1WZ0A

Solution structure of human sumo-2 (smt3b), a ubiquitin-like protein
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
104
structure length
104
Chain Sequence
GSSGSSGMADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin-like protein SMT3B
publication title Solution Structure of Human SUMO-2 (SMT3B), a Ubiquitin-like Protein
rcsb
source organism Homo sapiens
molecule tags Structural genomics, unknown function
total genus 12
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2005-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1wz0A01
2KX0A 2C60A 1J8CA 1WM2A 4P7IA 4HCPB 1P3QU 2UYZB 1LQBA 4JGHB 4IW0A 5BO4B 2DZIA 2DHZA 3O65B 3QQ8B 4HPMB 3R7QA 3ZIMA 2MX2A 2ZCCA 2KDIA 2WX1A 5D7GA 3QJZA 4KZCA 2DAJA 2EKEC 4BBNC 3EC8A 4I6LB 3A9JB 4AOFA 4W9GA 1V5TA 2JY6A 2BWES 4K81A 3B08A 2K6DB 2LWPA 2I1JA 4A3OA 2MBBB 1KJTA 1WXMA 4HDOA 3AULA 3V61A 5HKHA 2LRUA 1WX7A 2RSUA 4BFRA 3RUIB 1V9JA 5DPTA 2Y5BB 4ZRKA 3A9KA 1FXTB 3RT3B 2AEHA 3VVWB 3R3MA 1ZW7A 4GDKB 1WE6A 3DBHI 4MGKE 3DVGX 4NJ6A 1I42A 4KDLB 2ZNVB 1YQBA 4TKNA 4B95A 4B9KA 4HJKA 1T0YA 2K8BA 4KV2A 2K39A 1HE8A 3U30A 4PYZA 2B3AA 5LLIA 3SHQA 2JRHA 5DCNA 5JZEB 3JSVB 2MBEA 3IBEA 2M8SA 3TL5A 1NBFC 4NAWB 1WXVA 3H7PB 1LM8B 3KUZA 3PVLA 3VUXA 4AJYB 1OTRB 1V6EA 3ZNID 3VXWA 2LD9A 3UGBB 4HCNB 4B6WA 2KQSA 4W9EA 1CMXB 1OEYJ 5CX3A 3ZNGC 4K7WA 2RR9A 1H4RA 2KJRA 3SDLC 2REXA 4W9DA 5D6JB 2LJ5A 3QIJA 1E90A 3DBLI 1S3SG 4GDKA 1P1AA 2GBNA 5C23A 3DDCB 5CTRC 3VTWA 2CKHB 3ZNHB 4ANUA 4ANVA 3GOEA 4DHZE 1E8YA 1WX8A 2MRPA 1E7UA 1TZ1A 2KWVB 2N9XA 3RD2A 1S1QB 3K9PB 2KDEB 3KYCD 4LJOB 1UELA 4EZKA 3M63B 4AUQC 4ZYNA 2CU1A 2NBWB 4IWQA 4KIKB 4FJYA 3UF8A 2VRRB 4HWIB 2C7MB 2CR5A 4W9KA 3WAOA 3KUDB 3QCAA 1SIFA 1C3TA 3UQAA 2KNBA 2KANA 3KVFB 3PGEA 4EFOA 4DDID 3DBSA 2ASQA 1WRDB 3ZVVA 3L08A 1IYFA 2Z0EB 4I6PA 3EFUA 3WAMA 4NQKE 1IPGA 2GMIC 1SGHA 4II3B 3LDZE 3NHEB 4WQOB 3AXCA 3ZUNA 2K8HA 4TQ1A 2MW5A 4ZRIA 3RULA 3PLUA 4E74A 2IZVB 3NZUA 3DOWA 1PQSA 2FCMA 4RMAA 3MJWA 3IHPC 2FCNA 1WGDA 1NI2A 3UIOB 4LCDE 1KLVA 3CF6E 2LGYA 4EKUA 2AWTA 2D2QA 2RPQA 3PS6A 4KIKA 3I3TB 1WJ6A 1WR1A 2IO3B 3W1SA 1GC6A 2BYEA 1L2NA 3PSEB 2HD5B 1RAXA 2JT4B 2LRWA 3DVNU 1OGWA 2PE9A 1Q1OA 2BWFA 2JVCA 1J0GA 5J18A 4TV3A 4M8NA 5IAAC 4WJNA 2KFKB 5JH5C 2IBIB 2KO3A 2BKRB 3PREA 3PZDA 4EZLA 3EHVA 4MSMB 4URKA 2ZVNA 2IY0B 3BY4B 4GOCA 2M17A 2J7QB 2N4FA 5L83A 2KX3A 2NR2A 2MSED 5D94A 3CSFA 2KXJA 2HJ8A 4F1SA 3QK0A 3IFWB 2ZCBA 3AU4A 4MGYE 4KVGB 4E71A 3IVFA 4ICVA 4GSWA 3TBLD 1Q5WB 2C7HA 3PRPB 2JF5A 3Q3FA 4JL9A 4M0WB 4DK5A 2C5LC 2D07B 1RRBA 2L0FA 3OJ3A 2KZRA 2GBKA 4W9IA 3KW5B 3GZNI 2KKCA 3TJPA 2N7DA 3DQVA 2Z59B 3A1QB 2L76A 2DX5B 2MQJA 4PYUA 2O2VA 1YD8U 3APDA 1WJUA 3H6NA 4G11A 2J0JA 3S2AA 1A5RA 2XK5B 4J6IA 1V49A 5FR6A 2MWSB 1IP9A 2LUEA 2WDTB 3ALBA 3VFKA 1EUVB 1EO6A 1EF1A 4MJSB 4FJZA 3RCZA 2KD0A 2BYVE 2PJHA 2ZPYA 3UIPB 3HHMA 2NCNA 1E8ZA 4IUMB 2DYBA 3QA8A 1WJNA 4DHJB 4WWNA 1WGYA 2C7NB 4NY0A 3A9JA 2L05A 5EDSA 1EF5A 1VCBA 1XD3B 3A1QA 1WE7A 4FADA 2GBJA 2QHOA 3HK0A 4CO7A 3C0RB 2O6VB 2KVRA 1V81A 1F9JA 1GNUA 2LXCA 3BINA 2DYOA 2IYDB 2L00B 2MBHA 3A4RA 3L13A 2DZJA 2NBVB 3B1LX 3LJ3A 2J0MA 3APCA 4F8CB 1GJZA 2V1YA 4MELA 4HLEA 3RZFA 2R2OA 4EZJA 3V6CB 2ZZPB 3VAWA 5C1ZA 3VUWA 2DZMA 2AYOB 4II2B 3VHTC 2BGFA 4W9LA 1WGHA 3DPDA 3KYDD 4NNJB 2A5UA 1AARA 2LZ6A 3QC8B 2MBOA 1UH6A 3X0WA 3ZW3A 1WH3A 3JSVA 3ZO5B 1E5WA 4BVUC 2KJHB 2HTHA 4KSKC 4NAWA 4OVVA 5DPRA 3H7PA 3OLMD 2NVUI 3T9LA 3DCGA 2N1VA 3IG3A 2XBBC 2O6VA 1WI0A 2KOXA 4FBJB 5JHAA 2KTRB 3R7RA 2ZJDA 3ML8A 3CMMB 5G55A 3A33B 4GXBA 3PT2B 5AEKB 1K8RB 1XT9B 5L95C 1E7VA 4TUUA 4FA6A 3HM6X 3V62A 3ECIA 2UWQA 3DVGY 2KC2A 2KDBA 4XX5A 1UBIA 4ASWC 3PTFC 4G0NB 1YX6B 2JRIB 5G2NA 1J19A 3A4SC 4LDTB 5E6NA 4NPNA 5KHOA 2KWCA 2KMCA 3W1SC 2N9PC 3AU5A 4G50A 4TQ0A 3Q3JA 5AZFA 3ZDMC 3ZLZA 3VQIA 4MEMA 1WM3A 3TCAA 2GBRA 1UBQA 3ONSA 1WMHB 1GG3A 2L0TA 4LJPB 4HVBA 1WFYA 2PE6B 4F7ZA 3VH4B 4G3XB 2IO1B 2ZEQA 4WJPA 1C1YB 2L8JA 5E6OA 3V6EB 3L54A 1V2YA 2MP2B 2LVQA 3ZNZB 1ISNA 1P98A 1H8CA 3TIXA 3WIMA 3WAPA 5CHVC 4DDGD 4DWFA 2BYFA 1VD2A 4MH0E 3QARA 3N30A 2KWUB 4W9FA 2V4LA 2N7EA 2G4SA 4IM3A 3QWZB 1Z2MA 2KFJA 3R66C 4IWPA 1ZGUB 5JHBA 1TTNA 2N1WA 4WWOA 4JIOU 2M4NA 3VH3B 4YL8A 2K6QA 3X23A 2RD0A 2CS4A 3N3KB 4PS3A 3RZWC 1WF9A 4WJQA 2LXAA 4MM3A 4IM2A 2MA9B 2KFKA 4K7SA 1WJ4A 3A9KB 3VUYA 3VTUA 2N9EB 3ZTDA 2J0KA 3L0WB 4FN2A 2W9NA 2DAFA 5KHQA 2G45B 1UD7A 2M0XA 3NS8A 3P2BA 5DPWA 5E6PA 2LASA 5IA7A 1MG8A 3TMPB 1JRUA 2EMTA 1R4NI 2JZZA 2YVCA 4BKTA 4BBNF 5DPSA 1WGGA 2GOWA 2LI5A 1P0RA 3D32A 3ZRCA 3AI5A 5D2MB 2NBUA 1WGRA 2KQ7A 2Z0DB 3ENEA 4GIVA 2PPHA 3RYTA 2HE7A 1WX9A 4BOSC 2V3SA 3H7SA 4WWPA 2L7RA 2NS5A 2XEWA 1LFDA 4KSLC 2G4DB 4DBGA 4EOYA 3M3JA 2KC1A 3W1YA 4ANWA 3DBRI 1YX5B 1L7YA 1WY8A 5CHFA 2BF8B 4MDKE 4ICUA 5J2RA 1WIAA 4DHZB 3L10B 1WR6E 4GB9A 5LXIB 2LVPA 3OAWA 2AL6A 2LGXA 3L17A 3PLVA 2D10A 2IY1B 5AZHA 4CHKA 2DYMA 2ZVOA 3U8ZA 1WZ0A 4ANXA 3ZKJC 2M1MA 4FULA 2XK5A 2A4ZA 2MBQA 1ZKHA 2FIDA 2ZNVC 2NPTB 3N32A 4MSQB 1SE9A 4X57B 4ZRJA 3PV1A 1V86A 2BKFA 4BKGA 1Y8RC 1Z5SB 3M95A 4MJSA 1X1MA 3PHWB 2R2QA 3ZRFA 3HIZA 4WAAA 3NOBA 4PS7A 4IG7B 1E8WA 4JQWC 2JPHA 3WANA 3PRMB 4E3CA 4EUTA 1TGZB 2KLCA 4DHJD 1D3ZA 4IM0A 3ZDTA 3MHSD 3V60A 4IC7B 4EEWA 4GN1A 2MCNB 2FUHB 4JLCA 2O6VD 1RFAA 2KDFB 3QAQA 4K7UA 2D11A 3SD5A 1YJ1A 2JUOA 1KOTA 4BOZB 3MTNB 4HDQA 5J17A 4OVUA 3K9OB 3ML9A 3EECA 2WWZA 2KTFA 2DENB 2OJRA 2K8CA 1WYWB 2NPTA 3UQBA 1GUAB 3KH0A 2WX0A 4GU2A 1UGMA 3UINB 4NJ7A 4NQLB 3QHTA 3VDZA 1LXDA 3H1UA 1UZXB 2AL3A 2C9WB 4IWOA 1XQQA 2JXXA 2JZ3B 1NDDA 4K1RB 2FIFA 1RLFA 2G3QB 1V5OA 1OQYA 3B0AA 3JVZX 3PRZA 3QX1A 4I6NB 4W9CA 3VTVA 4AWJA 2KLGA 4HXDA 4W9HA 1G6JA 4HK2A 3JW0X 4N9F4 1I35A 3CSTA 1WXAA 2FCSA 2MLBA 1KM7A 2KN5A 4PS8A 4RM8A 3JYUA 2IO2B 2KK8A 5GMVA 4A20A 2JWZA 4FJVB 2KTRA 4GDLB 1BT0A 3T8MA 2L3ZA 4MGIE 2D3GA 1R4MI 2KMAA 2PEAA 1Q0WB 1YIWA 4GMVA 4XC2A 1P9DU 3ZTCA 3APFA 2WYQA 4FLHA 4A3PA 2EMSA 4GGQA 4DXAB 3U7DA 3WA0A 4CYEA 5LXHA 3L16A 4FHKA 1M94A 3PHXB 3PPAA 4AJWA 2OOBB 2FAZA 3OJ4B 4XZ4A 4ZDVA 4LDTD 3H9DA 2CHWA 1WXSA 2CHZA 2GBMA 2IO0B 2KJ6A 2ZPNA 4KZ0A 2FNJB 5CHWA 3M62B 4BKSD 1WZ3A 3NY5A 5TR5A 4BKSA 2DZKA 2LVOA 1E8XA 1OEYA 3HM3A 2KHWB 2I1KA 2LGDA 4AP4C 2YLMA 4W9JA 2O2VB 1V80A 5AZGA 1QZEA 1WMHA 2RGFA 2CHXA 4HPLB 3KUCB 3WALA 2K1FA 3SU8X 4KDIC 1TBEA 4GDLA 3DVNV 2FCQA 1GC7A 4FHJA 2BPSA 2K25A 1U4AA 4M8MA 2MP2A 4MGZE 3NZSA 4RM9A 4WJOA
chains in the Genus database with same CATH superfamily
