2ICIA

Crystal structure of streptococcal pyrogenic exotoxin i
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
227
structure length
227
Chain Sequence
YEMSSVGVINLRNMYSTYDPTEVKGKINEGPPFSGSLFYKNIPYGNSSIELKVEMNSVEKANFFSGKRVDIFTLEYSPPSNSNIKKNSYGGITLSDGNRIDKKNIPVNIFIDGVQQKYSYTDISTVSTDKKEVTIQELDVKSRYYLQKHFNIYGFGDVKDFGRSSRFQSGFEEGNIIFHLNSGERISYNMFDTGHGDRESMLKKYSDNKTAYSDQLHIDIYLVKFNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Exotoxin I
publication title Crystal Structure of the Streptococcal Superantigen SpeI and Functional Role of a Novel Loop Domain in T Cell Activation by Group V Superantigens.
pubmed doi rcsb
source organism Streptococcus pyogenes
molecule tags Toxin
total genus 67
structure length 227
sequence length 227
ec nomenclature
pdb deposition date 2006-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2iciA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2iciA01
5D3IB 4RCOA 1CQVA 1EU3A 2XRQD 1YN4A 3BVGA 3EFXD 5ELBA 1HXYD 1EU4A 1DJRD 4RGNA 1BCPC 1KTKA 1SE3A 1KLUD 4RHRA 1FNUA 1SEBD 3OWEB 1LTAD 1LTID 1SBBB 1TS4A 3DWAA 1TS2A 1QILA 1UNSA 1EEID 1RDPD 1JCKB 1I4HA 1STEA 3BZDB 1V1PA 3MC0B 1YN3A 1TY2A 5ELEA 1SJHD 1KLGD 4DXFA 1BCPD 1GOZA 1HQRD 1PTOH 2SEBD 1CK1A 1S5BD 2R61A 2Z8LA 4DXGA 1I4GA 1TS5A 1FNWA 1XTCD 1F77A 1CHQD 4RFBA 3DWPA 4O1NA 1HA5A 4Z9CB 3SEBA 1JQYD 1I4PA 1ET9A 3URYA 1BCPF 2AQ1B 1L0YB 2XNAC 3EA6A 2RDHA 1I4QA 4OHJA 1PTOD 5FK9C 1DYQA 2ICIA 1M4VA 2AQ2B 5ELDA 5TSSA 5FKAC 2QEJC 1PZID 4RGOS 1S5DD 4L63B 1YN5A 3V05A 1ET6A 3R2IA 2AQ3B 1EWCA 3GP7A 3BYYB 2XN9C 4RH6A 1UUPA 1PTOC 1PRTD 1SE4A 1G8ZD 1LLRD 4BWGB 2XRSD 1CHPD 1LTGD 3W2DA 1JWSD 1JR0D 1LO5D 1LT4D 3TSSA 4UDUC 4ZYSA 1B44D 2NTSA 1MD2D 1RF2D 4RGMA 1T5XD 4NZLB 2WV6D 1LTSD 5D3DA 1B1ZA 1I4XA 4K6LA 3R8BA 1PRTC 1BXTA 1D5ZC 1BCPB 1ENFA 1S5CD 2TSSA 1PZJD 1ESFA 3CHBD 1EFID 1LTBD 1TY0A 1D6EC 2IJ0A 1CT1D 1EEFD 1L0XB 1AN8A 1LTTD 2QILA 1SJED 3MFGA 3R2TA 3BVZA 1SE2A 1LT3D 1V1PB 2IPKD 3KLSX 3BVMA 1LT6D 1PTOF 1FNVA 4RHSA 4L6TB 2NTTA 2G9HD 1RD9D 1HTLD 1AW7A 1PTOB 4RGTA 1RCVD 1S5ED 1XXGA 1FGBD 1JWUD 1PZKD 1V1OA 2J4XA 1TS3A 1JWMD 2RDGA 1FD7D 4TSSA 4C56C 1PRTF 1D5MC 1I4RA 1S5FD 3BYTB 5ELFA 5I4DA 2O2LD 5ELCA 1LT5D 1LTRD 2CHBD 3O13A 1SXTA 1D5XC 1PRTB 1PYWD 3DWQA
chains in the Genus database with same CATH superfamily
2VXWA 3J80c 3NQTA 2JYTA 4BY1G 3AE2B 2K50A 2QC8A 5FO7B 3ALBA 1PMRA 1D8LA 5IGCA 3Q3MC 1EYAA 3OIQA 4RKBA 5JHBA 4PZ8A 1DJRD 5IGFA 1GUSA 4GLVB 4XDCA 5FR3A 3WCQA 1JC7A 1P8LA 1E7UA 3MC9A 1JWBD 2KYWA 3OWEB 2WAQG 1LTAD 1S4ZA 3G6JB 2I5MX 3J80i 4P73A 4QY7A 1KXLA 2WXIA 3E5SA 4X3KA 2R7ZH 1B70B 2EYJA 2AYOB 2OF1A 3QWNA 3ZW3A 5CBEE 3S9WA 3CC7A 1ESRA 1RL2A 1V1PA 5HKHA 2WB1E 1CJEA 5HG2A 2LRWA 1SE9A 4B3SL 1KLVA 2P5ZX 4KY6A 2Z6BA 5I6YA 3IAM1 4TUUA 3AULA 3T53B 3B2GA 3S2DB 5E6OA 5EBCA 1TS5A 2CWAA 4F8MA 1FNWA 4JI1Q 3NVVA 4BBNC 1QZHA 1F77A 2BCOA 3DPDA 4R8IA 4F7ZA 1KDAA 5C5LA 4XC2A 3ZRCA 1EZ6A 3K7AH 4UAIA 2CKZB 5LL6S 3VR3A 1KDCA 2DZMA 3F2UA 3KYDD 4BXXH 4MJSB 1SFOH 2IO1B 3NUHB 1KRHA 1OEYA 4HEDA 4AWJA 4DHJD 1PTOD 2RHSB 1AYFA 2OWOA 4LTUA 3KUZA 2WNMA 1PH8A 1UE6A 3K0YA 2KBNA 3TEWA 2QJLA 5J1ZA 1R4NI 5LXHA 4YWKA 3PQIA 4JBJA 4IG7B 4WAFA 4HJ8A 4V0BA 3CU7A 3UINB 3AQQA 3IXSA 4POGA 2M0AA 1CHPD 3ECIA 3NENA 4YSXB 5IGGA 4ABNA 4HEA1 4GLAC 3B08A 3A9KA 1D3ZA 3W1GA 2JF5A 3NS1A 1XPUA 1M94A 3DHGC 3ZTCA 3MWYW 1H9KA 5JJKA 2NVQB 2H4OA 4G3XB 2N9XA 4K6LA 2AUJD 1YHBA 3EECA 2OT2A 2HD3A 2L0FA 3AMZA 2KQ7A 2UU9L 3RZOB 3J81c 2QEXA 2E2JB 5E6NA 1XNRQ 2BT6A 2KJ6A 3ZDTA 5GMVA 4DPGA 5GAGC 1CFMA 3I56A 1JALA 3GTQB 4DR7Q 4IWQA 1QOHA 2AUKA 3BVMA 1IUEA 1SR3A 2WXNA 3MXNB 3NTKA 4WJ4A 1B9RA 1ZKHA 4V190 1RD9D 1E0BA 3TBIB 4ZCKA 3PCOB 3J81i 2RPVA 2NVYB 4KD3A 4RGTA 5TR5A 1FGBD 1O80A 3E0EA 3L9AX 4DR2Q 4KSKC 1QUQA 4A3PA 1YQBA 4JPSA 1MIUA 3ABVB 5L95C 2BDNA 3R3OA 1PQSA 1RLFA 2KK8A 4HDQA 5AFWA 2JEAI 4A3CG 3FKIG 3S1RB 1WJUA 4GSWA 2K01A 1XMQQ 3NWTA 1GUOA 2HCCA 3E9HA 2MJ3A 4B3TQ 2M4NA 4HJAA 4K7UA 2L11A 5M3MG 3C0RB 4LJPB 1JORA 4WJOA 3U4ZA 1Z5SB 1R4MI 1SYGA 4RCOA 3EFCA 4W9CA 3ITPA 5BYQA 2NVQH 2R2OA 1V2YA 4BBSG 2W3SA 1TKYA 1C77A 3ULLA 3Q22A 3K80C 3DHQA 1YIJA 1HNWQ 3P2BA 1LABA 2D5DA 4QF4A 5IYDG 1V43A 2G4DB 1YZ6A 3FKIH 1MSGA 3QOLA 3L54A 4OVZA 2BH2A 3C1EA 4TKOB 2KHJA 3CCJA 3L4PA 1YJNA 2F3VA 1PA6A 3GTQH 4QMGA 3J7AF 4B9XA 2VW9A 2MQHA 1CQFA 3Q2AC 3VR6A 3BZDB 1RODA 1TY2A 2K05A 2R92B 3NHEB 4RF0A 2CCZA 1HZBA 2N9EB 4R4QA 5AJ3L 4II3B 1PH2A 1AP0A 4WWOA 4WWNA 1TWGB 3AYHB 1P16A 1DGSA 1YQ3B 2KAJA 5IP7G 1STGA 3VHTC 5HURA 4X64Q 3AU4A 4USAA 1EQQA 2IO3B 2A5UA 4CJ2C 2L00B 2L12A 4KKIA 1IKLA 3HOUB 1WGYA 1L4ZB 4XWTA 1F2ZA 2DNFA 2KECA 3N20C 5D2MB 3H09A 4JC0A 4KJOA 3T51B 5C1ZA 3NP8A 4NXMQ 1EZ8A 4KIKA 3PO3B 1M4VA 3DVGY 2L5TA 4MNOA 1E7PB 4KX6B 4X3SA 2M9VA 4FN2A 1I94Q 1RM6C 2KVZA 4O2DA 3B9JA 4LNKA 3PF4A 1OO9B 1OQRA 1JB3A 1ZGUB 4FXCA 2KMAA 4DKAC 4HMIA 1G2SA 2GA4B 5JVG3 1UELA 2Y3AA 3L10B 3K58A 1CUKA 2SAKA 2J42A 3CW2C 3Q0AA 4YCUA 1PUTA 5BN5A 2X8XX 5CBAE 4HIKA 1FD6A 2J0JA 3ZDMC 1JE5A 3CF5A 1XNQQ 3HOUG 3PUVA 4EVOA 4OIKA 3TSSA 3HKZG 4OO1G 1E6EB 2J0KA 2QDFA 1TZ1A 2R92H 1HZ5A 4IOCA 1WMHA 1L6VA 1A62A 1IP9A 1FXAA 2JX5A 1TWGH 5IA7A 