3RMKC

Toluene 4 monooxygenase h with 4-bromophenol
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
81
structure length
81
Chain Sequence
SAFPVHAAFEKDFLVQLVVVDLNDSMDQVAEKVAYHCVNRRVAPREGVMRVRKHRSTELFPRDMTIAESGLNPTEVIDVVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic analysis of active site contributions to regiospecificity in the diiron enzyme toluene 4-monooxygenase.
pubmed doi rcsb
source organism Pseudomonas mendocina
molecule tags Oxidoreductase
molecule keywords Toluene-4-monooxygenase system protein A
total genus 24
structure length 81
sequence length 81
chains with identical sequence F
ec nomenclature ec 1.14.13.236: Toluene 4-monooxygenase.
pdb deposition date 2011-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF06234 TmoB Toluene-4-monooxygenase system protein B (TmoB)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.270 Alpha Beta Roll Ubiquitin-like (UB roll) TmoB-like 3rmkC00
3Q2AC 3Q3NC 3DHHC 3DHGC 3RNBC 1T0QC 3RI7C 3I63C 1T0SC 3GE3C 3Q3MC 3Q14C 3N1XC 3N1ZC 3RNFC 3RNEC 3RNAC 3Q3OC 3RNCC 4P1CC 3N1YC 2INCC 3N20C 3RNGC 3I5JC 3RMKC 3GE8C 3RN9C 1T0RC 3DHIC 4P1BC 2INDC 2RDBC
chains in the Genus database with same CATH superfamily
2BB6A 1VCBA 4MH8A 2H88B 1E7VA 4BKSA 2C7MB 3Q69A 3AB5A 5IOIA 3RPFC 1EO6A 1QOFA 2KKCA 1FNWA 4KGRA 1L5PA 4DBGA 1XEEA 2LRUA 4GDKA 5LXHA 2G4SA 1SIJA 1R7SA 2J7QB 1T0YA 1K53A 3OG5A 1KRHA 3ZTDA 1UGJA 3KQ4A 1L6UA 2JZZA 1GAQB 1WX9A 1WFYA 3Q3JA 5EE3A 2RDGA 3UI3A 4FA6A 1ZXHA 2QMTA 5D3DA 3A1QA 4YWGG 2KO3A 4LLGM 1MHXA 2XK5A 5E6OA 5LXIB 2WDQB 3VTVA 4GN1A 1H8CA 2IPKD 1J19A 1L2NA 4GB9A 2OOBB 1N60A 3MJWA 4WAFA 3I5JC 1WGYA 1JW9D 1EF5A 2REXA 1FIQA 4ICUA 4F8CB 3P4RB 2BGFA 1YX5B 3TEZA 1TKYA 1D3ZA 2INNE 2IO2B 4US8A 1C1YB 2ICIA 3UQAA 2JZPA 3QC8B 1L0XB 3LB8C 3PO0A 2KJ6A 3R3MA 4I6LB 4RGTA 5AZGA 3KUDB 2Z0DB 4B6WA 1EWCA 2Y5CA 3ZJTA 2CHXA 2BTEA 2PIAA 2VH1A 4XZ4A 1XLPA 4J3OD 2ASQA 4KGTA 2PEAA 1GB1A 1E90A 3NHEB 3CSFA 4CQNA 3T8MA 2FCQA 2KJRA 1Y8RC 1BUIC 3K9OB 1UBIA 3V3XA 3ZXRA 2KQSA 3JSVB 2BYTA 2W3SA 5KHOA 3U7ZA 2FE8A 1VZ7A 2MLBA 2WXNA 4LNIA 4EZLA 2O2VA 2RPQA 4HPPA 4WJNA 4W9FA 4C56C 1OGWA 1FPYA 4I6PA 3QCAA 2WDRB 5FKAC 1FNUA 1OQQA 2ZVOA 2KQ4X 4JWSC 1M4VA 2V4IB 3NS8A 3GP7A 1LM8B 2J4XA 3LYYA 3EA6A 4NJ6A 2XN9C 2D5GA 1P7EA 2V4LA 4HDOA 1KLVA 5HFYA 5EE9A 4ARCA 3KH0A 2M4NA 4A3OA 3PGEA 4TQ1A 1YN3A 3H8HA 1T0SC 4XX5A 5D94A 2WXJA 2DZJA 2KFKA 1DOXA 2K8CA 2JWUA 3ZIMA 2LHEA 1VJKA 3RCZA 2BF8B 4GSWA 2KWVB 3DVNV 5J17A 2FUHB 4LNNA 1N61A 3EC8A 2XBBC 2PVOD 4ACFA 1R4NI 4AUQC 2MBOA 3NVYA 1UZXB 1V97A 1C4AA 1FXTB 4MGKE 2JUOA 1CK1A 2WP9B 3AEEB 3RNEC 2ZW1A 1VZ6A 4LCDE 2DZIA 3ML8A 3DVNU 3NOBA 1Y56A 2DBYA 3B2FA 1GJZA 1FCLA 2QC8A 2GB1A 1PDXA 3IG3A 2WU5B 1QZEA 5AUIA 3BK2A 1VRAB 3I63C 2O2VB 2LUMA 1LQBA 4USAA 1A5RA 2GBRA 2NR2A 2CU3A 1P3QU 3NG0A 1SB3C 4ANXA 2GLSA 3ZXVA 4RM8A 2PKOA 2JQRB 3KW5B 2HD5B 3N20C 1DYQA 3NJTA 2G1EA 4AQ7A 2UYZB 4HLEA 2DENB 1HZ6A 3DHHC 3W1SC 2KJHB 3JW0X 2NBVB 2MBEA 4IUMB 2L1AA 2W3RA 2MJDA 4BBNF 3RZWC 3PSEB 1XXGA 4W9GA 2WHIA 1LO5D 3IAS1 5C2TB 1E8ZA 3GS2A 4NQKE 2NS5A 3NZUA 3AU5A 2DZKA 4X57B 1LGRA 2WXMA 1V80A 3R7QA 5J18A 3RZFA 1F1HA 2GRIA 2KMCA 2OJRA 3RUIB 2BKRB 1WM2A 2WXFA 1GB4A 1WGKA 2DYMA 2YVCA 1MPEA 1IPGA 4MT5A 1UBQA 2KOXA 4P6VF 1WJ4A 1UUPA 1R4NB 2AL3A 3Q3NC 1RFKA 2JX5A 4DXAB 2LZ6A 2Z59B 1UGMA 3UGBB 2KD0A 1SE4A 5G5HA 4IG7B 1HQRD 4MH0E 3D32A 2XEWA 1YN5A 2KX3A 3I3TB 4YTMB 4LK0M 2BYEA 2NBUA 1WE7A 3TEYA 2DWQA 4AP4C 1WJUA 2J0KA 1V6EA 1E5WA 1YQ4B 1KM7A 2KVZA 3AE6B 2MBBB 2KTFA 2MCNB 1IYFA 3NVZA 2GBNA 1SEBD 3U52E 2JT4B 4YTPB 3BZDB 2WLBA 3TUOA 1I35A 2MWSB 1I4HA 2VRRB 3ONSA 4NAMA 4W9CA 4DDGD 2Z8LA 3TIXA 3L13A 4GGQA 1XQQA 3ZUNA 2K5PA 3X0WA 2K8BA 3W1SA 3LJ3A 3R7RA 3BVGA 3HVZA 3BWUD 4PK1A 2KDBA 4ZRKA 