2K9XA

Solution structure of urm1 from trypanosoma brucei
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
102
structure length
102
Chain Sequence
b'MSNHNHITVQFAGGCELLFAKQTSLQLDGVVPTGTNLNGLVQLLKTNYVKERPDLLVDQTGQTLRPGILVLVNSCDAEVVGGMDYVLNDGDTVEFISTLHGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Solution structure of Urm1 from Trypanosoma brucei
pubmed doi rcsb
source organism Trypanosoma brucei
molecule tags Unknown function
total genus 12
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2008-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09138 Urm1 Urm1 (Ubiquitin related modifier)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2k9xA00
4WWMA 1JROA 1QOFA 3AB5A 4ZHOA 2H89B 2Q5WD 3AE5B 1FMAD 1YQ4B 1E10A 2E3TA 1WGKA 2PKOA 1JALA 1WWTA 3NS1A 3P4RB 4YSXB 2DBYA 3SFEB 1EWYC 1FM0D 1SIJA 1J7AA 1YJJA 4WQMA 2BT6A 1F0ZA 1E7PB 3AEEB 3LB8C 1FRRA 3AEFB 4YTMB 1J7CA 4LTUA 1L6UA 4YT0B 1DOXA 1AWDA 3AEDB 4N59A 4FXCA 1WXQA 1JW9D 3AE3B 3P4QB 4ZOHC 1TKGA 2WP9B 5GXGB 1SF0A 1VDVA 2W3RA 4HROA 3HUIA 3AEGB 1E9MA 1YJIA 1YQ3B 3FC4A 2N0SB 3AE9B 3EUB2 3FAHA 1FFVA 2PVGC 4ZHPA 1N62A 5C3JB 2WU2B 2MJDA 5C2TB 4ITKA 2QIEB 1J7BA 3P4PB 2K9XA 4USAA 2DWQA 3WCQA 1QLBB 2WU5B 3NRZA 5EE3A 4C80A 1QT9A 4A9AA 1L0VB 1NYQA 3SR6A 4JWUC 3DWMA 1NI3A 5EE9A 3BIID 4YTPB 1CJEA 1OQRA 1RWSA 3ETRA 4YTNB 2WDQB 3AM9A 4KX6B 2PVOD 1TKYA 2L52A 1JWAD 4YSZB 3NVYA 4C7ZA 1V8CA 2WQYB 1ZP0B 1V97A 2HTME 1GPXA 1DOYA 2KAJA 1L5PA 1NEKB 3CIRB 3KWLA 1QOAA 1FIQA 1A70A 3HVZA 4HRSA 1NVID 3ABVB 1TYGB 3B9JA 5G5HA 2BS2B 3VR8B 1B9RA 1ZXIA 2MJ3A 1XLQA 3AE6B 1SB3C 1DGJA 1CZPA 1TKEA 1WRIA 1E6EB 4US9A 1JRPA 3SFDB 2B76B 3VRBB 2MH7A 3ZYYX 3AEAB 1VJKA 3AEBB 3AV8A 4N6EB 2W55A 2MJEA 3W9CB 3LXFA 1I7HA 2FBWB 3VRAB 1E0ZA 2EKIA 2BS4B 1XO3A 1N61A 1ROEA 3NVWA 1FRDA 2H88B 2WLBA 1QF6A 3W5VB 1PFDA 1N5WA 2LEKA 2L83A 1OQQA 3AE2B 3AMZA 5EE0A 5MPOA 3AE7B 2K5PA 1JQ4A 2ACZB 4JX1C 3AE1B 3AE4B 3DWGC 3VR9B 2WDVB 1R7SA 3HRDD 2W54A 1DOIA 2K22A 1ZUD2 1RFKA 1T3QA 2Y5CA 1AYFA 1TJEA 5EE1A 5H8YE 1PDXA 1FO4A 1FXIA 2G1EA 1FXAA 1N5XA 1XLOA 2KMMA 4JWSC 4P6VF 1NYRA 1UWMA 3AN1A 3NVVA 4N58A 3AH7A 3B2FA 3W5UB 1GAQB 2M56B 1FFUA 1XLPA 1RM6C 2CJNA 2QJLA 1N63A 1JWBD 1QOBA 2WDRB 2WS3B 5AUIA 4US8A 3NVZA 2PIAA 2JQRB 1N60A 1ZOYB 2W3SA 3P1MA 1PUTA 3B2GA 5G5GA 3AECB 5AUKA 1XLNA 1KF6B 2CJOA 2M19A 4IDIA 1KRHA 1WYGA 5H92C 1NENB 3P4SB 2BS3B 3P63A 1IUEA 2AX5A 1VLBA 1KFYB 1L6VA 3AE8B 3CWIA 1OFFA 2CU3A 4YSYB 3RPFC 4C7YA 3PO0A 1QOGA 1RYJA 4YXDB 2JX5A 2OHFA 3L4PA
chains in the Genus database with same CATH superfamily
1LFDA 5CX3A 1P98A 4J6IA 2IGDA 2IY1B 3N30A 3OJ4B 2L76A 1EWYC 2L0TA 4YTMB 1L6UA 5LXHA 1KLVA 3P42A 2KO3A 2LVOA 4HPMB 2W3RA 1C9FA 1R4MB 5D3DA 3PS6A 3U30A 4IWOA 3R8BA 4TQ1A 2QIEB 3DVGY 2M8SA 1V1OA 2UYZB 1P7EA 2GBRA 4YTNB 2IDYA 2KLGA 2J0MA 4BKSA 3ZRFA 2WHIA 3N3KB 3KWLA 2N1WA 3B9JA 3IFWB 3RZWC 3ZIMA 2MJ3A 2ASQA 1R4NI 2ZZPB 4MJSA 3AV8A 1Q1OA 2JXXA 2KOXA 2L83A 4FJYA 4MH0E 3L10B 1T3QA 2TSSA 2MA9B 1OGWA 3ZNID 1BUIC 4BZAA 2V3PA 1N5XA 3MHZA 2GI9A 2XK5B 2LASA 3PHWB 1FNUA 1GAQB 3TSSA 4NAWA 1D5MC 2LHDA 4DHZB 2LFIA 4RGNA 1AARA 3WAOA 4E3CA 4X57B 2IO3B 2CJOA 1KF6B 1V49A 1I4XA 1WM2A 3C0RB 3H9DA 4IDIA 2JUOA 2BWFA 2KX0A 4NJ6A 3BYYB 2J52A 1NDDA 4ZHOA 2WXQA 3QK0A 2FAZA 2VZKB 1XD3B 2LJIA 1RRBA 4B6WA 2CHZA 3AEDB 2ZCCA 3Q8BA 2PE6B 2O6VA 4DHJB 5BMGA 3ALBA 2IGHA 2FUG1 3MC8A 3FAHA 1VRAB 3U7DA 4DHZE 2MJDA 3DHHC 1GB1A 3MJ5A 3TEWA 1JRUA 2MBBB 4KX6B 2JRHA 1YNTE 1V97A 3JSVB 2N9LA 1GPXA 3ZO5B 2KX3A 3NHEB 1A70A 1I4HA 1YIWA 4J3OD 1UGMA 4US9A 2J0JA 5BMIA 1XCTL 3UI3A 2LEKA 1MFWA 4G11A 2BYEA 4PS7A 2ZEQA 2EKEC 2LMCA 1PDXA 1FXIA 2BVCA 4KDLB 3KYCD 1PQSA 3QIJA 1XLOA 2YEPB 1GC7A 4P6VF 4F7ZA 3NOBA 1L7YA 1UWMA 1M4VA 2CHXA 2LUMA 2WDRB 2A5UA 1UBIA 3Q3NC 2K25A 2J53A 3AXCA 3AECB 2WXNA 2MBHA 1SXTA 3FILB 4P16A 2QC8A 3E9SA 4C4VA 3A9JA 4AQ7A 3ZDTA 4YSYB 3TMPB 1SE2A 2AYOB 1D3ZA 1E8WA 3VUWA 1K52A 4IW0A 4WIPA 2KT7A 2LUEA 4PS8A 2N7JA 3VH3B 1JW9D 1T6BX 1Q0WB 2NBVB 4NAMA 1VR9A 5IA7A 4AS1A 1R4NB 3EUB2 2W82A 5C3JB 4P1CC 1P3QU 2FNJB 2RDBC 4NJCA 2LVPA 3PV1A 2WU5B 4EE2A 3N9YC 4FHKA 3ETRA 2KJHB 3UIPB 3IBEA 1S3SG 1JWSD 1VZ7A 4R3DA 2N7EA 4C7ZA 4WWNA 2N9XA 2HE7A 1TS2A 1D6EC 3AULA 2NBWB 2ZCBA 4BKGA 3BZDB 3V05A 3DBRI 3TJPA 2XBBC 5HI1A 2MJEA 1I7HA 4W9LA 3I57A 2D3AA 2WLBA 1YQBA 4NZLB 5MPOA 4W9IA 3DWGC 3HRDD 1DOIA 3L17A 1RFKA 4P7IA 2GBNA 3A4SC 2YVCA 3RI7C 3B08A 4HVBA 4EZJA 3AN1A 4KSKC 4FA6A 1XLPA 3W2DA 1JWBD 1LQBA 3N1ZC 4LNIA 4K7WA 4DQOC 2HD5B 1ZDXA 3QWZB 4MSMB 2JSVX 4JL9A 4LDTD 4WJOA 3PRPB 2Z0EB 2IO2B 4IOIE 5AZGA 4FLHA 3PO0A 2JX5A 1LO5D 3V3XA 4HJKA 1WGKA 3S2AA 3ZXVA 3PRZA 2LVQA 1J7CA 1UNSA 3M63B 4NY0A 3ZNGC 2ZVNA 3M62B 1TKGA 1SF0A 3L0WB 2K8CA 2DZMA 3WALA 3FC4A 4L23A 4ZHPA 1WXMA 4CO7A 1YN4A 2K9XA 4A9AA 1IGDA 3UGBB 5EE9A 1V6EA 4M0WA 3AU4A 1OQRA 2Y5PA 4I6PA 3VVWB 2NR2A 3BK2A 4RH6A 2PVOD 4WAFA 2VRRB 4YSZB 2RGFA 4NNJB 4F1SA 1A5RA 1ZP0B 2C7MB 3JSVA 1DOYA 2OEDA 3U2SC 4OZCA 2BS2B 1ZXIA 3H6NA 3BYTB 1DGJA 2DNFA 1JRPA 3HVDA 3VHTC 3ZW3A 4NPNA 4P1BC 4AOFA 2MEKA 2SAKA 4JX1C 2WXIA 3PTFC 3MJWA 3VXWA 2JU6X 4DXAB 1UF0A 4MGYE 3ZJUA 1WX7A 3ZXRA 2L8JA 2I1KA 3WAMA 5D7GA 3DOWA 5T8IA 4MJSB 1FNVA 1JWUD 1N63A 2FIFA 4LNOA 2JQRB 4A20A 1TS5A 3V6EB 3I3TB 2AL6A 1Z2MA 3Q14C 5DPSA 5E6JA 1J19A 1L0XB 5H92C 2BS3B 2LI5A 1KH0A 1WXSA 1TIFA 4K81A 3L4PA 1JROA 2Z8LA 4EFOA 2Q5WD 3AE5B 3V60A 4PK1A 4MGZE 1J7AA 4NAWB 2XNAC 3ZGZA 1HEZE 3DDCB 2MBEA 3ML9A 4NQKE 2AL3A 5E6OA 3R2TA 1H4RA 3AEGB 1YJIA 4UDUC 2QMTA 3DBRB 1V9JA 1ZE3D 1B1ZA 5AZFA 2ZNVC 4RM9A 4W9CA 3AM9A 1FEHA 5D3IB 3DVGX 3Q8CA 1IP9A 1UUPA 3SU8X 3NVYA 5FR6A 4BKTA 2KN4A 5D6JB 2O6VB 3JVZX 3W1SA 2I2YA 