4LF8Q 2DYBA 3JSVA 5C0XG 5G5HA 4DK5A 3CCUA 4FO2A 4OW0A 2D10A 4IM0A 4LF7Q 3ZYYX 1S3OA 4YWLA 2INNE 2Z6KA 3SK4A 1H4RA 2MJEA 4GOCA 1CT1D 4DV6L 1WRIA 3T1HL 3HOUH 2JA6B 4OO1H 1UWMA 1LTTD 3NK9A 2MWSB 2N55A 1QOAA 1K28A 4K3CA 5KEEA 1XLNA 3I2ZA 1IKMA 1PTOF 1STHA 3GDEA 4ZRZA 5IT9E 1MHWC 3PO3H 3IAS1 2Y0SG 1HZ6A 4DWFA 2LVPA 4NQKE 3IKJA 3UDXA 2V1YA 2QSDA 2JA8G 3KF8A 2UUBL 3ZNGC 1PZKD 2GBMA 4W9LA 2N88A 3HOZB 2L0TA 3KUCB 1TIFA 2O2VA 2V0GA 2LKVA 4HPLB 3HOVG 5JJZA 4HVBA 2BYVE 4EE2A 2LMCB 3KYHC 4FF1A 4X57B 2M56B 4TRDA 4GGQA 1QG7A 1IW7D 3RNBC 4LNNA 1LT5D 3TDQA 2Z59B 3O13A 3AU7A 2E2HB 2KD0A 3JYUA 3MJWA 1RIPA 3L3OC 4MACA 4NAWA 4R1JA 1PYWD 2AHOB 3I91A 2WXQA 4A3FB 2MRPA 5D14A 1BKBA 2JA8H 1MVKA 3PF5A 2RSUA 4JBMA 2MPMA 5FO9B 2G3QB 3ZVVA 4XWWA 2KJXA 2K6AA 3VTWA 4R3DA 3S14H 1GD7A 3VTVA 3X0WA 4RGNA 3HOVH 4QJFA 1BDOA 1H95A 1WH3A 2KACA 1M1KC 3SR1A 3NS8A 4E3CA 3HOZG 2JA6H 1N63A 1TS4A 2KQ4X 2RA4A 1PH9A 1TS2A 1A2UA 1C76A 5M5WH 1GC6A 2KQ3A 2K39A 3DBHB 1IL8A 2N3SA 3IVFA 5D94A 1RRBA 1WIAA 2LUMA 3T8MA 5EE9A 2KLCA 3OW2A 2EJMA 3NEMA 2BB6A 2A74C 2QDBA 1Z7TA 3SVMA 3HOZH 2A4ZA 4N9TA 1C9OA 4A3DG 1VZ6A 4DDGD 2ZM6Q 1STAA 3EJIA 1K8MA 1FR3A 3URYA 2LHEA 4HPPA 1L0YB 4DUYQ 3H15A 2E2HH 2B63B 2EY5A 4KKUA 2R3ZA 4JPBW 5C3EG 1KD1C 4LFCQ 1B53A 5GROA 1E5WA 3D8GA 3PIPA 2WACA 3KOJA 2PI2A 5JAVA 4XGAB 2LGDA 5CYUA 2B2WC 3HOWB 3V6CB 5BMIA 1HH2P 2MO1A 4L63B 3V05A 4C7YA 1N5XA 3AE1B 3I7FA 1P7FA 2OEOA 3I4MG 1N36L 2LEKA 4RH6A 2HT1A 3NVYA 3QARA 3BDCA 1FCCC 3I4NG 4ZYNA 1VCIA 3U52E 1HNXQ 5K36G 4A3KG 3BY4B 3SR6A 3NELA 3ZNID 4O0AA 3U58A 3P7JA 2EKEC 4P2CB 4XYOA 1EY0A 2NBUA 3LWUA 1LTSD 4PZ7A 1WM2A 2BWFA 2PLPA 3PZ8A 1BXTA 2KDMA 3ONSA 3R7RA 4ID6A 2L9HA 5BYRA 3PUYA 4LUOA 1HA6A 2UWQA 2D5GA 4GNXB 1T0QC 5JJLA 3KWLA 4J3OD 4LJOB 4EKUA 1DOXA 2B63H 2LXAA 1SNMA 1IGDA 2AEHA 5BN4A 5BR8Q 1F9JA 4AYBB 2OOBB 1NI3A 4JI1L 2KWDA 4MH0E 2YYZA 3D32A 2R7FA 3WDNA 2KOXA 1KL9A 2NN6I 1BMLC 2J7QB 2K8BA 3U30A 1VQ9A 3H3VC 1ILPA 4FF3A 4YCWA 1TWFB 4WWPA 1JWUD 3UIPB 4BFRA 2JK8A 1TS3A 4NJ7A 3RNCC 3ULJA 2RDGA 3A9KB 2DGYA 2OQKA 1WZ0A 2PMVA 3CCVA 1V5OA 4C4VA 3J7AV 2V4IB 4OONA 1TVXA 3OW7A 5FJ8G 1R4NB 4YSYB 5C4JB 2CHBD 1WX8A 1UF0A 2CWPA 1D5XC 1PDQA 1PRTB 2YEPB 1SYDA 3C46A 4LF4Q 2BS3B 2L0CA 1FXIA 1EUVB 2K5VA 4K5VA 3H8HA 2F0GA 2B29A 4A93B 3EBEA 1K51A 1IBXB 1GC7A 2WLBA 5DNFA 4Y7NB 3ZQ4A 2JXMB 5FJ8H 1LTID 3SGIA 1SIJA 1WSPA 4ZHPA 3K5MA 2NBWB 1WVLA 2IYDB 3V62A 4GKJQ 2CU1A 4IUVA 1JCKB 4A3GB 3A7LA 3SK6A 1WJ6A 2B2YC 3APDA 4OZAA 2H89B 5DPWA 5M5YB 1LUZA 4KY7A 1XNRL 2NR2A 1TQOA 1YI2A 3TCAA 2IBIB 5C3JB 5D6JB 2R93G 1B8AA 1L1OA 4GS3A 5L37A 2SOBA 4K5WA 1VQ8A 1YJ1A 5EJWA 3V6EB 3DWPA 4Y52H 3Q23A 4WQOB 1FRDA 2O6VB 3J7YW 3FPPA 3QB3A 1K3RA 3ER0A 1YITA 3Q3NC 4GZYC 4PMWA 5C4JH 2JA7B 1LXDA 1KQSA 4EEWA 3CXCA 4NPNA 4DR2L 2A6ED 1KNAA 4GN3B 1EYGA 1NEKB 1SLJA 4A3GG 3G71A 1VQKA 3DBSA 3AMUA 5ELDA 1GUAB 3OG5A 3P4RB 2A19A 3DBRB 2F4IA 2R93H 2YLMA 3U9SA 2PE6B 3Q8BA 1SMXA 3RNFC 1XMQL 1J8IA 1R9TB 3VFKA 4B3TL 3FILA 4Y7NH 2RDBC 3MEFA 1R4MB 3DWGC 1EF1A 4JLCA 1NMGA 4BA2I 4L5RC 1EQRA 3NWSA 5T1IA 3TZUA 5KRUA 1NDDA 4PMBA 5IYCH 1L2NA 2BKFA 1ENAA 1O7IA 2CJOA 4X3UA 4A3GH 2ZJDA 2XWBB 1RTNA 2OJWA 3Q3JA 4ZYSA 2VS1A 4DR1Q 5M5YH 1HNWL 4PS7A 2YU9H 1PVOA 2KX3A 2RCNA 4IPCA 4K1RB 4FYDA 3ND8A 4YIJA 4G11A 1EYDA 5C3WA 3RUIB 4YXDB 1A3TA 3TN2A 1K73C 3N52A 3QA8A 3VVWB 1QVFA 1YQ4B 1L0WA 4OL7A 2NPTB 2WXGA 2NZ1D 2R7DA 1MKHA 3UDGA 2MBHA 1TY0A 5AZHA 3E9IA 4LFBQ 1RYJA 2B3AA 1L0XB 3RD2A 1SJED 2DJFC 3DVNV 4C3HG 4Q5VA 4X64L 1NYQA 1YNND 2G9HD 5E4WC 2K5WA 3VR4A 2MEKA 2A68C 5A35A 4OZCA 4WWMA 2VY3A 5CGKA 4HJ5A 1VQCA 4PG3A 1R9TH 2WFWA 4FXGC 4XDDA 2VUMB 1OXTA 2F0NA 5J22A 1V1OA 3E56A 4X62Q 2DNCA 1ZW7A 2FJ2A 4NXML 1C79A 2R7ZG 1E2ZA 1WCMG 4A3JG 3IL8A 2WB1G 4DK0A 1I94L 3D4DA 1P7EA 4IFDI 2Y5PA 3CCMA 3PIO3 4XT3B 3ZJVA 1A0IA 3GE3C 3GTMB 3S16B 1WXQA 1WD0A 1XYIA 2EPBA 2XRQD 1SSNA 1CSQA 3V2TA 2JA5B 2V1CC 2ONQA 3PSIA 4L2YA 2K1BA 3VDZA 3K0XA 1JE4A 3HOYB 2FCSA 1XNQL 4JV5Q 1S1QB 1E0ZA 4ULLA 4A3OA 1TWAH 1NCVA 2EY2A 4A3JH 5EKLA 3K6OA 3RCZA 2AWTA 2D0OA 5IOIA 1DONA 1PFMA 4LF8L 2KFKA 4IKGA 4A3LG 3ZXVA 4LF7L 1DCZA 2K0PA 2IL8A 3NVZA 2O2VB 2B2WA 5KYIA 1N32Q 3NSWA 3VUXA 2NVXB 3FEWX 2F0VA 4ICUA 5JXVA 4I6LB 2W3RA 2VUMH 2KC2A 2HD5B 2HDLA 3H6MA 2ZPYA 5L83A 2IO2B 3RLOA 3OIPA 1V49A 4U68A 4JBWA 1KM7A 4YTMB 3C19A 3K5NA 1NSNS 1MI0A 1PH3A 1ISNA 1BCPF 1TIID 1X9NA 4OIJA 4DR6Q 4ZRJA 1P0RA 3D4WA 2DYOA 2RDHA 1TYGB 2QIEB 1G91A 3U9OA 5DPRA 3GTMH 3S16H 4W9DA 4YSZB 2QKIC 3DCGA 2CJNA 3NZUA 2E2IH 2JA5H 3Q8CA 3HOYH 3ZGZA 1UEBA 1Y8NB 3NTHA 4DU9A 3IT4B 4C80A 3FHWA 3QC8B 4LUZA 3D6CA 1Q1BA 2D62A 2D3AA 4QIWB 1XCTL 3CSTA 2LXKA 4O42A 5LL6X 4IUMB 3UQAA 2D2CC 3GP7A 4EQNA 2NUCA 2NVTH 3CMMB 5JEAH 3S1QH 4M8AA 2GI9A 4IM2A 4JWUC 2XRSD 4KV6A 4AYBE 4YT0B 3RI7C 5GAEC 1YBYA 5FLXE 3AEEB 4KTAA 4ZRPA 5ISRA 1TR5A 3A4SC 3E3XA 2W82A 2PNHA 4M00A 1TWCB 1Z6HA 2YTXA 5C4XG 3QCAA 2NCNA 1XWEA 1FMAD 2OQ0A 4UY8C 4LFAQ 4KGSA 1M8AA 2LS01 1ENFA 5EQ0A 3VYSA 1SIFA 1ZXHA 2L76A 4US8A 5IGDA 1BO0A 1XX8A 3T16A 1E7VA 4BKSA 2WXKA 2A73B 2LJIA 1MG4A 2DZIA 1E3PA 2FCMA 3ZNZB 2KO3A 1ACCA 3AH7A 1NJIC 2G5DA 1VD2A 2WXJA 1CZWA 1SNDA 3NE5B 1JROA 3A5ZB 1WD1A 4IUPA 