1T0QC

Structure of the toluene/o-xylene monooxygenase hydroxylase
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
83
structure length
83
Chain Sequence
TFPIMSNFERDFVIQLVPVDTEDTMDQVAEKCAYHSINRRVHPQPEKILRVRRHEDGTLFPRGMIVSDAGLRPTETLDIIFMD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Toluene/o-Xylene Monooxygenase Hydroxylase from Pseudomonas stutzeri OX1: INSIGHT INTO THE SUBSTRATE SPECIFICITY, SUBSTRATE CHANNELING, AND ACTIVE SITE TUNING OF MULTICOMPONENT MONOOXYGENASES.
pubmed doi rcsb
source organism Pseudomonas stutzeri
molecule tags Oxidoreductase
molecule keywords toluene, o-xylene monooxygenase oxygenase subunit
total genus 25
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2004-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF06234 TmoB Toluene-4-monooxygenase system protein B (TmoB)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.270 Alpha Beta Roll Ubiquitin-like (UB roll) TmoB-like 1t0qC00
3DHIC 3RNBC 4P1CC 2INDC 3Q2AC 3Q3MC 3Q14C 3RNEC 2INCC 1T0SC 3I5JC 3N20C 3RI7C 3N1ZC 1T0QC 3N1XC 3GE8C 3GE3C 3RN9C 3RNAC 3Q3OC 4P1BC 3I63C 3N1YC 3DHHC 3Q3NC 3RNCC 1T0RC 3RNFC 2RDBC 3DHGC 3RMKC 3RNGC
chains in the Genus database with same CATH superfamily
3JVZX 2M4NA 1ENFA 3RUIB 1WX7A 3A9KB 1DYQA 1VCBA 1PGAA 2GOWA 3NVYA 3GE8C 5MPOA 1QILA 1STEA 4JX1C 3TEWA 2KTRB 1NBFC 1J7CA 1WGHA 5EE0A 1NYQA 2R2QA 2N9KA 1FXAA 3W1SC 2LXCA 4BKSD 2K9XA 3ECIA 1V5OA 2JZZA 1UGJA 2WS3B 1ZPSA 5J2RA 4ZRJA 2IDYA 1V6EA 2NCNA 4WURA 1GG3A 3VR9B 1FFUA 1V80A 1KTKA 2D3AA 4KKIA 4NAWB 3OAWA 4M02A 1WH3A 2HD5B 1Y56A 2PJHA 4TSSA 1K51A 2BPSA 2MX2A 1SE2A 1RAXA 3R8BA 1HQRD 1WWTA 4RNAA 4DXAB 2LHEA 2NTTA 3PRZA 2DYMA 1N61A 3EUB2 2VZKD 4URKA 3ZLZA 5LXHA 1TGZB 4HPLB 2FCMA 1YQ4B 1XT9B 5BYQA 1WZ0A 2BWES 3QX1A 3JYUA 1KF6B 3CF6E 5E6NA 1V81A 2HE7A 5J17A 1RFAA 4FLHA 2FNJB 2PE6B 3JW0X 5EDSA 2JRIB 2IBIB 3R2TA 3X23A 1L0VB 1ZGUB 3MP9A 3Q3JA 3ZNGC 1C3TA 3A33B 2PW9A 4PS7A 4XGAB 3SEBA 1SIJA 4TQ0A 4GDKA 3ZNHB 2L1AA 1WGGA 2UU7A 2JRHA 2O2VB 1GC6A 3N1XC 3RZWC 3BVGA 2W82A 3GS2A 2KMMA 1N62A 1VR9A 2G4SA 4G3XB 2RD0A 3KUCB 2ZZPB 1NDDA 2J4XA 4MGKE 2K6DB 2JYEA 4LNIA 2KN5A 4OW0A 4S17A 3SHQA 3W1SA 3W1YA 4BVUC 3NY5A 1FXTB 4EKUA 4MGZE 1TY2A 2I38A 4C7ZA 3T8MA 2D3CA 1P1AA 1XO3A 2Q5WD 4RGTA 4ZRKA 3RNFC 5D3DA 2KK8A 4BBNF 3BY4B 4ASWC 5CHVC 3HM6X 3C0RB 1JQ4A 2LGIA 2K8CA 2L00B 4NAWA 1R7SA 5IOIA 3GOEA 4W9CA 2KQSA 2CHXA 3TL5A 2W9NA 2KJHB 2MP2B 2EMTA 2KTFA 2FIDA 2MBHA 1WX9A 2MSED 2NBUA 4OZBA 1AARA 1XXGA 3I5JC 2DBYA 1AYFA 2VRRB 1RWSA 2J0KA 5IO9A 1LGRA 4ICUA 3AULA 1ISNA 3AEEB 3W9CB 1QT9A 1KLUD 2WLBA 3DWMA 5D7GA 2L0TA 4BOZB 3B2GA 5D3IB 1ZDXA 2KVZA 1WIAA 3ZJUA 2LXAA 1Y8RC 4PK1A 1WJUA 4EZJA 1XCTL 2ZJDA 3ZO5B 1D5MC 2KDFB 1WGDA 2WGSA 3DHHC 1A5RA 1YIWA 4LDTB 1YNTE 3AE7B 3QAQA 3R3MA 3UIPB 1I42A 1KFYB 2M56B 2IO3B 2D11A 3Q8CA 1Z5SB 3SFEB 4GIVA 1B9RA 3RN9C 3VTUA 3U7DA 3P2BA 1SF0A 1HZ5A 2K0PA 1FCCC 3DVGX 1PFDA 4HPPA 2HDEA 2GMIC 1XLQA 1E90A 4NZLB 3KH0A 5TSSA 4FN2A 3RYTA 3SU8X 2X38A 4NNJB 2FAZA 3ZXVA 1EF5A 2BGFA 4FXCA 4W9DA 1XLOA 1TS5A 3P4RB 3RULA 3FILB 3U30A 4BOSC 2KFJA 2MJDA 3O65B 1FPYA 3WAOA 2X8XX 1F2RC 1V5TA 3BVZA 4DHZE 4OVUA 1GB4A 4HKQA 1FNVA 2QHOA 1WXAA 4ZDVA 2KAJA 3RNGC 2BKRB 2KXJA 2JF5A 2N1WA 3APFA 4DXFA 4ZRPA 3ZW3A 4YSXB 1WYWB 4O1NA 3B2FA 3HIZA 5JHAA 5KHQA 2FUHB 3RPFC 3ABVB 2N4FA 3I9V1 4XDDA 4AQ7A 3PVLA 1I4PA 2BVCA 4PYUA 3RZFA 1TJEA 5IP4D 1F77A 4HDQA 2ZVNA 2RMMA 2KZRA 3NZUA 3UF8A 4QAYA 5DPWA 4C4VA 1C4PA 2XEWA 1SJED 1E8YA 2BT6A 2OJRA 1JWMD 1T0RC 1OFFA 2G1EA 4WJNA 2ICIA 2AQ1B 2J7QB 2KQ7A 2JQRB 3ZJTA 1C79A 3E56A 2XBBC 3QQ8B 3IXSA 1L0XB 3I63C 2N9PC 1JRPA 4XWWA 1L0YB 4HK2A 4LNFA 4K7SA 3TJPA 4N6EB 2ACZB 4W9LA 3TEYA 1JALA 4HCPB 4ANXA 2M1MA 3M3JA 3OJ3A 3L16A 4BAXA 2D2QA 2WP9B 2CU3A 