1WZ0A

Solution structure of human sumo-2 (smt3b), a ubiquitin-like protein
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
104
structure length
104
Chain Sequence
GSSGSSGMADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin-like protein SMT3B
publication title Solution Structure of Human SUMO-2 (SMT3B), a Ubiquitin-like Protein
rcsb
source organism Homo sapiens
molecule tags Structural genomics, unknown function
total genus 12
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2005-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1wz0A01
1R4NI 4LJPB 3X0WA 4NQLB 3CSTA 3M63B 4KZ0A 2O6VA 2O6VB 2OOBB 1HE8A 4HVBA 3K9OB 4E74A 3ZUNA 2ASQA 2C7MB 4CYEA 2MA9B 2FCMA 1UBIA 3ZNGC 4F1SA 1U4AA 4GB9A 1TZ1A 3NZSA 1KOTA 4G0NB 3MJWA 2DENB 1WXMA 4GDKA 4GDKB 2CR5A 4K7WA 2VRRB 4EOYA 2C7HA 2IY1B 1E8YA 2N7EA 2FCSA 1Z2MA 2KQSA 3LJ3A 1V9JA 4NAWA 4NAWB 5D7GA 1CMXB 2JZ3B 1V80A 2ZPNA 4A3PA 4HDOA 4E71A 2K8BA 3Q3FA 4W9FA 2KJHB 5TR5A 2L76A 2M17A 2ZJDA 3PZDA 2D3GA 4DDID 2DAFA 3AU5A 5DCNA 3DBHI 2HJ8A 3OJ3A 1J19A 4XC2A 3SDLC 3NOBA 2M8SA 3QHTA 3RZWC 1GC6A 2YLMA 4FJVB 4KIKA 4ANVA 3VHTC 4BVUC 1UD7A 2C9WB 2DZMA 3DBRI 3ENEA 2JWZA 4MSQB 2AL3A 2M1MA 2CKHB 2LI5A 1WE6A 5C1ZA 3K9PB 1WXSA 2RPQA 2DYMA 4W9DA 2DYBA 5IA7A 3R7QA 3BY4B 1RRBA 1WM2A 3EFUA 2UWQA 2R2OA 3V60A 3SD5A 3AXCA 1JRUA 1H8CA 3WANA 3H7SA 2FCNA 3JYUA 3OJ4B 5AZHA 2GMIC 2KX0A 2BKFA 5EDSA 2M0XA 1E7VA 3PLVA 4KZCA 2Z59B 5CHFA 4ZRJA 1IP9A 1V49A 4MJSA 4MJSB 1GNUA 4BKGA 2KOXA 4NQKE 3AU4A 1WMHA 3B1LX 3WA0A 3IG3A 3OAWA 3DVNU 2N4FA 1WYWB 1WM3A 2GBNA 3M95A 1EF5A 1WJ6A 4MEMA 1LQBA 2B3AA 2JPHA 2KK8A 3C0RB 2D11A 3Q3JA 4W9JA 3HHMA 3SHQA 3PREA 1NI2A 2D10A 1XD3B 4ZYNA 2FCQA 2JVCA 3QA8A 3MTNB 4HPLB 4URKA 4N9F4 2DAJA 5JHAA 3N3KB 3N30A 1L7YA 2G45B 2V4LA 5DPTA 3QIJA 1WJ4A 4WJPA 5D6JB 3EHVA 3CSFA 3KYCD 4PYUA 3ZTCA 2MBQA 2KANA 1UELA 2RGFA 1WGGA 4NJ7A 2MQJA 1WFYA 2CU1A 1IYFA 4IM0A 2BYVE 4RM9A 4PS8A 4ANUA 1WJUA 3RT3B 4DDGD 4AOFA 4MGYE 3L08A 1EO6A 4W9IA 5J2RA 3U7DA 3GOEA 3QJZA 4HXDA 2K25A 4IUMB 2PJHA 1Q5WB 4NJ6A 2KJ6A 2I1JA 2LGYA 3UIOB 1GJZA 2KD0A 1V6EA 2CHZA 1AARA 1TGZB 1LXDA 3KUZA 3GZNI 2R2QA 3QQ8B 4KVGB 3ZRFA 2BYFA 3DPDA 3VH4B 5D94A 4KSLC 4MM3A 3PT2B 3QC8B 3A4RA 4WAAA 4IWOA 3MHSD 2IYDB 2MBOA 5BO4B 3KVFB 1T0YA 1WGDA 3RZFA 1P0RA 3A9JA 3A9JB 4PS3A 4FN2A 1YQBA 2N9EB 1WX8A 1KLVA 2O2VA 1SE9A 4FJZA 1WIAA 2KFJA 2N7DA 2D07B 4G50A 2PE6B 4GOCA 3ZRCA 1YD8U 1TBEA 3IHPC 3PRMB 2KFKA 2KFKB 4K7UA 4BKSD 4FA6A 5LLIA 4NPNA 1E5WA 1WJNA 3ZTDA 1VCBA 2ZNVC 3A4SC 2ZEQA 2L8JA 5D2MB 3VXWA 2KQ7A 2MWSB 2DX5B 3S2AA 2MBBB 1LM8B 1Q0WB 2YVCA 4A20A 3DCGA 4AUQC 4FADA 1V5OA 4HJKA 3UQBA 1WGRA 1A5RA 3APFA 3KUDB 4FULA 3HK0A 3R66C 4NNJB 1PQSA 2EMSA 3WAOA 3WALA 4JL9A 3PVLA 4DXAB 3PS6A 2IO3B 2LUEA 3PGEA 2G3QB 2HE7A 4EKUA 4A3OA 2KMAA 4HCNB 5KHOA 3W1SC 4PS7A 5G55A 3U30A 3O65B 3VUYA 3QAQA 2KC2A 4IW0A 2K8HA 4KIKB 4RM8A 4B6WA 3VUWA 2KLCA 3I3TB 4NY0A 1WI0A 2KWCA 1WX7A 3M3JA 2BKRB 1XQQA 3OLMD 4BOZB 2KVRA 1UBQA 3N32A 2IBIB 5C23A 5DPWA 2ZPYA 1J0GA 2AEHA 4KDLB 2GOWA 2LRUA 1V2YA 2D2QA 2LVOA 1H4RA 1P98A 2I1KA 3PLUA 1J8CA 5AZFA 4WJQA 3ML9A 2N1VA 3PHWB 4I6PA 3RULA 3HM3A 4WQOB 4LDTD 1BT0A 1WY8A 4J6IA 2NBVB 3IBEA 2BGFA 4GN1A 4GXBA 2WWZA 1ZW7A 1WGYA 4G3XB 1WXAA 4BKSA 4HLEA 3VDZA 2XBBC 4TUUA 4W9LA 3PRZA 3V6EB 2IO1B 2V1YA 4BBNF 2LXAA 3AULA 5JH5C 2JXXA 2L0TA 1WZ3A 1L2NA 4AJWA 1WMHB 1OTRB 3B08A 3CMMB 4PYZA 3NS8A 3VTWA 4GIVA 1Z5SB 1P9DU 4M0WB 4DK5A 2KX3A 2JRIB 2LZ6A 2BYEA 1ZKHA 4IWPA 4FJYA 2J0KA 3WAPA 1WZ0A 4CO7A 3NZUA 1ZGUB 3TJPA 2LJ5A 3WAMA 3ONSA 2KHWB 2KTFA 3L10B 3U8ZA 1WH3A 4DBGA 3UGBB 1WR6E 2KDFB 2CS4A 1C1YB 3PHXB 4B95A 2M4NA 5HKHA 3APCA 5JHBA 5CHWA 3APDA 4EZJA 2IO2B 3B0AA 2KWVB 1P1AA 5J17A 4HWIB 2MW5A 4MH0E 1X1MA 2RSUA 2REXA 4AWJA 3ZNID 1S3SG 4EFOA 4X57B 2O6VD 1D3ZA 2G4DB 1QZEA 2K39A 3BINA 3W1SA 4F8CB 1E8XA 4TV3A 4II3B 4HDQA 2PEAA 2JY6A 2L7RA 3WIMA 4AP4C 1WF9A 3H1UA 4XX5A 3RUIB 1NDDA 1E8ZA 1GUAB 2LGXA 4WWOA 4ZDVA 2AL6A 1WXVA 3H9DA 2GBMA 5CHVC 2GBKA 3ZW3A 2FAZA 1I35A 3UQAA 4IM2A 3R3MA 1Q1OA 4MGZE 4HPMB 1EF1A 2DZJA 2L3ZA 2MBHA 4GU2A 2J0MA 4B9KA 2UYZB 4LDTB 4EUTA 3ML8A 4LCDE 2MRPA 4RMAA 2NCNA 3QK0A 1WR1A 4WJNA 2IO0B 2N9PC 2GBRA 4JLCA 3VTVA 4K81A 3JW0X 2QHOA 4I6LB 2XEWA 2FNJB 3ZVVA 3ZDTA 4KV2A 1WE7A 3X23A 2O2VB 2KDEB 2WX0A 3KUCB 4IG7B 2A4ZA 2DZKA 2K8CA 3IVFA 3T8MA 3ZDMC 4W9HA 2L05A 2DYOA 3UINB 4HK2A 2WDTB 4E3CA 2NPTA 2NPTB 2Z0EB 2Y5BB 4KSKC 5E6PA 4IC7B 1C3TA 2J7QB 3PTFC 2ZVNA 1WX9A 4MDKE 3D32A 4MGIE 4FHKA 4AJYB 2LVQA 2IY0B 2FUHB 3VAWA 4MGKE 1YJ1A 4TQ0A 2OJRA 3KW5B 3L0WB 1XT9B 2KWUB 3DOWA 4ASWC 4EZKA 4OVVA 2K6QA 3DQVA 3V62A 5LXHA 3H7PA 1OQYA 3H7PB 4ICUA 3A9KA 3A9KB 1R4MI 1SGHA 2DZIA 2RR9A 4WJOA 2LASA 3ZO5B 1UH6A 3JSVA 3JSVB 2MBEA 4FHJA 1G6JA 2KKCA 3ZNZB 2IZVB 3ZLZA 1KM7A 2C60A 2AWTA 5J18A 2A5UA 2ZCBA 3EC8A 4TKNA 1M94A 4MELA 4K1RB 4GMVA 3H6NA 2LWPA 4TQ1A 2AYOB 4EZLA 3AI5A 5IAAC 3RYTA 2BF8B 3HIZA 3L13A 3PPAA 4W9KA 3ALBA 4XZ4A 3DVNV 1Y8RC 1NBFC 2DHZA 3DDCB 4OVUA 5E6NA 3SU8X 4CHKA 2MCNB 3CF6E 3QX1A 4IM3A 3W1YA 1E8WA 5FR6A 2W9NA 4MSMB 2CHWA 4IWQA 1OEYA 2KJRA 3L17A 5AZGA 2K1FA 2WX1A 5LXIB 2MLBA 1OGWA 1KJTA 2LXCA 2JZZA 2HD5B 2N1WA 3DVGX 2L00B 3VFKA 4GGQA 4YL8A 1V81A 3QARA 2NBWB 2BPSA 2LD9A 5AEKB 4K7SA 1RLFA 4JGHB 1WGHA 2NS5A 1V5TA 3ZNHB 1ISNA 2ZNVB 5L95C 3VUXA 2ZVOA 2KMCA 3KYDD 3M62B 3RCZA 5KHQA 3VVWB 2G4SA 3KH0A 1P3QU 3JVZX 4FLHA 5DPSA 2MP2A 2MP2B 3A1QA 3A1QB 1TTNA 4DHJD 2NBUA 3T9LA 4GDLA 4GDLB 3NY5A 4ANXA 2L0FA 2KZRA 2K6DB 2KDIA 4BKTA 3DBSA 1VD2A 3IFWB 1V86A 3ECIA 2JUOA 3VQIA 2KTRA 2KTRB 4P7IA 2C7NB 4KDIC 4DHZB 4ANWA 4LJOB 1S1QB 5JZEB 3L16A 3RD2A 3VH3B 4II2B 2JRHA 2LRWA 3A33B 4M8NA 4WWPA 1GC7A 2CHXA 2EMTA 3VTUA 1IPGA 4JIOU 3PV1A 2FIFA 4JQWC 2JT4B 2FIDA 4DWFA 3R7RA 2MSED 2RD0A 3PRPB 4HCPB 2JF5A 3UF8A 3V61A 4BOSC 3PSEB 3V6CB 3DBLI 3LDZE 1GG3A 1K8RB 1UGMA 2C5LC 1SIFA 2KLGA 2KNBA 2LVPA 3ZIMA 2KC1A 2EKEC 1I42A 4EEWA 2KXJA 4F7ZA 1UZXB 1OEYJ 3HM6X 2NR2A 2PE9A 4M8MA 1EUVB 3NHEB 3TBLD 3TIXA 5DPRA 3P2BA 2NVUI 1WRDB 4ICVA 3DVGY 1RAXA 4BBNC 2BWFA 2MX2A 2ZZPB 3TL5A 1YX5B 3QWZB 4W9EA 1LFDA 2N9XA 2ZCCA 2WYQA 4W9CA 4ZRIA 2KO3A 2V3SA 5CTRC 2J0JA 1YX6B 2KN5A 3TCAA 5L83A 4DHZE 2HTHA 4WWNA 4DHJB 1RFAA 3EECA 5CX3A 4I6NB 4G11A 4ZRKA 4W9GA 3ZKJC 4BFRA 3L54A 1E7UA 2PPHA 2LGDA 4FBJB 2XK5A 1F9JA 2XK5B 4GSWA 2KDBA 5G2NA 5E6OA 1FXTB 1YIWA 1MG8A 2BWES 1E90A 3TMPB 3UIPB 2Z0DB 2GBJA 3QCAA 5GMVA
chains in the Genus database with same CATH superfamily
