3RNFC

Structure of the toluene/o-xylene monooxygenase hydroxylase t201s/v271a double mutant
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
85
structure length
85
Chain Sequence
ATFPIMSNFERDFVIQLVPVDTEDTMDQVAEKCAYHSINRRVHPQPEKILRVRRHEDGTLFPRGMIVSDAGLRPTETLDIIFMDN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Tracking a defined route for O2 migration in a dioxygen-activating diiron enzyme.
pubmed doi rcsb
source organism Pseudomonas sp. ox1
molecule tags Oxidoreductase
molecule keywords Toluene o-xylene monooxygenase component
total genus 25
structure length 85
sequence length 85
ec nomenclature ec 1.14.-.-:
pdb deposition date 2011-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF06234 TmoB Toluene-4-monooxygenase system protein B (TmoB)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.270 Alpha Beta Roll Ubiquitin-like (UB roll) TmoB-like 3rnfC00
3DHHC 3I63C 1T0QC 2INDC 3GE8C 3N1XC 1T0RC 2INCC 3RNFC 3N1YC 3RNBC 3Q3NC 1T0SC 4P1BC 3Q3MC 3RNCC 3Q3OC 3Q2AC 2RDBC 3N20C 3I5JC 3RI7C 3N1ZC 3RMKC 3GE3C 3RN9C 3Q14C 4P1CC 3DHGC 3RNGC 3RNAC 3DHIC 3RNEC
chains in the Genus database with same CATH superfamily
1OFFA 2LGIA 2M0AA 1B9RA 1ET9A 3PHWB 3JSVA 2KTFA 1YJ1A 4LCDE 1WF9A 1HZ5A 2KJ6A 4BKTA 5AUIA 1V1OA 4RF0A 3NZSA 2WXHA 2BYFA 4RF1A 1K51A 2LXAA 1QF6A 1A5RA 3DDCB 2M0XA 1C3TA 4ZYNA 1SIFA 2L8JA 2LGDA 2Y5CA 1KLUD 1C79A 2XK5A 1FCCC 1SE3A 4WJQA 1L0VB 2BGFA 2JZZA 1IGCA 5BMHA 1SF0A 4CHKA 3V6CB 4ZOHC 3U2SC 1FM0D 1SEBD 3I5JC 3MTNB 3GB1A 1T0YA 2J0KA 2NR2A 3PSEB 2AL3A 5MPOA 2XEWA 3C19A 1VLBA 2Q5WD 4DBGA 3OAWA 2NBVB 3PREA 3AE4B 4MGYE 5E6PA 3VHTC 3VRAB 4KIKA 1FNWA 3DBRI 3R7RA 4MSMB 3RCZA 1AN8A 3MHZA 5IP4D 1TJEA 1VZ6A 4HJGE 4RMAA 3VQIA 2QMTA 2QSDA 1JROA 1DOIA 1CZPA 2MLBA 4HCPB 1UNSA 1I4QA 3B0AA 5C2TB 3B2FA 4RGNA 1OQYA 2G4DB 5IAAC 2OJWA 3NS8A 2LVPA 4II3B 4P6VF 1N63A 2WX0A 2RPVA 4YSZB 3Q3JA 3N20C 3EC8A 5C3JB 3ZNZB 4NQLB 5L83A 1WRIA 2K25A 3DVNV 1UH6A 2G1EA 2DZIA 1XLOA 3R2IA 1MG8A 1T0RC 1V2YA 3RNBC 3L10B 4QAYA 2KWDA 5AZHA 3KWLA 3ONSA 2BYTA 2WDTB 2WXPA 3AE5B 2LGXA 3DVNU 1WWTA 4W9GA 2KQ7A 3U8ZA 3CSTA 1KOTA 1EU4A 3U4EG 2KLCA 1YX6B 5C23A 4DWFA 5JHAA 2G4SA 1N60A 5HHDG 1GPXA 1L4DB 1ZKHA 2FCNA 2GI9A 1RFAA 2K8CA 3ML8A 3VTVA 4KGTA 2GBRA 1VZ7A 1F1HA 4WURA 2FCSA 1J8CA 3HUIA 2KJRA 2MBOA 2RDGA 1HZ6A 1IUEA 1TTNA 1FO4A 4UDUC 1WM2A 1YQ4B 5FK9C 4HLEA 3IBEA 2LUEA 1J19A 2WXMA 4L1BA 3HRDD 2BB6A 2FIDA 3VR8B 3CMMB 2JT4B 3QIJA 3P1MA 2QEJC 3FILA 2I1KA 3KQ4A 1EM7A 1J7BA 2JRHA 2I38A 4ANVA 4W9KA 2JZ3B 2KTRA 1WXMA 3V60A 3I57A 4E3CA 1WXSA 5JHBA 3TEZA 2RDHA 4C4VA 3AI5A 1TKYA 2JU6X 3TCAA 2KT7A 2MH7A 4OZCA 2KAJA 1FRRA 1WGKA 2LI5A 2DAJA 1EU3A 2BTEA 4JIOU 3WAOA 2D2QA 5BO4B 3UQAA 2KOXA 4PS3A 2PMVA 1YN3A 2YEPF 2W9NA 1TKEA 4EZJA 4HPMB 3M63B 5DPTA 5HG2A 4MGKE 3PZDA 3AE9B 2D3CA 1QLBB 1TS5A 3RUIB 1DOYA 3A9KB 4C7YA 1UBQA 3VR9B 3AMZA 3A33B 4WH4A 3AECB 3L16A 2PTLA 5FKAC 2O6VD 2LEKA 4KZ0A 5FR3A 2IO1B 2BS3B 2ZNVC 5E6OA 3ZNHB 4ZRJA 3PT2B 1ESFA 2WX1A 2PKOA 2KK8A 1Z5SB 1N5WA 2NMQA 2D07B 4IOIE 3MC9A 3RNAC 3VRBB 2W55A 3RNEC 3MC8A 2JSVX 4TV3A 2EELA 3UIPB 1HXYD 1I4PA 3AULA 4IC7B 1H4RA 1WIAA 4M8MA 4N58A 5E6JA 4RNAA 3BK1A 3TIXA 1RAXA 4LNNA 2YVCA 2HTHA 4KDIC 5G55A 4RM9A 2A5UA 3QJZA 2FUHB 3BINA 1NENB 4K7WA 1N5XA 1FCLA 4HKZE 3L4PA 2V1YA 1D5ZC 2LRUA 3T8MA 4OZAA 1MI0A 3ZXVA 2M4NA 1YQ3B 3ZJUA 1NBFC 2D5GA 3C0RB 3RZWC 3WCQA 1DYQA 2SAKA 4JWUC 4FN2A 4N6EB 1WY8A 1XEEA 2PPHA 4CQNA 2PIAA 3FAHA 3RD2A 1C4PA 1UGJA 4KV2A 4NAMA 3Q3FA 4YT0B 1QQRA 1EF1A 2JXTA 4MGIE 4MGZE 1AW7A 2WQYB 1IYFA 2A4ZA 2CJNA 1C76A 4EZLA 2GB1A 1C9FA 2IBIB 4K3BA 1KM7A 3LJ3A 2EMTA 1PQSA 1ZGUB 3A1QB 2MJEA 1T6BX 1CJEA 2BPSA 2KXJA 1RWSA 2JQRB 3Q3OC 3ZO5B 1E8ZA 4ZHPA 4FHJA 1OQQA 1TT5B 1CQVA 4KKIA 5TSSA 4JPSA 3MHSD 