2ICIA

Crystal structure of streptococcal pyrogenic exotoxin i
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
227
structure length
227
Chain Sequence
b'YEMSSVGVINLRNMYSTYDPTEVKGKINEGPPFSGSLFYKNIPYGNSSIELKVEMNSVEKANFFSGKRVDIFTLEYSPPSNSNIKKNSYGGITLSDGNRIDKKNIPVNIFIDGVQQKYSYTDISTVSTDKKEVTIQELDVKSRYYLQKHFNIYGFGDVKDFGRSSRFQSGFEEGNIIFHLNSGERISYNMFDTGHGDRESMLKKYSDNKTAYSDQLHIDIYLVKFNK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Exotoxin I
publication title Crystal Structure of the Streptococcal Superantigen SpeI and Functional Role of a Novel Loop Domain in T Cell Activation by Group V Superantigens.
pubmed doi rcsb
source organism Streptococcus pyogenes
molecule tags Toxin
total genus 67
structure length 227
sequence length 227
ec nomenclature
pdb deposition date 2006-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2iciA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2iciA01
5ELCA 2IPKD 2XRQD 1LTGD 1JWSD 1B1ZA 1G8ZD 1FNUA 3BYYB 1LTSD 3DWPA 1CQVA 1LTAD 1PRTC 1KLGD 1EFID 2TSSA 1BCPD 1V1PB 2AQ3B 1T5XD 1SE4A 1SXTA 2XNAC 5D3DA 1EEFD 5ELFA 1I4XA 1MD2D 1ET6A 3O13A 3R8BA 1LTTD 1V1PA 1UUPA 1I4QA 1LT5D 1LT6D 1PZJD 4RGNA 1S5CD 4BWGB 1YN3A 4RFBA 4C56C 3OWEB 5I4DA 1EEID 4L63B 1TS5A 5ELDA 1RF2D 5D3IB 1BCPC 1PTOF 2IJ0A 1SJHD 1CK1A 1SE3A 5FK9C 1I4PA 1LTRD 1D6EC 1I4HA 1B44D 2XRSD 1FNWA 2CHBD 1JCKB 2WV6D 3BVZA 3DWQA 3BYTB 1DYQA 1PZID 4TSSA 1RDPD 1PTOH 1RCVD 4RCOA 3MC0B 1AN8A 3EFXD 1JQYD 1V1OA 1TY0A 1S5FD 1PRTF 4Z9CB 3V05A 3TSSA 1PYWD 1XTCD 1PTOB 1S5DD 3DWAA 3URYA 4RGOS 3R2IA 3KLSX 1BXTA 3W2DA 1HXYD 1SBBB 1DJRD 4DXGA 5TSSA 2J4XA 3CHBD 1LT3D 1SEBD 1BCPF 3EA6A 2NTSA 4RGTA 1EU3A 2Z8LA 4RH6A 1HTLD 4DXFA 1TY2A 2RDHA 1LTID 1YN5A 1KLUD 2R61A 1PRTB 1FNVA 1LTBD 1LO5D 1QILA 2RDGA 1D5XC 1LLRD 4UDUC 1S5ED 1I4RA 3MFGA 1HQRD 1JWMD 2AQ1B 2QEJC 4RGMA 4ZYSA 5ELBA 1F77A 1D5ZC 1I4GA 3BZDB 1ET9A 3R2TA 4O1NA 1JWUD 1TS2A 2O2LD 2XN9C 1JR0D 1S5BD 1ENFA 1FD7D 1EU4A 1EWCA 1BCPB 1SJED 1HA5A 2QILA 4OHJA 3SEBA 1PTOD 1SE2A 1LT4D 1D5MC 3BVGA 4RHSA 1XXGA 2ICIA 5ELEA 1RD9D 4RHRA 1PZKD 1TS3A 4L6TB 1CHQD 2NTTA 5FKAC 1ESFA 1KTKA 1L0YB 2AQ2B 2SEBD 1CHPD 1GOZA 1PTOC 1AW7A 1M4VA 1PRTD 1STEA 1CT1D 2G9HD 4NZLB 3BVMA 4K6LA 1YN4A 1FGBD 1UNSA 1TS4A 3GP7A 1L0XB
chains in the Genus database with same CATH superfamily
3A7LA 3PUVA 2IPKD 4XTCS 1SNOA 1FNUA 1EF1A 1KLVA 1RTOA 3Q3OC 4A3IG 4YWKA 1J19A 2OJWA 3JYUA 4JOIC 3ML9A 1SSNA 4BFRA 2E2JH 3J80c 3VH4B 1T5XD 1SXTA 3ONSA 5IYDG 1KRHA 3L4PA 4KSKC 3GDEA 4LDTD 4MSQB 1B4OA 4AIMA 3Q8BA 2BKRB 1KM7A 1XLNA 1UUPA 4OIKA 3S1QB 4K0KL 2IYDB 1JB3A 2ZXRA 3M7GA 4DA2A 1EEID 4L2YA 4GKKQ 3VRAB 3DQVA 2ALYB 4XYCA 1F2MA 3M4YA 4NXMQ 4CYEA 3C19A 4DU9A 3AH7A 3ND9A 1K9MC 1N32Q 4ZHOA 3VH3B 4LF4L 1EY5A 1WTRA 2ACZB 1FVIA 5C2TB 1E7ZA 3G4SA 4DV1L 2HIVA 2JXMB 2WWZA 4A93H 2FHTA 2VY3A 4DV0L 4KHVA 1HFGA 4PMWA 1XT9B 5TR5A 1NR4A 4UY8C 3CMMB 1D3ZA 5E6NA 2IL8A 3I4LA 2WU2B 1WTWA 3HKZB 1XNQQ 4JC0A 4YTMB 1U4PA 4Z9CB 2KX3A 4ZYNA 2L1AA 3P4PB 1MHXA 4L5QA 1EUJA 1DONA 3RPFC 2K25A 1DOYA 3HOUB 3OW2A 4IJLA 2JA6G 2O6VD 1RTNA 2C9WB 1GM5A 3ITPA 1KXLA 4DGZA 3CSTA 1E10A 4DXGA 3H09A 3CCQA 5IYCH 1FFVA 4CO7A 4DR5Q 1WSPA 3VA5A 2G5DA 5DM63 1SFOB 4A3MH 3K0YA 4KHPL 4XXEA 1D2BA 2M0AA 5CX3A 4FJZA 4XDCA 1MGSA 4TV3A 2R93H 4MSMB 3BWUD 2F3IA 2PQEA 1LO5D 4X3SA 3P75A 5KRUA 1VQ5A 2UXCL 3TEYA 2AQ1B 1WZ3A 1YBYA 1FM0D 4W9EA 4GMVA 1WI5A 2WDRB 4JOIA 1YZ6A 1EOVA 2CW0C 4YHHL 1PFDA 4ICUA 4ASWC 1F77A 5LMUQ 1WF9A 1OTCA 1VJKA 4LUVA 4BXXH 3AFPA 2XN9C 2I0QA 1EU4A 2KECA 1IGDA 2J0JA 3TP5A 5IIFA 2WXGA 2JN4A 3LNNA 1R4MI 1QB5D 1UWXA 5BMGA 3CF6E 2WB1E 1N61A 2N7DA 1FCLA 1D5MC 4PV1C 5M9OA 2K22A 3F1ZA 1HR0Q 1BVSA 2O5IC 2CW0D 2INPE 3U52E 1SRUA 4RHRA 1STGA 1D8LA 2FBWB 5C4ZA 2RD0A 3U4EG 3S2DH 2DX5B 2AX5A 4LLGM 2KX0A 1XLOA 3M4OH 3SDLC 2O6VA 4OX9Q 2MH7A 1STBA 3TL5A 4OIJA 3QA8A 1TJEA 2YLMA 4F7XA 5G55A 5M3MG 2F0FA 1PHJA 3AE9B 1CA6A 3TMPB 3VR6A 5C4JH 4K6LA 1E7PB 1XX8A 1OXUA 3UI2A 2K9XA 1DOKA 2EKEC 3KDFA 4KD4A 2GBNA 4YWMA 3A7AB 2D62A 3S2AA 4YWLA 4JBJA 4ZRJA 3F2DA 4TKNA 3CW2C 3O65B 2O4XA 1KLGD 4ZKCB 1AZPA 2QCZA 4A3EB 3S1RH 5EE0A 4JWUC 4GKJL 2MBQA 3A9KA 3QJZA 1WMHB 3I7FA 3TBLD 3I72A 1XMOQ 1QUQA 2LZ6A 4DR3L 3L7ZC 4RGNA 5CV4A 5IGFA 2QDLA 2LS01 3UDFA 1UWMA 2K6DB 3OWEB 2PZUA 2LXJA 5ELDA 3I90A 2UYZB 1X3PA 1SNDA 4ALPA 1SJHD 4PZ8A 2KMAA 5C3EH 1F9PA 4FADA 3GQBA 3MHBA 4BAXA 1QKZA 3H6NA 4DV5L 4DK0A 3PSEB 4JI5L 3DHQA 5K36G 1WR6E 2PI2A 1O7LA 3HM3A 2XSCA 3ZW3A 3ZDMC 2H5XA 2V4IB 4A3CG 1RFKA 2N3SA 1X54A 3BU2A 2KWDA 3DVNU 3ZRFA 4A3OA 2WLBA 3GTMB 2KFKB 2WXKA 2JA5G 1JJ2A 5IE8A 4HCNB 4IWPA 3AECB 2REXA 1PYWD 4G3XB 4IOAA 2GVAA 4LUOA 4BA2I 3MP9A 1VF7A 3V61A 4QUCA 2R7DA 3SK5A 2DZIA 3T1YQ 1EYDA 1QVGA 3CCEA 2HDLA 4HPPA 3H3VH 1E1TA 5EPLA 4X65Q 5I6WA 2B2YC 3T56B 2N0SB 1TWGH 4DR1Q 2D3CA 3NQTA 3KUDB 3CF5A 2WACA 2NBUA 4RNAA 4ME3A 4RG1A 1EY8A 2PMZE 1YN5A 2A6HC 3CXCA 1Z47A 4B9XA 1SYCA 1DGSA 3OTOQ 1WYGA 3SVMA 1HZ6A 1H8CA 2Q2IA 4B3TL 4N9TA 3I4NG 2MHVA 4MTKA 4ZKBB 3S1NB 1FIQA 2GI9A 2JZ3B 2V9HA 1HQRD 3IRBA 2JA8B 1L4DB 5T1IA 5JXVA 4HPLB 1NSNS 2A6EC 2OCEA 3A8KE 1YD8U 5HG2A 3M3YB 3NY5A 1PGAA 1SYBA 4FDBA 1D5ZC 3RD4A 4LNIA 