4NQLB 2WXFA 1R4NB 4TMAB 1FM0D 1QF6A 2QSDA 3ZNGC 4F1SA 2JZPA 4GB9A 1AYFA 3BZDB 1WXMA 1N60A 4GDKA 4K7WA 2WHIA 1E8YA 3LJ3A 3Q6BA 2CJOA 5BYSA 4W9FA 2W54A 3BYTB 2M17A 2RDHA 1SE4A 5DCNA 2I38A 3BVZA 3P4SB 1NVID 4FJVB 3VHTC 2C9WB 3DBRI 4RCOA 3I5JC 1I4XA 5C1ZA 4W9DA 4KGRA 3R7QA 3BY4B 5HFYA 3WANA 5IOIA 3H7SA 2KX0A 1NI3A 2MEKA 4LNNA 4ZRJA 1V49A 4MJSA 1SF0A 4BKGA 1I4QA 4XWTA 2KOXA 1GPXA 4NQKE 3OG5A 3AU4A 1WMHA 3VR9B 3I9V1 2PLPA 3OAWA 3R2IA 2N4FA 1WJ6A 3C0RB 1FO4A 2D11A 1QKZA 2D10A 1F2RI 1HTQA 1TZOA 3VR8B 2DAJA 5JHAA 3N3KB 3U7ZA 2V4LA 4OZCA 3QIJA 5D6JB 3KYCD 1WGGA 1WFYA 1UNSA 2V3PA 4AOFA 1EO6A 4W9IA 4IKGA 2K25A 4OZBA 4NJ6A 3GE3C 1GJZA 2KD0A 1TGZB 3IT4B 3ZRFA 2WU2B 1I4GA 5D94A 2NMQA 1VRAB 2KAJA 4MM3B 1K51A 2MBOA 3KVFB 1T0YA 3DHHC 3EA6A 3RZFA 3A9JB 1TYGB 2O2VA 1SE9A 4FJZA 2KFJA 2N7DA 2D07B 2H89B 1YD8U 2KFKB 3RNFC 1XEEA 2ZEQA 1WXQA 4JE3B 1Q0WB 1V5OA 4HJKA 3UI3A 3UQBA 1N62A 1MVKA 1A5RA 1AWDA 2DBYA 1C4CA 2WXJA 3R66C 4YTPB 1J7BA 2EMSA 3WAOA 2E3TA 4C56C 4ITKA 3CIRB 1QOFA 1F52A 3AEAB 3LXFA 5KHOA 3RNAC 3W1SC 1JMLA 3AMZA 2WXIA 1XLQA 4OHJA 4C4VA 2BKRB 3AN1A 1FFUA 5C23A 4P1CC 4KDLB 2LVOA 2INDC 2WLBA 3PLUA 4C80A 3MJ5A 1D5MC 3PHWB 5BYQA 3RNGC 3T3NA 3BYYB 4J6IA 1YQ3B 2BGFA 4GXBA 2WWZA 2NTSA 3DWMA 4W9LA 3ZYYX 3PRZA 1N6ZA 4BBNF 1XLPA 5JH5C 1L2NA 1WZ3A 4HEA1 1WMHB 3NVWA 4DK5A 2L1AA 1ZKHA 3WAPA 1ZGUB 3I63C 3WAMA 3ONSA 3VRAB 2TSSA 3L10B 2JYEA 4DBGA 3PHXB 1C1YB 2RDGA 3APCA 1SEBD 5CHWA 3BVMA 5JHBA 2KWVB 5J17A 2QJLA 1X1MA 3ZNID 4ARCA 2O6VD 1D3ZA 3W1SA 1HXYD 4II3B 2PEAA 1I4HA 3H1UA 4XX5A 3RUIB 2L32A 2PTLA 2AL6A 2GBMA 5CHVC 3ZW3A 3Q8CA 1TJEA 2UU7A 3R3MA 1T0SC 3NVVA 1ZDVA 2DZJA 4GU2A 3ZJTA 3E9SA 4LDTB 4LCDE 4C7YA 3P4PB 2NCNA 1WR1A 2GBRA 1TS4A 3JW0X 3SEBA 4KKJA 3LB8C 2PIAA 2O2VB 4S17A 2DZKA 1ROEA 2K8CA 3B2GA 3ZDMC 4W9HA 2L05A 2MH7A 2WDTB 3ZXVA 4ACFA 2NPTB 4RNAA 2Z0EB 2Y5BB 2GI9A 4MGIE 4FHKA 1QILA 3VAWA 1YJ1A 1L0YB 2OJRA 2LGIA 3DOWA 2K6QA 5LXHA 3H7PB 2RR9A 2LASA 1R4MB 3ZO5B 1UH6A 2MBEA 1CK1A 1FRDA 4O1NA 3ZNZB 5IO9A 2ZCBA 4TKNA 4K1RB 1F0ZA 1YN3A 3MC9A 5IAAC 3L13A 4W9KA 1F77A 1F2RC 4OVUA 5G5GA 3W2DA 3SU8X 3P1MA 1J7CA 1E8WA 4NJCA 4LK0M 5AZGA 3RPFC 2PVOD 3W5VB 2BB5A 2HD5B 3AM9A 3DVGX 2L00B 2LD9A 1JWBD 4JGHB 1WGHA 2BS2B 2ZVOA 3VVWB 1TS2A 1HTOA 1P3QU 4FLHA 5DPSA 2MP2B 2L0FA 3B9JA 3RN9C 2KDIA 5IKCM 1V86A 1K52A 2JUOA 3VQIA 1GB1A 2C7NB 5JZEB 3RD2A 4II2B 2JRHA 2LRWA 4WWMA 2EMTA 1IPGA 3PV1A 2FIFA 4JQWC 4REZA 2JT4B 3RI7C 3R7RA 2RD0A 3PRPB 3V61A 3IAS1 4BOSC 3ABVB 1GG3A 1UGMA 1N61A 3KWVA 4F7ZA 1WGKA 2NR2A 4M8MA 1HZ6A 5DPRA 1RAXA 4W9CA 1LFDA 1KF6B 4ZRIA 1MG4A 1AN8A 2J0JA 1YX6B 2KN5A 3TCAA 1STEA 2HTHA 4KGTA 3RNCC 4DHJB 4AQ7A 1BUIC 3NS1A 2WP9B 2LUMA 4BFRA 2PPHA 2LGDA 4GSWA 2KDBA 5G2NA 3Q8AA 1FXTB 3AE3B 2Y3AA 2GBJA 3QCAA 3X0WA 1FNWA 2LHDA 2O6VB 4JPSA 2QC8A 3FC4A 2ASQA 1UBIA 5TSSA 1TT5B 1KOTA 4HKQA 1MPEA 2BS4B 2DENB 4EOYA 2D5GA 1E7PB 1QQRA 2FCSA 1Z2MA 2KQSA 4M01A 4NAWB 4LNOA 2BB6A 2ZPNA 1PDXA 4HDOA 2K8BA 1XLNA 2KJHB 5TR5A 2L76A 2ZJDA 4DDID 2DAFA 3AE7B 2HJ8A 1ZXIA 3N1XC 3QHTA 2M8SA 2V4IB 1GC6A 4ANVA 4KIKA 1UD7A 3P63A 3DBRB 5EE1A 1UWXA 2M1MA 2CKHB 2LI5A 3K9PB 1WXSA 2DYMA 3WCQA 2DYBA 5IA7A 1TY2A 2QDFA 3R2TA 3AEGB 1WM2A 1BMLC 3AEEB 1R7SA 2QEJC 1JRUA 2W3SA 2IJ0A 4PK1A 1JW9D 1SJED 5AZHA 2GMIC 2X8XX 5EDSA 3PLVA 2Z59B 1IP9A 1MHXA 4RGOS 2INPE 5D3IB 1SJHD 4M0WA 1I4PA 1NYRA 1WM3A 4XDCA 1KLUD 1IUEA 3Q3JA 3SHQA 3AE6B 1ACCA 4M00A 2FCQA 4XDDA 4HPLB 3MTNB 5EE9A 4URKA 4OVZA 1L7YA 3FKYA 4WJPA 1XO3A 3ZTCA 1GB4A 2KANA 4K3BA 1UELA 4NJ7A 3ZJUA 2N0SB 1WJUA 4MGYE 3L08A 3U7DA 1I7HA 3KQ4A 4IUMB 3B2FA 2CHZA 1AARA 4YWGG 1LXDA 3KUZA 3GZNI 4KVGB 2KYWA 2KDMA 2VH2A 4A9AA 4KSLC 4MM3A 1MFWA 2V0GA 3DHGC 3A9JA 4FN2A 1YQBA 2N9EB 1WIAA 4GOCA 1TBEA 2DWQA 2KFKA 4K7UA 4FA6A 4NPNA 1WJNA 3ZTDA 1VCBA 2ZNVC 2L8JA 2ACZB 5D2MB 4ZYSA 3VXWA 2KQ7A 2MWSB 1V1OA 2DX5B 3S2AA 2MBBB 4FADA 4AUQC 2GLSA 2JSVX 1WGRA 3IAM1 2ZW0A 1PQSA 3WALA 2IO3B 1T6BX 1V8CA 2G3QB 2HE7A 4A3OA 2KMAA 5BMGA 3QAQA 2KC2A 4KIKB 2K8HA 2AQ2B 3I3TB 2KWCA 4BOZB 2WDVB 2KVRA 3N32A 5DPWA 2ZPYA 2AEHA 2GOWA 2LRUA 5AZFA 3BK2A 3ML9A 3N20C 4LDTD 1ZXHA 2NBVB 2Y5CA 4GN1A 1ZW7A 3VDZA 2XBBC 3V6EB 2M0AA 2JXXA 3AECB 4AJWA 3CMMB 2M56B 4PYZA 3VTWA 2BYTA 1Z5SB 1P9DU 4M0WB 1FIQA 2JRIB 3HUIA 1SB3C 1RM6C 2J0KA 4FJYA 1WZ0A 2WDRB 1VDVA 2KTFA 4RH6A 2M4NA 5HKHA 4C00A 3MC8A 4WAFA 1T3QA 1SE3A 4HKZE 1P1AA 2REXA 1L6VA 4X57B 2G4DB 1QZEA 2K39A 4F8CB 2X38A 2L7RA 4AP4C 1WF9A 1L0XB 1NDDA 1E8ZA 1GUAB 4ZDVA 2IDYA 3BK1A 1I35A 4IM2A 1QOGA 4MGZE 4N6EB 4HPMB 1HZ5A 2J0MA 4EUTA 2MRPA 1C77A 4RMAA 2MJ3A 4WJNA 2BT6A 4KKIA 3V05A 3VTVA 1HA5A 2ON8A 4K81A 1FPYA 2QHOA 2HDEA 3X23A 2KDEB 4YTNB 3IVFA 3T8MA 3NVYA 1E10A 2NPTA 3ZJVA 4CQNA 3AE8B 1TY0A 2J7QB 2N9LA 3H8HA 2D3BA 2BW2A 4MDKE 3D32A 4AJYB 3TEZA 2IY0B 1SIJA 4BAXA 2KWUB 4OVVA 3H7PA 1OQYA 3AE2B 3PO0A 1JCKB 1EU4A 1SGHA 4WJOA 1Q10A 3N9YC 2WXHA 4FHJA 1G6JA 2KKCA 2QILA 2IZVB 2KVZA 1KM7A 2AWTA 1CZPA 1YQ4B 4TQ1A 1WSPA 3RYTA 3DWGC 1JRPA 3HIZA 4XZ4A 1Y8RC 2WXOA 2DHZA 4CHKA 2MCNB 4IM3A 1NEKB 5FR6A 1YMHE 1DOXA 1KFYB 4P6VF 4IWQA 3I57A 1OEYA 2K1FA 1DYQA 4TSSA 3N1ZC 2WXKA 4YL8A 1JWUD 2HTME 2WS3B 3AE4B 1N5XA 4K7SA 4OW0A 2I2YA 4YSZB 5E6JA 2ZNVB 1E9MA 3VUXA 3KH0A 2MP2A 4DHJD 3KLSX 2NBUA 3T9LA 3TSSA 3NY5A 2KZRA 2K6DB 1C79A 4BKTA 1C4PA 1VD2A 2KTRB 1ET9A 2INNE 4KDIC 3A33B 4A6QA 4WWPA 1JQ4A 2CHXA 3SR6A 2MSED 1B1ZA 4HCPB 2JF5A 3UF8A 2DLBA 3W9CB 3V6CB 3DBLI 1N5WA 1K8RB 5FR3A 2C5LC 2KNBA 2KLGA 2EKEC 4EEWA 3CWIA 2PE9A 4IOIE 1L6UA 3Q8EA 2NVUI 4USAA 3V3XA 3TL5A 1YX5B 2ZCCA 4NZLB 4OZAA 1VZ6A 1XXGA 3L54A 1OQRA 5E6OA 1YIWA 1MG8A 1P7FA 2L83A 1L4ZB 1E90A 3TMPB 3B1LX 2Z0DB 2J4XA 4LJPB 3CSTA 2O6VA 4LLGM 2OOBB 1JWAD 3RNEC 2KQ4X 4HVBA 3FAHA 2C7MB 1LO5D 1C76A 3NZSA 1T0QC 2VRRB 1FRRA 2C7HA 2N7EA 1YJIA 4NAWA 1CMXB 1V80A 5T8IA 1ZP0B 4EE2A 1D4BA 1ZDXA 3DBHI 3OJ3A 1J19A 4R3DA 3C8YA 4GLSC 4XGAB 4BVUC 4JX1C 3ENEA 2JWZA 1WE6A 2RPQA 4WH4A 3KWLA 4K3CA 4ZRQA 5IP4D 3V60A 2UWQA 1KTKA 3SD5A 1H8CA 3MFGA 3GE8C 2M0XA 4KZCA 1IGCA 5G5HA 1QT9A 4BZAA 1GNUA 4RF0A 2LJIA 3WA0A 3IG3A 3DVNU 3EFCA 2GBNA 4MEMA 3AE5B 2JX5A 1RFKA 2B3AA 2KK8A 3HHMA 1NI2A 4ZYNA 3QA8A 3W5UB 2JWUA 2G45B 3MHZA 1WJ4A 4PYUA 2VH1A 1DOYA 1TKGA 4J3OD 1JROA 2CU1A 1IYFA 2BYVE 1C78A 4ANUA 4DDGD 2BTEA 2WXGA 2BVCA 2PJHA 1Q5WB 2GB1A 3UIOB 2LGYA 2WXRA 1UF0A 1ZE3D 4LNKA 3BIID 2W55A 3GZNB 3PT2B 1D5XC 2CU3A 3A4RA 3U2SC 4IWOA 2R61A 5JXVA 2OHFA 2IYDB 5BO4B 1P0RA 4PS3A 5EE0A 5HG2A 4B0MA 3NZ3A 4YSXB 2PE6B 1EWCA 3ZRCA 3IHPC 4BKSD 5AUKA 5H92C 1E5WA 5C2TB 2RMMA 3A4SC 1ESFA 2ZW1A 4XE0A 2J42A 1LM8B 2YVCA 2SEBD 1ZOYB 1PFDA 3AV8A 1XLOA 3APFA 2RDBC 3KUDB 4NNJB 3PVLA 4DXAB 3PS6A 4US9A 2LUEA 4EKUA 4PS7A 3U30A 3O65B 3VUYA 2D3CA 2AQ3B 2KLCA 1WI0A 1WX7A 1FEHA 1IBXB 2IBIB 5BMIA 3LYYA 1V2YA 2D2QA 4N59A 2OEDA 1H4RA 1HQRD 1P98A 2I1KA 1KLGD 1J8CA 2N1VA 3HM3A 3P42A 4WQOB 1BT0A 1WY8A 3IBEA 3J9CA 4BKSA 1WGYA 1VLBA 1WXAA 2RPVA 2WGSA 4TUUA 2W3RA 2IO1B 2K0PA 2V1YA 2LXAA 2L0TA 3B08A 3NS8A 4GIVA 2WXQA 4ZRPA 4KX6B 2BYEA 4IWPA 2NTTA 4PT5A 2PKOA 1D6EC 5I4DA 2K5PA 3TJPA 2LJ5A 3U8ZA 4JWUC 4YXDB 3UGBB 1LGRA 1WR6E 2CS4A 4B95A 4WURA 3APDA 1SXTA 3B0AA 4HWIB 4MH0E 2IPKD 1ZPSA 2KMMA 4HDQA 2JY6A 1WWTA 2LGXA 4WWOA 1V1PB 2GBKA 1TKYA 2J52A 3GB1A 4N58A 4DQOC 2BQQA 2ONQA 2N9PC 4JLCA 2M19A 2BBCA 1NENB 4I6LB 3ZVVA 2FNJB 3EGRA 1EWYC 3ZDTA 1WRIA 3TEYA 3IXSA 1FCCC 4KV2A 2WX0A 1RYJA 2DYOA 4HK2A 4E3CA 3RNBC 4IC7B 4P16A 3PTFC 2ZVNA 4L1BA 1F1HA 2J53A 3IT6B 2LVQA 3U52E 3RFZB 2FUHB 4MGKE 3KW5B 2KN4A 4ASWC 4LNIA 3DQVA 3V62A 4YT0B 3A9KB 2FBWB 4B0EA 2DZIA 1KRHA 3FILB 2B76B 3AEDB 3JSVB 2K9XA 2YEPF 1PGXA 3ZLZA 2C60A 5J18A 2A5UA 2IGHA 4MELA 1WYGA 3H6NA 2FUG1 2LWPA 5H8YE 1QLBB 2BF8B 3PPAA 3ALBA 1NBFC 1FXIA 3DDCB 5E6NA 3CF6E 3QX1A 2BS3B 2W9NA 4MSMB 1DGJA 1CJEA 3L17A 2EKIA 2WX1A 2MLBA 1OGWA 2WXMA 2JXTA 1AW7A 2N1WA 3VFKA 4GGQA 2NBWB 3AE9B 3N1YC 2BPSA 5AEKB 1RLFA 2KACA 2NS5A 3P4QB 1ISNA 3KYDD 5KHQA 3MC0B 1PGBA 2G4SA 1HEZE 3A1QB 4GDLB 2QIEB 1B9RA 5AUIA 2JU6X 3DBSA 1FCLA 2KTRA 4HPPA 4DHZB 3E56A 2PMVA 3RMKC 4ANWA 