2K9XA

Solution structure of urm1 from trypanosoma brucei
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
102
structure length
102
Chain Sequence
MSNHNHITVQFAGGCELLFAKQTSLQLDGVVPTGTNLNGLVQLLKTNYVKERPDLLVDQTGQTLRPGILVLVNSCDAEVVGGMDYVLNDGDTVEFISTLHGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of Urm1 from Trypanosoma brucei
pubmed doi rcsb
source organism Trypanosoma brucei
molecule tags Unknown function
molecule keywords Uncharacterized protein
total genus 12
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2008-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09138 Urm1 Urm1 (Ubiquitin related modifier)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2k9xA00
2KMMA 5GXGB 3AE2B 3W5VB 3NVWA 1NI3A 2W55A 3AEBB 1JRPA 3AMZA 4WQMA 2MJ3A 1J7CA 3W5UB 3NVZA 5EE3A 1WRIA 3AE3B 3AEDB 1YJIA 1RM6C 3DWMA 2K5PA 4YTMB 2W3RA 3AE7B 1E0ZA 3AE5B 3L4PA 3AE1B 5G5GA 1N60A 1FXAA 3HUIA 4YSXB 1N63A 1WYGA 5MPOA 2FBWB 1NENB 1FFVA 1J7BA 1YJJA 2PVOD 3AE6B 5EE0A 3NVYA 1FIQA 2JQRB 5AUKA 4IDIA 1N5WA 1OQRA 1QOAA 5H8YE 1AWDA 4C7YA 1XLQA 2WU5B 2BT6A 3VR8B 2AX5A 1TYGB 1NYRA 1NVID 2B76B 1JW9D 1N62A 1XLOA 1JWAD 1DOYA 1YQ3B 1NYQA 3LXFA 2JX5A 2WLBA 2EKIA 1FO4A 2PVGC 3P4PB 3HRDD 3FC4A 1B9RA 1ZP0B 1ZOYB 3AE4B 1FM0D 1PFDA 2K9XA 1L5PA 1SF0A 2MJDA 3AM9A 4JWSC 2BS3B 2CU3A 3P1MA 3SR6A 3VRBB 2MH7A 1QOFA 1ZUD2 4ZHPA 2W3SA 1QLBB 1SB3C 1CZPA 1I7HA 1RFKA 1VLBA 4YTPB 4JWUC 1JROA 1A70A 1T3QA 2QIEB 1XLPA 1FXIA 3W9CB 1N61A 4US9A 4ZOHC 1VJKA 1CJEA 1RYJA 2Q5WD 2WQYB 2W54A 3P63A 1F0ZA 1WWTA 3CIRB 3ABVB 3AN1A 5AUIA 2HTME 1WGKA 3RPFC 2N0SB 4LTUA 2K22A 1FRRA 4HRSA 2Y5CA 5EE9A 3DWGC 1SIJA 3B2GA 5C2TB 4WWMA 3SFEB 1JWBD 3HVZA 3AEEB 3ETRA 2BS2B 1TKYA 3AB5A 1NEKB 1WXQA 2WDQB 3AV8A 5G5HA 2QJLA 4N58A 1KFYB 2G1EA 3VR9B 1FFUA 4C80A 1ZXIA 1V97A 4FXCA 1XO3A 3NVVA 1E6EB 1DOIA 2L83A 3AEAB 1TKEA 4N59A 2M56B 1DGJA 3KWLA 1QOGA 1OQQA 1N5XA 3AEGB 4N6EB 3AE8B 4JX1C 1E7PB 1QOBA 3AECB 1XLNA 1GPXA 2H88B 5H92C 2ACZB 2WS3B 1PDXA 1J7AA 2BS4B 3WCQA 1L6UA 1IUEA 1TJEA 3B2FA 1YQ4B 1L0VB 2CJNA 2H89B 4YSZB 4US8A 1V8CA 4ITKA 3VRAB 2DWQA 1FRDA 5C3JB 3P4RB 4C7ZA 4P6VF 5EE1A 1DOXA 1GAQB 2WU2B 1UWMA 1L6VA 3B9JA 3AH7A 1EWYC 2CJOA 3BIID 1JQ4A 3EUB2 3P4SB 3P4QB 1OFFA 1TKGA 3CWIA 1KF6B 3SFDB 1E10A 2PIAA 4YTNB 2KAJA 2WDVB 3AEFB 3ZYYX 4ZHOA 1VDVA 1ROEA 2OHFA 1PUTA 3LB8C 2WP9B 3NS1A 3FAHA 2E3TA 4YT0B 1KRHA 3NRZA 4A9AA 1QF6A 2DBYA 1QT9A 1R7SA 2PKOA 3AE9B 1E9MA 1FMAD 4YXDB 1RWSA 4KX6B 2MJEA 2L52A 4HROA 1AYFA 2LEKA 2M19A 2WDRB 3PO0A 4YSYB 1JALA 4USAA
chains in the Genus database with same CATH superfamily
4HPPA 2PPHA 3DVGX 5EE3A 3AE3B 3MC8A 4GU2A 4YSXB 4EEWA 4F7ZA 4DXGA 3V60A 2A4ZA 3NVYA 1EM7A 4IDIA 1N5WA 2LJ5A 2ON8A 4XYCA 4OVZA 2B76B 2KQ4X 2V0GA 1P7EA 4ZYSA 1T0SC 2JZ3B 1P9DU 2JT4B 2WXGA 3W1SC 5DPWA 1K52A 1ZUD2 2L05A 4K7SA 4ZHPA 1QLBB 4KKIA 4WJOA 1D3ZA 2LHDA 3ZKJC 1VJKA 4IM2A 1WGKA 3DVGY 4IWPA 5L83A 2MX2A 4HRSA 1JCKB 5C2TB 4WWMA 1MVKA 3EA6A 1J8CA 1XD3B 2IO1B 4LNFA 1AN8A 3QX1A 4RM8A 1H8CA 2WNMA 3DBHB 4HLEA 3V6CB 1QOBA 3AECB 3P2BA 2FIFA 3ZO5B 3KYDD 2KJRA 3ZUNA 1HTQA 4US8A 3P4RB 4MDKE 1I4GA 4GOCA 3N3KB 3AH7A 2WXOA 1E10A 3Q69A 5IA7A 1D6EC 1PUTA 4W9JA 2KACA 1H4RA 2E3TA 1KRHA 3NRZA 3RNEC 3H7PA 2KN5A 4TMAB 3NZ3A 2LZ6A 3W5VB 3AEBB 5IN7A 4ZRKA 4KZ0A 5G2NA 1FXAA 2C7HA 3HUIA 2KX0A 5MPOA 3AE6B 3IG3A 1C1YB 1UELA 2G45B 1WX7A 3B08A 1OQRA 1LGRA 3H7PB 4HCPB 5CHFA 3Q3JA 1KTKA 1OEYA 1R4MI 5GMVA 4AOFA 3RCZA 3AU5A 4HPMB 4IG7B 1I4QA 2K25A 1J19A 2N9KA 4YL8A 3VRBB 3QA8A 4KGRA 3DHIC 3R66C 2ASQA 2GBRA 4FLHA 4JWUC 3W9CB 4PT5A 3ZRCA 1TIFA 4CHKA 4K3CA 2OOBB 2K39A 1WJ6A 3HK0A 3H1UA 4LCDE 1GNUA 3PVLA 3SEBA 2BF8B 2IGHA 2LVOA 3QARA 2EELA 2Z8LA 3AEAB 1LM8B 2J7QB 1TZOA 3Q14C 2CHXA 3AEGB 2N7EA 2MBEA 4M01A 3EC8A 4PS8A 2KK8A 3BVZA 4ANWA 2YVCA 1TY0A 4AS1A 1ENFA 3TIXA 4YWGG 2FCSA 1TGZB 1C76A 1HEZE 1GAQB 3ZJUA 4HJGE 4W9DA 3RD2A 3EUB2 2IGGA 2Y3AA 4HDOA 2V9HA 1CQVA 3ZYYX 1YNTE 1QF6A 4EKUA 3Q8AA 3AE9B 1FMAD 1Q0WB 3QQ8B 4DHZB 1T0QC 2GMIC 1IGDA 2W55A 2DZKA 1HZ5A 3A9KA 1WZ0A 1WYGA 2V1YA 1LFDA 2J52A 2DNFA 3VFKA 1AWDA 4C7YA 1FNVA 5IKCM 5IO9A 2LMCA 1ET6A 1V1PB 2BYFA 3TSSA 2EKIA 3DBSA 3FILB 2Y5PA 3NZUA 1ZOYB 5FKAC 2ZPYA 2MJDA 1L5PA 3SR6A 1SE4A 3RNAC 3ZTCA 1D4BA 2O2VB 1GJZA 1IGCA 4RNAA 1FXIA 3V62A 1BMLC 3WAPA 4FULA 1WM2A 4A3OA 4BKSA 2JZZA 3HM3A 4KGSA 3NZSA 3L13A 4JPSA 1ZXIA 4AP4C 1GC6A 1E6EB 2KWVB 4IM0A 2PE9A 1SJHD 3DBLI 4C00A 1SE9A 3QWZB 3AE8B 2PMVA 2KDEB 2GRIA 1PDXA 2MCNB 2BS4B 3RZWC 2H89B 4MH8A 4NNJB 3QAQA 1FNUA 1ZXHA 3KUZA 5EE1A 2RR9A 1V2YA 3AU4A 3Q8FA 1XF5L 4B0EA 2PIAA 2WYQA 2VH1A 1MHXA 1G6JA 1Z5SB 3KH0A 1T5XD 1UWXA 3PZ8A 2XN9C 2PKOA 1C3TA 4P1CC 4RF1A 2MJEA 2M19A 1KJTA 4N9F4 3AXCA 5AZGA 2RSUA 2DLBA 2DZJA 2GI9A 3NOBA 1XT9B 1WGGA 2EMTA 3BWUD 5DCNA 3PHXB 3TEWA 3N20C 1WGHA 3QCAA 2PJHA 5AUKA 2CU1A 1QOAA 2BT6A 2MBOA 2WXRA 2KFKA 3M63B 1N6ZA 2NS5A 1DOYA 3BINA 3VTVA 2WLBA 4NAMA 1FM0D 3EGRA 2IPKD 1Q1OA 2PTLA 3RYTA 2L8JA 3ZDTA 3TJPA 2ZW1A 2PLPA 3D32A 4ZDVA 1CK1A 2LVPA 4L1BA 2KDMA 1WGRA 1E8WA 4ARCA 2FCNA 4HXDA 3HIZA 2XK5B 5AUIA 3RPFC 2WXIA 2ZVOA 3B2GA 2KVZA 3BY4B 3SFEB 3PGEA 4WWOA 4B95A 3AV8A 1WIAA 1QQRA 3AULA 2LVQA 4MGYE 2KNBA 3VTWA 3M3JA 4JX1C 4A90A 2DZMA 3TEXA 3VRAB 4TQ0A 4M8NA 1QILA 3N30A 1FEHA 1UWMA 1CMXB 2Z0EB 2CJOA 2ZCBA 2KMAA 2G4DB 2V3PA 4YTNB 4ZHOA 3H7SA 1VDVA 3A9JB 1L2NA 4NPNA 2INDC 1C77A 4KV2A 1TTNA 2LD9A 4YXDB 1RWSA 2V3SA 1ZW7A 2CS4A 1V1PA 2XK5A 2BKRB 3AE5B 1N63A 1VZ6A 3JW0X 1VZ7A 2C5LC 1C4CA 4WQOB 4EZJA 1K53A 1YX6B 2BKFA 1UGMA 2EKEC 4LLGM 1SE2A 2BB5A 1WE6A 3ZNHB 3TCAA 1HZ6A 3Q6BA 3P42A 3ZW3A 3IAM1 2J4XA 3A1QB 2MHJA 2L0TA 3P63A 4JLCA 1SE3A 2K22A 1ET9A 1WY8A 5EE9A 