1SE2A

Staphylococcal enterotoxin c2, monoclinic form
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
239
structure length
235
Chain Sequence
b'ESQPDPTPDELHKSSEFTGTMGNMKYLYDDHYVSATKVMSVDKFLAHDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKDNTGGKTCMYGGITKHEGNHFDNGNLQNVLIRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STAPHYLOCOCCAL ENTEROTOXIN C2
publication title Residues defining V beta specificity in staphylococcal enterotoxins.
pubmed doi rcsb
molecule tags Toxin
total genus 63
structure length 235
sequence length 239
ec nomenclature
pdb deposition date 1995-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1se2A01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1se2A02
1S5ED 1G8ZD 1PRTD 3URYA 1JQYD 4RHSA 1LTID 1EU3A 2Z8LA 5D3IB 3R8BA 3TSSA 4ZYSA 1I4RA 1TY0A 4BWGB 1RDPD 1LO5D 5FK9C 1KLUD 1FNWA 1JWSD 1SBBB 1DJRD 1QILA 2RDGA 1AN8A 2TSSA 3GP7A 1YN3A 1PRTC 3R2IA 1I4PA 4Z9CB 1JWMD 4DXGA 1CHPD 1TS2A 1FGBD 3OWEB 1V1OA 1FNUA 4OHJA 1SE3A 1YN4A 2O2LD 1EWCA 1KLGD 1ET9A 1RCVD 4RGTA 1XTCD 3BYYB 1LTAD 5ELCA 1LT3D 2XN9C 1CK1A 4L63B 1B44D 1I4GA 3V05A 1DYQA 1EFID 2XRQD 1BCPF 2J4XA 4RH6A 1I4QA 1D5XC 1S5BD 2SEBD 1EEFD 1JR0D 3R2TA 4K6LA 4RCOA 1FD7D 1CHQD 1TS3A 3DWQA 1PZKD 1TY2A 1LTSD 1V1PB 1BCPD 1EU4A 2RDHA 1TS4A 2AQ3B 4NZLB 1HXYD 2AQ1B 3MFGA 1PTOB 4DXFA 1ET6A 5FKAC 3BVGA 1SXTA 3CHBD 1CT1D 1SJHD 1CQVA 1M4VA 1PTOF 1SE2A 3KLSX 1KTKA 3BYTB 2WV6D 5D3DA 3W2DA 1BCPC 1B1ZA 1LT5D 1F77A 1UNSA 1L0XB 1LT4D 1D5ZC 1SE4A 5ELEA 1SEBD 1PTOD 1S5DD 5TSSA 1PTOH 1ENFA 2R61A 3BVMA 1EEID 3DWAA 1D5MC 1YN5A 2AQ2B 1PYWD 3DWPA 1UUPA 1I4HA 2IJ0A 1JCKB 1PTOC 3O13A 1PRTB 4RFBA 2XNAC 1BXTA 1D6EC 4RGOS 1HQRD 1ESFA 1JWUD 1V1PA 1LTRD 4RGNA 2G9HD 3MC0B 1GOZA 4O1NA 1FNVA 1AW7A 4RGMA 2ICIA 1PZID 1RD9D 1LTGD 1STEA 5ELDA 3BZDB 1XXGA 1T5XD 5I4DA 5ELBA 4UDUC 1L0YB 3EA6A 1S5FD 1HTLD 1I4XA 1LT6D 1PZJD 2NTSA 4C56C 3BVZA 1S5CD 1SJED 2IPKD 2XRSD 3EFXD 1LTBD 2QEJC 4L6TB 3SEBA 1TS5A 2NTTA 1HA5A 2CHBD 1MD2D 2QILA 1RF2D 1PRTF 5ELFA 4RHRA 1BCPB 1LTTD 1LLRD 4TSSA
chains in the Genus database with same CATH superfamily
4ZRJA 2ZXRA 2QDBA 4L5TA 1JQYD 1LTID 2V3PA 4HCEA 3SR6A 2AUKA 4LDTD 1H8CA 4XDDA 2VQFQ 1HZ9A 4DR5L 1RIPA 3FAHA 4A3GB 2F4VL 1UEAB 1QT9A 1CTMA 2KJRA 3NHEB 4Z9CB 5D2MB 2KVRA 4JC0A 1AWDA 4NAWB 1D7QA 1XQQA 2BPSA 1VD2A 3VR9B 2YTYA 3AEEB 1T3QA 1HNWL 4P75A 3V2TA 1GJZA 2B8GA 3M95A 3T1YL 3D3RA 1WR6E 3NXWA 3AU5A 4IDIA 2B29A 4B08A 4GLVB 1YHQA 3WA0A 2L83A 3A56A 3WOEA 1IYUA 1E3PA 2MQJA 3LX0A 2M8SA 3CPFA 2AWOA 1TWAB 1V1QA 4X66Q 4EX5A 2J42A 3A9JB 4PS3A 2IBIB 3AM9A 2M9VA 4GDLA 3GB1A 2IX1A 1C4AA 1TKYA 3T3OA 1IL8A 1ZYRC 1T9HA 4ODGA 5AZHA 3AB9A 2CQOA 2JQOA 1EU4A 5C3EG 4JV5L 3C8YA 3KLWA 4H13C 1A3UA 4KV2A 1FXTB 5JAVA 2BCOA 2LXKA 3CHBD 4OELB 1N6ZA 3AQQA 2R92B 2LVPA 4NP5A 3FILB 1XNRL 2KO3A 4NXNQ 3VHTC 1L6VA 2K9XA 3HM6X 1TR5A 3HKSA 4LF6L 1RWSA 2LY7A 1F77A 4HJ9A 3I4NB 2PEAA 5IYDH 1UNSA 1CFMA 3VVWB 3A4SC 3ML9A 1EYAA 4NPNA 1EFWA 1G51A 2V9HA 2Z59B 4XT3B 4P1BC 4W9EA 2WGSA 2LXCA 1VMCA 3CU7A 3K0XA 1FIQA 1LABA 3AEVA 4GN3B 4JI6L 5BYQA 3DWPA 1VQPA 3KUPA 4I7ZC 3I4MH 5IE8A 3VUYA 5AFWA 1BXTA 1R7SA 2ZVOA 2WB1B 2INNE 3TMPB 4M8AA 4BXXG 2N88A 1C76A 2K8BA 3FDTA 5FJ8G 2M2LA 4NAWA 4LW1A 3WDNA 4HEDA 3NQIA 3UQAA 1TQOA 3SK5A 3HOUH 2ZNVC 4BKSD 3WAOA 1B9NA 2EDGA 1C0AA 3BZDB 2L1BA 1ZUD2 3ZW3A 1T5XD 3Q3FA 4OX9L 3DMUA 1JRUA 1U4AA 4ABNA 3EA6A 4MIUA 1HTLD 1EIHA 4HCPB 3D4RA 2N7JA 2O2VA 3I70A 3BVZA 4XXEA 4BS9A 5FR3A 5C5LA 1QVGA 1R4MB 3M4QA 4R4TA 2D5DA 1U5KA 4YL8A 3A9JA 5EE3A 1X3EA 3KLSA 3DCGA 5HI1A 2IZVB 1J6QA 3DDCB 4HROA 2LD9A 3IFDA 2QILA 4LUOA 2JSOA 3AE4B 5KEEA 2FAZA 2IYDB 2UXBL 2W55A 3LJ3A 3CSFA 2RPVA 2VNUD 2ZCCA 4FXDA 1IGDA 4XYOA 3EBEA 1K73C 1AH9A 2HDEA 5DPTA 3ZGZA 3TP5A 1K8MA 2K3UA 2M19A 1FMAD 2KFKB 4QIWB 3S2HB 3QOJA 4LF7L 2WXJA 5JVG3 2D0OA 2O5IC 5D3IB 4S17A 2JA8G 1LO5D 4LJOB 1QOBA 1JJCB 1J7AA 4PMCA 2A1AA 3AYHB 4MEMA 2D10A 5CV4A 3RZDH 1EY9A 4N8X1 4PQXA 3PO3G 1G6ZA 1GXDC 1TWGH 4UHVA 1NTGA 3E5SA 5DM73 1J7BA 1MI0A 2KMCA 3PLVA 1N32L 2P5ZX 2FE8A 5IOIA 3FKYA 2D9UA 3Q24A 1WZ3A 1O78A 4LFAQ 2CCZA 1RLFA 4FBJB 3V05A 5BN3A 1EYGA 1DYQA 2VL6A 5J22A 2XWBB 1PMRA 1DOXA 1H95A 3HOZG 2LRWA 2KVZA 2UXDQ 3H91A 3S1NB 3PLUA 2RQXA 2VB2X 4ME3A 4XT1B 4F7XA 4A3FG 4BOSC 1FD7D 4EKUA 1CHQD 5C44G 1SROA 4C3IH 2L52A 1C1YB 3SU8X 1STBA 4EQNA 4K5XA 5BYSA 4B3RQ 1SB3C 4M02A 1PYBA 3PO2G 5FKAC 2MJEA 2N4FA 3BVGA 2F0OA 3HVDA 4YCUA 4W9LA 2GVBA 4NXML 2KOLA 5C3EB 2WQYB 2BDOA 3AE1B 2MO1A 1E90A 5BN4A 3DUZA 4IJLA 2WV6D 1UGJA 1MJCA 4Y52H 4HIMA 5HKHA 4B3TQ 1IUEA 1LT5D 3PV0A 4DV2L 2VUMG 3QHTA 1KFYB 3VH3B 4DQOC 1WTRA 4V190 2PPHA 1XMOL 1VQ7A 1MFWA 2WX0A 1SE4A 1STAA 3KYDD 3B2GA 3DEPA 2F0SA 2UUCQ 1WX8A 2MJDA 2AHOB 1V80A 2A4ZA 4JG2A 2KFKA 3HIZA 1YQ3B 4TVAB 4WRDA 1GG3A 1NSNS 5BMHA 3IT6B 2PMZB 2KFJA 2A6HC 4DK5A 1UUPA 3FC4A 1UF0A 3SR1A 3VYUA 3J81L 5FLMG 3ND8A 4XWWA 1NMFA 3I2ZA 1ISNA 4BBSG 3NTKA 1E1OA 2B76B 1STNA 3J80E 2AL6A 3A74A 1TWFH 2NVYH 1PGAA 4MM3B 5LMNQ 1FGUA 1WTVA 2L11A 5ELBA 5I4DA 4B3SQ 2EYLA 1S5FD 2IGHA 2QDFA 2SOBA 1X54A 4C56C 2OEDA 4HN7A 4WWMA 1CKNB 1AFPA 2KJ6A 4GKKQ 1M1KC 3OJ4B 2E74C 