2K9XA

Solution structure of urm1 from trypanosoma brucei
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
102
structure length
102
Chain Sequence
b'MSNHNHITVQFAGGCELLFAKQTSLQLDGVVPTGTNLNGLVQLLKTNYVKERPDLLVDQTGQTLRPGILVLVNSCDAEVVGGMDYVLNDGDTVEFISTLHGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
molecule tags Unknown function
source organism Trypanosoma brucei
publication title Solution structure of Urm1 from Trypanosoma brucei
pubmed doi rcsb
total genus 12
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2008-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09138 Urm1 Urm1 (Ubiquitin related modifier)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2k9xA00
3AEAB 2JQRB 3DWMA 3L4PA 3AEBB 3P63A 1JALA 4ITKA 3AE7B 1N60A 1XLNA 3FC4A 1N62A 3AE8B 2L52A 2M56B 3AE1B 3AV8A 4A9AA 1FO4A 3BIID 1IUEA 2K22A 1E0ZA 1PUTA 1TKGA 2JX5A 3AECB 3LB8C 4HRSA 3ZYYX 1FXAA 1JW9D 4US9A 1E9MA 2MH7A 2WU2B 3LXFA 2WP9B 1TJEA 3KWLA 1JWBD 1DGJA 3HUIA 2PKOA 1OQQA 1RFKA 1OFFA 1RWSA 1YJIA 1N5XA 4YSXB 3P1MA 4C80A 3P4SB 1L6VA 1JRPA 1V97A 1PDXA 2MJEA 2W3SA 1UWMA 3NVVA 2WU5B 4N59A 3VR8B 3CIRB 1FFUA 3ETRA 3AMZA 1FRRA 1YQ3B 1B9RA 2W54A 1JWAD 3HVZA 3AE6B 3P4PB 2LEKA 3NS1A 2KAJA 1SF0A 2WDRB 2OHFA 2W3RA 1WRIA 2PIAA 1E10A 1E6EB 3AE4B 1DOXA 2MJ3A 4HROA 1NI3A 3W5VB 2E3TA 4KX6B 4N6EB 1TKEA 1T3QA 1VDVA 2KMMA 4US8A 1QOGA 1WGKA 2L83A 1QOAA 1N5WA 2PVGC 1ZXIA 5MPOA 1GPXA 2WS3B 1NYQA 1F0ZA 1R7SA 2ACZB 3AE2B 3NVZA 4ZHPA 1V8CA 1KF6B 3VRBB 1KFYB 5C2TB 1FIQA 3NVWA 2EKIA 3AM9A 1NVID 4JX1C 1L0VB 1TKYA 1J7AA 1QOFA 1XO3A 1CZPA 4WQMA 3SR6A 1QF6A 2FBWB 2H89B 1EWYC 5GXGB 1WXQA 4YTPB 3SFEB 2G1EA 1DOYA 1L5PA 1QOBA 2CU3A 3DWGC 4LTUA 2B76B 3VRAB 1ZP0B 3AEFB 2BS2B 1XLQA 2AX5A 2K9XA 3AH7A 5EE0A 1XLPA 3W9CB 3AB5A 1J7CA 3AEEB 1VJKA 3AEDB 1FFVA 2QIEB 5G5HA 1RYJA 2W55A 2QJLA 5G5GA 1YJJA 4YXDB 4YTNB 2DWQA 5EE3A 1L6UA 4C7ZA 1YQ4B 3AE9B 2N0SB 1FRDA 3B9JA 3NRZA 2BS4B 2DBYA 5H92C 3RPFC 1NEKB 5C3JB 5EE1A 1DOIA 1VLBA 2Y5CA 3HRDD 3SFDB 4YTMB 1JQ4A 4USAA 3VR9B 3W5UB 1FMAD 5AUIA 1WYGA 2K5PA 2WLBA 3NVYA 1ZUD2 1JROA 1NYRA 1AYFA 1ZOYB 1AWDA 5AUKA 2M19A 2BS3B 1OQRA 3AE3B 3EUB2 1WWTA 2BT6A 2Q5WD 1N61A 4FXCA 1A70A 1N63A 4C7YA 2H88B 3AN1A 4YT0B 3WCQA 1E7PB 1CJEA 3B2GA 2PVOD 1SIJA 4ZHOA 4IDIA 2WDQB 1ROEA 1KRHA 1GAQB 4ZOHC 4YSZB 1QT9A 2WQYB 1SB3C 1TYGB 1FXIA 1I7HA 2HTME 4P6VF 2CJNA 3ABVB 3AEGB 2CJOA 2WDVB 3AE5B 4WWMA 1NENB 3P4QB 1FM0D 1J7BA 3CWIA 4JWSC 3B2FA 4JWUC 1QLBB 3P4RB 5EE9A 2MJDA 4YSYB 1XLOA 3PO0A 3FAHA 5H8YE 1RM6C 4N58A 1PFDA
chains in the Genus database with same CATH superfamily
3L0WB 3NZUA 2IO2B 1WJ4A 4LNKA 3N1XC 1YQBA 2JPHA 2N1WA 4XWWA 2ON8A 3VUYA 2JWZA 3SD5A 4KSKC 3ZDTA 4AP4C 2G9HD 3BINA 4NNJB 4AOFA 1SE4A 4OZCA 2IY1B 1L6VA 2NTSA 3VUWA 1FNWA 3D32A 1KLUD 2WU5B 1I4RA 2JF5A 3DQVA 4MH0E 1WJUA 3ZRFA 2JSVX 3PZ8A 4N6EB 1IYFA 3APFA 4LNOA 1MHHE 1R7SA 2ACZB 4KVGB 2X8XX 2FCMA 3RNGC 5C2TB 2E6XA 4HXDA 1L2NA 4A55A 5KHQA 2IPKD 4K3CA 1TTNA 1MHXA 5HKHA 3GP7A 1XLQA 5BYSA 2IYDB 2WXMA 3AB5A 3AEEB 4MGIE 3GZNB 5EE3A 4BBNC 1KOTA 2KTRA 2Y5BB 4ZRJA 1RLFA 1XCQL 3UI3A 5H92C 2LXCA 1ET6A 4CYEA 1EU4A 3QC8B 4W9DA 3I57A 3KVFB 2WLBA 4KGRA 1NYRA 1F9JA 3MP9A 2LVQA 3PV1A 2LHDA 3B0AA 1YNTE 4A20A 4RM9A 1UBQA 2BW2A 5DPSA 3Q2AC 1GB4A 3ZNID 1WJ6A 1I7HA 2K25A 1ZGUB 3R2IA 4GXBA 3PTFC 1OEYJ 4NAWB 5IOIA 4OVVA 2OJWA 4MGKE 1RM6C 4M8MA 2CKHB 3IAM1 1SE3A 2ZZPB 2BB5A 2OEDA 2QCZA 1ESFA 4HWIB 4KDIC 2QILA 3LB8C 3ML8A 1YOVB 2KTFA 3MC8A 2RGFA 2KKCA 1TJEA 2KXJA 2PW9A 4K1RB 1DGJA 3L08A 5D2MB 3KUZA 3P2BA 4R3DA 1MG8A 4W9CA 2N9XA 3FKYA 1WF9A 4XE0A 4ANUA 1M4VA 3URYA 1SSNA 1WR6E 3NVVA 2XNAC 2HD5B 1FFUA 1B9RA 4GDKA 5J17A 2N7DA 2LEKA 3ZTCA 1SF0A 1WZ0A 1E8ZA 3ENEA 4K81A 3AE4B 4HROA 3W5VB 3DHIC 1WX8A 2KMMA 1WGKA 1TBEA 1UH6A 2KHWB 3N20C 1UWXA 1NYQA 2FIFA 5FR3A 5IP4D 1M94A 1GJZA 2K1FA 5JHBA 2RDBC 3L17A 1C77A 4P1BC 3Q8EA 1EWYC 1XF5L 3RNCC 3K9OB 2YEPB 1C78A 2KN4A 5D3IB 4LDTB 2KK8A 1XLPA 3AI5A 3QCAA 1S3SG 1C3TA 1JCKB 2KC2A 4WJNA 4RGNA 3V6CB 3B9JA 2DBYA 4JGHB 2AWTA 2DZMA 3Q14C 4FLHA 1XCTL 3L13A 3PZ7A 2KWUB 2IO0B 2WWZA 2WXGA 2H88B 4M0WA 1F2RC 2PVOD 1SIJA 5TR5A 4MH8A 2FAZA 4MT5A 1T0SC 3ZDMC 2CJNA 2V3SA 5DPRA 2KVZA 4A3PA 1TS5A 2O6VB 1AARA 3B2FA 4MM3A 5IA7A 3DHHC 1JRUA 5H8YE 2D07B 3I63C 1LGRA 2IO3B 2CHWA 2K39A 3L54A 4BKSA 2GRIA 3KUCB 2WU2B 5CHWA 3TSSA 3IFWB 4M02A 1JWBD 2KANA 3E9SA 1OQQA 5E6JA 2IDYA 4BKTA 1OFFA 1RWSA 3P4SB 4FADA 3PT2B 2K8BA 1ZDVA 3TMPB 4G11A 5C23A 1C1YB 2OHFA 2LVPA 4BOZB 2LD9A 3K9PB 3QJZA 1TZOA 4L23A 2PE9A 2C9WB 3TEYA 4HK2A 2PVGC 3QA8A 4PS7A 2Y5PA 2MCNB 3X23A 4ZHPA 1SIFA 2INNE 2L0FA 2BTEA 4RGTA 3Q8FA 1FIQA 3NVWA 2VZKB 4WQMA 3SR6A 2MW5A 4RMAA 2H89B 4NAMA 2EELA 2AEHA 3O13A 2QEJC 3AEFB 3DBHB 4IM0A 1T0RC 4DBGA 4GDLA 2KVRA 4RF1A 1RYJA 5G5GA 2KO3A 1WIAA 5HG2A 1HXYD 1E8XA 2KDIA 3C0RB 5E6OA 1YN3A 1ZW7A 2MBQA 4LJPB 4OHJA 4EE2A 1ZDXA 1VZ6A 3QHTA 2WXNA 2DLBA 1L7YA 1FNUA 2IZVB 4IC7B 3NUHB 3BVMA 5D94A 2KLCA 4HDOA 4MACA 4WJOA 4YSYB 1FEHA 2AL6A 2K3UA 3DWMA 3L4PA 1D5MC 2LGXA 3AE8B 2M56B 4MM3B 4CQNA 1CMXB 1K51A 2BYEA 1OGWA 1TY2A 4OVUA 3LXFA 2Z59B 4JPSA 2WP9B 2X38A 3ZGZA 1PGBA 1STEA 2M17A 1YN5A 1LQBA 4NPNA 2TSSA 1JRPA 2MJEA 1D3ZA 4RGMA 4FJZA 3P4PB 4QAYA 1P0RA 4WH4A 3SHQA 2DENB 1E10A 3QARA 1OTRB 1E6EB 5J2RA 2XN9C 1UD7A 3DHGC 2L8JA 3C19A 1TKEA 2KDMA 1BT0A 3IAS1 2R2OA 3W1YA 4W9GA 2KQ4X 4FHKA 5D3DA 1WM2A 2WXIA 4EOYA 4PK1A 4JX1C 4MGYE 3UINB 3EECA 2NVUI 2WYQA 4OZAA 2NTTA 5G5HA 1WXVA 1JWUD 4IKGA 1L6UA 1YQ4B 2JY6A 4LJOB 3OLMD 4NJ6A 1IBXB 2JZZA 2O2VB 4W9EA 1OQRA 4LDTD 3R66C 3DBRB 1T0QC 3I5JC 1QT9A 3APDA 1GOZA 4GDLB 4P6VF 1OQYA 3ABVB 1P9DU 4D2KA 2NBWB 4W9IA 3DVNU 3RNEC 1D6EC 2RDHA 