1WZ0A

Solution structure of human sumo-2 (smt3b), a ubiquitin-like protein
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
104
structure length
104
Chain Sequence
GSSGSSGMADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Ubiquitin-like protein SMT3B
publication title Solution Structure of Human SUMO-2 (SMT3B), a Ubiquitin-like Protein
rcsb
source organism Homo sapiens
total genus 12
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2005-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1wz0A01
4B6WA 3MHSD 1UELA 2CHWA 4IWQA 4W9IA 3H7PA 1NBFC 1LQBA 1L2NA 1K8RB 5KHQA 2MWSB 2FNJB 4A20A 3WAPA 2KD0A 3PSEB 4WJPA 1E8XA 5CHVC 3AXCA 2K8BA 1GC6A 3C0RB 3ONSA 4HWIB 3SD5A 4E71A 3RUIB 2N7DA 2DZMA 2L7RA 2IO1B 3ML8A 3VFKA 3V62A 5CHFA 2LZ6A 3ZRFA 4MSMB 2KHWB 1IP9A 1YX6B 2IO0B 2KO3A 4MELA 2DZJA 4M8NA 3N32A 2G3QB 3ZTCA 4G11A 4G0NB 2BWFA 2DAJA 2N9EB 3EFUA 4JQWC 2JUOA 1E8ZA 2AL6A 2K1FA 4DXAB 3DVNV 3QIJA 5DPSA 3A33B 4EEWA 2GBJA 2LVPA 3PGEA 4DHJD 4W9EA 4BKSA 4GDLB 1WY8A 2L3ZA 3UGBB 2D07B 2LRUA 1EF5A 3VHTC 2AWTA 2FCSA 4GGQA 3VUWA 4ANXA 3TIXA 2IBIB 1X1MA 3L10B 1C3TA 4MEMA 3R7RA 2KWCA 2O6VB 4DWFA 2NCNA 2L0FA 2ZNVC 2IZVB 4DHZE 4E3CA 4TV3A 2LVQA 2KC2A 2FCMA 1E8WA 4KSKC 4WJOA 3VDZA 4DHZB 4GSWA 3V6CB 2N1WA 2PEAA 3T8MA 4GIVA 1WX9A 2J0KA 3TMPB 4EFOA 3R3MA 2HE7A 3PZDA 3IFWB 3UQBA 3GZNI 3ZNGC 3ALBA 3UINB 1KM7A 4IWPA 1RRBA 1OGWA 3V6EB 4ANUA 4FULA 2V4LA 2LUEA 3QWZB 1H4RA 2CHZA 3DVGX 4MJSA 2ZCBA 4BKTA 3DVGY 2DAFA 5KHOA 1LFDA 2N4FA 4GN1A 2DYMA 2LI5A 2KNBA 4FJZA 3PRMB 4W9JA 4FHKA 4XX5A 3O65B 1I35A 1SGHA 4KVGB 4NPNA 5AZFA 4HPLB 1E8YA 2QHOA 4P7IA 3W1YA 3ZDMC 2V1YA 3VQIA 1Z2MA 1E90A 2DHZA 2KJ6A 3NY5A 4F8CB 3HIZA 4IUMB 4MGKE 4DHJB 1P9DU 1F9JA 4KIKB 4A3OA 1JRUA 2M8SA 2XK5A 3DOWA 3SHQA 5AZGA 2R2QA 2MA9B 2C7MB 4BFRA 2ZZPB 2IYDB 2HD5B 3L08A 3DQVA 2CR5A 3DBHI 4KSLC 5CHWA 2RD0A 4FN2A 3TCAA 2LRWA 4LDTB 4HVBA 1L7YA 2XBBC 2KVRA 4BKSD 2KKCA 2EMTA 4IG7B 4ICUA 2OOBB 3H1UA 3I3TB 4HJKA 2KFKA 3RZWC 2A5UA 3QCAA 2M17A 2RGFA 1P3QU 1J0GA 1WE7A 1WR6E 1WIAA 3X23A 5LLIA 2LGDA 1QZEA 3QA8A 3M95A 1ISNA 2MX2A 4JGHB 3RYTA 2KOXA 4TQ0A 4WJQA 3DVNU 2DZIA 3APDA 3UIOB 1WGGA 4ZRIA 1WM2A 2AEHA 2KQSA 4AJWA 1WJ6A 4W9KA 1GC7A 2MP2B 1LM8B 2K8HA 3RULA 4MSQB 4NNJB 2M1MA 2NBUA 3A9KA 3APCA 2MBBB 3HK0A 2KTRB 3MTNB 4HDQA 3JW0X 4M8MA 1T0YA 3UF8A 3RZFA 1WXMA 3N3KB 5DCNA 1UZXB 3BY4B 3WIMA 2KDEB 4K1RB 4GB9A 4W9CA 4NAWB 5CTRC 4CYEA 3KUCB 1MG8A 3VTVA 3IVFA 2YLMA 1WI0A 3ZKJC 1XT9B 2JVCA 2M4NA 2GMIC 1OEYA 2GBMA 4FJVB 2YVCA 4JL9A 3EECA 2KN5A 4ICVA 4EZLA 4I6LB 3EHVA 3ZTDA 1V9JA 3H7SA 3S2AA 5J17A 2N9PC 3HM3A 1WX7A 3A1QB 3A9JA 3OJ3A 3AULA 3M3JA 3PRZA 2JWZA 3PV1A 2C60A 1U4AA 2UYZB 3WANA 3EC8A 3DPDA 4XC2A 3PS6A 3L54A 2DYBA 3DBLI 1GJZA 2EMSA 2M0XA 3U8ZA 3ZIMA 1Z5SB 5J18A 3WAMA 4RM9A 1C1YB 2BYVE 1HE8A 2LASA 3PRPB 2O2VB 3ZLZA 1XD3B 4GMVA 2I1KA 1WGDA 4HCPB 1WGHA 3JVZX 2MBHA 4WWPA 4BOSC 3UIPB 4WWNA 1CMXB 1KJTA 4MDKE 4MGIE 1A5RA 1S1QB 1UH6A 3QARA 2L8JA 1RLFA 2BYFA 2KTFA 2ZPNA 1M94A 1YQBA 3BINA 4GU2A 5L95C 3ZNID 4FA6A 2JRHA 4IC7B 5G2NA 4BKGA 3QJZA 1S3SG 3TJPA 4J6IA 4EZJA 1WJNA 4LCDE 4TQ1A 4IM0A 4FADA 1E5WA 2JY6A 4GDLA 4MH0E 5D2MB 5DPWA 1V81A 3NZSA 4FJYA 1OEYJ 2G4SA 2KFJA 4K7UA 4NY0A 4YL8A 2NBWB 5GMVA 3SU8X 1EO6A 3P2BA 3L16A 3PVLA 4KZ0A 3T9LA 1VD2A 2KX0A 3JSVB 2O6VA 3L17A 4W9LA 1D3ZA 1TGZB 2Z0DB 3QHTA 1H8CA 2IO3B 4GDKB 2D10A 1GUAB 2Y5BB 4XZ4A 2BKRB 2NS5A 3H9DA 2IO2B 3IBEA 4HPMB 1YX5B 2BYEA 1WYWB 5E6OA 5AEKB 2A4ZA 2CHXA 4CO7A 3PHXB 3PLVA 4FHJA 4WJNA 2N9XA 3ZW3A 1TZ1A 3A4SC 2UWQA 3DCGA 2VRRB 4HLEA 3M63B 2KLGA 4GOCA 4KDIC 2C7NB 3VUXA 1WMHB 4DK5A 2BKFA 2OJRA 4LJOB 4BBNF 3VUYA 5G55A 4TKNA 1R4MI 4BVUC 2G45B 1YJ1A 4URKA 1V5TA 1AARA 1GNUA 3Q3FA 4ANWA 4EOYA 1NI2A 5IA7A 3PREA 1WJ4A 4WAAA 3B08A 2NPTB 3R66C 4NJ7A 3DBRI 1OQYA 1SIFA 4G3XB 3V60A 2KC1A 4MGZE 4IW0A 4NQLB 1UBIA 2KK8A 2LWPA 2I1JA 4NQKE 4WQOB 3WA0A 4ANVA 4E74A 2MBQA 3ZRCA 4PS8A 3CSFA 1WE6A 3WALA 3VTWA 3V61A 4KIKA 1NDDA 5EDSA 2C5LC 5IAAC 4DDID 1G6JA 3IG3A 2MSED 2KJRA 1E7UA 4M0WB 3AI5A 4JIOU 3QC8B 2WX1A 2AYOB 1WFYA 2JXXA 3AU5A 1Q5WB 2G4DB 4K7WA 4W9GA 1J19A 4NJ6A 4B95A 3A4RA 3W1SA 3X0WA 3KYCD 3SDLC 2NR2A 1V2YA 3ECIA 3H7PB 5E6PA 4F7ZA 3APFA 5DPRA 3AU4A 1VCBA 2MCNB 3WAOA 4AWJA 4RM8A 2Z0EB 5E6NA 2KWVB 1I42A 3ZNZB 3L0WB 3DBSA 3PTFC 4G50A 2O6VD 2K39A 2KZRA 2PJHA 5FR6A 1WXSA 3H6NA 2C9WB 3QX1A 1ZKHA 2PE9A 4AOFA 2LVOA 2MP2A 2IY1B 2ZNVB 4KZCA 3KUDB 2FCNA 5JHAA 3TBLD 4BBNC 2FUHB 3OJ4B 4EKUA 3W1SC 2DX5B 2KTRA 1EUVB 1UBQA 3QK0A 1EF1A 2L0TA 2REXA 4II3B 4EUTA 2KMCA 2KLCA 4TUUA 2XEWA 4K81A 2K25A 4NAWA 4A3PA 3VVWB 3KVFB 2J0MA 4IM3A 1BT0A 3OLMD 1RAXA 2IY0B 3M62B 1P0RA 2BF8B 4EZKA 2RSUA 2HTHA 3LDZE 3K9PB 4W9DA 3MJWA 5JZEB 3QAQA 3PT2B 2KJHB 1YIWA 3A1QA 4IM2A 4FLHA 4HXDA 4KV2A 1WM3A 4CHKA 2MRPA 1UD7A 4AP4C 4KDLB 2WWZA 2LXAA 4DBGA 1FXTB 1WGYA 2MBEA 4F1SA 2B3AA 5TR5A 2MBOA 2ZCCA 4PYZA 3IHPC 4I6PA 2FIDA 2KANA 2O2VA 3R7QA 2KXJA 2MQJA 5HKHA 2MW5A 4WWOA 3ZVVA 2KDBA 2KQ7A 3NHEB 3PPAA 4W9FA 1KLVA 4ZRKA 2JF5A 2PE6B 1PQSA 1WXAA 4K7SA 5L83A 3HM6X 2DZKA 2AL3A 3KW5B 4LDTD 4MJSB 1TTNA 2ZEQA 2JZ3B 2GBKA 5C23A 1UGMA 1WRDB 3PHWB 1V86A 4MM3A 1TBEA 3KH0A 2KDFB 2N7EA 4II2B 2V3SA 1WF9A 2NVUI 2CS4A 2LGYA 5D7GA 3UQAA 1OTRB 3DDCB 1ZW7A 3ZUNA 4PS3A 4PS7A 3CMMB 2ZPYA 3N30A 4N9F4 4ZYNA 4X57B 2ZVNA 4W9HA 2JZZA 1WJUA 2LXCA 5LXIB 2JT4B 1WXVA 4AJYB 3HHMA 2XK5B 2KMAA 2ZVOA 3KUZA 4HCNB 2L76A 3TL5A 1Q0WB 3JSVA 1R4NI 2R2OA 2GBNA 4HK2A 3RT3B 3VH4B 3CSTA 4FBJB 2BGFA 4BOZB 3JYUA 1GG3A 2D11A 4GDKA 3VXWA 3K9OB 3U30A 1P1AA 1KOTA 2JRIB 4JLCA 1J8CA 2GOWA 3ZNHB 2RPQA 2K8CA 1Q1OA 2K6DB 2JPHA 2WX0A 2KFKB 4OVUA 2D2QA 2NBVB 3ZO5B 1LXDA 4IWOA 1ZGUB 2L05A 3B0AA 1WH3A 2EKEC 3NS8A 2DENB 3GOEA 3KYDD 3Q3JA 4OVVA 1YD8U 5JHBA 5J2RA 2KDIA 2J7QB 2KX3A 2CU1A 3NZUA 3RCZA 3QQ8B 3VAWA 2WDTB 3B1LX 2KWUB 3LJ3A 1Y8RC 2HJ8A 3L13A 2PPHA 2ZJDA 3RD2A 1E7VA 1WMHA 3CF6E 2W9NA 5CX3A 4ASWC 4LJPB 1P98A 2LD9A 3A9KB 4ZRJA 2LJ5A 2RR9A 2DYOA 4RMAA 4HDOA 5C1ZA 3ML9A 2J0JA 2FIFA 3U7DA 3VH3B 2BWES 2FAZA 4AUQC 1WGRA 1IPGA 2NPTA 1V5OA 5AZHA 1V49A 1IYFA 1RFAA 2FCQA 4GXBA 3ENEA 1SE9A 1V80A 2LGXA 5DPTA 1WX8A 3VTUA 1V6EA 2ASQA 1WZ0A 4B9KA 3A9JB 4DDGD 1XQQA 2C7HA 3NOBA 5JH5C 1WR1A 4ZDVA 2D3GA 1WZ3A 4PYUA 5BO4B 2Z59B 2MLBA 2L00B 3D32A 4MGYE 2GBRA 5D94A 2CKHB 2K6QA 2N1VA 2BPSA 3OAWA 3PLUA 4I6NB 3ZDTA 5LXHA 2WYQA 5D6JB
chains in the Genus database with same CATH superfamily
