2K9XA

Solution structure of urm1 from trypanosoma brucei
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
102
structure length
102
Chain Sequence
MSNHNHITVQFAGGCELLFAKQTSLQLDGVVPTGTNLNGLVQLLKTNYVKERPDLLVDQTGQTLRPGILVLVNSCDAEVVGGMDYVLNDGDTVEFISTLHGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Solution structure of Urm1 from Trypanosoma brucei
pubmed doi rcsb
source organism Trypanosoma brucei
molecule tags Unknown function
total genus 12
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2008-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09138 Urm1 Urm1 (Ubiquitin related modifier)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2k9xA00
3AEAB 1IUEA 3AEDB 3AH7A 2BT6A 1RFKA 1TYGB 1XO3A 2G1EA 2MJ3A 2K22A 3W5UB 5EE9A 4IDIA 1RYJA 1ZP0B 5EE0A 1QLBB 2L52A 2MH7A 1JW9D 3AN1A 1WWTA 2BS3B 4FXCA 1WYGA 3WCQA 1DGJA 1FXAA 1KF6B 3L4PA 1J7CA 1N63A 3SR6A 3CIRB 2WLBA 3DWMA 2WP9B 5H92C 1JALA 2ACZB 2JQRB 4ITKA 1CJEA 5AUKA 5AUIA 1NYRA 2H89B 1WRIA 2WDQB 3FC4A 1NI3A 5H8YE 1WXQA 1ROEA 1A70A 2B76B 2BS2B 3AEFB 3NVWA 2K5PA 1XLPA 3AEGB 1OQRA 1OQQA 2PIAA 2PVGC 4JWSC 3W9CB 1DOYA 2WS3B 4WQMA 1AYFA 2MJEA 1QOFA 3AMZA 3P1MA 4A9AA 2LEKA 3NRZA 4N59A 4C80A 1N62A 1DOIA 1T3QA 1SIJA 3BIID 4N6EB 5GXGB 3ABVB 3VRBB 2W54A 2PVOD 1YQ3B 2CJNA 3SFEB 1L0VB 3SFDB 2W55A 1RM6C 1TKEA 2Y5CA 2WU5B 1VDVA 4YTPB 1N5WA 1E6EB 2W3SA 1B9RA 1TKYA 2EKIA 1YJIA 3AE8B 1QOBA 1VLBA 2WQYB 4YT0B 2PKOA 2WDRB 4YTMB 3EUB2 3AEBB 1E10A 4P6VF 4C7ZA 1TJEA 1TKGA 3NS1A 5C2TB 1FFUA 1FMAD 1AWDA 2CU3A 1GPXA 1L5PA 1EWYC 1FM0D 2OHFA 3KWLA 5C3JB 1E9MA 1JWBD 4ZHOA 4YTNB 3B9JA 1SB3C 1V97A 3AE2B 1GAQB 1XLNA 3P4RB 2WDVB 2M19A 2M56B 3HRDD 3P4PB 3VRAB 1CZPA 3VR9B 1QT9A 4YSYB 1JQ4A 4WWMA 2WU2B 1JRPA 1SF0A 3W5VB 3AECB 1J7BA 1JROA 3DWGC 5G5GA 3NVVA 4ZOHC 1QOAA 3NVYA 3AE9B 1KFYB 3ETRA 1F0ZA 2QJLA 2MJDA 1I7HA 1YQ4B 3HVZA 1N61A 3RPFC 4YSZB 1JWAD 4HROA 1L6VA 3NVZA 1R7SA 1KRHA 3PO0A 1YJJA 3CWIA 1FFVA 1N60A 4C7YA 1J7AA 3B2GA 3FAHA 3ZYYX 2KAJA 4USAA 2BS4B 1NENB 5EE3A 1QF6A 1UWMA 3AEEB 4HRSA 4JX1C 3AE1B 4YSXB 1FXIA 1ZOYB 1XLOA 1FRRA 4JWUC 2HTME 1QOGA 1RWSA 1ZUD2 1E7PB 1DOXA 1L6UA 3AM9A 4US9A 1FO4A 1PFDA 2DWQA 3P4QB 1FRDA 2KMMA 1ZXIA 4KX6B 2CJOA 3AE3B 3AV8A 2L83A 3P4SB 5MPOA 4YXDB 2DBYA 4ZHPA 1WGKA 4LTUA 1FIQA 1PDXA 2K9XA 2E3TA 3B2FA 3LB8C 1XLQA 1PUTA 2N0SB 3VR8B 4US8A 3LXFA 1VJKA 3P63A 3AE4B 1V8CA 3AE6B 5G5HA 2H88B 1NVID 1E0ZA 2FBWB 2JX5A 4N58A 1NYQA 5EE1A 2Q5WD 1NEKB 2AX5A 3HUIA 3AE7B 3AB5A 2QIEB 3AE5B 1OFFA 2W3RA 1N5XA
chains in the Genus database with same CATH superfamily
2N9LA 2MJ3A 2WXOA 4BBNF 4NAWA 4GDKB 2WXQA 3AN1A 4BKSD 3MP9A 3HM6X 4JPSA 2GB1A 1WYGA 1WXAA 4PS7A 4GDLA 3FC4A 3KUZA 2GLSA 3E56A 1IPGA 3DBRI 5BYQA 3ML8A 1DOYA 2WS3B 1WZ3A 3DHHC 4OHJA 3AMZA 4ZRQA 1EF5A 2JPHA 3A4SC 2A5UA 2PVOD 1MHHE 2WU5B 1ZDXA 2D3BA 4MT5A 3QHTA 2ZJDA 4IW0A 3AEBB 2PTLA 4OZCA 3QQ8B 4GDLB 4LLGM 1H8CA 4G0NB 2CHZA 4AP4C 1Q5WB 1TY0A 5LNK1 3RUIB 1X1MA 1TS4A 1WE6A 3IBEA 2BYEA 2BTEA 1I7HA 3RPFC 2MX2A 1JWAD 1VR9A 2GBRA 3IG3A 2WXHA 2ZCBA 2DZIA 1XCTL 1D5ZC 1ACCA 4DDGD 3WIMA 2N9PC 1FEHA 3B0AA 4NJ6A 4WURA 2WYQA 1FO4A 3P4QB 2LUMA 4RF0A 2GRIA 2KJRA 4MSQB 4RFBA 3PSEB 2FCSA 2M17A 3W1SC 1PDXA 4J6IA 3V60A 1UBQA 2FBWB 1OQYA 5IOIA 2RGFA 1F9JA 2BT6A 2G1EA 2L0TA 1UBIA 2WGSA 3TBLD 5EE0A 4NPNA 1GG3A 3Q8BA 4EZKA 2V3NA 3N1ZC 3OAWA 5AUKA 3NJTA 3CMMB 3W1SA 5BO4B 1EUVB 3Q14C 5CHWA 1BUIC 2UYZB 3AEGB 1SE2A 3IT4B 5D3IB 5AEKB 3PLVA 2BKFA 1M94A 3N1YC 4RM9A 3KWVA 3BYTB 3UF8A 4TQ1A 3FILA 1WJUA 2BWES 1K52A 1YJIA 5KHOA 2SAKA 2JVCA 4IOIE 3NS1A 4LNIA 4E71A 3EFCA 1GAQB 1E8XA 3P4PB 3VRAB 4WWMA 4D2KA 4XWWA 3B08A 1HZ5A 4EUTA 3HM3A 2AQ3B 3JYUA 3MJWA 2D07B 4EFOA 2KXJA 3PV1A 1QZEA 1P1AA 2X38A 3J9CA 3DPDA 4HROA 4HKZE 5DCNA 4BAXA 3PRZA 3I9V1 3BVMA 4RCOA 2KDMA 3Q8AA 4ACFA 1E5WA 4USAA 2J42A 1WY8A 3MC0B 4DHJB 5KHQA 4I6LB 3L0WB 2AYOB 4ARIA 2KMMA 1L2NA 2LUEA 1GJZA 3T3OA 1K8RB 2MLBA 4HPMB 1C4PA 1CK1A 4W9IA 3TEWA 3M62B 3V6EB 1LO5D 2J53A 4XDDA 2NTTA 1OFFA 2BW2A 2MBQA 1TYGB 4KVGB 4NQLB 1WIAA 3GZNB 1RYJA 4IWOA 4PT5A 4XGAB 1FXAA 2LVPA 2J4XA 2TSSA 3NG0A 3UI3A 1TZ1A 2LGSA 4DXAB 2K0PA 4A90A 4ASWC 1EM7A 1ET6A 2L1AA 2MQJA 4ZRPA 4LNKA 2WXFA 5G55A 1IBXA 1L0VB 2XK5A 3ZXVA 2JY6A 1UUPA 2RDGA 4WAAA 4FLHA 1VZ7A 1I35A 1E10A 4RGMA 4H2AA 3KW5B 4XC2A 3ZJVA 3RD2A 2M56B 1WGRA 4K3BA 4LNNA 1CQVA 1C9FA 2I38A 3QK0A 2WXMA 3M95A 2INNE 3NVYA 2HDEA 3Q3FA 1K51A 4M0WA 3TUOA 3VTUA 5JZEB 1UH6A 1NDDA 3BVGA 4JL9A 3TJPA 3B2GA 3U7ZA 1VZ6A 1SIFA 4MH8A 1D4BA 3TIXA 1EO6A 1E7PB 3ZUNA 3ZJTA 4DHZB 1PFDA 2Z8LA 2CJOA 2HJ8A 3AE3B 3ZNHB 4MDKE 2AL6A 3SHQA 4HLEA 2OJWA 3B2FA 2M4NA 5CHVC 3KYCD 3RI7C 4M0WB 2AWTA 2MHJA 2YEPF 3NZUA 2O6VA 2WXLA 1I4HA 3NOBA 5JXVA 2D10A 2PEAA 3L54A 2BGFA 4GN1A 5H92C 3A4RA 4HWIB 4M02A 1WRIA 4WWOA 3E9SA 2C7NB 1QKZA 2FNJB 3O65B 4ANXA 2RMMA 2WXGA 1AYFA 5GXGB 3L16A 3ABVB 4BZAA 2EELA 2CU1A 3GOEA 2DYBA 2KWVB 1JQ4A 4P6VF 2R2OA 2CU3A 1WX9A 4BKTA 3W2DA 4F8CB 2Y3AA 1WXSA 1SF0A 4ANVA 1WX8A 3W5VB 1D6EC 1JROA 2BVCA 3DWGC 3IXSA 1E8ZA 3ZIMA 1UGMA 1HA5A 5BYSA 4MH0E 3DBLB 2QJLA 2KQSA 2JRIB 2MA9B 4CQNA 2O6VD 3Q6BA 1WX7A 1KM7A 1UD7A 1J7AA 3A9KA 2BS4B 3AEEB 1V86A 4XWTA 4GB9A 1TS5A 2AQ2B 1VD2A 2L8JA 4MGKE 3V6CB 3SD5A 2LD9A 1P7EA 4IWPA 3VR8B 3ZNID 1E0ZA 3A33B 2Q5WD 3ENEA 3AE7B 1KJTA 2NTSA 2KKCA 2XN9C 1SGHA 2KN5A 2VZKB 4PYUA 4FHJA 2C60A 2WXNA 4G50A 2IGGA 4FXCA 2MCNB 3L4PA 4PYZA 4YWGG 2JYEA 2ACZB 1CJEA 4OW0A 1I4GA 2KC1A 2ZNVC 4WQOB 2LJIA 1T0QC 3WA0A 4OVVA 3V62A 4WQMA 4KIKA 4N6EB 3FKYA 3ZDMC 2IGHA 3KQ4A 2DZJA 4ICVA 1LM8B 1PGXA 4RGOS 1B9RA 3A9JA 2JXXA 4AWJA 2A4ZA 5J2RA 2VZKD 4FN2A 2GI9A 5C2TB 1EWYC 1C79A 3ECIA 2KT7A 4HJGE 5FR3A 3GE3C 