1T0QC

Structure of the toluene/o-xylene monooxygenase hydroxylase
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
83
structure length
83
Chain Sequence
b'TFPIMSNFERDFVIQLVPVDTEDTMDQVAEKCAYHSINRRVHPQPEKILRVRRHEDGTLFPRGMIVSDAGLRPTETLDIIFMD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords toluene, o-xylene monooxygenase oxygenase subunit
publication title Crystal Structure of the Toluene/o-Xylene Monooxygenase Hydroxylase from Pseudomonas stutzeri OX1: INSIGHT INTO THE SUBSTRATE SPECIFICITY, SUBSTRATE CHANNELING, AND ACTIVE SITE TUNING OF MULTICOMPONENT MONOOXYGENASES.
pubmed doi rcsb
source organism Pseudomonas stutzeri
molecule tags Oxidoreductase
total genus 25
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2004-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF06234 TmoB Toluene-4-monooxygenase system protein B (TmoB)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.270 Alpha Beta Roll Ubiquitin-like (UB roll) TmoB-like 1t0qC00
3N20C 3RMKC 3I5JC 1T0SC 3RNCC 3DHGC 3RNBC 3RNGC 3N1ZC 3GE8C 3DHHC 3RNFC 4P1CC 2RDBC 3GE3C 3Q3OC 3RNEC 3RI7C 3Q2AC 3RNAC 1T0QC 2INDC 3Q14C 3RN9C 4P1BC 3I63C 3Q3MC 3Q3NC 2INCC 3N1XC 3N1YC 1T0RC 3DHIC
chains in the Genus database with same CATH superfamily
5E6NA 4G50A 4KV2A 1ZXHA 1KLVA 1V86A 1E90A 2K6DB 5FR3A 2WWZA 5E6PA 2DYOA 3DVNU 2O2VA 1AARA 3KQ4A 3IBEA 3P42A 1UNSA 3AULA 2AWTA 4C4VA 2KK8A 3V61A 2PE9A 1E9MA 5LXHA 4KSLC 2LHDA 2B76B 2PJHA 2INNE 3GP7A 4ARIA 4KDIC 4P7IA 2OJWA 2G3QB 2LJIA 4G0NB 3KUCB 3FC4A 2HJ1A 3MC0B 2A5UA 4HROA 1GB4A 4HJGE 4TKNA 4US9A 1AW7A 1TKEA 3UQAA 3A33B 3RNGC 2JWZA 4BOSC 3NVYA 1M94A 1WM2A 3RNEC 2WX1A 2WXJA 1HZ5A 3WAOA 2GBJA 4M01A 2KC1A 1WGRA 3AV8A 4NPNA 4L1BA 1IBXA 1D6EC 3JYUA 3VFKA 3AE6B 3ZDTA 1LFDA 2BPSA 5J18A 2C60A 4OW0A 2HTME 2CU1A 3EHVA 5FK9C 1FD6A 3ZGZA 1V5OA 3U8ZA 2WYQA 4ZRJA 4DXFA 4MH8A 4DQOC 4MDKE 3IFWB 3HK0A 5BO4B 1N63A 4GDKA 1LXDA 2N9LA 3CWIA 4MGZE 4HLEA 5HFYA 2LJ5A 4ARCA 4GIVA 1H8CA 4PT5A 4IC7B 1ZOYB 1WRDB 4HEA1 1P0RA 5JZEB 2M17A 3WAPA 4AS1A 4OZBA 4FHJA 4EZKA 1F1HA 4NY0A 3IG3A 2NTTA 3DHGC 3DBHI 2E3TA 4BFRA 3QIJA 1GOZA 2L0FA 1Y8RC 4IDIA 4XC2A 1PUTA 1WX8A 1LQBA 1VZ6A 1MVKA 4W9HA 1IYFA 2ZW1A 2K8HA 2LUMA 4DBGA 3VQIA 2HJ8A 3ZUNA 4MM3B 2KZRA 1BXTA 1ZW7A 2MSED 1I7HA 4A6QA 4FHKA 3WAMA 3AMZA 1C4CA 3IAM1 2LRUA 1F9JA 3DDCB 5TR5A 4I6PA 4B0MA 2FUG1 2ONQA 4DHZB 2DWQA 2QMTA 4OVVA 3X0WA 4NZLB 2J42A 4BOZB 2MHJA 1JRPA 4P6VF 4M0WA 3R8BA 3V05A 4IG7B 1I42A 1H4RA 1K53A 1N5WA 1Q0WB 2KTRA 2SAKA 3PPAA 5AEKB 1F0ZA 4K7UA 4USAA 3QCAA 3U4EG 2O2VB 1J7AA 3ZVVA 4B95A 1A5RA 5G2NA 1JCKB 4C4VB 2G1EA 4RF1A 5CHWA 2I1KA 3URYA 5JHBA 1R4MI 3BYYB 3RD2A 2KQ7A 3VR9B 3V6CB 3DVGX 2DENB 4GN1A 4RM8A 2BW2A 1I35A 2REXA 3QX1A 4AJWA 1NENB 2KFKB 2ZZPB 3RT3B 2CHZA 2V3PA 2XNAC 3WANA 3ZRFA 4KVGB 3GS2A 2WGSA 3JSVA 1NDDA 1LO5D 4ZYNA 3B2GA 3KW5B 2KWUB 1FXAA 3NOBA 5DPSA 3Q8BA 3Q8CA 2KACA 4FXCA 1KLGD 1C4AA 3AEBB 1XF5L 1SJHD 2NBUA 3DBRI 4W9GA 1DOXA 2Y5PA 3ABVB 1MG8A 3NVVA 4XX5A 2WXNA 3V3XA 4FN2A 1EU3A 3T9LA 2MBBB 2BYFA 4BKTA 4EEWA 1PDXA 2G4DB 4P16A 1OQRA 2K25A 4GDKB 2XBBC 1EF5A 1UBQA 3BK1A 4EUTA 1G6JA 3ZXRA 4C7ZA 4GOCA 3V60A 1WGKA 3L54A 3OJ4B 2CJOA 2DZKA 4WWMA 3DVNV 2V3NA 1C4PA 3ENEA 1UZXB 1XXGA 4JWSC 2DNFA 1AWDA 1FRDA 2M0XA 3TBLD 3H8HA 4KIKA 4MJSB 2DYBA 2ASQA 3W1SA 5MPOA 4HKQA 1YJ1A 3V62A 4DDID 3OAWA 1GUAB 1TS3A 5CHFA 4EZLA 4CHKA 4W9CA 2WXQA 2KDBA 2OEDA 3B1LX 2MP2A 3SFEB 5L95C 3PZ7A 1TT5B 1V80A 2CHXA 4S0RA 3DHIC 1P7EA 3P4SB 5G5GA 4F1SA 2CS4A 4LJOB 1JWMD 1WI0A 3C8YA 3PRZA 5I4DA 2IO2B 1PYWD 2LWPA 3KUDB 2QIEB 4NJCA 1GC7A 4LNNA 3ZRCA 4ITKA 4M0WB 2FCMA 1EO6A 4NJ6A 4FULA 2KTRB 2FUHB 3UQBA 2OHFA 3IHPC 2WQYB 1GG3A 3DBRB 2KVZA 4GSWA 2YEPB 5J17A 3R66C 2JQRB 3N30A 3WA0A 2JVCA 1YD8U 3RZFA 3RFZB 