3RNFC

Structure of the toluene/o-xylene monooxygenase hydroxylase t201s/v271a double mutant
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
85
structure length
85
Chain Sequence
ATFPIMSNFERDFVIQLVPVDTEDTMDQVAEKCAYHSINRRVHPQPEKILRVRRHEDGTLFPRGMIVSDAGLRPTETLDIIFMDN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Toluene o-xylene monooxygenase component
publication title Tracking a defined route for O2 migration in a dioxygen-activating diiron enzyme.
pubmed doi rcsb
source organism Pseudomonas sp. ox1
total genus 25
structure length 85
sequence length 85
ec nomenclature ec 1.14.-.-:
pdb deposition date 2011-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF06234 TmoB Toluene-4-monooxygenase system protein B (TmoB)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.270 Alpha Beta Roll Ubiquitin-like (UB roll) TmoB-like 3rnfC00
1T0SC 3RNCC 3RI7C 3DHIC 3Q2AC 3Q3NC 2INDC 3RNEC 3N1ZC 3Q3OC 3Q3MC 3I63C 2RDBC 3GE8C 1T0RC 3GE3C 3N20C 3I5JC 3RNGC 4P1BC 3RNBC 2INCC 3RN9C 3RNFC 3N1XC 3DHHC 4P1CC 3RMKC 3N1YC 3RNAC 3Q14C 1T0QC 3DHGC
chains in the Genus database with same CATH superfamily
5G5GA 4XDDA 3UQAA 1T5XD 2PIAA 1NEKB 4NAWA 2NPTA 2DZKA 1UELA 3NS8A 2GBKA 5AZGA 2L05A 1SIFA 2JY6A 3KYDD 2WXJA 1CK1A 4C80A 3QAQA 4ARCA 2X38A 1WR6E 4JWUC 4GDKB 4HKQA 1L0VB 2DYBA 4LJPB 5LLIA 2LASA 2N9EB 3IFWB 4X57B 4UDUC 4AP4C 3ZO5B 2M4NA 1KM7A 1VCBA 1EWYC 3Q3MC 4WWNA 4ZRIA 4M0WB 3ZQ4A 1XLQA 5AEKB 2KJRA 2AQ2B 3L13A 1OQQA 2N9XA 2D3CA 1SE9A 3C19A 3AV8A 4GOCA 2BF8B 1YX6B 5BMIA 2L0FA 2IO2B 4C00A 1XO3A 5DCNA 4C4VA 5L95C 1V97A 3JVZX 4W9KA 3PREA 4RGOS 1E7PB 3BYTB 1ZPSA 4ZYSA 1TS2A 1HQRD 1TS3A 3IT6B 1HZ5A 1TY2A 5HKHA 2LI5A 1WR1A 2JWZA 4K7WA 3N32A 2UYZB 1J7CA 3GB1A 4CQNA 1WIAA 2WS3B 4LNOA 4XDCA 4DHZE 4BKTA 4ZRPA 4ZYNA 1FRRA 2PPHA 1ZXIA 4N9F4 3U4EG 2W82A 4DDID 3MC9A 4IOIE 2FCNA 2BGFA 2QDFA 2DBYA 4KV2A 4J6IA 2QHOA 2KC1A 3SD5A 1ZDVA 1SIJA 4FULA 3IAS1 2RDHA 2SAKA 4P1BC 2NTSA 1ZOYB 1JALA 2A5UA 2LUEA 1T0QC 3TSSA 4P6VF 2QEJC 4IUMB 1R4MB 4BKSD 1SF0A 2NS5A 2K1FA 1P7FA 4W9DA 1OTRB 4A20A 1GAQB 2BKRB 2ZVOA 4US9A 1L2NA 1EWCA 2IJ0A 1UWXA 3OJ4B 2K25A 3RZFA 5EE0A 1RAXA 3BK2A 3U7DA 4OVVA 3ZDMC 3W2DA 4M00A 3TJPA 3SFDB 3DVNU 2GI9A 2KLCA 1PGBA 4K3CA 3C0RB 1IPGA 4MSMB 3DOWA 4FBJB 4OHJA 2CR5A 1QOFA 2EELA 3ZTDA 4MT5A 4BFRA 1HZ6A 4N59A 1F77A 1I4XA 2KJ6A 2C5LC 4YT0B 3QIJA 3LXFA 1AW7A 4WJOA 2LWPA 2KMCA 4LNFA 3RNCC 4BZAA 4DWFA 2JX5A 3V6EB 3APFA 2AQ3B 2K0PA 3PPAA 1M94A 4AWJA 2JRHA 4LDTD 4S0RA 3I57A 1VLBA 2KVZA 5JXVA 2C9WB 3HRDD 2K8BA 3MP9A 2Y5BB 4JQWC 1GB4A 3NZUA 3AM9A 4HROA 4ANUA 3P2BA 5BYSA 3W1SA 1L6UA 2K6DB 1C4AA 2Y5CA 1KLGD 2KK8A 1PGXA 1HE8A 3VUYA 1V86A 3T3OA 1L4DB 2IO3B 3KLSX 3ZJUA 1RWSA 3NRZA 1WXMA 3P1MA 4NAMA 2CHXA 2W3SA 2PE9A 3RULA 2KT7A 2DAFA 2YEPF 1ET9A 3BY4B 3OWEB 3ZYYX 1C77A 2L52A 3VR9B 1D3ZA 2KHWB 2LGDA 3RMKC 3SU8X 2MLBA 3WIMA 1F2RI 1Q1OA 4HK2A 2D11A 2BS2B 4NJ6A 2KC2A 3PTFC 1VDVA 4KSLC 4KKIA 3OAWA 4Q2JA 1KH0A 2H89B 1K51A 4E74A 2FCMA 2Q5WD 4BBNC 2GB1A 5IA7A 4XX5A 4IM2A 3EFCA 4YTNB 1N63A 1ENFA 3HM6X 2V0GA 4FN2A 3AEBB 2ZPNA 1D5XC 1V6EA 1A70A 1SJED 2BYVE 2WU2B 1FRDA 4MH0E 3DBRI 4CHKA 2BVCA 5HFYA 4YTPB 3PLVA 4HKZE 1WSPA 4W9GA 2J0MA 2J4XA 2IGGA 3FC4A 3H9DA 3TUOA 1YJJA 2LFIA 2IO1B 2K39A 2J53A 1NDDA 4FA6A 5IO9A 3P42A 4L2YA 1YQ4B 2DENB 3VAWA 4YTMB 3MTNB 2D5GA 3NG0A 1I4GA 2WWZA 4DXAB 1BXTA 4LK0M 3BIID 1P7EA 5MPOA 2D2QA 3A4SC 4AJYB 5D94A 3R2TA 1GNUA 3GE3C 3QCAA 3X0WA 3OG5A 4JL9A 4I6NB 1P1AA 4F7ZA 3QX1A 1D5ZC 1E8YA 3UIPB 1WZ0A 1ZGUB 2LRUA 4FJYA 2L76A 2L3ZA 2ZW1A 2K8CA 3VTWA 2YLMA 3SHQA 1D5MC 1ZW7A 1L0XB 2QMTA 1OQRA 4KZCA 2YVCA 4WQMA 4F1SA 4G3XB 2WXOA 3WANA 5AUIA 3H7PB 2BWES 3HVDA 5J18A 4TQ1A 1B1ZA 2XBBC 3SEBA 3AN1A 2KO3A 2L1AA 2H88B 3P4RB 3VHTC 2B3AA 