1IGDA

The third igg-binding domain from streptococcal protein g: an analysis by x-ray crystallography of the structure alone and in a complex with fab
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
61
structure length
61
Chain Sequence
MTPAVTTYKLVINGKTLKGETTTKAVDAETAEKAFKQYANDNGVDGVWTYDDATKTFTVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immunoglobulin binding protein
molecule keywords PROTEIN G
publication title The third IgG-binding domain from streptococcal protein G. An analysis by X-ray crystallography of the structure alone and in a complex with Fab.
pubmed doi rcsb
source organism Streptococcus sp. g148
total genus 16
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 1994-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1igdA00
1C9FA 2IGGA 1ZXHA 2J52A 2ONQA 5HFYA 1K52A 2J53A 1IGCA 2N9KA 3MP9A 4HJGE 2RMMA 2JU6X 1K53A 1MI0A 1MVKA 2GB1A 2PLPA 5HI1A 4IOIE 1FCLA 2RPVA 5JXVA 2KDMA 4WH4A 1YNTE 1GB4A 5BMGA 1P7EA 1PGXA 1GB1A 2JXTA 2LHEA 2K0PA 2LHDA 1IBXB 2IGHA 2IGDA 1XF5L 2LGIA 4D2KA 3GB1A 2JSVX 4KGTA 2N7JA 2ZW1A 1K51A 3UI3A 4KGRA 2LUMA 3FILA 1YMHE 2I38A 1XCTL 1MHXA 2KN4A 1QKZA 2QSDA 4OZAA 1XCQL 4OZBA 1P7FA 2KQ4X 3FILB 1MPEA 5BMHA 1Q10A 5HHDG 1D4BA 2JWUA 4IKGA 2KWDA 1PGAA 4GLSC 2PTLA 2EELA 2OEDA 1MHHE 1PGBA 1UWXA 1KH0A 1K50A 2NMQA 2JZPA 5BMIA 2I2YA 3V3XA 1HZ5A 4OZCA 2N9LA 2ON8A 4MACA 1FCCC 1FD6A 1F2RC 2ZW0A 1JMLA 1HEZE 2KACA 2GI9A 1HZ6A 2PW9A 2QMTA 4HKZE 1IBXA 5HG2A 4KGSA 1IGDA 1F2RI 1EM7A
chains in the Genus database with same CATH superfamily
4YSXB 2KFKA 2W82A 3ZTCA 2OJWA 1FFUA 5TSSA 2J52A 1FNWA 4WWMA 2WX1A 2KOXA 1FIQA 2JU6X 1N62A 4NPNA 3VTUA 4I6LB 2BKFA 1AW7A 3FKYA 3ZIMA 4RF0A 1WGDA 1YNTE 5JHAA 4RFBA 4PYUA 5FK9C 1P7EA 4II3B 3U30A 4BOSC 2IO3B 1SEBD 1KTKA 4G3XB 3HK0A 2QCZA 1E7VA 3ZXVA 3QX1A 2K39A 3AEFB 1OFFA 1TKGA 2BS2B 4E74A 3Q3FA 1E8WA 3R2TA 4F7ZA 4YTPB 2LUMA 1WXAA 5GXGB 4EE2A 1YJJA 2YEPB 2JQRB 1RFAA 2WX0A 1L6VA 1VR9A 2AL6A 2N7DA 1I4XA 1TBEA 2KVRA 1Q10A 5C23A 3RYTA 2K3UA 3EGRA 3WIMA 2PEAA 3FAHA 1A5RA 4LNIA 4MM3B 2WXGA 1L4ZB 1PGAA 2C9WB 3LDZE 2MJEA 3IT6B 3L17A 2KAJA 3WCQA 4ASWC 4II2B 1UWMA 2E3TA 1HZ5A 4IWQA 1IP9A 2NR2A 3NOBA 3AEDB 1FCCC 3X23A 4ZHOA 2MCNB 3DBHI 3MJWA 3PT2B 3N3KB 4ANUA 1ET9A 1IBXA 3C8YA 2VRRB 2X38A 2C7MB 4HDOA 4DXAB 2REXA 2MHJA 2XK5B 2D3BA 2OJRA 1D5XC 3QIJA 2KQSA 4C80A 1GB4A 2FIFA 3UQBA 1T6BX 2IY0B 3U52E 3KUCB 3ONSA 2LHEA 3B9JA 4G0NB 2CJOA 4NAWA 2L3ZA 2ZEQA 5TR5A 1SIFA 3EFCA 3OJ4B 3B0AA 4BZAA 4LLGM 3R7RA 4KGRA 2H88B 1NVID 1QT9A 3Q3OC 1YMHE 1JCKB 1DOIA 5CHWA 4LDTB 3TCAA 3SU8X 4MGYE 1DGJA 4IC7B 4WAAA 5C2TB 2SAKA 2BB6A 4C7ZA 4ICUA 4P6VF 1BUIC 4REZA 2ICIA 4XDCA 3IBEA 1WGKA 2PIAA 3KVFB 2KO3A 4YTMB 2O2VA 1QOGA 3GE8C 2L52A 4JIOU 5D3IB 1FD6A 3R66C 2B3AA 3RN9C 2LGSA 1D6EC 4LNFA 4P16A 5KHQA 4RM9A 1XLOA 1RWSA 3GZNB 3I57A 1J7AA 1WX8A 3H6NA 1WWTA 3RZWC 5IAAC 3Q8BA 2WXQA 4LJPB 3VR8B 3I9V1 2Y3AA 2V3NA 5BO4B 5HI1A 3L4PA 3DBLI 2MQJA 3IT4B 2HE7A 2JZ3B 1B1ZA 2L76A 2C7NB 2ZNVB 1V6EA 1V5TA 4ZDVA 1UH6A 2GBJA 3UGBB 1P1AA 2KANA 2LWPA 1FO4A 3NVWA 4DHJB 2IPKD 2MSED 3RNEC 2NBWB 3FC4A 2MJDA 4M0WB 3NRZA 1F0ZA 1AN8A 2GOWA 4XDDA 1WJ4A 2WDRB 4KGTA 2KK8A 2DLBA 3RT3B 1LQBA 2D2QA 1D5ZC 4I6NB 5FR6A 4NAMA 1I4GA 4R3DA 2JYEA 3PRZA 1T5XD 3U8ZA 1TKYA 1UNSA 1MPEA 5BMHA 3NZUA 1P3QU 5D7GA 1T3QA 1S1QB 2DZIA 1FNVA 2IDYA 2KWCA 4HRSA 2DYMA 3QAQA 3B2FA 1QZEA 5LXIB 2PTLA 2KX3A 4JL9A 4FBJB 3AU4A 3E9SA 4XZ4A 2JZPA 2LI5A 4DHZB 4YXDB 2N9PC 3KWVA 2PE6B 4F8CB 1RM6C 1WYWB 4KKIA 2L0TA 2KFJA 4W9JA 4PK1A 4C56C 2CR5A 1WRDB 1HEZE 1BXTA 4A8XC 2IO1B 3A33B 3V60A 4MH8A 1KM7A 4LCDE 2ZZPB 2N0SB 3NHEB 3M95A 2V0GA 1N5XA 2UU7A 2XNAC 4HCPB 1YJ1A 3T3OA 3TIXA 4DXFA 1K52A 3Q8EA 2AQ3B 1RLFA 2RMMA 3DHHC 1UBIA 2D3GA 3BY4B 2WWZA 4KZ0A 3RZFA 1QLBB 3H8HA 3IAM1 4IDIA 4WWNA 5JXVA 2D11A 1TZ1A 3ML8A 1WX7A 2WLBA 4MGKE 1TT5B 2DZJA 3DBSA 1ACCA 4FXCA 2BYFA 2KMAA 1U4AA 4A9AA 3LYYA 4AUQC 3U7ZA 5BYRA 2G4DB 3M3JA 2KDBA 1ZW7A 1L5PA 2NPTA 3UIPB 2MP2B 1OEYJ 2GLSA 1XO3A 4IM3A 2NS5A 4GXBA 2ACZB 3D32A 4KIKA 3UINB 4AJYB 4NQKE 2V9HA 3P4QB 3ZUNA 1OTRB 2W55A 1PGBA 3VH4B 4B0MA 2M4NA 2CJNA 4S0RA 1ZDXA 1C79A 5FR3A 2I1JA 2D3CA 1UELA 1WGYA 1HA5A 2O6VB 2ZVNA 4HPLB 1JRUA 2KD0A 4N9F4 1WF9A 1J0GA 2QMTA 3PHWB 2W9NA 3L08A 4LJOB 4LNKA 5LLIA 2MJ3A 2N7EA 2M0XA 3HUIA 1FMAD 3MJ5A 2KLCA 4ANXA 5L83A 2WXNA 3A9KA 2KMMA 4E3CA 1T0YA 2WS3B 3QHTA 2LD9A 3RUIB 1UGMA 3EFUA 4IWPA 1VRAB 4FJYA 1TS5A 3R8BA 1SE3A 2KDIA 2BQQA 2J42A 1RFKA 2L05A 4ANVA 4P7IA 3A1QA 1NBFC 2HJ8A 3BINA 1WH3A 1XEEA 2LHDA 1E5WA 2ZJDA 4C4VA 1WXSA 1PUTA 4FJVB 4OVZA 4DK5A 3O65B 2N9EB 1LXDA 1YQ4B 3S2AA 1T0SC 3VVWB 1YOVB 1Q1OA 4BKGA 4H2AA 2V3PA 1AARA 1WX9A 3N1YC 2G3QB 1V49A 1FXAA 2D10A 2N4FA 1WXMA 4ZHPA 3ZXRA 3Q69A 2KQ4X 3EUB2 1GNUA 3Q3NC 3BK2A 3PREA 2DZKA 2MX2A 4KDLB 2M56B 3LJ3A 5KHOA 3N30A 2FCMA 1OEYA 2KYWA 1VZ8A 2LJ5A 2WXKA 2KKCA 4XE0A 2G9HD 4IM2A 1KJTA 4GLSC 5AEKB 4FLHA 1SE9A 1LM8B 1XLPA 1UWXA 2J7QB 2QC8A 4J3OD 4GMVA 1QILA 1MG8A 1TYGB 2RDHA 2AX5A 4P1BC 1I4HA 3QCAA 4DDID 2DBYA 1C77A 3TJPA 3SFDB 1NYRA 4ZRQA 3AE6B 1WR1A 1VLBA 2ZPYA 3VAWA 3O13A 4J6IA 3MHZA 2HD5B 1WJNA 2VH2A 4LDTD 5E6PA 3RULA 2PKOA 2IBIB 3BYYB 4XX5A 4L23A 4XWTA 1F2RI 3RNAC 5DPSA 3OLMD 4IUMB 3M63B 2N9KA 3AE2B 3H1UA 4NY0A 1ZUD2 4W9IA 1WR6E 2XBBC 1HQRD 3VUWA 3EECA 3BVZA 3I5JC 2LUEA 2J0KA 