1AW7A 3PZ7A 4D2KA 1UBQA 5TSSA 3VUYA 1ENFA 1WE7A 3VR8B 1ESFA 3SHQA 4WWOA 2VZKD 4A55A 3APFA 5D2MB 3EA6A 5IKCM 2HTHA 1VCBA 1HA5A 1NBFC 3Q69A 1N5WA 2JVCA 2INDC 4AP4C 2KDMA 3R3MA 2JWZA 4ZRQA 3RNAC 3APDA 1V5OA 3MP9A 1NI2A 3ZTDA 2L32A 3PZ8A 3BWUD 3U7ZA 1OEYA 1MI0A 4ANVA 3NVVA 3APCA 2V1YA 1YN3A 3DBLI 1EF5A 4DBGA 1IGCA 1C3TA 2BQQA 3RMKC 5BYQA 2K6QA 1VLBA 5C1ZA 4I6LB 2L00B 1WRDB 2QSDA 5BO4B 4ARIA 1E10A 3PZDA 4KSLC 1XQQA 1F0ZA 1HE8A 3ZTCA 5DCNA 2DZKA 4C4VB 3VAWA 3HM6X 2KWDA 1WH3A 1F2RC 2INNE 3LJ3A 3NZ3A 4S0RA 2KQ7A 2J7QB 2KK8A 1QT9A 2PE9A 1C76A 4MGIE 3NG0A 4DDGD 2LXCA 1XT9B 3SD5A 1LGRA 1FXTB 1SJHD 2LGXA 3Q3OC 1CZPA 2FCNA 2LGSA 2NVUI 1VZ6A 1WXAA 4ACFA 3TEXA 5E6PA 1ZXHA 3Q3JA 1YMHE 4W9KA 2BS4B 2BYFA 2QEJC 3NVWA 4IG7B 1V1PB 2N1VA 1OQYA 2BYVE 4A3OA 2MCNB 2ACZB 1P0RA 2PLPA 3AE1B 3OLMD 1R7SA 1C1YB 1I4GA 2DZIA 4URKA 3GB1A 5DPWA 3EFCA 1K50A 1FXAA 1QZEA 4DWFA 1J0GA 2WXRA 3W5UB 2M56B 2NTSA 4PYUA 1WX9A 2PIAA 5IN7A 2KD0A 3TUOA 1PUTA 2IZVB 3VTVA 2M19A 3RNFC 3QX1A 2N9PC 2GOWA 3BK1A 4K3CA 4JLCA 3RT3B 1LM8B 4C7YA 3VFKA 3IVFA 2K0PA 4K7SA 2PKOA 3NS1A 4MELA 2DBYA 1YJJA 3IT4B 1JMLA 2K1FA 4G0NB 2D07B 3AEFB 4LTUA 4A90A 1XEEA 3A33B 2KC2A 1CQVA 5GXGB 3DVNU 3H1UA 1VDVA 2V3NA 4GDKA 2PJHA 3PREA 2WU2B 4M8NA 4WJNA 4RCOA 1I4PA 3EGRA 2LJ5A 2BTEA 3UQBA 1K53A 2C7HA 2FE8A 3KYDD 4WJPA 2MLBA 4KV2A 3T8MA 2KHWB 1AN8A 3KVFB 3ZNZB 2WXOA 4EEWA 2HTME 1E7UA 1F52A 3L13A 1FIQA 5KHQA 2ZW0A 2AQ2B 3L08A 1B9RA 5HFYA 3UIOB 2I1JA 3L54A 1MJDA 4KKIA 1TTNA 3DBLB 3RNEC 4GOCA 3VRAB 2KC1A 2R2OA 5DPTA 4M0WB 2CS4A 2ICIA 4MEMA 4AJWA 3OAWA 1EU3A 4LNNA 5IAAC 2ZPYA 1ZW7A 2JRIB 2D3CA 2ONQA 1WGYA 2KMAA 2KZRA 4XDDA 2KTFA 1VD2A 1RM6C 4ZRIA 1N60A 2N9KA 2KVZA 1ACCA 2KJ6A 2K39A 1HQRD 2BB6A 3K9PB 1UH6A 4HCNB 3RPFC 2JYTA 3ZJVA 2MQJA 1S1QB 4WWMA 4LLGM 2EMSA 2BT6A 1P1AA 4GLSC 2V4LA 4BKSD 2IO0B 4N59A 4O1NA 1BMLC 5JZEB 1IYFA 4BBNC 2WP9B 4NQLB 3D32A 1L4ZB 3AI5A 5I4DA 2RD0A 1N62A 2LWPA 3DHGC 1I42A 2NMQA 1Z5SB 4GSWA 4USAA 3ZVVA 3U52E 3NJTA 1LXDA 3QJZA 1EUVB 4MSQB 1NI3A 3N1YC 2HDEA 1GG3A 3EC8A 2J0KA 3GS2A 2KAJA 3ECIA 4ANXA 1JCKB 2KKCA 3R7QA 1FCCC 3N20C 3DQVA 4ICVA 4FHJA 5L83A 3DBHB 3I63C 2EKIA 1TS4A 1ROEA 2V0GA 1V1PA 5CHFA 1PFDA 2BGFA 5BMHA 1EU4A 4MGKE 4HDOA 5H8YE 1WM3A 2Z0DB 4GMVA 2DAFA 4B95A 1F1HA 3IT6B 4JWSC 4KGRA 3TEZA 1T0YA 4LNFA 4N58A 1XCQL 2RMMA 2D2QA 2KVRA 1G6JA 3NVZA 2DYMA 3PT2B 2O6VD 4KIKB 3Q3FA 3BVMA 1XLNA 4ICUA 3OG5A 2G4SA 2MBOA 3Q8AA 1WYGA 1NENB 5LXIB 3P4SB 4DXGA 2HJ8A 3LDZE 1QOFA 5AEKB 3K9OB 2NPTA 4HKQA 1UZXB 3UF8A 1KM7A 4RNAA 3R7RA 1DOXA 2KDBA 4FXCA 1WXQA 4ZOHC 4GB9A 4WQOB 2WXLA 3T9LA 4HROA 3AE9B 3H7PB 2PVGC 4KKJA 1SE4A 1KJTA 4K1RB 4TQ0A 4IWPA 4II2B 1MHHE 1QILA 2KFKB 3PRMB 1I4QA 2IPKD 3J9CA 1RAXA 2WDQB 5D94A 2J42A 2L52A 3PLVA 4IKGA 3ML8A 2BKRB 1J8CA 2JT4B 1HZ5A 1NEKB 4KGTA 1QOAA 4HRSA 5FK9C 4DXFA 5G5HA 1YD8U 4W9HA 4HK2A 4ZYNA 3ZDMC 2ZPNA 4EZLA 2JF5A 2JY6A 4WH4A 2NBUA 2B3AA 2B76B 3ZQ4A 1Q5WB 3RCZA 3AEBB 4S17A 2FBWB 4RGMA 3RNGC 3R2IA 1WGDA 2AQ1B 3W5VB 1SJED 2SEBD 1HXYD 1YX5B 2WDVB 5JH5C 3R66C 2KMCA 3X0WA 4HCPB 2J4XA 5CTRC 4OW0A 2KMMA 2W9NA 1NYRA 2XEWA 4XWTA 1SGHA 3P2BA 4XGAB 3RD2A 1WMHB 3RUIB 4MDKE 3P1MA 5HG2A 3RNBC 1I4RA 4LJPB 3EHVA 2WXGA 4YXDB 4E74A 1WI0A 1WF9A 1STEA 1WGGA 4GIVA 3MTNB 2JZZA 3W1YA 2RDGA 1P9DU 3LB8C 2N9EB 4A3PA 3VTUA 1WYWB 5IO9A 1YQ3B 2Y5BB 4AWJA 2N0SB 1Q10A 1FFVA 1GOZA 3MC9A 4EZKA 2O2VA 5JHBA 3P4PB 4JWUC 3T3OA 1ZKHA 1CMXB 2CHWA 4OVVA 2YEPF 3CSTA 1V8CA 1TZ1A 3HM3A 1KOTA 2JZ3B 5J18A 2MSED 3B0AA 3HVZA 2DENB 3ABVB 4GDKB 1XLQA 1E6EB 4OVUA 2MH7A 2C5LC 1E8YA 1WZ0A 3O13A 2JZPA 1XXGA 1FRDA 1WJNA 2WWZA 2DYOA 1OQQA 1D5XC 3AE4B 3IAM1 2W54A 3DPDA 1ZUD2 3DHIC 3NUHB 2GB1A 2G1EA 1Y56A 4W9EA 3VQIA 4H2AA 2IGGA 4FULA 3HK0A 1E5WA 2CJNA 4NJ7A 2W3SA 1WGHA 4DHJD 4KIKA 3KUDB 5G5GA 3QAQA 4BBNF 3RZFA 2KLCA 4W9DA 1WY8A 2C7NB 2MWSB 1C79A 3P63A 3MFGA 1KFYB 2KQSA 1RYJA 2XN9C 4F8CB 3C19A 3SFEB 4ANUA 3WA0A 2RPQA 3P4QB 2ZNVB 2GMIC 3BVGA 4MT5A 2G45B 5CHVC 3I9V1 3H7PA 4JGHB 4FJVB 1VZ8A 2RDHA 3V62A 1PYWD 2KFKA 1TBEA 1L0VB 2GBMA 3SR6A 2D3BA 1T0RC 3RFZB 1V5TA 2KWCA 4RF1A 3QCAA 4ZRPA 4C00A 1L5PA 2LHEA 3CIRB 4MM3B 3M3JA 1QQRA 3KW5B 4ZDVA 1D5ZC 3GP7A 1TT5B 4DK5A 1WRIA 2NCNA 3E56A 1Y8RC 3SFDB 2WXFA 3RNCC 3VRBB 4CHKA 4M8MA 2M1MA 1FPYA 4GDLB 3DVNV 1WJ6A 2G4DB 4BOSC 1V81A 3OJ3A 2LRWA 1V86A 5EE1A 3SDLC 4REZA 3TBLD 3MHSD 5E6NA 4FADA 2L1AA 2L05A 1K51A 3ZUNA 4M00A 2N7DA 4XX5A 3RYTA 2L7RA 1WMHA 2WX1A 4B0MA 1MG8A 2OJWA 2R2QA 2KN5A 2D11A 3MC0B 3N1XC 3PLUA 4CYEA 1IUEA 2DHZA 3CWIA 4QAYA 2YLMA 2BKFA 2OHFA 1ET9A 3AB5A 2BB5A 2H89B 2JWUA 1FMAD 4AJYB 5AZHA 1WWTA 2FUHB 2INPE 3DBHI 3V6CB 4PT5A 3BY4B 5C23A 5HHDG 1ZGUB 5J17A 2KFJA 3BINA 5LNK1 3TCAA 2JXTA 1GUAB 4RGTA 1XF5L 4KVGB 1KLGD 2WXJA 5EE3A 2WXPA 2NPTB 2KXJA 2WDTB 3A1QA 4KDIC 3Q6BA 4WAAA 2MX2A 5BYSA 3BIID 2GBJA 2CR5A 2REXA 2ZW1A 2FCSA 2G3QB 3H8HA 3N32A 1GJZA 2QCZA 3AU5A 2CU1A 4YWGG 3ZKJC 5IOIA 3VH4B 4XZ4A 4RGOS 3KWVA 1YJ1A 1WR1A 4OHJA 4BFRA 1TKEA 2RSUA 1FCLA 1GNUA 3W9CB 1IPGA 1CK1A 5JXVA 1JWMD 1E0ZA 2R61A 3VTWA 4TMAB 3O65B 4BAXA 3AE7B 1WJ4A 4A8XC 4C56C 4ZRJA 4RFBA 3VR9B 1T0SC 4LK0M 2JYEA 1L4DB 1L2NA 4BVUC 3DCGA 3TL5A 1HTQA 1WR6E 4GU2A 5AUIA 1X1MA 1QKZA 3EFUA 4W9JA 4OVZA 1IBXA 1FD6A 3WAPA 1UWXA 2X38A 2KANA 3L16A 2FCMA 5FR3A 4RMAA 4LCDE 1TZOA 4ASWC 4L1BA 2KQ4X 3C8YA 1V80A 5J2RA 1L6VA 2CU3A 1FFUA 3GZNI 2KWVB 4K7UA 1YQ4B 1WZ3A 3P4RB 1M94A 2BYTA 2ON8A 4RM8A 3AEEB 4KGSA 1K8RB 1L0YB 2KDFB 4I6NB 2KYWA 1GB4A 2KTRB 4WURA 4ITKA 2PMVA 3QA8A 1QLBB 2WX0A 3PGEA 1D4BA 4OZAA 2OOBB 4XC2A 4YTPB 1MPEA 2K3UA 1F9JA 2MP2B 1JWAD 5EDSA 1BT0A 2PPHA 1C77A 4MM3A 4PS3A 5KHOA 3SEBA 1NVID 5HKHA 1TYGB 4ZYSA 2GRIA 3JW0X 2WXMA 3AE6B 