1SE2A

Staphylococcal enterotoxin c2, monoclinic form
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
239
structure length
235
Chain Sequence
ESQPDPTPDELHKSSEFTGTMGNMKYLYDDHYVSATKVMSVDKFLAHDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKDNTGGKTCMYGGITKHEGNHFDNGNLQNVLIRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STAPHYLOCOCCAL ENTEROTOXIN C2
publication title Residues defining V beta specificity in staphylococcal enterotoxins.
pubmed doi rcsb
molecule tags Toxin
total genus 63
structure length 235
sequence length 239
ec nomenclature
pdb deposition date 1995-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1se2A01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1se2A02
1D6EC 1AN8A 2RDGA 3BVGA 4L6TB 1HQRD 2XN9C 1JQYD 1BCPD 5ELEA 4OHJA 4BWGB 1S5BD 1XXGA 3URYA 2RDHA 5D3DA 1FNVA 4ZYSA 1PRTD 1LT3D 3BVMA 3O13A 1EEID 2AQ3B 2AQ2B 2WV6D 4NZLB 3CHBD 1DJRD 3EFXD 3DWPA 1LT5D 3MFGA 1LO5D 3DWQA 2CHBD 1L0XB 1KLGD 2SEBD 1JWMD 1L0YB 1PTOC 3KLSX 3R8BA 1LTTD 1TS3A 4RGOS 1F77A 1UUPA 5ELCA 1LLRD 1LT4D 1EWCA 1EEFD 2IJ0A 1TY2A 3R2IA 1JCKB 2O2LD 1BCPF 1FD7D 2IPKD 1SXTA 3DWAA 1TS4A 5ELDA 1I4RA 1PZKD 1YN4A 1BCPB 1DYQA 1I4GA 4RFBA 1PTOD 1STEA 1PRTF 1ESFA 5D3IB 4L63B 1V1OA 2QILA 1TS2A 1JR0D 1PRTB 1V1PA 3R2TA 2Z8LA 1M4VA 1AW7A 3EA6A 1YN5A 1PZJD 1SBBB 3GP7A 1LTBD 1ET9A 1FGBD 1I4XA 4RGTA 1B1ZA 3W2DA 1TS5A 5ELBA 3BYYB 1G8ZD 3OWEB 1EFID 4Z9CB 1PTOF 1I4HA 1RD9D 1LT6D 1LTID 3MC0B 1YN3A 1PTOB 5FK9C 1SEBD 1SE4A 4RHSA 3SEBA 1SJED 1SJHD 4RCOA 1ENFA 1HA5A 3TSSA 4O1NA 2TSSA 4RHRA 4DXFA 1CQVA 4RH6A 4DXGA 5TSSA 1SE2A 1BXTA 4RGMA 1ET6A 1KLUD 1PZID 1UNSA 2NTTA 4UDUC 2XRSD 1JWSD 1QILA 1MD2D 1CHQD 1S5FD 3BYTB 2AQ1B 1HXYD 4C56C 4RGNA 5ELFA 1SE3A 1KTKA 1PYWD 1S5ED 1HTLD 1B44D 1CK1A 1RDPD 4TSSA 1T5XD 1D5MC 3BVZA 1RCVD 1TY0A 1LTSD 1RF2D 2XNAC 1D5XC 1D5ZC 1CHPD 1I4QA 5FKAC 1FNUA 5I4DA 2NTSA 1GOZA 1LTGD 1LTRD 1V1PB 1CT1D 3V05A 1EU3A 1BCPC 1JWUD 1S5CD 2XRQD 4K6LA 2ICIA 1EU4A 1FNWA 1I4PA 2G9HD 2R61A 1LTAD 1PTOH 2J4XA 1XTCD 1PRTC 3BZDB 1S5DD 2QEJC
chains in the Genus database with same CATH superfamily
5GAGC 1AN8A 1F0ZA 4JBJA 1HQRD 5NUCA 4YY3Q 5JEAH 1RRBA 4QF4A 4XT1B 1SFOB 1E7VA 2FCNA 2HDEA 5JHAA 3ND8A 4BWGB 5C44H 1XXGA 1UWXA 2MJDA 4FLHA 1N61A 2DN8A 5H8YE 3X3NA 1EEID 1T0QC 3S1MB 2K9XA 2F0GA 3IKJA 3TZUA 2FIDA 1QOBA 2KOXA 1LT5D 3C1FA 4AQ7A 1K83H 1VQJA 3K0XA 5COYA 5FJ8G 1YJWA 1KLGD 2OOBB 1DOLA 4NY0A 5DCNA 5JHBA 4G7OC 1Y8RC 4JPBW 4KV6A 3KDFA 3OTOQ 2HJ1A 4C3IG 3LWUA 2LVOA 4PS7A 1MHXA 3AI5A 4R4QA 1EEFD 1EY5A 4CGYB 3GTQH 2PMZE 3OJ3A 1RIPA 5BMIA 4NMZA 5CV4A 3G7LA 1GUTA 1YQ3B 1HCZA 3IFDA 4HKZE 4KD4A 4OL7A 1Q90A 4GKJQ 4Y52H 4HCPB 1KHIA 1HZ9A 1IBML 1HR0Q 3QX1A 2N0SB 3CCQA 1JE5A 4E6IA 4A3MH 1IW7C 4LF7L 1FMAD 2MBOA 4LNFA 5E6PA 3O65B 4AOFA 2RSUA 3TS0A 1DM0B 1AARA 1R4MB 2CU1A 4F8CB 4LF6Q 2F0EA 4WWNA 1DOKA 2N1WA 2D2CC 1TS5A 4ZUJA 2N9XA 1EZ6A 1EY4A 2EYMA 3QR8A 2K8BA 3HGBA 2JU6X 5I2YA 3RYTA 5LHY1 3OWEB 3IFWB 1TU2B 3VH4B 4QUFA 3E9SA 5IOIA 1I35A 3AE9B 1GG3A 4A3IG 3BU2A 4KY6A 1VQHA 2R7ZH 2JA5H 1P7EA 4G7ZC 1ASZA 1FRRA 2K32A 2DX5B 1GUOA 3IXSA 4IWPA 2NVUI 1CKOA 2L11A 1HZ5A 1WMHA 4RCNA 1C8CA 1MHWC 2F0QA 2IGHA 2JZPA 1J0GA 2C7HA 4HRSA 2TSSA 1WGDA 4BKGA 3I9V1 4KI0A 1HNZQ 2LRWA 1I6VC 1PLFA 1WCMG 3TQYA 1WTXA 4PMWA 3PS6A 3UQAA 4M02A 2G3QB 4YCUA 1OQRA 5DLQE 2K6AA 1I94L 2J0TD 2VL6A 4MHEA 1JWSD 4YIJA 2N7EA 4TMAB 3CMEA 3A4SC 1CZWA 3NZ3A 1CA6A 3MTNB 3Q3OC 1AE3A 2NN6G 3TEZA 1FL0A 1S5ED 4XDCA 5CTRC 2VH2A 3FPPA 2JA6B 1K8GA 1CK1A 1RDPD 1VQ8A 1IXRA 2MSED 2JRHA 3UDIA 