2ICIA

Crystal structure of streptococcal pyrogenic exotoxin i
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
227
structure length
227
Chain Sequence
YEMSSVGVINLRNMYSTYDPTEVKGKINEGPPFSGSLFYKNIPYGNSSIELKVEMNSVEKANFFSGKRVDIFTLEYSPPSNSNIKKNSYGGITLSDGNRIDKKNIPVNIFIDGVQQKYSYTDISTVSTDKKEVTIQELDVKSRYYLQKHFNIYGFGDVKDFGRSSRFQSGFEEGNIIFHLNSGERISYNMFDTGHGDRESMLKKYSDNKTAYSDQLHIDIYLVKFNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Exotoxin I
publication title Crystal Structure of the Streptococcal Superantigen SpeI and Functional Role of a Novel Loop Domain in T Cell Activation by Group V Superantigens.
pubmed doi rcsb
source organism Streptococcus pyogenes
molecule tags Toxin
total genus 67
structure length 227
sequence length 227
ec nomenclature
pdb deposition date 2006-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2iciA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2iciA01
1UNSA 1I4QA 2SEBD 3EFXD 1STEA 1I4XA 1PRTB 1TS2A 3DWAA 3CHBD 1ENFA 2IPKD 2J4XA 1LO5D 3DWPA 5ELCA 4RHRA 1V1PA 2AQ1B 3OWEB 1V1PB 2O2LD 1FNWA 3O13A 3R2TA 4Z9CB 1BCPC 5ELFA 4C56C 5D3IB 1S5BD 3KLSX 4DXFA 1FD7D 1AN8A 2NTTA 1ET6A 1EU4A 4L63B 1KLGD 1D5ZC 1S5ED 2CHBD 2QILA 2IJ0A 5ELBA 1PTOF 1RCVD 3BVMA 1TS3A 4RHSA 1JQYD 1CQVA 4TSSA 2WV6D 1JWMD 1HQRD 1DYQA 3BVGA 4K6LA 1EEFD 1FNUA 1LT4D 3GP7A 1S5DD 2G9HD 1YN3A 4NZLB 1PRTF 3BZDB 1DJRD 1I4HA 1GOZA 2NTSA 1LTID 1F77A 1BCPD 1PTOC 1D5MC 3R8BA 1YN5A 1FGBD 1SE3A 4RFBA 2R61A 1SBBB 1LT5D 1XXGA 1AW7A 1ESFA 2XN9C 1PZKD 1SJHD 1V1OA 5FKAC 1G8ZD 1RDPD 1TS5A 2XNAC 3R2IA 3BYTB 5FK9C 1JWSD 1LTGD 3SEBA 1D5XC 5D3DA 1PRTC 1HA5A 4OHJA 5TSSA 1YN4A 3MFGA 4RGTA 1LTBD 1LTAD 1HTLD 4BWGB 1ET9A 4O1NA 1PZID 4RGNA 3EA6A 4RGOS 1HXYD 3W2DA 4RGMA 5ELEA 1PTOD 1I4PA 1PTOH 1RF2D 4RH6A 1MD2D 1EWCA 1EFID 3V05A 1UUPA 1RD9D 4DXGA 1CHQD 1B1ZA 4L6TB 1BCPB 5ELDA 3DWQA 1CK1A 1D6EC 2AQ2B 1LTSD 1T5XD 1XTCD 4ZYSA 4UDUC 1JR0D 1PRTD 2TSSA 1JCKB 2AQ3B 1PYWD 1I4RA 1SXTA 1BXTA 1S5FD 4RCOA 3BVZA 1LTRD 1QILA 1L0YB 2RDHA 1TY0A 5I4DA 1SE4A 2QEJC 1EEID 2Z8LA 1LT3D 1SEBD 1SE2A 2XRQD 2RDGA 1CT1D 3TSSA 1M4VA 1TY2A 1FNVA 1LTTD 1JWUD 1KTKA 3URYA 1S5CD 3MC0B 1LT6D 1PTOB 1CHPD 1BCPF 1LLRD 2ICIA 1PZJD 1I4GA 1SJED 2XRSD 1EU3A 1L0XB 1KLUD 1B44D 3BYYB 1TS4A
chains in the Genus database with same CATH superfamily
1E3PA 3U4ZA 5EPJA 1I4QA 4LF7Q 2PPBC 5CGKA 5IWAQ 1E8WA 4QUFA 2BWFA 3PO0A 3RZWC 2KDBA 4OW0A 1A70A 3QA8A 1KAWA 2K75A 4RNAA 5KYLA 1SNQA 5LHY1 4WRDA 1NEKB 4A3FG 3V6EB 3EBEA 4HPMB 3AYHB 4I6PA 1GG3A 3PREA 4LJOB 4DXFA 5KNDA 1HZAA 2ASBA 4JYAQ 2YLMA 4XXEA 4X6AH 1ET6A 2BA0A 2L5TA 1SSNA 1R4NI 3QO2A 5H8YE 5M5YH 1NDDA 4K0KL 2LSSA 4AJYB 5AJ3L 3A54A 3BU2A 2ZJPA 1JQYD 4LFBQ 2R2QA 3H91A 3LYYA 5HI1A 4AP4C 1I3QB 2BKFA 4BY1B 2LVOA 4YXDB 2BE5C 2UXCQ 2JN4A 1JICA 3QARA 4IOCA 1V81A 2MA9B 3AE9B 1STYA 1UE1A 4GN5A 1L0VB 3RR5A 3M4OB 3D6WA 1EWYC 3H0GB 1XMOQ 3ZLZA 1OXVA 2NTSA 4AQ7A 3CCMA 4L8JA 1PTOC 2D62A 3JVZX 3GTJH 5CV6A 2D3BA 1EZ6A 4BBNC 2Y5BB 2EMSA 4KKTA 2IO2B 2VXWA 2AX5A 2KC1A 3GS2A 5DPTA 2AWNA 3RCZA 3TEHB 5IOIA 3I90A 2EVBA 3PCOB 3Q0AA 3S14B 1TS5A 2XNAC 1NYQA 4W9EA 4JOIC 4KK7A 3BYTB 3IT6B 3MZ5A 2MO0A 4DUZQ 1PH1A 1V86A 1WJ6A 5FLXL 4A3OA 4GN3B 3P1HA 4BA1I 2JEBI 5C4XB 1N5XA 4A8XC 1WFQA 1BDOA 3DBSA 3S16H 3E9IA 4MIUA 4DK1A 3P7JA 2NVXH 1AP0A 4F7ZA 3APCA 3NBHA 3IFWB 4W9CA 2UUAQ 3NZ3A 3RNFC 4L23A 5EQ0A 3OHXC 3A55A 1F2YA 2EYFA 4K5WA 2K28A 1SR3A 2MFIA 1F2LA 2EYOA 2Z1CA 4DR3Q 4PZ6A 2B2YA 1YNNC 2EE1A 2K3UA 1CK1A 2AQ2B 4DR7L 2GBMA 2C35B 1NAPA 2HHHQ 1FEHA 4MT5A 3GTQH 4BOZB 2MWSB 1RYJA 3VTUA 4C3JH 2JEAI 4X62Q 4RCOA 2RDHA 4ME5A 2GRIA 1EEID 2PPHA 3EFUA 3H8HA 1K28A 3QOLA 1RWSA 4N8X1 2I5MX 2K8BA 1OO9B 4KJOA 2JSVX 2KD0A 4KLKA 2EKEC 2KFJA 2WXOA 2NZOA 3OLMD 4BBSB 1E24A 4K5VA 3NBHB 4G57A 1Q1EA 5JPNC 3URYA 3JSVB 3TBIB 2AKWB 1P7FA 3M62B 4GB9A 4J8QA 4X64L 4DR6Q 1UBIA 1FYCA 2L12A 1V80A 4QL5A 1DZ1A 1I7HA 2YTYA 3A74A 4IWQA 4O0AA 4ICUA 4L5SA 2RF4A 2LXCA 4PZ8A 3S2DB 4HEDA 4HIOA 4GDLB 4B6WA 4LNIA 5BYRA 1TS2A 2WX1A 2YTVA 1K0RA 3I57A 5IYDG 2J0MA 1RODA 3OW7A 2VH2A 2N8NA 1H9RA 2E2IH 5IP4D 1NMGA 3NE5B 2PIAA 1GHJA 4LJPB 1Y8RC 3M63B 3NVVA 2H89B 3EGRA 2HD5B 4IPGA 4G0NB 5L95C 2NBFA 2KEDA 3U4VA 2D07B 3HM3A 3QAQA 3QWZB 5A2QL 3C19A 2F03A 1OQYA 4IPDA 4DR5Q 2QDFA 3CQZB 2XVSA 2BQQA 4HR7B 1FCCC 3CKIB 4KHPQ 3P4QB 1N34Q 2ZXRA 2VY3A 2DYMA 2KDIA 4KHZA 2UUCL 3KJOA 2B3AA 1UGJA 4A3IG 1EEFD 1TIID 1WCMG 4HIDA 3GTPH 5JEAH 1MG8A 4C3IB 1EYDA 4M00A 3WDNA 4ACFA 2KX3A 4G7HC 4LF9Q 2KNBA 4XYQA 3MXGA 1MSGA 3CMAA 3HOZG 4UPAA 1MHXA 2LD9A 3A8JE 1E2ZA 2WU2B 4WAFA 5I9OA 1QNKA 5T1GA 4US9A 1V6EA 2V4LA 4YTPB 1RDPD 2M9VA 3M7NA 5AUIA 4P74A 5GAHC 1VZ7A 1IYVA 1LV9A 1QZHA 1C4PA 2QIEB 3LGJA 2K8CA 3RPFC 4Y7NB 4P1BC 3LXFA 4FDBA 1RFKA 1V49A 3LDZE 1XNRL 1RHPA 3RZDB 3CIRB 3S1RH 3NVZA 1SNMA 3FRPB 4LFAQ 1TTNA 1T3QA 2INDC 2F0HA 2BBCA 3RYTA 2DZKA 5TR5A 3I2ZA 2K5NA 4G7ZC 2NVTH 1E7ZA 4AYBG 4A9AA 3S1QB 5IT9c 3V96A 3J81c 1FRRA 1F9SA 2OTLA 2WHIA 2QW7A 3NUCA 4DXAB 2DN8A 1FPYA 4FXDA 2BTEA 1PGAA 2NVQB 5AZHA 4A3EB 3GTMB 4M8MA 4OWTB 2HD3A 1Q90A 5JEAG 4RKLA 4N59A 4CDFC 5KIXA 4JI4L 4B0EA 3HM6X 4BOSC 4I7ZC 1VDVA 4GS3A 4HJ7A 3MVVA 1F1HA 