2ZJDA 3Q6BA 2I1JA 3LYYA 3PO0A 3H8HA 1JWMD 3AEBB 4DHJB 2EKEC 2M0AA 1PUTA 2L0TA 3AECB 1KLGD 4ICVA 2LGDA 1TT5B 3KH0A 4ICUA 3H7SA 4A6QA 2RDGA 4YSXB 4J3OD 3PRPB 2INCC 3AMZA 1MVKA 3AE6B 1UNSA 4YL8A 3JW0X 3DDCB 2WDRB 2W3RA 2CS4A 1L4DB 1ZPSA 3PLUA 3N1YC 1T3QA 4JE3B 2CU1A 5E6PA 3B1LX 3Q3FA 3ML9A 4KZCA 2WS3B 2WXKA 3A9JA 1MJDA 3VRBB 4GB9A 4NY0A 1P1AA 1XO3A 3N3KB 5D6JB 2J0KA 3E56A 3FILA 5GXGB 2ZVOA 2CU3A 4LTUA 3H9DA 4DWFA 1YN4A 4IM2A 1BMLC 4KIKA 1LM8B 3ONSA 2N9KA 2BF8B 4ANWA 4DK5A 4YTNB 3RFZB 1T5XD 3NRZA 2IY0B 1NEKB 1JQ4A 1VLBA 4FA6A 5I4DA 4KKIA 4A8XC 3RULA 2NPTB 2J0MA 2JUOA 1WFYA 2WXQA 3ZO5B 3BK1A 1I35A 3PHWB 3S2AA 4W9HA 3Q3NC 1ROEA 4W9LA 2C7HA 1NDDA 3DVGY 1Z2MA 1J7BA 2Z8LA 4F8CB 2RR9A 3BYYB 4IWPA 1WM3A 3RUIB 3HHMA 2N9PC 3P63A 4HPMB 2AQ2B 1N62A 4A9AA 4C4VA 1IUEA 1L0XB 2JX5A 5AEKB 1JW9D 4AJWA 3IHPC 4RGOS 2ASQA 3T3NA 2BYTA 1YJ1A 4A90A 1H8CA 2FCQA 2VRRB 1SBBB 4LK0M 4JQWC 4DDGD 2LJ5A 1FRRA 4II2B 1JWAD 2REXA 1N6ZA 3RNFC 2IGGA 1NI3A 2E3TA 1FCLA 1V86A 1A5RA 1ZXIA 5MPOA 2G4DB 3AE2B 2JVCA 2KWDA 2NBVB 2NPTA 4HKQA 3ZJVA 2BWFA 2Z0EB 3RZWC 1R4MI 1P3QU 4YTPB 2I38A 3VRAB 4FBJB 1BXTA 2N7EA 1ENFA 2MX2A 3APCA 3QIJA 5BYRA 1T0YA 2PLPA 2LRWA 3HRDD 1X1MA 3NS8A 2K5PA 1ZOYB 2L3ZA 1C4CA 2BT6A 4FXCA 1A70A 3AN1A 1CJEA 2L32A 4TQ0A 4M00A 2WDQB 2INPE 3GE3C 3PPAA 1C4AA 3NZ3A 4PYUA 3KUDB 3P4QB 4EKUA 1EWCA 1UBIA 5BMIA 5EE9A 4E74A 1WXAA 3JSVA 3UQAA 2JRHA 1I4GA 2JQRB 3VFKA 4ITKA 4K7UA 3RNAC 3ECIA 4ZYNA 3FC4A 3R7QA 2L52A 1FO4A 3TEWA 2M0XA 3ZYYX 1FXAA 1E9MA 3PVLA 4BFRA 5DPWA 1E7UA 4BVUC 4WJPA 1L4ZB 2GBNA 3VXWA 1RFKA 4DXFA 2WXLA 2MWSB 3TCAA 3DOWA 1V97A 2UU7A 1EUVB 4FJVB 1FPYA 4TUUA 3WIMA 2KAJA 3TEZA 1WRIA 1C9FA 2D5GA 1F2RI 4KX6B 3P42A 2BKRB 2RMMA 3N9YC 4AWJA 3T3OA 1ZE3D 3SDLC 3KYCD 4MDKE 1XD3B 4KGTA 1KFYB 2J52A 2DZKA 5BMGA 2QSDA 2BPSA 1J8CA 5CX3A 4GN1A 2PMVA 5LLIA 2BKFA 2BS2B 2FIDA 1GC6A 4BKSD 4DQOC 5FKAC 1FFVA 2SEBD 3U7ZA 1RFAA 5HI1A 2MP2B 5EDSA 2MBBB 1P98A 2MA9B 2WGSA 4FN2A 3RT3B 2C5LC 3DBRI 2V3NA 1WWTA 4C7YA 4DHZB 4HEA1 3CF6E 3DBLB 4PS8A 3PSEB 4BZAA 3OG5A 2J7QB 3AEGB 4XC2A 5FR6A 3U7DA 5LXIB 4MSMB 3W2DA 1LFDA 2Z0DB 4NQLB 3AE7B 1EF5A 5DPTA 3KWLA 2LZ6A 4TQ1A 1E8YA 2NR2A 1NI2A 1R4NI 2LVOA 3QX1A 1N5XA 4Q2JA 2DNFA 2QC8A 3VR8B 3MC0B 2KYWA 4URKA 3MJ5A 3HVZA 3NS1A 1GNUA 2FCNA 2ONQA 1D5ZC 3ZTDA 2KQSA 1QOGA 2L83A 4ZRQA 5CHFA 1WE6A 1ZKHA 4WWPA 3T8MA 1E7VA 2M8SA 1KF6B 5BMHA 3EGRA 2LUMA 3RCZA 4ZRIA 4WIPA 4TV3A 1VZ8A 1V2YA 2INDC 1WXSA 1WXQA 1L5PA 1E5WA 3U4EG 3W9CB 2KDBA 5GMVA 1UUPA 4KKJA 1VJKA 3UF8A 1TZ1A 4KGSA 4W9FA 1P7FA 1FXTB 3VAWA 1FRDA 2EMTA 1MG4A 1HQRD 3BVGA 4YTMB 1FMAD 4OZBA 1WYGA 3EA6A 1AWDA 3ALBA 2RD0A 1KJTA 2QMTA 4HVBA 4M0WB 1N63A 2NS5A 2D2QA 3IVFA 1KRHA 2BVCA 3EFUA 1FM0D 3VDZA 3CWIA 4JWUC 2LASA 3MHSD 1QLBB 3JSVB 3MC9A 2ZW0A 4AQ7A 5CHVC 2ZCBA 5E6NA 1N60A 3ZNZB 4HDQA 2I1KA 2KC1A 3Q3MC 4US9A 2O2VA 5G2NA 2VH1A 2K8CA 3O65B 4KDLB 4C80A 2NCNA 4HCPB 3GZNI 2C7NB 4AJYB 4CHKA 1UZXB 2MLBA 3RNBC 4DXAB 1S1QB 1WR1A 1D4BA 1VR9A 2MP2A 5JZEB 4ANXA 4US8A 2L1AA 1C76A 2GBRA 4LNNA 4LNIA 2O6VA 5AZGA 3SEBA 2LFIA 1V5TA 5IN7A 2GBJA 3KYDD 2L7RA 3KW5B 3V6EB 2K6DB 1NVID 3GOEA 4X57B 4HPLB 3CSTA 1QOBA 3I3TB 1PYWD 3AEDB 3VH4B 4WQOB 2KZRA 3BVZA 2BYFA 2DWQA 2JXTA 1AW7A 2KFKB 1WYWB 2WXFA 1Z5SB 3ZUNA 4IWQA 2IGDA 5EE1A 5AZHA 1PGXA 4TKNA 1JROA 2KMAA 4WAFA 4H2AA 1WZ3A 4P1CC 1LXDA 3AE3B 3ZIMA 4GSWA 3U8ZA 5C1ZA 3Q8CA 3Q3JA 1GAQB 4NQKE 3W1SA 2QDFA 4WWMA 4I6LB 4M8NA 1Q1OA 3WAPA 2D11A 2KDEB 3PZDA 4GGQA 4KV2A 2MBOA 4CO7A 3LJ3A 3IBEA 2AQ3B 3RYTA 1PFDA 4DXGA 2D3GA 3QAQA 1ZXHA 3KLSX 2WXOA 2V0GA 2AQ1B 2LJIA 1SGHA 3EHVA 2MBEA 5BYQA 3ZJUA 3VVWB 1WSPA 3HVDA 5CTRC 2JYEA 2JT4B 1YQ3B 2HJ1A 1CQVA 1WGGA 3JYUA 2V9HA 2FE8A 4NJ7A 1I42A 1Q0WB 1PGAA 2BGFA 3BWUD 1SJHD 3DBSA 4E71A 1QOAA 1TGZB 2D3BA 3H7PB 4RFBA 2HTHA 2KDFB 2J53A 3N1ZC 3NVZA 1V8CA 2ZNVB 1QZEA 4LCDE 1TY0A 2ZEQA 1QF6A 2MSED 4NJCA 4OW0A 3VQIA 2IBIB 3HIZA 2FNJB 1V1PB 3Q8AA 4C7ZA 3ZNHB 4EUTA 2LUEA 3UGBB 2LWPA 4BBNF 2KLGA 4S17A 3ZNGC 3B2GA 1WXMA 4ACFA 2V4LA 2IGHA 2CR5A 2D3CA 2HTME 4BAXA 5J18A 2HDEA 4BOSC 2UWQA 4JL9A 4B6WA 2WXPA 3P4RB 1HEZE 1K50A 1TS3A 3CMMB 2JZ3B 4L1BA 3DCGA 5HFYA 3DBLI 1FNVA 4FHJA 4UDUC 2MH7A 2HJ8A 3EFCA 4XGAB 1EU3A 4MSQB 2CHXA 1VZ7A 3TEXA 4ARCA 1V49A 1HTQA 4RH6A 1HTOA 2W9NA 1IBXA 3UIPB 3CIRB 3BZDB 1WY8A 1XT9B 2BB6A 4IWOA 4L2YA 1WH3A 2GI9A 4HJKA 2PIAA 3PGEA 2B3AA 1QKZA 2V4IB 2V1YA 4WAAA 2EMSA 2KJRA 2LXAA 1D5XC 1R4NB 3C8YA 3PRZA 4G0NB 2BBCA 3KQ4A 4XZ4A 3AM9A 1RAXA 4C56C 2LI5A 2K0PA 2NBUA 1I4QA 1R4MB 2KQ7A 2ZW1A 4JLCA 2K9XA 4B95A 3M95A 3NY5A 1J7CA 2ZPYA 4ANVA 2W55A 4YXDB 1J0GA 4IUMB 2N0SB 2Y5CA 3VR9B 3UQBA 2BS3B 3TIXA 1N61A 3M62B 1EO6A 2GBKA 3A9KA 4IDIA 4KZ0A 1YIWA 1HA5A 4G50A 1FXIA 2G45B 3AE5B 3VHTC 3V61A 1QILA 1WRDB 2DYOA 3FILB 2DZJA 1MFWA 4N58A 5L95C 1I4PA 1SXTA 3RZFA 4DDID 2KTRB 1MPEA 1BUIC 4LNFA 4PYZA 4E3CA 3HM6X 3UIOB 1ACCA 3WAMA 2DAJA 3ZXVA 2Y3AA 1U4AA 4IOIE 1V1OA 2W3SA 3WAOA 2WXJA 2NMQA 2MQJA 4HKZE 4I6NB 2PPHA 2XEWA 3U2SC 4WWOA 1N5WA 1RRBA 1GPXA 4MJSA 1UGJA 2KFJA 2PTLA 4GIVA 4ZRKA 3WA0A 1CZPA 1ISNA 4MEMA 3SFEB 4GOCA 2FUHB 4S0RA 2B76B 1ZP0B 2AX5A 2DX5B 1K8RB 3OJ3A 1YX6B 4AUQC 2M1MA 5DCNA 2MEKA 4RNAA 5FK9C 3Q8BA 1V5OA 2FUG1 3V62A 1WMHB 3TUOA 3AU4A 4IM3A 3RD2A 1T6BX 2YLMA 3I9V1 1E7PB 2LRUA 3PHXB 4JIOU 3R7RA 2FCSA 4GLSC 2LMCA 3PLVA 3WALA 3A4SC 4RF0A 1SEBD 3VTVA 2MJDA 4EZJA 3L16A 4XDDA 2WX0A 2QHOA 3AEAB 1Y56A 1HZ5A 4FJYA 2WHIA 4MELA 1KTKA 3R8BA 1TKGA 4EZLA 4HRSA 1Q5WB 4WURA 1VRAB 2GMIC 1WX7A 1E8WA 2PKOA 3B08A 1I4HA 5L83A 1KLVA 1UWMA 3ETRA 2W54A 1AN8A 4WJQA 1JMLA 2R2QA 4O1NA 2KFKA 2OJRA 3GE8C 3QWZB 2C60A 2ZVNA 1HE8A 2GOWA 1VDVA 3PREA 2L05A 4FULA 3ZW3A 3DVNV 2SAKA 4B9KA 