4D2KA 3Q69A 1S1QB 3L16A 1ENFA 3VH3B 1GC7A 3AEBB 3VTUA 3VRBB 2FIDA 4DWFA 2SAKA 3URYA 3LDZE 3DBLB 1SIFA 3ZIMA 3T3OA 1I42A 4MT5A 2KXJA 1FMAD 2EELA 1UZXB 3HM6X 1EUVB 3TIXA 2G9HD 2ZZPB 4W9EA 2N9XA 2WYQA 4MACA 1GOZA 4XWWA 5CTRC 4DHZE 1YJJA 2Z8LA 5MPOA 4WWNA 4WIPA 5CX3A 4I6NB 4ZRKA 2V3NA 4W9GA 3ZKJC 2LFIA 4FBJB 2XK5B 3C19A 1ET6A 3R8BA 2MJDA 3UIPB 1R4NI 3M63B 4KZ0A 4RGMA 3SFDB 1HE8A 3HVDA 3K9OB 4E74A 3ZUNA 4CYEA 2MA9B 1VR9A 2FCMA 1U4AA 4P1BC 1TZ1A 4G0NB 3MJWA 4GDKB 2CR5A 5D3DA 1Y56A 4ARIA 1JWMD 2IY1B 1V9JA 5D7GA 2JZ3B 1FFVA 4E71A 4A3PA 1SBBB 3Q3FA 2VZKD 3TEXA 3PZDA 2D3GA 3ETRA 3AU5A 1QOAA 3DBHB 4XC2A 1XCTL 3SDLC 1PUTA 3NOBA 3RZWC 5FK9C 2YLMA 2FE8A 2DZMA 4S0RA 1SSNA 4KGSA 4MSQB 2AL3A 3TUOA 1RRBA 3EFUA 2R2OA 1XF5L 3AXCA 4DXFA 2FCNA 3JYUA 2WXLA 3OJ4B 2BKFA 2XN9C 1E7VA 2Y5PA 1OFFA 2K22A 5CHFA 4MJSB 2WXPA 4H2AA 1VJKA 1K50A 5IN7A 5EE3A 1WYWB 3OWEB 3M95A 1EF5A 1LQBA 2JPHA 4RGNA 4W9JA 3PREA 4HROA 1XD3B 3ZXRA 3AH7A 2JVCA 5BYRA 4N9F4 2PW9A 3N30A 5DPTA 3EHVA 3CSFA 2XNAC 1MJDA 2MBQA 2MJEA 2RGFA 5GXGB 2MQJA 4IM0A 4RM9A 4PS8A 2LEKA 3RT3B 1YN5A 4JWSC 5J2RA 3GOEA 3QJZA 1IGDA 4HXDA 4A55A 2KJ6A 2I1JA 1V6EA 4NAMA 3QQ8B 2R2QA 3AEFB 2BYFA 2IGGA 3DPDA 3VH4B 3QC8B 5FKAC 4WAAA 4C7ZA 3MHSD 3AE1B 1WGDA 1WX8A 2N7JA 1KLVA 1TIFA 2G1EA 4G50A 3PRMB 5LLIA 2KT7A 5LNK1 5BMHA 4FXCA 4A20A 3DCGA 1J7AA 3DHIC 4ZOHC 1NYQA 3GS2A 4MH8A 1I4RA 4FULA 3HK0A 1YOVB 4ZHPA 4JL9A 1EU3A 3PGEA 4HCNB 2LMCA 5G55A 1L4DB 4ZHOA 3AB5A 4IW0A 4RM8A 4B6WA 1GAQB 2LHEA 4NY0A 3BVGA 3VUWA 2WQYB 3M3JA 3OLMD 1XQQA 2CJNA 4HRSA 4C4VB 1IBXA 4UDUC 1UBQA 2AQ1B 4RGTA 1J0GA 3PZ8A 3O13A 4WJQA 2INCC 4I6PA 1UWMA 4L23A 3RULA 1M4VA 1RWSA 2MHJA 2KWDA 4G3XB 4HLEA 3AULA 1OTRB 2LGSA 4QAYA 2KX3A 2LZ6A 3PZ7A 1MHHE 4CO7A 3NZUA 2KHWB 1WH3A 4IDIA 2KDFB 3NRZA 2VZKB 2WXNA 4EZJA 2IO2B 1FXAA 2MW5A 4AWJA 2RSUA 1S3SG 1A70A 4EFOA 3BINA 1E8XA 4TV3A 2HJ1A 3WIMA 1V1PA 3H9DA 1WXVA 4AS1A 1SE2A 2FAZA 3UQAA 3Q3MC 1Q1OA 1EF1A 2L3ZA 2MBHA 4B9KA 1TKEA 2UYZB 2IGDA 3ML8A 3QK0A 3HVZA 1BXTA 2AX5A 3NVZA 2IO0B 4RFBA 2OJWA 2XEWA 3Q3NC 1WE7A 2QMTA 3KUCB 4IG7B 2A4ZA 1L5PA 2Q5WD 1EM7A 3UINB 4KSKC 5E6PA 1C3TA 1L0VB 3SFEB 1XCQL 1WX9A 3Q14C 4TQ0A 1YN4A 3L0WB 3Q8FA 3NJTA 1XT9B 4EZKA 1DOIA 4ICUA 3A9KA 1R4MI 4US8A 1PGAA 1ZUD2 3FILA 1FNUA 3JSVA 1TS3A 1D5ZC 1JWSD 3HRDD 3EC8A 1M94A 4GMVA 4Q2JA 2AYOB 1P7EA 4EZLA 3AI5A 1T0RC 3DVNV 4LTUA 3ZGZA 2JQRB 3L4PA 3W1YA 1TS5A 2CHWA 1VZ7A 1C9FA 2KJRA 1PYWD 3ZQ4A 2N9KA 2WDQB 5LXIB 4YSYB 3TEWA 1KJTA 2LXCA 4HJGE 2JZZA 4A90A 1V81A 3EUB2 1JALA 3QARA 1V5TA 3ZNHB 5L95C 3Q2AC 2D3AA 2KMCA 3RCZA 3M62B 2W82A 4A8XC 3JVZX 1FD6A 3A1QA 1TTNA 1FNVA 4GDLA 2GRIA 1V97A 2WU5B 4ANXA 1E0ZA 3Q3OC 4LNFA 4WQMA 3IFWB 4YTMB 3ECIA 1MI0A 4P7IA 3U4EG 1UGJA 4L2YA 3BWUD 4LJOB 1UUPA 2V9HA 1N63A 2ICIA 4M8NA 4JIOU 4M02A 1C4AA 2DNFA 1OQQA 2K3UA 3P4RB 3MP9A 1K53A 3PSEB 5C3JB 1E6EB 1T5XD 2LVPA 2QCZA 2PVGC 2KC1A 4RF1A 1OEYJ 2L52A 3NHEB 5HHDG 3TBLD 3P2BA 1WRDB 4ICVA 3NUHB 3DVGY 5HI1A 4BBNC 2BWFA 2MX2A 1CQVA 3QWZB 2YEPB 1VZ8A 2KO3A 2V3SA 5L83A 3NG0A 1KH0A 2WNMA 2H88B 1RFAA 3EECA 1YNTE 1QOBA 4G11A 2JYTA 4XYCA 2E6XA 1E7UA 3Q8BA 2XK5A 1F9JA 4DXGA 2BWES 3GP7A 5GMVA
chains in the Genus database with same CATH topology
1R4NI 4LJPB 3X0WA 4NQLB 3CSTA 3M63B 4KZ0A 2O6VA 2O6VB 2OOBB 1HE8A 4HVBA 3K9OB 4E74A 3ZUNA 2ASQA 2C7MB 4CYEA 2MA9B 2FCMA 1UBIA 3ZNGC 4F1SA 1U4AA 4GB9A 1TZ1A 3NZSA 1KOTA 4G0NB 3MJWA 2DENB 1WXMA 4GDKA 4GDKB 2CR5A 4K7WA 2VRRB 4EOYA 2C7HA 2IY1B 1E8YA 2N7EA 2FCSA 1Z2MA 2KQSA 3LJ3A 1V9JA 4NAWA 4NAWB 5D7GA 1CMXB 2JZ3B 1V80A 2ZPNA 4A3PA 4HDOA 4E71A 2K8BA 3Q3FA 4W9FA 2KJHB 5TR5A 2L76A 2M17A 2ZJDA 3PZDA 2D3GA 4DDID 2DAFA 3AU5A 5DCNA 3DBHI 2HJ8A 3OJ3A 1J19A 4XC2A 3SDLC 3NOBA 2M8SA 3QHTA 3RZWC 1GC6A 2YLMA 4FJVB 4KIKA 4ANVA 3VHTC 4BVUC 1UD7A 2C9WB 2DZMA 3DBRI 3ENEA 2JWZA 4MSQB 2AL3A 2M1MA 2CKHB 2LI5A 1WE6A 5C1ZA 3K9PB 1WXSA 2RPQA 2DYMA 4W9DA 2DYBA 5IA7A 3R7QA 3BY4B 1RRBA 1WM2A 3EFUA 2UWQA 2R2OA 3V60A 3SD5A 3AXCA 1JRUA 1H8CA 3WANA 3H7SA 2FCNA 3JYUA 3OJ4B 5AZHA 2GMIC 2KX0A 2BKFA 5EDSA 2M0XA 1E7VA 3PLVA 4KZCA 2Z59B 5CHFA 4ZRJA 1IP9A 1V49A 4MJSA 4MJSB 1GNUA 4BKGA 2KOXA 4NQKE 3AU4A 1WMHA 3B1LX 3WA0A 3IG3A 3OAWA 3DVNU 2N4FA 1WYWB 1WM3A 2GBNA 3M95A 1EF5A 1WJ6A 4MEMA 1LQBA 2B3AA 2JPHA 2KK8A 3C0RB 2D11A 3Q3JA 4W9JA 3HHMA 3SHQA 3PREA 1NI2A 2D10A 1XD3B 4ZYNA 2FCQA 2JVCA 3QA8A 3MTNB 4HPLB 4URKA 4N9F4 2DAJA 5JHAA 3N3KB 3N30A 1L7YA 2G45B 2V4LA 5DPTA 3QIJA 1WJ4A 4WJPA 5D6JB 3EHVA 3CSFA 3KYCD 4PYUA 3ZTCA 2MBQA 2KANA 1UELA 2RGFA 1WGGA 4NJ7A 2MQJA 1WFYA 2CU1A 1IYFA 4IM0A 2BYVE 4RM9A 4PS8A 4ANUA 1WJUA 3RT3B 4DDGD 4AOFA 4MGYE 3L08A 1EO6A 4W9IA 5J2RA 3U7DA 3GOEA 3QJZA 4HXDA 2K25A 4IUMB 2PJHA 1Q5WB 4NJ6A 2KJ6A 2I1JA 2LGYA 3UIOB 1GJZA 2KD0A 1V6EA 2CHZA 1AARA 1TGZB 1LXDA 3KUZA 3GZNI 2R2QA 3QQ8B 4KVGB 3ZRFA 2BYFA 3DPDA 3VH4B 5D94A 4KSLC 4MM3A 3PT2B 3QC8B 3A4RA 4WAAA 4IWOA 3MHSD 2IYDB 2MBOA 5BO4B 3KVFB 1T0YA 1WGDA 3RZFA 1P0RA 3A9JA 3A9JB 4PS3A 4FN2A 1YQBA 2N9EB 1WX8A 1KLVA 2O2VA 1SE9A 4FJZA 1WIAA 2KFJA 2N7DA 2D07B 4G50A 2PE6B 4GOCA 3ZRCA 1YD8U 1TBEA 3IHPC 3PRMB 2KFKA 2KFKB 4K7UA 4BKSD 4FA6A 5LLIA 4NPNA 1E5WA 1WJNA 3ZTDA 1VCBA 2ZNVC 3A4SC 2ZEQA 2L8JA 5D2MB 3VXWA 2KQ7A 2MWSB 2DX5B 3S2AA 2MBBB 1LM8B 1Q0WB 2YVCA 4A20A 3DCGA 4AUQC 4FADA 1V5OA 4HJKA 3UQBA 1WGRA 1A5RA 3APFA 3KUDB 4FULA 3HK0A 3R66C 4NNJB 1PQSA 2EMSA 3WAOA 3WALA 4JL9A 3PVLA 4DXAB 3PS6A 2IO3B 2LUEA 3PGEA 2G3QB 2HE7A 4EKUA 4A3OA 2KMAA 4HCNB 5KHOA 3W1SC 4PS7A 5G55A 3U30A 3O65B 3VUYA 3QAQA 2KC2A 4IW0A 2K8HA 4KIKB 4RM8A 4B6WA 3VUWA 2KLCA 3I3TB 4NY0A 1WI0A 2KWCA 1WX7A 3M3JA 2BKRB 1XQQA 3OLMD 4BOZB 2KVRA 1UBQA 3N32A 2IBIB 5C23A 5DPWA 2ZPYA 1J0GA 2AEHA 4KDLB 2GOWA 2LRUA 1V2YA 2D2QA 2LVOA 1H4RA 1P98A 2I1KA 3PLUA 1J8CA 5AZFA 4WJQA 3ML9A 2N1VA 3PHWB 4I6PA 3RULA 3HM3A 4WQOB 4LDTD 1BT0A 1WY8A 4J6IA 2NBVB 3IBEA 2BGFA 4GN1A 4GXBA 2WWZA 1ZW7A 1WGYA 4G3XB 1WXAA 4BKSA 4HLEA 3VDZA 2XBBC 4TUUA 4W9LA 3PRZA 3V6EB 2IO1B 2V1YA 4BBNF 2LXAA 3AULA 5JH5C 2JXXA 2L0TA 1WZ3A 1L2NA 4AJWA 1WMHB 1OTRB 3B08A 3CMMB 4PYZA 3NS8A 3VTWA 4GIVA 1Z5SB 1P9DU 4M0WB 4DK5A 2KX3A 2JRIB 2LZ6A 2BYEA 1ZKHA 4IWPA 4FJYA 2J0KA 3WAPA 1WZ0A 4CO7A 3NZUA 1ZGUB 3TJPA 2LJ5A 3WAMA 3ONSA 2KHWB 2KTFA 3L10B 3U8ZA 1WH3A 4DBGA 3UGBB 1WR6E 2KDFB 2CS4A 1C1YB 3PHXB 4B95A 2M4NA 5HKHA 3APCA 5JHBA 5CHWA 3APDA 4EZJA 2IO2B 3B0AA 2KWVB 1P1AA 5J17A 4HWIB 2MW5A 4MH0E 1X1MA 2RSUA 2REXA 4AWJA 3ZNID 1S3SG 4EFOA 4X57B 2O6VD 1D3ZA 2G4DB 1QZEA 2K39A 3BINA 3W1SA 4F8CB 1E8XA 4TV3A 4II3B 4HDQA 2PEAA 2JY6A 2L7RA 3WIMA 4AP4C 1WF9A 3H1UA 4XX5A 3RUIB 1NDDA 1E8ZA 1GUAB 2LGXA 4WWOA 4ZDVA 2AL6A 1WXVA 3H9DA 2GBMA 5CHVC 2GBKA 3ZW3A 2FAZA 1I35A 3UQAA 4IM2A 3R3MA 1Q1OA 4MGZE 4HPMB 1EF1A 2DZJA 2L3ZA 2MBHA 4GU2A 2J0MA 4B9KA 2UYZB 4LDTB 4EUTA 3ML8A 4LCDE 2MRPA 4RMAA 2NCNA 3QK0A 1WR1A 4WJNA 2IO0B 2N9PC 2GBRA 4JLCA 3VTVA 4K81A 3JW0X 2QHOA 4I6LB 2XEWA 2FNJB 3ZVVA 3ZDTA 4KV2A 1WE7A 3X23A 2O2VB 2KDEB 2WX0A 3KUCB 4IG7B 2A4ZA 2DZKA 2K8CA 3IVFA 3T8MA 3ZDMC 4W9HA 2L05A 2DYOA 3UINB 4HK2A 2WDTB 4E3CA 2NPTA 2NPTB 2Z0EB 2Y5BB 4KSKC 5E6PA 4IC7B 1C3TA 2J7QB 3PTFC 2ZVNA 1WX9A 4MDKE 3D32A 4MGIE 4FHKA 4AJYB 2LVQA 2IY0B 2FUHB 3VAWA 4MGKE 1YJ1A 4TQ0A 2OJRA 3KW5B 3L0WB 1XT9B 2KWUB 3DOWA 4ASWC 4EZKA 4OVVA 2K6QA 