1WZ0A

Solution structure of human sumo-2 (smt3b), a ubiquitin-like protein
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
104
structure length
104
Chain Sequence
b'GSSGSSGMADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin-like protein SMT3B
publication title Solution Structure of Human SUMO-2 (SMT3B), a Ubiquitin-like Protein
rcsb
source organism Homo sapiens
molecule tags Structural genomics, unknown function
total genus 12
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2005-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1wz0A01
1WGDA 3QK0A 3N3KB 5JHAA 2N7EA 2KTRB 4HCNB 4TV3A 2GBNA 3EC8A 2J0KA 1P3QU 2BPSA 2ZPNA 3HM3A 3RT3B 4ZYNA 3HHMA 1LXDA 4WWPA 4LJPB 3IBEA 1U4AA 1WGGA 2LRUA 3WANA 4ICUA 1WMHB 2O6VA 3ML9A 4F8CB 3WIMA 4W9DA 4KSKC 2KNBA 4ZDVA 2LZ6A 1PQSA 4G0NB 1EF5A 3L0WB 1OQYA 4DXAB 1WMHA 2C60A 3KYCD 2ZVOA 1OEYA 3R66C 4II3B 4NQKE 4EZLA 3KUZA 3ZIMA 4GDKB 2KJ6A 2C7HA 5BO4B 1P0RA 2D2QA 2FUHB 3TBLD 1I42A 3RUIB 2ZCBA 4BOSC 3A9JB 2KQSA 4LCDE 3VQIA 1SIFA 2KZRA 4BVUC 2OOBB 1LM8B 4GDKA 5EDSA 3HK0A 4ZRJA 3MTNB 2FCQA 2D3GA 3X23A 4URKA 3VUYA 2A4ZA 2BYFA 3A9JA 4HDOA 3PT2B 3ZO5B 4RMAA 3GOEA 1E90A 2R2OA 3PLUA 4NPNA 3RCZA 5JH5C 2KX3A 2BF8B 2RGFA 2ZJDA 2MCNB 3B1LX 2NPTB 2O6VD 4XZ4A 4GXBA 2IBIB 2AYOB 3NOBA 4ANUA 4N9F4 5D6JB 4TQ0A 2NS5A 3P2BA 1V2YA 2DZIA 1V9JA 3ZRFA 2BKRB 2ASQA 1RAXA 1P1AA 2NPTA 5DPSA 2M0XA 1H8CA 5KHQA 3S2AA 3QC8B 2MWSB 2GBKA 2R2QA 4HJKA 3K9PB 3PRMB 3DBLI 2KANA 3SDLC 2K39A 2BGFA 4FHJA 2M1MA 5E6PA 4HCPB 4MJSB 2NVUI 5JHBA 1KJTA 2IY0B 4WAAA 4E74A 4FJVB 4B9KA 4E3CA 2DYBA 1WJUA 4RM8A 1WX7A 2MBHA 2O2VA 4KZCA 3TJPA 3W1SA 3QHTA 4MJSA 3UQBA 5IA7A 2EKEC 5LXHA 4JGHB 1IPGA 2DYMA 2NBWB 3U30A 3ZKJC 3DBSA 2PPHA 3ZDTA 3PRPB 1WGHA 2MP2A 4IM2A 4NQLB 2L76A 4EZJA 4MGYE 2K6QA 3L08A 4NAWB 3PZDA 3X0WA 2G45B 1NI2A 2VRRB 4MEMA 4F7ZA 2KO3A 1WI0A 3QAQA 4GU2A 1G6JA 3OJ3A 4DWFA 1S3SG 3ZTDA 5G2NA 4JLCA 1GG3A 3QCAA 2UYZB 2MRPA 2Y5BB 4I6PA 1IYFA 3IHPC 1LFDA 4LDTD 2FIDA 4CYEA 3VTVA 1H4RA 1E8YA 2JZZA 4GDLB 4NY0A 4FADA 4B95A 4A3OA 3HM6X 1A5RA 2IO1B 1UZXB 3ENEA 1YX6B 4FN2A 2OJRA 2UWQA 3AXCA 4GDLA 3HIZA 1R4NI 3EECA 3LJ3A 2V4LA 1TZ1A 3BY4B 4G50A 2KMCA 1EUVB 3KUCB 1E8WA 2GOWA 2JRIB 1WX9A 2KVRA 3IG3A 4WWOA 3KW5B 4F1SA 3R7QA 1UBQA 2KDIA 3Q3FA 3QIJA 2YVCA 1R4MI 2KDFB 2BYVE 1C1YB 2NBUA 2J7QB 3H7SA 3LDZE 3H9DA 2JT4B 2G3QB 2C5LC 3QA8A 3A4SC 4WJQA 1SE9A 4K7SA 4M0WB 4BOZB 2G4SA 3PSEB 2Z59B 2JUOA 2FCSA 3H1UA 5FR6A 1NDDA 3A1QB 3IVFA 2KC2A 3DVGX 3U7DA 2O6VB 2A5UA 2LD9A 1WRDB 5DPRA 4NJ7A 2MQJA 2C7MB 1YIWA 2WWZA 2D11A 2N7DA 3A1QA 4ASWC 1YJ1A 2BWES 1WFYA 1AARA 4CO7A 1GC6A 1NBFC 3UIOB 1P9DU 2KDBA 2KFKB 4WJOA 2GBMA 3ZLZA 2M8SA 2JZ3B 2GBJA 2PEAA 3EFUA 4AP4C 1KOTA 3VUXA 4ICVA 2D10A 2M17A 3DDCB 2KFKA 3JYUA 1WJNA 2KX0A 1GNUA 3N30A 4GGQA 3WAOA 4W9CA 4BKSA 2D07B 2K6DB 3AU5A 1GUAB 1E8ZA 4IW0A 2K1FA 1GC7A 4IWQA 4K7UA 3VAWA 4MDKE 4KDIC 3OAWA 4DDID 3WAMA 3UIPB 1UBIA 4K1RB 4MGZE 3C0RB 5KHOA 2HTHA 2MSED 2L05A 3PHXB 4M8NA 5TR5A 4TQ1A 4W9HA 1FXTB 5AZFA 4E71A 3RD2A 2J0JA 1WM3A 2DAJA 5CHFA 3TL5A 1EO6A 2MLBA 3A4RA 4FBJB 2FCNA 1WR6E 3H7PB 3AULA 1V49A 1E7UA 2WYQA 3APCA 3KUDB 1WF9A 2DZMA 2BYEA 5GMVA 3VUWA 1F9JA 3MJWA 1S1QB 2KXJA 2NCNA 2ZEQA 3APDA 3H7PA 4PS8A 3V62A 4HPLB 3O65B 4RM9A 4FA6A 4BKSD 3DOWA 2MX2A 3NHEB 3TIXA 1E5WA 2JY6A 3ZNGC 4LDTB 4EKUA 3ONSA 3L10B 4W9IA 1LQBA 4TUUA 3QX1A 2O2VB 1WXMA 2IO0B 1UGMA 4MH0E 4BKTA 4HVBA 3L13A 3VHTC 1CMXB 4HDQA 3BINA 3DBHI 3QARA 1E7VA 5HKHA 4CHKA 2CS4A 3DVNU 4DHZE 1J0GA 3PPAA 1QZEA 2DENB 2CKHB 2PE9A 4GIVA 2LWPA 1WXVA 5DPTA 4DHJD 2MP2B 3JW0X 2MBEA 3PV1A 2JXXA 3N32A 2KWCA 1WZ3A 2I1JA 3M3JA 3PS6A 3VVWB 1EF1A 1WXSA 4WJPA 1ZKHA 2DZJA 3V61A 1IP9A 2NBVB 3MHSD 3W1SC 2AL6A 2KLCA 2KMAA 4MELA 4G3XB 1V81A 3PGEA 4HK2A 4I6NB 4M8MA 2WX0A 1T0YA 1V86A 3DBRI 4FJZA 3ZUNA 4OVUA 3NZUA 2GBRA 2B3AA 2C9WB 2N9EB 2L0TA 2ZVNA 3R3MA 4HWIB 3U8ZA 2HE7A 4MSMB 2NR2A 3ECIA 1KLVA 5J2RA 3I3TB 4GN1A 4KVGB 2KOXA 2ZZPB 2CU1A 3TCAA 4HLEA 3SU8X 2KTFA 3RZWC 1WH3A 5LXIB 2Z0EB 3D32A 1L2NA 3WAPA 1RFAA 1XD3B 2JWZA 1OEYJ 3L17A 3M63B 3V6CB 1D3ZA 2GMIC 3ZVVA 2QHOA 2MA9B 4A3PA 1I35A 2PJHA 2N1WA 2JF5A 3PREA 4NNJB 4IM3A 4PS3A 3PTFC 2XK5A 4WQOB 2KFJA 4B6WA 3APFA 1JRUA 3AU4A 5E6OA 4EFOA 5D94A 2RPQA 2WX1A 2EMSA 3ZNZB 3ZNID 1V5TA 1WZ0A 2KKCA 4JIOU 1V6EA 4PS7A 3VTWA 2XEWA 3DVNV 4IC7B 1RRBA 3TMPB 4MGIE 4K7WA 1WXAA 2CHWA 4EZKA 1ISNA 2FNJB 4BBNC 3CMMB 2MBBB 3M95A 2BWFA 4KIKA 4EUTA 3VH3B 4W9GA 4ZRKA 3T8MA 3UINB 4XC2A 2CHXA 4DDGD 3NY5A 1KM7A 1WGYA 3VTUA 2J0MA 1Y8RC 2N1VA 1BT0A 4DHZB 2K8HA 1E8XA 1VCBA 1Q0WB 3R7RA 3NZSA 3VDZA 3RZFA 2JVCA 2FAZA 1Z2MA 2LVQA 5L95C 3ML8A 3VH4B 5D2MB 1V5OA 1WX8A 2KD0A 2RR9A 2LRWA 2L00B 2W9NA 1J19A 4LJOB 3PLVA 4W9JA 3JSVA 3SD5A 5IAAC 3B08A 1YD8U 4ZRIA 3DCGA 4MM3A 4BKGA 1WY8A 4KDLB 2KTRA 2FCMA 3ZDMC 2KWUB 5DCNA 4GMVA 4P7IA 2CR5A 1Z5SB 2G4DB 4DHJB 4IM0A 3M62B 2LVOA 1M94A 1WJ6A 1VD2A 4XX5A 1TTNA 1UD7A 2KWVB 4KV2A 2AL3A 4TKNA 1Q5WB 3K9OB 2DAFA 4FLHA 2MBOA 1ZW7A 2WDTB 1V80A 2KN5A 2C7NB 4W9KA 3A33B 3V6EB 4IUMB 1WE6A 2ZCCA 4MGKE 2HD5B 4ANVA 3ZNHB 5DPWA 2BKFA 3VXWA 2LVPA 5G55A 5AZHA 1UH6A 3CSTA 4YL8A 2LGYA 2CHZA 2HJ8A 5LLIA 3SHQA 2ZNVB 3DVGY 3IFWB 4KZ0A 4HPMB 4FULA 2K25A 3UGBB 2KC1A 4PYUA 1MG8A 3Q3JA 2L0FA 2LXCA 4OVVA 3KYDD 2V3SA 3RYTA 4JQWC 5JZEB 2L8JA 2MBQA 4DK5A 2REXA 4KSLC 2L3ZA 3RULA 4DBGA 4A20A 2K8BA 4WWNA 2ZNVC 2I1KA 3V60A 2N9PC 5J17A 5E6NA 2Z0DB 1C3TA 1TGZB 2YLMA 5CTRC 2PE6B 2LXAA 3WA0A 2LGDA 2DHZA 3NS8A 2DX5B 2KLGA 2DYOA 4FHKA 4HXDA 3KH0A 3ZW3A 4WJNA 1X1MA 2M4NA 4IWPA 2EMTA 5CHVC 4GB9A 2ZPYA 2IO3B 3DQVA 4FJYA 3PVLA 1L7YA 4AWJA 1WE7A 2JRHA 3CF6E 3AI5A 2LJ5A 4IG7B 4AJYB 4MSQB 3PRZA 3T9LA 2IYDB 4W9FA 4W9LA 4AJWA 3UQAA 4GSWA 1TBEA 1K8RB 4J6IA 4PYZA 4AUQC 2RD0A 2IO2B 2XK5B 1P98A 5L83A 2LGXA 1GJZA 2IY1B 1ZGUB 4K81A 2L7RA 3QJZA 2LASA 4G11A 5D7GA 1WJ4A 5J18A 3B0AA 3H6NA 2LI5A 1WYWB 2XBBC 5AZGA 1Q1OA 1WIAA 2N9XA 3UF8A 2KQ7A 1OGWA 4NAWA 3QWZB 2KK8A 3KVFB 2V1YA 5AEKB 5CHWA 3OJ4B 1OTRB 1HE8A 3DPDA 4NJ6A 5C23A 3EHVA 4X57B 4BBNF 4ANXA 4I6LB 1UELA 2AEHA 4KIKB 2AWTA 1WGRA 2KHWB 4GOCA 4II2B 3ZRCA 2KJRA 2N4FA 3L54A 3VFKA 3A9KB 4ANWA 3PHWB 3GZNI 3ALBA 3WALA 4BFRA 1RLFA 1YX5B 4JL9A 3OLMD 4AOFA 2FIFA 2MW5A 2RSUA 1XT9B 2KDEB 2K8CA 3A9KA 2IZVB 1XQQA 4W9EA 1SGHA 3QQ8B 4IWOA 3CSFA 3ZTCA 1J8CA 2DZKA 5C1ZA 1WR1A 2JPHA 3L16A 3JVZX 1WM2A 2LUEA 3JSVB 4EEWA 2KJHB 1YQBA 4EOYA 3W1YA 5CX3A
chains in the Genus database with same CATH superfamily
