3RMKC

Toluene 4 monooxygenase h with 4-bromophenol
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
81
structure length
81
Chain Sequence
SAFPVHAAFEKDFLVQLVVVDLNDSMDQVAEKVAYHCVNRRVAPREGVMRVRKHRSTELFPRDMTIAESGLNPTEVIDVVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Toluene-4-monooxygenase system protein A
publication title Crystallographic analysis of active site contributions to regiospecificity in the diiron enzyme toluene 4-monooxygenase.
pubmed doi rcsb
source organism Pseudomonas mendocina
total genus 24
structure length 81
sequence length 81
chains with identical sequence F
ec nomenclature ec 1.14.13.236: Toluene 4-monooxygenase.
pdb deposition date 2011-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF06234 TmoB Toluene-4-monooxygenase system protein B (TmoB)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.270 Alpha Beta Roll Ubiquitin-like (UB roll) TmoB-like 3rmkC00
3I5JC 3RNEC 1T0SC 3GE3C 3N1ZC 3N1YC 3N20C 3I63C 3RNCC 3Q3NC 3RMKC 4P1BC 2INDC 2INCC 3Q14C 3DHIC 3GE8C 3DHGC 3RI7C 3RNFC 3RNBC 3N1XC 3Q3MC 1T0RC 4P1CC 3Q2AC 1T0QC 2RDBC 3RNAC 3RNGC 3Q3OC 3RN9C 3DHHC
chains in the Genus database with same CATH superfamily
2DLBA 4IC7B 2KDFB 1K50A 1E7VA 2LRWA 3V62A 3U2SC 2OJRA 1UH6A 2UU7A 1NDDA 4OZAA 3IHPC 2C7NB 4C7YA 3EFUA 3PLUA 2A5UA 3N32A 1YOVB 4ZYSA 4B9KA 1HTQA 3AMZA 4X57B 1K51A 2INDC 1C9FA 2MJ3A 3NS1A 1R4NI 1Z2MA 2L0FA 2LGXA 2J4XA 2W55A 1X1MA 1FXIA 3PREA 2W54A 2WU5B 4RNAA 2KX3A 3KQ4A 1TS5A 5D3DA 5D2MB 1E8WA 5D7GA 1R7SA 1WJUA 3DWGC 4C80A 1SE4A 4MACA 2N7EA 2GBNA 2PJHA 4IOIE 3P4SB 4ZRKA 2CU3A 4KSKC 4CHKA 2JT4B 1YJ1A 2LRUA 2V3PA 4DBGA 4HCPB 1RAXA 1AARA 1SB3C 1TKGA 1OTRB 4MJSB 3AECB 3V6EB 3PRZA 1BMLC 4H2AA 2Z0EB 5CX3A 3ZGZA 2J52A 2MJDA 1MVKA 4WWMA 3WAMA 3DBRB 2N1WA 3FILB 2XEWA 3T9LA 2KC1A 3X0WA 2ZCCA 1V86A 2D11A 3LB8C 3RNAC 2GLSA 3Q3OC 3NZUA 3AEFB 3QJZA 4WQMA 1MPEA 1WFYA 2VH2A 2C7MB 2A4ZA 3A1QA 2JY6A 4W9JA 3A9JB 3WAPA 2KJ6A 4OVUA 2GB1A 2K8CA 3PRMB 3RZWC 3IAM1 4XWWA 1GAQB 3TEZA 1E8YA 2D3GA 3ZYYX 2HJ8A 2Y5PA 2KMMA 3M62B 2PW9A 2NBUA 2AEHA 4ARCA 1OQYA 3QA8A 3MTNB 2LUMA 1FCCC 2WXKA 1WX7A 5GXGB 3QIJA 4LNIA 2JPHA 4GOCA 2BYEA 4GDLA 4RGNA 1QILA 2ZVNA 5FK9C 4K7SA 4A90A 3I9V1 3L0WB 5JXVA 1J8CA 1F77A 4KSLC 1NYRA 1WJ6A 2YVCA 3UIPB 2JZPA 4IWOA 2WXFA 1L4DB 3DPDA 3L54A 2LXAA 3KWLA 3KH0A 4TMAB 2NVUI 5D94A 3A4SC 2HDEA 1P1AA 2EKIA 1ESFA 3OAWA 2WXHA 4E71A 4LJPB 4NY0A 1T0YA 1WXAA 1J7BA 3LXFA 3W5UB 2DYBA 1S1QB 3GOEA 1R4NB 3DHIC 3ZKJC 1WIAA 3RNFC 4G11A 3V61A 1WZ3A 3M3JA 3I3TB 1MHHE 2ZNVB 3EUB2 2N9EB 4NQKE 1WXVA 2N4FA 1WE7A 1FEHA 2KLCA 2MHJA 4LTUA 1QOAA 2V4LA 2JXXA 3PHWB 5CHWA 3AEEB 4FJYA 3BVMA 2W9NA 5H8YE 1YQBA 1N6ZA 4EZJA 3ZDMC 4DQOC 3ONSA 3AXCA 5D6JB 4EZKA 1EO6A 2KTRA 3AEAB 4W9IA 3AI5A 2JQRB 3KVFB 3RCZA 3WANA 4WJQA 4MGYE 3QQ8B 4NZLB 2MEKA 2WDQB 3HHMA 1NI3A 2MX2A 1YMHE 1I42A 1FXTB 3ML9A 4B0EA 3TEXA 4MH8A 2J7QB 3AU4A 2V0GA 1IBXB 4W9CA 3WIMA 4JGHB 3L17A 4GDKA 4M8MA 2OHFA 4RH6A 2KYWA 4URKA 2V3SA 1IUEA 3N1YC 2NR2A 1WGDA 1J19A 2AWTA 1NI2A 1WM2A 4FULA 2NTTA 3RT3B 4ANUA 1HE8A 2KNBA 2IO3B 4TKNA 3VDZA 1IGCA 3GZNI 4FBJB 2CHWA 2FUHB 3Q8FA 2MP2B 1CMXB 1JWSD 1FNWA 3ZXVA 4WH4A 5GMVA 4ZHOA 2O6VB 1I4RA 3R66C 4JX1C 2WXRA 2WDTB 2FCNA 1V9JA 3D32A 1NENB 1ACCA 2KWDA 2L00B 2CU1A 5JHAA 5G55A 1B9RA 3C19A 4WQOB 2JYEA 5IOIA 5G5HA 1YJIA 4K1RB 1JWUD 2WX1A 2M17A 1UBQA 4I6NB 3P4QB 5CTRC 3DOWA 2UWQA 3AN1A 4K81A 3QX1A 2QJLA 5AUKA 3CSFA 1P7EA 2PE6B 2XK5B 1RM6C 1JALA 2XBBC 4I6PA 1WRIA 2M19A 3HVDA 3WA0A 4M00A 3DBHI 5BMGA 3FAHA 2WQYB 2BWES 1YJJA 1TKYA 3E56A 1YD8U 3TL5A 2JZZA 1VJKA 2BGFA 4FHJA 4RFBA 1HA5A 1GB1A 3J9CA 1QF6A 4NPNA 3AM9A 3CF6E 2MRPA 1F2RC 2JRHA 2BVCA 2IZVB 2DHZA 2BQQA 4BKTA 1WMHA 3HVZA 5JZEB 2BYVE 1FRRA 4CYEA 3VTWA 2WP9B 1WX9A 