1T0QC

Structure of the toluene/o-xylene monooxygenase hydroxylase
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
83
structure length
83
Chain Sequence
TFPIMSNFERDFVIQLVPVDTEDTMDQVAEKCAYHSINRRVHPQPEKILRVRRHEDGTLFPRGMIVSDAGLRPTETLDIIFMD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords toluene, o-xylene monooxygenase oxygenase subunit
publication title Crystal Structure of the Toluene/o-Xylene Monooxygenase Hydroxylase from Pseudomonas stutzeri OX1: INSIGHT INTO THE SUBSTRATE SPECIFICITY, SUBSTRATE CHANNELING, AND ACTIVE SITE TUNING OF MULTICOMPONENT MONOOXYGENASES.
pubmed doi rcsb
source organism Pseudomonas stutzeri
total genus 25
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2004-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF06234 TmoB Toluene-4-monooxygenase system protein B (TmoB)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.270 Alpha Beta Roll Ubiquitin-like (UB roll) TmoB-like 1t0qC00
3N1XC 3N20C 2RDBC 4P1BC 1T0RC 3RN9C 2INCC 3Q3MC 3RNEC 3RNFC 3I5JC 3DHHC 1T0QC 3N1YC 3RNAC 1T0SC 2INDC 3GE3C 3Q2AC 3Q3NC 3Q14C 3I63C 3RI7C 3RMKC 3RNGC 3RNCC 3DHIC 3GE8C 3Q3OC 3N1ZC 3DHGC 4P1CC 3RNBC
chains in the Genus database with same CATH superfamily
2PIAA 4P1BC 3R7RA 3RN9C 3Q3JA 2JWZA 2INCC 2VH1A 1WJUA 1TKGA 1DOIA 4XWTA 1UD7A 3V61A 2QMTA 4LDTB 3BYYB 4NAWB 3CSTA 3FC4A 4RGTA 5CHFA 5T8IA 3VUWA 3NVWA 4GIVA 1WM2A 2BKRB 2JYTA 3N9YC 2LXCA 1WR1A 4KGTA 4B95A 1XLNA 1IGCA 1OQRA 3U2SC 3IHPC 3TSSA 5EE1A 3SD5A 2DAJA 3URYA 2XK5A 4YWGG 1TZOA 1ZUD2 4MM3B 2UU7A 2BWFA 3H7SA 2E3TA 2ZNVB 2FIDA 3HM3A 1V81A 2DZIA 3QK0A 2O6VD 3DOWA 1KJTA 2CKHB 4WAFA 5JXVA 4YSZB 3V62A 2KANA 4HKZE 5AUIA 1ESFA 2QILA 4L23A 2AQ3B 1TS5A 3ZDMC 2FUHB 2BW2A 4HJKA 3OJ4B 3AE6B 4NY0A 2K6DB 2IO1B 2KMMA 1IBXA 3Q69A 2PKOA 3PT2B 4BBNF 3L4PA 3RZFA 1R4NB 3V60A 3JSVB 2PW9A 2J52A 4LNOA 1KLVA 1HE8A 2K8HA 2QJLA 1E8WA 3N1ZC 1N62A 1WM3A 3W5VB 3M62B 4BVUC 1XCTL 2L3ZA 1V86A 1WXVA 2GBMA 2LXAA 4IW0A 3BIID 1UNSA 2N9LA 2L0TA 3P1MA 4C7YA 4DQOC 1RWSA 4ZYNA 3ZNGC 3KUZA 2X38A 2C9WB 3B9JA 1XLOA 3FILB 2K6QA 3EC8A 3Q8AA 4E3CA 1I4QA 4LTUA 2MBQA 1WXSA 3ZIMA 3AB5A 4TQ0A 2KYWA 3P63A 3IXSA 2KHWB 4HJGE 1L4ZB 2KN4A 1WRIA 2KTRA 1TS3A 3H7PA 3KLSX 3MJ5A 3SDLC 4FULA 4ICUA 3O65B 3ZGZA 2BGFA 4GLSC 1ZPSA 3KYCD 4NAMA 3W2DA 3ZW3A 3TJPA 2D3GA 4ZRPA 1YN5A 4MELA 4ZHOA 2YEPF 3AE1B 1M4VA 2L76A 2XN9C 3EHVA 2WXKA 4W9JA 2J0MA 4NQKE 3APDA 3ZRCA 2MP2A 4KVGB 5H92C 2LGXA 3DBHB 2V3PA 4TKNA 4XDCA 2SAKA 1TGZB 2RSUA 1KM7A 4RGNA 3AI5A 1K50A 2E6XA 3PS6A 3PZ8A 2PJHA 2NS5A 1OFFA 1WSPA 1I4RA 4WJQA 5J17A 1QLBB 1E7VA 2Y5PA 3UGBB 3VR9B 4FHKA 2OOBB 1L5PA 2ONQA 2NCNA 1WGDA 2GI9A 1LM8B 1F9JA 4PS3A 3AN1A 2AQ1B 3ZUNA 2BF8B 2K39A 1D4BA 3A1QB 1J8CA 2DYMA 4JGHB 2QIEB 3MHSD 4XX5A 1R4MI 3DHIC 1UWXA 1GC6A 1E5WA 1OEYA 1ZKHA 4TSSA 3N1XC 3ECIA 4M8MA 4B9KA 4KIKB 2IO3B 1WYWB 2KLGA 2KFJA 4ZRIA 1HZ6A 2ON8A 1JW9D 1WWTA 1TS4A 3HHMA 3RI7C 1BMLC 4JLCA 3PZ7A 2KN5A 3VUYA 4OZBA 2N4FA 3M95A 3VH3B 2FUG1 3HVZA 2JT4B 3MTNB 1EF1A 2DYOA 2BS2B 2MBEA 3K9OB 4DDID 2WXFA 2JRHA 2W55A 5DPSA 1RAXA 1P7EA 1HXYD 5FKAC 2B3AA 2BPSA 4IUMB 4JWUC 1YMHE 1TBEA 2ZVNA 4GU2A 2OEDA 5JHAA 1WR6E 3W1SA 1F1HA 4MJSA 4ASWC 1T5XD 2OHFA 3R2IA 3N30A 5HG2A 3VQIA 4DWFA 1QOFA 1PGAA 1VZ8A 3R66C 1PQSA 4DXGA 4LLGM 2LVQA 3L54A 3AEBB 1FFVA 2MWSB 2CHZA 2LRUA 5LNK1 1GC7A 3KYDD 3QIJA 3RD2A 1CMXB 2GBKA 1V49A 1VLBA 1UUPA 2BYFA 4YT0B 2G3QB 1UF0A 2MJEA 2VH2A 2I1KA 3VTUA 3WANA 2LZ6A 1C78A 4N6EB 1JQ4A 2NTTA 2FCNA 4BOZB 4NPNA 1C79A 3B2FA 1SBBB 1V5OA 2LUEA 2D11A 1E8XA 5C23A 2EKEC 2MH7A 3H6NA 5D7GA 5DPWA 2DWQA 3FAHA 2KC1A 2ACZB 3LJ3A 2WX1A 5BO4B 2QSDA 1P0RA 1XO3A 3DVNV 2XK5B 2ZJDA 3W5UB 1DYQA 4CYEA 4F7ZA 3C8YA 1STEA 5L83A 2K0PA 2IDYA 2WXMA 1FPYA 3TBLD 4AP4C 1S3SG 3WIMA 4HPLB 