1WGDA 3QK0A 4RH6A 3VR9B 4HCNB 5IP4D 2J0KA 2ZPNA 2M56B 4M01A 3HHMA 4M0WA 4WWPA 4LJPB 1XLQA 1FXAA 1AW7A 1AWDA 4JE3B 4F8CB 3P4QB 2LZ6A 3L0WB 3KYCD 3R66C 4II3B 4EZLA 1KRHA 2JWUA 3AEDB 2C7HA 3ZJTA 2ZCBA 1ZP0B 3DHGC 1LM8B 4GDKA 4ZRJA 2PMVA 1ESFA 3VUYA 4RMAA 2KX3A 1UNSA 2MCNB 2V0GA 4XZ4A 4GXBA 3BK2A 2AYOB 3NOBA 1T3QA 4N9F4 1PUTA 1V9JA 4IOIE 1P1AA 3C8YA 5DPSA 1CQVA 3HVDA 3BVMA 3NS1A 3K9PB 1L6VA 1QOAA 3SDLC 4BAXA 2VH1A 4FHJA 2WXMA 2JQRB 5HFYA 1KJTA 2IY0B 4HROA 4WAAA 4E74A 4B9KA 1B1ZA 4WH4A 1D5MC 4KZCA 2MBHA 2O2VA 4JPSA 3W1SA 4MJSA 2MH7A 4KGTA 4JGHB 2LGIA 3IAS1 1F52A 1YQ4B 1I4QA 3PRPB 2MP2A 4NQLB 1N60A 2WNMA 3L08A 2ON8A 3QAQA 1G6JA 4TSSA 4A90A 2MRPA 2Y5BB 1IYFA 1L0YB 1LFDA 4NY0A 4FADA 4YTPB 4A3OA 3HM6X 1YX6B 2E3TA 4GDLA 1V1PB 1JW9D 2GLSA 2AQ1B 3KUCB 2Q5WD 5E6JA 4ZRPA 3IG3A 2GOWA 2KVRA 4F1SA 2KDFB 1C1YB 4USAA 1KF6B 2C5LC 3A4SC 2G1EA 4WJQA 1SE9A 4M0WB 2G4SA 3PSEB 3AE6B 4O1NA 3DVGX 1QOGA 2IDYA 1YJ1A 2BWES 1GC6A 2KDBA 4WJOA 2GBMA 1PGAA 2IGGA 2PEAA 2GBJA 4C4VA 3VRAB 3VUXA 2WP9B 2V9HA 3PZ7A 2M17A 2KFKA 3JYUA 3N30A 4YTNB 4W9CA 4BKSA 2K6DB 3AU5A 1E8ZA 2J52A 4NJCA 3OAWA 1AN8A 5KHOA 2L05A 2WLBA 1SE4A 1FPYA 2D3CA 4TQ1A 1FXTB 4E71A 3B2GA 1EO6A 2MLBA 1D4BA 3H7PB 1PFDA 1V49A 1E7UA 1TS3A 3KUDB 1WF9A 5GMVA 3VUWA 1S1QB 2NCNA 4JX1C 4HPLB 3O65B 4RM9A 4BKSD 2MX2A 1E5WA 2JY6A 1QKZA 3L10B 4W9IA 1SSNA 1FFUA 3BWUD 3N20C 2O2VB 3GB1A 1UGMA 3VHTC 5LNK1 2QIEB 3QARA 5HKHA 2RPVA 4CHKA 1R4NB 3PPAA 2MP2B 2INPE 3PV1A 1I4PA 2I1JA 4B0MA 1V8CA 1WXSA 1V1OA 2DZJA 3W1SC 2AL6A 2KMAA 4MELA 4G3XB 1R4MB 1V86A 3NZUA 3AE3B 2C9WB 2N9EB 4HWIB 1JWMD 4R3DA 1KLVA 2KOXA 3LXFA 1YOVB 1XD3B 2QILA 3L17A 2JWZA 3V6CB 3ZVVA 2MA9B 1E7PB 2QJLA 2WXIA 3I5JC 3ZJVA 2RPQA 1E0ZA 4S17A 1V5TA 2RMMA 3NVWA 3VTWA 3DVNV 2CHWA 1ISNA 2FNJB 4BBNC 3URYA 3M95A 4KIKA 1VR9A 4EUTA 3VTUA 3W5UB 1Y8RC 4C4VB 1E8XA 4LLGM 3R7RA 2Z8LA 1ENFA 1SIJA 4WURA 2FUG1 2JVCA 5L95C 1CK1A 2W9NA 4LJOB 4A6QA 5TSSA 3PLVA 3SD5A 3JSVA 5JXVA 3B08A 1L6UA 3RMKC 4MM3A 2W54A 4BKGA 1XEEA 2J42A 5IO9A 4AQ7A 2BT6A 3PZ8A 2G4DB 2OEDA 4IM0A 1M94A 3Q2AC 1WJ6A 3AM9A 1T0QC 4TKNA 4YT0B 2MBOA 1TKEA 2C7NB 5C2TB 1M4VA 3KQ4A 2ACZB 4LK0M 1XLNA 1WGKA 2BKFA 3VXWA 3CSTA 2CHZA 5LLIA 4KZ0A 2K9XA 3R2IA 4FULA 4DQOC 2KAJA 2KC1A 2QMTA 2L0FA 3IT6B 4JQWC 5JZEB 2L8JA 3RULA 4DBGA 4IKGA 5D3IB 4WWNA 2Z0DB 2YLMA 3RNEC 2LGDA 2DHZA 3NVVA 2DX5B 4FHKA 3BVGA 1TY2A 1X1MA 3RNFC 4RGTA 1SXTA 3U52E 1C4PA 4AWJA 3AI5A 1IGDA 4AJYB 2MHJA 4MSQB 3PRZA 2IYDB 4AJWA 2BTEA 1Q10A 4GSWA 1GAQB 4KKIA 4M00A 3Q8CA 5L83A 1F77A 1P98A 2N7JA 2LGXA 2IY1B 2JXTA 5J18A 3H6NA 4XDCA 2CU3A 5AZGA 1WIAA 3MHZA 1F1HA 2KK8A 5AEKB 4N6EB 3DPDA 1HE8A 4MH8A 2AEHA 4KIKB 1DOIA 3ZRCA 1XXGA 4P6VF 3AE9B 3VFKA 1RYJA 1VJKA 4BFRA 4K3CA 2BVCA 4L2YA 1XT9B 2K8CA 3A9KA 4W9EA 3CSFA 5C1ZA 2LUEA 3JSVB 2D3AA 1JRPA 2JX5A 4EOYA 4S0RA 5MPOA 3NZ3A 1BXTA 5JHAA 2N7EA 2LGSA 3RT3B 1LXDA 3IBEA 1U4AA 1WGGA 2LRUA 3ML9A 4RFBA 3WIMA 4KSKC 2OJWA 1TKGA 1PQSA 2ZW1A 1OQYA 4DXAB 2RDGA 2C60A 3KUZA 5BO4B 2D2QA 2INDC 3AE8B 2FUHB 4LTUA 4BOSC 3A9JB 2WDVB 1MPEA 2KZRA 1CJEA 3X23A 4URKA 2A4ZA 3FKYA 4YWGG 3BVZA 1E90A 4NPNA 3E56A 3ABVB 2NPTB 1T0RC 2DNFA 2IBIB 4ANUA 2NS5A 1V2YA 3TEYA 1RAXA 2PW9A 1TS5A 3S2AA 2MWSB 1P7FA 2DWQA 2W55A 3PRMB 1TZOA 2H88B 4K3BA 4HCPB 5JHBA 4E3CA 4RM8A 1WX7A 3TJPA 2AX5A 1DGJA 3QHTA 5IA7A 5LXHA 1WRIA 1IPGA 3ZJUA 2DYMA 3U30A 3DBSA 3ZDTA 4IM2A 2I2YA 2NMQA 3W2DA 3X0WA 2G9HD 3ZGZA 1NI2A 2VRRB 4F7ZA 4HKZE 2HTME 5G2NA 2UYZB 3IHPC 4CYEA 3VTVA 1E8YA 3DWGC 4B95A 1A5RA 1SB3C 1OQQA 4FN2A 2OJRA 2LMCA 3HIZA 3U4EG 1R4NI 3LJ3A 4DXGA 4G50A 2LHDA 1EUVB 3R7QA 2YVCA 2D3BA 1R4MI 2J7QB 3H9DA 1D6EC 2JT4B 2G3QB 2QSDA 4XGAB 1E6EB 3IVFA 1XF5L 3U7DA 2A5UA 4NJ7A 2MQJA 2C7MB 1XCTL 4ASWC 1JWUD 2WQYB 3GE3C 1FNUA 3V05A 3DBLB 4ICVA 3V3XA 5AUIA 2PTLA 3VRBB 4GGQA 2KX0A 1GNUA 3EUB2 2QDFA 4XWWA 4IW0A 4K7UA 4DDID 4MDKE 3TEXA 1UBIA 4K1RB 1KTKA 2HTHA 4M8NA 5TR5A 3RD2A 2J0JA 1WM3A 2DAJA 3TL5A 3A4RA 2OHFA 2L1AA 2PVGC 2FCNA 2WDQB 3AV8A 1PYWD 1XLOA 1Y56A 2WYQA 4REZA 2E6XA 1L4DB 3Q3OC 3MJWA 1SBBB 2INNE 1N61A 1C4CA 2KXJA 4PS8A 3H7PA 5T8IA 1FFVA 3V62A 1UF0A 3DOWA 3NHEB 3TIXA 3ZNGC 1JCKB 4TUUA 2Y5PA 4HVBA 1T5XD 1CMXB 3P1MA 4US9A 3MC8A 4GIVA 5DPTA 4DHJD 1YMHE 3B2FA 4BZAA 4KGRA 3PS6A 2HDEA 1IP9A 2NBVB 2QEJC 2KLCA 4HK2A 3AEGB 1T0YA 4FJZA 2LUMA 2QCZA 2FBWB 3U8ZA 1KLGD 2W3RA 2NR2A 4ZYSA 5J2RA 3I3TB 2ZZPB 2CU1A 3RZWC 1K52A 2KACA 5LXIB 3WAPA 1RFAA 1K50A 3B9JA 2KWDA 2EELA 4WAFA 4A3PA 1I35A 4PS3A 2M0AA 1QOBA 3PTFC 1WWTA 1HEZE 4WQOB 2KFJA 4XE0A 3FILA 3SEBA 2WXFA 3AU4A 1P7EA 2IJ0A 4EFOA 2QC8A 3BK1A 5FKAC 3ZNZB 3ZNID 1V97A 3IAM1 4IC7B 4MGIE 1YJIA 4FXCA 1I4GA 3CMMB 3KWVA 3T8MA 3UINB 2CHXA 1WGYA 1PDXA 2K8HA 1Q0WB 3RPFC 3NZSA 2YEPB 3RZFA 1ZDXA 2FAZA 4YSXB 1GB1A 2BS4B 3VH4B 1V5OA 2KD0A 4W9JA 3UI3A 1YD8U 3NJTA 4KDLB 2FE8A 2KTRA 1RWSA 2FCMA 5DCNA 3TUOA 4DHJB 1VLBA 4XX5A 1UD7A 2NTSA 3GS2A 2KWVB 3KLSX 4KV2A 3N1ZC 3K9OB 3PO0A 2WDTB 5BYSA 3DBRB 2KN5A 3V6EB 3A33B 4IUMB 4J3OD 2WU2B 4RNAA 3Q8FA 5DPWA 2J4XA 2LVPA 5G55A 2INCC 4YL8A 2LGYA 2ZNVB 2BQQA 1EU4A 2K25A 2JU6X 2V3SA 1FMAD 1FXIA 1FRRA 4KSLC 4DXFA 4UDUC 2K8BA 2ZNVC 3V60A 5J17A 5E6NA 1C3TA 2BW2A 3NS8A 3KH0A 3W5VB 2M4NA 4IWPA 1UWMA 3TEZA 4GB9A 2GB1A 1WE7A 5BYQA 1C4AA 4W9FA 4W9LA 1K8RB 1NYQA 3WCQA 3BIID 3FILB 1I7HA 3P4RB 1ZGUB 4K81A 5D7GA 1WJ4A 3N9YC 2XBBC 4A55A 2KQ7A 3AEBB 1OGWA 3KVFB 1YN5A 1OTRB 4LNKA 2K5PA 3EHVA 1YN3A 4BBNF 4I6LB 1UELA 2AWTA 2WXLA 4WWMA 3L54A 4RGOS 1ZUD2 1YX5B 4JL9A 5AUKA 2RSUA 1TS2A 3MJ5A 3OWEB 3ZTCA 1FNWA 2DZKA 5H8YE 1HTOA 2JPHA 3JVZX 1WM2A 5BMGA 4EEWA 4IDIA 2AQ2B 3N3KB 2KTRB 3NVZA 2GBNA 3EC8A 1UUPA 1SF0A 1P3QU 2BPSA 3HM3A 1PGXA 4ZYNA 1JWBD 3SFDB 1IGCA 3WANA 4ICUA 1WMHB 1I4RA 3R2TA 4PK1A 4RF1A 1EF5A 4C00A 1FO4A 2ZVOA 3EGRA 4NQKE 1GB4A 3ZIMA 3EA6A 5HI1A 3TBLD 1LO5D 3RUIB 1YJJA 4BVUC 1SIFA 1TYGB 5EDSA 3HK0A 1DOXA 2FCQA 1ZDVA 2KQ4X 3A9JA 4H2AA 3ZO5B 1FM0D 3GOEA 1L0VB 2RGFA 2ZJDA 3B1LX 2GRIA 3AEAB 5D6JB 2BKRB 2ASQA 2NPTA 2GI9A 3HUIA 3QC8B 5HG2A 1RFKA 2GBKA 2R2QA 4HJKA 1KH0A 1QQRA 2X38A 4A9AA 3DBLI 2K39A 2WXKA 3IT4B 3LB8C 1NENB 1GOZA 1C78A 3ZKJC 4US8A 1JMLA 1WGHA 1VDVA 2L76A 1ZOYB 2K6QA 2Y3AA 3Q14C 2G45B 4MEMA 2KO3A 1QILA 1WI0A 4GU2A 4P1CC 3OJ3A 4DWFA 3ZTDA 4D2KA 1QT9A 4JLCA 1GG3A 3QCAA 1QF6A 2FIDA 3DHIC 1YQ3B 2UWQA 3AXCA 3Q6BA 1ZPSA 4WIPA 2W82A 2V4LA 1RM6C 2Y5CA 1E8WA 2JRIB 3GE8C 4WWOA 3KW5B 3Q3FA 3OG5A 2WXPA 2BYVE 3H7SA 3LDZE 4KKJA 1TT5B 4K7SA 1C76A 1VRAB 5EE3A 2Z59B 3GP7A 2JUOA 2FCSA 5FR6A 1NDDA 3A1QB 2KC2A 3SR6A 2BB6A 2LD9A 3AN1A 1WRDB 4HRSA 1YIWA 1J7BA 2WWZA 3C19A 4CO7A 1N62A 3UIOB 1P9DU 3ZLZA 4YXDB 1ACCA 2M8SA 2JZ3B 3EFUA 1KOTA 2D10A 1B9RA 2BYTA 1MHXA 2D07B 4GLSC 4C56C 3VAWA 4KDIC 4TMAB 3UIPB 3C0RB 2MSED 3PHXB 2L32A 5BMIA 1J7CA 1EU3A 2B76B 1I4XA 4FBJB 1HZ5A 3BZDB 1WR6E 3MFGA 3AULA 2DZMA 2BYEA 4ZRQA 1SJHD 2KDMA 4EKUA 4ACFA 1LQBA 3E9SA 3N1YC 4ARCA 3DBHI 1E7VA 2K3UA 2CS4A 1QZEA 2NTTA 2PE9A 1WXVA 2MBEA 1WZ3A 3AECB 4OVZA 1EF1A 1SEBD 4WJPA 3I57A 3V61A 3MHSD 1V81A 3PGEA 4M8MA 2V3NA 2WX0A 3DBRI 3ZUNA 4OVUA 2GBRA 2L0TA 2IGDA 1FNVA 4GN1A 2WXRA 3TCAA 2KTFA 1I4HA 4ZOHC 1JALA 4P16A 1D3ZA 2GMIC 3CWIA 3L4PA 2QHOA 2KN4A 2N1WA 4NNJB 4Q2JA 4IM3A 1UWXA 3APFA 3AH7A 4XYCA 1J7AA 1L0XB 1JRUA 3J9CA 2EMSA 3I9V1 3FAHA 1V6EA 4PS7A 2N9KA 3HRDD 1RRBA 2BBCA 1N63A 1T6BX 1WXAA 4EZKA 2KT7A 1T0SC 2W3SA 2BWFA 2PLPA 3AMZA 1MFWA 4DDGD 1KM7A 2J0MA 2N1VA 2D5GA 1C9FA 1VCBA 3AEEB 1MI0A 1FRDA 2WXNA 2V4IB 1MVKA 3MP9A 1LGRA 3ML8A 2LRWA 2VH2A 4ZRIA 3CIRB 4KX6B 1WY8A 2N9LA 3ZDMC 1KLUD 1IBXB 1Z5SB 3Q3MC 1OQRA 3HVZA 2WDRB 2LVOA 1OFFA 1VD2A 1JQ4A 3Q69A 4M02A 2AL3A 1Q5WB 1AYFA 5IOIA 1STEA 1UGJA 1WE6A 5G5HA 4C7YA 1UH6A 2M19A 3SHQA 4RGNA 3FC4A 2K0PA 3IFWB 1HZ6A 4OZBA 1FCCC 4PYUA 1MG4A 3Q3JA 2LXCA 5EE1A 2I38A 3KYDD 1QOFA 4OVVA 1A70A 3MC0B 2REXA 2L3ZA 4MACA 2I1KA 5CTRC 3WA0A 2KLGA 3ZW3A 3IXSA 4HXDA 1BUIC 4WJNA 2EMTA 2CJNA 2ZPYA 2IO3B 1L7YA 2JRHA 3CF6E 2LJ5A 2JYEA 4J6IA 1TBEA 4PYZA 3Q8EA 4AUQC 2IO2B 2WXJA 1GJZA 1F0ZA 2VZKD 5EE9A 4ZHOA 3QJZA 3BYYB 2SEBD 2LI5A 3UF8A 