1V80A 3A4RA 3Q2AC 1LQBA 2QMTA 4KGRA 4KX6B 4KIKB 3VQIA 2MWSB 2IO0B 2VH1A 4YL8A 1I4XA 1E0ZA 1QT9A 4HWIB 3RYTA 1QOBA 4OVVA 4N59A 1P0RA 4RGTA 3ABVB 1C4CA 3BVZA 1TZOA 4A20A 2MJEA 1V5OA 3GZNB 1AN8A 1V1PB 2KWUB 4FN2A 3ZO5B 1L5PA 5KHQA 1KH0A 4HJGE 2IGDA 4S0RA 1L6VA 2KMAA 2NMQA 2XNAC 3R2IA 1YIWA 3PVLA 4MM3A 2ASQA 4GIVA 3N9YC 3VR8B 4M01A 1E90A 2M56B 3RFZB 1YQ4B 3ZTCA 1DYQA 3Q8EA 5E6OA 4HKZE 1JW9D 3U4EG 4DXFA 3RN9C 5AZFA 2ICIA 2W3RA 1TS3A 4AQ7A 4KDLB 1JQ4A 3NRZA 1RWSA 1N61A 3VFKA 5BYQA 4K3CA 4DK5A 1EU4A 2N9KA 2EELA 5AEKB 1CZPA 4C4VB 3NVVA 1EWCA 1TZ1A 2GBRA 1D5ZC 2KWCA 3OJ3A 2KTFA 2MCNB 2J0MA 3AU5A 4RCOA 4ANWA 1ZOYB 4GSWA 4EFOA 2Q5WD 4YTPB 4JL9A 1M94A 2PTLA 4G3XB 1V1OA 2FCMA 3ALBA 1KTKA 2D2QA 2MP2A 3AE6B 2BS2B 5BYRA 3DBHB 1DOYA 3DDCB 1NVID 1KLUD 3AULA 5HFYA 3Q3NC 4US8A 2WX0A 4M02A 2QEJC 3B1LX 2G4SA 3DHGC 3QARA 1XCQL 3BINA 2QIEB 1G6JA 1NYQA 4W9FA 2NS5A 2MQJA 1LGRA 2RDGA 2LI5A 2JF5A 4ICVA 3H7SA 2KC2A 4C56C 2DBYA 2BB6A 2L05A 2IY0B 4WIPA 4BFRA 3M63B 2DYOA 4II3B 2LHEA 2WXJA 3E9SA 1AYFA 3L16A 1E8ZA 1C4PA 2LGYA 1D5MC 3CMMB 1VR9A 1FCLA 2PKOA 1C79A 3OWEB 3EFCA 4MT5A 4HLEA 2LHDA 3P4PB 1FPYA 2WWZA 3ZJUA 2KDBA 2X8XX 4TQ0A 1WI0A 3EC8A 3ENEA 1P7FA 3TCAA 3R3MA 1RYJA 1STEA 4XDCA 3PPAA 3VTVA 1VZ8A 4Q2JA 5EE0A 4EEWA 3IG3A 2KQ7A 1OFFA 1ZXHA 3GB1A 3KYCD 4HVBA 4TQ1A 1UWXA 2VZKB 4TSSA 4IG7B 1TTNA 2G1EA 3ZVVA 4EKUA 1I4GA 2N9PC 4NAWA 5CHVC 3HRDD 2NPTB 2LMCA 2WXNA 1WY8A 2PMVA 2WXLA 4FLHA 3HIZA 3H7PB 2BT6A 3QK0A 3A9KB 3NVWA 4YT0B 2YEPF 3Q8BA 4FJVB 1KJTA 2LVPA 1SF0A 2WXOA 5EE9A 4B95A 1SE9A 2O2VB 1EUVB 3IBEA 2JYTA 1T5XD 4HROA 2DAFA 4M0WA 1V49A 3PRPB 4W9EA 2M4NA 3RNGC 5C3JB 4WJPA 3NVYA 4HEA1 1T0SC 4HJKA 1WR6E 1KLGD 1EF1A 1VLBA 2KFKB 1WYWB 1JROA 4RGOS 1V1PA 4GB9A 1GB4A 1ZUD2 3L13A 3HM6X 4TUUA 4A6QA 1A70A 2G3QB 2H89B 3QCAA 4ACFA 1WSPA 3KWVA 4PK1A 1WRDB 3PT2B 3ZNID 1WH3A 2RDBC 3UIOB 1PQSA 1HQRD 1F1HA 2HTME 4ZDVA 1ET6A 3DCGA 1S3SG 4MH0E 1E10A 1V6EA 5IA7A 2K22A 2ZW1A 4YTMB 1C76A 2BKRB 1D4BA 1WGHA 1T0RC 4REZA 4BBNF 2LVQA 1PGAA 2KN5A 2AQ1B 2M0AA 3IVFA 4XDDA 4WAAA 2CHZA 3P42A 2W82A 2K1FA 1VZ6A 1V2YA 4C4VA 4GU2A 1E9MA 2I1KA 5J17A 5CHFA 3OG5A 1PGBA 4ZRQA 3RPFC 1H8CA 4DXAB 2K25A 2CR5A 3R2TA 1LO5D 2KJHB 4LNNA 2VZKD 2L7RA 2L1AA 1XD3B 3I57A 4IM0A 3P63A 1GOZA 3APFA 4HDOA 4N9F4 4RGMA 3GP7A 2NCNA 2CHXA 4ITKA 3LYYA 3MFGA 3W5VB 3MC9A 2G45B 2E3TA 4D2KA 2QC8A 1F9JA 3U52E 4MSQB 2MBEA 3AE8B 3H8HA 2V3NA 4ANXA 2LJIA 2ZPNA 5EE1A 5T8IA 3IFWB 2JX5A 2WXQA 1K8RB 3N20C 4DXGA 3EHVA 1I35A 1OQRA 2CS4A 3APCA 1UELA 4RMAA 2RPVA 4RF1A 1WGRA 2WDVB 2BYFA 3BK1A 3ZNZB 4HPMB 4ZRJA 4ANVA 2MBBB 2WGSA 3URYA 1WR1A 3PZDA 1JRPA 4DHJB 3DVGY 2W3SA 2GBJA 4OZBA 5L95C 4LCDE 2L32A 1PDXA 5EDSA 4EZLA 2PVOD 4P6VF 2MW5A 2V9HA 1NEKB 4XWTA 2BBCA 3JSVB 3NOBA 2ZPYA 2RPQA 2WYQA 5DPTA 4CO7A 2CKHB 4P1CC 1A5RA 4ZOHC 1HZ6A 4DHZB 3BYTB 1WXMA 2AX5A 4A8XC 2ZZPB 2R61A 2IBIB 2HTHA 3RI7C 4ARIA 3NHEB 1MI0A 4K7WA 2V1YA 2K8HA 3R8BA 3L4PA 3APDA 2ZJDA 3RZFA 2KXJA 1N63A 1UNSA 1D6EC 2MBHA 1LM8B 2GBKA 2BKFA 4IUMB 5J2RA 1YN3A 3U8ZA 3BZDB 3LJ3A 5IO9A 1UD7A 1Q0WB 3N30A 3DWMA 4JQWC 4ASWC 3AH7A 4YSZB 1WGKA 3N1XC 4IKGA 2L8JA 2RR9A 4MJSA 4OVZA 1V5TA 1N5XA 2MSED 3O65B 3SHQA 3WALA 1OEYA 2WNMA 3A9KA 2LD9A 1GJZA 3AE4B 3FILA 2INPE 3O13A 2QSDA 3I63C 4DDID 1ET9A 1BUIC 3ZLZA 3T3OA 3B2FA 3RNBC 3DBLI 2K5PA 1ZGUB 4LDTB 3JYUA 3FKYA 2WXPA 3A9JA 4F1SA 2LWPA 1UGJA 2DZIA 3JW0X 2FAZA 4BVUC 1BT0A 3UQBA 3ZJTA 3MHSD 4E74A 1QOGA 2SEBD 5EE3A 2MH7A 4NNJB 4S17A 2K0PA 3WCQA 1WE6A 2ZNVC 2NBVB 3PHXB 4MELA 4FADA 1OEYJ 1E6EB 1FRDA 4DDGD 2MA9B 5LXIB 1XT9B 2FUG1 1PFDA 3S2AA 3MC0B 4J6IA 4YSXB 3AEDB 4MGKE 2AQ3B 2L0TA 2ZVOA 1YNTE 2ZEQA 5FKAC 4WWPA 1L0XB 3AE1B 1WGYA 5IAAC 4USAA 1J0GA 4EOYA 5MPOA 4A3PA 1GC7A 3VUXA 1RRBA 4XGAB 2IGGA 3NG0A 3ZRFA 4OW0A 3QHTA 3SD5A 