5IAAC 2B3AA 3VTWA 3BY4B 1WZ3A 1I4HA 3TJPA 2XEWA 2AQ3B 2D3GA 3A9KA 2KN5A 4C56C 3JSVB 4K7WA 2D3BA 1J7CA 2WNMA 3APCA 2KYWA 4RGTA 2JUOA 4TMAB 4RGMA 2BQQA 1EWYC 1ENFA 1YOVB 4RGOS 2J7QB 4LNOA 3AEGB 4TUUA 4A8XC 4LNIA 2K8BA 2IZVB 2MBEA 2V4LA 3W1YA 2V3SA 1T5XD 2IGHA 1KOTA 4HRSA 3SHQA 3B0AA 3ZW3A 3NZ3A 3EFUA 3AE7B 1P1AA 3P63A 3L13A 4WAAA 2GBRA 2HD5B 3NRZA 3ZJTA 1CZPA 1WR1A 4ZDVA 2I2YA 4RGNA 3K9OB 4A3OA 3ZNGC 1R7SA 1STEA 2JYTA 3A9JA 1YNTE 2N9EB 2V4IB 1V2YA 1JALA 1ISNA 2VRRB 2LVQA 1B9RA 5HG2A 2JSVX 2MQJA 4WJNA 4MGYE 2KX3A 3FKYA 4NJ7A 3P4QB 3P4PB 4C80A 1QZEA 1TS2A 3QARA 3EUB2 1VD2A 2MCNB 4KX6B 1ZE3D 1FPYA 4GXBA 1QOAA 1KF6B 3AE2B 2NVUI 4CO7A 1WGYA 4FBJB 1SSNA 2LGXA 4LJPB 4KIKB 4II3B 2DLBA 3Q2AC 3VR8B 5EE0A 2D10A 1WE6A 5JXVA 2KDEB 2EMSA 1F52A 3MHSD 4RNAA 1C79A 4BBNC 1PGBA 2BWES 2RR9A 2NS5A 3MJWA 4HK2A 3L16A 4R3DA 4X57B 2MP2B 3S2AA 4HDQA 4GLSC 1T0YA 4AJYB 3LJ3A 2KFJA 5BMGA 2KWDA 2LXCA 3TCAA 1L4DB 2CHWA 4PS3A 2N9XA 1FEHA 2L76A 1SB3C 4FJZA 2JXTA 5DCNA 2VZKB 3AB5A 4WAFA 1WH3A 3GE8C 3CIRB 5G5HA 2UWQA 4CQNA 4XWTA 2MBQA 1T6BX 2WXLA 4W9LA 4ICVA 5KHQA 1Q10A 3PHWB 2O6VA 4MM3A 1PFDA 2J0JA 4GB9A 2INDC 3P1MA 2MJ3A 1FNWA 2KT7A 3O13A 3TUOA 2D5GA 1TZOA 4XDDA 4LK0M 3DHHC 2Y3AA 3VXWA 1VRAB 2FIDA 3N32A 2K3UA 3Q8AA 1N61A 4FADA 3R2TA 2AL6A 1ZPSA 1FNVA 2L1AA 3Q8EA 4M8NA 1NI2A 5H92C 3TEYA 1E0ZA 3DCGA 2INPE 3A9KB 3Q3FA 1ET6A 4ZRPA 1HTQA 2AQ2B 4FA6A 4YSZB 3ALBA 1Z5SB 3H1UA 1TY2A 2LZ6A 2DAJA 3PV1A 5J2RA 4PS7A 2GBNA 2JU6X 5E6JA 4KZ0A 2VH1A 2UYZB 1KFYB 3AM9A 4EE2A 1FNUA 2DBYA 3AECB 2GBMA 2KFKA 3VUWA 4FLHA 4GU2A 2BS2B 2Z0DB 2LGSA 5IP4D 2RDHA 4QAYA 4ZRQA 3PSEB 1ZP0B 4HPLB 1UF0A 1B1ZA 1YIWA 1FMAD 5DPTA 3DBLB 4E3CA 1TS4A 4JLCA 5HHDG 1S1QB 1FO4A 5C1ZA 1KH0A 2RGFA 3SDLC 3NG0A 2W9NA 3X23A 1VDVA 3A9JB 4DXGA 1YX5B 1GB1A 2Y5CA 4KGRA 1RAXA 2IGDA 3TEWA 1P98A 2BYVE 2BGFA 4RFBA 1WJ4A 5D6JB 4BVUC 2FNJB 4JWUC 4GGQA 2KAJA 4M02A 3FAHA 3PLVA 1AYFA 2HTHA 1XD3B 2KLCA 4MEMA 5JH5C 1UWXA 2JRIB 4ACFA 5D2MB 2YLMA 5EDSA 3ZTCA 3Q6BA 1ZKHA 2NMQA 4EZJA 3QHTA 1SEBD 3NVZA 3Q3OC 3ZJVA 2W54A 3NHEB 3PZ8A 1GJZA 2R2QA 3ML9A 3AE8B 4LDTB 1CJEA 2K6QA 3U2SC 1WF9A 5AUKA 1MPEA 4YT0B 1S3SG 2JWUA 3VH3B 3O65B 5HKHA 3RMKC 3SR6A 1HXYD 2MX2A 1RFAA 2C9WB 2Y5BB 4MJSA 1TYGB 3I57A 4IWQA 5D3DA 3AE4B 2EELA 3EFCA 1SE2A 3AEFB 3P4RB 4OHJA 2PMVA 1GPXA 3BVZA 1YN4A 3KH0A 1E8ZA 3RUIB 3B08A 3A1QA 2K1FA 2XK5A 2IGGA 3N20C 2JZZA 3VDZA 3PVLA 4WIPA 3Q8FA 2O6VB 3M62B 2V9HA 5C2TB 1F2RC 3E56A 2JY6A 1XCQL 3T3NA 2ZNVB 2KWCA 1HE8A 2L3ZA 2EMTA 3ECIA 2Z59B 5BMHA 3U52E 5AZFA 1V49A 4URKA 4AWJA 2AEHA 2D11A 1ESFA 4WWPA 2VZKD 2LVPA 1I4QA 2FCNA 4N58A 3OWEB 2BKFA 2BKRB 2J0MA 3Q69A 3R7QA 5L83A 4K81A 4HCPB 2JPHA 2K22A 2G4SA 2RPVA 1IGDA 1WXAA 5DPRA 4II2B 3VRBB 4BZAA 1C78A 2IYDB 4IUMB 2N9KA 3DBSA 2BBCA 2PE6B 4IKGA 3VHTC 2HDEA 2MWSB 1WJNA 5LNK1 3PRMB 2WHIA 3OJ3A 4BBNF 2N0SB 3HIZA 3IT4B 2UU7A 4RCOA 3EECA 4WQMA 2EKEC 4UDUC 2KX0A 4D2KA 1EWCA 1MJDA 4BKSA 2M19A 1FM0D 1HQRD 3M3JA 1PGAA 4XGAB 1V9JA 3ONSA 1PGXA 5AUIA 2WXFA 2W3RA 1SIFA 3RNAC 4MACA 5EE1A 4N6EB 2DZIA 1E7UA 1WY8A 2G9HD 3UGBB 1WJ6A 2JZ3B 2R61A 3N1YC 3DBHB 2WU5B 3ZTDA 1D5ZC 2LD9A 4H2AA 3VTUA 2RDBC 4ANXA 1VLBA 4TQ1A 4XWWA 2XN9C 2KQ4X 4JIOU 1OTRB 2PKOA 1OFFA 3NVWA 2K5PA 3LYYA 3RPFC 2BT6A 5BMIA 1AN8A 1KLUD 1VZ7A 3ZO5B 1Q1OA 3SU8X 2X38A 4YSXB 2Z8LA 1XLOA 3W1SC 1EM7A 2HE7A 2RMMA 1C76A 2LRWA 1TZ1A 2KANA 3N1ZC 2KNBA 2ZVOA 4CYEA 4AQ7A 3IT6B 3VUYA 4K3CA 1XQQA 2ZEQA 1N6ZA 5CHVC 4AP4C 3QA8A 5KHOA 4WJPA 2L83A 1TS5A 4JX1C 4TQ0A 3B2FA 2L7RA 3W5VB 2KOXA 1TKYA 3P2BA 2LMCA 1P3QU 3PTFC 4KKIA 3U7ZA 2BVCA 4W9EA 3KWVA 2CKHB 2K8CA 2WXGA 2QDFA 4LDTD 4YTNB 3RI7C 4NAMA 1GAQB 3A1QB 1JQ4A 2BF8B 2XK5B 1R4MB 1WRIA 1FXTB 2IO1B 2KWVB 3N1XC 2KKCA 4DHZE 2L05A 3AEEB 4MH0E 1SE4A 3RNBC 1EU4A 1QKZA 4E71A 3A4SC 2BYTA 1FFVA 