2K9XA

Solution structure of urm1 from trypanosoma brucei
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
102
structure length
102
Chain Sequence
MSNHNHITVQFAGGCELLFAKQTSLQLDGVVPTGTNLNGLVQLLKTNYVKERPDLLVDQTGQTLRPGILVLVNSCDAEVVGGMDYVLNDGDTVEFISTLHGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords Uncharacterized protein
publication title Solution structure of Urm1 from Trypanosoma brucei
pubmed doi rcsb
source organism Trypanosoma brucei
total genus 12
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2008-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09138 Urm1 Urm1 (Ubiquitin related modifier)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2k9xA00
4JX1C 3NVWA 3WCQA 3W5UB 1WXQA 1OQRA 1XLNA 1XLQA 1L6VA 3AE2B 1FM0D 4HRSA 1TKGA 4YT0B 4ZHOA 1OQQA 4HROA 1GPXA 1N60A 1KFYB 2CU3A 1QOFA 1E0ZA 1N61A 1XO3A 2WU2B 4JWUC 1N5XA 2BS3B 3FAHA 2QJLA 5C3JB 2MJDA 4ZOHC 1YQ3B 2H89B 2WS3B 2WLBA 4YTPB 5H92C 2K9XA 1NI3A 3VR8B 4YTMB 1JWAD 3AEDB 1NVID 1I7HA 4USAA 3NVYA 5MPOA 5AUKA 3AE9B 1T3QA 1B9RA 3AN1A 3AE8B 2WP9B 2DBYA 2BS4B 3DWGC 3ZYYX 1RFKA 1TKYA 1SB3C 1V97A 1L5PA 1N62A 2H88B 2WDVB 4JWSC 4YSYB 1NENB 3AEAB 3AEEB 2KMMA 1E6EB 1FRDA 1JRPA 1RWSA 2L52A 1TKEA 3RPFC 2M19A 2PIAA 3AECB 1XLOA 3AEFB 3B2FA 3P1MA 1YQ4B 2ACZB 1DGJA 1SIJA 1WGKA 3LXFA 3SFDB 3SR6A 3L4PA 4YXDB 2K22A 1FIQA 3LB8C 4C80A 1QT9A 2W3RA 4YTNB 1V8CA 1A70A 2MJ3A 2B76B 1JROA 1KF6B 1FFUA 1ZXIA 3PO0A 1E10A 1CZPA 3AE5B 1RYJA 3AV8A 3P4QB 3P4PB 4N6EB 4ITKA 3EUB2 4US9A 3VRBB 4US8A 1N5WA 3AEBB 2CJOA 1L6UA 3AE4B 1PDXA 2W3SA 4WWMA 4KX6B 1RM6C 2W55A 3KWLA 1TYGB 3NS1A 2M56B 4IDIA 3P63A 3VR9B 3AMZA 4C7YA 1WWTA 2DWQA 2N0SB 1J7BA 3AEGB 1OFFA 1WRIA 2WU5B 1UWMA 1SF0A 5EE1A 4YSXB 1QOBA 2WDRB 2Y5CA 4FXCA 3AE7B 1WYGA 3AE1B 3P4SB 3ETRA 2KAJA 1ZOYB 1FMAD 1FXAA 2PKOA 1DOYA 1N63A 3SFEB 4WQMA 2FBWB 2OHFA 3HRDD 2MJEA 2JX5A 2G1EA 1GAQB 5H8YE 4C7ZA 5EE3A 2BS2B 3NVVA 5C2TB 3B9JA 5G5HA 2JQRB 3NVZA 5AUIA 2W54A 4N59A 1ZUD2 1XLPA 3AB5A 3AE6B 1FO4A 1VJKA 1AYFA 2PVOD 2L83A 1JQ4A 1ZP0B 3W9CB 1FFVA 1QLBB 1VLBA 3AE3B 3AM9A 2WQYB 3B2GA 1L0VB 3CWIA 1PFDA 2Q5WD 2QIEB 3BIID 4A9AA 1F0ZA 5GXGB 5G5GA 1IUEA 1E7PB 2MH7A 1QOGA 1YJJA 2EKIA 3FC4A 4N58A 4YSZB 1YJIA 1J7CA 1CJEA 2LEKA 1NYRA 1PUTA 1JALA 1DOXA 1AWDA 2PVGC 3DWMA 3W5VB 1JWBD 4ZHPA 2E3TA 1NYQA 4P6VF 2AX5A 2CJNA 3P4RB 1VDVA 2K5PA 3VRAB 2HTME 3NRZA 5EE0A 5EE9A 4LTUA 1KRHA 1QF6A 1FRRA 1NEKB 3ABVB 1TJEA 3AH7A 3CIRB 1E9MA 1J7AA 2WDQB 1ROEA 1R7SA 1FXIA 1DOIA 1QOAA 3HVZA 2BT6A 1JW9D 3HUIA 1EWYC
chains in the Genus database with same CATH superfamily
2JSVX 4LNIA 1MHHE 1XLNA 2Z0DB 3HK0A 4KGSA 1C9FA 1GPXA 3PV1A 3QX1A 1XO3A 1WGHA 2CU1A 3N1ZC 1QQRA 1T0QC 2N7DA 2WXPA 2KJRA 3LJ3A 3I9V1 4W9HA 2QCZA 2DZMA 1C3TA 2FE8A 4M01A 2HJ8A 4OVUA 1C4PA 2PIAA 5CTRC 4GU2A 4WAAA 3VQIA 2K0PA 4C80A 5D2MB 4IM0A 3R66C 1A70A 4LNKA 1HA5A 1ZXHA 3U7DA 1I35A 4K7SA 4KX6B 1EF1A 1WSPA 4W9DA 2WNMA 4K3BA 2J0JA 1WWTA 2NTTA 3RFZB 4HVBA 3DVNV 1SJED 5LXIB 2N1WA 1FMAD 3UGBB 2JZ3B 2UWQA 2L7RA 2D07B 2VH1A 1GAQB 2V3PA 3ZDMC 1SE4A 3N3KB 1P0RA 2ZCBA 1HQRD 1F2RC 4K7WA 1YX6B 4LNNA 2KN4A 5DPTA 1JQ4A 4A3OA 4LK0M 4FHJA 4ARIA 5GXGB 1WMHB 2ON8A 3RNAC 3ZGZA 5FR6A 1NYQA 2LZ6A 4P6VF 3SDLC 1EM7A 1S3SG 2QDFA 3NRZA 2FIDA 1E9MA 2D3GA 4A20A 1WXSA 4PYZA 4RMAA 1R7SA 1STEA 4IWPA 2PTLA 5JZEB 4JGHB 3WAMA 4PS7A 4B6WA 1FD6A 2MBBB 3FAHA 4EUTA 2WX0A 1K53A 2RDBC 1WXVA 4ZOHC 3BYYB 4E3CA 4OZBA 5BYSA 5H92C 1I4RA 2FCQA 1T3QA 4MSQB 2Z59B 2XK5A 1SB3C 3K9PB 2KO3A 3J9CA 1VZ7A 4WWNA 2REXA 3AECB 3NHEB 1TT5B 1WGRA 4W9CA 4I6NB 2GBMA 3EA6A 1I42A 2O2VB 3KQ4A 2B76B 3PPAA 4IW0A 1V81A 2LVQA 2RPVA 3AU4A 4G50A 4RNAA 3AEBB 1L6UA 1JWMD 4HKZE 4ZRPA 1V5TA 2CKHB 4KV2A 2KQ4X 1OFFA 2BB5A 5EE1A 1UGMA 2LGDA 4FXCA 2KAJA 2J52A 2KQSA 4IM2A 2KFKB 4DXGA 4FN2A 2RD0A 1LQBA 1UUPA 2HTHA 1UWXA 3A33B 2MJEA 4EKUA 2JXXA 2DYBA 3NVVA 5C2TB 3V6CB 4N59A 2WXQA 3QCAA 3RN9C 4E74A 4WJOA 2D3AA 3AM9A 1OQYA 4F8CB 4LJOB 3BIID 2DZJA 1YN4A 1MJDA 2GBNA 1FXTB 2EMTA 2R61A 5AZHA 2AEHA 2M4NA 1OEYJ 1EU4A 4HDOA 5IP4D 4PS8A 4HKQA 2QSDA 1MI0A 1P7FA 3OAWA 3V61A 2L0FA 3QC8B 3TCAA 2BS3B 4ZDVA 4EEWA 2FCMA 1V80A 4GLSC 3VR8B 2FIFA 5GMVA 3L0WB 2G3QB 2BBCA 3BYTB 5AEKB 3BVZA 5IO9A 4OZAA 4NQKE 1V1OA 1YN5A 5BO4B 1WFYA 2AL3A 2WDVB 1LXDA 2DYMA 4KKJA 2LGIA 2L1AA 1E6EB 1RWSA 4WIPA 3ZKJC 2JWZA 3ZRCA 3AEFB 3B2FA 3W1SC 1SIJA 3MJ5A 3O65B 3QQ8B 4OVVA 5IN7A 2NBUA 1YOVB 4ITKA 3V62A 4HDQA 3V6EB 1V1PB 3ONSA 4KDLB 5FKAC 2C9WB 4L1BA 5E6NA 4C7YA 2GOWA 2LRWA 2CHWA 1C1YB 4HCPB 4JL9A 5DCNA 3H7PA 2ZW1A 2UYZB 2QHOA 3AE1B 2KKCA 3AI5A 4W9GA 3PZ8A 2LHDA 2RDHA 1YX5B 2O6VA 3AB5A 3N9YC 2MEKA 3UIOB 4YL8A 2ZCCA 2UU7A 1K52A 2J0MA 4DHJB 2KTRB 4TQ0A 4MGZE 4YSZB 1YJIA 2MRPA 2LEKA 3Q3NC 1C4CA 1C4AA 2E3TA 3DVNU 3P4RB 1XCTL 2IGDA 5D94A 1EWYC 4JX1C 1YD8U 2MP2B 2WXFA 2ZVNA 2KWUB 4HCNB 2C60A 1CMXB 1FCLA 2OOBB 2JYTA 2MJDA 3IFWB 4M8MA 2BKRB 5D6JB 3I63C 3DBHB 1N6ZA 1F1HA 1GUAB 4GDKB 2D11A 3EFCA 3EECA 1WYWB 2QC8A 4NJCA 2N7EA 2NCNA 4IOIE 2KN5A 2LGSA 1NENB 1C78A 1LFDA 3P1MA 4S0RA 4BVUC 5E6JA 1FIQA 2JUOA 3L16A 3P4PB 4GXBA 4J6IA 3RT3B 1RM6C 3U4EG 1I4QA 2Y5PA 1IBXA 2G45B 3NS1A 4AP4C 3AMZA 4ANVA 4PYUA 3KVFB 3EFUA 4LCDE 3IAS1 4MGYE 2LVPA 2N9PC 1WJ4A 4IM3A 3A9JB 4FLHA 2LHEA 2LGXA 2V3NA 1AYFA 2PEAA 2FAZA 4C56C 2QILA 4NPNA 4RH6A 4BKSD 3N32A 4W9LA 3VHTC 2KMAA 2ZPNA 1EO6A 2PVGC 4ZHPA 1VDVA 1KRHA 2CS4A 3ABVB 1TJEA 1ZGUB 1PYWD 4W9JA 4W9EA 1DOIA 3CSTA 2BT6A 1OTRB 1JW9D 1ET6A 3TEZA 2L32A 2KVRA 1MG8A 3JYUA 1XLQA 1L6VA 1VCBA 3N30A 2I38A 1Z2MA 2K1FA 4EE2A 2DBYA 1E7VA 1YJ1A 1SEBD 4GDLB 2M19A 4C4VB 3K9OB 3PZDA 1F52A 2L05A 4YXDB 1RFAA 3IBEA 3PVLA 2JWUA 1ZDVA 3JSVB 1V8CA 4N6EB 