1SE2A

Staphylococcal enterotoxin c2, monoclinic form
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
239
structure length
235
Chain Sequence
ESQPDPTPDELHKSSEFTGTMGNMKYLYDDHYVSATKVMSVDKFLAHDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKDNTGGKTCMYGGITKHEGNHFDNGNLQNVLIRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Residues defining V beta specificity in staphylococcal enterotoxins.
pubmed doi rcsb
molecule tags Toxin
molecule keywords STAPHYLOCOCCAL ENTEROTOXIN C2
total genus 63
structure length 235
sequence length 239
ec nomenclature
pdb deposition date 1995-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1se2A01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1se2A02
1JCKB 2RDGA 5ELEA 2CHBD 1PZKD 1LT4D 1FNVA 1HTLD 3BYYB 1S5ED 2R61A 1YN3A 2AQ3B 1D5MC 1AW7A 1LTAD 1PZJD 1V1PA 2XRQD 1LT5D 5ELCA 1I4HA 1PTOF 1STEA 2O2LD 3TSSA 5D3DA 5TSSA 1PRTC 2Z8LA 1PTOB 1BCPD 1TS3A 1TS2A 3R2TA 1S5FD 4RGTA 4RGNA 2TSSA 1D5ZC 1I4GA 1LTBD 1S5DD 1JWUD 4K6LA 3GP7A 3SEBA 4OHJA 1I4PA 2XNAC 1EU4A 3DWAA 1T5XD 1LTSD 1JWMD 3EFXD 1JR0D 1CHPD 2SEBD 1RDPD 1FD7D 2RDHA 4Z9CB 1EEID 1XXGA 1S5BD 4NZLB 1HXYD 4RGMA 1V1OA 3DWPA 2IPKD 4L6TB 5FK9C 5ELDA 1ET9A 1KLGD 1EFID 1LO5D 1TY2A 3V05A 2NTTA 1BCPB 2J4XA 3R8BA 1BCPC 1I4RA 4UDUC 1F77A 3BZDB 4L63B 5I4DA 5D3IB 1CK1A 1YN4A 4O1NA 1PTOD 1EU3A 1TY0A 1PTOH 1HA5A 1B1ZA 1D5XC 1M4VA 2QEJC 4RFBA 1XTCD 3CHBD 2AQ2B 1B44D 1PRTF 1SEBD 1LTGD 1SBBB 4RH6A 2WV6D 1G8ZD 1L0XB 2ICIA 3R2IA 2AQ1B 1PYWD 1UUPA 2IJ0A 2QILA 2G9HD 4ZYSA 1EEFD 1JQYD 1FNUA 1LTRD 1BXTA 4DXFA 5FKAC 3BVZA 1LLRD 4RHRA 1SXTA 2NTSA 1KLUD 1L0YB 1SE2A 1SJHD 3BVMA 1SE4A 1I4XA 1MD2D 4TSSA 1SE3A 1PRTB 1GOZA 1PTOC 1I4QA 1LTTD 1V1PB 2XN9C 1DYQA 4BWGB 1HQRD 3KLSX 1EWCA 3EA6A 1BCPF 1TS5A 1YN5A 1RCVD 1LTID 1DJRD 1FGBD 1D6EC 4DXGA 3O13A 1LT6D 1QILA 1AN8A 1CQVA 1ENFA 1RF2D 3BVGA 1TS4A 1S5CD 3OWEB 4RHSA 4RGOS 1ET6A 1ESFA 2XRSD 3W2DA 1PZID 3DWQA 5ELFA 1SJED 3BYTB 4RCOA 1CHQD 1FNWA 1LT3D 1CT1D 3MC0B 3MFGA 1JWSD 1UNSA 5ELBA 4C56C 1PRTD 1RD9D 3URYA 1KTKA
chains in the Genus database with same CATH superfamily
4M0WB 1DOMA 1I5FA 1XMOL 3SU8X 3S24A 2Z6KA 2INPE 3S1MB 2M1MA 4JI0L 2KEEA 2PQAB 4C4VA 1E7ZA 5KNDA 2MNAA 4F8MA 3I70A 3TRZA 3AI5A 2JE6I 1Y8PB 1PTOF 2PPBC 2F3VA 2AWNA 3J7YW 4F8CB 3GTJH 3JAME 4KHPQ 2WXIA 1RRBA 3V6CB 1D5ZC 2I1JA 1K8RB 1B7YB 1N5XA 3MTSA 1VRAB 2L76A 4X3TA 3JYUA 1KDCA 4A3EB 1ZDVA 1XMQQ 3PQIA 4MJSA 4S0RA 5DAUA 4K3CA 1I7HA 1SRUA 1EIGA 5C6AA 2UXCL 1KJTA 2DNEA 2KMMA 2YTXA 1ZXTA 4GKKQ 2ZNVC 3NXWA 1CKOA 3U4EG 2JYEA 3CMEA 1JT8A 3VYRA 2N88A 2JRHA 2B29A 2VQFQ 1TXYA 2M00A 1WD1A 1VZ6A 2IPKD 1NYRA 4QJFA 3OSOA 4HSPA 3PZ8A 4ABNA 3BJUA 2KN4A 2FINB 4YSZB 1WFYA 1SMYD 2RCFA 4MSQB 2KLGA 3PT2B 2ASBA 4LNOA 3NY5A 2KCCA 2WINB 3J81c 1I6HB 3GB1A 4GGQA 1A3UA 3UDIA 4WJNA 1FXIA 1FXTB 4C2MH 3PVLA 1X6OA 4NP5A 3AE5B 1YIJA 2KO3A 2R93H 1XX8A 3A5ZB 4XXEA 1GJZA 2O2VA 1VQDA 5E3FA 3DXJC 5D14A 4LF8Q 3Q3NC 3UGBB 1VQMA 5JEAJ 2O5JC 1L1OC 1YD8U 3E5SA 4RH6A 2WV6D 3PRMB 1NSNS 4RNAA 3MXNA 3NJTA 2B2UC 3F2BA 1YHBA 1CMXB 1MI2A 3MFYA 2A68D 1PGAA 2BWFA 5BR8L 4POGA 4A3GH 2KJRA 3KUZA 1VF7A 5DPSA 1VF5C 4GN3B 4RHRA 4LFCL 4DQOC 2MHJA 2KOLA 2E2IH 5CV6A 1TYGB 2OF1A 3A7LA 4P2CB 4U68A 2AUKA 3CQZH 2L0FA 3A9JB 3I3TB 2A5UA 1OXTA 2WU2B 1WXVA 3I4MB 3I73A 2EYMA 5DCNA 3N52A 3R66C 2WXFA 3HG9A 5F2DA 1ROEA 2B2TA 4OEMB 2UUCQ 2MFIA 2DENB 3RLFA 1E7UA 1LT6D 5J17A 1AZPA 1SROA 1WMHB 2MQHA 2IY5B 1WRIA 1TS4A 3TZUA 3CCVA 2D0PA 1VQPA 1HEZE 2VH1A 4IWPA 3ZQ4A 1TWCB 2XWBB 1A3VA 4N59A 4WJOA 3Q8EA 4RCOA 1VQ8A 4FN2A 2PTLA 1JICA 3NK9A 2N4FA 4C56C 3JW0X 2MJ3A 2M2LA 3Q0AA 1Q86C 1VQ6A 3RNCC 4KKUA 1EY0A 1HA6A 3KWVA 3WCQA 4LJOB 1WMHA 1VQBA 1VQEA 1LFDA 4LNKA 1TIFA 1F52A 3C0RB 2H89B 1PXUA 2AMCB 2QKIC 4OWXB 4XQNA 3GTQH 4IFDH 3G7LA 4IURA 4YY3Q 1BKBA 2J0KA 1PZJD 3EJIA 2KC1A 2IX1A 2A6HD 5BN3A 1QG7A 3OHXC 1WJUA 2XVSA 3CU7A 3DPDA 3HM3A 3H3VI 3PSEB 3DVNU 2KTFA 4KHVA 5JOBA 1GKHA 3S2DH 3M85A 4BBSB 5NUCA 2KHWB 4DN4M 1B2TA 1YX6B 2VZAA 1WRDB 4DDGD 4LF4Q 1FCCC 5AZHA 4E74A 1EQTA 2BA1A 4DV7Q 2ZW0A 2UU9L 1QUQA 2IW3A 1X3QA 1PV4A 4XWTA 2G5DA 1LTSD 2IBIB 1JE5A 1NI2A 4Z9CB 1FD7D 2RDHA 5AZFA 3V62A 5BMIA 1EEID 2JY6A 1SYGA 1AZQA 1OEYA 4C3IG 4ZOHC 4OVVA 1WZ3A 3IT6B 4LDTD 2NVXB 2KCNA 1ZPSA 1BUIC 2O2VB 5L83A 4CDDC 2WACA 2ZJPA 4LFBL 5LHY1 2EJMA 5D65A 4L6TB 1IKMA 4NAWA 3SK6A 1ET9A 3TEYA 1VQ4A 2BE5C 4WQMA 3AU7A 1STGA 1TTNA 3P20A 1A62A 4LF7Q 3NENA 1B9NA 3CC4A 3GZNI 4K81A 4E71A 5K36G 1GHJA 3W3AA 2INCC 3ML9A 3I90A 1RFAA 5JEAH 2PMZE 1WTQA 1L1OB 3E9HA 5IYBH 2R7ZB 1PTOH 3DVGX 1NMFA 3FAHA 4MH0E 4ANWA 2KECA 4ZKBB 3P63A 5LLIA 1P7FA 4MEMA 2QIEB 1Q12A 3W1BA 4DR4L 2VB3X 2K8BA 1YNNC 1V8CA 3IFDA 1YNTE 1T6BX 5CORA 4AQYL 3QCAA 5BYSA 1LTLA 2JA5G 2BB5A 1PGBA 2J0JA 4JBWA 1QNKA 3GQBA 1TWAB 2MLBA 5IGBA 2V4LA 1XMQL 2CW0D 3KBXA 4ZCKA 2UUBL 3UI3A 2R92B 3WAPA 1I4QA 4K0KL 1HNXQ 4MGIE 4JWSC 3GTGB 3SFEB 1QT9A 3A1QB 1F9QA 2J53A 4DK0A 4KGRA 3J80c 3HOVG 1WX7A 3PLUA 2V1CC 2OJWA 2UU7A 1Q7YC 2PNHA 1ZYRD 2F0OA 3X0WA 4GB9A 2K5NA 1GHKA 4DU9A 1AH9A 1JROA 1YQ3B 3HHMA 4KKSA 3OIQA 2JA6H 3S15H 2EJFC 4EZJA 3ZDMC 5IP9H 1S5CD 2JVCA 2MEKA 