1DYQA 1PFDA 1R7SA 4NPNA 2V4LA 1ESFA 2CU1A 1WJ4A 5CHVC 2M19A 2BYEA 3IVFA 4EEWA 4H2AA 4L1BA 4F8CB 1E10A 4A90A 2MBEA 2M0AA 1IGCA 1C78A 1XLPA 1WY8A 3K9OB 4ACFA 1JQ4A 2KX0A 1WRDB 5CTRC 4W9FA 2LVQA 2JYTA 3RNFC 4JGHB 1MHXA 1RFAA 5IP4D 2KMAA 3QARA 4NAWB 4TSSA 1WGKA 2NPTB 4B9KA 1VJKA 4C7YA 2C7MB 4LNNA 1FNUA 1KTKA 1WI0A 1UBIA 2Z8LA 2DAJA 4K7UA 3DPDA 2ZNVB 1QZEA 3DVGX 2JPHA 2A4ZA 2MQJA 2Y5PA 2QILA 2JZPA 4HLEA 2IPKD 1E8WA 2MW5A 3IG3A 4NQKE 1P0RA 2L0TA 2DX5B 3Q3OC 4AS1A 4OZAA 1VZ6A 1L5PA 2IYDB 3WAPA 3TEXA 3ZXVA 3ML9A 2MBHA 2WDQB 3TEZA 2KDIA 3KUZA 4WJQA 1Q0WB 1NBFC 4BOZB 3H7PA 4C4VB 3ZNZB 2LVOA 3EC8A 3VFKA 4PK1A 3ZXRA 5AUKA 3NZ3A 2KQSA 1B9RA 3DBRB 3BZDB 2O6VA 1YJIA 2OEDA 2BYFA 2LGXA 5EE1A 3KYCD 4EZJA 3I9V1 2L32A 5GXGB 1YIWA 1SXTA 4M01A 1YQBA 4REZA 1WJ6A 2KTFA 1YJ1A 1X1MA 1FO4A 1T0SC 1TKYA 3KWVA 3AEFB 3LB8C 3MHSD 3U8ZA 3NUHB 4RM8A 1TJEA 3NY5A 2IY1B 5IKCM 3W5VB 4URKA 2N9LA 3LJ3A 5E6OA 3AE6B 5JHBA 4W9JA 1WFYA 5JH5C 3AB5A 3HUIA 2GMIC 5G5HA 4FJZA 2N7JA 2ZCCA 3KUDB 3PSEB 1I4PA 1ET6A 3BYYB 3GP7A 4B95A 2V9HA 1L7YA 4MGYE 1TS4A 1Y8RC 1S3SG 4OVZA 4WAFA 3AMZA 2DHZA 2MH7A 3GS2A 3I3TB 3ZTCA 1JWUD 3DBSA 3K9PB 3DVNV 1CZPA 3PRMB 3ZJVA 4PYUA 1C4CA 1D6EC 2W9NA 4BBNF 1C3TA 1WE6A 3BK1A 4MM3A 4E3CA 1TT5B 1I4QA 2WXLA 1VZ7A 3A9KB 3ENEA 1R4NI 1WXQA 1XCTL 1PYWD 2WGSA 4OZCA 5C23A 4IW0A 4NY0A 4YL8A 1AN8A 4DHJB 3UF8A 1MI0A 3LDZE 3Q3JA 3V60A 2BQQA 1V5OA 1ISNA 4P7IA 1IGDA 1E8ZA 1FPYA 2NBWB 1XCQL 3H1UA 4TV3A 1TS5A 3VR8B 1OEYJ 3CF6E 3DWGC 1PDXA 1T6BX 2UWQA 2DZIA 3P4PB 3V6CB 1N6ZA 1TKEA 3AE4B 1WM2A 3FKYA 4FXCA 4JWSC 2KLGA 4I6LB 3JW0X 3R3MA 2D3GA 1UGJA 1GC7A 1FEHA 2IO0B 2MHJA 4WWOA 1K52A 1V5TA 2WQYB 4FHJA 3PRPB 2AEHA 4IDIA 3E56A 3R8BA 3GZNI 4HJGE 3B9JA 4MGZE 3M62B 2WXFA 3AEAB 3CSTA 1CQVA 1E7UA 4GSWA 4KGRA 3QQ8B 2D3AA 2I1JA 1DGJA 2WX0A 4YSYB 5E6PA 2RR9A 4AQ7A 2VRRB 3AU5A 4TKNA 2LHEA 1XT9B 2FCQA 4ZRJA 2ZCBA 5HI1A 2MA9B 2GBNA 2GBRA 2EKIA 4A8XC 3E9SA 3MJ5A 2KJHB 5BMHA 4ICVA 1FD6A 1FCCC 1XLNA 3KH0A 2INCC 3RYTA 2FUHB 1E5WA 1EU4A 3A9KA 2GOWA 1WM3A 1FXAA 1EO6A 1ZP0B 2DYMA 3ZKJC 3ZJTA 1GPXA 1DOYA 2Z0EB 5FR3A 3DDCB 5TR5A 1Y56A 1QOAA 3PO0A 3ONSA 5KHOA 3A1QA 2HE7A 1T3QA 1OFFA 4ICUA 3RN9C 2CJNA 2GBMA 1MVKA 1ZDXA 3W9CB 4KKJA 3QJZA 2NCNA 2JUOA 3PVLA 2KDBA 4NZLB 1SEBD 3OLMD 2GBJA 2K22A 3P4SB 3MC8A 3IXSA 4KDIC 3U52E 1F0ZA 1VD2A 4KSKC 2AQ1B 3AH7A 4HJKA 3QHTA 2N4FA 1WYWB 2DZMA 2W54A 4ZHPA 1JMLA 3B08A 2BS3B 4E71A 2M1MA 2INNE 2EKEC 2OOBB 2BB6A 2PW9A 1RLFA 3HIZA 3QK0A 4GLSC 3TEWA 2KWVB 1V2YA 2HDEA 5C3JB 3MC0B 1R4NB 2HD5B 4RF0A 1MG8A 5G55A 1EU3A 3Q8AA 2O2VA 5TSSA 3QC8B 2IBIB 2DNFA 2BPSA 5KHQA 1G6JA 2WXIA 4GIVA 1IYFA 2E6XA 2M17A 1V8CA 3M95A 2FUG1 1SE4A 1RRBA 4XZ4A 4HCPB 2MJEA 4RGNA 4A6QA 1N5WA 1BUIC 4N6EB 3TMPB 1JCKB 2M8SA 4MJSB 1N61A 2XK5A 4M02A 4BKGA 5CX3A 2D3BA 3ZGZA 3HK0A 4KDLB 2RPVA 1VR9A 3HM3A 4QAYA 3VDZA 4GN1A 2AX5A 4KX6B 2RPQA 1UWMA 2O6VD 2WX1A 3AE1B 5G2NA 4LNIA 3AE9B 2I2YA 4WURA 4W9IA 3PZ8A 4PS7A 3L54A 5L83A 3GZNB 5JHAA 1JROA 2PE6B 2MCNB 3A9JA 4GDLB 4A9AA 2HTHA 1ACCA 2KFJA 1TBEA 3UGBB 3VXWA 3RNAC 2N1WA 4CYEA 1MJDA 2I1KA 4EKUA 1BMLC 2FCSA 3TL5A 2G1EA 3Q8FA 2KDMA 3NVWA 2MBOA 1SJHD 2JSVX 3AE5B 3H8HA 2N7DA 2REXA 4IWOA 3CMMB 1VZ8A 2DYOA 1E6EB 1QOBA 1UD7A 4LNKA 1GOZA 1YNTE 3DHGC 1FFUA 3X23A 1F52A 1D4BA 3DBHI 1XXGA 1Z5SB 3L16A 2TSSA 2LJ5A 3NVVA 2WNMA 1WX8A 2KKCA 3AI5A 2INPE 3ALBA 3D32A 4DBGA 5LXIB 4MEMA 4MJSA 3I63C 5BMGA 5EE9A 5C2TB 4OW0A 1H8CA 1V1PA 2CS4A 4HEA1 3L0WB 1TYGB 5D3DA 1SSNA 4ANWA 3B2FA 4BKSA 2KN4A 2MSED 4MGKE 2WDRB 3AE2B 1T0YA 5DPRA 3V61A 2O6VB 4K3BA 4OVUA 2X8XX 3AEEB 4JX1C 2KDEB 1V80A 2N0SB 4HXDA 4ZHOA 3L17A 2LJIA 4XWTA 1IUEA 2LMCA 2WDTB 4LCDE 2QSDA 4WQOB 1SB3C 2MP2A 3WALA 4GDLA 3FAHA 3ZNHB 5E6JA 1L0YB 1NI2A 2B76B 2G9HD 3R2IA 3IHPC 2WU5B 3ZUNA 1E7VA 