2ICIA

Crystal structure of streptococcal pyrogenic exotoxin i
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
227
structure length
227
Chain Sequence
YEMSSVGVINLRNMYSTYDPTEVKGKINEGPPFSGSLFYKNIPYGNSSIELKVEMNSVEKANFFSGKRVDIFTLEYSPPSNSNIKKNSYGGITLSDGNRIDKKNIPVNIFIDGVQQKYSYTDISTVSTDKKEVTIQELDVKSRYYLQKHFNIYGFGDVKDFGRSSRFQSGFEEGNIIFHLNSGERISYNMFDTGHGDRESMLKKYSDNKTAYSDQLHIDIYLVKFNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords Exotoxin I
publication title Crystal Structure of the Streptococcal Superantigen SpeI and Functional Role of a Novel Loop Domain in T Cell Activation by Group V Superantigens.
pubmed doi rcsb
source organism Streptococcus pyogenes
total genus 67
structure length 227
sequence length 227
ec nomenclature
pdb deposition date 2006-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2iciA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2iciA01
1RDPD 4OHJA 1D5XC 3R2IA 1S5FD 4RGTA 1UNSA 1LTSD 1PTOC 1LT5D 1F77A 1LO5D 4DXFA 1CK1A 3SEBA 1XXGA 1CHQD 1HTLD 1S5ED 4Z9CB 2IJ0A 2QILA 2G9HD 2QEJC 1EU3A 2SEBD 1JWMD 1M4VA 1KLUD 1I4QA 4RHRA 1PZJD 1G8ZD 1RF2D 1S5DD 1PTOB 3O13A 1PTOF 1DYQA 1PRTD 2AQ3B 2WV6D 4RHSA 5ELBA 5FKAC 5ELDA 3EFXD 1I4GA 1HA5A 1I4HA 1AW7A 1EEFD 1CHPD 1V1PB 1LTBD 2XNAC 1BCPC 1XTCD 1AN8A 2XRQD 1CT1D 1LTGD 1TS5A 1MD2D 4O1NA 1SBBB 2R61A 1HQRD 4RFBA 3DWPA 1ET9A 1JCKB 2IPKD 4RGOS 1BCPB 3BZDB 1FD7D 1JWUD 1KLGD 1I4XA 1FGBD 1PZID 1KTKA 1LTTD 1TS2A 4RGMA 1SEBD 1FNWA 3MFGA 3DWAA 4UDUC 3OWEB 1I4PA 1BXTA 1TS4A 1LT3D 4ZYSA 3DWQA 1ESFA 1PZKD 1SXTA 1PRTC 2ICIA 4DXGA 1JR0D 1LT4D 1DJRD 1L0YB 2XRSD 1ET6A 5D3IB 2RDGA 1I4RA 2RDHA 1S5BD 1CQVA 3URYA 3V05A 1BCPF 3R2TA 4RH6A 1EWCA 1ENFA 4C56C 1PRTB 1YN3A 1PRTF 1S5CD 1LLRD 2NTTA 3BYYB 3BVMA 1STEA 1B1ZA 3MC0B 3CHBD 4RCOA 1YN5A 1D5MC 1EFID 1T5XD 1PTOD 5ELFA 1LTAD 2TSSA 4BWGB 1FNVA 5TSSA 4L6TB 1L0XB 2AQ2B 1RD9D 1UUPA 3GP7A 1V1OA 4K6LA 4L63B 4TSSA 5ELCA 1TY2A 1JQYD 5FK9C 2NTSA 1FNUA 1PTOH 1D5ZC 1PYWD 1EEID 1SE2A 3BVGA 1TS3A 1LT6D 1SJHD 3BVZA 3W2DA 5I4DA 2O2LD 2XN9C 3TSSA 1HXYD 5D3DA 5ELEA 1D6EC 1QILA 1V1PA 4NZLB 1BCPD 1LTRD 1RCVD 1GOZA 3KLSX 4RGNA 2AQ1B 1JWSD 3EA6A 3R8BA 1SE3A 2Z8LA 1SE4A 2J4XA 1YN4A 1EU4A 2CHBD 1LTID 1TY0A 3BYTB 1B44D 1SJED
chains in the Genus database with same CATH superfamily
4US9A 4ANXA 1Z47A 5I6WA 2M0XA 1XMQQ 5EE1A 4BY7H 4FADA 5C44H 4L5SA 4MJSA 3NP8A 2Y5PA 2IY0B 1EYGA 1V81A 3VQIA 5M3MH 1CFMA 2E2JB 5G5HA 4WJNA 3X23A 4WQMA 1SSOA 2M56B 2XGTA 1S5ED 4I7ZC 5LMNL 1XPRA 2A6HD 2GRIA 4DV6L 4S0RA 3PZ8A 4HRSA 2G9HD 2QEJC 4LF8Q 2NVQH 2HHHQ 2VZKB 4CDDC 3ML9A 2W3RA 3EROA 3ER0A 2PZTA 4DDGD 1G6JA 4IFDG 1PFNA 3AE8B 4HDQA 4IM0A 2Q8RE 2GB1A 2F4IA 3EVQA 2A6HC 2JJQA 4HCSA 3WOEA 1JORA 4P74A 2KDIA 4F7ZA 3GTJH 1KLVA 4DR6L 1QOBA 2QC8A 1JWBD 2J7QB 1SYBA 4JBMA 4JV5Q 1SB3C 3VDYA 1I7HA 1V86A 4R4IA 1WMHB 2KAJA 1BO0A 1TIFA 3UQAA 1JQ4A 1I6VC 1GB1A 3D6CA 2R61A 5JJKA 4B3SL 1HQRD 1KJTA 4A3GH 1OTRB 3N1YC 2V0GA 3AE5B 4KI0A 1A15A 1HPCA 3S14H 4JWUC 4XGAB 3I55A 4BBNC 2DJFC 2FE8A 3AXCA 2EY5A 3PPAA 1R4MB 1UEAB 1K83B 4YSZB 1TWAH 4HJAA 3HOWB 4P71A 1MSHA 3K0YA 4FP5D 2UU7A 4IG7B 4MEMA 4UHVA 3U50C 4KLKA 4WJPA 2G5DA 4C00A 4JI3Q 3WAPA 2ZZPB 4M01A 4KKTA 2EYPA 4RWSC 5C3XA 4WJQA 1EY8A 3LJ3A 4P75A 3ZXVA 2Z0SA 4R4OA 4BKGA 2REXA 4W9HA 5EE0A 2D62A 4A55A 2O5IC 3L54A 1FYCA 3BDOA 3FILA 2B2WA 3ETRA 4A3BH 1Q82C 4PYUA 1PFMA 3KYDD 3DUZA 1UWMA 2MHJA 4C3HH 1MHWC 4YTNB 4WQOB 4KKJA 1WYDA 2WXIA 3V05A 5LXHA 1UELA 1SNDA 3M7NA 5D7GA 1O80A 1TWCB 4ZHOA 1KABA 2JT4B 2KX0A 1DD2A 1EQRA 2KTFA 1VCBA 1XPOA 5K36H 5IAAC 1VQ4A 5T1GA 2M17A 3PQIA 2KMMA 4B9KA 3TRZA 5I9PA 2O5JC 3MEFA 2E76C 2P5ZX 1TT2A 3D0FA 2CW0D 2WDTB 2B2WC 4FVMA 5KEEA 4NPNA 1NBFC 3I63C 4MACA 1N36L 3W1BA 2ZXOA 2LHDA 3V6CB 4ME5A 2ACZB 4DV0L 4PK1A 1X3FA 2KO3A 2K22A 1IW7C 2IO0B 1YI2A 3J81L 4GLSC 5C0XJ 4OXPA 1OXUA 1X3QA 5ELEA 3MEHA 1GKHA 3FILB 3KW5B 3R3MA 3EFCA 2MBEA 1E0BA 3R7RA 4ASWC 3TJPA 2R3ZA 5ELNA 3QWZB 1PH2A 3OMCA 4YWLA 3NVYA 3HRZC 2E2JH 1N32L 2XWBB 1F2RC 2Q2HA 2X8XX 3B2FA 4IDIA 1NUCA 1CKNA 2N78A 3U9SA 3NBIA 2R7ZH 1STYA 3CRLC 4N58A 3I72A 4W9GA 3NWSA 3F2BA 2DZIA 4I6NB 4QIWE 5A2QE 1WTPA 1JJGA 3AQQA 1ASZA 4DGZA 4A75A 2Y0SE 2VXWA 4HJ8A 1K73C 4PZ7A 3TMEA 4LJPB 2VS1A 3CC4A 4AWJA 4IC7B 4FDBA 4BBRG 5COYA 2H88B 3F2UA 2H5XA 2R2OA 1S40A 4ODGA 5T8IA 4AQ7A 1EWIA 1H9MA 4A3JH 1STGA 2WXLA 4GS3A 2D9UA 4A93H 3PUVA 3O13A 1PTOF 4XYOA 3AMUA 4K5XA 4ZRZA 5FR3A 5JHAA 3ZNID 1IZ6A 1CI3M 1QCBD 3Q24A 1XCQL 3D32A 3IAS1 4MH8A 3ZNGC 2FFKB 1QQRA 3AE4B 3NXWA 4EFOA 1BCPC 5EBDA 2K32A 3H7PB 2FXQA 2HIXA 1KM7A 2H89B 2EIFA 4LUOA 3S24A 1SIJA 3PO0A 4ULLA 5LMNQ 2MO1A 1T0YA 2NZOA 2JF5A 1HCZA 4X3TA 2CWAA 5F2DA 4DV6Q 2GLSA 2W3SA 1CKNB 4LK0M 4KY5A 1SIFA 3T1HL 1YD8U 1BCPB 3BZDB 2WB1E 2D3BA 1E1TA 2HIVA 2XBBC 2C9OA 2B2UA 1EF5A 2QCZA 5GMVA 4HLEA 4DR6Q 1HZCA 3T9LA 1L7YA 3QAQA 1YNXA 2HCIA 1M94A 3LYYA 4DUYL 1FNWA 3VTVA 2NS5A 4NW2A 1NMFA 3STBD 4G11A 1WD1A 3I73A 3RFZB 2KNBA 1KOTA 4TQ1A 4F87A 4B3SQ 3IXSA 3RI7C 3L2PA 1SXTA 1TWCH 3OAWA 3TN2A 2QDFA 2KOLA 2R92G 3HOZG 2OOBB 3NVZA 4GB9A 3HEJA 2RGFA 1SNQA 1KC8C 1N60A 4WAAA 3STBC 1NJIC 3V62A 3NENA 1Y1VG 4PZ8A 2K8HA 2QCPX 