1SE2A

Staphylococcal enterotoxin c2, monoclinic form
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
239
structure length
235
Chain Sequence
ESQPDPTPDELHKSSEFTGTMGNMKYLYDDHYVSATKVMSVDKFLAHDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKDNTGGKTCMYGGITKHEGNHFDNGNLQNVLIRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STAPHYLOCOCCAL ENTEROTOXIN C2
publication title Residues defining V beta specificity in staphylococcal enterotoxins.
pubmed doi rcsb
molecule tags Toxin
total genus 63
structure length 235
sequence length 239
ec nomenclature
pdb deposition date 1995-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1se2A01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1se2A02
2QEJC 1PRTF 1PZKD 2IJ0A 1I4QA 3DWPA 4UDUC 1JWMD 1SJED 3GP7A 5ELCA 4RGMA 1SE3A 3DWQA 1I4RA 1S5FD 1CT1D 1I4HA 2Z8LA 4RGTA 1D6EC 3CHBD 1LTGD 1B1ZA 3R2TA 2SEBD 1YN5A 1LTID 1STEA 2CHBD 1V1OA 3V05A 1FNUA 1HXYD 1PTOH 1TS2A 1XXGA 3BYYB 3BZDB 5ELFA 2XRSD 4OHJA 5D3DA 1KLGD 1KLUD 2RDHA 1TS4A 4RHSA 3EA6A 1SJHD 2AQ1B 1LTSD 3O13A 3BVGA 4DXFA 5ELDA 1FD7D 1M4VA 1MD2D 3SEBA 1PTOB 1UNSA 1ESFA 1EU3A 1YN3A 1LT3D 1T5XD 4RGNA 2G9HD 1RDPD 5ELEA 1D5XC 1LT4D 3TSSA 1CHPD 1RD9D 3MC0B 1JWSD 2WV6D 4RFBA 1LTAD 1V1PA 4L63B 1SXTA 1FNWA 1SBBB 3KLSX 1GOZA 1JWUD 5ELBA 3URYA 1TY2A 2AQ2B 3BVZA 2QILA 4Z9CB 1JQYD 1HTLD 1V1PB 4RGOS 1AN8A 2XN9C 1CQVA 1LTRD 1PYWD 1B44D 1QILA 1BXTA 4RHRA 3W2DA 1F77A 1CHQD 2NTSA 2ICIA 4RH6A 1AW7A 1S5DD 1I4PA 1SE4A 1PZJD 2IPKD 3BVMA 5FKAC 1BCPB 4NZLB 1EU4A 1LTBD 1EWCA 1HQRD 1SEBD 3R8BA 3BYTB 1LT6D 4ZYSA 4RCOA 1CK1A 1PRTB 1S5BD 1ENFA 2R61A 1PTOD 5D3IB 1UUPA 1EFID 1RCVD 1PZID 1RF2D 3MFGA 1JCKB 2AQ3B 1DYQA 5TSSA 1LLRD 1EEID 1PTOC 1D5MC 4K6LA 1BCPC 2O2LD 1G8ZD 2TSSA 1FGBD 1S5CD 1TS5A 1FNVA 1S5ED 1PRTC 1TS3A 2NTTA 1XTCD 4O1NA 1I4GA 1ET9A 1LO5D 1DJRD 3R2IA 1EEFD 4L6TB 3EFXD 1LT5D 1ET6A 1L0XB 2J4XA 1KTKA 3DWAA 1D5ZC 1HA5A 4DXGA 1L0YB 2RDGA 4C56C 1LTTD 1JR0D 2XNAC 1TY0A 5I4DA 1BCPD 4BWGB 1YN4A 4TSSA 1PRTD 1PTOF 1BCPF 1I4XA 5FK9C 3OWEB 2XRQD 1SE2A
chains in the Genus database with same CATH superfamily
1PZKD 4RG1A 3GP7A 1SSOA 4PS3A 2M0AA 2KHSA 1SMYD 2G45B 3S2HB 2JXTA 1PGXA 4B6WA 3Q69A 3K80C 4HDOA 4EX5A 4TQUS 2PNRC 2Z4IA 3P7JA 1MKHA 1LTID 4KY6A 2E8GA 2EVBA 1FIQA 1UBIA 3H7PB 4PZ6A 3U4EG 1LM0A 4ANXA 3NTHA 2Y5PA 4BZAA 5L37A 1U4AA 3GO5A 2BH8A 4FJYA 2CKZB 4K3CA 2ZJDA 4ZOHC 3T3OA 2EY5A 2Q5WD 5C3EG 4LDTD 2LXCA 3M4QA 5LMUL 4PS8A 4LUOA 1NJIC 4HMIA 3RN5A 4ARIA 1YNXA 2CU3A 4IPGA 1KFYB 2N9XA 3KUPA 4KHPL 4OELB 4Q5VA 1V6EA 4GIVA 1JJGA 1B7YB 2N9KA 1YNND 1JB3A 2F0SA 3O13A 3M7GA 2WDQB 2EZVA 4LAAA 3P4PB 2JXMB 2F03A 5CORA 2N8NA 1WXAA 2ENBA 4MN3A 4WJWA 5JHAA 2WB1B 1NY4A 4OIJA 1I3QH 2R3ZA 1LM8B 4KJOA 2E2JB 1WGHA 2NVQB 4KY7A 2E6XA 1FCCC 2WV6D 1WE6A 1CQFA 5JZEB 5IOIA 3D4RA 3FKIB 3U4ZA 4GKJL 2GLSA 5G5HA 3RNCC 5CV9A 3MHZA 3VHTC 5KNDA 3A54A 2JA5H 2Z4HA 4QCLA 4P7IA 4HJ9A 1UE6A 1Y8RC 4ZRQA 3UQBA 1U9RA 2W82A 1F77A 2E5LL 3C19A 4RCNA 4AQYL 4QQBX 1KC8C 3NS8A 4IC7B 2J7QB 1STHA 3S15B 3K5MA 4JG2A 4F1SA 2QIEB 4FF2A 2M4NA 3UE0A 1TKEA 1EU4A 4HJ5A 1VQKA 2B63H 2JA6G 1OFFA 3W1GA 3MTNB 4JBWA 4J3OD 3QC8B 3J7A5 1S5BD 4BY1G 1L6VA 1ENFA 4QUCA 2R61A 1WRIA 2C5LC 1SFOB 1QUQB 1E6EB 4HMJA 2N9LA 1PTOC 2XBBC 3UINB 4GB9A 5C0XI 2O6VA 4UHVA 4BAXA 4DAPA 2N9EB 3R7RA 3I4LA 2L0FA 2KK8A 4JPSA 3VTUA 2PZWA 4RA8A 5AUKA 2J42A 2EYJA 1CM9A 4A55A 3GZNB 2H88B 3A9JA 2JVCA 3RPFC 5D6JB 4C3IH 2HE7A 5GQOA 3S24A 3Q3FA 2K52A 1F2RI 3EFXD 1WXSA 1N34L 4A3GB 2FAZA 2PTLA 1C4QA 1HQMC 4CO7A 4A3CG 4C00A 4BBRG 1UEBA 3RN2A 3P63A 4X66Q 4A3DH 5K36G 2KMMA 4ZRJA 5M3MG 2DNEA 4A3BB 4BOZB 2AWNA 3IFDA 4TSSA 1T6BX 5FK9C 1LACA 2XGTA 2CWAA 2K25A 5IA7A 2QEJC 3P1HA 1PRTF 3I3CA 5L95C 3K58A 3HM3A 3CU7A 4PZ7A 1YNTE 1TIFA 5ISRA 5ELCA 3OPOA 1SF0A 2OHFA 1WOCA 3IAM1 3LWEA 3R3OA 5CBEE 2EIFA 2CVRA 3I8ZA 4DV1L 5JJLA 1ICWA 5HURA 4BFRA 4J6IA 3X23A 2AKWB 2L52A 2AL6A 3H91A 3AE4B 4ZAIA 2LXJA 4QUFA 5EBDA 1VQ9A 3HOWB 2VUMB 5LXIB 1V8QA 1OO9B 2RVLA 3FVQA 3NUCA 4APVA 1WF9A 2I5MX 1EM7A 1VRAB 2MBEA 4R9WA 4C1NK 2FIFA 3T1YQ 1VQ5A 2I1KA 4N8FA 4RKLA 1EQTA 3RLOA 2PMZB 2KBNA 5E1FA 1BBUA 3AU4A 4LJOB 2NVTB 5I2XA 2IY1B 3CSFA 1WTVA 2L12A 2VS1A 3AEEB 1F0ZA 2V4IB 4DXFA 3MC9A 4CKCA 3BDLA 1JC7A 2JK8A 3D31A 1C4CA 4FADA 3S1MB 3WCQA 1EYAA 3VR4A 3Q2AC 1K8AC 5EAYA 3TSSA 3JVZX 3HZXA 4FBJB 1GKHA 4B3SL 1HFGA 4HPMB 4A3JB 3LWUA 4RNAA 4JI4L 2CWPA 2QF7A 2Z0DB 2M8SA 1G51A 4G57A 5IGEA 5KHOA 3I4NB 4KD4A 2BB6A 2V3SA 2D2QA 3ITPA 1KDBA 4DV5L 2R7FA 2PEAA 2IX3A 2JSVX 1A8VA 1RM6C 1BMLC 1FL0A 2JY6A 5J17A 4TV3A 4OONA 2OTJA 2ICIA 2JSOA 1AW7A 3SK8A 4R8IA 4K1RB 5MPOA 1UELA 2B2VA 2C5CA 2QCZA 1SE4A 4J1MA 3I55A 2KUMA 4LFAL 2UXBQ 3K8AA 3ZJUA 2NVXH 2R93G 2MH7A 2N88A 3A8KE 3A56A 1UF0A 4RCOA 2V9HA 3RYTA 3J81E 1KAAA 3RLFA 3JAML 2MP1A 2AWTA 3MFGA 1XNRL 1JCKB 4GOCA 1EYGA 2WXPA 5L83A 3NZ3A 3N1ZC 4KHVA 3FRPB 5IGBA 3DQVA 1QT9A 4EE2A 4A3FB 4AJYB 4IKGA 1T0RC 1FRDA 5IIFA 2IO1B 1U4MA 2WWZA 4IPDA 1R4MB 4DR5L 4OO1H 4YWMA 2Z6KC 3KFUA 1HH2P 3VYUA 2MX2A 1C79A 3QB3A 3GTLB 5IP9G 4E3CA 4BXXH 3QAQA 3QX1A 4JI0Q 1HTPA 1WYWB 2NUCA 2JXXA 1Y56A 3L17A 3APFA 4C56C 3GQBA 