1T0QC

Structure of the toluene/o-xylene monooxygenase hydroxylase
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
83
structure length
83
Chain Sequence
TFPIMSNFERDFVIQLVPVDTEDTMDQVAEKCAYHSINRRVHPQPEKILRVRRHEDGTLFPRGMIVSDAGLRPTETLDIIFMD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Toluene/o-Xylene Monooxygenase Hydroxylase from Pseudomonas stutzeri OX1: INSIGHT INTO THE SUBSTRATE SPECIFICITY, SUBSTRATE CHANNELING, AND ACTIVE SITE TUNING OF MULTICOMPONENT MONOOXYGENASES.
pubmed doi rcsb
source organism Pseudomonas stutzeri
molecule tags Oxidoreductase
molecule keywords toluene, o-xylene monooxygenase oxygenase subunit
total genus 25
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2004-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF06234 TmoB Toluene-4-monooxygenase system protein B (TmoB)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.270 Alpha Beta Roll Ubiquitin-like (UB roll) TmoB-like 1t0qC00
2INDC 3N1ZC 3Q2AC 3N20C 1T0SC 3RN9C 3I5JC 3RI7C 3Q3OC 4P1CC 1T0RC 3Q3MC 3DHIC 3RNBC 3RNCC 3Q3NC 3RNGC 1T0QC 3Q14C 4P1BC 3I63C 2INCC 2RDBC 3RNEC 3RNFC 3GE3C 3RNAC 3N1YC 3RMKC 3GE8C 3N1XC 3DHHC 3DHGC
chains in the Genus database with same CATH superfamily
3GS2A 1EU3A 1Q0WB 1V5OA 4ARCA 2VH2A 3QWZB 1ZDXA 3KW5B 4W9JA 2WU5B 1OEYA 3U7DA 4MM3B 1HTOA 1WYGA 2RDBC 3PS6A 2D3BA 3WAMA 2LGYA 3GE3C 2WXLA 2MA9B 1TS2A 1YOVB 3TL5A 4B0EA 1XLNA 5DPSA 2LZ6A 2C9WB 5BO4B 2J53A 1R4NB 3EFCA 4LJPB 2MBBB 2PPHA 2WDQB 4DHZB 1WMHB 1YNTE 2BB6A 2N7JA 1WJNA 4RMAA 2BKFA 3RZFA 3R7RA 2GOWA 1HZ5A 1XD3B 2N9EB 1QOFA 2LUEA 2WXJA 2M17A 2ZEQA 3RD2A 3P42A 2IPKD 4GGQA 3UQBA 4NQLB 3C19A 4BOZB 2N4FA 1UH6A 2AQ3B 1E8YA 4A3PA 3R8BA 3DHIC 1F1HA 2K8HA 1A5RA 2BB5A 2O6VB 2N9LA 3BY4B 4G11A 1XLOA 2BS3B 2L3ZA 1SE3A 3C8YA 1WXSA 1FMAD 2JZZA 3TEXA 3R3MA 3L4PA 1TJEA 1IUEA 2K8CA 3AE6B 4GSWA 2KWCA 4WQMA 1P1AA 1WE6A 5EDSA 4MEMA 2C7HA 4YSZB 2ONQA 2KAJA 3VQIA 1XCQL 3W5VB 1YMHE 4G3XB 2RPVA 1M4VA 1TT5B 4K3CA 2Z8LA 1B9RA 3PRZA 4LLGM 1IP9A 1EWCA 5J2RA 1NENB 2E6XA 1IGCA 4C56C 2ZZPB 2WXGA 4MGZE 4YTPB 2I38A 4PS7A 4GOCA 4MJSB 4K1RB 3Q8EA 4EFOA 3TMPB 4WIPA 1J7CA 2QEJC 2IGHA 3RNFC 1IPGA 2WX1A 3L10B 3M95A 2XBBC 4ANWA 2Y5CA 3IVFA 2IY0B 2D07B 4NAWA 5EE9A 4MGIE 1UWXA 4LCDE 2IYDB 4ANUA 1V49A 4MT5A 1F52A 1R4NI 5AZGA 5TSSA 2J0JA 3NG0A 1JALA 3IG3A 2HTHA 2J4XA 4BKTA 3LXFA 2M56B 2QDFA 4EUTA 5MPOA 3HUIA 4RGMA 2CKHB 4KSLC 3ZNGC 4EZJA 2ZVNA 2LGIA 1TGZB 3BYYB 2GLSA 1TY0A 2AWTA 2DYOA 2LJ5A 3O65B 4LNIA 3ZUNA 4E74A 4I6LB 1XT9B 1L6VA 4XC2A 1GAQB 4BZAA 5HFYA 4M02A 4LK0M 1IBXB 3I9V1 3L16A 1TZ1A 1TKYA 3AXCA 1YN3A 3KH0A 3O13A 3Q69A 5FR6A 5AUKA 2FIDA 4AJWA 3SD5A 1WX9A 3ML8A 5KHQA 4K3BA 3BIID 1FRRA 2D2QA 4F7ZA 2HE7A 5E6JA 2INDC 3BZDB 2W9NA 4M8MA 1J7AA 5EE1A 5EE3A 4X57B 4WURA 2BW2A 1LGRA 3BK2A 2XNAC 4GN1A 3DBLB 3L0WB 1KJTA 1UUPA 3RNEC 3APFA 2HTME 2KDBA 5HG2A 1V81A 1DOIA 3I5JC 4IUMB 4KIKA 2I1JA 3PHXB 5JHBA 2DYMA 4NJ6A 4CHKA 3DQVA 4JWSC 4YTNB 3U30A 2D3CA 2KYWA 4AWJA 2BKRB 5E6PA 2X8XX 4W9IA 2K0PA 5BYRA 4XYCA 3AM9A 4RGOS 4N59A 2GRIA 4IDIA 1SE9A 1L4DB 3H8HA 1YX5B 3H7PB 4WJQA 4M8NA 3AE3B 3B08A 1YQBA 2XEWA 2JZPA 3U7ZA 1V8CA 4TQ0A 3E56A 4BVUC 3ZQ4A 3ENEA 3HHMA 2RGFA 1WY8A 2JPHA 4TV3A 2JQRB 5JXVA 3W9CB 2QILA 2AEHA 1UWMA 3RFZB 4OZBA 2FNJB 1WGHA 2BTEA 1V6EA 1TS4A 2R2OA 4P16A 1NEKB 4K7UA 1D4BA 2KTRA 1CZPA 1E5WA 3KUZA 3QARA 1V86A 4TKNA 4E71A 2WP9B 3A4RA 3MFGA 1RRBA 4AQ7A 4P1BC 4MGKE 1TY2A 3DBLI 2NTTA 1GOZA 4HLEA 1XF5L 1TBEA 1WJ6A 2FCQA 3FAHA 1R4MB 1WM3A 3D32A 2JUOA 1WYWB 3DBRB 3KWVA 1EF1A 2INPE 3RZWC 3JYUA 2KMMA 4L1BA 3CIRB 3HM6X 1XLQA 1ET6A 3AI5A 2WDTB 2K6QA 4XWWA 1QT9A 2JXXA 2V0GA 1ZGUB 3VTWA 4OZCA 3KWLA 5D3DA 2L8JA 2J7QB 2KKCA 1JWSD 2IDYA 3ZKJC 1EUVB 2V9HA 3OJ4B 2W3SA 4GB9A 3NS8A 1YJJA 3BK1A 