1PFSA 3F8TA 4NY0A 2IX0A 4EX5A 4HJ5A 3ABVB 4LF7L 3Q23A 4GLXA 2L1AA 3DBRB 4JBJA 3NS1A 4ZRQA 3HRDD 1VQAA 1OXTA 3PO3B 1Q12A 2HCCA 4OIJA 4KZ0A 4BA1I 3A7AB 3CHBD 1BOSA 4A3IG 2E2HB 5IGCA 4ZQ3A 2OWOA 3CCQA 1J7AA 2SAKA 3CMMB 4ARCA 1RJTA 2LXAA 2V3PA 4BY1G 3ZW3A 5EKLA 3DLLA 2ZJRA 4K6LA 2VUMB 4TV3A 1D1IA 1TY2A 1V9JA 3U4ZA 4IFDI 4XZ4A 2ZNVC 1E6EB 4KKUA 1FNUA 1SYCA 1E3PA 1L1OA 1TBEA 3R93A 4DK0A 2RHSB 1SSNA 2KYWA 4APVA 5KYLA 1B9MA 3HOXG 1JMCA 3A8KE 4QAYA 1EOVA 2LXCA 5D65A 1EUJA 2Y0SG 1DGJA 1WGGA 2KHWB 1RCVD 4KMUC 2ZCBA 3K5LA 3C46A 2ZNVB 4ZOHC 2BB5A 2B2YA 3J7YW 1PQSA 2C9WB 2OCEA 2WNMA 2EVBA 4OZAA 1NR2A 1N61A 4WH4A 1B2TA 4QCLA 1WRIA 2KQ7A 2RQXA 1N36Q 4ILWA 4TUUA 3U7ZA 2CHWA 3SK6A 2WXJA 3QJZA 3EJIA 3J81c 4O2DA 4FJYA 4DV0Q 2CH4W 1L1OC 3AEDB 4OVZA 1PH1A 1HTLD 4DHZB 4C1NI 4Z9CB 4YIJA 4CKBA 3BY4B 3FVQA 4DAYA 5HGQA 2QKIC 1D7QA 3CU7A 2Q8IB 1L1OB 2L32A 4IQZA 1H4RA 4JYAL 5ELDA 2KCMA 2G3QB 1JE5A 2WB1G 1I4GA 1CA5A 1BR9A 1WJJA 2F4VL 1K53A 4N9F4 3ZKJC 5H8YE 4LWCA 4H7BA 4YHHL 5JZEB 4DHJB 1RTOA 2V4LA 2DYOA 1W6KA 1FO4A 5C3WA 1OO9B 2CCZA 3AB9A 3PZDA 3CCMA 2WXNA 4I65A 1FFUA 1K50A 4GOPA 1NDDA 2Q2TA 2D3AA 2V3NA 3IAYA 1WX8A 3TEYA 1SE9A 1RLFA 3K9OB 4R4CA 1ROEA 3NTHA 1BBWA 1QE6A 3P20A 2DHZA 2KC2A 1WRDB 2JK8A 1IYJB 3NY5A 2F1MA 4NP5A 4CJ0B 4A3FG 4LUVA 1P7EA 1QOFA 1WFYA 2BYEA 4GLVB 1FXTB 4DAYB 4M8AA 4QF4A 3JAME 1NYRA 1K8AC 1BVSA 1O7IA 5FO9B 2KANA 4MDKE 2J0TD 1KDBA 1Y8PB 3ERSX 3PO2H 4EEWA 4GLAC 4QJFA 1M90C 3DM3A 3P42A 2PI2A 4NPSA 3DVNV 3T1HQ 3AE2B 3H0GG 1FRDA 1SMYD 4MIUA 3S15H 5D3IB 1Y1WG 4GGQA 1I4RA 3ZYYX 5AJ3L 3GTLH 3DHHC 5DAUA 1EZ6A 4CKEA 4DK3C 5BYSA 2N49A 4DUZL 1I3QH 1YN3A 4JLCA 4DUYQ 2CKHB 1SMYC 4ANUA 1IHZA 4GOPB 1YJNA 4H13C 4NAMA 2K5NA 2UXCL 2F0DA 5IY0A 1EFID 3K57A 2YU9B 2FMMA 4BBSG 3MXGA 4OVVA 1UE6A 5L37A 2PO4A 1SGHA 1U4AA 4N6EB 3RULA 3X0WA 4B9WA 4WORA 5DEHA 3VHTC 2B76B 1JQYD 3VA7A 2ZTCA 4EQPA 5IWAL 2LHEA 1WTOA 3VR8B 2RSOA 2CU1A 1AFPA 3P1HA 3IFTA 1KNEA 1HUMA 2K6QA 3KLWA 4LCDE 4X65Q 4K2LA 2UUAQ 2A5UA 4WURA 1YJ1A 2BOSA 4JPSA 3A5ZB 4JE3B 4HIMA 4EOYA 4POFA 2BE5D 3M4OB 2LEKA 1F9QA 3PUYA 1LM8B 1YX6B 1GHKA 2J4XA 3ZRCA 2KN5A 3PRZA 3JAMi 2EYOA 1LTID 3PLUA 1SRUA 1RM6C 1J6QA 3LB8C 2J52A 3DM1A 5CR3A 4OHJA 1WTWA 2FBWB 2KDMA 1VQEA 2BE5C 1SFOB 5EKKA 1EIHA 2XSCA 4GZYC 1C78A 1UWXA 2KT7A 1KNAA 4XIGS 1ONLA 4LF6L 1K51A 1T0RC 2WXFA 5L83A 1R9TB 5IYBH 2K5PA 4X3UA 2NVYB 2FNJB 4DXFA 2D2QA 2CS4A 3TREA 1WJNA 1A8VA 1OEYJ 2QILA 3W1SA 3APDA 4N59A 3RLOA 1WY8A 2QIEB 3H6NA 3PMFA 1GUGA 3QO2A 4DFAA 4OO1G 1SYEA 4IJHA 5CMDA 1BBXC 3LXFA 2AQ3B 2WV6D 2NR2A 4YT0B 2RKSA 5CTRC 4ANWA 3UDIA 1TVXA 2D10A 4GMVA 3A56A 3PUZA 3G4SA 3N1ZC 4LNIA 3ITPA 4JCVE 1KXLA 4EKUA 4IURA 4YXDB 5EPKA 5C23A 4O0AA 1T9HA 4CDCC 3QIJA 3DCGA 2K5WA 4X62L 1FJGL 5D94A 2LGXA 3TL5A 3F1ZA 2JA8G 1OFFA 1Q86C 1B53A 3RLFA 5AZFA 3U4VA 5IGFA 3RNCC 1E7VA 1TGZB 2PVGC 2WU5B 2IT1A 1K8GA 4NXNQ 1SNOA 4HSPA 2Q2IA 1QUQA 2F4VQ 1LTTD 3J80L 1XD3B 3KLSA 3UINB 1AH9A 2KDFB 3P63A 2L55A 2NWGA 4JOIA 2WDQB 3MFGA 4XX5A 2E74C 2A1AA 2F0WA 4LDTB 3FEWX 2YEPF 5IA7A 4NKLA 3NS8A 3NVVA 3GE8C 2FCMA 1CJEA 5M5WH 1JJ2A 2J0KA 4RMFA 1OQQA 1EWYC 2Z4IA 2KFJA 4FXKC 4AQYQ 4XT3B 1WCMB 2ASBA 1ET6A 5KNBA 1NI2A 5IGDA 2XVSA 2RDHA 4C2MH 3PHWB 3RUZA 4KGRA 2MUYA 1UE1A 2YU9H 1GC6A 1VQIA 3PIP3 3OSOA 3VR4A 4NNJB 1LUZA 2F0GA 2GOWA 4F8MA 1PGBA 3NQIA 1LV9A 2UU9L 2W54A 3DBHI 2NN6G 3IBEA 3Q8FA 4RCOA 4IO9A 2JZPA 2OT2A 2VQEQ 4LFCL 2JZ3B 2TSSA 3Q2AC 1QUQB 1L6VA 3AEFB 3S1MH 4L63B 1NI3A 2JXTA 3BDCA 4D2KA 4LJOB 1QJOA 4GIVA 2R7FA 5AJ3Q 3HOYH 3APFA 2JRIB 2PMZE 2WIIB 1LT6D 3GD7A 1LGRA 4DUZQ 3DVGY 3ZLZA 1PH6A 2ATWA 3BU2A 4HJGE 3K59A 2UXCQ 5IYCG 4HSVA 5FOBB 3GTOB 2CFMA 4HPPA 1SFOH 3EGRA 3MJWA 4K5WA 2IW3A 2R93B 1S4ZA 5KIXA 3NELA 4AUQC 1SE3A 4IALA 1MJCA 3CMEA 5E6NA 1HNZL 3C0RB 2MEKA 3NSWA 5IWAQ 1N62A 4DR2L 1WTXA 2XK5A 4KIKA 1K9MC 1S5FD 1B7YB 2PZUA 5CC4A 3NRZA 4P73A 2RPVA 4W9CA 1TWHB 4CGYB 4S17A 4ZLTF 1PHJA 1EYCA 1O7YA 2YV5A 1SYDA 1B3AA 5CHVC 3SEBA 4POGA 1RODA 1AZQA 4A3OA 1PYSB 2B8FA 1ENAA 5JEAH 3E0EA 2RR9A 4HJKA 1D1KA 2SEBD 1E9MA 5C4ZA 4RHRA 2DENB 5GXGB 4B95A 5EE3A 4W9LA 3ZUNA 3FKYA 5ELBA 5EPLA 1NAPA 2L05A 1OXSC 3HHMA 4OONA 2BWFA 1HZBA 4WFN3 4FA6A 1WM3A 2WAQE 3J7AF 1TJEA 1GXDC 1EEFD 1WXVA 3PF5A 1C4CA 1JRUA 1ZXHA 4LF6Q 2Z0DB 4XDCA 3SGIA 3CPWA 5IP7G 1MG4A 3S1NB 3GTQB 3T8MA 5IIFA 1SBBB 3J81j 2K5QA 3U52E 5C3EB 3H09A 1EIYB 1V49A 4K7UA 3CQZB 1HJPA 4L5RC 1E8XA 4KIKB 2XK5B 2IPKD 5MPOA 2E2DC 1PH8A 4A3CG 1Q8IA 3QA8A 1VQ9A 2J7ZA 3I4OA 5FLMG 2WDRB 1CKOA 4BY7B 4W9DA 5C44B 1A3VA 3RZOH 4US8A 2JQRB 1VQJA 3H6MA 3A4RA 1AE3A 3GB1A 2LKVA 5HHDG 3UE1A 2UXDL 3VRBB 1H9SA 1RYJA 3DWAA 4EQ5A 4PNYA 2F0MA 3NHHA 1VQGA 1I4PA 4X62Q 1YJIA 3KDFA 4WJ4A 1L2FA 3DWQA 1FJGQ 1GJZA 4CQNA 2PYKA 1B4OA 2FUG1 1PRTC 4G0NB 2ICIA 4DXGA 1JR0D 1EY7A 2NVTH 3RD2A 1L0YB 1YMHE 2N88A 4JI2L 5HG2A 4UAIA 3J80c 5HY6A 2RSUA 3ZIMA 1QB5D 3TCAA 1E1OA 1NYQA 1A2UA 1W3SA 2I1JA 2L00B 2G45B 1WGDA 3I91A 4KY7A 3VR5A 1PRTB 1VZ6A 3OG5A 2E5LQ 1WTHA 3QOLA 2LXKA 3VR3A 4IFDH 3BVMA 4K8IA 4MTKA 4XDXA 4BBRB 4A3GB 2BW2A 5IP9G 1GG3A 4NQLB 2MJ8A 2LFIA 3PTFC 3LX0A 4ZRPA 3S14B 5I2XA 1LYLA 1FCCC 2F0LA 1U9RA 2IO3B 5BR8L 2N1WA 1H9KA 4OO1I 3P4RB 