1IPGA 3RMKC 2KQ4X 2BWFA 1YN4A 2Z59B 4NJ6A 1TIFA 1ZDXA 4TV3A 3BWUD 3N3KB 1JWBD 3EA6A 2L76A 3PLVA 3VR9B 1CK1A 3SU8X 4G50A 1MFWA 2FE8A 4AWJA 1SJED 3NUHB 1TBEA 3PZ8A 3AB5A 1TGZB 5D3IB 3H9DA 2O6VD 2R2OA 4E3CA 2KHWB 4MGZE 4BAXA 3P1MA 3PO0A 4A55A 1ZDVA 1TKEA 2K39A 1JCKB 1PGXA 5TSSA 2IYDB 3UINB 4LNFA 5FR3A 2MBOA 2B76B 1N60A 1WYGA 1T0QC 1TYGB 5DPSA 1Q10A 3KYDD 4PT5A 4WWNA 5BMIA 3MC8A 4LDTD 2LGIA 3B2GA 5C23A 2LFIA 4MDKE 4W9DA 1CQVA 2INNE 3A1QB 1I4QA 4HDQA 2Z0DB 2FCSA 2GI9A 2N7JA 1NBFC 3VHTC 1ZP0B 1WJNA 4MSMB 3DHHC 2TSSA 3R7RA 2LEKA 3SFDB 1XLOA 4P7IA 1IBXA 1J7CA 3AE2B 3DBLB 4ZYNA 3ZXRA 1TY0A 1XO3A 1WXSA 2KWVB 3AV8A 1FMAD 4XC2A 1WX8A 4GDLB 3TEWA 3KW5B 2JSVX 2E6XA 3L10B 1DGJA 1V8CA 2RGFA 2K3UA 1SXTA 1P3QU 2JWUA 1Q5WB 1GNUA 2DYMA 2DZMA 2EKEC 3W1YA 4KGSA 1HTOA 4N58A 5LLIA 4EUTA 2RDHA 1Y56A 1Y8RC 2PVGC 2O6VA 1KF6B 2PLPA 3AE9B 3GE3C 1M4VA 4IW0A 1ENFA 1IYFA 2KDMA 2D5GA 4GN1A 3V05A 3GE8C 1P9DU 1JRUA 1QLBB 2ZCBA 2C7HA 2BTEA 4F7ZA 1WM3A 4ICUA 4W9HA 3MHZA 1TS4A 2WDRB 3L08A 3OJ4B 2GBMA 3NZSA 3TSSA 2INCC 2D3AA 4GGQA 3R7QA 4WJOA 5HI1A 4JWSC 2XK5A 1IP9A 3IT6B 4AJWA 3RD2A 4XE0A 4I6LB 3MJWA 2CJNA 2LGSA 2QCZA 4LK0M 4KKIA 2KTRB 1GC6A 3PTFC 2PE9A 1MG8A 1C4AA 1ZE3D 1U4AA 1T6BX 4EE2A 5IN7A 5BMHA 2LGDA 4JPSA 2FBWB 1FNUA 1SE2A 1SGHA 3VAWA 1SIFA 5E6PA 4YTNB 1UBIA 1V81A 3DVNU 1EF5A 1L7YA 1OQQA 5AUIA 3HUIA 3P2BA 1MJDA 1XLNA 3NVZA 2IPKD 5BYSA 4KZ0A 1N62A 3W9CB 2NTSA 4CQNA 3U7ZA 4GDKB 2C60A 3PZ7A 3VRAB 2JRIB 2N0SB 2WXMA 2D3CA 1CJEA 4UDUC 4NAMA 3SFEB 3TUOA 1RFKA 3ECIA 4OZCA 1ROEA 2X38A 3HM3A 3TMPB 5J18A 4B0MA 2KACA 4PS7A 3RNCC 2N9LA 4JWUC 3UQAA 1UUPA 3VUWA 4PYUA 1HZ5A 3QAQA 4KIKA 3TJPA 2KJRA 2AYOB 3Q3MC 1JWAD 1EWYC 5L83A 2AL3A 1UF0A 3NJTA 2JXTA 2JZ3B 1ZKHA 1FIQA 3AEGB 1E5WA 4XYCA 1F2RI 2LVOA 2RD0A 3SEBA 1WZ0A 3U7DA 2KN4A 3ZRCA 3SDLC 4FXCA 4IM3A 1TJEA 3IXSA 1FFVA 1E7UA 1WF9A 3V3XA 4A3OA 2K9XA 5E6NA 5DPRA 4KVGB 4YWGG 2MLBA 2KZRA 2KFJA 3W2DA 1VZ7A 1DOIA 5HG2A 2UYZB 1SIJA 3Q69A 1XCTL 1VD2A 2RSUA 3P4RB 2DX5B 4HK2A 2OOBB 1C78A 2BW2A 2ONQA 3EECA 2IO1B 5AZGA 2Y3AA 4K3BA 2RMMA 3A33B 4W9LA 1B1ZA 2PPHA 1KM7A 4XZ4A 1EU3A 1TS2A 4YSYB 3BY4B 4PS3A 2FIDA 2KT7A 2DNFA 1L4ZB 3FC4A 5G2NA 3AE3B 1J7AA 1XF5L 5JH5C 3RNEC 4BOSC 4C7ZA 4KZCA 2I38A 2WU2B 2IDYA 1XLQA 2N7DA 1EM7A 3B9JA 3QWZB 2WS3B 3RUIB 3ZUNA 2HE7A 2D10A 5JHBA 1WMHB 3WAOA 3MP9A 3U30A 1FO4A 2H88B 3VVWB 1ISNA 2QDFA 3ZJVA 2MBQA 2I2YA 1DOXA 1WJ4A 1SBBB 1FM0D 1PYWD 2KVZA 5BO4B 3ZTDA 2N1VA 3K9OB 2KX0A 2BS4B 1YQ3B 1QQRA 4KV2A 1GPXA 5HKHA 4KGTA 2B3AA 3BYYB 1SE3A 2LXCA 3W1SC 3V60A 2JUOA 2WXGA 5TR5A 2L83A 2HD5B 2L52A 2K6QA 3DVNV 3IAS1 2GMIC 2L3ZA 3KLSX 4BKSD 2R2QA 3ML8A 3VRBB 1QZEA 5IP4D 2Z8LA 2GRIA 2OJWA 4JLCA 2JU6X 4GMVA 2YEPB 3AEBB 4II2B 1XXGA 4MM3B 4HCNB 2DZJA 3H1UA 2KVRA 3VTUA 3AE7B 1FXAA 4L1BA 4AP4C 3PGEA 2REXA 2ON8A 3C0RB 3NY5A 1SJHD 3C8YA 2ZW0A 4JIOU 4LJOB 4OHJA 4IDIA 2QILA 1BXTA 3VXWA 2I1JA 2LASA 3M95A 3Q8CA 1TT5B 2D07B 1WXQA 2AL6A 2LZ6A 1R4MI 1I4PA 1LFDA 1XEEA 3OLMD 4AUQC 2KOXA 2M8SA 4FA6A 2NPTA 1L0VB 2KMCA 2FIFA 2DENB 5C1ZA 3W1SA 4JE3B 2GOWA 1H4RA 3Q3FA 4LLGM 1F52A 2LJ5A 3H7PA 4NJCA 4PS8A 5FR6A 2BYTA 3DVGX 3ZNGC 2KD0A 2O2VA 3KUZA 5LNK1 3UI3A 4MEMA 5I4DA 4BKGA 3EGRA 2G4DB 2K8BA 1UZXB 1KOTA 1VCBA 2KO3A 2KFKA 1V97A 1LXDA 5IKCM 2EMTA 5DCNA 1SEBD 1TY2A 2WHIA 5AZHA 1N5WA 4HPPA 1WWTA 1C3TA 1F0ZA 1QOFA 2BS3B 3ETRA 4BKSA 4DHJD 3Q14C 3BIID 2KLGA 1FFUA 3NS8A 3Q6BA 4FHKA 2KDEB 2PIAA 1AW7A 1VRAB 4B6WA 4QAYA 4RM9A 1SSNA 1OGWA 4RF0A 3Q8AA 4P16A 3VUYA 2FNJB 1C77A 2D3BA 3VH4B 2J0KA 1JMLA 3ZDTA 1MHXA 4W9KA 4XX5A 1KRHA 4J3OD 4HKQA 3ZNHB 4WURA 2DZKA 1QKZA 1AWDA 3DBSA 4P1BC 1E7PB 5E6JA 1L2NA 2G9HD 4GXBA 2KQSA 3X23A 3UGBB 4L2YA 3CSTA 3PSEB 3QC8B 2HJ1A 3JVZX 3T8MA 3Q3JA 4BZAA 3TEYA 2K6DB 3B0AA 5HHDG 4PYZA 4G0NB 4LNKA 1P98A 