3RNFC

Structure of the toluene/o-xylene monooxygenase hydroxylase t201s/v271a double mutant
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
85
structure length
85
Chain Sequence
ATFPIMSNFERDFVIQLVPVDTEDTMDQVAEKCAYHSINRRVHPQPEKILRVRRHEDGTLFPRGMIVSDAGLRPTETLDIIFMDN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Toluene o-xylene monooxygenase component
publication title Tracking a defined route for O2 migration in a dioxygen-activating diiron enzyme.
pubmed doi rcsb
source organism Pseudomonas sp. ox1
molecule tags Oxidoreductase
total genus 25
structure length 85
sequence length 85
ec nomenclature ec 1.14.-.-:
pdb deposition date 2011-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF06234 TmoB Toluene-4-monooxygenase system protein B (TmoB)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.270 Alpha Beta Roll Ubiquitin-like (UB roll) TmoB-like 3rnfC00
4P1BC 3I5JC 3Q3NC 1T0RC 3DHGC 3N1YC 3RI7C 3Q3OC 1T0SC 4P1CC 3GE8C 3RNEC 2INCC 3RNFC 3RNGC 2RDBC 3N1XC 2INDC 3RNBC 3RN9C 1T0QC 3Q14C 3RNAC 3N1ZC 3GE3C 3Q2AC 3DHIC 3I63C 3Q3MC 3N20C 3RNCC 3DHHC 3RMKC
chains in the Genus database with same CATH superfamily
3U7DA 4XYCA 3V3XA 1FD6A 1OQRA 4GDLB 3KUZA 1T5XD 1K8RB 3B9JA 2KTRB 2Z8LA 3AMZA 2AL3A 3ZKJC 4OVUA 3BZDB 2GBKA 5I4DA 2CJOA 2MH7A 3QHTA 5E6OA 2GBNA 4LDTB 2WX1A 2K6QA 2J4XA 3VUXA 2M1MA 3MC8A 3VRBB 1IGCA 2KTRA 2HDEA 4XDDA 2N9KA 2B76B 1NEKB 2N1WA 3CSTA 3JSVB 1KF6B 3N32A 3AU4A 3FC4A 5D3IB 5T8IA 2WDTB 4JPSA 5AZGA 2CJNA 3HM3A 1QZEA 1N5WA 2QJLA 4KZCA 2KT7A 4ANUA 3Q3OC 2INCC 4HWIB 1GB4A 5BO4B 4N58A 2AYOB 2IJ0A 5BMHA 1ZUD2 2DAJA 2Y5BB 3RNAC 2I1JA 2O2VB 3NG0A 4RFBA 3BK1A 1CZPA 4D2KA 2WDQB 3DHHC 3RMKC 1D3ZA 2B3AA 3EA6A 3EFUA 3FKYA 4F8CB 4KKJA 4L2YA 5C23A 1E0ZA 2OJWA 4NNJB 1YJJA 4ANXA 2QEJC 2KC2A 3ZW3A 2O2VA 2Z0DB 1K53A 3NUHB 4Q2JA 3GP7A 2BKFA 3AECB 4TUUA 2PVGC 3OWEB 1OQYA 1OGWA 4M02A 1SB3C 3QX1A 4KSKC 2KQSA 1RAXA 2KAJA 1DOIA 5MPOA 2MSED 2FCSA 3ZXVA 2ZEQA 2V3SA 4BFRA 4LCDE 4II3B 3DWMA 1IP9A 2MBQA 3IG3A 3R3MA 1QQRA 2G4DB 4KDIC 2IDYA 4YSZB 1VLBA 3FILA 2K3UA 1FMAD 2AQ2B 4ZRQA 2AWTA 5J2RA 4N59A 5LXHA 1BXTA 2X38A 3I5JC 1V5TA 5GMVA 2WYQA 2GOWA 1KLVA 3X23A 2ICIA 1VZ6A 5FR6A 2MJ3A 4B0EA 3QIJA 3J9CA 4RCOA 3MJ5A 3KLSX 4BOZB 2LRUA 4LNNA 3TSSA 4A90A 3IFWB 1JROA 4HJGE 1YN3A 3E56A 3CWIA 2G1EA 3IBEA 2MA9B 3LB8C 3SU8X 2HD5B 2YVCA 5BYSA 2NR2A 2MLBA 2N1VA 2UYZB 1EF1A 4PS8A 3OAWA 3TIXA 3ZUNA 3B1LX 1WRDB 1PYWD 2K8BA 5DPRA 3AU5A 3IT6B 2WQYB 2LD9A 1TYGB 2K9XA 3W5UB 2JU6X 2ONQA 4MM3A 2M0XA 4W9HA 3BINA 3VUYA 3NVVA 2BYEA 4YSXB 4MT5A 2KVRA 4LLGM 3Q8EA 4IWOA 2MBEA 4FHJA 2FCNA 4WJNA 3A1QB 3BVZA 4NAWB 1J8CA 3ETRA 1J19A 1XF5L 2ZPNA 4ZOHC 4ZYSA 2KMAA 5TR5A 5L95C 1WRIA 3TL5A 1Z5SB 3KYDD 1GJZA 1WGYA 2J42A 2QMTA 3AEBB 4DXAB 1D6EC 2EMSA 3NZUA 2GI9A 3DBLB 3NZSA 2LJ5A 4ARCA 2RPVA 3TEZA 3QAQA 5EDSA 5EE3A 2KDEB 4WQMA 4HK2A 2WXPA 4K3CA 3AEEB 5IN7A 4DXFA 2JPHA 1WX7A 3CF6E 2KK8A 4EEWA 2GMIC 4B6WA 1DYQA 3H9DA 2AQ3B 3GZNB 2K1FA 4KGSA 2KANA 4LJOB 2MHJA 3URYA 4DXGA 1OTRB 3KUCB 1V97A 4HDQA 1N6ZA 2BPSA 1BMLC 4AQ7A 1OQQA 2BTEA 5CTRC 1XLPA 4ZDVA 2KN5A 4B0MA 3PZ8A 1AWDA 2NMQA 4DHZE 4TV3A 3RZWC 2WXLA 3H8HA 4W9JA 3V61A 1GPXA 2CU3A 3IXSA 1NI3A 3OLMD 3TUOA 3EECA 1IBXB 1P98A 3QCAA 1B1ZA 3DVNV 1JW9D 1E7VA 3VDZA 2PKOA 1GOZA 4JIOU 4K7WA 2NTTA 4EE2A 1FRRA 2Z59B 3W2DA 3D32A 3BK2A 1D5MC 2CHZA 1RFKA 2JYTA 5AEKB 3NOBA 2RMMA 2ZCCA 1FXIA 2IGGA 4FN2A 1J7BA 4PK1A 4MSQB 3Q6BA 4XZ4A 3SR6A 2AQ1B 1V1PA 3O13A 3JYUA 3ZNID 4REZA 1N62A 2M17A 4ZHPA 2MBOA 1WMHB 3H6NA 3L17A 4HLEA 1C79A 3AE6B 3IVFA 4I6NB 2MJEA 1L7YA 2M8SA 2LGSA 4EUTA 4IC7B 4GMVA 4FBJB 2FUHB 3UQBA 2J0MA 2BGFA 4W9FA 4M0WB 2JQRB 3WAOA 5IA7A 4HCNB 4GIVA 1SJHD 2V0GA 3B0AA 3AE1B 4B9KA 4NPNA 3B2GA 1ZGUB 3QWZB 2OHFA 2V9HA 