4F1SA 2LUMA 2DAJA 4US9A 3TL5A 2CJOA 2L0TA 3OJ3A 4FA6A 2W55A 1TY0A 4RF0A 2EMSA 1XF5L 4FJZA 5DPRA 2DWQA 4WQOB 1QOBA 4XYCA 4BZAA 3PRPB 1NDDA 2FBWB 2D3BA 5H8YE 4ANXA 2K25A 1SXTA 3KW5B 1XLPA 1FO4A 2L83A 2KMCA 3L17A 3CWIA 2Q5WD 3DVGX 4QAYA 4LNFA 1PUTA 1ESFA 3A9KA 1V49A 5D3DA 1M4VA 2AX5A 3NZ3A 3Q69A 1UH6A 2LGYA 4TMAB 2GB1A 2YEPB 3MC9A 2MWSB 3CMMB 3PLVA 2XNAC 1KOTA 1GNUA 2DYOA 2MX2A 2WDTB 3Q8BA 1BXTA 4II3B 4TUUA 1TS2A 2K9XA 2LI5A 4YTMB 1WE6A 1TBEA 4ICUA 1NVID 5MPOA 3DBRB 4HPPA 5IOIA 2FUG1 2KWCA 1E5WA 4F7ZA 3CF6E 2PE6B 4YSYB 2PLPA 3VAWA 3H8HA 1SBBB 4DXAB 4I6PA 3A1QB 3CSFA 1DGJA 3R2IA 2K22A 2D5GA 1SE9A 2GBJA 1ZXIA 2WXLA 3AV8A 3Q3OC 4RCOA 2HD5B 1FCCC 3VRBB 4US8A 5CHWA 2JPHA 3PTFC 5T8IA 3TSSA 3RNFC 4A90A 1NI2A 2NS5A 2INNE 1SIFA 2KTFA 1UWMA 1HTQA 2MBHA 2WXKA 3H9DA 4TKNA 2BYFA 2ZPYA 1AW7A 2V4IB 3HIZA 3R3MA 2G1EA 1WZ3A 1QKZA 2PW9A 4NAWA 2IO3B 2RR9A 4RGTA 1V2YA 1ZP0B 2WXMA 1BT0A 1L0VB 4P7IA 2KC2A 1QOGA 1GB4A 4LDTD 2KDMA 5FR3A 1NYRA 4GSWA 2N9XA 4CHKA 1AWDA 1UZXB 4A3PA 4C00A 4BKSA 1R4MI 2O6VD 3B0AA 3JW0X 2PPHA 1EUVB 1GC7A 1AN8A 1TGZB 2FCSA 3Q8AA 3RCZA 1TZOA 3KUDB 3AE2B 1R4NB 3RNCC 3U2SC 2BWFA 2NVUI 2TSSA 3H6NA 2WU2B 4JWUC 1N5XA 4B9KA 1EU3A 2KFKA 2QMTA 1V9JA 3APDA 1I4GA 1K51A 3T8MA 1XQQA 3IT6B 2LASA 2CHXA 3NVYA 4N9F4 1EF5A 1B9RA 5D3IB 3ZYYX 4FULA 4GIVA 3N1XC 2KDFB 3AEAB 3AEEB 1UBIA 1HZ6A 2BYEA 3RPFC 4JE3B 5LLIA 2NPTB 1WGKA 3LB8C 4FJYA 4DQOC 1FNVA 3VUWA 3RYTA 2IZVB 3V60A 1D5MC 2J7QB 5HHDG 1MPEA 3QA8A 4R3DA 2N0SB 1GC6A 1XT9B 4GN1A 4RM8A 1BUIC 4XX5A 1JMLA 3PHXB 1ZOYB 1FXAA 3B08A 1KTKA 2KYWA 3BK2A 2I2YA 2KK8A 3NY5A 3KUZA 3L08A 4C7ZA 2DENB 3MHZA 4W9KA 1H8CA 2PVOD 2HDEA 4HXDA 3ZXVA 3I5JC 3AE3B 2LFIA 3Q3FA 1WGDA 2LRUA 3BVMA 2L76A 1OEYA 3H1UA 4P1BC 3DDCB 4HPMB 1Q0WB 3WANA 2M17A 4NAMA 1QF6A 3GZNI 2GRIA 1V1PA 2YVCA 3OG5A 3HVZA 1MHXA 3SFEB 3UQBA 1GOZA 3WCQA 3KLSX 2MA9B 1WXQA 1WXMA 1VD2A 3E56A 1P7EA 1KFYB 4DDID 2W82A 1WM3A 1N61A 1PQSA 4IKGA 5C3JB 3ZRFA 3PRMB 2WWZA 1MG4A 1GG3A 2DZIA 3OJ4B 4EFOA 1OGWA 2ZEQA 3AULA 4HEA1 4MACA 3AE9B 1E8WA 3RUIB 3ZNID 4CQNA 3DWGC 3M3JA 1I4XA 2WXOA 2KMMA 1JRPA 5KHOA 4AUQC 3DCGA 3ALBA 4DDGD 3X0WA 2C7NB 4TV3A 1FFUA 4B95A 3N1YC 3Q2AC 2XK5B 3APFA 3VR9B 3BK1A 1C79A 2Y5CA 1H4RA 3PGEA 2IYDB 4OW0A 4RGOS 3ZTCA 3R2TA 4EOYA 2JX5A 3MC0B 4JPSA 1ZKHA 1L0XB 2JQRB 5D7GA 2KLGA 2AL6A 4IG7B 1FFVA 5HKHA 2Z0EB 2EELA 3S2AA 4MJSB 3ZJTA 3DBLB 1J7CA 3HVDA 3IT4B 2PE9A 2D10A 1JALA 2JF5A 3R7QA 3PS6A 3P42A 2SAKA 1KH0A 1KLUD 5EE0A 1WXAA 3AH7A 3PT2B 4IWQA 4OZCA 3WIMA 4MH0E 1TY2A 1CK1A 2MSED 2AQ3B 2LVOA 4AJYB 1GJZA 5LNK1 2ZVOA 2VZKB 3AU5A 2H89B 4AJWA 2I1JA 2K8BA 3NUHB 4GMVA 3A9JA 3ECIA 5AUKA 3VXWA 2X38A 2INCC 2MW5A 1L7YA 1SSNA 1QZEA 4AQ7A 1WR6E 3SFDB 3A4SC 3OWEB 1FPYA 3VVWB 4B0MA 1KM7A 3Q3MC 4ASWC 3UF8A 2WHIA 3ML8A 3PO0A 4IWOA 3Q8CA 4DBGA 5J2RA 4LLGM 3SHQA 3EUB2 1UELA 1L4DB 4HWIB 4NJ7A 4XGAB 1SJHD 2BQQA 2M56B 2D2QA 3GP7A 4GOCA 3U52E 2WU5B 2R2OA 3MP9A 2DX5B 4XWTA 3VFKA 2KDIA 3RZWC 4KGRA 5J18A 2QEJC 2FUHB 1SGHA 1T5XD 2BGFA 4JLCA 1NBFC 1XD3B 1A5RA 3QHTA 2N1VA 3OLMD 3HM6X 3SD5A 2OEDA 4BAXA 2ICIA 1F0ZA 2KLCA 1TS5A 4GDLA 4A9AA 4C4VA 2MH7A 3H7PB 4MM3A 3JSVA 4ZRQA 2CR5A 4FBJB 4M0WB 3VRAB 1FRRA 2L00B 4KSLC 3Q14C 2OJWA 4FJVB 3KH0A 2L8JA 2O6VB 3HUIA 5IAAC 2M1MA 1K50A 2D3CA 1T6BX 4A55A 2A4ZA 2KJHB 2ZNVC 3VUYA 5BMIA 2BB6A 5JH5C 2GMIC 3M95A 3WALA 3U7ZA 1NI3A 4RM9A 4KDIC 3AEDB 2C7MB 2WXGA 2L3ZA 3LDZE 4PS3A 2MBQA 3VTUA 3URYA 3T3OA 2KANA 1PGBA 5KHQA 3R7RA 5E6PA 2ONQA 1ISNA 2ACZB 3FKYA 1BMLC 2IO1B 4MH8A 2MCNB 5C23A 3VH3B 1ZW7A 4D2KA 4DHZE 1JROA 4CO7A 5TSSA 3Q8EA 2K6QA 4NJ6A 5G55A 1KLVA 3RD2A 1X1MA 1V86A 1HZ5A 3NS8A 2KACA 4YSXB 5J17A 1WR1A 1TS3A 3FILA 1D5ZC 5AUIA 1WJ6A 2KDEB 3N20C 1IBXB 3EGRA 3ZNZB 1SE3A 1QLBB 3QK0A 3ZDTA 2WQYB 2K6DB 4P16A 4XWWA 1F9JA 2KQ7A 1M94A 3M63B 1VZ6A 4M8NA 3W5VB 2IPKD 2J4XA 4DXFA 4L2YA 1L2NA 3HHMA 2HTME 1T0SC 1FNWA 1NEKB 4ARCA 1ROEA 4WAFA 1FXIA 4B0EA 4ZYSA 1Z5SB 3X23A 1QOFA 4NQLB 3BZDB 1JCKB 4KZ0A 4ZRJA 2N9KA 3AXCA 3RMKC 5L83A 3GOEA 2FNJB 2WXHA 1LM8B 1C77A 3HM3A 4MDKE 1IYFA 4NY0A 2NTSA 3AE8B 2BS4B 1RFKA 3ZQ4A 1YN3A 3W1SA 3DHHC 1XLOA 3NOBA 3PZ7A 3SR6A 2PMVA 4M02A 5E6OA 1WRDB 4AS1A 2RMMA 1E10A 1E90A 4TSSA 1N5WA 4MGKE 1IGDA 4WWMA 4ZRKA 3I3TB 2R2QA 4PK1A 1WMHA 2N7JA 3M62B 3P4SB 1Q10A 2JT4B 4JQWC 2XN9C 3E9SA 1DOYA 1E8ZA 4WQMA 4RGNA 4K3CA 2V0GA 5L95C 2VRRB 2K39A 3B9JA 4MT5A 2X8XX 2GLSA 2AWTA 3DBHI 5I4DA 3U8ZA 2BKFA 4XDCA 2V9HA 4P1CC 1UF0A 1IGCA 2YEPF 3DPDA 1L4ZB 2NPTA 1P3QU 3FC4A 4HJKA 1I4PA 1DOXA 4A8XC 3MHSD 2MQJA 2K5PA 4LTUA 1J7AA 3WAOA 1TZ1A 4URKA 5CHFA 1KLGD 2LMCA 2H88B 2KHWB 4A6QA 4MGIE 2KDBA 3W5UB 3UINB 4KZCA 4ZHOA 1E8XA 2JXTA 1N60A 1E0ZA 4ICVA 5BYQA 3NG0A 1WH3A 2JU6X 3A9KB 1D3ZA 4KIKB 1QILA 2O2VA 2WLBA 1I7HA 1VZ8A 2DAFA 5DPWA 3TUOA 2KNBA 3AN1A 2WP9B 4XZ4A 4CYEA 4RGMA 1WX7A 3IAM1 4JWSC 1P1AA 1WY8A 3DVGY 4XDDA 1ZE3D 4WJQA 2LJIA 1D5XC 1FEHA 1ENFA 2GBKA 4YTNB 3Q3JA 1F77A 3P4QB 3AE5B 4K1RB 4YWGG 3Q8FA 5IKCM 4WJPA 5BYRA 2J53A 1ZPSA 1J0GA 4WH4A 3T3NA 3PSEB 2JZPA 1WI0A 2ZZPB 2LWPA 2GI9A 3W1YA 2B3AA 2E6XA 2K8CA 4WURA 1FNUA 1PGAA 1JRUA 2BS2B 5G5HA 3NVZA 4EZLA 1ZUD2 2JRIB 2NBWB 2I1KA 3W9CB 4EZJA 1F2RI 5G5GA 1IUEA 4FHKA 3SEBA 3RULA 2KWVB 4IC7B 4ZRIA 3DWMA 4HPLB 4MELA 1UNSA 2C7HA 3RZFA 1E7UA 2INPE 5EE9A 3CIRB 1EWCA 4NAWB 2DZKA 3A4RA 4M00A 2EKIA 2XEWA 2IO2B 3TIXA 1OQRA 4HRSA 1FM0D 1OQQA 4HROA 3ZIMA 2CU3A 1VR9A 2N4FA 2N9LA 2QJLA 1UGJA 3NZSA 1JWAD 3RNEC 3ML9A 3KWVA 1MVKA 4WWOA 4Q2JA 2JZZA 1TKYA 1V97A 1N62A 1Y8RC 3W2DA 2WXNA 2KJ6A 2W9NA 3JVZX 1FRDA 2L52A 4MJSA 4HLEA 2IGGA 4DK5A 1T0RC 3L4PA 1ACCA 3PLUA 5C1ZA 2DNFA 2G9HD 5AZGA 1CZPA 4TQ1A 3T9LA 5BMHA 4UDUC 4K81A 1WIAA 1B1ZA 4BFRA 