1ZE3D 1DYQA 4NAWA 1TJEA 1FEHA 3QWZB 3NRZA 4CQNA 1EM7A 4ITKA 2WXQA 3P4PB 5C23A 2KYWA 1K53A 1NI3A 4ANXA 2KHWB 4II2B 2JYTA 1XO3A 1QLBB 2N4FA 4L23A 4ANWA 3GZNI 4A8XC 1RLFA 3OLMD 5I4DA 3BYTB 1HA5A 2IZVB 4XWTA 3VR8B 4OHJA 5IKCM 2ICIA 4C7ZA 1TKYA 3W1YA 4TV3A 2KMMA 2YEPF 4LNNA 3DBHB 2R61A 3AE1B 2LJIA 2O6VA 1E10A 4W9DA 3P63A 2TSSA 2KNBA 4ZDVA 4G0NB 1WMHA 5BYRA 1L4ZB 1OEYA 4LNIA 1NYRA 4GDKB 2KJ6A 1P0RA 4P1BC 1I42A 4LNFA 2KQSA 4LCDE 3RNAC 3VQIA 2OOBB 2JSVX 1WSPA 3T3NA 3MTNB 2D3GA 1F2RI 2BYFA 4HDOA 3PT2B 1ET9A 2R2OA 3PLUA 3RCZA 5JH5C 2BF8B 2O6VD 2PVOD 4TQ0A 3DWMA 3P2BA 2DZIA 2VZKB 4YSYB 3ZRFA 2WXOA 5C3JB 2M0XA 1H8CA 5KHQA 2IGHA 4AS1A 2KANA 2BGFA 1HTQA 2M1MA 5E6PA 4MJSB 2NVUI 1YN4A 4FJVB 2DYBA 1WJUA 2N0SB 3UQBA 2EKEC 4HKQA 5BMHA 2NBWB 2ONQA 1TIFA 2PPHA 1FCLA 3AE5B 4EZJA 4MGYE 2SAKA 4NAWB 3PZDA 4OZCA 2L83A 1S3SG 3ZXRA 2X8XX 4I6PA 4LDTD 1H4RA 2JZZA 4GDLB 2PKOA 2IO1B 1UZXB 3ENEA 5D3DA 4KGSA 2AQ3B 1N5WA 3EECA 1NEKB 3RNCC 1TZ1A 3BY4B 2KMCA 2WS3B 2WXGA 1BMLC 1WX9A 1UBQA 2KDIA 3QIJA 1EWYC 3RI7C 3ETRA 5IN7A 4B0EA 2NBUA 4ARIA 3TEWA 3QA8A 4BOZB 3H1UA 2O6VB 5DPRA 1R7SA 1SE2A 1KFYB 2D11A 2N7DA 3A1QA 1WFYA 2UU7A 3AE2B 1AARA 4N58A 2J53A 1NBFC 1N5XA 2KFKB 4AP4C 1JWAD 1GPXA 3DDCB 1FIQA 1SJED 2MEKA 1WJNA 3WAOA 1C77A 1XCQL 1GUAB 2K1FA 1GC7A 4IWQA 4EE2A 3WAMA 4MGZE 2H89B 3NG0A 3I63C 4W9HA 5AZFA 4JWUC 4RF0A 5CHFA 3APCA 1WXQA 3T3OA 1F9JA 4NAMA 2ZEQA 3APDA 3LYYA 3ZQ4A 4FA6A 5H92C 4LDTB 3ONSA 3QX1A 1WXMA 2IO0B 1C79A 4MH0E 4BKTA 3W9CB 3L13A 4HDQA 1SE3A 3BINA 3DVNU 4DHZE 1J0GA 2DENB 2CKHB 2LWPA 3GZNB 3JW0X 2JXXA 3N32A 2KWCA 3VVWB 3RN9C 3M3JA 1ZKHA 2XNAC 4HJGE 4I6NB 3RNGC 3AE7B 2B3AA 2ZVNA 3R3MA 3P4SB 2HE7A 4MSMB 3ECIA 4KVGB 3RNBC 1D5XC 3U2SC 3DHHC 4HLEA 1CZPA 3AB5A 4OW0A 3SU8X 4NZLB 1WH3A 1MHHE 2Z0EB 3D32A 1L2NA 3M63B 1OEYJ 1K51A 4LNOA 2PJHA 2JF5A 3PREA 3O13A 2MJDA 2XK5A 4PT5A 4B6WA 4C80A 2XN9C 3R8BA 3AE4B 5E6OA 2WU5B 1DOYA 2PIAA 5FR3A 5D94A 2WX1A 1HQRD 1MJDA 3NUHB 1WZ0A 2DLBA 2KKCA 4JIOU 4N59A 4WQMA 4HPPA 4QAYA 2XEWA 3TMPB 3NVYA 4K7WA 4YTMB 3P42A 4OZAA 1E9MA 2MBBB 1XLPA 2WXHA 3VH3B 4W9GA 4ZRKA 1JWSD 4XC2A 3NY5A 4DHZB 1FD6A 1BT0A 4MT5A 1F2RC 3AEFB 1VZ7A 5FK9C 3VDZA 2LVQA 1Z2MA 4MM3B 3ZXVA 5D2MB 1WX8A 2RR9A 1L5PA 2L00B 1J19A 3U7ZA 5IAAC 2HJ1A 1ET6A 3DCGA 2KVZA 2JZPA 2KWUB 4RGMA 1ROEA 4GMVA 2ZW0A 4P7IA 2CR5A 2K22A 2IPKD 2DBYA 3M62B 2CJOA 1TTNA 1IBXA 1VZ8A 4FLHA 2DAFA 1ZW7A 1V80A 4W9KA 3H8HA 2MJ3A 2ZCCA 3Q3NC 4MGKE 1EWCA 2HD5B 4ANVA 3RFZB 3ZNHB 3MC9A 5AZHA 2HJ8A 2MJEA 3DVGY 3ZYYX 3Q8AA 4HPMB 3UGBB 1MG8A 1TS4A 2WGSA 3RYTA 4ZHPA 1HXYD 2MBQA 4DK5A 2LEKA 4A20A 2LHEA 4HEA1 2N9PC 1TGZB 1NVID 2RDBC 2BS2B 2LXAA 2PE6B 5EE0A 2DYOA 1TY0A 1N6ZA 1ZXHA 5CHVC 1WYGA 3DQVA 4FJYA 3PVLA 4IG7B 3T9LA 3UQAA 2L52A 3KWLA 2V3PA 2RD0A 2XK5B 5GXGB 2L7RA 4YSZB 2LASA 4G11A 3SFEB 3B0AA 3N1XC 4JWSC 1WYWB 4RCOA 1Q1OA 2RDHA 2N9XA 4XDDA 2LFIA 2WHIA 2EKIA 2V1YA 5CHWA 1JROA 3OJ4B 4L1BA 2BB5A 4NJ6A 5G5GA 4X57B 1IUEA 1WGRA 4GOCA 5HHDG 2KJRA 3A9KB 3PHWB 2BS3B 3ALBA 3WALA 4AOFA 2FIFA 2MW5A 1PGBA 3EFCA 1V1PA 1VZ6A 3TSSA 2KDEB 3Q8BA 1ZXIA 1XQQA 1SGHA 3QQ8B 4IWOA 1J8CA 1WR1A 3L16A 2KJHB 1YQBA 1YNTE 5CX3A 1D5ZC
chains in the Genus database with same CATH topology
1WGDA 3QK0A 3N3KB 5JHAA 2N7EA 2KTRB 4HCNB 4TV3A 2GBNA 3EC8A 2J0KA 1P3QU 2BPSA 2ZPNA 3HM3A 3RT3B 4ZYNA 3HHMA 1LXDA 4WWPA 4LJPB 3IBEA 1U4AA 1WGGA 2LRUA 3WANA 4ICUA 1WMHB 2O6VA 3ML9A 4F8CB 3WIMA 4W9DA 4KSKC 2KNBA 4ZDVA 2LZ6A 1PQSA 4G0NB 1EF5A 3L0WB 1OQYA 4DXAB 1WMHA 2C60A 3KYCD 2ZVOA 1OEYA 3R66C 4II3B 4NQKE 4EZLA 3KUZA 3ZIMA 4GDKB 2KJ6A 2C7HA 5BO4B 1P0RA 2D2QA 2FUHB 3TBLD 1I42A 3RUIB 2ZCBA 4BOSC 3A9JB 2KQSA 4LCDE 3VQIA 1SIFA 2KZRA 4BVUC 2OOBB 1LM8B 4GDKA 5EDSA 3HK0A 4ZRJA 3MTNB 2FCQA 2D3GA 3X23A 4URKA 3VUYA 2A4ZA 2BYFA 3A9JA 4HDOA 3PT2B 3ZO5B 4RMAA 3GOEA 1E90A 2R2OA 3PLUA 4NPNA 3RCZA 5JH5C 2KX3A 2BF8B 2RGFA 2ZJDA 2MCNB 3B1LX 2NPTB 2O6VD 4XZ4A 4GXBA 2IBIB 2AYOB 3NOBA 4ANUA 4N9F4 5D6JB 4TQ0A 2NS5A 3P2BA 1V2YA 2DZIA 1V9JA 3ZRFA 2BKRB 2ASQA 1RAXA 1P1AA 2NPTA 5DPSA 2M0XA 1H8CA 5KHQA 3S2AA 3QC8B 2MWSB 2GBKA 2R2QA 4HJKA 3K9PB 3PRMB 3DBLI 2KANA 3SDLC 2K39A 2BGFA 4FHJA 2M1MA 5E6PA 4HCPB 4MJSB 2NVUI 5JHBA 1KJTA 2IY0B 4WAAA 4E74A 4FJVB 4B9KA 4E3CA 2DYBA 1WJUA 4RM8A 1WX7A 2MBHA 2O2VA 4KZCA 3TJPA 3W1SA 3QHTA 4MJSA 3UQBA 5IA7A 2EKEC 5LXHA 4JGHB 1IPGA 2DYMA 2NBWB 3U30A 3ZKJC 3DBSA 2PPHA 3ZDTA 3PRPB 1WGHA 2MP2A 4IM2A 4NQLB 2L76A 4EZJA 4MGYE 2K6QA 3L08A 4NAWB 3PZDA 3X0WA 2G45B 1NI2A 2VRRB 4MEMA 4F7ZA 2KO3A 1WI0A 3QAQA 4GU2A 1G6JA 3OJ3A 4DWFA 1S3SG 3ZTDA 5G2NA 4JLCA 1GG3A 3QCAA 2UYZB 2MRPA 2Y5BB 4I6PA 1IYFA 3IHPC 1LFDA 4LDTD 2FIDA 4CYEA 3VTVA 1H4RA 1E8YA 2JZZA 4GDLB 4NY0A 4FADA 4B95A 4A3OA 3HM6X 1A5RA 2IO1B 1UZXB 3ENEA 1YX6B 4FN2A 2OJRA 2UWQA 3AXCA 4GDLA 3HIZA 1R4NI 3EECA 3LJ3A 2V4LA 1TZ1A 3BY4B 4G50A 2KMCA 1EUVB 3KUCB 1E8WA 2GOWA 2JRIB 1WX9A 2KVRA 3IG3A 4WWOA 3KW5B 4F1SA 3R7QA 1UBQA 2KDIA 3Q3FA 3QIJA 2YVCA 1R4MI 2KDFB 2BYVE 1C1YB 2NBUA 2J7QB 3H7SA 3LDZE 3H9DA 2JT4B 2G3QB 2C5LC 3QA8A 3A4SC 4WJQA 1SE9A 4K7SA 4M0WB 4BOZB 2G4SA 3PSEB 2Z59B 2JUOA 2FCSA 3H1UA 5FR6A 1NDDA 3A1QB 3IVFA 2KC2A 3DVGX 3U7DA 2O6VB 2A5UA 2LD9A 1WRDB 5DPRA 4NJ7A 2MQJA 2C7MB 1YIWA 2WWZA 2D11A 2N7DA 3A1QA 4ASWC 1YJ1A 2BWES 1WFYA 1AARA 4CO7A 1GC6A 1NBFC 3UIOB 1P9DU 2KDBA 2KFKB 4WJOA 2GBMA 3ZLZA 2M8SA 2JZ3B 2GBJA 2PEAA 3EFUA 4AP4C 1KOTA 3VUXA 4ICVA 2D10A 2M17A 3DDCB 2KFKA 3JYUA 1WJNA 2KX0A 1GNUA 3N30A 4GGQA 3WAOA 4W9CA 4BKSA 2D07B 2K6DB 3AU5A 1GUAB 1E8ZA 4IW0A 2K1FA 1GC7A 4IWQA 4K7UA 3VAWA 4MDKE 4KDIC 3OAWA 4DDID 3WAMA 3UIPB 1UBIA 4K1RB 4MGZE 3C0RB 5KHOA 2HTHA 2MSED 2L05A 3PHXB 4M8NA 5TR5A 4TQ1A 4W9HA 1FXTB 5AZFA 4E71A 3RD2A 2J0JA 1WM3A 2DAJA 5CHFA 3TL5A 1EO6A 2MLBA 3A4RA 4FBJB 2FCNA 1WR6E 3H7PB 3AULA 1V49A 1E7UA 2WYQA 3APCA 3KUDB 1WF9A 2DZMA 2BYEA 5GMVA 3VUWA 1F9JA 3MJWA 1S1QB 2KXJA 2NCNA 2ZEQA 3APDA 3H7PA 4PS8A 3V62A 4HPLB 3O65B 4RM9A 4FA6A 4BKSD 3DOWA 2MX2A 3NHEB 3TIXA 1E5WA 2JY6A 3ZNGC 4LDTB 4EKUA 3ONSA 3L10B 4W9IA 1LQBA 4TUUA 3QX1A 2O2VB 1WXMA 2IO0B 1UGMA 4MH0E 4BKTA 4HVBA 3L13A 3VHTC 1CMXB 4HDQA 3BINA 3DBHI 3QARA 1E7VA 5HKHA 4CHKA 2CS4A 3DVNU 4DHZE 1J0GA 3PPAA 1QZEA 2DENB 2CKHB 2PE9A 4GIVA 2LWPA 1WXVA 5DPTA 4DHJD 2MP2B 3JW0X 2MBEA 3PV1A 2JXXA 3N32A 2KWCA 1WZ3A 2I1JA 3M3JA 3PS6A 3VVWB 1EF1A 1WXSA 4WJPA 1ZKHA 2DZJA 3V61A 1IP9A 2NBVB 3MHSD 3W1SC 2AL6A 2KLCA 2KMAA 4MELA 4G3XB 1V81A 3PGEA 4HK2A 4I6NB 4M8MA 2WX0A 1T0YA 1V86A 3DBRI 4FJZA 3ZUNA 4OVUA 3NZUA 2GBRA 2B3AA 2C9WB 2N9EB 2L0TA 2ZVNA 3R3MA 4HWIB 3U8ZA 2HE7A 4MSMB 2NR2A 3ECIA 1KLVA 5J2RA 3I3TB 4GN1A 4KVGB 2KOXA 2ZZPB 2CU1A 3TCAA 4HLEA 3SU8X 2KTFA 3RZWC 1WH3A 5LXIB 2Z0EB 3D32A 1L2NA 3WAPA 1RFAA 1XD3B 2JWZA 1OEYJ 3L17A 3M63B 3V6CB 1D3ZA 2GMIC 3ZVVA 2QHOA 2MA9B 4A3PA 1I35A 2PJHA 2N1WA 2JF5A 3PREA 4NNJB 4IM3A 4PS3A 3PTFC 2XK5A 4WQOB 2KFJA 4B6WA 3APFA 1JRUA 3AU4A 5E6OA 4EFOA 5D94A 2RPQA 2WX1A 2EMSA 3ZNZB 3ZNID 1V5TA 1WZ0A 2KKCA 4JIOU 1V6EA 4PS7A 3VTWA 2XEWA 3DVNV 4IC7B 1RRBA 3TMPB 4MGIE 4K7WA 1WXAA 2CHWA 4EZKA 1ISNA 2FNJB 4BBNC 3CMMB 2MBBB 3M95A 2BWFA 4KIKA 4EUTA 3VH3B 4W9GA 4ZRKA 3T8MA 3UINB 4XC2A 2CHXA 4DDGD 3NY5A 1KM7A 1WGYA 3VTUA 2J0MA 1Y8RC 2N1VA 1BT0A 4DHZB 2K8HA 1E8XA 1VCBA 1Q0WB 3R7RA 3NZSA 3VDZA 3RZFA 2JVCA 