3V62A 2WP9B 2LWPA 2N7DA 2QILA 1PGBA 3WAMA 2ZPYA 2WS3B 3W9CB 1OFFA 3KW5B 2SEBD 4M0WA 2FCQA 1QT9A 3M95A 1EF5A 1WJ6A 1HEZE 3ENEA 2CS4A 2G3QB 3DCGA 3UF8A 2WXMA 3Q8CA 5EE1A 3CMMB 1WE6A 1QILA 2G4SA 2VH2A 5IAAC 1T0RC 4MJSA 2LGYA 1ISNA 2JXTA 4PT5A 2D11A 2BS3B 2ZVOA 1NBFC 3EGRA 4JGHB 1WH3A 4IUMB 1YJIA 4NAMA 2AEHA 4ANVA 3MP9A 1UWMA 3IAS1 1QOFA 4ASWC 3R7QA 1XXGA 2E6XA 2OEDA 3APDA 3NS1A 2L00B 4USAA 3DVNU 1N63A 4MGKE 3RNBC 1YD8U 5EE0A 1FCCC 3APFA 2IY0B 2WGSA 1R4NB 1SJED 3ZNHB 1LO5D 3ZJTA 1K52A 4HPMB 2PEAA 1FRDA 5C2TB 2XEWA 2RGFA 2H89B 1MJDA 1P7FA 2JZPA 3N1XC 3VR8B 1D4BA 5HG2A 1I4PA 2V4LA 3TJPA 1SGHA 2KWVB 4P6VF 1I4HA 4TMAB 1ROEA 3A9JB 4MH8A 3HHMA 1HXYD 2JZ3B 5D6JB 1L4DB 5FK9C 1JWBD 1S1QB 1C78A 2HJ1A 1MVKA 3TBLD 1YNTE 5LLIA 1IGDA 2MQJA 4RMAA 2R2QA 4EOYA 3A9KB 1WGKA 5LXIB 1XCQL 1WGRA 2N9EB 3QA8A 2C60A 1WM3A 4K81A 4DK5A 2JT4B 4WAFA 1WX8A 1XD3B 3MHZA 1V5OA 3M62B 2BQQA 3MTNB 2KFKA 1XO3A 3VFKA 4XDCA 2LASA 2PIAA 3AXCA 2QDFA 5H92C 2W9NA 2XBBC 1JMLA 5D2MB 1RWSA 3ZTDA 1FIQA 2W82A 1AN8A 1STEA 1KH0A 3H1UA 3N3KB 3JVZX 4LNOA 1JCKB 1FM0D 4DBGA 3WIMA 4DDID 1F9JA 3GS2A 1L0VB 2WXGA 1JRPA 1IUEA 4EFOA 1N61A 1FO4A 3HK0A 2NBWB 1Q0WB 5GXGB 1T0YA 1E6EB 2MEKA 4OZCA 3ZRFA 2L32A 5KHOA 2JF5A 3RZFA 3Q69A 2G9HD 3H7SA 3QC8B 2JUOA 2JWUA 4W9DA 2KXJA 4LTUA 1VRAB 1EU4A 3N1ZC 2M19A 2NS5A 2XN9C 3AE3B 4FJVB 2BKRB 3AM9A 3R66C 2KJ6A 3K9PB 1EO6A 4FXCA 5AUIA 1WXQA 1J0GA 1VD2A 4AS1A 3PS6A 3PT2B 3RUIB 2D3BA 2L0FA 2KWDA 2LI5A 4JX1C 1S3SG 3C0RB 3PO0A 4WWOA 3SHQA 2PJHA 3A33B 1N5XA 3UGBB 1YN4A 2K22A 4GDKA 4EKUA 4ZRPA 2INNE 4F1SA 1NYQA 2LMCA 3APCA 1C9FA 1C77A 4KKIA 4MGYE 3T3OA 1NDDA 2G45B 4RH6A 4BKSD 4RM9A 3ZNZB 4AOFA 3AE4B 3Q3NC 2V1YA 1PFDA 4A9AA 2JWZA 1E8XA 2C7MB 2KTFA 1AW7A 2N4FA 4P16A 3FILB 2IZVB 3SEBA 1T3QA 4W9IA 3RYTA 2CKHB 4W9KA 3NZ3A 4GGQA 3ZO5B 3B2FA 5FKAC 2D3CA 4PYZA 3NS8A 4JWSC 1XQQA 2LJIA 2J52A 4A8XC 1OEYJ 2BS4B 3LDZE 4GLSC 4WIPA 2DYMA 2KYWA 1V8CA 2M0AA 1ZDXA 1WGHA 2WXFA 1FEHA 4C80A 5AZFA 2LGIA 4MELA 2KN4A 2NTSA 3QQ8B 2INDC 3P2BA 2LXCA 4KZ0A 4NJ6A 4MM3B 2KLCA 1SIFA 2I38A 1RYJA 2PPHA 1RLFA 2RR9A 3ABVB 2JX5A 3DDCB 4J3OD 2GBMA 2H88B 4FHKA 3VTWA 1YJ1A 3Q8AA 1HZ6A 2LGDA 4IM2A 1JWMD 1TBEA 4GN1A 3RULA 2L05A 4BKTA 2RSUA 1BUIC 4W9EA 1GG3A 1WX9A 2IO1B 2X8XX 3ZNGC 3K9OB 4HPPA 1KM7A 3PRMB 2NCNA 3ML9A 2Y5CA 1M4VA 2K8CA 1D5ZC 1WIAA 2PTLA 4C7ZA 2KDIA 3C8YA 2N7JA 2V3NA 3SD5A 4E3CA 1V6EA 4HRSA 4IM3A 1ET6A 1EWCA 4WWPA 4KIKA 2RDGA 4M00A 1WM2A 4US9A 1C4CA 3W1YA 1ESFA 3RFZB 1F0ZA 1H4RA 1MG4A 2RDHA 4FULA 4ICUA 4OHJA 3TCAA 1Z2MA 1K50A 4HJKA 1P1AA 2R2OA 4FLHA 3TMPB 3KVFB 4YL8A 4YT0B 1DOYA 2N0SB 4IOIE 1L4ZB 4LNFA 1WGDA 2MJDA 3U8ZA 2R61A 5G5HA 5JH5C 5DCNA 2INPE 4CQNA 2C7NB 1E8ZA 4LK0M 1I4XA 1E5WA 1HTQA 3EHVA 1LGRA 4BOSC 3UQAA 3QJZA 1B9RA 3P4SB 3HIZA 2C7HA 2Z0EB 3LXFA 2DWQA 2LUEA 4EZLA 5JHAA 2VZKB 3GE3C 4DWFA 3HVDA 4US8A 4IW0A 2IPKD 2MWSB 4A20A 2QHOA 5G2NA 2WU2B 2L76A 3AN1A 3WA0A 1AARA 4YTMB 2N7EA 3ZJVA 3HRDD 3DBLI 3R8BA 2GLSA 5H8YE 5JZEB 1Q10A 3BYYB 2Q5WD 2ZNVC 3X0WA 1GUAB 1DOXA 2IO0B 2DZMA 4PS3A 1LXDA 1NYRA 2KVZA 1I4QA 4MACA 4PYUA 2KJHB 4B95A 3QARA 2MW5A 4JLCA 1WF9A 2ZJDA 4G50A 1TS2A 2HJ8A 3GZNI 1V1PB 4M8MA 2QSDA 1RRBA 1TS4A 1SBBB 1V49A 2NBVB 1ENFA 4UDUC 4HXDA 3Q8FA 2DYOA 1EWYC 4I6LB 4P1BC 3DHGC 2L7RA 2FAZA 5CHFA 1FFVA 2L8JA 2WXOA 2IY1B 3VHTC 3B08A 1SSNA 1C76A 1WXAA 2K39A 2K25A 3A4RA 1M94A 2BWFA 2BYTA 1V81A 2WXJA 4HDOA 2W3SA 1I7HA 4TKNA 4S0RA 1TY0A 3NVYA 1ZDVA 4P1CC 1GNUA 1ET9A 2PE6B 2KMCA 4LNIA 4I6PA 1VDVA 4RGOS 2WXQA 1FNVA 1J7CA 1WJ4A 2REXA 4XE0A 4G11A 1FXTB 4MSMB 2WDVB 2KHWB 2VZKD 4WWMA 1ZXIA 4BBNF 4MJSB 3U52E 2N9PC 2JYEA 1WJUA 1JQ4A 3WAPA 1TGZB 2XK5A 3DOWA 1L0XB 1L2NA 3ZGZA 3UIOB 4FJYA 4CHKA 3V60A 5DPTA 1E7UA 1N60A 2MBHA 4DQOC 2LFIA 3S2AA 3VQIA 3P42A 1YQBA 2MX2A 