3RMKC

Toluene 4 monooxygenase h with 4-bromophenol
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
81
structure length
81
Chain Sequence
SAFPVHAAFEKDFLVQLVVVDLNDSMDQVAEKVAYHCVNRRVAPREGVMRVRKHRSTELFPRDMTIAESGLNPTEVIDVVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic analysis of active site contributions to regiospecificity in the diiron enzyme toluene 4-monooxygenase.
pubmed doi rcsb
source organism Pseudomonas mendocina
molecule tags Oxidoreductase
molecule keywords Toluene-4-monooxygenase system protein A
total genus 24
structure length 81
sequence length 81
chains with identical sequence F
ec nomenclature ec 1.14.13.236: Toluene 4-monooxygenase.
pdb deposition date 2011-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF06234 TmoB Toluene-4-monooxygenase system protein B (TmoB)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.270 Alpha Beta Roll Ubiquitin-like (UB roll) TmoB-like 3rmkC00
3GE3C 3RNGC 3N20C 2INDC 3Q3NC 3RNEC 3Q2AC 1T0RC 2INCC 3RNFC 3RI7C 3RNAC 3N1YC 1T0SC 3I63C 3RMKC 3RN9C 1T0QC 4P1BC 3DHIC 3N1ZC 3Q3MC 3RNCC 3Q14C 3N1XC 2RDBC 4P1CC 3DHGC 3I5JC 3Q3OC 3RNBC 3GE8C 3DHHC
chains in the Genus database with same CATH superfamily
1WJ6A 4K7WA 3P4RB 2PVGC 2D3AA 2J7QB 2Y5PA 4P6VF 3RNAC 3N1YC 3QIJA 3AE2B 1NDDA 2KX3A 2WDTB 2LVQA 3V05A 3DBLI 3VVWB 2I2YA 5CHVC 1C1YB 2K39A 1H8CA 2OHFA 2N9KA 1ZDXA 1C78A 2IY0B 3PHWB 3KW5B 4GMVA 5DPWA 4FHJA 1SF0A 3B9JA 3BZDB 2PTLA 4HRSA 4XC2A 3ZRCA 4ZYSA 2W54A 2FCNA 2NMQA 3DVNU 4RGMA 4JWUC 3W1YA 3RYTA 1SJED 2V4IB 2BS2B 1RM6C 1T0YA 4DQOC 3AE4B 2IJ0A 1WMHA 3AN1A 4XE0A 1VZ8A 3SU8X 1DYQA 2INDC 4PT5A 2WU5B 2FBWB 1SGHA 3TL5A 1IGDA 3QAQA 2C7MB 3U8ZA 2L0TA 2DBYA 5FR6A 4FULA 4OZAA 2GBNA 3OAWA 2KWVB 1JALA 1V97A 2D2QA 2WDRB 1TKEA 1FCCC 2J0JA 2V0GA 4C4VB 2C60A 4US8A 1QF6A 1WGDA 4OHJA 1TT5B 2LMCA 2WLBA 2MHJA 3A4SC 2OOBB 2FCQA 3PSEB 1T0QC 1ZXHA 3OJ4B 2LEKA 2BTEA 2L3ZA 2KDFB 3DHGC 2G9HD 4MJSB 3CF6E 3V62A 2JPHA 1WX7A 5BMIA 2QC8A 4JGHB 2V9HA 2XEWA 3Q3JA 4BAXA 5HG2A 4YTNB 3IAS1 4ZRKA 1WZ0A 1V8CA 4C4VA 2PEAA 4RCOA 1JWAD 2LGYA 2BYTA 2ZVNA 1FXAA 3I57A 3BK1A 5JHBA 3D32A 3FC4A 3DDCB 2LUMA 4JPSA 1LQBA 2XN9C 3NVYA 2WHIA 1JCKB 4G11A 3ZTCA 2AL6A 2IO3B 4CYEA 3ZNGC 4A9AA 3ML9A 5AUKA 4DBGA 1M4VA 3ZXVA 4OVVA 1OFFA 4DXFA 1CMXB 2LVOA 5J2RA 1D6EC 1AYFA 2H88B 4G50A 2RPQA 3RNGC 2C7NB 1EF5A 2CHZA 2WP9B 5EE1A 1R4MB 2HTME 2GB1A 1EUVB 1VD2A 3NY5A 1IBXB 2AQ1B 5J18A 1RWSA 4PK1A 1WGRA 4JE3B 4XZ4A 1N5XA 1WGKA 1MFWA 2N7JA 1I4GA 3ALBA 4TQ0A 2CU3A 2R2OA 3NZ3A 2JRHA 2JZPA 1ZDVA 4JX1C 2WXJA 4B0EA 3M63B 1FPYA 2G4DB 3VAWA 1WJNA 4KSKC 4RFBA 3VUWA 2LVPA 4MACA 2KNBA 1WE6A 2L00B 1C3TA 1E8XA 2WXRA 1SBBB 2RD0A 2M1MA 3SEBA 2JWUA 3I9V1 1XLQA 3KH0A 3QWZB 1RFKA 3EC8A 4DXAB 2WXNA 4BBNC 2KWUB 3O65B 3EA6A 5JZEB 1ET6A 1XO3A 3CIRB 3ZDTA 5HI1A 1TBEA 3AEGB 3SFDB 1PQSA 3QQ8B 2QCZA 1HQRD 1WJUA 3JSVA 4RM8A 5LXHA 3JW0X 3Q6BA 1KOTA 2V3SA 2BB5A 2M0AA 1OQYA 3CWIA 3EGRA 2ZCBA 2NCNA 1UWMA 2D3CA 4K81A 4RH6A 1EM7A 3Q8EA 2X38A 2KXJA 2YEPF 4BVUC 4ANWA 3UIOB 2IO0B 4B9KA 1J7AA 4P1BC 2RMMA 2JU6X 4LNOA 2AEHA 2NTTA 4BOZB 3QX1A 4MM3A 5HKHA 1ESFA 5CHFA 2CS4A 3ZVVA 1ET9A 1WXSA 3IXSA 3PLUA 4RMAA 4GU2A 2RDGA 3P1MA 1YJ1A 4AS1A 3FILA 4ITKA 4DXGA 2ACZB 1ZW7A 3B0AA 3A9KA 3A9JB 5E6OA 2I38A 1GOZA 3R8BA 4G0NB 2MA9B 1QOBA 3N1XC 5G2NA 3DBHB 2IO2B 3V6EB 4N58A 1L7YA 2ZW0A 4IWQA 4DHJD 2BF8B 3T8MA 4MM3B 1YX5B 4KKJA 3KUZA 3TJPA 2K8HA 4K7UA 4YTPB 3IVFA 2GRIA 1XEEA 5EDSA 3N1ZC 2MW5A 2WXIA 1RAXA 2MJDA 5GXGB 1HZ6A 2MP2B 4YSXB 4KIKA 1TIFA 2M4NA 4DHJB 3DBLB 2KVRA 3QK0A 4KSLC 4WIPA 2HE7A 3TMPB 4ANVA 4YTMB 2D5GA 4WWOA 4RGNA 3LJ3A 4F1SA 2I1JA 4LNFA 4GIVA 1XLNA 2J42A 2SAKA 3C0RB 2JSVX 2BW2A 3PV1A 1NYQA 2AQ3B 2MBQA 4NZLB 4M02A 4AJWA 2K8BA 2LXCA 4HPLB 2DZJA 2K5PA 