2M0XA 4NAWB 1K52A 2J53A 1GUAB 3MJ5A 2KAJA 4DHZE 3V6CB 3DQVA 1YN5A 2KKCA 2BB5A 2QHOA 2IGHA 4IM2A 4AOFA 2KDIA 1WGGA 2LUEA 2CJOA 4HPLB 4ZHPA 1R4MB 2JWZA 1L0YB 4HXDA 4KDIC 4M0WB 1JWMD 1Q1OA 2AQ2B 1ZPSA 4BBNC 4WAFA 4NJ7A 3ZW3A 3H6NA 2V4IB 2IY1B 1PUTA 3PS6A 4ZRIA 3ZIMA 1I7HA 2BF8B 3AE5B 3SR6A 5KHOA 4R3DA 3RULA 1FNVA 1E8XA 4W9GA 1KFYB 3JSVA 2ACZB 3T3NA 4BOZB 3GS2A 1XQQA 2NBWB 2FCQA 4K7UA 1VDVA 4FJZA 3LDZE 1RFAA 2KANA 2KK8A 2VRRB 4M8NA 2WXIA 4RM8A 1Z5SB 4A9AA 1ZW7A 3UF8A 4AS1A 5H92C 2Y5BB 1T3QA 4DWFA 4HRSA 1D3ZA 4ZRPA 1D5XC 2DAJA 4C00A 1UGMA 1HEZE 2JVCA 4F8CB 1GG3A 1K53A 2IO2B 3DBRI 2YLMA 3KUDB 3BK2A 1HXYD 4LNOA 4MGIE 2PEAA 2N9XA 1ZXIA 3N1ZC 3CIRB 1KLVA 5DPWA 3PV1A 4N6EB 5G5GA 1UWMA 2C5LC 4AJYB 3ZQ4A 2OEDA 4L23A 5LXHA 3NZ3A 4O1NA 4US9A 2WLBA 4IWQA 3KUCB 1IGDA 2XN9C 1L6UA 1I4HA 1XLPA 2DWQA 2J0JA 2Y5CA 3K9PB 3I5JC 2SAKA 3IT4B 4IWPA 2EMSA 4NQLB 4GLSC 2M1MA 1RLFA 1YX5B 3B08A 3TBLD 2BPSA 3TIXA 3CWIA 4WWOA 3BVGA 1C1YB 2C9WB 3VH3B 1FD6A 2IJ0A 1YX6B 3HK0A 4WJNA 2J42A 4YXDB 5C2TB 4KKJA 1MG4A
chains in the Genus database with same CATH topology
3I5JC 3RNEC 1T0SC 3GE3C 3N1ZC 3N1YC 3N20C 3I63C 3RNCC 3Q3NC 3RMKC 4P1BC 2INDC 2INCC 3Q14C 3DHIC 3GE8C 3DHGC 3RI7C 3RNFC 3RNBC 3N1XC 3Q3MC 1T0RC 4P1CC 3Q2AC 1T0QC 2RDBC 3RNAC 3RNGC 3Q3OC 3RN9C 3DHHC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I5J C;  3RNE C;  1T0S C;  3GE3 C;  3N1Z C;  3N1Y C;  3N20 C;  3I63 C;  3RNC C;  3Q3N C;  3RMK C;  4P1B C;  2IND C;  2INC C;  3Q14 C;  3DHI C;  3GE8 C;  3DHG C;  3RI7 C;  3RNF C;  3RNB C;  3N1X C;  3Q3M C;  1T0R C;  4P1C C;  3Q2A C;  1T0Q C;  2RDB C;  3RNA C;  3RNG C;  3Q3O C;  3RN9 C;  3DHH C; 
#chains in the Genus database with same CATH topology
 2DLB A;  4IC7 B;  2KDF B;  1K50 A;  1E7V A;  2LRW A;  3V62 A;  3U2S C;  2OJR A;  1UH6 A;  2UU7 A;  1NDD A;  4OZA A;  3IHP C;  2C7N B;  4C7Y A;  3EFU A;  3PLU A;  2A5U A;  3N32 A;  1YOV B;  4ZYS A;  4B9K A;  1HTQ A;  3AMZ A;  4X57 B;  1K51 A;  2IND C;  1C9F A;  2MJ3 A;  3NS1 A;  1R4N I;  1Z2M A;  2L0F A;  2LGX A;  2J4X A;  2W55 A;  1X1M A;  1FXI A;  3PRE A;  2W54 A;  2WU5 B;  4RNA A;  2KX3 A;  3KQ4 A;  1TS5 A;  5D3D A;  5D2M B;  1E8W A;  5D7G A;  1R7S A;  1WJU A;  3DWG C;  4C80 A;  1SE4 A;  4MAC A;  2N7E A;  2GBN A;  2PJH A;  4IOI E;  3P4S B;  4ZRK A;  2CU3 A;  4KSK C;  4CHK A;  2JT4 B;  1YJ1 A;  2LRU A;  2V3P A;  4DBG A;  4HCP B;  1RAX A;  1AAR A;  1SB3 C;  1TKG A;  1OTR B;  4MJS B;  3AEC B;  3V6E B;  3PRZ A;  1BML C;  4H2A A;  2Z0E B;  5CX3 A;  3ZGZ A;  2J52 A;  2MJD A;  1MVK A;  4WWM A;  3WAM A;  3DBR B;  2N1W A;  3FIL B;  2XEW A;  3T9L A;  2KC1 A;  3X0W A;  2ZCC A;  1V86 A;  2D11 A;  3LB8 C;  3RNA C;  2GLS A;  3Q3O C;  3NZU A;  3AEF B;  3QJZ A;  4WQM A;  1MPE A;  1WFY A;  2VH2 A;  2C7M B;  2A4Z A;  3A1Q A;  2JY6 A;  4W9J A;  3A9J B;  3WAP A;  2KJ6 A;  4OVU A;  2GB1 A;  2K8C A;  3PRM B;  3RZW C;  3IAM 1;  4XWW A;  1GAQ B;  3TEZ A;  1E8Y A;  2D3G A;  3ZYY X;  2HJ8 A;  2Y5P A;  2KMM A;  3M62 B;  2PW9 A;  2NBU A;  2AEH A;  4ARC A;  1OQY A;  3QA8 A;  3MTN B;  2LUM A;  1FCC C;  2WXK A;  1WX7 A;  5GXG B;  3QIJ A;  4LNI A;  2JPH A;  4GOC A;  2BYE A;  4GDL A;  4RGN A;  1QIL A;  2ZVN A;  5FK9 C;  4K7S A;  4A90 A;  3I9V 1;  3L0W B;  5JXV A;  1J8C A;  1F77 A;  4KSL C;  1NYR A;  1WJ6 A;  2YVC A;  3UIP B;  2JZP A;  4IWO A;  2WXF A;  1L4D B;  3DPD A;  3L54 A;  2LXA A;  3KWL A;  3KH0 A;  4TMA B;  2NVU I;  5D94 A;  3A4S C;  2HDE A;  1P1A A;  2EKI A;  1ESF A;  3OAW A;  2WXH A;  4E71 A;  4LJP B;  4NY0 A;  1T0Y A;  1WXA A;  1J7B A;  3LXF A;  3W5U B;  2DYB A;  1S1Q B;  3GOE A;  1R4N B;  3DHI C;  3ZKJ C;  1WIA A;  3RNF C;  4G11 A;  3V61 A;  1WZ3 A;  3M3J A;  3I3T B;  1MHH E;  2ZNV B;  3EUB 2;  2N9E B;  4NQK E;  