1IGDA

The third igg-binding domain from streptococcal protein g: an analysis by x-ray crystallography of the structure alone and in a complex with fab
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
61
structure length
61
Chain Sequence
b'MTPAVTTYKLVINGKTLKGETTTKAVDAETAEKAFKQYANDNGVDGVWTYDDATKTFTVTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN G
molecule tags Immunoglobulin binding protein
source organism Streptococcus sp. g148
publication title The third IgG-binding domain from streptococcal protein G. An analysis by X-ray crystallography of the structure alone and in a complex with Fab.
pubmed doi rcsb
total genus 16
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 1994-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1igdA00
5BMGA 5BMIA 1HZ5A 1K52A 3FILB 2NMQA 2PW9A 3UI3A 1XCQL 1FCCC 1HEZE 2LHEA 4KGSA 2GI9A 1MPEA 2OEDA 1P7EA 4IKGA 2RMMA 1Q10A 3GB1A 4GLSC 2IGHA 5HFYA 1D4BA 1YNTE 1IBXA 2JWUA 2JZPA 1MHXA 5HI1A 1EM7A 1MI0A 1ZXHA 1MVKA 2JU6X 2K0PA 3MP9A 1UWXA 1PGBA 2PTLA 5BMHA 4OZCA 1XCTL 2EELA 4KGTA 1F2RI 1IGDA 2N9KA 2IGGA 4OZBA 2I2YA 1F2RC 1P7FA 2LUMA 1QKZA 4KGRA 2GB1A 1IBXB 1GB1A 1K51A 2KQ4X 4D2KA 2JSVX 1KH0A 2RPVA 1K53A 1GB4A 2ZW1A 1FD6A 3V3XA 2ZW0A 2LHDA 2ON8A 2ONQA 2QSDA 1PGXA 2IGDA 4MACA 2KACA 4OZAA 2JXTA 2KN4A 4HJGE 2LGIA 1IGCA 1XF5L 2N7JA 2J52A 2J53A 1K50A 3FILA 5HG2A 5JXVA 1FCLA 2I38A 1YMHE 5HHDG 1HZ6A 1MHHE 2N9LA 2KDMA 1PGAA 4HKZE 2KWDA 2QMTA 1C9FA 2PLPA 4WH4A 4IOIE 1JMLA
chains in the Genus database with same CATH superfamily
5BMIA 3KVFB 4HWIB 1PUTA 3FILB 4EZKA 1ESFA 3DVNV 2EKIA 3I9V1 5G5HA 4ARCA 3WA0A 3FKYA 3PVLA 4HROA 2NVUI 4GLSC 2CU1A 4II3B 5IKCM 4M02A 2JX5A 1VR9A 4PYUA 3NZSA 2J4XA 2R2OA 2WX1A 2BBCA 4TQ0A 3BVZA 3T3OA 2KT7A 3WCQA 4B6WA 2JZZA 4YTPB 2FUHB 4HVBA 1I4XA 2KJRA 4L1BA 4YSXB 3A1QA 1ET6A 3ZJTA 3NVZA 4L23A 2V9HA 1ZE3D 2WU2B 4LNFA 1VLBA 2M17A 1ZGUB 2ICIA 4FJZA 2KDBA 1FD6A 3N32A 2MHJA 2L7RA 2MBHA 2ON8A 2ONQA 4ZHPA 3ZDMC 4MACA 2LRWA 2QIEB 2LGIA 4EKUA 1QILA 2D2QA 1K50A 2KWVB 1GPXA 3LJ3A 1PGAA 1RM6C 5MPOA 3U2SC 5J18A 3C19A 3GZNB 4K7SA 3I5JC 2CJNA 3L16A 5J17A 1WR6E 4LNIA 1HZ5A 2OOBB 3A4RA 3I3TB 1JRPA 2DAJA 1FNVA 2MX2A 1KOTA 2D3AA 4E3CA 4LNNA 4WWPA 2IDYA 3M3JA 3MC0B 4IWPA 3RNEC 5AUKA 1HTQA 1OQRA 2KX3A 1V80A 1FRDA 1IBXA 2AQ3B 1BUIC 1V86A 3DQVA 1WGYA 3P4PB 4ICVA 4LDTD 2QEJC 3ZXVA 3DCGA 1UWXA 2ZCBA 1T0SC 3QK0A 1GJZA 2M0AA 1N5XA 4KDLB 4BBNC 3A33B 3KWLA 4EZLA 4N9F4 1RAXA 1UELA 4NAWB 3I63C 3AB5A 3SR6A 3AEGB 1YOVB 1N63A 2KQSA 2M1MA 1SSNA 3JYUA 2GB1A 2KD0A 4PS8A 1QOBA 2LZ6A 1WX7A 1RWSA 4W9HA 3WALA 2XBBC 4AQ7A 2MJEA 2WDVB 4NJCA 4ZRJA 2V3NA 1F52A 3VAWA 2Y3AA 1TGZB 2D07B 1M94A 2IYDB 2VH2A 2DWQA 2ZVOA 3AULA 4II2B 1JRUA 3AMZA 4IWQA 3HVDA 4WURA 4USAA 1XQQA 3R7RA 3ZRCA 2IZVB 1T0RC 4C4VB 2L0TA 2DZJA 2FCMA 2PPHA 1BT0A 2L1AA 4US8A 2LJIA 2TSSA 3AE5B 1R4MI 2LFIA 1YN4A 3M62B 2I1JA 3Q8CA 3VTVA 3V61A 2KXJA 1ZW7A 2YEPF 3PS6A 4P16A 2IPKD 4JLCA 1E7PB 3KUDB 3W1SA 1NI3A 1EWCA 4N59A 2M8SA 2VH1A 2KDFB 3ZJVA 1E90A 1Q10A 3QHTA 2BPSA 1U4AA 2KOXA 3BYYB 3PV1A 4DXGA 2DZIA 2UU7A 1QOGA 3VTUA 3MJ5A 3PGEA 3ZJUA 2ZPNA 2MBBB 3IG3A 3KW5B 1E8XA 2NR2A 3W5VB 2ZCCA 2WXFA 4M00A 2N7EA 2Z8LA 5KHQA 2KHWB 4B9KA 2MBOA 2E6XA 3TUOA 1MJDA 3NZUA 3QX1A 4F1SA 1V6EA 3KUCB 1WX9A 4XDCA 3AH7A 1C1YB 4MSMB 1SIFA 3DWMA 5LXIB 2NBVB 1KFYB 2R61A 2ZW1A 1RYJA 2ZW0A 3RN9C 2DAFA 4GN1A 1Z5SB 2KACA 2REXA 1FO4A 2VRRB 2Y5BB 3BY4B 4GXBA 4FHJA 1FXTB 3EUB2 1D5XC 3HHMA 3Q8BA 2J53A 3TBLD 1PFDA 2BKRB 1ZDXA 1YMHE 3NRZA 4PK1A 2IO2B 2WHIA 3NVWA 3R66C 1NEKB 4KX6B 2SEBD 2PVOD 2V4LA 3Q8AA 2RGFA 4JIOU 2WXKA 1Q5WB 4AS1A 3APFA 2C7NB 4WJPA 4AUQC 3RNAC 2PW9A 3AE4B 2O2VB 1FCCC 3DBSA 5EE9A 1IYFA 3AECB 2LJ5A 3AE7B 3M63B 1D5ZC 1PYWD 2QJLA 3M95A 3N3KB 3Q69A 2XNAC 4OVZA 2MA9B 3A9KB 3QIJA 3ZIMA 4W9KA 4A8XC 2RDBC 3P4QB 1SJHD 1JQ4A 5H92C 2DYBA 3H6NA 5IA7A 1XLQA 2WXJA 4XGAB 3ZTDA 1EU4A 2WXGA 4ZRPA 1CZPA 4DBGA 1V5TA 1WRDB 3N1XC 2V0GA 1NYRA 2G4SA 1IGDA 4RGOS 5L95C 1VDVA 2K6DB 2GBNA 2JPHA 1EO6A 1M4VA 2KMAA 4YXDB 4DXAB 4WAFA 1I4PA 3TEWA 3B0AA 5JHAA 2GOWA 3RZWC 2J0KA 3V60A 3RT3B 3IBEA 4HK2A 1UGJA 3A9KA 4OW0A 2BQQA 3OG5A 1LO5D 1WM3A 2IGDA 2WDQB 2W54A 4HPMB 3EA6A 4TSSA 3B9JA 2IO3B 2KTFA 2LGDA 2C7MB 4IWOA 1FCLA 1E8WA 4NZLB 2UYZB 3V6EB 1IUEA 3ZUNA 3KH0A 1XLPA 5I4DA 2XK5B 2K6QA 4EEWA 2OJRA 1JW9D 5H8YE 3AU4A 2LI5A 1L0XB 5D6JB 2JRHA 1E6EB 4LJPB 4DXFA 4C56C 2DZMA 2NMQA 2V4IB 2JT4B 4LTUA 3WAOA 3KQ4A 2PMVA 3NZ3A 2KKCA 1I42A 4AOFA 3TJPA 3SFDB 3IFWB 2OEDA 1WGRA 1P98A 2O2VA 4FJVB 2MJDA 3VR8B 1B9RA 2KK8A 5BYRA 3IXSA 3PSEB 2WP9B 2WDRB 3DVGX 2RSUA 1KTKA 2YLMA 2WGSA 3TSSA 3T9LA 2AQ2B 1ZXHA 1KLGD 4K7UA 1RLFA 1XD3B 2B76B 2CHXA 4MGZE 5LNK1 4NQLB 1V1PA 3RYTA 4R3DA 5E6NA 2LGYA 5C1ZA 2V3PA 2EELA 3RPFC 2N1WA 1F9JA 4RMAA 3SDLC 3KYDD 1YJ1A 1TT5B 4HCPB 1JWAD 2EMTA 3GOEA 2K8BA 4FLHA 2Z0EB 1YD8U 3SU8X 2O6VD 3ZRFA 3U52E 3ZQ4A 4FXCA 3NS8A 1H8CA 3L08A 1H4RA 4M01A 3V3XA 3PZDA 2LEKA 1KLUD 2XK5A 3WAPA 3J9CA 1I4GA 3MHSD 4IC7B 1G6JA 2LGSA 4P6VF 4C80A 1EUVB 5G5GA 4P7IA 2GBKA 1WY8A 1QLBB 2N9PC 1FNWA 4BVUC 2BGFA 2B3AA 4HRSA 1IPGA 4WIPA 3BVGA 1TZOA 1J8CA 1OGWA 2L05A 2DENB 1L5PA 3OJ4B 1KLVA 3L10B 4DWFA 4JGHB 3HIZA 2KC1A 4KKIA 2L32A 2KDIA 1LGRA 3MHZA 4TQ1A 1FM0D 3FAHA 2BYVE 2BTEA 3PZ7A 3DWGC 4BOSC 1YQBA 1OTRB 2G45B 3W2DA 1YN3A 3NOBA 2BF8B 