3APFA 1Q0WB 3AE8B 4M0WA 3PPAA 2GRIA 1WE7A 1I4PA 2MEKA 2V4IB 3P42A 1QT9A 3VUXA 1FMAD 5E6PA 2G9HD 3LB8C 3PHWB 3AE9B 5G5GA 4BAXA 1RLFA 5DPRA 4WH4A 3OJ3A 1JWUD 3NVVA 1GUAB 2W9NA 2DHZA 4A6QA 1KLGD 2CJNA 2LFIA 3GOEA 2MJ3A 5FR3A 1WI0A 1JCKB 1UGJA 1UWMA 1ZE3D 1VZ7A 1XQQA 2VZKD 2QDFA 5G2NA 3KUCB 3VDZA 4JWSC 4IM3A 2WGSA 3BVZA 4WJOA 2BS4B 2INNE 3DWGC 3DWMA 1KF6B 3R2TA 3GZNB 2JYEA 1C9FA 1B9RA 4EUTA 2L83A 4BKTA 3E56A 2MRPA 4WWOA 3CF6E 4ICVA 3TUOA 4URKA 4OZAA 3ZDTA 4HEA1 1IP9A 2YEPB 3AE3B 2DZMA 3HVDA 5FR6A 2KTRB 1T0SC 3GE3C 3H7PB 4HPPA 4NNJB 2M17A 1RFKA 2AWTA 1UBIA 3JVZX 1NYQA 3QC8B 4ANWA 3B0AA 4XGAB 3NZ3A 2IY1B 3LDZE 2KO3A 2AL3A 1A5RA 1V1OA 4QAYA 2KD0A 1K8RB 1YOVB 2W54A 1R7SA 2DENB 1HQRD 3DPDA 2I38A 2BBCA 3AEEB 3N1YC 3ONSA 1JRUA 4KV2A 1EU3A 3Q2AC 1WJNA 2LGIA 4BKSD 4I6LB 2W3SA 4II3B 1DGJA 2MA9B 1Z2MA 2MP2B 2G4SA 3N20C 2R2OA 1MPEA 3JYUA 4N9F4 4PS8A 3W9CB 1WZ3A 1DOYA 1K53A 1NVID 2TSSA 4I6PA 2L05A 2HDEA 2V3NA 4BFRA 2KQSA 5CHWA 1HA5A 2RPQA 1L0XB 1J19A 1YD8U 2XEWA 3UF8A 3UIPB 2Y5BB 4MT5A 1QOBA 3RPFC 1VD2A 3T3NA 2B76B 1RM6C 4HCNB 4A3OA 3AH7A 1MG4A 3J9CA 4RGOS 1TY2A 4S17A 4HXDA 3Q3NC 1FO4A 2CHXA 2LVPA 4EFOA 5EE0A 2QHOA 2PE9A 4MEMA 2DZJA 3HM6X 3IT4B 4LK0M 2N1VA 1E6EB 3ML8A 1KH0A 3QQ8B 4G11A 1WZ0A 1L2NA 4HROA 3AEDB 4LNKA 1XCQL 1TS2A 1V1PB 2AEHA 4ARCA 1SGHA 3QX1A 1NBFC 1P7FA 3IFWB 4E71A 3KWVA 3APCA 5G5HA 2WNMA 1FD6A 2YLMA 2J0JA 2KDIA 4F1SA 4C56C 3RT3B 4GDLA 2FCMA 2YVCA 2PTLA 4ANUA 4KZ0A 2WXQA 3NRZA 1VDVA 3MC9A 3DVGY 1PUTA 2JPHA 1F0ZA 2BKFA 1JWAD 2IJ0A 2IGDA 2RGFA 4YL8A 4YTPB 1MFWA 4MJSB 2BWES 3WCQA 3EUB2 3I9V1 3BVMA 3VTVA 3BVGA 1WIAA 2IO2B 3HUIA 3NZUA 2HE7A 4UDUC 2IBIB 4RMAA 4O1NA 1JWMD 1L6UA 1WX7A 3FKYA 1IUEA 4HCPB 1OEYJ 3ZO5B 1JROA 2G1EA 2Y5CA 1WGHA 2FCSA 1WXQA 3AEAB 2VZKB 3ML9A 2MBOA 4NQLB 1WH3A 3RYTA 2WU2B 3ZNID 3TL5A 1AW7A 4IOIE 4C80A 1D3ZA 1IPGA 3AV8A 1EWCA 5IN7A 2WXOA 4MH8A 4FA6A 3Q3OC 2KDEB 2J42A 3DBRI 1E9MA 4M02A 3ZXRA 2QCZA 2LEKA 3U7DA 1YN4A 2R2QA 3CWIA 2AX5A 4RH6A 1WJ4A 2JY6A 3BK1A 2DX5B 3IBEA 1N5WA 3MP9A 1AARA 4MH0E 1SE3A 1ZDVA 2D5GA 4K3BA 1XD3B 2KK8A 3RNBC 3O13A 3Q8BA 2JQRB 4K1RB 3Q8CA 3SFDB 1G6JA 4DHZE 5AEKB 2JZPA 2J53A 5CX3A 3V3XA 2C5LC 3PGEA 1TT5B 2IGGA 1FCCC 4TV3A 2O2VB 4BKGA 2LHDA 3V6EB 1GAQB 3M63B 4WQOB 2HJ1A 3TEYA 2VRRB 2LJIA 2NMQA 1V8CA 4ZRJA 4R3DA 1P9DU 3K9PB 2UYZB 1V6EA 2JSVX 1ENFA 4LNNA 2K5PA 4W9FA 1YN3A 2KLCA 3ZJTA 2GBRA 4ZDVA 2WDVB 1V2YA 3PV1A 4Q2JA 3AEFB 2DBYA 2RMMA 3HIZA 2EMTA 1D5ZC 4MACA 1D5MC 1R4NI 4L2YA 1JALA 4MGZE 2MLBA 3BWUD 2IYDB 3H1UA 1XXGA 4WURA 2JU6X 3L16A 3Q8FA 5DPTA 3AECB 3KUDB 1FFUA 1LQBA 1T6BX 2X8XX 4MGKE 3VR8B 4HKQA 1MI0A 1YNTE 3RNFC 5BMGA 1BUIC 4XDDA 4PS7A 4K7SA 2H88B 2BYTA 2GBNA 3LYYA 2M0AA 1Q10A 1FNVA 2L00B 1PFDA 2JZ3B 4HVBA 2ZPNA 4PYUA 2WXGA 2MJDA 2N9PC 2KMAA 5BYSA 3LXFA 4XC2A 3X0WA 1C3TA 4AOFA 2N7DA 1YJ1A 1CK1A 3QJZA 3I63C 4FJZA 4KGSA 4B0EA 1QF6A 2LVOA 2C7MB 4HK2A 2JXXA 2CR5A 4WIPA 2C7NB 2DAFA 2LI5A 4HDQA 2IZVB 4AUQC 1PDXA 1C77A 5D3DA 3L08A 3P4SB 4AS1A 1SIFA 5IOIA 3KW5B 2CJOA 4WWNA 2NVUI 3X23A 3AU4A 1FCLA 3E9SA 4NAWA 4GDKA 1YQ3B 3I57A 2KNBA 3A9JA 4OVVA 1VR9A 3AM9A 3R8BA 1UBQA 1E7UA 1ET6A 1MJDA 5C1ZA 2WHIA 1SSNA 3TIXA 2M0XA 3DBHI 1LGRA 2ZW1A 1PGXA 1EO6A 4NZLB 1E10A 1C4CA 3PO0A 4S0RA 5AZFA 1TJEA 3MC8A 1J7BA 1ZDXA 4ARIA 3AE7B 3BZDB 2G45B 1XLQA 4A3PA 2MW5A 2DZKA 4YSYB 1EUVB 1NI3A 3ZXVA 2JVCA 5EE3A 4KSKC 2I2YA 2LGYA 1A70A 3MHZA 2M4NA 3AXCA 1TZ1A 1CQVA 2OJRA 1NI2A 1T0YA 2WU5B 1F2RC 2DYBA 4GOCA 1SIJA 1ZW7A 4EZJA 2NTSA 3EFUA 2KT7A 4IC7B 2WXHA 3U52E 1VCBA 2KJHB 2M1MA 1TY0A 3NS1A 3NY5A 1QZEA 4NJ7A 3TEXA 1X1MA 2WWZA 4MSQB 4KDIC 1MVKA 3OG5A 1HTQA 2EELA 3DBLB 1AYFA 2WS3B 2RD0A 5LLIA 1I4XA 1FEHA 2MBHA 4XWWA 1DOXA 1NYRA 2WDTB 1SXTA 4GGQA 2CHWA 2DNFA 2INDC 4J3OD 1N60A 3SHQA 2V3SA 2ZPYA 3FILA 1WGGA 