1GC6A 4CQNA 4N9F4 1JRPA 2K1BA 1RL2A 2KX3A 3FKIH 4DV0Q 4GNXC 2BYEA 1SAPA 3WWVA 4C3JH 1TWCH 5IT9L 4WAFA 1C7YA 4GIVA 1K0SA 1HZAA 1MSHA 3FPUB 1YI2A 1C77A 3VRBB 2VRRB 1HJPA 3CW2C 4A3DH 2D5GA 3J81j 4LF4Q 1F9PA 3U30A 3JSVB 4TQ1A 2VH1A 1CKOA 1S5ED 3RN5A 3M4OH 2LFNA 4RHSA 1E8XA 2ZTDA 1FRRA 5IWAQ 2B8FA 4KKJA 2K8HA 1R9TH 3P4QB 2LHDA 3E0JA 2E2HB 3GP7A 1AN8A 3GE3C 3EN2A 4LUZA 4W9KA 5EE0A 1HEZE 2JA8B 1L7YA 4FN2A 4DV6L 4UY8C 1A3TA 1N61A 2K4KA 5FO9B 4CDEC 2IO2B 4KY7A 3BDLA 1K3BC 1PFBA 3NSWA 4DNTB 1F2RI 1YN4A 2BWES 3UI2A 3PO3B 2EXZA 4HEA1 4JGHB 4IJHA 1F9SA 4H02A 1LT3D 1WGKA 4C3HG 5MPOA 4AYBG 4PYZA 1KABA 2DY7A 5EBCA 3DHHC 3C1FA 1I4QA 2I5LX 4HJKA 1EEFD 1JR0D 1OGWA 1H9JA 3GZNB 2B2VC 3CRKC 1YQ4B 3E6ZX 2NMQA 1O7ZA 4I6NB 4AIMA 3STBC 2QCPX 3K7AH 3DWQA 1EY6A 1BUVT 3HOZB 3ZRCA 3APFA 3RNAC 2L8JA 1DOMA 4A3FB 4ZOHC 2MPMA 1SNDA 2NPTB 2AKWB 2DUDA 5C44B 4RKLA 2DGYA 1KF6B 4R8NA 2K8CA 4RNAA 4DK0A 1SJHD 4NW2A 3KBXA 1ILPA 3TN2A 1KRSA 3PO2B 1IYFA 3PIPA 2Y5BB 3ETRA 3NTIA 1FVIA 3GTLH 3M3YB 4CGYB 3K5MA 1WI0A 2MFIA 4KK7A 2YEPB 1X65A 2YTXA 4A3JG 1MKHA 4OO1I 2Y5PA 3KWLA 4KZCA 2VUMB 4IO9A 3CF5A 1J8IA 3J7YW 1Y8RC 3DVNU 4A3PA 1PTOH 3JSVA 3D4DA 4DR4L 2K0PA 1W6KA 2RDFA 5HY6A 4XDXA 2IJ0A 3CC7A 4A3MH 3O13A 2A68D 2C5CA 1Q86C 3MHSD 4JI7L 4EUTA 1EOVA 1P98A 1JWUD 1HCZA 2INPE 3BY4B 2EVBA 2UUAL 3TZUA 1OQYA 4M01A 2PCFB 2Z4HA 2KA7A 2RSUA 4QGUA 2NVXH 3ZO5B 4EQPA 1E2ZA 1PZID 5IT9c 2LGDA 5L95C 2LHEA 3MXNB 1TWHH 1Z47A 1RAXA 4IZ8A 3A7LA 1YX6B 3JAML 4GKJQ 4BBSB 3P1HA 2MBOA 4GXBA 2ICEC 1A0IA 2LJ5A 4P72A 1A62A 1VQIA 4A3BH 1HE8A 5D94A 1HUNA 4IW0A 1HNXL 1S5CD 1STHA 2MP1A 3GTQH 4K5VA 3N3KB 5JEAG 3X0WA 2LGIA 1VF7A 3CXCA 3UGBB 2AX5A 1SYDA 3NG0A 4QL5A 3WIMA 3SK4A 4MN3A 1BQQT 2R7ZG 4KDIC 3RD2A 4CO7A 2KYWA 1NVID 3SEBA 1OXSC 1TS5A 4WJ3M 2I38A 3UIPB 2ASBA 2IY5B 5ELFA 5IGFA 4A3LG 1LFDA 3ZNHB 4DV5L 1OEYA 2EY2A 1XLOA 5H92C 1BCPB 1Q8IA 1VQJA 2NPTA 3K9PB 3X3NA 1TT5B 2DNFA 1P16A 4EEWA 4ITKA 2KN5A 5C23A 4K2KA 1E10A 2Q8RE 2F0WA 4FLHA 2EPBA 3R7QA 1RDPD 2AMCB 1YJWA 3UE0A 5FK9C 1K8RB 2HTME 2O6VA 2XTIA 2VQEQ 2IW3A 2ZJQA 1T0RC 3ZXRA 3GTGH 2K5WA 4DR7Q 2UYZB 4XQNA 1D1IA 2SDFA 1HHVA 3NP8A 4LF5L 2FJ2A 3RMHA 1ROEA 4GLSC 1Y8PB 2PNHA 1MHXA 4L8JA 1VCIA 5E4XA 2NBFA 3IAS1 2W9NA 3ULPA 1Q1OA 1KLVA 4APVA 4LF9Q 1CK1A 3U50C 3F2BA 2KEEA 3K5OA 1CM9A 4JI4Q 1NEKB 4QY7A 1L1OA 2WX1A 2CWAA 2C7NB 3EQLC 1KRHA 1D5XC 1LM0A 2DENB 2JJQA 1A8VA 4AYBB 3CSTA 2HJ8A 3MXNA 5IYBG 3Q8DA 2LEKA 4ACFA 3GTKB 5C2TB 4US9A 3DBSA 3A8JE 5EKIA 4ZHPA 3F2DA 2J52A 3D32A 4HLEA 2JE6I 1UD7A 2BGFA 3K59A 4JIOU 2AQ1B 2IT1A 4IPDA 4YWKA 4B3ML 3ND9A 5H8YE 4AJYB 4C7YA 3CKIB 3KF6B 3KLSX 2L5TA 4KN4C 1IBKQ 1M4VA 3C46A 1UEBA 2VY3A 1EF1A 4N6EB 1L0WA 1Z2MA 4U68A 1YIWA 1MJEA 1VQBA 2Q8TA 2BOSA 3ZJYC 2UU9Q 2WDVB 1B7YB 2F0KA 4C1NI 1X56A 1DD2A 1PTOD 4L23A 1P9DU 4JOIA 5JJIA 3RFZB 2B2TC 4JI3L 3RNUA 2HJ1A 3MA2B 3APCA 3JAMc 4K81A 5LLIA 5DPRA 1WXSA 5GAEC 2WNMA 2Z4IA 4A3JB 4DK1A 1VQ6A 1GNUA 2QMTA 4II2B 1Q46A 4QAYA 1D6EC 2M0AA 3APDA 2KWUB 2A6ED 2F0NA 1Y1WG 3CMAA 1J5EL 5NUCA 1UH6A 2PI2E 1I50B 3KLRA 3DVNV 3PUXA 1ILQA 3M9BA 2UXCQ 2F3WA 3I8ZA 3QQ8B 1GUTA 2BH8A 1C3TA 3S16B 3ECIA 3MC8A 3DM1A 2OCEA 2FHTA 5A35A 1N36Q 1PA6A 3ZNZB 5CV6A 3H3VH 4A3IG 5M3MG 1SLJA 4HSPA 3NE5B 1XO3A 1ZGUB 1SMYD 2N55A 1RFAA 5I9OA 2CFMA 1BBXC 3AEGB 2NZ1D 1WD0A 1GC7A 4WURA 1SNMA 2NWGA 2MBBB 1YBYA 3HOWH 1PH6A 1Q81C 1MI2A 1IBLQ 1ICFB 2EJFC 2RBMA 2UWQA 3N30A 2KBNA 2C35B 2R7ZB 3U7DA 2WXPA 1KDBA 1SIJA 1NNXA 4K2LA 3V60A 2DZIA 3D6WA 2J0JA 1LLRD 1Q10A 2KAJA 1T0YA 1I3QH 1EY0A 1XMQQ 3AE3B 4K8IA 4JI8L 2MP2B 1XX8A 1A6XA 2Z6KC 3RLOA 4DR1Q 2DYOA 5LXIB 3KDFB 1QUQA 1TY0A 2D07B 2W3RA 3RZWC 3KF8B 4C2MH 2KWVB 1VS0A 4DAYB 2G5DA 1KLUD 2LS01 5KIXA 3H09A 3S1MB 1LXDA 2KKCA 3R2IA 1WJUA 1XD3B 1TS2A 1C4QA 1Y8NB 2WP8J 2ES2A 4LFCL 3UDIA 2QIEB 3T56B 4JI2Q 1OQRA 3GTMH 2KDIA 1Q5WB 3DEOA 2KDEB 1PH5A 2XN9C 1TVXA 3NWTA 1S3SG 2K5PA 2ZEQA 2ZNVB 4FHKA 3AB5A 1I4GA 4DR2Q 4GB9A 2K25A 4A3GH 1GHKA 1GVPA 1K9MC 4RCNA 5JHBA 1SNOA 4XQQA 2XEWA 2RGFA 3QX1A 4JBKA 3LYYA 1D4BA 3DBLB 4S3SA 3FPPA 3S24A 4K5WA 2KTFA 2CVRA 5IKCM 1A5RA 4H44C 1ZXTA 2CHZA 1R4NB 4HR7B 1EQQA 3C3LA 1EWYC 1G6PA 4MACA 4OW0A 1PH7A 2JRHA 2K75A 4R1JA 5GAHC 1V6EA 1IPGA 2KDMA 4OO1H 3H6NA 4JI1Q 2VB3X 3PRZA 3OTOL 4YTMB 1AE2A 3AMZA 4E6IA 4BA2I 5C0XG 4W9CA 2BVCA 1CMXB 1YQBA 3OG5A 4W9GA 1CQVA 1SE2A 4KHVA 1WJJA 2DAFA 5D3DA 2NN6H 1FJGL 1MG4A 4JPSA 3B9JA 1O80A 1HNZQ 1GB4A 1SEBD 2ZM6L 1VQGA 4OL7A 1SYFA 4TKOB 2JA7H 3CCMA 1JWAD 4I65A 4KD4A 2XVSA 3MEHA 1N8RC 1QZEA 2MP2A 3NUHB 1EEID 5FLXE 1GUAB 1U0LA 2IX0A 4FJVB 2KXJA 1I4HA 2R92H 4BOZB 3HOXH 1WFYA 3GZNI 3KDFA 5J18A 3N1XC 1Q7YC 4IOIE 4DAYA 5K5PA 1PLFA 3I4NH 4HAEA 4HWIB 4KD3A 3D31A 3A5ZB 2KK8A 1OXVA 1FYCA 1GUNA 4X3UA 2LVOA 2A68C 3GE8C 1XPRA 1Y1WB 1EM7A 3KJPA 1V9JA 1VQCA 2F0UA 1K50A 2EE1A 1PDQA 1RODA 2IL8A 1D8LA 1NDDA 3RI7C 1SFOB 3L0OA 5CV7A 1YZ6A 3Q6SA 2QA4A 4BY1H 1K8OA 2IY1B 3L0WB 3AFQA 4JI5L 1MG8A 2AWNA 1V2YA 2F0TA 1N33Q 2BTEA 1E2WA 2YEPF 2KHSA 1JC7A 4HPMB 3K57A 1XJVA 3KBGA 3RT3B 2CH4W 4M1UB 1I94Q 4WH4A 1JICA 1L4ZB 3N1ZC 1A3VA 4A3IB 5M3MB 2J7QB 5JPNC 4ZKBB 5JJZA 4K7UA 1RF2D 3QR8A 3ZDTA 4C7ZA 4IFDG 