1T0QC

Structure of the toluene/o-xylene monooxygenase hydroxylase
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
83
structure length
83
Chain Sequence
TFPIMSNFERDFVIQLVPVDTEDTMDQVAEKCAYHSINRRVHPQPEKILRVRRHEDGTLFPRGMIVSDAGLRPTETLDIIFMD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords toluene, o-xylene monooxygenase oxygenase subunit
publication title Crystal Structure of the Toluene/o-Xylene Monooxygenase Hydroxylase from Pseudomonas stutzeri OX1: INSIGHT INTO THE SUBSTRATE SPECIFICITY, SUBSTRATE CHANNELING, AND ACTIVE SITE TUNING OF MULTICOMPONENT MONOOXYGENASES.
pubmed doi rcsb
source organism Pseudomonas stutzeri
molecule tags Oxidoreductase
total genus 25
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2004-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF06234 TmoB Toluene-4-monooxygenase system protein B (TmoB)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.270 Alpha Beta Roll Ubiquitin-like (UB roll) TmoB-like 1t0qC00
3RNEC 3GE3C 3Q14C 3I63C 2INDC 3N1ZC 2INCC 3Q3MC 3I5JC 3RNAC 3Q3NC 2RDBC 3N1XC 3DHHC 3RNFC 4P1CC 1T0RC 3N1YC 3DHGC 3RNGC 1T0SC 3N20C 3Q3OC 3RN9C 3RMKC 3GE8C 3RI7C 4P1BC 1T0QC 3RNBC 3Q2AC 3DHIC 3RNCC
chains in the Genus database with same CATH superfamily
4K3BA 3VUYA 2D3AA 3UF8A 1WZ0A 4DK5A 2ZVNA 3DBRB 4AOFA 5JXVA 1FXIA 2NVUI 1UNSA 3H7SA 3AE8B 1WM3A 1J0GA 1YN3A 4ICVA 3WAPA 4BBNC 1WYWB 3QQ8B 2A4ZA 2L52A 4KV2A 3O13A 4BZAA 3QK0A 4MT5A 4NZLB 1AARA 4MACA 3ZQ4A 4GDKB 1IYFA 4FLHA 4XX5A 2RR9A 1JRPA 1M4VA 2LMCA 2XK5B 2IPKD 3SD5A 1PDXA 4NQKE 4RM8A 1C4PA 2KDMA 2WP9B 1OEYJ 4AUQC 2YEPB 2CS4A 3VH4B 2BKRB 2DZMA 4HKZE 4XWWA 5EE1A 5IP4D 2NMQA 4XDDA 1F2RC 2Y3AA 2IBIB 1I42A 1WGKA 2CJOA 4M0WB 1QT9A 2I1JA 3N1XC 4D2KA 4LNNA 3N3KB 2ON8A 1WJ6A 3RN9C 2M1MA 2MBOA 3PHWB 4TQ1A 2LWPA 1YX6B 3A1QA 3T3NA 1N5WA 3PREA 1UBIA 3RNCC 1P98A 1RM6C 4IKGA 4PK1A 2KTFA 2AEHA 4MDKE 2MJEA 4KGSA 1RRBA 1LM8B 3I3TB 4HDQA 4WWOA 1KOTA 3M95A 1HA5A 2FE8A 1F1HA 2XBBC 1LGRA 2K8CA 1YJJA 3QC8B 2W9NA 2ZPYA 4FXCA 2RDGA 3KUZA 4M8MA 2WGSA 2L76A 3IAM1 4ZYNA 1ZP0B 1OTRB 2OHFA 2BB6A 2RDBC 3JVZX 3ML8A 2N1WA 4MEMA 2RDHA 3AE4B 2Z0EB 2KVZA 1L6VA 1AN8A 3DBHI 1ZOYB 2D07B 3KUCB 3PZ7A 2LFIA 1T5XD 1BUIC 1IGCA 4S17A 4N6EB 1I4GA 5FKAC 3N9YC 1TTNA 4WURA 1EUVB 1FRDA 3AEFB 3UIPB 2FAZA 3PLVA 1VZ6A 1IPGA 1FXTB 1IP9A 3TSSA 2JPHA 4FA6A 4ANVA 1YMHE 1TKYA 3IBEA 1UH6A 2KWDA 3ZXVA 3Q6BA 1WX7A 1D5ZC 4B9KA 1RLFA 2MBHA 2KTRA 4HJGE 3DBRI 2ZNVB 2OJRA 2KDFB 2GBNA 1ISNA 3LDZE 3A9KA 4E3CA 2AQ3B 1NI3A 1V1PB 2BQQA 1A5RA 1KJTA 4LK0M 3Q14C 5E6JA 3B2GA 2AL6A 2AQ2B 5L83A 4TKNA 1SB3C 3ZNGC 3AI5A 1FIQA 3C8YA 2K9XA 3DHGC 4ANUA 1TJEA 3WANA 2WXOA 4LJOB 1LFDA 3Q3JA 1XLQA 3DPDA 2CR5A 3ZVVA 1TZOA 3H7PA 1L4ZB 1YJIA 3MC9A 2MW5A 1T3QA 4RGMA 4JX1C 2G3QB 4DHZE 4ANWA 2W82A 4JL9A 1MPEA 3KQ4A 2WXHA 4BKGA 4FULA 3HM6X 1XD3B 1WYGA 2EKEC 5D6JB 3B0AA 4HPPA 4IWQA 3ZJVA 2QC8A 2KKCA 2M0XA 3GP7A 2BGFA 4H2AA 4MH0E 3DQVA 1CJEA 2AWTA 1FXAA 2FCNA 3BWUD 3VTWA 4BOZB 4KIKA 4ZRIA 2A5UA 4EZJA 1L0XB 1TS4A 2LRUA 2WDVB 3S2AA 5IA7A 2DAJA 2N9XA 2AL3A 3B9JA 3PZ8A 5DCNA 3A4SC 1E7PB 3M62B 5HFYA 1V6EA 1VZ7A 1YQBA 2O6VA 5EE3A 4CHKA 3PV1A 3TL5A 1K53A 3ABVB 5D94A 1OQRA 4MM3B 3HHMA 3IT6B 3KYCD 1P3QU 2LXAA 4A20A 4FJZA 4HK2A 2B76B 2QEJC 3PVLA 3AMZA 2WXQA 1S3SG 2LGYA 3SHQA 3VH3B 3O65B 4KGTA 2LGSA 1D4BA 2AQ1B 1Q0WB 1V86A 2D3BA 1I4XA 4F8CB 3QCAA 3R66C 1V9JA 2K5PA 3H8HA 1AYFA 1WXAA 3KYDD 1WZ3A 2ZCCA 4WIPA 3ZO5B 1E8ZA 3FILB 1TIFA 3U2SC 3RPFC 5C1ZA 2MLBA 3RZFA 5AEKB 2WNMA 2L00B 4GOCA 3ZDTA 1SEBD 4CO7A 2GBKA 3U30A 2WXFA 3VRBB 2WXJA 2GBJA 1WR1A 2ZEQA 4C00A 1TT5B 1T6BX 4M0WA 3DBSA 4OVVA 4KDIC 2JRHA 2LGDA 3V60A 3C0RB 4DWFA 4FHJA 3MJ5A 1SGHA 4FJYA 4M02A 1E10A 4B95A 2ICIA 5HG2A 1C4AA 3BK1A 2NPTA 1I4RA 1J7BA 2INDC 1WX8A 