4KSKC 3V05A 1ACCA 3QAQA 4W9CA 2FE8A 3ZLZA 1R4NB 4ANUA 2EKEC 2MRPA 2OHFA 4G50A 3AI5A 3P4SB 4BKSA 1MHXA 3VH4B 2IO0B 3ZTCA 3IT6B 4WQOB 2LWPA 4MH8A 4NJ6A 5DPSA 1QOAA 1WF9A 1HQRD 3BK1A 4EOYA 2MW5A 1P9DU 2BYTA 4REZA 2YEPB 3PRMB 3U4EG 2H89B 3QJZA 1EWYC 1EF1A 4GMVA 3DBHI 1LXDA 3VFKA 3VQIA 3GS2A 4GOCA 1P7FA 2INPE 1TJEA 4MGKE 3ZYYX 3VVWB 4G3XB 1GB1A 2V3SA 5AUIA 1XEEA 1HXYD 2NPTA 4FHKA 3WAMA 1PGXA 2M4NA 2KLGA 3BIID 4XZ4A 3W1SC 1WXAA 3R2IA 1L0YB 1E10A 4XDDA 1GC6A 2A4ZA 3U30A 2ZNVB 1YIWA 2N9EB 1L6UA 2HD5B 1HZ6A 1MHHE 3RNBC 1V49A 4ITKA 4HKZE 1S1QB 2LVOA 2CS4A 3MJWA 3ZW3A 3RD2A 2KVZA 2QMTA 1E9MA 4FJYA 3HVZA 2NTTA 2GRIA 4JE3B 3LYYA 4MELA 5BMGA 1XLNA 3Q3OC 2HTME 3HM6X 3RI7C 2L83A 2MSED 2KANA 1YJJA 2KWUB 2BWFA 1HEZE 3Q3NC 4W9GA 2LHEA 2L52A 2BKFA 4EUTA 3ZGZA 1P7EA 2L00B 5KHOA 1A70A 3GB1A 4WWNA 1P3QU 2IGHA 1PQSA 2KQ7A 1YNTE 1CJEA 2X8XX 4DDGD 5DPRA 1MVKA 3KYCD 1F0ZA 2RDGA 3C8YA 4HPPA 2HDEA 1AWDA 5EDSA 1C4AA 1LFDA 2ZJDA 2N9KA 2IGGA 3GZNI 3NHEB 3Q6BA 3H7PB 4W9FA 1N5WA 4I6LB 3LXFA 2KNBA 4IG7B 3UIPB 1C76A 1OFFA 2HTHA 1UWMA 2K5PA 3PRZA 2KQ4X 4D2KA 4MJSA 3GE3C 1V97A 4NQKE 1GB4A 4XE0A 1KRHA 1TS5A 1K8RB 3QA8A 2W82A 3QWZB 3PRPB 1J7BA 2CJOA 2L3ZA 1QZEA 1WIAA 3FC4A 4HJGE 3UGBB 3PT2B 4LK0M 3DHGC 4IM2A 4LJOB 3H7SA 2N1VA 1BXTA 5D3IB 3CSTA 1WZ0A 3DBLB 4HEA1 2KDMA 2AEHA 1VZ6A 1T0QC 2E3TA 3R8BA 5AEKB 1SJED 3AV8A 3NVYA 4G0NB 3EHVA 2WXRA 2Q5WD 2FAZA 4W9LA 4YTMB 3JSVA 5BO4B 4US9A 1E5WA 1FXIA 1E8ZA 1A5RA 3BYTB 1MPEA 4WJQA 4B95A 3IHPC 2J0MA 3PPAA 1ZKHA 5D94A 3ZO5B 4IDIA 4B0EA 2L8JA 3A9JB 3AEAB 5D2MB 4CQNA 2HE7A 2WXOA 1WMHA 4QAYA 4YSZB 1L4ZB 2JU6X 4DHJD 2PEAA 1XO3A 4AWJA 2CR5A 4BKSD 2MBEA 3HM3A 3ENEA 1ZUD2 2ACZB 1F2RI 2O6VB 1NYQA 3HRDD 5CHVC 4A3OA 2W3RA 4M8MA 1KJTA 3JSVB 3AE6B 4JQWC 4C4VA 4ZYSA 3ZVVA 1KH0A 3OAWA 2FNJB 2XN9C 5IOIA 3A4SC 2MJ3A 2WQYB 4JWSC 4TKNA 3ONSA 2LUEA 4P1CC 3TEYA 2N7JA 4DHZB 2N7DA 2RR9A 4J6IA 5JXVA 3KUZA 4TUUA 2KDEB 4XWTA 3T8MA 2D3CA 5L83A 1TY2A 3O65B 1WWTA 1L4DB 1SEBD 4BBNF 4IUMB 2MP2B 1E7VA 2WYQA 2AX5A 1AW7A 4M0WA 2JWZA 1DOXA 1GAQB 4IOIE 4MGYE 4MJSB 3TEXA 5IO9A 4FA6A 3VRBB 1WGKA 3URYA 1XCQL 2PE9A 2BW2A 3AE8B 3TIXA 5JHBA 2BS4B 1ZP0B 3I57A 3JVZX 4DDID 3ML8A 2CHWA 1UBIA 3AEFB 4FBJB 3H7PA 1ZPSA 3V6CB 2C7HA 3ZNHB 1Q0WB 2KYWA 2JYEA 2JZPA 3AEEB 1WZ3A 4RNAA 4MEMA 4UDUC 3EFCA 1X1MA 4K81A 4YSYB 5C23A 5G2NA 4WWMA 4A9AA 4JL9A 4GIVA 4F7ZA 1I4RA 4GU2A 3AEBB 2ZZPB 2NPTB 3ETRA 5GMVA 2LXAA 3L0WB 4LNOA 4O1NA 4HDOA 3AM9A 2UWQA 3VUWA 5BYSA 1WMHB 4A55A 3A1QB 3O13A 1WYWB 5IP4D 1Y56A 2KFKB 2V1YA 4DK5A 4PS7A 1CMXB 2PJHA 3DDCB 4KDIC 1XF5L 2NCNA 4HLEA 1YQ4B 1T6BX 2PE6B 3BK2A 2SAKA 3DBHB 4RM8A 2G1EA 4ZRIA 3OLMD 2N9LA 2KMCA 2BYFA 1VCBA 1N6ZA 1J19A 3N1ZC 3N30A 4LLGM 4RFBA 2L0FA 1JWSD 1XXGA 1YX5B 3U7ZA 2RPQA 4YWGG 2OJWA 3SFEB 1SE3A 4MGIE 4W9EA 4YT0B 3HK0A 2RD0A 5JH5C 3B2GA 2QILA 1RFAA 1RRBA 3IAS1 3W9CB 1D4BA 2NBWB 2JWUA 5HI1A 1MI0A 3N1YC 4XYCA 1Z2MA 5HKHA 1WR1A 1XCTL 2D3GA 4MH0E 3P2BA 5T8IA 2LD9A 3KLSX 2JF5A 1WJNA 1UD7A 2C5LC 2JZ3B 4Q2JA 4OZBA 1F2RC 1FPYA 1TY0A 2LUMA 2K8HA 5IAAC 3APDA 1WX8A 4XC2A 4ARIA 2MWSB 4BFRA 1FFUA 4J3OD 2RDHA 4H2AA 1ZDVA 3RULA 2JXTA 3TMPB 2WXPA 2W3SA 4ZDVA 3APCA 1UUPA 1D6EC 4S17A 1E7UA 4MSQB 1HE8A 2IBIB 4HDQA 2WS3B 3Q8FA 1N62A 2AWTA 2CU3A 2KWDA 3DHHC 2VZKD 3BINA 1GUAB 4F8CB 4GGQA 4IW0A 4ZOHC 3IAM1 2M19A 3DBRI 1L0VB 3VDZA 3H9DA 3L13A 1WJ4A 1WI0A 4ZYNA 1DOYA 2HJ1A 4AP4C 1WE7A 3E56A 1WJUA 2KVRA 3RUIB 1TS4A 4IKGA 5DPWA 2X38A 2J42A 5HFYA 2LGXA 3SHQA 1MFWA 2ZEQA 4AJYB 2Z0DB 3VHTC 2WXLA 1T3QA 3X0WA 3DVNU 1F1HA 4LNKA 1QOFA 5CHWA 3UF8A 4N6EB 1YN5A 3UQAA 2DZKA 3EFUA 2PTLA 4NPNA 1V5OA 1UNSA 3GP7A 1E8YA 1HA5A 4WJOA 2I2YA 4DHJB 1V1OA 1QKZA 3QC8B 2FIFA 1KM7A 1Q1OA 4NJ7A 3PHWB 3RNFC 3NUHB 5FR6A 3WANA 4BKGA 2R2QA 1FMAD 3RCZA 3BWUD 1OEYJ 1R4MB 2KMMA 3VRAB 1TZ1A 5CX3A 2PIAA 4OZAA 3Q3FA 4KZ0A 5JZEB 2G4DB 5LLIA 2J52A 3PLUA 3ZXRA 3P1MA 4GDKB 5BYQA 3ALBA 4JWUC 2FUG1 5HHDG 5LXHA 4DQOC 4A3PA 1SGHA 3EGRA 2NS5A 2LASA 3WIMA 2BB6A 1OQQA 1JWMD 1FFVA 4OHJA 5GXGB 3AE3B 2LVPA 3B1LX 3PO0A 2AYOB 4TV3A 4ZHOA 1SE4A 1UZXB 3UIOB 1E0ZA 4P1BC 5TR5A 3VH3B 2Y5PA 3AE9B 2JQRB 3RFZB 3R2TA 1ZXIA 2JRIB 2L76A 2MH7A 1VJKA 1L2NA 3Q2AC 1CQVA 4RH6A 4CYEA 4KZCA 1I35A 3AE1B 4MM3B 1B1ZA 4RM9A 1EF5A 1I4QA 1FXAA 4RF0A 1C3TA 4OVUA 2BYEA 1PGBA 2LXCA 4LCDE 3ZNGC 3NS1A 1WXMA 1UH6A 1C4CA 1C78A 1JWBD 1UGMA 4KGRA 1IBXB 3ML9A 2NBUA 3AXCA 2KLCA 3Q3JA 2K9XA 1QT9A 3KWVA 2JYTA 3RNGC 1VRAB 2GBJA 4W9DA 2LMCA 2LVQA 4URKA 2AQ1B 2N9XA 1JALA 4G11A 4PYZA 3W1YA 3BZDB 2M56B 3RMKC 4HJKA 4ACFA 2DLBA 2J0JA 4RF1A 1RFKA 4S0RA 3AE2B 2BS2B 2A5UA 3AU5A 1TBEA 2WDTB 3PREA 3ECIA 3OWEB 2MCNB 4IM3A 1YX6B 3DOWA 5FKAC 2KO3A 4WAAA 4MDKE 3S2AA 1K52A 4MT5A 4FN2A 3NY5A 3IVFA 2DYOA 2WX0A 3LB8C 1TIFA 3L17A 1L7YA 4EZJA 2KFJA 1FEHA 5DPTA 4XX5A 4GSWA 3R3MA 5EE3A 2KTRA 1CK1A 2WWZA 4W9IA 1XLOA 3PTFC 1TTNA 4BKTA 3ZNZB 2KFKA 1TKEA 2K39A 4BZAA 1V81A 2JXXA 2WU5B 4EE2A 4PT5A 1SE9A 2GMIC 4KVGB 2DX5B 3PZ8A 2GLSA 2K0PA 4C00A 2ZPYA 4NY0A 3A9JA 1WM2A 1SF0A 4NAWA 4RGMA 2NTSA 4C7ZA 4OZCA 1DYQA 2BWES 2IY1B 1VD2A 3CMMB 3RZFA 1FIQA 1N60A 2INNE 3N20C 1WXSA 1TKGA 4BAXA 4IM0A 3H8HA 2N0SB 2WXMA 3P4RB 2BS3B 3UQBA 1YJIA 4TMAB 3B2FA 1UF0A 4ZRKA 2BB5A 1K53A 3EECA 1XT9B 2QSDA 1IP9A 4ICUA 2JVCA 1WSPA 3VUYA 3P42A 2IY0B 1IGCA 1JCKB 3IT4B 2QDFA 1MG4A 3Q14C 3FILA 5HG2A 1ET9A 2MLBA 