3GTPH 4PMWA 1WXVA 1HZCA 3HOVG 1HZ6A 5E3FA 1Z6HA 3KYCD 2N1VA 4MHEA 4B0MA 3ML8A 1SNQA 2NBWB 4GDLB 4WJ4A 2IHFA 4LAAA 5D65A 5AJ3Q 1PRTD 3Q6BA 5DPSA 2YYZA 4EZKA 1I4RA 2G45B 3WAPA 3F1ZA 1SBBB 4JW0A 2FCQA 1QWYA 3OWFA 2V3NA 1IYJB 5LL6S 3BDCA 2FMCA 3Q8EA 1IKMA 5JXVA 1SE3A 3L54A 2KMMA 3S2HH 5IYCH 3RNFC 2F0LA 4FF3A 2JXXA 2OOBB 2ZJPA 3SHLA 1WTOA 3PHXB 3TP6A 4FXGC 5KGUA 1ZDXA 1KOTA 4FNFA 4WQMA 2LSSA 1DCZA 5ELNA 1V49A 2A74C 1PFMA 4R3DA 3BU2A 2K1FA 4HKZE 3RZFA 2XGTA 1V8QA 5EKKA 2F1MA 4HIKA 4JYAL 4HK2A 1EFID 4FADA 1BCPF 3DHQA 3QOLA 1VQ5A 5KHQA 5I6YA 4JI0L 1VQHA 3KQ4A 2MBHA 4K6DA 1L0VB 3HGBA 2VXWA 2HCIA 4IUTA 1C48A 1EY7A 3K7UC 1U4RA 2N1WA 4TQ0A 1ACCA 1H9KA 3D0FA 2DZKA 2HD3A 4TRDA 4A76A 4DXFA 3GTJB 2E2JB 1JORA 1I7HA 1VR9A 3I5JC 4GNXB 3IG3A 1JMCA 4E3CA 2CJOA 1I6HB 1E0ZA 2I46A 2L0CA 2PQEA 4W9HA 3U7ZA 3W2DA 2JP1A 5CBEE 4X3SA 3PIOA 4LNQA 2B63G 1PH2A 4G3XB 4C4VB 2JA6G 1SSOA 3S1NH 3GV6A 5IO9A 1IZ6A 4G0NB 1XNQL 2KOXA 1L0XB 2O2VB 3TQYA 4JPBW 4CKCA 4DA2A 1E8ZA 3AFPA 4FJYA 3ZQ4A 4ANWA 4KKTA 3AI5A 1VJKA 5C3JB 2KC2A 1GHJA 3CCUA 1ICWA 2R61A 1CSQA 5C3EH 3TMEA 1VCBA 1QNUA 2JVCA 1JCKB 4P7IA 1PTOC 1B3QA 2E2DC 4RFBA 1A2UA 2XNAC 2MH7A 1X3FA 4LDTB 3ZTCA 1XWEA 3QC8B 4MNOA 1V1PA 4QQBX 1EZ8A 1E7VA 2G9HD 3PO0A 1HQMC 4YCVA 2K5HA 1SDFA 5G2NA 4X62Q 1QKZA 3A8IE 2JPHA 2V1YA 5LNK1 3J7AV 3F2UA 1PGBA 4EZLA 1VQ9A 2K7VA 4LF8Q 4IUUA 1VMPA 4J6HA 4DV1Q 2KCCA 3HG9A 1WGHA 4ZYNA 3TCAA 4DNIA 4U673 3OHXC 1JT8A 3PIP3 1NENB 2L12A 4RAUC 4L1BA 2QJLA 1ASYA 2BQQA 5K36G 5A2QL 1QOFA 4YCWA 4JK1C 3PF5A 1BNZA 1MVKA 3AEAB 2NTTA 5J3BA 4DR5Q 4BXXH 4G57A 1HA5A 1VF5C 2NUCA 2UUBL 2A73B 3J7A5 3BIID 3PREA 4J1MA 1DM0B 3T53B 1FPYA 1VLBA 5L37A 2WXNA 3S9WA 3ONSA 5CHFA 1SMYC 3P42A 5JJLA 4X65L 1LTTD 1HTOA 2G9DA 1WXMA 3AE9B 2JA9A 4G7OC 4GNXA 2WWZA 3QA8A 1EUJA 3I73A 3RLFA 4IURA 3WAMA 3ONAB 1HR0L 3X3MA 3P20A 1HNWQ 1UE7A 3MVVA 3PSIA 3HOVB 3W5VB 3T1YQ 2XWJB 1BDOA 1WX9A 3CCLA 4C4VA 2RCNA 2ZTEA 2EIFA 1YHAA 4KX6B 1Q12A 1E8WA 4CJ2C 1Q0WB 3P63A 1PXUA 1JWSD 1X6OA 1S1QB 3PSEB 4PNYA 3U9SA 2AYOB 1YN3A 4EQ5A 3I4MG 2KNBA 2QSDA 4GSWA 4HXDA 1TBEA 1VQ8A 2Q5WD 4YY3L 3EFUA 4MGYE 4ZRIA 1DGJA 5ISRA 1UBQA 3S1QB 3J80i 1FRDA 2ID0A 1PVOA 2KWCA 1K83H 3PRPB 5CTRC 4A3OA 1WFQA 2CKZB 4JV5Q 4PMBA 4ZK9B 4CHKA 1E9MA 4CKEA 2E5LQ 5C5MA 3HOUG 4AQ7A 1VQMA 4LJZC 4GMVA 1ZKHA 3PUYA 2FUG1 3R7RA 2I5MX 2MEKA 3EECA 2XRQD 4B95A 1XNRQ 1C4PA 1BR9A 3EVQA 2FIDA 4DGZA 3T13A 4LF6Q 1BO0A 3R2TA 3HVZA 3QARA 3CF6E 2FXQA 2N3SA 1XF5L 3AV8A 3A1QA 4DK3C 1PUTA 5DPWA 1IW7D 5GQOA 4CJ1B 2JXTA 3CMMB 5M5XB 3TS0A 3OAWA 4EFOA 3ICEA 3LWUA 2B2VA 3DBHB 2QEXA 1ET6A 2MBQA 2K5VA 2N49A 3OW2A 3HOYG 3ZNID 2O4XA 1WYWB 3TBLD 1V5TA 4OGQC 2JA5H 3SK8A 4PYUA 5IN7A 2X8XX 3PPAA 4YTPB 3A9KB 1SSNA 3CCVA 2EKEC 2B63B 3HOZH 5EAYA 1HTQA 1TKWB 2E75C 3ITPA 2JA6B 2DZMA 5EDSA 1WCMG 4A3FH 1FEHA 1G2TA 1MBYA 5C44H 3DWAA 5IGEA 2R7DA 2L00B 2AQ2B 3I7FA 1EQRA 2CHXA 2PW5A 5IA7A 1B9RA 3RNEC 1GKHA 2RSOA 3VYRA 3HM3A 3E0EA 2OJRA 3WCQA 2WKCA 4K7SA 2L55A 2OQKA 2FCNA 2VUMH 1M90C 2R93G 2PVGC 5AZFA 2AUJD 3SE0A 2JT4B 1SF0A 2BS3B 1QF6A 1YJ1A 4MH8A 1F2YA 2UXBQ 1DOKA 5G3LD 1B70B 4A90A 3KFUA 2ZW0A 1II3A 4DHZE 3VYTA 4BKGA 2FCSA 3RD4A 1L5PA 3AU7A 5GAGC 4LF7Q 2XRSD 1KNAA 5C4JB 2KD0A 2F0FA 3OOCA 2KZRA 3H3VC 2BYTA 3D8GA 1KHIA 4KKUA 4AS1A 5FLMH 4IPGA 2HQEA 1XPOA 3Q3OC 3VR4A 1B50A 3A54A 4BKSA 4HMJA 3Q8FA 1EUVB 4BBSH 2ZCBA 1K52A 3AN1A 2K32A 5HGQA 5JOBA 4NB3A 5IWAL 1Y56A 1LV9A 3RR5A 5J17A 1DZ1A 1E24A 1FO4A 4X6AH 3MJWA 4HMIA 2E2IB 5GXGB 4OWTB 1S40A 1JWBD 5JH5C 1F9JA 2PNRC 1N32Q 1VQAA 2A69D 1EU3A 3PZDA 1SNPA 4IWPA 4B0EA 2EYOA 4ZLTF 1KD1C 2HIXA 1HFNA 2K5QA 1F2RC 2KACA 3A9KA 4LK0M 3Q23A 1GAQB 5CGKA 2K22A 1JB3A 2F0PA 3PT2B 2WXGA 1PRTC 1GUWA 1GO3E 3MTSA 2XIWA 4GN1A 4KLKA 1Y1VG 3BS1A 2QC8A 3TEZA 4TKNA 2CWPA 4RMFA 2OWOA 3I4MB 3ENEA 4HDOA 4HJGE 1EWCA 1KLGD 4MGKE 2L4NA 1EO6A 4GS3A 3OIQA 3H3VI 2PE6B 2NBUA 2LJIA 4PV1C 2YTVA 3C2PA 4NXMQ 1HR0W 4JE3B 2QGQA 4CDDC 3HOUB 2JX5A 3DM3A 5EQ0A 4DV2Q 4K6LA 4I6LB 3ZUNA 4NKLA 2GMIC 4XDCA 4DUYL 3AU4A 2D0PA 1VQNA 2OJWA 2H5XA 2H89B 1CZGA 2V3SA 4UP9A 1P7FA 1TS4A 4E74A 5HGTA 1QOHA 4I7AA 3FKIG 1IXRA 1J19A 2WXFA 3K58A 4D2KA 4AWJA 4ZRKA 2D2CC 1MSGA 4MTNA 1N62A 1CT1D 2IHEA 2PQAB 1KRTA 3VA7A 2ON8A 3PS6A 1Q3LA 5IP7G 1T6BX 4K1RB 5J2RA 1A2TA 3SK6A 1TIFA 3VAWA 4C3HH 4CDFC 2JXMB 3NQTA 5IGCA 3ZVVA 2JK8A 1IBML 5HHDG 1X3GA 3HOYB 1H9SB 4G7HC 4N59A 1TKEA 5I6WA 3HKZE 2CQAA 1WY8A 4E71A 1ESRA 2HTHA 1NUCA 2WAQE 3CCRA 3L4PA 4F87A 5KNBA 2BF8B 5I2YA 4DN4M 4WIPA 3QWNA 1P7EA 1WCMB 2K50A 5CV8A 1L6UA 2B2TA 2F0JA 3S1RH 3CCQA 1NJIC 2AL3A 3DBRB 4TQUS 1R4QB 2A19A 3Q2AC 2GRIA 4JQWC 4GKJL 3U2SC 1F52A 3EJIA 5FOBB 3TREA 1IP9A 3UINB 1FNVA 3J81c 1MPEA 5LMUL 1AW7A 3L3OC 2PPBC 3V62A 3Q3MC 3CQZB 4GOPC 4KN7C 2O6VB 1EIFA 4A3JH 3HK0A 2L3ZA 3T9LA 1A15A 2R93B 1LQBA 4DKAC 3MXPA 4M8MA 3WALA 3U58A 4L5QA 4R4OA 3VDYA 2WINB 2AWTA 4NMZA 3N1YC 1NR4A 1VQFA 2KENA 3TEYA 1QOGA 2NN6I 1UAPA 3JC66 1I50H 4OONA 1NMGA 4DV3L 2DN8A 3I3CA 4A55A 5KRUA 1V9PA 2MHJA 2MRPA 4K0KQ 2D3BA 3NRZA 1S3OA 5CR3A 4Q2JA 1YVCA 2KN4A 2REXA 3NEMA 1L1OB 2MW5A 2QF7A 1TJEA 4DV6Q 3H7SA 3L10B 1BMLC 3NBHB 4IN3A 1PFNA 3RLNA 1SGHA 