2FAZA 1Z2MA 2LVQA 5L95C 3ML8A 3VH4B 5D2MB 1V5OA 1WX8A 2KD0A 2RR9A 2LRWA 2L00B 2W9NA 1J19A 4LJOB 3PLVA 4W9JA 3JSVA 3SD5A 5IAAC 3B08A 1YD8U 4ZRIA 3DCGA 4MM3A 4BKGA 1WY8A 4KDLB 2KTRA 2FCMA 3ZDMC 2KWUB 5DCNA 4GMVA 4P7IA 2CR5A 1Z5SB 2G4DB 4DHJB 4IM0A 3M62B 2LVOA 1M94A 1WJ6A 1VD2A 4XX5A 1TTNA 1UD7A 2KWVB 4KV2A 2AL3A 4TKNA 1Q5WB 3K9OB 2DAFA 4FLHA 2MBOA 1ZW7A 2WDTB 1V80A 2KN5A 2C7NB 4W9KA 3A33B 3V6EB 4IUMB 1WE6A 2ZCCA 4MGKE 2HD5B 4ANVA 3ZNHB 5DPWA 2BKFA 3VXWA 2LVPA 5G55A 5AZHA 1UH6A 3CSTA 4YL8A 2LGYA 2CHZA 2HJ8A 5LLIA 3SHQA 2ZNVB 3DVGY 3IFWB 4KZ0A 4HPMB 4FULA 2K25A 3UGBB 2KC1A 4PYUA 1MG8A 3Q3JA 2L0FA 2LXCA 4OVVA 3KYDD 2V3SA 3RYTA 4JQWC 5JZEB 2L8JA 2MBQA 4DK5A 2REXA 4KSLC 2L3ZA 3RULA 4DBGA 4A20A 2K8BA 4WWNA 2ZNVC 2I1KA 3V60A 2N9PC 5J17A 5E6NA 2Z0DB 1C3TA 1TGZB 2YLMA 5CTRC 2PE6B 2LXAA 3WA0A 2LGDA 2DHZA 3NS8A 2DX5B 2KLGA 2DYOA 4FHKA 4HXDA 3KH0A 3ZW3A 4WJNA 1X1MA 2M4NA 4IWPA 2EMTA 5CHVC 4GB9A 2ZPYA 2IO3B 3DQVA 4FJYA 3PVLA 1L7YA 4AWJA 1WE7A 2JRHA 3CF6E 3AI5A 2LJ5A 4IG7B 4AJYB 4MSQB 3PRZA 3T9LA 2IYDB 4W9FA 4W9LA 4AJWA 3UQAA 4GSWA 1TBEA 1K8RB 4J6IA 4PYZA 4AUQC 2RD0A 2IO2B 2XK5B 1P98A 5L83A 2LGXA 1GJZA 2IY1B 1ZGUB 4K81A 2L7RA 3QJZA 2LASA 4G11A 5D7GA 1WJ4A 5J18A 3B0AA 3H6NA 2LI5A 1WYWB 2XBBC 5AZGA 1Q1OA 1WIAA 2N9XA 3UF8A 2KQ7A 1OGWA 4NAWA 3QWZB 2KK8A 3KVFB 2V1YA 5AEKB 5CHWA 3OJ4B 1OTRB 1HE8A 3DPDA 4NJ6A 5C23A 3EHVA 4X57B 4BBNF 4ANXA 4I6LB 1UELA 2AEHA 4KIKB 2AWTA 1WGRA 2KHWB 4GOCA 4II2B 3ZRCA 2KJRA 2N4FA 3L54A 3VFKA 3A9KB 4ANWA 3PHWB 3GZNI 3ALBA 3WALA 4BFRA 1RLFA 1YX5B 4JL9A 3OLMD 4AOFA 2FIFA 2MW5A 2RSUA 1XT9B 2KDEB 2K8CA 3A9KA 2IZVB 1XQQA 4W9EA 1SGHA 3QQ8B 4IWOA 3CSFA 3ZTCA 1J8CA 2DZKA 5C1ZA 1WR1A 2JPHA 3L16A 3JVZX 1WM2A 2LUEA 3JSVB 4EEWA 2KJHB 1YQBA 4EOYA 3W1YA 5CX3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WGD A;  3QK0 A;  3N3K B;  5JHA A;  2N7E A;  2KTR B;  4HCN B;  4TV3 A;  2GBN A;  3EC8 A;  2J0K A;  1P3Q U;  2BPS A;  2ZPN A;  3HM3 A;  3RT3 B;  4ZYN A;  3HHM A;  1LXD A;  4WWP A;  4LJP B;  3IBE A;  1U4A A;  1WGG A;  2LRU A;  3WAN A;  4ICU A;  1WMH B;  2O6V A;  3ML9 A;  4F8C B;  3WIM A;  4W9D A;  4KSK C;  2KNB A;  4ZDV A;  2LZ6 A;  1PQS A;  4G0N B;  1EF5 A;  3L0W B;  1OQY A;  4DXA B;  1WMH A;  2C60 A;  3KYC D;  2ZVO A;  1OEY A;  3R66 C;  4II3 B;  4NQK E;  4EZL A;  3KUZ A;  3ZIM A;  4GDK B;  2KJ6 A;  2C7H A;  5BO4 B;  1P0R A;  2D2Q A;  2FUH B;  3TBL D;  1I42 A;  3RUI B;  2ZCB A;  4BOS C;  3A9J B;  2KQS A;  4LCD E;  3VQI A;  1SIF A;  2KZR A;  4BVU C;  2OOB B;  1LM8 B;  4GDK A;  5EDS A;  3HK0 A;  4ZRJ A;  3MTN B;  2FCQ A;  2D3G A;  3X23 A;  4URK A;  3VUY A;  2A4Z A;  2BYF A;  3A9J A;  4HDO A;  3PT2 B;  3ZO5 B;  4RMA A;  3GOE A;  1E90 A;  2R2O A;  3PLU A;  4NPN A;  3RCZ A;  5JH5 C;  2KX3 A;  2BF8 B;  2RGF A;  2ZJD A;  2MCN B;  3B1L X;  2NPT B;  2O6V D;  4XZ4 A;  4GXB A;  2IBI B;  2AYO B;  3NOB A;  4ANU A;  4N9F 4;  5D6J B;  4TQ0 A;  2NS5 A;  3P2B A;  1V2Y A;  2DZI A;  1V9J A;  3ZRF A;  2BKR B;  2ASQ A;  1RAX A;  1P1A A;  2NPT A;  5DPS A;  2M0X A;  1H8C A;  5KHQ A;  3S2A A;  3QC8 B;  2MWS B;  2GBK A;  2R2Q A;  4HJK A;  3K9P B;  3PRM B;  3DBL I;  2KAN A;  3SDL C;  2K39 A;  2BGF A;  4FHJ A;  2M1M A;  5E6P A;  4HCP B;  4MJS B;  2NVU I;  5JHB A;  1KJT A;  2IY0 B;  4WAA A;  4E74 A;  4FJV B;  4B9K A;  4E3C A;  2DYB A;  1WJU A;  4RM8 A;  1WX7 A;  2MBH A;  2O2V A;  4KZC A;  3TJP A;  3W1S A;  3QHT A;  4MJS A;  3UQB A;  5IA7 A;  2EKE C;  5LXH A;  4JGH B;  1IPG A;  2DYM A;  2NBW B;  3U30 A;  3ZKJ C;  3DBS A;  2PPH A;  3ZDT A;  3PRP B;  1WGH A;  2MP2 A;  4IM2 A;  4NQL B;  2L76 A;  4EZJ A;  4MGY E;  2K6Q A;  3L08 A;  4NAW B;  3PZD A;  3X0W A;  2G45 B;  1NI2 A;  2VRR B;  4MEM A;  4F7Z A;  2KO3 A;  1WI0 A;  3QAQ A;  4GU2 A;  1G6J A;  3OJ3 A;  4DWF A;  1S3S G;  3ZTD A;  5G2N A;  4JLC A;  1GG3 A;  3QCA A;  2UYZ B;  2MRP A;  2Y5B B;  4I6P A;  1IYF A;  3IHP C;  1LFD A;  4LDT D;  2FID A;  4CYE A;  3VTV A;  1H4R A;  1E8Y A;  2JZZ A;  4GDL B;  4NY0 A;  4FAD A;  4B95 A;  4A3O A;  3HM6 X;  1A5R A;  2IO1 B;  1UZX B;  3ENE A;  1YX6 B;  4FN2 A;  2OJR A;  2UWQ A;  3AXC A;  4GDL A;  3HIZ A;  1R4N I;  3EEC A;  3LJ3 A;  2V4L A;  1TZ1 A;  3BY4 B;  4G50 A;  2KMC A;  1EUV B;  3KUC B;  1E8W A;  2GOW A;  2JRI B;  1WX9 A;  2KVR A;  3IG3 A;  4WWO A;  3KW5 B;  4F1S A;  3R7Q A;  1UBQ A;  2KDI A;  3Q3F A;  3QIJ A;  2YVC A;  1R4M I;  2KDF B;  2BYV E;  1C1Y B;  2NBU A;  2J7Q B;  3H7S A;  3LDZ E;  3H9D A;  2JT4 B;  2G3Q B;  2C5L C;  3QA8 A;  3A4S C;  4WJQ A;  1SE9 A;  4K7S A;  4M0W B;  4BOZ B;  2G4S A;  3PSE B;  2Z59 B;  2JUO A;  2FCS A;  3H1U A;  5FR6 A;  1NDD A;  3A1Q B;  3IVF A;  2KC2 A;  3DVG X;  3U7D A;  2O6V B;  2A5U A;  2LD9 A;  1WRD B;  5DPR A;  4NJ7 A;  2MQJ A;  2C7M B;  1YIW A;  2WWZ A;  2D11 A;  2N7D A;  3A1Q A;  4ASW C;  1YJ1 A;  2BWE S;  1WFY A;  1AAR A;  4CO7 A;  1GC6 A;  1NBF C;  3UIO B;  1P9D U;  2KDB A;  2KFK B;  4WJO A;  2GBM A;  3ZLZ A;  2M8S A;  2JZ3 B;  2GBJ A;  2PEA A;  3EFU A;  4AP4 C;  1KOT A;  3VUX A;  4ICV A;  2D10 A;  2M17 A;  3DDC B;  2KFK A;  3JYU A;  1WJN A;  2KX0 A;  1GNU A;  3N30 A;  4GGQ A;  3WAO A;  4W9C A;  4BKS A;  2D07 B;  2K6D B;  3AU5 A;  1GUA B;  1E8Z A;  4IW0 A;  2K1F A;  1GC7 A;  4IWQ A;  4K7U A;  3VAW A;  4MDK E;  4KDI C;  3OAW A;  4DDI D;  3WAM A;  3UIP B;  1UBI A;  4K1R B;  4MGZ E;  3C0R B;  5KHO A;  2HTH A;  2MSE D;  2L05 A;  3PHX B;  4M8N A;  5TR5 A;  4TQ1 A;  4W9H A;  1FXT B;  5AZF A;  4E71 A;  3RD2 A;  2J0J A;  1WM3 A;  2DAJ A;  5CHF A;  3TL5 A;  1EO6 A;  2MLB A;  3A4R A;  4FBJ B;  2FCN A;  1WR6 E;  3H7P B;  3AUL A;  1V49 A;  1E7U A;  2WYQ A;  3APC A;  3KUD B;  1WF9 A;  2DZM A;  2BYE A;  5GMV A;  3VUW A;  1F9J A;  3MJW A;  1S1Q B;  2KXJ A;  2NCN A;  2ZEQ A;  3APD A;  3H7P A;  4PS8 A;  3V62 A;  4HPL B;  3O65 B;  4RM9 A;  4FA6 A;  4BKS D;  3DOW A;  2MX2 A;  3NHE B;  3TIX A;  1E5W A;  2JY6 A;  3ZNG C;  4LDT B;  4EKU A;  3ONS A;  3L10 B;  4W9I A;  1LQB A;  4TUU A;  3QX1 A;  2O2V B;  1WXM A;  2IO0 B;  1UGM A;  4MH0 E;  4BKT A;  4HVB A;  3L13 A;  3VHT C;  1CMX B;  4HDQ A;  3BIN A;  3DBH I;  3QAR A;  1E7V A;  5HKH A;  4CHK A;  2CS4 A;  3DVN U;  4DHZ E;  1J0G A;  3PPA A;  1QZE A;  2DEN B;  2CKH B;  2PE9 A;  4GIV A;  2LWP A;  1WXV A;  5DPT A;  4DHJ D;  2MP2 B;  3JW0 X;  2MBE A;  3PV1 A;  2JXX A;  3N32 A;  2KWC A;  1WZ3 A;  2I1J A;  3M3J A;  3PS6 A;  3VVW B;  1EF1 A;  1WXS A;  4WJP A;  1ZKH A;  2DZJ A;  3V61 A;  1IP9 A;  2NBV B;  3MHS D;  3W1S C;  2AL6 A;  2KLC A;  2KMA A;  4MEL A;  4G3X B;  1V81 A;  3PGE A;  4HK2 A;  4I6N B;  4M8M A;  2WX0 A;  1T0Y A;  1V86 A;  3DBR I;  4FJZ A;  3ZUN A;  4OVU A;  3NZU A;  2GBR A;  2B3A A;  2C9W B;  2N9E B;  2L0T A;  2ZVN A;  3R3M A;  4HWI B;  3U8Z A;  2HE7 A;  4MSM B;  2NR2 A;  3ECI A;  1KLV A;  5J2R A;  3I3T B;  4GN1 A;  4KVG B;  2KOX A;  2ZZP B;  2CU1 A;  3TCA A;  4HLE A;  3SU8 X;  2KTF A;  3RZW C;  1WH3 A;  5LXI B;  2Z0E B;  3D32 A;  1L2N A;  3WAP A;  1RFA A;  1XD3 B;  2JWZ A;  1OEY J;  3L17 A;  3M63 B;  3V6C B;  1D3Z A;  2GMI C;  3ZVV A;  2QHO A;  2MA9 B;  4A3P A;  1I35 A;  2PJH A;  2N1W A;  2JF5 A;  3PRE A;  4NNJ B;  4IM3 A;  4PS3 A;  3PTF C;  2XK5 A;  4WQO