1WXV A;  2N4F A;  1WE7 A;  1FEH A;  2KLC A;  2MHJ A;  4LTU A;  1QOA A;  2V4L A;  2JXX A;  3PHW B;  5CHW A;  3AEE B;  4FJY A;  3BVM A;  2W9N A;  5H8Y E;  1YQB A;  1N6Z A;  4EZJ A;  3ZDM C;  4DQO C;  3ONS A;  3AXC A;  5D6J B;  4EZK A;  1EO6 A;  2KTR A;  3AEA B;  4W9I A;  3AI5 A;  2JQR B;  3KVF B;  3RCZ A;  3WAN A;  4WJQ A;  4MGY E;  3QQ8 B;  4NZL B;  2MEK A;  2WDQ B;  3HHM A;  1NI3 A;  2MX2 A;  1YMH E;  1I42 A;  1FXT B;  3ML9 A;  4B0E A;  3TEX A;  4MH8 A;  2J7Q B;  3AU4 A;  2V0G A;  1IBX B;  4W9C A;  3WIM A;  4JGH B;  3L17 A;  4GDK A;  4M8M A;  2OHF A;  4RH6 A;  2KYW A;  4URK A;  2V3S A;  1IUE A;  3N1Y C;  2NR2 A;  1WGD A;  1J19 A;  2AWT A;  1NI2 A;  1WM2 A;  4FUL A;  2NTT A;  3RT3 B;  4ANU A;  1HE8 A;  2KNB A;  2IO3 B;  4TKN A;  3VDZ A;  1IGC A;  3GZN I;  4FBJ B;  2CHW A;  2FUH B;  3Q8F A;  2MP2 B;  1CMX B;  1JWS D;  1FNW A;  3ZXV A;  4WH4 A;  5GMV A;  4ZHO A;  2O6V B;  1I4R A;  3R66 C;  4JX1 C;  2WXR A;  2WDT B;  2FCN A;  1V9J A;  3D32 A;  1NEN B;  1ACC A;  2KWD A;  2L00 B;  2CU1 A;  5JHA A;  5G55 A;  1B9R A;  3C19 A;  4WQO B;  2JYE A;  5IOI A;  5G5H A;  1YJI A;  4K1R B;  1JWU D;  2WX1 A;  2M17 A;  1UBQ A;  4I6N B;  3P4Q B;  5CTR C;  3DOW A;  2UWQ A;  3AN1 A;  4K81 A;  3QX1 A;  2QJL A;  5AUK A;  3CSF A;  1P7E A;  2PE6 B;  2XK5 B;  1RM6 C;  1JAL A;  2XBB C;  4I6P A;  1WRI A;  2M19 A;  3HVD A;  3WA0 A;  4M00 A;  3DBH I;  5BMG A;  3FAH A;  2WQY B;  2BWE S;  1YJJ A;  1TKY A;  3E56 A;  1YD8 U;  3TL5 A;  2JZZ A;  1VJK A;  2BGF A;  4FHJ A;  4RFB A;  1HA5 A;  1GB1 A;  3J9C A;  1QF6 A;  4NPN A;  3AM9 A;  3CF6 E;  2MRP A;  1F2R C;  2JRH A;  2BVC A;  2IZV B;  2DHZ A;  2BQQ A;  4BKT A;  1WMH A;  3HVZ A;  5JZE B;  2BYV E;  1FRR A;  4CYE A;  3VTW A;  2WP9 B;  1WX9 A;  1V80 A;  3A4R A;  3Q2A C;  1LQB A;  2QMT A;  4KGR A;  4KX6 B;  4KIK B;  3VQI A;  2MWS B;  2IO0 B;  2VH1 A;  4YL8 A;  1I4X A;  1E0Z A;  1QT9 A;  4HWI B;  3RYT A;  1QOB A;  4OVV A;  4N59 A;  1P0R A;  4RGT A;  3ABV B;  1C4C A;  3BVZ A;  1TZO A;  4A20 A;  2MJE A;  1V5O A;  3GZN B;  1AN8 A;  1V1P B;  2KWU B;  4FN2 A;  3ZO5 B;  1L5P A;  5KHQ A;  1KH0 A;  4HJG E;  2IGD A;  4S0R A;  1L6V A;  2KMA A;  2NMQ A;  2XNA C;  3R2I A;  1YIW A;  3PVL A;  4MM3 A;  2ASQ A;  4GIV A;  3N9Y C;  3VR8 B;  4M01 A;  1E90 A;  2M56 B;  3RFZ B;  1YQ4 B;  3ZTC A;  1DYQ A;  3Q8E A;  5E6O A;  4HKZ E;  1JW9 D;  3U4E G;  4DXF A;  3RN9 C;  5AZF A;  2ICI A;  2W3R A;  1TS3 A;  4AQ7 A;  4KDL B;  1JQ4 A;  3NRZ A;  1RWS A;  1N61 A;  3VFK A;  5BYQ A;  4K3C A;  4DK5 A;  1EU4 A;  2N9K A;  2EEL A;  5AEK B;  1CZP A;  4C4V B;  3NVV A;  1EWC A;  1TZ1 A;  2GBR A;  1D5Z C;  2KWC A;  3OJ3 A;  2KTF A;  2MCN B;  2J0M A;  3AU5 A;  4RCO A;  4ANW A;  1ZOY B;  4GSW A;  4EFO A;  2Q5W D;  4YTP B;  4JL9 A;  1M94 A;  2PTL A;  4G3X B;  1V1O A;  2FCM A;  3ALB A;  1KTK A;  2D2Q A;  2MP2 A;  3AE6 B;  2BS2 B;  5BYR A;  3DBH B;  1DOY A;  3DDC B;  1NVI D;  1KLU D;  3AUL A;  5HFY A;  3Q3N C;  4US8 A;  2WX0 A;  4M02 A;  2QEJ C;  3B1L X;  2G4S A;  3DHG C;  3QAR A;  1XCQ L;  3BIN A;  2QIE B;  1G6J A;  1NYQ A;  4W9F A;  2NS5 A;  2MQJ A;  1LGR A;  2RDG A;  2LI5 A;  2JF5 A;  4ICV A;  3H7S A;  2KC2 A;  4C56 C;  2DBY A;  2BB6 A;  2L05 A;  2IY0 B;  4WIP A;  4BFR A;  3M63 B;  2DYO A;  4II3 B;  2LHE A;  2WXJ A;  3E9S A;  1AYF A;  3L16 A;  1E8Z A;  1C4P A;  2LGY A;  1D5M C;  3CMM B;  1VR9 A;  1FCL A;  2PKO A;  1C79 A;  3OWE B;  3EFC A;  4MT5 A;  4HLE A;  2LHD A;  3P4P B;  1FPY A;  2WWZ A;  3ZJU A;  2KDB A;  2X8X X;  4TQ0 A;  1WI0 A;  3EC8 A;  3ENE A;  1P7F A;  3TCA A;  3R3M A;  1RYJ A;  1STE A;  4XDC A;  3PPA A;  3VTV A;  1VZ8 A;  4Q2J A;  5EE0 A;  4EEW A;  3IG3 A;  2KQ7 A;  1OFF A;  1ZXH A;  3GB1 A;  3KYC D;  4HVB A;  4TQ1 A;  