3MJ5A 1UELA 2CHWA 1JROA 4W9IA 1L2NA 4ITKA 1K50A 4ZOHC 4A20A 3MC0B 3WAPA 5CHVC 1GC6A 3RUIB 2DZMA 5EE0A 4Q2JA 1IGDA 3V62A 1XCTL 3AN1A 4MSMB 1IP9A 2IGGA 2KO3A 2V3PA 4MELA 2DZJA 2VH2A 4R3DA 4G0NB 2N9EB 3R8BA 1HXYD 2J4XA 1YN4A 1LGRA 3DVNV 3QIJA 1WY8A 2AWTA 3TIXA 2IBIB 5IN7A 2MJDA 3BYYB 1HZ6A 2KWCA 4DWFA 4E3CA 2LVQA 1WYGA 2FCMA 1PYWD 2N1WA 4LNIA 1QQRA 3R3MA 2HE7A 1DOYA 3IFWB 3UQBA 5HHDG 4FULA 2LUEA 3DVGX 4A90A 4BKTA 3DVGY 4P6VF 1LFDA 1C76A 4W9JA 3PRMB 3EGRA 3O65B 1E8YA 4P7IA 1WRIA 3W1YA 3ZDMC 1E90A 2DHZA 3NY5A 3P4PB 1YQ3B 2GB1A 4LK0M 4RGNA 1XLPA 3NJTA 3U2SC 1TKEA 2XK5A 2K5PA 3DBHI 4KSLC 4RGTA 3Q69A 1VLBA 1T6BX 1DYQA 3I3TB 4JWUC 1V97A 1NVID 1SE2A 1QZEA 3BVMA 1ISNA 1ZDXA 2JWUA 2DZIA 1WGGA 3P4SB 1WM2A 3W2DA 3ZJTA 3HRDD 1GC7A 1PDXA 2BBCA 3RULA 2Q5WD 2M1MA 2JQRB 2I38A 2MBBB 1JWBD 2KTRB 3HK0A 4IOIE 3JW0X 3N3KB 1Q10A 3BY4B 4W9CA 2VZKD 3IVFA 3ZKJC 2GMIC 5TSSA 1OEYA 4FJVB 1PGXA 3EECA 2MJ3A 3FAHA 4ICVA 1XF5L 4C4VB 1P7FA 1V9JA 5J17A 2N9PC 3A1QB 3A9JA 3PV1A 1YMHE 5GXGB 3AEGB 2M0XA 1Z5SB 1VZ8A 3MFGA 4MACA 2HDEA 4GMVA 4OZBA 3AEAB 1WGDA 4HCPB 2MBHA 1FCCC 1L0XB 1PFDA 1QLBB 4MDKE 4MGIE 1A5RA 2DNFA 3E9SA 1KLUD 3QARA 2L8JA 2KTFA 1M94A 1AW7A 4MT5A 3BINA 2INDC 4GU2A 5L95C 3ZNID 1TY2A 5G2NA 4BKGA 3QJZA 1S3SG 4IM0A 4QAYA 3Q8AA 4FJYA 2KFJA 2HJ1A 2BS2B 3PVLA 2V4IB 2KX0A 1ESFA 1TGZB 1R4MB 4GDKB 1ET6A 1UUPA 3TEYA 2EELA 4O1NA 2BYEA 5AEKB 3PHXB 4JWSC 1TZ1A 3Q6BA 2UWQA 2VRRB 2V3NA 3M63B 1B9RA 1DOIA 2WS3B 2OJRA 2RMMA 3VUYA 5G55A 1XCQL 1TT5B 2G45B 1YJ1A 1AARA 2SEBD 2BS3B 3VR8B 1NI2A 4A6QA 5IA7A 1SE4A 3PREA 4ZHPA 4NJ7A 1SIFA 3SR6A 2LWPA 2MBQA 4PS8A 3BIID 1WE6A 1QOGA 2JYEA 1NDDA 2J53A 2K9XA 2NTTA 3IG3A 2KJRA 4M0WB 3AI5A 1WFYA 2G4DB 1J19A 3V05A 2MHJA 4F7ZA 3NZ3A 1L0VB 1AWDA 3U4EG 2Z0EB 1GPXA 1TYGB 3L0WB 3VRBB 2R61A 2KZRA 1C4PA 2ACZB 2QJLA 2ZNVB 2L52A 2FCNA 4YSZB 2DX5B 2KTRA 1EUVB 1UBQA 3HVDA 4CQNA 3LXFA 1TKGA 2KLCA 4DQOC 1R7SA 2BS4B 1KRHA 1D5MC 3M62B 2RSUA 4RGOS 4PT5A 4C4VA 2KJHB 3P42A 1C4CA 3A1QA 4YTNB 4YTPB 1T5XD 4HXDA 2X38A 2GRIA 2WWZA 5C3JB 1WGYA 2N9KA 2MBEA 2IDYA 2B3AA 5EE1A 2MBOA 4PYZA 1NI3A 2FIDA 5HKHA 2QEJC 1FMAD 1SF0A 3ZVVA 2KDBA 2KQ7A 4W9FA 4ZRKA 5L83A 4K7SA 3HM6X 2DZKA 1TTNA 1MVKA 1F1HA 2GBKA 2RPVA 1TS5A 2Z8LA 2ONQA 5C23A 2LEKA 4WQMA 1PGAA 1TBEA 3KH0A 4LNKA 3AECB 2LGYA 5D7GA 1ZW7A 1MPEA 4A9AA 4YWGG 3HVZA 2JZZA 1WJUA 1PGBA 2XN9C 1WGKA 2WHIA 2KMAA 3P63A 3KQ4A 2R2OA 1KH0A 3RT3B 4FBJB 2D11A 4GDKA 3K9OB 3N1ZC 1P1AA 1KOTA 3NVZA 2K8CA 1Q1OA 2K6DB 2KFKB 1NEKB 2D2QA 2NBVB 3ZO5B 1ZGUB 4WIPA 1RM6C 2EKEC 2DENB 3NS8A 1YD8U 1GOZA 5JHBA 5J2RA 2KDIA 1HTOA 2CU1A 3CIRB 2PVOD 2KWUB 1Y8RC 2HJ8A 4YSYB 3RD2A 1N63A 1E7VA 5CX3A 4ZRJA 1VJKA 4RMAA 1IBXB 2WXOA 2WDRB 2RDBC 1EM7A 3NRZA 3U7DA 3VH3B 2M19A 1V49A 1IYFA 4HKZE 1D5ZC 1RFAA 4GXBA 5DPTA 4YTMB 2ASQA 1QOAA 2BB6A 4DDGD 4M0WA 3E56A 4ZDVA 2LUMA 3DWMA 2BYTA 1WZ3A 4PYUA 2BTEA 2Z59B 2MLBA 5D94A 4MGYE 1XLQA 3RPFC 4LTUA 3OAWA 2BPSA 4S17A 4WH4A 4JE3B 4HROA 4NZLB 4E71A 1I4GA 2K8BA 4HWIB 1HA5A 2WXHA 2N7DA 4XDCA 1T0RC 2LZ6A 2KHWB 1UWMA 3BK1A 3ZTCA 4G11A 1CJEA 2BWFA 2K1FA 1EU4A 3A33B 2LVPA 4DHJD 4BKSA 4GDLB 1C4AA 3ZYYX 2L3ZA 2KYWA 3VHTC 4C00A 2FCSA 4GGQA 2G9HD 5D3DA 2RDGA 1SE3A 2O6VB 2NCNA 2L0FA 2KC2A 4KSKC 1E8WA 4WJOA 3V6CB 2LFIA 2PEAA 1WX9A 4EFOA 1OQRA 1V1PB 1TZOA 1TJEA 3GZNI 1TKYA 3UINB 1KM7A 3RMKC 1RRBA 1OGWA 2WU5B 3T3OA 1YQ4B 3AE2B 2CHZA 2ON8A 4ARCA 2B76B 1K52A 2N4FA 3DBHB 4GN1A 2LI5A 4AQ7A 1N5WA 4K3BA 2QCZA 4DXFA 3AB5A 2V1YA 4F8CB 3HIZA 4IUMB 5AUKA 4KIKB 4A3OA 4M01A 1JRUA 3DOWA 3SHQA 2MA9B 3SEBA 2C7MB 4BFRA 4UDUC 2BQQA 4HVBA 2RD0A 3TCAA 4LDTB 1L7YA 3EA6A 2KKCA 4IG7B 3NVYA 2OOBB 3H1UA 3I5JC 4HJKA 2KFKA 3RZWC 1J7BA 2A5UA 1J0GA 4IDIA 1WE7A 2WXQA 2TSSA 1YJJA 5LLIA 2LGDA 1N62A 3M95A 3RYTA 2KOXA 3BVZA 1LO5D 4ZRIA 2AEHA 4S0RA 1FIQA 1WJ6A 3J9CA 2AQ2B 3AE6B 2MP2B 3Q3MC 2IJ0A 2Y5PA 4MSQB 4NNJB 3APCA 1IBXA 4ZRPA 3EFCA 3UF8A 1WXMA 4ZHOA 4M02A 1BUIC 1WI0A 1XT9B 2M4NA 3NG0A 4I6LB 3H7SA 3HM3A 4A8XC 1HTQA 3M3JA 2LMCA 3URYA 1U4AA 2I2YA 3EC8A 2J52A 3L54A 2EMSA 3U8ZA 3WAMA 5FKAC 1C1YB 1HE8A 1HZ5A 3N9YC 1WGHA 1CQVA 3UIPB 1YJIA 2JX5A 3Q2AC 1CMXB 1KJTA 3I9V1 1RYJA 1RLFA 2BYFA 1ACCA 4MM3B 3WCQA 1YQBA 2L83A 2JRHA 4C80A 3KWVA 4IC7B 1E0ZA 3RFZB 3TJPA 4J6IA 4EZJA 4FADA 1N5XA 2JY6A 4GDLA 4MH0E 5D2MB 5DPWA 3NZSA 2V0GA 2PIAA 3SU8X 1EO6A 3L16A 3FILB 1VD2A 2O6VA 4W9LA 1D3ZA 2Z0DB 1H8CA 3ABVB 4N58A 1L4DB 2D10A 1GUAB 2Y5BB 2NS5A 4HPMB 4MH8A 1V1PA 3PLVA 2N9XA 2LHEA 3DCGA 2KLGA 4GOCA 4KDIC 2C7NB 3VUXA 4DK5A 2BKFA 4LJOB 4BVUC 1V5TA 1JWMD 2SAKA 3AEFB 3BZDB 1UNSA 1T0SC 4ANWA 2YEPB 1WJ4A 1VZ6A 4ARIA 3R66C 3AE5B 3CWIA 4NQKE 4E74A 3SFEB 4KIKA 2C5LC 1G6JA 4WAFA 1JWSD 2AYOB 2JXXA 4K7WA 4OVZA 3W1SA 3SDLC 3BWUD 3H7PB 3WAOA 4AWJA 4RM8A 3AE1B 3ZNZB 3DBSA 4G50A 2K39A 3QX1A 2MP2A 4KZCA 2OEDA 2JU6X 3KUDB 2FUG1 2FUHB 3OJ4B 4EKUA 2ZW1A 3QK0A 1QOFA 4II3B 2KAJA 2CJOA 4N59A 2J0MA 4IM3A 2M56B 1P0RA 2BF8B 2HTHA 4W9DA 1WSPA 5JZEB 1YIWA 3I63C 4KV2A 4CHKA 3GE3C 2LXAA 4DBGA 5BYQA 1N61A 1C78A 1N6ZA 3N1YC 5TR5A 2ZCCA 3IHPC 4I6PA 2INNE 2KANA 3IT4B 3R7QA 2MQJA 4WWOA 3PPAA 1PQSA 3P4QB 4C56C 4LLGM 1SB3C 3PHWB 1V86A 4IKGA 4MM3A 2WP9B 4RCOA 4PS3A 4ZYNA 2LGSA 1JQ4A 2ZVNA 2CJNA 4AJYB 3FILA 5D3IB 4OW0A 4KKJA 3AEDB 1R4NI 4HK2A 3VH4B 4BOZB 3VXWA 3U30A 1E10A 2WDVB 4JLCA 2GOWA 4P1CC 2WXIA 2KN4A 1LXDA 1N60A 1WH3A 3KYDD 3Q3JA 3B2GA 2J7QB 1C77A 3AM9A 3VAWA 1B1ZA 1E7PB 2WDTB 3B1LX 3LJ3A 1ZXHA 4LNFA 2AQ3B 2PPHA 2ZJDA 3IXSA 3NVWA 4ASWC 1AYFA 2V9HA 3AEBB 2HTME 2LJ5A 2DYOA 4XGAB 5EE9A 2FIFA 3ZXRA 1TS3A 1V5OA 2IGHA 2PW9A 1V80A 5E6JA 1WX8A 2WXJA 3AE8B 2N0SB 1WZ0A 1XO3A 3NOBA 1EWCA 5JH5C 2D3GA 5AUIA 2INPE 3D32A 2L00B 2CKHB 2N1VA 5LXHA 5BMIA 3TEWA 2W55A 3MHSD 4IWQA 4LNNA 3H7PA 1NBFC 1QT9A 1IGCA 4ZYSA 1K8RB 5KHQA 2FNJB 1FRDA 3Q8EA 2KD0A 3PSEB 1E8XA 3AXCA 3ONSA 1FFUA 3C0RB 4RH6A 4USAA 5HG2A 3TEXA 1I4HA 2L7RA 3BYTB 3AE4B 5CHFA 1YX6B 2IO0B 2G3QB 4JPSA 2DAJA 1SEBD 2AL6A 4JX1C 5DPSA 4EEWA 3GZNB 3UGBB 2D07B 2W3SA 2LRUA 1EF5A 2FE8A 3VUWA 4ANXA 1XEEA 1X1MA 3L10B 1C3TA 4MEMA 3R7RA 2ZNVC 1NENB 4TV3A 3VDZA 3AE7B 4GSWA 1QKZA 1EU3A 1DGJA 3T8MA 3PZDA 3AMZA 3ZNGC 1L4ZB 3ZJUA 5BYRA 3V6EB 4ANUA 2V4LA 4KX6B 3QWZB 5JXVA 1H4RA 1HQRD 2ZCBA 5KHOA 3R2TA 2DYMA 2AX5A 2KNBA 4FJZA 1GB4A 4FHKA 4XX5A 1F52A 3H8HA 1T0QC 1I35A 4KVGB 4NPNA 4HPLB 2QHOA 3I57A 1Z2MA 4RFBA 2E6XA 4DHJB 2OJWA 1SSNA 2M8SA 5AZGA 2R2QA 2ZZPB 2IYDB 5CHWA 2LRWA 3N1XC 4BKSD 4ICUA 1BXTA 2AQ1B 3X23A 1HEZE 2MX2A 4JGHB 4EE2A 1SJHD 3APDA 4AJWA 2IGDA 1FXIA 4W9KA 4K3CA 1LM8B 4D2KA 2NBUA 4HDQA 4M8MA 5LNK1 5DCNA 1UZXB 4L2YA 3WIMA 4GB9A 5CTRC 4NAWB 3ZQ4A 1VZ7A 1MG8A 2YLMA 2JVCA 3PO0A 2GBMA 4NJCA 2KN5A 4EZLA 3DHGC 2ZW0A 3EHVA 3S2AA 3RN9C 3OJ3A 1D4BA 3PRZA 2JWZA 1GJZA 2DYBA 3DBLI 3ZIMA 5J18A 4J3OD 4RM9A 3P1MA 1STEA 3PRPB 3ZLZA 3JVZX 4WWPA 1T3QA 3W5VB 1V8CA 1AN8A 5HI1A 1WWTA 1L0YB 2ZPNA 3TUOA 1P7EA 4HEA1 2L1AA 4FA6A 3PZ7A 2QILA 4LCDE 4US9A 1E5WA 4TMAB 1OEYJ 4NY0A 4K7UA 5H8YE 5GMVA 1DOXA 2BT6A 1UWXA 4HJGE 3AV8A 1QOBA 4XZ4A 3H9DA 2IO2B 3IBEA 1YX5B 5E6OA 1OQQA 4AS1A 2DBYA 2CHXA 1SXTA 1I7HA 4WJNA 2WXGA 4HLEA 2PKOA 1XLNA 1WMHB 2BVCA 2LGIA 4TKNA 2KDMA 2WXPA 4URKA 1JW9D 3DHIC 4EOYA 4WAAA 4XYCA 2NPTB 3DBRI 3V60A 4MGZE 4IW0A 4NQLB 4ANVA 4WQOB 4M00A 3ZRCA 3VTWA 3V61A 1ZP0B 5EDSA 4DDID 2MSED 4JIOU 3QC8B 2PTLA 4ZRQA 3AU5A 4XWWA 4W9GA 4NJ6A 2NR2A 1V2YA 5DPRA 1BMLC 2NTSA 2MCNB 3R2IA 2KVZA 4KGRA 4DXGA 2KWVB 1I42A 2WXMA 4OZCA 1C79A 2O6VD 2PJHA 4REZA 2WXNA 1WXSA 1J7CA 2PLPA 2C9WB 1MJDA 1ZDVA 5JHAA 3MHZA 4WWMA 3W1SC 1RFKA 1EF1A 4RF1A 1GB1A 2KMCA 4TUUA 4K81A 4NAWA 2NMQA 1FCLA 4A3PA 1FM0D 3VVWB 3KVFB 3DHHC 3OLMD 4HRSA 3LDZE 3MJWA 2WXFA 3QAQA 3PT2B 1JCKB 4IM2A 4FLHA 3OG5A 3GB1A 2DWQA 2MRPA 4C7YA 2CU3A 4KDLB 1FXTB 2W3RA 1QILA 3Q8BA 1FEHA 4F1SA 2H88B 1V1OA 3B2FA 5C2TB 2Y5CA 1ZUD2 1F0ZA 2MW5A 3PZ8A 2VZKB 3RI7C 1WXAA 3KW5B 4LDTD 4MJSB 3ZJVA 1I4PA 1E9MA 3AEEB 1R4NB 1RWSA 1IUEA 2KDFB 3Q3NC 3UQAA 1OTRB 4PS7A 3N30A 3TSSA 4N9F4 4X57B 4OZAA 2JT4B 3HHMA 2ZVOA 3KUZA 2L76A 1Q0WB 1D6EC 2GBNA 2YEPF 2G1EA 3JYUA 1ET9A 2FBWB 2JRIB 1J8CA 2JPHA 