B;  2KFJ A;  4B6W A;  3APF A;  1JRU A;  3AU4 A;  5E6O A;  4EFO A;  5D94 A;  2RPQ A;  2WX1 A;  2EMS A;  3ZNZ B;  3ZNI D;  1V5T A;  1WZ0 A;  2KKC A;  4JIO U;  1V6E A;  4PS7 A;  3VTW A;  2XEW A;  3DVN V;  4IC7 B;  1RRB A;  3TMP B;  4MGI E;  4K7W A;  1WXA A;  2CHW A;  4EZK A;  1ISN A;  2FNJ B;  4BBN C;  3CMM B;  2MBB B;  3M95 A;  2BWF A;  4KIK A;  4EUT A;  3VH3 B;  4W9G A;  4ZRK A;  3T8M A;  3UIN B;  4XC2 A;  2CHX A;  4DDG D;  3NY5 A;  1KM7 A;  1WGY A;  3VTU A;  2J0M A;  1Y8R C;  2N1V A;  1BT0 A;  4DHZ B;  2K8H A;  1E8X A;  1VCB A;  1Q0W B;  3R7R A;  3NZS A;  3VDZ A;  3RZF A;  2JVC A;  2FAZ A;  1Z2M A;  2LVQ A;  5L95 C;  3ML8 A;  3VH4 B;  5D2M B;  1V5O A;  1WX8 A;  2KD0 A;  2RR9 A;  2LRW A;  2L00 B;  2W9N A;  1J19 A;  4LJO B;  3PLV A;  4W9J A;  3JSV A;  3SD5 A;  5IAA C;  3B08 A;  1YD8 U;  4ZRI A;  3DCG A;  4MM3 A;  4BKG A;  1WY8 A;  4KDL B;  2KTR A;  2FCM A;  3ZDM C;  2KWU B;  5DCN A;  4GMV A;  4P7I A;  2CR5 A;  1Z5S B;  2G4D B;  4DHJ B;  4IM0 A;  3M62 B;  2LVO A;  1M94 A;  1WJ6 A;  1VD2 A;  4XX5 A;  1TTN A;  1UD7 A;  2KWV B;  4KV2 A;  2AL3 A;  4TKN A;  1Q5W B;  3K9O B;  2DAF A;  4FLH A;  2MBO A;  1ZW7 A;  2WDT B;  1V80 A;  2KN5 A;  2C7N B;  4W9K A;  3A33 B;  3V6E B;  4IUM B;  1WE6 A;  2ZCC A;  4MGK E;  2HD5 B;  4ANV A;  3ZNH B;  5DPW A;  2BKF A;  3VXW A;  2LVP A;  5G55 A;  5AZH A;  1UH6 A;  3CST A;  4YL8 A;  2LGY A;  2CHZ A;  2HJ8 A;  5LLI A;  3SHQ A;  2ZNV B;  3DVG Y;  3IFW B;  4KZ0 A;  4HPM B;  4FUL A;  2K25 A;  3UGB B;  2KC1 A;  4PYU A;  1MG8 A;  3Q3J A;  2L0F A;  2LXC A;  4OVV A;  3KYD D;  2V3S A;  3RYT A;  4JQW C;  5JZE B;  2L8J A;  2MBQ A;  4DK5 A;  2REX A;  4KSL C;  2L3Z A;  3RUL A;  4DBG A;  4A20 A;  2K8B A;  4WWN A;  2ZNV C;  2I1K A;  3V60 A;  2N9P C;  5J17 A;  5E6N A;  2Z0D B;  1C3T A;  1TGZ B;  2YLM A;  5CTR C;  2PE6 B;  2LXA A;  3WA0 A;  2LGD A;  2DHZ A;  3NS8 A;  2DX5 B;  2KLG A;  2DYO A;  4FHK A;  4HXD A;  3KH0 A;  3ZW3 A;  4WJN A;  1X1M A;  2M4N A;  4IWP A;  2EMT A;  5CHV C;  4GB9 A;  2ZPY A;  2IO3 B;  3DQV A;  4FJY A;  3PVL A;  1L7Y A;  4AWJ A;  1WE7 A;  2JRH A;  3CF6 E;  3AI5 A;  2LJ5 A;  4IG7 B;  4AJY B;  4MSQ B;  3PRZ A;  3T9L A;  2IYD B;  4W9F A;  4W9L A;  4AJW A;  3UQA A;  4GSW A;  1TBE A;  1K8R B;  4J6I A;  4PYZ A;  4AUQ C;  2RD0 A;  2IO2 B;  2XK5 B;  1P98 A;  5L83 A;  2LGX A;  1GJZ A;  2IY1 B;  1ZGU B;  4K81 A;  2L7R A;  3QJZ A;  2LAS A;  4G11 A;  5D7G A;  1WJ4 A;  5J18 A;  3B0A A;  3H6N A;  2LI5 A;  1WYW B;  2XBB C;  5AZG A;  1Q1O A;  1WIA A;  2N9X A;  3UF8 A;  2KQ7 A;  1OGW A;  4NAW A;  3QWZ B;  2KK8 A;  3KVF B;  2V1Y A;  5AEK B;  5CHW A;  3OJ4 B;  1OTR B;  1HE8 A;  3DPD A;  4NJ6 A;  5C23 A;  3EHV A;  4X57 B;  4BBN F;  4ANX A;  4I6L B;  1UEL A;  2AEH A;  4KIK B;  2AWT A;  1WGR A;  2KHW B;  4GOC A;  4II2 B;  3ZRC A;  2KJR A;  2N4F A;  3L54 A;  3VFK A;  3A9K B;  4ANW A;  3PHW B;  3GZN I;  3ALB A;  3WAL A;  4BFR A;  1RLF A;  1YX5 B;  4JL9 A;  3OLM D;  4AOF A;  2FIF A;  2MW5 A;  2RSU A;  1XT9 B;  2KDE B;  2K8C A;  3A9K A;  2IZV B;  1XQQ A;  4W9E A;  1SGH A;  3QQ8 B;  4IWO A;  3CSF A;  3ZTC A;  1J8C A;  2DZK A;  5C1Z A;  1WR1 A;  2JPH A;  3L16 A;  3JVZ X;  1WM2 A;  2LUE A;  3JSV B;  4EEW A;  2KJH B;  1YQB A;  4EOY A;  3W1Y A;  5CX3 A; 
#chains in the Genus database with same CATH topology
 1WGD A;  3QK0 A;  4RH6 A;  3VR9 B;  4HCN B;  5IP4 D;  2J0K A;  2ZPN A;  2M56 B;  4M01 A;  3HHM A;  4M0W A;  4WWP A;  4LJP B;  1XLQ A;  1FXA A;  1AW7 A;  1AWD A;  4JE3 B;  4F8C B;  3P4Q B;  2LZ6 A;  3L0W B;  3KYC D;  3R66 C;  4II3 B;  4EZL A;  1KRH A;  2JWU A;  3AED B;  2C7H A;  3ZJT A;  2ZCB A;  1ZP0 B;  3DHG C;  1LM8 B;  4GDK A;  4ZRJ A;  2PMV A;  1ESF A;  3VUY A;  4RMA A;  2KX3 A;  1UNS A;  2MCN B;  2V0G A;  4XZ4 A;  4GXB A;  3BK2 A;  2AYO B;  3NOB A;  1T3Q A;  4N9F 4;  1PUT A;  1V9J A;  4IOI E;  1P1A A;  3C8Y A;  5DPS A;  1CQV A;  3HVD A;  3BVM A;  3NS1 A;  3K9P B;  1L6V A;  1QOA A;  3SDL C;  4BAX A;  2VH1 A;  4FHJ A;  2WXM A;  2JQR B;  5HFY A;  1KJT A;  2IY0 B;  4HRO A;  4WAA A;  4E74 A;  4B9K A;  1B1Z A;  4WH4 A;  1D5M C;  4KZC A;  2MBH A;  2O2V A;  4JPS A;  3W1S A;  4MJS A;  2MH7 A;  4KGT A;  4JGH B;  2LGI A;  3IAS 1;  1F52 A;  1YQ4 B;  1I4Q A;  3PRP B;  2MP2 A;  4NQL B;  1N60 A;  2WNM A;  3L08 A;  2ON8 A;  3QAQ A;  1G6J A;  4TSS A;  4A90 A;  2MRP A;  2Y5B B;  1IYF A;  1L0Y B;  1LFD A;  4NY0 A;  4FAD A;  4YTP B;  4A3O A;  3HM6 X;  1YX6 B;  2E3T A;  4GDL A;  1V1P B;  1JW9 D;  2GLS A;  2AQ1 B;  3KUC B;  2Q5W D;  5E6J A;  4ZRP A;  3IG3 A;  2GOW A;  2KVR A;  4F1S A;  2KDF B;  1C1Y B;  4USA A;  1KF6 B;  2C5L C;  3A4S C;  2G1E A;  4WJQ A;  1SE9 A;  4M0W B;  2G4S A;  3PSE B;  3AE6 B;  4O1N A;  3DVG X;  1QOG A;  2IDY A;  1YJ1 A;  2BWE S;  1GC6 A;  2KDB A;  4WJO A;  2GBM A;  1PGA A;  2IGG A;  2PEA A;  2GBJ A;  4C4V A;  3VRA B;  3VUX A;  2WP9 B;  2V9H A;  3PZ7 A;  2M17 A;  2KFK A;  3JYU A;  3N30 A;  4YTN B;  4W9C A;  4BKS A;  2K6D B;  3AU5 A;  1E8Z A;  2J52 A;  4NJC A;  3OAW A;  1AN8 A;  5KHO A;  2L05 A;  2WLB A;  1SE4 A;  1FPY A;  2D3C A;  4TQ1 A;  1FXT B;  4E71 A;  3B2G A;  1EO6 A;  2MLB A;  1D4B A;  3H7P B;  1PFD A;  1V49 A;  1E7U A;  1TS3 A;  3KUD B;  1WF9 A;  5GMV A;  3VUW A;  1S1Q B;  2NCN A;  4JX1 C;  4HPL B;  3O65 B;  4RM9 A;  4BKS D;  2MX2 A;  1E5W A;  2JY6 A;  1QKZ A;  3L10 B;  4W9I A;  1SSN A;  1FFU A;  3BWU D;  3N20 C;  2O2V B;  3GB1 A;  1UGM A;  3VHT C;  5LNK 1;  2QIE B;  3QAR A;  5HKH A;  2RPV A;  4CHK A;  1R4N B;  3PPA A;  2MP2 B;  2INP E;  3PV1 A;  1I4P A;  2I1J A;  4B0M A;  1V8C A;  1WXS A;  1V1O A;  2DZJ A;  3W1S C;  2AL6 A;  2KMA A;  4MEL A;  4G3X B;  1R4M B;  1V86 A;  3NZU A;  3AE3 B;  2C9W B;  2N9E B;  4HWI B;  1JWM D;  4R3D A;  1KLV A;  2KOX A;  3LXF A;  1YOV B;  1XD3 B;  2QIL A;  3L17 A;  2JWZ A;  3V6C B;  3ZVV A;  2MA9 B;  1E7P B;  2QJL A;  2WXI A;  3I5J C;  3ZJV A;  2RPQ A;  1E0Z A;  4S17 A;  1V5T A;  2RMM A;  3NVW A;  3VTW A;  3DVN V;  2CHW A;  1ISN A;  2FNJ B;  4BBN C;  3URY A;  3M95 A;  4KIK A;  1VR9 A;  4EUT A;  3VTU A;  3W5U B;  1Y8R C;  4C4V B;  1E8X A;  4LLG M;  3R7R A;  2Z8L A;  1ENF A;  1SIJ A;  4WUR A;  2FUG 1;  2JVC A;  5L95 C;  1CK1 A;  2W9N A;  4LJO B;  4A6Q A;  5TSS A;  3PLV A;  3SD5 A;  3JSV A;  5JXV A;  3B08 A;  1L6U A;  3RMK C;  4MM3 A;  2W54 A;  4BKG A;  1XEE A;  2J42 A;  5IO9 A;  4AQ7 A;  2BT6 A;  3PZ8 A;  2G4D B;  2OED A;  4IM0 A;  1M94 A;  3Q2A C;  1WJ6 A;  3AM9 A;  1T0Q C;  4TKN A;  4YT0 B;  2MBO A;  1TKE A;  2C7N B;  5C2T B;  1M4V A;  3KQ4 A;  2ACZ B;  4LK0 M;  1XLN A;  1WGK A;  2BKF A;  3VXW A;  3CST A;  2CHZ A;  5LLI A;  4KZ0 A;  2K9X A;  3R2I A;  4FUL A;  4DQO C;  2KAJ A;  2KC1 A;  2QMT A;  2L0F A;  3IT6 B;  4JQW C;  5JZE B;  2L8J A;  3RUL A;  4DBG A;  4IKG A;  5D3I B;  4WWN A;  2Z0D B;  2YLM A;  3RNE C;  2LGD A;  2DHZ A;  3NVV A;  2DX5 B;  4FHK A;  3BVG A;  1TY2 A;  1X1M A;  3RNF C;  4RGT A;  1SXT A;  3U52 E;  1C4P A;  4AWJ A;  3AI5 A;  1IGD A;  4AJY B;  2MHJ A;  4MSQ B;  3PRZ A;  2IYD B;  4AJW A;  2BTE A;  1Q10 A;  4GSW A;  1GAQ B;  4KKI A;  4M00 A;  3Q8C A;  5L83 A;  1F77 A;  1P98 A;  2N7J A;  2LGX A;  2IY1 B;  2JXT A;  5J18 A;  