1SE2A

Staphylococcal enterotoxin c2, monoclinic form
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
239
structure length
235
Chain Sequence
ESQPDPTPDELHKSSEFTGTMGNMKYLYDDHYVSATKVMSVDKFLAHDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKDNTGGKTCMYGGITKHEGNHFDNGNLQNVLIRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords STAPHYLOCOCCAL ENTEROTOXIN C2
publication title Residues defining V beta specificity in staphylococcal enterotoxins.
pubmed doi rcsb
total genus 63
structure length 235
sequence length 239
ec nomenclature
pdb deposition date 1995-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1se2A01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1se2A02
3EA6A 1AW7A 1KTKA 2IPKD 2QEJC 1FGBD 1SBBB 1FNUA 1I4XA 1PZJD 5ELCA 2ICIA 2RDHA 1PRTF 1CK1A 1SE3A 1TS4A 5TSSA 3BVZA 3EFXD 1I4QA 1EFID 1TS3A 2XNAC 1CHQD 1QILA 1SXTA 4ZYSA 1FD7D 3V05A 1LLRD 1PTOF 3BYTB 2SEBD 1YN4A 1LTAD 1S5CD 1SEBD 1EU4A 2NTTA 1ENFA 2O2LD 3DWQA 4RGMA 4UDUC 2WV6D 5D3DA 1DYQA 1ET6A 1LTID 1LTTD 3BYYB 4NZLB 1JWMD 1PRTB 4BWGB 3TSSA 1XXGA 2Z8LA 4RCOA 1AN8A 2TSSA 1D5XC 1PYWD 1HQRD 2R61A 1D5MC 1I4GA 1RDPD 3MFGA 3BZDB 2J4XA 1KLUD 1I4RA 4RGTA 3O13A 4C56C 1PTOH 3MC0B 1L0XB 1PTOB 3R2IA 5ELDA 4Z9CB 1ET9A 1JWUD 1HA5A 5FKAC 1EEID 3BVMA 1I4PA 1PRTC 4L63B 1FNVA 1EU3A 1GOZA 1SJHD 5FK9C 1EEFD 1EWCA 1BCPB 5ELBA 1B44D 1YN3A 4O1NA 1F77A 3OWEB 1CHPD 1V1PA 1PRTD 1LT5D 1CQVA 3R8BA 1BCPF 5I4DA 1TY0A 4DXGA 1PTOC 1TS2A 1TS5A 1YN5A 1D6EC 1SE2A 2NTSA 2XN9C 1PTOD 1TY2A 4RGOS 1BCPC 1L0YB 1RF2D 2G9HD 2XRSD 4RH6A 1B1ZA 1SE4A 5ELFA 4OHJA 2AQ1B 4TSSA 1UUPA 4L6TB 1M4VA 1KLGD 2CHBD 3CHBD 3DWAA 4RHSA 1BCPD 1UNSA 1G8ZD 1RCVD 4RGNA 1JCKB 1LT6D 1DJRD 1HTLD 4RFBA 1LTSD 1JQYD 1S5ED 1XTCD 2RDGA 2XRQD 1PZID 1S5FD 1CT1D 1MD2D 4DXFA 3SEBA 2IJ0A 1S5BD 1RD9D 1SJED 1V1PB 3DWPA 1LO5D 1LT4D 1V1OA 1LTRD 1JR0D 1T5XD 3GP7A 1BXTA 1LTGD 3URYA 1LTBD 5ELEA 2QILA 4RHRA 1LT3D 1PZKD 3W2DA 1I4HA 1FNWA 1JWSD 1STEA 5D3IB 3BVGA 3R2TA 1ESFA 1S5DD 2AQ2B 2AQ3B 1D5ZC 1HXYD 4K6LA 3KLSX
chains in the Genus database with same CATH superfamily
4G50A 3ERQA 1PA6A 2D3BA 1HFNA 3DHQA 1GC7A 1BUIC 1N61A 4LUVA 1HPCA 4LUOA 4JG2A 4K14A 1E2ZA 3S15B 4FYDA 1CK1A 2XBBC 3I4NG 1UH6A 3L3OC 2WXGA 2KVRA 1KD1C 4H0LC 3KUPA 3VYUA 2BQQA 2MJEA 2WDTB 3PO3B 1SN8A 5IA7A 4X65L 3SD5A 3J80c 3KLWA 2R7DA 3P1HA 4MJSA 3I4NH 2YTYA 3I91A 2LMCB 1ENFA 1SYDA 5KRUA 1DOLA 4A3EB 4FNFA 3PVLA 1PHJA 1DCZA 2N4FA 2N9XA 3Q3JA 1V49A 4QF4A 2JJQA 4R4IA 3AV8A 3KUDB 2KQ7A 3LXFA 3J80i 5CGKA 3J7A5 3P4SB 4REZA 2GVBA 1D5MC 3EUB2 4A3JG 1OXVA 1OXUA 1U0LA 4JI5L 4LF7L 4LF9L 2EXDA 2HDMA 2HDEA 1ZDXA 3W5VB 3ZNGC 5DM63 5L83A 1KH0A 3AQQA 4RGTA 4WWPA 4DV0Q 2K75A 3Q8CA 2NBFA 1EEID 1CUKA 1G291 1IZ6A 2L9HA 5M3FG 1PH7A 4JI3Q 3VUYA 5CR3A 2D3AA 2F0KA 2IGGA 2E74C 4A3JH 4JI7L 4C80A 1VQJA 1FL0A 5IT9E 1PH1A 1YN3A 4G7HC 4O0AA 3K0YA 5JJZA 3MHSD 4QJFA 3Q14C 4RA8A 1WGDA 3QHTA 3GE8C 3AEEB 3P7JA 3VA5A 4W9LA 2F0GA 1V80A 5M3FH 1EY5A 4GS3A 1F52A 3RMHA 4XGAB 1XNRL 3UI3A 3PZDA 4PS7A 1D6EC 1KRSA 3VR5A 1DONA 4R4TA 4BBSB 2O2VA 5CX3A 5M5WB 1WD0A 4RH6A 5JZEB 4R4QA 2D11A 1WXVA 4OHJA 1GUNA 3L2PA 2KENA 3SR6A 2ZJRA 3NQTA 2JZZA 3CHBD 1JROA 1B7YB 1SNPA 1DXMA 2F0JA 2I5LX 4QB4A 2M19A 1RCVD 5ISRA 4GKKL 2PW7A 3LYYA 2EYOA 2L00B 1MJEA 1IYVA 3K5MA 3DHGC 1Q8KA 1MJDA 2ZM6Q 1JALA 4GZYC 3PZ8A 2PNRC 4GOPA 1WXQA 3QQ8B 4TKNA 2G1EA 2FMMA 3PSEB 1II3A 3F2DA 1RD9D 4QAYA 2QHOA 2F0TA 1LTRD 3K9OB 2X6LA 1VDVA 3J7ZC 2WU5B 4OVUA 2JUOA 4M02A 4DUYQ 4ICUA 3A54A 1IGCA 4YTPB 2JYEA 3A74A 4RAUC 3JAMi 1XMOL 3AFPA 4F88A 1TKEA 4BY7B 3DVGY 3ONSA 2NB0A 3DOWA 4HKQA 1U4PA 1QOBA 4WQMA 3SDZA 4XQNA 2VQFL 3PO3G 1TT5B 2FAZA 2KHSA 1AW7A 1DGJA 1I4XA 4LFAL 1X3GA 1F2ZA 3FP9A 1ENAA 1EWHA 3HP3A 5I2XA 3CCMA 3S15H 2LVOA 3AB5A 4HWIB 2MBHA 2EYJA 4P2CB 1YX6B 4L2YA 3VYRA 1Q5WB 1VQPA 3A1QB 3K57A 4A3PA 3CCVA 2JQOA 4EE2A 4A3EG 2I38A 3PO3H 1K3RA 3X23A 2ZTDA 2G5DA 1CKNB 3BIID 3BJUA 1K0SA 2PQEA 3V05A 1UE1A 3L0OA 3MXUA 1VQLA 3U7DA 1EIGA 3IXSA 4MM3B 5JOBA 1I3QB 4M8AA 3V6CB 4A4IA 4F7XA 5GAHC 1FXTB 1R4NB 2M8SA 3QX1A 4A3EH 1GJZA 1SYBA 1HA6A 2QDFA 2F0OA 1ZE3D 1L6UA 3AE9B 4M01A 3IVFA 1Q1EA 5CV4A 2LRUA 3ZRFA 2VQEQ 3HIZA 4QIWE 1V9JA 2FCSA 3LGJA 3VUXA 2BW2A 3ZNID 1Y1WB 1WTOA 3J7YW 1ROEA 2GB1A 1HTOA 4WJNA 2LHEA 3MFGA 2A68D 1OXXK 2H89B 3NHHA 2MHJA 4GLXA 2KHWB 3KF6A 5GQOA 5EJWA 4NJ6A 1KHIA 5FKAC 4JYAQ 5D65A 5E3FA 2JRHA 4GDLA 2JA6B 3ZTDA 5HKHA 1IL8A 4X62L 2JZPA 2W54A 1NBFC 3T51B 2IO3B 3M7GA 1EUJA 2A6HC 2EZVA 4JI4Q 4GMVA 4HDQA 1PGBA 4IQZA 3GTOB 2MRPA 5CV9A 1C77A 3AN1A 3QA8A 3RN9C 4CJ0B 2J7ZA 3EFCA 3J7AV 3J80L 4TV3A 4EZKA 1XWEA 4JWSC 5M5WH 2WWZA 4O42A 4AQ7A 2BDNA 3A4RA 4W9IA 4HCNB 1MBYA 2DN8A 1D7QA 5E4WC 4Y52H 1VRAB 3EFUA 3ZO5B 1JOOA 1XLQA 3AMUA 3LWEA 2Q5WD 3IFWB 3U9OA 4IPGA 4PZ6A 2DJFC 3EHVA 4LJOB 1G6JA 4AWJA 1FCLA 3D0FA 4IJLA 1C4CA 2JWUA 5E6NA 5AFWA 1OQQA 4S0RA 1XT9B 4BKTA 1CZGA 3P1MA 4N6EB 1OQYA 4JI2L 1E22A 4JX1C 2KUMA 3I55A 3D4RA 1HEZE 1CT1D 1HR0W 1MD2D 1EYCA 3HKZB 2IJ0A 4BY7G 4GDKB 2K5DA 1B9RA 1MKHA 2OTLA 2RPVA 2RD0A 1P98A 3H7SA 1FFVA 3FDTA 1BXTA 4KY7A 2CFMA 4FF1A 2JX5A 1DZ1A 2Y5CA 4I6NB 4AJWA 3DBHB 