3DQVA 3V62A 5LXHA 3H7PA 1OQYA 3H7PB 4ICUA 3A9KA 3A9KB 1R4MI 1SGHA 2DZIA 2RR9A 4WJOA 2LASA 3ZO5B 1UH6A 3JSVA 3JSVB 2MBEA 4FHJA 1G6JA 2KKCA 3ZNZB 2IZVB 3ZLZA 1KM7A 2C60A 2AWTA 5J18A 2A5UA 2ZCBA 3EC8A 4TKNA 1M94A 4MELA 4K1RB 4GMVA 3H6NA 2LWPA 4TQ1A 2AYOB 4EZLA 3AI5A 5IAAC 3RYTA 2BF8B 3HIZA 3L13A 3PPAA 4W9KA 3ALBA 4XZ4A 3DVNV 1Y8RC 1NBFC 2DHZA 3DDCB 4OVUA 5E6NA 3SU8X 4CHKA 2MCNB 3CF6E 3QX1A 4IM3A 3W1YA 1E8WA 5FR6A 2W9NA 4MSMB 2CHWA 4IWQA 1OEYA 2KJRA 3L17A 5AZGA 2K1FA 2WX1A 5LXIB 2MLBA 1OGWA 1KJTA 2LXCA 2JZZA 2HD5B 2N1WA 3DVGX 2L00B 3VFKA 4GGQA 4YL8A 1V81A 3QARA 2NBWB 2BPSA 2LD9A 5AEKB 4K7SA 1RLFA 4JGHB 1WGHA 2NS5A 1V5TA 3ZNHB 1ISNA 2ZNVB 5L95C 3VUXA 2ZVOA 2KMCA 3KYDD 3M62B 3RCZA 5KHQA 3VVWB 2G4SA 3KH0A 1P3QU 3JVZX 4FLHA 5DPSA 2MP2A 2MP2B 3A1QA 3A1QB 1TTNA 4DHJD 2NBUA 3T9LA 4GDLA 4GDLB 3NY5A 4ANXA 2L0FA 2KZRA 2K6DB 2KDIA 4BKTA 3DBSA 1VD2A 3IFWB 1V86A 3ECIA 2JUOA 3VQIA 2KTRA 2KTRB 4P7IA 2C7NB 4KDIC 4DHZB 4ANWA 4LJOB 1S1QB 5JZEB 3L16A 3RD2A 3VH3B 4II2B 2JRHA 2LRWA 3A33B 4M8NA 4WWPA 1GC7A 2CHXA 2EMTA 3VTUA 1IPGA 4JIOU 3PV1A 2FIFA 4JQWC 2JT4B 2FIDA 4DWFA 3R7RA 2MSED 2RD0A 3PRPB 4HCPB 2JF5A 3UF8A 3V61A 4BOSC 3PSEB 3V6CB 3DBLI 3LDZE 1GG3A 1K8RB 1UGMA 2C5LC 1SIFA 2KLGA 2KNBA 2LVPA 3ZIMA 2KC1A 2EKEC 1I42A 4EEWA 2KXJA 4F7ZA 1UZXB 1OEYJ 3HM6X 2NR2A 2PE9A 4M8MA 1EUVB 3NHEB 3TBLD 3TIXA 5DPRA 3P2BA 2NVUI 1WRDB 4ICVA 3DVGY 1RAXA 4BBNC 2BWFA 2MX2A 2ZZPB 3TL5A 1YX5B 3QWZB 4W9EA 1LFDA 2N9XA 2ZCCA 2WYQA 4W9CA 4ZRIA 2KO3A 2V3SA 5CTRC 2J0JA 1YX6B 2KN5A 3TCAA 5L83A 4DHZE 2HTHA 4WWNA 4DHJB 1RFAA 3EECA 5CX3A 4I6NB 4G11A 4ZRKA 4W9GA 3ZKJC 4BFRA 3L54A 1E7UA 2PPHA 2LGDA 4FBJB 2XK5A 1F9JA 2XK5B 4GSWA 2KDBA 5G2NA 5E6OA 1FXTB 1YIWA 1MG8A 2BWES 1E90A 3TMPB 3UIPB 2Z0DB 2GBJA 3QCAA 5GMVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R4N I;  4LJP B;  3X0W A;  4NQL B;  3CST A;  3M63 B;  4KZ0 A;  2O6V A;  2O6V B;  2OOB B;  1HE8 A;  4HVB A;  3K9O B;  4E74 A;  3ZUN A;  2ASQ A;  2C7M B;  4CYE A;  2MA9 B;  2FCM A;  1UBI A;  3ZNG C;  4F1S A;  1U4A A;  4GB9 A;  1TZ1 A;  3NZS A;  1KOT A;  4G0N B;  3MJW A;  2DEN B;  1WXM A;  4GDK A;  4GDK B;  2CR5 A;  4K7W A;  2VRR B;  4EOY A;  2C7H A;  2IY1 B;  1E8Y A;  2N7E A;  2FCS A;  1Z2M A;  2KQS A;  3LJ3 A;  1V9J A;  4NAW A;  4NAW B;  5D7G A;  1CMX B;  2JZ3 B;  1V80 A;  2ZPN A;  4A3P A;  4HDO A;  4E71 A;  2K8B A;  3Q3F A;  4W9F A;  2KJH B;  5TR5 A;  2L76 A;  2M17 A;  2ZJD A;  3PZD A;  2D3G A;  4DDI D;  2DAF A;  3AU5 A;  5DCN A;  3DBH I;  2HJ8 A;  3OJ3 A;  1J19 A;  4XC2 A;  3SDL C;  3NOB A;  2M8S A;  3QHT A;  3RZW C;  1GC6 A;  2YLM A;  4FJV B;  4KIK A;  4ANV A;  3VHT C;  4BVU C;  1UD7 A;  2C9W B;  2DZM A;  3DBR I;  3ENE A;  2JWZ A;  4MSQ B;  2AL3 A;  2M1M A;  2CKH B;  2LI5 A;  1WE6 A;  5C1Z A;  3K9P B;  1WXS A;  2RPQ A;  2DYM A;  4W9D A;  2DYB A;  5IA7 A;  3R7Q A;  3BY4 B;  1RRB A;  1WM2 A;  3EFU A;  2UWQ A;  2R2O A;  3V60 A;  3SD5 A;  3AXC A;  1JRU A;  1H8C A;  3WAN A;  3H7S A;  2FCN A;  3JYU A;  3OJ4 B;  5AZH A;  2GMI C;  2KX0 A;  2BKF A;  5EDS A;  2M0X A;  1E7V A;  3PLV A;  4KZC A;  2Z59 B;  5CHF A;  4ZRJ A;  1IP9 A;  1V49 A;  4MJS A;  4MJS B;  1GNU A;  4BKG A;  2KOX A;  4NQK E;  3AU4 A;  1WMH A;  3B1L X;  3WA0 A;  3IG3 A;  3OAW A;  3DVN U;  2N4F A;  1WYW B;  1WM3 A;  2GBN A;  3M95 A;  1EF5 A;  1WJ6 A;  4MEM A;  1LQB A;  2B3A A;  2JPH A;  2KK8 A;  3C0R B;  2D11 A;  3Q3J A;  4W9J A;  3HHM A;  3SHQ A;  3PRE A;  1NI2 A;  2D10 A;  1XD3 B;  4ZYN A;  2FCQ A;  2JVC A;  3QA8 A;  3MTN B;  4HPL B;  4URK A;  4N9F 4;  2DAJ A;  5JHA A;  3N3K B;  3N30 A;  1L7Y A;  2G45 B;  2V4L A;  5DPT A;  3QIJ A;  1WJ4 A;  4WJP A;  5D6J B;  3EHV A;  3CSF A;  3KYC D;  4PYU A;  3ZTC A;  2MBQ A;  2KAN A;  1UEL A;  2RGF A;  1WGG A;  4NJ7 A;  2MQJ A;  1WFY A;  2CU1 A;  1IYF A;  4IM0 A;  2BYV E;  4RM9 A;  4PS8 A;  4ANU A;  1WJU A;  3RT3 B;  4DDG D;  4AOF A;  4MGY E;  3L08 A;  1EO6 A;  4W9I A;  5J2R A;  3U7D A;  3GOE A;  3QJZ A;  4HXD A;  2K25 A;  4IUM B;  2PJH A;  1Q5W B;  4NJ6 A;  2KJ6 A;  2I1J A;  2LGY A;  3UIO B;  1GJZ A;  2KD0 A;  1V6E A;  2CHZ A;  1AAR A;  1TGZ B;  1LXD A;  3KUZ A;  3GZN I;  2R2Q A;  3QQ8 B;  4KVG B;  3ZRF A;  2BYF A;  3DPD A;  3VH4 B;  5D94 A;  4KSL C;  4MM3 A;  3PT2 B;  3QC8 B;  3A4R A;  4WAA A;  4IWO A;  3MHS D;  2IYD B;  2MBO A;  5BO4 B;  3KVF B;  1T0Y A;  1WGD A;  3RZF A;  1P0R A;  3A9J A;  3A9J B;  4PS3 A;  4FN2 A;  1YQB A;  2N9E B;  1WX8 A;  1KLV A;  2O2V A;  1SE9 A;  4FJZ A;  1WIA A;  2KFJ A;  2N7D A;  2D07 B;  4G50 A;  2PE6 B;  4GOC A;  3ZRC A;  1YD8 U;  1TBE A;  3IHP C;  3PRM B;  2KFK A;  2KFK B;  4K7U A;  4BKS D;  4FA6 A;  5LLI A;  4NPN A;  1E5W A;  1WJN A;  3ZTD A;  1VCB A;  2ZNV C;  3A4S C;  2ZEQ A;  2L8J A;  5D2M B;  3VXW A;  2KQ7 A;  2MWS B;  2DX5 B;  3S2A A;  2MBB B;  1LM8 B;  1Q0W B;  2YVC A;  4A20 A;  3DCG A;  4AUQ C;  4FAD A;  1V5O A;  4HJK A;  3UQB A;  1WGR A;  1A5R A;  3APF A;  3KUD B;  4FUL A;  3HK0 A;  3R66 C;  4NNJ B;  1PQS A;  2EMS A;  3WAO A;  3WAL A;  4JL9 A;  3PVL A;  4DXA B;  3PS6 A;  2IO3 B;  2LUE A;  3PGE A;  2G3Q B;  2HE7 A;  4EKU A;  4A3O A;  2KMA A;  4HCN B;  5KHO A;  3W1S C;  4PS7 A;  5G55 A;  3U30 A;  3O65 B;  3VUY A;  3QAQ A;  2KC2 A;  4IW0 A;  2K8H A;  4KIK B;  4RM8 A;  4B6W A;  3VUW A;  2KLC A;  3I3T B;  4NY0 A;  1WI0 A;  2KWC A;  1WX7 A;  3M3J A;  2BKR B;  1XQQ A;  3OLM D;  4BOZ B;  2KVR A;  1UBQ A;  3N32 A;  2IBI B;  5C23 A;  5DPW A;  2ZPY A;  1J0G A;  2AEH A;  4KDL B;  2GOW A;  2LRU A;  1V2Y A;  2D2Q A;  2LVO A;  1H4R A;  1P98 A;  2I1K A;  3PLU A;  1J8C A;  5AZF A;  4WJQ A;  3ML9 A;  2N1V A;  3PHW B;  4I6P A;  3RUL A;  3HM3 A;  4WQO B;  4LDT D;  1BT0 A;  1WY8 A;  4J6I A;  2NBV B;  3IBE A;  2BGF A;  4GN1 A;  4GXB A;  2WWZ A;  1ZW7 A;  1WGY A;  4G3X B;  1WXA A;  4BKS A;  4HLE A;  3VDZ A;  2XBB C;  4TUU A;  4W9L A;  3PRZ A;  3V6E B;  2IO1 B;  2V1Y A;  4BBN F;  2LXA A;  3AUL A;  5JH5 C;  2JXX A;  2L0T A;  1WZ3 A;  1L2N A;  4AJW A;  1WMH B;  1OTR B;  3B08 A;  3CMM B;  4PYZ A;  3NS8 A;  3VTW A;  4GIV A;  1Z5S B;  1P9D U;  4M0W B;  4DK5 A;  2KX3 A;  2JRI B;  2LZ6 A;  2BYE A;  1ZKH A;  4IWP A;  4FJY A;  2J0K A;  3WAP A;  1WZ0 A;  4CO7 A;  3NZU A;  1ZGU B;  3TJP A;  2LJ5 A;  3WAM A;  3ONS A;  2KHW B;  2KTF A;  3L10 B;  3U8Z A;  1WH3 A;  4DBG A;  3UGB B;  1WR6 E;  2KDF B;  2CS4 A;  1C1Y B;  3PHX B;  4B95 A;  2M4N A;  5HKH A;  3APC A;  5JHB A;  5CHW A;  3APD A;  4EZJ A;  2IO2 B;  3B0A A;  2KWV B;  1P1A A;  5J17 A;  4HWI B;  2MW5 A;  4MH0 E;  1X1M A;  2RSU A;  2REX A;  4AWJ A;  3ZNI D;  1S3S G;  4EFO A;  4X57 B;  2O6V D;  1D3Z A;  2G4D B;  1QZE A;  2K39 A;  3BIN A;  3W1S A;  4F8C B;  1E8X A;  4TV3 A;  4II3 B;  4HDQ A;  2PEA A;  2JY6 A;  2L7R A;  3WIM A;  4AP4 C;  1WF9 A;  3H1U A;  4XX5 A;  3RUI B;  1NDD A;  1E8Z A;  1GUA B;  2LGX A;  4WWO A;  4ZDV A;  2AL6 A;  1WXV A;  3H9D A;  2GBM A;  5CHV C;  2GBK A;  3ZW3 A;  2FAZ A;  1I35 A;  3UQA A;  4IM2 A;  3R3M A;  1Q1O A;  4MGZ E;  4HPM B;  1EF1 A;  2DZJ A;  2L3Z A;  2MBH A;  4GU2 A;  2J0M A;  4B9K A;  2UYZ B;  4LDT B;  4EUT A;  3ML8 A;  4LCD E;  2MRP A;  4RMA A;  2NCN A;  3QK0 A;  1WR1 A;  4WJN A;  2IO0 B;  2N9P C;  2GBR