2IJ0A 1AYFA 3DBSA 3L54A 5JHAA 2VH2A 3JSVA 2E3TA 2JXTA 3HRDD 4MJSA 3O65B 2JY6A 4WWPA 2I1KA 5CHWA 1I4GA 1WGDA 2AQ2B 4GMVA 3B1LX 4M0WB 3OWEB 3AEFB 2ZZPB 1OFFA 1FFUA 4PS3A 4FXCA 4HWIB 4WQOB 4XDCA 3AE3B 3H7PA 1SE9A 1I4XA 3RNCC 3WANA 3C8YA 4YT0B 2ZEQA 3AMZA 4MEMA 1F9JA 1X1MA 2NPTA 2AEHA 2M56B 2LFIA 2AYOB 1ROEA 2VZKB 4S17A 4KIKB 3AXCA 2O6VB 4IWQA 2L0TA 2AL6A 2M19A 1ET9A 1WY8A 1GC7A 1E0ZA 1QKZA 1J7AA 4A90A 3IXSA 2L00B 4EFOA 2B3AA 1IBXB 2KDFB 4MGYE 1Z2MA 2LJIA 3GE3C 3EFUA 2UU7A 3KLSX 3Q14C 4GLSC 2L05A 3PTFC 3DBLI 4FHKA 3ZRFA 1V5TA 4BKTA 2FCNA 4HDQA 2L32A 3HUIA 2MQJA 1QT9A 4HCPB 1V1PA 3ZQ4A 1YJ1A 4P1BC 3NZ3A 4D2KA 2R2QA 3WAOA 3EGRA 1C76A 4GDKB 5E6PA 3ZNID 3KYCD 1L7YA 2DZMA 4RGMA 3DVGX 2VZKD 1I4RA 2INCC 2EMSA 3A33B 1D5ZC 4LJPB 1LXDA 4BZAA 2D3GA 4FULA 2N1WA 4MDKE 4BBNC 3A4SC 2Q5WD 3BK1A 2D07B 2EKEC 1GG3A 1ENFA 4ANWA 4OZBA 4AJWA 1SXTA 1D5XC 3N9YC 4XC2A 3ZDMC 1UNSA 3GZNB 4RCOA 4HXDA 2K1FA 4LTUA 3BIID 2DLBA 1WSPA 1R4MI 3GB1A 3DBRI 1EU3A 2M8SA 4BKGA 4H2AA 2LGYA 3CMMB 4TKNA 3N3KB 3DBRB 5AUKA 5BYRA 2KYWA 1RYJA 3N1XC 3ALBA 3V05A 3DWMA 1KLGD 3I57A 1K51A 3PHWB 1T3QA 3DVGY 1ZXIA 2MJ3A 4NAWB 3ML9A 4WQMA 1MJDA 3FKYA 4R3DA 2KLGA 2R61A 1TBEA 1FD6A 2GI9A 4N9F4 4B0EA 4ZHOA 4BOZB 3MJ5A 2LVQA 3N32A 3PZDA 3SFEB 1SBBB 1TTNA 4LDTD 3AN1A 1GNUA 2EMTA 1EF1A 4L2YA 4MM3A 1K52A 3N1YC 3O13A 2OJWA 4S0RA 3IVFA 1MVKA 4RNAA 2LGDA 2D3CA 3DPDA 2WS3B 3H9DA 2AQ3B 3AE4B 3PLUA 3KWLA 1XT9B 3KVFB 5TSSA 2WXRA 3R2IA 1YN4A 2L76A 3QWZB 1RAXA 2Y5BB 5EDSA 4WIPA 1V1OA 3ZVVA 2LGXA 4OVVA 3OAWA 5C1ZA 3P42A 3VRBB 2N7DA 4AJYB 1N5WA 1AN8A 4EEWA 3AV8A 2G3QB 3SR6A 2M0AA 1FFVA 1TZ1A 1PUTA 4NJCA 1YJIA 1C4PA 3PRMB 4TUUA 1NYRA 1HEZE 3VH3B 2KDEB 1XO3A 1HXYD 3QQ8B 2WWZA 4YL8A 3Q3FA 1KTKA 2LVPA 1YIWA 3RNBC 1WH3A 2KN5A 4B0MA 2D2QA 1TKEA 5JH5C 3X23A 3A9JB 4XE0A 4K7WA 3L4PA 2LASA 3VTWA 3L10B 2KACA 2C9WB 4M01A 3PREA 4NJ7A 4BFRA 4EE2A 1MG4A 5KHQA 2ZVNA 1NI2A 3QAQA 4BAXA 1JWMD 3BVZA 2NVUI 2OHFA 3Q3OC 4P1CC 4HEA1 3R8BA 4W9JA 1IGDA 1EUVB 2M1MA 1SJED 3FILA 3TMPB 1PGXA 4KGSA 1YJJA 2ONQA 2GBJA 2JPHA 5CTRC 4NZLB 4MM3B 4LNKA 1B1ZA 2L0FA 4DHZB 2N7EA 3W2DA 2K22A 4IDIA 2EELA 2FNJB 3PRPB 1MG8A 2W55A 3Q8EA 4PYUA 2D11A 1ZOYB 1I7HA 1V8CA 1L4ZB 2KWDA 2PVGC 3GZNI 2JWZA 1G6JA 3EFCA 3P4PB 4L23A 1SJHD 1WR6E 1HTOA 2K8HA 5J2RA 1ISNA 1UH6A 4W9DA 1AARA 3WALA 2IBIB 2RSUA 3AH7A 3HVDA 2LRWA 2LXCA 2K39A 3W5UB 1V2YA 5CHFA 3T9LA 4ASWC 1TYGB 5L95C 1V81A 2ZCBA 3PHXB 2MBQA 3QIJA 3C19A 3QA8A 2FAZA 1HTQA 1XCQL 1FXAA 1YQ3B 2J52A 2LHDA 5G2NA 3MHSD 1N62A 1Q1OA 3NY5A 4TMAB 3NUHB 3N1ZC 3OJ4B 2G45B 3DBLB 2JF5A 4CYEA 3V6CB 2WGSA 2CJOA 1UELA 3W9CB 4P16A 1T5XD 1JCKB 3RT3B 2JYEA 3UIPB 4ZYNA 5I4DA 1U4AA 2WXOA 1STEA 1Q5WB 3B2GA 2FCSA 1N6ZA 1S1QB 1UWMA 2KWCA 4WWOA 1WYGA 1WRIA 2DNFA 2BT6A 4ZDVA 4Q2JA 4K3CA 3VFKA 2V3PA 4URKA 3RYTA 3WIMA 3SU8X 2NTSA 3EUB2 1P7FA 4AS1A 3V62A 1PYWD 3L0WB 3PV1A 2LD9A 2KMAA 2KTRA 2KHWB 2BW2A 2K25A 1TY0A 3RFZB 2K9XA 4IC7B 4K7UA 4PT5A 3HK0A 4FLHA 3HM6X 1J0GA 2CKHB 4KIKA 1M94A 4KV2A 2KC2A 5CHVC 4FJZA 5IP4D 3L17A 3HM3A 4DDID 3NZSA 3JVZX 4ARIA 1L0VB 1IP9A 2WDVB 3AE2B 1OEYJ 1RRBA 2IZVB 3ZO5B 4A3PA 4KDIC 4KX6B 3H7PB 2HDEA 4A8XC 2M17A 1ET6A 3K9PB 3P4SB 2MA9B 2DX5B 2E6XA 4G0NB 2QSDA 4HK2A 1E7UA 2DHZA 2C5LC 2LI5A 5IKCM 1HZ5A 5DCNA 3APFA 2MH7A 3P63A 2KC1A 4ICVA 1TT5B 1VDVA 2PLPA 1XLOA 1XF5L 2CHWA 4XDDA 1WX8A 1FRDA 3LXFA 3VVWB 2W82A 3Q3MC 4WWMA 1KOTA 4EZJA 3TEWA 1WIAA 4HVBA 5HHDG 5L83A 3QK0A 2HE7A 2PPHA 3A4RA 1C3TA 1E9MA 5BO4B 3J9CA 2WX0A 2QHOA 2TSSA 1QILA 2MP2B 2QIEB 3DBHB 1CMXB 2XK5B 2LJ5A 2AX5A 3A1QB 3OJ3A 3BYTB 1ZPSA 2ZJDA 2W9NA 4HKZE 5BYQA 2K0PA 4HJKA 2N9XA 3GOEA 1WJNA 1I4QA 2INDC 3TSSA 4TQ0A 1QOAA 2KWUB 5AEKB 1YQBA 2PMVA 2GBKA 1V1PB 4F7ZA 2BQQA 4YSXB 1D4BA 2WYQA 2OEDA 2WU2B 2IDYA 2N1VA 4JLCA 2KMMA 2HTHA 4LDTB 