3ZYYX 1UH6A 1TBEA 3R2IA 5FR6A 4IM0A 2LI5A 1SGHA 4HPPA 1OQQA 1C1YB 1JROA 3PREA 3BVGA 2DZJA 3C19A 2O6VD 4B6WA 3OLMD 3BINA 1I4GA 2OJRA 4DHJB 3T8MA 3V6EB 3DWGC 1EF1A 4M8MA 4M00A 1FCLA 4C7YA 3NZUA 3NZSA 1YN5A 4YTPB 2KJHB 1HZ6A 2N1WA 1V1OA 1FFUA 2MA9B 2KMMA 4ANWA 3I3TB 3DVGY 2FAZA 1QOBA 1NEKB 3PT2B 2GRIA 2CR5A 4YL8A 4JGHB 4ASWC 2ZPYA 1RLFA 1P9DU 4C00A 4WH4A 4KDLB 2LHEA 4OZAA 3AE3B 1L0VB 4FJYA 2PIAA 3JW0X 1R4NI 4AUQC 2CJNA 1TJEA 1WYWB 1I4XA 3HVDA 5TSSA 4A20A 1D4BA 2IPKD 1N5XA 2CU3A 3QJZA 1YN3A 2W55A 2FIFA 2MBOA 2W3SA 3RCZA 3PRPB 4ICUA 2KVRA 4LCDE 2JYEA 2PTLA 2N9PC 3ZXVA 3MP9A 2BTEA 4RMAA 3UIOB 4MSMB 1D3ZA 2QC8A 4WJQA 4K7SA 1TGZB 2LASA 4IWPA 2C7HA 2KMAA 2PW9A 3MTNB 4L23A 1UELA 2M56B 3L17A 3L4PA 4B9KA 3RN9C 4J6IA 5JHAA 4A9AA 3Q3MC 1D5XC 3VAWA 2AQ1B 3LB8C 1E7VA 3B9JA 2MW5A 1YJJA 3Q14C 5BYSA 2QEJC 3ML8A 4DK5A 2WXRA 2ON8A 5D3IB 1C9FA 3VRAB 4NQKE 3AXCA 4LNFA 4G3XB 1L0XB 5IO9A 4XZ4A 1K8RB 1Q5WB 1WYGA 2RD0A 2N7EA 4Q2JA 1QLBB 2KJ6A 4WURA 3R7RA 4GMVA 1WXMA 2WDQB 2AX5A 2KHWB 2L8JA 3KWLA 3ZKJC 3TMPB 4NAWA 2MJDA 1V6EA 3NY5A 1WX7A 2ZNVC 3R3MA 2D2QA 3I5JC 4KGSA 1ZUD2 2IDYA 1VZ8A 3APFA 2YVCA 3NS8A 1WXVA 1NBFC 2PEAA 4TSSA 2AL3A 4DDGD 1RM6C 3SFDB 4MGKE 4IW0A 2LEKA 4HWIB 3DWMA 1R4NB 4LNKA 1BMLC 3UINB 2V0GA 3EGRA 1WM3A 2JX5A 2PLPA 3BVMA 2D3CA 3L0WB 4LLGM 3NJTA 2KJRA 3J9CA 1L6VA 1UUPA 2WXOA 2GBKA 1I4PA 3H6NA 2ZCCA 2BS3B 2NCNA 2FE8A 5BYRA 4HDOA 4KSKC 1MHHE 1HTOA 4PYUA 3U7DA 1WWTA 1XCTL 3L08A 3CSFA 1WR6E 2TSSA 1VR9A 3BIID 1WMHA 1UBIA 4F8CB 2JF5A 2GMIC 4DHJD 4MSQB 3GE3C 3KYCD 2G45B 3WCQA 4JL9A 3QK0A 3DPDA 3M95A 2ACZB 2DX5B 4MGIE 2EKIA 3UF8A 2L00B 3TSSA 4I6LB 2N4FA 5IKCM 2BWFA 2J52A 2KN4A 3ZJUA 1T0SC 3FILA 4K3BA 3ZNID 1N62A 1XLQA 2WX0A 3KYDD 3VVWB 3LXFA 3K9PB 5GMVA 3TEXA 2GLSA 4BKSD 3BWUD 4P1BC 4KZCA 3PS6A 4WWNA 2INCC 2FCSA 3PGEA 1T0RC 1YQ3B 1DOYA 3MC8A 1WJUA 1XT9B 1OQYA 4P1CC 1GNUA 1I4RA 1NVID 1FCCC 1FXIA 3AEAB 2FBWB 2KDMA 3ZDMC 1WXSA 3GB1A 3ZIMA 1V8CA 4WWOA 2DYMA 2WXKA 3BZDB 2PVGC 3ZLZA 3VH4B 2PPHA 1J19A 1A70A 1ACCA 2QHOA 4ANVA 1UWMA 1CMXB 2WXPA 3AU4A 5DPWA 2LGYA 1XEEA 1WX9A 2C7NB 1SBBB 4IM3A 4W9JA 1SJED 4PS8A 1V1PA 4N59A 1E7PB 1WZ0A 4JQWC 2JT4B 5GXGB 4REZA 3W5UB 4TV3A 3KVFB 4NAWB 4ZHOA 3QWZB 3KUZA 2H88B 1WE7A 3CMMB 3QAQA 2LGIA 3APDA 2RPQA 2KMCA 4A55A 2FCQA 3N3KB 3RNFC 3BK2A 1Z2MA 1T3QA 1OEYJ 3MFGA 2PVOD 4HVBA 4IWOA 3T3OA 2R2OA 1VCBA 3DOWA 1J8CA 1BT0A 2Q5WD 1J7BA 3TL5A 1RYJA 4MELA 1GC6A 2WP9B 2QCZA 4XE0A 1WGDA 1YX6B 4RM9A 1L2NA 1TTNA 1MG4A 2ZPNA 3SEBA 3TIXA 1LM8B 1WMHB 2WXIA 2NPTA 5IN7A 3CSTA 3AN1A 5E6OA 1LGRA 2IBIB 1L6UA 1TY0A 1RRBA 4IM2A 1QILA 1QOFA 1N60A 1ZDVA 4N9F4 2MJEA 2IJ0A 4GDLA 1BUIC 1DGJA 5CX3A 4ZRIA 5EE9A 4ZRKA 1PQSA 3FILB 3QQ8B 2KO3A 3ZNZB 3IXSA 2M1MA 4ZHPA 2ICIA 5IOIA 3AH7A 3LDZE 1SE9A 5G55A 1ET9A 1KRHA 3AI5A 1OGWA 2BS4B 2GOWA 2NR2A 2M8SA 3SD5A 4MT5A 4HKZE 4RH6A 3H7PA 1V97A 4A90A 1P7FA 5FKAC 2WDRB 3Q3JA 5CTRC 1RWSA 4W9IA 2BB6A 1F2RI 3PZDA 2DHZA 3UIPB 3TEZA 2WXMA 1KTKA 1IBXB 2AYOB 3HUIA 4YTMB 5LXIB 4BAXA 1UGJA 2C7MB 1DYQA 2NTSA 2MBHA 4HPMB 3Q3NC 2KDFB 1JRUA 2ZCBA 1E8YA 2WU2B 3RNCC 4EKUA 1U4AA 4US8A 2LXAA 2N7DA 2BYEA 4A3PA 4WJOA 1XLNA 1L5PA 1M4VA 1CQVA 3D32A 1NI3A 1T0QC 1V1PB 2N7JA 5AZHA 2VH2A 2JZPA 2ZVNA 5C23A 2SEBD 1D5MC 3L10B 4PK1A 3HHMA 1XLPA 1C77A 1QQRA 4IOIE 1YQ4B 2WS3B 1JMLA 2M0AA 1DOIA 3GZNI 1K51A 1TIFA 1K52A 3MHZA 4L2YA 5C3JB 1TKGA 2WXHA 2ZJDA 4K1RB 3W2DA 1WXQA 2IY1B 4OVUA 3MC9A 4W9FA 2L32A 4G11A 4YSYB 3OG5A 1QT9A 4F7ZA 1E10A 4XYCA 1IPGA 3N9YC 1JWUD 1IGCA 4O1NA 4EOYA 1WIAA 4NNJB 3AU5A 3IVFA 3I63C 1ROEA 4I6NB 4KKJA 2LFIA 2GI9A 2KXJA 3EC8A 4S17A 2MRPA 3U30A 2J4XA 2NBVB 2IY0B 2NPTB 3PHXB 1C3TA 2W82A 3A4RA 3DQVA 3PLUA 2J53A 2WDTB 4YWGG 1MI0A 1YJIA 1L7YA 2K39A 3RZWC 1OEYA 1CK1A 2BB5A 3M63B 3ZNHB 3HM6X 1EUVB 4RF0A 3H9DA 3W9CB 