A;  4JLC A;  3VTV A;  4K81 A;  3JW0 X;  2QHO A;  4I6L B;  2XEW A;  2FNJ B;  3ZVV A;  3ZDT A;  4KV2 A;  1WE7 A;  3X23 A;  2O2V B;  2KDE B;  2WX0 A;  3KUC B;  4IG7 B;  2A4Z A;  2DZK A;  2K8C A;  3IVF A;  3T8M A;  3ZDM C;  4W9H A;  2L05 A;  2DYO A;  3UIN B;  4HK2 A;  2WDT B;  4E3C A;  2NPT A;  2NPT B;  2Z0E B;  2Y5B B;  4KSK C;  5E6P A;  4IC7 B;  1C3T A;  2J7Q B;  3PTF C;  2ZVN A;  1WX9 A;  4MDK E;  3D32 A;  4MGI E;  4FHK A;  4AJY B;  2LVQ A;  2IY0 B;  2FUH B;  3VAW A;  4MGK E;  1YJ1 A;  4TQ0 A;  2OJR A;  3KW5 B;  3L0W B;  1XT9 B;  2KWU B;  3DOW A;  4ASW C;  4EZK A;  4OVV A;  2K6Q A;  3DQV A;  3V62 A;  5LXH A;  3H7P A;  1OQY A;  3H7P B;  4ICU A;  3A9K A;  3A9K B;  1R4M I;  1SGH A;  2DZI A;  2RR9 A;  4WJO A;  2LAS A;  3ZO5 B;  1UH6 A;  3JSV A;  3JSV B;  2MBE A;  4FHJ A;  1G6J A;  2KKC A;  3ZNZ B;  2IZV B;  3ZLZ A;  1KM7 A;  2C60 A;  2AWT A;  5J18 A;  2A5U A;  2ZCB A;  3EC8 A;  4TKN A;  1M94 A;  4MEL A;  4K1R B;  4GMV A;  3H6N A;  2LWP A;  4TQ1 A;  2AYO B;  4EZL A;  3AI5 A;  5IAA C;  3RYT A;  2BF8 B;  3HIZ A;  3L13 A;  3PPA A;  4W9K A;  3ALB A;  4XZ4 A;  3DVN V;  1Y8R C;  1NBF C;  2DHZ A;  3DDC B;  4OVU A;  5E6N A;  3SU8 X;  4CHK A;  2MCN B;  3CF6 E;  3QX1 A;  4IM3 A;  3W1Y A;  1E8W A;  5FR6 A;  2W9N A;  4MSM B;  2CHW A;  4IWQ A;  1OEY A;  2KJR A;  3L17 A;  5AZG A;  2K1F A;  2WX1 A;  5LXI B;  2MLB A;  1OGW A;  1KJT A;  2LXC A;  2JZZ A;  2HD5 B;  2N1W A;  3DVG X;  2L00 B;  3VFK A;  4GGQ A;  4YL8 A;  1V81 A;  3QAR A;  2NBW B;  2BPS A;  2LD9 A;  5AEK B;  4K7S A;  1RLF A;  4JGH B;  1WGH A;  2NS5 A;  1V5T A;  3ZNH B;  1ISN A;  2ZNV B;  5L95 C;  3VUX A;  2ZVO A;  2KMC A;  3KYD D;  3M62 B;  3RCZ A;  5KHQ A;  3VVW B;  2G4S A;  3KH0 A;  1P3Q U;  3JVZ X;  4FLH A;  5DPS A;  2MP2 A;  2MP2 B;  3A1Q A;  3A1Q B;  1TTN A;  4DHJ D;  2NBU A;  3T9L A;  4GDL A;  4GDL B;  3NY5 A;  4ANX A;  2L0F A;  2KZR A;  2K6D B;  2KDI A;  4BKT A;  3DBS A;  1VD2 A;  3IFW B;  1V86 A;  3ECI A;  2JUO A;  3VQI A;  2KTR A;  2KTR B;  4P7I A;  2C7N B;  4KDI C;  4DHZ B;  4ANW A;  4LJO B;  1S1Q B;  5JZE B;  3L16 A;  3RD2 A;  3VH3 B;  4II2 B;  2JRH A;  2LRW A;  3A33 B;  4M8N A;  4WWP A;  1GC7 A;  2CHX A;  2EMT A;  3VTU A;  1IPG A;  4JIO U;  3PV1 A;  2FIF A;  4JQW C;  2JT4 B;  2FID A;  4DWF A;  3R7R A;  2MSE D;  2RD0 A;  3PRP B;  4HCP B;  2JF5 A;  3UF8 A;  3V61 A;  4BOS C;  3PSE B;  3V6C B;  3DBL I;  3LDZ E;  1GG3 A;  1K8R B;  1UGM A;  2C5L C;  1SIF A;  2KLG A;  2KNB A;  2LVP A;  3ZIM A;  2KC1 A;  2EKE C;  1I42 A;  4EEW A;  2KXJ A;  4F7Z A;  1UZX B;  1OEY J;  3HM6 X;  2NR2 A;  2PE9 A;  4M8M A;  1EUV B;  3NHE B;  3TBL D;  3TIX A;  5DPR A;  3P2B A;  2NVU I;  1WRD B;  4ICV A;  3DVG Y;  1RAX A;  4BBN C;  2BWF A;  2MX2 A;  2ZZP B;  3TL5 A;  1YX5 B;  3QWZ B;  4W9E A;  1LFD A;  2N9X A;  2ZCC A;  2WYQ A;  4W9C A;  4ZRI A;  2KO3 A;  2V3S A;  5CTR C;  2J0J A;  1YX6 B;  2KN5 A;  3TCA A;  5L83 A;  4DHZ E;  2HTH A;  4WWN A;  4DHJ B;  1RFA A;  3EEC A;  5CX3 A;  4I6N B;  4G11 A;  4ZRK A;  4W9G A;  3ZKJ C;  4BFR A;  3L54 A;  1E7U A;  2PPH A;  2LGD A;  4FBJ B;  2XK5 A;  1F9J A;  2XK5 B;  4GSW A;  2KDB A;  5G2N A;  5E6O A;  1FXT B;  1YIW A;  1MG8 A;  2BWE S;  1E90 A;  3TMP B;  3UIP B;  2Z0D B;  2GBJ A;  3QCA A;  5GMV A; 
#chains in the Genus database with same CATH topology
 4NQL B;  2WXF A;  1R4N B;  4TMA B;  1FM0 D;  1QF6 A;  2QSD A;  3ZNG C;  4F1S A;  2JZP A;  4GB9 A;  1AYF A;  3BZD B;  1WXM A;  1N60 A;  4GDK A;  4K7W A;  2WHI A;  1E8Y A;  3LJ3 A;  3Q6B A;  2CJO A;  5BYS A;  4W9F A;  2W54 A;  3BYT B;  2M17 A;  2RDH A;  1SE4 A;  5DCN A;  2I38 A;  3BVZ A;  3P4S B;  1NVI D;  4FJV B;  3VHT C;  2C9W B;  3DBR I;  4RCO A;  3I5J C;  1I4X A;  5C1Z A;  4W9D A;  4KGR A;  3R7Q A;  3BY4 B;  5HFY A;  3WAN A;  5IOI A;  3H7S A;  2KX0 A;  1NI3 A;  2MEK A;  4LNN A;  4ZRJ A;  1V49 A;  4MJS A;  1SF0 A;  4BKG A;  1I4Q A;  4XWT A;  2KOX A;  1GPX A;  4NQK E;  3OG5 A;  3AU4 A;  1WMH A;  3VR9 B;  3I9V 1;  2PLP A;  3OAW A;  3R2I A;  2N4F A;  1WJ6 A;  3C0R B;  1FO4 A;  2D11 A;  1QKZ A;  2D10 A;  1F2R I;  1HTQ A;  1TZO A;  3VR8 B;  2DAJ A;  5JHA A;  3N3K B;  3U7Z A;  2V4L A;  4OZC A;  3QIJ A;  5D6J B;  3KYC D;  1WGG A;  1WFY A;  1UNS A;  2V3P A;  4AOF A;  1EO6 A;  4W9I A;  4IKG A;  2K25 A;  4OZB A;  4NJ6 A;  3GE3 C;  1GJZ A;  2KD0 A;  1TGZ B;  3IT4 B;  3ZRF A;  2WU2 B;  1I4G A;  5D94 A;  2NMQ A;  1VRA B;  2KAJ A;  4MM3 B;  1K51 A;  2MBO A;  3KVF B;  1T0Y A;  3DHH C;  3EA6 A;  3RZF A;  3A9J B;  1TYG B;  2O2V A;  1SE9 A;  4FJZ A;  2KFJ A;  2N7D A;  2D07 B;  2H89 B;  1YD8 U;  2KFK B;  3RNF C;  1XEE A;  2ZEQ A;  1WXQ A;  4JE3 B;  1Q0W B;  1V5O A;  4HJK A;  3UI3 A;  3UQB A;  1N62 A;  1MVK A;  1A5R A;  1AWD A;  2DBY A;  1C4C A;  2WXJ A;  3R66 C;  4YTP B;  1J7B A;  2EMS A;  3WAO A;  2E3T A;  4C56 C;  4ITK A;  3CIR B;  1QOF A;  1F52 A;  3AEA B;  3LXF A;  5KHO A;  3RNA C;  3W1S C;  1JML A;  3AMZ A;  2WXI A;  1XLQ A;  4OHJ A;  4C4V A;  2BKR B;  3AN1 A;  1FFU A;  5C23 A;  4P1C C;  4KDL B;  2LVO A;  2IND C;  2WLB A;  3PLU A;  4C80 A;  3MJ5 A;  1D5M C;  3PHW B;  5BYQ A;  3RNG C;  3T3N A;  3BYY B;  4J6I A;  1YQ3 B;  2BGF A;  4GXB A;  2WWZ A;  2NTS A;  3DWM A;  4W9L A;  3ZYY X;  3PRZ A;  1N6Z A;  4BBN F;  1XLP A;  5JH5 C;  1L2N A;  1WZ3 A;  4HEA 1;  1WMH B;  3NVW A;  4DK5 A;  2L1A A;  1ZKH A;  3WAP A;  1ZGU B;  3I63 C;  3WAM A;  3ONS A;  3VRA B;  2TSS A;  3L10 B;  2JYE A;  4DBG A;  3PHX B;  1C1Y B;  2RDG A;  3APC A;  1SEB D;  5CHW A;  3BVM A;  5JHB A;  2KWV B;  5J17 A;  2QJL A;  1X1M A;  3ZNI D;  4ARC A;  2O6V D;  1D3Z A;  3W1S A;  1HXY D;  4II3 B;  2PEA A;  1I4H A;  3H1U A;  4XX5 A;  3RUI B;  2L32 A;  2PTL A;  2AL6 A;  2GBM A;  5CHV C;  3ZW3 A;  3Q8C A;  1TJE A;  2UU7 A;  3R3M A;  1T0S C;  3NVV A;  1ZDV A;  2DZJ A;  4GU2 A;  3ZJT A;  3E9S A;  4LDT B;  4LCD E;  4C7Y A;  3P4P B;  2NCN A;  1WR1 A;  2GBR A;  1TS4 A;  3JW0 X;  3SEB A;  4KKJ A;  3LB8 C;  2PIA A;  2O2V B;  4S17 A;  2DZK A;  1ROE A;  2K8C A;  3B2G A;  3ZDM C;  4W9H A;  2L05 A;  2MH7 A;  2WDT B;  3ZXV A;  4ACF A;  2NPT B;  4RNA A;  2Z0E B;  2Y5B B;  2GI9 A;  4MGI E;  4FHK A;  1QIL A;  3VAW A;  1YJ1 A;  1L0Y B;  2OJR A;  2LGI A;  3DOW A;  2K6Q A;  5LXH A;  3H7P B;  2RR9 A;  2LAS A;  1R4M B;  3ZO5 B;  1UH6 A;  2MBE A;  1CK1 A;  1FRD A;  4O1N A;  3ZNZ B;  5IO9 A;  2ZCB A;  4TKN A;  4K1R B;  1F0Z A;  1YN3 A;  3MC9 A;  5IAA C;  3L13 A;  4W9K A;  1F77 A;  1F2R C;  4OVU A;  5G5G A;  3W2D A;  3SU8 X;  3P1M A;  1J7C A;  1E8W A;  4NJC A;  4LK0 M;  5AZG A;  3RPF C;  2PVO D;  3W5V B;  2BB5 A;  2HD5 B;  3AM9 A;  3DVG X;  2L00 B;  2LD9 A;  1JWB D;  4JGH B;  1WGH A;  2BS2 B;  2ZVO A;  3VVW B;  1TS2 A;  1HTO A;  1P3Q U;  4FLH A;  5DPS A;  2MP2 B;  2L0F A;  3B9J A;  3RN9 C;  2KDI A;  5IKC M;  1V86 A;  1K52 A;  2JUO A;  3VQI A;  1GB1 A;  2C7N B;  5JZE B;  3RD2 A;  4II2 B;  2JRH A;  2LRW A;  4WWM A;  2EMT A;  1IPG A;  3PV1 A;  2FIF A;  4JQW C;  4REZ A;  2JT4 B;  3RI7 C;  3R7R A;  2RD0 A;  3PRP B;  3V61 A;  3IAS 1;  4BOS C;  3ABV B;  1GG3 A;  1UGM A;  1N61 A;  3KWV A;  4F7Z A;  1WGK A;  2NR2 A;  4M8M A;  1HZ6 A;  5DPR A;  1RAX A;  4W9C A;  1LFD A;  