4KVGB 4IDIA 2ZNVB 3L10B 2KTRA 3DBSA 2KWDA 3APCA 3VUXA 3WA0A 4KSKC 3RI7C 3C19A 3IHPC 4KGTA 2HE7A 2WYQA 1S1QB 2PKOA 1N63A 4J3OD 4HK2A 3HRDD 4JIOU 1LO5D 2RPQA 3QJZA 4MEMA 2BYVE 2NMQA 3VH4B 3DHGC 5JHAA 3ZTDA 2N9EB 2G4SA 3MJWA 1HEZE 1GB1A 2AYOB 1YMHE 4K7UA 2MP2A 3B2GA 2QIEB 3L54A 3DBRI 1JWSD 3U30A 2KD0A 3QAQA 2CJNA 1RRBA 4GDKA 3TEXA 2WXIA 4BKGA 1WX9A 2WDQB 3ZNHB 4NZLB 3UI3A 2BW2A 3NVWA 3ZW3A 3VTVA 3MFGA 4L23A 3ZUNA 1WJNA 2J0KA 1YQ3B 2BTEA 1XEEA 2ASQA 1WE7A 5G2NA 2WX1A 2IBIB 1L5PA 4BKTA 5CHVC 1YIWA 3VTWA 2LUEA 4RFBA 2NR2A 2Y3AA 3GS2A 1LGRA 5AZFA 3LYYA 2W3RA 2IJ0A 4BOSC 4M0WA 5DPSA 2MJ3A 2DHZA 2Y5BB 1RYJA 2WXRA 2IY0B 1PDXA 2W3SA 3KWLA 2C5LC 3P63A 4GB9A 3AEGB 4ZYNA 3QWZB 3IXSA 4MSMB 1V6EA 1U4AA 2OHFA 4W9FA 3WAPA 1SE2A 1R4NI 4AWJA 2BPSA 4RF1A 2IDYA 1V5OA 2KZRA 2W54A 4ANWA 1WM2A 2V1YA 3B1LX 3ZVVA 3RNBC 1YJJA 1WF9A 2HJ1A 3MTNB 1CJEA 2NBVB 2CHZA 2BVCA 1P98A 2GBRA 3ZXRA 4BBNF 1Q5WB 2BF8B 2OJRA 2VH2A 3PREA 4S17A 4EZKA 4LNOA 5HG2A 2KXJA 3I57A 2RGFA 3C8YA 3QARA 4G0NB 5CX3A 3TEWA 3ZJUA 3R8BA 1WJUA 2IO0B 3V05A 2WS3B 4YTPB 1Q1OA 3TBLD 4XC2A 2DLBA 4I6LB 4LDTB 4OVZA 2RDGA 5BMGA 2BYTA 3KYDD 3Q6BA 1R4MB 3VDZA 4G11A 5EDSA 1IP9A 1TKEA 2V4LA 1G6JA 1ZDXA 3L13A 2M0AA 4NNJB 1QT9A 1WGGA 1KF6B 4II2B 3H7SA 2IGHA 2BWES 2WXJA 2LD9A 2RSUA 3NJTA 4OHJA 3KYCD 2MLBA 4HJGE 1J8CA 2JYEA 3IVFA 2Z8LA 4XE0A 1CQVA 3EC8A 1J7BA 2WGSA 3IG3A 1SF0A 2AQ1B 5FK9C 3ETRA 3D32A 2K3UA 3EHVA 2M0XA 3KUCB 5EE3A 4G3XB 4FADA 1K8RB 3ZJVA 2KX3A 3AE6B 3MC8A 2G4DB 5JHBA 1VLBA 1I4HA 1C76A 2KOXA 1E7PB 1VRAB 2EKEC 3TMPB 1KJTA 1UBQA 3BWUD 3BY4B 4E71A 1P9DU 3UQAA 2MBOA 3SU8X 1QOAA 2KT7A 3C0RB 1AARA 1YQBA 4KKIA 2JY6A 5HFYA 1TTNA 3UIPB 1TKGA 4YT0B 1JWUD 1RAXA 1WGYA 2INDC 1WZ0A 4MM3B 1HE8A 2ZW0A 3A1QA 3RNGC 3ENEA 4ACFA 1HTOA 2MHJA 2LJ5A 3DQVA 4WWPA 4USAA 3NZUA 1TIFA 4IUMB 1MFWA 2ZJDA 3P2BA 2J42A 2IY1B 2JVCA 4H2AA 1J19A 2KVZA 3GZNB 1UD7A 3V3XA 1YQ4B 2KX0A 3LXFA 1E8YA 2LXAA 4DWFA 4BBNC 4BOZB 3GE8C 3GB1A 3DBLI 3AE4B 2V3SA 2A5UA 1TYGB 1RLFA 2JRHA 4O1NA 1WRIA 4DHZB 2KFJA 1WX8A 3O13A 1XXGA 2WDRB 1ET9A 3AE7B 1WYGA 5TR5A 2FCNA 3DOWA 1XCQL 4KIKA 4LJPB 2SEBD 4AOFA 1DYQA 3ZLZA 1PGXA 3PHWB 3GE3C 3DHIC 4W9IA 1L0YB 2K8HA 1T0YA 4X57B 5HI1A 3TJPA 2KC1A 2XBBC 1IPGA 5IA7A 4DHJD 3ZNGC 1VJKA 3PRZA 2PJHA 3ZO5B 2VZKD 1D4BA 4WJNA 5JXVA 5LXHA 1PFDA 3QIJA 2AQ2B 1Y56A 4N58A 1D6EC 3BVGA 2YLMA 1JWBD 4ANUA 4GGQA 3BINA 1HXYD 2LXCA 3TEYA 3FILB 4REZA 1YNTE 2MBEA 1TS4A 2M8SA 4PT5A
chains in the Genus database with same CATH topology
2JSVX 1ET6A 1CK1A 1TY2A 3TEZA 2L32A 1MHHE 1OQRA 1XLNA 4KGSA 1XLQA 1L6VA 2AQ3B 1FM0D 4HRSA 1C9FA 1GPXA 1OQQA 4HROA 2CU3A 1VR9A 1XO3A 2N9LA 2I38A 2QJLA 1UGJA 5LNK1 2VZKB 1QQRA 2H89B 4EE2A 2WXPA 3NUHB 1JWAD 3KWVA 5AUKA 3I9V1 1MVKA 2X38A 2DBYA 4Q2JA 1TKYA 1V97A 1N62A 2FE8A 1SSNA 3W2DA 2WXNA 1FRDA 1SEBD 2L52A 4AQ7A 1C4PA 4GDLB 2M19A 2IGGA 2PIAA 4YXDB 3SFDB 3VQIA 3L4PA 3OWEB 2K0PA 1ACCA 2JWUA 1ZDVA 4B0MA 4C80A 1V8CA 1A70A 2G9HD 3PO0A 1HA5A 1ZXHA 1CZPA 3Q8CA 4N6EB 4TQ1A 2LUMA 4LLGM 5BMHA 3EUB2 4US9A 4UDUC 2CJOA 1L4DB 4KX6B 2W55A 1TY0A 4RF0A 1WSPA 1XF5L 1B1ZA 1SJHD 2M56B 3GP7A 2WNMA 4IDIA 3U52E 1WWTA 2DWQA 2NTTA 2WU5B 3MP9A 4XWTA 3RFZB 1QOBA 2KWDA 1SJED 4KGRA 1FMAD 4KGTA 2PKOA 1N63A 2QEJC 2FBWB 4J3OD 3HRDD 1T5XD 1GAQB 1LO5D 5H8YE 2V3PA 1SE4A 2NMQA 1HQRD 1F2RC 1SXTA 1XLPA 1FO4A 1HEZE 2KN4A 2L83A 1GB1A 1JQ4A 1YMHE 2OEDA 3B2GA 2ICIA 3CWIA 4LK0M 1TS5A 2Q5WD 2QIEB 4A9AA 4ARIA 5GXGB 1F0ZA 1JWSD 2MH7A 2ON8A 3ZGZA 1PUTA 1ESFA 4ZRQA 5D3DA 1NYQA 4P6VF 1M4VA 2AX5A 2CJNA 1EM7A 3TEXA 3NZ3A 3NRZA 3Q69A 3VRAB 1FRRA 2WXIA 1E9MA 2WDQB 1R7SA 1STEA 4TMAB 4NZLB 2PTLA 3UI3A 2GB1A 3HUIA 2YEPB 2BW2A 1K50A 3NVWA 2XNAC 1T6BX 1FD6A 3MFGA 4A55A 4L23A 2DYOA 3FAHA 5BMIA 1K53A 2BB6A 3Q8BA 4ZOHC 3BYYB 1BXTA 1YQ3B 4OZBA 3U7ZA 5BYSA 1TS2A 5H92C 2K9XA 1NI3A 4YTMB 2BTEA 1XEEA 1I4RA 3AEDB 1NVID 5MPOA 2WXGA 1T3QA 2FUG1 1SB3C 1L5PA 3URYA 3T3OA 1PGBA 3J9CA 4YSYB 1VZ7A 2PLPA 3H8HA 1SBBB 4RFBA 3AECB 2ONQA 2Y3AA 3GS2A 2ACZB 1DGJA 3R2IA 1BMLC 2K22A 3EA6A 3LYYA 2W3RA 2D5GA 4MH8A 2IJ0A 4M0WA 4D2KA 2MJ3A 3KQ4A 2B76B 1JROA 1ZXIA 5TSSA 4PT5A 2WXLA 2RPVA 3AV8A 1RYJA 2WXRA 3Q8EA 4RCOA 4RNAA 1FCCC 3VRBB 4US8A 3AEBB 1L6UA 5T8IA 1PDXA 2W3SA 3KWLA 1JWMD 3P63A 4HKZE 4ZRPA 3TSSA 4A90A 2INNE 3AEGB 2KQ4X 1HZ5A 1OFFA 2BB5A 1UWMA 2KACA 5EE1A 4YSXB 1JW9D 4FXCA 2WXKA 2KAJA 2J52A 3IXSA 4DXGA 1AW7A 2V4IB 2OHFA 1UUPA 1UWXA 1SE2A 2MJEA 1TS3A 2G1EA 1QKZA 3FILA 1D5ZC 4RF1A 2PW9A 2IDYA 3NVVA 5C2TB 5AUIA 2W54A 4N59A 2WXQA 4RGTA 1IBXB 3EGRA 1ZP0B 1SE3A 1QLBB 2WXMA 3AM9A 2WQYB 1L0VB 3BIID 4P16A 1QOGA 1YJJA 4XWWA 1GB4A 1CJEA 2KDMA 5FR3A 1YN4A 1NYRA 1AWDA 1VZ6A 3W5VB 2IPKD 2J4XA 4DXFA 4L2YA 2R61A 2HTME 1FNWA 1NEKB 5HG2A 4ARCA 1ROEA 4WAFA 1EU4A 3I57A 1FXIA 1AN8A 3C8YA 3Q8AA 4B0EA 4ZYSA 1TZOA 3AE2B 4HKQA 2QSDA 3TEWA 1MI0A 1P7FA 3ZJUA 3U2SC 1QOFA 2TSSA 3BZDB 3R8BA 2WU2B 4JWUC 1N5XA 2BS3B 1EU3A 2QMTA 1JCKB 2N9KA 3V05A 4GLSC 2WS3B 1I4GA 1K51A 4YTPB 3VR8B 3IT6B 2WXHA 2DLBA 3NVYA 2BBCA 3BYTB 1C77A 4OVZA 2NTSA 3BVZA 1B9RA 2RDGA 3AE8B 4OZAA 5D3IB 5BMGA 2BS4B 1V1OA 1YN5A 1RFKA 3ZQ4A 3ZYYX 1YN3A 2BYTA 2WDVB 3W1SA 2DYMA 4KKJA 2LGIA 2L1AA 3AEAB 3AEEB 1E6EB 1RWSA 4WIPA 1HZ6A 1TKEA 3RPFC 4JE3B 1XLOA 3AEFB 3B2FA 1ZDXA 3PZ7A 1WGKA 1SIJA 2M0AA 3MJ5A 3SR6A 2PMVA 3LB8C 1QT9A 4DQOC 1FNVA 4AS1A 1KF6B 2RMMA 2IGHA 1E10A 1D5MC 2WXJA 4TSSA 4ITKA 1N5WA 4OHJA 4HJGE 1V1PB 1IGDA 2JYEA 4WWMA 2Z8LA 5HHDG 5FKAC 4XE0A 1MPEA 4L1BA 1CQVA 4R3DA 4C7YA 2N0SB 1J7BA 1SF0A 1BUIC 2AQ1B 2ZW1A 2N7JA 5FK9C 3P4SB 3AE1B 1JMLA 3ETRA 1Q10A 1ZOYB 1FXAA 2XN9C 3E9SA 1DOYA 4WQMA 4RGNA 1KTKA 2K3UA 3BK2A 2I2YA 2V0GA 3PZ8A 4C7ZA 5EE3A 3MHZA 2LHDA 2RDHA 