4OZCA 1YI2A 4MSMB 2NBUA 1E5WA 1LT3D 1EIFA 4LF5L 2K5DA 1VQNA 2NMQA 3N1YC 2VW9A 3M95A 2PQEA 3FP9A 1Q1OA 2EKIA 4G3XB 5D65A 1SF0A 3D4DA 3UIOB 2A6HC 3AB9A 1JWUD 2ICEC 4K0KQ 5AJ3Q 3AFPA 1MHWC 2CWPA 4B3ML 4XDCA 1E8YA 5LXHA 3I4NB 1CHPD 1ZKHA 1E7VA 3AN1A 2VUMH 1ISNA 2PQAA 4KY5A 3GTOH 4GNXC 4C3HH 4ILWA 1Q81C 3M4YA 3NY5A 4PYZA 4QF4A 5IP9H 1EU3A 1A2TA 3PUZA 2C9WB 3M3JA 4JWSC 4LLGM 5C4HA 1V43A 3TRZA 2KKCA 3IAM1 4GN4B 4ZK9B 4IUMB 4A3GH 4CGYB 3DWAA 3K7AH 3DWPA 3ML8A 1MVKA 2JA7H 4EVOA 4RHRA 4OIJA 3I4MB 1QQRA 4I6LB 3HOWG 4BAXA 4QIWB 2AQ1B 4XQJA 2LGYA 3GTLH 3GDEA 1OQQA 1VD2A 4YIJA 3S15B 1V97A 2LGXA 5IO9A 4ZHPA 1DOIA 1P0RA 4AQYQ 2WXMA 3KLSX 1EOTA 3BDCA 4Q2JA 5HFYA 2WQYB 3H7PB 1S5ED 1PLFA 4TV3A 3BDLA 1VRAB 2PNRC 4XT3B 2CWAA 3D4RA 2PQAB 3RZOH 3BVMA 1JJCB 2A69D 2V3SA 1H9KA 1AFPA 4NAMA 1B9MA 1W6KA 2KVRA 1KOTA 4XYOA 3Q14C 5FO8B 4KTAA 4M8AA 2Z9HA 3BZDB 2WYQA 1FL0A 1WYWB 3D4WA 4YTMB 4QIWE 4QMGA 1C8CA 1N62A 2VUMG 1CUKA 4DR7Q 5IKCM 4HWIB 1FGBD 1HNZL 2Q5WD 1WM2A 2ZNVC 5EE3A 3OW2A 1WTWA 1KAAA 3ITPA 5J22A 2C7MB 4CJ2C 1QUQB 2L7RA 5FKAC 1L1OA 1L4DB 4FF4A 1BR9A 4IPHA 4LF6L 5IGGA 3EC8A 1N33L 3IT4B 4IW0A 4J6IA 4OVZA 3L2PA 2F0VA 2X69A 4JI7L 2OOBB 1O78A 1VQKA 3C3LA 2K03A 3U9SA 5KNCA 3KFUA 1HUNA 1RTOA 2KX0A 1FR3A 2K1BA 1N8RC 2L1AA 4A55A 3Q3NC 4CYEA 3KF6A 4X64Q 4YHHL 2F0QA 1SYBA 2I5HA 4IZ8A 3W2DA 2RCNA 4OEMB 4DKAC 5KEEA 3HOYH 1EO6A 4JV5L 1N63A 3GZNB 4JQWC 3MEFA 3M3YB 4KV2A 2FJ2A 3SK6A 4F8MA 5C4JH 5JZEB 4K8JA 2QKIC 1B70B 1X55A 1MJCA 2YU9H 1YEZA 4OELB 4LF8L 3NWSA 1E2WA 3W5OA 3HOUB 4R8IA 3P4RB 4NJ6A 3TP6A 1RM6C 3N52A 1HE8A 1J7AA 2AUKA 4I7AA 2WX0A 1GD7A 4UDUC 1ZXIA 3VR6A 4KN4C 2AL6A 1NENB 1TWCB 1TT2A 1TWAB 1HTQA 2EYHA 1HA6A 2HJ1A 4HSPA 4IM3A 2F0TA 1ZPSA 2KN5A 3GOEA 1LTRD 2IZVB 2KENA 4ZQ3A 2QEJC 4A4IA 2LWPA 4JI0L 1Q1BA 2I2YA 3ZTDA 2KCMA 2XRQD 2L15A 3KF6B 2GA4B 4DAYB 4POGA 1Y56A 1ZUD2 2IY0B 2VZAA 1WXAA 3H7SA 1C3TA 1XCQL 1XEEA 2VB2X 1IGDA 1WCMB 3GQBA 2E74C 2LKVA 1BO0A 3A9KA 2UUCQ 1YVCA 5C6AA 3CWIA 3RD2A 3J80L 3H15A 3HG9A 3RNUA 4A3MB 4DV1L 3HOZB 1ZDVA 3TEXA 2B8FA 2UU7A 1WJ4A 2DNEA 4BKGA 3K81C 1IBLL 5IAAC 3R93A 4MTNA 4UP7A 1WX7A 2B76B 1UWMA 1NNXA 1K73C 2F0SA 2WXFA 2AL3A 1J7CA 2K6DB 4BBRB 4HDOA 2G1EA 1DD2A 3W1YA 4HJ5A 3UI3A 1ESRA 4NW2A 2I5LX 1SYEA 4DUYQ 3JYUA 3V3XA 1VQ8A 1GJXA 1JROA 3QCAA 1HEZE 1UEBA 3MAQA 1SN8A 1WGRA 1M94A 5T1IA 4JIOU 4LUZA 5BMGA 2FCNA 2MCNB 2VL6A 2ZVOA 4E3CA 1ILQA 3KBXA 2XWJB 1XNRQ 2Y5CA 1TS3A 4LTUA 4P6VF 2Z4HA 4MN3A 4JBKA 1WZ0A 1XNQL 3NZSA 3NSWA 2LMCA 4EQPA 4HCPB 3PF5A 2KMCA 4UP9A 4IFDJ 2N7DA 4H13C 5E6JA 1ZDXA 3H1UA 2E2HB 3HVZA 3FMCA 1YNJC 1HZCA 2JA8H 4N8FA 4FF3A 3R8BA 1IL2A 1F9JA 5ELOA 2IWHA 1YN5A 2EJMA 1WM3A 3PHXB 2B2YC 5GAGC 3HOXH 1HH2P 4DHZE 2JQOA 3S9WA 1UBQA 4JI4Q 2ZXPA 1FVIA 1B3QA 2JJQA 2I0QA 3RN9C 1MIUA 1T0RC 3GZNI 5J3BA 4KSKC 2R92H 4JC0A 4LF5Q 2RDFA 2OWOA 3DBLI 3VHTC 1Q10A 4JI1L 4AYBE 3KYHC 1YITA 4IN3A 1PQSA 1ZEQX 3PGZA 1WGGA 2IGDA 3D0FA 4GOCA 3H94A 4LNQA 3PO3H 2BVCA 4HXDA 2LMCB 2RSNA 4KZCA 4RGMA 2Q2TA 2IGGA 2V4IB 4PT5A 3BJUA 4XWTA 4RH6A 1A3UA 3I3TB 2XBBC 5IWAL 4A3BG 4CBVA 4OGQC 5IIFA 3JAME 2MJEA 4L6TB 1BCPB 1PH6A 3TN2A 4AOFA 1IKLA 2X6GA 5BN4A 1D6EC 3DHHC 1XTCD 4XZ4A 3DBHB 2Q2IA 3CRKC 3T56B 4W9IA 2AQ3B 4ZKCB 3DWGC 2W3RA 5K36H 2X8XX 1SNDA 4A93H 1VQMA 2BDNA 3D3RA 1HZ6A 2JA8G 1TZOA 3ZDMC 1WF9A 2RD0A 4Y52H 4W9FA 3FKIH 2KWCA 3P1MA 2M17A 3NRZA 3T1HL 3PRMB 3HOXG 2F0NA 2JVCA 3OMGA 5FO7B 4W9DA 2GN5A 1WTRA 3PIP3 2A1AA 2NUCA 3QG1A 4IO9A 1TKYA 3STBC 3RNEC 2WB1B 4FXGC 1FIQA 2K33A 4X3KA 2VZKD 5MPOA 2O4XA 1SGHA 1CFMA 2KFKA 4A90A 3VR2A 3PO3G 3HOVG 2GVAA 3KW5B 1IP9A 2MEKA 2CH4W 1PFSA 4CO7A 2KQ3A 1EL0A 2W54A 1C78A 2QCPX 1MFWA 5GADC 2F0KA 4GMVA 2D10A 5I9PA 4JWUC 4HLEA 1ENFA 1HNZQ 1LO5D 5ELCA 4WORA 1EQTA 3M9BA 1X54A 1OQRA 2FCQA 2QCZA 4OO1I 2CW0C 4ZRJA 2WACA 1VQOA 3DBRI 1H95A 1KNAA 2XGTA 3IKJA 2LUEA 5M3FG 1WYDA 1FD7D 4IUUA 1AN8A 1N33Q 3DVNU 1SROA 1YX6B 2KBNA 3ZNID 1ZYRC 4JI7Q 2HDEA 1IW7C 1I94L 3C1FA 4ID6A 4KN7C 4WWMA 1GC6A 5K36G 4M0WA 2OEDA 2PCFB 4A93G 2K7VA 2KFKB 1FFVA 3DVGY 3E0JA 4YHHQ 2E2JB 2KDMA 1CQVA 3K8AA 2NBVB 1KRTA 1DM0B 3FKIG 4JV5Q 1CI3M 2L3ZA 4K6LA 4XYCA 1LABA 4JI8Q 1S5DD 1WTQA 5EBCA 2V3PA 4LF8Q 3RMKC 2VQEL 1N60A 3S1NH 1C76A 1I4HA 3TP5A 2MGSA 2ACZB 2BYEA 2IO1B 1GUSA 1U4MA 4JK1C 4UY8C 1F2RC 1OGWA 2ZJQA 2L52A 3R3MA 3A5UA 3P20A 1J5EL 2K14A 1YJIA 4WJPA 1KNEA 2JQRB 3PTFC 2B39A 2A68C 4YWMA 2ZM6L 1X65A 3PO2G 1DOKA 2N9LA 3TDQA 2XN9C 3EN2A 2UXDL 1LFDA 2I1KA 1G6PA 1PV4A 1XX8A 2G4SA 4MZ9A 4DGZA 3CSTA 2DJFC 4YCUA 5D3DA 4NKLA 3SK5A 4JI0Q 2DAJA 5TSSA 1ZGUB 5GXGB 3A7AB 1I50H 2BE5D 2OF1A 4O2DA 4RWSC 1LTBD 3J7YW 1V5TA 4R3DA 1P3QU 4F88A 1K83H 1HTLD 1SYCA 4WURA 3ZYYX 2QF7A 3QJZA 1G91A 3ULPA 2FHTA 3MTSA 1XQQA 5AZGA 5E4WC 1CJEA 1IGCA 3P63A 1N61A 1T0QC 2LJIA 1PTOD 3I55A 3MA2B 4NQLB 3DEOA 1X6OA 3IAYA 5L37A 3Q6SA 4DV1Q 1XPRA 1XCTL 2NVYB 5L83A 1B1ZA 3CQZH 5C0XI 1IBLQ 3N3KB 1CQFA 3VVWB 4V190 4AJWA 4OZBA 2IO3B 1Z47A 1HPCA 1TYGB 1IBXA 3APFA 2IBIB 4ZRPA 3VYSA 1RL2A 3C0RB 1VQCA 2PMZB 4PK1A 2CHWA 2MX2A 1QLBB 1OXTA 1FRDA 4ZRKA 4J6HA 4WJNA 2D5GA 5I4DA 4D2KA 3ZJYC 3AEEB 3NP8A 2Z8LA 1K53A 4K81A 4P7IA 1E8ZA 4B95A 4M8NA 4ZUIA 3QR8A 4QUCA 2M4NA 