1TKEA 1DOXA 4JWSC 4HKZE 2LHDA 3NUHB 2V1YA 5IN7A 2ZCBA 4ARIA 3OWEB 3N1YC 3U4EG 2E6XA 3Q8FA 4IUMB 2KDIA 3ZTCA 1K53A 1T6BX 3MC0B 5AUKA 2D3GA 2BW2A 2ZW0A 3RD2A 4IDIA 3N30A 4RCOA 2MH7A 2WX0A 1AN8A 1V86A 5D2MB 3IFWB 3H6NA 3AE1B 2DENB 4LK0M 3VRBB 1SJHD 1N5WA 1QQRA 2PMVA 4W9GA 2N1VA 4EFOA 1ZW7A 1V1PA 1WGYA 3PPAA 1SIFA 4BBNC 4M8MA 4NQLB 1NVID 2INCC 1ZDVA 4KVGB 1F1HA 5DPTA 4S0RA 5IKCM 1LXDA 2MBBB 3MJWA 1EU3A 3HRDD 2INPE 1Z2MA 2IYDB 1TT5B 2VH2A 3P63A 3NZ3A 1Q1OA 1F2RI 3L4PA 2PE9A 2KX0A 3OG5A 3TMPB 3O13A 4WJQA 1MHHE 3B0AA 1JWBD 4KSLC 1EU4A 3VR8B 1TBEA 3UIOB 4WJOA 4USAA 4A55A 4ZHOA 1RRBA 2DLBA 1HXYD 2N0SB 5J18A 3PZ7A 4IOIE 2DX5B 5JZEB 1IGCA 5E6OA 1TYGB 4KDIC 4LNNA 2K6QA 5G5GA 1M4VA 3V05A 2CHZA 1WE6A 4DHJD 3Q14C 2D10A 3AE8B 4NJCA 1WFYA 2GRIA 1H8CA 4FJZA 2OHFA 3PV1A 2CU1A 4IM3A 2JPHA 2YVCA 3V61A 2DHZA 5HHDG 1BXTA 3PRPB 4M0WA 1T3QA 1GNUA 4GMVA 4I6PA 3K9OB 3PHWB 2CS4A 3BYTB 4GOCA 2DZMA 1HE8A 2GBJA 1FNWA 4JGHB 2MHJA 3KYCD 2V3NA 3DWGC 3V6EB 4AOFA 3KUDB 2L3ZA 5D6JB 2VZKB 1MG8A 3QC8B 1D4BA 4KKJA 4TQ1A 3JSVB 2M19A 4EEWA 2DAFA 3VVWB 1V49A 1C1YB 2KWVB 1ACCA 1SE4A 3DBLI 4XZ4A 2RPQA 1KM7A 1OEYA 2WXNA 4OVVA 3Q3NC 4WAAA 1IBXA 3DBHI 2IY0B 3P1MA 1LO5D 4N58A 4BFRA 3Q3MC 2WXJA 2AWTA 2BYVE 4MH0E 3C8YA 2K3UA 1V9JA 1T5XD 4F1SA 2WXFA 4RH6A 3L17A 2WXLA 4LNKA 1UUPA 1UGMA 3H1UA 3ZRCA 3AEBB 2JWUA 1GJZA 3IVFA 4MM3A 1YJIA 3PSEB 1J19A 4ANWA 3IG3A 4IM0A 4KGRA 2W3RA 2WXKA 1UNSA 3H7PA 1AWDA 3KW5B 3WIMA 3N3KB 1D5ZC 2AL3A 4IWQA 3RMKC 1SXTA 3DBRB 3AB5A 2LD9A 1V1PB 1NI2A 2SAKA 3QK0A 4HJGE 5T8IA 2PPHA 2FCNA 3BINA 3R7RA 4ICVA 3V60A 1J7AA 2MP2A 4P6VF 4DHZB 2M0XA 4K3BA 4FHKA 2LEKA 1OEYJ 1GAQB 4FULA 4EUTA 1NEKB 3UI3A 1WYGA 4MH8A 1WRDB 4A6QA 4FA6A 3T3OA 1E7UA 2KVRA 1RLFA 1HTQA 1WM3A 3L10B 4WAFA 1YQ3B 5BMGA 1MG4A 3JSVA 4OZAA 2ZNVC 4L2YA 2QEJC 2JX5A 3CWIA 2LI5A 3DOWA 4AS1A 2LVPA 3RT3B 2WHIA 4GDLA 4LNOA 4EZLA 4REZA 2W3SA 4P7IA 3A1QA 3QHTA 2N9EB 3AEAB 2LFIA 1FO4A 1V97A 1IYFA 2Y3AA 2CKHB 4MGYE 1C9FA 4LJOB 5IAAC 4M00A 3EECA 4DBGA 3U7ZA 2K5PA 4GLSC 4CO7A 4A20A 3NZSA 3ONSA 2FBWB 3A4RA 2QC8A 1TIFA 1TZ1A 3NG0A 2WU5B 3BVMA 1GPXA 1N60A 1JCKB 2XN9C 3HHMA 4CHKA 4HEA1 3WA0A 2MBOA 4US8A 1ESFA 2HJ1A 2NS5A 3WAPA 2KMAA 4WWOA 4OVZA 2IO2B 4DXGA 2REXA 2KNBA 4KGSA 2HTHA 3NS1A 3P4QB 4YTPB 1CQVA 1WY8A 2KLGA 5JHBA 3VQIA 2KQ4X 4JLCA 1IBXB 3DBSA 5E6PA 3H8HA 4ZRIA 5L83A 2LMCA 4ANUA 4FHJA 2FUG1 3C19A 1E9MA 1R4NB 2VH1A 2NPTB 2PTLA 2RR9A 3GE3C 2BYEA 3PT2B 4NQKE 2NTSA 1R4NI 3MC8A 4YSYB 1JROA 1ZE3D 1J0GA 1IUEA 1WMHB 4PT5A 1L6VA 2AX5A 3DBRI 2LZ6A 3DVNV 3NS8A 1ZXHA 3P4SB 2NMQA 4LJPB 4DHJB 1ZP0B 4ZRQA 3FILA 4G50A 1S1QB 2OEDA 2WQYB 1QF6A 1V2YA 3BIID 1SE3A 3HVZA 1XF5L 2LGYA 3DVGY 1C4CA 2KDBA 4II3B 3W2DA 2BB6A 3APDA 1VD2A 3NVVA 3L54A 1DOYA 4PS8A 1SEBD 2K22A 2HTME 1P7EA 2DZKA 4WQOB 2QIEB 5BYRA 3RNAC 4KSKC 3Q3FA 2IZVB 4AUQC 1VDVA 1KRHA 1CZPA 3Q8AA 3WCQA 1XD3B 4KV2A 2O6VB 1TS4A 2WXHA 3ZQ4A 3KWVA 1E5WA 4NPNA 1E0ZA 3FC4A 2Z8LA 5EE1A 3SR6A 3PLVA 4I6LB 5JXVA 5C3JB 5H92C 4B0EA 2BTEA 1C78A 2TSSA 1GC7A 4AJYB 2BB5A 5LXIB 1XLNA 4DQOC 2Y5PA 2KDMA 3EC8A 2INDC 3DDCB 3ML8A 3J9CA 4LDTD 4WWPA 2K8BA 1HEZE 2BS4B 4HJKA 2ASQA 3LXFA 4RM9A 3AE5B 4GDLB 4US9A 2QMTA 1CK1A 5FR3A 2Z59B 3PO0A 4F8CB 1I4XA 3PZDA 1TZOA 4NJ6A 3VAWA 2ZW1A 3VUYA 4XYCA 2KKCA 2WXRA 1I4GA 2ON8A 5GXGB 2Y5CA 2JZPA 2IY1B 5EE3A 5TR5A 3WALA 3Q3OC 2L7RA 3B08A 3U2SC 2O6VD 2ZCCA 3PLUA 1TKGA 1K52A 4N9F4 4NAMA 4MGIE 3TBLD 1ZXIA 4B6WA 1HTOA 1YN4A 4TMAB 1PGBA 2EKEC 4RGMA 4C80A 1FD6A 3SDLC 1E7PB 3AEDB 5FR6A 2JXXA 1E8ZA 1TTNA 3Q6BA 3BK2A 4IWPA 2RGFA 1FXIA 5BO4B 3HUIA 1UWMA 2KD0A 3EFCA 2G9HD 1NYRA 5AZFA 3VTVA 4JPSA 3AE3B 4KIKA 5E6JA 3T3NA 2MA9B 1WJ6A 4IG7B 3GZNB 2N7JA 3KQ4A 1UBQA 2GBNA 2RPVA 3A9KA 4BKSA 5L95C 2JWZA 3AMZA 1JMLA 3LJ3A 1LM8B 2Y5BB 2LJIA 3FAHA 3APCA 4E71A 