3AXCA 3QK0A 4C7ZA 1FMAD 3P4RB 4OVZA 4LK0M 4AWJA 2JYTA 4L2YA 2XK5B 4EZKA 4ZYSA 2LGSA 3OLMD 1WM3A 4TQ0A 1WJNA 1UUPA 2AQ1B 2BVCA 1IP9A 1WSPA 2KZRA 2BS4B 4P16A 4ANXA 4E74A 3DBHB 1U4AA 2IGHA 3GZNI 1UGMA 2FUG1 3AE6B 3AV8A 3B9JA 1JCKB 3D32A 3H7SA 2MRPA 2JX5A 1HA5A 2HD5B 2KVZA 4KIKB 4G0NB 4MJSA 4IKGA 2WXLA 2LD9A 3V62A 2INNE 1F77A 2BYVE 4FA6A 1QZEA 4DHZE 3TL5A 4ZDVA 2OEDA 3BZDB 1WMHA 1F0ZA 4MM3B 2M19A 2O2VB 2J4XA 3AE2B 5CHFA 4K81A 2IYDB 3A9JB 1YNTE 2MP2B 3SFDB 4WWPA 3H7PA 4TUUA 2J53A 2PE6B 3JW0X 1VZ8A 1JWSD 3A4RA 3A4SC 4ASWC 4YSXB 4ANWA 3SDLC 5IN7A 1STEA 3MJ5A 4YTPB 4KSLC 1XD3B 4A55A 2MP2A 2DZKA 3IT6B 1Q0WB 4W9IA 2MJDA 2ZVOA 3BVGA 4B0MA 1HTOA 3PRMB 2WXJA 1F52A 3DHHC 3W5VB 2I1JA 1Q5WB 1WZ0A 4RH6A 3NRZA 1XT9B 3DBLB 3ZRFA 3VTUA 1ROEA 1XQQA 3V3XA 1N61A 1WXAA 2D3GA 3IFWB 3FKYA 4WAAA 4EOYA 1P0RA 3KWVA 2HE7A 3BWUD 2GBNA 1KH0A 4KSKC 4N59A 3T3OA 4PS8A 3ZRCA 3N3KB 1T3QA 1C4AA 1BMLC 2K6DB 1UD7A 3QC8B 4US8A 1WFYA 3P42A 4ICVA 2MBQA 2JWUA 1JWMD 2K0PA 4GN1A 2HJ1A 3VXWA 2O6VA 3SHQA 1L2NA 2DYBA 1WJUA 5EE0A 1HQRD 1WR1A 2LVQA 1MVKA 2CR5A 4W9LA 1E8WA 3APFA 3R2TA 2FCQA 2WXOA 4KKJA 2BS2B 1IBXA 1I7HA 2WHIA 2BF8B 1TY2A 3DPDA 2MCNB 4USAA 3OJ3A 2IPKD 2CS4A 1S1QB 4DXGA 2RMMA 3PO0A 3VAWA 5D3DA 2Z8LA 1TS2A 2WYQA 2L52A 1FXTB 1KFYB 3RMKC 3B1LX 1FXIA 3L08A 4XDDA 2LASA 2KFKB 2MWSB 2YEPB 3PTFC 2MSED 2Z0EB 1D6EC 3WAMA 4GDKB 3PZ8A 3Q3MC 1TBEA 2KDFB 4M0WA 1E8XA 4IW0A 1FFUA 2FNJB 2LRWA 4W9JA 3ZYYX 2MBEA 4IWOA 2JPHA 4A6QA 3MFGA 3IHPC 4S17A 1DGJA 5BYSA 1B1ZA 2L05A 2KD0A 4DDID 2ZW1A 2MHJA 4GXBA 1F9JA 1RFKA 2W3SA 2KN4A 2K22A 5DPWA 2AYOB 2BKFA 3TEWA 3CSFA 3DWMA 1WGHA 4MEMA 4ZRIA 2HDEA 4IG7B 2R61A 2LGYA 5DPSA 4PYUA 1V5OA 4C56C 1UBIA 1I42A 3OJ4B 3DBLI 3WIMA 5G5HA 2G9HD 4OVVA 1WE6A 2WU2B 3DHGC 1X1MA 4HEA1 1WRDB 3AB5A 3H9DA 1YJIA 5D2MB 5BYQA 4PT5A 4DXFA 2Z0DB 1PGBA 2KACA 1V9JA 3URYA 4WAFA 2DWQA 5KHOA 3N1YC 3EHVA 1V6EA 2GRIA 5EE1A 2INPE 3DVGX 1Q10A 4JE3B 3X23A 5L95C 3VTWA 4US9A 4IM0A 4MH0E 3ZJVA 3UQBA 1GC7A 2BKRB 2B76B 1NI3A 4EEWA 1N62A 5IO9A 1WX8A 2FBWB 2WNMA 1XLPA 1Y8RC 4RGOS 1GUAB 1V81A 1WGRA 2REXA 4PYZA 5BYRA 1KF6B 2DLBA 4KGSA 1MHXA 1ET6A 2ZNVB 4W9EA 1YN4A 2V3SA 2KWUB 4GDLA 2DYOA 4W9DA 4BKSD 4ZHOA 1SSNA 5LLIA 3LB8C 3TEXA 3CIRB 4JQWC 3TEYA 4HRSA 1TKGA 3KYDD 3IG3A 3DBRB 3GZNB 2DX5B 3VUYA 2IO3B 1I4XA 3X0WA 4GSWA 3AH7A 3HVZA 2V3NA 1JMLA 3Q69A 1GOZA 3W1SA 4M02A 1YJJA 4WJPA 1C4CA 1P7EA 3SFEB 3GS2A 2Y3AA 3H7PB 2NBWB 2LWPA 1J7CA 1YMHE 2PLPA 3MC0B 1NI2A 4DHZB 2ZZPB 1OEYA 3L0WB 2VRRB 3LXFA 2G3QB 1R4MI 1NYRA 1J7AA 2QJLA 2IZVB 4IUMB 4H2AA 2R2QA 1XF5L 3NOBA 3H1UA 3HM6X 3AEAB 3EFUA 2DZMA 3ZNID 3HIZA 1ZXHA 3L54A 2IGGA 2MBBB 4FJVB 4M8NA 4K7UA 2BWFA 2DYMA 1ZXIA 4NAWA 3ZKJC 2QIEB 5H8YE 4BBNC 4YTMB 2N9LA 2GBKA 2INCC 3M3JA 2LMCA 5EE3A 1WZ3A 1GB4A 4YTNB 1GAQB 2ZPYA 3K9PB 1YD8U 2K5PA 2KKCA 1AARA 3M95A 3DWGC 1WE7A 2K1FA 1V49A 4HVBA 1I4RA 2C5LC 2ZEQA 1UWXA 2L0FA 1TS3A 5HI1A 4B6WA 2XNAC 1WXQA 4WJNA 4XYCA 3O13A 2AQ2B 5CHWA 2C7HA 2MW5A 1WMHB 4OVUA 2KYWA 4MM3A 3A9JA 4HDOA 2IO0B 4AJYB 4BZAA 2BB5A 3P4SB 1SE2A 1L6VA 2N9EB 2NBUA 3NZ3A 1JALA 2M1MA 2MEKA 3RT3B 2NVUI 4DDGD 3ZNGC 4ZRKA 2Z59B 2K8BA 2QHOA 4KGRA 3VDZA 1TZ1A 3ZLZA 3JVZX 1ZW7A 1H8CA 4LNFA 3QCAA 1L6UA 3UINB 1QKZA 3J9CA 1CMXB 3RNGC 5J2RA 1KJTA 2WXGA 3NVZA 5E6NA 1WJ6A 2PW9A 4FLHA 4HJKA 4MDKE 2ZVNA 3U52E 2D10A 4MH8A 3AE3B 3S2AA 4JGHB 2I2YA 2N4FA 1KLVA 4IWQA 5J18A 2J42A 2Y5PA 1J0GA 4GMVA 2KDEB 4PK1A 2FAZA 3AU5A 5HKHA 4MT5A 2RGFA 2WP9B 1VCBA 2AQ3B 1V80A 4JWSC 4DXAB 3WA0A 3MP9A 3W1SC 3W2DA 4CO7A 4KX6B 4M01A 4RM8A 1NYQA 3UI3A 3VVWB 1EWYC 2ZCBA 4S0RA 3GE3C 2MBHA 1Z2MA 3AE7B 3KUZA 4AOFA 1SXTA 3GOEA 2WDRB 1FFVA 2N9KA 2ON8A 4HROA 3NZUA 4LNOA 4OHJA 4LJOB 1YIWA 4LTUA 4HPPA 3JYUA 1WR6E 1RM6C 5G5GA 3QAQA 2ZPNA 2QCZA 3SR6A 3ZTCA 1E8YA 3VFKA 1QILA 2CJOA 5AUKA 2MX2A 1XCQL 3KH0A 1IBXB 4IM2A 1PYWD 1GG3A 3I63C 2K9XA 3QARA 1AYFA 2WXKA 2RR9A 1ZOYB 1C1YB 2AEHA 3TJPA 4F7ZA 1UWMA 1I4HA 1TS4A 4ITKA 1EWCA 4ZRQA 5T8IA 4C4VB 4MACA 2R2OA 4BOSC 2WXNA 2KFKA 4O1NA 2INDC 2L7RA 1T5XD 1EF5A 1MPEA 4JX1C 1D4BA 2DHZA 4G11A 3P4QB 2VZKB 1TZOA 4BAXA 1DOXA 4N9F4 1D5MC 2CU3A 5G2NA 3V61A 2RDBC 2IJ0A 4L23A 4AQ7A 2WXQA 4FBJB 3NUHB 2V0GA 2BBCA 4BOZB 3NY5A 3FC4A 2EKEC 4WIPA 3M62B 3ZDTA 5FR6A 2GBMA 3AE1B 3AEBB 1QOGA 1PFDA 2UWQA 4K3CA 3ZXRA 2SEBD 2OOBB 4HWIB 2WXIA 3WAPA 1JQ4A 4OW0A 4OZBA 4C80A 3A9KA 2BQQA 3SU8X 1NDDA 2KLGA 5DCNA 1FRDA 3N32A 3ZJTA 4XWWA 4BBNF 4EE2A 4EKUA 2KHWB 2ZJDA 2KFJA 3EA6A 5D3IB 4MJSB 4HXDA 1E9MA 1FXAA 1ZP0B 3ZW3A 2JYEA 1M94A 2ONQA 2PE9A 2BT6A 1UF0A 1TIFA 3QX1A 1G6JA 3BK2A 2E6XA 4K7SA 4GDLB 1SB3C 1LQBA 2KMAA 2WXRA 1GC6A 3BYTB 3OWEB 2X38A 2M17A 1TY0A 3N9YC 4REZA 1LO5D 2DZJA 2WXFA 4NZLB 2K8HA 4HK2A 1V8CA 1XXGA 4LLGM 4NJ7A 3RI7C 2L32A 3NS1A 1SBBB 3RYTA 1PGAA 1AWDA 1WX9A 5BMGA 3KYCD 2JZPA 1P1AA 3PRPB 1JRPA 3W9CB 3U7ZA 4E71A 4WJOA 3N1XC 4LJPB 1SE9A 1ACCA 1WH3A 3TMPB 4XWTA 2KN5A 1XLQA 4PS7A 1FPYA 1KLGD 2K6QA 3E56A 4D2KA 4AJWA 2RSUA 3PPAA 1WYGA 1L5PA 2XN9C 4A20A 1KRHA 1E0ZA 4AP4C 2KMMA 4WQOB 5JXVA 1E7UA 2JRIB 3ETRA 4DHJD 3NHEB 3BYYB 3W1YA 2M8SA 4LDTB 1FNUA 3UF8A 2RPQA 3MJWA 2LJ5A 3AE8B 3WALA 3OG5A 1SJHD 3DVGY 2PVOD 5I4DA 2PJHA 1JWUD 1WJ4A 4I6PA 2KX3A 3TSSA 4F8CB 1F2RI 4JL9A 2WWZA 5D94A 2X8XX 1QT9A 4B9KA 1I4GA 2KQ4X 4P1CC 1WYWB 3ML9A 1LXDA 4AS1A 1NEKB 5DPRA 5AEKB 3APDA 2FE8A 3GE8C 1A70A 2AWTA 2WS3B 3AM9A 3L17A 5D7GA 1GJZA 3PHXB 2HJ8A 3I9V1 2XBBC 2RD0A 2O6VB 4EFOA 1V97A 2VH1A 5IKCM 5JH5C 4A8XC 3KUCB 1OTRB 2H89B 3U30A 5GXGB 1YX5B 4BFRA 3TBLD 3CF6E 3AEEB 3ZQ4A 2KQSA 4I6NB 4G50A 1RLFA 1UELA 2Y5BB 2W3RA 2L3ZA 4HDQA 3LYYA 3Q8FA 3B08A 4LNIA 2N7EA 2L76A 4I6LB 3VH4B 3FILB 3LDZE 1ZPSA 1YN5A 2BWES 3WANA 4B95A 1F2RC 2KTRB 4YSYB 3AEFB 2N1WA 5LXHA 4KVGB 1VD2A 5CHVC 4W9CA 3R7QA 3VUXA 4NJCA 4Q2JA 2J7QB 4GLSC 2KO3A 2KJHB 2K3UA 2GLSA 1LM8B 2TSSA 4LDTD 4NNJB 4ARCA 3KW5B 1K52A 1ZE3D 2NPTB 1TYGB 1PGXA 4JLCA 4B0EA 1HEZE 2FIFA 1LGRA 2KNBA 2V3PA 4ICUA 3PVLA 2UYZB 1SGHA 3AEGB 1FIQA 3I3TB 2ZW0A 1Y56A 4FXCA 3BVZA 4M00A 3ZGZA 3Q2AC 1EO6A 1R7SA 1GB1A 2BW2A 4BVUC 3HVDA 4FJZA 2CHXA 2FCMA 1WXVA 2LFIA 4MSQB 2WDQB 3APCA 3PS6A 2GOWA 2NS5A 4RCOA 1C77A 1L0YB 1I35A 2NCNA 3ALBA 3PV1A 1IGDA 2JY6A 1PDXA 2KDBA 2BYEA 3NG0A 2W82A 1JWAD 2VZKD 3PLUA 5CTRC 2KWCA 1SJED 2C9WB 4YL8A 2GMIC 3ZTDA 3ECIA 1JWBD 3ZDMC 1E10A 3L13A 4XDCA 1FNVA 2M56B 3BVMA 2N9XA 3DCGA 1VRAB 3GP7A 4CYEA 2O2VA 2JWZA 2ZCCA 2WGSA 3EECA 3IT4B 3Q3NC 4WQMA 1ZDXA 2QILA 4RFBA 2CHZA 2KMCA 4NQKE 5BMIA 4DK5A 4TQ1A 5C1ZA 2V9HA 4A90A 2KVRA 1R4MB 4URKA 3Q8CA 3QQ8B 5LXIB 2IO2B 3QA8A 4IDIA 1L7YA 4LNKA 4WWNA 4DHJB 1T0QC 5IA7A 4IM3A 2D3BA 4J6IA 1BUIC 1GNUA 1ISNA 5D6JB 3RULA 1QOAA 4ANUA 4P1BC 1WGDA 3UIOB 2QDFA 3O65B 2ACZB 1L0XB 3N1ZC 1YQBA 4TSSA 1HTQA 4XX5A 4W9HA 3QHTA 3Q8BA 1XCTL 2GBJA 4XC2A 3AN1A 1XO3A 1MJDA 4FJYA 2KWVB 3IVFA 1E7PB 5KHQA 3V6EB 4K1RB 2JF5A 2B3AA 5LNK1 3T9LA 1N6ZA 1R4NI 3PZ7A 2NTTA 4ZRPA 3E9SA 2L00B 1UZXB 1VDVA 2C7MB 2PEAA 4NAWB 2J0MA 2D3AA 1Q1OA 2E3TA 1SIJA 1XLNA 2LVOA 3N30A 1JRUA 3DBHI 3B2GA 3KLSX 3W5UB 1BT0A 1YOVB 4TMAB 3DHIC 2N1VA 2N7DA 2L83A 2H88B 2KANA 2N7JA 4GU2A 2CHWA 4A3OA 5GMVA 2JUOA 5TR5A 2V4LA 4KDLB 3ABVB 1OGWA 1MHHE 4HCNB 2MA9B 4GB9A 4A9AA 2DBYA 3PRZA 4XE0A 2KDIA 4FHKA 2NTSA 5CX3A 3T3NA 4G3XB 4BKGA 3P63A 2LXCA 2V4IB 3AU4A 2MQJA 2D11A 1K8RB 1ZDVA 2W54A 4BKSA 5EE9A 2MJ3A 1VJKA 2EMSA 3IAM1 2IDYA 1EUVB 2QC8A 3NVYA 5JZEB 2ASQA 3PGEA 1KTKA 3H8HA 3AEDB 2CU1A 2LUMA 3P2BA 1K53A 4KZCA 4RGTA 2OJRA 4ACFA 2KC1A 3NVWA 3C8YA 3Q6BA 2HTME 3Q14C 1D3ZA 1K50A 2DNFA 1OQRA 1JW9D 2DENB 1QOFA 3DBSA 5HFYA 1P9DU 4GOCA 1LFDA 5IOIA 1V86A 1FD6A 