2ES2A 4OO1G 2P5ZX 5JJZA 1TWAB 4X65Q 2UUCQ 2N9PC 5CV8A 2D62A 2JXMB 2NVQH 2PLPA 3OWFA 3I90A 1STNA 1FEHA 2XK5B 1HE8A 3QCAA 4A3GB 3H6MA 3C3LA 3UQBA 3CAMA 4DK1A 2XRQD 3CXCA 2JWUA 4LDTD 2FCMA 4MTNA 3C1EA 4WWOA 2R61A 1QUQA 1E5WA 1LTAD 4HSPA 2F3WA 1JRPA 2KWUB 2VS1A 3SDLC 5IIFA 3SDZA 2E6XA 5IYBH 2NZ1D 2MX2A 2PNRC 3GTPH 2FBWB 3AE1B 4IM3A 4L23A 3RI7C 2BA1A 4IJLA 1PH1A 4M00A 2KECA 3AFPA 3K80C 4EZJA 3CQZH 2BYTA 3PUWA 1CZGA 3GTOH 3AB9A 4ZYSA 2V4IB 1KRSA 4XGAB 4ZRIA 4JVZA 1E24A 4ZCKA 1WZ3A 4NZLB 4A93H 2ATWA 1WD0A 1A3TA 2D3CA 2R6GA 2MP2A 2E2HB 2OJRA 1Q3LA 2NBFA 4IFDJ 3T53B 2JP1A 4LDTB 1MBYA 2I2YA 4KN4C 1Y8NB 3A55A 3JC66 4OO1I 1JB3A 2DHZA 2MH7A 3KYHC 5BN4A 1M94A 2K5HA 2KHSA 3Q3NC 2L1AA 1QZEA 1SMYC 3KQ4A 1WX7A 3M4PA 3P2BA 1S40A 2Z0DB 2FUHB 4ZK9B 1PV4A 2Y5BB 5DM73 3TMPB 2V3SA 1A8VA 5M9OA 5IYDH 3HRDD 5K36G 1WE6A 2KJHB 3FILB 5EE1A 4DNIA 3GZNB 4OWTB 2A8VA 3IL8A 1XMQQ 2ZW1A 1Z7TA 3NWTA 3SE0A 3GTGH 2A73B 3A1QB 2WXGA 3M4QA 2NBWB 4C3HG 2LS01 3AYHB 3FC4A 4A3BH 1IW7D 2ASQA 3CIRB 1EYCA 1E0BA 3P63A 3NVVA 5LMNQ 1F9JA 3BK1A 4X64Q 2IYDB 3KYCD 2K5QA 2XVSA 3PO3G 5HY6A 4OWWB 1R4MI 1B2TA 2LFIA 4EUTA 2F1MA 4UY8C 3HOWG 3S16B 4MEMA 5EKIA 4DAPA 3S1QH 5C1ZA 5KNBA 1BUVT 1YX5B 1WJUA 3OMCA 4MM3A 1MJDA 4M0WB 4MSQB 2EYHA 3KUZA 4WAAA 3AXCA 1B70B 3V6EB 2QC8A 2ZT9C 2BPSA 4AP4C 3FKIB 3N6RA 4JI2Q 1VQ4A 1EY9A 3GO5A 4E74A 1OGWA 5I9PA 3AEAB 2WX1A 4JI5L 4UDUC 3I4MB 5JH5C 4PYZA 2MRPA 1MD2D 3RZDB 3OIPA 1V97A 3STBC 4PZ7A 5TR5A 4C56C 1UWVA 3TDQA 2M4NA 4DUYL 2PQAB 2R7FA 1STGA 2RVLA 2N9EB 3FAHA 1SGHA 3TREA 2WWZA 4G11A 1YIWA 2WXIA 4GNXA 2B3AA 1TY0A 1ZDVA 3Q8FA 5C0XG 5JJIA 2UU9L 4G57A 1VS0A 4P2CB 2BGFA 2UWQA 3KLSA 3I63C 1KL9A 2DYMA 4ZRJA 3OYYA 3H3VI 5FO7B 3M7GA 2WB1B 3A5ZB 4Q2JA 2CJNA 1S3SG 3JYUA 1I4PA 1T9HA 4N6EB 2JXTA 2MHJA 1O7IA 4WJPA 2O6VA 1WTRA 2DZIA 2KCCA 3QWZB 1G6JA 2KACA 3RLOA 4DR3L 4HJ9A 1N62A 2MJ8A 2KOLA 3ABVB 3DWMA 5LXIB 1R9TH 1UAPA 1NUCA 3H8HA 4CO7A 4ZHOA 4NJ7A 3G6JB 2KHWB 4TQ1A 1SAPA 1GHJA 3PO2H 3VUYA 1J7BA 1I3QB 2I1KA 5J22A 3NP8A 5KNCA 3NSWA 1G2TA 1JROA 3W1BA 4JI1L 1L0WA 1U4AA 2WP8J 4P74A 4LJZC 1EIFA 1N60A 1Z47A 1WX8A 4LLGM 4ZUIA 2SEBD 2JZ3B 3G71A 4ITKA 1PH6A 5L37A 3I56A 3TEWA 1BNZA 1DGSA 2PPHA 2HDMA 4ME3A 5D6JB 3T4AC 1WD1A 4APVA 3HOYH 1LT4D 1KOTA 2KXJA 1TY2A 4J8QA 3EFCA 4DV2Q 2H89B 4HDQA 5GMVA 2KEEA 3H0GH 4K1RB 4U673 2E2IH 1KD1C 3M4OH 1ESFA 2B8FA 2IL8A 1UELA 3TP7A 4FA6A 2JN4A 1B53A 3VDZA 1UE7A 4BA2I 4JI6Q 3LDZE 1SMYD 2KHIA 3DHHC 3TEYA 4KHPQ 4DU9A 4YSXB 3EVQA 5KGUA 1LUZA 3RLFA 2VRRB 2D9UA 1B1ZA 3AE4B 2N7JA 3E56A 4J3OD 1VZ8A 2O2VA 4B3SL 4DAYA 4A3FB 1J19A 1NJIC 4WORA 4FVMA 3PF5A 2WNMA 4TQ0A 2EJMA 1WTPA 3I4MG 2EIFA 4RA8A 1CFMA 3SFDB 5F2DA 1JRUA 3DM3A 4CHKA 3J81j 1LT6D 5J3BA 3GZNI 2JUOA 1CSQA 2Q2HA 3MWYW 3L13A 4ASWC 2GOWA 1YJ1A 3BINA 4RAUC 2BB6A 4YWKA 1C0AA 4X3UA 3RMKC 1WJ6A 1E0ZA 1DOXA 3CCSA 1SNDA 3J7A5 4LF5L 5JEAG 1Y1WG 2KFKA 1YNNC 2CWAA 4IPHA 4K2LA 1QZHA 5JJKA 2AL6A 4E71A 3SU8X 4X3TA 3DDCB 4P1CC 2MLBA 1BBWA 3TIXA 4BBSB 2KNBA 3QC8B 1U4RA 2L0CA 1PZID 2WB1G 2ZCBA 4LUOA 5LNK1 2ACZB 3QHTA 1V8CA 3P75A 4RMFA 2V4DA 2NPTA 1FIQA 3VVWB 3EFUA 2QSDA 1EYDA 1PUTA 1ROEA 3IHPC 4HWIB 2FCSA 3BDLA 2MPMA 2IWHA 2PE6B 3NVYA 4WQOB 4ME5A 1E8WA 1I94Q 5FJ8H 4KY5A 4A3CH 1PYBA 1VQKA 4ICVA 4BBNF 2QGQA 1WGGA 1EWYC 1B3AA 3STBD 3M63B 3I3TB 1HNWQ 3D6CA 3J80E 4P73A 1WRIA 4HEDA 2YVCA 1A3VA 1V1PB 4KZCA 2EJFC 3UDGA 3HOZB 3RT3B 1WE7A 3DQVA 4IOIE 4FADA 2B2WA 4AJYB 1Q1BA 4DK3C 3NENA 3S1RH 4LFAL 1SE9A 2NBUA 3CP0A 1STHA 1N9WA 1T6BX 3CF6E 4HJKA 2KDEB 4HMJA 4DUZQ 2BE5C 3K58A 3BVGA 3BWUD 