4HJ7A 1QWYA 4DR3Q 4WWOA 3W1SC 2Z1CA 3DXJC 1YX5B 4LK1C 3W1BA 1MI0A 1VCIA 2B2WA 1HPCA 4B3ML 3UDGA 3TS2A 5C44G 4X3KA 3QJYA 1K0RA 1SE2A 4PMCA 1J5EL 3E9HA 3U9OA 2F0VA 2KMAA 2KOXA 1T5EA 4O0AA 3L0WB 1B2TA 2N7JA 4UDUC 4BKGA 2LFNA 3TBIB 1VLBA 3OIPA 1ILPA 3VAWA 2JP1A 1HE8A 1WZ0A 3VDZA 1TYGB 3ND9A 3GTKB 3OJ3A 1YHAA 3TN2A 1KF6B 5C3EB 1ZP0B 2B2UA 2WYQA 1EQVA 4JI6L 1A3VA 1GUGA 1B50A 1G6JA 4KDLB 4N9F4 4E71A 4X64L 3QK0A 2XVSA 3VYSA 1BO0A 1JWBD 3LNNA 3NSWA 3I2ZA 3CCEA 4OGQC 3ZXVA 2QDBA 1Y1WG 1E7ZA 2WX0A 2N7EA 1K28A 5EJWA 2WACA 1C9FA 4L2YA 2K0PA 5IOCA 3ZJTA 3L10B 3BZKA 4NKLA 4DUZQ 1HNWL 3EN2A 1STNA 2CHZA 2W3RA 3ZO5B 3B08A 3C8YA 3TREA 3UI2A 2KDMA 2LY7A 3MXPA 3UE1A 5IYDH 4DA2A 2CHXA 1E90A 2KLGA 4C3JH 3NEMA 1E8XA 4FXCA 1BDOA 4A3MG 3B1LX 3MHSD 4ILWA 2ZCCA 5JPNC 2NBUA 1GC6A 2XEWA 4X62Q 4DHJD 2I07B 1EU3A 4GOPA 2EELA 2NN6H 1NAPA 2AMCB 3QWZB 1OEYJ 3T1HQ 2KO3A 3EECA 1JJCB 2Q8RE 5E4WC 4LFBL 4GOPB 3IAYA 5GXGB 5JOBA 2V0GA 2CFMA 3QO2A 4NXML 1G6PA 1AH9A 5ELBA 2BTEA 2BYVE 3URYA 2F0DA 3A7LA 3HOUH 3W5UB 1X54A 2R7ZH 1DGSA 1N5WA 2JA6B 1HR0L 3HGBA 2JQOA 4BY1B 3S1NB 2W55A 1R9TH 1V97A 3KBGA 2PW5A 3F2DA 2BDNA 2GOWA 3GZNI 4HXDA 2K33A 2RA4A 5FOBB 2JX5A 2MJEA 3FILB 3S2HH 1H95A 1TJEA 2JRHA 4XYCA 2ACZB 1EWCA 3CCQA 2LRWA 2I38A 2K6DB 2WQYB 1MSHA 4GNXC 3S1RH 4JOIA 3HKZE 2CW0C 1SYBA 2G5DA 3GV6A 4KGSA 2MSED 1Q8KA 3NTKA 1XMQL 4BY7G 3PUWA 3A1QA 4YCWA 1RKNA 1SRUA 1IW7C 3HKZG 1AEXA 4RAUC 2RPQA 1TS5A 3KK7A 3CCJA 1XT9B 1X55A 2X69A 2XWJB 1EY9A 2PKOA 2DGYA 4BBRB 3H7SA 1STYA 4O1NA 4KDIC 4IO9A 3N30A 3KW5B 3PHWB 1TTNA 3MXNA 4WJOA 3TRZA 3PIP3 4IPCA 2JWUA 2W9NA 2A69C 4L6TB 1F1HA 5T1IA 4EGVA 2PI2E 1PH1A 3IAS1 1KRSA 1KTKA 2J4XA 1C7YA 3CD6A 2LEKA 3HS0C 2LFIA 4ZK9B 2NMQA 4NMZA 3TIXA 2O2VA 4H0LC 4ZLTF 2QSDA 1TZOA 4ICUA 3AMUA 2WP8J 2HDLA 2I1JA 2KXJA 4JV5L 2BWFA 1XMOQ 2B8GA 2LUMA 3NG0A 1IW7D 2O2VB 5A2QL 1PH2A 4RM9A 1DD2A 2ZCBA 4B3TL 4IFDG 1UD7A 4IOIE 1S40A 4LF9Q 2IJ0A 4WH4A 3IFTA 2F0HA 4AYBE 4F8MA 1DONA 4W9IA 1NBWA 1PFSA 2C9OA 1WJUA 2NBWB 2A69D 1JE5A 3C1EA 2IGGA 4URKA 1BOSA 4DR1L 4AYBG 2LHDA 2B29A 1WCMG 4DV0L 1CKMA 5G3LD 3Q0AA 3M3YH 1WTRA 3Q3NC 3Q8CA 1Y1VG 3RZFA 5M9OA 3PUXA 4OX9Q 4A93G 1EQQA 4DHZB 3H0GG 1C8CA 1F2RC 3J81j 5DLQE 2IDYA 1KL9A 3NS1A 4BBNC 4IN3A 4WJQA 1PYSB 1F9RA 1G2SA 2DUDA 1TS4A 4RHSA 2KVZA 3NZUA 5I9PA 4G7ZC 1K51A 4IWPA 2LXAA 1EF1A 1WI5A 2NVYH 3CPWA 1CTMA 1IYUA 2M56B 1EL0A 3EC8A 3QJZA 2YTYA 1SYGA 2NB0A 2NZOA 1SDFA 4DNIA 3SEBA 2D9UA 3G48A 4HIKA 3TP7A 3GTOH 3J9CA 1A2UA 3BDOA 4LWCA 3Q6BA 3T51B 1VZ6A 4IUTA 5ELEA 1TKGA 5E7NA 2G1EA 5FR6A 2RSUA 4LF8Q 1X3QA 1NI2A 3OWFA 4TRDA 5AZGA 3G6EA 3AE3B 1QZGA 1MFWA 2PZTA 4QAYA 5KGUA 3APCA 4ACFA 2INCC 2WU5B 2R93B 2E3TA 2Y5CA 3BS1A 4JQWC 2BCOA 1WTPA 1AE3A 2RQXA 1R7SA 3K5NA 2JF5A 2XN9C 2KD0A 3KYDD 2K39A 2CHWA 1MBYA 1MVKA 2GBKA 4FJVB 3C0RB 1Q86C 1R4QB 1W6JA 2BVCA 1DOYA 1WGGA 4OWWB 1RHPA 1R4MI 2IPKD 1SB3C 1WGKA 3CRKC 2KT7A 3ZRCA 1WX9A 5A35A 4JWSC 1E2VA 2JEAI 3U2SC 1HQRD 2M0XA 4US9A 3PSEB 1SMXA 2L55A 3B9JA 3SU8X 3MXGA 1XWEA 1WTQA 2D5DA 1SNDA 1AZPA 2L1AA 4NJ6A 4XZ4A 2LGYA 1BVSA 1RCVD 2WB1E 3HOWH 2LGDA 5EKLA 4LMQD 2AQ3B 2VZAA 2PNHA 3ZGZA 4JI1L 1OEYA 1BCPC 4IUNA 4OXPA 1YI2A 4HPPA 1VMCA 2VH2A 3N3KB 1QVGA 2ZZPB 4A4IA 1TS3A 2HJ1A 4M8NA 2ZNVC 1WMHB 1YOVB 3A33B 2JYEA 3WAPA 1TWAH 4B9KA 3GTPH 3ONSA 2PPBC 3D4DA 2VQEQ 4M0WA 2YU9B 2DZMA 1LGRA 3WIMA 1FO4A 5LNK1 5BMGA 3SGIA 3NVWA 2F0WA 5C44B 3VUYA 4Y52H 4M0WB 5G2NA 1QZEA 3UGBB 4RMFA 1WD0A 3V96A 3DDCB 3MP9A 1L0YB 2RDGA 4S17A 3S1MH 4ZRIA 3GE8C 3PIOA 1ZEQX 4MDKE 3ZDMC 2N4FA 1TY0A 3JSVA 1BCPD 1F2MA 4LF4L 1L5PA 4HJGE 4JE3B 1JALA 2FIDA 1SIFA 3RD2A 1K73C 1IGCA 1L7YA 3TZUA 3KUZA 2WHIA 2J0TD 2DHZA 1I50B 2B2YA 2A74C 4L5TA 1XCTL 2UUAL 1EO6A 3JSVB 5T8IA 1VQ4A 4LLGM 1NMFA 4HEDA 1EIGA 2UU7A 4QY7A 2MNAA 4V0BA 1GPXA 1Y1WB 1SE3A 4BA2I 2KN4A 1K83B 1WR6E 1HNZQ 3MXUA 5EKKA 1UGJA 2KX3A 1BKBA 1LTGD 1N32L 4LF6Q 5M3FG 2MP2A 3UDIA 3WWVA 1STEA 4MIUA 1UE1A 1YVCA 2XK5A 3V60A 2F0TA 1FNUA 2HHHL 2D3GA 1VDVA 2HJ8A 3TBLD 3FPUB 2FFKB 3IRBA 3KYHC 2WXJA 4CYEA 3JAMc 4A3MB 1FJGQ 3SD5A 3OW7A 4DV6L 4A3KG 2ZVOA 4KVGB 4KKUA 3NUHB 1UWVA 4WWPA 2AYOB 1GB4A 1IPGA 2X6GA 1J9OA 2L5TA 4B9WA 5M5WB 5KIXA 3VTWA 3FHWA 1E8ZA 1SAPA 3PCOB 1IBKL 3C3LA 1TBEA 1QF6A 4DR6L 4GKKQ 2ASBA 1Q0WB 3A74A 4KIKA 1C3TA 2YTXA 1Z5SB 2QDFA 1MJDA 2DLBA 1LT3D 3PO3H 2YEPF 1VQ6A 4AS1A 3ICEA 1KABA 3GTLH 1JOOA 3MC0B 5LMUQ 2ZTDA 4KIKB 3K7AB 3TEYA 1V1QA 1D1KA 5C2TB 3JAMi 4JI7L 1LTAD 3IVFA 2PVOD 1FNWA 4IURA 3G7LA 4X65L 4DK0A 4KZ0A 4BBSG 4AJWA 2XWBB 3NK9A 2QCPX 2QILA 4Z9CB 4DV7L 3TMPB 4CKEA 4MH8A 2L7RA 3BJUA 1UH6A 2PMZE 2M2LA 3W2DA 3EFCA 4MJSA 2ZXOA 1J7CA 5H8YE 4WJPA 3TZDA 2K6QA 1I4PA 2AX5A 2NPTA 4MT5A 2INPE 4BY7B 5BN5A 3IKJA 3HKZB 1VQLA 4MJSB 3W3AA 1SEBD 1TKWB 1HZ6A 2OJRA 1QOGA 3R8BA 1LT6D 4ZYSA 2K5QA 4MACA 4DR4Q 1YZ6A 5CGKA 3X0WA 4GKJQ 1SIJA 2CH4W 2EYOA 4JCVE 4ULLA 3VUWA 1YMHE 3N52A 4DDGD 4V190 3S16H 2IY5B 2R7DA 2FE8A 3D0FA 4C2MH 3VDYA 1VZ7A 2PI2A 4ZHOA 3CMAA 3KLWA 3H6NA 2E5LQ 1RAXA 1RLFA 1FNVA 1DOLA 4AQYQ 2D07B 5C4ZA 4DGZA 1WVLA 1E8WA 2R2OA 3AH7A 1ROEA 4MGIE 3UQAA 4HIMA 4CKBA 1SYEA 4DK1A 1HZ5A 1HR0W 1KDAA 3U30A 3E5SA 3R66C 1QB5D 