2O2VA 2CU1A 2YLMA 1V5OA 1OQRA 3Q2AC 3AMZA 5D2MB 3DWGC 1L0VB 1YJJA 2R2QA 4KZ0A 4WJNA 1WRIA 2B76B 1OEYA 2X8XX 1E8YA 5HFYA 1WGYA 1XCTL 4YL8A 4GDKA 4RF0A 1L0YB 4GN1A 3DBHI 4NJCA 4A3PA 3R2TA 4PS7A 3EFUA 2M56B 4CQNA 1WM3A 2Z8LA 2N0SB 1JMLA 1MG4A 5LXIB 1NVID 3UIPB 3PZDA 1E8ZA 1VLBA 3VQIA 3PVLA 2DAFA 1FNWA 3ZNID 1E5WA 1TS2A 1YN4A 3E56A 2PIAA 4RNAA 3AB5A 3MJWA 5FK9C 2WXLA 2GBRA 1XT9B 3AE8B 1WH3A 5BO4B 3IG3A 5TSSA 3W1SA 1I4XA 3MHZA 1EF1A 3H1UA 2MQJA 1HTOA 2IZVB 4RF1A 1AWDA 1JWBD 4EOYA 2MJ3A 3RN9C 2M17A 4NAMA 1SJHD 2V3PA 1L6UA 4ZHPA 3BVMA 1ZPSA 3KYCD 1N61A 2KZRA 1ZOYB 4KDIC 2K0PA 4LNIA 4KGSA 1C4PA 1UELA 1KLVA 3TBLD 1ISNA 1C9FA 2RSUA 2EELA 2GBKA 1ZGUB 4N59A 1K8RB 2LZ6A 4FHKA 5DCNA 1K53A 2ZW1A 4PS3A 1F77A 1I4HA 5AEKB 4WH4A 3X23A 3AE6B 3BY4B 4LNKA 3U52E 2QSDA 4YXDB 1IP9A 1HZ5A 4HWIB 1Y56A 1ZUD2 1FD6A 2KJ6A 1OTRB 2IDYA 3WALA 4GGQA 3AE7B 2NVUI 2N9XA 4M8NA 1D5MC 1WGGA 3TEXA 2JXXA 4TKNA 4NAWB 2NPTB 2LRWA 2HTHA 3AU5A 4P16A 3OLMD 4LLGM 3T3OA 4HLEA 4ARIA 2QMTA 2ZNVB 5D94A 3ZNZB 3WA0A 3APCA 3RCZA 3AE9B 4YT0B 3VTWA 3EFCA 1F1HA 3AE3B 1KTKA 2WQYB 1UUPA 2MCNB 2JT4B 1RYJA 3ZGZA 4OW0A 4GLSC 3I63C 1V81A 4A20A 4HVBA 3T3NA 1GUAB 2Y5BB 4WURA 4XX5A 3A1QB 4M01A 2L05A 1WR6E 3R7RA 4II2B 4EUTA 1QQRA 4ARCA 1P3QU 1LXDA 1XLOA 4NNJB 2VRRB 4KGRA 1OGWA 2M0XA 2DYMA 1R4NB 1YQBA 4LNNA 2N1VA 3L13A 1JRPA 3RT3B 2WDQB 2WYQA 1YMHE 2LXAA 3ENEA 2A5UA 3ZTDA 4US9A 1ACCA 2CJOA 3TUOA 1T5XD 2SEBD 3BINA 5AZGA 4LDTB 2MRPA 3ZRFA 4M00A 3ZLZA 3RI7C 1Y8RC 1T0SC 1I7HA 3J9CA 5AZHA 2LWPA 3RD2A 2MH7A 3L16A 4WJQA 2MLBA 2PW9A 1Q0WB 2ZNVC 1E7VA 3RNBC 2L83A 2A4ZA 3LYYA 2KO3A 4PYUA 2KD0A 4ICUA 2D10A 3HIZA 4GSWA 4I6PA 3RZWC 1R4NI 3A9KB 1IPGA 2DAJA 2MEKA 1CK1A 5G5HA 3NG0A 5H8YE 4B95A 4ASWC 4TQ1A 1P0RA 3C19A 3R7QA 4HJKA 2JVCA 1RFAA 1WXVA 2W82A 3QARA 4IDIA 2HJ8A 4G3XB 2IO1B 3RFZB 1WSPA 1YNTE 4J3OD 2NBWB 2JRIB 2W3SA 3V60A 1SIJA 3Q8FA 4O1NA 4XGAB 1NEKB 3WAPA 2W55A 3KUDB 1UWXA 4OVZA 3GS2A 2JYTA 3ZYYX 2AL3A 3SHQA 4IW0A 4GDLA 1S1QB 3WAMA 1UZXB 3A33B 4TSSA 3PZ7A 2G3QB 2M8SA 1FRRA 1KF6B 2D07B 3P63A 5E6PA 1YN3A 3DVNV 3L4PA 3ZJTA 1FRDA 1MI0A 2FIFA 1YJIA 1Z2MA 2JWZA 3P4QB 4WJOA 1J0GA 3M95A 3VDZA 2UWQA 3WANA 2LGSA 1WIAA 1TS3A 3S2AA 5BMGA 1F9JA 2N7DA 3ZXRA 1QZEA 4JLCA 1C4AA 1DOIA 3AM9A 3M3JA 2KX0A 2H89B 1WI0A 2L52A 3DCGA 1C79A 5DPSA 1BT0A 1FNUA 5T8IA 2AQ2B 2WU2B 4D2KA 4IM3A 3JVZX 1PYWD 1E9MA 1TS4A 2IBIB 4K3BA 2VH1A 4XDDA 1E0ZA 2BT6A 2IGHA 3NUHB 1GNUA 1SB3C 5C2TB 2ZZPB 3ZDMC 2GLSA 2MWSB 2C9WB 4MGZE 1TZOA 2KMMA 1UNSA 3B2GA 3QCAA 1WF9A 1WYWB 4E3CA 1TKYA 2Y5CA 4X57B 4DHZE 3NVWA 4HCNB 2CJNA 2BYFA 3BVGA 2G45B 4L1BA 1QKZA 2KVZA 4KX6B 4K7SA 2WNMA 3L08A 3AEEB 3JYUA 1SE2A 1KLGD 4K3CA 2WXQA 3I5JC 1WY8A 1C76A 4HKQA 3NHEB 2KTRB 2JZ3B 2PVOD 2HD5B 3NOBA 1ENFA 4MH0E 1FM0D 1SE3A 3VR8B 1YQ4B 2WX1A 1T6BX 2K25A 2JQRB 4MELA 3IT6B 3UGBB 4B6WA 3P2BA 3R66C 2BS3B 3R3MA 2UU7A 4QAYA 4YSYB 1E7PB 4PYZA 3HVDA 5C1ZA 3BYYB 4N6EB 5C3JB 1U4AA 1NENB 1LGRA 4I6NB 2VZKD 2N9EB 2REXA 3TEWA 1YX6B 2WXOA 5CX3A 4H2AA 3ML8A 4GXBA 4UDUC 1WXAA 1I4PA 4URKA 2KN5A 2MBEA 2EKEC 5FKAC 1TZ1A 2DENB 2QEJC 4ACFA 2GBJA 4WJPA 1N60A 4C7YA 1WJ4A 5AZFA 2FUHB 3PRZA 1VR9A 2KANA 5L95C 4KVGB 3IHPC 4NJ6A 4IKGA 3URYA 1JWMD 4FBJB 1F52A 2BVCA 3ZUNA 1WRDB 4USAA 5IOIA 3Q8BA 2LGIA 1HEZE 4NQKE 1L6VA 1Q5WB 1GC6A 1M94A 2C7HA 1V9JA 4AP4C 1J19A 1GB4A 3W9CB 3OG5A 2J0KA 3IBEA 3H8HA 3P42A 4WWPA 1N63A 4W9KA 1TY0A 4LJOB 2JZZA 4C80A 3RNEC 2LFIA 3NS8A 4TMAB 2JXTA 2ON8A 1JW9D 1R4MI 1SXTA 2OJRA 4ZRJA 3AH7A 4HK2A 4P1CC 2N4FA 3UINB 2LJIA 4MGYE 3AECB 1V6EA 2DYBA 1FXTB 2BYVE 2FNJB 4WQMA 1PGAA 1Q1OA 3LDZE 3KYDD 1UH6A 1VZ7A 2INCC 2K8CA 5IKCM 2HJ1A 5L83A 4JIOU 1PGBA 2D11A 2FAZA 5JHAA 1NI3A 2BS4B 4EE2A 3TEYA 2KMAA 5LLIA 3FAHA 1AARA 2BKRB 3H9DA 3B2FA 4YSZB 2ZEQA 2MBOA 3GP7A 1VRAB 3VUYA 