3OJ4B 1F0ZA 1JWSD 4RCOA 2WNMA 3MJWA 3BY4B 2XK5B 4REZA 2PE6B 3TBLD 2R61A 3AULA 2FBWB 4GU2A 3AU5A 3NJTA 5T8IA 4F7ZA 3U52E 1WGRA 3R2TA 2K6QA 1IPGA 3N32A 4K7SA 4DHJD 3BYTB 4ZDVA 2IJ0A 2M4NA 2QJLA 3SU8X 4N9F4 2XBBC 2VZKD 3A33B 2PEAA 1YMHE 2BS4B 3IT4B 3VUXA 4PS3A 1DOIA 3MHZA 3SFDB 2OOBB 4A3OA 2PJHA 5D7GA 2DYBA 1C79A 2M19A 4HJGE 5IKCM 3WCQA 3U30A 1YD8U 4LLGM 3ZKJC 2DAFA 3JVZX 2D10A 1NBFC 3LDZE 4JWSC 2KX3A 2WDTB 2YVCA 3ZJTA 3V60A 2LGSA 3GB1A 2CJOA 1YX5B 3IG3A 2KN5A 3MFGA 4P7IA 1JALA 4DHZE 3AE1B 4EFOA 3BIID 2K22A 1E0ZA 1H4RA 1XQQA 1GG3A 1PQSA 4BKGA 2L76A 1FCCC 3RI7C 1WX9A 2MBHA 2DYMA 2I2YA 4J6IA 3A1QA 1OEYA 4EZKA 4HPPA 4C00A 2K8HA 4KIKB 1DOXA 5IO9A 3VH3B 1SE2A 4WWNA 4EEWA 5HHDG 2KX0A 1SJED 4ASWC 3J9CA 4MGZE 3GS2A 3H6NA 3RN9C 1WJNA 3NHEB 1I4XA 3IT6B 4AS1A 4ZRPA 3PRMB 5IAAC 1L0VB 1QOFA 2KWVB 3BK2A 3DWGC 4B0MA 2GB1A 2L00B 2CHZA 2DZIA 1IP9A 3W1SC 1YJJA 1KM7A 3L10B 4GDKB 1TS2A 2DHZA 5C3JB 2RPVA 3DPDA 1CK1A 3ZQ4A 5JHAA 3OAWA 2A4ZA 2KWCA 3ZXRA 2BQQA 1B1ZA 1ZUD2 3NVYA 1EM7A 1AYFA 2ZNVC 5AUKA 2XK5A 2Q5WD 3DBHI 2BWES 3KWVA 2AL3A 2WQYB 2KACA 4F1SA 1GUAB 5KHOA 2AYOB 4RM8A 1WGHA 3TJPA 4OVZA 3QQ8B 3ZLZA 2N4FA 5JXVA 5G55A 2KMCA 1F52A 3HUIA 4MJSB 2RPQA 1MI0A 3OWEB 3P1MA 1V9JA 3VTWA 1TS4A 2O6VD 1PDXA 1V80A 2GBMA 2KT7A 1C4PA 2KJ6A 5BO4B 4NZLB 4II3B 2J42A 1KH0A 4TMAB 4G3XB 4HLEA 1VCBA 1VD2A 4XDCA 1IGDA 3X0WA 3A9KB 3IXSA 1G6JA 1J19A 2WXRA 3N30A 1TIFA 2EKIA 1TKYA 1J7AA 1L0YB 2G4SA 2G1EA 1DOYA 4PT5A 2KOXA 5EE0A 3AH7A 2V3PA 3AXCA 2KNBA 1V6EA 2QIEB 1ET9A 1SE9A 3RPFC 2JRIB 3PS6A 3W5UB 3RMKC 1DYQA 3A1QB 3EUB2 2LHEA 4IG7B 4W9JA 3M63B 3A9JB 1LO5D 4ZOHC 4YSZB 1TYGB 1HZ6A 1EF1A 3WANA 3A4RA 3R3MA 2LGIA 1UF0A 2RSUA 2N9LA 1XLOA 2KJHB 1K53A 2HE7A 2YEPF 1GB1A 3NOBA 2WX1A 2WXHA 1XLNA 3H1UA 3AV8A 5AZFA 2ZPNA 4B0EA 2JU6X 1Q10A 2JZPA 4XX5A 1F1HA 2JWUA 2GLSA 2JXXA 1P7EA 1WGYA 1UELA 1UGMA 3Q3OC 1YJIA 3DVGX 1V81A 4M01A 2ICIA 2A5UA 3M3JA 2VH2A 4N59A 2J0JA 1F77A 4GMVA 1XXGA 4KSLC 3ZVVA 1GC7A 5LXHA 3T9LA 2MJ3A 1WMHA 2MRPA 4I6PA 2IO1B 2KD0A 2C7MB 3TL5A 3VTUA 3EC8A 3V3XA 3H7PA 2MHJA 4K7WA 4NAWA 4YWGG 3MTNB 2ZCCA 5TSSA 1E90A 4P16A 1IGCA 2W82A 3Q69A 1Y8RC 1V1PA 2N9EB 1WE7A 1WI0A 2J4XA 2G3QB 4ARIA 2D3AA 3NG0A 3AE9B 3HM3A 2N1VA 4W9KA 3QK0A 4XYCA 4USAA 1K52A 2BYVE 3HK0A 1XEEA 4TSSA 5AUIA 2JYTA 5JH5C 4YT0B 4XWTA 4ZHOA 4ZYSA 2N7JA 5LNK1 1SB3C 2LGYA 2UYZB 3NZSA 2WDVB 1NENB 4IW0A 3ZRCA 3CSFA 4C4VB 4HCNB 1WGDA 3V05A 1QQRA 3FAHA 4K3BA 1FD6A
chains in the Genus database with same CATH topology
3AEAB 1JWMD 1Y56A 1HZ5A 3AEBB 1N60A 1KTKA 2M0AA 3R8BA 1PUTA 1TKGA 3AECB 4HRSA 4US9A 1KLGD 4WURA 1VRAB 4XWWA 2ON8A 2PKOA 2G9HD 1SE4A 4OZCA 4A6QA 2RDGA 4YSXB 4J3OD 4C80A 1I4HA 1L6VA 2NTSA 1FNWA 1KLUD 1UWMA 2WU5B 1I4RA 3ETRA 3AMZA 2W54A 1AN8A 1JMLA 1MVKA 1UNSA 3AE6B 2WDRB 4O1NA 2W3RA 2JSVX 1L4DB 3PZ8A 1D4BA 1ZPSA 1VR9A 4N6EB 1T3QA 1VDVA 4JE3B 4US8A 2L1AA 1C76A 1MHHE 2SAKA 2WS3B 1F0ZA 1JWSD 2WXKA 2LFIA 4RCOA 1R7SA 2WNMA 2ACZB 3SEBA 3VRBB 5C2TB 4REZA 2E6XA 1NVID 1XO3A 2R61A 4A55A 2FBWB 3E56A 3FILA 5GXGB 2IPKD 5T8IA 1QOBA 2CU3A 3U52E 4LTUA 1MHXA 1YN4A 3R2TA 1BMLC 3GP7A 1XLQA 5BYSA 1PYWD 2WXMA 3AB5A 2N9KA 3AEEB 3AEDB 3BYTB 2IJ0A 2QJLA 3BVZA 1JQ4A 2JXTA 2DWQA 4YTNB 5EE3A 1AW7A 1T5XD 3RFZB 2VZKD 1YMHE 1XCQL 3UI3A 3NRZA 2BS4B 2WXFA 3IT4B 5H92C 1ET6A 1NEKB 5EE1A 1DOIA 1VLBA 2IGDA 3MHZA 1EU4A 4KKIA 1PGXA 3SFDB 5I4DA 3I57A 4A8XC 2WLBA 5D7GA 4KGRA 1JROA 1NYRA 4WAFA 1C79A 4H2AA 2M19A 2WXQA 4HJGE 3AE3B 3BK1A 3MP9A 3WCQA 2LHDA 1YNTE 4LLGM 3Q8CA 1ROEA 2BW2A 1GAQB 1GB4A 3W1SA 1I7HA 4WWMA 1J7BA 3R2IA 4JWSC 2Z8LA 3BYYB 4NAWB 3ZJTA 1RM6C 2AQ3B 3GB1A 2CJOA 1PFDA 3IAM1 4DXGA 1SE3A 3MFGA 3P63A 1JALA 2AQ2B 2BB5A 2OEDA 1N62A 1ZXHA 3AE1B 1ESFA 4A9AA 3KLSX 3BIID 1IUEA 1L0XB 2WXOA 2K22A 2QILA 1E0ZA 2JX5A 3LB8C 1JW9D 2V0GA 2AQ1B 4RGOS 2LJIA 3T3NA 1TJEA 2PW9A 1DGJA 2BYTA 4R3DA 4A90A 1FCCC 5BYQA 3ZJUA 4XE0A 2DYMA 1SBBB 1M4VA 3URYA 4LK0M 1SSNA 1WSPA 3HVDA 3NVVA 2I2YA 2XNAC 2JYEA 1FFUA 1FRRA 1YQ3B 1B9RA 1JWAD 1CQVA 2LEKA 1SF0A 2FE8A 3AE4B 1PGAA 2IGGA 1DOXA 4HROA 3W5VB 1NI3A 2E3TA 1FCLA 3BWUD 1SJHD 2KMMA 1WGKA 1QOAA 1SE2A 5HHDG 1UWXA 1SJED 1ZXIA 4RFBA 5MPOA 3J9CA 1NYQA 3GS2A 5FR3A 3AE2B 2J53A 3NVZA 1V8CA 1I4XA 2KWDA 3IT6B 4AS1A 4ZRPA 1TY0A 1L0VB 1QOFA 4HKQA 3ZJVA 1QF6A 1C77A 3BK2A 3Q8EA 1EWYC 1XF5L 4YTPB 3DWGC 4B0MA 2GB1A 2YEPB 1C78A 2KN4A 2I38A 3VRAB 4NJCA 4OW0A 5D3IB 1XLPA 3VQIA 1BXTA 1ENFA 1JCKB 1YJJA 4GDKB 5BYRA 1V1PB 3Q8AA 4C7ZA 1TS2A 2PLPA 4RGNA 5C3JB 3B9JA 2RPVA 2DBYA 1CK1A 3ZQ4A 3HRDD 2K5PA 3NVYA 1B1ZA 1ZUD2 1EM7A 1AYFA 1ZOYB 5AUKA 1XCTL 1C4CA 2BT6A 2Q5WD 3PZ7A 4FXCA 1A70A 2WXGA 2H88B 3AN1A 4M0WA 3KWVA 1CJEA 1F2RC 2L32A 2PVOD 3B2GA 1SIJA 4TQ0A 4MH8A 4MT5A 2WDQB 2IGHA 2INPE 1C4AA 2WQYB 3NZ3A 2HTME 2KACA 2CJNA 2HDEA 3P4QB 1TS5A 3B2FA 1EWCA 2WXPA 5BMIA 3P4RB 5EE9A 1HEZE 1K50A 1TS3A 5H8YE 4OVZA 4L1BA 1I4GA 2JQRB 4ITKA 5HFYA 3FC4A 2L52A 1FO4A 3TEWA 1FNVA 4UDUC 3ZYYX 2GRIA 1FXAA 5JXVA 1E9MA 2MH7A 2WU2B 3TSSA 1JWBD 3HUIA 1L4ZB 3E9SA 1MI0A 1OQQA 1EU3A 3OWEB 2IDYA 5E6JA 1RFKA 1VZ7A 3TEXA 2WXLA 4DXFA 4ARCA 1OFFA 1RWSA 4RH6A 3P1MA 3P4SB 1TS4A 1V97A 1PDXA 1IBXA 1C4PA 1ZDVA 3CIRB 3BZDB 4NZLB 2BB6A 2KAJA 4L2YA 2GI9A 2OHFA 3TEZA 1WRIA 2PIAA 2J42A 1C9FA 2D5GA 1F2RI 1QKZA 2V4IB 1TZOA 1KH0A 4KX6B 3P42A 4TMAB 4L23A 1D5XC 2RMMA 3TEYA 3N9YC 2PVGC 3C8YA 2Y5PA 1ZE3D 3T3OA 4XDCA 1IGDA 4ZHPA 2INNE 2BTEA 3IXSA 2BBCA 1KFYB 4KGTA 2WXRA 3Q8FA 4RGTA 1FIQA 2J52A 3KQ4A 2VZKB 3NVWA 5BMGA 2EKIA 3AM9A 1TKYA 1J7AA 2QSDA 4WQMA 3SR6A 4C56C 2H89B 2K0PA 4NAMA 1L0YB 1I4QA 2G1EA 1DOYA 2PMVA 2ZW1A 2EELA 4PT5A 3O13A 2QEJC 5EE0A 3AEFB 2BS2B 2K9XA 2V3PA 3AH7A 4DQOC 1J7CA 4RF1A 5FKAC 