1WZ0A

Solution structure of human sumo-2 (smt3b), a ubiquitin-like protein
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
104
structure length
104
Chain Sequence
GSSGSSGMADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of Human SUMO-2 (SMT3B), a Ubiquitin-like Protein
rcsb
source organism Homo sapiens
molecule tags Structural genomics, unknown function
molecule keywords Ubiquitin-like protein SMT3B
total genus 12
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2005-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1wz0A01
1YQBA 3R7QA 4GDLA 3HIZA 4XZ4A 5AZHA 3AI5A 1J8CA 4EZKA 4BVUC 3KYDD 3L13A 4PS3A 2EMTA 4HDOA 3NZSA 2KDBA 2K8CA 1P9DU 4W9EA 1EF1A 3RT3B 3RCZA 1YJ1A 3M62B 3QAQA 2L0TA 4KDLB 1C3TA 2V3SA 4NNJB 3WIMA 4II3B 3PPAA 2BF8B 3H7PB 2LVQA 4FHKA 4OVVA 5LXIB 3OJ3A 4WWPA 3Q3FA 3QK0A 2K8HA 2MW5A 2BYEA 2JT4B 1WY8A 4MM3A 3AU4A 3IVFA 2KMCA 3TBLD 3A9KA 3QA8A 2JRIB 2KKCA 2XK5A 2JWZA 1WGGA 5D7GA 1WXVA 1V6EA 1V9JA 5J18A 1JRUA 5CHWA 3W1YA 1TBEA 3ZNID 3V6EB 1WF9A 2KJ6A 3A33B 4B6WA 4TKNA 2M8SA 1ZKHA 4MGKE 1WJNA 2JZ3B 4LDTB 3A4SC 2DZKA 2BGFA 1ISNA 2K1FA 2KX0A 2WX0A 3PSEB 3DBSA 3KUZA 1WYWB 3MJWA 2O2VA 4FN2A 4JIOU 4HJKA 5GMVA 3X0WA 2G45B 4ANVA 3A4RA 4B9KA 1Q1OA 1CMXB 2DZJA 1L2NA 4XC2A 2DZMA 2I1KA 4HK2A 4KIKA 2G3QB 3N3KB 3K9OB 4MSMB 4AOFA 1XT9B 4FJVB 3VVWB 1R4MI 4PS7A 2JPHA 4IW0A 3L0WB 2NCNA 3ZLZA 4W9GA 4F1SA 1WE6A 2YVCA 1ZW7A 3TIXA 2KXJA 4MDKE 2HTHA 3QWZB 5LXHA 1OEYA 2D10A 5C1ZA 2L8JA 4MH0E 3RUIB 5JHBA 1IYFA 4DHZB 1OTRB 1S1QB 2KWUB 2C7HA 5KHOA 4M8MA 3GOEA 3JVZX 3L10B 4EZJA 2BKFA 3R7RA 3VTWA 3HM3A 1U4AA 2LXAA 5C23A 4MJSB 1WMHB 3VH4B 2MBHA 3TL5A 5L83A 3PLVA 1UBQA 1H8CA 2WDTB 2Z59B 4X57B 3U30A 3ML9A 2LXCA 1LQBA 2ZCCA 3ZNHB 1P98A 3UQAA 4ZDVA 2DYMA 2LWPA 2D2QA 4MELA 2LRUA 2J7QB 4FBJB 4LJOB 2ZNVC 2FCMA 3L54A 2NBUA 4WWNA 3D32A 1YD8U 4G50A 5AZFA 2N1VA 2OJRA 1VCBA 2O6VB 4J6IA 3PLUA 4BBNC 3VFKA 4EOYA 1OGWA 2NBWB 2EMSA 3EC8A 1D3ZA 2KJHB 2KWCA 1RRBA 2MSED 2KQ7A 4F8CB 2ZVOA 4N9F4 3ZRFA 1NBFC 1Q0WB 2FIFA 2NPTA 2ZEQA 2M4NA 3PTFC 1WM2A 4GDLB 2NVUI 2KD0A 3EFUA 3VQIA 2CHXA 4IM0A 2PE9A 3HM6X 3GZNI 2CKHB 1WGDA 4FJZA 4ZRIA 1PQSA 2DHZA 2HJ8A 4TQ0A 1YIWA 3UIPB 3UF8A 2D3GA 2DYOA 3AULA 3VH3B 5JH5C 2FIDA 2IO2B 2M1MA 1P3QU 4G3XB 2N4FA 2CR5A 4KSLC 2NBVB 4DHJD 3RYTA 4BBNF 4FA6A 1T0YA 4GU2A 4MGZE 3L16A 2JVCA 4HPLB 4ICVA 4WJPA 2KK8A 2KLCA 4BFRA 4CO7A 3SHQA 1KJTA 1GUAB 1WJUA 3QQ8B 3DBLI 3R3MA 2LI5A 4RM8A 1NI2A 4WQOB 1TZ1A 3QIJA 3CSFA 5LLIA 2PEAA 2G4DB 2JRHA 3ZTCA 2MWSB 2FCNA 1WGRA 2GOWA 2C60A 4GDKB 3VUYA 1UELA 1KOTA 3EECA 1WMHA 2K39A 2L7RA 2MP2A 2V1YA 3A9JB 4DHZE 1EO6A 4EKUA 3KVFB 4NAWA 2IO3B 2XEWA 1OQYA 2A5UA 2M17A 3W1SA 5BO4B 5AEKB 1IP9A 4HDQA 4F7ZA 5D94A 4CYEA 2KO3A 1E8XA 2RPQA 1I35A 2VRRB 4IWPA 4P7IA 4W9CA 4AUQC 4FHJA 4EUTA 5G55A 2ZVNA 1WJ4A 2BYFA 3C0RB 1WX8A 3PS6A 4IG7B 2XBBC 3ML8A 1IPGA 2DAJA 4W9HA 2NPTB 2ZCBA 3ZDMC 3APDA 3QC8B 2R2OA 4ANWA 2LASA 1V49A 3UINB 3ALBA 2CU1A 2FCSA 3DCGA 2LRWA 1E7UA 3TCAA 2MBQA 2PE6B 3LDZE 2D11A 3HHMA 2BPSA 2ZNVB 2ZJDA 3KH0A 1A5RA 4E74A 2DYBA 1YX5B 3B08A 2MP2B 4LCDE 1E7VA 3APFA 3WAMA 3X23A 4W9LA 2JZZA 1ZGUB 1R4NI 1WRDB 2UYZB 3A9JA 2ZPNA 4MGYE 3VTUA 3WANA 3IFWB 3B0AA 4HCPB 2GBNA 5G2NA 5IAAC 3DVNU 3H6NA 2N9PC 3H1UA 2KHWB 4I6PA 2UWQA 3M63B 2KWVB 2MA9B 2IO0B 1V2YA 1QZEA 1E5WA 2J0KA 4KDIC 5D6JB 3A1QA 3NOBA 3SD5A 4W9KA 3TJPA 1LFDA 2BWES 5TR5A 1WR1A 4ZRJA 2KDEB 3NY5A 3T8MA 3WAOA 2KLGA 3ONSA 4NJ6A 4WAAA 4W9JA 1WX9A 5E6PA 2LD9A 2KTRB 4FJYA 4ANUA 3M95A 4LDTD 3L17A 3B1LX 3MTNB 3UIOB 3PT2B 2XK5B 3VHTC 1UD7A 1I42A 1WE7A 2KTFA 4W9IA 4PS8A 4E71A 3ZO5B 2NS5A 5CHVC 4RM9A 4EFOA 4AJWA 4HLEA 1WGYA 3DVNV 4MJSA 5E6OA 2BWFA 3PRZA 4JQWC 3PHXB 2PJHA 2K6DB 4AJYB 4HCNB 3UQBA 2N9EB 5J2RA 4HVBA 3JSVA 3PVLA 4CHKA 2LGXA 3P2BA 4DHJB 3V6CB 2FUHB 1AARA 2LGDA 2AEHA 1XQQA 1KM7A 2L0FA 3VUWA 2KC1A 1Z2MA 4GIVA 5IA7A 2MX2A 3JSVB 2KVRA 3WA0A 1G6JA 2JF5A 1EUVB 4G0NB 4A3PA 1NDDA 1WR6E 2K6QA 5JZEB 2K25A 4KZCA 2KFKA 4K7SA 3RD2A 5E6NA 4DBGA 2HE7A 4OVUA 4LJPB 5DPTA 1V5OA 3OJ4B 3NZUA 1GJZA 1UZXB 3DOWA 3ZDTA 1YX6B 2MBEA 1M94A 2N1WA 2KNBA 1X1MA 5J17A 2KQSA 2Z0DB 2RSUA 2JUOA 5FR6A 1P1AA 3KUCB 1V81A 2O6VA 4DWFA 4I6NB 1HE8A 4MSQB 1WZ3A 4ICUA 1V80A 3VXWA 4HPMB 3N30A 1XD3B 2KX3A 4BKGA 1E8WA 3RZWC 1H4RA 3O65B 2M0XA 5DPWA 3BINA 4JLCA 3APCA 3DPDA 1Y8RC 4BOZB 4HXDA 3KW5B 2CHZA 2V4LA 2FCQA 2FAZA 4IWOA 4TUUA 2AL6A 3EHVA 4JGHB 2YLMA 2LGYA 3QCAA 2HD5B 2KJRA 4B95A 3ZW3A 1L7YA 2KC2A 4GDKA 2W9NA 3JW0X 3I3TB 2N7DA 3VTVA 2J0MA 2IO1B 4GOCA 4NPNA 5AZGA 4I6LB 2B3AA 2O2VB 3ENEA 3SDLC 4FADA 1WM3A 3QHTA 4WJOA 1TGZB 3HK0A 3ZVVA 2KDFB 2KN5A 4K81A 4EZLA 2OOBB 1VD2A 2C5LC 2NR2A 2I1JA 3ZKJC 2LUEA 1SIFA 1BT0A 4GGQA 4BKSD 1KLVA 2JY6A 4KVGB 3U7DA 1WIAA 4NY0A 2AWTA 2CHWA 2RD0A 3ZNZB 5HKHA 2JXXA 3ZNGC 4RMAA 3AXCA 4IM3A 4WWOA 2KOXA 3A1QB 3NHEB 4G11A 2IYDB 3TMPB 3WALA 5CTRC 3ZIMA 2GBJA 1S3SG 3T9LA 4FLHA 5L95C 3K9PB 3ECIA 3DBHI 1WI0A 2N7EA 4IWQA 4BOSC 1UBIA 2MRPA 1WXSA 3SU8X 1UH6A 3CF6E 2QHOA 1J0GA 4XX5A 2LZ6A 4GN1A 2MBBB 4EEWA 1GG3A 2D07B 3PZDA 2K8BA 3RULA 2LVPA 1RLFA 3IHPC 3VUXA 3M3JA 2LVOA 2GBRA 2BYVE 2ASQA 2LJ5A 3H7SA 4JL9A 3Q3JA 1LM8B 2C7MB 1GC6A 1WJ6A 2C7NB 2L3ZA 3OLMD 3VAWA 5JHAA 3H9DA 1OEYJ 3DVGX 1SE9A 3RZFA 4IM2A 1Q5WB 1GNUA 4W9FA 3A9KB 2KFJA 4KV2A 3V62A 5D2MB 2WYQA 2KANA 1WXMA 1V86A 3QARA 2DZIA 3W1SC 4GB9A 1LXDA 3L08A 3BY4B 4KIKB 4K1RB 3DBRI 3ZUNA 4DDID 2GMIC 4GXBA 4GMVA 4GSWA 4II2B 3U8ZA 3UGBB 4ANXA 5EDSA 4WJNA 2PPHA 2WWZA 2Z0EB 3AU5A 1WGHA 4BKTA 2EKEC 5CHFA 3DQVA 2RR9A 1SGHA 3PRPB 2KMAA 3QX1A 1WH3A 3JYUA 3N32A 1F9JA 1EF5A 2KFKB 1J19A 3IG3A 1GC7A 1WZ0A 1WX7A 2CS4A 2ZPYA 2J0JA 3S2AA 2IZVB 4MEMA 4YL8A 4E3CA 4KSKC 2BKRB 4W9DA 3V60A 4ASWC 5KHQA 2REXA 4A3OA 4ZYNA 1Z5SB 3KUDB 3CSTA 3PV1A 1FXTB 3PRMB 4MGIE 5DPSA 3VDZA 1C1YB 1UGMA 4NJ7A 4M0WB 4AWJA 1RFAA 4TQ1A 2GBKA 4K7WA 3LJ3A 3ZRCA 2L00B 3PHWB 2GBMA 4FULA 2L05A 3CMMB 4BKSA 2R2QA 2MCNB 2RGFA 2KDIA 4IUMB 4ZRKA 2MLBA 2IY1B 1V5TA 3R66C 2A4ZA 1TTNA 2AYOB 2C9WB 4URKA 4DDGD 2MQJA 3V61A 4NQLB 2IY0B 3H7PA 3IBEA 4IC7B 4PYUA 1P0RA 3OAWA 2IBIB 1K8RB 5DPRA 1E90A 2DX5B 2AL3A 2FNJB 2N9XA 4DXAB 1E8ZA 2Y5BB 4NAWB 2G4SA 1WFYA 3QJZA 3PREA 3DVGY 5DCNA 4AP4C 4K7UA 5CX3A 4M8NA 2MBOA 2O6VD 2WX1A 4HWIB 2DAFA 2KZRA 2ZZPB 1WXAA 3DDCB 4NQKE 3KYCD 4WJQA 4TV3A 1E8YA 2DENB 4KZ0A 1RAXA 3ZTDA 4DK5A 3WAPA 1MG8A 4A20A 3MHSD 4PYZA 3PGEA 2L76A 2KTRA 3NS8A
chains in the Genus database with same CATH superfamily