1LQBA 1MHHE 4XWWA 4RGMA 2KN5A 4PS3A 5FKAC 2W55A 1WWTA 4BOSC 2ZVNA 2NMQA 1TTNA 3VVWB 4EFOA 3WAOA 2DLBA 1E90A 3EFUA 4NJ7A 3N1YC 1KLUD 3Q14C 5D2MB 2ACZB 3Q8BA 3VUWA 4YSXB 4FJVB 3A33B 4JPSA 2K8HA 1U4AA 3TBLD 1QKZA 2L7RA 3Q6BA 3P63A 1UZXB 2FNJB 3SR6A 4JIOU 2WXPA 1RM6C 3T8MA 2WHIA 2KYWA 3VH4B 2N9KA 4ZRKA 2R2QA 1WZ3A 1C4PA 2OJRA 1K8RB 3PT2B 3DHIC 2LRWA 3V3XA 2D07B 2PEAA 4MM3B 1V49A 3UQBA 1I4RA 1Z2MA 2K3UA 3IAM1 1T0RC 4FLHA 2G3QB 2AWTA 3I5JC 4KIKA 1GB1A 4YXDB 3APCA 4W9LA 4A3PA 5EE3A 4DHJD 2JRIB 1L6VA 3AU4A 3T9LA 1XF5L 3TEYA 3IBEA 3NJTA 1SBBB 3L4PA 2LGIA 2QCZA 3Q69A 2BBCA 3KUCB 4KZ0A 2BYTA 4I6PA 2LGYA 3Q8CA 3N9YC 5HG2A 1P98A 1WYGA 3RI7C 2INDC 1QOGA 4AUQC 1LXDA 2KTRA 4HPMB 2KAJA 3EUB2 2ZW0A 4NQLB 3C8YA 3AE7B 3FILB 2KACA 3DBHB 5D3IB 2N1VA 1TZOA 1LFDA 2FIDA 1I35A 3R7QA 3HHMA 2PKOA 4TQ0A 3NOBA 3GOEA 5FR6A 4A3OA 4EOYA 2LD9A 5IOIA 2KXJA 2OJWA 3KWLA 1I7HA 4WIPA 4DDGD 1EM7A 4P1CC 4WH4A 1M4VA 1XLOA 2JXXA 2VZKD 4MDKE 1ROEA 2JZZA 4EUTA 2MWSB 2V3NA 4II3B 1WE7A 1ZXHA 2LXAA 3W1SC 3DQVA 2JF5A 2L83A 2MBBB 3QA8A 4KVGB 4NJCA 1STEA 4IWQA 3WA0A 1J8CA 2BB5A 1HEZE 4M8MA 3VRBB 2CHWA 2BKFA 1V1OA 2YEPB 1WXSA 1UF0A 3VRAB 2JQRB 1WJUA 2NR2A 3O13A 4G0NB 2WXQA 2XEWA 2ASQA 1MPEA 2L00B 3ML8A 1FIQA 2LVPA 5AZHA 3A1QB 1KF6B 2LUMA 2AYOB 2G4DB 1GC6A 1EF5A 1WMHA 1UBQA 3ZIMA 4WJPA 2KWCA 2PTLA 4JLCA 2NVUI 2J0JA 5H92C 3R7RA 1YOVB 1N5XA 1Q10A 2RSUA 5C1ZA 1FXTB 3KVFB 1JWSD 3BINA 2NTTA 1JWBD 1OQYA 3FILA 1WGRA 2KX3A 2LZ6A 2PMVA 3ZRFA 3ETRA 1HA5A 3PZDA 3KQ4A 1WXVA 4LTUA 3URYA 1E0ZA 1IBXA 3U30A 4RM9A 2KFKA 2CKHB 1S1QB 5J2RA 2O2VB 3N1XC 2C7NB 3JSVB 1YN4A 4ANVA 1RYJA 1P3QU 2E3TA 1IP9A 1TKGA 2K6QA 3PZ7A 3RZWC 3M3JA 2VZKB 4RNAA 3WAMA 1CMXB 4EE2A 3RNGC 1SE3A 2W3RA 4AJWA 2VH1A 2XK5B 4EZLA 3MFGA 4B0EA 5JZEB 1V9JA 2MJ3A 3Q3FA 2GLSA 1GG3A 4GMVA 4JE3B 3ECIA 4EZKA 1RFKA 1L4ZB 3KW5B 3Q2AC 4GDKA 1KJTA 2N9PC 1E8XA 2KWDA 3DCGA 4MH8A 3TCAA 4WWMA 2JZ3B 1YMHE 3HVZA 3BVZA 4M0WA 4P16A 1JW9D 4C56C 4O1NA 3H6NA 1J7AA 1SE2A 2C60A 1WJNA 1JWAD 2G45B 4MACA 5LNK1 5HHDG 1EUVB 4S17A 3UIOB 4MELA 4G11A 4RCOA 1C76A 3BVGA 3A9JB 2AL3A 2KD0A 2M0XA 2WLBA 1DOXA 4IG7B 4BVUC 2WYQA 3ZDTA 3ZW3A 2D10A 2Z59B 1MFWA 2IGDA 1WF9A 1PQSA 2KDFB 2MJDA 2I38A 1OEYA 4PYZA 1BT0A 3RNEC 4GGQA 3ZVVA 1NENB 2AL6A 1ZKHA 3B1LX 3DVGY 2ZZPB 1PUTA 4HDQA 3EA6A 3U2SC 2ICIA 4HVBA 1P9DU 3BVMA 1QF6A 3UI3A 4ZRQA 4ANXA 2MX2A 3B0AA 3NVYA 2C7HA 2FBWB 4K7SA 4WAAA 5T8IA 1J0GA 5DPTA 3JSVA 3VTVA 1CJEA 4USAA 1XD3B 1JRUA 2QC8A 5AZFA 2WXKA 1NYQA 2MBQA 3RT3B 4NNJB 2BTEA 4DXGA 3EECA 1HXYD 1XQQA 1A5RA 3S2AA 2BWFA 2K9XA 4HPPA 1Q5WB 1V1PB 3QWZB 4RGTA 4ZDVA 2RDBC 1LO5D 2BS4B 2RD0A 4IM0A 3UINB 3AEGB 4TMAB 1ZUD2 4XYCA 2MRPA 4DXFA 3AECB 4OZBA 2LHDA 3PRZA 4W9CA 3AEDB 4W9HA 2IY0B 2QJLA 1QILA 5IN7A 1WH3A 2OHFA 4M8NA 1TGZB 2KMMA 1ZE3D 4II2B 1MG4A 2MP2B 2J52A 3NS1A 5CHFA 4A55A 2V3PA 1YN5A 2J0KA 2RMMA 1J7BA 2IZVB 2V3SA 3SFEB 4ASWC 2RGFA 1FMAD 4XGAB 2V4IB 1I4HA 3PHXB 5IAAC 4DK5A 3ZNGC 2LEKA 4YWGG 2PVOD 1E9MA 2FAZA 4XC2A 5GMVA 4D2KA 3DBLI 2JXTA 2QIEB 4GU2A 2J42A 4HCNB 4C7ZA 2EMTA 3NZSA 5CHWA 3L10B 3ZNID 2KANA 1F9JA 3M63B 2HJ1A 2RDGA 1GJZA 4LDTB 4ARIA 3PGEA 2WXRA 2KWUB 1C79A 1YX5B 2DZJA 3LYYA 4WJNA 3NVZA 1UUPA 3A4RA 3VQIA 1FM0D 2DWQA 2Z0DB 5DPSA 4RF1A 1PGAA 5D7GA 4FHKA 2ZJDA 3CIRB 5BO4B 1UGMA 3TIXA 4KIKB 4N58A 1F2RC 1TY0A 2JU6X 2K5PA 3DWMA 4LJOB 2WDVB 2CU3A 1AARA 4HRSA 2R61A 2ZNVC 5H8YE 1UNSA 4CO7A 2KVRA 1WGGA 4US8A 1YN3A 1NVID 4DQOC 2JYEA 4TUUA 2KQ4X 2HJ8A 4IKGA 1DOIA 3CWIA 3V62A 3V05A 1K50A 1NYRA 3RCZA 4B6WA 4ITKA 2J7QB 4RMAA 3SDLC 4HPLB 4G50A 1WX9A 1JRPA 4YSZB 4PT5A 2KTRB 3J9CA 4LLGM 1FNWA 2WXMA 1QQRA 2V1YA 1K53A 2ZEQA 4R3DA 2EMSA 1GUAB 2UU7A 2ON8A 2NBUA 4KGTA 3MHZA 3EGRA 3AULA 1KLVA 4DHZB 3ZLZA 1LM8B 2KOXA 2WP9B 1VRAB 3DHHC 4IC7B 2BT6A 1LGRA 