1TKEA 5BMGA 1V8CA 5JZEB 2K9XA 4B9KA 1D3ZA 3RMKC 2JXTA 2RPQA 2R2QA 2JWZA 2HTHA 2NBUA 1R7SA 4D2KA 4MT5A 1PDXA 1K51A 4W9EA 2BW2A 1WMHB 3FILA 2MWSB 4WURA 4NAWB 2KNBA 2K8HA 3V62A 2WXFA 4AWJA 3RFZB 2GMIC 4FN2A 3NZ3A 5J17A 2LRWA 2IZVB 3CSFA 2R61A 3N1XC 4HKQA 1V81A 2L0FA 5JH5C 3UQAA 5HHDG 4W9KA 2WXHA 1X1MA 2KTRA 1E0ZA 1MHHE 3IVFA 1KH0A 2NTSA 2I2YA 2PMVA 1P9DU 2N9XA 2QIEB 4B6WA 4US8A 1BMLC 2MBEA 4QAYA 4M8MA 4JWUC 2O2VB 2GI9A 2PW9A 4PS8A 2R2OA 3J9CA 4ITKA 1ZGUB 1SF0A 4HKZE 3RI7C 3AE8B 1WI0A 2OHFA 3HM6X 3T9LA 1TS4A 2E6XA 1NDDA 3QK0A 4ZOHC 2FNJB 5HFYA 4A20A 3PZDA 3HM3A 1GUAB 4RH6A 5I4DA 4URKA 3RCZA 2MH7A 1KRHA 3ECIA 1SE2A 4WIPA 3A4RA 1J19A 2YLMA 2ZPNA 3TBLD 2KDMA 2DENB 2X8XX 1ZDVA 3AU5A 1I7HA 3HRDD 3W1SA 3Q2AC 2GBMA 3P42A 5G2NA 3NUHB 5E6NA 2GBNA 3KYDD 2BVCA 4GDLB 3DBHB 2KWUB 5JHBA 4M02A 2KJRA 2MBBB 2L83A 1TJEA 3I3TB 4TQ1A 4LTUA 1WY8A 1SJHD 4EFOA 1FM0D 2VZKD 2WHIA 2QSDA 5E6JA 4BFRA 1LFDA 5J2RA 3AB5A 4M00A 3PPAA 1XLNA 2ZCBA 3K9PB 1CJEA 4EKUA 2BPSA 1V86A 2KMCA 5CX3A 2CS4A 3SHQA 2D5GA 1WGHA 2LVPA 2JPHA 3ALBA 3VR9B 1V1PA 4WJNA 1HTOA 1F1HA 2J4XA 1MFWA 2QDFA 4HROA 3AXCA 1V80A 1GPXA 2GRIA 1E7UA 3W1SC 4TKNA 4MACA 1N63A 2BYTA 1JQ4A 1F2RC 2J0MA 1JWAD 3UF8A 4O1NA 3ENEA 1I42A 4RCOA 3DVGY 4EOYA 1M4VA 2AEHA 5HG2A 2UWQA 3AE9B 2AQ2B 2D07B 1XT9B 3Q6BA 2JZZA 2Q5WD 1C9FA 2FUG1 3VFKA 2ONQA 4G50A 1G6JA 3MP9A 2V1YA 1MI0A 4TUUA 2KVZA 4ANWA 1V9JA 4DBGA 2PLPA 2BWES 3P63A 2MA9B 4YSZB 2LGXA 1KFYB 5DPRA 2OOBB 2CKHB 1JROA 1VDVA 3R2IA 1UGJA 4MM3A 3KQ4A 4RGMA 3RNFC 1FPYA 1CZPA 1MJDA 2JXXA 4IW0A 4EZLA 1J7CA 4E71A 1C1YB 2N7JA 4X57B 3L0WB 2PE9A 2FIDA 3DVGX 1FRRA 3Q8AA 2QILA 1XCTL 1EUVB 2DZMA 2AYOB 1QOBA 2LXCA 5FKAC 4GB9A 1I35A 4S17A 5EE1A 1UUPA 1EWYC 3ETRA 5D6JB 4BKSD 4GU2A 3PLUA 3APFA 2JY6A 4IM0A 4IKGA 4RNAA 1FXIA 5H8YE 2XK5A 3ZJTA 4HJKA 2K1FA 2INPE 4K7WA 4JWSC 1SE4A 4JQWC 5GMVA 2N9LA 2DAFA 4LNOA 3UIOB 2JRHA 3ZGZA 5C3JB 2EKEC 4K7UA 2WYQA 3VRBB 4ARIA 1XLQA 3WAMA 3KUDB 3DBRB 1RYJA 4PS7A 4YWGG 1JALA 2KC1A 3MC8A 3QWZB 4WAFA 4DWFA 3T8MA 4HJGE 2MBHA 1TS3A 1L4DB 2BWFA 4IOIE 3AEBB 2PJHA 2IO2B 4WH4A 4WQMA 4OVVA 1T0QC 2W54A 4DXGA 2M8SA 1KLGD 4MEMA 1GB1A 3EA6A 2MBQA 1SJED 1YN5A 5CTRC 2J0JA 2IGHA 4A3PA 2G1EA 2RR9A 1FNUA 1I4PA 3HHMA 3A1QB 4KKJA 4GOCA 3ZNGC 2KX0A 3C0RB 1WXQA 2QHOA 3RNCC 2ZVOA 4C4VB 5MPOA 2I38A 5HKHA 4EEWA 1Y56A 4EZJA 3VHTC 2UYZB 4FJZA 3PZ7A 4TQ0A 1WZ3A 4W9LA 4RMAA 1VCBA 3N1ZC 3APDA 3ZO5B 1FXTB 4HPMB 2M0AA 2FUHB 2RGFA 1GJZA 2KWDA 3NG0A 1TS2A 1N60A 2INDC 3KH0A 4KSKC 5D2MB 3V05A 5CHFA 3ZQ4A 2BYVE 2DHZA 1R4MI 3IXSA 1N6ZA 3RNGC 4WJPA 4BBNC 3ZTDA 3AE3B 2C7HA 1E6EB 2M19A 4MGZE 4FA6A 1I4RA 4TSSA 3PO0A 1R4NB 3ABVB 3Q8FA 5LNK1 4KGSA 2V3SA 1GOZA 1L0VB 2IO0B 1ZXHA 1SGHA 2JRIB 1IPGA 2W3RA 4B0EA 4AQ7A 1MVKA 4ZYNA 3DDCB 1YN4A 1E9MA 1UF0A 2C60A 1ZKHA 5AUIA 3DPDA 2DX5B 2RPVA 4W9FA 1TTNA 1S3SG 2BBCA 3KW5B 2K0PA 3DWMA 4K1RB 2ZNVC 3U7DA 2KWVB 2QJLA 4AS1A 2KFKB 1JW9D 1XQQA 3PZ8A 3ZYYX 4RM8A 2FAZA 3B08A 4A6QA 1N5WA 1SSNA 4F1SA 3AEGB 2HDEA 1XD3B 3R7QA 1ET6A 3FILB 3PTFC 3H7PA 4MJSA 2INNE 3P1MA 4KV2A 3ZDTA 2CU1A 2PPHA 2Y5PA 1KLVA 2DYBA 3CF6E 1C4PA 5IKCM 3TEZA 2KJHB 1V1OA 3A9JA 2KN5A 3SR6A 4BVUC 2ON8A 4JX1C 4TV3A 3BVMA 4YSYB 3Q8CA 2ZW0A 3ZKJC 2WDTB 1GC6A 1SBBB 1OQRA 4RGTA 5J18A 2KDFB 1TGZB 4KSLC 1IGDA 1E10A 2RDBC 2AWTA 4WWOA 1WGRA 3B2GA 2IGGA 2ZCCA 1IGCA 4A90A 2NTTA 4HCNB 3L16A 2BS4B 2MP2A 4XWWA 2XEWA 5DCNA 5DPWA 1ZE3D 3DCGA 1TIFA 3ZJUA 1JWSD 3AV8A 4PT5A 2BGFA 4AP4C 4EZKA 3E56A 3NS8A 3LB8C 4LNNA 4IG7B 3NS1A 3VTVA 2CHXA 5G5GA 1IBXB 2L8JA 2LJIA 2QEJC 3VQIA 3V6CB 1N61A 3Q3JA 2LMCA 2MBOA 4US9A 2JSVX 1YX6B 5EE0A 2MLBA 2ZW1A 1CQVA 2BF8B 1GG3A 2KJ6A 4KX6B 3EHVA 4NJCA 2JUOA 3W2DA 3VXWA 5EE3A 4WJOA 1WSPA 1XCQL 2H89B 1WM3A 3PRMB 4HVBA 4HWIB 4DDGD 2KTFA 4ZRJA 3QQ8B 1DYQA 3CMMB 2JWUA 3DQVA 3JSVA 1EWCA 4MELA 1A70A 4JLCA 1GC7A 3PS6A 2W3SA 5BMIA 2A5UA 2PVOD 3N20C 3V3XA 4EUTA 4BKSA 1WIAA 1V1PB 3V6EB 3LXFA 3QA8A 3ZJVA 4KDIC 2GBKA 2CHWA 4GDKA 2N1WA 3DOWA 4DHJD 1DOXA 1OGWA 5IO9A 1EM7A 5D3DA 1SB3C 2K6DB 3W5UB 1EU3A 3ZNID 3VUYA 3N9YC 1MG4A 1F9JA 3W9CB 1K53A 5BYQA 1ZOYB 1WM2A 2V4IB 1ROEA 3SDLC 1D5MC 2K8BA 2LFIA 3ZVVA 2BT6A 4OHJA 4XGAB 3P4PB 1C76A 2NVUI 2L7RA 4JE3B 3T3NA 2DAJA 1UD7A 1EF5A 2BKRB 4N59A 3AN1A 2DNFA 3URYA 1WE7A 3W5VB 2G4SA 1AYFA 4FHJA 1PFDA 3MFGA 2IGDA 1XF5L 2JVCA 1QOFA 2FCSA 4HEA1 3TMPB 1C78A 3PGEA 3OJ3A 1FFVA 1OQQA 3NZSA 3R3MA 4M8NA 4USAA 2RD0A 1SIJA 4ACFA 3N32A 4K81A 4MGIE 1BT0A 2YEPF 1QKZA 3SD5A 4OZBA 1VZ7A 2FE8A 3U4EG 1AWDA 4YT0B 4NJ6A 3AULA 3IAS1 1VZ6A 3PVLA 3AEEB 5T8IA 3ZW3A 3CSTA 3AMZA 2LVOA 2EELA 4W9HA 1E8XA 2EMSA 3ZDMC 1WJ6A 3ZNZB 4XYCA 3VDZA 4OZCA 3RPFC 3WAPA 3A4SC 2M1MA 2FCNA 4LK0M 2BS3B 2LXAA 1E90A 2LGYA 3OG5A 4HXDA 3I63C 1H4RA 4ARCA 2CHZA 3DWGC 4BOZB 3AE1B 4K7SA 2IYDB 3EC8A 2WP9B 2HTME 3OAWA 1LGRA 3HVZA 2Y5BB 3HIZA 3TUOA 4NNJB 4C7YA 1M94A 1YX5B 2SEBD 2J53A 1NENB 1WMHA 1OQYA 3AEAB 3NVVA 2WXPA 1L0YB 4MSMB 1KF6B 5AZHA 3PLVA 1YQBA 4DHZE 2WU5B 3C19A 3GE3C 2INCC 2MW5A 2Z0EB 3P2BA 2N1VA 2JYTA 5IP4D 5G55A 1YQ3B 1QF6A 2VH1A 2D3AA 2RDGA 1WGGA 1K8RB 2K25A 4DQOC 4XC2A 3W1YA 3GZNI 1P7FA 2K22A 3MHSD 3BZDB 4M01A 2O6VD 4K3CA 3CWIA 1Q5WB 2ASQA 4ZYSA 2WXMA 1C4CA 4YL8A 1KOTA 4AJWA 1T0RC 4HPPA 2WXOA 2TSSA 3AECB 5G5HA 1WYGA 2MRPA 4W9GA 4JPSA 1ZXIA 3ZNHB 3L54A 1CK1A 4BBNF 2G45B 5EE9A 2WNMA 1XXGA 2I1KA 4ICVA 