1UWX A;  2VZK B;  4TSS A;  4IG7 B;  1TTN A;  2G1E A;  3ZVV A;  4EKU A;  1I4G A;  2N9P C;  4NAW A;  5CHV C;  3HRD D;  2NPT B;  2LMC A;  2WXN A;  1WY8 A;  2PMV A;  2WXL A;  4FLH A;  3HIZ A;  3H7P B;  2BT6 A;  3QK0 A;  3A9K B;  3NVW A;  4YT0 B;  2YEP F;  3Q8B A;  4FJV B;  1KJT A;  2LVP A;  1SF0 A;  2WXO A;  5EE9 A;  4B95 A;  1SE9 A;  2O2V B;  1EUV B;  3IBE A;  2JYT A;  1T5X D;  4HRO A;  2DAF A;  4M0W A;  1V49 A;  3PRP B;  4W9E A;  2M4N A;  3RNG C;  5C3J B;  4WJP A;  3NVY A;  4HEA 1;  1T0S C;  4HJK A;  1WR6 E;  1KLG D;  1EF1 A;  1VLB A;  2KFK B;  1WYW B;  1JRO A;  4RGO S;  1V1P A;  4GB9 A;  1GB4 A;  1ZUD 2;  3L13 A;  3HM6 X;  4TUU A;  4A6Q A;  1A70 A;  2G3Q B;  2H89 B;  3QCA A;  4ACF A;  1WSP A;  3KWV A;  4PK1 A;  1WRD B;  3PT2 B;  3ZNI D;  1WH3 A;  2RDB C;  3UIO B;  1PQS A;  1HQR D;  1F1H A;  2HTM E;  4ZDV A;  1ET6 A;  3DCG A;  1S3S G;  4MH0 E;  1E10 A;  1V6E A;  5IA7 A;  2K22 A;  2ZW1 A;  4YTM B;  1C76 A;  2BKR B;  1D4B A;  1WGH A;  1T0R C;  4REZ A;  4BBN F;  2LVQ A;  1PGA A;  2KN5 A;  2AQ1 B;  2M0A A;  3IVF A;  4XDD A;  4WAA A;  2CHZ A;  3P42 A;  2W82 A;  2K1F A;  1VZ6 A;  1V2Y A;  4C4V A;  4GU2 A;  1E9M A;  2I1K A;  5J17 A;  5CHF A;  3OG5 A;  1PGB A;  4ZRQ A;  3RPF C;  1H8C A;  4DXA B;  2K25 A;  2CR5 A;  3R2T A;  1LO5 D;  2KJH B;  4LNN A;  2VZK D;  2L7R A;  2L1A A;  1XD3 B;  3I57 A;  4IM0 A;  3P63 A;  1GOZ A;  3APF A;  4HDO A;  4N9F 4;  4RGM A;  3GP7 A;  2NCN A;  2CHX A;  4ITK A;  3LYY A;  3MFG A;  3W5V B;  3MC9 A;  2G45 B;  2E3T A;  4D2K A;  2QC8 A;  1F9J A;  3U52 E;  4MSQ B;  2MBE A;  3AE8 B;  3H8H A;  2V3N A;  4ANX A;  2LJI A;  2ZPN A;  5EE1 A;  5T8I A;  3IFW B;  2JX5 A;  2WXQ A;  1K8R B;  3N20 C;  4DXG A;  3EHV A;  1I35 A;  1OQR A;  2CS4 A;  3APC A;  1UEL A;  4RMA A;  2RPV A;  4RF1 A;  1WGR A;  2WDV B;  2BYF A;  3BK1 A;  3ZNZ B;  4HPM B;  4ZRJ A;  4ANV A;  2MBB B;  2WGS A;  3URY A;  1WR1 A;  3PZD A;  1JRP A;  4DHJ B;  3DVG Y;  2W3S A;  2GBJ A;  4OZB A;  5L95 C;  4LCD E;  2L32 A;  1PDX A;  5EDS A;  4EZL A;  2PVO D;  4P6V F;  2MW5 A;  2V9H A;  1NEK B;  4XWT A;  2BBC A;  3JSV B;  3NOB A;  2ZPY A;  2RPQ A;  2WYQ A;  5DPT A;  4CO7 A;  2CKH B;  4P1C C;  1A5R A;  4ZOH C;  1HZ6 A;  4DHZ B;  3BYT B;  1WXM A;  2AX5 A;  4A8X C;  2ZZP B;  2R61 A;  2IBI B;  2HTH A;  3RI7 C;  4ARI A;  3NHE B;  1MI0 A;  4K7W A;  2V1Y A;  2K8H A;  3R8B A;  3L4P A;  3APD A;  2ZJD A;  3RZF A;  2KXJ A;  1N63 A;  1UNS A;  1D6E C;  2MBH A;  1LM8 B;  2GBK A;  2BKF A;  4IUM B;  5J2R A;  1YN3 A;  3U8Z A;  3BZD B;  3LJ3 A;  5IO9 A;  1UD7 A;  1Q0W B;  3N30 A;  3DWM A;  4JQW C;  4ASW C;  3AH7 A;  4YSZ B;  1WGK A;  3N1X C;  4IKG A;  2L8J A;  2RR9 A;  4MJS A;  4OVZ A;  1V5T A;  1N5X A;  2MSE D;  3O65 B;  3SHQ A;  3WAL A;  1OEY A;  2WNM A;  3A9K A;  2LD9 A;  1GJZ A;  3AE4 B;  3FIL A;  2INP E;  3O13 A;  2QSD A;  3I63 C;  4DDI D;  1ET9 A;  1BUI C;  3ZLZ A;  3T3O A;  3B2F A;  3RNB C;  3DBL I;  2K5P A;  1ZGU B;  4LDT B;  3JYU A;  3FKY A;  2WXP A;  3A9J A;  4F1S A;  2LWP A;  1UGJ A;  2DZI A;  3JW0 X;  2FAZ A;  4BVU C;  1BT0 A;  3UQB A;  3ZJT A;  3MHS D;  4E74 A;  1QOG A;  2SEB D;  5EE3 A;  2MH7 A;  4NNJ B;  4S17 A;  2K0P A;  3WCQ A;  1WE6 A;  2ZNV C;  2NBV B;  3PHX B;  4MEL A;  4FAD A;  1OEY J;  1E6E B;  1FRD A;  4DDG D;  2MA9 B;  5LXI B;  1XT9 B;  2FUG 1;  1PFD A;  3S2A A;  3MC0 B;  4J6I A;  4YSX B;  3AED B;  4MGK E;  2AQ3 B;  2L0T A;  2ZVO A;  1YNT E;  2ZEQ A;  5FKA C;  4WWP A;  1L0X B;  3AE1 B;  1WGY A;  5IAA C;  4USA A;  1J0G A;  4EOY A;  5MPO A;  4A3P A;  1GC7 A;  3VUX A;  1RRB A;  4XGA B;  2IGG A;  3NG0 A;  3ZRF A;  4OW0 A;  3QHT A;  3SD5 A;  1IPG A;  3RMK C;  2KQ4 X;  2BWF A;  1YN4 A;  2Z59 B;  4NJ6 A;  1TIF A;  1ZDX A;  4TV3 A;  3BWU D;  3N3K