1EU3A 1SBBB 2VZKB 4WQMA 4HKQA 2WLBA 1WGHA 2AL3A 1SE2A 1C9FA 2KTRB 3NG0A 1TKYA 2PLPA 2QHOA 1P0RA 1JMLA 3VUXA 4EFOA 1LQBA 4BOZB 2FCQA 1C77A 5FK9C 2DBYA 1WXVA 2WNMA 4A90A 4KKJA 1SXTA 2KN5A 2ZNVC 4K3CA 5EE1A 1D5MC 4FULA 2K22A 1WGDA 1I7HA 1KF6B 2RMMA 2KAJA 3T3NA 3K9OB 4C7YA 3DHIC 1ISNA 4ZRQA 2M0XA 2D3BA 3Q8EA 2PVGC 1WE6A 3ZDTA 2AL6A 4B0MA 1GC7A 2HJ8A 3AEDB 3L4PA 4DHZE 4KSLC 3CWIA 1Y8RC 1SIJA 3ABVB 4HCNB 4ASWC 1J7AA 2XEWA 4A6QA 2MEKA 3LDZE 2QCZA 2MP2A 2FCNA 2JY6A 3N9YC 2JSVX 3L54A 2RPVA 2W9NA 4M0WB 1F77A 2LHDA 2CHZA 2MQJA 4X57B 4GDLB 5C2TB 4AJWA 3QQ8B 5D3DA 2K1FA 3V62A 4I6NB 2BVCA 4WWOA 2WXIA 4A20A 1I4HA 1WGGA 3OJ3A 3VTWA 4M8NA 1JWUD 3K9PB 2WXHA 3ZNID 2MBQA 1D3ZA 1DOIA 2W55A 4E71A 2FCSA 4HXDA 1OEYA 2WXNA 3NJTA 4JPSA 2GBMA 4FADA 1NVID 3DBRB 1PDXA 1V2YA 3DPDA 4GDKA 4L2YA 5AZFA 5AZGA 4NAMA 3QCAA 3ZKJC 1WRIA 4KIKA 4KGSA 2GI9A 2DNFA 5TSSA 2IJ0A 1N61A 1WYGA 3PHXB 2KJ6A 2DYMA 2FBWB 4RGTA 1FNUA 3B08A 5IN7A 2KWCA 3E9SA 2D5GA 1STEA 3VR9B 1GG3A 1EM7A 4YL8A 4RGNA 2K3UA 4HPLB 1WJ6A 2LRUA 5AZHA 3R7QA 3QARA 5BMHA 1BMLC 1ENFA 1WH3A 1QF6A 4LDTB 3D32A 4RCOA 2J7QB 1V8CA 4E74A 1P1AA 5E6PA 4N58A 1S3SG 1L6VA 3H1UA 3SD5A 5EE0A 4MM3A 2YVCA 5E6OA 3VXWA 1T0YA 3P63A 2BT6A 1K51A 3MC9A 1J7CA 3NVVA 3SEBA 1MG8A 2N4FA 4CO7A 2KJHB 2WXQA 2D10A 2D11A 2FIDA 3BVMA 3MTNB 5G55A 5C3JB 2Y5CA 2INDC 2I38A 3DBLI 4K7WA 1TS3A 3AN1A 4CHKA 1SB3C 1AYFA 1WXQA 2PKOA 3RNCC 1NI2A 5FR3A 1NENB 4KIKB 2K25A 4YTNB 3C0RB 1AN8A 4ANVA 2IO1B 2GBRA 3TCAA 2KC2A 5DCNA 4GB9A 4XWWA 1C4PA 2K8CA 3U8ZA 5D7GA 1R4NI 3UI3A 2EMSA 4I6PA 1J0GA 3UINB 3TL5A 3CSFA 3PLVA 5J2RA 1YQ3B 1QQRA 4PS3A 1VZ8A 2G3QB 2I1KA 1NBFC 1V1PB 1WFYA 1TYGB 3JW0X 1AARA 3U7DA 2INCC 1TS2A 3MP9A 1GNUA 4GDLA 4KGTA 2ASQA 1ZOYB 4OVVA 2G9HD 5E6JA 4ANWA 1GOZA 2CKHB 1NDDA 1DGJA 2H88B 2C60A 3HUIA 1VZ7A 4W9JA 4K1RB 2Z59B 4KV2A 1R7SA 4ANXA 1JROA 3EC8A 2JUOA 4NNJB 4WJNA 3TEZA 1LM8B 1V9JA 3DVGY 4K3BA 3GE8C 3X23A 2KN4A 2KX0A 1HTOA 1T5XD 1OQYA 2DHZA 1ROEA 3W5UB 1UBQA 3Q3MC 4JX1C 2KZRA 1FRRA 2QC8A 5CTRC 3CF6E 2O6VA 3MFGA 3MC8A 2C9WB 1C79A 2ZVNA 3CIRB 5CHFA 4WH4A
chains in the Genus database with same CATH topology
1E6EB 4DXFA 4C56C 5BMIA 1K52A 1PUTA 4MT5A 3FILB 2NMQA 3VRBB 1WGKA 2DYOA 2V4IB 3LB8C 1XCQL 1ESFA 4LTUA 3URYA 3KQ4A 2PMVA 2BW2A 3AE8B 2EKIA 3NZ3A 2BS4B 1FEHA 1ZP0B 3I57A 3I9V1 5G5HA 4ARCA 5EE3A 3SFDB 2OEDA 1CK1A 2MJDA 3VR8B 1B9RA 3AEFB 4HROA 1ZPSA 1XLOA 4GLSC 5BYRA 3IXSA 2WP9B 2WDRB 1KTKA 1TKEA 3TSSA 2WU5B 4EE2A 2JX5A 2AQ2B 2JYEA 2JZPA 4PT5A 1VR9A 1ZXHA 1KLGD 3AEEB 2J4XA 2B76B 4RNAA 3PZ8A 2K0PA 5LNK1 2BBCA 4UDUC 1V1PA 1SF0A 4TQ0A 4R3DA 3BVZA 3T3OA 4RGMA 2NTSA 4C7ZA 4OZCA 1DYQA 2V3PA 4YSYB 3WCQA 2EELA 4WWMA 4A9AA 3RPFC 1FIQA 1N60A 2INNE 4YTPB 1TKGA 1I4XA 3H8HA 2N0SB 1JWAD 2WXMA 3P4RB 4L1BA 4YSXB 3ZJTA 1ET6A 2BS3B 1I4RA 3NVZA 4L23A 3AEBB 1ZE3D 2WU2B 1YJIA 3ETRA 4TMAB 3B2FA 3U52E 1VLBA 3ZQ4A 4FXCA 2BB5A 2ICIA 1K53A 4O1NA 1FD6A 3V3XA 3AM9A 2ON8A 2ONQA 5BYSA 2LEKA 1KLUD 2QSDA 4A55A 4ZHPA 3O13A 4MACA 1WSPA 1Y56A 2QIEB 3J9CA 1I4GA 3P42A 2LGIA 1IGCA 1JCKB 3IT4B 1QILA 4P6VF 1XF5L 4C80A 5G5GA 1QLBB 1YQ4B 1T6BX 3BK2A 2SAKA 3FILA 1K50A 1ET9A 1FNWA 5HG2A 2G1EA 1GPXA 4HRSA 1EU3A 1SBBB 2VZKB 4WQMA 4WIPA 4HKQA 3BVGA 2N9LA 1TZOA 1PGAA 2WLBA 1RM6C 5MPOA 1L5PA 3U2SC 1SE2A 1C9FA 4LLGM 4RFBA 1TKYA 2PLPA 2CJNA 4KKIA 2L32A 1JMLA 1JWSD 1XXGA 1C77A 1HZ5A 3U7ZA 3MHZA 5FK9C 4TQ1A 4YWGG 1FM0D 1JRPA 2DBYA 3FAHA 3SFEB 1SE3A 2BTEA 3PZ7A 2WNMA 3DWGC 4A90A 1FNVA 4KKJA 1SXTA 5EE1A 4YT0B 1D5MC 3W2DA 1YN3A 2K22A 3B2GA 3V05A 1ACCA 1I7HA 2QILA 1KF6B 2IDYA 2FE8A 3MC0B 2RMMA 5AUKA 1OQRA 3IAS1 3W9CB 1D4BA 2KAJA 2OHFA 3T3NA 3P4SB 1FRDA 1IBXA 2JWUA 2AQ3B 1MHXA 5HI1A 1BUIC 1MI0A 3P4PB 4C7YA 3IT6B 2QEJC 4MH8A 4ZRQA 1UWXA 1QOAA 1HQRD 3BK1A 1XCTL 2BYTA 2M0AA 3Q8EA 1N5XA 2PVGC 4REZA 2YEPB 3KWLA 4B0MA 3U4EG 5T8IA 2H89B 3AEDB 3L4PA 3CWIA 1EWYC 3KLSX 3VQIA 4NAWB 3GS2A 3AB5A 1SIJA 3ABVB 3AEGB 3SR6A 4Q2JA 4OZBA 2INPE 1F2RC 1J7AA 1P7FA 1TY0A 1N63A 1TJEA 2LUMA 4A6QA 2MEKA 1SSNA 3ZYYX 2GB1A 1QOBA 1GB1A 3N9YC 1RWSA 2JSVX 2RPVA 4ARIA 5AUIA 1XEEA 1HXYD 1F77A 2LHDA 4AQ7A 2MJEA 2WDVB 4NJCA 1FFUA 1PGXA 4J3OD 2RDHA 2V3NA 4H2AA 2Y3AA 3BIID 1ZDVA 4GDLB 2JXTA 2WXPA 2W3SA 3R2IA 5C2TB 1L0YB 1UUPA 1D6EC 2DWQA 1E10A 4XDDA 5D3DA 3AMZA 4WURA 3HVDA 4USAA 1L6UA 2WS3B 1HZ6A 1MHHE 3Q8FA 1N62A 2WXIA 4ITKA 1I4HA 4HKZE 2CU3A 2KWDA 1JWUD 2QMTA 1E9MA 2VZKD 2WXHA 3HVZA 1DOIA 2NTTA 2W55A 2GRIA 4JE3B 2L1AA 3LYYA 4US8A 4JPSA 2WXNA 2LJIA 4ZOHC 5BMGA 1NVID 2TSSA 1PDXA 1XLNA 3AE5B 2M19A 3IAM1 1L0VB 2HTME 2LFIA 1YN4A 2L83A 4L2YA 3Q8CA 4NAMA 1YJJA 1HEZE 1WRIA 2LHEA 2L52A 2YEPF 4KGSA 3ZGZA 2GI9A 4P16A 1DOYA 5TSSA 2IJ0A 1N61A 3E56A 1WYGA 1P7EA 1E7PB 2IPKD 3W1SA 1NI3A 2DYMA 1EWCA 1TS4A 2FBWB 4IKGA 4N59A 4RGTA 3ZJVA 2X38A 1A70A 2J42A 1Q10A 1FNUA 3GB1A 3BYYB 4DXGA 2IGHA 3E9SA 5HFYA 1YNTE 1CJEA 2D5GA 1QOGA 1STEA 3VR9B 1EM7A 3MJ5A 4RGNA 2K3UA 1MVKA 2WXLA 3ZJUA 1T3QA 1F0ZA 2RDGA 1QOFA 3C8YA 1YN5A 4N6EB 3W5VB 2PTLA 5BMHA 2HDEA 1BMLC 1UNSA 3GP7A 1ENFA 2WXFA 1AWDA 1QF6A 2Z8LA 1C4AA 1HA5A 4RCOA 2N9KA 2E6XA 3TUOA 1V8CA 2IGGA 4N58A 2I2YA 4XDCA 1L6VA 1V1OA 1QKZA 3AH7A 5EE0A 1N5WA 3LXFA 3P63A 1C76A 2BT6A 1OFFA 3NUHB 3DWMA 1UWMA 2K5PA 1K51A 2KQ4X 4D2KA 1KFYB 2R61A 1J7CA 1FMAD 3BWUD 1V97A 1GB4A 2KMMA 2ZW1A 3VRAB 1RYJA 2ZW0A 4XE0A 1KRHA 3NVVA 