3HM3A 3KLSX 2L52A 2J0KA 1V81A 2K0PA 4GDLB 5HI1A 1RFKA 2MEKA 5D7GA 4YXDB 1WGHA 1SXTA 3ETRA 1KJTA 2KLGA 1E8XA 2K9XA 2N1VA 1SF0A 2LVOA 4WQOB 2M4NA 4HCNB 4NQLB 2IO3B 4FJVB 1YQBA 1ZXIA 3H7PB 4HXDA 1WGGA 1VJKA 2D07B 1QF6A 2I38A 3EA6A 2KDIA 4DWFA 3AE9B 4OZCA 1JWAD 4J3OD 1E8WA 1WFYA 3WIMA 3GZNB 2L0TA 2QSDA 1HEZE 2JRHA 3C0RB 3HVZA 1Y56A 1JW9D 4JPSA 1KM7A 4ANUA 3VUXA 3IAS1 1FRRA 1NYRA 1X1MA 2YEPF 3ZQ4A 2DAFA 5EE3A 1WSPA 5H8YE 3RYTA 1FIQA 3GOEA 4ZYSA 2DZMA 3WALA 1JWSD 2D3AA 2JXXA 2MH7A 2A4ZA 2KTFA 2X8XX 2RSUA 1J0GA 2I1JA 4W9KA 2OOBB 2E6XA 4JE3B 1YMHE 5T8IA 1IP9A 1MFWA 3AE5B 1E6EB 4W9DA 1F77A 4BKGA 2RDGA 3UI3A 1SIJA 1QOGA 3HRDD 2H89B 3I9V1 5D94A 3H7SA 1L0YB 3PO0A 4PYZA 3MJ5A 3AEDB 1L4ZB 1HA5A 2NBWB 3DBLI 5BYQA 2KD0A 4LTUA 5LLIA 3E9SA 2V1YA 1SE3A 2C5LC 2LGDA 2LUEA 4HJKA 4EFOA 3VTVA 1UGMA 2GB1A 2QILA 3NUHB 4ZOHC 1ZGUB 1ZDXA 3NS1A 2KC2A 2Z0EB 5AZGA 4OVZA 1E5WA 4E74A 3BYTB 2MLBA 4KGTA 2IO0B 1JWBD 1K50A 2WDVB 5IA7A 3JVZX 4B0EA 2WLBA 1UD7A 3QC8B 4AOFA 3AE1B 2ZW0A 2QJLA 2KQSA 4XDCA 4DXAB 3RULA 3CF6E 1IUEA 1NYQA 1XO3A 1MHXA 1V5TA
chains in the Genus database with same CATH topology
3N20C 3RMKC 3I5JC 1T0SC 3RNCC 3DHGC 3RNBC 3RNGC 3N1ZC 3GE8C 3DHHC 3RNFC 4P1CC 2RDBC 3GE3C 3Q3OC 3RNEC 3RI7C 3Q2AC 3RNAC 1T0QC 2INDC 3Q14C 3RN9C 4P1BC 3I63C 3Q3MC 3Q3NC 2INCC 3N1XC 3N1YC 1T0RC 3DHIC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N20 C;  3RMK C;  3I5J C;  1T0S C;  3RNC C;  3DHG C;  3RNB C;  3RNG C;  3N1Z C;  3GE8 C;  3DHH C;  3RNF C;  4P1C C;  2RDB C;  3GE3 C;  3Q3O C;  3RNE C;  3RI7 C;  3Q2A C;  3RNA C;  1T0Q C;  2IND C;  3Q14 C;  3RN9 C;  4P1B C;  3I63 C;  3Q3M C;  3Q3N C;  2INC C;  3N1X C;  3N1Y C;  1T0R C;  3DHI C; 
#chains in the Genus database with same CATH topology
 5E6N A;  4G50 A;  4KV2 A;  1ZXH A;  1KLV A;  1V86 A;  1E90 A;  2K6D B;  5FR3 A;  2WWZ A;  5E6P A;  2DYO A;  3DVN U;  2O2V A;  1AAR A;  3KQ4 A;  3IBE A;  3P42 A;  1UNS A;  3AUL A;  2AWT A;  4C4V A;  2KK8 A;  3V61 A;  2PE9 A;  1E9M A;  5LXH A;  4KSL C;  2LHD A;  2B76 B;  2PJH A;  2INN E;  3GP7 A;  4ARI A;  4KDI C;  4P7I A;  2OJW A;  2G3Q B;  2LJI A;  4G0N B;  3KUC B;  3FC4 A;  2HJ1 A;  3MC0 B;  2A5U A;  4HRO A;  1GB4 A;  4HJG E;  4TKN A;  4US9 A;  1AW7 A;  1TKE A;  3UQA A;  3A33 B;  3RNG C;  2JWZ A;  4BOS C;  3NVY A;  1M94 A;  1WM2 A;  3RNE C;  2WX1 A;  2WXJ A;  1HZ5 A;  3WAO A;  2GBJ A;  4M01 A;  2KC1 A;  1WGR A;  3AV8 A;  4NPN A;  4L1B A;  1IBX A;  1D6E C;  3JYU A;  3VFK A;  3AE6 B;  3ZDT A;  1LFD A;  2BPS A;  5J18 A;  2C60 A;  4OW0 A;  2HTM E;  2CU1 A;  3EHV A;  5FK9 C;  1FD6 A;  3ZGZ A;  1V5O A;  3U8Z A;  2WYQ A;  4ZRJ A;  4DXF A;  4MH8 A;  4DQO C;  4MDK E;  3IFW B;  3HK0 A;  5BO4 B;  1N63 A;  4GDK A;  1LXD A;  2N9L A;  3CWI A;  4MGZ E;  4HLE A;  5HFY A;  2LJ5 A;  4ARC A;  4GIV A;  1H8C A;  4PT5 A;  4IC7 B;  1ZOY B;  1WRD B;  4HEA 1;  1P0R A;  5JZE B;  2M17 A;  3WAP A;  4AS1 A;  4OZB A;  4FHJ A;  4EZK A;  1F1H A;  4NY0 A;  3IG3 A;  2NTT A;  3DHG C;  3DBH I;  2E3T A;  4BFR A;  3QIJ A;  1GOZ A;  2L0F A;  1Y8R C;  4IDI A;  4XC2 A;  1PUT A;  1WX8 A;  1LQB A;  1VZ6 A;  1MVK A;  4W9H A;  1IYF A;  2ZW1 A;  2K8H A;  2LUM A;  4DBG A;  3VQI A;  2HJ8 A;  3ZUN A;  4MM3 B;  2KZR A;  1BXT A;  1ZW7 A;  2MSE D;  1I7H A;  4A6Q A;  4FHK A;  3WAM A;  3AMZ A;  1C4C A;  3IAM 1;  2LRU A;  1F9J A;  3DDC B;  5TR5 A;  4I6P A;  4B0M A;  2FUG 1;  2ONQ A;  4DHZ B;  2DWQ A;  2QMT A;  4OVV A;  3X0W A;  4NZL B;  2J42 A;  4BOZ B;  2MHJ A;  1JRP A;  4P6V F;  4M0W A;  3R8B A;  3V05 A;  4IG7 B;  1I42 A;  1H4R A;  1K53 A;  1N5W A;  1Q0W B;  2KTR A;  2SAK A;  3PPA A;  5AEK B;  1F0Z A;  4K7U A;  4USA A;  3QCA A;  3U4E G;  2O2V B;  1J7A A;  3ZVV A;  4B95 A;  1A5R A;  5G2N A;  1JCK B;  4C4V B;  2G1E