3RNFC

Structure of the toluene/o-xylene monooxygenase hydroxylase t201s/v271a double mutant
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
85
structure length
85
Chain Sequence
ATFPIMSNFERDFVIQLVPVDTEDTMDQVAEKCAYHSINRRVHPQPEKILRVRRHEDGTLFPRGMIVSDAGLRPTETLDIIFMDN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Toluene o-xylene monooxygenase component
publication title Tracking a defined route for O2 migration in a dioxygen-activating diiron enzyme.
pubmed doi rcsb
source organism Pseudomonas sp. ox1
molecule tags Oxidoreductase
total genus 25
structure length 85
sequence length 85
ec nomenclature ec 1.14.-.-:
pdb deposition date 2011-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF06234 TmoB Toluene-4-monooxygenase system protein B (TmoB)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.270 Alpha Beta Roll Ubiquitin-like (UB roll) TmoB-like 3rnfC00
4P1CC 3I5JC 3RNGC 3GE3C 3RNFC 3N1ZC 1T0RC 3GE8C 3Q3OC 3RMKC 3Q3NC 3RI7C 1T0QC 2RDBC 3Q2AC 1T0SC 3RNAC 3N20C 3RN9C 4P1BC 3DHGC 3DHIC 3RNCC 3Q3MC 3Q14C 2INCC 3N1XC 3DHHC 3RNEC 3I63C 3RNBC 3N1YC 2INDC
chains in the Genus database with same CATH superfamily
2IYDB 1TY0A 1HXYD 2K6DB 4O1NA 3C8YA 5CHWA 4FHKA 3TSSA 4FADA 1GB1A 1E10A 3Q8CA 2MBBB 1C79A 2E3TA 4AJWA 5G5GA 2KD0A 4IWQA 3W2DA 4G0NB 4PS7A 4BBNF 1ENFA 1JMLA 3LYYA 4ZYSA 2VZKB 1OEYA 1XCQL 2IPKD 3B9JA 1ZP0B 1L0YB 1IYFA 2BS4B 3VTVA 2KJRA 3BYTB 4OZAA 3BZDB 1RLFA 1WXQA 2IBIB 2M19A 4M8MA 3N20C 1WGGA 4ACFA 2WXLA 2FCNA 3RNEC 2AWTA 3VDZA 4WH4A 2WGSA 1OTRB 5GMVA 3SDLC 4GDLB 2K8HA 1UGJA 1FD6A 2JYTA 1UH6A 3IAM1 4YT0B 2CR5A 4NJCA 4LNNA 2PIAA 3DOWA 4W9FA 4RNAA 1R4MI 5BYQA 2KJ6A 5G2NA 4JWUC 1TZOA 4RGNA 3GE3C 4FJZA 2A4ZA 3R2TA 2KQ4X 2MHJA 3T3NA 2JQRB 3L54A 3H7SA 4W9JA 4MEMA 1OGWA 2KLGA 4KZCA 3RN9C 3AXCA 2LGSA 1V6EA 1EF1A 3M95A 5E6PA 4J6IA 1A5RA 3DBRB 1WGHA 1SGHA 4W9IA 4YTNB 2FCSA 4JL9A 2M4NA 1GAQB 1WJ4A 1WM2A 3M62B 3KH0A 3VVWB 3DQVA 1DOIA 2LGIA 3APDA 1ZE3D 4ZRIA 1I42A 2J0KA 3B2FA 1JCKB 3AE5B 3O13A 2BYFA 2K25A 2MP2B 4FA6A 1VJKA 4K7UA 2X38A 1V2YA 1SE4A 3ZDMC 2MWSB 2YVCA 2NBUA 3DBHI 2AL3A 3Q3JA 4DHZE 2DZKA 4G50A 1A70A 4HWIB 4ZDVA 2WX1A 2DX5B 3MHSD 4EOYA 2HE7A 3RULA 2LD9A 4HDOA 3C0RB 3PRPB 3QAQA 3H9DA 2ACZB 1WM3A 3GP7A 1LXDA 1J0GA 1YX5B 2GOWA 2Y5PA 2M1MA 2MBEA 3RMKC 1T0QC 4KSKC 1PGAA 1AARA 4RH6A 5AZGA 1WJNA 1P9DU 3DVNU 3DHIC 1C78A 2LUMA 3ML9A 2FCQA 2LHDA 5IKCM 3MC9A 3I63C 4WURA 2IDYA 2ON8A 1C4CA 1ZDVA 2IZVB 3ZGZA 1DOYA 2MLBA 2C5LC 1E7VA 5BO4B 2W3SA 2BYEA 3BWUD 3TL5A 1C76A 1GPXA 1WX8A 2ZJDA 1PUTA 3MC8A 3PTFC 3HM6X 3VRAB 1AWDA 1VCBA 1QZEA 3MP9A 4PYZA 2IGDA 1EWCA 2K39A 4FXCA 3FC4A 3R7QA 2KC2A 4K81A 1BT0A 2N1WA 3AI5A 1T0YA 1IUEA 1FXIA 2L7RA 2NPTA 1P0RA 3RNBC 4L23A 2WDQB 3KVFB 2HDEA 4N9F4 1WJUA 4KIKA 3WCQA 4DDID 1J19A 1UD7A 4FJYA 3N1ZC 5AUKA 2YEPF 3RZFA 3LDZE 3TEWA 2GBRA 3DBSA 1XLQA 4KDIC 2AQ1B 2N9KA 4I6LB 4HXDA 3DBLI 4AS1A 2PVGC 3NS1A 3N30A 1SB3C 1G6JA 4FN2A 4AWJA 4XYCA 2G9HD 2KMCA 3QX1A 3RZWC 3VH3B 2I2YA 1KRHA 2EMSA 1WE7A 1NENB 3AMZA 5D6JB 4PS3A 2DENB 2G1EA 2QILA 3APFA 2CJOA 4J3OD 1JW9D 2MCNB 3U7DA 1ZXIA 2XK5A 4K7WA 4JWSC 4KDLB 2ZW0A 2IY1B 3E56A 3QJZA 3FILB 1IBXB 2BYTA 4KV2A 4US9A 1T0SC 3ZNZB 2FAZA 4OVUA 5IO9A 2FCMA 1WXSA 3QC8B 4E3CA 4MH0E 1T5XD 4MM3B 4JPSA 1SIJA 2L0TA 4KVGB 2PLPA 3AU5A 3DWGC 1N5WA 1L4DB 1XLPA 5DPWA 4TSSA 1T0RC 4OHJA 1WYGA 2W3RA 3T8MA 2RR9A 1L2NA 5IP4D 3A1QA 1V8CA 2KNBA 1BXTA 3A4RA 2C7HA 5G55A 4HKQA 4GDKA 3ZKJC 1SJED 1KLUD 5G5HA 1ZUD2 4IWPA 3ZQ4A 3ZW3A 1EUVB 3R8BA 1YQ3B 3E9SA 4RMAA 3W1YA 2MBQA 1FO4A 3ZIMA 3P2BA 4A3OA 3EA6A 3AE3B 3IG3A 1TTNA 5JZEB 2N0SB 1PQSA 4IM3A 1I4QA 3M3JA 4BKGA 1TKYA 5H92C 1ESFA 2GBNA 2WXQA 3CWIA 1V5OA 2WDTB 3W5UB 2YEPB 4BFRA 3LXFA 2WXOA 4ZHPA 2KC1A 2CKHB 2VH2A 1HTOA 1FRDA 