2KJ6A 2WDQB 1SGHA 3RFZB 1WGKA 2PEAA 5HI1A 2KYWA 1I35A 1VRAB 4EE2A 2JZ3B 3UQAA 3DBHB 1TKYA 4KGTA 5CTRC 4C00A 2ONQA 2WYQA 1UD7A 1IPGA 3N32A 1WM2A 2JY6A 2J0MA 4RGOS 3DHGC 2EMSA 2M8SA 4WWMA 1KLGD 3I3TB 1PQSA 1N63A 1QKZA 2BYFA 1AW7A 2GB1A 3ZNID 2LGSA 3PZ8A 2L8JA 4G11A 4N59A 1Q0WB 3W5UB 2MW5A 2PVOD 3S2AA 4W9EA 4JE3B 3AH7A 1RM6C 3IBEA 5FKAC 2FE8A 3OLMD 1D3ZA 2L76A 1WX8A 4LCDE 1UWXA 5C2TB 4ZOHC 2RSUA 3VTWA 2INNE 4H2AA 3P4PB 2MQJA 4E74A 2JU6X 3QIJA 2KDEB 1CJEA 4ZYSA 4EZKA 1WR1A 2KT7A 1F9JA 1IP9A 3R66C 1X1MA 4YTNB 4XWTA 4RMAA 2NBWB 4BKTA 4YWGG 1VZ8A 2K8HA 2L52A 5C1ZA 4ACFA 4MSMB 4P1BC 2GBKA 4TUUA 1NI3A 3PS6A 1G6JA 3AE2B 5D94A 1KH0A 4MT5A 2PIAA 1IGDA 1YJ1A 2LUEA 4I6NB 1MVKA 5IA7A 5BMHA 2DYOA 3AU4A 3KYDD 2WXIA 3R7QA 2IO1B 1U4AA 5EE9A 4Q2JA 2KLCA 2WXPA 4A3OA 4YSZB 4A9AA 5G2NA 2N7EA 5HFYA 3VH3B 5C23A 1PUTA 5BMIA 3VDZA 3MFGA 4HDOA 3AM9A 1FCLA 3QWZB 2R61A 2KTRA 1WF9A 2IGGA 3VHTC 1YN3A 2QSDA 2PVGC 3NVZA 2N9XA 3GZNI 4K7UA 3ZVVA 1PYWD 3BYYB 1OTRB 2KOXA 3AE6B 4FJVB 4JIOU 3WAMA 2G4DB 4RFBA 2XNAC 2I1KA 4M0WB 4XDCA 1D6EC 1E7VA 2J52A 2LRUA 1LQBA 2GBRA 2QCZA 4GU2A 4KIKB 3QA8A 3ZJVA 2WWZA 3KLSX 1TS2A 1L2NA 1D5XC 3UQBA 1FRRA 3PREA 2V4IB 3ZUNA 4CQNA 2C7HA 2KMCA 1GUAB 2V0GA 1FFVA 3AU5A 2ZEQA 3AXCA 3ENEA 5AZHA 3FKYA 3A9JA 2MCNB 2MJ3A 4MACA 4MEMA 1JW9D 2RDGA 4YXDB 1LFDA 2C7NB 1A70A 1QOGA 4RGNA 2AEHA 3L08A 4DK5A 1BMLC 2KC2A 4K7WA 2KN4A 4KDLB 3E9SA 4W9JA 5G5HA 4C7YA 3DQVA 1QLBB 3ZTDA 2LVOA 3AI5A 3TEZA 4B0MA 4C56C 3EFUA 3W5VB 4KX6B 5G55A 1M94A 3Q69A 2DNFA 3RNBC 3H7SA 1GOZA 4BZAA 3IAM1 4A8XC 1T0SC 3RI7C 1T0QC 2W55A 1BUIC 3M95A 1HZ6A 2LRWA 3QARA 3ZKJC 4YL8A 2BWFA 4WWNA 4NJ7A 2MBQA 2MLBA 1ET9A 4IM2A 3UGBB 4IWOA 3A4SC 3BK1A 3DHIC 3HM3A 3TCAA 2LUMA 4P1CC 4HVBA 3RNEC 4GB9A 3IT4B 1I7HA 1QZEA 3V3XA 4XC2A 2WDVB 1VJKA 3NOBA 4IC7B 1VLBA 1MPEA 1E8WA 1OQQA 2LGDA 2BS3B 3PRMB 3QCAA 1ZKHA 2FCQA 1YN5A 2B76B 4MDKE 2J42A 1VZ7A 3Q8EA 3Q2AC 1WXQA 2JSVX 1EM7A 2V4LA 3KVFB 4P16A 5LLIA 2V3SA 3N9YC 5HKHA 4KZ0A 4TKNA 2NPTA 3HK0A 4ITKA 3V6CB 2WXMA 2KWUB 1UF0A 2KWDA 1OQRA 1TY0A 3EGRA 2W54A 1L6UA 4WIPA 3WANA 2BYTA 2WXQA 3N1ZC 1B1ZA 5GMVA 3OJ4B 3KWLA 1E6EB 1MJDA 4W9IA 4JQWC 4W9FA 2C60A 2CHWA 1UH6A 2WX1A 2BQQA 2RDBC 5BYSA 1I4RA 1OQYA 3RCZA 1XCQL 3K9PB 2IPKD 4FJYA 3MHZA 4UDUC 2QILA 3TUOA 2YLMA 2WNMA 3IT6B 1JWSD 4E3CA 1H4RA 2ZPYA 1DGJA 3CSTA 4F7ZA 3PHXB 2DWQA 2K25A 1JWUD 1L5PA 3SFDB 1EWYC 1YQBA 2D3BA 2EELA 1N5XA 1QOFA 2MWSB 4G0NB 2C9WB 2KHWB 2LASA 5CHFA 2JUOA 4W9HA 2IJ0A 3AE9B 5AEKB 5DCNA 1EF1A 1L4ZB 1YX6B 1P98A 3VXWA 1QOBA 3AEGB 2AQ3B 1BT0A 5CX3A 1YOVB 2XK5B 2CR5A 1P9DU 3IHPC 4DDID 2R2OA 1SB3C 4YT0B 3VUXA 2KANA 3L0WB 3DPDA 3B9JA 4DWFA 1RYJA 1VZ6A 2QJLA 4IKGA 4B9KA 4TV3A 2L0FA 1E10A 1YMHE 1PDXA 2B3AA 3NHEB 4II2B 2G3QB 1XQQA 4ZYNA 3H7PB 5I4DA 2UYZB 1P7FA 3DCGA 3A9JB 3ML9A 3EHVA 1UBIA 1I4HA 2N9LA 1KJTA 2DAJA 1JWAD 1E8XA 2CJNA 2K1FA 2H89B 1WE7A 2KJRA 4OHJA 2BF8B 2L83A 2MJEA 3M62B 2RDHA 2DZIA 1FRDA 2Z0EB 1K8RB 1N6ZA 2BS2B 4GN1A 2WDTB 4FBJB 2YEPB 3SD5A 4WJPA 2C5LC 4JWUC 2AQ2B 1MFWA 2LGXA 2V9HA 1Q10A 5DPSA 4AP4C 4ZHPA 2LVQA 1C76A 4ANVA 2ZPNA 3UINB 2M0AA 1OGWA 4M8NA 1CMXB 1FIQA 1PGXA 3BZDB 2LJ5A 5HG2A 1J8CA 3Q8BA 1WRIA 1QOAA 3ZDTA 1Q5WB 1KOTA 1SSNA 1RFKA 2XK5A 1R4MB 1WGRA 4HRSA 4DDGD 3B1LX 1YX5B 2AL6A 3PGEA 2L05A 2A5UA 1WXVA 1KLVA 1P3QU 1JRUA 4XE0A 2JVCA 3PTFC 1FEHA 2KX3A 1MHXA 4XX5A 2KFKA 3AE4B 3IAS1 3DVNU 4MJSB 1L7YA 2KACA 4GSWA 3ZDMC 2AYOB 1ET6A 3V62A 3TSSA 5JH5C 3QJZA 5DPRA 1C77A 4D2KA 3U52E 1WSPA 4J3OD 4L1BA 4OZCA 5CHWA 2I1JA 3P42A 2J0JA 2KWCA 2N7DA 1SBBB 2MBEA 3DBLB 1WZ3A 3TEXA 4B95A 3ZYYX 4PS3A 2HJ8A 2GBMA 4C4VB 1HA5A 2E3TA 4MELA 3ETRA 2DYBA 4RF1A 4FADA 1UZXB 4A90A 1V8CA 3GB1A 3LDZE 4HWIB 5H8YE 3NVWA 2NR2A 3LB8C 3A1QB 4AWJA 1WJNA 4CYEA 4MM3B 5AUIA 3HVDA 1F52A 2V3PA 4HROA 