5A2QL 2IY5B 1BO0A 2M17A 2INNE 1DZ1A 2KC1A 4L5RC 1DXMA 2OEDA 1AP0A 2FIFA 1VQIA 1V1QA 1WI0A 1T3QA 5CV7A 1Y1VH 1LTLA 1EY0A 5D94A 4TUUA 1LM0A 3CHBD 5GADC 2OQ0A 4DV7L 2K5NA 1PDXA 2BKFA 1GAQB 4M1UB 1GHKA 2IO0B 4BXXH 2J0KA 1F9QA 1L0YB 1S3OA 2WACA 3RN5A 1KJTA 2L4NA 1PTOC 3NBHB 1Q0WB 3W5UB 4AUQC 2C5LC 4BZAA 4XDDA 4ZOHC 5HFYA 2PJHA 4B9KA 1SSOA 3RLNA 2W55A 2JRIB 2BS3B 4HEA1 4A3FG 3Q8BA 3PRMB 1X32A 2B2VC 4KKTA 4HIDA 2QDFA 5D14A 2WXRA 2L05A 3P7JA 5EBDA 5CBEE 1TIFA 3MP9A 3S24A 4OX9Q 3HVZA 3S2DB 1XEEA 1TZ1A 2E5LQ 2WB1E 1WCMH 1I42A 4P7IA 3OW7A 3HM6X 1GPXA 2QCZA 2KDIA 1JMLA 3OTOL 1GC7A 4KSLC 2NVXH 4AH6A 5AEKB 1K53A 1YQ4B 2L0FA 2AUJD 1EQVA 4J6HA 4KK7A 5IE8A 2B2WC 1L4ZB 2KDFB 3RZFA 3W1YA 2N55A 3W2DA 2NR2A 1XWEA 1NEKB 3SK8A 1VDVA 1SFOH 4USAA 5J39A 4BBSG 4OO1H 1TWHB 2CFMA 1OTRB 4QUCA 3MZ5A 4PMCA 3M7NA 4EX5A 2L76A 1D1KA 1K8MA 3M4YA 1RWSA 1HR0L 1R4NB 1GNUA 4DXAB 5KRUA 4JLCA 2D3BA 2DJGC 4FNFA 2HD3A 2F0FA 3NXWA 2X6GA 1EQRA 1VQDA 1LABA 4MZ9A 3S1MH 4HPMB 4RHSA 2AWTA 2INCC 4K7WA 2UU7A 3PZDA 1T0YA 3VHTC 1KLVA 1VQMA 1A0IA 4K5XA 5CYUA 2GI9A 2WFWA 5IYBG 2ZJDA 2SOBA 1SYDA 4R4OA 4WQMA 3PUYA 1AZPA 4DXFA 3S1NB 2KQ7A 4KY7A 1XX8A 2YEPF 1PH3A 2MBQA 1FCLA 3HOZG 4JI0Q 2OJWA 5FR3A 2NVTB 2K4KA 2XRSD 2UUBQ 1SYCA 2JQOA 3OHXC 4A93G 2CQOA 1CHQD 3A33B 3FKYA 4GSWA 3RFZB 1X6OA 2AQ1B 5ELOA 1J8IA 1HXYD 2R2OA 1YNND 4HIKA 1ILQA 2A1AA 1YI2A 4P75A 2GBKA 1Q7YC 3PVLA 4IUPA 3CF5A 3DVNV 5CHFA 3ZGZA 2JA7B 1EIHA 1WYGA 3R7QA 4RKBA 2MP1A 1D3ZA 1QNUA 1QVGA 4XQJA 4DUYQ 5I2XA 1JWAD 3M95A 3F1ZA 4MGYE 3V62A 1Y8OB 5BN3A 2BT6A 3K5MA 1B50A 1BCPC 1S5CD 3EIVA 3SXHA 3NBIA 3OAWA 4IUVA 1YZ6A 3CD6A 4KSKC 4ZRKA 1PFBA 1PA6A 3P4RB 4DR2L 3AU5A 1EO6A 5EE9A 3DBRB 2V9HA 5EDSA 3N3KB 4EEWA 4XE0A 2UUAQ 3ZNHB 3L2PA 1VF7A 3DCGA 3X3MA 3B9JA 2INDC 2A68C 4NAWB 3RD2A 2J7ZA 5CHWA 1HTQA 2YTXA 1QT9A 2XWJB 4ANXA 2WV6D 2BE5D 1II3A 3NRZA 1NTGA 1YMHE 4S0RA 3RUIB 3L9AX 2KX3A 1MJCA 5BYQA 4H13C 4K5VA 1XPUA 3CWIA 2O5JC 4RM9A 3ZXVA 3EJIA 2QW7A 3T3OA 3GV6A 4ICUA 3M62B 5IN7A 2MUYA 3LXFA 4KDLB 4DDGD 3G4SA 3ERQA 2LXJA 1ZW7A 2ZM6Q 2HTHA 2JA6H 3VYTA 1XT9B 1JOKA 4IURA 3KH0A 4FJZA 2N9LA 2GN5A 4ZRPA 5ELDA 2ENBA 1TWAH 4TVAB 1Q46A 5IP9H 3S2HB 2AYOB 1PTOD 1STEA 1ZE3D 4JIOU 5D3IB 1IBLQ 1J6QA 3VUWA 4KZ0A 1V1OA 3U2SC 2ZJRA 3A8IE 2QHOA 3PUVA 2C5CA 2XK5A 1TS2A 4A3GH 1U4PA 2LXCA 4YL8A 3RNCC 1XCQL 2KBNA 2RQXA 1XJVA 3M9BA 3MEFA 3NQIA 1EF5A 2CJOA 1FJGL 2D5GA 2EXDA 4M8MA 1VQGA 3K9PB 1HHVA 1E2VA 2IX1A 3BDOA 5JPNC 3VR8B 1L1OC 3MFYA 4KGSA 4BA1I 2B2TA 2R93B 1K51A 4S3SA 4OZCA 2CH4W 1IYUA 3MXNB 2WLBA 4G0NB 1F9SA 4K3CA 3VTUA 1RD9D 2OT2A 2EDGA 2QDBA 3HP3A 4F88A 5AZFA 4HJ7A 1PTOB 3ETRA 3E6ZX 4FXKC 2JWZA 1L2FA 1VQLA 4OVVA 1SJED 4H2AA 3HOUB 1XMQL 1WFYA 2KJ6A 4DR5L 1N34L 3ULJA 3E0JA 4C3JB 2EY1A 4AYBG 3CSFA 1RYJA 1E7UA 2KTRB 4XYCA 1K52A 2X69A 3PO2G 1NMFA 1NBWA 3U4VA 1R4NI 1E2WA 1U4LA 3MEHA 1F2MA 2WQYB 1U0LA 5EGTA 1L6UA 5LMNL 3L0OA 1G6PA 1H9JA 4X64L 1N32Q 5CV5A 4DGZA 4QMGA 5A35A 2VXWA 4OIKA 2K5VA 4A3JB 2EMSA 2IZVB 2Z6KA 2WIIB 1YJ9A 2GVAA 1PFDA 1KRHA 4PZ6A 1SIJA 4YCWA 1DONA 1KQSA 1NR2A 1F2LA 1F9PA 1HTLD 1JALA 1L6VA 3ZTCA 4TSSA 2BW2A 1TGZB 3Q8AA 4HPLB 5J1ZA 2B63B 3BVZA 3CU7A 1YEZA 3ZJTA 1OEYJ 4IUQA 4JI2L 3DMUA 3ZDMC 3AFQA 3BDCA 3A1QA 1NMGA 1D5ZC 1CHPD 4FXGC 3ZIMA 3H0GG 4NW2A 4DV5Q 2JSVX 3NVZA 5DAUA 3K7AB 3V05A 3AN1A 1C77A 4FHKA 4JPSA 4K6LA 4LNNA 4JWUC 1SE8A 2LY7A 4YWMA 1HEZE 2A4ZA 3NHEB 2ZVNA 4DV3L 4DR7Q 2ZNVC 3T1YQ 4NPSA 2DENB 1K3RA 2SNMA 4MSMB 4GLSC 3S16H 2KDBA 1BKBA 1UE5A 2JXXA 1BCPD 3DXJC 1MJEA 5LMUQ 1UF0A 4M0WA 1S5BD 1SNCA 3DBLB 1RHPA 