1R7SA 5BMGA 1X1MA 2FIFA 2KD0A 1TIFA 1TTNA 1TS5A 3ZLZA 3L08A 3R7RA 1I35A 1Y56A 3DPDA 1J7AA 2PVOD 4A3OA 1P0RA 3UINB 2DLBA 3RNFC 2KX3A 1WJNA 1CK1A 3AE8B 3DVGY 4G0NB 4WAAA 2AL6A 3N9YC 3RCZA 1LFDA 5IKCM 3PSEB 3VTVA 1PQSA 3P1MA 2WXNA 3RNCC 1QF6A 2NVUI 3ZYYX 2A4ZA 2GBJA 2KDMA 3PHWB 2D5GA 3U2SC 3I57A 2DZKA 3L54A 5FR3A 3OJ4B 1MPEA 1ZXHA 2PE9A 1V86A 1R4MB 1GB1A 4HROA 5EE9A 4NQLB 4ARIA 1TKGA 1UH6A 3ZXRA 3E9SA 5HI1A 2GRIA 2LHDA 3DQVA 2WX0A 3DBRB 3VRAB 1YIWA 2BBCA 2WLBA 1JWSD 3PVLA 4ZRKA 3MHSD 1GC6A 2WNMA 4WJPA 2Y3AA 2KFKB 2UU7A 4C00A 3AE7B 3VXWA 3DHIC 2FBWB 1R4NI 4XWWA 3WCQA 4JE3B 1WWTA 1ZW7A 1QOBA 5J18A 1WZ3A 3L4PA 3P4PB 4WH4A 1WXMA 4PS7A 3IHPC 1KRHA 3NVZA 2CU1A 1L6UA 2GBRA 1HQRD 2DX5B 1L0YB 2KX0A 3T8MA 1TZ1A 2DZJA 4K3BA 5DPSA 1VZ7A 3DBSA 2L1AA 2J0KA 1YQ3B 2KKCA 2KDFB 5C1ZA 1HA5A 1HTOA 3AE2B 2JZZA 2DYBA 5D94A 4XGAB 2ZW1A 2KFJA 3U4EG 2C9WB 3H7PA 2BB6A 3ZQ4A 3VAWA 2KC1A 1JRUA 1MHXA 1U4AA 3UIPB 3PHXB 4C7YA 4GXBA 4DDGD 4AJYB 3WANA 2LVPA 2N9XA 2W54A 3PZ7A 1PGXA 2L3ZA 1UWXA 3A4SC 4JL9A 3U7ZA 4A6QA 1AYFA 4LNKA 1YN5A 2CHXA 2KWCA 1SE2A 3AE5B 3ZIMA 3AEGB 3KQ4A 4HKQA 2AX5A 4KV2A 1QLBB 3T3NA 4C4VB 3W1SC 1F2RI 3KWLA 4GDKB 2C5LC 4WURA 4AWJA 1MHHE 4YTPB 3RN9C 5TSSA 1WR1A 2EKEC 3Q14C 2DNFA 3AI5A 2IBIB 1SE9A 1P3QU 4OZAA 1I4RA 2YLMA 4RM8A 2BWES 2I2YA 1KFYB 1V1OA 4N9F4 4GDLA 4C4VA 3ONSA 4WQOB 3WALA 5C3JB 1F52A 4MEMA 1T0QC 1I4GA 2PLPA 3ML8A 1V80A 3W5VB 2D10A 2D2QA 1ZE3D 3T9LA 1F77A 3N20C 1Y8RC 1QOGA 3NY5A 4DHZB 2KQ4X 2V4IB 3GOEA 2LVQA 3GE8C 3LYYA 1SE3A 4OVZA 1KLUD 4OZBA 3JSVA 3PLUA 3N30A 4JQWC 3ZJUA 2OJRA 3NJTA 2A5UA 2L83A 2L52A 2L0TA 2M4NA 2ZCBA 1CMXB 1L6VA 4IWQA 3BYTB 2KNBA 4WWNA 1UELA 1VZ8A 3GB1A 1FCLA 2BB5A 2XNAC 1FXAA 1Q5WB 2RD0A 4DHJB 3RD2A 2ACZB 5BMIA 1OEYA 5BYRA 3C19A 3EUB2 1EUVB 3IAM1 1ZPSA 4K7SA 1WXSA 4BZAA 1GC7A 2KZRA 3MFGA 5JXVA 2NBUA 4H2AA 4O1NA 4K1RB 4RF1A 2CHWA 1WGGA 2KO3A 4NJ7A 2WXHA 3I9V1 2K0PA 2QCZA 2IGHA 2DENB 2ZZPB 2SAKA 2WU5B 3EFCA 3SDLC 5CHWA 5AZHA 4RGNA 4LDTD 3W1SA 2E3TA 3V05A 3L16A 4X57B 4M8NA 4CYEA 1YMHE 2KQ7A 1PUTA 2KMMA 2EMTA 5D7GA 4KIKB 1QOAA 3SFDB 3VR9B 2KACA 1TKEA 1HE8A 1ACCA 3VVWB 4C56C 1UF0A 1RM6C 1E8YA 1NVID 5IP4D 3RPFC 3MJWA 3SFEB 4RF0A 4AUQC 3MC0B 1MFWA 1WI0A 4W9GA 5HHDG 1SXTA 1TKYA 1WXVA 2MCNB 3PLVA 1XLQA 4L23A 3PV1A 4P7IA 2WXRA 3EC8A 1KJTA 5L83A 1PDXA 1SEBD 3AEDB 1T0SC 3PRPB 2V3PA 4WJQA 5G5GA 4G3XB 3O65B 1RFAA 4II2B 4HPLB 1UGJA 4ACFA 4BVUC 1CQVA 1SE4A 3TEYA 3ZDTA 5DPWA 2RPQA 1KOTA 3LJ3A 4HCPB 1UD7A 2BF8B 2JRHA 3VH3B 2Y5PA 2IO3B 1LM8B 4DHJD 4KGRA 2BVCA 3PTFC 1P9DU 2IYDB 3A1QA 3DBHB 3BVMA 4NAWA 4QAYA 5AUKA 3RNGC 2RDBC 3BVGA 2MBBB 3Q3FA 2ON8A 3KYCD 1DGJA 1C4AA 2O6VB 4NY0A 2W55A 3AULA 4W9LA 2HE7A 2BT6A 2LVOA 1WFYA 1A70A 1IPGA 3ZVVA 4KVGB 2WXKA 2O6VA 1EM7A 1D5XC 2KOXA 4W9CA 3KH0A 3AB5A 1YX5B 3ALBA 4FADA 4K7UA 1TJEA 4TQ1A 3Q3JA 2WWZA 4RNAA 1YOVB 3VTUA 4ZRIA 4WJOA 1ZP0B 4NQKE 1SIJA 4F7ZA 1MI0A 2BW2A 3PRZA 3FAHA 2FE8A 1JALA 5IO9A 3AEFB 1JWAD 2KDBA 3DBHI 2VRRB 2YEPB 3OJ3A 4NZLB 2DHZA 2KJRA 3CSFA 1XLNA 1PGAA 5LNK1 3JW0X 3AH7A 4GSWA 1C4PA 4IWPA 4ZRJA 4BAXA 5CX3A 4CO7A 2FCMA 2K6DB 2LZ6A 1WE7A 4HKZE 3U30A 5BYQA 2DBYA 4FA6A 1UBIA 2EKIA 2VH1A 5KHQA 1IBXA 4XX5A 2OOBB 3IT4B 3TEXA 3ECIA 1E7PB 2IO2B 2NPTB 3MC9A 1WY8A 2BYFA 1TT5B 4L1BA 4AJWA 2EELA 4MDKE 4GB9A 2J53A 2K5PA 5JHBA 2J7QB 2BS2B 1HZ5A 4XWTA 5E6JA 2N9LA 3PZDA 2XK5B 4YSYB 1WR6E 2DZIA 3Q3MC 2LEKA 1T6BX 2PW9A 2O6VD 3NRZA 2NPTA 3P63A 4IM0A 4M01A 1XEEA 1XCTL 3KUDB 5HFYA 3NHEB 3P4QB 3Q8BA 4OW0A 1FNUA 2BYVE 4JWUC 1K51A 2J0JA 2JVCA 1IYFA 3AE9B 4HEA1 4ANWA 3L10B 3PGEA 1WMHA 2LGXA 5CHVC 1QKZA 5E6PA 1C1YB 2KWUB 3L13A 3DWGC 4ZYNA 2WHIA 4LJPB 1P7EA 1WYGA 4FJZA 1UBQA 4XC2A 2MP2B 2ZNVB 3L0WB 1TY2A 3ZRCA 4R3DA 1JWUD 4RGTA 2LXAA 3R2TA 1UUPA 1I42A 3I3TB 4HVBA 1L5PA 4MH0E 