1NBFC 3DUZA 3H3VI 2MLBA 1OXSC 2JA8G 3T53B 1P7FA 1JROA 2RHQB 2JYOA 1YJ9A 3RD4A 1Q1OA 2D3BA 3VR5A 4YSXB 2BBCA 3HOVG 4N6EB 2KHWB 3VRAB 2K05A 3AE6B 2ZJQA 3I4OA 4EQPA 4ARCA 3NZSA 1TT5B 3NHHA 2QEXA 5D65A 3DEOA 4AYBB 2R92G 1YN4A 3PRZA 1PTOF 1WCMB 5C5LA 1LV9A 3BG3A 4R4OA 1E24A 1Y1VB 2E74C 4N8X1 3S17H 1I4QA 1EIFA 2KQ3A 4A93B 3K81C 1N34Q 1B4OA 1HZCA 2HQLA 3H0GB 4YY3L 1HUNA 4NQKE 5GADC 4PG3A 2K5PA 2ZPNA 2CR5A 4BY1H 2LZ6A 2Z8LA 3SXHA 2N49A 4IZ8A 3AB5A 1GVPA 1SNQA 1OXVA 3R2TA 1J7AA 1FFUA 3SVMA 2HTHA 1V5TA 1VQMA 2VZKB 3A8JE 1TIID 3I57A 4W9CA 3C46A 2ZXPA 4KJNA 3T8MA 1WTOA 1O7IA 4ODGA 3HM6X 2LVQA 1B9NA 5ELFA 2WX1A 3AECB 3HOXG 1KLGD 1KLUD 2HCIA 1PH9A 4BA1I 2RDFA 4A6QA 5KNBA 2LRUA 3PZDA 4DV1Q 3AEVA 2LD9A 4IUQA 2N1VA 2PW7A 4L5QA 2AQ1B 5CC4A 2KJRA 5IT9L 3A8IE 4A3CH 4DNTB 1NSNS 5IP7H 3ZKJC 1WJNA 1M4VA 3RZOH 2I2YA 4KTAA 3S2DB 1YNNC 2Q8IB 4XGAB 3CF6E 2XTIA 5M3MH 2JZZA 3CF5A 5DPWA 1HTQA 1CHPD 1RD9D 3BDCA 3S9WA 1G6ZA 2J53A 1PH3A 3TUOA 2I0QA 3HOYH 3LYYA 2K9XA 3ECIA 4K5XA 3TP6A 1KQSA 2OJWA 4I7AA 3BVZA 1P8LA 4HCNB 4A3LH 3AULA 3AEAB 4GS3A 3KH0A 1S3OA 3MEHA 3WOFA 1L4ZB 3NWSA 3ZNGC 2BA0A 1BXTA 1IXRA 4AH6A 4A3IB 2GBJA 1OXUA 3CCVA 1N36L 1E7PB 3RCZA 1DGJA 4B3SQ 3BVMA 3TL5A 4ZUIA 3NWTA 2A5UA 1VQ8A 4JI4Q 3OTOL 3KUDB 1E10A 3BYTB 1DOXA 2IGHA 2BDOA 3F1ZA 4DV5Q 1CA5A 4HJKA 1Y8NB 4XWTA 5TSSA 1K8RB 3L54A 2DYBA 1EY4A 1FXTB 2GA4B 5CHWA 2PYKA 4HRSA 4LNIA 3K59A 1BBWA 4J6HA 1XF5L 1QNUA 2K04A 3BINA 1CA6A 1Q8IA 4LK0M 4LFAQ 4DBGA 3DLLA 1JICA 1PFBA 1ZYRC 2K50A 1VDZA 1RODA 2KWDA 1VQOA 2LWPA 4PYUA 1PFNA 4BKSA 2EJMA 4NB3A 2BKRB 4UP9A 1XNRQ 4AQ7A 3VR3A 4DAYA 1WI0A 5DCNA 1UZXB 3M62B 3E9IA 3TEXA 1VQHA 2EDGA 2V4DA 2LVPA 5DM73 4FA6A 1SYCA 2FCMA 4KK7A 4GN4B 3ENEA 1QVCA 2NYZD 4OZCA 5M3FB 4K6DA 4DR5Q 2RGFA 1ZYRD 1VS0A 5IY0A 3DWPA 2F0EA 1YJWA 2ICEC 3GTQH 2UYZB 1Q90A 3BU2A 3TP5A 3RUZA 4ZQ3A 1HZ9A 1V80A 3DWQA 5JVH3 5BYRA 1TT2A 3ZUNA 2O6VB 2JA7G 4DR7Q 3PF5A 4WIPA 3RT3B 4A3KB 3S14B 1KIXA 4AOFA 4NDXA 1TWGH 5E6JA 5IYBG 2FINB 2E2IB 3NY5A 4B3MQ 2BF8B 2JEBI 3A9JB 5G5GA 2N1WA 1SYDA 2D5GA 2GMIC 3VXWA 1HXYD 1HZBA 2L4NA 4DQOC 4JI3L 1MHWC 5M5YH 1J5EQ 1BBXC 1P0RA 1ONLA 4LFCL 2K5DA 2BS3B 2AHOB 2FUHB 3DOWA 4Q2JA 4R3DA 2FXQA 3X3NA 5JAVA 4CHKA 5C4JB 1XCQL 4AUQC 3GTGB 2KQ7A 3WAOA 1WYDA 3AB9A 1Q10A 5G55A 2K28A 2EJFC 2SNSA 5J39A 4JI6Q 1RFKA 4WAAA 5IP9H 1EOVA 2KENA 1TWHH 4X64Q 2WDRB 1G291 1X3EA 4YHHL 1TWFH 2UU9L 1K3BC 2WFWA 1QQRA 2KDEB 4P1CC 2EMSA 4ID6A 5M5XB 3DVNV 3W9CB 3PGZA 4DK3C 5F2DA 1YHQA 1CSQA 4BBSB 4EUTA 4QF4A 2B3GA 4MTNA 1JB7A 1QOFA 3ABVB 4B0EA 2A1AA 2N9PC 2IGDA 4LUVA 4J8QA 2D11A 4L5RC 3BK1A 2W3SA 1HNWQ 3CCRA 3FEWX 4KX6B 1X3PA 5KRUA 4DV3L 4IOCA 3M63B 2ID0A 1WRDB 3EUB2 2W54A 4NY0A 4K3BA 2DJGC 4II3B 5EPLA 1TY2A 4CGYB 4DHZE 1IZ6A 2C60A 1EY6A 3ZXRA 1JQYD 4ZRPA 3VFKA 3PHXB 1V81A 1L4DB 1AN8A 3CCLA 3DBSA 4IWOA 1CQVA 1HNXL 1PYWD 3BZCA 2LGSA 1WJ4A 2OCEA 3K0XA 3A0JA 2RR9A 3PVLA 1W3SA 1XLOA 4QL5A 5DAUA 4FHJA 2KX0A 4LFBQ 1Y1WH 4JYAL 5EE3A 4JC0A 1LTBD 3H6MA 4NXMQ 3PV1A 3HIZA 4WRDA 1A3UA 4IFDI 1CK1A 1DOMA 4XTCS 2V3PA 3K5LA 4KN4C 5C1ZA 2HD3A 1HR0Q 4XXEA 1P9DU 1KM7A 1B8AA 2R2QA 2E2HH 1W6KA 1EEID 3V3XA 2KCCA 2JA8B 1FGBD 1PXUA 1B3AA 4A3MH 1ASZA 2BYFA 2IO2B 3PO2H 4FHKA 1WTXA 5IYCG 5C0XH 5DPSA 3SK5A 3EGRA 4D2KA 3HOVB 3GTJB 3V61A 1WXVA 1OQRA 1L1OC 3W1YA 2LSSA 1GJXA 4JK1C 1ZKOA 4A3OA 1EEFD 2M19A 5I6YA 3DCGA 4C1NI 3P75A 3S1QB 2R92B 1E7UA 1ZPSA 2K01A 4JOIC 1E1TA 2EKIA 2LJIA 1YIJA 1PH7A 2EJGC 3MFYA 2EYPA 4DXGA 3Q8BA 2MGSA 4OVZA 3RNFC 1S4ZA 1XMQQ 1H9RA 2KJXA 4C3HH 2IO0B 1JR0D 4CHTB 3J7ZC 1A63A 3GB1A 5IWAL 3JAME 1IBLL 4HSPA 2B63G 4I6NB 4MGZE 3NELA 4NQLB 4Q0FA 4HPLB 3PS6A 3KJOA 1K50A 4L1BA 2OEDA 2JE6I 4KN7C 5CV5A 3ZNID 1E2ZA 1V9JA 4I7ZC 2JYTA 4HIDA 4RGMA 2A6HD 1BR9A 1QE6A 2CKHB 1E0ZA 5T1GA 1A3TA 1H9JA 1YBYA 3HOXB 4JV5Q 1B1ZA 1AZQA 4UP8A 3SDZA 1YN5A 3LXFA 2B8FA 5G3LF 4C3IG 1KJTA 2Q8TA 3J81L 4BY7H 1NUCA 2BS4B 4F7XA 4W9LA 1TS2A 4AWJA 4H13C 4P71A 1XXGA 4B3TQ 1E8YA 2KMCA 1A5RA 5AUIA 5FO8B 2L0CA 1YQ3B 4K7UA 3RN9C 2C9WB 2NR2A 1B70B 4KKSA 1S72A 4L8JA 1J19A 2KA7A 1NEKB 2REXA 1Y8OB 1P98A 1YJ1A 4DR1Q 2DYMA 2RPVA 4GN1A 1D1IA 4ITKA 3AE9B 1VQCA 3M95A 4C7ZA 2KTFA 1IP9A 3NJTA 1XX8A 4H02A 2ES2A 4HEA1 1HCZA 1PTOB 4GLSC 5FO7B 4ZYNA 1Q7YC 3W5OA 3Q24A 4IOAA 5D14A 3P2BA 1EQRA 1RDPD 1IL8A 5NUCA 2EOTA 3CQZH 5IKCM 1EWHA 2B2TC 1OGWA 3RNUA 2FNJB 4YSYB 1F9PA 4IFDH 3I63C 1VQNA 4BBNF 4WFN3 2OWOA 3OOCA 2KACA 4ICVA 2LMCA 1GOZA 2KECA 3U58A 1EWYC 3P20A 2FHTA 4RKBA 3FMCA 4PT5A 4KKTA 3VRBB 4XT1B 1MG4A 1EYDA 2LMCB 3MAQA 2KANA 3HOZH 1LTRD 1VQIA 4FLHA 4FULA 1B44D 1RL2A 2EYLA 4JGHB 2F0PA 4GGQA 3N1XC 4LNFA 2RBMA 4A93H 4LF7L 5ELOA 3JYUA 3MJ5A 3RZDB 4JI2L 2B39A 4HK2A 4A90A 4NZLB 4LF5L 2H1EA 1V86A 5C3XA 4NJCA 3EJIA 2GI9A 4JX1C 1TZ1A 4A3EG 4MEMA 1PLFA 1K53A 4P73A 3ZW3A 2O5IC 2VNUD 2EY2A 1GUWA 2LUEA 1DYQA 3HRZC 1QOAA 3J80c 2L76A 1LLRD 4JL9A 3F8TA 4RMAA 4I65A 4HKZE 2HT1A 1WY8A 1XLPA 3L08A 3CWIA 4W9FA 1EFWA 1S5ED 4W9HA 1AYFA 3BWUD 5CV4A 1QVFA 1L0VB 2JWZA 3A4SC 1GHKA 3TCAA 5IT9c 5JEAH 5E4XA 4ZRKA 2M00A 3RNGC 5LMNL 4B9XA 1V43A 4G4KA 5FLXE 2WXRA 2UXCL 1KH0A 1JT8A 4XIGS 2ZXRA 3EIVA 2NZHA 3HUIA 3IXSA 1C4PA 1P16A 