2BYEA 3WCQA 4OZBA 4W9FA 3UQAA 2DLBA 2L76A 3W5UB 1HXYD 4REZA 4LDTD 1I4QA 1RLFA 3TIXA 1LFDA 2JX5A 1R7SA 2J52A 2QILA 2KDEB 1S3SG 1I35A 1IGCA 1ZE3D 1STEA 2KDIA 3ZJVA 1LM8B 4W9JA 3DOWA 2BWES 2Q5WD 3PLVA 5IA7A 4HDOA 2RGFA 2KDBA 4XYCA 3DBRB 5IO9A 2GMIC 2N1WA 4NQLB 4KKIA 3NJTA 4PS8A 1MHXA 4KZCA 2Z0EB 4ZOHC 3A4RA 2O6VD 4TUUA 3HM3A 3NVVA 3PS6A 3ZNHB 2GI9A 3AEBB 3AE5B 4ICVA 2PJHA 2MX2A 1KJTA 3IT4B 1MPEA 1F2RI 1EU3A 1KFYB 1L5PA 2DZIA 3U30A 3AEDB 1JRUA 3N30A 1QLBB 4ANXA 4BKSA 2KWDA 5C23A 2Y3AA 1WR1A 3QJZA 3Q8AA 4MH8A 2LHDA 1D3ZA 1TKGA 4BKGA 3ZIMA 1UF0A 4Q2JA 5IP4D 3N9YC 5KHOA 3PT2B 1PGXA 2K3UA 2EMSA 2FCSA 1VCBA 2YEPB 2QJLA 2QHOA 2JY6A 3NRZA 5KHQA 4WWMA 4XWWA 1AW7A 1ZP0B 5J17A 3Q14C 4OVUA 1YN5A 2Z0DB 3VRBB 2AX5A 4DHZB 1D4BA 2DHZA 3ZO5B 1Q10A 3ECIA 1VDVA 2KTFA 2MJEA 3DQVA 2LJ5A 4HXDA 4IWOA 4FJZA 2KK8A 1IBXA 2TSSA 2CHWA 5TR5A 1V2YA 2HDEA 2W3RA 1YD8U 2W9NA 4GB9A 2M19A 4EFOA 4IG7B 2BWFA 3NZSA 4OZCA 4EKUA 3AE1B 4NPNA 1YOVB 4MEMA 2PLPA 1MJDA 4R3DA 3DVGY 3Q3NC 2DZKA 2UYZB 1I42A 3Q3FA 3U2SC 2XK5B 1CQVA 2RR9A 5E6NA 3LB8C 2KFJA 4BZAA 1WXQA 4FLHA 3ZQ4A 2XBBC 2O6VB 2WX0A 3K9PB 4ZRQA 1BMLC 3VUXA 1KH0A 4M0WB 2J53A 1QOAA 1EWYC 2BGFA 1K51A 3VFKA 3TSSA 2DX5B 2K22A 1B1ZA 2ASQA 4I6LB 4LK0M 3APDA 2KQ7A 1QOFA 2KDMA 1J8CA 4MDKE 2N7EA 2YVCA 4CO7A 2JYEA 2WGSA 1HE8A 2QDFA 4MGIE 3B1LX 3BK2A 5G5GA 3GE3C 4RGOS 1E6EB 4WWNA 2BB6A 1CZPA 1FCLA 4RM9A 4AUQC 3LXFA 4BKTA 2KFKB 3AULA 4E74A 1WGHA 5GMVA 3R2IA 3MTNB 3N32A 5MPOA 4EZKA 4KDLB 3A1QA 3CSTA 5I4DA 2L1AA 2EKIA 3GZNI 1QILA 2KJRA 3VTVA 2ZPNA 1V86A 2R61A 1N62A 4FN2A 3DWMA 3SDLC 1XLPA 3MC8A 2RDBC 2INPE 3QHTA 1SEBD 3M62B 1JWUD 3VR9B 4ZRPA 2FCMA 1Z5SB 1JWSD 1L4ZB 3W2DA 3KVFB 3PTFC 4EEWA 3ETRA 3HK0A 2KT7A 1MVKA 3SFEB 2LD9A 2KHWB 4EZJA 5BMHA 1T3QA 1TY2A 5EE9A 1SE4A 2G1EA 3HM6X 1A5RA 3GOEA 2WXMA 3MFGA 3AU4A 5E6JA 5IAAC 2ICIA 2LGDA 4A3OA 4FADA 2E3TA 3HUIA 4HEA1 4J6IA 1QT9A 4WAFA 2IGGA 4HKZE 1UBQA 2Z59B 1DGJA 3VH3B 3DPDA 4W9IA 1FFVA 1ZKHA 4N9F4 3RPFC 4F7ZA 1V1OA 2PPHA 5DPTA 3RUIB 3K9OB 1K50A 2IGDA 1XXGA 1UBIA 1CJEA 3AXCA 3P4PB 4M8MA 3PO0A 1UGJA 1GB1A 3MJ5A 2ONQA 2GBMA 3RULA 1TGZB 4W9GA 3DBSA 2RPVA 3VHTC 3E9SA 4WQOB 4W9EA 3Q3OC 1FFUA 2CHXA 3L10B 3CSFA 4GOCA 2NR2A 1WE7A 2KC1A 1C4CA 1BXTA 3NS1A 4BBNF 1QOGA 3WIMA 2K1FA 4S17A 1WX8A 5AUIA 4AQ7A 4W9CA 1FEHA 2WXHA 4L23A 3BVZA 3W1SC 2BQQA 3L17A 4P7IA 2KQSA 2K6DB 2L32A 5JXVA 2L0FA 3JSVB 4L2YA 2OJWA 3QA8A 2NPTA 1FXIA 4MJSA 5H92C 3MC0B 3FILB 4FJYA 2LHEA 1P9DU 3DVGX 4HCPB 2IY1B 2K6QA 2KWCA 3OWEB 4DWFA 1IYFA 2PE9A 2DNFA 3PGEA 1WX9A 3MHSD 2XK5A 1ROEA 3KWLA 3DBRI 3V3XA 1WYGA 3PREA 4IUMB 3H7PB 3KQ4A 1J7CA 3HRDD 1XF5L 4CHKA 3RNCC 4DDID 2KAJA 1D5XC 4NJ7A 3APFA 4IOIE 1F0ZA 3Q8CA 4JWSC 2KLCA 2GOWA 3BIID 4JL9A 1NI2A 3EECA 3PPAA 1SE9A 1XCQL 4KIKB 1E8WA 3RNFC 2B3AA 2J4XA 1D5ZC 1EWCA 1DOXA 1WFYA 4YWGG 3NVZA 2LRUA 3FKYA 2KQ4X 4BFRA 1ZXIA 3PHXB 4ZRIA 1L4DB 3EHVA 4RGTA 5HHDG 4W9HA 1SIFA 1XD3B 2O2VB 4E71A 4ZYNA 2PMVA 3IFWB 3SR6A 3UQBA 2KTRA 1FO4A 1FMAD 4EZLA 1E90A 4XDCA 1TJEA 2WWZA 4WAAA 2WDVB 1A70A 3AV8A 1HA5A 2LI5A 3KLSX 3O13A 2NBVB 2ZVOA 3VTUA 1OEYJ 4IM0A 1V5TA 4DDGD 3MC9A 5CTRC 1P7FA 4TV3A 2PE6B 4HJGE 1PUTA 4IC7B 3L54A 1HTQA 2V1YA 1LO5D 2KFKA 3ABVB 1G6JA 3GB1A 3BWUD 4MSMB 1TS5A 3PZ8A 4A8XC 1IUEA 1X1MA 3V61A 3VXWA 1H4RA 1E10A 1MHHE 2KYWA 2WXKA 2MSED 2KLGA 3UF8A 1TYGB 3VH4B 1KM7A 2CKHB 5D7GA 1FIQA 3BYTB 1XQQA 1VJKA 3HVZA 2V3NA 3NZUA 4ZHOA 4II3B 1N5WA 1GG3A 4JQWC 4IWPA 1OQQA 4HDQA 1WWTA 4B0MA 4MT5A 4ANUA 2NS5A 1JROA 3ZJUA 3RMKC 2FIDA 4W9LA 3L0WB 3V6CB 3Q3MC 4F8CB 2C5LC 2ZPYA 2K9XA 4LCDE 2J0MA 3ZKJC 3IAM1 1SSNA 1WXMA 1L2NA 3W5VB 3I3TB 4NY0A 5EE0A 3U7ZA 1E7UA 1EU4A 3H7SA 3N20C 3MP9A 2IPKD 4A55A 2V4LA 3B08A 3CMMB 2O6VA 3U7DA 1T0RC 1P7EA 4C7ZA 2VH2A 2LUEA 1J7BA 3DHIC 1L0XB 2QIEB 5DPRA 2AYOB 