1WGRA 4A55A 4OWTB 3DM3A 3K5NA 2XIWA 2V3PA 4ANVA 2KBNA 5JJLA 2MEKA 4DR4Q 2L76A 3LGJA 5AZGA 2K5WA 2QILA 1PH8A 5M5WB 2KJRA 4FXGC 2IGDA 4RM9A 4PYZA 1SYGA 2A6ED 5AEKB 4KZCA 3QAQA 2XVSA 4C3JB 1DOXA 2ASBA 1QNKA 4R4CA 1VQMA 2F0GA 4C3HG 5CC4A 4B3SL 2EYPA 3P20A 3KUZA 3L9AX 2WXNA 2WXIA 4QJFA 1NR2A 4LF7Q 2R7ZH 3N1XC 4BBRB 4DR2L 3UDIA 1QG7A 2DAJA 1KRSA 1RHPA 4JG2A 2HD5B 4Y7NB 1PRTD 1N33L 1K3BC 1STEA 1FPYA 1K8RB 2Z1CA 5I2XA 2J52A 2DNCA 1RIPA 3E6ZX 2ZCBA 3I4MG 4LNOA 1AWDA 4MJSA 1M8AA 4H02A 5EE3A 2KEDA 3RD2A 2BVCA 3AULA 3ZTDA 1UELA 4LWCA 2VQEL 3T3NA 1QOHA 3DMUA 4KHZA 1V1PB 2B2YA 1TZ1A 3HVZA 1HFNA 4A93G 1V8QA 1I4XA 2K32A 1FL0A 2WDQB 2IGGA 2QHOA 3NS8A 5BN5A 1ZDVA 1KAWA 1KNAA 4HDOA 4ITKA 4M8NA 1F2YA 1I4QA 4IO9A 3IAM1 2VUMB 3LXFA 3QX1A 3Q24A 1GO3E 1A62A 1V43A 1K8AC 2F52A 3K7UC 1T6BX 4HIDA 3TREA 4A6QA 2H4OA 3N6RA 3CCMA 2MNAA 4GGQA 4KDIC 1I4HA 1MHHE 1JWBD 3RN5A 3FHWA 5HURA 1VQDA 2D9UA 2PJHA 3EGRA 3NTHA 4B3ML 4OZAA 1HHVA 4ANXA 3PUXA 1EO6A 1O80A 1RDPD 2EIFA 2LGXA 2MWSB 3M7NA 1Y8RC 5IYCG 1V5OA 2CJNA 1Q3LA 4K1RB 1R9TH 1RODA 2D0OA 4AYBG 2YTVA 4CDEC 4ZUIA 4XGAB 4B0EA 5ISRA 2X69A 4K5WA 3RNBC 1ICFB 3HOYB 2RMMA 3GE8C 3E0EA 4PG3A 1NJIC 2R93G 5HGTA 1SNQA 4A3BB 4LW1A 3ZNHB 2PPHA 4O0AA 3P1MA 2KN5A 1P3QU 2LXCA 3HFZB 1B53A 3S1RB 1EQRA 1K8MA 5FJ8H 1ZW7A 1DJRD 5DLQE 4JI8Q 2V1YA 1MSGA 3K5MA 4BXXG 3R7QA 3GTOH 3QJYA 4KDLB 4A20A 2CR5A 1K0SA 2XEWA 2NVXH 3EQLC 3WAMA 5L83A 2M8SA 3NSWA 3PMFA 5A35A 1R4MB 2C7MB 2LGIA 2MQHA 3UQAA 2SDFA 4R4IA 4LF5Q 3KK7A 2B2UC 2IT1A 3PUZA 2WB1B 4UDUC 5FOBB 2Y5CA 2DYMA 2KVRA 1I94Q 3OSOA 4X62Q 4HCPB 1VZ7A 4JPSA 2KKCA 3BZKA 2LSSA 5JJKA 2BYFA 5ELBA 2XWBB 4ICVA 3TIXA 1QOAA 3K7AB 4GLAC 3KYHC 5A2QE 2UWQA 4RF0A 4W9HA 2KCCA 1II3A 1JWUD 2ZW1A 5CHVC 1DGJA 2GA4B 3VHTC 2EY2A 3HVDA 3U30A 4YIJA 3P63A 5IP9G 5BN3A 1MG8A 1MKHA 4MEMA 4LDTB 1O78A 3TBIB 1GUOA 3AU4A 2J0TD 1BNZA 3H7SA 2UXDQ 4ZRPA 3PIPA 2ONQA 4F7ZA 3KLRA 5E3FA 3CCUA 3W9CB 3CU7A 3IHPC 1C8CA 3H0GH 3RN2A 1RM6C 1J6QA 2BWES 1WCMB 1A5RA 3MEHA 3F2BA 2FUG1 3V96A 5CBAE 4KY5A 2D2CC 2KNBA 3RZWC 1GPXA 3D4WA 4A3PA 3L10B 1ZUD2 1RLFA 1WXVA 2G9HD 2PZTA 3S1MB 3BVMA 4CDCC 5EE1A 3OHXC 1FGBD 2JA7G 2IX0A 1NENB 1BQQT 1C77A 5JEAH 3AFQA 2XRQD 4XE0A 1IYFA 3SHQA 4QL5A 2LWPA 1NBWA 1JOQA 1B70B 1QNUA 4N8X1 3A9JA 1J9OA 3EC8A 2BYTA 2L1BA 1QQRA 2NR2A 4P2CB 3C8YA 3DVGX 4ZLTF 4IM2A 3U50C 5G5HA 4BVUC 2RHSB 4DWFA 1PXUA 3GTJH 4KLKA 4JX1C 1HQMC 5CV7A 4JVZA 3PF5A 1QVCA 4LMQD 2AUJD 4BBSB 1R4QB 3E9HA 3H6MA 1ILPA 3HGBA 1GVPA 2B2UA 3TEHB 4YY3Q 4IJHA 2CU1A 2IO1B 5BMIA 5D3IB 2IJ0A 1I5FA 4N8FA 4WJNA 5L37A 2QKIC 2G45B 5GQOA 2UXBL 1WXMA 3VA7A 3HOXH 2N88A 3DBRB 2IO3B 4QMGA 5DPTA 3Q8EA 4B9WA 3C3LA 1GUSA 1CA5A 5ELNA 4APVA 1W3SA 5H92C 4FHJA 4RF1A 4IC7B 3AEVA 1G6PA 4JI0Q 5M5XH 4JCVE 3PLVA 1Q81C 1Y1WH 4A3GB 1X1MA 1HCZA 2NVYB 1UBIA 2PMZB 2I46A 4E3CA 4O42A 4KKIA 1PYSB 1P16A 1S4ZA 1PH3A 2JK8A 5IWAL 4DUYL 2RDFA 3RMHA 3TRZA 1MVKA 2Y3AA 1NAPA 4KGRA 3X23A 3FKYA 4AJWA 1NMFA 2BE5D 3HK0A 3HOVB 1CFMA 1BCPF 4HR7B 3QG1A 4ILWA 4C2MH 1JW9D 2W3RA 3QC8B 1HTLD 1OFFA 5BMHA 3HOWH 3AE8B 1G6JA 1KLUD 1FR3A 3FMCA 1YIWA 2R61A 1IBKQ 1ZGUB 3I3TB 4G7ZC 4KSLC 1EY4A 1NEKB 4QB4A 3PV0A 2HCCA 2DENB 1OXSC 3JAME 3AE1B 4JW0A 1XPUA 4OELB 3STBC 4CJ0B 2N9LA 2QC8A 4R9WA 5JZEB 2B2TC 3BK1A 2R7ZG 2EVBA 1QVFA 2O5JC 2BPSA 1S40A 3M95A 2TMPA 1SNPA 4EZJA 1WM2A 3LWUA 4C3IG 3DVNV 4QY7A 1NE3A 4HWIB 4XDDA 4YT0B 1UWVA 2RR9A 1EZ8A 3RNEC 3HG9A 3PO3G 3SHLA 5IP7G 4IPDA 4B3RQ 3GTLB 1X6OA 2DYOA 3K9OB 4LFBL 2ZTCA 3NE5B 2RCNA 2FE8A 2KDMA 2LHDA 3RNFC 2JXXA 4EEWA 5AFWA 1IPGA 3ZDTA 1S3OA 4RKBA 4YSXB 2KUMA 1WYWB 3UQBA 2E76C 3L17A 4DNRB 2GB1A 3VTUA 2EY1A 3BK2A 4UHVA 1JJCB 2V1CC 1VQPA 4MNOA 3QR8A 3I5JC 4YL8A 3RNCC 3JAMi 1I50B 4KKJA 4P75A 2LI5A 1VMCA 3I55A 1R4NI 5AZFA 1HJPA 2NVQB 2NPTB 4II3B 1YITA 1J7CA 2OXPA 1JWSD 1K8GA 3GOEA 3ND8A 2YV5A 3AQQA 3BYYB 2V4DA 1LTSD 3EN2A 4DF7A 4DNTB 3S1QH 4GSWA 1YIJA 4ZRQA 3L3OC 1PH4A 1JMCA 2F0NA 2TSSA 3K0XA 1IBML 4FJYA 1LACA 5ELFA 3AE7B 1STAA 2LRUA 3U9SA 5BYRA 1ASYA 3AEEB 1PH5A 1Q82C 4BWGB 1S5CD 1C76A 5I4DA 3MXUA 3LB8C 2EPBA 1L2NA 2WXQA 2EOTA 3OMCA 5DPRA 1PTOF 5AUKA 4BKSD 2HJ8A 2BCOA 1PH9A 1VQNA 1CK1A 1OEYA 1Z5SB 1HUMA 2K5DA 1IKLA 1IZ6A 1I4PA 2B2TA 2G9DA 1FMAD 5JHBA 1NY4A 4DV3L 4C7YA 1L6VA 5FLXc 1JCKB 1SIFA 4WQMA 1EZ6A 3T53B 2PYKA 2PW5A 5FJ8G 4JI6L 3P4RB 2JRHA 2KMCA 3HOUH 1KD1C 1Q86C 3MJWA 5I9OA 3DHGC 3DVGY 4IFDH 2F0OA 1ENAA 1TY0A 4M1UB 2BBCA 1IGCA 1CKMA 1TZOA 2CHZA 1YNXA 3M63B 4BBNC 3GV6A 3GD7A 4Q5VA 2HDMA 3H1UA 3BY4B 3BDOA 1SFOH 2JZZA 2Q8RE 5M3FB 3WAOA 2K39A 5DAUA 1TKGA 5BO4B 5KHQA 4R1JA 3H8HA 4JWSC 1O7IA 1XMQL 4JI1L 1PH6A 2DYBA 1QCBD 2NBWB 3GE3C 3CHBD 1XNRQ 2LXKA 3PO0A 5J18A 4LJOB 3I3CA 1MFWA 2N9KA 3QARA 1QZGA 4OZBA 1A70A 3NVZA 3L08A 3ZNZB 2F3WA 1PRTB 2GVBA 2H1EA 1JC7A 2KA7A 1GAQB 1SN8A 2NN6G 5LMNW 1QE6A 2ES2A 1AEXA 2G1EA 3IFWB 1I4RA 3NVVA 2BH8A 5JPNC 2WDVB 4LF4Q 4BKSA 2LEKA 3NZSA 1D1IA 2KO3A 4L8JA 2QEXA 2WKDA 1RL2A 1ET9A 3CRLC 3H0GG 3MXPA 3R2TA 3RUZA 1E3PA 2AWOA 2Z9HA 3E56A 3MC9A 2CVRA 2EYJA 4DV0Q 3R7RA 1PDXA 4KN4C 2A68C 5C44G 4LCDE 3MZ5A 4GDKB 1K52A 3GTGB 3OMGA 2F0TA 2R7FA 1Y1WB 4JV5L 2K4KA 1WGYA 4HXDA 2EXDA 3K57A 2ZEQA 4RHSA 2M9VA 