1JWAD 1CJEA 2UYZB 1LQBA 4IW0A 5BO4B 2DZIA 2WDQB 4HPMB 3ZIMA 4LNKA 3AE9B 2JY6A 3B08A 2I1JA 1WXMA 5HKHA 3RUIB 5DPTA 4UDUC 4US8A 2AEHA 3AM9A 1FPYA 4USAA 4TKNA 1IBXA 5BMIA 1T0YA 2K8BA 3MC0B 1FM0D 1FXAA 3U30A 5LLIA 5G5GA 5JZEB 2MBEA 1NBFC 3PVLA 1AW7A 1OTRB 1V6EA 1WXQA 4WAFA 1OEYJ 4K7WA 2N0SB 5BMGA 5D6JB 3V3XA 3DBLI 4GDKA 5C23A 3DDCB 3ZNHB 1E8YA 2MRPA 2KWVB 4K3CA 2R61A 2HTME 4EZKA 4AUQC 4KIKB 4HWIB 5BYRA 1TS4A 1IYFA 2IGHA 2BB5A 3WAMA 4ZYSA 1FRDA 1SGHA 4II3B 4WQOB 2K8HA 2JYEA 2MW5A 3O13A 3PLUA 2IZVB 2W55A 3W5UB 1PQSA 2FCMA 4KKIA 3IHPC 1PUTA 2KMMA 1NI2A 4LCDE 1KLVA 1ZDXA 3PS6A 3I3TB 1WR1A 2BYEA 3PSEB 4TSSA 2LRWA 3DVNU 1Q1OA 2BWFA 3ZXVA 4IOIE 5J18A 1MI0A 5JH5C 3PREA 3E9SA 3AE6B 1HZ5A 3RNGC 4MSMB 1L6VA 5EE0A 2IY0B 3RNEC 4O1NA 3MC8A 2NR2A 3E56A 2MSED 3PZ7A 3CSFA 2KXJA 2ZCBA 4MGYE 4KVGB 2TSSA 4E71A 3IVFA 3TBLD 2KZRA 1KH0A 2SAKA 2DBYA 1EU4A 3KW5B 1FIQA 3TJPA 1TYGB 2EKIA 1OFFA 4MT5A 3APDA 1I4PA 1EWCA 2HJ1A 4G11A 3AE3B 4RGOS 1T0RC 2VZKD 2NTTA 3VFKA 3WCQA 2KAJA 1EO6A 2KD0A 2PJHA 2ZPYA 3ZJTA 1E8ZA 1QOAA 4US9A 3QA8A 4WWNA 1WGYA 5EDSA 1T6BX 2H89B 3LYYA 1NYRA 4FADA 2QHOA 3C0RB 4MACA 3AE8B 1KLGD 3I63C 3BINA 4WURA 3OWEB 1DOXA 3L13A 4LNNA 2J0MA 3C19A 3TSSA 2V1YA 4MELA 2K3UA 2R2OA 1WSPA 4HKZE 3KWVA 4II2B 3AEGB 4W9LA 2QSDA 2LZ6A 2N7JA 3QC8B 2MBOA 1UH6A 4P6VF 3X0WA 3ZW3A 2PVGC 2HTHA 1SF0A 3H7PA 2NVUI 2E3TA 1RYJA 2O6VA 1VZ8A 4DXFA 3GP7A 1CQVA 4GXBA 4RGNA 4XYCA 3HM6X 3V62A 2UWQA 2NTSA 3Q6BA 1YNTE 1YX6B 3AH7A 4RGMA 2OHFA 2JRIB 1J19A 1F2RI 2WXOA 3ZJVA 2KMCA 3W1SC 3ZDMC 3VQIA 3TCAA 1UBQA 4LJPB 4HVBA 1STEA 3I57A 5E6OA 3L54A 4ZRQA 1ISNA 1UWXA 3TIXA 1HXYD 4DDGD 3AEAB 2D3AA 1QQRA 1D5ZC 1AYFA 1ZGUB 5JHBA 4ZHPA 3KQ4A 2K6QA 2RD0A 1TIFA 2CS4A 4PS3A 1RFKA 4WJQA 2LXAA 1GOZA 3EFCA 2KFKA 3VUYA 4RFBA 4L2YA 2M0XA 3L4PA 3NS8A 3P2BA 4XE0A 1IUEA 4S0RA 1TZOA 2EMTA 1R4NI 2YVCA 2BT6A 3GE8C 3ENEA 2EELA 1GAQB 4WWPA 1ZE3D 4KSLC 2G4DB 1DOIA 5GXGB 1I4GA 4DBGA 4EOYA 4RF1A 1KTKA 2BF8B 4TMAB 1L0YB 3PO0A 3L10B 4GB9A 5LXIB 2LVPA 4LK0M 3Q3OC 3U8ZA 3I5JC 3IAS1 1L0VB 4HEA1 2A4ZA 1CZPA 2ZNVC 1VR9A 3N32A 1JMLA 1V86A 2RPVA 3DBHB 4C7ZA 1X1MA 3PHWB 3Q8EA 1E8WA 3WANA 3PRMB 4EUTA 4DHJD 4IM0A 1XLQA 3FAHA 2WXMA 2MCNB 4YSYB 4MH8A 1VZ6A 4K7UA 2KACA 3SD5A 3W5VB 1YJ1A 1N60A 4BOZB 3RPFC 1K53A 3ML9A 2KTFA 2J52A 2NPTA 2K5PA 3UQBA 2BQQA 2JQRB 1GB4A 3SFDB 2WX0A 4YTMB 5BMHA 1UGMA 4YSXB 4NQLB 3QHTA 3H1UA 4D2KA 3MFGA 4I6NB 1OQYA 3QX1A 4W9CA 4M01A 3CSTA 1L0XB 2BW2A 4HPPA 2WXKA 3VR8B 5IO9A 1ZXIA 1VZ7A 2PMVA 2IO2B 4A20A 4FJVB 2KTRA 3P4SB 1BT0A 4KGRA 4ZOHC 1JQ4A 1Q0WB 4M02A 2LFIA 2EMSA 4CYEA 3P63A 1QILA 4AJWA 2OOBB 2FE8A 3HVDA 3RFZB 2GBMA 1EWYC 2KJ6A 1E9MA 4BKSD 4BKSA 1NVID 5EE1A 3HM3A 4Q2JA 4W9JA 1V80A 2RGFA 3WALA 2K1FA 3GB1A 4GDLA 5HG2A 2MP2A 3NZSA 2XNAC 1WM2A 4P7IA 3BYTB 4WWMA 4JGHB 2SEBD 5G5HA 2ZW0A 1D5MC 2HDEA 3R7QA 4C4VB 2MX2A 2ZCCA 3Q8BA 3QJZA 2EKEC 4XGAB 1FNUA 3A9JB 2BWES 2LWPA 4OZBA 1KJTA 2N9KA 2VH2A 3GZNB 2Y5BB 3MJ5A 3AEDB 1WE6A 1N5XA 4KDLB 1Q10A 2ZNVB 3BWUD 1HE8A 3AECB 2PKOA 1ZUD2 3W2DA 3AB5A 3JSVB 4NAWB 1WXVA 3KUZA 2MHJA 1YQ3B 4ZRPA 3ZNID 3ZJUA 3RN9C 3ZNGC 3U52E 1H4RA 2KJRA 3AE2B 2ACZB 3R2TA 3VTWA 2CKHB 1FCCC 3GOEA 4DHZE 1JWUD 1S1QB 4ITKA 2KDEB 4LJOB 1UELA 3M63B 4ZYNA 1ZOYB 2NBWB 4JWSC 2VRRB 4YXDB 3UQAA 1XO3A 2KNBA 4OVZA 5AUKA 3KVFB 3PGEA 1B9RA 3ZVVA 3L08A 1IPGA 3NHEB 3ZGZA 4TQ1A 1ACCA 1BMLC 1V1OA 4LTUA 2LMCA 1JCKB 1YOVB 2LGYA 2AWTA 2D2QA 4KIKA 4AS1A 1WJ6A 1T5XD 2IO3B 1GC6A 3AE4B 1L2NA 3B9JA 2HD5B 2JVCA 1J7CA 1N61A 1C79A 3NJTA 1FFVA 2BKRB 2I2YA 1FMAD 4URKA 3BY4B 4NZLB 2KX3A 3P4RB 2HJ8A 2WHIA 3QK0A 4P16A 1D4BA 4GSWA 2PTLA 2JF5A 4JL9A 1LO5D 4DK5A 3OJ3A 3I9V1 4JWUC 2KKCA 2AQ1B 3A1QB 1UGJA 2GRIA 2J0JA 1A5RA 2XK5B 4J6IA 3FILA 4A55A 5FR6A 1TKEA 2LUEA 3ALBA 3T3NA 2INNE 4MJSB 1UWMA 2DLBA 3HRDD 2NCNA 4IUMB 2DYBA 1TS2A 2JYTA 2B76B 4NY0A 2L05A 1EF5A 1VCBA 3DHIC 3HK0A 4CO7A 2KVRA 1V81A 4J3OD 1F9JA 1GNUA 2LXCA 2DYOA 2MBHA 3AV8A 2K0PA 3A4RA 3BK2A 2DZJA 3B1LX 4C56C 4HLEA 3RZFA 3VAWA 1QF6A 2AYOB 3T3OA 3VHTC 2WP9B 4NNJB 5IOIA 5JXVA 2PW9A 4BZAA 4YTPB 1E5WA 1YJIA 3OLMD 3T9LA 3DCGA 2XBBC 3TEYA 2KOXA 1VRAB 3CMMB 3A33B 1XLPA 5AEKB 4TUUA 2KC2A 1PDXA 1UBIA 3VRBB 1E10A 5G2NA 2FBWB 3A4SC 5EE3A 4LDTB 3Q8FA 5KHOA 2DWQA 2KWCA 1SXTA 4G50A 3Q3JA 2K9XA 4RNAA 2GBRA 1A70A 1C77A 2L0TA 3V05A 1JWSD 4OZCA 2WXQA 4G3XB 5HHDG 1V2YA 1VJKA 3ZNZB 2BTEA 1I4RA 1PGXA 3WIMA 1VD2A 4ARCA 4XWTA 4W9FA 3NVZA 2N7EA 1R7SA 4NJCA 1R4MB 2G4SA 1PYWD 4OW0A 1TKGA 1TTNA 1YN4A 4WWOA 4JIOU 2M4NA 2JZPA 3N3KB 2I38A 3Q3MC 2BS3B 1NENB 2WXLA 4MM3A 4K7SA 4YT0B 1WJ4A 2N9EB 2ONQA 4FN2A 2W9NA 2DAFA 5KHQA 2G45B 5DPWA 5IA7A 1MG8A 3TMPB 1JRUA 2KQ4X 4BBNF 2J53A 3ZRCA 5D2MB 1WGRA 5HI1A 2KQ7A 2Z0DB 4LLGM 3AE5B 1E7PB 3U4EG 2L7RA 2XEWA 1LFDA 2V9HA 4BAXA 1YX5B 1HTOA 2KWDA 1WIAA 2X38A 2ON8A 3VR9B 3OAWA 2AL6A 2LGXA 2D10A 2IY1B 2D5GA 4K3BA 1F77A 1WRIA 3ZKJC 2MBQA 1FNVA 1Y56A 4XDDA 1SB3C 1Y8RC 2R2QA 5C3JB 1T0SC 2KLCA 3MHSD 4IC7B 3P1MA 2QILA 2FUHB 2O6VD 2D11A 2JUOA 1KOTA 2QDFA 2OEDA 4HDQA 2H88B 2QC8A 3EECA 5T8IA 3MP9A 2OJRA 2M19A 4GU2A 4NAMA 3UINB 4NJ7A 3RNAC 3VDZA 1SJED 1LXDA 5H92C 2C9WB 1XQQA 3AE1B 1OQQA 1F0ZA 1NDDA 2Y3AA 3PRZA 2FIFA 1RLFA 1V5OA 3B0AA 4K1RB 5D94A 1I42A 4AWJA 1V97A 2L1AA 3DHGC 4HXDA 4W9HA 1I4XA 1I35A 2BB6A 2CJOA 2MLBA 1JALA 3RI7C 1LGRA 5FKAC 2D3GA 3Q8CA 1V1PA 3ZTCA 2WYQA 4FLHA 4A3PA 3L16A 3OJ4B 4XZ4A 2V0GA 2CHWA 1XEEA 2FNJB 2DNFA 2INDC 3GE3C 5TR5A 1P7EA 2LGDA 1QOGA 1ROEA 1WMHA 2BS2B 2CHXA 2FCQA 1GC7A 1U4AA 1ENFA 2M0AA 2WS3B 2VZKB 2WU2B 1FRRA 3ZXRA 4RGTA 2C60A 4HCPB 1P3QU 2DHZA 3O65B 3QQ8B 1XCQL 2WX1A 4KZCA 2DAJA 4I6LB 4AOFA 1TJEA 4W9GA 1V5TA 1MHHE 1YN5A 4K81A 2LHEA 2K6DB 2KT7A 2MBBB 4HDOA 3V61A 2RSUA 4BFRA 3A9KA 1FXTB 3VVWB 4KGTA 3DBHI 3N1YC 1XLOA 4B95A 2QCZA 1YQBA 4KV2A 2K39A 4PYZA 1XCTL 2B3AA 3MC9A 2X8XX 1T3QA 2CJNA 3IBEA 2M8SA 3NVVA 2WXGA 3EA6A 1KF6B 3H7PB 1LM8B 3VUXA 4R3DA 1J7BA 3VXWA 2LD9A 3UGBB 4B6WA 2KQSA 1CMXB 5CX3A 4W9DA 1N63A 3IT6B 1E90A 4B0MA 3U7ZA 1P1AA 2GBNA 2FUG1 4ANUA 1E7UA 2N9XA 3P42A 2LUMA 1HZ6A 5IN7A 1QOBA 1YN3A 5FK9C 3FKYA 4FJYA 2C7MB 2CR5A 3WAOA 3ETRA 4N59A 4L23A 3QCAA 1SIFA 3J9CA 1VLBA 2KANA 1RM6C 4DDID 3DBSA 2ASQA 1K50A 1TY2A 3DWMA 2Z0EB 4NQKE 4FXCA 3ZUNA 2MJEA 4E74A 3DOWA 1T0QC 5C2TB 1FNWA 2FCNA 1WGDA 4C00A 1C4AA 4EKUA 2RPQA 4JPSA 1SEBD 2WXFA 3DHHC 1C78A 2JT4B 2PE9A 3VRAB 3N20C 4TV3A 2JXTA 1ET9A 4M8NA 4WJNA 1WGKA 1E0ZA 2KFKB 1IGCA 2IBIB 4WH4A 2WDVB 3N9YC 1E6EB 2ICIA 2ZVNA 5I4DA 4GOCA 2M17A 1ZXHA 2N4FA 4LNIA 5L83A 2AX5A 4YTNB 4F1SA 3AU4A 3NRZA 2V4IB 1Q5WB 2C7HA 4M0WB 1RRBA 2L0FA 2N9LA 4W9IA 3GZNI 1SE2A 3DQVA 2KN4A 2DX5B 3FC4A 2O2VA 2L52A 1WJUA 3H6NA 3NZ3A 1N5WA 2IJ0A 3DWGC 2RDHA 1V49A 2BYTA 2MWSB 1HQRD 1OQRA 1QKZA 5H8YE 1EUVB 1EF1A 3RCZA 4FJZA 2BYVE 2Y5PA 3HUIA 2YEPF 4RF0A 4DHJB 2C7NB 3A1QA 1WE7A 1D6EC 1MPEA 2GBJA 1J7AA 2QIEB 1MHXA 2QEJC 3DBRB 2VH1A 2L00B 3B2GA 3RNCC 3LJ3A 2QJLA 2ZZPB 3VUWA 2DZMA 4PK1A 3KYDD 3NG0A 2A5UA 1AARA 3IXSA 1MG4A 2GLSA 1WH3A 2KJHB 5DPRA 1C76A 2N1VA 1WI0A 4FBJB 2KTRB 3R7RA 2ZJDA 3ML8A 4ARIA 3CWIA 5G55A 3PT2B 2J42A 4FA6A 1KFYB 3ECIA 2JX5A 2KDBA 4XX5A 1N62A 1P7FA 3N1XC 2GI9A 4P1BC 4IKGA 5AZFA 3BIID 3ZLZA 2PIAA 3R8BA 1UNSA 3ONSA 1GG3A 2PE6B 1C9FA 1M4VA 2IO1B 2ZEQA 4WJPA 1C1YB 2L8JA 3V6EB 2MP2B 3W9CB 3ZQ4A 1JWMD 3WAPA 4HROA 3AEEB 2KWUB 4A9AA 3RMKC 4IM3A 3R66C 4IWPA 3IT4B 4YL8A 3BVMA 1WWTA 3RZWC 3SFEB 2IGDA 1ESFA 3NS1A 1WF9A 1F1HA 1K52A 2MA9B 2BS4B 3Q2AC 2IDYA 1AN8A 1SBBB 2WLBA 2L83A 2AQ2B 5E6PA 4WIPA 4BKTA 1UUPA 4HJGE 1WGGA 2LI5A 1P0RA 3D32A 2NBUA 1FO4A 4GIVA 2PPHA 3AEBB 3RYTA 3UI3A 1WX9A 2V3SA 3H7SA 2WU5B 1QLBB 2K22A 4DXGA 2YEPB 4C7YA 3TEZA 4ANWA 3URYA 2JWUA 5CHFA 1HTQA 1FEHA 3L17A 3PLVA 4AQ7A 4FULA 4RCOA 2MEKA 2FIDA 4MSQB 4XWWA 3PV1A 1TY0A 3M95A 1MVKA 2WGSA 1QOFA 3N1ZC 3HIZA 3NOBA 4PS7A 1UF0A 2JPHA 4E3CA 3IAM1 3ZDTA 3V60A 4EEWA 2PVOD 4WQMA 4JLCA 3OG5A 1RFAA 2KDFB 4HRSA 4OVUA 2WWZA 4KKJA 2K8CA 2D3BA 1TT5B 3DBLB 1FFUA 2MJDA 1UZXB 1I7HA 2JXXA 2WXIA 3BZDB 2G3QB 3VTVA 2LJIA 4B0EA 1G6JA 4C80A 1WXAA 1JWBD 