5J39A 3B1LX 5E6OA 2PQAA 1KIXA 1B4OA 2JZPA 4P74A 3M62B 4X64L 1YJNA 2FUHB 1N63A 2NB0A 2PE9A 4HDQA 3MJ5A 5FO7B 4HJAA 3G6JB 1IYVA 1H9SA 5JEAH 1AP0A 5CHWA 4ICUA 1DJRD 2PW7A 1K8GA 1JE4A 2R7ZH 4A3MG 2DAJA 2Z6KA 4IPHA 4BBRG 2HHHQ 1YNJD 5M3FG 2HE7A 1LUZA 4BBNC 2RR9A 2ZTCA 3BK1A 3OMCA 1TIID 1WZ0A 4O2DA 3EFCA 4RGTA 4HTHA 1XTCD 4ZHOA 3V6EB 3L17A 1Y1VB 3HZXA 2LGSA 1C78A 4DXAB 2B2YA 2DBYA 1SYBA 2VZAA 5IY0A 2Y0SE 1DGSA 2PLPA 5EGTA 2WIIB 1EIYB 4MGIE 1ZXIA 2MHVA 1A70A 2EMSA 2KT7A 2BKRB 2QHOA 4Y7NB 4DV7L 1NBWA 1JMLA 4RCOA 2NVYB 1ZOYB 3SDZA 4CDCC 2CU1A 3MZ5A 3NHHA 3BINA 4XX5A 4DR6L 1PZKD 1Z9FA 4P16A 1NYRA 2PO4A 4A3KG 2KHJA 2GOWA 1YX5B 4BVUC 1YNTE 4ARIA 2RHQB 4IUMB 4C80A 1MHWC 4A8XC 2R7FA 2JYTA 4DR4Q 2UU9L 3E9SA 3HRZC 2FNJB 1CUKA 3H1UA 3IAYA 1E7ZA 3J81E 1R4MI 4GGQA 4YWGG 2D62A 1IW7C 1TU2B 3FKIB 1GUOA 1WI5A 4DAMA 4W9IA 4XE0A 3K6OA 3ABVB 3BWUD 2UUAQ 1E7PB 3B08A 3H9DA 3LGJA 2F0GA 3CCJA 2SNMA 2B2UC 3NBHA 5IYBH 1EL0A 1V81A 4AP4C 3E56A 4K3CA 2DNCA 3QJYA 3KUDB 4DUZL 3I55A 1J9OA 1ENAA 3ERQA 2PMVA 4PG3A 5JJKA 1TXYA 2F0DA 1GUSA 1SIFA 4IQZA 3AXCA 3DLLA 5DEHA 2L7RA 1R9TB 1WXAA 4RGOS 1WR1A 1HNXQ 3VDZA 3IFWB 3HS0C 2NVUI 2FIFA 4O1NA 4A3CH 3VR8B 4QB4A 1F9RA 5IT9E 1N36L 1Y8OB 2ICIA 1FFUA 1RD9D 4Q0FA 1XT9B 2I1KA 1QUQB 1V5OA 2DYMA 1HPCA 5ELDA 2EYFA 3AE7B 3FRPB 4DV4L 3BG3A 2ZJRA 1WMHB 2ONQA 4BKTA 2ZPYA 3DWGC 4J6IA 4XQJA 4KJNA 1E7UA 1WGRA 4YHHL 5E6PA 2K03A 2ZZPB 2GLSA 1GB1A 3AE8B 4L2YA 4LMQD 4P71A 2ASQA 2B39A 4IPCA 3NS8A 4ULLA 3QG1A 3BJUA 4C1NK 4P6VF 4JL9A 3ZLZA 1LTBD 2J7ZA 1EQTA 1ONLA 5LL6X 1Y1WH 3R3OA 1ASZA 3K7AB 2YV5A 4QUFA 2BS2B 3V6CB 3GS2A 4MDKE 3TBIB 3RPFC 1SNCA 2ZPNA 2G4DB 4AH6A 5CV9A 1SFOH 3AE2B 1AEXA 4IG7B 4GZYC 4KGRA 2BB5A 4LF5Q 1KAAA 1ZE3D 4A93H 3ER0A 1AZQA 2ZW1A 1NI2A 3CRLC 1G8ZD 4JVZA 4MELA 1SYCA 2Z8LA 4NNJB 3W1YA 5F2DA 4FP5D 4TMAB 3W1SA 3ZDMC 4A3IH 4JI2L 4FF2A 5M3MH 1UGMA 5C6AA 1FNWA 2NVQB 1Q1EA 1B2TA 2F0MA 2N9EB 1L2NA 2TSSA 3RNGC 3KK7A 3G48A 2M17A 2A69C 1JWMD 5FR6A 3P4RB 4LNKA 2BS4B 1PFDA 4ZCKA 5LXHA 3UDXA 3NVWA 1QVFA 1FNUA 4OHJA 2M4NA 4YIJA 4A3MB 4NJ7A 1JOKA 4ID6A 4XYQA 1V97A 4BBRB 3ZJUA 4BAXA 3A5UA 2L76A 5M3FB 3HUIA 5M5WB 1JJ2A 4XWTA 1WM3A 3CWIA 1FR3A 4B3MQ 4YWLA 3OYYA 1RYJA 1W6JA 2PYKA 3H0GG 1WD1A 2PW9A 2EZVA 2GA4B 2LXAA 3VR6A 2NVXB 2JN4A 4TV3A 1CI3M 3K0YA 2M1MA 1G6JA 4OWWB 4ZAIA 1LGRA 5C1ZA 4OEMB 1WMHA 4WJOA 4KV6A 3CIRB 1EYDA 3I72A 4JI3Q 1SYEA 4HKQA 3CP0A 3MFGA 3GTQB 2K5DA 2BE5D 2EOTA 4A3EH 1QLBB 2BT6A 1X3QA 2B2YC 3IVFA 2QKIC 1SXTA 4A3KB 1UWXA 5C4XH 3PCOB 2F0EA 3D4WA 2MLBA 3I90A 4EOYA 1HUMA 2FMMA 1VQEA 4WWNA 1O7IA 4PZ7A 2DWQA 4FHJA 5IGDA 2RPQA 5C4HA 1ZW7A 1WE6A 3MXUA 2EY6A 1R4PB 1OQQA 3K9OB 1J5EQ 4AQYQ 1V86A 5BR8L 4ZQ3A 4KTAA 3JAME 1BUIC 4LTUA 2IWHA 3GTJH 2E2JH 2C5LC 2WXIA 1P1AA 1H9RA 1Z7TA 1CA5A 1CZPA 1B53A 1YNXA 2DY8A 4XTCS 1I6HH 3I91A 1WGYA 5CORA 2LUMA 5JHAA 4JBJA 3SVMA 5FO8B 1ZP0B 5C0XH 4YXDB 4RGNA 1SYGA 3HEJA 3T1HL 2ENBA 1B9MA 1VZ7A 2F0IA 2INDC 1CJEA 3U4VA 1YOVB 3SD5A 4WQOB 5DLQE 2EQSA 4QCLA 3UIOB 4RGMA 3VTWA 4ZUIA 1TWAH 2HD5B 3U4EG 2L15A 1STEA 3GD7A 2LVQA 5HURA 3PUWA 2X6GA 2D11A 3I9V1 1YHBA 1WE7A 1L0YB 3S15B 1NBFC 2RMMA 5E6NA 1LACA 1O7YA 5EE9A 2A8VA 3N52A 1Z5SB 2GBJA 5G55A 1TKGA 2K33A 4JI8Q 2J0KA 2IPKD 4KHPL 3JVZX 2NZOA 1N34Q 3T4AC 4HCNB 5IP9H 3W1BA 1Q82C 2PI2A 4GOCA 5DNFA 1B8AA 2F0QA 4GN4B 1C79A 1XCQL 2WXMA 3P75A 4ALPA 1IBXB 1BBUA 1MD2D 3H6MA 2K39A 4KSLC 3PMFA 5BO4B 1TGZB 3VFKA 4RHRA 2RCFA 3S17B 1RM6C 3IFTA 5CC4A 4LFCQ 4PS7A 2CKHB 2EY1A 3BZCA 3UQBA 4K8JA 5KNDA 2Z6BA 2YVCA 2HT1A 3URYA 2JA7G 5D14A 1F9QA 2BBCA 2B3GA 1QZGA 1YD8U 1SN8A 4IOAA 1YIJA 3AEBB 1F2LA 4H7BA 5KYIA 4IC7B 3IKJA 1JE5A 2GBRA 4Q5VA 2Q2UA 3HOXG 4B6WA 3S2DB 3T51B 4HJ7A 3DWMA 3NVYA 3EC8A 1E0BA 4I6PA 1F2ZA 2Z0SA 1EOTA 2NYZD 3CD6A 3UI3A 2VZKB 2MJ8A 3PVLA 5AZGA 3HOVH 1RTOA 5C4ZA 3BYYB 2E8GA 4YSXB 2ZVNA 3A7AB 3RN9C 3OTOQ 1PYSB 1YNJC 1NYQA 4NJ6A 3W1SC 2VQFL 4J8QA 2JWUA 2VW9A 5JEAJ 4F1SA 4FF1A 4JBWA 3KWVA 4EQOA 3Q8CA 1X3PA 3P4PB 4BY1G 2NVTB 1CZWA 2LGYA 3GOEA 3QIJA 3OJ3A 4PK1A 3M85A 3GV3A 3TIXA 3H0GB 3S1QH 4ZDVA 1TS3A 2WXKA 3A55A 3TP7A 3IBEA 2E76C 1V1PB 3HP3A 3PZ8A 3U9OA 2AQ3B 3J7ZC 1QZHA 1BF4A 1XCTL 3I56A 2H88B 2JSVX 4DR3Q 3FHWA 4USAA 4BFRA 1QNKA 5M9OA 4HIOA 1C9OA 2BA0A 4POFA 2YU9B 2WLBA 4LNNA 4FVMA 4DHJB 2W82A 2E6XA 3PUVA 2RF4A 4REZA 2LXJA 4IM3A 4X66L 2KWDA 3ALBA 1NE3A 2QDLA 1IGCA 2R2QA 2UU7A 4W9JA 1IBXA 1WTXA 1Q8KA 1LT4D 1D3ZA 2K5NA 4OVVA 2G4SA 3SDLC 2L9HA 1WIAA 1I3QB 5M5XH 1YMHE 2TMPA 2DZJA 2N0SB 1C8CA 5BMIA 4RF1A 2KC1A 5D6JB 4QUCA 4BY7G 4NXNL 1PRTB 3NPPA 4JWUC 1JJGA 3M7GA 4IM2A 5GROA 4JI5Q 2JYOA 4LFBQ 2KQ7A 4LF8L 2B2WC 4RWSC 1LTRD 4A75A 3W5OA 1WXQA 3TDQA 2I1JA 3KUCB 3R3MA 1GOZA 2B63H 4QJFA 2C60A 2JA6H 2RVLA 1FM0D 3DXJC 4ASWC 1FL0A 2KECA 2EMTA 4KIKA 4KGSA 3GTMB 4IALA 4N58A 4RA8A 2N7DA 2D2QA 1V8CA 4ZRZA 2WKDA 2LZ6A 4GLXA 2M56B 2NTSA 4K14A 4JWSC 1D1KA 2KCNA 1KC8C 1F0ZA 4KHZA 3C0RB 3ZRFA 1OXUA 1X32A 2EYHA 4AUQC 3I57A 4G4KA 2XK5A 2IO3B 2Q2IA 1Y14B 2NCNA 3RUIB 3U4ZA 3MTNB 1P8LA 2J0MA 4DBGA 2QW7A 2CHBD 4UP8A 1VDVA 4EVOA 3MC9A 2LI5A 4HPLB 4NDXA 3VXWA 4DK6C 3J80L 2ZT9C 4HJ8A 4OZBA 3NWSA 2Z0EB 1AYFA 4HIDA 1G2SA 3STBD 4TSSA 