1KLGD 2D3AA 3RNEC 4ICVA 2MP2A 1NI2A 3HM6X 1TS3A 1VCBA 4IG7B 1V2YA 3BY4B 1F2RC 1KTKA 2D3GA 3HUIA 1EU3A 1XT9B 4GOCA 5HKHA 3I63C 3AEAB 3ZTCA 1WZ0A 4KX6B 2QIEB 1UZXB 1C3TA 2ZVNA 2HTME 4YXDB 3BIID 2WDRB 4GU2A 4URKA 1H8CA 2CR5A 1WSPA 3KWVA 3VUWA 2JXXA 1UGMA 1E9MA 1FNWA 3M63B 1Q1OA 2JRIB 4E74A 3ZDMC 4IKGA 3PREA 3HVZA 1E10A 1MG8A 2PMVA 1CJEA 2IGDA 3RT3B 1UNSA 4IDIA 3OG5A 2GB1A 4OVVA 2QC8A 2M56B 4RGMA 4ZHOA 3V6CB 1FPYA 3VH4B 3M3JA 5D3DA 3P4RB 4YWGG 2FIDA 3RI7C 2DAFA 1ZOYB 2UWQA 4EZJA 2LHEA 2JSVX 1BT0A 4TQ0A 4N6EB 5G55A 1VR9A 2LUMA 3AV8A 4MGIE 3UI3A 2I1KA 3A9JA 4EZKA 3NVWA 1R4MI 4A3PA 2HTHA 2KLGA 4KGTA 4E71A 2JY6A 3Q2AC 1NENB 1TZOA 3DVGX 2WXIA 3H7PB 3V6EB 4A55A 3N1YC 4YTNB 4AP4C 3CIRB 1VJKA 3DBRI 1E8WA 2LRWA 3BWUD 4TSSA 1ZKHA 1YX6B 1A5RA 1E90A 3A9KA 4J6IA 4NJCA 4MGZE 4S17A 4KSLC 1FFUA 3TEWA 5IOIA 4ITKA 1XLOA 2ASQA 4BBNC 4BKSA 1G6JA 2K8HA 2FUG1 2D07B 1YQ4B 2MRPA 3QK0A 2ZW0A 3PPAA 5E6NA 1WYWB 1SF0A 1GAQB 4KDLB 2W3RA 4BKGA 3R2IA 1F1HA 2TSSA 1V9JA 2FNJB 2YEPF 5J17A 1LQBA
chains in the Genus database with same CATH topology
4P1BC 3I5JC 3Q3NC 1T0RC 3DHGC 3N1YC 3RI7C 3Q3OC 1T0SC 4P1CC 3GE8C 3RNEC 2INCC 3RNFC 3RNGC 2RDBC 3N1XC 2INDC 3RNBC 3RN9C 1T0QC 3Q14C 3RNAC 3N1ZC 3GE3C 3Q2AC 3DHIC 3I63C 3Q3MC 3N20C 3RNCC 3DHHC 3RMKC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P1B C;  3I5J C;  3Q3N C;  1T0R C;  3DHG C;  3N1Y C;  3RI7 C;  3Q3O C;  1T0S C;  4P1C C;  3GE8 C;  3RNE C;  2INC C;  3RNF C;  3RNG C;  2RDB C;  3N1X C;  2IND C;  3RNB C;  3RN9 C;  1T0Q C;  3Q14 C;  3RNA C;  3N1Z C;  3GE3 C;  3Q2A C;  3DHI C;  3I63 C;  3Q3M C;  3N20 C;  3RNC C;  3DHH C;  3RMK C; 
#chains in the Genus database with same CATH topology
 3U7D A;  4XYC A;  3V3X A;  1FD6 A;  1OQR A;  4GDL B;  3KUZ A;  1T5X D;  1K8R B;  3B9J A;  2KTR B;  2Z8L A;  3AMZ A;  2AL3 A;  3ZKJ C;  4OVU A;  3BZD B;  2GBK A;  5I4D A;  2CJO A;  2MH7 A;  3QHT A;  5E6O A;  2GBN A;  4LDT B;  2WX1 A;  2K6Q A;  2J4X A;  3VUX A;  2M1M A;  3MC8 A;  3VRB B;  1IGC A;  2KTR A;  2HDE A;  4XDD A;  2N9K A;  2B76 B;  1NEK B;  2N1W A;  3CST A;  3JSV B;  1KF6 B;  3N32 A;  3AU4 A;  3FC4 A;  5D3I B;  5T8I A;  2WDT B;  4JPS A;  5AZG A;  2CJN A;  3HM3 A;  1QZE A;  1N5W A;  2QJL A;  4KZC A;  2KT7 A;  4ANU A;  3Q3O C;  2INC C;  4HWI B;  1GB4 A;  5BO4 B;  4N58 A;  2AYO B;  2IJ0 A;  5BMH A;  1ZUD 2;  2DAJ A;  2Y5B B;  3RNA C;  2I1J A;  2O2V B;  3NG0 A;  4RFB A;  3BK1 A;  1CZP A;  4D2K A;  2WDQ B;  3DHH C;  3RMK C;  1D3Z A;  2B3A A;  3EA6 A;  3EFU A;  3FKY A;  4F8C B;  4KKJ A;  4L2Y A;  5C23 A;  1E0Z A;  2OJW A;  4NNJ B;  1YJJ A;  4ANX A;  2QEJ C;  2KC2 A;  3ZW3 A;  2O2V A;  2Z0D B;  1K53 A;  3NUH B;  4Q2J A;  3GP7 A;  2BKF A;  3AEC B;  4TUU A;  2PVG C;  3OWE B;  1OQY A;  1OGW A;  4M02 A;  1SB3 C;  3QX1 A;  4KSK C;  2KQS A;  1RAX A;  2KAJ A;  1DOI A;  5MPO A;  2MSE D;  2FCS A;  3ZXV A;  2ZEQ A;  2V3S A;  4BFR A;  4LCD E;  4II3 B;  3DWM A;  1IP9 A;  2MBQ A;  3IG3 A;  3R3M A;  1QQR A;  2G4D B;  4KDI C;  2IDY A;  4YSZ B;  1VLB A;  3FIL A;  2K3U A;  1FMA D;  2AQ2 B;  4ZRQ A;  2AWT A;  5J2R A;  4N59 A;  5LXH A;  1BXT A;  2X38 A;  3I5J C;  1V5T A;  5GMV A;  2WYQ A;  2GOW A;  1KLV A;  3X23 A;  2ICI A;  1VZ6 A;  5FR6 A;  2MJ3 A;  4B0E A;  3QIJ A;  3J9C A;  4RCO A;  3MJ5 A;  3KLS X;  4BOZ B;  2LRU A;  4LNN A;  3TSS A;  4A90 A;  3IFW B;  1JRO A;  4HJG E;  1YN3 A;  3E56 A;  3CWI A;  2G1E A;  3IBE A;  2MA9 B;  3LB8 C;  3SU8 X;  2HD5 B;  2YVC A;  5BYS A;  2NR2 A;  2MLB A;  2N1V A;  2UYZ B;  1EF1 A;  4PS8 A;  3OAW A;  3TIX A;  3ZUN A;  3B1L X;  1WRD B;  1PYW D;  2K8B A;  5DPR A;  3AU5 A;  3IT6 B;  2WQY B;  2LD9 A;  1TYG B;  2K9X A;  3W5U B;  2JU6 X;  2ONQ A;  4MM3 A;  2M0X A;  4W9H A;  3BIN A;  3VUY A;  3NVV