3PZDA 2KWVB 4G0NB 3WAMA 4RM8A 1I4GA 3DDCB 3U8ZA 4MGYE 1T3QA 1IBXB 2LMCA 2RR9A 1T0RC 2JF5A 2KJ6A 2J4XA 4IWOA 4FJVB 5EDSA 1L4DB 2L7RA 4J6IA 5KHQA 4M01A 1SJHD 1IYFA 4FLHA 2KWDA 2ZEQA 3UQAA 5E6NA 4K7UA 2C7HA 5JZEB 1FNUA 1Q5WB 3VFKA 3ZYYX 2WX0A 4FXCA 5I4DA 1I4HA 4ZRQA 3ABVB 3VRBB 2KWCA 4AJYB 2PVOD 1YX5B 2XBBC 1V9JA 2Z0EB 3DCGA 5H8YE 2MQJA 2KACA 2MSED 2V0GA 3Q3MC 2NBWB 1EU4A 1PGBA 3TMPB 1ZXIA 1WX8A 1LO5D 2FE8A 4W9IA 2C60A 1S1QB 2WDRB 2L32A 3UQBA 4YTMB 1NDDA 1WJ6A 1MG8A 4ZRKA 4ANXA 3DBLI 4W9DA 1M94A 2D3AA 3GB1A 3EFCA 3RNEC 3ZRFA 4BZAA 4YXDB 1I7HA 5IP4D 4EZKA 3NOBA 4W9LA 1U4AA 2LGDA 3H8HA 4MGIE 3GP7A 1GOZA 4LJOB 1SEBD 3NHEB 4GMVA 3W1SC 1TYGB 2J0KA 4LNFA 5IKCM 2HJ8A 3C0RB 4FJYA 2LJ5A 1C1YB 1BXTA 4USAA 3T9LA 3S2AA 4WJNA 1QOAA 1WF9A 2AL6A 5HFYA 1CJEA 5BYRA 1E7PB 2SEBD 3NVYA 3VVWB 2KQ4X 5D3IB 4K7WA 4N58A 3ZQ4A 1F52A 2K1FA 3RZWC 2NR2A 2PMVA 1ET9A 2D07B 4P1CC 1FIQA 1WY8A 4IM0A 2MHJA 4JIOU 1B1ZA 1K51A 1UELA 2PLPA 2RDBC 1WFYA 2KFKA 4US9A 5E6JA 2L0FA 1AN8A 1VRAB 2O6VA 3KQ4A 2FNJB 3GZNI 3KH0A 3U4EG 1P3QU 2WXIA 3PRMB 2LWPA 4H2AA 4IWQA 4KZCA 4RM9A 4W9EA 3HRDD 3D32A 4IDIA 1FRRA 3Q8EA 1ZOYB 2ZVOA 4FADA 3I5JC 3DHHC 2ZW0A 2LRWA 5IO9A 1RYJA 3MC0B 3PSEB 3VTWA 3Q3FA 5G55A 3ZKJC 4F8CB 2PVGC 4G50A 2HTME 2N0SB 3BINA 2LASA 5C3JB 1EWYC 1I35A 1KLUD 4DHJD 4GDKB 2PEAA 4K3CA 2H89B 1SE4A 3A9JB 4HPMB 3U7ZA 1FM0D 2INPE 4ITKA 2HTHA 3C19A 4OW0A 4KDLB 1WMHA 1ACCA 4ZHPA 1L6VA 2V1YA 1YX6B 4DHZB 2IGHA 1QOGA 3AULA 1WGYA 3RNAC 3RCZA 4EOYA 3L10B 2L1AA 3BK2A 4D2KA 2JRIB 1PYWD 3GS2A 4RF1A 4C7ZA 4EE2A 2BTEA 4C4VA 5BMIA 4GN1A 4HRSA 4KGRA 1MHXA 3ZVVA 2KAJA 4ZYSA 2KXJA 4JE3B 4RGMA 1JRPA 2NBVB 3N32A 5J18A 3VXWA 2GB1A 4KX6B 3L0WB 4RCOA 2Z8LA 1F77A 2JWUA 4E74A 3QARA 2K3UA 3A4SC 4BOSC 2DLBA 4W9HA 4AWJA 2NPTA 2AQ2B 3P4PB 1KOTA 3L17A 4OVUA 4WJPA 3Q14C 1UZXB 2KVRA 1EM7A 1XF5L 2Y3AA 4M00A 3W1YA 3CSFA 2ZCCA 3SEBA 3NVZA 1GG3A 4M0WB 1SE9A 3QA8A 2I1JA 4FBJB 1EF5A 1FNWA 3V6CB 3RUIB 1R4MB 4JQWC 2KTFA 3DBSA 2KX0A 4XZ4A 3RNGC 2W3RA 1NEKB 3WALA 2QEJC 1N63A 3VH4B 2D3CA 2GMIC 5IAAC 4LCDE 2N1WA 3A4RA 2Z59B 4P7IA 4K81A 3AEGB 4N59A 3IAS1 4HLEA 3L13A 1C4AA 1XEEA 1Y56A 2CU3A 3EECA 1XLPA 1I42A 2WP9B 3GE8C 3QAQA 2M19A 2M8SA 2N9EB 3SFEB 1KTKA 4A20A 4A55A 3CIRB 5HI1A 1KFYB 2M56B 2HD5B 4YTNB 3B1LX 1YJJA 4KSLC 1T0QC 5D94A 2KDMA 2L52A 2AYOB 4DDGD 2RPVA 3ZLZA 2BB5A 4ACFA 2WDQB 5JH5C 1SJED 1TTNA 3A9KA 3ZNHB 3TEZA 5LXHA 4JX1C 3NS8A 1XT9B 2MX2A 1D5XC 2N7JA 3SR6A 4EKUA 1ZXHA 3B2GA 3WA0A 2ZCBA 1GJZA 3PRPB 1P1AA 1J7CA 2PE6B 1IGDA 4NJ6A 3WAOA 1TKYA 2KOXA 4XE0A 1E0ZA 2W82A 3DQVA 3UI3A 4RF0A 1Y8RC 4CHKA 2FBWB 5C2TB 2KDFB 5DCNA 1SE2A 1MHHE 2LUMA 2D2QA 3VRAB 4I6NB 1FXIA 3P4RB 4OHJA 1YJIA 2K25A 1ROEA 4DHJB 3I3TB 2IO0B 5IA7A 1BT0A 1C76A 3QWZB 5CHVC 3UIOB 3PLVA 1RFAA 3NZSA 1V1PA 4ZOHC 2LGSA 3SU8X 3R7QA 3T3OA 1ZP0B 3WAPA 2ZZPB 4A90A 4W9GA 4BBNC 1AWDA 2KFKB 4YSXB 4TMAB 1K52A 2OJWA 5AUKA 2WXLA 5TSSA 4OVZA 2O6VB 3TEWA 1KRHA 1YQBA 2KC2A 3ZNZB 3T8MA 4AQ7A 1WGKA 1J7AA 1RRBA 1JMLA 2RDGA 3RMKC 1GNUA 2KMCA 4IWPA 4P6VF 4MM3A 3MFGA 3V05A 3IT6B 1HTOA 1N5XA 1V5TA 4RFBA 5TR5A 2K22A 3AMZA 4GXBA 1GB4A 1TKEA 3NUHB 4REZA 4CQNA 3ETRA 4EZLA 4OZCA 1WYGA 5AZGA 3ZTCA 3OAWA 1J0GA 3PVLA 4A8XC 3NJTA 4HDOA 3OLMD 4KKJA 1L0VB 1E8ZA 4PK1A 4A9AA 2IY0B 1WRDB 4WQMA 2N9XA 3VHTC 4DXFA 2JUOA 5BMHA 1WXMA 3JW0X 4AJWA 2D10A 4NJCA 1TIFA 4GDLB 1VZ6A 4EEWA 5D2MB 2N7EA 4P16A 1YIWA 1P98A 2J7QB 1JWBD 3JSVA 2IPKD 1OQYA 4PT5A 2BS3B 2Q5WD 4HWIB 4PYZA 3A33B 3RNCC 4M8NA 2WXRA 2XNAC 4DBGA 2K9XA 1WMHB 3TCAA 1QKZA 1HEZE 2WXPA 3IAM1 1GPXA 2BVCA 4L1BA 4GB9A 1SB3C 4LDTD 5FK9C 2KWUB 1GB1A 4ANVA 4KKIA 3PHXB 3B08A 1LFDA 2K8BA 2N9KA 5MPOA 5KHOA 2V9HA 2CU1A 2WQYB 2EMSA 4C4VB 2MCNB 2BYEA 1JWSD 2GBJA 1OTRB 3U30A 4DK5A 1FXAA 2BYVE 2WLBA 4X57B 3IVFA 2FIFA 1L7YA 3CMMB 