1IGDA

The third igg-binding domain from streptococcal protein g: an analysis by x-ray crystallography of the structure alone and in a complex with fab
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
61
structure length
61
Chain Sequence
MTPAVTTYKLVINGKTLKGETTTKAVDAETAEKAFKQYANDNGVDGVWTYDDATKTFTVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The third IgG-binding domain from streptococcal protein G. An analysis by X-ray crystallography of the structure alone and in a complex with Fab.
pubmed doi rcsb
source organism Streptococcus sp. g148
molecule tags Immunoglobulin binding protein
molecule keywords PROTEIN G
total genus 16
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 1994-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1igdA00
5JXVA 2IGHA 4IOIE 2ZW1A 1IGDA 5HG2A 2IGDA 1Q10A 4IKGA 1P7FA 1FCLA 3MP9A 1C9FA 2I38A 2JWUA 1F2RC 2ON8A 4OZBA 1K51A 1YNTE 2KQ4X 2IGGA 2JXTA 4KGTA 1IBXA 1K52A 2LGIA 2PTLA 1UWXA 5HI1A 1MPEA 1FD6A 1MHXA 1P7EA 1EM7A 2JSVX 1F2RI 2KACA 2N9KA 3FILB 4KGRA 3V3XA 1HZ5A 1HEZE 2NMQA 1K53A 2J52A 2LHDA 2OEDA 2ZW0A 4D2KA 2KN4A 2GB1A 4HKZE 1MHHE 2I2YA 5HFYA 1K50A 1FCCC 1ZXHA 1GB4A 2RMMA 4OZAA 2RPVA 4GLSC 5BMHA 1IGCA 1MI0A 2EELA 1GB1A 2KDMA 5BMIA 5HHDG 2PW9A 1XCTL 2QSDA 4OZCA 2LHEA 2ONQA 1PGBA 2GI9A 2J53A 2JU6X 1JMLA 1XCQL 5BMGA 1D4BA 1YMHE 2N9LA 2N7JA 1QKZA 2QMTA 2K0PA 4MACA 4HJGE 2KWDA 3UI3A 1HZ6A 4WH4A 3GB1A 1PGAA 2JZPA 1PGXA 2LUMA 4KGSA 1XF5L 2PLPA 1MVKA 3FILA 1KH0A 1IBXB
chains in the Genus database with same CATH superfamily
2IGHA 3IFWB 4P16A 3WIMA 2GBRA 5IP4D 5J17A 2MP2B 1SE3A 3SEBA 5D3DA 2INPE 1B1ZA 2IGDA 3NUHB 1WRDB 4JPSA 4PYUA 2NPTA 4ANXA 1MG8A 1BUIC 4J6IA 3TBLD 2LGSA 3CSFA 1NDDA 4NQKE 3UIPB 1E5WA 4R3DA 1V97A 2KLGA 3NHEB 3ZYYX 5CHVC 1WM2A 4DXGA 1FNUA 4DHJD 3GE3C 2KVZA 3TEZA 2V4LA 1U4AA 2JSVX 2KC1A 2WHIA 4M8NA 1R7SA 2KDIA 3AE5B 2CHZA 1CMXB 2JVCA 4TV3A 4DHJB 1SIJA 1WZ3A 1EU3A 3AE7B 2JUOA 2K8HA 2L32A 3HHMA 3VRAB 3VH4B 2LI5A 3APDA 5LXHA 5BMHA 2BS2B 4CHKA 2MJDA 2LRWA 1YQ4B 4K1RB 2KZRA 1P1AA 5HHDG 4FJVB 2GBMA 4YT0B 3DVGY 2JZ3B 3IBEA 3GP7A 3RD2A 3MJWA 2D3GA 3BZDB 4FXCA 3DVNV 1JMLA 2KDFB 3NOBA 3KWVA 2R2QA 3AH7A 1QKZA 2N0SB 2L3ZA 4L2YA 2ZZPB 4AJYB 2VH2A 3QK0A 4PS7A 2ZCBA 4MM3A 5E6JA 3NS8A 4KIKB 3KYDD 4W9KA 3AECB 4WQOB 1J0GA 1L4ZB 2C7HA 2KQSA 1SSNA 4FN2A 5E6OA 3I5JC 3EGRA 4HVBA 4HKQA 1EUVB 1A70A 1XXGA 2QHOA 4JLCA 3OAWA 3N20C 3GZNI 4ZYSA 1FIQA 1K51A 2LASA 3WAMA 2KJ6A 4S0RA 4EKUA 1QF6A 1WRIA 3ZRFA 1UNSA 2BS3B 1WYWB 1WJ4A 2B76B 3C0RB 3HIZA 5HI1A 1VCBA 3V6EB 2MWSB 1VRAB 3N1YC 1J7CA 1V8CA 3L4PA 2LWPA 4KVGB 4PT5A 3RN9C 5C1ZA 2M56B 1FXTB 3IAM1 1OEYA 4ZHOA 2XK5A 1D5MC 1KLVA 4RGNA 1WGRA 1RWSA 2ZCCA 4MGIE 4RGMA 3PHWB 1N5XA 1D6EC 1HEZE 1WMHA 1JRUA 1ROEA 5BO4B 1K53A 3D32A 3DBHI 1DOXA 1HQRD 2JRHA 4HK2A 2WXRA 4X57B 1LXDA 2KANA 4RF0A 3BVMA 3Q3MC 1NYQA 4OZAA 1JALA 2INDC 3CWIA 2XK5B 4FHJA 4KX6B 3RZFA 1UBQA 4F7ZA 3BIID 2BGFA 3R3MA 1JWSD 1YOVB 4MJSB 4YTNB 3GOEA 3IAS1 4JQWC 5G55A 1WX9A 3ENEA 4XDDA 1RM6C 4K7SA 2M4NA 2MJ3A 4DHZB 2D10A 1RLFA 1SB3C 4LJPB 2KMAA 3R66C 3N32A 4OHJA 5L95C 5HG2A 3VUWA 2J0MA 2BTEA 2NTTA 3Q6BA 4JWSC 2L0TA 3B08A 1OEYJ 4MM3B 4C56C 4PK1A 1YJ1A 1WF9A 1V81A 2JWUA 2IO1B 1QOFA 1C3TA 3OG5A 1C76A 2PVOD 3PV1A 1ZUD2 1I4GA 4C00A 3U30A 4EUTA 1MPEA 4C7ZA 2WXQA 2MBOA 3ETRA 3ZTCA 1F0ZA 3VTWA 4C7YA 3SFDB 3K9OB 3J9CA 2KVRA 3QIJA 2DZIA 4H2AA 3PT2B 4FULA 2XNAC 3I3TB 4EE2A 2KQ7A 4AUQC 2QILA 5EE1A 1UUPA 2HDEA 3RFZB 1LM8B 5CHWA 4J3OD 4NJ7A 2EMTA 3RZWC 1T0YA 4N6EB 1KF6B 2C5LC 1UWMA 2BVCA 2ZPNA 4NAWA 4CYEA 4FA6A 2LXCA 3ZXVA 3VTUA 4F8CB 5LXIB 3PZ8A 4HJKA 4W9JA 1QOBA 4US9A 4G50A 4MDKE 2NBUA 3HM6X 4RFBA 3KW5B 2UYZB 3WAPA 4BOSC 1CQVA 1FNWA 2FCQA 4KGSA 4IM0A 2PPHA 2O6VB 3NVZA 1A5RA 1IBXB 2L52A 4G11A 2L0FA 3KWLA 3P4RB 2K8CA 3WANA 2J0KA 1ZKHA 2CJOA 3MP9A 1XLPA 2XN9C 3PREA 4DHZE 4HPMB 1M4VA 3ZJUA 4GU2A 1V49A 4PS3A 2RDHA 2G9HD 1FXAA 2X8XX 1RFAA 1E6EB 1YX6B 2BYTA 4RMAA 4YWGG 2LGXA 4DBGA 3VUYA 2QCZA 1GAQB 4LNKA 4HDOA 3VUXA 4B0EA 4ANWA 4JE3B 1MHXA 1HTQA 5MPOA 3MFGA 3PRZA 4A6QA 4K7WA 2IDYA 2WX1A 3CF6E 2K6QA 2PE6B 2OEDA 2O6VA 2RDGA 4D2KA 1FPYA 1XLQA 2PKOA 1FCCC 3Q8EA 3DHHC 3ZDTA 2HJ1A 3U2SC 2NR2A 2MBBB 1AWDA 2HJ8A 2G45B 5FK9C 1E8YA 3W9CB 4ZOHC 2GBNA 1XCQL 1JRPA 1VZ8A 3MC8A 4GDKA 2LD9A 4RH6A 2V3SA 2KAJA 1XQQA 3NVWA 3RI7C 4HROA 2DZMA 1PGXA 1GNUA 3ZO5B 4I6LB 3Q3JA 2M8SA 4EOYA 2ICIA 4TKNA 2KXJA 2C7MB 1ZDXA 3ZVVA 2MSED 2DAJA 3R7QA 1QT9A 1YN4A 2DYMA 1L0VB 2I38A 3KQ4A 2ON8A 1I4HA 3Q69A 3DBRI 1V1PA 5G5GA 3V6CB 3EFCA 3L17A 4FJYA 2OOBB 3I57A 4ZDVA 2WXMA 1TTNA 2D3CA 1V5TA 3NS1A 2DENB 4E71A 1V86A 1FRDA 2CHXA 4BOZB 3FC4A 1WM3A 3EC8A 1FNVA 4A3PA 3NZSA 3EA6A 1ENFA 3TJPA 3NJTA 1ZXHA 4ZRIA 2VRRB 3MC9A 3H1UA 3DOWA 2D07B 2WU5B 2BB6A 2ZEQA 3T9LA 3TSSA 2AL6A 3HRDD 2LJ5A 2V9HA 5JZEB 2BQQA 1XD3B 4BBNF 4XZ4A 3WALA 4MGKE 1E8XA 4AJWA 2UU7A 4M00A 2QEJC 2JZPA 2PE9A 4B95A 4MJSA 2KX3A 4A55A 2A5UA 3AEGB 2HTME 4W9LA 4IOIE 5T8IA 2FCSA 2WWZA 1CJEA 3PSEB 4ITKA 2C60A 3A33B 2MBHA 4LNFA 1KM7A 5KHQA 2JWZA 2ZNVC 1KOTA 2OJRA 2KOXA 3X23A 4ASWC 2W9NA 4RM8A 1D3ZA 2CS4A 4BKSA 3AEEB 2WDTB 5BYSA 4KKIA 2A4ZA 2ZNVB 4YTPB 2L8JA 1WXSA 2FAZA 3QJZA 3ZQ4A 2MW5A 2LVOA 1D5ZC 4AP4C 4TSSA 1UD7A 3PRMB 5CX3A 4QAYA 2CU3A 1XLOA 5DPRA 3VTVA 1EF1A 2LHDA 2AQ1B 2DHZA 4HCPB 3NVYA 2KO3A 3C8YA 