2LMCA 2K5PA 3R7QA 2ZW1A 3KYDD 3L13A 1VR9A 4PS3A 4HEA1 2KDBA 2QC8A 2IGHA 4W9EA 5IP4D 3RCZA 3Q8BA 4NNJB 4RGNA 3H7PB 1YN3A 4OVVA 1L4ZB 3DWGC 4WWPA 3Q3FA 4OZAA 3MJ5A 1WY8A 3A9KA 3N9YC 3QA8A 3IXSA 2BS3B 4A90A 5D7GA 1WXVA 1V9JA 3U2SC 1TBEA 1WF9A 4TKNA 1NENB 2M8SA 4US8A 3N1YC 1E10A 2WX0A 3DBSA 1TT5B 2BW2A 3X0WA 4B9KA 3NS1A 4J3OD 4XC2A 1L2NA 4HK2A 2L83A 1E6EB 2G3QB 3K9OB 4MSMB 1J7CA 4FJVB 1R4MI 2JPHA 1C79A 2NCNA 4C4VA 4F1SA 2KACA 3KWLA 3TIXA 4M00A 3KQ4A 3MP9A 3DHGC 1OEYA 2K0PA 5C1ZA 3RUIB 5JHBA 4DHZB 3ZJVA 1EWYC 2C7HA 4EZJA 2BKFA 3VTWA 1C9FA 5C23A 1I4PA 3IAM1 1D5XC 1BUIC 1P7EA 4C80A 5L83A 1H8CA 3IAS1 3U30A 2LXCA 4QAYA 2ZCCA 3ZNHB 2BTEA 3AE8B 5HG2A 4WQMA 3N1ZC 1YQ4B 3L54A 1FMAD 1GAQB 3D32A 2OJRA 4J6IA 3OWEB 3PLUA 2EMSA 3EC8A 4C7ZA 3V3XA 1RRBA 1PYWD 2ZVOA 4N9F4 4ZRQA 4HKQA 3PTFC 5BMHA 2QIEB 1XO3A 4YTMB 3VQIA 4IM0A 3GZNI 2CKHB 3SFEB 1PQSA 3ZQ4A 3UF8A 3VH3B 5JH5C 1F77A 2WXHA 4KGSA 3RYTA 4RCOA 4FA6A 3MC8A 2G1EA 3MC0B 2D3BA 1OFFA 4WH4A 2LI5A 2WP9B 1DOIA 4P6VF 4MM3B 2G4DB 2JRHA 1MFWA 2MWSB 3ZTCA 1KOTA 1WMHA 1MPEA 2L7RA 1WRIA 1MVKA 2V1YA 1EO6A 4EKUA 4LTUA 4ZYSA 2A5UA 1E7PB 4RH6A 3BVZA 1T0SC 4HDQA 1V97A 5D94A 1E8XA 1I35A 2VRRB 3AE1B 4IWPA 4W9CA 4AUQC 4FHJA 4USAA 3AB5A 2BYFA 2PKOA 3C0RB 3PS6A 2XBBC 1IPGA 1KLGD 1T0QC 2INNE 4JWSC 1K53A 3QC8B 2E3TA 1JQ4A 1ZP0B 2MBQA 1E0ZA 3C19A 2VH2A 2FUG1 3X23A 1ZGUB 1R4NI 1FIQA 1N5XA 1WRDB 2UYZB 3VTUA 4MGYE 3IFWB 4HCPB 2Y5PA 5G2NA 3M63B 2KWVB 1V2YA 2LUMA 1NI3A 1WR1A 2KDEB 4Q2JA 2LD9A 1WWTA 2KTRB 5AUKA 4FJYA 2CU3A 2ZW0A 1SJHD 1I4QA 1TZOA 4RF0A 2XK5B 1QF6A 4PS8A 4D2KA 3ZO5B 4EFOA 4AJWA 3RPFC 1WGYA 3DVNV 4MJSA 1FXIA 1N61A 3PHXB 1JALA 2K6DB 5HHDG 4HCNB 1HEZE 5J2RA 4HVBA 4DHJB 4LK0M 3RNBC 1KFYB 1KM7A 3TEXA 2DBYA 1GOZA 2L0FA 3VUWA 3WA0A 1G6JA 1QOGA 1EUVB 1SB3C 4G0NB 3HUIA 1NDDA 2RDGA 2K25A 1YNTE 1F1HA 5E6NA 1IBXB 5DPTA 1GJZA 3Q69A 2MBEA 3DBRB 2N1WA 4HKZE 5J17A 2Z0DB 5FR6A 2H89B 2Q5WD 1P1AA 4MT5A 3U52E 1IBXA 4YTNB 1HE8A 4HPPA 1V80A 1XD3B 4BKGA 3PO0A 5DPWA 2ON8A 4JLCA 1SBBB 4BOZB 1PDXA 4HXDA 2XN9C 2CHZA 4IWOA 4TUUA 3EHVA 3IT4B 2YLMA 2LGYA 4RGTA 3QCAA 3ZW3A 2N7DA 4I6LB 2AQ3B 2B3AA 2LEKA 4RGMA 2KN5A 3HVDA 2NTTA 5BYSA 2WU5B 4EZLA 1IUEA 2NR2A 1UNSA 2CHWA 1YMHE 3AXCA 4YSXB 1R4MB 4IM3A 3B2GA 1PUTA 3BZDB 3NHEB 1S3SG 2GI9A 1WI0A 2N9KA 4P1CC 2MRPA 1I4XA 1UH6A 3CF6E 5BYQA 2W55A 4OVZA 3AN1A 3VUXA 3IHPC 3ZJTA 2J4XA 1GC6A 3VAWA 2MH7A 5JHAA 3DVGX 3AEAB 1SE9A 4IM2A 1Q5WB 1VZ7A 4W9FA 3WCQA 3E9SA 1MG4A 4ZHOA 2J42A 4YTPB 2DZIA 1C4PA 4GB9A 1LXDA 2UU7A 1L4DB 3ZUNA 1WSPA 2KWDA 4WJNA 1AW7A 1L0XB 2PPHA 3AU5A 1WGHA 2EKEC 1YJJA 3PRPB 1SGHA 3JYUA 3KWVA 2WDRB 4KSKC 2PW9A 4ASWC 3V60A 1MI0A 4TSSA 1VRAB 1MHHE 3CSTA 3PV1A 1C4AA 3VDZA 1C1YB 3TEZA 1RFAA 4EE2A 3OG5A 1YJIA 3ZRCA 2L00B 2L05A 1T0RC 1DOXA 2A4ZA 4URKA 3R2IA 4DDGD 1P0RA 3OAWA 1E90A 1HXYD 2FNJB 2WX1A 1TS4A 3DDCB 4WJQA 1K51A 2PIAA 2WXOA 2L76A 3TEYA 1XXGA 1RWSA 4GDLA 4XZ4A 5AZHA 3AI5A 3VRBB 2EMTA 3NZSA 2QCZA 1P9DU 4JPSA 3SEBA 1N63A 3M62B 1TY0A 2L0TA 3QAQA 4II3B 2ONQA 4RNAA 1C77A 3NRZA 3QK0A 4C00A 1RYJA 5HI1A 3AU4A 3TBLD 4WURA 2JRIB 5EE3A 2JWZA 1TS2A 4WIPA 4ITKA 1JRUA 5CHWA 1ZKHA 2JZ3B 5JXVA 3A4SC 2DZKA 2KX0A 1V8CA 1XLNA 4FN2A 4JIOU 4HJKA 5GMVA 4ANVA 1Q1OA 2I38A 2DZMA 2I1KA 5AUIA 3FILA 4B0EA 4AOFA 3VVWB 2WLBA 3L0WB 3ZLZA 1QT9A 2JZPA 2HTHA 3AEBB 1I4RA 5IKCM 2KWUB 4M8MA 5EE0A 2D3CA 4MJSB 1HTOA 4C56C 3TL5A 3PLVA 2INDC 1JW9D 4L1BA 3UQAA 1L6VA 4MELA 2LRUA 2NBUA 5AZFA 4BBNC 3VFKA 1QILA 2NBWB 2M0AA 2KJHB 2MSED 4F8CB 2FIFA 2ZEQA 1WM2A 3EFUA 2INCC 3RNFC 3AEDB 4ZRIA 2HJ8A 3UIPB 1NVID 2D3GA 3AULA 2WXIA 2IO2B 2N4FA 4KSLC 2INPE 5C2TB 2JVCA 3GE8C 4XYCA 2OJWA 1GUAB 3QQ8B 3MFGA 4RM8A 2WDVB 2Y3AA 1ZXHA 3Q3NC 3BYTB 1GB4A 1UELA 3EECA 2MP2A 3A9JB 3AEEB 1C76A 2IO3B 1N62A 2IGGA 3W1SA 5BO4B 5AEKB 1IP9A 2GLSA 3DHIC 1BXTA 1PFDA 2RPQA 4IKGA 3DBLB 5G55A 1WX8A 4US9A 3Q8EA 4IG7B 2V9HA 4LNFA 4YXDB 3ML8A 2KDMA 2NTSA 1YOVB 3APDA 2R2OA 4ANWA 3DCGA 4S17A 2LRWA 1E7UA 5EE1A 3LDZE 3HHMA 2ZNVB 3KH0A 2IPKD 2BT6A 1WYGA 1E7VA 3APFA 1DOYA 3B9JA 2EKIA 3A9JA 3WANA 2DLBA 2HDEA 3DVNU 2N9PC 3UI3A 2PVGC 2KVZA 2MA9B 3P4PB 1L5PA 1E5WA 5D6JB 3NOBA 3TJPA 1LFDA 3AM9A 3H8HA 2WXJA 1CZPA 2KLGA 2RPVA 4W9JA 1WX9A 4HRSA 4ANUA 3P63A 2YEPB 3FILB 3VR9B 3GB1A 3P42A 4LNKA 5IOIA 1I42A 4E71A 2N0SB 5CHVC 3BK2A 2AX5A 2ICIA 5E6OA 4WAFA 2BWFA 3TUOA 1FFUA 4JQWC 4PK1A 3ZJUA 3NJTA 4CHKA 3NVWA 2LGXA 3R2TA 3V6CB 3RNCC 2LGDA 2AEHA 1XQQA 3DWMA 1L6UA 2KQ4X 1Z2MA 2KVRA 2JF5A 2BQQA 5JZEB 4K7SA 3RD2A 4DBGA 1VDVA 1V5OA 3OJ4B 4OHJA 4LNOA 1UZXB 3SFDB 1YX6B 1X1MA 4BAXA 1SXTA 3KUCB 1B1ZA 1XF5L 1CK1A 1WZ3A 2KX3A 2PMVA 1E8WA 3RZWC 1H4RA 3RNEC 3APCA 1Y8RC 2V4LA 2FCQA 2FAZA 2W54A 2LHDA 3LYYA 2HD5B 4P1BC 4GDKA 1FFVA 3FKYA 3VTVA 3HRDD 2J0MA 2IO1B 2V3PA 3CWIA 5AZGA 2I2YA 2O2VB 4FADA 2WXGA 1TGZB 3ZVVA 1XCQL 1FM0D 4H2AA 4KKIA 1KRHA 4K81A 5IN7A 3ETRA 1WGKA 1KLUD 2OOBB 2C5LC 3RN9C 3ZKJC 2LUEA 1SIFA 4GGQA 2JY6A 4KVGB 1WIAA 5HKHA 3RMKC 4RMAA 1MHXA 2KOXA 3A1QB 3TMPB 3ZIMA 3DBHI 2N7EA 2BB6A 1UBIA 3SU8X 2QHOA 2JU6X 4EEWA 1ZPSA 1GG3A 3PZDA 3SR6A 4JL9A 3RZFA 4JE3B 3T3NA 4LLGM 2KFJA 1QOAA 5D2MB 2WYQA 1V86A 3QARA 3W1SC 4K1RB 4GMVA 4JWUC 4II2B 4ANXA 4BKTA 1HZ6A 4ZHPA 3RNGC 3QJZA 2KMAA 1F9JA 1J19A 1WZ0A 2ZPYA 3S2AA 2IZVB 4MEMA 3J9CA 5KHQA 1EU3A 2REXA 4ZYNA 3PRMB 2L52A 4M0WB 1ZUD2 2GBKA 2CJNA 5H8YE 4K7WA 3LJ3A 2IDYA 4DQOC 3PHWB 1VJKA 2GBMA 2MJDA 2MCNB 4IUMB 2IY1B 2MLBA 3R66C 1V5TA 3P1MA 3ZYYX 2SEBD 2IY0B 4PYUA 1HA5A 2IBIB 3NVYA 2WXPA 2DX5B 2GRIA 1E8ZA 1UF0A 5CX3A 4M8NA 2O6VD 2WNMA 4HWIB 4JX1C 2KZRA 4NQKE 3NZ3A 4S0RA 3KYCD 3TEWA 1JROA 4DK5A 3ZTDA 1MG8A 1QQRA 4N59A 4PYZA 1R7SA 3HIZA 1J8CA 1HTQA 4HDOA 3C8YA 1D5ZC 1T6BX 1EF1A 4XDDA 3RT3B 1ET6A 1YJ1A 2RDHA 4NAMA 4KDLB 4NJCA 2V3SA 2WXQA 2JSVX 2BF8B 1I7HA 5LXIB 2M56B 2JT4B 3IVFA 2KMCA 2KKCA 1DYQA 4MH8A 1WGGA 1JWMD 5FR3A 2QEJC 2AQ2B 1EU4A 3A33B 1AYFA 3LB8C 4MGKE 3HVZA 2BGFA 2K1FA 3T3OA 2OEDA 3KUZA 3AE7B 3MJWA 2G45B 2JQRB 3A4RA 1LGRA 2DZJA 2PLPA 1C4CA 1EWCA 2V4IB 1FO4A 1XT9B 2FBWB 1M4VA 2D3AA 1JCKB 4W9GA 1F2RI 1WE6A 1ZW7A 2KXJA 3QWZB 5LXHA 2D10A 1JWUD 4N6EB 2L8JA 1IYFA 3U7ZA 3ZGZA 5KHOA 3L10B 3IT6B 3HM3A 5I4DA 3ABVB 2L32A 3VH4B 2MBHA 1FNVA 2WDTB 3O13A 1LQBA 1P98A 2D2QA 3V05A 1V1OA 2J7QB 4M01A 4WWNA 4NZLB 2N1VA 4EOYA 3NVZA 4OZBA 2KWCA 4C7YA 4P16A 3ZRFA 1NBFC 1V1PA 2NPTA 1SIJA 2M4NA 2NVUI 2KD0A 3I57A 2K3UA 2W3RA 2PE9A 1WGDA 4FJZA 3MHZA 3AE3B 2DHZA 4TQ0A 1YIWA 2DYOA 5BMGA 4UDUC 1P3QU 4G3XB 1CQVA 2NBVB 3NVVA 4BBNF 4MGZE 1QOBA 2K9XA 4BFRA 1FCCC 4WQOB 1TZ1A 3QIJA 3CSFA 2KN4A 5LLIA 1WGRA 2GOWA 2C60A 4GDKB 2PVOD 5IO9A 2WXFA 4DHZE 3KVFB 2LHEA 2M17A 1HQRD 5FK9C 1JWSD 1QLBB 2MHJA 4CYEA 3BYYB 3EFCA 4P7IA 4EUTA 1HZ5A 2KAJA 2K22A 2QJLA 2DAJA 2NPTB 2E6XA 3ALBA 2CU1A 4HJGE 3RFZB 2V3NA 3TCAA 2WDQB 2D11A 2BPSA 2EELA 2DYBA 1YX5B 3B08A 2MP2B 3WAMA 2J52A 2JZZA 4LNNA 1FNUA 1E9MA 3Q8CA 2LJIA 2RDBC 2ZPNA 2GBNA 3H6NA 3AV8A 4I6PA 2UWQA 1ESFA 4KDIC 2J0KA 4DXFA 3A1QA 2R61A 5FKAC 3SD5A 1K52A 2BVCA 3GZNB 4O1NA 5TR5A 4HROA 3NY5A 3T8MA 3WAOA 2Z8LA 5E6PA 4XWTA 1WXQA 3M95A 4WWMA 3MTNB 3VHTC 1WE7A 2KTFA 4W9IA 4TMAB 1ZE3D 3VR8B 2PJHA 1F2RC 4AJYB 2JX5A 3BIID 3JSVA 3P2BA 2FUHB 5MPOA 1KTKA 5IA7A 2MX2A 4ACFA 4KX6B 4A3PA 2K6QA 4KZCA 2KFKA 2NMQA 2HJ1A 3W5VB 1J7BA 4OVUA 4LJPB 3NZUA 1ROEA 4OZCA 1XCTL 2WU2B 2KQSA 2RSUA 1FRRA 3N30A 3O65B 2M0XA 3AE5B 2BS2B 4M0WA 1OQRA 2AL6A 4JGHB 4RF1A 1L7YA 3JW0X 3I3TB 2V0GA 3ENEA 3SDLC 1WM3A 3LXFA 3QHTA 4WJOA 1SJED 2N9LA 2VZKD 1QOFA 4PT5A 1I4HA 1VD2A 2X38A 2I1JA 1BT0A 1TIFA 4NY0A 2AWTA 2RD0A 3E56A 3Q2AC 1ZDXA 5TSSA 3WALA 1IGCA 2IYDB 1ENFA 1TS3A 3K9PB 3ECIA 1ZDVA 3CIRB 2D5GA 2MBBB 2D07B 3Q3MC 2W82A 2K8BA 3RULA 1RLFA 1RFKA 2GBRA 2BYVE 2WXLA 4B0MA 3Q3JA 2GB1A 1LM8B 1WJ6A 1J7AA 1Y56A 1GNUA 2J53A 3A9KB 5BYRA 3Q6BA 3URYA 1WXMA 1Q10A 4RFBA 2QDFA 4DDID 4GXBA 2JYTA 1FD6A 3UGBB 3U8ZA 5EDSA 1JRPA 2Z0EB 5CHFA 2IGDA 3QX1A 3DQVA 2KFKB 1EF5A 4KGRA 1GC7A 1WX7A 2J0JA 4E3CA 3B2FA 5D3IB 2BBCA 4W9DA 3KLSX 4DXGA 1N60A 4A3OA 1Z5SB 2MEKA 4ARCA 4TQ1A 4FULA 3CMMB 3GP7A 1F0ZA 2IJ0A 