4JL9A 5JHBA 4TUUA 2KJRA 1LXDA 1WXAA 5E6OA 5J2RA 2K8CA 5LXIB 4BKSA 4WWMA 2PPHA 4B0MA 4G3XB 2O2VA 4JPSA 3ZJUA 4MSMB 4WWPA 3OWEB 4TQ1A 2NPTB 3ALBA 5BYQA 5GXGB 4W9KA 4US8A 1WGRA 1FXTB 3AU5A 3H9DA 4IG7B 1VJKA 3MJWA 2MBBB 4MDKE 2KDBA 3EA6A 1N61A 4WAAA 4CO7A 3QCAA 2WXNA 2ICIA 3ZTDA 1L0YB 3M3JA 4FN2A 3RFZB 2A4ZA 3NG0A 3PRZA 3N3KB 1FRDA 3KWLA 4FHJA 3KVFB 3AE4B 4XYCA 2Z0DB 2JXTA 1V80A 2D3BA 5GMVA 1QILA 1OGWA 1SF0A 5HHDG 3AE5B 3Q6BA 3DVNU 4W9CA 3PLUA 2BB6A 3ZJVA 1D6EC 1N6ZA 2LD9A 1QQRA 2WXJA 3IG3A 2KVZA 2G4DB 3A1QA 2L8JA 5HKHA 5D6JB 4GSWA 2R61A 2V4LA 2NBUA 3BY4B 3DVGX 2REXA 2BT6A 4RNAA 5EE9A 1NENB 3RULA 3HK0A 5CTRC 4KIKA 3P4QB 1C4PA 1Q1OA 2KQ7A 1V97A 1WX9A 3ENEA 2EKIA 3PTFC 5L95C 1UH6A 3DHGC 2ZNVC 3A9KB 2FCQA 4LNIA 1WE6A 1UGMA 1Z5SB 1H4RA 3BYTB 1OQQA 1HZ5A 2GOWA 2JX5A 3UINB 4C00A 2ASQA 3AE2B 5AZHA 2KZRA 3EGRA 4B6WA 2JZZA 3PREA 3R3MA 2A5UA 1YQ4B 2QC8A 1ZGUB 2KX3A 2GLSA 3P2BA 1E90A 4II2B 1ISNA 1CZPA 2LHEA 1F2RI 3VAWA 4DXAB 2FAZA 4LJPB 2WYQA 2RDHA 4IKGA 2KKCA 1E8YA 2BQQA 3DBRB 1H8CA 3QHTA 2UWQA 4IM2A 2CS4A
chains in the Genus database with same CATH topology
3N1XC 3N20C 2RDBC 4P1BC 1T0RC 3RN9C 2INCC 3Q3MC 3RNEC 3RNFC 3I5JC 3DHHC 1T0QC 3N1YC 3RNAC 1T0SC 2INDC 3GE3C 3Q2AC 3Q3NC 3Q14C 3I63C 3RI7C 3RMKC 3RNGC 3RNCC 3DHIC 3GE8C 3Q3OC 3N1ZC 3DHGC 4P1CC 3RNBC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N1X C;  3N20 C;  2RDB C;  4P1B C;  1T0R C;  3RN9 C;  2INC C;  3Q3M C;  3RNE C;  3RNF C;  3I5J C;  3DHH C;  1T0Q C;  3N1Y C;  3RNA C;  1T0S C;  2IND C;  3GE3 C;  3Q2A C;  3Q3N C;  3Q14 C;  3I63 C;  3RI7 C;  3RMK C;  3RNG C;  3RNC C;  3DHI C;  3GE8 C;  3Q3O C;  3N1Z C;  3DHG C;  4P1C C;  3RNB C; 
#chains in the Genus database with same CATH topology
 2PIA A;  4P1B C;  3R7R A;  3RN9 C;  3Q3J A;  2JWZ A;  2INC C;  2VH1 A;  1WJU A;  1TKG A;  1DOI A;  4XWT A;  1UD7 A;  3V61 A;  2QMT A;  4LDT B;  3BYY B;  4NAW B;  3CST A;  3FC4 A;  4RGT A;  5CHF A;  5T8I A;  3VUW A;  3NVW A;  4GIV A;  1WM2 A;  2BKR B;  2JYT A;  3N9Y C;  2LXC A;  1WR1 A;  4KGT A;  4B95 A;  1XLN A;  1IGC A;  1OQR A;  3U2S C;  3IHP C;  3TSS A;  5EE1 A;  3SD5 A;  2DAJ A;  3URY A;  2XK5 A;  4YWG G;  1TZO A;  1ZUD 2;  4MM3 B;  2UU7 A;  2BWF A;  3H7S A;  2E3T A;  2ZNV B;  2FID A;  3HM3 A;  1V81 A;  2DZI A;  3QK0 A;  2O6V D;  3DOW A;  1KJT A;  2CKH B;  4WAF A;  5JXV A;  4YSZ B;  3V62 A;  2KAN A;  4HKZ E;  5AUI A;  1ESF A;  2QIL A;  4L23 A;  2AQ3 B;  1TS5 A;  3ZDM C;  2FUH B;  2BW2 A;  4HJK A;  3OJ4 B;  3AE6 B;  4NY0 A;  2K6D B;  2IO1 B;  2KMM A;  1IBX A;  3Q69 A;  2PKO A;  3PT2 B;  4BBN F;  3L4P A;  3RZF A;  1R4N B;  3V60 A;  3JSV B;  2PW9 A;  2J52 A;  4LNO A;  1KLV A;  1HE8 A;  2K8H A;  2QJL A;  1E8W A;  3N1Z C;  1N62 A;  1WM3 A;  3W5V B;  3M62 B;  4BVU C;  1XCT L;  2L3Z A;  1V86 A;  1WXV A;  2GBM A;  2LXA A;  4IW0 A;  3BII D;  1UNS A;  2N9L A;  2L0T A;  3P1M A;  4C7Y A;  4DQO C;  1RWS A;  4ZYN A;  3ZNG C;  3KUZ A;  2X38 A;  2C9W B;  3B9J A;  1XLO A;  3FIL B;  2K6Q A;  3EC8 A;  3Q8A A;  4E3C A;  1I4Q A;  4LTU A;  2MBQ A;  1WXS A;  3ZIM A;  3AB5 A;  4TQ0 A;  2KYW A;  3P63 A;  3IXS A;  2KHW B;  4HJG E;  1L4Z B;  2KN4 A;  1WRI A;  2KTR A;  1TS3 A;  3H7P A;  3KLS X;  3MJ5 A;  3SDL C;  4FUL A;  4ICU A;  3O65 B;  3ZGZ A;  2BGF A;  4GLS C;  1ZPS A;  3KYC D;  4NAM A;  3W2D A;  3ZW3 A;  3TJP A;  2D3G A;  4ZRP A;  1YN5 A;  4MEL A;  4ZHO A;  2YEP F;  3AE1 B;  1M4V A;  2L76 A;  2XN9 C;  3EHV A;  2WXK A;  4W9J A;  2J0M A;  4NQK E;  3APD A;  3ZRC A;  2MP2 A;  4KVG B;  5H92 C;  2LGX A;  3DBH B;  2V3P A;  4TKN A;  4XDC A;  2SAK A;  1TGZ B;  2RSU A;  1KM7 A;  4RGN A;  3AI5 A;  1K50 A;  2E6X A;  3PS6 A;  3PZ8 A;  2PJH A;  2NS5 A;  1OFF A;  1WSP A;  1I4R A;  4WJQ A;  5J17 A;  1QLB B;  