3KDFA 1FR3A 4K8JA 4CBVA 1LTTD 2FMCA 4JI1Q 4NPSA 3S2DH 2JT4B 4HVBA 4R4IA 1SNOA 2EY6A 3KDFB 1G2TA 3J80i 2JA7B 1FPYA 1LFDA 1BCPF 3L0OA 1K8GA 3AE2B 3I56A 3HHMA 1QG7A 1UBQA 2G9DA 2K75A 1TWCB 3AEDB 1FYCA 4YWLA 3HEJA 2SDFA 2WKCA 1WH3A 2ZPYA 3SFDB 3QA8A 1NCVA 3A1QB 4IUMB 1IGDA 3FKYA 3M85A 1XJVA 1VQDA 1D6EC 3CHBD 2IL8A 3ZYYX 2IBIB 4LF4Q 4KD3A 3WAMA 4OO1G 1YX6B 2Q2IA 4U68A 3AE7B 1PVOA 3L2PA 3MXNB 2LKVA 4TKNA 2B2YC 4G11A 4M8AA 4BXXG 2EY1A 4PQXA 3SR1A 2UUAQ 3BZDB 4G7OC 1K52A 1T0YA 3K9OB 1BNZA 2E2JH 3FDTA 1EIYB 4NW2A 2NVQH 5A2QE 4K0KL 2OTLA 1ASYA 3KWLA 3RMHA 2OQKA 1GG3A 5KEEA 3PIPA 1XNQQ 3OJ4B 4JBMA 3DM1A 2ZW1A 1GB1A 3FKIH 3QIAA 1N32Q 3P4RB 2TMPA 3Q23A 3ZLZA 2BYTA 1STBA 3Q3MC 3VYTA 1FMAD 1AARA 1JRUA 1SSNA 4FF3A 3Q22A 1JW9D 1SE9A 2K8BA 2LJ5A 4DV4L 2HHHQ 1GM5A 1UNSA 1ESFA 2D10A 3ALBA 3VQIA 3OIQA 1T9HA 3RR5A 4HIOA 1L6UA 2Z6KA 4OWXB 3A5UA 1C77A 1ZOYB 2C35B 4JI5Q 4DV6Q 3S15H 2BS2B 4A3PA 1JWSD 1SYFA 1YJJA 1A0IA 1VQFA 3IHPC 4ME5A 1PMRA 2Q2UA 4JI0L 2ZW0A 4ZDVA 2I5HA 3U50C 4JI8L 1IBXA 2N0SB 3W1SA 5BO4B 4QB4A 1SFOH 4N58A 1IBKQ 4US8A 2FCSA 4DR6Q 3A7AB 2F4VL 4RGOS 2KWCA 3AI5A 3BY4B 1X3GA 1IBXB 3I91A 4FO2A 1LQBA 1T3QA 2VRRB 2EKEC 5E6OA 1I3QB 2C7MB 5IYDG 2QGQA 1PDQA 2KJ6A 4C3JG 4S0RA 3P1MA 5GROA 1GJZA 1JQ4A 3K7UC 3JW0X 3JC66 1I94L 3PQIA 4JI7Q 4P6VF 4C4VA 2IHFA 4XDDA 1QJOA 2QKIC 2DZIA 2F1MA 4X65Q 4A3KH 1PRTB 1PV4A 3MZ5A 5AJ3Q 5C23A 2KTRA 4A3GH 5J2RA 1S1QB 5D3IB 5DEHA 5EBCA 2NN6G 4DV7Q 4C4VB 3SK6A 4JBJA 4A8XC 2KFKA 2F52A 2ZM6L 3NHEB 3Q3OC 2KTRB 1L2NA 4LUZA 4A20A 3VA7A 1I35A 2K4KA 1VQJA 3ZIMA 4A3BH 2UWQA 5E6PA 3SR6A 4OZAA 3AM9A 4K81A 4P75A 1YIWA 1NMGA 1I4GA 1Z47A 3HOUG 1VQ7A 2R7ZG 1CSPA 2Q2HA 5EGTA 2B63B 1YD8U 4KGTA 3AFPA 1WFQA 3CMMB 2GVBA 3X3MA 1X6OA 2K32A 1MIUA 3QWNA 5M5XH 1NENB 2FCNA 4KHZA 3VR2A 1QNKA 2E2DC 4A3IG 2RDBC 4MSQB 3U4VA 2VUMH 3ETRA 3DMUA 4HKQA 2MPMA 1MGSA 3GDEA 1A2TA 5FLMG 5C3WA 5BN3A 3AMZA 4C3IB 3Q8FA 1HJPA 1EWIA 5BN4A 3PZ7A 2J0MA 2NVTH 2CQAA 1X32A 3D6WA 2GBNA 1E5WA 2ZJPA 4LNKA 2ASQA 4IALA 1O78A 1RJTA 5EQ0A 4ZKBB 2SOBA 1XEEA 2C7NB 2CS4A 1E2WA 2PMVA 5CR3A 2D3CA 1EZ6A 3Q6SA 2VQFL 5D3DA 2RCFA 1QKZA 2QA4A 4GNXA 1SNMA 2RDHA 4YY3Q 2WDVB 3OAWA 4WURA 4A3JH 1VQPA 3NP8A 1IBML 3NTIA 4J15A 3Q14C 1SJHD 1TKYA 4BS9A 3RZWC 1NE3A 3I4NH 1DM0B 4YWGG 2CQOA 5EE9A 2ALYB 2MJ3A 2INDC 1KD1C 4ASWC 4A76A 1FD7D 1P7EA 2MCNB 1QCBD 3P4SB 1RIPA 1V2YA 2PQAA 4MGKE 4IWQA 1TQOA 4XQJA 1GUNA 4LJPB 2G9HD 2AUJD 4B3RQ 1D5XC 1Q3LA 4KSKC 3UF8A 5ELNA 2LASA 2EXDA 3CPFA 5K5PA 2WLBA 2PQAB 2KCMA 4FF4A 4USAA 2MP2B 3MEFA 1C1YB 1MPEA 2VZKD 3L9AX 2CJOA 2K8CA 5IE8A 2JU6X 2XK5B 2Z0SA 5J22A 4NNJB 3HP3A 2CH4A 2EPBA 1O7ZA 1H9MA 1ZXHA 2MA9B 4O42A 4A3EB 3AYHB 2HDMA 2UUBL 4B95A 3RI7C 2L8JA 4A3FH 1HA6A 1O80A 1I6HB 5C4XG 5CMDA 2ZTCA 1FFVA 2K5VA 1RFAA 3D6CA 5JJZA 4NAWA 3UI3A 1M8AA 4FVMA 2F0OA 4FNFA 3BK2A 2BB5A 4YCUA 3J81c 3GV3A 2L1BA 1CZWA 3DVNU 4EZKA 2LXKA 5HY6A 1M94A 3IT4B 4NAWB 4DUYL 4KHPQ 4WWMA 5DPRA 1L0WA 5JJKA 2O2LD 4YL8A 1Q82C 1K8OA 1N36Q 2J0JA 1QLBB 3E0EA 4L23A 3KVFB 4QMGA 2FBWB 2DBYA 2HIXA 4R1JA 2A68D 4CJ1B 1ZXIA 5CV6A 2WDTB 3OTOQ 2NVXB 3E9SA 1ILQA 5IGDA 3PT2B 3EHVA 1GHJA 2WXGA 5KHQA 2VY3A 2MFIA 3N32A 4MTKA 1HTOA 3DM3A 3GTKH 4JIOU 3MWYW 2M1MA 2MUYA 5C3EH 1HHVA 1T0SC 3AFQA 1V5OA 3DWGC 1PFDA 2XNAC 1VQBA 2NPTB 3E6ZX 4YWKA 2GRIA 2KKCA 2MQJA 4AP4C 3I3TB 5JHBA 1Q46A 2F0LA 2WKDA 1YJNA 2L00B 1I4XA 4KI0A 3PTFC 1A62A 5EKIA 2MBBB 3PREA 3M4YA 3TEHB 1MG8A 2J7ZA 1PH6A 3PMFA 1NR4A 4GN3B 2O4XA 2NBFA 1RTNA 1Z9FA 2PCFB 1I4HA 2NWGA 1LUZA 3AEBB 4K5WA 3OLMD 1S3SG 1KXLA 2A6ED 1J6QA 2CHBD 2K6AA 5D2MB 3RZDH 3NQTA 2LVOA 1NI3A 1YITA 1C78A 1D8LA 4WJNA 1ICFB 2F0IA 1SLJA 4TUUA 5IGCA 2I46A 1X56A 3TMEA 4POFA 3QOLA 5IGFA 1G91A 4BKSD 2L83A 4QGUA 1LABA 4DXAB 1A70A 5CV7A 5GAGC 2JJQA 4JLCA 3H94A 2JA6H 4R4TA 1JRPA 1XLNA 1MD2D 3S1NH 1NNXA 4JPBW 1Z6HA 4NXNL 2VQEL 4JI3Q 2AWOA 3ZJYC 4LFCQ 1JMLA 4BKTA 1T5XD 1UEAB 2XIWA 4RGNA 1R4PB 2O6VD 4ANUA 4KKJA 5LLIA 2RMMA 3LB8C 4HSVA 4R8NA 5DPTA 1STAA 3C2PA 4XT3B 3I73A 3IL8A 4FXGC 3J80E 4NPNA 3ZDTA 2F0NA 3TEWA 3NQIA 4C3JB 2WP9B 2VB2X 2F3WA 4H44C 4YHHQ 2UU9Q 3FP9A 3DVGY 3Q8EA 1OQQA 3RNEC 1CKOA 4UPAA 3R93A 3A9KA 4LTUA 3AXCA 2GN5A 1N33L 2GBRA 4BBRH 2K8HA 3VR8B 1PZJD 3AE1B 4LNNA 1DZ1A 2N3SA 1X65A 5IGGA 4MHEA 1XPUA 5K36H 4PK1A 2FUG1 3A9KB 3OW2A 2PJHA 4MELA 4RF1A 3CC2A 3ULLA 4CDEC 3PO3G 3HOUB 1J7BA 2R7ZB 2VB3X 5FJ8G 3DPDA 2F0MA 1Q1EA 3M9BA 1ML0D 1I5FA 2KVMA 1HNXQ 2NS5A 3NVZA 4JBKA 3DWMA 4QJFA 1R9TB 1N60A 2OT2A 5I9OA 1WD1A 1FJGL 4HAEA 3R7QA 3UIOB 4JYAQ 3H7PA 1SE8A 2IZVB 2CU1A 3NE5B 2P5ZX 2K7VA 2KQ4X 4NP5A 1UAPA 5AFWA 3S1RB 3KUCB 2WINB 3H3VH 2F0FA 2LS01 4JW0A 1WWTA 4IDIA 4GKKL 3QIJA 1CKNA 1ENAA 1EUJA 1YNJC 4R4QA 4FF1A 3QHTA 4DNRB 4KV2A 3DBRB 2FCQA 4HN7A 4WJ3M 2EYMA 4GLXA 1FXAA 4YTPB 2DWQA 2JZPA 1FM0D 4MM3A 2HIVA 1CKNB 2UXDL 1WGDA 4KGRA 1E7VA 1IL2A 2D3AA 1VR9A 3CCMA 2C7HA 1MHXA 2DZKA 1IKMA 2WGSA 4MM3B 2QHOA 1JWMD 2B2VC 1NR2A 3GS2A 5BMIA 1PH4A 2F0KA 1FCLA 2F3VA 5CBAE 3P4QB 1S5FD 1TU2B 3Q8AA 4F88A 4IQZA 4OIKA 3Q3JA 4IUUA 3N9YC 1YNJD 4YTNB 4F7ZA 1V9PA 2SEBD 3CAMA 5I2YA 5IWAQ 1IBLQ 1WE7A 2BA1A 3PRPB 1JORA 1OXXK 3I4MG 1V1OA 1ZE3D 1BF4A 