2WX0A 4IWOA 1VDVA 3B0AA 2QIEB 3GOEA 4OVVA 2DLBA 2WXKA 3KLSX 3NZUA 4PK1A 2QC8A 1KF6B 1JMLA 3QQ8B 2KQ4X 2K3UA 3L13A 3IAS1 1WMHA 3MC9A 2W9NA 3AH7A 1TIFA 2PMVA 1L5PA 4LJPB 1JWAD 1P98A 2LD9A 3A9KB 5IP4D 4HDOA 1NYRA 1KFYB 5C1ZA 2WXLA 3IAM1 2FAZA 3Q8CA 4HKQA 1WGRA 1IPGA 2NPTA 2PVGC 1SBBB 1KLGD 4XE0A 2INCC 2FCQA 3ENEA 1SE9A 2LGXA 2W54A 3VTUA 2KT7A 2UU7A 3VRAB 4B9KA 1YNTE 5EE3A 1XQQA 2C7HA 3ZGZA 3AE9B 5BO4B 1M4VA 3C8YA 3PLUA 3VR9B 2W82A 2WYQA 5D6JB 3TEZA 5FK9C 4B6WA 1LQBA 2H89B 4L23A 2MWSB 4P1BC 4WJPA 3SD5A 4XDDA 3ML8A 2IO1B 1WXQA 3VFKA 3RNAC 3RNFC 3ZRFA 1CK1A 4M8NA 3N32A 2QMTA 4JQWC 3EFUA 2JUOA 1E8ZA 3LB8C 3AE3B 1CZPA 4DXAB 5BYSA 1YN3A 2GBJA 2QDFA 3PGEA 4W9EA 1FFVA 1UF0A 5I4DA 1ZOYB 4FXCA 1OFFA 2IZVB 4DHZE 4DHZB 3IT6B 4GIVA 2J0KA 3HUIA 3TMPB 1MI0A 4OHJA 3ALBA 4IWPA 3BK2A 4RGMA 3UI3A 3B9JA 4MJSA 1FD6A 2DAFA 1FO4A 2JXTA 5HFYA 1SGHA 5AZFA 1ROEA 2MEKA 2IPKD 2KWDA 3VQIA 2KJ6A 4MGKE 1P9DU 1F9JA 2KACA 1F77A 4XWTA 1SJED 2HD5B 4C7ZA 3L08A 3DQVA 2CR5A 3ZXVA 4FN2A 1FRRA 2XBBC 3O13A 3FC4A 2KVRA 3Q14C 3P4RB 2EMTA 2LJIA 2N7JA 2M17A 2RGFA 1P3QU 3QCAA 2KMMA 5BMGA 1I4RA 1WR6E 1WIAA 2D5GA 3QA8A 2WLBA 4TQ0A 4WJQA 3DVNU 3UIOB 3RNGC 2KQSA 4L1BA 2XNAC 2K8HA 3A9KA 3DBLB 3MTNB 1T0YA 3RZFA 2KDEB 4K1RB 5MPOA 4CYEA 3KUCB 3VTVA 4P16A 4GLSC 3MP9A 4YT0B 2YVCA 4JL9A 5IO9A 4YSXB 3ZTDA 1ZXIA 4B0EA 1WX7A 1FPYA 3AULA 2X8XX 1YOVB 2C60A 2UYZB 3WANA 2VH1A 3DPDA 4XC2A 3PS6A 2OHFA 2BYVE 2LASA 1C9FA 2O2VB 1MHXA 1XD3B 2I1KA 3ETRA 4BOSC 4WWNA 1S1QB 1UH6A 4YXDB 1FXAA 1ENFA 1WJNA 1Y56A 4TQ1A 2MH7A 2J42A 4TSSA 1V81A 1ZPSA 3DWGC 2G4SA 4YL8A 2NBWB 3P2BA 4KZ0A 3T9LA 2L32A 5G5GA 3JSVB 3L17A 1MFWA 3QHTA 2IO3B 1F2RC 1L6VA 3SFDB 2BKRB 1I4XA 1WYWB 2A4ZA 3OWEB 3DBRB 4CO7A 4FHJA 1FNUA 3ZW3A 1K51A 3A4SC 3KWLA 1SIJA 4BBNF 1R4MI 1E6EB 5T8IA 1YN5A 1GNUA 3Q3FA 3GP7A 1KTKA 3B08A 1OQYA 4G3XB 2KC1A 1UBIA 2KK8A 2I1JA 4KGTA 3WA0A 3CSFA 3WALA 2WNMA 5IAAC 4N6EB 1E7UA 4B0MA 2WX1A 1JALA 1MG4A 3N20C 1Q5WB 4ACFA 3RNEC 4B95A 3A4RA 3X0WA 3KYCD 1TS4A 3ECIA 2GI9A 5E6PA 3APFA 1JWUD 3AU4A 1VCBA 2BB5A 3W5UB 1FNWA 5E6NA 3PTFC 3NUHB 5FR6A 1VR9A 3Q3OC 3H6NA 2EKIA 5H92C 4AOFA 1UGJA 1ZKHA 2PE9A 2LVOA 3FKYA 2IY1B 2LHDA 3TBLD 4BBNC 2K22A 3T3NA 1PUTA 2L0TA 2REXA 4EUTA 2XEWA 2K25A 1BT0A 3BVGA 1RAXA 2IY0B 4HPPA 4RF0A 4EZKA 3K9PB 3RNBC 5IOIA 3LYYA 1K53A 2D3BA 4H2AA 1WM3A 1UD7A 4AP4C 1I4QA 3W9CB 3GE8C 2O2VA 2KXJA 1D5XC 1A70A 1GAQB 3NHEB 1KLVA 2JF5A 2PE6B 1TS2A 2AL3A 2ZEQA 2JZ3B 2GLSA 2WXRA 1F2RI 2D3AA 1UGMA 1WRDB 5FR3A 2K0PA 4KKIA 4II2B 2N7EA 3C19A 2ICIA 2V3SA 1WF9A 2NVUI 3L4PA 2CS4A 5G5HA 1L6UA 3DDCB 3ZUNA 4KGSA 2BW2A 2ZPYA 3CMMB 4LNOA 4W9HA 2LXCA 5LXIB 1WXVA 2XK5B 4HCNB 2E3TA 3TL5A 4A55A 3U52E 3JSVA 1ZE3D 3CSTA 2BGFA 1GG3A 1MHHE 2WU2B 1NYQA 3Q8FA 3ZNHB 1FNVA 2RPQA 4OVUA 3NS1A 1EWYC 2L05A 5BMHA 1TY0A 2QSDA 1XLOA 2KX3A 1VRAB 3NVVA 2JZPA 3RCZA 4NAMA 1J7AA 4BAXA 3CF6E 2M0AA 3GS2A 2WDQB 2RR9A 2WQYB 2N9LA 3ML9A 2J0JA 3RNCC 2BWES 4AUQC 5AZHA 4BZAA 3U7ZA 3EUB2 1XXGA 5IKCM 1JRPA 4WURA 2WGSA 1V6EA 1QF6A 4US8A 3V3XA 2Y3AA 4RNAA 3A9JB 2RDHA 3MC8A 1WR1A 2MJEA 2JSVX 2D3CA 2GBRA 2JYTA 2K6QA 3ZDTA 4I6NB
chains in the Genus database with same CATH topology
4B6WA 3MHSD 1UELA 2CHWA 4IWQA 4W9IA 3H7PA 1NBFC 1LQBA 1L2NA 1K8RB 5KHQA 2MWSB 2FNJB 4A20A 3WAPA 2KD0A 3PSEB 4WJPA 1E8XA 5CHVC 3AXCA 2K8BA 1GC6A 3C0RB 3ONSA 4HWIB 3SD5A 4E71A 3RUIB 2N7DA 2DZMA 2L7RA 2IO1B 3ML8A 3VFKA 3V62A 5CHFA 2LZ6A 3ZRFA 4MSMB 2KHWB 1IP9A 1YX6B 2IO0B 2KO3A 4MELA 2DZJA 4M8NA 3N32A 2G3QB 3ZTCA 4G11A 4G0NB 2BWFA 2DAJA 2N9EB 3EFUA 4JQWC 2JUOA 1E8ZA 2AL6A 2K1FA 4DXAB 3DVNV 3QIJA 5DPSA 3A33B 4EEWA 2GBJA 2LVPA 3PGEA 4DHJD 4W9EA 4BKSA 4GDLB 1WY8A 2L3ZA 3UGBB 2D07B 2LRUA 1EF5A 3VHTC 2AWTA 2FCSA 4GGQA 3VUWA 4ANXA 3TIXA 2IBIB 1X1MA 3L10B 1C3TA 4MEMA 3R7RA 2KWCA 2O6VB 4DWFA 2NCNA 2L0FA 2ZNVC 2IZVB 4DHZE 4E3CA 4TV3A 2LVQA 2KC2A 2FCMA 1E8WA 4KSKC 4WJOA 3VDZA 4DHZB 4GSWA 3V6CB 2N1WA 2PEAA 3T8MA 4GIVA 1WX9A 2J0KA 3TMPB 4EFOA 3R3MA 2HE7A 3PZDA 3IFWB 3UQBA 3GZNI 3ZNGC 3ALBA 3UINB 1KM7A 4IWPA 1RRBA 1OGWA 3V6EB 4ANUA 4FULA 2V4LA 2LUEA 3QWZB 1H4RA 2CHZA 3DVGX 4MJSA 2ZCBA 4BKTA 3DVGY 2DAFA 5KHOA 1LFDA 2N4FA 4GN1A 2DYMA 2LI5A 2KNBA 4FJZA 3PRMB 4W9JA 4FHKA 4XX5A 3O65B 1I35A 1SGHA 4KVGB 4NPNA 5AZFA 4HPLB 1E8YA 2QHOA 4P7IA 3W1YA 3ZDMC 2V1YA 3VQIA 1Z2MA 1E90A 2DHZA 2KJ6A 3NY5A 4F8CB 3HIZA 4IUMB 4MGKE 4DHJB 1P9DU 1F9JA 4KIKB 4A3OA 1JRUA 2M8SA 2XK5A 3DOWA 3SHQA 5AZGA 2R2QA 2MA9B 2C7MB 4BFRA 2ZZPB 2IYDB 2HD5B 3L08A 3DQVA 2CR5A 3DBHI 4KSLC 5CHWA 2RD0A 4FN2A 3TCAA 2LRWA 4LDTB 4HVBA 1L7YA 2XBBC 2KVRA 4BKSD 2KKCA 2EMTA 4IG7B 4ICUA 2OOBB 3H1UA 3I3TB 4HJKA 2KFKA 3RZWC 2A5UA 3QCAA 2M17A 2RGFA 1P3QU 1J0GA 1WE7A 1WR6E 1WIAA 3X23A 5LLIA 2LGDA 1QZEA 3QA8A 3M95A 1ISNA 2MX2A 4JGHB 3RYTA 2KOXA 4TQ0A 4WJQA 3DVNU 2DZIA 3APDA 3UIOB 1WGGA 4ZRIA 1WM2A 2AEHA 2KQSA 4AJWA 1WJ6A 4W9KA 1GC7A 2MP2B 1LM8B 2K8HA 3RULA 4MSQB 4NNJB 2M1MA 2NBUA 3A9KA 3APCA 2MBBB 3HK0A 2KTRB 3MTNB 4HDQA 3JW0X 4M8MA 1T0YA 3UF8A 3RZFA 1WXMA 3N3KB 5DCNA 1UZXB 3BY4B 3WIMA 2KDEB 4K1RB 4GB9A 4W9CA 4NAWB 5CTRC 4CYEA 3KUCB 1MG8A 3VTVA 3IVFA 2YLMA 1WI0A 3ZKJC 1XT9B 2JVCA 2M4NA 2GMIC 1OEYA 2GBMA 4FJVB 2YVCA 4JL9A 3EECA 2KN5A 4ICVA 4EZLA 4I6LB 3EHVA 3ZTDA 1V9JA 3H7SA 3S2AA 5J17A 2N9PC 3HM3A 1WX7A 3A1QB 3A9JA 3OJ3A 3AULA 3M3JA 3PRZA 2JWZA 3PV1A 2C60A 1U4AA 2UYZB 3WANA 3EC8A 3DPDA 4XC2A 3PS6A 3L54A 2DYBA 3DBLI 1GJZA 2EMSA 2M0XA 3U8ZA 3ZIMA 1Z5SB 5J18A 3WAMA 4RM9A 1C1YB 2BYVE 1HE8A 2LASA 3PRPB 2O2VB 3ZLZA 1XD3B 4GMVA 2I1KA 1WGDA 4HCPB 1WGHA 3JVZX 2MBHA 4WWPA 4BOSC 3UIPB 4WWNA 1CMXB 1KJTA 4MDKE 4MGIE 1A5RA 1S1QB 1UH6A 3QARA 2L8JA 1RLFA 2BYFA 2KTFA 2ZPNA 1M94A 1YQBA 3BINA 4GU2A 5L95C 3ZNID 4FA6A 2JRHA 4IC7B 5G2NA 4BKGA 3QJZA 1S3SG 3TJPA 4J6IA 4EZJA 1WJNA 4LCDE 4TQ1A 4IM0A 4FADA 1E5WA 2JY6A 4GDLA 4MH0E 5D2MB 5DPWA 1V81A 3NZSA 4FJYA 1OEYJ 2G4SA 2KFJA 4K7UA 4NY0A 4YL8A 2NBWB 5GMVA 3SU8X 1EO6A 3P2BA 3L16A 3PVLA 4KZ0A 3T9LA 1VD2A 2KX0A 3JSVB 2O6VA 3L17A 4W9LA 1D3ZA 1TGZB 2Z0DB 3QHTA 1H8CA 2IO3B 4GDKB 2D10A 1GUAB 2Y5BB 4XZ4A 2BKRB 2NS5A 3H9DA 2IO2B 3IBEA 4HPMB 1YX5B 2BYEA 1WYWB 5E6OA 5AEKB 2A4ZA 2CHXA 4CO7A 3PHXB 3PLVA 4FHJA 4WJNA 2N9XA 3ZW3A 1TZ1A 3A4SC 2UWQA 3DCGA 2VRRB 4HLEA 3M63B 2KLGA 4GOCA 4KDIC 2C7NB 3VUXA 1WMHB 4DK5A 2BKFA 2OJRA 4LJOB 4BBNF 3VUYA 5G55A 4TKNA 1R4MI 4BVUC 2G45B 1YJ1A 4URKA 1V5TA 1AARA 1GNUA 3Q3FA 4ANWA 4EOYA 1NI2A 5IA7A 3PREA 1WJ4A 4WAAA 3B08A 2NPTB 3R66C 4NJ7A 3DBRI 1OQYA 1SIFA 4G3XB 3V60A 2KC1A 4MGZE 4IW0A 4NQLB 1UBIA 2KK8A 2LWPA 2I1JA 4NQKE 4WQOB 3WA0A 4ANVA 4E74A 2MBQA 3ZRCA 4PS8A 3CSFA 1WE6A 3WALA 3VTWA 3V61A 4KIKA 1NDDA 5EDSA 2C5LC 5IAAC 4DDID 1G6JA 3IG3A 2MSED 2KJRA 1E7UA 4M0WB 3AI5A 4JIOU 3QC8B 2WX1A 2AYOB 1WFYA 2JXXA 3AU5A 1Q5WB 2G4DB 4K7WA 4W9GA 1J19A 4NJ6A 4B95A 3A4RA 3W1SA 3X0WA 3KYCD 3SDLC 2NR2A 1V2YA 3ECIA 3H7PB 5E6PA 4F7ZA 3APFA 5DPRA 3AU4A 1VCBA 2MCNB 3WAOA 4AWJA 4RM8A 2Z0EB 5E6NA 2KWVB 1I42A 3ZNZB 3L0WB 3DBSA 3PTFC 4G50A 2O6VD 2K39A 2KZRA 2PJHA 5FR6A 1WXSA 3H6NA 2C9WB 3QX1A 1ZKHA 2PE9A 4AOFA 2LVOA 2MP2A 2IY1B 2ZNVB 4KZCA 3KUDB 2FCNA 5JHAA 3TBLD 4BBNC 2FUHB 3OJ4B 4EKUA 3W1SC 2DX5B 2KTRA 1EUVB 1UBQA 3QK0A 1EF1A 2L0TA 2REXA 4II3B 4EUTA 2KMCA 2KLCA 4TUUA 2XEWA 4K81A 2K25A 4NAWA 4A3PA 