3TZDA 1CKNA 5ELNA 1XLQA 3KVFB 4D2KA 1WXMA 3HZXA 2K75A 1D7QA 2AX5A 1L6UA 5C4XH 2HTHA 1QOBA 3TMPB 4A6QA 2KWCA 3I72A 1A63A 2Z1CA 2UXCQ 2KNBA 2N0SB 4MM3B 3J80L 1Q81C 2ZM6L 1QOGA 1IZ6A 1T0YA 3VH3B 2JU6X 5MPOA 1IYJB 4B3MQ 3VA5A 5JEAJ 4DUYL 3WIMA 4JCVE 3C1FA 2E3TA 5H92C 4OWXB 2M17A 1J6QA 4XX5A 1EY6A 1W6KA 2EXZA 1DM0B 4LFCL 5KGUA 1WFYA 4L1BA 1ZUD2 1GUGA 4JG2A 2IGDA 3KUPA 1DOIA 3ML9A 1QE6A 2LXJA 2KJHB 5FR6A 2B2YA 4W9IA 4MELA 3AM9A 1WWTA 4B3RQ 1PDXA 2K6QA 1B2TA 1SYEA 1WXSA 2CHXA 2KHWB 1WR1A 3KF6B 1SRUA 2B76B 1GB4A 1DOMA 2NZHA 3NUCA 2EYMA 1VQFA 2FXQA 1Z47A 4XQNA 2JYOA 1C4CA 1HNXL 2OHFA 4FP5D 4DV5Q 3K9PB 2BDOA 4HKQA 2DHZA 1ZEQX 4DHZB 3D4RA 1EY4A 1RKNA 5E3FA 2RHQB 1FRRA 1FNUA 2VZKD 3AU5A 5DPTA 3V60A 2MBOA 3TEZA 3DWAA 3WWVA 4BOSC 3AV8A 1RAXA 2QMTA 3MP9A 2PW9A 4LK0M 3IG3A 1OXUA 2DLBA 3QIJA 4ZK9B 4P7IA 1QQRA 2X6LA 1C7YA 1IYFA 1SYCA 4C4VB 3CP0A 2RD0A 3DXJC 2LASA 3H0GB 1VQ5A 4M8MA 3FP9A 3RMHA 2MA9B 4C2MH 2RGFA 2R61A 4HJKA 4ITKA 5FLXc 2Z8LA 3L13A 1GHKA 3A1QA 1Q0WB 2MLBA 5BR8L 2VZKB 1FL0A 5C23A 2DY7A 4OWTB 1S40A 1JB7A 3N1XC 4NAMA 1FCLA 3SFEB 3VYTA 3FRPB 3RMKC 2MO0A 2AQ1B 1XO3A 2IGHA 1I5FA 5EPLA 5E6PA 4PYZA 3GQBA 3EVQA 2C35B 1LQBA 2JQRB 1K83B 2L52A 3QQ8B 1EY8A 4LF6Q 5D7GA 1MHHE 4IM3A 3QJYA 2D3CA 3PPAA 1X3GA 4BXXG 2RR9A 3B1LX 3LB8C 2CQOA 3IRBA 3NHHA 4DAYA 3I9V1 2KFJA 2C5LC 3OTOQ 2KT7A 3PT2B 4ILWA 4IWOA 2AQ3B 2YVCA 2FE8A 3PGEA 2YEPF 4BZAA 2PQAB 4LF4L 5IKCM 4GMVA 3BYYB 4JK1C 1UUPA 4QQBX 3J81L 4S3SA 1EFWA 3DOWA 3ZJUA 4J15A 2MP2A 1LTGD 2ES2A 4PNYA 4WAAA 1X56A 3RNGC 4KLKA 4BBNF 4H0LC 4EZLA 2GN5A 1LO5D 5J17A 1NAPA 4JI4Q 3EIVA 3QX1A 1SB3C 2PVOD 1VQGA 1X6OA 3I70A 5FO8B 3H0GH 3S1MH 2ID0A 3JAMc 2Q2UA 1E1TA 4GDLA 4RAUC 2ZXOA 2A69D 1WE6A 3T4AC 3DVNU 5IO9A 4GKJL 1PZJD 3I4OA 1F2RC 1GG3A 2NN6H 1AE2A 1EFID 4A4IA 3S17B 2ASQA 2XBBC 1ZP0B 5KNCA 2WQYB 4LJZC 2BVCA 3QOJA 4DF7A 1SE8A 4HCSA 1BBXC 1I3QB 1HUNA 2VH1A 2LVOA 3JAMi 1LT6D 2GBJA 1ASYA 5BO4B 1UE1A 3V61A 4L6TB 2FNJB 1OFFA 2F0JA 1F2LA 3KFUA 3GB1A 3KBGA 4DHJB 1PTOB 1JJ2A 4EZKA 4L5SA 1IHZA 2J4XA 2WDQB 1EWHA 1TT2A 1K8GA 2O5JC 3S2DH 3TEXA 5IWAQ 3A0JA 1YNJC 2PVGC 3M85A 3MHZA 4FBJB 3W5OA 5ELCA 4DFAA 2I07B 1R4PB 1N6ZA 2NBVB 3SFDB 4LLGM 5D3IB 4JI6Q 1VLBA 2JZ3B 1VS0A 5DAUA 4YY3Q 2PE9A 2ZVOA 5ELBA 3RLFA 2FMCA 2K5DA 3S17H 1GJXA 4DR1L 1QB5D 1WTRA 4LF5Q 1WXAA 1GAQB 4B9KA 3JVZX 2BS4B 2BYEA 5C44B 1EWIA 2EZVA 4MIUA 2N8NA 1QILA 4DK1A 3R3MA 2K5PA 2J0TD 4CKEA 2KZRA 3CPWA 2BWES 3AN1A 4KI0A 1WJNA 3DBRI 4R9WA 5ELEA 2D3GA 1KLGD 2LJ5A 1PFNA 1PH4A 1MI2A 2ENBA 4LFBL 1AFPA 1PTOH 2WDTB 4QIWE 1DOYA 4DNRB 3CC4A 5LMNQ 4JI7Q 2ZCBA 1N34Q 3IFDA 3P20A 4QUCA 3TJPA 2JN4A 5CV7A 3G6EA 3RZOH 2E2JH 4M0WB 2XNAC 2E8GA 2ZEQA 4NJ6A 4L5QA 3IFTA 4HJ7A 3UI3A 2RSNA 5K5PA 4X62L 1DYQA 2KEDA 3OJ3A 4DV0Q 3DQVA 1EQVA 2M8SA 5TSSA 3GTOB 3ERSX 5ELOA 4GOPC 3KH0A 4TMAB 3TBLD 5IYBG 1B3QA 1H9SB 1EOVA 4F8CB 1ZXIA 1JOQA 3RNEC 1EWCA 2NVYH 1Y1VB 3HGBA 1Q7YC 1A15A 2IT1A 3RLNA 2XN9C 2OEDA 1GKHA 1SE4A 4RF1A 4BWGB 2UUCQ 2XK5B 4C00A 5E4XA 3U7DA 3P4QB 5J18A 4YCVA 3A8IE 1PYBA 1HPCA 3S1RH 1BBWA 4JV5L 1ZXTA 4J6HA 4CKBA 1N60A 2JT4B 4ANWA 4AS1A 4MHEA 2I1KA 1MD2D 1RF2D 3S15B 4HLEA 5IYBH 4IOAA 3KQ4A 4RKLA 2E74C 4JI8Q 3A9JA 1DXMA 3QAQA 2EOTA 1SN8A 4ZOHC 4E71A 2FMMA 4JI0Q 4HCPB 1HNZL 1MGSA 2R92G 1N33Q 2EIFA 3AE3B 4PS3A 3GO5A 4HWIB 1CSPA 2F4VQ 3ZNHB 3PUZA 1N32L 1AEXA 3HRDD 3V96A 5D65A 1KRTA 4LF9Q 4DV3Q 2KLGA 1T0RC 2IPKD 2EY6A 1E8XA 2GBKA 1MJDA 2MBEA 1TKWB 2WXOA 2BE5D 3O65B 3VUYA 3GTOH 2WDVB 1P3QU 5CHVC 3T56B 4BKSD 4DK6C 2QA4A 1QKZA 4DHZE 1U4MA 4IFDH 2F3IA 1UBIA 4RNAA 5G3LF 4AIMA 4DR6L 3M7GA 2AKWB 1Y1VH 3PO3G 3Q69A 3RZDB 2F0PA 3BYTB 4RA8A 3TREA 2WXHA 2K25A 4YHHQ 2PW5A 1OQYA 5I2YA 3P75A 4MGIE 2X69A 1IYUA 4HJGE 3I4LA 2QF7A 3S15H 5DM73 3A55A 1NE3A 3BK1A 4AP4C 4WJ3M 1LV9A 4KDIC 4MGKE 3W5VB 3EFXD 4YTPB 4MN3A 4K0KL 4H13C 4NKLA 1N61A 1U4AA 1BR9A 3KLWA 4GDKA 1WI5A 3S1NB 2EJGC 3DDCB 1Q90A 5I6WA 1SBBB 2GVBA 4K14A 2Z9HA 1N9WA 4FDBA 4KMUC 4XYQA 3PZDA 4IQZA 4LFAL 2AL6A 4H2AA 3RZFA 4KGTA 3HHMA 3OYYA 4IFDJ 3MXGA 4ZUJA 3Q3FA 2HHHQ 4ODGA 2HDMA 3EUB2 3RZWC 2JA6G 5C2TB 1GOZA 1HQRD 1IBKQ 2H5XA 2KENA 4LWCA 2Q8TA 2JPHA 2LI5A 1H8CA 1RWSA 3BDLA 1GB1A 3HOXB 4ARCA 2YTYA 1QOFA 2N9KA 3B0AA 1ML0D 4BOZB 3T9LA 3RZDH 1GPXA 1M90C 2PZTA 1NVID 3MJ5A 2IHEA 2UXCL 1NUCA 3NBHB 3K81C 1PGAA 3EA6A 4B3ML 2KDFB 3WA0A 1UE7A 1D1KA 2AWNA 2OTLA 1VQLA 4S17A 1F1HA 2QHOA 2ICIA 1XD3B 1G291 1C0AA 4N9PA 4KHVA 1TGZB 1HCZA 1EIHA 5H8YE 4CDDC 1F9QA 3H9DA 4DDID 2WP9B 4RGOS 2ZJPA 3KDFA 4DV4Q 4B3RL 3S1NH 4A3FG 2MBQA 1K3BC 1STBA 3CIRB 5C4ZA 5JHAA 2K03A 3KLSA 1LT4D 4OVUA 2MX2A 4DV5L 3I55A 5IN7A 4JI5Q 1L4DB 1Y8RC 5CC4A 2WV6D 4OEMB 3M3YB 3AEBB 4FF4A 3HOXH 2UXBQ 4A90A 4A3FH 2D2QA 4OX9L 2L15A 1D5ZC 4W9KA 2TSSA 4KVGB 1Q12A 1EOTA 2A68D 2HIXA 3U4VA 3RN9C 3KUDB 4I65A 1ZDVA 2ZJQA 4C3IB 4E6IA 2ZW0A 4EX5A 3BDOA 4IZ8A 2K7VA 3BK2A 4HXDA 3V3XA 1V1PB 5IT9c 2JRHA 4KZ0A 3DUZA 1L2FA 1Q3LA 4W9FA 2OJRA 4JX1C 3PS6A 4P71A 4TV3A 5J39A 1CTMA 1PLFA 4BKGA 1WM3A 4URKA 1YMHE 4HMJA 5AUIA 2B63G 3UF8A 1JQ4A 3NOBA 3UIOB 3KW5B 2VNUD 3N32A 4R4TA 1V97A 2PIAA 4M8NA 1V80A 4S0RA 3SE0A 4LF6L 3HOWG 1ZOYB 1FPYA 1HFGA 4L5TA 2D3BA 4RG1A 4GDLB 4DBGA 