3H6N A;  4XDC A;  2CU3 A;  5AZG A;  1WIA A;  3MHZ A;  1F1H A;  2KK8 A;  5AEK B;  4N6E B;  3DPD A;  1HE8 A;  4MH8 A;  2AEH A;  4KIK B;  1DOI A;  3ZRC A;  1XXG A;  4P6V F;  3AE9 B;  3VFK A;  1RYJ A;  1VJK A;  4BFR A;  4K3C A;  2BVC A;  4L2Y A;  1XT9 B;  2K8C A;  3A9K A;  4W9E A;  3CSF A;  5C1Z A;  2LUE A;  3JSV B;  2D3A A;  1JRP A;  2JX5 A;  4EOY A;  4S0R A;  5MPO A;  3NZ3 A;  1BXT A;  5JHA A;  2N7E A;  2LGS A;  3RT3 B;  1LXD A;  3IBE A;  1U4A A;  1WGG A;  2LRU A;  3ML9 A;  4RFB A;  3WIM A;  4KSK C;  2OJW A;  1TKG A;  1PQS A;  2ZW1 A;  1OQY A;  4DXA B;  2RDG A;  2C60 A;  3KUZ A;  5BO4 B;  2D2Q A;  2IND C;  3AE8 B;  2FUH B;  4LTU A;  4BOS C;  3A9J B;  2WDV B;  1MPE A;  2KZR A;  1CJE A;  3X23 A;  4URK A;  2A4Z A;  3FKY A;  4YWG G;  3BVZ A;  1E90 A;  4NPN A;  3E56 A;  3ABV B;  2NPT B;  1T0R C;  2DNF A;  2IBI B;  4ANU A;  2NS5 A;  1V2Y A;  3TEY A;  1RAX A;  2PW9 A;  1TS5 A;  3S2A A;  2MWS B;  1P7F A;  2DWQ A;  2W55 A;  3PRM B;  1TZO A;  2H88 B;  4K3B A;  4HCP B;  5JHB A;  4E3C A;  4RM8 A;  1WX7 A;  3TJP A;  2AX5 A;  1DGJ A;  3QHT A;  5IA7 A;  5LXH A;  1WRI A;  1IPG A;  3ZJU A;  2DYM A;  3U30 A;  3DBS A;  3ZDT A;  4IM2 A;  2I2Y A;  2NMQ A;  3W2D A;  3X0W A;  2G9H D;  3ZGZ A;  1NI2 A;  2VRR B;  4F7Z A;  4HKZ E;  2HTM E;  5G2N A;  2UYZ B;  3IHP C;  4CYE A;  3VTV A;  1E8Y A;  3DWG C;  4B95 A;  1A5R A;  1SB3 C;  1OQQ A;  4FN2 A;  2OJR A;  2LMC A;  3HIZ A;  3U4E G;  1R4N I;  3LJ3 A;  4DXG A;  4G50 A;  2LHD A;  1EUV B;  3R7Q A;  2YVC A;  2D3B A;  1R4M I;  2J7Q B;  3H9D A;  1D6E C;  2JT4 B;  2G3Q B;  2QSD A;  4XGA B;  1E6E B;  3IVF A;  1XF5 L;  3U7D A;  2A5U A;  4NJ7 A;  2MQJ A;  2C7M B;  1XCT L;  4ASW C;  1JWU D;  2WQY B;  3GE3 C;  1FNU A;  3V05 A;  3DBL B;  4ICV A;  3V3X A;  5AUI A;  2PTL A;  3VRB B;  4GGQ A;  2KX0 A;  1GNU A;  3EUB 2;  2QDF A;  4XWW A;  4IW0 A;  4K7U A;  4DDI D;  4MDK E;  3TEX A;  1UBI A;  4K1R B;  1KTK A;  2HTH A;  4M8N A;  5TR5 A;  3RD2 A;  2J0J A;  1WM3 A;  2DAJ A;  3TL5 A;  3A4R A;  2OHF A;  2L1A A;  2PVG C;  2FCN A;  2WDQ B;  3AV8 A;  1PYW D;  1XLO A;  1Y56 A;  2WYQ A;  4REZ A;  2E6X A;  1L4D B;  3Q3O C;  3MJW A;  1SBB B;  2INN E;  1N61 A;  1C4C A;  2KXJ A;  4PS8 A;  3H7P A;  5T8I A;  1FFV A;  3V62 A;  1UF0 A;  3DOW A;  3NHE B;  3TIX A;  3ZNG C;  1JCK B;  4TUU A;  2Y5P A;  4HVB A;  1T5X D;  1CMX B;  3P1M A;  4US9 A;  3MC8 A;  4GIV A;  5DPT A;  4DHJ D;  1YMH E;  3B2F A;  4BZA A;  4KGR A;  3PS6 A;  2HDE A;  1IP9 A;  2NBV B;  2QEJ C;  2KLC A;  4HK2 A;  3AEG B;  1T0Y A;  4FJZ A;  2LUM A;  2QCZ A;  2FBW B;  3U8Z A;  1KLG D;  2W3R A;  2NR2 A;  4ZYS A;  5J2R A;  3I3T B;  2ZZP B;  2CU1 A;  3RZW C;  1K52 A;  2KAC A;  5LXI B;  3WAP A;  1RFA A;  1K50 A;  3B9J A;  2KWD A;  2EEL A;  4WAF A;  4A3P A;  1I35 A;  4PS3 A;  2M0A A;  1QOB A;  3PTF C;  1WWT A;  1HEZ E;  4WQO B;  2KFJ A;  4XE0 A;  3FIL A;  3SEB A;  2WXF A;  3AU4 A;  1P7E A;  2IJ0 A;  4EFO A;  2QC8 A;  3BK1 A;  5FKA C;  3ZNZ B;  3ZNI D;  1V97 A;  3IAM 1;  4IC7 B;  4MGI E;  1YJI A;  4FXC A;  1I4G A;  3CMM B;  3KWV A;  3T8M A;  3UIN B;  2CHX A;  1WGY A;  1PDX A;  2K8H A;  1Q0W B;  3RPF C;  3NZS A;  2YEP B;  3RZF A;  1ZDX A;  2FAZ A;  4YSX B;  1GB1 A;  2BS4 B;  3VH4 B;  1V5O A;  2KD0 A;  4W9J A;  3UI3 A;  1YD8 U;  3NJT A;  4KDL B;  2FE8 A;  2KTR A;  1RWS A;  2FCM A;  5DCN A;  3TUO A;  4DHJ B;  1VLB A;  4XX5 A;  1UD7 A;  2NTS A;  3GS2 A;  2KWV B;  3KLS X;  4KV2 A;  3N1Z C;  3K9O B;  3PO0 A;  2WDT B;  5BYS A;  3DBR B;  2KN5 A;  3V6E B;  3A33 B;  4IUM B;  4J3O D;  2WU2 B;  4RNA A;  3Q8F A;  5DPW A;  2J4X A;  2LVP A;  5G55 A;  2INC C;  4YL8 A;  2LGY A;  2ZNV B;  2BQQ A;  1EU4 A;  2K25 A;  2JU6 X;  2V3S A;  1FMA D;  1FXI A;  1FRR A;  4KSL C;  4DXF A;  4UDU C;  2K8B A;  2ZNV C;  3V60 A;  5J17 A;  5E6N A;  1C3T A;  2BW2 A;  3NS8 A;  3KH0 A;  3W5V B;  2M4N A;  4IWP A;  1UWM A;  3TEZ A;  4GB9 A;  2GB1 A;  1WE7 A;  5BYQ A;  1C4A A;  4W9F A;  4W9L A;  1K8R B;  1NYQ A;  3WCQ A;  3BII D;  3FIL B;  1I7H A;  3P4R B;  1ZGU B;  4K81 A;  5D7G A;  1WJ4 A;  3N9Y C;  2XBB C;  4A55 A;  2KQ7 A;  3AEB B;  1OGW A;  3KVF B;  1YN5 A;  1OTR B;  4LNK A;  2K5P A;  3EHV A;  1YN3 A;  4BBN F;  4I6L B;  1UEL A;  2AWT A;  2WXL A;  4WWM A;  3L54 A;  4RGO S;  1ZUD 2;  1YX5 B;  4JL9 A;  5AUK A;  2RSU A;  1TS2 A;  3MJ5 A;  3OWE B;  3ZTC A;  1FNW A;  2DZK A;  5H8Y E;  1HTO A;  2JPH A;  3JVZ X;  1WM2 A;  5BMG A;  4EEW A;  4IDI A;  2AQ2 B;  3N3K B;  2KTR B;  3NVZ A;  2GBN A;  3EC8 A;  1UUP A;  1SF0 A;  1P3Q U;  2BPS A;  3HM3 A;  1PGX A;  4ZYN A;  1JWB D;  3SFD B;  1IGC A;  3WAN A;  4ICU A;  1WMH B;  1I4R A;  3R2T A;  4PK1 A;  4RF1 A;  1EF5 A;  4C00 A;  1FO4 A;  2ZVO A;  3EGR A;  4NQK E;  1GB4 A;  3ZIM A;  3EA6 A;  5HI1 A;  3TBL D;  1LO5 D;  3RUI B;  1YJJ A;  4BVU C;  1SIF A;  1TYG B;  5EDS A;  3HK0 A;  1DOX A;  2FCQ A;  1ZDV A;  2KQ4 X;  3A9J A;  4H2A A;  3ZO5 B;  1FM0 D;  3GOE A;  1L0V B;  2RGF A;  2ZJD A;  3B1L X;  2GRI A;  3AEA B;  5D6J B;  2BKR B;  2ASQ A;  2NPT A;  2GI9 A;  3HUI A;  3QC8 B;  5HG2 A;  1RFK A;  2GBK A;  2R2Q A;  4HJK A;  1KH0 A;  1QQR A;  2X38 A;  4A9A A;  3DBL I;  2K39 A;  2WXK A;  3IT4 B;  3LB8 C;  1NEN B;  1GOZ A;  1C78 A;  3ZKJ C;  4US8 A;  1JML A;  1WGH A;  1VDV A;  2L76 A;  1ZOY B;  2K6Q A;  2Y3A A;  3Q14 C;  2G45 B;  4MEM A;  2KO3 A;  1QIL A;  1WI0 A;  4GU2 A;  4P1C C;  3OJ3 A;  4DWF A;  3ZTD A;  4D2K A;  1QT9 A;  4JLC A;  1GG3 A;  3QCA A;  1QF6 A;  2FID A;  3DHI C;  1YQ3 B;  2UWQ A;  3AXC A;  3Q6B A;  1ZPS A;  4WIP A;  2W82 A;  2V4L A;  1RM6 C;  2Y5C A;  1E8W A;  2JRI B;  3GE8 C;  4WWO A;  3KW5 B;  3Q3F A;  3OG5 A;  2WXP A;  2BYV E;  3H7S A;  3LDZ E;  4KKJ A;  1TT5 B;  4K7S A;  1C76 A;  1VRA B;  5EE3 A;  2Z59 B;  3GP7 A;  2JUO A;  2FCS A;  5FR6 A;  1NDD A;  3A1Q B;  2KC2 A;  3SR6 A;  2BB6 A;  2LD9 A;  3AN1 A;  1WRD B;  4HRS A;  1YIW A;  1J7B A;  2WWZ A;  3C19 A;  4CO7 A;  1N62 A;  3UIO B;  1P9D U;  3ZLZ A;  4YXD B;  1ACC A;  2M8S A;  2JZ3 B;  3EFU A;  1KOT A;  2D10 A;  1B9R A;  2BYT A;  1MHX A;  2D07 B;  4GLS C;  4C56 C;  3VAW A;  4KDI C;  4TMA B;  3UIP B;  3C0R B;  2MSE D;  3PHX B;  2L32 A;  5BMI A;  1J7C A;  1EU3 A;  2B76 B;  1I4X A;  4FBJ B;  1HZ5 A;  3BZD B;  1WR6 E;  3MFG A;  3AUL A;  2DZM A;  2BYE A;  4ZRQ A;  1SJH D;  2KDM A;  4EKU A;  4ACF A;  1LQB A;  3E9S A;  3N1Y C;  4ARC A;  3DBH I;  1E7V A;  2K3U A;  2CS4 A;  1QZE A;  2NTT A;  2PE9 A;  1WXV A;  2MBE A;  1WZ3 A;  3AEC B;  4OVZ A;  1EF1 A;  1SEB D;  4WJP A;  3I57 A;  3V61 A;  3MHS D;  1V81 A;  3PGE A;  4M8M A;  2V3N A;  2WX0 A;  3DBR I;  3ZUN A;  4OVU A;  2GBR A;  2L0T A;  2IGD A;  1FNV A;  4GN1 A;  2WXR A;  3TCA A;  2KTF A;  1I4H A;  4ZOH C;  1JAL A;  4P16 A;  1D3Z A;  2GMI C;  3CWI A;  3L4P A;  2QHO A;  2KN4 A;  2N1W A;  4NNJ B;  4Q2J A;  4IM3 A;  1UWX A;  3APF A;  3AH7 A;  4XYC A;  1J7A A;  1L0X B;  1JRU A;  3J9C A;  2EMS A;  3I9V 1;  3FAH A;  1V6E A;  4PS7 A;  2N9K A;  3HRD D;  1RRB A;  2BBC A;  1N63 A;  1T6B X;  1WXA A;  4EZK A;  2KT7 A;  1T0S C;  2W3S A;  2BWF A;  2PLP A;  3AMZ A;  1MFW A;  4DDG D;  1KM7 A;  2J0M A;  2N1V A;  2D5G A;  1C9F A;  1VCB A;  3AEE B;  1MI0 A;  1FRD A;  