2R2QA 2RGFA 2KDIA 4ZRKA 1TTNA 2AYOB 2C9WB 2AQ1B 1CJEA 3H7PA 3AEFB 1K8RB 1TJEA 3NUHB 1FNWA 1UWXA 2AL3A 4DXAB 4CQNA 2Y5BB 4NAWB 5DCNA 2G4SA 3DVGY 4AP4C 2MJEA 2MBOA 3I5JC 2DAFA 1WXAA 4TV3A 1E8YA 2DENB 2LGIA 1RAXA 4KZ0A 3WAPA 4A20A 3EUB2 3PVLA 3BVMA 1YQBA 2BYTA 3ZXVA 1OQQA 1GPXA 2N7JA 4EZKA 4BVUC 3AE2B 4YSYB 1JWAD 2K8CA 1SEBD 1VZ8A 1ZOYB 3P4QB 1C3TA 3WIMA 3PPAA 2LVQA 4FHKA 2WXMA 1TKEA 3OJ3A 2K8HA 3FC4A 2MW5A 3FAHA 1PGAA 2BYEA 4MM3A 4OW0A 3VRAB 2XK5A 3W9CB 3RI7C 4L2YA 1V6EA 1IGDA 1RM6C 5J18A 3W1YA 2MJ3A 3ZNID 3V6EB 2KJ6A 4B6WA 4YT0B 1WJNA 4LDTB 1ISNA 3PSEB 1KH0A 1WYWB 2SAKA 2O2VA 1CMXB 3BVGA 2XNAC 1FRDA 4KIKA 3N3KB 1R4NB 4PS7A 3NG0A 4IW0A 2WXNA 1FEHA 2YVCA 3N20C 2VZKB 2QMTA 4MDKE 4MH0E 4XGAB 1OTRB 4ZRPA 1S1QB 1UUPA 3EGRA 2B76B 3DHHC 3GOEA 3JVZX 3AH7A 2KMMA 3R7RA 1ZXIA 1T5XD 1U4AA 2LXAA 4A9AA 1WMHB 2G9HD 1UBQA 2Z59B 4X57B 3ML9A 3BWUD 5GXGB 4ZDVA 2DYMA 1XLPA 2LWPA 4FBJB 4LJOB 2ZNVC 2FCMA 4G50A 1YD8U 1D5MC 1VCBA 2O6VB 3GS2A 1N5WA 2CJOA 1OGWA 1D3ZA 5EE9A 2KQ7A 1D4BA 1Q0WB 5C3JB 1FCLA 4KGTA 2WQYB 4GDLB 2JXTA 2CHXA 3AE6B 3HM6X 1D6EC 2FIDA 2M1MA 3AMZA 2CR5A 5E6JA 4DHJD 5T8IA 1T0YA 4GU2A 3L16A 1L0YB 3DBHB 4REZA 4HPLB 4ICVA 4WJPA 1GB1A 2KK8A 1A70A 2KLCA 4CO7A 3SHQA 1KJTA 3AE9B 1WJUA 3R3MA 3DBLI 1NI2A 2YEPF 2PTLA 2PEAA 1NYQA 3U4EG 2FCNA 3VUYA 2K39A 3W2DA 1T3QA 1AN8A 4FXCA 1FXAA 2VH1A 1L0VB 1LO5D 4NAWA 2XEWA 1OQYA 1I4GA 4F7ZA 2KO3A 3R8BA 4N58A 4IOIE 2ZVNA 1WJ4A 1UGJA 3AECB 4M02A 3RNAC 4W9HA 2ZCBA 3ZDMC 2LASA 1V49A 3UINB 2FCSA 4R3DA 5HFYA 5D3DA 2PE6B 2ZJDA 1JWBD 1A5RA 1YN4A 4E74A 4AQ7A 4LCDE 4KKJA 4W9LA 1JMLA 4XWWA 1B9RA 4GLSC 2X8XX 3B0AA 5IAAC 3H1UA 2KHWB 1V1PB 2ACZB 2IO0B 1QZEA 4W9KA 2BWES 4A6QA 4ZRJA 1UWMA 3ONSA 4NJ6A 1ACCA 4WAAA 1VZ6A 3P4SB 4LDTD 1NYRA 3L17A 3B1LX 3UIOB 3PT2B 1UD7A 1VLBA 1XLOA 2OHFA 2JWUA 2NS5A 4MACA 3MC9A 1XLQA 3AE4B 4RM9A 3PZ8A 4HLEA 1TS5A 3ZXRA 3PRZA 2HTME 5G5HA 3UQBA 4IDIA 2N9EB 2KT7A 4AS1A 1SF0A 1AARA 4RGOS 1C78A 2JYEA 2KC1A 4GIVA 3JSVB 3W5UB 1TKGA 1WR6E 2HE7A 5H92C 2LGSA 2WS3B 3BK1A 3DOWA 3ZDTA 1BMLC 2TSSA 1M94A 2KNBA 2JUOA 4L23A 1PGBA 1TYGB 1V81A 2O6VA 4DWFA 4I6NB 4YWGG 4MSQB 2RMMA 4ICUA 3VXWA 4HPMB 1YN5A 3BINA 1SE3A 2FE8A 3DPDA 1QKZA 1FPYA 3KW5B 1AWDA 1PGXA 3Q8FA 1K50A 4B95A 2KJRA 2KC2A 2W9NA 2QILA 2M19A 4GOCA 4NPNA 3P4RB 2WXRA 3HK0A 3L4PA 2KDFB 3PZ7A 4YSZB 4C4VB 3AEGB 3Q8AA 2DNFA 4BKSD 1KLVA 3U7DA 2WGSA 3ZNZB 2JXXA 3ZNGC 2LFIA 4WWOA 4G11A 2KYWA 5CTRC 4K3BA 2GBJA 5LNK1 5L95C 3T9LA 2DWQA 4FLHA 5BMIA 1DGJA 4IWQA 4BOSC 1WXSA 1J0GA 1NEKB 4XX5A 2LZ6A 4GN1A 2LVPA 3M3JA 2LVOA 2WHIA 3H7SA 2ASQA 2LJ5A 2Y5CA 5G5GA 2C7NB 1XEEA 2C7MB 2L3ZA 3OLMD 3H9DA 1OEYJ 2WXKA 1SSNA 4LNIA 1TKYA 4KV2A 3V62A 2H88B 2KANA 2L1AA 1MJDA 1F52A 3L08A 1SE4A 3BY4B 4KIKB 4A55A 3DBRI 2GMIC 3GE3C 4GSWA 1STEA 2WWZA 1EM7A 2RR9A 4ARIA 1WH3A 3N32A 3IG3A 3TSSA 1SE2A 2CS4A 4YL8A 2BKRB 3I9V1 3KUDB 1P7FA 4MGIE 1FXTB 5DPSA 1UGMA 4NJ7A 4AWJA 1YQ3B 4BZAA 2BB5A 1TY2A 3N1XC 3I63C 4XDCA 4BKSA 3Q14C 4A8XC 2QSDA 3Q3OC 1ET9A 2MQJA 3V61A 4NQLB 3IBEA 4IC7B 5DPRA 4K3CA 1KF6B 2N9XA 2W3SA 1WFYA 3PREA 4K7UA 4ZOHC 1N6ZA 3EA6A 2ZZPB 2BS4B 4XE0A 3MHSD 3PGEA 2KTRA 3NS8A
chains in the Genus database with same CATH topology
1YQBA 3R7QA 4GDLA 3HIZA 4XZ4A 5AZHA 3AI5A 1J8CA 4EZKA 4BVUC 3KYDD 3L13A 4PS3A 2EMTA 4HDOA 3NZSA 2KDBA 2K8CA 1P9DU 4W9EA 1EF1A 3RT3B 3RCZA 1YJ1A 3M62B 3QAQA 2L0TA 4KDLB 1C3TA 2V3SA 4NNJB 3WIMA 4II3B 3PPAA 2BF8B 3H7PB 2LVQA 4FHKA 4OVVA 5LXIB 3OJ3A 4WWPA 3Q3FA 3QK0A 2K8HA 2MW5A 2BYEA 2JT4B 1WY8A 4MM3A 3AU4A 3IVFA 2KMCA 3TBLD 3A9KA 3QA8A 2JRIB 2KKCA 2XK5A 2JWZA 1WGGA 5D7GA 1WXVA 1V6EA 1V9JA 5J18A 1JRUA 5CHWA 3W1YA 1TBEA 3ZNID 3V6EB 1WF9A 2KJ6A 3A33B 4B6WA 4TKNA 2M8SA 1ZKHA 4MGKE 1WJNA 2JZ3B 4LDTB 3A4SC 2DZKA 2BGFA 1ISNA 2K1FA 2KX0A 2WX0A 3PSEB 3DBSA 3KUZA 1WYWB 3MJWA 2O2VA 4FN2A 4JIOU 4HJKA 5GMVA 3X0WA 2G45B 4ANVA 3A4RA 4B9KA 1Q1OA 1CMXB 2DZJA 1L2NA 4XC2A 2DZMA 2I1KA 4HK2A 4KIKA 2G3QB 3N3KB 3K9OB 4MSMB 4AOFA 1XT9B 4FJVB 3VVWB 1R4MI 4PS7A 2JPHA 4IW0A 3L0WB 2NCNA 3ZLZA 4W9GA 4F1SA 1WE6A 2YVCA 1ZW7A 3TIXA 2KXJA 4MDKE 2HTHA 3QWZB 5LXHA 1OEYA 2D10A 5C1ZA 2L8JA 4MH0E 3RUIB 5JHBA 1IYFA 4DHZB 1OTRB 1S1QB 2KWUB 2C7HA 5KHOA 4M8MA 3GOEA 3JVZX 3L10B 4EZJA 2BKFA 3R7RA 3VTWA 3HM3A 1U4AA 2LXAA 5C23A 4MJSB 1WMHB 3VH4B 2MBHA 3TL5A 5L83A 3PLVA 1UBQA 1H8CA 2WDTB 2Z59B 4X57B 3U30A 3ML9A 2LXCA 1LQBA 2ZCCA 3ZNHB 1P98A 3UQAA 4ZDVA 2DYMA 2LWPA 2D2QA 4MELA 2LRUA 2J7QB 4FBJB 4LJOB 2ZNVC 2FCMA 3L54A 2NBUA 4WWNA 3D32A 1YD8U 4G50A 5AZFA 2N1VA 2OJRA 1VCBA 2O6VB 4J6IA 3PLUA 4BBNC 3VFKA 4EOYA 1OGWA 2NBWB 2EMSA 3EC8A 1D3ZA 2KJHB 2KWCA 1RRBA 2MSED 2KQ7A 4F8CB 2ZVOA 4N9F4 3ZRFA 1NBFC 1Q0WB 2FIFA 2NPTA 2ZEQA 2M4NA 3PTFC 1WM2A 4GDLB 2NVUI 2KD0A 3EFUA 3VQIA 2CHXA 4IM0A 2PE9A 3HM6X 3GZNI 2CKHB 1WGDA 4FJZA 4ZRIA 1PQSA 2DHZA 2HJ8A 4TQ0A 1YIWA 3UIPB 3UF8A 2D3GA 2DYOA 3AULA 3VH3B 5JH5C 2FIDA 2IO2B 2M1MA 1P3QU 4G3XB 2N4FA 2CR5A 4KSLC 2NBVB 4DHJD 3RYTA 4BBNF 4FA6A 1T0YA 4GU2A 4MGZE 3L16A 2JVCA 4HPLB 4ICVA 4WJPA 2KK8A 2KLCA 4BFRA 4CO7A 3SHQA 1KJTA 1GUAB 1WJUA 3QQ8B 3DBLI 3R3MA 2LI5A 4RM8A 1NI2A 4WQOB 1TZ1A 3QIJA 3CSFA 5LLIA 2PEAA 2G4DB 2JRHA 3ZTCA 2MWSB 2FCNA 1WGRA 2GOWA 2C60A 4GDKB 3VUYA 1UELA 1KOTA 3EECA 1WMHA 2K39A 2L7RA 2MP2A 2V1YA 3A9JB 4DHZE 1EO6A 4EKUA 3KVFB 4NAWA 2IO3B 2XEWA 1OQYA 2A5UA 2M17A 3W1SA 5BO4B 5AEKB 1IP9A 4HDQA 4F7ZA 5D94A 4CYEA 2KO3A 1E8XA 2RPQA 1I35A 2VRRB 4IWPA 4P7IA 4W9CA 4AUQC 4FHJA 4EUTA 5G55A 2ZVNA 1WJ4A 2BYFA 3C0RB 1WX8A 3PS6A 4IG7B 2XBBC 3ML8A 1IPGA 2DAJA 4W9HA 2NPTB 2ZCBA 3ZDMC 3APDA 3QC8B 2R2OA 4ANWA 2LASA 1V49A 3UINB 3ALBA 2CU1A 2FCSA 3DCGA 2LRWA 1E7UA 3TCAA 2MBQA 2PE6B 3LDZE 2D11A 3HHMA 2BPSA 2ZNVB 2ZJDA 3KH0A 1A5RA 4E74A 2DYBA 1YX5B 3B08A 2MP2B 4LCDE 1E7VA 3APFA 3WAMA 3X23A 4W9LA 2JZZA 1ZGUB 1R4NI 1WRDB 2UYZB 3A9JA 2ZPNA 4MGYE 3VTUA 3WANA 3IFWB 3B0AA 4HCPB 2GBNA 5G2NA 5IAAC 3DVNU 3H6NA 2N9PC 3H1UA 2KHWB 4I6PA 2UWQA 3M63B 2KWVB 2MA9B 2IO0B 1V2YA 1QZEA 1E5WA 2J0KA 4KDIC 5D6JB 3A1QA 3NOBA 3SD5A 4W9KA 3TJPA 1LFDA 2BWES 5TR5A 1WR1A 4ZRJA 2KDEB 3NY5A 3T8MA 3WAOA 2KLGA 3ONSA 4NJ6A 4WAAA 4W9JA 1WX9A 5E6PA 2LD9A 2KTRB 4FJYA 4ANUA 3M95A 4LDTD 3L17A 3B1LX 3MTNB 3UIOB 3PT2B 2XK5B 3VHTC 1UD7A 1I42A 1WE7A 2KTFA 4W9IA 4PS8A 4E71A 3ZO5B 2NS5A 5CHVC 4RM9A 4EFOA 4AJWA 4HLEA 1WGYA 3DVNV 4MJSA 5E6OA 2BWFA 3PRZA 4JQWC 3PHXB 2PJHA 2K6DB 4AJYB 4HCNB 3UQBA 2N9EB 5J2RA 4HVBA 3JSVA 3PVLA 4CHKA 2LGXA 3P2BA 4DHJB 3V6CB 2FUHB 1AARA 2LGDA 2AEHA 1XQQA 1KM7A 2L0FA 3VUWA 2KC1A 1Z2MA 4GIVA 5IA7A 2MX2A 3JSVB 2KVRA 3WA0A 1G6JA 2JF5A 1EUVB 4G0NB 4A3PA 1NDDA 1WR6E 2K6QA 5JZEB 2K25A 4KZCA 2KFKA 4K7SA 3RD2A 5E6NA 4DBGA 2HE7A 4OVUA 4LJPB 5DPTA 1V5OA 3OJ4B 3NZUA 1GJZA 1UZXB 3DOWA 3ZDTA 1YX6B 2MBEA 1M94A 2N1WA 2KNBA 1X1MA 5J17A 2KQSA 2Z0DB 2RSUA 2JUOA 5FR6A 1P1AA 3KUCB 1V81A 2O6VA 4DWFA 4I6NB 1HE8A 4MSQB 1WZ3A 4ICUA 1V80A 3VXWA 4HPMB 3N30A 1XD3B 2KX3A 4BKGA 1E8WA 3RZWC 1H4RA 3O65B 2M0XA 5DPWA 3BINA 4JLCA 3APCA 3DPDA 1Y8RC 4BOZB 4HXDA 3KW5B 2CHZA 2V4LA 2FCQA 2FAZA 4IWOA 4TUUA 2AL6A 3EHVA 4JGHB 2YLMA 2LGYA 3QCAA 2HD5B 2KJRA 4B95A 3ZW3A 1L7YA 2KC2A 4GDKA 2W9NA 3JW0X 3I3TB 2N7DA 3VTVA 2J0MA 2IO1B 4GOCA 4NPNA 5AZGA 4I6LB 2B3AA 2O2VB 3ENEA 3SDLC 4FADA 1WM3A 3QHTA 4WJOA 1TGZB 3HK0A 