3ABVB 4AOFA 1WGHA 3R66C 5BYRA 2PJHA 2WXNA 3RUIB 3OJ3A 1EF1A 1QLBB 4IWPA 4BAXA 3VUXA 5E6NA 4K1RB 2ZPYA 3WCQA 3N3KB 3GE8C 1I42A 2CHZA 2FE8A 3AXCA 2WXGA 2N7EA 1C9FA 1AYFA 4KGSA 3N30A 1KRHA 4FADA 4XE0A 1J19A 5FK9C 1WGDA 3PV1A 3RFZB 4W9EA 4RFBA 1SGHA 4RH6A 2IDYA 2CJOA 5J17A 3N1ZC 3IT4B 3O65B 2ONQA 1FXIA 2L8JA 2JVCA 2FIFA 3CSFA 2PVGC 1TZ1A 4PS8A 4GB9A 3RNBC 4B0MA 1QT9A 3PHWB 4K81A 4IM3A 2KZRA 3Q8EA 3Q3NC 1WX7A 1HTQA 2MEKA 2PLPA 3VH3B 1TIFA 2M56B 1UH6A 1WXAA 1WGYA 2GRIA 4MSQB 1AWDA 3VTUA 1V81A 2G4SA 1XEEA 3DBLB 2IGHA 1WMHB 1YD8U 2JWUA 1C1YB 3AE8B 1R4MI 3MJWA 5EDSA 2KQ7A 5BYQA 2WXHA 1KOTA 2Y3AA 5D6JB 2VH2A 3EHVA 3T3NA 3PLUA 4L23A 2BW2A 3N20C 3P4QB 1FFVA 5DPWA 3ZRCA 3AE3B 5LXHA 3JYUA 3NHEB 2LXCA 3W5UB 4HDOA 1N60A 3L08A 2LGSA 2SEBD 4HWIB 1YQ3B 2R2OA 1IBXB 3PS6A 4GXBA 3RD2A 1NI3A 1HTOA 1F1HA 1N62A 1OGWA 3BWUD 1FNVA 1FCLA 2KFKB 1KFYB 4J3OD 3H7SA 4ZOHC 2NBVB 4WWPA 1JWMD 1WRIA 3B2GA 2XNAC 4MGIE 1H4RA 2JT4B 3U7ZA 3APDA 2HTME 5I4DA 2KNBA 3W1YA 3RPFC 2XN9C
chains in the Genus database with same CATH topology
1T0SC 3RNCC 3RI7C 3DHIC 3Q2AC 3Q3NC 2INDC 3RNEC 3N1ZC 3Q3OC 3Q3MC 3I63C 2RDBC 3GE8C 1T0RC 3GE3C 3N20C 3I5JC 3RNGC 4P1BC 3RNBC 2INCC 3RN9C 3RNFC 3N1XC 3DHHC 4P1CC 3RMKC 3N1YC 3RNAC 3Q14C 1T0QC 3DHGC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T0S C;  3RNC C;  3RI7 C;  3DHI C;  3Q2A C;  3Q3N C;  2IND C;  3RNE C;  3N1Z C;  3Q3O C;  3Q3M C;  3I63 C;  2RDB C;  3GE8 C;  1T0R C;  3GE3 C;  3N20 C;  3I5J C;  3RNG C;  4P1B C;  3RNB C;  2INC C;  3RN9 C;  3RNF C;  3N1X C;  3DHH C;  4P1C C;  3RMK C;  3N1Y C;  3RNA C;  3Q14 C;  1T0Q C;  3DHG C; 
#chains in the Genus database with same CATH topology
 5G5G A;  4XDD A;  3UQA A;  1T5X D;  2PIA A;  1NEK B;  4NAW A;  2NPT A;  2DZK A;  1UEL A;  3NS8 A;  2GBK A;  5AZG A;  2L05 A;  1SIF A;  2JY6 A;  3KYD D;  2WXJ A;  1CK1 A;  4C80 A;  3QAQ A;  4ARC A;  2X38 A;  1WR6 E;  4JWU C;  4GDK B;  4HKQ A;  1L0V B;  2DYB A;  4LJP B;  5LLI A;  2LAS A;  2N9E B;  3IFW B;  4X57 B;  4UDU C;  4AP4 C;  3ZO5 B;  2M4N A;  1KM7 A;  1VCB A;  1EWY C;  3Q3M C;  4WWN A;  4ZRI A;  4M0W B;  3ZQ4 A;  1XLQ A;  5AEK B;  2KJR A;  2AQ2 B;  3L13 A;  1OQQ A;  2N9X A;  2D3C A;  1SE9 A;  3C19 A;  3AV8 A;  4GOC A;  2BF8 B;  1YX6 B;  5BMI A;  2L0F A;  2IO2 B;  4C00 A;  1XO3 A;  5DCN A;  4C4V A;  5L95 C;  1V97 A;  3JVZ X;  4W9K A;  3PRE A;  4RGO S;  1E7P B;  3BYT B;  1ZPS A;  4ZYS A;  1TS2 A;  1HQR D;  1TS3 A;  3IT6 B;  1HZ5 A;  1TY2 A;  5HKH A;  2LI5 A;  1WR1 A;  2JWZ A;  4K7W A;  3N32 A;  2UYZ B;  1J7C A;  3GB1 A;  4CQN A;  1WIA A;  2WS3 B;  4LNO A;  4XDC A;  4DHZ E;  4BKT A;  4ZRP A;  4ZYN A;  1FRR A;  2PPH A;  1ZXI A;  4N9F 4;  3U4E G;  2W82 A;  4DDI D;  3MC9 A;  4IOI E;  2FCN A;  2BGF A;  2QDF A;  2DBY A;  4KV2 A;  4J6I A;  2QHO A;  2KC1 A;  3SD5 A;  1ZDV A;  1SIJ A;  4FUL A;  3IAS 1;  2RDH A;  2SAK A;  4P1B C;  2NTS A;  1ZOY B;  1JAL A;  2A5U A;  2LUE A;  1T0Q C;  3TSS A;  4P6V F;  2QEJ C;  4IUM B;  1R4M B;  4BKS D;  1SF0 A;  2NS5 A;  2K1F A;  1P7F A;  4W9D A;  1OTR B;  4A20 A;  1GAQ B;  2BKR B;  2ZVO A;  4US9 A;  1L2N A;  1EWC A;  2IJ0 A;  1UWX A;  3OJ4 B;  2K25 A;  3RZF A;  5EE0 A;  1RAX A;  3BK2 A;  3U7D A;  4OVV A;  3ZDM C;  3W2D A;  4M00 A;  3TJP A;  3SFD B;  3DVN U;  2GI9 A;  2KLC A;  1PGB A;  4K3C A;  3C0R B;  1IPG A;  4MSM B;  3DOW A;  4FBJ B;  4OHJ A;  2CR5 A;  1QOF A;  2EEL A;  3ZTD A;  4MT5 A;  4BFR A;  1HZ6 A;  4N59 A;  1F77 A;  1I4X A;  2KJ6 A;  2C5L C;  4YT0 B;  3QIJ A;  3LXF A;  1AW7 A;  4WJO A;  2LWP A;  2KMC A;  4LNF A;  3RNC C;  4BZA A;  4DWF A;  2JX5 A;  3V6E B;  3APF A;  2AQ3 B;  2K0P A;  3PPA A;  1M94 A;  4AWJ A;  2JRH A;  4LDT D;  4S0R A;  3I57 A;  1VLB A;  2KVZ A;  5JXV A;  2C9W B;  