3ICEA 4EKUA 2UXCQ 4QIWB 3FKIH 3RN9C 1XNRQ 3CMAA 4MJSB 3PIO3 3U4EG 3I4MH 5E6JA 3U9SA 2JE6I 3DBRI 3DWQA 1ZGUB 4BY1B 3RZDH 1HZAA 5D2MB 4YT0B 2A68D 3RMHA 1LTTD 2J7QB 4DV7Q 2PQAA 3BS1A 4B3TL 3W5VB 5GROA 2WP9B 3OIQA 1Z2MA 1JCKB 4W9JA 4FULA 3KF6B 5JAVA 3SR1A 3TRZA 4MELA 1EOTA 3ER0A 2Y0SB 4C2MB 2IO3B 3IAM1 1XTDA 1BCPB 3L3OC 1I6HB 3NELA 1Y1WH 1SB3C 1PH5A 2PW9A 2DJFC 4HIMA 1XPOA 1NY4A 2QILA 3P1MA 3ONSA 3PSEB 4A3PA 1A2UA 4FF1A 1WTWA 2K01A 2LEKA 1X3PA 4OGQC 4O42A 2K5DA 1J7CA 3EA6A 1YN5A 4GN1A 4II2B 4RWSC 1HQMC 5L95C 2GBNA 4DV2L 2Q2IA 1KIXA 3B08A 4A3CG 1CKNB 5HG2A 1HTOA 4E3CA 2DAFA 1TWCB 5T1GA 4BFRA 3J81L 4HCSA 1CMXB 1SSNA 2BS4B 5HHDG 1I3QH 1E1TA 4DR4Q 3Q6BA 1K8RB 4LK1C 5C3JB 1JJCB 4IUUA 1PGBA 4JI6L 3D0FA 2KQSA 2Y5PA 3Q8EA 1SEBD 4WIPA 3V61A 2EE1A 4KHPL 5CORA 2WXNA 1QOFA 2XGTA 2B63G 3N20C 3A8JE 1KF6B 4C1NK 2A5UA 1PYSB 3D4WA 4GLXA 3CMMB 2L12A 3WALA 4IO9A 4IUNA 1JQ4A 3HOVB 2RA4A 4ABNA 1ZYRC 1WF9A 4QY7A 1SE2A 2AWNA 2VZAA 5EE3A 1YNXA 1Y1VG 3H9DA 1KLUD 3RZOB 1P98A 1Q1EA 2PEAA 4S17A 1F2RC 5FLXE 1PHJA 3KWVA 1QWYA 4A55A 5C23A 3NQTA 5I6YA 3EROA 5KEEA 4JI7Q 3DUZA 4K8IA 1PH8A 5ELFA 5EPJA 4BXXG 2DNFA 4GN3B 2KFJA 2BH8A 4GLVB 1BMLC 4LF4L 1L1OB 3QJYA 2ZPYA 5JVG3 3PV0A 2WXJA 1G51A 3GS2A 1GUGA 3AEVA 4K7UA 1VQFA 2N7DA 2HCIA 4I6LB 1K0RA 1ML0D 5I4DA 4A3FH 1K8OA 2N78A 4XIGS 1NI2A 4A90A 4A3DB 3UE1A 3L10B 4IDIA 4JX1C 3GTJB 1WGRA 2J53A 3RR5A 1F9RA 2B8GA 2JX5A 3D4DA 3TN2A 1ZXTA 2RHSB 1CJEA 3HOXB 2KC2A 2GA4B 4XX5A 5HGTA 3KYDD 3CPWA 4TRDA 1J9OA 3AEEB 4FHJA 4ANUA 2KT7A 1E8YA 1HNWL 4DR2Q 3L16A 1ZKHA 1HUMA 2KQ4X 4I65A 2F0DA 5D3DA 5FO9B 1ZXIA 4M8NA 2JSOA 4G4KA 2BS2B 2NVYB 3EQLC 5J2RA 4MGKE 4LK0M 4P71A 3DWPA 1SYBA 4BBSH 1EQQA 3A54A 4HXDA 2F0HA 4GOPC 4CDFC 3D6WA 2CHBD 5E3FA 2KWDA 1XMOQ 4DUZL 5JPMC 3P4SB 1TS3A 4DAVA 1UUPA 5ELCA 2WINB 3A9JB 3AB5A 2LJ5A 4IPCA 3DBLI 3Q3JA 4G50A 2IY1B 3R66C 3WAPA 2V3NA 2C9OA 4W9IA 2DUDA 5HURA 2M8SA 3EUB2 3A9KB 1KNAA 1CM9A 3ERSX 3PUXA 4RFBA 3TUOA 3MHBA 1FFUA 1AH9A 3GDEA 4GMVA 2ZNVB 1V1PA 2YU9B 1SIFA 4B3MQ 3HOZH 5H92C 5M5WB 3CCEA 4DV0Q 5DPRA 3DM1A 2AHOB 1QOHA 4JBWA 1GJXA 1E8ZA 4FN2A 2LUMA 4JCVE 2L7RA 2ZEQA 3NUHB 3IT6B 1VR9A 3CW2C 4DK0A 1LQBA 1N63A 1OQYA 5M5XB 1VF5C 1FJGQ 2F4VQ 2WDRB 2L55A 4OX9L 1BOSA 4QIWE 3VR9B 2D3GA 1TT2A 3V3XA 4N58A 2E5LL 2GB1A 3AMUA 3JAME 2V1CC 1LTID 1KH0A 4P72A 2L15A 1WTHA 2RKSA 3RNUA 5EJWA 1OXXK 2G4SA 4OONA 1EY8A 2KCMA 3FDTA 3SEBA 1Q12A 3P4PB 1PMRA 2NUCA 1BF4A 2REXA 2I07B 1G2SA 4HAEA 3OPOA 3ULLA 2WU2B 3NBHA 3S14B 3X0WA 4ARCA 1K9MC 3DVNU 3TSSA 4O1NA 3K5LA 4LF9Q 2VUMB 2KO3A 5FR6A 2HT1A 1DCZA 3LB8C 2Y0SE 4DR5Q 1N34Q 4A3DG 2WXHA 2G4DB 2FAZA 1VLBA 4QQBX 3WWVA 4ILWA 3D31A 4KKSA 1YOVB 2HTME 4GOCA 4B6WA 5JJLA 3N30A 1STBA 2KCNA 3W1SC 3S2DH 4OIJA 4DWFA 3HOXG 3LX0A 1YNTE 4IUTA 3PREA 5C4JB 3J9CA 4GB9A 1R4PB 1ZYRD 2WYQA 1A2TA 1DGJA 3BZKA 3RUZA 3B2GA 1GM5A 3CC4A 2JA6G 1B3QA 2HIXA 2VNUD 3GOEA 2PI2E 3U7DA 1U5KA 1TIID 3I8ZA 1WXAA 2N4FA 1W6KA 1FNUA 4JI0L 5IP9G 2PPBC 1RTOA 4R4CA 2M0AA 2UUBL 2MO1A 4RG1A 1OTCA 1CT1D 1EIYB 4B3RQ 1TWHH 2C60A 2KYWA 2G9HD 4A3GG 4XZ4A 3UI2A 1JWBD 4W9EA 3GTMB 5HI1A 1PRTC 1V43A 4OW0A 4BKSD 3PLVA 2BOSA 1Y56A 1IP9A 1UEAB 4ZYNA 1WWTA 3RULA 4L6TB 1EF1A 3IBEA 1ENCA 1JQYD 5ELEA 2LGIA 2Z0EB 2AX5A 3TL5A 1UEBA 1QLBB 4DV3Q 1QE6A 1B9RA 2OXPA 1XLPA 4DDID 5IP7G 2KVMA 1P9DU 4EQOA 3EFXD 4F7XA 2JA8B 2K39A 3N9YC 1EWHA 2XTIA 2NVTH 4R9WA 3VYSA 1LO5D 1NNXA 4K14A 1X1MA 4C4VB 4FF3A 1V49A 2LRUA 4EOYA 4ANVA 4PNYA 3R8BA 2X8XX 3ZKJC 1RKNA 1B4OA 5CHVC 2IJ0A 2H88B 4BKTA 4ZKBB 2UUAL 2Q8TA 2O2LD 2L8JA 1VQ7A 4IPDA 2KLCA 