3B9JA 4MT5A 3ZJVA 3AB5A 3AE6B 5I4DA 2PVOD 2HDEA 3N9YC 2MEKA 4XDCA 1VLBA 3AE3B 1IGCA 1I4HA 1K52A 2YEPF 1C76A 2LFIA 4TQ0A 1E7PB 1L4ZB 1VRAB 3FC4A 4YSZB 1YJIA 2LEKA 1I4PA 1DOXA 3BWUD 1C4CA 4A8XC 1C4AA 3BVMA 2E3TA 3P4RB 2K5PA 4NAMA 4LTUA 1QF6A 2GRIA 1V1PA 1J7AA 1XCTL 2IGDA 1QOAA 3HVZA 1KLGD 1MHXA 2LMCA 2H88B 3SFEB 4A6QA 1EWYC 4JX1C 1GOZA 4KKIA 3WCQA 3KLSX 3W5UB 1WXQA 5HFYA 1TKGA 4YT0B 1JWUD 2JXTA 3E56A 1P7EA 1N60A 2WXFA 4ZHOA 1KFYB 2W82A 4MM3B 1E0ZA 2ZW0A 1N61A 5BYQA 4IKGA 5C3JB 1FCLA 2JYTA 2JU6X 2MJDA 1QILA 2WLBA 4GDKB 1I7HA 4USAA 4HEA1 4MACA 1VZ8A 4NJCA 3AE9B 3TUOA 3AN1A 2WP9B 4CQNA 3DWGC 4IOIE 2J42A 1I4XA 3IAM1 2WXOA 4JWSC 4RGMA 1NENB 1C78A 2KMMA 1JRPA 4XDDA 4H2AA 3V3XA 3P1MA 1YQ4B 1ZE3D 3LXFA 2LJIA 1D5XC 1FEHA 1FIQA 5E6JA 1ENFA 4YTNB 1F77A 1FFUA 3P4QB 3AE5B 3P4PB 4YWGG 3GB1A 3Q8FA 3AE4B 1RM6C 3U4EG 5BYRA 2J53A 1I4QA 1TYGB 1ZPSA 2Y5PA 3NS1A 1IBXA 3VR9B 3BK1A 3AMZA 4WH4A 3T3NA 1C79A 4O1NA 1WRIA 2JZPA 3O13A 2GI9A 1XXGA 2WDRB 2Y5CA 1ET9A 3AE7B 1WYGA 1XCQL 2SEBD 2E6XA 1DYQA 4WURA 3IAS1 1PGXA 4OW0A 4RGOS 1L0YB 3R2TA 2JX5A 5HI1A 3MC0B 4JPSA 1FNUA 1PGAA 2BS2B 1L0XB 5G5HA 2JQRB 2LHEA 3NVZA 5D7GA 1ZUD2 2V3NA 1VJKA 1AYFA 3W9CB 1F2RI 1FFVA 4C56C 2VZKD 1D4BA 5JXVA 2QILA 1PFDA 4RH6A 2EELA 2AQ2B 5G5GA 1IUEA 1Y56A 4N58A 3SEBA 1D6EC 3ZJTA 3BVGA 1J7CA 3HVDA 3IT4B 1JALA 2PVGC 3DWMA 4ZHPA 1JWBD 3P42A 1UNSA 1VDVA 1HXYD 2SAKA 1KH0A 1KLUD 2INPE 1KRHA 5EE0A 5EE9A 3ABVB 3FILB 4REZA 3TEYA 1TJEA 3AH7A 3CIRB 1PYWD 1EWCA 1YNTE 4NAWB 1DOIA 4OZCA 1TS4A 2BT6A 2EKIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JX1 C;  3NVW A;  3WCQ A;  3W5U B;  1WXQ A;  1OQR A;  1XLN A;  1XLQ A;  1L6V A;  3AE2 B;  1FM0 D;  4HRS A;  1TKG A;  4YT0 B;  4ZHO A;  1OQQ A;  4HRO A;  1GPX A;  1N60 A;  1KFY B;  2CU3 A;  1QOF A;  1E0Z A;  1N61 A;  1XO3 A;  2WU2 B;  4JWU C;  1N5X A;  2BS3 B;  3FAH A;  2QJL A;  5C3J B;  2MJD A;  4ZOH C;  1YQ3 B;  2H89 B;  2WS3 B;  2WLB A;  4YTP B;  5H92 C;  2K9X A;  1NI3 A;  3VR8 B;  4YTM B;  1JWA D;  3AED B;  1NVI D;  1I7H A;  4USA A;  3NVY A;  5MPO A;  5AUK A;  3AE9 B;  1T3Q A;  1B9R A;  3AN1 A;  3AE8 B;  2WP9 B;  2DBY A;  2BS4 B;  3DWG C;  3ZYY X;  1RFK A;  1TKY A;  1SB3 C;  1V97 A;  1L5P A;  1N62 A;  2H88 B;  2WDV B;  4JWS C;  4YSY B;  1NEN B;  3AEA B;  3AEE B;  2KMM A;  1E6E B;  1FRD A;  1JRP A;  1RWS A;  2L52 A;  1TKE A;  3RPF C;  2M19 A;  2PIA A;  3AEC B;  1XLO A;  3AEF B;  3B2F A;  3P1M A;  1YQ4 B;  2ACZ B;  1DGJ A;  1SIJ A;  1WGK A;  3LXF A;  3SFD B;  3SR6 A;  3L4P A;  4YXD B;  2K22 A;  1FIQ A;  3LB8 C;  4C80 A;  1QT9 A;  2W3R A;  4YTN B;  1V8C A;  1A70 A;  2MJ3 A;  2B76 B;  1JRO A;  1KF6 B;  1FFU A;  1ZXI A;  3PO0 A;  1E10 A;  1CZP A;  3AE5 B;  1RYJ A;  3AV8 A;  3P4Q B;  3P4P B;  4N6E B;  4ITK A;  3EUB 2;  4US9 A;  3VRB B;  4US8 A;  1N5W A;  3AEB B;  2CJO A;  1L6U A;  3AE4 B;  1PDX A;  2W3S A;  4WWM A;  4KX6 B;  1RM6 C;  2W55 A;  3KWL A;  1TYG B;  3NS1 A;  2M56 B;  4IDI A;  3P63 A;  3VR9 B;  3AMZ A;  4C7Y A;  1WWT A;  2DWQ A;  2N0S B;  1J7B A;  3AEG B;  1OFF A;  1WRI A;  2WU5 B;  1UWM A;  1SF0 A;  5EE1 A;  4YSX B;  1QOB A;  2WDR B;  2Y5C A;  4FXC A;  3AE7 B;  1WYG A;  3AE1 B;  3P4S B;  3ETR A;  2KAJ A;  1ZOY B;  1FMA D;  1FXA A;  2PKO A;  1DOY A;  1N63 A;  3SFE B;  4WQM A;  2FBW B;  2OHF A;  3HRD D;  2MJE A;  2JX5 A;  2G1E A;  1GAQ B;  5H8Y E;  4C7Z A;  5EE3 A;  2BS2 B;  3NVV A;  5C2T B;  3B9J A;  5G5H A;  2JQR B;  3NVZ A;  5AUI A;  2W54 A;  4N59 A;  1ZUD 2;  1XLP A;  3AB5 A;  3AE6 B;  1FO4 A;  1VJK A;  1AYF A;  2PVO D;  2L83 A;  1JQ4 A;  1ZP0 B;  3W9C B;  1FFV A;  1QLB B;  1VLB A;  3AE3 B;  3AM9 A;  2WQY B;  3B2G A;  1L0V B;  3CWI A;  1PFD A;  2Q5W D;  2QIE B;  3BII D;  4A9A A;  1F0Z A;  5GXG B;  5G5G A;  1IUE A;  1E7P B;  2MH7 A;  1QOG A;  1YJJ A;  2EKI A;  3FC4 A;  4N58 A;  4YSZ B;  1YJI A;  1J7C A;  1CJE A;  2LEK A;  1NYR A;  1PUT A;  1JAL A;  1DOX A;  1AWD A;  2PVG C;  3DWM A;  3W5V B;  1JWB D;  4ZHP A;  2E3T A;  1NYQ A;  4P6V F;  2AX5 A;  2CJN A;  3P4R B;  1VDV A;  2K5P A;  3VRA B;  2HTM E;  3NRZ A;  5EE0 A;  5EE9 A;  4LTU A;  1KRH A;  1QF6 A;  1FRR A;  1NEK B;  3ABV B;  1TJE A;  3AH7 A;  3CIR B;  1E9M A;  1J7A A;  2WDQ B;  1ROE A;  1R7S A;  1FXI A;  1DOI A;  1QOA A;  3HVZ A;  2BT6 A;  1JW9 D;  3HUI A;  1EWY C; 
#chains in the Genus database with same CATH topology
 2JSV X;  4LNI A;  1MHH E;  1XLN A;  2Z0D B;  3HK0 A;  4KGS A;  1C9F A;  1GPX A;  3PV1 A;  3QX1 A;  1XO3 A;  1WGH A;  2CU1 A;  3N1Z C;  1QQR A;  1T0Q C;  2N7D A;  2WXP A;  2KJR A;  3LJ3 A;  3I9V 1;  4W9H A;  2QCZ A;  2DZM A;  1C3T A;  2FE8 A;  4M01 A;  2HJ8 A;  4OVU A;  1C4P A;  2PIA A;  5CTR C;  4GU2 A;  4WAA A;  3VQI A;  2K0P A;  4C80 A;  5D2M B;  4IM0 A;  3R66 C;  1A70 A;  4LNK A;  1HA5 A;  1ZXH A;  3U7D A;  1I35 A;  4K7S A;  4KX6 B;  1EF1 A;  1WSP A;  4W9D A;  2WNM A;  4K3B A;  2J0J A;  1WWT A;  2NTT A;  3RFZ B;  4HVB A;  3DVN V;  1SJE D;  5LXI B;  2N1W A;  1FMA D;  3UGB B;  2JZ3 B;  2UWQ A;  2L7R A;  2D07 B;  2VH1 A;  1GAQ B;  2V3P A;  3ZDM C;  1SE4 A;  3N3K B;  1P0R A;  2ZCB A;  1HQR D;  1F2R C;  4K7W A;  1YX6 B;  4LNN A;  2KN4 A;  5DPT A;  1JQ4 A;  4A3O A;  4LK0 M;  4FHJ A;  4ARI A;  5GXG B;  1WMH B;  2ON8 A;  3RNA C;  3ZGZ A;  5FR6 A;  1NYQ A;  2LZ6 A;  4P6V F;  3SDL C;  1EM7 A;  1S3S G;  2QDF A;  3NRZ A;  2FID A;  1E9M A;  2D3G A;  4A20 A;  1WXS A;  4PYZ A;  4RMA A;  1R7S A;  1STE A;  4IWP A;  2PTL A;  5JZE B;  4JGH B;  3WAM A;  4PS7 A;  4B6W A;  1FD6 A;  2MBB B;  3FAH A;  4EUT A;  2WX0 A;  1K53 A;  2RDB C;  1WXV A;  4ZOH C;  3BYY B;  4E3C A;  4OZB A;  5BYS A;  5H92 C;  