2FCQA 2A4ZA 1Y69U 3ZGZA 4WJ4A 1PZID 4JOIA 4R4TA 3U30A 2XIWA 2RKSA 1E2ZA 2WKDA 1WR1A 2K39A 3ZNZB 1A2TA 5CV7A 3MHSD 5AUIA 3QK0A 3WA0A 3IAS1 1N36Q 4C3HB 1MJCA 2XSCA 3BK1A 4NAMA 1EU3A 4AH6A 4A3DB 2NVYB 1J9OA 5GADC 5ELEA 2BKRB 1YNJD 1KAAA 1H9SA 4GLSC 5KGUA 3ZTCA 1E1OA 3BYYB 1YJNA 2F4VQ 1S5ED 1F9SA 1ZEQX 4OXPA 4W9HA 3CIRB 3NQIA 3QR8A 1WTPA 1CA6A 4BKSD 1LT5D 4DAMA 1PQSA 1HCZA 5ELCA 1STEA 2O2LD 4JVZA 2NYZD 1P1AA 2WX0A 1VMPA 3A8IE 3AULA 4PS3A 4I65A 4ILWA 4L5RC 2KLCA 4LAAA 1KDBA 2M9VA 3BDOA 2LWPA 4RKLA 2Q5WD 4GNXB 2BOSA 2CHZA 2HUGA 4UP8A 4FJYA 1WGDA 2WYQA 2N55A 3AU4A 4ZYNA 4CDEC 2K75A 4B3SL 3K7UC 3PO2B 4OZBA 3ZW3A 1RTOA 2K9XA 3FILB 2KN5A 2EYJA 1QVCA 2NBFA 4IUNA 3UDFA 4LCDE 3I4MH 3AEGB 1WTOA 4A3JG 4GOCA 1GM5A 2E76C 4FBJB 1DOYA 3L10B 1R4QB 2OCEA 2D2QA 4OZCA 3S1RB 2E2IB 1HR0W 4R9WA 3DWPA 1EIHA 2M19A 2FCNA 3KWLA 4Q0FA 2ZW1A 1AE2A 4X3UA 3W5VB 3SD5A 1M8AA 2ZXPA 3HOYG 4MJSB 4PYUA 1VMCA 2F3WA 4KD3A 3ZRCA 3AQQA 1YHQA 3BZDB 1PH4A 2JJQA 4PQXA 3QWNA 4BBSG 4DV2L 2B63H 1ZE3D 4GDKA 3DHGC 3K59A 2KXJA 3C1EA 5T1IA 1CKNA 3HOUG 3B0AA 2CKHB 2AQ2B 1EIFA 4OIKA 3U4ZA 3NWSA 4A3CG 4IC7B 3OAWA 3JVZX 1PFMA 2V9HA 2MJEA 2JUOA 3GTKB 4OW0A 1K52A 3J7AV 5IA7A 2HJ8A 2FUHB 5G55A 3M9BA 4ZYSA 2EY1A 1U9RA 1NCVA 4IZ8A 3GO5A 2O4XA 4XE0A 3QO2A 1G6ZA 3TEWA 3EFCA 1ICFB 3H6NA 3PIO3 4JYAQ 1K8AC 1FM0D 4AYBE 1ZDXA 4Y52H 1S1QB 4RKBA 1WJ6A 2W55A 4YWMA 2NVQB 3P4QB 4HROA 4JPSA 3FVQA 1HQRD 2DNFA 4JG2A 3CCQA 4D2KA 4UPAA 3K80C 2A73B 1HFNA 4JI5L 1J8IA 1PGXA 4XDDA 4NJ7A 2UXBQ 2EY5A 3QA8A 4K7WA 2Q2UA 4LFBQ 5J1ZA 3O13A 3GDEA 1CQFA 2YTYA 1Q0WB 5EJWA 1AN8A 1RF2D 2IWHA 4NXMQ 3AYHB 2JA8G 3L08A 3OWEB 2AL6A 3GTJB 1ET6A 4RG1A 3MVVA 3PUZA 1J5EL 1N62A 4B9WA 5M9OA 2RHQB 5DM63 3CD6A 4PK1A 1GD7A 1HHVA 2WB1G 4NY0A 2JEBI 2RHSB 2BGFA 2YEPF 1RD9D 2Y0SG 3S1MH 2YVCA 3D6CA 2B63B 4YCUA 1D7QA 1EOVA 2B2WC 3VA5A 2RDGA 4DF7A 1Q82C 3M4OH 3S14B 1HTQA 1Y14B 3HK0A 1C4QA 3CC2A 2BKFA 2JZ3B 2JWUA 2DBYA 3EIVA 2D2CC 5EPKA 4MH8A 2I5MX 1PLFA 3RN2A 4XX5A 2MCNB 3NUCA 3CKIB 1V80A 1S40A 3I4MG 3UIOB 1V86A 3TMEA 4A20A 4DK5A 4CDCC 5IY0A 4FF3A 1T3QA 1PRTC 1WX8A 2IX0A 2D9UA 2Z6BA 4ANXA 5JXVA 1S5FD 2TSSA 3Q8CA 4L8JA 2E3TA 4JGHB 4AIMA 4OZAA 3SEBA 4K0KQ 3ZVVA 5EAYA 2CU3A 1VLBA 4N8X1 1VQLA 2NVUI 3TP7A 2M8SA 1VDZA 2EY2A 1F2YA 2JEAI 3AEAB 4JI6L 1D4BA 3DWAA 3AXCA 3UQBA 4GU2A 1A15A 3TBLD 1CHPD 3NSWA 3RFZB 4JOIC 3RUZA 4K14A 4X64Q 5IYDG 5C44G 2Q2TA 1EM7A 1LUZA 2B63G 4A3DG 3K5MA 5DNFA 2KANA 1L5PA 4K5VA 4IALA 3AEEB 1HJPA 2R2QA 2G4DB 1I3QH 4BBRH 2BH8A 2KUMA 1H4RA 1EY4A 4DR3Q 2HTME 5HGQA 1IBLL 2X6LA 2LUMA 3LX0A 1QUQB 3ZRFA 3QX1A 2O6VB 1N36L 4LUOA 2IL8A 1Y8OB 4KX6B 3T1HQ 2CHWA 4YTNB 1JOOA 2VNUD 1MHXA 4O1NA 5M3FH 2GA4B 3OTOL 1Y8RC 1ILQA 4IPHA 1X32A 3K81C 1KM7A 4ID6A 5HGTA 3D0FA 3NE5B 5J2RA 4J6IA 4JLCA 1TZ1A 3VTUA 2EYPA 4G3XB 4J6HA 4YHHQ 4A75A 1ZOYB 2NPTB 2ZPYA 2VQEL 3DCGA 1ZW7A 4C3JG 5G5GA 4LDTB 1JE4A 2E75C 3A74A 4B08A 5BN4A 1Y56A 2ENBA 3P1HA 3P7JA 3VUYA 3M7NA 4OO1I 2JXXA 3MJ5A 4G0NB 4TQUS 3A4SC 1K83B 3L54A 2ZM6L 3U7ZA 2EOTA 3TP6A 2I0QA 1JW9D 3GTLB 3TN2A 3R7RA 5FLXc 3T4AC 3DBSA 2FMMA 4YXDB 2CCZA 3VDZA 2PW5A 1YQBA 3KOJA 4HPPA 3AM9A 3VR8B 1Q8IA 2DJGC 1EWCA 3Q3JA 4A3IG 4RWSC 2N9LA 1E0ZA 4AJWA 4K2KA 5BYRA 2PCFB 2OT2A 1EQRA 4BXXH 1HH2P 3STBD 3QIAA 1L6VA 2Y0SB 4WRDA 2JU6X 1SFOH 4ICUA 4JE3B 2NR2A 1VQ5A 1V8QA 1N32L 3H1UA 5IOIA 2LVOA 5LMUL 4HKQA 1ENFA 2KQ4X 2LVQA 3W1YA 2JXTA 3RUIB 5M3MH 3DWQA 1UWMA 1MHHE 4JBJA 5KRUA 3PO3G 2I5HA 3HOXB 3ZUNA 5IYBG 2A6EC 2L55A 3DWGC 2V1YA 3HS0C 3EBEA 2FNJB 4XTCS 2BW2A 2KHIA 1FJGL 3IL8A 3MHBA 2Q8IB 4DV5Q 3J81i 3H0GB 1T0QC 2KDBA 3A33B 2NB0A 4HN7A 4J15A 5IYCG 2K5WA 4NQKE 3E6ZX 1STNA 1J7CA 3BZCA 4PS7A 1TGZB 3A1QA 1TVXA 3PO2G 1D5MC 4FO2A 1OXVA 2NMQA 4HKZE 4KY6A 4DHJB 4A3PA 1AYFA 1STBA 3DHIC 4KY7A 2ICEC 3ZJUA 2KJHB 4ZRIA 5C44H 5D3DA 4JPBW 1IUEA 1CM9A 5DM73 1XT9B 2V0GA 1TS3A 1UE5A 1A3TA 5ELNA 2CWPA 2PQAA 4R1JA 1QVGA 1AFPA 2KEDA 4PG3A 4K6LA 5C4JB 1AEXA 1FIQA 2FHTA 2O6VA 3I4NH 5AEKB 1PHJA 4JI5Q 1WJ4A 2VUMB 2XBBC 4ARIA 3S1NH 3S16H 3K8AA 3VDYA 2DGYA 1RTNA 4V0BA 4YL8A 2PMZB 4QL5A 3V3XA 4TUUA 1WTXA 3RD4A 1N61A 3NPPA 3AE3B 1EOTA 4N9TA 2AL3A 3RZOB 1SIFA 1O7ZA 1UGMA 2Q8RE 2BH2A 3VUWA 2OTLA 1YNXA 2J4XA 4MIUA 1WGYA 2EKIA 3ZTDA 4LF6Q 3M4PA 5CYUA 1B4OA 5I4DA 3AN1A 4X57B 2WXOA 1VD2A 3KK7A 3H0GH 3AE1B 4FADA 4JBMA 2Y5BB 5C4XG 3ONAB 1L4DB 3HOXH 2F0VA 1XF5L 1V81A 4GMVA 1F9PA 4OIJA 5EBDA 4JI7L 1WX9A 1JMCA 2WX1A 2N8NA 1B3AA 2F0LA 1C3TA 5IE8A 4R8IA 2K4KA 1NTGA 2EPBA 4C3HG 4V190 3U8ZA 1JQYD 1KXLA 2CR5A 2RSOA 4H0LC 4NNJB 3H3VH 1V43A 4MACA 4B9KA 1Z7TA 5H1SE 1WCMB 5AZGA 3P42A 4E3CA 3F2CA 4XQQA 4TSSA 1FVIA 4P73A 3U9OA 4DV4Q 1E8ZA 3NG0A 3TBIB 2UUCL 5BMGA 1B3QA 3VYSA 3L2PA 3T3OA 1OO9B 3CQZB 3MEHA 1PFBA 2B3GA 2EKEC 5HKHA 3PIOA 1FYCA 3NQTA 3FMCA 1BDOA 3ETRA 4KGSA 4RMAA 2MJDA 3DUZA 1SLJA 1FMAD 1IGDA 1JORA 1UZXB 2KQ3A 4A3FB 3AE8B 4W9JA 3OW2A 2HCCA 2VUMH 3SK8A 4YTPB 1L2NA 4DR3L 4LNQA 4CQNA 3SR1A 1RL2A 2R92G 3JSVA 4CYEA 3A8JE 5K36H 4B3MQ 2ES2A 5L95C 3HEJA 1W3SA 1NAPA 2K3UA 4L1BA 2OJRA 2MJ8A 1OQRA 2KOXA 3M4QA 3M4YA 1G2TA 3B1LX 3I5JC 1XNQQ 2C5CA 5EPLA 4MELA 3ABVB 2ZEQA 2AHOB 3PRPB 1E2WA 1SYDA 3I4NB 3IBEA 4XYCA 3RZDB 5KYLA 4ZUIA 3JAMc 1TKGA 4WH4A 3QB3A 5K5PA 1V97A 1YIWA 3WALA 3FPPA 1G2SA 4BY1H 5EKKA 2K5DA 2X69A 4HR7B 2BF8B 3X3MA 3AE9B 3K0XA 3I2ZA 5EKLA 3ML8A 2JA9A 2AQ3B 3N1XC 2QC8A 1AW7A 1UE1A 2DY7A 3TEHB 2F0DA 2WFWA 3M7GA 3A9KB 1KQSA 3AH7A 5D7GA 3SGIA 5DPRA 4DV7L 2UU9Q 2DAFA 3H9DA 1A63A 2A69C 4L5SA 2KDIA 4ANUA 3L13A 3AE4B 4OO1H 3TREA 3DVNV 2DYOA 5EE3A 3UE0A 4BXXG 1NNXA 1IYUA 2QHOA 2PI2E 3AMZA 1QB5D 4OHJA 2R3ZA 4FYDA 4A3GG 2LUEA 3MXNB 1IW7D 4US9A 4K3BA 1JR0D 2XWJB 3QOLA 4MTNA 3CCSA 4HIDA 1ZXHA 2LMCA 5T8IA 4A3OA 1QOGA 2N9XA 2LJ5A 1YVCA 1MSHA 1P3QU 2H88B 4KKIA 2ON8A 3DM1A 4R4OA 5LMNQ 1HZBA 3HOWB 3HOZH 2L1AA 4LTUA 4F1SA 1IW7C 2A5HA 4RGMA 4DR5L 2INNE 3ER0A 5FLMH 3U4VA 1YITA 3AEDB 4X3SA 2PO4A 3S16B 3RNEC 4A9AA 4A3GB 2KQ7A 2L3ZA 1TY2A 1OQYA 2F0FA 1TZOA 3I63C 3MA2B 3NTKA 1BCPB 1HNZQ 3BINA 4A8XC 5EPJA 4DV0Q 3UQAA 1HZAA 1IHZA 1X65A 5JPMC 4KMUC 1XLPA 4POFA 3PZ7A 5EE0A 3T13A 1OTRB 3H91A 2LXAA 3WWVA 4GKJQ 4KHZA 3AB9A 2DZJA 2VXWA 1ACCA 1FR3A 3JAML 2QEJC 2WS3B 3H94A 2VW9A 2LGYA 5H8YE 4IUVA 2B3AA 4BVUC 3AE2B 3MEFA 1TQOA 3S9WA 3HOVH 1L0XB 1KF6B 1K0RA 4GDLB 1WFQA 3R7QA 2Y0SE 2UWQA 3M3YB 2IJ0A 4J8QA 2G1EA 1LACA 1AE3A 3OLMD 1GAQB 1EEFD 4JC0A 3I4NG 4N58A 4KD4A 3PIP3 2HCIA 2OXPA 1HNXL 3J7ZC 4C80A 3H09A 4KVGB 3V61A 3KJPA 3AEFB 4PS8A 3GS2A 3KLWA 3IHPC 1SE3A 3OYYA 2PKOA 2BTEA 2JQOA 2K5PA 1WTVA 2B76B 3HKZG 2I46A 4DV6Q 4BWGB 4F7XA 5FOBB 1I94Q 5ISRA 2OHFA 1WYDA 4JI8L 3VR5A 1PH8A 1K9MC 1DJRD 1S3SG 2GN5A 3APFA 2KD0A 3N9YC 2HHHQ 2ZJDA 1AARA 2Z1CA 2D5DA 3WOEA 1GVPA 2KDMA 2L9HA 1S3OA 1YJIA 1T0YA 1NR2A 4LF5Q 1F2RC 2ZTDA 4NJ6A 4IM0A 2KYWA 5FO7B 3WDNA 4XGAB 3Q69A 4X6AH 2EIFA 4TRDA 3T53B 1UH6A 4KJNA 4K1RB 3SHQA 1JWSD 4G4KA 4YSXB 4MM3B 2FBWB 3KUCB 4ME3A 4HJGE 2IHEA 2SOBA 4DR1L 5A2QE 5EKIA 1VQGA 2KWUB 3CC7A 3I3CA 2WLBA 4AP4C 4P71A 2RDFA 4Y7NB 1J5EQ 1X9NA 2JQRB 4HDQA 3RD2A 2XGTA 1CUKA 2XRQD 3RMHA 1SYEA 1X54A 3S14H 4II3B 2KAJA 1D1IA 4MZ9A 1C77A 2F4IA 5FLXL 4C3IB 3M3JA 1ML0D 2K50A 1TS2A 3NZSA 2KCMA 3R2TA 4DV4L 4KTAA 4M00A 1YNJC 1JJ2A 3A56A 1KLVA 5IWAQ 2B8FA 5KYIA 3Q3FA 2XNAC 3I91A 1FCLA 1GUSA 4WIPA 3PO2H 2BS2B 1SNPA 1JWMD 1V9PA 2PVGC 3ZDTA 4GDLA 4NMZA 4BOSC 5CGKA 4XT1B 2EMTA 1BO0A 1N34L 3S1QB 3VR6A 4CGYB 4DAVA 3PUVA 4DR7L 4B3RL 2UXCQ 3EHVA 5C23A 1L7YA 4B3TQ 2I1KA 2KX0A 4B3ML 3AEVA 1EY9A 3S2AA 2X38A 3S17B 5JJZA 4A3EG 2IO1B 1D1KA 5IGDA 4HCSA 3UE1A 1EFID 1LO5D 3CP0A 4HPLB 4OELB 1V49A 1G6JA 1NVID 1GC7A 4OVUA 2PZWA 5J39A 2J7ZA 2WXLA 3CRLC 4IFDG 3S2HH 1E6EB 2PI2A 2RR9A 1E2VA 2LHDA 4MHEA 1UWVA 1VQOA 1JB3A 4LUVA 1RHPA 2KTRA 1EYDA 2KWDA 5LNK1 4QY7A 3G6EA 2ZCBA 2AX5A 3K5NA 4ZK9B 2JZZA 4IO9A 4DUYQ 2QW7A 5ELOA 3T1YQ 1PH2A 3EROA 2KMAA 4A3KH 1FPYA 1UUPA 5G3LF 3GTKH 3FPUB 4FHJA 3AMUA 4GOPA 2CQAA 4XC2A 1TWHH 1IBKQ 1SNCA 5M5YH 2N9KA 2OWOA 3TDQA 2AUJD 1VZ8A 5J3BA 4CJ0B 1SMYC 1QE6A 1KOTA 3ICEA 2N7DA 1N9WA 3LJ3A 4DPGA 4A3BG 4YWGG 2UXBL 1D3ZA 1PUTA 5AUKA 4LFCQ 3LWUA 4LWCA 3ZXVA 3A9KA 2AYOB 1BCPF 2F1MA 3PO3B 2F0PA 4NPNA 2HDMA 4CKEA 3CPWA 2OOBB 2PLPA 3STBC 1D6EC 4HK2A 4DUZL 5C5MA 4NQLB 3VQIA 4JI4Q 3KF6A 2F0GA 2LXKA 4M01A 3Q14C 3T16A 4LNFA 5IP7G 2JXMB 2JA7H 3J80L 1HNZL 2IHFA 3RYTA 2W9NA 1GNUA 2O5IC 4BY1G 5CHWA 1LT3D 1IL8A 4DGZA 1OGWA 3P4SB 1PYSB 3KDFA 2E2HB 1QZEA 1Q8KA 4K8IA 3URYA 4GKJL 1HTPA 4M8AA 3LWEA 4B6WA 1JCKB 3VYUA 2VY3A 4H7BA 2KMCA 4OL7A 3K7AB 4FF4A 5GROA 3WOFA 4BBNC 2Q2IA 5FLXE 1ONLA 1A70A 1HZ9A 4EUTA 1YN3A 4OWWB 3PV0A 4P7IA 5AJ3L 1WZ0A 2IY0B 2J52A 4NJCA 3IT4B 2NVYH 1CSPA 1TKEA 3F8TA 4RM9A 2K5HA 4NXNL 2Z8LA 3T8MA 1KAWA 5I2YA 4YY3L 3F1ZA 1I6VC 3L4PA 5CHFA 4N6EB 1I4GA 1OFFA 2ZTCA 3JSVB 4XDXA 1BBXC 2YV5A 4X64L 1OXXK 3H7SA 3RT3B 4DKAC 2LASA 2SDFA 2C9OA 4JI8Q 5KNCA 1C4PA 3HOXG 1X56A 1ENAA 3KW5B 3A9JA 3ZXRA 4ZRJA 3NOBA 1IBLQ 2LY7A 5FR6A 1EY7A 4HPMB 3IRBA 4ODGA 3ZYYX 2GB1A 4CO7A 3T9LA 4DR2L 3N3KB 5ELDA 1KLGD 2Z9HA 3K6OA 4A93G 4GN5A 2RQXA 2NTTA 1AWDA 3J7A5 2R6GA 3CWIA 4O2DA 1N8RC 5E6NA 3R8BA 4GOPB 2GBRA 4C7ZA 2JRIB 4I7ZC 5C4JH 1J7AA 4L63B 5IYCH 1XMOQ 1YOVB 2WWZA 4RF1A 2WIIB 1SN8A 2ZVOA 2K05A 2ALYB 4O42A 2D07B 2NBVB 2L7RA 1JRUA 3NZUA 2KA7A 3JC66 2K6QA 2OEDA 5C3XA 5EBCA 5CMDA 1TWGH 4NB3A 2M0AA 2ONQA 1QOBA 2VZKB 3IFTA 2QGQA 4K8JA 3MAQA 2E5LQ 2A68C 4A3MG 2LGIA 3HVDA 4IDIA 4NW2A 2BVCA 4MSMB 1PYWD 1EY8A 5T1GA 3QQ8B 5J18A 5E6PA 2D0OA 2GLSA 2L05A 5C0XJ 3IKJA 3PRZA 1SR3A 4WFN3 3P1MA 4XYQA 1Q81C 1O7IA 2CKZB 1NDDA 3A5UA 3IXSA 4G50A 1TWGB 5C3EB 4AUQC 4HJAA 1FL0A 4C00A 5JHBA 1EIYB 1UBQA 2KDEB 1EZ6A 4TKNA 3U7DA 2NS5A 3EN2A 4PMCA 1PFDA 2EDGA 1V5OA 1BQQT 1YX5B 4DR7Q 1B8AA 4B3RQ 1QOAA 2LFNA 1ASZA 2VQFL 3L0WB 3PHXB 4GIVA 1VQJA 4W9IA 4MTKA 4DK3C 1J7BA 1KRTA 2WKCA 4XT3B 1QILA 1CTMA 1IYFA 5AFWA 2BQQA 2FIFA 1WTHA 4YT0B 4JX1C 1X55A 5I9OA 3GTGH 1YNND 2I5LX 4DV5L 1K8GA 3HKSA 2JT4B 4X3KA 4U673 2RDBC 1DXMA 3OMGA 1UELA 2RVLA 1SYFA 4ZLTF 1EF1A 4ZKCB 2KC2A 4LJZC 3GE3C 3RMKC 4A6QA 2ZJQA 4AWJA 1I50H 4HIOA 3B2FA 2MHVA 1HUMA 1OXUA 3Q23A 1QCBD 4LF8L 4OONA 4HCNB 5M5YB 4XWWA 2EMSA 3W1SC 3G71A 1KABA 5IGGA 5C0XI 4CKCA 1PH6A 3RLNA 3VA7A 1E8YA 3RI7C 3T1YL 1WYWB 4W9KA 4HMIA 4US8A 4AYBG 2WXPA 4IJHA 3DEPA 2YLMA 1GO3E 1C48A 5CHVC 1NUCA 3N6RA 1VQHA 2F4VL 3CSTA 