4G7ZC 2K01A 2N9KA 3I3TB 2A6EC 2MQHA 2A5UA 2JRIB 4FO2A 4JX1C 4OZAA 5C4JH 3A1QB 4RMAA 5BMGA 2LMCB 1N5WA 2KLGA 2WB1E 4KSKC 1WRDB 4J15A 1MIUA 5JVH3 2V4LA 1I42A 5KHOA 3T3NA 2OTJA 2PJHA 3KOJA 3ULLA 2RDGA 4JYAQ 2JA7B 1WJ4A 5K36H 2C9WB 4ILWA 3A8KE 3GTOB 2M0XA 3Q0AA 3DOWA 1I4PA 2WDRB 3JYUA 2K6AA 2E5LL 1UWVA 1STGA 3OWEB 4JI0Q 2R6GA 3M4PA 4EGVA 3NBIA 4O0AA 5DM63 1A63A 4M0WA 2EY5A 4YWMA 2E2IH 5BYRA 2F4VQ 2N8NA 3HOXB 5I2XA 2FCMA 5FJ8H 3MFYA 1Q1BA 3S14B 2DHZA 4P73A 4RF0A 4R9WA 2LGXA 3TS2A 3RYTA 5EJWA 2K6DB 1K51A 4HVBA 3QIAA 5IYDG 4GOPB 3GO5A 2F0HA 3AULA 3ERSX 2OQ0A 1VQLA 3PZ7A 2SEBD 5CYUA 1WTQA 2CH4A 3VA5A 2NBVB 1EWHA 2LWPA 3FMCA 1T5EA 1XNQQ 2JEAI 1KM7A 1TZ1A 3V3XA 3R93A 4PT5A 3RNCC 2PZTA 4IUVA 4BY1B 1XLQA 2ACZB 1DONA 2L05A 4NZLB 3VR3A 5IOCA 2PZWA 4LFAL 1DXMA 4QIWE 2NS5A 5H1SE 1FXAA 1KQSA 2BB6A 1H9MA 4DFAA 1PTOF 3SHQA 5M5YB 2N78A 5EPLA 4F88A 3L08A 1GM5A 2UXDL 4A4IA 1VZ6A 2GBKA 4NQLB 2BE5C 1FXIA 2KX0A 4POGA 3PQIA 2KQ3A 2KCTA 3EIVA 5ELEA 1UE6A 2E2HH 1WH3A 4IWOA 3TRZA 2V4DA 4B3RL 3H7PB 2JA8H 1BBWA 1HA6A 3MWYW 2PIAA 3ULJA 1JW9D 4FJZA 4ZKCB 1MGSA 4FULA 2LMCA 3PO3H 3MXGA 4B3TL 2KTRB 1NY4A 2WXLA 3X23A 3UDGA 1RFKA 1QQRA 4WWPA 1JOQA 1IHZA 1OXXK 3HOYH 2Y5CA 3KW5B 1TT2A 4JI6Q 4BY7B 3MC0B 2UUCL 3J9CA 4J3OD 3MAQA 1IKLA 2EKIA 1RTNA 3J80c 2UUBQ 1SE9A 4R4QA 3FILA 1E2VA 2K04A 2K52A 4MSMB 1WX7A 3CAMA 4X65Q 3DHGC 1WCMH 3T16A 1CA6A 3EUB2 1PZJD 1NAPA 3RZOB 2KANA 3GTPB 4KY6A 1HR0Q 5E1FA 1QJOA 1WOCA 5C0XJ 4GOPA 1NI3A 1OFFA 3MHZA 1I35A 1G91A 2JY6A 3VR5A 4OX9Q 4OIJA 1HTPA 3NTHA 3DBLI 2KHIA 2MSED 4NQKE 3PO2H 2LFIA 3CQZH 2PKOA 4IUPA 4IUNA 3M3YH 1R4NI 5LMNL 4F8CB 4B3SL 3AECB 1TZOA 2JA5G 4YY3Q 2R93H 1XLNA 2L32A 1GUGA 5IGGA 1J8CA 3CPWA 2RHSB 2PMZE 3UDFA 5EBDA 4GKKL 3HRDD 3DHIC 1WTHA 3K81C 3TSSA 2GI9A 3QAQA 3HKZG 3GDEA 4H2AA 4DV0L 4LJPB 1W3SA 1BT0A 4FDBA 4CJ0B 3IXSA 4DDGD 2KJHB 3H8HA 2WAQG 4OZCA 4JCVE 4C3IG 4DXGA 1LM8B 1KDAA 4K7WA 3H7PA 4DNRB 4LF4L 4B9XA 3E3XA 2E3TA 4FXCA 3A33B 4KDLB 1VQDA 3VQIA 1KAWA 4MH0E 2KTRA 3TJPA 4LWCA 1LTLA 3LWEA 5EPJA 4AOFA 3W1GA 3TL5A 3ZJTA 5C3WA 2KJXA 2KMAA 4WJQA 5L83A 5CHVC 1AARA 2WACA 3G6EA 1BOSA 4KJOA 2D3AA 3R66C 1F1HA 1TY2A 5CBAE 1QOAA 4IFDJ 4DAVA 4JLCA 1WJ6A 3N9YC 1VQOA 3IAM1 1HXYD 3PUZA 1Y1VH 2DX5B 2YLMA 2ZJDA 3M7NA 1PH4A 3ZKJC 4DHZB 1LYLA 5IP4D 3Q69A 1RRBA 3FVQA 5C4XB 4QF4A 3AE5B 2F52A 5IAAC 3AMUA 4P2CB 1MHHE 4MZ9A 4Y7NH 1HZ5A 3CMEA 1D2BA 1WSPA 5DAUA 3NELA 3FEWX 3L2PA 1MJDA 1FCCC 1WRIA 2M00A 1XEEA 4WWOA 5T8IA 5I9PA 1PHJA 3G71A 4M8NA 3QJZA 4IWQA 4HSVA 1XMOQ 1PYWD 4XIGS 3TP8A 5J1ZA 4DF7A 2RD0A 1ZXHA 2B2UA 5A2QE 2I2YA 3NOBA 4C3JG 2Z0DB 5IP7H 4HRSA 2WHIA 2EYPA 3RMKC 1XTDA 2EYMA 4LLGM 1DOLA 3CC4A 5GMVA 5CX3A 1K83B 4A3DG 2FINB 3I4LA 1F2MA 4OXPA 3W9CB 1YNND 4MTKA 1EWIA 2Y0SG 5T1GA 1WYDA 3GTKH 1JROA 3AE6B 1JOOA 5C3XA 4GDKB 3SFEB 1ENCA 2BA1A 4K0KL 3NZSA 4S0RA 2V0GA 1SJED 2RSNA 1V43A 4K3BA 3VRAB 2WYQA 2JUOA 4LNOA 3J81i 2IGGA 3I4OA 2O6VD 2N9PC 2WXRA 4ANXA 2NR2A 4YSYB 3DPDA 3AEFB 3WANA 1JB7A 1PRTF 2KUMA 1UBIA 2X6LA 3RZDB 3G7LA 1J7CA 3MHBA 1TWGB 4F8MA 3MP9A 4G11A 1EIGA 4XZ4A 4URKA 4NPSA 3M3JA 2OXPA 2JA5B 3NK9A 4XYCA 2HHHL 3R8BA 2BYFA 1N5XA 3IRBA 1U4LA 1KDCA 3OW7A 2KDFB 4RM8A 3W5UB 4BWGB 5C0XI 4ANVA 1E8YA 3V96A 3ZNGC 4MM3A 3P2BA 4WFN3 3LXFA 1FD6A 4ANUA 3B0AA 3RCZA 3VTUA 3HKZB 1QVCA 4FXKC 2VH2A 1CHPD 2LKVA 2RDBC 2JQRB 1CKNA 2F4IA 3QB3A 4DUYQ 2WAQB 2O2LD 2KDBA 1KNEA 4C3IB 1VZ8A 3NZ3A 3ZJVA 1RCVD 2DJFC 3OMGA 5LMNW 2VS1A 3S16H 5COYA 1WYGA 3WOFA 1TTNA 1M8AA 1VDZA 2VQEL 4B9WA 4ZRPA 2NVQH 3FP9A 3NUCA 1UWMA 4DR7L 4RG1A 4RH6A 1S5BD 2MUYA 1S4ZA 1RKNA 3N32A 2I5HA 2OF1A 1HFGA 1RJTA 2C7MB 4HJ5A 3SXHA 1EF5A 1IBMQ 5E7NA 2NZHA 1LTSD 3F2CA 1K0RA 4N9TA 1BCPD 4BBRH 2CJNA 2K6QA 4IUQA 4GDKA 5M3FH 5GADC 5M5WH 2CS4A 1W2BA 4A9AA 4LF9L 1KJTA 3B6YA 4II3B 3RUZA 3NS1A 2BWFA 4JI4L 4IOCA 1UE1A 1E5WA 4LNIA 3E9HA 4A3LH 4XC2A 3VUWA 3BYTB 2GBMA 5EKLA 2KEDA 3TEHB 4DU9A 4X3KA 2V4IB 2SAKA 2X38A 5LHY1 2BW2A 3Q3JA 2F03A 3BDOA 3DQVA 4QMGA 3S1MH 5LMUQ 4WORA 3QO2A 1YJ9A 2MNAA 4A3BG 1TWFB 4WJPA 2DJGC 1ENFA 3BVMA 3J7AF 4IFDI 1D5MC 1UELA 4A3KH 1IBKL 2W54A 2WXHA 2PTLA 4WJNA 1L2FA 1SR3A 4GLAC 1HH2P 2IGDA 4UP7A 3AH7A 1OO9B 3HHMA 4CKBA 2XBBC 4US8A 2CW0D 3OPOA 2JF5A 2MJ3A 4KVGB 2EYJA 2OT2A 4AYBE 1PQSA 5KYLA 4MJSB 3U52E 1PH3A 4DV3Q 4JI7Q 2Q2HA 1K28A 4C3JB 3ZXVA 1TWCB 2FBWB 3IL8A 2K28A 2OTLA 2FFKB 3D6CA 2WU2B 2DLBA 1K8AC 4UDUC 3Q14C 1N60A 2IX3A 5FLXL 1LT6D 3W3AA 4A3DB 4TUUA 3VUXA 3VTVA 3B2FA 2JZZA 4IKGA 3M4OB 2Y0SB 2KCMA 1YITA 3EHVA 3TEWA 4DPGA 4X64Q 1SMXA 1GPXA 3DVGX 4X57B 4A20A 3NENA 1VQKA 4KKIA 2UXCL 1K3RA 5JZEB 2INCC 5EE1A 1NR2A 4OVZA 4RM9A 3S15H 1GD7A 4BBNF 1Q90A 3L7ZC 3JAMi 1EQVA 1WGGA 2WXOA 3DBHI 1OEYJ 4KZ0A 2JYEA 1XPUA 4GN5A 1X55A 4V0BA 2R2OA 3IHPC 3LDZE 2W3SA 4C3HB 1UE5A 4ZYSA 4DV5Q 3BK2A 5D7GA 4C00A 3PIO3 1WWTA 4CYEA 1S72A 1IBLL 3PRMB 3A0JA 1PV4A 1QILA 3LNNA 4XGAB 2RKSA 1C9FA 1YJJA 3S17H 2J53A 3V61A 1FGBD 1EY4A 4DV7Q 2Z1CA 1V1OA 4NJCA 4R4CA 1XMQL 2HQLA 1P0RA 4UAIA 4DR6Q 3E9IA 3M4YA 3S1RB 4A3CG 3KYHC 4DR1L 1UZXB 5ELCA 1WTPA 2EJGC 1ZYRD 1B44D 2WS3B 3K5LA 4W9FA 2MO0A 2H1EA 3C1EA 2GB1A 4MJSA 3SFDB 2F3IA 2ZXOA 4LUVA 3S2DH 