4N59A 1FEHA 4DHZE 2WXHA 1EU4A 1E7PB 2J0MA 1WRDB 2A5UA 2JRHA 2BWES 4C7YA 1NENB 3I9V1 3MC0B 4ANUA 1ESFA 3AE7B 4GOCA 3VH4B 2YLMA 3E9SA 4YSYB 3BY4B 2V3SA 2IY1B 4K3BA 1F2RC 3E56A 4NQLB 3BYYB 4DQOC 4RGNA 1EM7A 1JRUA 1OQRA 1YMHE 3PZ7A 4AOFA 4NY0A 2INPE 2N9LA 2QEJC 5GXGB 2Z0EB 4M8NA 1RLFA 3DHGC 3M63B 2G4DB 2J0JA 4A20A 4A55A 5AZHA 3AI5A 2QILA 4ZHPA 3ZKJC 2ZNVC 1WM3A 3A9KA 4FADA 2KK8A 1QQRA 3RNGC 4C00A 1WXMA 2IY0B 4M0WA 2KT7A 2WQYB 3V60A 1TS2A 4ZOHC 2QCZA 3SEBA 4I6NB 3DDCB 4MJSB 4BVUC 3UINB 1E6EB 1TJEA 2PE9A 3QX1A 3M62B 4TSSA 2J53A 1V86A 1IUEA 2V1YA 3KUCB 5C3JB 4E3CA 4FHJA 2HJ8A 3DWGC 1T0RC 3PPAA 1GOZA 4E74A 2KFJA 2L3ZA 2C7NB 2D3BA 2C7HA 1ZDXA 5DPRA 3IT6B 2QDFA 2JSVX 2L7RA 3M95A 1WYWB 1F52A 1FRRA 1FM0D 3FILB 5E6NA 5DPTA 1E8XA 2LEKA 1DGJA 2K6DB 4II3B 2FIDA 4REZA 2JXXA 2KANA 1FCCC 5HG2A 2FCMA 4EUTA 1TKGA 2YEPB 2K3UA 2FIFA 5H8YE 1UD7A 5FK9C 2HTME 2IO3B 4HJGE 3H1UA 1FMAD 2MBHA 2RPVA 3KYDD 3VUWA 2CHZA 5D7GA 1OQYA 1WZ0A 3AE5B 1MI0A 3Q6BA 2WXKA 4II2B 5HKHA 3ZNGC 4OZCA 4HKQA 1DOIA 2BBCA 2AQ1B 5IN7A 3NRZA 4XWTA 3B9JA 3KWVA 5DPWA 5JHBA 1NEKB 4HCNB 5FR6A 4JE3B 3AEAB 3L08A 3IFWB 2MEKA 2LMCA 1ZDVA 4WAAA 2BS4B 4W9IA 3AECB 1UWXA 4JQWC 1P98A 3DCGA 4FN2A 1PGAA 3ETRA 1XLQA 3VRAB 2RGFA 4DHJD 4M8MA 1SIFA 4C4VB 3QJZA 3P4QB 2D10A 2DYOA 3ZJVA 2H89B 4K81A 3PT2B 3HHMA 1WXAA 2WNMA 1NVID 2PJHA 3IHPC 5BMGA 2WXGA 1BT0A 1XLNA 3OLMD 4A9AA 2BPSA 5EE0A 1PGBA 1J7BA 3RD2A 2ZW0A 1E10A 4OZAA 3T3OA 3AE9B 1P0RA 1SE3A 3Q8BA 1P9DU 2IYDB 5D6JB 2SEBD 2DAFA 2RR9A 3RNFC 2QJLA 5HI1A 2N0SB 1ZGUB 2ZPNA 4ANVA 1B9RA 3AEDB 2L8JA 2L83A 2K6QA 4WJOA 4JGHB 3U7DA 4C80A 1N63A 1AWDA 4KZCA 4KVGB 2J42A 4GDLB 1QOBA 1WE6A 5D2MB 2CU1A 2KVRA 3BVMA 1HE8A 1J7CA 2PE6B 5G55A 1QF6A 1KLUD 2NMQA 3RN9C 4TV3A 1OEYA 3ZNHB 3UQBA 1RFAA 2DYBA 2M0XA 3AE8B 3VDZA 1JRPA 4QAYA 3PRZA 4N6EB 2GBMA 4HPMB 3W1YA 1JALA 1BXTA 1KJTA 2PTLA 1ZW7A 1NBFC 1EWYC 5BYSA 3RULA 3VXWA 5JXVA 4GXBA 2UWQA 3EHVA 1TIFA 4K1RB 2RDBC 4FBJB 1VR9A 4ZRQA 1WGHA 2BS3B 3U4EG 3VTUA 2HJ1A 4M02A 1MHHE 3RNAC 1L4DB 4IWOA 2CR5A 2JZ3B 4IW0A 1I4PA 1KH0A 1C77A 3TJPA 1NDDA 1WX7A 4DXGA 3U30A 3SFDB 4DXFA 1S3SG 2V9HA 4OHJA 5LNK1 4W9HA 4ZRPA 1HA5A 4ZYSA 1SE2A 1WI0A 3KUZA 4KKIA 3DOWA 5H92C 3AEBB 4RF0A 1WGGA 3ZYYX 4WWNA 3U8ZA 1Z5SB 1K50A 3C0RB 3AE1B 3CSTA 3Q8CA 3PLVA 4RMAA 4CO7A 4W9KA 1YNTE 4OW0A 1WZ3A 3U2SC 2O6VA 2KAJA 4YXDB 2MHJA 2YEPF 1XCTL 2I38A 1D6EC 3APDA 3LDZE 4FJYA 1TGZB 2ON8A 2KLCA 1GC6A 1XD3B 4G50A 1V5OA 3MP9A 2LWPA 3Q8AA 4OVUA 4ITKA 2BYVE 5TR5A 1MFWA 2LGIA 1VD2A 5D3IB 1CQVA 4DWFA 1OTRB 4WJPA 2KDMA 2O6VD 5G5GA 1JQ4A 3ENEA 1C79A 5AZFA 4MSMB 5IA7A 2KZRA 3AU4A 3VUYA 1ZP0B 3R66C 1WXVA 3ABVB 5GMVA 1A70A 3MHZA 4M00A 1L0YB 2KTRB 4G11A 4KDLB 3MC8A 3RI7C 4FJVB 1JWSD 1ZUD2 1TZOA 4RGOS 2JYTA 2KXJA 5JZEB 4J6IA 4NNJB 3VR8B 3P2BA 2KN4A 4XGAB 3A9JA 1C78A 3TBLD 4JWUC 1TS4A 5E6JA 3WA0A 3GE8C 1CJEA 1JWBD 2MX2A 4W9LA 1WJ6A 2X38A 3MC9A 2FUG1 1JWUD 2MRPA 5FR3A 2X8XX 1NYQA 4N58A 4YTNB 2NBWB 4WH4A 2EKIA 4PYZA 3SD5A 4KSKC 4RH6A 3WAPA 3IBEA 3L16A 3ZJUA 3H6NA 1RWSA 2BVCA 4XYCA 2BB5A 1TS3A 3ZNZB 3CIRB 3PZ8A 1J8CA 4KSLC 1YOVB 2NTTA 4UDUC 2AWTA 1WMHB 2Y5PA 1T6BX 3SDLC 4E71A 1FXIA 3MFGA 4OVZA 1CZPA 2IO1B 1N5XA 2WDTB 3VAWA 5BMHA 1AW7A 3T3NA 1ZE3D 3ZTCA 1D5MC 3HIZA 4XWWA 4ZRIA 3B08A 1F0ZA 3BINA 4GDLA 4P7IA 2BWFA 2ACZB 4B9KA 2JU6X 1E8WA 2N9PC 4RF1A 3R2TA 3PS6A 2LXAA 2IO0B 1VZ8A 4MGIE 3NS1A 1BMLC 5DPSA 2KDIA 4HRSA 1I42A 1QLBB 2GOWA 3ZW3A 1YD8U 2KX0A 2ZNVB 3P1MA 3H7SA 2RMMA 1YX6B 3UF8A 1GPXA 3SHQA 5LLIA 3ZLZA 2N4FA 4PS8A 4CHKA 4US9A 2CJNA 2WXPA 2N7JA 4WURA 2LUEA 2L52A 4RFBA 5MPOA 1IGCA 4IWPA 4JPSA 3M3JA 3CWIA 2LGSA 3ZGZA 2WXQA 3NVVA 4B95A 2JRIB 5CX3A 2I2YA 3W5VB 1SF0A 2V3NA 4C4VA 4LNFA 1V9JA 4JIOU 3CF6E 2PW9A 2C60A 4MELA 1R4MB 3NVWA 1C4CA 3S2AA 2BS2B 4IM3A 4JL9A 2ZPYA 