2WXHA 4HDQA 3DWGC 1HXYD 2DAFA 2QEJC 4P1BC 3HVZA 1ZGUB 2OEDA 5C23A 2KLCA 2C60A 2IDYA 4F1SA 1DOIA 3VUWA 4GN1A 2K8BA 3VTUA 3UGBB 3VH3B 5H92C 3QK0A 1YQ4B 4M0WA 1V5OA 4W9KA 2LRWA 1KOTA 1UF0A 2O6VB 2GBJA 2W9NA 5BMGA 4R3DA 5TR5A 3I5JC 3R3MA 3TEZA 1MHHE 3IXSA 4ZRPA 2PW9A 1IBXB 4A9AA 4LNOA 5JHBA 1I4HA 2L52A 2N9EB 4GB9A 2LEKA 2M1MA 3LDZE 3AMZA 1E8YA 1J7CA 3C19A 5HHDG 2CHWA 4J6IA 2WX1A 3OJ4B 5G5GA 2O2VA 3DBLB 4WAFA 2MRPA 3VUYA 2ICIA 2IO0B 1NI2A 1V9JA 1LO5D 4GDKB 4KGTA 3ZJVA 4X57B 4CO7A 4W9IA 1J0GA 3B0AA 4DDGD 2KC2A 4MSMB 1WYWB 2ZZPB 2DYMA 3MHSD 1TT5B 5T8IA 4FN2A 3P4PB 4MEMA 3ZTDA 3GZNI 1B9RA 2K9XA 3N1XC 2K0PA 4GDLB 1PQSA 2DYBA 3PRZA 4B6WA 3IAS1 4BKGA 2D3BA 3ZIMA 3T3OA 1P1AA 3PLUA 2JYTA 4MGZE 1P0RA 2V4LA 1HA5A 2IGDA 4I6NB 2HE7A 4KIKB 1JWBD 1C4AA 1OEYJ 1YD8U 3AB5A 1ZKHA 3KWVA 5G5HA 3FILA 1QZEA 1YN3A 4OZCA 3VUXA 5AEKB 1QOGA 4HJKA 4HK2A 1I4RA 2MA9B 1MPEA 3RUIB 2O6VA 3ONSA 4RMAA 4XDDA 3QIJA 4G11A 3RT3B 2WU2B 2KT7A 4M00A 5LLIA 1EWCA 1KF6B 1GC7A 4IM3A 2M8SA 1QT9A 2K8CA 2K6DB 1F1HA 2KWCA 2AQ3B 2V3NA 4USAA 1I4XA 3U4EG 2LGDA 1V80A 4CQNA 2LXCA 3AE7B 1K51A 3AE1B 2IYDB 2WXQA 4BAXA 1WX9A 2LHEA 1UBQA 2LUEA 3DPDA 2ZVNA 3JYUA 5BYQA 4K81A 4G3XB 3QJZA 2L32A 1NYQA 3U30A 4NJ6A 1BT0A 1DYQA 3Q8EA 1SF0A 1AARA 2MEKA 4JQWC 1E7VA 1EU4A 4W9EA 5DPSA 1WSPA 1I7HA 3RNGC 2INCC 1T3QA 4KZCA 3J9CA 2KN4A 2RDGA 1YN4A 4Q2JA 1Q5WB 2KTFA 3AN1A 3H9DA 2BYTA 1VR9A 1IYFA 2GLSA 2D2QA 3V6EB 3URYA 2FIDA 2L3ZA 3GS2A 2BS2B 1TKYA 2JWUA 4N58A 5CHWA 1FFUA 3BVMA 3KWLA 4N6EB 3EECA 1SGHA 3WIMA 3WANA 2WS3B 3TMPB 1J7AA 3Q3MC 1JWUD 1TJEA 3DDCB 3IT4B 4J3OD 3U2SC 3IT6B 1Z2MA 2MW5A 1MJDA 4JGHB 5E6NA 5IAAC 4PYZA 1HQRD 1WMHA 3AEFB 2G3QB 3LB8C 2WP9B 2DBYA 2HDEA 3RMKC 1Q10A 2QDFA 4GDKA 1VRAB 3R7QA 3WAOA 3PO0A 3VR8B 3AE2B 2KHWB 1JRPA 3NVZA 2LGIA 4BOZB 2FUG1 2KWDA 1ACCA 1WXSA 4YTMB 2D07B 1N60A 2LJIA 3B1LX 5HG2A 3E9SA 2KTRB 1FFVA 3JVZX 2OJRA 4NQLB 2UYZB 3ZLZA 1NVID 4A8XC 1WF9A 1N62A 4C4VB 1FO4A 2AQ1B 2Y5BB 4FJVB 2JY6A 1FCCC 1ZP0B 4WJQA 2CU3A 1UGJA 4LDTD 1RFKA 2I1KA 4E71A 3UIOB 1RYJA 2Q5WD 1ZPSA 4DXAB 4MH0E 2NTSA 1RRBA 4H2AA 5IOIA 4MELA 3AI5A 4TSSA 1XQQA 4RF0A 1RFAA 5G55A 3AEEB 1TS2A 4KDIC 3EHVA 3CSFA 3WA0A 2ZCCA 4W9HA 4ZRJA 2NTTA 4WJNA 3UINB 3H8HA 4XGAB 3PRMB 3DQVA 2IO3B 3U7ZA 4PYUA 2K3UA 2VH2A 5JXVA 4OVVA 2JUOA 2LRUA 2D10A 1V86A 3A1QA 4K7WA 1VZ8A 1PYWD 1WFYA 1D5XC 4L23A 2CR5A 1EO6A 3DBRB 4MM3B 2NCNA 1EWYC 2QCZA 5DPRA 3RNBC 2LGXA 1OFFA 1HTOA 4II2B 1JWMD 4XC2A 2K8HA 4TKNA 3EFUA 1C4PA 2FNJB 1E90A 2D11A 1L0XB 1P7FA 3TUOA 1LQBA 1NI3A 2RGFA 1STEA 3W5UB 3SD5A 4MACA 1RM6C 2K5PA 5E6PA 2KKCA 1T0RC 2KXJA 2AL3A 5E6OA 1JMLA 1NENB 3M62B 1YJJA 1V6EA 4RGNA 2KO3A 1XLQA 3MC9A 4NAWB 3ENEA 2QC8A 3LXFA 1T6BX 4W9LA 1E7UA 4FBJB 2KDFB 4RM9A 1WZ3A 1KM7A 4KKJA 4PS3A 2MWSB 2YEPF 2V4IB 3L17A 1N61A 3ALBA 1CJEA 2VZKD 3Q8CA 4A6QA 1WJUA 1MI0A 3DHGC 4PS7A 4AWJA 4KSLC 5HI1A 4LJOB 3PHWB 5JHAA 2KC1A 2WXNA 1F2RC 1WXQA 3I3TB 4RGMA 4DK5A 3UIPB 1V97A 1EUVB 4FXCA 2UWQA 2L83A 4N59A 2M56B 2MLBA 4BVUC 4DHJD 1N5XA 2LUMA 2ACZB 2DAJA 2JVCA 2D5GA 3K9PB 3M95A 4ITKA 2DWQA 4P6VF 1F77A 4NJCA 1L6VA 1F52A 3APDA 1D5MC 2ZJDA 3T9LA 2K6QA 4UDUC 2AYOB 3NS1A 3FAHA 3NUHB 3BYTB 2IZVB 2WHIA 1GG3A 3OG5A 1IBXA 4KX6B 4ANXA 4HROA 3JSVA 1RAXA 4DHZE 3ZNGC 4LNKA 1C79A 5IP4D 3MFGA 3NJTA 4GLSC 2L00B 4M0WB 1X1MA 1WGYA 2ZNVB 3U7DA 1GUAB 2MBBB 5FR6A 3ZXVA 3PS6A 4JE3B 2GBNA 2DENB 5HFYA 3SHQA 2JU6X 3CF6E 1JWAD 1YQ3B 2NPTB 3L10B 1FPYA 2AQ2B 1R4NI 2NMQA 4LJPB 3AM9A 3I57A 3P1MA 2MH7A 5D6JB 2N9LA 1I4PA 4I6PA 2C9WB 4FADA 3UQAA 4ZOHC 2W54A 2BW2A 3CIRB 2BGFA 2Y5CA 1SIJA 1TY2A 3KUDB 3Q3OC 3U52E 2BPSA 1NEKB 2JWZA 2WDQB 2BWFA 4KSKC 4GMVA 2QSDA 1XEEA 2KMCA 4C80A 4E3CA 3NVVA 3T8MA 2QHOA 3DCGA 4IOIE 1V5TA 1U4AA 1YJ1A 4FA6A 2SAKA 2SEBD 2KJ6A 2M4NA 1L6UA 2AWTA 2M17A 4YSZB 3ZRFA 1BUIC 5D94A 3KVFB 3PV1A 4DBGA 2N1VA 1JQ4A 2NVUI 3P4QB 4GXBA 5L95C 2MP2A 2JRHA 4PK1A 2KJHB 2ZEQA 1ROEA 1F2RI 4ANUA 2YEPB 3UQBA 5CTRC 2QMTA 1C9FA 5C1ZA 3VH4B 1AYFA 3KLSX 4FJYA 4YSYB 2INNE 2ZW0A 4MGKE 1OQYA 4WQMA 2MJ3A 2G4SA 3NG0A 1WRIA 1Y8RC 1MFWA 1WH3A 1YJIA 2N7JA 1S1QB 1WRDB 1PGBA 4S17A 2KDBA 3PZ7A 4FJZA 2D3GA 5EDSA 3RZFA 1GOZA 1Y56A 3L0WB 3ML9A 1ZDXA 1TS3A 1SXTA 2BB6A 2UU7A 3NY5A 2KFKB 2PVGC 5JH5C 3FC4A 1PFDA 3Q3FA 4XWWA 2LXAA 1UBIA 1KLGD 1PGAA 3QHTA 4LDTB 3KQ4A 3PREA 1E8ZA 2L1AA 4F8CB 1KLUD 2LI5A 5LXHA 1F9JA 2R2QA 2QIEB 5DPTA 2IO2B 3N1YC 1EF5A 1XXGA 2HTME 3R7RA 3RNFC 5BMHA 2WXPA 2L0FA 4O1NA 2G9HD 4E74A 2O6VD 3I9V1 4XZ4A 2BBCA 4ASWC 1JRUA 3KUCB 2RPVA 3ZJTA 4P7IA 1XO3A 1BXTA 3W2DA 1L7YA 2VZKB 4WH4A 4TUUA 2LGYA 4W9GA 2J0MA 4HEA1 2XBBC 3B2FA 4MT5A 2JRIB 4WWNA 1FD6A 4LNIA 2BVCA 2GB1A 3B9JA 3VDZA 3PTFC 3CWIA 1NBFC 1RLFA 2WDVB 3PT2B 2WWZA 5BO4B 1E9MA 3TBLD 1XCQL 4LK0M 2N9XA 4WIPA 3NVWA 5JZEB 4ZRQA 4FHKA 5J18A 3VHTC 3GB1A 3V3XA 1E0ZA 1L4ZB 1YN5A 4ICUA 4DXFA 4W9FA 3O13A 2ZNVC 3HVDA 3DOWA 1WGDA 1J7BA 2PVOD 5EE0A 2GBKA 2FE8A 2R2OA 2J53A 3O65B 4K1RB 2HJ8A 2CKHB 3A9JA 2AX5A 1K8RB 1VD2A 3C0RB 3PRPB 3MHZA 1SEBD 1QKZA 1P3QU 2W3SA 2Z0DB 2IBIB 5D7GA 1CZPA 1JROA 1A70A 1XLPA 4US9A 1UZXB 1F0ZA 3R8BA 4II3B 1WJ4A 4RGOS 4OZAA 2TSSA 2BQQA 1YQBA 4QAYA 1WJNA 1WR6E 4IWQA 2N1WA 4HWIB 1I42A 3ETRA 1TZ1A 2IJ0A 3SDLC 5CHVC 3RN9C 2I38A 5E6JA 4BBNC 5J2RA 1TKEA 5AZFA 2W82A 1DGJA 3TEYA 2MBQA 4HKZE 2ONQA 4K7UA 3Q8BA 4ACFA 1R4NB 2BYVE 4C7ZA 1KLVA 2LFIA 1SJED 2QILA 3L54A 2KZRA 1V49A 4HCNB 2KX3A 3GOEA 3I63C 4YT0B 4HKQA 4IUMB 4RCOA 2HJ1A 4RFBA 3ZGZA 2REXA 4A20A 2WDRB 3ECIA 2IY1B 1WX8A 2PE6B 4D2KA 3R2TA 4XE0A 3VVWB 3GE3C 2WXLA 4NY0A 2GOWA 2XNAC 3L4PA 4EUTA 3DVNV 4REZA 3IBEA 3MTNB 2D3AA 2AEHA 1D5ZC 5BYSA 4EZLA 1XLOA 2JX5A 2KD0A 2N4FA 2D3CA 3AE4B 4BOSC 1MG4A 4JWSC 2JSVX 2ZPNA 