4OVUA 3TZDA 4F7ZA 1ZPSA 3GTLB 2J0TD 4KGTA 1WF9A 4DDID 4H0LC 1ZDVA 4CBVA 1SRUA 2R3ZA 1QB5D 2CR5A 3KH0A 3O65B 1XYIA 2RDHA 3VYSA 3PHWB 5HFYA 1PTOB 4OIKA 3EROA 2ZXPA 4WJWA 4BA1I 3Q22A 4DUZQ 2O5JC 2D3GA 4DR2L 1NCVA 1FFVA 1M94A 1HZBA 3CCSA 2HIVA 2QCZA 4AQYL 1KTKA 3F8TA 4PZ6A 3OSOA 4OWXB 1VQ4A 1B1ZA 2ATWA 2NVTH 1VRAB 1WM2A 2MA9B 5AUKA 2GN5A 3NVZA 1TYGB 4A93G 3H0GH 2MX2A 3NVVA 3VH4B 3ZTDA 2KHWB 1ML0D 3N6RA 2HDMA 1E6EB 2HCCA 1SE8A 4JI1L 1PGXA 1TWHB 3LB8C 4DAPA 4ZUJA 2PVOD 1ZKOA 5KNCA 2YU9H 2KLCA 3ZIMA 5AEKB 4DV4Q 2MBEA 5FLXc 3QK0A 3QCAA 2G3QB 4A3BB 3OLMD 2LUEA 4YHHQ 5IGBA 2F0VA 3HOWG 1N9WA 4LK1C 4R4IA 1HQRD 3L16A 4L5RC 1PH8A 2JWZA 2KQ4X 1HNZL 1O7LA 5G3LF 2WFWA 1T0SC 1WGDA 1JQ4A 1PH9A 3PTFC 5CV5A 4JBMA 2BYVE 5DCNA 1U4MA 3GQBA 2H4OA 1LTGD 2SNSA 3KF6A 1C4CA 2IDYA 1PDXA 1XXGA 2B2WA 1N34L 2BH2A 1OXTA 4LNFA 4P1CC 4M00A 5IIFA 2LRUA 1DOYA 4KKSA 2JEBI 4L5SA 2N7EA 3RULA 1EY8A 1PH1A 3EFXD 1YNNC 3K5NA 1G291 4YTNB 3MEFA 4A6QA 4R8IA 3C19A 4A3EG 4N9PA 1WJNA 3PGZA 3GTGB 1BVSA 5C4XG 4UPAA 3P7JA 2WP9B 3L13A 3L9AX 1IL2A 1RHPA 1N33L 3PGEA 1FCLA 2ALYB 4WAAA 3BZKA 4EE2A 2IO1B 3NZUA 1JALA 5EPKA 1B3AA 4A3GG 3P4SB 3TUOA 1I94L 2N9LA 4BZAA 5ELOA 2A5HA 2IO0B 3IT4B 3NY5A 5CMDA 3EGRA 5BN5A 2G1EA 1QG7A 2DYBA 3SGIA 4G50A 5T1IA 3RNBC 2Z9HA 4ZRQA 4OO1G 5AUIA 5HG2A 2XSCA 3S2AA 4N8FA 1I5FA 4PZ8A 1QE6A 2JZ3B 4ARCA 4AJWA 1GJXA 1U4PA 1L1OC 5AJ3L 4X3TA 1KXLA 1ET9A 1CKMA 1CQFA 2AEHA 4ME5A 3CC2A 3KVFB 1EZ6A 1YEZA 4B9KA 1LTAD 4FF4A 3AEDB 3DBRI 5E4WC 3NJTA 4NAMA 2K14A 4L63B 2NN6G 4GU2A 2WDQB 2DNEA 2GVAA 4ICVA 2C9OA 3KJOA 5TR5A 2J4XA 1E1TA 3GTOH 2I07B 1EYCA 1OTRB 3Q3NC 4DR3L 3JW0X 5JPMC 4IM0A 2VZKD 2Q8IB 1AE3A 2LASA 3KUZA 2CU3A 5E6JA 3P1MA 1YJIA 2MCNB 1DOIA 5BR8Q 5IP9G 2RA4A 3KF8A 2R92G 1CSPA 1ZEQX 2I0QA 3S14H 1K53A 3T8MA 1HRJA 3H94A 1L4DB 2KQSA 4O42A 2BDNA 3K80C 4NY0A 3K8AA 2X69A 3UE1A 3I4NG 1P3QU 3I63C 4KIKB 3ZYYX 4YSZB 3PF4A 4JOIC 4IFDH 2L1AA 1J0GA 1H4RA 1BCPC 1AZPA 2OHFA 1U9RA 1I6VC 2WXQA 4KI0A 1KL9A 2Y3AA 2L0FA 3T1HQ 2JU6X 1D5ZC 2A6HD 2KVMA 4MGZE 2MWSB 1STYA 1S5DD 2K05A 5TSSA 4DHJD 4LFBL 2XK5B 4A93B 3QWZB 3TEXA 1WTWA 1FJGQ 4MT5A 4EZJA 2WB1G 2GBNA 3N20C 3PV1A 4RKBA 1YN5A 4HCSA 2BKFA 2EXDA 2L0TA 2HDLA 2ZM6Q 1X1MA 5M5YH 5IODA 2EJMA 2WU5B 2MGSA 2D3CA 1ESFA 1QCBD 1E22A 4KHPQ 1OTCA 1Y69U 2B3AA 3Q8BA 3CCEA 1WVLA 3A4RA 3HOWB 3VR2A 1XLPA 4W9DA 2HUGA 2EELA 3DVGY 3OIPA 3M63B 5G5HA 2OEOA 2CW0C 3RN2A 2WDTB 3UF8A 4DWFA 4PS8A 1I4XA 2C7HA 4YT0B 1PFSA 2F3VA 2V1CC 5G5GA 1EY5A 4M0WB 4BY7H 2CHWA 3U8ZA 4LCDE 4X62L 4CHTB 2QEJC 4L6TB 4C2MB 3Q8AA 4FYDA 2Q2TA 1T0QC 3HFZB 5IYCG 1X9NA 4DV1L 2IY0B 4MSQB 1KH0A 4KMUC 4FA6A 4A3EB 1BKBA 2N9XA 4KY5A 3G4SA 2PZUA 3RZOH 3H15A 4HPPA
chains in the Genus database with same CATH topology
2ZXRA 2QDBA 1JQYD 1LTID 2V3PA 4HCEA 3SR6A 2AUKA 4XDDA 3FAHA 4A3GB 1UEAB 1QT9A 1CTMA 4Z9CB 1AWDA 4NAWB 3VR9B 3AEEB 1T3QA 3V2TA 2B8GA 3D3RA 3NXWA 4IDIA 4B08A 2L83A 3A56A 3WOEA 1IYUA 3LX0A 2AWOA 1TWAB 2J42A 3AM9A 2M9VA 3GB1A 2IX1A 1C4AA 1TKYA 3T3OA 1IL8A 1ZYRC 4ODGA 3AB9A 1EU4A 3C8YA 4H13C 1A3UA 5JAVA 2BCOA 3CHBD 3FILB 2R92B 4NP5A 1L6VA 2K9XA 1TR5A 1RWSA 2LY7A 1F77A 3I4NB 1UNSA 1CFMA 1EYAA 4XT3B 1VMCA 3CU7A 1FIQA 1LABA 5BYQA 3DWPA 3KUPA 4I7ZC 5AFWA 1BXTA 1R7SA 2WB1B 2INNE 4M8AA 2N88A 1C76A 3FDTA 2M2LA 3WDNA 4HEDA 3NQIA 1TQOA 3SK5A 1B9NA 2EDGA 3BZDB 2L1BA 1ZUD2 1T5XD 3DMUA 4ABNA 3EA6A 4MIUA 1HTLD 1EIHA 3D4RA 2N7JA 3I70A 3BVZA 4XXEA 4BS9A 5FR3A 5C5LA 2D5DA 5EE3A 5HI1A 3KLSA 4HROA 3IFDA 2QILA 2JSOA 3AE4B 5KEEA 2W55A 2RPVA 2VNUD 4FXDA 1IGDA 4XYOA 2HDEA 3ZGZA 3TP5A 1K8MA 2K3UA 2M19A 1FMAD 4QIWB 3S2HB 3QOJA 2WXJA 5JVG3 2O5IC 5D3IB 1LO5D 1QOBA 1J7AA 4PMCA 5CV4A 1EY9A 1G6ZA 4PQXA 1GXDC 3E5SA 5DM73 1J7BA 1MI0A 2FE8A 2D9UA 3Q24A 1O78A 3V05A 5BN3A 1DYQA 5J22A 2XWBB 1PMRA 1DOXA 3H91A 3S1NB 2RQXA 2VB2X 4F7XA 4XT1B 1FD7D 1CHQD 2L52A 1STBA 4EQNA 4K5XA 5BYSA 1SB3C 5FKAC 2MJEA 3BVGA 2F0OA 3HVDA 2WQYB 3AE1B 2KOLA 5C3EB 2BDOA 5BN4A 3DUZA 2WV6D 1UGJA 1IUEA 1LT5D 3PV0A 1KFYB 4DQOC 1WTRA 4V190 1SE4A 1STAA 3B2GA 3DEPA 2F0SA 2MJDA 1YQ3B 4WRDA 1NSNS 5BMHA 3IT6B 2PMZB 2A6HC 1UUPA 3FC4A 3SR1A 3VYUA 3J81L 3ND8A 4XWWA 3NTKA 2B76B 1STNA 3J80E 1PGAA 4MM3B 1WTVA 2L11A 5ELBA 5I4DA 2EYLA 1S5FD 2IGHA 2SOBA 4C56C 2OEDA 4HN7A 4WWMA 1AFPA 2E74C 4CQNA 1JRPA 2K1BA 1SAPA 5IT9L 4WAFA 1MSHA 3FPUB 1C77A 3VRBB 2D5GA 1F9PA 4TQ1A 1S5ED 2LFNA 4RHSA 1FRRA 2B8FA 4KKJA 3P4QB 2LHDA 3E0JA 2E2HB 3GP7A 1AN8A 5EE0A 1HEZE 2JA8B 1A3TA 1N61A 5FO9B 4KY7A 3BDLA 1PFBA 3NSWA 1YN4A 4DNTB 1F2RI 3UI2A 3PO3B 2EXZA 4HEA1 1F9SA 1WGKA 1LT3D 4C3HG 5MPOA 1KABA 2DY7A 5EBCA 3C1FA 1I4QA 1EEFD 1JR0D 1H9JA 2B2VC 3CRKC 1YQ4B 3E6ZX 2NMQA 1O7ZA 2QCPX 3DWQA 1EY6A 1BUVT 3HOZB 1DOMA 4A3FB 4ZOHC 2MPMA 1SNDA 5C44B 4RKLA 1KF6B 4R8NA 4RNAA 4DK0A 1SJHD 4NW2A 3KBXA 1ILPA 3TN2A 3PO2B 3ETRA 3NTIA 3M3YB 4CGYB 3K5MA 4KK7A 2YEPB 4OO1I 2Y5PA 3KWLA 2VUMB 1J8IA 3J7YW 1PTOH 3D4DA 2K0PA 1W6KA 2RDFA 4XDXA 2IJ0A 3O13A 2A68D 2C5CA 1JWUD 1HCZA 2INPE 2EVBA 3TZUA 2PCFB 2Z4HA 2KA7A 4EQPA 1E2ZA 1PZID 2LHEA 1Z47A 4IZ8A 3A7LA 3JAML 4BBSB 3P1HA 2ICEC 1HUNA 1S5CD 1STHA 2MP1A 4K5VA 5JEAG 2LGIA 1VF7A 2AX5A 1SYDA 3SK4A 