1FFVA 2QIEB 1RYJA 2W55A 2SEBD 5G5GA 4YXDB 5HG2A 1ET9A 1HXYD 3U7ZA 2N0SB 3RPFC 5HI1A 2Y5CA 1YN3A 3VR9B 3W5UB 4OHJA 1DYQA 4EE2A 1ZDXA 1VZ6A 2BS3B 2WXNA 2V3NA 3EUB2 1WWTA 2LHEA 4C7YA 1N61A 2DLBA 4HEA1 1FNUA 4IDIA 1LO5D 3NUHB 4ZOHC 3BVMA 4YSZB 1HA5A 1TYGB 1FXIA 3AEGB 1HZ6A 3AE5B 1QILA 4MACA 2DYOA 2LGIA 3FILB 2N9LA 3W2DA 4YSYB 1XLOA 1FEHA 1K53A 4N58A 2K3UA 2YEPF 1GB1A 3DWMA 3L4PA 1D5MC 1I4PA 3AE7B 2WXHA 1XLNA 3AV8A 3AE8B 2M56B 4MM3B 1SXTA 4B0EA 2JU6X 1Q10A 4CQNA 1MPEA 2JZPA 1K51A 1BUIC 2JWUA 1TY2A 3LXFA 4JPSA 2WP9B 1P7EA 2X38A 3KWLA 4TQ1A 1ACCA 3ZGZA 1PGBA 1STEA 1YJIA 1YN5A 1N5XA 4Q2JA 2TSSA 2Y3AA 1JRPA 4IOIE 1V1OA 2MJEA 2W3SA 2ICIA 3VR8B 4N59A 4RGMA 3MC0B 2WXJA 2NMQA 1F77A 1XXGA 3MJ5A 3HVZA 3P4PB 3NS1A 4WH4A 4HKZE 1E10A 2ONQA 1D5ZC 1E6EB 2XN9C 2MJ3A 3U2SC 1TKEA 2KDMA 1QOGA 3IAS1 2L83A 4ZRQA 1N5WA 1GPXA 2KQ4X 3V3XA 5D3DA 1KF6B 5BMHA 4YWGG 3EGRA 1UGJA 2WXIA 2LUMA 2PTLA 4WIPA 4JX1C 5TSSA 1CZPA 1VZ8A 1WXQA 4P16A 3SFEB 1L5PA 2B76B 1IGCA 1ZP0B 2AX5A 3U4EG 3W9CB 2W82A 3Q69A 1UUPA 1VJKA 4KKJA 2NTTA 1V1PA 4OZAA 5G5HA 2J4XA 4KGSA 4ARIA 1P7FA 1JWUD 4IKGA 1L6UA 1YQ4B 2MEKA 3AE9B 4RNAA 1FRDA 5FK9C 3Q8BA 2FUG1 1HQRD 3BVGA 4YTMB 4USAA 1K52A 1FMAD 1XEEA 4OZBA 4TSSA 1WYGA 5AUIA 1IBXB 3TUOA 3EA6A 1AWDA 2JYTA 2QMTA 1OQRA 1T6BX 1N63A 3I9V1 4YT0B 1E7PB 4XWTA 4ZHOA 1KRHA 4ZYSA 2N7JA 1QT9A 5LNK1 1GOZA 1SB3C 4GDLB 4P6VF 4GLSC 2LMCA 3ABVB 2WDVB 4D2KA 1NENB 4RF0A 1FM0D 1SEBD 3CWIA 4JWUC 1QLBB 1D6EC 3V05A 1QQRA 2MJDA 2RDHA 2ZW0A 3LYYA 3PO0A 3FAHA 3H8HA 4XDDA 4AQ7A 1FD6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AEA B;  2JQR B;  3DWM A;  3L4P A;  3AEB B;  3P63 A;  1JAL A;  4ITK A;  3AE7 B;  1N60 A;  1XLN A;  3FC4 A;  1N62 A;  3AE8 B;  2L52 A;  2M56 B;  3AE1 B;  3AV8 A;  4A9A A;  1FO4 A;  3BII D;  1IUE A;  2K22 A;  1E0Z A;  1PUT A;  1TKG A;  2JX5 A;  3AEC B;  3LB8 C;  4HRS A;  3ZYY X;  1FXA A;  1JW9 D;  4US9 A;  1E9M A;  2MH7 A;  2WU2 B;  3LXF A;  2WP9 B;  1TJE A;  3KWL A;  1JWB D;  1DGJ A;  3HUI A;  2PKO A;  1OQQ A;  1RFK A;  1OFF A;  1RWS A;  1YJI A;  1N5X A;  4YSX B;  3P1M A;  4C80 A;  3P4S B;  1L6V A;  1JRP A;  1V97 A;  1PDX A;  2MJE A;  2W3S A;  1UWM A;  3NVV A;  2WU5 B;  4N59 A;  3VR8 B;  3CIR B;  1FFU A;  3ETR A;  3AMZ A;  1FRR A;  1YQ3 B;  1B9R A;  2W54 A;  1JWA D;  3HVZ A;  3AE6 B;  3P4P B;  2LEK A;  3NS1 A;  2KAJ A;  1SF0 A;  2WDR B;  2OHF A;  2W3R A;  1WRI A;  2PIA A;  1E10 A;  1E6E B;  3AE4 B;  1DOX A;  2MJ3 A;  4HRO A;  1NI3 A;  3W5V B;  2E3T A;  4KX6 B;  4N6E B;  1TKE A;  1T3Q A;  1VDV A;  2KMM A;  4US8 A;  1QOG A;  1WGK A;  2L83 A;  1QOA A;  1N5W A;  2PVG C;  1ZXI A;  5MPO A;  1GPX A;  2WS3 B;  1NYQ A;  1F0Z A;  1R7S A;  2ACZ B;  3AE2 B;  3NVZ A;  4ZHP A;  1V8C A;  1KF6 B;  3VRB B;  1KFY B;  5C2T B;  1FIQ A;  3NVW A;  2EKI A;  3AM9 A;  1NVI D;  4JX1 C;  1L0V B;  1TKY A;  1J7A A;  1QOF A;  1XO3 A;  1CZP A;  4WQM A;  3SR6 A;  1QF6 A;  2FBW B;  2H89 B;  1EWY C;  5GXG B;  1WXQ A;  4YTP B;  3SFE B;  2G1E A;  1DOY A;  1L5P A;  1QOB A;  2CU3 A;  3DWG C;  4LTU A;  2B76 B;  3VRA B;  1ZP0 B;  3AEF B;  2BS2 B;  1XLQ A;  2AX5 A;  2K9X A;  3AH7 A;  5EE0 A;  1XLP A;  3W9C B;  3AB5 A;  1J7C A;  3AEE B;  1VJK A;  3AED B;  1FFV A;  2QIE B;  5G5H A;  1RYJ A;  2W55 A;  2QJL A;  5G5G A;  1YJJ A;  4YXD B;  4YTN B;  2DWQ A;  5EE3 A;  1L6U A;  4C7Z A;  1YQ4 B;  3AE9 B;  2N0S B;  1FRD A;  3B9J A;  3NRZ A;  2BS4 B;  2DBY A;  5H92 C;  3RPF C;  1NEK B;  5C3J B;  5EE1 A;  1DOI A;  1VLB A;  2Y5C A;  3HRD D;  3SFD B;  4YTM B;  1JQ4 A;  4USA A;  3VR9 B;  3W5U B;  1FMA D;  5AUI A;  1WYG A;  2K5P A;  2WLB A;  3NVY A;  1ZUD 2;  1JRO A;  1NYR A;  1AYF A;  1ZOY B;  1AWD A;  5AUK A;  2M19 A;  2BS3 B;  1OQR A;  3AE3 B;  3EUB 2;  1WWT A;  2BT6 A;  2Q5W D;  1N61 A;  4FXC A;  1A70 A;  1N63 A;  4C7Y A;  2H88 B;  3AN1 A;  4YT0 B;  3WCQ A;  1E7P B;  1CJE A;  3B2G A;  2PVO D;  1SIJ A;  4ZHO A;  4IDI A;  2WDQ B;  1ROE A;  1KRH A;  1GAQ B;  4ZOH C;  4YSZ B;  1QT9 A;  2WQY B;  1SB3 C;  1TYG B;  1FXI A;  1I7H A;  2HTM E;  4P6V F;  2CJN A;  3ABV B;  3AEG B;  2CJO A;  2WDV B;  3AE5 B;  4WWM A;  1NEN B;  3P4Q B;  1FM0 D;  1J7B A;  3CWI A;  4JWS C;  3B2F A;  4JWU C;  1QLB B;  3P4R B;  5EE9 A;  2MJD A;  4YSY B;  1XLO A;  3PO0 A;  3FAH A;  5H8Y E;  1RM6 C;  4N58 A;  1PFD A; 
#chains in the Genus database with same CATH topology
 3L0W B;  3NZU A;  2IO2 B;  1WJ4 A;  4LNK A;  3N1X C;  1YQB A;  2JPH A;  2N1W A;  4XWW A;  2ON8 A;  3VUY A;  2JWZ A;  3SD5 A;  4KSK C;  3ZDT A;  4AP4 C;  2G9H D;  3BIN A;  4NNJ B;  4AOF A;  1SE4 A;  4OZC A;  2IY1 B;  1L6V A;  2NTS A;  3VUW A;  1FNW A;  3D32 A;  1KLU D;  2WU5 B;  1I4R A;  2JF5 A;  3DQV A;  4MH0 E;  1WJU A;  3ZRF A;  2JSV X;  3PZ8 A;  4N6E B;  1IYF A;  3APF A;  4LNO A;  1MHH E;  1R7S A;  2ACZ B;  4KVG B;  2X8X X;  2FCM A;  3RNG C;  5C2T B;  2E6X A;  4HXD A;  1L2N A;  4A55 A;  5KHQ A;  2IPK D;  4K3C A;  1TTN A;  1MHX A;  5HKH A;  3GP7 A;  1XLQ A;  5BYS A;  2IYD B;  2WXM A;  3AB5 A;  3AEE B;  4MGI E;  3GZN B;  5EE3 A;  4BBN C;  1KOT A;  2KTR A;  2Y5B B;  4ZRJ A;  1RLF A;  1XCQ L;  3UI3 A;  5H92 C;  2LXC A;  1ET6 A;  4CYE A;  1EU4 A;  3QC8 B;  4W9D A;  3I57 A;  3KVF B;  2WLB A;  4KGR A;  1NYR A;  1F9J A;  3MP9 A;  2LVQ A;  3PV1 A;  2LHD A;  3B0A A;  1YNT E;  4A20 A;  4RM9 A;  1UBQ A;  2BW2 A;  5DPS A;  3Q2A C;  1GB4 A;  3ZNI D;  1WJ6 A;  1I7H A;  2K25 A;  1ZGU B;  3R2I A;  4GXB A;  3PTF C;  1OEY J;  4NAW B;  5IOI A;  4OVV A;  2OJW A;  4MGK E;  1RM6 C;  4M8M A;  2CKH B;  3IAM 1;  1SE3 A;  2ZZP B;  2BB5 A;  2OED A;  2QCZ A;  1ESF A;  4HWI B;  4KDI C;  2QIL A;  3LB8 