3SFDB 5FJ8H 3I55A 4DFAA 3FDTA 1YMHE 1IXRA 1MG4A 4RGTA 5IP4D 4PMWA 2B2TC 4GSWA 2EYHA 2ZNVB 2BYVE 1K0SA 3ERSX 2F0TA 4KIKB 5G3LD 4DV3L 1JWAD 3ZLZA 3DEOA 2HD5B 3DBRI 1OEYJ 3ALBA 2V3SA 4BOZB 4ZAIA 4DHZE 1Y1WH 3PV1A 1U0LA 2MBHA 2WB1E 1ZKHA 1XNRL 3I9V1 1HFGA 3VRAB 4EQOA 1P16A 3KYCD 1WI0A 2A6HC 1X3FA 1IZ6A 1Z6HA 1NY4A 4KKTA 1YJ1A 1UAPA 4WJWA 2LGXA 3OW7A 1XLQA 3QJYA 5IAAC 5I9PA 2EZVA 4FJZA 4IUPA 2ZVNA 5FO8B 1Q5WB 3GTLH 1AP0A 4UDUC 2XTIA 1FRDA 3Q3MC 1CK1A 1VQKA 1F2LA 2IX3A 5C2TB 4KDIC 4CHTB 2WU5B 2F0JA 3PIPA 5JAVA 3C2PA 4BBSH 4JI7Q 1RIPA 2JA8H 3S2DB 1NENB 2C7NB 1SB3C 3L17A 1YI2A 4FLHA 3DBLI 4IW0A 1XTCD 3TZDA 2X8XX 2GVAA 1H9KA 1Y1VG 2BDNA 5DEHA 1LV9A 1YHAA 1STYA 4ULLA 3B2GA 1H9SB 2VUMG 1F9RA 2D3GA 1N6ZA 1HRJA 2N9PC 3SDLC 3VRBB 1KC8C 3Q24A 1LTRD 5JJKA 3NWTA 2ASQA 4LFAQ 2NTSA 4FF1A 1JRPA 2Z6KC 1EQVA 3MC9A 1XTDA 2MBBB 1MHWC 1EF5A 2WXHA 2JSOA 2WAQG 3ULJA 2JK8A 2GRIA 1GOZA 1VQ7A 3VH4B 3A7AB 5BN5A 1I3QB 1C1YB 3PUWA 1TWCH 1F1HA 1TU2B 4TQ0A 3J80E 2YYZA 2RSNA 2DX5B 1LTID 4KGTA 3RNAC 1MIUA 1EUJA 3GD7A 4GKKL 2N1VA 4E6IA 2N9EB 2CQOA 3PS6A 2MP2B 1IYVA 1BNZA 4RM8A 1K8OA 1UE6A 3VVWB 3SE0A 2G3QB 3MXUA 2BWES 2NVTH 2Q2HA 4LF7L 4A3CH 3C46A 2KK8A 1EYAA 5A2QL 2MRPA 4DV1L 3WAOA 1ASYA 1Y1VB 2OEOA 1YEZA 1JB7A 2F03A 4A55A 4AS1A 5BO4B 4I6PA 1X3PA 2L0CA 2EXDA 4YSYB 1F0ZA 4XDCA 4FNFA 2B39A 2WHIA 2WXMA 3IVFA 3V6EB 5EGTA 2D10A 2V4IB 4JV5L 4HVBA 2CHBD 3DHQA 4ME5A 1F2MA 1UE7A 1UEAB 1CZGA 1LT4D 2KX3A 2CJNA 4EKUA 5MPOA 1FNVA 5CV5A 1WIAA 4HEDA 4B9XA 2N7JA 4TQ1A 1WH3A 1WSPA 4DNRB 1V1PA 4PV1C 3OPOA 1CZWA 1SIJA 3LDZE 1L2FA 2QA4A 3PSIA 1GUGA 2IDYA 1UWXA 4RGNA 1UEBA 2BYTA 2L52A 2N1WA 4DK6C 3KLRA 1H95A 2BE5D 5C4ZA 2G45B 4L2YA 4IOCA 1XPOA 1I6HH 3HFZB 1TT2A 2B2UA 2NCNA 4FA6A 1Z2MA 4A3KB 4HJKA 1ZUD2 2B8GA 2NBUA 4GZYC 3EFXD 3RNGC 2DWQA 4JW0A 3DQVA 3VR3A 5CTRC 3RNFC 1IYJB 4QF4A 3AU5A 1VQFA 1XXGA 3N1YC 1J8CA 5C5LA 1NYQA 1EFWA 2EQSA 2Q8TA 4PZ6A 1RYJA 1A5RA 3HOWH 2ZXOA 3HOZB 5GXGB 1UGJA 5I6WA 5EQ0A 3UI2A 5M3FB 2AWTA 3GE8C 3MXGA 4DV0L 3I57A 3DMUA 2WXNA 2UUAL 2J0MA 1Y1VH 4HXDA 3PF4A 2CWAA 3HZXA 3VUXA 4X65L 2E8GA 4AOFA 2F0NA 2GBJA 3KF6B 3PCOB 2A74C 5IGCA 3SK5A 2IZVB 3ZNGC 3P4RB 5CX3A 2N0SB 1GB1A 3S17H 2JA5B 1C0AA 1YN4A 4HIMA 1A2UA 1TJEA 4YIJA 2CH4W 4Q5VA 3KYDD 4P1BC 5M3FG 4EOYA 2VRRB 5CBAE 1B1ZA 3T1HL 2RPVA 4IUTA 2RD0A 4IUUA 3OTOQ 3AB5A 4Q2JA 1HNWL 1L0VB 5E7NA 4A3IB 2QILA 3E3XA 3I72A 4WURA 2G9HD 1RWSA 3N32A 1KDAA 1S4ZA 2EJGC 1PH3A 3NELA 4LF9L 4HTHA 2FE8A 4DV6L 3D32A 1L0YB 3MC8A 3Q8FA 4C3IH 4OX9Q 4DV3Q 1K51A 4C3HH 1NE3A 4IWOA 3MZ5A 2PPHA 1PRTB 2LVPA 4LF4L 2UYZB 2ZM6Q 4WWNA 2HHHL 2WDTB 3U2SC 1PFNA 1E3PA 1JOQA 4DR6Q 3GV6A 3ULPA 3H6MA 4A3MH 1IPGA 2DHZA 1XNRQ 3B9JA 4JI3L 1MGSA 4DXGA 4B0MA 1SMXA 4I6NB 2SAKA 1LABA 4X66L 3CF5A 3K57A 1SF0A 3D4WA 1X3GA 2MSED 1EZ8A 5KEEA 4EE2A 4DDID 3L7ZC 1D2BA 4K2LA 2IYDB 4YTMB 2C35B 3BDLA 4EQ5A 4GXBA 3CCJA 2Z4IA 2F0SA 2MO0A 3BZKA 2JYTA 3BYTB 4A3LH 1K53A 4W9GA 4USAA 1QLBB 2LSSA 5IP9G 1SYBA 3FKIH 3PUYA 2IO3B 4KK7A 4DV2Q 2P5ZX 4H44C 1TIID 2NN6G 3ZJYC 4HJ9A 2UXDL 1U4MA 4P16A 4EZKA 2MP1A 2D3CA 2Z4HA 2N3SA 3RN5A 3PZDA 3VH3B 4EEWA 1FJGQ 2WP9B 3KUPA 1O7LA 2ZXRA 4BKGA 3QG1A 1XWEA 5IO9A 3NHHA 5CBEE 4DR4Q 1I4HA 1IBMQ 1RLFA 3A54A 4A3DH 2NPTA 2CHXA 2QDFA 5CR3A 4PNYA 4P1CC 1PTOB 2BYFA 2JZPA 2HQEA 5I6YA 2RSUA 4KY5A 4LMQD 4NKLA 4O0AA 1LTBD 4TVAB 1H8CA 2TMPA 1II3A 3ITPA 3J81j 1I4PA 2NUCA 3V96A 1T0RC 2XK5A 5EDSA 2UUBQ 1GB4A 1GUWA 1EWHA 1KH0A 1S72A 3TP5A 3K5OA 4GNXC 4BY1B 2HJ1A 4B3TL 3L3OC 3BDCA 3Q3OC 4HJ5A 5JH5C 3EVQA 5DPWA 5KHOA 4LNIA 3QWZB 2WGSA 1MG8A 2K25A 5HFYA 3J81L 3F2DA 4B95A 2LHEA 4BY7H 1DGJA 4GN1A 3Q22A 4RAUC 1UD7A 1SYCA 4A3KG 3W1GA 3Q8DA 1M94A 4A93H 3HM6X 3HUIA 3NBIA 5L37A 4EQNA 1J19A 4GS3A 1QWYA 2QDLA 2JWZA 2RCNA 5D94A 3D3RA 2YU9B 2MP2A 5D3IB 1QKZA 3Q8BA 5IT9E 1DZ1A 1YQ4B 1FO4A 1BF4A 1K73C 1WE6A 2JA8B 5E1FA 5CC4A 3FEWX 3C1FA 5BR8Q 4FXGC 2A1AA 4GDKB 1LTGD 1CKMA 1SBBB 2K0PA 2RMMA 1G8ZD 3LYYA 2LXCA 4AJYB 3PUXA 4HSVA 4IN3A 4IKGA 2QDBA 2AQ1B 4MGZE 2F0WA 2I38A 2JA7G 3BK2A 2DZMA 3EC8A 3MHZA 3V60A 5JHAA 3SR6A 5GAGC 1SXTA 1BOSA 2IGHA 1KLUD 1VDVA 4ICVA 1P7EA 1SE4A 5CV8A 1I4XA 1E22A 1XCQL 3W5OA 4A3JH 4EFOA 2KENA 1XLOA 3T3NA 3ENEA 4DUZQ 1V1PB 2XN9C 4JIOU 1EWYC 2KWCA 3ZNID 2IO2B 4FDBA 2JX5A 4UY8C 4HDOA 1HTOA 1PDXA 4KLKA 2MWSB 5FR3A 4A90A 4QUCA 1PH7A 1G291 3RNUA 3CPFA 4P74A 4OWTB 3RZDH 1BMLC 4C7YA 4LNNA 2F0KA 1R9TB 3OOCA 1YZ6A 2C9WB 2CFMA 5JVG3 3Q6SA 3APDA 2Z0SA 1K8MA 4QGUA 2EYLA 2FFKB 3TEXA 2L5TA 3W2DA 3K0YA 4YCVA 2NN6I 1P8LA 3RNBC 3TUOA 1JWBD 1CHQD 1FNWA 1B50A 3D31A 4HJ8A 1F9JA 1FXAA 5IKCM 3QOJA 3R3MA 1E9MA 5ELBA 3HOUH 4WWPA 1WVLA 3AE6B 2HQLA 2JA6B 3S15B 4AQ7A 2SNSA 2AWOA 2K5VA 3HOZG 2Z59B 5M5XH 1M1KC 1OTCA 5GMVA 2H1EA 4A4IA 3EGRA 1PZKD 2DN8A 1K83H 1HZCA 1WCMG 1E5WA 2XK5B 4PYZA 5G5HA 3W9CB 4ZHPA 2L15A 1HTLD 1HNWQ 4A93B 2IT1A 4FXKC 1YBYA 4F87A 3GTMB 3E0JA 2MA9B 3IFWB 2K33A 2ZT9C 3U58A 4UP9A 2C7HA 5IGFA 1J0GA 4DHZB 1OQQA 2NBWB 3VTVA 4BY7G 1N33Q 4LF9Q 5LL6X 3TCAA 5M5WH 4GLXA 2GBKA 2WDQB 3A8KE 3PO0A 4A3FG 3BIID 4I6LB 2A69D 1S5DD 4H02A 4RMFA 1XEEA 3IAM1 5IIFA 3TS2A 1EU4A 4DR6L 4S17A 1FFVA 2V3NA 1JALA 1SSNA 3M95A 