4HLEA 4HIMA 2JY6A 1WTHA 2W9NA 3AEBB 3MWYW 3AECB 3C3LA 2OF1A 4BY7H 3ECIA 1C3TA 1J7AA 2R92B 4A55A 5CV7A 4R8NA 4I6PA 1HXYD 3X3MA 1E8YA 1WR6E 2UWQA 4N9F4 3CAMA 1KTKA 2JYTA 2PI2A 1E24A 1WRDB 5M3MB 4EX5A 4II2B 3PO0A 3AE1B 2MP2B 1ZYRC 4ZRZA 5DLQE 1Z2MA 4W9CA 2I1JA 2NBVB 4JWUC 1L4ZB 2XNAC 1VMCA 3WA0A 3DPDA 2WYQA 2LZ6A 4B6WA 1R7SA 2PTLA 3BZKA 1A3UA 1MJCA 1PTOF 2KECA 3GDEA 5J3BA 3WOFA 4F87A 2K25A 3SHQA 2ZPYA 4HN7A 1Y1WG 4EEWA 2PNHA 4DR4Q 1I3QH 3ULJA 5GAGC 2O2LD 1HNXL 4ACFA 4NAMA 4HK2A 3A4SC 4GN4B 3KBGA 3H8HA 2N7EA 3Q23A 5CYUA 1E0ZA 1Y56A 4NAWA 1I94Q 1B50A 2EELA 4DR7Q 3N1YC 3TSSA 3CCUA 1IW7C 1KXLA 3ZVVA 2JA6G 1FGUA 1PYWD 1D3ZA 1Y1WH 3TEYA 3KF8B 5T1IA 3R66C 4TQ0A 3PT2B 1R4MI 3IAYA 1P3QU 3F2CA 2XK5B 1S1QB 1JC7A 2KTRB 1XPUA 4O2DA 4BOZB 4IWQA 2D9UA 4ARIA 5IN7A 4ZHPA 3U4EG 2IY5B 1SIFA 2PQAB 2FXQA 1NY4A 3RZFA 2NZ1D 4GNXB 3PGZA 2JA6H 3A9JB 4JBMA 2V3NA 4KKIA 5H92C 3E9SA 4B9KA 3M9BA 2MPMA 3QARA 5FJ8G 1N63A 1WX8A 2BKRB 4P1CC 5NUCA 1LT5D 4MIUA 1YJWA 1AZPA 4DHJB 1X32A 3GTOH 2K5VA 4KTAA 1RFAA 3DDCB 1KRTA 2BGFA 2J0TD 5CC4A 1WGKA 4OVZA 2DY8A 3J81E 1B3AA 4YWMA 4C3JB 4KJOA 4Y7NB 3P4QB 4HCPB 5FJ8H 1KRHA 4FDBA 2XIWA 2LS01 1IKMA 4WQOB 4J6HA 1CJEA 1WIAA 3IFDA 2RR9A 4E71A 1SE4A 5C4XB 2UXBQ 1JOKA 3ZNHB 1KLGD 1F2RC 2LUEA 5HG2A 3FMCA 2NZHA 3AU7A 3E9HA 5EQ0A 5FLMG 1WGGA 3ZXVA 4PNYA 4GOCA 2WAQB 2F0FA 4BAXA 1PH4A 2IY0B 1CSPA 2L76A 1Y14B 1JQYD 2EYLA 4LUZA 3MAQA 3SVMA 2A5HA 2Z9HA 4B08A 5FLXE 4ZKCB 1MG8A 4GDLB 4M0WA 1YNND 1N60A 2M2LA 2R92G 3MVVA 2B2VC 5FLMH 2B29A 1IUEA 5IOCA 4DR1L 2ZXOA 3P75A 2N7DA 1V1OA 5GADC 4AJYB 2EPBA 2QF7A 1BOSA 1X56A 3PUVA 4DV4Q 1OTRB 5M3MG 4Q2JA 1H9SB 5DEHA 2YVCA 2LSSA 1WTXA 1KDCA 2NN6G 2R92H 3PSIA 5KYIA 2GBKA 3QIJA 3HKSA 4B0MA 1HNZQ 4A8XC 3RZOB 1LYLA 2MBQA 1T0YA 2EVBA 2HE7A 4DFAA 2WXRA 3K9PB 2JSOA 5L37A 5M3MH 1SBBB 3CC7A 1PZJD 1BQQT 4RF1A 3T53B 1PRTF 1ZP0B 2NN6H 3ND9A 1UGJA 2KOLA 1YHQA 2CU1A 1QB5D 3NP8A 2MQHA 1B2TA 2NBUA 3GOEA 4IM0A 1TS3A 1TGZB 5H8YE 4MH8A 4R1JA 1EM7A 1QILA 5KHOA 4HTHA 4AYBB 3EQLC 3PIO3 1EFWA 2ZZPB 1LXDA 1K8AC 1H4RA 3VUWA 3KYHC 1KABA 4DKAC 4FHJA 5C23A 3FVQA 1SAPA 2D2CC 2PZWA 2NVQB 3H91A 5BR8Q 1EU4A 2Y3AA 1GJXA 2WV6D 1VQ7A 4QUFA 4L5TA 1UBQA 4J15A 4K3CA 4JPSA 4FHKA 4EGVA 3S1QB 2WS3B 4CJ1B 3CCSA 4AYBE 1PUTA 2KJRA 4BWGB 4A75A 2RCFA 2LHDA 4XE0A 2CW0D 3DWGC 5FOBB 2Q2UA 3M4OB 1WJUA 5CORA 2FMCA 2VZAA 2YEPF 4OX9L 1WRIA 1RKNA 1D1KA 3NPPA 4IUNA 4HVBA 4DAPA 1JWUD 4U68A 3CKIB 1XF5L 3BVMA 3S2AA 4XQJA 1L1OB 2K4KA 4KV6A 2ZW1A 4C3JG 3N1XC 2FIFA 1EEFD 2DZJA 1VQ4A 2O6VA 1B44D 4JBWA 4DV7Q 2DLBA 2FCNA 1GKHA 1N33L 1Q46A 4AQYQ 1ONLA 1WH3A 3K80C 3QJYA 5I4DA 1WTRA 1HR0Q 1EYGA 1OTCA 5C4XG 4XTCS 3ZUNA 4OXPA 2L15A 4P1BC 2A6HD 3Q6BA 2FNJB 4LF4L 4C3JH 1GNUA 3ZDTA 3JC66 3AULA 2OQ0A 2WAQG 3A55A 2UYZB 4K3BA 4KKSA 4LFBQ 3DBRB 2UU9Q 3DBSA 3IL8A 2KFKB 5C4XH 2AQ1B 4RG1A 4TSSA 1Y8NB 4NXNQ 1HHVA 3DEOA 1UNSA 3B2FA 2V0GA 1IYUA 1WFQA 4N59A 1JCKB 1LT6D 4WJWA 5LNK1 4J6IA 5BMIA 1CQFA 1C8CA 3ETRA 1VR9A 3L16A 2ZTCA 3MP9A 3AU4A 1V1QA 5CBEE 2WB1E 2ZT9C 1XTDA 2O6VD 1EY7A 2WACA 4IW0A 4BBNC 1IBLQ 1V8QA 2LWPA 2Q2TA 3FILB 1B4OA 2K8CA 1VQHA 4FP5D 4ZUIA 2F3WA 2WXLA 2BA0A 5HGTA 3QOLA 4YT0B 4G57A 5K5PA 2ZTEA 3BWUD 1WF9A 4PZ7A 4FULA 3KYCD 4A93G 2B2WC 1WE6A 1GD7A 1STEA 3R2TA 1I6VC 2MUYA 5E6OA 5EBDA 4DV6L 3RZOH 3MXPA 2XWBB 1FCCC 1WZ3A 4WIPA 2MCNB 4G7ZC 4NY0A 3PTFC 3VQIA 5IGDA 4IDIA 2UUBQ 2AMCB 4AYBG 4N8FA 2QEJC 4FN2A 1A3VA 3S1RB 1VQ5A 1L0VB 4A93H 4DV3L 4KZ0A 3Q22A 5HFYA 1WJJA 3HEJA 4KD4A 1D2BA 3RNBC 1H9KA 4YWKA 3H7PB 4LW1A 4CJ2C 1JT8A 2V9HA 3H09A 5DM73 4X64L 2IZVB 2KWCA 3KDFB 2SNSA 2AX5A 2LMCA 4EOYA 3P4RB 1CHQD 2GBNA 2QKIC 4BOSC 1AE2A 4ZCKA 1TWAB 5C4JB 2W82A 1X3FA 3CSTA 2D3CA 3EIVA 2QJLA 4FA6A 2K0PA 3NBIA 1F1HA 3B9JA 2WXIA 1GUSA 3Q2AC 3A9KB 1O78A 4L5QA 4LF5L 4GKJL 4K1RB 2KWUB 3W5OA 2NVQH 4A9AA 4MN3A 3K0XA 4A3KB 4DR6Q 1LQBA 2KCTA 3TP7A 4EUTA 3UF8A 4LFCL 4DDGD 3AYHB 3ABVB 2RVLA 4NXML 3S1QH 4WAFA 1K0RA 2ZW0A 3HK0A 1LTTD 2R7ZB 2LFNA 3FPPA 2D10A 1OO9B 4FF3A 2K6AA 1VQDA 4RCOA 5G3LF 4QY7A 2LJIA 4I6LB 3ZYYX 4C4VB 1EO6A 4D2KA 2BKFA 2M17A 2N55A 1C79A 3M4OH 1PGAA 3VH4B 1YJ1A 2IX3A 1WR1A 4B3RQ 2WNMA 1IW7D 2NMQA 3IFTA 3MC0B 2JXTA 2MEKA 3NZSA 3S2HB 3BDLA 3SXHA 3C1EA 3T1HL 4KJNA 4R8IA 1GOZA 1EZ8A 1MSHA 3DBLB 4OVVA 4XWTA 3A7AB 2HTME 3AE7B 1CHPD 3I3TB 4ANVA 4APVA 5TR5A 1HZAA 1Q82C 3CCLA 3W3AA 1C48A 4C00A 2PPBC 2RDBC 2RGFA 1MI0A 3UQAA 2A68C 1TS2A 4XDCA 5DCNA 4HEDA 2BOSA 3RD4A 4HJ7A 1SE8A 4RKBA 2B2VA 2BPSA 3KLSA 3RFZB 3D3RA 4B3SL 2CR5A 4K6DA 3KWVA 2IL8A 2G9HD 2L1BA 3E6ZX 5FO7B 1NBWA 5HY6A 3VR2A 1A6XA 1J8CA 1XPOA 4DV2L 3ML8A 1VLBA 2CCZA 1C78A 5IGGA 1I5FA 3N6RA 4FADA 4LNKA 3CPFA 2KVZA 4PS3A 3OYYA 3PUXA 4RKLA 3KBXA 1J8IA 4X57B 1MHWC 3C0RB 1X55A 2E2DC 1PFDA 1ILPA 2M0AA 2LKVA 2SAKA 4KHZA 3ZRCA 3ER0A 4ZOHC 1STHA 3ENEA 1S5FD 2CHXA 3D32A 3RNEC 2JWZA 1J9OA 2M0XA 1NYQA 1SF0A 5EPKA 1PXUA 4DV1L 1H9RA 3H3VI 1JR0D 4IUQA 2J53A 3P4PB 3V61A 1LTGD 2B2YC 2ENBA 4F8MA 2F1MA 5D6JB 1TJEA 2CKHB 1GPXA 1B70B 4BKGA 5KYLA 1R4QB 4G7OC 4MGIE 5IO9A 3D6WA 5IWAQ 3Q6SA 3GTQB 4DR2L 4OZAA 2AQ3B 2MA9B 3A1QA 1WMHB 2CS4A 4XIGS 2ZXPA 3DM1A 4LNNA 3C1FA 1S72A 2KKCA 3ND8A 