3N1ZC 2D11A 2Z8LA 3I5JC 3P4SB 4PS8A 3NUHB 3GZNI 4BBNF 4M01A 4PYUA 1V1OA 1MJDA 4IUMB 1QILA 4C80A 5BMHA 3AE1B 1E90A 1YQ3B 1FFUA 1QKZA 5FR6A 2V4LA 2HDEA 2J0MA 1IBXB 1NEKB 4GGQA 2I2YA 3WAMA 2JXTA 3VHTC 2MBQA 1KTKA 3SDLC 3FC4A 2IO1B 4HJKA 4ZHOA 4HROA 3RNFC 1T0RC 4GB9A 1T0QC 2PTLA 1ET9A 2KDIA 1JWAD 3EUB2 1KLVA 2KANA 2BYTA 3DVNU 2V3SA 4HEA1 4AQ7A 1PFDA 3BINA 3N1YC 3AE5B 1E8YA 4JE3B 1N5XA 1L6UA 4W9GA 3T8MA 5FR3A 2DZIA 1WRIA 2J42A 1GC6A 3OJ4B 2HTME 3BK2A 1NYRA 4MGIE 5JHAA 1V1PA 2N7DA 1WGHA 1D5MC 3P42A 4MSMB 1DOIA 4GXBA 2KTRB 1EO6A 4GIVA 2MQJA 3KWLA 4O1NA 2PIAA 4II3B 2R2OA 3QARA 3URYA 2L3ZA 4S0RA 2JZZA 1MG4A 1UGJA 1P1AA 4JGHB 2WWZA 4XZ4A 1KF6B 1UZXB 2WYQA 3MTNB 1HTOA 4HCNB 4IM0A 2PMVA 4BVUC 1GB4A 3LXFA 1N60A 2J52A 1DOXA 1WFYA 1E7UA 3WALA 4WQMA 1J7CA 3X0WA 3H7PB 4IDIA 3EHVA 2BTEA 2KNBA 1YX5B 4MGYE 2FUHB 1C9FA 5DPWA 2BPSA 4RH6A 2J4XA 3K9PB 3EFUA 3L4PA 2KQSA 1V81A 1VDVA 5C3JB 4FJVB 3DVGY 2M17A 1XLPA 4EUTA 1V8CA 3VXWA 4HCPB 2MCNB 1NYQA 1EWCA 3W9CB 3HIZA 4CYEA 4C7YA 3T9LA 1CZPA 4KIKB 3GB1A 2VH2A 1XO3A 4LCDE 1TS3A 1VR9A 2GRIA 1SIJA 3OLMD 2FIFA 3Q8EA 3VQIA 4MM3A 3I9V1 4DQOC 2JT4B 3NJTA 3UINB 2WU2B 2HD5B 2VRRB 2FCMA 1UBQA 4EOYA 2C7HA 2ASQA 1GOZA 2NTTA 3KH0A 4HDOA 3APFA 1WJNA 1VCBA 4YL8A 2KVRA 1XCQL 2D2QA 2GI9A 5CX3A 1UF0A 1H4RA 4JWUC 1HQRD 3FILA 2DZJA 2H89B 2KJRA 2KN4A 4ZRQA 2GBMA 3H6NA 2PVOD 5BYRA 4PS3A 3EC8A 3PO0A 2QIEB 3AE9B 1CMXB 1LO5D 5FK9C 5IKCM 1E9MA 2GLSA 2V3NA 4P6VF 5E6NA 1YNTE 4WAFA 4P7IA 2KWVB 1K52A 3HK0A 3B1LX 3AN1A 1ZUD2 4A55A 3R7QA 3ZJUA 1OGWA 1I35A 4WJPA 1J8CA 1UD7A 1GG3A 3AEBB 1WE6A 2QHOA 3RCZA 4EE2A 4AJWA 4BKSD 2DENB 3EFCA 3TMPB 2RPVA 3ZKJC 1SE9A 4F7ZA 2NPTB 3DHIC 4WAAA 1TBEA 1V49A 3ZW3A 3ZNZB 2W3SA 4WH4A 3P2BA 4M00A 3C19A 1I4QA 3DDCB 2WXPA 3U8ZA 2RPQA 4YSXB 4ITKA 1XEEA 3TEYA 4L2YA 4P1BC 4RNAA 2KC1A 4QAYA 4IW0A 2BB5A 3KWVA 3VR9B 1IBXA 3PRMB 5E6OA 2NS5A 3ZRFA 3U7ZA 2N9LA 3V6CB 3L0WB 1TS5A 1I4PA 3OAWA 3PS6A 3HUIA 4OW0A 1SJHD 2IY0B 3Q69A 2JVCA 2W54A 1SXTA 5D3IB 4US8A 1L0VB 2Z0DB 2KWUB 4MJSB 4RFBA 3NG0A 4HPLB 4YTPB 2DYOA 3R8BA 3GS2A 4TUUA 4TQ0A 3PPAA 4I6PA 2JWUA 2LEKA 1WH3A 1ET6A 2JRIB 2ZJDA 2E3TA 2FNJB 4ZRJA 2KJ6A 3DHHC 4W9JA 4ZYSA 5DPTA 3NZ3A 3Q8AA 4YWGG 2ZNVC 4II2B 4X57B 5TR5A 2BVCA 2ZPNA 4XE0A 1P7EA 3KW5B 4MGZE 2NBUA 2BF8B 2J0JA 1L2NA 1HEZE 3NS1A 3JYUA 5CHFA 2K6DB 3RNAC 3AULA 1K8RB 3DVNV 4NAMA 3Q3OC 2K1FA 2Y5PA 2K8HA 1FCCC 4W9KA 3AV8A 3P4PB 2OOBB 3AE6B 3GE3C 2V9HA 2M0AA 3DCGA 4PYZA 1MI0A 4I6NB 4Q2JA 2YLMA 3L08A 2FUG1 4NJ7A 2K3UA 1FMAD 2QCZA 3H1UA 3UQAA 1FO4A 2BYFA 4JWSC 4IM2A 1F0ZA 2ZVOA 2KLGA 2MJDA 2NTSA 4LTUA 2BKFA 2LUMA 2VZKD 4OZBA 1WJ4A 4YSYB 1EU3A 3JW0X 1YN5A 1TKGA 3L10B 1FFVA 2K25A 5IAAC 3P4QB 3W2DA 3PRPB 1ENFA 1R4NB 4FHKA 2N0SB 2LASA 2OEDA 4A8XC 2L8JA 3IT4B 1JROA 2ONQA 3R2IA 1VJKA 3VVWB 2J7QB 2UWQA 2B3AA 5J18A 3MHZA 2KQ7A 2LXCA 4EKUA 2HE7A 4NQLB 4JIOU 1XQQA 1F9JA 2CHZA 3PT2B 1B1ZA 5BMIA 3A9JA 3AEGB 3VFKA 3EECA 3P4RB 1SF0A 1ZXHA 3W5VB 3BYTB 1XLOA 4RCOA 1C79A 1TY0A 3TEXA 2EKIA 4WJNA 2ACZB 2N9PC 4UDUC 1G6JA 4DXGA 3I57A 1Z2MA 2MA9B 1WE7A 3NOBA 3HRDD 1N61A 5J2RA 4E71A 2FBWB 3W1SA 4C56C 2MP2A 1CK1A 3CSTA 5JH5C 1TZ1A 1WR6E 2LGIA 1KM7A 3AECB 2N4FA 4ZOHC 4AWJA 4ANXA 1FEHA 2LVPA 2O2VB 2PEAA 1EF1A 4EFOA 2Z59B 5JZEB 2EMSA 1Q1OA 2LHEA 3RFZB 1XT9B 2PE9A 1STEA 1P9DU 4WQOB 3NRZA 4WWMA 1GJZA 1JQ4A 1QOGA 4ARCA 2KACA 5EDSA 4YTMB 5AZGA 3VDZA 3PRZA 2LJ5A 3Q3MC 5LXIB 2KT7A 4WWNA 3RNGC 1T0SC 3CMMB 2WS3B 3QAQA 2Y5BB 3RULA 1JWMD 4XC2A 2J0KA 1QLBB 3PTFC 4EZKA 3DWGC 2IO2B 4YSZB 1HZ6A 1YD8U 2DAFA 4LNOA 1C77A 4HXDA 3N32A 4RF0A 1X1MA 2I1KA 5CHVC 2IO0B 3Q3NC 2WDTB 4NJ6A 2KC2A 1FRRA 3H9DA 5D7GA 1S1QB 4LJPB 4MJSA 2IJ0A 3VR8B 2KMMA 3X23A 3U7DA 3ZNHB 4ZRPA 4XDCA 3BVZA 1WM2A 4GN1A 1C4CA 4G3XB 3CIRB 5EE0A 2WXMA 2PJHA 1RFKA 2LHDA 2IY1B 