1WXQA 1DOKA 4ALPA 3VHTC 4JI3Q 2VB2X 2JPHA 2SEBD 4PZ7A 1DOXA 3IAYA 2C7MB 1EYGA 3DHHC 4HAEA 4DAPA 2GMIC 3BG3A 5IODA 1E24A 4LW1A 3O65B 1E0BA 2JYOA 3FC4A 1KHIA 3CMAA 3QIJA 5KHQA 2MO1A 1R4MB 1XQQA 2M0XA 4S3SA 2NN6H 4DA2A 3NVZA 1ZGUB 2CW0C 1L4ZB 3EFUA 1SNOA 1KNAA 3CCRA 2KBNA 4DR5Q 1WY8A 1EQQA 2R93G 1BCPC 1ICWA 2KNBA 4A3EH 3NVYA 1VQCA 3LGJA 2UXDQ 2M4NA 3TMPB 3RZOH 2QF7A 1SFOB 3VR4A 3PLVA 4J1MA 3RULA 5E4XA 5IT9c 2B2VC 2E5LL 4XIGS 2F0QA 3PO3H 3WIMA 1D5XC 1KL9A 4ITKA 1HPCA 3FKIG 4APVA 3K9PB 4C1NK 3SHLA 3P2BA 2KTRB 1WGRA 4FJVB 4WAFA 4LK1C 5C3JB 1C9FA 2BYEA 1IBML 1WXSA 5KNBA 3RN9C 2LS01 2WB1B 4R4CA 1UBIA 3NHEB 4MN3A 4P72A 4G11A 2MQJA 2B2WA 1WOCA 2BPSA 2LGSA 2PJHA 4WJQA 4GNXA 4DBGA 2K01A 1N63A 4HCEA 5FKAC 1KRHA 1G91A 1SJHD 3B6YA 3I56A 3DBRB 4LK0M 4EGVA 1D8LA 2BB6A 5IYDH 3HOUB 2MBQA 2AKWB 1PH1A 3KYHC 1L0WA 2FCMA 4H2AA 2FUG1 4CDFC 2KACA 1H9RA 3Q6BA 5IGEA 1IBXA 2H4OA 1W6KA 4IUQA 4TV3A 4RCNA 4JQWC 5D2MB 1OXSC 3LXFA 2F3IA 3RPFC 3KUDB 1SE9A 2N78A 2R7FA 2JN4A 5A35A 4XYOA 2JSVX 3TL5A 1JJCB 3H0GG 4QIWB 4G7OC 1I94L 3E56A 4P75A 3GTPH 5D6JB 1LGRA 2HDLA 5E6JA 2Y5CA 1WR6E 4QUFA 2OQKA 3NVWA 1ESFA 1IBXB 1B9RA 2L1BA 3A55A 3HOYH 2K32A 1LXDA 5H92C 4K5XA 4WQOB 4A3JB 1KRSA 4BA1I 3IG3A 3U9SA 5M3MG 3S1QH 3K5LA 3KVFB 1KTKA 4KKJA 4C4VB 4JBKA 3A0JA 2PQEA 1GJXA 4ASWC 2LI5A 2L8JA 3J7AF 1XD3B 1Y1WG 2MBOA 1HUNA 3CCUA 1B53A 3WANA 1E7PB 2KHSA 3CRKC 1CA5A 3OJ4B 4N8FA 2D62A 1NBFC 4IPCA 1EUVB 3HRZC 2OQ0A 3DM3A 3TSSA 1GXDC 4JI0Q 4B3SQ 3H7PA 4WWOA 2MBEA 3VR2A 1YJWA 1IGCA 5C4XB 1WM2A 3MTNB 1N60A 3AECB 3NUHB 1C9OA 3GP7A 1U4LA 3NEMA 1FFUA 1C4CA 1RAXA 1XPUA 4KHPL 3SVMA 2G4SA 4C3JB 4C3JH 4A3MB 2K5QA 4FP5D 3AEBB 1DCZA 4PMBA 2E2DC 5IWAL 3PF5A 3H7PB 4URKA 3RLOA 3NP8A 1C4AA 2DYBA 1S5BD 4HIKA 3S1RH 2K6AA 4NZLB 4RA8A 2KVMA 1TBEA 5IOCA 1JQ4A 1R4PB 3GTOB 1N32Q 4FHKA 3RR5A 1E10A 4R4QA 3KBGA 3QARA 3WAMA 1GUTA 5JEAG 2LKVA 4FXDA 2NWGA 3CMMB 1XNQL 5C3WA 2QSDA 2VS1A 4HCPB 2LXJA 1MKHA 4BAXA 3KFUA 4QB4A 4BBRB 2EYOA 4R3DA 3VR9B 4IPDA 5EE9A 4DWFA 2H5XA 4L5QA 1XJVA 3J81E 3LB8C 4HWIB 1IL2A 1Q90A 2CVRA 2NVQH 3DVGY 2HD3A 1TT5B 4GLVB 2D5GA 1N33L 3R2IA 3S2HB 2KVZA 4IWQA 2LGDA 3EECA 1QZHA 4CJ1B 3UDGA 3DOWA 1JMLA 1C8CA 4IM2A 1WI5A 1FEHA 2BS4B 4W9CA 2Z0EB 1KFYB 5JVH3 3BVMA 4DNTB 3KJOA 1V1QA 3CSFA 3NS8A 4MGKE 3H3VC 2L4NA 3L0OA 1RFKA 1SDFA 3FKIB 2INDC 2W3RA 3BWUD 3TJPA 2BS3B 1V5TA 4YWKA 1N5WA 3C19A 1P0RA 1LM0A 1SGHA 4WAAA 4JI1L 5C0XH 4HMJA 1X1MA 3VXWA 4ANVA 1F2ZA 5JPNC 4NXML 2A6ED 4W9DA 1RCVD 2LZ6A 2SNMA 5LMNL 4C1NI 1STAA 1K3BC 2FCSA 4LJPB 1QOHA 3CF6E 4R8NA 1WTWA 3UF8A 3M4OB 2MH7A 1DONA 3BVGA 1MVKA 2EXZA 2B2VA 4BA2I 2KCTA 3VFKA 2G9DA 3HVZA 5ELFA 2MX2A 4JV5Q 5BMHA 3FRPB 2YEPB 5C4XH 2N49A 4ZRPA 5LXHA 1UNSA 2R92H 4IFDI 5FLMG 1UF0A 2BCOA 4WORA 1WM3A 2E2JB 3W5UB 3PREA 1ILPA 1EY5A 3T56B 2KFJA 2ACZB 4FXCA 1EYCA 1TWAH 1ENCA 4ZRZA 2W54A 4LUZA 4G7ZC 2VL6A 2K22A 2R2OA 4JK1C 2R61A 4PZ8A 1BT0A 2HDEA 1C79A 4CHKA 1LTAD 2MUYA 3QHTA 3R3OA 2BT6A 4W9EA 1LM8B 1U4PA 2NZOA 4BKTA 1CSQA 1TWFH 3UINB 3PHWB 2KQSA 5LXIB 1BCPD 1XO3A 5IT9L 5AJ3Q 2IO0B 1ISNA 1Q1BA 2PZTA 1R4MI 1YJJA 1Y1WB 1JWUD 2F0EA 4G57A 4ZUJA 4HEA1 3C3LA 4A3BH 1CI3M 4N9PA 1MJDA 3DBHB 3G48A 3P4PB 1Z47A 2KKCA 3LNNA 1T5XD 2IGDA 4IQZA 1H9JA 1GG3A 3MXPA 2L83A 2GBMA 4W9LA 1CZPA 2PW9A 3HRDD 4IPGA 1HR0L 2E6XA 4X65Q 2WDRB 3NS1A 2ZJRA 1U4AA 2NVXH 2WXKA 4IFDJ 1V1OA 3ULLA 4GN4B 1A6XA 2V4DA 2ZCCA 2B2YC 1SNDA 3GTPB 4EZLA 3DBLB 2PYKA 1MBYA 5E6OA 1DM0B 2W3SA 5CV4A 2HIVA 4YCWA 4AYBB 3K9OB 2DLBA 2QJLA 5HG2A 3VAWA 1BBWA 4M8NA 3HOVB 2K14A 1WXMA 1VZ7A 2QCPX 4DR1Q 2DUDA 2RBMA 4FULA 1WYGA 3I7FA 5C4HA 2VQEQ 2O6VD 1I50B 1TY0A 2WP8J 4K7SA 1GC6A 3ZJTA 2X6GA 2RGFA 4OGQC 4CKBA 2BA0A 3CHBD 3DBHI 1J6QA 2J42A 3KQ4A 1PRTF 1ZXIA 3HKZE 4XQJA 2KFKB 3H8HA 3CXCA 1TR5A 3OJ3A 1JOKA 3FILA 3V2TA 3L9AX 5GQOA 2K04A 4KSLC 1T9HA 4W9FA 1LQBA 2K7VA 5I2XA 4BBRG 1FNUA 1EO6A 3ZO5B 1BXTA 1XLNA 4DXFA 1ZYRC 2FXQA 3F2UA 5LL6S 2BBCA 1VR9A 4N9F4 5KIXA 2CU1A 1SE2A 4REZA 4AQYQ 1KNEA 2F0MA 1V6EA 3DLLA 5HY6A 1VQ9A 1QOFA 5GAHC 2DNCA 1PTOC 1SNQA 4TKOB 1R4NI 1JJGA 2D11A 1HQMC 1LTTD 1G6PA 3BY4B 5IN7A 3FHWA 1DYQA 5C3EH 2L32A 3T51B 3J9CA 3R93A 4IG7B 2EYFA 2K1BA 1TS5A 2R7ZH 2NVTB 4KN4C 5FJ8G 2BDOA 4KIKA 3N1ZC 4QMGA 2ZTEA 5COYA 1NEKB 1XCTL 1C78A 4HJ7A 1GUOA 1XYIA 4KV6A 4RGOS 2FIDA 1VQAA 1CKNB 3X23A 4MM3A 2L11A 1GUNA 3PMFA 1CT1D 4M8MA 3N20C 4ZQ3A 2NZHA 1Z9FA 1P98A 1VQNA 4BS9A 5FK9C 1WJNA 4X62Q 1KD1C 1Q46A 2HE7A 4IOAA 2IGGA 4GOPC 1NI3A 1WD0A 4ARCA 1V9JA 4UP7A 3QAQA 3E9IA 5TR5A 3TEZA 4DUYL 1PH9A 1RODA 2QMTA 4H13C 2HTHA 2WAQE 3OMCA 4BZAA 2JF5A 5JZEB 2M17A 3C8YA 3GOEA 3PGEA 2MPMA 3SXHA 1MSGA 3ND9A 2DZIA 4DXAB 3ZNHB 4WJ3M 2V3PA 5C44B 2A8VA 1SE8A 1Q1OA 2K1FA 1RM6C 3VTWA 2LMCB 2A19A 2RA4A 2QCZA 2DAJA 2EELA 4A3FH 1E7VA 1E8WA 2KT7A 1GUAB 2WXJA 4KN7C 1K50A 5BYQA 4JI1Q 2PMVA 1F2RI 2N7EA 2YTVA 1M90C 2GBNA 3KF8A 2CH4A 1R9TH 1VJKA 3I4OA 2KFKA 2MW5A 1C76A 4EVOA 4KDLB 3ND8A 2L12A 1YJ9A 1RDPD 4M02A 2K6DB 5CV9A 4CBVA 4OVZA 2C5LC 3EQLC 2WXQA 4JI2L 3PTFC 2DY8A 3CCMA 3MJWA 1WCMH 3TIXA 2HIXA 1VCBA 1I42A 2GVBA 2D3AA 1BVSA 2JP1A 1DGSA 2WAQB 4LF6L 1O78A 2ID0A 4DAYB 1U4RA 1K28A 3HKZB 3B08A 