4K2KA 4HEA1 1CKNA 3S1RH 1F0ZA 2DNCA 2FUG1 2N9PC 2L52A 1N36L 4ANWA 3DVGX 2LUMA 1K83B 3S1MB 3KJPA 4BS9A 5TSSA 4A3KG 1BVSA 4MM3A 2A69C 1S3OA 5E1FA 4HJAA 3B08A 2L12A 2M1MA 5C4JH 1TWAH 3Q24A 1VQGA 1QUQB 1SXTA 4R9WA 4ZYSA 2R7ZG 1K51A 3QC8B 5BYRA 2VW9A 3NUCA 1FJGL 3KK7A 3CP0A 3WDNA 2H88B 1YQ3B 2JVCA 4AUQC 1HNWL 4A3KH 1IGDA 4X65Q 3RNFC 1ZUD2 4XWWA 3K8AA 1PFBA 5IP4D 5A2QL 2GBMA 4DGZA 5C3EB 3VVWB 4TRDA 1RLFA 2WXNA 3PV0A 2F52A 2R7ZH 3PUWA 3GB1A 1XXGA 2F0DA 4B95A 1EY9A 2L4NA 3EN2A 3UDXA 2EOTA 3S14B 3L9AX 3GV6A 1U5KA 2QC8A 3HRZC 2VS1A 3BZDB 1QCBD 2UXDL 4IWOA 3RZWC 2EY2A 3RNGC 4JL9A 1U4RA 1Y8OB 3A8JE 3UDIA 1PH9A 4IPCA 3S2HH 4JI5Q 1G51A 4LF7Q 4LF9Q 3NVVA 1JICA 2D2QA 2JF5A 2C9OA 2CU3A 4IOIE 1VQEA 4PG3A 2ALYB 4ODGA 1XNQL 2K5PA 2KD0A 1LV9A 1X3PA 2Z1CA 1C4AA 4JI6L 2GLSA 5HURA 2BE5C 2PVGC 4WURA 2WKDA 4IG7B 4JI7Q 1WX7A 3NBHB 1QE6A 5JAVA 1C7YA 4WRDA 2JE6I 2K22A 5DPSA 4E74A 1H9MA 3S1NB 4ZYNA 4C7YA 2CH4A 2HDLA 3OLMD 4N58A 1O7YA 1TIID 1L1OC 1C76A 4IUTA 1JOQA 3FC4A 1WTQA 2JA5B 1XMQL 1XNRQ 5JJIA 3Q0AA 3B2GA 3ZJTA 4NMZA 1N62A 3C8YA 3C19A 1BR9A 1I50B 3DWAA 1G2SA 2B2WA 2OQKA 3UE0A 3J81j 1F2RI 3F2UA 4WJOA 1N32L 2Y0SE 4C2MB 5EE3A 3QWZB 2MH7A 4HMJA 2QEXA 4GDKA 4DAMA 3ZQ4A 1QOHA 1J5EL 2DGYA 3ULPA 4J3OD 1IHZA 3UIOB 1STBA 1VZ6A 2INDC 3Q8FA 5LXHA 4NJ7A 4JCVE 1H8CA 3OMGA 4GKKQ 3APDA 2L7RA 5IKCM 1SSNA 1SNDA 3KH0A 1U9RA 1UE6A 4NDXA 3S16B 2BB6A 1B3QA 4UAIA 1WE7A 3G71A 1WI0A 4GGQA 3DWPA 2ES2A 1LT4D 4HROA 4KHPQ 1RFKA 1BKBA 1SRUA 2WP8J 4QCLA 4MT5A 2BCOA 3QK0A 2Z4IA 1LT3D 3W2DA 4HPMB 1I4HA 2KHIA 2ZJPA 1B9MA 2ATWA 2RKSA 3GTQH 3RNUA 4KN7C 1VQMA 2DAFA 2ONQA 2CWAA 3ULLA 4DK6C 2MP2A 2BH8A 3MA2B 2KO3A 1VJKA 3UINB 1Q90A 3TDQA 1XMOQ 1JB3A 1JWBD 1HFGA 1YNNC 1K28A 3D4WA 3APFA 3V62A 4G4KA 3BS1A 4CHTB 1G6PA 1HZ9A 2ICIA 1K83H 3S1MH 2QCPX 1V2YA 3NHEB 1E3PA 1WSPA 2ZCBA 2MSED 3GS2A 3R7RA 4HSPA 1IYJB 4LFAQ 5C3EG 1EFID 2YU9B 2O5JC 4ZUJA 3M3YB 1TKYA 5J2RA 3GD7A 3TRZA 4W9FA 4RWSC 2JZ3B 1WY8A 2DZMA 3OG5A 2AL6A 2WDRB 4KY6A 3GTMB 2R7FA 2WXOA 1CM9A 3SGIA 4R4CA 2NVXB 3N3KB 3KF8A 5ELNA 5ELOA 4P71A 4JI8L 3T13A 4CKCA 5C3EH 4OO1G 1GG3A 1P7FA 3PPAA 2XK5A 4MGKE 5D3DA 2EY1A 1X6OA 2CH4W 2IWHA 2KTRA 2N3SA 2Z0EB 3CWIA 3WCQA 3KFUA 4LF6L 1VQIA 3QAQA 4US8A 1QJOA 2PQAA 2OJRA 2JA7B 2QA4A 4GNXA 1ILQA 3H6MA 3S14H 3M4PA 1HUNA 3A9JA 4OO1H 3N32A 1BF4A 4HRSA 4ANUA 4POGA 1TU2B 2K28A 4PMBA 4RMFA 1R4NI 1FD6A 1P0RA 4A3OA 2K7VA 1PTOB 2WHIA 3EECA 5ELDA 3J9CA 1KJTA 4KX6B 3OSOA 5C1ZA 4QIWB 2CHWA 2ZM6L 2Y0SG 2KA7A 4DF7A 4DNTB 4NJCA 2VB2X 2ICEC 2N8NA 2LGXA 4ZK9B 4CDCC 3KWLA 4X62Q 3I2ZA 1GUGA 4H13C 4ULLA 2EYPA 4GN5A 2CW0C 2JA5G 2LGIA 2UXCL 2E75C 4ZAIA 4MACA 3NWTA 3PMFA 3S1NH 5JPNC 1WGRA 4C1NI 5IP9G 2JPHA 2IYDB 1EIHA 3K6OA 3JAME 3KLRA 2GRIA 1N8RC 4II3B 4M8NA 1YD8U 2EQSA 2F0MA 1O7IA 3GO5A 4YIJA 2A73B 1Q1OA 3KUCB 2JA5H 3DEPA 1FXAA 2B63B 2KACA 2B2YA 5CV5A 3V96A 5KNDA 1SSOA 3CCJA 1V6EA 1VD2A 1WJ4A 1UUPA 3I72A 2JXXA 5LMUL 3CMMB 2AHOB 1E2WA 1I50H 5IP9H 1TKGA 5C3JB 4RHSA 1OGWA 1LTLA 1HH2P 4C2MH 2HQLA 2RCNA 2VUMB 5IGEA 3HS0C 2JT4B 3G6JB 4DHJD 4FO2A 2NVYB 3NK9A 5KGUA 3AE4B 2LGDA 4ASWC 2MWSB 2EJFC 1N9WA 2GA4B 4JV5L 1VMPA 2IGDA 1HZBA 1WYDA 1V5OA 3OWFA 3MXNB 2B3GA 1N5WA 1XPRA 1H9SA 4WH4A 3S16H 3G7LA 5IT9L 5E6PA 2K32A 5I6WA 3AEGB 1Q3LA 2RSUA 1DOMA 2MGSA 4JI2Q 2CHZA 1DM0B 3NVZA 2FCQA 1RHPA 2Z0SA 2QILA 1SYFA 1PZKD 2MBEA 2C7MB 3Q3NC 1FNWA 1XCTL 5D3IB 1TQOA 4DR5L 4KKJA 1DOIA 3VYTA 1L7YA 1M94A 2AQ2B 4LWCA 5KNCA 3I9V1 2KMMA 1EL0A 3ZIMA 4K6LA 3O65B 2F4VQ 4EKUA 2KXJA 3Q8DA 1NYRA 5G2NA 4CHKA 1V97A 4CQNA 5LMNW 1YNJC 2J7QB 2B76B 5BO4B 2KTFA 3TBLD 3NZ3A 1T0SC 3WANA 1SR3A 2R2OA 5F2DA 2OXPA 2YU9H 1VS0A 3QB3A 5LL6S 1Y1VB 3K7AB 4POFA 3M3YH 1QLBB 4OGQC 2FE8A 5IOIA 1PH5A 1UWXA 1HQMC 2KWDA 3RMKC 4JI0L 3FRPB 4GIVA 1F9PA 5IYBG 3L0WB 2A69D 1P1AA 2R2QA 3ZLZA 2JA7G 2WFWA 3GTMH 1WCMB 1MGSA 2NVXH 1E7PB 4PV1C 2WP9B 1KAAA 2KOXA 4UDUC 1HUMA 3DQVA 2WXQA 4LMQD 1NUCA 3GE3C 2K1BA 1PRTB 5IYBH 1HNXQ 1N6ZA 1TIFA 1Z5SB 3N20C 4NW2A 4GB9A 5GAEC 5JXVA 2JA7H 3PO2B 3S17B 1VZ8A 4HCSA 3H9DA 3HRDD 3U52E 3U30A 2A4ZA 3ICEA 1I4GA 1L1OA 3DHHC 2OOBB 1ZKHA 2KDMA 2XWJB 1JQ4A 2ZVOA 4R3DA 4IUVA 1PTOH 5J22A 2N9KA 3APCA 4F7ZA 4WFN3 1FPYA 3BY4B 3PRZA 2Q2HA 1SGHA 2NS5A 4L63B 2X69A 5BN4A 1NENB 3GTGB 5C0XI 5FK9C 3I4MB 1WXAA 2MP1A 5G3LD 2LVPA 2HIVA 5ELBA 1A62A 2XTIA 3FAHA 1PMRA 3F8TA 1CQVA 2K52A 3SK8A 2B63G 2EMSA 4IFDG 1EUVB 2WKCA 1AWDA 4YCUA 1TWFB 1KIXA 2EDGA 4ZQ3A 2KFKA 1Q12A 5C3WA 2MBOA 2BE5D 3VR6A 2YEPB 1A2UA 2PW5A 2IGHA 2VUMG 2HCCA 3AEVA 4HIDA 5M5YB 5JH5C 3VRAB 2BB5A 2B63H 4LF8L 4L5RC 1T5EA 1GUTA 4IFDH 4ME3A 1NJIC 2SOBA 4MGZE 2KMCA 2PMVA 1XO3A 4ICVA 2YYZA 1RYJA 3V6EB 5C3XA 3I73A 1ZEQX 1T0QC 1J19A 3BDCA 4YHHL 4KMUC 2VUMH 2K9XA 1JMLA 2VZKD 1QZHA 2Y5PA 3AEAB 3FILA 1EY6A 2KHJA 2J0JA 3MC8A 5BYQA 3W5UB 2NVYH 3MHBA 3SK4A 2KANA 3EC8A 2JEBI 2F0PA 2Z6BA 5CV8A 3AXCA 2AUKA 1PFMA 1KAWA 2Z4HA 1OEYJ 4LDTD 3UQBA 5EKLA 1Z7TA 1JWAD 4P72A 2K5QA 4DK3C 3HOVG 3U58A 1NEKB 1WM2A 3G4SA 1T5XD 4YY3L 5KEEA 2EYMA 5AJ3L 3KW5B 1LTBD 1QVCA 4DR1Q 3W1GA 4L1BA 4IURA 1YNXA 3HOUB 1R4MB 3MTNB 4MZ9A 3WAMA 2IO1B 3HZXA 2KC1A 5AZFA 1WXMA 1YMHE 3NS8A 3PIPA 2JA8B 