4QAYA 1GC6A 5LNK1 3EFUA 3ABVB 1R4MB 3RYTA 4WWMA 3CMMB 2WXFA 5H8YE 2BPSA 2LMCA 3TMPB 3X0WA 3QA8A 2M0AA 2AX5A 3P4QB 3KYCD 3VQIA 2D10A 1C4AA 1VDVA 3UIOB 2BS2B 4MELA 3TIXA 3PT2B 3LB8C 4M0WA 3VR8B 1SF0A 2JPHA 2WP9B 2KTRB 2NCNA 3FAHA 2GMIC 1XCTL 2JRHA 2KTFA 2TSSA 1RWSA 4IWOA 1FIQA 2MA9B 4BAXA 2NVUI 4ITKA 4PK1A 4HKZE 2MX2A 2EELA 1YN3A 3UGBB 2DAFA 1SEBD 2LI5A 4BZAA 3PLVA 2LHEA 2V4IB 5KHQA 2WQYB 5FR6A 3T3OA 1WGRA 3V60A 3D32A 4LDTD 4S17A 1WR1A 1J7BA 4A6QA 3EUB2 2LJIA 3OJ4B 4Q2JA 3WALA 4EZKA 1LO5D 1FFUA 3KLSX 2EKIA 3VRBB 5CTRC 2ZCBA 4MT5A 4N59A 2V9HA 1GUAB 4P1CC 4W9LA 3CSFA 1F2RI 4A3PA 3Q3OC 2K8CA 3NOBA 3DCGA 2KQSA 3U7ZA 3BVMA 2KO3A 3R3MA 1GNUA 1SE3A 4X57B 1TY2A 1C1YB 1V49A 3AB5A 1D3ZA 1V1PB 2D3BA 4XDCA 3V6EB 3PRMB 1EWYC 4BBNC 4LNOA 4TMAB 1MJDA 4OVZA 1D6EC 3VFKA 5DCNA 1KLGD 4BOSC 1I7HA 5IOIA 4K3BA 1QOBA 3BY4B 4II3B 3KYDD 4ZRKA 2ZPNA 2KDIA 2JU6X 5AZFA 2N4FA 3OAWA 2WXRA 3A9KB 2LGYA 5DPSA 2FUG1 1NDDA 4YXDB 3W1SA 3I5JC 2N9XA 2OJWA 1IBXA 2RPVA 2ASQA 2KX0A 1TYGB 3JW0X 2Z0DB 3KW5B 4MGZE 2BWES 5BYSA 1OQRA 4ASWC 5E6OA 3A33B 4GB9A 4DHJD 4LLGM 3PGEA 4MM3A 3TEYA 1YQ4B 1MHXA 2N7JA 4URKA 2KN4A 5T8IA 2I1JA 1KLVA 1L5PA 4LJPB 2J0JA 1RYJA 2JX5A 4KKJA 4M8NA 3Q8EA 2ZVNA 1E9MA 1UGMA 3IFWB 2I1KA 2WXMA 3Q6BA 3TEXA 3WANA 4AUQC 2KX3A 4GOCA 2KWUB 1QOGA 2KFJA 1OEYJ 2O6VD 4TQ0A 5L95C 1WZ3A 4IM0A 2KN5A 3NVZA 1N62A 3HM3A 1WX9A 4M01A 5E6NA 5EE1A 2N9LA 5DPTA 4HLEA 4JE3B 4HPMB 1WE6A 3HUIA 5DPRA 5FK9C 1PDXA 3PS6A 3AV8A 2CHZA 3NVVA 3AEBB 4MDKE 3RFZB 4US8A 4P1BC 3KUZA 4NJ7A 3V3XA 2K0PA 2MEKA 3KUDB 1KOTA 3B1LX 3P63A 2MJDA 2KMAA 4C7YA 2OEDA 4R3DA 3EFCA 1VZ8A 3JSVA 4WJNA 3PRZA 1VZ6A 4HK2A 2N9EB 1XO3A 5IAAC 4YSYB 5L83A 5LXHA 1SSNA 1UBQA 2KDFB 1QF6A 1KTKA 2D3AA 3EC8A 1XXGA 5E6JA 2FBWB 2V0GA 5C2TB 2PVOD 4N58A 4YL8A 5D3DA 1H4RA 2K3UA 1F1HA 1DOXA 1E6EB 1M4VA 2Z59B 4ICUA 3ETRA 1ZW7A 3NZUA 3GB1A 1JWUD 3P4SB 3V62A 1Q5WB 4XX5A 2UU7A 4NPNA 1HA5A 3P1MA 1K8RB 5EDSA 2CHXA 1YIWA 1TT5B 3ZXRA 3J9CA 3JVZX 2JXXA 4NAWA 2KYWA 3I57A 4ZOHC 4AOFA 4FBJB 2PE9A 4NQLB 1WMHA 1YNTE 3L0WB 1J7CA 2IGGA 1EU4A 2HTHA 2DLBA 2OJRA 1J8CA 4MH8A 2O2VA 2LEKA 2KWCA 1L7YA 4GXBA 2D11A 1PGXA 1XD3B 1MI0A 5GXGB 4AP4C 3L16A 2QHOA 1SXTA 1T6BX 4ZRJA 4LTUA 3SHQA 3W9CB 1IGCA 1FXTB 1EU3A 4ICVA 2LXCA 4ZRQA 3RT3B 1N61A 1HEZE 1YMHE 3AN1A 2Y3AA 1WWTA 4LDTB 2R61A 3V05A 3WAPA 1I4PA 3QHTA 3CIRB 1GJZA 2XEWA 3GS2A 1DYQA 3AEEB 4WJOA 3SFEB 1B1ZA 1Q0WB 3OWEB 2OHFA 1TIFA 1ROEA 2ZNVC 2JYEA 4BKTA 2DYMA 3BVGA 1QOAA 4NY0A 3PZ7A 1RFKA 3AEAB 4HCPB 4WQMA 3QCAA 4P7IA 3GZNI 2M0XA 4LK0M 3WAMA 2H89B 2J42A 4DBGA 2LVOA 3V61A 3DVGY 2INPE 3GOEA 1M94A 2LUEA 2BQQA 1P7FA 3IT6B 3ZDTA 1JRUA 3UIPB 1TS4A 3R2IA 4HROA 2HJ1A 2G3QB 2KAJA 3RPFC 1H8CA 1L0XB 3AEGB 4HJKA 4ANXA 1P1AA 4RM8A 1WIAA 1FFVA 3AEFB 3N3KB 4IW0A 1C9FA 2L05A 3AU4A 3U2SC 4YWGG 1EM7A 2KHWB 1WYWB 3TJPA 1BMLC 1K51A 1FXAA 2WDRB 1RM6C 1ISNA 4DHZB 4GDLA 1QILA 3PO0A 1FEHA 1Z2MA 5EE3A 1WR6E 2CU3A 3URYA 3V6CB 3H7PB 3UQBA 3A9JB 1OQYA 5CX3A 1CJEA 1YX6B 1U4AA 2VZKD 2LFIA 2WXGA 2BGFA 2PMVA 3IHPC 3UQAA 4B0EA 2M56B 4GGQA 1XT9B 3AE7B 2J4XA 2L00B 2WNMA 3P42A 1D5MC 1UWXA 2WXIA 3PSEB 1XF5L 1FCLA 1NI2A 2INDC 2O6VB 2NTSA 4GMVA 2JWZA 4DQOC 1OQQA 1E7PB 1S3SG 4CHKA 1C4PA 1TZ1A 2REXA 3EECA 3VH4B 2DZIA 2M17A 2D3CA 1TBEA 2WYQA 4IUMB 1NEKB 4LCDE 3VTUA 2J53A 1Q10A 2ICIA 2G45B 3N1XC 1XLOA 2KZRA 3TBLD 1WGYA 1HZ5A 2MP2A 4NZLB 4WIPA 2DNFA 3W5VB 3TEZA 1AYFA 2L0FA 2AYOB 4C80A 2Y5CA 5C3JB 1WSPA 1ZPSA 2LWPA 4WJPA 3PV1A 4MJSB 5AEKB 4WWNA 3BIID 4USAA 2DAJA 1NI3A 2AL6A 3RUIB 3TCAA 1RAXA 2MQJA 2W9NA 3NZ3A 3UI3A 2FE8A 4EEWA 3UF8A 4PS8A 1MFWA 3KWLA 1YN5A 2GB1A 2JVCA 3Q8BA 4UDUC 4II2B 4XZ4A 2BKRB 4TUUA 1IP9A 2BB6A 3L17A 4N6EB 1K52A 3QWZB 3GE8C 2RDBC 3RD2A 1PYWD 1YJ1A 3DWMA 4B0MA 2WXKA 2HTME 3MJWA 1YJJA 1D5XC 