2BBCA 1V80A 3GZNB 2MP2A 2ZCCA 1V49A 2ZJDA 1AN8A 3OJ3A 2CR5A 1I4RA 4BKSD 4W9DA 2WS3B 4HROA 2FE8A 2WXPA 3SD5A 4KV2A 4A6QA 1GPXA 4GDKB 2KACA 2RDHA 5BYQA 1NBFC 3PRPB 5JH5C 4M0WA 1V1PA 2WXGA 3AEAB 3U4EG 3AI5A 1N6ZA 1GC7A 3X0WA 2NTSA 2BPSA 1GJZA 1FNVA 3TCAA 5G55A 1JQ4A 2NBUA 1MG8A 2EMTA 3ZW3A 1NYRA 4S0RA 2KOXA 5FR3A 1PFDA 2PKOA 3RZFA 4AWJA 5EE3A 5D3DA 2D3BA 1DOYA 4HPMB 1V1PB 2INNE 2KMCA 2D3GA 1UD7A 1B9RA 2XNAC 4A90A 4DK5A 3N3KB 1WZ3A 3DHHC 3PRMB 2MBBB 4LTUA 1P98A 3UI3A 2N9PC 2VZKB 4GDLB 1PDXA 4KGTA 4HPPA 3H7PA 4LJPB 4AJYB 2E6XA 2G4SA 3C8YA 3KWVA 5D3IB 1WM2A 5BYRA 3P4SB 3H6NA 4MSQB 3WAOA 2KC2A 5BYSA 4K1RB 2DWQA 4ZDVA 2N9LA 2KN4A 3Q69A 2FUG1 1TTNA 4C00A 2LASA 1C77A 4FXCA 2L7RA 1K52A 2I1KA 5D6JB 5LNK1 2OEDA 2IYDB 3A9JA 1KRHA 2KKCA 3ONSA 2DZMA 2LGXA 4FJVB 1P1AA 2BKFA 2AWTA 3VRAB 4BOSC 5IN7A 4AOFA 3KUCB 4XWTA 3GE8C 2DYOA 1YIWA 3TEZA 4FA6A 1UGMA 1WMHB 2JF5A 1F2RC 3HHMA 1YQ3B 3AEFB 2WXFA 2JUOA 4C56C 1VZ6A 2L8JA 2MBHA 5CHWA 4NAWA 4IM2A 3EUB2 2KJHB 3QC8B 1EO6A 1BUIC 1KLUD 1GAQB 1RRBA 3T9LA 4MGKE
chains in the Genus database with same CATH topology
3GE3C 3RNGC 3N20C 2INDC 3Q3NC 3RNEC 3Q2AC 1T0RC 2INCC 3RNFC 3RI7C 3RNAC 3N1YC 1T0SC 3I63C 3RMKC 3RN9C 1T0QC 4P1BC 3DHIC 3N1ZC 3Q3MC 3RNCC 3Q14C 3N1XC 2RDBC 4P1CC 3DHGC 3I5JC 3Q3OC 3RNBC 3GE8C 3DHHC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GE3 C;  3RNG C;  3N20 C;  2IND C;  3Q3N C;  3RNE C;  3Q2A C;  1T0R C;  2INC C;  3RNF C;  3RI7 C;  3RNA C;  3N1Y C;  1T0S C;  3I63 C;  3RMK C;  3RN9 C;  1T0Q C;  4P1B C;  3DHI C;  3N1Z C;  3Q3M C;  3RNC C;  3Q14 C;  3N1X C;  2RDB C;  4P1C C;  3DHG C;  3I5J C;  3Q3O C;  3RNB C;  3GE8 C;  3DHH C; 
#chains in the Genus database with same CATH topology
 1WJ6 A;  4K7W A;  3P4R B;  2PVG C;  2D3A A;  2J7Q B;  2Y5P A;  4P6V F;  3RNA C;  3N1Y C;  3QIJ A;  3AE2 B;  1NDD A;  2KX3 A;  2WDT B;  2LVQ A;  3V05 A;  3DBL I;  3VVW B;  2I2Y A;  5CHV C;  1C1Y B;  2K39 A;  1H8C A;  2OHF A;  2N9K A;  1ZDX A;  1C78 A;  2IY0 B;  3PHW B;  3KW5 B;  4GMV A;  5DPW A;  4FHJ A;  1SF0 A;  3B9J A;  3BZD B;  2PTL A;  4HRS A;  4XC2 A;  3ZRC A;  4ZYS A;  2W54 A;  2FCN A;  2NMQ A;  3DVN U;  4RGM A;  4JWU C;  3W1Y A;  3RYT A;  1SJE D;  2V4I B;  2BS2 B;  1RM6 C;  1T0Y A;  4DQO C;  3AE4 B;  2IJ0 A;  1WMH A;  3AN1 A;  4XE0 A;  1VZ8 A;  3SU8 X;  1DYQ A;  2IND C;  4PT5 A;  2WU5 B;  2FBW B;  1SGH A;  3TL5 A;  1IGD A;  3QAQ A;  2C7M B;  3U8Z A;  2L0T A;  2DBY A;  5FR6 A;  4FUL A;  4OZA A;  2GBN A;  3OAW A;  2KWV B;  1JAL A;  1V97 A;  2D2Q A;  2WDR B;  1TKE A;  1FCC C;  2J0J A;  2V0G A;  4C4V B;  2C60 A;  4US8 A;  1QF6 A;  1WGD A;  4OHJ A;  1TT5 B;  2LMC A;  2WLB A;  2MHJ A;  3A4S C;  2OOB B;  2FCQ A;  3PSE B;  1T0Q C;  1ZXH A;  3OJ4 B;  2LEK A;  2BTE A;  2L3Z A;  2KDF B;  3DHG C;  2G9H D;  4MJS B;  3CF6 E;  3V62 A;  2JPH A;  1WX7 A;  5BMI A;  2QC8 A;  4JGH B;  2V9H A;  2XEW A;  3Q3J A;  4BAX A;  5HG2 A;  4YTN B;  3IAS 1;  4ZRK A;  1WZ0 A;  1V8C A;  4C4V A;  2PEA A;  4RCO A;  1JWA D;  2LGY A;  2BYT A;  2ZVN A;  1FXA A;  3I57 A;  3BK1 A;  5JHB A;  3D32 A;  3FC4 A;  3DDC B;  2LUM A;  4JPS A;  1LQB A;  2XN9 C;  3NVY A;  2WHI A;  1JCK B;  4G11 A;  3ZTC A;  2AL6 A;  2IO3 B;  4CYE A;  3ZNG C;  4A9A A;  3ML9 A;  5AUK A;  4DBG A;  1M4V A;  3ZXV A;  4OVV A;  1OFF A;  4DXF A;  1CMX B;  2LVO A;  5J2R A;  1D6E C;  1AYF A;  2H88 B;  4G50 A;  2RPQ A;  3RNG C;  2C7N B;  1EF5 A;  2CHZ A;  2WP9 B;  5EE1 A;  1R4M B;  2HTM E;  2GB1 A;  1EUV B;  1VD2 A;  3NY5 A;  1IBX B;  2AQ1 B;  5J18 A;  1RWS A;  4PK1 A;  1WGR A;  4JE3 B;  4XZ4 A;  1N5X A;  1WGK A;  1MFW A;  2N7J A;  1I4G A;  3ALB A;  4TQ0 A;  2CU3 A;  2R2O A;  3NZ3 A;  2JRH A;  2JZP A;  1ZDV A;  4JX1 C;  2WXJ A;  4B0E A;  3M63 B;  1FPY A;  