4HN7A 4IZ8A 5HGQA 4LF8Q 1PZKD 2JA7H 3ZNGC 3M3YH 5L83A 1I4GA 5IO9A 3PGZA 3FP9A 2K52A 2PZUA 2WXKA 4UP9A 4L63B 4J15A 4B3TQ 1RJTA 4C1NI 5MPOA 4AQYQ 2V1YA 3CC2A 2CR5A 3NWSA 3U8ZA 2OHFA 4BY7B 4PG3A 3T9LA 2YTYA 1WM2A 2ZM6L 4JYAQ 2BYEA 4CDDC 3CPFA 3AV8A 1ET9A 1I4XA 2DZMA 3MXUA 3M85A 4WJ3M 2EQSA 1HFGA 2LVPA 3MJWA 4EZLA 5IT9E 3BYYB 3SVMA 3PHXB 2QDLA 4L5TA 3VFKA 1WYWB 1CUKA 3NY5A 1IBLL 1EFID 4Z9CB 2KUMA 3SK5A 3F2DA 1GUAB 2EELA 2KTFA 3UE0A 4GOPB 2FINB 4IWOA 4NAWA 4GS3A 1RL2A 2K1BA 4A8XC 1JC7A 3J81c 3GTQB 3D32A 2WXQA 3PPAA 1E3PA 2OF1A 2A6ED 4F7ZA 5CX3A 2KMMA 2V0GA 4ZRQA 1I50B 1SJHD 2BCOA 1KRTA 3AH7A 3SHQA 1QVFA 1WXQA 3PRPB 4KDIC 1ENFA 1ZDXA 2G5DA 2ZPNA 3HIZA 3PHWB 3GQBA 3I4NB 5JVH3 1WGKA 1IUEA 4JBKA 1HNXQ 2IBIB 4IW0A 2PVGC 2DY7A 1E90A 4PV1C 1XQQA 1AFPA 1V6EA 5GAHC 2RDBC 3LJ3A 1OXTA 2FMMA 3FKIG 4PQXA 1ET6A 4LAAA 2OCEA 3S2HH 4JL9A 5CMDA 1E6EB 2LGSA 5KNDA 5EPLA 5E4XA 3AM9A 4FDBA 3BYTB 1NYRA 3S2AA 2A19A 3Q22A 1UE6A 1WTQA 4XTCS 3A56A 4LMQD 4JI8L 4EVOA 1EWIA 4EFOA 1O7ZA 5BYSA 5DPWA 1Z6HA 2RSOA 2Z4HA 2Y3AA 2IX0A 1FRDA 1P8LA 2X6LA 4PK1A 3VA5A 3CCVA 3JSVB 2PTLA 4IFDG 4ZHPA 1MG8A 3UDFA 3C19A 1QB5D 4I7AA 4KGTA 5BMHA 2PNHA 4LF4Q 2NTSA 2MNAA 3MXGA 2R93H 2JA8G 1N32L 2F0MA 2J42A 3PCOB 1C79A 3SK6A 2L00B 4QL5A 1JWUD 1STYA 4AIMA 2MQJA 3MXNA 2JT4B 5E6OA 4X66L 1J7AA 4NQLB 4GN5A 3IVFA 2F4IA 1IKMA 1PTOH 1XTCD 3D4RA 2CWPA 3AEBB 5IGFA 2QEJC 2CH4A 4WRDA 1QJOA 3HOUH 1QQRA 5IODA 2RMMA 3B6YA 5DEHA 1YNJC 2XWBB 4C3JH 1H9SB 3AECB 1SYGA 4GDKB 1YVCA 2B2VA 2W3SA 2F0LA 3MAQA 3NS8A 3QWNA 4DV5L 4FXDA 2KTRA 2L0TA 1N36Q 1ICFB 3CRKC 1PRTD 2HHHL 3BVMA 4ACFA 4AJWA 1GUWA 3N1XC 5LMNW 4BY7G 2DNEA 2INPE 4OELB 3D3RA 3UF8A 1WGHA 2HQEA 4A3JH 4DR7L 3T1YL 1K50A 2VQFQ 1N6ZA 4B08A 1A63A 3CKIB 2UXBQ 4GDLB 2E2JB 5E6NA 1P16A 4CHTB 1Q1OA 1IBXB 2Z59B 2KEDA 5LMUL 5IGBA 4YSZB 2E74C 4IFDI 2CHXA 4DV1Q 2RPVA 3BK2A 1F2RI 3DWAA 2B63H 2UXCL 4JWSC 2FE8A 1X3GA 1YN4A 4JGHB 1FO4A 1SNOA 1XF5L 5D7GA 1MGSA 1XNRL 4KLKA 1UGJA 1VMPA 2R2QA 3AU4A 2CKHB 3R93A 3GTPB 3FMCA 1PRTB 3K7AH 2FMCA 1DOYA 3OOCA 3T1HL 4FF4A 3SD5A 1X55A 1AW7A 1PFSA 2TMPA 4CYEA 1SLJA 3IAS1 3UIOB 1DOIA 4ULLA 2UXDQ 1KAWA 1L7YA 4NXML 4DK5A 1HZCA 3CCMA 2N1VA 2PE9A 2ONQA 2QIEB 4GKKQ 2C35B 3HKZB 2F0SA 3I4OA 4XQQA 4HJAA 4YHHL 1YHQA 2JEAI 1EUVB 2IDYA 1VQAA 4DA2A 1P1AA 1I4HA 1FD6A 1B9MA 4ZLTF 3NOBA 4W9HA 5FK9C 1Y69U 3D8GA 5DPSA 3KK7A 2MW5A 4MJSA 4R4IA 3VR5A 1YBYA 4IM2A 2JYOA 2LI5A 1IBKQ 4BY1H 2M00A 1S72A 2FHTA 3NK9A 1WRDB 5J18A 1X65A 1BDOA 3VA7A 4FYDA 2LHEA 4NJCA 2PVOD 3J7AF 4DR1L 1LV9A 2L1BA 4DR4L 1MPEA 2H4OA 3KF6A 1Q5WB 4W9KA 4C2MH 5FOBB 4UP7A 2NTTA 1I6HH 5KHOA 4XC2A 4NKLA 1QILA 1QVCA 3J80L 2WHIA 3TP5A 4XWWA 1H8CA 2JA9A 3EGRA 4WWMA 5KIXA 1V9JA 4FP5D 3GTKB 2EY2A 1BR9A 4CKBA 2KENA 3NTKA 1D5MC 1IYJB 2D07B 4K7SA 1O80A 1G6ZA 5M3FB 1R4QB 2KJXA 2ZZPB 5IKCM 2JJQA 2D5DA 3PV1A 1RF2D 1CKNA 5M5YB 1JOOA 1TWCH 4XT3B 3TP8A 2F3IA 2PI2A 4X3KA 2RPQA 3I72A 2IGDA 4MGZE 3U7ZA 4F87A 3R7RA 1UGMA 3RNFC 4JI7L 3OJ4B 4MDKE 2PZWA 3MVVA 5LL6S 3PMFA 2WDVB 3T8MA 2G45B 5EQ0A 4JK1C 5C3XA 1BUIC 2XEWA 2F0UA 2H1EA 2ZTEA 2R92B 1D6EC 2MBHA 2IY0B 4WWPA 2Q5WD 4CJ2C 2ZW0A 3MHZA 3RNAC 1KFYB 5AZGA 4OHJA 1BBXC 4ZQ3A 1ACCA 1YX6B 4LFCL 3B1LX 4I6PA 1LT3D 1VQOA 3HOVH 1AZQA 4A3LH 5AFWA 2K33A 5EBCA 4Q0FA 4ZRZA 3C46A 1VCBA 3GB1A 3RZOH 3BJUA 2QMTA 1YNJD 4B95A 3AE5B 4D2KA 2BDOA 2YYZA 1K0SA 1L0XB 3J7YW 1WXSA 2EVBA 1NBFC 1TKYA 3Q14C 3VUXA 2AKWB 3WAMA 1GJZA 4IJHA 2I0QA 1JB7A 1F77A 1OXVA 3J81i 1OQQA 3KUCB 1W3SA 1L1OA 1RM6C 3HKZG 3F2BA 3Q24A 5C3EB 5G3LD 2K03A 4U68A 4KX6B 2ZCCA 