5AZGA 1E5WA 4P7IA 4TKNA 4A3PA 4YWGG 4GGQA 3P4PB 1WGYA 3IXSA 1CK1A 1PUTA 3QWZB 3JSVB 1TGZB 2C60A 4FADA 4XGAB 1OEYJ 4YXDB 1R4NB 3EGRA 3R66C 2WLBA 2K39A 1IPGA 4F1SA 4HKQA 3K9OB 4ARIA 1BXTA 3IAS1 1VR9A 3RN9C 3H6NA 4J3OD 4W9FA 1S3SG 3EUB2 1P7FA 2OHFA 4NY0A 3HK0A 2J0JA 2JVCA 1NVID 1E7VA 2N0SB 1RYJA 2WU5B 5EDSA 2IY1B 4II2B 1WX7A 2DAFA 5J17A 1D5XC 4C00A 1M4VA 2AX5A 2LHDA 2L1AA 1E6EB 1C78A 2KDMA 2VH2A 3VH3B 4AUQC 3SD5A 2L0TA 1MFWA 4DQOC 4HPLB 3ZUNA 3HHMA 2G45B 1ENFA 1ZUD2 2LJIA 5H92C 1L4ZB 3RFZB 4FULA 2C7NB 2N9PC 2ICIA 2J52A 1P3QU 3BY4B 3U7DA 5AZFA 3ZVVA 3NJTA 3R8BA 1QOBA 3DQVA 3BIID 1E90A 1HE8A 4IWPA 2LZ6A 3SEBA 4X57B 2UU7A 4MELA 3UGBB 3ZIMA 3Q8EA 4WWOA 3KVFB 2CKHB 3NVVA 3TUOA 3PLVA 4NJ6A 4RGMA 2EKIA 1V5TA 2KC2A 3RNCC 1SE4A 3V05A 1RRBA 3DOWA 2AL6A 4R3DA 3RZFA 3RPFC 2YLMA 3EFCA 1MG4A 1V1PB 1WGGA 4GIVA 3KUDB 2JXXA 4GDKA 3R3MA 3VUWA 1WI0A 3ENEA 3A1QA 2KX0A 3CWIA 4M0WB 1FEHA 4NPNA 3RNFC 3Q8AA 1T0SC 3HM3A 2NPTA 4WWMA 2IY0B 1P98A 4XZ4A 2WDVB 2LHEA 2IGDA 2PVGC 4EUTA 1V1PA
chains in the Genus database with same CATH topology
3DHHC 3I63C 1T0QC 2INDC 3GE8C 3N1XC 1T0RC 2INCC 3RNFC 3N1YC 3RNBC 3Q3NC 1T0SC 4P1BC 3Q3MC 3RNCC 3Q3OC 3Q2AC 2RDBC 3N20C 3I5JC 3RI7C 3N1ZC 3RMKC 3GE3C 3RN9C 3Q14C 4P1CC 3DHGC 3RNGC 3RNAC 3DHIC 3RNEC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DHH C;  3I63 C;  1T0Q C;  2IND C;  3GE8 C;  3N1X C;  1T0R C;  2INC C;  3RNF C;  3N1Y C;  3RNB C;  3Q3N C;  1T0S C;  4P1B C;  3Q3M C;  3RNC C;  3Q3O C;  3Q2A C;  2RDB C;  3N20 C;  3I5J C;  3RI7 C;  3N1Z C;  3RMK C;  3GE3 C;  3RN9 C;  3Q14 C;  4P1C C;  3DHG C;  3RNG C;  3RNA C;  3DHI C;  3RNE C; 
#chains in the Genus database with same CATH topology
 1OFF A;  2LGI A;  2M0A A;  1B9R A;  1ET9 A;  3PHW B;  3JSV A;  2KTF A;  1YJ1 A;  4LCD E;  1WF9 A;  1HZ5 A;  2KJ6 A;  4BKT A;  5AUI A;  1V1O A;  4RF0 A;  3NZS A;  2WXH A;  2BYF A;  4RF1 A;  1K51 A;  2LXA A;  1QF6 A;  1A5R A;  3DDC B;  2M0X A;  1C3T A;  4ZYN A;  1SIF A;  2L8J A;  2LGD A;  2Y5C A;  1KLU D;  1C79 A;  2XK5 A;  1FCC C;  1SE3 A;  4WJQ A;  1L0V B;  2BGF A;  2JZZ A;  1IGC A;  5BMH A;  1SF0 A;  4CHK A;  3V6C B;  4ZOH C;  3U2S C;  1FM0 D;  1SEB D;  3I5J C;  3MTN B;  3GB1 A;  1T0Y A;  2J0K A;  2NR2 A;  3PSE B;  2AL3 A;  5MPO A;  2XEW A;  3C19 A;  1VLB A;  2Q5W D;  4DBG A;  3OAW A;  2NBV B;  3PRE A;  3AE4 B;  4MGY E;  5E6P A;  3VHT C;  3VRA B;  4KIK A;  1FNW A;  3DBR I;  3R7R A;  4MSM B;  3RCZ A;  1AN8 A;  3MHZ A;  5IP4 D;  1TJE A;  1VZ6 A;  4HJG E;  4RMA A;  3VQI A;  2QMT A;  2QSD A;  1JRO A;  1DOI A;  1CZP A;  2MLB A;  4HCP B;  1UNS A;  1I4Q A;  3B0A A;  5C2T B;  3B2F A;  4RGN A;  1OQY A;  2G4D B;  5IAA C;  2OJW A;  3NS8 A;  2LVP A;  4II3 B;  4P6V F;  1N63 A;  2WX0 A;  2RPV A;  4YSZ B;  3Q3J A;  3N20 C;  3EC8 A;  5C3J B;  3ZNZ B;  4NQL B;  5L83 A;  1WRI A;  2K25 A;  3DVN V;  1UH6 A;  2G1E A;  2DZI A;  1XLO A;  3R2I A;  1MG8 A;  1T0R C;  1V2Y A;  3RNB C;  3L10 B;  4QAY A;  2KWD A;  5AZH A;  3KWL A;  3ONS A;  2BYT A;  2WDT B;  2WXP A;  3AE5 B;  2LGX A;  3DVN U;  1WWT A;  4W9G A;  2KQ7 A;  3U8Z A;  3CST A;  1KOT A;  1EU4 A;  3U4E G;  2KLC A;  1YX6 B;  5C23 A;  4DWF A;  5JHA A;  2G4S A;  1N60 A;  5HHD G;  1GPX A;  1L4D B;  1ZKH A;  2FCN A;  2GI9 A;  1RFA A;  2K8C A;  3ML8 A;  3VTV A;  4KGT A;  2GBR A;  1VZ7 A;  1F1H A;  4WUR A;  2FCS A;  1J8C A;  3HUI A;  2KJR A;  2MBO A;  2RDG A;  1HZ6 A;  1IUE A;  1TTN A;  1FO4 A;  4UDU C;  1WM2 A;  1YQ4 B;  5FK9 C;  4HLE A;  3IBE A;  2LUE A;  1J19 A;  2WXM A;  4L1B A;  3HRD D;  2BB6 A;  2FID A;  3VR8 B;  3CMM B;  2JT4 B;  3QIJ A;  3P1M A;  2QEJ C;  3FIL A;  2I1K A;  3KQ4 A;  1EM7 A;  1J7B A;  2JRH A;  2I38 A;  4ANV A;  4W9K A;  2JZ3 B;  2KTR A;  1WXM A;  3V60 A;  3I57 