1HEZE 2DWQA 2LXAA 2KFKA 3M3JA 1BT0A 1KRHA 1STEA 3Q6BA 3X0WA 3PPAA 4H2AA 4USAA 4A6QA 2LASA 3HM3A 2M0AA 2LJIA 1SSNA 1XEEA 1SB3C 1FXIA 4ZRIA 3I3TB 3IT4B 4AP4C 1I4GA 1FEHA 1SGHA 4N9F4 2WHIA 3ZTCA 4RF1A 4US9A 2WXMA 4NPNA 2FCSA 1FRDA 1MHHE 4L23A 1HZ6A 3V3XA 2WQYB 3PRPB 4TMAB 2VZKB 2RDGA 1TS3A 1L0VB 3AV8A 1FPYA 2WU2B 3FILA 3BVMA 2DZKA 2MJDA 5J17A 1T0YA 4KDIC 2KWUB 1OTRB 5DPRA 4IM2A 2W82A 3DVGX 4FJZA 4MJSA 2ZNVB 2WDVB 4RH6A 3LJ3A 4K7WA 4PK1A 2O2VB 2J0KA 2L0TA 2LHDA 2KJHB 2KWDA 2QMTA 1WXMA 4JX1C 2KJ6A 3QK0A 1C4PA 1WR6E 4GIVA 2MBEA 3NVZA 2PEAA 3VFKA 1OQRA 2PVOD 3AE5B 3EC8A 1MFWA 1VD2A 4M01A 4HJKA 1LQBA 2PLPA 2K25A 3WCQA 1CK1A 2R61A 3MC8A 1P3QU 2KVZA 3VRBB 2MSED 3VH4B 2RMMA 5LLIA 1NI2A 2BYEA 1V97A 2KMAA 4W9LA 1BUIC 1Y8RC 3A4SC 4KGRA 2C60A 1A70A 1EM7A 2EMSA 2ZCBA 3NZUA 2LRUA 4K7SA 3M62B 1K51A 4OVUA 2KD0A 3AE7B 3RNGC 3PRMB 3AEGB 1WF9A 3S2AA 3PZ7A 4W9HA 2PIAA 3PSEB 4LDTD 1EO6A 2BF8B 4W9CA 2X38A 1T0RC 2N1VA 3IT6B 4WJPA 4KIKB 3UINB 4ZRJA 1UZXB 2WXIA 4NAWB 1T0QC 1FXAA 5BMHA 2V1YA 1D3ZA 1D5XC 2PW9A 4JPSA 4OZAA 3KUDB 4DDID 3H6NA 2A5UA 4AUQC 3VTUA 2J42A 4KV2A 3P1MA 4WAFA 1PUTA 2BWFA 2RD0A 1TKEA 3AEFB 2HDEA 4FADA 2XK5B 1L5PA 2J0MA 5C3JB 1MJDA 2L52A 2LVOA 3QX1A 3TEZA 4CYEA 3H9DA 3K9PB 2B76B 2D5GA 2IBIB 1WGYA 2JYEA 3EA6A 2L76A 4FHKA 1ZUD2 2JYTA 2LI5A 1ZP0B 2YLMA 1V1PA 2INNE 4YSXB 4FN2A 3V05A 3R7QA 3PLUA 3Q8FA 2MCNB 2NTSA 3EECA 2XN9C 1WI0A 3AE8B 3WAPA 3A1QA 1YX6B 3ZXVA 3IAM1 3VDZA 4RF0A 2JF5A 4NNJB 2B3AA 3N3KB 2Q5WD 4N6EB 1IYFA 4EKUA 2ZPNA 1WXQA 2IGGA 1XCTL 1QOGA 1Q1OA 4ICVA 3PZDA 3FILB 4MELA 3RULA 1CMXB 2JRIB 4LNNA 3ETRA 1PGBA 2K39A 1PYWD 2KLCA 1FFVA 4IWPA 4IM0A 1V1OA 2YVCA 1FM0D 1PGAA 1RAXA 2BQQA 2GBKA 2KWVB 3ZNID 4JQWC 3OAWA 4DBGA 1JWUD 1OFFA 3Q8BA 3B2GA 4MGYE 2KK8A 1JWAD 2KT7A 3AEEB 5TR5A 1M94A 1P7FA 1NDDA 1R4MI 1SBBB 3MC9A 4XDCA 4YWGG 2M8SA 3EGRA 4WAAA 5G5GA 3RNBC 4FJVB 4MACA 4DHJD 2BYVE 2WXKA 3K9OB 5DPWA 1UD7A 2EKEC 3T9LA 1BMLC 1UGJA 3DBHB 5D2MB 3HVZA 3N30A 4N58A 3N20C 2KDEB 1E8ZA 1VJKA 1WXVA 4ZOHC 2RR9A 3L17A 3VHTC 3CMMB 5DCNA 1J19A 5D7GA 5GMVA 3SEBA 2GBRA 3L13A 5HI1A 4WWNA 1XQQA 1YD8U 4LTUA 3QCAA 4KVGB 3RNAC 1E90A 2L7RA 1B1ZA 4ZRKA 2HD5B 2LRWA 2JRHA 3VH3B 5DPTA 3ZVVA 3HVDA 1PGXA 5L95C 2MJ3A 2YEPB 1ISNA 1RLFA 2L05A 3JW0X 2VZKD 5IA7A 2LVQA 3TBLD 3QIJA 2NBUA 3NOBA 3VR9B 3DVGY 4OHJA 2MJEA 3GZNI 3W5UB 3TEWA 3RI7C 1E9MA 1D5ZC 1TYGB 3UIPB 3FKYA 2ZW1A 3JSVB 3SFEB 2YEPF 1ZKHA 1E7UA 4WQOB 4BOSC 2C7MB 2MBQA 1ZDVA 1CQVA 3U8ZA 2KNBA 4MDKE 1Y56A 4HDOA 1F9JA 2DX5B 2M1MA 4II3B 3P4SB 2WDRB 1EU4A 5T8IA 1QOAA 3QAQA 2DHZA 3PZ8A 4NY0A 1AW7A 1JW9D 2QSDA 3DDCB 1ROEA 3VVWB 3QQ8B 2R2QA 4Q2JA 4DXAB 2LVPA 3GE8C 1LO5D 3MP9A 4DXGA 3PVLA 4PS8A 2UWQA 2JXTA 2BT6A 4MH0E 4C4VB 4FBJB 2NBWB 1I4RA 4HCPB 3RPFC 2ICIA 2AX5A 4GU2A 3NY5A 3CWIA 3MHSD 2KC1A 1WXAA 1R7SA 2CHWA 3DHHC 3PO0A 4GDLB 2MW5A 3V6CB 4IG7B 3P4PB 3VUWA 2CR5A 2K8BA 1ZXHA 4C00A 2GBMA 1UBQA 4HEA1 2O6VD 4TUUA 4EEWA 4KZ0A 3Q3JA 2BYFA 4MSQB 4HJGE 2JU6X 1YJIA 4IOIE 1I7HA 2W3RA 2L83A 2MHJA 4HK2A 5FR3A 3KYDD 4YSYB 3R2TA 1JROA 4HCNB 2WXFA 3DVNU 5BYSA 3TEYA 1RWSA 1G6JA 5JZEB 4DWFA 2MBOA 1K53A 2KACA 4DHZE 2N7DA 1F0ZA 4WWOA 3ZRFA 2E3TA 1PQSA 1WGDA 3OLMD 2K6DB 1VLBA 4JGHB 3P4QB 2JSVX 3BYTB 5E6OA 4M00A 2OEDA 2KTRB 3ZJTA 3RMKC 2QC8A 1E8XA 1P9DU 4WWPA 2DAJA 1T6BX 1FD6A 4EZLA 1V2YA 2KTFA 2KFKB 4CO7A 1GB1A 2KXJA 4QAYA 3DPDA 1V80A 4D2KA 5D94A 5AZFA 3ZDTA 2PE9A 3TCAA 3OG5A 4MM3A 3NHEB 4ZRPA 3IFWB 4AOFA 4ITKA 1KTKA 5BMIA 1ACCA 1HQRD 5FK9C 1HA5A 3A9JA 2VH1A 4HWIB 4LNFA 4PYUA 1KLVA 2DENB 3KVFB 1ZE3D 2LD9A 2UYZB 1TZOA 1MI0A 1E6EB 3FC4A 4KX6B 2G9HD 4I6PA 4URKA 2G4SA 4AJYB 1HTQA 2WXQA 3RNCC 4RCOA 1QOBA 3RYTA 5KHOA 1SF0A 2NMQA 4KKIA 5J18A 2KOXA 2WX0A 3Q3NC 3AEAB 3NZSA 4KGTA 1XLPA 5IN7A 1OQQA 1N6ZA 4GLSC 1SJED 4ZRQA 2G45B 