1UE1A 1PGAA 1MI2A 4OWXB 3SGIA 4O2DA 2Z6BA 1Q86C 2UYZB 3UIPB 2YTVA 4A3DH 2LUEA 1XMOL 4J1MA 1WR1A 3GTJH 3L4PA 3R2TA 2Z8LA 1BBUA 1SNPA 2ZTDA 4JE3B 3Q8DA 1QNKA 1E2ZA 4KJOA 4M01A 5C4HA 3ZNZB 3HOXH 1WY8A 1FR3A 5ELBA 4XXEA 2MGSA 3EC8A 2F52A 4WJWA 2ZXOA 4JI3L 4RMAA 2K28A 3W3AA 4K8JA 1D8LA 1X9NA 4KD3A 3K7UC 3U52E 4KKUA 3G48A 2WAQB 2LASA 2RHQB 1S1QB 3N52A 1A70A 2K3UA 4B3ML 1YN3A 1W2BA 3SK4A 4MH0E 2D0OA 3ZJVA 4DV0L 4B0EA 2DLBA 1O7YA 1SE4A 1CA5A 1YJIA 4A9AA 1QOAA 1Q82C 4HR7B 3KFUA 1IGDA 5BO4B 4GN4B 1V5TA 3WOFA 4ODGA 3L0WB 1ESRA 2GRIA 1WSPA 3A9JA 3TZDA 4IN3A 4R8IA 2VZKD 4RHRA 5C4XB 2F4VL 4TKNA 3F2UA 5AJ3Q 1FYCA 3J7ZC 2W9NA 4R3DA 4DBGA 2XBBC 4MNOA 4RF0A 3ZJYC 4X62Q 1SDFA 2AMCB 2GMIC 3A9KA 2E76C 2F0JA 1JT8A 2Z1CA 4LNKA 1RLFA 3Q8CA 3TBLD 2K50A 4RGNA 2D0PA 2N49A 3H91A 5IP7H 2F0IA 4A3KB 2YU9H 4L2YA 4HCEA 4DV4Q 3KOJA 3T3NA 5C5LA 3U50C 5M5WH 4R4TA 2DGYA 4P1BC 4WJQA 1WI5A 1K3BC 4LF9L 3A4RA 1IYFA 2B3GA 2I5MX 2E2HH 3NJTA 1RODA 1WJNA 2IO1B 1WX9A 1A62A 4BOZB 4JI8Q 4NXNQ 2NBVB 1PFNA 3HKZE 2JA7G 3NZSA 4IKGA 1GOZA 1Z5SB 1LTGD 3H94A 2VZKB 5M5XH 1VQBA 3S9WA 2KLGA 2WDTB 1TWGB 4JOIC 2LSSA 3WCQA 3X23A 3H1UA 2J4XA 5DNFA 3T16A 2WKDA 3BZDB 2E2DC 1S4ZA 4A3EB 3ONAB 5D65A 3PLUA 3ZW3A 2DNCA 4HTHA 4C80A 2LZ6A 2HCCA 4X66Q 2OTLA 1FGUA 5C3EG 1VQ6A 1YHAA 2RR9A 3S14H 4FJVB 1GKHA 2WGSA 4NPNA 5IWAQ 4EQPA 4R8NA 4DV6Q 2VUMH 4DR6Q 1FFVA 4C00A 3PRZA 1HJPA 4B3RL 2ID0A 2J0JA 1MKHA 2Z9HA 2HE7A 2OQKA 4JC0A 3HVDA 3NEMA 3H3VC 3OG5A 4LJOB 1HZ6A 1EOVA 4JV5Q 1TXYA 2DAJA 5ELNA 4HSVA 4C3IB 2WXOA 2HHHQ 3KLSX 1JJ2A 1KDAA 2BYVE 2FJ2A 3GV3A 3NE5B 1P3QU 2LWPA 5C4JH 1LLRD 1KC8C 1IL8A 3KWLA 3ZUNA 4AS1A 3DOWA 1Q81C 4W9CA 1KDCA 2MCNB 1K8AC 1V9PA 1MFWA 4PZ8A 1UBIA 4PYUA 1DYQA 2ZXPA 2GBRA 1PH7A 4ARIA 4N9F4 1F52A 3AE2B 3NUCA 3IFTA 4MT5A 4A3OA 3I3CA 1JR0D 4GLAC 3OLMD 1GVPA 2HIVA 5EAYA 4CKEA 2M1MA 3LNNA 4ZKCB 3GE8C 3GTMH 3DEOA 1AE2A 2Z4IA 1XYIA 2BQQA 1VZ6A 4EE2A 4TV3A 5C4XG 2WXPA 1QZGA 1VQPA 3T1HQ 4LF8L 1H4RA 3V6CB 4BOSC 1IZ6A 5GAEC 2FUG1 5T8IA 3MHSD 4A3IB 5IGEA 1MHHE 1PTOF 3KLRA 4AQYL 4IFDH 4NXMQ 2R93G 1WGYA 2N3SA 3E5SA 2F0WA 1D2BA 2EMTA 4A3KG 2G1EA 4QGUA 1NE3A 3KVFB 4RNAA 2LGXA 3AQQA 2JA8H 3NPPA 4JYAL 5AUIA 4YHHQ 2JYTA 1RFAA 4C4VA 1NVID 1JE4A 3HOUG 2WXFA 3NZUA 5BN5A 3MC8A 3I2ZA 4G3XB 3N32A 4C3JG 2I1JA 2KAJA 3CCJA 2GBMA 2A74C 3QIJA 2WX0A 2MHVA 4BKSA 2MBEA 4DXGA 3S15B 3PTFC 1SR3A 1H9KA 3A7LA 1I7HA 2JVCA 2G9DA 1VJKA 3G6EA 4EQ5A 2E3TA 4YCVA 1ENAA 4W9FA 1SYFA 3MXPA 4DR1Q 1O78A 1Q8KA 3C0RB 4A3EG 4A3JG 3QOLA 1PYWD 4BY7H 4K0KQ 2HD5B 1B44D 2KN5A 4KVGB 1ISNA 3J80c 2HUGA 3PQIA 5C6AA 1T5XD 2A69C 4LNOA 1HNXL 1FM0D 4IWQA 3Q23A 4YSYB 2IGGA 3GD7A 5LXHA 1YD8U 5EPKA 2D11A 2XNAC 3ALBA 4GGQA 1P0RA 4NJ6A 3ZRFA 1V5OA 3JAMi 5CV9A 4JI4Q 3VYUA 1HUNA 1LTRD 2WAQE 5FO8B 3DHGC 2R3ZA 4CQNA 1WTOA 4A75A 5LLIA 4GOPA 4HPPA 4H44C 4ANWA 1EFWA 1WIAA 4EQNA 2KKCA 4QCLA 1J5EQ 1I50H 4QB4A 3DEPA 3SFEB 2XN9C 1AEXA 3V2TA 5G55A 2RGFA 4CDEC 3I4NH 3FHWA 4XYOA 2B2YC 2RBMA 2K5PA 2RDHA 1ZEQX 4XYQA 3S17B 2CHZA 3TBIB 1N5XA 2CW0C 3NG0A 3K5NA 4RF1A 3ZYYX 4DHJD 1ZPSA 1BQQT 3DWGC 1XLOA 2MWSB 3RZWC 3ZLZA 2OEOA 4LWCA 4DAMA 4LFCQ 5C0XJ 4LNIA 4NB3A 4NQKE 3VR3A 4BY1G 5IY0A 5IAAC 5T1IA 1WZ0A 3QARA 1YIJA 2RCFA 3CCRA 1O7LA 1BCPF 2HDLA 1FD7D 2QF7A 3C2PA 1D7QA 1N36L 1E22A 3JSVA 2VW9A 4C7ZA 2L32A 1IKLA 1PFMA 4KIKB 2Y0SG 3HFZB 2H5XA 2MBBB 1SYEA 2EXZA 3AE6B 3DVGX 3I57A 4I6NB 3KF8B 1JOQA 2BTEA 2VQFL 1QG7A 4C7YA 2UXBL 2EOTA 3A7AB 3N1YC 2N88A 2RSNA 4DHJB 1SBBB 1TJEA 4AWJA 4C3HB 4RGTA 1HRJA 4DV1L 2DZKA 3VAWA 3RCZA 1CI3M 2KDMA 3APFA 3KJOA 1EL0A 