A;  2BYE A;  4YSX B;  4MT5 A;  2KVR A;  4LLG M;  3Q8E A;  4IWO A;  2MBE A;  4FHJ A;  2FCN A;  4WJN A;  3A1Q B;  3BVZ A;  4NAW B;  1J8C A;  3ETR A;  1J19 A;  1XF5 L;  2ZPN A;  4ZOH C;  4ZYS A;  2KMA A;  5TR5 A;  5L95 C;  1WRI A;  3TL5 A;  1Z5S B;  3KYD D;  1GJZ A;  1WGY A;  2J42 A;  2QMT A;  3AEB B;  4DXA B;  1D6E C;  2EMS A;  3NZU A;  2GI9 A;  3DBL B;  3NZS A;  2LJ5 A;  4ARC A;  2RPV A;  3TEZ A;  3QAQ A;  5EDS A;  5EE3 A;  2KDE B;  4WQM A;  4HK2 A;  2WXP A;  4K3C A;  3AEE B;  5IN7 A;  4DXF A;  2JPH A;  1WX7 A;  3CF6 E;  2KK8 A;  4EEW A;  2GMI C;  4B6W A;  1DYQ A;  3H9D A;  2AQ3 B;  3GZN B;  2K1F A;  4KGS A;  2KAN A;  4LJO B;  2MHJ A;  3URY A;  4DXG A;  1OTR B;  3KUC B;  1V97 A;  4HDQ A;  1N6Z A;  2BPS A;  1BML C;  4AQ7 A;  1OQQ A;  2BTE A;  5CTR C;  1XLP A;  4ZDV A;  2KN5 A;  4B0M A;  3PZ8 A;  1AWD A;  2NMQ A;  4DHZ E;  4TV3 A;  3RZW C;  2WXL A;  3H8H A;  4W9J A;  3V61 A;  1GPX A;  2CU3 A;  3IXS A;  1NI3 A;  3OLM D;  3TUO A;  3EEC A;  1IBX B;  1P98 A;  3QCA A;  1B1Z A;  3DVN V;  1JW9 D;  1E7V A;  3VDZ A;  2PKO A;  1GOZ A;  4JIO U;  4K7W A;  2NTT A;  4EE2 A;  1FRR A;  2Z59 B;  3W2D A;  3D32 A;  3BK2 A;  1D5M C;  2CHZ A;  1RFK A;  2JYT A;  5AEK B;  3NOB A;  2RMM A;  2ZCC A;  1FXI A;  2IGG A;  4FN2 A;  1J7B A;  4PK1 A;  4MSQ B;  3Q6B A;  4XZ4 A;  3SR6 A;  2AQ1 B;  1V1P A;  3O13 A;  3JYU A;  3ZNI D;  4REZ A;  1N62 A;  2M17 A;  4ZHP A;  2MBO A;  1WMH B;  3H6N A;  3L17 A;  4HLE A;  1C79 A;  3AE6 B;  3IVF A;  4I6N B;  2MJE A;  1L7Y A;  2M8S A;  2LGS A;  4EUT A;  4IC7 B;  4GMV A;  4FBJ B;  2FUH B;  3UQB A;  2J0M A;  2BGF A;  4W9F A;  4M0W B;  2JQR B;  3WAO A;  5IA7 A;  4HCN B;  4GIV A;  1SJH D;  2V0G A;  3B0A A;  3AE1 B;  4B9K A;  4NPN A;  3B2G A;  1ZGU B;  3QWZ B;  2OHF A;  2V9H A;  3V62 A;  2WP9 B;  2LWP A;  2N7D A;  2QIL A;  1PGB A;  3WAM A;  2ZPY A;  2WS3 B;  3W9C B;  1OFF A;  3KW5 B;  2SEB D;  4M0W A;  2FCQ A;  1QT9 A;  3M95 A;  1EF5 A;  1WJ6 A;  1HEZ E;  3ENE A;  2CS4 A;  2G3Q B;  3DCG A;  3UF8 A;  2WXM A;  3Q8C A;  5EE1 A;  3CMM B;  1WE6 A;  1QIL A;  2G4S A;  2VH2 A;  5IAA C;  1T0R C;  4MJS A;  2LGY A;  1ISN A;  2JXT A;  4PT5 A;  2D11 A;  2BS3 B;  2ZVO A;  1NBF C;  3EGR A;  4JGH B;  1WH3 A;  4IUM B;  1YJI A;  4NAM A;  2AEH A;  4ANV A;  3MP9 A;  1UWM A;  3IAS 1;  1QOF A;  4ASW C;  3R7Q A;  1XXG A;  2E6X A;  2OED A;  3APD A;  3NS1 A;  2L00 B;  4USA A;  3DVN U;  1N63 A;  4MGK E;  3RNB C;  1YD8 U;  5EE0 A;  1FCC C;  3APF A;  2IY0 B;  2WGS A;  1R4N B;  1SJE D;  3ZNH B;  1LO5 D;  3ZJT A;  1K52 A;  4HPM B;  2PEA A;  1FRD A;  5C2T B;  2XEW A;  2RGF A;  2H89 B;  1MJD A;  1P7F A;  2JZP A;  3N1X C;  3VR8 B;  1D4B A;  5HG2 A;  1I4P A;  2V4L A;  3TJP A;  1SGH A;  2KWV B;  4P6V F;  1I4H A;  4TMA B;  1ROE A;  3A9J B;  4MH8 A;  3HHM A;  1HXY D;  2JZ3 B;  5D6J B;  1L4D B;  5FK9 C;  1JWB D;  1S1Q B;  1C78 A;  2HJ1 A;  1MVK A;  3TBL D;  1YNT E;  5LLI A;  1IGD A;  2MQJ A;  4RMA A;  2R2Q A;  4EOY A;  3A9K B;  1WGK A;  5LXI B;  1XCQ L;  1WGR A;  2N9E B;  3QA8 A;  2C60 A;  1WM3 A;  4K81 A;  4DK5 A;  2JT4 B;  4WAF A;  1WX8 A;  1XD3 B;  3MHZ A;  1V5O A;  3M62 B;  2BQQ A;  3MTN B;  2KFK A;  1XO3 A;  3VFK A;  4XDC A;  2LAS A;  2PIA A;  3AXC A;  2QDF A;  5H92 C;  2W9N A;  2XBB C;  1JML A;  5D2M B;  1RWS A;  3ZTD A;  1FIQ A;  2W82 A;  1AN8 A;  1STE A;  1KH0 A;  3H1U A;  3N3K B;  3JVZ X;  4LNO A;  1JCK B;  1FM0 D;  4DBG A;  3WIM A;  4DDI D;  1F9J A;  3GS2 A;  1L0V B;  2WXG A;  1JRP A;  1IUE A;  4EFO A;  1N61 A;  1FO4 A;  3HK0 A;  2NBW B;  1Q0W B;  5GXG B;  1T0Y A;  1E6E B;  2MEK A;  4OZC A;  3ZRF A;  2L32 A;  5KHO A;  2JF5 A;  3RZF A;  3Q69 A;  2G9H D;  3H7S A;  3QC8 B;  2JUO A;  2JWU A;  4W9D A;  2KXJ A;  4LTU A;  1VRA B;  1EU4 