4HLEA 2VZKB 2Y5PA 3RN9C 2X6LA 1HNXL 2DZMA 2DAFA 2MRPA 4IQZA 1B3QA 4K5XA 5JEAG 3ZLZA 1VQ9A 3H91A 4HRSA 2KWCA 4E74A 3ERSX 3FVQA 3MVVA 2QSDA 1CHPD 1U0LA 4A9AA 1CJEA 1L4ZB 3GO5A 1TYGB 4IZ8A 2GBKA 3GV3A 4AQYQ 4WAAA 3U2SC 1BBXC 2OEOA 4OEMB 5E1FA 4BY7G 1R4PB 4NXNQ 1ROEA 2LD9A 2N7JA 4A3EH 1Q8KA 2NVUI 1EIGA 2N7EA 3T13A 3SK6A 4G7HC 1WTHA 2MLBA 2MCNB 4FBJB 2LHEA 3PSIA 2UXCQ 3TDQA 5KEEA 3AEBB 1L2FA 3CRKC 4A3KG 1JWAD 1ZXIA 3NZUA 4ANUA 4YHHQ 2BH2A 2K5HA 3FKIB 2XWJB 2VB3X 4GLVB 1J5EL 3BDCA 4FF3A 2E6XA 4XQQA 2IZVB 3S15B 1FRRA 1BUIC 3HIZA 1V1PA 2OJRA 1LT6D 2NYZD 4A3LH 5GAEC 2A5UA 1TWAB 3VYUA 2Y0SG 1HE8A 4RKLA 1DCZA 2F0MA 3X3NA 5IT9E 3UF8A 2K33A 3T1HQ 2YU9B 3GTMH 2E5LL 1HTOA 1LTRD 3ML8A 1F0ZA 1B9MA 1GJZA 2BGFA 3G6EA 5KNCA 3BVZA 3Q6SA 4ZDVA 1QLBB 2BB5A 4DHZE 2K5PA 1Q1EA 4P16A 3H3VC 1V8CA 1AN8A 2KTFA 2MBHA 1H9SB 2VH1A 1FXIA 2JX5A 3DHIC 1VQOA 3PIOA 3HOWG 3CD6A 4OVUA 2VS1A 3HOZB 2GRIA 1SYDA 1HR0W 3WA0A 1HPCA 1XTCD 1D4BA 2F0SA 1CZGA 4EE2A 2CWPA 1VR9A 4K8IA 1PA6A 3AE4B 2FFKB 1MSHA 4HKQA 3NENA 1HXYD 1AH9A 3V6CB 2DN8A 2NZ1D 4GKJQ 1KL9A 3HS0C 1E2ZA 1YEZA 3S1NH 3ZXVA 4AYBE 1JALA 2RSNA 2E8GA 2JA8H 2JZPA 1EU3A 4K8JA 2K0PA 3M3YH 4JI4L 4LFCL 3UI3A 1CZPA 3WOFA 1LTBD 3E0JA 2HTME 2IO2B 1LLRD 2MP1A 2PW9A 3VUXA 4NPNA 4QCLA 2VW9A 2J7ZA 5M5WH 4AOFA 3Q22A 4I7AA 4RGMA 2PLPA 2WGSA 1BDOA 1F2RC 4JI5Q 3DCGA 3L16A 2BA1A 2F3VA 2BS3B 4LF6L 4NJ6A 4C3JH 2KLCA 2UUCL 1JR0D 3K81C 3PT2B 4GXBA 3IXSA 1HA5A 4YTPB 3PREA 3KF6B 3IT4B 2WXFA 4RA8A 2OT2A 4P73A 1JT8A 4BBRH 5C5MA 3SR1A 1ZYRC 1XXGA 4KJNA 4QUFA 2KFJA 2QDFA 1R4NB 5HGQA 4OZCA 4Y7NH 3VTWA 3N32A 4WJWA 3IVFA 5D7GA 2MUYA 4K3BA 4IUQA 4BS9A 2C35B 2AQ2B 4I7ZC 1QOFA 3PUWA 3N30A 3V2TA 1M94A 1CZWA 1FEHA 2Z0DB 1TT2A 1FD6A 4FXCA 2DJFC 1VQ7A 4AS1A 1ZYRD 3ZQ4A 1IW7C 4DR6L 2M56B 4IUUA 2BS4B 1IL2A 2WP9B 1DXMA 4IW0A 3HEJA 3TCAA 2LY7A 1ML0D 1EQVA 3I4OA 3VYTA 1QWYA 3VUYA 1X3EA 1M1KC 1A2TA 2N55A 4B3TQ 3EECA 3RUIB 2PCFB 3J7YW 1K73C 2B2WC 2CH4W 2JA9A 3W5VB 3DWPA 2PMVA 4FF4A 2Z59B 1B3AA 4HCEA 1IW7D 2VUMH 5C0XH 1WJUA 3HKZG 2CHWA 1C7YA 3SDZA 1ZPSA 1SE4A 2RCFA 5IAAC 2JXTA 1MD2D 4IWOA 1BUVT 3ZJYC 1N60A 1L0VB 1X55A 2NB0A 1JROA 2JJQA 1WE7A 3VAWA 1L1OB 2L05A 1Y8OB 4RFBA 4A75A 1TT5B 2K75A 2L8JA 1WX7A 2YEPB 5D65A 1MBYA 5EPJA 4CKEA 3I57A 2K28A 1SE3A 5C6AA 1JMLA 1PLFA 2PQAB 2MJEA 1LGRA 2XRSD 3V3XA 2CHBD 2WV6D 4CGYB 3HOYH 3DWQA 1L5PA 2N8NA 4DR2Q 2KQSA 4FHKA 4IOIE 1DYQA 1YHBA 3T4AC 4A3BH 2OEDA 3W1YA 4GNXB 5KIXA 2NBFA 2RBMA 3T9LA 5IA7A 5LMNL 3EFXD 4DPGA 2NZOA 3QIAA 1QT9A 1V1OA 1VLBA 1HZAA 4G57A 3NQIA 2Q8IB 1AARA 4ZK9B 3C0RB 2RGFA 3ULPA 2MJ3A 2F0KA 3TP7A 3N1ZC 4BY1G 3AYHB 2HD3A 2HQLA 3CCSA 3C46A 2ZVNA 4W9DA 2VRRB 2KJXA 5GADC 1EY7A 2LXAA 1HA6A 2B3GA 3VR9B 1TGZB 3PZDA 4DNIA 5J17A 3MTNB 4NNJB 3W2DA 4ARCA 2D3BA 1F52A 4NAMA 3NUHB 3KBGA 2N9XA 2IY5B 4ZUJA 1LT3D 3S24A 5E4WC 4GKKL 2KDBA 4NXML 2DWQA 4A3FB 3S2HB 3PZ8A 5FO8B 1FRDA 3K7AH 4Q0FA 3ZO5B 3ONAB 1ZXHA 3SFEB 3G7LA 2B2WA 4GLSC 2IY1B 2ZW0A 3J81E 1P98A 3IT6B 3CAMA 2L0TA 3PTFC 1EM7A 2IWHA 3I4NB 3PHXB 1WE6A 4FYDA 4RMFA 1LM0A 4JE3B 3OPOA 1PMRA 4HJ8A 2EZVA 1NVID 2C7HA 4FJVB 1SE9A 1WJJA 1DD2A 2A73B 1V80A 2CHXA 2X38A 4URKA 3DBSA 4OHJA 2LKVA 1Q1OA 2HQEA 2LUMA 1SE2A 1U4LA 1WCMH 1Y8NB 2EJFC 4HSVA 2E3TA 2IHEA 4GOPB 2L7RA 3V62A 2R2OA 1BO0A 2VQFQ 1KNEA 3QO2A 5EKIA 4L6TB 3S17B 4ID6A 3TN2A 2NTTA 3BG3A 1MHWC 3S1MH 4HJ7A 2V3NA 1KFYB 4FXKC 5LHY1 5FO9B 1WTVA 2E2IB 4M8MA 3AE2B 2WXMA 1EWHA 4PZ7A 2JEAI 2CKZB 1E8XA 1AW7A 5EQ0A 1VQBA 3VR3A 1IBXB 3J81i 3CMEA 1CUKA 1WFYA 1OXVA 3M85A 1DOIA 1HTPA 2ZVOA 1UNSA 1STHA 4KD3A 3I56A 1QZEA 2PNRC 4LF8L 1U9RA 2MSED 2NPTA 3V6EB 1PRTC 2C5CA 2WKCA 3RNUA 4NAWB 4BBSH 1WRDB 1BCPD 5C23A 2BDOA 3AM9A 2KVMA 1I42A 2PI2E 4K2KA 1EEFD 1LYLA 1XWEA 2EELA 1HR0L 3AE6B 2ZXOA 3SXHA 2KEEA 2JP1A 1OTRB 2AL3A 2G3QB 1Q5WB 4A3DB 4M8AA 1IXRA 3AU7A 2HUGA 2Q5WD 5KYLA 2W82A 5H8YE 3MA2B 1BR9A 1RF2D 3DM1A 3PGZA 1U4AA 1KDBA 3Q8DA 1YQ3B 5FK9C 5G5GA 4GIVA 4UP9A 1OXXK 1WR1A 1N6ZA 4A3GH 5C4XB 2NCNA 2NVYH 2JWZA 3P42A 4HSPA 1K53A 2R92H 4NJ7A 4S0RA 5HI1A 3ZTCA 1W6KA 4CKCA 2DJGC 3J81L 3FP9A 4L1BA 2JA8G 5MPOA 1JE5A 2RA4A 4PS7A 5KNDA 2W55A 3SK8A 4ABNA 2ZT9C 3Q69A 4AYBB 1H9KA 2UU9Q 1E9MA 5D14A 3CCJA 1SB3C 4FA6A 4CJ1B 3NBHB 4YWGG 2AHOB 1QJOA 2CCZA 4U673 3HOVH 2VZKD 5KHOA 1WOCA 4DKAC 2KHSA 3D6WA 1SAPA 2KDFB 3OWFA 4XWTA 3U8ZA 1VQIA 5IOIA 1F9SA 3RZFA 1P9DU 4IPCA 3FEWX 2NS5A 1TIID 4CJ2C 1G51A 1OO9B 4CHKA 2WINB 1SEBD 2WAQG 5JJIA 1E22A 1H9JA 4DXFA 4PQXA 4NY0A 2QDBA 4R4OA 1Q8IA 1GUWA 2L15A 2G4SA 3KOJA 3D4DA 3UIPB 1OQRA 1ZDXA 2M4NA 4A3MG 3AB9A 4TQ1A 4OO1H 3KBXA 2UXBQ 3FPUB 2HJ1A 1C3TA 2FMMA 2K3UA 3DPDA 3GTLH 3ICEA 4WIPA 1P7FA 1YOVB 2O2LD 3A1QA 2NVTB 1ENFA 2KCMA 3Q3FA 5FR3A 1EWCA 2E75C 4X3UA 5IGEA 4K7SA 3I70A 1YHQA 1PTOD 5AZHA 3HUIA 3PLUA 2NN6I 1RD9D 3PZ7A 2L12A 4GDKA 2MW5A 4X65L 2JYEA 3OYYA 1G291 1C4PA 3FC4A 5FKAC 1I50H 3PO2H 2D07B 4LUZA 5IWAQ 4DUYQ 2JVCA 3L54A 5EE9A 4X64L 4KX6B 3NPPA 3TMEA 2NVQH 2VUMG 4MT5A 5C0XG 1YNJC 1RWSA 3OTOL 3IFTA 4IPGA 3BINA 1NNXA 1VQ8A 4K2LA 4POGA 3PGEA 1TXYA 4LF9Q 1V86A 2FCMA 3D32A 4P7IA 4US8A 4GN1A 2EJMA 2EYHA 1E8ZA 1PV4A 1PGXA 1PVOA 2WDTB 2JA7B 4F87A 1LTGD 2LRWA 3IL8A 3NELA 1JICA 