4GXBA 1WMHA 4PYZA 4L23A 4WH4A 4LTUA 1SE9A 2JYTA 4W9KA 3LYYA 1WXSA 2CJOA 3VH4B 4KZCA 3ALBA 4HPMB 3ZGZA 2WXOA 4HLEA 1EO6A 3NJTA 1YJJA 3ZRFA 1T0YA 3ZNZB 3EA6A 2SEBD 1EWCA 5KHOA 2D5GA 1F0ZA 2A4ZA 3AEFB 3M63B 2WXGA 1DOIA 1K50A 3VUWA 2IGDA 4WQMA 2ZVOA 4J6IA 1J7BA 1XEEA 4EOYA 1GB1A 4MJSA 3T9LA 2PKOA 4YTMB 2D07B 5LNK1 1WI0A 3D32A 2GLSA 2JT4B 1P0RA 2IO0B 3BWUD 4JL9A 5FK9C 1FNUA 2NBVB 1FM0D 1YD8U 4X57B 3MHSD 1ZUD2 3VRAB 4GDKB 3R2IA 1FMAD 2M17A 3L13A 4AJWA 4HCNB 3MTNB 2KC1A 1WXMA 2BKFA 3KUZA 2K39A 2NVUI 3AECB 3TIXA 2MRPA 4RM8A 2H88B 4NY0A 3NRZA 2O2VA 2OOBB 3H9DA 3GP7A 3X0WA 3U8ZA 1UELA 1TS3A 4K1RB 2FCSA 2L32A 3I57A 2YEPF 4LLGM 1R4MI 3VFKA 2LWPA 4A3PA 2PLPA 2DZJA 2MEKA 2C7MB 2G45B 2IGHA 3CSFA 4IW0A 3URYA 1V1OA 1MI0A 3CIRB 2BBCA 1I4QA 4K81A 3N20C 2J53A 4HXDA 2FIFA 2WU2B 5AZGA 4RF0A 1XLPA 2EKIA 2QDFA 1ZOYB 3MC9A 3ZIMA 2KFKB 4GGQA 4M01A 1NENB 2I2YA 2UWQA 2GI9A 4K3CA 3MJ5A 3CMMB 4BKGA 1ROEA 2KO3A 3AN1A 2OJWA 4ARCA 2WDRB 1S3SG 2O6VA 4MSQB 2JXTA 1C4AA 3ZXRA 1L4DB 2Z0DB 1EUVB 1WJ4A 4R3DA 3RNCC 3AV8A 2ZNVB 1WR6E
chains in the Genus database with same CATH topology
3DHIC 3RNBC 4P1CC 2INDC 3Q2AC 3Q3MC 3Q14C 3RNEC 2INCC 1T0SC 3I5JC 3N20C 3RI7C 3N1ZC 1T0QC 3N1XC 3GE8C 3GE3C 3RN9C 3RNAC 3Q3OC 4P1BC 3I63C 3N1YC 3DHHC 3Q3NC 3RNCC 1T0RC 3RNFC 2RDBC 3DHGC 3RMKC 3RNGC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DHI C;  3RNB C;  4P1C C;  2IND C;  3Q2A C;  3Q3M C;  3Q14 C;  3RNE C;  2INC C;  1T0S C;  3I5J C;  3N20 C;  3RI7 C;  3N1Z C;  1T0Q C;  3N1X C;  3GE8 C;  3GE3 C;  3RN9 C;  3RNA C;  3Q3O C;  4P1B C;  3I63 C;  3N1Y C;  3DHH C;  3Q3N C;  3RNC C;  1T0R C;  3RNF C;  2RDB C;  3DHG C;  3RMK C;  3RNG C; 
#chains in the Genus database with same CATH topology
 3JVZ X;  2M4N A;  1ENF A;  3RUI B;  1WX7 A;  3A9K B;  1DYQ A;  1VCB A;  1PGA A;  2GOW A;  3NVY A;  3GE8 C;  5MPO A;  1QIL A;  1STE A;  4JX1 C;  3TEW A;  2KTR B;  1NBF C;  1J7C A;  1WGH A;  5EE0 A;  1NYQ A;  2R2Q A;  2N9K A;  1FXA A;  3W1S C;  2LXC A;  4BKS D;  2K9X A;  3ECI A;  1V5O A;  2JZZ A;  1UGJ A;  2WS3 B;  1ZPS A;  5J2R A;  4ZRJ A;  2IDY A;  1V6E A;  2NCN A;  4WUR A;  1GG3 A;  3VR9 B;  1FFU A;  1V80 A;  1KTK A;  2D3A A;  4KKI A;  4NAW B;  3OAW A;  4M02 A;  1WH3 A;  2HD5 B;  1Y56 A;  2PJH A;  4TSS A;  1K51 A;  2BPS A;  2MX2 A;  1SE2 A;  1RAX A;  3R8B A;  1HQR D;  1WWT A;  4RNA A;  4DXA B;  2LHE A;  2NTT A;  3PRZ A;  2DYM A;  1N61 A;  3EUB 2;  2VZK D;  4URK A;  3ZLZ A;  5LXH A;  1TGZ B;  4HPL B;  2FCM A;  1YQ4 B;  1XT9 B;  5BYQ A;  1WZ0 A;  2BWE S;  3QX1 A;  3JYU A;  1KF6 B;  3CF6 E;  5E6N A;  1V81 A;  2HE7 A;  5J17 A;  1RFA A;  4FLH A;  2FNJ B;  2PE6 B;  3JW0 X;  5EDS A;  2JRI B;  2IBI B;  3R2T A;  3X23 A;  1L0V B;  1ZGU B;  3MP9 A;  3Q3J A;  3ZNG C;  1C3T A;  3A33 B;  2PW9 A;  4PS7 A;  4XGA B;  3SEB A;  1SIJ A;  4TQ0 A;  4GDK A;  3ZNH B;  2L1A A;  1WGG A;  2UU7 A;  2JRH A;  2O2V B;  1GC6 A;  3N1X C;  3RZW C;  3BVG A;  2W82 A;  3GS2 A;  2KMM A;  1N62 A;  1VR9 A;  2G4S A;  4G3X B;  2RD0 A;  3KUC B;  2ZZP B;  1NDD A;  2J4X A;  4MGK E;  2K6D B;  2JYE A;  4LNI A;  2KN5 A;  4OW0 A;  4S17 A;  3SHQ A;  3W1S A;  3W1Y A;  4BVU C;  3NY5 A;  1FXT B;  4EKU A;  4MGZ E;  1TY2 A;  2I38 A;  4C7Z A;  3T8M A;  2D3C A;  1P1A A;  1XO3 A;  2Q5W D;  4RGT A;  4ZRK A;  3RNF C;  5D3D A;  2KK8 A;  4BBN F;  3BY4 B;  4ASW C;  5CHV C;  3HM6 X;  3C0R B;  1JQ4 A;  2LGI A;  2K8C A;  2L00 B;  4NAW A;  1R7S A;  5IOI A;  3GOE A;  4W9C A;  2KQS A;  2CHX A;  3TL5 A;  2W9N A;  2KJH B;  2MP2 B;  2EMT A;  2KTF A;  2FID A;  2MBH A;  1WX9 A;  2MSE D;  2NBU A;  4OZB A;  1AAR A;  1XXG A;  3I5J C;  2DBY A;  1AYF A;  2VRR B;  1RWS A;  2J0K A;  5IO9 A;  1LGR A;  4ICU A;  3AUL A;  1ISN A;  3AEE B;  3W9C B;  1QT9 A;  