3VVWB 3KVFB 2J0MA 4IM3A 1BT0A 3OLMD 1RAXA 2IY0B 3M62B 1P0RA 2BF8B 4EZKA 2RSUA 2HTHA 3LDZE 3K9PB 4W9DA 3MJWA 5JZEB 3QAQA 3PT2B 2KJHB 1YIWA 3A1QA 4IM2A 4FLHA 4HXDA 4KV2A 1WM3A 4CHKA 2MRPA 1UD7A 4AP4C 4KDLB 2WWZA 2LXAA 4DBGA 1FXTB 1WGYA 2MBEA 4F1SA 2B3AA 5TR5A 2MBOA 2ZCCA 4PYZA 3IHPC 4I6PA 2FIDA 2KANA 2O2VA 3R7QA 2KXJA 2MQJA 5HKHA 2MW5A 4WWOA 3ZVVA 2KDBA 2KQ7A 3NHEB 3PPAA 4W9FA 1KLVA 4ZRKA 2JF5A 2PE6B 1PQSA 1WXAA 4K7SA 5L83A 3HM6X 2DZKA 2AL3A 3KW5B 4LDTD 4MJSB 1TTNA 2ZEQA 2JZ3B 2GBKA 5C23A 1UGMA 1WRDB 3PHWB 1V86A 4MM3A 1TBEA 3KH0A 2KDFB 2N7EA 4II2B 2V3SA 1WF9A 2NVUI 2CS4A 2LGYA 5D7GA 3UQAA 1OTRB 3DDCB 1ZW7A 3ZUNA 4PS3A 4PS7A 3CMMB 2ZPYA 3N30A 4N9F4 4ZYNA 4X57B 2ZVNA 4W9HA 2JZZA 1WJUA 2LXCA 5LXIB 2JT4B 1WXVA 4AJYB 3HHMA 2XK5B 2KMAA 2ZVOA 3KUZA 4HCNB 2L76A 3TL5A 1Q0WB 3JSVA 1R4NI 2R2OA 2GBNA 4HK2A 3RT3B 3VH4B 3CSTA 4FBJB 2BGFA 4BOZB 3JYUA 1GG3A 2D11A 4GDKA 3VXWA 3K9OB 3U30A 1P1AA 1KOTA 2JRIB 4JLCA 1J8CA 2GOWA 3ZNHB 2RPQA 2K8CA 1Q1OA 2K6DB 2JPHA 2WX0A 2KFKB 4OVUA 2D2QA 2NBVB 3ZO5B 1LXDA 4IWOA 1ZGUB 2L05A 3B0AA 1WH3A 2EKEC 3NS8A 2DENB 3GOEA 3KYDD 3Q3JA 4OVVA 1YD8U 5JHBA 5J2RA 2KDIA 2J7QB 2KX3A 2CU1A 3NZUA 3RCZA 3QQ8B 3VAWA 2WDTB 3B1LX 2KWUB 3LJ3A 1Y8RC 2HJ8A 3L13A 2PPHA 2ZJDA 3RD2A 1E7VA 1WMHA 3CF6E 2W9NA 5CX3A 4ASWC 4LJPB 1P98A 2LD9A 3A9KB 4ZRJA 2LJ5A 2RR9A 2DYOA 4RMAA 4HDOA 5C1ZA 3ML9A 2J0JA 2FIFA 3U7DA 3VH3B 2BWES 2FAZA 4AUQC 1WGRA 1IPGA 2NPTA 1V5OA 5AZHA 1V49A 1IYFA 1RFAA 2FCQA 4GXBA 3ENEA 1SE9A 1V80A 2LGXA 5DPTA 1WX8A 3VTUA 1V6EA 2ASQA 1WZ0A 4B9KA 3A9JB 4DDGD 1XQQA 2C7HA 3NOBA 5JH5C 1WR1A 4ZDVA 2D3GA 1WZ3A 4PYUA 5BO4B 2Z59B 2MLBA 2L00B 3D32A 4MGYE 2GBRA 5D94A 2CKHB 2K6QA 2N1VA 2BPSA 3OAWA 3PLUA 4I6NB 3ZDTA 5LXHA 2WYQA 5D6JB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B6W A;  3MHS D;  1UEL A;  2CHW A;  4IWQ A;  4W9I A;  3H7P A;  1NBF C;  1LQB A;  1L2N A;  1K8R B;  5KHQ A;  2MWS B;  2FNJ B;  4A20 A;  3WAP A;  2KD0 A;  3PSE B;  4WJP A;  1E8X A;  5CHV C;  3AXC A;  2K8B A;  1GC6 A;  3C0R B;  3ONS A;  4HWI B;  3SD5 A;  4E71 A;  3RUI B;  2N7D A;  2DZM A;  2L7R A;  2IO1 B;  3ML8 A;  3VFK A;  3V62 A;  5CHF A;  2LZ6 A;  3ZRF A;  4MSM B;  2KHW B;  1IP9 A;  1YX6 B;  2IO0 B;  2KO3 A;  4MEL A;  2DZJ A;  4M8N A;  3N32 A;  2G3Q B;  3ZTC A;  4G11 A;  4G0N B;  2BWF A;  2DAJ A;  2N9E B;  3EFU A;  4JQW C;  2JUO A;  1E8Z A;  2AL6 A;  2K1F A;  4DXA B;  3DVN V;  3QIJ A;  5DPS A;  3A33 B;  4EEW A;  2GBJ A;  2LVP A;  3PGE A;  4DHJ D;  4W9E A;  4BKS A;  4GDL B;  1WY8 A;  2L3Z A;  3UGB B;  2D07 B;  2LRU A;  1EF5 A;  3VHT C;  2AWT A;  2FCS A;  4GGQ A;  3VUW A;  4ANX A;  3TIX A;  2IBI B;  1X1M A;  3L10 B;  1C3T A;  4MEM A;  3R7R A;  2KWC A;  2O6V B;  4DWF A;  2NCN A;  2L0F A;  2ZNV C;  2IZV B;  4DHZ E;  4E3C A;  4TV3 A;  2LVQ A;  2KC2 A;  2FCM A;  1E8W A;  4KSK C;  4WJO A;  3VDZ A;  4DHZ B;  4GSW A;  3V6C B;  2N1W A;  2PEA A;  3T8M A;  4GIV A;  1WX9 A;  2J0K A;  3TMP B;  4EFO A;  3R3M A;  2HE7 A;  3PZD A;  3IFW B;  3UQB A;  3GZN I;  3ZNG C;  3ALB A;  3UIN B;  1KM7 A;  4IWP A;  1RRB A;  1OGW A;  3V6E B;  4ANU A;  4FUL A;  2V4L A;  2LUE A;  3QWZ B;  1H4R A;  2CHZ A;  3DVG X;  4MJS A;  2ZCB A;  4BKT A;  3DVG Y;  2DAF A;  5KHO A;  1LFD A;  2N4F A;  4GN1 A;  2DYM A;  2LI5 A;  2KNB A;  4FJZ A;  3PRM B;  4W9J A;  4FHK A;  4XX5 A;  3O65 B;  1I35 A;  1SGH A;  4KVG B;  4NPN A;  5AZF A;  4HPL B;  1E8Y A;  2QHO A;  4P7I A;  3W1Y A;  3ZDM C;  2V1Y A;  3VQI A;  1Z2M A;  1E90 A;  2DHZ A;  2KJ6 A;  3NY5 A;  4F8C B;  3HIZ A;  4IUM B;  4MGK E;  4DHJ B;  1P9D U;  1F9J A;  4KIK B;  4A3O A;  1JRU A;  2M8S A;  2XK5 A;  3DOW A;  3SHQ A;  5AZG A;  2R2Q A;  2MA9 B;  2C7M B;  4BFR A;  2ZZP B;  2IYD B;  2HD5 B;  3L08 A;  3DQV A;  2CR5 A;  3DBH I;  4KSL C;  5CHW A;  2RD0 A;  4FN2 A;  3TCA A;  2LRW A;  4LDT B;  4HVB A;  1L7Y A;  2XBB C;  2KVR A;  4BKS D;  2KKC A;  2EMT A;  4IG7 B;  4ICU A;  2OOB B;  3H1U A;  3I3T B;  4HJK A;  2KFK A;  3RZW C;  2A5U A;  3QCA A;  2M17 A;  2RGF A;  1P3Q U;  1J0G A;  1WE7 A;  1WR6 E;  1WIA A;  3X23 A;  5LLI A;  2LGD A;  1QZE A;  3QA8 A;  3M95 A;  1ISN A;  2MX2 A;  4JGH B;  3RYT A;  2KOX A;  4TQ0 A;  4WJQ A;  3DVN U;  2DZI A;  3APD A;  3UIO B;  1WGG A;  4ZRI A;  1WM2 A;  2AEH A;  2KQS A;  4AJW A;  1WJ6 A;  4W9K A;  1GC7 A;  2MP2 B;  1LM8 B;  2K8H A;  3RUL A;  4MSQ B;  4NNJ B;  2M1M A;  2NBU A;  3A9K A;  3APC A;  2MBB B;  3HK0 A;  2KTR B;  3MTN B;  4HDQ A;  3JW0 X;  4M8M A;  1T0Y A;  3UF8 A;  3RZF A;  1WXM A;  3N3K B;  5DCN A;  1UZX B;  3BY4 B;  3WIM A;  2KDE B;  4K1R B;  4GB9 A;  4W9C A;  4NAW B;  5CTR C;  4CYE A;  3KUC B;  1MG8 A;  3VTV A;  3IVF A;  2YLM A;  1WI0 A;  3ZKJ C;  1XT9 B;  2JVC A;  2M4N A;  2GMI C;  1OEY A;  2GBM A;  4FJV B;  2YVC A;  4JL9 A;  3EEC A;  2KN5 A;  4ICV A;  4EZL A;  4I6L B;  3EHV A;  3ZTD A;  1V9J A;  3H7S A;  3S2A A;  5J17 A;  2N9P C;  3HM3 A;  1WX7 A;  3A1Q B;  3A9J A;  3OJ3 A;  3AUL A;  3M3J A;  3PRZ A;  2JWZ A;  3PV1 A;  2C60 A;  1U4A A;  2UYZ B;  3WAN A;  3EC8 A;  3DPD A;  4XC2 A;  3PS6 A;  3L54 A;  2DYB A;  3DBL I;  1GJZ A;  2EMS A;  2M0X A;  3U8Z A;  3ZIM A;  1Z5S B;  5J18 A;  3WAM A;  4RM9 A;  1C1Y B;  2BYV E;  1HE8 A;  2LAS A;  3PRP B;  2O2V B;  3ZLZ A;  1XD3 B;  4GMV A;  2I1K A;  1WGD A;  4HCP B;  1WGH A;  3JVZ X;  2MBH A;  4WWP A;  4BOS C;  3UIP B;  4WWN A;  1CMX B;  1KJT A;  4MDK E;  4MGI E;  1A5R A;  1S1Q B;  1UH6 A;  3QAR A;  2L8J A;  1RLF A;  2BYF A;  2KTF A;  2ZPN A;  1M94 A;  1YQB A;  3BIN A;  4GU2 A;  5L95 C;  3ZNI D;  4FA6 A;  2JRH A;  4IC7 B;  5G2N A;  4BKG A;  3QJZ A;  1S3S G;  3TJP A;  4J6I A;  4EZJ A;  1WJN A;  4LCD E;  4TQ1 A;  4IM0 A;  4FAD A;  1E5W A;  2JY6 A;  4GDL A;  4MH0 E;  5D2M B;  5DPW A;  1V81 A;  3NZS A;  4FJY A;  1OEY J;  2G4S A;  2KFJ A;  4K7U A;  4NY0 A;  4YL8 A;  2NBW B;  5GMV A;  3SU8 X;  1EO6 A;  3P2B A;  3L16 A;  3PVL A;  4KZ0 A;  3T9L A;  1VD2 A;  2KX0 A;  3JSV B;  2O6V A;  3L17 A;  4W9L A;  1D3Z A;  1TGZ B;  2Z0D B;  3QHT A;  1H8C A;  2IO3 B;  4GDK B;  2D10 A;  1GUA B;  2Y5B B;  4XZ4 A;  2BKR B;  2NS5 A;  3H9D A;  2IO2 B;  3IBE A;  4HPM B;  1YX5 B;  2BYE A;  1WYW B;  5E6O A;  5AEK B;  2A4Z A;  2CHX A;  4CO7 A;  3PHX B;  3PLV A;  4FHJ A;  4WJN A;  2N9X A;  3ZW3 A;  1TZ1 A;  3A4S C;  2UWQ A;  3DCG A;  2VRR B;  4HLE A;  3M63 B;  2KLG A;  4GOC A;  4KDI C;  2C7N B;  3VUX A;  1WMH B;  4DK5 A;  2BKF A;  2OJR A;  4LJO B;  4BBN F;  3VUY A;  5G55 A;  4TKN A;  1R4M I;  4BVU C;  2G45 B;  1YJ1 A;  4URK A;  1V5T A;  1AAR A;  1GNU A;  3Q3F A;  4ANW A;  4EOY A;  1NI2 A;  5IA7 A;  3PRE A;  1WJ4 A;  4WAA A;  3B08 A;  2NPT B;  3R66 C;  4NJ7 A;  3DBR I;  1OQY A;  1SIF A;  4G3X B;  3V60 A;  2KC1 A;  4MGZ E;  4IW0 A;  4NQL B;  1UBI A;  2KK8 A;  2LWP A;  2I1J A;  4NQK E;  4WQO B;  3WA0 A;  4ANV A;  4E74 A;  2MBQ A;  3ZRC A;  4PS8 A;  3CSF A;  1WE6 A;  3WAL A;  3VTW A;  3V61 A;  4KIK A;  1NDD A;  5EDS A;  2C5L C;  5IAA C;  4DDI D;  1G6J A;  3IG3 A;  2MSE D;  2KJR A;  1E7U A;  4M0W B;  3AI5 A;  4JIO U;  3QC8 B;  2WX1 A;  2AYO B;  1WFY A;  2JXX A;  3AU5 A;  1Q5W B;  2G4D B;  4K7W A;  4W9G A;  1J19 A;  4NJ6 A;  4B95 A;  3A4R A;  3W1S A;  3X0W A;  3KYC D;  