1G6JA 1SMYC 3SXHA 2K5QA 4CDCC 3D0FA 4NMZA 4BA1I 3OTOL 2LVQA 1X3QA 2AMCB 2GB1A 2HQLA 1LACA 5LHY1 1YNXA 3D6WA 1WYDA 5T8IA 2A6HC 2M19A 1X3FA 4FHKA 1VQHA 2EKIA 3E0JA 4GN5A 1QNUA 2JP1A 1EL0A 4KKJA 2KX0A 3HOWH 4JI4L 4YWGG 1IXRA 1KTKA 3KK7A 5G5GA 2OCEA 4AUQC 2K32A 4C3IH 1VQEA 1Q82C 2GMIC 4NQLB 4LNIA 1QNKA 3AE4B 3EN2A 1WOCA 1A5RA 2EYFA 2ZW1A 2RQXA 3L0WB 1JJCB 4FXDA 1T9HA 4KN7C 5A2QL 2UUAQ 1STEA 4AJWA 1XPRA 3DVGX 2WXMA 1BQQT 1HTPA 5GXGB 4GOPA 4WRDA 3DHHC 4B0EA 1BCPD 1HUMA 2NBFA 4A3EB 2KTRA 2HQEA 1TWHB 2N1WA 3HEJA 2PPBC 1E2WA 4AYBG 1UE5A 4K5XA 4KN4C 2WHIA 2AL3A 1P9DU 1LYLA 3BZCA 3ICEA 1VR9A 3A4RA 3VXWA 2WP8J 3CCRA 2MH7A 2SNMA 2ZTEA 3SK8A 3CD6A 3N1YC 1S72A 2E2DC 3DMUA 1F9PA 3G48A 4OWWB 1HFNA 1JWAD 4HIDA 1E8YA 2WWZA 1OXVA 4E74A 1KH0A 4KKTA 1CA6A 2Z0DB 3H7PA 4CGYB 1VQ4A 1AH9A 4ZQ3A 1YOVB 5IWAL 1TT5B 1QUQB 2SNSA 1VQ7A 2KC1A 2VH2A 3G7LA 1KJTA 5HI1A 4KDLB 4K81A 4DN4M 2F0TA 1EY9A 4DR3Q 1HR0Q 1TWFH 4JI6L 5FOBB 4A93G 1ZPSA 3SDLC 5HFYA 1GUNA 3CCEA 3W2DA 4YY3L 4DR7L 4I6NB 2DJGC 4NW2A 2G45B 3G4SA 3P63A 2C7NB 2IGGA 4BY7B 1ZYRD 5CV6A 1PH5A 3I63C 3Q6SA 1X54A 2K33A 3NY5A 1G2TA 4LF5L 4A3EH 1VQNA 2UU7A 2IX3A 4H44C 2GBNA 3W1YA 5IYCG 1UH6A 1I4XA 2BYFA 3UDFA 5EDSA 2KCCA 3KJPA 1S5CD 1ILQA 4WORA 1OEYJ 4L23A 4A93H 2KKCA 4CJ1B 4ACFA 3ULPA 3OSOA 2LSSA 2IJ0A 2B2UC 1HHVA 3VYUA 3WAOA 4FJYA 1PFBA 1G6ZA 3K57A 2VQEQ 1VQOA 5LMNL 1V9PA 4IALA 2FCNA 1FNVA 2ZNVB 3FVQA 4JI7L 1GUWA 4MJSA 4B08A 4BBRB 1N34L 4A8XC 1IW7C 4A9AA 3ZKJC 3RN5A 1UWVA 1CMXB 2JJQA 2JA7G 2K8CA 4QAYA 2C60A 4JYAQ 2WINB 1XEEA 1VZ7A 2JE6I 4GXBA 1HEZE 2PO4A 1FGUA 1E9MA 1WTVA 4DV0L 2BS2B 3UGBB 3F2DA 2IX1A 2ZPNA 3ZJYC 3VH4B 2O2LD 2MSED 1L7YA 1PHJA 4BY7H 1ZDXA 4KIKB 1S3SG 1VZ8A 3KYCD 1YVCA 1O7YA 3DWQA 2K22A 2JA7H 1KAWA 1J7AA 3MXPA 1J5EQ 3Q8AA 4HDOA 1YN4A 3BVGA 3RN2A 2UUCL 1NNXA 1EU4A 4HKZE 4ANXA 2KOLA 3TP8A 4EZJA 4GN1A 2DAFA 3PIOA 3TS0A 1ICWA 4DR4Q 2NYZD 4FLHA 4NNJB 4QCLA 2NZOA 1IYVA 4PS8A 1HRJA 3FKYA 3GTJB 4A3BB 4KHZA 3CMAA 1J7CA 5M9OA 3NQIA 4JI8L 1OXXK 3MA2B 4C3JB 3P1MA 1FFVA 1WMHB 4R4IA 4A3IB 1RDPD 3HFZB 3GOEA 1K52A 4BBRH 4JI0L 3CSFA 3JSVB 4CQNA 1N33L 1SJHD 1VCBA 1F2YA 2F4VL 1BUIC 3MXNA 4WQMA 3CPFA 1S5BD 2JSOA 3KBXA 5J3BA 2EE1A 3C3LA 1GNUA 4LF9L 4DV3L 1C3TA 1EQTA 2PTLA 3QO2A 2L1AA 1MJCA 1CHQD 2JQOA 1JOOA 4G4KA 4PV1C 4RFBA 3BS1A 4KHPQ 1V9JA 4GB9A 1ROEA 2WXLA 2A1AA 1UGMA 2IDYA 2VUMG 4CJ0B 3FAHA 2N7DA 2ACZB 1Y1WB 1JMCA 5AZFA 2F0FA 4GNXC 2IZVB 4KY5A 3U50C 4GLSC 5FKAC 4HJ9A 3KF8B 4A3MB 3U7ZA 1WE7A 5EPKA 4QUFA 1WX7A 4ZKCB 4YHHL 1OTCA 1IL2A 4MSQB 1GXDC 4UP9A 3M3JA 2GOWA 3HK0A 3SHQA 4A55A 2RPQA 3PVLA 3GTJH 2JA5G 4NAWB 2B2VC 2GVAA 3PMFA 4NJCA 4C3JH 3DLLA 3HOYG 1C48A 4CDFC 3SU8X 1KHIA 1VQDA 2WKDA 4A3IH 1FM0D 1UBQA 4US9A 5M3FB 3P4PB 4OO1I 4DV2Q 4DR5Q 5JEAG 2N7JA 3OJ4B 5T1GA 2R6GA 4TQUS 5D3DA 2DAJA 4FNFA 3R8BA 2MCNB 1PRTC 1ENCA 5C0XI 3AFPA 2PQEA 3H3VI 5AZGA 3IFWB 3NJTA 3PRZA 4MDKE 4IOIE 1VMPA 2KCTA 4ARIA 1YHAA 4F7XA 4IUTA 1GVPA 2HHHL 3TMEA 3RFZB 1V81A 1SROA 3S24A 3T1YQ 2QILA 1IBKL 1T0SC 4IW0A 4HROA 4Q0FA 3RNAC 1SE2A 4ZLTF 1Y1WH 2ON8A 1BNZA 4DV7Q 1EF5A 1BUVT 3NBIA 1Y8OB 3HVZA 3OMCA 1YNJD 2XEWA 4A3MH 2MQJA 3C8YA 4IPHA 5JPMC 4R8NA 2B8FA 1QWYA 3TP5A 2ZTCA 3BINA 3EHVA 4JI2Q 4II2B 2NVXH 2MW5A 3HG9A 2I46A 1YX6B 2E76C 1JWMD 4ME3A 1FD7D 4CBVA 5IAAC 1XT9B 4ZHOA 2HE7A 2CVRA 3M4YA 4WJWA 1C1YB 1PGXA 2EELA 2KWUB 1YIWA 2HUGA 2IWHA 3PLUA 3GD7A 4EQOA 4XE0A 3L0OA 4IURA 1YHQA 2WYQA 4DV4L 2HJ1A 2PKOA 2G9DA 2K4KA 2CW0C 3I57A 1XCQL 3J80E 2ZXRA 1I6HB 5HGQA 2LUEA 4R4CA 3T3OA 4JI5L 4RHRA 1D4BA 3I3TB 4X65Q 4LNQA 2E5LQ 3HRZC 2L4NA 1U4RA 1QJOA 1FXTB 1I6VC 1E22A 2UXBL 5JOBA 2ICEC 1EEID 5EAYA 4NXNQ 3PO2B 3W9CB 2RKSA 2HJ8A 1BVSA 1KRSA 1UGJA 2FIFA 2KVMA 5KIXA 1ZE3D 1CZGA 1SYFA 1FYCA 2L1BA 1H9RA 2J53A 3LX0A 3UI2A 1TWCH 4NPSA 4C1NK 2LGIA 3T3NA 2A8VA 3AEAB 3W1SC 3GTKB 4NP5A 4JI3Q 2E6XA 2JWZA 5I2XA 5GAHC 2XSCA 4JBKA 1YJIA 4M02A 2KCNA 1C8CA 2LMCA 5E7NA 4MZ9A 5C3XA 2CH4A 1MG8A 4WJNA 2JA9A 2JRIB 1WGKA 3PV1A 1V5TA 2ZTDA 3M9BA 2K9XA 3PTFC 3HS0C 5HY6A 1HZ9A 1WTXA 2QEJC 2JZZA 4P16A 1Y14B 3U8ZA 1I6HH 2KANA 4XDXA 1VF7A 1G51A 3JAML 2BKRB 1ET6A 2B2UA 3VR2A 3R2IA 4FADA 4RM9A 2BYTA 2R7ZB 3A74A 2CU3A 3WALA 3KJOA 2DNEA 2RDFA 3WAPA 4BY1B 2DYMA 3EGRA 1G8ZD 4QGUA 1LM0A 3CRLC 5NUCA 4XQJA 1JWSD 1RFAA 2FBWB 3EFUA 3AEVA 1SNCA 2Q5WD 1EYCA 1H9MA 3X3NA 3M4OB 2PEAA 1B44D 1AWDA 2NTSA 1L5PA 2M1MA 2QGQA 3ZTDA 2EYOA 2D9UA 3L2PA 4YL8A 4YWMA 3ZIMA 2N78A 2WAQB 3J81j 2D11A 2KN4A 2F0WA 4ANUA 4PZ6A 2X6GA 3K7AB 1YNNC 3AEGB 3RD4A 1K8RB 1SAPA 2UUAL 3ZJTA 4C7ZA 1T6BX 1A3UA 3H0GG 2ALYB 1MJEA 1SFOB 4AQ7A 1EEFD 4DAMA 3PUXA 3J81E 3FPUB 4GKKQ 1HTQA 1Q10A 3N1ZC 5G3LD 3M4QA 4MTKA 4ZDVA 1HJPA 1E90A 4HTHA 2RVLA 3MTSA 5DM63 3A5UA 2NN6G 1N62A 4OELB 4FJVB 5KYLA 1HTLD 3STBC 1C78A 1U4PA 1L1OB 3U2SC 1RJTA 1I50B 5IIFA 4B6WA 1V8QA 3F1ZA 3BIID 2K6DB 3UE1A 2F0MA 2D0PA 3PV0A 4BAXA 3K59A 4ZRKA 4TSSA 2BBCA 2JYEA 4RMAA 4BY1H 3NG0A 4HRSA 2F0HA 3A7AB 1NR4A 4ZUIA 1JRUA 1F2MA 3I3CA 4ZAIA 3DEOA 2BB5A 1SXTA 4B9WA 2HCIA 3LNNA 3M4OH 4J1MA 1J9OA 5JZEB 3PRMB 1KAAA 2M00A 2K8HA 3L16A 4DR3L 1HR0L 2LFNA 5BMHA 3FILB 1SNOA 2CS4A 4DXAB 1K83H 1VQ6A 1Q5WB 2W54A 3LXFA 2PNRC 1Q1OA 4N6EB 