3RMKC

Toluene 4 monooxygenase h with 4-bromophenol
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
81
structure length
81
Chain Sequence
SAFPVHAAFEKDFLVQLVVVDLNDSMDQVAEKVAYHCVNRRVAPREGVMRVRKHRSTELFPRDMTIAESGLNPTEVIDVVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Toluene-4-monooxygenase system protein A
publication title Crystallographic analysis of active site contributions to regiospecificity in the diiron enzyme toluene 4-monooxygenase.
pubmed doi rcsb
source organism Pseudomonas mendocina
molecule tags Oxidoreductase
total genus 24
structure length 81
sequence length 81
chains with identical sequence F
ec nomenclature ec 1.14.13.236: Toluene 4-monooxygenase.
pdb deposition date 2011-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF06234 TmoB Toluene-4-monooxygenase system protein B (TmoB)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.270 Alpha Beta Roll Ubiquitin-like (UB roll) TmoB-like 3rmkC00
3RI7C 3RNAC 3RMKC 1T0RC 3I63C 2RDBC 3RN9C 3RNBC 3Q3MC 3RNFC 3RNGC 4P1CC 1T0QC 3GE3C 3I5JC 3DHGC 3RNEC 3N1YC 4P1BC 3RNCC 3Q14C 3N1XC 3Q3NC 1T0SC 3DHHC 3N20C 3DHIC 3GE8C 3Q3OC 2INCC 2INDC 3Q2AC 3N1ZC
chains in the Genus database with same CATH superfamily
3K9OB 4ACFA 1QOBA 2KQ4X 3NZSA 2FBWB 2IPKD 2KDMA 4W9KA 1FFVA 1ET9A 1JRUA 5H92C 2G4DB 5D6JB 3VRBB 3W1SC 2H88B 3SU8X 3H7SA 2BF8B 1D5ZC 1JCKB 4B9KA 3I9V1 4PYUA 3R7QA 4US8A 2BBCA 4ARCA 1WJUA 4A3OA 4WURA 1TS2A 3RUIB 1WGGA 2BKFA 2WYQA 4P1BC 1UELA 2BWES 4C7YA 4FLHA 5BYRA 3GS2A 4YSYB 3ZUNA 2KWUB 2KNBA 2LASA 3Q8BA 4NAMA 1OEYA 4FJZA 2KDFB 2IO0B 1LFDA 4O1NA 1JRPA 4MSQB 3AE5B 4J6IA 5BMHA 3HK0A 2ZNVC 3NS8A 1SJHD 1WX7A 3IT6B 4MH8A 2FE8A 2PLPA 3AN1A 4RNAA 1E90A 2ZVNA 4J3OD 3Q2AC 2L32A 1FRDA 3E9SA 3JSVB 1EU4A 4G50A 4MJSA 4YT0B 2AQ1B 3EFCA 5AZHA 4YWGG 1FFUA 1AYFA 2M56B 3ZNZB 5JHAA 3APFA 3ML9A 2DHZA 3V62A 5CHWA 2KAJA 1ZPSA 4GDLB 1N6ZA 2R2OA 2VZKB 1L0XB 3RZFA 3CSFA 4F1SA 5DPRA 4W9CA 4JWSC 4P6VF 3GE3C 2KFJA 3Q3FA 3AEAB 3ABVB 2OEDA 3LDZE 4KKJA 3KYDD 2MBHA 4OVUA 1WGRA 2NBUA 1V2YA 2GI9A 1TGZB 1LO5D 5DCNA 4TQ0A 1FO4A 1BUIC 5FK9C 4ZHOA 2NS5A 1C77A 3PHWB 3KLSX 4KSLC 2KHWB 3RNGC 3V6CB 3AE7B 1FM0D 4FADA 1YOVB 4HDQA 2LGSA 5I4DA 1QZEA 4A6QA 2OJWA 2DZJA 3DHHC 3TEWA 1V8CA 2IZVB 3IAS1 4MH0E 2WU5B 2GBJA 3L10B 3IAM1 1ET6A 4W9GA 2L05A 2WQYB 4YSZB 3QWZB 3NVZA 1WWTA 3RFZB 4HJGE 3AI5A 3ONSA 4FHKA 1HZ5A 1WE6A 2LUMA 4GXBA 1S1QB 2UWQA 1UBIA 1E7VA 2V4IB 3J9CA 2G45B 2Y5CA 4DXAB 1Q10A 1XLQA 1J7BA 2KK8A 4DHJD 2J0KA 4NJ7A 1WM3A 1CZPA 1C4AA 4BBNC 1QILA 1IGCA 5G5HA 3VUXA 5HHDG 2W3RA 4G11A 2QHOA 2MH7A 2N7DA 1P3QU 2BTEA 3OWEB 2NBWB 4MACA 2RMMA 5DPWA 4ZYNA 3HVZA 1T3QA 1TYGB 4C80A 3P4QB 3R3MA 3SEBA 3MHSD 2D3BA 1WJ4A 3DVNU 4ZOHC 4HLEA 2K8BA 3P1MA 4DK5A 3L08A 3PLVA 3ZLZA 4HRSA 3P2BA 3M63B 2WDTB 5MPOA 1L6VA 4DHZB 2WX1A 4DWFA 5C2TB 1SIFA 1TZ1A 2GMIC 3BINA 2AQ2B 2RPVA 3OLMD 3TSSA 5D3IB 4ZRQA 3L54A 3N9YC 4KGSA 3WANA 1TTNA 2QCZA 1KF6B 1SBBB 2O6VD 2LI5A 1EWYC 2NCNA 2X8XX 1C9FA 2DX5B 1D5MC 2WXRA 1TY0A 3Q3NC 5AZGA 2IGHA 4ANWA 1FMAD 4RF0A 1I4XA 1P0RA 1UH6A 1WXAA 1XD3B 4ZRKA 3DVNV 2LGDA 2MRPA 3HM3A 1FRRA 1JWSD 2WXGA 4GN1A 2DZMA 2FCQA 1EWCA 1IGDA 1YX5B 3ECIA 1F77A 4DXGA 2WWZA 4N58A 1V6EA 4ZRPA 5LLIA 2KX3A 4FN2A 3VAWA 2GOWA 4B6WA 4PS3A 3AULA 1SE3A 3IG3A 2WXOA 1HE8A 5J17A 1L0YB 3BWUD 3FAHA 3NHEB 3OJ3A 4A8XC 5KHQA 1ZOYB 1VLBA 3UINB 1E10A 1E8ZA 3AEEB 2TSSA 3IFWB 4ANXA 5IP4D 1JMLA 2BYFA 2GLSA 2UYZB 4IM0A 4BFRA 3H7PB 1L2NA 1YNTE 2R61A 2NPTA 3X0WA 1YQ3B 1NYQA 2LJ5A 4EZLA 2JPHA 3H6NA 2WXQA 3UF8A 5AEKB 3NVWA 2BYVE 5FKAC 4BVUC 4NNJB 3ALBA 3LB8C 1QKZA 3VHTC 3RULA 3PT2B 3RNAC 2K6QA 3RMKC 2JU6X 4HDOA 4BAXA 3A4SC 1JROA 4GDKA 2N7EA 3RNCC 5DPSA 4KZ0A 4RMAA 4ARIA 4L2YA 2KACA 1WGKA 1QT9A 3DQVA 3DCGA 2JUOA 1PGBA 1PDXA 