4OW0A 1X3FA 3V05A 2KYWA 1NYQA 1J0GA 4UP7A 4I6LB 5IYCH 4OHJA 4DR2L 4DR4L 2MJDA 4KV6A 4DAYB 2AEHA 4W9EA 1EOTA 2LGIA 1MHHE 1PFMA 3OSOA 3VUXA 4HR7B 1WTHA 4ME3A 2OEOA 3M3YB 4Y7NB 4MH0E 4W9JA 4DK5A 2IYDB 4HROA 2QMTA 2R93H 2K1FA 4K2LA 3CSTA 2L32A 2MWSB 1QUQA 2R6GA 1U4LA 1PH8A 1E9MA 2KDFB 1VCBA 1KOTA 1FXIA 2B2WC 2F0QA 4DAVA 2YYZA 3NBIA 1LT4D 1P3QU 5HG2A 2ZTEA 4RFBA 2WAQE 1N8RC 2ZEQA 3CW2C 1V1PA 4L5SA 1Y8PB 4DAMA 1R4NB 5C4XB 1ENCA 2WAQG 2NVYB 5BR8L 1V1PB 2MQHA 1EY0A 4YXDB 3KYCD 3L13A 1TGZB 3D3RA 1K0SA 2B2UC 1QILA 1SNPA 3GTOB 3TQYA 1K9MC 2IO3B 3DBHB 3QARA 4K2KA 4P72A 2F0UA 1BUIC 4W9GA 2V3NA 2MBHA 1ACCA 1ISNA 5IP7G 2YU9H 4YT0B 4OL7A 2UUCL 4K5VA 1WFYA 1IYVA 2KFJA 3W5VB 5C44H 4ANVA 3PLUA 4DV2L 1PTOD 3VR6A 1Z2MA 4FYDA 5GAEC 1RF2D 2PW9A 1H8CA 4GDKA 4CDCC 3TP8A 2V4LA 1HEZE 2PE9A 2LHEA 2RF4A 3L3OC 3HOYG 4LF7Q 3U7ZA 1XLQA 1VZ8A 4GDKB 4IW0A 2NTTA 3AQQA 1XTCD 5GAHC 3V6EB 2EXZA 2I5LX 1ET9A 1I50H 4JI2Q 4GOPC 4OO1I 2RSOA 1CZGA 3VA5A 2KHJA 3ULPA 4LF5Q 4A3LG 4GXBA 4F87A 1B9RA 2BQQA 1AFPA 1I7HA 2HCCA 3T3NA 4A75A 2JA9A 4TKOB 1D5ZC 4OEMB 1K83H 2PZUA 1N62A 2CJNA 1DOKA 4EZLA 3K57A 2Y3AA 2WXLA 4LDTB 3G6JB 1CMXB 1ZKHA 4FN2A 4XYQA 1XO3A 4BOSC 5EE0A 5IP4D 2HQEA 3T4AC 4QIWB 2IHEA 2NBVB 3Q8DA 3SFEB 4P74A 4X57B 3IFWB 1WSPA 3M4OB 3M3JA 2K14A 1TWAB 3OWEB 3HFZB 4HCSA 3GTPB 3GTMB 1Q5WB 4PV1C 1XPRA 5LMNQ 2KCTA 3I72A 3QOJA 2UXCQ 1NVID 3ZTDA 2BPSA 2JN4A 3WA0A 2RHSB 2HUGA 1D7QA 5CHFA 3RULA 2L9HA 4U673 3NENA 3ML8A 4M8MA 2N55A 4A3EH 5C6AA 3KBXA 2JA5G 2XSCA 1T0QC 1M1KC 2DY8A 5M5WH 1OTRB 1WIAA 2GBMA 1FVIA 5D94A 2A6HC 2ZJRA 2Z0EB 3H1UA 4FDBA 1XPOA 2F4IA 2L11A 3STBC 1I6HH 4ZUJA 4O2DA 5KYIA 2KEDA 2CCZA 4MSMB 1FD6A 2IY0B 2KNBA 3HRDD 4KZCA 4CDFC 5AEKB 1VF7A 3T16A 3PPAA 3K7AH 4X3SA 4EQOA 4XX5A 3PUVA 2L15A 4RM8A 4XWWA 5IAAC 2E76C 3KF8A 1EY5A 4HCPB 4N9TA 3BVGA 1LXDA 2MW5A 2KHIA 2NN6I 2D0PA 3STBD 3RNBC 3H8HA 3KF8B 3RLNA 1PYBA 1VD2A 2V1CC 4E74A 4GN5A 2OXPA 4K0KQ 3E56A 2OQ0A 1D2BA 5E6NA 5KNCA 3H3VC 1ZDVA 4G7HC 1CUKA 4POGA 1IYFA 4HCEA 3KOJA 2AQ2B 4CDDC 1PA6A 1KRHA 2VXWA 3PO0A 1KDCA 3CCUA 1F9SA 2V1YA 3APDA 4A3DG 2KLCA 4OWTB 1ESRA 4DV4Q 3P42A 4MGYE 3A5ZB 4DV0Q 4ABNA 2KC1A 3G4SA 4RHRA 4LW1A 3PO3B 1CHQD 1L2FA 3SDLC 2OOBB 4R4CA 3B2GA 1TXYA 2DYOA 2Z6BA 3EFUA 3A55A 2ZVNA 1EYCA 4JVZA 4PZ8A 4DR7L 4JI8Q 1DCZA 3G71A 2FJ2A 4IG7B 4G3XB 3AEFB 2G4DB 1ZDXA 4GMVA 3PUZA 2Y5BB 4M02A 2BYEA 4N9PA 1RWSA 2WXHA 2F4VQ 3DBRI 3IT6B 1K3RA 4CJ0B 4K6LA 5TR5A 3A4RA 2SNMA 4G50A 2A5HA 4X66L 1KNEA 5LHY1 1PRTC 4LJZC 4DDID 4KY5A 4EKUA 2KOLA 1WCMH 1I94Q 2BGFA 1LO5D 4TVAB 4DK6C 1Y1VH 3I7FA 3R2IA 2AL3A 4RWSC 2K1BA 4MZ9A 5HI1A 1KNAA 1E3PA 4HJ8A 3PRMB 4WQOB 2K5HA 5LL6S 3S2AA 3H0GH 3MA2B 1RRBA 2YLMA 1JOKA 2DJFC 3ONAB 1HA5A 4M1UB 2ZM6Q 1WXMA 3S16B 2DAJA 3TDQA 2K22A 4BVUC 4C2MB 1H9SA 4CJ2C 3LGJA 3UDFA 3E0JA 1WXQA 2IW3A 1BT0A 4LCDE 3E3XA 3T13A 2WXKA 2X8XX 1UE7A 4IUPA 3AN1A 5AZHA 4IM2A 1PRTD 3GOEA 2NCNA 2D2CC 1H9SB 3PSIA 2DN8A 3H09A 2H4OA 3ER0A 2GVAA 3T1YL 3I4MB 3LX0A 2KJHB 1EY8A 2KAJA 3ZTCA 2JRIB 3M4PA 3PO2G 4IPHA 5C0XG 4YTMB 2M17A 5EE1A 3CRLC 3K5OA 1VJKA 2PVGC 1LTLA 3SE0A 1C4AA 2ON8A 3U8ZA 3PLVA 2WIIB 1PUTA 4HTHA 2LI5A 5CX3A 3DHHC 2Y0SE 2WXQA 3VTVA 3BYYB 3EBEA 3S17B 3U52E 3B6YA 2VW9A 3QQ8B 4EOYA 2XRSD 2IT1A 1E1OA 2Y0SG 3HKSA 5HGTA 1F2ZA 2F0JA 4C3HG 3CCSA 2KDIA 2MEKA 4HJAA 1JOQA 3L7ZC 2WXNA 1R4NI 3ERSX 4EVOA 1VMPA 2ZT9C 1IKLA 3L16A 2G3QB 1PH5A 3FILA 5BYQA 1YEZA 4PMBA 1QOBA 1LTSD 4UY8C 2DX5B 4X3UA 1O7YA 3KWVA 2WXIA 5CHVC 1E0BA 4P2CB 5FLXL 3VR9B 4F8CB 1UE5A 3DBHI 4LNOA 3KLSA 5HHDG 2A73B 1L1OA 2WAQB 3EQLC 3CMEA 4A3IH 1YN3A 5HKHA 1RYJA 1HUMA 2PPHA 2VQFQ 1V8CA 1TR5A 2WU2B 4C7YA 4YSZB 3CP0A 1SROA 4DF7A 2UXBL 1L1OB 3DBLB 2K03A 5FLMH 3V62A 5JPMC 1IBMQ 1KRTA 3IBEA 3R3MA 1JWUD 1C9OA 1W2BA 2Q2TA 5I6WA 4K8IA 3CC4A 4DKAC 1H4RA 2KC2A 1HTLD 3I70A 1EIHA 4K14A 2N78A 3RZOB 1YHBA 1NDDA 2A4ZA 3OMCA 1FRRA 3O65B 4P1BC 5C0XJ 1EUVB 2K3UA 4CQNA 3HVDA 5M3MB 5H1SE 4IM3A 1EF5A 1Q81C 4KLKA 1CJEA 3CXCA 4II2B 3WOEA 3I9V1 5JH5C 3EVQA 3C1FA 3WDNA 3DHIC 1X9NA 3L4PA 2CW0D 5IO9A 3HOYB 3SHQA 3VYRA 3EROA 5JVG3 3U9SA 2BH2A 1UUPA 2MBOA 3AE8B 5IN7A 3RNAC 2BWES 1VQGA 4N59A 1GNUA 4GZYC 4DR3L 2UUBQ 5CTRC 3NVYA 2TSSA 4FXKC 1S5CD 4ZCKA 3ZRFA 3HG9A 1JJ2A 1N5XA 2PQEA 3ZJVA 1MSGA 5J3BA 4EEWA 5M3FH 2PE6B 5C5MA 5FO9B 1J8CA 4Y7NH 3HOZG 4FXDA 2B76B 2YVCA 1ET6A 1L0XB 2RSNA 1WGRA 1RTOA 1H9KA 4DUYQ 5IODA 3U7DA 2H5XA 1ZW7A 1K8MA 1MI2A 3S14H 1U4PA 2MBQA 3B2FA 2E75C 2HDEA 5I4DA 4GSWA 2E2IH 2L0TA 1AP0A 4BWGB 1Y14B 3T56B 2B2TA 3TS0A 3N6RA 3HVZA 2JA5B 4HDQA 3WALA 2XRQD 3AU5A 1PHJA 3PGEA 1BUVT 3KF6A 4FP5D 5C4XH 4FJZA 2KCNA 5C4JH 3B0AA 1SJED 1VQEA 1WR1A 5H92C 4DHJB 2KFKB 4DUZL 2OF1A 4KMUC 3GTGH 2WNMA 1CFMA 1GC7A 1WM2A 3KF6B 4TQ0A 4E6IA 2FMMA 1LYLA 1CT1D 3CKIB 3DEPA 4RGTA 1A6XA 3TEZA 1STGA 5EPKA 3CC7A 1OTCA 1XD3B 5JEAG 2NVUI 4I6PA 4XC2A 1U0LA 5E3FA 1UGMA 4YCVA 3OG5A 4BBSH 2KWVB 4X62L 2X38A 3ZNZB 2K5WA 1KHIA 1WGYA 1HZAA 4IFDJ 2DZJA 1GUOA 3T1HL 2O5JC 1WJ6A 3GTQB 4GU2A 3LDZE 1GUAB 1GD7A 1F9QA 1WZ3A 1WTWA 1F52A 1N61A 4DFAA 3EA6A 2EYHA 3FC4A 5LXHA 1V49A 4PS7A 4WWNA 2X6LA 1B3QA 1IYJB 1TWGB 3ZNHB 1U4RA 3LJ3A 4X6AH 3OHXC 2QW7A 