4I7AA 1YQ3B 1H9SB 3RN5A 2PPBC 3FHWA 3GTOH 3DDCB 3QWNA 2N9KA 1EEID 3BVZA 2MQJA 5I4DA 2KCCA 3TP5A 3E6ZX 2K6DB 2YVCA 2L0FA 3NVWA 2N7DA 5D3DA 2KENA 2UU9Q 2VL6A 1QNKA 1C48A 2ES2A 2N4FA 1WSPA 1GOZA 1WTQA 4LFCQ 4A3BB 2JXXA 2W55A 1JWSD 2CH4A 3R8BA 3RZDB 1SE4A 1W6JA 1ZXTA 2FJ2A 4DV7L 1L4DB 3IVFA 4C7ZA 2CHBD 2MBHA 4MGIE 4FXGC 1SJED 1Q3LA 1RDPD 2G4SA 2R2QA 2RA4A 3ZNHB 1Q7YC 5G3LD 3DWMA 1VQNA 3VUWA 1N63A 2INNE 5K5PA 4LF5Q 2JQOA 2WAQG 3K8AA 1LT5D 5CV4A 1UH6A 1PXUA 4PYZA 4W9IA 3KBXA 3AEVA 1AYFA 1SDFA 1Y8OB 1Y69U 1P3QU 4X57B 1STBA 1XWEA 1JWMD 3U9OA 2PE6B 2J0JA 3AEEB 1DOXA 1M8AA 3OOCA 2LRWA 1HNZQ 5C5LA 4LNNA 1FMAD 1CKMA 4IKGA 3S1NH 3DHQA 5C4XG 5C2TB 4DR2Q 1C76A 3WDNA 1HA5A 3KBGA 3TEWA 3FKIG 2ZXPA 2IGGA 3HVZA 4KHZA 3ZXRA 5EDSA 3PT2B 3PS6A 2QA4A 1UWVA 2EY6A 3J7ZC 5JHBA 3OW7A 4WWPA 2I2YA 1TYGB 3L0OA 2MQHA 1Z9FA 1HFNA 3HFZB 4B08A 4A3IB 3L9AX 2Z4HA 2CJOA 4U68A 4BVUC 2D2CC 3L0WB 4BY1B 2N9XA 1UBQA 4A3DG 2R7ZB 1Q90A 3I5JC 1NY4A 3CPFA 1EQTA 1KFYB 2HDLA 2PW5A 2HT1A 2F0SA 3FMCA 2CHZA 3KH0A 3Q8AA 1PZID 1ZDXA 3K6OA 4BXXG 1TU2B 2WXMA 1KAWA 4EZJA 2FHTA 3D8GA 1GJXA 3U7DA 2A6ED 4QIWB 4RM9A 4LF4L 4A3JB 2A68D 2JX5A 4JI8L 2ZTDA 1ESFA 1E2VA 1UEBA 1HZ9A 2A6EC 4A93B 1HA6A 4HPMB 1DJRD 3SE0A 3E56A 2ZW1A 4GDKB 2B3GA 2L1BA 3CC2A 4BBRH 3QJYA 4R8NA 2XIWA 1X56A 3PRMB 2SOBA 1I6HH 4G4KA 3R2TA 2YYZA 4MZ9A 4X64Q 2UXDQ 5DM73 3AMZA 4L1BA 2Z9HA 2EMSA 4JK1C 3Q8EA 1G6PA 3ZDMC 4PV1C 3DBHB 1YJ9A 4DNTB 2NUCA 3MFYA 1BUVT 1E7PB 3AB5A 3QQ8B 3PZ7A 2LSSA 3I4MG 1GUOA 4NXML 1D5MC 3M9BA 2UUCL 3HKZB 3H3VH 2BYFA 4PS7A 1SNMA 3PV0A 2AQ2B 1HQMC 1UUPA 3GP7A 3HKSA 4JI2Q 1J9OA 2XWJB 3AI5A 3I9V1 2IO1B 3W5OA 5BMHA 1EY6A 2INPE 2WKCA 4DAMA 5JPNC 2RVLA 2XN9C 4ITKA 5BN3A 3RZDH 2WX1A 4WWNA 3DWGC 1OXXK 4U673 3AU4A 4PT5A 1KDAA 1ISNA 1X1MA 5C1ZA 1V1PA 2EY2A 3H94A 2EE1A 2KHIA 1VQ6A 2AQ1B 1E7ZA 4W9JA 1I94Q 3A74A 2NZ1D 1C0AA 1KAAA 1C9FA 4JBWA 5BR8Q 2VRRB 4CBVA 4P72A 1VQMA 1U4LA 1WWTA 3CP0A 4DR4L 2KACA 2LGSA 3Q8DA 4CJ2C 2R92H 4A3FB 3HOZH 2RMMA 2F0FA 3KYCD 2UYZB 2G9DA 1WE7A 2L52A 1Y1VH 3L13A 3IL8A 4LLGM 4QUFA 1NBWA 5J3BA 4G57A 1QKZA 2KX3A 3NHEB 1BDOA 4BS9A 2FCSA 2K6AA 4PS3A 2CW0C 5KNDA 1HR0W 4FHJA 1KLUD 3H0GB 1RF2D 4DV7Q 4EQOA 1E7UA 3AE3B 3DOWA 1DOMA 3H7PA 3VXWA 1VQHA 4A3IH 5AZGA 1KQSA 3RNEC 3ULJA 2FIFA 1XNRL 5CHWA 4JW0A 1CHPD 1E2WA 1V1PB 4BY1H 4TQ0A 3Q8BA 1JC7A 2MW5A 3W1GA 1SLJA 1KL9A 2RBMA 2E2IH 2MJEA 2VW9A 2LJIA 4OVUA 5IKCM 2LUMA 3RR5A 2YTXA 4UPAA 1ET9A 1O7LA 1GUNA 4JQWC 3HOUG 2PNRC 1IBKL 3QX1A 4A20A 3T1YQ 2ASQA 4DR1L 1JB7A 1YVCA 3HOXH 1C7YA 1JMLA 1YIWA 4XXEA 1CQFA 2JRHA 4BAXA 2QJLA 1L0VB 2EYMA 4TQUS 3DVGX 4DDID 1MKHA 2IGHA 4HJ9A 4CJ1B 2DY8A 4YCWA 4YTMB 2BA0A 4QQBX 4URKA 1A6XA 2Z1CA 3AN1A 2K5VA 1FXIA 1F9RA 1LT3D 1WOCA 2HJ1A 3QR8A 3DEOA 4JWSC 4LW1A 3VH3B 3A8JE 1L4ZB 3CMAA 4OX9L 3HOVG 2CHXA 5LL6S 3T53B 5BN5A 3BK1A 1EY9A 2RDGA 4GN4B 1I50H 1C79A 3HIZA 3D4DA 2L5TA 3GV3A 2BDOA 1F9PA 1SYFA 4LK1C 4C56C 3SVMA 3S2AA 5BO4B 2A8VA 4XWWA 3MXUA 4X6AH 1STHA 4K5VA 1WTRA 4LF4Q 3P4QB 3RN2A 5JH5C 4JI8Q 3AFQA 3C19A 1V5TA 4YSXB 1T5XD 1PTOD 4EUTA 3M4PA 5IGGA 1LTAD 2AL3A 1HZAA 5KGUA 1IGCA 4HIKA 4DNIA 4FF1A 1P7FA 5ELCA 4TSSA 4GU2A 4OZBA 4FO2A 1F2LA 2KJ6A 2KOXA 2NMQA 1WD0A 1YHAA 3CF5A 1PH5A 1S1QB 2OTJA 2MP2A 2WHIA 3TIXA 3TQYA 3TUOA 2JVCA 1SMXA 2EDGA 2EJMA 2JWUA 3QC8B 2B63G 4A3KG 1YHBA 4KY6A 1KH0A 1YQ4B 1XJVA 4J1MA 3DPDA 2WX0A 3H9DA 2C5CA 2KJXA 1STAA 1G91A 2LJ5A 4RM8A 4BOZB 3R66C 1VQKA 4ACFA 3PO2B 4YL8A 3MXNA 1LABA 3M3JA 4HWIB 4NXMQ 4DQOC 2UUCQ 2QF7A 1WXAA 1VJKA 1N34L 2JA8B 3OLMD 1CSPA 1K8MA 1AZPA 2JWZA 3VUXA 5A2QL 3S15B 3EA6A 2HUGA 4A3FH 3VVWB 4S3SA 2F0KA 4X65L 2UUAL 1ZUD2 4IW0A 3GTLB 1GAQB 2LS01 1V8QA 2IYDB 4LAAA 4B3ML 5C0XG 3N9YC 1I3QB 1H95A 3A8IE 2BDNA 2K7VA 2M00A 4II3B 4A76A 1CZPA 4G7ZC 3PCOB 1OQRA 5HKHA 3E5SA 1UNSA 2KQ3A 3H0GH 3ML8A 1RHPA 3S16H 3KUZA 3ZNZB 1Y1WH 3R3OA 3QOJA 1FCLA 3L17A 1N8RC 1C77A 3PHXB 2NBWB 1TWGH 3BINA 3W3AA 3E3XA 1PH4A 2MP2B 1L0WA 4LMQD 5M5YH 5T1IA 1G8ZD 2B3AA 3D4WA 3T56B 1VQPA 1GC7A 4YY3L 5FKAC 2KWDA 4A8XC 1QVFA 5TR5A 5FR6A 4DR4Q 1XLPA 4BBSH 4HTHA 3MXNB 1RFKA 3B0AA 4RA8A 2ZPYA 2HQLA 1XLNA 1MGSA 3A1QA 4KKIA 1CT1D 1PFBA 3EHVA 1PUTA 2Z0EB 2CR5A 2IWHA 1YNND 1IYUA 2K8BA 2OQ0A 2ZJDA 3K7UC 5ISRA 2JA5G 4OIKA 3SR1A 1UF0A 2I1KA 2EKEC 3B9JA 2D0OA 2WFWA 3KVFB 2IY5B 1FD7D 5JVH3 2I46A 2L4NA 2QW7A 2HD5B 2D11A 2F52A 5JJZA 5LL6X 4MN3A 5C4HA 5KNCA 3NBHA 2SDFA 2O6VD 1XNRQ 2EYFA 3BS1A 4K3CA 3RLNA 1IYVA 2MA9B 4NXNL 3W5VB 1B70B 1UE7A 2LGDA 2KQSA 4ZRIA 1R4QB 1RRBA 3M4YA 3I3TB 4ZYSA 1JE4A 5JXVA 4H02A 4KTAA 2QDBA 4WJOA 2Q2UA 3WCQA 1IBKQ 3HOWG 1LT4D 5LNK1 4OL7A 3A5UA 4DR1Q 2AL6A 2ZT9C 1NNXA 1N5WA 1G291 4PMCA 2PMVA 3A1QB 1S5BD 2JU6X 5CGKA 5D6JB 4AQYL 2WINB 1EWCA 3M7GA 1Q1BA 3T16A 5GAHC 2NTTA 4RF1A 5M3FG 1J7BA 3NZSA 4OO1H 1XLOA 2DAFA 4TMAB 1GB4A 5H1SE 1IL8A 5CORA 1CMXB 2RCNA 2C7HA 3Q3OC 4JI0L 4GDLB 2D3GA 3TEHB 4J6HA 2F3VA 3NE5B 4OX9Q 4YWGG 4F88A 3NBHB 3KK7A 2DUDA 2WP8J 3E9IA 4IWOA 3GTPB 2VQEL 2I07B 3VTUA 1F2ZA 1JOOA 3ULLA 4GN1A 1G51A 1FL0A 3I70A 1WGHA 5H92C 1PTOH 2JA8H 1SE8A 2PTLA 2QHOA 1QT9A 2O2VB 3CSFA 1L2NA 2KD0A 1EYDA 1XX8A 1EZ8A 2WXOA 3CF6E 3NQTA 4ZUIA 4ICUA 1WTVA 4DR5Q 1IYFA 4TKOB 