4MSMB 4HDQA 2K1FA 2M8SA 4ZHOA 3H6NA 1HQRD 3L08A 4GIVA 4RCOA 1TKEA 2ZNVB 1YD8U 4ZRPA 4DK5A 1NYQA 2QDFA 2VH1A 3VUWA 2JZZA 4B6WA 1WX7A 4ANWA 3KQ4A 4C4VB 1I4GA 4PYUA 3DBHB 5BMHA 1UELA 1NBFC 1QOFA 1TKGA 2KVRA 3ENEA 2BF8B 4G3XB 1L6UA 1WI0A 2NTTA 5HI1A 3ZXVA 2SAKA 3SD5A 4BKSA 3JYUA 2N9PC 3NZSA 4LNKA 2FNJB 1AW7A 4M02A 1JROA 1KF6B 2LRWA 2D3GA 4HEA1 4K7SA 1K50A 3O65B 4W9GA 5TR5A 3H8HA 3ECIA 2V3SA 4WQOB 1MPEA 2G4SA 5HHDG 2ZEQA 2MBHA 2JT4B 2L8JA 4NQKE 3ZNHB 1N5XA 4AQ7A 1E90A 1F77A 2CS4A 2JY6A 4IM2A 3A9JA 4DXFA 2BB5A 2NBVB 2N7EA 3FILA 3U52E 5C1ZA 3OLMD 1B9RA 2NR2A 2NBWB 3Q3NC 2RGFA 4KSLC 3IBEA 3CF6E 1FNWA 4BKSD 5JHAA 1P98A 3PHWB 2V3NA 2MRPA 3A4SC 5LLIA 1FRRA 3N1YC 4HCNB 4RGOS 3B0AA 1CK1A 4XC2A 1TS2A 1C77A 3IAS1 3T9LA 1FPYA 3R7RA 3VUYA 2CU1A 3DVGX 4D2KA 4A20A 1F2RC 1D5ZC 2QIEB 4GN1A 4MSQB 3MTNB 5J18A 2EKEC 1ZXHA 3BYYB 2QCZA 4RM9A 1WZ0A 1SE9A 1V5TA 1S1QB 5D7GA 1GOZA 1V1OA 4K3CA 4HRSA 3DBLB 3AE6B 5EE9A 3HHMA 2WDVB 2AEHA 3AECB 3S2AA 1ET9A 2GRIA 5JHBA 3BVZA 4HPPA 3Q3MC 3ZTCA 1YQBA 2H88B 1WGKA 3TUOA 1I4HA 1YN4A 2XBBC 4LNFA 3M63B 4DDGD 2BYVE 3OG5A 1FM0D 2JF5A 4KKIA 1WXAA 4A55A 3BINA 1UUPA 3HRDD 1P7EA 2PJHA 1KFYB 1QQRA 1QKZA 4F7ZA 2ZCCA 1I35A 2X8XX 2NPTB 4WWPA 5J2RA 1R4NI 3NRZA 2INNE 4KIKB 1EO6A 4P16A 1KM7A 2KTRA 2KWDA 1TJEA 2BKFA 2KDBA 3ZRCA 1HZ6A 4XWTA 1TS3A 4C00A 3DHGC 4TQ1A 3R66C 2C7NB 2KOXA 1WXMA 4G11A 4FHJA 1N63A 1E8ZA 4LJOB 1MVKA 1T3QA 2UYZB 3SU8X 4F1SA 4C7ZA 2DBYA 4MGYE 1L4ZB 4NNJB 3B2GA 3C19A 3NHEB 5I4DA 3HK0A 3I3TB 3RNAC 1SIFA 3MHZA 1WF9A 3Q8FA 4K1RB 4C4VA 1UZXB 2LVPA 3W1SC 2XK5B 3Q69A 4JQWC 4W9EA 2L1AA 3EHVA 5CHVC 1GG3A 1KH0A 3ZTDA 1QT9A 2JXTA 1P3QU 3Q8AA 2JRIB 1IGDA 3K9OB 2JSVX 5AZHA 1WY8A 2MJEA 1ZKHA 5BYRA 2KQ7A 2J52A 4YTMB 2DYBA 1XQQA 1ACCA 1Y8RC 1RRBA 4TV3A 4EUTA 2GBMA 1UF0A 3Q14C 3FKYA 1V1PA 5IN7A 2R2QA 3AEDB 2K5PA 1UBIA 2QSDA 3NJTA 4CYEA 5D3IB 2KDEB 4MGKE 2L32A 1YOVB 2IO3B 3A1QB 5KHOA 4JGHB 2XN9C 2Z0EB 2CJNA 3H1UA 4GDKB 4W9KA 3A9KA 1VD2A 3ZO5B 4DWFA 1L6VA 2KVZA 3AH7A 4BOZB 4RGMA 1ZOYB 2JZPA 4IOIE 2ZVOA 4A9AA 2BTEA 3ZVVA 2WLBA 4HPLB 1PGBA 2KFKB 5EE0A 2XNAC 4WAAA 4E74A 4ZYNA 2LGXA 3VXWA 2HD5B 4NAMA 1LGRA 1KJTA 1FCCC 3PREA 4XE0A 5AUIA 3RCZA 1QLBB 2IO1B 3AE2B 1E8XA 2QJLA 2DYOA 4KGRA 2QEJC 2EMTA 3ZNGC 3HVZA 4B95A 4EZJA 1CMXB 1SE2A 3VTWA 2E6XA 2JZ3B 2MBOA 2J7QB 5CHFA 3U30A 4YTPB 1V81A 2DHZA 4M0WB 1STEA 2YLMA 4RF0A 1WJ6A 3RNGC 5JH5C 3UINB 2K8BA 1LFDA 2JUOA 3Q2AC 4WAFA 1WGDA 2L52A 1JRPA 2LVQA 4ANVA 3I9V1 2LZ6A 4KZ0A 2FIFA 3P4PB 2JWUA 3AULA 3WA0A 2WU2B 2GBKA 2KWVB 1SJHD 2D2QA 1EF5A 2GI9A 1JWMD 4A90A 2AQ2B 1K53A 2PEAA 2W82A 2ZPYA 1LM8B 1RFAA 1MG8A 2WU5B 1VR9A 4EZLA 2KKCA 2BS3B 2RPQA 2AQ3B 4OVVA 3ZNID 4FULA 3PHXB 4MACA 2GLSA 1Z5SB 1V9JA 2BVCA 2KJHB 3AE1B 4W9HA 2J0MA 5D2MB 4IC7B 1UNSA 2DWQA 4EKUA 3VUXA 4I6NB 3B08A 1TGZB 2DZMA 1AN8A 1JWAD 2FUHB 3APCA 4DHJB 2V4LA 4KGSA 4F8CB 3MFGA 4HJGE 1UWMA 1CZPA 1MHHE 4L2YA 2MW5A 5HKHA 2ONQA 2L83A 3K9PB 4NJ6A 2RD0A 4ANUA 3NVWA 3PLUA 1WRIA 2W55A 2B3AA 4YSZB 1GC7A 2K6QA 3L10B 2LRUA 2K9XA 2V3PA 2RDHA 3BK2A 1Y56A 2C7MB 2D5GA 2V1YA 3PVLA 2IJ0A 3VHTC 2KLCA 1E7UA 4KX6B 3IT4B 1HTQA 1IPGA 1JALA 5HFYA 1ZGUB 4MGIE 1L0VB 1E0ZA 2K22A 3CSTA 3ZUNA 2QMTA 3SFDB 4IG7B 2FIDA 2KT7A 4YSXB 1V80A 2HJ8A 2I38A 5LXIB 2WS3B 3IVFA 1JQ4A 1FNVA 1D4BA 2WWZA 2C60A 3PPAA 3AE8B 1HE8A 1R4NB 4EE2A 4EFOA 1PFDA 4S0RA 3QQ8B 4WWOA 5HG2A 4IDIA 3QIJA 3QK0A 4RF1A 1V86A 3L13A 4XGAB 4TKNA 4C56C 1JWSD 3PZ8A 2A5UA 3WAOA 1LQBA 4JIOU 5TSSA 1E5WA 4P6VF 2KANA 2SEBD 2RSUA 3DVNV 1SBBB 3DBRI 1BUIC 2KFKA 2W54A 3MJ5A 3N32A 1DGJA 4W9CA 3HVDA 3ZYYX 2IY0B 3P4RB 1WH3A 2KK8A 5BMIA 1WFYA 1OFFA 2RDGA 4WJQA 2PTLA 4ARCA 4IKGA 2IGHA 3IXSA 3HIZA 2RMMA 1NYRA 3NVYA 2PKOA 2IO2B 3KUCB 1X1MA 2L76A 3SEBA 4CO7A 4OW0A 4PT5A 1J7AA 2LXAA 4XWWA 3OJ3A 3PZDA 