4XGAB 2PJHA 2KDFB 2KZRA 3B0AA 2V3SA 4HPPA 3AULA 2OJWA 2Y5PA 4TSSA 2FCNA 4AS1A 2DZMA 2PMVA 2LMCA 4W9DA 2KANA 3V62A 4M0WA 1LM8B 2L00B 3DBHI 1KLUD 1V9JA 1NVID 3L54A 4FULA 3ZXRA 3APDA 2N7EA 5BYQA 3CF6E 3U52E 3QHTA 2KDMA 4II2B 5I4DA 2JZ3B 3N9YC 4PS3A 2J52A 1KF6B 2XK5A 1PFDA 1ET9A 1EWYC 1VR9A 1NBFC 1E8WA 4LNOA 1QF6A 5C23A 4WJNA 4FA6A 2V4LA 1RFKA 3PT2B 2WGSA 3CSFA 1TKGA 3V60A 1MPEA 1YJ1A 2TSSA 2IGDA 4A20A 3AECB 2CHXA 1DOXA 1DGJA 4RM9A 3EUB2 4LNKA 5GXGB 1RM6C 3M63B 1QLBB 3A9KB 2FBWB 3A33B 2WXPA 2WS3B 2LWPA 4IM3A 1L4ZB 1WJUA 3RCZA 3TJPA 4W9KA 2MP2A 3E9SA 2GI9A 4XE0A 4ZHOA 1WGRA 2PTLA 3PLVA 3A9KA 4WH4A 4DK5A 3QJZA 1FCLA 4B0MA 4DHJB 4MSMB 2L0FA 4K81A 1WM2A 3N1YC 2PKOA 3N1XC 2H89B 3AE9B 5CHWA 1WFYA 2BGFA 1GB4A 3A1QB 4C7ZA 3DOWA 2KQ7A 2MWSB 1JQ4A 3VUYA 2QCZA 4JIOU 1P98A 4P7IA 4HPMB 3UIOB 2CS4A 2KX0A 2I1KA 3NJTA 1GPXA 3IXSA 2G1EA 3SDLC 1EF5A 2KN4A 4HKZE 3JSVA 3V6EB 4P1CC 2LEKA 4JWUC 2IY1B 2CHZA 5IAAC 4BFRA 5AZHA 1MVKA 4YL8A 3DWMA 1NYRA 2C5LC 3OWEB 2BS2B 1I35A 1C76A 1WR1A 5L83A 4A8XC 3L08A 2OHFA 1U4AA 3WIMA 4FJYA 1AYFA 1L0YB 2AQ2B 4DQOC 2SEBD 3ZW3A 1P0RA 3CSTA 4B6WA 2A4ZA 1I42A 2ZCCA 3NS1A 3PREA 3NUHB 4DDGD 1FO4A 4W9EA 5HKHA 2WXRA 3I63C 1WZ0A 4J6IA 3AE1B 3AMZA 3RUIB 4RGTA 1XXGA 5CHVC 3Q2AC 3LB8C 3B2FA 4ZYSA 2WXOA 3ZIMA 2W54A 1VRAB 4GDKA 1F77A 2BS4B 3MJWA 4HRSA 1WZ3A 2NS5A 2BVCA 2LGXA 1C1YB 4JL9A 4C80A 2M19A 1QKZA 3AE4B 1JWBD 1N61A 3VTVA 4EZKA 3ZGZA 4ARIA 3NRZA 4RNAA 4XX5A 2D10A 4F8CB 3ML9A 1GUAB 3Q3MC 4ASWC 3HIZA 1RYJA 4KZCA 3ZNZB 1MHXA 2QJLA 2LGDA 2FCMA 4XDDA 4W9GA 1TTNA 2MBHA 1SIFA 2FUG1 1WJ4A 4B9KA 1IGDA 2Z0EB 2MEKA 2JWUA 1L0XB 2V4IB 2O2VA 1C4AA 4KSKC 2BBCA 2BPSA 3W2DA 3NZ3A 2N1WA 2KO3A 3Q14C 3SU8X 2CJOA 3ABVB 2V3NA 4RGNA 4JE3B 2LXCA 3MC0B 2OJRA 5LXHA 2CU3A 2V3PA 5G55A 4EE2A 2EKIA 1D5MC 1HXYD 1FNUA 4G50A 3NVWA 1L6UA 1LXDA 1I4QA 1VZ8A 4CQNA 5HHDG 1Z2MA 1AN8A 1FXTB 2M4NA 1WGGA 4M0WB 5LNK1 1QILA 3AB5A 4BBNC 1JMLA 1NI3A 4ZYNA 2JX5A 3TSSA 4YT0B 5EE0A 4GDLA 1OQYA 2W55A 2REXA 3N1ZC 1GG3A 2ZVOA 2O6VA 2DZIA 1JRPA 2KJRA 4BAXA 1SE4A 4BKSD 2D3AA 4FXCA 1LFDA 3U4EG 3P63A 2IO3B 3J9CA 3DCGA 2Y5BB 1WMHA 3H7SA 1SJHD 3P4RB 4IW0A 5IKCM 1J7BA 3ONSA 5JH5C 4NAMA 4RFBA 1VZ7A 2KDIA 4L2YA 3B1LX 1TS5A 4HXDA 1YN5A 5LXIB 5H92C 2PVGC 3DBSA 4HVBA 3DVNV 5C1ZA 3VRAB 1I4PA 1ZXIA 2NPTA 2WXNA 4WJOA 3Q8AA 2H88B 1WSPA 2ZJDA 1BXTA 2BWES 2QHOA 4ACFA 4LJOB 4HPLB 1MG4A 4FHJA 4R3DA 1T3QA 2MP2B 3BVGA 3WANA 2GBNA 3ZTDA 1ZPSA 1C78A 4HROA 4OVVA 3Q8CA 3P2BA 1YQ4B 3T3NA 4ICUA 2ZNVC 3PTFC 2G4DB 3NVVA 1UF0A 2KMCA 1Q10A 1KM7A 1DOYA 2K9XA 2IO2B 2IO1B 1WRDB 3WALA 1UBIA 4REZA 1T5XD 2LHEA 3Q3OC 4HDQA 1XO3A 1JRUA 2RSUA 3BVZA 3R66C 4GXBA 1MG8A 1OGWA 4GMVA 2NR2A 1S3SG 1WWTA 1CJEA 2DZJA 5BMGA 2WYQA 3APCA 4MH8A 2EMTA 1UGMA 1X1MA 4P6VF 5FKAC 3HRDD 3KLSX 4BKSA 3T8MA 2WWZA 1FCCC 1WX7A 4DXFA 2SAKA 1V5TA 4YTMB 3UI3A 1ZOYB 2KHWB 2EELA 1IBXA 1Q5WB 1DYQA 2DYBA 4F1SA 4A3OA 1N5WA 3GZNB 4IWQA 3NVYA 3EHVA 1GNUA 2Y3AA 3KUCB 2QIEB 1I4XA 3PGEA 5G2NA 1K52A 2M0XA 4J3OD 3SR6A 1AARA 3C0RB 1KFYB 3TUOA 1L2NA 1KLGD 2NCNA 5IP4D 3ECIA 2N9KA 4PYZA 1VCBA 1T0SC 1L7YA 4IC7B 2KN5A 1OEYJ 3UGBB 2VRRB 5JHAA 2LGSA 4FLHA 2K3UA 3A9JB 1UELA 4NJ7A 1N62A 3ZJVA 1WRIA 3ZYYX 2CU1A 2JT4B 4YXDB 3OJ3A 1H4RA 3IHPC 3AN1A 2AL6A 2KFJA 2MLBA 3QA8A 4XWTA 1QZEA 1C3TA 3ZJUA 3VR8B 3AU4A 3GP7A 3RN9C 4IWOA 1KOTA 2DLBA 2DBYA 5C2TB 2NPTB 3W1SC 1H8CA 5H8YE 4S0RA 2WNMA 3AE2B 3PHWB 3LYYA 4LDTB 1N63A 1RFAA 1D6EC 4NZLB 4C7YA 2GB1A 5CX3A 2LUMA 2I2YA 4NJCA 1WH3A 3ZRCA 4TQ1A 5IOIA 4NQKE 2K5PA 3ZLZA 2UU7A 4OVZA 3TIXA 3UF8A 2N9XA 2JWZA 1VDVA 2JY6A 2KQSA 2ZPYA 5D6JB 1VZ6A 2DAFA 2IZVB 1GJZA 1F2RI 5AUIA 3IAS1 3JVZX 3KYCD 5AEKB 3WAOA 3Q3FA 1GC6A 3GOEA 1WX8A 2PE6B 1ZW7A 4WWMA 2HJ8A 1UNSA 1WGKA 3LDZE 4PT5A 3VUXA 5IO9A 2AYOB 3SHQA 2L1AA 2N9PC 4EOYA 