3HRD D;  2K8B A;  3MP9 A;  2Y5B B;  4JQW C;  1GB4 A;  3NZU A;  3AM9 A;  4HRO A;  4ANU A;  3P2B A;  5BYS A;  3W1S A;  1L6U A;  2K6D B;  1C4A A;  2Y5C A;  1KLG D;  2KK8 A;  1PGX A;  1HE8 A;  3VUY A;  1V86 A;  3T3O A;  1L4D B;  2IO3 B;  3KLS X;  3ZJU A;  1RWS A;  3NRZ A;  1WXM A;  3P1M A;  4NAM A;  2CHX A;  2W3S A;  2PE9 A;  3RUL A;  2KT7 A;  2DAF A;  2YEP F;  1ET9 A;  3BY4 B;  3OWE B;  3ZYY X;  1C77 A;  2L52 A;  3VR9 B;  1D3Z A;  2KHW B;  2LGD A;  3RMK C;  3SU8 X;  2MLB A;  3WIM A;  1F2R I;  1Q1O A;  4HK2 A;  2D11 A;  2BS2 B;  4NJ6 A;  2KC2 A;  3PTF C;  1VDV A;  4KSL C;  4KKI A;  3OAW A;  4Q2J A;  1KH0 A;  2H89 B;  1K51 A;  4E74 A;  2FCM A;  2Q5W D;  4BBN C;  2GB1 A;  5IA7 A;  4XX5 A;  4IM2 A;  3EFC A;  4YTN B;  1N63 A;  1ENF A;  3HM6 X;  2V0G A;  4FN2 A;  3AEB B;  2ZPN A;  1D5X C;  1V6E A;  1A70 A;  1SJE D;  2BYV E;  2WU2 B;  1FRD A;  4MH0 E;  3DBR I;  4CHK A;  2BVC A;  5HFY A;  4YTP B;  3PLV A;  4HKZ E;  1WSP A;  4W9G A;  2J0M A;  2J4X A;  2IGG A;  3FC4 A;  3H9D A;  3TUO A;  1YJJ A;  2LFI A;  2IO1 B;  2K39 A;  2J53 A;  1NDD A;  4FA6 A;  5IO9 A;  3P42 A;  4L2Y A;  1YQ4 B;  2DEN B;  3VAW A;  4YTM B;  3MTN B;  2D5G A;  3NG0 A;  1I4G A;  2WWZ A;  4DXA B;  1BXT A;  4LK0 M;  3BII D;  1P7E A;  5MPO A;  2D2Q A;  3A4S C;  4AJY B;  5D94 A;  3R2T A;  1GNU A;  3GE3 C;  3QCA A;  3X0W A;  3OG5 A;  4JL9 A;  4I6N B;  1P1A A;  4F7Z A;  3QX1 A;  1D5Z C;  1E8Y A;  3UIP B;  1WZ0 A;  1ZGU B;  2LRU A;  4FJY A;  2L76 A;  2L3Z A;  2ZW1 A;  2K8C A;  3VTW A;  2YLM A;  3SHQ A;  1D5M C;  1ZW7 A;  1L0X B;  2QMT A;  1OQR A;  4KZC A;  2YVC A;  4WQM A;  4F1S A;  4G3X B;  2WXO A;  3WAN A;  5AUI A;  3H7P B;  2BWE S;  3HVD A;  5J18 A;  4TQ1 A;  1B1Z A;  2XBB C;  3SEB A;  3AN1 A;  2KO3 A;  2L1A A;  2H88 B;  3P4R B;  3VHT C;  2B3A A;  1DYQ A;  1PFD A;  1R7S A;  4NPN A;  2V4L A;  1ESF A;  2CU1 A;  1WJ4 A;  5CHV C;  2M19 A;  2BYE A;  3IVF A;  4EEW A;  4H2A A;  4L1B A;  4F8C B;  1E10 A;  4A90 A;  2MBE A;  2M0A A;  1IGC A;  1C78 A;  1XLP A;  1WY8 A;  3K9O B;  4ACF A;  1JQ4 A;  2KX0 A;  1WRD B;  5CTR C;  4W9F A;  2LVQ A;  2JYT A;  3RNF C;  4JGH B;  1MHX A;  1RFA A;  5IP4 D;  2KMA A;  3QAR A;  4NAW B;  4TSS A;  1WGK A;  2NPT B;  4B9K A;  1VJK A;  4C7Y A;  2C7M B;  4LNN A;  1FNU A;  1KTK A;  1WI0 A;  1UBI A;  2Z8L A;  2DAJ A;  4K7U A;  3DPD A;  2ZNV B;  1QZE A;  3DVG X;  2JPH A;  2A4Z A;  2MQJ A;  2Y5P A;  2QIL A;  2JZP A;  4HLE A;  2IPK D;  1E8W A;  2MW5 A;  3IG3 A;  4NQK E;  1P0R A;  2L0T A;  2DX5 B;  3Q3O C;  4AS1 A;  4OZA A;  1VZ6 A;  1L5P A;  2IYD B;  3WAP A;  3TEX A;  3ZXV A;  3ML9 A;  2MBH A;  2WDQ B;  3TEZ A;  2KDI A;  3KUZ A;  4WJQ A;  1Q0W B;  1NBF C;  4BOZ B;  3H7P A;  4C4V B;  3ZNZ B;  2LVO A;  3EC8 A;  3VFK A;  4PK1 A;  3ZXR A;  5AUK A;  3NZ3 A;  2KQS A;  1B9R A;  3DBR B;  3BZD B;  2O6V A;  1YJI A;  2OED A;  2BYF A;  2LGX A;  5EE1 A;  3KYC D;  4EZJ A;  3I9V 1;  2L32 A;  5GXG B;  1YIW A;  1SXT A;  4M01 A;  1YQB A;  4REZ A;  1WJ6 A;  2KTF A;  1YJ1 A;  1X1M A;  1FO4 A;  1T0S C;  1TKY A;  3KWV A;  3AEF B;  3LB8 C;  3MHS D;  3U8Z A;  3NUH B;  4RM8 A;  1TJE A;  3NY5 A;  2IY1 B;  5IKC M;  3W5V B;  4URK A;  2N9L A;  3LJ3 A;  5E6O A;  3AE6 B;  5JHB A;  4W9J A;  1WFY A;  5JH5 C;  3AB5 A;  3HUI A;  2GMI C;  5G5H A;  4FJZ A;  2N7J A;  2ZCC A;  3KUD B;  3PSE B;  1I4P A;  1ET6 A;  3BYY B;  3GP7 A;  4B95 A;  2V9H A;  1L7Y A;  4MGY E;  1TS4 A;  1Y8R C;  1S3S G;  4OVZ A;  4WAF A;  3AMZ A;  2DHZ A;  2MH7 A;  3GS2 A;  3I3T B;  3ZTC A;  1JWU D;  3DBS A;  3K9P B;  3DVN V;  1CZP A;  3PRM B;  3ZJV A;  4PYU A;  1C4C A;  1D6E C;  2W9N A;  4BBN F;  1C3T A;  1WE6 A;  3BK1 A;  4MM3 A;  4E3C A;  1TT5 B;  1I4Q A;  2WXL A;  1VZ7 A;  3A9K B;  3ENE A;  1R4N