1TS5A 3SEBA 2W82A 2KACA 2PIAA 4OZAA 1J7BA 2CJOA 1FO4A 3FC4A 4HJGE 2WXQA 4LK0M 3EUB2 2J52A 1D5XC 3BVMA 3Q8BA 2J53A 3P1MA 4GDKB 5C3JB 2Y5CA 5BYQA 1PFDA 4JWUC 1BXTA 2I38A 1ZDXA 5D3IB 2FUG1 1YMHE 1TS3A 3AN1A 3NRZA 5HHDG 4DQOC 4HEA1 1SB3C 1AYFA 1WXQA 2PKOA 2KDMA 1VZ6A 5FR3A 1NENB 3EGRA 2E3TA 4YTNB 3R8BA 1SJED 3NVWA 1NEKB 2BB6A 3AV8A 3NVYA 4KX6B 1AN8A 1OQQA 2PVOD 1JWMD 2SEBD 3Q8AA 2WXRA 2Q5WD 1FFVA 4OHJA 5GXGB 2WXKA 4XWWA 3AE3B 4AS1A 4YTMB 1C4PA 5D7GA 4US9A 3PO0A 2PW9A 3AE4B 3UI3A 5EE9A 1FCCC 4ZHOA 1FXIA 1SE4A 3AECB 3BYTB 1E0ZA 1MPEA 2Y5PA 3AE7B 1D5ZC 1PYWD 2JQRB 2QJLA 3AE9B 3Q69A 3RFZB 2XNAC 4OVZA 3R2TA 1ZXIA 2MH7A 1YQ3B 1QQRA 1VJKA 4A8XC 1VZ8A 3P4QB 4IDIA 1CQVA 4B0EA 1SJHD 1V1PB 1JQ4A 3AEAB 1TYGB 4RH6A 5H92C 4CQNA 2WXOA 1XLQA 3AE1B 2WXJA 4MM3B 1EU4A 1B1ZA 1L4ZB 4YSZB 2JU6X 2WXGA 1TS2A 4ZRPA 1XO3A 3MP9A 1I4QA 1FXAA 4RF0A 1CZPA 1PGBA 3NS1A 1ZUD2 4KGTA 2ACZB 2V0GA 1F2RI 1NYRA 1C4CA 1IGDA 4RGOS 1ZOYB 2G9HD 5E6JA 1NYQA 1GOZA 3HRDD 1C78A 1DGJA 1VDVA 2H88B 1JWBD 1M4VA 3HUIA 1VZ7A 4YXDB 2W3RA 4KGRA 4WAFA 1I4PA 3AE6B 3TEWA 1IBXB 4ZYSA 1KH0A 1R7SA 2K9XA 1QT9A 1JROA 3KWVA 2JYTA 1VRAB 2LMCA 2XN9C 1UGJA 4OW0A 1LO5D 4JWSC 2AQ1B 2MJ3A 2WQYB 2IGDA 3TEZA 2WDQB 1JALA 3TEYA 2KN4A 2W54A 4TSSA 3EA6A 3B9JA 1T5XD 2N7JA 3BZDB 2M56B 1ROEA 5JXVA 2DLBA 1FCLA 3W5UB 4RF1A 4XWTA 4JX1C 1RFKA 1FRRA 3AE2B 4NZLB 1TY2A 2BS2B 1IUEA 1SEBD 1L4DB 1WWTA 1XLPA 5I4DA 3MFGA 3OWEB 1C79A 2AX5A 1AW7A 1JW9D 3CIRB 4M0WA 4WH4A 5FKAC 5H8YE 1DOXA 1GAQB 4IOIE 1L0XB 3TEXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BMG A;  5BMI A;  1HZ5 A;  1K52 A;  3FIL B;  2NMQ A;  2PW9 A;  3UI3 A;  1XCQ L;  1FCC C;  1HEZ E;  2LHE A;  4KGS A;  2GI9 A;  1MPE A;  2OED A;  1P7E A;  4IKG A;  2RMM A;  1Q10 A;  3GB1 A;  4GLS C;  2IGH A;  5HFY A;  1D4B A;  1YNT E;  1IBX A;  2JWU A;  2JZP A;  1MHX A;  5HI1 A;  1EM7 A;  1MI0 A;  1ZXH A;  1MVK A;  2JU6 X;  2K0P A;  3MP9 A;  1UWX A;  1PGB A;  2PTL A;  5BMH A;  4OZC A;  1XCT L;  2EEL A;  4KGT A;  1F2R I;  1IGD A;  2N9K A;  2IGG A;  4OZB A;  2I2Y A;  1F2R C;  1P7F A;  2LUM A;  1QKZ A;  4KGR A;  2GB1 A;  1IBX B;  1GB1 A;  1K51 A;  2KQ4 X;  4D2K A;  2JSV X;  1KH0 A;  2RPV A;  1K53 A;  1GB4 A;  2ZW1 A;  1FD6 A;  3V3X A;  2ZW0 A;  2LHD A;  2ON8 A;  2ONQ A;  2QSD A;  1PGX A;  2IGD A;  4MAC A;  2KAC A;  4OZA A;  2JXT A;  2KN4 A;  4HJG E;  2LGI A;  1IGC A;  1XF5 L;  2N7J A;  2J52 A;  2J53 A;  1K50 A;  3FIL A;  5HG2 A;  5JXV A;  1FCL A;  2I38 A;  1YMH E;  5HHD G;  1HZ6 A;  1MHH E;  2N9L A;  2KDM A;  1PGA A;  4HKZ E;  2KWD A;  2QMT A;  1C9F A;  2PLP A;  4WH4 A;  4IOI E;  1JML A; 
#chains in the Genus database with same CATH topology
 5BMI A;  3KVF B;  4HWI B;  1PUT A;  3FIL B;  4EZK A;  1ESF A;  3DVN V;  2EKI A;  3I9V 1;  5G5H A;  4ARC A;  3WA0 A;  3FKY A;  3PVL A;  4HRO A;  2NVU I;  4GLS C;  2CU1 A;  4II3 B;  5IKC M;  4M02 A;  2JX5 A;  1VR9 A;  4PYU A;  3NZS A;  2J4X A;  2R2O A;  2WX1 A;  2BBC A;  4TQ0 A;  3BVZ A;  3T3O A;  2KT7 A;  3WCQ A;  4B6W A;  2JZZ A;  4YTP B;  2FUH B;  4HVB A;  1I4X A;  2KJR A;  4L1B A;  4YSX B;  3A1Q A;  1ET6 A;  3ZJT A;  3NVZ A;  4L23 A;  2V9H A;  1ZE3 D;  2WU2 B;  4LNF A;  1VLB A;  2M17 A;  1ZGU B;  2ICI A;  4FJZ A;  2KDB A;  1FD6 A;  3N32 A;  2MHJ A;  2L7R A;  2MBH A;  2ON8 A;  2ONQ A;  4ZHP A;  3ZDM C;  4MAC A;  2LRW A;  2QIE B;  2LGI A;  4EKU A;  1QIL A;  2D2Q A;  1K50 A;  2KWV B;  1GPX A;  3LJ3 A;  1PGA A;  1RM6 C;  5MPO A;  3U2S C;  5J18 A;  3C19 A;  3GZN B;  4K7S A;  3I5J C;  2CJN A;  3L16 A;  5J17 A;  1WR6 E;  4LNI A;  1HZ5 A;  2OOB B;  3A4R A;  3I3T B;  1JRP A;  2DAJ A;  1FNV A;  2MX2 A;  1KOT A;  2D3A A;  4E3C A;  4LNN A;  4WWP A;  2IDY A;  3M3J A;  3MC0 B;  4IWP A;  3RNE C;  5AUK A;  1HTQ A;  1OQR A;  2KX3 A;  1V80 A;  1FRD A;  1IBX A;  2AQ3 B;  1BUI C;  1V86 A;  3DQV A;  1WGY A;  3P4P B;  4ICV A;  4LDT D;  2QEJ C;  3ZXV A;  3DCG A;  1UWX A;  2ZCB A;  1T0S C;  3QK0 A;  1GJZ A;  2M0A A;  1N5X A;  4KDL B;  4BBN C;  3A33 B;  3KWL A;  4EZL A;  4N9F 4;  1RAX A;  1UEL A;  4NAW B;  3I63 C;  3AB5 A;  3SR6 A;  3AEG B;  1YOV B;  1N63 A;  2KQS A;  2M1M A;  1SSN A;  3JYU A;  2GB1 A;  2KD0 A;  4PS8 A;  1QOB A;  2LZ6 A;  1WX7 A;  1RWS A;  4W9H A;  3WAL A;  2XBB C;  4AQ7 A;  2MJE A;  2WDV B;  4NJC A;  4ZRJ A;  2V3N A;  1F52 A;  3VAW A;  2Y3A A;  1TGZ B;  2D07 B;  1M94 A;  2IYD B;  2VH2 A;  2DWQ A;  2ZVO A;  3AUL A;  4II2 B;  1JRU A;  3AMZ A;  4IWQ A;  3HVD A;  4WUR A;  4USA A;  1XQQ A;  3R7R A;  3ZRC A;  2IZV B;  1T0R C;  4C4V B;  2L0T A;  2DZJ A;  2FCM A;  2PPH A;  1BT0 A;  2L1A A;  4US8 A;  2LJI A;  2TSS A;  3AE5 B;  1R4M I;  2LFI A;  1YN4 A;  3M62 B;  2I1J A;  3Q8C A;  3VTV A;  3V61 A;  2KXJ A;  1ZW7 A;  2YEP F;  3PS6 A;  4P16 A;  2IPK D;  4JLC A;  1E7P B;  3KUD B;  3W1S A;  1NI3 A;  1EWC A;  4N59 A;  2M8S A;  2VH1 A;  2KDF B;  3ZJV A;  1E90 A;  1Q10 A;  3QHT A;  2BPS A;  1U4A A;  2KOX A;  3BYY B;  3PV1 A;  4DXG A;  2DZI A;  2UU7 A;  1QOG A;  3VTU A;  3MJ5 A;  3PGE A;  3ZJU A;  2ZPN A;  2MBB B;  3IG3 A;  3KW5 B;  1E8X A;  2NR2 A;  3W5V B;  2ZCC A;  2WXF A;  4M00 A;  2N7E A;  2Z8L A;  5KHQ A;  2KHW B;  4B9K A;  2MBO A;  2E6X A;  3TUO A;  1MJD A;  3NZU A;  3QX1 A;  4F1S A;  1V6E A;  3KUC B;  1WX9 A;  4XDC A;  3AH7 A;  1C1Y B;  4MSM B;  1SIF A;  3DWM A;  5LXI B;  2NBV B;  1KFY B;  2R61 A;  2ZW1 A;  1RYJ A;  2ZW0 A;  3RN9 C;  2DAF A;  4GN1 A;  1Z5S B;  2KAC A;  2REX A;  1FO4 A;  2VRR B;  2Y5B B;  3BY4 B;  4GXB A;  4FHJ A;  1FXT B;  3EUB 2;  1D5X C;  3HHM A;  3Q8B A;  2J53 A;  3TBL D;  1PFD A;  2BKR B;  1ZDX A;  1YMH E;  3NRZ A;  4PK1 A;  2IO2 B;  2WHI A;  3NVW A;  3R66 C;  1NEK B;  4KX6 B;  2SEB D;  2PVO D;  2V4L A;  3Q8A A;  2RGF A;  4JIO U;  2WXK A;  1Q5W B;  4AS1 A;  3APF A;  2C7N B;  4WJP A;  4AUQ C;  3RNA C;  2PW9 A;  3AE4 B;  2O2V B;  1FCC C;  3DBS A;  5EE9 A;  1IYF A;  3AEC B;  2LJ5 A;  3AE7 B;  3M63 B;  1D5Z C;  1PYW D;  2QJL A;  3M95 A;  3N3K B;  3Q69 A;  2XNA C;  4OVZ A;  2MA9 B;  3A9K B;  3QIJ A;  3ZIM A;  4W9K A;  4A8X C;  2RDB C;  3P4Q B;  1SJH D;  1JQ4 A;  5H92 C;  2DYB A;  3H6N A;  5IA7 A;  1XLQ A;  2WXJ A;  4XGA B;  3ZTD A;  1EU4 A;  2WXG A;  4ZRP A;  1CZP A;  4DBG A;  1V5T A;  1WRD B;  3N1X C;  2V0G A;  1NYR A;  2G4S A;  1IGD A;  4RGO S;  5L95 C;  1VDV A;  2K6D B;  2GBN A;  2JPH A;  1EO6 A;  1M4V A;  2KMA A;  4YXD B;  4DXA B;  4WAF A;  1I4P A;  3TEW A;  3B0A A;  5JHA A;  2GOW A;  3RZW C;  2J0K A;  3V60 A;  3RT3 B;  3IBE A;  4HK2 A;  1UGJ A;  3A9K A;  4OW0 A;  2BQQ A;  3OG5 A;  1LO5 D;  1WM3 A;  2IGD A;  2WDQ B;  2W54 A;  4HPM B;  3EA6 A;  4TSS A;  3B9J A;  2IO3 B;  2KTF A;  2LGD A;  2C7M B;  4IWO A;  1FCL A;  1E8W A;  4NZL B;  2UYZ B;  3V6E B;  1IUE A;  3ZUN A;  3KH0 A;  1XLP A;  5I4D A;  2XK5 B;  2K6Q A;  4EEW A;  2OJR A;  1JW9 D;  5H8Y E;  3AU4 A;  2LI5 A;  1L0X B;  5D6J B;  2JRH A;  1E6E B;  4LJP B;  4DXF A;  4C56 C;  2DZM A;  2NMQ A;  2V4I B;  2JT4 B;  4LTU A;  3WAO A;  3KQ4 A;  2PMV A;  3NZ3 A;  2KKC A;  1I42 A;  4AOF A;  3TJP A;  3SFD B;  3IFW B;  2OED A;  1WGR A;  1P98 A;  2O2V A;  4FJV B;  2MJD A;  3VR8 B;  1B9R A;  2KK8 A;  5BYR A;  3IXS A;  3PSE B;  2WP9 B;  2WDR B;  3DVG X;  2RSU A;  1KTK A;  2YLM A;  2WGS A;  3TSS A;  3T9L A;  2AQ2 B;  1ZXH A;  1KLG D;  4K7U A;  1RLF A;  1XD3 B;  2B76 B;  2CHX A;  4MGZ E;  5LNK 1;  4NQL B;  1V1P A;  3RYT A;  4R3D A;  5E6N A;  2LGY A;  5C1Z A;  2V3P A;  2EEL A;  3RPF C;  2N1W A;  1F9J A;  4RMA A;  3SDL C;  3KYD D;  1YJ1 A;  1TT5 B;  4HCP B;  1JWA D;  2EMT A;  3GOE A;  2K8B A;  4FLH A;  2Z0E B;  1YD8 U;  3SU8 X;  2O6V D;  3ZRF A;  3U52 E;  3ZQ4 A;  4FXC A;  3NS8 A;  1H8C A;  3L08 A;  1H4R A;  4M01 A;  3V3X A;  3PZD A;  2LEK A;  1KLU D;  2XK5 A;  3WAP A;  3J9C A;  1I4G A;  3MHS D;  4IC7 B;  1G6J A;  2LGS A;  4P6V F;  4C80 A;  1EUV B;  5G5G A;  4P7I A;  2GBK A;  1WY8 A;  1QLB B;  2N9P C;  1FNW A;  4BVU C;  2BGF A;  2B3A A;  4HRS A;  1IPG A;  4WIP A;  3BVG A;  1TZO A;  1J8C A;  1OGW A;  2L05 A;  2DEN B;  1L5P A;  3OJ4 B;  1KLV A;  3L10 B;  4DWF A;  4JGH B;  3HIZ A;  2KC1 A;  4KKI A;  2L32 A;  2KDI A;  1LGR A;  3MHZ A;  4TQ1 A;  1FM0 D;  3FAH A;  2BYV E;  2BTE A;  3PZ7 A;  3DWG C;  4BOS C;  1YQB A;  1OTR B;  2G45 B;  3W2D A;  1YN3 A;  3NOB A;  2BF8 B;  4KSK C;  3V05 A;  1ACC A;  3QAQ A;  4W9C A;  2FE8 A;  3ZLZ A;  1R4N B;  4ANU A;  2EKE C;  2MRP A;  2OHF A;  4G50 A;  3AI5 A;  3P4S B;  4BKS A;  1MHX A;  3VH4 B;  2IO0 B;  3ZTC A;  3IT6 B;  4WQO B;  2LWP A;  4MH8 A;  4NJ6 A;  5DPS A;  1QOA A;  1WF9 A;  1HQR D;  3BK1 A;  4EOY A;  2MW5 A;  1P9D U;  2BYT A;  4REZ A;  2YEP B;  3PRM B;  3U4E G;  2H89 B;  3QJZ A;  1EWY C;  1EF1 A;  4GMV A;  3DBH I;  1LXD A;  3VFK A;  3VQI A;  3GS2 A;  4GOC A;  1P7F A;  2INP E;  1TJE A;  4MGK E;  3ZYY X;  3VVW B;  4G3X B;  1GB1 A;  2V3S A;  5AUI A;  1XEE A;  1HXY D;  2NPT A;  4FHK A;  3WAM A;  1PGX A;  2M4N A;  2KLG A;  3BII D;  4XZ4 A;  3W1S C;  1WXA A;  3R2I A;  1L0Y B;  1E10 A;  4XDD A;  1GC6 A;  2A4Z A;  3U30 A;  2ZNV B;  1YIW A;  2N9E B;  1L6U A;  2HD5 B;  1HZ6 A;  1MHH E;  3RNB C;  1V49 A;  4ITK A;  4HKZ E;  1S1Q B;  2LVO A;  2CS4 A;  3MJW A;  3ZW3 A;  3RD2 A;  2KVZ A;  2QMT A;  1E9M A;  4FJY A;  3HVZ A;  2NTT A;  2GRI A;  4JE3 B;  3LYY A;  4MEL A;  5BMG A;  1XLN A;  3Q3O C;  2HTM E;  3HM6 X;  3RI7 C;  2L83 A;  2MSE D;  2KAN A;  1YJJ A;  2KWU B;  2BWF A;  1HEZ E;  3Q3N C;  4W9G A;  2LHE A;  2L52 A;  2BKF A;  4EUT A;  3ZGZ A;  1P7E A;  2L00 B;  5KHO A;  1A70 A;  3GB1 A;  4WWN A;  1P3Q U;  2IGH A;  1PQS A;  2KQ7 A;  1YNT E;  1CJE A;  2X8X X;  4DDG D;  5DPR A;  1MVK A;  3KYC D;  1F0Z A;  2RDG A;  3C8Y A;  4HPP A;  2HDE A;  1AWD A;  5EDS A;  1C4A A;  1LFD A;  2ZJD A;  2N9K A;  2IGG A;  3GZN I;  3NHE B;  3Q6B A;  3H7P B;  4W9F A;  1N5W A;  4I6L B;  3LXF A;  2KNB A;  4IG7 B;  3UIP B;  1C76 A;  1OFF A;  2HTH A;  1UWM A;  2K5P A;  3PRZ A;  2KQ4 X;  4D2K A;  4MJS A;  3GE3 C;  1V97 A;  4NQK E;  1GB4 A;  4XE0 A;  1KRH A;  1TS5 A;  1K8R B;  3QA8 A;  2W82 A;  3QWZ B;  3PRP B;  1J7B A;  2CJO A;  2L3Z A;  1QZE A;  1WIA A;  3FC4 A;  4HJG E;  3UGB B;  3PT2 B;  4LK0 M;  3DHG C;  4IM2 A;  4LJO B;  3H7S A;  2N1V A;  1BXT A;  5D3I B;  3CST A;  1WZ0 A;  3DBL B;  4HEA 1;  2KDM A;  2AEH A;  1VZ6 A;  1T0Q C;  2E3T A;  3R8B A;  5AEK B;  1SJE D;  3AV8 A;  3NVY A;  4G0N B;  3EHV A;  2WXR A;  2Q5W D;  2FAZ A;  4W9L A;  4YTM B;  3JSV A;  5BO4 B;  4US9 A;  1E5W A;  1FXI A;  1E8Z A;  1A5R A;  3BYT B;  1MPE A;  4WJQ A;  4B95 A;  3IHP C;  2J0M A;  3PPA A;  1ZKH A;  5D94 A;  3ZO5 B;  4IDI A;  4B0E A;  