2LGIA 2NBWB 3DBHB 2WDVB 3UIPB 3L10B 2KK8A 3TSSA 4KIKB 2DZMA 2Y5BB 3JVZX 4KDIC 1N61A 1J8CA 5AZGA 5DPRA 4HCNB 4HXDA 2EMSA 1Q1OA 3R3MA 2PW9A 2JXTA 3EGRA 3DVGX 4MGIE 4LCDE 5J18A 3EC8A 1NENB 4NJCA 2CHXA 1XLOA 2HTME 3VTWA 4YL8A 2KDBA 1BXTA 3ZJUA 4MEMA 2L83A 4E3CA 1SJHD 1J0GA 1WGKA 2G4SA 1XLQA 3JSVB 3ZVVA 2LFIA 2M0AA 4JIOU 1LGRA 1V8CA 3U8ZA 3MJ5A 2JX5A 2KQ4X 1D5XC 2MBEA 5E6JA 4GDKA 3VFKA 2KNBA 5EE9A 2ONQA 3K9OB 4MACA 4OZBA 1DYQA 4B0MA 1DGJA 1KTKA 2WNMA 3CIRB 1MFWA 2JQRB 2PE6B 3ZNGC 1KLGD 3X0WA 2N9XA 2BPSA 1GB1A 3MC8A 3PS6A 2D3GA 2JWZA 3P1MA 4GGQA 1FNWA 1T3QA 1XT9B 4HKQA 1OGWA 3DHIC 2UU7A 1V1OA 2W3SA 4OVZA 1TKYA 2KMAA 4W9EA 4MJSB 1VLBA 2WQYB 2LI5A 3ONSA 4CHKA 3URYA 2RDBC 2DHZA 2KOXA 1EU4A 3KWLA 2BWFA 3AE2B 3P4RB 3Q3NC 2KFKB 2N1WA 4TKNA 2KYWA 2PMVA 2WU2B 1GUAB 1IYFA 3OLMD 2ZZPB 3PREA 2ZVNA 3KUDB 2RDHA 3QARA 1YQ4B 3R2IA 4K3CA 4II3B 3DBRB 1L6VA 2J7QB 2KMCA 3PRMB 3HVDA 3A1QB 4CO7A 2KAJA 1UWMA 1HTQA 2KDEB 1F2RI 2N4FA 4KX6B 3H7PB 2R61A 2VH1A 2DBYA 4NY0A 1V2YA 3AU4A 1PUTA 1VCBA 4URKA 4US8A 2QSDA 1PGBA 1WI0A 5CTRC 4BBNC 2BKRB 3AEDB 1XO3A 3U2SC 5D6JB 2YVCA 1ZP0B 2KD0A 1JW9D 1WWTA 4IG7B 3EFUA 2WLBA 1FXTB 2NS5A 3ALBA 1FNVA 2H89B 5IN7A 1V81A 3PTFC 3RNFC 1YIWA 4Q2JA 4ANUA 4UDUC 1C1YB 2J0JA 4A3OA 1V80A 3VRBB 1YJ1A 1SE3A 4AUQC 3BVZA 4YTPB 1UELA 1V5TA 4N9F4 2PKOA 2Z0EB 4C7ZA 1UF0A 1ZXHA 1TJEA 4TMAB 1TBEA 2WXPA 5AZFA 1JWBD 2K25A 4C4VB 2Z0DB 2N7JA 2ZVOA 3UQAA 2DAFA 1CZPA 4YSYB 2V4LA 3GB1A 3MHZA 3NZSA 2OJRA 4X57B 2WDTB 3VUWA 1I4XA 1ZE3D 3T9LA 3BWUD 4I6NB 1F0ZA 4M8NA 4W9JA 1FPYA 4GIVA 2BYVE 4ARCA 4IM3A 2K8BA 1ENFA 2WHIA 5AZHA 4LNFA 1YN5A 1ZUD2 2D11A 2IDYA 5J17A 4BOSC 4IKGA 3PZDA 3KUCB 1H4RA 3X23A 2MSED 4DXFA 2BF8B 2E3TA 4FHKA 2INCC 4ZRIA 4FJZA 3AE4B 2AEHA 1XF5L 2K8HA 1T0YA 4N58A 2QC8A 3PT2B 2BBCA 5FKAC 2QIEB 1XLPA 2FE8A 2OEDA 3H7SA 4AS1A 2DENB 4BFRA 3VXWA 5IAAC 2G3QB 1BMLC 1E7VA 3PZ8A 1N63A 4S0RA 3R8BA 2WP9B 1JALA 2IYDB 3DVGY 3UQBA 1PGAA 4A20A 1T5XD 3OWEB 4HEA1 2MJEA 1HXYD 3ZTCA 2MP2B 4C80A 5T8IA 4XE0A 3D32A 2ZEQA 1TIFA 3B1LX 4EZJA 1TKEA 3ML9A 1K50A 3AE8B 2WDRB 1WYWB 3AI5A 1WXVA 4AQ7A 1FFUA 4DHJD 1GPXA 4KGTA 2VH2A 4NNJB 4DWFA 3DVNU 3ZLZA 4DDID 5BYRA 2M19A 3HRDD 3C8YA 3I3TB 1QILA 3IHPC 1D3ZA 1WXMA 1B1ZA 4LDTB 1V9JA 1WMHA 3NY5A 4A55A 3AE9B 3PHWB 3WAPA 2VRRB 3ETRA 3HHMA 1S3SG 4WJQA 3BZDB 2PJHA 3NVZA 1KRHA 4MGYE 4OZAA 1FFVA 1WGGA 4NAMA 3FAHA 3RZWC 4C56C 2LGDA 1EWCA 2ZW0A 3BK1A 2C5LC 2L05A 2BB5A 2L76A 2QHOA 3P42A 2KQ7A 5L95C 4KSLC 3U4EG 1WMHB 2KACA 5MPOA 4YXDB 3EHVA 1V6EA 1E90A 4WJPA 1V49A 1ISNA 2H88B 1NVID 5C23A 2WX0A 2KTRB 2K22A 3IVFA 4G11A 2BS3B 2KANA 1C76A 3VDZA 2IO3B 3IAM1 3VUYA 1OQRA 1OQQA 2INPE 4MM3B 3IFWB 4JGHB 4HK2A 4FADA 4B6WA 1TT5B 3BIID 1DOIA 4RGNA 1QQRA 2WXJA 4KV2A 5LXHA 1D5MC 1RM6C 2PPHA 1E6EB 1JWUD 1GC6A 2L7RA 5JHBA 5D3DA 4KSKC 3OJ3A 1L4ZB 4ZYNA 2UWQA 4IM0A 1FM0D 2KZRA 4P7IA 1MG8A 3NZ3A 4J3OD 3KVFB 2IGDA 2FIFA 3DQVA 3APFA 2GBNA 2IBIB 3H1UA 3RMKC 4HPPA 1YQBA 2DLBA 2IY1B 4JX1C 4W9FA 4A8XC 2RD0A 3R2TA 1FRRA 3U7DA 1QOGA 2LMCA 2W82A 2D3CA 2N7DA 3GE8C 2JUOA 2PE9A 3DBLI 2K9XA 3I57A 3T8MA 4AOFA 2WXRA 5CX3A 1WJ4A 2V3SA 2LRWA 2XBBC 3UGBB 3Q8FA 1N5XA 2K39A 4WIPA 3RNAC 3AH7A 2KX0A 2D3AA 1GB4A 5JHAA 1L7YA 1ZKHA 3S2AA 4W9DA 2Z59B 3K9PB 4P1BC 2KO3A 1KLUD 1ZGUB 2L32A 4RM8A 3CSTA 3BK2A 2ON8A 3V3XA 2BS2B 3NVWA 1JCKB 3NS8A 2KDFB 1C3TA 4B0EA 2O2VB 1JWMD 1YN4A 2W55A 4MELA 4HCPB 1WGHA 1MPEA 5HI1A 1QOBA 4YT0B 5EDSA 3EUB2 1YX6B 2MBBB 1AWDA 3VQIA 4ZHOA 1P0RA 1V97A 3UIOB 2YEPB 1KLVA 5E6OA 2ZW1A 3QCAA 4DBGA 1ESFA 3MTNB 2KX3A 4WJNA 1NI2A 1OEYJ 2KFJA 1R4NI 3BY4B 1R4MI 2JYTA 5JH5C 3T3NA 4IUMB 1YNTE 2K6DB 4WAFA 3QJZA 2KWUB 4KGSA 2LRUA 1WH3A 3DVNV 5EE3A 4YSXB 1ZOYB 2G45B 3BINA 3AM9A 2M0XA 4DQOC 2L00B 2NVUI 1L4DB 4II2B 4LNOA 1RRBA 3JSVA 4ZHPA 1RAXA 4LTUA 5I4DA 3LXFA 3ZXRA 4AJWA 2KN4A 4REZA 4LJOB 3L13A 1IGDA 1WM2A 4BOZB 1T0SC 1QLBB 2M8SA 3IAS1 4KZCA 3C0RB 2LASA 3DWMA 1LQBA 1K53A 4ITKA 5TR5A 5H8YE 4TQ0A 3O13A 2B76B 3WAMA 3Q8CA 2K5PA 2LWPA 2D5GA 5BMIA 3AU5A 2LVQA 1YX5B 1MJDA 1QOFA 3NRZA 4LK0M 4DXGA 4W9LA 4W9GA 2JZ3B 1YMHE 1JMLA 2NPTB 2C9WB 2QILA 4MJSA 3RZFA 2CKHB 2LGXA 1FMAD 2KFKA 4YTNB 1SSNA 2JWUA 1V1PB 3APDA 2RR9A 3AXCA 2YLMA 1Q10A 4RH6A 4GLSC 1TGZB 3DOWA 4I6PA 4CYEA 3WAOA 3Q2AC 1RLFA 3UINB 1T6BX 4EKUA 1VRAB 3BYYB 3A1QA 3PO0A 2DAJA 2V1YA 2G4DB 3U52E 4W9KA 1F2RC 1WR6E 3CSFA 3PGEA 1WJNA 2KDIA 1QF6A 4MSMB 4JWUC 3H7PA 2LJ5A 2J0KA 1IGCA 2KJ6A 3I63C 3RNGC 2LXAA 2KJHB 1ZDVA 3L17A 3QC8B 1GNUA 4PS3A 4K7UA 3TL5A 4PK1A 1NYQA 1E7UA 2N1VA 3AB5A 1HQRD 2DX5B 1I4RA 4P1CC 2LGYA 2L52A 1XXGA 1MG4A 4NAWB 2JF5A 1U4AA 2MWSB 4TUUA 1EU3A 3TEXA 2XEWA 3OJ4B 2MW5A 2MRPA 2PIAA 2PVGC 1STEA 2IO1B 4A9AA 4N59A 1YN3A 5CHFA 2W54A 1HZ6A 2V9HA 1KOTA 2Y5CA 3N1XC 3RN9C 2ASQA 1S1QB 3PZ7A 2RSUA 2XNAC 4XYCA 2I1KA 4KGRA 2FIDA 3R7QA 4EEWA 4C4VA 5C3JB 2OHFA 2DNFA 2IJ0A 4RMAA 4FJYA 2GBJA 3ZNZB 2K1FA 4NQKE 1QT9A 3VR9B 3TEYA 2R2QA 4EE2A 4FA6A 1T0RC 4ZRKA 4NZLB 4PS8A 3QX1A 3RYTA 4B95A 3C19A 2MJDA 3VTVA 3CF6E 2OOBB 3Q3MC 3PLUA 1WFYA 4L1BA 3H9DA 4GOCA 4IC7B 1F52A 3RT3B 2SEBD 3KH0A 3V61A 3MFGA 5TSSA 3N3KB 2KWDA 2V0GA 4FJVB 1RFAA 2EMTA 2HD5B 2CHWA 2BYFA 1SXTA 3LYYA 4M00A 4WJOA 3RFZB 5EE1A 4JE3B 3HK0A 3AE5B 3QAQA 2LZ6A 2QDFA 3R66C 4ZDVA 1WGYA 4XZ4A 3LJ3A 3WCQA 2ZPYA 2K3UA 4JQWC 4KZ0A 1BT0A 2WXIA 4ZRJA 3AEFB 4ANWA 2MP2A 3H6NA 3N30A 3W1YA 4DK5A 2NR2A 1G6JA 2LEKA 1HTOA 1TZOA 5D94A 3VH3B 1N62A 5FR6A 4K1RB 4KDLB 4OVUA 1WM3A 1J19A 1VDVA 1N5WA 2CR5A 1Y56A 3FILB 2L3ZA 2KVRA 1WJ6A 4YTMB 1WSPA 1XEEA 1TTNA 3MHSD 5L83A 2IY0B 4F1SA 4S17A 4JLCA 3SDLC 4EOYA 1AARA 1P9DU 2DYOA 4GU2A 2PLPA 1F1HA 1P7FA 3GZNI 2KHWB 4L23A 4WH4A 1QOAA 4C00A 1KFYB 5DPSA 