1E7V A;  2Y5P A;  3UGB B;  3VR9 B;  4FHK A;  2OOB B;  1L5P A;  2ONQ A;  2NCN A;  1WGD A;  2GI9 A;  1LM8 B;  1F9J A;  4PS3 A;  3AN1 A;  2AQ1 B;  3ZUN A;  2BF8 B;  2K39 A;  1D4B A;  3A1Q B;  1J8C A;  2DYM A;  4JGH B;  2QIE B;  3MHS D;  4XX5 A;  1R4M I;  3DHI C;  1UWX A;  1GC6 A;  1E5W A;  1OEY A;  1ZKH A;  4TSS A;  3N1X C;  3ECI A;  4M8M A;  4B9K A;  4KIK B;  2IO3 B;  1WYW B;  2KLG A;  2KFJ A;  4ZRI A;  1HZ6 A;  2ON8 A;  1JW9 D;  1WWT A;  1TS4 A;  3HHM A;  3RI7 C;  1BML C;  4JLC A;  3PZ7 A;  2KN5 A;  3VUY A;  4OZB A;  2N4F A;  3M95 A;  3VH3 B;  2FUG 1;  3HVZ A;  2JT4 B;  3MTN B;  1EF1 A;  2DYO A;  2BS2 B;  2MBE A;  3K9O B;  4DDI D;  2WXF A;  2JRH A;  2W55 A;  5DPS A;  1RAX A;  1P7E A;  1HXY D;  5FKA C;  2B3A A;  2BPS A;  4IUM B;  4JWU C;  1YMH E;  1TBE A;  2ZVN A;  4GU2 A;  2OED A;  5JHA A;  1WR6 E;  3W1S A;  1F1H A;  4MJS A;  4ASW C;  1T5X D;  2OHF A;  3R2I A;  3N30 A;  5HG2 A;  3VQI A;  4DWF A;  1QOF A;  1PGA A;  1VZ8 A;  3R66 C;  1PQS A;  4DXG A;  4LLG M;  2LVQ A;  3L54 A;  3AEB B;  1FFV A;  2MWS B;  2CHZ A;  2LRU A;  5LNK 1;  1GC7 A;  3KYD D;  3QIJ A;  3RD2 A;  1CMX B;  2GBK A;  1V49 A;  1VLB A;  1UUP A;  2BYF A;  4YT0 B;  2G3Q B;  1UF0 A;  2MJE A;  2VH2 A;  2I1K A;  3VTU A;  3WAN A;  2LZ6 A;  1C78 A;  4N6E B;  1JQ4 A;  2NTT A;  2FCN A;  4BOZ B;  4NPN A;  1C79 A;  3B2F A;  1SBB B;  1V5O A;  2LUE A;  2D11 A;  1E8X A;  5C23 A;  2EKE C;  2MH7 A;  3H6N A;  5D7G A;  5DPW A;  2DWQ A;  3FAH A;  2KC1 A;  2ACZ B;  3LJ3 A;  2WX1 A;  5BO4 B;  2QSD A;  1P0R A;  1XO3 A;  3DVN V;  2XK5 B;  2ZJD A;  3W5U B;  1DYQ A;  4CYE A;  4F7Z A;  3C8Y A;  1STE A;  5L83 A;  2K0P A;  2IDY A;  2WXM A;  1FPY A;  3TBL D;  4AP4 C;  1S3S G;  3WIM A;  4HPL B;  3APF A;  1Q0W B;  3AE8 B;  4M0W A;  3PPA A;  2GRI A;  1WE7 A;  1I4P A;  2MEK A;  2V4I B;  3P42 A;  1QT9 A;  3VUX A;  1FMA D;  5E6P A;  2G9H D;  3LB8 C;  3PHW B;  3AE9 B;  5G5G A;  4BAX A;  1RLF A;  5DPR A;  4WH4 A;  3OJ3 A;  1JWU D;  3NVV A;  1GUA B;  2W9N A;  2DHZ A;  4A6Q A;  1KLG D;  2CJN A;  2LFI A;  3GOE A;  2MJ3 A;  5FR3 A;  1WI0 A;  1JCK B;  1UGJ A;  1UWM A;  1ZE3 D;  1VZ7 A;  1XQQ A;  2VZK D;  2QDF A;  5G2N A;  3KUC B;  3VDZ A;  4JWS C;  4IM3 A;  2WGS A;  3BVZ A;  4WJO A;  2BS4 B;  2INN E;  3DWG C;  3DWM A;  1KF6 B;  3R2T A;  3GZN B;  2JYE A;  1C9F A;  1B9R A;  4EUT A;  2L83 A;  4BKT A;  3E56 A;  2MRP A;  4WWO A;  3CF6 E;  4ICV A;  3TUO A;  4URK A;  4OZA A;  3ZDT A;  4HEA 1;  1IP9 A;  2YEP B;  3AE3 B;  2DZM A;  3HVD A;  5FR6 A;  2KTR B;  1T0S C;  3GE3 C;  3H7P B;  4HPP A;  4NNJ B;  2M17 A;  1RFK A;  2AWT A;  1UBI A;  3JVZ X;  1NYQ A;  3QC8 B;  4ANW A;  3B0A A;  4XGA B;  3NZ3 A;  2IY1 B;  3LDZ E;  2KO3 A;  2AL3 A;  1A5R A;  1V1O A;  4QAY A;  2KD0 A;  1K8R B;  1YOV B;  2W54 A;  1R7S A;  2DEN B;  1HQR D;  3DPD A;  2I38 A;  2BBC A;  3AEE B;  3N1Y C;  3ONS A;  1JRU A;  4KV2 A;  1EU3 A;  3Q2A C;  1WJN A;  2LGI A;  4BKS D;  4I6L B;  2W3S A;  4II3 B;  1DGJ A;  2MA9 B;  1Z2M A;  2MP2 B;  2G4S A;  3N20 C;  2R2O A;  1MPE A;  3JYU A;  4N9F 4;  4PS8 A;  3W9C B;  1WZ3 A;  1DOY A;  1K53 A;  1NVI D;  2TSS A;  4I6P A;  2L05 A;  2HDE A;  2V3N A;  4BFR A;  2KQS A;  5CHW A;  1HA5 A;  2RPQ A;  1L0X B;  1J19 A;  1YD8 U;  2XEW A;  3UF8 A;  3UIP B;  2Y5B B;  4MT5 A;  1QOB A;  3RPF C;  1VD2 A;  3T3N A;  2B76 B;  1RM6 C;  4HCN B;  4A3O A;  3AH7 A;  1MG4 A;  3J9C A;  4RGO S;  1TY2 A;  4S17 A;  4HXD A;  3Q3N C;  1FO4 A;  2CHX A;  2LVP A;  4EFO A;  5EE0 A;  2QHO A;  2PE9 A;  4MEM A;  2DZJ A;  3HM6 X;  3IT4 B;  4LK0 M;  2N1V A;  1E6E B;  3ML8 A;  1KH0 A;  3QQ8 B;  4G11 A;  1WZ0 A;  1L2N A;  4HRO A;  3AED B;  4LNK A;  1XCQ L;  1TS2 A;  1V1P B;  2AEH A;  4ARC A;  1SGH A;  3QX1 A;  1NBF C;  1P7F A;  3IFW B;  