A;  4E3C A;  1WXS A;  5JHB A;  3TEZ A;  2RDH A;  4C4V A;  3AI5 A;  1TKY A;  2JU6 X;  3TCA A;  2KT7 A;  2MH7 A;  4OZC A;  2KAJ A;  1FRR A;  1WGK A;  2LI5 A;  2DAJ A;  1EU3 A;  2BTE A;  4JIO U;  3WAO A;  2D2Q A;  5BO4 B;  3UQA A;  2KOX A;  4PS3 A;  2PMV A;  1YN3 A;  2YEP F;  2W9N A;  1TKE A;  4EZJ A;  4HPM B;  3M63 B;  5DPT A;  5HG2 A;  4MGK E;  3PZD A;  3AE9 B;  2D3C A;  1QLB B;  1TS5 A;  3RUI B;  1DOY A;  3A9K B;  4C7Y A;  1UBQ A;  3VR9 B;  3AMZ A;  3A33 B;  4WH4 A;  3AEC B;  3L16 A;  2PTL A;  5FKA C;  2O6V D;  2LEK A;  4KZ0 A;  5FR3 A;  2IO1 B;  2BS3 B;  2ZNV C;  5E6O A;  3ZNH B;  4ZRJ A;  3PT2 B;  1ESF A;  2WX1 A;  2PKO A;  2KK8 A;  1Z5S B;  1N5W A;  2NMQ A;  2D07 B;  4IOI E;  3MC9 A;  3RNA C;  3VRB B;  2W55 A;  3RNE C;  3MC8 A;  2JSV X;  4TV3 A;  2EEL A;  3UIP B;  1HXY D;  1I4P A;  3AUL A;  4IC7 B;  1H4R A;  1WIA A;  4M8M A;  4N58 A;  5E6J A;  4RNA A;  3BK1 A;  3TIX A;  1RAX A;  4LNN A;  2YVC A;  2HTH A;  4KDI C;  5G55 A;  4RM9 A;  2A5U A;  3QJZ A;  2FUH B;  3BIN A;  1NEN B;  4K7W A;  1N5X A;  1FCL A;  4HKZ E;  3L4P A;  2V1Y A;  1D5Z C;  2LRU A;  3T8M A;  4OZA A;  1MI0 A;  3ZXV A;  2M4N A;  1YQ3 B;  3ZJU A;  1NBF C;  2D5G A;  3C0R B;  3RZW C;  3WCQ A;  1DYQ A;  2SAK A;  4JWU C;  4FN2 A;  4N6E B;  1WY8 A;  1XEE A;  2PPH A;  4CQN A;  2PIA A;  3FAH A;  3RD2 A;  1C4P A;  1UGJ A;  4KV2 A;  4NAM A;  3Q3F A;  4YT0 B;  1QQR A;  1EF1 A;  2JXT A;  4MGI E;  4MGZ E;  1AW7 A;  2WQY B;  1IYF A;  2A4Z A;  2CJN A;  1C76 A;  4EZL A;  2GB1 A;  1C9F A;  2IBI B;  4K3B A;  1KM7 A;  3LJ3 A;  2EMT A;  1PQS A;  1ZGU B;  3A1Q B;  2MJE A;  1T6B X;  1CJE A;  2BPS A;  2KXJ A;  1RWS A;  2JQR B;  3Q3O C;  3ZO5 B;  1E8Z A;  4ZHP A;  4FHJ A;  1OQQ A;  1TT5 B;  1CQV A;  4KKI A;  5TSS A;  4JPS A;  3MHS D;  3AXC A;  3QK0 A;  4C7Z A;  1FMA D;  3P4R B;  4OVZ A;  4LK0 M;  4AWJ A;  2JYT A;  4L2Y A;  2XK5 B;  4EZK A;  4ZYS A;  2LGS A;  3OLM D;  1WM3 A;  4TQ0 A;  1WJN A;  1UUP A;  2AQ1 B;  2BVC A;  1IP9 A;  1WSP A;  2KZR A;  2BS4 B;  4P16 A;  4ANX A;  4E74 A;  3DBH B;  1U4A A;  2IGH A;  3GZN I;  1UGM A;  2FUG 1;  3AE6 B;  3AV8 A;  3B9J A;  1JCK B;  3D32 A;  3H7S A;  2MRP A;  2JX5 A;  1HA5 A;  2HD5 B;  2KVZ A;  4KIK B;  4G0N B;  4MJS A;  4IKG A;  2WXL A;  2LD9 A;  3V62 A;  2INN E;  1F77 A;  2BYV E;  4FA6 A;  1QZE A;  4DHZ E;  3TL5 A;  4ZDV A;  2OED A;  3BZD B;  1WMH A;  1F0Z A;  4MM3 B;  2M19 A;  2O2V B;  2J4X A;  3AE2 B;  5CHF A;  4K81 A;  2IYD B;  3A9J B;  1YNT E;  2MP2 B;  3SFD B;  4WWP A;  3H7P A;  4TUU A;  2J53 A;  2PE6 B;  3JW0 X;  1VZ8 A;  1JWS D;  3A4R A;  3A4S C;  4ASW C;  4YSX B;  4ANW A;  3SDL C;  5IN7 A;  1STE A;  3MJ5 A;  4YTP B;  4KSL C;  1XD3 B;  4A55 A;  2MP2 A;  2DZK A;  3IT6 B;  1Q0W B;  4W9I A;  2MJD A;  2ZVO A;  3BVG A;  4B0M A;  1HTO A;  3PRM B;  2WXJ A;  1F52 A;  3DHH C;  3W5V B;  2I1J A;  1Q5W B;  1WZ0 A;  4RH6 A;  3NRZ A;  1XT9 B;  3DBL B;  3ZRF A;  3VTU A;  1ROE A;  1XQQ A;  3V3X A;  1N61 A;  1WXA A;  2D3G A;  3IFW B;  3FKY A;  4WAA A;  4EOY A;  1P0R A;  3KWV A;  2HE7 A;  3BWU D;  2GBN A;  1KH0 A;  4KSK C;  4N59 A;  3T3O A;  4PS8 A;  3ZRC A;  3N3K B;  1T3Q A;  1C4A A;  1BML C;  2K6D B;  1UD7 A;  3QC8 B;  4US8 A;  1WFY A;  3P42 A;  4ICV A;  2MBQ A;  2JWU A;  1JWM D;  2K0P A;  4GN1 A;  2HJ1 A;  3VXW A;  2O6V A;  3SHQ A;  1L2N A;  2DYB A;  1WJU A;  5EE0 A;  1HQR D;  1WR1 A;  2LVQ A;  1MVK A;  2CR5 A;  4W9L A;  1E8W A;  3APF A;  3R2T A;  2FCQ A;  2WXO A;  4KKJ A;  2BS2 B;  1IBX A;  1I7H A;  2WHI A;  2BF8 B;  1TY2 A;  3DPD A;  2MCN B;  4USA A;  3OJ3 A;  2IPK D;  2CS4 A;  1S1Q B;  4DXG A;  2RMM A;  3PO0 A;  3VAW A;  5D3D A;  2Z8L A;  1TS2 A;  2WYQ A;  2L52 A;  1FXT B;  1KFY B;  3RMK C;  3B1L X;  1FXI A;  3L08 A;  4XDD