3ZVVA 2KDFB 2KN5A 4K81A 4EZLA 2OOBB 1VD2A 2C5LC 2NR2A 2I1JA 3ZKJC 2LUEA 1SIFA 1BT0A 4GGQA 4BKSD 1KLVA 2JY6A 4KVGB 3U7DA 1WIAA 4NY0A 2AWTA 2CHWA 2RD0A 3ZNZB 5HKHA 2JXXA 3ZNGC 4RMAA 3AXCA 4IM3A 4WWOA 2KOXA 3A1QB 3NHEB 4G11A 2IYDB 3TMPB 3WALA 5CTRC 3ZIMA 2GBJA 1S3SG 3T9LA 4FLHA 5L95C 3K9PB 3ECIA 3DBHI 1WI0A 2N7EA 4IWQA 4BOSC 1UBIA 2MRPA 1WXSA 3SU8X 1UH6A 3CF6E 2QHOA 1J0GA 4XX5A 2LZ6A 4GN1A 2MBBB 4EEWA 1GG3A 2D07B 3PZDA 2K8BA 3RULA 2LVPA 1RLFA 3IHPC 3VUXA 3M3JA 2LVOA 2GBRA 2BYVE 2ASQA 2LJ5A 3H7SA 4JL9A 3Q3JA 1LM8B 2C7MB 1GC6A 1WJ6A 2C7NB 2L3ZA 3OLMD 3VAWA 5JHAA 3H9DA 1OEYJ 3DVGX 1SE9A 3RZFA 4IM2A 1Q5WB 1GNUA 4W9FA 3A9KB 2KFJA 4KV2A 3V62A 5D2MB 2WYQA 2KANA 1WXMA 1V86A 3QARA 2DZIA 3W1SC 4GB9A 1LXDA 3L08A 3BY4B 4KIKB 4K1RB 3DBRI 3ZUNA 4DDID 2GMIC 4GXBA 4GMVA 4GSWA 4II2B 3U8ZA 3UGBB 4ANXA 5EDSA 4WJNA 2PPHA 2WWZA 2Z0EB 3AU5A 1WGHA 4BKTA 2EKEC 5CHFA 3DQVA 2RR9A 1SGHA 3PRPB 2KMAA 3QX1A 1WH3A 3JYUA 3N32A 1F9JA 1EF5A 2KFKB 1J19A 3IG3A 1GC7A 1WZ0A 1WX7A 2CS4A 2ZPYA 2J0JA 3S2AA 2IZVB 4MEMA 4YL8A 4E3CA 4KSKC 2BKRB 4W9DA 3V60A 4ASWC 5KHQA 2REXA 4A3OA 4ZYNA 1Z5SB 3KUDB 3CSTA 3PV1A 1FXTB 3PRMB 4MGIE 5DPSA 3VDZA 1C1YB 1UGMA 4NJ7A 4M0WB 4AWJA 1RFAA 4TQ1A 2GBKA 4K7WA 3LJ3A 3ZRCA 2L00B 3PHWB 2GBMA 4FULA 2L05A 3CMMB 4BKSA 2R2QA 2MCNB 2RGFA 2KDIA 4IUMB 4ZRKA 2MLBA 2IY1B 1V5TA 3R66C 2A4ZA 1TTNA 2AYOB 2C9WB 4URKA 4DDGD 2MQJA 3V61A 4NQLB 2IY0B 3H7PA 3IBEA 4IC7B 4PYUA 1P0RA 3OAWA 2IBIB 1K8RB 5DPRA 1E90A 2DX5B 2AL3A 2FNJB 2N9XA 4DXAB 1E8ZA 2Y5BB 4NAWB 2G4SA 1WFYA 3QJZA 3PREA 3DVGY 5DCNA 4AP4C 4K7UA 5CX3A 4M8NA 2MBOA 2O6VD 2WX1A 4HWIB 2DAFA 2KZRA 2ZZPB 1WXAA 3DDCB 4NQKE 3KYCD 4WJQA 4TV3A 1E8YA 2DENB 4KZ0A 1RAXA 3ZTDA 4DK5A 3WAPA 1MG8A 4A20A 3MHSD 4PYZA 3PGEA 2L76A 2KTRA 3NS8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YQB A;  3R7Q A;  4GDL A;  3HIZ A;  4XZ4 A;  5AZH A;  3AI5 A;  1J8C A;  4EZK A;  4BVU C;  3KYD D;  3L13 A;  4PS3 A;  2EMT A;  4HDO A;  3NZS A;  2KDB A;  2K8C A;  1P9D U;  4W9E A;  1EF1 A;  3RT3 B;  3RCZ A;  1YJ1 A;  3M62 B;  3QAQ A;  2L0T A;  4KDL B;  1C3T A;  2V3S A;  4NNJ B;  3WIM A;  4II3 B;  3PPA A;  2BF8 B;  3H7P B;  2LVQ A;  4FHK A;  4OVV A;  5LXI B;  3OJ3 A;  4WWP A;  3Q3F A;  3QK0 A;  2K8H A;  2MW5 A;  2BYE A;  2JT4 B;  1WY8 A;  4MM3 A;  3AU4 A;  3IVF A;  2KMC A;  3TBL D;  3A9K A;  3QA8 A;  2JRI B;  2KKC A;  2XK5 A;  2JWZ A;  1WGG A;  5D7G A;  1WXV A;  1V6E A;  1V9J A;  5J18 A;  1JRU A;  5CHW A;  3W1Y A;  1TBE A;  3ZNI D;  3V6E B;  1WF9 A;  2KJ6 A;  3A33 B;  4B6W A;  4TKN A;  2M8S A;  1ZKH A;  4MGK E;  1WJN A;  2JZ3 B;  4LDT B;  3A4S C;  2DZK A;  2BGF A;  1ISN A;  2K1F A;  2KX0 A;  2WX0 A;  3PSE B;  3DBS A;  3KUZ A;  1WYW B;  3MJW A;  2O2V A;  4FN2 A;  4JIO U;  4HJK A;  5GMV A;  3X0W A;  2G45 B;  4ANV A;  3A4R A;  4B9K A;  1Q1O A;  1CMX B;  2DZJ A;  1L2N A;  4XC2 A;  2DZM A;  2I1K A;  4HK2 A;  4KIK A;  2G3Q B;  3N3K B;  3K9O B;  4MSM B;  4AOF A;  1XT9 B;  4FJV B;  3VVW B;  1R4M I;  4PS7 A;  2JPH A;  4IW0 A;  3L0W B;  2NCN A;  3ZLZ A;  4W9G A;  4F1S A;  1WE6 A;  2YVC A;  1ZW7 A;  3TIX A;  2KXJ A;  4MDK E;  2HTH A;  3QWZ B;  5LXH A;  1OEY A;  2D10 A;  5C1Z A;  2L8J A;  4MH0 E;  3RUI B;  5JHB A;  1IYF A;  4DHZ B;  1OTR B;  1S1Q B;  2KWU B;  2C7H A;  5KHO A;  4M8M A;  3GOE A;  3JVZ X;  3L10 B;  4EZJ A;  2BKF A;  3R7R A;  3VTW A;  3HM3 A;  1U4A A;  2LXA A;  5C23 A;  4MJS B;  1WMH B;  3VH4 B;  2MBH A;  3TL5 A;  5L83 A;  3PLV A;  1UBQ A;  1H8C A;  2WDT B;  2Z59 B;  4X57 B;  3U30 A;  3ML9 A;  2LXC A;  1LQB A;  2ZCC A;  3ZNH B;  1P98 A;  3UQA A;  4ZDV A;  2DYM A;  2LWP A;  2D2Q A;  4MEL A;  2LRU A;  2J7Q B;  4FBJ B;  4LJO B;  2ZNV C;  2FCM A;  3L54 A;  2NBU A;  4WWN A;  3D32 A;  1YD8 U;  4G50 A;  5AZF A;  2N1V A;  2OJR A;  1VCB A;  2O6V B;  4J6I A;  3PLU A;  4BBN C;  3VFK A;  4EOY A;  1OGW A;  2NBW B;  2EMS A;  3EC8 A;  1D3Z A;  2KJH B;  2KWC A;  1RRB A;  2MSE D;  2KQ7 A;  4F8C B;  2ZVO A;  4N9F 4;  3ZRF A;  1NBF C;  1Q0W B;  2FIF A;  2NPT A;  2ZEQ A;  2M4N A;  3PTF C;  1WM2 A;  4GDL B;  2NVU I;  2KD0 A;  3EFU A;  3VQI A;  2CHX A;  4IM0 A;  2PE9 A;  3HM6 X;  3GZN I;  2CKH B;  1WGD A;  4FJZ A;  4ZRI A;  1PQS A;  2DHZ A;  2HJ8 A;  4TQ0 A;  1YIW A;  3UIP B;  3UF8 A;  2D3G A;  2DYO A;  3AUL A;  3VH3 B;  5JH5 C;  2FID A;  2IO2 B;  2M1M A;  1P3Q U;  4G3X B;  2N4F A;  2CR5 A;  4KSL C;  2NBV B;  4DHJ D;  3RYT A;  4BBN F;  4FA6 A;  1T0Y A;  4GU2 A;  4MGZ E;  3L16 A;  2JVC A;  4HPL B;  4ICV A;  4WJP A;  2KK8 A;  2KLC A;  4BFR A;  4CO7 A;  3SHQ A;  1KJT A;  1GUA B;  1WJU A;  3QQ8 B;  3DBL I;  3R3M A;  2LI5 A;  4RM8 A;  1NI2 A;  4WQO B;  1TZ1 A;  3QIJ A;  3CSF A;  5LLI A;  2PEA A;  2G4D B;  2JRH A;  3ZTC A;  2MWS B;  2FCN A;  1WGR A;  2GOW A;  2C60 A;  4GDK B;  3VUY A;  1UEL A;  1KOT A;  3EEC A;  1WMH A;  2K39 A;  2L7R A;  2MP2 A;  2V1Y A;  3A9J B;  4DHZ E;  1EO6 A;  4EKU A;  3KVF B;  4NAW A;  2IO3 B;  2XEW A;  1OQY A;  2A5U A;  2M17 A;  3W1S A;  5BO4 B;  5AEK B;  1IP9 A;  4HDQ A;  4F7Z A;  5D94 A;  4CYE A;  2KO3 A;  1E8X A;  2RPQ A;  1I35 A;  2VRR B;  4IWP A;  4P7I A;  4W9C A;  4AUQ C;  4FHJ A;  4EUT A;  5G55 A;  2ZVN A;  1WJ4 A;  2BYF A;  3C0R B;  1WX8 A;  3PS6 A;  4IG7 B;  2XBB C;  3ML8 A;  1IPG A;  2DAJ A;  4W9H A;  2NPT B;  2ZCB A;  3ZDM C;  3APD A;  3QC8 B;  2R2O A;  4ANW A;  2LAS A;  1V49 A;  3UIN B;  3ALB A;  2CU1 A;  2FCS A;  3DCG A;  2LRW A;  1E7U A;  3TCA A;  2MBQ A;  2PE6 B;  3LDZ E;  2D11 A;  3HHM A;  2BPS A;  2ZNV B;  2ZJD A;  3KH0 A;  1A5R A;  4E74 A;  2DYB A;  1YX5 B;  3B08 A;  2MP2 B;  4LCD E;  1E7V A;  3APF A;  3WAM A;  3X23 A;  4W9L A;  2JZZ A;  1ZGU B;  1R4N I;  1WRD B;  2UYZ B;  3A9J A;  2ZPN A;  4MGY E;  3VTU A;  3WAN A;  3IFW B;  3B0A A;  4HCP B;  2GBN A;  5G2N A;  5IAA C;  3DVN U;  3H6N A;  2N9P C;  3H1U A;  2KHW B;  4I6P A;  2UWQ A;  3M63 B;  2KWV B;  2MA9 B;  2IO0 B;  1V2Y A;  1QZE A;  1E5W A;  2J0K A;  4KDI C;  5D6J B;  3A1Q A;  3NOB A;  3SD5 A;  4W9K A;  3TJP A;  1LFD A;  2BWE S;  5TR5 A;  1WR1 A;  4ZRJ A;  2KDE B;  3NY5 A;  3T8M A;  3WAO A;  2KLG A;  3ONS A;  4NJ6 A;  4WAA A;  4W9J A;  1WX9 A;  5E6P A;  2LD9 A;  2KTR B;  4FJY A;  4ANU A;  3M95 A;  4LDT D;  3L17 A;  3B1L X;  3MTN B;  3UIO B;  3PT2 B;  2XK5 B;  3VHT C;  1UD7 A;  1I42 A;  1WE7 A;  2KTF A;  4W9I A;  4PS8 A;  4E71 A;  3ZO5 B;  2NS5 A;  5CHV C;  4RM9 A;  4EFO A;  4AJW A;  4HLE A;  1WGY A;  3DVN V;  4MJS A;  5E6O A;  2BWF A;  3PRZ A;  4JQW C;  3PHX B;  2PJH A;  2K6D B;  4AJY B;  4HCN B;  3UQB A;  2N9E B;  5J2R A;  4HVB A;  3JSV A;  3PVL A;  4CHK A;  2LGX A;  3P2B A;  4DHJ B;  3V6C B;  2FUH B;  1AAR A;  2LGD A;  2AEH A;  1XQQ A;  1KM7 A;  2L0F A;  3VUW A;  2KC1 A;  1Z2M A;  4GIV A;  5IA7 A;  2MX2 A;  3JSV B;  2KVR A;  3WA0 A;  1G6J A;  2JF5 A;  1EUV B;  4G0N B;  4A3P A;  1NDD A;  1WR6 E;  2K6Q A;  5JZE B;  2K25 A;  4KZC A;  2KFK A;  4K7S A;  3RD2 A;  5E6N A;  4DBG A;  2HE7 A;  4OVU A;  4LJP B;  5DPT A;  1V5O A;  3OJ4 B;  3NZU A;  1GJZ A;  1UZX B;  3DOW A;  3ZDT A;  1YX6 B;  2MBE A;  1M94 A;  2N1W A;  2KNB A;  1X1M A;  5J17 A;  2KQS A;  2Z0D B;  2RSU A;  2JUO A;  5FR6 A;  1P1A A;  3KUC B;  1V81 A;  2O6V A;  4DWF A;  