4EE2A 2KN5A 3JYUA 1QT9A 2JWZA 1SSNA 3T8MA 4MGIE 1R4MI 4GMVA 1YIWA 4XC2A 3APFA 4DXAB 4GGQA 1TS3A 3WA0A 4FHKA 4N58A 3PPAA 2FAZA 4ZDVA 4P1CC 4LNFA 3H9DA 4KZ0A 2ZPNA 1ZPSA 4L1BA 1WZ3A 1L4ZB 3Q3NC 1I4HA 1F2RC 1E8XA 1OEYA 2KHWB 2I1KA 4AP4C 4F8CB 2YLMA 1QZEA 1ET6A 4HPLB 3KUCB 3SU8X 1BXTA 4QAYA 4KDIC 1TBEA 5IKCM 3DVNV 4FHJA 2K25A 2G9HD 4MGZE 1F52A 1YJJA 3FILB 4RM9A 4WJOA 2KX0A 1J8CA 1IBXB 3BYYB 1NI3A 2LEKA 1PGAA 4N6EB 3ABVB 2KDIA 2GB1A 5D7GA 4BBNC 1SJHD 3EC8A 1JROA 4A8XC 4A3OA 1ZDVA 3AULA 2LRUA 2BVCA 1ZP0B 1WX7A 2ZW1A 4ZHOA 1V9JA 4ZRKA 3RT3B 3R3MA 1ZW7A 4GDKB 4NJ6A 4MGKE 3DVGX 3BVGA 3EUB2 1SE3A 4B9KA 4HJKA 4YSZB 3SHQA 3P4PB 3TEXA 2JRHA 4REZA 5DCNA 3TL5A 4AJYB 2WXHA 2WDRB 1SE4A 4HCNB 1GB1A 4W9EA 2RR9A 3SDLC 2REXA 1L4DB 2Z8LA 2WXRA 2LJ5A 3QIJA 2W3SA 3CIRB 1S3SG 4OZAA 5CTRC 4ANVA 1CK1A 1WX8A 1TZ1A 2LGSA 3RD2A 2XN9C 3K9PB 3KYCD 3AE7B 3NVWA 2CU1A 3LXFA 4IWQA 3UF8A 4W9KA 3KUDB 1C3TA 1FD6A 3AN1A 4EFOA 1V8CA 1WRDB 4ACFA 2OJWA 1BUIC 3GS2A 5BYQA 3BVZA 4I6PA 2WNMA 3EFUA 3SEBA 1C4CA 2GMIC 3H8HA 3LDZE 3AXCA 4ZRIA 4PT5A 3RULA 3NZUA 1TS5A 4RMAA 2INCC 3MJWA 2W82A 3PZ8A 4YWGG 3UIOB 3CF6E 3NUHB 3P4QB 1FXIA 3W1SA 1NYQA 3AMZA 4HKQA 1RAXA 1OGWA 3EGRA 2KVZA 1J0GA 2AQ3B 4MM3B 5IAAC 1GPXA 2JSVX 2UU7A 2KO3A 3PZDA 5FR3A 4EZLA 2KYWA 3EHVA 1MJDA 5HFYA 2J7QB 2BBCA 5BYSA 2WXJA 3RNFC 5MPOA 3IFWB 4ICVA 3PRPB 3Q3FA 2W3RA 2C5LC 2D07B 1HEZE 2GBKA 2N7DA 2Z59B 2L76A 2MQJA 4JX1C 4PYUA 1YD8U 5E6JA 2WXPA 1L5PA 3S2AA 2PLPA 4OHJA 1IP9A 2WDTB 3AEFB 2L32A 1VDVA 4M0WA 1R4NB 3HHMA 3UIPB 4C4VA 5AUIA 1WJNA 3A9JA 4JE3B 1DGJA 1XD3B 2IPKD 2O6VB 1KLUD 2IYDB 2INPE 1N6ZA 2NBVB 3APCA 2KDMA 1GJZA 1JRPA 3V6CB 4EZJA 5C1ZA 4DQOC 2BGFA 4H2AA 1EM7A 1WGHA 3DPDA 3B2FA 3R2IA 1L6UA 1RWSA 3JSVA 3ZO5B 3TUOA 1AWDA 4BVUC 4KSKC 4NAWA 4OVVA 3IG3A 5JHAA 1DOYA 2QMTA 1K8RB 1XT9B 5L95C 1E7VA 1V1PB 1YQ4B 3DVGY 4ASWC 3PTFC 4G0NB 2MJ3A 5E6NA 4NPNA 2LGIA 2N9PC 3AU5A 3BK1A 4TQ0A 2M56B 2W54A 3LB8C 4MEMA 1WM3A 1WMHB 5D3IB 3Q69A 1WFYA 2MH7A 4GLSC 3VH4B 4F7ZA 3C8YA 2LVQA 1TKYA 1P98A 1H8CA 1XF5L 5CHVC 3TEWA 4DWFA 2BYFA 4MH0E 3QARA 3N30A 2V4LA 3U2SC 3QWZB 1Z2MA 3SR6A 2KFJA 3KLSX 1JW9D 2N1WA 3VH3B 3X23A 1B1ZA 3NVYA 5IP4D 1SIJA 3MHZA 4IM2A 4CQNA 3A9KB 3VTUA 3ZTDA 2J0KA 3L0WB 1D5XC 1UD7A 2LASA 2G1EA 2Y5CA 2JZZA 4S17A 5DPSA 2GOWA 5D3DA 1I4QA 2LHDA 3AI5A 1HA5A 2V3NA 2NMQA 2HE7A 1C4PA 1WYGA 4BOSC 2NS5A 3RNBC 3M3JA 2KC1A 3W1YA 3DBRI 1L7YA 1WY8A 5LNK1 4MDKE 4ICUA 5J2RA 1KRHA 4DHZB 1WR6E 2JU6X 5AZHA 1IGDA 4CHKA 4LNOA 2DYMA 2ZVOA 1WZ0A 1PGBA 4ANXA 2M1MA 2XK5A 1ZKHA 2NPTB 4X57B 4ZRJA 1SE9A 1DYQA 3HVZA 2BKFA 4BKGA 1Z5SB 4MJSA 5EE9A 2RMMA 2RDGA 3ZRFA 4WAAA 4IG7B 4JQWC 1TGZB 1D3ZA 2WXNA 4A90A 4KGSA 3Q14C 4GN1A 4A6QA 3QAQA 4IDIA 3MTNB 1EU3A 5J17A 3K9OB 4KX6B 2DENB 1WYWB 1GUAB 3KH0A 3Q8AA 1K51A 4XDCA 4IWOA 2AL3A 2JZ3B 3JVZX 2KLGA 1NEKB 4HK2A 3JW0X 4RH6A 4N9F4 4M00A 1MFWA 3KWLA 2FCSA 1XXGA 1KM7A 4PS8A 4RM8A 2D3CA 2KK8A 5GMVA 1PFDA 4GDLB 5TSSA 2L3ZA 2KMAA 2J4XA 2PEAA 2WQYB 2CU3A 1P9DU 2Q5WD 5LXHA 3U7DA 1XLNA 1M94A 3PHXB 2V3PA 4LDTD 1WXSA 2CHZA 2IGGA 2IO0B 2E6XA 5CHWA 3M62B 3ZYYX 3NY5A 2DZKA 2LVOA 2O2VB 5AZGA 4M8MA 2BPSA 2RDBC 1FCLA 1YMHE
chains in the Genus database with same CATH topology
2KX0A 2C60A 1J8CA 1WM2A 4P7IA 4HCPB 1P3QU 2UYZB 1LQBA 4JGHB 4IW0A 5BO4B 2DZIA 2DHZA 3O65B 3QQ8B 4HPMB 3R7QA 3ZIMA 2MX2A 2ZCCA 2KDIA 2WX1A 5D7GA 3QJZA 4KZCA 2DAJA 2EKEC 4BBNC 3EC8A 4I6LB 3A9JB 4AOFA 4W9GA 1V5TA 2JY6A 2BWES 4K81A 3B08A 2K6DB 2LWPA 2I1JA 4A3OA 2MBBB 1KJTA 1WXMA 4HDOA 3AULA 3V61A 5HKHA 2LRUA 1WX7A 2RSUA 4BFRA 3RUIB 1V9JA 5DPTA 2Y5BB 4ZRKA 3A9KA 1FXTB 3RT3B 2AEHA 3VVWB 3R3MA 1ZW7A 4GDKB 1WE6A 3DBHI 4MGKE 3DVGX 4NJ6A 1I42A 4KDLB 2ZNVB 1YQBA 4TKNA 4B95A 4B9KA 4HJKA 1T0YA 2K8BA 4KV2A 2K39A 1HE8A 3U30A 4PYZA 2B3AA 5LLIA 3SHQA 2JRHA 5DCNA 5JZEB 3JSVB 2MBEA 3IBEA 2M8SA 3TL5A 1NBFC 4NAWB 1WXVA 3H7PB 1LM8B 3KUZA 3PVLA 3VUXA 4AJYB 1OTRB 1V6EA 3ZNID 3VXWA 2LD9A 3UGBB 4HCNB 4B6WA 2KQSA 4W9EA 1CMXB 1OEYJ 5CX3A 3ZNGC 4K7WA 2RR9A 1H4RA 2KJRA 3SDLC 2REXA 4W9DA 5D6JB 2LJ5A 3QIJA 1E90A 3DBLI 1S3SG 4GDKA 1P1AA 2GBNA 5C23A 3DDCB 5CTRC 3VTWA 2CKHB 3ZNHB 4ANUA 4ANVA 3GOEA 4DHZE 1E8YA 1WX8A 2MRPA 1E7UA 1TZ1A 2KWVB 2N9XA 3RD2A 1S1QB 3K9PB 2KDEB 3KYCD 4LJOB 1UELA 4EZKA 3M63B 4AUQC 4ZYNA 2CU1A 2NBWB 4IWQA 4KIKB 4FJYA 3UF8A 2VRRB 4HWIB 2C7MB 2CR5A 4W9KA 3WAOA 3KUDB 3QCAA 1SIFA 1C3TA 3UQAA 2KNBA 2KANA 3KVFB 3PGEA 4EFOA 4DDID 3DBSA 2ASQA 1WRDB 3ZVVA 3L08A 1IYFA 2Z0EB 4I6PA 3EFUA 3WAMA 4NQKE 1IPGA 2GMIC 1SGHA 4II3B 3LDZE 3NHEB 4WQOB 3AXCA 3ZUNA 2K8HA 4TQ1A 2MW5A 4ZRIA 3RULA 3PLUA 4E74A 2IZVB 3NZUA 3DOWA 1PQSA 2FCMA 4RMAA 3MJWA 3IHPC 2FCNA 1WGDA 1NI2A 3UIOB 4LCDE 1KLVA 3CF6E 2LGYA 4EKUA 2AWTA 2D2QA 2RPQA 3PS6A 4KIKA 3I3TB 1WJ6A 1WR1A 2IO3B 3W1SA 1GC6A 2BYEA 1L2NA 3PSEB 2HD5B 1RAXA 2JT4B 2LRWA 3DVNU 1OGWA 2PE9A 1Q1OA 2BWFA 2JVCA 1J0GA 5J18A 4TV3A 4M8NA 5IAAC 4WJNA 2KFKB 5JH5C 2IBIB 2KO3A 2BKRB 3PREA 3PZDA 4EZLA 3EHVA 4MSMB 4URKA 2ZVNA 2IY0B 3BY4B 4GOCA 2M17A 2J7QB 2N4FA 5L83A 2KX3A 2NR2A 2MSED 5D94A 3CSFA 2KXJA 2HJ8A 4F1SA 3QK0A 3IFWB 2ZCBA 3AU4A 4MGYE 4KVGB 4E71A 3IVFA 4ICVA 4GSWA 3TBLD 1Q5WB 2C7HA 3PRPB 2JF5A 3Q3FA 4JL9A 4M0WB 4DK5A 2C5LC 2D07B 1RRBA 2L0FA 3OJ3A 2KZRA 2GBKA 4W9IA 3KW5B 3GZNI 2KKCA 3TJPA 2N7DA 3DQVA 2Z59B 3A1QB 2L76A 2DX5B 2MQJA 4PYUA 2O2VA 1YD8U 3APDA 1WJUA 3H6NA 4G11A 2J0JA 3S2AA 1A5RA 2XK5B 4J6IA 1V49A 5FR6A 2MWSB 1IP9A 2LUEA 2WDTB 3ALBA 3VFKA 1EUVB 1EO6A 1EF1A 4MJSB 4FJZA 3RCZA 2KD0A 2BYVE 2PJHA 2ZPYA 3UIPB 3HHMA 2NCNA 1E8ZA 4IUMB 2DYBA 3QA8A 1WJNA 4DHJB 4WWNA 1WGYA 2C7NB 4NY0A 3A9JA 2L05A 5EDSA 1EF5A 1VCBA 1XD3B 3A1QA 1WE7A 4FADA 2GBJA 2QHOA 3HK0A 4CO7A 3C0RB 2O6VB 2KVRA 1V81A 1F9JA 1GNUA 2LXCA 3BINA 2DYOA 2IYDB 2L00B 2MBHA 3A4RA 3L13A 2DZJA 2NBVB 3B1LX 3LJ3A 2J0MA 3APCA 4F8CB 1GJZA 2V1YA 4MELA 4HLEA 3RZFA 2R2OA 4EZJA 3V6CB 2ZZPB 3VAWA 5C1ZA 3VUWA 2DZMA 2AYOB 4II2B 3VHTC 2BGFA 4W9LA 1WGHA 3DPDA 3KYDD 4NNJB 2A5UA 1AARA 2LZ6A 3QC8B 2MBOA 1UH6A 3X0WA 3ZW3A 1WH3A 3JSVA 3ZO5B 1E5WA 4BVUC 2KJHB 2HTHA 4KSKC 4NAWA 4OVVA 5DPRA 3H7PA 3OLMD 2NVUI 3T9LA 3DCGA 2N1VA 3IG3A 2XBBC 2O6VA 1WI0A 2KOXA 4FBJB 5JHAA 2KTRB 3R7RA 2ZJDA 3ML8A 3CMMB 5G55A 3A33B 4GXBA 3PT2B 5AEKB 1K8RB 1XT9B 5L95C 1E7VA 4TUUA 4FA6A 3HM6X 3V62A 3ECIA 2UWQA 3DVGY 2KC2A 2KDBA 4XX5A 1UBIA 4ASWC 3PTFC 4G0NB 1YX6B 2JRIB 5G2NA 1J19A 3A4SC 4LDTB 5E6NA 4NPNA 5KHOA 2KWCA 2KMCA 3W1SC 2N9PC 3AU5A 4G50A 4TQ0A 3Q3JA 5AZFA 3ZDMC 3ZLZA 3VQIA 4MEMA 1WM3A 3TCAA 2GBRA 1UBQA 3ONSA 1WMHB 1GG3A 2L0TA 4LJPB 4HVBA 1WFYA 2PE6B 4F7ZA 3VH4B 4G3XB 2IO1B 2ZEQA 4WJPA 1C1YB 2L8JA 5E6OA 3V6EB 3L54A 1V2YA 2MP2B 2LVQA 3ZNZB 1ISNA 1P98A 1H8CA 3TIXA 3WIMA 3WAPA 5CHVC 4DDGD 4DWFA 2BYFA 1VD2A 4MH0E 3QARA 3N30A 2KWUB 4W9FA 2V4LA 2N7EA 2G4SA 4IM3A 3QWZB 1Z2MA 2KFJA 3R66C 4IWPA 1ZGUB 5JHBA 1TTNA 2N1WA 4WWOA 4JIOU 2M4NA 3VH3B 4YL8A 2K6QA 3X23A 2RD0A 2CS4A 3N3KB 4PS3A 3RZWC 1WF9A 4WJQA 2LXAA 4MM3A 4IM2A 2MA9B 2KFKA 4K7SA 1WJ4A 3A9KB 3VUYA 3VTUA 2N9EB 3ZTDA 2J0KA 3L0WB 4FN2A 2W9NA 2DAFA 5KHQA 2G45B 1UD7A 2M0XA 3NS8A 3P2BA 5DPWA 5E6PA 2LASA 5IA7A 1MG8A 3TMPB 1JRUA 2EMTA 1R4NI 2JZZA 2YVCA 4BKTA 4BBNF 5DPSA 1WGGA 2GOWA 2LI5A 1P0RA 3D32A 3ZRCA 3AI5A 5D2MB 2NBUA 1WGRA 2KQ7A 2Z0DB 3ENEA 4GIVA 2PPHA 