1QQRA 2D3GA 3BWUD 3ZDMC 4KDLB 3QC8B 5CTRC 2FUHB 4B95A 2KQ4X 4A90A 2N0SB 3WA0A 2KX3A 1K8RB 1N60A 1E0ZA 1NYQA 1J0GA 2MRPA 3URYA 2ON8A 3X23A 1C9FA 3H7PA 4BBNF 2DNFA 4UDUC 3VAWA 2MQJA 1FNVA 3ALBA 3HK0A 1FIQA 1YN4A 4I6NB 4C4VA 4RM8A 2LFIA 4BKGA 2FE8A 4US8A 2WLBA 1C79A 2NBVB 1ESFA 4GDKB 2FAZA 2C7NB 1N5XA 3MJ5A 3PV1A 1FNWA 2ZW0A 1SE2A 3MHZA 5D3IB 4KGSA 1SXTA 2Z0DB 4OW0A 3BINA 2L32A 1PDXA 3UQAA 3B9JA 4A55A 3AEDB 2OOBB 4ZHPA 5E6NA 3I57A 2G3QB 1ENFA 1F2RC 2ASQA 2K1FA 2RDHA 3ZNHB 1C77A 1JWMD 2K22A 2BYTA 1WIAA 1AWDA 1SIJA 1JCKB 4HKQA 3T3OA 2AL3A 4S17A 4A9AA 2JVCA 2GMIC 4O1NA 1E7VA 4W9FA 2RPQA 2ACZB 3AEBB 3RT3B 3W1YA 4IKGA 1FFUA 3N32A 1J8CA 2WXHA 2INCC 1YQ3B 1V1PB 1K50A 1E10A 2KC2A 4JLCA 3U2SC 1TIFA 4G0NB 4ANXA 3W1SA 2NVUI 3V61A 4E3CA 3SFDB 1HE8A 1P7EA 3GB1A 4XZ4A 1YIWA 2CJNA 2D11A 2KVRA 2HJ1A 5G5HA 3ZO5B 1E7PB 3AH7A 3KQ4A 1S1QB 3DWGC 1SEBD 3DHGC 3EFUA 3H1UA 1I4HA 4ANVA 2MH7A 2IJ0A 2MX2A 3R2IA 3VXWA 4ZDVA 1Z5SB 2AQ1B 3DBRI 2GBJA 1KH0A 2Z59B 3IBEA 5CHFA 3MTNB 2FIFA 2KLGA 3AU5A 2IO0B 4KKJA 1GC7A 1WE7A 1C4CA
chains in the Genus database with same CATH topology
2INDC 3N1ZC 3Q2AC 3N20C 1T0SC 3RN9C 3I5JC 3RI7C 3Q3OC 4P1CC 1T0RC 3Q3MC 3DHIC 3RNBC 3RNCC 3Q3NC 3RNGC 1T0QC 3Q14C 4P1BC 3I63C 2INCC 2RDBC 3RNEC 3RNFC 3GE3C 3RNAC 3N1YC 3RMKC 3GE8C 3N1XC 3DHHC 3DHGC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IND C;  3N1Z C;  3Q2A C;  3N20 C;  1T0S C;  3RN9 C;  3I5J C;  3RI7 C;  3Q3O C;  4P1C C;  1T0R C;  3Q3M C;  3DHI C;  3RNB C;  3RNC C;  3Q3N C;  3RNG C;  1T0Q C;  3Q14 C;  4P1B C;  3I63 C;  2INC C;  2RDB C;  3RNE C;  3RNF C;  3GE3 C;  3RNA C;  3N1Y C;  3RMK C;  3GE8 C;  3N1X C;  3DHH C;  3DHG C; 
#chains in the Genus database with same CATH topology
 3GS2 A;  1EU3 A;  1Q0W B;  1V5O A;  4ARC A;  2VH2 A;  3QWZ B;  1ZDX A;  3KW5 B;  4W9J A;  2WU5 B;  1OEY A;  3U7D A;  4MM3 B;  1HTO A;  1WYG A;  2RDB C;  3PS6 A;  2D3B A;  3WAM A;  2LGY A;  3GE3 C;  2WXL A;  2MA9 B;  1TS2 A;  1YOV B;  3TL5 A;  4B0E A;  1XLN A;  5DPS A;  2LZ6 A;  2C9W B;  5BO4 B;  2J53 A;  1R4N B;  3EFC A;  4LJP B;  2MBB B;  2PPH A;  2WDQ B;  4DHZ B;  1WMH B;  1YNT E;  2BB6 A;  2N7J A;  1WJN A;  4RMA A;  2BKF A;  3RZF A;  3R7R A;  2GOW A;  1HZ5 A;  1XD3 B;  2N9E B;  1QOF A;  2LUE A;  2WXJ A;  2M17 A;  2ZEQ A;  3RD2 A;  3P42 A;  2IPK D;  4GGQ A;  3UQB A;  4NQL B;  3C19 A;  4BOZ B;  2N4F A;  1UH6 A;  2AQ3 B;  1E8Y A;  4A3P A;  3R8B A;  3DHI C;  1F1H A;  2K8H A;  1A5R A;  2BB5 A;  2O6V B;  2N9L A;  3BY4 B;  4G11 A;  1XLO A;  2BS3 B;  2L3Z A;  1SE3 A;  3C8Y A;  1WXS A;  1FMA D;  2JZZ A;  3TEX A;  3R3M A;  3L4P A;  1TJE A;  1IUE A;  2K8C A;  3AE6 B;  4GSW A;  2KWC A;  4WQM A;  1P1A A;  1WE6 A;  5EDS A;  4MEM A;  2C7H A;  4YSZ B;  2ONQ A;  2KAJ A;  3VQI A;  1XCQ L;  3W5V B;  1YMH E;  4G3X B;  2RPV A;  1M4V A;  1TT5 B;  4K3C A;  2Z8L A;  1B9R A;  3PRZ A;  4LLG M;  1IP9 A;  1EWC A;  5J2R A;  1NEN B;  2E6X A;  1IGC A;  4C56 C;  2ZZP B;  2WXG A;  4MGZ E;  4YTP B;  2I38 A;  4PS7 A;  4GOC A;  4MJS B;  4K1R B;  3Q8E A;  4EFO A;  3TMP B;  4WIP A;  1J7C A;  2QEJ C;  2IGH A;  3RNF C;  1IPG A;  2WX1 A;  3L10 B;  3M95 A;  2XBB C;  4ANW A;  2Y5C A;  3IVF A;  2IY0 B;  2D07 B;  4NAW A;  5EE9 A;  4MGI E;  1UWX A;  4LCD E;  2IYD B;  4ANU A;  1V49 A;  4MT5 A;  1F52 A;  1R4N I;  5AZG A;  5TSS A;  2J0J A;  3NG0 A;  1JAL A;  3IG3 A;  2HTH A;  2J4X A;  4BKT A;  3LXF A;  2M56 B;  2QDF A;  4EUT A;  5MPO A;  3HUI A;  4RGM A;  2CKH B;  4KSL C;  3ZNG C;  4EZJ A;  2ZVN A;  2LGI A;  1TGZ B;  3BYY B;  2GLS A;  1TY0 A;  2AWT A;  2DYO A;  2LJ5 A;  3O65 B;  4LNI A;  3ZUN A;  4E74 A;  4I6L B;  1XT9 B;  1L6V A;  4XC2 A;  1GAQ B;  4BZA A;  5HFY A;  4M02 A;  4LK0 M;  1IBX B;  3I9V 1;  3L16 A;  1TZ1 A;  