2L8J A;  3A9J B;  3AEA B;  5D2M B;  4CQN A;  2HE7 A;  2WXO A;  1WMH A;  4QAY A;  4YSZ B;  1L4Z B;  2JU6 X;  4DHJ D;  2PEA A;  1XO3 A;  4AWJ A;  2CR5 A;  4BKS D;  2MBE A;  3HM3 A;  3ENE A;  1ZUD 2;  2ACZ B;  1F2R I;  2O6V B;  1NYQ A;  3HRD D;  5CHV C;  4A3O A;  2W3R A;  4M8M A;  1KJT A;  3JSV B;  3AE6 B;  4JQW C;  4C4V A;  4ZYS A;  3ZVV A;  1KH0 A;  3OAW A;  2FNJ B;  2XN9 C;  5IOI A;  3A4S C;  2MJ3 A;  2WQY B;  4JWS C;  4TKN A;  3ONS A;  2LUE A;  4P1C C;  3TEY A;  2N7J A;  4DHZ B;  2N7D A;  2RR9 A;  4J6I A;  5JXV A;  3KUZ A;  4TUU A;  2KDE B;  4XWT A;  3T8M A;  2D3C A;  5L83 A;  1TY2 A;  3O65 B;  1WWT A;  1L4D B;  1SEB D;  4BBN F;  4IUM B;  2MP2 B;  1E7V A;  2WYQ A;  2AX5 A;  1AW7 A;  4M0W A;  2JWZ A;  1DOX A;  1GAQ B;  4IOI E;  4MGY E;  4MJS B;  3TEX A;  5IO9 A;  4FA6 A;  3VRB B;  1WGK A;  3URY A;  1XCQ L;  2PE9 A;  2BW2 A;  3AE8 B;  3TIX A;  5JHB A;  2BS4 B;  1ZP0 B;  3I57 A;  3JVZ X;  4DDI D;  3ML8 A;  2CHW A;  1UBI A;  3AEF B;  4FBJ B;  3H7P A;  1ZPS A;  3V6C B;  2C7H A;  3ZNH B;  1Q0W B;  2KYW A;  2JYE A;  2JZP A;  3AEE B;  1WZ3 A;  4RNA A;  4MEM A;  4UDU C;  3EFC A;  1X1M A;  4K81 A;  4YSY B;  5C23 A;  5G2N A;  4WWM A;  4A9A A;  4JL9 A;  4GIV A;  4F7Z A;  1I4R A;  4GU2 A;  3AEB B;  2ZZP B;  2NPT B;  3ETR A;  5GMV A;  2LXA A;  3L0W B;  4LNO A;  4O1N A;  4HDO A;  3AM9 A;  2UWQ A;  3VUW A;  5BYS A;  1WMH B;  4A55 A;  3A1Q B;  3O13 A;  1WYW B;  5IP4 D;  1Y56 A;  2KFK B;  2V1Y A;  4DK5 A;  4PS7 A;  1CMX B;  2PJH A;  3DDC B;  4KDI C;  1XF5 L;  2NCN A;  4HLE A;  1YQ4 B;  1T6B X;  2PE6 B;  3BK2 A;  2SAK A;  3DBH B;  4RM8 A;  2G1E A;  4ZRI A;  3OLM D;  2N9L A;  2KMC A;  2BYF A;  1VCB A;  1N6Z A;  1J19 A;  3N1Z C;  3N30 A;  4LLG M;  4RFB A;  2L0F A;  1JWS D;  1XXG A;  1YX5 B;  3U7Z A;  2RPQ A;  4YWG G;  2OJW A;  3SFE B;  1SE3 A;  4MGI E;  4W9E A;  4YT0 B;  3HK0 A;  2RD0 A;  5JH5 C;  3B2G A;  2QIL A;  1RFA A;  1RRB A;  3IAS 1;  3W9C B;  1D4B A;  2NBW B;  2JWU A;  5HI1 A;  1MI0 A;  3N1Y C;  4XYC A;  1Z2M A;  5HKH A;  1WR1 A;  1XCT L;  2D3G A;  4MH0 E;  3P2B A;  5T8I A;  2LD9 A;  3KLS X;  2JF5 A;  1WJN A;  1UD7 A;  2C5L C;  2JZ3 B;  4Q2J A;  4OZB A;  1F2R C;  1FPY A;  1TY0 A;  2LUM A;  2K8H A;  5IAA C;  3APD A;  1WX8 A;  4XC2 A;  4ARI A;  2MWS B;  4BFR A;  1FFU A;  4J3O D;  2RDH A;  4H2A A;  1ZDV A;  3RUL A;  2JXT A;  3TMP B;  2WXP A;  2W3S A;  4ZDV A;  3APC A;  1UUP A;  1D6E C;  4S17 A;  1E7U A;  4MSQ B;  1HE8 A;  2IBI B;  4HDQ A;  2WS3 B;  3Q8F A;  1N62 A;  2AWT A;  2CU3 A;  2KWD A;  3DHH C;  2VZK D;  3BIN A;  1GUA B;  4F8C B;  4GGQ A;  4IW0 A;  4ZOH C;  3IAM 1;  2M19 A;  3DBR I;  1L0V B;  3VDZ A;  3H9D A;  3L13 A;  1WJ4 A;  1WI0 A;  4ZYN A;  1DOY A;  2HJ1 A;  4AP4 C;  1WE7 A;  3E56 A;  1WJU A;  2KVR A;  3RUI B;  1TS4 A;  4IKG A;  5DPW A;  2X38 A;  2J42 A;  5HFY A;  2LGX A;  3SHQ A;  1MFW A;  2ZEQ A;  4AJY B;  2Z0D B;  3VHT C;  2WXL A;  1T3Q A;  3X0W A;  3DVN U;  1F1H A;  4LNK A;  1QOF A;  5CHW A;  3UF8 A;  4N6E B;  1YN5 A;  3UQA A;  2DZK A;  3EFU A;  2PTL A;  4NPN A;  1V5O A;  1UNS A;  3GP7 A;  1E8Y A;  1HA5 A;  4WJO A;  2I2Y A;  4DHJ B;  1V1O A;  1QKZ A;  3QC8 B;  2FIF A;  1KM7 A;  1Q1O A;  4NJ7 A;  3PHW B;  3RNF C;  3NUH B;  5FR6 A;  3WAN A;  4BKG A;  2R2Q A;  1FMA D;  3RCZ A;  3BWU D;  1OEY J;  1R4M B;  2KMM A;  3VRA B;  1TZ1 A;  5CX3 A;  2PIA A;  4OZA A;  3Q3F A;  4KZ0 A;  5JZE B;  2G4D B;  5LLI A;  2J52 A;  3PLU A;  3ZXR A;  3P1M A;  4GDK B;  5BYQ A;  3ALB A;  4JWU C;  2FUG 1;  5HHD G;  5LXH A;  4DQO C;  4A3P A;  1SGH A;  3EGR A;  2NS5 A;  2LAS A;  3WIM A;  2BB6 A;  1OQQ A;  1JWM D;  1FFV A;  4OHJ A;  5GXG B;  3AE3 B;  2LVP A;  3B1L X;  3PO0 A;  2AYO B;  4TV3 A;  4ZHO A;  1SE4 A;  1UZX B;  3UIO B;  1E0Z A;  4P1B C;  5TR5 A;  3VH3 B;  2Y5P A;  3AE9 B;  2JQR B;  3RFZ B;  3R2T A;  1ZXI A;  2JRI B;  2L76 A;  2MH7 A;  1VJK A;  1L2N A;  3Q2A C;  1CQV A;  4RH6 A;  4CYE A;  4KZC A;  1I35 A;  3AE1 B;  4MM3 B;  1B1Z A;  4RM9 A;  1EF5 A;  1I4Q A;  1FXA A;  4RF0 A;  1C3T A;  4OVU A;  2BYE A;  1PGB A;  2LXC A;  4LCD E;  3ZNG C;  3NS1 A;  1WXM A;  1UH6 A;  1C4C A;  1C78 A;  1JWB D;  1UGM A;  4KGR A;  1IBX B;  3ML9 A;  2NBU A;  3AXC A;  2KLC A;  3Q3J A;  2K9X A;  1QT9 A;  3KWV A;  2JYT A;  3RNG C;  1VRA B;  2GBJ A;  4W9D A;  2LMC A;  2LVQ A;  4URK A;  2AQ1 B;  2N9X A;  1JAL A;  4G11 A;  4PYZ A;  3W1Y A;  3BZD B;  2M56 B;  3RMK C;  4HJK A;  4ACF A;  2DLB A;  2J0J A;  4RF1 A;  1RFK A;  4S0R A;  3AE2 B;  2BS2 B;  2A5U A;  3AU5 A;  1TBE A;  2WDT B;  3PRE A;  3ECI A;  3OWE B;  2MCN B;  4IM3 A;  1YX6 B;  3DOW A;  5FKA C;  2KO3 A;  4WAA A;  4MDK E;  3S2A A;  1K52 A;  4MT5 A;  4FN2 A;  3NY5 A;  3IVF A;  2DYO A;  2WX0 A;  3LB8 C;  1TIF A;  3L17 A;  1L7Y A;  4EZJ A;  2KFJ A;  1FEH A;  5DPT A;  4XX5 A;  4GSW A;  3R3M A;  5EE3 A;  2KTR A;  1CK1 A;  2WWZ A;  4W9I A;  1XLO A;  3PTF C;  1TTN A;  4BKT A;  3ZNZ B;  2KFK A;  1TKE A;  2K39 A;  4BZA A;  1V81 A;  2JXX A;  2WU5 B;  4EE2 A;  4PT5 A;  1SE9 A;  2GMI C;  4KVG B;  2DX5 B;  3PZ8 A;  2GLS A;  2K0P A;  4C00 A;  2ZPY A;  4NY0 A;  3A9J A;  1WM2 A;  1SF0 A;  4NAW A;  4RGM A;  2NTS A;  4C7Z A;  4OZC A;  1DYQ A;  2BWE S;  2IY1 B;  1VD2 A;  3CMM B;  3RZF A;  1FIQ A;  1N60 A;  2INN E;  3N20 C;  1WXS A;  