5M5WB 3OJ3A 3TP8A 2ZPNA 1GHJA 2VQFL 4RGNA 2Y3AA 1WIAA 4FXCA 1R4PB 1HUNA 2NBVB 4C2MB 2L15A 1YN4A 2MX2A 5FO7B 3M62B 4P7IA 3BJUA 4XT1B 3AM9A 2X38A 4DK6C 1U4PA 2FIDA 4LNFA 5J18A 4IWQA 1S3OA 1X3PA 1E8YA 1K8OA 2LUEA 4K3BA 1U4RA 4ALPA 3GTMB 1PMRA 1VLBA 3VH4B 3B2GA 1LO5D 3MXPA 1CK1A 4ID6A 4LNQA 2F0UA 1TIID 3H3VI 1ACCA 3MP9A 4GNXC 1N34Q 2SNSA 1VCIA 3S1MB 4XYQA 1VQDA 1SYGA 1I4QA 2BH8A 1XMOL 3TBIB 3HOYB 4MHEA 2EZVA 3KWLA 1S5DD 5BYRA 1FXAA 2Q8TA 4B3MQ 2NN6H 2ZXRA 1EFWA 3B1LX 3TDQA 5D2MB 1I4HA 2R7DA 4GNXB 1WZ3A 3N30A 2F3IA 2JEBI 2XNAC 1QZHA 3J80E 2LGIA 4R3DA 1WJUA 1FR3A 1MI2A 4LUZA 5EGTA 2MJ3A 3NWTA 4YWMA 2F0IA 4CKCA 1WXMA 1BT0A 3ULPA 1XCTL 4XDDA 3JW0X 3J7A5 3N20C 1E24A 1DOIA 5JAVA 1JWUD 4YY3Q 2JY6A 3AE9B 4E74A 3KLRA 5IYCH 1EOTA 2IZVB 4DHZE 1FD6A 2CKZB 2V1YA 4C7YA 1EY4A 1PV4A 4GSWA 3U2SC 1YZ6A 5J22A 3K9PB 3IG3A 2E3TA 1CZWA 5FJ8G 1JOKA 1JWAD 4DV4L 1T6BX 3MC9A 2F0OA 1A0IA 1XF5L 4HMIA 4KJNA 2PKOA 3APCA 2MPMA 3P1MA 4HKQA 2WKDA 4IM2A 2ZTEA 2ZVNA 3UI3A 1QOGA 2HTME 5C0XI 4HAEA 1ICWA 4NB3A 4IUVA 2IL8A 2K39A 4FJZA 3VFKA 3P7JA 2PQEA 1CUKA 1DCZA 1FGUA 5I6YA 2M9VA 3E0JA 1VZ7A 2L83A 3D4RA 2BWES 3GTPH 3ZTCA 1XQQA 3MC0B 5CX3A 4IUPA 1JRPA 2K33A 1ZKOA 5AFWA 4P1BC 2K01A 5EJWA 3CCVA 2E5LL 4FULA 4DKAC 1WYWB 3X3MA 1U5KA 3C1FA 3J80i 1IBLL 1BNZA 3RZOB 5IP7H 4XQJA 3AE7B 2L7RA 2WXQA 3TBLD 2C5LC 3PO3G 4GKJL 4DA2A 4LFBL 2JYOA 4FJVB 2JA9A 3I4LA 3S17H 3Q69A 5EE9A 4A3CH 1V5OA 2DNCA 2JA6G 5FLMH 3K5MA 1H8CA 3UF8A 2AWNA 4P16A 1ASYA 2VUMG 3NK9A 3T13A 4JI0Q 4HEDA 1RIPA 2NVTB 3KLSX 5JOBA 1L5PA 2BGFA 1MVKA 1MG8A 2K03A 2IO2B 4NJCA 1PDXA 2TMPA 3V3XA 4ABNA 4Y7NB 1HFGA 5JJLA 3GTMH 1J5EL 3OWFA 1VRAB 2NCNA 2OEDA 3NJTA 1HTPA 1D5XC 4AH6A 4C3JG 3C3LA 3NOBA 3R2IA 1XYIA 2PNHA 3P2BA 4FF3A 2DNEA 3RMHA 4AS1A 3NTKA 1UZXB 2G4DB 1MJDA 2EELA 3EN2A 3PGEA 2A74C 4QGUA 5IGEA 3PGZA 1CHQD 2RSNA 2VQFQ 1WGKA 1XLQA 1QWYA 2BKRB 3QB3A 4HCEA 4LF5L 3VRAB 3OTOQ 1M4VA 4HEA1 2IHFA 1GM5A 1A3UA 1ESRA 2JE6I 4A3LG 3TMPB 4O42A 4A90A 2PI2E 5IP9H 1FVIA 1AP0A 1WXSA 2X69A 2YEPB 1LM0A 2I0QA 4ZRJA 2ZCCA 3W5UB 4PZ6A 3OIQA 1XTCD 1VZ8A 2JYTA 4IUMB 2L9HA 3K7AH 1CTMA 5E7NA 3NEMA 3I4MB 5C4JH 1HEZE 2K1FA 3BDLA 3KUCB 4LTUA 1BKBA 3FPPA 4RF0A 1YX5B 1WVLA 1JROA 1XT9B 2MBQA 1CSQA 4WRDA 3C8YA 3VUYA 1XMOQ 3IT6B 2VH2A 4K1RB 3T3NA 1KLGD 1I4XA 1JJCB 4HROA 5NUCA 3ZTDA 2WYQA 2WWZA 2ALYB 4JPBW 1WZ0A 4WJ3M 4KDLB 2LVQA 4K7SA 3VYRA 1YJJA 2IGDA 3WIMA 3GTGH 2W9NA 2V9HA 5JEAJ 3U8ZA 2WS3B 1YJWA 1NVID 4L5TA 3K81C 4CYEA 1MIUA 1VQ7A 1VF7A 3RYTA 4ZUJA 4IOIE 1W2BA 3CW2C 2L0TA 3KJOA 2C7MB 1B9NA 1VQ5A 2NVXH 3H1UA 3HUIA 2K52A 4KHPL 1PRTF 4NAWA 2PW7A 2JSOA 3A0JA 2QSDA 4M02A 1ILPA 5C4XH 3ZQ4A 4RMAA 2XTIA 1YNJD 4X64L 1XNQL 4DV4Q 3FKIH 3RZFA 3Q6SA 2B2VA 5ELFA 3G6JB 3PREA 4DV2L 3PSIA 3W9CB 3JVZX 4DU9A 1IUEA 1PVOA 2UWQA 1WR1A 4ME3A 3E9SA 2NTSA 3CCUA 4R4QA 1P1AA 1PFDA 3JYUA 1PYWD 3CSTA 2M1MA 1SE2A 1F9JA 1WGYA 4QMGA 4FN2A 4Y52H 4M0WB 4A3DH 4Y7NH 4JBKA 1HNWL 4P1CC 4J8QA 2KDEB 1LTRD 2X6LA 4IUQA 4L8JA 1I42A 4BXXH 2BYTA 1B3QA 1WI0A 1O7ZA 4YCVA 5FLXL 3HVDA 2JA7G 3WOFA 1YIJA 1WGRA 5CYUA 3MTSA 1F2MA 1M1KC 2B2VC 1IBLQ 3KF6A 1TXYA 3H3VC 1HE8A 3FPUB 4ZKCB 1K0SA 2WLBA 3ND9A 2BCOA 1I6HB 4HR7B 4NAWB 3K0XA 4GKJQ 3EFUA 1I94L 4LFBQ 3RT3B 1EYAA 1E8WA 3RZWC 2N9EB 1F9SA 4JI7L 5IT9L 4W9FA 3CAMA 3FRPB 4IFDJ 1UBIA 4K7WA 1PH3A 1LTSD 2N0SB 3CCSA 1TWFB 1DOKA 5CBEE 4A3EG 2WDVB 1XXGA 3V96A 4OGQC 2DAJA 2JYEA 2M4NA 4AYBE 4JI5L 3T51B 1X9NA 1TTNA 1KIXA 3HOVB 2EYJA 2EY1A 3PIOA 2KECA 1TKGA 3ERQA 2BQQA 1J5EQ 4ZKBB 2LY7A 3I4MH 4PG3A 2J53A 2KBNA 1Q1EA 2RF4A 3UE0A 3WWVA 3RCZA 3KFUA 1YNTE 4KK7A 1ZE3D 1A63A 5BYQA 1JALA 2UXBL 3BIID 2AHOB 1OQYA 4B0EA 5DPSA 3C2PA 1FM0D 5EBCA 4NQKE 2F0VA 3KF6B 2IX3A 3I7FA 5KHQA 1T3QA 1D4BA 1PLFA 4G7OC 4KSLC 4IUTA 3PUXA 1VD2A 3UI2A 1HH2P 4CHTB 3DBRI 2MH7A 4RAUC 1FGBD 4TVAB 2KVMA 4OWTB 2A19A 3HOZB 2R92B 3SFEB 2B63B 4A3KB 3T1YL 4RGMA 3ZJTA 2RD0A 4C80A 1Y1VB 3M4QA 4NDXA 3JSVA 1ICFB 4HVBA 1G2TA 1ML0D 3VA5A 1WYGA 4DBGA 1I5FA 3DXJC 3CCJA 3BK2A 4GDKA 1QVCA 2WXHA 2J0MA 3SK8A 2ZEQA 2KEEA 1TT5B 4IPHA 2NN6I 1V80A 1P9DU 4K6DA 3TZUA 1KD1C 4CO7A 4B9XA 4A3MG 3ICEA 1PDQA 3V61A 4BKSD 3GZNI 2UUBL 3Q14C 2E2IB 3HK0A 3A55A 1F1HA 1YEZA 2ICEC 5AUKA 2D5GA 2NYZD 3FDTA 3SHLA 1WCMG 2F0JA 1NCVA 3HS0C 4FF4A 2KFKA 1ZP0B 4BBNF 1QVGA 1OXVA 4BWGB 3HOXB 4L23A 1P98A 1RD9D 2Y0SB 1ZEQX 3F2DA 3PIO3 1D3ZA 2GBNA 3JSVB 4C3IG 5IE8A 4JGHB 1V2YA 5FK9C 2EPBA 1DOLA 3Q0AA 1NSNS 1D5ZC 1Q8KA 1SNPA 2K75A 2Z6BA 4JI1L 4XQNA 1HR0L 2GBKA 2GBRA 4KHPQ 3HOUH 2A68C 2ZJPA 4X66L 2PE9A 3J7AV 1TKWB 1UAPA 4XQQA 2I5HA 3KOJA 5IYDG 4AOFA 3I4NG 5BMGA 4AJWA 4HIOA 1XNQQ 1J8CA 4HKZE 3VYTA 2EYLA 3KJPA 2JA5B 3N6RA 4DV2Q 1EY5A 4AYBG 2AEHA 1I50B 2EJFC 2F3WA 5IODA 1XEEA 2OQKA 2EQSA 3Q3JA 3J81E 1TWFH 4DR7L 1EU4A 4JVZA 2LMCA 3MHZA 3BYTB 2K8CA 1B44D 1PH9A 4DR3L 4DK1A 4B3RL 3OPOA 2VB2X 2INDC 2CVRA 2HD3A 3MZ5A 3A33B 1JB3A 1QNUA 3HOVH 1HNWQ 5L95C 2KFKB 4GN5A 2WB1B 1IP9A 2R93G 1DZ1A 1F77A 3H15A 2F0NA 3S1RB 3IFDA 1WJ6A 5FLXc 3R7QA 4MJSB 1S72A 4WWOA 4M00A 3Q3MC 1Q5WB 3QK0A 1MBYA 2MFIA 2HQEA 2N8NA 4DN4M 1IL2A 2K3UA 2OJWA 3D3RA 3NZUA 3OJ4B 3TEXA 1RKNA 1E10A 4ICVA 5G55A 5IT9c 2PEAA 3LWEA 4HMJA 3UDGA 