1I4RA 2PE6B 3RNCC 3N9YC 3X23A 2GBJA 2Y5BB 2L3ZA 1VLBA 1VZ7A 4HVBA 3JSVB 4CQNA 1GB4A 4FJVB 2KXJA 1E8WA 1R7SA 3SR6A 2WHIA 4L1BA 4B9KA 1WXVA 4LNIA 2KMMA 5D94A 4OZCA 3EGRA 2OOBB 3MC0B 3LJ3A 1N6ZA 3RNFC 1ZDXA 1FNUA 3VR9B 1ET6A 2ZZPB 1I4XA 3AE4B 1C3TA 3ZJUA 4XDDA 2NS5A 4W9DA 3NG0A 3Q3FA 2UWQA 2B76B 2PW9A 2Z8LA 4DXGA 4E71A 2LGDA 2LASA 4I6PA 1XEEA 4NAWB 2MH7A 4ARIA 2MJ3A 1WMHB 3NUHB 4RGTA 3NS8A 4FLHA 2CHWA 4JLCA 1XLNA 3H7PA 4REZA 2LJ5A 2BW2A 5MPOA 1MG4A 4GU2A 1FMAD 2VRRB 4GLSC 2KACA 1TS5A 3AM9A 4KGTA 2MSED 1YJIA 2O2VB 2R2OA 4OZBA 3RI7C 3NY5A 2WXPA 3VAWA 2WXNA 2WXJA 3ZLZA 2ZW1A 2NMQA 5FR3A 1F52A 2BBCA 1JWBD 5C23A 4JX1C 3L4PA 3GZNB 2INCC 5FKAC 3DDCB 1F9JA 2O6VA 4BVUC 3DPDA 1N60A 2KDMA 2WXHA 2D07B 1Q1OA 5JXVA 3ZJTA 4H2AA 2PPHA 2QC8A 4AJYB 2DZJA 4GSWA 3ZRFA 5J17A 3U4EG 2C9WB 2N7DA 3ZJVA 1CQVA 2Q5WD 3ML8A 3BK1A 1F0ZA 2BT6A 4DXAB 1WRDB 2WX0A 2IO0B 5BMGA 1VRAB 2BWFA 1V97A 1E8YA 3KWVA 3ALBA 2N1VA 5IA7A 1NVID 3U8ZA 3AE9B 4RFBA 3DHHC 4MJSA 3QARA 4M00A 3WIMA 4A8XC 2G4DB 3ONSA
chains in the Genus database with same CATH topology
4P1CC 3I5JC 3RNGC 3GE3C 3RNFC 3N1ZC 1T0RC 3GE8C 3Q3OC 3RMKC 3Q3NC 3RI7C 1T0QC 2RDBC 3Q2AC 1T0SC 3RNAC 3N20C 3RN9C 4P1BC 3DHGC 3DHIC 3RNCC 3Q3MC 3Q14C 2INCC 3N1XC 3DHHC 3RNEC 3I63C 3RNBC 3N1YC 2INDC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P1C C;  3I5J C;  3RNG C;  3GE3 C;  3RNF C;  3N1Z C;  1T0R C;  3GE8 C;  3Q3O C;  3RMK C;  3Q3N C;  3RI7 C;  1T0Q C;  2RDB C;  3Q2A C;  1T0S C;  3RNA C;  3N20 C;  3RN9 C;  4P1B C;  3DHG C;  3DHI C;  3RNC C;  3Q3M C;  3Q14 C;  2INC C;  3N1X C;  3DHH C;  3RNE C;  3I63 C;  3RNB C;  3N1Y C;  2IND C; 
#chains in the Genus database with same CATH topology
 2IYD B;  1TY0 A;  1HXY D;  2K6D B;  4O1N A;  3C8Y A;  5CHW A;  4FHK A;  3TSS A;  4FAD A;  1GB1 A;  1E10 A;  3Q8C A;  2MBB B;  1C79 A;  2E3T A;  4AJW A;  5G5G A;  2KD0 A;  4IWQ A;  3W2D A;  4G0N B;  4PS7 A;  4BBN F;  1ENF A;  1JML A;  3LYY A;  4ZYS A;  2VZK B;  1OEY A;  1XCQ L;  2IPK D;  3B9J A;  1ZP0 B;  1L0Y B;  1IYF A;  2BS4 B;  3VTV A;  2KJR A;  3BYT B;  4OZA A;  3BZD B;  1RLF A;  1WXQ A;  2IBI B;  2M19 A;  4M8M A;  3N20 C;  1WGG A;  4ACF A;  2WXL A;  2FCN A;  3RNE C;  2AWT A;  3VDZ A;  4WH4 A;  2WGS A;  1OTR B;  5GMV A;  3SDL C;  4GDL B;  2K8H A;  1UGJ A;  1FD6 A;  2JYT A;  1UH6 A;  3IAM 1;  4YT0 B;  2CR5 A;  4NJC A;  4LNN A;  2PIA A;  3DOW A;  4W9F A;  4RNA A;  1R4M I;  5BYQ A;  2KJ6 A;  5G2N A;  4JWU C;  1TZO A;  4RGN A;  3GE3 C;  4FJZ A;  2A4Z A;  3R2T A;  2KQ4 X;  2MHJ A;  3T3N A;  2JQR B;  3L54 A;  3H7S A;  4W9J A;  4MEM A;  1OGW A;  2KLG A;  4KZC A;  3RN9 C;  3AXC A;  2LGS A;  1V6E A;  1EF1 A;  3M95 A;  5E6P A;  4J6I A;  1A5R A;  3DBR B;  1WGH A;  1SGH A;  4W9I A;  4YTN B;  2FCS A;  4JL9 A;  2M4N A;  1GAQ B;  1WJ4 A;  1WM2 A;  3M62 B;  3KH0 A;  3VVW B;  3DQV A;  1DOI A;  2LGI A;  3APD A;  1ZE3 D;  4ZRI A;  1I42 A;  2J0K A;  3B2F A;  1JCK B;  3AE5 B;  3O13 A;  2BYF A;  2K25 A;  2MP2 B;  4FA6 A;  1VJK A;  4K7U A;  2X38 A;  1V2Y A;  1SE4 A;  3ZDM C;  2MWS B;  2YVC A;  2NBU A;  3DBH I;  2AL3 A;  3Q3J A;  4DHZ E;  2DZK A;  4G50 A;  1A70 A;  4HWI B;  4ZDV A;  2WX1 A;  2DX5 B;  3MHS D;  4EOY A;  2HE7 A;  3RUL A;  2LD9 A;  4HDO A;  3C0R B;  3PRP B;  3QAQ A;  3H9D A;  2ACZ B;  1WM3 A;  3GP7 A;  1LXD A;  1J0G A;  1YX5 B;  2GOW A;  2Y5P A;  2M1M A;  2MBE A;  3RMK C;  1T0Q C;  4KSK C;  1PGA A;  1AAR A;  4RH6 A;  5AZG A;  1WJN A;  1P9D U;  3DVN U;  3DHI C;  1C78 A;  2LUM A;  3ML9 A;  2FCQ A;  2LHD A;  5IKC M;  3MC9 A;  3I63 C;  4WUR A;  2IDY A;  2ON8 A;  1C4C A;  1ZDV A;  2IZV B;  3ZGZ A;  1DOY A;  2MLB A;  2C5L C;  1E7V A;  5BO4 B;  2W3S A;  2BYE A;  3BWU D;  3TL5 A;  1C76 A;  1GPX A;  1WX8 A;  2ZJD A;  1PUT