A;  2LAS A;  2KFK B;  2MWS B;  2YEP B;  3PTF C;  2MSE D;  2Z0E B;  1D6E C;  3WAM A;  4GDK B;  3PZ8 A;  3Q3M C;  1TBE A;  2KDF B;  4M0W A;  1E8X A;  4IW0 A;  1FFU A;  2FNJ B;  2LRW A;  4W9J A;  3ZYY X;  2MBE A;  4IWO A;  2JPH A;  4A6Q A;  3MFG A;  3IHP C;  4S17 A;  1DGJ A;  5BYS A;  1B1Z A;  2L05 A;  2KD0 A;  4DDI D;  2ZW1 A;  2MHJ A;  4GXB A;  1F9J A;  1RFK A;  2W3S A;  2KN4 A;  2K22 A;  5DPW A;  2AYO B;  2BKF A;  3TEW A;  3CSF A;  3DWM A;  1WGH A;  4MEM A;  4ZRI A;  2HDE A;  4IG7 B;  2R61 A;  2LGY A;  5DPS A;  4PYU A;  1V5O A;  4C56 C;  1UBI A;  1I42 A;  3OJ4 B;  3DBL I;  3WIM A;  5G5H A;  2G9H D;  4OVV A;  1WE6 A;  2WU2 B;  3DHG C;  1X1M A;  4HEA 1;  1WRD B;  3AB5 A;  3H9D A;  1YJI A;  5D2M B;  5BYQ A;  4PT5 A;  4DXF A;  2Z0D B;  1PGB A;  2KAC A;  1V9J A;  3URY A;  4WAF A;  2DWQ A;  5KHO A;  3N1Y C;  3EHV A;  1V6E A;  2GRI A;  5EE1 A;  2INP E;  3DVG X;  1Q10 A;  4JE3 B;  3X23 A;  5L95 C;  3VTW A;  4US9 A;  4IM0 A;  4MH0 E;  3ZJV A;  3UQB A;  1GC7 A;  2BKR B;  2B76 B;  1NI3 A;  4EEW A;  1N62 A;  5IO9 A;  1WX8 A;  2FBW B;  2WNM A;  1XLP A;  1Y8R C;  4RGO S;  1GUA B;  1V81 A;  1WGR A;  2REX A;  4PYZ A;  5BYR A;  1KF6 B;  2DLB A;  4KGS A;  1MHX A;  1ET6 A;  2ZNV B;  4W9E A;  1YN4 A;  2V3S A;  2KWU B;  4GDL A;  2DYO A;  4W9D A;  4BKS D;  4ZHO A;  1SSN A;  5LLI A;  3LB8 C;  3TEX A;  3CIR B;  4JQW C;  3TEY A;  4HRS A;  1TKG A;  3KYD D;  3IG3 A;  3DBR B;  3GZN B;  2DX5 B;  3VUY A;  2IO3 B;  1I4X A;  3X0W A;  4GSW A;  3AH7 A;  3HVZ A;  2V3N A;  1JML A;  3Q69 A;  1GOZ A;  3W1S A;  4M02 A;  1YJJ A;  4WJP A;  1C4C A;  1P7E A;  3SFE B;  3GS2 A;  2Y3A A;  3H7P B;  2NBW B;  2LWP A;  1J7C A;  1YMH E;  2PLP A;  3MC0 B;  1NI2 A;  4DHZ B;  2ZZP B;  1OEY A;  3L0W B;  2VRR B;  3LXF A;  2G3Q B;  1R4M I;  1NYR A;  1J7A A;  2QJL A;  2IZV B;  4IUM B;  4H2A A;  2R2Q A;  1XF5 L;  3NOB A;  3H1U A;  3HM6 X;  3AEA B;  3EFU A;  2DZM A;  3ZNI D;  3HIZ A;  1ZXH A;  3L54 A;  2IGG A;  2MBB B;  4FJV B;  4M8N A;  4K7U A;  2BWF A;  2DYM A;  1ZXI A;  4NAW A;  3ZKJ C;  2QIE B;  5H8Y E;  4BBN C;  4YTM B;  2N9L A;  2GBK A;  2INC C;  3M3J A;  2LMC A;  5EE3 A;  1WZ3 A;  1GB4 A;  4YTN B;  1GAQ B;  2ZPY A;  3K9P B;  1YD8 U;  2K5P A;  2KKC A;  1AAR A;  3M95 A;  3DWG C;  1WE7 A;  2K1F A;  1V49 A;  4HVB A;  1I4R A;  2C5L C;  2ZEQ A;  1UWX A;  2L0F A;  1TS3 A;  5HI1 A;  4B6W A;  2XNA C;  1WXQ A;  4WJN A;  4XYC A;  3O13 A;  2AQ2 B;  5CHW A;  2C7H A;  2MW5 A;  1WMH B;  4OVU A;  2KYW A;  4MM3 A;  3A9J A;  4HDO A;  2IO0 B;  4AJY B;  4BZA A;  2BB5 A;  3P4S B;  1SE2 A;  1L6V A;  2N9E B;  2NBU A;  3NZ3 A;  1JAL A;  2M1M A;  2MEK A;  3RT3 B;  2NVU I;  4DDG D;  3ZNG C;  4ZRK A;  2Z59 B;  2K8B A;  2QHO A;  4KGR A;  3VDZ A;  1TZ1 A;  3ZLZ A;  3JVZ X;  1ZW7 A;  1H8C A;  4LNF A;  3QCA A;  1L6U A;  3UIN B;  1QKZ A;  3J9C A;  1CMX B;  3RNG C;  5J2R A;  1KJT A;  2WXG A;  3NVZ A;  5E6N A;  1WJ6 A;  2PW9 A;  4FLH A;  4HJK A;  4MDK E;  2ZVN A;  3U52 E;  2D10 A;  4MH8 A;  3AE3 B;  3S2A A;  4JGH B;  2I2Y A;  2N4F A;  1KLV A;  4IWQ A;  5J18 A;  2J42 A;  2Y5P A;  1J0G A;  4GMV A;  2KDE B;  4PK1 A;  2FAZ A;  3AU5 A;  5HKH A;  4MT5 A;  2RGF A;  2WP9 B;  1VCB A;  2AQ3 B;  1V80 A;  4JWS C;  4DXA B;  3WA0 A;  3MP9 A;  3W1S C;  3W2D A;  4CO7 A;  4KX6 B;  4M01 A;  4RM8 A;  1NYQ A;  3UI3 A;  3VVW B;  1EWY C;  2ZCB A;  4S0R A;  3GE3 C;  2MBH A;  1Z2M A;  3AE7 B;  3KUZ A;  4AOF A;  1SXT A;  3GOE A;  2WDR B;  1FFV A;  2N9K A;  2ON8 A;  4HRO A;  3NZU A;  4LNO A;  4OHJ A;  4LJO B;  1YIW A;  4LTU A;  4HPP A;  3JYU A;  1WR6 E;  1RM6 C;  5G5G A;  3QAQ A;  2ZPN A;  2QCZ A;  3SR6 A;  3ZTC A;  1E8Y A;  3VFK A;  1QIL A;  2CJO A;  5AUK A;  2MX2 A;  1XCQ L;  3KH0 A;  1IBX B;  4IM2 A;  