3B0AA 1V49A 1FNVA 4HPLB 2IGGA 2WXIA 4HROA 2XNAC 1NI3A 2MSED 2SAKA 1JWAD 1K8RB 1Q0WB 4GIVA 4YSZB 1PFDA 5C23A 3Q8FA 2N9EB 2W54A 4LJOB 4K7SA 4PS7A 3DBHI 1JMLA 2WX1A 3UIOB 2RDHA 3URYA 5T8IA 3AULA 1JROA 4LNOA 4AWJA 2FBWB 2KNBA 2WXLA 3V6EB 2I1JA 1PQSA 1RM6C 1E8YA 3QARA 5IAAC 4KZ0A 2IGHA 3ZRCA 1SSNA 4G3XB 3TCAA 1SGHA 3DHIC 1IBXA 3EECA 3AM9A 1GUAB 5BMIA 3ZDTA 1Q10A 4EOYA 2KFKB 3WCQA 1WGRA 1F77A 2MP2A 4L1BA 2JVCA 4C7ZA 1H4RA 3QHTA 2B76B 1F2RI 3MTNB 2KQ7A 1KFYB 3PVLA 3TL5A 4IM2A 3TEXA 3N30A 4BKSD 3IT4B 3FC4A 2MJEA 4IM0A 2NPTB 2BYFA 3Q2AC 4EZKA 4DHJB 5EE1A 2D3AA 4EKUA 1LFDA 3V61A 2MW5A 4F1SA 3VR9B 4A6QA 1KF6B 3VUXA 4O1NA 4BOSC 4RM9A 4DK5A 3ECIA 4MSQB 2R2OA 3APCA 2CS4A 2NCNA 2RD0A 1TS5A 1UF0A 1FO4A 1WR1A 4KKJA 1QOGA 4IKGA 1DOYA 1WF9A 1T0QC 3VHTC 2DAJA 4NAWA 5IO9A 4WJQA 2V0GA 1TY2A 4ZRJA 3WAMA 2IGDA 3VQIA 4JX1C 1L6VA 1ACCA 2Y3AA 3RMKC 1VLBA 2LVOA 3A9KB 1C9FA 3FAHA 2BKFA 4GU2A 1ZKHA 1WXSA 1WXQA 2ZCCA 1P1AA 3DQVA 2G9HD 1WWTA 1WMHA 2N9KA 2A4ZA 2GMIC 4NPNA 4W9EA 3AEGB 4IOIE 3IAM1 4MACA 4MGZE 3JYUA
chains in the Genus database with same CATH topology
3Q2AC 3Q3NC 3DHHC 3DHGC 3RNBC 1T0QC 3RI7C 3I63C 1T0SC 3GE3C 3Q3MC 3Q14C 3N1XC 3N1ZC 3RNFC 3RNEC 3RNAC 3Q3OC 3RNCC 4P1CC 3N1YC 2INCC 3N20C 3RNGC 3I5JC 3RMKC 3GE8C 3RN9C 1T0RC 3DHIC 4P1BC 2INDC 2RDBC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q2A C;  3Q3N C;  3DHH C;  3DHG C;  3RNB C;  1T0Q C;  3RI7 C;  3I63 C;  1T0S C;  3GE3 C;  3Q3M C;  3Q14 C;  3N1X C;  3N1Z C;  3RNF C;  3RNE C;  3RNA C;  3Q3O C;  3RNC C;  4P1C C;  3N1Y C;  2INC C;  3N20 C;  3RNG C;  3I5J C;  3RMK C;  3GE8 C;  3RN9 C;  1T0R C;  3DHI C;  4P1B C;  2IND C;  2RDB C; 
#chains in the Genus database with same CATH topology
 2BB6 A;  1VCB A;  4MH8 A;  2H88 B;  1E7V A;  4BKS A;  2C7M B;  3Q69 A;  3AB5 A;  5IOI A;  3RPF C;  1EO6 A;  1QOF A;  2KKC A;  1FNW A;  4KGR A;  1L5P A;  4DBG A;  1XEE A;  2LRU A;  4GDK A;  5LXH A;  2G4S A;  1SIJ A;  1R7S A;  2J7Q B;  1T0Y A;  1K53 A;  3OG5 A;  1KRH A;  3ZTD A;  1UGJ A;  3KQ4 A;  1L6U A;  2JZZ A;  1GAQ B;  1WX9 A;  1WFY A;  3Q3J A;  5EE3 A;  2RDG A;  3UI3 A;  4FA6 A;  1ZXH A;  2QMT A;  5D3D A;  3A1Q A;  4YWG G;  2KO3 A;  4LLG M;  1MHX A;  2XK5 A;  5E6O A;  5LXI B;  2WDQ B;  3VTV A;  4GN1 A;  1H8C A;  2IPK D;  1J19 A;  1L2N A;  4GB9 A;  2OOB B;  1N60 A;  3MJW A;  4WAF A;  3I5J C;  1WGY A;  1JW9 D;  1EF5 A;  2REX A;  1FIQ A;  4ICU A;  4F8C B;  3P4R B;  2BGF A;  1YX5 B;  3TEZ A;  1TKY A;  1D3Z A;  2INN E;  2IO2 B;  4US8 A;  1C1Y B;  2ICI A;  3UQA A;  2JZP A;  3QC8 B;  1L0X B;  3LB8 C;  3PO0 A;  2KJ6 A;  3R3M A;  4I6L B;  4RGT A;  5AZG A;  3KUD B;  2Z0D B;  4B6W A;  1EWC A;  2Y5C A;  3ZJT A;  2CHX A;  2BTE A;  2PIA A;  2VH1 A;  4XZ4 A;  1XLP A;  4J3O D;  2ASQ A;  4KGT A;  2PEA A;  1GB1 A;  1E90 A;  3NHE B;  3CSF A;  4CQN A;  3T8M A;  2FCQ A;  2KJR A;  1Y8R C;  1BUI C;  3K9O B;  1UBI A;  3V3X A;  3ZXR A;  2KQS A;  3JSV B;  2BYT A;  2W3S A;  5KHO A;  3U7Z A;  2FE8 A;  1VZ7 A;  2MLB A;  2WXN A;  4LNI A;  4EZL A;  2O2V A;  2RPQ A;  4HPP A;  4WJN A;  4W9F A;  4C56 C;  1OGW A;  1FPY A;  4I6P A;  3QCA A;  2WDR B;  5FKA C;  1FNU A;  1OQQ A;  2ZVO A;  2KQ4 X;  4JWS C;  1M4V A;  2V4I B;  3NS8 A;  3GP7 A;  1LM8 B;  2J4X A;  3LYY A;  3EA6 A;  4NJ6 A;  2XN9 C;  2D5G A;  1P7E A;  2V4L A;  4HDO A;  1KLV A;  5HFY A;  5EE9 A;  4ARC A;  3KH0 A;  2M4N A;  4A3O A;  3PGE A;  4TQ1 A;  1YN3 A;  3H8H A;  1T0S C;  4XX5 A;  5D94 A;  2WXJ A;  2DZJ A;  2KFK A;  1DOX A;  2K8C A;  2JWU A;  3ZIM A;  2LHE A;  1VJK A;  3RCZ A;  2BF8 B;  4GSW A;  2KWV B;  3DVN V;  5J17 A;  2FUH B;  4LNN A;  1N61 A;  3EC8 A;  2XBB C;  2PVO D;  4ACF A;  1R4N I;  4AUQ C;  2MBO A;  3NVY A;  1UZX B;  1V97 A;  1C4A A;  1FXT B;  