1LQBA 3NOBA 4W9FA 2X38A 4RM8A 2I1JA 1QF6A 2KVZA 3PGEA 1I42A 1C79A 4TMAB 1V49A 2I2YA 1PUTA 2KZRA 2OHFA 2W55A 1T0SC 2WGSA 2QC8A 2KT7A 3ZDMC 4RCOA 1DOIA 2MEKA 2HTME 2PE9A 5AUIA 2K8HA 3EA6A 3MJ5A 1UBQA 2EKEC 4JPSA 4HPPA 5EDSA 1C4CA 2L76A 1NEKB 3AM9A 1YN5A 4K7WA 1C78A 5HI1A 5BO4B 3VRAB 2KANA 1QOFA 1FCLA 1I4QA 4LJOB 5C1ZA 1Z2MA 2D11A 3APCA 3WAMA 1C4PA 1WY8A 1RFKA 1T6BX 2MWSB 3BYYB 2MSED 2MBOA 3MFGA 1VR9A 1P7EA 4WWNA 4WQMA 2QMTA 1WZ3A 1NENB 4XE0A 1FXIA 1ZXIA 3VFKA 4D2KA 2WXKA 1J19A 1WM2A 5TSSA 1D4BA 3GZNB 4HKZE 3O65B 4HVBA 3ZW3A 1TKEA 2PIAA 1MI0A 3ZTCA 4EFOA 3QCAA 3MP9A 2CR5A 2CJNA 2LGYA 2SAKA 1YN3A 2QIEB 1QQRA 3NS1A 3HIZA 4DQOC 3PLUA 1S3SG 1WX8A 2A4ZA 4N59A 2BS2B 3AEBB 5BYSA 1JQ4A 3L13A 2CU3A 3ZDTA 1B1ZA 2LXAA 2W54A 1Z5SB 3MC8A 1NI3A 2KJHB 3VUWA 2LWPA 3U8ZA 3ZJUA 1ZGUB 2YEPB 3PZ8A 3V61A 3I5JC 5T8IA 1RM6C 2PW9A 2HJ1A 1FCCC 2PVOD 4WIPA 1N60A 4HCPB 1V1PA 1SE9A 2KTRA 1FIQA 2G3QB 4FA6A 3Q8CA 3HVDA 3RN9C 2XN9C 4C4VA 2KX0A 1E7UA 4W9LA 4LLGM 4E74A 4DHZE 2NTTA 1TT5B 2DYOA 4HK2A 1WMHA 5AZFA 1E8XA 2ZEQA 4LNFA 2N9EB 1D6EC 3Q3OC 2N9LA 4EE2A 4IDIA 4MGZE 4HROA 4C00A 2LHDA 1WXSA 4LNIA 2K22A 3O13A 4IW0A 1E7PB 2MBEA 4W9EA 1T0QC 4GMVA 1I7HA 3TUOA 3V3XA 2WXIA 1RAXA 4MM3B 5IA7A 2KFKA 1A5RA 2CJOA 2ZJDA 2L0FA 3ZNID 2C7MB 3GP7A 4NJ6A 3S2AA 3AXCA 1E0ZA 3VQIA 1KM7A 1BMLC 3MTNB 5EE9A 4BBNF 2M1MA 2LRWA 1WGHA 2IO1B 2MQJA 1YJIA 3HM6X 3DHGC 1RFAA 2M19A 2IO2B 5G55A 1R4NB 3IT4B 3W1SA 4LNNA 1WGDA 2UU7A 3GE8C 2PJHA 4HXDA 3KUDB 4GSWA 2MLBA 1XO3A 4GU2A 1C1YB 3QJZA 1ENFA 1WX9A 3W5VB 2C7HA 2H89B 1WF9A 4II3B 2WDVB 2JZ3B 3ZXRA 1LXDA 3N32A 2N9XA 2BKRB 3KH0A 2MBQA 1FXAA 1QLBB 3FILA 2FCMA 3IVFA 1UGJA 1ZUD2 3VTVA 3GB1A 1STEA 1QOAA 1V97A 4GDKB 1AN8A 3PVLA 1P1AA 3QC8B 1HZ6A 3DWMA 3URYA 1DOXA 1OQRA 3IHPC 1JW9D 3L17A 1FNWA 2WXHA 4USAA 3AE4B 4IWPA 4WJPA 2FIFA 2DAFA 5HKHA 1TS3A 3PZDA 3BVZA 3AV8A 4BKSD 4A3PA 3R7RA 1D3ZA 1B9RA 1E8WA 3PTFC 2Y3AA 2IJ0A 1VD2A 2N0SB 3T9LA 4DHJB 1L6UA 2JRIB 3DVGX 3OJ4B 1U4AA 3P42A 2WXNA 2K5PA 3E56A 1FEHA 1I4RA 2KDEB 4W9HA 2MP2A 2EELA 4YTNB 1EUVB 2KC1A 2JXTA 3PO0A 4XYCA 1TJEA 4W9DA 2JWUA 1KJTA 1OQYA 1WXMA 4MELA 3V6EB 3MJWA 1I4HA 1RWSA 2J7QB 1XXGA 3R8BA 3KVFB 1VCBA 2M8SA 1HTQA 1WYGA 4FHJA 1HEZE 3JVZX 4S0RA 4WH4A 3EC8A 2YLMA 1G6JA 3BK2A 1YQBA 4HKQA 2B3AA 3VVWB 1K51A 2JQRB 2O2VB 4KIKA 3PHXB 4WWMA 2CHXA 3B2FA 5TR5A 3B9JA 3X23A 2RPQA 2V4LA 2QEJC 1C76A 2QILA 2LUEA 3HUIA 4PS8A 2WU2B 1V1OA 2WX0A 4A9AA 2JYEA 2NVUI 4KDIC 3HRDD 4HPLB 2BVCA 2CHZA 3M3JA 3TBLD 2N9PC 4N6EB 3UIPB 2O6VB 4YL8A 4HWIB 2WNMA 1ROEA 4KKIA 1KFYB 1ZXHA 2AWTA 1YX6B 4BOZB 3QHTA 4GIVA 2ZZPB 2C9WB 3AEFB 1UUPA 5L95C 1EF1A 3H9DA 1YN4A 1NVID 4JGHB 4C4VB 2BYTA 4NAWA 2KDIA 4I6LB 1GPXA 3H1UA 2KMMA 1UGMA 2ACZB 2PKOA 1WMHB 2M4NA 3A9KB 5J2RA 3VR9B 3ENEA 1ZKHA 4K1RB 5C3JB 1ESFA 1JALA 2ASQA 4ICVA 2KO3A 4KGRA 2GBMA 4BKTA 2INCC 2KN5A 4AWJA 2G1EA 3ML8A 4OZBA 2FUHB 1V5TA 4B0EA 4BOSC 4M0WA 4QAYA 3A9JA 3JYUA 3GOEA 1WGYA 1UWXA 5E6NA 1I4PA 3B08A 1YJJA 2WXJA 2ONQA 2AL6A 2VRRB 3OAWA 4CO7A 5E6JA 4K7UA 2J4XA 3TEXA 5AUKA 4OZCA 3MHZA 1JWAD 1BXTA 1V80A 2HDEA 4X57B 1GG3A 1Q0WB 5IAAC 2GBNA 1NBFC 5D7GA 5G5GA 2V3NA 1R4MB 1XLPA 1F9JA 1QOGA 1SE4A 3MC0B 2Z59B 4II2B 2JRHA 2IYDB 1H8CA 1E8YA 2PPHA 3AE1B 3BZDB 3RNFC 3FILB 3WCQA 2D10A 2RGFA 1UD7A 2XBBC 2WDQB 3W1YA 2AEHA 4US9A 1E6EB 2INDC 2WXFA 3P4PB 3N1ZC 1ZDVA 4MJSB 1K8RB 3CF6E 3AB5A 1HQRD 3KW5B 5JHBA 4H2AA 1C3TA 1MG8A 4IWOA 4MGYE 5EE3A 2MX2A 4EZKA 3C19A 4AJWA 4BKSA 4K81A 3ZJVA 4XX5A 1F1HA 4IM3A 3QK0A 4C7ZA 3TCAA 4NY0A 1SSNA 1J0GA 1R4NI 4WJOA 1SXTA 3EGRA 4PS7A 2K0PA 2M0AA 5IOIA 2KJRA 2MHJA 4NPNA 1TKGA 4A55A 1IP9A 4KGTA 3PRPB 2RDHA 2V0GA 2N1VA 2KWVB 5IO9A 1CJEA 3AECB 4IOIE 3DOWA 3B1LX 3JSVA 4EZJA 1EO6A 1VZ6A 4KDLB 2AQ3B 5J18A 1WR6E 3SFEB 2JWZA 2DNFA 2MJEA 1SIJA 2AX5A 