4RF1A 3AH7A 5AUKA 3VUXA 3ZXRA 3CSFA 4AS1A 1QOAA 2JZ3B 4LDTD 3APCA 5LXHA 5G5HA 3OWEB 2JY6A 2WDRB 2G4DB 3GOEA 1KRHA 4W9HA 1JWUD 2LGXA 2ZZPB 2JX5A 3HVZA 1HXYD 3NVVA 1M94A 1B9RA 2NR2A 2DZKA 3PGEA 1YOVB 1L4DB 2KO3A 2K22A 5CHWA 2QMTA 5BO4B 1V97A 3EGRA 3ZGZA 3AEEB 1GPXA 2BYVE 2KK8A 1MG8A 3Q8CA 4N58A 2PLPA 3N20C 3MHSD 2EMTA 4GSWA 2GMIC 3GE8C 3T3OA 4HVBA 4MH8A 2L0FA 2PPHA 1MVKA 3PHXB 4J6IA 4LNIA 3N30A 4EZLA 4IG7B 3ZIMA 2W55A 1UWXA 2PW9A 2MX2A 2WXIA 1N6ZA 3AE7B 1ROEA 2AYOB 2LVOA 3MJWA 4AP4C 1TGZB 4NY0A 2R61A 5T8IA 5JHBA 2UYZB 2BS2B 2L0TA 2RMMA 4A90A 2KFKB 1DYQA 2WDQB 3BVGA 2JUOA 5C2TB 3P63A 3TEZA 4C7ZA 2LZ6A 1HE8A 3JSVB 1L0YB 1WXSA 4BKSA 2YVCA 4DBGA 2C7MB 1KFYB 1WGGA 1NI2A 1D6EC 3L54A 2JF5A 1IGDA 1DOYA 1WGRA 2REXA 3WAOA 2C9WB 1E8XA 3SU8X 5IO9A 2N7JA 1FNVA 2SEBD 1XF5L 4IC7B 3CF6E 1OQYA 1SE3A 2VH1A 2WHIA 4NAWB 1RAXA 3RNBC 5C23A 3ZNID 4WJOA 1DGJA 1MHHE 2M4NA 1NBFC 1ZDXA 1JWSD 2WLBA 3W5UB 2KFJA 2FIDA 4W9LA 2MEKA 4K81A 4RGOS 1P7FA 4IOIE 3A9JB 1EF5A 2WXLA 1H8CA 1JMLA 2K8BA 1QOBA 2KJHB 3KVFB 1AW7A 2L7RA 2IGDA 4K3CA 2QSDA 3NVYA 4XGAB 3VUWA 2MBBB 1A70A 4OVUA 5GXGB 4B0MA 5MPOA 1GB1A 2DYMA 2O2VA 2MP2B 2RSUA 4LDTB 5GMVA 2JQRB 3BY4B 2JYTA 3AU4A 2IZVB 5G2NA 2KWCA 2MSED 4A3OA 5AZFA 3IVFA 4HLEA 3DOWA 2BWES 1KH0A 1F52A 3WIMA 2RGFA 3AM9A 3E56A 2V1YA 4ARIA 1N63A 4KSKC 2XNAC 1E7VA 2DLBA 3AEDB 2L83A 5DPRA 3VAWA 3A33B 4NJCA 2GOWA 3EA6A 1ESFA 1WF9A 2D3GA 4GU2A 1FD6A 1N62A 4GMVA 2D3CA 2IYDB 3B2FA 2FCSA 3RYTA 2JXXA 1WXQA 1OEYA 3TUOA 2DYBA 3IG3A 3R7RA 4XYCA 3J9CA 2WXKA 1ZKHA 2UU7A 3DWMA 1GUAB 4C4VA 1R7SA 4BAXA 5AZHA 2TSSA 3UIOB 2IGGA 4ZHPA 3FAHA 4OZAA 3DVGX 2KYWA 2C7NB 1BXTA 2MJ3A 3ZUNA 3MFGA 3ALBA 3V05A 3RD2A 2KDBA 5KHQA 3TJPA 1ZDVA 1EWYC 5L95C 2PE6B 4IM3A 3NVWA 1WI0A 3Q2AC 4G11A 1V80A 2QDFA 1HZ5A 2K39A 4ZRKA 3V6EB 5IOIA 2PKOA 2DHZA 4N59A 3RZWC 4L1BA 3LJ3A 1RYJA 1WGYA 1WIAA 2L32A 3ZJTA 4B6WA 1ZE3D 3FKYA 2CHXA 1I7HA 2CU1A 1TKEA 4FN2A 4TSSA 1UUPA 1WGDA 5D2MB 2KMAA 3QWZB 1E8WA 1WRDB 4LNKA 2KDEB 3Q8FA 2BWFA 3AXCA 1Y8RC 2N1VA 4WWPA 2V4IB 4FBJB 1QQRA 1BMLC 2NCNA 3NHEB 3Q8BA 3RUIB 4GLSC 4HRSA 1WXMA 2QILA 3AE2B 1EM7A 2JZPA 1LQBA 2BBCA 2KX3A 3M63B 2WXGA 4RM9A 4WJQA 1Q10A 2NBVB 2KXJA 3QX1A 4K1RB 4NPNA 4DDGD 2ZCBA 2V0GA 1SSNA 3ONSA 3WA0A 4KKJA 3ZLZA 2KZRA 1TY2A 4EEWA 5H92C 3L13A 2G4SA 2HTHA 1BT0A 1QOFA 3GZNB 2M19A 4A6QA 2KFKA 4OZCA 4DXAB 4FADA 2V3PA 4ZDVA 1WWTA 2L1AA 3JSVA 3QIJA 4W9FA 2X8XX 5E6PA 4USAA 1JRUA 3V3XA 3ECIA 2MWSB 5DPSA 2FCQA 3IFWB 3R3MA 4KKIA 1QZEA 4URKA 4ICUA 2WXNA 4DXFA 1FCLA 2WX0A 3TBLD 1RFAA 4HWIB 4P16A 2XN9C 1YIWA 3RI7C 4OVZA 4RGTA 4NAWA 1T0YA 3IHPC 2BW2A 3K9OB 2CHWA 4TV3A 2KN5A 4DHJD 1WSPA 1ACCA 2BT6A 2J53A 2WU5B 1EU4A 1YN4A 1Y56A 1F2RI 2JYEA 3ZYYX 4GDLB 2N7EA 5KHOA 1ZGUB 2W3RA 2H88B 2M8SA 2LJIA 2JWZA 2ZW0A 1WX9A 3UGBB 5HI1A 3NY5A 1WMHB 2C5LC 2KLCA 4TMAB 1ZPSA 3KLSX 4K7SA 2KHWB 4AJYB 1F77A 4LLGM 4HKQA 2C60A 2INPE 3SFDB 4LNFA 1J7AA 4CQNA 2AX5A 4US9A 4RMAA 1XCTL 1P0RA 3DBLB 1GNUA 2BS4B 3BIID 3BVMA 4DHZB 1D5XC 2R2QA 4HPMB 4GDKA 2DWQA 4W9CA 1PGXA 1RWSA 2K6QA 4ASWC 3B08A 2G45B 4JQWC 2NBWB 4KGRA 2XK5A 4K7UA 3ZTCA 3SR6A 1K51A 3ENEA 2DBYA 3VRAB 1FNWA 2MBEA 3OG5A 2GB1A 4IWOA 2CJNA 1UELA 1Q5WB 1C1YB 3AB5A 4RGNA 2PVGC 4PS7A 1L5PA 1GAQB 4KZCA 4W9IA 4ACFA 4JLCA 4YT0B 2M56B 2YEPF 3RMKC 1JCKB 1E0ZA 2KAJA 1JWBD 2MH7A 3E9SA 3A4RA 4KX6B 1SE4A 1AWDA 1V5TA 3AU5A 5LNK1 2E6XA 4KZ0A 5BYSA 3IXSA 1SIFA 2INCC 3LB8C 4N9F4 3QA8A 3TEWA 3V62A 2N9EB 3AE3B 3KUDB 1SJED 3NS8A 1C76A 1NENB 4R3DA 4MGKE 3A1QB 3QHTA 4C4VB 2VZKB 1R4MB 1LXDA 4DDID 3VTUA 3NVZA 2WX1A 3NZUA 1R4NI 2JU6X 3ML9A 4W9EA 1UWMA 1WY8A 2O6VD 2D5GA 2SAKA 2WXRA 3AEAB 3L16A 4BFRA 4JPSA 1GC7A 4KSLC 3L17A 2LVQA 1ZW7A 1FNUA 5CTRC 1V2YA 2XEWA 4I6LB 1YJ1A 2G9HD 2KX0A 2L05A 3I63C 5LLIA 3BYYB 4OHJA 2IGHA 1PQSA 1J19A 