1I4R A;  2FCQ A;  1T3Q A;  4MSQ B;  2Z59 B;  2XK5 A;  1SB3 C;  3K9P B;  2KO3 A;  3J9C A;  1VZ7 A;  4WWN A;  2REX A;  3AEC B;  3NHE B;  1TT5 B;  1WGR A;  4W9C A;  4I6N B;  2GBM A;  3EA6 A;  1I42 A;  2O2V B;  3KQ4 A;  2B76 B;  3PPA A;  4IW0 A;  1V81 A;  2LVQ A;  2RPV A;  3AU4 A;  4G50 A;  4RNA A;  3AEB B;  1L6U A;  1JWM D;  4HKZ E;  4ZRP A;  1V5T A;  2CKH B;  4KV2 A;  2KQ4 X;  1OFF A;  2BB5 A;  5EE1 A;  1UGM A;  2LGD A;  4FXC A;  2KAJ A;  2J52 A;  2KQS A;  4IM2 A;  2KFK B;  4DXG A;  4FN2 A;  2RD0 A;  1LQB A;  1UUP A;  2HTH A;  1UWX A;  3A33 B;  2MJE A;  4EKU A;  2JXX A;  2DYB A;  3NVV A;  5C2T B;  3V6C B;  4N59 A;  2WXQ A;  3QCA A;  3RN9 C;  4E74 A;  4WJO A;  2D3A A;  3AM9 A;  1OQY A;  4F8C B;  4LJO B;  3BII D;  2DZJ A;  1YN4 A;  1MJD A;  2GBN A;  1FXT B;  2EMT A;  2R61 A;  5AZH A;  2AEH A;  2M4N A;  1OEY J;  1EU4 A;  4HDO A;  5IP4 D;  4PS8 A;  4HKQ A;  2QSD A;  1MI0 A;  1P7F A;  3OAW A;  3V61 A;  2L0F A;  3QC8 B;  3TCA A;  2BS3 B;  4ZDV A;  4EEW A;  2FCM A;  1V80 A;  4GLS C;  3VR8 B;  2FIF A;  5GMV A;  3L0W B;  2G3Q B;  2BBC A;  3BYT B;  5AEK B;  3BVZ A;  5IO9 A;  4OZA A;  4NQK E;  1V1O A;  1YN5 A;  5BO4 B;  1WFY A;  2AL3 A;  2WDV B;  1LXD A;  2DYM A;  4KKJ A;  2LGI A;  2L1A A;  1E6E B;  1RWS A;  4WIP A;  3ZKJ C;  2JWZ A;  3ZRC A;  3AEF B;  3B2F A;  3W1S C;  1SIJ A;  3MJ5 A;  3O65 B;  3QQ8 B;  4OVV A;  5IN7 A;  2NBU A;  1YOV B;  4ITK A;  3V62 A;  4HDQ A;  3V6E B;  1V1P B;  3ONS A;  4KDL B;  5FKA C;  2C9W B;  4L1B A;  5E6N A;  4C7Y A;  2GOW A;  2LRW A;  2CHW A;  1C1Y B;  4HCP B;  4JL9 A;  5DCN A;  3H7P A;  2ZW1 A;  2UYZ B;  2QHO A;  3AE1 B;  2KKC A;  3AI5 A;  4W9G A;  3PZ8 A;  2LHD A;  2RDH A;  1YX5 B;  2O6V A;  3AB5 A;  3N9Y C;  2MEK A;  3UIO B;  4YL8 A;  2ZCC A;  2UU7 A;  1K52 A;  2J0M A;  4DHJ B;  2KTR B;  4TQ0 A;  4MGZ E;  4YSZ B;  1YJI A;  2MRP A;  2LEK A;  3Q3N C;  1C4C A;  1C4A A;  2E3T A;  3DVN U;  3P4R B;  1XCT L;  2IGD A;  5D94 A;  1EWY C;  4JX1 C;  1YD8 U;  2MP2 B;  2WXF A;  2ZVN A;  2KWU B;  4HCN B;  2C60 A;  1CMX B;  1FCL A;  2OOB B;  2JYT A;  2MJD A;  3IFW B;  4M8M A;  2BKR B;  5D6J B;  3I63 C;  3DBH B;  1N6Z A;  1F1H A;  1GUA B;  4GDK B;  2D11 A;  3EFC A;  3EEC A;  1WYW B;  2QC8 A;  4NJC A;  2N7E A;  2NCN A;  4IOI E;  2KN5 A;  2LGS A;  1NEN B;  1C78 A;  1LFD A;  3P1M A;  4S0R A;  4BVU C;  5E6J A;  1FIQ A;  2JUO A;  3L16 A;  3P4P B;  4GXB A;  4J6I A;  3RT3 B;  1RM6 C;  3U4E G;  1I4Q A;  2Y5P A;  1IBX A;  2G45 B;  3NS1 A;  4AP4 C;  3AMZ A;  4ANV A;  4PYU A;  3KVF B;  3EFU A;  4LCD E;  3IAS 1;  4MGY E;  2LVP A;  2N9P C;  1WJ4 A;  4IM3 A;  3A9J B;  4FLH A;  2LHE A;  2LGX A;  2V3N A;  1AYF A;  2PEA A;  2FAZ A;  4C56 C;  2QIL A;  4NPN A;  4RH6 A;  4BKS D;  3N32 A;  4W9L A;  3VHT C;  2KMA A;  2ZPN A;  1EO6 A;  2PVG C;  4ZHP A;  1VDV A;  1KRH A;  2CS4 A;  3ABV B;  1TJE A;  1ZGU B;  1PYW D;  4W9J A;  4W9E A;  1DOI A;  3CST A;  2BT6 A;  1OTR B;  1JW9 D;  1ET6 A;  3TEZ A;  2L32 A;  2KVR A;  1MG8 A;  3JYU A;  1XLQ A;  1L6V A;  1VCB A;  3N30 A;  2I38 A;  1Z2M A;  2K1F A;  4EE2 A;  2DBY A;  1E7V A;  1YJ1 A;  1SEB D;  4GDL B;  2M19 A;  4C4V B;  3K9O B;  3PZD A;  1F52 A;  2L05 A;  4YXD B;  1RFA A;  3IBE A;  3PVL A;  2JWU A;  1ZDV A;  3JSV B;  1V8C A;  4N6E B;  4F1S A;  2LUM A;  2DAJ A;  4US9 A;  3TL5 A;  2CJO A;  2L0T A;  3OJ3 A;  4FA6 A;  2W55 A;  1TY0 A;  4RF0 A;  2EMS A;  1XF5 L;  4FJZ A;  5DPR A;  2DWQ A;  4WQO B;  1QOB A;  4XYC A;  4BZA A;  3PRP B;  1NDD A;  2FBW B;  2D3B A;  5H8Y E;  4ANX A;  2K25 A;  1SXT A;  3KW5 B;  1XLP A;  1FO4 A;  2L83 A;  2KMC A;  3L17 A;  3CWI A;  2Q5W D;  3DVG X;  4QAY A;  4LNF A;  1PUT A;  1ESF A;  3A9K A;  1V49 A;  5D3D A;  1M4V A;  2AX5 A;  3NZ3 A;  3Q69 A;  1UH6 A;  2LGY A;  4TMA B;  2GB1 A;  2YEP B;  3MC9 A;  2MWS B;  3CMM B;  3PLV A;  2XNA C;  1KOT A;  1GNU A;  2DYO A;  2MX2 A;  2WDT B;  3Q8B A;  1BXT A;  4II3 B;  4TUU A;  1TS2 A;  2K9X A;  2LI5 A;  4YTM B;  1WE6 A;  1TBE A;  4ICU A;  1NVI D;  5MPO A;  3DBR B;  4HPP A;  5IOI A;  2FUG 1;  2KWC A;  1E5W A;  4F7Z A;  3CF6 E;  2PE6 B;  4YSY B;  2PLP A;  3VAW A;  3H8H A;  1SBB B;  4DXA B;  4I6P A;  3A1Q B;  3CSF A;  1DGJ A;  3R2I A;  2K22 A;  2D5G A;  1SE9 A;  2GBJ A;  1ZXI A;  2WXL A;  3AV8 A;  3Q3O C;  4RCO A;  2HD5 B;  1FCC C;  3VRB B;  4US8 A;  5CHW A;  2JPH A;  3PTF C;  5T8I A;  3TSS A;  3RNF C;  4A90 A;  1NI2 A;  2NS5 A;  2INN E;  1SIF A;  2KTF A;  1UWM A;  1HTQ A;  2MBH A;  2WXK A;  3H9D A;  4TKN A;  2BYF A;  2ZPY A;  1AW7 A;  2V4I B;  3HIZ A;  3R3M A;  2G1E A;  1WZ3 A;  1QKZ A;  2PW9 A;  4NAW A;  2IO3 B;  2RR9 A;  4RGT A;  1V2Y A;  1ZP0 B;  2WXM A;  1BT0 A;  1L0V B;  4P7I A;  2KC2 A;  1QOG A;  1GB4 A;  4LDT D;  2KDM A;  5FR3 A;  1NYR A;  4GSW A;  2N9X A;  4CHK A;  1AWD A;  1UZX B;  4A3P A;  4C00 A;  4BKS A;  1R4M I;  2O6V D;  3B0A A;  3JW0 X;  2PPH A;  1EUV B;  1GC7 A;  1AN8 A;  1TGZ B;  2FCS A;  3Q8A A;  3RCZ A;  1TZO A;  3KUD B;  3AE2 B;  1R4N B;  3RNC C;  3U2S C;  2BWF A;  2NVU I;  2TSS A;  3H6N A;  2WU2 B;  4JWU C;  1N5X A;  4B9K A;  1EU3 A;  2KFK A;  2QMT A;  1V9J A;  3APD A;  1I4G A;  1K51 A;  3T8M A;  1XQQ A;  3IT6 B;  2LAS A;  2CHX A;  3NVY A;  4N9F 4;  1EF5 A;  1B9R A;  5D3I B;  3ZYY X;  4FUL A;  4GIV A;  3N1X C;  2KDF B;  3AEA B;  3AEE B;  1UBI A;  1HZ6 A;  2BYE A;  3RPF C;  4JE3 B;  5LLI A;  2NPT B;  1WGK A;  3LB8 C;  4FJY A;  4DQO C;  1FNV A;  3VUW A;  3RYT A;  2IZV B;  3V60 A;  1D5M C;  2J7Q B;  5HHD G;  1MPE A;  3QA8 A;  4R3D A;  2N0S B;  1GC6 A;  1XT9 B;  4GN1 A;  4RM8 A;  1BUI C;  4XX5 A;  1JML A;  3PHX B;  1ZOY B;  1FXA A;  3B08 