4OVZA 1V9JA 1WR1A 4ICUA 3RT3B 1WXQA 2ZPNA 5EE1A 3EECA 1OFFA 5JH5C 5D2MB 3DBLB 1MJDA 5JXVA 2RR9A 3DBHB 2IY1B 4L1BA 2R2QA 2KKCA 4XDCA 2NBVB 3SR6A 4MGIE 1N63A 5DPTA 3N1XC 2M17A 4LDTD 4OHJA 4CHKA 4LK0M 5GMVA 1VJKA 3KUCB 4BKGA 3VR8B 3M95A 1L5PA 2KTFA 4RFBA 1CMXB 1Y56A 2AYOB 3WA0A 4P1CC 1AARA 2J42A 3R2TA 2K8CA 1FXTB 3AU4A 1MPEA 3PREA 2ZW0A 3T8MA 3AMZA 1XF5L 2VH1A 3NRZA 1RLFA 4ZDVA 2J0JA 2V3PA 3JW0X 4XZ4A 4K7SA 1MG4A 2VH2A 3U4EG 5FR3A 2LJIA 3I57A 3DBSA 3B0AA 5LNK1 4RF1A 2WXLA 3MC9A 3V05A 1RRBA 2HTHA 3P63A 2SEBD 5CTRC 1HXYD 3Q6BA 1IYFA 3QA8A 4FJVB 4GGQA 4F8CB 3U7DA 4HEA1 4EUTA 4GB9A 3VXWA 1WH3A 4C56C 4AQ7A 3AE8B 2RDGA 1FNUA 2G9HD 2Y5BB 2CU1A 1WJ6A 3IXSA 1N5WA 4M8MA 4AP4C 3NUHB 2ZW1A 1EF5A 3ZQ4A 1KLVA 3A9JB 2DZKA 1LM8B 5FR6A 3NVVA 1TZOA 3NJTA 3A4RA 3QARA 1M4VA 1J7CA 2LXCA 1WXVA 2DAJA 1KLGD 3LXFA 3Q14C 5CX3A 3AH7A 3VTWA 1WRIA 4BZAA 4TUUA 3UI3A 2REXA 4JX1C 2NR2A 4ANUA 1F0ZA 1FNVA 1DGJA 3KWVA 3RI7C 3RD2A 3L4PA 3DVGY 3QAQA 4NJCA 1XLOA 4ZRJA 2M0XA 2INPE 1ISNA 4NQKE 1FD6A 1NI2A 2WXPA 1AW7A 3P4RB 3PRMB 1SE2A 1IPGA 4YTMB 2C7NB 4RH6A 1VZ7A 1XEEA 1J7AA 5HG2A 3OG5A 3BYTB 4TKNA 3AEDB 4NZLB 4B0MA 2EMSA 4N9F4 1V86A 2KVRA 2W9NA 2HJ8A 2HE7A 2KQ7A 1YMHE 1T5XD 1PFDA 3WAPA 2BGFA 4M8NA 1TKYA 3TJPA 1WE7A 3BY4B 2ZPYA 3L16A 2OJRA 4AUQC 2IO3B 2XK5A 2JY6A 2NPTB 4CYEA 1EU3A 5LXHA 4R3DA 2JVCA 4OZAA 1YJ1A 5KHOA 4XC2A 4GLSC 1GNUA 5GXGB 3N30A 5BMIA 4WAFA 5L83A 4RGOS 1T0YA 3VTUA 2W82A 2MJ3A 2WP9B 2IGGA 4ANVA 1WFYA 2Z8LA 1T0RC 3KQ4A 3PSEB 2CS4A 3TIXA 2KDBA 2LFIA 2YEPF 3A1QA 1LGRA 1R4MI 4KSKC 4YSXB 4PK1A 2PEAA 4YXDB 2BS3B 5CHVC 1UF0A 1NDDA 5EE0A 4KVGB 4DXFA 1GB4A 2D3GA 2LVOA 2QDFA 3PPAA 3H7PA 2L3ZA 4JE3B 3BVGA 2KOXA 4WAAA 3KUZA 4PT5A 2BQQA 2QJLA 1IUEA 1WSPA 3CSTA 3I3TB 4E71A 5IKCM 1IBXA 2K9XA 1N62A 2FIDA 4XDDA 5HFYA 3ZNGC 1TIFA 1TY2A 2KYWA 4OW0A 2L00B 3VUYA 3U2SC 2K25A 3UGBB 3FC4A 1VDVA 4WWOA 3VDZA 3Q3JA 3ZNHB 2KD0A 1P7FA 3RCZA 4E3CA 1R7SA 1ZE3D 1XLNA 4TSSA 1FPYA 4L23A 2BB6A 1M94A 5D3DA 2LGXA 5BYQA 3U52E 1Q1OA 3N3KB 2JZZA 4PYZA 3W5UB 2KMCA 3UQBA 3SFDB 3Q8AA 4M01A 4DDID 2CKHB 4M02A 1N5XA 3ZO5B 1NYRA 2K39A 1MFWA 4KV2A 5JZEB 2FUG1 3A33B 4F7ZA 1YD8U 3R66C 3Q8FA 1L0VB 1E9MA 1X1MA 4RGMA 1JWBD 1UWMA 2YVCA 3UQAA 2E6XA 1OTRB 3AE9B 3NG0A 3DBRB 3W2DA 4AOFA 3PRZA 2BPSA 4XWWA 1PGAA 3RNBC 2VZKD 2LVPA 2J53A 2ZCBA 4ZHPA 2KWCA 2KLCA 4EEWA 5LXIB 1Q5WB 2BT6A 1UNSA 1ZW7A 3N20C 4UDUC 4DBGA 3VH3B 1ZP0B 2KC2A 2BYEA 4RM9A 2PTLA 2WS3B 3DBLI 5C23A 4RGTA 2D3AA 1CQVA 4YTPB 1MHXA 3DBHI 1DOYA 4TQ1A 3RZWC 2FAZA 1PGXA 1WJNA 2GB1A 3PS6A 1N61A 1EM7A 4MSMB 1GJZA 2LVQA 3ZYYX 5E6OA 2A5UA 3DWGC 1V1PB 2NMQA 2WHIA 2KTRB 2KQSA 4EKUA 1KTKA 5BMGA 4LNKA 1P9DU 2KWDA 3GZNI 2Y5PA 3KYCD 3APDA 2L83A 3N1YC 1A70A 1F52A 3ZTDA 2KN4A 3NVYA 2J0MA 4IKGA 3H8HA 1JWMD 4IM2A 4EOYA 2V9HA 2BS4B 3WAOA 1ZDXA 4IG7B 3ZXVA 2ZVOA 2E3TA 1SF0A 3RPFC 2LHEA 4ITKA 2JX5A 3T3NA 3RNEC 2KFKB 3DHIC 3WALA 3CMMB 2LRUA 2JYTA 1JWUD 2D07B 2JZPA 2CHWA 2Q5WD 1L4DB 1PQSA 2NTSA 4A90A 4FXCA 5CHFA 2G4SA 2K3UA 3AU5A 4XGAB 2RSUA 2EKIA 2ICIA 3ZGZA 3ZRFA 3LYYA 2XK5B 4I6PA 2MA9B 1KOTA 2GBKA 2ZCCA 4LNOA 1YIWA 4LCDE 4URKA 3TMPB 1GC6A 4NQLB 4WJQA 3LJ3A 2WDRB 1XT9B 5IN7A 4S17A 2KXJA 3I63C 4LTUA 1TBEA 2RDBC 2HD5B 3HHMA 2N1WA 3FKYA 3QX1A 2L0TA 4A20A 2AL3A 4MM3A 3Q69A 1GUAB 2D3CA 1AWDA 2K6DB 4RGNA 2QSDA 3ZIMA 2JXXA 1Y8RC 1I4GA 3A1QB 3VH4B 4REZA 1KLUD 2L52A 3BVMA 2ZNVB 4WQOB 1SGHA 4FJYA 2KMAA 3AE3B 5E6PA 4JL9A 2DENB 4FULA 2DWQA 2D2QA 3P4SB 1UZXB 3QIJA 3ZKJC 4I6NB 1WZ0A 4ZRIA 4KX6B 4HCNB 1F2RC 2Z0DB 1V81A 3Q8EA 2MBBB 4MDKE 2DLBA 4ZYSA 1IBXB 1GOZA 4WJNA 3B2GA 1L7YA 2IDYA 2WLBA 3KWLA 4CQNA 4LDTB 3SD5A 1VRAB 1HA5A 3R2IA 3ETRA 2V3SA 3NZ3A 2J52A 1VZ8A 4GOCA 4JIOU 2ON8A 3RYTA 2MP2B 2PMVA 3EUB2 1RYJA 4G0NB 4OVVA 4B95A 2JT4B 3V60A 1TS5A 1F2RI 3PZ7A 2FNJB 