2G4D B;  3VAW A;  1WJN A;  4KSK C;  4RFB A;  3VUW A;  2LVP A;  4MAC A;  2KNB A;  1WE6 A;  2L00 B;  1C3T A;  1E8X A;  2WXR A;  1SBB B;  2RD0 A;  2M1M A;  3SEB A;  2JWU A;  3I9V 1;  1XLQ A;  3KH0 A;  3QWZ B;  1RFK A;  3EC8 A;  4DXA B;  2WXN A;  4BBN C;  2KWU B;  3O65 B;  3EA6 A;  5JZE B;  1ET6 A;  1XO3 A;  3CIR B;  3ZDT A;  5HI1 A;  1TBE A;  3AEG B;  3SFD B;  1PQS A;  3QQ8 B;  2QCZ A;  1HQR D;  1WJU A;  3JSV A;  4RM8 A;  5LXH A;  3JW0 X;  3Q6B A;  1KOT A;  2V3S A;  2BB5 A;  2M0A A;  1OQY A;  3CWI A;  3EGR A;  2ZCB A;  2NCN A;  1UWM A;  2D3C A;  4K81 A;  4RH6 A;  1EM7 A;  3Q8E A;  2X38 A;  2KXJ A;  2YEP F;  4BVU C;  4ANW A;  3UIO B;  2IO0 B;  4B9K A;  1J7A A;  4P1B C;  2RMM A;  2JU6 X;  4LNO A;  2AEH A;  2NTT A;  4BOZ B;  3QX1 A;  4MM3 A;  5HKH A;  1ESF A;  5CHF A;  2CS4 A;  3ZVV A;  1ET9 A;  1WXS A;  3IXS A;  3PLU A;  4RMA A;  4GU2 A;  2RDG A;  3P1M A;  1YJ1 A;  4AS1 A;  3FIL A;  4ITK A;  4DXG A;  2ACZ B;  1ZW7 A;  3B0A A;  3A9K A;  3A9J B;  5E6O A;  2I38 A;  1GOZ A;  3R8B A;  4G0N B;  2MA9 B;  1QOB A;  3N1X C;  5G2N A;  3DBH B;  2IO2 B;  3V6E B;  4N58 A;  1L7Y A;  2ZW0 A;  4IWQ A;  4DHJ D;  2BF8 B;  3T8M A;  4MM3 B;  1YX5 B;  4KKJ A;  3KUZ A;  3TJP A;  2K8H A;  4K7U A;  4YTP B;  3IVF A;  2GRI A;  1XEE A;  5EDS A;  3N1Z C;  2MW5 A;  2WXI A;  1RAX A;  2MJD A;  5GXG B;  1HZ6 A;  2MP2 B;  4YSX B;  4KIK A;  1TIF A;  2M4N A;  4DHJ B;  3DBL B;  2KVR A;  3QK0 A;  4KSL C;  4WIP A;  2HE7 A;  3TMP B;  4ANV A;  4YTM B;  2D5G A;  4WWO A;  4RGN A;  3LJ3 A;  4F1S A;  2I1J A;  4LNF A;  4GIV A;  1XLN A;  2J42 A;  2SAK A;  3C0R B;  2JSV X;  2BW2 A;  3PV1 A;  1NYQ A;  2AQ3 B;  2MBQ A;  4NZL B;  4M02 A;  4AJW A;  2K8B A;  2LXC A;  4HPL B;  2DZJ A;  2K5P A;  2O2V A;  2CU1 A;  2YLM A;  1V5O A;  1OQR A;  3Q2A C;  3AMZ A;  5D2M B;  3DWG C;  1L0V B;  1YJJ A;  2R2Q A;  4KZ0 A;  4WJN A;  1WRI A;  2B76 B;  1OEY A;  2X8X X;  1E8Y A;  5HFY A;  1WGY A;  1XCT L;  4YL8 A;  4GDK A;  4RF0 A;  1L0Y B;  4GN1 A;  3DBH I;  4NJC A;  4A3P A;  3R2T A;  4PS7 A;  3EFU A;  2M56 B;  4CQN A;  1WM3 A;  2Z8L A;  2N0S B;  1JML A;  1MG4 A;  5LXI B;  1NVI D;  3UIP B;  3PZD A;  1E8Z A;  1VLB A;  3VQI A;  3PVL A;  2DAF A;  1FNW A;  3ZNI D;  1E5W A;  1TS2 A;  1YN4 A;  3E56 A;  2PIA A;  4RNA A;  3AB5 A;  3MJW A;  5FK9 C;  2WXL A;  2GBR A;  1XT9 B;  3AE8 B;  1WH3 A;  5BO4 B;  3IG3 A;  5TSS A;  3W1S A;  1I4X A;  3MHZ A;  1EF1 A;  3H1U A;  2MQJ A;  1HTO A;  2IZV B;  4RF1 A;  1AWD A;  1JWB D;  4EOY A;  2MJ3 A;  3RN9 C;  2M17 A;  4NAM A;  1SJH D;  2V3P A;  1L6U A;  4ZHP A;  3BVM A;  1ZPS A;  3KYC D;  1N61 A;  2KZR A;  1ZOY B;  4KDI C;  2K0P A;  4LNI A;  4KGS A;  1C4P A;  1UEL A;  1KLV A;  3TBL D;  1ISN A;  1C9F A;  2RSU A;  2EEL A;  2GBK A;  1ZGU B;  4N59 A;  1K8R B;  2LZ6 A;  4FHK A;  5DCN A;  1K53 A;  2ZW1 A;  4PS3 A;  1F77 A;  1I4H A;  5AEK B;  4WH4 A;  3X23 A;  3AE6 B;  3BY4 B;  4LNK A;  3U52 E;  2QSD A;  4YXD B;  1IP9 A;  1HZ5 A;  4HWI B;  1Y56 A;  1ZUD 2;  1FD6 A;  2KJ6 A;  1OTR B;  2IDY A;  3WAL A;  4GGQ A;  3AE7 B;  2NVU I;  2N9X A;  4M8N A;  1D5M C;  1WGG A;  3TEX A;  2JXX A;  4TKN A;  4NAW B;  2NPT B;  2LRW A;  2HTH A;  3AU5 A;  4P16 A;  3OLM D;  4LLG M;  3T3O A;  4HLE A;  4ARI A;  2QMT A;  2ZNV B;  5D94 A;  3ZNZ B;  3WA0 A;  3APC A;  3RCZ A;  3AE9 B;  4YT0 B;  3VTW A;  3EFC A;  1F1H A;  3AE3 B;  1KTK A;  2WQY B;  1UUP A;  2MCN B;  2JT4 B;  1RYJ A;  3ZGZ A;  4OW0 A;  4GLS C;  3I63 C;  1V81 A;  4A20 A;  4HVB A;  3T3N A;  1GUA B;  2Y5B B;  4WUR A;  4XX5 A;  3A1Q B;  4M01 A;  2L05 A;  1WR6 E;  3R7R A;  4II2 B;  4EUT A;  1QQR A;  4ARC A;  1P3Q U;  1LXD A;  1XLO A;  4NNJ B;  2VRR B;  4KGR A;  1OGW A;  2M0X A;  2DYM A;  1R4N B;  1YQB A;  4LNN A;  2N1V A;  3L13 