2RDGA 3QB3A 4X65L 2NCNA 1EY7A 1TWGB 3IG3A 1KTKA 3APDA 1GUOA 1KM7A 2PMVA 4DNTB 3FILA 3ZW3A 2SNMA 2Q8IB 5H92C 4LAAA 2YV5A 1YNND 2KOLA 3RUZA 1P98A 3ULLA 1XNQQ 1V2YA 3E0EA 4XTCS 2PO4A 1BCPF 3PPAA 1PMRA 1VQ6A 2B2WC 5AUKA 4TRDA 1R7SA 5IT9L 1C4QA 2KHIA 1IBXB 3J81L 1NVID 3K0XA 1AARA 2PMZE 2SEBD 2ZCBA 2Q2UA 3CC7A 5JPMC 1X56A 2KDFB 3AU7A 1HNXL 4A3JH 3K0YA 3K57A 3X3NA 5C3EH 3CC4A 4XC2A 1I35A 4A3DG 3K5MA 1WMHB 1NR2A 1YJNA 3S1QH 3OIPA 3G6EA 3K9PB 2RCFA 3HUIA 2JA9A 2NPTB 3KBGA 2QA4A 3F2DA 3IHPC 4XT1B 4POFA 2JZ3B 2AMCB 2ZT9C 4N6EB 2K9XA 4EE2A 3ZNGC 2NTTA 5KYIA 3GTMH 2Y0SB 4LNOA 2KQ7A 4Q5VA 2JY6A 2WDTB 4FF2A 2NYZD 2BPSA 2ID0A 2JSOA 3TBLD 4GOPA 5C44H 1JOKA 2SNSA 4W9LA 1JOQA 4A3BB 1EY4A 3ABVB 4GN1A 2Z0SA 4RHSA 4IJHA 2ATWA 1NE3A 2D3AA 1CSQA 2CHZA 4HMJA 4TVAB 2L0CA 4H0LC 1GNUA 3DXJC 2JU6X 4GDKA 4YWLA 3JW0X 2E8GA 1J6QA 4PQXA 2K5QA 1WE7A 1VQDA 3NOBA 1GUNA 3GTGH 3PS6A 4P72A 1PUTA 5CHFA 2ZPNA 4OIKA 2IW3A 3B2GA 5M5XB 4J1MA 2K1FA 1HZ5A 2MHVA 3HKSA 2HTHA 1QCBD 1SE3A 3I5JC 3L08A 1VCIA 2NB0A 1B2TA 5LLIA 1EY0A 1JMLA 1P1AA 2BWES 4ITKA 4A3PA 1AW7A 2RHQB 1ESFA 1WR1A 2WS3B 2Y0SE 3IFDA 3B0AA 5HHDG 3Q8FA 4QY7A 1FM0D 3PRZA 1L6UA 5IA7A 5FK9C 2RR9A 5HURA 4KD3A 4A3JG 2D11A 3SEBA 3DCGA 4HJKA 2W3SA 4GOPB 4BS9A 4WIPA 4DDID 3T1HQ 3G6JB 4RF1A 1WJNA 3EIVA 2P5ZX 5IY0A 2IGHA 1EQVA 3S15H 1OXXK 4HMIA 3CCQA 1BUVT 4GDKB 3MXUA 4BKTA 5KHQA 3KQ4A 4PS7A 3K58A 5ELEA 4HKZE 1SYDA 3Q3JA 1Q8KA 2ZJDA 3ZGZA 2D2QA 1QG7A 1AZPA 1K3RA 1VDZA 1UUPA 3VA7A 1WJUA 2K22A 1B9RA 4DXGA 5C44G 2L0TA 2CJNA 3R3OA 4OVVA 4GSWA 4MDKE 1WXSA 4KI0A 2J0TD 3HRZC 2B63G 2IO0B 2MBQA 5IE8A 2LEKA 3A5ZB 4WJ4A 1WX9A 4K5XA 1C9FA 4AQYL 4J15A 2Q8TA 3NZUA 4K2LA 3RZFA 3F1ZA 1CTMA 4RAUC 3RNGC 4AH6A 1FFUA 2JYTA 4BFRA 5C1ZA 4QCLA 3VRBB 1P16A 3VH3B 1IPGA 3KWVA 1I94Q 4NJ7A 4N9TA 2Z0DB 1IUEA 3K7UC 5JXVA 1ENAA 3JSVA 3CCEA 4LJZC 4ZCKA 1TWHH 3AI5A 3R7RA 4CKCA 3HIZA 3KOJA 4MELA 1MKHA 3F2BA 4S17A 3ZIMA 3ML9A 3VTWA 4GDLA 2VQEQ 3ZJUA 2PTLA 3PO2B 5DNFA 3RLFA 2JA6H 3HEJA 3Q24A 3PF4A 1VS0A 4R4TA 1J5EQ 2D2CC 3M3YH 3CHBD 2OT2A 1JALA 2K25A 3KLRA 2KWVB 2RPQA 2WWZA 4IC7B 2D0OA 5DEHA 3JAMc 2ZM6Q 1KD1C 1SMYC 3Q69A 4PV1C 4HCNB 2W55A 1B3AA 3LB8C 4BXXH 5EE9A 2UXDQ 2JXXA 2A6HD 5CORA 1F9PA 3E3XA 1BCPC 1JRUA 2EJGC 4A3KB 1A63A 1R4MI 4EX5A 4WQOB 1V8CA 5H1SE 2F0MA 1GO3E 1CKNA 5CHVC 2B29A 1SRUA 2D9UA 2A19A 5IGBA 2C5LC 2R2OA 1KQSA 1H8CA 2FBWB 3KDFB 1XPUA 4JBWA 2JT4B 2ZVNA 3Q8DA 1EY9A 3RUIB 1GC7A 1GVPA 1AZQA 2EY2A 4KIKA 1YJWA 4ANXA 3VR4A 1AWDA 4NJCA 1JWMD 3F8TA 1NI3A 2WLBA 1T0YA 2KCTA 4NXNL 4K3CA 3FC4A 5EKKA 3NEMA 4EQ5A 3CD6A 3T8MA 2KT7A 3IBEA 3P4SB 2R7ZH 2A8VA 3WIMA 3TP7A 1XYIA 1SSOA 5M3MB 4DR4L 3PRPB 3U7DA 2N9XA 2PVOD 3RLNA 4RFBA 1YNTE 2KACA 4QQBX 1CKNB 2WAQG 3ZJTA 2LGSA 4IPCA 3ERQA 1ML0D 4C3JG 2JA6G 3RNAC 2AYOB 2KEEA 1Y1VH 3R7QA 1JWSD 1YJ1A 2DY8A 5AZFA 2JA5B 3J80i 4NPNA 4KIKB 3L0OA 5G5HA 4CDEC 4BXXG 2KVMA 2RA4A 4X65Q 1HHVA 4IURA 3CF5A 4N9F4 3B9JA 3EJIA 1YHAA 1LM8B 1RFAA 2ZW0A 2I38A 1PTOH 3T4AC 1ZXTA 1YBYA 2D5DA 2EJFC 5J39A 5IYCH 1ZW7A 2LXJA 2N9EB 3A1QB 3GO5A 1EFID 4FP5D 3V05A 4YWKA 4GLXA 4DV2L 4OO1H 3W1SA 1S3SG 3LX0A 1CHQD 3AEVA 4A3DB 2JWZA 2KK8A 3I4LA 2KYWA 2WXRA 5BN3A 3KH0A 5EPLA 3KUDB 3ECIA 1WTOA 4DUYL 1V9PA 3IL8A 1HNXQ 1VQLA 2MP2B 2LY7A 1GUGA 4BKSA 2C9OA 2QEXA 2PE6B 2Q2HA 3W1BA 1WE6A 5J2RA 2WIIB 3FPUB 1HCZA 4C1NI 1S5FD 1C4CA 3NBIA 2R7ZG 1BUIC 4K1RB 3ZVVA 1AH9A 2F1MA 4C2MH 1NJIC 3OAWA 2UUBQ 1KHIA 1QB5D 2ZZPB 1J0GA 1NR4A 1D2BA 5HG2A 3MFYA 4TUUA 4HVBA 2WDQB 2LRUA 2N7EA 1ZOYB 2J0KA 2A4ZA 3NENA 1JWBD 1JJ2A 2HT1A 1HQMC 1HTPA 5JJIA 3VYUA 5IGFA 4W9GA 3C46A 1WTVA 4PNYA 2EYMA 3GTKB 4A3FB 3I4OA 5IYBH 1TQOA 3OMCA 1HRJA 2WXHA 4GKJQ 2IHFA 3J7AV 4REZA 3SFEB 3K9OB 2DYBA 3NWTA 1IYJB 3A4SC 1WY8A 1STEA 5BR8L 3E9SA 4DBGA 2L0FA 1YQ4B 1SIFA 4HJ8A 4OO1G 2N7JA 2B8GA 3CMEA 1QOAA 4LFCL 1Y1WH 5ELFA 4LMQD 4RM9A 1STAA 4CKEA 4RA8A 2UWQA 2V1YA 3H7PA 1ONLA 2VH1A 5C2TB 1QVGA 1D5ZC 1XMQL 5J1ZA 3AXCA 3FAHA 5ELNA 3PVLA 2WXNA 1L2NA 2L1BA 2F0PA 1WYGA 4A76A 3TZDA 5C0XH 2BYTA 2HTME 2K04A 4AS1A 2HCCA 2QC8A 5BN5A 3AU5A 1HQRD 5C5LA 2DWQA 3CXCA 4LK0M 1VZ8A 5M9OA 2R93H 1V8QA 4P2CB 4XIGS 3CPWA 2B63B 1I6HB 2Q8RE 3GP7A 1PFDA 2IY1B 3OJ3A 3P4PB 2SDFA 1J9OA 2NR2A 4CDDC 1WTXA 1TBEA 3VTVA 2Y5PA 3IRBA 1E7UA 4A75A 4K3BA 3N20C 1BKBA 3CP0A 3KF8A 3T16A 1H4RA 2N4FA 1O7LA 1NTGA 3A8KE 4ZAIA 2E6XA 1MBYA 2LVPA 3VR9B 5AEKB 3DVNV 3SHLA 2F3VA 2SOBA 3SK8A 2CS4A 2LVQA 1QUQA 2M1MA 4IUVA 3PIPA 4R9WA 2GB1A 2DHZA 2DZJA 2O6VB 4YSZB 3S1MB 1WJJA 4IOAA 3QC8B 2QSDA 4OL7A 2RSUA 2JXTA 2FNJB 5D6JB 4NAWB 2B2WA 2JK8A 3ND9A 3VR5A 5A35A 4DFAA 5M5YB 3L4PA 3AFQA 4DHJB 5DCNA 1KLVA 2WNMA 1Y1WG 4ZYNA 4LNFA 1Q0WB 4L2YA 1YNJD 3ULJA 4ANVA 1SFOH 2A6ED 4LDTB 2IY5B 3A33B 1TZ1A 4YCWA 2CKHB 1IKMA 1EY5A 2CKZB 3KF8B 1G6ZA 2K0PA 1JE4A 4C3HG 1Z9FA 5IGEA 5C0XG 1VQJA 5IP9G 2E2JH 3GTJB 4N58A 4NY0A 3PQIA 1VQFA 2F0DA 2L76A 4IUPA 4ZYSA 3DHQA 1XTDA 2JWUA 4ICVA 3NQIA 1PDQA 3ZNZB 1U4LA 4A3GG 1B4OA 2C5CA 1MGSA 1UF0A 1MSHA 3B2FA 3SK4A 4X66L 1SXTA 1C48A 2JA7G 1WGDA 3MC9A 4H44C 5CV8A 2RVLA 1QILA 5C3XA 3S17B 1XWEA 3U8ZA 1HNWQ 4UHVA 1FXIA 1S40A 4P1CC 4DAYA 4NXML 3S16B 1VQPA 3SFDB 3S2HH 5HGQA 2Z6BA 2NVXB 3GE3C 4JI8L 