1TKY A;  3AXC A;  1YN3 A;  3KH0 A;  3O13 A;  3Q69 A;  5FR6 A;  5AUK A;  2FID A;  4AJW A;  3SD5 A;  1WX9 A;  3ML8 A;  5KHQ A;  4K3B A;  3BII D;  1FRR A;  2D2Q A;  4F7Z A;  2HE7 A;  5E6J A;  2IND C;  3BZD B;  2W9N A;  4M8M A;  1J7A A;  5EE1 A;  5EE3 A;  4X57 B;  4WUR A;  2BW2 A;  1LGR A;  3BK2 A;  2XNA C;  4GN1 A;  3DBL B;  3L0W B;  1KJT A;  1UUP A;  3RNE C;  3APF A;  2HTM E;  2KDB A;  5HG2 A;  1V81 A;  1DOI A;  3I5J C;  4IUM B;  4KIK A;  2I1J A;  3PHX B;  5JHB A;  2DYM A;  4NJ6 A;  4CHK A;  3DQV A;  4JWS C;  4YTN B;  3U30 A;  2D3C A;  2KYW A;  4AWJ A;  2BKR B;  5E6P A;  2X8X X;  4W9I A;  2K0P A;  5BYR A;  4XYC A;  3AM9 A;  4RGO S;  4N59 A;  2GRI A;  4IDI A;  1SE9 A;  1L4D B;  3H8H A;  1YX5 B;  3H7P B;  4WJQ A;  4M8N A;  3AE3 B;  3B08 A;  1YQB A;  2XEW A;  2JZP A;  3U7Z A;  1V8C A;  4TQ0 A;  3E56 A;  4BVU C;  3ZQ4 A;  3ENE A;  3HHM A;  2RGF A;  1WY8 A;  2JPH A;  4TV3 A;  2JQR B;  5JXV A;  3W9C B;  2QIL A;  2AEH A;  1UWM A;  3RFZ B;  4OZB A;  2FNJ B;  1WGH A;  2BTE A;  1V6E A;  1TS4 A;  2R2O A;  4P16 A;  1NEK B;  4K7U A;  1D4B A;  2KTR A;  1CZP A;  1E5W A;  3KUZ A;  3QAR A;  1V86 A;  4TKN A;  4E71 A;  2WP9 B;  3A4R A;  3MFG A;  1RRB A;  4AQ7 A;  4P1B C;  4MGK E;  1TY2 A;  3DBL I;  2NTT A;  1GOZ A;  4HLE A;  1XF5 L;  1TBE A;  1WJ6 A;  2FCQ A;  3FAH A;  1R4M B;  1WM3 A;  3D32 A;  2JUO A;  1WYW B;  3DBR B;  3KWV A;  1EF1 A;  2INP E;  3RZW C;  3JYU A;  2KMM A;  4L1B A;  3CIR B;  3HM6 X;  1XLQ A;  1ET6 A;  3AI5 A;  2WDT B;  2K6Q A;  4XWW A;  1QT9 A;  2JXX A;  2V0G A;  1ZGU B;  3VTW A;  4OZC A;  3KWL A;  5D3D A;  2L8J A;  2J7Q B;  2KKC A;  1JWS D;  2IDY A;  3ZKJ C;  1EUV B;  2V9H A;  3OJ4 B;  2W3S A;  4GB9 A;  3NS8 A;  1YJJ A;  3BK1 A;  1HEZ E;  2DWQ A;  2LXA A;  2KFK A;  3M3J A;  1BT0 A;  1KRH A;  1STE A;  3Q6B A;  3X0W A;  3PPA A;  4H2A A;  4USA A;  4A6Q A;  2LAS A;  3HM3 A;  2M0A A;  2LJI A;  1SSN A;  1XEE A;  1SB3 C;  1FXI A;  4ZRI A;  3I3T B;  3IT4 B;  4AP4 C;  1I4G A;  1FEH A;  1SGH A;  4N9F 4;  2WHI A;  3ZTC A;  4RF1 A;  4US9 A;  2WXM A;  4NPN A;  2FCS A;  1FRD A;  1MHH E;  4L23 A;  1HZ6 A;  3V3X A;  2WQY B;  3PRP B;  4TMA B;  2VZK B;  2RDG A;  1TS3 A;  1L0V B;  3AV8 A;  1FPY A;  2WU2 B;  3FIL A;  3BVM A;  2DZK A;  2MJD A;  5J17 A;  1T0Y A;  4KDI C;  2KWU B;  1OTR B;  5DPR A;  4IM2 A;  2W82 A;  3DVG X;  4FJZ A;  4MJS A;  2ZNV B;  2WDV B;  4RH6 A;  3LJ3 A;  4K7W A;  4PK1 A;  2O2V B;  2J0K A;  2L0T A;  2LHD A;  2KJH B;  2KWD A;  2QMT A;  1WXM A;  4JX1 C;  2KJ6 A;  3QK0 A;  1C4P A;  1WR6 E;  4GIV A;  2MBE A;  3NVZ A;  2PEA A;  3VFK A;  1OQR A;  2PVO D;  3AE5 B;  3EC8 A;  1MFW A;  1VD2 A;  4M01 A;  4HJK A;  1LQB A;  2PLP A;  2K25 A;  3WCQ A;  1CK1 A;  2R61 A;  3MC8 A;  1P3Q U;  2KVZ A;  3VRB B;  2MSE D;  3VH4 B;  2RMM A;  5LLI A;  1NI2 A;  2BYE A;  1V97 A;  2KMA A;  4W9L A;  1BUI C;  1Y8R C;  3A4S C;  4KGR A;  2C60 A;  1A70 A;  1EM7 A;  2EMS A;  2ZCB A;  3NZU A;  2LRU A;  4K7S A;  3M62 B;  1K51 A;  4OVU A;  2KD0 A;  3AE7 B;  3RNG C;  3PRM B;  3AEG B;  1WF9 A;  3S2A A;  3PZ7 A;  4W9H A;  2PIA A;  3PSE B;  4LDT D;  1EO6 A;  2BF8 B;  4W9C A;  2X38 A;  1T0R C;  2N1V A;  3IT6 B;  4WJP A;  4KIK B;  3UIN B;  4ZRJ A;  1UZX B;  2WXI A;  4NAW B;  1T0Q C;  1FXA A;  5BMH A;  2V1Y A;  1D3Z A;  1D5X C;  2PW9 A;  4JPS A;  4OZA A;  3KUD B;  4DDI D;  3H6N A;  2A5U A;  4AUQ C;  3VTU A;  2J42 A;  4KV2 A;  3P1M A;  4WAF A;  1PUT A;  2BWF A;  2RD0 A;  1TKE A;  3AEF B;  2HDE A;  4FAD A;  2XK5 B;  1L5P A;  2J0M A;  5C3J B;  1MJD A;  2L52 A;  2LVO A;  3QX1 A;  3TEZ A;  4CYE A;  3H9D A;  3K9P B;  2B76 B;  2D5G A;  2IBI B;  1WGY A;  2JYE A;  3EA6 A;  2L76 A;  4FHK A;  1ZUD 2;  2JYT A;  2LI5 A;  1ZP0 B;  2YLM A;  1V1P A;  2INN E;  4YSX B;  4FN2 A;  3V05 A;  3R7Q A;  3PLU A;  3Q8F A;  2MCN B;  2NTS A;  3EEC A;  2XN9 C;  1WI0 A;  3AE8 B;  3WAP A;  3A1Q A;  1YX6 B;  3ZXV A;  3IAM 1;  3VDZ A;  4RF0 A;  2JF5 A;  4NNJ B;  2B3A A;  3N3K B;  2Q5W D;  4N6E B;  1IYF A;  4EKU A;  2ZPN A;  1WXQ A;  2IGG A;  1XCT L;  1QOG A;  1Q1O A;  4ICV A;  3PZD A;  3FIL B;  4MEL A;  3RUL A;  1CMX B;  2JRI B;  4LNN A;  3ETR A;  1PGB A;  2K39 A;  1PYW D;  2KLC A;  1FFV A;  4IWP A;  4IM0 A;  1V1O A;  2YVC A;  1FM0 D;  1PGA A;  1RAX A;  2BQQ A;  2GBK A;  2KWV B;  3ZNI D;  4JQW C;  3OAW A;  4DBG A;  1JWU D;  1OFF A;  3Q8B A;  3B2G A;  4MGY E;  2KK8 A;  1JWA D;  2KT7 A;  3AEE B;  5TR5 A;  1M94 A;  1P7F A;  1NDD A;  1R4M I;  1SBB B;  3MC9 A;  4XDC A;  4YWG G;  2M8S A;  3EGR A;  4WAA A;  5G5G A;  3RNB C;  4FJV B;  4MAC A;  4DHJ D;  2BYV E;  2WXK A;  3K9O B;  5DPW A;  1UD7 A;  2EKE C;  3T9L A;  1BML C;  1UGJ A;  3DBH B;  5D2M B;  3HVZ A;  3N30 A;  4N58 A;  3N20 C;  2KDE B;  1E8Z A;  1VJK A;  1WXV A;  4ZOH C;  2RR9 A;  3L17 A;  3VHT C;  3CMM B;  5DCN A;  1J19 A;  5D7G A;  5GMV A;  3SEB A;  2GBR A;  3L13 A;  5HI1 A;  4WWN A;  1XQQ A;  1YD8 U;  4LTU A;  3QCA A;  4KVG B;  3RNA C;  1E90 A;  2L7R A;  1B1Z A;  4ZRK A;  2HD5 B;  2LRW A;  2JRH A;  3VH3 B;  5DPT A;  3ZVV A;  3HVD A;  1PGX A;  5L95 C;  2MJ3 A;  2YEP B;  1ISN A;  1RLF A;  2L05 A;  3JW0 X;  2VZK D;  5IA7 A;  2LVQ A;  3TBL D;  3QIJ A;  2NBU A;  3NOB A;  3VR9 B;  3DVG Y;  4OHJ A;  2MJE A;  3GZN I;  3W5U B;  3TEW A;  3RI7 C;  1E9M A;  1D5Z C;  1TYG B;  3UIP B;  3FKY A;  2ZW1 A;  3JSV B;  3SFE B;  2YEP F;  1ZKH A;  1E7U A;  4WQO B;  4BOS C;  2C7M B;  2MBQ A;  1ZDV A;  1CQV A;  3U8Z A;  2KNB A;  4MDK E;  1Y56 A;  4HDO A;  1F9J A;  2DX5 B;  2M1M A;  4II3 B;  3P4S B;  2WDR B;  1EU4 A;  5T8I A;  1QOA A;  3QAQ A;  2DHZ A;  3PZ8 A;  4NY0 A;  1AW7 A;  1JW9 D;  2QSD A;  3DDC B;  1ROE A;  3VVW B;  3QQ8 B;  2R2Q A;  4Q2J A;  4DXA B;  2LVP A;  3GE8 C;  1LO5 D;  3MP9 A;  4DXG A;  3PVL A;  4PS8 A;  2UWQ A;  2JXT A;  2BT6 A;  4MH0 E;  4C4V B;  4FBJ B;  2NBW B;  1I4R A;  4HCP B;  3RPF C;  2ICI A;  2AX5 A;  4GU2 A;  3NY5 A;  3CWI A;  3MHS D;  2KC1 A;  1WXA A;  1R7S A;  2CHW A;  3DHH C;  3PO0 A;  4GDL B;  2MW5 A;  3V6C B;  4IG7 B;  3P4P B;  3VUW A;  2CR5 A;  2K8B A;  1ZXH A;  4C00 A;  2GBM A;  1UBQ A;  4HEA 1;  2O6V D;  4TUU A;  4EEW A;  4KZ0 A;  3Q3J A;  2BYF A;  4MSQ B;  4HJG E;  2JU6 X;  1YJI A;  4IOI E;  1I7H A;  2W3R A;  2L83 A;  2MHJ A;  4HK2 A;  5FR3 A;  3KYD D;  4YSY B;  3R2T A;  1JRO A;  4HCN B;  2WXF A;  3DVN U;  5BYS A;  3TEY A;  1RWS A;  1G6J A;  5JZE B;  4DWF A;  2MBO A;  1K53 A;  2KAC A;  4DHZ E;  2N7D A;  1F0Z A;  4WWO A;  3ZRF A;  2E3T A;  1PQS A;  1WGD A;  3OLM D;  2K6D B;  1VLB A;  4JGH B;  3P4Q B;  2JSV X;  3BYT B;  5E6O A;  4M00 A;  2OED A;  2KTR B;  3ZJT A;  3RMK C;  2QC8 A;  1E8X A;  1P9D U;  4WWP A;  2DAJ A;  1T6B X;  1FD6 A;  4EZL A;  1V2Y A;  2KTF A;  2KFK B;  4CO7 A;  1GB1 A;  2KXJ A;  4QAY A;  3DPD A;  1V80 A;  4D2K A;  5D94 A;  5AZF A;  3ZDT A;  2PE9 A;  3TCA A;  3OG5 A;  4MM3 A;  3NHE B;  4ZRP A;  3IFW B;  4AOF A;  4ITK A;  1KTK A;  5BMI A;  1ACC A;  1HQR D;  5FK9 C;  1HA5 A;  3A9J A;  2VH1 A;  4HWI B;  4LNF A;  4PYU A;  1KLV A;  2DEN B;  3KVF B;  1ZE3 D;  2LD9 A;  2UYZ B;  1TZO A;  1MI0 A;  1E6E B;  3FC4 A;  4KX6 B;  2G9H D;  4I6P A;  4URK A;  2G4S A;  4AJY B;  1HTQ A;  2WXQ A;  3RNC C;  4RCO A;  1QOB A;  3RYT A;  5KHO A;  1SF0 A;  2NMQ A;  4KKI A;  5J18 A;  2KOX A;  2WX0 A;  3Q3N C;  3AEA B;  3NZS A;  4KGT A;  1XLP A;  5IN7 A;  1OQQ A;  1N6Z A;  4GLS C;  1SJE D;  4ZRQ A;  2G45 B;  4XGA B;  2PJH A;  2KDF B;  2KZR A;  3B0A A;  2V3S A;  4HPP A;  3AUL A;  2OJW A;  2Y5P A;  4TSS A;  2FCN A;  4AS1 A;  2DZM A;  2PMV