3SDL C;  2NR2 A;  1V2Y A;  3ECI A;  3H7P B;  5E6P A;  4F7Z A;  3APF A;  5DPR A;  3AU4 A;  1VCB A;  2MCN B;  3WAO A;  4AWJ A;  4RM8 A;  2Z0E B;  5E6N A;  2KWV B;  1I42 A;  3ZNZ B;  3L0W B;  3DBS A;  3PTF C;  4G50 A;  2O6V D;  2K39 A;  2KZR A;  2PJH A;  5FR6 A;  1WXS A;  3H6N A;  2C9W B;  3QX1 A;  1ZKH A;  2PE9 A;  4AOF A;  2LVO A;  2MP2 A;  2IY1 B;  2ZNV B;  4KZC A;  3KUD B;  2FCN A;  5JHA A;  3TBL D;  4BBN C;  2FUH B;  3OJ4 B;  4EKU A;  3W1S C;  2DX5 B;  2KTR A;  1EUV B;  1UBQ A;  3QK0 A;  1EF1 A;  2L0T A;  2REX A;  4II3 B;  4EUT A;  2KMC A;  2KLC A;  4TUU A;  2XEW A;  4K81 A;  2K25 A;  4NAW A;  4A3P A;  3VVW B;  3KVF B;  2J0M A;  4IM3 A;  1BT0 A;  3OLM D;  1RAX A;  2IY0 B;  3M62 B;  1P0R A;  2BF8 B;  4EZK A;  2RSU A;  2HTH A;  3LDZ E;  3K9P B;  4W9D A;  3MJW A;  5JZE B;  3QAQ A;  3PT2 B;  2KJH B;  1YIW A;  3A1Q A;  4IM2 A;  4FLH A;  4HXD A;  4KV2 A;  1WM3 A;  4CHK A;  2MRP A;  1UD7 A;  4AP4 C;  4KDL B;  2WWZ A;  2LXA A;  4DBG A;  1FXT B;  1WGY A;  2MBE A;  4F1S A;  2B3A A;  5TR5 A;  2MBO A;  2ZCC A;  4PYZ A;  3IHP C;  4I6P A;  2FID A;  2KAN A;  2O2V A;  3R7Q A;  2KXJ A;  2MQJ A;  5HKH A;  2MW5 A;  4WWO A;  3ZVV A;  2KDB A;  2KQ7 A;  3NHE B;  3PPA A;  4W9F A;  1KLV A;  4ZRK A;  2JF5 A;  2PE6 B;  1PQS A;  1WXA A;  4K7S A;  5L83 A;  3HM6 X;  2DZK A;  2AL3 A;  3KW5 B;  4LDT D;  4MJS B;  1TTN A;  2ZEQ A;  2JZ3 B;  2GBK A;  5C23 A;  1UGM A;  1WRD B;  3PHW B;  1V86 A;  4MM3 A;  1TBE A;  3KH0 A;  2KDF B;  2N7E A;  4II2 B;  2V3S A;  1WF9 A;  2NVU I;  2CS4 A;  2LGY A;  5D7G A;  3UQA A;  1OTR B;  3DDC B;  1ZW7 A;  3ZUN A;  4PS3 A;  4PS7 A;  3CMM B;  2ZPY A;  3N30 A;  4N9F 4;  4ZYN A;  4X57 B;  2ZVN A;  4W9H A;  2JZZ A;  1WJU A;  2LXC A;  5LXI B;  2JT4 B;  1WXV A;  4AJY B;  3HHM A;  2XK5 B;  2KMA A;  2ZVO A;  3KUZ A;  4HCN B;  2L76 A;  3TL5 A;  1Q0W B;  3JSV A;  1R4N I;  2R2O A;  2GBN A;  4HK2 A;  3RT3 B;  3VH4 B;  3CST A;  4FBJ B;  2BGF A;  4BOZ B;  3JYU A;  1GG3 A;  2D11 A;  4GDK A;  3VXW A;  3K9O B;  3U30 A;  1P1A A;  1KOT A;  2JRI B;  4JLC A;  1J8C A;  2GOW A;  3ZNH B;  2RPQ A;  2K8C A;  1Q1O A;  2K6D B;  2JPH A;  2WX0 A;  2KFK B;  4OVU A;  2D2Q A;  2NBV B;  3ZO5 B;  1LXD A;  4IWO A;  1ZGU B;  2L05 A;  3B0A A;  1WH3 A;  2EKE C;  3NS8 A;  2DEN B;  3GOE A;  3KYD D;  3Q3J A;  4OVV A;  1YD8 U;  5JHB A;  5J2R A;  2KDI A;  2J7Q B;  2KX3 A;  2CU1 A;  3NZU A;  3RCZ A;  3QQ8 B;  3VAW A;  2WDT B;  3B1L X;  2KWU B;  3LJ3 A;  1Y8R C;  2HJ8 A;  3L13 A;  2PPH A;  2ZJD A;  3RD2 A;  1E7V A;  1WMH A;  3CF6 E;  2W9N A;  5CX3 A;  4ASW C;  4LJP B;  1P98 A;  2LD9 A;  3A9K B;  4ZRJ A;  2LJ5 A;  2RR9 A;  2DYO A;  4RMA A;  4HDO A;  5C1Z A;  3ML9 A;  2J0J A;  2FIF A;  3U7D A;  3VH3 B;  2BWE S;  2FAZ A;  4AUQ C;  1WGR A;  1IPG A;  2NPT A;  1V5O A;  5AZH A;  1V49 A;  1IYF A;  1RFA A;  2FCQ A;  4GXB A;  3ENE A;  1SE9 A;  1V80 A;  2LGX A;  5DPT A;  1WX8 A;  3VTU A;  1V6E A;  2ASQ A;  1WZ0 A;  4B9K A;  3A9J B;  4DDG D;  1XQQ A;  2C7H A;  3NOB A;  5JH5 C;  1WR1 A;  4ZDV A;  2D3G A;  1WZ3 A;  4PYU A;  5BO4 B;  2Z59 B;  2MLB A;  2L00 B;  3D32 A;  4MGY E;  2GBR A;  5D94 A;  2CKH B;  2K6Q A;  2N1V A;  2BPS A;  3OAW A;  3PLU A;  4I6N B;  3ZDT A;  5LXH A;  2WYQ A;  5D6J B; 
#chains in the Genus database with same CATH topology
 3MJ5 A;  1UEL A;  2CHW A;  1JRO A;  4W9I A;  1L2N A;  4ITK A;  1K50 A;  4ZOH C;  4A20 A;  3MC0 B;  3WAP A;  5CHV C;  1GC6 A;  3RUI B;  2DZM A;  5EE0 A;  4Q2J A;  1IGD A;  3V62 A;  1XCT L;  3AN1 A;  4MSM B;  1IP9 A;  2IGG A;  2KO3 A;  2V3P A;  4MEL A;  2DZJ A;  2VH2 A;  4R3D A;  4G0N B;  2N9E B;  3R8B A;  1HXY D;  2J4X A;  1YN4 A;  1LGR A;  3DVN V;  3QIJ A;  1WY8 A;  2AWT A;  3TIX A;  2IBI B;  5IN7 A;  2MJD A;  3BYY B;  1HZ6 A;  2KWC A;  4DWF A;  4E3C A;  2LVQ A;  1WYG A;  2FCM A;  1PYW D;  2N1W A;  4LNI A;  1QQR A;  3R3M A;  2HE7 A;  1DOY A;  3IFW B;  3UQB A;  5HHD G;  4FUL A;  2LUE A;  3DVG X;  4A90 A;  4BKT A;  3DVG Y;  4P6V F;  1LFD A;  1C76 A;  4W9J A;  3PRM B;  3EGR A;  3O65 B;  1E8Y A;  4P7I A;  1WRI A;  3W1Y A;  3ZDM C;  1E90 A;  2DHZ A;  3NY5 A;  3P4P B;  1YQ3 B;  2GB1 A;  4LK0 M;  4RGN A;  1XLP A;  3NJT A;  3U2S C;  1TKE A;  2XK5 A;  2K5P A;  3DBH I;  4KSL C;  4RGT A;  3Q69 A;  1VLB A;  1T6B X;  1DYQ A;  3I3T B;  4JWU C;  1V97 A;  1NVI D;  1SE2 A;  1QZE A;  3BVM A;  1ISN A;  1ZDX A;  2JWU A;  2DZI A;  1WGG A;  3P4S B;  1WM2 A;  3W2D A;  3ZJT A;  3HRD D;  1GC7 A;  1PDX A;  2BBC A;  3RUL A;  2Q5W D;  2M1M A;  2JQR B;  2I38 A;  2MBB B;  1JWB D;  2KTR B;  3HK0 A;  4IOI E;  3JW0 X;  3N3K B;  1Q10 A;  3BY4 B;  4W9C A;  2VZK D;  3IVF A;  3ZKJ C;  2GMI C;  5TSS A;  1OEY A;  4FJV B;  1PGX A;  3EEC A;  2MJ3 A;  3FAH A;  4ICV A;  1XF5 L;  4C4V B;  1P7F A;  1V9J A;  5J17 A;  2N9P C;  3A1Q B;  3A9J A;  3PV1 A;  1YMH E;  5GXG B;  3AEG B;  2M0X A;  1Z5S B;  1VZ8 A;  3MFG A;  4MAC A;  2HDE A;  4GMV A;  4OZB A;  3AEA B;  1WGD A;  4HCP B;  2MBH A;  1FCC C;  1L0X B;  1PFD A;  1QLB B;  4MDK E;  4MGI E;  1A5R A;  2DNF A;  3E9S A;  1KLU D;  3QAR A;  2L8J A;  2KTF A;  1M94 A;  1AW7 A;  4MT5 A;  3BIN A;  2IND C;  4GU2 A;  5L95 C;  3ZNI D;  1TY2 A;  5G2N A;  4BKG A;  3QJZ A;  1S3S G;  4IM0 A;  4QAY A;  3Q8A A;  4FJY A;  2KFJ A;  2HJ1 A;  2BS2 B;  3PVL A;  2V4I B;  2KX0 A;  1ESF A;  1TGZ B;  1R4M B;  4GDK B;  1ET6 A;  1UUP A;  3TEY A;  2EEL A;  4O1N A;  2BYE A;  5AEK B;  3PHX B;  4JWS C;  1TZ1 A;  3Q6B A;  2UWQ A;  2VRR B;  2V3N A;  3M63 B;  1B9R A;  1DOI A;  2WS3 B;  2OJR A;  2RMM A;  3VUY A;  5G55 A;  1XCQ L;  1TT5 B;  2G45 B;  1YJ1 A;  1AAR A;  2SEB D;  2BS3 B;  3VR8 B;  1NI2 A;  4A6Q A;  5IA7 A;  1SE4 A;  3PRE A;  4ZHP A;  4NJ7 A;  1SIF A;  3SR6 A;  2LWP A;  2MBQ A;  4PS8 A;  3BII D;  1WE6 A;  1QOG A;  2JYE A;  1NDD A;  2J53 A;  2K9X A;  2NTT A;  3IG3 A;  2KJR A;  4M0W B;  3AI5 A;  1WFY A;  2G4D B;  1J19 A;  3V05 A;  2MHJ A;  4F7Z A;  3NZ3 A;  1L0V B;  1AWD A;  3U4E G;  2Z0E B;  1GPX A;  1TYG B;  3L0W B;  3VRB B;  2R61 A;  2KZR A;  1C4P A;  2ACZ B;  2QJL A;  2ZNV B;  2L52 A;  2FCN A;  4YSZ B;  2DX5 B;  2KTR A;  1EUV B;  1UBQ A;  3HVD A;  4CQN A;  3LXF A;  1TKG A;  2KLC A;  4DQO C;  1R7S A;  2BS4 B;  1KRH A;  1D5M C;  3M62 B;  2RSU A;  4RGO S;  4PT5 A;  4C4V A;  2KJH B;  3P42 A;  1C4C A;  3A1Q A;  4YTN B;  4YTP B;  1T5X D;  4HXD A;  2X38 A;  2GRI A;  2WWZ A;  5C3J B;  1WGY A;  2N9K A;  2MBE A;  2IDY A;  2B3A A;  5EE1 A;  2MBO A;  4PYZ A;  1NI3 A;  2FID A;  5HKH A;  2QEJ C;  1FMA D;  1SF0 A;  3ZVV A;  2KDB A;  2KQ7 A;  4W9F A;  4ZRK A;  5L83 A;  4K7S A;  3HM6 X;  2DZK A;  1TTN A;  1MVK A;  1F1H A;  2GBK A;  2RPV A;  1TS5 A;  2Z8L A;  2ONQ A;  5C23 A;  2LEK A;  4WQM A;  1PGA A;  1TBE A;  3KH0 A;  4LNK A;  3AEC B;  2LGY A;  5D7G A;  1ZW7 A;  1MPE A;  4A9A A;  4YWG G;  3HVZ A;  2JZZ A;  1WJU A;  1PGB A;  2XN9 C;  1WGK A;  2WHI A;  2KMA A;  3P63 A;  3KQ4 A;  2R2O A;  1KH0 A;  3RT3 B;  4FBJ B;  2D11 A;  4GDK A;  3K9O B;  3N1Z C;  1P1A A;  1KOT A;  3NVZ A;  2K8C A;  1Q1O A;  2K6D B;  2KFK B;  1NEK B;  2D2Q A;  2NBV B;  3ZO5 B;  1ZGU B;  4WIP A;  1RM6 C;  2EKE C;  2DEN B;  3NS8 A;  1YD8 U;  1GOZ A;  5JHB A;  5J2R A;  