2FJ2A 3NZ3A 4IM3A 4JWUC 1WJJA 1T0SC 1I4RA 1CFMA 3NBHA 1DOLA 1F77A 4II2B 1A0IA 1EL0A 3I4LA 3ZKJC 4NPSA 1PTOD 5IP7H 5M5WB 1GPXA 2EVBA 4QQBX 1QJOA 3RZWC 1Q10A 1ZP0B 4RFBA 3VYTA 1B44D 1HZ6A 5C3EG 4A76A 2KJXA 3GTMH 2K28A 1QF6A 2GI9A 2W82A 3NBHB 2EE1A 4I7AA 2LD9A 3UDXA 2VZKD 1CJEA 2YU9H 1STHA 3BVZA 5M5XB 1LLRD 1FRRA 4WWMA 1BBUA 5GAEC 5EE1A 4J3OD 1I35A 3AE7B 4LLGM 4EQPA 1QQRA 4HLEA 5DPTA 3BS1A 1MD2D 3H15A 2K52A 4K7UA 3QJZA 4KSKC 1VCIA 2K03A 3FKYA 1QNUA 3OIPA 4YWLA 1TKYA 2B2YA 3AFPA 4LFAL 1WE7A 2LFIA 3KLSX 2PEAA 1NMGA 3EA6A 3S1NB 4JYAL 4M1UB 1NR4A 1PH5A 2AEHA 2J7QB 1HR0Q 2R93B 3GTQB 1YN5A 2WQYB 4WJPA 3SDZA 3UIPB 4QAYA 2PNRC 4BBNF 1BR9A 2KVRA 2KDFB 4F7ZA 4C2MB 2XEWA 3NTIA 2REXA 4K5WA 1N34Q 2VH2A 1CQVA 1HZ5A 5LMNW 2MGSA 2Z0DB 2PE9A 3EUB2 4A3BB 3KDFB 3JAMi 1HE8A 4JCVE 2XRSD 3I8ZA 4R4IA 4DNIA 4P6VF 4TMAB 1U5KA 5DLQE 2WXGA 3MC0B 3MFGA 3U52E 4K6DA 3ECIA 3TP8A 1JC7A 1R4NB 1MPEA 1WGGA 2F0IA 1G51A 1ZKOA 3FP9A 5G2NA 4KZ0A 4DV1Q 2GOWA 4ZRQA 1EY6A 3HOWG 3L16A 3AFQA 4RF0A 1O7YA 3DDCB 1WF9A 3K7AH 3J80i 3P75A 2LJIA 1P9DU 1Y8NB 1WWTA 4QCLA 3G6JB 3KF8B 5E4WC 5J22A 1V2YA 2PZUA 3CCLA 1B70B 4NAWB 3E9SA 4XZ4A 2EY6A 2E2HH 2J0TD 4CJ2C 1E90A 4DAYA 1IP9A 1WGKA 3D4RA 5JJIA 1DOIA 3X3NA 3NVVA 3ONSA 4HRSA 5M3MB 2I07B 2JA6G 5TSSA 4IJLA 4OO1G 1QZGA 1SNMA 1WGHA 2L0TA 2WXRA 4NDXA 3DWMA 2KWVB 3NRZA 4KV2A 1IBKL 2I2YA 1ESRA 1L1OA 3CAMA 5C0XG 3PPAA 2WDVB 3APCA 2RPQA 1PFSA 4ZRKA 2DJFC 1B9MA 3D8GA 1MJEA 3ZJVA 1Q1EA 2PIAA 3HP3A 2L00B 1K3RA 4EX5A 4IOIE 1WXAA 2WNMA 4GLAC 4BY7B 1NBWA 2R7DA 5HI1A 2LRUA 2KJ6A 4MDKE 4JI6Q 1R7SA 1O80A 2PW7A 4DK1A 2DYMA 2QEXA 2M56B 4G7HC 1W2BA 1HXYD 3Q8AA 2NZ1D 4JI4L 4B0EA 1E1TA 2ZPNA 2K8CA 1X3EA 4UHVA 5FO9B 1TWHB 2LRWA 3V05A 3MWYW 3W1SA 1VQIA 4BFRA 4L5TA 1MFWA 4ZHOA 2OTJA 4IUMB 3NTHA 4Y7NH 3M63B 2KHJA 3U50C 3KH0A 1WTRA 1W6JA 4X62L 2LEKA 2UUAQ 5JJLA 2DZKA 1PYBA 3TQYA 2D3BA 3PGZA 4KI0A 3A4RA 3OWFA 1SSOA 3HGBA 2FMCA 3OG5A 1RJTA 3G4SA 1HA5A 1M4VA 1BUVT 3CCEA 1NJIC 1LYLA 1KIXA 1L6UA 2K8HA 2Y5PA 4QIWE 3GV3A 1QVFA 5HHDG 3N30A 1TKWB 1SEBD 1FGUA 3ERQA 4A3LG 1Z5SB 2CJOA 2ICIA 1C7YA 1MI0A 3GZNB 4A3IH 1DD2A 3KLSA 2KZRA 1A8VA 2RF4A 4UAIA 1Q3LA 4MT5A 4YHHL 4BKSA 5C1ZA 2F0HA 4KZCA 3E0EA 4DHJD 2PVOD 3HIZA 2R7ZG 4NXNQ 1PA6A 1XPRA 4FF2A 2HT1A 1FD6A 2F52A 1PDQA 4ZDVA 1TWFB 4KJOA 2JA5H 4PT5A 3AV8A 3MP9A 3HOYB 2CS4A 3TS0A 1EWIA 4OX9L 2FAZA 2JA7B 1FGBD 5HURA 3D4DA 4JI2Q 2ZZPB 4JL9A 4MGYE 1PMRA 4LF5L 1H9MA 3BU2A 1IKLA 2ATWA 4ACFA 2Y3AA 1RKNA 3RCZA 4F88A 2IY1B 3CW2C 3GTOH 4M0WA 2E2JH 1PVOA 3M3YH 3RZFA 4RHSA 2C60A 2PE6B 4L23A 3Q2AC 4DR2Q 1SJED 1E8XA 4X66Q 1T5EA 4FVMA 4MNOA 1VS0A 5LMUQ 1SAPA 3SK4A 3K58A 3QC8B 1PRTD 3ZIMA 2F0UA 3D6WA 2E74C 3M62B
chains in the Genus database with same CATH topology
1DOMA 2INPE 3S1MB 2KEEA 5KNDA 4F8MA 3I70A 2JE6I 1Y8PB 1PTOF 2PPBC 2F3VA 2AWNA 3J7YW 3JAME 2WXIA 1D5ZC 1N5XA 3MTSA 1VRAB 4X3TA 1KDCA 4A3EB 1ZDVA 5DAUA 1I7HA 1EIGA 5C6AA 2KMMA 2DNEA 1ZXTA 3NXWA 3U4EG 2JYEA 3VYRA 2N88A 2M00A 1WD1A 1VZ6A 2IPKD 1NYRA 3OSOA 4HSPA 3PZ8A 4ABNA 2KN4A 2FINB 4YSZB 1SMYD 2KCCA 2WINB 1I6HB 3GB1A 1A3UA 1FXIA 4NP5A 3AE5B 1XX8A 4XXEA 5E3FA 3DXJC 5D14A 5JEAJ 2O5JC 3E5SA 4RH6A 2WV6D 1NSNS 4RNAA 3MXNA 2B2UC 1MI2A 3MFYA 2A68D 1PGAA 1VF7A 1VF5C 4RHRA 4DQOC 2KOLA 5CV6A 1TYGB 2OF1A 3A7LA 4P2CB 4U68A 2AUKA 2WU2B 1OXTA 3I4MB 3I73A 2EYMA 3N52A 2WXFA 3HG9A 5F2DA 1ROEA 2B2TA 3RLFA 1LT6D 1AZPA 1WRIA 1TS4A 3TZUA 1HEZE 3ZQ4A 1TWCB 2XWBB 1A3VA 4N59A 3Q8EA 4RCOA 2PTLA 1JICA 3NK9A 4C56C 2MJ3A 2M2LA 3Q0AA 4KKUA 1EY0A 1HA6A 3KWVA 3WCQA 2H89B 1PXUA 2QKIC 4XQNA 4IFDH 3G7LA 4IURA 1PZJD 3EJIA 2IX1A 2A6HD 5BN3A 1QG7A 3OHXC 2XVSA 3CU7A 4KHVA 5JOBA 4BBSB 3M85A 5NUCA 4DN4M 1B2TA 1FCCC 1EQTA 2BA1A 2ZW0A 2IW3A 1X3QA 4XWTA 1LTSD 4Z9CB 1FD7D 2RDHA 5BMIA 1EEID 1SYGA 1AZQA 4ZOHC 4C3IG 3IT6B 2NVXB 2KCNA 1ZPSA 1BUIC 2WACA 5LHY1 2EJMA 5D65A 4L6TB 1IKMA 3SK6A 1ET9A 3TEYA 4WQMA 2BE5C 3AU7A 1STGA 3P20A 1B9NA 5K36G 1GHJA 3W3AA 3I90A 5JEAH 1WTQA 2R7ZB 1PTOH 3FAHA 2KECA 4ZKBB 3P63A 1P7FA 2QIEB 1Q12A 2VB3X 1YNNC 1V8CA 3IFDA 1YNTE 1T6BX 5CORA 5BYSA 2BB5A 1PGBA 4JBWA 1QNKA 3GQBA 1TWAB 5IGBA 2CW0D 3KBXA 3UI3A 2R92B 1I4QA 4JWSC 3GTGB 3SFEB 1QT9A 1F9QA 2J53A 4DK0A 4KGRA 1ZYRD 2F0OA 1GHKA 4DU9A 1JROA 1YQ3B 4KKSA 3OIQA 2EJFC 2MEKA 1S5CD 1Y69U 3ZGZA 1PZID 2XIWA 2RKSA 1E2ZA 2WKDA 1A2TA 5CV7A 5AUIA 3IAS1 4C3HB 2XSCA 3BK1A 4NAMA 1EU3A 4A3DB 2NVYB 1J9OA 5ELEA 1YNJD 1KAAA 1H9SA 4GLSC 5KGUA 3BYYB 1S5ED 1F9SA 1ZEQX 3CIRB 3NQIA 1WTPA 1CA6A 1LT5D 1HCZA 5ELCA 1STEA 2O2LD 2NYZD 1VMPA 3A8IE 4I65A 4ILWA 2M9VA 1KDBA 3BDOA 4LAAA 4RKLA 2Q5WD 2BOSA 2HUGA 2N55A 3PO2B 4OZBA 1RTOA 2K9XA 3FILB 2EYJA 2NBFA 4IUNA 3AEGB 1WTOA 2E76C 1DOYA 1R4QB 4OZCA 3S1RB 2E2IB 4R9WA 3DWPA 1EIHA 2M19A 3KWLA 4Q0FA 2ZW1A 4X3UA 3W5VB 1M8AA 2ZXPA 1VMCA 2F3WA 4KD3A 3BZDB 4PQXA 3QWNA 1ZE3D 3K59A 3C1EA 5T1IA 2AQ2B 4OIKA 3NWSA 1PFMA 2MJEA 3GTKB 4OW0A 1K52A 3J7AV 4ZYSA 2EY1A 1U9RA 1NCVA 4IZ8A 3GO5A 2O4XA 4XE0A 3QO2A 1G6ZA 3TEWA 3PIO3 1FM0D 1ZDXA 3P4QB 4RKBA 2W55A 2NVQB 4HROA 4JPSA 3FVQA 1HQRD 4D2KA 2A73B 1HFNA 1J8IA 1PGXA 4XDDA 2EY5A 5J1ZA 3O13A 1CQFA 5EJWA 1AN8A 1RF2D 2IWHA 3OWEB 3GTJB 1ET6A 