4E71 A;  3KWV A;  3APC A;  5G5H A;  2WNM A;  1FD6 A;  2YLM A;  2J0J A;  2KDI A;  4F1S A;  4C56 C;  3RT3 B;  4GDL A;  2FCM A;  2YVC A;  2PTL A;  4ANU A;  4KZ0 A;  2WXQ A;  3NRZ A;  1VDV A;  3MC9 A;  3DVG Y;  1PUT A;  2JPH A;  1F0Z A;  2BKF A;  1JWA D;  2IJ0 A;  2IGD A;  2RGF A;  4YL8 A;  4YTP B;  1MFW A;  4MJS B;  2BWE S;  3WCQ A;  3EUB 2;  3I9V 1;  3BVM A;  3VTV A;  3BVG A;  1WIA A;  2IO2 B;  3HUI A;  3NZU A;  2HE7 A;  4UDU C;  2IBI B;  4RMA A;  4O1N A;  1JWM D;  1L6U A;  1WX7 A;  3FKY A;  1IUE A;  4HCP B;  1OEY J;  3ZO5 B;  1JRO A;  2G1E A;  2Y5C A;  1WGH A;  2FCS A;  1WXQ A;  3AEA B;  2VZK B;  3ML9 A;  2MBO A;  4NQL B;  1WH3 A;  3RYT A;  2WU2 B;  3ZNI D;  3TL5 A;  1AW7 A;  4IOI E;  4C80 A;  1D3Z A;  1IPG A;  3AV8 A;  1EWC A;  5IN7 A;  2WXO A;  4MH8 A;  4FA6 A;  3Q3O C;  2KDE B;  2J42 A;  3DBR I;  1E9M A;  4M02 A;  3ZXR A;  2QCZ A;  2LEK A;  3U7D A;  1YN4 A;  2R2Q A;  3CWI A;  2AX5 A;  4RH6 A;  1WJ4 A;  2JY6 A;  3BK1 A;  2DX5 B;  3IBE A;  1N5W A;  3MP9 A;  1AAR A;  4MH0 E;  1SE3 A;  1ZDV A;  2D5G A;  4K3B A;  1XD3 B;  2KK8 A;  3RNB C;  3O13 A;  3Q8B A;  2JQR B;  4K1R B;  3Q8C A;  3SFD B;  1G6J A;  4DHZ E;  5AEK B;  2JZP A;  2J53 A;  5CX3 A;  3V3X A;  2C5L C;  3PGE A;  1TT5 B;  2IGG A;  1FCC C;  4TV3 A;  2O2V B;  4BKG A;  2LHD A;  3V6E B;  1GAQ B;  3M63 B;  4WQO B;  2HJ1 A;  3TEY A;  2VRR B;  2LJI A;  2NMQ A;  1V8C A;  4ZRJ A;  4R3D A;  1P9D U;  3K9P B;  2UYZ B;  1V6E A;  2JSV X;  1ENF A;  4LNN A;  2K5P A;  4W9F A;  1YN3 A;  2KLC A;  3ZJT A;  2GBR A;  4ZDV A;  2WDV B;  1V2Y A;  3PV1 A;  4Q2J A;  3AEF B;  2DBY A;  2RMM A;  3HIZ A;  2EMT A;  1D5Z C;  4MAC A;  1D5M C;  1R4N I;  4L2Y A;  1JAL A;  4MGZ E;  2MLB A;  3BWU D;  2IYD B;  3H1U A;  1XXG A;  4WUR A;  2JU6 X;  3L16 A;  3Q8F A;  5DPT A;  3AEC B;  3KUD B;  1FFU A;  1LQB A;  1T6B X;  2X8X X;  4MGK E;  3VR8 B;  4HKQ A;  1MI0 A;  1YNT E;  3RNF C;  5BMG A;  1BUI C;  4XDD A;  4PS7 A;  4K7S A;  2H88 B;  2BYT A;  2GBN A;  3LYY A;  2M0A A;  1Q10 A;  1FNV A;  2L00 B;  1PFD A;  2JZ3 B;  4HVB A;  2ZPN A;  4PYU A;  2WXG A;  2MJD A;  2N9P C;  2KMA A;  5BYS A;  3LXF A;  4XC2 A;  3X0W A;  1C3T A;  4AOF A;  2N7D A;  1YJ1 A;  1CK1 A;  3QJZ A;  3I63 C;  4FJZ A;  4KGS A;  4B0E A;  1QF6 A;  2LVO A;  2C7M B;  4HK2 A;  2JXX A;  2CR5 A;  4WIP A;  2C7N B;  2DAF A;  2LI5 A;  4HDQ A;  2IZV B;  4AUQ C;  1PDX A;  1C77 A;  5D3D A;  3L08 A;  3P4S B;  4AS1 A;  1SIF A;  5IOI A;  3KW5 B;  2CJO A;  4WWN A;  2NVU I;  3X23 A;  3AU4 A;  1FCL A;  3E9S A;  4NAW A;  4GDK A;  1YQ3 B;  3I57 A;  2KNB A;  3A9J A;  4OVV A;  1VR9 A;  3AM9 A;  3R8B A;  1UBQ A;  1E7U A;  1ET6 A;  1MJD A;  5C1Z A;  2WHI A;  1SSN A;  3TIX A;  2M0X A;  3DBH I;  1LGR A;  2ZW1 A;  1PGX A;  1EO6 A;  4NZL B;  1E10 A;  1C4C A;  3PO0 A;  4S0R A;  5AZF A;  1TJE A;  3MC8 A;  1J7B A;  1ZDX A;  4ARI A;  3AE7 B;  3BZD B;  2G45 B;  1XLQ A;  4A3P A;  2MW5 A;  2DZK A;  4YSY B;  1EUV B;  1NI3 A;  3ZXV A;  2JVC A;  5EE3 A;  4KSK C;  2I2Y A;  2LGY A;  1A70 A;  3MHZ A;  2M4N A;  3AXC A;  1TZ1 A;  1CQV A;  2OJR A;  1NI2 A;  1T0Y A;  2WU5 B;  1F2R C;  2DYB A;  4GOC A;  1SIJ A;  1ZW7 A;  4EZJ A;  2NTS A;  3EFU A;  2KT7 A;  4IC7 B;  2WXH A;  3U52 E;  1VCB A;  2KJH B;  2M1M A;  1TY0 A;  3NS1 A;  3NY5 A;  1QZE A;  4NJ7 A;  3TEX A;  1X1M A;  2WWZ A;  4MSQ B;  4KDI C;  1MVK A;  3OG5 A;  1HTQ A;  2EEL A;  3DBL B;  1AYF A;  2WS3 B;  2RD0 A;  5LLI A;  1I4X A;  1FEH A;  2MBH A;  4XWW A;  1DOX A;  1NYR A;  2WDT B;  1SXT A;  4GGQ A;  2CHW A;  2DNF A;  2IND C;  4J3O D;  1N60 A;  3SHQ A;  2V3S A;  2ZPY A;  3FIL A;  1WGG A;  3PZD A;  2KWV B;  4G0N B;  3WAM A;  4RM8 A;  1I4G A;  3DDC B;  3U8Z A;  4MGY E;  1T3Q A;  1IBX B;  2LMC A;  2RR9 A;  1T0R C;  2JF5 