3W1YA 3PLUA 1NDDA 2WQYB 1K50A 1PGAA 3RT3B 5BMGA 4REZA 4BKTA 3SFEB 1OQQA 4MELA 3ZRCA 1CQVA 2OJWA 1KLUD 4PT5A 1QF6A 1PGBA 3PZDA 4DHJB 1I4HA 5EE9A 2KQ4X 3ZTDA 1HTQA 1VZ8A 3U52E 2INNE 1XXGA 4M8NA 3QJZA 4A9AA 1KLGD 1PUTA 1Z5SB 1WJUA 1YQ4B 3BZDB 2I38A 2QJLA 1TS2A 2GBRA 4K7WA 3PSEB 2CU3A 2Y5CA 4YTNB 3HM3A 3M3JA 5BYQA 3CWIA 1PYWD 3ETRA 1ZXIA 1VRAB 3DBLI 2LI5A 2Q5WD 1JW9D 2BS3B 1OFFA 3APDA 4L23A 5IN7A 1TYGB 4P1CC 1U4AA 2CKHB 3MP9A 3SEBA 1VLBA 5D3DA 2LD9A 4J3OD 3A9KB 1MHXA 3OJ3A 3R2TA 3U4EG 1C78A 2BYEA 3MC0B 1C3TA 5AUIA 3NZSA 4KVGB 4IWPA 2EELA 3RNEC 2KOXA 4KDLB 3HVDA 1SE2A 5H8YE 1D3ZA 5I4DA 5G55A 4G50A 3Q3FA 4W9DA 2IDYA 1E6EB 5HKHA 3IAS1 2RD0A 2KMCA 2LRWA 4A3PA 2G1EA 2JSVX 1FM0D 2MHJA 1UGMA 2LUEA 1JALA 4XWTA 2IO3B 4G0NB 5HHDG 2X38A 4NNJB 1MFWA 3UQBA 4MSQB 3DBHB 2N9KA 2K0PA 3ZDMC 5J17A 4GDLA 1WXVA 4B0EA 3MC8A 1SBBB 1XLNA 5TSSA 4BOSC 1R4MI 3WCQA 1E5WA 3VTVA 1L7YA 2DX5B 1WMHA 2ZW1A 2MRPA 2HJ8A 1V5OA 1FPYA 3UI3A 4YXDB 3D32A 4F1SA 1VD2A 3W1SC 1NVID 4E74A 2HJ1A 3V61A 1IUEA 2D10A 5G5GA 2DNFA 2O6VB 2KD0A 3P1MA 3LYYA 3TCAA 3TIXA
chains in the Genus database with same CATH topology
3RNEC 3GE3C 3Q14C 3I63C 2INDC 3N1ZC 2INCC 3Q3MC 3I5JC 3RNAC 3Q3NC 2RDBC 3N1XC 3DHHC 3RNFC 4P1CC 1T0RC 3N1YC 3DHGC 3RNGC 1T0SC 3N20C 3Q3OC 3RN9C 3RMKC 3GE8C 3RI7C 4P1BC 1T0QC 3RNBC 3Q2AC 3DHIC 3RNCC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RNE C;  3GE3 C;  3Q14 C;  3I63 C;  2IND C;  3N1Z C;  2INC C;  3Q3M C;  3I5J C;  3RNA C;  3Q3N C;  2RDB C;  3N1X C;  3DHH C;  3RNF C;  4P1C C;  1T0R C;  3N1Y C;  3DHG C;  3RNG C;  1T0S C;  3N20 C;  3Q3O C;  3RN9 C;  3RMK C;  3GE8 C;  3RI7 C;  4P1B C;  1T0Q C;  3RNB C;  3Q2A C;  3DHI C;  3RNC C; 
#chains in the Genus database with same CATH topology
 4K3B A;  3VUY A;  2D3A A;  3UF8 A;  1WZ0 A;  4DK5 A;  2ZVN A;  3DBR B;  4AOF A;  5JXV A;  1FXI A;  2NVU I;  1UNS A;  3H7S A;  3AE8 B;  1WM3 A;  1J0G A;  1YN3 A;  4ICV A;  3WAP A;  4BBN C;  1WYW B;  3QQ8 B;  2A4Z A;  2L52 A;  4KV2 A;  3O13 A;  4BZA A;  3QK0 A;  4MT5 A;  4NZL B;  1AAR A;  4MAC A;  3ZQ4 A;  4GDK B;  1IYF A;  4FLH A;  4XX5 A;  2RR9 A;  1JRP A;  1M4V A;  2LMC A;  2XK5 B;  2IPK D;  3SD5 A;  1PDX A;  4NQK E;  4RM8 A;  1C4P A;  2KDM A;  2WP9 B;  1OEY J;  4AUQ C;  2YEP B;  2CS4 A;  3VH4 B;  2BKR B;  2DZM A;  4HKZ E;  4XWW A;  5EE1 A;  5IP4 D;  2NMQ A;  4XDD A;  1F2R C;  2Y3A A;  2IBI B;  1I42 A;  1WGK A;  2CJO A;  4M0W B;  1QT9 A;  2I1J A;  3N1X C;  4D2K A;  4LNN A;  3N3K B;  2ON8 A;  1WJ6 A;  3RN9 C;  2M1M A;  2MBO A;  3PHW B;  4TQ1 A;  2LWP A;  1YX6 B;  3A1Q A;  3T3N A;  1N5W A;  3PRE A;  1UBI A;  3RNC C;  1P98 A;  1RM6 C;  4IKG A;  4PK1 A;  2KTF A;  2AEH A;  4MDK E;  2MJE A;  4KGS A;  1RRB A;  1LM8 B;  3I3T B;  4HDQ A;  4WWO A;  1KOT A;  3M95 A;  1HA5 A;  2FE8 A;  1F1H A;  2XBB C;  1LGR A;  2K8C A;  1YJJ A;  3QC8 B;  2W9N A;  2ZPY A;  4FXC A;  2RDG A;  3KUZ A;  4M8M A;  2WGS A;  2L76 A;  3IAM 1;  4ZYN A;  1ZP0 B;  1OTR B;  2OHF A;  2BB6 A;  2RDB C;  3JVZ X;  3ML8 A;  2N1W A;  4MEM A;  2RDH A;  3AE4 B;  2Z0E B;  2KVZ A;  1L6V A;  1AN8 A;  3DBH I;  1ZOY B;  2D07 B;  3KUC B;  3PZ7 A;  2LFI A;  1T5X D;  1BUI C;  1IGC A;  4S17 A;  4N6E B;  1I4G A;  5FKA C;  3N9Y C;  1TTN A;  4WUR A;  1EUV B;  1FRD A;  3AEF B;  3UIP B;  2FAZ A;  3PLV A;  1VZ6 A;  1IPG A;  1FXT B;  1IP9 A;  3TSS A;  2JPH A;  4FA6 A;  4ANV A;  1YMH E;  1TKY A;  3IBE A;  1UH6 A;  2KWD A;  3ZXV A;  3Q6B A;  1WX7 A;  1D5Z C;  4B9K A;  1RLF A;  2MBH A;  2KTR A;  4HJG E;  3DBR I;  2ZNV B;  2OJR A;  2KDF B;  2GBN A;  1ISN A;  3LDZ E;  3A9K A;  4E3C A;  2AQ3 B;  1NI3 A;  1V1P B;  2BQQ A;  1A5R A;  1KJT A;  4LK0 M;  3Q14 C;  5E6J A;  3B2G A;  2AL6 A;  2AQ2 B;  5L83 A;  4TKN A;  1SB3 C;  3ZNG C;  3AI5 