A;  4RF1 A;  5CHW A;  2I1K A;  3URY A;  5JHB A;  1R4M I;  3BYY B;  3RD2 A;  2KQ7 A;  3VR9 B;  3V6C B;  3DVG X;  2DEN B;  4GN1 A;  4RM8 A;  2BW2 A;  1I35 A;  2REX A;  3QX1 A;  4AJW A;  1NEN B;  2KFK B;  2ZZP B;  3RT3 B;  2CHZ A;  2V3P A;  2XNA C;  3WAN A;  3ZRF A;  4KVG B;  3GS2 A;  2WGS A;  3JSV A;  1NDD A;  1LO5 D;  4ZYN A;  3B2G A;  3KW5 B;  2KWU B;  1FXA A;  3NOB A;  5DPS A;  3Q8B A;  3Q8C A;  2KAC A;  4FXC A;  1KLG D;  1C4A A;  3AEB B;  1XF5 L;  1SJH D;  2NBU A;  3DBR I;  4W9G A;  1DOX A;  2Y5P A;  3ABV B;  1MG8 A;  3NVV A;  4XX5 A;  2WXN A;  3V3X A;  4FN2 A;  1EU3 A;  3T9L A;  2MBB B;  2BYF A;  4BKT A;  4EEW A;  1PDX A;  2G4D B;  4P16 A;  1OQR A;  2K25 A;  4GDK B;  2XBB C;  1EF5 A;  1UBQ A;  3BK1 A;  4EUT A;  1G6J A;  3ZXR A;  4C7Z A;  4GOC A;  3V60 A;  1WGK A;  3L54 A;  3OJ4 B;  2CJO A;  2DZK A;  4WWM A;  3DVN V;  2V3N A;  1C4P A;  3ENE A;  1UZX B;  1XXG A;  4JWS C;  2DNF A;  1AWD A;  1FRD A;  2M0X A;  3TBL D;  3H8H A;  4KIK A;  4MJS B;  2DYB A;  2ASQ A;  3W1S A;  5MPO A;  4HKQ A;  1YJ1 A;  3V62 A;  4DDI D;  3OAW A;  1GUA B;  1TS3 A;  5CHF A;  4EZL A;  4CHK A;  4W9C A;  2WXQ A;  2KDB A;  2OED A;  3B1L X;  2MP2 A;  3SFE B;  5L95 C;  3PZ7 A;  1TT5 B;  1V80 A;  2CHX A;  4S0R A;  3DHI C;  1P7E A;  3P4S B;  5G5G A;  4F1S A;  2CS4 A;  4LJO B;  1JWM D;  1WI0 A;  3C8Y A;  3PRZ A;  5I4D A;  2IO2 B;  1PYW D;  2LWP A;  3KUD B;  2QIE B;  4NJC A;  1GC7 A;  4LNN A;  3ZRC A;  4ITK A;  4M0W B;  2FCM A;  1EO6 A;  4NJ6 A;  4FUL A;  2KTR B;  2FUH B;  3UQB A;  2OHF A;  3IHP C;  2WQY B;  1GG3 A;  3DBR B;  2KVZ A;  4GSW A;  2YEP B;  5J17 A;  3R66 C;  2JQR B;  3N30 A;  3WA0 A;  2JVC A;  1YD8 U;  3RZF A;  3RFZ B;  5IAA C;  2B3A A;  3VTW A;  3BY4 B;  1WZ3 A;  1I4H A;  3TJP A;  2XEW A;  2AQ3 B;  2D3G A;  3A9K A;  2KN5 A;  4C56 C;  3JSV B;  4K7W A;  2D3B A;  1J7C A;  2WNM A;  3APC A;  2KYW A;  4RGT A;  2JUO A;  4TMA B;  4RGM A;  2BQQ A;  1EWY C;  1ENF A;  1YOV B;  4RGO S;  2J7Q B;  4LNO A;  3AEG B;  4TUU A;  4A8X C;  4LNI A;  2K8B A;  2IZV B;  2MBE A;  2V4L A;  3W1Y A;  2V3S A;  1T5X D;  2IGH A;  1KOT A;  4HRS A;  3SHQ A;  3B0A A;  3ZW3 A;  3NZ3 A;  3EFU A;  3AE7 B;  1P1A A;  3P63 A;  3L13 A;  4WAA A;  2GBR A;  2HD5 B;  3NRZ A;  3ZJT A;  1CZP A;  1WR1 A;  4ZDV A;  2I2Y A;  4RGN A;  3K9O B;  4A3O A;  3ZNG C;  1R7S A;  1STE A;  2JYT A;  3A9J A;  1YNT E;  2N9E B;  2V4I B;  1V2Y A;  1JAL A;  1ISN A;  2VRR B;  2LVQ A;  1B9R A;  5HG2 A;  2JSV X;  2MQJ A;  4WJN A;  4MGY E;  2KX3 A;  3FKY A;  4NJ7 A;  3P4Q B;  3P4P B;  4C80 A;  1QZE A;  1TS2 A;  3QAR A;  3EUB 2;  1VD2 A;  2MCN B;  4KX6 B;  1ZE3 D;  1FPY A;  4GXB A;  1QOA A;  1KF6 B;  3AE2 B;  2NVU I;  4CO7 A;  1WGY A;  4FBJ B;  1SSN A;  2LGX A;  4LJP B;  4KIK B;  4II3 B;  2DLB A;  3Q2A C;  3VR8 B;  5EE0 A;  2D10 A;  1WE6 A;  5JXV A;  2KDE B;  2EMS A;  1F52 A;  3MHS D;  4RNA A;  1C79 A;  4BBN C;  1PGB A;  2BWE S;  2RR9 A;  2NS5 A;  3MJW A;  4HK2 A;  3L16 A;  4R3D A;  4X57 B;  2MP2 B;  3S2A A;  4HDQ A;  4GLS C;  1T0Y A;  4AJY B;  3LJ3 A;  2KFJ A;  5BMG A;  2KWD A;  2LXC A;  3TCA A;  1L4D B;  2CHW A;  4PS3 A;  2N9X A;  1FEH A;  2L76 A;  1SB3 C;  4FJZ A;  2JXT A;  5DCN A;  2VZK B;  3AB5 A;  4WAF A;  1WH3 A;  3GE8 C;  3CIR B;  5G5H A;  2UWQ A;  4CQN A;  4XWT A;  2MBQ A;  1T6B X;  2WXL A;  4W9L A;  4ICV A;  5KHQ A;  1Q10 A;  3PHW B;  2O6V A;  4MM3 A;  1PFD A;  2J0J A;  4GB9 A;  2IND C;  3P1M A;  2MJ3 A;  1FNW A;  2KT7 A;  3O13 A;  3TUO A;  2D5G A;  1TZO A;  4XDD A;  4LK0 M;  3DHH C;  2Y3A A;  3VXW A;  1VRA B;  2FID A;  3N32 A;  2K3U A;  3Q8A A;  1N61 A;  4FAD A;  3R2T A;  2AL6 A;  1ZPS A;  1FNV A;  2L1A A;  3Q8E A;  4M8N A;  1NI2 A;  5H92 C;  3TEY A;  1E0Z A;  3DCG A;  2INP E;  3A9K B;  3Q3F