3SU8X 3DDCB 2M1MA 1CMXB 4W9CA 2MBHA 2IO2B 4W9HA 2N7EA 5D2MB 4TV3A 4C7YA 3N9YC 3SEBA 1WF9A 2ICIA 1FXIA 3RCZA 2J0MA 3M3JA 1DOXA 2FCMA 1JRUA 2B3AA 2DWQA 2I1JA 1Y8RC 3AV8A 1FCCC 4R3DA 1WGDA 5GMVA 3LB8C 2BB6A 5G5HA 1I4QA 2INDC 2HJ1A 3N20C 2KTRA 1Q0WB 3MC9A 3AEAB 4IDIA 2ZCCA 1L0YB 5E6NA 1Z2MA 1VZ8A 1SE4A 1UWXA 2N9EB 1SJED 1OEYA 4G3XB 4O1NA 4MM3A 2WDQB 1NI3A 1WXQA 3ZKJC 1A70A 2KC2A 4LDTD 5LLIA 3VUXA 3W9CB 1UGJA 1I4PA 2KWCA 4M01A 2GBKA 1SIJA 1EF1A 4HJKA 5DPWA 3GS2A 2QMTA 2L0FA 4DHZE 2JRHA 1IBXB 1XQQA 1OTRB 2LHEA 2XK5B 2EKIA 4E74A 3APCA 2KVZA 1P98A 1MVKA 2RPQA 1E9MA 3Q3OC 4GSWA 4NJ7A 2V4IB 2AL3A 2QCZA 3AECB 1LXDA 4ZOHC 2GOWA 1MI0A 3Q69A 3TCAA 1E8YA 3QIJA 1ZPSA 1YD8U 2JT4B 3U30A 1R7SA 3NUHB 2FUG1 1N60A 2JZZA 3ZQ4A 3PHXB 3LDZE 2C7MB 1N6ZA 3L08A 5IKCM 2EKEC 1L6UA 3NHEB 1AN8A 3Q3JA 2N9KA 3HIZA 3P4SB 4HDOA 4HDQA 1FIQA 4A6QA 2IPKD 5IO9A 3Q8EA 3P63A 2IZVB 1C78A 3EECA 3AE6B 2BYTA 4IM2A 1WZ0A 2LHDA 1NEKB 2FUHB 4F7ZA 3QA8A 2JSVX 2O6VB 4BKGA 1SE9A 2MH7A 4TSSA 2V3PA 4GMVA 1Z5SB 3JW0X 1J7CA 3GP7A 3SR6A 4RGTA 1NYRA 1UNSA 3VAWA 3N32A 1ROEA 4JWSC 3ZW3A 1JWSD 2O2VA 4WWNA 4ZYSA 1E8WA 4KKIA 2REXA 2C7HA 3I5JC 2K8CA 1GC7A 3SFDB 3KLSX 4BVUC 1TS2A 4XDCA 5G2NA 2JZPA 3R7RA 5FK9C 1M4VA 3P2BA 1TS3A 3VHTC 1P3QU 3ZDTA 2W9NA 1L5PA 5IP4D 3ZRFA 1F77A 1KH0A 1L0XB 1SB3C 3QWZB 4HPLB 5HFYA 1ZW7A 2JU6X 2G9HD 1WE7A 3VH4B 2K6QA 1FCLA 5G5GA 3NVVA 1HEZE 2KLGA 4HVBA 3HVZA 1WRDB 4RNAA 4YSZB 2Y5PA 1XD3B 4XX5A 1NBFC 2BQQA 3CWIA 5HKHA 3ZYYX 4K81A 2LVOA 1LFDA 1MHXA 3AE1B 3A9KB 3PPAA 4AJYB 1GOZA 4B9KA 3RNCC 3DHGC 5BMHA 1ET9A 3TEZA 4FULA 5DPTA 1FRDA 5HG2A 3OG5A 3TMPB 4RF1A 2N0SB 2GBMA 1XCQL 3ZRCA 1IUEA 1RFKA 4LJPB 3W5UB 3DBHI 4KKJA 3DBSA 3V05A 4FBJB 2KTFA 3ZO5B 1R4NB 1KF6B 1R4MB 2LXCA 1PYWD 3H8HA 1C4AA 1HE8A 2NMQA 2D2QA 5AUIA 1I42A 1PQSA 4ICUA 3WANA 2FAZA 3RNBC 5C1ZA 3WALA 1IP9A 1WR1A 3M63B 1YOVB 2HTHA 2NPTA 2MBOA 1YQ3B 2CJNA 2NBVB 3SFEB 3ZTDA 4IWQA 1FNUA 4GXBA 4A3PA 4BKSA 4K7WA 2FCQA 2E6XA 2RPVA 3RNEC 4L2YA 1TKGA 3A9JB 3DCGA 2DZKA 4P16A 2ZNVB 3B9JA 1V1PA 5IA7A 1XLNA 4QAYA 1JRPA 2J52A 5HHDG 3EA6A 1J7BA 1SEBD 1UZXB 5E6PA 1C4CA 1FD6A 2CS4A 2WWZA 2AQ1B 1C77A 2IO0B 5D7GA 1YJJA 2NCNA 3RULA 4M8MA 4MGZE 2HE7A 4K7SA 2WXKA 4HRSA 1TY2A 2DYMA 1A5RA 1RWSA 2FCNA 1AW7A 1SBBB 3IT6B 4US9A 1V5OA 3KYDD 5BMGA 2ZPNA 2MEKA 1ZXIA 4WWPA 2KLCA 2QEJC 3PVLA 3PRPB 2WX1A 3AULA 3VVWB 1VJKA 4EZLA 2GMIC 2X8XX 2I2YA 2AX5A 3HUIA 3ZGZA 2NBUA 5LXIB 2W3RA
chains in the Genus database with same CATH topology
2XN9C 2N9LA 2MJ3A 2K22A 2WXOA 2VZKB 4GDKB 2WXQA 2WXNA 3AN1A 3MP9A 4JPSA 2IGGA 2BS3B 2GB1A 1WYGA 4FXCA 3WCQA 3L4PA 1C76A 4YWGG 2JYEA 2K3UA 2ACZB 1CJEA 4OW0A 1I4GA 3FC4A 2WXIA 3E56A 3AEFB 2LJIA 3IAM1 5BYQA 1OQRA 1OQQA 2INPE 4MM3B 1DOYA 2WS3B 4WQMA 4OHJA 3AMZA 2LEKA 4ZRQA 1TZOA 1N62A 1DOIA 3BIID 4N6EB 1QQRA 2WXJA 4RGNA 2PVOD 1D5MC 2IGHA 3KQ4A 1RM6C 1MHHE 2WU5B 1ZDXA 1VDVA 4MT5A 1N5WA 1PGXA 1E6EB 1JWUD 1Y56A 3FILB 4RGOS 1B9RA 4YTMB 1WSPA 3AEBB 1XEEA 5D3DA 2PTLA 2VZKD 2GI9A 5C2TB 1L4ZB 4OZCA 1EWYC 1FM0D 1C79A 4GDLB 4LLGM 5FR3A 4HJGE 2LGIA 2WDVB 3NZ3A 2DYOA 1TY0A 4J3OD 3TSSA 5LNK1 2PLPA 1P7FA 4L23A 4WH4A 1TS4A 1QOAA 2IGDA 1KFYB 2BTEA 1I7HA 3RPFC 1N61A 1JWAD 1VR9A 2WXHA 1XCTL 1D5ZC 1ACCA 2PW9A 2JXTA 3EGRA 3N9YC 4C7YA 3SEBA 2ICIA 2DLBA 1FEHA 1NENB 4NJCA 4JX1C 4A8XC 1FXIA 1XLOA 1FRRA 3R2TA 4WURA 2HTME 1QOGA 2LMCA 1DOXA 2W82A 1FO4A 1BXTA 2DWQA 3P4QB 2LUMA 4RF0A 3ZJUA 3AV8A 2L83A 1FCCC 2GRIA 4R3DA 1SJHD 4RFBA 1WGKA 2K9XA 1PDXA 3LB8C 1XLQA 3I57A 2BB6A 2LFIA 2M0AA 2WXRA 1V8CA 1I4QA 5G5HA 3MJ5A 2FBWB 2JX5A 2KQ4X 1D5XC 3Q8FA 1N5XA 4WIPA 3AEAB 5E6JA 3AH7A 2BT6A 2G1EA 1GB4A 5EE9A 2ONQA 4IDIA 5EE0A 4MACA 1L0YB 4OZBA 1DYQA 1VZ8A 3Q8BA 2V3NA 4B0MA 1DGJA 1KTKA 1SE4A 2WNMA 3CIRB 1UWXA 1KLUD 1SJED 2JQRB 5AUKA 2L32A 3W1SA 1KLGD 4O1NA 2WDQB 3BK2A 2ON8A 1BUIC 1NI3A 3V3XA 1GB1A 1WXQA 2BS2B 1A70A 3NVWA 3AEGB 1SE2A 3IT4B 5D3IB 3W9CB 1JCKB 1UGJA 1I4PA 3P1MA 4B0EA 1FNWA 1T3QA 1SIJA 4HKQA 1JWMD 3GS2A 3BYTB 3KWVA 2QMTA 4TQ1A 1YN4A 3FILA 2W55A 1IBXB 1V1OA 2LHEA 1MPEA 2W3SA 4OVZA 5HI1A 1TKYA 2EKIA 1K52A 1YJIA 1QOBA 1VLBA 2WQYB 4YT0B 3EUB2 2SAKA 3URYA 4IOIE 3NS1A 1MVKA 1AWDA 1EU4A 3KWLA 1E9MA 3VQIA 4ZHOA 1V97A 3AE2B 1GAQB 2YEPB 3P4RB 3P4PB 3VRAB 2PMVA 2V4IB 4WWMA 2WU2B 2ZW1A 4D2KA 1ESFA 4XWWA 1HZ5A 3AECB 2AQ3B 4ZOHC 1MI0A 2RDHA 3Q69A 2X38A 3J9CA 2JYTA 1YQ4B 1ZPSA 3R2IA 3T3NA 4HROA 1L6VA 4HKZE 1YNTE 1R7SA 3NUHB 3HVDA 4WAFA 2FUG1 4KGSA 1N60A 3I9V1 3BVMA 3ZQ4A 4RCOA 2KDMA 3Q8AA 2KAJA 4USAA 2J42A 5EE3A 1UWMA 3MC0B 4YSXB 1ZOYB 1L6UA 1F2RI 3AM9A 4DQOC 4ARIA 1AN8A 4KX6B 2KMMA 1L4DB 2N9KA 2R61A 3P4SB 2DBYA 4ZHPA 4LTUA 5I4DA 1FIQA 4A6QA 2IPKD 3T3OA 1PUTA 3Q8EA 4US8A 3LXFA 3P63A 1C78A 1C4PA 1CK1A 2QSDA 3AE6B 3TEWA 1PGBA 2BYTA 2KN4A 2LHDA 1NEKB 4REZA 1LO5D 2J53A 1IGDA 4XDDA 2NTTA 1OFFA 3AEDB 2BW2A 1XO3A 1TYGB 3U2SC 2JSVX 1RYJA 1ZP0B 1QLBB 2MH7A 1JW9D 4PT5A 4TSSA 1WWTA 2V3PA 3IAS1 1FXAA 1J7CA 3GP7A 3SR6A 2WLBA 3DWMA 1K53A 2J4XA 2TSSA 4ITKA 3UI3A 1FNVA 4RGTA 1NYRA 2H89B 1UNSA 5H8YE 4TQ0A 4Q2JA 3O13A 1ROEA 2B76B 3Q8CA 4UDUC 2K5PA 2D5GA 5BMIA 4JWSC 2K0PA 4A90A 1JWSD 1QOFA 1EM7A 4ZYSA 3NRZA 4KKIA 4LK0M 1ET6A 2L1AA 4DXGA 4ZRPA 2WXFA 3VRBB 1IBXA 1YMHE 1SE3A 1JMLA 1L0VB 3BVZA 3KLSX 3SFDB 2QILA 1TS2A 4XDCA 4YTPB 1UUPA 2RDGA 2JZPA 5FK9C 1M4VA 1VZ7A 2PKOA 1E10A 1TS3A 4RGMA 4H2AA 4C7ZA 1ZXHA 1TJEA 4TMAB 2WXPA 1FMAD 1L5PA 1JWBD 1F77A 1KH0A 4YTNB 3ZJVA 1L0XB 1SB3C 2N7JA 1SSNA 2M56B 2JWUA 5HFYA 1CZPA 4YSYB 1V1PB 3GB1A 3MHZA 1CQVA 2JU6X 2G9HD 1C9FA 2I38A 1FCLA 2WXMA 1I4XA 5G5GA 1ZE3D 2INNE 1Q10A 3NVVA 3NVYA 1HEZE 3BWUD 2HDEA 4RH6A 4GLSC 1F0ZA 4M0WA 1K51A 3HVZA 4RNAA 3TUOA 4YSZB 1T6BX 