3KUZA 1V97A 2NPTB 5AZFA 3DBLB 1WRIA 5AZGA 3HVDA 2WXRA 5LXHA 4GDLA 1ZPSA 2PVGC 3M62B 5C1ZA 2GBRA 4KIKB 4MSQB 1TY0A 2KZRA 1YN3A 2LGDA 4N58A 1P0RA 2KXJA 2CU3A 3AI5A 2GB1A 2KLGA 1H8CA 1Z2MA 1E8YA 1GAQB 2DWQA 2V4LA 1ZP0B 2BB5A 3APCA 3DVNV 2WQYB 1WJUA 1J7BA 2A4ZA 3AH7A 1PGXA 1Z5SB 3DBRI 4FHKA 1J8CA 4BKTA 2JF5A 1ENFA 5DPTA 3KLSX 1C4AA 1P98A 3GB1A 4CO7A 4P1CC 1E8ZA 4W9DA 3A9KB 2L1AA 1SXTA 4YTNB 3IG3A 3WANA 2B76B 4KZCA 5E6OA 4GIVA 4RGOS 1FRDA 1D4BA 2WDVB 3RNBC 2AL3A 3PSEB 3ZRCA 2L00B 4B95A 3H7PB 2M17A 2NCNA 4MJSB 4N6EB 2RSUA 4PS3A 2Z0DB 3L13A 2VZKB 1WXVA 3NJTA 1NEKB 3BIID 3P4SB 1LO5D 1L7YA 2KACA 2EKIA 3P4RB 2KC2A 1STEA 3A9JB 4A55A 1EU4A 1CMXB 2JT4B 4MDKE 1TY2A 1JMLA 4AOFA 1JWMD 1WE6A 1PQSA 3IHPC 2NBVB 3WAOA 3GOEA 1RRBA 3H7SA 5CHVC 4ZRPA 3K9OB 4G11A 3VUXA 1FCLA 2JX5A 3MC0B 1UZXB 3VTWA 5IOIA 4M0WA 1R4NI 1I4QA 3BVGA 1YIWA 2LRUA 3NVZA 3TEWA 1R4MB 3NY5A 4L1BA 2LEKA 4C00A 3TL5A 3BK1A 1QOAA 1HXYD 2YVCA 1L0XB 2LZ6A 5H92C 3PV1A 5L95C 3BYTB 1KLUD 3X0WA 1ISNA 1MHXA 1Q0WB 3AE5B 3IFWB 1L6UA 2KN4A 4RGNA 2WXIA 1EF1A 3JW0X 1C3TA 4OZAA 1NI3A 1JWUD 3DHGC 1B9RA 3ZRFA 2WGSA 4OW0A 2KHWB 1YJIA 1DOYA 4RF1A 1HTQA 3PRPB 3B1LX 2IJ0A 4TMAB 4CHKA 2FCQA 2Z59B 4WJQA 4ZRKA 1K50A 4HK2A 4GGQA 1FEHA 1Y8RC 3JSVB 1JWBD 1NYQA 1RAXA 2K5PA 3GS2A 2WU2B 3MTNB 5AUKA 4WWPA 2K8CA 4Q2JA 4GSWA 3SEBA 1TZOA 4OVUA 2LVQA 4PYZA 4KVGB 2K6QA 3TEYA 4NQLB 1HE8A 3Q14C 3CIRB 5D94A 2Y5CA 4JGHB 3QARA 2AQ1B 3OWEB 4MH0E 4GDKB 2BTEA 3TEXA 3QJZA 2KTRB 3U2SC 3DHIC 1ESFA 2FBWB 2BYEA 1UBQA 2C5LC 1YD8U 4HDQA 4K3BA 2MEKA 1NI2A 1V5OA 3MC9A 4W9CA 1WZ0A 1F52A 3TSSA 1QQRA 2LASA 4CYEA 2XN9C 2WXLA 3ML9A 2LGIA 3RD2A 4I6PA 1EO6A 3NVYA 3VRAB 4CQNA 2DYOA 3WA0A 3L10B 3UI3A 3H9DA 4GN1A 4NZLB 3BWUD 2WXJA 4FADA 2KQ7A 2KDEB 1PYWD 1VJKA 3DVNU 2HJ1A 4HLEA 1E7PB 3AE4B 5BYSA 5IA7A 1JRPA 5EDSA 4A3OA 3PHXB 3AE7B 4WQOB 3KWLA 1F77A 3Q3MC 4NJ7A 5IN7A 2Z8LA 3ZLZA 2OEDA 2L32A 2WDQB 4L2YA 4BAXA 3AM9A 4ZRIA 2NMQA 2O6VA 1V2YA 4FULA 1WFYA 2IY1B 3JYUA 1IYFA 3KYCD 4UDUC 3QC8B 3VH3B 1L2NA 1HZ6A 2EMTA 1IUEA 3GP7A 3SFEB 3WALA 4IWOA 3V61A 3JVZX 1VD2A 2KT7A
chains in the Genus database with same CATH topology
4YSXB 3TUOA 2W82A 3HUIA 4WAFA 1FFUA 1FMAD 3MJ5A 5TSSA 4C7YA 2J52A 2SEBD 1FNWA 2WXNA 2J53A 4HJGE 4WWMA 1NENB 1FIQA 2KMMA 1TS3A 1N62A 2JU6X 3AEAB 3NVVA 1L4DB 2WXPA 1L0YB 1AW7A 1KF6B 2WS3B 4RF0A 4IOIE 1VRAB 1TS5A 3AEBB 3R8BA 1SE3A 4WH4A 4WQMA 2J42A 1YNTE 1RFKA 4RFBA 2W54A 2WU5B 5FK9C 4DXGA 1P7EA 1SEBD 1KTKA 1KLGD 1GB1A 3EA6A 1SJED 1YN5A 1XEEA 2LHDA 2IGHA 3AEFB 2G1EA 1PUTA 1OFFA 2JYTA 4OVZA 1TKGA 1FNUA 1I4PA 2BS2B 4KKJA 1YQ3B 1YQ4B 3R2TA 1QF6A 1WXQA 2RDGA 4YTPB 2LUMA 5MPOA 4DQOC 2I38A 5GXGB 4H2AA 4EE2A 2V3PA 1YJJA 2YEPB 2JQRB 1Y56A 4TQ0A 1FXAA 3PZ7A 1L6VA 4ZHPA 1P7FA 2K22A 1VR9A 3BZDB 3Q69A 1I4XA 2KQ4X 3EUB2 3CWIA 1Q10A 4ZYSA 2WXMA 3BK2A 1C4CA 2K3UA 3EGRA 2M56B 3FAHA 2M0AA 2WXOA 4XE0A 1VZ8A 2TSSA 2WXKA 3AECB 4MM3B 2WXGA 2G9HD 1L4ZB 2KWDA 5G5HA 1PGAA 4GLSC 1WYGA 1TS2A 2MJEA 3IT6B 1N60A 4JPSA 1XLPA 2KAJA 1UWXA 1ZXIA 4J3OD 3WCQA 1CK1A 3V05A 1UWMA 1QILA 1TYGB 3ZQ4A 2E3TA 2RDHA 1HZ5A 2AX5A 1I4HA 2WNMA 5EE9A 1XXGA 2DBYA 1C77A 3IXSA 3SFDB 3AEDB 1FCCC 1NYRA 1V97A 4ZRQA 3AE6B 1VLBA 3AE3B 4ZHOA 3O13A 3MHZA 1E6EB 1WRIA 3HVDA 2M19A 1I4RA 4TSSA 3PO0A 1ET9A 3ABVB 3C8YA 3Q8FA 5LNK1 1IBXA 2WXRA 2PKOA 4KGSA 3BYYB 4L23A 1GOZA 1F2RI 1ZPSA 4XWTA 2PVGC 1L0VB 2X38A 1ZXHA 1TY0A 2N9KA 3AE2B 1YN3A 2W3RA 4B0EA 4AQ7A 1ZUD2 4N58A 1MVKA 1YN4A 2CU3A 1E9MA 1HQRD 2GB1A 5AUIA 1GAQB 2DWQA 1ZP0B 2BB5A 2WQYB 3BVZA 2RPVA 1D5XC 1J7BA 3AH7A 4C80A 1TKEA 1GB4A 5BMGA 1V8CA 2K9XA 1PGXA 1T6BX 2BBCA 3U52E 2JXTA 2LHEA 3B9JA 2K0PA 3DWMA 1ENFA 2CJOA 2QJLA 3KLSX 1R7SA 4D2KA 4MT5A 1PDXA 1C4AA 3GB1A 4AS1A 1K51A 4LLGM 1JW9D 3PZ8A 3ZYYX 4KGRA 2BW2A 2H88B 1NVID 3FILA 2L1AA 1QT9A 4NAWB 1YMHE 4WURA 4A6QA 1JCKB 1SXTA 2WXFA 4YTNB 1DOIA 1N5WA 1SSNA 2B76B 3AEGB 3NZ3A 2HDEA 1ET6A 2R61A 3FILB 4HKQA 1DGJA 4RGOS 1FRDA 5C2TB 2SAKA 5HHDG 2WDVB 1D4BA 2WXHA 2INNE 3P1MA 2BB6A 4C7ZA 4P6VF 1BUIC 4REZA 2Y5PA 1C4PA 1E0ZA 1MHHE 2ICIA 4N6EB 4XDCA 1KH0A 3TEZA 2NTSA 1WGKA 2PIAA 2I2YA 2PMVA 4YTMB 1V1OA 2QIEB 3SR6A 2VZKB 4US8A 1BMLC 1QOGA 2ON8A 1NEKB 4JX1C 5D3IB 2L52A 3BIID 3P4SB 1LO5D 1FD6A 3BVMA 4YSYB 3Q8CA 2ZW0A 4JWUC 2KACA 2EKIA 2GI9A 3P4RB 1STEA 2PW9A 1D6EC 4A55A 3J9CA 1SBBB 4P16A 1OQRA 4ITKA 1SF0A 4HKZE 4RGTA 3AE8B 1EU4A 2OHFA 1IGDA 1E10A 1TS4A 1XLOA 1RWSA 1TY2A 1JMLA 3I57A 1JWMD 2E6XA 1J7AA 3B2GA 2IGGA 1WWTA 4ZOHC 5HFYA 3Q8BA 1IGCA 2WXQA 4RH6A 5I4DA 4ZRPA 4A90A 3VR8B 2NTTA 2MH7A 1KRHA 3I9V1 2BS4B 2Y3AA 4XWWA 1SE2A 2V3NA 5HI1A 3L4PA 4WIPA 1FCLA 2JX5A 1ZE3D 3IT4B 3MC0B 1B1ZA 2KDMA 4M0WA 3ZJUA 1JWSD 1I4QA 3AV8A 3BVGA 4PT5A 1FO4A 1ZDVA 1I7HA 3HRDD 3NVWA 2IPKD 3NVZA 3TEWA 3E56A 3LB8C 3FC4A 3W1SA 4L1BA 2LEKA 3P42A 3NS1A 5G5GA 2MJDA 1QOAA 3BK1A 3NUHB 1IBXB 3NRZA 1HXYD 2LJIA 2QEJC 1AN8A 3VQIA 4GDLB 1F0ZA 1L0XB 5H92C 4XDDA 1N61A 2WDRB 2LMCA 4US9A 4KGTA 2JSVX 5EE0A 2DLBA 2ZW1A 1CQVA 2L83A 1TJEA 4TQ1A 4LTUA 3BYTB 1D5ZC 1KLUD 1SJHD 1MHXA 4KX6B 1FM0D 3AE5B 1I4GA 2VZKD 1L6UA 2KN4A 4NJCA 4NAMA 4R3DA 4RGNA 3W2DA 2WXIA 2JYEA 5EE3A 2QSDA 5E6JA 4OZAA 1NI3A 1WSPA 1T5XD 1XCQL 1JWUD 2H89B 3AB5A 1TKYA 1XLNA 1UNSA 1MPEA 1B9RA 5BMHA 1CJEA 4OW0A 5D7GA 1T3QA 1YJIA 1FNVA 2IDYA 4HRSA 1DOYA 1DYQA 2JWUA 2DYMA 2D5GA 4RF1A 1EWCA 2IJ0A 