1HH2P 1LV9A 1YNJD 4DR4L 2FJ2A 2PIAA 1UF0A 3M4QA 1Q90A 3CIRB 2KTRB 1HRJA 4HKZE 1WTOA 3HOYG 4OVVA 4AWJA 1MI2A 2N49A 1P8LA 1IKMA 4WFN3 1RKNA 5I2YA 1ZKOA 1BT0A 5BYSA 3IAS1 4JI7L 2I1JA 4FP5D 4KJOA 4W9LA 1C79A 1GNUA 2J42A 1FYCA 2KZRA 1LT5D 2UUBQ 2B63B 1V2YA 4JQWC 1YN3A 4C56C 1GG3A 3G48A 5LL6S 1JRPA 2ZCCA 3FILB 3RLNA 3KJOA 1TS5A 1EIYB 2UUAL 4LFBQ 2F0DA 2KOLA 1WH3A 5BN4A 4N6EB 5M5YB 1EQTA 3A5UA 1XCTL 2FXQA 1E8WA 2N9PC 2ZJRA 2RDBC 2KQ3A 1E24A 1MG4A 3BYTB 1TWFB 2D11A 2KVZA 4REZA 1PZID 3N20C 1Z7TA 1K0RA 1Q46A 5C3EG 4XT3B 3WOEA 4JIOU 4TMAB 3P4QB 4OL7A 1JQYD 5M3FH 4DV7Q 5D2MB 5DPWA 4M02A 2Y0SE 1YVCA 1UE7A 1F1HA 1RFAA 4HROA 3GTKB 2JQRB 2KHWB 3E3XA 4GDLB 1NYRA 1EL0A 1H9SA 2SNMA 2OHFA 4OVZA 2C9OA 3NBIA 3URYA 2HHHL 1VQJA 1TQOA 1X3QA 3UE0A 2KT7A 1SF0A 3X0WA 5E6OA 4NMZA 1WTPA 5BR8L 1IBMQ 3NHEB 4MH8A 2MBOA 3ALBA 1CM9A 4EZKA 2QJLA 1L6UA 2GOWA 4ZRKA 3F8TA 4A4IA 1C4QA 2OOBB 1BF4A 1XJVA 3VDZA 1K50A 2HCIA 4DFAA 1X9NA 4C7ZA 2KHIA 4G7OC 1QILA 1WXAA 2ZPNA 5JOBA 4J8QA 1VQKA 5JHAA 2F0VA 2K8CA 2BE5C 5GAGC 3BDLA 1C0AA 1L1OC 3GTGH 3SU8X 5A2QL 1MI0A 2ZNVB 2R92B 2K01A 3K80C 4LK0M 1TU2B 3KWLA 3VR8B 1FD7D 4JYAQ 4MDKE 3GTPB 2E2HB 5GAHC 1WIAA 2BKFA 3B9JA 3KUCB 2EE1A 1N36Q 3UE1A 3AB5A 4IUPA 4C3IB 4L5TA 1FCCC 1EY9A 3RNGC 3LX0A 2K8BA 3K6OA 4NW2A 4LFAL 5EKLA 3L0OA 4GNXC 4UP8A 3KF6A 1WD0A 1K83B 2OF1A 2Q2UA 2KAJA 3DWMA 5IP4D 2JSOA 1C4AA 2AYOB 4DV6L 2L11A 3SFDB 5L95C 3QOJA 4DV2Q 1XMQQ 1GOZA 4JI1Q 2LGDA 1TKWB 2J0MA 4FN2A 1CSPA 1JQ4A 4YCUA 3N3KB 2F0QA 3FKIH 4YXDB 2VZAA 4A3IH 4X62L 1SNCA 2WFWA 1PDQA 1TIFA 1JE4A 5I9PA 1OQYA 3S15H 2KYWA 3W1SC 4J6HA 2MBBB 4HMIA 3EBEA 4WJ4A 1WGGA 1B1ZA 4GB9A 1G8ZD 4KGTA 4C4VB 4EKUA 3NEMA 3KLSA 1W6JA 3N9YC 1CQVA 4K3CA 4II2B 1TWAH 5C4HA 1FXTB 1P7EA 4AUQC 2FINB 3NHHA 4MGYE 2KD0A 4DAMA 2YU9H 3UGBB 2LASA 2FMCA 1V1QA 1PZJD 2L9HA 4JV5Q 4DDGD 2Z4HA 3J80i 5CV6A 1SGHA 2JSVX 4L63B 3QOLA 1SIJA 2IBIB 1HNXQ 2F0JA 3PO2B 1EUVB 1L1OA 2Z4IA 1AYFA 2XK5B 4OXPA 1VQCA 1XLPA 2EDGA 3DEPA 3HKZE 1G91A 3NVWA 3S16B 1B44D 4PT5A 3TEZA 1E6EB 4GOPC 3Q2AC 5JH5C 2F4VL 2SAKA 3HOZH 1WXSA 3KQ4A 5JPMC 1WY8A 4W9GA 5T8IA 2PQAA 3C1FA 3P7JA 2MA9B 1RCVD 2LFNA 2FIFA 3GTQB 1KOTA 3CC2A 2AEHA 3FRPB 1FGUA 1WJNA 1YNNC 3Q0AA 3RYTA 2PNHA 4ZAIA 3R3MA 2JF5A 3IG3A 5LNK1 4K6DA 2FIDA 1KQSA 1UGMA 4TKOB 2EYLA 3DWAA 4F8CB 4RGOS 4OO1G 1WMHA 1EYGA 4WURA 5J22A 1T9HA 3L13A 2FNJB 3SE0A 3VFKA 3VQIA 3M3JA 1Q7YC 1J5EQ 4V0BA 1GUGA 1N5XA 1YNND 3MC8A 1GB1A 2J4XA 2BF8B 1J8IA 3U4ZA 4R4QA 2K1FA 2KMMA 1TWCB 4LK1C 4XYQA 3H7PB 3BS1A 3CC7A 1CKNB 5CORA 3W5OA 3J7ZC 2KACA 3W1SA 3ZKJC 2B39A 3JAML 3NTIA 2B3AA 3MFGA 2PE6B 2VB2X 2JEBI 3KH0A 1YNTE 3EROA 2E5LQ 1V9JA 4K81A 1YJIA 4ZYSA 5IY0A 2KFKA 3W5UB 4AH6A 3AEGB 2EQSA 2ZZPB 4DHJD 4RM8A 1CKOA 2WXRA 4LJPB 1E8YA 2WQYB 4TQ0A 2BW2A 1BCPB 2F0PA 2EY5A 1B9NA 4DXAB 1X56A 4XYOA 1YHAA 3W3AA 3SGIA 1ZKHA 3WCQA 2VNUD 2K5NA 2C7NB 5BYQA 4QIWE 2GBJA 1YJ9A 4DN4M 4LAAA 4JBMA 1UE5A 1LQBA 5C3WA 1LXDA 3NOBA 3RFZB 4K0KQ 3DEOA 2VL6A 2L83A 2LGYA 4GOPA 1WRIA 3KW5B 1UBQA 3DLLA 1SMYD 1F2LA 3KJPA 5IGGA 1E90A 3OAWA 3N1YC 2DY7A 3PVLA 4LNKA 1VQ6A 3AE5B 2WIIB 4HDQA 2F0LA 1Z6HA 1IBKL 3TS0A 1M4VA 3CCRA 2KCTA 3TP8A 1HTQA 2VH2A 2QGQA 4DV1Q 1Y56A 4X66L 4A3JB 2K05A 1ACCA 4JI4Q 2KJ6A 4M01A 4BY7B 1X3FA 4FULA 3PUYA 4RWSC 2JT4B 2W54A 1VS0A 4UPAA 4IWQA 1IBXA 4ZRIA 1VRAB 5K5PA 1N34L 3I63C 2N4FA 5CR3A 4WWMA 3W1GA 3TEXA 3LJ3A 2KN4A 1I3QB 1DM0B 1Y1VB 5D3DA 2UUCQ 1VDVA 3H9DA 3K8AA 4B3RL 2EMSA 4MACA 2L0FA 1PUTA 5E4XA 1ET6A 4NAWA 2R3ZA 1SLJA 2ZTDA 4G0NB 3R8BA 3DBLI 1S1QB 3MHZA 1IHZA 3R66C 4F8MA 4XZ4A 1ZXTA 4WJOA 4HJAA 5K36H 1KF6B 4KIKB 1AE2A 4DUZL 4KHPQ 4NP5A 2Y0SB 3RZDB 4A3CH 3APDA 4B08A 1XQQA 3DOWA 2RPQA 1VMPA 3T51B 2KENA 3APFA 3PQIA 4LNFA 1UEBA 4E6IA 1NBFC 4NJCA 1GB4A 2KWUB 2NWGA 4XDXA 2MP2B 4W9KA 5CYUA 4IDIA 2EYFA 3HOXG 1IBLL 4DR6Q 4PMBA 3OOCA 4A3IB 1AZQA 2KJHB 5DPSA 2D3AA 3AXCA 3AEDB 4LNQA 1NDDA 1S3SG 2SOBA 3S9WA 4OGQC 1WGHA 3I73A 4E71A 4HN7A 1EIHA 1PTOB 2FCSA 2XGTA 2H88B 3A4SC 3SR6A 3HZXA 2IY0B 4WQOB 2PE9A 4IG7B 3NBHA 4A3FH 3S2HH 1VDZA 5CBEE 1TKYA 1SE8A 1PFBA 3APCA 1I6VC 1Y1WG 4HJ5A 1IYVA 4K7WA 1NYQA 2AWTA 4TUUA 5EKKA 3TS2A 3B0AA 1WX8A 4W9JA 3EA6A 4EGVA 3I4NH 4V190 1BBUA 4P74A 4WORA 4EUTA 4J15A 2INCC 4P6VF 2H89B 1RYJA 4YTNB 4HEDA 3NWSA 2JPHA 3D4RA 4ARIA 4PK1A 4F88A 1UGJA 1VCIA 2MO1A 1MIUA 4MH0E 3M9BA 3VVWB 2WAQE 1T3QA 1S5BD 3Q6BA 4RCNA 2O2VB 4LTUA 2JA6B 1C78A 4HCSA 3S17H 2N1WA 1VF5C 4EQ5A 3PIP3 4RMAA 3ZGZA 3RZOB 1S72A 1Z9FA 1HNWL 2E2IH 3FKIG 3Q3JA 2PO4A 2JQOA 2W9NA 4JK1C 1XD3B 2MQJA 1XF5L 4N58A 3K9PB 1PZKD 1NTGA 4DR3Q 2LJIA 3CWIA 2Z0SA 2KDIA 1CQFA 2INNE 4TRDA 4X57B 1XNRL 3PHWB 2KDEB 2EXZA 3JAMc 2LVPA 2AL6A 1Y14B 3I4MH 1A0IA 3LWEA 4NPSA 3TZUA 1KIXA 1CI3M 1G2TA 1H9MA 4DV5Q 3ENEA 5IODA 3CSFA 3P1HA 1KH0A 3MJ5A 1JB7A 3ZJTA 3NTKA 1DOLA 4NZLB 2YTYA 1E0ZA 1TS4A 3KFUA 2DLBA 3AEAB 3NZ3A 4YSYB 3IAYA 2V0GA 2FCNA 2P5ZX 5G3LF 4P1CC 2VXWA 2F0WA 1ONLA 2Z6KC 4A3DH 2A5HA 2RQXA 5C0XI 1KJTA 2CS4A 2MBEA 4B0MA 1TBEA 4K5VA 2D5GA 3HOZG 4P71A 1KC8C 4JI2L 3CPFA 2J0KA 2KTRA 4J1MA 4UAIA 3A4RA 3M62B 1LTTD 2D10A 1FO4A 2ZNVC 4A8XC 1ZE3D 1MJDA 2BDNA 5C4XH 3W1BA 5IT9L 2BB6A 1TWHB 1TR5A 4EQOA 2I1KA 1WGDA 