2N9PC 4JI7Q 2KHSA 2LWPA 3IKJA 3RNUA 3IHPC 2XRQD 5M3FB 4GXBA 4HCNB 1K3BC 1LTLA 1EQQA 2CQAA 3ZRFA 1C4QA 1ENCA 2PW9A 2WGSA 3L7ZC 5CV5A 2LMCB 2M8SA 2B63H 4A3KH 4JI5Q 2GI9A 4HXDA 3SR6A 4XTCS 4IWPA 5C5MA 1V97A 1VQCA 4N9TA 3SDLC 4UP7A 1VF5C 3ZJUA 1BMLC 3S1QH 1TZOA 4C1NK 1KTKA 4EQNA 1IBML 4LNKA 2OHFA 5LMNW 1ZDVA 3QHTA 3D31A 3S16B 1GVPA 4BKTA 4OELB 1Y1WB 4NJ7A 2WQYB 5C3EG 2L12A 2ID0A 2UXBQ 1A5RA 3I3CA 3L4PA 1TWGB 3OWEB 3J81i 1Y56A 1FIQA 5C0XH 1TS4A 4DAPA 5E3FA 1UD7A 2A5HA 1IW7D 2BH2A 5M5YB 2BVCA 2V4DA 1K3RA 1PZKD 4BY7G 4JIOU 5C44G 2KWVB 2KXJA 1Z6HA 5HFYA 2HE7A 3V60A 5DNFA 2LZ6A 4P6VF 5M3MG 3ALBA 3SHQA 1YHQA 3KF8A 1GNUA 3M3YB 4BBSB 5CV7A 2AYOB 4JI4L 3N52A 4QB4A 3CIRB 3HM3A 4KDIC 1JOQA 3URYA 4ZHPA 2N9LA 1BF4A 1KF6B 1XTDA 1BCPF 2AWOA 1FFVA 2DY7A 1JW9D 2A4ZA 1AEXA 1VQFA 3H91A 4HIDA 1WI5A 3QARA 3EC8A 4G3XB 4AP4C 1B1ZA 2W82A 2YLMA 2BKFA 1N33L 1R4NI 2VH1A 2KKCA 3Q3NC 4ZCKA 2ON8A 2EXZA 1WFQA 1X3EA 2VNUD 4M8NA 3AH7A 1EIGA 1U4MA 3MHBA 4PQXA 4QL5A 1MJEA 3RNFC 5LHY1 1QOAA 3W2DA 2JA5H 4A3GG 4BOSC 2UUBQ 1K28A 1E5WA 3AYHB 3T4AC 3RPFC 3G7LA 2BF8B 2KLGA 1HXYD 4DF7A 3CC7A 2C35B 2V3SA 4NZLB 1BCPD 1H9RA 2GBMA 3GS2A 5CHFA 3U58A 4ZYNA 3KF8B 2GBJA 3HG9A 2DYBA 1WJ4A 2L3ZA 3WAMA 4DR5L 2M0AA 5CV9A 4UP8A 2DWQA 1N5XA 2JZZA 3S1RH 3FP9A 2AUJD 2BTEA 4NMZA 3SFDB 2QMTA 3HKZE 1HR0Q 4KGTA 4JI1Q 3ENEA 1K83H 3CWIA 2DZJA 1X6OA 3DBSA 4CDEC 3HOWH 3EBEA 3GV6A 3VYUA 2L0CA 3FC4A 4H0LC 1Y8RC 2FCNA 1X55A 1Y14B 4X66Q 1PTOC 3M85A 4A3BG 1K0RA 3SXHA 4Q2JA 4KD3A 1HZ5A 2LFNA 4C3HG 3U4EG 1C4AA 2NZHA 1TR5A 3NUCA 4HCPB 3OYYA 3L10B 5BMIA 4W9KA 2C60A 1BQQT 5M3FH 2LRUA 2MP1A 4DR7Q 1PTOB 5M9OA 2E75C 4DR3Q 3KQ4A 4IOCA 4B3RQ 1SF0A 2DN8A 5K36G 1AW7A 3C1EA 3MTNB 3DQVA 1ZYRD 1PYBA 1AN8A 2K50A 1LTGD 4FHKA 1BUIC 1MFWA 4II2B 2WP9B 2JN4A 2BA1A 2ZW0A 4LF9L 1T5EA 4LNOA 1A70A 3A9KA 3ZDTA 3FAHA 2L8JA 1ZYRC 3AULA 2BYVE 2LD9A 1IGDA 1P8LA 2C7NB 4PS8A 4RGOS 4PMWA 3S2HB 2K0PA 2B2UC 2QEXA 1X65A 4XE0A 1AWDA 3V6EB 4HN7A 1ZW7A 1EY0A 4BA2I 3TP6A 5IOIA 3GO5A 2G1EA 2B39A 2JA6B 2KVRA 3LGJA 4KX6B 4JL9A 3M3YH 1WE6A 1OEYA 4KGSA 3CKIB 2R7ZG 2MBBB 4OW0A 3DEPA 3MAQA 1GUSA 5DPWA 2KMAA 1GUWA 5DCNA 2GA4B 4IZ8A 4J15A 2O6VA 3V2TA 2PVOD 3NZ3A 3OHXC 1Z7TA 4Q5VA 1UGMA 1IBMQ 4KJOA 2KEDA 4C3JB 3BZCA 4MELA 3VYSA 3G48A 3GZNB 4KVGB 4GKKL 3A9KB 4A3JG 4GDLA 2A69D 1YNNC 1LLRD 2KMCA 3QCAA 5DPTA 2JSVX 4A93G 1STNA 1XO3A 1V9PA 5HI1A 2EMTA 2YTVA 4OEMB 3G71A 2BT6A 2QDLA 3ECIA 2JUOA 2A69C 4R9WA 5TSSA 1H9JA 3JC66 4XWTA 1EWHA 1L0XB 2O2VA 1T0SC 1T0QC 3RNAC 1VQBA 4E3CA 2KHJA 2RHQB 4JI4Q 3S2DB 1N6ZA 2BPSA 4GOCA 1VQLA 4DHJD 4J6IA 2HDMA 4KN7C 4IPGA 4FBJB 3RN9C 4FXDA 1TS3A 3TS0A 2WXPA 3N32A 2O2LD 4BFRA 4WAFA 3HKZG 2ZVOA 1A62A 4UP9A 3CCRA 2PZWA 3H8HA 3L16A 2O6VB 2KN4A 4IPCA 1TKYA 5DPRA 2AKWB 2B2YC 1X32A 1N32Q 3AEBB 4I6PA 1N33Q 2D0PA 4A9AA 1NR4A 1MSGA 4RNAA 4DPGA 1YITA 4ARIA 4L5QA 3SK4A 4MM3A 3J9CA 2EOTA 2MHVA 5FJ8H 2BS2B 1F2YA 3AE6B 1F0ZA 1V43A 1KHIA 2B29A 1DGSA 4K14A 2OXPA 5AUIA 3U30A 2NBFA 2GVBA 4RGTA 5JJIA 2INCC 4MT5A 3P75A 4AJYB 1E2ZA 1LXDA 2KZRA 1Q0WB 3VDZA 4UY8C 5CV8A 1KRTA 1V1QA 5BN4A 4GNXA 1A2TA 1ZGUB 4X3SA 2DZMA 1PZJD 1WX7A 3AU5A 4RHSA 4KD4A 3OTOL 2WXRA 4CHKA 1G2SA 3S17B 1P0RA 1A3TA 4ZAIA 2CU3A 2PJHA 5JPMC 2I5MX 1Y8NB 3S2HH 2DGYA 4A4IA 3SD5A 4WJWA 1GPXA 3K5OA 4O1NA 3ONAB 5E4WC 1VDZA 3O65B 4GOPC 3PO3H 5CBAE 1F52A 2MJDA 4MM3B 4R1JA 1L6UA 4QUCA 3RNGC 3VAWA 4RFBA 2ZM6L 3DWPA 4IUUA 2R6GA 4MNOA 1PA6A 1JCKB 2E2HH 2ONQA 3DVNU 2PLPA 3P4SB 1B9RA 2JA6H 3EQLC 1EF1A 1Q46A 2YTYA 1AE2A 2I5LX 5DLQE 1NENB 4W9EA 2VUMH 1MPEA 2K05A 1RAXA 4MSMB 3WAOA 4F8CB 2Y5CA 3DBLI 1E8ZA 3I2ZA 1CA6A 2KLCA 5J2RA 2QGQA 1HNXL 4N8FA 4UDUC 1VDVA 3A7LA 2IBIB 4LF9Q 5DM63 2F0QA 4C3JH 3UGBB 2F0PA 2PMZB 2KTRA 4TRDA 3CXCA 3MHSD 1YBYA 2JA7B 1SAPA 2CJNA 1HHVA 4LF7Q 4MTNA 1MI0A 5EQ0A 1ZXIA 4MH0E 3A4SC 1B50A 3IRBA 3UIPB 3ZO5B 5CV6A 4ANVA 4DXAB 2LASA 2A73B 3JAML 4RH6A 1EUVB 1TZ1A 1VR9A 2BB6A 3K7AB 5GROA 1S5CD 5LLIA 5C4JB 2EYHA 3B08A 4A3LH 3SDZA 4LJZC 4A3EB 1HZ6A 4R4TA 2MLBA 3TEZA 3S2DH 3BG3A 3L3OC 3CCLA 3KUPA 4MSQB 1R4NB 1YN5A 2CWPA 3BZKA 3Q22A 3GE3C 2DLBA 1EO6A 1WH3A 3ONSA 1K8RB 3PIPA 1DM0B 3UQBA 4G50A 3T3OA 2DBYA 2LI5A 4YSYB 1WXQA 1E0ZA 2MNAA 4DAVA 1E22A 1OTCA 4GKKQ 1D2BA 2KK8A 4I6LB 3GTGB 2KTRB 1RTNA 2MSED 5M5XB 3Q8CA 3A9JA 1D6EC 2WXKA 2K4KA 2NPTA 2KDBA 4JX1C 2MRPA 3NUHB 3AU7A 1LQBA 2KUMA 2WAQB 2K1BA 2KA7A 2BBCA 3N3KB 1CZGA 4DV1L 2D07B 3HZXA 3GDEA 3PSEB 5G5GA 2M2LA 4ZK9B 1Z5SB 3LWUA 4CDFC 4K81A 3RUIB 4KHVA 3EIVA 1RL2A 4DV3L 2NVXB 2AWTA 2N1VA 2WU2B 1KRSA 4EE2A 3UIOB 5ELOA 1PGXA 3VR2A 3PO2G 4LDTD 2OEOA 5JVG3 5C4XB 4KV6A 1VQOA 2PQAA 3GOEA 2AX5A 2N55A 2V1CC 3FKIB 4N8X1 4JI6L 2K25A 5GQOA 3W1SC 2FMCA 2KCTA 5A35A 4JYAQ 1P16A 1C4PA 2K5HA 5E6OA 4A3PA 1CM9A 3TZDA 2NB0A 2K04A 3WA0A 1KRHA 2IDYA 4YHHQ 1DYQA 2O4XA 2D3CA 3EFXD 4L2YA 4MGZE 2DYMA 4A3MB 4A3DB 4G7HC 3A9JB 2VY3A 4LFAL 1WF9A 2NPTB 3W1YA 1LTBD 1JICA 2JXMB 1EL0A 2RDBC 2EXDA 3KWVA 2MCNB 1SN8A 3AE1B 3RNBC 3Q3FA 2KWUB 1J7CA 5GAGC 3NPPA 4DNRB 4DV5L 4ZRKA 4YCUA 3S9WA 1J19A 4C3IB 2LVPA 4IOAA 1R4MI 3OW2A 2PQAB 1TS2A 1DOYA 2KWCA 1NTGA 1MHHE 5C3JB 2E8GA 2EJGC 3SK5A 4JOIC 3I56A 2IHEA 3MWYW 2JA7H 2MBOA 1X3GA 