1A70A 3B2FA 3VR9B 4TMAB 1V1PA 2PTLA 3E9SA 2J4XA 4HROA 1K50A 2W3SA 5BMIA 2JZPA 1GPXA 2PVOD 1FEHA 3V3XA 4YXDB 2GRIA 1JWBD 3KWVA 1NYQA 1RM6C 2K5PA 1V1PB 3GS2A 2WU2B 5AUKA 4KKIA 1N63A 4MACA 2BYTA 1JQ4A 1F2RC 4C56C 3LXFA 1HEZE 1BXTA 4A8XC 4Q2JA 3ZJVA 3SEBA 1JWAD 1TZOA 4O1NA 4MH8A 3TEYA 4RCOA 3CIRB 1DOXA 2Y5CA 1M4VA 2N0SB 5HG2A 2V0GA 1N5XA 3AE9B 2AQ1B 1EM7A 5D3DA 2AQ2B 1SB3C 3OWEB 3W5UB 2XNAC 2Q5WD 1C9FA 4GDKB 1EU3A 2FUG1 2BTEA 2ONQA 3TEXA 4DXFA 3T3OA 1K52A 3MP9A 3Q8EA 2AQ3B 2RMMA 3N9YC 3U2SC 3W9CB 1ESFA 1K53A 1MI0A 1ZOYB 5BYQA 2V4IB 2FBWB 1ROEA 1QLBB 3H8HA 1D5MC 3IAM1 2MEKA 2LFIA 2PLPA 2BT6A 4IDIA 5JXVA 4OHJA 3P63A 4YSZB 1KFYB 3P4PB 1C76A 4JE3B 3TSSA 3T3NA 2WLBA 1QQRA 1JROA 1VDVA 3R2IA 4N59A 3AN1A 1UGJA 3URYA 2XN9C 3KQ4A 1ACCA 4RGMA 3W5VB 1AYFA 2WXLA 1PFDA 1CZPA 3MFGA 2IGDA 4FXCA 1XF5L 1QOFA 3LYYA 4A9AA 3U7ZA 1J7CA 2LGIA 4HEA1 3NVYA 5BYRA 3VRAB 2N7JA 1C78A 2DYOA 4CQNA 3UI3A 1FFVA 1OQQA 4NZLB 3BWUD 2WXJA 1FRRA 3Q8AA 4USAA 2QILA 1XCTL 1SIJA 1PYWD 1VJKA 1L5PA 1E7PB 2YEPF 3AE4B 1QKZA 5BYSA 1JRPA 1QOBA 1XO3A 4OZBA 5FKAC 1VZ7A 2FE8A 3U4EG 5EE1A 1UUPA 1AWDA 4YT0B 1EWYC 3ETRA 3IAS1 1VZ6A 3AE7B 2ACZB 3AEEB 3KWLA 1F77A 4IKGA 5T8IA 3P4QB 2Z8LA 3AMZA 4RNAA 1FXIA 2EELA 5H8YE 2OEDA 3ZJTA 2W55A 1PGBA 2L32A 2WDQB 4L2YA 4B0MA 2INPE 3AM9A 2CJNA 4JWSC 1SE4A 2NMQA 4OZCA 1ZDXA 3RPFC 1C79A 2N9LA 4LK0M 5FR3A 4UDUC 2BS3B 1HA5A 3ZGZA 5C3JB 4ARCA 3DWGC 1HZ6A 3AE1B 1IUEA 2QMTA 3VRBB 4ARIA 1XLQA 2WP9B 3GP7A 3SFEB 2HTME 3HVZA 2MJ3A 1RYJA 4YWGG 1JALA 3RFZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1C9F A;  2IGG A;  1ZXH A;  2J52 A;  2ONQ A;  5HFY A;  1K52 A;  2J53 A;  1IGC A;  2N9K A;  3MP9 A;  4HJG E;  2RMM A;  2JU6 X;  1K53 A;  1MI0 A;  1MVK A;  2GB1 A;  2PLP A;  5HI1 A;  4IOI E;  1FCL A;  2RPV A;  5JXV A;  2KDM A;  4WH4 A;  1YNT E;  1GB4 A;  5BMG A;  1P7E A;  1PGX A;  1GB1 A;  2JXT A;  2LHE A;  2K0P A;  2LHD A;  1IBX B;  2IGH A;  2IGD A;  1XF5 L;  2LGI A;  4D2K A;  3GB1 A;  2JSV X;  4KGT A;  2N7J A;  2ZW1 A;  1K51 A;  3UI3 A;  4KGR A;  2LUM A;  3FIL A;  1YMH E;  2I38 A;  1XCT L;  1MHX A;  2KN4 A;  1QKZ A;  2QSD A;  4OZA A;  1XCQ L;  4OZB A;  1P7F A;  2KQ4 X;  3FIL B;  1MPE A;  5BMH A;  1Q10 A;  5HHD G;  1D4B A;  2JWU A;  4IKG A;  2KWD A;  1PGA A;  4GLS C;  2PTL A;  2EEL A;  2OED A;  1MHH E;  1PGB A;  1UWX A;  1KH0 A;  1K50 A;  2NMQ A;  2JZP A;  5BMI A;  2I2Y A;  3V3X A;  1HZ5 A;  4OZC A;  2N9L A;  2ON8 A;  4MAC A;  1FCC C;  1FD6 A;  1F2R C;  2ZW0 A;  1JML A;  1HEZ E;  2KAC A;  2GI9 A;  1HZ6 A;  2PW9 A;  2QMT A;  4HKZ E;  1IBX A;  5HG2 A;  4KGS A;  1IGD A;  1F2R I;  1EM7 A; 
#chains in the Genus database with same CATH topology
 4YSX B;  2KFK A;  2W82 A;  3ZTC A;  2OJW A;  1FFU A;  5TSS A;  2J52 A;  1FNW A;  4WWM A;  2WX1 A;  2KOX A;  1FIQ A;  2JU6 X;  1N62 A;  4NPN A;  3VTU A;  4I6L B;  2BKF A;  1AW7 A;  3FKY A;  3ZIM A;  4RF0 A;  1WGD A;  1YNT E;  5JHA A;  4RFB A;  4PYU A;  5FK9 C;  1P7E A;  4II3 B;  3U30 A;  4BOS C;  2IO3 B;  1SEB D;  1KTK A;  4G3X B;  3HK0 A;  2QCZ A;  1E7V A;  3ZXV A;  3QX1 A;  2K39 A;  3AEF B;  1OFF A;  1TKG A;  2BS2 B;  4E74 A;  3Q3F A;  1E8W A;  3R2T A;  4F7Z A;  4YTP B;  2LUM A;  1WXA A;  5GXG B;  4EE2 A;  1YJJ A;  2YEP B;  2JQR B;  1RFA A;  2WX0 A;  1L6V A;  1VR9 A;  2AL6 A;  2N7D A;  1I4X A;  1TBE A;  2KVR A;  1Q10 A;  5C23 A;  3RYT A;  2K3U A;  3EGR A;  3WIM A;  2PEA A;  3FAH A;  1A5R A;  4LNI A;  4MM3 B;  2WXG A;  1L4Z B;  1PGA A;  2C9W B;  3LDZ E;  2MJE A;  3IT6 B;  3L17 A;  2KAJ A;  3WCQ A;  4ASW C;  4II2 B;  1UWM A;  2E3T A;  1HZ5 A;  4IWQ A;  1IP9 A;  2NR2 A;  3NOB A;  3AED B;  1FCC C;  3X23 A;  4ZHO A;  2MCN B;  3DBH I;  3MJW A;  3PT2 B;  3N3K B;  4ANU A;  1ET9 A;  1IBX A;  3C8Y A;  2VRR B;  2X38 A;  2C7M B;  4HDO A;  4DXA B;  2REX A;  2MHJ A;  2XK5 B;  2D3B A;  2OJR A;  1D5X C;  3QIJ A;  2KQS A;  4C80 A;  1GB4 A;  2FIF A;  3UQB A;  1T6B X;  2IY0 B;  3U52 E;  3KUC B;  3ONS A;  2LHE A;  3B9J A;  4G0N B;  2CJO A;  4NAW A;  2L3Z A;  2ZEQ A;  5TR5 A;  1SIF A;  3EFC A;  3OJ4 B;  3B0A A;  4BZA A;  4LLG M;  3R7R A;  4KGR A;  2H88 B;  1NVI D;  1QT9 A;  3Q3O C;  1YMH E;  1JCK B;  1DOI A;  5CHW A;  4LDT B;  3TCA A;  3SU8 X;  4MGY E;  1DGJ A;  4IC7 B;  4WAA A;  5C2T B;  2SAK A;  2BB6 A;  4C7Z A;  4ICU A;  4P6V F;  1BUI C;  4REZ A;  2ICI A;  4XDC A;  3IBE A;  1WGK A;  2PIA A;  3KVF B;  2KO3 A;  4YTM B;  2O2V A;  1QOG A;  3GE8 C;  2L52 A;  4JIO U;  5D3I B;  1FD6 A;  3R66 C;  2B3A A;  3RN9 C;  2LGS A;  1D6E C;  4LNF A;  4P16 A;  5KHQ A;  4RM9 A;  1XLO A;  1RWS A;  3GZN B;  3I57 A;  1J7A A;  1WX8 A;  3H6N A;  1WWT A;  3RZW C;  5IAA C;  3Q8B A;  2WXQ A;  4LJP B;  3VR8 B;  3I9V 1;  2Y3A A;  2V3N A;  5BO4 B;  5HI1 A;  3L4P A;  3DBL I;  2MQJ A;  3IT4 B;  2HE7 A;  2JZ3 B;  1B1Z A;  2L76 A;  2C7N B;  2ZNV B;  1V6E A;  1V5T A;  4ZDV A;  1UH6 A;  2GBJ A;  3UGB B;  1P1A A;  2KAN A;  2LWP A;  1FO4 A;  3NVW A;  4DHJ B;  2IPK D;  2MSE D;  3RNE C;  2NBW B;  3FC4 A;  2MJD A;  4M0W B;  3NRZ A;  1F0Z A;  1AN8 A;  2GOW A;  4XDD A;  1WJ4 A;  2WDR B;  4KGT A;  2KK8 A;  2DLB A;  3RT3 B;  1LQB A;  2D2Q A;  1D5Z C;  4I6N B;  5FR6 A;  4NAM A;  1I4G A;  4R3D A;  2JYE A;  3PRZ A;  1T5X D;  3U8Z A;  1TKY A;  1UNS A;  1MPE A;  5BMH A;  3NZU A;  1P3Q U;  