2A19A 3ZJUA 3A56A 1A6XA 1FJGL 2EKIA 2EYOA 5M3MB 5IN7A 3CMAA 3J7AF 1T0SC 4MGKE 3FILA 2DGYA 2MFIA 1D6EC 4AQYL 1D1KA 1XPRA 1KHIA 2GBRA 4TVAB 2KWVB 4DV4L 1FNWA 1HUNA 3NUCA 4F1SA 1HZ5A 4MTNA 4NXNL 1DZ1A 2RSOA 1SDFA 5NUCA 1AP0A 4MGZE 4PNYA 2PPBC 1I6HB 2NUCA 3AMUA 1B7YB 1YQBA 3MC0B 2BT6A 1VZ6A 1AFPA 2D2QA 2WNMA 3KWVA 4I6NB 4HJKA 3HOUG 3VYSA 5AJ3L 3H15A 1H4RA 4FF2A 4IFDG 4BY1B 2K6QA 4LF8Q 3E9IA 3CQZB 1F9QA 4GDLA 4CBVA 3WAPA 1BXTA 2W3SA 1GHJA 1WXQA 4MM3B 2BQQA 3HM6X 5TSSA 4B3SQ 4S17A 1HNZL 1X3GA 4BOZB 2DY8A 1A15A 4HMJA 3CCVA 4AQ7A 1G6ZA 1HZCA 1TY2A 4DR7L 3JC66 4NDXA 3T1HL 1B8AA 2IGHA 4JI3L 4DK1A 2LFIA 4DK3C 2LUEA 1Q0WB 2ZM6L 2RVLA 3K5LA 4HTHA 2NVTH 3KF8B 1N33Q 2L00B 4USAA 3N52A 1JWMD 4QIWB 2Z6KA 2JA5B 1Y8PB 1W2BA 4DAYB 4HIOA 4QQBX 2GLSA 2F0IA 2K50A 2FCQA 5IP9H 1LTLA 3B1LX 4XT1B 4BBNF 5J39A 4X3KA 3MHSD 4ZOHC 1HZ9A 4JPBW 4C1NI 3NG0A 2VQEQ 1JJGA 2LMCB 1EF5A 2BYVE 2WX1A 4GOCA 3H3VI 4C80A 2X8XX 3SEBA 2RKSA 4O2DA 2K52A 4NKLA 1LABA 2KC1A 1WVLA 2K5QA 2A4ZA 5JJZA 3ECIA 1QOBA 1E0BA 1VQEA 3OIQA 3VRBB 1N32L 2FUHB 3OW7A 3ZRCA 3JVZX 1ESFA 4WJPA 5IKCM 2SEBD 2PEAA 4EFOA 1EOTA 2CFMA 4IURA 1T0QC 2Q2HA 1EYAA 2LVOA 2B76B 4YCWA 3ABVB 2JA7H 1K51A 3IFDA 3E5SA 1GUAB 3EFCA 3P2BA 5DCNA 4KTAA 2I5HA 1WI0A 1X32A 4FXDA 2HE7A 2LVQA 2CH4A 1CT1D 4B3MQ 1VQAA 3J7AV 1XNQL 2PVGC 3QIJA 2F0UA 5EBDA 3DBLB 1A63A 1J7AA 2NZHA 3ZYYX 1MJEA 3QWZB 2CKHB 1F2ZA 2BTEA 4A3EG 3G71A 4X6AH 2JE6I 2B63H 1LTAD 3RCZA 3DDCB 1GUNA 3RNAC 1F2RI 5DEHA 3S14B 4C4VA 3DBHI 2YVCA 1SSOA 2JY6A 2XBBC 3MEFA 4C3HB 1ENCA 3BJUA 2ICEC 3ULJA 3B6YA 5M5YH 4DR5L 3CCLA 1QOGA 3Q3MC 3O13A 2MX2A 2UU7A 3MXNB 1E5WA 4ZQ3A 3OG5A 4EX5A 3DBRI 3CKIB 1TWFH 3RI7C 1EFWA 1K3RA 2HIXA 2RPVA 2E2JB 1VCBA 1BCPC 1GJXA 5J3BA 5IGBA 2NBVB 2F1MA 3Q3NC 1PYBA 2AKWB 3VR2A 1CSQA 4A3LG 4PS8A 2DHZA 1KRTA 4A3FG 1SR3A 5LMUL 4X64Q 2D5DA 3I4MB 1E2VA 3GTKH 4CQNA 2XK5A 1C4CA 2V4LA 4MGIE 3I91A 4TSSA 2E2DC 3PRMB 3UINB 4DHJB 3L0WB 1QF6A 1JORA 4JBWA 3F2UA 4EQNA 4AP4C 2M1MA 3V05A 4JBKA 3MFYA 4A93B 3NP8A 1R7SA 5JEAJ 5IGDA 3EJIA 2KHJA 4DHZB 2BS2B 4KVGB 2N78A 3A0JA 3VYRA 4P1BC 2A6HD 5JAVA 3PRPB 3J9CA 1NMGA 5IT9c 3JSVB 3BZCA 3D31A 4WJQA 4OX9L 2RHQB 1SROA 3ZNID 1H9RA 1PH2A 5HHDG 3DXJC 2IHFA 5EPKA 1PH1A 4NQLB 5D6JB 4MHEA 3AEFB 1WJ4A 4JI7Q 2A1AA 5CMDA 3U7ZA 2HTHA 2JYTA 1YJNA 3JW0X 2WAQB 4S3SA 2K14A 3H94A 3RR5A 2RDGA 2UUAQ 3MXGA 5CHWA 3V60A 3GTPH 2E2HH 4OO1I 3H7PA 1YX5B 4C3IH 1CKNA 4W9FA 3Q23A 4A3MB 1F9RA 2MJ8A 4KI0A 1RAXA 4IUMB 4N59A 1J0GA 2DUDA 4IPHA 4DK5A 3PO3H 1IYJB 2R93B 5IP7H 4IUTA 1K83H 5COYA 1IYUA 3QB3A 1XMOL 2OWOA 4B9KA 2KQ7A 1NCVA 3HHMA 1BKBA 4C3JG 1E7UA 4H0LC 5ELEA 2KXJA 3I2ZA 4FO2A 4MELA 3LDZE 3SD5A 4AJYB 1UAPA 2L4NA 5LXHA 2L55A 2OQKA 4BBRG 2HHHQ 1UEAB 3QK0A 5GXGB 4XIGS 1VQ4A 4A3DG 2JWUA 5CTRC 2A69C 4CKBA 2F03A 1PTOC 5BR8Q 3NS1A 3OLMD 2J53A 4M0WB 1KDAA 3S2DB 1Y69U 2WS3B 3R3OA 2LJ5A 5CGKA 3M4OB 3B2GA 4GU2A 1E7VA 3D0FA 5C4XG 2WP8J 4ODGA 3NK9A 2A69D 3EVQA 5FLXE 3QQ8B 3PRZA 4N9F4 4KK7A 3T1YL 1K28A 4CDFC 4DAVA 3UIOB 1NI2A 1EFID 5C4JB 2AQ3B 2Q8TA 3A5ZB 1YI2A 4WWNA 4DR1L 3G6JB 4KY7A 1CTMA 2LGSA 1D7QA 2CJOA 4I6LB 4HAEA 2VQFL 4IOCA 3B08A 3S16H 3EFUA 2M2LA 4BA1I 1WYDA 1YQ4B 3I8ZA 4LNNA 5C3JB 2B8FA 4XWWA 2IW3A 4QGUA 5CHFA 3FPPA 4LFAQ 4HPMB 1N62A 4K14A 2L3ZA 3GTQH 1V6EA 4IUNA 2WXLA 1GHKA 1ESRA 1XCQL 1VQHA 2FAZA 4KIKA 4DV6Q 5D94A 3Q8CA 2PZWA 2K7VA 1LM8B 3PIO3 2KANA 1B2TA 4I65A 2N9EB 4ME5A 1TVXA 4GN3B 4H44C 5C3EB 4L5SA 3PV1A 1S5FD 3PCOB 4A3BG 1WTXA 3TSSA 1H95A 1WM3A 2MP2A 4KZ0A 4M00A 4BKTA 3MAQA 4IM3A 1J7BA 1UH6A 1A8VA 2OQ0A 1TWCH 2IX1A 2WXHA 3KLSX 4LF7L 2JRIB 5IOCA 2G4DB 1EQQA 3A55A 1XO3A 2EMTA 4JL9A 5FR6A 2B29A 4NQKE 1IL8A 2NN6H 1O7ZA 2Z8LA 3X3MA 4G11A 5LLIA 2ZJQA 3FAHA 1ISNA 2K1BA 2AUKA 2GN5A 3TZDA 2JUOA 2MHJA 5IYBH 2Y5BB 4QAYA 3B2FA 3AN1A 2WB1G 3C1EA 1OQQA 4HJGE 2ON8A 2GBMA 1TWGB 3EUB2 3ZXRA 2MO0A 3K5OA 2B8GA 3A8JE 3UDXA 5C44H 1GKHA 1C48A 1I4GA 2M19A 2F4VQ 3HRZC 2WXPA 1TS2A 3VDYA 1B50A 2UU9L 3U9OA 4EQPA 4WWPA 5CV5A 3TP6A 3F2CA 2DZKA 4IFDJ 3E9SA 1YJ1A 5FLXL 1NUCA 2RSUA 1STNA 2K03A 2KQ4X 1LT4D 5KYIA 4GLXA 1VZ8A 2O2VA 1A2UA 4EVOA 2O6VB 2ZPYA 1ZEQX 5EJWA 2ZJPA 4WRDA 1BMLC 1HEZE 1YMHE 2SNSA 4FF1A 3K59A 4A3JH 1WCMG 4N9PA 1DOMA 1KTKA 1TKEA 3WANA 4BY7H 3J81c 1C1YB 1M90C 2B63G 3D3RA 2R6GA 4HVBA 1GC6A 1UD7A 3DHHC 4GS3A 4BKGA 4EOYA 2MPMA 1T0RC 4Y52H 5KNBA 3ZNGC 1I35A 3SK4A 1WGKA 4DV3Q 3KDFB 3DBHB 1L0WA 1TTNA 4LJZC 5E6JA 2K04A 2I07B 4JI6Q 3AE3B 2R7ZB 4A3KH 1YN4A 3GZNI 4WWOA 4L23A 1I3QH 1Y1VH 2L32A 5ELCA 2M17A 1YJWA 4W9IA 2C5LC 3U4VA 2DNFA 2HDEA 4KV6A 1Z2MA 4R8NA 1UZXB 3A9KB 3Q8AA 2BWFA 3PO3B 2N1VA 2D0PA 4J6IA 4CHTB 1ILQA 1QUQB 2EYMA 1PQSA 4JI8L 3CPWA 3AI5A 3IBEA 2WYQA 3C2PA 4HK2A 2Z6BA 4WH4A 2XNAC 3FDTA 3J80E 3RZDH 3RMKC 4HIMA 4DDID 1A3TA 3J81j 5FLMH 1V5TA 4BBSG 3KYDD 4HIKA 1P1AA 4KN7C 4GN4B 3CP0A 4PYUA 4LF5L 1BBWA 1RJTA 2KOXA 5T1GA 2BYEA 3PS6A 3D8GA 4DAPA 4FNFA 1I94L 5EAYA 4IM0A 4IN3A 4U68A 3U58A 2B2VC 1LUZA 1STYA 4PMCA 4DQOC 4XC2A 1MPEA 1XYIA 2EY6A 4LF9L 3HRDD 5IYDH 1X65A 2MGSA 1WZ0A 1PTOH 2KLGA 1VD2A 4KKTA 1WWTA 2M00A 5GROA 3OIPA 3ZIMA 4J3OD 4G4KA 4X66Q 4A3GG 2C60A 3AMZA 1PRTF 3NWTA 5H1SE 2DNEA 2R92G 2UXDL 2X6GA 3ZUNA 