A;  1KTK A;  2KYW A;  3BK2 A;  2I2Y A;  2KK8 A;  3NY5 A;  3KUZ A;  3L08 A;  4C7Z A;  2DEN B;  3MHZ A;  4W9K A;  1H8C A;  2PVO D;  2HDE A;  4HXD A;  3ZXV A;  3I5J C;  3AE3 B;  2LFI A;  3Q3F A;  1WGD A;  2LRU A;  3BVM A;  2L76 A;  1OEY A;  3H1U A;  4P1B C;  3DDC B;  4HPM B;  1Q0W B;  3WAN A;  2M17 A;  4NAM A;  1QF6 A;  3GZN I;  2GRI A;  1V1P A;  2YVC A;  3OG5 A;  3HVZ A;  1MHX A;  3SFE B;  3UQB A;  1GOZ A;  3WCQ A;  3KLS X;  2MA9 B;  1WXQ A;  1WXM A;  1VD2 A;  3E56 A;  1P7E A;  1KFY B;  4DDI D;  2W82 A;  1WM3 A;  1N61 A;  1PQS A;  4IKG A;  5C3J B;  3ZRF A;  3PRM B;  2WWZ A;  1MG4 A;  1GG3 A;  2DZI A;  3OJ4 B;  4EFO A;  1OGW A;  2ZEQ A;  3AUL A;  4HEA 1;  4MAC A;  3AE9 B;  1E8W A;  3RUI B;  3ZNI D;  4CQN A;  3DWG C;  3M3J A;  1I4X A;  2WXO A;  2KMM A;  1JRP A;  5KHO A;  4AUQ C;  3DCG A;  3ALB A;  4DDG D;  3X0W A;  2C7N B;  4TV3 A;  1FFU A;  4B95 A;  3N1Y C;  3Q2A C;  2XK5 B;  3APF A;  3VR9 B;  3BK1 A;  1C79 A;  2Y5C A;  1H4R A;  3PGE A;  2IYD B;  4OW0 A;  4RGO S;  3ZTC A;  3R2T A;  4EOY A;  2JX5 A;  3MC0 B;  4JPS A;  1ZKH A;  1L0X B;  2JQR B;  5D7G A;  2KLG A;  2AL6 A;  4IG7 B;  1FFV A;  5HKH A;  2Z0E B;  2EEL A;  3S2A A;  4MJS B;  3ZJT A;  3DBL B;  1J7C A;  3HVD A;  3IT4 B;  2PE9 A;  2D10 A;  1JAL A;  2JF5 A;  3R7Q A;  3PS6 A;  3P42 A;  2SAK A;  1KH0 A;  1KLU D;  5EE0 A;  1WXA A;  3AH7 A;  3PT2 B;  4IWQ A;  4OZC A;  3WIM A;  4MH0 E;  1TY2 A;  1CK1 A;  2MSE D;  2AQ3 B;  2LVO A;  4AJY B;  1GJZ A;  5LNK 1;  2ZVO A;  2VZK B;  3AU5 A;  2H89 B;  4AJW A;  2I1J A;  2K8B A;  3NUH B;  4GMV A;  3A9J A;  3ECI A;  5AUK A;  3VXW A;  2X38 A;  2INC C;  2MW5 A;  1L7Y A;  1SSN A;  1QZE A;  4AQ7 A;  1WR6 E;  3SFD B;  3A4S C;  3OWE B;  1FPY A;  3VVW B;  4B0M A;  1KM7 A;  3Q3M C;  4ASW C;  3UF8 A;  2WHI A;  3ML8 A;  3PO0 A;  4IWO A;  3Q8C A;  4DBG A;  5J2R A;  4LLG M;  3SHQ A;  3EUB 2;  1UEL A;  1L4D B;  4HWI B;  4NJ7 A;  4XGA B;  1SJH D;  2BQQ A;  2M56 B;  2D2Q A;  3GP7 A;  4GOC A;  3U52 E;  2WU5 B;  2R2O A;  3MP9 A;  2DX5 B;  4XWT A;  3VFK A;  2KDI A;  3RZW C;  4KGR A;  5J18 A;  2QEJ C;  2FUH B;  1SGH A;  1T5X D;  2BGF A;  4JLC A;  1NBF C;  1XD3 B;  1A5R A;  3QHT A;  2N1V A;  3OLM D;  3HM6 X;  3SD5 A;  2OED A;  4BAX A;  2ICI A;  1F0Z A;  2KLC A;  1TS5 A;  4GDL A;  4A9A A;  4C4V A;  2MH7 A;  3H7P B;  4MM3 A;  3JSV A;  4ZRQ A;  2CR5 A;  4FBJ B;  4M0W B;  3VRA B;  1FRR A;  2L00 B;  4KSL C;  3Q14 C;  2OJW A;  4FJV B;  3KH0 A;  2L8J A;  2O6V B;  3HUI A;  5IAA C;  2M1M A;  1K50 A;  2D3C A;  1T6B X;  4A55 A;  2A4Z A;  2KJH B;  2ZNV C;  3VUY A;  5BMI A;  2BB6 A;  5JH5 C;  2GMI C;  3M95 A;  3WAL A;  3U7Z A;  1NI3 A;  4RM9 A;  4KDI C;  3AED B;  2C7M B;  2WXG A;  2L3Z A;  3LDZ E;  4PS3 A;  2MBQ A;  3VTU A;  3URY A;  3T3O A;  2KAN A;  1PGB A;  5KHQ A;  3R7R A;  5E6P A;  2ONQ A;  1ISN A;  2ACZ B;  3FKY A;  1BML C;  2IO1 B;  4MH8 A;  2MCN B;  5C23 A;  3VH3 B;  1ZW7 A;  4D2K A;  4DHZ E;  1JRO A;  4CO7 A;  5TSS A;  3Q8E A;  2K6Q A;  4NJ6 A;  5G55 A;  1KLV A;  3RD2 A;  1X1M A;  1V86 A;  1HZ5 A;  3NS8 A;  2KAC A;  4YSX B;  5J17 A;  1WR1 A;  1TS3 A;  3FIL A;  1D5Z C;  5AUI A;  1WJ6 A;  2KDE B;  3N20 C;  1IBX B;  3EGR A;  3ZNZ B;  1SE3 A;  1QLB B;  3QK0 A;  3ZDT A;  2WQY B;  2K6D B;  4P16 A;  4XWW A;  1F9J A;  2KQ7 A;  1M94 A;  3M63 B;  1VZ6 A;  4M8N A;  3W5V B;  2IPK D;  2J4X A;  4DXF A;  4L2Y A;  1L2N A;  3HHM A;  2HTM E;  1T0S C;  1FNW A;  1NEK B;  4ARC A;  1ROE A;  4WAF A;  1FXI A;  4B0E A;  4ZYS A;  1Z5S B;  3X23 A;  1QOF A;  4NQL B;  3BZD B;  1JCK B;  4KZ0 A;  4ZRJ A;  2N9K A;  3AXC A;  3RMK C;  5L83 A;  3GOE A;  2FNJ B;  2WXH A;  1LM8 B;  1C77 A;  3HM3 A;  4MDK E;  1IYF A;  4NY0 A;  2NTS A;  3AE8 B;  2BS4 B;  1RFK A;  3ZQ4 A;  1YN3 A;  3W1S A;  3DHH C;  1XLO A;  3NOB A;  3PZ7 A;  3SR6 A;  2PMV A;  4M02 A;  5E6O A;  1WRD B;  4AS1 A;  2RMM A;  1E10 A;  1E90 A;  4TSS A;  1N5W A;  4MGK E;  1IGD A;  4WWM A;  4ZRK A;  3I3T B;  2R2Q A;  4PK1 A;  1WMH A;  2N7J A;  3M62 B;  3P4S B;  1Q10 A;  2JT4 B;  4JQW C;  2XN9 C;  3E9S A;  1DOY A;  1E8Z A;  4WQM A;  4RGN A;  4K3C A;  2V0G A;  5L95 C;  2VRR B;  2K39 A;  3B9J A;  4MT5 A;  2X8X X;  2GLS A;  2AWT A;  3DBH I;  5I4D A;  3U8Z A;  2BKF A;  4XDC A;  2V9H A;  4P1C C;  1UF0 A;  1IGC A;  2YEP F;  3DPD A;  1L4Z B;  2NPT A;  1P3Q U;  3FC4 A;  4HJK A;  1I4P A;  1DOX A;  4A8X C;  3MHS D;  2MQJ A;  2K5P A;  4LTU A;  1J7A A;  3WAO A;  1TZ1 A;  4URK A;  5CHF A;  1KLG D;  2LMC A;  2H88 B;  2KHW B;  4A6Q A;  4MGI E;  2KDB A;  3W5U B;  3UIN B;  4KZC A;  4ZHO A;  1E8X A;  2JXT A;  1N60 A;  1E0Z A;  4ICV A;  5BYQ A;  3NG0 A;  1WH3 A;  2JU6 X;  3A9K B;  1D3Z A;  4KIK B;  1QIL A;  2O2V A;  2WLB A;  1I7H A;  1VZ8 A;  2DAF A;  5DPW A;  3TUO A;  2KNB A;  3AN1 A;  2WP9 B;  4XZ4 A;  4CYE A;  4RGM A;  1WX7 A;  3IAM 1;  4JWS C;  1P1A A;  1WY8 A;  3DVG Y;  4XDD A;  1ZE3 D;  4WJQ A;  2LJI A;  1D5X C;  1FEH A;  1ENF A;  2GBK A;  4YTN B;  3Q3J A;  1F77 A;  3P4Q B;  3AE5 B;  4K1R B;  4YWG G;  3Q8F A;  5IKC M;  4WJP A;  5BYR A;  2J53 A;  1ZPS A;  1J0G A;  4WH4 A;  3T3N A;  3PSE B;  2JZP A;  1WI0 A;  2ZZP B;  2LWP A;  2GI9 A;  3W1Y A;  2B3A A;  2E6X A;  2K8C A;  4WUR A;  1FNU A;  1PGA A;  1JRU A;  2BS2 B;  5G5H A;  3NVZ A;  4EZL A;  1ZUD 2;  2JRI B;  2NBW B;  2I1K A;  3W9C B;  4EZJ A;  1F2R I;  5G5G A;  1IUE A;  4FHK A;  3SEB A;  3RUL A;  2KWV B;  4IC7 B;  4ZRI A;  3DWM A;  4HPL B;  4MEL A;  1UNS A;  2C7H A;  3RZF A;  1E7U A;  2INP E;  5EE9 A;  3CIR B;  1EWC A;  4NAW B;  2DZK A;  3A4R A;  4M00 A;  2EKI A;  2XEW A;  2IO2 B;  3TIX A;  1OQR A;  4HRS A;  1FM0 D;  1OQQ A;  4HRO A;  3ZIM A;  2CU3 A;  1VR9 A;  2N4F A;  2N9L A;  2QJL A;  1UGJ A;  3NZS A;  1JWA D;  3RNE C;  3ML9 A;  3KWV A;  1MVK A;  4WWO A;  4Q2J A;  2JZZ A;  1TKY A;  1V97 A;  1N62 A;  1Y8R C;  3W2D A;  2WXN A;  2KJ6 A;  2W9N A;  3JVZ X;  1FRD A;  2L52 A;  4MJS A;  4HLE A;  2IGG A;  4DK5 A;  1T0R C;  3L4P A;  1ACC A;  3PLU A;  5C1Z A;  2DNF A;  2G9H D;  5AZG A;  1CZP A;  4TQ1 A;  3T9L A;  5BMH A;  4UDU C;  4K81 A;  1WIA A;  1B1Z A;  4BFR A;  4KVG B;  4IDI A;  2ZNV B;  3L10 B;  2KTR A;  3DBS A;  2KWD A;  3APC A;  3VUX A;  3WA0 A;  4KSK C;  3RI7 C;  3C19 A;  3IHP C;  4KGT A;  2HE7 A;  2WYQ A;  1S1Q B;  2PKO A;  1N63 A;  4J3O D;  4HK2 A;  3HRD D;  4JIO U;  1LO5 D;  2RPQ A;  3QJZ A;  4MEM A;  2BYV E;  2NMQ A;  3VH4 B;  3DHG C;  5JHA A;  3ZTD A;  2N9E B;  2G4S A;  3MJW A;  1HEZ E;  1GB1 A;  2AYO B;  1YMH E;  4K7U A;  2MP2 A;  3B2G A;  2QIE B;  3L54 A;  3DBR I;  1JWS D;  3U30 A;  2KD0 A;  3QAQ A;  2CJN A;  1RRB A;  4GDK A;  3TEX A;  2WXI A;  4BKG A;  1WX9 A;  2WDQ B;  3ZNH B;  4NZL B;  3UI3 A;  2BW2 A;  3NVW A;  3ZW3 A;  3VTV A;  3MFG A;  4L23 A;  3ZUN A;  1WJN A;  2J0K A;  1YQ3 B;  2BTE A;  1XEE A;  2ASQ A;  1WE7 A;  5G2N A;  2WX1 A;  2IBI B;  1L5P A;  4BKT A;  5CHV C;  1YIW A;  3VTW A;  2LUE A;  4RFB A;  2NR2 A;  2Y3A A;  3GS2 A;  1LGR A;  5AZF A;  3LYY A;  2W3R A;  2IJ0 A;  4BOS C;  4M0W A;  5DPS A;  2MJ3 A;  2DHZ A;  2Y5B B;  1RYJ A;  2WXR A;  2IY0 B;  1PDX A;  2W3S A;  3KWL A;  2C5L C;  3P63 A;  4GB9 A;  3AEG B;  4ZYN A;  3QWZ B;  3IXS A;  4MSM B;  1V6E A;  1U4A A;  2OHF A;  4W9F A;  3WAP A;  1SE2 A;  1R4N I;  4AWJ A;  2BPS A;  4RF1 A;  2IDY A;  1V5O A;  2KZR A;  2W54 A;  4ANW A;  1WM2 A;  2V1Y A;  3B1L X;  3ZVV A;  3RNB C;  1YJJ A;  1WF9 A;  2HJ1 A;  3MTN B;  1CJE A;  2NBV B;  2CHZ A;  2BVC A;  1P98 A;  2GBR A;  3ZXR A;  4BBN F;  1Q5W B;  2BF8 B;  2OJR A;  2VH2 A;  3PRE A;  4S17 A;  4EZK A;  4LNO A;  5HG2 A;  2KXJ A;  3I57 A;  2RGF A;  3C8Y A;  3QAR A;  4G0N B;  5CX3 A;  3TEW A;  3ZJU A;  3R8B A;  1WJU A;  2IO0 B;  3V05 A;  2WS3 B;  4YTP B;  1Q1O A;  3TBL D;  4XC2 A;  2DLB A;  4I6L B;  4LDT B;  4OVZ A;  2RDG A;  5BMG A;  2BYT A;  3KYD D;  3Q6B A;  1R4M B;  3VDZ A;  4G11 A;  5EDS A;  1IP9 A;  1TKE A;  2V4L A;  1G6J A;  1ZDX A;  3L13 A;  2M0A A;  4NNJ B;  1QT9 A;  1WGG A;  1KF6 B;  4II2 B;  3H7S A;  2IGH A;  2BWE S;  2WXJ A;  2LD9 A;  2RSU A;  3NJT A;  4OHJ A;  3KYC D;  2MLB A;  4HJG E;  1J8C A;  2JYE A;  3IVF A;  2Z8L A;  4XE0 A;  1CQV A;  3EC8 A;  1J7B A;  2WGS A;  3IG3 A;  1SF0 A;  2AQ1 B;  5FK9 C;  3ETR A;  3D32 A;  2K3U A;  3EHV A;  2M0X A;  3KUC B;  5EE3 A;  4G3X B;  4FAD A;  1K8R B;  3ZJV A;  2KX3 A;  3AE6 B;  3MC8 A;  2G4D B;  5JHB A;  1VLB A;  1I4H A;  1C76 A;  2KOX A;  1E7P B;  1VRA B;  2EKE C;  3TMP B;  1KJT A;  1UBQ A;  3BWU D;  3BY4 B;  4E71 A;  1P9D U;  3UQA A;  2MBO A;  3SU8 X;  1QOA A;  2KT7 A;  3C0R B;  1AAR A;  1YQB A;  4KKI A;  2JY6 A;  5HFY A;  1TTN A;  3UIP B;  1TKG A;  4YT0 B;  1JWU D;  1RAX A;  1WGY A;  2IND C;  1WZ0 A;  4MM3 B;  1HE8 A;  2ZW0 A;  3A1Q A;  3RNG C;  3ENE A;  4ACF A;  1HTO A;  2MHJ A;  2LJ5 A;  3DQV A;  4WWP A;  4USA A;  3NZU A;  1TIF A;  4IUM B;  1MFW A;  2ZJD A;  3P2B A;  2J42 A;  2IY1 B;  2JVC A;  4H2A A;  1J19 A;  2KVZ A;  3GZN B;  1UD7 A;  3V3X A;  1YQ4 B;  2KX0 A;  3LXF A;  1E8Y A;  2LXA A;  4DWF A;  4BBN C;  4BOZ B;  3GE8 C;  3GB1 A;  3DBL I;  3AE4 B;  2V3S A;  2A5U A;  1TYG B;  1RLF A;  2JRH A;  4O1N A;  1WRI A;  4DHZ B;  2KFJ A;  1WX8 A;  3O13 A;  1XXG A;  2WDR B;  1ET9 A;  3AE7 B;  1WYG A;  5TR5 A;  2FCN A;  3DOW A;  1XCQ L;  4KIK A;  4LJP B;  2SEB D;  4AOF A;  1DYQ A;  3ZLZ A;  1PGX A;  3PHW B;  3GE3 C;  3DHI C;  4W9I A;  1L0Y B;  2K8H A;  1T0Y A;  4X57 B;  5HI1 A;  3TJP A;  2KC1 A;  2XBB C;  1IPG A;  5IA7 A;  4DHJ D;  3ZNG C;  1VJK A;  3PRZ A;  2PJH A;  3ZO5 B;  2VZK D;  1D4B A;  4WJN A;  5JXV A;  5LXH A;  1PFD A;  3QIJ A;  2AQ2 B;  1Y56 A;  4N58 A;  1D6E C;  3BVG A;  2YLM A;  1JWB D;  4ANU A;  4GGQ A;  3BIN A;  1HXY D;  2LXC A;  3TEY A;  3FIL B;  4REZ A;  1YNT E;  2MBE A;  1TS4 A;  2M8S A;  4PT5 A; 
#chains in the Genus database with same CATH homology
 2JSV X;  1ET6 A;  1CK1 A;  1TY2 A;  3TEZ A;  2L32 A;  1MHH E;  1OQR A;  1XLN A;  4KGS A;  1XLQ A;  1L6V A;  2AQ3 B;  1FM0 D;  4HRS A;  1C9F A;  1GPX A;  1OQQ A;  4HRO A;  2CU3 A;  1VR9 A;  1XO3 A;  2N9L A;  2I38 A;  2QJL A;  1UGJ A;  5LNK 1;  2VZK B;  1QQR A;  2H89 B;  4EE2 A;  2WXP A;  3NUH B;  1JWA D;  3KWV A;  5AUK A;  3I9V 1;  1MVK A;  2X38 A;  2DBY A;  4Q2J A;  1TKY A;  1V97 A;  1N62 A;  2FE8 A;  1SSN A;  3W2D A;  2WXN A;  1FRD A;  1SEB D;  2L52 A;  4AQ7 A;  1C4P A;  4GDL B;  2M19 A;  2IGG A;  2PIA A;  4YXD B;  3SFD B;  3VQI A;  3L4P A;  3OWE B;  2K0P A;  1ACC A;  2JWU A;  1ZDV A;  4B0M A;  4C80 A;  1V8C A;  1A70 A;  2G9H D;  3PO0 A;  1HA5 A;  1ZXH A;  1CZP A;  3Q8C A;  4N6E B;  4TQ1 A;  2LUM A;  4LLG M;  5BMH A;  3EUB 2;  4US9 A;  4UDU C;  2CJO A;  1L4D B;  4KX6 B;  2W55 A;  1TY0 A;  4RF0 A;  1WSP A;  1XF5 L;  1B1Z A;  1SJH D;  2M56 B;  3GP7 A;  2WNM A;  4IDI A;  3U52 E;  1WWT A;  2DWQ A;  2NTT A;  2WU5 B;  3MP9 A;  4XWT A;  3RFZ B;  1QOB A;  2KWD A;  1SJE D;  4KGR A;  1FMA D;  4KGT A;  2PKO A;  1N63 A;  2QEJ C;  2FBW B;  4J3O D;  3HRD D;  1T5X D;  1GAQ B;  1LO5 D;  5H8Y E;  2V3P A;  1SE4 A;  2NMQ A;  1HQR D;  1F2R C;  1SXT A;  1XLP A;  1FO4 A;  1HEZ E;  2KN4 A;  2L83 A;  1GB1 A;  1JQ4 A;  1YMH E;  2OED A;  3B2G A;  2ICI A;  3CWI A;  4LK0 M;  1TS5 A;  2Q5W D;  2QIE B;  4A9A A;  4ARI A;  5GXG B;  1F0Z A;  1JWS D;  2MH7 A;  2ON8 A;  