A;  3MC8 A;  3PTF C;  3HM6 X;  3VRA B;  1AWD A;  1VCB A;  1QZE A;  3MP9 A;  4PYZ A;  2IGD A;  1EWC A;  2K39 A;  4FXC A;  3FC4 A;  3R7Q A;  2KC2 A;  4K81 A;  1BT0 A;  2N1W A;  3AI5 A;  1T0Y A;  1IUE A;  1FXI A;  2L7R A;  2NPT A;  1P0R A;  3RNB C;  4L23 A;  2WDQ B;  3KVF B;  2HDE A;  4N9F 4;  1WJU A;  4KIK A;  3WCQ A;  4DDI D;  1J19 A;  1UD7 A;  4FJY A;  3N1Z C;  5AUK A;  2YEP F;  3RZF A;  3LDZ E;  3TEW A;  2GBR A;  3DBS A;  1XLQ A;  4KDI C;  2AQ1 B;  2N9K A;  4I6L B;  4HXD A;  3DBL I;  4AS1 A;  2PVG C;  3NS1 A;  3N30 A;  1SB3 C;  1G6J A;  4FN2 A;  4AWJ A;  4XYC A;  2G9H D;  2KMC A;  3QX1 A;  3RZW C;  3VH3 B;  2I2Y A;  1KRH A;  2EMS A;  1WE7 A;  1NEN B;  3AMZ A;  5D6J B;  4PS3 A;  2DEN B;  2G1E A;  2QIL A;  3APF A;  2CJO A;  4J3O D;  1JW9 D;  2MCN B;  3U7D A;  1ZXI A;  2XK5 A;  4K7W A;  4JWS C;  4KDL B;  2ZW0 A;  2IY1 B;  3E56 A;  3QJZ A;  3FIL B;  1IBX B;  2BYT A;  4KV2 A;  4US9 A;  1T0S C;  3ZNZ B;  2FAZ A;  4OVU A;  5IO9 A;  2FCM A;  1WXS A;  3QC8 B;  4E3C A;  4MH0 E;  1T5X D;  4MM3 B;  4JPS A;  1SIJ A;  2L0T A;  4KVG B;  2PLP A;  3AU5 A;  3DWG C;  1N5W A;  1L4D B;  1XLP A;  5DPW A;  4TSS A;  1T0R C;  4OHJ A;  1WYG A;  2W3R A;  3T8M A;  2RR9 A;  1L2N A;  5IP4 D;  3A1Q A;  1V8C A;  2KNB A;  1BXT A;  3A4R A;  2C7H A;  5G55 A;  4HKQ A;  4GDK A;  3ZKJ C;  1SJE D;  1KLU D;  5G5H A;  1ZUD 2;  4IWP A;  3ZQ4 A;  3ZW3 A;  1EUV B;  3R8B A;  1YQ3 B;  3E9S A;  4RMA A;  3W1Y A;  2MBQ A;  1FO4 A;  3ZIM A;  3P2B A;  4A3O A;  3EA6 A;  3AE3 B;  3IG3 A;  1TTN A;  5JZE B;  2N0S B;  1PQS A;  4IM3 A;  1I4Q A;  3M3J A;  4BKG A;  1TKY A;  5H92 C;  1ESF A;  2GBN A;  2WXQ A;  3CWI A;  1V5O A;  2WDT B;  3W5U B;  2YEP B;  4BFR A;  3LXF A;  2WXO A;  4ZHP A;  2KC1 A;  2CKH B;  2VH2 A;  1HTO A;  1FRD A;  4QAY A;  1GC6 A;  5LNK 1;  3EFU A;  3ABV B;  1R4M B;  3RYT A;  4WWM A;  3CMM B;  2WXF A;  5H8Y E;  2BPS A;  2LMC A;  3TMP B;  3X0W A;  3QA8 A;  2M0A A;  2AX5 A;  3P4Q B;  3KYC D;  3VQI A;  2D10 A;  1C4A A;  1VDV A;  3UIO B;  2BS2 B;  4MEL A;  3TIX A;  3PT2 B;  3LB8 C;  4M0W A;  3VR8 B;  1SF0 A;  2JPH A;  2WP9 B;  2KTR B;  2NCN A;  3FAH A;  2GMI C;  1XCT L;  2JRH A;  2KTF A;  2TSS A;  1RWS A;  4IWO A;  1FIQ A;  2MA9 B;  4BAX A;  2NVU I;  4ITK A;  4PK1 A;  4HKZ E;  2MX2 A;  2EEL A;  1YN3 A;  3UGB B;  2DAF A;  1SEB D;  2LI5 A;  4BZA A;  3PLV A;  2LHE A;  2V4I B;  5KHQ A;  2WQY B;  5FR6 A;  3T3O A;  1WGR A;  3V60 A;  3D32 A;  4LDT D;  4S17 A;  1WR1 A;  1J7B A;  4A6Q A;  3EUB 2;  2LJI A;  3OJ4 B;  4Q2J A;  3WAL A;  4EZK A;  1LO5 D;  1FFU A;  3KLS X;  2EKI A;  3VRB B;  5CTR C;  2ZCB A;  4MT5 A;  4N59 A;  2V9H A;  1GUA B;  4P1C C;  4W9L A;  3CSF A;  1F2R I;  4A3P A;  3Q3O C;  2K8C A;  3NOB A;  3DCG A;  2KQS A;  3U7Z A;  3BVM A;  2KO3 A;  3R3M A;  1GNU A;  1SE3 A;  4X57 B;  1TY2 A;  1C1Y B;  1V49 A;  3AB5 A;  1D3Z A;  1V1P B;  2D3B A;  4XDC A;  3V6E B;  3PRM B;  1EWY C;  4BBN C;  4LNO A;  4TMA B;  1MJD A;  4OVZ A;  1D6E C;  3VFK A;  5DCN A;  1KLG D;  4BOS C;  1I7H A;  5IOI A;  4K3B A;  1QOB A;  3BY4 B;  4II3 B;  3KYD D;  4ZRK A;  2ZPN A;  2KDI A;  2JU6 X;  5AZF A;  2N4F A;  3OAW A;  2WXR A;  3A9K B;  2LGY A;  5DPS A;  2FUG 1;  1NDD A;  4YXD B;  3W1S A;  3I5J C;  2N9X A;  2OJW A;  1IBX A;  2RPV A;  2ASQ A;  2KX0 A;  1TYG B;  3JW0 X;  2Z0D B;  3KW5 B;  4MGZ E;  2BWE S;  5BYS A;  1OQR A;  4ASW C;  5E6O A;  3A33 B;  4GB9 A;  4DHJ D;  4LLG M;  3PGE A;  4MM3 A;  3TEY A;  1YQ4 B;  1MHX A;  2N7J A;  4URK A;  2KN4 A;  5T8I A;  2I1J A;  1KLV A;  1L5P A;  4LJP B;  2J0J A;  1RYJ A;  2JX5 A;  4KKJ A;  4M8N A;  3Q8E A;  2ZVN A;  1E9M A;  1UGM A;  3IFW B;  2I1K A;  2WXM A;  3Q6B A;  3TEX A;  3WAN A;  4AUQ C;  2KX3 A;  4GOC A;  2KWU B;  1QOG A;  2KFJ A;  1OEY J;  2O6V D;  4TQ0 A;  5L95 C;  1WZ3 A;  4IM0 A;  2KN5 A;  3NVZ A;  1N62 A;  3HM3 A;  1WX9 A;  4M01 A;  5E6N A;  5EE1 A;  2N9L A;  5DPT A;  4HLE A;  4JE3 B;  4HPM B;  1WE6 A;  3HUI A;  5DPR A;  5FK9 C;  1PDX A;  3PS6 A;  3AV8 A;  2CHZ A;  3NVV A;  3AEB B;  4MDK E;  3RFZ B;  4US8 A;  4P1B C;  3KUZ A;  4NJ7 A;  3V3X A;  2K0P A;  2MEK A;  3KUD B;  1KOT A;  3B1L X;  3P63 A;  2MJD A;  2KMA A;  4C7Y A;  2OED A;  4R3D A;  3EFC A;  1VZ8 A;  3JSV A;  4WJN A;  3PRZ A;  1VZ6 A;  4HK2 A;  2N9E B;  1XO3 A;  5IAA C;  4YSY B;  5L83 A;  5LXH A;  1SSN A;  1UBQ A;  2KDF B;  1QF6 A;  1KTK A;  2D3A A;  3EC8 A;  1XXG A;  5E6J A;  2FBW B;  2V0G A;  5C2T B;  2PVO D;  4N58 A;  4YL8 A;  5D3D A;  1H4R A;  2K3U A;  1F1H A;  1DOX A;  1E6E B;  1M4V A;  2Z59 B;  4ICU A;  3ETR A;  1ZW7 A;  3NZU A;  3GB1 A;  1JWU D;  3P4S B;  3V62 A;  1Q5W B;  4XX5 A;  2UU7 A;  4NPN A;  1HA5 A;  3P1M A;  1K8R B;  5EDS A;  2CHX A;  1YIW A;  1TT5 B;  3ZXR A;  3J9C A;  3JVZ X;  2JXX A;  4NAW A;  2KYW A;  3I57 A;  4ZOH C;  4AOF A;  4FBJ B;  2PE9 A;  4NQL B;  1WMH A;  1YNT E;  3L0W B;  1J7C A;  2IGG A;  1EU4 A;  2HTH A;  2DLB A;  2OJR A;  1J8C A;  4MH8 A;  2O2V A;  2LEK A;  2KWC A;  1L7Y A;  4GXB A;  2D11 A;  1PGX A;  1XD3 B;  1MI0 A;  5GXG B;  4AP4 C;  3L16 A;  2QHO A;  1SXT A;  1T6B X;  4ZRJ A;  4LTU A;  3SHQ A;  3W9C B;  1IGC A;  1FXT B;  1EU3 A;  4ICV A;  2LXC A;  4ZRQ A;  3RT3 B;  1N61 A;  1HEZ E;  1YMH E;  3AN1 A;  2Y3A A;  1WWT A;  4LDT B;  2R61 A;  3V05 A;  3WAP A;  1I4P A;  3QHT A;  3CIR B;  1GJZ A;  2XEW A;  3GS2 A;  1DYQ A;  3AEE B;  4WJO A;  3SFE B;  1B1Z A;  1Q0W B;  3OWE B;  2OHF A;  1TIF A;  1ROE A;  2ZNV C;  2JYE A;  4BKT A;  2DYM A;  3BVG A;  1QOA A;  4NY0 A;  3PZ7 A;  1RFK A;  3AEA B;  4HCP B;  4WQM A;  3QCA A;  4P7I A;  3GZN I;  2M0X A;  4LK0 M;  3WAM A;  2H89 B;  2J42 A;  4DBG A;  2LVO A;  3V61 A;  3DVG Y;  2INP E;  3GOE A;  1M94 A;  2LUE A;  2BQQ A;  1P7F A;  3IT6 B;  3ZDT A;  1JRU A;  3UIP B;  1TS4 A;  3R2I A;  4HRO A;  2HJ1 A;  2G3Q B;  2KAJ A;  3RPF C;  1H8C A;  1L0X B;  3AEG B;  4HJK A;  4ANX A;  1P1A A;  4RM8 A;  1WIA A;  1FFV A;  3AEF B;  3N3K B;  4IW0 A;  1C9F A;  2L05 A;  3AU4 A;  3U2S C;  4YWG G;  1EM7 A;  2KHW B;  1WYW B;  3TJP A;  1BML C;  1K51 A;  1FXA A;  2WDR B;  1RM6 C;  1ISN A;  4DHZ B;  4GDL A;  1QIL A;  3PO0 A;  1FEH A;  1Z2M A;  5EE3 A;  1WR6 E;  2CU3 A;  3URY A;  3V6C B;  3H7P B;  3UQB A;  3A9J B;  1OQY A;  5CX3 A;  1CJE A;  1YX6 B;  1U4A A;  2VZK D;  2LFI A;  2WXG A;  2BGF A;  2PMV A;  3IHP C;  3UQA A;  4B0E A;  2M56 B;  4GGQ A;  1XT9 B;  3AE7 B;  2J4X A;  2L00 B;  2WNM A;  3P42 A;  1D5M C;  1UWX A;  2WXI A;  3PSE B;  1XF5 L;  1FCL A;  1NI2 A;  2IND C;  2O6V B;  2NTS A;  4GMV A;  2JWZ A;  4DQO C;  1OQQ A;  1E7P B;  1S3S G;  4CHK A;  1C4P A;  1TZ1 A;  2REX A;  3EEC A;  3VH4 B;  2DZI A;  2M17 A;  2D3C A;  1TBE A;  2WYQ A;  4IUM B;  1NEK B;  4LCD E;  3VTU A;  2J53 A;  1Q10 A;  2ICI A;  2G45 B;  3N1X C;  1XLO A;  2KZR A;  3TBL D;  1WGY A;  1HZ5 A;  2MP2 A;  4NZL B;  4WIP A;  2DNF A;  3W5V B;  3TEZ A;  1AYF A;  2L0F A;  2AYO B;  4C80 A;  2Y5C A;  5C3J B;  1WSP A;  1ZPS A;  2LWP A;  4WJP A;  3PV1 A;  4MJS B;  5AEK B;  4WWN A;  3BII D;  4USA A;  2DAJ A;  1NI3 A;  2AL6 A;  3RUI B;  3TCA A;  1RAX A;  2MQJ A;  2W9N A;  3NZ3 A;  3UI3 A;  2FE8 A;  4EEW A;  3UF8 A;  4PS8 A;  1MFW A;  3KWL A;  1YN5 A;  2GB1 A;  2JVC A;  3Q8B A;  4UDU C;  4II2 B;  4XZ4 A;  2BKR B;  4TUU A;  1IP9 A;  2BB6 A;  3L17 A;  4N6E B;  1K52 A;  3QWZ B;  3GE8 C;  2RDB C;  3RD2 A;  1PYW D;  1YJ1 A;  3DWM A;  4B0M A;  2WXK A;  2HTM E;  3MJW A;  1YJJ A;  1D5X C;  4MSM B;  4HDQ A;  2K1F A;  2M8S A;  4ZHO A;  3H6N A;  1HQR D;  3L08 A;  4GIV A;  