1TKG A;  4BAX A;  4IM0 A;  3H8H A;  2N0S B;  2WXM A;  3P4R B;  2BS3 B;  3UQB A;  1YJI A;  4TMA B;  3B2F A;  1UF0 A;  4ZRK A;  2BB5 A;  1K53 A;  3EEC A;  1XT9 B;  2QSD A;  1IP9 A;  4ICU A;  2JVC A;  1WSP A;  3VUY A;  3P42 A;  2IY0 B;  1IGC A;  1JCK B;  3IT4 B;  2QDF A;  1MG4 A;  3Q14 C;  3FIL A;  5HG2 A;  1ET9 A;  2MLB A;  1EU3 A;  1SBB B;  2VZK B;  4WQM A;  4HKQ A;  2WLB A;  1WGH A;  2AL3 A;  1SE2 A;  1C9F A;  2KTR B;  3NG0 A;  1TKY A;  2PLP A;  2QHO A;  1P0R A;  1JML A;  3VUX A;  4EFO A;  1LQB A;  4BOZ B;  2FCQ A;  1C77 A;  5FK9 C;  2DBY A;  1WXV A;  2WNM A;  4A90 A;  4KKJ A;  1SXT A;  2KN5 A;  2ZNV C;  4K3C A;  5EE1 A;  1D5M C;  4FUL A;  2K22 A;  1WGD A;  1I7H A;  1KF6 B;  2RMM A;  2KAJ A;  3T3N A;  3K9O B;  4C7Y A;  3DHI C;  1ISN A;  4ZRQ A;  2M0X A;  2D3B A;  3Q8E A;  2PVG C;  1WE6 A;  3ZDT A;  2AL6 A;  4B0M A;  1GC7 A;  2HJ8 A;  3AED B;  3L4P A;  4DHZ E;  4KSL C;  3CWI A;  1Y8R C;  1SIJ A;  3ABV B;  4HCN B;  4ASW C;  1J7A A;  2XEW A;  4A6Q A;  2MEK A;  3LDZ E;  2QCZ A;  2MP2 A;  2FCN A;  2JY6 A;  3N9Y C;  2JSV X;  3L54 A;  2RPV A;  2W9N A;  4M0W B;  1F77 A;  2LHD A;  2CHZ A;  2MQJ A;  4X57 B;  4GDL B;  5C2T B;  4AJW A;  3QQ8 B;  5D3D A;  2K1F A;  3V62 A;  4I6N B;  2BVC A;  4WWO A;  2WXI A;  4A20 A;  1I4H A;  1WGG A;  3OJ3 A;  3VTW A;  4M8N A;  1JWU D;  3K9P B;  2WXH A;  3ZNI D;  2MBQ A;  1D3Z A;  1DOI A;  2W55 A;  4E71 A;  2FCS A;  4HXD A;  1OEY A;  2WXN A;  3NJT A;  4JPS A;  2GBM A;  4FAD A;  1NVI D;  3DBR B;  1PDX A;  1V2Y A;  3DPD A;  4GDK A;  4L2Y A;  5AZF A;  5AZG A;  4NAM A;  3QCA A;  3ZKJ C;  1WRI A;  4KIK A;  4KGS A;  2GI9 A;  2DNF A;  5TSS A;  2IJ0 A;  1N61 A;  1WYG A;  3PHX B;  2KJ6 A;  2DYM A;  2FBW B;  4RGT A;  1FNU A;  3B08 A;  5IN7 A;  2KWC A;  3E9S A;  2D5G A;  1STE A;  3VR9 B;  1GG3 A;  1EM7 A;  4YL8 A;  4RGN A;  2K3U A;  4HPL B;  1WJ6 A;  2LRU A;  5AZH A;  3R7Q A;  3QAR A;  5BMH A;  1BML C;  1ENF A;  1WH3 A;  1QF6 A;  4LDT B;  3D32 A;  4RCO A;  2J7Q B;  1V8C A;  4E74 A;  1P1A A;  5E6P A;  4N58 A;  1S3S G;  1L6V A;  3H1U A;  3SD5 A;  5EE0 A;  4MM3 A;  2YVC A;  5E6O A;  3VXW A;  1T0Y A;  3P63 A;  2BT6 A;  1K51 A;  3MC9 A;  1J7C A;  3NVV A;  3SEB A;  1MG8 A;  2N4F A;  4CO7 A;  2KJH B;  2WXQ A;  2D10 A;  2D11 A;  2FID A;  3BVM A;  3MTN B;  5G55 A;  5C3J B;  2Y5C A;  2IND C;  2I38 A;  3DBL I;  4K7W A;  1TS3 A;  3AN1 A;  4CHK A;  1SB3 C;  1AYF A;  1WXQ A;  2PKO A;  3RNC C;  1NI2 A;  5FR3 A;  1NEN B;  4KIK B;  2K25 A;  4YTN B;  3C0R B;  1AN8 A;  4ANV A;  2IO1 B;  2GBR A;  3TCA A;  2KC2 A;  5DCN A;  4GB9 A;  4XWW A;  1C4P A;  2K8C A;  3U8Z A;  5D7G A;  1R4N I;  3UI3 A;  2EMS A;  4I6P A;  1J0G A;  3UIN B;  3TL5 A;  3CSF A;  3PLV A;  5J2R A;  1YQ3 B;  1QQR A;  4PS3 A;  1VZ8 A;  2G3Q B;  2I1K A;  1NBF C;  1V1P B;  1WFY A;  1TYG B;  3JW0 X;  1AAR A;  3U7D A;  2INC C;  1TS2 A;  3MP9 A;  1GNU A;  4GDL A;  4KGT A;  2ASQ A;  1ZOY B;  4OVV A;  2G9H D;  5E6J A;  4ANW A;  1GOZ A;  2CKH B;  1NDD A;  1DGJ A;  2H88 B;  2C60 A;  3HUI A;  1VZ7 A;  4W9J A;  4K1R B;  2Z59 B;  4KV2 A;  1R7S A;  4ANX A;  1JRO A;  3EC8 A;  2JUO A;  4NNJ B;  4WJN A;  3TEZ A;  1LM8 B;  1V9J A;  3DVG Y;  4K3B A;  3GE8 C;  3X23 A;  2KN4 A;  2KX0 A;  1HTO A;  1T5X D;  1OQY A;  2DHZ A;  1ROE A;  3W5U B;  1UBQ A;  3Q3M C;  4JX1 C;  2KZR A;  1FRR A;  2QC8 A;  5CTR C;  3CF6 E;  2O6V A;  3MFG A;  3MC8 A;  2C9W B;  1C79 A;  2ZVN A;  3CIR B;  5CHF A;  4WH4 A; 
#chains in the Genus database with same CATH homology
 1E6E B;  4DXF A;  4C56 C;  5BMI A;  1K52 A;  1PUT A;  4MT5 A;  3FIL B;  2NMQ A;  3VRB B;  1WGK A;  2DYO A;  2V4I B;  3LB8 C;  1XCQ L;  1ESF A;  4LTU A;  3URY A;  3KQ4 A;  2PMV A;  2BW2 A;  3AE8 B;  2EKI A;  3NZ3 A;  2BS4 B;  1FEH A;  1ZP0 B;  3I57 A;  3I9V 1;  5G5H A;  4ARC A;  5EE3 A;  3SFD B;  2OED A;  1CK1 A;  2MJD A;  3VR8 B;  1B9R A;  3AEF B;  4HRO A;  1ZPS A;  1XLO A;  4GLS C;  5BYR A;  3IXS A;  2WP9 B;  2WDR B;  1KTK A;  1TKE A;  3TSS A;  2WU5 B;  4EE2 A;  2JX5 A;  2AQ2 B;  2JYE A;  2JZP A;  4PT5 A;  1VR9 A;  1ZXH A;  1KLG D;  3AEE B;  2J4X A;  2B76 B;  4RNA A;  3PZ8 A;  2K0P A;  5LNK 1;  2BBC A;  4UDU C;  1V1P A;  1SF0 A;  4TQ0 A;  4R3D A;  3BVZ A;  3T3O A;  4RGM A;  2NTS A;  4C7Z A;  4OZC A;  1DYQ A;  2V3P A;  4YSY B;  3WCQ A;  2EEL A;  4WWM A;  4A9A A;  3RPF C;  1FIQ A;  1N60 A;  2INN E;  4YTP B;  1TKG A;  1I4X A;  3H8H A;  2N0S B;  1JWA D;  2WXM A;  3P4R B;  4L1B A;  4YSX B;  3ZJT A;  1ET6 A;  2BS3 B;  1I4R A;  3NVZ A;  4L23 A;  3AEB B;  1ZE3 D;  2WU2 B;  1YJI A;  3ETR A;  4TMA B;  3B2F A;  3U52 E;  1VLB A;  3ZQ4 A;  4FXC A;  2BB5 A;  2ICI A;  1K53 A;  4O1N A;  1FD6 A;  3V3X A;  3AM9 A;  2ON8 A;  2ONQ A;  5BYS A;  2LEK A;  1KLU D;  2QSD A;  4A55 A;  4ZHP A;  3O13 A;  4MAC A;  1WSP A;  1Y56 A;  2QIE B;  3J9C A;  1I4G A;  3P42 A;  2LGI A;  1IGC A;  1JCK B;  3IT4 B;  1QIL A;  4P6V F;  1XF5 L;  4C80 A;  5G5G A;  1QLB B;  1YQ4 B;  1T6B X;  3BK2 A;  2SAK A;  3FIL A;  1K50 A;  1ET9 A;  1FNW A;  5HG2 A;  2G1E A;  1GPX A;  4HRS A;  1EU3 A;  1SBB B;  2VZK B;  4WQM A;  4WIP A;  4HKQ A;  3BVG A;  2N9L A;  1TZO A;  1PGA A;  2WLB A;  1RM6 C;  5MPO A;  1L5P A;  3U2S C;  1SE2 A;  1C9F A;  4LLG M;  4RFB A;  1TKY A;  2PLP A;  2CJN A;  4KKI A;  2L32 A;  1JML