1VRAB 2Y5PA 3BYYB 3PO0A 4ARCA 3U52E 3CWIA 3BVGA 1F2RC 1ENFA 3B2GA 3U7ZA 3ZYYX 1VZ6A 1MHXA 1QF6A 4MH8A 3AE1B 1D4BA 4JWUC 1GOZA 1YN5A 1ZUD2 3ZJTA 1E7PB 5BMHA 2IDYA 1ET9A 3TEZA 1PFDA 2Z8LA 1FRDA 4IKGA 1IGCA 2CJOA 3AE3B 5HG2A 4DXFA 1ZDVA 2E3TA 3B2FA 4RF1A 2N0SB 3AE4B 1XCQL 1XF5L 4N58A 1NYQA 2BBCA 2YEPF 5FKAC 3AB5A 2QIEB 1HQRD 1XLPA 1IUEA 2FE8A 2WXLA 1RFKA 1I4RA 2OEDA 3W5UB 4KKJA 4AS1A 1I4HA 3V05A 2L52A 5JXVA 1XXGA 1BMLC 4NAWB 3PZ8A 1KF6B 3H8HA 1N63A 1PYWD 3R8BA 2WP9B 1C4AA 1EU3A 1JALA 2NMQA 5H92C 3TEXA 5AUIA 1WRIA 3E9SA 1PGAA 1QKZA 1T5XD 2PIAA 2PVGC 1STEA 2RMMA 3OWEB 2WXGA 1AYFA 2MJEA 4HEA1 1HXYD 4A9AA 4N59A 4C80A 1YN3A 5GXGB 3ABVB 5T8IA 2W54A 4XE0A 1YQ3B 2CJNA 3SFEB 1HZ6A 2EELA 1TKEA 2Y5CA 1FNUA 3PZ7A 1K50A 3AE8B 2XNAC 1JQ4A 2RPVA 2E6XA 2WDRB 4KGRA 4P6VF 4L2YA 1TKGA 4AQ7A 1FFUA 2CU3A 1GPXA 5C3JB 2OHFA 3W2DA 4P16A 4KGTA 3B9JA 1V1PA 2IJ0A 1XLNA 5BYRA 2M19A 2Y3AA 3C8YA 3HRDD 1QILA 3VR9B 1QT9A 3TEYA 1B1ZA 4EE2A 1JRPA 1SF0A 3W5VB 2J52A 1D6EC 5HHDG 3EA6A 1J7BA 1JROA 3DWGC 3IXSA 4A55A 3AE9B 1HA5A 5BYSA 1SEBD 4NZLB 3ETRA 2QJLA 1C4CA 1FD6A 2MJDA 3BZDB 2AQ1B 1C77A 3NVZA 4CQNA 1KRHA 4OZAA 5D7GA 4L1BA 1YJJA 1FFVA 4NAMA 1J7AA 2WXKA 3FAHA 2SEBD 4C56C 2BS4B 3AEEB 4HRSA 1EWCA 2ZW0A 4XWTA 3BK1A 1TY2A 2DYMA 1RWSA 2BB5A 3MFGA 5TSSA 1AW7A 1SBBB 3IT6B 2KWDA 1TS5A 4US9A 2AQ2B 2V0GA 5BMGA 2MEKA 3P42A 1ZXIA 3U4EG 2KACA 2QEJC 5MPOA 4YXDB 1SXTA 3LYYA 1P7EA 3RFZB 3VR8B 1VJKA 2H88B 1NVID 2I2YA 1E0ZA 5EE1A 4JE3B 2Q5WD 2AX5A 3HUIA 3AE7B 3ZGZA 3AE5B 2W3RA 2NTSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AEA B;  1IUE A;  3AED B;  3AH7 A;  2BT6 A;  1RFK A;  1TYG B;  1XO3 A;  2G1E A;  2MJ3 A;  2K22 A;  3W5U B;  5EE9 A;  4IDI A;  1RYJ A;  1ZP0 B;  5EE0 A;  1QLB B;  2L52 A;  2MH7 A;  1JW9 D;  3AN1 A;  1WWT A;  2BS3 B;  4FXC A;  1WYG A;  3WCQ A;  1DGJ A;  1FXA A;  1KF6 B;  3L4P A;  1J7C A;  1N63 A;  3SR6 A;  3CIR B;  2WLB A;  3DWM A;  2WP9 B;  5H92 C;  1JAL A;  2ACZ B;  2JQR B;  4ITK A;  1CJE A;  5AUK A;  5AUI A;  1NYR A;  2H89 B;  1WRI A;  2WDQ B;  3FC4 A;  1NI3 A;  5H8Y E;  1WXQ A;  1ROE A;  1A70 A;  2B76 B;  2BS2 B;  3AEF B;  3NVW A;  2K5P A;  1XLP A;  3AEG B;  1OQR A;  1OQQ A;  2PIA A;  2PVG C;  4JWS C;  3W9C B;  1DOY A;  2WS3 B;  4WQM A;  1AYF A;  2MJE A;  1QOF A;  3AMZ A;  3P1M A;  4A9A A;  2LEK A;  3NRZ A;  4N59 A;  4C80 A;  1N62 A;  1DOI A;  1T3Q A;  1SIJ A;  3BII D;  4N6E B;  5GXG B;  3ABV B;  3VRB B;  2W54 A;  2PVO D;  1YQ3 B;  2CJN A;  3SFE B;  1L0V B;  3SFD B;  2W55 A;  1RM6 C;  1TKE A;  2Y5C A;  2WU5 B;  1VDV A;  4YTP B;  1N5W A;  1E6E B;  2W3S A;  1B9R A;  1TKY A;  2EKI A;  1YJI A;  3AE8 B;  1QOB A;  1VLB A;  2WQY B;  4YT0 B;  2PKO A;  2WDR B;  4YTM B;  3EUB 2;  3AEB B;  1E10 A;  4P6V F;  4C7Z A;  1TJE A;  1TKG A;  3NS1 A;  5C2T B;  1FFU A;  1FMA D;  1AWD A;  2CU3 A;  1GPX A;  1L5P A;  1EWY C;  1FM0 D;  2OHF A;  3KWL A;  5C3J B;  1E9M A;  1JWB D;  4ZHO A;  4YTN B;  3B9J A;  1SB3 C;  1V97 A;  3AE2 B;  1GAQ B;  1XLN A;  3P4R B;  2WDV B;  2M19 A;  2M56 B;  3HRD D;  3P4P B;  3VRA B;  1CZP A;  3VR9 B;  1QT9 A;  4YSY B;  1JQ4 A;  4WWM A;  2WU2 B;  1JRP A;  1SF0 A;  3W5V B;  3AEC B;  1J7B A;  1JRO A;  3DWG C;  5G5G A;  3NVV A;  4ZOH C;  1QOA A;  3NVY A;  3AE9 B;  1KFY B;  3ETR A;  1F0Z A;  2QJL A;  2MJD A;  1I7H A;  1YQ4 B;  3HVZ A;  1N61 A;  3RPF C;  4YSZ B;  1JWA D;  4HRO A;  1L6V A;  3NVZ A;  1R7S A;  1KRH A;  3PO0 A;  1YJJ A;  3CWI A;  1FFV A;  1N60 A;  4C7Y A;  1J7A A;  3B2G A;  3FAH A;  3ZYY X;  2KAJ A;  4USA A;  2BS4 B;  1NEN B;  5EE3 A;  1QF6 A;  1UWM A;  3AEE B;  4HRS A;  4JX1 C;  3AE1 B;  4YSX B;  1FXI A;  1ZOY B;  1XLO A;  1FRR A;  4JWU C;  2HTM E;  1QOG A;  1RWS A;  1ZUD 2;  1E7P B;  1DOX A;  1L6U A;  3AM9 A;  4US9 A;  1FO4 A;  1PFD A;  2DWQ A;  3P4Q B;  1FRD A;  2KMM A;  1ZXI A;  4KX6 B;  2CJO A;  3AE3 B;  3AV8 A;  2L83 A;  3P4S B;  5MPO A;  4YXD B;  2DBY A;  4ZHP A;  1WGK A;  4LTU A;  1FIQ A;  1PDX A;  2K9X A;  2E3T A;  3B2F A;  3LB8 C;  1XLQ A;  1PUT A;  2N0S B;  3VR8 B;  4US8 A;  3LXF A;  1VJK A;  3P63 A;  3AE4 B;  1V8C A;  3AE6 B;  5G5H A;  2H88 B;  1NVI D;  1E0Z A;  2FBW B;  2JX5 A;  4N58 A;  1NYQ A;  5EE1 A;  2Q5W D;  1NEK B;  2AX5 A;  3HUI A;  3AE7 B;  3AB5 A;  2QIE B;  3AE5 B;  1OFF A;  2W3R A;  1N5X A; 
#chains in the Genus database with same CATH topology
 2N9L A;  2MJ3 A;  2WXO A;  4BBN F;  4NAW A;  4GDK B;  2WXQ A;  3AN1 A;  4BKS D;  3MP9 A;  3HM6 X;  4JPS A;  2GB1 A;  1WYG A;  1WXA A;  4PS7 A;  4GDL A;  3FC4 A;  3KUZ A;  2GLS A;  3E56 A;  1IPG A;  3DBR I;  5BYQ A;  3ML8 A;  1DOY A;  2WS3 B;  1WZ3 A;  3DHH C;  4OHJ A;  3AMZ A;  4ZRQ A;  1EF5 A;  2JPH A;  3A4S C;  2A5U A;  2PVO D;  1MHH E;  2WU5 B;  1ZDX A;  2D3B A;  4MT5 A;  3QHT A;  2ZJD A;  4IW0 A;  3AEB B;  2PTL A;  4OZC A;  3QQ8 B;  4GDL B;  4LLG M;  1H8C A;  4G0N B;  2CHZ A;  4AP4 C;  1Q5W B;  1TY0 A;  5LNK 1;  3RUI B;  1X1M A;  1TS4 A;  1WE6 A;  3IBE A;  2BYE A;  2BTE A;  1I7H A;  3RPF C;  2MX2 A;  1JWA D;  1VR9 A;  2GBR A;  3IG3 A;  2WXH A;  2ZCB A;  2DZI A;  1XCT L;  1D5Z C;  1ACC A;  4DDG D;  3WIM A;  2N9P C;  1FEH A;  3B0A A;  4NJ6 A;  4WUR A;  2WYQ A;  1FO4 A;  3P4Q B;  2LUM A;  4RF0 A;  2GRI A;  2KJR A;  4MSQ B;  4RFB A;  3PSE B;  2FCS A;  2M17 A;  3W1S C;  1PDX A;  4J6I A;  3V60 A;  1UBQ A;  2FBW B;  1OQY A;  5IOI A;  2RGF A;  1F9J A;  2BT6 A;  2G1E A;  2L0T A;  1UBI A;  2WGS A;  3TBL D;  5EE0 A;  4NPN A;  1GG3 A;  3Q8B A;  4EZK A;  2V3N A;  3N1Z C;  3OAW A;  5AUK A;  3NJT A;  3CMM B;  3W1S A;  5BO4 B;  1EUV B;  3Q14 C;  5CHW A;  1BUI C;  2UYZ B;  3AEG B;  1SE2 A;  3IT4 