I;  1WXQ A;  1XCT L;  1PYW D;  2WGS A;  4OZC A;  5C23 A;  4IW0 A;  4NY0 A;  4YL8 A;  1AN8 A;  4DHJ B;  3UF8 A;  1MI0 A;  3LDZ E;  3Q3J A;  3V60 A;  2BQQ A;  1V5O A;  1ISN A;  4P7I A;  1IGD A;  1E8Z A;  1FPY A;  2NBW B;  1XCQ L;  3H1U A;  4TV3 A;  1TS5 A;  3VR8 B;  1OEY J;  3CF6 E;  3DWG C;  1PDX A;  1T6B X;  2UWQ A;  2DZI A;  3P4P B;  3V6C B;  1N6Z A;  1TKE A;  3AE4 B;  1WM2 A;  3FKY A;  4FXC A;  4JWS C;  2KLG A;  4I6L B;  3JW0 X;  3R3M A;  2D3G A;  1UGJ A;  1GC7 A;  1FEH A;  2IO0 B;  2MHJ A;  4WWO A;  1K52 A;  1V5T A;  2WQY B;  4FHJ A;  3PRP B;  2AEH A;  4IDI A;  3E56 A;  3R8B A;  3GZN I;  4HJG E;  3B9J A;  4MGZ E;  3M62 B;  2WXF A;  3AEA B;  3CST A;  1CQV A;  1E7U A;  4GSW A;  4KGR A;  3QQ8 B;  2D3A A;  2I1J A;  1DGJ A;  2WX0 A;  4YSY B;  5E6P A;  2RR9 A;  4AQ7 A;  2VRR B;  3AU5 A;  4TKN A;  2LHE A;  1XT9 B;  2FCQ A;  4ZRJ A;  2ZCB A;  5HI1 A;  2MA9 B;  2GBN A;  2GBR A;  2EKI A;  4A8X C;  3E9S A;  3MJ5 A;  2KJH B;  5BMH A;  4ICV A;  1FD6 A;  1FCC C;  1XLN A;  3KH0 A;  2INC C;  3RYT A;  2FUH B;  1E5W A;  1EU4 A;  3A9K A;  2GOW A;  1WM3 A;  1FXA A;  1EO6 A;  1ZP0 B;  2DYM A;  3ZKJ C;  3ZJT A;  1GPX A;  1DOY A;  2Z0E B;  5FR3 A;  3DDC B;  5TR5 A;  1Y56 A;  1QOA A;  3PO0 A;  3ONS A;  5KHO A;  3A1Q A;  2HE7 A;  1T3Q A;  1OFF A;  4ICU A;  3RN9 C;  2CJN A;  2GBM A;  1MVK A;  1ZDX A;  3W9C B;  4KKJ A;  3QJZ A;  2NCN A;  2JUO A;  3PVL A;  2KDB A;  4NZL B;  1SEB D;  3OLM D;  2GBJ A;  2K22 A;  3P4S B;  3MC8 A;  3IXS A;  4KDI C;  3U52 E;  1F0Z A;  1VD2 A;  4KSK C;  2AQ1 B;  3AH7 A;  4HJK A;  3QHT A;  2N4F A;  1WYW B;  2DZM A;  2W54 A;  4ZHP A;  1JML A;  3B08 A;  2BS3 B;  4E71 A;  2M1M A;  2INN E;  2EKE C;  2OOB B;  2BB6 A;  2PW9 A;  1RLF A;  3HIZ A;  3QK0 A;  4GLS C;  3TEW A;  2KWV B;  1V2Y A;  2HDE A;  5C3J B;  3MC0 B;  1R4N B;  2HD5 B;  4RF0 A;  1MG8 A;  5G55 A;  1EU3 A;  3Q8A A;  2O2V A;  5TSS A;  3QC8 B;  2IBI B;  2DNF A;  2BPS A;  5KHQ A;  1G6J A;  2WXI A;  4GIV A;  1IYF A;  2E6X A;  2M17 A;  1V8C A;  3M95 A;  2FUG 1;  1SE4 A;  1RRB A;  4XZ4 A;  4HCP B;  2MJE A;  4RGN A;  4A6Q A;  1N5W A;  1BUI C;  4N6E B;  3TMP B;  1JCK B;  2M8S A;  4MJS B;  1N61 A;  2XK5 A;  4M02 A;  4BKG A;  5CX3 A;  2D3B A;  3ZGZ A;  3HK0 A;  4KDL B;  2RPV A;  1VR9 A;  3HM3 A;  4QAY A;  3VDZ A;  4GN1 A;  2AX5 A;  4KX6 B;  2RPQ A;  1UWM A;  2O6V D;  2WX1 A;  3AE1 B;  5G2N A;  4LNI A;  3AE9 B;  2I2Y A;  4WUR A;  4W9I A;  3PZ8 A;  4PS7 A;  3L54 A;  5L83 A;  3GZN B;  5JHA A;  1JRO A;  2PE6 B;  2MCN B;  3A9J A;  4GDL B;  4A9A A;  2HTH A;  1ACC A;  2KFJ A;  1TBE A;  3UGB B;  3VXW A;  3RNA C;  2N1W A;  4CYE A;  1MJD A;  2I1K A;  4EKU A;  1BML C;  2FCS A;  3TL5 A;  2G1E A;  3Q8F A;  2KDM A;  3NVW A;  2MBO A;  1SJH D;  2JSV X;  3AE5 B;  3H8H A;  2N7D A;  2REX A;  4IWO A;  3CMM B;  1VZ8 A;  2DYO A;  1E6E B;  1QOB A;  1UD7 A;  4LNK A;  1GOZ A;  1YNT E;  3DHG C;  1FFU A;  3X23 A;  1F52 A;  1D4B A;  3DBH I;  1XXG A;  1Z5S B;  3L16 A;  2TSS A;  2LJ5 A;  3NVV A;  2WNM A;  1WX8 A;  2KKC A;  3AI5 A;  2INP E;  3ALB A;  3D32 A;  4DBG A;  5LXI B;  4MEM A;  4MJS A;  3I63 C;  5BMG A;  5EE9 A;  5C2T B;  4OW0 A;  1H8C A;  1V1P A;  2CS4 A;  4HEA 1;  3L0W B;  1TYG B;  5D3D A;  1SSN A;  4ANW A;  3B2F A;  4BKS A;  2KN4 A;  2MSE D;  4MGK E;  2WDR B;  3AE2 B;  1T0Y A;  5DPR A;  3V61 A;  2O6V B;  4K3B A;  4OVU A;  2X8X X;  3AEE B;  4JX1 C;  2KDE B;  1V80 A;  2N0S B;  4HXD A;  4ZHO A;  3L17 A;  2LJI A;  4XWT A;  1IUE A;  2LMC A;  2WDT B;  4LCD E;  2QSD A;  4WQO B;  1SB3 C;  2MP2 A;  3WAL A;  4GDL A;  3FAH A;  3ZNH B;  5E6J A;  1L0Y B;  1NI2 A;  2B76 B;  2G9H D;  3R2I A;  3IHP C;  2WU5 B;  3ZUN A;  1E7V A;  1LQB A;  1MHH E;  4XWW A;  4RGM A;  2KN5 A;  4PS3 A;  