2V1CC 4JE3B 3ZKJC 1E7ZA 3H7PA 1Y1VG 2VH2A 3KDFA 1O80A 3PS6A 4KKTA 4RM9A 1FNUA 1UWVA 5COYA 4DHZB 2AKWB 4BBRB 2KX3A 4FJVB 1WCMG 2LGSA 3A9KA 1STGA 2BWES 1JRPA 2KCCA 1NR2A 2B8GA 3A5ZB 1Y1VH 3K7AH 2XSCA 3TZDA 3VDZA 1N5XA 3HG9A 2DZIA 3CQZB 1ZOYB 1E1OA 4FBJB 1IBML 4DHZE 3PO2G 1EY4A 2BH2A 1WCMH 3PHXB 2LI5A 2K50A 3A0JA 4KY5A 4WJ3M 2NPTB 4ITKA 4C4VA 3PLUA 1TBEA 2NTTA 4KGTA 4TVAB 2QSDA 4IOCA 3T8MA 1QZGA 5LHY1 1UE5A 5LLIA 1YVCA 4J1MA 3NOBA 3AE3B 4NZLB 5C4ZA 2UUAL 3PO2H 4IO9A 1D5XC 3S17H 2RHSB 1T6BX 4QUCA 3L13A 3L08A 2I2YA 3A7LA 4MHEA 4A93B 4RF0A 4JC0A 4B3TL 3I4MG 2UXBL 1C1YB 4L23A 3CMAA 3U7ZA 3DHIC 1I4RA 3TMEA 3CMEA 3E0EA 3RUIB 4IFDJ 1ESRA 4DV5L 2RQXA 4OX9Q 3T56B 4C3HG 4YTNB 2WU2B 2W3SA 3IBEA 3NQIA 4RNAA 1EU3A 3GTGH 5G5GA 4QMGA 3I4MH 4Q0FA 3K5NA 3KUZA 1EWCA 5EPJA 3SE0A 4GLSC 3QJZA 2PZTA 5AZGA 1V1PA 1PH3A 3R8BA 3MC9A 2BF8B 2FINB 4NPSA 1TWFH 4DXGA 3M62B 3MEFA 4BFRA 2HHHL 1PTOC 1AEXA 1YHAA 3L10B 2PO4A 1N33Q 1QG7A 2K03A 3UGBB 2KBNA 2X8XX 3IT6B 5LL6X 1OXSC 1ENCA 3CCQA 3MJWA 4KKUA 1PH8A 4JIOU 1E1TA 5M5YH 3L17A 2KX0A 2N1VA 2EXZA 1NDDA 4X3KA 4LF4Q 1NMFA 4XXEA 3P2BA 3VTWA 1SNQA 2ZPNA 5DPRA 1EYAA 4L6TB 3VR3A 1NVID 5JVH3 1F9QA 3STBC 2QDLA 4OWTB 2F0SA 2LFIA 5LMNQ 2VH1A 3ZTCA 1K3BC 2K05A 2VZKB 4DR3L 4MNOA 2AWTA 1WTWA 3DBRI 4V190 3FHWA 2E2HB 4AOFA 3HOUG 4OEMB 2Y5BB 2XRQD 3NEMA 1J0GA 1QZEA 2K3UA 3NELA 2JA8G 4GLVB 4A90A 4IM2A 5IYDG 4LDTB 4JI1L 2DYOA 4GN1A 1P8LA 1WMHA 2KLGA 3TIXA 4LNFA 2I07B 5ELEA 3LNNA 2WB1B 3HOUH 2SDFA 1AFPA 3A33B 4BBRG 3NVYA 1MSGA 3BINA 4M00A 3SU8X 3WIMA 4PMCA 1YHBA 2IHEA 2VRRB 4DK5A 4K5VA 3BVGA 2JA8H 3W9CB 3L7ZC 4FF4A 3CPWA 3SDLC 1Q0WB 4MEMA 2PI2E 1YEZA 4LNQA 1I6HB 3U9SA 4PMWA 3I8ZA 1LGRA 3LX0A 1GVPA 1QUQA 4BBRH 1X65A 5J39A 4FJYA 1K8OA 4KSLC 4IJHA 4LJZC 1EQQA 1TS4A 2MJDA 2KN4A 4XYQA 1ASZA 2GMIC 4K8IA 1VZ7A 5G5HA 1YNJD 2ZCCA 3CQZH 2B2UC 2HD3A 1BO0A 3OAWA 3HOXB 3TEWA 4X64Q 2NZOA 1MHXA 1PYBA 2LD9A 2XEWA 2E8GA 2MFIA 2SEBD 4AQYL 1W2BA 3HOWB 1KL9A 1K8GA 1ZDVA 3G48A 2HQEA 3TN2A 1LABA 2K01A 4GKJQ 4WWMA 3BYYB 2MO0A 3A56A 4XDXA 4NXMQ 3RI7C 2WINB 4HKZE 2D5GA 1HQRD 2HCIA 2L0FA 3GTJB 2E2JB 2J4XA 2IHFA 1QOGA 4DBGA 1IXRA 4DUZL 5GMVA 3O13A 1JORA 5CMDA 3GQBA 3R2IA 2BT6A 4FJZA 1EF5A 5IGCA 2KQ3A 3NBHA 2MNAA 1A3TA 2K6QA 1PRTC 2D62A 2K33A 1WFYA 2LVQA 2ZJDA 4F8CB 2WX1A 2MLBA 1ZPSA 1BCPB 3KQ4A 4WWNA 3DM3A 2F4IA 3T1HQ 1L2FA 1IBLL 2J0MA 2DZKA 2ZJQA 3Q8BA 2RA4A 1YJNA 1QF6A 4GXBA 1ACCA 3CW2C 1FVIA 3M85A 3SR1A 4KVGB 1M1KC 2WX0A 1V81A 4WORA 3B1LX 1D4BA 1T9HA 3A8KE 1CI3M 5T1GA 4B3ML 3DBLI 5IAAC 4W9EA 1N34Q 3I57A 4YSYB 1TR5A 3VR9B 5ELFA 4JQWC 1L5PA 1GB1A 1YZ6A 3T1YL 4B3SQ 3AM9A 2KYWA 1ICFB 4UY8C 3H6NA 2B39A 3CU7A 1GXDC 4IPHA 4YWLA 1LUZA 5EDSA 1W6JA 2RF4A 2E76C 2OCEA 1Q8IA 1BMLC 4DV2Q 2C60A 2IDYA 4C3IB 5IIFA 3I70A 4X3TA 1WZ0A 1YIWA 5MPOA 3HOZB 1G6ZA 3NE5B 2Q8IB 4YWGG 4MSQB 4DA2A 2E2HH 2WB1G 1JJCB 4K5WA 2RDGA 2A8VA 4HIKA 1V8CA 4PZ8A 3TP8A 1WM3A 3DUZA 1QQRA 3SEBA 3AFQA 4GNXC 3ZW3A 1MIUA 1YJJA 2HIXA 2OWOA 1V1PB 4EFOA 5I2YA 2JQRB 2CVRA 1RM6C 2GBRA 4ZRKA 2EIFA 2K14A 2L55A 3PCOB 3URYA 1GUOA 2YTVA 4MTNA 2N9EB 4QGUA 3MTSA 2PMZE 4DV1Q 1E8XA 4LNIA 3PZ7A 1OEYA 1SYEA 3U2SC 2FCMA 3SK5A 1BUVT 2Q2IA 4OELB 4A3GB 1CSQA 1I6HH 3BDOA 4PYUA 4DR2Q 3EA6A 3GZNB 3HOXG 4IN3A 4DQOC 4X6AH 2PJHA 3PV1A 3Q69A 2PKOA 3WAPA 5ELCA 1WTPA 3ERSX 3UDGA 2I5HA 4N8X1 2FJ2A 2RDHA 1LM8B 2MBBB 2K6DB 3RCZA 4KDIC 3HOWG 5L95C 1EIFA 3NVWA 2XVSA 4JK1C 1N36Q 1PGXA 2HUGA 2ID0A 1STAA 3CC4A 4EQOA 3HOXH 3GTKB 1PFNA 5IP7G 1YIJA 2UUCL 4MGYE 3RLNA 1LTAD 5JPMC 3X3NA 3HOWH 1YJ9A 4ZRQA 2N78A 1QVGA 2ZVNA 1FJGQ 3BU2A 3T9LA 3TQYA 1DOYA 2W3RA 2OJWA 4K0KL 1TVXA 1HNWQ 5BMHA 2E6XA 1XX8A 1DYQA 1LTID 3BK2A 3LJ3A 1JWMD 5IP7H 1MHHE 4AP4C 1WGHA 4ID6A 3CIRB 3SFEB 2PE6B 3FPUB 4AIMA 3PREA 4EQ5A 4HDOA 1UE7A 3GTJH 4XX5A 5DPTA 5I6YA 4ZRJA 1RODA 2I5MX 4OWXB 2E2JH 1AYFA 2V4DA 2G4SA 3DWMA 4ALPA 3HGBA 1HZCA 1L0XB 1BNZA 2DYMA 5DAUA 1WI5A 1DOKA 3FKIB 2KQ4X 3QG1A 4OWWB 3OIQA 2UXDQ 3H94A 4OL7A 4JGHB 4YSXB 5EE9A 3U8ZA 3NTKA 5IE8A 1EOTA 3I90A 3OTOL 2F3IA 3GTPB 5HGQA 1LM0A 3VR8B 2CQAA 4JBKA 4A3LG 2NR2A 1XNQQ 1OFFA 4RMAA 5I9OA 1BCPF 3TJPA 2O4XA 1KM7A 1PLFA 4JI6Q 1NCVA 3HUIA 2BBCA 2RHQB 1GUAB 3QO2A 3S24A 1KFYB 3AE6B 4X66L 2KEDA 2PPHA 4UP7A 3P42A 2DJGC 4C3IG 2Q8TA 4A3LH 1PTOD 4DPGA 3VR4A 1WX9A 2NBWB 3AU5A 4PS8A 1L0YB 2PIAA 2LJ5A 4G0NB 1TZOA 3HOZG 4WWOA 1B1ZA 5HI1A 1T3QA 1JRUA 1X1MA 3V60A 3NJTA 4CDFC 5IT9c 3DCGA 2A6ED 1WOCA 2DAJA 1XMQQ 3Q8AA 4YTMB 3OOCA 3MXNA 4LCDE 4RGNA 1DGSA 3QIAA 4C3IH 4NQKE 5EAYA 1VCIA 2K8HA 3KOJA 4TMAB 4WAAA 3EVQA 4H7BA 1HTPA 1KDAA 3PF4A 2V1YA 3HOZH 1N32Q 1W6KA 4K7UA 3K58A 3STBD 1IBKL 4W9DA 2NCNA 1J5EQ 2PVOD 2LRWA 4BZAA 1E6EB 2DBYA 1PZID 1EY8A 3NG0A 1VQCA 1WGYA 2Y0SB 4R4OA 2WXJA 1R9TB 3ZDMC 4A3GG 1SYCA 1W3SA 2B2UA 1TWHB 3I4OA 2YV5A 4K8JA 3V2TA 1SMXA 4CGYB 5J1ZA 4RHRA 1Y8PB 4DU9A 4FF2A 3M63B 4IC7B 3CXCA 4ME5A 2KWVB 2E5LL 2IX1A 4B9WA 5A35A 4N9TA 1TTNA 4J8QA 2A19A 1NMGA 2HD5B 4LNOA 1IP9A 3F2BA 3RN5A 4A3GH 2WXKA 1PFSA 3MHZA 5K36G 5M9OA 2G45B 1BDOA 2IPKD 5EPLA 4HJGE 2EJMA 3K81C 2IX0A 1SE3A 5C5MA 3CF5A 1WJNA 1E7UA 1P9DU 4U673 5I9PA 1JB7A 2WGSA 4ARCA 4K7WA 1TWGB 5KNBA 