A;  1JWS D;  1XXG A;  1C77 A;  1HZ5 A;  3U7Z A;  3MHZ A;  5FK9 C;  4TQ1 A;  4YWG G;  1FM0 D;  1JRP A;  2DBY A;  3FAH A;  3SFE B;  1SE3 A;  2BTE A;  3PZ7 A;  2WNM A;  3DWG C;  4A90 A;  1FNV A;  4KKJ A;  1SXT A;  5EE1 A;  4YT0 B;  1D5M C;  3W2D A;  1YN3 A;  2K22 A;  3B2G A;  3V05 A;  1ACC A;  1I7H A;  2QIL A;  1KF6 B;  2IDY A;  2FE8 A;  3MC0 B;  2RMM A;  5AUK A;  1OQR A;  3IAS 1;  3W9C B;  1D4B A;  2KAJ A;  2OHF A;  3T3N A;  3P4S B;  1FRD A;  1IBX A;  2JWU A;  2AQ3 B;  1MHX A;  5HI1 A;  1BUI C;  1MI0 A;  3P4P B;  4C7Y A;  3IT6 B;  2QEJ C;  4MH8 A;  4ZRQ A;  1UWX A;  1QOA A;  1HQR D;  3BK1 A;  1XCT L;  2BYT A;  2M0A A;  3Q8E A;  1N5X A;  2PVG C;  4REZ A;  2YEP B;  3KWL A;  4B0M A;  3U4E G;  5T8I A;  2H89 B;  3AED B;  3L4P A;  3CWI A;  1EWY C;  3KLS X;  3VQI A;  4NAW B;  3GS2 A;  3AB5 A;  1SIJ A;  3ABV B;  3AEG B;  3SR6 A;  4Q2J A;  4OZB A;  2INP E;  1F2R C;  1J7A A;  1P7F A;  1TY0 A;  1N63 A;  1TJE A;  2LUM A;  4A6Q A;  2MEK A;  1SSN A;  3ZYY X;  2GB1 A;  1QOB A;  1GB1 A;  3N9Y C;  1RWS A;  2JSV X;  2RPV A;  4ARI A;  5AUI A;  1XEE A;  1HXY D;  1F77 A;  2LHD A;  4AQ7 A;  2MJE A;  2WDV B;  4NJC A;  1FFU A;  1PGX A;  4J3O D;  2RDH A;  2V3N A;  4H2A A;  2Y3A A;  3BII D;  1ZDV A;  4GDL B;  2JXT A;  2WXP A;  2W3S A;  3R2I A;  5C2T B;  1L0Y B;  1UUP A;  1D6E C;  2DWQ A;  1E10 A;  4XDD A;  5D3D A;  3AMZ A;  4WUR A;  3HVD A;  4USA A;  1L6U A;  2WS3 B;  1HZ6 A;  1MHH E;  3Q8F A;  1N62 A;  2WXI A;  4ITK A;  1I4H A;  4HKZ E;  2CU3 A;  2KWD A;  1JWU D;  2QMT A;  1E9M A;  2VZK D;  2WXH A;  3HVZ A;  1DOI A;  2NTT A;  2W55 A;  2GRI A;  4JE3 B;  2L1A A;  3LYY A;  4US8 A;  4JPS A;  2WXN A;  2LJI A;  4ZOH C;  5BMG A;  1NVI D;  2TSS A;  1PDX A;  1XLN A;  3AE5 B;  2M19 A;  3IAM 1;  1L0V B;  2HTM E;  2LFI A;  1YN4 A;  2L83 A;  4L2Y A;  3Q8C A;  4NAM A;  1YJJ A;  1HEZ E;  1WRI A;  2LHE A;  2L52 A;  2YEP F;  4KGS A;  3ZGZ A;  2GI9 A;  4P16 A;  1DOY A;  5TSS A;  2IJ0 A;  1N61 A;  3E56 A;  1WYG A;  1P7E A;  1E7P B;  2IPK D;  3W1S A;  1NI3 A;  2DYM A;  1EWC A;  1TS4 A;  2FBW B;  4IKG A;  4N59 A;  4RGT A;  3ZJV A;  2X38 A;  1A70 A;  2J42 A;  1Q10 A;  1FNU A;  3GB1 A;  3BYY B;  4DXG A;  2IGH A;  3E9S A;  5HFY A;  1YNT E;  1CJE A;  2D5G A;  1QOG A;  1STE A;  3VR9 B;  1EM7 A;  3MJ5 A;  4RGN A;  2K3U A;  1MVK A;  2WXL A;  3ZJU A;  1T3Q A;  1F0Z A;  2RDG A;  1QOF A;  3C8Y A;  1YN5 A;  4N6E B;  3W5V B;  2PTL A;  5BMH A;  2HDE A;  1BML C;  1UNS A;  3GP7 A;  1ENF A;  2WXF A;  1AWD A;  1QF6 A;  2Z8L A;  1C4A A;  1HA5 A;  4RCO A;  2N9K A;  2E6X A;  3TUO A;  1V8C A;  2IGG A;  4N58 A;  2I2Y A;  4XDC A;  1L6V A;  1V1O A;  1QKZ A;  3AH7 A;  5EE0 A;  1N5W A;  3LXF A;  3P63 A;  1C76 A;  2BT6 A;  1OFF A;  3NUH B;  3DWM A;  1UWM A;  2K5P A;  1K51 A;  2KQ4 X;  4D2K A;  1KFY B;  2R61 A;  1J7C A;  1FMA D;  3BWU D;  1V97 A;  1GB4 A;  2KMM A;  2ZW1 A;  3VRA B;  1RYJ A;  2ZW0 A;  4XE0 A;  1KRH A;  3NVV A;  1TS5 A;  3SEB A;  2W82 A;  2KAC A;  2PIA A;  4OZA A;  1J7B A;  2CJO A;  1FO4 A;  3FC4 A;  4HJG E;  2WXQ A;  4LK0 M;  3EUB 2;  2J52 A;  1D5X C;  3BVM A;  3Q8B A;  2J53 A;  3P1M A;  4GDK B;  5C3J B;  2Y5C A;  5BYQ A;  1PFD A;  4JWU C;  1BXT A;  2I38 A;  1ZDX A;  5D3I B;  2FUG 1;  1YMH E;  1TS3 A;  3AN1 A;  3NRZ A;  5HHD G;  4DQO C;  4HEA 1;  1SB3 C;  1AYF A;  1WXQ A;  2PKO A;  2KDM A;  1VZ6 A;  5FR3 A;  1NEN B;  3EGR A;  2E3T A;  4YTN B;  3R8B A;  1SJE D;  3NVW A;  1NEK B;  2BB6 A;  3AV8 A;  3NVY A;  4KX6 B;  1AN8 A;  1OQQ A;  2PVO D;  1JWM D;  2SEB D;  3Q8A A;  2WXR A;  2Q5W D;  1FFV A;  4OHJ A;  5GXG B;  2WXK A;  4XWW A;  3AE3 B;  4AS1 A;  4YTM B;  1C4P A;  5D7G A;  4US9 A;  3PO0 A;  2PW9 A;  3AE4 B;  3UI3 A;  5EE9 A;  1FCC C;  4ZHO A;  1FXI A;  1SE4 A;  3AEC B;  3BYT B;  1E0Z A;  1MPE A;  2Y5P A;  3AE7 B;  1D5Z C;  1PYW D;  2JQR B;  2QJL A;  3AE9 B;  3Q69 A;  3RFZ B;  2XNA C;  4OVZ A;  3R2T A;  1ZXI A;  2MH7 A;  1YQ3 B;  1QQR A;  1VJK A;  4A8X C;  1VZ8 A;  3P4Q B;  4IDI A;  1CQV A;  4B0E A;  1SJH D;  1V1P B;  1JQ4 A;  3AEA B;  1TYG B;  4RH6 A;  5H92 C;  4CQN A;  2WXO A;  1XLQ A;  3AE1 B;  2WXJ A;  4MM3 B;  1EU4 A;  1B1Z A;  1L4Z B;  4YSZ B;  2JU6 X;  2WXG A;  1TS2 A;  4ZRP A;  1XO3 A;  3MP9 A;  1I4Q A;  1FXA A;  4RF0 A;  1CZP A;  1PGB A;  3NS1 A;  1ZUD 2;  4KGT A;  2ACZ B;  2V0G A;  1F2R I;  1NYR A;  1C4C A;  1IGD A;  4RGO S;  1ZOY B;  2G9H D;  5E6J A;  1NYQ A;  1GOZ A;  3HRD D;  1C78 A;  1DGJ A;  1VDV A;  2H88 B;  1JWB D;  1M4V A;  3HUI A;  1VZ7 A;  4YXD B;  2W3R A;  4KGR A;  4WAF A;  1I4P A;  3AE6 B;  3TEW A;  1IBX B;  4ZYS A;  1KH0 A;  1R7S A;  2K9X A;  1QT9 A;  1JRO A;  3KWV A;  2JYT A;  1VRA B;  2LMC A;  2XN9 C;  1UGJ A;  4OW0 A;  1LO5 D;  4JWS C;  2AQ1 B;  2MJ3 A;  2WQY B;  2IGD A;  3TEZ A;  2WDQ B;  1JAL A;  3TEY A;  2KN4 A;  2W54 A;  4TSS A;  3EA6 A;  3B9J A;  1T5X D;  2N7J A;  3BZD B;  2M56 B;  1ROE A;  5JXV A;  2DLB A;  1FCL A;  3W5U B;  4RF1 A;  4XWT A;  4JX1 C;  1RFK A;  1FRR A;  3AE2 B;  4NZL B;  1TY2 A;  2BS2 B;  1IUE A;  1SEB D;  1L4D B;  1WWT A;  1XLP A;  5I4D A;  3MFG A;  3OWE B;  1C79 A;  2AX5 A;  1AW7 A;  1JW9 D;  3CIR B;  4M0W A;  4WH4 A;  5FKA C;  5H8Y E;  1DOX A;  1GAQ B;  4IOI E;  1L0X B;  3TEX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...