4I6N B;  1HE8 A;  4MSQ B;  1WZ3 A;  4ICU A;  1V80 A;  3VXW A;  4HPM B;  3N30 A;  1XD3 B;  2KX3 A;  4BKG A;  1E8W A;  3RZW C;  1H4R A;  3O65 B;  2M0X A;  5DPW A;  3BIN A;  4JLC A;  3APC A;  3DPD A;  1Y8R C;  4BOZ B;  4HXD A;  3KW5 B;  2CHZ A;  2V4L A;  2FCQ A;  2FAZ A;  4IWO A;  4TUU A;  2AL6 A;  3EHV A;  4JGH B;  2YLM A;  2LGY A;  3QCA A;  2HD5 B;  2KJR A;  4B95 A;  3ZW3 A;  1L7Y A;  2KC2 A;  4GDK A;  2W9N A;  3JW0 X;  3I3T B;  2N7D A;  3VTV A;  2J0M A;  2IO1 B;  4GOC A;  4NPN A;  5AZG A;  4I6L B;  2B3A A;  2O2V B;  3ENE A;  3SDL C;  4FAD A;  1WM3 A;  3QHT A;  4WJO A;  1TGZ B;  3HK0 A;  3ZVV A;  2KDF B;  2KN5 A;  4K81 A;  4EZL A;  2OOB B;  1VD2 A;  2C5L C;  2NR2 A;  2I1J A;  3ZKJ C;  2LUE A;  1SIF A;  1BT0 A;  4GGQ A;  4BKS D;  1KLV A;  2JY6 A;  4KVG B;  3U7D A;  1WIA A;  4NY0 A;  2AWT A;  2CHW A;  2RD0 A;  3ZNZ B;  5HKH A;  2JXX A;  3ZNG C;  4RMA A;  3AXC A;  4IM3 A;  4WWO A;  2KOX A;  3A1Q B;  3NHE B;  4G11 A;  2IYD B;  3TMP B;  3WAL A;  5CTR C;  3ZIM A;  2GBJ A;  1S3S G;  3T9L A;  4FLH A;  5L95 C;  3K9P B;  3ECI A;  3DBH I;  1WI0 A;  2N7E A;  4IWQ A;  4BOS C;  1UBI A;  2MRP A;  1WXS A;  3SU8 X;  1UH6 A;  3CF6 E;  2QHO A;  1J0G A;  4XX5 A;  2LZ6 A;  4GN1 A;  2MBB B;  4EEW A;  1GG3 A;  2D07 B;  3PZD A;  2K8B A;  3RUL A;  2LVP A;  1RLF A;  3IHP C;  3VUX A;  3M3J A;  2LVO A;  2GBR A;  2BYV E;  2ASQ A;  2LJ5 A;  3H7S A;  4JL9 A;  3Q3J A;  1LM8 B;  2C7M B;  1GC6 A;  1WJ6 A;  2C7N B;  2L3Z A;  3OLM D;  3VAW A;  5JHA A;  3H9D A;  1OEY J;  3DVG X;  1SE9 A;  3RZF A;  4IM2 A;  1Q5W B;  1GNU A;  4W9F A;  3A9K B;  2KFJ A;  4KV2 A;  3V62 A;  5D2M B;  2WYQ A;  2KAN A;  1WXM A;  1V86 A;  3QAR A;  2DZI A;  3W1S C;  4GB9 A;  1LXD A;  3L08 A;  3BY4 B;  4KIK B;  4K1R B;  3DBR I;  3ZUN A;  4DDI D;  2GMI C;  4GXB A;  4GMV A;  4GSW A;  4II2 B;  3U8Z A;  3UGB B;  4ANX A;  5EDS A;  4WJN A;  2PPH A;  2WWZ A;  2Z0E B;  3AU5 A;  1WGH A;  4BKT A;  2EKE C;  5CHF A;  3DQV A;  2RR9 A;  1SGH A;  3PRP B;  2KMA A;  3QX1 A;  1WH3 A;  3JYU A;  3N32 A;  1F9J A;  1EF5 A;  2KFK B;  1J19 A;  3IG3 A;  1GC7 A;  1WZ0 A;  1WX7 A;  2CS4 A;  2ZPY A;  2J0J A;  3S2A A;  2IZV B;  4MEM A;  4YL8 A;  4E3C A;  4KSK C;  2BKR B;  4W9D A;  3V60 A;  4ASW C;  5KHQ A;  2REX A;  4A3O A;  4ZYN A;  1Z5S B;  3KUD B;  3CST A;  3PV1 A;  1FXT B;  3PRM B;  4MGI E;  5DPS A;  3VDZ A;  1C1Y B;  1UGM A;  4NJ7 A;  4M0W B;  4AWJ A;  1RFA A;  4TQ1 A;  2GBK A;  4K7W A;  3LJ3 A;  3ZRC A;  2L00 B;  3PHW B;  2GBM A;  4FUL A;  2L05 A;  3CMM B;  4BKS A;  2R2Q A;  2MCN B;  2RGF A;  2KDI A;  4IUM B;  4ZRK A;  2MLB A;  2IY1 B;  1V5T A;  3R66 C;  2A4Z A;  1TTN A;  2AYO B;  2C9W B;  4URK A;  4DDG D;  2MQJ A;  3V61 A;  4NQL B;  2IY0 B;  3H7P A;  3IBE A;  4IC7 B;  4PYU A;  1P0R A;  3OAW A;  2IBI B;  1K8R B;  5DPR A;  1E90 A;  2DX5 B;  2AL3 A;  2FNJ B;  2N9X A;  4DXA B;  1E8Z A;  2Y5B B;  4NAW B;  2G4S A;  1WFY A;  3QJZ A;  3PRE A;  3DVG Y;  5DCN A;  4AP4 C;  4K7U A;  5CX3 A;  4M8N A;  2MBO A;  2O6V D;  2WX1 A;  4HWI B;  2DAF A;  2KZR A;  2ZZP B;  1WXA A;  3DDC B;  4NQK E;  3KYC D;  4WJQ A;  4TV3 A;  1E8Y A;  2DEN B;  4KZ0 A;  1RAX A;  3ZTD A;  4DK5 A;  3WAP A;  1MG8 A;  4A20 A;  3MHS D;  4PYZ A;  3PGE A;  2L76 A;  2KTR A;  3NS8 A; 
#chains in the Genus database with same CATH topology
 2LMC A;  2K5P A;  3R7Q A;  2ZW1 A;  3KYD D;  3L13 A;  1VR9 A;  4PS3 A;  4HEA 1;  2KDB A;  2QC8 A;  2IGH A;  4W9E A;  5IP4 D;  3RCZ A;  3Q8B A;  4NNJ B;  4RGN A;  3H7P B;  1YN3 A;  4OVV A;  1L4Z B;  3DWG C;  4WWP A;  3Q3F A;  4OZA A;  3MJ5 A;  1WY8 A;  3A9K A;  3N9Y C;  3QA8 A;  3IXS A;  2BS3 B;  4A90 A;  5D7G A;  1WXV A;  1V9J A;  3U2S C;  1TBE A;  1WF9 A;  4TKN A;  1NEN B;  2M8S A;  4US8 A;  3N1Y C;  1E10 A;  2WX0 A;  3DBS A;  1TT5 B;  2BW2 A;  3X0W A;  4B9K A;  3NS1 A;  4J3O D;  4XC2 A;  1L2N A;  4HK2 A;  2L83 A;  1E6E B;  2G3Q B;  3K9O B;  4MSM B;  1J7C A;  4FJV B;  1R4M I;  2JPH A;  1C79 A;  2NCN A;  4C4V A;  4F1S A;  2KAC A;  3KWL A;  3TIX A;  4M00 A;  3KQ4 A;  3MP9 A;  3DHG C;  1OEY A;  2K0P A;  5C1Z A;  3RUI B;  5JHB A;  4DHZ B;  3ZJV A;  1EWY C;  2C7H A;  4EZJ A;  2BKF A;  3VTW A;  1C9F A;  5C23 A;  1I4P A;  3IAM 1;  1D5X C;  1BUI C;  1P7E A;  4C80 A;  5L83 A;  1H8C A;  3IAS 1;  3U30 A;  2LXC A;  4QAY A;  2ZCC A;  3ZNH B;  2BTE A;  3AE8 B;  5HG2 A;  4WQM A;  3N1Z C;  1YQ4 B;  3L54 A;  1FMA D;  1GAQ B;  3D32 A;  2OJR A;  4J6I A;  3OWE B;  3PLU A;  2EMS A;  3EC8 A;  4C7Z A;  3V3X A;  1RRB A;  1PYW D;  2ZVO A;  4N9F 4;  4ZRQ A;  4HKQ A;  3PTF C;  5BMH A;  2QIE B;  1XO3 A;  4YTM B;  3VQI A;  4IM0 A;  3GZN I;  2CKH B;  3SFE B;  1PQS A;  3ZQ4 A;  3UF8 A;  3VH3 B;  5JH5 C;  1F77 A;  2WXH A;  4KGS A;  3RYT A;  4RCO A;  4FA6 A;  3MC8 A;  2G1E A;  3MC0 B;  2D3B A;  1OFF A;  4WH4 A;  2LI5 A;  2WP9 B;  1DOI A;  4P6V F;  4MM3 B;  2G4D B;  2JRH A;  1MFW A;  2MWS B;  3ZTC A;  1KOT A;  1WMH A;  1MPE A;  2L7R A;  1WRI A;  1MVK A;  2V1Y A;  1EO6 A;  4EKU A;  4LTU A;  4ZYS A;  2A5U A;  1E7P B;  4RH6 A;  3BVZ A;  1T0S C;  4HDQ A;  1V97 A;  5D94 A;  1E8X A;  1I35 A;  2VRR B;  3AE1 B;  4IWP A;  4W9C A;  4AUQ C;  4FHJ A;  4USA A;  3AB5 A;  2BYF A;  2PKO A;  3C0R B;  3PS6 A;  2XBB C;  1IPG A;  1KLG D;  1T0Q C;  2INN E;  4JWS C;  1K53 A;  3QC8 B;  2E3T A;  1JQ4 A;  1ZP0 B;  2MBQ A;  1E0Z A;  3C19 A;  2VH2 A;  2FUG 1;  3X23 A;  1ZGU B;  1R4N I;  1FIQ A;  1N5X A;  1WRD B;  2UYZ B;  3VTU A;  4MGY E;  3IFW B;  4HCP B;  2Y5P A;  5G2N A;  3M63 B;  2KWV B;  1V2Y A;  2LUM A;  1NI3 A;  1WR1 A;  2KDE B;  4Q2J A;  2LD9 A;  1WWT A;  2KTR B;  5AUK A;  4FJY A;  2CU3 A;  2ZW0 A;  1SJH D;  1I4Q A;  1TZO A;  4RF0 A;  2XK5 B;  1QF6 A;  4PS8 A;  4D2K A;  3ZO5 B;  4EFO A;  4AJW A;  3RPF C;  1WGY A;  3DVN V;  4MJS A;  1FXI A;  1N61 A;  3PHX B;  1JAL A;  2K6D B;  5HHD G;  4HCN B;  1HEZ E;  5J2R A;  4HVB A;  4DHJ B;  4LK0 M;  3RNB C;  1KFY B;  1KM7 A;  3TEX A;  2DBY A;  1GOZ A;  2L0F A;  3VUW A;  3WA0 A;  1G6J A;  1QOG A;  1EUV B;  1SB3 C;  4G0N B;  3HUI A;  1NDD A;  2RDG A;  2K25 A;  1YNT E;  1F1H A;  5E6N A;  1IBX B;  5DPT A;  1GJZ A;  3Q69 A;  2MBE A;  3DBR B;  2N1W A;  4HKZ E;  5J17 A;  2Z0D B;  5FR6 A;  2H89 B;  2Q5W D;  1P1A A;  4MT5 A;  3U52 E;  1IBX A;  4YTN B;  1HE8 A;  4HPP A;  1V80 A;  1XD3 B;  4BKG A;  3PO0 A;  5DPW A;  2ON8 A;  4JLC A;  1SBB B;  4BOZ B;  1PDX A;  4HXD A;  2XN9 C;  2CHZ A;  4IWO A;  4TUU A;  3EHV A;  3IT4 B;  2YLM A;  2LGY A;  4RGT A;  3QCA A;  3ZW3 A;  2N7D A;  4I6L B;  2AQ3 B;  2B3A A;  2LEK A;  4RGM A;  2KN5 A;  3HVD A;  2NTT A;  5BYS A;  2WU5 B;  4EZL A;  1IUE A;  2NR2 A;  1UNS A;  2CHW A;  1YMH E;  3AXC A;  4YSX B;  1R4M B;  4IM3 A;  3B2G A;  1PUT A;  3BZD B;  3NHE B;  1S3S G;  2GI9 A;  1WI0 A;  2N9K A;  4P1C C;  2MRP A;  1I4X A;  1UH6 A;  3CF6 E;  5BYQ A;  2W55 A;  4OVZ A;  3AN1 A;  3VUX A;  3IHP C;  3ZJT A;  2J4X A;  1GC6 A;  3VAW A;  2MH7 A;  5JHA A;  3DVG X;  3AEA B;  1SE9 A;  4IM2 A;  1Q5W B;  1VZ7 A;  4W9F A;  3WCQ A;  3E9S A;  1MG4 A;  4ZHO A;  2J42 A;  4YTP B;  2DZI A;  1C4P A;  4GB9 A;  1LXD A;  2UU7 A;  1L4D B;  3ZUN A;  1WSP A;  2KWD A;  4WJN A;  1AW7 A;  1L0X B;  2PPH A;  3AU5 