3EFUA 4M00A 4W9JA 2PE6B 3C0RB 3EHVA 4XWTA 2B76B 2MJDA 1K52A 3AEGB 2WXMA 4P16A 2MCNB 4KZCA 1V5OA 2BW2A 2L8JA 3TEZA 2GRIA 1HTOA 2IY0B 3WIMA 4GDLA 2FCSA 3SHQA 1XCTL 1CK1A 2GBRA 4KIKB 3BIID 4K3BA 1MVKA 3U7ZA 3NY5A 4Q2JA 3L0WB 1OQQA 3UIOB 4HJKA 2KJ6A 2IGDA 3DDCB 1D5XC 2PVGC 4AJYB 2N9KA 3IBEA 3CIRB 1I35A 2C5LC 1L4ZB 2N7JA 4LJPB 2XEWA 3U30A 1GAQB 2LD9A 3CWIA 2Z0EB 2C60A 2DYMA 2I1KA 2D5GA 2L1AA 4ASWC 2BB5A 1E5WA 4HPMB 2KLGA 1OEYJ 2N4FA 1K53A 1J8CA 2EMTA 2JF5A 2DYBA 4P7IA 1K50A 3BK1A 1H4RA 1MHHE 1KRHA 2L7RA 4WWPA 3ZVVA 3AE6B 1KH0A 3D32A 2IBIB 1WI0A 3DPDA 4G3XB 4NAWB 2O2VA 2I38A 3SDLC 1WRDB 3TEYA 1ACCA 3Q3MC 2JSVX 3TL5A 4W9IA 4AS1A 5H8YE 1XCQL 4IWQA 2DBYA 3AE2B 5G2NA 3DBRI 3ZJTA 1WYWB 2K1FA 4M0WB 3PV1A 3K9PB 2OOBB 2W3SA 4JWUC 3NZUA 4IUMB 2INNE 5D94A 4MEMA 1BT0A 2O6VA 4JQWC 2LZ6A 3QQ8B 3T3OA 4JLCA 1YQ4B 2LEKA 3C8YA 1XQQA 1SEBD 3ZRCA 4DDGD 1DYQA 1OGWA 1TS4A 2DZIA 2MW5A 2LMCA 4TV3A 2LGIA 4K3CA 2XNAC 3W9CB 2RD0A 1P98A 4FBJB 4MT5A 2V1YA 1GC7A 2FCNA 1SB3C 1SJED 1GB1A 4MGKE 2BWFA 3A9KA 4IC7B 3M62B 1PYWD 1WIAA
chains in the Genus database with same CATH topology
3RI7C 3RNAC 3RMKC 1T0RC 3I63C 2RDBC 3RN9C 3RNBC 3Q3MC 3RNFC 3RNGC 4P1CC 1T0QC 3GE3C 3I5JC 3DHGC 3RNEC 3N1YC 4P1BC 3RNCC 3Q14C 3N1XC 3Q3NC 1T0SC 3DHHC 3N20C 3DHIC 3GE8C 3Q3OC 2INCC 2INDC 3Q2AC 3N1ZC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RI7 C;  3RNA C;  3RMK C;  1T0R C;  3I63 C;  2RDB C;  3RN9 C;  3RNB C;  3Q3M C;  3RNF C;  3RNG C;  4P1C C;  1T0Q C;  3GE3 C;  3I5J C;  3DHG C;  3RNE C;  3N1Y C;  4P1B C;  3RNC C;  3Q14 C;  3N1X C;  3Q3N C;  1T0S C;  3DHH C;  3N20 C;  3DHI C;  3GE8 C;  3Q3O C;  2INC C;  2IND C;  3Q2A C;  3N1Z C; 
#chains in the Genus database with same CATH topology
 3K9O B;  4ACF A;  1QOB A;  2KQ4 X;  3NZS A;  2FBW B;  2IPK D;  2KDM A;  4W9K A;  1FFV A;  1ET9 A;  1JRU A;  5H92 C;  2G4D B;  5D6J B;  3VRB B;  3W1S C;  2H88 B;  3SU8 X;  3H7S A;  2BF8 B;  1D5Z C;  1JCK B;  4B9K A;  3I9V 1;  4PYU A;  3R7Q A;  4US8 A;  2BBC A;  4ARC A;  1WJU A;  4A3O A;  4WUR A;  1TS2 A;  3RUI B;  1WGG A;  2BKF A;  2WYQ A;  4P1B C;  1UEL A;  2BWE S;  4C7Y A;  4FLH A;  5BYR A;  3GS2 A;  4YSY B;  3ZUN A;  2KWU B;  2KNB A;  2LAS A;  3Q8B A;  4NAM A;  1OEY A;  4FJZ A;  2KDF B;  2IO0 B;  1LFD A;  4O1N A;  1JRP A;  4MSQ B;  3AE5 B;  4J6I A;  5BMH A;  3HK0 A;  2ZNV C;  3NS8 A;  1SJH D;  1WX7 A;  3IT6 B;  4MH8 A;  2FE8 A;  2PLP A;  3AN1 A;  4RNA A;  1E90 A;  2ZVN A;  4J3O D;  3Q2A C;  2L32 A;  1FRD A;  3E9S A;  3JSV B;  1EU4 A;  4G50 A;  4MJS A;  4YT0 B;  2AQ1 B;  3EFC A;  5AZH A;  4YWG G;  1FFU A;  1AYF A;  2M56 B;  3ZNZ B;  5JHA A;  3APF A;  3ML9 A;  2DHZ A;  3V62 A;  5CHW A;  2KAJ A;  1ZPS A;  4GDL B;  1N6Z A;  2R2O A;  2VZK B;  1L0X B;  3RZF A;  3CSF A;  4F1S A;  5DPR A;  4W9C A;  4JWS C;  4P6V F;  3GE3 C;  2KFJ A;  3Q3F A;  3AEA B;  3ABV B;  2OED A;  3LDZ E;  4KKJ A;  3KYD D;  2MBH A;  4OVU A;  1WGR A;  2NBU A;  1V2Y A;  2GI9 A;  1TGZ B;  1LO5 D;  5DCN A;  4TQ0 A;  1FO4 A;  1BUI C;  5FK9 C;  4ZHO A;  2NS5 A;  1C77 A;  3PHW B;  3KLS X;  4KSL C;  2KHW B;  3RNG C;  3V6C B;  3AE7 B;  1FM0 D;  4FAD A;  1YOV B;  4HDQ A;  2LGS A;  5I4D A;  1QZE A;  4A6Q A;  2OJW A;  2DZJ A;  3DHH C;  3TEW A;  1V8C A;  2IZV B;  3IAS 1;  4MH0 E;  2WU5 B;  2GBJ A;  3L10 B;  3IAM 1;  1ET6 A;  4W9G A;  2L05 A;  2WQY B;  4YSZ B;  3QWZ B;  3NVZ A;  1WWT A;  3RFZ B;  4HJG E;  3AI5 A;  3ONS A;  4FHK A;  1HZ5 A;  1WE6 A;  2LUM A;  4GXB A;  1S1Q B;  2UWQ A;  1UBI A;  1E7V A;  2V4I B;  3J9C A;  2G45 B;  2Y5C A;  4DXA B;  1Q10 A;  1XLQ A;  1J7B A;  2KK8 A;  4DHJ D;  2J0K A;  4NJ7 A;  1WM3 A;  1CZP A;  1C4A A;  4BBN C;  1QIL A;  1IGC A;  5G5H A;  3VUX A;  5HHD G;  2W3R A;  4G11 A;  2QHO A;  2MH7 A;  