1KF6 B;  4ZRI A;  1MG4 A;  1AN8 A;  2J0J A;  1YX6 B;  2KN5 A;  3TCA A;  1STE A;  2HTH A;  4KGT A;  3RNC C;  4DHJ B;  4AQ7 A;  1BUI C;  3NS1 A;  2WP9 B;  2LUM A;  4BFR A;  2PPH A;  2LGD A;  4GSW A;  2KDB A;  5G2N A;  3Q8A A;  1FXT B;  3AE3 B;  2Y3A A;  2GBJ A;  3QCA A;  3X0W A;  1FNW A;  2LHD A;  2O6V B;  4JPS A;  2QC8 A;  3FC4 A;  2ASQ A;  1UBI A;  5TSS A;  1TT5 B;  1KOT A;  4HKQ A;  1MPE A;  2BS4 B;  2DEN B;  4EOY A;  2D5G A;  1E7P B;  1QQR A;  2FCS A;  1Z2M A;  2KQS A;  4M01 A;  4NAW B;  4LNO A;  2BB6 A;  2ZPN A;  1PDX A;  4HDO A;  2K8B A;  1XLN A;  2KJH B;  5TR5 A;  2L76 A;  2ZJD A;  4DDI D;  2DAF A;  3AE7 B;  2HJ8 A;  1ZXI A;  3N1X C;  3QHT A;  2M8S A;  2V4I B;  1GC6 A;  4ANV A;  4KIK A;  1UD7 A;  3P63 A;  3DBR B;  5EE1 A;  1UWX A;  2M1M A;  2CKH B;  2LI5 A;  3K9P B;  1WXS A;  2DYM A;  3WCQ A;  2DYB A;  5IA7 A;  1TY2 A;  2QDF A;  3R2T A;  3AEG B;  1WM2 A;  1BML C;  3AEE B;  1R7S A;  2QEJ C;  1JRU A;  2W3S A;  2IJ0 A;  4PK1 A;  1JW9 D;  1SJE D;  5AZH A;  2GMI C;  2X8X X;  5EDS A;  3PLV A;  2Z59 B;  1IP9 A;  1MHX A;  4RGO S;  2INP E;  5D3I B;  1SJH D;  4M0W A;  1I4P A;  1NYR A;  1WM3 A;  4XDC A;  1KLU D;  1IUE A;  3Q3J A;  3SHQ A;  3AE6 B;  1ACC A;  4M00 A;  2FCQ A;  4XDD A;  4HPL B;  3MTN B;  5EE9 A;  4URK A;  4OVZ A;  1L7Y A;  3FKY A;  4WJP A;  1XO3 A;  3ZTC A;  1GB4 A;  2KAN A;  4K3B A;  1UEL A;  4NJ7 A;  3ZJU A;  2N0S B;  1WJU A;  4MGY E;  3L08 A;  3U7D A;  1I7H A;  3KQ4 A;  4IUM B;  3B2F A;  2CHZ A;  1AAR A;  4YWG G;  1LXD A;  3KUZ A;  3GZN I;  4KVG B;  2KYW A;  2KDM A;  2VH2 A;  4A9A A;  4KSL C;  4MM3 A;  1MFW A;  2V0G A;  3DHG C;  3A9J A;  4FN2 A;  1YQB A;  2N9E B;  1WIA A;  4GOC A;  1TBE A;  2DWQ A;  2KFK A;  4K7U A;  4FA6 A;  4NPN A;  1WJN A;  3ZTD A;  1VCB A;  2ZNV C;  2L8J A;  2ACZ B;  5D2M B;  4ZYS A;  3VXW A;  2KQ7 A;  2MWS B;  1V1O A;  2DX5 B;  3S2A A;  2MBB B;  4FAD A;  4AUQ C;  2GLS A;  2JSV X;  1WGR A;  3IAM 1;  2ZW0 A;  1PQS A;  3WAL A;  2IO3 B;  1T6B X;  1V8C A;  2G3Q B;  2HE7 A;  4A3O A;  2KMA A;  5BMG A;  3QAQ A;  2KC2 A;  4KIK B;  2K8H A;  2AQ2 B;  3I3T B;  2KWC A;  4BOZ B;  2WDV B;  2KVR A;  3N32 A;  5DPW A;  2ZPY A;  2AEH A;  2GOW A;  2LRU A;  5AZF A;  3BK2 A;  3ML9 A;  3N20 C;  4LDT D;  1ZXH A;  2NBV B;  2Y5C A;  4GN1 A;  1ZW7 A;  3VDZ A;  2XBB C;  3V6E B;  2M0A A;  2JXX A;  3AEC B;  4AJW A;  3CMM B;  2M56 B;  4PYZ A;  3VTW A;  2BYT A;  1Z5S B;  1P9D U;  4M0W B;  1FIQ A;  2JRI B;  3HUI A;  1SB3 C;  1RM6 C;  2J0K A;  4FJY A;  1WZ0 A;  2WDR B;  1VDV A;  2KTF A;  4RH6 A;  2M4N A;  5HKH A;  4C00 A;  3MC8 A;  4WAF A;  1T3Q A;  1SE3 A;  4HKZ E;  1P1A A;  2REX A;  1L6V A;  4X57 B;  2G4D B;  1QZE A;  2K39 A;  4F8C B;  2X38 A;  2L7R A;  4AP4 C;  1WF9 A;  1L0X B;  1NDD A;  1E8Z A;  1GUA B;  4ZDV A;  2IDY A;  3BK1 A;  1I35 A;  4IM2 A;  1QOG A;  4MGZ E;  4N6E B;  4HPM B;  1HZ5 A;  2J0M A;  4EUT A;  2MRP A;  1C77 A;  4RMA A;  2MJ3 A;  4WJN A;  2BT6 A;  4KKI A;  3V05 A;  3VTV A;  1HA5 A;  2ON8 A;  4K81 A;  1FPY A;  2QHO A;  2HDE A;  3X23 A;  2KDE B;  4YTN B;  3IVF A;  3T8M A;  3NVY A;  1E10 A;  2NPT A;  3ZJV A;  4CQN A;  3AE8 B;  1TY0 A;  2J7Q B;  2N9L A;  3H8H A;  2D3B A;  2BW2 A;  4MDK E;  3D32 A;  4AJY B;  3TEZ A;  2IY0 B;  1SIJ A;  4BAX A;  2KWU B;  4OVV A;  3H7P A;  1OQY A;  3AE2 B;  3PO0 A;  1JCK B;  1EU4 A;  1SGH A;  4WJO A;  1Q10 A;  3N9Y C;  2WXH A;  4FHJ A;  1G6J A;  2KKC A;  2QIL A;  2IZV B;  2KVZ A;  1KM7 A;  2AWT A;  1CZP A;  1YQ4 B;  4TQ1 A;  1WSP A;  3RYT A;  3DWG C;  1JRP A;  3HIZ A;  4XZ4 A;  1Y8R C;  2WXO A;  2DHZ A;  4CHK A;  2MCN B;  4IM3 A;  1NEK B;  5FR6 A;  1YMH E;  1DOX A;  1KFY B;  4P6V F;  4IWQ A;  3I57 A;  1OEY A;  2K1F A;  1DYQ A;  4TSS A;  3N1Z C;  2WXK A;  4YL8 A;  1JWU D;  2HTM E;  2WS3 B;  3AE4 B;  1N5X A;  4K7S A;  4OW0 A;  2I2Y A;  4YSZ B;  5E6J A;  2ZNV B;  1E9M A;  3VUX A;  3KH0 A;  2MP2 A;  4DHJ D;  3KLS X;  2NBU A;  3T9L A;  3TSS A;  3NY5 A;  2KZR A;  2K6D B;  1C79 A;  4BKT A;  1C4P A;  1VD2 A;  2KTR B;  1ET9 A;  2INN E;  4KDI C;  3A33 B;  4A6Q A;  4WWP A;  1JQ4 A;  2CHX A;  3SR6 A;  2MSE D;  1B1Z A;  4HCP B;  2JF5 A;  3UF8 A;  2DLB A;  3W9C B;  3V6C B;  3DBL I;  1N5W A;  1K8R B;  5FR3 A;  2C5L C;  2KNB A;  2KLG A;  2EKE C;  4EEW A;  3CWI A;  2PE9 A;  4IOI E;  1L6U A;  3Q8E A;  2NVU I;  4USA A;  3V3X A;  3TL5 A;  1YX5 B;  2ZCC A;  4NZL B;  4OZA A;  1VZ6 A;  1XXG A;  3L54 A;  1OQR A;  5E6O A;  1YIW A;  1MG8 A;  1P7F A;  2L83 A;  1L4Z B;  1E90 A;  3TMP B;  3B1L X;  2Z0D B;  2J4X A;  4LJP B;  3CST A;  2O6V A;  4LLG M;  2OOB B;  1JWA D;  3RNE C;  2KQ4 X;  4HVB A;  3FAH A;  2C7M B;  1LO5 D;  1C76 A;  3NZS A;  1T0Q C;  2VRR B;  1FRR A;  2C7H A;  2N7E A;  1YJI A;  4NAW A;  1CMX B;  1V80 A;  5T8I A;  1ZP0 B;  4EE2 A;  1D4B A;  1ZDX A;  3DBH I;  3OJ3 A;  1J19 A;  4R3D A;  3C8Y A;  4GLS C;  4XGA B;  4BVU C;  4JX1 C;  3ENE A;  2JWZ A;  1WE6 A;  2RPQ A;  4WH4 A;  3KWL A;  4K3C A;  4ZRQ A;  5IP4 D;  3V60 A;  2UWQ A;  1KTK A;  3SD5 A;  1H8C A;  3MFG A;  3GE8 C;  2M0X A;  4KZC A;  1IGC A;  5G5H A;  1QT9 A;  4BZA A;  1GNU A;  4RF0 A;  2LJI A;  3WA0 A;  3IG3 A;  3DVN U;  3EFC A;  2GBN A;  4MEM A;  3AE5 B;  2JX5 A;  1RFK A;  2B3A A;  2KK8 A;  3HHM A;  1NI2 A;  4ZYN A;  3QA8 A;  3W5U B;  2JWU A;  2G45 B;  3MHZ A;  1WJ4 A;  4PYU A;  2VH1 A;  1DOY A;  1TKG A;  4J3O D;  1JRO A;  2CU1 A;  1IYF A;  2BYV E;  1C78 A;  4ANU A;  4DDG D;  2BTE A;  2WXG A;  2BVC A;  2PJH A;  1Q5W B;  2GB1 A;  3UIO B;  2LGY A;  2WXR A;  1UF0 A;  1ZE3 D;  4LNK A;  3BII D;  2W55 A;  3GZN B;  3PT2 B;  1D5X C;  2CU3 A;  3A4R A;  3U2S C;  4IWO A;  2R61 A;  5JXV A;  2OHF A;  2IYD B;  5BO4 B;  1P0R A;  4PS3 A;  5EE0 A;  5HG2 A;  4B0M A;  3NZ3 A;  4YSX B;  2PE6 B;  1EWC A;  3ZRC A;  3IHP C;  4BKS D;  5AUK A;  5H92 C;  1E5W A;  5C2T B;  2RMM A;  3A4S C;  1ESF A;  2ZW1 A;  4XE0 A;  2J42 A;  1LM8 B;  2YVC A;  2SEB D;  1ZOY B;  1PFD A;  3AV8 A;  1XLO A;  3APF A;  2RDB C;  3KUD B;  4NNJ B;  3PVL A;  4DXA B;  3PS6 A;  4US9 A;  2LUE A;  4EKU A;  4PS7 A;  3U30 A;  3O65 B;  3VUY A;  2D3C A;  2AQ3 B;  2KLC A;  1WI0 A;  1WX7 A;  1FEH A;  1IBX B;  2IBI B;  5BMI A;  3LYY A;  1V2Y A;  2D2Q A;  4N59 A;  2OED A;  1H4R A;  1HQR D;  1P98 A;  2I1K A;  1KLG D;  1J8C A;  2N1V A;  3HM3 A;  3P42 A;  4WQO B;  1BT0 A;  1WY8 A;  3IBE A;  3J9C A;  4BKS A;  1WGY A;  1VLB A;  1WXA A;  2RPV A;  2WGS A;  4TUU A;  2W3R A;  2IO1 B;  2K0P A;  2V1Y A;  2LXA A;  2L0T A;  3B08 A;  3NS8 A;  4GIV A;  2WXQ A;  4ZRP A;  4KX6 B;  2BYE A;  4IWP A;  2NTT A;  4PT5 A;  2PKO A;  1D6E C;  5I4D A;  2K5P A;  3TJP A;  2LJ5 A;  3U8Z A;  4JWU C;  4YXD B;  3UGB B;  1LGR A;  1WR6 E;  2CS4 A;  4B95 A;  4WUR A;  3APD A;  1SXT A;  3B0A A;  4HWI B;  4MH0 E;  2IPK D;  1ZPS A;  2KMM A;  4HDQ A;  2JY6 A;  1WWT A;  2LGX A;  4WWO A;  1V1P B;  2GBK A;  1TKY A;  2J52 A;  3GB1 A;  4N58 A;  4DQO C;  2BQQ A;  2ONQ A;  2N9P C;  4JLC A;  2M19 A;  2BBC A;  1NEN B;  4I6L B;  3ZVV A;  2FNJ B;  3EGR A;  1EWY C;  3ZDT A;  1WRI A;  3TEY A;  3IXS A;  1FCC C;  4KV2 A;  2WX0 A;  1RYJ A;  2DYO A;  4HK2 A;  4E3C A;  3RNB C;  4IC7 B;  4P16 A;  3PTF C;  2ZVN A;  4L1B A;  