B;  1JWB D;  3EA6 A;  2L76 A;  3PLV A;  3VR9 B;  1CK1 A;  3SU8 X;  4G50 A;  1MFW A;  2FE8 A;  4AWJ A;  1SJE D;  3NUH B;  1TBE A;  3PZ8 A;  3AB5 A;  1TGZ B;  5D3I B;  3H9D A;  2O6V D;  2R2O A;  4E3C A;  2KHW B;  4MGZ E;  4BAX A;  3P1M A;  3PO0 A;  4A55 A;  1ZDV A;  1TKE A;  2K39 A;  1JCK B;  1PGX A;  5TSS A;  2IYD B;  3UIN B;  4LNF A;  5FR3 A;  2MBO A;  2B76 B;  1N60 A;  1WYG A;  1T0Q C;  1TYG B;  5DPS A;  1Q10 A;  3KYD D;  4PT5 A;  4WWN A;  5BMI A;  3MC8 A;  4LDT D;  2LGI A;  3B2G A;  5C23 A;  2LFI A;  4MDK E;  4W9D A;  1CQV A;  2INN E;  3A1Q B;  1I4Q A;  4HDQ A;  2Z0D B;  2FCS A;  2GI9 A;  2N7J A;  1NBF C;  3VHT C;  1ZP0 B;  1WJN A;  4MSM B;  3DHH C;  2TSS A;  3R7R A;  2LEK A;  3SFD B;  1XLO A;  4P7I A;  1IBX A;  1J7C A;  3AE2 B;  3DBL B;  4ZYN A;  3ZXR A;  1TY0 A;  1XO3 A;  1WXS A;  2KWV B;  3AV8 A;  1FMA D;  4XC2 A;  1WX8 A;  4GDL B;  3TEW A;  3KW5 B;  2JSV X;  2E6X A;  3L10 B;  1DGJ A;  1V8C A;  2RGF A;  2K3U A;  1SXT A;  1P3Q U;  2JWU A;  1Q5W B;  1GNU A;  2DYM A;  2DZM A;  2EKE C;  3W1Y A;  4KGS A;  1HTO A;  4N58 A;  5LLI A;  4EUT A;  2RDH A;  1Y56 A;  1Y8R C;  2PVG C;  2O6V A;  1KF6 B;  2PLP A;  3AE9 B;  3GE3 C;  1M4V A;  4IW0 A;  1ENF A;  1IYF A;  2KDM A;  2D5G A;  4GN1 A;  3V05 A;  3GE8 C;  1P9D U;  1JRU A;  1QLB B;  2ZCB A;  2C7H A;  2BTE A;  4F7Z A;  1WM3 A;  4ICU A;  4W9H A;  3MHZ A;  1TS4 A;  2WDR B;  3L08 A;  3OJ4 B;  2GBM A;  3NZS A;  3TSS A;  2INC C;  2D3A A;  4GGQ A;  3R7Q A;  4WJO A;  5HI1 A;  4JWS C;  2XK5 A;  1IP9 A;  3IT6 B;  4AJW A;  3RD2 A;  4XE0 A;  4I6L B;  3MJW A;  2CJN A;  2LGS A;  2QCZ A;  4LK0 M;  4KKI A;  2KTR B;  1GC6 A;  3PTF C;  2PE9 A;  1MG8 A;  1C4A A;  1ZE3 D;  1U4A A;  1T6B X;  4EE2 A;  5IN7 A;  5BMH A;  2LGD A;  4JPS A;  2FBW B;  1FNU A;  1SE2 A;  1SGH A;  3VAW A;  1SIF A;  5E6P A;  4YTN B;  1UBI A;  1V81 A;  3DVN U;  1EF5 A;  1L7Y A;  1OQQ A;  5AUI A;  3HUI A;  3P2B A;  1MJD A;  1XLN A;  3NVZ A;  2IPK D;  5BYS A;  4KZ0 A;  1N62 A;  3W9C B;  2NTS A;  4CQN A;  3U7Z A;  4GDK B;  2C60 A;  3PZ7 A;  3VRA B;  2JRI B;  2N0S B;  2WXM A;  2D3C A;  1CJE A;  4UDU C;  4NAM A;  3SFE B;  3TUO A;  1RFK A;  3ECI A;  4OZC A;  1ROE A;  2X38 A;  3HM3 A;  3TMP B;  5J18 A;  4B0M A;  2KAC A;  4PS7 A;  3RNC C;  2N9L A;  4JWU C;  3UQA A;  1UUP A;  3VUW A;  4PYU A;  1HZ5 A;  3QAQ A;  4KIK A;  3TJP A;  2KJR A;  2AYO B;  3Q3M C;  1JWA D;  1EWY C;  5L83 A;  2AL3 A;  1UF0 A;  3NJT A;  2JXT A;  2JZ3 B;  1ZKH A;  1FIQ A;  3AEG B;  1E5W A;  4XYC A;  1F2R I;  2LVO A;  2RD0 A;  3SEB A;  1WZ0 A;  3U7D A;  2KN4 A;  3ZRC A;  3SDL C;  4FXC A;  4IM3 A;  1TJE A;  3IXS A;  1FFV A;  1E7U A;  1WF9 A;  3V3X A;  4A3O A;  2K9X A;  5E6N A;  5DPR A;  4KVG B;  4YWG G;  2MLB A;  2KZR A;  2KFJ A;  3W2D A;  1VZ7 A;  1DOI A;  5HG2 A;  2UYZ B;  1SIJ A;  3Q69 A;  1XCT L;  1VD2 A;  2RSU A;  3P4R B;  2DX5 B;  4HK2 A;  2OOB B;  1C78 A;  2BW2 A;  2ONQ A;  3EEC A;  2IO1 B;  5AZG A;  2Y3A A;  4K3B A;  2RMM A;  3A33 B;  4W9L A;  1B1Z A;  2PPH A;  1KM7 A;  4XZ4 A;  1EU3 A;  1TS2 A;  4YSY B;  3BY4 B;  4PS3 A;  2FID A;  2KT7 A;  2DNF A;  1L4Z B;  3FC4 A;  5G2N A;  3AE3 B;  1J7A A;  1XF5 L;  5JH5 C;  3RNE C;  4BOS C;  4C7Z A;  4KZC A;  2I38 A;  2WU2 B;  2IDY A;  1XLQ A;  2N7D A;  1EM7 A;  3B9J A;  3QWZ B;  2WS3 B;  3RUI B;  3ZUN A;  2HE7 A;  2D10 A;  5JHB A;  1WMH B;  3WAO A;  3MP9 A;  3U30 A;  1FO4 A;  2H88 B;  3VVW B;  1ISN A;  2QDF A;  3ZJV A;  2MBQ A;  2I2Y A;  1DOX A;  1WJ4 A;  1SBB B;  1FM0 D;  1PYW D;  2KVZ A;  5BO4 B;  3ZTD A;  2N1V A;  3K9O B;  2KX0 A;  2BS4 B;  1YQ3 B;  1QQR A;  4KV2 A;  1GPX A;  5HKH A;  4KGT A;  2B3A A;  3BYY B;  1SE3 A;  2LXC A;  3W1S C;  3V60 A;  2JUO A;  2WXG A;  5TR5 A;  2L83 A;  2HD5 B;  2L52 