A;  1JRP A;  3RT3 B;  2WDQ B;  2WYQ A;  1YMH E;  2LXA A;  3ENE A;  2A5U A;  3ZTD A;  4US9 A;  1ACC A;  2CJO A;  3TUO A;  1T5X D;  2SEB D;  3BIN A;  5AZG A;  4LDT B;  2MRP A;  3ZRF A;  4M00 A;  3ZLZ A;  3RI7 C;  1Y8R C;  1T0S C;  1I7H A;  3J9C A;  5AZH A;  2LWP A;  3RD2 A;  2MH7 A;  3L16 A;  4WJQ A;  2MLB A;  2PW9 A;  1Q0W B;  2ZNV C;  1E7V A;  3RNB C;  2L83 A;  2A4Z A;  3LYY A;  2KO3 A;  4PYU A;  2KD0 A;  4ICU A;  2D10 A;  3HIZ A;  4GSW A;  4I6P A;  3RZW C;  1R4N I;  3A9K B;  1IPG A;  2DAJ A;  2MEK A;  1CK1 A;  5G5H A;  3NG0 A;  5H8Y E;  4B95 A;  4ASW C;  4TQ1 A;  1P0R A;  3C19 A;  3R7Q A;  4HJK A;  2JVC A;  1RFA A;  1WXV A;  2W82 A;  3QAR A;  4IDI A;  2HJ8 A;  4G3X B;  2IO1 B;  3RFZ B;  1WSP A;  1YNT E;  4J3O D;  2NBW B;  2JRI B;  2W3S A;  3V60 A;  1SIJ A;  3Q8F A;  4O1N A;  4XGA B;  1NEK B;  3WAP A;  2W55 A;  3KUD B;  1UWX A;  4OVZ A;  3GS2 A;  2JYT A;  3ZYY X;  2AL3 A;  3SHQ A;  4IW0 A;  4GDL A;  1S1Q B;  3WAM A;  1UZX B;  3A33 B;  4TSS A;  3PZ7 A;  2G3Q B;  2M8S A;  1FRR A;  1KF6 B;  2D07 B;  3P63 A;  5E6P A;  1YN3 A;  3DVN V;  3L4P A;  3ZJT A;  1FRD A;  1MI0 A;  2FIF A;  1YJI A;  1Z2M A;  2JWZ A;  3P4Q B;  4WJO A;  1J0G A;  3M95 A;  3VDZ A;  2UWQ A;  3WAN A;  2LGS A;  1WIA A;  1TS3 A;  3S2A A;  5BMG A;  1F9J A;  2N7D A;  3ZXR A;  1QZE A;  4JLC A;  1C4A A;  1DOI A;  3AM9 A;  3M3J A;  2KX0 A;  2H89 B;  1WI0 A;  2L52 A;  3DCG A;  1C79 A;  5DPS A;  1BT0 A;  1FNU A;  5T8I A;  2AQ2 B;  2WU2 B;  4D2K A;  4IM3 A;  3JVZ X;  1PYW D;  1E9M A;  1TS4 A;  2IBI B;  4K3B A;  2VH1 A;  4XDD A;  1E0Z A;  2BT6 A;  2IGH A;  3NUH B;  1GNU A;  1SB3 C;  5C2T B;  2ZZP B;  3ZDM C;  2GLS A;  2MWS B;  2C9W B;  4MGZ E;  1TZO A;  2KMM A;  1UNS A;  3B2G A;  3QCA A;  1WF9 A;  1WYW B;  4E3C A;  1TKY A;  2Y5C A;  4X57 B;  4DHZ E;  3NVW A;  4HCN B;  2CJN A;  2BYF A;  3BVG A;  2G45 B;  4L1B A;  1QKZ A;  2KVZ A;  4KX6 B;  4K7S A;  2WNM A;  3L08 A;  3AEE B;  3JYU A;  1SE2 A;  1KLG D;  4K3C A;  2WXQ A;  3I5J C;  1WY8 A;  1C76 A;  4HKQ A;  3NHE B;  2KTR B;  2JZ3 B;  2PVO D;  2HD5 B;  3NOB A;  1ENF A;  4MH0 E;  1FM0 D;  1SE3 A;  3VR8 B;  1YQ4 B;  2WX1 A;  1T6B X;  2K25 A;  2JQR B;  4MEL A;  3IT6 B;  3UGB B;  4B6W A;  3P2B A;  3R66 C;  2BS3 B;  3R3M A;  2UU7 A;  4QAY A;  4YSY B;  1E7P B;  4PYZ A;  3HVD A;  5C1Z A;  3BYY B;  4N6E B;  5C3J B;  1U4A A;  1NEN B;  1LGR A;  4I6N B;  2VZK D;  2N9E B;  2REX A;  3TEW A;  1YX6 B;  2WXO A;  5CX3 A;  4H2A A;  3ML8 A;  4GXB A;  4UDU C;  1WXA A;  1I4P A;  4URK A;  2KN5 A;  2MBE A;  2EKE C;  5FKA C;  1TZ1 A;  2DEN B;  2QEJ C;  4ACF A;  2GBJ A;  4WJP A;  1N60 A;  4C7Y A;  1WJ4 A;  5AZF A;  2FUH B;  3PRZ A;  1VR9 A;  2KAN A;  5L95 C;  4KVG B;  3IHP C;  4NJ6 A;  4IKG A;  3URY A;  1JWM D;  4FBJ B;  1F52 A;  2BVC A;  3ZUN A;  1WRD B;  4USA A;  5IOI A;  3Q8B A;  2LGI A;  1HEZ E;  4NQK E;  1L6V A;  1Q5W B;  1GC6 A;  1M94 A;  2C7H A;  1V9J A;  4AP4 C;  1J19 A;  1GB4 A;  3W9C B;  3OG5 A;  2J0K A;  3IBE A;  3H8H A;  3P42 A;  4WWP A;  1N63 A;  4W9K A;  1TY0 A;  4LJO B;  2JZZ A;  4C80 A;  3RNE C;  2LFI A;  3NS8 A;  4TMA B;  2JXT A;  2ON8 A;  1JW9 D;  1R4M I;  1SXT A;  2OJR A;  4ZRJ A;  3AH7 A;  4HK2 A;  4P1C C;  2N4F A;  3UIN B;  2LJI A;  4MGY E;  3AEC B;  1V6E A;  2DYB A;  1FXT B;  2BYV E;  2FNJ B;  4WQM A;  1PGA A;  1Q1O A;  3LDZ E;  3KYD D;  1UH6 A;  1VZ7 A;  2INC C;  2K8C A;  5IKC M;  2HJ1 A;  5L83 A;  4JIO U;  1PGB A;  2D11 A;  2FAZ A;  5JHA A;  1NI3 A;  2BS4 B;  4EE2 A;  3TEY A;  2KMA A;  5LLI A;  3FAH A;  1AAR A;  2BKR B;  3H9D A;  3B2F A;  4YSZ B;  2ZEQ A;  2MBO A;  3GP7 A;  1VRA B;  3VUY A;  2BYE A;  3WCQ A;  4OZB A;  4W9F A;  3UQA A;  2DLB A;  2L76 A;  3W5U B;  1HXY D;  4REZ A;  4LDT D;  1I4Q A;  1RLF A;  