5HKHA 2G3QB 4HKZE 4KDIC 2I2YA 3JVZX 3V62A 1NVID 1F1HA 3Q14C 3RUIB 2V0GA 4OVVA 5JHBA 5AZGA 2KDMA 1KLUD 3E56A 3QWZB 3M63B 1ZW7A 4MEMA 4WWPA 5DCNA 1CK1A 2W3SA 1UZXB 1GG3A 4W9GA 1TS5A 2YVCA 2DAFA 3DBLB 1R4NB 4TQ1A 3V61A 3NZUA 1RRBA 2Q5WD 1WSPA 1I4PA 2BKFA 4DWFA 4HJGE 1C4AA 3NG0A 3AB5A 2WXPA 3FILA 1GJZA 1L0YB 3HVZA 4LLGM 1UGMA 5JXVA 1MJDA 2C7NB 3PZ7A 1JROA 4HPPA 2AEHA 3VQIA 1YQBA 4ZRKA 4ZRJA 3H9DA 4WJNA 2DNFA 4PS8A 1JWUD 3MTNB 1IPGA 4IWOA 1WE7A 1DYQA 2XEWA 4GDLB 4NPNA 1NENB 4KSKC 2C9WB 2CU1A 5D6JB 1TGZB 2EMSA 3U4EG 1XEEA 4KGTA 2LGIA 2PTLA 1AYFA 3AU4A 2M19A 3AE6B 1D5XC 1SBBB 3PTFC 1SE9A 3U7DA 2LZ6A 3PGEA 5D7GA 4EZKA 4HEA1 2H89B 3VR8B 4KGRA 3V3XA 3AULA 1BMLC 1Z5SB 3AEAB 3W5VB 3N9YC 4HCNB 3L10B 2KKCA 2NMQA 3B2FA 1ZP0B 3ZNHB 2KN4A 1WH3A 2HD5B 1M94A 2WXGA 4ZRQA 3APCA 3LDZE 4DDGD 3AM9A 2FUHB 4ZHPA 2BYFA 3U52E 2KC2A 2IPKD 4IUMB 3VFKA 1BXTA 2DBYA 1GB1A 2N9XA 2PW9A 4XX5A 2FCNA 3L16A 3H7PB 2FIFA 1PGBA 2GI9A 3O65B 3BY4B 1V1PB 3URYA 2PEAA 3DDCB 1YMHE 1YQ3B 2AL3A 1E90A 4AS1A 2OJWA 4RF1A 2WLBA 2H88B 3SDLC 5GMVA 1TIFA 1WR1A 3ZNGC 1VJKA 1MVKA 1SF0A 2Z0EB 1WFYA 2QIEB 2V4IB 4A3OA 4KIKA 2XBBC 2WU2B 1WJ6A 1NEKB 3Q3NC 4FADA 1J7BA 4M8MA 3A9KB 1PUTA 3L13A 4GMVA 3TEYA 3ZRCA 2MLBA 4WJOA 4JL9A 4TQ0A 4B6WA 2Y5BB 3UINB 3SU8X 5E6NA 2K9XA 2SAKA 3BWUD 2BS4B 1ZDVA 1RAXA 4M0WA 3KUDB 2DLBA 2NBWB 1Q0WB 4WWOA 4M0WB 1EF5A 1K52A 4YTMB 3RNCC 1FMAD 4EZJA 1P7EA 2K5PA 3W2DA 4LNNA 4F1SA 2NCNA 1C4CA 3A9KA 4JWUC 1WI0A 3P4PB 3RT3B 5AEKB 1NBFC 4IM2A 3W5UB 3DBLI 1VDVA 3SR6A 3BINA 3DWMA 1J8CA 2Y5CA 1UF0A 1VLBA 3L08A 2KHWB 3FAHA 3SD5A 1N61A 2ZVNA 1JWMD 4GLSC 3MHZA 3ML8A 3Q8CA 5C2TB 4HXDA 2AX5A 2L76A 3RNGC 1N6ZA 2LHEA 5LLIA 2K3UA 2ONQA 3W1SC 4WWNA 2YEPB 3BYYB 3PHXB 1FO4A 2N9EB 2N9LA 2KFJA 2IY0B 3AEFB 5EE3A 2INNE 4BKSD 3WAOA 3BYTB 2WXFA 3EECA 1PGAA 1UH6A 1UBIA 3BK1A 2MJEA 3B0AA 1P98A 1FM0D 3B1LX 2N4FA 3Q3FA 2DZJA 4DXAB 3PO0A 2LEKA 2CR5A 3UQBA 4MH0E 3DQVA 4BKGA 4IG7B 4IKGA 4EFOA 3ZLZA 1TT5B 1WX7A 1V9JA 2JQRB 2Y3AA 1F2RC 3ZDMC 1WXAA 4WAFA 3BK2A 1WJUA 2KWVB 2MRPA 2D3BA 2L1AA 1L5PA 4WIPA 4URKA 1I42A 5EE9A 4YL8A 3ZJTA 1ESFA 5CTRC 3T8MA 1AARA 4LJOB 3QHTA 1Z2MA 1Q1OA 1DOIA 1QZEA 5J18A 1GOZA 1G6JA 5AZFA 3AE8B 5IO9A 2L05A 2LVQA 4ANVA 2MEKA 3MC0B 2BB5A 5DPSA 3DVGX 2QDFA 2VZKD 4FJZA 4KZ0A 1LFDA 3DBHB 4WJQA 3OLMD 1WGYA 2FBWB 5TR5A 1WGGA 1ISNA 1ZE3D 3V60A 1B9RA 3IHPC 1T5XD 5H92C 4B0MA 1WYGA 1AN8A 1XLNA 3V05A 2WDQB 2O2VA 4W9HA 2RPQA 1SXTA 2ZJDA 1MG4A 2KJHB 4MACA 2LXAA 3AXCA 2J0JA 3AE2B 1IUEA 5C23A 1KH0A 3P2BA 1T3QA 2IZVB 1ZGUB 2HTHA 3BVGA 3RYTA 5IKCM 3JSVA 3DCGA 4WQMA 4ICUA 2LGDA 1Q10A 3R2TA 1P7FA 3M95A 3QC8B 3TEXA 1VD2A 1AW7A 5C3JB 2K8BA 1SEBD 2CKHB 2LFIA 3ZNZB 2KTRA 4ICVA 5L83A 1NI2A 4YSYB 4G0NB 1OFFA 2KQ4X 3KYCD 2RR9A 1YIWA 1ZOYB 2WNMA 2JXXA 1ET9A 3JYUA 5IN7A 1JCKB 1XO3A 2FUG1 3IXSA 1TZOA 1P3QU 2V1YA 2ASQA 5IAAC 4GDKB 1L4DB 2N9KA 1Y56A 1OTRB 2MX2A 1TJEA 4ZRPA 1DOYA 2KDEB 4M02A 2D3AA 3AN1A 1SE2A 3VRBB 1RFKA 3LB8C 3PPAA 1QILA 1N60A 1NI3A 3VAWA 2WP9B 2L7RA 2KWUB 4DDID 3DBSA 3RNAC 2DX5B 1KJTA 4EZLA 1GB4A 5IA7A 1I35A 2BBCA 4IW0A 4HRSA 5FR6A 1SIFA 3Q8AA 2J4XA 2R2OA 1GC6A 3KVFB 1I7HA 2RD0A 1D4BA 4C4VB 1PFDA 2E3TA 1I4XA 4YSZB 4IDIA 5KHOA 4BBNC 5CHFA 1NYRA 1OGWA 1T6BX 2BYVE 1HZ6A 1WX8A 3VXWA 4MGYE 1PQSA 5TSSA 1HE8A 2GOWA 5JH5C 2RSUA 3AE3B 2K39A 3VR9B 4B9KA 3AEDB 3AEBB 3LXFA 4S17A 4TUUA 4MELA 3LJ3A 5G2NA 2R61A 1WY8A 2SEBD 3K9PB 3T3NA 5I4DA 3JW0X 1F77A 1ET6A 2W54A 1OQRA 1IBXA 3UF8A 2WS3B 2G1EA 1HA5A 2BW2A 4E3CA 3P4SB 3HM3A 1L6UA 4L1BA 1TY0A 1L2NA 4BVUC 3M3JA 4P1CC 3Q2AC 2KYWA 1TS3A 2FNJB 4P1BC 2WXJA 1V1OA 4OVUA 1TS4A 4WAAA 2Z8LA 5DPTA 2YEPF 2FIDA 4XGAB 4LK0M 1MHHE 3W1YA 3AI5A 2WXHA 2RMMA 1V6EA 4TMAB 3AU5A 3NRZA 2NS5A 4NQLB 5BMIA 3S2AA 3ZXRA 5EDSA 2JU6X 2WXLA 2J53A 1E8WA 4K3CA 3A1QA 2K25A 5BMGA 2MHJA 4PYZA 4UDUC 3X0WA 4W9CA 1H8CA 3PZDA 2V3PA 4K81A 1T0QC 1DGJA 2KN5A 3RULA 3E9SA 2GBKA 2KLCA 4BZAA 1V5OA 5DPWA 3A4SC 3ZUNA 1Q5WB 2W82A 2QC8A 4NZLB 3N1ZC 4NJ6A 3H7SA 2E6XA 4DQOC 3APFA 3ZNID 1QLBB 2GBJA 2CHWA 2GLSA 1LQBA 3KUZA 2IO0B 2B3AA 1C4PA 4OZBA 1YNTE 3P42A 1GC7A 2JYTA 4NAMA 4BKTA 3CIRB 2IGGA 3ABVB 3U8ZA 1JWBD 4MSMB 2BF8B 3WA0A 1I4QA 1TY2A 4MGZE 2WDVB 2IY1B 1KLGD 4L23A 1GUAB 4ACFA 2CJNA 2O6VD 4GOCA 2PVGC 1SGHA 2I1JA 2BPSA 2KJRA 3VH3B 4N58A 4DXFA 1QOGA 1FEHA 3ZW3A 4BAXA 4GN1A 2NVUI 4G3XB 4GIVA 5HFYA 5FR3A 3T3OA 1FRRA 5IOIA 2DWQA 3A1QB 3UQAA 1IGCA 4LDTB 3FKYA 1YJIA 1TKEA 3QA8A 3QCAA 1TBEA 4GDLA 3DPDA 2BT6A 2KWCA 3IT6B 3W1SA 1L0XB 3I9V1 4IWQA 4JGHB 5H8YE 3RMKC 1S1QB 1JQ4A 2KFKA 1IYFA 5D3IB 4WH4A 1VZ7A 2LUMA 1V80A 2PLPA 2JF5A 4RCOA 3TL5A 2KT7A 2JYEA 5AUIA 1IGDA 4O1NA 1OQYA 2WXNA 2N9PC 5BYRA 1T0RC 2M0AA 4FHKA 1H4RA 4JX1C 2REXA 3R8BA 3RCZA 1VZ6A 1EWYC 3UGBB 4Q2JA 4NJCA 3GZNB 4W9FA 3CMMB 4ARIA 3IT4B 4GSWA 1JWAD 4KDLB 3ECIA 2D5GA 1KFYB 1WE6A 4LDTD 4EEWA 3AE4B 4FBJB 4REZA 4A90A 2MA9B 1F52A 2LMCA 2KD0A 2KX0A 2K6DB 2ZW0A 2N1VA 3WCQA 3P1MA 3QARA 3H6NA 5GXGB 4I6NB 3ONSA 3N1XC 3QAQA 2PMVA 2Y5PA 4JIOU 2RPVA 3NZ3A 2JZZA 1MI0A 5D2MB 4RNAA 2ZPYA 2WXKA 2W3RA 3OWEB 1XCTL 3ZJVA 1GPXA 2FCMA 5EE0A 4AQ7A 4OVZA 4XWWA 2MCNB 3PRPB 4C80A 2JT4B 2M1MA 2OHFA 4KV2A 4HWIB 4MSQB 4KKJA 2G4DB 4NY0A 1LO5D 2K0PA 1C1YB 2GRIA 3AV8A 3I63C 4NNJB 3TUOA 2YLMA 4HLEA 2KWDA 4IWPA 3HK0A 2NBVB 3A9JA 2L83A 1R4MI 3N30A 3VHTC 3ALBA 1TKGA 2BWES 1C78A 1K8RB 