1PYW D;  1GG3 A;  3I63 C;  2K9X A;  3QAR A;  1AYF A;  2WXK A;  2RR9 A;  1ZOY B;  1C1Y B;  2AEH A;  3TJP A;  4F7Z A;  1UWM A;  1I4H A;  1TS4 A;  4ITK A;  1EWC A;  4ZRQ A;  5T8I A;  4C4V B;  4MAC A;  2R2O A;  4BOS C;  2WXN A;  2KFK A;  4O1N A;  2IND C;  2L7R A;  1T5X D;  1EF5 A;  1MPE A;  4JX1 C;  1D4B A;  2DHZ A;  4G11 A;  3P4Q B;  2VZK B;  1TZO A;  4BAX A;  1DOX A;  4N9F 4;  1D5M C;  2CU3 A;  5G2N A;  3V61 A;  2RDB C;  2IJ0 A;  4L23 A;  4AQ7 A;  2WXQ A;  4FBJ B;  3NUH B;  2V0G A;  2BBC A;  4BOZ B;  3NY5 A;  3FC4 A;  2EKE C;  4WIP A;  3M62 B;  3ZDT A;  5FR6 A;  2GBM A;  3AE1 B;  3AEB B;  1QOG A;  1PFD A;  2UWQ A;  4K3C A;  3ZXR A;  2SEB D;  2OOB B;  4HWI B;  2WXI A;  3WAP A;  1JQ4 A;  4OW0 A;  4OZB A;  4C80 A;  3A9K A;  2BQQ A;  3SU8 X;  1NDD A;  2KLG A;  5DCN A;  1FRD A;  3N32 A;  3ZJT A;  4XWW A;  4BBN F;  4EE2 A;  4EKU A;  2KHW B;  2ZJD A;  2KFJ A;  3EA6 A;  5D3I B;  4MJS B;  4HXD A;  1E9M A;  1FXA A;  1ZP0 B;  3ZW3 A;  2JYE A;  1M94 A;  2ONQ A;  2PE9 A;  2BT6 A;  1UF0 A;  1TIF A;  3QX1 A;  1G6J A;  3BK2 A;  2E6X A;  4K7S A;  4GDL B;  1SB3 C;  1LQB A;  2KMA A;  2WXR A;  1GC6 A;  3BYT B;  3OWE B;  2X38 A;  2M17 A;  1TY0 A;  3N9Y C;  4REZ A;  1LO5 D;  2DZJ A;  2WXF A;  4NZL B;  2K8H A;  4HK2 A;  1V8C A;  1XXG A;  4LLG M;  4NJ7 A;  3RI7 C;  2L32 A;  3NS1 A;  1SBB B;  3RYT A;  1PGA A;  1AWD A;  1WX9 A;  5BMG A;  3KYC D;  2JZP A;  1P1A A;  3PRP B;  1JRP A;  3W9C B;  3U7Z A;  4E71 A;  4WJO A;  3N1X C;  4LJP B;  1SE9 A;  1ACC A;  1WH3 A;  3TMP B;  4XWT A;  2KN5 A;  1XLQ A;  4PS7 A;  1FPY A;  1KLG D;  2K6Q A;  3E56 A;  4D2K A;  4AJW A;  2RSU A;  3PPA A;  1WYG A;  1L5P A;  2XN9 C;  4A20 A;  1KRH A;  1E0Z A;  4AP4 C;  2KMM A;  4WQO B;  5JXV A;  1E7U A;  2JRI B;  3ETR A;  4DHJ D;  3NHE B;  3BYY B;  3W1Y A;  2M8S A;  4LDT B;  1FNU A;  3UF8 A;  2RPQ A;  3MJW A;  2LJ5 A;  3AE8 B;  3WAL A;  3OG5 A;  1SJH D;  3DVG Y;  2PVO D;  5I4D A;  2PJH A;  1JWU D;  1WJ4 A;  4I6P A;  2KX3 A;  3TSS A;  4F8C B;  1F2R I;  4JL9 A;  2WWZ A;  5D94 A;  2X8X X;  1QT9 A;  4B9K A;  1I4G A;  2KQ4 X;  4P1C C;  1WYW B;  3ML9 A;  1LXD A;  4AS1 A;  1NEK B;  5DPR A;  5AEK B;  3APD A;  2FE8 A;  3GE8 C;  1A70 A;  2AWT A;  2WS3 B;  3AM9 A;  3L17 A;  5D7G A;  1GJZ A;  3PHX B;  2HJ8 A;  3I9V 1;  2XBB C;  2RD0 A;  2O6V B;  4EFO A;  1V97 A;  2VH1 A;  5IKC M;  5JH5 C;  4A8X C;  3KUC B;  1OTR B;  2H89 B;  3U30 A;  5GXG B;  1YX5 B;  4BFR A;  3TBL D;  3CF6 E;  3AEE B;  3ZQ4 A;  2KQS A;  4I6N B;  4G50 A;  1RLF A;  1UEL A;  2Y5B B;  2W3R A;  2L3Z A;  4HDQ A;  3LYY A;  3Q8F A;  3B08 A;  4LNI A;  2N7E A;  2L76 A;  4I6L B;  3VH4 B;  3FIL B;  3LDZ E;  1ZPS A;  1YN5 A;  2BWE S;  3WAN A;  4B95 A;  1F2R C;  2KTR B;  4YSY B;  3AEF B;  2N1W A;  5LXH A;  4KVG B;  1VD2 A;  5CHV C;  4W9C A;  3R7Q A;  3VUX A;  4NJC A;  4Q2J A;  2J7Q B;  4GLS C;  2KO3 A;  2KJH B;  2K3U A;  2GLS A;  1LM8 B;  2TSS A;  4LDT D;  4NNJ B;  4ARC A;  3KW5 B;  1K52 A;  1ZE3 D;  2NPT B;  1TYG B;  1PGX A;  4JLC A;  4B0E A;  1HEZ E;  2FIF A;  1LGR A;  2KNB A;  2V3P A;  4ICU A;  3PVL A;  2UYZ B;  1SGH A;  3AEG B;  1FIQ A;  3I3T B;  2ZW0 A;  1Y56 A;  4FXC A;  3BVZ A;  4M00 A;  3ZGZ A;  3Q2A C;  1EO6 A;  1R7S A;  1GB1 A;  2BW2 A;  4BVU C;  3HVD A;  4FJZ A;  2CHX A;  2FCM A;  1WXV A;  2LFI A;  4MSQ B;  2WDQ B;  3APC A;  3PS6 A;  2GOW A;  2NS5 A;  4RCO A;  1C77 A;  1L0Y B;  1I35 A;  2NCN A;  3ALB A;  3PV1 A;  1IGD A;  2JY6 A;  1PDX A;  2KDB A;  2BYE A;  3NG0 A;  2W82 A;  1JWA D;  2VZK D;  3PLU A;  5CTR C;  2KWC A;  1SJE D;  2C9W B;  4YL8 A;  2GMI C;  3ZTD A;  3ECI A;  1JWB D;  3ZDM C;  1E10 A;  3L13 A;  4XDC A;  1FNV A;  2M56 B;  3BVM A;  2N9X A;  3DCG A;  1VRA B;  3GP7 A;  4CYE A;  2O2V A;  2JWZ A;  