1KLU D;  2WLB A;  3DWM A;  5D7G A;  2L0T A;  4BOZ B;  3B2G A;  5D3I B;  1ZDX A;  2KVZ A;  1WIA A;  3ZJU A;  2LXA A;  1Y8R C;  4PK1 A;  1WJU A;  4EZJ A;  1XCT L;  2ZJD A;  3ZO5 B;  1D5M C;  2KDF B;  1WGD A;  2WGS A;  3DHH C;  1A5R A;  1YIW A;  4LDT B;  1YNT E;  3AE7 B;  3QAQ A;  3R3M A;  3UIP B;  1I42 A;  1KFY B;  2M56 B;  2IO3 B;  2D11 A;  3Q8C A;  1Z5S B;  3SFE B;  4GIV A;  1B9R A;  3RN9 C;  3VTU A;  3U7D A;  3P2B A;  1SF0 A;  1HZ5 A;  2K0P A;  1FCC C;  3DVG X;  1PFD A;  4HPP A;  2HDE A;  2GMI C;  1XLQ A;  1E90 A;  4NZL B;  3KH0 A;  5TSS A;  4FN2 A;  3RYT A;  3SU8 X;  2X38 A;  4NNJ B;  2FAZ A;  3ZXV A;  1EF5 A;  2BGF A;  4FXC A;  4W9D A;  1XLO A;  1TS5 A;  3P4R B;  3RUL A;  3FIL B;  3U30 A;  4BOS C;  2KFJ A;  2MJD A;  3O65 B;  1FPY A;  3WAO A;  2X8X X;  1F2R C;  1V5T A;  3BVZ A;  4DHZ E;  4OVU A;  1GB4 A;  4HKQ A;  1FNV A;  2QHO A;  1WXA A;  4ZDV A;  2KAJ A;  3RNG C;  2BKR B;  2KXJ A;  2JF5 A;  2N1W A;  3APF A;  4DXF A;  4ZRP A;  3ZW3 A;  4YSX B;  1WYW B;  4O1N A;  3B2F A;  3HIZ A;  5JHA A;  5KHQ A;  2FUH B;  3RPF C;  3ABV B;  2N4F A;  3I9V 1;  4XDD A;  4AQ7 A;  3PVL A;  1I4P A;  2BVC A;  4PYU A;  3RZF A;  1TJE A;  5IP4 D;  1F77 A;  4HDQ A;  2ZVN A;  2RMM A;  2KZR A;  3NZU A;  3UF8 A;  4QAY A;  5DPW A;  4C4V A;  1C4P A;  2XEW A;  1SJE D;  1E8Y A;  2BT6 A;  2OJR A;  1JWM D;  1T0R C;  1OFF A;  2G1E A;  4WJN A;  2ICI A;  2AQ1 B;  2J7Q B;  2KQ7 A;  2JQR B;  3ZJT A;  1C79 A;  3E56 A;  2XBB C;  3QQ8 B;  3IXS A;  1L0X B;  3I63 C;  2N9P C;  1JRP A;  4XWW A;  1L0Y B;  4HK2 A;  4LNF A;  4K7S A;  3TJP A;  4N6E B;  2ACZ B;  4W9L A;  3TEY A;  1JAL A;  4HCP B;  4ANX A;  2M1M A;  3M3J A;  3OJ3 A;  3L16 A;  4BAX A;  2D2Q A;  2WP9 B;  2CU3 A;  1TKE A;  1DOX A;  4JWS C;  4HKZ E;  2LHD A;  3NUH B;  2V1Y A;  5IN7 A;  2ZCB A;  4ARI A;  3OWE B;  3N1Y C;  3U4E G;  2E6X A;  3Q8F A;  4IUM B;  2KDI A;  3ZTC A;  1K53 A;  1T6B X;  3MC0 B;  5AUK A;  2D3G A;  2BW2 A;  2ZW0 A;  3RD2 A;  4IDI A;  3N30 A;  4RCO A;  2MH7 A;  2WX0 A;  1AN8 A;  1V86 A;  5D2M B;  3IFW B;  3H6N A;  3AE1 B;  2DEN B;  4LK0 M;  3VRB B;  1SJH D;  1N5W A;  1QQR A;  2PMV A;  4W9G A;  2N1V A;  4EFO A;  1ZW7 A;  1V1P A;  1WGY A;  3PPA A;  1SIF A;  4BBN C;  4M8M A;  4NQL B;  1NVI D;  2INC C;  1ZDV A;  4KVG B;  1F1H A;  5DPT A;  4S0R A;  5IKC M;  1LXD A;  2MBB B;  3MJW A;  1EU3 A;  3HRD D;  2INP E;  1Z2M A;  2IYD B;  1TT5 B;  2VH2 A;  3P63 A;  3NZ3 A;  1Q1O A;  1F2R I;  3L4P A;  2PE9 A;  2KX0 A;  3OG5 A;  3TMP B;  3O13 A;  4WJQ A;  1MHH E;  3B0A A;  1JWB D;  4KSL C;  1EU4 A;  3VR8 B;  1TBE A;  3UIO B;  4WJO A;  4USA A;  4A55 A;  4ZHO A;  1RRB A;  2DLB A;  1HXY D;  2N0S B;  5J18 A;  3PZ7 A;  4IOI E;  2DX5 B;  5JZE B;  1IGC A;  5E6O A;  1TYG B;  4KDI C;  4LNN A;  2K6Q A;  5G5G A;  1M4V A;  3V05 A;  2CHZ A;  1WE6 A;  4DHJ D;  3Q14 C;  2D10 A;  3AE8 B;  4NJC A;  1WFY A;  2GRI A;  1H8C A;  4FJZ A;  2OHF A;  3PV1 A;  2CU1 A;  4IM3 A;  2JPH A;  2YVC A;  3V61 A;  2DHZ A;  5HHD G;  1BXT A;  3PRP B;  4M0W A;  1T3Q A;  1GNU A;  4GMV A;  4I6P A;  3K9O B;  3PHW B;  2CS4 A;  3BYT B;  4GOC A;  2DZM A;  1HE8 A;  2GBJ A;  1FNW A;  4JGH B;  2MHJ A;  3KYC D;  2V3N A;  3DWG C;  3V6E B;  4AOF A;  3KUD B;  2L3Z A;  5D6J B;  2VZK B;  1MG8 A;  3QC8 B;  1D4B A;  4KKJ A;  4TQ1 A;  3JSV B;  2M19 A;  4EEW A;  2DAF A;  3VVW B;  1V49 A;  1C1Y B;  2KWV B;  1ACC A;  1SE4 A;  3DBL I;  4XZ4 A;  2RPQ A;  1KM7 A;  1OEY A;  2WXN A;  4OVV A;  3Q3N C;  4WAA A;  1IBX A;  3DBH I;  2IY0 B;  3P1M A;  1LO5 D;  4N58 A;  4BFR A;  3Q3M C;  2WXJ A;  2AWT A;  2BYV E;  4MH0 E;  3C8Y A;  2K3U A;  1V9J A;  1T5X D;  4F1S A;  2WXF A;  4RH6 A;  3L17 A;  2WXL A;  4LNK A;  1UUP A;  1UGM A;  3H1U A;  3ZRC A;  3AEB B;  2JWU A;  