C;  3ML8 A;  1YOV B;  2KTF A;  3MC8 A;  2RGF A;  2KKC A;  1TJE A;  2KXJ A;  2PW9 A;  4K1R B;  1DGJ A;  3L08 A;  5D2M B;  3KUZ A;  3P2B A;  4R3D A;  1MG8 A;  4W9C A;  2N9X A;  3FKY A;  1WF9 A;  4XE0 A;  4ANU A;  1M4V A;  3URY A;  1SSN A;  1WR6 E;  3NVV A;  2XNA C;  2HD5 B;  1FFU A;  1B9R A;  4GDK A;  5J17 A;  2N7D A;  2LEK A;  3ZTC A;  1SF0 A;  1WZ0 A;  1E8Z A;  3ENE A;  4K81 A;  3AE4 B;  4HRO A;  3W5V B;  3DHI C;  1WX8 A;  2KMM A;  1WGK A;  1TBE A;  1UH6 A;  2KHW B;  3N20 C;  1UWX A;  1NYQ A;  2FIF A;  5FR3 A;  5IP4 D;  1M94 A;  1GJZ A;  2K1F A;  5JHB A;  2RDB C;  3L17 A;  1C77 A;  4P1B C;  3Q8E A;  1EWY C;  1XF5 L;  3RNC C;  3K9O B;  2YEP B;  1C78 A;  2KN4 A;  5D3I B;  4LDT B;  2KK8 A;  1XLP A;  3AI5 A;  3QCA A;  1S3S G;  1C3T A;  1JCK B;  2KC2 A;  4WJN A;  4RGN A;  3V6C B;  3B9J A;  2DBY A;  4JGH B;  2AWT A;  2DZM A;  3Q14 C;  4FLH A;  1XCT L;  3L13 A;  3PZ7 A;  2KWU B;  2IO0 B;  2WWZ A;  2WXG A;  2H88 B;  4M0W A;  1F2R C;  2PVO D;  1SIJ A;  5TR5 A;  4MH8 A;  2FAZ A;  4MT5 A;  1T0S C;  3ZDM C;  2CJN A;  2V3S A;  5DPR A;  2KVZ A;  4A3P A;  1TS5 A;  2O6V B;  1AAR A;  3B2F A;  4MM3 A;  5IA7 A;  3DHH C;  1JRU A;  5H8Y E;  2D07 B;  3I63 C;  1LGR A;  2IO3 B;  2CHW A;  2K39 A;  3L54 A;  4BKS A;  2GRI A;  3KUC B;  2WU2 B;  5CHW A;  3TSS A;  3IFW B;  4M02 A;  1JWB D;  2KAN A;  3E9S A;  1OQQ A;  5E6J A;  2IDY A;  4BKT A;  1OFF A;  1RWS A;  3P4S B;  4FAD A;  3PT2 B;  2K8B A;  1ZDV A;  3TMP B;  4G11 A;  5C23 A;  1C1Y B;  2OHF A;  2LVP A;  4BOZ B;  2LD9 A;  3K9P B;  3QJZ A;  1TZO A;  4L23 A;  2PE9 A;  2C9W B;  3TEY A;  4HK2 A;  2PVG C;  3QA8 A;  4PS7 A;  2Y5P A;  2MCN B;  3X23 A;  4ZHP A;  1SIF A;  2INN E;  2L0F A;  2BTE A;  4RGT A;  3Q8F A;  1FIQ A;  3NVW A;  2VZK B;  4WQM A;  3SR6 A;  2MW5 A;  4RMA A;  2H89 B;  4NAM A;  2EEL A;  2AEH A;  3O13 A;  2QEJ C;  3AEF B;  3DBH B;  4IM0 A;  1T0R C;  4DBG A;  4GDL A;  2KVR A;  4RF1 A;  1RYJ A;  5G5G A;  2KO3 A;  1WIA A;  5HG2 A;  1HXY D;  1E8X A;  2KDI A;  3C0R B;  5E6O A;  1YN3 A;  1ZW7 A;  2MBQ A;  4LJP B;  4OHJ A;  4EE2 A;  1ZDX A;  1VZ6 A;  3QHT A;  2WXN A;  2DLB A;  1L7Y A;  1FNU A;  2IZV B;  4IC7 B;  3NUH B;  3BVM A;  5D94 A;  2KLC A;  4HDO A;  4MAC A;  4WJO A;  4YSY B;  1FEH A;  2AL6 A;  2K3U A;  3DWM A;  3L4P A;  1D5M C;  2LGX A;  3AE8 B;  2M56 B;  4MM3 B;  4CQN A;  1CMX B;  1K51 A;  2BYE A;  1OGW A;  1TY2 A;  4OVU A;  3LXF A;  2Z59 B;  4JPS A;  2WP9 B;  2X38 A;  3ZGZ A;  1PGB A;  1STE A;  2M17 A;  1YN5 A;  1LQB A;  4NPN A;  2TSS A;  1JRP A;  2MJE A;  1D3Z A;  4RGM A;  4FJZ A;  3P4P B;  4QAY A;  1P0R A;  4WH4 A;  3SHQ A;  2DEN B;  1E10 A;  3QAR A;  1OTR B;  1E6E B;  5J2R A;  2XN9 C;  1UD7 A;  3DHG C;  2L8J A;  3C19 A;  1TKE A;  2KDM A;  1BT0 A;  3IAS 1;  2R2O A;  3W1Y A;  4W9G A;  2KQ4 X;  4FHK A;  5D3D A;  1WM2 A;  2WXI A;  4EOY A;  4PK1 A;  4JX1 C;  4MGY E;  3UIN B;  3EEC A;  2NVU I;  2WYQ A;  4OZA A;  2NTT A;  5G5H A;  1WXV A;  1JWU D;  4IKG A;  1L6U A;  1YQ4 B;  2JY6 A;  4LJO B;  3OLM D;  4NJ6 A;  1IBX B;  2JZZ A;  2O2V B;  4W9E A;  1OQR A;  4LDT D;  3R66 C;  3DBR B;  1T0Q C;  3I5J C;  1QT9 A;  3APD A;  1GOZ A;  4GDL B;  4P6V F;  1OQY A;  3ABV B;  1P9D U;  4D2K A;  2NBW B;  4W9I A;  3DVN U;  3RNE C;  1D6E C;  2RDH A;  2ZJD A;  3Q6B A;  2I1J A;  3LYY A;  3PO0 A;  3H8H A;  1JWM D;  3AEB B;  4DHJ B;  2EKE C;  2M0A A;  1PUT A;  2L0T A;  3AEC B;  1KLG D;  4ICV A;  2LGD A;  1TT5 B;  3KH0 A;  4ICU A;  3H7S A;  4A6Q A;  2RDG A;  4YSX B;  4J3O D;  3PRP B;  2INC C;  3AMZ A;  1MVK A;  3AE6 B;  1UNS A;  4YL8 A;  3JW0 X;  3DDC B;  2WDR B;  2W3R A;  2CS4 A;  1L4D B;  1ZPS A;  3PLU A;  3N1Y C;  1T3Q A;  4JE3 B;  2CU1 A;  5E6P A;  3B1L X;  3Q3F A;  3ML9 A;  4KZC A;  2WS3 B;  2WXK A;  3A9J A;  1MJD A;  3VRB B;  4GB9 A;  4NY0 A;  1P1A A;  1XO3 A;  3N3K B;  5D6J B;  2J0K A;  3E56 A;  3FIL A;  5GXG B;  2ZVO A;  2CU3 A;  4LTU A;  3H9D A;  4DWF A;  1YN4 A;  4IM2 A;  1BML C;  4KIK A;  1LM8 B;  3ONS A;  2N9K A;  2BF8 B;  4ANW A;  4DK5 A;  4YTN B;  3RFZ B;  1T5X D;  3NRZ A;  2IY0 B;  1NEK B;  1JQ4 A;  1VLB A;  4FA6 A;  5I4D A;  4KKI A;  4A8X C;  3RUL A;  2NPT B;  2J0M A;  2JUO A;  1WFY A;  2WXQ A;  3ZO5 B;  3BK1 A;  1I35 A;  3PHW B;  3S2A A;  4W9H A;  3Q3N C;  1ROE A;  4W9L A;  2C7H A;  1NDD A;  3DVG Y;  1Z2M A;  1J7B A;  2Z8L A;  4F8C B;  2RR9 A;  3BYY B;  4IWP A;  1WM3 A;  3RUI B;  3HHM A;  2N9P C;  3P63 A;  4HPM B;  2AQ2 B;  1N62 A;  4A9A A;  4C4V A;  1IUE A;  1L0X B;  2JX5 A;  5AEK B;  1JW9 D;  4AJW A;  3IHP C;  4RGO S;  2ASQ A;  3T3N A;  2BYT A;  1YJ1 A;  4A90 A;  1H8C A;  2FCQ A;  2VRR B;  1SBB B;  4LK0 M;  4JQW C;  4DDG D;  2LJ5 A;  1FRR A;  4II2 B;  1JWA D;  2REX A;  1N6Z A;  3RNF C;  2IGG A;  1NI3 A;  2E3T A;  1FCL A;  1V86 A;  1A5R A;  1ZXI A;  5MPO A;  2G4D B;  3AE2 B;  2JVC A;  2KWD A;  2NBV B;  2NPT A;  4HKQ A;  3ZJV A;  2BWF A;  2Z0E B;  3RZW C;  1R4M I;  1P3Q U;  4YTP B;  2I38 A;  3VRA B;  4FBJ B;  1BXT A;  2N7E A;  1ENF A;  2MX2 A;  3APC A;  3QIJ A;  5BYR A;  1T0Y A;  2PLP A;  2LRW A;  3HRD D;  1X1M A;  3NS8 A;  2K5P A;  1ZOY B;  2L3Z A;  1C4C A;  2BT6 A;  4FXC A;  1A70 A;  3AN1 A;  1CJE A;  2L32 A;  4TQ0 A;  4M00 A;  2WDQ B;  2INP E;  3GE3 C;  3PPA A;  1C4A A;  3NZ3 A;  4PYU A;  3KUD B;  3P4Q B;  4EKU A;  1EWC A;  1UBI A;  5BMI A;  5EE9 A;  4E74 A;  1WXA A;  3JSV A;  3UQA A;  2JRH A;  1I4G A;  2JQR B;  3VFK A;  4ITK A;  4K7U A;  3RNA C;  3ECI A;  4ZYN A;  3FC4 A;  3R7Q A;  2L52 A;  1FO4 A;  3TEW A;  2M0X A;  3ZYY X;  1FXA A;  1E9M A;  3PVL A;  4BFR A;  5DPW A;  1E7U A;  4BVU C;  4WJP A;  1L4Z B;  2GBN