B;  5D3I B;  5AEK B;  3PLV A;  2BKF A;  1M94 A;  3N1Y C;  4RM9 A;  3KWV A;  3BYT B;  3UF8 A;  4TQ1 A;  3FIL A;  1WJU A;  2BWE S;  1K52 A;  1YJI A;  5KHO A;  2SAK A;  2JVC A;  4IOI E;  3NS1 A;  4LNI A;  4E71 A;  3EFC A;  1GAQ B;  1E8X A;  3P4P B;  3VRA B;  4WWM A;  4D2K A;  4XWW A;  3B08 A;  1HZ5 A;  4EUT A;  3HM3 A;  2AQ3 B;  3JYU A;  3MJW A;  2D07 B;  4EFO A;  2KXJ A;  3PV1 A;  1QZE A;  1P1A A;  2X38 A;  3J9C A;  3DPD A;  4HRO A;  4HKZ E;  5DCN A;  4BAX A;  3PRZ A;  3I9V 1;  3BVM A;  4RCO A;  2KDM A;  3Q8A A;  4ACF A;  1E5W A;  4USA A;  2J42 A;  1WY8 A;  3MC0 B;  4DHJ B;  5KHQ A;  4I6L B;  3L0W B;  2AYO B;  4ARI A;  2KMM A;  1L2N A;  2LUE A;  1GJZ A;  3T3O A;  1K8R B;  2MLB A;  4HPM B;  1C4P A;  1CK1 A;  4W9I A;  3TEW A;  3M62 B;  3V6E B;  1LO5 D;  2J53 A;  4XDD A;  2NTT A;  1OFF A;  2BW2 A;  2MBQ A;  1TYG B;  4KVG B;  4NQL B;  1WIA A;  3GZN B;  1RYJ A;  4IWO A;  4PT5 A;  4XGA B;  1FXA A;  2LVP A;  2J4X A;  2TSS A;  3NG0 A;  3UI3 A;  1TZ1 A;  2LGS A;  4DXA B;  2K0P A;  4A90 A;  4ASW C;  1EM7 A;  1ET6 A;  2L1A A;  2MQJ A;  4ZRP A;  4LNK A;  2WXF A;  5G55 A;  1IBX A;  1L0V B;  2XK5 A;  3ZXV A;  2JY6 A;  1UUP A;  2RDG A;  4WAA A;  4FLH A;  1VZ7 A;  1I35 A;  1E10 A;  4RGM A;  4H2A A;  3KW5 B;  4XC2 A;  3ZJV A;  3RD2 A;  2M56 B;  1WGR A;  4K3B A;  4LNN A;  1CQV A;  1C9F A;  2I38 A;  3QK0 A;  2WXM A;  3M95 A;  2INN E;  3NVY A;  2HDE A;  3Q3F A;  1K51 A;  4M0W A;  3TUO A;  3VTU A;  5JZE B;  1UH6 A;  1NDD A;  3BVG A;  4JL9 A;  3TJP A;  3B2G A;  3U7Z A;  1VZ6 A;  1SIF A;  4MH8 A;  1D4B A;  3TIX A;  1EO6 A;  1E7P B;  3ZUN A;  3ZJT A;  4DHZ B;  1PFD A;  2Z8L A;  2CJO A;  2HJ8 A;  3AE3 B;  3ZNH B;  4MDK E;  2AL6 A;  3SHQ A;  4HLE A;  2OJW A;  3B2F A;  2M4N A;  5CHV C;  3KYC D;  3RI7 C;  4M0W B;  2AWT A;  2MHJ A;  2YEP F;  3NZU A;  2O6V A;  2WXL A;  1I4H A;  3NOB A;  5JXV A;  2D10 A;  2PEA A;  3L54 A;  2BGF A;  4GN1 A;  5H92 C;  3A4R A;  4HWI B;  4M02 A;  1WRI A;  4WWO A;  3E9S A;  2C7N B;  1QKZ A;  2FNJ B;  3O65 B;  4ANX A;  2RMM A;  2WXG A;  1AYF A;  5GXG B;  3L16 A;  3ABV B;  4BZA A;  2EEL A;  2CU1 A;  3GOE A;  2DYB A;  2KWV B;  1JQ4 A;  4P6V F;  2R2O A;  2CU3 A;  1WX9 A;  4BKT A;  3W2D A;  4F8C B;  2Y3A A;  1WXS A;  1SF0 A;  4ANV A;  1WX8 A;  3W5V B;  1D6E C;  1JRO A;  2BVC A;  3DWG C;  3IXS A;  1E8Z A;  3ZIM A;  1UGM A;  1HA5 A;  5BYS A;  4MH0 E;  3DBL B;  2QJL A;  2KQS A;  2JRI B;  2MA9 B;  4CQN A;  2O6V D;  3Q6B A;  1WX7 A;  1KM7 A;  1UD7 A;  1J7A A;  3A9K A;  2BS4 B;  3AEE B;  1V86 A;  4XWT A;  4GB9 A;  1TS5 A;  2AQ2 B;  1VD2 A;  2L8J A;  4MGK E;  3V6C B;  3SD5 A;  2LD9 A;  1P7E A;  4IWP A;  3VR8 B;  3ZNI D;  1E0Z A;  3A33 B;  2Q5W D;  3ENE A;  3AE7 B;  1KJT A;  2NTS A;  2KKC A;  2XN9 C;  1SGH A;  2KN5 A;  2VZK B;  4PYU A;  4FHJ A;  2C60 A;  2WXN A;  4G50 A;  2IGG A;  4FXC A;  2MCN B;  3L4P A;  4PYZ A;  4YWG G;  2JYE A;  2ACZ B;  1CJE A;  4OW0 A;  1I4G A;  2KC1 A;  2ZNV C;  4WQO B;  2LJI A;  1T0Q C;  3WA0 A;  4OVV A;  3V62 A;  4WQM A;  4KIK A;  4N6E B;  3FKY A;  3ZDM C;  2IGH A;  3KQ4 A;  2DZJ A;  4ICV A;  1LM8 B;  1PGX A;  4RGO S;  1B9R A;  3A9J A;  2JXX A;  4AWJ A;  2A4Z A;  5J2R A;  2VZK D;  4FN2 A;  2GI9 A;  5C2T B;  1EWY C;  1C79 A;  3ECI A;  2KT7 A;  4HJG E;  5FR3 A;  3GE3 C;  2LGI A;  2NBW B;  3DBH B;  2WDV B;  3UIP B;  3L10 B;  2KK8 A;  3TSS A;  4KIK B;  2DZM A;  2Y5B B;  3JVZ X;  4KDI C;  1N61 A;  1J8C A;  5AZG A;  5DPR A;  4HCN B;  4HXD A;  2EMS A;  1Q1O A;  3R3M A;  2PW9 A;  2JXT A;  3EGR A;  3DVG X;  4MGI E;  4LCD E;  5J18 A;  3EC8 A;  1NEN B;  4NJC A;  2CHX A;  1XLO A;  2HTM E;  3VTW A;  4YL8 A;  2KDB A;  1BXT A;  3ZJU A;  4MEM A;  2L83 A;  4E3C A;  1SJH D;  1J0G A;  1WGK A;  2G4S A;  1XLQ A;  3JSV B;  3ZVV A;  2LFI A;  2M0A A;  4JIO U;  1LGR A;  1V8C A;  3U8Z A;  3MJ5 A;  2JX5 A;  2KQ4 X;  1D5X C;  2MBE A;  5E6J A;  4GDK A;  3VFK A;  2KNB A;  5EE9 A;  2ONQ A;  3K9O B;  4MAC A;  4OZB A;  1DYQ A;  4B0M A;  1DGJ A;  1KTK A;  2WNM A;  3CIR B;  1MFW A;  2JQR B;  2PE6 B;  3ZNG C;  1KLG D;  3X0W A;  2N9X A;  2BPS A;  1GB1 A;  3MC8 A;  3PS6 A;  2D3G A;  2JWZ A;  3P1M A;  4GGQ A;  1FNW A;  1T3Q A;  1XT9 B;  4HKQ A;  1OGW A;  3DHI C;  2UU7 A;  1V1O A;  2W3S A;  4OVZ A;  1TKY A;  2KMA A;  4W9E A;  4MJS B;  1VLB A;  2WQY B;  2LI5 A;  3ONS A;  4CHK A;  3URY A;  2RDB C;  2DHZ A;  2KOX A;  1EU4 A;  3KWL A;  2BWF A;  3AE2 B;  3P4R B;  3Q3N C;  2KFK B;  2N1W A;  4TKN A;  2KYW A;  2PMV A;  2WU2 B;  1GUA B;  1IYF A;  3OLM D;  2ZZP B;  3PRE A;  2ZVN A;  3KUD B;  2RDH A;  3QAR A;  1YQ4 B;  3R2I A;  4K3C A;  4II3 B;  3DBR B;  1L6V A;  2J7Q B;  2KMC A;  3PRM B;  3HVD A;  3A1Q B;  4CO7 A;  2KAJ A;  1UWM A;  1HTQ A;  2KDE B;  1F2R I;  2N4F A;  4KX6 B;  3H7P B;  2R61 A;  2VH1 A;  2DBY A;  4NY0 A;  1V2Y A;  3AU4 A;  1PUT A;  1VCB A;  4URK A;  4US8 A;  2QSD A;  1PGB A;  1WI0 A;  5CTR C;  4BBN C;  2BKR B;  3AED B;  1XO3 A;  3U2S C;  5D6J B;  2YVC A;  1ZP0 B;  2KD0 A;  1JW9 D;  1WWT A;  4IG7 B;  3EFU A;  2WLB A;  1FXT B;  2NS5 A;  3ALB A;  1FNV A;  2H89 B;  5IN7 A;  1V81 A;  3PTF C;  3RNF C;  1YIW A;  4Q2J A;  4ANU A;  4UDU C;  1C1Y B;  2J0J A;  4A3O A;  1V80 A;  3VRB B;  1YJ1 A;  1SE3 A;  4AUQ C;  3BVZ A;  4YTP B;  1UEL A;  1V5T A;  4N9F 4;  2PKO A;  2Z0E B;  4C7Z A;  1UF0 A;  1ZXH A;  1TJE A;  4TMA B;  1TBE A;  2WXP A;  5AZF A;  1JWB D;  2K25 A;  4C4V B;  2Z0D B;  2N7J A;  2ZVO A;  3UQA A;  2DAF A;  1CZP A;  4YSY B;  2V4L A;  3GB1 A;  3MHZ A;  3NZS A;  2OJR A;  4X57 B;  2WDT B;  3VUW A;  1I4X A;  1ZE3 D;  3T9L A;  3BWU D;  4I6N B;  1F0Z A;  4M8N A;  