3MVVA 3PUZA 1N62A 4B9WA 5M9OA 5DM63 1HHVA 2JEBI 2YEPF 1RD9D 3D6CA 2B63B 3VA5A 2B2WC 4DF7A 2RDGA 3S14B 1C4QA 2DBYA 5EPKA 2D2CC 4MH8A 1PLFA 3NUCA 3CKIB 3TMEA 4FF3A 1T3QA 1PRTC 2IX0A 2D9UA 5JXVA 1S5FD 2TSSA 3Q8CA 4L8JA 2E3TA 4OZAA 3SEBA 2CU3A 1VLBA 3TP7A 1VDZA 2EY2A 1F2YA 2JEAI 3AEAB 1D4BA 3DWAA 1A15A 1CHPD 3NSWA 3RFZB 3RUZA 4K14A 1EM7A 3K5MA 5DNFA 1L5PA 4K5VA 4IALA 3AEEB 2KUMA 1EY4A 2HTME 2X6LA 2LUMA 3LX0A 2IL8A 1Y8OB 4KX6B 4YTNB 1JOOA 2VNUD 1MHXA 4O1NA 2GA4B 1ILQA 1X32A 4ID6A 5HGTA 3NE5B 2EYPA 4J6HA 1ZOYB 4C3JG 5G5GA 1JE4A 5BN4A 2E75C 4B08A 1Y56A 2ENBA 3P1HA 3P7JA 3M7NA 4OO1I 3MJ5A 4TQUS 1K83B 3U7ZA 2EOTA 3TP6A 1JW9D 3GTLB 3TN2A 3T4AC 2FMMA 4YXDB 2PW5A 3AM9A 3VR8B 1Q8IA 1EWCA 4RWSC 2N9LA 1E0ZA 4K2KA 5BYRA 2PCFB 2OT2A 1L6VA 3QIAA 2Y0SB 4WRDA 2JU6X 4JE3B 1V8QA 4HKQA 1ENFA 2KQ4X 2JXTA 3DWQA 1UWMA 1MHHE 5KRUA 3HOXB 2A6EC 2L55A 3DWGC 3HS0C 4XTCS 2BW2A 3IL8A 3MHBA 2Q8IB 3H0GB 2NB0A 4HN7A 2K5WA 3E6ZX 1STNA 1J7CA 1TVXA 1D5MC 4FO2A 1OXVA 2NMQA 4HKZE 4KY6A 1AYFA 1STBA 4KY7A 2ICEC 3ZJUA 5D3DA 1IUEA 1CM9A 5DM73 2V0GA 1TS3A 1A3TA 1AFPA 2KEDA 4K6LA 5C4JB 1AEXA 1FIQA 2FHTA 2VUMB 4ARIA 1RTNA 4V0BA 2PMZB 3V3XA 1WTXA 3RD4A 1N61A 3NPPA 3AE3B 1EOTA 4N9TA 3RZOB 1O7ZA 2Q8RE 2J4XA 4MIUA 2EKIA 5CYUA 1B4OA 5I4DA 3AN1A 2WXOA 3KK7A 3AE1B 3ONAB 1L4DB 1XF5L 2F0VA 1F9PA 4OIJA 5EBDA 1B3AA 2F0LA 4R8IA 4C3HG 2EPBA 4V190 1JQYD 2RSOA 4H0LC 1V43A 4MACA 1Z7TA 1WCMB 3P42A 4XQQA 4TSSA 3U9OA 3TBIB 5BMGA 3T3OA 3VYSA 1OO9B 3CQZB 3MEHA 1PFBA 1FYCA 3NQTA 3FMCA 1BDOA 3ETRA 4KGSA 2MJDA 3DUZA 1IGDA 1FMAD 1JORA 2KQ3A 4A3FB 3AE8B 2HCCA 3SK8A 4YTPB 4CQNA 3SR1A 3A8JE 5K36H 3HEJA 1NAPA 2K3UA 4L1BA 2MJ8A 1OQRA 3M4YA 1G2TA 2C5CA 5EPLA 3ABVB 1SYDA 1E2WA 3I4NB 3RZDB 5KYLA 4ZUIA 1TKGA 4WH4A 3QB3A 5K5PA 1V97A 3FPPA 1G2SA 5EKKA 2K5DA 2X69A 4HR7B 3X3MA 3AE9B 5EKLA 2AQ3B 1AW7A 2DY7A 2F0DA 3M7GA 5D7GA 3AH7A 2A69C 3AE4B 4OO1H 2DYOA 5EE3A 1IYUA 3AMZA 1QB5D 4OHJA 2R3ZA 4FYDA 1IW7D 4US9A 1JR0D 2XWJB 3QOLA 5T8IA 1ZXHA 2LMCA 1QOGA 1MSHA 2H88B 2ON8A 3DM1A 2L1AA 3HOWB 4LTUA 1IW7C 2A5HA 4RGMA 2INNE 3AEDB 4X3SA 2PO4A 3S16B 4A9AA 4A3GB 1TY2A 2F0FA 1TZOA 3MA2B 3NTKA 1BCPB 4A8XC 5EPJA 1IHZA 5JPMC 4KMUC 1XLPA 3PZ7A 5EE0A 3T13A 3H91A 4KHZA 3AB9A 2VXWA 1ACCA 1FR3A 3JAML 2QEJC 2WS3B 3H94A 5H8YE 4IUVA 3AE2B 1TQOA 3S9WA 1L0XB 1KF6B 4GDLB 3M3YB 2IJ0A 4J8QA 2G1EA 1LACA 1GAQB 1EEFD 4N58A 4KD4A 3PIP3 2HCIA 2OXPA 4C80A 3H09A 3AEFB 3GS2A 1SE3A 2PKOA 2BTEA 2K5PA 1WTVA 2B76B 2I46A 4BWGB 4F7XA 5FOBB 5ISRA 2OHFA 3VR5A 1DJRD 3N9YC 2Z1CA 2D5DA 3WOEA 2KDMA 2L9HA 1YJIA 1NR2A 1F2RC 5FO7B 3WDNA 3Q69A 4TRDA 3T53B 4KJNA 1JWSD 4G4KA 4YSXB 4MM3B 2FBWB 4HJGE 2SOBA 5A2QE 5EKIA 3I3CA 2WLBA 2RDFA 4Y7NB 2JQRB 2XRQD 3RMHA 1SYEA 2KAJA 1D1IA 1C77A 2F4IA 5FLXL 4C3IB 1ML0D 1TS2A 3R2TA 4KTAA 1YNJC 3A56A 2B8FA 5KYIA 2XNAC 3I91A 1FCLA 1GUSA 4WIPA 2PVGC 2BS2B 1SNPA 1JWMD 4NMZA 5CGKA 4XT1B 1BO0A 3S1QB 3VR6A 4CGYB 4DAVA 3PUVA 1EY9A 2X38A 3S17B 5JJZA 1D1KA 5IGDA 4HCSA 1EFID 1LO5D 1NVID 2PZWA 5J39A 2J7ZA 2WXLA 3CRLC 4IFDG 1E6EB 1E2VA 2LHDA 4MHEA 1JB3A 1RHPA 1EYDA 2KWDA 5LNK1 2AX5A 3K5NA 4ZK9B 3EROA 1UUPA 5G3LF 3FPUB 3AMUA 2CQAA 1SNCA 2N9KA 3TDQA 2AUJD 1VZ8A 4CJ0B 1SMYC 1QE6A 4YWGG 1PUTA 5AUKA 3LWUA 1BCPF 2F1MA 3PO3B 2F0PA 2HDMA 4CKEA 2PLPA 1D6EC 5C5MA 3VQIA 2F0GA 3T16A 2JXMB 3J80L 2O5IC 1LT3D 1IL8A 4DGZA 3P4SB 2E2HB 4K8IA 3URYA 1HTPA 4M8AA 3LWEA 1JCKB 3VYUA 4H7BA 4OL7A 3K7AB 4FF4A 3WOFA 5FLXE 1ONLA 1A70A 1YN3A 3PV0A 2J52A 4NJCA 3IT4B 1TKEA 2Z8LA 5I2YA 1I6VC 3L4PA 4N6EB 1I4GA 1OFFA 4XDXA 1BBXC 1OXXK 2SDFA 2C9OA 5KNCA 1C4PA 1ENAA 2LY7A 1EY7A 4ODGA 3ZYYX 2GB1A 5ELDA 1KLGD 3K6OA 2RQXA 2NTTA 1AWDA 2R6GA 3CWIA 3R8BA 4C7ZA 4I7ZC 1J7AA 4L63B 4RF1A 2WIIB 2K05A 4O42A 2KA7A 2OEDA 5C3XA 5EBCA 5CMDA 2ONQA 2M0AA 1QOBA 2VZKB 3IFTA 4K8JA 3MAQA 2A68C 2LGIA 3HVDA 4IDIA 4NW2A 1PYWD 1EY8A 5T1GA 5C0XJ 3IKJA 4WFN3 3P1MA 4XYQA 3IXSA 1TWGB 5C3EB 1EZ6A 4PMCA 1PFDA 2EDGA 1BQQT 1QOAA 2LFNA 1J7BA 2WKCA 4XT3B 1QILA 1CTMA 5AFWA 4YT0B 4JX1C 5I9OA 1YNND 4X3KA 4U673 1DXMA 3OMGA 2RVLA 1SYFA 4ZLTF 4A6QA 4ZKCB 4LJZC 3B2FA 2MHVA 1HUMA 1OXUA 3Q23A 1QCBD 5M5YB 4XWWA 1KABA 5IGGA 5C0XI 4CKCA 3VA7A 4US8A 4HMIA 2WXPA 3DEPA 1C48A 1NUCA 3N6RA 3SFDB 4DFAA 3FDTA 1YMHE 4RGTA 4PMWA 2B2TC 2EYHA 2F0TA 5G3LD 1JWAD 3DEOA 4ZAIA 3I9V1 1HFGA 3VRAB 4EQOA 2A6HC 1Z6HA 4KKTA 1UAPA 4WJWA 3OW7A 1XLQA 3QJYA 5I9PA 2EZVA 4IUPA 5FO8B 1AP0A 4UDUC 1FRDA 1CK1A 5C2TB 1F2LA 2IX3A 4CHTB 2WU5B 2F0JA 3C2PA 5JAVA 3S2DB 1NENB 1SB3C 1XTCD 3TZDA 1H9KA 2BDNA 5DEHA 1LV9A 1STYA 4ULLA 3B2GA 1H9SB 1F9RA 1HRJA 3VRBB 3Q24A 1LTRD 3NWTA 4FF1A 2NTSA 1JRPA 1EQVA 2WXHA 2JSOA 2GRIA 1GOZA 3A7AB 5BN5A 1I3QB 3PUWA 1TU2B 4TQ0A 3J80E 2YYZA 2RSNA 1LTID 4KGTA 3GD7A 4E6IA 1IYVA 1BNZA 1K8OA 3SE0A 3MXUA 3C46A 1EYAA 5A2QL 4AS1A 1Y1VB 2OEOA 2F03A 4A55A 1X3PA 2L0CA 4YSYB 1F0ZA 4XDCA 4FNFA 2B39A 2WXMA 5EGTA 2V4IB 2CHBD 3DHQA 4ME5A 1F2MA 5MPOA 1UEAB 1CZGA 1LT4D 2CJNA 1FNVA 5CV5A 4HEDA 4B9XA 2N7JA 4TQ1A 1WSPA 4DNRB 1V1PA 4PV1C 3OPOA 1CZWA 1SIJA 1GUGA 2IDYA 1UWXA 4RGNA 2BYTA 2L52A 3KLRA 2BE5D 5C4ZA 4L2YA 1TT2A 2B2UA 4A3KB 1ZUD2 2B8GA 4GZYC 3EFXD 2DWQA 3VR3A 4QF4A 1XXGA 5C5LA 