A;  3N1Z C;  2M19 A;  2NS5 A;  2XN9 C;  3AE3 B;  4FJV B;  2BKR B;  3AM9 A;  3R66 C;  2KJ6 A;  3K9P B;  1EO6 A;  4FXC A;  5AUI A;  1WXQ A;  1J0G A;  1VD2 A;  4AS1 A;  3PS6 A;  3PT2 B;  3RUI B;  2D3B A;  2L0F A;  2KWD A;  2LI5 A;  4JX1 C;  1S3S G;  3C0R B;  3PO0 A;  4WWO A;  3SHQ A;  2PJH A;  3A33 B;  1N5X A;  3UGB B;  1YN4 A;  2K22 A;  4GDK A;  4EKU A;  4ZRP A;  2INN E;  4F1S A;  1NYQ A;  2LMC A;  3APC A;  1C9F A;  1C77 A;  4KKI A;  4MGY E;  3T3O A;  1NDD A;  2G45 B;  4RH6 A;  4BKS D;  4RM9 A;  3ZNZ B;  4AOF A;  3AE4 B;  3Q3N C;  2V1Y A;  1PFD A;  4A9A A;  2JWZ A;  1E8X A;  2C7M B;  2KTF A;  1AW7 A;  2N4F A;  4P16 A;  3FIL B;  2IZV B;  3SEB A;  1T3Q A;  4W9I A;  3RYT A;  2CKH B;  4W9K A;  3NZ3 A;  4GGQ A;  3ZO5 B;  3B2F A;  5FKA C;  2D3C A;  4PYZ A;  3NS8 A;  4JWS C;  1XQQ A;  2LJI A;  2J52 A;  4A8X C;  1OEY J;  2BS4 B;  3LDZ E;  4GLS C;  4WIP A;  2DYM A;  2KYW A;  1V8C A;  2M0A A;  1ZDX A;  1WGH A;  2WXF A;  1FEH A;  4C80 A;  5AZF A;  2LGI A;  4MEL A;  2KN4 A;  2NTS A;  3QQ8 B;  2IND C;  3P2B A;  2LXC A;  4KZ0 A;  4NJ6 A;  4MM3 B;  2KLC A;  1SIF A;  2I38 A;  1RYJ A;  2PPH A;  1RLF A;  2RR9 A;  3ABV B;  2JX5 A;  3DDC B;  4J3O D;  2GBM A;  2H88 B;  4FHK A;  3VTW A;  1YJ1 A;  3Q8A A;  1HZ6 A;  2LGD A;  4IM2 A;  1JWM D;  1TBE A;  4GN1 A;  3RUL A;  2L05 A;  4BKT A;  2RSU A;  1BUI C;  4W9E A;  1GG3 A;  1WX9 A;  2IO1 B;  2X8X X;  3ZNG C;  3K9O B;  4HPP A;  1KM7 A;  3PRM B;  2NCN A;  3ML9 A;  2Y5C A;  1M4V A;  2K8C A;  1D5Z C;  1WIA A;  2PTL A;  4C7Z A;  2KDI A;  3C8Y A;  2N7J A;  2V3N A;  3SD5 A;  4E3C A;  1V6E A;  4HRS A;  4IM3 A;  1ET6 A;  1EWC A;  4WWP A;  4KIK A;  2RDG A;  4M00 A;  1WM2 A;  4US9 A;  1C4C A;  3W1Y A;  1ESF A;  3RFZ B;  1F0Z A;  1H4R A;  1MG4 A;  2RDH A;  4FUL A;  4ICU A;  4OHJ A;  3TCA A;  1Z2M A;  1K50 A;  4HJK A;  1P1A A;  2R2O A;  4FLH A;  3TMP B;  3KVF B;  4YL8 A;  4YT0 B;  1DOY A;  2N0S B;  4IOI E;  1L4Z B;  4LNF A;  1WGD A;  2MJD A;  3U8Z A;  2R61 A;  5G5H A;  5JH5 C;  5DCN A;  2INP E;  4CQN A;  2C7N B;  1E8Z A;  4LK0 M;  1I4X A;  1E5W A;  1HTQ A;  3EHV A;  1LGR A;  4BOS C;  3UQA A;  3QJZ A;  1B9R A;  3P4S B;  3HIZ A;  2C7H A;  2Z0E B;  3LXF A;  2DWQ A;  2LUE A;  4EZL A;  5JHA A;  2VZK B;  3GE3 C;  4DWF A;  3HVD A;  4US8 A;  4IW0 A;  2IPK D;  2MWS B;  4A20 A;  2QHO A;  5G2N A;  2WU2 B;  2L76 A;  3AN1 A;  3WA0 A;  1AAR A;  4YTM B;  2N7E A;  3ZJV A;  3HRD D;  3DBL I;  3R8B A;  2GLS A;  5H8Y E;  5JZE B;  1Q10 A;  3BYY B;  2Q5W D;  2ZNV C;  3X0W A;  1GUA B;  1DOX A;  2IO0 B;  2DZM A;  4PS3 A;  1LXD A;  1NYR A;  2KVZ A;  1I4Q A;  4MAC A;  4PYU A;  2KJH B;  4B95 A;  3QAR A;  2MW5 A;  4JLC A;  1WF9 A;  2ZJD A;  4G50 A;  1TS2 A;  2HJ8 A;  3GZN I;  1V1P B;  4M8M A;  2QSD A;  1RRB A;  1TS4 A;  1SBB B;  1V49 A;  2NBV B;  1ENF A;  4UDU C;  4HXD A;  3Q8F A;  2DYO A;  1EWY C;  4I6L B;  4P1B C;  3DHG C;  2L7R A;  2FAZ A;  5CHF A;  1FFV A;  2L8J A;  2WXO A;  2IY1 B;  3VHT C;  3B08 A;  1SSN A;  1C76 A;  1WXA A;  2K39 A;  2K25 A;  3A4R A;  1M94 A;  2BWF A;  2BYT A;  1V81 A;  2WXJ A;  4HDO A;  2W3S A;  1I7H A;  4TKN A;  4S0R A;  1TY0 A;  3NVY A;  1ZDV A;  4P1C C;  1GNU A;  1ET9 A;  2PE6 B;  2KMC A;  4LNI A;  4I6P A;  1VDV A;  4RGO S;  2WXQ A;  1FNV A;  1J7C A;  1WJ4 A;  2REX A;  4XE0 A;  4G11 A;  1FXT B;  4MSM B;  2WDV B;  2KHW B;  2VZK D;  4WWM A;  1ZXI A;  4BBN F;  4MJS B;  3U52 E;  2N9P C;  2JYE A;  1WJU A;  1JQ4 A;  3WAP A;  1TGZ B;  2XK5 A;  3DOW A;  1L0X B;  1L2N A;  3ZGZ A;  3UIO B;  4FJY A;  4CHK A;  3V60 A;  5DPT A;  1E7U A;  1N60 A;  2MBH A;  4DQO C;  2LFI A;  3S2A A;  3VQI A;  3P42 A;  1YQB A;  2MX2 A;  1R7S A;  5BMG A;  1X1M A;  2FIF A;  2KD0 A;  1TIF A;  1TTN A;  1TS5 A;  3ZLZ A;  