2TSSA 4KZCA 1E10A 4OW0A 3P4QB 2QJLA 1C79A 4HPLB 4ANUA 3A9JB 2KK8A 1V2YA 2N1WA 4NAWB 5D94A 1S3SG 3OJ4B 2BYEA 1E7UA 2LVPA 3LYYA 3QX1A 1FD6A 3TMPB 4FLHA 4W9IA 2MQJA 2KACA 3P63A 3JSVB 4GXBA 3FILB 2WXIA 3O13A 2HE7A 2WXOA 1TZ1A 2N7EA 2D2QA 1PYWD 2IO3B 4WWMA 2W55A 2ZVOA 4RGOS 3B9JA 4ARCA 1ZPSA 1E9MA 4A9AA 2FE8A 3MJ5A 3AE9B 4MT5A 3CSTA 2RGFA 3PLUA 4LNOA 2O2VB 3PVLA 4WURA 1QQRA 1WR6E 3NVVA 4GGQA 3RNFC 3DBRB 4AWJA 4W9EA 3DWGC 3GE8C 2AQ3B 1RYJA 2N7DA 1E0ZA 4P6VF 3TIXA 4WJPA 2DYOA 3RNEC 1UELA 1STEA 2ACZB 2AQ2B 2M17A 4US8A 3GB1A 2KMMA 3B2GA 4M01A 1YN5A 2DZKA 1FFUA 2BKRB 3A4RA 4RGTA 3EUB2 2ZW1A 4IM3A 2L00B 1Y8RC 3C19A 2EKEC 2LJIA 4LCDE 2INCC 1L7YA 1WJNA 4C4VA 1WGKA 1ZXIA 1C9FA 1YN3A 2AYOB 3ML9A 1LGRA 2LUEA 4N9F4 2KDBA 2J7QB 4LTUA 3KLSX 2JY6A 3EHVA 2M0XA 4HDQA 2JXTA 3L0WB 2EKIA 1UWXA 1YJJA 1L6VA 1P9DU 1E7VA 5JHAA 3ZGZA 3AMZA 2KTFA 4II2B 4USAA 3Q3OC 1HZ5A 1UGJA 4DK5A 2MP2A 2I1KA 3MHSD 4MH8A 2WDRB 3DHIC 2AWTA 1WXQA 2J52A 3TEWA 1WMHB 2IO2B 2NTSA 3R2IA 1WGHA 4AOFA 1WGDA 1J7AA 2GB1A 1EO6A 3HUIA 2KMCA 1JW9D 4II3B 1PDXA 1VR9A 3PLVA 1R4MB 5G5HA 2NPTB 3UIOB 5E6PA 2EELA 3NY5A 1E7PB 1HTOA 2PJHA 2QSDA 2KNBA 4OZCA 1XT9B 4ZYNA 1N63A 2K1FA 4IC7B 3H8HA 2D11A 1EU4A 2KTRB 5BYQA 4KSLC 2IBIB 2QMTA 2Z59B 4LNIA 1WWTA 2BWFA 1KRHA 2JX5A 3HVDA 2MBQA 1OQQA 1T0SC 3TCAA 1SJED 1XF5L 4I6PA 1P0RA 3KUCB 1I4RA 4K3BA 4P7IA 4YXDB 1C77A 2WYQA 2Z0DB 4K7UA 4XDCA 4GB9A 1BT0A 1ACCA 4XYCA 1QOAA 1YD8U 2VH1A 4XWTA 1FCLA 1N5WA 1N62A 1CZPA 2G4SA 5FKAC 4CO7A 3SFEB 1TYGB 4W9DA 2LGYA 2JPHA 3IVFA 1WIAA 4A8XC 3R7RA 3L54A 2KFKB 3BVZA 3M62B 3SHQA 4A20A 2LRUA 3DHGC 2V3NA 3OJ3A 3VVWB 2JRIB 1TKYA 1KTKA 4N59A 4CQNA 5LNK1 3DVNU 1EM7A 1F2RI 2PIAA 1HXYD 2WX0A 2WGSA 3RNBC 2VZKB 1SE4A 2IYDB 1E8ZA 3Q8BA 1YX5B 2MBEA 3KH0A 1R4NI 1TS2A 3N3KB 3Q8FA 1FXIA 3VDZA 5J2RA 2RDBC 3GS2A 3ZIMA 1EWCA 1K50A 2DYBA 3QQ8B 3ZTDA 2J42A 3IG3A 1SJHD 3H7PA 4BFRA 2UWQA 1FFVA 2WQYB 1F9JA 4XE0A 5AZHA 3AE1B 2X38A 2K22A 1WXMA 1WZ0A 2IJ0A 4E74A 2N7JA 4RM9A 3EFUA 1IP9A 1J19A 3RPFC 5AUKA 2GMIC 1WXVA 3UI3A 3U7ZA 3PS6A 1MFWA 1X1MA 4XC2A 3ZKJC 4YSXB 2MH7A
chains in the Genus database with same CATH topology
2JYEA 2IGHA 4P16A 5AUIA 1SE3A 2ICIA 1IGDA 4O1NA 3PO0A 2LEKA 3SEBA 2WXNA 5BYRA 5D3DA 2INPE 1B1ZA 2IGDA 2M0AA 4IKGA 3NUHB 1ZDXA 4JPSA 4JX1C 3R8BA 1BUIC 1QT9A 1YN4A 2DYMA 1L0VB 2I38A 2JQRB 2Y3AA 1F2RC 1VZ6A 3KQ4A 2ON8A 1I4HA 1EWYC 4WAFA 4Q2JA 4NJCA 4R3DA 3BK2A 1V97A 3Q69A 1V1PA 5G5GA 2L1AA 4ARIA 3IT4B 1L5PA 4WIPA 3ZYYX 5EE9A 3ZJTA 1JWAD 1ESFA 2D5GA 4DXGA 3I57A 1FNUA 1KFYB 2WXMA 1DOIA 3TEZA 1GOZA 2JSVX 3AE4B 3NS1A 1R7SA 4REZA 4A90A 1FRDA 3AE5B 3FC4A 3AE8B 2LMCA 1SIJA 2MEKA 3MC0B 1EU3A 2BB5A 1FNVA 2ZW0A 3WCQA 3AE7B 3P1MA 2L32A 2VZKD 5GXGB 3VRAB 3EA6A 1ENFA 2FBWB 2PMVA 1ZXHA 2Y5PA 1ZE3D 2RPVA 3NZ3A 2BS2B 5BMHA 1B9RA 2MJDA 1MI0A 1YQ4B 1T5XD 4RNAA 2WXKA 2W3RA 3OWEB 5HHDG 1XCTL 3ZJVA 4YT0B 5H92C 2WU5B 1WYGA 4B0MA 1AN8A 2BB6A 3TSSA 1GPXA 5EE0A 1XLNA 3V05A 2WDQB 3GP7A 4AQ7A 4OVZA 4XWWA 3HRDD 1SXTA 3BZDB 4FXCA 4C80A 1JMLA 3KWVA 2OHFA 3AH7A 1QKZA 2N0SB 4KKJA 4L2YA 1LO5D 2K0PA 4MACA 2GRIA 3AV8A 3TUOA 2KWDA 2QEJC 2JZPA 3AE2B 2L83A 1IUEA 1TKGA 1C78A 1KH0A 4A55A 3AEGB 2HTME 4IOIE 1T3QA 5E6JA 5T8IA 3BVGA 3AECB 1CJEA 1L4ZB 2TSSA 4ITKA 4WQMA 1SSNA 1E10A 4OW0A 1Q10A 3R2TA 1P7FA 3EGRA 3P4QB 2QJLA 3TEXA 4HKQA 1A70A 1C79A 1AW7A 5C3JB 1SEBD 1XXGA 2LFIA 4ZYSA 1FIQA 1K51A 4YSYB 1OFFA 2KQ4X 3AEEB 1QF6A 1WRIA 5BYSA 4KKIA 1UNSA 2BS3B 4NAWB 4YTPB 1ZOYB 2WNMA 2B76B 1ET9A 5HI1A 3ZQ4A 1VRAB 1JCKB 1J7CA 1V8CA 3L4PA 4PT5A 1D5ZC 1XO3A 4TSSA 3LYYA 2FUG1 3IXSA 1TZOA 2M56B 3IAM1 1FD6A 4ZHOA 4GDKB 1D5MC 4RGNA 2KACA 2N9KA 1L4DB 3P63A 1RWSA 1Y56A 4RGMA 3FILB 2WXIA 3O13A 1N5XA 2CU3A 1D6EC 1XLOA 1HEZE 1TJEA 4ZRPA 1DOYA 2WXOA 1ROEA 3AN1A 1K53A 1SE2A 2LHDA 3VRBB 1HQRD 1RFKA 1DOXA 1PYWD 4WWMA 2AQ1B 3LB8C 2W55A 3NVYA 2WXRA 1QILA 1N60A 1NI3A 3C8YA 4RGOS 3B9JA 4HKZE 4ARCA 2I2YA 1ZPSA 2WP9B 1E9MA 4RF0A 4A9AA 2FE8A 3BVMA 1GB4A 1NVID 3MJ5A 3AE9B 4MT5A 2BBCA 1NYQA 4OZAA 1JALA 4HRSA 2V0GA 3CWIA 2KDMA 1KLUD 3E56A 3Q8AA 2J4XA 4WURA 1CK1A 4KX6B 1QQRA 2W3SA 3NVVA 1I7HA 3BIID 1TS5A 3DWGC 1JWSD 1RYJA 2AQ3B 1E0ZA 1D4BA 4TQ1A 4YTNB 4P6VF 2Q5WD 3IAS1 1PFDA 2E3TA 1I4XA 4YSZB 1WSPA 4IDIA 2DYOA 1I4PA 4XDDA 1RM6C 1STEA 4HJGE 1C4AA 1NYRA 1T6BX 2ACZB 2AQ2B 1HZ6A 3AB5A 2MJ3A 4US8A 3GB1A 2KMMA 2WXPA 3B2GA 3FILA 5TSSA 1L0YB 3HVZA 4LLGM 1SB3C 1YN5A 5JXVA 1FFUA 3PZ7A 3AE3B 4OHJA 4RGTA 3EUB2 1JROA 2ZW1A 3AEDB 3AEBB 3VR9B 5HG2A 3LXFA 2BTEA 2NTTA 3VQIA 4JWSC 1JWUD 2LJIA 4MM3B 4C56C 1DYQA 4GDLB 1WGKA 1ZXIA 1C9FA 1YN3A 2JWUA 2R61A 1NENB 2SEBD 1QOFA 3T3NA 5I4DA 4LTUA 1C76A 2PVOD 3KLSX 1F77A 3U4EG 1ET6A 2W54A 1OQRA 1XEEA 2JXTA 4KGTA 1IBXA 2LGIA 2EKIA 2PTLA 1ZUD2 1UWXA 1YJJA 1I4GA 2WS3B 1AYFA 1L6VA 2G1EA 2M19A 1HA5A 3AE6B 1MPEA 4C7ZA 2WXQA 1D5XC 1SBBB 2BW2A 3ZGZA 3AMZA 3P4SB 3ETRA 4USAA 1L6UA 1F0ZA 5D7GA 4HEA1 2H89B 3VR8B 4KGRA 4L1BA 3V3XA 4C7YA 1HZ5A 1UGJA 1TY0A 3SFDB 1BMLC 3AEAB 3W5VB 3N9YC 2WDRB 4MH8A 3J9CA 1TS3A 2NMQA 1WXQA 3B2FA 4H2AA 1ZP0B 2J52A 3TEWA 2WXJA 2XNAC 1V1OA 1TS4A 4EE2A 2Z8LA 2NTSA 2KN4A 3R2IA 1J7AA 2QILA 2YEPF 2WXGA 1UUPA 2GB1A 5EE1A 2HDEA 4ZRQA 4LK0M 1MHHE 3HUIA 3RFZB 1JW9D 3AM9A 2WXHA 1PDXA 1VR9A 4J3OD 4ZHPA 2RMMA 3U52E 5G5HA 4TMAB 2IPKD 4N6EB 1KF6B 2EELA 3NRZA 1BXTA 1E7PB 1UWMA 2DBYA 1GB1A 