3TIX A;  1LFD A;  2JX5 A;  1R7S A;  2J52 A;  2QIL A;  2KDE B;  1S3S G;  1I35 A;  1IGC A;  1ZE3 D;  1STE A;  2KDI A;  3ZJV A;  1LM8 B;  4W9J A;  3DOW A;  2BWE S;  2Q5W D;  3PLV A;  5IA7 A;  4HDO A;  2RGF A;  2KDB A;  4XYC A;  3DBR B;  5IO9 A;  2GMI C;  2N1W A;  4NQL B;  4KKI A;  3NJT A;  4PS8 A;  1MHX A;  4KZC A;  2Z0E B;  4ZOH C;  3A4R A;  2O6V D;  4TUU A;  3HM3 A;  3NVV A;  3PS6 A;  3ZNH B;  2GI9 A;  3AEB B;  3AE5 B;  4ICV A;  2PJH A;  2MX2 A;  1KJT A;  3IT4 B;  1MPE A;  1F2R I;  1EU3 A;  1KFY B;  1L5P A;  2DZI A;  3U30 A;  3AED B;  1JRU A;  3N30 A;  1QLB B;  4ANX A;  4BKS A;  2KWD A;  5C23 A;  2Y3A A;  1WR1 A;  3QJZ A;  3Q8A A;  4MH8 A;  2LHD A;  1D3Z A;  1TKG A;  4BKG A;  3ZIM A;  1UF0 A;  4Q2J A;  5IP4 D;  3N9Y C;  5KHO A;  3PT2 B;  1PGX A;  2K3U A;  2EMS A;  2FCS A;  1VCB A;  2YEP B;  2QJL A;  2QHO A;  2JY6 A;  3NRZ A;  5KHQ A;  4WWM A;  4XWW A;  1AW7 A;  1ZP0 B;  5J17 A;  3Q14 C;  4OVU A;  1YN5 A;  2Z0D B;  3VRB B;  2AX5 A;  4DHZ B;  1D4B A;  2DHZ A;  3ZO5 B;  1Q10 A;  3ECI A;  1VDV A;  2KTF A;  2MJE A;  3DQV A;  2LJ5 A;  4HXD A;  4IWO A;  4FJZ A;  2KK8 A;  1IBX A;  2TSS A;  2CHW A;  5TR5 A;  1V2Y A;  2HDE A;  2W3R A;  1YD8 U;  2W9N A;  4GB9 A;  2M19 A;  4EFO A;  4IG7 B;  2BWF A;  3NZS A;  4OZC A;  4EKU A;  3AE1 B;  4NPN A;  1YOV B;  4MEM A;  2PLP A;  1MJD A;  4R3D A;  3DVG Y;  3Q3N C;  2DZK A;  2UYZ B;  1I42 A;  3Q3F A;  3U2S C;  2XK5 B;  1CQV A;  2RR9 A;  5E6N A;  3LB8 C;  2KFJ A;  4BZA A;  1WXQ A;  4FLH A;  3ZQ4 A;  2XBB C;  2O6V B;  2WX0 A;  3K9P B;  4ZRQ A;  1BML C;  3VUX A;  1KH0 A;  4M0W B;  2J53 A;  1QOA A;  1EWY C;  2BGF A;  1K51 A;  3VFK A;  3TSS A;  2DX5 B;  2K22 A;  1B1Z A;  2ASQ A;  4I6L B;  4LK0 M;  3APD A;  2KQ7 A;  1QOF A;  2KDM A;  1J8C A;  4MDK E;  2N7E A;  2YVC A;  4CO7 A;  2JYE A;  2WGS A;  1HE8 A;  2QDF A;  4MGI E;  3B1L X;  3BK2 A;  5G5G A;  3GE3 C;  4RGO S;  1E6E B;  4WWN A;  2BB6 A;  1CZP A;  1FCL A;  4RM9 A;  4AUQ C;  3LXF A;  4BKT A;  2KFK B;  3AUL A;  4E74 A;  1WGH A;  5GMV A;  3R2I A;  3MTN B;  3N32 A;  5MPO A;  4EZK A;  4KDL B;  3A1Q A;  3CST A;  5I4D A;  2L1A A;  2EKI A;  3GZN I;  1QIL A;  2KJR A;  3VTV A;  2ZPN A;  1V86 A;  2R61 A;  1N62 A;  4FN2 A;  3DWM A;  3SDL C;  1XLP A;  3MC8 A;  2RDB C;  2INP E;  3QHT A;  1SEB D;  3M62 B;  1JWU D;  3VR9 B;  4ZRP A;  2FCM A;  1Z5S B;  1JWS D;  1L4Z B;  3W2D A;  3KVF B;  3PTF C;  4EEW A;  3ETR A;  3HK0 A;  2KT7 A;  1MVK A;  3SFE B;  2LD9 A;  2KHW B;  4EZJ A;  5BMH A;  1T3Q A;  1TY2 A;  5EE9 A;  1SE4 A;  2G1E A;  3HM6 X;  1A5R A;  3GOE A;  2WXM A;  3MFG A;  3AU4 A;  5E6J A;  5IAA C;  2ICI A;  2LGD A;  4A3O A;  4FAD A;  2E3T A;  3HUI A;  4HEA 1;  4J6I A;  1QT9 A;  4WAF A;  2IGG A;  4HKZ E;  1UBQ A;  2Z59 B;  1DGJ A;  3VH3 B;  3DPD A;  4W9I A;  1FFV A;  1ZKH A;  4N9F 4;  3RPF C;  4F7Z A;  1V1O A;  2PPH A;  5DPT A;  3RUI B;  3K9O B;  1K50 A;  2IGD A;  1XXG A;  1UBI A;  1CJE A;  3AXC A;  3P4P B;  4M8M A;  3PO0 A;  1UGJ A;  1GB1 A;  3MJ5 A;  2ONQ A;  2GBM A;  3RUL A;  1TGZ B;  4W9G A;  3DBS A;  2RPV A;  3VHT C;  3E9S A;  4WQO B;  4W9E A;  3Q3O C;  1FFU A;  2CHX A;  3L10 B;  3CSF A;  4GOC A;  2NR2 A;  1WE7 A;  2KC1 A;  1C4C A;  1BXT A;  3NS1 A;  4BBN F;  1QOG A;  3WIM A;  2K1F A;  4S17 A;  1WX8 A;  5AUI A;  4AQ7 A;  4W9C A;  1FEH A;  2WXH A;  4L23 A;  3BVZ A;  3W1S C;  2BQQ A;  3L17 A;  4P7I A;  2KQS A;  2K6D B;  2L32 A;  5JXV A;  2L0F A;  3JSV B;  4L2Y A;  2OJW A;  3QA8 A;  2NPT A;  1FXI A;  4MJS A;  5H92 C;  3MC0 B;  3FIL B;  4FJY A;  2LHE A;  1P9D U;  3DVG X;  4HCP B;  2IY1 B;  2K6Q A;  2KWC A;  3OWE B;  4DWF A;  1IYF A;  2PE9 A;  2DNF A;  3PGE A;  1WX9 A;  3MHS D;  2XK5 A;  1ROE A;  3KWL A;  3DBR I;  3V3X A;  1WYG A;  3PRE A;  4IUM