4HMIA 5K36H 3GTKH 2VB3X 3VTVA 1RRBA 3N9YC 1VCBA 1LLRD 2CJNA 4FXCA 3CD6A 3BYTB 5JHBA 3VXWA 1TXYA 3RUZA 2KVMA 3J80E 4UPAA 4A3BB 2AL3A 3JSVB 3DWQA 2OHFA 3OJ4B 1H9JA 2DHZA 4M1UB 3DVNV 1VQ6A 4KZCA 1C4QA 3AB9A 2NVUI 3FKIG 2IO2B 1QNKA 1JE5A 4JI8Q 3W1YA 2A5UA 4C7ZA 1Z6HA 3I56A 1AARA 4ZRIA 4FXKC 4C1NK 2VQFQ 3TL5A 4DK0A 4DV0L 1J7BA 4LF6Q 2JN4A 4BA1I 4JI3L 1SE9A 3T3OA 4C56C 1WD1A 2L05A 3FKIH 5E6JA 2A74C 3IG3A 3ZJUA 1HA5A 1I4PA 3PUZA 1ICWA 4TQUS 3NWSA 2KFJA 3RLFA 3W1BA 4IM3A 3H3VH 3GTPH 3HHMA 2N1WA 1ZXIA 4OZCA 3QR8A 2NUCA 2WQYB 2LXKA 4I7AA 3CF6E 1PRTD 2M00A 3PUYA 5EE0A 4NB3A 2DNFA 1I7HA 2KJ6A 2PLPA 3D31A 3JAMc 4LK0M 4XC2A 1A8VA 3TS2A 4KSKC 2HJ1A 3ZGZA 4KHPL 3VHTC 1EZ6A 1CZWA 4DN4M 2UXCQ 2GOWA 4AH6A 2V3PA 1IBXB 4JLCA 4G3XB 1E0BA 2D0OA 1XLNA 1BCPC 3E5SA 2BA1A 1EY0A 1IKLA 2MW5A 1JE4A 5CTRC 1C9FA 3EGRA 3P20A 1I35A 1UEBA 1E90A 2MO1A 4MH0E 1CZPA 1MFWA 1SROA 1K8MA 1G8ZD 1S3SG 3VRBB 2CQOA 2M4NA 5LMUQ 3M3JA 1DJRD 4KGRA 2BYVE 3K7UC 3LWUA 1RL2A 3E9IA 5IODA 4BXXG 2JRIB 2GBJA 1YQBA 1LTSD 3MJ5A 1HJPA 4JPBW 5C5LA 2K1FA 3I7FA 4IFDI 1STNA 1RTNA 2L11A 3WOEA 4DXFA 5KIXA 4JV5Q 4PYZA 2GVAA 3OHXC 4A3DB 1R9TH 1CKOA 5D2MB 4DUYL 4A3CG 3P63A 2F03A 4F1SA 4BXXH 1TWHH 1SIJA 2D3GA 3GP7A 3HVZA 5BN5A 4KI0A 1Q7YC 1EYDA 2AYOB 2KCNA 3UI2A 5CHWA 4IUMB 3MXGA 1RJTA 1JWSD 4NQLB 3RNAC 4IUPA 1ESFA 4CKEA 3D6CA 4W9GA 2RSNA 4A3CH 3I3CA 2LY7A 1AE3A 3BG3A 4YCVA 2KDFB 4DAYB 1VQ8A 4HJKA 4DR5Q 3PIP3 1X3EA 4XYCA 3V3XA 3OW7A 4HAEA 4XT1B 2BYEA 1FO4A 4GN3B 1RTOA 1XEEA 1FXIA 1ML0D 2WXFA 3RD2A 1RIPA 1KOTA 4A3BG 2RPQA 4P7IA 3CSFA 1I4QA 2NPTA 2EE1A 2I1KA 1TWGH 2KCMA 4S17A 2AUJD 3NXWA 4YL8A 3M4YA 2WLBA 4H02A 1EWYC 2KT7A 4ZDVA 4IWPA 1K9MC 2CKZB 2B2TC 5GROA 2KC2A 3CCEA 4FVMA 2D5DA 2L32A 4HSVA 2MJ3A 1FIQA 4JI0Q 4A3BH 4BBSG 2DENB 5EKKA 1KLVA 4W9JA 2INNE 2VQEL 4DK1A 4L8JA 2BS3B 2BDOA 4IKGA 2EJGC 3HOVB 4KHVA 1M8AA 3H1UA 4A3IB 1X3QA 2AWNA 1FFUA 1F2YA 4KIKA 4DNRB 1Q86C 2D07B 2PE9A 2TSSA 4MJSB 5T8IA 2PCFB 3VH3B 4CO7A 4A20A 3PLVA 5DNFA 2KEEA 1DD2A 4KGSA 4BBSH 3NSWA 3DBHI 3NY5A 4A3FB 1ZXTA 3TZUA 3QWNA 1CA5A 1PDXA 4JYAL 1KLUD 1ASYA 4FLHA 1I42A 4FXGC 4W9KA 2JA9A 3TBIB 1SB3C 3VA7A 2VNUD 4BA2I 2QIEB 3RT3B 1CTMA 1NAPA 1EQTA 5C44B 1KNAA 2KDIA 3QCAA 3S9WA 2GI9A 4JI4L 1Z47A 1SJHD 2L83A 3KYDD 4KD3A 1QT9A 4O1NA 1F77A 2NN6I 2J0KA 4RCNA 2I46A 3AEFB 3CRKC 1X9NA 1TY0A 2F0UA 1T0RC 4MELA 5KHQA 5IY0A 2FHTA 3S2DB 4HIOA 2TMPA 1VDZA 3WAOA 4A3MB 1AP0A 4LJPB 1NR4A 1CA6A 3H3VC 2PEAA 4RGOS 1S40A 1JMCA 2K39A 1ZKOA 1HRJA 1IYFA 2HT1A 1EQRA 1O7ZA 1VF5C 4OIJA 1PV4A 1SYGA 4LF8Q 2F4VL 2O2VB 1F2LA 3HKZE 4A3DG 1MVKA 2LXAA 3EJIA 2RSOA 4IUUA 3M95A 3U4VA 2QW7A 5C4HA 1A2TA 2KN5A 4RFBA 4YHHQ 3DVNU 4CBVA 2GN5A 3OMCA 1F9JA 3RNCC 1Y69U 2AWOA 3OIPA 4HR7B 3TEHB 3UDFA 1EF1A 3J81c 4DXAB 4C3HB 2YTXA 1PH6A 4NP5A 2G3QB 2KJHB 4IZ8A 3IAS1 3OW2A 4A3DH 1WTVA 1SNMA 1S5BD 4WJ4A 1MI2A 2IO0B 4BVUC 3IT4B 4KN4C 2REXA 4EZLA 1V43A 1TWCB 2K5WA 4GOPB 2OTJA 1UEAB 2OT2A 1Y8RC 1L2NA 4TUUA 1L6VA 3JAML 4YY3Q 3J81i 4BKSA 2B3AA 5AJ3Q 4HPPA 3LB8C 1HCZA 1YBYA 1WJ6A 1XLOA 2F0EA 1K8RB 3KLSX 1NNXA 4CDDC 3ML9A 4USAA 2VL6A 5FLXc 1QOAA 5EGTA 4QL5A 1IPGA 3HM6X 2Z6KC 4LLGM 1U4MA 4PT5A 3N30A 1K50A 4NKLA 2R93B 3H15A 3J7AF 3E0JA 4ANXA 3Q3OC 4UP9A 3EFXD 3RR5A 3HOYB 2INCC 3I63C 2H1EA 5GXGB 4A3IG 1KF6B 2JU6X 5FR6A 4DR4L 2MHVA 1L0WA 2KMAA 3VAWA 2VXWA 4JOIC 2F3VA 1E8WA 1YN4A 4TQ1A 1G91A 1GHKA 5JHAA 3D8GA 4A3FG 3MFYA 1I94L 2K04A 4RGMA 2EYHA 1IBMQ 4DR7L 1UF0A 4UP8A 5D7GA 3HOVH 2EY6A 4A3IH 1BBUA 3D4DA 1J7CA 1YJIA 4BKSD 4XYOA 4OIKA 2Z8LA 1G2TA 5C44G 3TUOA 1XD3B 1E7VA 4H2AA 2R61A 2JXMB 1K53A 4A3FH 4LK1C 5H1SE 1RDPD 4HPLB 1UAPA 2UUAQ 3UE1A 3RZDB 4IPDA 2KJXA 2QGQA 5JJKA 3B6YA 1YITA 3JYUA 4B3TQ 2ZXRA 2BS4B 1HTQA 4YCWA 2PZUA 5C44H 2MX2A 1Q1BA 1E5WA 4M8MA 3G6EA 3HKZG 2F0NA 1C0AA 4KLKA 3AEDB 2EKEC 2KZRA 4BBNF 4A3MG 4ZHOA 4DV5Q 5D94A 2QCZA 1UBIA 1PDQA 4EZJA 3KF6B 1P16A 4GLAC 4UHVA 4XDDA 2ZNVB 4YSZB 3S2DH 1UWMA 2KK8A 4LAAA 1CFMA 2Z0DB 3SHLA 1SMYC 2LEKA 1ZW7A 1WWTA 4A6QA 4A3MH 2WDVB 4WJQA 1FEHA 3FEWX 2HHHQ 3ZNZB 2WAQE 4HXDA 1CKMA 1RF2D 2XRSD 5EBCA 3CRLC 4XQQA 4KIKB 1JJGA 4DNIA 2NVTB 3RLOA 4WJPA 1BCPD 4ABNA 1P7EA 1YNTE 4OW0A 1Q81C 5EKIA 3N52A 1SFOB 4V0BA 1HTLD 3BK1A 4JVZA 1HE8A 2KQSA 1S5ED 3PQIA 5CV6A 2WDQB 1XTCD 5D14A 4PQXA 1C9OA 4C3HH 2XGTA 5BMGA 2FIDA 2N9LA 4DR3Q 1FYCA 2V4IB 1VQAA 3PGEA 3K59A 1YOVB 2JP1A 4DV4L 3ONAB 4W9HA 2R3ZA 3K5OA 1SJED 2A6EC 1UGMA 1TWCH 1QWYA 4BY1B 4EQPA 2LASA 3JW0X 5C0XG 2B2TA 3MEHA 1HNZL 4PK1A 1NSNS 4JI1Q 2DNEA 3TREA 1B53A 2R93G 1VQKA 3M7NA 4MDKE 2BYTA 4P75A 4KDLB 2CJOA 2HTHA 3AI5A 3HOYG 2RDFA 3GTLB 4GU2A 4I7ZC 2KDEB 1E8ZA 1S4ZA 3Q3MC 5C0XH 3TCAA 5JEAG 1FRRA 4I65A 3WALA 5FO8B 2W55A 2JYOA 2R93H 2BWFA 4Q5VA 3BVZA 2DYBA 2IY1B 5AUKA 4K81A 3W1SC 3HOYH 1F9RA 4B9XA 4AS1A 1XLPA 1QVFA 3T4AC 2DWQA 2RMMA 1WYWB 1ISNA 4US9A 5BR8L 5CHFA 1GO3E 5JEAH 1VQOA 1O7LA 1FMAD 4DDID 4NNJB 4YXDB 2PYKA 3NS1A 2EKIA 2E3TA 1S5CD 5JJLA 2L0CA 3K5LA 1EWIA 3J81L 1XCQL 2IT1A 2A1AA 1XJVA 1A63A 2RBMA 5IYDH 3R7QA 4E3CA 3BZCA 3AE8B 2WXMA 1BBXC 4G11A 4XZ4A 1NE3A 1U4LA 3EBEA 1QKZA 3TS0A 4DV6Q 2OEDA 4K2LA 1D8LA 3IRBA 2DUDA 4Y7NH 2IBIB 1V9PA 1F2MA 