3KH0A 2V3SA 2O2VB 2IO1B 3AEAB 3W1SC 3OWEB 1WGRA 4GDLA 3UINB 3CMMB 2H88B 2G9HD 2WGSA 1HZ6A 1T0QC 3GE8C 5EE0A 3KQ4A 5FKAC 2K22A 1WX8A 4N9F4 2Z59B 4CQNA 3PHXB 2IYDB 2D5GA 3Q8FA 2DX5B 2LGIA 5CHWA 5LLIA 2BPSA 4IM3A 1EF1A 3NZSA 4WJQA 2EMTA 2Y3AA 2FCQA 1C78A 2OJRA 2WS3B 4US8A 3V61A 2MHJA 4G3XB 4FBJB 4HPLB 2IY0B 4HPPA 1KRHA 4HJGE 3KLSX 3HIZA 4FN2A 4B9KA 3AE8B 2EELA 2QILA 1ET6A 1FNWA 2KDIA 2ZJDA 3NZUA 1JALA 4YSXB 4HXDA 4WQMA 2WNMA 3DBSA 4GN1A 3A9KB 4YT0B 1AWDA 4HWIB 3AE3B 2C60A 4TSSA 4XDCA 4TKNA 2RR9A 3FKYA 4HLEA 2DLBA 5L95C 1TY2A 2VH1A 1J7BA 2RPVA 2WXKA 3RULA 3WCQA 4C80A 1E8ZA 3DWMA 4JPSA 3KUZA 4ANWA 1RWSA 3ZNHB 4DDID 1TKYA 3QARA 4YL8A 1MG4A 1MHXA 2M0AA 2V9HA 4HDQA 3GE3C 1TY0A 3URYA 4MH8A 4IWQA 2XK5A 2DZJA 2ZVOA 2L3ZA 1SE3A 2LGDA 3ZRCA 4XE0A 3I5JC 1UELA 3U4EG 4AUQC 2CKHB 1C4PA 2K8HA 4IM2A 1E7VA 3UQAA 3ZJTA 2Y5CA 1AYFA 2HJ1A 3GZNB 1FO4A 2QHOA 3CSFA 3ZLZA 4IC7B 1E90A 1EO6A 1ZPSA 1YOVB 2D3GA 1ZOYB 1WXVA 2IJ0A 5G2NA 3Q3MC 5AUKA 4L2YA 1BXTA 1PGAA 2AEHA 2AQ3B 2E6XA 2PEAA 1OFFA 4EKUA 2MW5A 2PTLA 2E3TA 1ISNA 1SIFA 1FM0D 2DYBA 1SIJA 2MBQA 3IAS1 4K3BA 3Q8EA 2NS5A 2JPHA 4IUMB 1YN5A 1RLFA 3KUCB 4RF0A 2LD9A 4EUTA 2GLSA 3HUIA 1E9MA 3RN9C 5GMVA 2KTRA 2M4NA 1RFAA 1TGZB 3NRZA 4XWWA 4PYZA 1NYQA 4JE3B 4JIOU 1CJEA 3GOEA 2VH2A 2MP2A 2WXHA 3TEYA 3U8ZA 1HTOA 4XYCA 3QHTA 1R4MI 1SB3C 4HKZE 4EOYA 4JQWC 3QC8B 5TR5A 2M17A 4A6QA 4E71A 1VJKA 4GXBA 4N6EB 5JHAA 4WWPA 3A1QB 1N61A 2X8XX 4G50A 1V2YA 1E8XA 3AE2B 1F2RI 4TUUA 2BW2A 4B0EA 3FILA 3IHPC 1TJEA 1C4CA 1PGXA 3QQ8B 2IBIB 5BYRA 4HEA1 1H8CA 3EECA 3AH7A 3B2FA 1GC6A 4M01A 1QOBA 2I38A 2UWQA 3WANA 3T3NA 2A4ZA 2FIDA 3B2GA 2V4IB 2M0XA 2LGYA 2K6DB 1U4AA 1P7FA 2AX5A 2KWUB 2L0FA 1F77A 4ZRKA 1YX6B 1UD7A 2K8BA 5DPRA 4BOZB 4LNKA 4GGQA 2PW9A 5IP4D 2UU7A 3LYYA 1WJUA 2LZ6A 3VDZA 1IBXB 1MVKA 1E7PB 3A9KA 1FRRA 4IM0A 4II3B 4FJZA 1I35A 1KLUD 3ENEA 1KTKA 3CF6E 3X23A 2BWES 1C4AA 3B1LX 4W9FA 3ONSA 5C2TB 3HHMA 2QDFA 4W9GA 2KJRA 1ZDVA 4TV3A 2DWQA 3NS8A 1WE6A 1OTRB 5G55A 2AWTA 3TIXA 2D10A 2DAJA 4KZ0A 1WFYA 4M02A 3JYUA 2GBKA 4LJOB 2WQYB 1PGBA 2BBCA 4LDTB 1SEBD 1EWCA 3H7SA 3M95A 3IG3A 1WIAA 2LRUA 3PVLA 2C9WB 3ZYYX 2W55A 3LXFA 4Q2JA 2NTTA 3PPAA 3WIMA 1XO3A 1N6ZA 2INCC 1QF6A 2BF8B 3AMZA 2K5PA 1JQ4A 1TS3A 4KZCA 3VUXA 2KNBA 3NY5A 1WSPA 1SE9A 1UGJA 3Q2AC 3IXSA 1SBBB 2QJLA 1SSNA 4OZBA 4MACA 3BVZA 2WYQA 3A4RA 2N4FA 4ARCA 1OEYJ 2LXAA 2KDEB 3A9JB 1DYQA 1EM7A 1T5XD 3PSEB 2MRPA 1QOGA 2KACA
chains in the Genus database with same CATH topology
1JROA 1QOFA 2Z8LA 2Q5WD 3AE5B 1YQ4B 2IGDA 3P4RB 1EWYC 2BYTA 4HKQA 1J7AA 4NAWB 2ON8A 2XNAC 3ZGZA 3AEEB 1HEZE 4KGSA 4YTMB 4RNAA 1L6UA 1L0YB 1DOXA 4FXCA 1WXQA 3P42A 4ZOHC 2WXLA 3R2TA 2W3RA 4HROA 1GB4A 3AEGB 1YJIA 4UDUC 1C9FA 5D3DA 3AE9B 2PVGC 4KKJA 1SE4A 2QMTA 4TQ0A 1ZE3D 3R8BA 1B1ZA 4TQ1A 4WURA 4ITKA 1MHHE 2QIEB 2PMVA 1QILA 1QLBB 1D4BA 1I4QA 4OZAA 1V1OA 2IPKD 1P7EA 4YTPB 1MPEA 2K3UA 3J9CA 4YTNB 2WDQB 1FEHA 3AM9A 5D3IB 3Q8CA 2IDYA 2J42A 1JWAD 1UUPA 2L52A 3NVYA 4IKGA 2KN4A 3W1SA 2I2YA 1AW7A 1HZ5A 3PZ7A 1NEKB 3SEBA 4KGTA 1C77A 1QOAA 3KWLA 5TSSA 4D2KA 4HRSA 1NVID 1ENFA 5FK9C 4DXFA 3B9JA 1TYGB 5G5HA 3VR8B 4ZYSA 2GRIA 2MJ3A 1ESFA 2WXMA 3AE6B 2VZKD 4WH4A 4A55A 2B76B 3ZQ4A 3AEAB 3AV8A 3AEBB 3OWEB 3EA6A 2FBWB 4RGMA 3R2IA 2H88B 2G9HD 1HA5A 1HZ6A 2AQ1B 3W5VB 1SJED 1N5WA 2SEBD 2L83A 3Q69A 5EE0A 1HXYD 3KQ4A 2KDMA 5FKAC 4ZRQA 2WDVB 2K22A 1T3QA 2TSSA 4CQNA 3MP9A 2D5GA 2J4XA 3Q8FA 2L32A 3PZ8A 1BUIC 3BWUD 2LGIA 3U7ZA 1MI0A 2V3PA 4OW0A 1N5XA 2KMMA 3MHZA 1NYRA 2GI9A 3NVVA 4XWTA 1FNUA 1GAQB 2Y3AA 3TSSA 1C78A 2WS3B 1YN3A 4US8A 1D5MC 2LHDA 2LFIA 4RGNA 3P1MA 1IGCA 2CJOA 1KF6B 1I4XA 5HG2A 4IDIA 1KRHA 4HJGE 3KLSX 1I4RA 5BYQA 1VLBA 2WXGA 3AE8B 3BYYB 2EELA 4YXDB 2J52A 2QILA 1ET6A 2QSDA 1STEA 1FNWA 4ZHOA 2WXQA 4ARIA 1E10A 1JALA 4YSXB 2VZKB 2RDGA 4WQMA 2LJIA 2WNMA 1F0ZA 3LB8C 4YT0B 1AWDA 3AEDB 3Q8BA 3AE3B 4TSSA 5BMGA 4XDCA 2IGHA 2FUG1 1YQ3B 2N0SB 1Q10A 1FFVA 1GOZA 3FAHA 1VRAB 2KWDA 2DLBA 1TY2A 1F2RC 2MJDA 2INNE 1J7BA 3NZ3A 3P4PB 2RPVA 2WXKA 3MJ5A 1GB1A 3WCQA 3TEWA 4C80A 1QT9A 1C76A 4JWUC 3T3OA 3DWMA 4JPSA 1RWSA 4KX6B 1TKYA 2YEPF 1YNTE 1V8CA 1MHXA 1V97A 1GPXA 2N9LA 2M0AA 1A70A 1I4HA 3HVZA 3ABVB 1TY0A 3URYA 4MH8A 1SJHD 4GDKB 1XLQA 4J3OD 1CZPA 1E6EB 4US9A 2MH7A 1VZ6A 3TEXA 5BMIA 1XCTL 1ZXHA 1SE3A 1YMHE 3O13A 2JZPA 2BS4B 3UI3A 1XXGA 3NVWA 1FRDA 2QEJC 4XE0A 1V1PB 2DYOA 2LEKA 1OQQA 3U4EG 2ACZB 1D5XC 2PLPA 3AE1B 3AE4B 3IAM1 1C4PA 1R7SA 2W54A 3ZJTA 1ZUD2 2Y5CA 1I4GA 1AYFA 3NUHB 2GB1A 2LMCA 1PDXA 1FO4A 1FXIA 3GB1A 2G1EA 1K50A 1Y56A 1FXAA 1XLOA 2YEPB 3VQIA 4P6VF 4H2AA 1UWMA 2IGGA 1M4VA 2WXRA 3W5UB 2M56B 1ZPSA 2NTSA 2CJNA 2LUMA 2WDRB 2PIAA 2W3SA 1ZOYB 3TUOA 2IJ0A 2J53A 1PUTA 5G5GA 3AECB 5AUKA 2M19A 4L2YA 1BXTA 2WXNA 1SXTA 3FILB 4P16A 3E9SA 1PGAA 1C79A 3P63A 2AQ3B 3BK1A 4AQ7A 2E6XA 3MFGA 1KFYB 4YSYB 1OFFA 4C7YA 1SE2A 1RYJA 2XN9C 2K0PA 2PTLA 2E3TA 2PKOA 3NS1A 1K52A 2DBYA 3SFEB 1FM0D 1YJJA 1SIJA 3IT4B 4WIPA 3IAS1 1JMLA 3Q8EA 1YN5A 3AEFB 4LTUA 4A90A 2N7JA 1JW9D 1XEEA 1T6BX 3P4QB 4RF0A 3BVGA 1CQVA 4MT5A 4NAMA 5GXGB 1VR9A 1VDVA 3HUIA 4AS1A 2V3NA 1E9MA 3I9V1 3EUB2 2W82A 5C3JB 2WU2B 4RCOA 1VZ8A 2RDHA 1PYWD 4NJCA 1I4PA 3EGRA 2BTEA 1K53A 2WU5B 2FE8A 3NRZA 4EE2A 3N9YC 4XWWA 1L0VB 1NYQA 3SR6A 4JE3B 1CJEA 3RFZB 3ETRA 1AN8A 1JWSD 4RF1A 2WXHA 3TEYA 1VZ7A 4R3DA 2WXOA 4ZRPA 4C7ZA 2HTME 1L5PA 1TS2A 2LHEA 3CIRB 4MM3B 1FIQA 1QQRA 1D6EC 2ZW0A 2AQ2B 1B9RA 5HFYA 1D5ZC 3BZDB 3GP7A 3V05A 1SB3C 4HKZE 1WRIA 3E56A 3SFDB 2WXFA 3VRBB 4KKIA 4A6QA 1VJKA 4N6EB 5HI1A 2MJEA 1I7HA 3VRAB 3I57A 4GDLB 1N61A 2WLBA 2ICIA 3AE2B 4NZLB 5MPOA 1EU3A 1F2RI 3DWGC 2BW2A 4B0EA 3FILA 3HRDD 1DOIA 1RFKA 5EE1A 1TJEA 