3ULPA 1H9SA 2XIWA 4IQZA 3B2FA 4GDKA 3EECA 4F8MA 4URKA 2K6DB 3E3XA 2MJEA 1JMCA 2VB2X 4QAYA 4BBNC 4P16A 1CZPA 1E8XA 3PO3B 2Q8IB 3W1SA 1KXLA 4KMUC 4JI3Q 3HOWB 1OO9B 1E7ZA 2UXDL 1Q10A 3RD4A 3K81C 2LMCB 1TWFB 5FLXL 3RNBC 1GD7A 2E2JH 4BBRB 4GDLA 5IP4D 5ISRA 4GKKL 3MA2B 4A76A 1IBXA 3E9HA 1C4PA 1CQVA 3QO2A 2K8CA 2PCFB 5C4ZA 2F03A 1YQBA 2DZJA 3HOVG 2QJLA 2A6EC 4DKAC 2GLSA 4A3LG 4POFA 2NZOA 1IPGA 4YXDB 5JOBA 2K14A 1IBKL 2MA9B 4HJ5A 3IRBA 4GIVA 2NB0A 4MGIE 1SF0A 1FXIA 2W54A 1WXVA 2K5WA 3UI3A 1PQSA 2KD0A 3K5OA 4CJ1B 3IG3A 1WH3A 3LYYA 2O5IC 1JW9D 2AEHA 4WJOA 1LTSD 5FLMH 2RDFA 1TZOA 1JORA 2DYBA 5FKAC 1R7SA 4LTUA 2F0OA 3ML9A 2NYZD 2NN6I 1XCTL 3I55A 1TVXA 4L5QA 1CTMA 1N8RC 1C4AA 2A69D 1EM7A 2L52A 5I6WA 2E8GA 4L8JA 2F0VA 5JEAJ 1V81A 3QJZA 3VYRA 2WU5B 3I5JC 3AEDB 3GTLB 4DK6C 2L9HA 4IALA 4A20A 2KJRA 4Q5VA 4B9WA 1VQ5A 1D4BA 4TKOB 3MC9A 1V8QA 2A6HC 1GB4A 1HZBA 1DOMA 3K6OA 3DPDA 3NTHA 5BR8L 1PGXA 2M19A 2GVBA 4ALPA 1X3FA 1UZXB 1A6XA 3QAQA 2X38A 1EZ8A 5EKLA 1XPRA 2BKRB 2IHFA 2KZRA 1EYGA 1TR5A 2F0PA 4FF2A 3PF4A 2YV5A 4MH8A 3ZVVA 4HLEA 4PS3A 4I7ZC 3QB3A 1MSHA 1HR0W 1SN8A 3BY4B 3GTKH 2CW0D 3R2IA 1PDQA 3TP6A 4N9PA 5CBAE 1XNQQ 5G5GA 1B8AA 4UPAA 1ZP0B 1T5EA 2CS4A 2WXLA 5M3FH 1N33Q 4GU2A 1L2NA 1U9RA 1KABA 4KHVA 2K1FA 2F0KA 4WH4A 3L17A 4X6AH 5M5YH 1LFDA 1B9NA 2J0MA 3QK0A 3BG3A 3UDXA 1IHZA 3AEGB 2PIAA 3ZJUA 1SROA 2M0XA 1LACA 2K22A 3JW0X 5M3MB 3S1NH 2BVCA 1FXAA 2N9KA 3JAML 3I7FA 1A3UA 4BBRG 4CDCC 1C7YA 2K75A 3KUPA 1RFKA 5KYLA 2R92H 2DY8A 3VR2A 1GXDC 1G8ZD 4X3SA 1GB1A 2B39A 3JVZX 3J80i 2LKVA 3TMEA 4LCDE 4Y7NB 1Y8PB 5JXVA 2EYFA 3MC0B 3H7PB 4L1BA 1X3EA 3ZO5B 2RCNA 3Q2AC 2NZHA 3TJPA 4N9TA 2AUKA 3CC7A 3ECIA 1C4QA 2F0NA 1Y1WB 5LL6X 2K04A 5C44B 1CQFA 3I91A 4LJPB 3AEFB 2VUMG 2I46A 4DHZE 5TSSA 5C3EH 2BBCA 4X57B 3VTWA 4WURA 1K83B 4GZYC 3KBXA 3KDFB 1Z9FA 1HTPA 4HJGE 1SE3A 1DD2A 1YHBA 1MSGA 1YJJA 3ZXRA 2K6QA 5IA7A 4LNQA 4OEMB 1WYDA 1TTNA 5AJ3L 2N8NA 2JYEA 2BDNA 1ASYA 5IYCH 1F1HA 5C3WA 3FVQA 3VXWA 4X62L 1HA6A 3VDYA 1ZUD2 4CBVA 1STAA 3HM3A 3VR4A 2KHJA 5CR3A 3K59A 1M90C 1BT0A 4A3MB 3P4QB 5EE0A 5HKHA 1RAXA 4HVBA 3H15A 2F0TA 4DV4L 2MJ3A 1VDZA 3E0EA 3E9IA 1S5DD 5C0XI 4NNJB 4RM8A 3Q69A 2PZTA 1WXMA 3KLWA 4CKCA 5IOCA 1GC6A 3ML8A 1HH2P 4K2KA 1NCVA 4GNXC 4NXNL 2JF5A 1CSPA 1FCCC 3HS0C 4M8AA 5C4XH 4HJ8A 1FNVA 3RNEC 3F2CA 1IGCA 1TYGB 2AWOA 2JZZA 2AQ3B 4HDOA 3P1HA 5M3MG 2R7ZB 1DJRD 2JA5B 3IAYA 3M3JA 3PSIA 3F8TA 4WFN3 2A6HD 2K0PA 2PW5A 1FPYA 1IBMQ 5A2QE 5J17A 4LFBL 2XSCA 3HK0A 3N1ZC 1WMHB 4MTKA 2J52A 2MEKA 4H0LC 4LF7Q 4A3KH 5GXGB 1UD7A 5E7NA 2L83A 2FFKB 1V86A 3NTIA 4JW0A 5IWAL 4DV6L 4DR6L 3I73A 2JY6A 3TEXA 2IPKD 1I4RA 1K28A 3W9CB 2R7DA 4OVUA 4B0MA 4BAXA 2BA0A 2Z0SA 5IT9L 2KK8A 2L5TA 4ID6A 4JV5L 2B2UA 4HROA 5KHQA 1LM8B 1KNEA 4IPGA 1EYAA 4IOAA 1TWGH 1UBQA 1FXTB 4EGVA 2KQ3A 5E4WC 5C44G 3OMGA 4IOCA 3AULA 5G2NA 1EQTA 3WANA 4A3EH 2FNJB 3KUDB 2JK8A 1GUNA 3T51B 1TKGA 2EKEC 2KVRA 4W9GA 3K9OB 3MJ5A 2NVQB 3TS2A 1E1OA 5DM63 1QKZA 2BYFA 1XLQA 4KGRA 3TEHB 2ZVOA 1VQNA 5K5PA 4NP5A 2K25A 2M56B 2E75C 1QUQB 1T0RC 2NMQA 1UH6A 3Q6SA 4O0AA 1H95A 4IUMB 4G7HC 3VTVA 1C78A 1ZXHA 2B76B 2FCQA 3CCUA 3AE3B 4KKJA 2F3VA 1EY6A 4C3IH 3PT2B 4J6IA 3ZDTA 3MTSA 2O4XA 2BWFA 3CQZB 4BVUC 5FLXc 1GO3E 3GTOB 3L54A 3R3MA 1VD2A 1ONLA 3I4NG 1JICA 2KANA 1MI0A 1NSNS 3WOEA 4A93B 5IGGA 2Q8RE 1AWDA 2MP2B 2BH2A 3FPUB 1T0SC 4A3MG 3A8KE 1U4MA 4A4IA 3U58A 3K0YA 2YEPB 2MQHA 1VRAB 1S5FD 4L5SA 2ALYB 3A0JA 2VQEL 2C9WB 3AMZA 1G291 1TKWB 2DBYA 2WXMA 1WOCA 2B2UC 3U9OA 5IGCA 1PH9A 4YWGG 4UP8A 3W1GA 1VQEA 5CC4A 1L4DB 2BWES 