4MGK E;  2JUO A;  1CK1 A;  2WP9 B;  3AEE B;  3RNE C;  2ZW1 A;  1VZ6 A;  4LCD E;  2DZI A;  3ML8 A;  3DVN U;  3NOB A;  1Y56 A;  2DBY A;  3B2F A;  1GJZ A;  1FCL A;  2QC8 A;  2GB1 A;  1PDX A;  3IG3 A;  2WU5 B;  1QZE A;  5AUI A;  3BK2 A;  1VRA B;  3I63 C;  2O2V B;  2LUM A;  1LQB A;  4USA A;  1A5R A;  2GBR A;  2NR2 A;  2CU3 A;  1P3Q U;  3NG0 A;  1SB3 C;  4ANX A;  2GLS A;  3ZXV A;  4RM8 A;  2PKO A;  2JQR B;  3KW5 B;  2HD5 B;  3N20 C;  1DYQ A;  3NJT A;  2G1E A;  4AQ7 A;  2UYZ B;  4HLE A;  2DEN B;  1HZ6 A;  3DHH C;  3W1S C;  2KJH B;  3JW0 X;  2NBV B;  2MBE A;  4IUM B;  2L1A A;  2W3R A;  2MJD A;  4BBN F;  3RZW C;  3PSE B;  1XXG A;  4W9G A;  2WHI A;  1LO5 D;  3IAS 1;  5C2T B;  1E8Z A;  3GS2 A;  4NQK E;  2NS5 A;  3NZU A;  3AU5 A;  2DZK A;  4X57 B;  1LGR A;  2WXM A;  1V80 A;  3R7Q A;  5J18 A;  3RZF A;  1F1H A;  2GRI A;  2KMC A;  2OJR A;  3RUI B;  2BKR B;  1WM2 A;  2WXF A;  1GB4 A;  1WGK A;  2DYM A;  2YVC A;  1MPE A;  1IPG A;  4MT5 A;  1UBQ A;  2KOX A;  4P6V F;  1WJ4 A;  1UUP A;  1R4N B;  2AL3 A;  3Q3N C;  1RFK A;  2JX5 A;  4DXA B;  2LZ6 A;  2Z59 B;  1UGM A;  3UGB B;  2KD0 A;  1SE4 A;  5G5H A;  4IG7 B;  1HQR D;  4MH0 E;  3D32 A;  2XEW A;  1YN5 A;  2KX3 A;  3I3T B;  4YTM B;  4LK0 M;  2BYE A;  2NBU A;  1WE7 A;  3TEY A;  2DWQ A;  4AP4 C;  1WJU A;  2J0K A;  1V6E A;  1E5W A;  1YQ4 B;  1KM7 A;  2KVZ A;  3AE6 B;  2MBB B;  2KTF A;  2MCN B;  1IYF A;  3NVZ A;  2GBN A;  1SEB D;  3U52 E;  2JT4 B;  4YTP B;  3BZD B;  2WLB A;  3TUO A;  1I35 A;  2MWS B;  1I4H A;  2VRR B;  3ONS A;  4NAM A;  4W9C A;  4DDG D;  2Z8L A;  3TIX A;  3L13 A;  4GGQ A;  1XQQ A;  3ZUN A;  2K5P A;  3X0W A;  2K8B A;  3W1S A;  3LJ3 A;  3R7R A;  3BVG A;  3HVZ A;  3BWU D;  4PK1 A;  2KDB A;  4ZRK A;  2IJ0 A;  1AYF A;  3DBS A;  3L54 A;  5JHA A;  2VH2 A;  3JSV A;  2E3T A;  2JXT A;  3HRD D;  4MJS A;  3O65 B;  2JY6 A;  4WWP A;  2I1K A;  5CHW A;  1I4G A;  1WGD A;  2AQ2 B;  4GMV A;  3B1L X;  4M0W B;  3OWE B;  3AEF B;  2ZZP B;  1OFF A;  1FFU A;  4PS3 A;  4FXC A;  4HWI B;  4WQO B;  4XDC A;  3AE3 B;  3H7P A;  1SE9 A;  1I4X A;  3RNC C;  3WAN A;  3C8Y A;  4YT0 B;  2ZEQ A;  3AMZ A;  4MEM A;  1F9J A;  1X1M A;  2NPT A;  2AEH A;  2M56 B;  2LFI A;  2AYO B;  1ROE A;  2VZK B;  4S17 A;  4KIK B;  3AXC A;  2O6V B;  4IWQ A;  2L0T A;  2AL6 A;  2M19 A;  1ET9 A;  1WY8 A;  1GC7 A;  1E0Z A;  1QKZ A;  1J7A A;  4A90 A;  3IXS A;  2L00 B;  4EFO A;  2B3A A;  1IBX B;  2KDF B;  4MGY E;  1Z2M A;  2LJI A;  3GE3 C;  3EFU A;  2UU7 A;  3KLS X;  3Q14 C;  4GLS C;  2L05 A;  3PTF C;  3DBL I;  4FHK A;  3ZRF A;  1V5T A;  4BKT A;  2FCN A;  4HDQ A;  2L32 A;  3HUI A;  2MQJ A;  1QT9 A;  4HCP B;  1V1P A;  3ZQ4 A;  1YJ1 A;  4P1B C;  3NZ3 A;  4D2K A;  2R2Q A;  3WAO A;  3EGR A;  1C76 A;  4GDK B;  5E6P A;  3ZNI D;  3KYC D;  1L7Y A;  2DZM A;  4RGM A;  3DVG X;  2VZK D;  1I4R A;  2INC C;  2EMS A;  3A33 B;  1D5Z C;  4LJP B;  1LXD A;  4BZA A;  2D3G A;  4FUL A;  2N1W A;  4MDK E;  4BBN C;  3A4S C;  2Q5W D;  3BK1 A;  2D07 B;  2EKE C;  1GG3 A;  1ENF A;  4ANW A;  4OZB A;  4AJW A;  1SXT A;  1D5X C;  3N9Y C;  4XC2 A;  3ZDM C;  1UNS A;  3GZN B;  4RCO A;  4HXD A;  2K1F A;  4LTU A;  3BII D;  2DLB A;  1WSP A;  1R4M I;  3GB1 A;  3DBR I;  1EU3 A;  2M8S A;  4BKG A;  4H2A A;  2LGY A;  3CMM B;  4TKN A;  3N3K B;  3DBR B;  5AUK A;  5BYR A;  2KYW A;  1RYJ A;  3N1X C;  3ALB A;  3V05 A;  3DWM A;  1KLG D;  3I57 A;  1K51 A;  3PHW B;  1T3Q A;  3DVG Y;  1ZXI A;  2MJ3 A;  4NAW B;  3ML9 A;  4WQM A;  1MJD A;  3FKY A;  4R3D A;  2KLG A;  2R61 A;  1TBE A;  1FD6 A;  2GI9 A;  4N9F 4;  4B0E A;  4ZHO A;  4BOZ B;  3MJ5 A;  2LVQ A;  3N32 A;  3PZD A;  3SFE B;  1SBB B;  1TTN A;  4LDT D;  3AN1 A;  1GNU A;  2EMT A;  1EF1 A;  4L2Y A;  4MM3 A;  1K52 A;  3N1Y C;  3O13 