3RYTA 2HE7A 1WX9A 4BOSC 2V3SA 3H7SA 4WWPA 2L7RA 2NS5A 2XEWA 1LFDA 4KSLC 2G4DB 4DBGA 4EOYA 3M3JA 2KC1A 3W1YA 4ANWA 3DBRI 1YX5B 1L7YA 1WY8A 5CHFA 2BF8B 4MDKE 4ICUA 5J2RA 1WIAA 4DHZB 3L10B 1WR6E 4GB9A 5LXIB 2LVPA 3OAWA 2AL6A 2LGXA 3L17A 3PLVA 2D10A 2IY1B 5AZHA 4CHKA 2DYMA 2ZVOA 3U8ZA 1WZ0A 4ANXA 3ZKJC 2M1MA 4FULA 2XK5A 2A4ZA 2MBQA 1ZKHA 2FIDA 2ZNVC 2NPTB 3N32A 4MSQB 1SE9A 4X57B 4ZRJA 3PV1A 1V86A 2BKFA 4BKGA 1Y8RC 1Z5SB 3M95A 4MJSA 1X1MA 3PHWB 2R2QA 3ZRFA 3HIZA 4WAAA 3NOBA 4PS7A 4IG7B 1E8WA 4JQWC 2JPHA 3WANA 3PRMB 4E3CA 4EUTA 1TGZB 2KLCA 4DHJD 1D3ZA 4IM0A 3ZDTA 3MHSD 3V60A 4IC7B 4EEWA 4GN1A 2MCNB 2FUHB 4JLCA 2O6VD 1RFAA 2KDFB 3QAQA 4K7UA 2D11A 3SD5A 1YJ1A 2JUOA 1KOTA 4BOZB 3MTNB 4HDQA 5J17A 4OVUA 3K9OB 3ML9A 3EECA 2WWZA 2KTFA 2DENB 2OJRA 2K8CA 1WYWB 2NPTA 3UQBA 1GUAB 3KH0A 2WX0A 4GU2A 1UGMA 3UINB 4NJ7A 4NQLB 3QHTA 3VDZA 1LXDA 3H1UA 1UZXB 2AL3A 2C9WB 4IWOA 1XQQA 2JXXA 2JZ3B 1NDDA 4K1RB 2FIFA 1RLFA 2G3QB 1V5OA 1OQYA 3B0AA 3JVZX 3PRZA 3QX1A 4I6NB 4W9CA 3VTVA 4AWJA 2KLGA 4HXDA 4W9HA 1G6JA 4HK2A 3JW0X 4N9F4 1I35A 3CSTA 1WXAA 2FCSA 2MLBA 1KM7A 2KN5A 4PS8A 4RM8A 3JYUA 2IO2B 2KK8A 5GMVA 4A20A 2JWZA 4FJVB 2KTRA 4GDLB 1BT0A 3T8MA 2L3ZA 4MGIE 2D3GA 1R4MI 2KMAA 2PEAA 1Q0WB 1YIWA 4GMVA 4XC2A 1P9DU 3ZTCA 3APFA 2WYQA 4FLHA 4A3PA 2EMSA 4GGQA 4DXAB 3U7DA 3WA0A 4CYEA 5LXHA 3L16A 4FHKA 1M94A 3PHXB 3PPAA 4AJWA 2OOBB 2FAZA 3OJ4B 4XZ4A 4ZDVA 4LDTD 3H9DA 2CHWA 1WXSA 2CHZA 2GBMA 2IO0B 2KJ6A 2ZPNA 4KZ0A 2FNJB 5CHWA 3M62B 4BKSD 1WZ3A 3NY5A 5TR5A 4BKSA 2DZKA 2LVOA 1E8XA 1OEYA 3HM3A 2KHWB 2I1KA 2LGDA 4AP4C 2YLMA 4W9JA 2O2VB 1V80A 5AZGA 1QZEA 1WMHA 2RGFA 2CHXA 4HPLB 3KUCB 3WALA 2K1FA 3SU8X 4KDIC 1TBEA 4GDLA 3DVNV 2FCQA 1GC7A 4FHJA 2BPSA 2K25A 1U4AA 4M8MA 2MP2A 4MGZE 3NZSA 4RM9A 4WJOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KX0 A;  2C60 A;  1J8C A;  1WM2 A;  4P7I A;  4HCP B;  1P3Q U;  2UYZ B;  1LQB A;  4JGH B;  4IW0 A;  5BO4 B;  2DZI A;  2DHZ A;  3O65 B;  3QQ8 B;  4HPM B;  3R7Q A;  3ZIM A;  2MX2 A;  2ZCC A;  2KDI A;  2WX1 A;  5D7G A;  3QJZ A;  4KZC A;  2DAJ A;  2EKE C;  4BBN C;  3EC8 A;  4I6L B;  3A9J B;  4AOF A;  4W9G A;  1V5T A;  2JY6 A;  2BWE S;  4K81 A;  3B08 A;  2K6D B;  2LWP A;  2I1J A;  4A3O A;  2MBB B;  1KJT A;  1WXM A;  4HDO A;  3AUL A;  3V61 A;  5HKH A;  2LRU A;  1WX7 A;  2RSU A;  4BFR A;  3RUI B;  1V9J A;  5DPT A;  2Y5B B;  4ZRK A;  3A9K A;  1FXT B;  3RT3 B;  2AEH A;  3VVW B;  3R3M A;  1ZW7 A;  4GDK B;  1WE6 A;  3DBH I;  4MGK E;  3DVG X;  4NJ6 A;  1I42 A;  4KDL B;  2ZNV B;  1YQB A;  4TKN A;  4B95 A;  4B9K A;  4HJK A;  1T0Y A;  2K8B A;  4KV2 A;  2K39 A;  1HE8 A;  3U30 A;  4PYZ A;  2B3A A;  5LLI A;  3SHQ A;  2JRH A;  5DCN A;  5JZE B;  3JSV B;  2MBE A;  3IBE A;  2M8S A;  3TL5 A;  1NBF C;  4NAW B;  1WXV A;  3H7P B;  1LM8 B;  3KUZ A;  3PVL A;  3VUX A;  4AJY B;  1OTR B;  1V6E A;  3ZNI D;  3VXW A;  2LD9 A;  3UGB B;  4HCN B;  4B6W A;  2KQS A;  4W9E A;  1CMX B;  1OEY J;  5CX3 A;  3ZNG C;  4K7W A;  2RR9 A;  1H4R A;  2KJR A;  3SDL C;  2REX A;  4W9D A;  5D6J B;  2LJ5 A;  3QIJ A;  1E90 A;  3DBL I;  1S3S G;  4GDK A;  1P1A A;  2GBN A;  5C23 A;  3DDC B;  5CTR C;  3VTW A;  2CKH B;  3ZNH B;  4ANU A;  4ANV A;  3GOE A;  4DHZ E;  1E8Y A;  1WX8 A;  2MRP A;  1E7U A;  1TZ1 A;  2KWV B;  2N9X A;  3RD2 A;  1S1Q B;  3K9P B;  2KDE B;  3KYC D;  4LJO B;  1UEL A;  4EZK A;  3M63 B;  4AUQ C;  4ZYN A;  2CU1 A;  2NBW B;  4IWQ A;  4KIK B;  4FJY A;  3UF8 A;  2VRR B;  4HWI B;  2C7M B;  2CR5 A;  4W9K A;  3WAO A;  3KUD B;  3QCA A;  1SIF A;  1C3T A;  3UQA A;  2KNB A;  2KAN A;  3KVF B;  3PGE A;  4EFO A;  4DDI D;  3DBS A;  2ASQ A;  1WRD B;  3ZVV A;  3L08 A;  1IYF A;  2Z0E B;  4I6P A;  3EFU A;  3WAM A;  4NQK E;  1IPG A;  2GMI C;  1SGH A;  4II3 B;  3LDZ E;  3NHE B;  4WQO B;  3AXC A;  3ZUN A;  2K8H A;  4TQ1 A;  2MW5 A;  4ZRI A;  3RUL A;  3PLU A;  4E74 A;  2IZV B;  3NZU A;  3DOW A;  1PQS A;  2FCM A;  4RMA A;  3MJW A;  3IHP C;  2FCN A;  1WGD A;  1NI2 A;  3UIO B;  4LCD E;  1KLV A;  3CF6 E;  2LGY A;  4EKU A;  2AWT A;  2D2Q A;  2RPQ A;  3PS6 A;  4KIK A;  3I3T B;  1WJ6 A;  1WR1 A;  2IO3 B;  3W1S A;  1GC6 A;  2BYE A;  1L2N A;  3PSE B;  2HD5 B;  1RAX A;  2JT4 B;  2LRW A;  3DVN U;  1OGW A;  2PE9 A;  1Q1O A;  2BWF A;  2JVC A;  1J0G A;  5J18 A;  4TV3 A;  4M8N A;  5IAA C;  4WJN A;  2KFK B;  5JH5 C;  2IBI B;  2KO3 A;  2BKR B;  3PRE A;  3PZD A;  4EZL A;  3EHV A;  4MSM B;  4URK A;  2ZVN A;  2IY0 B;  3BY4 B;  4GOC A;  2M17 A;  2J7Q B;  2N4F A;  5L83 A;  2KX3 A;  2NR2 A;  2MSE D;  5D94 A;  3CSF A;  2KXJ A;  2HJ8 A;  4F1S A;  3QK0 A;  3IFW B;  2ZCB A;  3AU4 A;  4MGY E;  4KVG B;  4E71 A;  3IVF A;  4ICV A;  4GSW A;  3TBL D;  1Q5W B;  2C7H A;  3PRP B;  2JF5 A;  3Q3F A;  4JL9 A;  4M0W B;  4DK5 A;  2C5L C;  2D07 B;  1RRB A;  2L0F A;  3OJ3 A;  2KZR A;  2GBK A;  4W9I A;  3KW5 B;  3GZN I;  2KKC A;  3TJP A;  2N7D A;  3DQV A;  2Z59 B;  3A1Q B;  2L76 A;  2DX5 B;  2MQJ A;  4PYU A;  2O2V A;  1YD8 U;  3APD A;  1WJU A;  3H6N A;  4G11 A;  2J0J A;  3S2A A;  1A5R A;  2XK5 B;  4J6I A;  1V49 A;  5FR6 A;  2MWS B;  1IP9 A;  2LUE A;  2WDT B;  3ALB A;  3VFK A;  1EUV B;  1EO6 A;  1EF1 A;  4MJS B;  4FJZ A;  3RCZ A;  2KD0 A;  2BYV E;  2PJH A;  2ZPY A;  3UIP B;  3HHM A;  2NCN A;  1E8Z A;  4IUM B;  2DYB A;  3QA8 A;  1WJN A;  4DHJ B;  4WWN A;  1WGY A;  2C7N B;  4NY0 A;  3A9J A;  2L05 A;  5EDS A;  1EF5 A;  1VCB A;  1XD3 B;  3A1Q A;  1WE7 A;  4FAD A;  2GBJ A;  2QHO A;  3HK0 A;  4CO7 A;  3C0R B;  2O6V B;  2KVR A;  1V81 A;  1F9J A;  1GNU A;  2LXC A;  3BIN A;  2DYO A;  2IYD B;  2L00 B;  2MBH A;  3A4R A;  3L13 A;  2DZJ A;  2NBV B;  3B1L X;  3LJ3 A;  2J0M A;  3APC A;  4F8C B;  1GJZ A;  2V1Y A;  4MEL A;  4HLE A;  3RZF A;  2R2O A;  4EZJ A;  3V6C B;  2ZZP B;  3VAW A;  5C1Z A;  3VUW A;  2DZM A;  2AYO B;  4II2 B;  3VHT C;  2BGF A;  4W9L A;  1WGH A;  3DPD A;  3KYD D;  4NNJ B;  2A5U A;  1AAR A;  2LZ6 A;  3QC8 B;  2MBO A;  1UH6 A;  3X0W A;  3ZW3 A;  1WH3 A;  3JSV A;  3ZO5 B;  1E5W A;  4BVU C;  2KJH B;  2HTH A;  4KSK C;  4NAW A;  4OVV A;  5DPR A;  3H7P A;  3OLM D;  2NVU I;  3T9L A;  3DCG A;  2N1V A;  3IG3 A;  2XBB C;  2O6V A;  1WI0 A;  2KOX A;  4FBJ B;  5JHA A;  2KTR B;  3R7R A;  2ZJD A;  3ML8 A;  3CMM B;  5G55 A;  3A33 B;  4GXB A;  3PT2 B;  5AEK B;  1K8R B;  1XT9 B;  5L95 C;  1E7V A;  4TUU A;  4FA6 A;  3HM6 X;  3V62 A;  3ECI A;  2UWQ A;  3DVG Y;  2KC2 A;  2KDB A;  4XX5 A;  1UBI A;  4ASW C;  3PTF C;  4G0N B;  1YX6 B;  2JRI B;  5G2N A;  1J19 A;  3A4S C;  4LDT B;  5E6N A;  4NPN A;  5KHO A;  2KWC A;  2KMC A;  3W1S C;  2N9P C;  3AU5 A;  4G50 A;  4TQ0 A;  3Q3J A;  5AZF A;  3ZDM C;  3ZLZ A;  3VQI A;  4MEM A;  1WM3 A;  3TCA A;  2GBR A;  1UBQ A;  3ONS A;  1WMH B;  1GG3 A;  2L0T A;  4LJP B;  4HVB A;  1WFY A;  2PE6 B;  4F7Z A;  3VH4 B;  4G3X B;  2IO1 B;  2ZEQ A;  4WJP A;  1C1Y B;  2L8J A;  5E6O A;  3V6E B;  3L54 A;  1V2Y A;  2MP2 B;  2LVQ A;  3ZNZ B;  1ISN A;  1P98 A;  1H8C A;  3TIX A;  3WIM A;  3WAP A;  5CHV C;  4DDG D;  4DWF A;  2BYF A;  1VD2 A;  4MH0 E;  3QAR A;  3N30 A;  2KWU B;  4W9F A;  2V4L A;  2N7E A;  2G4S A;  4IM3 A;  3QWZ B;  1Z2M A;  2KFJ A;  3R66 C;  4IWP A;  1ZGU B;  5JHB A;  1TTN A;  2N1W A;  4WWO