3L08 A;  3R7R A;  1I35 A;  1Y56 A;  3DPD A;  1J7A A;  2PVO D;  4A3O A;  1P0R A;  3UIN B;  2DLB A;  3RNF C;  2KX3 A;  1WJN A;  1CK1 A;  3AE8 B;  3DVG Y;  4G0N B;  4WAA A;  2AL6 A;  3N9Y C;  3RCZ A;  1LFD A;  5IKC M;  3PSE B;  3VTV A;  1PQS A;  3P1M A;  2WXN A;  3RNC C;  1QF6 A;  2NVU I;  3ZYY X;  2A4Z A;  2GBJ A;  2KDM A;  3PHW B;  2D5G A;  3U2S C;  3I57 A;  2DZK A;  3L54 A;  5FR3 A;  3OJ4 B;  1MPE A;  1ZXH A;  2PE9 A;  1V86 A;  1R4M B;  1GB1 A;  4HRO A;  5EE9 A;  4NQL B;  4ARI A;  1TKG A;  1UH6 A;  3ZXR A;  3E9S A;  5HI1 A;  2GRI A;  2LHD A;  3DQV A;  2WX0 A;  3DBR B;  3VRA B;  1YIW A;  2BBC A;  2WLB A;  1JWS D;  3PVL A;  4ZRK A;  3MHS D;  1GC6 A;  2WNM A;  4WJP A;  2Y3A A;  2KFK B;  2UU7 A;  4C00 A;  3AE7 B;  3VXW A;  3DHI C;  2FBW B;  1R4N I;  4XWW A;  3WCQ A;  4JE3 B;  1WWT A;  1ZW7 A;  1QOB A;  5J18 A;  1WZ3 A;  3L4P A;  3P4P B;  4WH4 A;  1WXM A;  4PS7 A;  3IHP C;  1KRH A;  3NVZ A;  2CU1 A;  1L6U A;  2GBR A;  1HQR D;  2DX5 B;  1L0Y B;  2KX0 A;  3T8M A;  1TZ1 A;  2DZJ A;  4K3B A;  5DPS A;  1VZ7 A;  3DBS A;  2L1A A;  2J0K A;  1YQ3 B;  2KKC A;  2KDF B;  5C1Z A;  1HA5 A;  1HTO A;  3AE2 B;  2JZZ A;  2DYB A;  5D94 A;  4XGA B;  2ZW1 A;  2KFJ A;  3U4E G;  2C9W B;  3H7P A;  2BB6 A;  3ZQ4 A;  3VAW A;  2KC1 A;  1JRU A;  1MHX A;  1U4A A;  3UIP B;  3PHX B;  4C7Y A;  4GXB A;  4DDG D;  4AJY B;  3WAN A;  2LVP A;  2N9X A;  2W54 A;  3PZ7 A;  1PGX A;  2L3Z A;  1UWX A;  3A4S C;  4JL9 A;  3U7Z A;  4A6Q A;  1AYF A;  4LNK A;  1YN5 A;  2CHX A;  2KWC A;  1SE2 A;  3AE5 B;  3ZIM A;  3AEG B;  3KQ4 A;  4HKQ A;  2AX5 A;  4KV2 A;  1QLB B;  3T3N A;  4C4V B;  3W1S C;  1F2R I;  3KWL A;  4GDK B;  2C5L C;  4WUR A;  4AWJ A;  1MHH E;  4YTP B;  3RN9 C;  5TSS A;  1WR1 A;  2EKE C;  3Q14 C;  2DNF A;  3AI5 A;  2IBI B;  1SE9 A;  1P3Q U;  4OZA A;  1I4R A;  2YLM A;  4RM8 A;  2BWE S;  2I2Y A;  1KFY B;  1V1O A;  4N9F 4;  4GDL A;  4C4V A;  3ONS A;  4WQO B;  3WAL A;  5C3J B;  1F52 A;  4MEM A;  1T0Q C;  1I4G A;  2PLP A;  3ML8 A;  1V80 A;  3W5V B;  2D10 A;  2D2Q A;  1ZE3 D;  3T9L A;  1F77 A;  3N20 C;  1Y8R C;  1QOG A;  3NY5 A;  4DHZ B;  2KQ4 X;  2V4I B;  3GOE A;  2LVQ A;  3GE8 C;  3LYY A;  1SE3 A;  4OVZ A;  1KLU D;  4OZB A;  3JSV A;  3PLU A;  3N30 A;  4JQW C;  3ZJU A;  2OJR A;  3NJT A;  2A5U A;  2L83 A;  2L52 A;  2L0T A;  2M4N A;  2ZCB A;  1CMX B;  1L6V A;  4IWQ A;  3BYT B;  2KNB A;  4WWN A;  1UEL A;  1VZ8 A;  3GB1 A;  1FCL A;  2BB5 A;  2XNA C;  1FXA A;  1Q5W B;  2RD0 A;  4DHJ B;  3RD2 A;  2ACZ B;  5BMI A;  1OEY A;  5BYR A;  3C19 A;  3EUB 2;  1EUV B;  3IAM 1;  1ZPS A;  4K7S A;  1WXS A;  4BZA A;  1GC7 A;  2KZR A;  3MFG A;  5JXV A;  2NBU A;  4H2A A;  4O1N A;  4K1R B;  4RF1 A;  2CHW A;  1WGG A;  2KO3 A;  4NJ7 A;  2WXH A;  3I9V 1;  2K0P A;  2QCZ A;  2IGH A;  2DEN B;  2ZZP B;  2SAK A;  2WU5 B;  3EFC A;  3SDL C;  5CHW A;  5AZH A;  4RGN A;  4LDT D;  3W1S A;  2E3T A;  3V05 A;  3L16 A;  4X57 B;  4M8N A;  4CYE A;  1YMH E;  2KQ7 A;  1PUT A;  2KMM A;  2EMT A;  5D7G A;  4KIK B;  1QOA A;  3SFD B;  3VR9 B;  2KAC A;  1TKE A;  1HE8 A;  1ACC A;  3VVW B;  4C56 C;  1UF0 A;  1RM6 C;  1E8Y A;  1NVI D;  5IP4 D;  3RPF C;  3MJW A;  3SFE B;  4RF0 A;  4AUQ C;  3MC0 B;  1MFW A;  1WI0 A;  4W9G A;  5HHD G;  1SXT A;  1TKY A;  1WXV A;  2MCN B;  3PLV A;  1XLQ A;  4L23 A;  3PV1 A;  4P7I A;  2WXR A;  3EC8 A;  1KJT A;  5L83 A;  1PDX A;  1SEB D;  3AED B;  1T0S C;  3PRP B;  2V3P A;  4WJQ A;  5G5G A;  4G3X B;  3O65 B;  1RFA A;  4II2 B;  4HPL B;  1UGJ A;  4ACF A;  4BVU C;  1CQV A;  1SE4 A;  3TEY A;  3ZDT A;  5DPW A;  2RPQ A;  1KOT A;  3LJ3 A;  4HCP B;  1UD7 A;  2BF8 B;  2JRH A;  3VH3 B;  2Y5P A;  2IO3 B;  1LM8 B;  4DHJ D;  4KGR A;  2BVC A;  3PTF C;  1P9D U;  2IYD B;  3A1Q A;  3DBH B;  