4MN3A 1BQQT 1NVID 3SEBA 1OXSC 1TS5A 2I38A 5ELFA 5IGFA 1XLOA 2EY2A 5H92C 1BCPB 1Q8IA 3X3NA 4ITKA 4K2KA 1E10A 2Q8RE 2F0WA 2EPBA 1RDPD 5FK9C 2HTME 2IW3A 2K5WA 4XQNA 1D1IA 2SDFA 1HHVA 3NP8A 4GLSC 2FJ2A 3RMHA 1ROEA 1Y8PB 1MHXA 4L8JA 1VCIA 5E4XA 2NBFA 3IAS1 1CK1A 2KEEA 3K5OA 1CM9A 1NEKB 3EQLC 1KRHA 1D5XC 4AYBB 3MXNA 2LEKA 3GTKB 5C2TB 4US9A 3A8JE 5EKIA 4ZHPA 2J52A 2JE6I 3K59A 2AQ1B 2IT1A 3ND9A 5H8YE 4C7YA 3CKIB 3KLSX 2L5TA 4KN4C 1M4VA 3C46A 4N6EB 4U68A 2Q8TA 2BOSA 2WDVB 2F0KA 4C1NI 1DD2A 1PTOD 4L23A 3RFZB 2B2TC 3MA2B 2WNMA 2Z4IA 4A3JB 4DK1A 2QMTA 1D6EC 2M0AA 2A6ED 2F0NA 5NUCA 1I50B 3KLRA 3PUXA 1ILQA 2F3WA 3I8ZA 1GUTA 3S16B 3DM1A 2FHTA 5A35A 5CV6A 4HSPA 3NE5B 1XO3A 1SMYD 2N55A 3AEGB 5I9OA 1BBXC 2NZ1D 1WD0A 4WURA 1SNMA 2NWGA 1MI2A 2EJFC 2RBMA 2R7ZB 2WXPA 1KDBA 1SIJA 4K2LA 3D6WA 1LLRD 1Q10A 2KAJA 1EY0A 3AE3B 4K8IA 1XX8A 1A6XA 2DYOA 2W3RA 1TY0A 1KLUD 2LS01 5KIXA 3H09A 3S1MB 3R2IA 1TS2A 1C4QA 1Y8NB 2WP8J 2QIEB 3T56B 1OQRA 3DEOA 2XN9C 1TVXA 3NWTA 2K5PA 3W9CB 3AB5A 1I4GA 1GHKA 4RCNA 1SNOA 4XQQA 3LYYA 1D4BA 4S3SA 3FPPA 4K5WA 2CVRA 4H44C 1ZXTA 4MACA 4HR7B 3C3LA 1EWYC 4OW0A 2KDMA 4OO1H 2VB3X 4YTMB 3AMZA 4E6IA 4BA2I 5C0XG 1CQVA 1SE2A 4KHVA 5D3DA 2NN6H 4JPSA 3B9JA 1O80A 1GB4A 1SEBD 4OL7A 1SYFA 4TKOB 1JWAD 4I65A 4KD4A 2XVSA 3MEHA 3NUHB 1EEID 5FLXE 2IX0A 1I4HA 4IOIE 4DAYA 5K5PA 1PLFA 4HAEA 4KD3A 3D31A 1OXVA 1FYCA 1GUNA 4X3UA 2A68C 1Y1WB 1EM7A 2F0UA 1K50A 2EE1A 1PDQA 1RODA 2IL8A 1SFOB 5CV7A 3Q6SA 1K8OA 2AWNA 2F0TA 2BTEA 1E2WA 2YEPF 2KHSA 1JC7A 3K57A 3KBGA 4WH4A 4M1UB 1JICA 1L4ZB 1A3VA 4A3IB 5M3MB 5JPNC 4ZKBB 5JJZA 1RF2D 4C7ZA 4IFDG 4PMWA 1HZ6A 5E3FA 1Z6HA 4MHEA 4B0MA 1SNQA 4GDLB 4LAAA 5D65A 1PRTD 2YYZA 1I4RA 1SBBB 1QWYA 3OWFA 2V3NA 5LL6S 3BDCA 2FMCA 3Q8EA 1IKMA 5JXVA 1SE3A 2KMMA 2F0LA 4FF3A 1WTOA 3SHLA 3TP6A 4FXGC 5KGUA 1ZDXA 4FNFA 4WQMA 1DCZA 4R3DA 2A74C 1PFMA 4HKZE 1V8QA 5EKKA 2F1MA 1EFID 1BCPF 3DHQA 3QOLA 5I6YA 3KQ4A 4K6DA 1L0VB 3HGBA 2VXWA 2HCIA 4IUTA 1C48A 1EY7A 1U4RA 4TQ0A 1ACCA 1H9KA 4TRDA 4DXFA 3GTJB 2E2JB 1JORA 1I7HA 1VR9A 2CJOA 1I6HB 1E0ZA 2I46A 2L0CA 2PQEA 3U7ZA 3W2DA 2JP1A 5CBEE 4X3SA 1SSOA 3GV6A 1L0XB 4DA2A 4CKCA 3ZQ4A 4KKTA 1VJKA 5C3JB 1GHJA 1ICWA 2R61A 3TMEA 1QNUA 1JCKB 1PTOC 2E2DC 4RFBA 1A2UA 2XNAC 2MH7A 1XWEA 1V1PA 1EZ8A 2G9HD 3PO0A 1HQMC 1SDFA 1QKZA 3A8IE 5LNK1 3J7AV 3F2UA 1PGBA 2K7VA 4IUUA 1VMPA 4J6HA 2KCCA 3HG9A 4U673 3OHXC 3PIP3 1NENB 2L12A 4RAUC 4L1BA 2QJLA 5K36G 5A2QL 1QOFA 1BNZA 4JK1C 1MVKA 3AEAB 2NTTA 1HA5A 2NUCA 1VF5C 4G57A 2A73B 3BIID 4J1MA 1DM0B 3T53B 2WXNA 1VLBA 3S9WA 1SMYC 3P42A 1LTTD 3AE9B 2G9DA 4G7OC 3RLFA 3I73A 4IURA 3ONAB 3X3MA 3P20A 3MVVA 3HOVB 3W5VB 2XWJB 1BDOA 4KX6B 1Q12A 4CJ2C 3P63A 1PXUA 1JWSD 4PNYA 3U9SA 2QSDA 1YN3A 2Q5WD 1DGJA 5ISRA 3S1QB 1FRDA 2ID0A 4PMBA 4ZK9B 1E9MA 4CKEA 5C5MA 4AQ7A 4LJZC 3PUYA 2FUG1 2MEKA 2XRQD 1C4PA 1BR9A 3EVQA 4DGZA 3T13A 1BO0A 3R2TA 3HVZA 1XF5L 3AV8A 1PUTA 1IW7D 4CJ1B 2JXTA 5M5XB 3LWUA 2B2VA 1ET6A 2O4XA 4OGQC 3SK8A 4YTPB 1SSNA 2B63B 1TKWB 2E75C 3ITPA 2JA6B 1FEHA 1G2TA 1MBYA 3DWAA 5IGEA 2AQ2B 2PW5A 1B9RA 2RSOA 3VYRA 3WCQA 2WKCA 2L55A 2PVGC 2AUJD 3SE0A 1QF6A 1SF0A 2BS3B 4MH8A 1F2YA 1DOKA 5G3LD 4A90A 2ZW0A 1II3A 3VYTA 3RD4A 1L5PA 3AU7A 2XRSD 1KNAA 5C4JB 2F0FA 3OOCA 3H3VC 2BYTA 3D8GA 4KKUA 4AS1A 2HQEA 3VR4A 1B50A 3A54A 4HMJA 3Q8FA 1K52A 3AN1A 2K32A 5JOBA 1Y56A 1LV9A 1DZ1A 1FO4A 4HMIA 2E2IB 5GXGB 1JWBD 2PNRC 2A69D 1EU3A 1SNPA 4B0EA 2EYOA 4ZLTF 1HFNA 2K5QA 1F2RC 2KACA 4LK0M 3Q23A 1GAQB 5CGKA 2K22A 1JB3A 2F0PA 2WXGA 1PRTC 1GUWA 3MTSA 2XIWA 3BS1A 3TEZA 3I4MB 4HJGE 1EWCA 1KLGD 2L4NA 3OIQA 2LJIA 4PV1C 3C2PA 4JE3B 3HOUB 2JX5A 5EQ0A 4K6LA 4NKLA 4XDCA 2H89B 1CZGA 1P7FA 1TS4A 5HGTA 1QOHA 2WXFA 3K58A 4D2KA 2D2CC 1MSGA 1N62A 1CT1D 3VA7A 2ON8A 1Q3LA 1T6BX 1A2TA 3SK6A 5IGCA 2JXMB 3NQTA 5HHDG 3HOYB 1H9SB 4G7HC 4N59A 1TKEA 5I6WA 2CQAA 1ESRA 1NUCA 3L4PA 4F87A 5KNBA 5I2YA 4DN4M 4WIPA 3QWNA 1P7EA 1WCMB 5CV8A 1L6UA 2B2TA 2F0JA 4TQUS 1R4QB 2GRIA 3U2SC 3EJIA 5FOBB 1FNVA 1MPEA 2PPBC 1AW7A 3L3OC 3CQZB 4KN7C 1A15A 2R93B 3MXPA 2WINB 4NMZA 1NR4A 3TEYA 1QOGA 2NN6I 1UAPA 2DN8A 3I3CA 4A55A 5KRUA 3NRZA 5CR3A 4Q2JA 2KN4A 2QF7A 1TJEA 1BMLC 4IN3A 1PFNA 5J39A 2JZPA 1B4OA 1N63A 2NB0A 3MJ5A 5FO7B 3G6JB 1IYVA 1H9SA 5JEAH 1AP0A 1DJRD 2PW7A 1JE4A 1YNJD 3BK1A 3OMCA 1TIID 4RGTA 4HTHA 1XTCD 4ZHOA 1Y1VB 3HZXA 1C78A 2B2YA 2DBYA 1SYBA 2PLPA 5EGTA 2WIIB 1ZXIA 2MHVA 1A70A 4Y7NB 1JMLA 4RCOA 2NVYB 1ZOYB 3SDZA 3MZ5A 3NHHA 4P16A 1PZKD 1NYRA 2PO4A 1YNTE 4ARIA 4C80A 4A8XC 2JYTA 3E9SA 3HRZC 3IAYA 3J81E 4YWGG 2D62A 1IW7C 1TU2B 3FKIB 1GUOA 4XE0A 3K6OA 3ABVB 3BWUD 1E7PB 2F0GA 2SNMA 2B2UC 3NBHA 1EL0A 3E56A 2DNCA 3QJYA 1J9OA 1ENAA 3ERQA 2PMVA 2F0DA 1GUSA 4IQZA 5DEHA 1R9TB 4RGOS 3HS0C 4O1NA 3VR8B 4QB4A 1F9RA 5IT9E 1FFUA 1Y8OB 2ICIA 1RD9D 4Q0FA 2DYMA 1HPCA 5ELDA 2EYFA 3AE7B 3FRPB 3BG3A 2ONQA 3DWGC 4XQJA 4KJNA 2K03A 1GB1A 3AE8B 4L2YA 4LMQD 2B39A 4ULLA 3QG1A 4C1NK 4P6VF 1LTBD 2J7ZA 1EQTA 1ONLA 5LL6X 3R3OA 3K7AB 4QUFA 2BS2B 3GS2A 3TBIB 3RPFC 1SNCA 3AE2B 5CV9A 1AEXA 4KGRA 4GZYC 2BB5A 1KAAA 1ZE3D 1AZQA 2ZW1A 3CRLC 1G8ZD 1SYCA 2Z8LA 5F2DA 4FP5D 4TMAB 3W1SA 4FF2A 5C6AA 1FNWA 2NVQB 1Q1EA 