A;  4JIO U;  2M4N A;  3VH3 B;  4YL8 A;  2K6Q A;  3X23 A;  2RD0 A;  2CS4 A;  3N3K B;  4PS3 A;  3RZW C;  1WF9 A;  4WJQ A;  2LXA A;  4MM3 A;  4IM2 A;  2MA9 B;  2KFK A;  4K7S A;  1WJ4 A;  3A9K B;  3VUY A;  3VTU A;  2N9E B;  3ZTD A;  2J0K A;  3L0W B;  4FN2 A;  2W9N A;  2DAF A;  5KHQ A;  2G45 B;  1UD7 A;  2M0X A;  3NS8 A;  3P2B A;  5DPW A;  5E6P A;  2LAS A;  5IA7 A;  1MG8 A;  3TMP B;  1JRU A;  2EMT A;  1R4N I;  2JZZ A;  2YVC A;  4BKT A;  4BBN F;  5DPS A;  1WGG A;  2GOW A;  2LI5 A;  1P0R A;  3D32 A;  3ZRC A;  3AI5 A;  5D2M B;  2NBU A;  1WGR A;  2KQ7 A;  2Z0D B;  3ENE A;  4GIV A;  2PPH A;  3RYT A;  2HE7 A;  1WX9 A;  4BOS C;  2V3S A;  3H7S A;  4WWP A;  2L7R A;  2NS5 A;  2XEW A;  1LFD A;  4KSL C;  2G4D B;  4DBG A;  4EOY A;  3M3J A;  2KC1 A;  3W1Y A;  4ANW A;  3DBR I;  1YX5 B;  1L7Y A;  1WY8 A;  5CHF A;  2BF8 B;  4MDK E;  4ICU A;  5J2R A;  1WIA A;  4DHZ B;  3L10 B;  1WR6 E;  4GB9 A;  5LXI B;  2LVP A;  3OAW A;  2AL6 A;  2LGX A;  3L17 A;  3PLV A;  2D10 A;  2IY1 B;  5AZH A;  4CHK A;  2DYM A;  2ZVO A;  3U8Z A;  1WZ0 A;  4ANX A;  3ZKJ C;  2M1M A;  4FUL A;  2XK5 A;  2A4Z A;  2MBQ A;  1ZKH A;  2FID A;  2ZNV C;  2NPT B;  3N32 A;  4MSQ B;  1SE9 A;  4X57 B;  4ZRJ A;  3PV1 A;  1V86 A;  2BKF A;  4BKG A;  1Y8R C;  1Z5S B;  3M95 A;  4MJS A;  1X1M A;  3PHW B;  2R2Q A;  3ZRF A;  3HIZ A;  4WAA A;  3NOB A;  4PS7 A;  4IG7 B;  1E8W A;  4JQW C;  2JPH A;  3WAN A;  3PRM B;  4E3C A;  4EUT A;  1TGZ B;  2KLC A;  4DHJ D;  1D3Z A;  4IM0 A;  3ZDT A;  3MHS D;  3V60 A;  4IC7 B;  4EEW A;  4GN1 A;  2MCN B;  2FUH B;  4JLC A;  2O6V D;  1RFA A;  2KDF B;  3QAQ A;  4K7U A;  2D11 A;  3SD5 A;  1YJ1 A;  2JUO A;  1KOT A;  4BOZ B;  3MTN B;  4HDQ A;  5J17 A;  4OVU A;  3K9O B;  3ML9 A;  3EEC A;  2WWZ A;  2KTF A;  2DEN B;  2OJR A;  2K8C A;  1WYW B;  2NPT A;  3UQB A;  1GUA B;  3KH0 A;  2WX0 A;  4GU2 A;  1UGM A;  3UIN B;  4NJ7 A;  4NQL B;  3QHT A;  3VDZ A;  1LXD A;  3H1U A;  1UZX B;  2AL3 A;  2C9W B;  4IWO A;  1XQQ A;  2JXX A;  2JZ3 B;  1NDD A;  4K1R B;  2FIF A;  1RLF A;  2G3Q B;  1V5O A;  1OQY A;  3B0A A;  3JVZ X;  3PRZ A;  3QX1 A;  4I6N B;  4W9C A;  3VTV A;  4AWJ A;  2KLG A;  4HXD A;  4W9H A;  1G6J A;  4HK2 A;  3JW0 X;  4N9F 4;  1I35 A;  3CST A;  1WXA A;  2FCS A;  2MLB A;  1KM7 A;  2KN5 A;  4PS8 A;  4RM8 A;  3JYU A;  2IO2 B;  2KK8 A;  5GMV A;  4A20 A;  2JWZ A;  4FJV B;  2KTR A;  4GDL B;  1BT0 A;  3T8M A;  2L3Z A;  4MGI E;  2D3G A;  1R4M I;  2KMA A;  2PEA A;  1Q0W B;  1YIW A;  4GMV A;  4XC2 A;  1P9D U;  3ZTC A;  3APF A;  2WYQ A;  4FLH A;  4A3P A;  2EMS A;  4GGQ A;  4DXA B;  3U7D A;  3WA0 A;  4CYE A;  5LXH A;  3L16 A;  4FHK A;  1M94 A;  3PHX B;  3PPA A;  4AJW A;  2OOB B;  2FAZ A;  3OJ4 B;  4XZ4 A;  4ZDV A;  4LDT D;  3H9D A;  2CHW A;  1WXS A;  2CHZ A;  2GBM A;  2IO0 B;  2KJ6 A;  2ZPN A;  4KZ0 A;  2FNJ B;  5CHW A;  3M62 B;  4BKS D;  1WZ3 A;  3NY5 A;  5TR5 A;  4BKS A;  2DZK A;  2LVO A;  1E8X A;  1OEY A;  3HM3 A;  2KHW B;  2I1K A;  2LGD A;  4AP4 C;  2YLM A;  4W9J A;  2O2V B;  1V80 A;  5AZG A;  1QZE A;  1WMH A;  2RGF A;  2CHX A;  4HPL B;  3KUC B;  3WAL A;  2K1F A;  3SU8 X;  4KDI C;  1TBE A;  4GDL A;  3DVN V;  2FCQ A;  1GC7 A;  4FHJ A;  2BPS A;  2K25 A;  1U4A A;  4M8M A;  2MP2 A;  4MGZ E;  3NZS A;  4RM9 A;  4WJO A; 
#chains in the Genus database with same CATH topology
 1JWA D;  1CJE A;  2UYZ B;  1LQB A;  4IW0 A;  5BO4 B;  2DZI A;  2WDQ B;  4HPM B;  3ZIM A;  4LNK A;  3AE9 B;  2JY6 A;  3B08 A;  2I1J A;  1WXM A;  5HKH A;  3RUI B;  5DPT A;  4UDU C;  4US8 A;  2AEH A;  3AM9 A;  1FPY A;  4USA A;  4TKN A;  1IBX A;  5BMI A;  1T0Y A;  2K8B A;  3MC0 B;  1FM0 D;  1FXA A;  3U30 A;  5LLI A;  5G5G A;  5JZE B;  2MBE A;  1NBF C;  3PVL A;  1AW7 A;  1OTR B;  1V6E A;  1WXQ A;  4WAF A;  1OEY J;  4K7W A;  2N0S B;  5BMG A;  5D6J B;  3V3X A;  3DBL I;  4GDK A;  5C23 A;  3DDC B;  3ZNH B;  1E8Y A;  2MRP A;  2KWV B;  4K3C A;  2R61 A;  2HTM E;  4EZK A;  4AUQ C;  4KIK B;  4HWI B;  5BYR A;  1TS4 A;  1IYF A;  2IGH A;  2BB5 A;  3WAM A;  4ZYS A;  1FRD A;  1SGH A;  4II3 B;  4WQO B;  2K8H A;  2JYE A;  2MW5 A;  3O13 A;  3PLU A;  2IZV B;  2W55 A;  3W5U B;  1PQS A;  2FCM A;  4KKI A;  3IHP C;  1PUT A;  2KMM A;  1NI2 A;  4LCD E;  1KLV A;  1ZDX A;  3PS6 A;  3I3T B;  1WR1 A;  2BYE A;  3PSE B;  4TSS A;  2LRW A;  3DVN U;  1Q1O A;  2BWF A;  3ZXV A;  4IOI E;  5J18 A;  1MI0 A;  5JH5 C;  3PRE A;  3E9S A;  3AE6 B;  1HZ5 A;  3RNG C;  4MSM B;  1L6V A;  5EE0 A;  2IY0 B;  3RNE C;  4O1N A;  3MC8 A;  2NR2 A;  3E56 A;  2MSE D;  3PZ7 A;  3CSF A;  2KXJ A;  2ZCB A;  4MGY E;  4KVG B;  2TSS A;  4E71 A;  3IVF A;  3TBL D;  2KZR A;  1KH0 A;  2SAK A;  2DBY A;  1EU4 A;  3KW5 B;  1FIQ A;  3TJP A;  1TYG B;  2EKI A;  1OFF A;  4MT5 A;  3APD A;  1I4P A;  1EWC A;  2HJ1 A;  4G11 A;  3AE3 B;  4RGO S;  1T0R C;  2VZK D;  2NTT A;  3VFK A;  3WCQ A;  2KAJ A;  1EO6 A;  2KD0 A;  2PJH A;  2ZPY A;  3ZJT A;  1E8Z A;  1QOA A;  4US9 A;  3QA8 A;  4WWN A;  1WGY A;  5EDS A;  1T6B X;  2H89 B;  3LYY A;  1NYR A;  4FAD A;  2QHO A;  3C0R B;  4MAC A;  3AE8 B;  1KLG D;  3I63 C;  3BIN A;  4WUR A;  3OWE B;  1DOX A;  3L13 A;  4LNN A;  2J0M A;  3C19 A;  3TSS A;  2V1Y A;  4MEL A;  2K3U A;  2R2O A;  1WSP A;  4HKZ E;  3KWV A;  4II2 B;  3AEG B;  4W9L A;  2QSD A;  2LZ6 A;  2N7J A;  3QC8 B;  2MBO A;  1UH6 A;  4P6V F;  3X0W A;  3ZW3 A;  2PVG C;  2HTH A;  1SF0 A;  3H7P A;  2NVU I;  2E3T A;  1RYJ A;  2O6V A;  1VZ8 A;  4DXF A;  3GP7 A;  1CQV A;  4GXB A;  4RGN A;  4XYC A;  3HM6 X;  3V62 A;  2UWQ A;  2NTS A;  3Q6B A;  1YNT E;  1YX6 B;  3AH7 A;  4RGM A;  2OHF A;  2JRI B;  1J19 A;  1F2R I;  2WXO A;  3ZJV A;  2KMC A;  3W1S C;  3ZDM C;  3VQI A;  3TCA A;  1UBQ A;  4LJP B;  4HVB A;  1STE A;  3I57 A;  5E6O A;  3L54 A;  4ZRQ A;  1ISN A;  1UWX A;  3TIX A;  1HXY D;  4DDG D;  3AEA B;  2D3A A;  1QQR A;  1D5Z C;  1AYF A;  1ZGU B;  5JHB A;  4ZHP A;  3KQ4 A;  2K6Q A;  2RD0 A;  1TIF A;  2CS4 A;  4PS3 A;  1RFK A;  4WJQ A;  2LXA A;  1GOZ A;  3EFC A;  2KFK A;  3VUY A;  4RFB A;  4L2Y A;  2M0X A;  3L4P A;  3NS8 A;  3P2B A;  4XE0 A;  1IUE A;  4S0R A;  1TZO A;  2EMT A;  1R4N I;  2YVC A;  2BT6 A;  3GE8 C;  3ENE A;  2EEL A;  1GAQ B;  4WWP A;  1ZE3 D;  4KSL C;  2G4D B;  1DOI A;  5GXG B;  1I4G A;  4DBG A;  4EOY A;  4RF1 A;  1KTK A;  2BF8 B;  4TMA B;  1L0Y B;  3PO0 A;  3L10 B;  4GB9 A;  5LXI B;  2LVP A;  4LK0 M;  3Q3O C;  3U8Z A;  3I5J C;  3IAS 1;  1L0V B;  4HEA 1;  2A4Z A;  1CZP A;  2ZNV C;  1VR9 A;  3N32 A;  1JML A;  1V86 A;  2RPV A;  3DBH B;  4C7Z A;  1X1M A;  3PHW B;  3Q8E A;  1E8W A;  3WAN A;  3PRM B;  4EUT A;  4DHJ D;  4IM0 A;  1XLQ A;  3FAH A;  2WXM A;  2MCN B;  4YSY B;  4MH8 A;  1VZ6 A;  4K7U A;  2KAC A;  3SD5 A;  3W5V B;  1YJ1 A;  1N60 A;  4BOZ B;  3RPF C;  1K53 A;  3ML9 A;  2KTF A;  2J52 A;  2NPT A;  2K5P A;  3UQB A;  2BQQ A;  2JQR B;  1GB4 A;  3SFD B;  2WX0 A;  4YTM B;  5BMH A;  1UGM A;  4YSX B;  4NQL B;  3QHT A;  3H1U A;  4D2K A;  3MFG A;  4I6N B;  1OQY A;  3QX1 A;  4W9C A;  4M01 A;  3CST A;  1L0X B;  2BW2 A;  4HPP A;  2WXK A;  3VR8 B;  5IO9 A;  1ZXI A;  1VZ7 A;  2PMV A;  2IO2 B;  4A20 A;  4FJV B;  2KTR A;  3P4S B;  1BT0 A;  4KGR A;  4ZOH C;  1JQ4 A;  1Q0W B;  4M02 A;  