2LI5A 2L8JA 3FKYA 4S3SA 3GE8C 3AH7A 1A6XA 1A5RA 2GMIC 2L32A 1DXMA 3MHBA 3Q3MC 5JHAA 1LLRD 1IL8A 4YY3Q 4GOPC 4LK1C 4ZUJA 1R9TH 4NXNQ 4B3SL 4A3LH 2ZCCA 3Q2AC 4GU2A 3TZUA 5F2DA 3HKZG 1STHA 4IUTA 1NY4A 4DN4M 4CJ1B 4JI6L 1FJGL 2BGFA 2LJ5A 3N30A 1M8AA 2ZTCA 2DZMA 3EFXD 4TQ0A 3H9DA 1F2RI 3HRDD 2ENBA 4DR4Q 3GTQB 2RKSA 4ALPA 1GM5A 2KMMA 2EY1A 2K50A 5E4XA 1GUAB 1H9SB 4TKOB 1WTHA 2J0JA 3TMEA 2W82A 3UQBA 1V1PB 5GAEC 2V3NA 2CH4A 3O13A 1EOVA 4M1UB 3ETRA 3Q8BA 5G3LF 2KA7A 3STBD 4IUNA 4LF4L 1KFYB 4A3IB 2F0WA 3AE1B 3D8GA 2Z4IA 1ENCA 3I70A 5GMVA 2QDLA 1K9MC 3VUYA 1WD0A 2IJ0A 1U9RA 1TGZB 5M5WH 3NHEB 2L05A 1N36L 2F3IA 5C3JB 1S72A 1PYBA 1V5OA 2RGFA 5G2NA 3KUCB 2YVCA 1DYQA 1VQ9A 1RRBA 3TEWA 2N78A 4QAYA 3HOYG 3PV1A 3Q3OC 2ONQA 1K51A 1LT4D 2WAQE 4DV2Q 3ZRCA 3T51B 1MI2A 1CA5A 2CW0D 2A5HA 3QHTA 3UIPB 1SNCA 1O80A 1GOZA 1QT9A 2XTIA 2FINB 1NI2A 1C79A 4EEWA 5EGTA 4BY7H 4FF1A 2E2IB 1Q86C 3QJYA 1E6EB 2PI2E 2CQAA 2LXKA 4A3LG 4DHZB 4B9KA 2R61A 1ZYRD 1IW7D 2BB5A 3I8ZA 4FJYA 1TWFH 2KVZA 1EUJA 2ZJRA 4ASWC 2EYJA 3UF8A 4EFOA 1LTGD 1JJGA 4NB3A 2E76C 4AYBB 2J7ZA 4OHJA 1DGSA 4IFDI 3AE2B 1X3GA 1YNXA 3J81i 4MGZE 3TCAA 4BWGB 1R4QB 1EF5A 2N49A 1XO3A 2XK5A 4KZ0A 2GBRA 3VXWA 3CPFA 3OYYA 2KDEB 2B2VC 3ZUNA 2V9HA 4HDQA 5E6PA 2OEOA 4DWFA 3GTPB 4WAAA 1AE2A 2EY6A 3CU7A 2A6EC 2QDBA 1CMXB 2A68D 2ZEQA 1B7YB 3NS1A 2A5UA 3H09A 2MSED 4X3TA 1L4ZB 3E6ZX 4DR2L 2CR5A 1OTCA 1FO4A 2LFIA 5BR8Q 1ZXHA 4KDIC 3ZQ4A 3WOFA 2K39A 1HZBA 3IVFA 3NK9A 1UGMA 1SMXA 1JCKB 1CA6A 3WWVA 1KL9A 2PLPA 4LFCQ 1PFNA 2LXAA 3BVZA 3VYRA 2EXDA 5M5XH 3N1ZC 1TY0A 4BY7G 1WD1A 3C2PA 1TKEA 4FN2A 4DV7L 1XMQQ 2XK5B 5E3FA 1FMAD 1SLJA 1HTOA 1U5KA 3OOCA 1M4VA 2WP9B 2KANA 3RLOA 3S1RB 1UE5A 1S5CD 1T6BX 5FLMH 4L5TA 4F1SA 5EDSA 1VF5C 2NVTB 4JPBW 3HOWB 1S1QB 3SGIA 5EKIA 1I3QH 1LGRA 4BY1H 2ICIA 5EPKA 1N5WA 1I4GA 1SJED 3ZJVA 4RF0A 2CJOA 4JL9A 2R3ZA 3M4OH 2ZXOA 1KH0A 3DM3A 3H0GH 5T8IA 1PRTB 1AE3A 1QOFA 2WXKA 3DQVA 2OJWA 2J4XA 1J19A 2PZWA 2FMMA 1PYSB 2WP8J 4II2B 3R2TA 2MBEA 3OTOL 2KQSA 1B9NA 4APVA 2RSOA 3K80C 3D32A 5LNK1 3S14H 1I5FA 1NYRA 4WJ3M 1EU4A 1KLGD 2AUJD 2V4DA 4XQNA 2RBMA 3FVQA 2R92G 3KLWA 2DZIA 5LMNL 5C4XH 3D6CA 3DPDA 3V62A 4IQZA 2NZHA 4F7XA 2VUMB 2MH7A 3GTOB 2WV6D 1ICFB 1Z5SB 1K0SA 1QF6A 4UAIA 2DX5B 4L5QA 1DOXA 1U4PA 2K32A 4NZLB 2D0PA 1MJEA 5LMNW 3T53B 4TQUS 3AEDB 3AECB 5D94A 3NQTA 1LACA 3J9CA 1UZXB 2LHEA 3K7AB 3TEZA 2VS1A 5C4ZA 3W1SC 2EDGA 4MEMA 3WANA 3OPOA 1Z7TA 3JAML 4YWGG 4NQKE 4BY1G 3GTLB 1UEAB 2B2TA 1JMCA 5JJLA 1SYGA 3U30A 4X66Q 3DOWA 2CFMA 4EKUA 4LNNA 1ZKOA 4UP8A 4C4VB 1JWAD 1IBKL 4DV3L 4QJFA 4MH0E 2L83A 4HPLB 4NXMQ 3MFGA 1JOOA 1UELA 1W6JA 5EE0A 5JEAJ 3RZOB 2GOWA 4GKKL 5C5MA 4TMAB 1ET9A 4BBSH 1N6ZA 1LYLA 4LUOA 2EPBA 4RGOS 3VH4B 4P75A 4W9HA 4NMZA 4KDLB 2N1VA 1Q12A 2BS2B 1MD2D 2LUMA 3K6OA 1WXQA 4B3SQ 2VQFL 5LMUL 5C4XG 3MXNB 2KTRB 1SE9A 4U673 2L4NA 5JOBA 4JI6Q 1FJGQ 1DONA 2KC2A 3EFCA 4M01A 3NUHB 3S2DH 4JI5L 2L55A 1E90A 2H4OA 4KHVA 3ALBA 4RCNA 4KKSA 5KNBA 4ZKBB 2UU9Q 1WXMA 4WJQA 4K8IA 5CV9A 2TSSA 3CCRA 2K05A 2EXZA 1WWTA 4R1JA 4EQNA 4DA2A 3X0WA 1RAXA 3LWEA 4FBJB 3KVFB 4LF4Q 4NNJB 2JRIB 5M3MH 4A20A 4E74A 3U7ZA 3J7A5 4DV4L 4JVZA 1WSPA 1ZE3D 3DBHI 4K7UA 3L7ZC 1SNOA 3HKZE 3ND8A 4RKBA 1N36Q 2O5IC 1KABA 2BKRB 3DUZA 3BZKA 2M8SA 5CV5A 3V2TA 2JA5H 3T1YQ 5C4JB 2KLGA 3W9CB 2FCMA 2YU9B 5GQOA 3N6RA 5J17A 4BBNF 1D4BA 2J53A 3Q8EA 4XWWA 3VRAB 2JP1A 1X3EA 1D1IA 4BBSG 2MQHA 5DM63 3A9JA 4C3IH 3A4RA 1M1KC 5ISRA 2WGSA 4JLCA 2F52A 2HCIA 4KD4A 1R4NB 2ON8A 4R4CA 2YEPB 5D14A 1WMHA 4II3B 1Q3LA 1E9MA 3SHQA 1FD6A 1NMFA 1K3BC 2NPTA 1K50A 3HVDA 1PFBA 2PZUA 3H6MA 3NXWA 2BH2A 1C77A 1FXAA 1PGBA 2AWOA 2BW2A 3OJ4B 1OXSC 2PW7A 1UH6A 2G45B 5I6YA 4IWPA 3WAOA 1I6VC 4MNOA 4K14A 3K59A 2CHBD 2EYLA 1VF7A 5DM73 3L16A 3MHZA 1X32A 4ZLTF 3K5NA 4Y7NH 2PZTA 2A73B 2QGQA 3P75A 4HPPA 4EQOA 4MACA 4BVUC 3VUWA 1XJVA 3AE6B 5CC4A 1KDBA 3RZDH 3PZ7A 1TU2B 4KVGB 1YJJA 3A9JB 3L17A 1QOHA 2KUMA 1TKGA 2F0IA 2F0UA 2F4VL 1QOGA 1SMYD 3BY4B 1PRTF 1F9QA 4GLVB 3L0WB 1DJRD 4WWNA 3OSOA 4DR2Q 1STBA 1YQBA 1BCPD 1D5MC 5KGUA 3ZKJC 1Q46A 2NZ1D 1WFYA 4O42A 1PH8A 3T3NA 5CX3A 3DEPA 4OX9L 2UUBL 2NVQH 2INNE 2M56B 5DLQE 5JVG3 1TKWB 1DOMA 4A3EH 3PIOA 4ANUA 3NS8A 1V1OA 4HJGE 3ZDTA 5HKHA 3PSEB 3I72A 3TL5A 1Y8OB 5D2MB 4B3RQ 2O2VB 2UXBQ 1D5XC 2F0FA 3RMHA 4DV7Q 3S24A 3KUPA 4PG3A 2E3TA 3I3CA 1LTAD 4R4QA 2EQSA 1KDAA 4R4IA 1MI0A 1X1MA 4KY7A 3Q8CA 2HQEA 1WOCA 2N9KA 2N88A 1JE5A 4GKJL 3E5SA 3RNBC 3UGBB 4TQ1A 4ARIA 5CV4A 3ZTCA 2BT6A 1E10A 2GBJA 2LZ6A 1XLQA 3I4NH 1EWCA 3A0JA 2FCSA 4RMAA 1VMPA 3VYTA 4IALA 1PFMA 3L13A 4IM2A 2JA8B 2M0AA 3AV8A 1S3OA 4HN7A 5ELDA 4DK0A 3OG5A 2PKOA 3AE7B 3LJ3A 4EZJA 1STNA 1YX5B 3HOXB 3G4SA 2B2UA 3Q22A 4BA2I 2X38A 4DK6C 4DAPA 3IAS1 4L1BA 1I6HH 2KTFA 2RPVA 3CCSA 5FLXE 3TS0A 3AEAB 5C3EG 4KGTA 1TJEA 3I4MH 3TJPA 2OQ0A 3OTOQ 1X9NA 1C0AA 2K6QA 2YYZA 2R92B 2MP1A 1JT8A 1WI0A 3B1LX 1SEBD 3HOVB 5EBDA 3PO3B 1WH3A 3J7ZC 3MHSD 2HDLA 2LS01 4A3EG 5LMNQ 2GVBA 1EIYB 4WWOA 3S1MH 4DV5L 1GUTA 4FYDA 2DUDA 2LRWA 4PMCA 5DPRA 2JZPA 1C7YA 3RD4A 2JF5A 1K8GA 3PUYA 4U68A 3CCLA 4CQNA 4HCEA 1OEYA 1HUMA 5M3FB 5JJKA 4EUTA 1ASZA 3PUXA 4ZHOA 3MWYW 2CU3A 3X3MA 1I4XA 4DV0L 1ROEA 