4REZA 1C4CA 1PGXA 2ONQA 5BYRA 4HEA1 2L1AA 4XDDA 3AN1A 3AH7A 3B2FA 1K51A 1XLPA 1RM6C 3W2DA 1JWBD 1QOBA 4DQOC 2I38A 3T3NA 1N60A 2N9KA 1ZDXA 1ACCA 4B0MA 3B2GA 2JSVX 1HQRD 2BB6A 2V4IB 3MC0B 4IOIE 1IUEA 1P7FA 2AX5A 3CWIA 3RPFC 1F77A 2JYTA 3ZJVA 3PO0A 2JX5A 1LO5D 2OHFA 1ET9A 4WWMA 3V3XA 3AB5A 4LLGM 2BB5A 2H89B 2JWUA 1FMAD 1WGKA 1WWTA 2PW9A 3LYYA 2INPE 1IBXB 2BT6A 1MVKA 1E7PB 1FRRA 1J7CA 1UNSA 4GLSC 4PT5A 4N59A 4O1NA 1BMLC 5HHDG 1TKGA 2WP9B 1KLUD 1SF0A 1KTKA 3FC4A 1C4AA 1L4ZB 5LNK1 4L23A 4ZHPA 5I4DA 2JXTA 1N62A 1YN4A 4RGTA 1XF5L 5C2TB 2NMQA 1ZDVA 4USAA 2K9XA 1KLGD 2DWQA 2WXJA 3U52E 5EE3A 4A9AA 2WXPA 1IGDA 5BYSA 1NI3A 5EE9A 3BIID 4M0WA 1OQRA 2Y5PA 2ZW1A 3BK2A 4RH6A 2PVOD 3H8HA 4WAFA 2HDEA 4YSZB 2WQYB 1ZP0B 1PGBA 2BBCA 3GS2A 1DOYA 2KAJA 2OEDA 4YWGG 3U2SC 4OZCA 1SEBD 1JCKB 2BS2B 1EWCA 4RGOS 3KWVA 1ZXIA 3BYTB 4OHJA 1DGJA 1FCCC 1TKEA 1JRPA 1FCLA 3HVDA 3ZYYX 3W9CB 2W55A 1CK1A 5JXVA 3LXFA 1JWMD 4Q2JA 2NTTA 1E0ZA 2R61A 2EKIA 4TMAB 1XO3A 1TS4A 1ROEA 2V0GA 1V1PA 1QF6A 1PFDA 3AMZA 5BMHA 3AE7B 2K5PA 2MEKA 2SAKA 1JQ4A 4A8XC 4JX1C 4C56C 4RFBA 3VR9B 1EU4A 1TS3A 2WXIA 4LK0M 2JU6X 1WSPA 2JYEA 5H8YE 1L4DB 3ZJUA 3IT6B 4JWSC 1UGJA 4KGRA 3TEZA 5D7GA 4N58A 1XCQL 5T8IA 2RMMA 3IXSA 1SBBB 1FNVA 2QJLA 1SSNA 1JWUD 1N63A 1QKZA 4OZBA 5AUIA 4MACA 4OVZA 3NVZA 3BVZA 2DYMA 1FD6A 1IBXA 2JQRB 1UWXA 1TS5A 2X38A 3BVMA 5FR3A 1XLNA 4ARCA 1TZOA 4L1BA 2KQ4X 3Q8AA 3C8YA 5E6JA 1WYGA 1L0XB 1NENB 5H92C 1DYQA 1EM7A 3P4SB 2BS3B 1KH0A 1T5XD 4DXGA 1L6VA 2CU3A 1QOGA 1FFUA 2KACA 3L4PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WWM A;  1JRO A;  1QOF A;  3AB5 A;  4ZHO A;  2H89 B;  2Q5W D;  3AE5 B;  1FMA D;  1YQ4 B;  1E10 A;  2E3T A;  1WGK A;  2PKO A;  1JAL A;  1WWT A;  3NS1 A;  3P4R B;  4YSX B;  2DBY A;  3SFE B;  1EWY C;  1FM0 D;  1SIJ A;  1J7A A;  1YJJ A;  4WQM A;  2BT6 A;  1F0Z A;  1E7P B;  3AEE B;  3LB8 C;  1FRR A;  3AEF B;  4YTM B;  1J7C A;  4LTU A;  1L6U A;  4YT0 B;  1DOX A;  1AWD A;  3AED B;  4N59 A;  4FXC A;  1WXQ A;  1JW9 D;  3AE3 B;  3P4Q B;  4ZOH C;  1TKG A;  2WP9 B;  5GXG B;  1SF0 A;  1VDV A;  2W3R A;  4HRO A;  3HUI A;  3AEG B;  1E9M A;  1YJI A;  1YQ3 B;  3FC4 A;  2N0S B;  3AE9 B;  3EUB 2;  3FAH A;  1FFV A;  2PVG C;  4ZHP A;  1N62 A;  5C3J B;  2WU2 B;  2MJD A;  5C2T B;  4ITK A;  2QIE B;  1J7B A;  3P4P B;  2K9X A;  4USA A;  2DWQ A;  3WCQ A;  1QLB B;  2WU5 B;  3NRZ A;  5EE3 A;  4C80 A;  1QT9 A;  4A9A A;  1L0V B;  1NYQ A;  3SR6 A;  4JWU C;  3DWM A;  1NI3 A;  5EE9 A;  3BII D;  4YTP B;  1CJE A;  1OQR A;  1RWS A;  3ETR A;  4YTN B;  2WDQ B;  3AM9 A;  4KX6 B;  2PVO D;  1TKY A;  2L52 A;  1JWA D;  4YSZ B;  3NVY A;  4C7Z A;  1V8C A;  2WQY B;  1ZP0 B;  1V97 A;  2HTM E;  1GPX A;  1DOY A;  2KAJ A;  1L5P A;  1NEK B;  3CIR B;  3KWL A;  1QOA A;  1FIQ A;  1A70 A;  3HVZ A;  4HRS A;  1NVI D;  3ABV B;  1TYG B;  3B9J A;  5G5H A;  2BS2 B;  3VR8 B;  1B9R A;  1ZXI A;  2MJ3 A;  1XLQ A;  3AE6 B;  1SB3 C;  1DGJ A;  1CZP A;  1TKE A;  1WRI A;  1E6E B;  4US9 A;  1JRP A;  3SFD B;  2B76 B;  3VRB B;  2MH7 A;  3ZYY X;  3AEA B;  1VJK A;  3AEB B;  3AV8 A;  4N6E B;  2W55 A;  2MJE A;  3W9C B;  3LXF A;  1I7H A;  2FBW B;  3VRA B;  1E0Z A;  2EKI A;  2BS4 B;  1XO3 A;  1N61 A;  1ROE A;  3NVW A;  1FRD A;  2H88 B;  2WLB A;  1QF6 A;  3W5V B;  1PFD A;  1N5W A;  2LEK A;  2L83 A;  1OQQ A;  3AE2 B;  3AMZ A;  5EE0 A;  5MPO A;  3AE7 B;  2K5P A;  1JQ4 A;  2ACZ B;  4JX1 C;  3AE1 B;  3AE4 B;  3DWG C;  3VR9 B;  2WDV B;  1R7S A;  3HRD D;  2W54 A;  1DOI A;  2K22 A;  1ZUD 2;  1RFK A;  1T3Q A;  2Y5C A;  1AYF A;  1TJE A;  5EE1 A;  5H8Y E;  1PDX A;  1FO4 A;  1FXI A;  2G1E A;  1FXA A;  1N5X A;  1XLO A;  2KMM A;  4JWS C;  4P6V F;  1NYR A;  1UWM A;  3AN1 A;  3NVV A;  4N58 A;  3AH7 A;  3B2F A;  3W5U B;  1GAQ B;  2M56 B;  1FFU A;  1XLP A;  1RM6 C;  2CJN A;  2QJL A;  1N63 A;  1JWB D;  1QOB A;  2WDR B;  2WS3 B;  5AUI A;  4US8 A;  3NVZ A;  2PIA A;  2JQR B;  1N60 A;  1ZOY B;  2W3S A;  3P1M A;  1PUT A;  3B2G A;  5G5G A;  3AEC B;  5AUK A;  1XLN A;  1KF6 B;  2CJO A;  2M19 A;  4IDI A;  1KRH A;  1WYG A;  5H92 C;  1NEN B;  3P4S B;  2BS3 B;  3P63 A;  1IUE A;  2AX5 A;  1VLB A;  1KFY B;  1L6V A;  3AE8 B;  3CWI A;  1OFF A;  2CU3 A;  4YSY B;  3RPF C;  4C7Y A;  3PO0 A;  1QOG A;  1RYJ A;  4YXD B;  2JX5 A;  2OHF A;  3L4P A; 
#chains in the Genus database with same CATH topology
 1LFD A;  5CX3 A;  1P98 A;  4J6I A;  2IGD A;  2IY1 B;  3N30 A;  3OJ4 B;  2L76 A;  1EWY C;  2L0T A;  4YTM B;  1L6U A;  5LXH A;  1KLV A;  3P42 A;  2KO3 A;  2LVO A;  4HPM B;  2W3R A;  1C9F A;  1R4M B;  5D3D A;  3PS6 A;  3U30 A;  4IWO A;  3R8B A;  4TQ1 A;  2QIE B;  3DVG Y;  2M8S A;  1V1O A;  2UYZ B;  1P7E A;  2GBR A;  4YTN B;  2IDY A;  2KLG A;  2J0M A;  4BKS A;  3ZRF A;  2WHI A;  3N3K B;  3KWL A;  2N1W A;  3B9J A;  3IFW B;  3RZW C;  3ZIM A;  2MJ3 A;  2ASQ A;  1R4N I;  2ZZP B;  4MJS A;  3AV8 A;  1Q1O A;  2JXX A;  2KOX A;  2L83 A;  4FJY A;  4MH0 E;  3L10 B;  1T3Q A;  2TSS A;  2MA9 B;  1OGW A;  3ZNI D;  1BUI C;  4BZA A;  2V3P A;  1N5X A;  3MHZ A;  2GI9 A;  2XK5 B;  2LAS A;  3PHW B;  1FNU A;  1GAQ B;  3TSS A;  4NAW A;  1D5M C;  2LHD A;  4DHZ B;  2LFI A;  4RGN A;  1AAR A;  3WAO A;  4E3C A;  4X57 B;  2IO3 B;  2CJO A;  1KF6 B;  1V49 A;  1I4X A;  1WM2 A;  3C0R B;  3H9D A;  4IDI A;  2JUO A;  2BWF A;  2KX0 A;  4NJ6 A;  3BYY B;  2J52 A;  1NDD A;  4ZHO A;  2WXQ A;  3QK0 A;  2FAZ A;  2VZK B;  1XD3 B;  2LJI A;  1RRB A;  4B6W A;  2CHZ A;  3AED B;  2ZCC A;  3Q8B A;  2PE6 B;  2O6V A;  4DHJ B;  5BMG A;  3ALB A;  2IGH A;  2FUG 1;  3MC8 A;  3FAH A;  1VRA B;  3U7D A;  4DHZ E;  2MJD A;  3DHH C;  1GB1 A;  3MJ5 