A;  1WGH A;  2EKE C;  1YJJ A;  3PRP B;  1SGH A;  3JYU A;  3KWV A;  2WDR B;  4KSK C;  2PW9 A;  4ASW C;  3V60 A;  1MI0 A;  4TSS A;  1VRA B;  1MHH E;  3CST A;  3PV1 A;  1C4A A;  3VDZ A;  1C1Y B;  3TEZ A;  1RFA A;  4EE2 A;  3OG5 A;  1YJI A;  3ZRC A;  2L00 B;  2L05 A;  1T0R C;  1DOX A;  2A4Z A;  4URK A;  3R2I A;  4DDG D;  1P0R A;  3OAW A;  1E90 A;  1HXY D;  2FNJ B;  2WX1 A;  1TS4 A;  3DDC B;  4WJQ A;  1K51 A;  2PIA A;  2WXO A;  2L76 A;  3TEY A;  1XXG A;  1RWS A;  4GDL A;  4XZ4 A;  5AZH A;  3AI5 A;  3VRB B;  2EMT A;  3NZS A;  2QCZ A;  1P9D U;  4JPS A;  3SEB A;  1N63 A;  3M62 B;  1TY0 A;  2L0T A;  3QAQ A;  4II3 B;  2ONQ A;  4RNA A;  1C77 A;  3NRZ A;  3QK0 A;  4C00 A;  1RYJ A;  5HI1 A;  3AU4 A;  3TBL D;  4WUR A;  2JRI B;  5EE3 A;  2JWZ A;  1TS2 A;  4WIP A;  4ITK A;  1JRU A;  5CHW A;  1ZKH A;  2JZ3 B;  5JXV A;  3A4S C;  2DZK A;  2KX0 A;  1V8C A;  1XLN A;  4FN2 A;  4JIO U;  4HJK A;  5GMV A;  4ANV A;  1Q1O A;  2I38 A;  2DZM A;  2I1K A;  5AUI A;  3FIL A;  4B0E A;  4AOF A;  3VVW B;  2WLB A;  3L0W B;  3ZLZ A;  1QT9 A;  2JZP A;  2HTH A;  3AEB B;  1I4R A;  5IKC M;  2KWU B;  4M8M A;  5EE0 A;  2D3C A;  4MJS B;  1HTO A;  4C56 C;  3TL5 A;  3PLV A;  2IND C;  1JW9 D;  4L1B A;  3UQA A;  1L6V A;  4MEL A;  2LRU A;  2NBU A;  5AZF A;  4BBN C;  3VFK A;  1QIL A;  2NBW B;  2M0A A;  2KJH B;  2MSE D;  4F8C B;  2FIF A;  2ZEQ A;  1WM2 A;  3EFU A;  2INC C;  3RNF C;  3AED B;  4ZRI A;  2HJ8 A;  3UIP B;  1NVI D;  2D3G A;  3AUL A;  2WXI A;  2IO2 B;  2N4F A;  4KSL C;  2INP E;  5C2T B;  2JVC A;  3GE8 C;  4XYC A;  2OJW A;  1GUA B;  3QQ8 B;  3MFG A;  4RM8 A;  2WDV B;  2Y3A A;  1ZXH A;  3Q3N C;  3BYT B;  1GB4 A;  1UEL A;  3EEC A;  2MP2 A;  3A9J B;  3AEE B;  1C76 A;  2IO3 B;  1N62 A;  2IGG A;  3W1S A;  5BO4 B;  5AEK B;  1IP9 A;  2GLS A;  3DHI C;  1BXT A;  1PFD A;  2RPQ A;  4IKG A;  3DBL B;  5G55 A;  1WX8 A;  4US9 A;  3Q8E A;  4IG7 B;  2V9H A;  4LNF A;  4YXD B;  3ML8 A;  2KDM A;  2NTS A;  1YOV B;  3APD A;  2R2O A;  4ANW A;  3DCG A;  4S17 A;  2LRW A;  1E7U A;  5EE1 A;  3LDZ E;  3HHM A;  2ZNV B;  3KH0 A;  2IPK D;  2BT6 A;  1WYG A;  1E7V A;  3APF A;  1DOY A;  3B9J A;  2EKI A;  3A9J A;  3WAN A;  2DLB A;  2HDE A;  3DVN U;  2N9P C;  3UI3 A;  2PVG C;  2KVZ A;  2MA9 B;  3P4P B;  1L5P A;  1E5W A;  5D6J B;  3NOB A;  3TJP A;  1LFD A;  3AM9 A;  3H8H A;  2WXJ A;  1CZP A;  2KLG A;  2RPV A;  4W9J A;  1WX9 A;  4HRS A;  4ANU A;  3P63 A;  2YEP B;  3FIL B;  3VR9 B;  3GB1 A;  3P42 A;  4LNK A;  5IOI A;  1I42 A;  4E71 A;  2N0S B;  5CHV C;  3BK2 A;  2AX5 A;  2ICI A;  5E6O A;  4WAF A;  2BWF A;  3TUO A;  1FFU A;  4JQW C;  4PK1 A;  3ZJU A;  3NJT A;  4CHK A;  3NVW A;  2LGX A;  3R2T A;  3V6C B;  3RNC C;  2LGD A;  2AEH A;  1XQQ A;  3DWM A;  1L6U A;  2KQ4 X;  1Z2M A;  2KVR A;  2JF5 A;  2BQQ A;  5JZE B;  4K7S A;  3RD2 A;  4DBG A;  1VDV A;  1V5O A;  3OJ4 B;  4OHJ A;  4LNO A;  1UZX B;  3SFD B;  1YX6 B;  1X1M A;  4BAX A;  1SXT A;  3KUC B;  1B1Z A;  1XF5 L;  1CK1 A;  1WZ3 A;  2KX3 A;  2PMV A;  1E8W A;  3RZW C;  1H4R A;  3RNE C;  3APC A;  1Y8R C;  2V4L A;  2FCQ A;  2FAZ A;  2W54 A;  2LHD A;  3LYY A;  2HD5 B;  4P1B C;  4GDK A;  1FFV A;  3FKY A;  3VTV A;  3HRD D;  2J0M A;  2IO1 B;  2V3P A;  3CWI A;  5AZG A;  2I2Y A;  2O2V B;  4FAD A;  2WXG A;  1TGZ B;  3ZVV A;  1XCQ L;  1FM0 D;  4H2A A;  4KKI A;  1KRH A;  4K81 A;  5IN7 A;  3ETR A;  1WGK A;  1KLU D;  2OOB B;  2C5L C;  3RN9 C;  3ZKJ C;  2LUE A;  1SIF A;  4GGQ A;  2JY6 A;  4KVG B;  1WIA A;  5HKH A;  3RMK C;  4RMA A;  1MHX A;  2KOX A;  3A1Q B;  3TMP B;  3ZIM A;  3DBH I;  2N7E A;  2BB6 A;  1UBI A;  3SU8 X;  2QHO A;  2JU6 X;  4EEW A;  1ZPS A;  1GG3 A;  3PZD A;  3SR6 A;  4JL9 A;  3RZF A;  4JE3 B;  3T3N A;  4LLG M;  2KFJ A;  1QOA A;  5D2M B;  2WYQ A;  1V86 A;  3QAR A;  3W1S C;  4K1R B;  4GMV A;  4JWU C;  4II2 B;  4ANX A;  4BKT A;  1HZ6 A;  4ZHP A;  3RNG C;  3QJZ A;  2KMA A;  1F9J A;  1J19 A;  1WZ0 A;  2ZPY A;  3S2A A;  2IZV B;  4MEM A;  3J9C A;  5KHQ A;  1EU3 A;  2REX A;  4ZYN A;  3PRM B;  2L52 A;  4M0W B;  1ZUD 2;  2GBK A;  2CJN A;  5H8Y E;  4K7W A;  3LJ3 A;  2IDY A;  4DQO C;  3PHW B;  1VJK A;  2GBM A;  2MJD A;  2MCN B;  4IUM B;  2IY1 B;  2MLB A;  3R66 C;  1V5T A;  3P1M A;  3ZYY X;  2SEB D;  2IY0 B;  4PYU A;  1HA5 A;  2IBI B;  3NVY A;  2WXP A;  2DX5 B;  2GRI A;  1E8Z A;  1UF0 A;  5CX3 A;  4M8N A;  2O6V D;  2WNM A;  4HWI B;  4JX1 C;  2KZR A;  4NQK E;  3NZ3 A;  4S0R A;  3KYC D;  3TEW A;  1JRO A;  4DK5 A;  3ZTD A;  1MG8 A;  1QQR A;  4N59 A;  4PYZ A;  1R7S A;  3HIZ A;  1J8C A;  1HTQ A;  4HDO A;  3C8Y A;  1D5Z C;  1T6B X;  1EF1 A;  4XDD A;  3RT3 B;  1ET6 A;  1YJ1 A;  2RDH A;  4NAM A;  4KDL B;  4NJC A;  2V3S A;  2WXQ A;  2JSV X;  2BF8 B;  1I7H A;  5LXI B;  2M56 B;  2JT4 B;  3IVF A;  2KMC A;  2KKC A;  1DYQ A;  4MH8 A;  1WGG A;  1JWM D;  5FR3 A;  2QEJ C;  2AQ2 B;  1EU4 A;  3A33 B;  1AYF A;  3LB8 C;  4MGK E;  3HVZ A;  2BGF A;  2K1F A;  3T3O A;  2OED A;  3KUZ A;  3AE7 B;  3MJW A;  2G45 B;  2JQR B;  3A4R A;  1LGR A;  2DZJ A;  2PLP A;  1C4C A;  1EWC A;  2V4I B;  1FO4 A;  1XT9 B;  2FBW B;  1M4V A;  2D3A A;  1JCK B;  4W9G A;  1F2R I;  1WE6 A;  1ZW7 A;  2KXJ A;  3QWZ B;  5LXH A;  2D10 A;  1JWU D;  4N6E B;  2L8J A;  1IYF A;  3U7Z A;  3ZGZ A;  5KHO A;  3L10 B;  3IT6 B;  3HM3 A;  5I4D A;  3ABV B;  2L32 A;  3VH4 B;  2MBH A;  1FNV A;  2WDT B;  3O13 A;  1LQB A;  1P98 A;  2D2Q A;  3V05 A;  1V1O A;  2J7Q B;  4M01 A;  4WWN A;  4NZL B;  2N1V A;  4EOY A;  3NVZ A;  4OZB A;  2KWC A;  4C7Y A;  4P16 A;  3ZRF A;  1NBF C;  1V1P A;  2NPT A;  1SIJ A;  2M4N A;  2NVU I;  2KD0 A;  3I57 A;  2K3U A;  2W3R A;  2PE9 A;  1WGD A;  4FJZ A;  3MHZ A;  3AE3 B;  2DHZ A;  4TQ0 A;  1YIW A;  2DYO A;  5BMG A;  4UDU C;  1P3Q U;  4G3X B;  1CQV A;  2NBV B;  3NVV A;  4BBN F;  4MGZ E;  1QOB A;  2K9X A;  4BFR A;  1FCC C;  4WQO B;  1TZ1 A;  3QIJ A;  3CSF A;  2KN4 A;  5LLI A;  1WGR A;  2GOW A;  2C60 A;  4GDK B;  2PVO D;  5IO9 A;  2WXF A;  4DHZ E;  3KVF B;  2LHE A;  2M17 A;  1HQR D;  5FK9 C;  1JWS D;  1QLB B;  2MHJ A;  4CYE A;  3BYY B;  3EFC A;  4P7I A;  4EUT A;  1HZ5 A;  2KAJ A;  2K22 A;  2QJL A;  2DAJ A;  2NPT B;  2E6X A;  3ALB A;  2CU1 A;  4HJG E;  3RFZ B;  2V3N A;  3TCA A;  2WDQ B;  2D11 A;  2BPS A;  2EEL A;  2DYB A;  1YX5 B;  3B08 A;  2MP2 B;  3WAM A;  2J52 A;  2JZZ A;  4LNN A;  1FNU A;  1E9M A;  3Q8C A;  2LJI A;  2RDB C;  2ZPN A;  2GBN A;  3H6N A;  3AV8 A;  4I6P A;  2UWQ A;  1ESF A;  4KDI C;  2J0K A;  4DXF A;  3A1Q A;  2R61 A;  5FKA C;  3SD5 A;  1K52 A;  2BVC A;  3GZN B;  4O1N A;  5TR5 A;  4HRO A;  3NY5 A;  3T8M A;  3WAO A;  2Z8L A;  5E6P A;  4XWT A;  1WXQ A;  3M95 A;  4WWM A;  3MTN B;  3VHT C;  1WE7 A;  2KTF A;  4W9I A;  4TMA B;  1ZE3 D;  3VR8 B;  2PJH A;  1F2R C;  4AJY B;  2JX5 A;  3BII D;  3JSV A;  3P2B A;  2FUH B;  5MPO A;  1KTK A;  5IA7 A;  2MX2 A;  4ACF A;  4KX6 B;  4A3P A;  2K6Q A;  4KZC A;  2KFK A;  2NMQ A;  2HJ1 A;  3W5V B;  1J7B A;  4OVU A;  4LJP B;  3NZU A;  1ROE A;  4OZC A;  1XCT L;  2WU2 B;  2KQS A;  2RSU A;  1FRR A;  3N30 A;  3O65 B;  2M0X A;  3AE5 B;  2BS2 B;  4M0W A;  1OQR A;  2AL6 A;  4JGH B;  4RF1 A;  1L7Y A;  3JW0 X;  3I3T B;  2V0G A;  3ENE A;  3SDL C;  1WM3 