1NYQA 2Q8TA 1RYJA 5GXGB 2ZXOA 3HOZB 1UGJA 5I6WA 5M3FB 5EQ0A 3UI2A 3MXGA 3I57A 3DMUA 2WXNA 3HZXA 2F0NA 5IGCA 2A74C 3SK5A 3P4RB 2N0SB 1GB1A 2JA5B 1YN4A 1A2UA 1TJEA 4YIJA 4Q5VA 5CBAE 1B1ZA 2RPVA 4IUTA 4IUUA 3AB5A 4Q2JA 1L0VB 4A3IB 2QILA 3I72A 4WURA 2G9HD 1RWSA 1KDAA 1S4ZA 2EJGC 3Q8FA 2FE8A 4HTHA 1L0YB 1K51A 3MZ5A 1PRTB 3U2SC 1PFNA 1JOQA 3GV6A 3H6MA 3B9JA 1MGSA 4DXGA 4B0MA 2SAKA 1LABA 3K57A 1SF0A 3D4WA 1EZ8A 5KEEA 4EE2A 3L7ZC 1D2BA 4K2LA 4YTMB 3BDLA 2F0SA 2Z4IA 2JYTA 3BYTB 1K53A 4USAA 1QLBB 1SYBA 3PUYA 4KK7A 4H44C 1TIID 2NN6G 1U4MA 4P16A 2MP1A 2Z4HA 2WP9B 3KUPA 1O7LA 2ZXRA 3QG1A 1XWEA 3NHHA 5CBEE 1I4HA 3A54A 5CR3A 4PNYA 1PTOB 2JZPA 5I6YA 2HQEA 4KY5A 4LMQD 4NKLA 1LTBD 2TMPA 1II3A 3ITPA 1I4PA 2NUCA 3V96A 1GB4A 1GUWA 1EWHA 1KH0A 4BY1B 3TP5A 3K5OA 3L3OC 3BDCA 3EVQA 5HFYA 3J81L 2LHEA 1DGJA 3Q22A 4RAUC 1SYCA 3HUIA 3NBIA 4EQNA 1QWYA 3D3RA 2YU9B 5D3IB 1QKZA 3Q8BA 5IT9E 1DZ1A 1YQ4B 1FO4A 1BF4A 2JA8B 5E1FA 5CC4A 3FEWX 3C1FA 4FXGC 4GDKB 1LTGD 1SBBB 2RMMA 2K0PA 3LYYA 1G8ZD 3PUXA 4HSVA 4IN3A 4IKGA 2QDBA 2AQ1B 2F0WA 2I38A 3BK2A 3MHZA 3SR6A 1SXTA 1BOSA 2IGHA 1KLUD 1VDVA 1P7EA 1SE4A 5CV8A 1I4XA 1XCQL 1XLOA 3T3NA 1V1PB 2XN9C 1EWYC 2JX5A 1PDXA 5FR3A 4A90A 4QUCA 1G291 1BMLC 2F0KA 1R9TB 3OOCA 5JVG3 3Q6SA 1K8MA 2EYLA 2FFKB 3TEXA 2L5TA 3W2DA 3K0YA 2NN6I 3TUOA 1JWBD 1CHQD 1FNWA 1B50A 3D31A 1FXAA 3QOJA 1E9MA 5ELBA 1WVLA 3AE6B 4AQ7A 2JA6B 3S15B 2SNSA 2AWOA 2H1EA 3EGRA 1PZKD 2DN8A 5G5HA 3W9CB 4ZHPA 1HTLD 4A93B 2IT1A 4FXKC 4F87A 3GTMB 3E0JA 2K33A 2ZT9C 5IGFA 1OQQA 5LL6X 2WDQB 3A8KE 3PO0A 3BIID 2A69D 1S5DD 1XEEA 3IAM1 5IIFA 1EU4A 1FFVA 2V3NA 1JALA 1SSNA 1WXQA 1DOKA 2VB2X 2SEBD 1DOXA 3IAYA 4HAEA 4DAPA 3BG3A 5IODA 1E0BA 2JYOA 3FC4A 4S3SA 2NN6H 4DA2A 3NVZA 2CW0C 1L4ZB 1SNOA 1KNAA 1BCPC 1ICWA 3NVYA 2QF7A 1SFOB 3VR4A 4J1MA 5E4XA 2B2VC 4XIGS 2F0QA 1D5XC 4ITKA 1HPCA 4C1NK 3SHLA 4WAFA 1C9FA 4LK1C 5C3JB 5KNBA 2LS01 2WB1B 4MN3A 2B2WA 2K01A 1N63A 4HCEA 5FKAC 1KRHA 1G91A 1SJHD 4LK0M 4EGVA 2BB6A 3HOUB 4H2AA 2FUG1 2KACA 1H9RA 5IGEA 1IBXA 2H4OA 1W6KA 4IUQA 4RCNA 1OXSC 3LXFA 3RPFC 5A35A 4XYOA 2JSVX 4QIWB 4G7OC 3E56A 2HDLA 5E6JA 2Y5CA 4QUFA 3NVWA 1ESFA 1IBXB 1B9RA 2L1BA 3A55A 2K32A 5H92C 4K5XA 4A3JB 4BA1I 3U9SA 3K5LA 1KTKA 4KKJA 2PQEA 1GJXA 3J7AF 1HUNA 1B53A 1E7PB 2KHSA 3CRKC 1CA5A 2D62A 3HRZC 3TSSA 1GXDC 3VR2A 1IGCA 5C4XB 1N60A 3AECB 3NUHB 3GP7A 1U4LA 1FFUA 1C4CA 3SVMA 4C3JB 4A3MB 2K5QA 4FP5D 3AEBB 1DCZA 4PMBA 2E2DC 3NP8A 1C4AA 1S5BD 2K6AA 4NZLB 4RA8A 2KVMA 1JQ4A 5IOCA 1R4PB 3GTOB 1E10A 3KBGA 1GUTA 5JEAG 2LKVA 4FXDA 2NWGA 5C3WA 2QSDA 4QB4A 4BBRB 2EYOA 4R3DA 3VR9B 5EE9A 3LB8C 3J81E 1Q90A 2CVRA 2D5GA 3S2HB 3R2IA 4CJ1B 1JMLA 1C8CA 2BS4B 1FEHA 1KFYB 5JVH3 3BVMA 4DNTB 4C7YA 3H3VC 2L4NA 1RFKA 1SDFA 3FKIB 3BWUD 2W3RA 2BS3B 1N5WA 5C0XH 4HMJA 1F2ZA 5JPNC 2A6ED 1RCVD 2SNMA 4C1NI 1STAA 1QOHA 4R8NA 1WTWA 3M4OB 2MH7A 1DONA 3BVGA 1MVKA 2EXZA 2B2VA 4BA2I 2G9DA 3HVZA 5ELFA 5BMHA 3FRPB 2YEPB 1UNSA 4IFDI 2BCOA 4WORA 2E2JB 3W5UB 1ILPA 1EY5A 3T56B 2ACZB 4FXCA 1EYCA 1ENCA 4ZRZA 2W54A 4G7ZC 2K22A 4JK1C 2R61A 2HDEA 1C79A 1LTAD 2MUYA 3R3OA 2BT6A 1U4PA 1BCPD 1XO3A 5IT9L 1Q1BA 2PZTA 1YJJA 1Y1WB 1JWUD 2F0EA 4G57A 4ZUJA 4HEA1 3C3LA 1CI3M 4N9PA 3P4PB 1Z47A 3LNNA 1T5XD 2IGDA 4IQZA 1H9JA 3MXPA 2L83A 1CZPA 2PW9A 3HRDD 2E6XA 2WDRB 3NS1A 2WXKA 4IFDJ 1V1OA 1A6XA 2V4DA 3GTPB 2B2YC 1SNDA 2PYKA 1MBYA 1DM0B 2W3SA 5CV4A 4AYBB 5HG2A 2DLBA 2QJLA 3HOVB 1VZ7A 2QCPX 2RBMA 1WYGA 5C4HA 1I50B 1TY0A 2WP8J 3ZJTA 2X6GA 4OGQC 4CKBA 2BA0A 3CHBD 2J42A 3KQ4A 1PRTF 1ZXIA 4XQJA 3H8HA 1TR5A 1JOKA 3FILA 3V2TA 3L9AX 2K04A 2K7VA 5I2XA 1FNUA 1BXTA 1XLNA 4DXFA 1ZYRC 3F2UA 5LL6S 2BBCA 4REZA 1VR9A 5KIXA 1SE2A 1KNEA 2F0MA 1QOFA 2JWUA 2DNCA 1PTOC 1SNQA 4TKOB 1HQMC 1LTTD 1DYQA 2L32A 3T51B 3J9CA 3R93A 2EYFA 2K1BA 1TS5A 2NVTB 4KN4C 2BDOA 4QMGA 5COYA 1NEKB 1XCTL 1C78A 1GUOA 1XYIA 4KV6A 4RGOS 2L11A 1GUNA 3PMFA 1CT1D 4ZQ3A 4BS9A 5FK9C 2IGGA 1NI3A 1WD0A 4ARCA 3TEZA 1RODA 2QMTA 4H13C 3OMCA 3C8YA 2MPMA 3SXHA 1MSGA 3ND9A 2V3PA 5C44B 1RM6C 2LMCB 2RA4A 2WXJA 2EELA 4ZRPA 4KN7C 1K50A 5BYQA 2PMVA 1F2RI 3KF8A 1VJKA 1C76A 4EVOA 3ND8A 2L12A 1RDPD 5CV9A 4CBVA 4OVZA 2WXQA 3EQLC 2DY8A 2JP1A 2WAQB 1O78A 2ID0A 1U4RA 3HKZB 3NZ3A 2FJ2A 4JWUC 1I4RA 1CFMA 3NBHA 1DOLA 1F77A 1EL0A 3I4LA 1PTOD 5M5WB 1GPXA 2EVBA 1QJOA 1Q10A 1ZP0B 4RFBA 3VYTA 1B44D 1HZ6A 2KJXA 2K28A 1QF6A 2GI9A 2W82A 2EE1A 2VZKD 1CJEA 1STHA 3BVZA 5M5XB 1LLRD 1FRRA 4WWMA 5EE1A 4J3OD 3AE7B 4LLGM 4EQPA 1QQRA 3BS1A 1MD2D 1VCIA 2K03A 1QNUA 3OIPA 1TKYA 2B2YA 2LFIA 3KLSX 3EA6A 3S1NB 4KKIA 4M1UB 1NR4A 2WQYB 2R93B 3GTQB 1YN5A 3SDZA 2PNRC 1BR9A 4C2MB 3NTIA 4K5WA 1CQVA 1HZ5A 2MGSA 3EUB2 4A3BB 2XRSD 3I8ZA 4P6VF 4TMAB 2WXGA 3MC0B 3MFGA 3U52E 4K6DA 3TP8A 1JC7A 1MPEA 2F0IA 1ZKOA 4ZRQA 1EY6A 4RF0A 1O7YA 3P75A 2LJIA 1Y8NB 1WWTA 4QCLA 3G6JB 5E4WC 5J22A 2PZUA 4NAWB 3E9SA 2EY6A 2J0TD 4CJ2C 4DAYA 1WGKA 3D4RA 1DOIA 3X3NA 3NVVA 4HRSA 5M3MB 2I07B 5TSSA 4OO1G 1SNMA 2WXRA 4NDXA 3DWMA 3NRZA 2I2YA 1ESRA 5C0XG 2WDVB 1B9MA 3D8GA 3ZJVA 1Q1EA 2PIAA 3HP3A 4IOIE 2WNMA 4BY7B 5HI1A 1R7SA 1O80A 2PW7A 4DK1A 2DYMA 2M56B 4G7HC 1HXYD 3Q8AA 2NZ1D 4B0EA 5FO9B 1TWHB 3V05A </