2N7D A;  1P3Q U;  2BTE A;  3OWE B;  2NBW B;  4MAC A;  2RMM A;  5DPW A;  4ZYN A;  3HVZ A;  1T3Q A;  1TYG B;  4C80 A;  3P4Q B;  3R3M A;  3SEB A;  3MHS D;  2D3B A;  1WJ4 A;  3DVN U;  4ZOH C;  4HLE A;  2K8B A;  3P1M A;  4DK5 A;  3L08 A;  3PLV A;  3ZLZ A;  4HRS A;  3P2B A;  3M63 B;  2WDT B;  5MPO A;  1L6V A;  4DHZ B;  2WX1 A;  4DWF A;  5C2T B;  1SIF A;  1TZ1 A;  2GMI C;  3BIN A;  2AQ2 B;  2RPV A;  3OLM D;  3TSS A;  5D3I B;  4ZRQ A;  3L54 A;  3N9Y C;  4KGS A;  3WAN A;  1TTN A;  2QCZ A;  1KF6 B;  1SBB B;  2O6V D;  2LI5 A;  1EWY C;  2NCN A;  2X8X X;  1C9F A;  2DX5 B;  1D5M C;  2WXR A;  1TY0 A;  3Q3N C;  5AZG A;  2IGH A;  4ANW A;  1FMA D;  4RF0 A;  1I4X A;  1P0R A;  1UH6 A;  1WXA A;  1XD3 B;  4ZRK A;  3DVN V;  2LGD A;  2MRP A;  3HM3 A;  1FRR A;  1JWS D;  2WXG A;  4GN1 A;  2DZM A;  2FCQ A;  1EWC A;  1IGD A;  1YX5 B;  3ECI A;  1F77 A;  4DXG A;  2WWZ A;  4N58 A;  1V6E A;  4ZRP A;  5LLI A;  2KX3 A;  4FN2 A;  3VAW A;  2GOW A;  4B6W A;  4PS3 A;  3AUL A;  1SE3 A;  3IG3 A;  2WXO A;  1HE8 A;  5J17 A;  1L0Y B;  3BWU D;  3FAH A;  3NHE B;  3OJ3 A;  4A8X C;  5KHQ A;  1ZOY B;  1VLB A;  3UIN B;  1E10 A;  1E8Z A;  3AEE B;  2TSS A;  3IFW B;  4ANX A;  5IP4 D;  1JML A;  2BYF A;  2GLS A;  2UYZ B;  4IM0 A;  4BFR A;  3H7P B;  1L2N A;  1YNT E;  2R61 A;  2NPT A;  3X0W A;  1YQ3 B;  1NYQ A;  2LJ5 A;  4EZL A;  2JPH A;  3H6N A;  2WXQ A;  3UF8 A;  5AEK B;  3NVW A;  2BYV E;  5FKA C;  4BVU C;  4NNJ B;  3ALB A;  3LB8 C;  1QKZ A;  3VHT C;  3RUL A;  3PT2 B;  3RNA C;  2K6Q A;  3RMK C;  2JU6 X;  4HDO A;  4BAX A;  3A4S C;  1JRO A;  4GDK A;  2N7E A;  3RNC C;  5DPS A;  4KZ0 A;  4RMA A;  4ARI A;  4L2Y A;  2KAC A;  1WGK A;  1QT9 A;  3DQV A;  3DCG A;  2JUO A;  1PGB A;  1PDX A;  1LQB A;  3NOB A;  4W9F A;  2X38 A;  4RM8 A;  2I1J A;  1QF6 A;  2KVZ A;  3PGE A;  1I42 A;  1C79 A;  4TMA B;  1V49 A;  2I2Y A;  1PUT A;  2KZR A;  2OHF A;  2W55 A;  1T0S C;  2WGS A;  2QC8 A;  2KT7 A;  3ZDM C;  4RCO A;  1DOI A;  2MEK A;  2HTM E;  2PE9 A;  5AUI A;  2K8H A;  3EA6 A;  3MJ5 A;  1UBQ A;  2EKE C;  4JPS A;  4HPP A;  5EDS A;  1C4C A;  2L76 A;  1NEK B;  3AM9 A;  1YN5 A;  4K7W A;  1C78 A;  5HI1 A;  5BO4 B;  3VRA B;  2KAN A;  1QOF A;  1FCL A;  1I4Q A;  4LJO B;  5C1Z A;  1Z2M A;  2D11 A;  3APC A;  3WAM A;  1C4P A;  1WY8 A;  1RFK A;  1T6B X;  2MWS B;  3BYY B;  2MSE D;  2MBO A;  3MFG A;  1VR9 A;  1P7E A;  4WWN A;  4WQM A;  2QMT A;  1WZ3 A;  1NEN B;  4XE0 A;  1FXI A;  1ZXI A;  3VFK A;  4D2K A;  2WXK A;  1J19 A;  1WM2 A;  5TSS A;  1D4B A;  3GZN B;  4HKZ E;  3O65 B;  4HVB A;  3ZW3 A;  1TKE A;  2PIA A;  1MI0 A;  3ZTC A;  4EFO A;  3QCA A;  3MP9 A;  2CR5 A;  2CJN A;  2LGY A;  2SAK A;  1YN3 A;  2QIE B;  1QQR A;  3NS1 A;  3HIZ A;  4DQO C;  3PLU A;  1S3S G;  1WX8 A;  2A4Z A;  4N59 A;  2BS2 B;  3AEB B;  5BYS A;  1JQ4 A;  3L13 A;  2CU3 A;  3ZDT A;  1B1Z A;  2LXA A;  2W54 A;  1Z5S B;  3MC8 A;  1NI3 A;  2KJH B;  3VUW A;  2LWP A;  3U8Z A;  3ZJU A;  1ZGU B;  2YEP B;  3PZ8 A;  3V61 A;  3I5J C;  5T8I A;  1RM6 C;  2PW9 A;  2HJ1 A;  1FCC C;  2PVO D;  4WIP A;  1N60 A;  4HCP B;  1V1P A;  1SE9 A;  2KTR A;  1FIQ A;  2G3Q B;  4FA6 A;  3Q8C A;  3HVD A;  3RN9 C;  2XN9 C;  4C4V A;  2KX0 A;  1E7U A;  4W9L A;  4LLG M;  4E74 A;  4DHZ E;  2NTT A;  1TT5 B;  2DYO A;  4HK2 A;  1WMH A;  5AZF A;  1E8X A;  2ZEQ A;  4LNF A;  2N9E B;  1D6E C;  3Q3O C;  2N9L A;  4EE2 A;  4IDI A;  4MGZ E;  4HRO A;  4C00 A;  2LHD A;  1WXS A;  4LNI A;  2K22 A;  3O13 A;  4IW0 A;  1E7P B;  2MBE A;  4W9E A;  1T0Q C;  4GMV A;  1I7H A;  3TUO A;  3V3X A;  2WXI A;  1RAX A;  4MM3 B;  5IA7 A;  2KFK A;  1A5R A;  2CJO A;  2ZJD A;  2L0F A;  3ZNI D;  2C7M B;  3GP7 A;  4NJ6 A;  3S2A A;  3AXC A;  1E0Z A;  3VQI A;  1KM7 A;  1BML C;  3MTN B;  5EE9 A;  4BBN F;  