1GJZ A;  3IVF A;  4MM3 A;  1YJI A;  3PSE B;  1J19 A;  4ANW A;  3IG3 A;  4IM0 A;  4KGR A;  2W3R A;  2WXK A;  1UNS A;  3H7P A;  1AWD A;  3KW5 B;  3WIM A;  3N3K B;  1D5Z C;  2AL3 A;  4IWQ A;  3RMK C;  1SXT A;  3DBR B;  3AB5 A;  2LD9 A;  1V1P B;  1NI2 A;  2SAK A;  3QK0 A;  4HJG E;  5T8I A;  2PPH A;  2FCN A;  3BIN A;  3R7R A;  4ICV A;  3V60 A;  1J7A A;  2MP2 A;  4P6V F;  4DHZ B;  2M0X A;  4K3B A;  4FHK A;  2LEK A;  1OEY J;  1GAQ B;  4FUL A;  4EUT A;  1NEK B;  3UI3 A;  1WYG A;  4MH8 A;  1WRD B;  4A6Q A;  4FA6 A;  3T3O A;  1E7U A;  2KVR A;  1RLF A;  1HTQ A;  1WM3 A;  3L10 B;  4WAF A;  1YQ3 B;  5BMG A;  1MG4 A;  3JSV A;  4OZA A;  2ZNV C;  4L2Y A;  2QEJ C;  2JX5 A;  3CWI A;  2LI5 A;  3DOW A;  4AS1 A;  2LVP A;  3RT3 B;  2WHI A;  4GDL A;  4LNO A;  4EZL A;  4REZ A;  2W3S A;  4P7I A;  3A1Q A;  3QHT A;  2N9E B;  3AEA B;  2LFI A;  1FO4 A;  1V97 A;  1IYF A;  2Y3A A;  2CKH B;  4MGY E;  1C9F A;  4LJO B;  5IAA C;  4M00 A;  3EEC A;  4DBG A;  3U7Z A;  2K5P A;  4GLS C;  4CO7 A;  4A20 A;  3NZS A;  3ONS A;  2FBW B;  3A4R A;  2QC8 A;  1TIF A;  1TZ1 A;  3NG0 A;  2WU5 B;  3BVM A;  1GPX A;  1N60 A;  1JCK B;  2XN9 C;  3HHM A;  4CHK A;  4HEA 1;  3WA0 A;  2MBO A;  4US8 A;  1ESF A;  2HJ1 A;  2NS5 A;  3WAP A;  2KMA A;  4WWO A;  4OVZ A;  2IO2 B;  4DXG A;  2REX A;  2KNB A;  4KGS A;  2HTH A;  3NS1 A;  3P4Q B;  4YTP B;  1CQV A;  1WY8 A;  2KLG A;  5JHB A;  3VQI A;  2KQ4 X;  4JLC A;  1IBX B;  3DBS A;  5E6P A;  3H8H A;  4ZRI A;  5L83 A;  2LMC A;  4ANU A;  4FHJ A;  2FUG 1;  3C19 A;  1E9M A;  1R4N B;  2VH1 A;  2NPT B;  2PTL A;  2RR9 A;  3GE3 C;  2BYE A;  3PT2 B;  4NQK E;  2NTS A;  1R4N I;  3MC8 A;  4YSY B;  1JRO A;  1ZE3 D;  1J0G A;  1IUE A;  1WMH B;  4PT5 A;  1L6V A;  2AX5 A;  3DBR I;  2LZ6 A;  3DVN V;  3NS8 A;  1ZXH A;  3P4S B;  2NMQ A;  4LJP B;  4DHJ B;  1ZP0 B;  4ZRQ A;  3FIL A;  4G50 A;  1S1Q B;  2OED A;  2WQY B;  1QF6 A;  1V2Y A;  3BII D;  1SE3 A;  3HVZ A;  1XF5 L;  2LGY A;  3DVG Y;  1C4C A;  2KDB A;  4II3 B;  3W2D A;  2BB6 A;  3APD A;  1VD2 A;  3NVV A;  3L54 A;  1DOY A;  4PS8 A;  1SEB D;  2K22 A;  2HTM E;  1P7E A;  2DZK A;  4WQO B;  2QIE B;  5BYR A;  3RNA C;  4KSK C;  3Q3F A;  2IZV B;  4AUQ C;  1VDV A;  1KRH A;  1CZP A;  3Q8A A;  3WCQ A;  1XD3 B;  4KV2 A;  2O6V B;  1TS4 A;  2WXH A;  3ZQ4 A;  3KWV A;  1E5W A;  4NPN A;  1E0Z A;  3FC4 A;  2Z8L A;  5EE1 A;  3SR6 A;  3PLV A;  4I6L B;  5JXV A;  5C3J B;  5H92 C;  4B0E A;  2BTE A;  1C78 A;  2TSS A;  1GC7 A;  4AJY B;  2BB5 A;  5LXI B;  1XLN A;  4DQO C;  2Y5P A;  2KDM A;  3EC8 A;  2IND C;  3DDC B;  3ML8 A;  3J9C A;  4LDT D;  4WWP A;  2K8B A;  1HEZ E;  2BS4 B;  4HJK A;  2ASQ A;  3LXF A;  4RM9 A;  3AE5 B;  4GDL B;  4US9 A;  2QMT A;  1CK1 A;  5FR3 A;  2Z59 B;  3PO0 A;  4F8C B;  1I4X A;  3PZD A;  1TZO A;  4NJ6 A;  3VAW A;  2ZW1 A;  3VUY A;  4XYC A;  2KKC A;  2WXR A;  1I4G A;  2ON8 A;  5GXG B;  2Y5C A;  2JZP A;  2IY1 B;  5EE3 A;  5TR5 A;  3WAL A;  3Q3O C;  2L7R A;  3B08 A;  3U2S C;  2O6V D;  2ZCC A;  3PLU A;  1TKG A;  1K52 A;  4N9F 4;  4NAM A;  4MGI E;  3TBL D;  1ZXI A;  4B6W A;  1HTO A;  1YN4 A;  4TMA B;  1PGB A;  2EKE C;  4RGM A;  4C80 A;  1FD6 A;  3SDL C;  1E7P B;  3AED B;  5FR6 A;  2JXX A;  1E8Z A;  1TTN A;  3Q6B A;  3BK2 A;  4IWP A;  2RGF A;  1FXI A;  5BO4 B;  3HUI A;  1UWM A;  2KD0 A;  3EFC A;  2G9H D;  1NYR A;  5AZF A;  3VTV A;  4JPS A;  3AE3 B;  4KIK A;  5E6J A;  3T3N A;  2MA9 B;  1WJ6 A;  4IG7 B;  3GZN B;  2N7J A;  3KQ4 A;  1UBQ A;  2GBN A;  2RPV A;  3A9K A;  4BKS A;  5L95 C;  2JWZ A;  3AMZ A;  1JML A;  3LJ3 A;  1LM8 B;  2Y5B B;  2LJI A;  3FAH A;  3APC A;  4E71 A;  2KJ6 A;  2WDQ B;  1SGH A;  3RFZ B;  1WGK A;  2PEA A;  5HI1 A;  2KYW A;  1I35 A;  1VRA B;  4EE2 A;  2JZ3 B;  3UQA A;  3DBH B;  1TKY