A;  3VXW A;  1RFK A;  4DXF A;  2WXL A;  2MWS B;  3TCA A;  3DOW A;  1V97 A;  2UU7 A;  1EUV B;  4FJV B;  1FPY A;  4TUU A;  3WIM A;  2KAJ A;  3TEZ A;  1WRI A;  1C9F A;  2D5G A;  1F2R I;  4KX6 B;  3P42 A;  2BKR B;  2RMM A;  3N9Y C;  4AWJ A;  3T3O A;  1ZE3 D;  3SDL C;  3KYC D;  4MDK E;  1XD3 B;  4KGT A;  1KFY B;  2J52 A;  2DZK A;  5BMG A;  2QSD A;  2BPS A;  1J8C A;  5CX3 A;  4GN1 A;  2PMV A;  5LLI A;  2BKF A;  2BS2 B;  2FID A;  1GC6 A;  4BKS D;  4DQO C;  5FKA C;  1FFV A;  2SEB D;  3U7Z A;  1RFA A;  5HI1 A;  2MP2 B;  5EDS A;  2MBB B;  1P98 A;  2MA9 B;  2WGS A;  4FN2 A;  3RT3 B;  2C5L C;  3DBR I;  2V3N A;  1WWT A;  4C7Y A;  4DHZ B;  4HEA 1;  3CF6 E;  3DBL B;  4PS8 A;  3PSE B;  4BZA A;  3OG5 A;  2J7Q B;  3AEG B;  4XC2 A;  5FR6 A;  3U7D A;  5LXI B;  4MSM B;  3W2D A;  1LFD A;  2Z0D B;  4NQL B;  3AE7 B;  1EF5 A;  5DPT A;  3KWL A;  2LZ6 A;  4TQ1 A;  1E8Y A;  2NR2 A;  1NI2 A;  1R4N I;  2LVO A;  3QX1 A;  1N5X A;  4Q2J A;  2DNF A;  2QC8 A;  3VR8 B;  3MC0 B;  2KYW A;  4URK A;  3MJ5 A;  3HVZ A;  3NS1 A;  1GNU A;  2FCN A;  2ONQ A;  1D5Z C;  3ZTD A;  2KQS A;  1QOG A;  2L83 A;  4ZRQ A;  5CHF A;  1WE6 A;  1ZKH A;  4WWP A;  3T8M A;  1E7V A;  2M8S A;  1KF6 B;  5BMH A;  3EGR A;  2LUM A;  3RCZ A;  4ZRI A;  4WIP A;  4TV3 A;  1VZ8 A;  1V2Y A;  2IND C;  1WXS A;  1WXQ A;  1L5P A;  1E5W A;  3U4E G;  3W9C B;  2KDB A;  5GMV A;  1UUP A;  4KKJ A;  1VJK A;  3UF8 A;  1TZ1 A;  4KGS A;  4W9F A;  1P7F A;  1FXT B;  3VAW A;  1FRD A;  2EMT A;  1MG4 A;  1HQR D;  3BVG A;  4YTM B;  1FMA D;  4OZB A;  1WYG A;  3EA6 A;  1AWD A;  3ALB A;  2RD0 A;  1KJT A;  2QMT A;  4HVB A;  4M0W B;  1N63 A;  2NS5 A;  2D2Q A;  3IVF A;  1KRH A;  2BVC A;  3EFU A;  1FM0 D;  3VDZ A;  3CWI A;  4JWU C;  2LAS A;  3MHS D;  1QLB B;  3JSV B;  3MC9 A;  2ZW0 A;  4AQ7 A;  5CHV C;  2ZCB A;  5E6N A;  1N60 A;  3ZNZ B;  4HDQ A;  2I1K A;  2KC1 A;  3Q3M C;  4US9 A;  2O2V A;  5G2N A;  2VH1 A;  2K8C A;  3O65 B;  4KDL B;  4C80 A;  2NCN A;  4HCP B;  3GZN I;  2C7N B;  4AJY B;  4CHK A;  1UZX B;  2MLB A;  3RNB C;  4DXA B;  1S1Q B;  1WR1 A;  1D4B A;  1VR9 A;  2MP2 A;  5JZE B;  4ANX A;  4US8 A;  2L1A A;  1C76 A;  2GBR A;  4LNN A;  4LNI A;  2O6V A;  5AZG A;  3SEB A;  2LFI A;  1V5T A;  5IN7 A;  2GBJ A;  3KYD D;  2L7R A;  3KW5 B;  3V6E B;  2K6D B;  1NVI D;  3GOE A;  4X57 B;  4HPL B;  3CST A;  1QOB A;  3I3T B;  1PYW D;  3AED B;  3VH4 B;  4WQO B;  2KZR A;  3BVZ A;  2BYF A;  2DWQ A;  2JXT A;  1AW7 A;  2KFK B;  1WYW B;  2WXF A;  1Z5S B;  3ZUN A;  4IWQ A;  2IGD A;  5EE1 A;  5AZH A;  1PGX A;  4TKN A;  1JRO A;  2KMA A;  4WAF A;  4H2A A;  1WZ3 A;  4P1C C;  1LXD A;  3AE3 B;  3ZIM A;  4GSW A;  3U8Z A;  5C1Z A;  3Q8C A;  3Q3J A;  1GAQ B;  4NQK E;  3W1S A;  2QDF A;  4WWM A;  4I6L B;  4M8N A;  1Q1O A;  3WAP A;  2D11 A;  2KDE B;  3PZD A;  4GGQ A;  4KV2 A;  2MBO A;  4CO7 A;  3LJ3 A;  3IBE A;  2AQ3 B;  3RYT A;  1PFD A;  4DXG A;  2D3G A;  3QAQ A;  1ZXH A;  3KLS X;  2WXO A;  2V0G A;  2AQ1 B;  2LJI A;  1SGH A;  3EHV A;  2MBE A;  5BYQ A;  3ZJU A;  3VVW B;  1WSP A;  3HVD A;  5CTR C;  2JYE A;  2JT4 B;  1YQ3 B;  2HJ1 A;  1CQV A;  1WGG A;  3JYU A;  2V9H A;  2FE8 A;  4NJ7 A;  1I42 A;  1Q0W B;  1PGA A;  2BGF A;  3BWU D;  1SJH D;  3DBS A;  4E71 A;  1QOA A;  1TGZ B;  2D3B A;  3H7P B;  4RFB A;  2HTH A;  2KDF B;  2J53 A;  3N1Z C;  3NVZ A;  1V8C A;  2ZNV B;  1QZE A;  4LCD E;  1TY0 A;  2ZEQ A;  1QF6 A;  2MSE D;  4NJC A;  4OW0 A;  3VQI A;  2IBI B;  3HIZ A;  2FNJ B;  1V1P B;  3Q8A A;  4C7Z A;  3ZNH B;  4EUT A;  2LUE A;  3UGB B;  2LWP A;  4BBN F;  2KLG A;  4S17 A;  3ZNG C;  3B2G A;  1WXM A;  4ACF A;  2V4L A;  2IGH A;  2CR5 A;  2D3C A;  2HTM E;  4BAX A;  5J18 A;  2HDE A;  4BOS C;  2UWQ A;  4JL9 A;  4B6W A;  2WXP A;  3P4R B;  1HEZ E;  1K50 A;  1TS3 A;  3CMM B;  2JZ3 B;  4L1B A;  3DCG A;  5HFY A;  3DBL I;  1FNV A;  4FHJ A;  4UDU C;  2MH7 A;  2HJ8 A;  3EFC A;  4XGA B;  1EU3 A;  4MSQ B;  2CHX A;  1VZ7 A;  3TEX A;  4ARC A;  1V49 A;  1HTQ A;  4RH6 A;  1HTO A;  2W9N A;  1IBX A;  3UIP B;  3CIR B;  3BZD B;  1WY8 A;  1XT9 B;  2BB6 A;  4IWO A;  4L2Y A;  1WH3 A;  2GI9 A;  4HJK A;  2PIA A;  3PGE A;  2B3A A;  1QKZ A;  2V4I B;  2V1Y A;  4WAA A;  2EMS A;  2KJR A;  2LXA A;  1D5X C;  1R4N B;  3C8Y A;  3PRZ A;  4G0N B;  2BBC A;  3KQ4 A;  4XZ4 A;  3AM9 A;  1RAX A;  4C56 C;  2LI5 A;  2K0P A;  2NBU A;  1I4Q A;  1R4M B;  2KQ7 A;  2ZW1 A;  4JLC A;  2K9X A;  4B95 A;  3M95 A;  3NY5 A;  1J7C A;  2ZPY A;  4ANV A;  2W55 A;  4YXD B;  1J0G A;  4IUM B;  2N0S B;  2Y5C A;  3VR9 B;  3UQB A;  2BS3 B;  3TIX A;  1N61 A;  3M62 B;  1EO6 A;  2GBK A;  3A9K A;  4IDI A;  4KZ0 A;  1YIW A;  1HA5 A;  4G50 A;  1FXI A;  2G45 B;  3AE5 B;  3VHT C;  3V61 A;  1QIL A;  1WRD B;  2DYO A;  3FIL B;  2DZJ A;  1MFW A;  4N58 A;  5L95 C;  1I4P A;  1SXT A;  3RZF A;  4DDI D;  2KTR B;  1MPE A;  1BUI C;  4LNF A;  4PYZ A;  4E3C A;  3HM6 X;  3UIO B;  1ACC A;  3WAM A;  2DAJ A;  3ZXV A;  2Y3A A;  1U4A A;  4IOI E;  1V1O A;  2W3S A;  3WAO A;  2WXJ A;  2NMQ A;  2MQJ A;  4HKZ E;  4I6N B;  2PPH A;  2XEW A;  3U2S C;  4WWO A;  1N5W A;  1RRB A;  1GPX A;  4MJS A;  1UGJ A;  2KFJ A;  2PTL A;  4GIV A;  4ZRK A;  3WA0 A;  1CZP A;  1ISN A;  4MEM A;  3SFE B;  4GOC A;  2FUH B;  4S0R A;  2B76 B;  1ZP0 B;  2AX5 A;  2DX5 B;  1K8R B;  3OJ3 A;  1YX6 B;  4AUQ C;  2M1M A;  5DCN A;  2MEK A;  4RNA A;  5FK9 C;  3Q8B A;  1V5O A;  2FUG 1;  3V62 A;  1WMH B;  3TUO A;  3AU4 A;  4IM3 A;  3RD2 A;  1T6B X;  2YLM A;  3I9V 1;  1E7P B;  2LRU A;  3PHX B;  4JIO U;  3R7R A;  2FCS A;  4GLS C;  2LMC A;  3PLV A;  3WAL A;  3A4S C;  4RF0 A;  1SEB D;  3VTV A;  2MJD A;  4EZJ A;  