A;  3TEW A;  1JRU A;  2MBB B;  4KX6 B;  2JRH A;  1YNT E;  1V97 A;  3JSV B;  2N9L A;  1GPX A;  3ZO5 B;  2KX3 A;  3NHE B;  1A70 A;  1I4H A;  1YIW A;  4J3O D;  1UGM A;  4US9 A;  2J0J A;  5BMI A;  1XCT L;  3UI3 A;  2LEK A;  1MFW A;  4G11 A;  2BYE A;  4PS7 A;  2ZEQ A;  2EKE C;  2LMC A;  1PDX A;  1FXI A;  2BVC A;  4KDL B;  3KYC D;  1PQS A;  3QIJ A;  1XLO A;  2YEP B;  1GC7 A;  4P6V F;  4F7Z A;  3NOB A;  1L7Y A;  1UWM A;  1M4V A;  2CHX A;  2LUM A;  2WDR B;  2A5U A;  1UBI A;  3Q3N C;  2K25 A;  2J53 A;  3AXC A;  3AEC B;  2WXN A;  2MBH A;  1SXT A;  3FIL B;  4P16 A;  2QC8 A;  3E9S A;  4C4V A;  3A9J A;  4AQ7 A;  3ZDT A;  4YSY B;  3TMP B;  1SE2 A;  2AYO B;  1D3Z A;  1E8W A;  3VUW A;  1K52 A;  4IW0 A;  4WIP A;  2KT7 A;  2LUE A;  4PS8 A;  2N7J A;  3VH3 B;  1JW9 D;  1T6B X;  1Q0W B;  2NBV B;  4NAM A;  1VR9 A;  5IA7 A;  4AS1 A;  1R4N B;  3EUB 2;  2W82 A;  5C3J B;  4P1C C;  1P3Q U;  2FNJ B;  2RDB C;  4NJC A;  2LVP A;  3PV1 A;  2WU5 B;  4EE2 A;  3N9Y C;  4FHK A;  3ETR A;  2KJH B;  3UIP B;  3IBE A;  1S3S G;  1JWS D;  1VZ7 A;  4R3D A;  2N7E A;  4C7Z A;  4WWN A;  2N9X A;  2HE7 A;  1TS2 A;  1D6E C;  3AUL A;  2NBW B;  2ZCB A;  4BKG A;  3BZD B;  3V05 A;  3DBR I;  3TJP A;  2XBB C;  5HI1 A;  2MJE A;  1I7H A;  4W9L A;  3I57 A;  2D3A A;  2WLB A;  1YQB A;  4NZL B;  5MPO A;  4W9I A;  3DWG C;  3HRD D;  1DOI A;  3L17 A;  1RFK A;  4P7I A;  2GBN A;  3A4S C;  2YVC A;  3RI7 C;  3B08 A;  4HVB A;  4EZJ A;  3AN1 A;  4KSK C;  4FA6 A;  1XLP A;  3W2D A;  1JWB D;  1LQB A;  3N1Z C;  4LNI A;  4K7W A;  4DQO C;  2HD5 B;  1ZDX A;  3QWZ B;  4MSM B;  2JSV X;  4JL9 A;  4LDT D;  4WJO A;  3PRP B;  2Z0E B;  2IO2 B;  4IOI E;  5AZG A;  4FLH A;  3PO0 A;  2JX5 A;  1LO5 D;  3V3X A;  4HJK A;  1WGK A;  3S2A A;  3ZXV A;  3PRZ A;  2LVQ A;  1J7C A;  1UNS A;  3M63 B;  4NY0 A;  3ZNG C;  2ZVN A;  3M62 B;  1TKG A;  1SF0 A;  3L0W B;  2K8C A;  2DZM A;  3WAL A;  3FC4 A;  4L23 A;  4ZHP A;  1WXM A;  4CO7 A;  1YN4 A;  2K9X A;  4A9A A;  1IGD A;  3UGB B;  5EE9 A;  1V6E A;  4M0W A;  3AU4 A;  1OQR A;  2Y5P A;  4I6P A;  3VVW B;  2NR2 A;  3BK2 A;  4RH6 A;  2PVO D;  4WAF A;  2VRR B;  4YSZ B;  2RGF A;  4NNJ B;  4F1S A;  1A5R A;  1ZP0 B;  2C7M B;  3JSV A;  1DOY A;  2OED A;  3U2S C;  4OZC A;  2BS2 B;  1ZXI A;  3H6N A;  3BYT B;  1DGJ A;  2DNF A;  1JRP A;  3HVD A;  3VHT C;  3ZW3 A;  4NPN A;  4P1B C;  4AOF A;  2MEK A;  2SAK A;  4JX1 C;  2WXI A;  3PTF C;  3MJW A;  3VXW A;  2JU6 X;  4DXA B;  1UF0 A;  4MGY E;  3ZJU A;  1WX7 A;  3ZXR A;  2L8J A;  2I1K A;  3WAM A;  5D7G A;  3DOW A;  5T8I A;  4MJS B;  1FNV A;  1JWU D;  1N63 A;  2FIF A;  4LNO A;  2JQR B;  4A20 A;  1TS5 A;  3V6E B;  3I3T B;  2AL6 A;  1Z2M A;  3Q14 C;  5DPS A;  5E6J A;  1J19 A;  1L0X B;  5H92 C;  2BS3 B;  2LI5 A;  1KH0 A;  1WXS A;  1TIF A;  4K81 A;  3L4P A;  1JRO A;  2Z8L A;  4EFO A;  2Q5W D;  3AE5 B;  3V60 A;  4PK1 A;  4MGZ E;  1J7A A;  4NAW B;  2XNA C;  3ZGZ A;  1HEZ E;  3DDC B;  2MBE A;  3ML9 A;  4NQK E;  2AL3 A;  5E6O A;  3R2T A;  1H4R A;  3AEG B;  1YJI A;  4UDU C;  2QMT A;  3DBR B;  1V9J A;  1ZE3 D;  1B1Z A;  5AZF A;  2ZNV C;  4RM9 A;  4W9C A;  3AM9 A;  1FEH A;  5D3I B;  3DVG X;  3Q8C A;  1IP9 A;  1UUP A;  3SU8 X;  3NVY A;  5FR6 A;  4BKT A;  2KN4 A;  5D6J B;  2O6V B;  3JVZ X;  3W1S A;  2I2Y A;  1AW7 A;  3PZ7 A;  4D2K A;  1UBQ A;  5TSS A;  3VUY A;  1ENF A;  1WE7 A;  3VR8 B;  1ESF A;  3SHQ A;  4WWO A;  2VZK D;  4A55 A;  3APF A;  5D2M B;  3EA6 A;  5IKC M;  2HTH A;  1VCB A;  1HA5 A;  1NBF C;  3Q69 A;  1N5W A;  2JVC A;  2IND C;  4AP4 C;  2KDM A;  3R3M A;  2JWZ A;  4ZRQ A;  3RNA C;  3APD A;  1V5O A;  3MP9 A;  1NI2 A;  3ZTD A;  2L32 A;  3PZ8 A;  3BWU D;  3U7Z A;  1OEY A;  1MI0 A;  4ANV A;  3NVV A;  3APC A;  2V1Y A;  1YN3 A;  3DBL I;  1EF5 A;  4DBG A;  1IGC A;  1C3T A;  2BQQ A;  3RMK C;  5BYQ A;  2K6Q A;  1VLB A;  5C1Z A;  4I6L B;  2L00 B;  1WRD B;  2QSD A;  5BO4 B;  4ARI A;  1E10 A;  3PZD A;  4KSL C;  1XQQ A;  1F0Z A;  1HE8 A;  3ZTC A;  5DCN A;  2DZK A;  4C4V B;  3VAW A;  3HM6 X;  2KWD A;  1WH3 A;  1F2R C;  2INN E;  3LJ3 A;  3NZ3 A;  4S0R A;  2KQ7 A;  2J7Q B;  2KK8 A;  1QT9 A;  2PE9 A;  1C76 A;  4MGI E;  3NG0 A;  4DDG D;  2LXC A;  1XT9 B;  3SD5 A;  1LGR A;  1FXT B;  1SJH D;  2LGX A;  3Q3O C;  1CZP A;  2FCN A;  2LGS A;  2NVU I;  1VZ6 A;  1WXA A;  4ACF A;  3TEX A;  5E6P A;  1ZXH A;  3Q3J A;  1YMH E;  4W9K A;  2BS4 B;  2BYF A;  2QEJ C;  3NVW A;  4IG7 B;  1V1P B;  2N1V A;  1OQY A;  2BYV E;  4A3O A;  2MCN B;  2ACZ B;  1P0R A;  2PLP A;  3AE1 B;  3OLM D;  1R7S A;  1C1Y B;  1I4G A;  2DZI A;  4URK A;  3GB1 A;  5DPW A;  3EFC A;  1K50 A;  1FXA A;  1QZE A;  4DWF A;  1J0G A;  2WXR A;  3W5U B;  2M56 B;  2NTS A;  4PYU A;  1WX9 A;  2PIA A;  5IN7 A;  2KD0 A;  3TUO A;  1PUT A;  2IZV B;  3VTV A;  2M19 A;  3RNF C;  3QX1 A;  2N9P C;  2GOW A;  3BK1 A;  4K3C A;  4JLC A;  3RT3 B;  1LM8 B;  4C7Y A;  3VFK A;  3IVF A;  2K0P A;  4K7S A;  2PKO A;  3NS1 A;  4MEL A;  2DBY A;  1YJJ A;  3IT4 B;  1JML A;  2K1F A;  4G0N B;  2D07 B;  3AEF B;  4LTU A;  4A90 A;  1XEE A;  3A33 B;  2KC2 A;  1CQV A;  5GXG B;  3DVN U;  3H1U A;  1VDV A;  2V3N A;  4GDK A;  2PJH A;  3PRE A;  2WU2 B;  4M8N A;  4WJN A;  4RCO A;  1I4P A;  3EGR A;  2LJ5 A;  2BTE A;  3UQB A;  1K53 A;  2C7H A;  2FE8 A;  3KYD D;  4WJP A;  2MLB A;  4KV2 A;  3T8M A;  2KHW B;  1AN8 A;  3KVF B;  3ZNZ B;  2WXO A;  4EEW A;  2HTM E;  1E7U A;  1F52 A;  3L13 A;  1FIQ A;  5KHQ A;  2ZW0 A;  2AQ2 B;  3L08 A;  1B9R A;  5HFY A;  3UIO B;  2I1J A;  3L54 A;  1MJD A;  4KKI A;  1TTN A;  3DBL B;  3RNE C;  4GOC A;  3VRA B;  2KC1 A;  2R2O A;  5DPT A;  4M0W B;  2CS4 A;  