A;  2KJ6 A;  2J4X A;  4IWO A;  4FJV B;  5EDS A;  1L4D B;  2L7R A;  4J6I A;  5KHQ A;  4M01 A;  1SJH D;  1IYF A;  4FLH A;  2KWD A;  2ZEQ A;  3UQA A;  5E6N A;  4K7U A;  2C7H A;  5JZE B;  1FNU A;  1Q5W B;  3VFK A;  3ZYY X;  2WX0 A;  4FXC A;  5I4D A;  1I4H A;  4ZRQ A;  3ABV B;  3VRB B;  2KWC A;  4AJY B;  2PVO D;  1YX5 B;  2XBB C;  1V9J A;  2Z0E B;  3DCG A;  5H8Y E;  2MQJ A;  2KAC A;  2MSE D;  2V0G A;  3Q3M C;  2NBW B;  1EU4 A;  1PGB A;  3TMP B;  1ZXI A;  1WX8 A;  1LO5 D;  2FE8 A;  4W9I A;  2C60 A;  1S1Q B;  2WDR B;  2L32 A;  3UQB A;  4YTM B;  1NDD A;  1WJ6 A;  1MG8 A;  4ZRK A;  4ANX A;  3DBL I;  4W9D A;  1M94 A;  2D3A A;  3GB1 A;  3EFC A;  3RNE C;  3ZRF A;  4BZA A;  4YXD B;  1I7H A;  5IP4 D;  4EZK A;  3NOB A;  4W9L A;  1U4A A;  2LGD A;  3H8H A;  4MGI E;  3GP7 A;  1GOZ A;  4LJO B;  1SEB D;  3NHE B;  4GMV A;  3W1S C;  1TYG B;  2J0K A;  4LNF A;  5IKC M;  2HJ8 A;  3C0R B;  4FJY A;  2LJ5 A;  1C1Y B;  1BXT A;  4USA A;  3T9L A;  3S2A A;  4WJN A;  1QOA A;  1WF9 A;  2AL6 A;  5HFY A;  1CJE A;  5BYR A;  1E7P B;  2SEB D;  3NVY A;  3VVW B;  2KQ4 X;  5D3I B;  4K7W A;  4N58 A;  3ZQ4 A;  1F52 A;  2K1F A;  3RZW C;  2NR2 A;  2PMV A;  1ET9 A;  2D07 B;  4P1C C;  1FIQ A;  1WY8 A;  4IM0 A;  2MHJ A;  4JIO U;  1B1Z A;  1K51 A;  1UEL A;  2PLP A;  2RDB C;  1WFY A;  2KFK A;  4US9 A;  5E6J A;  2L0F A;  1AN8 A;  1VRA B;  2O6V A;  3KQ4 A;  2FNJ B;  3GZN I;  3KH0 A;  3U4E G;  1P3Q U;  2WXI A;  3PRM B;  2LWP A;  4H2A A;  4IWQ A;  4KZC A;  4RM9 A;  4W9E A;  3HRD D;  3D32 A;  4IDI A;  1FRR A;  3Q8E A;  1ZOY B;  2ZVO A;  4FAD A;  3I5J C;  3DHH C;  2ZW0 A;  2LRW A;  5IO9 A;  1RYJ A;  3MC0 B;  3PSE B;  3VTW A;  3Q3F A;  5G55 A;  3ZKJ C;  4F8C B;  2PVG C;  4G50 A;  2HTM E;  2N0S B;  3BIN A;  2LAS A;  5C3J B;  1EWY C;  1I35 A;  1KLU D;  4DHJ D;  4GDK B;  2PEA A;  4K3C A;  2H89 B;  1SE4 A;  3A9J B;  4HPM B;  3U7Z A;  1FM0 D;  2INP E;  4ITK A;  2HTH A;  3C19 A;  4OW0 A;  4KDL B;  1WMH A;  1ACC A;  4ZHP A;  1L6V A;  2V1Y A;  1YX6 B;  4DHZ B;  2IGH A;  1QOG A;  3AUL A;  1WGY A;  3RNA C;  3RCZ A;  4EOY A;  3L10 B;  2L1A A;  3BK2 A;  4D2K A;  2JRI B;  1PYW D;  3GS2 A;  4RF1 A;  4C7Z A;  4EE2 A;  2BTE A;  4C4V A;  5BMI A;  4GN1 A;  4HRS A;  4KGR A;  1MHX A;  3ZVV A;  2KAJ A;  4ZYS A;  2KXJ A;  4JE3 B;  4RGM A;  1JRP A;  2NBV B;  3N32 A;  5J18 A;  3VXW A;  2GB1 A;  4KX6 B;  3L0W B;  4RCO A;  2Z8L A;  1F77 A;  2JWU A;  4E74 A;  3QAR A;  2K3U A;  3A4S C;  4BOS C;  2DLB A;  4W9H A;  4AWJ A;  2NPT A;  2AQ2 B;  3P4P B;  1KOT A;  3L17 A;  4OVU A;  4WJP A;  3Q14 C;  1UZX B;  2KVR A;  1EM7 A;  1XF5 L;  2Y3A A;  4M00 A;  3W1Y A;  3CSF A;  2ZCC A;  3SEB A;  3NVZ A;  1GG3 A;  4M0W B;  1SE9 A;  3QA8 A;  2I1J A;  4FBJ B;  1EF5 A;  1FNW A;  3V6C B;  3RUI B;  1R4M B;  4JQW C;  2KTF A;  3DBS A;  2KX0 A;  4XZ4 A;  3RNG C;  2W3R A;  1NEK B;  3WAL A;  2QEJ C;  1N63 A;  3VH4 B;  2D3C A;  2GMI C;  5IAA C;  4LCD E;  2N1W A;  3A4R A;  2Z59 B;  4P7I A;  4K81 A;  3AEG B;  4N59 A;  3IAS 1;  4HLE A;  3L13 A;  1C4A A;  1XEE A;  1Y56 A;  2CU3 A;  3EEC A;  1XLP A;  1I42 A;  2WP9 B;  3GE8 C;  3QAQ A;  2M19 A;  2M8S A;  2N9E B;  3SFE B;  1KTK A;  4A20 A;  4A55 A;  3CIR B;  5HI1 A;  1KFY B;  2M56 B;  2HD5 B;  4YTN B;  3B1L X;  1YJJ A;  4KSL C;  1T0Q C;  5D94 A;  2KDM A;  2L52 A;  2AYO B;  4DDG D;  2RPV A;  3ZLZ A;  2BB5 A;  4ACF A;  2WDQ B;  5JH5 C;  1SJE D;  1TTN A;  3A9K A;  3ZNH B;  3TEZ A;  5LXH A;  4JX1 C;  3NS8 A;  1XT9 B;  2MX2 A;  1D5X C;  2N7J A;  3SR6 A;  4EKU A;  1ZXH A;  3B2G A;  3WA0 A;  2ZCB A;  1GJZ A;  3PRP B;  1P1A A;  1J7C A;  2PE6 B;  1IGD A;  4NJ6 A;  3WAO A;  1TKY A;  2KOX A;  4XE0 A;  1E0Z A;  2W82 A;  3DQV A;  3UI3 A;  4RF0 A;  1Y8R C;  4CHK A;  2FBW B;  5C2T B;  