1F1H A;  2J53 A;  3IT6 B;  2LVQ A;  3U52 E;  3RFZ B;  2FUH B;  4MGK E;  3KW5 B;  2KN4 A;  4ASW C;  4LNI A;  3DQV A;  3V62 A;  4YT0 B;  3A9K B;  2FBW B;  4B0E A;  2DZI A;  1KRH A;  3FIL B;  2B76 B;  3AED B;  3JSV B;  2K9X A;  2YEP F;  1PGX A;  3ZLZ A;  2C60 A;  5J18 A;  2A5U A;  2IGH A;  4MEL A;  1WYG A;  3H6N A;  2FUG 1;  2LWP A;  5H8Y E;  1QLB B;  2BF8 B;  3PPA A;  3ALB A;  1NBF C;  1FXI A;  3DDC B;  5E6N A;  3CF6 E;  3QX1 A;  2BS3 B;  2W9N A;  4MSM B;  1DGJ A;  1CJE A;  3L17 A;  2EKI A;  2WX1 A;  2MLB A;  1OGW A;  2WXM A;  2JXT A;  1AW7 A;  2N1W A;  3VFK A;  4GGQ A;  2NBW B;  3AE9 B;  3N1Y C;  2BPS A;  5AEK B;  1RLF A;  2KAC A;  2NS5 A;  3P4Q B;  1ISN A;  3KYD D;  5KHQ A;  3MC0 B;  1PGB A;  2G4S A;  1HEZ E;  3A1Q B;  4GDL B;  2QIE B;  1B9R A;  5AUI A;  2JU6 X;  3DBS A;  1FCL A;  2KTR A;  4HPP A;  4DHZ B;  3E56 A;  2PMV A;  3RMK C;  4ANW A;  4D2K A;  3Q69 A;  1S1Q B;  3L16 A;  1ENF A;  3VH3 B;  1GC7 A;  3AEB B;  3VTU A;  3VRB B;  2FID A;  4DWF A;  2SAK A;  3URY A;  3LDZ E;  3DBL B;  1SIF A;  3ZIM A;  3T3O A;  1I42 A;  4MT5 A;  2KXJ A;  1FMA D;  2EEL A;  1UZX B;  3HM6 X;  1EUV B;  3TIX A;  2G9H D;  2ZZP B;  4W9E A;  2N9X A;  2WYQ A;  4MAC A;  1GOZ A;  4XWW A;  5CTR C;  4DHZ E;  1YJJ A;  2Z8L A;  5MPO A;  4WWN A;  4WIP A;  5CX3 A;  4I6N B;  4ZRK A;  2V3N A;  4W9G A;  3ZKJ C;  2LFI A;  4FBJ B;  2XK5 B;  3C19 A;  1ET6 A;  3R8B A;  2MJD A;  3UIP B;  1R4N I;  3M63 B;  4KZ0 A;  4RGM A;  3SFD B;  1HE8 A;  3HVD A;  3K9O B;  4E74 A;  3ZUN A;  4CYE A;  2MA9 B;  1VR9 A;  2FCM A;  1U4A A;  4P1B C;  1TZ1 A;  4G0N B;  3MJW A;  4GDK B;  2CR5 A;  5D3D A;  1Y56 A;  4ARI A;  1JWM D;  2IY1 B;  1V9J A;  5D7G A;  2JZ3 B;  1FFV A;  4E71 A;  4A3P A;  1SBB B;  3Q3F A;  2VZK D;  3TEX A;  3PZD A;  2D3G A;  3ETR A;  3AU5 A;  1QOA A;  3DBH B;  4XC2 A;  1XCT L;  3SDL C;  1PUT A;  3NOB A;  3RZW C;  5FK9 C;  2YLM A;  2FE8 A;  2DZM A;  4S0R A;  1SSN A;  4KGS A;  4MSQ B;  2AL3 A;  3TUO A;  1RRB A;  3EFU A;  2R2O A;  1XF5 L;  3AXC A;  4DXF A;  2FCN A;  3JYU A;  2WXL A;  3OJ4 B;  2BKF A;  2XN9 C;  1E7V A;  2Y5P A;  1OFF A;  2K22 A;  5CHF A;  4MJS B;  2WXP A;  4H2A A;  1VJK A;  1K50 A;  5IN7 A;  5EE3 A;  1WYW B;  3OWE B;  3M95 A;  1EF5 A;  1LQB A;  2JPH A;  4RGN A;  4W9J A;  3PRE A;  4HRO A;  1XD3 B;  3ZXR A;  3AH7 A;  2JVC A;  5BYR A;  4N9F 4;  2PW9 A;  3N30 A;  5DPT A;  3EHV A;  3CSF A;  2XNA C;  1MJD A;  2MBQ A;  2MJE A;  2RGF A;  5GXG B;  2MQJ A;  4IM0 A;  4RM9 A;  4PS8 A;  2LEK A;  3RT3 B;  1YN5 A;  4JWS C;  5J2R A;  3GOE A;  3QJZ A;  1IGD A;  4HXD A;  4A55 A;  2KJ6 A;  2I1J A;  1V6E A;  4NAM A;  3QQ8 B;  2R2Q A;  3AEF B;  2BYF A;  2IGG A;  3DPD A;  3VH4 B;  3QC8 B;  5FKA C;  4WAA A;  4C7Z A;  3MHS D;  3AE1 B;  1WGD A;  1WX8 A;  2N7J A;  1KLV A;  1TIF A;  2G1E A;  4G50 A;  3PRM B;  5LLI A;  2KT7 A;  5LNK 1;  5BMH A;  4FXC A;  4A20 A;  3DCG A;  1J7A A;  3DHI C;  4ZOH C;  1NYQ A;  3GS2 A;  4MH8 A;  1I4R A;  4FUL A;  3HK0 A;  1YOV B;  4ZHP A;  4JL9 A;  1EU3 A;  3PGE A;  4HCN B;  2LMC A;  5G55 A;  1L4D B;  4ZHO A;  3AB5 A;  4IW0 A;  4RM8 A;  4B6W A;  1GAQ B;  2LHE A;  4NY0 A;  3BVG A;  3VUW A;  2WQY B;  3M3J A;  3OLM D;  1XQQ A;  2CJN A;  4HRS A;  4C4V B;  1IBX A;  4UDU C;  1UBQ A;  2AQ1 B;  4RGT A;  1J0G A;  3PZ8 A;  3O13 A;  4WJQ A;  2INC C;  4I6P A;  1UWM A;  4L23 A;  3RUL A;  1M4V A;  1RWS A;  2MHJ A;  2KWD A;  4G3X B;  4HLE A;  3AUL A;  1OTR B;  2LGS A;  4QAY A;  2KX3 A;  2LZ6 A;  3PZ7 A;  1MHH E;  4CO7 A;  3NZU A;  2KHW B;  1WH3 A;  4IDI A;  2KDF B;  3NRZ A;  2VZK B;  2WXN A;  4EZJ A;  2IO2 B;  1FXA A;  2MW5 A;  4AWJ A;  2RSU A;  1S3S G;  1A70 A;  4EFO A;  3BIN A;  1E8X A;  4TV3 A;  2HJ1 A;  3WIM A;  1V1P A;  3H9D A;  1WXV A;  4AS1 A;  1SE2 A;  2FAZ A;  3UQA A;  3Q3M C;  1Q1O A;  1EF1 A;  2L3Z A;  2MBH A;  4B9K A;  1TKE A;  2UYZ B;  2IGD A;  3ML8 A;  3QK0 A;  3HVZ A;  1BXT A;  2AX5 A;  3NVZ A;  2IO0 B;  4RFB A;  2OJW A;  2XEW A;  3Q3N C;  1WE7 A;  2QMT A;  3KUC B;  4IG7 B;  2A4Z A;  1L5P A;  2Q5W D;  1EM7 A;  3UIN B;  4KSK C;  5E6P A;  1C3T A;  1L0V B;  3SFE B;  1XCQ L;  1WX9 A;  3Q14 C;  4TQ0 A;  1YN4 A;  3L0W B;  3Q8F A;  3NJT A;  1XT9 B;  4EZK A;  1DOI A;  4ICU A;  3A9K A;  1R4M I;  4US8 A;  1PGA A;  1ZUD 2;  3FIL A;  1FNU A;  3JSV A;  1TS3 A;  1D5Z C;  1JWS D;  3HRD D;  3EC8 A;  1M94 A;  4GMV A;  4Q2J A;  2AYO B;  1P7E A;  4EZL A;  3AI5 A;  1T0R C;  3DVN V;  4LTU A;  3ZGZ A;  2JQR B;  3L4P A;  3W1Y A;  1TS5 A;  2CHW A;  1VZ7 A;  1C9F A;  2KJR A;  1PYW D;  3ZQ4 A;  2N9K A;  2WDQ B;  5LXI B;  4YSY B;  3TEW A;  1KJT A;  2LXC A;  4HJG E;  2JZZ A;  4A90 A;  1V81 A;  3EUB 2;  1JAL A;  3QAR A;  1V5T A;  3ZNH B;  5L95 C;  3Q2A C;  2D3A A;  2KMC A;  3RCZ A;  3M62 B;  2W82 A;  4A8X C;  3JVZ X;  1FD6 A;  3A1Q A;  1TTN A;  1FNV A;  4GDL A;  2GRI A;  1V97 A;  2WU5 B;  4ANX A;  1E0Z A;  3Q3O C;  4LNF A;  4WQM A;  3IFW B;  4YTM B;  3ECI A;  1MI0 A;  4P7I A;  3U4E G;  1UGJ A;  4L2Y A;  3BWU D;  4LJO B;  1UUP A;  2V9H A;  1N63 A;  2ICI A;  4M8N A;  4JIO U;  4M02 A;  1C4A A;  2DNF A;  1OQQ A;  2K3U A;  3P4R B;  3MP9 A;  1K53 A;  3PSE B;  5C3J B;  1E6E B;  1T5X D;  2LVP A;  2QCZ A;  2PVG C;  2KC1 A;  4RF1 A;  1OEY J;  2L52 A;  3NHE B;  5HHD G;  3TBL D;  3P2B A;  1WRD B;  4ICV A;  3NUH B;  3DVG Y;  5HI1 A;  4BBN C;  2BWF A;  2MX2 A;  1CQV A;  3QWZ B;  2YEP B;  1VZ8 A;  2KO3 A;  2V3S A;  5L83 A;  3NG0 A;  1KH0 A;  2WNM A;  2H88 B;  1RFA A;  3EEC A;  1YNT E;  1QOB A;  4G11 A;  2JYT A;  4XYC A;  2E6X A;  1E7U A;  3Q8B A;  2XK5 A;  1F9J A;  4DXG A;  2BWE S;  3GP7 A;  5GMV A; 
#chains in the Genus database with same CATH homology
 1R4N I;  4LJP B;  3X0W A;  4NQL B;  3CST A;  3M63 B;  4KZ0 A;  2O6V A;  2O6V B;  2OOB B;  1HE8 A;  4HVB A;  3K9O B;  4E74 A;  3ZUN A;  2ASQ A;  2C7M B;  4CYE A;  2MA9 B;  2FCM A;  1UBI A;  3ZNG C;  4F1S A;  1U4A A;  4GB9 A;  1TZ1 A;  3NZS A;  1KOT A;  4G0N B;  3MJW A;  2DEN B;  1WXM A;  4GDK A;  4GDK B;  2CR5 A;  4K7W A;  2VRR B;  4EOY A;  2C7H A;  2IY1 B;  1E8Y A;  2N7E A;  2FCS A;  1Z2M A;  2KQS A;  3LJ3 A;  1V9J A;  4NAW A;  4NAW B;  5D7G A;  1CMX B;  2JZ3 B;  1V80 A;  2ZPN A;  4A3P A;  4HDO A;  4E71 A;  2K8B A;  3Q3F A;  4W9F A;  2KJH B;  5TR5 A;  2L76 A;  2M17 A;  2ZJD A;  3PZD A;  2D3G A;  4DDI D;  2DAF A;  3AU5 A;  5DCN A;  3DBH I;  2HJ8 A;  3OJ3 A;  1J19 A;  4XC2 A;  3SDL C;  3NOB A;  2M8S A;  3QHT A;  3RZW C;  1GC6 A;  2YLM A;  4FJV B;  4KIK A;  4ANV A;  3VHT C;  4BVU C;  1UD7 A;  2C9W B;  2DZM A;  3DBR I;  3ENE A;  2JWZ A;  4MSQ B;  2AL3 A;  2M1M A;  2CKH B;  2LI5 A;  1WE6 A;  5C1Z A;  3K9P B;  1WXS A;  2RPQ A;  2DYM A;  4W9D A;  2DYB A;  5IA7 A;  3R7Q A;  3BY4 B;  1RRB A;  1WM2 A;  3EFU A;  2UWQ A;  2R2O A;  3V60 A;  3SD5 A;  3AXC A;  1JRU A;  1H8C A;  3WAN A;  3H7S A;  2FCN A;  3JYU A;  3OJ4 B;  5AZH A;  2GMI C;  2KX0 A;  2BKF A;  5EDS A;  2M0X A;  1E7V A;  3PLV A;  4KZC A;  2Z59 B;  5CHF A;  4ZRJ A;  1IP9 A;  1V49 A;  4MJS A;  4MJS B;  1GNU A;  4BKG A;  2KOX A;  4NQK E;  3AU4 A;  1WMH A;  3B1L X;  3WA0 A;  3IG3 A;  3OAW A;  3DVN U;  2N4F A;  1WYW B;  1WM3 A;  2GBN A;  3M95 A;  1EF5 A;  1WJ6 A;  