A;  4KGT A;  5CTR C;  4C00 A;  2ONQ A;  2WYQ A;  1UD7 A;  1IPG A;  3N32 A;  1WM2 A;  2JY6 A;  2J0M A;  4RGO S;  3DHG C;  2EMS A;  2M8S A;  4WWM A;  1KLG D;  3I3T B;  1PQS A;  1N63 A;  1QKZ A;  2BYF A;  1AW7 A;  2GB1 A;  3ZNI D;  2LGS A;  3PZ8 A;  2L8J A;  4G11 A;  4N59 A;  1Q0W B;  3W5U B;  2MW5 A;  2PVO D;  3S2A A;  4W9E A;  4JE3 B;  3AH7 A;  1RM6 C;  3IBE A;  5FKA C;  2FE8 A;  3OLM D;  1D3Z A;  2L76 A;  1WX8 A;  4LCD E;  1UWX A;  5C2T B;  4ZOH C;  2RSU A;  3VTW A;  2INN E;  4H2A A;  3P4P B;  2MQJ A;  4E74 A;  2JU6 X;  3QIJ A;  2KDE B;  1CJE A;  4ZYS A;  4EZK A;  1WR1 A;  2KT7 A;  1F9J A;  1IP9 A;  3R66 C;  1X1M A;  4YTN B;  4XWT A;  4RMA A;  2NBW B;  4BKT A;  4YWG G;  1VZ8 A;  2K8H A;  2L52 A;  5C1Z A;  4ACF A;  4MSM B;  4P1B C;  2GBK A;  4TUU A;  1NI3 A;  3PS6 A;  1G6J A;  3AE2 B;  5D94 A;  1KH0 A;  4MT5 A;  2PIA A;  1IGD A;  1YJ1 A;  2LUE A;  4I6N B;  1MVK A;  5IA7 A;  5BMH A;  2DYO A;  3AU4 A;  3KYD D;  2WXI A;  3R7Q A;  2IO1 B;  1U4A A;  5EE9 A;  4Q2J A;  2KLC A;  2WXP A;  4A3O A;  4YSZ B;  4A9A A;  5G2N A;  2N7E A;  5HFY A;  3VH3 B;  5C23 A;  1PUT A;  5BMI A;  3VDZ A;  3MFG A;  4HDO A;  3AM9 A;  1FCL A;  3QWZ B;  2R61 A;  2KTR A;  1WF9 A;  2IGG A;  3VHT C;  1YN3 A;  2QSD A;  2PVG C;  3NVZ A;  2N9X A;  3GZN I;  4K7U A;  3ZVV A;  1PYW D;  3BYY B;  1OTR B;  2KOX A;  3AE6 B;  4FJV B;  4JIO U;  3WAM A;  2G4D B;  4RFB A;  2XNA C;  2I1K A;  4M0W B;  4XDC A;  1D6E C;  1E7V A;  2J52 A;  2LRU A;  1LQB A;  2GBR A;  2QCZ A;  4GU2 A;  4KIK B;  3QA8 A;  3ZJV A;  2WWZ A;  3KLS X;  1TS2 A;  1L2N A;  1D5X C;  3UQB A;  1FRR A;  3PRE A;  2V4I B;  3ZUN A;  4CQN A;  2C7H A;  2KMC A;  1GUA B;  2V0G A;  1FFV A;  3AU5 A;  2ZEQ A;  3AXC A;  3ENE A;  5AZH A;  3FKY A;  3A9J A;  2MCN B;  2MJ3 A;  4MAC A;  4MEM A;  1JW9 D;  2RDG A;  4YXD B;  1LFD A;  2C7N B;  1A70 A;  1QOG A;  4RGN A;  2AEH A;  3L08 A;  4DK5 A;  1BML C;  2KC2 A;  4K7W A;  2KN4 A;  4KDL B;  3E9S A;  4W9J A;  5G5H A;  4C7Y A;  3DQV A;  1QLB B;  3ZTD A;  2LVO A;  3AI5 A;  3TEZ A;  4B0M A;  4C56 C;  3EFU A;  3W5V B;  4KX6 B;  5G55 A;  1M94 A;  3Q69 A;  2DNF A;  3RNB C;  3H7S A;  1GOZ A;  4BZA A;  3IAM 1;  4A8X C;  1T0S C;  3RI7 C;  1T0Q C;  2W55 A;  1BUI C;  3M95 A;  1HZ6 A;  2LRW A;  3QAR A;  3ZKJ C;  4YL8 A;  2BWF A;  4WWN A;  4NJ7 A;  2MBQ A;  2MLB A;  1ET9 A;  4IM2 A;  3UGB B;  4IWO A;  3A4S C;  3BK1 A;  3DHI C;  3HM3 A;  3TCA A;  2LUM A;  4P1C C;  4HVB A;  3RNE C;  4GB9 A;  3IT4 B;  1I7H A;  1QZE A;  3V3X A;  4XC2 A;  2WDV B;  1VJK A;  3NOB A;  4IC7 B;  1VLB A;  1MPE A;  1E8W A;  1OQQ A;  2LGD A;  2BS3 B;  3PRM B;  3QCA A;  1ZKH A;  2FCQ A;  1YN5 A;  2B76 B;  4MDK E;  2J42 A;  1VZ7 A;  3Q8E A;  3Q2A C;  1WXQ A;  2JSV X;  1EM7 A;  2V4L A;  3KVF B;  4P16 A;  5LLI A;  2V3S A;  3N9Y C;  5HKH A;  4KZ0 A;  4TKN A;  2NPT A;  3HK0 A;  4ITK A;  3V6C B;  2WXM A;  2KWU B;  1UF0 A;  2KWD A;  1OQR A;  1TY0 A;  3EGR A;  2W54 A;  1L6U A;  4WIP A;  3WAN A;  2BYT A;  2WXQ A;  3N1Z C;  1B1Z A;  5GMV A;  3OJ4 B;  3KWL A;  1E6E B;  1MJD A;  4W9I A;  4JQW C;  4W9F A;  2C60 A;  2CHW A;  1UH6 A;  2WX1 A;  2BQQ A;  2RDB C;  5BYS A;  1I4R A;  1OQY A;  3RCZ A;  1XCQ L;  3K9P B;  2IPK D;  4FJY A;  3MHZ A;  4UDU C;  2QIL A;  3TUO A;  2YLM A;  2WNM A;  3IT6 B;  1JWS D;  4E3C A;  1H4R A;  2ZPY A;  1DGJ A;  3CST A;  4F7Z A;  3PHX B;  2DWQ A;  2K25 A;  1JWU D;  1L5P A;  3SFD B;  1EWY C;  1YQB A;  2D3B A;  2EEL A;  1N5X A;  1QOF A;  2MWS B;  4G0N B;  2C9W B;  2KHW B;  2LAS A;  5CHF A;  2JUO A;  4W9H A;  2IJ0 A;  3AE9 B;  5AEK B;  5DCN A;  1EF1 A;  1L4Z B;  1YX6 B;  1P98 A;  3VXW A;  1QOB A;  3AEG B;  2AQ3 B;  1BT0 A;  5CX3 A;  1YOV B;  2XK5 B;  2CR5 A;  1P9D U;  3IHP C;  4DDI D;  2R2O A;  1SB3 