3I4NG 4YSXB 5E1FA 4IFDH 2IYDB 4A93B 3OWEB 2R7FA 4KKJA 1DOLA 2B2VA 1XD3B 3ERSX 3FKIB 1IBKQ 1Z6HA 4DV3Q 1BVSA 1PH5A 3MC8A 2JYOA 3G71A 3IXSA 2FFKB 2K8HA 1II3A 2QILA 3KDFA 5CYUA 3T13A 2BH8A 4GKKQ 4M02A 3I4MG 4KMUC 5HGTA 1WRDB 1F2MA 3KLSA 5KRUA 4NPSA 1HZ9A 1M90C 1XF5L 4GXBA 3S17H 4EGVA 4HRSA 1K8RB 1JQ4A 2KO3A 1JB3A 1LTLA 1K8OA 2VQFQ 5LMUQ 2PE9A 1SE8A 5GROA 3PZ8A 2M2LA 3TQYA 2YEPF 3KYDD 1ILPA 5EAYA 2VB3X 4JI5Q 3V61A 2G9DA 5IYDH 3ZRFA 2JE6I 2MPMA 1FGUA 3HOUH 3FHWA 2XEWA 2M00A 4NDXA 2JRHA 2R6GA 1HNWL 2HE7A 3BIID 1XXGA 3HGBA 2PYKA 4QB4A 3AU4A 2KJXA 1TWCH 2RQXA 2ALYB 1TWAH 1KJTA 5A2QE 2R7DA 2KCNA 3TP8A 2F4IA 4DR1L 1Q82C 2KXJA 4HCSA 3PGEA 4B0MA 4Q0FA 2RDBC 1PRTC 4DV4Q 2H88B 4OWXB 2DENB 3CSFA 1X3FA 5FJ8H 4DV6L 1O7ZA 4G4KA 4JBJA 4IFDG 1A3TA 2KHJA 2LGDA 4W9KA 2L11A 4P73A 1B50A 4YY3L 1UWVA 2H5XA 5CV7A 1WR6E 1U4AA 4JCVE 4I65A 2PJHA 3RT3B 1HXYD 4A3IH 1PH2A 1AEXA 1WCMH 2XIWA 1J8IA 3DLLA 4IM0A 3A1QA 2EOTA 2K52A 2K6AA 1QE6A 3VDZA 4WFN3 5FR3A 1EF1A 3FEWX 3S1NB 3U52E 2G3QB 3SDLC 1WRIA 1G51A 4FULA 4A3MH 1T0SC 2ZPYA 1EYGA 1E0BA 3HOZH 1VCBA 2MP2A 1JC7A 1T5XD 3D31A 5DPSA 2V1CC 4LWCA 2WDRB 1PVOA 1EIGA 4BBRH 1WX8A 1BMLC 5IOCA 1RKNA 3AM9A 3PLUA 3QK0A 2BA1A 3NVWA 3HOUG 1I50B 1QZGA 2VRRB 3J81j 4CJ0B 4HTHA 1ACCA 1K83B 2ASQA 1SE2A 2EMTA 3O65B 3UDXA 5EE1A 1ZP0B 3AEGB 2DAFA 3VUXA 4HKQA 3T9LA 2I46A 3CCJA 1J7BA 2OJRA 2KJ6A 1UE7A 2IX0A 3H3VI 3VA5A 3KJPA 2K5PA 1IHZA 3MTNB 2ZTDA 1BQQT 5CBEE 3U9OA 5FJ8G 2WKCA 1XPOA 2F4VQ 1KLUD 3BYYB 2WXLA 1L2FA 3P2BA 2IHEA 2OXPA 1UNSA 2E2HH 3PT2B 3Q8AA 1E1TA 4WJWA 1MJDA 3ZO5B 1W2BA 4XQQA 5LL6X 4AUQC 4OX9Q 4V0BA 1DCZA 1KXLA 4HIKA 2J42A 3SD5A 1FNWA 2G5DA 4A3MG 2O5JC 1G2SA 3CCUA 4Z9CB 3M85A 3PIO3 1UWXA 5D3IB 3Q23A 2B2TC 1N32L 4MTKA 1Q8IA 5IODA 2MBHA 4GLSC 1C9OA 3FDTA 4FNFA 1Y1VG 1OEYJ 3TMPB 4IWOA 4BBRG 2N9PC 3I91A 4C1NK 2ZW1A 2NS5A 4PYUA 4YT0B 3RNCC 2K5VA 3I73A 1XLNA 2CHXA 1WIAA 4H2AA 3IFTA 3C1EA 1CKMA 1G291 3BVGA 3G48A 3UE0A 2KHSA 1F9RA 1BOSA 1GAQB 2G9HD 4ULLA 1C1YB 4HK2A 5IYCG 4JBMA 3KWLA 2RHSB 4A3JB 1VQ7A 1F77A 5C3EB 4FHJA 4XDDA 3UDGA 1YJ9A 4MM3A 3VDYA 3DM1A 3CC2A 3HOWH 1SIJA 3KYCD 3UI2A 2IDYA 2VNUD 5AFWA 1F2ZA 1WVLA 2JPHA 3EQLC 3SU8X 2X6LA 1PZKD 3N32A 3T3OA 2O6VA 4EZLA 2OQKA 3ENEA 3N1XC 1MHHE 3U50C 1R4PB 1DGJA 4NAWA 4KV6A 1NSNS 3SR6A 1HA5A 5BMHA 4E6IA 5KHOA 4FADA 2HIVA 5DPWA 1LQBA 4GIVA 2B3GA 1VQIA 5C44B 3RN2A 4PMWA 1OTRB 4BZAA 4FA6A 1MG4A 2AWTA 1V1QA 2I1JA 3Q6BA 4DV5Q 4DQOC 2Z6KC 2NN6I 2LGIA 1CKOA 3AE4B 3F2UA 2E75C 2FUG1 1RTNA 3BDOA 3BK2A 1BF4A 3CAMA 2K5WA 3GTGB 2JZZA 1UAPA 2QHOA 4MM3B 5IYBG 3L9AX 4JG2A 1VLBA 1GPXA 1PXUA 1SDFA 4DV0Q 1A8VA 1L7YA 2C7HA 4HJAA 1EWHA 5JH5C 2BB6A 3BZCA 1IZ6A 4G7OC 3CF6E 1T5EA 2OTJA 4R4OA 1GKHA 1EIHA 2HIXA 1K8MA 1E2VA 1P9DU 2F3WA 3L54A 3AMUA 2M0XA 4KY6A 1CZGA 1L0YB 1GJZA 1SE4A 1A2UA 3EROA 2MLBA 4JI2L 3JC66 4DK3C 1EM7A 5G55A 1NCVA 2XWBB 5EKLA 4DNIA 1WGYA 3P42A 3QWNA 1FNVA 4K2KA 4PS3A 1Y14B 3I7FA 2KHWB 3WOEA 4IKGA 3VQIA 5IN7A 3L3OC 1VQ5A 4KKUA 3JAMi 4B3TL 2DYOA 3ZNHB 3DMUA 3K5LA 1A62A 2KMAA 3BG3A 4WH4A 3HK0A 3AB5A 3GV6A 4CHTB 2OHFA 4ZRQA 1PZJD 2R93G 5G5GA 4FHKA 1TS4A 2KECA 2KN4A 3EVQA 2MJ3A 3C8YA 4DF7A 1QKZA 5I2XA 3U58A 2KAJA 3TREA 4N9PA 2BOSA 2WB1G 1H9SA 2MRPA 3QQ8B 4MH8A 4F87A 2MNAA 2HUGA 1V1PA 1ICWA 3NELA 1W3SA 3A7LA 3DHGC 2PI2A 2DBYA 1TR5A 4HJ9A 4ARCA 2EIFA 4DR1Q 1WI5A 1S5BD 3BINA 1TVXA 2NBWB 4TKNA 5BYSA 5FLXc 3M7GA 2FUHB 2CVRA 4DV6Q 2F0LA 2IX1A 1QZEA 2TMPA 3A8IE 4OXPA 4JGHB 1STGA 1TWHB 3NHHA 4HSVA 5CR3A 3UDFA 3J80E 1RCVD 1HR0L 1JORA 3AEBB 3AEFB 4KKIA 3OWFA 2VZKB 5FR6A 3HS0C 3CRLC 4NP5A 2BCOA 1RIPA 1PHJA 2WXIA 1LUZA 1S4ZA 2WAQB 2PNHA 4YTNB 3QIAA 2WFWA 1YN3A 2UU9L 2YTXA 1B8AA 2DJGC 4C3JB 2JA6B 3MXPA 4MJSA 4ZRZA 1HR0W 2NVYH 5BO4B 3DBLB 4OONA 2KWUB 3NTKA 4FXKC 2AHOB 2FIDA 2BYVE 3A56A 2M19A 5IP7H 1LT5D 4I6NB 3RFZB 2GLSA 5EJWA 3WAMA 3E56A 1SJHD 3J7AF 3N9YC 1K8AC 2B2UC 3UDIA 3AULA 1L1OB 1U0LA 2MQJA 4YSYB 3ZXRA 3H3VC 2INCC 1Y8PB 3NG0A 1PH3A 2BDOA 3MP9A 2BF8B 2KLCA 4JPSA 5G3LD 4DU9A 3T1YL 1PDXA 4ANWA 1Y69U 2F0OA 2MO1A 5LXIB 3RULA 4ME3A 3EA6A 4EZKA 1TWGH 2PW9A 3EECA 3BS1A 1HJPA 5IGCA 4P16A 1YIJA 4ZDVA 3DHIC 4MJSB 4AIMA 4URKA 1F0ZA 5CBAE 2E5LL 3DVGX 2R7ZB 4MGKE 1IYFA 5BYQA 2REXA 4DNRB 3MJWA 2EYPA 4JI3L 3F2CA 4BKSD 2FE8A 1LTSD 1K52A 1O7YA 2JXMB 1JR0D 4P71A 1L5PA 4JOIA 1XT9B 3TUOA 2CQOA 2N0SB 4W9JA 1WGHA 2A74C 3HP3A 1Y1VB 3ONAB 1QOBA 4FXCA 4WQMA 2C7NB 3W3AA 1N32Q 4IDIA 4H02A 2WU5B 1ASYA 1E1OA 1QVFA 2Z0EB 4ZOHC 1U4RA 1YHBA 3PMFA 3TSSA 5IP7G 4XDXA 2BS3B 3TIXA 1KDCA 1TY2A 1JB7A 3V6CB 3ONSA 4IOIE 4FO2A 2N1WA 4XX5A 1LT6D 1PTOB 1EY6A 4ZRIA 1UD7A 2XSCA 3V60A 3VR8B 4YCVA 1CZPA 1NUCA 4A3BH 3A9KB 3R66C 2D3GA 4G11A 4HROA 1TIFA 3KUZA 3U4EG 2PW5A 2J52A 3QOJA 2WKDA 2XRSD 1BBXC 1VJKA 3AE8B 1L0XB 3DBRB 5C23A 4XGAB 1LXDA 3VFKA 1WGKA 2DY7A 1GHKA 2A69C 4FJZA 4MSQB 2C60A 3OIQA 3M4QA 1CZWA 3PV0A 2G4DB 1WTPA 3AE3B 1BBWA 2IPKD 4LW1A 1YOVB 4B3RL 2UXBL 5CTRC 5J18A 2O2LD 4WWPA 4C2MB 3ZXVA 4GGQA 1D8LA 1X3PA 1J8CA 1KIXA 1EFWA 1VQBA 1HFGA 3E9HA 2RMMA 2O6VD 2BS4B 4L63B 4X3UA 1B53A 5LL6S 3TS2A 1VZ6A 4L5RC 1PA6A 2KWDA 4DHJD 3PUWA 1IBML 2WDVB 3CW2C 1NBFC 4MHEA 4A6QA 2LASA 3WALA 1EYAA 4TSSA 2EZVA 