4W9J A;  1FPY A;  4GIV A;  2BYV E;  4ARC A;  4IM3 A;  2K8B A;  1ENF A;  2WHI A;  5AZH A;  4LNF A;  1YN5 A;  1ZUD 2;  2D11 A;  2IDY A;  5J17 A;  4BOS C;  4IKG A;  3PZD A;  3KUC B;  1H4R A;  3X23 A;  2MSE D;  4DXF A;  2BF8 B;  2E3T A;  4FHK A;  2INC C;  4ZRI A;  4FJZ A;  3AE4 B;  2AEH A;  1XF5 L;  2K8H A;  1T0Y A;  4N58 A;  2QC8 A;  3PT2 B;  2BBC A;  5FKA C;  2QIE B;  1XLP A;  2FE8 A;  2OED A;  3H7S A;  4AS1 A;  2DEN B;  4BFR A;  3VXW A;  5IAA C;  2G3Q B;  1BML C;  1E7V A;  3PZ8 A;  1N63 A;  4S0R A;  3R8B A;  2WP9 B;  1JAL A;  2IYD B;  3DVG Y;  3UQB A;  1PGA A;  4A20 A;  1T5X D;  3OWE B;  4HEA 1;  2MJE A;  1HXY D;  3ZTC A;  2MP2 B;  4C80 A;  5T8I A;  4XE0 A;  3D32 A;  2ZEQ A;  1TIF A;  3B1L X;  4EZJ A;  1TKE A;  3ML9 A;  1K50 A;  3AE8 B;  2WDR B;  1WYW B;  3AI5 A;  1WXV A;  4AQ7 A;  1FFU A;  4DHJ D;  1GPX A;  4KGT A;  2VH2 A;  4NNJ B;  4DWF A;  3DVN U;  3ZLZ A;  4DDI D;  5BYR A;  2M19 A;  3HRD D;  3C8Y A;  3I3T B;  1QIL A;  3IHP C;  1D3Z A;  1WXM A;  1B1Z A;  4LDT B;  1V9J A;  1WMH A;  3NY5 A;  4A55 A;  3AE9 B;  3PHW B;  3WAP A;  2VRR B;  3ETR A;  3HHM A;  1S3S G;  4WJQ A;  3BZD B;  2PJH A;  3NVZ A;  1KRH A;  4MGY E;  4OZA A;  1FFV A;  1WGG A;  4NAM A;  3FAH A;  3RZW C;  4C56 C;  2LGD A;  1EWC A;  2ZW0 A;  3BK1 A;  2C5L C;  2L05 A;  2BB5 A;  2L76 A;  2QHO A;  3P42 A;  2KQ7 A;  5L95 C;  4KSL C;  3U4E G;  1WMH B;  2KAC A;  5MPO A;  4YXD B;  3EHV A;  1V6E A;  1E90 A;  4WJP A;  1V49 A;  1ISN A;  2H88 B;  1NVI D;  5C23 A;  2WX0 A;  2KTR B;  2K22 A;  3IVF A;  4G11 A;  2BS3 B;  2KAN A;  1C76 A;  3VDZ A;  2IO3 B;  3IAM 1;  3VUY A;  1OQR A;  1OQQ A;  2INP E;  4MM3 B;  3IFW B;  4JGH B;  4HK2 A;  4FAD A;  4B6W A;  1TT5 B;  3BII D;  1DOI A;  4RGN A;  1QQR A;  2WXJ A;  4KV2 A;  5LXH A;  1D5M C;  1RM6 C;  2PPH A;  1E6E B;  1JWU D;  1GC6 A;  2L7R A;  5JHB A;  5D3D A;  4KSK C;  3OJ3 A;  1L4Z B;  4ZYN A;  2UWQ A;  4IM0 A;  1FM0 D;  2KZR A;  4P7I A;  1MG8 A;  3NZ3 A;  4J3O D;  3KVF B;  2IGD A;  2FIF A;  3DQV A;  3APF A;  2GBN A;  2IBI B;  3H1U A;  3RMK C;  4HPP A;  1YQB A;  2DLB A;  2IY1 B;  4JX1 C;  4W9F A;  4A8X C;  2RD0 A;  3R2T A;  1FRR A;  3U7D A;  1QOG A;  2LMC A;  2W82 A;  2D3C A;  2N7D A;  3GE8 C;  2JUO A;  2PE9 A;  3DBL I;  2K9X A;  3I57 A;  3T8M A;  4AOF A;  2WXR A;  5CX3 A;  1WJ4 A;  2V3S A;  2LRW A;  2XBB C;  3UGB B;  3Q8F A;  1N5X A;  2K39 A;  4WIP A;  3RNA C;  3AH7 A;  2KX0 A;  2D3A A;  1GB4 A;  5JHA A;  1L7Y A;  1ZKH A;  3S2A A;  4W9D A;  2Z59 B;  3K9P B;  4P1B C;  2KO3 A;  1KLU D;  1ZGU B;  2L32 A;  4RM8 A;  3CST A;  3BK2 A;  2ON8 A;  3V3X A;  2BS2 B;  3NVW A;  1JCK B;  3NS8 A;  2KDF B;  1C3T A;  4B0E A;  2O2V B;  1JWM D;  1YN4 A;  2W55 A;  4MEL A;  4HCP B;  1WGH A;  1MPE A;  5HI1 A;  1QOB A;  4YT0 B;  5EDS A;  3EUB 2;  1YX6 B;  2MBB B;  1AWD A;  3VQI A;  4ZHO A;  1P0R A;  1V97 A;  3UIO B;  2YEP B;  1KLV A;  5E6O A;  2ZW1 A;  3QCA A;  4DBG A;  1ESF A;  3MTN B;  2KX3 A;  4WJN A;  1NI2 A;  1OEY J;  2KFJ A;  1R4N I;  3BY4 B;  1R4M I;  2JYT A;  5JH5 C;  3T3N A;  4IUM B;  1YNT E;  2K6D B;  4WAF A;  3QJZ A;  2KWU B;  4KGS A;  2LRU A;  1WH3 A;  3DVN V;  5EE3 A;  4YSX B;  1ZOY B;  2G45 B;  3BIN A;  3AM9 A;  2M0X A;  4DQO C;  2L00 B;  2NVU I;  1L4D B;  4II2 B;  4LNO A;  1RRB A;  3JSV A;  4ZHP A;  1RAX A;  4LTU A;  5I4D A;  3LXF A;  3ZXR A;  4AJW A;  2KN4 A;  4REZ A;  4LJO B;  3L13 A;  1IGD A;  1WM2 A;  4BOZ B;  1T0S C;  1QLB B;  2M8S A;  3IAS 1;  4KZC A;  3C0R B;  2LAS A;  3DWM A;  1LQB A;  1K53 A;  4ITK A;  5TR5 A;  5H8Y E;  4TQ0 A;  3O13 A;  2B76 B;  3WAM A;  3Q8C A;  2K5P A;  2LWP A;  2D5G A;  5BMI A;  3AU5 A;  2LVQ A;  1YX5 B;  1MJD A;  1QOF A;  3NRZ A;  4LK0 M;  4DXG A;  4W9L A;  4W9G A;  2JZ3 B;  1YMH E;  1JML A;  2NPT B;  2C9W B;  2QIL A;  4MJS A;  3RZF A;  2CKH B;  2LGX A;  1FMA D;  2KFK A;  4YTN B;  1SSN A;  2JWU A;  1V1P B;  3APD A;  2RR9 A;  3AXC A;  2YLM A;  1Q10 A;  4RH6 A;  4GLS C;  1TGZ B;  3DOW A;  4I6P A;  4CYE A;  3WAO A;  3Q2A C;  1RLF A;  3UIN B;  1T6B X;  4EKU A;  1VRA B;  3BYY B;  3A1Q A;  3PO0 A;  2DAJ A;  2V1Y A;  2G4D B;  3U52 E;  4W9K A;  1F2R C;  1WR6 E;  3CSF A;  3PGE A;  1WJN A;  2KDI A;  1QF6 A;  4MSM B;  4JWU C;  3H7P A;  2LJ5 A;  2J0K A;  1IGC A;  2KJ6 A;  3I63 C;  3RNG C;  2LXA A;  2KJH B;  1ZDV A;  3L17 A;  3QC8 B;  1GNU A;  4PS3 A;  4K7U A;  3TL5 A;  4PK1 A;  1NYQ A;  1E7U A;  2N1V A;  3AB5 A;  1HQR D;  2DX5 B;  1I4R A;  4P1C C;  2LGY A;  2L52 A;  1XXG A;  1MG4 A;  4NAW B;  2JF5 A;  1U4A A;  2MWS B;  4TUU A;  1EU3 A;  3TEX A;  2XEW A;  3OJ4 B;  2MW5 A;  2MRP A;  2PIA A;  2PVG C;  1STE A;  2IO1 B;  4A9A A;  4N59 A;  1YN3 A;  5CHF A;  2W54 A;  1HZ6 A;  2V9H A;  1KOT A;  2Y5C A;  3N1X C;  3RN9 C;  2ASQ A;  1S1Q B;  3PZ7 A;  2RSU A;  2XNA C;  4XYC A;  2I1K A;  4KGR A;  2FID A;  3R7Q A;  4EEW A;  4C4V A;  5C3J B;  2OHF A;  2DNF A;  2IJ0 A;  4RMA A;  4FJY A;  2GBJ A;  3ZNZ B;  2K1F A;  4NQK E;  1QT9 A;  3VR9 B;  3TEY A;  2R2Q A;  4EE2 A;  4FA6 A;  1T0R C;  4ZRK A;  4NZL B;  4PS8 A;  3QX1 A;  3RYT A;  4B95 A;  3C19 A;  2MJD A;  3VTV A;  3CF6 E;  2OOB B;  3Q3M C;  3PLU A;  1WFY A;  4L1B A;  3H9D A;  4GOC A;  4IC7 B;  1F52 A;  3RT3 B;  2SEB D;  3KH0 A;  3V61 A;  3MFG A;  5TSS A;  3N3K B;  2KWD A;  2V0G A;  4FJV B;  1RFA A;  2EMT A;  2HD5 B;  2CHW A;  2BYF A;  1SXT A;  3LYY A;  4M00 A;  4WJO A;  3RFZ B;  5EE1 A;  4JE3 B;  3HK0 A;  3AE5 B;  3QAQ A;  2LZ6 A;  2QDF A;  3R66 C;  4ZDV A;  1WGY A;  4XZ4 A;  3LJ3 A;  3WCQ A;  2ZPY A;  2K3U A;  4JQW C;  4KZ0 A;  1BT0 A;  2WXI A;  4ZRJ A;  3AEF B;  4ANW A;  2MP2 A;  3H6N A;  3N30 