2ICI A;  4MEM A;  4AJW A;  3OAW A;  1EU3 A;  4LNN A;  5IAA C;  2ZPY A;  1ZW7 A;  2JRI B;  2D3C A;  2ONQ A;  1WGY A;  2KMA A;  2KZR A;  4XDD A;  2KTF A;  1VD2 A;  1RM6 C;  4ZRI A;  1N60 A;  2N9K A;  2KVZ A;  1ACC A;  2KJ6 A;  2K39 A;  1HQR D;  2BB6 A;  3K9P B;  1UH6 A;  4HCN B;  3RPF C;  2JYT A;  3ZJV A;  2MQJ A;  1S1Q B;  4WWM A;  4LLG M;  2EMS A;  2BT6 A;  1P1A A;  4GLS C;  2V4L A;  4BKS D;  2IO0 B;  4N59 A;  4O1N A;  1BML C;  5JZE B;  1IYF A;  4BBN C;  2WP9 B;  4NQL B;  3D32 A;  1L4Z B;  3AI5 A;  5I4D A;  2RD0 A;  1N62 A;  2LWP A;  3DHG C;  1I42 A;  2NMQ A;  1Z5S B;  4GSW A;  4USA A;  3ZVV A;  3U52 E;  3NJT A;  1LXD A;  3QJZ A;  1EUV B;  4MSQ B;  1NI3 A;  3N1Y C;  2HDE A;  1GG3 A;  3EC8 A;  2J0K A;  3GS2 A;  2KAJ A;  3ECI A;  4ANX A;  1JCK B;  2KKC A;  3R7Q A;  1FCC C;  3N20 C;  3DQV A;  4ICV A;  4FHJ A;  5L83 A;  3DBH B;  3I63 C;  2EKI A;  1TS4 A;  1ROE A;  2V0G A;  1V1P A;  5CHF A;  1PFD A;  2BGF A;  5BMH A;  1EU4 A;  4MGK E;  4HDO A;  5H8Y E;  1WM3 A;  2Z0D B;  4GMV A;  2DAF A;  4B95 A;  1F1H A;  3IT6 B;  4JWS C;  4KGR A;  3TEZ A;  1T0Y A;  4LNF A;  4N58 A;  1XCQ L;  2RMM A;  2D2Q A;  2KVR A;  1G6J A;  3NVZ A;  2DYM A;  3PT2 B;  2O6V D;  4KIK B;  3Q3F A;  3BVM A;  1XLN A;  4ICU A;  3OG5 A;  2G4S A;  2MBO A;  3Q8A A;  1WYG A;  1NEN B;  5LXI B;  3P4S B;  4DXG A;  2HJ8 A;  3LDZ E;  1QOF A;  5AEK B;  3K9O B;  2NPT A;  4HKQ A;  1UZX B;  3UF8 A;  1KM7 A;  4RNA A;  3R7R A;  1DOX A;  2KDB A;  4FXC A;  1WXQ A;  4ZOH C;  4GB9 A;  4WQO B;  2WXL A;  3T9L A;  4HRO A;  3AE9 B;  3H7P B;  2PVG C;  4KKJ A;  1SE4 A;  1KJT A;  4K1R B;  4TQ0 A;  4IWP A;  4II2 B;  1MHH E;  1QIL A;  2KFK B;  3PRM B;  1I4Q A;  2IPK D;  3J9C A;  1RAX A;  2WDQ B;  5D94 A;  2J42 A;  2L52 A;  3PLV A;  4IKG A;  3ML8 A;  2BKR B;  1J8C A;  2JT4 B;  1HZ5 A;  1NEK B;  4KGT A;  1QOA A;  4HRS A;  5FK9 C;  4DXF A;  5G5H A;  1YD8 U;  4W9H A;  4HK2 A;  4ZYN A;  3ZDM C;  2ZPN A;  4EZL A;  2JF5 A;  2JY6 A;  4WH4 A;  2NBU A;  2B3A A;  2B76 B;  3ZQ4 A;  1Q5W B;  3RCZ A;  3AEB B;  4S17 A;  2FBW B;  4RGM A;  3RNG C;  3R2I A;  1WGD A;  2AQ1 B;  3W5V B;  1SJE D;  2SEB D;  1HXY D;  1YX5 B;  2WDV B;  5JH5 C;  3R66 C;  2KMC A;  3X0W A;  4HCP B;  2J4X A;  5CTR C;  4OW0 A;  2KMM A;  2W9N A;  1NYR A;  2XEW A;  4XWT A;  1SGH A;  3P2B A;  4XGA B;  3RD2 A;  1WMH B;  3RUI B;  4MDK E;  3P1M A;  5HG2 A;  3RNB C;  1I4R A;  4LJP B;  3EHV A;  2WXG A;  4YXD B;  4E74 A;  1WI0 A;  1WF9 A;  1STE A;  1WGG A;  4GIV A;  3MTN B;  2JZZ A;  3W1Y A;  2RDG A;  1P9D U;  3LB8 C;  2N9E B;  4A3P A;  3VTU A;  1WYW B;  5IO9 A;  1YQ3 B;  2Y5B B;  4AWJ A;  2N0S B;  1Q10 A;  1FFV A;  1GOZ A;  3MC9 A;  4EZK A;  2O2V A;  5JHB A;  3P4P B;  4JWU C;  3T3O A;  1ZKH A;  1CMX B;  2CHW A;  4OVV A;  2YEP F;  3CST A;  1V8C A;  1TZ1 A;  3HM3 A;  1KOT A;  2JZ3 B;  5J18 A;  2MSE D;  3B0A A;  3HVZ A;  2DEN B;  3ABV B;  4GDK B;  1XLQ A;  1E6E B;  4OVU A;  2MH7 A;  2C5L C;  1E8Y A;  1WZ0 A;  3O13 A;  2JZP A;  1XXG A;  1FRD A;  1WJN A;  2WWZ A;  2DYO A;  1OQQ A;  1D5X C;  3AE4 B;  3IAM 1;  2W54 A;  3DPD A;  1ZUD 2;  3DHI C;  3NUH B;  2GB1 A;  2G1E A;  1Y56 A;  4W9E A;  3VQI A;  4H2A A;  2IGG A;  4FUL A;  3HK0 A;  1E5W A;  2CJN A;  4NJ7 A;  2W3S A;  1WGH A;  4DHJ D;  4KIK A;  3KUD B;  5G5G A;  3QAQ A;  4BBN F;  3RZF A;  2KLC A;  4W9D A;  1WY8 A;  2C7N B;  2MWS B;  1C79 A;  3P63 A;  3MFG A;  1KFY B;  2KQS A;  1RYJ A;  2XN9 C;  4F8C B;  3C19 A;  3SFE B;  4ANU A;  3WA0 A;  2RPQ A;  3P4Q B;  2ZNV B;  2GMI C;  3BVG A;  4MT5 A;  2G45 B;  5CHV C;  3I9V 1;  3H7P A;  4JGH B;  4FJV B;  1VZ8 A;  2RDH A;  3V62 A;  1PYW D;  2KFK A;  1TBE A;  1L0V B;  2GBM A;  3SR6 A;  2D3B A;  1T0R C;  3RFZ B;  1V5T A;  2KWC A;  4RF1 A;  3QCA A;  4ZRP A;  4C00 A;  1L5P A;  2LHE A;  3CIR B;  4MM3 B;  3M3J A;  1QQR A;  3KW5 B;  4ZDV A;  1D5Z C;  3GP7 A;  1TT5 B;  4DK5 A;  1WRI A;  2NCN A;  3E56 A;  1Y8R C;  3SFD B;  2WXF A;  3RNC C;  3VRB B;  4CHK A;  4M8M A;  2M1M A;  1FPY A;  4GDL B;  3DVN V;  1WJ6 A;  2G4D B;  4BOS C;  1V81 A;  3OJ3 A;  2LRW A;  1V86 A;  5EE1 A;  3SDL C;  4REZ A;  3TBL D;  3MHS D;  5E6N A;  4FAD A;  2L1A A;  2L05 A;  1K51 A;  3ZUN A;  4M00 A;  2N7D A;  4XX5 A;  3RYT A;  2L7R A;  1WMH A;  2WX1 A;  4B0M A;  1MG8 A;  2OJW A;  2R2Q A;  2KN5 A;  2D11 A;  3MC0 B;  3N1X C;  3PLU A;  4CYE A;  1IUE A;  2DHZ A;  3CWI A;  4QAY A;  2YLM A;  2BKF A;  2OHF A;  1ET9 A;  3AB5 A;  2BB5 A;  2H89 B;  2JWU A;  1FMA D;  4AJY B;  5AZH A;  1WWT A;  2FUH B;  2INP E;  3DBH I;  3V6C B;  4PT5 A;  3BY4 B;  5C23 A;  5HHD G;  1ZGU B;  5J17 A;  2KFJ A;  3BIN A;  5LNK 1;  3TCA A;  2JXT A;  1GUA B;  4RGT A;  1XF5 L;  4KVG B;  1KLG D;  2WXJ A;  5EE3 A;  2WXP A;  2NPT B;  2KXJ A;  2WDT B;  3A1Q A;  4KDI C;  3Q6B A;  4WAA A;  2MX2 A;  5BYS A;  3BII D;  2GBJ A;  2CR5 A;  2REX A;  2ZW1 A;  2FCS A;  2G3Q B;  3H8H A;  3N32 A;  1GJZ A;  2QCZ A;  3AU5 A;  2CU1 A;  4YWG G;  3ZKJ C;  5IOI A;  3VH4 B;  4XZ4 A;  4RGO S;  3KWV A;  1YJ1 A;  1WR1 A;  4OHJ A;  4BFR A;  1TKE A;  2RSU A;  1FCL A;  1GNU A;  3W9C B;  1IPG A;  1CK1 A;  5JXV A;  1JWM D;  1E0Z A;  2R61 A;  3VTW A;  4TMA B;  3O65 B;  4BAX A;  3AE7 B;  1WJ4 A;  4A8X C;  4C56 C;  4ZRJ A;  4RFB A;  3VR9 B;  1T0S C;  4LK0 M;  2JYE A;  1L4D B;  1L2N A;  4BVU C;  3DCG A;  3TL5 A;  1HTQ A;  1WR6 E;  4GU2 A;  5AUI A;  1X1M A;  1QKZ A;  3EFU A;  4W9J A;  4OVZ A;  1IBX A;  1FD6 A;  3WAP A;  1UWX A;  2X38 A;  2KAN A;  3L16 A;  2FCM A;  5FR3 A;  4RMA A;  4LCD E;  1TZO A;  4ASW C;  4L1B A;  2KQ4 X;  3C8Y A;  1V80 A;  5J2R A;  1L6V A;  2CU3 A;  1FFU A;  3GZN