A;  2OJW A;  4S0R A;  3IVF A;  1MVK A;  4RNA A;  2LGD A;  2D3C A;  3DPD A;  2WS3 B;  3H9D A;  2AQ3 B;  3AE4 B;  3PLU A;  3KWL A;  1XT9 B;  3KVF B;  5TSS A;  2WXR A;  3R2I A;  1YN4 A;  2L76 A;  3QWZ B;  1RAX A;  2Y5B B;  5EDS A;  4WIP A;  1V1O A;  3ZVV A;  2LGX A;  4OVV A;  3OAW A;  5C1Z A;  3P42 A;  3VRB B;  2N7D A;  4AJY B;  1N5W A;  1AN8 A;  4EEW A;  3AV8 A;  2G3Q B;  3SR6 A;  2M0A A;  1FFV A;  1TZ1 A;  1PUT A;  4NJC A;  1YJI A;  1C4P A;  3PRM B;  4TUU A;  1NYR A;  1HEZ E;  3VH3 B;  2KDE B;  1XO3 A;  1HXY D;  3QQ8 B;  2WWZ A;  4YL8 A;  3Q3F A;  1KTK A;  2LVP A;  1YIW A;  3RNB C;  1WH3 A;  2KN5 A;  4B0M A;  2D2Q A;  1TKE A;  5JH5 C;  3X23 A;  3A9J B;  4XE0 A;  4K7W A;  3L4P A;  2LAS A;  3VTW A;  3L10 B;  2KAC A;  2C9W B;  4M01 A;  3PRE A;  4NJ7 A;  4BFR A;  4EE2 A;  1MG4 A;  5KHQ A;  2ZVN A;  1NI2 A;  3QAQ A;  4BAX A;  1JWM D;  3BVZ A;  2NVU I;  2OHF A;  3Q3O C;  4P1C C;  4HEA 1;  3R8B A;  4W9J A;  1IGD A;  1EUV B;  2M1M A;  1SJE D;  3FIL A;  3TMP B;  1PGX A;  4KGS A;  1YJJ A;  2ONQ A;  2GBJ A;  2JPH A;  5CTR C;  4NZL B;  4MM3 B;  4LNK A;  1B1Z A;  2L0F A;  4DHZ B;  2N7E A;  3W2D A;  2K22 A;  4IDI A;  2EEL A;  2FNJ B;  3PRP B;  1MG8 A;  2W55 A;  3Q8E A;  4PYU A;  2D11 A;  1ZOY B;  1I7H A;  1V8C A;  1L4Z B;  2KWD A;  2PVG C;  3GZN I;  2JWZ A;  1G6J A;  3EFC A;  3P4P B;  4L23 A;  1SJH D;  1WR6 E;  1HTO A;  2K8H A;  5J2R A;  1ISN A;  1UH6 A;  4W9D A;  1AAR A;  3WAL A;  2IBI B;  2RSU A;  3AH7 A;  3HVD A;  2LRW A;  2LXC A;  2K39 A;  3W5U B;  1V2Y A;  5CHF A;  3T9L A;  4ASW C;  1TYG B;  5L95 C;  1V81 A;  2ZCB A;  3PHX B;  2MBQ A;  3QIJ A;  3C19 A;  3QA8 A;  2FAZ A;  1HTQ A;  1XCQ L;  1FXA A;  1YQ3 B;  2J52 A;  2LHD A;  5G2N A;  3MHS D;  1N62 A;  1Q1O A;  3NY5 A;  4TMA B;  3NUH B;  3N1Z C;  3OJ4 B;  2G45 B;  3DBL B;  2JF5 A;  4CYE A;  3V6C B;  2WGS A;  2CJO A;  1UEL A;  3W9C B;  4P16 A;  1T5X D;  1JCK B;  3RT3 B;  2JYE A;  3UIP B;  4ZYN A;  5I4D A;  1U4A A;  2WXO A;  1STE A;  1Q5W B;  3B2G A;  2FCS A;  1N6Z A;  1S1Q B;  1UWM A;  2KWC A;  4WWO A;  1WYG A;  1WRI A;  2DNF A;  2BT6 A;  4ZDV A;  4Q2J A;  4K3C A;  3VFK A;  2V3P A;  4URK A;  3RYT A;  3WIM A;  3SU8 X;  2NTS A;  3EUB 2;  1P7F A;  4AS1 A;  3V62 A;  1PYW D;  3L0W B;  3PV1 A;  2LD9 A;  2KMA A;  2KTR A;  2KHW B;  2BW2 A;  2K25 A;  1TY0 A;  3RFZ B;  2K9X A;  4IC7 B;  4K7U A;  4PT5 A;  3HK0 A;  4FLH A;  3HM6 X;  1J0G A;  2CKH B;  4KIK A;  1M94 A;  4KV2 A;  2KC2 A;  5CHV C;  4FJZ A;  5IP4 D;  3L17 A;  3HM3 A;  4DDI D;  3NZS A;  3JVZ X;  4ARI A;  1L0V B;  1IP9 A;  2WDV B;  3AE2 B;  1OEY J;  1RRB A;  2IZV B;  3ZO5 B;  4A3P A;  4KDI C;  4KX6 B;  3H7P B;  2HDE A;  4A8X C;  2M17 A;  1ET6 A;  3K9P B;  3P4S B;  2MA9 B;  2DX5 B;  2E6X A;  4G0N B;  2QSD A;  4HK2 A;  1E7U A;  2DHZ A;  2C5L C;  2LI5 A;  5IKC M;  1HZ5 A;  5DCN A;  3APF A;  2MH7 A;  3P63 A;  2KC1 A;  4ICV A;  1TT5 B;  1VDV A;  2PLP A;  1XLO A;  1XF5 L;  2CHW A;  4XDD A;  1WX8 A;  1FRD A;  3LXF A;  3VVW B;  2W82 A;  3Q3M C;  4WWM A;  1KOT A;  4EZJ A;  3TEW A;  1WIA A;  4HVB A;  5HHD G;  5L83 A;  3QK0 A;  2HE7 A;  2PPH A;  3A4R A;  1C3T A;  1E9M A;  5BO4 B;  3J9C A;  2WX0 A;  2QHO A;  2TSS A;  1QIL A;  2MP2 B;  2QIE B;  3DBH B;  1CMX B;  2XK5 B;  2LJ5 A;  2AX5 A;  3A1Q B;  3OJ3 A;  3BYT B;  1ZPS A;  2ZJD A;  2W9N A;  4HKZ E;  5BYQ A;  2K0P A;  4HJK A;  2N9X A;  3GOE A;  1WJN A;  1I4Q A;  2IND C;  3TSS A;  4TQ0 A;  1QOA A;  2KWU B;  5AEK B;  1YQB A;  2PMV A;  2GBK A;  1V1P B;  4F7Z A;  2BQQ A;  4YSX B;  1D4B A;  2WYQ A;  2OED A;  2WU2 B;  2IDY A;  2N1V A;  4JLC A;  2KMM A;  2HTH A;  4LDT B;  4N59 A;  1FEH A;  4DHZ E;  2WXH A;  1EU4 A;  1E7P B;  2J0M A;  1WRD B;  2A5U A;  2JRH A;  2BWE S;  4C7Y A;  1NEN B;  