1ZDVA 3R2IA 1QOFA 1LXDA 2FUHB 1SB3C 1TS5A 2MP2B 1VLBA 2RMMA 2WDTB 3BYYB 2LWPA 1WWTA 1YX5B 4M8MA 3ABVB 3BK1A 2N0SB 2BTEA 1FRRA 3PLVA 2WXKA 4RGTA 1S3SG 2QJLA 1KFYB 2G1EA 3VR9B 4C56C 2FCMA 3IHPC 1V1OA 4JIOU 3RFZB 1SBBB 1IP9A 4ICVA 2KANA 2RD0A 3APFA 1L0YB 2AL6A 2H88B 1IUEA 1KH0A 3N1ZC 3APCA 2KDIA 2INPE 4GDLA 4MJSA 2FAZA 4FHJA 4A55A 3UF8A 2DX5B 3E56A 3NS8A 1TKGA 4DWFA 2FCQA 2JPHA 4NJ7A 2KWUB 1TS4A 3PSEB 3LYYA 4MSQB 1V81A 1I35A 2RDHA 5FR3A 5D3DA 3NHEB 1YMHE 3AEDB 4ZRIA 3DWMA 3MJ5A 2W3RA 1ISNA 2WX0A 4W9CA 3BK2A 1P98A 1EF1A 4EE2A 3VAWA 1PGXA 3IFWB 4HPLB 3VQIA 5H8YE 3CSTA 3ML8A 2WU5B 1NYRA 5D2MB 3JSVB 4JL9A 2PEAA 3HRDD 2RPQA 3LJ3A 2WXMA 4MM3A 1IPGA 1AW7A 2BS3B 1SIFA 4TV3A 2M0XA 3C8YA 3WALA 5D3IB 3PZDA 1GB4A 1MG8A 2WQYB 4MGIE 3N9YC 1YOVB 4G50A 3MJWA 2OJWA 1A5RA 4P16A 2JXXA 3OWEB 3CMMB 2DHZA 5LXIB 2C7MB 3RI7C 2MBHA 3RULA 4BZAA 3OAWA 1NDDA 5I4DA 1XLNA 2A5UA 4MJSB 2CHZA 3V61A 4IC7B 4EFOA 3A33B 1L0VB 4CYEA 2L76A 3PPAA 2KFJA 2MSED 3L16A 2HTHA 3BZDB 4AJYB 4XX5A 3P4SB 4XWTA 3BVGA 1FCLA 4OVUA 2NR2A 4BFRA 1UD7A 1JWSD 1K50A 3GZNB 4S0RA 1R7SA 4KDLB 4L2YA 1OGWA 4IKGA 4G0NB 2M0AA 3T3NA 3HM6X 1WXMA 1WI0A 3TL5A 2DYOA 4AJWA 4M02A 4WWPA 2FBWB 4DQOC 4XDCA 4OZBA 1FIQA 1C78A 1HE8A 3DBHI 3FKYA 1TYGB 2NPTA 1WMHB 1ZE3D 2DZIA 4HVBA 3WAMA 1UNSA 2R61A 5KHOA 3X23A 1WR1A 3W1SA 1M94A 2X38A 2NBUA 1FNWA 4ANVA 3GE8C 3A9KB 2C7NB 2KQSA 3A4RA 3IVFA 2WXJA 2N7DA 3UI3A 2KOXA 4LTUA 1YIWA 3Q2AC 2KYWA 3ZQ4A 2K1FA 1GB1A 4IWOA 3A4SC 4I6LB 2J42A 1UUPA 2B3AA 4ZYNA 3DVNU 1SSNA 1WXVA 2WGSA 4B9KA 1OQQA 1WXAA 3KW5B 1E7PB 2XEWA 2I1JA 2MQJA 3K9OB 2CJNA 3HHMA 2X8XX 1FRDA 1DOXA 3U8ZA 1R4MB 2LGSA 5KHQA 3OLMD 5J17A 4GGQA 4OHJA 3SFDB 4BBNF 4IW0A 2KAJA 3VXWA 1L4DB 4DHJB 5BYRA 4KVGB 1WE7A 4DDID 1EU3A 1M4VA 4YTPB 4C4VA 1JALA 2KMMA 5GXGB 1B1ZA 4WURA 4EOYA 4URKA 2JF5A 4OW0A 2J0JA 2E6XA 2KTRA 5HKHA 5LNK1 3ZXRA 3DBRI 2JQRB 4BKTA 5CX3A 4TQ1A 3MC0B 1T0YA 2LASA 4K3BA 2KVRA 3EFCA 1JW9D 2JXTA 2Z59B 5AZHA 5FK9C 2BWES 2WXFA 2KQ7A 4WAAA 3V05A 4AUQC 2IY0B 3Q3NC 4GIVA 3W1YA 4RH6A 3N32A 1TBEA 3ZDMC 2GBMA 2I2YA 1UH6A 1WM3A 2L7RA 2VRRB 3ZVVA 2YLMA 5TSSA 3KYCD 2JZPA 4NQKE 2KLGA 4EZKA 3ZNZB 1FXTB 4AQ7A 2EMSA 3ZNID 4ARIA 3H6NA 5BMIA 2JYEA 3OJ3A 4KIKA 4NAWA 4NZLB 4B0MA 1E5WA 3MP9A 2NBWB 3S2AA 1GPXA 3DHHC 1OTRB 3SU8X 3QC8B 3WCQA 1ESFA 1V8CA 3X0WA 5C3JB 1E8XA 2HD5B 1XCTL 4GSWA 3BIID 2NBVB 2BYEA 4A3PA 2OHFA 1VCBA 2J0KA 2RDBC 4LNNA 2N9PC 3RNCC 4WJPA 3GP7A 4BKSD 3L08A
chains in the Genus database with same CATH topology
4D2KA 1NI3A 1STEA 3R2TA 1V1PA 3W5UB 4XE0A 5EE3A 3AE3B 2WXLA 4MACA 1RM6C 2K5PA 2XNAC 3AE5B 3L4PA 4REZA 4YSXB 1N63A 1JMLA 4DXGA 1NENB 1YJJA 4RGNA 1VZ6A 3NVYA 1VZ7A 1EM7A 4IDIA 1N5WA 2ON8A 1C4CA 1D5ZC 5BYSA 1XLQA 1K53A 4OVZA 2B76B 2KQ4X 2V0GA 1P7EA 1XLOA 4NAWB 3LXFA 2JX5A 4ZYSA 4LLGM 1SE2A 2BB5A 1T6BX 3AE4B 2WXGA 4JWSC 2JSVX 1ZDVA 3R2IA 1HZ6A 1K52A 1QOFA 1ZUD2 4ZHPA 3P42A 1QLBB 1SB3C 1TS5A 4KKJA 1VLBA 4KKIA 3IAM1 2RMMA 2YEPF 2J4XA 2LHDA 2V4IB 1N61A 3BYYB 1CJEA 1VJKA 3P63A 2VZKD 1WWTA 3Q8CA 1SE3A 3ABVB 4A6QA 1WGKA 3BK1A 2N0SB 1MI0A 2K22A 1FRRA 1ET9A 4HRSA 2BTEA 5EE9A 2WXHA 3DWGC 5HI1A 1JCKB 5C2TB 1HXYD 2QEJC 4WWMA 1MVKA 3HVZA 2OEDA 3EA6A 2WXNA 2WXKA 1F2RC 4RGTA 1WXQA 2QJLA 4RGMA 1KFYB 2IDYA 2G1EA 3VR9B 1V97A 4C56C 4FXCA 1V1OA 1DOIA 2L83A 4N59A 1AN8A 3RFZB 1SBBB 2M56B 2WNMA 4ZRPA 1L0YB 1IBXB 1N5XA 1QOBA 3AECB 2LUMA 2H88B 5H92C 2ACZB 2D5GA 1IUEA 1YQ4B 1KH0A 4M0WA 4US8A 4ITKA 2DWQA 3P4RB 2INPE 4P6VF 1F77A 1I4GA 4NJCA 1L6VA 4A55A 3AH7A 2WXOA 3E56A 5BMGA 1TKGA 1E10A 1D5MC 4R3DA 3Q69A 1D6EC 3TEZA 4UDUC 1MHHE 1PUTA 3IXSA 1TS4A 2KACA 2PW9A 3NS1A 3FAHA 2E3TA 3LYYA 1KRHA 3NRZA 4A9AA 3NUHB 3BYTB 4TMAB 2RDHA 5FR3A 1IBXA 1I4HA 4KX6B 2L52A 5D3DA 4HROA 2LEKA 3NZ3A 3W5VB 3AEBB 1C79A 3AMZA 1J7CA 1YMHE 3MFGA 3AEDB 5HHDG 3DWMA 3MJ5A 2W3RA 4GLSC 5G5GA 3BK2A 1FXAA 3HUIA 4WAFA 5MPOA 4EE2A 3AE6B 2ICIA 1LO5D 4GDKB 1PGXA 4KGTA 3ZJVA 3VQIA 1OQRA 5H8YE 4JE3B 2WU5B 5HFYA 1NYRA 1KTKA 2JU6X 1JWAD 2DYMA 1YQ3B 5T8IA 2AQ2B 3P4PB 2NMQA 3HRDD 2WXMA 1B9RA 1I4QA 2K9XA 2N9KA 2K0PA 3AM9A 1AW7A 3I57A 4GDLB 2BS3B 3P1MA 3VRBB 2MH7A 2N9LA 4KGRA 1I4PA 3C8YA 3IAS1 5D3IB 4JWUC 3T3OA 3W9CB 1GB4A 4ZOHC 2JYTA 2WQYB 2W54A 2BW2A 3N9YC 3CIRB 4PT5A 2Y5CA 1HA5A 2IGDA 1SIJA 1TY2A 4P16A 1JWBD 3SEBA 1C4AA 3U52E 3OWEB 3AB5A 1NEKB 2WDQB 3KWVA 5G5HA 2IGHA 3FILA 2QSDA 1XEEA 4C80A 1YN3A 4OZCA 2EELA 3NVVA 2Z8LA 3AEAB 1QOGA 1TZOA 4IOIE 5I4DA 3AEGB 1I4RA 2SAKA 1XLNA 1MPEA 2SEBD 3BVZA 4AS1A 1TY0A 1L6UA 1L0VB 4YSZB 1ENFA 4YWGG 4XDDA 1BUIC 1C76A 1HEZE 1GAQB 3ZJUA 2WU2B 3BZDB 4HJGE 1JQ4A 3EUB2 3P4SB 2IGGA 2Y3AA 3P4QB 4XWTA 1EWCA 1KF6B 1CQVA 3ZYYX 1YNTE 3BVGA 1ROEA 1FCLA 1F2RI 2YEPB 1QF6A 1JWSD 1K50A 1QT9A 2QMTA 1R7SA 3Q8AA 3AE9B 1FMAD 1C9FA 4L2YA 4IKGA 1AYFA 3KLSX 4YSYB 2AQ3B 2INNE 1IGDA 2V3NA 2ZW0A 1I4XA 4USAA 3U4EG 2W55A 4WQMA 2MJ3A 4CQNA 2M0AA 1WRIA 3T3NA 1YJIA 3AE7B 2N7JA 1HZ5A 2DYOA 1K51A 3AE1B 2WXQA 1PGBA 3PZ7A 1WYGA 2FBWB 2LHEA 4DQOC 4XDCA 2J52A 1GOZA 5BYQA 4OZBA 1Y56A 1FIQA 1C78A 1AWDA 4C7YA 1FNVA 2LMCA 1TYGB 1ZDXA 1ET6A 1SXTA 1TS3A 1V1PB 2BB6A 1ZE3D 2L32A 3TSSA 1NYQA 2EKIA 2PVGC 3FILB 2Y5PA 3FC4A 1DYQA 1ZOYB 3Q8EA 5FKAC 2MJDA 1PFDA 1UNSA 1L5PA 1SF0A 2R61A 3SR6A 4XWWA 1KLGD 1SE4A 2MEKA 1PGAA 3W1SA 1D4BA 2X38A 3KQ4A 1EU4A 1FNWA 2L1AA 1WSPA 1I7HA 1KLUD 1IGCA 4RNAA 1T3QA 2QIEB 1FXIA 3J9CA 2KN4A 2RDGA 1BMLC 1YN4A 2WXJA 4Q2JA 3AN1A 1XXGA 2HTME 3UI3A 2BYTA 4LTUA 1VR9A 5BMHA 3ZQ4A 1GB1A 2WXPA 4KGSA 3URYA 4O1NA 2G9HD 3GS2A 2J42A 2BS2B 1TKYA 3I9V1 2JWUA 1UUPA 2BBCA 4N58A 4JPSA 1FFUA 2RPVA 3BVMA 1ZXIA 1SSNA 3ZJTA 1XO3A 1E6EB 1BXTA 3W2DA 1SJHD 3KWLA 1OQQA 2VZKB 4N6EB 3AE8B 2PMVA 1E7PB 