5BMIA 2PW9A 2QSDA 4OZCA 1N63A 3PZ8A 3H8HA 2JU6X 1PGBA 2GI9A 2J53A 2WXLA 1V1PB 1EU4A 1QOBA 4US9A 3URYA 5BMGA 1YMHE 5BYQA 4UDUC 2QMTA 1YQ3B 4RFBA 1WWTA 1KRHA 2JX5A 2V3PA 3HVDA 4AS1A 1OQQA 4RF1A 1CQVA 1FNWA 2WLBA 1SJED 2H88B 1DGJA 4KGSA 1XF5L 1VJKA 1MVKA 1SF0A 3E9SA 3NVZA 2QIEB 1IBXB 1I4RA 2V4IB 4YXDB 2L52A 1C77A 2WU2B 4XDCA 1NEKB 1J7BA 2W82A 1PUTA 1ACCA 3KWLA 3TEYA 3P4RB 4NZLB 1QOAA 4XWTA 1FCLA 1N5WA 1N62A 2E6XA 1CZPA 5FKAC 2CJOA 3MP9A 3SFEB 4DQOC 1XLPA 4TQ0A 1QLBB 2XN9C 1TYGB 2K9XA 1M4VA 2SAKA 3ZJUA 4A8XC 3BWUD 2BS4B 1C4PA 4OZBA 1ZDVA 3BVZA 4M0WA 1YNTE 2DLBA 2RDHA 2G9HD 3P42A 1FXAA 2JYTA 4NAMA 2V3NA 3CIRB 1E6EB 2BYTA 2IGGA 3ABVB 1JWBD 4YWGG 1K52A 4YTMB 1GAQB 1I4QA 1TY2A 1TKYA 4B0EA 1KTKA 4N59A 4CQNA 2WDVB 5LNK1 1KLGD 4JE3B 1FMAD 4L23A 1MHXA 1P7EA 2K5PA 3W2DA 1EM7A 5MPOA 2CJNA 3MFGA 1F2RI 2PIAA 1C4CA 1HXYD 4JWUC 4A6QA 2VZKB 1SE4A 3P4PB 2PVGC 2IDYA 3Q8BA 3W5UB 1VDVA 3SR6A 2OEDA 2RDGA 3DWMA 4N58A 1TS2A 2Y5CA 4D2KA 4DXFA 1VLBA 1QOGA 1FEHA 3Q8FA 1XLQA 3FAHA 1FXIA 1N61A 2PKOA 3GS2A 1EWCA 1K50A 1FCCC 5HFYA 3Q8EA 5FR3A 3T3OA 1FRRA 2J42A 1JWMD 2DWQA 4GLSC 3MHZA 1IGCA 3U2SC 3Q8CA 1AWDA 5C2TB 1SJHD 2AX5A 5FK9C 1YJIA 1FFVA 1TKEA 2WQYB 4XE0A 3AE1B 2X38A 2LHEA 3W9CB 2K22A 2K3UA 4ZOHC 2ONQA 2BT6A 3IT6B 2YEPB 3BYYB 3W1SA 1L0XB 1FO4A 1XCQL 2IJ0A 3I9V1 1JRPA 2N9LA 1VZ8A 2N7JA 3AEFB 5H8YE 5EE3A 4RH6A 2INNE 1JQ4A 2KAJA 3RPFC 5AUKA 3UI3A 3NVWA 5D3IB 3BYTB 4WH4A 1PGAA 1VZ7A 2WXFA 1PGXA 2LUMA 3BK1A 4HROA 4RCOA 2PLPA 3U7ZA 2MJEA 1FM0D 4YSXB 2MH7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JXV A;  2IGH A;  4IOI E;  2ZW1 A;  1IGD A;  5HG2 A;  2IGD A;  1Q10 A;  4IKG A;  1P7F A;  1FCL A;  3MP9 A;  1C9F A;  2I38 A;  2JWU A;  1F2R C;  2ON8 A;  4OZB A;  1K51 A;  1YNT E;  2KQ4 X;  2IGG A;  2JXT A;  4KGT A;  1IBX A;  1K52 A;  2LGI A;  2PTL A;  1UWX A;  5HI1 A;  1MPE A;  1FD6 A;  1MHX A;  1P7E A;  1EM7 A;  2JSV X;  1F2R I;  2KAC A;  2N9K A;  3FIL B;  4KGR A;  3V3X A;  1HZ5 A;  1HEZ E;  2NMQ A;  1K53 A;  2J52 A;  2LHD A;  2OED A;  2ZW0 A;  4D2K A;  2KN4 A;  2GB1 A;  4HKZ E;  1MHH E;  2I2Y A;  5HFY A;  1K50 A;  1FCC C;  1ZXH A;  1GB4 A;  2RMM A;  4OZA A;  2RPV A;  4GLS C;  5BMH A;  1IGC A;  1MI0 A;  2EEL A;  1GB1 A;  2KDM A;  5BMI A;  5HHD G;  2PW9 A;  1XCT L;  2QSD A;  4OZC A;  2LHE A;  2ONQ A;  1PGB A;  2GI9 A;  2J53 A;  2JU6 X;  1JML A;  1XCQ L;  5BMG A;  1D4B A;  1YMH E;  2N9L A;  2N7J A;  1QKZ A;  2QMT A;  2K0P A;  4MAC A;  4HJG E;  2KWD A;  3UI3 A;  1HZ6 A;  4WH4 A;  3GB1 A;  1PGA A;  2JZP A;  1PGX A;  2LUM A;  4KGS A;  1XF5 L;  2PLP A;  1MVK A;  3FIL A;  1KH0 A;  1IBX B; 
#chains in the Genus database with same CATH topology
 2IGH A;  3IFW B;  4P16 A;  3WIM A;  2GBR A;  5IP4 D;  5J17 A;  2MP2 B;  1SE3 A;  3SEB A;  5D3D A;  2INP E;  1B1Z A;  2IGD A;  3NUH B;  1WRD B;  4JPS A;  4PYU A;  2NPT A;  4ANX A;  1MG8 A;  1BUI C;  4J6I A;  3TBL D;  2LGS A;  3CSF A;  1NDD A;  4NQK E;  3UIP B;  1E5W A;  4R3D A;  1V97 A;  2KLG A;  3NHE B;  3ZYY X;  5CHV C;  1WM2 A;  4DXG A;  1FNU A;  4DHJ D;  3GE3 C;  2KVZ A;  3TEZ A;  2V4L A;  1U4A A;  2JSV X;  2KC1 A;  2WHI A;  4M8N A;  1R7S A;  2KDI A;  3AE5 B;  2CHZ A;  1CMX B;  2JVC A;  4TV3 A;  4DHJ B;  1SIJ A;  1WZ3 A;  1EU3 A;  3AE7 B;  2JUO A;  2K8H A;  2L32 A;  3HHM A;  3VRA B;  3VH4 B;  2LI5 A;  3APD A;  5LXH A;  5BMH A;  2BS2 B;  4CHK A;  2MJD A;  2LRW A;  1YQ4 B;  4K1R B;  2KZR A;  1P1A A;  5HHD G;  4FJV B;  2GBM A;  4YT0 B;  3DVG Y;  2JZ3 B;  3IBE A;  3GP7 A;  3RD2 A;  3MJW A;  2D3G A;  3BZD B;  4FXC A;  3DVN V;  1JML A;  2KDF B;  3NOB A;  3KWV A;  2R2Q A;  3AH7 A;  1QKZ A;  2N0S B;  2L3Z A;  4L2Y A;  2ZZP B;  4AJY B;  2VH2 A;  3QK0 A;  4PS7 A;  2ZCB A;  4MM3 A;  5E6J A;  3NS8 A;  4KIK B;  3KYD D;  4W9K A;  3AEC B;  4WQO B;  1J0G A;  1L4Z B;  2C7H A;  2KQS A;  1SSN A;  4FN2 A;  5E6O A;  3I5J C;  3EGR A;  4HVB A;  4HKQ A;  1EUV B;  1A70 A;  1XXG A;  2QHO A;  4JLC A;  3OAW A;  3N20 C;  3GZN I;  4ZYS A;  1FIQ A;  1K51 A;  2LAS A;  3WAM A;  2KJ6 A;  4S0R A;  4EKU A;  1QF6 A;  1WRI A;  3ZRF A;  1UNS A;  2BS3 B;  1WYW B;  1WJ4 A;  2B76 B;  3C0R B;  3HIZ A;  5HI1 A;  1VCB A;  3V6E B;  2MWS B;  1VRA B;  3N1Y C;  1J7C A;  1V8C A;  3L4P A;  2LWP A;  4KVG B;  4PT5 A;  3RN9 C;  5C1Z A;  2M56 B;  1FXT B;  3IAM 1;  1OEY A;  4ZHO A;  2XK5 A;  1D5M C;  1KLV A;  4RGN A;  1WGR A;  1RWS A;  2ZCC A;  4MGI E;  4RGM A;  3PHW B;  1N5X A;  1D6E C;  1HEZ E;  1WMH A;  1JRU A;  1ROE A;  5BO4 B;  1K53 A;  3D32 A;  3DBH I;  1DOX A;  1HQR D;  2JRH A;  4HK2 A;  2WXR A;  4X57 B;  1LXD A;  2KAN A;  4RF0 A;  3BVM A;  3Q3M C;  1NYQ A;  4OZA A;  1JAL A;  2IND C;  3CWI A;  2XK5 B;  4FHJ A;  4KX6 B;  3RZF A;  1UBQ A;  4F7Z A;  3BII D;  2BGF A;  3R3M A;  1JWS D;  1YOV B;  4MJS B;  4YTN B;  3GOE A;  3IAS 1;  4JQW C;  5G55 A;  1WX9 A;  3ENE A;  4XDD A;  1RM6 C;  4K7S A;  2M4N A;  2MJ3 A;  4DHZ B;  2D10 A;  1RLF A;  1SB3 C;  4LJP B;  2KMA A;  3R66 C;  3N32 A;  4OHJ A;  5L95 C;  5HG2 A;  3VUW A;  2J0M A;  2BTE A;  2NTT A;  3Q6B A;  4JWS C;  2L0T A;  3B08 A;  1OEY J;  4MM3 B;  4C56 C;  4PK1 A;  1YJ1 A;  1WF9 A;  1V81 A;  2JWU A;  2IO1 B;  1QOF A;  1C3T A;  3OG5 A;  1C76 A;  2PVO D;  3PV1 A;  1ZUD 2;  1I4G A;  4C00 A;  3U30 A;  4EUT A;  1MPE A;  4C7Z A;  2WXQ A;  2MBO A;  3ETR A;  3ZTC A;  1F0Z A;  3VTW A;  4C7Y A;  3SFD B;  3K9O B;  3J9C A;  2KVR A;  3QIJ A;  2DZI A;  4H2A A;  3PT2 B;  4FUL A;  2XNA C;  3I3T B;  4EE2 A;  2KQ7 A;  4AUQ C;  2QIL A;  5EE1 A;  1UUP A;  2HDE A;  3RFZ B;  1LM8 B;  5CHW A;  4J3O D;  4NJ7 A;  2EMT A;  3RZW C;  1T0Y A;  4N6E B;  1KF6 B;  2C5L C;  1UWM A;  2BVC A;  2ZPN A;  4NAW A;  4CYE A;  4FA6 A;  2LXC A;  3ZXV A;  3VTU A;  4F8C B;  5LXI B;  3PZ8 A;  4HJK A;  4W9J A;  1QOB A;  4US9 A;  4G50 A;  4MDK E;  2NBU A;  3HM6 X;  4RFB A;  3KW5 B;  2UYZ B;  3WAP A;  4BOS C;  1CQV A;  1FNW A;  2FCQ A;  4KGS A;  4IM0 A;  2PPH A;  2O6V B;  3NVZ A;  1A5R A;  1IBX B;  2L52 A;  4G11 A;  2L0F A;  3KWL A;  3P4R B;  2K8C A;  3WAN A;  2J0K A;  1ZKH A;  2CJO A;  3MP9 A;  1XLP A;  2XN9 C;  3PRE A;  4DHZ E;  4HPM B;  1M4V A;  3ZJU A;  4GU2 A;  1V49 A;  4PS3 A;  2RDH A;  2G9H D;  1FXA A;  2X8X X;  1RFA A;  1E6E B;  1YX6 B;  2BYT A;  4RMA A;  4YWG G;  2LGX A;  4DBG A;  3VUY A;  2QCZ A;  1GAQ B;  4LNK A;  4HDO A;  3VUX A;  4B0E A;  4ANW A;  4JE3 B;  1MHX A;  1HTQ A;  5MPO A;  3MFG A;  3PRZ A;  4A6Q A;  4K7W A;  2IDY A;  2WX1 A;  3CF6 E;  2K6Q A;  2PE6 B;  2OED A;  2O6V A;  2RDG A;  4D2K A;  1FPY A;  1XLQ A;  2PKO A;  1FCC C;  3Q8E A;  3DHH C;  3ZDT A;  2HJ1 A;  3U2S C;  2NR2 A;  2MBB B;  1AWD A;  2HJ8 A;  2G45 B;  5FK9 C;  1E8Y A;  3W9C B;  4ZOH C;  2GBN A;  1XCQ L;  1JRP A;  1VZ8 A;  3MC8 A;  4GDK A;  2LD9 A;  4RH6 A;  2V3S A;  2KAJ A;  1XQQ A;  3NVW A;  3RI7 C;  4HRO A;  2DZM A;  1PGX A;  1GNU A;  3ZO5 B;  4I6L B;  3Q3J A;  2M8S A;  4EOY A;  2ICI A;  4TKN A;  2KXJ A;  2C7M B;  1ZDX A;  3ZVV A;  2MSE D;  2DAJ A;  3R7Q A;  1QT9 A;  1YN4 A;  2DYM A;  1L0V B;  2I38 A;  3KQ4 A;  2ON8 A;  1I4H A;  3Q69 A;  3DBR I;  1V1P A;  5G5G A;  3V6C B;  3EFC A;  3L17 A;  4FJY A;  2OOB B;  3I57 A;  4ZDV A;  2WXM A;  1TTN A;  2D3C A;  1V5T A;  3NS1 A;  2DEN B;  4E71 A;  1V86 A;  1FRD A;  2CHX A;  4BOZ B;  3FC4 A;  1WM3 A;  3EC8 A;  1FNV A;  4A3P A;  3NZS A;  3EA6 A;  1ENF A;  3TJP A;  3NJT A;  1ZXH A;  4ZRI A;  2VRR B;  3MC9 A;  3H1U A;  3DOW A;  2D07 B;  2WU5 B;  2BB6 A;  2ZEQ A;  3T9L A;  3TSS A;  2AL6 A;  3HRD D;  2LJ5 A;  2V9H A;  5JZE B;  2BQQ A;  1XD3 B;  4BBN F;  4XZ4 A;  3WAL A;  4MGK E;  1E8X A;  4AJW A;  2UU7 A;  4M00 A;  2QEJ C;  2JZP A;  2PE9 A;  4B95 A;  4MJS A;  2KX3 A;  4A55 A;  2A5U A;  3AEG B;  2HTM E;  4W9L A;  4IOI E;  5T8I A;  2FCS A;  2WWZ A;  1CJE A;  3PSE B;  4ITK A;  2C60 A;  3A33 B;  2MBH A;  4LNF A;  1KM7 A;  5KHQ A;  2JWZ A;  2ZNV C;  1KOT A;  2OJR A;  2KOX A;  3X23 A;  4ASW C;  2W9N A;  4RM8 A;  1D3Z A;  2CS4 A;  4BKS A;  3AEE B;  2WDT B;  5BYS A;  4KKI A;  2A4Z A;  2ZNV B;  4YTP B;  2L8J A;  1WXS A;  2FAZ A;  3QJZ A;  3ZQ4 A;  2MW5 A;  2LVO A;  1D5Z C;  4AP4 C;  4TSS A;  1UD7 A;  3PRM B;  5CX3 A;  4QAY A;  2CU3 A;  1XLO A;  5DPR A;  3VTV A;  1EF1 A;  2LHD A;  2AQ1 B;  2DHZ A;  4HCP B;  3NVY A;  2KO3 A;  3C8Y A;  5HKH A;  2G3Q B;  4HKZ E;  4KDI C;  2I2Y A;  3JVZ X;  3V62 A;  1NVI D;  1F1H A;  3Q14 C;  3RUI B;  2V0G A;  4OVV A;  5JHB A;  5AZG A;  2KDM A;  1KLU D;  3E56 A;  3QWZ B;  3M63 B;  1ZW7 A;  4MEM A;  4WWP A;  5DCN A;  1CK1 A;  2W3S A;  1UZX B;  1GG3 A;  4W9G A;  1TS5 A;  2YVC A;  2DAF A;  3DBL B;  1R4N B;  4TQ1 A;  3V61 A;  3NZU A;  1RRB A;  2Q5W D;  1WSP A;  1I4P A;  2BKF A;  4DWF A;  4HJG E;  1C4A A;  3NG0 A;  3AB5 A;  2WXP A;  3FIL A;  1GJZ A;  1L0Y B;  3HVZ A;  4LLG M;  1UGM A;  5JXV A;  1MJD A;  2C7N B;  3PZ7 A;  1JRO A;  4HPP A;  2AEH A;  3VQI A;  1YQB A;  4ZRK A;  4ZRJ A;  3H9D A;  4WJN A;  2DNF A;  4PS8 A;  1JWU D;  3MTN B;  1IPG A;  4IWO A;  1WE7 A;  1DYQ A;  2XEW A;  4GDL B;  4NPN A;  1NEN B;  4KSK C;  2C9W B;  2CU1 A;  5D6J B;  1TGZ B;  2EMS A;  3U4E G;  1XEE A;  4KGT A;  2LGI A;  2PTL A;  1AYF A;  3AU4 A;  2M19 A;  3AE6 B;  1D5X C;  1SBB B;  3PTF C;  1SE9 A;  3U7D A;  2LZ6 A;  3PGE A;  5D7G A;  4EZK A;  4HEA 1;  2H89 B;  3VR8 B;  4KGR A;  3V3X A;  3AUL A;  1BML C;  1Z5S B;  3AEA B;  3W5V B;  3N9Y C;  4HCN B;  3L10 B;  2KKC A;  2NMQ A;  3B2F A;  1ZP0 B;  3ZNH B;  2KN4 A;  1WH3 A;  2HD5 B;  1M94 A;  2WXG A;  4ZRQ A;  3APC A;  3LDZ E;  4DDG D;  3AM9 A;  2FUH B;  4ZHP A;  2BYF A;  3U52 E;  2KC2 A;  2IPK D;  4IUM B;  3VFK A;  1BXT A;  2DBY A;  1GB1 A;  2N9X A;  2PW9 A;  4XX5 A;  2FCN A;  3L16 A;  3H7P B;  2FIF A;  1PGB A;  2GI9 A;  3O65 B;  3BY4 B;  1V1P B;  3URY A;  2PEA A;  3DDC B;  1YMH E;  1YQ3 B;  2AL3 A;  1E90 A;  4AS1 A;  2OJW A;  4RF1 A;  2WLB A;  2H88 B;  3SDL C;  5GMV A;  1TIF A;  1WR1 A;  3ZNG C;  1VJK A;  1MVK A;  1SF0 A;  2Z0E B;  1WFY A;  2QIE B;  2V4I B;  4A3O A;  4KIK A;  2XBB C;  2WU2 B;  1WJ6 A;  1NEK B;  3Q3N C;  4FAD A;  1J7B A;  4M8M A;  3A9K B;  1PUT A;  3L13 A;  4GMV A;  3TEY A;  3ZRC A;  2MLB A;  4WJO A;  4JL9 A;  4TQ0 A;  4B6W A;  2Y5B B;  3UIN B;  3SU8 X;  5E6N A;  2K9X A;  2SAK A;  3BWU D;  2BS4 B;  1ZDV A;  1RAX A;  4M0W A;  3KUD B;  2DLB A;  2NBW B;  1Q0W B;  4WWO A;  4M0W B;  1EF5 A;  1K52 A;  4YTM B;  3RNC C;  1FMA D;  4EZJ A;  1P7E A;  2K5P A;  3W2D A;  4LNN A;  4F1S A;  2NCN A;  1C4C A;  3A9K A;  4JWU C;  1WI0 A;  3P4P B;  3RT3 B;  5AEK B;  1NBF C;  4IM2 A;  3W5U B;  3DBL I;  1VDV A;  3SR6 A;  3BIN A;  3DWM A;  1J8C