3I9V 1;  3MC0 B;  4ANU A;  1ESF A;  3AE7 B;  4GOC A;  3VH4 B;  2YLM A;  3E9S A;  4YSY B;  3BY4 B;  2V3S A;  2IY1 B;  4K3B A;  1F2R C;  3E56 A;  4NQL B;  3BYY B;  4DQO C;  4RGN A;  1EM7 A;  1JRU A;  1OQR A;  1YMH E;  3PZ7 A;  4AOF A;  4NY0 A;  2INP E;  2N9L A;  2QEJ C;  5GXG B;  2Z0E B;  4M8N A;  1RLF A;  3DHG C;  3M63 B;  2G4D B;  2J0J A;  4A20 A;  4A55 A;  5AZH A;  3AI5 A;  2QIL A;  4ZHP A;  3ZKJ C;  2ZNV C;  1WM3 A;  3A9K A;  4FAD A;  2KK8 A;  1QQR A;  3RNG C;  4C00 A;  1WXM A;  2IY0 B;  4M0W A;  2KT7 A;  2WQY B;  3V60 A;  1TS2 A;  4ZOH C;  2QCZ A;  3SEB A;  4I6N B;  3DDC B;  4MJS B;  4BVU C;  3UIN B;  1E6E B;  1TJE A;  2PE9 A;  3QX1 A;  3M62 B;  4TSS A;  2J53 A;  1V86 A;  1IUE A;  2V1Y A;  3KUC B;  5C3J B;  4E3C A;  4FHJ A;  2HJ8 A;  3DWG C;  1T0R C;  3PPA A;  1GOZ A;  4E74 A;  2KFJ A;  2L3Z A;  2C7N B;  2D3B A;  2C7H A;  1ZDX A;  5DPR A;  3IT6 B;  2QDF A;  2JSV X;  2L7R A;  3M95 A;  1WYW B;  1F52 A;  1FRR A;  1FM0 D;  3FIL B;  5E6N A;  5DPT A;  1E8X A;  2LEK A;  1DGJ A;  2K6D B;  4II3 B;  2FID A;  4REZ A;  2JXX A;  2KAN A;  1FCC C;  5HG2 A;  2FCM A;  4EUT A;  1TKG A;  2YEP B;  2K3U A;  2FIF A;  5H8Y E;  1UD7 A;  5FK9 C;  2HTM E;  2IO3 B;  4HJG E;  3H1U A;  1FMA D;  2MBH A;  2RPV A;  3KYD D;  3VUW A;  2CHZ A;  5D7G A;  1OQY A;  1WZ0 A;  3AE5 B;  1MI0 A;  3Q6B A;  2WXK A;  4II2 B;  5HKH A;  3ZNG C;  4OZC A;  4HKQ A;  1DOI A;  2BBC A;  2AQ1 B;  5IN7 A;  3NRZ A;  4XWT A;  3B9J A;  3KWV A;  5DPW A;  5JHB A;  1NEK B;  4HCN B;  5FR6 A;  4JE3 B;  3AEA B;  3L08 A;  3IFW B;  2MEK A;  2LMC A;  1ZDV A;  4WAA A;  2BS4 B;  4W9I A;  3AEC B;  1UWX A;  4JQW C;  1P98 A;  3DCG A;  4FN2 A;  1PGA A;  3ETR A;  1XLQ A;  3VRA B;  2RGF A;  4DHJ D;  4M8M A;  1SIF A;  4C4V B;  3QJZ A;  3P4Q B;  2D10 A;  2DYO A;  3ZJV A;  2H89 B;  4K81 A;  3PT2 B;  3HHM A;  1WXA A;  2WNM A;  1NVI D;  2PJH A;  3IHP C;  5BMG A;  2WXG A;  1BT0 A;  1XLN A;  3OLM D;  4A9A A;  2BPS A;  5EE0 A;  1PGB A;  1J7B A;  3RD2 A;  2ZW0 A;  1E10 A;  4OZA A;  3T3O A;  3AE9 B;  1P0R A;  1SE3 A;  3Q8B A;  1P9D U;  2IYD B;  5D6J B;  2SEB D;  2DAF A;  2RR9 A;  3RNF C;  2QJL A;  5HI1 A;  2N0S B;  1ZGU B;  2ZPN A;  4ANV A;  1B9R A;  3AED B;  2L8J A;  2L83 A;  2K6Q A;  4WJO A;  4JGH B;  3U7D A;  4C80 A;  1N63 A;  1AWD A;  4KZC A;  4KVG B;  2J42 A;  4GDL B;  1QOB A;  1WE6 A;  5D2M B;  2CU1 A;  2KVR A;  3BVM A;  1HE8 A;  1J7C A;  2PE6 B;  5G55 A;  1QF6 A;  1KLU D;  2NMQ A;  3RN9 C;  4TV3 A;  1OEY A;  3ZNH B;  3UQB A;  1RFA A;  2DYB A;  2M0X A;  3AE8 B;  3VDZ A;  1JRP A;  4QAY A;  3PRZ A;  4N6E B;  2GBM A;  4HPM B;  3W1Y A;  1JAL A;  1BXT A;  1KJT A;  2PTL A;  1ZW7 A;  1NBF C;  1EWY C;  5BYS A;  3RUL A;  3VXW A;  5JXV A;  4GXB A;  2UWQ A;  3EHV A;  1TIF A;  4K1R B;  2RDB C;  4FBJ B;  1VR9 A;  4ZRQ A;  1WGH A;  2BS3 B;  3U4E G;  3VTU A;  2HJ1 A;  4M02 A;  1MHH E;  3RNA C;  1L4D B;  4IWO A;  2CR5 A;  2JZ3 B;  4IW0 A;  1I4P A;  1KH0 A;  1C77 A;  3TJP A;  1NDD A;  1WX7 A;  4DXG A;  3U30 A;  3SFD B;  4DXF A;  1S3S G;  2V9H A;  4OHJ A;  5LNK 1;  4W9H A;  4ZRP A;  1HA5 A;  4ZYS A;  1SE2 A;  1WI0 A;  3KUZ A;  4KKI A;  3DOW A;  5H92 C;  3AEB B;  4RF0 A;  1WGG A;  3ZYY X;  4WWN A;  3U8Z A;  1Z5S B;  1K50 A;  3C0R B;  3AE1 B;  3CST A;  3Q8C A;  3PLV A;  4RMA A;  4CO7 A;  4W9K A;  1YNT E;  4OW0 A;  1WZ3 A;  3U2S C;  2O6V A;  2KAJ A;  4YXD B;  2MHJ A;  2YEP F;  1XCT L;  2I38 A;  1D6E C;  3APD A;  3LDZ E;  4FJY A;  1TGZ B;  2ON8 A;  2KLC A;  1GC6 A;  1XD3 B;  4G50 A;  1V5O A;  3MP9 A;  2LWP A;  3Q8A A;  4OVU A;  4ITK A;  2BYV E;  5TR5 A;  1MFW A;  2LGI A;  1VD2 A;  5D3I B;  1CQV A;  4DWF A;  1OTR B;  4WJP A;  2KDM A;  2O6V D;  5G5G A;  1JQ4 A;  3ENE A;  1C79 A;  5AZF A;  4MSM B;  5IA7 