3DWGC 5EGTA 5J1ZA 1S5DD 3VR4A 3L2PA 1C9OA 1MJCA 1N34Q 5C1ZA 1SNMA 3AV8A 1SYEA 1R9TB 1OEYJ 1BOSA 1FFUA 1UE1A 2PW7A 4ACFA 1SBBB 4KMUC 1N8RC 3HOVG 3A74A 3KUPA 3ERQA 2UUBL 3VXWA 3STBD 4PS3A 3P4SB 2QA4A 1U5KA 1RRBA 3ZVVA 2GMIC 2NTSA 4RGTA 3T16A 3RT3B 2QCPX 3KLWA 3TUOA 4MM3A 2ASQA 2I38A 4IALA 3CC4A 5AUIA 3EHVA 5G3LD 1HZBA 1FNVA 2M0XA 4IFDI 1D5XC 4X3TA 4DUZQ 2JA6H 2KK8A 2WHIA 3GTOB 2QEJC 3NXWA 4GNXA 3RZOH 5DNFA 2NVXB 3BIID 1P0RA 1WX9A 3KF8A 1JOKA 3AU5A 4IUVA 5E7NA 3RLFA 3VR5A 4DV7L 1QZHA 3TEWA 3T3OA 4POFA 3HP3A 3ZJVA 1O7YA 4DAYA 1A3UA 1C9FA 1U4MA 1IBLQ 2OTJA 4DK6C 4UP7A 2ID0A 1PGBA 2NMQA 1VQLA 2PKOA 1SYFA 4P72A 3WWVA 3NVYA 4H2AA 4WAFA 1GC7A 2WXJA 2I5MX 2ICIA 4YY3L 2LMCA 1V81A 4IKGA 1G2SA 2CWAA 2QF7A 4JGHB 1VQFA 3RLOA 1WFQA 2XTIA 2RF4A 1TS3A 3T8MA 3J80L 2B2VA 5EBCA 1Q1BA 2F0HA 3RULA 2DZJA 1L0YB 1OGWA 2J7QB 2K5VA 1VQGA 3PF4A 4K7UA 4YCVA 1UE6A 2F0EA 3EIVA 4ZRZA 4MJSB 3PO2G 4HEA1 5EDSA 4BZAA 1OXTA 5JVH3 4JI0L 5KGUA 4FLHA 3VTVA 3H0GB 2CQOA 1ZP0B 2ATWA 4MIUA 2A8VA 1SMYC 1L0XB 4KGSA 1XEEA 1E2WA 4QF4A 3OJ3A 5C44B 3PPAA 3TQYA 4W9CA 4JYAL 5HKHA 1EYCA 1N36L 1E1OA 2K6AA 4WJ3M 3M4PA 4XQNA 1TWHH 3QWNA 3QCAA 4XX5A 2EJGC 2F4IA 4PZ6A 2Q2TA 5M3MH 1CMXB 5CV9A 2Z0EB 3Q14C 1I7HA 2JU6X 1L7YA 5F2DA 2BOSA 1PH7A 1V49A 3Q8FA 4G50A 3VUWA 1WTQA 3I9V1 4KKUA 1HNWQ 4D2KA 4MN3A 3UDGA 3GTJB 4R8IA 2CQAA 1EIFA 2MJDA 2PTLA 4I6PA 1N63A 1I6HH 1N5WA 3MXNA 4DV2L 1Q12A 1A3VA 3GB1A 1GUTA 4LFCQ 3OJ4B 1XLQA 4YSZB 3WDNA 2QW7A 4C00A 4FVMA 4BY1H 4RCOA 2ZJDA 3KYCD 5I6YA 4A3KB 3CQZH 4OONA 1XTDA 4A76A 5E6PA 4LF6Q 3HOXB 1PFNA 2ZXPA 3HKSA 4KKSA 2IDYA 3A1QB 2BA0A 2AWNA 1XPOA 4L5RC 4US9A 3WALA 5IYBG 4GN5A 2OTLA 1F9JA 1J8CA 2K8HA 5HFYA 2KC2A 5M3FG 1KAAA 3ULLA 3R2IA 1EY6A 2HT1A 1PFSA 2ENBA 5C0XJ 5G2NA 5J2RA 5M5XB 4OWXB 3TJPA 1GD7A 5HY6A 3LYYA 2E74C 1EY0A 1YX6B 1V97A 4RAUC 2QMTA 3JSVA 3MWYW 4BOSC 4JI2Q 4RH6A 1PFMA 2JA5H 3GS2A 4B6WA 2RDHA 1LTID 4ULLA 2QIEB 3A8IE 4ANWA 3DUZA 3U7DA 1B9RA 4HJ9A 3NJTA 1JOOA 1Q10A 2A68D 4NB3A 1S5ED 1FJGQ 2R2QA 1LFDA 5LXIB 1WJ6A 2I5LX 4C2MB 1YJJA 3WIMA 1AE3A 3IKJA 4EZLA 5C3XA 4TQUS 4A3JG 3HOWB 4DV4Q 1U4RA 2L0CA 3BZDB 5IGCA 4O1NA 1N9WA 2IX3A 2YTXA 3QHTA 4Q2JA 2I2YA 1V9PA 3ER0A 2KCNA 2V3SA 4KY6A 4DBGA 4C1NK 1SJED 3A33B 5ELOA 2L5TA 1ICWA 4R4TA 2INDC 2JYOA 4ZHPA 2IO0B 5JVG3 1ZOYB 4GZYC 5CV8A 3MTSA 4R3DA 1SMXA 3BVGA 4H13C 2CU3A 3ETRA 5GMVA 5AJ3Q 4A90A 1Y1VG 3GZNB 4JLCA 4XQJA 1CHQD 3KVFB 3K58A 4OW0A 4MZ9A 2ZTEA 3J7A5 2L52A 1WD1A 3D6CA 4ZCKA 1ASZA 1IUEA 1FXAA 5IO9A 4B95A 4KV2A 3R93A 1T0YA 1KABA 1T5EA 5DM73 1JRUA 2AMCB 4H7BA 1EWYC 2WXOA 1HNZQ 5C5LA 2YYZA 1K8OA 1NI3A 2PVOD 4OWWB 1EWIA 5FLMG 5FO7B 4DR7Q 2DBYA 2WU5B 2WX0A 1IP9A 5LL6X 3A54A 2A74C 4JI3Q 3S14H 2D3GA 2YEPF 1GXDC 1KDCA 3A9JB 4M0WA 2ZM6Q 3GP7A 5LMNQ 4CDDC 3NRZA 4C3HH
chains in the Genus database with same CATH topology
3A7LA 3PUVA 2IPKD 4XTCS 1SNOA 1FNUA 1RTOA 1SSNA 1T5XD 1SXTA 1KRHA 3L4PA 1B4OA 3Q8BA 1XLNA 1UUPA 4OIKA 3S1QB 1JB3A 2ZXRA 3M7GA 4DA2A 1EEID 4L2YA 3VRAB 1F2MA 3M4YA 4DU9A 3AH7A 3ND9A 1EY5A 1WTRA 2ACZB 5C2TB 2JXMB 2FHTA 4KHVA 1HFGA 4PMWA 1NR4A 2IL8A 3I4LA 2WU2B 1WTWA 3HKZB 4YTMB 1U4PA 4Z9CB 2L1AA 3P4PB 1MHXA 1DONA 3RPFC 1DOYA 3HOUB 1RTNA 3ITPA 4DGZA 1E10A 4DXGA 3H09A 1FFVA 1WSPA 3VA5A 5DM63 1SFOB 2M0AA 3K0YA 1D2BA 4XXEA 4XDCA 1MGSA 3BWUD 2PQEA 1LO5D 4X3SA 3P75A 5KRUA 3TEYA 2AQ1B 1FM0D 2WDRB 1PFDA 2CW0C 1F77A 1VJKA 2XN9C 1EU4A 2KECA 1IGDA 3TP5A 5IIFA 2WXGA 5BMGA 3LNNA 1QB5D 1UWXA 1N61A 1FCLA 1D5MC 4PV1C 5M9OA 2K22A 2O5IC 2CW0D 2INPE 3U52E 4RHRA 1STGA 3U4EG 2FBWB 5C4ZA 2AX5A 4LLGM 1XLOA 2MH7A 1STBA 4OIJA 1TJEA 4F7XA 2F0FA 3AE9B 1CA6A 3VR6A 4K6LA 1E7PB 1XX8A 1OXUA 3UI2A 2K9XA 1DOKA 4KD4A 3A7AB 2D62A 2O4XA 1KLGD 4ZKCB 1AZPA 4A3EB 5EE0A 4JWUC 3I72A 3L7ZC 4RGNA 5CV4A 5IGFA 2LS01 1UWMA 3OWEB 2PZUA 5ELDA 3I90A 1X3PA 1SNDA 1SJHD 1F9PA 3GQBA 3MHBA 1QKZA 4DK0A 3DHQA 5K36G 1O7LA 2XSCA 2V4IB 1RFKA 2KWDA 2WLBA 3GTMB 2WXKA 3AECB 1PYWD 4BA2I 3MP9A 1VF7A 4QUCA 3SK5A 1EYDA 2HDLA 5EPLA 5I6WA 2B2YC 3T56B 2N0SB 3NQTA 2WACA 4RNAA 1EY8A 1YN5A 2A6HC 1Z47A 4B9XA 1SYCA 1WYGA 3SVMA 1HZ6A 4N9TA 2MHVA 4ZKBB 3S1NB 1FIQA 2GI9A 5JXVA 1HQRD 1L4DB 2JA8B 5T1IA 1NSNS 2A6EC 3A8KE 5HG2A 3M3YB 1PGAA 1SYBA 3RD4A 1D5ZC 4A55A 3K5NA 2V3PA 2XIWA 2MEKA 2K5WA 2QILA 5M5WB 4FXGC 2IGDA 1SYGA 2A6ED 2XVSA 4C3JB 1DOXA 1QNKA 2F0GA 4C3HG 5CC4A 2EYPA 3P20A 3L9AX 2WXNA 2WXIA 1NR2A 4BBRB 1QG7A 1RHPA 4Y7NB 1PRTD 1STEA 2J52A 2Z1CA 5I2XA 2DNCA 3E6ZX 1AWDA 1M8AA 5EE3A 2KEDA 3T3NA 1QOHA 3DMUA 4KHZA 1V1PB 2B2YA 3HVZA 1HFNA 1V8QA 1I4XA 2K32A 2WDQB 4MACA 2IGGA 5BN5A 1ZDVA 1KNAA 4ITKA 1F2YA 1I4QA 3IAM1 2VUMB 3LXFA 3Q24A 1V43A 1T6BX 4A6QA 2H4OA 3N6RA 1I4HA 1MHHE 1JWBD 5HURA 2D9UA 3EGRA 3NTHA 4OZAA 1HHVA 3PUXA 1O80A 1RDPD 3M7NA 2CJNA 1Q3LA 1RODA 4B0EA 4ZUIA 5ISRA 2X69A 4K5WA 3HOYB 2RMMA 5HGTA 1SNQA 4A3BB 3P1MA 1B53A 3S1RB 1K8MA 1DJRD 1MSGA 3K5MA 3QJYA 3EQLC 3NSWA 3PMFA 5A35A 2LGIA 2SDFA 3KK7A 2B2UC 2IT1A 3PUZA 2WB1B 4UDUC 5FOBB 2Y5CA 2DYMA 4JPSA 3OSOA 1VZ7A 5ELBA 2XWBB 1QOAA 3K7AB 4RF0A 5A2QE 2KCCA 1II3A 1JWUD 2ZW1A 1DGJA 2GA4B 2EY2A 3HVDA 4YIJA 3P63A 5BN3A 1O78A 3TBIB 1GUOA 2J0TD 1BNZA 4ZRPA 2ONQA 3KLRA 5E3FA 3W9CB 