4PMWA 2HTME 3V2TA 5M5YB 1KLVA 1U5KA 1OXTA 2A8VA 1NTGA 4A3DB 2Z59B 2KZRA 2KEEA 2PO4A 1QZHA 3PV0A 3AE5B 2DAFA 4K7WA 2DNFA 2F0GA 1KAWA 3KLRA 3J7YW 2AUKA 1WMHA 1X1MA 1AWDA 1SBBB 4M01A 1XTDA 1B9MA 2WB1G 3PIO3 3SHLA 2YTVA 4KSLC 3NXWA 1TWHB 5J1ZA 1TWFB 2JPHA 3NVVA 3PZ8A 1MJCA 4EQNA 3M4OH 1I42A 1N9WA 3GTMH 4NXNQ 4ZRZA 1XQQA 2JA8H 4GNXB 2KQSA 4GLVB 1S5DD 4IJLA 1F2LA 1ZGUB 3FKIG 5JEAJ 2ATWA 1Q12A 3GTJH 3HOVH 4S3SA 2HD5B 1GXDC 1C0AA 1WM3A 4RF0A 3PUYA 3DHQA 1E22A 2D0OA 1IUEA 3ULJA 4XYOA 3TJPA 1M90C 2R92H 3S1QH 5BYSA 3D32A 2BE5C 2Z9HA 2MJ8A 4H7BA 2EMTA 1PZID 3VVWB 1YJIA 1A15A 4NJ7A 1D5MC 5D7GA 5DNFA 4JWUC 4B0MA 4WORA 1XMOL 2DENB 3MC8A 3GE3C 1CI3M 4K7SA 1N33Q 1ZUD2 2L3ZA 5CYUA 4G0NB 1WX7A 2SAKA 4UAIA 1D4BA 3NRZA 2MRPA 4YIJA 3H9DA 1XNQL 5KYLA 4LF9L 3I90A 2M9VA 3UIPB 2A68C 1XYIA 3DWAA 4TMAB 2BE5D 2YV5A 4DU9A 3NOBA 5J18A 5BMHA 3HOXH 4AIMA 4DN4M 2E2HB 3ML9A 2WS3B 2RD0A 3KJPA 1DXMA 1C76A 4HLEA 1JMCA 3PO2B 4PYZA 2VL6A 4JI5L 4OX9L 4ZHPA 1UWXA 1GO3E 4A3GG 2JZ3B 4DPGA 3PF4A 5HGQA 3N20C 4NAMA 2WXOA 1EY7A 5HFYA 4ZKCB 2KDBA 2QC8A 3V6CB 4X3TA 4TQ1A 3VH4B 2J52A 4OVVA 4HWIB 1HRJA 4W9KA 1JE4A 1I4RA 1GUSA 4A3BG 2A19A 5GMVA 4XDXA 1CZPA 2RCNA 2Y0SB 4P16A 2MHJA 4C3HB 4ALPA 3N1YC 3T9LA 2G4SA 1B53A 1I6VC 5FJ8H 3BIID 4ANWA 3SK4A 2UXDQ 1PGAA 3KQ4A 4XE0A 1PTOH 3J81i 4WQMA 4DWFA 2A6EC 3GD7A 3OMGA 3ERQA 3NPPA 4IJHA 2MO0A 2ONQA 1GAQB 4IM0A 4B08A 4A9AA 3DBLI 5AJ3L 1BQQT 4PNYA 4XQQA 1VF5C 1P1AA 2IX0A 1PDXA 2GB1A 3K6OA 1SGHA 4LF8L 3K0YA 4QIWE 2VUMG 4LNQA 3HOWG 2K5NA 4M00A 5AZFA 1MJEA 2MHVA 1GUTA 3UDXA 2WXFA 5C4HA 3H15A 5ELDA 2JQRB 1YQBA 3CIRB 1Q1BA 2QJLA 3AU7A 5COYA 4W9DA 3ZVVA 1AE2A 1PGBA 5LMNW 2B3AA 4DR2Q 2L05A 3OYYA 3RMKC 1DOIA 3QR8A 1SNCA 2DY7A 1O7LA 4L63B 3J7AV 1D3ZA 4XQNA 1SXTA 2INNE 1JWAD 3KLSX 3AV8A 4IUVA 4REZA 3RFZB 5JJIA 1Y69U 1OQYA 3RUIB 3AEGB 2KN5A 3MHBA 4MNOA 1IHZA 3ZQ4A 2BOSA 2MO1A 2IWHA 4A3JG 2NZ1D 5C3JB 2KVRA 2NTSA 3FPPA 4RH6A 3I4MH 2F3IA 1FGUA 4EQ5A 4EZJA 3CQZB 2N7DA 2WXMA 5LL6X 3D8GA 5CV8A 3I4NG 2KWUB 2LGXA 4OZBA 5FKAC 1BCPB 4GDLA 2BKFA 2EYFA 4XDCA 1F9JA 1J8IA 2ZNVB 1ZXTA 2H89B 2D62A 2EQSA 1EFID 5BR8Q 1NYRA 3MJWA 4GDLB 4GLAC 2BW2A 1C48A 4OVUA 3HOZB 2EE1A 3D4WA 3MTSA 1G8ZD 3WANA 1PQSA 3QCAA 2JA7H 3F2CA 4H2AA 4WAFA 2VH1A 1F2YA 3VH3B 1Z7TA 1SN8A 1DJRD 1VQAA 3F2UA 5IYBH 5IT9E 1II3A 3NBHA 2UUCQ 3J7AF 2JUOA 3DHGC 1TWCH 3IG3A 5FLXc 3MVVA 1SMYC 1TVXA 4DV2Q 1LT5D 1WX8A 3FAHA 5EPJA 1N63A 3F2BA 1YQ4B 3K9PB 4WJ4A 4EFOA 4A3FG 1EZ8A 3NBHB 4DV3Q 3M7NA 2DNCA 1HNZL 4C80A 2IX1A 2J0KA 4KKIA 1UWMA 3HK0A 4LF6L 5EDSA 5FR3A 1WJJA 1QOHA 3J80L 4B3RL 2PIAA 1N6ZA 3ND8A 2BT6A 2QDLA 1SR3A 1FEHA 2YEPB 1WYGA 3I5JC 3QG1A 1HFNA 2PLPA 5DM63 3DVGX 2RKSA 5JXVA
chains in the Genus database with same CATH topology
1PZKD 3GP7A 1SSOA 2M0AA 2KHSA 1SMYD 3S2HB 2JXTA 1PGXA 3Q69A 4TQUS 2PNRC 2Z4IA 3P7JA 4KY6A 1LTID 1FIQA 2EVBA 3P4QB 3U4EG 3NTHA 2Y5PA 3GO5A 4ZOHC 3T3OA 2EY5A 2Q5WD 4HMIA 4ARIA 2CU3A 1KFYB 3KUPA 4Q5VA 2N9KA 1YNND 1JB3A 2F0SA 3O13A 3M7GA 2WDQB 2EZVA 4LAAA 3P4PB 2JXMB 2F03A 5CORA 2ENBA 4MN3A 4WJWA 2WB1B 4OIJA 2R3ZA 4KJOA 2E2JB 2NVQB 4KY7A 2E6XA 1FCCC 2WV6D 1CQFA 3D4RA 3FKIB 5G5HA 5CV9A 3MHZA 5KNDA 3A54A 2Z4HA 4QCLA 4ZRQA 1U9RA 2W82A 1F77A 4RCNA 1STHA 3S15B 3K5MA 2QIEB 4FF2A 1TKEA 1EU4A 1OFFA 4JBWA 4J3OD 1S5BD 1L6VA 1ENFA 4QUCA 2R61A 1WRIA 1SFOB 1E6EB 4HMJA 2N9LA 1PTOC 5C0XI 4DAPA 3I4LA 4JPSA 2PZWA 4RA8A 5AUKA 2J42A 2EYJA 1CM9A 4A55A 3RPFC 2H88B 1F2RI 3EFXD 4A3GB 2PTLA 1C4QA 1HQMC 3P63A 5K36G 2KMMA 2DNEA 4A3BB 2AWNA 3IFDA 4TSSA 1T6BX 5FK9C 1LACA 2QEJC 3P1HA 1PRTF 3I3CA 3K58A 3CU7A 1YNTE 5ISRA 5ELCA 3OPOA 1SF0A 2OHFA 3IAM1 3LWEA 3R3OA 5CBEE 2CVRA 3I8ZA 1ICWA 5HURA 2L52A 3H91A 3AE4B 4ZAIA 4QUFA 5EBDA 3HOWB 2VUMB 1V8QA 1OO9B 2RVLA 3FVQA 3NUCA 1EM7A 1VRAB 4R9WA 4C1NK 4RKLA 1EQTA 2PMZB 5E1FA 2NVTB 5I2XA 1WTVA 2L12A 3AEEB 1F0ZA 2V4IB 4DXFA 4CKCA 3BDLA 1JC7A 3D31A 1C4CA 3S1MB 3WCQA 1EYAA 3VR4A 3TSSA 3HZXA 1HFGA 4A3JB 3LWUA 4RNAA 2QF7A 4G57A 5IGEA 3I4NB 4KD4A 2BB6A 3ITPA 1KDBA 2IX3A 2JSVX 1RM6C 1BMLC 2ICIA 2JSOA 1AW7A 3SK8A 4R8IA 5MPOA 2B2VA 2C5CA 1SE4A 4J1MA 2KUMA 3ZJUA 2MH7A 2N88A 3A8KE 3A56A 4RCOA 3J81E 1KAAA 3RLFA 3JAML 2MP1A 3MFGA 1JCKB 2WXPA 3NZ3A 4KHVA 3FRPB 5IGBA 1QT9A 4EE2A 4A3FB 4IKGA 1FRDA 5IIFA 1U4MA 4OO1H 3VYUA 1C79A 3QB3A 3GTLB 1HTPA 2NUCA 1Y56A 4C56C 3GQBA 1QWYA 2Z1CA 3DXJC 4LK1C 1MI0A 1VCIA 2B2WA 1HPCA 4X3KA 3QJYA 1SE2A 4PMCA 3U9OA 2F0VA 1T5EA 1B2TA 2N7JA 4UDUC 2LFNA 3TBIB 1VLBA 3OIPA 1ILPA 2JP1A 1TYGB 3ND9A 3GTKB 3TN2A 1KF6B 5C3EB 1ZP0B 2B2UA 1EQVA 1A3VA 1GUGA 1B50A 2XVSA 3VYSA 1BO0A 1JWBD 3LNNA 3NSWA 4OGQC 2QDBA 5EJWA 2WACA 1C9FA 4L2YA 2K0PA 5IOCA 3ZJTA 4NKLA 2W3RA 1STNA 3C8YA 3UI2A 2KDMA 2LY7A 3MXPA 4DA2A 4FXCA 1BDOA 4ILWA 5JPNC 2I07B 1EU3A 2EELA 2NN6H 1NAPA 2Q8RE 5E4WC 5GXGB 3IAYA 5JOBA 2V0GA 3QO2A 5ELBA 2BTEA 3URYA 2F0DA 3A7LA 3W5UB 1N5WA 2JA6B 3HGBA 4BY1B 3S1NB 2W55A 1V97A 3KBGA 2PW5A 2BDNA 2K33A 2RA4A 5FOBB 2JX5A 2MJEA 3FILB 1TJEA 2ACZB 1EWCA 2I38A 2WQYB 1MSHA 2CW0C 1SYBA 3GV6A 4KGSA 3NTKA 3PUWA 1RKNA 4RAUC 1IW7C 1AEXA 1TS5A 3KK7A 2X69A 2XWJB 1EY9A 2PKOA 4BBRB 1STYA 4O1NA 3MXNA 3PIP3 2JWUA 2A69C 