1WVLA 1UELA 2C9WB 1QOFA 2Z59B 5J18A 1X54A 3QOJA 1SNCA 3RZDH 1PH2A 2NWGA 2G4DB 4NAWB 2LGYA 3RYTA 4P73A 4DV3Q 2QDBA 5BN3A 3F1ZA 5DPWA 3PF5A 3B0AA 2FBWB 1ET9A 1C4PA 4IALA 5LMNL 4DV7L 3L54A 4DUZQ 5FLXL 3L4PA 1FNVA 1J6QA 2R6GA 2EYFA 1R4PB 4OONA 4EVOA 3ITPA 1HR0L 2WXPA 5AZHA 1LACA 1PVOA 2F0HA 1FM0D 5CHVC 1IL2A 1PQSA 1KDBA 2FFKB 4LF5Q 5JVG3 1SNOA 1TYGB 4A76A 3RULA 2UU7A 4JBJA 2C5LC 2N7JA 3JVZX 1SLJA 3VFKA 2MJ8A 4LFCQ 5M5XB 2KDBA 2F0VA 4LFBL 2ZEQA 2UU9L 1YN5A 1AZQA 2BYFA 4LTUA 3VYSA 2NTSA 2P5ZX 4DWFA 4NXNL 1JJ2A 4HJ8A 2F0QA 1HZ6A 2IW3A 4H44C 3TEZA 3R93A 4IOAA 2NVTH 1MPEA 1D1IA 2ACZB 1B8AA 4B3MQ 2CHBD 1MG4A 1HZ5A 3R3OA 3RPFC 3A8IE 2X6GA 2K5HA 4CKBA 3T1YQ 4B0EA 5C2TB 4P74A 4E6IA 4JW0A 1SFOH 3UIPB 1L4DB 2I0QA 2F0IA 2CWPA 4BY1G 1QNUA 4HJ5A 2Z6KA 5C0XJ 1NI3A 4DAVA 2DY7A 2V3SA 3MZ5A 1GUWA 1UZXB 4EQNA 3H0GB 5A2QE 2G9DA 3SK6A 3WWVA 3KJOA 4P6VF 4BY1H 1ZYRD 1XYIA 2D0PA 2M9VA 3ZJVA 4M0WB 4JOIA 3T16A 2ON8A 2PW9A 5JEAJ 1PYSB 1VQ9A 2FUHB 2UUBL 1S5DD 2E2IB 2V4LA 2WIIB 4L5SA 3AH7A 2BTEA 4K7SA 1D5ZC 2X38A 1VF7A 3GTLH 2ASBA 5J17A 1STYA 3PRPB 1YQ4B 2C35B 1E9MA 3OJ3A 1FGBD 4GOPC 3NENA 2PMZB 4CDEC 1VQNA 1E2VA 3AE2B 3I5JC 4X3SA 5E4XA 2H5XA 1ZGUB 3HVDA 4XT3B 2SNMA 1KC8C 3PIOA 1BBWA 3Q8EA 1GB4A 2L3ZA 3JSVA 2BVCA 1H95A 3KVFB 4CYEA 3PHWB 2B8FA 1Q10A 1WXSA 2L1AA 4DR6L 2MQJA 1FD7D 3ZXRA 5AUIA 3AMZA 3EROA 3GZNI 4KK7A 2JEAI 4X3UA 3TMPB 1LFDA 1SEBD 1EQVA 3I4NB 5BYSA 1TT2A 5CBAE 4KV2A 2UUCQ 3IAM1 3DXJC 3NUHB 3CCRA 1ET6A 1XQQA 5E7NA 4ZKBB 1KQSA 4B3RL 1Z9FA 4K0KQ 1AN8A 2KLCA 3NRZA 3TEXA 1N34L 4TKOB 5EE1A 5IGBA 2ASQA 2C7HA 3X0WA 4RM8A 3NTHA 4QQBX 3LDZE 3IKJA 4MTKA 2F0LA 2NYZD 3VDYA 4FXDA 1V86A 4Z9CB 2LXCA 3T3NA 2YLMA 1TZ1A 5FO9B 4NPNA 4ZLTF 1A70A 2EMTA 4S3SA 1JW9D 3U50C 4A3JB 1VQBA 1BT0A 1KNEA 3NTIA 1K52A 1GAQB 5AEKB 1B9NA 3OWEB 3I4LA 1SDFA 1IBXA 1NTGA 1NI2A 5LXIB 1FR3A 3OTOQ 1E10A 5HHDG 1GM5A 1RWSA 5M5XH 5M3FB 2DX5B 1TS5A 4URKA 3DLLA 2F0WA 2O6VB 3NZUA 3GV3A 3VTUA 1SE2A 2XN9C 5FR3A 2J42A 5IYCG 4N9PA 1TY2A 1EOVA 2N49A 3ZJYC 4HJ9A 1SMYD 3HM3A 2VY3A 1M90C 2N88A 2L5TA 4X66Q 1F9SA 3R3MA 1CMXB 3E3XA 4K5XA 1VQFA 4OZBA 3TP6A 4P16A 2ZNVC 1M4VA 2O5IC 1OXTA 2C5CA 1AH9A 2KAJA 3TP5A 3SFDB 2QMTA 2BS2B 2HJ8A 3C2PA 5IYCH 3H0GG 2N0SB 1ZXHA 4GSWA 3Q3FA 1A5RA 1GC6A 2WXHA 3FKYA 4MSMB 3AE5B 3E56A 3CC2A 4OO1I 2INPE 3DMUA 1GHJA 1YI2A 3PRMB 1WYGA 2LXJA 4ZRPA 1A15A 2OEOA 4HCEA 1RAXA 2EY5A 3IHPC 2JK8A 1IBKQ 3RN2A 2H4OA 3W1SA 3H0GH 1TKWB 3M4QA 1FRDA 1LO5D 1DOXA 5IGFA 3A5UA 2L8JA 5IWAL 5G55A 2K5NA 3U4ZA 4DAYA 2Q8RE 2K8BA 2KNBA 3N1ZC 1K73C 1A0IA 2AEHA 1UD7A 1OQRA 3HFZB 2JSVX 2L0TA 3C46A 1EIYB 2C7NB 3ALBA 1U4AA 2J52A 2E2IH 1V5TA 4ILWA 3OPOA 1YX5B 2M56B 2E5LQ 5C6AA
chains in the Genus database with same CATH topology
3ERQA 1HFNA 3DHQA 1BUIC 1N61A 1HPCA 3S15B 4K14A 1E2ZA 4FYDA 1CK1A 3L3OC 2WXGA 4H0LC 3KUPA 3VYUA 2MJEA 3PO3B 3P1HA 3I91A 2LMCB 1ENFA 1SYDA 5KRUA 1DOLA 4A3EB 4FNFA 1DCZA 4QF4A 3AV8A 3LXFA 5CGKA 3P4SB 4REZA 1D5MC 3EUB2 1OXVA 1OXUA 3W5VB 2HDMA 2HDEA 1ZDXA 5DM63 1KH0A 4RGTA 3Q8CA 2NBFA 1EEID 2L9HA 1G291 5CR3A 2F0KA 2IGGA 2E74C 4C80A 5IT9E 1YN3A 4G7HC 3K0YA 5JJZA 4RA8A 3AEEB 3P7JA 3VA5A 2F0GA 1EY5A 3RMHA 3UI3A 1D6EC 3VR5A 1DONA 4BBSB 5M5WB 1WD0A 4RH6A 4OHJA 1GUNA 3SR6A 3NQTA 3CHBD 1JROA 1SNPA 1DXMA 2F0JA 4QB4A 2M19A 1RCVD 5ISRA 2PW7A 3LYYA 2EYOA 1IYVA 3K5MA 1JALA 4GZYC 3PZ8A 2PNRC 1WXQA 2G1EA 2FMMA 1II3A 1RD9D 2F0TA 1LTRD 2X6LA 1VDVA 2WU5B 4YTPB 3A54A 1IGCA 2JYEA 4RAUC 1TKEA 4F88A 4BY7B 4HKQA 2NB0A 1U4PA 1QOBA 4WQMA 3SDZA 4XQNA 2KHSA 1AW7A 1DGJA 1I4XA 2WP9B 5I2XA 1F2ZA 3HP3A 1ENAA 1EWHA 3AB5A 5D7GA 4L2YA 2EYJA 4P2CB 3VYRA 3K57A 4EE2A 2I38A 3BIID 2PQEA 3V05A 3MXUA 1EIGA 3IXSA 4MM3B 5JOBA 1I3QB 4M8AA 4F7XA 1SYBA 1HA6A 2F0OA 1ZE3D 1L6UA 3AE9B 1Q1EA 5CV4A 2BW2A 1Y1WB 1WTOA 3J7YW 1ROEA 2GB1A 2LHEA 3MFGA 2A68D 1OXXK 2H89B 3NHHA 5EJWA 5FKAC 5D65A 5E3FA 2JA6B 1IL8A 2JZPA 2W54A 3T51B 3M7GA 2A6HC 2EZVA 1PGBA 4IQZA 3GTOB 3AN1A 5CV9A 1C77A 4CJ0B 2J7ZA 3J7AV 3J80L 1XWEA 4JWSC 4O42A 4AQ7A 2BDNA 1MBYA 2DN8A 1VRAB 5E4WC 1JOOA 1XLQA 3AMUA 3LWEA 2Q5WD 3U9OA 1FCLA 1C4CA 2JWUA 5AFWA 1OQQA 1CZGA 3P1MA 4N6EB 4JX1C 2KUMA 1HEZE 3D4RA 1CT1D 1MD2D 1EYCA 3HKZB 2IJ0A 4GDKB 2K5DA 1B9RA 2RPVA 1FFVA 3FDTA 1BXTA 4KY7A 4FF1A 2JX5A 2Y5CA 1DZ1A 3AEBB 3MWYW 3AECB 3C3LA 2OF1A 1J7AA 2R92B 4A55A 5CV7A 4R8NA 1HXYD 3X3MA 1KTKA 2JYTA 5M3MB 3PO0A 3AE1B 1ZYRC 4ZRZA 1L4ZB 2XNAC 1VMCA 1R7SA 2PTLA 1A3UA 2KECA 1PTOF 3WOFA 4F87A 4HN7A 2O2LD 4NAMA 3KBGA 3H8HA 3Q23A 5CYUA 1E0ZA 1Y56A 1B50A 2EELA 3TSSA 1IW7C 1PYWD 3TEYA 5T1IA 4TQ0A 3IAYA 1JC7A 4ARIA 2D9UA 4ZHPA 3U4EG 2NZ1D 2V3NA 4KKIA 5H92C 3E9SA 2MPMA 1N63A 5NUCA 1LT5D 4MIUA 1AZPA 1X32A 4KTAA 2J0TD 5CC4A 1WGKA 4OVZA 2DY8A 3J81E 1B3AA 4C3JB 4Y7NB 4KJOA 3P4QB 1KRHA 2XIWA 2LS01 1IKMA 4J6HA 1CJEA 3IFDA 1SE4A 5C4XB 1JOKA 1KLGD 1F2RC 5HG2A 3FMCA 3AU7A 5EQ0A 4PNYA 2WAQB 2F0FA 1JQYD 2EYLA 3MAQA 3SVMA 2A5HA 4ZKCB 4B08A 5FLXE 4GDLB 4M0WA 1YNND 1N60A 2M2LA 3MVVA 2B2VC 1IUEA 5IOCA 2ZXOA 3P75A 1V1OA 2EPBA 2QF7A 1BOSA 3PUVA 4Q2JA 1H9SB 5DEHA 1WTXA 1KDCA 2NN6G 5KYIA 4B0MA 4A8XC 3RZOB 2EVBA 4DFAA 2WXRA 2JSOA 1SBBB 1PZJD 1BQQT 4RF1A 