3L16 A;  4XDD A;  2WX0 A;  2QHO A;  3AEA B;  1Y56 A;  1HZ5 A;  4FJY A;  2WHI A;  4MEL A;  1KTK A;  3R8B A;  1TKG A;  4EZL A;  4HRS A;  1Q5W B;  4WUR A;  1VRA B;  2GMI C;  1WX7 A;  1E8W A;  2PKO A;  3B08 A;  1I4H A;  5L83 A;  1KLV A;  1UWM A;  3ETR A;  2W54 A;  1AN8 A;  4WJQ A;  1JML A;  2R2Q A;  4O1N A;  2KFK A;  2OJR A;  3GE8 C;  3QWZ B;  2C60 A;  2ZVN A;  1HE8 A;  2GOW A;  1VDV A;  3PRE A;  2L05 A;  4FUL A;  3ZW3 A;  3DVN V;  2SAK A;  4B9K A;  3OJ4 B;  1F0Z A;  1JWS D;  4RCO A;  2WNM A;  3MJW A;  3BY4 B;  2XK5 B;  4REZ A;  2PE6 B;  3TBL D;  2R61 A;  3AUL A;  2FBW B;  4GU2 A;  3AU5 A;  3NJT A;  5T8I A;  4F7Z A;  3U52 E;  1WGR A;  3R2T A;  2K6Q A;  1IPG A;  3N32 A;  4K7S A;  4DHJ D;  3BYT B;  4ZDV A;  2IJ0 A;  2M4N A;  2QJL A;  3SU8 X;  4N9F 4;  2XBB C;  2VZK D;  3A33 B;  2PEA A;  1YMH E;  2BS4 B;  3IT4 B;  3VUX A;  4PS3 A;  1DOI A;  3MHZ A;  3SFD B;  2OOB B;  4A3O A;  2PJH A;  5D7G A;  2DYB A;  1C79 A;  2M19 A;  4HJG E;  5IKC M;  3WCQ A;  3U30 A;  1YD8 U;  4LLG M;  3ZKJ C;  2DAF A;  3JVZ X;  2D10 A;  1NBF C;  3LDZ E;  4JWS C;  2KX3 A;  2WDT B;  2YVC A;  3ZJT A;  3V60 A;  2LGS A;  3GB1 A;  2CJO A;  1YX5 B;  3IG3 A;  2KN5 A;  3MFG A;  4P7I A;  1JAL A;  4DHZ E;  3AE1 B;  4EFO A;  3BII D;  2K22 A;  1E0Z A;  1H4R A;  1XQQ A;  1GG3 A;  1PQS A;  4BKG A;  2L76 A;  1FCC C;  3RI7 C;  1WX9 A;  2MBH A;  2DYM A;  2I2Y A;  4J6I A;  3A1Q A;  1OEY A;  4EZK A;  4HPP A;  4C00 A;  2K8H A;  4KIK B;  1DOX A;  5IO9 A;  3VH3 B;  1SE2 A;  4WWN A;  4EEW A;  5HHD G;  2KX0 A;  1SJE D;  4ASW C;  3J9C A;  4MGZ E;  3GS2 A;  3H6N A;  3RN9 C;  1WJN A;  3NHE B;  1I4X A;  3IT6 B;  4AS1 A;  4ZRP A;  3PRM B;  5IAA C;  1L0V B;  1QOF A;  2KWV B;  3BK2 A;  3DWG C;  4B0M A;  2GB1 A;  2L00 B;  2CHZ A;  2DZI A;  1IP9 A;  3W1S C;  1YJJ A;  1KM7 A;  3L10 B;  4GDK B;  1TS2 A;  2DHZ A;  5C3J B;  2RPV A;  3DPD A;  1CK1 A;  3ZQ4 A;  5JHA A;  3OAW A;  2A4Z A;  2KWC A;  3ZXR A;  2BQQ A;  1B1Z A;  1ZUD 2;  3NVY A;  1EM7 A;  1AYF A;  2ZNV C;  5AUK A;  2XK5 A;  2Q5W D;  3DBH I;  2BWE S;  3KWV A;  2AL3 A;  2WQY B;  2KAC A;  4F1S A;  1GUA B;  5KHO A;  2AYO B;  4RM8 A;  1WGH A;  3TJP A;  4OVZ A;  3QQ8 B;  3ZLZ A;  2N4F A;  5JXV A;  5G55 A;  2KMC A;  1F52 A;  3HUI A;  4MJS B;  2RPQ A;  1MI0 A;  3OWE B;  3P1M A;  1V9J A;  3VTW A;  1TS4 A;  2O6V D;  1PDX A;  1V80 A;  2GBM A;  2KT7 A;  1C4P A;  2KJ6 A;  5BO4 B;  4NZL B;  4II3 B;  2J42 A;  1KH0 A;  4TMA B;  4G3X B;  4HLE A;  1VCB A;  1VD2 A;  4XDC A;  1IGD A;  3X0W A;  3A9K B;  3IXS A;  1G6J A;  1J19 A;  2WXR A;  3N30 A;  1TIF A;  2EKI A;  1TKY A;  1J7A A;  1L0Y B;  2G4S A;  2G1E A;  1DOY A;  4PT5 A;  2KOX A;  5EE0 A;  3AH7 A;  2V3P A;  3AXC A;  2KNB A;  1V6E A;  2QIE B;  1ET9 A;  1SE9 A;  3RPF C;  2JRI B;  3PS6 A;  3W5U B;  3RMK C;  1DYQ A;  3A1Q B;  3EUB 2;  2LHE A;  4IG7 B;  4W9J A;  3M63 B;  3A9J B;  1LO5 D;  4ZOH C;  4YSZ B;  1TYG B;  1HZ6 A;  1EF1 A;  3WAN A;  3A4R A;  3R3M A;  2LGI A;  1UF0 A;  2RSU A;  2N9L A;  1XLO A;  2KJH B;  1K53 A;  2HE7 A;  2YEP F;  1GB1 A;  3NOB A;  2WX1 A;  2WXH A;  1XLN A;  3H1U A;  3AV8 A;  5AZF A;  2ZPN A;  4B0E A;  2JU6 X;  1Q10 A;  2JZP A;  4XX5 A;  1F1H A;  2JWU A;  2GLS A;  2JXX A;  1P7E A;  1WGY A;  1UEL A;  1UGM A;  3Q3O C;  1YJI A;  3DVG X;  1V81 A;  4M01 A;  2ICI A;  2A5U A;  3M3J A;  2VH2 A;  4N59 A;  2J0J A;  1F77 A;  4GMV A;  1XXG A;  4KSL C;  3ZVV A;  1GC7 A;  5LXH A;  3T9L A;  2MJ3 A;  1WMH A;  2MRP A;  4I6P A;  2IO1 B;  2KD0 A;  2C7M B;  3TL5 A;  3VTU A;  3EC8 A;  3V3X A;  3H7P A;  2MHJ A;  4K7W A;  4NAW A;  4YWG G;  3MTN B;  2ZCC A;  5TSS A;  1E90 A;  4P16 A;  1IGC A;  2W82 A;  3Q69 A;  1Y8R C;  1V1P A;  2N9E B;  1WE7 A;  1WI0 A;  2J4X A;  2G3Q B;  4ARI A;  2D3A A;  3NG0 A;  3AE9 B;  3HM3 A;  2N1V A;  4W9K A;  3QK0 A;  4XYC A;  4USA A;  1K52 A;  2BYV E;  3HK0 A;  1XEE A;  4TSS A;  5AUI A;  2JYT A;  5JH5 C;  4YT0 B;  4XWT A;  4ZHO A;  4ZYS A;  2N7J A;  5LNK 1;  1SB3 C;  2LGY A;  2UYZ B;  3NZS A;  2WDV B;  1NEN B;  4IW0 A;  3ZRC A;  3CSF A;  4C4V B;  4HCN B;  1WGD A;  3V05 A;  1QQR A;  3FAH A;  4K3B A;  1FD6 A; 
#chains in the Genus database with same CATH homology
 3AEA B;  1JWM D;  1Y56 A;  1HZ5 A;  3AEB B;  1N60 A;  1KTK A;  2M0A A;  3R8B A;  1PUT A;  1TKG A;  3AEC B;  4HRS A;  4US9 A;  1KLG D;  4WUR A;  1VRA B;  4XWW A;  2ON8 A;  2PKO A;  2G9H D;  1SE4 A;  4OZC A;  4A6Q A;  2RDG A;  4YSX B;  4J3O D;  4C80 A;  1I4H A;  1L6V A;  2NTS A;  1FNW A;  1KLU D;  1UWM A;  2WU5 B;  1I4R A;  3ETR A;  3AMZ A;  2W54 A;  1AN8 A;  1JML A;  1MVK A;  1UNS A;  3AE6 B;  2WDR B;  4O1N A;  2W3R A;  2JSV X;  1L4D B;  3PZ8 A;  1D4B A;  1ZPS A;  1VR9 A;  4N6E B;  1T3Q A;  1VDV A;  4JE3 B;  4US8 A;  2L1A A;  1C76 A;  1MHH E;  2SAK A;  2WS3 B;  1F0Z A;  1JWS D;  2WXK A;  2LFI A;  4RCO A;  1R7S A;  2WNM A;  2ACZ B;  3SEB A;  3VRB B;  5C2T B;  4REZ A;  2E6X A;  1NVI D;  1XO3 A;  2R61 A;  4A55 A;  2FBW B;  3E56 A;  3FIL A;  5GXG B;  2IPK D;  5T8I A;  1QOB A;  2CU3 A;  3U52 E;  4LTU A;  1MHX A;  1YN4 A;  3R2T A;  1BML C;  3GP7 A;  1XLQ A;  5BYS A;  1PYW D;  2WXM A;  3AB5 A;  2N9K A;  3AEE B;  3AED B;  3BYT B;  2IJ0 A;  2QJL A;  3BVZ A;  1JQ4 A;  2JXT A;  2DWQ A;  4YTN B;  5EE3 A;  1AW7 A;  1T5X D;  3RFZ B;  2VZK D;  1YMH E;  1XCQ L;  3UI3 A;  3NRZ A;  2BS4 B;  2WXF A;  3IT4 B;  5H92 C;  1ET6 A;  1NEK B;  5EE1 A;  1DOI A;  1VLB A;  2IGD A;  3MHZ A;  1EU4 A;  4KKI A;  1PGX A;  3SFD B;  5I4D A;  3I57 A;  4A8X C;  2WLB A;  5D7G A;  4KGR A;  1JRO A;  1NYR A;  4WAF A;  1C79 A;  4H2A A;  2M19 A;  2WXQ A;  4HJG E;  3AE3 B;  3BK1 A;  