3AECB 1VQ8A 4MGKE 1IPGA 3HGBA 3VR9B 3PF4A 2JPHA 4KV2A 3I4NB 5IOCA 5FO8B 1U0LA 2PCFB 2XEWA 1BBUA 1Q1OA 2ZM6Q 4RKBA 2HTHA 4DK5A 3K80C 2RDFA 4AYBB 2H4OA 3IFWB 3PLVA 1C9OA 2L11A 4PMBA 5IYBG 3M4OH 5EPJA 4A3EH 1EM7A 2M19A 5KHOA 2LVOA 2BS4B 4REZA 2I38A 1CQVA 4FYDA 1NEKB 1C1YB 3L08A 3LDZE 2MGSA 2LGYA 3BYYB 1HNXQ 4V190 3MC8A 5IGBA 4B3TL 4EVOA 4K2KA 4RG1A 1R9TH 1VMPA 4IUNA 2VZAA 3IT4B 1FRRA 2NVYH 2KJRA 3N1XC 1KDCA 2FINB 1B8AA 2AUKA 4GN3B 1K52A 1Q10A 2V4IB 1RFAA 4L6TB 3DHIC 3LNNA 4B0MA 1V1OA 2NBUA 4M0WA 3H7SA 5FLXE 5M5XH 4K0KL 2DZKA 5AEKB 3X3NA 1E90A 4RKLA 2IX1A 3JAMc 1ZPSA 1C3TA 5LMUL 1QOHA 1HRJA 4K8JA 4HJ7A 4WIPA 1AARA 2DX5B 3BVGA 2D5DA 5C6AA 1XMQL 1SJHD 2IY1B 3RD4A 3EUB2 1SNCA 1VS0A 2PIAA 4XC2A 3SU8X 2MO0A 3TSSA 3TP7A 4IN3A 5IT9E 1LFDA 4WWMA 1QILA 2ZJQA 2VB3X 5E6PA 3OIPA 4F7XA 1QG7A 1Z2MA 1MHXA 4OZCA 4LF8L 4Q0FA 1V8CA 2HHHL 2KCNA 4DWFA 1NMGA 3GTKB 4B6WA 3QG1A 2HJ8A 3P4PB 2K9XA 1TY0A 2EKIA 3CD6A 4XYCA 4ZDVA 4NJ6A 1IBXA 3A54A 5IO9A 3GQBA 2B2TA 3F2CA 2AMCB 1R7SA 2FAZA 1YNJC 2KJHB 5I9OA 4JV5L 1NE3A 2F0HA 5LXIB 3MVVA 1F2RI 2Z6KA 4HPLB 4FF2A 5HGTA 1ZOYB 2GVAA 1WX9A 3DMUA 4KN4C 4V0BA 5E1FA 4KZCA 2IJ0A 5AZHA 4A3MH 1IKMA 2WXGA 1EU3A 4DV1Q 5D14A 2E6XA 2CQOA 5M3MB 5GADC 3IAM1 4IPDA 4KKSA 1PRTD 4DV3Q 2JEAI 5EKIA 4KSKC 4MGYE 1UE5A 1WCMH 3HOUB 1IXRA 2H1EA 3PUWA 3HM6X 5I2YA 4M1UB 2GMIC 3BWUD 3PVLA 2NVQB 2B2TC 2ENBA 2MWSB 3NG0A 4E6IA 1TS5A 4X3KA 1MD2D 2F0EA 4JI3L 2B8GA 4JI6Q 2FCQA 2N7JA 4C3IH 1QLBB 1OGWA 3NTIA 4EZKA 3HOYG 1JT8A 1ILQA 4N9PA 4HK2A 2F03A 2Z6KC 3GTJB 3AEGB 5KRUA 3QIAA 5E4XA 1IBXB 1SROA 2F0TA 2LXJA 2X6GA 2K5DA 3UDFA 2K14A 4JG2A 2RCFA 1QZGA 1C8CA 4C4VA 5J39A 1WM2A 2GN5A 5IYDH 4M8MA 3I4NH 3PRPB 5E6JA 5HURA 3KYHC 2SNMA 1ZKHA 1GO3E 3DBLB 4LFAQ 1QF6A 2KQ4X 3AEAB 1SEBD 3UDXA 3G6EA 4J3OD 3RMKC 3VTWA 5J17A 4P2CB 1FPYA 5IP4D 5G3LF 3ZJYC 1BXTA 3HP3A 4A6QA 1TWAB 3TS2A 1HTQA 2DNFA 5G2NA 2DJGC 4DV5Q 3WANA 3ZGZA 1GUAB 3CCEA 2PPHA 3Q6BA 4F1SA 2Z59B 2WACA 1I35A 1Q81C 1D8LA 3I57A 2XRSD 3K5NA 3EECA 2OTLA 2KC1A 2R93H 2K28A 3MJ5A 3KDFB 4FLHA 4AIMA 3PV1A 3DHGC 3ZVVA 1IKLA 1LACA 2JP1A 1V6EA 2Q5WD 3M63B 5J1ZA 3OMGA 4OWXB 5JEAG 3M95A 1GD7A 1ENFA 1II3A 1DONA 2RPQA 2NVUI 4QY7A 5EAYA 3I90A 3CRKC 1YOVB 1STEA 2HDEA 1J0GA 2OJRA 4OWWB 1TWHH 4C3HB 1FEHA 4E71A 1J8IA 4C4VB 4H2AA 1TKEA 2OF1A 4IJLA 1N9WA 1FNVA 3S1QB 4BKSA 3AFPA 1X54A 2N3SA 1PH7A 4R8IA 2Y5BB 1UGJA 2FUHB 3KUDB 1G6ZA 1DXMA 3AV8A 4EGVA 1EIFA 3VR6A 1VMCA 5KYIA 3WALA 5IN7A 1YQBA 3E9HA 4HDOA 3ND8A 4IM3A 4YTPB 4YWKA 3GTKH 4EZLA 1QZEA 2N7EA 1EQVA 1GUTA 4B3TQ 2J42A 1PGAA 2L76A 1RWSA 3I8ZA 3K58A 1WMHA 1WR6E 3GTQH 4FNFA 4JC0A 4TKNA 2BS3B 1O78A 4BZAA 3B6YA 5C3EH 2Z8LA 3D6WA 1TQOA 4RCNA 1XPUA 5GAEC 2VZKD 2KVZA 4USAA 3CQZH 4K0KQ 3ZJVA 4H44C 1HTOA 1SR3A 1S3SG 3MA2B 5LMUQ
chains in the Genus database with same CATH topology
4US9A 1Z47A 5I6WA 5EE1A 3NP8A 2Y5PA 3VQIA 1CFMA 2E2JB 5G5HA 4WQMA 1SSOA 2M56B 1S5ED 4I7ZC 2A6HD 2GRIA 3PZ8A 4HRSA 2G9HD 2QEJC 2VZKB 2W3RA 3EROA 2PZTA 4IFDG 1PFNA 3AE8B 2Q8RE 2GB1A 2F4IA 3EVQA 2A6HC 4HCSA 1JORA 3WOEA 1QOBA 1JWBD 1SYBA 1SB3C 1I7HA 2KAJA 1BO0A 1JQ4A 1I6VC 1GB1A 3D6CA 2R61A 1HQRD 2V0GA 3AE5B 4KI0A 1A15A 1HPCA 4JWUC 2FE8A 2EY5A 1UEAB 1K83B 4YSZB 3HOWB 1MSHA 3K0YA 4FP5D 4KKTA 2EYPA 4RWSC 5C3XA 1EY8A 2D62A 4A55A 2O5IC 1FYCA 3BDOA 3FILA 2B2WA 3ETRA 1PFMA 3DUZA 1UWMA 4YTNB 4KKJA 2WXIA 3V05A 1SNDA 3M7NA 5D7GA 1O80A 1TWCB 4ZHOA 1KABA 1DD2A 5K36H 5T1GA 2KMMA 5I9PA 2O5JC 2E76C 1TT2A 2CW0D 2B2WC 4FVMA 5KEEA 4MACA 2ZXOA 2LHDA 4ME5A 2ACZB 2K22A 1IW7C 3J81L 4GLSC 5C0XJ 1OXUA 1X3QA 5ELEA 3MEHA 3FILB 1E0BA 2R3ZA 3OMCA 3NVYA 3HRZC 1F2RC 3B2FA 2XWBB 4IDIA 1NUCA 3U9SA 3NBIA 1STYA 3CRLC 4N58A 3I72A 3NWSA 5A2QE 1WTPA 4DGZA 2VXWA 3TMEA 5COYA 2H88B 3F2UA 5T8IA 4AQ7A 4ODGA 1H9MA 1STGA 2WXLA 2D9UA 3PUVA 3O13A 1PTOF 4XYOA 3AMUA 4K5XA 4ZRZA 5FR3A 1QCBD 1CI3M 3Q24A 1XCQL 3IAS1 4MH8A 2FFKB 1QQRA 3AE4B 3NXWA 1BCPC 5EBDA 2K32A 2H89B 1SIJA 3PO0A 4ULLA 1HCZA 4X3TA 5F2DA 2W3SA 4LK0M 4KY5A 1BCPB 3BZDB 2C9OA 2B2UA 2HCIA 3LYYA 1FNWA 4NW2A 1WD1A 3I73A 3RFZB 4TQ1A 4F87A 3IXSA 1SXTA 3TN2A 3NVZA 2KOLA 3HEJA 1SNQA 1N60A 2QCPX 2IX0A 3ABVB 2L1AA 3Q23A 3NS1A 4ZRQA 3HRDD 1OXTA 3PO3B 1Q12A 2HCCA 4OIJA 4BA1I 3A7AB 3CHBD 1BOSA 2SAKA 2E2HB 5IGCA 4ZQ3A 1J7AA 4ARCA 1RJTA 2V3PA 5EKLA 2VUMB 4K6LA 1D1IA 1TY2A 4IFDI 1E6EB 4KKUA 1FNUA 1SYCA 3R93A 4DK0A 1SSNA 5KYLA 1B9MA 3A8KE 5D65A 3NRZA 1DGJA 1RCVD 4KMUC 3K5LA 3C46A 4ZOHC 2BB5A 2B2YA 3J7YW 2WNMA 2EVBA 4OZAA 1NR2A 1N61A 4WH4A 1B2TA 4QCLA 1WRIA 2RQXA 4ILWA 3U7ZA 2WXJA 3SK6A 3EJIA 3AEDB 4OVZA 1HTLD 4C1NI 4Z9CB 4YIJA 4CKBA 3FVQA 4DAYA 2QKIC 3CU7A 2Q8IB 2L32A 4IQZA 5ELDA 1CA5A 1K53A 1I4GA 1BR9A 5H8YE 4H7BA 1RTOA 2DYOA 1W6KA 1FO4A 5C3WA 1OO9B 3AB9A 2WXNA 4I65A 1FFUA 1K50A 2V3NA 3IAYA 3TEYA 1ROEA 3NTHA 3P20A 1QE6A 2F1MA 4NP5A 4CJ0B 1QOFA 1P7EA 3JAME 4M8AA 4QF4A 1NYRA 5FO9B 2J0TD 1KDBA 1Y8PB 3P42A 3AE2B 1FRDA 1SMYD 4MIUA 5D3IB 1I4RA 3ZYYX 5DAUA 1EZ6A 4CKEA 5BYSA 1YN3A 1SMYC 1IHZA 4H13C 4NAMA 2F0DA 1EFID 3K57A 2YU9B 2FMMA 3MXGA 2PO4A 4N6EB 4B9WA 4WORA 5DEHA 2B76B 1JQYD 3VA7A 4EQPA 2LHEA 1WTOA 3VR8B 2RSOA 1AFPA 3P1HA 3IFTA 1KNEA 1HUMA 4K2LA 4WURA 2BOSA 