4L6TB 5T1IA 4EGVA 3IAS1 2J4XA 1KTKA 2LEKA 3HS0C 2LFIA 4ZK9B 2NMQA 4NMZA 4H0LC 4ZLTF 2QSDA 1TZOA 3AMUA 2WP8J 2HDLA 2B8GA 2LUMA 1IW7D 5A2QL 1DD2A 4IFDG 4IOIE 2IJ0A 4WH4A 3IFTA 2F0HA 4F8MA 1DONA 2C9OA 2A69D 3C1EA 2IGGA 1BOSA 2LHDA 5G3LD 3Q0AA 1WTRA 3Q8CA 5M9OA 3PUXA 1C8CA 1F2RC 2IDYA 3NS1A 4IN3A 1F9RA 1G2SA 1TS4A 4RHSA 5I9PA 4G7ZC 1K51A 1CTMA 1IYUA 2M56B 1EL0A 1SYGA 2NB0A 1SDFA 3SEBA 2D9UA 3TP7A 3J9CA 1A2UA 3BDOA 3T51B 1VZ6A 4IUTA 5ELEA 1TKGA 2G1EA 1X3QA 3OWFA 4TRDA 3AE3B 2PZTA 5KGUA 2WU5B 2R93B 2E3TA 2Y5CA 3BS1A 2BCOA 1WTPA 2RQXA 1R7SA 3K5NA 2XN9C 1MBYA 1MVKA 1R4QB 1W6JA 1DOYA 1RHPA 2IPKD 1SB3C 1WGKA 3CRKC 5A35A 4JWSC 1E2VA 2JEAI 3U2SC 1HQRD 4US9A 3B9JA 2L55A 3MXGA 1XWEA 1WTQA 2D5DA 1SNDA 1AZPA 2L1AA 1RCVD 5EKLA 4LMQD 2AQ3B 3ZGZA 1BCPC 4IUNA 1VMCA 1TS3A 2JYEA 2PPBC 3D4DA 4M0WA 2YU9B 1FO4A 5LNK1 5BMGA 3NVWA 2F0WA 5C44B 1WD0A 3V96A 3MP9A 1L0YB 2RDGA 1ZEQX 1TY0A 1BCPD 1F2MA 1L5PA 4HJGE 4JE3B 1JALA 1IGCA 3TZUA 2J0TD 1I50B 2B2YA 2A74C 1XCTL 5T8IA 4LLGM 4HEDA 1EIGA 1GPXA 4V0BA 1Y1WB 1SE3A 4BA2I 2KN4A 1K83B 3MXUA 5EKKA 1UGJA 1LTGD 1STEA 4MIUA 2F0TA 1FNUA 1VDVA 3FPUB 2FFKB 2WXJA 4A3MB 3OW7A 4KKUA 3NUHB 1GB4A 2X6GA 1J9OA 2L5TA 4B9WA 5M5WB 5KIXA 1SAPA 3C3LA 1QF6A 2DLBA 1LT3D 1KABA 1JOOA 3MC0B 3TEYA 3K7AB 1D1KA 5C2TB 1LTAD 2PVOD 1FNWA 4IURA 3G7LA 4DK0A 2XWBB 3NK9A 2QCPX 2QILA 4Z9CB 4CKEA 4MH8A 2M2LA 3W2DA 2ZXOA 1J7CA 5H8YE 3TZDA 1I4PA 2AX5A 4MT5A 2INPE 4BY7B 5BN5A 3IKJA 3HKZB 3W3AA 1SEBD 1TKWB 1HZ6A 1QOGA 3R8BA 1LT6D 4ZYSA 2K5QA 4MACA 5CGKA 1SIJA 2EYOA 4ULLA 1YMHE 3N52A 4V190 2FE8A 1VZ7A 4ZHOA 1FNVA 1DOLA 5C4ZA 4DGZA 1WVLA 3AH7A 1ROEA 4CKBA 1SYEA 4DK1A 1HZ5A 1KDAA 3E5SA 1QB5D 3DUZA 1OXSC 3T53B 1P7FA 1JROA 2JYOA 3RD4A 4YSXB 3VR5A 2BBCA 4N6EB 3VRAB 2K05A 3AE6B 4EQPA 4ARCA 3NHHA 5D65A 3DEOA 4AYBB 1YN4A 1PTOF 1WCMB 5C5LA 1LV9A 3BG3A 1Y1VB 2E74C 1I4QA 2KQ3A 4A93B 1B4OA 3H0GB 1HUNA 2K5PA 2Z8LA 3SXHA 4IZ8A 3AB5A 1SNQA 1OXVA 3R2TA 1J7AA 1FFUA 3SVMA 2VZKB 3A8JE 1TIID 3I57A 3C46A 2ZXPA 4KJNA 1WTOA 4ODGA 1B9NA 5ELFA 3AECB 1KLGD 1KLUD 2HCIA 4BA1I 2RDFA 4A6QA 5KNBA 4IUQA 2PW7A 2AQ1B 5CC4A 5IT9L 3A8IE 4DNTB 1NSNS 1M4VA 2I2YA 4KTAA 3S2DB 1YNNC 2Q8IB 1CHPD 1RD9D 3BDCA 3S9WA 1G6ZA 2J53A 3TUOA 3LYYA 2K9XA 4K5XA 3TP6A 3BVZA 3AEAB 3MEHA 3WOFA 1L4ZB 3NWSA 2BA0A 1BXTA 4A3IB 1OXUA 1E7PB 1DGJA 3BVMA 4ZUIA 3NWTA 1E10A 3BYTB 1DOXA 2IGHA 2BDOA 1CA5A 1Y8NB 4XWTA 5TSSA 1EY4A 2GA4B 2PYKA 4HRSA 3K59A 4J6HA 1XF5L 1QNUA 2K04A 4LK0M 1CA6A 1Q8IA 1JICA 1PFBA 1ZYRC 1VDZA 1RODA 2KWDA 1PFNA 2EJMA 4AQ7A 3VR3A 4DAYA 3TEXA 2EDGA 2V4DA 5DM73 1SYCA 4KK7A 2NYZD 4OZCA 5M3FB 4K6DA 1ZYRD 3DWPA 2F0EA 2ICEC 1Q90A 3TP5A 3RUZA 4ZQ3A 3DWQA 5JVH3 5BYRA 1TT2A 4WIPA 4A3KB 3S14B 4NDXA 5E6JA 2FINB 2E2IB 2JEBI 5G5GA 1SYDA 2D5GA 1HXYD 2L4NA 4DQOC 1BBXC 1ONLA 2BS3B 2K5DA 4R3DA 4Q2JA 3X3NA 5JAVA 5C4JB 1XCQL 3GTGB 3AB9A 1Q10A 2K28A 2EJFC 2SNSA 5J39A 1RFKA 2WDRB 1G291 4WURA 1QQRA 4ID6A 5M5XB 3W9CB 5F2DA 4BBSB 4QF4A 1QOFA 3ABVB 4B0EA 2IGDA 4J8QA 3BK1A 2W3SA 4KX6B 3FEWX 1X3PA 5KRUA 2ID0A 3EUB2 2W54A 5EPLA 4CGYB 1TY2A 1EY6A 1JQYD 4ZRPA 1L4DB 1AN8A 1CQVA 1PYWD 1XLOA 5DAUA 5EE3A 1LTBD 3H6MA 4WRDA 1A3UA 4IFDI 1CK1A 1DOMA 4XTCS 2V3PA 3K5LA 4KN4C 4XXEA 1W6KA 1EEID 3V3XA 2KCCA 2JA8B 1FGBD 1PXUA 1B3AA 1WTXA 5C0XH 3SK5A 3EGRA 4D2KA 3HOVB 3GTJB 1OQRA 1GJXA 4JK1C 1ZKOA 1EEFD 2M19A 5I6YA 4C1NI 3P75A 3S1QB 2R92B 1ZPSA 2EKIA 2K01A 2LJIA 2EJGC 3MFYA 4DXGA 2EYPA 3Q8BA 2MGSA 4OVZA 1S4ZA 1H9RA 2KJXA 1JR0D 4CHTB 3GB1A 3JAME 4HSPA 4Q0FA 1K50A 4L1BA 2OEDA 2JE6I 4KN7C 5CV5A 1E2ZA 4I7ZC 2JYTA 4RGMA 2A6HD 1BR9A 1QE6A 1E0ZA 5T1GA 1A3TA 1H9JA 3HOXB 1B1ZA 1AZQA 3SDZA 1YN5A 3LXFA 2B8FA 5G3LF 4C3IG 2Q8TA 3J81L 1NUCA 2BS4B 4F7XA 1TS2A 4H13C 1XXGA 5AUIA 5FO8B 2L0CA 1YQ3B 4KKSA 4L8JA 2KA7A 1NEKB 1Y8OB 2RPVA 2DYMA 1D1IA 4ITKA 3AE9B 4C7ZA 1XX8A 4HEA1 1HCZA 1PTOB 4GLSC 5FO7B 3Q24A 5D14A 1RDPD 1IL8A 5NUCA 2EOTA 1EWHA 2B2TC 4YSYB 1F9PA 4IFDH 4WFN3 3OOCA 2KACA 2LMCA 1GOZA 2KECA 1EWYC 3P20A 2FHTA 4RKBA 3FMCA 4PT5A 4KKTA 3VRBB 4XT1B 1EYDA 2LMCB 3MAQA 1LTRD 1B44D 2EYLA 2F0PA 2RBMA 3MJ5A 3RZDB 2B39A 4A90A 4NZLB 2H1EA 5C3XA 4NJCA 3EJIA 2GI9A 4JX1C 1PLFA 1K53A 2O5IC 2VNUD 2EY2A 1GUWA 1DYQA 3HRZC 1QOAA 1LLRD 4I65A 4HKZE 1XLPA 3CWIA 1S5ED 1AYFA 3BWUD 5CV4A 1L0VB 1GHKA 5JEAH 5E4XA 2M00A 4B9XA 1V43A 4G4KA 5FLXE 2WXRA 1KH0A 4XIGS 2ZXRA 3IXSA 3HUIA 1C4PA 1FR3A 4K8JA 4CBVA 1LTTD 2FMCA 1SNOA 2EY6A 1G2TA 2JA7B 1BCPF 3AE2B 1QG7A 2G9DA 3AEDB 1TWCB 1FYCA 3HEJA 2SDFA 2WKCA 3SFDB 1NCVA 1IGDA 3M85A 1D6EC 3CHBD 2IL8A 3ZYYX 4KD3A 4OO1G 3AE7B 4U68A 2LKVA 2B2YC 4M8AA 2EY1A 4PQXA 3SR1A 4G7OC 3BZDB 1K52A 1BNZA 3FDTA 4NW2A 5A2QE 3KWLA 3RMHA 5KEEA 3DM1A 2ZW1A 1GB1A 3QIAA 3P4RB 2TMPA 3Q23A 2BYTA 1STBA 3VYTA 1FMAD 1SSNA 2YEPF 4FF3A 3Q22A 1JW9D 1UNSA 1ESFA 3VQIA 3OIQA 1L6UA 1C77A 2BS2B 1ZOYB 1JWSD 1SYFA 1YJJA 4ME5A 1PMRA 2ZW0A 1IBXA 2N0SB 3W1SA 4QB4A 4N58A 4US8A 3A7AB 4RGOS 1IBXB 3I91A 4FO2A 1T3QA 1I3QB 1PDQA 4C3JG 3P1MA 1JQ4A 4P6VF 4XDDA 1QJOA 2QKIC 2F1MA 1PRTB 3MZ5A 5D3IB 5DEHA 5EBCA 2NN6G 3SK6A 4A8XC 3VA7A 3SR6A 4OZAA 3AM9A 1I4GA 1Z47A 5EGTA 2B63B 4KGTA 3X3MA 2K32A 3QWNA 1NENB 4KHZA 3VR2A 1QNKA 2E2DC 