3MP9 A;  3WCQ A;  2LHD A;  1YNT E;  4LLG M;  3Q8C A;  1ROE A;  2BW2 A;  1GAQ B;  1GB4 A;  3W1S A;  1I7H A;  4WWM A;  1J7B A;  3R2I A;  4JWS C;  2Z8L A;  3BYY B;  4NAW B;  3ZJT A;  1RM6 C;  2AQ3 B;  3GB1 A;  2CJO A;  1PFD A;  3IAM 1;  4DXG A;  1SE3 A;  3MFG A;  3P63 A;  1JAL A;  2AQ2 B;  2BB5 A;  2OED A;  1N62 A;  1ZXH A;  3AE1 B;  1ESF A;  4A9A A;  3KLS X;  3BII D;  1IUE A;  1L0X B;  2WXO A;  2K22 A;  2QIL A;  1E0Z A;  2JX5 A;  3LB8 C;  1JW9 D;  2V0G A;  2AQ1 B;  4RGO S;  2LJI A;  3T3N A;  1TJE A;  2PW9 A;  1DGJ A;  2BYT A;  4R3D A;  4A90 A;  1FCC C;  5BYQ A;  3ZJU A;  4XE0 A;  2DYM A;  1SBB B;  1M4V A;  3URY A;  4LK0 M;  1SSN A;  1WSP A;  3HVD A;  3NVV A;  2I2Y A;  2XNA C;  2JYE A;  1FFU A;  1FRR A;  1YQ3 B;  1B9R A;  1JWA D;  1CQV A;  2LEK A;  1SF0 A;  2FE8 A;  3AE4 B;  1PGA A;  2IGG A;  1DOX A;  4HRO A;  3W5V B;  1NI3 A;  2E3T A;  1FCL A;  3BWU D;  1SJH D;  2KMM A;  1WGK A;  1QOA A;  1SE2 A;  5HHD G;  1UWX A;  1SJE D;  1ZXI A;  4RFB A;  5MPO A;  3J9C A;  1NYQ A;  3GS2 A;  5FR3 A;  3AE2 B;  2J53 A;  3NVZ A;  1V8C A;  1I4X A;  2KWD A;  3IT6 B;  4AS1 A;  4ZRP A;  1TY0 A;  1L0V B;  1QOF A;  4HKQ A;  3ZJV A;  1QF6 A;  1C77 A;  3BK2 A;  3Q8E A;  1EWY C;  1XF5 L;  4YTP B;  3DWG C;  4B0M A;  2GB1 A;  2YEP B;  1C78 A;  2KN4 A;  2I38 A;  3VRA B;  4NJC A;  4OW0 A;  5D3I B;  1XLP A;  3VQI A;  1BXT A;  1ENF A;  1JCK B;  1YJJ A;  4GDK B;  5BYR A;  1V1P B;  3Q8A A;  4C7Z A;  1TS2 A;  2PLP A;  4RGN A;  5C3J B;  3B9J A;  2RPV A;  2DBY A;  1CK1 A;  3ZQ4 A;  3HRD D;  2K5P A;  3NVY A;  1B1Z A;  1ZUD 2;  1EM7 A;  1AYF A;  1ZOY B;  5AUK A;  1XCT L;  1C4C A;  2BT6 A;  2Q5W D;  3PZ7 A;  4FXC A;  1A70 A;  2WXG A;  2H88 B;  3AN1 A;  4M0W A;  3KWV A;  1CJE A;  1F2R C;  2L32 A;  2PVO D;  3B2G A;  1SIJ A;  4TQ0 A;  4MH8 A;  4MT5 A;  2WDQ B;  2IGH A;  2INP E;  1C4A A;  2WQY B;  3NZ3 A;  2HTM E;  2KAC A;  2CJN A;  2HDE A;  3P4Q B;  1TS5 A;  3B2F A;  1EWC A;  2WXP A;  5BMI A;  3P4R B;  5EE9 A;  1HEZ E;  1K50 A;  1TS3 A;  5H8Y E;  4OVZ A;  4L1B A;  1I4G A;  2JQR B;  4ITK A;  5HFY A;  3FC4 A;  2L52 A;  1FO4 A;  3TEW A;  1FNV A;  4UDU C;  3ZYY X;  2GRI A;  1FXA A;  5JXV A;  1E9M A;  2MH7 A;  2WU2 B;  3TSS A;  1JWB D;  3HUI A;  1L4Z B;  3E9S A;  1MI0 A;  1OQQ A;  1EU3 A;  3OWE B;  2IDY A;  5E6J A;  1RFK A;  1VZ7 A;  3TEX A;  2WXL A;  4DXF A;  4ARC A;  1OFF A;  1RWS A;  4RH6 A;  3P1M A;  3P4S B;  1TS4 A;  1V97 A;  1PDX A;  1IBX A;  1C4P A;  1ZDV A;  3CIR B;  3BZD B;  4NZL B;  2BB6 A;  2KAJ A;  4L2Y A;  2GI9 A;  2OHF A;  3TEZ A;  1WRI A;  2PIA A;  2J42 A;  1C9F A;  2D5G A;  1F2R I;  1QKZ A;  2V4I B;  1TZO A;  1KH0 A;  4KX6 B;  3P42 A;  4TMA B;  4L23 A;  1D5X C;  2RMM A;  3TEY A;  3N9Y C;  2PVG C;  3C8Y A;  2Y5P A;  1ZE3 D;  3T3O A;  4XDC A;  1IGD A;  4ZHP A;  2INN E;  2BTE A;  3IXS A;  2BBC A;  1KFY B;  4KGT A;  2WXR A;  3Q8F A;  4RGT A;  1FIQ A;  2J52 A;  3KQ4 A;  2VZK B;  3NVW A;  5BMG A;  2EKI A;  3AM9 A;  1TKY A;  1J7A A;  2QSD A;  4WQM A;  3SR6 A;  4C56 C;  2H89 B;  2K0P A;  4NAM A;  1L0Y B;  1I4Q A;  2G1E A;  1DOY A;  2PMV A;  2ZW1 A;  2EEL A;  4PT5 A;  3O13 A;  2QEJ C;  5EE0 A;  3AEF B;  2BS2 B;  2K9X A;  2V3P A;  3AH7 A;  4DQO C;  1J7C A;  4RF1 A;  5FKA C;  1FFV A;  2QIE B;  1RYJ A;  2W55 A;  2SEB D;  5G5G A;  4YXD B;  5HG2 A;  1ET9 A;  1HXY D;  3U7Z A;  2N0S B;  3RPF C;  5HI1 A;  2Y5C A;  1YN3 A;  3VR9 B;  3W5U B;  4OHJ A;  1DYQ A;  4EE2 A;  1ZDX A;  1VZ6 A;  2BS3 B;  2WXN A;  2V3N A;  3EUB 2;  1WWT A;  2LHE A;  4C7Y A;  1N61 A;  2DLB A;  4HEA 1;  1FNU A;  4IDI A;  1LO5 D;  3NUH B;  4ZOH C;  3BVM A;  4YSZ B;  1HA5 A;  1TYG B;  1FXI A;  3AEG B;  1HZ6 A;  3AE5 B;  1QIL A;  4MAC A;  2DYO A;  2LGI A;  3FIL B;  2N9L A;  3W2D A;  4YSY B;  1XLO A;  1FEH A;  1K53 A;  4N58 A;  2K3U A;  2YEP F;  1GB1 A;  3DWM A;  3L4P A;  1D5M C;  1I4P A;  3AE7 B;  2WXH A;  1XLN A;  3AV8 A;  3AE8 B;  2M56 B;  4MM3 B;  1SXT A;  4B0E A;  2JU6 X;  1Q10 A;  4CQN A;  1MPE A;  2JZP A;  1K51 A;  1BUI C;  2JWU A;  1TY2 A;  3LXF A;  4JPS A;  2WP9 B;  1P7E A;  2X38 A;  3KWL A;  4TQ1 A;  1ACC A;  3ZGZ A;  1PGB A;  1STE A;  1YJI A;  1YN5 A;  1N5X A;  4Q2J A;  2TSS A;  2Y3A A;  1JRP A;  4IOI E;  1V1O A;  2MJE A;  2W3S A;  2ICI A;  3VR8 B;  4N59 A;  4RGM A;  3MC0 B;  2WXJ A;  2NMQ A;  1F77 A;  1XXG A;  3MJ5 A;  3HVZ A;  3P4P B;  3NS1 A;  4WH4 A;  4HKZ E;  1E10 A;  2ONQ A;  1D5Z C;  1E6E B;  2XN9 C;  2MJ3 A;  3U2S C;  1TKE A;  2KDM A;  1QOG A;  3IAS 1;  2L83 A;  4ZRQ A;  1N5W A;  1GPX A;  2KQ4 X;  3V3X A;  5D3D A;  1KF6 B;  5BMH A;  4YWG G;  3EGR A;  1UGJ A;  2WXI A;  2LUM A;  2PTL A;  4WIP A;  4JX1 C;  5TSS A;  1CZP A;  1VZ8 A;  1WXQ A;  4P16 A;  3SFE B;  1L5P A;  2B76 B;  1IGC A;  1ZP0 B;  2AX5 A;  3U4E G;  3W9C B;  2W82 A;  3Q69 A;  1UUP A;  1VJK A;  4KKJ A;  2NTT A;  1V1P A;  4OZA A;  5G5H A;  2J4X A;  4KGS A;  4ARI A;  1P7F A;  1JWU D;  4IKG A;  1L6U A;  1YQ4 B;  2MEK A;  3AE9 B;  4RNA A;  1FRD A;  5FK9 C;  3Q8B A;  2FUG 1;  1HQR D;  3BVG A;  4YTM B;  4USA A;  1K52 A;  1FMA D;  1XEE A;  4OZB A;  4TSS A;  1WYG A;  5AUI A;  1IBX B;  3TUO A;  3EA6 A;  1AWD A;  2JYT A;  2QMT A;  1OQR A;  1T6B X;  1N63 A;  3I9V 1;  4YT0 B;  1E7P B;  4XWT A;  4ZHO A;  1KRH A;  4ZYS A;  2N7J A;  1QT9 A;  5LNK 1;  1GOZ A;  1SB3 C;  4GDL B;  4P6V F;  4GLS C;  2LMC A;  3ABV B;  2WDV B;  4D2K A;  1NEN B;  4RF0 A;  1FM0 D;  1SEB D;  3CWI A;  4JWU C;  1QLB B;  1D6E C;  3V05 A;  1QQR A;  2MJD A;  2RDH A;  2ZW0 A;  3LYY A;  3PO0 A;  3FAH A;  3H8H A;  4XDD A;  4AQ7 A;  1FD6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...