4JPSA 4JE3B 2BE5D 3M4OB 2LEKA 1F9QA 3PUYA 1GHKA 2J4XA 2EYOA 1LTID 1RM6C 3LB8C 2J52A 5CR3A 3DM1A 4OHJA 1WTWA 2FBWB 2KDMA 2BE5C 1SFOB 5EKKA 1EIHA 2XSCA 4GZYC 1C78A 1UWXA 1KNAA 4XIGS 1ONLA 1K51A 2WXFA 1R9TB 2K5PA 4X3UA 2NVYB 4DXFA 2QILA 3W1SA 4N59A 2QIEB 3PMFA 1GUGA 3QO2A 4DFAA 4OO1G 1SYEA 5CMDA 1BBXC 3LXFA 4YT0B 2AQ3B 2WV6D 2RKSA 1TVXA 3A56A 3PUZA 3ITPA 4IURA 4YXDB 5EPKA 2K5WA 1OFFA 1B53A 3RLFA 5IGFA 2PVGC 2WU5B 2IT1A 1SNOA 4HSPA 1LTTD 3J80L 3KLSA 3P63A 2L55A 2NWGA 2WDQB 3MFGA 2E74C 2F0WA 3FEWX 2YEPF 4NKLA 3NVVA 1CJEA 1OQQA 1EWYC 2Z4IA 4FXKC 4XT3B 1WCMB 1ET6A 5KNBA 5IGDA 2XVSA 2RDHA 3RUZA 4KGRA 2MUYA 3PIP3 3OSOA 3VR4A 2F0GA 2W54A 4F8MA 1PGBA 3NQIA 1LV9A 2NN6G 3Q8FA 4RCOA 2JZPA 2OT2A 2TSSA 1L6VA 3AEFB 4L63B 1NI3A 2JXTA 3BDCA 4D2KA 1QJOA 2WIIB 1LT6D 3GD7A 4HJGE 3K59A 4HSVA 5FOBB 3GTOB 3EGRA 4K5WA 2IW3A 2R93B 1S4ZA 5KIXA 1SE3A 4IALA 2MEKA 3NSWA 1N62A 1WTXA 1S5FD 2PZUA 5CC4A 2RPVA 1TWHB 4CGYB 4ZLTF 1EYCA 1O7YA 1SYDA 1B3AA 3SEBA 1RODA 1AZQA 2B8FA 1ENAA 5JEAH 1D1KA 2SEBD 1E9MA 5C4ZA 4RHRA 5GXGB 5EE3A 5ELBA 5EPLA 1NAPA 1OXSC 4WFN3 3J7AF 1TJEA 1ZXHA 1GXDC 1EEFD 1C4CA 4XDCA 3S1NB 3GTQB 5IIFA 1SBBB 3U52E 2K5QA 5C3EB 3H09A 3CQZB 5MPOA 2IPKD 2E2DC 1Q8IA 2J7ZA 2WDRB 4BY7B 5C44B 1A3VA 4US8A 2JQRB 3H6MA 3GB1A 2LKVA 5HHDG 3VRBB 1H9SA 1RYJA 3DWAA 4PNYA 2F0MA 3NHHA 1I4PA 1YJIA 3DWQA 4CQNA 2PYKA 1B4OA 2FUG1 1PRTC 2ICIA 4DXGA 1JR0D 1EY7A 1L0YB 1YMHE 2N88A 5HG2A 4UAIA 1QB5D 1NYQA 1A2UA 3I91A 4KY7A 3VR5A 1PRTB 1VZ6A 3QOLA 3VR3A 4IFDH 3BVMA 4K8IA 4XDXA 4BBRB 4A3GB 2BW2A 2MJ8A 2LFIA 4ZRPA 3LX0A 3S14B 5I2XA 1FCCC 2F0LA 1U9RA 1H9KA 4OO1I 3P4RB 1YQ3B 1H9SB 2PPBC 3QWNA 2N9KA 1EEID 3BVZA 5I4DA 2KCCA 3TP5A 3E6ZX 3NVWA 5D3DA 1QNKA 1C48A 1WSPA 1GOZA 1WTQA 4A3BB 2W55A 1JWSD 3R8BA 3RZDB 1SE4A 1W6JA 1ZXTA 2FJ2A 1L4DB 4C7ZA 2CHBD 4FXGC 1SJED 1Q3LA 1RDPD 2RA4A 5G3LD 3DWMA 1N63A 2INNE 5K5PA 5CV4A 1LT5D 1PXUA 3KBXA 1AYFA 1SDFA 1Y8OB 1Y69U 1STBA 1XWEA 1JWMD 3U9OA 3AEEB 1DOXA 1M8AA 3OOCA 5C5LA 1FMAD 4IKGA 3DHQA 5C2TB 1C76A 3WDNA 1HA5A 3KBGA 3TEWA 2ZXPA 2IGGA 3HVZA 4KHZA 2EY6A 2I2YA 3OW7A 1TYGB 1HFNA 4A3IB 4B08A 3L9AX 2Z4HA 2CJOA 4U68A 2D2CC 4BY1B 2R7ZB 1Q90A 1EQTA 1KFYB 2HDLA 2PW5A 3Q8AA 2F0SA 3FMCA 4P6VF 1PZID 1ZDXA 3K6OA 2WXMA 1TU2B 2FHTA 3D8GA 1GJXA 2A6ED 4QIWB 4A3JB 2A68D 2JX5A 1ESFA 1E2VA 2A6EC 4A93B 1HA6A 1DJRD 3SE0A 3E56A 2ZW1A 4GDKB 2L1BA 3QJYA 4R8NA 2XIWA 2SOBA 4G4KA 3R2TA 2YYZA 3AMZA 5DM73 3Q8EA 4JK1C 4PV1C 4DNTB 2NUCA 3MFYA 1BUVT 1E7PB 3AB5A 3PZ7A 1GUOA 1D5MC 3HKZB 1SNMA 3PV0A 2AQ2B 1HQMC 1UUPA 3GP7A 3I9V1 1J9OA 2XWJB 5BMHA 1EY6A 2INPE 2WKCA 5JPNC 2RVLA 2XN9C 4ITKA 5BN3A 3DWGC 1OXXK 4U673 4PT5A 1KDAA 1V1PA 2EY2A 3H94A 2EE1A 2AQ1B 2NZ1D 1KAAA 1C9FA 4JBWA 4CBVA 1U4LA 1WWTA 2KACA 4CJ2C 2RMMA 4A3FB 2F0FA 2G9DA 2L52A 3IL8A 4LLGM 4QUFA 4G57A 1QKZA 1BDOA 4BS9A 2K6AA 2CW0C 5KNDA 1KLUD 3H0GB 1RF2D 4EQOA 3AE3B 1DOMA 1CHPD 1E2WA 1V1PB 4TQ0A 3Q8BA 1JC7A 2RBMA 2MJEA 2LJIA 2LUMA 1ET9A 1O7LA 1GUNA 2PNRC 1JMLA 4XXEA 1CQFA 2QJLA 1L0VB 2EYMA 4TQUS 2IGHA 4CJ1B 2DY8A 4YTMB 2BA0A 1A6XA 2Z1CA 3AN1A 1FXIA 1F9RA 1LT3D 3DEOA 4JWSC 3A8JE 1L4ZB 5LL6S 3T53B 5BN5A 3BK1A 1EY9A 2RDGA 1C79A 3D4DA 2L5TA 3GV3A 2BDOA 1F9PA 1SYFA 4LK1C 4C56C 3SVMA 4XWWA 3MXUA 1STHA 4K5VA 1WTRA 3P4QB 4YSXB 1T5XD 1PTOD 5IGGA 1LTAD 5KGUA 1IGCA 1P7FA 4FF1A 5ELCA 4TSSA 4OZBA 4FO2A 1F2LA 2NMQA 1WD0A 3TUOA 2EDGA 2EJMA 2JWUA 1YQ4B 1KH0A 4KY6A 4J1MA 2C5CA 2KJXA 1STAA 1G91A 3PO2B 3MXNA 1LABA 4DQOC 2QF7A 1VJKA 2JA8B 1K8MA 1AZPA 5A2QL 3S15B 3EA6A 2HUGA 4S3SA 2F0KA 1ZUD2 3GTLB 1GAQB 2LS01 1V8QA 4LAAA 5C0XG 3N9YC 1I3QB 3A8IE 2BDNA 2K7VA 2M00A 1CZPA 4G7ZC 1OQRA 3E5SA 1UNSA 2KQ3A 1RHPA 3R3OA 3QOJA 1FCLA 1C77A 3W3AA 4LMQD 5T1IA 1G8ZD 3D4WA 3T56B 4A8XC 5FKAC 2KWDA 1XLPA 4HTHA 1RFKA 4RA8A 4KKIA 1XLNA 1MGSA 1CT1D 1PFBA 1PUTA 2IWHA 1YNND 1IYUA 5ISRA 4OIKA 3SR1A 3B9JA 1FD7D 5JVH3 2I46A 2L4NA 5JJZA 5LL6X 4MN3A 5C4HA 5KNCA 3NBHA 2SDFA 2EYFA 3BS1A 1IYVA 3W5VB 1R4QB 3M4YA 4ZYSA 1JE4A 5JXVA 4KTAA 2QDBA 3WCQA 1LT4D 5LNK1 4OL7A 2ZT9C 1N5WA 1G291 4PMCA 2PMVA 1S5BD 2JU6X 5CGKA 2WINB 1EWCA 3M7GA 1Q1BA 3T16A 2NTTA 4RF1A 4TMAB 1J7BA 4OO1H 1XLOA 1GB4A 1IL8A 5CORA 4GDLB 4J6HA 2F3VA 3NE5B 4YWGG 4F88A 3KK7A 2WP8J 3GTPB 2I07B 1F2ZA 1JOOA 3I70A 5H92C 1PTOH 2PTLA 1QT9A 1EYDA 1XX8A 1EZ8A 2WXOA 3NQTA 4ZUIA 1WTVA 4TKOB 5M5WB 3TP8A 1GHJA 4RGNA 2Y3AA 4FXCA 1R4PB 1HUNA 4C2MB 1YN4A 5FO7B 3AM9A 4XT1B 2X38A 1U4PA 1X3PA 1K8OA 1U4RA 3GTMB 1VLBA 1PMRA 3B2GA 1LO5D 3MXPA 1CK1A 4ID6A 1ACCA 2F0UA 1TIID 3MP9A 2SNSA 1VCIA 3S1MB 4XYQA 1SYGA 1I4QA 3TBIB 3HOYB 4MHEA 2EZVA 3KWLA 1S5DD 5BYRA 1FXAA 2Q8TA 2NN6H 2ZXRA 3TDQA 1I4HA 2JEBI 2XNAC 2LGIA 3J80E 4R3DA 1FR3A 1MI2A 5EGTA 2MJ3A 3NWTA 2F0IA 4CKCA 4XDDA 1XCTL 1DOIA 5JAVA 1JWUD 3AE9B 3KLRA 1EOTA 1FD6A 4C7YA 1EY4A 3U2SC 5J22A 2E3TA 1CZWA 1JOKA 1JWAD 1T6BX 2F0OA 1XF5L 4HMIA 4KJNA 2PKOA 2MPMA 3P1MA 4HKQA 2WKDA 3UI3A 1QOGA 2HTME 5C0XI 4HAEA 1ICWA 4IUVA 2IL8A 3P7JA 2PQEA 1DCZA 5I6YA 2M9VA 3E0JA 1VZ7A 2L83A 3D4RA 3MC0B 4IUPA 1JRPA 2K33A 1ZKOA 5AFWA 2K01A 5EJWA 3X3MA 3C1FA 3RZOB 1BNZA 3AE7B 4XQJA 2WXQA 4DA2A 2JYOA 3I4LA 3Q69A 5EE9A 2DNCA 3K5MA 2AWNA 4P16A 3NK9A 3T13A 4HEDA 