C;  4YT0 B;  3VUX A;  2KAN A;  3L0W B;  3DPD A;  3B9J A;  4DWF A;  1RYJ A;  1VZ6 A;  2QJL A;  4IKG A;  4B9K A;  4TV3 A;  2L0F A;  1E10 A;  1YMH E;  1PDX A;  2B3A A;  3NHE B;  4II2 B;  2G3Q B;  1XQQ A;  4ZYN A;  3H7P B;  5I4D A;  2UYZ B;  1P7F A;  3DCG A;  3A9J B;  3ML9 A;  3EHV A;  1UBI A;  1I4H A;  2N9L A;  1KJT A;  2DAJ A;  1JWA D;  1E8X A;  2CJN A;  2K1F A;  2H89 B;  1WE7 A;  2KJR A;  4OHJ A;  2BF8 B;  2L83 A;  2MJE A;  3M62 B;  2RDH A;  2DZI A;  1FRD A;  2Z0E B;  1K8R B;  1N6Z A;  2BS2 B;  4GN1 A;  2WDT B;  4FBJ B;  2YEP B;  3SD5 A;  4WJP A;  2C5L C;  4JWU C;  2AQ2 B;  1MFW A;  2LGX A;  2V9H A;  1Q10 A;  5DPS A;  4AP4 C;  4ZHP A;  2LVQ A;  1C76 A;  4ANV A;  2ZPN A;  3UIN B;  2M0A A;  1OGW A;  4M8N A;  1CMX B;  1FIQ A;  1PGX A;  3BZD B;  2LJ5 A;  5HG2 A;  1J8C A;  3Q8B A;  1WRI A;  1QOA A;  3ZDT A;  1Q5W B;  1KOT A;  1SSN A;  1RFK A;  2XK5 A;  1R4M B;  1WGR A;  4HRS A;  4DDG D;  3B1L X;  1YX5 B;  2AL6 A;  3PGE A;  2L05 A;  2A5U A;  1WXV A;  1KLV A;  1P3Q U;  1JRU A;  4XE0 A;  2JVC A;  3PTF C;  1FEH A;  2KX3 A;  1MHX A;  4XX5 A;  2KFK A;  3AE4 B;  3IAS 1;  3DVN U;  4MJS B;  1L7Y A;  2KAC A;  4GSW A;  3ZDM C;  2AYO B;  1ET6 A;  3V62 A;  3TSS A;  5JH5 C;  3QJZ A;  5DPR A;  1C77 A;  4D2K A;  3U52 E;  1WSP A;  4J3O D;  4L1B A;  4OZC A;  5CHW A;  2I1J A;  3P42 A;  2J0J A;  2KWC A;  2N7D A;  1SBB B;  2MBE A;  3DBL B;  1WZ3 A;  3TEX A;  4B95 A;  3ZYY X;  4PS3 A;  2HJ8 A;  2GBM A;  4C4V B;  1HA5 A;  2E3T A;  4MEL A;  3ETR A;  2DYB A;  4RF1 A;  4FAD A;  1UZX B;  4A90 A;  1V8C A;  3GB1 A;  3LDZ E;  4HWI B;  5H8Y E;  3NVW A;  2NR2 A;  3LB8 C;  3A1Q B;  4AWJ A;  1WJN A;  4CYE A;  4MM3 B;  5AUI A;  3HVD A;  1F52 A;  2V3P A;  4HRO A;  4GXB A;  1WMH A;  4PYZ A;  4L23 A;  4WH4 A;  4LTU A;  1SE9 A;  2JYT A;  4W9K A;  3LYY A;  1WXS A;  2CJO A;  3VH4 B;  4KZC A;  3ALB A;  4HPM B;  3ZGZ A;  2WXO A;  4HLE A;  1EO6 A;  3NJT A;  1YJJ A;  3ZRF A;  1T0Y A;  3ZNZ B;  3EA6 A;  2SEB D;  1EWC A;  5KHO A;  2D5G A;  1F0Z A;  2A4Z A;  3AEF B;  3M63 B;  2WXG A;  1DOI A;  1K50 A;  3VUW A;  2IGD A;  4WQM A;  2ZVO A;  4J6I A;  1J7B A;  1XEE A;  4EOY A;  1GB1 A;  4MJS A;  3T9L A;  2PKO A;  4YTM B;  2D07 B;  5LNK 1;  1WI0 A;  3D32 A;  2GLS A;  2JT4 B;  1P0R A;  2IO0 B;  3BWU D;  4JL9 A;  5FK9 C;  1FNU A;  2NBV B;  1FM0 D;  1YD8 U;  4X57 B;  3MHS D;  1ZUD 2;  3VRA B;  4GDK B;  3R2I A;  1FMA D;  2M17 A;  3L13 A;  4AJW A;  4HCN B;  3MTN B;  2KC1 A;  1WXM A;  2BKF A;  3KUZ A;  2K39 A;  2NVU I;  3AEC B;  3TIX A;  2MRP A;  4RM8 A;  2H88 B;  4NY0 A;  3NRZ A;  2O2V A;  2OOB B;  3H9D A;  3GP7 A;  3X0W A;  3U8Z A;  1UEL A;  1TS3 A;  4K1R B;  2FCS A;  2L32 A;  3I57 A;  2YEP F;  4LLG M;  1R4M I;  3VFK A;  2LWP A;  4A3P A;  2PLP A;  2DZJ A;  2MEK A;  2C7M B;  2G45 B;  2IGH A;  3CSF A;  4IW0 A;  3URY A;  1V1O A;  1MI0 A;  3CIR B;  2BBC A;  1I4Q A;  4K81 A;  3N20 C;  2J53 A;  4HXD A;  2FIF A;  2WU2 B;  5AZG A;  4RF0 A;  1XLP A;  2EKI A;  2QDF A;  1ZOY B;  3MC9 A;  3ZIM A;  2KFK B;  4GGQ A;  4M01 A;  1NEN B;  2I2Y A;  2UWQ A;  2GI9 A;  4K3C A;  3MJ5 A;  3CMM B;  4BKG A;  1ROE A;  2KO3 A;  3AN1 A;  2OJW A;  4ARC A;  2WDR B;  1S3S G;  2O6V A;  4MSQ B;  2JXT A;  1C4A A;  3ZXR A;  1L4D B;  2Z0D B;  1EUV B;  1WJ4 A;  4R3D A;  3RNC C;  3AV8 A;  2ZNV B;  1WR6 E; 
#chains in the Genus database with same CATH homology
 3DHI C;  3RNB C;  4P1C C;  2IND C;  3Q2A C;  3Q3M C;  3Q14 C;  3RNE C;  2INC C;  1T0S C;  3I5J C;  3N20 C;  3RI7 C;  3N1Z C;  1T0Q C;  3N1X C;  3GE8 C;  3GE3 C;  3RN9 C;  3RNA C;  3Q3O C;  4P1B C;  3I63 C;  3N1Y C;  3DHH C;  3Q3N C;  3RNC C;  1T0R C;  3RNF C;  2RDB C;  3DHG C;  3RMK C;  3RNG C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...