2M1M A;  2LRW A;  1WGH A;  2IO1 B;  2MQJ A;  1YJI A;  3HM6 X;  3DHG C;  1RFA A;  2M19 A;  2IO2 B;  5G55 A;  1R4N B;  3IT4 B;  3W1S A;  4LNN A;  1WGD A;  2UU7 A;  3GE8 C;  2PJH A;  4HXD A;  3KUD B;  4GSW A;  2MLB A;  1XO3 A;  4GU2 A;  1C1Y B;  3QJZ A;  1ENF A;  1WX9 A;  3W5V B;  2C7H A;  2H89 B;  1WF9 A;  4II3 B;  2WDV B;  2JZ3 B;  3ZXR A;  1LXD A;  3N32 A;  2N9X A;  2BKR B;  3KH0 A;  2MBQ A;  1FXA A;  1QLB B;  3FIL A;  2FCM A;  3IVF A;  1UGJ A;  1ZUD 2;  3VTV A;  3GB1 A;  1STE A;  1QOA A;  1V97 A;  4GDK B;  1AN8 A;  3PVL A;  1P1A A;  3QC8 B;  1HZ6 A;  3DWM A;  3URY A;  1DOX A;  1OQR A;  3IHP C;  1JW9 D;  3L17 A;  1FNW A;  2WXH A;  4USA A;  3AE4 B;  4IWP A;  4WJP A;  2FIF A;  2DAF A;  5HKH A;  1TS3 A;  3PZD A;  3BVZ A;  3AV8 A;  4BKS D;  4A3P A;  3R7R A;  1D3Z A;  1B9R A;  1E8W A;  3PTF C;  2Y3A A;  2IJ0 A;  1VD2 A;  2N0S B;  3T9L A;  4DHJ B;  1L6U A;  2JRI B;  3DVG X;  3OJ4 B;  1U4A A;  3P42 A;  2WXN A;  2K5P A;  3E56 A;  1FEH A;  1I4R A;  2KDE B;  4W9H A;  2MP2 A;  2EEL A;  4YTN B;  1EUV B;  2KC1 A;  2JXT A;  3PO0 A;  4XYC A;  1TJE A;  4W9D A;  2JWU A;  1KJT A;  1OQY A;  1WXM A;  4MEL A;  3V6E B;  3MJW A;  1I4H A;  1RWS A;  2J7Q B;  1XXG A;  3R8B A;  3KVF B;  1VCB A;  2M8S A;  1HTQ A;  1WYG A;  4FHJ A;  1HEZ E;  3JVZ X;  4S0R A;  4WH4 A;  3EC8 A;  2YLM A;  1G6J A;  3BK2 A;  1YQB A;  4HKQ A;  2B3A A;  3VVW B;  1K51 A;  2JQR B;  2O2V B;  4KIK A;  3PHX B;  4WWM A;  2CHX A;  3B2F A;  5TR5 A;  3B9J A;  3X23 A;  2RPQ A;  2V4L A;  2QEJ C;  1C76 A;  2QIL A;  2LUE A;  3HUI A;  4PS8 A;  2WU2 B;  1V1O A;  2WX0 A;  4A9A A;  2JYE A;  2NVU I;  4KDI C;  3HRD D;  4HPL B;  2BVC A;  2CHZ A;  3M3J A;  3TBL D;  2N9P C;  4N6E B;  3UIP B;  2O6V B;  4YL8 A;  4HWI B;  2WNM A;  1ROE A;  4KKI A;  1KFY B;  1ZXH A;  2AWT A;  1YX6 B;  4BOZ B;  3QHT A;  4GIV A;  2ZZP B;  2C9W B;  3AEF B;  1UUP A;  5L95 C;  1EF1 A;  3H9D A;  1YN4 A;  1NVI D;  4JGH B;  4C4V B;  2BYT A;  4NAW A;  2KDI A;  4I6L B;  1GPX A;  3H1U A;  2KMM A;  1UGM A;  2ACZ B;  2PKO A;  1WMH B;  2M4N A;  3A9K B;  5J2R A;  3VR9 B;  3ENE A;  1ZKH A;  4K1R B;  5C3J B;  1ESF A;  1JAL A;  2ASQ A;  4ICV A;  2KO3 A;  4KGR A;  2GBM A;  4BKT A;  2INC C;  2KN5 A;  4AWJ A;  2G1E A;  3ML8 A;  4OZB A;  2FUH B;  1V5T A;  4B0E A;  4BOS C;  4M0W A;  4QAY A;  3A9J A;  3JYU A;  3GOE A;  1WGY A;  1UWX A;  5E6N A;  1I4P A;  3B08 A;  1YJJ A;  2WXJ A;  2ONQ A;  2AL6 A;  2VRR B;  3OAW A;  4CO7 A;  5E6J A;  4K7U A;  2J4X A;  3TEX A;  5AUK A;  4OZC A;  3MHZ A;  1JWA D;  1BXT A;  1V80 A;  2HDE A;  4X57 B;  1GG3 A;  1Q0W B;  5IAA C;  2GBN A;  1NBF C;  5D7G A;  5G5G A;  2V3N A;  1R4M B;  1XLP A;  1F9J A;  1QOG A;  1SE4 A;  3MC0 B;  2Z59 B;  4II2 B;  2JRH A;  2IYD B;  1H8C A;  1E8Y A;  2PPH A;  3AE1 B;  3BZD B;  3RNF C;  3FIL B;  3WCQ A;  2D10 A;  2RGF A;  1UD7 A;  2XBB C;  2WDQ B;  3W1Y A;  2AEH A;  4US9 A;  1E6E B;  2IND C;  2WXF A;  3P4P B;  3N1Z C;  1ZDV A;  4MJS B;  1K8R B;  3CF6 E;  3AB5 A;  1HQR D;  3KW5 B;  5JHB A;  4H2A A;  1C3T A;  1MG8 A;  4IWO A;  4MGY E;  5EE3 A;  2MX2 A;  4EZK A;  3C19 A;  4AJW A;  4BKS A;  4K81 A;  3ZJV A;  4XX5 A;  1F1H A;  4IM3 A;  3QK0 A;  4C7Z A;  3TCA A;  4NY0 A;  1SSN A;  1J0G A;  1R4N I;  4WJO A;  1SXT A;  3EGR A;  4PS7 A;  2K0P A;  2M0A A;  5IOI A;  2KJR A;  2MHJ A;  4NPN A;  1TKG A;  4A55 A;  1IP9 A;  4KGT A;  3PRP B;  2RDH A;  2V0G A;  2N1V A;  2KWV B;  5IO9 A;  1CJE A;  3AEC B;  4IOI E;  3DOW A;  3B1L X;  3JSV A;  4EZJ A;  1EO6 A;  1VZ6 A;  4KDL B;  2AQ3 B;  5J18 A;  1WR6 E;  3SFE B;  2JWZ A;  2DNF A;  2MJE A;  1SIJ A;  2AX5 A;  4OVZ A;  1V9J A;  1WR1 A;  4ICU A;  3RT3 B;  1WXQ A;  2ZPN A;  5EE1 A;  3EEC A;  1OFF A;  5JH5 C;  5D2M B;  3DBL B;  1MJD A;  5JXV