2EY5A 2MJ8A 3HOVH 2D3CA 5JAVA 1EQQA 1YIWA 2WXPA 4LDTD 1FCLA 4B3MQ 3NVYA 1SNPA 2Y0SG 4XE0A 1A3VA 3SDZA 3B6YA 4HIMA 4LF7L 2AEHA 1GXDC 2CCZA 4CDCC 2DLBA 4C00A 4DK5A 1SB3C 2JX5A 4CHKA 1IXRA 2PVGC 1G6JA 1N9WA 1E7PB 1IYUA 1QWYA 1MPEA 1SBBB 1Y1WB 3CMMB 4LNKA 2INPE 1KRHA 5M3FH 4F8CB 2Z59B 3TEYA 4C4VA 3M4PA 3HFZB 5JHBA 3ICEA 1OFFA 3R2IA 4FVMA 3H3VH 2I07B 4JYAL 1TT5B 2SAKA 2E2DC 2ZTEA 2N3SA 4JI2Q 1EQRA 1F52A 4MGIE 3NTIA 4RGTA 3BK1A 4C3HB 1YHQA 3U2SC 1SYFA 3LNNA 2FIFA 4X3SA 5IGDA 1YMHE 3S2AA 1XLPA 1PGXA 3WCQA 2KCCA 1HFNA 2FAZA 3I9V1 4LFBL 2R93B 4B3TQ 5FLMG 4A3GB 1A0IA 1I4PA 1RF2D 5C3WA 2UXCL 1LM0A 2N55A 1FXTB 4C7YA 3MXNA 3SVMA 2JA7B 1P8LA 2KTRA 1H9MA 3BWUD 1WZ3A 1YD8U 4J3OD 2UYZB 1VQAA 4HEA1 4IUQA 1XMOL 1Z2MA 1KF6B 5JVH3 1KC8C 1KRSA 3DWQA 2LHDA 3Q3FA 1A15A 3H6NA 1T9HA 1JRPA 3PO2H 3GD7A 2K4KA 4B9WA 3H0GG 3I56A 3WAPA 4USAA 1I4RA 3X23A 4C7ZA 1RJTA 3MJ5A 4WJOA 1GUWA 5FO9B 3UQAA 2J7QB 4MGYE 4DUZL 4LCDE 4A3KH 5FOBB 3GV3A 4KGRA 4ODGA 3HKZB 2MBBB 1H9JA 1VR9A 4K7WA 1LTTD 1UE6A 2L9HA 4KJNA 4LF6Q 5CHWA 1HR0Q 3W5UB 5E6OA 1SFOB 2HQLA 4PS8A 3WA0A 3DWMA 2WB1E 4LUVA 2KJHB 1VQEA 2UUAL 2KZRA 4IJLA 2JYEA 1E22A 1PH7A 1E8XA 4X57B 1XLOA 4H7BA 2DNCA 1YQ3B 3KK7A 3CCVA 4GLAC 1QNUA 4PZ7A 4DPGA 4DR3L 2MW5A 2L00B 5BMIA 1BBUA 3UE1A 3QX1A 1P7EA 1RLFA 4K7SA 2HHHL 5D7GA 3NTHA 3SXHA 2F0JA 4RG1A 2BYFA 2Z6KA 3SE0A 4B9XA 1Y8NB 4US8A 2MUYA 2IT1A 4C56C 4X62L 4KSLC 2IX3A 1D3ZA 2NN6H 1BT0A 1CSPA 2LFNA 5E7NA 3HOYB 2KQ4X 5HY6A 3S2HB 1L6VA 2QJLA 2WINB 1V9JA 3RN5A 2Y3AA 3AE5B 5ELBA 1G2TA 1PTOF 4CKBA 5COYA 4DAVA 2PEAA 3B08A 2HJ8A 2QMTA 2H1EA 3UINB 2FMCA 4GNXA 2DGYA 4M0WB 3NPPA 4DDGD 5IT9E 4QGUA 3J81E 4DR6L 3PSIA 1R9TB 4A3KG 3PZDA 1GB4A 2GBNA 2OCEA 4KGSA 2WXQA 2F0EA 3MEHA 1FNUA 2E5LQ 1GB1A 1D7QA 2V0GA 2EELA 2NVUI 3K5OA 5I6WA 1LTID 4JI3Q 3ER0A 4A3DH 2MJDA 3GB1A 3SR1A 4E71A 2K5HA 4RMFA 2HDMA 3RI7C 1VQ4A 1PH9A 2KJRA 1VQGA 2FXQA 3LWUA 4OWWB 4A3CH 1EUVB 1WXVA 1OXUA 3PLVA 4ABNA 5C0XJ 1G8ZD 4AWJA 1X3QA 3FPPA 4HAEA 1Q5WB 2O2VA 4S0RA 4GNXB 1VQHA 4RM8A 3AQQA 5M5WB 5M3MG 1YN4A 1QJOA 1C4AA 3G7LA 2WXJA 4C80A 4FLHA 4OVUA 3VAWA 4DR5L 1E0ZA 4O1NA 1PZID 4K6DA 4RGNA 3DDCB 3VR3A 2NN6G 4KHPL 3EHVA 1N34L 1EYCA 4FJVB 1BNZA 2MHJA 4R8NA 2MBOA 1VMCA 1PH4A 2JA5G 2GBKA 4EOYA 2GI9A 3J80c 1RD9D 3GTKH 2JUOA 5CMDA 4A3FH 1D1KA 2DNFA 4YL8A 4BY7B 1NBWA 4LF9L 1AYFA 3HZXA 1Q7YC 2F0GA 4C3IG 3HHMA 1JW9D 1CM9A 3NJTA 1PRTD 4B08A 5K5PA 4JE3B 1TWFB 1PYWD 2KOXA 5E6NA 3AMZA 3W1GA 1BXTA 2IL8A 1SAPA 3W5VB 2W9NA 1YZ6A 1I42A 4PMBA 3PHWB 1L0WA 2NWGA 5I2YA 3I63C 3QIJA 1CT1D 2WXGA 5NUCA 4A3CG 4IG7B 2CU1A 1IBMQ 3MC0B 1TXYA 4JI1Q 3FILB 4OZAA 1EZ8A 4G50A 1L1OC 4GZYC 2K01A 4LFAL 5DAUA 2ZNVB 1DOYA 1EY8A 1QVCA 3PUVA 2ES2A 1EWIA 4JW0A 3EUB2 4JX1C 3L10B 1R4MB 4KX6B 1B44D 2B63H 1O7IA 5JJZA 4DAMA
chains in the Genus database with same CATH topology
5EPJA 1I4QA 2PPBC 5CGKA 4QUFA 3PO0A 4OW0A 1A70A 4RNAA 5KYLA 1SNQA 5LHY1 4WRDA 1NEKB 4DXFA 5KNDA 4XXEA 1ET6A 2BA0A 2L5TA 1SSNA 3QO2A 5H8YE 3A54A 3LYYA 1JQYD 5HI1A 3H91A 1I3QB 4BY1B 4YXDB 2BE5C 1JICA 3AE9B 1STYA 1L0VB 3M4OB 3D6WA 1EWYC 3H0GB 1OXVA 2NTSA 4AQ7A 4L8JA 1PTOC 2D62A 5CV6A 1EZ6A 4KKTA 3GS2A 2VXWA 2AX5A 2AWNA 3I90A 2EVBA 3S14B 3Q0AA 1NYQA 1TS5A 2XNAC 4KK7A 3BYTB 3IT6B 3MZ5A 5FLXL 4BA1I 3P1HA 1N5XA 2JEBI 5C4XB 4A8XC 1BDOA 4MIUA 4DK1A 3P7JA 1AP0A 3NBHA 3NZ3A 4L23A 5EQ0A 3OHXC 3A55A 1F2YA 2EYFA 4K5WA 2K28A 1F2LA 2EYOA 2Z1CA 2B2YA 1YNNC 2EE1A 2K3UA 1CK1A 2AQ2B 1NAPA 1FEHA 4MT5A 1RYJA 2JEAI 4RCOA 2RDHA 4ME5A 2GRIA 1EEID 3H8HA 3QOLA 1RWSA 1OO9B 4KJOA 2JSVX 2WXOA 4BBSB 4K5VA 4G57A 1Q1EA 5JPNC 3URYA 3TBIB 1P7FA 4J8QA 1FYCA 2L12A 1DZ1A 1I7HA 3S2DB 4HEDA 4GDLB 5BYRA 1TS2A 3I57A 1RODA 3OW7A 1H9RA 3NE5B 2PIAA 1GHJA 3NVVA 2H89B 3EGRA 2NBFA 2KEDA 5A2QL 2F03A 3CQZB 2XVSA 4HR7B 1FCCC 3CKIB 3P4QB 2ZXRA 2DYMA 4KHZA 1UGJA 1EEFD 1TIID 5JEAH 4C3IB 1EYDA 3WDNA 4G7HC 4XYQA 3MXGA 1MSGA 1MHXA 3A8JE 1E2ZA 2WU2B 4WAFA 5I9OA 1QNKA 5T1GA 4US9A 4YTPB 1RDPD 2M9VA 3M7NA 5AUIA 1VZ7A 1IYVA 1LV9A 1C4PA 2QIEB 3RPFC 4Y7NB 3LXFA 1RFKA 1RHPA 3RZDB 3CIRB 3NVZA 1SNMA 3FRPB 1T3QA 2F0HA 2BBCA 4A9AA 4G7ZC 3S1QB 3V96A 1FRRA 1F9SA 3NUCA 2DN8A 2BTEA 4FXDA 1PGAA 2NVQB 4A3EB 3GTMB 1Q90A 5JEAG 4RKLA 4N59A 4B0EA 5KIXA 4I7ZC 1VDVA 4OZCA 3MVVA 1LT3D 2NMQA 2K5DA 2PQEA 2EKIA 5D65A 1SF0A 3D4DA 2A6HC 3AB9A 1JWUD 2ICEC 4XDCA 3I4NB 1CHPD 3AN1A 4KY5A 4ILWA 3M4YA 4QF4A 1EU3A 1A2TA 3PUZA 4JWSC 4LLGM 5C4HA 1V43A 3IAM1 4ZK9B 4CGYB 3DWAA 3DWPA 1MVKA 3I4MB 4EVOA 4RHRA 4OIJA 1QQRA 4QIWB 2AQ1B 4XQJA 1OQQA 4YIJA 3S15B 1V97A 4ZHPA 1DOIA 2WXMA 3KLSX 1EOTA 3BDCA 4Q2JA 5HFYA 2WQYB 1S5ED 1PLFA 3BDLA 1VRAB 2PNRC 4XT3B 3D4RA 3BVMA 2A69D 1H9KA 1AFPA 4NAMA 1B9MA 1W6KA 4XYOA 5FO8B 4KTAA 4M8AA 3BZDB 3D4WA 4YTMB 4QMGA 1C8CA 1N62A 1FGBD 2Q5WD 5EE3A 1WTWA 1KAAA 3ITPA 5J22A 4CJ2C 5FKAC 1L4DB 4FF4A 1BR9A 5IGGA 3IT4B 4OVZA 2F0VA 2X69A 1O78A 3C3LA 5KNCA 3U9SA 2K03A 1HUNA 1RTOA 1FR3A 2K1BA 2L1AA 4A55A 2F0QA 1SYBA 4IZ8A 3W2DA 5KEEA 4JX1C 1N63A 3M3YB 2FJ2A 3SK6A 4F8MA 4K8JA 2QKIC 3NWSA 1E2WA 3HOUB 4R8IA 3P4RB 3TP6A 1RM6C 3N52A 1J7AA 2AUKA 4UDUC 1ZXIA 3VR6A 4KN4C 1NENB 1TWCB 1TT2A 1TWAB 2EYHA 1HA6A 4HSPA 2F0TA 1ZPSA 1LTRD 4ZQ3A 