4WH4A 3PGZA 5KNBA 2ZT9C 1CI3M 2CHWA 1SEBD 4C1NI 1BT0A 2KMCA 2L05A 4RM8A 4WURA 5DPSA 1QCBD 3CCQA 4F1SA 1VQAA 3TP7A 2DBYA 2KDBA 2OTJA 1FJGQ 4G50A 4GNXA 1U4LA 4DV1Q 3HIZA 3N30A 2WXRA 1DOLA 3NZSA 2V3SA 2PJHA 1IBLQ 4FULA 4XXEA 3ZO5B 1I50H 4P72A 2G4SA 1I4GA 3K9OB 1UEAB 1OGWA 2VQEL 1TBEA 3HM3A 2PCFB 1PH6A 3HUIA 2B2VA 4EOYA 4O1NA 1HA5A 5LMUQ 1E8WA 3ERQA 1WJJA 1WTPA 1WI0A 2NWGA 2EXDA 1DZ1A 2Q2TA 4I6PA 4MGZE 1MBYA 4JYAL 4HIOA 1B4OA 2N4FA 4OHJA 2Z0EB 1I3QH 3CQZB 4IO9A 1F9SA 4H02A 3W5UB 1VDZA 4KV2A 3GV6A 2WDRB 3FKIB 4HN7A 4IJLA 4ICVA 3NTIA 2Z0SA 4P6VF 1RTOA 5EE1A 2JXXA 1Z9FA 2A5HA 2F0SA 3A56A 5M3MB 3TS2A 1CM9A 2BW2A 1IBXA 2MBBB 1K8AC 1PH1A 5DEHA 1KC8C 1PH7A 2DZKA 1J5EL 1LLRD 3AXCA 4W9GA 4BS9A 2CR5A 1JR0D 1F9RA 2DUDA 4ME5A 3BJUA 2J0MA 4BBSB 2F0IA 3MHBA 3OMGA 1ONLA 1VQMA 1UD7A 3AEFB 1Y56A 4CHKA 4DR4L 2BA0A 5C44G 4NZLB 5LLIA 4W9EA 2V3PA 3PHWB 2IX0A 2WU5B 3R93A 1QZGA 4U673 1JOKA 4K6DA 3HKSA 4DK3C 3S2HB 1GO3E 1SNPA 5C5MA 1ESFA 2BF8B 3VDYA 1SNQA 1LTBD 4UHVA 3A54A 3GTGB 1WTWA 1W3SA 1J19A 2CHZA 2H88B 2KFKB 4JQWC 4FA6A 1ICFB 1WYGA 2PI2E 2OXPA 2O6VA 4B95A 4OXPA 5IE8A 4K7SA 3IBEA 2K5NA 1LM8B 5C44H 1BBUA 2E75C 1LTLA 3CQZH 4DNIA 2K5HA 1EO6A 3RULA 4KHPL 2XVSA 2K3UA 1SMYD 4A3CH 1EY5A 2WX0A 1QLBB 3QR8A 2JWUA 2YV5A 4APVA 3DBLI 3MTNB 1FO4A 5CV8A 4NB3A 5M3MH 4OGQC 3PZ7A 3PHXB 3RYTA 3WOEA 4LMQD 1A6XA 1WZ3A 5I4DA 2Q2IA 2A6HD 3I73A 2VQFQ 2FUG1 2GRIA 2LHDA 5CX3A 2DZJA 1WGGA 3MFYA 2WXPA 1B50A 4IFDG 1FVIA 1K9MC 3TRZA 4BBSH 3AE8B 2DN8A 1II3A 4W9HA 5IYDH 1Y1VG 2WKCA 5CORA 3UE0A 1B9NA 1CKMA 3BU2A 1XTDA 3A33B 4ZRIA 1WFQA 5CHWA 5HHDG 3W1SA 3GS2A 1HXYD 3S2HH 2XGTA 2DENB 4G7ZC 4A20A 2I5LX 2Y5BB 3HKZB 3A8JE 3GTGH 2LRUA 4DV2L 4FJZA 1U0LA 2XIWA 2KDIA 2NPTA 1B7YB 4DR5L 3VRBB 2F0EA 2EMSA 5AEKB 3DHIC 4G0NB 1QZEA 4JIOU 4N58A 5IP7H 1D1IA 1KNEA 1WGRA 2FFKB 1YN3A 1NBWA 1UAPA 1VQIA 2M0XA 3R7QA 2LD9A 2KN5A 1EY7A 1PXUA 5H1SE 1L1OC 3T1YL 3KLRA 2XTIA 3L08A 2FIDA 3K8AA 2KMMA 3RT3B 2KTFA 2K52A 4DV7L 1L0VB 4I7ZC 1E7ZA 1KDBA 2Y0SB 3APFA 3E6ZX 1K0SA 5FLMG 3BZKA 1Y69U 1KF6B 1T3QA 3P42A 1CKNB 3AECB 1VMCA 3M95A 2YTVA 4JI2L 2JA8B 2J52A 2LGSA 3AE6B 1F52A 2WAQE 4HSVA 1R7SA 2N9PC 1YEZA 3S14B 5IP9G 3HOVB 1AE3A 5M5XB 1K8OA 2KA7A 3CF6E 1PZID 4FVMA 2B2TC 1YN5A 2BPSA 4P1CC 4UPAA 4GU2A 1Y8PB 4F88A 1CKOA 1X3EA 5FLMH 1MSHA 3ZUNA 5M5WB 1F2RI 2CKHB 4JVZA 2I0QA 1PTOC 2A69C 3HM6X 4P1BC 2F1MA 3B6YA 2ATWA 5C0XH 1PGBA 1QT9A 3H3VH 2D07B 2Z4HA 3PO0A 4HCNB 4EFOA 1E10A 1N8RC 3NPPA 1SF0A 5LMNW 2KVRA 3RR5A 3VA7A 5G55A 2VB2X 1QVGA 1C9FA 2PMZB 5IT9L 5IP9H 4MGYE 3EC8A 1MFWA 4RGMA 4LDTD 2LZ6A 3Q8EA 4X65L 3FMCA 2E5LL 1LGRA 4P75A 1B1ZA 3AE5B 3LYYA 3ZXRA 2VL6A 1BOSA 4AOFA 3AFQA 4NXNL 1K53A 4F87A 1LFDA 1EIGA 5EKKA 3MXUA 2EYHA 2KEEA 3HP3A 4EGVA 3WANA 1AN8A 2RBMA 2WS3B 1STYA 3GZNB 2N7EA 3HOXG 2ZVNA 2L32A 1LT3D 1TXYA 3KLSX 1C4PA 1Q8KA 5IP4D 1WYWB 4AQYQ 1XMOQ 4K7WA 4LDTB 1JICA 5M5XH 4JI3L 5EE3A 4KJNA 4A3DB 2PZWA 3U4EG 2VB3X 4XQQA 4N8FA 3A1QB 3X3MA 3TUOA 1I7HA 1MPEA 1RCVD 3AI5A 4IPDA 1XXGA 3NVWA 1SYBA 3CC2A 4X66Q 5C0XJ 2KUMA 2R2QA 4J6IA 5C3EB 1V6EA 1AZPA 1IBMQ 4HR7B 1A3VA 2WIIB 4N8X1 3RNUA 2HTME 4DUZQ 1X32A 2M2LA 1EWYC 5HGTA 1EIFA 2RSOA 1EU3A 3I4MB 3IHPC 2L7RA 4DAYB 2CH4W 1FEHA 1I35A 1J7BA 2KWVB 4IC7B 4DAVA 5IODA 3I4NB 1UWXA 3NXWA 4A3KB 1U9RA 4MTNA 1RHPA 4BKTA 3SD5A 1SE3A 2MP2B 1TKGA 4N9F4 1D2BA 3S2AA 2SDFA 1SGHA 2MFIA 3MEHA 3WOFA 1WJ4A 4HSPA 2F0KA 4J8QA 1FFUA 1WGHA 3R66C 4HCEA 2PW7A 4A75A 1WTOA 2X38A 3D3RA 3CCSA 2L3ZA 4PT5A 2V4LA 2UYZB 1B9MA 4TVAB 4C3IG 1A8VA 4A3DH 1NENB 4NY0A 1TZOA 3OWFA 2SEBD 1X3PA 3Q14C 5KHOA 4GKKL 1FIQA 3CKIB 3TIXA 4MM3A 3OPOA 1EUJA 4KZCA 4LW1A 1O7ZA 3M3YH 1B3AA 4JOIC 3AB9A 5C3EH 3SEBA 3PIP3 4DQOC 4ANVA 4KSLC 4WJQA 4W9JA 1ET9A 3BWUD 4XZ4A 3OLMD 2F0LA 4R4OA 3M63B 4ZRQA 4LUVA 4HAEA 4FHJA 4JWSC 2INDC 3ZRFA 2UXDQ 5A2QE 1TTNA 3PUWA 3VQIA 3I4MH 5CHFA 2FAZA 2AQ2B 4MSMB 1OQQA 4P74A 3I4NH 4CYEA 3KF6A 5K36H 4A3KH 3ONAB 1RFKA 2IW3A 1IGCA 4RWSC 5EBDA 3VR8B 2EDGA 5BYSA 1XPOA 1V86A 1PRTD 5DLQE 4IUQA 4QL5A 4I7AA 2KHSA 5IY0A 1V1QA 3PRPB 4EQ5A 3FDTA 4UP7A 4UDUC 2HIVA 4LNOA 3QWZB 2CQAA 3AEDB 2MGSA 2V9HA 4HK2A 2F52A 2F3WA 1HZAA 3P1HA 1Q86C 4HPMB 2B39A 3K7UC 5CV5A 2BE5C 1NTGA 2WXFA 3LGJA 4RCNA 5EE0A 1FJGL 4LAAA 3NZ3A 1BCPB 4DV1L 3FC4A 3Q6BA 3SDZA 3M7NA 3ZLZA 2VZAA 3VAWA 4L8JA 1D6EC 3RUZA 1GHJA 5CV4A 5IGEA 4A3EG 1IBLL 4B3SQ 3MZ5A 3R2TA 2RMMA 3L17A 2Z4IA 1PFSA 3UDIA 5AUKA 4LNFA 2R93B 4RHSA 1N5WA 5G2NA 2L55A 2RCFA 2NTTA 1O78A 4MEMA 3I90A 1DOKA 4WIPA 5LMUL 5IOCA 5F2DA 5JVH3 3CWIA 2JEBI 3HKZE 1NR2A 2GBRA 2ZCCA 1W6JA 2O6VD 4JL9A 2F0OA 1V8CA 1WR6E 4OVVA 3F8TA 1GUTA 2CW0D 1TWHH 1JT8A 4C56C 3CRKC 3MAQA 3LDZE 1I42A 1XLPA 1S5FD 5ELFA 3I5JC 3BG3A 2PQAA 1CA5A 2YU9B 4IUNA 3OAWA 3Q24A 4K2KA 3IAYA 3W1BA 3A8KE 1JJGA 2WU2B 2EMTA 4BVUC 2QCPX 4DNTB 3K5LA 4CO7A 2V3NA 2N9LA 1F0ZA 3JC66 3LWEA 3DM1A 4GLXA 2CFMA 1AARA 2B8GA 4KK7A 4XIGS 1NY4A 4BY7G 3PREA 2Y0SE 3AB5A 3VRAB 4AJYB 1KLUD 4EQPA 1QF6A 4JE3B 1E8ZA 2VRRB 1X1MA 3X23A 1MHXA 2IY0B 2EQSA 1EIYB 1UNSA 2FUHB 2JSVX 2IY1B 4FXKC 3H1UA 3MHSD 4IDIA 5IGBA 2UU9Q 3W3AA 1C4AA 2KHIA 2JXTA 3MC0B 4PQXA 2IY5B 3A9JB 4IPGA 2ASBA 2B2TA 3N6RA 3GE8C 1HE8A 5EPJA 2N49A 