3CU7A 1C8CA 1RM6C 1WCMB 3MEHA 2FUG1 3V96A 5CBAE 4KY5A 2D2CC 1GPXA 3D4WA 2G9HD 2PZTA 3S1MB 3BVMA 5EE1A 3OHXC 1FGBD 1NENB 2IX0A 1BQQT 1C77A 5JEAH 2XRQD 4XE0A 1JOQA 1QNUA 1J9OA 2BYTA 2L1BA 1QQRA 5G5HA 4P2CB 3C8YA 4ZLTF 1PXUA 4JX1C 1HQMC 5CV7A 4LMQD 2AUJD 4BBSB 1R4QB 3H6MA 1ILPA 3HGBA 2B2UA 5BMIA 5D3IB 2IJ0A 2QKIC 3VA7A 2N88A 4QMGA 3Q8EA 4B9WA 3C3LA 1GUSA 1CA5A 5H92C 4RF1A 4A3GB 1HCZA 2NVYB 2PMZB 2I46A 4O42A 4KKIA 1S4ZA 1MVKA 2RDFA 3RMHA 2Y3AA 1NAPA 4KGRA 2BE5D 3HOVB 1CFMA 1BCPF 4HR7B 3QG1A 4ILWA 1JW9D 2W3RA 1HTLD 1OFFA 5BMHA 3AE8B 1KLUD 1FR3A 3FMCA 2R61A 4G7ZC 1EY4A 1NEKB 4QB4A 3PV0A 2HCCA 1OXSC 3JAME 3AE1B 2N9LA 4CJ0B 4R9WA 2B2TC 3BK1A 2EVBA 2O5JC 2TMPA 1SNPA 3LWUA 4C3IG 4YT0B 4XDDA 1EZ8A 3HG9A 3SHLA 2DYOA 3GTLB 3NE5B 2FE8A 2KDMA 2LHDA 5AFWA 4RKBA 4YSXB 2KUMA 2E76C 4DNRB 2GB1A 2EY1A 3BK2A 1I50B 4KKJA 1VMCA 2NVQB 1J7CA 2OXPA 1JWSD 3ND8A 3BYYB 4DF7A 2V4DA 1LTSD 4DNTB 4ZRQA 3L3OC 2F0NA 2TSSA 1LACA 5ELFA 3AE7B 1STAA 3U9SA 5BYRA 3AEEB 4BWGB 1S5CD 1C76A 5I4DA 3MXUA 3LB8C 2EPBA 2WXQA 2EOTA 3OMCA 5AUKA 1PTOF 2BCOA 1CK1A 1HUMA 2K5DA 1IKLA 1I4PA 2B2TA 1FMAD 2G9DA 4C7YA 1L6VA 1JCKB 4WQMA 1EZ6A 3T53B 2PYKA 2PW5A 3P4RB 5I9OA 4IFDH 2F0OA 1ENAA 1TY0A 4M1UB 2BBCA 1IGCA 1TZOA 3GV6A 3GD7A 4Q5VA 2HDMA 3BDOA 2Q8RE 5M3FB 5DAUA 1TKGA 3H8HA 4JWSC 1QCBD 3PO0A 3CHBD 3I3CA 2N9KA 4OZBA 1A70A 3NVZA 2F3WA 1PRTB 2H1EA 2KA7A 1JC7A 1GAQB 2NN6G 2G1EA 1QE6A 1AEXA 3NVVA 1I4RA 5JPNC 2WDVB 2LEKA 1D1IA 4L8JA 2WKDA 3CRLC 1ET9A 3R2TA 3MXPA 3RUZA 2AWOA 3E56A 2CVRA 2EYJA 1PDXA 4KN4C 2A68C 3MZ5A 4GDKB 1K52A 3GTGB 3OMGA 2F0TA 1Y1WB 3K57A 4RHSA 2M9VA 2VZKB 2Y5PA 2X6LA 4IQZA 5JEAG 4K5XA 3H91A 4HRSA 3FVQA 3MVVA 2QSDA 1CHPD 4A9AA 1CJEA 1L4ZB 3GO5A 1TYGB 4IZ8A 3U2SC 3GV3A 1BBXC 2OEOA 5E1FA 1R4PB 1ROEA 2N7JA 1EIGA 3T13A 3SK6A 4G7HC 2LHEA 3TDQA 5KEEA 3AEBB 3CRKC 1JWAD 1ZXIA 3FKIB 2XWJB 2VB3X 3BDCA 4FF3A 2E6XA 4XQQA 3S15B 1FRRA 1BUIC 1V1PA 1LT6D 2NYZD 1TWAB 3VYUA 4RKLA 1DCZA 2F0MA 3X3NA 5IT9E 2K33A 2YU9B 1LTRD 1B9MA 5KNCA 3BVZA 3Q6SA 1QLBB 2BB5A 2K5PA 1Q1EA 4P16A 3H3VC 1V8CA 1AN8A 1H9SB 1FXIA 2JX5A 3HOZB 2GRIA 1SYDA 1HPCA 1XTCD 1D4BA 2F0SA 1CZGA 4EE2A 1VR9A 4K8IA 3AE4B 2FFKB 1MSHA 4HKQA 1HXYD 2DN8A 2NZ1D 3HS0C 1E2ZA 1JALA 2RSNA 2JZPA 1EU3A 4K8JA 2K0PA 3UI3A 1CZPA 3WOFA 1LTBD 3E0JA 2HTME 1LLRD 2MP1A 2PW9A 4QCLA 2J7ZA 3Q22A 4RGMA 2PLPA 1BDOA 1F2RC 2BA1A 2F3VA 2BS3B 1JR0D 3IXSA 1HA5A 4YTPB 3IT4B 2WXFA 4RA8A 2OT2A 5C5MA 3SR1A 1ZYRC 1XXGA 4KJNA 4QUFA 4OZCA 4WJWA 5D7GA 2MUYA 4IUQA 4BS9A 2AQ2B 4I7ZC 1QOFA 3PUWA 3V2TA 1CZWA 1FEHA 1FD6A 1TT2A 4FXCA 4AS1A 1ZYRD 3ZQ4A 1IW7C 2M56B 4IUUA 2BS4B 2WP9B 1DXMA 3HEJA 2LY7A 1ML0D 1EQVA 3VYTA 1QWYA 1A2TA 2N55A 2PCFB 3J7YW 2B2WC 3W5VB 3DWPA 2PMVA 4FF4A 1B3AA 4HCEA 1IW7D 5C0XH 3SDZA 1ZPSA 1SE4A 2JXTA 1MD2D 1BUVT 1N60A 1L0VB 2NB0A 1JROA 1Y8OB 4RFBA 2YEPB 5D65A 1MBYA 5EPJA 4CKEA 3I57A 2K28A 1SE3A 5C6AA 1JMLA 1PLFA 2MJEA 2XRSD 3V3XA 2CHBD 2WV6D 4CGYB 1L5PA 3DWQA 4IOIE 1DYQA 3T4AC 2OEDA 5KIXA 2NBFA 2RBMA 3EFXD 3QIAA 1QT9A 1VLBA 1V1OA 4G57A 3NQIA 2Q8IB 4ZK9B 2MJ3A 2F0KA 3TP7A 3C46A 2KJXA 1EY7A 1HA6A 3VR9B 3W2DA 4ARCA 4NAMA 3NUHB 3KBGA 4ZUJA 1LT3D 5E4WC 2DWQA 4A3FB 3S2HB 3PZ8A 5FO8B 1FRDA 4Q0FA 3ONAB 1ZXHA 3SFEB 3G7LA 2B2WA 4GLSC 2ZW0A 3IT6B 3J81E 1EM7A 2IWHA 3I4NB 4FYDA 4JE3B 3OPOA 1PMRA 2EZVA 1NVID 1DD2A 2A73B 2X38A 4OHJA 2LKVA 2HQEA 2LUMA 1SE2A 1U4LA 1Y8NB 2EJFC 4HSVA 2E3TA 1BO0A 1KNEA 3QO2A 5EKIA 4L6TB 3S17B 4ID6A 3TN2A 2NTTA 3BG3A 2V3NA 1KFYB 4FXKC 5LHY1 5FO9B 1WTVA 2E2IB 3AE2B 2WXMA 1EWHA 2JEAI 1AW7A 5EQ0A 3VR3A 1IBXB 1OXVA 3M85A 1DOIA 1HTPA 1UNSA 1STHA 4KD3A 2PNRC 1U9RA 1PRTC 2C5CA 2WKCA 4NAWB 1BCPD 2BDOA 3AM9A 2KVMA 4K2KA 1EEFD 1XWEA 2EELA 3AE6B 2ZXOA 3SXHA 2KEEA 2JP1A 4A3DB 4M8AA 3AU7A 2HUGA 2Q5WD 5KYLA 2W82A 5H8YE 1BR9A 3MA2B 1RF2D 3DM1A 1KDBA 1YQ3B 5FK9C 5G5GA 1OXXK 5C4XB 3P42A 4HSPA 1K53A 5HI1A 1W6KA 4CKCA 3J81L 4L1BA 5MPOA 2RA4A 5KNDA 2W55A 3SK8A 4ABNA 2ZT9C 3Q69A 4AYBB 1H9KA 1SB3C 1E9MA 5D14A 4CJ1B 4YWGG 1QJOA 2VZKD 4U673 2KHSA 3D6WA 1SAPA 4XWTA 3OWFA 1F9SA 3FEWX 1TIID 4CJ2C 1OO9B 2WINB 1SEBD 1H9JA 4DXFA 4PQXA 2QDBA 1GUWA 1Q8IA 3D4DA 1OQRA 1ZDXA 3AB9A 4TQ1A 4OO1H 3KBXA 3FPUB 2FMMA 2K3UA 4WIPA 1P7FA 2O2LD 2NVTB 1ENFA 5FR3A 1EWCA 2E75C 4X3UA 5IGEA 3I70A 1PTOD 3HUIA 2NN6I 1RD9D 3PZ7A 2L12A 2JYEA 1G291 1C4PA 3FC4A 5FKAC 5EE9A 4KX6B 3NPPA 3TMEA 4MT5A 5C0XG 1YNJC 1RWSA 3IFTA 4K2LA 4US8A 2EJMA 2EYHA 1PGXA 2JA7B 4F87A 1LTGD 3IL8A 1JICA 1LV9A 1YNJD 2FJ2A 2PIAA 1Q90A 3CIRB 4HKZE 1HRJA 1WTOA 1MI2A 1IKMA 4WFN3 1RKNA 5I2YA 1ZKOA 5BYSA 3IAS1 4FP5D 4KJOA 1C79A 2J42A 1FYCA 1LT5D 2B63B 1YN3A 4C56C 1JRPA 5LL6S 3FILB 1TS5A 2F0DA 2KOLA 5BN4A 4N6EB 5M5YB 1EQTA 1XCTL 2KQ3A 3BYTB 1TWFB 4REZA 1PZID 1Z7TA 4XT3B 3WOEA 3P4QB 4OL7A 1JQYD 4HROA 3GTKB 2JQRB 4GDLB 1NYRA 1EL0A 1H9SA 2SNMA 2OHFA 4OVZA 2C9OA 3NBIA 3URYA 1TQOA 1X3QA 1SF0A 4NMZA 1WTPA 4MH8A 1CM9A 2QJLA 1L6UA 1C4QA 1BF4A 1K50A 2HCIA 4DFAA 4C7ZA 4G7OC 1QILA 5JOBA 4J8QA 2F0VA 2BE5C 3BDLA 5A2QL 1MI0A 2R92B 2K01A 4LK0M 1TU2B 3KWLA 3VR8B 1FD7D 3GTPB 2E2HB 3B9JA 2EE1A 3AB5A 4IUPA 4C3IB 1FCCC 1EY9A 3LX0A 3K6OA 4NW2A 5EKLA 1WD0A 1K83B 2OF1A 2KAJA 3DWMA 2JSOA 1C4AA 2L11A 