B;  3H7P B;  3KQ4 A;  1J7C A;  3HRD D;  1XF5 L;  4CHK A;  3RNC C;  4DDI D;  2KAJ A;  1D5X C;  4NJ7 A;  3APF A;  4IOI E;  1F0Z A;  3Q8C A;  4JWS C;  2KLC A;  2GOW A;  3BII D;  4JL9 A;  1NI2 A;  3EEC A;  3PPA A;  1SE9 A;  1XCQ L;  4KIK B;  1E8W A;  3RNF C;  2B3A A;  2J4X A;  1D5Z C;  1EWC A;  1DOX A;  1WFY A;  4YWG G;  3NVZ A;  2LRU A;  3FKY A;  2KQ4 X;  4BFR A;  1ZXI A;  3PHX B;  4ZRI A;  1L4D B;  3EHV A;  4RGT A;  5HHD G;  4W9H A;  1SIF A;  1XD3 B;  2O2V B;  4E71 A;  4ZYN A;  2PMV A;  3IFW B;  3SR6 A;  3UQB A;  2KTR A;  1FO4 A;  1FMA D;  4EZL A;  1E90 A;  4XDC A;  1TJE A;  2WWZ A;  4WAA A;  2WDV B;  1A70 A;  3AV8 A;  1HA5 A;  2LI5 A;  3KLS X;  3O13 A;  2NBV B;  2ZVO A;  3VTU A;  1OEY J;  4IM0 A;  1V5T A;  4DDG D;  3MC9 A;  5CTR C;  1P7F A;  4TV3 A;  2PE6 B;  4HJG E;  1PUT A;  4IC7 B;  3L54 A;  1HTQ A;  2V1Y A;  1LO5 D;  2KFK A;  3ABV B;  1G6J A;  3GB1 A;  3BWU D;  4MSM B;  1TS5 A;  3PZ8 A;  4A8X C;  1IUE A;  1X1M A;  3V61 A;  3VXW A;  1H4R A;  1E10 A;  1MHH E;  2KYW A;  2WXK A;  2MSE D;  2KLG A;  3UF8 A;  1TYG B;  3VH4 B;  1KM7 A;  2CKH B;  5D7G A;  1FIQ A;  3BYT B;  1XQQ A;  1VJK A;  3HVZ A;  2V3N A;  3NZU A;  4ZHO A;  4II3 B;  1N5W A;  1GG3 A;  4JQW C;  4IWP A;  1OQQ A;  4HDQ A;  1WWT A;  4B0M A;  4MT5 A;  4ANU A;  2NS5 A;  1JRO A;  3ZJU A;  3RMK C;  2FID A;  4W9L A;  3L0W B;  3V6C B;  3Q3M C;  4F8C B;  2C5L C;  2ZPY A;  2K9X A;  4LCD E;  2J0M A;  3ZKJ C;  3IAM 1;  1SSN A;  1WXM A;  1L2N A;  3W5V B;  3I3T B;  4NY0 A;  5EE0 A;  3U7Z A;  1E7U A;  1EU4 A;  3H7S A;  3N20 C;  3MP9 A;  2IPK D;  4A55 A;  2V4L A;  3B08 A;  3CMM B;  2O6V A;  3U7D A;  1T0R C;  1P7E A;  4C7Z A;  2VH2 A;  2LUE A;  1J7B A;  3DHI C;  1L0X B;  2QIE B;  5DPR A;  2AYO B;  2BBC A;  1V80 A;  3GZN B;  2MP2 A;  2ZCC A;  1V49 A;  2ZJD A;  1AN8 A;  3OJ3 A;  2CR5 A;  1I4R A;  4BKS D;  4W9D A;  2WS3 B;  4HRO A;  2FE8 A;  2WXP A;  3SD5 A;  4KV2 A;  4A6Q A;  1GPX A;  4GDK B;  2KAC A;  2RDH A;  5BYQ A;  1NBF C;  3PRP B;  5JH5 C;  4M0W A;  1V1P A;  2WXG A;  3AEA B;  3U4E G;  3AI5 A;  1N6Z A;  1GC7 A;  3X0W A;  2NTS A;  2BPS A;  1GJZ A;  1FNV A;  3TCA A;  5G55 A;  1JQ4 A;  2NBU A;  1MG8 A;  2EMT A;  3ZW3 A;  1NYR A;  4S0R A;  2KOX A;  5FR3 A;  1PFD A;  2PKO A;  3RZF A;  4AWJ A;  5EE3 A;  5D3D A;  2D3B A;  1DOY A;  4HPM B;  1V1P B;  2INN E;  2KMC A;  2D3G A;  1UD7 A;  1B9R A;  2XNA C;  4A90 A;  4DK5 A;  3N3K B;  1WZ3 A;  3DHH C;  3PRM B;  2MBB B;  4LTU A;  1P98 A;  3UI3 A;  2N9P C;  2VZK B;  4GDL B;  1PDX A;  4KGT A;  4HPP A;  3H7P A;  4LJP B;  4AJY B;  2E6X A;  2G4S A;  3C8Y A;  3KWV A;  5D3I B;  1WM2 A;  5BYR A;  3P4S B;  3H6N A;  4MSQ B;  3WAO A;  2KC2 A;  5BYS A;  4K1R B;  2DWQ A;  4ZDV A;  2N9L A;  2KN4 A;  3Q69 A;  2FUG 1;  1TTN A;  4C00 A;  2LAS A;  1C77 A;  4FXC A;  2L7R A;  1K52 A;  2I1K A;  5D6J B;  5LNK 1;  2OED A;  2IYD B;  3A9J A;  1KRH A;  2KKC A;  3ONS A;  2DZM A;  2LGX A;  4FJV B;  1P1A A;  2BKF A;  2AWT A;  3VRA B;  4BOS C;  5IN7 A;  4AOF A;  3KUC B;  4XWT A;  3GE8 C;  2DYO A;  1YIW A;  3TEZ A;  4FA6 A;  1UGM A;  1WMH B;  2JF5 A;  1F2R C;  3HHM A;  1YQ3 B;  3AEF B;  2WXF A;  2JUO A;  4C56 C;  1VZ6 A;  2L8J A;  2MBH A;  5CHW A;  4NAW A;  4IM2 A;  3EUB 2;  2KJH B;  3QC8 B;  1EO6 A;  1BUI C;  1KLU D;  1GAQ B;  1RRB A;  3T9L A;  4MGK E; 
#chains in the Genus database with same CATH homology
 3GE3 C;  3RNG C;  3N20 C;  2IND C;  3Q3N C;  3RNE C;  3Q2A C;  1T0R C;  2INC C;  3RNF C;  3RI7 C;  3RNA C;  3N1Y C;  1T0S C;  3I63 C;  3RMK C;  3RN9 C;  1T0Q C;  4P1B C;  3DHI C;  3N1Z C;  3Q3M C;  3RNC C;  3Q14 C;  3N1X C;  2RDB C;  4P1C C;  3DHG C;  3I5J C;  3Q3O C;  3RNB C;  3GE8 C;  3DHH C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...