A;  2RR9 A;  3DBH B;  2IY1 B;  4L1B A;  2R2Q A;  2KKC A;  4XDC A;  2NBV B;  3SR6 A;  4MGI E;  1N63 A;  5DPT A;  3N1X C;  2M17 A;  4LDT D;  4OHJ A;  4CHK A;  4LK0 M;  5GMV A;  1VJK A;  3KUC B;  4BKG A;  3VR8 B;  3M95 A;  1L5P A;  2KTF A;  4RFB A;  1CMX B;  1Y56 A;  2AYO B;  3WA0 A;  4P1C C;  1AAR A;  2J42 A;  3R2T A;  2K8C A;  1FXT B;  3AU4 A;  1MPE A;  3PRE A;  2ZW0 A;  3T8M A;  3AMZ A;  1XF5 L;  2VH1 A;  3NRZ A;  1RLF A;  4ZDV A;  2J0J A;  2V3P A;  3JW0 X;  4XZ4 A;  4K7S A;  1MG4 A;  2VH2 A;  3U4E G;  5FR3 A;  2LJI A;  3I57 A;  3DBS A;  3B0A A;  5LNK 1;  4RF1 A;  2WXL A;  3MC9 A;  3V05 A;  1RRB A;  2HTH A;  3P63 A;  2SEB D;  5CTR C;  1HXY D;  3Q6B A;  1IYF A;  3QA8 A;  4FJV B;  4GGQ A;  4F8C B;  3U7D A;  4HEA 1;  4EUT A;  4GB9 A;  3VXW A;  1WH3 A;  4C56 C;  4AQ7 A;  3AE8 B;  2RDG A;  1FNU A;  2G9H D;  2Y5B B;  2CU1 A;  1WJ6 A;  3IXS A;  1N5W A;  4M8M A;  4AP4 C;  3NUH B;  2ZW1 A;  1EF5 A;  3ZQ4 A;  1KLV A;  3A9J B;  2DZK A;  1LM8 B;  5FR6 A;  3NVV A;  1TZO A;  3NJT A;  3A4R A;  3QAR A;  1M4V A;  1J7C A;  2LXC A;  1WXV A;  2DAJ A;  1KLG D;  3LXF A;  3Q14 C;  5CX3 A;  3AH7 A;  3VTW A;  1WRI A;  4BZA A;  4TUU A;  3UI3 A;  2REX A;  4JX1 C;  2NR2 A;  4ANU A;  1F0Z A;  1FNV A;  1DGJ A;  3KWV A;  3RI7 C;  3RD2 A;  3L4P A;  3DVG Y;  3QAQ A;  4NJC A;  1XLO A;  4ZRJ A;  2M0X A;  2INP E;  1ISN A;  4NQK E;  1FD6 A;  1NI2 A;  2WXP A;  1AW7 A;  3P4R B;  3PRM B;  1SE2 A;  1IPG A;  4YTM B;  2C7N B;  4RH6 A;  1VZ7 A;  1XEE A;  1J7A A;  5HG2 A;  3OG5 A;  3BYT B;  4TKN A;  3AED B;  4NZL B;  4B0M A;  2EMS A;  4N9F 4;  1V86 A;  2KVR A;  2W9N A;  2HJ8 A;  2HE7 A;  2KQ7 A;  1YMH E;  1T5X D;  1PFD A;  3WAP A;  2BGF A;  4M8N A;  1TKY A;  3TJP A;  1WE7 A;  3BY4 B;  2ZPY A;  3L16 A;  2OJR A;  4AUQ C;  2IO3 B;  2XK5 A;  2JY6 A;  2NPT B;  4CYE A;  1EU3 A;  5LXH A;  4R3D A;  2JVC A;  4OZA A;  1YJ1 A;  5KHO A;  4XC2 A;  4GLS C;  1GNU A;  5GXG B;  3N30 A;  5BMI A;  4WAF A;  5L83 A;  4RGO S;  1T0Y A;  3VTU A;  2W82 A;  2MJ3 A;  2WP9 B;  2IGG A;  4ANV A;  1WFY A;  2Z8L A;  1T0R C;  3KQ4 A;  3PSE B;  2CS4 A;  3TIX A;  2KDB A;  2LFI A;  2YEP F;  3A1Q A;  1LGR A;  1R4M I;  4KSK C;  4YSX B;  4PK1 A;  2PEA A;  4YXD B;  2BS3 B;  5CHV C;  1UF0 A;  1NDD A;  5EE0 A;  4KVG B;  4DXF A;  1GB4 A;  2D3G A;  2LVO A;  2QDF A;  3PPA A;  3H7P A;  2L3Z A;  4JE3 B;  3BVG A;  2KOX A;  4WAA A;  3KUZ A;  4PT5 A;  2BQQ A;  2QJL A;  1IUE A;  1WSP A;  3CST A;  3I3T B;  4E71 A;  5IKC M;  1IBX A;  2K9X A;  1N62 A;  2FID A;  4XDD A;  5HFY A;  3ZNG C;  1TIF A;  1TY2 A;  2KYW A;  4OW0 A;  2L00 B;  3VUY A;  3U2S C;  2K25 A;  3UGB B;  3FC4 A;  1VDV A;  4WWO A;  3VDZ A;  3Q3J A;  3ZNH B;  2KD0 A;  1P7F A;  3RCZ A;  4E3C A;  1R7S A;  1ZE3 D;  1XLN A;  4TSS A;  1FPY A;  4L23 A;  2BB6 A;  1M94 A;  5D3D A;  2LGX A;  5BYQ A;  3U52 E;  1Q1O A;  3N3K B;  2JZZ A;  4PYZ A;  3W5U B;  2KMC A;  3UQB A;  3SFD B;  3Q8A A;  4M01 A;  4DDI D;  2CKH B;  4M02 A;  1N5X A;  3ZO5 B;  1NYR A;  2K39 A;  1MFW A;  4KV2 A;  5JZE B;  2FUG 1;  3A33 B;  4F7Z A;  1YD8 U;  3R66 C;  3Q8F A;  1L0V B;  1E9M A;  1X1M A;  4RGM A;  1JWB D;  1UWM A;  2YVC A;  3UQA A;  2E6X A;  1OTR B;  3AE9 B;  3NG0 A;  3DBR B;  3W2D A;  4AOF A;  3PRZ A;  2BPS A;  4XWW A;  1PGA A;  3RNB C;  2VZK D;  2LVP A;  2J53 A;  2ZCB A;  4ZHP A;  2KWC A;  2KLC A;  4EEW A;  5LXI B;  1Q5W B;  2BT6 A;  1UNS A;  1ZW7 A;  3N20 C;  4UDU C;  4DBG A;  3VH3 B;  1ZP0 B;  2KC2 A;  2BYE A;  4RM9 A;  2PTL A;  2WS3 B;  3DBL I;  5C23 A;  4RGT A;  2D3A A;  1CQV A;  4YTP B;  1MHX A;  3DBH I;  1DOY A;  4TQ1 A;  3RZW C;  2FAZ A;  1PGX A;  1WJN A;  2GB1 A;  3PS6 A;  1N61 A;  1EM7 A;  4MSM B;  1GJZ A;  2LVQ A;  3ZYY X;  5E6O A;  2A5U A;  3DWG C;  1V1P B;  2NMQ A;  2WHI A;  2KTR B;  2KQS A;  4EKU A;  1KTK A;  5BMG A;  4LNK A;  1P9D U;  2KWD A;  3GZN I;  2Y5P A;  3KYC D;  3APD A;  2L83 A;  3N1Y C;  1A70 A;  1F52 A;  3ZTD A;  2KN4 A;  3NVY A;  2J0M A;  4IKG A;  3H8H A;  1JWM D;  4IM2 A;  4EOY A;  2V9H A;  2BS4 B;  3WAO A;  1ZDX A;  4IG7 B;  3ZXV A;  2ZVO A;  2E3T A;  1SF0 A;  3RPF C;  2LHE A;  4ITK A;  2JX5 A;  3T3N A;  3RNE C;  2KFK B;  3DHI C;  3WAL A;  3CMM B;  2LRU A;  2JYT A;  1JWU D;  2D07 B;  2JZP A;  2CHW A;  2Q5W D;  1L4D B;  1PQS A;  2NTS A;  4A90 A;  4FXC A;  5CHF A;  2G4S A;  2K3U A;  3AU5 A;  4XGA B;  2RSU A;  2EKI A;  2ICI A;  3ZGZ A;  3ZRF A;  3LYY A;  2XK5 B;  4I6P A;  2MA9 B;  1KOT A;  2GBK A;  2ZCC A;  4LNO A;  1YIW A;  4LCD E;  4URK A;  3TMP B;  1GC6 A;  4NQL B;  4WJQ A;  3LJ3 A;  2WDR B;  1XT9 B;  5IN7 A;  4S17 A;  2KXJ A;  3I63 C;  4LTU A;  1TBE A;  2RDB C;  2HD5 B;  3HHM A;  2N1W A;  3FKY A;  3QX1 A;  2L0T A;  4A20 A;  2AL3 A;  4MM3 A;  3Q69 A;  1GUA B;  2D3C A;  1AWD A;  2K6D B;  4RGN A;  2QSD A;  3ZIM A;  2JXX A;  1Y8R C;  1I4G A;  3A1Q B;  3VH4 B;  4REZ A;  1KLU D;  2L52 A;  3BVM A;  2ZNV B;  4WQO B;  1SGH A;  4FJY A;  2KMA A;  3AE3 B;  5E6P A;  4JL9 A;  2DEN B;  4FUL A;  2DWQ A;  2D2Q A;  3P4S B;  1UZX B;  3QIJ A;  3ZKJ C;  4I6N B;  1WZ0 A;  4ZRI A;  4KX6 B;  4HCN B;  1F2R C;  2Z0D B;  1V81 A;  3Q8E A;  2MBB B;  4MDK E;  2DLB A;  4ZYS A;  1IBX B;  1GOZ A;  4WJN A;  3B2G A;  1L7Y A;  2IDY A;  2WLB A;  3KWL A;  4CQN A;  4LDT B;  3SD5 A;  1VRA B;  1HA5 A;  3R2I A;  3ETR A;  2V3S A;  3NZ3 A;  2J52 A;  1VZ8 A;  4GOC A;  4JIO U;  2ON8 A;  3RYT A;  2MP2 B;  2PMV A;  3EUB 2;  1RYJ A;  4G0N B;  4OVV A;  4B95 A;  2JT4 B;  3V60 A;  1TS5 A;  1F2R I;  3PZ7 A;  2FNJ B;  3EFU A;  4M00 A;  4W9J A;  2PE6 B;  3C0R B;  3EHV A;  4XWT A;  2B76 B;  2MJD A;  1K52 A;  3AEG B;  2WXM A;  4P16 A;  2MCN B;  4KZC A;  1V5O A;  2BW2 A;  2L8J A;  3TEZ A;  2GRI A;  1HTO A;  2IY0 B;  3WIM A;  4GDL A;  2FCS A;  3SHQ A;  1XCT L;  1CK1 A;  2GBR A;  4KIK B;  3BII D;  4K3B A;  1MVK A;  3U7Z A;  3NY5 A;  4Q2J A;  3L0W B;  1OQQ A;  3UIO B;  4HJK A;  2KJ6 A;  2IGD A;  3DDC B;  1D5X C;  2PVG C;  4AJY B;  2N9K A;  3IBE A;  3CIR B;  1I35 A;  2C5L C;  1L4Z B;  2N7J A;  4LJP B;  2XEW A;  3U30 A;  1GAQ B;  2LD9 A;  3CWI A;  2Z0E B;  2C60 A;  2DYM A;  2I1K A;  2D5G A;  2L1A A;  4ASW C;  2BB5 A;  1E5W A;  4HPM B;  2KLG A;  1OEY J;  2N4F A;  1K53 A;  1J8C A;  2EMT A;  2JF5 A;  2DYB A;  4P7I A;  1K50 A;  3BK1 A;  1H4R A;  1MHH E;  1KRH A;  2L7R A;  4WWP A;  3ZVV A;  3AE6 B;  1KH0 A;  3D32 A;  2IBI B;  1WI0 A;  3DPD A;  4G3X B;  4NAW B;  2O2V A;  2I38 A;  3SDL C;  1WRD B;  3TEY A;  1ACC A;  3Q3M C;  2JSV X;  3TL5 A;  4W9I A;  4AS1 A;  5H8Y E;  1XCQ L;  4IWQ A;  2DBY A;  3AE2 B;  5G2N A;  3DBR I;  3ZJT A;  1WYW B;  2K1F A;  4M0W B;  3PV1 A;  3K9P B;  2OOB B;  2W3S A;  4JWU C;  3NZU A;  4IUM B;  2INN E;  5D94 A;  4MEM A;  1BT0 A;  2O6V A;  4JQW C;  2LZ6 A;  3QQ8 B;  3T3O A;  4JLC A;  1YQ4 B;  2LEK A;  3C8Y A;  1XQQ A;  1SEB D;  3ZRC A;  4DDG D;  1DYQ A;  1OGW A;  1TS4 A;  2DZI A;  2MW5 A;  2LMC A;  4TV3 A;  2LGI A;  4K3C A;  2XNA C;  3W9C B;  2RD0 A;  1P98 A;  4FBJ B;  4MT5 A;  2V1Y A;  1GC7 A;  2FCN A;  1SB3 C;  1SJE D;  1GB1 A;  4MGK E;  2BWF A;  3A9K A;  4IC7 B;  3M62 B;  1PYW D;  1WIA A; 
#chains in the Genus database with same CATH homology
 3RI7 C;  3RNA C;  3RMK C;  1T0R C;  3I63 C;  2RDB C;  3RN9 C;  3RNB C;  3Q3M C;  3RNF C;  3RNG C;  4P1C C;  1T0Q C;  3GE3 C;  3I5J C;  3DHG C;  3RNE C;  3N1Y C;  4P1B C;  3RNC C;  3Q14 C;  3N1X C;  3Q3N C;  1T0S C;  3DHH C;  3N20 C;  3DHI C;  3GE8 C;  3Q3O C;  2INC C;  2IND C;  3Q2A C;  3N1Z C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...