5FKA C;  2W55 A;  1WWT A;  4BOS C;  2ZVN A;  2NMQ A;  1TTN A;  3VVW B;  4EFO A;  3WAO A;  2DLB A;  1E90 A;  3EFU A;  4NJ7 A;  3N1Y C;  1KLU D;  3Q14 C;  5D2M B;  2ACZ B;  3Q8B A;  3VUW A;  4YSX B;  4FJV B;  3A33 B;  4JPS A;  2K8H A;  1U4A A;  3TBL D;  1QKZ A;  2L7R A;  3Q6B A;  3P63 A;  1UZX B;  2FNJ B;  3SR6 A;  4JIO U;  2WXP A;  1RM6 C;  3T8M A;  2WHI A;  2KYW A;  3VH4 B;  2N9K A;  4ZRK A;  2R2Q A;  1WZ3 A;  1C4P A;  2OJR A;  1K8R B;  3PT2 B;  3DHI C;  2LRW A;  3V3X A;  2D07 B;  2PEA A;  4MM3 B;  1V49 A;  3UQB A;  1I4R A;  1Z2M A;  2K3U A;  3IAM 1;  1T0R C;  4FLH A;  2G3Q B;  2AWT A;  3I5J C;  4KIK A;  1GB1 A;  4YXD B;  3APC A;  4W9L A;  4A3P A;  5EE3 A;  4DHJ D;  2JRI B;  1L6V A;  3AU4 A;  3T9L A;  1XF5 L;  3TEY A;  3IBE A;  3NJT A;  1SBB B;  3L4P A;  2LGI A;  2QCZ A;  3Q69 A;  2BBC A;  3KUC B;  4KZ0 A;  2BYT A;  4I6P A;  2LGY A;  3Q8C A;  3N9Y C;  5HG2 A;  1P98 A;  1WYG A;  3RI7 C;  2IND C;  1QOG A;  4AUQ C;  1LXD A;  2KTR A;  4HPM B;  2KAJ A;  3EUB 2;  2ZW0 A;  4NQL B;  3C8Y A;  3AE7 B;  3FIL B;  2KAC A;  3DBH B;  5D3I B;  2N1V A;  1TZO A;  1LFD A;  2FID A;  1I35 A;  3R7Q A;  3HHM A;  2PKO A;  4TQ0 A;  3NOB A;  3GOE A;  5FR6 A;  4A3O A;  4EOY A;  2LD9 A;  5IOI A;  2KXJ A;  2OJW A;  3KWL A;  1I7H A;  4WIP A;  4DDG D;  1EM7 A;  4P1C C;  4WH4 A;  1M4V A;  1XLO A;  2JXX A;  2VZK D;  4MDK E;  1ROE A;  2JZZ A;  4EUT A;  2MWS B;  2V3N A;  4II3 B;  1WE7 A;  1ZXH A;  2LXA A;  3W1S C;  3DQV A;  2JF5 A;  2L83 A;  2MBB B;  3QA8 A;  4KVG B;  4NJC A;  1STE A;  4IWQ A;  3WA0 A;  1J8C A;  2BB5 A;  1HEZ E;  4M8M A;  3VRB B;  2CHW A;  2BKF A;  1V1O A;  2YEP B;  1WXS A;  1UF0 A;  3VRA B;  2JQR B;  1WJU A;  2NR2 A;  3O13 A;  4G0N B;  2WXQ A;  2XEW A;  2ASQ A;  1MPE A;  2L00 B;  3ML8 A;  1FIQ A;  2LVP A;  5AZH A;  3A1Q B;  1KF6 B;  2LUM A;  2AYO B;  2G4D B;  1GC6 A;  1EF5 A;  1WMH A;  1UBQ A;  3ZIM A;  4WJP A;  2KWC A;  2PTL A;  4JLC A;  2NVU I;  2J0J A;  5H92 C;  3R7R A;  1YOV B;  1N5X A;  1Q10 A;  2RSU A;  5C1Z A;  1FXT B;  3KVF B;  1JWS D;  3BIN A;  2NTT A;  1JWB D;  1OQY A;  3FIL A;  1WGR A;  2KX3 A;  2LZ6 A;  2PMV A;  3ZRF A;  3ETR A;  1HA5 A;  3PZD A;  3KQ4 A;  1WXV A;  4LTU A;  3URY A;  1E0Z A;  1IBX A;  3U30 A;  4RM9 A;  2KFK A;  2CKH B;  1S1Q B;  5J2R A;  2O2V B;  3N1X C;  2C7N B;  3JSV B;  1YN4 A;  4ANV A;  1RYJ A;  1P3Q U;  2E3T A;  1IP9 A;  1TKG A;  2K6Q A;  3PZ7 A;  3RZW C;  3M3J A;  2VZK B;  4RNA A;  3WAM A;  1CMX B;  4EE2 A;  3RNG C;  1SE3 A;  2W3R A;  4AJW A;  2VH1 A;  2XK5 B;  4EZL A;  3MFG A;  4B0E A;  5JZE B;  1V9J A;  2MJ3 A;  3Q3F A;  2GLS A;  1GG3 A;  4GMV A;  4JE3 B;  3ECI A;  4EZK A;  1RFK A;  1L4Z B;  3KW5 B;  3Q2A C;  4GDK A;  1KJT A;  2N9P C;  1E8X A;  2KWD A;  3DCG A;  4MH8 A;  3TCA A;  4WWM A;  2JZ3 B;  1YMH E;  3HVZ A;  3BVZ A;  4M0W A;  4P16 A;  1JW9 D;  4C56 C;  4O1N A;  3H6N A;  1J7A A;  1SE2 A;  2C60 A;  1WJN A;  1JWA D;  2G45 B;  4MAC A;  5LNK 1;  5HHD G;  1EUV B;  4S17 A;  3UIO B;  4MEL A;  4G11 A;  4RCO A;  1C76 A;  3BVG A;  3A9J B;  2AL3 A;  2KD0 A;  2M0X A;  2WLB A;  1DOX A;  4IG7 B;  4BVU C;  2WYQ A;  3ZDT A;  3ZW3 A;  2D10 A;  2Z59 B;  1MFW A;  2IGD A;  1WF9 A;  1PQS A;  2KDF B;  2MJD A;  2I38 A;  1OEY A;  4PYZ A;  1BT0 A;  3RNE C;  4GGQ A;  3ZVV A;  1NEN B;  2AL6 A;  1ZKH A;  3B1L X;  3DVG Y;  2ZZP B;  1PUT A;  4HDQ A;  3EA6 A;  3U2S C;  2ICI A;  4HVB A;  1P9D U;  3BVM A;  1QF6 A;  3UI3 A;  4ZRQ A;  4ANX A;  2MX2 A;  3B0A A;  3NVY A;  2C7H A;  2FBW B;  4K7S A;  4WAA A;  5T8I A;  1J0G A;  5DPT A;  3JSV A;  3VTV A;  1CJE A;  4USA A;  1XD3 B;  1JRU A;  2QC8 A;  5AZF A;  2WXK A;  1NYQ A;  2MBQ A;  3RT3 B;  4NNJ B;  2BTE A;  4DXG A;  3EEC A;  1HXY D;  1XQQ A;  1A5R A;  3S2A