2QEJC 1Q1BA 2I2YA 2XRQD 2GA4B 1Y56A 1ZUD2 1XCQL 1XEEA 2VB2X 1IGDA 1WCMB 3GQBA 2E74C 2LKVA 1BO0A 3CWIA 5C6AA 3J80L 4A3MB 3HG9A 3HOZB 1ZDVA 3TEXA 2B8FA 2DNEA 3R93A 2B76B 1UWMA 2WXFA 2F0SA 1J7CA 4BBRB 2G1EA 1DD2A 3UI3A 1ESRA 4NW2A 1SYEA 3V3XA 1GJXA 1JROA 1HEZE 3MAQA 5T1IA 5BMGA 1ILQA 3KBXA 2XWJB 1TS3A 4LTUA 4P6VF 2Z4HA 4MN3A 3NSWA 2LMCA 4EQPA 4IFDJ 4H13C 5E6JA 1ZDXA 2E2HB 3HVZA 3FMCA 1YNJC 4FF3A 3R8BA 1YN5A 2IWHA 2EJMA 2B2YC 3S9WA 2ZXPA 2RDFA 1Q10A 4IN3A 1ZEQX 2IGDA 3H94A 2LMCB 2RSNA 4RGMA 2IGGA 4PT5A 2V4IB 4XWTA 4RH6A 1A3UA 4CBVA 4OGQC 5IIFA 3JAME 2MJEA 4L6TB 1BCPB 3TN2A 1IKLA 2X6GA 5BN4A 1D6EC 1XTCD 3CRKC 3T56B 2AQ3B 4ZKCB 3DWGC 2W3RA 5K36H 1SNDA 2BDNA 3D3RA 1HZ6A 1TZOA 3P1MA 3NRZA 2F0NA 3OMGA 5FO7B 1WTRA 3PIP3 2NUCA 3QG1A 1TKYA 2WB1B 4FXGC 1FIQA 2K33A 4X3KA 2VZKD 5MPOA 2O4XA 1CFMA 4A90A 3VR2A 2MEKA 2KQ3A 1EL0A 2W54A 1C78A 2QCPX 2F0KA 5I9PA 4JWUC 1ENFA 1LO5D 5ELCA 4WORA 1EQTA 1OQRA 4OO1I 2CW0C 2WACA 1KNAA 3IKJA 1FD7D 4IUUA 1AN8A 1ZYRC 2HDEA 1IW7C 3C1FA 4ID6A 4KN7C 4WWMA 5K36G 4M0WA 2OEDA 2PCFB 2K7VA 1FFVA 3E0JA 2KDMA 2E2JB 1CQVA 1DM0B 1CI3M 4K6LA 1LABA 1S5DD 1WTQA 5EBCA 2V3PA 1N60A 1C76A 1I4HA 3TP5A 2MGSA 2ACZB 1GUSA 1U4MA 4JK1C 1F2RC 2L52A 3P20A 1YJIA 1KNEA 2JQRB 2B39A 2A68C 2N9LA 1DOKA 3TDQA 2XN9C 1XX8A 4DGZA 5D3DA 4NKLA 3SK5A 5TSSA 5GXGB 3A7AB 2BE5D 3J7YW 2OF1A 4RWSC 4R3DA 1LTBD 4F88A 1HTLD 1SYCA 4WURA 3ZYYX 2QF7A 1G91A 2FHTA 3MTSA 5E4WC 1CJEA 1IGCA 3P63A 1N61A 2LJIA 1PTOD 3MA2B 3DEOA 3IAYA 1XCTL 3Q6SA 2NVYB 1B1ZA 5C0XI 1CQFA 4V190 4OZBA 1Z47A 1HPCA 1TYGB 1IBXA 4ZRPA 3VYSA 2PMZB 1QLBB 1OXTA 1FRDA 4J6HA 2D5GA 5I4DA 4D2KA 3AEEB 3NP8A 2Z8LA 1K53A 4ZUIA 4QUCA 2RDGA 3QB3A 1EY7A 1TWGB 1KTKA 1GUOA 2PMVA 4DNTB 3FILA 2SNMA 2Q8IB 5H92C 4LAAA 1YNND 2KOLA 3RUZA 4XTCS 2PO4A 1BCPF 1PMRA 2B2WC 5AUKA 4TRDA 1R7SA 5IT9L 1C4QA 1IBXB 3J81L 1NVID 2SEBD 5JPMC 3AU7A 3K0YA 3K57A 3X3NA 3K5MA 1NR2A 3OIPA 3HUIA 3KBGA 4XT1B 4EE2A 2ZT9C 4N6EB 2K9XA 2NTTA 5KYIA 2Y0SB 4Q5VA 4FF2A 2NYZD 2ID0A 2JSOA 1JOKA 2SNSA 1JOQA 4A3BB 1EY4A 3ABVB 4RHSA 4HMJA 2L0CA 4H0LC 2JU6X 3DXJC 4PQXA 2K5QA 1GUNA 1PUTA 4OIKA 2IW3A 3B2GA 5M5XB 4J1MA 1HZ5A 2MHVA 1QCBD 1SE3A 1VCIA 2NB0A 1B2TA 1EY0A 1JMLA 4ITKA 1AW7A 1ESFA 5HHDG 3IFDA 3Q8FA 1FM0D 1L6UA 5FK9C 5HURA 4KD3A 3SEBA 2W3SA 4BS9A 4WIPA 3G6JB 4RF1A 2IGHA 1EQVA 1OXXK 4HMIA 1BUVT 4GDKB 3MXUA 3KQ4A 3K58A 5ELEA 4HKZE 1SYDA 3ZGZA 1QG7A 1AZPA 1VDZA 3VA7A 1UUPA 1B9RA 2K22A 4DXGA 2CJNA 3R3OA 4KI0A 2J0TD 3HRZC 2LEKA 1C9FA 4K5XA 2Q8TA 4K2LA 1CTMA 4RAUC 1FFUA 2JYTA 4QCLA 3VRBB 3KWVA 5JXVA 4N9TA 1IUEA 1ENAA 4LJZC 4CKCA 2PTLA 3PO2B 5DNFA 3RLFA 3HEJA 3Q24A 2D2CC 3CHBD 2OT2A 1JALA 3KLRA 5DEHA 3Q69A 1SMYC 4PV1C 2W55A 1B3AA 3LB8C 5EE9A 2A6HD 5CORA 1F9PA 4MACA 1BCPC 2EJGC 4A3KB 1V8CA 2F0MA 2D9UA 5IGBA 2FBWB 4JBWA 1EY9A 1AZQA 2EY2A 3VR4A 1AWDA 4NJCA 1JWMD 1NI3A 2WLBA 3FC4A 5EKKA 3P4SB 3TP7A 1XYIA 1SSOA 5M3MB 2PVOD 1YNTE 4RFBA 2KACA 3ZJTA 3ERQA 1ML0D 4C3JG 2KEEA 1JWSD 2DY8A 2JA5B 5G5HA 2KVMA 2RA4A 1HHVA 4IURA 3B9JA 3EJIA 2ZW0A 2I38A 1PTOH 3T4AC 1ZXTA 2D5DA 2EJFC 5J39A 2Y5CA 3GO5A 1EFID 4FP5D 3V05A 3W1SA 4OO1H 3LX0A 1CHQD 4A3DB 3I4LA 2WXRA 5BN3A 5EPLA 1WTOA 3IL8A 2LY7A 1GUGA 2C9OA 2WIIB 3FPUB 1HCZA 4C1NI 1S5FD 1C4CA 3NBIA 1BUIC 2F1MA 1QB5D 1NR4A 1D2BA 5HG2A 3MFYA 2WDQB 1ZOYB 1JWBD 1HQMC 1HTPA 3VYUA 5IGFA 3C46A 1WTVA 4PNYA 2EYMA 3GTKB 4A3FB 1TQOA 3OMCA 1HRJA 2WXHA 3J7AV 4REZA 3NWTA 1STEA 3E9SA 1YQ4B 4OO1G 2N7JA 2B8GA 1QOAA 5ELFA 4LMQD 1STAA 4CKEA 4RA8A 1ONLA 5C2TB 1D5ZC 5J1ZA 3FAHA 2WXNA 2L1BA 2F0PA 1WYGA 3TZDA 5C0XH 2BYTA 2HTME 2K04A 4AS1A 2HCCA 5BN5A 1HQRD 5C5LA 2DWQA 4LK0M 1VZ8A 5M9OA 1V8QA 4P2CB 4XIGS 2B63B 3P4PB 1I6HB 2Q8RE 3GP7A 1PFDA 2SDFA 1J9OA 1WTXA 2Y5PA 3KF8A 3T16A 1O7LA 3A8KE 4ZAIA 2E6XA 3VR9B 1MBYA 3SHLA 2F3VA 2SOBA 3SK8A 4IUVA 4R9WA 2GB1A 4YSZB 3S1MB 2QSDA 4OL7A 2JXTA 4NAWB 2B2WA 3ND9A 3VR5A 5A35A 4DFAA 5M5YB 3L4PA 2WNMA 4L2YA 1YNJD 2A6ED 2K0PA 1IKMA 1EY5A 1G6ZA 1JE4A 4C3HG 5IGEA 5C0XG 4N58A 3GTJB 2F0DA 4IUPA 4ZYSA 3DHQA 2JWUA 3NQIA 1PDQA 1U4LA 1B4OA 2C5CA 1MGSA 1MSHA 3B2FA 3SK4A 1SXTA 1C48A 4H44C 5CV8A 2RVLA 1QILA 5C3XA 3S17B 1XWEA 1FXIA 4DAYA 3S16B 3SFDB 2NVXB 4S3SA 3AH7A 1A6XA 2L32A 1DXMA 3MHBA 1LLRD 1IL8A 4LK1C 4ZUJA 3TZUA 5F2DA 4DN4M 1STHA 4IUTA 4CJ1B 1M8AA 3EFXD 4TQ0A 1F2RI 3HRDD 2ENBA 3GTQB 2RKSA 2KMMA 2EY1A 5E4XA 1H9SB 4TKOB 3TMEA 2W82A 1V1PB 2V3NA 3ETRA 3O13A 4M1UB 3Q8BA 5G3LF 2KA7A 1KFYB 4IUNA 4A3IB 2F0WA 3AE1B 3D8GA 2Z4IA 1ENCA 3I70A 1WD0A 2IJ0A 1U9RA 5C3JB 1DYQA 3TEWA 2ONQA 1K51A 1LT4D 3T51B 1MI2A 1CA5A 2CW0D 2A5HA 1SNCA 1O80A 1GOZA 1QT9A 2FINB 1C79A 5EGTA 4FF1A 2E2IB 1E6EB 3QJYA 2CQAA 2R61A 1ZYRD 1IW7D 2BB5A 3I8ZA 2EYJA 1LTGD 2E76C 4AYBB 2J7ZA 4OHJA 4IFDI 3AE2B 4BWGB 1R4QB 1XO3A 2B2VC 2OEOA 3GTPB 2EY6A 3CU7A 2A6EC 2QDBA 2A68D 3NS1A 3H09A 4X3TA 1L4ZB 3E6ZX 1FO4A 2LFIA 1ZXHA 3ZQ4A 3WOFA 3NK9A 1JCKB 1CA6A 2PLPA 1PFNA 3BVZA 3VYRA 1TY0A 1WD1A 3C2PA 1TKEA 5E3FA 1FMAD 3OOCA 1M4VA 2WP9B 3S1RB 1S5CD 1T6BX 1VF5C 2NVTB 3HOWB 5EKIA 1N5WA 3ZJVA 2ICIA 5EPKA 1I4GA 1SJED 4RF0A 2CJOA 2R3ZA 1KH0A 2ZXOA 5T8IA 1PRTB 1QOFA 2WXKA 2J4XA 2PZWA 2FMMA 2WP8J 3R2TA 1B9NA 2RSOA 5LNK1 1NYRA 1EU4A 1KLGD 