3ZGZ A;  1PUT A;  1ESF A;  4ZRQ A;  5D3D A;  1NYQ A;  4P6V F;  1M4V A;  2AX5 A;  2CJN A;  1EM7 A;  3TEX A;  3NZ3 A;  3NRZ A;  3Q69 A;  3VRA B;  1FRR A;  2WXI A;  1E9M A;  2WDQ B;  1R7S A;  1STE A;  4TMA B;  4NZL B;  2PTL A;  3UI3 A;  2GB1 A;  3HUI A;  2YEP B;  2BW2 A;  1K50 A;  3NVW A;  2XNA C;  1T6B X;  1FD6 A;  3MFG A;  4A55 A;  4L23 A;  2DYO A;  3FAH A;  5BMI A;  1K53 A;  2BB6 A;  3Q8B A;  4ZOH C;  3BYY B;  1BXT A;  1YQ3 B;  4OZB A;  3U7Z A;  5BYS A;  1TS2 A;  5H92 C;  2K9X A;  1NI3 A;  4YTM B;  2BTE A;  1XEE A;  1I4R A;  3AED B;  1NVI D;  5MPO A;  2WXG A;  1T3Q A;  2FUG 1;  1SB3 C;  1L5P A;  3URY A;  3T3O A;  1PGB A;  3J9C A;  4YSY B;  1VZ7 A;  2PLP A;  3H8H A;  1SBB B;  4RFB A;  3AEC B;  2ONQ A;  2Y3A A;  3GS2 A;  2ACZ B;  1DGJ A;  3R2I A;  1BML C;  2K22 A;  3EA6 A;  3LYY A;  2W3R A;  2D5G A;  4MH8 A;  2IJ0 A;  4M0W A;  4D2K A;  2MJ3 A;  3KQ4 A;  2B76 B;  1JRO A;  1ZXI A;  5TSS A;  4PT5 A;  2WXL A;  2RPV A;  3AV8 A;  1RYJ A;  2WXR A;  3Q8E A;  4RCO A;  4RNA A;  1FCC C;  3VRB B;  4US8 A;  3AEB B;  1L6U A;  5T8I A;  1PDX A;  2W3S A;  3KWL A;  1JWM D;  3P63 A;  4HKZ E;  4ZRP A;  3TSS A;  4A90 A;  2INN E;  3AEG B;  2KQ4 X;  1HZ5 A;  1OFF A;  2BB5 A;  1UWM A;  2KAC A;  5EE1 A;  4YSX B;  1JW9 D;  4FXC A;  2WXK A;  2KAJ A;  2J52 A;  3IXS A;  4DXG A;  1AW7 A;  2V4I B;  2OHF A;  1UUP A;  1UWX A;  1SE2 A;  2MJE A;  1TS3 A;  2G1E A;  1QKZ A;  3FIL A;  1D5Z C;  4RF1 A;  2PW9 A;  2IDY A;  3NVV A;  5C2T B;  5AUI A;  2W54 A;  4N59 A;  2WXQ A;  4RGT A;  1IBX B;  3EGR A;  1ZP0 B;  1SE3 A;  1QLB B;  2WXM A;  3AM9 A;  2WQY B;  1L0V B;  3BII D;  4P16 A;  1QOG A;  1YJJ A;  4XWW A;  1GB4 A;  1CJE A;  2KDM A;  5FR3 A;  1YN4 A;  1NYR A;  1AWD A;  1VZ6 A;  3W5V B;  2IPK D;  2J4X A;  4DXF A;  4L2Y A;  2R61 A;  2HTM E;  1FNW A;  1NEK B;  5HG2 A;  4ARC A;  1ROE A;  4WAF A;  1EU4 A;  3I57 A;  1FXI A;  1AN8 A;  3C8Y A;  3Q8A A;  4B0E A;  4ZYS A;  1TZO A;  3AE2 B;  4HKQ A;  2QSD A;  3TEW A;  1MI0 A;  1P7F A;  3ZJU A;  3U2S C;  1QOF A;  2TSS A;  3BZD B;  3R8B A;  2WU2 B;  4JWU C;  1N5X A;  2BS3 B;  1EU3 A;  2QMT A;  1JCK B;  2N9K A;  3V05 A;  4GLS C;  2WS3 B;  1I4G A;  1K51 A;  4YTP B;  3VR8 B;  3IT6 B;  2WXH A;  2DLB A;  3NVY A;  2BBC A;  3BYT B;  1C77 A;  4OVZ A;  2NTS A;  3BVZ A;  1B9R A;  2RDG A;  3AE8 B;  4OZA A;  5D3I B;  5BMG A;  2BS4 B;  1V1O A;  1YN5 A;  1RFK A;  3ZQ4 A;  3ZYY X;  1YN3 A;  2BYT A;  2WDV B;  3W1S A;  2DYM A;  4KKJ A;  2LGI A;  2L1A A;  3AEA B;  3AEE B;  1E6E B;  1RWS A;  4WIP A;  1HZ6 A;  1TKE A;  3RPF C;  4JE3 B;  1XLO A;  3AEF B;  3B2F A;  1ZDX A;  3PZ7 A;  1WGK A;  1SIJ A;  2M0A A;  3MJ5 A;  3SR6 A;  2PMV A;  3LB8 C;  1QT9 A;  4DQO C;  1FNV A;  4AS1 A;  1KF6 B;  2RMM A;  2IGH A;  1E10 A;  1D5M C;  2WXJ A;  4TSS A;  4ITK A;  1N5W A;  4OHJ A;  4HJG E;  1V1P B;  1IGD A;  2JYE A;  4WWM A;  2Z8L A;  5HHD G;  5FKA C;  4XE0 A;  1MPE A;  4L1B A;  1CQV A;  4R3D A;  4C7Y A;  2N0S B;  1J7B A;  1SF0 A;  1BUI C;  2AQ1 B;  2ZW1 A;  2N7J A;  5FK9 C;  3P4S B;  3AE1 B;  1JML A;  3ETR A;  1Q10 A;  1ZOY B;  1FXA A;  2XN9 C;  3E9S A;  1DOY A;  4WQM A;  4RGN A;  1KTK A;  2K3U A;  3BK2 A;  2I2Y A;  2V0G A;  3PZ8 A;  4C7Z A;  5EE3 A;  3MHZ A;  2LHD A;  2RDH A;  3B9J A;  4MT5 A;  3ZJV A;  3AB5 A;  3AE6 B;  5I4D A;  2PVO D;  2HDE A;  3N9Y C;  2MEK A;  4XDC A;  1VLB A;  3AE3 B;  1IGC A;  1I4H A;  1K52 A;  2YEP F;  1C76 A;  2LFI A;  4TQ0 A;  1E7P B;  1L4Z B;  1VRA B;  3FC4 A;  4YSZ B;  1YJI A;  2LEK A;  1I4P A;  1DOX A;  3BWU D;  1C4C A;  4A8X C;  1C4A A;  3BVM A;  2E3T A;  3P4R B;  2K5P A;  4NAM A;  4LTU A;  1QF6 A;  2GRI A;  1V1P A;  1J7A A;  1XCT L;  2IGD A;  1QOA A;  3HVZ A;  1KLG D;  1MHX A;  2LMC A;  2H88 B;  3SFE B;  4A6Q A;  1EWY C;  4JX1 C;  1GOZ A;  4KKI A;  3WCQ A;  3KLS X;  3W5U B;  1WXQ A;  5HFY A;  1TKG A;  4YT0 B;  1JWU D;  2JXT A;  3E56 A;  1P7E A;  1N60 A;  2WXF A;  4ZHO A;  1KFY B;  2W82 A;  4MM3 B;  1E0Z A;  2ZW0 A;  1N61 A;  5BYQ A;  4IKG A;  5C3J B;  1FCL A;  2JYT A;  2JU6 X;  2MJD A;  1QIL A;  2WLB A;  4GDK B;  1I7H A;  4USA A;  4HEA 1;  4MAC A;  1VZ8 A;  4NJC A;  3AE9 B;  3TUO A;  3AN1 A;  2WP9 B;  4CQN A;  3DWG C;  4IOI E;  2J42 A;  1I4X A;  3IAM 1;  2WXO A;  4JWS C;  4RGM A;  1NEN B;  1C78 A;  2KMM A;  1JRP A;  4XDD A;  4H2A A;  3V3X A;  3P1M A;  1YQ4 B;  1ZE3 D;  3LXF A;  2LJI A;  1D5X C;  1FEH A;  1FIQ A;  5E6J A;  1ENF A;  4YTN B;  1F77 A;  1FFU A;  3P4Q B;  3AE5 B;  3P4P B;  4YWG G;  3GB1 A;  3Q8F A;  3AE4 B;  1RM6 C;  3U4E G;  5BYR A;  2J53 A;  1I4Q A;  1TYG B;  1ZPS A;  2Y5P A;  3NS1 A;  1IBX A;  3VR9 B;  3BK1 A;  3AMZ A;  4WH4 A;  3T3N A;  1C79 A;  4O1N A;  1WRI A;  2JZP A;  3O13 A;  2GI9 A;  1XXG A;  2WDR B;  2Y5C A;  1ET9 A;  3AE7 B;  1WYG A;  1XCQ L;  2SEB D;  2E6X A;  1DYQ A;  4WUR A;  3IAS 1;  1PGX A;  4OW0 A;  4RGO S;  1L0Y B;  3R2T A;  2JX5 A;  5HI1 A;  3MC0 B;  4JPS A;  1FNU A;  1PGA A;  2BS2 B;  1L0X B;  5G5H A;  2JQR B;  2LHE A;  3NVZ A;  5D7G A;  1ZUD 2;  2V3N A;  1VJK A;  1AYF A;  3W9C B;  1F2R I;  1FFV A;  4C56 C;  2VZK D;  1D4B A;  5JXV A;  2QIL A;  1PFD A;  4RH6 A;  2EEL A;  2AQ2 B;  5G5G A;  1IUE A;  1Y56 A;  4N58 A;  3SEB A;  1D6E C;  3ZJT A;  3BVG A;  1J7C A;  3HVD A;  3IT4 B;  1JAL A;  2PVG C;  3DWM A;  4ZHP A;  1JWB D;  3P42 A;  1UNS A;  1VDV A;  1HXY D;  2SAK A;  1KH0 A;  1KLU D;  2INP E;  1KRH A;  5EE0 A;  5EE9 A;  3ABV B;  3FIL B;  4REZ A;  3TEY A;  1TJE A;  3AH7 A;  3CIR B;  1PYW D;  1EWC A;  1YNT E;  4NAW B;  1DOI A;  4OZC A;  1TS4 A;  2BT6 A;  2EKI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...