4RCO A;  1TKE A;  2ZNV B;  1YD8 U;  4ZRP A;  4DK5 A;  1NYQ A;  2QDF A;  2VH1 A;  3VUW A;  2JZZ A;  4B6W A;  1WX7 A;  4ANW A;  3KQ4 A;  4C4V B;  1I4G A;  4PYU A;  3DBH B;  5BMH A;  1UEL A;  1NBF C;  1QOF A;  1TKG A;  2KVR A;  3ENE A;  2BF8 B;  4G3X B;  1L6U A;  1WI0 A;  2NTT A;  5HI1 A;  3ZXV A;  2SAK A;  3SD5 A;  4BKS A;  3JYU A;  2N9P C;  3NZS A;  4LNK A;  2FNJ B;  1AW7 A;  4M02 A;  1JRO A;  1KF6 B;  2LRW A;  2D3G A;  4HEA 1;  4K7S A;  1K50 A;  3O65 B;  4W9G A;  5TR5 A;  3H8H A;  3ECI A;  2V3S A;  4WQO B;  1MPE A;  2G4S A;  5HHD G;  2ZEQ A;  2MBH A;  2JT4 B;  2L8J A;  4NQK E;  3ZNH B;  1N5X A;  4AQ7 A;  1E90 A;  1F77 A;  2CS4 A;  2JY6 A;  4IM2 A;  3A9J A;  4DXF A;  2BB5 A;  2NBV B;  2N7E A;  3FIL A;  3U52 E;  5C1Z A;  3OLM D;  1B9R A;  2NR2 A;  2NBW B;  3Q3N C;  2RGF A;  4KSL C;  3IBE A;  3CF6 E;  1FNW A;  4BKS D;  5JHA A;  1P98 A;  3PHW B;  2V3N A;  2MRP A;  3A4S C;  5LLI A;  1FRR A;  3N1Y C;  4HCN B;  4RGO S;  3B0A A;  1CK1 A;  4XC2 A;  1TS2 A;  1C77 A;  3IAS 1;  3T9L A;  1FPY A;  3R7R A;  3VUY A;  2CU1 A;  3DVG X;  4D2K A;  4A20 A;  1F2R C;  1D5Z C;  2QIE B;  4GN1 A;  4MSQ B;  3MTN B;  5J18 A;  2EKE C;  1ZXH A;  3BYY B;  2QCZ A;  4RM9 A;  1WZ0 A;  1SE9 A;  1V5T A;  1S1Q B;  5D7G A;  1GOZ A;  1V1O A;  4K3C A;  4HRS A;  3DBL B;  3AE6 B;  5EE9 A;  3HHM A;  2WDV B;  2AEH A;  3AEC B;  3S2A A;  1ET9 A;  2GRI A;  5JHB A;  3BVZ A;  4HPP A;  3Q3M C;  3ZTC A;  1YQB A;  2H88 B;  1WGK A;  3TUO A;  1I4H A;  1YN4 A;  2XBB C;  4LNF A;  3M63 B;  4DDG D;  2BYV E;  3OG5 A;  1FM0 D;  2JF5 A;  4KKI A;  1WXA A;  4A55 A;  3BIN A;  1UUP A;  3HRD D;  1P7E A;  2PJH A;  1KFY B;  1QQR A;  1QKZ A;  4F7Z A;  2ZCC A;  1I35 A;  2X8X X;  2NPT B;  4WWP A;  5J2R A;  1R4N I;  3NRZ A;  2INN E;  4KIK B;  1EO6 A;  4P16 A;  1KM7 A;  2KTR A;  2KWD A;  1TJE A;  2BKF A;  2KDB A;  3ZRC A;  1HZ6 A;  4XWT A;  1TS3 A;  4C00 A;  3DHG C;  4TQ1 A;  3R66 C;  2C7N B;  2KOX A;  1WXM A;  4G11 A;  4FHJ A;  1N63 A;  1E8Z A;  4LJO B;  1MVK A;  1T3Q A;  2UYZ B;  3SU8 X;  4F1S A;  4C7Z A;  2DBY A;  4MGY E;  1L4Z B;  4NNJ B;  3B2G A;  3C19 A;  3NHE B;  5I4D A;  3HK0 A;  3I3T B;  3RNA C;  1SIF A;  3MHZ A;  1WF9 A;  3Q8F A;  4K1R B;  4C4V A;  1UZX B;  2LVP A;  3W1S C;  2XK5 B;  3Q69 A;  4JQW C;  4W9E A;  2L1A A;  3EHV A;  5CHV C;  1GG3 A;  1KH0 A;  3ZTD A;  1QT9 A;  2JXT A;  1P3Q U;  3Q8A A;  2JRI B;  1IGD A;  3K9O B;  2JSV X;  5AZH A;  1WY8 A;  2MJE A;  1ZKH A;  5BYR A;  2KQ7 A;  2J52 A;  4YTM B;  2DYB A;  1XQQ A;  1ACC A;  1Y8R C;  1RRB A;  4TV3 A;  4EUT A;  2GBM A;  1UF0 A;  3Q14 C;  3FKY A;  1V1P A;  5IN7 A;  2R2Q A;  3AED B;  2K5P A;  1UBI A;  2QSD A;  3NJT A;  4CYE A;  5D3I B;  2KDE B;  4MGK E;  2L32 A;  1YOV B;  2IO3 B;  3A1Q B;  5KHO A;  4JGH B;  2XN9 C;  2Z0E B;  2CJN A;  3H1U A;  4GDK B;  4W9K A;  3A9K A;  1VD2 A;  3ZO5 B;  4DWF A;  1L6V A;  2KVZ A;  3AH7 A;  4BOZ B;  4RGM A;  1ZOY B;  2JZP A;  4IOI E;  2ZVO A;  4A9A A;  2BTE A;  3ZVV A;  2WLB A;  4HPL B;  1PGB A;  2KFK B;  5EE0 A;  2XNA C;  4WAA A;  4E74 A;  4ZYN A;  2LGX A;  3VXW A;  2HD5 B;  4NAM A;  1LGR A;  1KJT A;  1FCC C;  3PRE A;  4XE0 A;  5AUI A;  3RCZ A;  1QLB B;  2IO1 B;  3AE2 B;  1E8X A;  2QJL A;  2DYO A;  4KGR A;  2QEJ C;  2EMT A;  3ZNG C;  3HVZ A;  4B95 A;  4EZJ A;  1CMX B;  1SE2 A;  3VTW A;  2E6X A;  2JZ3 B;  2MBO A;  2J7Q B;  5CHF A;  3U30 A;  4YTP B;  1V81 A;  2DHZ A;  4M0W B;  1STE A;  2YLM A;  4RF0 A;  1WJ6 A;  3RNG C;  5JH5 C;  3UIN B;  2K8B A;  1LFD A;  2JUO A;  3Q2A C;  4WAF A;  1WGD A;  2L52 A;  1JRP A;  2LVQ A;  4ANV A;  3I9V 1;  2LZ6 A;  4KZ0 A;  2FIF A;  3P4P B;  2JWU A;  3AUL A;  3WA0 A;  2WU2 B;  2GBK A;  2KWV B;  1SJH D;  2D2Q A;  1EF5 A;  2GI9 A;  1JWM D;  4A90 A;  