2ZCC A;  2WGS A;  3EEC A;  3IT4 B;  3Q3N C;  4WQM A;  1ZDX A;  2QIL A;  4RFB A;  2CHZ A;  2KMC A;  4NQK E;  5BMI A;  4DK5 A;  4TQ1 A;  5C1Z A;  2V9H A;  4A90 A;  2KVR A;  1R4M B;  4URK A;  3Q8C A;  3QQ8 B;  5LXI B;  2IO2 B;  3QA8 A;  4IDI A;  1L7Y A;  4LNK A;  4WWN A;  4DHJ B;  1T0Q C;  5IA7 A;  4IM3 A;  2D3B A;  4J6I A;  1BUI C;  1GNU A;  1ISN A;  5D6J B;  3RUL A;  1QOA A;  4ANU A;  4P1B C;  1WGD A;  3UIO B;  2QDF A;  3O65 B;  2ACZ B;  1L0X B;  3N1Z C;  1YQB A;  4TSS A;  1HTQ A;  4XX5 A;  4W9H A;  3QHT A;  3Q8B A;  1XCT L;  2GBJ A;  4XC2 A;  3AN1 A;  1XO3 A;  1MJD A;  4FJY A;  2KWV B;  3IVF A;  1E7P B;  5KHQ A;  3V6E B;  4K1R B;  2JF5 A;  2B3A A;  5LNK 1;  3T9L A;  1N6Z A;  1R4N I;  3PZ7 A;  2NTT A;  4ZRP A;  3E9S A;  2L00 B;  1UZX B;  1VDV A;  2C7M B;  2PEA A;  4NAW B;  2J0M A;  2D3A A;  1Q1O A;  2E3T A;  1SIJ A;  1XLN A;  2LVO A;  3N30 A;  1JRU A;  3DBH I;  3B2G A;  3KLS X;  3W5U B;  1BT0 A;  1YOV B;  4TMA B;  3DHI C;  2N1V A;  2N7D A;  2L83 A;  2H88 B;  2KAN A;  2N7J A;  4GU2 A;  2CHW A;  4A3O A;  5GMV A;  2JUO A;  5TR5 A;  2V4L A;  4KDL B;  3ABV B;  1OGW A;  1MHH E;  4HCN B;  2MA9 B;  4GB9 A;  4A9A A;  2DBY A;  3PRZ A;  4XE0 A;  2KDI A;  4FHK A;  2NTS A;  5CX3 A;  3T3N A;  4G3X B;  4BKG A;  3P63 A;  2LXC A;  2V4I B;  3AU4 A;  2MQJ A;  2D11 A;  1K8R B;  1ZDV A;  2W54 A;  4BKS A;  5EE9 A;  2MJ3 A;  1VJK A;  2EMS A;  3IAM 1;  2IDY A;  1EUV B;  2QC8 A;  3NVY A;  5JZE B;  2ASQ A;  3PGE A;  1KTK A;  3H8H A;  3AED B;  2CU1 A;  2LUM A;  3P2B A;  1K53 A;  4KZC A;  4RGT A;  2OJR A;  4ACF A;  2KC1 A;  3NVW A;  3C8Y A;  3Q6B A;  2HTM E;  3Q14 C;  1D3Z A;  1K50 A;  2DNF A;  1OQR A;  1JW9 D;  2DEN B;  1QOF A;  3DBS A;  5HFY A;  1P9D U;  4GOC A;  1LFD A;  5IOI A;  1V86 A;  1FD6 A;  5AZG A;  1E5W A;  4P7I A;  4TKN A;  4A3P A;  4YWG G;  4GGQ A;  3P4P B;  1WGY A;  3IXS A;  1CK1 A;  1PUT A;  3QWZ B;  3JSV B;  1TGZ B;  2C60 A;  4FAD A;  4XGA B;  1OEY J;  4YXD B;  1R4N B;  3EGR A;  3R66 C;  2WLB A;  2K39 A;  1IPG A;  4F1S A;  4HKQ A;  3K9O B;  4ARI A;  1BXT A;  3IAS 1;  1VR9 A;  3RN9 C;  3H6N A;  4J3O D;  4W9F A;  1S3S G;  3EUB 2;  1P7F A;  2OHF A;  4NY0 A;  3HK0 A;  2J0J A;  2JVC A;  1NVI D;  1E7V A;  2N0S B;  1RYJ A;  2WU5 B;  5EDS A;  2IY1 B;  4II2 B;  1WX7 A;  2DAF A;  5J17 A;  1D5X C;  4C00 A;  1M4V A;  2AX5 A;  2LHD A;  2L1A A;  1E6E B;  1C78 A;  2KDM A;  2VH2 A;  3VH3 B;  4AUQ C;  3SD5 A;  2L0T A;  1MFW A;  4DQO C;  4HPL B;  3ZUN A;  3HHM A;  2G45 B;  1ENF A;  1ZUD 2;  2LJI A;  5H92 C;  1L4Z B;  3RFZ B;  4FUL A;  2C7N B;  2N9P C;  2ICI A;  2J52 A;  1P3Q U;  3BY4 B;  3U7D A;  5AZF A;  3ZVV A;  3NJT A;  3R8B A;  1QOB A;  3DQV A;  3BII D;  1E90 A;  1HE8 A;  4IWP A;  2LZ6 A;  3SEB A;  4X57 B;  2UU7 A;  4MEL A;  3UGB B;  3ZIM A;  3Q8E A;  4WWO A;  3KVF B;  2CKH B;  3NVV A;  3TUO A;  3PLV A;  4NJ6 A;  4RGM A;  2EKI A;  1V5T A;  2KC2 A;  3RNC C;  1SE4 A;  3V05 A;  1RRB A;  3DOW A;  2AL6 A;  4R3D A;  3RZF A;  3RPF C;  2YLM A;  3EFC A;  1MG4 A;  1V1P B;  1WGG A;  4GIV A;  3KUD B;  2JXX A;  4GDK A;  3R3M A;  3VUW A;  1WI0 A;  3ENE A;  3A1Q A;  2KX0 A;  3CWI A;  4M0W B;  1FEH A;  4NPN A;  3RNF C;  3Q8A A;  1T0S C;  3HM3 A;  2NPT A;  4WWM A;  2IY0 B;  1P98 A;  4XZ4 A;  2WDV B;  2LHE A;  2IGD A;  2PVG C;  4EUT A;  1V1P A; 
#chains in the Genus database with same CATH homology
 3DHH C;  3I63 C;  1T0Q C;  2IND C;  3GE8 C;  3N1X C;  1T0R C;  2INC C;  3RNF C;  3N1Y C;  3RNB C;  3Q3N C;  1T0S C;  4P1B C;  3Q3M C;  3RNC C;  3Q3O C;  3Q2A C;  2RDB C;  3N20 C;  3I5J C;  3RI7 C;  3N1Z C;  3RMK C;  3GE3 C;  3RN9 C;  3Q14 C;  4P1C C;  3DHG C;  3RNG C;  3RNA C;  3DHI C;  3RNE C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...