A;  2Y5C A;  1UF0 A;  1VLB A;  3L08 A;  2KHW B;  3FAH A;  3SD5 A;  1N61 A;  2ZVN A;  1JWM D;  4GLS C;  3MHZ A;  3ML8 A;  3Q8C A;  5C2T B;  4HXD A;  2AX5 A;  2L76 A;  3RNG C;  1N6Z A;  2LHE A;  5LLI A;  2K3U A;  2ONQ A;  3W1S C;  4WWN A;  2YEP B;  3BYY B;  3PHX B;  1FO4 A;  2N9E B;  2N9L A;  2KFJ A;  2IY0 B;  3AEF B;  5EE3 A;  2INN E;  4BKS D;  3WAO A;  3BYT B;  2WXF A;  3EEC A;  1PGA A;  1UH6 A;  1UBI A;  3BK1 A;  2MJE A;  3B0A A;  1P98 A;  1FM0 D;  3B1L X;  2N4F A;  3Q3F A;  2DZJ A;  4DXA B;  3PO0 A;  2LEK A;  2CR5 A;  3UQB A;  4MH0 E;  3DQV A;  4BKG A;  4IG7 B;  4IKG A;  4EFO A;  3ZLZ A;  1TT5 B;  1WX7 A;  1V9J A;  2JQR B;  2Y3A A;  1F2R C;  3ZDM C;  1WXA A;  4WAF A;  3BK2 A;  1WJU A;  2KWV B;  2MRP A;  2D3B A;  2L1A A;  1L5P A;  4WIP A;  4URK A;  1I42 A;  5EE9 A;  4YL8 A;  3ZJT A;  1ESF A;  5CTR C;  3T8M A;  1AAR A;  4LJO B;  3QHT A;  1Z2M A;  1Q1O A;  1DOI A;  1QZE A;  5J18 A;  1GOZ A;  1G6J A;  5AZF A;  3AE8 B;  5IO9 A;  2L05 A;  2LVQ A;  4ANV A;  2MEK A;  3MC0 B;  2BB5 A;  5DPS A;  3DVG X;  2QDF A;  2VZK D;  4FJZ A;  4KZ0 A;  1LFD A;  3DBH B;  4WJQ A;  3OLM D;  1WGY A;  2FBW B;  5TR5 A;  1WGG A;  1ISN A;  1ZE3 D;  3V60 A;  1B9R A;  3IHP C;  1T5X D;  5H92 C;  4B0M A;  1WYG A;  1AN8 A;  1XLN A;  3V05 A;  2WDQ B;  2O2V A;  4W9H A;  2RPQ A;  1SXT A;  2ZJD A;  1MG4 A;  2KJH B;  4MAC A;  2LXA A;  3AXC A;  2J0J A;  3AE2 B;  1IUE A;  5C23 A;  1KH0 A;  3P2B A;  1T3Q A;  2IZV B;  1ZGU B;  2HTH A;  3BVG A;  3RYT A;  5IKC M;  3JSV A;  3DCG A;  4WQM A;  4ICU A;  2LGD A;  1Q10 A;  3R2T A;  1P7F A;  3M95 A;  3QC8 B;  3TEX A;  1VD2 A;  1AW7 A;  5C3J B;  2K8B A;  1SEB D;  2CKH B;  2LFI A;  3ZNZ B;  2KTR A;  4ICV A;  5L83 A;  1NI2 A;  4YSY B;  4G0N B;  1OFF A;  2KQ4 X;  3KYC D;  2RR9 A;  1YIW A;  1ZOY B;  2WNM A;  2JXX A;  1ET9 A;  3JYU A;  5IN7 A;  1JCK B;  1XO3 A;  2FUG 1;  3IXS A;  1TZO A;  1P3Q U;  2V1Y A;  2ASQ A;  5IAA C;  4GDK B;  1L4D B;  2N9K A;  1Y56 A;  1OTR B;  2MX2 A;  1TJE A;  4ZRP A;  1DOY A;  2KDE B;  4M02 A;  2D3A A;  3AN1 A;  1SE2 A;  3VRB B;  1RFK A;  3LB8 C;  3PPA A;  1QIL A;  1N60 A;  1NI3 A;  3VAW A;  2WP9 B;  2L7R A;  2KWU B;  4DDI D;  3DBS A;  3RNA C;  2DX5 B;  1KJT A;  4EZL A;  1GB4 A;  5IA7 A;  1I35 A;  2BBC A;  4IW0 A;  4HRS A;  5FR6 A;  1SIF A;  3Q8A A;  2J4X A;  2R2O A;  1GC6 A;  3KVF B;  1I7H A;  2RD0 A;  1D4B A;  4C4V B;  1PFD A;  2E3T A;  1I4X A;  4YSZ B;  4IDI A;  5KHO A;  4BBN C;  5CHF A;  1NYR A;  1OGW A;  1T6B X;  2BYV E;  1HZ6 A;  1WX8 A;  3VXW A;  4MGY E;  1PQS A;  5TSS A;  1HE8 A;  2GOW A;  5JH5 C;  2RSU A;  3AE3 B;  2K39 A;  3VR9 B;  4B9K A;  3AED B;  3AEB B;  3LXF A;  4S17 A;  4TUU A;  4MEL A;  3LJ3 A;  5G2N A;  2R61 A;  1WY8 A;  2SEB D;  3K9P B;  3T3N A;  5I4D A;  3JW0 X;  1F77 A;  1ET6 A;  2W54 A;  1OQR A;  1IBX A;  3UF8 A;  2WS3 B;  2G1E A;  1HA5 A;  2BW2 A;  4E3C A;  3P4S B;  3HM3 A;  1L6U A;  4L1B A;  1TY0 A;  1L2N A;  4BVU C;  3M3J A;  4P1C C;  3Q2A C;  2KYW A;  1TS3 A;  2FNJ B;  4P1B C;  2WXJ A;  1V1O A;  4OVU A;  1TS4 A;  4WAA A;  2Z8L A;  5DPT A;  2YEP F;  2FID A;  4XGA B;  4LK0 M;  1MHH E;  3W1Y A;  3AI5 A;  2WXH A;  2RMM A;  1V6E A;  4TMA B;  3AU5 A;  3NRZ A;  2NS5 A;  4NQL B;  5BMI A;  3S2A A;  3ZXR A;  5EDS A;  2JU6 X;  2WXL A;  2J53 A;  1E8W A;  4K3C A;  3A1Q A;  2K25 A;  5BMG A;  2MHJ A;  4PYZ A;  4UDU C;  3X0W A;  4W9C A;  1H8C A;  3PZD A;  2V3P A;  4K81 A;  1T0Q C;  1DGJ A;  2KN5 A;  3RUL A;  3E9S A;  2GBK A;  2KLC A;  4BZA A;  1V5O A;  5DPW A;  3A4S C;  3ZUN A;  1Q5W B;  2W82 A;  2QC8 A;  4NZL B;  3N1Z C;  4NJ6 A;  3H7S A;  2E6X A;  4DQO C;  3APF A;  3ZNI D;  1QLB B;  2GBJ A;  2CHW A;  2GLS A;  1LQB A;  3KUZ A;  2IO0 B;  2B3A A;  1C4P A;  4OZB A;  1YNT E;  3P42 A;  1GC7 A;  2JYT A;  4NAM A;  4BKT A;  3CIR B;  2IGG A;  3ABV B;  3U8Z A;  1JWB D;  4MSM B;  2BF8 B;  3WA0 A;  1I4Q A;  1TY2 A;  4MGZ E;  2WDV B;  2IY1 B;  1KLG D;  4L23 A;  1GUA B;  4ACF A;  2CJN A;  2O6V D;  4GOC A;  2PVG C;  1SGH A;  2I1J A;  2BPS A;  2KJR A;  3VH3 B;  4N58 A;  4DXF A;  1QOG A;  1FEH A;  3ZW3 A;  4BAX A;  4GN1 A;  2NVU I;  4G3X B;  4GIV A;  5HFY A;  5FR3 A;  3T3O A;  1FRR A;  5IOI A;  2DWQ A;  3A1Q B;  3UQA A;  1IGC A;  4LDT B;  3FKY A;  1YJI A;  1TKE A;  3QA8 A;  3QCA A;  1TBE A;  4GDL A;  3DPD A;  2BT6 A;  2KWC A;  3IT6 B;  3W1S A;  1L0X B;  3I9V 1;  4IWQ A;  4JGH B;  5H8Y E;  3RMK C;  1S1Q B;  1JQ4 A;  2KFK A;  1IYF A;  5D3I B;  4WH4 A;  1VZ7 A;  2LUM A;  1V80 A;  2PLP A;  2JF5 A;  4RCO A;  3TL5 A;  2KT7 A;  2JYE A;  5AUI A;  1IGD A;  4O1N A;  1OQY A;  2WXN A;  2N9P C;  5BYR A;  1T0R C;  2M0A A;  4FHK A;  1H4R A;  4JX1 C;  2REX A;  3R8B A;  3RCZ A;  1VZ6 A;  1EWY C;  3UGB B;  4Q2J A;  4NJC A;  3GZN B;  4W9F A;  3CMM B;  4ARI A;  3IT4 B;  4GSW A;  1JWA D;  4KDL B;  3ECI A;  2D5G A;  1KFY B;  1WE6 A;  4LDT D;  4EEW A;  3AE4 B;  4FBJ B;  4REZ A;  4A90 A;  2MA9 B;  1F52 A;  2LMC A;  2KD0 A;  2KX0 A;  2K6D B;  2ZW0 A;  2N1V A;  3WCQ A;  3P1M A;  3QAR A;  3H6N A;  5GXG B;  4I6N B;  3ONS A;  3N1X C;  3QAQ A;  2PMV A;  2Y5P A;  4JIO U;  2RPV A;  3NZ3 A;  2JZZ A;  1MI0 A;  5D2M B;  4RNA A;  2ZPY A;  2WXK A;  2W3R A;  3OWE B;  1XCT L;  3ZJV A;  1GPX A;  2FCM A;  5EE0 A;  4AQ7 A;  4OVZ A;  4XWW A;  2MCN B;  3PRP B;  4C80 A;  2JT4 B;  2M1M A;  2OHF A;  4KV2 A;  4HWI B;  4MSQ B;  4KKJ A;  2G4D B;  4NY0 A;  1LO5 D;  2K0P A;  1C1Y B;  2GRI A;  3AV8 A;  3I63 C;  4NNJ B;  3TUO A;  2YLM A;  4HLE A;  2KWD A;  4IWP A;  3HK0 A;  2NBV B;  3A9J A;  2L83 A;  1R4M I;  3N30 A;  3VHT C;  3ALB A;  1TKG A;  2BWE S;  1C78 A;  1K8R B;  2TSS A;  4KZC A;  1E10 A;  4OW0 A;  3P4Q B;  2QJL A;  1C79 A;  4HPL B;  4ANU A;  3A9J B;  2KK8 A;  1V2Y A;  2N1W A;  4NAW B;  5D94 A;  1S3S G;  3OJ4 B;  2BYE A;  1E7U A;  2LVP A;  3LYY A;  3QX1 A;  1FD6 A;  3TMP B;  4FLH A;  4W9I A;  2MQJ A;  2KAC A;  3P63 A;  3JSV B;  4GXB A;  3FIL B;  2WXI A;  3O13 A;  2HE7 A;  2WXO A;  1TZ1 A;  2N7E A;  2D2Q A;  1PYW D;  2IO3 B;  4WWM A;  2W55 A;  2ZVO A;  4RGO S;  3B9J A;  4ARC A;  1ZPS A;  1E9M A;  4A9A A;  2FE8 A;  3MJ5 A;  3AE9 B;  4MT5 A;  3CST A;  2RGF A;  3PLU A;  4LNO A;  2O2V B;  3PVL A;  4WUR A;  1QQR A;  1WR6 E;  3NVV A;  4GGQ A;  3RNF C;  3DBR B;  4AWJ A;  4W9E A;  3DWG C;  3GE8 C;  2AQ3 B;  1RYJ A;  2N7D A;  1E0Z A;  4P6V F;  3TIX A;  4WJP A;  2DYO A;  3RNE C;  1UEL A;  1STE A;  2ACZ B;  2AQ2 B;  2M17 A;  4US8 A;  3GB1 A;  2KMM A;  3B2G A;  4M01 A;  1YN5 A;  2DZK A;  1FFU A;  2BKR B;  3A4R A;  4RGT A;  3EUB 2;  2ZW1 A;  4IM3 A;  2L00 B;  1Y8R C;  3C19 A;  2EKE C;  2LJI A;  4LCD E;  2INC C;  1L7Y A;  1WJN A;  4C4V A;  1WGK A;  1ZXI A;  1C9F A;  1YN3 A;  2AYO B;  3ML9 A;  1LGR A;  2LUE A;  4N9F 4;  2KDB A;  2J7Q B;  4LTU A;  3KLS X;  2JY6 A;  3EHV A;  2M0X A;  4HDQ A;  2JXT A;  3L0W B;  2EKI A;  1UWX A;  1YJJ A;  1L6V A;  1P9D U;  1E7V A;  5JHA A;  3ZGZ A;  3AMZ A;  2KTF A;  4II2 B;  4USA A;  3Q3O C;  1HZ5 A;  1UGJ A;  4DK5 A;  2MP2 A;  2I1K A;  3MHS D;  4MH8 A;  2WDR B;  3DHI C;  2AWT A;  1WXQ A;  2J52 A;  3TEW A;  1WMH B;  2IO2 B;  2NTS A;  3R2I A;  1WGH A;  4AOF A;  1WGD A;  1J7A A;  2GB1 A;  1EO6 A;  3HUI A;  2KMC A;  1JW9 D;  4II3 B;  1PDX A;  1VR9 A;  3PLV A;  1R4M B;  5G5H A;  2NPT B;  3UIO B;  5E6P A;  2EEL A;  3NY5 A;  1E7P B;  1HTO A;  2PJH A;  2QSD A;  2KNB A;  4OZC A;  1XT9 B;  4ZYN A;  1N63 A;  2K1F A;  4IC7 B;  3H8H A;  2D11 A;  1EU4 A;  2KTR B;  5BYQ A;  4KSL C;  2IBI B;  2QMT A;  2Z59 B;  4LNI A;  1WWT A;  2BWF A;  1KRH A;  2JX5 A;  3HVD A;  2MBQ A;  1OQQ A;  1T0S C;  3TCA A;  1SJE D;  1XF5 L;  4I6P A;  1P0R A;  3KUC B;  1I4R A;  4K3B A;  4P7I A;  4YXD B;  1C77 A;  2WYQ A;  2Z0D B;  4K7U A;  4XDC A;  4GB9 A;  1BT0 A;  1ACC A;  4XYC A;  1QOA A;  1YD8 U;  2VH1 A;  4XWT A;  1FCL A;  1N5W A;  1N62 A;  1CZP A;  2G4S A;  5FKA C;  4CO7 A;  3SFE B;  1TYG B;  4W9D A;  2LGY A;  2JPH A;  3IVF A;  1WIA A;  4A8X C;  3R7R A;  3L54 A;  2KFK B;  3BVZ A;  3M62 B;  3SHQ A;  4A20 A;  2LRU A;  3DHG C;  2V3N A;  3OJ3 A;  3VVW B;  2JRI B;  1TKY A;  1KTK A;  4N59 A;  4CQN A;  5LNK 1;  3DVN U;  1EM7 A;  1F2R I;  2PIA A;  1HXY D;  2WX0 A;  2WGS A;  3RNB C;  2VZK B;  1SE4 A;  2IYD B;  1E8Z A;  3Q8B A;  1YX5 B;  2MBE A;  3KH0 A;  1R4N I;  1TS2 A;  3N3K B;  3Q8F A;  1FXI A;  3VDZ A;  5J2R A;  2RDB C;  3GS2 A;  3ZIM A;  1EWC A;  1K50 A;  2DYB A;  3QQ8 B;  3ZTD A;  2J42 A;  3IG3 A;  1SJH D;  3H7P A;  4BFR A;  2UWQ A;  1FFV A;  2WQY B;  1F9J A;  4XE0 A;  5AZH A;  3AE1 B;  2X38 A;  2K22 A;  1WXM A;  1WZ0 A;  2IJ0 A;  4E74 A;  2N7J A;  4RM9 A;  3EFU A;  1IP9 A;  1J19 A;  3RPF C;  5AUK A;  2GMI C;  1WXV A;  3UI3 A;  3U7Z A;  3PS6 A;  1MFW A;  1X1M A;  4XC2 A;  3ZKJ C;  4YSX B;  2MH7 A; 
#chains in the Genus database with same CATH homology
 2JYE A;  2IGH A;  4P16 A;  5AUI A;  1SE3 A;  2ICI A;  1IGD A;  4O1N A;  3PO0 A;  2LEK A;  3SEB A;  2WXN A;  5BYR A;  5D3D A;  2INP E;  1B1Z A;  2IGD A;  2M0A A;  4IKG A;  3NUH B;  1ZDX A;  4JPS A;  4JX1 C;  3R8B A;  1BUI C;  1QT9 A;  1YN4 A;  2DYM A;  1L0V B;  2I38 A;  2JQR B;  2Y3A A;  1F2R C;  1VZ6 A;  3KQ4 A;  2ON8 A;  1I4H A;  1EWY C;  4WAF A;  4Q2J A;  4NJC A;  4R3D A;  3BK2 A;  1V97 A;  3Q69 A;  1V1P A;  5G5G A;  2L1A A;  4ARI A;  3IT4 B;  1L5P A;  4WIP A;  3ZYY X;  5EE9 A;  3ZJT A;  1JWA D;  1ESF A;  2D5G A;  4DXG A;  3I57 A;  1FNU A;  1KFY B;  2WXM A;  1DOI A;  3TEZ A;  1GOZ A;  2JSV X;  3AE4 B;  3NS1 A;  1R7S A;  4REZ A;  4A90 A;  1FRD A;  3AE5 B;  3FC4 A;  3AE8 B;  2LMC A;  1SIJ A;  2MEK A;  3MC0 B;  1EU3 A;  2BB5 A;  1FNV A;  2ZW0 A;  3WCQ A;  3AE7 B;  3P1M A;  2L32 A;  2VZK D;  5GXG B;  3VRA B;  3EA6 A;  1ENF A;  2FBW B;  2PMV A;  1ZXH A;  2Y5P A;  1ZE3 D;  2RPV A;  3NZ3 A;  2BS2 B;  5BMH A;  1B9R A;  2MJD A;  1MI0 A;  1YQ4 B;  1T5X D;  4RNA A;  2WXK A;  2W3R A;  3OWE B;  5HHD G;  1XCT L;  3ZJV A;  4YT0 B;  5H92 C;  2WU5 B;  1WYG A;  4B0M A;  1AN8 A;  2BB6 A;  3TSS A;  1GPX A;  5EE0 A;  1XLN A;  3V05 A;  2WDQ B;  3GP7 A;  4AQ7 A;  4OVZ A;  4XWW A;  3HRD D;  1SXT A;  3BZD B;  4FXC A;  4C80 A;  1JML A;  3KWV A;  2OHF A;  3AH7 A;  1QKZ A;  2N0S B;  4KKJ A;  4L2Y A;  1LO5 D;  2K0P A;  4MAC A;  2GRI A;  3AV8 A;  3TUO A;  2KWD A;  2QEJ C;  2JZP A;  3AE2 B;  2L83 A;  1IUE A;  1TKG A;  1C78 A;  1KH0 A;  4A55 A;  3AEG B;  2HTM E;  4IOI E;  1T3Q A;  5E6J A;  5T8I A;  3BVG A;  3AEC B;  1CJE A;  1L4Z B;  2TSS A;  4ITK A;  4WQM A;  1SSN A;  1E10 A;  4OW0 A;  1Q10 A;  3R2T A;  1P7F A;  3EGR A;  3P4Q B;  2QJL A;  3TEX A;  4HKQ A;  1A70 A;  1C79 A;  1AW7 