A;  2BWF A;  2K9X A;  4HPP A;  1Q5W B;  1V1P B;  3QWZ B;  4RGT A;  4ZDV A;  2RDB C;  1LO5 D;  2BS4 B;  2RD0 A;  4IM0 A;  3UIN B;  3AEG B;  4TMA B;  1ZUD 2;  4XYC A;  2MRP A;  4DXF A;  3AEC B;  4OZB A;  2LHD A;  3PRZ A;  4W9C A;  3AED B;  4W9H A;  2IY0 B;  2QJL A;  1QIL A;  5IN7 A;  1WH3 A;  2OHF A;  4M8N A;  1TGZ B;  2KMM A;  1ZE3 D;  4II2 B;  1MG4 A;  2MP2 B;  2J52 A;  3NS1 A;  5CHF A;  4A55 A;  2V3P A;  1YN5 A;  2J0K A;  2RMM A;  1J7B A;  2IZV B;  2V3S A;  3SFE B;  4ASW C;  2RGF A;  1FMA D;  4XGA B;  2V4I B;  1I4H A;  3PHX B;  5IAA C;  4DK5 A;  3ZNG C;  2LEK A;  4YWG G;  2PVO D;  1E9M A;  2FAZ A;  4XC2 A;  5GMV A;  4D2K A;  3DBL I;  2JXT A;  2QIE B;  4GU2 A;  2J42 A;  4HCN B;  4C7Z A;  2EMT A;  3NZS A;  5CHW A;  3L10 B;  3ZNI D;  2KAN A;  1F9J A;  3M63 B;  2HJ1 A;  2RDG A;  1GJZ A;  4LDT B;  4ARI A;  3PGE A;  2WXR A;  2KWU B;  1C79 A;  1YX5 B;  2DZJ A;  3LYY A;  4WJN A;  3NVZ A;  1UUP A;  3A4R A;  3VQI A;  1FM0 D;  2DWQ A;  2Z0D B;  5DPS A;  4RF1 A;  1PGA A;  5D7G A;  4FHK A;  2ZJD A;  3CIR B;  5BO4 B;  1UGM A;  3TIX A;  4KIK B;  4N58 A;  1F2R C;  1TY0 A;  2JU6 X;  2K5P A;  3DWM A;  4LJO B;  2WDV B;  2CU3 A;  1AAR A;  4HRS A;  2R61 A;  2ZNV C;  5H8Y E;  1UNS A;  4CO7 A;  2KVR A;  1WGG A;  4US8 A;  1YN3 A;  1NVI D;  4DQO C;  2JYE A;  4TUU A;  2KQ4 X;  2HJ8 A;  4IKG A;  1DOI A;  3CWI A;  3V62 A;  3V05 A;  1K50 A;  1NYR A;  3RCZ A;  4B6W A;  4ITK A;  2J7Q B;  4RMA A;  3SDL C;  4HPL B;  4G50 A;  1WX9 A;  1JRP A;  4YSZ B;  4PT5 A;  2KTR B;  3J9C A;  4LLG M;  1FNW A;  2WXM A;  1QQR A;  2V1Y A;  1K53 A;  2ZEQ A;  4R3D A;  2EMS A;  1GUA B;  2UU7 A;  2ON8 A;  2NBU A;  4KGT A;  3MHZ A;  3EGR A;  3AUL A;  1KLV A;  4DHZ B;  3ZLZ A;  1LM8 B;  2KOX A;  2WP9 B;  1VRA B;  3DHH C;  4IC7 B;  2BT6 A;  1LGR A;  3ABV B;  4AOF A;  1WGH A;  3R66 C;  5BYR A;  2PJH A;  2WXN A;  3RUI B;  3OJ3 A;  1EF1 A;  1QLB B;  4IWP A;  4BAX A;  3VUX A;  5E6N A;  4K1R B;  2ZPY A;  3WCQ A;  3N3K B;  3GE8 C;  1I42 A;  2CHZ A;  2FE8 A;  3AXC A;  2WXG A;  2N7E A;  1C9F A;  1AYF A;  4KGS A;  3N30 A;  1KRH A;  4FAD A;  4XE0 A;  1J19 A;  5FK9 C;  1WGD A;  3PV1 A;  3RFZ B;  4W9E A;  4RFB A;  1SGH A;  4RH6 A;  2IDY A;  2CJO A;  5J17 A;  3N1Z C;  3IT4 B;  3O65 B;  2ONQ A;  1FXI A;  2L8J A;  2JVC A;  2FIF A;  3CSF A;  2PVG C;  1TZ1 A;  4PS8 A;  4GB9 A;  3RNB C;  4B0M A;  1QT9 A;  3PHW B;  4K81 A;  4IM3 A;  2KZR A;  3Q8E A;  3Q3N C;  1WX7 A;  1HTQ A;  2MEK A;  2PLP A;  3VH3 B;  1TIF A;  2M56 B;  1UH6 A;  1WXA A;  1WGY A;  2GRI A;  4MSQ B;  1AWD A;  3VTU A;  1V81 A;  2G4S A;  1XEE A;  3DBL B;  2IGH A;  1WMH B;  1YD8 U;  2JWU A;  1C1Y B;  3AE8 B;  1R4M I;  3MJW A;  5EDS A;  2KQ7 A;  5BYQ A;  2WXH A;  1KOT A;  2Y3A A;  5D6J B;  2VH2 A;  3EHV A;  3T3N A;  3PLU A;  4L23 A;  2BW2 A;  3N20 C;  3P4Q B;  1FFV A;  5DPW A;  3ZRC A;  3AE3 B;  5LXH A;  3JYU A;  3NHE B;  2LXC A;  3W5U B;  4HDO A;  1N60 A;  3L08 A;  2LGS A;  2SEB D;  4HWI B;  1YQ3 B;  2R2O A;  1IBX B;  3PS6 A;  4GXB A;  3RD2 A;  1NI3 A;  1HTO A;  1F1H A;  1N62 A;  1OGW A;  3BWU D;  1FNV A;  1FCL A;  2KFK B;  1KFY B;  4J3O D;  3H7S A;  4ZOH C;  2NBV B;  4WWP A;  1JWM D;  1WRI A;  3B2G A;  2XNA C;  4MGI E;  1H4R A;  2JT4 B;  3U7Z A;  3APD A;  2HTM E;  5I4D A;  2KNB A;  3W1Y A;  3RPF C;  2XN9 C; 
#chains in the Genus database with same CATH homology
 1T0S C;  3RNC C;  3RI7 C;  3DHI C;  3Q2A C;  3Q3N C;  2IND C;  3RNE C;  3N1Z C;  3Q3O C;  3Q3M C;  3I63 C;  2RDB C;  3GE8 C;  1T0R C;  3GE3 C;  3N20 C;  3I5J C;  3RNG C;  4P1B C;  3RNB C;  2INC C;  3RN9 C;  3RNF C;  3N1X C;  3DHH C;  4P1C C;  3RMK C;  3N1Y C;  3RNA C;  3Q14 C;  1T0Q C;  3DHG C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...