4WH4A 2GRIA 4HEA1 2WS3B 1PDXA 1J7AA 2BS4B 1JWUD 1TJEA 4J3OD 3B2FA 3IT4B 3U2SC 4MT5A 2H89B 2CJNA 3IT6B 4MH8A 1FD6A 1FNUA 1ZXHA 1FRDA 1DOXA 5EE1A 2GB1A 3B9JA 3CWIA 4OHJA 3Q8FA 3SFDB 1XF5L 4B0EA 2PIAA 1HQRD 1MHXA 2KAJA 2WDVB 3AEFB 1T5XD 1L4DB 1UWXA 2WP9B 3LB8C 3PZ8A 5BYRA 2XN9C 2DBYA 2HDEA 2PKOA 1E9MA 4RF1A 1Q10A 1XCQL 2MJEA 1EU3A 1VRAB 1M4VA 2M19A 3PO0A 4LK0M 4YTPB 1JALA 3VR8B 2KMMA 5GXGB 3AE2B 4WIPA 2DLBA 3NVWA 1JRPA 1B1ZA 4ZRQA 3NVZA 2GI9A 2LGIA 4WURA 2FUG1 2KWDA 1ACCA 4YTMB 3GB1A 3V3XA 1E0ZA 1L4ZB 1YN5A 4OW0A 3BWUD 1N60A 2E6XA 2LJIA 4DXFA 3TEWA 3O13A 5HG2A 3E9SA 3HVDA 1FFVA 1J7BA 2PVOD 5LNK1 5EE0A 2FE8A 2J53A 2JQRB 5AUKA 1QOAA 2BT6A 4TQ1A 2AX5A 2WXRA 3MC0B 1NVID 4A8XC 1JW9D 2JXTA 1N62A 1DOYA 1FO4A 2WLBA 5FK9C 2AQ1B 2WXFA 1FCCC 3V05A 1ZP0B 4NAMA 3MHZA 1FM0D 1SEBD 1QKZA 3EGRA 2CU3A 1UGJA 2IPKD 2PTLA 2W3SA 4RH6A 2ZW1A 2PLPA 5D7GA 1CZPA 1RFKA 2I2YA 1CK1A 1JROA 1A70A 5TSSA 1XLPA 3GP7A 4L1BA 2KDMA 4US9A 1RYJA 2Q5WD 1ZPSA 4ARCA 1F0ZA 3R8BA 2NTSA 2JZPA 4H2AA 5AUIA 2WXIA 4RGOS 4OZAA 3RPFC 4TSSA 2TSSA 4RF0A 3B2GA 4AQ7A 3SFEB 4ARIA 3AEEB 3ETRA 1TS2A 5BMIA 2IJ0A 3AV8A 2JYEA 2I38A 1QQRA 5E6JA 4NZLB 2NTTA 1TKEA 4B0MA 2W82A 3MP9A 1DGJA 3H8HA 3TEYA 3U7ZA 5JXVA 2K3UA 1GPXA 4HKZE 4JX1C 2ONQA 3Q8BA 4A90A 3WCQA 1ESFA 3TEXA 1VZ8A 1PYWD 1V8CA 3VRAB 4TQ0A 5C3JB 1D5XC 4C7ZA 1QILA 4L23A 4MM3B 1FEHA 1UWMA 1XCTL 1EWYC 2CJOA 2LFIA 3BIID 1SJED 1OFFA 2QILA 2V3PA 1JWMD 4YTNB 4ZHOA 1VDVA 1C4PA 2OHFA 4YT0B 4HKQA 1L0XB 4RCOA 1C77A 4RFBA 1P7FA 4YXDB 3ZGZA 3TUOA 1RWSA 2WDRB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KMM A;  5GXG B;  3AE2 B;  3W5V B;  3NVW A;  1NI3 A;  2W55 A;  3AEB B;  1JRP A;  3AMZ A;  4WQM A;  2MJ3 A;  1J7C A;  3W5U B;  3NVZ A;  5EE3 A;  1WRI A;  3AE3 B;  3AED B;  1YJI A;  1RM6 C;  3DWM A;  2K5P A;  4YTM B;  2W3R A;  3AE7 B;  1E0Z A;  3AE5 B;  3L4P A;  3AE1 B;  5G5G A;  1N60 A;  1FXA A;  3HUI A;  4YSX B;  1N63 A;  1WYG A;  5MPO A;  2FBW B;  1NEN B;  1FFV A;  1J7B A;  1YJJ A;  2PVO D;  3AE6 B;  5EE0 A;  3NVY A;  1FIQ A;  2JQR B;  5AUK A;  4IDI A;  1N5W A;  1OQR A;  1QOA A;  5H8Y E;  1AWD A;  4C7Y A;  1XLQ A;  2WU5 B;  2BT6 A;  3VR8 B;  2AX5 A;  1TYG B;  1NYR A;  1NVI D;  2B76 B;  1JW9 D;  1N62 A;  1XLO A;  1JWA D;  1DOY A;  1YQ3 B;  1NYQ A;  3LXF A;  2JX5 A;  2WLB A;  2EKI A;  1FO4 A;  2PVG C;  3P4P B;  3HRD D;  3FC4 A;  1B9R A;  1ZP0 B;  1ZOY B;  3AE4 B;  1FM0 D;  1PFD A;  2K9X A;  1L5P A;  1SF0 A;  2MJD A;  3AM9 A;  4JWS C;  2BS3 B;  2CU3 A;  3P1M A;  3SR6 A;  3VRB B;  2MH7 A;  1QOF A;  1ZUD 2;  4ZHP A;  2W3S A;  1QLB B;  1SB3 C;  1CZP A;  1I7H A;  1RFK A;  1VLB A;  4YTP B;  4JWU C;  1JRO A;  1A70 A;  1T3Q A;  2QIE B;  1XLP A;  1FXI A;  3W9C B;  1N61 A;  4US9 A;  4ZOH C;  1VJK A;  1CJE A;  1RYJ A;  2Q5W D;  2WQY B;  2W54 A;  3P63 A;  1F0Z A;  1WWT A;  3CIR B;  3ABV B;  3AN1 A;  5AUI A;  2HTM E;  1WGK A;  3RPF C;  2N0S B;  4LTU A;  2K22 A;  1FRR A;  4HRS A;  2Y5C A;  5EE9 A;  3DWG C;  1SIJ A;  3B2G A;  5C2T B;  4WWM A;  3SFE B;  1JWB D;  3HVZ A;  3AEE B;  3ETR A;  2BS2 B;  1TKY A;  3AB5 A;  1NEK B;  1WXQ A;  2WDQ B;  3AV8 A;  5G5H A;  2QJL A;  4N58 A;  1KFY B;  2G1E A;  3VR9 B;  1FFU A;  4C80 A;  1ZXI A;  1V97 A;  4FXC A;  1XO3 A;  3NVV A;  1E6E B;  1DOI A;  2L83 A;  3AEA B;  1TKE A;  4N59 A;  2M56 B;  1DGJ A;  3KWL A;  1QOG A;  1OQQ A;  1N5X A;  3AEG B;  4N6E B;  3AE8 B;  4JX1 C;  1E7P B;  1QOB A;  3AEC B;  1XLN A;  1GPX A;  2H88 B;  5H92 C;  2ACZ B;  2WS3 B;  1PDX A;  1J7A A;  2BS4 B;  3WCQ A;  1L6U A;  1IUE A;  1TJE A;  3B2F A;  1YQ4 B;  1L0V B;  2CJN A;  2H89 B;  4YSZ B;  4US8 A;  1V8C A;  4ITK A;  3VRA B;  2DWQ A;  1FRD A;  5C3J B;  3P4R B;  4C7Z A;  4P6V F;  5EE1 A;  1DOX A;  1GAQ B;  2WU2 B;  1UWM A;  1L6V A;  3B9J A;  3AH7 A;  1EWY C;  2CJO A;  3BII D;  1JQ4 A;  3EUB 2;  3P4S B;  3P4Q B;  1OFF A;  1TKG A;  3CWI A;  1KF6 B;  3SFD B;  1E10 A;  2PIA A;  4YTN B;  2KAJ A;  2WDV B;  3AEF B;  3ZYY X;  4ZHO A;  1VDV A;  1ROE A;  2OHF A;  1PUT A;  3LB8 C;  2WP9 B;  3NS1 A;  3FAH A;  2E3T A;  4YT0 B;  1KRH A;  3NRZ A;  4A9A A;  1QF6 A;  2DBY A;  1QT9 A;  1R7S A;  2PKO A;  3AE9 B;  1E9M A;  1FMA D;  4YXD B;  1RWS A;  4KX6 B;  2MJE A;  2L52 A;  4HRO A;  1AYF A;  2LEK A;  2M19 A;  2WDR B;  3PO0 A;  4YSY B;  1JAL A;  4USA A; 
#chains in the Genus database with same CATH topology
 4HPP A;  2PPH A;  3DVG X;  5EE3 A;  3AE3 B;  3MC8 A;  4GU2 A;  4YSX B;  4EEW A;  4F7Z A;  4DXG A;  3V60 A;  2A4Z A;  3NVY A;  1EM7 A;  4IDI A;  1N5W A;  2LJ5 A;  2ON8 A;  4XYC A;  4OVZ A;  2B76 B;  2KQ4 X;  2V0G A;  1P7E A;  4ZYS A;  1T0S C;  2JZ3 B;  1P9D U;  2JT4 B;  2WXG A;  3W1S C;  5DPW A;  1K52 A;  1ZUD 2;  2L05 A;  4K7S A;  4ZHP A;  1QLB B;  4KKI A;  4WJO A;  1D3Z A;  2LHD A;  3ZKJ C;  1VJK A;  4IM2 A;  1WGK A;  3DVG Y;  4IWP A;  5L83 A;  2MX2 A;  4HRS A;  1JCK B;  5C2T B;  4WWM A;  1MVK A;  3EA6 A;  1J8C A;  1XD3 B;  2IO1 B;  4LNF A;  1AN8 A;  3QX1 A;  4RM8 A;  1H8C A;  2WNM A;  3DBH B;  4HLE A;  3V6C B;  1QOB A;  3AEC B;  3P2B A;  2FIF A;  3ZO5 B;  3KYD D;  2KJR A;  3ZUN A;  1HTQ A;  4US8 A;  3P4R B;  4MDK E;  1I4G A;  4GOC A;  3N3K B;  3AH7 A;  2WXO A;  1E10 A;  3Q69 A;  5IA7 A;  1D6E C;  1PUT A;  4W9J A;  2KAC A;  1H4R A;  2E3T A;  1KRH A;  3NRZ A;  3RNE C;  3H7P A;  2KN5 A;  4TMA B;  3NZ3 A;  2LZ6 A;  3W5V B;  3AEB B;  5IN7 A;  4ZRK A;  4KZ0 A;  5G2N A;  1FXA A;  2C7H A;  3HUI A;  2KX0 A;  5MPO A;  3AE6 B;  3IG3 A;  1C1Y B;  1UEL A;  2G45 B;  1WX7 A;  3B08 A;  1OQR A;  1LGR A;  3H7P B;  4HCP B;  5CHF A;  3Q3J A;  1KTK A;  1OEY A;  1R4M I;  5GMV A;  4AOF A;  3RCZ A;  3AU5 A;  4HPM B;  4IG7 B;  1I4Q A;  2K25 A;  1J19 A;  2N9K A;  4YL8 A;  3VRB B;  3QA8 A;  4KGR A;  3DHI C;  3R66 C;  2ASQ A;  2GBR A;  4FLH A;  4JWU C;  3W9C B;  4PT5 A;  3ZRC A;  1TIF A;  4CHK A;  4K3C A;  2OOB B;  2K39 A;  1WJ6 A;  3HK0 A;  3H1U A;  4LCD E;  1GNU A;  3PVL A;  3SEB A;  2BF8 B;  2IGH A;  2LVO A;  3QAR A;  2EEL A;  2Z8L A;  3AEA B;  1LM8 B;  2J7Q B;  1TZO A;  3Q14 C;  2CHX A;  3AEG B;  2N7E A;  2MBE A;  4M01 A;  3EC8 A;  4PS8 A;  2KK8 A;  3BVZ A;  4ANW A;  2YVC A;  1TY0 A;  4AS1 A;  1ENF A;  3TIX A;  4YWG G;  2FCS A;  1TGZ B;  1C76 A;  1HEZ E;  1GAQ B;  3ZJU A;  4HJG E;  4W9D A;  3RD2 A;  3EUB 2;  2IGG A;  2Y3A A;  4HDO A;  2V9H A;  1CQV A;  3ZYY X;  1YNT E;  1QF6 A;  4EKU A;  3Q8A A;  3AE9 B;  1FMA D;  1Q0W B;  3QQ8 B;  4DHZ B;  1T0Q C;  2GMI C;  1IGD A;  2W55 A;  2DZK A;  1HZ5 A;  3A9K A;  1WZ0 A;  1WYG A;  2V1Y A;  1LFD A;  2J52 A;  2DNF A;  3VFK A;  1AWD A;  4C7Y A;  1FNV A;  5IKC M;  5IO9 A;  2LMC A;  1ET6 A;  1V1P B;  2BYF A;  3TSS A;  2EKI A;  3DBS A;  3FIL B;  2Y5P A;  3NZU A;  1ZOY B;  5FKA C;  2ZPY A;  2MJD A;  1L5P A;  3SR6 A;  1SE4 A;  3RNA C;  3ZTC A;  1D4B A;  2O2V B;  1GJZ A;  1IGC A;  4RNA A;  1FXI A;  3V62 A;  1BML C;  3WAP A;  4FUL A;  1WM2 A;  4A3O A;  4BKS A;  2JZZ A;  3HM3 A;  4KGS A;  3NZS A;  3L13 A;  4JPS A;  1ZXI A;  4AP4 C;  1GC6 A;  1E6E B;  2KWV B;  4IM0 A;  2PE9 A;  1SJH D;  3DBL I;  4C00 A;  1SE9 A;  3QWZ B;  3AE8 B;  2PMV A;  2KDE B;  2GRI A;  1PDX A;  2MCN B;  2BS4 B;  3RZW C;  2H89 B;  4MH8 A;  4NNJ B;  3QAQ A;  1FNU A;  1ZXH A;  3KUZ A;  5EE1 A;  2RR9 A;  1V2Y A;  3AU4 A;  3Q8F A;  1XF5 L;  4B0E A;  2PIA A;  2WYQ A;  2VH1 A;  1MHX A;  1G6J A;  1Z5S B;  3KH0 A;  1T5X D;  1UWX A;  3PZ8 A;  2XN9 C;  2PKO A;  1C3T A;  4P1C C;  4RF1 A;  2MJE A;  2M19 A;  1KJT A;  4N9F 4;  3AXC A;  5AZG A;  2RSU A;  2DLB A;  2DZJ A;  2GI9 A;  3NOB A;  1XT9 B;  1WGG A;  2EMT A;  3BWU D;  5DCN A;  3PHX B;  3TEW A;  3N20 C;  1WGH A;  3QCA A;  2PJH A;  5AUK A;  2CU1 A;  1QOA A;  2BT6 A;  2MBO A;  2WXR A;  2KFK A;  3M63 B;  1N6Z A;  2NS5 A;  1DOY A;  3BIN A;  3VTV A;  2WLB A;  4NAM A;  1FM0 D;  3EGR A;  2IPK D;  1Q1O A;  2PTL A;  3RYT A;  2L8J A;  3ZDT A;  3TJP A;  2ZW1 A;  2PLP A;  3D32 A;  4ZDV A;  1CK1 A;  2LVP A;  4L1B A;  2KDM A;  1WGR A;  1E8W A;  4ARC A;  2FCN A;  4HXD A;  3HIZ A;  2XK5 B;  5AUI A;  3RPF C;  2WXI A;  2ZVO A;  3B2G A;  2KVZ A;  3BY4 B;  3SFE B;  3PGE A;  4WWO A;  4B95 A;  3AV8 A;  1WIA A;  1QQR A;  3AUL A;  2LVQ A;  4MGY E;  2KNB A;  3VTW A;  3M3J A;  4JX1 C;  4A90 A;  2DZM A;  3TEX A;  3VRA B;  4TQ0 A;  4M8N A;  1QIL A;  3N30 A;  1FEH A;  1UWM A;  1CMX B;  2Z0E B;  2CJO A;  2ZCB A;  2KMA A;  2G4D B;  2V3P A;  4YTN B;  4ZHO A;  3H7S A;  1VDV A;  3A9J B;  1L2N A;  4NPN A;  2IND C;  1C77 A;  4KV2 A;  1TTN A;  2LD9 A;  4YXD B;  1RWS A;  2V3S A;  1ZW7 A;  2CS4 A;  1V1P A;  2XK5 A;  2BKR B;  3AE5 B;  1N63 A;  1VZ6 A;  3JW0 X;  1VZ7 A;  2C5L C;  1C4C A;  4WQO B;  4EZJ A;  1K53 A;  1YX6 B;  2BKF A;  1UGM A;  2EKE C;  4LLG M;  1SE2 A;  2BB5 A;  1WE6 A;  3ZNH B;  3TCA A;  1HZ6 A;  3Q6B A;  3P42 A;  3ZW3 A;  3IAM 1;  2J4X A;  3A1Q B;  2MHJ A;  2L0T A;  3P63 A;  4JLC A;  1SE3 A;  2K22 A;  1ET9 A;  1WY8 A;  5EE9 A;  2WXH A;  4HDQ A;  3DWG C;  1HXY D;  2DAF A;  2QEJ C;  4P1B C;  3HVZ A;  1ZGU B;  2OED A;  5C23 A;  2KLC A;  2C60 A;  2IDY A;  4F1S A;  1DOI A;  3VUW A;  4GN1 A;  2K8B A;  3VTU A;  3UGB B;  3VH3 B;  5H92 C;  3QK0 A;  1YQ4 B;  4M0W A;  1V5O A;  4W9K A;  2LRW A;  1KOT A;  1UF0 A;  2O6V B;  2GBJ A;  2W9N A;  5BMG A;  4R3D A;  5TR5 A;  3I5J C;  3R3M A;  3TEZ A;  1MHH E;  3IXS A;  4ZRP A;  2PW9 A;  1IBX B;  4A9A A;  4LNO A;  5JHB A;  1I4H A;  2L52 A;  2N9E B;  4GB9 A;  2LEK A;  2M1M A;  3LDZ E;  3AMZ A;  1E8Y A;  1J7C A;  3C19 A;  5HHD G;  2CHW A;  4J6I A;  2WX1 A;  3OJ4 B;  5G5G A;  2O2V A;  3DBL B;  4WAF A;  2MRP A;  3VUY A;  2ICI A;  2IO0 B;  1NI2 A;  1V9J A;  1LO5 D;  4GDK B;  4KGT A;  3ZJV A;  4X57 B;  4CO7 A;  4W9I A;  1J0G A;  3B0A A;  4DDG D;  2KC2 A;  4MSM B;  1WYW B;  2ZZP B;  2DYM A;  3MHS D;  1TT5 B;  5T8I A;  4FN2 A;  3P4P B;  4MEM A;  3ZTD A;  3GZN I;  1B9R A;  2K9X A;  3N1X C;  2K0P A;  4GDL B;  1PQS A;  2DYB A;  3PRZ A;  4B6W A;  3IAS 1;  4BKG A;  2D3B A;  3ZIM A;  3T3O A;  1P1A A;  3PLU A;  2JYT A;  4MGZ E;  1P0R A;  2V4L A;  1HA5 A;  2IGD A;  4I6N B;  2HE7 A;  4KIK B;  1JWB D;  1C4A A;  1OEY J;  1YD8 U;  3AB5 A;  1ZKH A;  3KWV A;  5G5H A;  3FIL A;  1QZE A;  1YN3 A;  4OZC A;  3VUX A;  5AEK B;  1QOG A;  4HJK A;  4HK2 A;  1I4R A;  2MA9 B;  1MPE A;  3RUI B;  2O6V A;  3ONS A;  4RMA A;  4XDD A;  3QIJ A;  4G11 A;  3RT3 B;  2WU2 B;  2KT7 A;  4M00 A;  5LLI A;  1EWC A;  1KF6 B;  1GC7 A;  4IM3 A;  2M8S A;  1QT9 A;  2K8C A;  2K6D B;  1F1H A;  2KWC A;  2AQ3 B;  2V3N A;  4USA A;  1I4X A;  3U4E G;  2LGD A;  1V80 A;  4CQN A;  2LXC A;  3AE7 B;  1K51 A;  3AE1 B;  2IYD B;  2WXQ A;  4BAX A;  1WX9 A;  2LHE A;  1UBQ A;  2LUE A;  3DPD A;  2ZVN A;  3JYU A;  5BYQ A;  4K81 A;  4G3X B;  3QJZ A;  2L32 A;  1NYQ A;  3U30 A;  4NJ6 A;  1BT0 A;  1DYQ A;  3Q8E A;  1SF0 A;  1AAR A;  2MEK A;  4JQW C;  1E7V A;  1EU4 A;  4W9E A;  5DPS A;  1WSP A;  1I7H A;  3RNG C;  2INC C;  1T3Q A;  4KZC A;  3J9C A;  2KN4 A;  2RDG A;  1YN4 A;  4Q2J A;  1Q5W B;  2KTF A;  3AN1 A;  3H9D A;  2BYT A;  1VR9 A;  1IYF A;  2GLS A;  2D2Q A;  3V6E B;  3URY A;  2FID A;  2L3Z A;  3GS2 A;  2BS2 B;  1TKY A;  2JWU A;  4N58 A;  5CHW A;  1FFU A;  3BVM A;  3KWL A;  4N6E B;  3EEC A;  1SGH A;  3WIM A;  3WAN A;  2WS3 B;  3TMP B;  1J7A A;  3Q3M C;  1JWU