2AQ2 B;  1K53 A;  2PEA A;  2W82 A;  2ZPY A;  1LM8 B;  1RFA A;  1MG8 A;  2WU5 B;  1VR9 A;  4EZL A;  2KKC A;  2BS3 B;  2RPQ A;  2AQ3 B;  4OVV A;  3ZNI D;  4FUL A;  3PHX B;  4MAC A;  2GLS A;  1Z5S B;  1V9J A;  2BVC A;  2KJH B;  3AE1 B;  4W9H A;  2J0M A;  5D2M B;  4IC7 B;  1UNS A;  2DWQ A;  4EKU A;  3VUX A;  4I6N B;  3B08 A;  1TGZ B;  2DZM A;  1AN8 A;  1JWA D;  2FUH B;  3APC A;  4DHJ B;  2V4L A;  4KGS A;  4F8C B;  3MFG A;  4HJG E;  1UWM A;  1CZP A;  1MHH E;  4L2Y A;  2MW5 A;  5HKH A;  2ONQ A;  2L83 A;  3K9P B;  4NJ6 A;  2RD0 A;  4ANU A;  3NVW A;  3PLU A;  1WRI A;  2W55 A;  2B3A A;  4YSZ B;  1GC7 A;  2K6Q A;  3L10 B;  2LRU A;  2K9X A;  2V3P A;  2RDH A;  3BK2 A;  1Y56 A;  2C7M B;  2D5G A;  2V1Y A;  3PVL A;  2IJ0 A;  3VHT C;  2KLC A;  1E7U A;  4KX6 B;  3IT4 B;  1HTQ A;  1IPG A;  1JAL A;  5HFY A;  1ZGU B;  4MGI E;  1L0V B;  1E0Z A;  2K22 A;  3CST A;  3ZUN A;  2QMT A;  3SFD B;  4IG7 B;  2FID A;  2KT7 A;  4YSX B;  1V80 A;  2HJ8 A;  2I38 A;  5LXI B;  2WS3 B;  3IVF A;  1JQ4 A;  1FNV A;  1D4B A;  2WWZ A;  2C60 A;  3PPA A;  3AE8 B;  1HE8 A;  1R4N B;  4EE2 A;  4EFO A;  1PFD A;  4S0R A;  3QQ8 B;  4WWO A;  5HG2 A;  4IDI A;  3QIJ A;  3QK0 A;  4RF1 A;  1V86 A;  3L13 A;  4XGA B;  4TKN A;  4C56 C;  1JWS D;  3PZ8 A;  2A5U A;  3WAO A;  1LQB A;  4JIO U;  5TSS A;  1E5W A;  4P6V F;  2KAN A;  2SEB D;  2RSU A;  3DVN V;  1SBB B;  3DBR I;  1BUI C;  2KFK A;  2W54 A;  3MJ5 A;  3N32 A;  1DGJ A;  4W9C A;  3HVD A;  3ZYY X;  2IY0 B;  3P4R B;  1WH3 A;  2KK8 A;  5BMI A;  1WFY A;  1OFF A;  2RDG A;  4WJQ A;  2PTL A;  4ARC A;  4IKG A;  2IGH A;  3IXS A;  3HIZ A;  2RMM A;  1NYR A;  3NVY A;  2PKO A;  2IO2 B;  3KUC B;  1X1M A;  2L76 A;  3SEB A;  4CO7 A;  4OW0 A;  4PT5 A;  1J7A A;  2LXA A;  4XWW A;  3OJ3 A;  3PZD A;  1I4R A;  2PE6 B;  3RNC C;  3N9Y C;  3X23 A;  2GBJ A;  2Y5B B;  2L3Z A;  1VLB A;  1VZ7 A;  4HVB A;  3JSV B;  4CQN A;  1GB4 A;  4FJV B;  2KXJ A;  1E8W A;  1R7S A;  3SR6 A;  2WHI A;  4L1B A;  4B9K A;  1WXV A;  4LNI A;  2KMM A;  5D94 A;  4OZC A;  3EGR A;  2OOB B;  3MC0 B;  3LJ3 A;  1N6Z A;  3RNF C;  1ZDX A;  1FNU A;  3VR9 B;  1ET6 A;  2ZZP B;  1I4X A;  3AE4 B;  1C3T A;  3ZJU A;  4XDD A;  2NS5 A;  4W9D A;  3NG0 A;  3Q3F A;  2UWQ A;  2B76 B;  2PW9 A;  2Z8L A;  4DXG A;  4E71 A;  2LGD A;  2LAS A;  4I6P A;  1XEE A;  4NAW B;  2MH7 A;  4ARI A;  2MJ3 A;  1WMH B;  3NUH B;  4RGT A;  3NS8 A;  4FLH A;  2CHW A;  4JLC A;  1XLN A;  3H7P A;  4REZ A;  2LJ5 A;  2BW2 A;  5MPO A;  1MG4 A;  4GU2 A;  1FMA D;  2VRR B;  4GLS C;  2KAC A;  1TS5 A;  3AM9 A;  4KGT A;  2MSE D;  1YJI A;  2O2V B;  2R2O A;  4OZB A;  3RI7 C;  3NY5 A;  2WXP A;  3VAW A;  2WXN A;  2WXJ A;  3ZLZ A;  2ZW1 A;  2NMQ A;  5FR3 A;  1F52 A;  2BBC A;  1JWB D;  5C23 A;  4JX1 C;  3L4P A;  3GZN B;  2INC C;  5FKA C;  3DDC B;  1F9J A;  2O6V A;  4BVU C;  3DPD A;  1N60 A;  2KDM A;  2WXH A;  2D07 B;  1Q1O A;  5JXV A;  3ZJT A;  4H2A A;  2PPH A;  2QC8 A;  4AJY B;  2DZJ A;  4GSW A;  3ZRF A;  5J17 A;  3U4E G;  2C9W B;  2N7D A;  3ZJV A;  1CQV A;  2Q5W D;  3ML8 A;  3BK1 A;  1F0Z A;  2BT6 A;  4DXA B;  1WRD B;  2WX0 A;  2IO0 B;  5BMG A;  1VRA B;  2BWF A;  1V97 A;  1E8Y A;  3KWV A;  3ALB A;  2N1V A;  5IA7 A;  1NVI D;  3U8Z A;  3AE9 B;  4RFB A;  3DHH C;  4MJS A;  3QAR A;  4M00 A;  3WIM A;  4A8X C;  2G4D B;  3ONS A; 
#chains in the Genus database with same CATH homology
 4P1C C;  3I5J C;  3RNG C;  3GE3 C;  3RNF C;  3N1Z C;  1T0R C;  3GE8 C;  3Q3O C;  3RMK C;  3Q3N C;  3RI7 C;  1T0Q C;  2RDB C;  3Q2A C;  1T0S C;  3RNA C;  3N20 C;  3RN9 C;  4P1B C;  3DHG C;  3DHI C;  3RNC C;  3Q3M C;  3Q14 C;  2INC C;  3N1X C;  3DHH C;  3RNE C;  3I63 C;  3RNB C;  3N1Y C;  2IND C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...