5D7G A;  1T3Q A;  1S1Q B;  2DZI A;  1FNV A;  2IDY A;  2KWC A;  4HRS A;  2DYM A;  3QAQ A;  3B2F A;  1QZE A;  5LXI B;  2PTL A;  2KX3 A;  4JL9 A;  4FBJ B;  3AU4 A;  3E9S A;  4XZ4 A;  2JZP A;  2LI5 A;  4DHZ B;  4YXD B;  2N9P C;  3KWV A;  2PE6 B;  4F8C B;  1RM6 C;  1WYW B;  4KKI A;  2L0T A;  2KFJ A;  4W9J A;  4PK1 A;  4C56 C;  2CR5 A;  1WRD B;  1HEZ E;  1BXT A;  4A8X C;  2IO1 B;  3A33 B;  3V60 A;  4MH8 A;  1KM7 A;  4LCD E;  2ZZP B;  2N0S B;  3NHE B;  3M95 A;  2V0G A;  1N5X A;  2UU7 A;  2XNA C;  4HCP B;  1YJ1 A;  3T3O A;  3TIX A;  4DXF A;  1K52 A;  3Q8E A;  2AQ3 B;  1RLF A;  2RMM A;  3DHH C;  1UBI A;  2D3G A;  3BY4 B;  2WWZ A;  4KZ0 A;  3RZF A;  1QLB B;  3H8H A;  3IAM 1;  4IDI A;  4WWN A;  5JXV A;  2D11 A;  1TZ1 A;  3ML8 A;  1WX7 A;  2WLB A;  4MGK E;  1TT5 B;  2DZJ A;  3DBS A;  1ACC A;  4FXC A;  2BYF A;  2KMA A;  1U4A A;  4A9A A;  3LYY A;  4AUQ C;  3U7Z A;  5BYR A;  2G4D B;  3M3J A;  2KDB A;  1ZW7 A;  1L5P A;  2NPT A;  3UIP B;  2MP2 B;  1OEY J;  2GLS A;  1XO3 A;  4IM3 A;  2NS5 A;  4GXB A;  2ACZ B;  3D32 A;  4KIK A;  3UIN B;  4AJY B;  4NQK E;  2V9H A;  3P4Q B;  3ZUN A;  1OTR B;  2W55 A;  1PGB A;  3VH4 B;  4B0M A;  2M4N A;  2CJN A;  4S0R A;  1ZDX A;  1C79 A;  5FR3 A;  2I1J A;  2D3C A;  1UEL A;  1WGY A;  1HA5 A;  2O6V B;  2ZVN A;  4HPL B;  1JRU A;  2KD0 A;  4N9F 4;  1WF9 A;  1J0G A;  2QMT A;  3PHW B;  2W9N A;  3L08 A;  4LJO B;  4LNK A;  5LLI A;  2MJ3 A;  2N7E A;  2M0X A;  3HUI A;  1FMA D;  3MJ5 A;  2KLC A;  4ANX A;  5L83 A;  2WXN A;  3A9K A;  2KMM A;  4E3C A;  1T0Y A;  2WS3 B;  3QHT A;  2LD9 A;  3RUI B;  1UGM A;  3EFU A;  4IWP A;  1VRA B;  4FJY A;  1TS5 A;  3R8B A;  1SE3 A;  2KDI A;  2BQQ A;  2J42 A;  1RFK A;  2L05 A;  4ANV A;  4P7I A;  3A1Q A;  1NBF C;  2HJ8 A;  3BIN A;  1WH3 A;  1XEE A;  2LHD A;  1E5W A;  2ZJD A;  4C4V A;  1WXS A;  1PUT A;  4FJV B;  4OVZ A;  4DK5 A;  3O65 B;  2N9E B;  1LXD A;  1YQ4 B;  3S2A A;  1T0S C;  3VVW B;  1YOV B;  1Q1O A;  4BKG A;  4H2A A;  2V3P A;  1AAR A;  1WX9 A;  3N1Y C;  2G3Q B;  1V49 A;  1FXA A;  2D10 A;  2N4F A;  1WXM A;  4ZHP A;  3ZXR A;  3Q69 A;  2KQ4 X;  3EUB 2;  1GNU A;  3Q3N C;  3BK2 A;  3PRE A;  2DZK A;  2MX2 A;  4KDL B;  2M56 B;  3LJ3 A;  5KHO A;  3N30 A;  2FCM A;  1OEY A;  2KYW A;  1VZ8 A;  2LJ5 A;  2WXK A;  2KKC A;  4XE0 A;  2G9H D;  4IM2 A;  1KJT A;  4GLS C;  5AEK B;  4FLH A;  1SE9 A;  1LM8 B;  1XLP A;  1UWX A;  2J7Q B;  2QC8 A;  4J3O D;  4GMV A;  1QIL A;  1MG8 A;  1TYG B;  2RDH A;  2AX5 A;  4P1B C;  1I4H A;  3QCA A;  4DDI D;  2DBY A;  1C77 A;  3TJP A;  3SFD B;  1NYR A;  4ZRQ A;  3AE6 B;  1WR1 A;  1VLB A;  2ZPY A;  3VAW A;  3O13 A;  4J6I A;  3MHZ A;  2HD5 B;  1WJN A;  2VH2 A;  4LDT D;  5E6P A;  3RUL A;  2PKO A;  2IBI B;  3BYY B;  4XX5 A;  4L23 A;  4XWT A;  1F2R I;  3RNA C;  5DPS A;  3OLM D;  4IUM B;  3M63 B;  2N9K A;  3AE2 B;  3H1U A;  4NY0 A;  1ZUD 2;  4W9I A;  1WR6 E;  2XBB C;  1HQR D;  3VUW A;  3EEC A;  3BVZ A;  3I5J C;  2LUE A;  2J0K A;  1TKE A;  5BMG A;  1V8C A;  5JZE B;  2K9X A;  4B9K A;  1D3Z A;  3RMK C;  2JXT A;  2RPQ A;  2R2Q A;  2JWZ A;  2HTH A;  2NBU A;  1R7S A;  4D2K A;  4MT5 A;  1PDX A;  1K51 A;  4W9E A;  2BW2 A;  1WMH B;  3FIL A;  2MWS B;  4WUR A;  4NAW B;  2KNB A;  2K8H A;  3V62 A;  2WXF A;  4AWJ A;  3RFZ B;  2GMI C;  4FN2 A;  3NZ3 A;  5J17 A;  2LRW A;  2IZV B;  3CSF A;  2R61 A;  3N1X C;  4HKQ A;  1V81 A;  2L0F A;  5JH5 C;  3UQA A;  5HHD G;  4W9K A;  2WXH A;  1X1M A;  2KTR A;  1E0Z A;  1MHH E;  3IVF A;  1KH0 A;  2NTS A;  2I2Y A;  2PMV A;  1P9D U;  2N9X A;  2QIE B;  4B6W A;  4US8 A;  1BML C;  2MBE A;  4QAY A;  4M8M A;  4JWU C;  2O2V B;  2GI9 A;  2PW9 A;  4PS8 A;  2R2O A;  3J9C A;  4ITK A;  1ZGU B;  1SF0 A;  4HKZ E;  3RI7 C;  3AE8 B;  1WI0 A;  2OHF A;  3HM6 X;  3T9L A;  1TS4 A;  2E6X A;  1NDD A;  3QK0 A;  4ZOH C;  2FNJ B;  5HFY A;  4A20 A;  3PZD A;  3HM3 A;  1GUA B;  4RH6 A;  5I4D A;  4URK A;  3RCZ A;  2MH7 A;  1KRH A;  3ECI A;  1SE2 A;  4WIP A;  3A4R A;  1J19 A;  2YLM A;  2ZPN A;  3TBL D;  2KDM A;  2DEN B;  2X8X X;  1ZDV A;  3AU5 A;  1I7H A;  3HRD D;  3W1S A;  3Q2A C;  2GBM A;  3P42 A;  5G2N A;  3NUH B;  5E6N A;  2GBN A;  3KYD D;  2BVC A;  4GDL B;  3DBH B;  2KWU B;  5JHB A;  4M02 A;  2KJR A;  2MBB B;  2L83 A;  1TJE A;  3I3T B;  4TQ1 A;  4LTU A;  1WY8 A;  1SJH D;  4EFO A;  1FM0 D;  2VZK D;  2WHI A;  2QSD A;  5E6J A;  4BFR A;  1LFD A;  5J2R A;  3AB5 A;  4M00 A;  3PPA A;  1XLN A;  2ZCB A;  3K9P B;  1CJE A;  4EKU A;  2BPS A;  1V86 A;  2KMC A;  5CX3 A;  2CS4 A;  3SHQ A;  2D5G A;  1WGH A;  2LVP A;  2JPH A;  3ALB A;  3VR9 B;  1V1P A;  4WJN A;  1HTO A;  1F1H A;  2J4X A;  1MFW A;  2QDF A;  4HRO A;  3AXC A;  1V80 A;  1GPX A;  2GRI A;  1E7U A;  3W1S C;  4TKN A;  4MAC A;  1N63 A;  2BYT A;  1JQ4 A;  1F2R C;  2J0M A;  1JWA D;  3UF8 A;  4O1N A;  3ENE A;  1I42 A;  4RCO A;  3DVG Y;  4EOY A;  1M4V A;  2AEH A;  5HG2 A;  2UWQ A;  3AE9 B;  2AQ2 B;  2D07 B;  1XT9 B;  3Q6B A;  2JZZ A;  2Q5W D;  1C9F A;  2FUG 1;  3VFK A;  2ONQ A;  4G50 A;  1G6J A;  3MP9 A;  2V1Y A;  1MI0 A;  4TUU A;  2KVZ A;  4ANW A;  1V9J A;  4DBG A;  2PLP A;  2BWE S;  3P63 A;  2MA9 B;  4YSZ B;  2LGX A;  1KFY B;  5DPR A;  2OOB B;  2CKH B;  1JRO A;  1VDV A;  3R2I A;  1UGJ A;  4MM3 A;  3KQ4 A;  4RGM A;  3RNF C;  1FPY A;  1CZP A;  1MJD