D;  1TJE A;  3DDC B;  3IT4 B;  4J3O D;  3U2S C;  3IT6 B;  1Z2M A;  2MW5 A;  1MJD A;  4JGH B;  5E6N A;  5IAA C;  4PYZ A;  1HQR D;  1WMH A;  3AEF B;  2G3Q B;  3LB8 C;  2WP9 B;  2DBY A;  2HDE A;  3RMK C;  1Q10 A;  2QDF A;  4GDK A;  1VRA B;  3R7Q A;  3WAO A;  3PO0 A;  3VR8 B;  3AE2 B;  2KHW B;  1JRP A;  3NVZ A;  2LGI A;  4BOZ B;  2FUG 1;  2KWD A;  1ACC A;  1WXS A;  4YTM B;  2D07 B;  1N60 A;  2LJI A;  3B1L X;  5HG2 A;  3E9S A;  2KTR B;  1FFV A;  3JVZ X;  2OJR A;  4NQL B;  2UYZ B;  3ZLZ A;  1NVI D;  4A8X C;  1WF9 A;  1N62 A;  4C4V B;  1FO4 A;  2AQ1 B;  2Y5B B;  4FJV B;  2JY6 A;  1FCC C;  1ZP0 B;  4WJQ A;  2CU3 A;  1UGJ A;  4LDT D;  1RFK A;  2I1K A;  4E71 A;  3UIO B;  1RYJ A;  2Q5W D;  1ZPS A;  4DXA B;  4MH0 E;  2NTS A;  1RRB A;  4H2A A;  5IOI A;  4MEL A;  3AI5 A;  4TSS A;  1XQQ A;  4RF0 A;  1RFA A;  5G55 A;  3AEE B;  1TS2 A;  4KDI C;  3EHV A;  3CSF A;  3WA0 A;  2ZCC A;  4W9H A;  4ZRJ A;  2NTT A;  4WJN A;  3UIN B;  3H8H A;  4XGA B;  3PRM B;  3DQV A;  2IO3 B;  3U7Z A;  4PYU A;  2K3U A;  2VH2 A;  5JXV A;  4OVV A;  2JUO A;  2LRU A;  2D10 A;  1V86 A;  3A1Q A;  4K7W A;  1VZ8 A;  1PYW D;  1WFY A;  1D5X C;  4L23 A;  2CR5 A;  1EO6 A;  3DBR B;  4MM3 B;  2NCN A;  1EWY C;  2QCZ A;  5DPR A;  3RNB C;  2LGX A;  1OFF A;  1HTO A;  4II2 B;  1JWM D;  4XC2 A;  2K8H A;  4TKN A;  3EFU A;  1C4P A;  2FNJ B;  1E90 A;  2D11 A;  1L0X B;  1P7F A;  3TUO A;  1LQB A;  1NI3 A;  2RGF A;  1STE A;  3W5U B;  3SD5 A;  4MAC A;  1RM6 C;  2K5P A;  5E6P A;  2KKC A;  1T0R C;  2KXJ A;  2AL3 A;  5E6O A;  1JML A;  1NEN B;  3M62 B;  1YJJ A;  1V6E A;  4RGN A;  2KO3 A;  1XLQ A;  3MC9 A;  4NAW B;  3ENE A;  2QC8 A;  3LXF A;  1T6B X;  4W9L A;  1E7U A;  4FBJ B;  2KDF B;  4RM9 A;  1WZ3 A;  1KM7 A;  4KKJ A;  4PS3 A;  2MWS B;  2YEP F;  2V4I B;  3L17 A;  1N61 A;  3ALB A;  1CJE A;  2VZK D;  3Q8C A;  4A6Q A;  1WJU A;  1MI0 A;  3DHG C;  4PS7 A;  4AWJ A;  4KSL C;  5HI1 A;  4LJO B;  3PHW B;  5JHA A;  2KC1 A;  2WXN A;  1F2R C;  1WXQ A;  3I3T B;  4RGM A;  4DK5 A;  3UIP B;  1V97 A;  1EUV B;  4FXC A;  2UWQ A;  2L83 A;  4N59 A;  2M56 B;  2MLB A;  4BVU C;  4DHJ D;  1N5X A;  2LUM A;  2ACZ B;  2DAJ A;  2JVC A;  2D5G A;  3K9P B;  3M95 A;  4ITK A;  2DWQ A;  4P6V F;  1F77 A;  4NJC A;  1L6V A;  1F52 A;  3APD A;  1D5M C;  2ZJD A;  3T9L A;  2K6Q A;  4UDU C;  2AYO B;  3NS1 A;  3FAH A;  3NUH B;  3BYT B;  2IZV B;  2WHI A;  1GG3 A;  3OG5 A;  1IBX A;  4KX6 B;  4ANX A;  4HRO A;  3JSV A;  1RAX A;  4DHZ E;  3ZNG C;  4LNK A;  1C79 A;  5IP4 D;  3MFG A;  3NJT A;  4GLS C;  2L00 B;  4M0W B;  1X1M A;  1WGY A;  2ZNV B;  3U7D A;  1GUA B;  2MBB B;  5FR6 A;  3ZXV A;  3PS6 A;  4JE3 B;  2GBN A;  2DEN B;  5HFY A;  3SHQ A;  2JU6 X;  3CF6 E;  1JWA D;  1YQ3 B;  2NPT B;  3L10 B;  1FPY A;  2AQ2 B;  1R4N I;  2NMQ A;  4LJP B;  3AM9 A;  3I57 A;  3P1M A;  2MH7 A;  5D6J B;  2N9L A;  1I4P A;  4I6P A;  2C9W B;  4FAD A;  3UQA A;  4ZOH C;  2W54 A;  2BW2 A;  3CIR B;  2BGF A;  2Y5C A;  1SIJ A;  1TY2 A;  3KUD B;  3Q3O C;  3U52 E;  2BPS A;  1NEK B;  2JWZ A;  2WDQ B;  2BWF A;  4KSK C;  4GMV A;  2QSD A;  1XEE A;  2KMC A;  4C80 A;  4E3C A;  3NVV A;  3T8M A;  2QHO A;  3DCG A;  4IOI E;  1V5T A;  1U4A A;  1YJ1 A;  4FA6 A;  2SAK A;  2SEB D;  2KJ6 A;  2M4N A;  1L6U A;  2AWT A;  2M17 A;  4YSZ B;  3ZRF A;  1BUI C;  5D94 A;  3KVF B;  3PV1 A;  4DBG A;  2N1V A;  1JQ4 A;  2NVU I;  3P4Q B;  4GXB A;  5L95 C;  2MP2 A;  2JRH A;  4PK1 A;  2KJH B;  2ZEQ A;  1ROE A;  1F2R I;  4ANU A;  2YEP B;  3UQB A;  5CTR C;  2QMT A;  1C9F A;  5C1Z A;  3VH4 B;  1AYF A;  3KLS X;  4FJY A;  4YSY B;  2INN E;  2ZW0 A;  4MGK E;  1OQY A;  4WQM A;  2MJ3 A;  2G4S A;  3NG0 A;  1WRI A;  1Y8R C;  1MFW A;  1WH3 A;  1YJI A;  2N7J A;  1S1Q B;  1WRD B;  1PGB A;  4S17 A;  2KDB A;  3PZ7 A;  4FJZ A;  2D3G A;  5EDS A;  3RZF A;  1GOZ A;  1Y56 A;  3L0W B;  3ML9 A;  1ZDX A;  1TS3 A;  1SXT A;  2BB6 A;  2UU7 A;  3NY5 A;  2KFK B;  2PVG C;  5JH5 C;  3FC4 A;  1PFD A;  3Q3F A;  4XWW A;  2LXA A;  1UBI A;  1KLG D;  1PGA A;  3QHT A;  4LDT B;  3KQ4 A;  3PRE A;  1E8Z A;  2L1A A;  4F8C B;  1KLU D;  2LI5 A;  5LXH A;  1F9J A;  2R2Q A;  2QIE B;  5DPT A;  2IO2 B;  3N1Y C;  1EF5 A;  1XXG A;  2HTM E;  3R7R A;  3RNF C;  5BMH A;  2WXP A;  2L0F A;  4O1N A;  2G9H D;  4E74 A;  2O6V D;  3I9V 1;  4XZ4 A;  2BBC A;  4ASW C;  1JRU A;  3KUC B;  2RPV A;  3ZJT A;  4P7I A;  1XO3 A;  1BXT A;  3W2D A;  1L7Y A;  2VZK B;  4WH4 A;  4TUU A;  2LGY A;  4W9G A;  2J0M A;  4HEA 1;  2XBB C;  3B2F A;  4MT5 A;  2JRI B;  4WWN A;  1FD6 A;  4LNI A;  2BVC A;  2GB1 A;  3B9J A;  3VDZ A;  3PTF C;  3CWI A;  1NBF C;  1RLF A;  2WDV B;  3PT2 B;  2WWZ A;  5BO4 B;  1E9M A;  3TBL D;  1XCQ L;  4LK0 M;  2N9X A;  4WIP A;  3NVW A;  5JZE B;  4ZRQ A;  4FHK A;  5J18 A;  3VHT C;  3GB1 A;  3V3X A;  1E0Z A;  1L4Z B;  1YN5 A;  4ICU A;  4DXF A;  4W9F A;  3O13 A;  2ZNV C;  3HVD A;  3DOW A;  1WGD A;  1J7B A;  2PVO D;  5EE0 A;  2GBK A;  2FE8 A;  2R2O A;  2J53 A;  3O65 B;  4K1R B;  2HJ8 A;  2CKH B;  3A9J A;  2AX5 A;  1K8R B;  1VD2 A;  3C0R B;  3PRP B;  3MHZ A;  1SEB D;  1QKZ A;  1P3Q U;  2W3S A;  2Z0D B;  2IBI B;  5D7G A;  1CZP A;  1JRO A;  1A70 A;  1XLP A;  4US9 A;  1UZX B;  1F0Z A;  3R8B A;  4II3 B;  1WJ4 A;  4RGO S;  4OZA A;  2TSS A;  2BQQ A;  1YQB A;  4QAY A;  1WJN A;  1WR6 E;  4IWQ A;  2N1W A;  4HWI B;  1I42 A;  3ETR A;  1TZ1 A;  2IJ0 A;  3SDL C;  5CHV C;  3RN9 C;  2I38 A;  5E6J A;  4BBN C;  5J2R A;  1TKE A;  5AZF A;  2W82 A;  1DGJ A;  3TEY A;  2MBQ A;  4HKZ E;  2ONQ A;  4K7U A;  3Q8B A;  4ACF A;  1R4N B;  2BYV E;  4C7Z A;  1KLV A;  2LFI A;  1SJE D;  2QIL A;  3L54 A;  2KZR A;  