3EROA 3PSEB 2DY8A 1WTQA 2N1VA 2WX1A 4DXGA 2PPHA 3DWMA 3VYRA 1WX9A 3TEYA 5JPNC 4POFA 4BBRG 1XTCD 1P1AA 4C3HB 2AWOA 3MVVA 3N9YC 3B2FA 1JQYD 4X3TA 5BN3A 1I4PA 4KKSA 2Q8IB 4K3BA 4PK1A 2QDLA 2PMZE 3I8ZA 3DEPA 4WJPA 2XWJB 1TU2B 3D31A 2DWQA 1WGDA 3DBLB 3VR9B 3TL5A 4REZA 2HDEA 2MNAA 2IO0B 1T5EA 1NBFC 1I4QA 1KIXA 1J8CA 5FK9C 3OHXC 4A76A 3P4SB 2Q8RE 4JW0A 2K14A 3GTLB 2VQFL 1TWAB 2MHJA 4ASWC 1WCMB 1VQJA 4A3JB 2WB1B 5J2RA 5GQOA 1XLOA 5KHQA 1YD8U 3ETRA 2PYKA 2W9NA 3M62B 4EUTA 3F2BA 3H94A 2L8JA 2EYLA 1HZCA 1YJJA 2RF4A 3QJZA 3IT6B 3L7ZC 1G6PA 1ASZA 4XYCA 1VF5C 1VDVA 2I2YA 3H91A 2I5HA 1ZKOA 4A3BG 1UZXB 4OZBA 3H7SA 5LNK1 4C3JG 4IN3A 4H7BA 4A3IG 1CZPA 2WGSA 4GDKB 4B0MA 4K2LA 4C3HH 1PV4A 1TKEA 1Q46A 3STBD 1OTRB 3WAMA 3VR5A 2NB0A 5AJ3Q 4DA2A 3SK5A 3K5OA 3J9CA 3MFGA 4IUUA 1Q1EA 1K50A 4CKCA 5CV9A 3J7ZC 1XF5L 2ZZPB 2E2IB 5EKIA 5C6AA 5KNDA 2MUYA 4A3BH 4M0WA 2EJFC 3NRZA 2BOSA 1VRAB 1STNA 3GTLH 1HR0W 1WCMH 4XT1B 2BQQA 3E9SA 3J7A5 1Y1WG 2NVTB 1JW9D 2QW7A 3JW0X 1E2VA 1KABA 3S1QB 1JRPA 1U5KA 1DD2A 2NVUI 1H9SA 1PRTF 2C5CA 1A2TA 2F0UA 4A3MG 3TP6A 1HNZQ 1P98A 1A70A 1HTOA 1IPGA 2K04A 2L83A 3DM3A 2C9WB 2KJRA 2NMQA 1KFYB 2XK5A 1NYRA 2JY6A 1E24A 5JH5C 1NI2A 3TQYA 1PFDA 4M01A 1CQVA 3ENEA 4LK1C 3KDFB 1VJKA 4YTNB 4JOIA 2F0QA 5M3FG 4K8IA 4A3LH 1KOTA 1BCPC 2O4XA 1WY8A 5E6JA 4PMCA 1WRDB 3VUWA 4IJHA 2MP1A 1WTHA 2FCQA 3LJ3A 5C4XB 2LY7A 3ML8A 3VTUA 3Q3OC 2REXA 2ZXPA 1VQPA 1I4HA 3GV3A 4FF2A 1WF9A 3M4PA 4DV6Q 4DXFA 3T1HQ 2H1EA 3GTPB 3CAMA 5M3FH 5CTRC 1DGJA 4QB4A 1CK1A 4JGHB 2MHVA 2NS5A 4IWPA 4K0KQ 4RMFA 3F2CA 4Z9CB 4AQYL 2C9OA 1XMOL 5C4HA 1SSOA 2LGYA 1O7LA 1YJ9A 1X55A 2TMPA 5FLXL 2KCMA 3C2PA 1Q8IA 2UUBQ 2I1JA 1EM7A 2EVBA 2LWPA 4G7HC 1W2BA 1XQQA 1VQBA 3QK0A 4XTCS 4X66L 2DX5B 3CCLA 2F0DA 3EQLC 2V4DA 5EGTA 4G7OC 2JVCA 4HIMA 1BF4A 1JMLA 4TQ1A 2EY1A 1GM5A 1QVCA 5I9OA 1ZYRC 2EYPA 1IBML 3AE9B 1S5DD 2ZNVC 4TQ0A 5GADC 2JUOA 2F03A 5I9PA 2FINB 4DUZL 2J7ZA 4ALPA 3GZNI 4GIVA 3Q8FA 2A6EC 4TKNA 1C4QA 2LFIA 5BMGA 4CDEC 2FHTA 3N3KB 2LXCA 5DCNA 4C2MB 4KD4A 1Z2MA 3GTPH 1T5XD 5CR3A 5LXIB 2K1FA 3UQBA 2G1EA 2W55A 3PO2G 4WFN3 2MJ8A 4GN4B 2MJDA 2I38A 4X6AH 4AH6A 3JAME 1XJVA 1AZQA 2BA1A 3DBHI 1J0GA 3CHBD 2ZJRA 1R4QB 2GLSA 2KDEB 2LGXA 5CMDA 3AE7B 2BTEA 4LCDE 4MT5A 3T13A 3OOCA 1SDFA 3QIAA 3CMEA 3SHLA 3MC8A 5JJIA 4K8JA 2B3GA 3BVZA 1PYSB 1YNTE 4N59A 1HQMC 2IHFA 4MH8A 4PYUA 3QHTA 4GOPB 1OXSC 4UP8A 2BH8A 4DGZA 3NBHA 3RPFC 1X65A 2KTRB 2BGFA 1TJEA 2INCC 5COYA 3PO2H 1K0RA 2KXJA 3HVDA 1AW7A 4KGRA 2INPE 1WXVA 2K28A 2QCZA 1S5ED 2C7HA 3PLVA 3Q8DA 1YX5B 2KQSA 3ND9A 4M1UB 5E1FA 2Y5CA 3APCA 4CHTB 1H9JA 4OX9Q 2C7MB 2UXDL 3H6NA 1GJZA 1D5MC 1I4RA 4DAPA 3TEHB 4NDXA 2O5IC 3KWVA 3QG1A 4G57A 4Q2JA 2Z6KC 1NMFA 3GTKH 1YJWA 2Q2HA 1LTRD 4ZKBB 3S1MB 1E1OA 3H7PB 1N36Q 2PZUA 2JZPA
chains in the Genus database with same CATH topology
2VXWA 3NQTA 2JYTA 3AE2B 5FO7B 1PMRA 5IGCA 1EYAA 3OIQA 4RKBA 1DJRD 5IGFA 1GUSA 4XDCA 5FR3A 3WCQA 1JC7A 1JWBD 3OWEB 1LTAD 1S4ZA 3G6JB 2WXIA 3E5SA 4X3KA 2EYJA 2OF1A 3QWNA 5CBEE 3S9WA 1ESRA 1V1PA 1CJEA 5HG2A 4KY6A 5I6YA 3IAM1 3T53B 3B2GA 3S2DB 5EBCA 1TS5A 4F8MA 1FNWA 3NVVA 1F77A 2BCOA 4R8IA 1KDAA 5C5LA 1EZ6A 4UAIA 5LL6S 3VR3A 1KDCA 3F2UA 3NUHB 1KRHA 4HEDA 1PTOD 1AYFA 4LTUA 2WNMA 3K0YA 3TEWA 2QJLA 5J1ZA 4WAFA 4V0BA 3CU7A 3IXSA 2M0AA 1CHPD 4YSXB 5IGGA 4ABNA 4HEA1 3NS1A 3MWYW 1H9KA 2NVQB 2H4OA 4K6LA 2AUJD 2OT2A 3AMZA 3RZOB 2E2JB 2BT6A 1CFMA 1JALA 3GTQB 1QOHA 2AUKA 3BVMA 1IUEA 2WXNA 3NTKA 1B9RA 4V190 1RD9D 1E0BA 3TBIB 2RPVA 2NVYB 4KD3A 4RGTA 1FGBD 1O80A 3L9AX 4JPSA 3ABVB 2BDNA 3R3OA 5AFWA 2JEAI 3S1RB 2K01A 3NWTA 1GUOA 2HCCA 2MJ3A 2L11A 1JORA 1SYGA 4RCOA 3ITPA 5BYQA 2W3SA 1TKYA 1C77A 3Q22A 3DHQA 1LABA 2D5DA 4QF4A 1V43A 1MSGA 3QOLA 4OVZA 3C1EA 4TKOB 3L4PA 2F3VA 4QMGA 3J7AF 4B9XA 1CQFA 3VR6A 3BZDB 1RODA 1TY2A 2K05A 2R92B 4RF0A 1AP0A 1TWGB 1YQ3B 2KAJA 1STGA 5HURA 4USAA 4CJ2C 2L12A 4KKIA 1IKLA 3HOUB 1L4ZB 4XWTA 1F2ZA 2KECA 3H09A 4KJOA 3T51B 3NP8A 1EZ8A 3PO3B 1M4VA 2L5TA 1E7PB 4KX6B 4X3SA 2M9VA 1RM6C 3B9JA 1OO9B 1OQRA 1JB3A 4FXCA 4HMIA 1G2SA 2GA4B 5JVG3 2Y3AA 3K58A 2SAKA 2J42A 3Q0AA 1PUTA 5BN5A 5CBAE 1FD6A 3PUVA 4EVOA 4OIKA 3TSSA 4OO1G 1E6EB 1HZ5A 1L6VA 1FXAA 2JX5A 5C0XG 5G5HA 4FO2A 4OW0A 3ZYYX 2INNE 3SK4A 2MJEA 1CT1D 1WRIA 2JA6B 4OO1H 1UWMA 1LTTD 3NK9A 2N55A 1QOAA 5KEEA 1XLNA 1IKMA 1PTOF 1STHA 4ZRZA 5IT9E 3IAS1 1HZ6A 3IKJA 2QSDA 3KF8A 1PZKD 2N88A 3HOZB 2V0GA 2LKVA 5JJZA 4EE2A 2LMCB 4FF1A 2M56B 4TRDA 1QG7A 1IW7D 3TDQA 1LT5D 3O13A 3AU7A 2E2HB 4MACA 3L3OC 1PYWD 3I91A 2WXQA 4A3FB 5D14A 1MVKA 4XWWA 2MPMA 5FO9B 2KJXA 2K6AA 4R3DA 4RGNA 1BDOA 2KACA 3SR1A 1N63A 1TS4A 2KQ4X 2RA4A 1TS2A 1A2UA 1C76A 2KQ3A 1IL8A 2LUMA 5EE9A 2EJMA 2BB6A 2A74C 2QDBA 1Z7TA 3SVMA 4N9TA 1VZ6A 1STAA 3EJIA 1K8MA 1FR3A 3URYA 2LHEA 1L0YB 2B63B 2EY5A 4KKUA 2R3ZA 1B53A 3D8GA 2WACA 5JAVA 5CYUA 2B2WC 3HOWB 5BMIA 4L63B 3V05A 1N5XA 3AE1B 1P7FA 2OEOA 2LEKA 4RH6A 3NVYA 3BDCA 1FCCC 3U52E 1VCIA 5K36G 3SR6A 3P7JA 4P2CB 4XYOA 1EY0A 3LWUA 1LTSD 3PZ8A 2PLPA 1BXTA 2KDMA 4ID6A 2L9HA 5BYRA 3PUYA 1HA6A 2D5GA 4J3OD 3KWLA 1DOXA 1SNMA 1IGDA 5BN4A 4AYBB 1NI3A 2KWDA 2YYZA 3WDNA 2NN6I 1BMLC 3H3VC 1ILPA 4FF3A 1TWFB 1JWUD 