2NVTB 3KLSX 5JOBA 1L5PA 4NJCA 1MVKA 2K03A 1PDXA 2TMPA 3V3XA 4ABNA 4Y7NB 1HFGA 3OWFA 1VRAB 2OEDA 1HTPA 1D5XC 4C3JG 3C3LA 3R2IA 1XYIA 4FF3A 2DNEA 3RMHA 4AS1A 3NTKA 2EELA 2A74C 5IGEA 1CHQD 2RSNA 1WGKA 1XLQA 3VRAB 1QWYA 3QB3A 4HCEA 1M4VA 4HEA1 1A3UA 1ESRA 2JE6I 4A90A 4O42A 1AP0A 2X69A 2YEPB 3W5UB 3OIQA 1XTCD 1VZ8A 2JYTA 2L9HA 1CTMA 1HEZE 3I4MB 4LTUA 3BDLA 3FPPA 4RF0A 1WVLA 1JROA 4WRDA 3C8YA 3IT6B 3T3NA 1KLGD 1I4XA 4HROA 5NUCA 3VYRA 1YJJA 2IGDA 5JEAJ 2WS3B 1NVID 1VF7A 4ZUJA 4IOIE 1B9NA 3HUIA 1PRTF 2PW7A 2JSOA 2QSDA 1ILPA 3ZQ4A 1YNJD 3Q6SA 2B2VA 5ELFA 3G6JB 3W9CB 4DU9A 1IUEA 3E9SA 2NTSA 1PFDA 1PYWD 1SE2A 4QMGA 4J8QA 1LTRD 2X6LA 4IUQA 4L8JA 2BYTA 1O7ZA 5FLXL 3HVDA 3WOFA 5CYUA 3MTSA 1F2MA 2B2VC 3H3VC 3FPUB 4ZKCB 2WLBA 3ND9A 2BCOA 1I6HB 4HR7B 4NAWB 1EYAA 1F9SA 5IT9L 3FRPB 4IFDJ 2N0SB 1LTSD 1TWFB 1DOKA 5CBEE 2WDVB 1XXGA 3V96A 4OGQC 2JYEA 3T51B 3HOVB 2EYJA 2EY1A 2KECA 1TKGA 3ERQA 4ZKBB 2LY7A 2J53A 1Q1EA 1YNTE 4KK7A 1ZE3D 5BYQA 1JALA 3BIID 4B0EA 3C2PA 1FM0D 5EBCA 2F0VA 2IX3A 1T3QA 1D4BA 1PLFA 4G7OC 4IUTA 3PUXA 3UI2A 4CHTB 2MH7A 4RAUC 1FGBD 2KVMA 2R92B 3HOZB 3SFEB 2B63B 4A3KB 3ZJTA 4RGMA 4C80A 1Y1VB 4NDXA 1G2TA 1ML0D 3VA5A 1WYGA 3DXJC 3BK2A 2WXHA 3SK8A 2KEEA 2NN6I 4K6DA 3TZUA 4B9XA 1PDQA 2E2IB 3A55A 2ICEC 5AUKA 2D5GA 2NYZD 3FDTA 3SHLA 2F0JA 1NCVA 3HS0C 4FF4A 1ZP0B 1OXVA 4BWGB 3HOXB 4L23A 1RD9D 2Y0SB 1ZEQX 3PIO3 4C3IG 5FK9C 2EPBA 1DOLA 3Q0AA 1NSNS 1D5ZC 1SNPA 4XQNA 2A68C 3J7AV 1TKWB 1UAPA 4XQQA 5BMGA 4HKZE 3VYTA 2EYLA 2JA5B 3N6RA 1EY5A 1I50B 2EJFC 2F3WA 5IODA 1XEEA 3J81E 2LMCA 1EU4A 3MHZA 3BYTB 1B44D 4DK1A 3OPOA 2VB2X 2CVRA 3MZ5A 1JB3A 1QNUA 2WB1B 1DZ1A 1F77A 2F0NA 3S1RB 3IFDA 1MBYA 2HQEA 4DN4M 2K3UA 3D3RA 3TEXA 1RKNA 1E10A 3LWEA 4HMJA 2KHSA 3IKJA 2XRQD 5M3FB 2CQAA 1C4QA 1ENCA 2PW9A 3L7ZC 5CV5A 2LMCB 2GI9A 3SR6A 4XTCS 5C5MA 1V97A 4N9TA 1VF5C 3ZJUA 1BMLC 1TZOA 4C1NK 1KTKA 4EQNA 2OHFA 1ZDVA 3D31A 3S16B 1Y1WB 2WQYB 2L12A 2ID0A 3I3CA 3L4PA 1TWGB 3OWEB 1Y56A 1FIQA 5C0XH 1TS4A 4DAPA 5E3FA 2A5HA 1IW7D 5M5YB 2V4DA 1PZKD 1Z6HA 5HFYA 5DNFA 3KF8A 3M3YB 4BBSB 5CV7A 3N52A 4QB4A 3CIRB 1JOQA 3URYA 4ZHPA 2N9LA 1BF4A 1KF6B 1BCPF 2AWOA 1FFVA 2DY7A 1JW9D 1AEXA 3H91A 1B1ZA 2W82A 2ON8A 2EXZA 2VNUD 3AH7A 1EIGA 1U4MA 3MHBA 4PQXA 5LHY1 1QOAA 3W2DA 3T4AC 3RPFC 3G7LA 1HXYD 4DF7A 4NZLB 1BCPD 1H9RA 3GS2A 3HG9A 2M0AA 5CV9A 2DWQA 1N5XA 2AUJD 2BTEA 4NMZA 3SFDB 2QMTA 4KGTA 3CWIA 3FC4A 3GV6A 3VYUA 2L0CA 4H0LC 4L1BA 3M85A 1PTOC 3SXHA 4Q2JA 4KD3A 1HZ5A 2LFNA 4C3HG 3U4EG 1C4AA 1TR5A 3NUCA 5BMIA 1BQQT 2MP1A 1PTOB 5M9OA 2E75C 3KQ4A 1SF0A 2DN8A 5K36G 1AW7A 3C1EA 1ZYRD 1AN8A 1LTGD 1BUIC 2WP9B 2BA1A 2ZW0A 1T5EA 1A70A 3FAHA 1ZYRC 1IGDA 4RGOS 4PMWA 3S2HB 2K0PA 2B2UC 4XE0A 1AWDA 4HN7A 1EY0A 4BA2I 3TP6A 3GO5A 2G1EA 2B39A 2JA6B 4KX6B 4KGSA 3CKIB 4OW0A 3DEPA 3MAQA 1GUSA 1GUWA 2GA4B 4IZ8A 3V2TA 2PVOD 3NZ3A 3OHXC 1Z7TA 4Q5VA 4KJOA 2KEDA 4C3JB 3VYSA 2A69D 1YNNC 1LLRD 2JSVX 1STNA 1XO3A 5HI1A 2BT6A 2A69C 4R9WA 5TSSA 1H9JA 4XWTA 1EWHA 1L0XB 3S2DB 2HDMA 4KN7C 4FXDA 1TS3A 2WXPA 2O2LD 4WAFA 3H8HA 2PZWA 2KN4A 1TKYA 2B2YC 1X32A 3AEBB 4A9AA 1NR4A 1MSGA 4ARIA 3SK4A 3J9CA 2EOTA 2MHVA 2BS2B 1F2YA 3AE6B 1F0ZA 1V43A 4K14A 2OXPA 5AUIA 2NBFA 4RGTA 4MT5A 3P75A 1E2ZA 5CV8A 5BN4A 1A2TA 4X3SA 1PZJD 4RHSA 4KD4A 2WXRA 1G2SA 3S17B 1A3TA 4ZAIA 2CU3A 5JPMC 1Y8NB 1GPXA 4WJWA 3K5OA 4O1NA 3ONAB 5E4WC 1VDZA 5CBAE 2MJDA 4MM3B 1L6UA 4QUCA 4RFBA 3DWPA 4IUUA 2R6GA 1JCKB 2ONQA 2PLPA 3P4SB 1B9RA 3EQLC 1NENB 1MPEA 2K05A 2Y5CA 1CA6A 4UDUC 1VDVA 3A7LA 5DM63 2F0QA 2F0PA 2PMZB 4TRDA 2JA7B 1SAPA 2CJNA 1HHVA 1MI0A 5EQ0A 1ZXIA 1B50A 5CV6A 2A73B 3JAML 4RH6A 1VR9A 2BB6A 3K7AB 1S5CD 5C4JB 2EYHA 3SDZA 4LJZC 4A3EB 1HZ6A 3TEZA 3BG3A 3L3OC 3KUPA 1YN5A 3Q22A 2DLBA 1DM0B 3T3OA 2DBYA 4YSYB 1WXQA 1E0ZA 4DAVA 1D2BA 3GTGB 1RTNA 5M5XB 3Q8CA 1D6EC 2WXKA 4JX1C 3NUHB 3AU7A 2KUMA 2WAQB 2K1BA 2KA7A 2BBCA 1CZGA 3HZXA 5G5GA 2M2LA 4ZK9B 3LWUA 4KHVA 2NVXB 2WU2B 4EE2A 1PGXA 3VR2A 2OEOA 5JVG3 5C4XB 4KV6A 2AX5A 2N55A 3FKIB 2FMCA 5A35A 1C4PA 1CM9A 3TZDA 2NB0A 2K04A 1KRHA 2IDYA 1DYQA 2O4XA 4L2YA 3EFXD 2DYMA 4A3MB 4A3DB 4G7HC 1LTBD 1JICA 2JXMB 1EL0A 3KWVA 3AE1B 1J7CA 3NPPA 4DNRB 3S9WA 4C3IB 1TS2A 1DOYA 1MHHE 5C3JB 2EJGC 3SK5A 3MWYW 3AECB 3HGBA 3VR9B 3I4NB 5IOCA 5FO8B 2PCFB 4RKBA 2RDFA 4AYBB 2H4OA 2L11A 4PMBA 1EM7A 2M19A 5EPJA 2BS4B 4REZA 2I38A 1CQVA 4FYDA 1NEKB 2MGSA 3BYYB 4V190 5IGBA 4EVOA 4K2KA 1VMPA 4IUNA 3IT4B 1FRRA 1KDCA 2FINB 1K52A 2AUKA 1Q10A 2V4IB 4L6TB 3LNNA 4B0MA 1V1OA 4M0WA 5FLXE 3X3NA 4RKLA 2IX1A 1ZPSA 1HRJA 1QOHA 4WIPA 4K8JA 5EE0A 3BVGA 2D5DA 5C6AA 3EUB2 1SJHD 3RD4A 1SNCA 2PIAA 3TSSA 3TP7A 4IN3A 5IT9E 4WWMA 1QILA 2VB3X 3OIPA 4F7XA 1QG7A 1MHXA 4OZCA 4Q0FA 1V8CA 2KCNA 3GTKB 3QG1A 3P4PB 2K9XA 1TY0A 2EKIA 1IBXA 3A54A 2B2TA 3GQBA 1R7SA 1YNJC 5I9OA 2F0HA 3MVVA 1F2RI 4FF2A 5HGTA 1ZOYB 3DMUA 4KN4C 4V0BA 5E1FA 2IJ0A 1IKMA 2WXGA 1EU3A 5D14A 2E6XA 3IAM1 5M3MB 4KKSA 1PRTD 2JEAI 5EKIA 3HOUB 2H1EA 3PUWA 5I2YA 4M1UB 3BWUD 2NVQB 2B2TC 2ENBA 4E6IA 1TS5A 4X3KA 1MD2D 2F0EA 2N7JA 2B8GA 1QLBB 3NTIA 1ILQA 4N9PA 2F03A 3GTJB 3AEGB 5KRUA 3QIAA 5E4XA 1IBXB 2F0TA 2X6GA 2K5DA 1C8CA 5J39A 5E6JA 5HURA 2SNMA 1QF6A 2KQ4X 3AEAB