A;  1ET6 A;  4ZRP A;  1HTQ A;  2AQ2 B;  4FA6 A;  4YSZ B;  3ALB A;  1Z5S B;  3H1U A;  1TY2 A;  2LZ6 A;  2DAJ A;  3PV1 A;  5J2R A;  4PS7 A;  2GBN A;  2JU6 X;  5E6J A;  4KZ0 A;  2VH1 A;  2UYZ B;  1KFY B;  3AM9 A;  4EE2 A;  1FNU A;  2DBY A;  3AEC B;  2GBM A;  2KFK A;  3VUW A;  4FLH A;  4GU2 A;  2BS2 B;  2Z0D B;  2LGS A;  5IP4 D;  2RDH A;  4QAY A;  4ZRQ A;  3PSE B;  1ZP0 B;  4HPL B;  1UF0 A;  1B1Z A;  1YIW A;  1FMA D;  5DPT A;  3DBL B;  4E3C A;  1TS4 A;  4JLC A;  5HHD G;  1S1Q B;  1FO4 A;  5C1Z A;  1KH0 A;  2RGF A;  3SDL C;  3NG0 A;  2W9N A;  3X23 A;  1VDV A;  3A9J B;  4DXG A;  1YX5 B;  1GB1 A;  2Y5C A;  4KGR A;  1RAX A;  2IGD A;  3TEW A;  1P98 A;  2BYV E;  2BGF A;  4RFB A;  1WJ4 A;  5D6J B;  4BVU C;  2FNJ B;  4JWU C;  4GGQ A;  2KAJ A;  4M02 A;  3FAH A;  3PLV A;  1AYF A;  2HTH A;  1XD3 B;  2KLC A;  4MEM A;  5JH5 C;  1UWX A;  2JRI B;  4ACF A;  5D2M B;  2YLM A;  5EDS A;  3ZTC A;  3Q6B A;  1ZKH A;  2NMQ A;  4EZJ A;  3QHT A;  1SEB D;  3NVZ A;  3Q3O C;  3ZJV A;  2W54 A;  3NHE B;  3PZ8 A;  1GJZ A;  2R2Q A;  3ML9 A;  3AE8 B;  4LDT B;  1CJE A;  2K6Q A;  3U2S C;  1WF9 A;  5AUK A;  1MPE A;  4YT0 B;  1S3S G;  2JWU A;  3VH3 B;  3O65 B;  5HKH A;  3RMK C;  3SR6 A;  1HXY D;  2MX2 A;  1RFA A;  2C9W B;  2Y5B B;  4MJS A;  1TYG B;  3I57 A;  4IWQ A;  5D3D A;  3AE4 B;  2EEL A;  3EFC A;  1SE2 A;  3AEF B;  3P4R B;  4OHJ A;  2PMV A;  1GPX A;  3BVZ A;  1YN4 A;  3KH0 A;  1E8Z A;  3RUI B;  3B08 A;  3A1Q A;  2K1F A;  2XK5 A;  2IGG A;  3N20 C;  2JZZ A;  3VDZ A;  3PVL A;  4WIP A;  3Q8F A;  2O6V B;  3M62 B;  2V9H A;  5C2T B;  1F2R C;  3E56 A;  2JY6 A;  1XCQ L;  3T3N A;  2ZNV B;  2KWC A;  1HE8 A;  2L3Z A;  2EMT A;  3ECI A;  2Z59 B;  5BMH A;  3U52 E;  5AZF A;  1V49 A;  4URK A;  4AWJ A;  2AEH A;  2D11 A;  1ESF A;  4WWP A;  2VZK D;  2LVP A;  1I4Q A;  2FCN A;  4N58 A;  3OWE B;  2BKF A;  2BKR B;  2J0M A;  3Q69 A;  3R7Q A;  5L83 A;  4K81 A;  4HCP B;  2JPH A;  2K22 A;  2G4S A;  2RPV A;  1IGD A;  1WXA A;  5DPR A;  4II2 B;  3VRB B;  4BZA A;  1C78 A;  2IYD B;  4IUM B;  2N9K A;  3DBS A;  2BBC A;  2PE6 B;  4IKG A;  3VHT C;  2HDE A;  2MWS B;  1WJN A;  5LNK 1;  3PRM B;  2WHI A;  3OJ3 A;  4BBN F;  2N0S B;  3HIZ A;  3IT4 B;  2UU7 A;  4RCO A;  3EEC A;  4WQM A;  2EKE C;  4UDU C;  2KX0 A;  4D2K A;  1EWC A;  1MJD A;  4BKS A;  2M19 A;  1FM0 D;  1HQR D;  3M3J A;  1PGA A;  4XGA B;  1V9J A;  3ONS A;  1PGX A;  5AUI A;  2WXF A;  2W3R A;  1SIF A;  3RNA C;  4MAC A;  5EE1 A;  4N6E B;  2DZI A;  1E7U A;  1WY8 A;  2G9H D;  3UGB B;  1WJ6 A;  2JZ3 B;  2R61 A;  3N1Y C;  3DBH B;  2WU5 B;  3ZTD A;  1D5Z C;  2LD9 A;  4H2A A;  3VTU A;  2RDB C;  4ANX A;  1VLB A;  4TQ1 A;  4XWW A;  2XN9 C;  2KQ4 X;  4JIO U;  1OTR B;  2PKO A;  1OFF A;  3NVW A;  2K5P A;  3LYY A;  3RPF C;  2BT6 A;  5BMI A;  1AN8 A;  1KLU D;  1VZ7 A;  3ZO5 B;  1Q1O A;  3SU8 X;  2X38 A;  4YSX B;  2Z8L A;  1XLO A;  3W1S C;  1EM7 A;  2HE7 A;  2RMM A;  1C76 A;  2LRW A;  1TZ1 A;  2KAN A;  3N1Z C;  2KNB A;  2ZVO A;  4CYE A;  4AQ7 A;  3IT6 B;  3VUY A;  4K3C A;  1XQQ A;  2ZEQ A;  1N6Z A;  5CHV C;  4AP4 C;  3QA8 A;  5KHO A;  4WJP A;  2L83 A;  1TS5 A;  4JX1 C;  4TQ0 A;  3B2F A;  2L7R A;  3W5V B;  2KOX A;  1TKY A;  3P2B A;  2LMC A;  1P3Q U;  3PTF C;  4KKI A;  3U7Z A;  2BVC A;  4W9E A;  3KWV A;  2CKH B;  2K8C A;  2WXG A;  2QDF A;  4LDT D;  4YTN B;  3RI7 C;  4NAM A;  1GAQ B;  3A1Q B;  1JQ4 A;  2BF8 B;  2XK5 B;  1R4M B;  1WRI A;  1FXT B;  2IO1 B;  2KWV B;  3N1X C;  2KKC A;  4DHZ E;  2L05 A;  3AEE B;  4MH0 E;  1SE4 A;  3RNB C;  1EU4 A;  1QKZ A;  4E71 A;  3A4S C;  2BYT A;  1FFV A;  3ZYY X;  1UH6 A;  1TBE A;  3R2I A;  5FR6 A;  4IM0 A;  2LI5 A;  1SGH A;  4HPP A;  1OQQ A;  1C1Y B;  1JRO A;  3PRE A;  3BVG A;  2DZJ A;  3C19 A;  2O6V D;  4B6W