3SFDB 3QOJA 1GOZA 1TKWB 1JQ4A 2F0QA 4YXDB 1SNCA 1PDQA 1JE4A 5I9PA 4J6HA 4HMIA 1B1ZA 1G8ZD 4KGTA 3KLSA 1W6JA 3N9YC 1CQVA 5C4HA 1P7EA 2FINB 3NHHA 2FMCA 1PZJD 2L9HA 2Z4HA 5CV6A 2JSVX 4L63B 3QOLA 1SIJA 2F0JA 3PO2B 1AYFA 2Z4IA 1XLPA 3NVWA 2EDGA 3DEPA 1G91A 3TEZA 3S16B 1B44D 4PT5A 1E6EB 2SAKA 3KQ4A 5JPMC 5T8IA 3C1FA 3P7JA 1RCVD 2LFNA 3GTQB 3FRPB 1YNNC 3Q0AA 4ZAIA 5LNK1 4K6DA 4TKOB 2EYLA 3DWAA 4RGOS 4OO1G 4WURA 5J22A 3SE0A 3VQIA 1N5XA 4V0BA 1GUGA 1YNND 1GB1A 2J4XA 1J8IA 2KMMA 1TWCB 4LK1C 4XYQA 3BS1A 5CORA 2KACA 3W1SA 2B39A 3JAML 3NTIA 3MFGA 2VB2X 2JEBI 1YNTE 3EROA 1YJIA 4ZYSA 3W5UB 3AEGB 2WXRA 4TQ0A 2WQYB 2BW2A 1BCPB 2F0PA 2EY5A 1B9NA 4XYOA 3W3AA 3WCQA 2VNUD 5BYQA 4DN4M 4LAAA 5C3WA 3RFZB 3DEOA 2L83A 1WRIA 1SMYD 1F2LA 5IGGA 2DY7A 3AE5B 2WIIB 2F0LA 1Z6HA 1M4VA 3TP8A 1Y56A 4A3JB 1ACCA 2K05A 4BY7B 3PUYA 4RWSC 2W54A 1IBXA 1VRAB 5K5PA 5CR3A 4WWMA 3TEXA 2KN4A 1I3QB 1DM0B 1Y1VB 5D3DA 1VDVA 4TMAB 1PUTA 5E4XA 1ET6A 2R3ZA 3R8BA 3MHZA 1IHZA 4F8MA 1ZXTA 5K36H 1KF6B 4NP5A 2Y0SB 3RZDB 4B08A 1VMPA 3T51B 4NJCA 4E6IA 1GB4A 2NWGA 4XDXA 5CYUA 4IDIA 2EYFA 4PMBA 3OOCA 4A3IB 1AZQA 3AEDB 2SOBA 3S9WA 4OGQC 3I73A 4HN7A 1EIHA 1PTOB 2H88B 3SR6A 3HZXA 3NBHA 1VDZA 5CBEE 1TKYA 1PFBA 1I6VC 1IYVA 1NYQA 5EKKA 3EA6A 4EGVA 4V190 4WORA 4P6VF 2H89B 1RYJA 4YTNB 4HEDA 3NWSA 3D4RA 4ARIA 4F88A 1UGJA 1VCIA 1T3QA 1S5BD 4RCNA 4LTUA 2JA6B 1C78A 4HCSA 1VF5C 3PIP3 3ZGZA 3RZOB 2PO4A 4JK1C 1XF5L 4N58A 1PZKD 3CWIA 2LJIA 1CQFA 2INNE 4TRDA 2EXZA 3LWEA 3TZUA 1G2TA 1CI3M 1H9MA 5IODA 3P1HA 1KH0A 3MJ5A 3ZJTA 3NTKA 1DOLA 4NZLB 1E0ZA 1TS4A 2DLBA 3AEAB 3NZ3A 4YSYB 3IAYA 2V0GA 5G3LF 2VXWA 2F0WA 1ONLA 2A5HA 2RQXA 5C0XI 4B0MA 4K5VA 2D5GA 4J1MA 4UAIA 1FO4A 1LTTD 4A8XC 1ZE3D 2BDNA 5IT9L 2BB6A 1TWHB 1TR5A 4EQOA 3ZJUA 3A56A 1A6XA 2EKIA 2EYOA 5M3MB 3J7AF 3FILA 1D6EC 1D1KA 1HUNA 1FNWA 3NUCA 1HZ5A 1DZ1A 2RSOA 1SDFA 5NUCA 1AP0A 4PNYA 2PPBC 1I6HB 2NUCA 3AMUA 2BT6A 2WNMA 3MC0B 3KWVA 1VZ6A 1AFPA 3NS1A 3VYSA 4FF2A 4IFDG 4BY1B 3CQZB 1F9QA 4CBVA 1BXTA 2W3SA 1GHJA 1WXQA 4MM3B 5TSSA 2DY8A 1A15A 4HMJA 4AQ7A 1G6ZA 1TY2A 4NDXA 2IGHA 2LFIA 4DK1A 2RVLA 3K5LA 4HTHA 4USAA 3N52A 1JWMD 4QIWB 2JA5B 1Y8PB 2F0IA 4XT1B 5J39A 4X3KA 4ZOHC 4C1NI 2LMCB 4C80A 3SEBA 2RKSA 4NKLA 1LABA 1WVLA 2K5QA 5JJZA 1QOBA 1E0BA 3OIQA 3VRBB 3OW7A 1ESFA 2SEBD 1EOTA 4IURA 1EYAA 2B76B 3ABVB 1K51A 3IFDA 3E5SA 4KTAA 1X32A 4FXDA 1CT1D 3J7AV 2PVGC 2F0UA 5EBDA 1J7AA 3ZYYX 1F2ZA 2BTEA 2JE6I 1LTAD 1GUNA 1F2RI 5DEHA 3S14B 1SSOA 4C3HB 1ENCA 2ICEC 1QOGA 3O13A 4ZQ3A 3CKIB 2RPVA 2E2JB 1BCPC 1GJXA 5IGBA 2F1MA 3VR2A 2D5DA 3I4MB 1E2VA 4CQNA 1C4CA 3I91A 4TSSA 2E2DC 1QF6A 1JORA 4JBWA 3F2UA 4EQNA 3V05A 3MFYA 4A93B 3NP8A 1R7SA 5JEAJ 5IGDA 3EJIA 2BS2B 3VYRA 2A6HD 5JAVA 3J9CA 3D31A 1H9RA 5HHDG 3DXJC 5EPKA 4MHEA 3AEFB 5CMDA 3U7ZA 2JYTA 2WAQB 4S3SA 3H94A 2RDGA 3MXGA 4OO1I 3Q23A 4A3MB 1F9RA 2MJ8A 4KI0A 4N59A 2R93B 4IUTA 5COYA 1IYUA 3QB3A 1NCVA 4C3JG 4H0LC 5ELEA 4FO2A 1UAPA 2L4NA 2L55A 5GXGB 1UEAB 4XIGS 2JWUA 2A69C 4CKBA 2F03A 1PTOC 2J53A 1KDAA 3S2DB 1Y69U 2WS3B 3R3OA 5CGKA 3M4OB 3B2GA 2WP8J 4ODGA 3NK9A 2A69D 3EVQA 5FLXE 4KK7A 4DAVA 1EFID 5C4JB 2AQ3B 2Q8TA 3G6JB 4KY7A 1CTMA 2CJOA 4HAEA 2M2LA 4BA1I 1YQ4B 3I8ZA 4XWWA 5C3JB 2B8FA 2IW3A 3FPPA 1N62A 4K14A 4IUNA 2WXLA 1GHKA 1ESRA 1XCQL 3Q8CA 2PZWA 2K7VA 3PIO3 1B2TA 4I65A 4ME5A 1TVXA 4H44C 5C3EB 1S5FD 1WTXA 3TSSA 3MAQA 1J7BA 2WXHA 2IX1A 3KLSX 5IOCA 3A55A 1XO3A 1IL8A 2NN6H 1O7ZA 2Z8LA 3X3MA 3FAHA 2K1BA 2AUKA 3TZDA 4ZHOA 1F0ZA 3B2FA 3AN1A 3C1EA 1OQQA 4HJGE 2ON8A 1TWGB 3EUB2 3K5OA 2B8GA 3A8JE 1C48A 1I4GA 2M19A 3HRZC 2WXPA 1TS2A 1B50A 3U9OA 4EQPA 5CV5A 3TP6A 4IFDJ 3E9SA 5FLXL 1NUCA 1STNA 2K03A 2KQ4X 1LT4D 5KYIA 1VZ8A 1A2UA 4EVOA 1ZEQX 5EJWA 1HEZE 4WRDA 1BMLC 1YMHE 2SNSA 4FF1A 3K59A 4N9PA 1DOMA 1KTKA 1TKEA 3D3RA 2R6GA 2MPMA 5KNBA 3SK4A 1WGKA 4LJZC 5E6JA 2K04A 2I07B 3AE3B 2R7ZB 1YN4A 4L23A 2L32A 5ELCA 2HDEA 4KV6A 3Q8AA 4R8NA 3PO3B 4CHTB 1ILQA 2EYMA 4WH4A 3C2PA 2XNAC 3FDTA 3J80E 1A3TA 4KN7C 1RJTA 5T1GA 3D8GA 4DAPA 4FNFA 4IN3A 4U68A 2B2VC 4PMCA 1STYA 4DQOC 1MPEA 1XYIA 2EY6A 3HRDD 2MGSA 1PTOH 4KKTA 1WWTA 2M00A 3OIPA 4J3OD 4G4KA 3AMZA 1PRTF 3NWTA 2DNEA 2X6GA 3DWGC 5EGTA 5J1ZA 1S5DD 3VR4A 1SNMA 3AV8A 1SYEA 1R9TB 1BOSA 1FFUA 2PW7A 1SBBB 4KMUC 3KUPA 3ERQA 3P4SB 2NTSA 4RGTA 3T16A 2QCPX 3TUOA 2I38A 4IALA 5AUIA 5G3LD 1FNVA 4IFDI 1D5XC 4X3TA 3GTOB 2QEJC 3NXWA 5DNFA 2NVXB 3BIID 3KF8A 1JOKA 4IUVA 3RLFA 3VR5A 3TEWA 3T3OA 3HP3A 3ZJVA 1O7YA 4DAYA 1A3UA 1C9FA 1U4MA 2ID0A 1PGBA 2NMQA 2PKOA 1SYFA 3NVYA 4H2AA 4WAFA 2WXJA 2ICIA 2LMCA 4IKGA 1G2SA 2QF7A 1TS3A 3J80L 2B2VA 5EBCA 1Q1BA 2F0HA 1L0YB 2F0EA 4ZRZA 4HEA1 1OXTA 5JVH3 5KGUA 3H0GB 1ZP0B 4MIUA 1SMYC 1L0XB 4KGSA 1XEEA 1E2WA 4QF4A 5C44B 1EYCA 2K6AA 4XQNA 3QWNA 2EJGC 2F4IA 5CV9A 1I7HA 2JU6X 5F2DA 2BOSA 3Q8FA 1WTQA 3I9V1 4KKUA 4D2KA 4MN3A 2MJDA 3GTJB 4R8IA 2CQAA 2PTLA 1N63A 1N5WA 3MXNA 1Q12A 1A3VA 3GB1A 1GUTA 1XLQA 4YSZB 3WDNA 4FVMA 4RCOA 5I6YA 4A3KB 3HOXB 1PFNA 2ZXPA 4KKSA 2IDYA 2BA0A 2AWNA 4US9A 5HFYA 1KAAA 3R2IA 1EY6A 2ENBA 5C0XJ 5M5XB 3LYYA 2E74C 1EY0A 1V97A 4RAUC 2QMTA 3MWYW 4RH6A 1PFMA 3GS2A 2RDHA 1LTID 4ULLA 2QIEB 3A8IE 3DUZA 1B9RA 1JOOA 1Q10A 2A68D