A;  2KZR A;  3AU4 A;  3VUY A;  1ZP0 B;  3R66 C;  1WXV A;  3ABV B;  5GMV A;  1A70 A;  3MHZ A;  4M00 A;  1L0Y B;  2KTR B;  4G11 A;  4KDL B;  3MC8 A;  3RI7 C;  4FJV B;  1JWS D;  1ZUD 2;  1TZO A;  4RGO S;  2JYT A;  2KXJ A;  5JZE B;  4J6I A;  4NNJ B;  3VR8 B;  3P2B A;  2KN4 A;  4XGA B;  3A9J A;  1C78 A;  3TBL D;  4JWU C;  1TS4 A;  5E6J A;  3WA0 A;  3GE8 C;  1CJE A;  1JWB D;  2MX2 A;  4W9L A;  1WJ6 A;  2X38 A;  3MC9 A;  2FUG 1;  1JWU D;  2MRP A;  5FR3 A;  2X8X X;  1NYQ A;  4N58 A;  4YTN B;  2NBW B;  4WH4 A;  2EKI A;  4PYZ A;  3SD5 A;  4KSK C;  4RH6 A;  3WAP A;  3IBE A;  3L16 A;  3ZJU A;  3H6N A;  1RWS A;  2BVC A;  4XYC A;  2BB5 A;  1TS3 A;  3ZNZ B;  3CIR B;  3PZ8 A;  1J8C A;  4KSL C;  1YOV B;  2NTT A;  4UDU C;  2AWT A;  1WMH B;  2Y5P A;  1T6B X;  3SDL C;  4E71 A;  1FXI A;  3MFG A;  4OVZ A;  1CZP A;  2IO1 B;  1N5X A;  2WDT B;  3VAW A;  5BMH A;  1AW7 A;  3T3N A;  1ZE3 D;  3ZTC A;  1D5M C;  3HIZ A;  4XWW A;  4ZRI A;  3B08 A;  1F0Z A;  3BIN A;  4GDL A;  4P7I A;  2BWF A;  2ACZ B;  4B9K A;  2JU6 X;  1E8W A;  2N9P C;  4RF1 A;  3R2T A;  3PS6 A;  2LXA A;  2IO0 B;  1VZ8 A;  4MGI E;  3NS1 A;  1BML C;  5DPS A;  2KDI A;  4HRS A;  1I42 A;  1QLB B;  2GOW A;  3ZW3 A;  1YD8 U;  2KX0 A;  2ZNV B;  3P1M A;  3H7S A;  2RMM A;  1YX6 B;  3UF8 A;  1GPX A;  3SHQ A;  5LLI A;  3ZLZ A;  2N4F A;  4PS8 A;  4CHK A;  4US9 A;  2CJN A;  2WXP A;  2N7J A;  4WUR A;  2LUE A;  2L52 A;  4RFB A;  5MPO A;  1IGC A;  4IWP A;  4JPS A;  3M3J A;  3CWI A;  2LGS A;  3ZGZ A;  2WXQ A;  3NVV A;  4B95 A;  2JRI B;  5CX3 A;  2I2Y A;  3W5V B;  1SF0 A;  2V3N A;  4C4V A;  4LNF A;  1V9J A;  4JIO U;  3CF6 E;  2PW9 A;  2C60 A;  4MEL A;  1R4M B;  3NVW A;  1C4C A;  3S2A A;  2BS2 B;  4IM3 A;  4JL9 A;  2ZPY A;  3B0A A;  1V49 A;  1FNV A;  4HPL B;  2IGG A;  2WXI A;  4HRO A;  2XNA C;  1NI3 A;  2MSE D;  2SAK A;  1JWA D;  1K8R B;  1Q0W B;  4GIV A;  4YSZ B;  1PFD A;  5C23 A;  3Q8F A;  2N9E B;  2W54 A;  4LJO B;  4K7S A;  4PS7 A;  3DBH I;  1JML A;  2WX1 A;  3UIO B;  2RDH A;  3URY A;  5T8I A;  3AUL A;  1JRO A;  4LNO A;  4AWJ A;  2FBW B;  2KNB A;  2WXL A;  3V6E B;  2I1J A;  1PQS A;  1RM6 C;  1E8Y A;  3QAR A;  5IAA C;  4KZ0 A;  2IGH A;  3ZRC A;  1SSN A;  4G3X B;  3TCA A;  1SGH A;  3DHI C;  1IBX A;  3EEC A;  3AM9 A;  1GUA B;  5BMI A;  3ZDT A;  1Q10 A;  4EOY A;  2KFK B;  3WCQ A;  1WGR A;  1F77 A;  2MP2 A;  4L1B A;  2JVC A;  4C7Z A;  1H4R A;  3QHT A;  2B76 B;  1F2R I;  3MTN B;  2KQ7 A;  1KFY B;  3PVL A;  3TL5 A;  4IM2 A;  3TEX A;  3N30 A;  4BKS D;  3IT4 B;  3FC4 A;  2MJE A;  4IM0 A;  2NPT B;  2BYF A;  3Q2A C;  4EZK A;  4DHJ B;  5EE1 A;  2D3A A;  4EKU A;  1LFD A;  3V61 A;  2MW5 A;  4F1S A;  3VR9 B;  4A6Q A;  1KF6 B;  3VUX A;  4O1N A;  4BOS C;  4RM9 A;  4DK5 A;  3ECI A;  4MSQ B;  2R2O A;  3APC A;  2CS4 A;  2NCN A;  2RD0 A;  1TS5 A;  1UF0 A;  1FO4 A;  1WR1 A;  4KKJ A;  1QOG A;  4IKG A;  1DOY A;  1WF9 A;  1T0Q C;  3VHT C;  2DAJ A;  4NAW A;  5IO9 A;  4WJQ A;  2V0G A;  1TY2 A;  4ZRJ A;  3WAM A;  2IGD A;  3VQI A;  4JX1 C;  1L6V A;  1ACC A;  2Y3A A;  3RMK C;  1VLB A;  2LVO A;  3A9K B;  1C9F A;  3FAH A;  2BKF A;  4GU2 A;  1ZKH A;  1WXS A;  1WXQ A;  2ZCC A;  1P1A A;  3DQV A;  2G9H D;  1WWT A;  1WMH A;  2N9K A;  2A4Z A;  2GMI C;  4NPN A;  4W9E A;  3AEG B;  4IOI E;  3IAM 1;  4MAC A;  4MGZ E;  3JYU A; 
#chains in the Genus database with same CATH homology
 3Q2A C;  3Q3N C;  3DHH C;  3DHG C;  3RNB C;  1T0Q C;  3RI7 C;  3I63 C;  1T0S C;  3GE3 C;  3Q3M C;  3Q14 C;  3N1X C;  3N1Z C;  3RNF C;  3RNE C;  3RNA C;  3Q3O C;  3RNC C;  4P1C C;  3N1Y C;  2INC C;  3N20 C;  3RNG C;  3I5J C;  3RMK C;  3GE8 C;  3RN9 C;  1T0R C;  3DHI C;  4P1B C;  2IND C;  2RDB C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...