A;  3LXF A;  3QHT A;  4WJO A;  1SJE D;  2N9L A;  2VZK D;  1QOF A;  4PT5 A;  1I4H A;  1VD2 A;  2X38 A;  2I1J A;  1BT0 A;  1TIF A;  4NY0 A;  2AWT A;  2RD0 A;  3E56 A;  3Q2A C;  1ZDX A;  5TSS A;  3WAL A;  1IGC A;  2IYD B;  1ENF A;  1TS3 A;  3K9P B;  3ECI A;  1ZDV A;  3CIR B;  2D5G A;  2MBB B;  2D07 B;  3Q3M C;  2W82 A;  2K8B A;  3RUL A;  1RLF A;  1RFK A;  2GBR A;  2BYV E;  2WXL A;  4B0M A;  3Q3J A;  2GB1 A;  1LM8 B;  1WJ6 A;  1J7A A;  1Y56 A;  1GNU A;  2J53 A;  3A9K B;  5BYR A;  3Q6B A;  3URY A;  1WXM A;  1Q10 A;  4RFB A;  2QDF A;  4DDI D;  4GXB A;  2JYT A;  1FD6 A;  3UGB B;  3U8Z A;  5EDS A;  1JRP A;  2Z0E B;  5CHF A;  2IGD A;  3QX1 A;  3DQV A;  2KFK B;  1EF5 A;  4KGR A;  1GC7 A;  1WX7 A;  2J0J A;  4E3C A;  3B2F A;  5D3I B;  2BBC A;  4W9D A;  3KLS X;  4DXG A;  1N60 A;  4A3O A;  1Z5S B;  2MEK A;  4ARC A;  4TQ1 A;  4FUL A;  3CMM B;  3GP7 A;  1F0Z A;  2IJ0 A;  2R2Q A;  2RGF A;  2KDI A;  4ZRK A;  1TTN A;  2AYO B;  2C9W B;  2AQ1 B;  1CJE A;  3H7P A;  3AEF B;  1K8R B;  1TJE A;  3NUH B;  1FNW A;  1UWX A;  2AL3 A;  4DXA B;  4CQN A;  2Y5B B;  4NAW B;  5DCN A;  2G4S A;  3DVG Y;  4AP4 C;  2MJE A;  2MBO A;  3I5J C;  2DAF A;  1WXA A;  4TV3 A;  1E8Y A;  2DEN B;  2LGI A;  1RAX A;  4KZ0 A;  3WAP A;  4A20 A;  3EUB 2;  3PVL A;  3BVM A;  1YQB A;  2BYT A;  3ZXV A;  1OQQ A;  1GPX A;  2N7J A;  4EZK A;  4BVU C;  3AE2 B;  4YSY B;  1JWA D;  2K8C A;  1SEB D;  1VZ8 A;  1ZOY B;  3P4Q B;  1C3T A;  3WIM A;  3PPA A;  2LVQ A;  4FHK A;  2WXM A;  1TKE A;  3OJ3 A;  2K8H A;  3FC4 A;  2MW5 A;  3FAH A;  1PGA A;  2BYE A;  4MM3 A;  4OW0 A;  3VRA B;  2XK5 A;  3W9C B;  3RI7 C;  4L2Y A;  1V6E A;  1IGD A;  1RM6 C;  5J18 A;  3W1Y A;  2MJ3 A;  3ZNI D;  3V6E B;  2KJ6 A;  4B6W A;  4YT0 B;  1WJN A;  4LDT B;  1ISN A;  3PSE B;  1KH0 A;  1WYW B;  2SAK A;  2O2V A;  1CMX B;  3BVG A;  2XNA C;  1FRD A;  4KIK A;  3N3K B;  1R4N B;  4PS7 A;  3NG0 A;  4IW0 A;  2WXN A;  1FEH A;  2YVC A;  3N20 C;  2VZK B;  2QMT A;  4MDK E;  4MH0 E;  4XGA B;  1OTR B;  4ZRP A;  1S1Q B;  1UUP A;  3EGR A;  2B76 B;  3DHH C;  3GOE A;  3JVZ X;  3AH7 A;  2KMM A;  3R7R A;  1ZXI A;  1T5X D;  1U4A A;  2LXA A;  4A9A A;  1WMH B;  2G9H D;  1UBQ A;  2Z59 B;  4X57 B;  3ML9 A;  3BWU D;  5GXG B;  4ZDV A;  2DYM A;  1XLP A;  2LWP A;  4FBJ B;  4LJO B;  2ZNV C;  2FCM A;  4G50 A;  1YD8 U;  1D5M C;  1VCB A;  2O6V B;  3GS2 A;  1N5W A;  2CJO A;  1OGW A;  1D3Z A;  5EE9 A;  2KQ7 A;  1D4B A;  1Q0W B;  5C3J B;  1FCL A;  4KGT A;  2WQY B;  4GDL B;  2JXT A;  2CHX A;  3AE6 B;  3HM6 X;  1D6E C;  2FID A;  2M1M A;  3AMZ A;  2CR5 A;  5E6J A;  4DHJ D;  5T8I A;  1T0Y A;  4GU2 A;  3L16 A;  1L0Y B;  3DBH B;  4REZ A;  4HPL B;  4ICV A;  4WJP A;  1GB1 A;  2KK8 A;  1A70 A;  2KLC A;  4CO7 A;  3SHQ A;  1KJT A;  3AE9 B;  1WJU A;  3R3M A;  3DBL I;  1NI2 A;  2YEP F;  2PTL A;  2PEA A;  1NYQ A;  3U4E G;  2FCN A;  3VUY A;  2K39 A;  3W2D A;  1T3Q A;  1AN8 A;  4FXC A;  1FXA A;  2VH1 A;  1L0V B;  1LO5 D;  4NAW A;  2XEW A;  1OQY A;  1I4G A;  4F7Z A;  2KO3 A;  3R8B A;  4N58 A;  4IOI E;  2ZVN A;  1WJ4 A;  1UGJ A;  3AEC B;  4M02 A;  3RNA C;  4W9H A;  2ZCB A;  3ZDM C;  2LAS A;  1V49 A;  3UIN B;  2FCS A;  4R3D A;  5HFY A;  5D3D A;  2PE6 B;  2ZJD A;  1JWB D;  1A5R A;  1YN4 A;  4E74 A;  4AQ7 A;  4LCD E;  4KKJ A;  4W9L A;  1JML A;  4XWW A;  1B9R A;  4GLS C;  2X8X X;  3B0A A;  5IAA C;  3H1U A;  2KHW B;  1V1P B;  2ACZ B;  2IO0 B;  1QZE A;  4W9K A;  2BWE S;  4A6Q A;  4ZRJ A;  1UWM A;  3ONS A;  4NJ6 A;  1ACC A;  4WAA A;  1VZ6 A;  3P4S B;  4LDT D;  1NYR A;  3L17 A;  3B1L X;  3UIO B;  3PT2 B;  1UD7 A;  1VLB A;  1XLO A;  2OHF A;  2JWU A;  2NS5 A;  4MAC A;  3MC9 A;  1XLQ A;  3AE4 B;  4RM9 A;  3PZ8 A;  4HLE A;  1TS5 A;  3ZXR A;  3PRZ A;  2HTM E;  5G5H A;  3UQB A;  4IDI A;  2N9E B;  2KT7 A;  4AS1 A;  1SF0 A;  1AAR A;  4RGO S;  1C78 A;  2JYE A;  2KC1 A;  4GIV A;  3JSV B;  3W5U B;  1TKG A;  1WR6 E;  2HE7 A;  5H92 C;  2LGS A;  2WS3 B;  3BK1 A;  3DOW A;  3ZDT A;  1BML C;  2TSS A;  1M94 A;  2KNB A;  2JUO A;  4L23 A;  1PGB A;  1TYG B;  1V81 A;  2O6V A;  4DWF A;  4I6N B;  4YWG G;  4MSQ B;  2RMM A;  4ICU A;  3VXW A;  4HPM B;  1YN5 A;  3BIN A;  1SE3 A;  2FE8 A;  3DPD A;  1QKZ A;  1FPY A;  3KW5 B;  1AWD A;  1PGX A;  3Q8F A;  1K50 A;  4B95 A;  2KJR A;  2KC2 A;  2W9N A;  2QIL A;  2M19 A;  4GOC A;  4NPN A;  3P4R B;  2WXR A;  3HK0 A;  3L4P A;  2KDF B;  3PZ7 A;  4YSZ B;  4C4V B;  3AEG B;  3Q8A A;  2DNF A;  4BKS D;  1KLV A;  3U7D A;  2WGS A;  3ZNZ B;  2JXX A;  3ZNG C;  2LFI A;  4WWO A;  4G11 A;  2KYW A;  5CTR C;  4K3B A;  2GBJ A;  5LNK 1;  5L95 C;  3T9L A;  2DWQ A;  4FLH A;  5BMI A;  1DGJ A;  4IWQ A;  4BOS C;  1WXS A;  1J0G A;  1NEK B;  4XX5 A;  2LZ6 A;  4GN1 A;  2LVP A;  3M3J A;  2LVO A;  2WHI A;  3H7S A;  2ASQ A;  2LJ5 A;  2Y5C A;  5G5G A;  2C7N B;  1XEE A;  2C7M B;  2L3Z A;  3OLM D;  3H9D A;  1OEY J;  2WXK A;  1SSN A;  4LNI A;  1TKY A;  4KV2 A;  3V62 A;  2H88 B;  2KAN A;  2L1A A;  1MJD A;  1F52 A;  3L08 A;  1SE4 A;  3BY4 B;  4KIK B;  4A55 A;  3DBR I;  2GMI C;  3GE3 C;  4GSW A;  1STE A;  2WWZ A;  1EM7 A;  2RR9 A;  4ARI A;  1WH3 A;  3N32 A;  3IG3 A;  3TSS A;  1SE2 A;  2CS4 A;  4YL8 A;  2BKR B;  3I9V 1;  3KUD B;  1P7F A;  4MGI E;  1FXT B;  5DPS A;  1UGM A;  4NJ7 A;  4AWJ A;  1YQ3 B;  4BZA A;  2BB5 A;  1TY2 A;  3N1X C;  3I63 C;  4XDC A;  4BKS A;  3Q14 C;  4A8X C;  2QSD A;  3Q3O C;  1ET9 A;  2MQJ A;  3V61 A;  4NQL B;  3IBE A;  4IC7 B;  5DPR A;  4K3C A;  1KF6 B;  2N9X A;  2W3S A;  1WFY A;  3PRE A;  4K7U A;  4ZOH C;  1N6Z A;  3EA6 A;  2ZZP B;  2BS4 B;  4XE0 A;  3MHS D;  3PGE A;  2KTR A;  3NS8 A; 
#chains in the Genus database with same CATH homology
 1YQB A;  3R7Q A;  4GDL A;  3HIZ A;  4XZ4 A;  5AZH A;  3AI5 A;  1J8C A;  4EZK A;  4BVU C;  3KYD D;  3L13 A;  4PS3 A;  2EMT A;  4HDO A;  3NZS A;  2KDB A;  2K8C A;  1P9D U;  4W9E A;  1EF1 A;  3RT3 B;  3RCZ A;  1YJ1 A;  3M62 B;  3QAQ A;  2L0T A;  4KDL B;  1C3T A;  2V3S A;  4NNJ B;  3WIM A;  4II3 B;  3PPA A;  2BF8 B;  3H7P B;  2LVQ A;  4FHK A;  4OVV A;  5LXI B;  3OJ3 A;  4WWP A;  3Q3F A;  3QK0 A;  2K8H A;  2MW5 A;  2BYE A;  2JT4 B;  1WY8 A;  4MM3 A;  3AU4 A;  3IVF A;  2KMC A;  3TBL D;  3A9K A;  3QA8 A;  2JRI B;  2KKC A;  2XK5 A;  2JWZ A;  1WGG A;  5D7G A;  1WXV A;  1V6E A;  1V9J A;  5J18 A;  1JRU A;  5CHW A;  3W1Y A;  1TBE A;  3ZNI D;  3V6E B;  1WF9 A;  2KJ6 A;  3A33 B;  4B6W A;  4TKN A;  2M8S A;  1ZKH A;  4MGK E;  1WJN A;  2JZ3 B;  4LDT B;  3A4S C;  2DZK A;  2BGF A;  1ISN A;  2K1F A;  2KX0 A;  2WX0 A;  3PSE B;  3DBS A;  3KUZ A;  1WYW B;  3MJW A;  2O2V A;  4FN2 A;  4JIO U;  4HJK A;  5GMV A;  3X0W A;  2G45 B;  4ANV A;  3A4R A;  4B9K A;  1Q1O A;  1CMX B;  2DZJ A;  1L2N A;  4XC2 A;  2DZM A;  2I1K A;  4HK2 A;  4KIK A;  2G3Q B;  3N3K B;  3K9O B;  4MSM B;  4AOF A;  1XT9 B;  4FJV B;  3VVW B;  1R4M I;  4PS7 A;  2JPH A;  4IW0 A;  3L0W B;  2NCN A;  3ZLZ A;  4W9G A;  4F1S A;  1WE6 A;  2YVC A;  1ZW7 A;  3TIX A;  2KXJ A;  4MDK E;  2HTH A;  3QWZ B;  5LXH A;  1OEY A;  2D10 A;  5C1Z A;  2L8J A;  4MH0 E;  3RUI B;  5JHB A;  1IYF A;  4DHZ B;  1OTR B;  1S1Q B;  2KWU B;  2C7H A;  5KHO A;  4M8M A;  3GOE A;  3JVZ X;  3L10 B;  4EZJ A;  