A;  3W1Y A;  4DK5 A;  2NR2 A;  1G6J A;  2LEK A;  1HTO A;  1TZO A;  5D94 A;  3VH3 B;  1N62 A;  5FR6 A;  4K1R B;  4KDL B;  4OVU A;  1WM3 A;  1J19 A;  1VDV A;  1N5W A;  2CR5 A;  1Y56 A;  3FIL B;  2L3Z A;  2KVR A;  1WJ6 A;  4YTM B;  1WSP A;  1XEE A;  1TTN A;  3MHS D;  5L83 A;  2IY0 B;  4F1S A;  4S17 A;  4JLC A;  3SDL C;  4EOY A;  1AAR A;  1P9D U;  2DYO A;  4GU2 A;  2PLP A;  1F1H A;  1P7F A;  3GZN I;  2KHW B;  4L23 A;  4WH4 A;  1QOA A;  4C00 A;  1KFY B;  5DPS A;  3SU8 X;  3DDC B;  2M1M A;  1CMX B;  4W9C A;  2MBH A;  2IO2 B;  4W9H A;  2N7E A;  5D2M B;  4TV3 A;  4C7Y A;  3N9Y C;  3SEB A;  1WF9 A;  2ICI A;  1FXI A;  3RCZ A;  2J0M A;  3M3J A;  1DOX A;  2FCM A;  1JRU A;  2B3A A;  2DWQ A;  2I1J A;  1Y8R C;  3AV8 A;  1FCC C;  4R3D A;  1WGD A;  5GMV A;  3LB8 C;  2BB6 A;  5G5H A;  1I4Q A;  2IND C;  2HJ1 A;  3N20 C;  2KTR A;  1Q0W B;  3MC9 A;  3AEA B;  4IDI A;  2ZCC A;  1L0Y B;  5E6N A;  1Z2M A;  1VZ8 A;  1SE4 A;  1UWX A;  2N9E B;  1SJE D;  1OEY A;  4G3X B;  4O1N A;  4MM3 A;  2WDQ B;  1NI3 A;  1WXQ A;  3ZKJ C;  1A70 A;  2KC2 A;  4LDT D;  5LLI A;  3VUX A;  3W9C B;  1UGJ A;  1I4P A;  2KWC A;  4M01 A;  2GBK A;  1SIJ A;  1EF1 A;  4HJK A;  5DPW A;  3GS2 A;  2QMT A;  2L0F A;  4DHZ E;  2JRH A;  1IBX B;  1XQQ A;  1OTR B;  2LHE A;  2XK5 B;  2EKI A;  4E74 A;  3APC A;  2KVZ A;  1P98 A;  1MVK A;  2RPQ A;  1E9M A;  3Q3O C;  4GSW A;  4NJ7 A;  2V4I B;  2AL3 A;  2QCZ A;  3AEC B;  1LXD A;  4ZOH C;  2GOW A;  1MI0 A;  3Q69 A;  3TCA A;  1E8Y A;  3QIJ A;  1ZPS A;  1YD8 U;  2JT4 B;  3U30 A;  1R7S A;  3NUH B;  2FUG 1;  1N60 A;  2JZZ A;  3ZQ4 A;  3PHX B;  3LDZ E;  2C7M B;  1N6Z A;  3L08 A;  5IKC M;  2EKE C;  1L6U A;  3NHE B;  1AN8 A;  3Q3J A;  2N9K A;  3HIZ A;  3P4S B;  4HDO A;  4HDQ A;  1FIQ A;  4A6Q A;  2IPK D;  5IO9 A;  3Q8E A;  3P63 A;  2IZV B;  1C78 A;  3EEC A;  3AE6 B;  2BYT A;  4IM2 A;  1WZ0 A;  2LHD A;  1NEK B;  2FUH B;  4F7Z A;  3QA8 A;  2JSV X;  2O6V B;  4BKG A;  1SE9 A;  2MH7 A;  4TSS A;  2V3P A;  4GMV A;  1Z5S B;  3JW0 X;  1J7C A;  3GP7 A;  3SR6 A;  4RGT A;  1NYR A;  1UNS A;  3VAW A;  3N32 A;  1ROE A;  4JWS C;  3ZW3 A;  1JWS D;  2O2V A;  4WWN A;  4ZYS A;  1E8W A;  4KKI A;  2REX A;  2C7H A;  3I5J C;  2K8C A;  1GC7 A;  3SFD B;  3KLS X;  4BVU C;  1TS2 A;  4XDC A;  5G2N A;  2JZP A;  3R7R A;  5FK9 C;  1M4V A;  3P2B A;  1TS3 A;  3VHT C;  1P3Q U;  3ZDT A;  2W9N A;  1L5P A;  5IP4 D;  3ZRF A;  1F77 A;  1KH0 A;  1L0X B;  1SB3 C;  3QWZ B;  4HPL B;  5HFY A;  1ZW7 A;  2JU6 X;  2G9H D;  1WE7 A;  3VH4 B;  2K6Q A;  1FCL A;  5G5G A;  3NVV A;  1HEZ E;  2KLG A;  4HVB A;  3HVZ A;  1WRD B;  4RNA A;  4YSZ B;  2Y5P A;  1XD3 B;  4XX5 A;  1NBF C;  2BQQ A;  3CWI A;  5HKH A;  3ZYY X;  4K81 A;  2LVO A;  1LFD A;  1MHX A;  3AE1 B;  3A9K B;  3PPA A;  4AJY B;  1GOZ A;  4B9K A;  3RNC C;  3DHG C;  5BMH A;  1ET9 A;  3TEZ A;  4FUL A;  5DPT A;  1FRD A;  5HG2 A;  3OG5 A;  3TMP B;  4RF1 A;  2N0S B;  2GBM A;  1XCQ L;  3ZRC A;  1IUE A;  1RFK A;  4LJP B;  3W5U B;  3DBH I;  4KKJ A;  3DBS A;  3V05 A;  4FBJ B;  2KTF A;  3ZO5 B;  1R4N B;  1KF6 B;  1R4M B;  2LXC A;  1PYW D;  3H8H A;  1C4A A;  1HE8 A;  2NMQ A;  2D2Q A;  5AUI A;  1I42 A;  1PQS A;  4ICU A;  3WAN A;  2FAZ A;  3RNB C;  5C1Z A;  3WAL A;  1IP9 A;  1WR1 A;  3M63 B;  1YOV B;  2HTH A;  2NPT A;  2MBO A;  1YQ3 B;  2CJN A;  2NBV B;  3SFE B;  3ZTD A;  4IWQ A;  1FNU A;  4GXB A;  4A3P A;  4BKS A;  4K7W A;  2FCQ A;  2E6X A;  2RPV A;  3RNE C;  4L2Y A;  1TKG A;  3A9J B;  3DCG A;  2DZK A;  4P16 A;  2ZNV B;  3B9J A;  1V1P A;  5IA7 A;  1XLN A;  4QAY A;  1JRP A;  2J52 A;  5HHD G;  3EA6 A;  1J7B A;  1SEB D;  1UZX B;  5E6P A;  1C4C A;  1FD6 A;  2CS4 A;  2WWZ A;  2AQ1 B;  1C77 A;  2IO0 B;  5D7G A;  1YJJ A;  2NCN A;  3RUL A;  4M8M A;  4MGZ E;  2HE7 A;  4K7S A;  2WXK A;  4HRS A;  1TY2 A;  2DYM A;  1A5R A;  1RWS A;  2FCN A;  1AW7 A;  1SBB B;  3IT6 B;  4US9 A;  1V5O A;  3KYD D;  5BMG A;  2ZPN A;  2MEK A;  1ZXI A;  4WWP A;  2KLC A;  2QEJ C;  3PVL A;  3PRP B;  2WX1 A;  3AUL A;  3VVW B;  1VJK A;  4EZL A;  2GMI C;  2X8X X;  2I2Y A;  2AX5 A;  3HUI A;  3ZGZ A;  2NBU A;  5LXI B;  2W3R A; 
#chains in the Genus database with same CATH homology
 2XN9 C;  2N9L A;  2MJ3 A;  2K22 A;  2WXO A;  2VZK B;  4GDK B;  2WXQ A;  2WXN A;  3AN1 A;  3MP9 A;  4JPS A;  2IGG A;  2BS3 B;  2GB1 A;  1WYG A;  4FXC A;  3WCQ A;  3L4P A;  1C76 A;  4YWG G;  2JYE A;  2K3U A;  2ACZ B;  1CJE A;  4OW0 A;  1I4G A;  3FC4 A;  2WXI A;  3E56 A;  3AEF B;  2LJI A;  3IAM 1;  5BYQ A;  1OQR A;  1OQQ A;  2INP E;  4MM3 B;  1DOY A;  2WS3 B;  4WQM A;  4OHJ A;  3AMZ A;  2LEK A;  4ZRQ A;  1TZO A;  1N62 A;  1DOI A;  3BII D;  4N6E B;  1QQR A;  2WXJ A;  4RGN A;  2PVO D;  1D5M C;  2IGH A;  3KQ4 A;  1RM6 C;  1MHH E;  2WU5 B;  1ZDX A;  1VDV A;  4MT5 A;  1N5W A;  1PGX A;  1E6E B;  1JWU D;  1Y56 A;  3FIL B;  4RGO S;  1B9R A;  4YTM B;  1WSP A;  3AEB B;  1XEE A;  5D3D A;  2PTL A;  2VZK D;  2GI9 A;  5C2T B;  1L4Z B;  4OZC A;  1EWY C;  1FM0 D;  1C79 A;  4GDL B;  4LLG M;  5FR3 A;  4HJG E;  2LGI A;  2WDV B;  3NZ3 A;  2DYO A;  1TY0 A;  4J3O D;  3TSS A;  5LNK 1;  2PLP A;  1P7F A;  4L23 A;  4WH4 A;  1TS4 A;  1QOA A;  2IGD A;  1KFY B;  2BTE A;  1I7H A;  3RPF C;  1N61 A;  1JWA D;  1VR9 A;  2WXH A;  1XCT L;  1D5Z C;  1ACC A;  2PW9 A;  2JXT A;  3EGR A;  3N9Y C;  4C7Y A;  3SEB A;  2ICI A;  2DLB A;  1FEH A;  1NEN B;  4NJC A;  4JX1 C;  4A8X C;  1FXI A;  1XLO A;  1FRR A;  3R2T A;  4WUR A;  2HTM E;  1QOG A;  2LMC A;  1DOX A;  2W82 A;  1FO4 A;  1BXT A;  2DWQ A;  3P4Q B;  2LUM A;  4RF0 A;  3ZJU A;  3AV8 A;  2L83 A;  1FCC C;  2GRI A;  4R3D A;  1SJH D;  