A;  3OLM D;  3BIN A;  1I4G A;  2OJR A;  4DHJ B;  3T8M A;  3V6E B;  3DWG C;  1EF1 A;  4M8M A;  4M00 A;  1FCL A;  4C7Y A;  3NZU A;  3NZS A;  1YN5 A;  4YTP B;  2KJH B;  1HZ6 A;  2N1W A;  1V1O A;  1FFU A;  2MA9 B;  2KMM A;  4ANW A;  3I3T B;  3DVG Y;  2FAZ A;  1QOB A;  1NEK B;  3PT2 B;  2GRI A;  2CR5 A;  4YL8 A;  4JGH B;  4ASW C;  2ZPY A;  1RLF A;  1P9D U;  4C00 A;  4WH4 A;  4KDL B;  2LHE A;  4OZA A;  3AE3 B;  1L0V B;  4FJY A;  2PIA A;  3JW0 X;  1R4N I;  4AUQ C;  2CJN A;  1TJE A;  1WYW B;  1I4X A;  3HVD A;  5TSS A;  4A20 A;  1D4B A;  2IPK D;  1N5X A;  2CU3 A;  3QJZ A;  1YN3 A;  2W55 A;  2FIF A;  2MBO A;  2W3S A;  3RCZ A;  3PRP B;  4ICU A;  2KVR A;  4LCD E;  2JYE A;  2PTL A;  2N9P C;  3ZXV A;  3MP9 A;  2BTE A;  4RMA A;  3UIO B;  4MSM B;  1D3Z A;  2QC8 A;  4WJQ A;  4K7S A;  1TGZ B;  2LAS A;  4IWP A;  2C7H A;  2KMA A;  2PW9 A;  3MTN B;  4L23 A;  1UEL A;  2M56 B;  3L17 A;  3L4P A;  4B9K A;  3RN9 C;  4J6I A;  5JHA A;  4A9A A;  3Q3M C;  1D5X C;  3VAW A;  2AQ1 B;  3LB8 C;  1E7V A;  3B9J A;  2MW5 A;  1YJJ A;  3Q14 C;  5BYS A;  2QEJ C;  3ML8 A;  4DK5 A;  2WXR A;  2ON8 A;  5D3I B;  1C9F A;  3VRA B;  4NQK E;  3AXC A;  4LNF A;  4G3X B;  1L0X B;  5IO9 A;  4XZ4 A;  1K8R B;  1Q5W B;  1WYG A;  2RD0 A;  2N7E A;  4Q2J A;  1QLB B;  2KJ6 A;  4WUR A;  3R7R A;  4GMV A;  1WXM A;  2WDQ B;  2AX5 A;  2KHW B;  2L8J A;  3KWL A;  3ZKJ C;  3TMP B;  4NAW A;  2MJD A;  1V6E A;  3NY5 A;  1WX7 A;  2ZNV C;  3R3M A;  2D2Q A;  3I5J C;  4KGS A;  1ZUD 2;  2IDY A;  1VZ8 A;  3APF A;  2YVC A;  3NS8 A;  1WXV A;  1NBF C;  2PEA A;  4TSS A;  2AL3 A;  4DDG D;  1RM6 C;  3SFD B;  4MGK E;  4IW0 A;  2LEK A;  4HWI B;  3DWM A;  1R4N B;  4LNK A;  1BML C;  3UIN B;  2V0G A;  3EGR A;  1WM3 A;  2JX5 A;  2PLP A;  3BVM A;  2D3C A;  3L0W B;  4LLG M;  3NJT A;  2KJR A;  3J9C A;  1L6V A;  1UUP A;  2WXO A;  2GBK A;  1I4P A;  3H6N A;  2ZCC A;  2BS3 B;  2NCN A;  2FE8 A;  5BYR A;  4HDO A;  4KSK C;  1MHH E;  1HTO A;  4PYU A;  3U7D A;  1WWT A;  1XCT L;  3L08 A;  3CSF A;  1WR6 E;  2TSS A;  1VR9 A;  3BII D;  1WMH A;  1UBI A;  4F8C B;  2JF5 A;  2GMI C;  4DHJ D;  4MSQ B;  3GE3 C;  3KYC D;  2G45 B;  3WCQ A;  4JL9 A;  3QK0 A;  3DPD A;  3M95 A;  2ACZ B;  2DX5 B;  4MGI E;  2EKI A;  3UF8 A;  2L00 B;  3TSS A;  4I6L B;  2N4F A;  5IKC M;  2BWF A;  2J52 A;  2KN4 A;  3ZJU A;  1T0S C;  3FIL A;  4K3B A;  3ZNI D;  1N62 A;  1XLQ A;  2WX0 A;  3KYD D;  3VVW B;  3LXF A;  3K9P B;  5GMV A;  3TEX A;  2GLS A;  4BKS D;  3BWU D;  4P1B C;  4KZC A;  3PS6 A;  4WWN A;  2INC C;  2FCS A;  3PGE A;  1T0R C;  1YQ3 B;  1DOY A;  3MC8 A;  1WJU A;  1XT9 B;  1OQY A;  4P1C C;  1GNU A;  1I4R A;  1NVI D;  1FCC C;  1FXI A;  3AEA B;  2FBW B;  2KDM A;  3ZDM C;  1WXS A;  3GB1 A;  3ZIM A;  1V8C A;  4WWO A;  2DYM A;  2WXK A;  3BZD B;  2PVG C;  3ZLZ A;  3VH4 B;  2PPH A;  1J19 A;  1A70 A;  1ACC A;  2QHO A;  4ANV A;  1UWM A;  1CMX B;  2WXP A;  3AU4 A;  5DPW A;  2LGY A;  1XEE A;  1WX9 A;  2C7N B;  1SBB B;  4IM3 A;  4W9J A;  1SJE D;  4PS8 A;  1V1P A;  4N59 A;  1E7P B;  1WZ0 A;  4JQW C;  2JT4 B;  5GXG B;  4REZ A;  3W5U B;  4TV3 A;  3KVF B;  4NAW B;  4ZHO A;  3QWZ B;  3KUZ A;  2H88 B;  1WE7 A;  3CMM B;  3QAQ A;  2LGI A;  3APD A;  2RPQ A;  2KMC A;  4A55 A;  2FCQ A;  3N3K B;  3RNF C;  3BK2 A;  1Z2M A;  1T3Q A;  1OEY J;  3MFG A;  2PVO D;  4HVB A;  4IWO A;  3T3O A;  2R2O A;  1VCB A;  3DOW A;  1J8C A;  1BT0 A;  2Q5W D;  1J7B A;  3TL5 A;  1RYJ A;  4MEL A;  1GC6 A;  2WP9 B;  2QCZ A;  4XE0 A;  1WGD A;  1YX6 B;  4RM9 A;  1L2N A;  1TTN A;  1MG4 A;  2ZPN A;  3SEB A;  3TIX A;  1LM8 B;  1WMH B;  2WXI A;  2NPT A;  5IN7 A;  3CST A;  3AN1 A;  5E6O A;  1LGR A;  2IBI B;  1L6U A;  1TY0 A;  1RRB A;  4IM2 A;  1QIL A;  1QOF A;  1N60 A;  1ZDV A;  4N9F 4;  2MJE A;  