A;  2LMC A;  4W9D A;  2KAN A;  3V62 A;  4M0W A;  1LM8 B;  2L00 B;  3DBH I;  1KLU D;  1V9J A;  1NVI D;  3L54 A;  4FUL A;  3ZXR A;  3APD A;  2N7E A;  5BYQ A;  3CF6 E;  3U52 E;  3QHT A;  2KDM A;  4II2 B;  5I4D A;  2JZ3 B;  3N9Y C;  4PS3 A;  2J52 A;  1KF6 B;  2XK5 A;  1PFD A;  1ET9 A;  1EWY C;  1VR9 A;  1NBF C;  1E8W A;  4LNO A;  1QF6 A;  5C23 A;  4WJN A;  4FA6 A;  2V4L A;  1RFK A;  3PT2 B;  2WGS A;  3CSF A;  1TKG A;  3V60 A;  1MPE A;  1YJ1 A;  2TSS A;  2IGD A;  4A20 A;  3AEC B;  2CHX A;  1DOX A;  1DGJ A;  4RM9 A;  3EUB 2;  4LNK A;  5GXG B;  1RM6 C;  3M63 B;  1QLB B;  3A9K B;  2FBW B;  3A33 B;  2WXP A;  2WS3 B;  2LWP A;  4IM3 A;  1L4Z B;  1WJU A;  3RCZ A;  3TJP A;  4W9K A;  2MP2 A;  3E9S A;  2GI9 A;  4XE0 A;  4ZHO A;  1WGR A;  2PTL A;  3PLV A;  3A9K A;  4WH4 A;  4DK5 A;  3QJZ A;  1FCL A;  4B0M A;  4DHJ B;  4MSM B;  2L0F A;  4K81 A;  1WM2 A;  3N1Y C;  2PKO A;  3N1X C;  2H89 B;  3AE9 B;  5CHW A;  1WFY A;  2BGF A;  1GB4 A;  3A1Q B;  4C7Z A;  3DOW A;  2KQ7 A;  2MWS B;  1JQ4 A;  3VUY A;  2QCZ A;  4JIO U;  1P98 A;  4P7I A;  4HPM B;  3UIO B;  2CS4 A;  2KX0 A;  2I1K A;  3NJT A;  1GPX A;  3IXS A;  2G1E A;  3SDL C;  1EF5 A;  2KN4 A;  4HKZ E;  3JSV A;  3V6E B;  4P1C C;  2LEK A;  4JWU C;  2IY1 B;  2CHZ A;  5IAA C;  4BFR A;  5AZH A;  1MVK A;  4YL8 A;  3DWM A;  1NYR A;  2C5L C;  3OWE B;  2BS2 B;  1I35 A;  1C76 A;  1WR1 A;  5L83 A;  4A8X C;  3L08 A;  2OHF A;  1U4A A;  3WIM A;  4FJY A;  1AYF A;  1L0Y B;  2AQ2 B;  4DQO C;  2SEB D;  3ZW3 A;  1P0R A;  3CST A;  4B6W A;  2A4Z A;  1I42 A;  2ZCC A;  3NS1 A;  3PRE A;  3NUH B;  4DDG D;  1FO4 A;  4W9E A;  5HKH A;  2WXR A;  3I63 C;  1WZ0 A;  4J6I A;  3AE1 B;  3AMZ A;  3RUI B;  4RGT A;  1XXG A;  5CHV C;  3Q2A C;  3LB8 C;  3B2F A;  4ZYS A;  2WXO A;  3ZIM A;  2W54 A;  1VRA B;  4GDK A;  1F77 A;  2BS4 B;  3MJW A;  4HRS A;  1WZ3 A;  2NS5 A;  2BVC A;  2LGX A;  1C1Y B;  4JL9 A;  4C80 A;  2M19 A;  1QKZ A;  3AE4 B;  1JWB D;  1N61 A;  3VTV A;  4EZK A;  3ZGZ A;  4ARI A;  3NRZ A;  4RNA A;  4XX5 A;  2D10 A;  4F8C B;  3ML9 A;  1GUA B;  3Q3M C;  4ASW C;  3HIZ A;  1RYJ A;  4KZC A;  3ZNZ B;  1MHX A;  2QJL A;  2LGD A;  2FCM A;  4XDD A;  4W9G A;  1TTN A;  2MBH A;  1SIF A;  2FUG 1;  1WJ4 A;  4B9K A;  1IGD A;  2Z0E B;  2MEK A;  2JWU A;  1L0X B;  2V4I B;  2O2V A;  1C4A A;  4KSK C;  2BBC A;  2BPS A;  3W2D A;  3NZ3 A;  2N1W A;  2KO3 A;  3Q14 C;  3SU8 X;  2CJO A;  3ABV B;  2V3N A;  4RGN A;  4JE3 B;  2LXC A;  3MC0 B;  2OJR A;  5LXH A;  2CU3 A;  2V3P A;  5G55 A;  4EE2 A;  2EKI A;  1D5M C;  1HXY D;  1FNU A;  4G50 A;  3NVW A;  1L6U A;  1LXD A;  1I4Q A;  1VZ8 A;  4CQN A;  5HHD G;  1Z2M A;  1AN8 A;  1FXT B;  2M4N A;  1WGG A;  4M0W B;  5LNK 1;  1QIL A;  3AB5 A;  4BBN C;  1JML A;  1NI3 A;  4ZYN A;  2JX5 A;  3TSS A;  4YT0 B;  5EE0 A;  4GDL A;  1OQY A;  2W55 A;  2REX A;  3N1Z C;  1GG3 A;  2ZVO A;  2O6V A;  2DZI A;  1JRP A;  2KJR A;  4BAX A;  1SE4 A;  4BKS D;  2D3A A;  4FXC A;  1LFD A;  3U4E G;  3P63 A;  2IO3 B;  3J9C A;  3DCG A;  2Y5B B;  1WMH A;  3H7S A;  1SJH D;  3P4R B;  4IW0 A;  5IKC M;  1J7B A;  3ONS A;  5JH5 C;  4NAM A;  4RFB A;  1VZ7 A;  2KDI A;  4L2Y A;  3B1L X;  1TS5 A;  4HXD A;  1YN5 A;  5LXI B;  5H92 C;  2PVG C;  3DBS A;  4HVB A;  3DVN V;  5C1Z A;  3VRA B;  1I4P A;  1ZXI A;  2NPT A;  2WXN A;  4WJO A;  3Q8A A;  2H88 B;  1WSP A;  2ZJD A;  1BXT A;  2BWE S;  2QHO A;  4ACF A;  4LJO B;  4HPL B;  1MG4 A;  4FHJ A;  4R3D A;  1T3Q A;  2MP2 B;  3BVG A;  3WAN A;  2GBN A;  3ZTD A;  1ZPS A;  1C78 A;  4HRO A;  4OVV A;  3Q8C A;  3P2B A;  1YQ4 B;  3T3N A;  4ICU A;  2ZNV C;  3PTF C;  2G4D B;  3NVV A;  1UF0 A;  2KMC A;  1Q10 A;  1KM7 A;  1DOY A;  2K9X A;  2IO2 B;  2IO1 B;  1WRD B;  3WAL A;  1UBI A;  4REZ A;  1T5X D;  2LHE A;  3Q3O