4MEM A;  1LQB A;  2B3A A;  2JPH A;  2KK8 A;  3C0R B;  2D11 A;  3Q3J A;  4W9J A;  3HHM A;  3SHQ A;  3PRE A;  1NI2 A;  2D10 A;  1XD3 B;  4ZYN A;  2FCQ A;  2JVC A;  3QA8 A;  3MTN B;  4HPL B;  4URK A;  4N9F 4;  2DAJ A;  5JHA A;  3N3K B;  3N30 A;  1L7Y A;  2G45 B;  2V4L A;  5DPT A;  3QIJ A;  1WJ4 A;  4WJP A;  5D6J B;  3EHV A;  3CSF A;  3KYC D;  4PYU A;  3ZTC A;  2MBQ A;  2KAN A;  1UEL A;  2RGF A;  1WGG A;  4NJ7 A;  2MQJ A;  1WFY A;  2CU1 A;  1IYF A;  4IM0 A;  2BYV E;  4RM9 A;  4PS8 A;  4ANU A;  1WJU A;  3RT3 B;  4DDG D;  4AOF A;  4MGY E;  3L08 A;  1EO6 A;  4W9I A;  5J2R A;  3U7D A;  3GOE A;  3QJZ A;  4HXD A;  2K25 A;  4IUM B;  2PJH A;  1Q5W B;  4NJ6 A;  2KJ6 A;  2I1J A;  2LGY A;  3UIO B;  1GJZ A;  2KD0 A;  1V6E A;  2CHZ A;  1AAR A;  1TGZ B;  1LXD A;  3KUZ A;  3GZN I;  2R2Q A;  3QQ8 B;  4KVG B;  3ZRF A;  2BYF A;  3DPD A;  3VH4 B;  5D94 A;  4KSL C;  4MM3 A;  3PT2 B;  3QC8 B;  3A4R A;  4WAA A;  4IWO A;  3MHS D;  2IYD B;  2MBO A;  5BO4 B;  3KVF B;  1T0Y A;  1WGD A;  3RZF A;  1P0R A;  3A9J A;  3A9J B;  4PS3 A;  4FN2 A;  1YQB A;  2N9E B;  1WX8 A;  1KLV A;  2O2V A;  1SE9 A;  4FJZ A;  1WIA A;  2KFJ A;  2N7D A;  2D07 B;  4G50 A;  2PE6 B;  4GOC A;  3ZRC A;  1YD8 U;  1TBE A;  3IHP C;  3PRM B;  2KFK A;  2KFK B;  4K7U A;  4BKS D;  4FA6 A;  5LLI A;  4NPN A;  1E5W A;  1WJN A;  3ZTD A;  1VCB A;  2ZNV C;  3A4S C;  2ZEQ A;  2L8J A;  5D2M B;  3VXW A;  2KQ7 A;  2MWS B;  2DX5 B;  3S2A A;  2MBB B;  1LM8 B;  1Q0W B;  2YVC A;  4A20 A;  3DCG A;  4AUQ C;  4FAD A;  1V5O A;  4HJK A;  3UQB A;  1WGR A;  1A5R A;  3APF A;  3KUD B;  4FUL A;  3HK0 A;  3R66 C;  4NNJ B;  1PQS A;  2EMS A;  3WAO A;  3WAL A;  4JL9 A;  3PVL A;  4DXA B;  3PS6 A;  2IO3 B;  2LUE A;  3PGE A;  2G3Q B;  2HE7 A;  4EKU A;  4A3O A;  2KMA A;  4HCN B;  5KHO A;  3W1S C;  4PS7 A;  5G55 A;  3U30 A;  3O65 B;  3VUY A;  3QAQ A;  2KC2 A;  4IW0 A;  2K8H A;  4KIK B;  4RM8 A;  4B6W A;  3VUW A;  2KLC A;  3I3T B;  4NY0 A;  1WI0 A;  2KWC A;  1WX7 A;  3M3J A;  2BKR B;  1XQQ A;  3OLM D;  4BOZ B;  2KVR A;  1UBQ A;  3N32 A;  2IBI B;  5C23 A;  5DPW A;  2ZPY A;  1J0G A;  2AEH A;  4KDL B;  2GOW A;  2LRU A;  1V2Y A;  2D2Q A;  2LVO A;  1H4R A;  1P98 A;  2I1K A;  3PLU A;  1J8C A;  5AZF A;  4WJQ A;  3ML9 A;  2N1V A;  3PHW B;  4I6P A;  3RUL A;  3HM3 A;  4WQO B;  4LDT D;  1BT0 A;  1WY8 A;  4J6I A;  2NBV B;  3IBE A;  2BGF A;  4GN1 A;  4GXB A;  2WWZ A;  1ZW7 A;  1WGY A;  4G3X B;  1WXA A;  4BKS A;  4HLE A;  3VDZ A;  2XBB C;  4TUU A;  4W9L A;  3PRZ A;  3V6E B;  2IO1 B;  2V1Y A;  4BBN F;  2LXA A;  3AUL A;  5JH5 C;  2JXX A;  2L0T A;  1WZ3 A;  1L2N A;  4AJW A;  1WMH B;  1OTR B;  3B08 A;  3CMM B;  4PYZ A;  3NS8 A;  3VTW A;  4GIV A;  1Z5S B;  1P9D U;  4M0W B;  4DK5 A;  2KX3 A;  2JRI B;  2LZ6 A;  2BYE A;  1ZKH A;  4IWP A;  4FJY A;  2J0K A;  3WAP A;  1WZ0 A;  4CO7 A;  3NZU A;  1ZGU B;  3TJP A;  2LJ5 A;  3WAM A;  3ONS A;  2KHW B;  2KTF A;  3L10 B;  3U8Z A;  1WH3 A;  4DBG A;  3UGB B;  1WR6 E;  2KDF B;  2CS4 A;  1C1Y B;  3PHX B;  4B95 A;  2M4N A;  5HKH A;  3APC A;  5JHB A;  5CHW A;  3APD A;  4EZJ A;  2IO2 B;  3B0A A;  2KWV B;  1P1A A;  5J17 A;  4HWI B;  2MW5 A;  4MH0 E;  1X1M A;  2RSU A;  2REX A;  4AWJ A;  3ZNI D;  1S3S G;  4EFO A;  4X57 B;  2O6V D;  1D3Z A;  2G4D B;  1QZE A;  2K39 A;  3BIN A;  3W1S A;  4F8C B;  1E8X A;  4TV3 A;  4II3 B;  4HDQ A;  2PEA A;  2JY6 A;  2L7R A;  3WIM A;  4AP4 C;  1WF9 A;  3H1U A;  4XX5 A;  3RUI B;  1NDD A;  1E8Z A;  1GUA B;  2LGX A;  4WWO A;  4ZDV A;  2AL6 A;  1WXV A;  3H9D A;  2GBM A;  5CHV C;  2GBK A;  3ZW3 A;  2FAZ A;  1I35 A;  3UQA A;  4IM2 A;  3R3M A;  1Q1O A;  4MGZ E;  4HPM B;  1EF1 A;  2DZJ A;  2L3Z A;  2MBH A;  4GU2 A;  2J0M A;  4B9K A;  2UYZ B;  4LDT B;  4EUT A;  3ML8 A;  4LCD E;  2MRP A;  4RMA A;  2NCN A;  3QK0 A;  1WR1 A;  4WJN A;  2IO0 B;  2N9P C;  2GBR A;  4JLC A;  3VTV A;  4K81 A;  3JW0 X;  2QHO A;  4I6L B;  2XEW A;  2FNJ B;  3ZVV A;  3ZDT A;  4KV2 A;  1WE7 A;  3X23 A;  2O2V B;  2KDE B;  2WX0 A;  3KUC B;  4IG7 B;  2A4Z A;  2DZK A;  2K8C A;  3IVF A;  3T8M A;  3ZDM C;  4W9H A;  2L05 A;  2DYO A;  3UIN B;  4HK2 A;  2WDT B;  4E3C A;  2NPT A;  2NPT B;  2Z0E B;  2Y5B B;  4KSK C;  5E6P A;  4IC7 B;  1C3T A;  2J7Q B;  3PTF C;  2ZVN A;  1WX9 A;  4MDK E;  3D32 A;  4MGI E;  4FHK A;  4AJY B;  2LVQ A;  2IY0 B;  2FUH B;  3VAW A;  4MGK E;  1YJ1 A;  4TQ0 A;  2OJR A;  3KW5 B;  3L0W B;  1XT9 B;  2KWU B;  3DOW A;  4ASW C;  4EZK A;  4OVV A;  2K6Q A;  3DQV A;  3V62 A;  5LXH A;  3H7P A;  1OQY A;  3H7P B;  4ICU A;  3A9K A;  3A9K B;  1R4M I;  1SGH A;  2DZI A;  2RR9 A;  4WJO A;  2LAS A;  3ZO5 B;  1UH6 A;  3JSV A;  3JSV B;  2MBE A;  4FHJ A;  1G6J A;  2KKC A;  3ZNZ B;  2IZV B;  3ZLZ A;  1KM7 A;  2C60 A;  2AWT A;  5J18 A;  2A5U A;  2ZCB A;  3EC8 A;  4TKN A;  1M94 A;  4MEL A;  4K1R B;  4GMV A;  3H6N A;  2LWP A;  4TQ1 A;  2AYO B;  4EZL A;  3AI5 A;  5IAA C;  3RYT A;  2BF8 B;  3HIZ A;  3L13 A;  3PPA A;  4W9K A;  3ALB A;  4XZ4 A;  3DVN V;  1Y8R C;  1NBF C;  2DHZ A;  3DDC B;  4OVU A;  5E6N A;  3SU8 X;  4CHK A;  2MCN B;  3CF6 E;  3QX1 A;  4IM3 A;  3W1Y A;  1E8W A;  5FR6 A;  2W9N A;  4MSM B;  2CHW A;  4IWQ A;  1OEY A;  2KJR A;  3L17 A;  5AZG A;  2K1F A;  2WX1 A;  5LXI B;  2MLB A;  1OGW A;  1KJT A;  2LXC A;  2JZZ A;  2HD5 B;  2N1W A;  3DVG X;  2L00 B;  3VFK A;  4GGQ A;  4YL8 A;  1V81 A;  3QAR A;  2NBW B;  2BPS A;  2LD9 A;  5AEK B;  4K7S A;  1RLF A;  4JGH B;  1WGH A;  2NS5 A;  1V5T A;  3ZNH B;  1ISN A;  2ZNV B;  5L95 C;  3VUX A;  2ZVO A;  2KMC A;  3KYD D;  3M62 B;  3RCZ A;  5KHQ A;  3VVW B;  2G4S A;  3KH0 A;  1P3Q U;  3JVZ X;  4FLH A;  5DPS A;  2MP2 A;  2MP2 B;  3A1Q A;  3A1Q B;  1TTN A;  4DHJ D;  2NBU A;  3T9L A;  4GDL A;  4GDL B;  3NY5 A;  4ANX A;  2L0F A;  2KZR A;  2K6D B;  2KDI A;  4BKT A;  3DBS A;  1VD2 A;  3IFW B;  1V86 A;  3ECI A;  2JUO A;  3VQI A;  2KTR A;  2KTR B;  4P7I A;  2C7N B;  4KDI C;  4DHZ B;  4ANW A;  4LJO B;  1S1Q B;  5JZE B;  3L16 A;  3RD2 A;  3VH3 B;  4II2 B;  2JRH A;  2LRW A;  3A33 B;  4M8N A;  4WWP A;  1GC7 A;  2CHX A;  2EMT A;  3VTU A;  1IPG A;  4JIO U;  3PV1 A;  2FIF A;  4JQW C;  2JT4 B;  2FID A;  4DWF A;  3R7R A;  2MSE D;  2RD0 A;  3PRP B;  4HCP B;  2JF5 A;  3UF8 A;  3V61 A;  4BOS C;  3PSE B;  3V6C B;  3DBL I;  3LDZ E;  1GG3 A;  1K8R B;  1UGM A;  2C5L C;  1SIF A;  2KLG A;  2KNB A;  2LVP A;  3ZIM A;  2KC1 A;  2EKE C;  1I42 A;  4EEW A;  2KXJ A;  4F7Z A;  1UZX B;  1OEY J;  3HM6 X;  2NR2 A;  2PE9 A;  4M8M A;  1EUV B;  3NHE B;  3TBL D;  3TIX A;  5DPR A;  3P2B A;  2NVU I;  1WRD B;  4ICV A;  3DVG Y;  1RAX A;  4BBN C;  2BWF A;  2MX2 A;  2ZZP B;  3TL5 A;  1YX5 B;  3QWZ B;  4W9E A;  1LFD A;  2N9X A;  2ZCC A;  2WYQ A;  4W9C A;  4ZRI A;  2KO3 A;  2V3S A;  5CTR C;  2J0J A;  1YX6 B;  2KN5 A;  3TCA A;  5L83 A;  4DHZ E;  2HTH A;  4WWN A;  4DHJ B;  1RFA A;  3EEC A;  5CX3 A;  4I6N B;  4G11 A;  4ZRK A;  4W9G A;  3ZKJ C;  4BFR A;  3L54 A;  1E7U A;  2PPH A;  2LGD A;  4FBJ B;  2XK5 A;  1F9J A;  2XK5 B;  4GSW A;  2KDB A;  5G2N A;  5E6O A;  1FXT B;  1YIW A;  1MG8 A;  2BWE S;  1E90 A;  3TMP B;  3UIP B;  2Z0D B;  2GBJ A;  3QCA A;  5GMV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...