2IJ0 A;  4GDL A;  1BUI C;  1DGJ A;  5CX3 A;  4ZRI A;  5EE9 A;  4ZRK A;  1PQS A;  3FIL B;  3QQ8 B;  2KO3 A;  3ZNZ B;  3IXS A;  2M1M A;  4ZHP A;  2ICI A;  5IOI A;  3AH7 A;  3LDZ E;  1SE9 A;  5G55 A;  1ET9 A;  1KRH A;  3AI5 A;  1OGW A;  2BS4 B;  2GOW A;  2NR2 A;  2M8S A;  3SD5 A;  4MT5 A;  4HKZ E;  4RH6 A;  3H7P A;  1V97 A;  4A90 A;  1P7F A;  5FKA C;  2WDR B;  3Q3J A;  5CTR C;  1RWS A;  4W9I A;  2BB6 A;  1F2R I;  3PZD A;  2DHZ A;  3UIP B;  3TEZ A;  2WXM A;  1KTK A;  1IBX B;  2AYO B;  3HUI A;  4YTM B;  5LXI B;  4BAX A;  1UGJ A;  2C7M B;  1DYQ A;  2NTS A;  2MBH A;  4HPM B;  3Q3N C;  2KDF B;  1JRU A;  2ZCB A;  1E8Y A;  2WU2 B;  3RNC C;  4EKU A;  1U4A A;  4US8 A;  2LXA A;  2N7D A;  2BYE A;  4A3P A;  4WJO A;  1XLN A;  1L5P A;  1M4V A;  1CQV A;  3D32 A;  1NI3 A;  1T0Q C;  1V1P B;  2N7J A;  5AZH A;  2VH2 A;  2JZP A;  2ZVN A;  5C23 A;  2SEB D;  1D5M C;  3L10 B;  4PK1 A;  3HHM A;  1XLP A;  1C77 A;  1QQR A;  4IOI E;  1YQ4 B;  2WS3 B;  1JML A;  2M0A A;  1DOI A;  3GZN I;  1K51 A;  1TIF A;  1K52 A;  3MHZ A;  4L2Y A;  5C3J B;  1TKG A;  2WXH A;  2ZJD A;  4K1R B;  3W2D A;  1WXQ A;  2IY1 B;  4OVU A;  3MC9 A;  4W9F A;  2L32 A;  4G11 A;  4YSY B;  3OG5 A;  1QT9 A;  4F7Z A;  1E10 A;  4XYC A;  1IPG A;  3N9Y C;  1JWU D;  1IGC A;  4O1N A;  4EOY A;  1WIA A;  4NNJ B;  3AU5 A;  3IVF A;  3I63 C;  1ROE A;  4I6N B;  4KKJ A;  2LFI A;  2GI9 A;  2KXJ A;  3EC8 A;  4S17 A;  2MRP A;  3U30 A;  2J4X A;  2NBV B;  2IY0 B;  2NPT B;  3PHX B;  1C3T A;  2W82 A;  3A4R A;  3DQV A;  3PLU A;  2J53 A;  2WDT B;  4YWG G;  1MI0 A;  1YJI A;  1L7Y A;  2K39 A;  3RZW C;  1OEY A;  1CK1 A;  2BB5 A;  3M63 B;  3ZNH B;  3HM6 X;  1EUV B;  4RF0 A;  3H9D A;  3W9C B;  3HM3 A;  3KLS X;  2L52 A;  2J0K A;  1V81 A;  2K0P A;  4GDL B;  5HI1 A;  1RFK A;  2MEK A;  5D7G A;  4YXD B;  1WGH A;  1SXT A;  3ETR A;  1KJT A;  2KLG A;  1E8X A;  2K9X A;  2N1V A;  1SF0 A;  2LVO A;  4WQO B;  2M4N A;  4HCN B;  4NQL B;  2IO3 B;  4FJV B;  1YQB A;  1ZXI A;  3H7P B;  4HXD A;  1WGG A;  1VJK A;  2D07 B;  1QF6 A;  2I38 A;  3EA6 A;  2KDI A;  4DWF A;  3AE9 B;  4OZC A;  1JWA D;  4J3O D;  1E8W A;  1WFY A;  3WIM A;  3GZN B;  2L0T A;  2QSD A;  1HEZ E;  2JRH A;  3C0R B;  3HVZ A;  1Y56 A;  1JW9 D;  4JPS A;  1KM7 A;  4ANU A;  3VUX A;  3IAS 1;  1FRR A;  1NYR A;  1X1M A;  2YEP F;  3ZQ4 A;  2DAF A;  5EE3 A;  1WSP A;  5H8Y E;  3RYT A;  1FIQ A;  3GOE A;  4ZYS A;  2DZM A;  3WAL A;  1JWS D;  2D3A A;  2JXX A;  2MH7 A;  2A4Z A;  2KTF A;  2X8X X;  2RSU A;  1J0G A;  2I1J A;  4W9K A;  2OOB B;  2E6X A;  4JE3 B;  1YMH E;  5T8I A;  1IP9 A;  1MFW A;  3AE5 B;  1E6E B;  4W9D A;  1F77 A;  4BKG A;  2RDG A;  3UI3 A;  1SIJ A;  1QOG A;  3HRD D;  2H89 B;  3I9V 1;  5D94 A;  3H7S A;  1L0Y B;  3PO0 A;  4PYZ A;  3MJ5 A;  3AED B;  1L4Z B;  1HA5 A;  2NBW B;  3DBL I;  5BYQ A;  2KD0 A;  4LTU A;  5LLI A;  3E9S A;  2V1Y A;  1SE3 A;  2C5L C;  2LGD A;  2LUE A;  4HJK A;  4EFO A;  3VTV A;  1UGM A;  2GB1 A;  2QIL A;  3NUH B;  4ZOH C;  1ZGU B;  1ZDX A;  3NS1 A;  2KC2 A;  2Z0E B;  5AZG A;  4OVZ A;  1E5W A;  4E74 A;  3BYT B;  2MLB A;  4KGT A;  2IO0 B;  1JWB D;  1K50 A;  2WDV B;  5IA7 A;  3JVZ X;  4B0E A;  2WLB A;  1UD7 A;  3QC8 B;  4AOF A;  3AE1 B;  2ZW0 A;  2QJL A;  2KQS A;  4XDC A;  4DXA B;  3RUL A;  3CF6 E;  1IUE A;  1NYQ A;  1XO3 A;  1MHX A;  1V5T A; 
#chains in the Genus database with same CATH homology
 3N20 C;  3RMK C;  3I5J C;  1T0S C;  3RNC C;  3DHG C;  3RNB C;  3RNG C;  3N1Z C;  3GE8 C;  3DHH C;  3RNF C;  4P1C C;  2RDB C;  3GE3 C;  3Q3O C;  3RNE C;  3RI7 C;  3Q2A C;  3RNA C;  1T0Q C;  2IND C;  3Q14 C;  3RN9 C;  4P1B C;  3I63 C;  3Q3M C;  3Q3N C;  2INC C;  3N1X C;  3N1Y C;  1T0R C;  3DHI C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...