2LFI A;  2EMS A;  4CYE A;  3P63 A;  1QIL A;  4AJW A;  2OOB B;  2FE8 A;  3HVD A;  3RFZ B;  2GBM A;  1EWY C;  2KJ6 A;  1E9M A;  4BKS D;  4BKS A;  1NVI D;  5EE1 A;  3HM3 A;  4Q2J A;  4W9J A;  1V80 A;  2RGF A;  3WAL A;  2K1F A;  3GB1 A;  4GDL A;  5HG2 A;  2MP2 A;  3NZS A;  2XNA C;  1WM2 A;  4P7I A;  3BYT B;  4WWM A;  4JGH B;  2SEB D;  5G5H A;  2ZW0 A;  1D5M C;  2HDE A;  3R7Q A;  4C4V B;  2MX2 A;  2ZCC A;  3Q8B A;  3QJZ A;  2EKE C;  4XGA B;  1FNU A;  3A9J B;  2BWE S;  2LWP A;  4OZB A;  1KJT A;  2N9K A;  2VH2 A;  3GZN B;  2Y5B B;  3MJ5 A;  3AED B;  1WE6 A;  1N5X A;  4KDL B;  1Q10 A;  2ZNV B;  3BWU D;  1HE8 A;  3AEC B;  2PKO A;  1ZUD 2;  3W2D A;  3AB5 A;  3JSV B;  4NAW B;  1WXV A;  3KUZ A;  2MHJ A;  1YQ3 B;  4ZRP A;  3ZNI D;  3ZJU A;  3RN9 C;  3ZNG C;  3U52 E;  1H4R A;  2KJR A;  3AE2 B;  2ACZ B;  3R2T A;  3VTW A;  2CKH B;  1FCC C;  3GOE A;  4DHZ E;  1JWU D;  1S1Q B;  4ITK A;  2KDE B;  4LJO B;  1UEL A;  3M63 B;  4ZYN A;  1ZOY B;  2NBW B;  4JWS C;  2VRR B;  4YXD B;  3UQA A;  1XO3 A;  2KNB A;  4OVZ A;  5AUK A;  3KVF B;  3PGE A;  1B9R A;  3ZVV A;  3L08 A;  1IPG A;  3NHE B;  3ZGZ A;  4TQ1 A;  1ACC A;  1BML C;  1V1O A;  4LTU A;  2LMC A;  1JCK B;  1YOV B;  2LGY A;  2AWT A;  2D2Q A;  4KIK A;  4AS1 A;  1WJ6 A;  1T5X D;  2IO3 B;  1GC6 A;  3AE4 B;  1L2N A;  3B9J A;  2HD5 B;  2JVC A;  1J7C A;  1N61 A;  1C79 A;  3NJT A;  1FFV A;  2BKR B;  2I2Y A;  1FMA D;  4URK A;  3BY4 B;  4NZL B;  2KX3 A;  3P4R B;  2HJ8 A;  2WHI A;  3QK0 A;  4P16 A;  1D4B A;  4GSW A;  2PTL A;  2JF5 A;  4JL9 A;  1LO5 D;  4DK5 A;  3OJ3 A;  3I9V 1;  4JWU C;  2KKC A;  2AQ1 B;  3A1Q B;  1UGJ A;  2GRI A;  2J0J A;  1A5R A;  2XK5 B;  4J6I A;  3FIL A;  4A55 A;  5FR6 A;  1TKE A;  2LUE A;  3ALB A;  3T3N A;  2INN E;  4MJS B;  1UWM A;  2DLB A;  3HRD D;  2NCN A;  4IUM B;  2DYB A;  1TS2 A;  2JYT A;  2B76 B;  4NY0 A;  2L05 A;  1EF5 A;  1VCB A;  3DHI C;  3HK0 A;  4CO7 A;  2KVR A;  1V81 A;  4J3O D;  1F9J A;  1GNU A;  2LXC A;  2DYO A;  2MBH A;  3AV8 A;  2K0P A;  3A4R A;  3BK2 A;  2DZJ A;  3B1L X;  4C56 C;  4HLE A;  3RZF A;  3VAW A;  1QF6 A;  2AYO B;  3T3O A;  3VHT C;  2WP9 B;  4NNJ B;  5IOI A;  5JXV A;  2PW9 A;  4BZA A;  4YTP B;  1E5W A;  1YJI A;  3OLM D;  3T9L A;  3DCG A;  2XBB C;  3TEY A;  2KOX A;  1VRA B;  3CMM B;  3A33 B;  1XLP A;  5AEK B;  4TUU A;  2KC2 A;  1PDX A;  1UBI A;  3VRB B;  1E10 A;  5G2N A;  2FBW B;  3A4S C;  5EE3 A;  4LDT B;  3Q8F A;  5KHO A;  2DWQ A;  2KWC A;  1SXT A;  4G50 A;  3Q3J A;  2K9X A;  4RNA A;  2GBR A;  1A70 A;  1C77 A;  2L0T A;  3V05 A;  1JWS D;  4OZC A;  2WXQ A;  4G3X B;  5HHD G;  1V2Y A;  1VJK A;  3ZNZ B;  2BTE A;  1I4R A;  1PGX A;  3WIM A;  1VD2 A;  4ARC A;  4XWT A;  4W9F A;  3NVZ A;  2N7E A;  1R7S A;  4NJC A;  1R4M B;  2G4S A;  1PYW D;  4OW0 A;  1TKG A;  1TTN A;  1YN4 A;  4WWO A;  4JIO U;  2M4N A;  2JZP A;  3N3K B;  2I38 A;  3Q3M C;  2BS3 B;  1NEN B;  2WXL A;  4MM3 A;  4K7S A;  4YT0 B;  1WJ4 A;  2N9E B;  2ONQ A;  4FN2 A;  2W9N A;  2DAF A;  5KHQ A;  2G45 B;  5DPW A;  5IA7 A;  1MG8 A;  3TMP B;  1JRU A;  2KQ4 X;  4BBN F;  2J53 A;  3ZRC A;  5D2M B;  1WGR A;  5HI1 A;  2KQ7 A;  2Z0D B;  4LLG M;  3AE5 B;  1E7P B;  3U4E G;  2L7R A;  2XEW A;  1LFD A;  2V9H A;  4BAX A;  1YX5 B;  1HTO A;  2KWD A;  1WIA A;  2X38 A;  2ON8 A;  3VR9 B;  3OAW A;  2AL6 A;  2LGX A;  2D10 A;  2IY1 B;  2D5G A;  4K3B A;  1F77 A;  1WRI A;  3ZKJ C;  2MBQ A;  1FNV A;  1Y56 A;  4XDD A;  1SB3 C;  1Y8R C;  2R2Q A;  5C3J B;  1T0S C;  2KLC A;  3MHS D;  4IC7 B;  3P1M A;  2QIL A;  2FUH B;  2O6V D;  2D11 A;  2JUO A;  1KOT A;  2QDF A;  2OED A;  4HDQ A;  2H88 B;  2QC8 A;  3EEC A;  5T8I A;  3MP9 A;  2OJR A;  2M19 A;  4GU2 A;  4NAM A;  3UIN B;  4NJ7 A;  3RNA C;  3VDZ A;  1SJE D;  1LXD A;  5H92 C;  2C9W B;  1XQQ A;  3AE1 B;  1OQQ A;  1F0Z A;  1NDD A;  2Y3A A;  3PRZ A;  2FIF A;  1RLF A;  1V5O A;  3B0A A;  4K1R B;  5D94 A;  1I42 A;  4AWJ A;  1V97 A;  2L1A A;  3DHG C;  4HXD A;  4W9H A;  1I4X A;  1I35 A;  2BB6 A;  2CJO A;  2MLB A;  1JAL A;  3RI7 C;  1LGR A;  5FKA C;  2D3G A;  3Q8C A;  1V1P A;  3ZTC A;  2WYQ A;  4FLH A;  4A3P A;  3L16 A;  3OJ4 B;  4XZ4 A;  2V0G A;  2CHW A;  1XEE A;  2FNJ B;  2DNF A;  2IND C;  3GE3 C;  5TR5 A;  1P7E A;  2LGD A;  1QOG A;  1ROE A;  1WMH A;  2BS2 B;  2CHX A;  2FCQ A;  1GC7 A;  1U4A A;  1ENF A;  2M0A A;  2WS3 B;  2VZK B;  2WU2 B;  1FRR A;  3ZXR A;  4RGT A;  2C60 A;  4HCP B;  1P3Q U;  2DHZ A;  3O65 B;  3QQ8 B;  1XCQ L;  2WX1 A;  4KZC A;  2DAJ A;  4I6L B;  4AOF A;  1TJE A;  4W9G A;  1V5T A;  1MHH E;  1YN5 A;  4K81 A;  2LHE A;  2K6D B;  2KT7 A;  2MBB B;  4HDO A;  3V61 A;  2RSU A;  4BFR A;  3A9K A;  1FXT B;  3VVW B;  4KGT A;  3DBH I;  3N1Y C;  1XLO A;  4B95 A;  2QCZ A;  1YQB A;  4KV2 A;  2K39 A;  4PYZ A;  1XCT L;  2B3A A;  3MC9 A;  2X8X X;  1T3Q A;  2CJN A;  3IBE A;  2M8S A;  3NVV A;  2WXG A;  3EA6 A;  1KF6 B;  3H7P B;  1LM8 B;  3VUX A;  4R3D A;  1J7B A;  3VXW A;  2LD9 A;  3UGB B;  4B6W A;  2KQS A;  1CMX B;  5CX3 A;  4W9D A;  1N63 A;  3IT6 B;  1E90 A;  4B0M A;  3U7Z A;  1P1A A;  2GBN A;  2FUG 1;  4ANU A;  1E7U A;  2N9X A;  3P42 A;  2LUM A;  1HZ6 A;  5IN7 A;  1QOB A;  1YN3 A;  5FK9 C;  3FKY A;  4FJY A;  2C7M B;  2CR5 A;  3WAO A;  3ETR A;  4N59 A;  4L23 A;  3QCA A;  1SIF A;  3J9C A;  1VLB A;  2KAN A;  1RM6 C;  4DDI D;  3DBS A;  2ASQ A;  1K50 A;  1TY2 A;  3DWM A;  2Z0E B;  4NQK E;  4FXC A;  3ZUN A;  2MJE A;  4E74 A;  3DOW A;  1T0Q C;  5C2T B;  1FNW A;  2FCN A;  1WGD A;  4C00 A;  1C4A A;  4EKU A;  2RPQ A;  4JPS A;  1SEB D;  2WXF A;  3DHH C;  1C78 A;  2JT4 B;  2PE9 A;  3VRA B;  3N20 C;  4TV3 A;  2JXT A;  1ET9 A;  4M8N A;  4WJN A;  1WGK A;  1E0Z A;  2KFK B;  1IGC A;  2IBI B;  4WH4 A;  2WDV B;  3N9Y C;  1E6E B;  2ICI A;  2ZVN A;  5I4D A;  4GOC A;  2M17 A;  1ZXH A;  2N4F A;  4LNI A;  5L83 A;  2AX5 A;  4YTN B;  4F1S A;  3AU4 A;  3NRZ A;  2V4I B;  1Q5W B;  2C7H A;  4M0W B;  1RRB A;  2L0F A;  2N9L A;  4W9I A;  3GZN I;  1SE2 A;  3DQV A;  2KN4 A;  2DX5 B;  3FC4 A;  2O2V A;  2L52 A;  1WJU A;  3H6N A;  3NZ3 A;  1N5W A;  2IJ0 A;  3DWG C;  2RDH A;  1V49 A;  2BYT A;  2MWS B;  1HQR D;  1OQR A;  1QKZ A;  5H8Y E;  1EUV B;  1EF1 A;  3RCZ A;  4FJZ A;  2BYV E;  2Y5P A;  3HUI A;  2YEP F;  4RF0 A;  4DHJ B;  2C7N B;  3A1Q A;  1WE7 A;  1D6E C;  1MPE A;  2GBJ A;  1J7A A;  2QIE B;  1MHX A;  2QEJ C;  3DBR B;  2VH1 A;  2L00 B;  3B2G A;  3RNC C;  3LJ3 A;  2QJL A;  2ZZP B;  3VUW A;  2DZM A;  4PK1 A;  3KYD D;  3NG0 A;  2A5U A;  1AAR A;  3IXS A;  1MG4 A;  2GLS A;  1WH3 A;  2KJH B;  5DPR A;  1C76 A;  2N1V A;  1WI0 A;  4FBJ B;  2KTR B;  3R7R A;  2ZJD A;  3ML8 A;  4ARI A;  3CWI A;  5G55 A;  3PT2 B;  2J42 A;  4FA6 A;  1KFY B;  3ECI A;  2JX5 A;  2KDB A;  4XX5 A;  1N62 A;  1P7F A;  3N1X C;  2GI9 A;  4P1B C;  4IKG A;  5AZF A;  3BII D;  3ZLZ A;  2PIA A;  3R8B A;  1UNS A;  3ONS A;  1GG3 A;  2PE6 B;  1C9F A;  1M4V A;  2IO1 B;  2ZEQ A;  4WJP A;  1C1Y B;  2L8J A;  3V6E B;  2MP2 B;  3W9C B;  3ZQ4 A;  1JWM D;  3WAP A;  4HRO A;  3AEE B;  2KWU B;  4A9A A;  3RMK C;  4IM3 A;  3R66 C;  4IWP A;  3IT4 B;  4YL8 A;  3BVM A;  1WWT A;  3RZW C;  3SFE B;  2IGD A;  1ESF A;  3NS1 A;  1WF9 A;  1F1H A;  1K52 A;  2MA9 B;  