2BKF A;  3R7R A;  3VTW A;  3HM3 A;  1U4A A;  2LXA A;  5C23 A;  4MJS B;  1WMH B;  3VH4 B;  2MBH A;  3TL5 A;  5L83 A;  3PLV A;  1UBQ A;  1H8C A;  2WDT B;  2Z59 B;  4X57 B;  3U30 A;  3ML9 A;  2LXC A;  1LQB A;  2ZCC A;  3ZNH B;  1P98 A;  3UQA A;  4ZDV A;  2DYM A;  2LWP A;  2D2Q A;  4MEL A;  2LRU A;  2J7Q B;  4FBJ B;  4LJO B;  2ZNV C;  2FCM A;  3L54 A;  2NBU A;  4WWN A;  3D32 A;  1YD8 U;  4G50 A;  5AZF A;  2N1V A;  2OJR A;  1VCB A;  2O6V B;  4J6I A;  3PLU A;  4BBN C;  3VFK A;  4EOY A;  1OGW A;  2NBW B;  2EMS A;  3EC8 A;  1D3Z A;  2KJH B;  2KWC A;  1RRB A;  2MSE D;  2KQ7 A;  4F8C B;  2ZVO A;  4N9F 4;  3ZRF A;  1NBF C;  1Q0W B;  2FIF A;  2NPT A;  2ZEQ A;  2M4N A;  3PTF C;  1WM2 A;  4GDL B;  2NVU I;  2KD0 A;  3EFU A;  3VQI A;  2CHX A;  4IM0 A;  2PE9 A;  3HM6 X;  3GZN I;  2CKH B;  1WGD A;  4FJZ A;  4ZRI A;  1PQS A;  2DHZ A;  2HJ8 A;  4TQ0 A;  1YIW A;  3UIP B;  3UF8 A;  2D3G A;  2DYO A;  3AUL A;  3VH3 B;  5JH5 C;  2FID A;  2IO2 B;  2M1M A;  1P3Q U;  4G3X B;  2N4F A;  2CR5 A;  4KSL C;  2NBV B;  4DHJ D;  3RYT A;  4BBN F;  4FA6 A;  1T0Y A;  4GU2 A;  4MGZ E;  3L16 A;  2JVC A;  4HPL B;  4ICV A;  4WJP A;  2KK8 A;  2KLC A;  4BFR A;  4CO7 A;  3SHQ A;  1KJT A;  1GUA B;  1WJU A;  3QQ8 B;  3DBL I;  3R3M A;  2LI5 A;  4RM8 A;  1NI2 A;  4WQO B;  1TZ1 A;  3QIJ A;  3CSF A;  5LLI A;  2PEA A;  2G4D B;  2JRH A;  3ZTC A;  2MWS B;  2FCN A;  1WGR A;  2GOW A;  2C60 A;  4GDK B;  3VUY A;  1UEL A;  1KOT A;  3EEC A;  1WMH A;  2K39 A;  2L7R A;  2MP2 A;  2V1Y A;  3A9J B;  4DHZ E;  1EO6 A;  4EKU A;  3KVF B;  4NAW A;  2IO3 B;  2XEW A;  1OQY A;  2A5U A;  2M17 A;  3W1S A;  5BO4 B;  5AEK B;  1IP9 A;  4HDQ A;  4F7Z A;  5D94 A;  4CYE A;  2KO3 A;  1E8X A;  2RPQ A;  1I35 A;  2VRR B;  4IWP A;  4P7I A;  4W9C A;  4AUQ C;  4FHJ A;  4EUT A;  5G55 A;  2ZVN A;  1WJ4 A;  2BYF A;  3C0R B;  1WX8 A;  3PS6 A;  4IG7 B;  2XBB C;  3ML8 A;  1IPG A;  2DAJ A;  4W9H A;  2NPT B;  2ZCB A;  3ZDM C;  3APD A;  3QC8 B;  2R2O A;  4ANW A;  2LAS A;  1V49 A;  3UIN B;  3ALB A;  2CU1 A;  2FCS A;  3DCG A;  2LRW A;  1E7U A;  3TCA A;  2MBQ A;  2PE6 B;  3LDZ E;  2D11 A;  3HHM A;  2BPS A;  2ZNV B;  2ZJD A;  3KH0 A;  1A5R A;  4E74 A;  2DYB A;  1YX5 B;  3B08 A;  2MP2 B;  4LCD E;  1E7V A;  3APF A;  3WAM A;  3X23 A;  4W9L A;  2JZZ A;  1ZGU B;  1R4N I;  1WRD B;  2UYZ B;  3A9J A;  2ZPN A;  4MGY E;  3VTU A;  3WAN A;  3IFW B;  3B0A A;  4HCP B;  2GBN A;  5G2N A;  5IAA C;  3DVN U;  3H6N A;  2N9P C;  3H1U A;  2KHW B;  4I6P A;  2UWQ A;  3M63 B;  2KWV B;  2MA9 B;  2IO0 B;  1V2Y A;  1QZE A;  1E5W A;  2J0K A;  4KDI C;  5D6J B;  3A1Q A;  3NOB A;  3SD5 A;  4W9K A;  3TJP A;  1LFD A;  2BWE S;  5TR5 A;  1WR1 A;  4ZRJ A;  2KDE B;  3NY5 A;  3T8M A;  3WAO A;  2KLG A;  3ONS A;  4NJ6 A;  4WAA A;  4W9J A;  1WX9 A;  5E6P A;  2LD9 A;  2KTR B;  4FJY A;  4ANU A;  3M95 A;  4LDT D;  3L17 A;  3B1L X;  3MTN B;  3UIO B;  3PT2 B;  2XK5 B;  3VHT C;  1UD7 A;  1I42 A;  1WE7 A;  2KTF A;  4W9I A;  4PS8 A;  4E71 A;  3ZO5 B;  2NS5 A;  5CHV C;  4RM9 A;  4EFO A;  4AJW A;  4HLE A;  1WGY A;  3DVN V;  4MJS A;  5E6O A;  2BWF A;  3PRZ A;  4JQW C;  3PHX B;  2PJH A;  2K6D B;  4AJY B;  4HCN B;  3UQB A;  2N9E B;  5J2R A;  4HVB A;  3JSV A;  3PVL A;  4CHK A;  2LGX A;  3P2B A;  4DHJ B;  3V6C B;  2FUH B;  1AAR A;  2LGD A;  2AEH A;  1XQQ A;  1KM7 A;  2L0F A;  3VUW A;  2KC1 A;  1Z2M A;  4GIV A;  5IA7 A;  2MX2 A;  3JSV B;  2KVR A;  3WA0 A;  1G6J A;  2JF5 A;  1EUV B;  4G0N B;  4A3P A;  1NDD A;  1WR6 E;  2K6Q A;  5JZE B;  2K25 A;  4KZC A;  2KFK A;  4K7S A;  3RD2 A;  5E6N A;  4DBG A;  2HE7 A;  4OVU A;  4LJP B;  5DPT A;  1V5O A;  3OJ4 B;  3NZU A;  1GJZ A;  1UZX B;  3DOW A;  3ZDT A;  1YX6 B;  2MBE A;  1M94 A;  2N1W A;  2KNB A;  1X1M A;  5J17 A;  2KQS A;  2Z0D B;  2RSU A;  2JUO A;  5FR6 A;  1P1A A;  3KUC B;  1V81 A;  2O6V A;  4DWF A;  4I6N B;  1HE8 A;  4MSQ B;  1WZ3 A;  4ICU A;  1V80 A;  3VXW A;  4HPM B;  3N30 A;  1XD3 B;  2KX3 A;  4BKG A;  1E8W A;  3RZW C;  1H4R A;  3O65 B;  2M0X A;  5DPW A;  3BIN A;  4JLC A;  3APC A;  3DPD A;  1Y8R C;  4BOZ B;  4HXD A;  3KW5 B;  2CHZ A;  2V4L A;  2FCQ A;  2FAZ A;  4IWO A;  4TUU A;  2AL6 A;  3EHV A;  4JGH B;  2YLM A;  2LGY A;  3QCA A;  2HD5 B;  2KJR A;  4B95 A;  3ZW3 A;  1L7Y A;  2KC2 A;  4GDK A;  2W9N A;  3JW0 X;  3I3T B;  2N7D A;  3VTV A;  2J0M A;  2IO1 B;  4GOC A;  4NPN A;  5AZG A;  4I6L B;  2B3A A;  2O2V B;  3ENE A;  3SDL C;  4FAD A;  1WM3 A;  3QHT A;  4WJO A;  1TGZ B;  3HK0 A;  3ZVV A;  2KDF B;  2KN5 A;  4K81 A;  4EZL A;  2OOB B;  1VD2 A;  2C5L C;  2NR2 A;  2I1J A;  3ZKJ C;  2LUE A;  1SIF A;  1BT0 A;  4GGQ A;  4BKS D;  1KLV A;  2JY6 A;  4KVG B;  3U7D A;  1WIA A;  4NY0 A;  2AWT A;  2CHW A;  2RD0 A;  3ZNZ B;  5HKH A;  2JXX A;  3ZNG C;  4RMA A;  3AXC A;  4IM3 A;  4WWO A;  2KOX A;  3A1Q B;  3NHE B;  4G11 A;  2IYD B;  3TMP B;  3WAL A;  5CTR C;  3ZIM A;  2GBJ A;  1S3S G;  3T9L A;  4FLH A;  5L95 C;  3K9P B;  3ECI A;  3DBH I;  1WI0 A;  2N7E A;  4IWQ A;  4BOS C;  1UBI A;  2MRP A;  1WXS A;  3SU8 X;  1UH6 A;  3CF6 E;  2QHO A;  1J0G A;  4XX5 A;  2LZ6 A;  4GN1 A;  2MBB B;  4EEW A;  1GG3 A;  2D07 B;  3PZD A;  2K8B A;  3RUL A;  2LVP A;  1RLF A;  3IHP C;  3VUX A;  3M3J A;  2LVO A;  2GBR A;  2BYV E;  2ASQ A;  2LJ5 A;  3H7S A;  4JL9 A;  3Q3J A;  1LM8 B;  2C7M B;  1GC6 A;  1WJ6 A;  2C7N B;  2L3Z A;  3OLM D;  3VAW A;  5JHA A;  3H9D A;  1OEY J;  3DVG X;  1SE9 A;  3RZF A;  4IM2 A;  1Q5W B;  1GNU A;  4W9F A;  3A9K B;  2KFJ A;  4KV2 A;  3V62 A;  5D2M B;  2WYQ A;  2KAN A;  1WXM A;  1V86 A;  3QAR A;  2DZI A;  3W1S C;  4GB9 A;  1LXD A;  3L08 A;  3BY4 B;  4KIK B;  4K1R B;  3DBR I;  3ZUN A;  4DDI D;  2GMI C;  4GXB A;  4GMV A;  4GSW A;  4II2 B;  3U8Z A;  3UGB B;  4ANX A;  5EDS A;  4WJN A;  2PPH A;  2WWZ A;  2Z0E B;  3AU5 A;  1WGH A;  4BKT A;  2EKE C;  5CHF A;  3DQV A;  2RR9 A;  1SGH A;  3PRP B;  2KMA A;  3QX1 A;  1WH3 A;  3JYU A;  3N32 A;  1F9J A;  1EF5 A;  2KFK B;  1J19 A;  3IG3 A;  1GC7 A;  1WZ0 A;  1WX7 A;  2CS4 A;  2ZPY A;  2J0J A;  3S2A A;  2IZV B;  4MEM A;  4YL8 A;  4E3C A;  4KSK C;  2BKR B;  4W9D A;  3V60 A;  4ASW C;  5KHQ A;  2REX A;  4A3O A;  4ZYN A;  1Z5S B;  3KUD B;  3CST A;  3PV1 A;  1FXT B;  3PRM B;  4MGI E;  5DPS A;  3VDZ A;  1C1Y B;  1UGM A;  4NJ7 A;  4M0W B;  4AWJ A;  1RFA A;  4TQ1 A;  2GBK A;  4K7W A;  3LJ3 A;  3ZRC A;  2L00 B;  3PHW B;  2GBM A;  4FUL A;  2L05 A;  3CMM B;  4BKS A;  2R2Q A;  2MCN B;  2RGF A;  2KDI A;  4IUM B;  4ZRK A;  2MLB A;  2IY1 B;  1V5T A;  3R66 C;  2A4Z A;  1TTN A;  2AYO B;  2C9W B;  4URK A;  4DDG D;  2MQJ A;  3V61 A;  4NQL B;  2IY0 B;  3H7P A;  3IBE A;  4IC7 B;  4PYU A;  1P0R A;  3OAW A;  2IBI B;  1K8R B;  5DPR A;  1E90 A;  2DX5 B;  2AL3 A;  2FNJ B;  2N9X A;  4DXA B;  1E8Z A;  2Y5B B;  4NAW B;  2G4S A;  1WFY A;  3QJZ A;  3PRE A;  3DVG Y;  5DCN A;  4AP4 C;  4K7U A;  5CX3 A;  4M8N A;  2MBO A;  2O6V D;  2WX1 A;  4HWI B;  2DAF A;  2KZR A;  2ZZP B;  1WXA A;  3DDC B;  4NQK E;  3KYC D;  4WJQ A;  4TV3 A;  1E8Y A;  2DEN B;  4KZ0 A;  1RAX A;  3ZTD A;  4DK5 A;  3WAP A;  1MG8 A;  4A20 A;  3MHS D;  4PYZ A;  3PGE A;  2L76 A;  2KTR A;  3NS8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...