1V49 A;  4HCN B;  2KX3 A;  3GOE A;  3I63 C;  4YT0 B;  4HKQ A;  4IUM B;  4RCO A;  2HJ1 A;  4RFB A;  3ZGZ A;  2REX A;  4A20 A;  2WDR B;  3ECI A;  2IY1 B;  1WX8 A;  2PE6 B;  4D2K A;  3R2T A;  4XE0 A;  3VVW B;  3GE3 C;  2WXL A;  4NY0 A;  2GOW A;  2XNA C;  3L4P A;  4EUT A;  3DVN V;  4REZ A;  3IBE A;  3MTN B;  2D3A A;  2AEH A;  1D5Z C;  5BYS A;  4EZL A;  1XLO A;  2JX5 A;  2KD0 A;  2N4F A;  2D3C A;  3AE4 B;  4BOS C;  1MG4 A;  4JWS C;  2JSV X;  2ZPN A;  1ZDV A;  3R2I A;  1QOF A;  1LXD A;  2FUH B;  1SB3 C;  1TS5 A;  2MP2 B;  1VLB A;  2RMM A;  2WDT B;  3BYY B;  2LWP A;  1WWT A;  1YX5 B;  4M8M A;  3ABV B;  3BK1 A;  2N0S B;  2BTE A;  1FRR A;  3PLV A;  2WXK A;  4RGT A;  1S3S G;  2QJL A;  1KFY B;  2G1E A;  3VR9 B;  4C56 C;  2FCM A;  3IHP C;  1V1O A;  4JIO U;  3RFZ B;  1SBB B;  1IP9 A;  4ICV A;  2KAN A;  2RD0 A;  3APF A;  1L0Y B;  2AL6 A;  2H88 B;  1IUE A;  1KH0 A;  3N1Z C;  3APC A;  2KDI A;  2INP E;  4GDL A;  4MJS A;  2FAZ A;  4FHJ A;  4A55 A;  3UF8 A;  2DX5 B;  3E56 A;  3NS8 A;  1TKG A;  4DWF A;  2FCQ A;  2JPH A;  4NJ7 A;  2KWU B;  1TS4 A;  3PSE B;  3LYY A;  4MSQ B;  1V81 A;  1I35 A;  2RDH A;  5FR3 A;  5D3D A;  3NHE B;  1YMH E;  3AED B;  4ZRI A;  3DWM A;  3MJ5 A;  2W3R A;  1ISN A;  2WX0 A;  4W9C A;  3BK2 A;  1P98 A;  1EF1 A;  4EE2 A;  3VAW A;  1PGX A;  3IFW B;  4HPL B;  3VQI A;  5H8Y E;  3CST A;  3ML8 A;  2WU5 B;  1NYR A;  5D2M B;  3JSV B;  4JL9 A;  2PEA A;  3HRD D;  2RPQ A;  3LJ3 A;  2WXM A;  4MM3 A;  1IPG A;  1AW7 A;  2BS3 B;  1SIF A;  4TV3 A;  2M0X A;  3C8Y A;  3WAL A;  5D3I B;  3PZD A;  1GB4 A;  1MG8 A;  2WQY B;  4MGI E;  3N9Y C;  1YOV B;  4G50 A;  3MJW A;  2OJW A;  1A5R A;  4P16 A;  2JXX A;  3OWE B;  3CMM B;  2DHZ A;  5LXI B;  2C7M B;  3RI7 C;  2MBH A;  3RUL A;  4BZA A;  3OAW A;  1NDD A;  5I4D A;  1XLN A;  2A5U A;  4MJS B;  2CHZ A;  3V61 A;  4IC7 B;  4EFO A;  3A33 B;  1L0V B;  4CYE A;  2L76 A;  3PPA A;  2KFJ A;  2MSE D;  3L16 A;  2HTH A;  3BZD B;  4AJY B;  4XX5 A;  3P4S B;  4XWT A;  3BVG A;  1FCL A;  4OVU A;  2NR2 A;  4BFR A;  1UD7 A;  1JWS D;  1K50 A;  3GZN B;  4S0R A;  1R7S A;  4KDL B;  4L2Y A;  1OGW A;  4IKG A;  4G0N B;  2M0A A;  3T3N A;  3HM6 X;  1WXM A;  1WI0 A;  3TL5 A;  2DYO A;  4AJW A;  4M02 A;  4WWP A;  2FBW B;  4DQO C;  4XDC A;  4OZB A;  1FIQ A;  1C78 A;  1HE8 A;  3DBH I;  3FKY A;  1TYG B;  2NPT A;  1WMH B;  1ZE3 D;  2DZI A;  4HVB A;  3WAM A;  1UNS A;  2R61 A;  5KHO A;  3X23 A;  1WR1 A;  3W1S A;  1M94 A;  2X38 A;  2NBU A;  1FNW A;  4ANV A;  3GE8 C;  3A9K B;  2C7N B;  2KQS A;  3A4R A;  3IVF A;  2WXJ A;  2N7D A;  3UI3 A;  2KOX A;  4LTU A;  1YIW A;  3Q2A C;  2KYW A;  3ZQ4 A;  2K1F A;  1GB1 A;  4IWO A;  3A4S C;  4I6L B;  2J42 A;  1UUP A;  2B3A A;  4ZYN A;  3DVN U;  1SSN A;  1WXV A;  2WGS A;  4B9K A;  1OQQ A;  1WXA A;  3KW5 B;  1E7P B;  2XEW A;  2I1J A;  2MQJ A;  3K9O B;  2CJN A;  3HHM A;  2X8X X;  1FRD A;  1DOX A;  3U8Z A;  1R4M B;  2LGS A;  5KHQ A;  3OLM D;  5J17 A;  4GGQ A;  4OHJ A;  3SFD B;  4BBN F;  4IW0 A;  2KAJ A;  3VXW A;  1L4D B;  4DHJ B;  5BYR A;  4KVG B;  1WE7 A;  4DDI D;  1EU3 A;  1M4V A;  4YTP B;  4C4V A;  1JAL A;  2KMM A;  5GXG B;  1B1Z A;  4WUR A;  4EOY A;  4URK A;  2JF5 A;  4OW0 A;  2J0J A;  2E6X A;  2KTR A;  5HKH A;  5LNK 1;  3ZXR A;  3DBR I;  2JQR B;  4BKT A;  5CX3 A;  4TQ1 A;  3MC0 B;  1T0Y A;  2LAS A;  4K3B A;  2KVR A;  3EFC A;  1JW9 D;  2JXT A;  2Z59 B;  5AZH A;  5FK9 C;  2BWE S;  2WXF A;  2KQ7 A;  4WAA A;  3V05 A;  4AUQ C;  2IY0 B;  3Q3N C;  4GIV A;  3W1Y A;  4RH6 A;  3N32 A;  1TBE A;  3ZDM C;  2GBM A;  2I2Y A;  1UH6 A;  1WM3 A;  2L7R A;  2VRR B;  3ZVV A;  2YLM A;  5TSS A;  3KYC D;  2JZP A;  4NQK E;  2KLG A;  4EZK A;  3ZNZ B;  1FXT B;  4AQ7 A;  2EMS A;  3ZNI D;  4ARI A;  3H6N A;  5BMI A;  2JYE A;  3OJ3 A;  4KIK A;  4NAW A;  4NZL B;  4B0M A;  1E5W A;  3MP9 A;  2NBW B;  3S2A A;  1GPX A;  3DHH C;  1OTR B;  3SU8 X;  3QC8 B;  3WCQ A;  1ESF A;  1V8C A;  3X0W A;  5C3J B;  1E8X A;  2HD5 B;  1XCT L;  4GSW A;  3BII D;  2NBV B;  2BYE A;  4A3P A;  2OHF A;  1VCB A;  2J0K A;  2RDB C;  4LNN A;  2N9P C;  3RNC C;  4WJP A;  3GP7 A;  4BKS D;  3L08 A; 
#chains in the Genus database with same CATH homology
 4D2K A;  1NI3 A;  1STE A;  3R2T A;  1V1P A;  3W5U B;  4XE0 A;  5EE3 A;  3AE3 B;  2WXL A;  4MAC A;  1RM6 C;  2K5P A;  2XNA C;  3AE5 B;  3L4P A;  4REZ A;  4YSX B;  1N63 A;  1JML A;  4DXG A;  1NEN B;  1YJJ A;  4RGN A;  1VZ6 A;  3NVY A;  1VZ7 A;  1EM7 A;  4IDI A;  1N5W A;  2ON8 A;  1C4C A;  1D5Z C;  5BYS A;  1XLQ A;  1K53 A;  4OVZ A;  2B76 B;  2KQ4 X;  2V0G A;  1P7E A;  1XLO A;  4NAW B;  3LXF A;  2JX5 A;  4ZYS A;  4LLG M;  1SE2 A;  2BB5 A;  1T6B X;  3AE4 B;  2WXG A;  4JWS C;  2JSV X;  1ZDV A;  3R2I A;  1HZ6 A;  1K52 A;  1QOF A;  1ZUD 2;  4ZHP A;  3P42 A;  1QLB B;  1SB3 C;  1TS5 A;  4KKJ A;  1VLB A;  4KKI A;  3IAM 1;  2RMM A;  2YEP F;  2J4X A;  2LHD A;  2V4I B;  1N61 A;  3BYY B;  1CJE A;  1VJK A;  3P63 A;  2VZK D;  1WWT A;  3Q8C A;  1SE3 A;  3ABV B;  4A6Q A;  1WGK A;  3BK1 A;  2N0S B;  1MI0 A;  2K22 A;  1FRR A;  1ET9 A;  4HRS A;  2BTE A;  5EE9 A;  2WXH A;  3DWG C;  5HI1 A;  1JCK B;  5C2T B;  1HXY D;  2QEJ C;  4WWM A;  1MVK A;  3HVZ A;  2OED A;  3EA6 A;  2WXN A;  2WXK A;  1F2R C;  4RGT A;  1WXQ A;  2QJL A;  4RGM A;  1KFY B;  2IDY A;  2G1E A;  3VR9 B;  1V97 A;  4C56 C;  4FXC A;  1V1O A;  1DOI A;  2L83 A;  4N59 A;  1AN8 A;  3RFZ B;  1SBB B;  2M56 B;  2WNM A;  4ZRP A;  1L0Y B;  1IBX B;  1N5X A;  1QOB A;  3AEC B;  2LUM A;  2H88 B;  5H92 C;  2ACZ B;  2D5G A;  1IUE A;  1YQ4 B;  1KH0 A;  4M0W A;  4US8 A;  4ITK A;  2DWQ A;  3P4R B;  2INP E;  4P6V F;  