I;  2KWV B;  4K7U A;  1YQ4 B;  1WZ3 A;  3P4R B;  1M94 A;  2BYT A;  2ON8 A;  4RM8 A;  3AEE B;  4KGS A;  1K8R B;  1L0Y B;  2KDF B;  4I6N B;  2KYW A;  1GB4 A;  2KTR B;  4WUR A;  4ITK A;  2PMV A;  3QA8 A;  1QLB B;  2WX0 A;  3PGE A;  1D4B A;  4OZA A;  2OOB B;  4XC2 A;  4YTP B;  1MPE A;  2K3U A;  1F9J A;  2MP2 B;  1JWA D;  5EDS A;  1BT0 A;  2PPH A;  1C77 A;  4MM3 A;  4PS3 A;  5KHO A;  3SEB A;  1NVI D;  5HKH A;  1TYG B;  4ZYS A;  2GRI A;  3JW0 X;  2WXM A;  3AE6 B;  3KH0 A;  2V3S A;  2O2V B;  2IO1 B;  3AEA B;  3W1S C;  3OWE B;  1WGR A;  4GDL A;  3UIN B;  3CMM B;  2H88 B;  2G9H D;  2WGS A;  1HZ6 A;  1T0Q C;  3GE8 C;  5EE0 A;  3KQ4 A;  5FKA C;  2K22 A;  1WX8 A;  4N9F 4;  2Z59 B;  4CQN A;  3PHX B;  2IYD B;  2D5G A;  3Q8F A;  2DX5 B;  2LGI A;  5CHW A;  5LLI A;  2BPS A;  4IM3 A;  1EF1 A;  3NZS A;  4WJQ A;  2EMT A;  2Y3A A;  2FCQ A;  1C78 A;  2OJR A;  2WS3 B;  4US8 A;  3V61 A;  2MHJ A;  4G3X B;  4FBJ B;  4HPL B;  2IY0 B;  4HPP A;  1KRH A;  4HJG E;  3KLS X;  3HIZ A;  4FN2 A;  4B9K A;  3AE8 B;  2EEL A;  2QIL A;  1ET6 A;  1FNW A;  2KDI A;  2ZJD A;  3NZU A;  1JAL A;  4YSX B;  4HXD A;  4WQM A;  2WNM A;  3DBS A;  4GN1 A;  3A9K B;  4YT0 B;  1AWD A;  4HWI B;  3AE3 B;  2C60 A;  4TSS A;  4XDC A;  4TKN A;  2RR9 A;  3FKY A;  4HLE A;  2DLB A;  5L95 C;  1TY2 A;  2VH1 A;  1J7B A;  2RPV A;  2WXK A;  3RUL A;  3WCQ A;  4C80 A;  1E8Z A;  3DWM A;  4JPS A;  3KUZ A;  4ANW A;  1RWS A;  3ZNH B;  4DDI D;  1TKY A;  3QAR A;  4YL8 A;  1MG4 A;  1MHX A;  2M0A A;  2V9H A;  4HDQ A;  3GE3 C;  1TY0 A;  3URY A;  4MH8 A;  4IWQ A;  2XK5 A;  2DZJ A;  2ZVO A;  2L3Z A;  1SE3 A;  2LGD A;  3ZRC A;  4XE0 A;  3I5J C;  1UEL A;  3U4E G;  4AUQ C;  2CKH B;  1C4P A;  2K8H A;  4IM2 A;  1E7V A;  3UQA A;  3ZJT A;  2Y5C A;  1AYF A;  2HJ1 A;  3GZN B;  1FO4 A;  2QHO A;  3CSF A;  3ZLZ A;  4IC7 B;  1E90 A;  1EO6 A;  1ZPS A;  1YOV B;  2D3G A;  1ZOY B;  1WXV A;  2IJ0 A;  5G2N A;  3Q3M C;  5AUK A;  4L2Y A;  1BXT A;  1PGA A;  2AEH A;  2AQ3 B;  2E6X A;  2PEA A;  1OFF A;  4EKU A;  2MW5 A;  2PTL A;  2E3T A;  1ISN A;  1SIF A;  1FM0 D;  2DYB A;  1SIJ A;  2MBQ A;  3IAS 1;  4K3B A;  3Q8E A;  2NS5 A;  2JPH A;  4IUM B;  1YN5 A;  1RLF A;  3KUC B;  4RF0 A;  2LD9 A;  4EUT A;  2GLS A;  3HUI A;  1E9M A;  3RN9 C;  5GMV A;  2KTR A;  2M4N A;  1RFA A;  1TGZ B;  3NRZ A;  4XWW A;  4PYZ A;  1NYQ A;  4JE3 B;  4JIO U;  1CJE A;  3GOE A;  2VH2 A;  2MP2 A;  2WXH A;  3TEY A;  3U8Z A;  1HTO A;  4XYC A;  3QHT A;  1R4M I;  1SB3 C;  4HKZ E;  4EOY A;  4JQW C;  3QC8 B;  5TR5 A;  2M17 A;  4A6Q A;  4E71 A;  1VJK A;  4GXB A;  4N6E B;  5JHA A;  4WWP A;  3A1Q B;  1N61 A;  2X8X X;  4G50 A;  1V2Y A;  1E8X A;  3AE2 B;  1F2R I;  4TUU A;  2BW2 A;  4B0E A;  3FIL A;  3IHP C;  1TJE A;  1C4C A;  1PGX A;  3QQ8 B;  2IBI B;  5BYR A;  4HEA 1;  1H8C A;  3EEC A;  3AH7 A;  3B2F A;  1GC6 A;  4M01 A;  1QOB A;  2I38 A;  2UWQ A;  3WAN A;  3T3N A;  2A4Z A;  2FID A;  3B2G A;  2V4I B;  2M0X A;  2LGY A;  2K6D B;  1U4A A;  1P7F A;  2AX5 A;  2KWU B;  2L0F A;  1F77 A;  4ZRK A;  1YX6 B;  1UD7 A;  2K8B A;  5DPR A;  4BOZ B;  4LNK A;  4GGQ A;  2PW9 A;  5IP4 D;  2UU7 A;  3LYY A;  1WJU A;  2LZ6 A;  3VDZ A;  1IBX B;  1MVK A;  1E7P B;  3A9K A;  1FRR A;  4IM0 A;  4II3 B;  4FJZ A;  1I35 A;  1KLU D;  3ENE A;  1KTK A;  3CF6 E;  3X23 A;  2BWE S;  1C4A A;  3B1L X;  4W9F A;  3ONS A;  5C2T B;  3HHM A;  2QDF A;  4W9G A;  2KJR A;  1ZDV A;  4TV3 A;  2DWQ A;  3NS8 A;  1WE6 A;  1OTR B;  5G55 A;  2AWT A;  3TIX A;  2D10 A;  2DAJ A;  4KZ0 A;  1WFY A;  4M02 A;  3JYU A;  2GBK A;  4LJO B;  2WQY B;  1PGB A;  2BBC A;  4LDT B;  1SEB D;  1EWC A;  3H7S A;  3M95 A;  3IG3 A;  1WIA A;  2LRU A;  3PVL A;  2C9W B;  3ZYY X;  2W55 A;  3LXF A;  4Q2J A;  2NTT A;  3PPA A;  3WIM A;  1XO3 A;  1N6Z A;  2INC C;  1QF6 A;  2BF8 B;  3AMZ A;  2K5P A;  1JQ4 A;  1TS3 A;  4KZC A;  3VUX A;  2KNB A;  3NY5 A;  1WSP A;  1SE9 A;  1UGJ A;  3Q2A C;  3IXS A;  1SBB B;  2QJL A;  1SSN A;  4OZB A;  4MAC A;  3BVZ A;  2WYQ A;  3A4R A;  2N4F A;  4ARC A;  1OEY J;  2LXA A;  2KDE B;  3A9J B;  1DYQ A;  1EM7 A;  1T5X D;  3PSE B;  2MRP A;  1QOG A;  2KAC A; 
#chains in the Genus database with same CATH homology
 1JRO A;  1QOF A;  2Z8L A;  2Q5W D;  3AE5 B;  1YQ4 B;  2IGD A;  3P4R B;  1EWY C;  2BYT A;  4HKQ A;  1J7A A;  4NAW B;  2ON8 A;  2XNA C;  3ZGZ A;  3AEE B;  1HEZ E;  4KGS A;  4YTM B;  4RNA A;  1L6U A;  1L0Y B;  1DOX A;  4FXC A;  1WXQ A;  3P42 A;  4ZOH C;  2WXL A;  3R2T A;  2W3R A;  4HRO A;  1GB4 A;  3AEG B;  1YJI A;  4UDU C;  1C9F A;  5D3D A;  3AE9 B;  2PVG C;  4KKJ A;  1SE4 A;  2QMT A;  4TQ0 A;  1ZE3 D;  3R8B A;  1B1Z A;  4TQ1 A;  4WUR A;  4ITK A;  1MHH E;  2QIE B;  2PMV A;  1QIL A;  1QLB B;  1D4B A;  1I4Q A;  4OZA A;  1V1O A;  2IPK D;  1P7E A;  4YTP B;  1MPE A;  2K3U A;  3J9C A;  4YTN B;  2WDQ B;  1FEH A;  3AM9 A;  5D3I B;  3Q8C A;  2IDY A;  2J42 A;  1JWA D;  1UUP A;  2L52 A;  3NVY A;  4IKG A;  2KN4 A;  3W1S A;  2I2Y A;  1AW7 A;  1HZ5 A;  3PZ7 A;  1NEK B;  3SEB A;  4KGT A;  1C77 A;  1QOA A;  3KWL A;  5TSS A;  4D2K A;  4HRS A;  1NVI D;  1ENF A;  5FK9 C;  4DXF A;  3B9J A;  1TYG B;  5G5H A;  3VR8 B;  4ZYS A;  2GRI A;  2MJ3 A;  1ESF A;  2WXM A;  3AE6 B;  2VZK D;  4WH4 A;  4A55 A;  2B76 B;  3ZQ4 A;  3AEA B;  3AV8 A;  3AEB B;  3OWE B;  3EA6 A;  2FBW B;  4RGM A;  3R2I A;  2H88 B;  2G9H D;  1HA5 A;  1HZ6 A;  2AQ1 B;  3W5V B;  1SJE D;  1N5W A;  2SEB D;  2L83 A;  3Q69 A;  5EE0 A;  1HXY D;  3KQ4 A;  2KDM A;  5FKA C;  4ZRQ A;  2WDV B;  2K22 A;  1T3Q A;  2TSS A;  4CQN A;  3MP9 A;  2D5G A;  2J4X A;  3Q8F A;  2L32 A;  3PZ8 A;  1BUI C;  3BWU D;  2LGI A;  