A;  1FIQ A;  3C8Y A;  2K9X A;  3DHG C;  4ANU A;  1TJE A;  3WAN A;  2WXO A;  4LJO B;  1LFD A;  3Q3J A;  1XLQ A;  3DPD A;  2CR5 A;  3ZVV A;  1TZO A;  3H7P A;  1L4Z B;  1YJI A;  3MC9 A;  2MW5 A;  1T3Q A;  4RGM A;  4JX1 C;  2G3Q B;  4DHZ E;  4ANW A;  2W82 A;  4JL9 A;  1MPE A;  3KQ4 A;  2WXH A;  4BKG A;  4FUL A;  3HM6 X;  1XD3 B;  1WYG A;  2EKE C;  5D6J B;  3B0A A;  4HPP A;  4IWQ A;  3ZJV A;  2QC8 A;  2KKC A;  2M0X A;  3GP7 A;  2BGF A;  4H2A A;  4MH0 E;  3DQV A;  1CJE A;  2AWT A;  1FXA A;  2FCN A;  3BWU D;  3VTW A;  4BOZ B;  4KIK A;  4ZRI A;  2A5U A;  4EZJ A;  1L0X B;  1TS4 A;  2LRU A;  2WDV B;  3S2A A;  5IA7 A;  2DAJ A;  2N9X A;  2AL3 A;  3B9J A;  3PZ8 A;  5DCN A;  3A4S C;  1E7P B;  3M62 B;  5HFY A;  1V6E A;  1VZ7 A;  1YQB A;  2O6V A;  5EE3 A;  4CHK A;  3PV1 A;  3TL5 A;  1K53 A;  3ABV B;  5D94 A;  1OQR A;  4MM3 B;  3HHM A;  3IT6 B;  3KYC D;  1P3Q U;  2LXA A;  4A20 A;  4FJZ A;  4HK2 A;  2B76 B;  2QEJ C;  3PVL A;  3AMZ A;  2WXQ A;  1S3S G;  2LGY A;  3SHQ A;  3VH3 B;  3O65 B;  4KGT A;  2LGS A;  1D4B A;  2AQ1 B;  1Q0W B;  1V86 A;  2D3B A;  1I4X A;  4F8C B;  3QCA A;  3R66 C;  1V9J A;  2K5P A;  3H8H A;  1AYF A;  1WXA A;  3KYD D;  1WZ3 A;  2ZCC A;  4WIP A;  3ZO5 B;  1E8Z A;  3FIL B;  1TIF A;  3U2S C;  3RPF C;  5C1Z A;  2MLB A;  3RZF A;  5AEK B;  2WNM A;  2L00 B;  4GOC A;  3ZDT A;  1SEB D;  4CO7 A;  2GBK A;  3U30 A;  2WXF A;  3VRB B;  2WXJ A;  2GBJ A;  1WR1 A;  2ZEQ A;  4C00 A;  1TT5 B;  1T6B X;  4M0W A;  3DBS A;  4OVV A;  4KDI C;  2JRH A;  2LGD A;  3V60 A;  3C0R B;  4DWF A;  4FHJ A;  3MJ5 A;  1SGH A;  4FJY A;  4M02 A;  1E10 A;  4B95 A;  2ICI A;  5HG2 A;  1C4A A;  3BK1 A;  2NPT A;  1I4R A;  1J7B A;  2IND C;  1WX8 A;  3N1Z C;  2D11 A;  2Z8L A;  3I5J C;  3P4S B;  4PS8 A;  3NUH B;  3GZN I;  4BBN F;  4M01 A;  4PYU A;  1V1O A;  1MJD A;  4IUM B;  1QIL A;  4C80 A;  5BMH A;  3AE1 B;  1E90 A;  1YQ3 B;  1FFU A;  1QKZ A;  5FR6 A;  2V4L A;  2HDE A;  2J0M A;  1IBX B;  1NEK B;  4GGQ A;  2I2Y A;  3WAM A;  2JXT A;  3VHT C;  2MBQ A;  1KTK A;  3SDL C;  3FC4 A;  2IO1 B;  4HJK A;  4ZHO A;  4HRO A;  3RNF C;  1T0R C;  4GB9 A;  1T0Q C;  2PTL A;  1ET9 A;  2KDI A;  1JWA D;  3EUB 2;  1KLV A;  2KAN A;  2BYT A;  3DVN U;  2V3S A;  4HEA 1;  4AQ7 A;  1PFD A;  3BIN A;  3N1Y C;  3AE5 B;  1E8Y A;  4JE3 B;  1N5X A;  1L6U A;  4W9G A;  3T8M A;  5FR3 A;  2DZI A;  1WRI A;  2J42 A;  1GC6 A;  3OJ4 B;  2HTM E;  3BK2 A;  1NYR A;  4MGI E;  5JHA A;  1V1P A;  2N7D A;  1WGH A;  1D5M C;  3P42 A;  4MSM B;  1DOI A;  4GXB A;  2KTR B;  1EO6 A;  4GIV A;  2MQJ A;  3KWL A;  4O1N A;  2PIA A;  4II3 B;  2R2O A;  3QAR A;  3URY A;  2L3Z A;  4S0R A;  2JZZ A;  1MG4 A;  1UGJ A;  1P1A A;  4JGH B;  2WWZ A;  4XZ4 A;  1KF6 B;  1UZX B;  2WYQ A;  3MTN B;  1HTO A;  4HCN B;  4IM0 A;  2PMV A;  4BVU C;  1GB4 A;  3LXF A;  1N60 A;  2J52 A;  1DOX A;  1WFY A;  1E7U A;  3WAL A;  4WQM A;  1J7C A;  3X0W A;  3H7P B;  4IDI A;  3EHV A;  2BTE A;  2KNB A;  1YX5 B;  4MGY E;  2FUH B;  1C9F A;  5DPW A;  2BPS A;  4RH6 A;  2J4X A;  3K9P B;  3EFU A;  3L4P A;  2KQS A;  1V81 A;  1VDV A;  5C3J B;  4FJV B;  3DVG Y;  2M17 A;  1XLP A;  4EUT A;  1V8C A;  3VXW A;  4HCP B;  2MCN B;  1NYQ A;  1EWC A;  3W9C B;  3HIZ A;  4CYE A;  4C7Y A;  3T9L A;  1CZP A;  4KIK B;  3GB1 A;  2VH2 A;  1XO3 A;  4LCD E;  1TS3 A;  1VR9 A;  2GRI A;  1SIJ A;  3OLM D;  2FIF A;  3Q8E A;  3VQI A;  4MM3 A;  3I9V 1;  4DQO C;  2JT4 B;  3NJT A;  3UIN B;  2WU2 B;  2HD5 B;  2VRR B;  2FCM A;  1UBQ A;  4EOY A;  2C7H A;  2ASQ A;  1GOZ A;  2NTT A;  3KH0 A;  4HDO A;  3APF A;  1WJN A;  1VCB A;  4YL8 A;  2KVR A;  1XCQ L;  2D2Q A;  2GI9 A;  5CX3 A;  1UF0 A;  1H4R A;  4JWU C;  1HQR D;  3FIL A;  2DZJ A;  2H89 B;  2KJR A;  2KN4 A;  4ZRQ A;  2GBM A;  3H6N A;  2PVO