4RFB A;  1WGK A;  2K9X A;  1PDX A;  3LB8 C;  1XLQ A;  3I57 A;  2BB6 A;  2LFI A;  2M0A A;  2WXR A;  1V8C A;  1I4Q A;  5G5H A;  3MJ5 A;  2FBW B;  2JX5 A;  2KQ4 X;  1D5X C;  3Q8F A;  1N5X A;  4WIP A;  3AEA B;  5E6J A;  3AH7 A;  2BT6 A;  2G1E A;  1GB4 A;  5EE9 A;  2ONQ A;  4IDI A;  5EE0 A;  4MAC A;  1L0Y B;  4OZB A;  1DYQ A;  1VZ8 A;  3Q8B A;  2V3N A;  4B0M A;  1DGJ A;  1KTK A;  1SE4 A;  2WNM A;  3CIR B;  1UWX A;  1KLU D;  1SJE D;  2JQR B;  5AUK A;  2L32 A;  3W1S A;  1KLG D;  4O1N A;  2WDQ B;  3BK2 A;  2ON8 A;  1BUI C;  1NI3 A;  3V3X A;  1GB1 A;  1WXQ A;  2BS2 B;  1A70 A;  3NVW A;  3AEG B;  1SE2 A;  3IT4 B;  5D3I B;  3W9C B;  1JCK B;  1UGJ A;  1I4P A;  3P1M A;  4B0E A;  1FNW A;  1T3Q A;  1SIJ A;  4HKQ A;  1JWM D;  3GS2 A;  3BYT B;  3KWV A;  2QMT A;  4TQ1 A;  1YN4 A;  3FIL A;  2W55 A;  1IBX B;  1V1O A;  2LHE A;  1MPE A;  2W3S A;  4OVZ A;  5HI1 A;  1TKY A;  2EKI A;  1K52 A;  1YJI A;  1QOB A;  1VLB A;  2WQY B;  4YT0 B;  3EUB 2;  2SAK A;  3URY A;  4IOI E;  3NS1 A;  1MVK A;  1AWD A;  1EU4 A;  3KWL A;  1E9M A;  3VQI A;  4ZHO A;  1V97 A;  3AE2 B;  1GAQ B;  2YEP B;  3P4R B;  3P4P B;  3VRA B;  2PMV A;  2V4I B;  4WWM A;  2WU2 B;  2ZW1 A;  4D2K A;  1ESF A;  4XWW A;  1HZ5 A;  3AEC B;  2AQ3 B;  4ZOH C;  1MI0 A;  2RDH A;  3Q69 A;  2X38 A;  3J9C A;  2JYT A;  1YQ4 B;  1ZPS A;  3R2I A;  3T3N A;  4HRO A;  1L6V A;  4HKZ E;  1YNT E;  1R7S A;  3NUH B;  3HVD A;  4WAF A;  2FUG 1;  4KGS A;  1N60 A;  3I9V 1;  3BVM A;  3ZQ4 A;  4RCO A;  2KDM A;  3Q8A A;  2KAJ A;  4USA A;  2J42 A;  5EE3 A;  1UWM A;  3MC0 B;  4YSX B;  1ZOY B;  1L6U A;  1F2R I;  3AM9 A;  4DQO C;  4ARI A;  1AN8 A;  4KX6 B;  2KMM A;  1L4D B;  2N9K A;  2R61 A;  3P4S B;  2DBY A;  4ZHP A;  4LTU A;  5I4D A;  1FIQ A;  4A6Q A;  2IPK D;  3T3O A;  1PUT A;  3Q8E A;  4US8 A;  3LXF A;  3P63 A;  1C78 A;  1C4P A;  1CK1 A;  2QSD A;  3AE6 B;  3TEW A;  1PGB A;  2BYT A;  2KN4 A;  2LHD A;  1NEK B;  4REZ A;  1LO5 D;  2J53 A;  1IGD A;  4XDD A;  2NTT A;  1OFF A;  3AED B;  2BW2 A;  1XO3 A;  1TYG B;  3U2S C;  2JSV X;  1RYJ A;  1ZP0 B;  1QLB B;  2MH7 A;  1JW9 D;  4PT5 A;  4TSS A;  1WWT A;  2V3P A;  3IAS 1;  1FXA A;  1J7C A;  3GP7 A;  3SR6 A;  2WLB A;  3DWM A;  1K53 A;  2J4X A;  2TSS A;  4ITK A;  3UI3 A;  1FNV A;  4RGT A;  1NYR A;  2H89 B;  1UNS A;  5H8Y E;  4TQ0 A;  4Q2J A;  3O13 A;  1ROE A;  2B76 B;  3Q8C A;  4UDU C;  2K5P A;  2D5G A;  5BMI A;  4JWS C;  2K0P A;  4A90 A;  1JWS D;  1QOF A;  1EM7 A;  4ZYS A;  3NRZ A;  4KKI A;  4LK0 M;  1ET6 A;  2L1A A;  4DXG A;  4ZRP A;  2WXF A;  3VRB B;  1IBX A;  1YMH E;  1SE3 A;  1JML A;  1L0V B;  3BVZ A;  3KLS X;  3SFD B;  2QIL A;  1TS2 A;  4XDC A;  4YTP B;  1UUP A;  2RDG A;  2JZP A;  5FK9 C;  1M4V A;  1VZ7 A;  2PKO A;  1E10 A;  1TS3 A;  4RGM A;  4H2A A;  4C7Z A;  1ZXH A;  1TJE A;  4TMA B;  2WXP A;  1FMA D;  1L5P A;  1JWB D;  1F77 A;  1KH0 A;  4YTN B;  3ZJV A;  1L0X B;  1SB3 C;  2N7J A;  1SSN A;  2M56 B;  2JWU A;  5HFY A;  1CZP A;  4YSY B;  1V1P B;  3GB1 A;  3MHZ A;  1CQV A;  2JU6 X;  2G9H D;  1C9F A;  2I38 A;  1FCL A;  2WXM A;  1I4X A;  5G5G A;  1ZE3 D;  2INN E;  1Q10 A;  3NVV A;  3NVY A;  1HEZ E;  3BWU D;  2HDE A;  4RH6 A;  4GLS C;  1F0Z A;  4M0W A;  1K51 A;  3HVZ A;  4RNA A;  3TUO A;  4YSZ B;  1T6B X;  1VRA B;  2Y5P A;  3BYY B;  3PO0 A;  4ARC A;  3U52 E;  3CWI A;  3BVG A;  1F2R C;  1ENF A;  3B2G A;  3U7Z A;  3ZYY X;  1VZ6 A;  1MHX A;  1QF6 A;  4MH8 A;  3AE1 B;  1D4B A;  4JWU C;  1GOZ A;  1YN5 A;  1ZUD 2;  3ZJT A;  1E7P B;  5BMH A;  2IDY A;  1ET9 A;  3TEZ A;  1PFD A;  2Z8L A;  1FRD A;  4IKG A;  1IGC A;  2CJO A;  3AE3 B;  5HG2 A;  4DXF A;  1ZDV A;  2E3T A;  3B2F A;  4RF1 A;  2N0S B;  3AE4 B;  1XCQ L;  1XF5 L;  4N58 A;  1NYQ A;  2BBC A;  2YEP F;  5FKA C;  3AB5 A;  2QIE B;  1HQR D;  1XLP A;  1IUE A;  2FE8 A;  2WXL A;  1RFK A;  1I4R A;  2OED A;  3W5U B;  4KKJ A;  4AS1 A;  1I4H A;  3V05 A;  2L52 A;  5JXV A;  1XXG A;  1BML C;  4NAW B;  3PZ8 A;  1KF6 B;  3H8H A;  1N63 A;  1PYW D;  3R8B A;  2WP9 B;  1C4A A;  1EU3 A;  1JAL A;  2NMQ A;  5H92 C;  3TEX A;  5AUI A;  1WRI A;  3E9S A;  1PGA A;  1QKZ A;  1T5X D;  2PIA A;  2PVG C;  1STE A;  2RMM A;  3OWE B;  2WXG A;  1AYF A;  2MJE A;  4HEA 1;  1HXY D;  4A9A A;  4N59 A;  4C80 A;  1YN3 A;  5GXG B;  3ABV B;  5T8I A;  2W54 A;  4XE0 A;  1YQ3 B;  2CJN A;  3SFE B;  1HZ6 A;  2EEL A;  1TKE A;  2Y5C A;  1FNU A;  3PZ7 A;  1K50 A;  3AE8 B;  2XNA C;  1JQ4 A;  2RPV A;  2E6X A;  2WDR B;  4KGR A;  4P6V F;  4L2Y A;  1TKG A;  4AQ7 A;  1FFU A;  2CU3 A;  1GPX A;  5C3J B;  2OHF A;  3W2D A;  4P16 A;  4KGT A;  3B9J A;  1V1P A;  2IJ0 A;  1XLN A;  5BYR A;  2M19 A;  2Y3A A;  3C8Y A;  3HRD D;  1QIL A;  3VR9 B;  1QT9 A;  3TEY A;  1B1Z A;  4EE2 A;  1JRP A;  1SF0 A;  3W5V B;  2J52 A;  1D6E C;  5HHD G;  3EA6 A;  1J7B A;  1JRO A;  3DWG C;  3IXS A;  4A55 A;  3AE9 B;  1HA5 A;  5BYS A;  1SEB D;  4NZL B;  3ETR A;  2QJL A;  1C4C A;  1FD6 A;  2MJD A;  3BZD B;  2AQ1 B;  1C77 A;  3NVZ A;  4CQN A;  1KRH A;  4OZA A;  5D7G A;  4L1B A;  1YJJ A;  1FFV A;  4NAM A;  1J7A A;  2WXK A;  3FAH A;  2SEB D;  4C56 C;  2BS4 B;  3AEE B;  4HRS A;  1EWC A;  2ZW0 A;  4XWT A;  3BK1 A;  1TY2 A;  2DYM A;  1RWS A;  2BB5 A;  3MFG A;  5TSS A;  1AW7 A;  1SBB B;  3IT6 B;  2KWD A;  1TS5 A;  4US9 A;  2AQ2 B;  2V0G A;  5BMG A;  2MEK A;  3P42 A;  1ZXI A;  3U4E G;  2KAC A;  2QEJ C;  5MPO A;  4YXD B;  1SXT A;  3LYY A;  1P7E A;  3RFZ B;  3VR8 B;  1VJK A;  2H88 B;  1NVI D;  2I2Y A;  1E0Z A;  5EE1 A;  4JE3 B;  2Q5W D;  2AX5 A;  3HUI A;  3AE7 B;  3ZGZ A;  3AE5 B;  2W3R A;  2NTS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...