3U7Z A;  1MI0 A;  2V3P A;  4OW0 A;  1N5X A;  2KMM A;  3MHZ A;  1NYR A;  2GI9 A;  3NVV A;  4XWT A;  1FNU A;  1GAQ B;  2Y3A A;  3TSS A;  1C78 A;  2WS3 B;  1YN3 A;  4US8 A;  1D5M C;  2LHD A;  2LFI A;  4RGN A;  3P1M A;  1IGC A;  2CJO A;  1KF6 B;  1I4X A;  5HG2 A;  4IDI A;  1KRH A;  4HJG E;  3KLS X;  1I4R A;  5BYQ A;  1VLB A;  2WXG A;  3AE8 B;  3BYY B;  2EEL A;  4YXD B;  2J52 A;  2QIL A;  1ET6 A;  2QSD A;  1STE A;  1FNW A;  4ZHO A;  2WXQ A;  4ARI A;  1E10 A;  1JAL A;  4YSX B;  2VZK B;  2RDG A;  4WQM A;  2LJI A;  2WNM A;  1F0Z A;  3LB8 C;  4YT0 B;  1AWD A;  3AED B;  3Q8B A;  3AE3 B;  4TSS A;  5BMG A;  4XDC A;  2IGH A;  2FUG 1;  1YQ3 B;  2N0S B;  1Q10 A;  1FFV A;  1GOZ A;  3FAH A;  1VRA B;  2KWD A;  2DLB A;  1TY2 A;  1F2R C;  2MJD A;  2INN E;  1J7B A;  3NZ3 A;  3P4P B;  2RPV A;  2WXK A;  3MJ5 A;  1GB1 A;  3WCQ A;  3TEW A;  4C80 A;  1QT9 A;  1C76 A;  4JWU C;  3T3O A;  3DWM A;  4JPS A;  1RWS A;  4KX6 B;  1TKY A;  2YEP F;  1YNT E;  1V8C A;  1MHX A;  1V97 A;  1GPX A;  2N9L A;  2M0A A;  1A70 A;  1I4H A;  3HVZ A;  3ABV B;  1TY0 A;  3URY A;  4MH8 A;  1SJH D;  4GDK B;  1XLQ A;  4J3O D;  1CZP A;  1E6E B;  4US9 A;  2MH7 A;  1VZ6 A;  3TEX A;  5BMI A;  1XCT L;  1ZXH A;  1SE3 A;  1YMH E;  3O13 A;  2JZP A;  2BS4 B;  3UI3 A;  1XXG A;  3NVW A;  1FRD A;  2QEJ C;  4XE0 A;  1V1P B;  2DYO A;  2LEK A;  1OQQ A;  3U4E G;  2ACZ B;  1D5X C;  2PLP A;  3AE1 B;  3AE4 B;  3IAM 1;  1C4P A;  1R7S A;  2W54 A;  3ZJT A;  1ZUD 2;  2Y5C A;  1I4G A;  1AYF A;  3NUH B;  2GB1 A;  2LMC A;  1PDX A;  1FO4 A;  1FXI A;  3GB1 A;  2G1E A;  1K50 A;  1Y56 A;  1FXA A;  1XLO A;  2YEP B;  3VQI A;  4P6V F;  4H2A A;  1UWM A;  2IGG A;  1M4V A;  2WXR A;  3W5U B;  2M56 B;  1ZPS A;  2NTS A;  2CJN A;  2LUM A;  2WDR B;  2PIA A;  2W3S A;  1ZOY B;  3TUO A;  2IJ0 A;  2J53 A;  1PUT A;  5G5G A;  3AEC B;  5AUK A;  2M19 A;  4L2Y A;  1BXT A;  2WXN A;  1SXT A;  3FIL B;  4P16 A;  3E9S A;  1PGA A;  1C79 A;  3P63 A;  2AQ3 B;  3BK1 A;  4AQ7 A;  2E6X A;  3MFG A;  1KFY B;  4YSY B;  1OFF A;  4C7Y A;  1SE2 A;  1RYJ A;  2XN9 C;  2K0P A;  2PTL A;  2E3T A;  2PKO A;  3NS1 A;  1K52 A;  2DBY A;  3SFE B;  1FM0 D;  1YJJ A;  1SIJ A;  3IT4 B;  4WIP A;  3IAS 1;  1JML A;  3Q8E A;  1YN5 A;  3AEF B;  4LTU A;  4A90 A;  2N7J A;  1JW9 D;  1XEE A;  1T6B X;  3P4Q B;  4RF0 A;  3BVG A;  1CQV A;  4MT5 A;  4NAM A;  5GXG B;  1VR9 A;  1VDV A;  3HUI A;  4AS1 A;  2V3N A;  1E9M A;  3I9V 1;  3EUB 2;  2W82 A;  5C3J B;  2WU2 B;  4RCO A;  1VZ8 A;  2RDH A;  1PYW D;  4NJC A;  1I4P A;  3EGR A;  2BTE A;  1K53 A;  2WU5 B;  2FE8 A;  3NRZ A;  4EE2 A;  3N9Y C;  4XWW A;  1L0V B;  1NYQ A;  3SR6 A;  4JE3 B;  1CJE A;  3RFZ B;  3ETR A;  1AN8 A;  1JWS D;  4RF1 A;  2WXH A;  3TEY A;  1VZ7 A;  4R3D A;  2WXO A;  4ZRP A;  4C7Z A;  2HTM E;  1L5P A;  1TS2 A;  2LHE A;  3CIR B;  4MM3 B;  1FIQ A;  1QQR A;  1D6E C;  2ZW0 A;  2AQ2 B;  1B9R A;  5HFY A;  1D5Z C;  3BZD B;  3GP7 A;  3V05 A;  1SB3 C;  4HKZ E;  1WRI A;  3E56 A;  3SFD B;  2WXF A;  3VRB B;  4KKI A;  4A6Q A;  1VJK A;  4N6E B;  5HI1 A;  2MJE A;  1I7H A;  3VRA B;  3I57 A;  4GDL B;  1N61 A;  2WLB A;  2ICI A;  3AE2 B;  4NZL B;  5MPO A;  1EU3 A;  1F2R I;  3DWG C;  2BW2 A;  4B0E A;  3FIL A;  3HRD D;  1DOI A;  1RFK A;  5EE1 A;  1TJE A;  4REZ A;  1C4C A;  1PGX A;  2ONQ A;  5BYR A;  4HEA 1;  2L1A A;  4XDD A;  3AN1 A;  3AH7 A;  3B2F A;  1K51 A;  1XLP A;  1RM6 C;  3W2D A;  1JWB D;  1QOB A;  4DQO C;  2I38 A;  3T3N A;  1N60 A;  2N9K A;  1ZDX A;  1ACC A;  4B0M A;  3B2G A;  2JSV X;  1HQR D;  2BB6 A;  2V4I B;  3MC0 B;  4IOI E;  1IUE A;  1P7F A;  2AX5 A;  3CWI A;  3RPF C;  1F77 A;  2JYT A;  3ZJV A;  3PO0 A;  2JX5 A;  1LO5 D;  2OHF A;  1ET9 A;  4WWM A;  3V3X A;  3AB5 A;  4LLG M;  2BB5 A;  2H89 B;  2JWU A;  1FMA D;  1WGK A;  1WWT A;  2PW9 A;  3LYY A;  2INP E;  1IBX B;  2BT6 A;  1MVK A;  1E7P B;  1FRR A;  1J7C A;  1UNS A;  4GLS C;  4PT5 A;  4N59 A;  4O1N A;  1BML C;  5HHD G;  1TKG A;  2WP9 B;  1KLU D;  1SF0 A;  1KTK A;  3FC4 A;  1C4A A;  1L4Z B;  5LNK 1;  4L23 A;  4ZHP A;  5I4D A;  2JXT A;  1N62 A;  1YN4 A;  4RGT A;  1XF5 L;  5C2T B;  2NMQ A;  1ZDV A;  4USA A;  2K9X A;  1KLG D;  2DWQ A;  2WXJ A;  3U52 E;  5EE3 A;  4A9A A;  2WXP A;  1IGD A;  5BYS A;  1NI3 A;  5EE9 A;  3BII D;  4M0W A;  1OQR A;  2Y5P A;  2ZW1 A;  3BK2 A;  4RH6 A;  2PVO D;  3H8H A;  4WAF A;  2HDE A;  4YSZ B;  2WQY B;  1ZP0 B;  1PGB A;  2BBC A;  3GS2 A;  1DOY A;  2KAJ A;  2OED A;  4YWG G;  3U2S C;  4OZC A;  1SEB D;  1JCK B;  2BS2 B;  1EWC A;  4RGO S;  3KWV A;  1ZXI A;  3BYT B;  4OHJ A;  1DGJ A;  1FCC C;  1TKE A;  1JRP A;  1FCL A;  3HVD A;  3ZYY X;  3W9C B;  2W55 A;  1CK1 A;  5JXV A;  3LXF A;  1JWM D;  4Q2J A;  2NTT A;  1E0Z A;  2R61 A;  2EKI A;  4TMA B;  1XO3 A;  1TS4 A;  1ROE A;  2V0G A;  1V1P A;  1QF6 A;  1PFD A;  3AMZ A;  5BMH A;  3AE7 B;  2K5P A;  2MEK A;  2SAK A;  1JQ4 A;  4A8X C;  4JX1 C;  4C56 C;  4RFB A;  3VR9 B;  1EU4 A;  1TS3 A;  2WXI A;  4LK0 M;  2JU6 X;  1WSP A;  2JYE A;  5H8Y E;  1L4D B;  3ZJU A;  3IT6 B;  4JWS C;  1UGJ A;  4KGR A;  3TEZ A;  5D7G A;  4N58 A;  1XCQ L;  5T8I A;  2RMM A;  3IXS A;  1SBB B;  1FNV A;  2QJL A;  1SSN A;  1JWU D;  1N63 A;  1QKZ A;  4OZB A;  5AUI A;  4MAC A;  4OVZ A;  3NVZ A;  3BVZ A;  2DYM A;  1FD6 A;  1IBX A;  2JQR B;  1UWX A;  1TS5 A;  2X38 A;  3BVM A;  5FR3 A;  1XLN A;  4ARC A;  1TZO A;  4L1B A;  2KQ4 X;  3Q8A A;  3C8Y A;  5E6J A;  1WYG A;  1L0X B;  1NEN B;  5H92 C;  1DYQ A;  1EM7 A;  3P4S B;  2BS3 B;  1KH0 A;  1T5X D;  4DXG A;  1L6V A;  2CU3 A;  1QOG A;  1FFU A;  2KAC A;  3L4P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...