D;  5BYR A;  4PS3 A;  3EC8 A;  3PO0 A;  2QIE B;  3AE9 B;  1CMX B;  1LO5 D;  5FK9 C;  5IKC M;  1E9M A;  2GLS A;  2V3N A;  4P6V F;  5E6N A;  1YNT E;  4WAF A;  4P7I A;  2KWV B;  1K52 A;  3HK0 A;  3B1L X;  3AN1 A;  1ZUD 2;  4A55 A;  3R7Q A;  3ZJU A;  1OGW A;  1I35 A;  4WJP A;  1J8C A;  1UD7 A;  1GG3 A;  3AEB B;  1WE6 A;  2QHO A;  3RCZ A;  4EE2 A;  4AJW A;  4BKS D;  2DEN B;  3EFC A;  3TMP B;  2RPV A;  3ZKJ C;  1SE9 A;  4F7Z A;  2NPT B;  3DHI C;  4WAA A;  1TBE A;  1V49 A;  3ZW3 A;  3ZNZ B;  2W3S A;  4WH4 A;  3P2B A;  4M00 A;  3C19 A;  1I4Q A;  3DDC B;  2WXP A;  3U8Z A;  2RPQ A;  4YSX B;  4ITK A;  1XEE A;  3TEY A;  4L2Y A;  4P1B C;  4RNA A;  2KC1 A;  4QAY A;  4IW0 A;  2BB5 A;  3KWV A;  3VR9 B;  1IBX A;  3PRM B;  5E6O A;  2NS5 A;  3ZRF A;  3U7Z A;  2N9L A;  3V6C B;  3L0W B;  1TS5 A;  1I4P A;  3OAW A;  3PS6 A;  3HUI A;  4OW0 A;  1SJH D;  2IY0 B;  3Q69 A;  2JVC A;  2W54 A;  1SXT A;  5D3I B;  4US8 A;  1L0V B;  2Z0D B;  2KWU B;  4MJS B;  4RFB A;  3NG0 A;  4HPL B;  4YTP B;  2DYO A;  3R8B A;  3GS2 A;  4TUU A;  4TQ0 A;  3PPA A;  4I6P A;  2JWU A;  2LEK A;  1WH3 A;  1ET6 A;  2JRI B;  2ZJD A;  2E3T A;  2FNJ B;  4ZRJ A;  2KJ6 A;  3DHH C;  4W9J A;  4ZYS A;  5DPT A;  3NZ3 A;  3Q8A A;  4YWG G;  2ZNV C;  4II2 B;  4X57 B;  5TR5 A;  2BVC A;  2ZPN A;  4XE0 A;  1P7E A;  3KW5 B;  4MGZ E;  2NBU A;  2BF8 B;  2J0J A;  1L2N A;  1HEZ E;  3NS1 A;  3JYU A;  5CHF A;  2K6D B;  3RNA C;  3AUL A;  1K8R B;  3DVN V;  4NAM A;  3Q3O C;  2K1F A;  2Y5P A;  2K8H A;  1FCC C;  4W9K A;  3AV8 A;  3P4P B;  2OOB B;  3AE6 B;  3GE3 C;  2V9H A;  2M0A A;  3DCG A;  4PYZ A;  1MI0 A;  4I6N B;  4Q2J A;  2YLM A;  3L08 A;  2FUG 1;  4NJ7 A;  2K3U A;  1FMA D;  2QCZ A;  3H1U A;  3UQA A;  1FO4 A;  2BYF A;  4JWS C;  4IM2 A;  1F0Z A;  2ZVO A;  2KLG A;  2MJD A;  2NTS A;  4LTU A;  2BKF A;  2LUM A;  2VZK D;  4OZB A;  1WJ4 A;  4YSY B;  1EU3 A;  3JW0 X;  1YN5 A;  1TKG A;  3L10 B;  1FFV A;  2K25 A;  5IAA C;  3P4Q B;  3W2D A;  3PRP B;  1ENF A;  1R4N B;  4FHK A;  2N0S B;  2LAS A;  2OED A;  4A8X C;  2L8J A;  3IT4 B;  1JRO A;  2ONQ A;  3R2I A;  1VJK A;  3VVW B;  2J7Q B;  2UWQ A;  2B3A A;  5J18 A;  3MHZ A;  2KQ7 A;  2LXC A;  4EKU A;  2HE7 A;  4NQL B;  4JIO U;  1XQQ A;  1F9J A;  2CHZ A;  3PT2 B;  1B1Z A;  5BMI A;  3A9J A;  3AEG B;  3VFK A;  3EEC A;  3P4R B;  1SF0 A;  1ZXH A;  3W5V B;  3BYT B;  1XLO A;  4RCO A;  1C79 A;  1TY0 A;  3TEX A;  2EKI A;  4WJN A;  2ACZ B;  2N9P C;  4UDU C;  1G6J A;  4DXG A;  3I57 A;  1Z2M A;  2MA9 B;  1WE7 A;  3NOB A;  3HRD D;  1N61 A;  5J2R A;  4E71 A;  2FBW B;  3W1S A;  4C56 C;  2MP2 A;  1CK1 A;  3CST A;  5JH5 C;  1TZ1 A;  1WR6 E;  2LGI A;  1KM7 A;  3AEC B;  2N4F A;  4ZOH C;  4AWJ A;  4ANX A;  1FEH A;  2LVP A;  2O2V B;  2PEA A;  1EF1 A;  4EFO A;  2Z59 B;  5JZE B;  2EMS A;  1Q1O A;  2LHE A;  3RFZ B;  1XT9 B;  2PE9 A;  1STE A;  1P9D U;  4WQO B;  3NRZ A;  4WWM A;  1GJZ A;  1JQ4 A;  1QOG A;  4ARC A;  2KAC A;  5EDS A;  4YTM B;  5AZG A;  3VDZ A;  3PRZ A;  2LJ5 A;  3Q3M C;  5LXI B;  2KT7 A;  4WWN A;  3RNG C;  1T0S C;  3CMM B;  2WS3 B;  3QAQ A;  2Y5B B;  3RUL A;  1JWM D;  4XC2 A;  2J0K A;  1QLB B;  3PTF C;  4EZK A;  3DWG C;  2IO2 B;  4YSZ B;  1HZ6 A;  1YD8 U;  2DAF A;  4LNO A;  1C77 A;  4HXD A;  3N32 A;  4RF0 A;  1X1M A;  2I1K A;  5CHV C;  2IO0 B;  3Q3N C;  2WDT B;  4NJ6 A;  2KC2 A;  1FRR A;  3H9D A;  5D7G A;  1S1Q B;  4LJP B;  4MJS A;  2IJ0 A;  3VR8 B;  2KMM A;  3X23 A;  3U7D A;  3ZNH B;  4ZRP A;  4XDC A;  3BVZ A;  1WM2 A;  4GN1 A;  1C4C A;  4G3X B;  3CIR B;  5EE0 A;  2WXM A;  2PJH A;  1RFK A;  2LHD A;  2IY1 B;  4RF1 A;  3AH7 A;  5AUK A;  3VUX A;  3ZXR A;  3CSF A;  4AS1 A;  1QOA A;  2JZ3 B;  4LDT D;  3APC A;  5LXH A;  5G5H A;  3OWE B;  2JY6 A;  2WDR B;  2G4D B;  3GOE