2WXN A;  2V4I B;  1MVK A;  3MP9 A;  1LGR A;  3ML8 A;  2LRW A;  2VH2 A;  4ZRI A;  3CIR B;  4KX6 B;  1WY8 A;  2N9L A;  3ZDM C;  1KLU D;  1IBX B;  1Z5S B;  3Q3M C;  1OQR A;  3HVZ A;  2WDR B;  2LVO A;  1OFF A;  1VD2 A;  1JQ4 A;  3Q69 A;  4M02 A;  2AL3 A;  1Q5W B;  1AYF A;  5IOI A;  1STE A;  1UGJ A;  1WE6 A;  5G5H A;  4C7Y A;  1UH6 A;  2M19 A;  3SHQ A;  4RGN A;  3FC4 A;  2K0P A;  3IFW B;  1HZ6 A;  4OZB A;  1FCC C;  4PYU A;  1MG4 A;  3Q3J A;  2LXC A;  5EE1 A;  2I38 A;  3KYD D;  1QOF A;  4OVV A;  1A70 A;  3MC0 B;  2REX A;  2L3Z A;  4MAC A;  2I1K A;  5CTR C;  3WA0 A;  2KLG A;  3ZW3 A;  3IXS A;  4HXD A;  1BUI C;  4WJN A;  2EMT A;  2CJN A;  2ZPY A;  2IO3 B;  1L7Y A;  2JRH A;  3CF6 E;  2LJ5 A;  2JYE A;  4J6I A;  1TBE A;  4PYZ A;  3Q8E A;  4AUQ C;  2IO2 B;  2WXJ A;  1GJZ A;  1F0Z A;  2VZK D;  5EE9 A;  4ZHO A;  3QJZ A;  3BYY B;  2SEB D;  2LI5 A;  3UF8 A;  1ZE3 D;  1DYQ A;  4NAW A;  1TJE A;  1FEH A;  3QWZ B;  3NRZ A;  4CQN A;  1EM7 A;  4ITK A;  2WXQ A;  3P4P B;  5C23 A;  2KYW A;  1K53 A;  1NI3 A;  4ANX A;  2KHW B;  4II2 B;  2JYT A;  1XO3 A;  1QLB B;  2N4F A;  4L23 A;  4ANW A;  3GZN I;  4A8X C;  1RLF A;  3OLM D;  5I4D A;  3BYT B;  1HA5 A;  2IZV B;  4XWT A;  3VR8 B;  4OHJ A;  5IKC M;  2ICI A;  4C7Z A;  1TKY A;  3W1Y A;  4TV3 A;  2KMM A;  2YEP F;  4LNN A;  3DBH B;  2R61 A;  3AE1 B;  2LJI A;  2O6V A;  1E10 A;  4W9D A;  3P63 A;  2TSS A;  2KNB A;  4ZDV A;  4G0N B;  1WMH A;  5BYR A;  1L4Z B;  1OEY A;  4LNI A;  1NYR A;  4GDK B;  2KJ6 A;  1P0R A;  4P1B C;  1I42 A;  4LNF A;  2KQS A;  4LCD E;  3RNA C;  3VQI A;  2OOB B;  2JSV X;  1WSP A;  3T3N A;  3MTN B;  2D3G A;  1F2R I;  2BYF A;  4HDO A;  3PT2 B;  1ET9 A;  2R2O A;  3PLU A;  3RCZ A;  5JH5 C;  2BF8 B;  2O6V D;  2PVO D;  4TQ0 A;  3DWM A;  3P2B A;  2DZI A;  2VZK B;  4YSY B;  3ZRF A;  2WXO A;  5C3J B;  2M0X A;  1H8C A;  5KHQ A;  2IGH A;  4AS1 A;  2KAN A;  2BGF A;  1HTQ A;  2M1M A;  5E6P A;  4MJS B;  2NVU I;  1YN4 A;  4FJV B;  2DYB A;  1WJU A;  2N0S B;  3UQB A;  2EKE C;  4HKQ A;  5BMH A;  2NBW B;  2ONQ A;  1TIF A;  2PPH A;  1FCL A;  3AE5 B;  4EZJ A;  4MGY E;  2SAK A;  4NAW B;  3PZD A;  4OZC A;  2L83 A;  1S3S G;  3ZXR A;  2X8X X;  4I6P A;  4LDT D;  1H4R A;  2JZZ A;  4GDL B;  2PKO A;  2IO1 B;  1UZX B;  3ENE A;  5D3D A;  4KGS A;  2AQ3 B;  1N5W A;  3EEC A;  1NEK B;  3RNC C;  1TZ1 A;  3BY4 B;  2KMC A;  2WS3 B;  2WXG A;  1BML C;  1WX9 A;  1UBQ A;  2KDI A;  3QIJ A;  1EWY C;  3RI7 C;  3ETR A;  5IN7 A;  4B0E A;  2NBU A;  4ARI A;  3TEW A;  3QA8 A;  4BOZ B;  3H1U A;  2O6V B;  5DPR A;  1R7S A;  1SE2 A;  1KFY B;  2D11 A;  2N7D A;  3A1Q A;  1WFY A;  2UU7 A;  3AE2 B;  1AAR A;  4N58 A;  2J53 A;  1NBF C;  1N5X A;  2KFK B;  4AP4 C;  1JWA D;  1GPX A;  3DDC B;  1FIQ A;  1SJE D;  2MEK A;  1WJN A;  3WAO A;  1C77 A;  1XCQ L;  1GUA B;  2K1F A;  1GC7 A;  4IWQ A;  4EE2 A;  3WAM A;  4MGZ E;  2H89 B;  3NG0 A;  3I63 C;  4W9H A;  5AZF A;  4JWU C;  4RF0 A;  5CHF A;  3APC A;  1WXQ A;  3T3O A;  1F9J A;  4NAM A;  2ZEQ A;  3APD A;  3LYY A;  3ZQ4 A;  4FA6 A;  5H92 C;  4LDT B;  3ONS A;  3QX1 A;  1WXM A;  2IO0 B;  1C79 A;  4MH0 E;  4BKT A;  3W9C B;  3L13 A;  4HDQ A;  1SE3 A;  3BIN A;  3DVN U;  4DHZ E;  1J0G A;  2DEN B;  2CKH B;  2LWP A;  3GZN B;  3JW0 X;  2JXX A;  3N32 A;  2KWC A;  3VVW B;  3RN9 C;  3M3J A;  1ZKH A;  2XNA C;  4HJG E;  4I6N B;  3RNG C;  3AE7 B;  2B3A A;  2ZVN A;  3R3M A;  3P4S B;  2HE7 A;  4MSM B;  3ECI A;  4KVG B;  3RNB C;  1D5X C;  3U2S C;  3DHH C;  4HLE A;  1CZP A;  3AB5 A;  4OW0 A;  3SU8 X;  4NZL B;  1WH3 A;  1MHH E;  2Z0E B;  3D32 A;  1L2N A;  3M63 B;  1OEY J;  1K51 A;  4LNO A;  2PJH A;  2JF5 A;  3PRE A;  3O13 A;  2MJD A;  2XK5 A;  4PT5 A;  4B6W A;  4C80 A;  2XN9 C;  3R8B A;  3AE4 B;  5E6O A;  2WU5 B;  1DOY A;  2PIA A;  5FR3 A;  5D94 A;  2WX1 A;  1HQR D;  1MJD A;  3NUH B;  1WZ0 A;  2DLB A;  2KKC A;  4JIO U;  4N59 A;  4WQM A;  4HPP A;  4QAY A;  2XEW A;  3TMP B;  3NVY A;  4K7W A;  4YTM B;  3P42 A;  4OZA A;  1E9M A;  2MBB B;  1XLP A;  2WXH A;  3VH3 B;  4W9G A;  4ZRK A;  1JWS D;  4XC2 A;  3NY5 A;  4DHZ B;  1FD6 A;  1BT0 A;  4MT5 A;  1F2R C;  3AEF B;  1VZ7 A;  5FK9 C;  3VDZ A;  2LVQ A;  1Z2M A;  4MM3 B;  3ZXV A;  5D2M B;  1WX8 A;  2RR9 A;  1L5P A;  2L00 B;  1J19 A;  3U7Z A;  5IAA C;  2HJ1 A;  1ET6 A;  3DCG A;  2KVZ A;  2JZP A;  2KWU B;  4RGM A;  1ROE A;  4GMV A;  2ZW0 A;  4P7I A;  2CR5 A;  2K22 A;  2IPK D;  2DBY A;  3M62 B;  2CJO A;  1TTN A;  1IBX A;  1VZ8 A;  4FLH A;  2DAF A;  1ZW7 A;  1V80 A;  4W9K A;  3H8H A;  2MJ3 A;  2ZCC A;  3Q3N C;  4MGK E;  1EWC A;  2HD5 B;  4ANV A;  3RFZ B;  3ZNH B;  3MC9 A;  5AZH A;  2HJ8 A;  2MJE A;  3DVG Y;  3ZYY X;  3Q8A A;  4HPM B;  3UGB B;  1MG8 A;  1TS4 A;  2WGS A;  3RYT A;  4ZHP A;  1HXY D;  2MBQ A;  4DK5 A;  2LEK A;  4A20 A;  2LHE A;  4HEA 1;  2N9P C;  1TGZ B;  1NVI D;  2RDB C;  2BS2 B;  2LXA A;  2PE6 B;  5EE0 A;  2DYO A;  1TY0 A;  1N6Z A;  1ZXH A;  5CHV C;  1WYG A;  3DQV A;  4FJY A;  3PVL A;  4IG7 B;  3T9L A;  3UQA A;  2L52 A;  3KWL A;  2V3P A;  2RD0 A;  2XK5 B;  5GXG B;  2L7R A;  4YSZ B;  2LAS A;  4G11 A;  3SFE B;  3B0A A;  3N1X C;  4JWS C;  1WYW B;  4RCO A;  1Q1O A;  2RDH A;  2N9X A;  4XDD A;  2LFI A;  2WHI A;  2EKI A;  2V1Y A;  5CHW A;  1JRO A;  3OJ4 B;  4L1B A;  2BB5 A;  4NJ6 A;  5G5G A;  4X57 B;  1IUE A;  1WGR A;  4GOC A;  5HHD G;  2KJR A;  3A9K B;  3PHW B;  2BS3 B;  3ALB A;  3WAL A;  4AOF A;  2FIF A;  2MW5 A;  1PGB A;  3EFC A;  1V1P A;  1VZ6 A;  3TSS A;  2KDE B;  3Q8B A;  1ZXI A;  1XQQ A;  1SGH A;  3QQ8 B;  4IWO A;  1J8C A;  1WR1 A;  3L16 A;  2KJH B;  1YQB A;  1YNT E;  5CX3 A;  1D5Z C; 
#chains in the Genus database with same CATH homology
 1WGD A;  3QK0 A;  3N3K B;  5JHA A;  2N7E A;  2KTR B;  4HCN B;  4TV3 A;  2GBN A;  3EC8 A;  2J0K A;  1P3Q U;  2BPS A;  2ZPN A;  3HM3 A;  3RT3 B;  4ZYN A;  3HHM A;  1LXD A;  4WWP A;  4LJP B;  3IBE A;  1U4A A;  1WGG A;  2LRU A;  3WAN A;  4ICU A;  1WMH B;  2O6V A;  3ML9 A;  4F8C B;  3WIM A;  4W9D A;  4KSK C;  2KNB A;  4ZDV A;  2LZ6 A;  1PQS A;  4G0N B;  1EF5 A;  3L0W B;  1OQY A;  4DXA B;  1WMH A;  2C60 A;  3KYC D;  2ZVO A;  1OEY A;  3R66 C;  4II3 B;  4NQK E;  4EZL A;  3KUZ A;  3ZIM A;  4GDK B;  2KJ6 A;  2C7H A;  5BO4 B;  1P0R A;  2D2Q A;  2FUH B;  3TBL D;  1I42 A;  3RUI B;  2ZCB A;  4BOS C;  3A9J B;  2KQS A;  4LCD E;  3VQI A;  1SIF A;  2KZR A;  4BVU C;  2OOB B;  1LM8 B;  4GDK A;  5EDS A;  3HK0 A;  4ZRJ A;  3MTN B;  2FCQ A;  2D3G A;  3X23 A;  4URK A;  3VUY A;  2A4Z A;  2BYF A;  3A9J A;  4HDO A;  3PT2 B;  3ZO5 B;  4RMA A;  3GOE A;  1E90 A;  2R2O A;  3PLU A;  4NPN A;  3RCZ A;  5JH5 C;  2KX3 A;  2BF8 B;  2RGF A;  2ZJD A;  2MCN B;  3B1L X;  2NPT B;  2O6V D;  4XZ4 A;  4GXB A;  2IBI B;  2AYO B;  3NOB A;  4ANU A;  4N9F 4;  5D6J B;  4TQ0 A;  2NS5 A;  3P2B A;  1V2Y A;  2DZI A;  1V9J A;  3ZRF A;  2BKR B;  2ASQ A;  1RAX A;  1P1A A;  2NPT A;  5DPS A;  2M0X A;  1H8C A;  5KHQ A;  3S2A A;  3QC8 B;  2MWS B;  2GBK A;  2R2Q A;  4HJK A;  3K9P B;  3PRM B;  3DBL I;  2KAN A;  3SDL C;  2K39 A;  2BGF A;  4FHJ A;  2M1M A;  5E6P A;  4HCP B;  4MJS B;  2NVU I;  5JHB A;  1KJT A;  2IY0 B;  4WAA A;  4E74 A;  4FJV B;  4B9K A;  4E3C A;  2DYB A;  