A;  2JXX A;  4IW0 A;  4EZL A;  1J7C A;  4E71 A;  1C1Y B;  2N7J A;  4X57 B;  3L0W B;  2PE9 A;  2FID A;  3DVG X;  1FRR A;  3Q8A A;  2QIL A;  1XCT L;  1EUV B;  2DZM A;  2AYO B;  1QOB A;  2LXC A;  5FKA C;  4GB9 A;  1I35 A;  4S17 A;  5EE1 A;  1UUP A;  1EWY C;  3ETR A;  5D6J B;  4BKS D;  4GU2 A;  3PLU A;  3APF A;  2JY6 A;  4IM0 A;  4IKG A;  4RNA A;  1FXI A;  5H8Y E;  2XK5 A;  3ZJT A;  4HJK A;  2K1F A;  2INP E;  4K7W A;  4JWS C;  1SE4 A;  4JQW C;  5GMV A;  2N9L A;  2DAF A;  4LNO A;  3UIO B;  2JRH A;  3ZGZ A;  5C3J B;  2EKE C;  4K7U A;  2WYQ A;  3VRB B;  4ARI A;  1XLQ A;  3WAM A;  3KUD B;  3DBR B;  1RYJ A;  4PS7 A;  4YWG G;  1JAL A;  2KC1 A;  3MC8 A;  3QWZ B;  4WAF A;  4DWF A;  3T8M A;  4HJG E;  2MBH A;  1TS3 A;  1L4D B;  2BWF A;  4IOI E;  3AEB B;  2PJH A;  2IO2 B;  4WH4 A;  4WQM A;  4OVV A;  1T0Q C;  2W54 A;  4DXG A;  2M8S A;  1KLG D;  4MEM A;  1GB1 A;  3EA6 A;  2MBQ A;  1SJE D;  1YN5 A;  5CTR C;  2J0J A;  2IGH A;  4A3P A;  2G1E A;  2RR9 A;  1FNU A;  1I4P A;  3HHM A;  3A1Q B;  4KKJ A;  4GOC A;  3ZNG C;  2KX0 A;  3C0R B;  1WXQ A;  2QHO A;  3RNC C;  2ZVO A;  4C4V B;  5MPO A;  2I38 A;  5HKH A;  4EEW A;  1Y56 A;  4EZJ A;  3VHT C;  2UYZ B;  4FJZ A;  3PZ7 A;  4TQ0 A;  1WZ3 A;  4W9L A;  4RMA A;  1VCB A;  3N1Z C;  3APD A;  3ZO5 B;  1FXT B;  4HPM B;  2M0A A;  2FUH B;  2RGF A;  1GJZ A;  2KWD A;  3NG0 A;  1TS2 A;  1N60 A;  2IND C;  3KH0 A;  4KSK C;  5D2M B;  3V05 A;  5CHF A;  3ZQ4 A;  2BYV E;  2DHZ A;  1R4M I;  3IXS A;  1N6Z A;  3RNG C;  4WJP A;  4BBN C;  3ZTD A;  3AE3 B;  2C7H A;  1E6E B;  2M19 A;  4MGZ E;  4FA6 A;  1I4R A;  4TSS A;  3PO0 A;  1R4N B;  3ABV B;  3Q8F A;  5LNK 1;  4KGS A;  2V3S A;  1GOZ A;  1L0V B;  2IO0 B;  1ZXH A;  1SGH A;  2JRI B;  1IPG A;  2W3R A;  4B0E A;  4AQ7 A;  1MVK A;  4ZYN A;  3DDC B;  1YN4 A;  1E9M A;  1UF0 A;  2C60 A;  1ZKH A;  5AUI A;  3DPD A;  2DX5 B;  2RPV A;  4W9F A;  1TTN A;  1S3S G;  2BBC A;  3KW5 B;  2K0P A;  3DWM A;  4K1R B;  2ZNV C;  3U7D A;  2KWV B;  2QJL A;  4AS1 A;  2KFK B;  1JW9 D;  1XQQ A;  3PZ8 A;  3ZYY X;  4RM8 A;  2FAZ A;  3B08 A;  4A6Q A;  1N5W A;  1SSN A;  4F1S A;  3AEG B;  2HDE A;  1XD3 B;  3R7Q A;  1ET6 A;  3FIL B;  3PTF C;  3H7P A;  4MJS A;  2INN E;  3P1M A;  4KV2 A;  3ZDT A;  2CU1 A;  2PPH A;  2Y5P A;  1KLV A;  2DYB A;  3CF6 E;  1C4P A;  5IKC M;  3TEZ A;  2KJH B;  1V1O A;  3A9J A;  2KN5 A;  3SR6 A;  4BVU C;  2ON8 A;  4JX1 C;  4TV3 A;  3BVM A;  4YSY B;  3Q8C A;  2ZW0 A;  3ZKJ C;  2WDT B;  1GC6 A;  1SBB B;  1OQR A;  4RGT A;  5J18 A;  2KDF B;  1TGZ B;  4KSL C;  1IGD A;  1E10 A;  2RDB C;  2AWT A;  4WWO A;  1WGR A;  3B2G A;  2IGG A;  2ZCC A;  1IGC A;  4A90 A;  2NTT A;  4HCN B;  3L16 A;  2BS4 B;  2MP2 A;  4XWW A;  2XEW A;  5DCN A;  5DPW A;  1ZE3 D;  3DCG A;  1TIF A;  3ZJU A;  1JWS D;  3AV8 A;  4PT5 A;  2BGF A;  4AP4 C;  4EZK A;  3E56 A;  3NS8 A;  3LB8 C;  4LNN A;  4IG7 B;  3NS1 A;  3VTV A;  2CHX A;  5G5G A;  1IBX B;  2L8J A;  2LJI A;  2QEJ C;  3VQI A;  3V6C B;  1N61 A;  3Q3J A;  2LMC A;  2MBO A;  4US9 A;  2JSV X;  1YX6 B;  5EE0 A;  2MLB A;  2ZW1 A;  1CQV A;  2BF8 B;  1GG3 A;  2KJ6 A;  4KX6 B;  3EHV A;  4NJC A;  2JUO A;  3W2D A;  3VXW A;  5EE3 A;  4WJO A;  1WSP A;  1XCQ L;  2H89 B;  1WM3 A;  3PRM B;  4HVB A;  4HWI B;  4DDG D;  2KTF A;  4ZRJ A;  3QQ8 B;  1DYQ A;  3CMM B;  2JWU A;  3DQV A;  3JSV A;  1EWC A;  4MEL A;  1A70 A;  4JLC A;  1GC7 A;  3PS6 A;  2W3S A;  5BMI A;  2A5U A;  2PVO D;  3N20 C;  3V3X A;  4EUT A;  4BKS A;  1WIA A;  1V1P B;  3V6E B;  3LXF A;  3QA8 A;  3ZJV A;  4KDI C;  2GBK A;  2CHW A;  4GDK A;  2N1W A;  3DOW A;  4DHJ D;  1DOX A;  1OGW A;  5IO9 A;  1EM7 A;  5D3D A;  1SB3 C;  2K6D B;  3W5U B;  1EU3 A;  3ZNI D;  3VUY A;  3N9Y C;  1MG4 A;  1F9J A;  3W9C B;  1K53 A;  5BYQ A;  1ZOY B;  1WM2 A;  2V4I B;  1ROE A;  3SDL C;  1D5M C;  2K8B A;  2LFI A;  3ZVV A;  2BT6 A;  4OHJ A;  4XGA B;  3P4P B;  1C76 A;  2NVU I;  2L7R A;  4JE3 B;  3T3N A;  2DAJ A;  1UD7 A;  1EF5 A;  2BKR B;  4N59 A;  3AN1 A;  2DNF A;  3URY A;  1WE7 A;  3W5V B;  2G4S A;  1AYF A;  4FHJ A;  1PFD A;  3MFG A;  2IGD A;  1XF5 L;  2JVC A;  1QOF A;  2FCS A;  4HEA 1;  3TMP B;  1C78 A;  3PGE A;  3OJ3 A;  1FFV A;  1OQQ A;  3NZS A;  3R3M A;  4M8N A;  4USA A;  2RD0 A;  1SIJ A;  4ACF A;  3N32 A;  4K81 A;  4MGI E;  1BT0 A;  2YEP F;  1QKZ A;  3SD5 A;  4OZB A;  1VZ7 A;  2FE8 A;  3U4E G;  1AWD A;  4YT0 B;  4NJ6 A;  3AUL A;  3IAS 1;  1VZ6 A;  3PVL A;  3AEE B;  5T8I A;  3ZW3 A;  3CST A;  3AMZ A;  2LVO A;  2EEL A;  4W9H A;  1E8X A;  2EMS A;  3ZDM C;  1WJ6 A;  3ZNZ B;  4XYC A;  3VDZ A;  4OZC A;  3RPF C;  3WAP A;  3A4S C;  2M1M A;  2FCN A;  4LK0 M;  2BS3 B;  2LXA A;  1E90 A;  2LGY A;  3OG5 A;  4HXD A;  3I63 C;  1H4R A;  4ARC A;  2CHZ A;  3DWG C;  4BOZ B;  3AE1 B;  4K7S A;  2IYD B;  3EC8 A;  2WP9 B;  2HTM E;  3OAW A;  1LGR A;  3HVZ A;  2Y5B B;  3HIZ A;  3TUO A;  4NNJ B;  4C7Y A;  1M94 A;  1YX5 B;  2SEB D;  2J53 A;  1NEN B;  1WMH A;  1OQY A;  3AEA B;  3NVV A;  2WXP A;  1L0Y B;  4MSM B;  1KF6 B;  5AZH A;  3PLV A;  1YQB A;  4DHZ E;  2WU5 B;  3C19 A;  3GE3 C;  2INC C;  2MW5 A;  2Z0E B;  3P2B A;  2N1V A;  2JYT A;  5IP4 D;  5G55 A;  1YQ3 B;  1QF6 A;  2VH1 A;  2D3A A;  2RDG A;  1WGG A;  1K8R B;  2K25 A;  4DQO C;  4XC2 A;  3W1Y A;  3GZN I;  1P7F A;  2K22 A;  