1TS3A 2RDGA 2PMVA 3J7AV 2V4IB 1TVXA 3OW7A 4YSYB 5C4JB 2CHBD 1D5XC 1PDQA 1PRTB 2YEPB 1SYDA 3C46A 2BS3B 2L0CA 1FXIA 4K5VA 3H8HA 2F0GA 4A93B 1K51A 1IBXB 2WLBA 5DNFA 4Y7NB 3ZQ4A 2JXMB 1LTID 4ZHPA 1SIJA 1WSPA 3K5MA 1WVLA 4IUVA 1JCKB 4A3GB 3A7LA 3SK6A 4OZAA 2B2YC 2H89B 5M5YB 4KY7A 1TQOA 5C3JB 2SOBA 4K5WA 5EJWA 3DWPA 3Q23A 1FRDA 3J7YW 3FPPA 3QB3A 4GZYC 4PMWA 2JA7B 2A6ED 1KNAA 1NEKB 3P4RB 3AMUA 5ELDA 2F4IA 3Q8BA 3U9SA 1J8IA 1R9TB 3FILA 3DWGC 4BA2I 3NWSA 5T1IA 3TZUA 5KRUA 4PMBA 1ENAA 2CJOA 4X3UA 2XWBB 1RTNA 4ZYSA 4FYDA 3ND8A 4YIJA 1EYDA 5C3WA 4YXDB 1A3TA 3TN2A 3N52A 1YQ4B 2WXGA 4OL7A 2NZ1D 1TY0A 1RYJA 1L0XB 1SJED 4C3HG 4Q5VA 1NYQA 1YNND 2G9HD 5E4WC 2K5WA 3VR4A 2MEKA 2A68C 5A35A 4OZCA 4WWMA 5CGKA 4FXGC 4XDDA 2VUMB 1OXTA 2F0NA 5J22A 1V1OA 3E56A 2DNCA 2FJ2A 1C79A 1E2ZA 3IL8A 4DK0A 3D4DA 1P7EA 4IFDI 2Y5PA 3PIO3 4XT3B 3ZJVA 3GTMB 3S16B 1WXQA 1WD0A 1XYIA 2EPBA 2XRQD 1SSNA 3V2TA 2JA5B 2ONQA 4L2YA 2K1BA 3HOYB 1JE4A 1E0ZA 4ULLA 1NCVA 2EY2A 5EKLA 3K6OA 1DONA 1PFMA 4IKGA 1DCZA 2K0PA 2IL8A 3NVZA 2B2WA 5KYIA 3NSWA 2NVXB 3FEWX 2F0VA 5JXVA 2W3RA 2HDLA 3H6MA 3OIPA 4U68A 4JBWA 4YTMB 3K5NA 1NSNS 1MI0A 1BCPF 1TIID 4OIJA 3D4WA 2DYOA 2RDHA 1TYGB 2QIEB 1G91A 3U9OA 4YSZB 2QKIC 2CJNA 3Q8CA 3ZGZA 1Y8NB 3NTHA 4DU9A 3IT4B 4C80A 3D6CA 1Q1BA 2D62A 4QIWB 1XCTL 4O42A 5LL6X 2D2CC 3GP7A 4EQNA 2NUCA 5JEAH 4M8AA 2GI9A 4JWUC 2XRSD 4KV6A 4YT0B 5FLXE 3AEEB 4KTAA 4ZRPA 5ISRA 1TR5A 2W82A 1TWCB 1Z6HA 1XWEA 1FMAD 4KGSA 1M8AA 2LS01 1ENFA 5EQ0A 3VYSA 1ZXHA 4US8A 5IGDA 1BO0A 1XX8A 3T16A 2WXKA 2A73B 2LJIA 1ACCA 3AH7A 2WXJA 1CZWA 1SNDA 3NE5B 1JROA 1WD1A 4IUPA 3TZDA 1XLQA 4D2KA 3HZXA 4A6QA 2AX5A 1L6UA 1QOBA 2N0SB 3I72A 2Z1CA 4MM3B 3J80L 1QOGA 2JU6X 5MPOA 3VA5A 5JEAJ 3C1FA 2E3TA 5H92C 1EY6A 1W6KA 2EXZA 1DM0B 5KGUA 4L1BA 1ZUD2 1GUGA 2IGDA 3KUPA 1DOIA 1QE6A 2B2YA 3AM9A 1WWTA 1PDXA 1B2TA 1SYEA 1GB4A 2B76B 1DOMA 3NUCA 2EYMA 2OHFA 1Z47A 4XQNA 2JYOA 1C4CA 4FP5D 2BDOA 4HKQA 1ZEQX 3D4RA 1EY4A 1RKNA 5E3FA 2VZKD 1FRRA 1FNUA 3TEZA 3DWAA 3AV8A 2QMTA 3MP9A 2PW9A 4LK0M 1OXUA 2DLBA 4ZK9B 1QQRA 2X6LA 1SYCA 3DXJC 3H0GB 3RMHA 4ITKA 2R61A 2Z8LA 1GHKA 2VZKB 2DY7A 1FCLA 4NAMA 3SFEB 3VYTA 3FRPB 2AQ1B 1XO3A 2IGHA 5EPLA 3GQBA 3EVQA 2L52A 2JQRB 1K83B 1EY8A 5D7GA 1MHHE 3QJYA 3LB8C 3NHHA 4DAYA 3I9V1 4ILWA 2AQ3B 2FE8A 3BYYB 4JK1C 1UUPA 3J81L 4S3SA 3ZJUA 1LTGD 4PNYA 4H0LC 1LO5D 1NAPA 1SB3C 2PVOD 3I70A 5FO8B 2ID0A 4RAUC 2ZXOA 2A69D 3T4AC 1F2RC 1PZJD 2NN6H 1EFID 3S17B 1ZP0B 5KNCA 2WQYB 4LJZC 3QOJA 4DF7A 4HCSA 1BBXC 1I3QB 1HUNA 1LT6D 4L6TB 1OFFA 2F0JA 1F2LA 3GB1A 3KBGA 1PTOB 1IHZA 2J4XA 2WDQB 1EWHA 1TT2A 2O5JC 3TEXA 2PVGC 1YNJC 3MHZA 3M85A 4DFAA 5ELCA 2I07B 1R4PB 3SFDB 4LLGM 5D3IB 1VLBA 5DAUA 5ELBA 3RLFA 2FMCA 2K5DA 1GJXA 1QB5D 1WTRA 1GAQB 2BS4B 5C44B 2EZVA 4MIUA 1QILA 4DK1A 2K5PA 2J0TD 4CKEA 3AN1A 4KI0A 4R9WA 5ELEA 1KLGD 1PFNA 1MI2A 2ENBA 1AFPA 1PTOH 1DOYA 4DNRB 3IFDA 3P20A 4QUCA 5CV7A 2XNAC 3IFTA 3UI3A 2RSNA 5K5PA 1DYQA 2KEDA 1EQVA 5TSSA 3GTOB 4TMAB 1H9SB 1ZXIA 1JOQA 1EWCA 1Y1VB 3HGBA 2OEDA 1A15A 2IT1A 2XN9C 1SE4A 4RF1A 4BWGB 5E4XA 3P4QB 3A8IE 1HPCA 1ZXTA 4J6HA 4CKBA 1N60A 4AS1A 4MHEA 1MD2D 1RF2D 3S15B 3KQ4A 4RKLA 2E74C 1DXMA 2EOTA 4ZOHC 2FMMA 1MGSA 3AE3B 3GO5A 3PUZA 1AEXA 3HRDD 3V96A 5D65A 2IPKD 2EY6A 1TKWB 2WXOA 2BE5D 2WDVB 3T56B 1QKZA 1U4MA 4IFDH 4RNAA 5G3LF 3M7GA 3Q69A 3RZDB 2F0PA 3BYTB 4RA8A 2WXHA 2PW5A 5I2YA 3P75A 2X69A 1IYUA 4HJGE 3I4LA 2QF7A 5DM73 3A55A 3BK1A 1LV9A 3W5VB 3EFXD 4YTPB 4MN3A 4H13C 4NKLA 1N61A 1BR9A 3S1NB 2EJGC 1Q90A 5I6WA 1SBBB 4K14A 4KMUC 4XYQA 4IQZA 4H2AA 4KGTA 4IFDJ 3MXGA 4ZUJA 4ODGA 2HDMA 3EUB2 5C2TB 1GOZA 1HQRD 2Q8TA 1RWSA 3BDLA 1GB1A 3HOXB 4ARCA 1QOFA 2N9KA 1ML0D 1GPXA 2PZTA 1NVID 3MJ5A 1NUCA 1PGAA 3EA6A 1D1KA 2AWNA 2ICIA 1G291 4N9PA 4KHVA 1HCZA 1EIHA 5H8YE 1F9QA 2WP9B 4RGOS 1STBA 3CIRB 5C4ZA 2K03A 3KLSA 1LT4D 1L4DB 5CC4A 2WV6D 3M3YB 3AEBB 4FF4A 4A90A 1D5ZC 2TSSA 1Q12A 1EOTA 2A68D 4I65A 1ZDVA 4C3IB 4E6IA 2ZW0A 3BDOA 4IZ8A 2K7VA 3BK2A 3V3XA 1V1PB 3DUZA 1Q3LA 4JX1C 5J39A 1CTMA 1PLFA 1YMHE 4HMJA 5AUIA 1JQ4A 2VNUD 1V97A 2PIAA 3SE0A 1ZOYB 1HFGA 4GDLB 1SMYC 3SXHA 2K5QA 4NMZA 4BA1I 1X3QA 2GB1A 1LACA 5LHY1 3D6WA 5T8IA 2A6HC 2M19A 2EKIA 3E0JA 1QNUA 2JP1A 1EL0A 4KKJA 4YWGG 1KTKA 3KK7A 5G5GA 2K32A 1QNKA 3AE4B 2EYFA 2ZW1A 2RQXA 4FXDA 4KN7C 5A2QL 1STEA 2WXMA 1BQQT 1HTPA 5GXGB 4WRDA 4B0EA 1BCPD 1HUMA 2NBFA 4A3EB 2HQEA 1TWHB 3HEJA 2PPBC 1E2WA 4K5XA 4KN4C 1VR9A 2WP8J 2MH7A 2SNMA 3SK8A 2E2DC 3DMUA 1F9PA 1HFNA 1JWAD 1OXVA 1KH0A 4KKTA 1CA6A 4CGYB 4ZQ3A 2SNSA 3G7LA 5HI1A 4DN4M 2F0TA 1EY9A 5FOBB 1ZPSA 5HFYA 1GUNA 3W2DA 4NW2A 3P63A 2IGGA 4BY7B 1ZYRD 5CV6A 3Q6SA 2K33A 1G2TA 2IX3A 4H44C 1I4XA 2KCCA 1S5CD 1ILQA 4WORA 4L23A 4CJ1B 3OSOA 2IJ0A 2B2UC 1HHVA 3VYUA 1PFBA 1G6ZA 3K57A 4IALA 1FNVA 3FVQA 1GUWA 4B08A 4BBRB 4A8XC 1IW7C 4A9AA 2WINB 1XEEA 1VZ7A 2JE6I 1HEZE 2PO4A 1E9MA 1WTVA 2BS2B 2IX1A 2O2LD 1ZDXA 1VZ8A 1O7YA 3DWQA 2K22A 1J7AA 3MXPA 3Q8AA 1YN4A 3BVGA 1EU4A 4HKZE 2KOLA 3TP8A 1ICWA 2NYZD 4QCLA 1IYVA 1HRJA 3GTJB 4A3BB 4KHZA 1J7CA 5M9OA 3NQIA 1OXXK 3MA2B 4C3JB 3P1MA 1FFVA 4A3IB 1RDPD 1K52A 4CQNA 1SJHD 1F2YA 1BUIC 4WQMA 3MXNA 1S5BD 2JSOA 3KBXA 2EE1A 3C3LA 1EQTA 