A;  2K6Q A;  3DVN V;  3IAS 1;  2GMI C;  2L3Z A;  3KLS X;  4BKS D;  2R2Q A;  3ML8 A;  3VRB B;  1QZE A;  5IP4 D;  2Z8L A;  2GRI A;  2OJW A;  4JLC A;  2JU6 X;  4GMV A;  2YEP B;  3AEB B;  4II2 B;  1XXG A;  4MM3 B;  4HCN B;  2DZJ A;  3H1U A;  2KVR A;  3VTU A;  3AE7 B;  1FXA A;  4L1B A;  4AP4 C;  3PGE A;  2REX A;  2ON8 A;  3C0R B;  3NY5 A;  1SJH D;  3C8Y A;  2ZW0 A;  4JIO U;  4LJO B;  4OHJ A;  4IDI A;  2QIL A;  1BXT A;  3VXW A;  2I1J A;  2LAS A;  3M95 A;  3Q8C A;  1TT5 B;  2D07 B;  1WXQ A;  2AL6 A;  2LZ6 A;  1R4M I;  1I4P A;  1LFD A;  1XEE A;  3OLM D;  4AUQ C;  2KOX A;  2M8S A;  4FA6 A;  2NPT A;  1L0V B;  2KMC A;  2FIF A;  2DEN B;  5C1Z A;  3W1S A;  4JE3 B;  2GOW A;  1H4R A;  3Q3F A;  4LLG M;  1F52 A;  2LJ5 A;  3H7P A;  4NJC A;  4PS8 A;  5FR6 A;  2BYT A;  3DVG X;  3ZNG C;  2KD0 A;  2O2V A;  3KUZ A;  5LNK 1;  3UI3 A;  4MEM A;  5I4D A;  4BKG A;  3EGR A;  2G4D B;  2K8B A;  1UZX B;  1KOT A;  1VCB A;  2KO3 A;  2KFK A;  1V97 A;  1LXD A;  5IKC M;  2EMT A;  5DCN A;  1SEB D;  1TY2 A;  2WHI A;  5AZH A;  1N5W A;  4HPP A;  1WWT A;  1C3T A;  1F0Z A;  1QOF A;  2BS3 B;  3ETR A;  4BKS A;  4DHJ D;  3Q14 C;  3BII D;  2KLG A;  1FFU A;  3NS8 A;  3Q6B A;  4FHK A;  2KDE B;  2PIA A;  1AW7 A;  1VRA B;  4B6W A;  4QAY A;  4RM9 A;  1SSN A;  1OGW A;  4RF0 A;  3Q8A A;  4P16 A;  3VUY A;  2FNJ B;  1C77 A;  2D3B A;  3VH4 B;  2J0K A;  1JML A;  3ZDT A;  1MHX A;  4W9K A;  4XX5 A;  1KRH A;  4J3O D;  4HKQ A;  3ZNH B;  4WUR A;  2DZK A;  1QKZ A;  1AWD A;  3DBS A;  4P1B C;  1E7P B;  5E6J A;  1L2N A;  2G9H D;  4GXB A;  2KQS A;  3X23 A;  3UGB B;  4L2Y A;  3CST A;  3PSE B;  3QC8 B;  2HJ1 A;  3JVZ X;  3T8M A;  3Q3J A;  4BZA A;  3TEY A;  2K6D B;  3B0A A;  5HHD G;  4PYZ A;  4G0N B;  4LNK A;  1P98 A;  2M0X A;  4NAW B;  1K52 A;  2J53 A;  1GUA B;  3MJ5 A;  2KAJ A;  4DHZ E;  3V6C B;  3DQV A;  1YN5 A;  2KKC A;  2BB5 A;  2QHO A;  2IGH A;  4IM2 A;  4AOF A;  2KDI A;  1WGG A;  2LUE A;  2CJO A;  4HPL B;  4ZHP A;  1R4M B;  2JWZ A;  1L0Y B;  4HXD A;  4KDI C;  4M0W B;  1JWM D;  1Q1O A;  2AQ2 B;  1ZPS A;  4BBN C;  4WAF A;  4NJ7 A;  3ZW3 A;  3H6N A;  2V4I B;  2IY1 B;  1PUT A;  3PS6 A;  4ZRI A;  3ZIM A;  1I7H A;  2BF8 B;  3AE5 B;  3SR6 A;  5KHO A;  4R3D A;  3RUL A;  1FNV A;  1E8X A;  4W9G A;  1KFY B;  3JSV A;  2ACZ B;  3T3N A;  4BOZ B;  3GS2 A;  1XQQ A;  2NBW B;  2FCQ A;  4K7U A;  1VDV A;  4FJZ A;  3LDZ E;  1RFA A;  2KAN A;  2KK8 A;  2VRR B;  4M8N A;  2WXI A;  4RM8 A;  1Z5S B;  4A9A A;  1ZW7 A;  3UF8 A;  4AS1 A;  5H92 C;  2Y5B B;  1T3Q A;  4DWF A;  4HRS A;  1D3Z A;  4ZRP A;  1D5X C;  2DAJ A;  4C00 A;  1UGM A;  1HEZ E;  2JVC A;  4F8C B;  1GG3 A;  1K53 A;  2IO2 B;  3DBR I;  2YLM A;  3KUD B;  3BK2 A;  1HXY D;  4LNO A;  4MGI E;  2PEA A;  2N9X A;  1ZXI A;  3N1Z C;  3CIR B;  1KLV A;  5DPW A;  3PV1 A;  4N6E B;  5G5G A;  1UWM A;  2C5L C;  4AJY B;  3ZQ4 A;  2OED A;  4L23 A;  5LXH A;  3NZ3 A;  4O1N A;  4US9 A;  2WLB A;  4IWQ A;  3KUC B;  1IGD A;  2XN9 C;  1L6U A;  1I4H A;  1XLP A;  2DWQ A;  2J0J A;  2Y5C A;  3K9P B;  3I5J C;  2SAK A;  3IT4 B;  4IWP A;  2EMS A;  4NQL B;  4GLS C;  2M1M A;  1RLF A;  1YX5 B;  3B08 A;  3TBL D;  2BPS A;  3TIX A;  3CWI A;  4WWO A;  3BVG A;  1C1Y B;  2C9W B;  3VH3 B;  1FD6 A;  2IJ0 A;  1YX6 B;  3HK0 A;  4WJN A;  2J42 A;  4YXD B;  5C2T B;  4KKJ A;  1MG4 A; 
#chains in the Genus database with same CATH homology
 3I5J C;  3RNE C;  1T0S C;  3GE3 C;  3N1Z C;  3N1Y C;  3N20 C;  3I63 C;  3RNC C;  3Q3N C;  3RMK C;  4P1B C;  2IND C;  2INC C;  3Q14 C;  3DHI C;  3GE8 C;  3DHG C;  3RI7 C;  3RNF C;  3RNB C;  3N1X C;  3Q3M C;  1T0R C;  4P1C C;  3Q2A C;  1T0Q C;  2RDB C;  3RNA C;  3RNG C;  3Q3O C;  3RN9 C;  3DHH C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...