3MHS D;  3BZD B;  4M01 A;  2O6V D;  4K3C A;  3CWI A;  1Q5W B;  2ASQ A;  4ZYS A;  2WXM A;  1C4C A;  4YL8 A;  1KOT A;  4AJW A;  1T0R C;  4HPP A;  2WXO A;  2TSS A;  3AEC B;  5G5H A;  1WYG A;  2MRP A;  4W9G A;  4JPS A;  1ZXI A;  3ZNH B;  3L54 A;  1CK1 A;  4BBN F;  2G45 B;  5EE9 A;  2WNM A;  1XXG A;  2I1K A;  4ICV A;  3KUZ A;  1V97 A;  2NPT B;  5AZF A;  3DBL B;  1WRI A;  5AZG A;  3HVD A;  2WXR A;  5LXH A;  4GDL A;  1ZPS A;  2PVG C;  3M62 B;  5C1Z A;  2GBR A;  4KIK B;  4MSQ B;  1TY0 A;  2KZR A;  1YN3 A;  2LGD A;  4N58 A;  1P0R A;  2KXJ A;  2CU3 A;  3AI5 A;  2GB1 A;  2KLG A;  1H8C A;  1Z2M A;  1E8Y A;  1GAQ B;  2DWQ A;  2V4L A;  1ZP0 B;  2BB5 A;  3APC A;  3DVN V;  2WQY B;  1WJU A;  1J7B A;  2A4Z A;  3AH7 A;  1PGX A;  1Z5S B;  3DBR I;  4FHK A;  1J8C A;  4BKT A;  2JF5 A;  1ENF A;  5DPT A;  3KLS X;  1C4A A;  1P98 A;  3GB1 A;  4CO7 A;  4P1C C;  1E8Z A;  4W9D A;  3A9K B;  2L1A A;  1SXT A;  4YTN B;  3IG3 A;  3WAN A;  2B76 B;  4KZC A;  5E6O A;  4GIV A;  4RGO S;  1FRD A;  1D4B A;  2WDV B;  3RNB C;  2AL3 A;  3PSE B;  3ZRC A;  2L00 B;  4B95 A;  3H7P B;  2M17 A;  2NCN A;  4MJS B;  4N6E B;  2RSU A;  4PS3 A;  2Z0D B;  3L13 A;  2VZK B;  1WXV A;  3NJT A;  1NEK B;  3BII D;  3P4S B;  1LO5 D;  1L7Y A;  2KAC A;  2EKI A;  3P4R B;  2KC2 A;  1STE A;  3A9J B;  4A55 A;  1EU4 A;  1CMX B;  2JT4 B;  4MDK E;  1TY2 A;  1JML A;  4AOF A;  1JWM D;  1WE6 A;  1PQS A;  3IHP C;  2NBV B;  3WAO A;  3GOE A;  1RRB A;  3H7S A;  5CHV C;  4ZRP A;  3K9O B;  4G11 A;  3VUX A;  1FCL A;  2JX5 A;  3MC0 B;  1UZX B;  3VTW A;  5IOI A;  4M0W A;  1R4N I;  1I4Q A;  3BVG A;  1YIW A;  2LRU A;  3NVZ A;  3TEW A;  1R4M B;  3NY5 A;  4L1B A;  2LEK A;  4C00 A;  3TL5 A;  3BK1 A;  1QOA A;  1HXY D;  2YVC A;  1L0X B;  2LZ6 A;  5H92 C;  3PV1 A;  5L95 C;  3BYT B;  1KLU D;  3X0W A;  1ISN A;  1MHX A;  1Q0W B;  3AE5 B;  3IFW B;  1L6U A;  2KN4 A;  4RGN A;  2WXI A;  1EF1 A;  3JW0 X;  1C3T A;  4OZA A;  1NI3 A;  1JWU D;  3DHG C;  1B9R A;  3ZRF A;  2WGS A;  4OW0 A;  2KHW B;  1YJI A;  1DOY A;  4RF1 A;  1HTQ A;  3PRP B;  3B1L X;  2IJ0 A;  4TMA B;  4CHK A;  2FCQ A;  2Z59 B;  4WJQ A;  4ZRK A;  1K50 A;  4HK2 A;  4GGQ A;  1FEH A;  1Y8R C;  3JSV B;  1JWB D;  1NYQ A;  1RAX A;  2K5P A;  3GS2 A;  2WU2 B;  3MTN B;  5AUK A;  4WWP A;  2K8C A;  4Q2J A;  4GSW A;  3SEB A;  1TZO A;  4OVU A;  2LVQ A;  4PYZ A;  4KVG B;  2K6Q A;  3TEY A;  4NQL B;  1HE8 A;  3Q14 C;  3CIR B;  5D94 A;  2Y5C A;  4JGH B;  3QAR A;  2AQ1 B;  3OWE B;  4MH0 E;  4GDK B;  2BTE A;  3TEX A;  3QJZ A;  2KTR B;  3U2S C;  3DHI C;  1ESF A;  2FBW B;  2BYE A;  1UBQ A;  2C5L C;  1YD8 U;  4HDQ A;  4K3B A;  2MEK A;  1NI2 A;  1V5O A;  3MC9 A;  4W9C A;  1WZ0 A;  1F52 A;  3TSS A;  1QQR A;  2LAS A;  4CYE A;  2XN9 C;  2WXL A;  3ML9 A;  2LGI A;  3RD2 A;  4I6P A;  1EO6 A;  3NVY A;  3VRA B;  4CQN A;  2DYO A;  3WA0 A;  3L10 B;  3UI3 A;  3H9D A;  4GN1 A;  4NZL B;  3BWU D;  2WXJ A;  4FAD A;  2KQ7 A;  2KDE B;  1PYW D;  1VJK A;  3DVN U;  2HJ1 A;  4HLE A;  1E7P B;  3AE4 B;  5BYS A;  5IA7 A;  1JRP A;  5EDS A;  4A3O A;  3PHX B;  3AE7 B;  4WQO B;  3KWL A;  1F77 A;  3Q3M C;  4NJ7 A;  5IN7 A;  2Z8L A;  3ZLZ A;  2OED A;  2L32 A;  2WDQ B;  4L2Y A;  4BAX A;  3AM9 A;  4ZRI A;  2NMQ A;  2O6V A;  1V2Y A;  4FUL A;  1WFY A;  2IY1 B;  3JYU A;  1IYF A;  3KYC D;  4UDU C;  3QC8 B;  3VH3 B;  1L2N A;  1HZ6 A;  2EMT A;  1IUE A;  3GP7 A;  3SFE B;  3WAL A;  4IWO A;  3V61 A;  3JVZ X;  1VD2 A;  2KT7 A; 
#chains in the Genus database with same CATH homology
 4YSX B;  3TUO A;  2W82 A;  3HUI A;  4WAF A;  1FFU A;  1FMA D;  3MJ5 A;  5TSS A;  4C7Y A;  2J52 A;  2SEB D;  1FNW A;  2WXN A;  2J53 A;  4HJG E;  4WWM A;  1NEN B;  1FIQ A;  2KMM A;  1TS3 A;  1N62 A;  2JU6 X;  3AEA B;  3NVV A;  1L4D B;  2WXP A;  1L0Y B;  1AW7 A;  1KF6 B;  2WS3 B;  4RF0 A;  4IOI E;  1VRA B;  1TS5 A;  3AEB B;  3R8B A;  1SE3 A;  4WH4 A;  4WQM A;  2J42 A;  1YNT E;  1RFK A;  4RFB A;  2W54 A;  2WU5 B;  5FK9 C;  4DXG A;  1P7E A;  1SEB D;  1KTK A;  1KLG D;  1GB1 A;  3EA6 A;  1SJE D;  1YN5 A;  1XEE A;  2LHD A;  2IGH A;  3AEF B;  2G1E A;  1PUT A;  1OFF A;  2JYT A;  4OVZ A;  1TKG A;  1FNU A;  1I4P A;  2BS2 B;  4KKJ A;  1YQ3 B;  1YQ4 B;  3R2T A;  1QF6 A;  1WXQ A;  2RDG A;  4YTP B;  2LUM A;  5MPO A;  4DQO C;  2I38 A;  5GXG B;  4H2A A;  4EE2 A;  2V3P A;  1YJJ A;  2YEP B;  2JQR B;  1Y56 A;  4TQ0 A;  1FXA A;  3PZ7 A;  1L6V A;  4ZHP A;  1P7F A;  2K22 A;  1VR9 A;  3BZD B;  3Q69 A;  1I4X A;  2KQ4 X;  3EUB 2;  3CWI A;  1Q10 A;  4ZYS A;  2WXM A;  3BK2 A;  1C4C A;  2K3U A;  3EGR A;  2M56 B;  3FAH A;  2M0A A;  2WXO A;  4XE0 A;  1VZ8 A;  2TSS A;  2WXK A;  3AEC B;  4MM3 B;  2WXG A;  2G9H D;  1L4Z B;  2KWD A;  5G5H A;  1PGA A;  4GLS C;  1WYG A;  1TS2 A;  2MJE A;  3IT6 B;  1N60 A;  4JPS A;  1XLP A;  2KAJ A;  1UWX A;  1ZXI A;  4J3O D;  3WCQ A;  1CK1 A;  3V05 A;  1UWM A;  1QIL A;  1TYG B;  3ZQ4 A;  2E3T A;  2RDH A;  1HZ5 A;  2AX5 A;  1I4H A;  2WNM A;  5EE9 A;  1XXG A;  2DBY A;  1C77 A;  3IXS A;  3SFD B;  3AED B;  1FCC C;  1NYR A;  1V97 A;  4ZRQ A;  3AE6 B;  1VLB A;  3AE3 B;  4ZHO A;  3O13 A;  3MHZ A;  1E6E B;  1WRI A;  3HVD A;  2M19 A;  1I4R A;  4TSS A;  3PO0 A;  1ET9 A;  3ABV B;  3C8Y A;  3Q8F A;  5LNK 1;  1IBX A;  2WXR A;  2PKO A;  4KGS A;  3BYY B;  4L23 A;  