2KDI A;  1HTO A;  2CU1 A;  3CIR B;  2PVO D;  2KWU B;  1Y8R C;  2HJ8 A;  4YSY B;  3RD2 A;  1N63 A;  1E7V A;  5CX3 A;  4ZRJ A;  1VJK A;  4RMA A;  1IBX B;  2WXO A;  2WDR B;  2RDB C;  1EM7 A;  3NRZ A;  3U7D A;  3VH3 B;  2M19 A;  1V49 A;  1IYF A;  4HKZ E;  1D5Z C;  1RFA A;  4GXB A;  5DPT A;  4YTM B;  2ASQ A;  1QOA A;  2BB6 A;  4DDG D;  4M0W A;  3E56 A;  4ZDV A;  2LUM A;  3DWM A;  2BYT A;  1WZ3 A;  4PYU A;  2BTE A;  2Z59 B;  2MLB A;  5D94 A;  4MGY E;  1XLQ A;  3RPF C;  4LTU A;  3OAW A;  2BPS A;  4S17 A;  4WH4 A;  4JE3 B;  4HRO A;  4NZL B;  4E71 A;  1I4G A;  2K8B A;  4HWI B;  1HA5 A;  2WXH A;  2N7D A;  4XDC A;  1T0R C;  2LZ6 A;  2KHW B;  1UWM A;  3BK1 A;  3ZTC A;  4G11 A;  1CJE A;  2BWF A;  2K1F A;  1EU4 A;  3A33 B;  2LVP A;  4DHJ D;  4BKS A;  4GDL B;  1C4A A;  3ZYY X;  2L3Z A;  2KYW A;  3VHT C;  4C00 A;  2FCS A;  4GGQ A;  2G9H D;  5D3D A;  2RDG A;  1SE3 A;  2O6V B;  2NCN A;  2L0F A;  2KC2 A;  4KSK C;  1E8W A;  4WJO A;  3V6C B;  2LFI A;  2PEA A;  1WX9 A;  4EFO A;  1OQR A;  1V1P B;  1TZO A;  1TJE A;  3GZN I;  1TKY A;  3UIN B;  1KM7 A;  3RMK C;  1RRB A;  1OGW A;  2WU5 B;  3T3O A;  1YQ4 B;  3AE2 B;  2CHZ A;  2ON8 A;  4ARC A;  2B76 B;  1K52 A;  2N4F A;  3DBH B;  4GN1 A;  2LI5 A;  4AQ7 A;  1N5W A;  4K3B A;  2QCZ A;  4DXF A;  3AB5 A;  2V1Y A;  4F8C B;  3HIZ A;  4IUM B;  5AUK A;  4KIK B;  4A3O A;  4M01 A;  1JRU A;  3DOW A;  3SHQ A;  2MA9 B;  3SEB A;  2C7M B;  4BFR A;  4UDU C;  2BQQ A;  4HVB A;  2RD0 A;  3TCA A;  4LDT B;  1L7Y A;  3EA6 A;  2KKC A;  4IG7 B;  3NVY A;  2OOB B;  3H1U A;  3I5J C;  4HJK A;  2KFK A;  3RZW C;  1J7B A;  2A5U A;  1J0G A;  4IDI A;  1WE7 A;  2WXQ A;  2TSS A;  1YJJ A;  5LLI A;  2LGD A;  1N62 A;  3M95 A;  3RYT A;  2KOX A;  3BVZ A;  1LO5 D;  4ZRI A;  2AEH A;  4S0R A;  1FIQ A;  1WJ6 A;  3J9C A;  2AQ2 B;  3AE6 B;  2MP2 B;  3Q3M C;  2IJ0 A;  2Y5P A;  4MSQ B;  4NNJ B;  3APC A;  1IBX A;  4ZRP A;  3EFC A;  3UF8 A;  1WXM A;  4ZHO A;  4M02 A;  1BUI C;  1WI0 A;  1XT9 B;  2M4N A;  3NG0 A;  4I6L B;  3H7S A;  3HM3 A;  4A8X C;  1HTQ A;  3M3J A;  2LMC A;  3URY A;  1U4A A;  2I2Y A;  3EC8 A;  2J52 A;  3L54 A;  2EMS A;  3U8Z A;  3WAM A;  5FKA C;  1C1Y B;  1HE8 A;  1HZ5 A;  3N9Y C;  1WGH A;  1CQV A;  3UIP B;  1YJI A;  2JX5 A;  3Q2A C;  1CMX B;  1KJT A;  3I9V 1;  1RYJ A;  1RLF A;  2BYF A;  1ACC A;  4MM3 B;  3WCQ A;  1YQB A;  2L83 A;  2JRH A;  4C80 A;  3KWV A;  4IC7 B;  1E0Z A;  3RFZ B;  3TJP A;  4J6I A;  4EZJ A;  4FAD A;  1N5X A;  2JY6 A;  4GDL A;  4MH0 E;  5D2M B;  5DPW A;  3NZS A;  2V0G A;  2PIA A;  3SU8 X;  1EO6 A;  3L16 A;  3FIL B;  1VD2 A;  2O6V A;  4W9L A;  1D3Z A;  2Z0D B;  1H8C A;  3ABV B;  4N58 A;  1L4D B;  2D10 A;  1GUA B;  2Y5B B;  2NS5 A;  4HPM B;  4MH8 A;  1V1P A;  3PLV A;  2N9X A;  2LHE A;  3DCG A;  2KLG A;  4GOC A;  4KDI C;  2C7N B;  3VUX A;  4DK5 A;  2BKF A;  4LJO B;  4BVU C;  1V5T A;  1JWM D;  2SAK A;  3AEF B;  3BZD B;  1UNS A;  1T0S C;  4ANW A;  2YEP B;  1WJ4 A;  1VZ6 A;  4ARI A;  3R66 C;  3AE5 B;  3CWI A;  4NQK E;  4E74 A;  3SFE B;  4KIK A;  2C5L C;  1G6J A;  4WAF A;  1JWS D;  2AYO B;  2JXX A;  4K7W A;  4OVZ A;  3W1S A;  3SDL C;  3BWU D;  3H7P B;  3WAO A;  4AWJ A;  4RM8 A;  3AE1 B;  3ZNZ B;  3DBS A;  4G50 A;  2K39 A;  3QX1 A;  2MP2 A;  4KZC A;  2OED A;  2JU6 X;  3KUD B;  2FUG 1;  2FUH B;  3OJ4 B;  4EKU A;  2ZW1 A;  3QK0 A;  1QOF A;  4II3 B;  2KAJ A;  2CJO A;  4N59 A;  2J0M A;  4IM3 A;  2M56 B;  1P0R A;  2BF8 B;  2HTH A;  4W9D A;  1WSP A;  5JZE B;  1YIW A;  3I63 C;  4KV2 A;  4CHK A;  3GE3 C;  2LXA A;  4DBG A;  5BYQ A;  1N61 A;  1C78 A;  1N6Z A;  3N1Y C;  5TR5 A;  2ZCC A;  3IHP C;  4I6P A;  2INN E;  2KAN A;  3IT4 B;  3R7Q A;  2MQJ A;  4WWO A;  3PPA A;  1PQS A;  3P4Q B;  4C56 C;  4LLG M;  1SB3 C;  3PHW B;  1V86 A;  4IKG A;  4MM3 A;  2WP9 B;  4RCO A;  4PS3 A;  4ZYN A;  2LGS A;  1JQ4 A;  2ZVN A;  2CJN A;  4AJY B;  3FIL A;  5D3I B;  4OW0 A;  4KKJ A;  3AED B;  1R4N I;  4HK2 A;  3VH4 B;  4BOZ B;  3VXW A;  3U30 A;  1E10 A;  2WDV B;  4JLC A;  2GOW A;  4P1C C;  2WXI A;  2KN4 A;  1LXD A;  1N60 A;  1WH3 A;  3KYD D;  3Q3J A;  3B2G A;  2J7Q B;  1C77 A;  3AM9 A;  3VAW A;  1B1Z A;  1E7P B;  2WDT B;  3B1L X;  3LJ3 A;  1ZXH A;  4LNF A;  2AQ3 B;  2PPH A;  2ZJD A;  3IXS A;  3NVW A;  4ASW C;  1AYF A;  2V9H A;  3AEB B;  2HTM E;  2LJ5 A;  2DYO A;  4XGA B;  5EE9 A;  2FIF A;  3ZXR A;  1TS3 A;  1V5O A;  2IGH A;  2PW9 A;  1V80 A;  5E6J A;  1WX8 A;  2WXJ A;  3AE8 B;  2N0S B;  1WZ0 A;  1XO3 A;  3NOB A;  1EWC A;  5JH5 C;  2D3G A;  5AUI A;  2INP E;  3D32 A;  2L00 B;  2CKH B;  2N1V A;  5LXH A;  5BMI A;  3TEW A;  2W55 A;  3MHS D;  4IWQ A;  4LNN A;  3H7P A;  1NBF C;  1QT9 A;  1IGC A;  4ZYS A;  1K8R B;  5KHQ A;  2FNJ B;  1FRD A;  3Q8E A;  2KD0 A;  3PSE B;  1E8X A;  3AXC A;  3ONS A;  1FFU A;  3C0R B;  4RH6 A;  4USA A;  5HG2 A;  3TEX A;  1I4H A;  2L7R A;  3BYT B;  3AE4 B;  5CHF A;  1YX6 B;  2IO0 B;  2G3Q B;  4JPS A;  2DAJ A;  1SEB D;  2AL6 A;  4JX1 C;  5DPS A;  4EEW A;  3GZN B;  3UGB B;  2D07 B;  2W3S A;  2LRU A;  1EF5 A;  2FE8 A;  3VUW A;  4ANX A;  1XEE A;  1X1M A;  3L10 B;  1C3T A;  4MEM A;  3R7R A;  2ZNV C;  1NEN B;  4TV3 A;  3VDZ A;  3AE7 B;  4GSW A;  1QKZ A;  1EU3 A;  1DGJ A;  3T8M A;  3PZD A;  3AMZ A;  3ZNG C;  1L4Z B;  3ZJU A;  5BYR A;  3V6E B;  4ANU A;  2V4L A;  4KX6 B;  3QWZ B;  5JXV A;  1H4R A;  1HQR D;  2ZCB A;  5KHO A;  3R2T A;  2DYM A;  2AX5 A;  2KNB A;  4FJZ A;  1GB4 A;  4FHK A;  4XX5 A;  1F52 A;  3H8H A;  1T0Q C;  1I35 A;  4KVG B;  4NPN A;  4HPL B;  2QHO A;  3I57 A;  1Z2M A;  4RFB A;  2E6X A;  4DHJ B;  2OJW A;  1SSN A;  2M8S A;  5AZG A;  2R2Q A;  2ZZP B;  2IYD B;  5CHW A;  2LRW A;  3N1X C;  4BKS D;  4ICU A;  1BXT A;  2AQ1 B;  3X23 A;  1HEZ E;  2MX2 A;  4JGH B;  4EE2 A;  1SJH D;  3APD A;  4AJW A;  2IGD A;  1FXI A;  4W9K A;  4K3C A;  1LM8 B;  4D2K A;  2NBU A;  4HDQ A;  4M8M A;  5LNK 1;  5DCN A;  1UZX B;  4L2Y A;  3WIM A;  4GB9 A;  5CTR C;  4NAW B;  3ZQ4 A;  1VZ7 A;  1MG8 A;  2YLM A;  2JVC A;  3PO0 A;  2GBM A;  4NJC A;  2KN5 A;  4EZL A;  3DHG C;  2ZW0 A;  3EHV A;  3S2A A;  3RN9 C;  3OJ3 A;  1D4B A;  3PRZ A;  2JWZ A;  1GJZ A;  2DYB A;  3DBL I;  3ZIM A;  5J18 A;  4J3O D;  4RM9 A;  3P1M A;  1STE A;  3PRP B;  3ZLZ A;  3JVZ X;  4WWP A;  1T3Q A;  3W5V B;  1V8C A;  1AN8 A;  5HI1 A;  1WWT A;  1L0Y B;  2ZPN A;  3TUO A;  1P7E A;  4HEA 1;  2L1A A;  4FA6 A;  3PZ7 A;  2QIL A;  4LCD E;  4US9 A;  1E5W A;  4TMA B;  1OEY J;  4NY0 A;  4K7U A;  5H8Y E;  5GMV A;  1DOX A;  2BT6 A;  1UWX A;  4HJG E;  3AV8 A;  1QOB A;  4XZ4 A;  3H9D A;  2IO2 B;  3IBE A;  1YX5 B;  5E6O A;  1OQQ A;  4AS1 A;  2DBY A;  2CHX A;  1SXT A;  1I7H A;  4WJN A;  2WXG A;  4HLE A;  2PKO A;  1XLN A;  1WMH B;  2BVC A;  2LGI A;  4TKN A;  2KDM A;  2WXP A;  4URK A;  1JW9 D;  3DHI C;  4EOY A;  4WAA A;  4XYC A;  2NPT B;  3DBR I;  3V60 A;  4MGZ E;  4IW0 A;  4NQL B;  4ANV A;  4WQO B;  4M00 A;  3ZRC A;  3VTW A;  3V61 A;  1ZP0 B;  5EDS A;  4DDI D;  2MSE D;  4JIO U;  3QC8 B;  2PTL A;  4ZRQ A;  3AU5 A;  4XWW A;  4W9G A;  4NJ6 A;  2NR2 A;  1V2Y A;  5DPR A;  1BML C;  2NTS A;  2MCN B;  3R2I A;  2KVZ A;  4KGR A;  4DXG A;  2KWV B;  1I42 A;  2WXM A;  4OZC A;  1C79 A;  2O6V