1WJU A;  4RM8 A;  1WX7 A;  2MBH A;  2O2V A;  4KZC A;  3TJP A;  3W1S A;  3QHT A;  4MJS A;  3UQB A;  5IA7 A;  2EKE C;  5LXH A;  4JGH B;  1IPG A;  2DYM A;  2NBW B;  3U30 A;  3ZKJ C;  3DBS A;  2PPH A;  3ZDT A;  3PRP B;  1WGH A;  2MP2 A;  4IM2 A;  4NQL B;  2L76 A;  4EZJ A;  4MGY E;  2K6Q A;  3L08 A;  4NAW B;  3PZD A;  3X0W A;  2G45 B;  1NI2 A;  2VRR B;  4MEM A;  4F7Z A;  2KO3 A;  1WI0 A;  3QAQ A;  4GU2 A;  1G6J A;  3OJ3 A;  4DWF A;  1S3S G;  3ZTD A;  5G2N A;  4JLC A;  1GG3 A;  3QCA A;  2UYZ B;  2MRP A;  2Y5B B;  4I6P A;  1IYF A;  3IHP C;  1LFD A;  4LDT D;  2FID A;  4CYE A;  3VTV A;  1H4R A;  1E8Y A;  2JZZ A;  4GDL B;  4NY0 A;  4FAD A;  4B95 A;  4A3O A;  3HM6 X;  1A5R A;  2IO1 B;  1UZX B;  3ENE A;  1YX6 B;  4FN2 A;  2OJR A;  2UWQ A;  3AXC A;  4GDL A;  3HIZ A;  1R4N I;  3EEC A;  3LJ3 A;  2V4L A;  1TZ1 A;  3BY4 B;  4G50 A;  2KMC A;  1EUV B;  3KUC B;  1E8W A;  2GOW A;  2JRI B;  1WX9 A;  2KVR A;  3IG3 A;  4WWO A;  3KW5 B;  4F1S A;  3R7Q A;  1UBQ A;  2KDI A;  3Q3F A;  3QIJ A;  2YVC A;  1R4M I;  2KDF B;  2BYV E;  1C1Y B;  2NBU A;  2J7Q B;  3H7S A;  3LDZ E;  3H9D A;  2JT4 B;  2G3Q B;  2C5L C;  3QA8 A;  3A4S C;  4WJQ A;  1SE9 A;  4K7S A;  4M0W B;  4BOZ B;  2G4S A;  3PSE B;  2Z59 B;  2JUO A;  2FCS A;  3H1U A;  5FR6 A;  1NDD A;  3A1Q B;  3IVF A;  2KC2 A;  3DVG X;  3U7D A;  2O6V B;  2A5U A;  2LD9 A;  1WRD B;  5DPR A;  4NJ7 A;  2MQJ A;  2C7M B;  1YIW A;  2WWZ A;  2D11 A;  2N7D A;  3A1Q A;  4ASW C;  1YJ1 A;  2BWE S;  1WFY A;  1AAR A;  4CO7 A;  1GC6 A;  1NBF C;  3UIO B;  1P9D U;  2KDB A;  2KFK B;  4WJO A;  2GBM A;  3ZLZ A;  2M8S A;  2JZ3 B;  2GBJ A;  2PEA A;  3EFU A;  4AP4 C;  1KOT A;  3VUX A;  4ICV A;  2D10 A;  2M17 A;  3DDC B;  2KFK A;  3JYU A;  1WJN A;  2KX0 A;  1GNU A;  3N30 A;  4GGQ A;  3WAO A;  4W9C A;  4BKS A;  2D07 B;  2K6D B;  3AU5 A;  1GUA B;  1E8Z A;  4IW0 A;  2K1F A;  1GC7 A;  4IWQ A;  4K7U A;  3VAW A;  4MDK E;  4KDI C;  3OAW A;  4DDI D;  3WAM A;  3UIP B;  1UBI A;  4K1R B;  4MGZ E;  3C0R B;  5KHO A;  2HTH A;  2MSE D;  2L05 A;  3PHX B;  4M8N A;  5TR5 A;  4TQ1 A;  4W9H A;  1FXT B;  5AZF A;  4E71 A;  3RD2 A;  2J0J A;  1WM3 A;  2DAJ A;  5CHF A;  3TL5 A;  1EO6 A;  2MLB A;  3A4R A;  4FBJ B;  2FCN A;  1WR6 E;  3H7P B;  3AUL A;  1V49 A;  1E7U A;  2WYQ A;  3APC A;  3KUD B;  1WF9 A;  2DZM A;  2BYE A;  5GMV A;  3VUW A;  1F9J A;  3MJW A;  1S1Q B;  2KXJ A;  2NCN A;  2ZEQ A;  3APD A;  3H7P A;  4PS8 A;  3V62 A;  4HPL B;  3O65 B;  4RM9 A;  4FA6 A;  4BKS D;  3DOW A;  2MX2 A;  3NHE B;  3TIX A;  1E5W A;  2JY6 A;  3ZNG C;  4LDT B;  4EKU A;  3ONS A;  3L10 B;  4W9I A;  1LQB A;  4TUU A;  3QX1 A;  2O2V B;  1WXM A;  2IO0 B;  1UGM A;  4MH0 E;  4BKT A;  4HVB A;  3L13 A;  3VHT C;  1CMX B;  4HDQ A;  3BIN A;  3DBH I;  3QAR A;  1E7V A;  5HKH A;  4CHK A;  2CS4 A;  3DVN U;  4DHZ E;  1J0G A;  3PPA A;  1QZE A;  2DEN B;  2CKH B;  2PE9 A;  4GIV A;  2LWP A;  1WXV A;  5DPT A;  4DHJ D;  2MP2 B;  3JW0 X;  2MBE A;  3PV1 A;  2JXX A;  3N32 A;  2KWC A;  1WZ3 A;  2I1J A;  3M3J A;  3PS6 A;  3VVW B;  1EF1 A;  1WXS A;  4WJP A;  1ZKH A;  2DZJ A;  3V61 A;  1IP9 A;  2NBV B;  3MHS D;  3W1S C;  2AL6 A;  2KLC A;  2KMA A;  4MEL A;  4G3X B;  1V81 A;  3PGE A;  4HK2 A;  4I6N B;  4M8M A;  2WX0 A;  1T0Y A;  1V86 A;  3DBR I;  4FJZ A;  3ZUN A;  4OVU A;  3NZU A;  2GBR A;  2B3A A;  2C9W B;  2N9E B;  2L0T A;  2ZVN A;  3R3M A;  4HWI B;  3U8Z A;  2HE7 A;  4MSM B;  2NR2 A;  3ECI A;  1KLV A;  5J2R A;  3I3T B;  4GN1 A;  4KVG B;  2KOX A;  2ZZP B;  2CU1 A;  3TCA A;  4HLE A;  3SU8 X;  2KTF A;  3RZW C;  1WH3 A;  5LXI B;  2Z0E B;  3D32 A;  1L2N A;  3WAP A;  1RFA A;  1XD3 B;  2JWZ A;  1OEY J;  3L17 A;  3M63 B;  3V6C B;  1D3Z A;  2GMI C;  3ZVV A;  2QHO A;  2MA9 B;  4A3P A;  1I35 A;  2PJH A;  2N1W A;  2JF5 A;  3PRE A;  4NNJ B;  4IM3 A;  4PS3 A;  3PTF C;  2XK5 A;  4WQO B;  2KFJ A;  4B6W A;  3APF A;  1JRU A;  3AU4 A;  5E6O A;  4EFO A;  5D94 A;  2RPQ A;  2WX1 A;  2EMS A;  3ZNZ B;  3ZNI D;  1V5T A;  1WZ0 A;  2KKC A;  4JIO U;  1V6E A;  4PS7 A;  3VTW A;  2XEW A;  3DVN V;  4IC7 B;  1RRB A;  3TMP B;  4MGI E;  4K7W A;  1WXA A;  2CHW A;  4EZK A;  1ISN A;  2FNJ B;  4BBN C;  3CMM B;  2MBB B;  3M95 A;  2BWF A;  4KIK A;  4EUT A;  3VH3 B;  4W9G A;  4ZRK A;  3T8M A;  3UIN B;  4XC2 A;  2CHX A;  4DDG D;  3NY5 A;  1KM7 A;  1WGY A;  3VTU A;  2J0M A;  1Y8R C;  2N1V A;  1BT0 A;  4DHZ B;  2K8H A;  1E8X A;  1VCB A;  1Q0W B;  3R7R A;  3NZS A;  3VDZ A;  3RZF A;  2JVC A;  2FAZ A;  1Z2M A;  2LVQ A;  5L95 C;  3ML8 A;  3VH4 B;  5D2M B;  1V5O A;  1WX8 A;  2KD0 A;  2RR9 A;  2LRW A;  2L00 B;  2W9N A;  1J19 A;  4LJO B;  3PLV A;  4W9J A;  3JSV A;  3SD5 A;  5IAA C;  3B08 A;  1YD8 U;  4ZRI A;  3DCG A;  4MM3 A;  4BKG A;  1WY8 A;  4KDL B;  2KTR A;  2FCM A;  3ZDM C;  2KWU B;  5DCN A;  4GMV A;  4P7I A;  2CR5 A;  1Z5S B;  2G4D B;  4DHJ B;  4IM0 A;  3M62 B;  2LVO A;  1M94 A;  1WJ6 A;  1VD2 A;  4XX5 A;  1TTN A;  1UD7 A;  2KWV B;  4KV2 A;  2AL3 A;  4TKN A;  1Q5W B;  3K9O B;  2DAF A;  4FLH A;  2MBO A;  1ZW7 A;  2WDT B;  1V80 A;  2KN5 A;  2C7N B;  4W9K A;  3A33 B;  3V6E B;  4IUM B;  1WE6 A;  2ZCC A;  4MGK E;  2HD5 B;  4ANV A;  3ZNH B;  5DPW A;  2BKF A;  3VXW A;  2LVP A;  5G55 A;  5AZH A;  1UH6 A;  3CST A;  4YL8 A;  2LGY A;  2CHZ A;  2HJ8 A;  5LLI A;  3SHQ A;  2ZNV B;  3DVG Y;  3IFW B;  4KZ0 A;  4HPM B;  4FUL A;  2K25 A;  3UGB B;  2KC1 A;  4PYU A;  1MG8 A;  3Q3J A;  2L0F A;  2LXC A;  4OVV A;  3KYD D;  2V3S A;  3RYT A;  4JQW C;  5JZE B;  2L8J A;  2MBQ A;  4DK5 A;  2REX A;  4KSL C;  2L3Z A;  3RUL A;  4DBG A;  4A20 A;  2K8B A;  4WWN A;  2ZNV C;  2I1K A;  3V60 A;  2N9P C;  5J17 A;  5E6N A;  2Z0D B;  1C3T A;  1TGZ B;  2YLM A;  5CTR C;  2PE6 B;  2LXA A;  3WA0 A;  2LGD A;  2DHZ A;  3NS8 A;  2DX5 B;  2KLG A;  2DYO A;  4FHK A;  4HXD A;  3KH0 A;  3ZW3 A;  4WJN A;  1X1M A;  2M4N A;  4IWP A;  2EMT A;  5CHV C;  4GB9 A;  2ZPY A;  2IO3 B;  3DQV A;  4FJY A;  3PVL A;  1L7Y A;  4AWJ A;  1WE7 A;  2JRH A;  3CF6 E;  3AI5 A;  2LJ5 A;  4IG7 B;  4AJY B;  4MSQ B;  3PRZ A;  3T9L A;  2IYD B;  4W9F A;  4W9L A;  4AJW A;  3UQA A;  4GSW A;  1TBE A;  1K8R B;  4J6I A;  4PYZ A;  4AUQ C;  2RD0 A;  2IO2 B;  2XK5 B;  1P98 A;  5L83 A;  2LGX A;  1GJZ A;  2IY1 B;  1ZGU B;  4K81 A;  2L7R A;  3QJZ A;  2LAS A;  4G11 A;  5D7G A;  1WJ4 A;  5J18 A;  3B0A A;  3H6N A;  2LI5 A;  1WYW B;  2XBB C;  5AZG A;  1Q1O A;  1WIA A;  2N9X A;  3UF8 A;  2KQ7 A;  1OGW A;  4NAW A;  3QWZ B;  2KK8 A;  3KVF B;  2V1Y A;  5AEK B;  5CHW A;  3OJ4 B;  1OTR B;  1HE8 A;  3DPD A;  4NJ6 A;  5C23 A;  3EHV A;  4X57 B;  4BBN F;  4ANX A;  4I6L B;  1UEL A;  2AEH A;  4KIK B;  2AWT A;  1WGR A;  2KHW B;  4GOC A;  4II2 B;  3ZRC A;  2KJR A;  2N4F A;  3L54 A;  3VFK A;  3A9K B;  4ANW A;  3PHW B;  3GZN I;  3ALB A;  3WAL A;  4BFR A;  1RLF A;  1YX5 B;  4JL9 A;  3OLM D;  4AOF A;  2FIF A;  2MW5 A;  2RSU A;  1XT9 B;  2KDE B;  2K8C A;  3A9K A;  2IZV B;  1XQQ A;  4W9E A;  1SGH A;  3QQ8 B;  4IWO A;  3CSF A;  3ZTC A;  1J8C A;  2DZK A;  5C1Z A;  1WR1 A;  2JPH A;  3L16 A;  3JVZ X;  1WM2 A;  2LUE A;  3JSV B;  4EEW A;  2KJH B;  1YQB A;  4EOY A;  3W1Y A;  5CX3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...