1GOZ A;  1F2R I;  1ZPS A;  4XWT A;  2PVG C;  1L0V B;  2X38 A;  1ZXH A;  1TY0 A;  2N9K A;  3AE2 B;  1YN3 A;  2W3R A;  4B0E A;  4AQ7 A;  1ZUD 2;  4N58 A;  1MVK A;  1YN4 A;  2CU3 A;  1E9M A;  1HQR D;  2GB1 A;  5AUI A;  1GAQ B;  2DWQ A;  1ZP0 B;  2BB5 A;  2WQY B;  3BVZ A;  2RPV A;  1D5X C;  1J7B A;  3AH7 A;  4C80 A;  1TKE A;  1GB4 A;  5BMG A;  1V8C A;  2K9X A;  1PGX A;  1T6B X;  2BBC A;  3U52 E;  2JXT A;  2LHE A;  3B9J A;  2K0P A;  3DWM A;  1ENF A;  2CJO A;  2QJL A;  3KLS X;  1R7S A;  4D2K A;  4MT5 A;  1PDX A;  1C4A A;  3GB1 A;  4AS1 A;  1K51 A;  4LLG M;  1JW9 D;  3PZ8 A;  3ZYY X;  4KGR A;  2BW2 A;  2H88 B;  1NVI D;  3FIL A;  2L1A A;  1QT9 A;  4NAW B;  1YMH E;  4WUR A;  4A6Q A;  1JCK B;  1SXT A;  2WXF A;  4YTN B;  1DOI A;  1N5W A;  1SSN A;  2B76 B;  3AEG B;  3NZ3 A;  2HDE A;  1ET6 A;  2R61 A;  3FIL B;  4HKQ A;  1DGJ A;  4RGO S;  1FRD A;  5C2T B;  2SAK A;  5HHD G;  2WDV B;  1D4B A;  2WXH A;  2INN E;  3P1M A;  2BB6 A;  4C7Z A;  4P6V F;  1BUI C;  4REZ A;  2Y5P A;  1C4P A;  1E0Z A;  1MHH E;  2ICI A;  4N6E B;  4XDC A;  1KH0 A;  3TEZ A;  2NTS A;  1WGK A;  2PIA A;  2I2Y A;  2PMV A;  4YTM B;  1V1O A;  2QIE B;  3SR6 A;  2VZK B;  4US8 A;  1BML C;  1QOG A;  2ON8 A;  1NEK B;  4JX1 C;  5D3I B;  2L52 A;  3BII D;  3P4S B;  1LO5 D;  1FD6 A;  3BVM A;  4YSY B;  3Q8C A;  2ZW0 A;  4JWU C;  2KAC A;  2EKI A;  2GI9 A;  3P4R B;  1STE A;  2PW9 A;  1D6E C;  4A55 A;  3J9C A;  1SBB B;  4P16 A;  1OQR A;  4ITK A;  1SF0 A;  4HKZ E;  4RGT A;  3AE8 B;  1EU4 A;  2OHF A;  1IGD A;  1E10 A;  1TS4 A;  1XLO A;  1RWS A;  1TY2 A;  1JML A;  3I57 A;  1JWM D;  2E6X A;  1J7A A;  3B2G A;  2IGG A;  1WWT A;  4ZOH C;  5HFY A;  3Q8B A;  1IGC A;  2WXQ A;  4RH6 A;  5I4D A;  4ZRP A;  4A90 A;  3VR8 B;  2NTT A;  2MH7 A;  1KRH A;  3I9V 1;  2BS4 B;  2Y3A A;  4XWW A;  1SE2 A;  2V3N A;  5HI1 A;  3L4P A;  4WIP A;  1FCL A;  2JX5 A;  1ZE3 D;  3IT4 B;  3MC0 B;  1B1Z A;  2KDM A;  4M0W A;  3ZJU A;  1JWS D;  1I4Q A;  3AV8 A;  3BVG A;  4PT5 A;  1FO4 A;  1ZDV A;  1I7H A;  3HRD D;  3NVW A;  2IPK D;  3NVZ A;  3TEW A;  3E56 A;  3LB8 C;  3FC4 A;  3W1S A;  4L1B A;  2LEK A;  3P42 A;  3NS1 A;  5G5G A;  2MJD A;  1QOA A;  3BK1 A;  3NUH B;  1IBX B;  3NRZ A;  1HXY D;  2LJI A;  2QEJ C;  1AN8 A;  3VQI A;  4GDL B;  1F0Z A;  1L0X B;  5H92 C;  4XDD A;  1N61 A;  2WDR B;  2LMC A;  4US9 A;  4KGT A;  2JSV X;  5EE0 A;  2DLB A;  2ZW1 A;  1CQV A;  2L83 A;  1TJE A;  4TQ1 A;  4LTU A;  3BYT B;  1D5Z C;  1KLU D;  1SJH D;  1MHX A;  4KX6 B;  1FM0 D;  3AE5 B;  1I4G A;  2VZK D;  1L6U A;  2KN4 A;  4NJC A;  4NAM A;  4R3D A;  4RGN A;  3W2D A;  2WXI A;  2JYE A;  5EE3 A;  2QSD A;  5E6J A;  4OZA A;  1NI3 A;  1WSP A;  1T5X D;  1XCQ L;  1JWU D;  2H89 B;  3AB5 A;  1TKY A;  1XLN A;  1UNS A;  1MPE A;  1B9R A;  5BMH A;  1CJE A;  4OW0 A;  5D7G A;  1T3Q A;  1YJI A;  1FNV A;  2IDY A;  4HRS A;  1DOY A;  1DYQ A;  2JWU A;  2DYM A;  2D5G A;  4RF1 A;  1EWC A;  2IJ0 A;  1A70 A;  3B2F A;  3VR9 B;  4TMA B;  1V1P A;  2PTL A;  3E9S A;  2J4X A;  4HRO A;  1K50 A;  2W3S A;  5BMI A;  2JZP A;  1GPX A;  2PVO D;  1FEH A;  3V3X A;  4YXD B;  2GRI A;  1JWB D;  3KWV A;  1NYQ A;  1RM6 C;  2K5P A;  1V1P B;  3GS2 A;  2WU2 B;  5AUK A;  4KKI A;  1N63 A;  4MAC A;  2BYT A;  1JQ4 A;  1F2R C;  4C56 C;  3LXF A;  1HEZ E;  1BXT A;  4A8X C;  4Q2J A;  3ZJV A;  3SEB A;  1JWA D;  1TZO A;  4O1N A;  4MH8 A;  3TEY A;  4RCO A;  3CIR B;  1DOX A;  2Y5C A;  1M4V A;  2N0S B;  5HG2 A;  2V0G A;  1N5X A;  3AE9 B;  2AQ1 B;  1EM7 A;  5D3D A;  2AQ2 B;  1SB3 C;  3OWE B;  3W5U B;  2XNA C;  2Q5W D;  1C9F A;  4GDK B;  1EU3 A;  2FUG 1;  2BTE A;  2ONQ A;  3TEX A;  4DXF A;  3T3O A;  1K52 A;  3MP9 A;  3Q8E A;  2AQ3 B;  2RMM A;  3N9Y C;  3U2S C;  3W9C B;  1ESF A;  1K53 A;  1MI0 A;  1ZOY B;  5BYQ A;  2V4I B;  2FBW B;  1ROE A;  1QLB B;  3H8H A;  1D5M C;  3IAM 1;  2MEK A;  2LFI A;  2PLP A;  2BT6 A;  4IDI A;  5JXV A;  4OHJ A;  3P63 A;  4YSZ B;  1KFY B;  3P4P B;  1C76 A;  4JE3 B;  3TSS A;  3T3N A;  2WLB A;  1QQR A;  1JRO A;  1VDV A;  3R2I A;  4N59 A;  3AN1 A;  1UGJ A;  3URY A;  2XN9 C;  3KQ4 A;  1ACC A;  4RGM A;  3W5V B;  1AYF A;  2WXL A;  1PFD A;  1CZP A;  3MFG A;  2IGD A;  4FXC A;  1XF5 L;  1QOF A;  3LYY A;  4A9A A;  3U7Z A;  1J7C A;  2LGI A;  4HEA 1;  3NVY A;  5BYR A;  3VRA B;  2N7J A;  1C78 A;  2DYO A;  4CQN A;  3UI3 A;  1FFV A;  1OQQ A;  4NZL B;  3BWU D;  2WXJ A;  1FRR A;  3Q8A A;  4USA A;  2QIL A;  1XCT L;  1SIJ A;  1PYW D;  1VJK A;  1L5P A;  1E7P B;  2YEP F;  3AE4 B;  1QKZ A;  5BYS A;  1JRP A;  1QOB A;  1XO3 A;  4OZB A;  5FKA C;  1VZ7 A;  2FE8 A;  3U4E G;  5EE1 A;  1UUP A;  1AWD A;  4YT0 B;  1EWY C;  3ETR A;  3IAS 1;  1VZ6 A;  3AE7 B;  2ACZ B;  3AEE B;  3KWL A;  1F77 A;  4IKG A;  5T8I A;  3P4Q B;  2Z8L A;  3AMZ A;  4RNA A;  1FXI A;  2EEL A;  5H8Y E;  2OED A;  3ZJT A;  2W55 A;  1PGB A;  2L32 A;  2WDQ B;  4L2Y A;  4B0M A;  2INP E;  3AM9 A;  2CJN A;  4JWS C;  1SE4 A;  2NMQ A;  4OZC A;  1ZDX A;  3RPF C;  1C79 A;  2N9L A;  4LK0 M;  5FR3 A;  4UDU C;  2BS3 B;  1HA5 A;  3ZGZ A;  5C3J B;  4ARC A;  3DWG C;  1HZ6 A;  3AE1 B;  1IUE A;  2QMT A;  3VRB B;  4ARI A;  1XLQ A;  2WP9 B;  3GP7 A;  3SFE B;  2HTM E;  3HVZ A;  2MJ3 A;  1RYJ A;  4YWG G;  1JAL A;  3RFZ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...