2PTLA 3QO2A 2L1AA 1CHQD 4G4KA 1JOOA 4PV1C 4RFBA 3BS1A 1ROEA 2WXLA 2IDYA 3FAHA 4CJ0B 2ACZB 1Y1WB 2F0FA 4KY5A 4GLSC 5FKAC 4A3MB 3U7ZA 5EPKA 4QUFA 4ZKCB 1GXDC 4A55A 4NAWB 2B2VC 3PMFA 4NJCA 1C48A 2WKDA 1FM0D 4US9A 5M3FB 3P4PB 4OO1I 5JEAG 2N7JA 5T1GA 2R6GA 4TQUS 5D3DA 4FNFA 3R8BA 1PRTC 1ENCA 5C0XI 2PQEA 4IOIE 1VMPA 4ARIA 4F7XA 4IUTA 3TMEA 3RFZB 4C7YA 2QILA 4HROA 4Q0FA 1SE2A 4ZLTF 2ON8A 1BNZA 1BUVT 3NBIA 1Y8OB 3HVZA 3OMCA 1YNJD 3C8YA 5JPMC 4R8NA 2B8FA 1QWYA 3TP5A 3HG9A 2I46A 2E76C 1JWMD 1FD7D 4CBVA 4ZHOA 2CVRA 3M4YA 4WJWA 1PGXA 2EELA 2HUGA 2IWHA 3GD7A 4EQOA 4XE0A 4IURA 2PKOA 2G9DA 2CW0C 3I57A 1XCQL 3J80E 2ZXRA 1I6HB 3T3OA 4RHRA 1D4BA 3HRZC 2L4NA 1U4RA 1QJOA 1I6VC 5JOBA 2ICEC 1EEID 3PO2B 3W9CB 2RKSA 1UGJA 2KVMA 5KIXA 1ZE3D 1CZGA 1SYFA 1FYCA 2L1BA 1H9RA 2J53A 3LX0A 3UI2A 2LGIA 4C1NK 3T3NA 3AEAB 3GTKB 4NP5A 2E6XA 5I2XA 2XSCA 1YJIA 2KCNA 1C8CA 2LMCA 5C3XA 1WGKA 2K9XA 4P16A 3HS0C 1WTXA 2QEJC 4XDXA 1VF7A 3JAML 1ET6A 2B2UA 3VR2A 3R2IA 2BYTA 2R7ZB 2CU3A 2DNEA 2RDFA 4BY1B 2DYMA 3EGRA 1G8ZD 3CRLC 5NUCA 4XQJA 1JWSD 2FBWB 1SNCA 2Q5WD 1EYCA 1H9MA 3X3NA 3M4OB 1B44D 1AWDA 2NTSA 1L5PA 2EYOA 2D9UA 2WAQB 2KN4A 2F0WA 2X6GA 3K7AB 1YNNC 3AEGB 3RD4A 1SAPA 3ZJTA 4C7ZA 1T6BX 1A3UA 4AQ7A 1SFOB 1EEFD 3PUXA 3J81E 3FPUB 1Q10A 5G3LD 4HTHA 2RVLA 3MTSA 5DM63 2NN6G 1N62A 5KYLA 1HTLD 1C78A 1U4PA 3U2SC 1RJTA 1I50B 5IIFA 1V8QA 3BIID 2F0MA 3PV0A 3K59A 4TSSA 2BBCA 2JYEA 4HRSA 2F0HA 3A7AB 1NR4A 4ZUIA 1F2MA 3I3CA 4ZAIA 3DEOA 2BB5A 1SXTA 4B9WA 2HCIA 3LNNA 4J1MA 1J9OA 1KAAA 2M00A 2LFNA 5BMHA 3FILB 1SNOA 2W54A 3LXFA 2PNRC 4WH4A 4N6EB 5KNBA 2ZT9C 1CI3M 1SEBD 4C1NI 4WURA 1QCBD 3TP7A 2DBYA 1U4LA 2WXRA 1DOLA 4XXEA 1I4GA 1UEAB 2PCFB 3HUIA 2B2VA 4O1NA 1HA5A 3ERQA 1WTPA 2NWGA 1DZ1A 1MBYA 1B4OA 4OHJA 3CQZB 1F9SA 3W5UB 1VDZA 3GV6A 2WDRB 3FKIB 4HN7A 3NTIA 4P6VF 1RTOA 5EE1A 2F0SA 2A5HA 3A56A 5M3MB 1CM9A 2BW2A 1IBXA 5DEHA 1LLRD 4BS9A 1JR0D 1F9RA 4ME5A 4BBSB 2F0IA 3MHBA 3OMGA 1ONLA 3AEFB 1Y56A 2BA0A 4NZLB 2V3PA 2IX0A 2WU5B 3R93A 4U673 1JOKA 4K6DA 3S2HB 1SNPA 5C5MA 1ESFA 1SNQA 1LTBD 3A54A 3GTGB 1WTWA 2H88B 1WYGA 2OXPA 2E75C 2XVSA 2K3UA 1SMYD 1EY5A 1QLBB 2JWUA 1FO4A 5CV8A 4OGQC 3PZ7A 3WOEA 4LMQD 1A6XA 5I4DA 3I73A 2A6HD 2FUG1 2GRIA 2LHDA 3MFYA 2WXPA 1B50A 4IFDG 3AE8B 2DN8A 1II3A 2WKCA 5CORA 1B9NA 5HHDG 3W1SA 3GS2A 1HXYD 4G7ZC 3HKZB 3A8JE 2XIWA 3VRBB 2F0EA 4N58A 1D1IA 1KNEA 2FFKB 1YN3A 1UAPA 1EY7A 1PXUA 3KLRA 2KMMA 1L0VB 4I7ZC 1KDBA 2Y0SB 3E6ZX 3P42A 1Y69U 1KF6B 1T3QA 3AECB 1VMCA 2JA8B 2J52A 3AE6B 4HSVA 1R7SA 3S14B 3HOVB 5M5XB 1K8OA 2KA7A 1PZID 4FVMA 2B2TC 1YN5A 1Y8PB 4F88A 1MSHA 5M5WB 1F2RI 1PTOC 2A69C 2F1MA 1PGBA 3PO0A 5C0XH 1QT9A 2Z4HA 1E10A 3NPPA 1SF0A 3VA7A 2VB2X 1C9FA 2PMZB 5IT9L 4RGMA 3Q8EA 3FMCA 3LYYA 1B1ZA 3AE5B 1BOSA 1K53A 4F87A 1EIGA 5EKKA 3MXUA 2EYHA 2KEEA 3HP3A 4EGVA 1AN8A 2RBMA 2WS3B 1STYA 2L32A 1LT3D 3KLSX 1C4PA 1JICA 5EE3A 4KJNA 4A3DB 2PZWA 3U4EG 2VB3X 4XQQA 3TUOA 3X3MA 1I7HA 1MPEA 1RCVD 3NVWA 1XXGA 1SYBA 5C0XJ 2KUMA 5C3EB 1AZPA 4HR7B 1A3VA 2WIIB 2HTME 1X32A 2M2LA 1EWYC 5HGTA 3I4MB 2RSOA 1EU3A 1FEHA 1J7BA 4DAVA 5IODA 3I4NB 1UWXA 3NXWA 4A3KB 1U9RA 1RHPA 1SE3A 1TKGA 1D2BA 2SDFA 3MEHA 3WOFA 4HSPA 2F0KA 4J8QA 1FFUA 4HCEA 2PW7A 1WTOA 2X38A 3D3RA 4PT5A 1B9MA 4C3IG 1NENB 1TZOA 2SEBD 1X3PA 3OWFA 1FIQA 3CKIB 3OPOA 1O7ZA 1B3AA 3AB9A 3SEBA 3PIP3 4DQOC 1ET9A 3BWUD 2F0LA 4ZRQA 4HAEA 4JWSC 5A2QE 3VQIA 3PUWA 2AQ2B 1OQQA 5K36H 3ONAB 1RFKA 2IW3A 1IGCA 4RWSC 5EBDA 3VR8B 2EDGA 5BYSA 1PRTD 4IUQA 2KHSA 3FDTA 4UDUC 2CQAA 3AEDB 2MGSA 2F3WA 3P1HA 2B39A 5CV5A 2BE5C 2WXFA 4RCNA 5EE0A 4LAAA 3NZ3A 1BCPB 3FC4A 3SDZA 3M7NA 4L8JA 1D6EC 3RUZA 1GHJA 5CV4A 5IGEA 3MZ5A 3R2TA 2RMMA 2Z4IA 5AUKA 2R93B 4RHSA 1N5WA 2L55A 2NTTA 1O78A 3I90A 1DOKA 4WIPA 5IOCA 5F2DA 5JVH3 3CWIA 2JEBI 1NR2A 1W6JA 2F0OA 1V8CA 1GUTA 2CW0D 4C56C 3CRKC 3MAQA 1XLPA 1S5FD 5ELFA 3BG3A 1CA5A 2YU9B 4IUNA 3Q24A 4K2KA 3IAYA 3A8KE 2WU2B 2QCPX 4DNTB 3K5LA 2V3NA 2N9LA 1F0ZA 3LWEA 3DM1A 2B8GA 4KK7A 4XIGS 3AB5A 3VRAB 1KLUD 4EQPA 1QF6A 4JE3B 1MHXA 2JSVX 1UNSA 4IDIA 4FXKC 5IGBA 3W3AA 1C4AA 2JXTA 3MC0B 4PQXA 2B2TA 3N6RA 5EPJA 3EROA 2DY8A 1WTQA 4DXGA 3DWMA 3VYRA 3TEYA 5JPNC 1XTCD 4C3HB 2AWOA 3MVVA 3N9YC 3B2FA 1JQYD 4X3TA 5BN3A 1I4PA 2Q8IB 4KKSA 3I8ZA 3DEPA 2XWJB 1TU2B 3D31A 2DWQA 3VR9B 4REZA 2HDEA 1T5EA 1I4QA 5FK9C 3OHXC 3P4SB 2Q8RE 3GTLB 1TWAB 1WCMB 4A3JB 2WB1B 1XLOA 3ETRA 2PYKA 3H94A 2EYLA 1YJJA 3IT6B 3L7ZC 1VF5C 1VDVA 2I2YA 3H91A 4OZBA 1ZKOA 5LNK1 4C3JG 4IN3A 4H7BA 1CZPA 4GDKB 4B0MA 4K2LA 1TKEA 3VR5A 2NB0A 4DA2A 3SK5A 3K5OA 3J9CA 3MFGA 4IUUA 1Q1EA 1K50A 4CKCA 5CV9A 1XF5L 2E2IB 5EKIA 5C6AA 5KNDA 2MUYA 4M0WA 2EJFC 3NRZA 2BOSA 1VRAB 1STNA 4XT1B 3E9SA 1JW9D 2NVTB 1E2VA 1KABA 3S1QB 1JRPA 1DD2A 1H9SA 1PRTF 2C5CA 1A2TA 2F0UA 2YEPF 3TP6A 1A70A 2K04A 2L83A 2NMQA 1KFYB 1NYRA 1PFDA 1CQVA 4LK1C 1VJKA 4YTNB 2F0QA 4K8IA 1BCPC 2O4XA 5E6JA 4PMCA 2MP1A 5C4XB 2LY7A 2ZXPA 1I4HA 3GV3A 4FF2A 4DXFA 2H1EA 3GTPB 1DGJA 4QB4A 1CK1A 2MHVA 4Z9CB 2C9OA 5C4HA 1SSOA 1O7LA 2TMPA 5FLXL 3C2PA 1Q8IA 1EM7A 2EVBA 4G7HC 4XTCS 2F0DA 3EQLC 2V4DA 5EGTA 4G7OC 1BF4A 1JMLA 4TQ1A 2EY1A 5I9OA 1ZYRC 2EYPA 3AE9B 1S5DD 4TQ0A 2F03A 5I9PA 2FINB 2J7ZA