3ETRA 3DMUA 4HKQA 2MPMA 1MGSA 1A2TA 5C3WA 5BN3A 3AMZA 4C3IB 3Q8FA 5BN4A 3PZ7A 2CQAA 1X32A 3D6WA 4IALA 1O78A 1RJTA 5EQ0A 4ZKBB 2SOBA 1XEEA 1E2WA 2PMVA 5CR3A 1EZ6A 3Q6SA 5D3DA 1QKZA 1SNMA 2RDHA 2WDVB 3NP8A 3NTIA 1SJHD 1TKYA 4BS9A 1DM0B 4YWGG 5EE9A 2MJ3A 1P7EA 1FD7D 1QCBD 3P4SB 1TQOA 4XQJA 1GUNA 2G9HD 2AUJD 1D5XC 1Q3LA 5K5PA 2WLBA 4FF4A 4USAA 1MPEA 2VZKD 3L9AX 2CJOA 2JU6X 5J22A 3HP3A 2EPBA 1O7ZA 1H9MA 1ZXHA 4O42A 4A3EB 2HDMA 1HA6A 1O80A 1I6HB 5CMDA 1FFVA 3D6CA 5JJZA 3UI3A 1M8AA 4FVMA 2F0OA 4FNFA 3BK2A 2BB5A 3GV3A 2L1BA 1CZWA 3IT4B 4NAWB 4WWMA 2O2LD 1K8OA 4L23A 1QLBB 4QMGA 2FBWB 2DBYA 2A68D 4CJ1B 1ZXIA 5CV6A 2NVXB 3E9SA 1ILQA 5IGDA 1GHJA 2WXGA 3MWYW 2MUYA 1HHVA 3DWGC 1PFDA 2XNAC 3E6ZX 2GRIA 2F0LA 2WKDA 1I4XA 4KI0A 5EKIA 3M4YA 2J7ZA 3PMFA 1NR4A 2O4XA 2NBFA 1RTNA 2PCFB 1I4HA 2NWGA 3AEBB 4K5WA 2A6ED 2CHBD 2K6AA 3NQTA 1NI3A 1C78A 2F0IA 5IGCA 2I46A 3TMEA 1G91A 3QOLA 5IGFA 2L83A 1LABA 1A70A 5CV7A 3H94A 1JRPA 1XLNA 1MD2D 1Z6HA 1JMLA 2AWOA 1T5XD 1UEAB 2XIWA 4RGNA 1R4PB 4KKJA 2RMMA 3LB8C 4HSVA 4R8NA 1STAA 3C2PA 4XT3B 3I73A 3IL8A 4FXGC 3J80E 2F0NA 3TEWA 3NQIA 4C3JB 2WP9B 2VB2X 2F3WA 4H44C 3Q8EA 1OQQA 3R93A 4LTUA 3VR8B 1PZJD 3AE1B 1DZ1A 5IGGA 5K36H 4MHEA 2FUG1 4RF1A 3HOUB 1J7BA 2R7ZB 2VB3X 2F0MA 1Q1EA 1ML0D 2KVMA 3NVZA 3DWMA 1R9TB 1N60A 2OT2A 5I9OA 1WD1A 4HAEA 3NE5B 2K7VA 2KQ4X 4NP5A 1UAPA 5AFWA 3S1RB 4IDIA 2WINB 2F0FA 2LS01 1WWTA 1ENAA 1YNJC 4FF1A 4DNRB 4HN7A 2EYMA 1FXAA 4YTPB 2DWQA 2JZPA 1FM0D 4KGRA 1VR9A 1MHXA 1IKMA 4MM3B 1JWMD 2B2VC 1NR2A 3GS2A 5BMIA 2F0KA 1FCLA 2F3VA 5CBAE 3Q8AA 1S5FD 1TU2B 4F88A 4IQZA 4OIKA 4IUUA 3N9YC 1YNJD 4YTNB 5I2YA 2SEBD 2BA1A 1JORA 1OXXK 1ZE3D 1V1OA 1BF4A 4OW0A 3V05A 1NYQA 4OHJA 2MJDA 4KV6A 1EOTA 2LGIA 1MHHE 1PFMA 3OSOA 4HR7B 2OEOA 3M3YB 4Y7NB 4HROA 2QMTA 4K2LA 2L32A 2R6GA 1U4LA 1E9MA 1FXIA 2B2WC 2F0QA 4DAVA 2YYZA 3NBIA 1LT4D 5HG2A 4RFBA 1V1PA 1Y8PB 5C4XB 1ENCA 2NVYB 4YXDB 1V1PB 1EY0A 3D3RA 2B2UC 1QILA 1SNPA 3GTOB 4K2KA 2F0UA 1BUIC 2V3NA 1ACCA 4YT0B 4OL7A 4K5VA 1IYVA 3W5VB 1PTOD 3VR6A 4FYDA 1RF2D 2PW9A 3TP8A 1HEZE 2LHEA 3L3OC 3U7ZA 1XLQA 1VZ8A 4GDKB 2NTTA 1XTCD 2EXZA 1ET9A 4OO1I 2HTME 2RSOA 1CZGA 3VA5A 4F87A 1B9RA 1AFPA 1I7HA 2HCCA 3T3NA 4TKOB 1N62A 1D5ZC 2PZUA 2CJNA 1DOKA 3K57A 2Y3AA 2WXLA 3G6JB 4XYQA 1XO3A 5EE0A 2HQEA 3T4AC 4QIWB 3SFEB 1WSPA 3M4OB 1TWAB 3OWEB 4HCSA 3GTPB 3GTMB 4PV1C 3I72A 3QOJA 1NVID 2HUGA 2L9HA 4U673 2N55A 5C6AA 3KBXA 2XSCA 2DY8A 2A6HC 2F4IA 2L11A 1FD6A 4ZUJA 5KYIA 2KEDA 3HRDD 1VF7A 3T16A 4X3SA 4EQOA 3PUVA 4XWWA 2E76C 3KF8A 1EY5A 4N9TA 3BVGA 2NN6I 3H8HA 2OXPA 3E56A 1D2BA 5KNCA 3H3VC 1ZDVA 4G7HC 4HCEA 2AQ2B 1KRHA 2VXWA 3PO0A 1KDCA 1F9SA 1ESRA 3P42A 4ABNA 4RHRA 3PO3B 1CHQD 3B2GA 2DYOA 3A55A 1EYCA 1DCZA 2FJ2A 3AEFB 1ZDXA 3PUZA 4N9PA 1RWSA 2WXHA 3IT6B 4CJ0B 4K6LA 2SNMA 2A5HA 1KNEA 5LHY1 1PRTC 4LJZC 4KY5A 2KOLA 1LO5D 4AS1A 5HI1A 3R2IA 4RWSC 2K1BA 1KNAA 5LL6S 3MA2B 1JOKA 3ONAB 1HA5A 4M1UB 3S16B 3TDQA 2K22A 4C2MB 1H9SA 4CJ2C 3E0JA 1WXQA 2IW3A 3T13A 2WXKA 3AN1A 4IUPA 1PRTD 2D2CC 1H9SB 2DN8A 3H09A 2H4OA 3I4MB 3LX0A 1EY8A 2KAJA 5C0XG 4YTMB 5EE1A 3CRLC 3K5OA 1VJKA 2PVGC 3SE0A 1C4AA 2ON8A 2WIIB 1PUTA 4HTHA 2WXQA 3BYYB 3S17B 3U52E 2XRSD 2IT1A 5HGTA 2MEKA 1F2ZA 2F0JA 4C3HG 1JOQA 3L7ZC 2WXNA 4EVOA 1VMPA 2ZT9C 1IKLA 3FILA 5BYQA 4PMBA 1QOBA 1LTSD 4X3UA 1O7YA 3KWVA 2WXIA 1E0BA 4P2CB 5FLXL 3VR9B 5HHDG 3KLSA 2A73B 2WAQB 3EQLC 1YN3A 1RYJA 1HUMA 1V8CA 1TR5A 2WU2B 4C7YA 4YSZB 4DF7A 2K03A 5JPMC 1JWUD 5I6WA 4K8IA 1HTLD 3I70A 1EIHA 4K14A 3RZOB 3OMCA 1FRRA 5C0XJ 2K3UA 4CQNA 3HVDA 5M3MB 1CJEA 3WOEA 3I9V1 3EVQA 3C1FA 3WDNA 3L4PA 2CW0D 3HOYB 3VYRA 3EROA 5JVG3 3U9SA 1UUPA 3AE8B 4N59A 4GZYC 3NVYA 2TSSA 4FXKC 1S5CD 3HG9A 1N5XA 2PQEA 3ZJVA 1MSGA 5C5MA 5FO9B 4FXDA 2B76B 1ET6A 1L0XB 2RSNA 1RTOA 1H9KA 5IODA 1K8MA 1MI2A 1U4PA 3B2FA 2E75C 2HDEA 5I4DA 1AP0A 4BWGB 3T56B 2B2TA 3HVZA 3N6RA 2JA5B 2XRQD 1BUVT 4FP5D 2KCNA 1SJED 5H92C 2OF1A 4KMUC 2WNMA 1CFMA 4TQ0A 4E6IA 2FMMA 1CT1D 3CKIB 3DEPA 4RGTA 1A6XA 3TEZA 1STGA 5EPKA 5JEAG 5E3FA 2X38A 2K5WA 4IFDJ 1GUOA 2O5JC 3GTQB 1F9QA 1WTWA 1N61A 4DFAA 3EA6A 2EYHA 3FC4A 2X6LA 1TWGB 1U4RA 3OHXC 4PMWA 3V2TA 5M5YB 1OXTA 4A3DB 3AE5B 2KEEA 2PO4A 3PV0A 2F0GA 3KLRA 3J7YW 2AUKA 1AWDA 1SBBB 1B9MA 3PIO3 3SHLA 3NXWA 1TWHB 5J1ZA 1TWFB 3NVVA 3PZ8A 4EQNA 4ZRZA 1S5DD 1F2LA 5JEAJ 1Q12A 4S3SA 1GXDC 4RF0A 3PUYA 3DHQA 1IUEA 4XYOA 5BYSA 2BE5C 2MJ8A 4H7BA 1PZID 1YJIA 1A15A 1D5MC 5D7GA 5DNFA 4JWUC 4B0MA 4WORA 1CI3M 1ZUD2 5CYUA 2SAKA 4UAIA 1D4BA 3NRZA 4YIJA 5KYLA 3I90A 2M9VA 2A68C 1XYIA 3DWAA 4TMAB 2BE5D 4DU9A 5BMHA 4DN4M 2E2HB 2WS3B 1DXMA 1C76A 3PO2B 4ZHPA 1UWXA 4NAMA 2WXOA 1EY7A 5HFYA 4ZKCB 4X3TA 4TQ1A 2J52A 1HRJA 1JE4A 1I4RA 1GUSA 4XDXA 1CZPA 4P16A 2Y0SB 4C3HB 3BIID 1B53A 1I6VC 3SK4A 1PGAA 3KQ4A 4XE0A 1PTOH 4WQMA 2A6EC 3GD7A 3OMGA 3ERQA 3NPPA 2ONQA 1GAQB 4A9AA 4B08A 1BQQT 4PNYA 4XQQA 1VF5C 2IX0A 1PDXA 2GB1A 3K6OA 3K0YA 2MHVA 1GUTA 2WXFA 5C4HA 5ELDA 2JQRB 3CIRB 1Q1BA 2QJLA 3AU7A 5COYA 1PGBA 1DOIA 1SNCA 2DY7A 1O7LA 4L63B 3J7AV 4XQNA 1SXTA 2INNE 1JWAD 3KLSX 3AV8A 4IUVA 4REZA 3RFZB 1Y69U 3AEGB 3MHBA 1IHZA 3ZQ4A 2BOSA 2IWHA 5C3JB 2NZ1D 2NTSA 3FPPA