2BS4 B;  3Q2A C;  2IDY A;  1AN8 A;  1SBB B;  2WLB A;  2L83 A;  2AQ2 B;  5E6P A;  4WIP A;  4BKT A;  1UUP A;  4HJG E;  1WGG A;  2LI5 A;  1P0R A;  3D32 A;  2NBU A;  1FO4 A;  4GIV A;  2PPH A;  3AEB B;  3RYT A;  3UI3 A;  1WX9 A;  2V3S A;  3H7S A;  2WU5 B;  1QLB B;  2K22 A;  4DXG A;  2YEP B;  4C7Y A;  3TEZ A;  4ANW A;  3URY A;  2JWU A;  5CHF A;  1HTQ A;  1FEH A;  3L17 A;  3PLV A;  4AQ7 A;  4FUL A;  4RCO A;  2MEK A;  2FID A;  4MSQ B;  4XWW A;  3PV1 A;  1TY0 A;  3M95 A;  1MVK A;  2WGS A;  1QOF A;  3N1Z C;  3HIZ A;  3NOB A;  4PS7 A;  1UF0 A;  2JPH A;  4E3C A;  3IAM 1;  3ZDT A;  3V60 A;  4EEW A;  2PVO D;  4WQM A;  4JLC A;  3OG5 A;  1RFA A;  2KDF B;  4HRS A;  4OVU A;  2WWZ A;  4KKJ A;  2K8C A;  2D3B A;  1TT5 B;  3DBL B;  1FFU A;  2MJD A;  1UZX B;  1I7H A;  2JXX A;  2WXI A;  3BZD B;  2G3Q B;  3VTV A;  2LJI A;  4B0E A;  1G6J A;  4C80 A;  1WXA A;  1JWB D;  4EE2 A;  2KN5 A;  3JYU A;  1QT9 A;  2JWZ A;  1SSN A;  3T8M A;  4MGI E;  1R4M I;  4GMV A;  1YIW A;  4XC2 A;  3APF A;  4DXA B;  4GGQ A;  1TS3 A;  3WA0 A;  4FHK A;  4N58 A;  3PPA A;  2FAZ A;  4ZDV A;  4P1C C;  4LNF A;  3H9D A;  4KZ0 A;  2ZPN A;  1ZPS A;  4L1B A;  1WZ3 A;  1L4Z B;  3Q3N C;  1I4H A;  1F2R C;  1E8X A;  1OEY A;  2KHW B;  2I1K A;  4AP4 C;  4F8C B;  2YLM A;  1QZE A;  1ET6 A;  4HPL B;  3KUC B;  3SU8 X;  1BXT A;  4QAY A;  4KDI C;  1TBE A;  5IKC M;  3DVN V;  4FHJ A;  2K25 A;  2G9H D;  4MGZ E;  1F52 A;  1YJJ A;  3FIL B;  4RM9 A;  4WJO A;  2KX0 A;  1J8C A;  1IBX B;  3BYY B;  1NI3 A;  2LEK A;  1PGA A;  4N6E B;  3ABV B;  2KDI A;  2GB1 A;  5D7G A;  4BBN C;  1SJH D;  3EC8 A;  1JRO A;  4A8X C;  4A3O A;  1ZDV A;  3AUL A;  2LRU A;  2BVC A;  1ZP0 B;  1WX7 A;  2ZW1 A;  4ZHO A;  1V9J A;  4ZRK A;  3RT3 B;  3R3M A;  1ZW7 A;  4GDK B;  4NJ6 A;  4MGK E;  3DVG X;  3BVG A;  3EUB 2;  1SE3 A;  4B9K A;  4HJK A;  4YSZ B;  3SHQ A;  3P4P B;  3TEX A;  2JRH A;  4REZ A;  5DCN A;  3TL5 A;  4AJY B;  2WXH A;  2WDR B;  1SE4 A;  4HCN B;  1GB1 A;  4W9E A;  2RR9 A;  3SDL C;  2REX A;  1L4D B;  2Z8L A;  2WXR A;  2LJ5 A;  3QIJ A;  2W3S A;  3CIR B;  1S3S G;  4OZA A;  5CTR C;  4ANV A;  1CK1 A;  1WX8 A;  1TZ1 A;  2LGS A;  3RD2 A;  2XN9 C;  3K9P B;  3KYC D;  3AE7 B;  3NVW A;  2CU1 A;  3LXF A;  4IWQ A;  3UF8 A;  4W9K A;  3KUD B;  1C3T A;  1FD6 A;  3AN1 A;  4EFO A;  1V8C A;  1WRD B;  4ACF A;  2OJW A;  1BUI C;  3GS2 A;  5BYQ A;  3BVZ A;  4I6P A;  2WNM A;  3EFU A;  3SEB A;  1C4C A;  2GMI C;  3H8H A;  3LDZ E;  3AXC A;  4ZRI A;  4PT5 A;  3RUL A;  3NZU A;  1TS5 A;  4RMA A;  2INC C;  3MJW A;  2W82 A;  3PZ8 A;  4YWG G;  3UIO B;  3CF6 E;  3NUH B;  3P4Q B;  1FXI A;  3W1S A;  1NYQ A;  3AMZ A;  4HKQ A;  1RAX A;  1OGW A;  3EGR A;  2KVZ A;  1J0G A;  2AQ3 B;  4MM3 B;  5IAA C;  1GPX A;  2JSV X;  2UU7 A;  2KO3 A;  3PZD A;  5FR3 A;  4EZL A;  2KYW A;  3EHV A;  1MJD A;  5HFY A;  2J7Q B;  2BBC A;  5BYS A;  2WXJ A;  3RNF C;  5MPO A;  3IFW B;  4ICV A;  3PRP B;  3Q3F A;  2W3R A;  2C5L C;  2D07 B;  1HEZ E;  2GBK A;  2N7D A;  2Z59 B;  2L76 A;  2MQJ A;  4JX1 C;  4PYU A;  1YD8 U;  5E6J A;  2WXP A;  1L5P A;  3S2A A;  2PLP A;  4OHJ A;  1IP9 A;  2WDT B;  3AEF B;  2L32 A;  1VDV A;  4M0W A;  1R4N B;  3HHM A;  3UIP B;  4C4V A;  5AUI A;  1WJN A;  3A9J A;  4JE3 B;  1DGJ A;  1XD3 B;  2IPK D;  2O6V B;  1KLU D;  2IYD B;  2INP E;  1N6Z A;  2NBV B;  3APC A;  2KDM A;  1GJZ A;  1JRP A;  3V6C B;  4EZJ A;  5C1Z A;  4DQO C;  2BGF A;  4H2A A;  1EM7 A;  1WGH A;  3DPD A;  3B2F A;  3R2I A;  1L6U A;  1RWS A;  3JSV A;  3ZO5 B;  3TUO A;  1AWD A;  4BVU C;  4KSK C;  4NAW A;  4OVV A;  3IG3 A;  5JHA A;  1DOY A;  2QMT A;  1K8R B;  1XT9 B;  5L95 C;  1E7V A;  1V1P B;  1YQ4 B;  3DVG Y;  4ASW C;  3PTF C;  4G0N B;  2MJ3 A;  5E6N A;  4NPN A;  2LGI A;  2N9P C;  3AU5 A;  3BK1 A;  4TQ0 A;  2M56 B;  2W54 A;  3LB8 C;  4MEM A;  1WM3 A;  1WMH B;  5D3I B;  3Q69 A;  1WFY A;  2MH7 A;  4GLS C;  3VH4 B;  4F7Z A;  3C8Y A;  2LVQ A;  1TKY A;  1P98 A;  1H8C A;  1XF5 L;  5CHV C;  3TEW A;  4DWF A;  2BYF A;  4MH0 E;  3QAR A;  3N30 A;  2V4L A;  3U2S C;  3QWZ B;  1Z2M A;  3SR6 A;  2KFJ A;  3KLS X;  1JW9 D;  2N1W A;  3VH3 B;  3X23 A;  1B1Z A;  3NVY A;  5IP4 D;  1SIJ A;  3MHZ A;  4IM2 A;  4CQN A;  3A9K B;  3VTU A;  3ZTD A;  2J0K A;  3L0W B;  1D5X C;  1UD7 A;  2LAS A;  2G1E A;  2Y5C A;  2JZZ A;  4S17 A;  5DPS A;  2GOW A;  5D3D A;  1I4Q A;  2LHD A;  3AI5 A;  1HA5 A;  2V3N A;  2NMQ A;  2HE7 A;  1C4P A;  1WYG A;  4BOS C;  2NS5 A;  3RNB C;  3M3J A;  2KC1 A;  3W1Y A;  3DBR I;  1L7Y A;  1WY8 A;  5LNK 1;  4MDK E;  4ICU A;  5J2R A;  1KRH A;  4DHZ B;  1WR6 E;  2JU6 X;  5AZH A;  1IGD A;  4CHK A;  4LNO A;  2DYM A;  2ZVO A;  1WZ0 A;  1PGB A;  4ANX A;  2M1M A;  2XK5 A;  1ZKH A;  2NPT B;  4X57 B;  4ZRJ A;  1SE9 A;  1DYQ A;  3HVZ A;  2BKF A;  4BKG A;  1Z5S B;  4MJS A;  5EE9 A;  2RMM A;  2RDG A;  3ZRF A;  4WAA A;  4IG7 B;  4JQW C;  1TGZ B;  1D3Z A;  2WXN A;  4A90 A;  4KGS A;  3Q14 C;  4GN1 A;  4A6Q A;  3QAQ A;  4IDI A;  3MTN B;  1EU3 A;  5J17 A;  3K9O B;  4KX6 B;  2DEN B;  1WYW B;  1GUA B;  3KH0 A;  3Q8A A;  1K51 A;  4XDC A;  4IWO A;  2AL3 A;  2JZ3 B;  3JVZ X;  2KLG A;  1NEK B;  4HK2 A;  3JW0 X;  4RH6 A;  4N9F 4;  4M00 A;  1MFW A;  3KWL A;  2FCS A;  1XXG A;  1KM7 A;  4PS8 A;  4RM8 A;  2D3C A;  2KK8 A;  5GMV A;  1PFD A;  4GDL B;  5TSS A;  2L3Z A;  2KMA A;  2J4X A;  2PEA A;  2WQY B;  2CU3 A;  1P9D U;  2Q5W D;  5LXH A;  3U7D A;  1XLN A;  1M94 A;  3PHX B;  2V3P A;  4LDT D;  1WXS A;  2CHZ A;  2IGG A;  2IO0 B;  2E6X A;  5CHW A;  3M62 B;  3ZYY X;  3NY5 A;  2DZK A;  2LVO A;  2O2V B;  5AZG A;  4M8M A;  2BPS A;  2RDB C;  1FCL A;  1YMH E; 
#chains in the Genus database with same CATH homology
 2KX0 A;  2C60 A;  1J8C A;  1WM2 A;  4P7I A;  4HCP B;  1P3Q U;  2UYZ B;  1LQB A;  4JGH B;  4IW0 A;  5BO4 B;  2DZI A;  2DHZ A;  3O65 B;  3QQ8 B;  4HPM B;  3R7Q A;  3ZIM A;  2MX2 A;  2ZCC A;  2KDI A;  2WX1 A;  5D7G A;  3QJZ A;  4KZC A;  2DAJ A;  2EKE C;  4BBN C;  3EC8 A;  4I6L B;  3A9J B;  4AOF A;  4W9G A;  1V5T A;  2JY6 A;  2BWE S;  4K81 A;  3B08 A;  2K6D B;  2LWP A;  2I1J A;  4A3O A;  2MBB B;  1KJT A;  1WXM A;  4HDO A;  3AUL A;  3V61 A;  5HKH A;  2LRU A;  1WX7 A;  2RSU A;  4BFR A;  3RUI B;  1V9J A;  5DPT A;  2Y5B B;  4ZRK A;  3A9K A;  1FXT B;  3RT3 B;  2AEH A;  3VVW B;  3R3M A;  1ZW7 A;  4GDK B;  1WE6 A;  3DBH I;  4MGK E;  3DVG X;  4NJ6 A;  1I42 A;  4KDL B;  2ZNV B;  1YQB A;  4TKN A;  4B95 A;  4B9K A;  4HJK A;  1T0Y A;  2K8B A;  4KV2 A;  2K39 A;  1HE8 A;  3U30 A;  4PYZ A;  2B3A A;  5LLI A;  3SHQ A;  2JRH A;  5DCN A;  5JZE B;  3JSV B;  2MBE A;  3IBE A;  2M8S A;  3TL5 A;  1NBF C;  4NAW B;  1WXV A;  3H7P B;  1LM8 B;  3KUZ A;  3PVL A;  3VUX A;  4AJY B;  1OTR B;  1V6E A;  3ZNI D;  3VXW A;  2LD9 A;  3UGB B;  4HCN B;  4B6W A;  2KQS A;  4W9E A;  1CMX B;  1OEY J;  5CX3 A;  3ZNG C;  4K7W A;  2RR9 A;  1H4R A;  2KJR A;  3SDL C;  2REX A;  4W9D A;  5D6J B;  2LJ5 A;  3QIJ A;  1E90 A;  3DBL I;  1S3S G;  4GDK A;  1P1A A;  2GBN A;  5C23 A;  3DDC B;  5CTR C;  3VTW A;  2CKH B;  3ZNH B;  4ANU A;  4ANV A;  3GOE A;  4DHZ E;  1E8Y A;  1WX8 A;  2MRP A;  1E7U A;  1TZ1 A;  2KWV B;  2N9X A;  3RD2 A;  1S1Q B;  3K9P B;  2KDE B;  3KYC D;  