3BVM A;  4NAW A;  4QAY A;  5AUK A;  3RNG C;  2RDB C;  3BVG A;  2MBB B;  3Q3F A;  2ON8 A;  3KYC D;  1DGJ A;  1C4A A;  2O6V B;  4NY0 A;  2W55 A;  3AUL A;  4W9L A;  2HE7 A;  2BT6 A;  2LVO A;  1WFY A;  1A70 A;  1IPG A;  3ZVV A;  4KVG B;  2WXK A;  2O6V A;  1EM7 A;  1D5X C;  2KOX A;  4W9C A;  3KH0 A;  3AB5 A;  1YX5 B;  3ALB A;  4FAD A;  4K7U A;  1TJE A;  4TQ1 A;  3Q3J A;  2WWZ A;  4RNA A;  1YOV B;  3VTU A;  4ZRI A;  4WJO A;  1ZP0 B;  4NQK E;  1SIJ A;  4F7Z A;  1MI0 A;  2BW2 A;  3PRZ A;  3FAH A;  2FE8 A;  1JAL A;  5IO9 A;  3AEF B;  1JWA D;  2KDB A;  3DBH I;  2VRR B;  2YEP B;  3OJ3 A;  4NZL B;  2DHZ A;  2KJR A;  3CSF A;  1XLN A;  1PGA A;  5LNK 1;  3JW0 X;  3AH7 A;  4GSW A;  1C4P A;  4IWP A;  4ZRJ A;  4BAX A;  5CX3 A;  4CO7 A;  2FCM A;  2K6D B;  2LZ6 A;  1WE7 A;  4HKZ E;  3U30 A;  5BYQ A;  2DBY A;  4FA6 A;  1UBI A;  2EKI A;  2VH1 A;  5KHQ A;  1IBX A;  4XX5 A;  2OOB B;  3IT4 B;  3TEX A;  3ECI A;  1E7P B;  2IO2 B;  2NPT B;  3MC9 A;  1WY8 A;  2BYF A;  1TT5 B;  4L1B A;  4AJW A;  2EEL A;  4MDK E;  4GB9 A;  2J53 A;  2K5P A;  5JHB A;  2J7Q B;  2BS2 B;  1HZ5 A;  4XWT A;  5E6J A;  2N9L A;  3PZD A;  2XK5 B;  4YSY B;  1WR6 E;  2DZI A;  3Q3M C;  2LEK A;  1T6B X;  2PW9 A;  2O6V D;  3NRZ A;  2NPT A;  3P63 A;  4IM0 A;  4M01 A;  1XEE A;  1XCT L;  3KUD B;  5HFY A;  3NHE B;  3P4Q B;  3Q8B A;  4OW0 A;  1FNU A;  2BYV E;  4JWU C;  1K51 A;  2J0J A;  2JVC A;  1IYF A;  3AE9 B;  4HEA 1;  4ANW A;  3L10 B;  3PGE A;  1WMH A;  2LGX A;  5CHV C;  1QKZ A;  5E6P A;  1C1Y B;  2KWU B;  3L13 A;  3DWG C;  4ZYN A;  2WHI A;  4LJP B;  1P7E A;  1WYG A;  4FJZ A;  1UBQ A;  4XC2 A;  2MP2 B;  2ZNV B;  3L0W B;  1TY2 A;  3ZRC A;  4R3D A;  1JWU D;  4RGT A;  2LXA A;  3R2T A;  1UUP A;  1I42 A;  3I3T B;  4HVB A;  1L5P A;  4MH0 E;  1KLG D;  2D3A A;  3RNE C;  4ICV A;  2MP2 A;  1NI2 A;  3HM6 X;  1TS3 A;  1VCB A;  4IG7 B;  1V2Y A;  3BY4 B;  1F2R C;  1KTK A;  2D3G A;  3HUI A;  1EU3 A;  1XT9 B;  4GOC A;  5HKH A;  3I63 C;  3AEA B;  3ZTC A;  1WZ0 A;  4KX6 B;  2QIE B;  1UZX B;  1C3T A;  2ZVN A;  2HTM E;  4YXD B;  3BII D;  2WDR B;  4GU2 A;  4URK A;  1H8C A;  2CR5 A;  1WSP A;  3KWV A;  3VUW A;  2JXX A;  1UGM A;  1E9M A;  1FNW A;  3M63 B;  1Q1O A;  2JRI B;  4E74 A;  3ZDM C;  4IKG A;  3PRE A;  3HVZ A;  1E10 A;  1MG8 A;  2PMV A;  1CJE A;  2IGD A;  3RT3 B;  1UNS A;  4IDI A;  3OG5 A;  2GB1 A;  4OVV A;  2QC8 A;  2M56 B;  4RGM A;  4ZHO A;  3V6C B;  1FPY A;  3VH4 B;  3M3J A;  5D3D A;  3P4R B;  4YWG G;  2FID A;  3RI7 C;  2DAF A;  1ZOY B;  2UWQ A;  4EZJ A;  2LHE A;  2JSV X;  1BT0 A;  4TQ0 A;  4N6E B;  5G55 A;  1VR9 A;  2LUM A;  3AV8 A;  4MGI E;  3UI3 A;  2I1K A;  3A9J A;  4EZK A;  3NVW A;  1R4M I;  4A3P A;  2HTH A;  2KLG A;  4KGT A;  4E71 A;  2JY6 A;  3Q2A C;  1NEN B;  1TZO A;  3DVG X;  2WXI A;  3H7P B;  3V6E B;  4A55 A;  3N1Y C;  4YTN B;  4AP4 C;  3CIR B;  1VJK A;  3DBR I;  1E8W A;  2LRW A;  3BWU D;  4TSS A;  1ZKH A;  1YX6 B;  1A5R A;  1E90 A;  3A9K A;  4J6I A;  4NJC A;  4MGZ E;  4S17 A;  4KSL C;  1FFU A;  3TEW A;  5IOI A;  4ITK A;  1XLO A;  2ASQ A;  4BBN C;  4BKS A;  1G6J A;  2K8H A;  2FUG 1;  2D07 B;  1YQ4 B;  2MRP A;  3QK0 A;  2ZW0 A;  3PPA A;  5E6N A;  1WYW B;  1SF0 A;  1GAQ B;  4KDL B;  2W3R A;  4BKG A;  3R2I A;  1F1H A;  2TSS A;  1V9J A;  2FNJ B;  2YEP F;  5J17 A;  1LQB A; 
#chains in the Genus database with same CATH homology
 4P1B C;  3I5J C;  3Q3N C;  1T0R C;  3DHG C;  3N1Y C;  3RI7 C;  3Q3O C;  1T0S C;  4P1C C;  3GE8 C;  3RNE C;  2INC C;  3RNF C;  3RNG C;  2RDB C;  3N1X C;  2IND C;  3RNB C;  3RN9 C;  1T0Q C;  3Q14 C;  3RNA C;  3N1Z C;  3GE3 C;  3Q2A C;  3DHI C;  3I63 C;  3Q3M C;  3N20 C;  3RNC C;  3DHH C;  3RMK C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...