1F77 A;  1I4G A;  4NJC A;  1L6V A;  4A55 A;  3AH7 A;  2WXO A;  3E56 A;  5BMG A;  1TKG A;  1E10 A;  1D5M C;  4R3D A;  3Q69 A;  1D6E C;  3TEZ A;  4UDU C;  1MHH E;  1PUT A;  3IXS A;  1TS4 A;  2KAC A;  2PW9 A;  3NS1 A;  3FAH A;  2E3T A;  3LYY A;  1KRH A;  3NRZ A;  4A9A A;  3NUH B;  3BYT B;  4TMA B;  2RDH A;  5FR3 A;  1IBX A;  1I4H A;  4KX6 B;  2L52 A;  5D3D A;  4HRO A;  2LEK A;  3NZ3 A;  3W5V B;  3AEB B;  1C79 A;  3AMZ A;  1J7C A;  1YMH E;  3MFG A;  3AED B;  5HHD G;  3DWM A;  3MJ5 A;  2W3R A;  4GLS C;  5G5G A;  3BK2 A;  1FXA A;  3HUI A;  4WAF A;  5MPO A;  4EE2 A;  3AE6 B;  2ICI A;  1LO5 D;  4GDK B;  1PGX A;  4KGT A;  3ZJV A;  3VQI A;  1OQR A;  5H8Y E;  4JE3 B;  2WU5 B;  5HFY A;  1NYR A;  1KTK A;  2JU6 X;  1JWA D;  2DYM A;  1YQ3 B;  5T8I A;  2AQ2 B;  3P4P B;  2NMQ A;  3HRD D;  2WXM A;  1B9R A;  1I4Q A;  2K9X A;  2N9K A;  2K0P A;  3AM9 A;  1AW7 A;  3I57 A;  4GDL B;  2BS3 B;  3P1M A;  3VRB B;  2MH7 A;  2N9L A;  4KGR A;  1I4P A;  3C8Y A;  3IAS 1;  5D3I B;  4JWU C;  3T3O A;  3W9C B;  1GB4 A;  4ZOH C;  2JYT A;  2WQY B;  2W54 A;  2BW2 A;  3N9Y C;  3CIR B;  4PT5 A;  2Y5C A;  1HA5 A;  2IGD A;  1SIJ A;  1TY2 A;  4P16 A;  1JWB D;  3SEB A;  1C4A A;  3U52 E;  3OWE B;  3AB5 A;  1NEK B;  2WDQ B;  3KWV A;  5G5H A;  2IGH A;  3FIL A;  2QSD A;  1XEE A;  4C80 A;  1YN3 A;  4OZC A;  2EEL A;  3NVV A;  2Z8L A;  3AEA B;  1QOG A;  1TZO A;  4IOI E;  5I4D A;  3AEG B;  1I4R A;  2SAK A;  1XLN A;  1MPE A;  2SEB D;  3BVZ A;  4AS1 A;  1TY0 A;  1L6U A;  1L0V B;  4YSZ B;  1ENF A;  4YWG G;  4XDD A;  1BUI C;  1C76 A;  1HEZ E;  1GAQ B;  3ZJU A;  2WU2 B;  3BZD B;  4HJG E;  1JQ4 A;  3EUB 2;  3P4S B;  2IGG A;  2Y3A A;  3P4Q B;  4XWT A;  1EWC A;  1KF6 B;  1CQV A;  3ZYY X;  1YNT E;  3BVG A;  1ROE A;  1FCL A;  1F2R I;  2YEP B;  1QF6 A;  1JWS D;  1K50 A;  1QT9 A;  2QMT A;  1R7S A;  3Q8A A;  3AE9 B;  1FMA D;  1C9F A;  4L2Y A;  4IKG A;  1AYF A;  3KLS X;  4YSY B;  2AQ3 B;  2INN E;  1IGD A;  2V3N A;  2ZW0 A;  1I4X A;  4USA A;  3U4E G;  2W55 A;  4WQM A;  2MJ3 A;  4CQN A;  2M0A A;  1WRI A;  3T3N A;  1YJI A;  3AE7 B;  2N7J A;  1HZ5 A;  2DYO A;  1K51 A;  3AE1 B;  2WXQ A;  1PGB A;  3PZ7 A;  1WYG A;  2FBW B;  2LHE A;  4DQO C;  4XDC A;  2J52 A;  1GOZ A;  5BYQ A;  4OZB A;  1Y56 A;  1FIQ A;  1C78 A;  1AWD A;  4C7Y A;  1FNV A;  2LMC A;  1TYG B;  1ZDX A;  1ET6 A;  1SXT A;  1TS3 A;  1V1P B;  2BB6 A;  1ZE3 D;  2L32 A;  3TSS A;  1NYQ A;  2EKI A;  2PVG C;  3FIL B;  2Y5P A;  3FC4 A;  1DYQ A;  1ZOY B;  3Q8E A;  5FKA C;  2MJD A;  1PFD A;  1UNS A;  1L5P A;  1SF0 A;  2R61 A;  3SR6 A;  4XWW A;  1KLG D;  1SE4 A;  2MEK A;  1PGA A;  3W1S A;  1D4B A;  2X38 A;  3KQ4 A;  1EU4 A;  1FNW A;  2L1A A;  1WSP A;  1I7H A;  1KLU D;  1IGC A;  4RNA A;  1T3Q A;  2QIE B;  1FXI A;  3J9C A;  2KN4 A;  2RDG A;  1BML C;  1YN4 A;  2WXJ A;  4Q2J A;  3AN1 A;  1XXG A;  2HTM E;  3UI3 A;  2BYT A;  4LTU A;  1VR9 A;  5BMH A;  3ZQ4 A;  1GB1 A;  2WXP A;  4KGS A;  3URY A;  4O1N A;  2G9H D;  3GS2 A;  2J42 A;  2BS2 B;  1TKY A;  3I9V 1;  2JWU A;  1UUP A;  2BBC A;  4N58 A;  4JPS A;  1FFU A;  2RPV A;  3BVM A;  1ZXI A;  1SSN A;  3ZJT A;  1XO3 A;  1E6E B;  1BXT A;  3W2D A;  1SJH D;  3KWL A;  1OQQ A;  2VZK B;  4N6E B;  3AE8 B;  2PMV A;  1E7P B;  4WH4 A;  2GRI A;  4HEA 1;  2WS3 B;  1PDX A;  1J7A A;  2BS4 B;  1JWU D;  1TJE A;  4J3O D;  3B2F A;  3IT4 B;  3U2S C;  4MT5 A;  2H89 B;  2CJN A;  3IT6 B;  4MH8 A;  1FD6 A;  1FNU A;  1ZXH A;  1FRD A;  1DOX A;  5EE1 A;  2GB1 A;  3B9J A;  3CWI A;  4OHJ A;  3Q8F A;  3SFD B;  1XF5 L;  4B0E A;  2PIA A;  1HQR D;  1MHX A;  2KAJ A;  2WDV B;  3AEF B;  1T5X D;  1L4D B;  1UWX A;  2WP9 B;  3LB8 C;  3PZ8 A;  5BYR A;  2XN9 C;  2DBY A;  2HDE A;  2PKO A;  1E9M A;  4RF1 A;  1Q10 A;  1XCQ L;  2MJE A;  1EU3 A;  1VRA B;  1M4V A;  2M19 A;  3PO0 A;  4LK0 M;  4YTP B;  1JAL A;  3VR8 B;  2KMM A;  5GXG B;  3AE2 B;  4WIP A;  2DLB A;  3NVW A;  1JRP A;  1B1Z A;  4ZRQ A;  3NVZ A;  2GI9 A;  2LGI A;  4WUR A;  2FUG 1;  2KWD A;  1ACC A;  4YTM B;  3GB1 A;  3V3X A;  1E0Z A;  1L4Z B;  1YN5 A;  4OW0 A;  3BWU D;  1N60 A;  2E6X A;  2LJI A;  4DXF A;  3TEW A;  3O13 A;  5HG2 A;  3E9S A;  3HVD A;  1FFV A;  1J7B A;  2PVO D;  5LNK 1;  5EE0 A;  2FE8 A;  2J53 A;  2JQR B;  5AUK A;  1QOA A;  2BT6 A;  4TQ1 A;  2AX5 A;  2WXR A;  3MC0 B;  1NVI D;  4A8X C;  1JW9 D;  2JXT A;  1N62 A;  1DOY A;  1FO4 A;  2WLB A;  5FK9 C;  2AQ1 B;  2WXF A;  1FCC C;  3V05 A;  1ZP0 B;  4NAM A;  3MHZ A;  1FM0 D;  1SEB D;  1QKZ A;  3EGR A;  2CU3 A;  1UGJ A;  2IPK D;  2PTL A;  2W3S A;  4RH6 A;  2ZW1 A;  2PLP A;  5D7G A;  1CZP A;  1RFK A;  2I2Y A;  1CK1 A;  1JRO A;  1A70 A;  5TSS A;  1XLP A;  3GP7 A;  4L1B A;  2KDM A;  4US9 A;  1RYJ A;  2Q5W D;  1ZPS A;  4ARC A;  1F0Z A;  3R8B A;  2NTS A;  2JZP A;  4H2A A;  5AUI A;  2WXI A;  4RGO S;  4OZA A;  3RPF C;  4TSS A;  2TSS A;  4RF0 A;  3B2G A;  4AQ7 A;  3SFE B;  4ARI A;  3AEE B;  3ETR A;  1TS2 A;  5BMI A;  2IJ0 A;  3AV8 A;  2JYE A;  2I38 A;  1QQR A;  5E6J A;  4NZL B;  2NTT A;  1TKE A;  4B0M A;  2W82 A;  3MP9 A;  1DGJ A;  3H8H A;  3TEY A;  3U7Z A;  5JXV A;  2K3U A;  1GPX A;  4HKZ E;  4JX1 C;  2ONQ A;  3Q8B A;  4A90 A;  3WCQ A;  1ESF A;  3TEX A;  1VZ8 A;  1PYW D;  1V8C A;  3VRA B;  4TQ0 A;  5C3J B;  1D5X C;  4C7Z A;  1QIL A;  4L23 A;  4MM3 B;  1FEH A;  1UWM A;  1XCT L;  1EWY C;  2CJO A;  2LFI A;  3BII D;  1SJE D;  1OFF A;  2QIL A;  2V3P A;  1JWM D;  4YTN B;  4ZHO A;  1VDV A;  1C4P A;  2OHF A;  4YT0 B;  4HKQ A;  1L0X B;  4RCO A;  1C77 A;  4RFB A;  1P7F A;  4YXD B;  3ZGZ A;  3TUO A;  1RWS A;  2WDR B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...