2AUJD 2V4DA 4XQNA 2RBMA 3FVQA 3D6CA 4IQZA 4F7XA 2VUMB 2MH7A 3GTOB 2WV6D 1QF6A 4UAIA 1DOXA 1U4PA 2K32A 4NZLB 3AEDB 3T53B 4TQUS 3AECB 3NQTA 1LACA 3J9CA 2LHEA 3K7AB 3TEZA 5C4ZA 2EDGA 3OPOA 1Z7TA 3JAML 4YWGG 3GTLB 1UEAB 2B2TA 1SYGA 1ZKOA 1JWAD 2L83A 3MFGA 1JOOA 1W6JA 5EE0A 5JEAJ 3RZOB 5C5MA 4TMAB 1ET9A 2EPBA 4RGOS 4NMZA 1Q12A 2BS2B 1MD2D 2LUMA 3K6OA 1WXQA 4U673 2L4NA 5JOBA 1DONA 3NUHB 2L55A 2H4OA 4KHVA 4RCNA 4KKSA 5KNBA 4ZKBB 4K8IA 5CV9A 2TSSA 1WWTA 2K05A 2EXZA 4EQNA 4DA2A 3LWEA 3U7ZA 1WSPA 1ZE3D 3L7ZC 1SNOA 3ND8A 4RKBA 2O5IC 1KABA 3DUZA 5CV5A 3V2TA 5C4JB 3W9CB 2YU9B 3N6RA 1D4BA 2J53A 3Q8EA 4XWWA 3VRAB 2JP1A 1D1IA 5DM63 5ISRA 2HCIA 4KD4A 2YEPB 2ON8A 5D14A 1Q3LA 1E9MA 1FD6A 1K50A 3HVDA 1PFBA 2PZUA 3H6MA 3NXWA 1C77A 1FXAA 1PGBA 2BW2A 2AWOA 1OXSC 2PW7A 5I6YA 1I6VC 4K14A 3K59A 2CHBD 2EYLA 1VF7A 5DM73 3MHZA 1X32A 4ZLTF 3K5NA 2PZTA 2A73B 3P75A 4EQOA 3AE6B 5CC4A 1KDBA 3PZ7A 1TU2B 1YJJA 1QOHA 2KUMA 1TKGA 2F0IA 2F0UA 1QOGA 1SMYD 1PRTF 1F9QA 1DJRD 3OSOA 1STBA 1BCPD 1D5MC 5KGUA 2NZ1D 4O42A 3T3NA 3DEPA 2INNE 2M56B 5JVG3 1TKWB 1DOMA 1V1OA 4HJGE 3I72A 1Y8OB 1D5XC 2F0FA 3RMHA 3KUPA 2E3TA 3I3CA 1LTAD 3Q8CA 1MI0A 1KDAA 4KY7A 2HQEA 2N9KA 2N88A 3E5SA 4TQ1A 4ARIA 5CV4A 1E10A 2BT6A 1XLQA 1EWCA 1VMPA 3VYTA 4IALA 1PFMA 2JA8B 2M0AA 3AV8A 4HN7A 5ELDA 4DK0A 2PKOA 3AE7B 1STNA 3HOXB 2B2UA 3Q22A 4BA2I 2X38A 4DAPA 3IAS1 4L1BA 2RPVA 5FLXE 3AEAB 4KGTA 1TJEA 2YYZA 2R92B 2MP1A 1SEBD 3HOVB 5EBDA 3PO3B 2HDLA 2LS01 1GUTA 4FYDA 4PMCA 2JZPA 3RD4A 3PUYA 4U68A 4CQNA 4HCEA 1HUMA 5M3FB 3PUXA 4ZHOA 3MWYW 2CU3A 3X3MA 1I4XA 1ROEA 4YSXB 5E1FA 4IFDH 4A93B 3OWEB 4KKJA 1DOLA 2B2VA 3FKIB 1Z6HA 2JYOA 3IXSA 2FFKB 1II3A 2QILA 5CYUA 3T13A 4KMUC 5HGTA 1F2MA 3KLSA 5KRUA 1XF5L 4EGVA 4HRSA 1JQ4A 1JB3A 1K8OA 3PZ8A 2M2LA 2YEPF 1ILPA 2VB3X 2G9DA 2JE6I 2MPMA 2M00A 4NDXA 2R6GA 3BIID 1XXGA 3HGBA 2PYKA 4QB4A 2KJXA 2RQXA 5A2QE 3TP8A 2KCNA 2F4IA 4HCSA 4B0MA 4Q0FA 1PRTC 2H88B 4IFDG 1O7ZA 4G4KA 1A3TA 2L11A 1B50A 5CV7A 4I65A 1HXYD 1AEXA 2XIWA 1J8IA 2EOTA 2K6AA 1QE6A 4WFN3 5FR3A 3FEWX 3S1NB 3U52E 1WRIA 1E0BA 1JC7A 1T5XD 3D31A 2WDRB 1EIGA 1BMLC 5IOCA 1RKNA 3AM9A 2BA1A 3NVWA 1I50B 4CJ0B 4HTHA 1ACCA 1K83B 1SE2A 5EE1A 1ZP0B 3AEGB 4HKQA 2I46A 1J7BA 2IX0A 3VA5A 2K5PA 1IHZA 5CBEE 1BQQT 3U9OA 2WKCA 1KLUD 3BYYB 2WXLA 2OXPA 1UNSA 3Q8AA 4WJWA 4XQQA 5LL6X 4V0BA 1DCZA 2J42A 1FNWA 2O5JC 1G2SA 4Z9CB 3M85A 3PIO3 1UWXA 5D3IB 3Q23A 2B2TC 4GLSC 1Q8IA 5IODA 3FDTA 4FNFA 3I91A 4C1NK 2ZW1A 4YT0B 3I73A 1XLNA 4H2AA 3IFTA 3C1EA 1G291 3BVGA 2KHSA 1F9RA 1BOSA 1GAQB 2G9HD 4ULLA 3KWLA 4A3JB 1F77A 5C3EB 4XDDA 1SIJA 3DM1A 3UI2A 2IDYA 2VNUD 5AFWA 1F2ZA 1WVLA 3EQLC 2X6LA 1PZKD 3T3OA 1MHHE 1R4PB 1DGJA 4KV6A 1NSNS 3SR6A 1HA5A 5BMHA 4E6IA 5C44B 3ZJUA 4PMWA 4DQOC 2NN6I 2LGIA 3AE4B 3F2UA 2E75C 2FUG1 1RTNA 3BDOA 3BK2A 1BF4A 3GTGB 2K5WA 1UAPA 4MM3B 3L9AX 1VLBA 1GPXA 1PXUA 1SDFA 1EWHA 2BB6A 4G7OC 1T5EA 1EIHA 1K8MA 1E2VA 2F3WA 3AMUA 4KY6A 1CZGA 1L0YB 1SE4A 1A2UA 3EROA 1EM7A 1NCVA 2XWBB 5EKLA 3P42A 3QWNA 1FNVA 4K2KA 4IKGA 3WOEA 3VQIA 3L3OC 2DYOA 4KKUA 3DMUA 3K5LA 4WH4A 3BG3A 3AB5A 3GV6A 4CHTB 2OHFA 4ZRQA 1PZJD 5G5GA 1TS4A 2KECA 2KN4A 3EVQA 2MJ3A 3C8YA 4DF7A 1QKZA 5I2XA 2KAJA 4N9PA 2BOSA 1H9SA 4MH8A 4F87A 2HUGA 1V1PA 1ICWA 3A7LA 2DBYA 1TR5A 4ARCA 1S5BD 1TVXA 5BYSA 3M7GA 2CVRA 2F0LA 2IX1A 2TMPA 3A8IE 1STGA 1TWHB 3NHHA 5CR3A 4HSVA 3J80E 1JORA 1RCVD 2WS3B 3AEBB 4YSYB 3AEFB 4KKIA 3OWFA 2VZKB 3HS0C 3CRLC 4NP5A 2BCOA 2WXIA 1S4ZA 2WAQB 4YTNB 3QIAA 1YN3A 4C3JB 2JA6B 3MXPA 4ZRZA 3NTKA 4FXKC 3A56A 2M19A 1LT5D 3RFZB 5EJWA 3E56A 1SJHD 3J7AF 3N9YC 2B2UC 3H3VC 1Y8PB 2BDOA 3MP9A 4JPSA 5G3LD 4DU9A 1PDXA 1Y69U 2F0OA 3EA6A 2PW9A 3BS1A 5IGCA 4P16A 1F0ZA 5CBAE 2R7ZB 5BYQA 4DNRB 2EYPA 2FE8A 1LTSD 1K52A 1O7YA 2JXMB 1JR0D 1L5PA 3TUOA 2N0SB 2A74C 3HP3A 1Y1VB 3ONAB 1QOBA 4FXCA 4WQMA 3W3AA 4IDIA 2WU5B 4ZOHC 1U4RA 3PMFA 3TSSA 2BS3B 4XDXA 1KDCA 1TY2A 4IOIE 4FO2A 1LT6D 1PTOB 1EY6A 3VR8B 2XSCA 1CZPA 1NUCA 4HROA 3U4EG 2PW5A 2J52A 3QOJA 2WKDA 2XRSD 1BBXC 1VJKA 3AE8B 1L0XB 1WGKA 2DY7A 1GHKA 2A69C 3OIQA 1CZWA 3PV0A 1WTPA 3AE3B 2IPKD 2O2LD 4C2MB 1X3PA 1HFGA 2RMMA 2BS4B 4L63B 4X3UA 1B53A 5LL6S 1VZ6A 2KWDA 3PUWA 2WDVB 4MHEA 4A6QA 1EYAA 4TSSA 2EZVA 2EY5A 2MJ8A 5JAVA 2WXPA 1FCLA 3NVYA 1SNPA 4XE0A 1A3VA 3SDZA 1GXDC 2DLBA 1SB3C 2JX5A 2PVGC 1E7PB 1IYUA 1QWYA 1MPEA 1SBBB 1Y1WB 3SFEB 2INPE 1KRHA 3TEYA 1OFFA 3R2IA 4FVMA 2I07B 2SAKA 2E2DC 3NTIA 4RGTA 3BK1A 4C3HB 3U2SC 1SYFA 3LNNA 4X3SA 5IGDA 1YMHE 1XLPA 1PGXA 3WCQA 2KCCA 1HFNA 3I9V1 2R93B 4A3GB 1I4PA 5C3WA 1RF2D 2N55A 4C7YA 3MXNA 3SVMA 2JA7B 3BWUD 1H9MA 4J3OD 4HEA1 4IUQA 1KF6B 5JVH3 3DWQA 2LHDA 1A15A 1JRPA 3GD7A 4B9WA 4USAA 1I4RA 4C7ZA 1RJTA 3MJ5A 1GUWA 5FO9B 5FOBB 3GV3A 4KGRA 4ODGA 3HKZB 1H9JA 1VR9A 1LTTD 2L9HA 4KJNA 3W5UB 1SFOB 3DWMA 2JYEA 1XLOA 4H7BA 2DNCA 1YQ3B 3KK7A 1QNUA 5BMIA 1P7EA 5D7GA 3NTHA 3SXHA 2F0JA 3SE0A 4B9XA 1Y8NB 4US8A 2MUYA 2IT1A 4C56C 2IX3A 2NN6H 2LFNA 3HOYB 2KQ4X 1L6VA 3S2HB 2QJLA 2WINB 2Y3AA 3AE5B 5ELBA 1G2TA 1PTOF 4CKBA 5COYA 4DAVA 2QMTA 2H1EA 2FMCA 3NPPA 5IT9E 3J81E 1R9TB 1GB4A 4KGSA 2WXQA 2F0EA 3MEHA 1FNUA 1GB1A 2V0GA 2EELA 3K5OA 5I6WA 1LTID 2MJDA 3GB1A 3SR1A 2HDMA