1B2TA 2F0MA 2TSSA 3KK7A 2A69C 1JWMD 3P4RB 2BS4B 1PFDA 3NVWA 1FNUA 4OHJA 4YIJA 4A3MB 3ZJUA 1JOKA 4ID6A 4XYQA 1V97A 4BBRB 5M3FB 3HUIA 5M5WB 4XWTA 3CWIA 1FR3A 1RYJA 1W6JA 2PYKA 1WD1A 2PW9A 2EZVA 2GA4B 3VR6A 2NVXB 1CI3M 3K0YA 4ZAIA 4KV6A 3CIRB 1EYDA 3I72A 1SYEA 4HKQA 3MFGA 3GTQB 2K5DA 2BE5D 2EOTA 1QLBB 2BT6A 1X3QA 2B2YC 2QKIC 1SXTA 4A3KB 1UWXA 2F0EA 3D4WA 3I90A 1HUMA 2FMMA 2DWQA 5IGDA 5C4HA 3MXUA 2EY6A 1R4PB 1OQQA 4ZQ3A 4KTAA 3JAME 1BUIC 4LTUA 2IWHA 2WXIA 1H9RA 1Z7TA 1CA5A 1CZPA 1B53A 2DY8A 4XTCS 3I91A 2LUMA 5CORA 3SVMA 5FO8B 1ZP0B 5C0XH 4YXDB 4RGNA 1SYGA 3HEJA 2ENBA 1B9MA 1VZ7A 2F0IA 1CJEA 4QCLA 4RGMA 4ZUIA 3U4EG 1STEA 3GD7A 5HURA 3PUWA 2X6GA 3I9V1 1L0YB 3S15B 2RMMA 5EE9A 1LACA 1O7YA 3N52A 1TKGA 2K33A 2IPKD 3T4AC 5DNFA 2F0QA 1C79A 1XCQL 2WXMA 3P75A 1IBXB 3H6MA 1MD2D 3PMFA 4RHRA 3S17B 1RM6C 3IFTA 5CC4A 2EY1A 4K8JA 5KNDA 3URYA 5D14A 1F9QA 2BBCA 3AEBB 1F2LA 4H7BA 5KYIA 3IKJA 4Q5VA 3S2DB 3T51B 3DWMA 3NVYA 1E0BA 1F2ZA 3UI3A 1EOTA 2NYZD 2VZKB 2MJ8A 1RTOA 5C4ZA 3BYYB 4YSXB 3A7AB 1NYQA 1YNJC 4J8QA 2JWUA 5JEAJ 4FF1A 4JBWA 3KWVA 4EQOA 3Q8CA 1X3PA 3P4PB 2NVTB 1CZWA 3M85A 3GV3A 3H0GB 1TS3A 2WXKA 3TP7A 3A55A 2E76C 1V1PB 3HP3A 3PZ8A 3U9OA 2AQ3B 1BF4A 1XCTL 2JSVX 2H88B 4USAA 1QNKA 5M9OA 2YU9B 2WLBA 2BA0A 4FVMA 2W82A 2E6XA 3PUVA 4REZA 2KWDA 1IGCA 1IBXA 1WTXA 1LT4D 2L9HA 1I3QB 1YMHE 2TMPA 2N0SB 1C8CA 5BMIA 4RF1A 4QUCA 4JWUC 1PRTB 3NPPA 3M7GA 2JYOA 2B2WC 4RWSC 1LTRD 1WXQA 3TDQA 1GOZA 2RVLA 1FM0D 3DXJC 2KECA 4KGSA 3GTMB 4IALA 4N58A 4RA8A 4ZRZA 2WKDA 2M56B 2NTSA 4K14A 4JWSC 1D1KA 2KCNA 1F0ZA 4KHZA 1OXUA 1X32A 2EYHA 3I57A 4G4KA 2CHBD 1VDVA 4EVOA 4NDXA 3J80L 2ZT9C 4OZBA 3NWSA 1AYFA 1G2SA 4G7ZC 4TSSA 2K01A 2N9KA 2A6EC 4FO2A 4JX1C 4OZAA 5BMGA 2LMCB 1N5WA 5JVH3 3T3NA 2RDGA 2JA7B 5K36H 4ILWA 3A8KE 3GTOB 3Q0AA 1I4PA 2WDRB 2K6AA 1STGA 3OWEB 2R6GA 4EGVA 3NBIA 5DM63 4M0WA 2EY5A 5BYRA 3HOXB 5I2XA 3S14B 3MFYA 1Q1BA 4RF0A 4R9WA 5EJWA 1K51A 3QIAA 3GO5A 2F0HA 3PZ7A 2SEBD 5CYUA 1WTQA 3VA5A 1EWHA 3FMCA 1T5EA 2JEAI 3V3XA 3R93A 4PT5A 2PZTA 4IUVA 4BY1B 1XLQA 2ACZB 1DONA 4NZLB 3VR3A 5IOCA 2PZWA 1DXMA 1FXAA 2BB6A 1H9MA 4DFAA 1PTOF 5M5YB 5EPLA 4F88A 1VZ6A 2BE5C 1FXIA 5ELEA 2KQ3A 2V4DA 1HA6A 3MWYW 2PIAA 1JW9D 4ZKCB 1MGSA 2LMCA 3MXGA 2WXLA 1RFKA 1QQRA 1JOQA 1IHZA 1OXXK 2Y5CA 1TT2A 4BY7B 3MC0B 3J9CA 4J3OD 3MAQA 1IKLA 2EKIA 1RTNA 3FILA 1E2VA 2K04A 3T16A 1CA6A 3EUB2 1PZJD 1NAPA 3RZOB 3GTPB 4KY6A 5E1FA 1QJOA 5C0XJ 1NI3A 1OFFA 3MHZA 1G91A 3VR5A 4OIJA 1HTPA 3NTHA 2LFIA 2PKOA 4IUPA 4IUNA 3AECB 1TZOA 1XLNA 2L32A 1GUGA 5IGGA 5EBDA 3HRDD 3TSSA 2GI9A 4H2AA 4CJ0B 3IXSA 3H8HA 4OZCA 4C3IG 4DXGA 1KDAA 4DNRB 4B9XA 2E3TA 4FXCA 3VQIA 3LWEA 5EPJA 3ZJTA 5C3WA 2KJXA 2WACA 1BOSA 4KJOA 1TY2A 5CBAE 1QOAA 4IFDJ 4DAVA 3N9YC 3IAM1 1HXYD 3PUZA 3M7NA 3Q69A 3FVQA 4QF4A 3AE5B 3AMUA 4P2CB 1MHHE 1HZ5A 1D2BA 1WSPA 5DAUA 3FEWX 1FCCC 1WRIA 2M00A 1XEEA 5T8IA 5I9PA 4HSVA 1PYWD 4XIGS 3TP8A 5J1ZA 4DF7A 1ZXHA 2B2UA 5A2QE 2I2YA 4C3JG 4HRSA 2EYPA 2EYMA 4LLGM 1DOLA 1K83B 2FINB 3I4LA 1F2MA 1YNND 5T1GA 1JROA 3AE6B 4GDKB 1JOOA 5C3XA 3SFEB 1ENCA 2BA1A 2V0GA 1SJED 2RSNA 1V43A 3VRAB 2IGGA 2WXRA 4YSYB 3AEFB 1PRTF 2KUMA 2X6LA 3RZDB 3G7LA 1J7CA 3MHBA 1TWGB 4F8MA 3MP9A 1EIGA 2OXPA 2JA5B 3NK9A 3R8BA 1N5XA 1U4LA 1KDCA 3OW7A 3W5UB 4BWGB 5C0XI 3V96A 4WFN3 3LXFA 1FD6A 3HKZB 4FXKC 1CHPD 2LKVA 2JQRB 2F4IA 3QB3A 2WAQB 2O2LD 1KNEA 4C3IB 1VZ8A 3NZ3A 3ZJVA 1RCVD 3OMGA 5COYA 1WYGA 3WOFA 1M8AA 1VDZA 4B9WA 4ZRPA 3NUCA 1UWMA 4RH6A 1S5BD 2MUYA 1S4ZA 1RKNA 2OF1A 1HFGA 1RJTA 3SXHA 1LTSD 4N9TA 2CJNA 1BCPD 4IUQA 4A9AA 3RUZA 3NS1A 3BYTB 5EKLA 2KEDA 4DU9A 4X3KA 2V4IB 2SAKA 2X38A 5LHY1 2BW2A 2F03A 3BDOA 4QMGA 4WORA 3QO2A 1TWFB 1ENFA 3BVMA 3J7AF 4IFDI 1D5MC 2W54A 2WXHA 2PTLA 3AH7A 2IGDA 1OO9B 4CKBA 4US8A 2CW0D 3OPOA 2MJ3A 2EYJA 2OT2A 5KYLA 3U52E 4C3JB 1TWCB 2FBWB 3IL8A 2K28A 2FFKB 3D6CA 2WU2B 2DLBA 4UDUC 1N60A 2IX3A 5FLXL 1LT6D 3W3AA 4A3DB 3B2FA 4IKGA 3M4OB 2Y0SB 3TEWA 1GPXA 4KKIA 5EE1A 1NR2A 4OVZA 1Q90A 3L7ZC 2WXOA 1EQVA 2JYEA 4V0BA 2W3SA 4C3HB 4ZYSA 3BK2A 5D7GA 3PIO3 1WWTA 1QILA 3LNNA 2RKSA 1C9FA 1YJJA 2J53A 1FGBD 1EY4A 2Z1CA 1V1OA 4NJCA 4UAIA 3M4YA 3S1RB 5ELCA 1WTPA 2EJGC 1ZYRD 1B44D 2WS3B 3K5LA 2H1EA 3C1EA 2GB1A 3SFDB 2ZXOA 3TZDA 1ZPSA 3GTLB 2J0TD 4KGTA 4H0LC 1ZDVA 4CBVA 2R3ZA 1QB5D 1XYIA 2RDHA 3VYSA 5HFYA 1PTOB 4OIKA 3EROA 2ZXPA 4WJWA 4BA1I 3Q22A 2O5JC 1NCVA 1FFVA 1KTKA 3OSOA 1VRAB 1B1ZA 5AUKA 3NVZA 1TYGB 3NVVA 1ML0D 3N6RA 2HDMA 1E6EB 2HCCA 1PGXA 1TWHB 3LB8C 4DAPA 4ZUJA 2PVOD 1ZKOA 5KNCA 4A3BB 5IGBA 2F0VA 4LK1C 1HQRD 2KQ4X 1O7LA 5G3LF 1JQ4A 5CV5A 1U4MA 3GQBA 2H4OA 1LTGD 2SNSA 1C4CA 2IDYA 1PDXA 1XXGA 2B2WA 1OXTA 5IIFA 1DOYA 4KKSA 2JEBI 1EY8A 3EFXD 1YNNC 3K5NA 1G291 4YTNB 4A6QA 4R8IA 4N9PA 3GTGB 2WP9B 3P7JA 3L9AX 1RHPA 1FCLA 4EE2A 1JALA 5EPKA 1B3AA 3P4SB 3TUOA 2N9LA 2A5HA 3IT4B 5CMDA 3EGRA 5BN5A 2G1EA 1QG7A 5T1IA 4ZRQA 4OO1G 5AUIA 5HG2A 2XSCA 1QE6A 4ARCA 1GJXA 1U4PA 4X3TA 1ET9A 1CQFA 4ME5A 1EZ6A 1LTAD 4FF4A 3AEDB 5E4WC 4NAMA 4L63B 2NN6G 2WDQB 2DNEA 2C9OA 2J4XA 2I07B 1EYCA 5JPMC 2VZKD 2Q8IB 2CU3A 5E6JA 3P1MA 1YJIA 1DOIA 1V8CA 2RA4A 3KF8A 1ZEQX 1K53A 1HRJA 3H94A 1L4DB 4O42A