3T53B 1PRTF 1ZP0B 2NN6H 3ND9A 1UGJA 2KOLA 1QB5D 3NP8A 1B2TA 1TS3A 5H8YE 4MH8A 1EM7A 1QILA 4HTHA 4AYBB 3EQLC 3PIO3 1KABA 1SAPA 2PZWA 2D2CC 3FVQA 2NVQB 3H91A 1EU4A 2Y3AA 1GJXA 2WV6D 4QUFA 4JPSA 4EGVA 3S1QB 2WS3B 4CJ1B 1PUTA 4BWGB 2LHDA 4XE0A 2CW0D 3DWGC 5FOBB 3M4OB 5CORA 2FMCA 2YEPF 1WRIA 1RKNA 1D1KA 3NPPA 4IUNA 4DAPA 1JWUD 4U68A 3CKIB 1XF5L 3BVMA 4XQJA 4KV6A 2ZW1A 4C3JG 1EEFD 1B44D 4JBWA 2DLBA 1ONLA 3QJYA 5I4DA 1WTRA 4XTCS 2A6HD 3A55A 4KKSA 3IL8A 2AQ1B 4TSSA 1Y8NB 1HHVA 3DEOA 1UNSA 3B2FA 2V0GA 1IYUA 4N59A 1JCKB 1LT6D 4WJWA 5LNK1 5BMIA 1CQFA 1C8CA 3ETRA 1VR9A 3MP9A 5CBEE 2ZT9C 1EY7A 2WACA 1V8QA 3FILB 1B4OA 4FP5D 4ZUIA 2F3WA 2WXLA 2BA0A 5HGTA 3QOLA 4YT0B 4G57A 5K5PA 3BWUD 2B2WC 1STEA 3R2TA 1I6VC 2MUYA 5EBDA 3MXPA 2XWBB 1FCCC 4WIPA 4G7ZC 3VQIA 5IGDA 4IDIA 2QEJC 1A3VA 3S1RB 1L0VB 3Q22A 5HFYA 3HEJA 4KD4A 1D2BA 1H9KA 4CJ2C 3H09A 5DM73 2SNSA 2AX5A 2LMCA 3P4RB 1CHQD 2QKIC 5C4JB 1TWAB 2W82A 2QJLA 2K0PA 3NBIA 3B9JA 2WXIA 1GUSA 1O78A 4A9AA 4MN3A 4A3KB 3TP7A 3ABVB 2RVLA 4WAFA 2ZW0A 1LTTD 2R7ZB 2LFNA 3FPPA 1OO9B 4FF3A 2K6AA 4RCOA 5G3LF 2LJIA 3ZYYX 4D2KA 2N55A 1C79A 1PGAA 2IX3A 2WNMA 1IW7D 2NMQA 3IFTA 3MC0B 2JXTA 2MEKA 3S2HB 3BDLA 3SXHA 3C1EA 4KJNA 4R8IA 1GOZA 1EZ8A 1MSHA 4XWTA 3A7AB 2HTME 3AE7B 1CHPD 3W3AA 1C48A 2PPBC 1MI0A 2A68C 1TS2A 4XDCA 4HEDA 2BOSA 3RD4A 4RKBA 2B2VA 3RFZB 3KLSA 3D3RA 4K6DA 3KWVA 2IL8A 2G9HD 2L1BA 3E6ZX 5FO7B 3VR2A 1A6XA 1VLBA 1C78A 5IGGA 3N6RA 3PUXA 4RKLA 3KBXA 1J8IA 2E2DC 1PFDA 1ILPA 2M0AA 2LKVA 2SAKA 4KHZA 4ZOHC 1STHA 1S5FD 1J9OA 1NYQA 1SF0A 5EPKA 1PXUA 2J53A 1H9RA 1JR0D 4IUQA 3P4PB 1LTGD 2B2YC 2ENBA 4F8MA 2F1MA 1TJEA 1GPXA 5KYLA 1R4QB 4G7OC 3D6WA 3Q6SA 3GTQB 4OZAA 2AQ3B 4XIGS 2ZXPA 3DM1A 3C1FA 3ND8A 4K2KA 4HEA1 1F0ZA 2DNCA 2FUG1 2L52A 2LUMA 1K83B 3S1MB 4BS9A 5TSSA 2A69C 5E1FA 2L12A 3Q24A 1SXTA 1K51A 4R9WA 4ZYSA 5BYRA 3NUCA 2H88B 3KK7A 3WDNA 1YQ3B 1IGDA 1ZUD2 4XWWA 1PFBA 5A2QL 4DGZA 5C3EB 4TRDA 2WXNA 3PV0A 3PUWA 3GB1A 1XXGA 2F0DA 1EY9A 2L4NA 2EOTA 3S14B 3L9AX 3GV6A 3HRZC 3BZDB 1QCBD 2EY2A 1U4RA 1Y8OB 3A8JE 3NVVA 1JICA 2C9OA 2CU3A 4IOIE 2K5PA 4ODGA 1LV9A 1X3PA 2Z1CA 1C4AA 2PVGC 5HURA 2BE5C 4WURA 2WKDA 1QE6A 5JAVA 4WRDA 2JE6I 2K22A 1H9MA 3S1NB 4C7YA 2HDLA 4N58A 1O7YA 1TIID 1C76A 4IUTA 1JOQA 3FC4A 1WTQA 2JA5B 3Q0AA 3B2GA 3ZJTA 4NMZA 1N62A 3C8YA 1BR9A 1I50B 3DWAA 1G2SA 2B2WA 1F2RI 3F2UA 4C2MB 2MH7A 4HMJA 3ZQ4A 1QOHA 4J3OD 1IHZA 1STBA 1VZ6A 3Q8FA 3OMGA 1SSNA 1SNDA 1U9RA 4NDXA 3S16B 2BB6A 4UAIA 3DWPA 1LT4D 4HROA 1RFKA 2WP8J 4QCLA 4MT5A 2BCOA 2Z4IA 1LT3D 3W2DA 1I4HA 2K3UA 1B9MA 2ONQA 2RKSA 4KN7C 3MA2B 1VJKA 1Q90A 3TDQA 1JB3A 1JWBD 1HFGA 1YNNC 3D4WA 4G4KA 3BS1A 4CHTB 2ICIA 2QCPX 1WSPA 3GS2A 4HSPA 2YU9B 1TKYA 2O5JC 1EFID 4ZUJA 3M3YB 3GD7A 4RWSC 2WDRB 4KY6A 3GTMB 2WXOA 1CM9A 2NVXB 3KF8A 4OO1G 3CWIA 4CKCA 3T13A 1P7FA 5D3DA 2EY1A 2IWHA 3WCQA 4US8A 1QJOA 2JA7B 1ILQA 3H6MA 1HUNA 4HRSA 4OO1H 1BF4A 1TU2B 2K28A 4PMBA 1FD6A 2K7VA 1PTOB 3J9CA 5ELDA 4KX6B 3OSOA 4QIWB 2KA7A 4DF7A 4DNTB 4NJCA 2VB2X 2ICEC 4ZK9B 3KWLA 2LGIA 4ULLA 1GUGA 4H13C 2EYPA 2CW0C 2E75C 4ZAIA 4MACA 3NWTA 3PMFA 5JPNC 4C1NI 1EIHA 3K6OA 3JAME 3KLRA 2GRIA 2F0MA 3GO5A 4YIJA 2A73B 1FXAA 3DEPA 2B63B 2KACA 2B2YA 5CV5A 3V96A 5KNDA 1SSOA 5G5GA 1UUPA 3I72A 5C3JB 1E2WA 1TKGA 4RHSA 2VUMB 5IGEA 3HS0C 3G6JB 4FO2A 2NVYB 3NK9A 5KGUA 3AE4B 2EJFC 2GA4B 1VMPA 2IGDA 3OWFA 1N5WA 1H9SA 4WH4A 3G7LA 5IT9L 2K32A 5I6WA 3AEGB 1Q3LA 1DOMA 2MGSA 1DM0B 3NVZA 1RHPA 2QILA 1SYFA 1PZKD 1FNWA 1XCTL 5D3IB 1TQOA 4KKJA 1DOIA 3VYTA 3I9V1 2AQ2B 5KNCA 2KMMA 1EL0A 4K6LA 1NYRA 1V97A 4CQNA 1YNJC 2B76B 3NZ3A 5F2DA 2OXPA 3QB3A 5LL6S 1Y1VB 3K7AB 1QLBB 2FE8A 4OGQC 1UWXA 1HQMC 2KWDA 3FRPB 1F9PA 2A69D 1WCMB 1MGSA 1E7PB 4PV1C 1KAAA 4UDUC 1HUMA 2WXQA 4LMQD 1NUCA 2K1BA 1PRTB 4NW2A 5JXVA 3PO2B 3S17B 1VZ8A 4HCSA 3HRDD 3U52E 1I4GA 2KDMA 2XWJB 1JQ4A 4R3DA 4IUVA 1PTOH 5J22A 2N9KA 4WFN3 4L63B 2X69A 5BN4A 1NENB 3GTGB 5C0XI 5FK9C 3I4MB 2MP1A 5G3LD 5ELBA 3FAHA 1PMRA 3SK8A 1CQVA 4IFDG 2WKCA 1AWDA 1TWFB 2EDGA 4ZQ3A 1Q12A 5C3WA 2BE5D 3VR6A 2YEPB 1A2UA 2PW5A 2IGHA 2HCCA 5M5YB 3VRAB 2BB5A 1T5EA 1GUTA 4IFDH 2SOBA 2PMVA 1XO3A 2YYZA 1RYJA 5C3XA 3I73A 1ZEQX 2Y5PA 3BDCA 2K9XA 4KMUC 3AEAB 2VZKD 1JMLA 3FILA 1EY6A 5BYQA 3W5UB 3MHBA 3SK4A 2JEBI 2F0PA 5CV8A 2AUKA 1PFMA 2Z4HA 5EKLA 1Z7TA 1JWAD 2K5QA 1NEKB 1T5XD 5KEEA 2EYMA 1LTBD 4L1BA 4IURA 3HOUB 3HZXA 1YMHE 4JE3B 2JA8B 1O80A 4KKTA 1FNUA 5COYA 4BBRB 1STGA 1JRPA 2KCCA 1NR2A 2B8GA 2XSCA 3TZDA 1N5XA 3HG9A 3CQZB 1ZOYB 1EY4A 4KY5A 4ITKA 2NTTA 4KGTA 2QSDA 5LHY1 4J1MA 3AE3B 4NZLB 5C4ZA 1D5XC 1T6BX 4QUCA 2I2YA 3A7LA 4MHEA 4A93B 4RF0A 4L23A 3U7ZA 1I4RA 3TMEA 4IFDJ 1ESRA 2RQXA 3T56B 4C3HG 4YTNB 2WU2B 2W3SA 4RNAA 3NQIA 1EU3A 4QMGA 4Q0FA 3K5NA 1EWCA 5EPJA 3SE0A 4GLSC 2PZTA 1V1PA 3R8BA 2FINB 4DXGA 1PTOC 1AEXA 2PO4A 1QG7A 2K03A 3IT6B 5LL6X 1OXSC 1ENCA 4KKUA 2EXZA 4X3KA 4XXEA 1SNQA 1EYAA 4L6TB 3VR3A 1NVID 5JVH3 1F9QA 2F0SA 2LFIA 2K05A 2VZKB 1WTWA 4V190 2E2HB 2XRQD 4A90A 2DYOA 2I07B 5ELEA 3LNNA 2WB1B 2SDFA 1AFPA 3NVYA 1MSGA 4PMCA 4K5VA 3BVGA 3W9CB 3L7ZC 4FF4A 1I6HB 3U9SA 4PMWA 3I8ZA 3LX0A 5J39A 1K8OA 4LJZC 1TS4A 2MJDA 2KN4A 4XYQA 4K8IA 