C;  4HDQ A;  1XO3 A;  1JRU A;  2RSU A;  3BVZ A;  3R66 C;  4GXB A;  1MG8 A;  1OGW A;  4GMV A;  2NR2 A;  1S3S G;  1WWT A;  1CJE A;  2DZJ A;  5BMG A;  2WYQ A;  3APC A;  4MH8 A;  2EMT A;  1UGM A;  1X1M A;  4P6V F;  5FKA C;  3HRD D;  3KLS X;  4BKS A;  3T8M A;  2WWZ A;  1FCC C;  1WX7 A;  4DXF A;  2SAK A;  1V5T A;  4YTM B;  3UI3 A;  1ZOY B;  2KHW B;  2EEL A;  1IBX A;  1Q5W B;  1DYQ A;  2DYB A;  4F1S A;  4A3O A;  1N5W A;  3GZN B;  4IWQ A;  3NVY A;  3EHV A;  1GNU A;  2Y3A A;  3KUC B;  2QIE B;  1I4X A;  3PGE A;  5G2N A;  1K52 A;  2M0X A;  4J3O D;  3SR6 A;  1AAR A;  3C0R B;  1KFY B;  3TUO A;  1L2N A;  1KLG D;  2NCN A;  5IP4 D;  3ECI A;  2N9K A;  4PYZ A;  1VCB A;  1T0S C;  1L7Y A;  4IC7 B;  2KN5 A;  1OEY J;  3UGB B;  2VRR B;  5JHA A;  2LGS A;  4FLH A;  2K3U A;  3A9J B;  1UEL A;  4NJ7 A;  1N62 A;  3ZJV A;  1WRI A;  3ZYY X;  2CU1 A;  2JT4 B;  4YXD B;  3OJ3 A;  1H4R A;  3IHP C;  3AN1 A;  2AL6 A;  2KFJ A;  2MLB A;  3QA8 A;  4XWT A;  1QZE A;  1C3T A;  3ZJU A;  3VR8 B;  3AU4 A;  3GP7 A;  3RN9 C;  4IWO A;  1KOT A;  2DLB A;  2DBY A;  5C2T B;  2NPT B;  3W1S C;  1H8C A;  5H8Y E;  4S0R A;  2WNM A;  3AE2 B;  3PHW B;  3LYY A;  4LDT B;  1N63 A;  1RFA A;  1D6E C;  4NZL B;  4C7Y A;  2GB1 A;  5CX3 A;  2LUM A;  2I2Y A;  4NJC A;  1WH3 A;  3ZRC A;  4TQ1 A;  5IOI A;  4NQK E;  2K5P A;  3ZLZ A;  2UU7 A;  4OVZ A;  3TIX A;  3UF8 A;  2N9X A;  2JWZ A;  1VDV A;  2JY6 A;  2KQS A;  2ZPY A;  5D6J B;  1VZ6 A;  2DAF A;  2IZV B;  1GJZ A;  1F2R I;  5AUI A;  3IAS 1;  3JVZ X;  3KYC D;  5AEK B;  3WAO A;  3Q3F A;  1GC6 A;  3GOE A;  1WX8 A;  2PE6 B;  1ZW7 A;  4WWM A;  2HJ8 A;  1UNS A;  1WGK A;  3LDZ E;  4PT5 A;  3VUX A;  5IO9 A;  2AYO B;  3SHQ A;  2L1A A;  2N9P C;  4EOY A;  1QQR A;  2D3G A;  3BWU D;  3ZDM C;  4KDL B;  3QC8 B;  5CTR C;  2FUH B;  4B95 A;  2KQ4 X;  4A90 A;  2N0S B;  3WA0 A;  2KX3 A;  1K8R B;  1N60 A;  1E0Z A;  1NYQ A;  1J0G A;  2MRP A;  3URY A;  2ON8 A;  3X23 A;  1C9F A;  3H7P A;  4BBN F;  2DNF A;  4UDU C;  3VAW A;  2MQJ A;  1FNV A;  3ALB A;  3HK0 A;  1FIQ A;  1YN4 A;  4I6N B;  4C4V A;  4RM8 A;  2LFI A;  4BKG A;  2FE8 A;  4US8 A;  2WLB A;  1C79 A;  2NBV B;  1ESF A;  4GDK B;  2FAZ A;  2C7N B;  1N5X A;  3MJ5 A;  3PV1 A;  1FNW A;  2ZW0 A;  1SE2 A;  3MHZ A;  5D3I B;  4KGS A;  1SXT A;  2Z0D B;  4OW0 A;  3BIN A;  2L32 A;  1PDX A;  3UQA A;  3B9J A;  4A55 A;  3AED B;  2OOB B;  4ZHP A;  5E6N A;  3I57 A;  2G3Q B;  1ENF A;  1F2R C;  2ASQ A;  2K1F A;  2RDH A;  3ZNH B;  1C77 A;  1JWM D;  2K22 A;  2BYT A;  1WIA A;  1AWD A;  1SIJ A;  1JCK B;  4HKQ A;  3T3O A;  2AL3 A;  4S17 A;  4A9A A;  2JVC A;  2GMI C;  4O1N A;  1E7V A;  4W9F A;  2RPQ A;  2ACZ B;  3AEB B;  3RT3 B;  3W1Y A;  4IKG A;  1FFU A;  3N32 A;  1J8C A;  2WXH A;  2INC C;  1YQ3 B;  1V1P B;  1K50 A;  1E10 A;  2KC2 A;  4JLC A;  3U2S C;  1TIF A;  4G0N B;  4ANX A;  3W1S A;  2NVU I;  3V61 A;  4E3C A;  3SFD B;  1HE8 A;  1P7E A;  3GB1 A;  4XZ4 A;  1YIW A;  2CJN A;  2D11 A;  2KVR A;  2HJ1 A;  5G5H A;  3ZO5 B;  1E7P B;  3AH7 A;  3KQ4 A;  1S1Q B;  3DWG C;  1SEB D;  3DHG C;  3EFU A;  3H1U A;  1I4H A;  4ANV A;  2MH7 A;  2IJ0 A;  2MX2 A;  3R2I A;  3VXW A;  4ZDV A;  1Z5S B;  2AQ1 B;  3DBR I;  2GBJ A;  1KH0 A;  2Z59 B;  3IBE A;  5CHF A;  3MTN B;  2FIF A;  2KLG A;  3AU5 A;  2IO0 B;  4KKJ A;  1GC7 A;  1WE7 A;  1C4C A; 
#chains in the Genus database with same CATH homology
 2IND C;  3N1Z C;  3Q2A C;  3N20 C;  1T0S C;  3RN9 C;  3I5J C;  3RI7 C;  3Q3O C;  4P1C C;  1T0R C;  3Q3M C;  3DHI C;  3RNB C;  3RNC C;  3Q3N C;  3RNG C;  1T0Q C;  3Q14 C;  4P1B C;  3I63 C;  2INC C;  2RDB C;  3RNE C;  3RNF C;  3GE3 C;  3RNA C;  3N1Y C;  3RMK C;  3GE8 C;  3N1X C;  3DHH C;  3DHG C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...