A;  1KRH A;  4W9H A;  1JWU D;  2LGX A;  2ZZP B;  2JX5 A;  3HVZ A;  1HXY D;  3NVV A;  1M94 A;  1B9R A;  2NR2 A;  2DZK A;  3PGE A;  1YOV B;  1L4D B;  2KO3 A;  2K22 A;  5CHW A;  2QMT A;  5BO4 B;  1V97 A;  3EGR A;  3ZGZ A;  3AEE B;  1GPX A;  2BYV E;  2KK8 A;  1MG8 A;  3Q8C A;  4N58 A;  2PLP A;  3N20 C;  3MHS D;  2EMT A;  4GSW A;  2GMI C;  3GE8 C;  3T3O A;  4HVB A;  4MH8 A;  2L0F A;  2PPH A;  1MVK A;  3PHX B;  4J6I A;  4LNI A;  3N30 A;  4EZL A;  4IG7 B;  3ZIM A;  2W55 A;  1UWX A;  2PW9 A;  2MX2 A;  2WXI A;  1N6Z A;  3AE7 B;  1ROE A;  2AYO B;  2LVO A;  3MJW A;  4AP4 C;  1TGZ B;  4NY0 A;  2R61 A;  5T8I A;  5JHB A;  2UYZ B;  2BS2 B;  2L0T A;  2RMM A;  4A90 A;  2KFK B;  1DYQ A;  2WDQ B;  3BVG A;  2JUO A;  5C2T B;  3P63 A;  3TEZ A;  4C7Z A;  2LZ6 A;  1HE8 A;  3JSV B;  1L0Y B;  1WXS A;  4BKS A;  2YVC A;  4DBG A;  2C7M B;  1KFY B;  1WGG A;  1NI2 A;  1D6E C;  3L54 A;  2JF5 A;  1IGD A;  1DOY A;  1WGR A;  2REX A;  3WAO A;  2C9W B;  1E8X A;  3SU8 X;  5IO9 A;  2N7J A;  1FNV A;  2SEB D;  1XF5 L;  4IC7 B;  3CF6 E;  1OQY A;  1SE3 A;  2VH1 A;  2WHI A;  4NAW B;  1RAX A;  3RNB C;  5C23 A;  3ZNI D;  4WJO A;  1DGJ A;  1MHH E;  2M4N A;  1NBF C;  1ZDX A;  1JWS D;  2WLB A;  3W5U B;  2KFJ A;  2FID A;  4W9L A;  2MEK A;  4K81 A;  4RGO S;  1P7F A;  4IOI E;  3A9J B;  1EF5 A;  2WXL A;  1H8C A;  1JML A;  2K8B A;  1QOB A;  2KJH B;  3KVF B;  1AW7 A;  2L7R A;  2IGD A;  4K3C A;  2QSD A;  3NVY A;  4XGA B;  3VUW A;  2MBB B;  1A70 A;  4OVU A;  5GXG B;  4B0M A;  5MPO A;  1GB1 A;  2DYM A;  2O2V A;  2MP2 B;  2RSU A;  4LDT B;  5GMV A;  2JQR B;  3BY4 B;  2JYT A;  3AU4 A;  2IZV B;  5G2N A;  2KWC A;  2MSE D;  4A3O A;  5AZF A;  3IVF A;  4HLE A;  3DOW A;  2BWE S;  1KH0 A;  1F52 A;  3WIM A;  2RGF A;  3AM9 A;  3E56 A;  2V1Y A;  4ARI A;  1N63 A;  4KSK C;  2XNA C;  1E7V A;  2DLB A;  3AED B;  2L83 A;  5DPR A;  3VAW A;  3A33 B;  4NJC A;  2GOW A;  3EA6 A;  1ESF A;  1WF9 A;  2D3G A;  4GU2 A;  1FD6 A;  1N62 A;  4GMV A;  2D3C A;  2IYD B;  3B2F A;  2FCS A;  3RYT A;  2JXX A;  1WXQ A;  1OEY A;  3TUO A;  2DYB A;  3IG3 A;  3R7R A;  4XYC A;  3J9C A;  2WXK A;  1ZKH A;  2UU7 A;  3DWM A;  1GUA B;  4C4V A;  1R7S A;  4BAX A;  5AZH A;  2TSS A;  3UIO B;  2IGG A;  4ZHP A;  3FAH A;  4OZA A;  3DVG X;  2KYW A;  2C7N B;  1BXT A;  2MJ3 A;  3ZUN A;  3MFG A;  3ALB A;  3V05 A;  3RD2 A;  2KDB A;  5KHQ A;  3TJP A;  1ZDV A;  1EWY C;  5L95 C;  2PE6 B;  4IM3 A;  3NVW A;  1WI0 A;  3Q2A C;  4G11 A;  1V80 A;  2QDF A;  1HZ5 A;  2K39 A;  4ZRK A;  3V6E B;  5IOI A;  2PKO A;  2DHZ A;  4N59 A;  3RZW C;  4L1B A;  3LJ3 A;  1RYJ A;  1WGY A;  1WIA A;  2L32 A;  3ZJT A;  4B6W A;  1ZE3 D;  3FKY A;  2CHX A;  1I7H A;  2CU1 A;  1TKE A;  4FN2 A;  4TSS A;  1UUP A;  1WGD A;  5D2M B;  2KMA A;  3QWZ B;  1E8W A;  1WRD B;  4LNK A;  2KDE B;  3Q8F A;  2BWF A;  3AXC A;  1Y8R C;  2N1V A;  4WWP A;  2V4I B;  4FBJ B;  1QQR A;  1BML C;  2NCN A;  3NHE B;  3Q8B A;  3RUI B;  4GLS C;  4HRS A;  1WXM A;  2QIL A;  3AE2 B;  1EM7 A;  2JZP A;  1LQB A;  2BBC A;  2KX3 A;  3M63 B;  2WXG A;  4RM9 A;  4WJQ A;  1Q10 A;  2NBV B;  2KXJ A;  3QX1 A;  4K1R B;  4NPN A;  4DDG D;  2ZCB A;  2V0G A;  1SSN A;  3ONS A;  3WA0 A;  4KKJ A;  3ZLZ A;  2KZR A;  1TY2 A;  4EEW A;  5H92 C;  3L13 A;  2G4S A;  2HTH A;  1BT0 A;  1QOF A;  3GZN B;  2M19 A;  4A6Q A;  2KFK A;  4OZC A;  4DXA B;  4FAD A;  2V3P A;  4ZDV A;  1WWT A;  2L1A A;  3JSV A;  3QIJ A;  4W9F A;  2X8X X;  5E6P A;  4USA A;  1JRU A;  3V3X A;  3ECI A;  2MWS B;  5DPS A;  2FCQ A;  3IFW B;  3R3M A;  4KKI A;  1QZE A;  4URK A;  4ICU A;  2WXN A;  4DXF A;  1FCL A;  2WX0 A;  3TBL D;  1RFA A;  4HWI B;  4P16 A;  2XN9 C;  1YIW A;  3RI7 C;  4OVZ A;  4RGT A;  4NAW A;  1T0Y A;  3IHP C;  2BW2 A;  3K9O B;  2CHW A;  4TV3 A;  