A;  5C3J B;  1SEB D;  1XXG A;  2LFI A;  4ZYS A;  1FIQ A;  1K51 A;  4YSY B;  1OFF A;  2KQ4 X;  3AEE B;  1QF6 A;  1WRI A;  5BYS A;  4KKI A;  1UNS A;  2BS3 B;  4NAW B;  4YTP B;  1ZOY B;  2WNM A;  2B76 B;  1ET9 A;  5HI1 A;  3ZQ4 A;  1VRA B;  1JCK B;  1J7C A;  1V8C A;  3L4P A;  4PT5 A;  1D5Z C;  1XO3 A;  4TSS A;  3LYY A;  2FUG 1;  3IXS A;  1TZO A;  2M56 B;  3IAM 1;  1FD6 A;  4ZHO A;  4GDK B;  1D5M C;  4RGN A;  2KAC A;  2N9K A;  1L4D B;  3P63 A;  1RWS A;  1Y56 A;  4RGM A;  3FIL B;  2WXI A;  3O13 A;  1N5X A;  2CU3 A;  1D6E C;  1XLO A;  1HEZ E;  1TJE A;  4ZRP A;  1DOY A;  2WXO A;  1ROE A;  3AN1 A;  1K53 A;  1SE2 A;  2LHD A;  3VRB B;  1HQR D;  1RFK A;  1DOX A;  1PYW D;  4WWM A;  2AQ1 B;  3LB8 C;  2W55 A;  3NVY A;  2WXR A;  1QIL A;  1N60 A;  1NI3 A;  3C8Y A;  4RGO S;  3B9J A;  4HKZ E;  4ARC A;  2I2Y A;  1ZPS A;  2WP9 B;  1E9M A;  4RF0 A;  4A9A A;  2FE8 A;  3BVM A;  1GB4 A;  1NVI D;  3MJ5 A;  3AE9 B;  4MT5 A;  2BBC A;  1NYQ A;  4OZA A;  1JAL A;  4HRS A;  2V0G A;  3CWI A;  2KDM A;  1KLU D;  3E56 A;  3Q8A A;  2J4X A;  4WUR A;  1CK1 A;  4KX6 B;  1QQR A;  2W3S A;  3NVV A;  1I7H A;  3BII D;  1TS5 A;  3DWG C;  1JWS D;  1RYJ A;  2AQ3 B;  1E0Z A;  1D4B A;  4TQ1 A;  4YTN B;  4P6V F;  2Q5W D;  3IAS 1;  1PFD A;  2E3T A;  1I4X A;  4YSZ B;  1WSP A;  4IDI A;  2DYO A;  1I4P A;  4XDD A;  1RM6 C;  1STE A;  4HJG E;  1C4A A;  1NYR A;  1T6B X;  2ACZ B;  2AQ2 B;  1HZ6 A;  3AB5 A;  2MJ3 A;  4US8 A;  3GB1 A;  2KMM A;  2WXP A;  3B2G A;  3FIL A;  5TSS A;  1L0Y B;  3HVZ A;  4LLG M;  1SB3 C;  1YN5 A;  5JXV A;  1FFU A;  3PZ7 A;  3AE3 B;  4OHJ A;  4RGT A;  3EUB 2;  1JRO A;  2ZW1 A;  3AED B;  3AEB B;  3VR9 B;  5HG2 A;  3LXF A;  2BTE A;  2NTT A;  3VQI A;  4JWS C;  1JWU D;  2LJI A;  4MM3 B;  4C56 C;  1DYQ A;  4GDL B;  1WGK A;  1ZXI A;  1C9F A;  1YN3 A;  2JWU A;  2R61 A;  1NEN B;  2SEB D;  1QOF A;  3T3N A;  5I4D A;  4LTU A;  1C76 A;  2PVO D;  3KLS X;  1F77 A;  3U4E G;  1ET6 A;  2W54 A;  1OQR A;  1XEE A;  2JXT A;  4KGT A;  1IBX A;  2LGI A;  2EKI A;  2PTL A;  1ZUD 2;  1UWX A;  1YJJ A;  1I4G A;  2WS3 B;  1AYF A;  1L6V A;  2G1E A;  2M19 A;  1HA5 A;  3AE6 B;  1MPE A;  4C7Z A;  2WXQ A;  1D5X C;  1SBB B;  2BW2 A;  3ZGZ A;  3AMZ A;  3P4S B;  3ETR A;  4USA A;  1L6U A;  1F0Z A;  5D7G A;  4HEA 1;  2H89 B;  3VR8 B;  4KGR A;  4L1B A;  3V3X A;  4C7Y A;  1HZ5 A;  1UGJ A;  1TY0 A;  3SFD B;  1BML C;  3AEA B;  3W5V B;  3N9Y C;  2WDR B;  4MH8 A;  3J9C A;  1TS3 A;  2NMQ A;  1WXQ A;  3B2F A;  4H2A A;  1ZP0 B;  2J52 A;  3TEW A;  2WXJ A;  2XNA C;  1V1O A;  1TS4 A;  4EE2 A;  2Z8L A;  2NTS A;  2KN4 A;  3R2I A;  1J7A A;  2QIL A;  2YEP F;  2WXG A;  1UUP A;  2GB1 A;  5EE1 A;  2HDE A;  4ZRQ A;  4LK0 M;  1MHH E;  3HUI A;  3RFZ B;  1JW9 D;  3AM9 A;  2WXH A;  1PDX A;  1VR9 A;  4J3O D;  4ZHP A;  2RMM A;  3U52 E;  5G5H A;  4TMA B;  2IPK D;  4N6E B;  1KF6 B;  2EEL A;  3NRZ A;  1BXT A;  1E7P B;  1UWM A;  2DBY A;  1GB1 A;  5BMI A;  2PW9 A;  2QSD A;  4OZC A;  1N63 A;  3PZ8 A;  3H8H A;  2JU6 X;  1PGB A;  2GI9 A;  2J53 A;  2WXL A;  1V1P B;  1EU4 A;  1QOB A;  4US9 A;  3URY A;  5BMG A;  1YMH E;  5BYQ A;  4UDU C;  2QMT A;  1YQ3 B;  4RFB A;  1WWT A;  1KRH A;  2JX5 A;  2V3P A;  3HVD A;  4AS1 A;  1OQQ A;  4RF1 A;  1CQV A;  1FNW A;  2WLB A;  1SJE D;  2H88 B;  1DGJ A;  4KGS A;  1XF5 L;  1VJK A;  1MVK A;  1SF0 A;  3E9S A;  3NVZ A;  2QIE B;  1IBX B;  1I4R A;  2V4I B;  4YXD B;  2L52 A;  1C77 A;  2WU2 B;  4XDC A;  1NEK B;  1J7B A;  2W82 A;  1PUT A;  1ACC A;  3KWL A;  3TEY A;  3P4R B;  4NZL B;  1QOA A;  4XWT A;  1FCL A;  1N5W A;  1N62 A;  2E6X A;  1CZP A;  5FKA C;  2CJO A;  3MP9 A;  3SFE B;  4DQO C;  1XLP A;  4TQ0 A;  1QLB B;  2XN9 C;  1TYG B;  2K9X A;  1M4V A;  2SAK A;  3ZJU A;  4A8X C;  3BWU D;  2BS4 B;  1C4P A;  4OZB A;  1ZDV A;  3BVZ A;  4M0W A;  1YNT E;  2DLB A;  2RDH A;  2G9H D;  3P42 A;  1FXA A;  2JYT A;  4NAM A;  2V3N A;  3CIR B;  1E6E B;  2BYT A;  2IGG A;  3ABV B;  1JWB D;  4YWG G;  1K52 A;  4YTM B;  1GAQ B;  1I4Q A;  1TY2 A;  1TKY A;  4B0E A;  1KTK A;  4N59 A;  4CQN A;  2WDV B;  5LNK 1;  1KLG D;  4JE3 B;  1FMA D;  4L23 A;  1MHX A;  1P7E A;  2K5P A;  3W2D A;  1EM7 A;  5MPO A;  2CJN A;  3MFG A;  1F2R I;  2PIA A;  1C4C A;  1HXY D;  4JWU C;  4A6Q A;  2VZK B;  1SE4 A;  3P4P B;  2PVG C;  2IDY A;  3Q8B A;  3W5U B;  1VDV A;  3SR6 A;  2OED A;  2RDG A;  3DWM A;  4N58 A;  1TS2 A;  2Y5C A;  4D2K A;  4DXF A;  1VLB A;  1QOG A;  1FEH A;  3Q8F A;  1XLQ A;  3FAH A;  1FXI A;  1N61 A;  2PKO A;  3GS2 A;  1EWC A;  1K50 A;  1FCC C;  5HFY A;  3Q8E A;  5FR3 A;  3T3O A;  1FRR A;  2J42 A;  1JWM D;  2DWQ A;  4GLS C;  3MHZ A;  1IGC A;  3U2S C;  3Q8C A;  1AWD A;  5C2T B;  1SJH D;  2AX5 A;  5FK9 C;  1YJI A;  1FFV A;  1TKE A;  2WQY B;  4XE0 A;  3AE1 B;  2X38 A;  2LHE A;  3W9C B;  2K22 A;  2K3U A;  4ZOH C;  2ONQ A;  2BT6 A;  3IT6 B;  2YEP B;  3BYY B;  3W1S A;  1L0X B;  1FO4 A;  1XCQ L;  2IJ0 A;  3I9V 1;  1JRP A;  2N9L A;  1VZ8 A;  2N7J A;  3AEF B;  5H8Y E;  5EE3 A;  4RH6 A;  2INN E;  1JQ4 A;  2KAJ A;  3RPF C;  5AUK A;  3UI3 A;  3NVW A;  5D3I B;  3BYT B;  4WH4 A;  1PGA A;  1VZ7 A;  2WXF A;  1PGX A;  2LUM A;  3BK1 A;  4HRO A;  4RCO A;  2PLP A;  3U7Z A;  2MJE A;  1FM0 D;  4YSX B;  2MH7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...