1VZ7A 5G5HA 1YNJD 2B2UC 1BO0A 3HOXB 3TEWA 1MHXA 2SEBD 3HOWB 1ZDVA 2HQEA 3TN2A 1LABA 2K01A 4WWMA 3BYYB 3A56A 4XDXA 2WINB 4HKZE 2D5GA 1HQRD 2HCIA 3GTJB 2E2JB 2J4XA 1QOGA 3O13A 1JORA 5CMDA 3GQBA 3R2IA 2BT6A 5IGCA 2KQ3A 3NBHA 1A3TA 1PRTC 2D62A 2K33A 1ZPSA 1BCPB 3KQ4A 2F4IA 1QF6A 3Q8BA 2RA4A 1ACCA 3M85A 3SR1A 4WORA 1D4BA 3A8KE 1CI3M 5T1GA 4YSYB 3I57A 1TR5A 3VR9B 5ELFA 1L5PA 1GB1A 3AM9A 2B39A 3CU7A 1GXDC 1W6JA 2E76C 1Q8IA 1BMLC 2IDYA 4C3IB 5IIFA 3I70A 4X3TA 5MPOA 3HOZB 1G6ZA 3NE5B 2Q8IB 4YWGG 4DA2A 5EE3A 4K5WA 2RDGA 1V8CA 3TP8A 3DUZA 1QQRA 3SEBA 1YJJA 1V1PB 5I2YA 2JQRB 2CVRA 1RM6C 2L55A 3URYA 1GUOA 3MTSA 3PZ7A 1SYEA 3U2SC 3SK5A 1BUVT 4A3GB 3BDOA 3EA6A 4DQOC 4IN3A 3Q69A 2PKOA 5ELCA 1WTPA 2FJ2A 2RDHA 3NVWA 2XVSA 4JK1C 1PGXA 2HUGA 2ID0A 1STAA 4EQOA 3GTKB 1PFNA 1LTAD 5JPMC 3X3NA 4ZRQA 1DOYA 2W3RA 1TVXA 5BMHA 2E6XA 1XX8A 1DYQA 1LTID 3BK2A 1JWMD 1MHHE 4ID6A 3CIRB 3SFEB 3FPUB 5I6YA 1RODA 1AYFA 2V4DA 3DWMA 3HGBA 1L0XB 1BNZA 2DYMA 5DAUA 3FKIB 1DOKA 2KQ4X 3QG1A 3OIQA 4YSXB 3H94A 4OL7A 5EE9A 3NTKA 1EOTA 3I90A 3GTPB 3VR8B 2CQAA 1OFFA 5I9OA 1BCPF 2O4XA 1PLFA 1NCVA 3HUIA 2BBCA 3AE6B 3QO2A 1KFYB 2KEDA 3P42A 4C3IG 2Q8TA 1PTOD 3VR4A 1L0YB 2PIAA 1TZOA 5HI1A 1B1ZA 1T3QA 2A6ED 3Q8AA 4YTMB 3OOCA 3MXNA 4RGNA 3QIAA 1VCIA 4TMAB 3EVQA 4H7BA 1HTPA 1KDAA 1W6KA 3K58A 2PVOD 1E6EB 2DBYA 1PZID 1EY8A 2Y0SB 2WXJA 1R9TB 1SYCA 2B2UA 1TWHB 4K8JA 3V2TA 4CGYB 5J1ZA 4RHRA 1Y8PB 4DU9A 4FF2A 4ME5A 2IX1A 4B9WA 5A35A 4N9TA 4J8QA 2WXKA 3MHZA 5K36G 5M9OA 1BDOA 2IPKD 5EPLA 4HJGE 2EJMA 2IX0A 1SE3A 5C5MA 4U673 5I9PA 4ARCA 1TWGB 5KNBA 4HMIA 5K36H 2VB3X 3N9YC 1LLRD 2CJNA 4FXCA 3BYTB 3RUZA 2KVMA 3J80E 4A3BB 3DWQA 2OHFA 1H9JA 4M1UB 1C4QA 3AB9A 1QNKA 4C7ZA 1Z6HA 4FXKC 4C1NK 4DK0A 1J7BA 4BA1I 3T3OA 4C56C 1WD1A 5E6JA 2A74C 3ZJUA 1HA5A 1I4PA 3PUZA 1ICWA 4TQUS 3NWSA 3RLFA 1ZXIA 4OZCA 2NUCA 2WQYB 1PRTD 2M00A 3PUYA 5EE0A 1I7HA 2PLPA 3D31A 4LK0M 3ZGZA 1EZ6A 1CZWA 4DN4M 2V3PA 1IBXB 1E0BA 1XLNA 1BCPC 3E5SA 2BA1A 1EY0A 1IKLA 1C9FA 1JE4A 3EGRA 3P20A 1CZPA 1K8MA 1G8ZD 3VRBB 1DJRD 4KGRA 3LWUA 5IODA 3MJ5A 1LTSD 5C5LA 4IFDI 1STNA 1RTNA 2L11A 3WOEA 4DXFA 5KIXA 3OHXC 4A3DB 3P63A 2F03A 1SIJA 3GP7A 3HVZA 5BN5A 4KI0A 1EYDA 2KCNA 3UI2A 3MXGA 1RJTA 1JWSD 4IUPA 1ESFA 4CKEA 3D6CA 2RSNA 3I3CA 2LY7A 3BG3A 3PIP3 3V3XA 3OW7A 4HAEA 4XT1B 1FO4A 2WXFA 1RTOA 1XEEA 1FXIA 1ML0D 1I4QA 2EE1A 2AUJD 3NXWA 3M4YA 2WLBA 1EWYC 2B2TC 4FVMA 2D5DA 2L32A 4HSVA 2MJ3A 1FIQA 5EKKA 2INNE 4DK1A 4L8JA 2BS3B 2BDOA 4IKGA 2EJGC 3HOVB 4KHVA 1M8AA 4A3IB 1X3QA 2AWNA 1FFUA 1F2YA 4DNRB 2TSSA 5T8IA 2PCFB 5DNFA 2KEEA 1DD2A 4KGSA 3NSWA 4A3FB 1ZXTA 3TZUA 3QWNA 1CA5A 1PDXA 1KLUD 4FXGC 3TBIB 1SB3C 3VA7A 2VNUD 4BA2I 2QIEB 1CTMA 1NAPA 1EQTA 5C44B 1KNAA 3S9WA 2GI9A 1Z47A 1SJHD 2L83A 4KD3A 1QT9A 4O1NA 1F77A 2NN6I 4RCNA 2I46A 3AEFB 3CRKC 1TY0A 2F0UA 3S2DB 2FHTA 2TMPA 1VDZA 4A3MB 1AP0A 1NR4A 1CA6A 3H3VC 4RGOS 1ZKOA 1HRJA 1O7ZA 1VF5C 4OIJA 1SYGA 1F2LA 1MVKA 3EJIA 2RSOA 4IUUA 5C4HA 1A2TA 4RFBA 4CBVA 3OMCA 1Y69U 2AWOA 3OIPA 4HR7B 4C3HB 4NP5A 4IZ8A 3IAS1 1WTVA 1SNMA 1S5BD 1MI2A 3IT4B 4KN4C 1V43A 1TWCB 2K5WA 1UEAB 2OT2A 1L6VA 3JAML 3LB8C 1HCZA 1XLOA 2F0EA 3KLSX 4USAA 1QOAA 5EGTA 4LLGM 1U4MA 4PT5A 1K50A 4NKLA 2R93B 3J7AF 3E0JA 3EFXD 3HOYB 2H1EA 5GXGB 1KF6B 2JU6X 2MHVA 2VXWA 2F3VA 1YN4A 4TQ1A 1G91A 1GHKA 3D8GA 3MFYA 2K04A 4RGMA 2EYHA 2EY6A 3D4DA 1J7CA 1YJIA 4XYOA 4OIKA 2Z8LA 1G2TA 3TUOA 4H2AA 2R61A 2JXMB 1K53A 4LK1C 1RDPD 1UAPA 3RZDB 2KJXA 2ZXRA 2BS4B 2PZUA 1Q1BA 4ZHOA 2F0NA 3AEDB 1PDQA 4XDDA 4YSZB 1UWMA 4LAAA 1CFMA 4A6QA 3SHLA 1SMYC 2LEKA 1WWTA 2WDVB 1FEHA 3FEWX 1RF2D 2XRSD 5EBCA 3CRLC 4XQQA 2NVTB 1BCPD 4ABNA 1P7EA 1YNTE 4OW0A 5EKIA 3N52A 1SFOB 4V0BA 1HTLD 3BK1A 1S5ED 5CV6A 2WDQB 1XTCD 5D14A 4PQXA 5BMGA 2N9LA 2V4IB 1FYCA 3K59A 2JP1A 3ONAB 2R3ZA 3K5OA 1SJED 2A6EC 1QWYA 4BY1B 4EQPA 5C0XG 2B2TA 3MEHA 1NSNS 2DNEA 1B53A 3M7NA 2BYTA 2CJOA 2RDFA 3GTLB 4I7ZC 1S4ZA 5C0XH 5JEAG 1FRRA 4I65A 5FO8B 2W55A 2JYOA 4Q5VA 3BVZA 5AUKA 1F9RA 4B9XA 4AS1A 1XLPA 3T4AC 2DWQA 2RMMA 4US9A 5JEAH 1O7LA 1FMAD 4YXDB 2PYKA 3NS1A 2EKIA 2E3TA 1S5CD 2L0CA 3K5LA 3J81L 1XCQL 2IT1A 2RBMA 3AE8B 2WXMA 1BBXC 1U4LA 1QKZA 2OEDA 4K2LA 1WVLA 1F2MA 1QOFA 3QOJA 1SNCA 2NWGA 4NAWB 2QDBA 5BN3A 2FBWB 1ET9A 1C4PA 4IALA 5FLXL 3L4PA 1FNVA 2R6GA 2EYFA 1R4PB 4EVOA 2WXPA 3ITPA 1LACA 2F0HA 1FM0D 1KDBA 2FFKB 5JVG3 1SNOA 1TYGB 2N7JA 2MJ8A 5M5XB 2F0VA 1YN5A 1AZQA 4LTUA 3VYSA 2NTSA 2F0QA 1HZ6A 2IW3A 4H44C 3TEZA 3R93A 1MPEA 1D1IA 2ACZB 2CHBD 3RPFC 1HZ5A 3R3OA 3A8IE 2X6GA 4CKBA 4B0EA 5C2TB 4E6IA 1L4DB 2F0IA 1QNUA 5C0XJ 1NI3A 4DAVA 2DY7A 3MZ5A 1GUWA 4EQNA 3H0GB 5A2QE 2G9DA 3SK6A 4P6VF 1ZYRD 1XYIA 2M9VA 3ZJVA 3T16A 2ON8A 2PW9A 5JEAJ 1S5DD 2E2IB 2WIIB 3AH7A 2BTEA 1D5ZC 2X38A 1VF7A 1STYA 1YQ4B 1E9MA 1FGBD 2PMZB 3AE2B 1E2VA 4X3SA 5E4XA 3HVDA 4XT3B 2SNMA 3Q8EA 1GB4A 2B8FA 1Q10A 2L1AA 1FD7D 5AUIA 3AMZA 3EROA 4KK7A 2JEAI 4X3UA 1SEBD 1EQVA 3I4NB 5BYSA 1TT2A 5CBAE 3IAM1 3DXJC 3NUHB 1ET6A 4ZKBB 1AN8A 3NRZA 3TEXA 4TKOB 5EE1A 5IGBA 3NTHA 3IKJA 2F0LA 2NYZD 4FXDA 4Z9CB 3T3NA 5FO9B 4ZLTF 1A70A 4S3SA 1JW9D 4A3JB 1KNEA 3NTIA 1K52A 1GAQB 1B9NA 3I4LA 3OWEB 1SDFA 1IBXA