4LJO B;  1UEL A;  4EZK A;  3M63 B;  4AUQ C;  4ZYN A;  2CU1 A;  2NBW B;  4IWQ A;  4KIK B;  4FJY A;  3UF8 A;  2VRR B;  4HWI B;  2C7M B;  2CR5 A;  4W9K A;  3WAO A;  3KUD B;  3QCA A;  1SIF A;  1C3T A;  3UQA A;  2KNB A;  2KAN A;  3KVF B;  3PGE A;  4EFO A;  4DDI D;  3DBS A;  2ASQ A;  1WRD B;  3ZVV A;  3L08 A;  1IYF A;  2Z0E B;  4I6P A;  3EFU A;  3WAM A;  4NQK E;  1IPG A;  2GMI C;  1SGH A;  4II3 B;  3LDZ E;  3NHE B;  4WQO B;  3AXC A;  3ZUN A;  2K8H A;  4TQ1 A;  2MW5 A;  4ZRI A;  3RUL A;  3PLU A;  4E74 A;  2IZV B;  3NZU A;  3DOW A;  1PQS A;  2FCM A;  4RMA A;  3MJW A;  3IHP C;  2FCN A;  1WGD A;  1NI2 A;  3UIO B;  4LCD E;  1KLV A;  3CF6 E;  2LGY A;  4EKU A;  2AWT A;  2D2Q A;  2RPQ A;  3PS6 A;  4KIK A;  3I3T B;  1WJ6 A;  1WR1 A;  2IO3 B;  3W1S A;  1GC6 A;  2BYE A;  1L2N A;  3PSE B;  2HD5 B;  1RAX A;  2JT4 B;  2LRW A;  3DVN U;  1OGW A;  2PE9 A;  1Q1O A;  2BWF A;  2JVC A;  1J0G A;  5J18 A;  4TV3 A;  4M8N A;  5IAA C;  4WJN A;  2KFK B;  5JH5 C;  2IBI B;  2KO3 A;  2BKR B;  3PRE A;  3PZD A;  4EZL A;  3EHV A;  4MSM B;  4URK A;  2ZVN A;  2IY0 B;  3BY4 B;  4GOC A;  2M17 A;  2J7Q B;  2N4F A;  5L83 A;  2KX3 A;  2NR2 A;  2MSE D;  5D94 A;  3CSF A;  2KXJ A;  2HJ8 A;  4F1S A;  3QK0 A;  3IFW B;  2ZCB A;  3AU4 A;  4MGY E;  4KVG B;  4E71 A;  3IVF A;  4ICV A;  4GSW A;  3TBL D;  1Q5W B;  2C7H A;  3PRP B;  2JF5 A;  3Q3F A;  4JL9 A;  4M0W B;  4DK5 A;  2C5L C;  2D07 B;  1RRB A;  2L0F A;  3OJ3 A;  2KZR A;  2GBK A;  4W9I A;  3KW5 B;  3GZN I;  2KKC A;  3TJP A;  2N7D A;  3DQV A;  2Z59 B;  3A1Q B;  2L76 A;  2DX5 B;  2MQJ A;  4PYU A;  2O2V A;  1YD8 U;  3APD A;  1WJU A;  3H6N A;  4G11 A;  2J0J A;  3S2A A;  1A5R A;  2XK5 B;  4J6I A;  1V49 A;  5FR6 A;  2MWS B;  1IP9 A;  2LUE A;  2WDT B;  3ALB A;  3VFK A;  1EUV B;  1EO6 A;  1EF1 A;  4MJS B;  4FJZ A;  3RCZ A;  2KD0 A;  2BYV E;  2PJH A;  2ZPY A;  3UIP B;  3HHM A;  2NCN A;  1E8Z A;  4IUM B;  2DYB A;  3QA8 A;  1WJN A;  4DHJ B;  4WWN A;  1WGY A;  2C7N B;  4NY0 A;  3A9J A;  2L05 A;  5EDS A;  1EF5 A;  1VCB A;  1XD3 B;  3A1Q A;  1WE7 A;  4FAD A;  2GBJ A;  2QHO A;  3HK0 A;  4CO7 A;  3C0R B;  2O6V B;  2KVR A;  1V81 A;  1F9J A;  1GNU A;  2LXC A;  3BIN A;  2DYO A;  2IYD B;  2L00 B;  2MBH A;  3A4R A;  3L13 A;  2DZJ A;  2NBV B;  3B1L X;  3LJ3 A;  2J0M A;  3APC A;  4F8C B;  1GJZ A;  2V1Y A;  4MEL A;  4HLE A;  3RZF A;  2R2O A;  4EZJ A;  3V6C B;  2ZZP B;  3VAW A;  5C1Z A;  3VUW A;  2DZM A;  2AYO B;  4II2 B;  3VHT C;  2BGF A;  4W9L A;  1WGH A;  3DPD A;  3KYD D;  4NNJ B;  2A5U A;  1AAR A;  2LZ6 A;  3QC8 B;  2MBO A;  1UH6 A;  3X0W A;  3ZW3 A;  1WH3 A;  3JSV A;  3ZO5 B;  1E5W A;  4BVU C;  2KJH B;  2HTH A;  4KSK C;  4NAW A;  4OVV A;  5DPR A;  3H7P A;  3OLM D;  2NVU I;  3T9L A;  3DCG A;  2N1V A;  3IG3 A;  2XBB C;  2O6V A;  1WI0 A;  2KOX A;  4FBJ B;  5JHA A;  2KTR B;  3R7R A;  2ZJD A;  3ML8 A;  3CMM B;  5G55 A;  3A33 B;  4GXB A;  3PT2 B;  5AEK B;  1K8R B;  1XT9 B;  5L95 C;  1E7V A;  4TUU A;  4FA6 A;  3HM6 X;  3V62 A;  3ECI A;  2UWQ A;  3DVG Y;  2KC2 A;  2KDB A;  4XX5 A;  1UBI A;  4ASW C;  3PTF C;  4G0N B;  1YX6 B;  2JRI B;  5G2N A;  1J19 A;  3A4S C;  4LDT B;  5E6N A;  4NPN A;  5KHO A;  2KWC A;  2KMC A;  3W1S C;  2N9P C;  3AU5 A;  4G50 A;  4TQ0 A;  3Q3J A;  5AZF A;  3ZDM C;  3ZLZ A;  3VQI A;  4MEM A;  1WM3 A;  3TCA A;  2GBR A;  1UBQ A;  3ONS A;  1WMH B;  1GG3 A;  2L0T A;  4LJP B;  4HVB A;  1WFY A;  2PE6 B;  4F7Z A;  3VH4 B;  4G3X B;  2IO1 B;  2ZEQ A;  4WJP A;  1C1Y B;  2L8J A;  5E6O A;  3V6E B;  3L54 A;  1V2Y A;  2MP2 B;  2LVQ A;  3ZNZ B;  1ISN A;  1P98 A;  1H8C A;  3TIX A;  3WIM A;  3WAP A;  5CHV C;  4DDG D;  4DWF A;  2BYF A;  1VD2 A;  4MH0 E;  3QAR A;  3N30 A;  2KWU B;  4W9F A;  2V4L A;  2N7E A;  2G4S A;  4IM3 A;  3QWZ B;  1Z2M A;  2KFJ A;  3R66 C;  4IWP A;  1ZGU B;  5JHB A;  1TTN A;  2N1W A;  4WWO A;  4JIO U;  2M4N A;  3VH3 B;  4YL8 A;  2K6Q A;  3X23 A;  2RD0 A;  2CS4 A;  3N3K B;  4PS3 A;  3RZW C;  1WF9 A;  4WJQ A;  2LXA A;  4MM3 A;  4IM2 A;  2MA9 B;  2KFK A;  4K7S A;  1WJ4 A;  3A9K B;  3VUY A;  3VTU A;  2N9E B;  3ZTD A;  2J0K A;  3L0W B;  4FN2 A;  2W9N A;  2DAF A;  5KHQ A;  2G45 B;  1UD7 A;  2M0X A;  3NS8 A;  3P2B A;  5DPW A;  5E6P A;  2LAS A;  5IA7 A;  1MG8 A;  3TMP B;  1JRU A;  2EMT A;  1R4N I;  2JZZ A;  2YVC A;  4BKT A;  4BBN F;  5DPS A;  1WGG A;  2GOW A;  2LI5 A;  1P0R A;  3D32 A;  3ZRC A;  3AI5 A;  5D2M B;  2NBU A;  1WGR A;  2KQ7 A;  2Z0D B;  3ENE A;  4GIV A;  2PPH A;  3RYT A;  2HE7 A;  1WX9 A;  4BOS C;  2V3S A;  3H7S A;  4WWP A;  2L7R A;  2NS5 A;  2XEW A;  1LFD A;  4KSL C;  2G4D B;  4DBG A;  4EOY A;  3M3J A;  2KC1 A;  3W1Y A;  4ANW A;  3DBR I;  1YX5 B;  1L7Y A;  1WY8 A;  5CHF A;  2BF8 B;  4MDK E;  4ICU A;  5J2R A;  1WIA A;  4DHZ B;  3L10 B;  1WR6 E;  4GB9 A;  5LXI B;  2LVP A;  3OAW A;  2AL6 A;  2LGX A;  3L17 A;  3PLV A;  2D10 A;  2IY1 B;  5AZH A;  4CHK A;  2DYM A;  2ZVO A;  3U8Z A;  1WZ0 A;  4ANX A;  3ZKJ C;  2M1M A;  4FUL A;  2XK5 A;  2A4Z A;  2MBQ A;  1ZKH A;  2FID A;  2ZNV C;  2NPT B;  3N32 A;  4MSQ B;  1SE9 A;  4X57 B;  4ZRJ A;  3PV1 A;  1V86 A;  2BKF A;  4BKG A;  1Y8R C;  1Z5S B;  3M95 A;  4MJS A;  1X1M A;  3PHW B;  2R2Q A;  3ZRF A;  3HIZ A;  4WAA A;  3NOB A;  4PS7 A;  4IG7 B;  1E8W A;  4JQW C;  2JPH A;  3WAN A;  3PRM B;  4E3C A;  4EUT A;  1TGZ B;  2KLC A;  4DHJ D;  1D3Z A;  4IM0 A;  3ZDT A;  3MHS D;  3V60 A;  4IC7 B;  4EEW A;  4GN1 A;  2MCN B;  2FUH B;  4JLC A;  2O6V D;  1RFA A;  2KDF B;  3QAQ A;  4K7U A;  2D11 A;  3SD5 A;  1YJ1 A;  2JUO A;  1KOT A;  4BOZ B;  3MTN B;  4HDQ A;  5J17 A;  4OVU A;  3K9O B;  3ML9 A;  3EEC A;  2WWZ A;  2KTF A;  2DEN B;  2OJR A;  2K8C A;  1WYW B;  2NPT A;  3UQB A;  1GUA B;  3KH0 A;  2WX0 A;  4GU2 A;  1UGM A;  3UIN B;  4NJ7 A;  4NQL B;  3QHT A;  3VDZ A;  1LXD A;  3H1U A;  1UZX B;  2AL3 A;  2C9W B;  4IWO A;  1XQQ A;  2JXX A;  2JZ3 B;  1NDD A;  4K1R B;  2FIF A;  1RLF A;  2G3Q B;  1V5O A;  1OQY A;  3B0A A;  3JVZ X;  3PRZ A;  3QX1 A;  4I6N B;  4W9C A;  3VTV A;  4AWJ A;  2KLG A;  4HXD A;  4W9H A;  1G6J A;  4HK2 A;  3JW0 X;  4N9F 4;  1I35 A;  3CST A;  1WXA A;  2FCS A;  2MLB A;  1KM7 A;  2KN5 A;  4PS8 A;  4RM8 A;  3JYU A;  2IO2 B;  2KK8 A;  5GMV A;  4A20 A;  2JWZ A;  4FJV B;  2KTR A;  4GDL B;  1BT0 A;  3T8M A;  2L3Z A;  4MGI E;  2D3G A;  1R4M I;  2KMA A;  2PEA A;  1Q0W B;  1YIW A;  4GMV A;  4XC2 A;  1P9D U;  3ZTC A;  3APF A;  2WYQ A;  4FLH A;  4A3P A;  2EMS A;  4GGQ A;  4DXA B;  3U7D A;  3WA0 A;  4CYE A;  5LXH A;  3L16 A;  4FHK A;  1M94 A;  3PHX B;  3PPA A;  4AJW A;  2OOB B;  2FAZ A;  3OJ4 B;  4XZ4 A;  4ZDV A;  4LDT D;  3H9D A;  2CHW A;  1WXS A;  2CHZ A;  2GBM A;  2IO0 B;  2KJ6 A;  2ZPN A;  4KZ0 A;  2FNJ B;  5CHW A;  3M62 B;  4BKS D;  1WZ3 A;  3NY5 A;  5TR5 A;  4BKS A;  2DZK A;  2LVO A;  1E8X A;  1OEY A;  3HM3 A;  2KHW B;  2I1K A;  2LGD A;  4AP4 C;  2YLM A;  4W9J A;  2O2V B;  1V80 A;  5AZG A;  1QZE A;  1WMH A;  2RGF A;  2CHX A;  4HPL B;  3KUC B;  3WAL A;  2K1F A;  3SU8 X;  4KDI C;  1TBE A;  4GDL A;  3DVN V;  2FCQ A;  1GC7 A;  4FHJ A;  2BPS A;  2K25 A;  1U4A A;  4M8M A;  2MP2 A;  4MGZ E;  3NZS A;  4RM9 A;  4WJO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...