D;  2PJH A;  4REZ A;  2WXN A;  1WXS A;  1J7C A;  2PLP A;  2C9W B;  1MJD A;  1ZDV A;  5JHA A;  3MHZ A;  4WWM A;  3W1S C;  1RFK A;  1EF1 A;  4RF1 A;  1GB1 A;  2KMC A;  4TUU A;  4K81 A;  4NAW A;  2NMQ A;  1FCL A;  4A3P A;  1FM0 D;  3VVW B;  3KVF B;  3DHH C;  3OLM D;  4HRS A;  3LDZ E;  3MJW A;  2WXF A;  3QAQ A;  3PT2 B;  1JCK B;  4IM2 A;  4FLH A;  3OG5 A;  3GB1 A;  2DWQ A;  2MRP A;  4C7Y A;  2CU3 A;  4KDL B;  1FXT B;  2W3R A;  1QIL A;  3Q8B A;  1FEH A;  4F1S A;  2H88 B;  1V1O A;  3B2F A;  5C2T B;  2Y5C A;  1ZUD 2;  1F0Z A;  2MW5 A;  3PZ8 A;  2VZK B;  3RI7 C;  1WXA A;  3KW5 B;  4LDT D;  4MJS B;  3ZJV A;  1I4P A;  1E9M A;  3AEE B;  1R4N B;  1RWS A;  1IUE A;  2KDF B;  3Q3N C;  3UQA A;  1OTR B;  4PS7 A;  3N30 A;  3TSS A;  4N9F 4;  4X57 B;  4OZA A;  2JT4 B;  3HHM A;  2ZVO A;  3KUZ A;  2L76 A;  1Q0W B;  1D6E C;  2GBN A;  2YEP F;  2G1E A;  3JYU A;  1ET9 A;  2FBW B;  2JRI B;  1J8C A;  2JPH A;  2WX0 A;  4IWO A;  1VDV A;  3B0A A;  2QIE B;  3GOE A;  4OVV A;  2DLB A;  2WXK A;  3KLS X;  3NZU A;  4PK1 A;  2QC8 A;  1KF6 B;  1JML A;  3QQ8 B;  2KQ4 X;  2K3U A;  3L13 A;  3IAS 1;  1WMH A;  3MC9 A;  2W9N A;  3AH7 A;  1TIF A;  2PMV A;  1L5P A;  4LJP B;  1JWA D;  1P98 A;  2LD9 A;  3A9K B;  5IP4 D;  4HDO A;  1NYR A;  1KFY B;  5C1Z A;  2WXL A;  3IAM 1;  2FAZ A;  3Q8C A;  4HKQ A;  1WGR A;  1IPG A;  2NPT A;  2PVG C;  1SBB B;  1KLG D;  4XE0 A;  2INC C;  2FCQ A;  3ENE A;  1SE9 A;  2LGX A;  2W54 A;  3VTU A;  2KT7 A;  2UU7 A;  3VRA B;  4B9K A;  1YNT E;  5EE3 A;  1XQQ A;  2C7H A;  3ZGZ A;  3AE9 B;  5BO4 B;  1M4V A;  3C8Y A;  3PLU A;  3VR9 B;  2W82 A;  2WYQ A;  5D6J B;  3TEZ A;  5FK9 C;  4B6W A;  1LQB A;  2H89 B;  4L23 A;  2MWS B;  4P1B C;  4WJP A;  3SD5 A;  4XDD A;  3ML8 A;  2IO1 B;  1WXQ A;  3VFK A;  3RNA C;  3RNF C;  3ZRF A;  1CK1 A;  4M8N A;  3N32 A;  2QMT A;  4JQW C;  3EFU A;  2JUO A;  1E8Z A;  3LB8 C;  3AE3 B;  1CZP A;  4DXA B;  5BYS A;  1YN3 A;  2GBJ A;  2QDF A;  3PGE A;  4W9E A;  1FFV A;  1UF0 A;  5I4D A;  1ZOY B;  4FXC A;  1OFF A;  2IZV B;  4DHZ E;  4DHZ B;  3IT6 B;  4GIV A;  2J0K A;  3HUI A;  3TMP B;  1MI0 A;  4OHJ A;  3ALB A;  4IWP A;  3BK2 A;  4RGM A;  3UI3 A;  3B9J A;  4MJS A;  1FD6 A;  2DAF A;  1FO4 A;  2JXT A;  5HFY A;  1SGH A;  5AZF A;  1ROE A;  2MEK A;  2IPK D;  2KWD A;  3VQI A;  2KJ6 A;  4MGK E;  1P9D U;  1F9J A;  2KAC A;  1F77 A;  4XWT A;  1SJE D;  2HD5 B;  4C7Z A;  3L08 A;  3DQV A;  2CR5 A;  3ZXV A;  4FN2 A;  1FRR A;  2XBB C;  3O13 A;  3FC4 A;  2KVR A;  3Q14 C;  3P4R B;  2EMT A;  2LJI A;  2N7J A;  2M17 A;  2RGF A;  1P3Q U;  3QCA A;  2KMM A;  5BMG A;  1I4R A;  1WR6 E;  1WIA A;  2D5G A;  3QA8 A;  2WLB A;  4TQ0 A;  4WJQ A;  3DVN U;  3UIO B;  3RNG C;  2KQS A;  4L1B A;  2XNA C;  2K8H A;  3A9K A;  3DBL B;  3MTN B;  1T0Y A;  3RZF A;  2KDE B;  4K1R B;  5MPO A;  4CYE A;  3KUC B;  3VTV A;  4P16 A;  4GLS C;  3MP9 A;  4YT0 B;  2YVC A;  4JL9 A;  5IO9 A;  4YSX B;  3ZTD A;  1ZXI A;  4B0E A;  1WX7 A;  1FPY A;  3AUL A;  2X8X X;  1YOV B;  2C60 A;  2UYZ B;  3WAN A;  2VH1 A;  3DPD A;  4XC2 A;  3PS6 A;  2OHF A;  2BYV E;  2LAS A;  1C9F A;  2O2V B;  1MHX A;  1XD3 B;  2I1K A;  3ETR A;  4BOS C;  4WWN A;  1S1Q B;  1UH6 A;  4YXD B;  1FXA A;  1ENF A;  1WJN A;  1Y56 A;  4TQ1 A;  2MH7 A;  2J42 A;  4TSS A;  1V81 A;  1ZPS A;  3DWG C;  2G4S A;  4YL8 A;  2NBW B;  3P2B A;  4KZ0 A;  3T9L A;  2L32 A;  5G5G A;  3JSV B;  3L17 A;  1MFW A;  3QHT A;  2IO3 B;  1F2R C;  1L6V A;  3SFD B;  2BKR B;  1I4X A;  1WYW B;  2A4Z A;  3OWE B;  3DBR B;  4CO7 A;  4FHJ A;  1FNU A;  3ZW3 A;  1K51 A;  3A4S C;  3KWL A;  1SIJ A;  4BBN F;  1R4M I;  1E6E B;  5T8I A;  1YN5 A;  1GNU A;  3Q3F A;  3GP7 A;  1KTK A;  3B08 A;  1OQY A;  4G3X B;  2KC1 A;  1UBI A;  2KK8 A;  2I1J A;  4KGT A;  3WA0 A;  3CSF A;  3WAL A;  2WNM A;  5IAA C;  4N6E B;  1E7U A;  4B0M A;  2WX1 A;  1JAL A;  1MG4 A;  3N20 C;  1Q5W B;  4ACF A;  3RNE C;  4B95 A;  3A4R A;  3X0W A;  3KYC D;  1TS4 A;  3ECI A;  2GI9 A;  5E6P A;  3APF A;  1JWU D;  3AU4 A;  1VCB A;  2BB5 A;  3W5U B;  1FNW A;  5E6N A;  3PTF C;  3NUH B;  5FR6 A;  1VR9 A;  3Q3O C;  3H6N A;  2EKI A;  5H92 C;  4AOF A;  1UGJ A;  1ZKH A;  2PE9 A;  2LVO A;  3FKY A;  2IY1 B;  2LHD A;  3TBL D;  4BBN C;  2K22 A;  3T3N A;  1PUT A;  2L0T A;  2REX A;  4EUT A;  2XEW A;  2K25 A;  1BT0 A;  3BVG A;  1RAX A;  2IY0 B;  4HPP A;  4RF0 A;  4EZK A;  3K9P B;  3RNB C;  5IOI A;  3LYY A;  1K53 A;  2D3B A;  4H2A A;  1WM3 A;  1UD7 A;  4AP4 C;  1I4Q A;  3W9C B;  3GE8 C;  2O2V A;  2KXJ A;  1D5X C;  1A70 A;  1GAQ B;  3NHE B;  1KLV A;  2JF5 A;  2PE6 B;  1TS2 A;  2AL3 A;  2ZEQ A;  2JZ3 B;  2GLS A;  2WXR A;  1F2R I;  2D3A A;  1UGM A;  1WRD B;  5FR3 A;  2K0P A;  4KKI A;  4II2 B;  2N7E A;  3C19 A;  2ICI A;  2V3S A;  1WF9 A;  2NVU I;  3L4P A;  2CS4 A;  5G5H A;  1L6U A;  3DDC B;  3ZUN A;  4KGS A;  2BW2 A;  2ZPY A;  3CMM B;  4LNO A;  4W9H A;  2LXC A;  5LXI B;  1WXV A;  2XK5 B;  4HCN B;  2E3T A;  3TL5 A;  4A55 A;  3U52 E;  3JSV A;  1ZE3 D;  3CST A;  2BGF A;  1GG3 A;  1MHH E;  2WU2 B;  1NYQ A;  3Q8F A;  3ZNH B;  1FNV A;  2RPQ A;  4OVU A;  3NS1 A;  1EWY C;  2L05 A;  5BMH A;  1TY0 A;  2QSD A;  1XLO A;  2KX3 A;  1VRA B;  3NVV A;  2JZP A;  3RCZ A;  4NAM A;  1J7A A;  4BAX A;  3CF6 E;  2M0A A;  3GS2 A;  2WDQ B;  2RR9 A;  2WQY B;  2N9L A;  3ML9 A;  2J0J A;  3RNC C;  2BWE S;  4AUQ C;  5AZH A;  4BZA A;  3U7Z A;  3EUB 2;  1XXG A;  5IKC M;  1JRP A;  4WUR A;  2WGS A;  1V6E A;  1QF6 A;  4US8 A;  3V3X A;  2Y3A A;  4RNA A;  3A9J B;  2RDH A;  3MC8 A;  1WR1 A;  2MJE A;  2JSV X;  2D3C A;  2GBR A;  2JYT A;  2K6Q A;  3ZDT A;  4I6N B; 
#chains in the Genus database with same CATH homology
 4B6W A;  3MHS D;  1UEL A;  2CHW A;  4IWQ A;  4W9I A;  3H7P A;  1NBF C;  1LQB A;  1L2N A;  1K8R B;  5KHQ A;  2MWS B;  2FNJ B;  4A20 A;  3WAP A;  2KD0 A;  3PSE B;  4WJP A;  1E8X A;  5CHV C;  3AXC A;  2K8B A;  1GC6 A;  3C0R B;  3ONS A;  4HWI B;  3SD5 A;  4E71 A;  3RUI B;  2N7D A;  2DZM A;  2L7R A;  2IO1 B;  3ML8 A;  3VFK A;  3V62 A;  5CHF A;  2LZ6 A;  3ZRF A;  4MSM B;  2KHW B;  1IP9 A;  1YX6 B;  2IO0 B;  2KO3 A;  4MEL A;  2DZJ A;  4M8N A;  3N32 A;  2G3Q B;  3ZTC A;  4G11 A;  4G0N B;  2BWF A;  2DAJ A;  2N9E B;  3EFU A;  4JQW C;  2JUO A;  1E8Z A;  2AL6 A;  2K1F A;  4DXA B;  3DVN V;  3QIJ A;  5DPS A;  3A33 B;  4EEW A;  2GBJ A;  2LVP A;  3PGE A;  4DHJ D;  4W9E A;  4BKS A;  4GDL B;  1WY8 A;  2L3Z A;  3UGB B;  2D07 B;  2LRU A;  1EF5 A;  3VHT C;  2AWT A;  2FCS A;  4GGQ A;  3VUW A;  4ANX A;  3TIX A;  2IBI B;  1X1M A;  3L10 B;  1C3T A;  4MEM A;  3R7R A;  2KWC A;  2O6V B;  4DWF A;  2NCN A;  2L0F A;  2ZNV C;  2IZV B;  4DHZ E;  4E3C A;  4TV3 A;  2LVQ A;  2KC2 A;  2FCM A;  1E8W A;  4KSK C;  4WJO A;  3VDZ A;  4DHZ B;  4GSW A;  3V6C B;  2N1W A;  2PEA A;  3T8M A;  4GIV A;  1WX9 A;  2J0K A;  3TMP B;  4EFO A;  3R3M A;  2HE7 A;  3PZD A;  3IFW B;  3UQB A;  3GZN I;  3ZNG C;  3ALB A;  3UIN B;  1KM7 A;  4IWP A;  1RRB A;  1OGW A;  3V6E B;  4ANU A;  4FUL A;  2V4L A;  2LUE A;  3QWZ B;  1H4R A;  2CHZ A;  3DVG X;  4MJS A;  2ZCB A;  4BKT A;  3DVG Y;  2DAF A;  5KHO A;  1LFD A;  2N4F A;  4GN1 A;  2DYM A;  2LI5 A;  2KNB A;  4FJZ A;  3PRM B;  4W9J