2KN5 A;  4DHJ D;  1WSP A;  1ACC A;  2BT6 A;  2J53 A;  2WU5 B;  1EU4 A;  1YN4 A;  1Y56 A;  1F2R I;  2JYE A;  3ZYY X;  4GDL B;  2N7E A;  5KHO A;  1ZGU B;  2W3R A;  2H88 B;  2M8S A;  2LJI A;  2JWZ A;  2ZW0 A;  1WX9 A;  3UGB B;  5HI1 A;  3NY5 A;  1WMH B;  2C5L C;  2KLC A;  4TMA B;  1ZPS A;  3KLS X;  4K7S A;  2KHW B;  4AJY B;  1F77 A;  4LLG M;  4HKQ A;  2C60 A;  2INP E;  3SFD B;  4LNF A;  1J7A A;  4CQN A;  2AX5 A;  4US9 A;  4RMA A;  1XCT L;  1P0R A;  3DBL B;  1GNU A;  2BS4 B;  3BII D;  3BVM A;  4DHZ B;  1D5X C;  2R2Q A;  4HPM B;  4GDK A;  2DWQ A;  4W9C A;  1PGX A;  1RWS A;  2K6Q A;  4ASW C;  3B08 A;  2G45 B;  4JQW C;  2NBW B;  4KGR A;  2XK5 A;  4K7U A;  3ZTC A;  3SR6 A;  1K51 A;  3ENE A;  2DBY A;  3VRA B;  1FNW A;  2MBE A;  3OG5 A;  2GB1 A;  4IWO A;  2CJN A;  1UEL A;  1Q5W B;  1C1Y B;  3AB5 A;  4RGN A;  2PVG C;  4PS7 A;  1L5P A;  1GAQ B;  4KZC A;  4W9I A;  4ACF A;  4JLC A;  4YT0 B;  2M56 B;  2YEP F;  3RMK C;  1JCK B;  1E0Z A;  2KAJ A;  1JWB D;  2MH7 A;  3E9S A;  3A4R A;  4KX6 B;  1SE4 A;  1AWD A;  1V5T A;  3AU5 A;  5LNK 1;  2E6X A;  4KZ0 A;  5BYS A;  3IXS A;  1SIF A;  2INC C;  3LB8 C;  4N9F 4;  3QA8 A;  3TEW A;  3V62 A;  2N9E B;  3AE3 B;  3KUD B;  1SJE D;  3NS8 A;  1C76 A;  1NEN B;  4R3D A;  4MGK E;  3A1Q B;  3QHT A;  4C4V B;  2VZK B;  1R4M B;  1LXD A;  4DDI D;  3VTU A;  3NVZ A;  2WX1 A;  3NZU A;  1R4N I;  2JU6 X;  3ML9 A;  4W9E A;  1UWM A;  1WY8 A;  2O6V D;  2D5G A;  2SAK A;  2WXR A;  3AEA B;  3L16 A;  4BFR A;  4JPS A;  1GC7 A;  4KSL C;  3L17 A;  2LVQ A;  1ZW7 A;  1FNU A;  5CTR C;  1V2Y A;  2XEW A;  4I6L B;  1YJ1 A;  2G9H D;  2KX0 A;  2L05 A;  3I63 C;  5LLI A;  3BYY B;  4OHJ A;  2IGH A;  1PQS A;  1J19 A;  3W1Y A;  3PLU A;  1NDD A;  2WQY B;  1K50 A;  1PGA A;  3RT3 B;  5BMG A;  4REZ A;  4BKT A;  3SFE B;  1OQQ A;  4MEL A;  3ZRC A;  1CQV A;  2OJW A;  1KLU D;  4PT5 A;  1QF6 A;  1PGB A;  3PZD A;  4DHJ B;  1I4H A;  5EE9 A;  2KQ4 X;  3ZTD A;  1HTQ A;  1VZ8 A;  3U52 E;  2INN E;  1XXG A;  4M8N A;  3QJZ A;  4A9A A;  1KLG D;  1PUT A;  1Z5S B;  1WJU A;  1YQ4 B;  3BZD B;  2I38 A;  2QJL A;  1TS2 A;  2GBR A;  4K7W A;  3PSE B;  2CU3 A;  2Y5C A;  4YTN B;  3HM3 A;  3M3J A;  5BYQ A;  3CWI A;  1PYW D;  3ETR A;  1ZXI A;  1VRA B;  3DBL I;  2LI5 A;  2Q5W D;  1JW9 D;  2BS3 B;  1OFF A;  3APD A;  4L23 A;  5IN7 A;  1TYG B;  4P1C C;  1U4A A;  2CKH B;  3MP9 A;  3SEB A;  1VLB A;  5D3D A;  2LD9 A;  4J3O D;  3A9K B;  1MHX A;  3OJ3 A;  3R2T A;  3U4E G;  1C78 A;  2BYE A;  3MC0 B;  1C3T A;  5AUI A;  3NZS A;  4KVG B;  4IWP A;  2EEL A;  3RNE C;  2KOX A;  4KDL B;  3HVD A;  1SE2 A;  5H8Y E;  1D3Z A;  5I4D A;  5G55 A;  4G50 A;  3Q3F A;  4W9D A;  2IDY A;  1E6E B;  5HKH A;  3IAS 1;  2RD0 A;  2KMC A;  2LRW A;  4A3P A;  2G1E A;  2JSV X;  1FM0 D;  2MHJ A;  1UGM A;  2LUE A;  1JAL A;  4XWT A;  2IO3 B;  4G0N B;  5HHD G;  2X38 A;  4NNJ B;  1MFW A;  3UQB A;  4MSQ B;  3DBH B;  2N9K A;  2K0P A;  3ZDM C;  5J17 A;  4GDL A;  1WXV A;  4B0E A;  3MC8 A;  1SBB B;  1XLN A;  5TSS A;  4BOS C;  1R4M I;  3WCQ A;  1E5W A;  3VTV A;  1L7Y A;  2DX5 B;  1WMH A;  2ZW1 A;  2MRP A;  2HJ8 A;  1V5O A;  1FPY A;  3UI3 A;  4YXD B;  3D32 A;  4F1S A;  1VD2 A;  3W1S C;  1NVI D;  4E74 A;  2HJ1 A;  3V61 A;  1IUE A;  2D10 A;  5G5G A;  2DNF A;  2O6V B;  2KD0 A;  3P1M A;  3LYY A;  3TCA A;  3TIX A; 
#chains in the Genus database with same CATH homology
 3RNE C;  3GE3 C;  3Q14 C;  3I63 C;  2IND C;  3N1Z C;  2INC C;  3Q3M C;  3I5J C;  3RNA C;  3Q3N C;  2RDB C;  3N1X C;  3DHH C;  3RNF C;  4P1C C;  1T0R C;  3N1Y C;  3DHG C;  3RNG C;  1T0S C;  3N20 C;  3Q3O C;  3RN9 C;  3RMK C;  3GE8 C;  3RI7 C;  4P1B C;  1T0Q C;  3RNB C;  3Q2A C;  3DHI C;  3RNC C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...