2KDF B;  5DCN A;  1SE2 A;  1MHH E;  2LUM A;  2D2Q A;  3VRA B;  4I6N B;  1FXI A;  3P4R B;  4OHJ A;  1YJI A;  2K25 A;  1ROE A;  4DHJ B;  3I3T B;  2IO0 B;  5IA7 A;  1BT0 A;  1C76 A;  3QWZ B;  5CHV C;  3UIO B;  3PLV A;  1RFA A;  3NZS A;  1V1P A;  4ZOH C;  2LGS A;  3SU8 X;  3R7Q A;  3T3O A;  1ZP0 B;  3WAP A;  2ZZP B;  4A90 A;  4W9G A;  4BBN C;  1AWD A;  2KFK B;  4YSX B;  4TMA B;  1K52 A;  2OJW A;  5AUK A;  2WXL A;  5TSS A;  4OVZ A;  2O6V B;  3TEW A;  1KRH A;  1YQB A;  2KC2 A;  3ZNZ B;  3T8M A;  4AQ7 A;  1WGK A;  1J7A A;  1RRB A;  1JML A;  2RDG A;  3RMK C;  1GNU A;  2KMC A;  4IWP A;  4P6V F;  4MM3 A;  3MFG A;  3V05 A;  3IT6 B;  1HTO A;  1N5X A;  1V5T A;  4RFB A;  5TR5 A;  2K22 A;  3AMZ A;  4GXB A;  1GB4 A;  1TKE A;  3NUH B;  4REZ A;  4CQN A;  3ETR A;  4EZL A;  4OZC A;  1WYG A;  5AZG A;  3ZTC A;  3OAW A;  1J0G A;  3PVL A;  4A8X C;  3NJT A;  4HDO A;  3OLM D;  4KKJ A;  1L0V B;  1E8Z A;  4PK1 A;  4A9A A;  2IY0 B;  1WRD B;  4WQM A;  2N9X A;  3VHT C;  4DXF A;  2JUO A;  5BMH A;  1WXM A;  3JW0 X;  4AJW A;  2D10 A;  4NJC A;  1TIF A;  4GDL B;  1VZ6 A;  4EEW A;  5D2M B;  2N7E A;  4P16 A;  1YIW A;  1P98 A;  2J7Q B;  1JWB D;  3JSV A;  2IPK D;  1OQY A;  4PT5 A;  2BS3 B;  2Q5W D;  4HWI B;  4PYZ A;  3A33 B;  3RNC C;  4M8N A;  2WXR A;  2XNA C;  4DBG A;  2K9X A;  1WMH B;  3TCA A;  1QKZ A;  1HEZ E;  2WXP A;  3IAM 1;  1GPX A;  2BVC A;  4L1B A;  4GB9 A;  1SB3 C;  4LDT D;  5FK9 C;  2KWU B;  1GB1 A;  4ANV A;  4KKI A;  3PHX B;  3B08 A;  1LFD A;  2K8B A;  2N9K A;  5MPO A;  5KHO A;  2V9H A;  2CU1 A;  2WQY B;  2EMS A;  4C4V B;  2MCN B;  2BYE A;  1JWS D;  2GBJ A;  1OTR B;  3U30 A;  4DK5 A;  1FXA A;  2BYV E;  2WLB A;  4X57 B;  3IVF A;  2FIF A;  1L7Y A;  3CMM B;  4JL9 A;  5JHB A;  4TUU A;  2KJR A;  1LXD A;  1WXA A;  5E6O A;  5J2R A;  2K8C A;  5LXI B;  4BKS A;  4WWM A;  2PPH A;  4B0M A;  4G3X B;  2O2V A;  4JPS A;  3ZJU A;  4MSM B;  4WWP A;  3OWE B;  4TQ1 A;  2NPT B;  3ALB A;  5BYQ A;  5GXG B;  4W9K A;  4US8 A;  1WGR A;  1FXT B;  3AU5 A;  3H9D A;  4IG7 B;  1VJK A;  3MJW A;  2MBB B;  4MDK E;  2KDB A;  3EA6 A;  1N61 A;  4WAA A;  4CO7 A;  3QCA A;  2WXN A;  2ICI A;  3ZTD A;  1L0Y B;  3M3J A;  4FN2 A;  3RFZ B;  2A4Z A;  3NG0 A;  3PRZ A;  3N3K B;  1FRD A;  3KWL A;  4FHJ A;  3KVF B;  3AE4 B;  4XYC A;  2Z0D B;  2JXT A;  1V80 A;  2D3B A;  5GMV A;  1QIL A;  1OGW A;  1SF0 A;  5HHD G;  3AE5 B;  3Q6B A;  3DVN U;  4W9C A;  3PLU A;  2BB6 A;  3ZJV A;  1D6E C;  1N6Z A;  2LD9 A;  1QQR A;  2WXJ A;  3IG3 A;  2KVZ A;  2G4D B;  3A1Q A;  2L8J A;  5HKH A;  5D6J B;  4GSW A;  2R61 A;  2V4L A;  2NBU A;  3BY4 B;  3DVG X;  2REX A;  2BT6 A;  4RNA A;  5EE9 A;  1NEN B;  3RUL A;  3HK0 A;  5CTR C;  4KIK A;  3P4Q B;  1C4P A;  1Q1O A;  2KQ7 A;  1V97 A;  1WX9 A;  3ENE A;  2EKI A;  3PTF C;  5L95 C;  1UH6 A;  3DHG C;  2ZNV C;  3A9K B;  2FCQ A;  4LNI A;  1WE6 A;  1UGM A;  1Z5S B;  1H4R A;  3BYT B;  1OQQ A;  1HZ5 A;  2GOW A;  2JX5 A;  3UIN B;  4C00 A;  2ASQ A;  3AE2 B;  5AZH A;  2KZR A;  3EGR A;  4B6W A;  2JZZ A;  3PRE A;  3R3M A;  2A5U A;  1YQ4 B;  2QC8 A;  1ZGU B;  2KX3 A;  2GLS A;  3P2B A;  1E90 A;  4II2 B;  1ISN A;  1CZP A;  2LHE A;  1F2R I;  3VAW A;  4DXA B;  2FAZ A;  4LJP B;  2WYQ A;  2RDH A;  4IKG A;  2KKC A;  1E8Y A;  2BQQ A;  3DBR B;  1H8C A;  3QHT A;  2UWQ A;  4IM2 A;  2CS4 A; 
#chains in the Genus database with same CATH homology
 3N1X C;  3N20 C;  2RDB C;  4P1B C;  1T0R C;  3RN9 C;  2INC C;  3Q3M C;  3RNE C;  3RNF C;  3I5J C;  3DHH C;  1T0Q C;  3N1Y C;  3RNA C;  1T0S C;  2IND C;  3GE3 C;  3Q2A C;  3Q3N C;  3Q14 C;  3I63 C;  3RI7 C;  3RMK C;  3RNG C;  3RNC C;  3DHI C;  3GE8 C;  3Q3O C;  3N1Z C;  3DHG C;  4P1C C;  3RNB C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...