A;  4FHK A;  4XX5 A;  3O65 B;  1I35 A;  1SGH A;  4KVG B;  4NPN A;  5AZF A;  4HPL B;  1E8Y A;  2QHO A;  4P7I A;  3W1Y A;  3ZDM C;  2V1Y A;  3VQI A;  1Z2M A;  1E90 A;  2DHZ A;  2KJ6 A;  3NY5 A;  4F8C B;  3HIZ A;  4IUM B;  4MGK E;  4DHJ B;  1P9D U;  1F9J A;  4KIK B;  4A3O A;  1JRU A;  2M8S A;  2XK5 A;  3DOW A;  3SHQ A;  5AZG A;  2R2Q A;  2MA9 B;  2C7M B;  4BFR A;  2ZZP B;  2IYD B;  2HD5 B;  3L08 A;  3DQV A;  2CR5 A;  3DBH I;  4KSL C;  5CHW A;  2RD0 A;  4FN2 A;  3TCA A;  2LRW A;  4LDT B;  4HVB A;  1L7Y A;  2XBB C;  2KVR A;  4BKS D;  2KKC A;  2EMT A;  4IG7 B;  4ICU A;  2OOB B;  3H1U A;  3I3T B;  4HJK A;  2KFK A;  3RZW C;  2A5U A;  3QCA A;  2M17 A;  2RGF A;  1P3Q U;  1J0G A;  1WE7 A;  1WR6 E;  1WIA A;  3X23 A;  5LLI A;  2LGD A;  1QZE A;  3QA8 A;  3M95 A;  1ISN A;  2MX2 A;  4JGH B;  3RYT A;  2KOX A;  4TQ0 A;  4WJQ A;  3DVN U;  2DZI A;  3APD A;  3UIO B;  1WGG A;  4ZRI A;  1WM2 A;  2AEH A;  2KQS A;  4AJW A;  1WJ6 A;  4W9K A;  1GC7 A;  2MP2 B;  1LM8 B;  2K8H A;  3RUL A;  4MSQ B;  4NNJ B;  2M1M A;  2NBU A;  3A9K A;  3APC A;  2MBB B;  3HK0 A;  2KTR B;  3MTN B;  4HDQ A;  3JW0 X;  4M8M A;  1T0Y A;  3UF8 A;  3RZF A;  1WXM A;  3N3K B;  5DCN A;  1UZX B;  3BY4 B;  3WIM A;  2KDE B;  4K1R B;  4GB9 A;  4W9C A;  4NAW B;  5CTR C;  4CYE A;  3KUC B;  1MG8 A;  3VTV A;  3IVF A;  2YLM A;  1WI0 A;  3ZKJ C;  1XT9 B;  2JVC A;  2M4N A;  2GMI C;  1OEY A;  2GBM A;  4FJV B;  2YVC A;  4JL9 A;  3EEC A;  2KN5 A;  4ICV A;  4EZL A;  4I6L B;  3EHV A;  3ZTD A;  1V9J A;  3H7S A;  3S2A A;  5J17 A;  2N9P C;  3HM3 A;  1WX7 A;  3A1Q B;  3A9J A;  3OJ3 A;  3AUL A;  3M3J A;  3PRZ A;  2JWZ A;  3PV1 A;  2C60 A;  1U4A A;  2UYZ B;  3WAN A;  3EC8 A;  3DPD A;  4XC2 A;  3PS6 A;  3L54 A;  2DYB A;  3DBL I;  1GJZ A;  2EMS A;  2M0X A;  3U8Z A;  3ZIM A;  1Z5S B;  5J18 A;  3WAM A;  4RM9 A;  1C1Y B;  2BYV E;  1HE8 A;  2LAS A;  3PRP B;  2O2V B;  3ZLZ A;  1XD3 B;  4GMV A;  2I1K A;  1WGD A;  4HCP B;  1WGH A;  3JVZ X;  2MBH A;  4WWP A;  4BOS C;  3UIP B;  4WWN A;  1CMX B;  1KJT A;  4MDK E;  4MGI E;  1A5R A;  1S1Q B;  1UH6 A;  3QAR A;  2L8J A;  1RLF A;  2BYF A;  2KTF A;  2ZPN A;  1M94 A;  1YQB A;  3BIN A;  4GU2 A;  5L95 C;  3ZNI D;  4FA6 A;  2JRH A;  4IC7 B;  5G2N A;  4BKG A;  3QJZ A;  1S3S G;  3TJP A;  4J6I A;  4EZJ A;  1WJN A;  4LCD E;  4TQ1 A;  4IM0 A;  4FAD A;  1E5W A;  2JY6 A;  4GDL A;  4MH0 E;  5D2M B;  5DPW A;  1V81 A;  3NZS A;  4FJY A;  1OEY J;  2G4S A;  2KFJ A;  4K7U A;  4NY0 A;  4YL8 A;  2NBW B;  5GMV A;  3SU8 X;  1EO6 A;  3P2B A;  3L16 A;  3PVL A;  4KZ0 A;  3T9L A;  1VD2 A;  2KX0 A;  3JSV B;  2O6V A;  3L17 A;  4W9L A;  1D3Z A;  1TGZ B;  2Z0D B;  3QHT A;  1H8C A;  2IO3 B;  4GDK B;  2D10 A;  1GUA B;  2Y5B B;  4XZ4 A;  2BKR B;  2NS5 A;  3H9D A;  2IO2 B;  3IBE A;  4HPM B;  1YX5 B;  2BYE A;  1WYW B;  5E6O A;  5AEK B;  2A4Z A;  2CHX A;  4CO7 A;  3PHX B;  3PLV A;  4FHJ A;  4WJN A;  2N9X A;  3ZW3 A;  1TZ1 A;  3A4S C;  2UWQ A;  3DCG A;  2VRR B;  4HLE A;  3M63 B;  2KLG A;  4GOC A;  4KDI C;  2C7N B;  3VUX A;  1WMH B;  4DK5 A;  2BKF A;  2OJR A;  4LJO B;  4BBN F;  3VUY A;  5G55 A;  4TKN A;  1R4M I;  4BVU C;  2G45 B;  1YJ1 A;  4URK A;  1V5T A;  1AAR A;  1GNU A;  3Q3F A;  4ANW A;  4EOY A;  1NI2 A;  5IA7 A;  3PRE A;  1WJ4 A;  4WAA A;  3B08 A;  2NPT B;  3R66 C;  4NJ7 A;  3DBR I;  1OQY A;  1SIF A;  4G3X B;  3V60 A;  2KC1 A;  4MGZ E;  4IW0 A;  4NQL B;  1UBI A;  2KK8 A;  2LWP A;  2I1J A;  4NQK E;  4WQO B;  3WA0 A;  4ANV A;  4E74 A;  2MBQ A;  3ZRC A;  4PS8 A;  3CSF A;  1WE6 A;  3WAL A;  3VTW A;  3V61 A;  4KIK A;  1NDD A;  5EDS A;  2C5L C;  5IAA C;  4DDI D;  1G6J A;  3IG3 A;  2MSE D;  2KJR A;  1E7U A;  4M0W B;  3AI5 A;  4JIO U;  3QC8 B;  2WX1 A;  2AYO B;  1WFY A;  2JXX A;  3AU5 A;  1Q5W B;  2G4D B;  4K7W A;  4W9G A;  1J19 A;  4NJ6 A;  4B95 A;  3A4R A;  3W1S A;  3X0W A;  3KYC D;  3SDL C;  2NR2 A;  1V2Y A;  3ECI A;  3H7P B;  5E6P A;  4F7Z A;  3APF A;  5DPR A;  3AU4 A;  1VCB A;  2MCN B;  3WAO A;  4AWJ A;  4RM8 A;  2Z0E B;  5E6N A;  2KWV B;  1I42 A;  3ZNZ B;  3L0W B;  3DBS A;  3PTF C;  4G50 A;  2O6V D;  2K39 A;  2KZR A;  2PJH A;  5FR6 A;  1WXS A;  3H6N A;  2C9W B;  3QX1 A;  1ZKH A;  2PE9 A;  4AOF A;  2LVO A;  2MP2 A;  2IY1 B;  2ZNV B;  4KZC A;  3KUD B;  2FCN A;  5JHA A;  3TBL D;  4BBN C;  2FUH B;  3OJ4 B;  4EKU A;  3W1S C;  2DX5 B;  2KTR A;  1EUV B;  1UBQ A;  3QK0 A;  1EF1 A;  2L0T A;  2REX A;  4II3 B;  4EUT A;  2KMC A;  2KLC A;  4TUU A;  2XEW A;  4K81 A;  2K25 A;  4NAW A;  4A3P A;  3VVW B;  3KVF B;  2J0M A;  4IM3 A;  1BT0 A;  3OLM D;  1RAX A;  2IY0 B;  3M62 B;  1P0R A;  2BF8 B;  4EZK A;  2RSU A;  2HTH A;  3LDZ E;  3K9P B;  4W9D A;  3MJW A;  5JZE B;  3QAQ A;  3PT2 B;  2KJH B;  1YIW A;  3A1Q A;  4IM2 A;  4FLH A;  4HXD A;  4KV2 A;  1WM3 A;  4CHK A;  2MRP A;  1UD7 A;  4AP4 C;  4KDL B;  2WWZ A;  2LXA A;  4DBG A;  1FXT B;  1WGY A;  2MBE A;  4F1S A;  2B3A A;  5TR5 A;  2MBO A;  2ZCC A;  4PYZ A;  3IHP C;  4I6P A;  2FID A;  2KAN A;  2O2V A;  3R7Q A;  2KXJ A;  2MQJ A;  5HKH A;  2MW5 A;  4WWO A;  3ZVV A;  2KDB A;  2KQ7 A;  3NHE B;  3PPA A;  4W9F A;  1KLV A;  4ZRK A;  2JF5 A;  2PE6 B;  1PQS A;  1WXA A;  4K7S A;  5L83 A;  3HM6 X;  2DZK A;  2AL3 A;  3KW5 B;  4LDT D;  4MJS B;  1TTN A;  2ZEQ A;  2JZ3 B;  2GBK A;  5C23 A;  1UGM A;  1WRD B;  3PHW B;  1V86 A;  4MM3 A;  1TBE A;  3KH0 A;  2KDF B;  2N7E A;  4II2 B;  2V3S A;  1WF9 A;  2NVU I;  2CS4 A;  2LGY A;  5D7G A;  3UQA A;  1OTR B;  3DDC B;  1ZW7 A;  3ZUN A;  4PS3 A;  4PS7 A;  3CMM B;  2ZPY A;  3N30 A;  4N9F 4;  4ZYN A;  4X57 B;  2ZVN A;  4W9H A;  2JZZ A;  1WJU A;  2LXC A;  5LXI B;  2JT4 B;  1WXV A;  4AJY B;  3HHM A;  2XK5 B;  2KMA A;  2ZVO A;  3KUZ A;  4HCN B;  2L76 A;  3TL5 A;  1Q0W B;  3JSV A;  1R4N I;  2R2O A;  2GBN A;  4HK2 A;  3RT3 B;  3VH4 B;  3CST A;  4FBJ B;  2BGF A;  4BOZ B;  3JYU A;  1GG3 A;  2D11 A;  4GDK A;  3VXW A;  3K9O B;  3U30 A;  1P1A A;  1KOT A;  2JRI B;  4JLC A;  1J8C A;  2GOW A;  3ZNH B;  2RPQ A;  2K8C A;  1Q1O A;  2K6D B;  2JPH A;  2WX0 A;  2KFK B;  4OVU A;  2D2Q A;  2NBV B;  3ZO5 B;  1LXD A;  4IWO A;  1ZGU B;  2L05 A;  3B0A A;  1WH3 A;  2EKE C;  3NS8 A;  2DEN B;  3GOE A;  3KYD D;  3Q3J A;  4OVV A;  1YD8 U;  5JHB A;  5J2R A;  2KDI A;  2J7Q B;  2KX3 A;  2CU1 A;  3NZU A;  3RCZ A;  3QQ8 B;  3VAW A;  2WDT B;  3B1L X;  2KWU B;  3LJ3 A;  1Y8R C;  2HJ8 A;  3L13 A;  2PPH A;  2ZJD A;  3RD2 A;  1E7V A;  1WMH A;  3CF6 E;  2W9N A;  5CX3 A;  4ASW C;  4LJP B;  1P98 A;  2LD9 A;  3A9K B;  4ZRJ A;  2LJ5 A;  2RR9 A;  2DYO A;  4RMA A;  4HDO A;  5C1Z A;  3ML9 A;  2J0J A;  2FIF A;  3U7D A;  3VH3 B;  2BWE S;  2FAZ A;  4AUQ C;  1WGR A;  1IPG A;  2NPT A;  1V5O A;  5AZH A;  1V49 A;  1IYF A;  1RFA A;  2FCQ A;  4GXB A;  3ENE A;  1SE9 A;  1V80 A;  2LGX A;  5DPT A;  1WX8 A;  3VTU A;  1V6E A;  2ASQ A;  1WZ0 A;  4B9K A;  3A9J B;  4DDG D;  1XQQ A;  2C7H A;  3NOB A;  5JH5 C;  1WR1 A;  4ZDV A;  2D3G A;  1WZ3 A;  4PYU A;  5BO4 B;  2Z59 B;  2MLB A;  2L00 B;  3D32 A;  4MGY E;  2GBR A;  5D94 A;  2CKH B;  2K6Q A;  2N1V A;  2BPS A;  3OAW A;  3PLU A;  4I6N B;  3ZDT A;  5LXH A;  2WYQ A;  5D6J B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...