1PVOA 1F2ZA 1RCVD 3V60A 2KVZA 4FBJB 1W6JA 1D5XC 2QA4A 3C8YA 4US9A 1VCIA 2R7ZG 2JA5G 2M9VA 3Q3MC 4A3IH 3NVWA 3L7ZC 3A5UA 4DFAA 4YY3L 3GE3C 2ICIA 1OFFA 5KYIA 3DHIC 4K0KL 2EYLA 1X3QA 3H09A 1K73C 2LFNA 4A6QA 3GTGB 3HEJA 2I5HA 5CV6A 3KJPA 3Q0AA 2IHEA 3QOJA 2LJIA 3L08A 2Q2UA 1GUSA 1KAAA 2LXAA 3WAOA 2FXQA 5C5MA 4R1JA 3T56B 4DF7A 1F2YA 4A3BB 2BF8B 2PKOA 2D2QA 3PZ7A 4KV2A 4JI4L 2K7VA 3URYA 2SDFA 3UGBB 1P7FA 3ND9A 1QCBD 4DQOC 2PO4A 4W9LA 3O13A 2AQ2B 4XWTA 3DBHB 3PO0A 3S15H 3PIP3 5BR8Q 3HG9A 2NN6H 1XD3B 4N59A 1JWMD 1J5EL 3S1QB 3PIPA 1LGRA 4IG7B 4MM3B 4DNTB 1CKMA 3WIMA 4NAMA 2RF4A 4MIUA 1OEYA 3RNGC 4POGA 4QJFA 4GKJL 2V3PA 4WAFA 2AL3A 1SXTA 1V2YA 1EY7A 3FRPB 3DHQA 4DPGA 1OXSC 2JEBI 2QKIC 2O6VD 1UWMA 4US8A 2EZVA 1M8AA 1PRTF 4FJYA 3V96A 4LF6L 4OVZA 2CQAA 2CVRA 4RKLA 4PS8A 3OW2A 2KX0A 1NAPA 1M4VA 3EBEA 3BZCA 1C48A 3SR6A 2ZJQA 3GP7A 3A74A 4GNXB 1FGBD 1L0VB 2KWVB 3HKSA 2QEXA 1JJGA 4JQWC 3JAMc 2KWCA 2YLMA 2M2LA 4GXBA 4CJ0B 2B29A 3EN2A 5FLMG 2ON8A 3I70A 4WJ4A 2ICEC 3EHVA 2EJGC 3ITPA 4H02A 3S17H 1EUJA 5H1SE 4JI5Q 1D1IA 2O6VB 2ZXRA 4DHZB 1NYQA 4AYBB 1HNZL 1R9TB 2IX3A 3M3YB 1TKEA 3HHMA 2WKCA 4RCOA 2HJ8A 3PO2B 1ZOYB 3U30A 5JZEB 2EKIA 1H9MA 1QF6A 1WJJA 2OTJA 1SNMA 4UAIA 2KMCA 5IYDG 1VMCA 4MN3A 1MG4A 1N5WA 2WDQB 4N8FA 3VQIA 1C9FA 2EY5A 2UU9Q 1YJNA 4RGMA 4K3BA 3AE8B 4WJNA 4BS9A 1WVLA 1UNSA 3K8AA 1NENB 5K36H 3U4ZA 3W5OA 1C9OA 3KBGA 4KIKA 4JOIA 1WTVA 4X65L 2UUCL 3HRZC 2CU3A 1FVIA 3PGEA 3Q3FA 1OXUA 3KF8A 1KTKA 3FEWX 1X54A 4HIOA 3HOYB 2NVYH 3WDNA 4V0BA 2BB5A 1NR4A 1E10A 2LXKA 3R3OA 4DR3Q 1WFQA 2MO0A 4XQNA 4A3BG 3APDA 2PMZB 3APCA 3DVGY 4C3HH 4IM0A 1VQ9A 3H0GB 2ZTCA 1G91A 2D3AA 1PXUA 5GQOA 2E2IB 1WM3A 1I4QA 3M4OB 3CRLC 5M3FG 2VH1A 1NDDA 3AU7A 4OZBA 2EYOA 2SNSA 4H7BA 1AYFA 4JI1Q 4DN4M 4N8X1 3H3VH 2A5HA 1LYLA 4ZAIA 1EU3A 1V80A 1WR6E 2SAKA 2ZJPA 2ASBA 1E9MA 4KN7C 3PO3H 2D10A 1A5RA 5IGDA 3HOWH 3P20A 1C4CA 2C7NB 2CCZA 3UINB 3VRBB 2O2VB 1TWFH 2RDGA 4JG2A 4DAYB 1HFNA 4V190 2LMCA 3AE7B 3QIAA 2EY6A 2V4LA 4BBRH 3ZRCA 2R92G 3KW5B 4EZKA 4DNRB 2WS3B 2DYOA 1H9RA 2NS5A 3QQ8B 4P6VF 2LHDA 5I9OA 3LWEA 5C2TB 2QCPX 4NDXA 1NI3A 3P42A 2NCNA 3MFGA 2L3ZA 2VY3A 2K05A 2JQRB 2KA7A 2C7MB 2EYPA 4PMBA 4LUVA 1VZ7A 2K8HA 4TQUS 1PH4A 4RGOS 2KFKB 1Y14B 1LXDA 1EWCA 1WJ4A 4HKQA 3H6NA 1VQCA 4LFBQ 1XO3A 5C0XH 1TS4A 2EPBA 3PUZA 1QOGA 4B3SQ 2LVQA 3DBHI 1L5PA 3BIID 4LUZA 4B9XA 2NPTB 2VB3X 4REZA 4YTMB 2EYJA 2W3RA 4PT5A 1X56A 1ZKOA 3SHLA 3H7SA 4W9DA 2PYKA 5IT9c 4YTNB 3LGJA 1SMXA 3I4LA 3ZNID 4HK2A 2I38A 1PZJD 3IT4B 1XNQL 1LTBD 4K6DA 3CCLA 3GTLH 2IO2B 2CKZB 1C76A 1N33L 4LF5Q 4MACA 5BYRA 1TQOA 3PZ8A 1J8CA 4K81A 4K5WA 5E1FA 5G3LF 3ENEA 5IYCG 3K57A 3FILA 3VRAB 3J7AV 2HQLA 4KHZA 1ICWA 3S1RB 2WAQG 1XLNA 5CGKA 3VH3B 3DLLA 3HOYG 3OSOA 2CHWA 1BVSA 3TCAA 1KM7A 2I5LX 1C3TA 3HZXA 2KCTA 3DBSA 3HUIA 2LGYA 2KMAA 1MIUA 4YWLA 2NWGA 1YITA 3VR6A 3J81E 2KN4A 1HA5A 4LW1A 3RPFC 1RTNA 4IC7B 1PH2A 4HMIA 5EKKA 3NHHA 4OXPA 1C1YB 1Y1VB 4RH6A 2B2TC 1M1KC 1IL2A 2Y5CA 1BXTA 5BMGA 2LGDA 5G5HA 1E7PB 3B0AA 1A15A 2LD9A 2IT1A 1TBEA 4JBMA 2PMVA 1ILPA 2MFIA 4XDXA 3CSTA 4YTPB 2JPHA 5M3MH 2PW7A 4LFAQ 2Q2TA 3T13A 3QA8A 1MVKA 4KJNA 4OZAA 5AUKA 2GBJA 2PQEA 2VQEQ 3ZTDA 4FO2A 4FXCA 3ZQ4A 2OWOA 2B2YA 3NS1A 2IW3A 4II3B 1IYVA 5AZHA 1KDBA 1WCMB 3PIOA 2RD0A 4HCNB 1Q8IA 3RN2A 2W82A 1I5FA 4Y7NH 1HPCA 3WA0A 4F1SA 1B7YB 1EU4A 1FNWA 2DWQA 1SNQA 4KTAA 2Z6KC 2NVXB 4KKIA 1SRUA 3H7PA 3QG1A 4AYBE 5DPTA 4ZDVA 4UHVA 1EIGA 1TT5B
chains in the Genus database with same CATH topology
1AN8A 1F0ZA 5NUCA 1HQRD 5JEAH 2HDEA 4QF4A 4XT1B 1SFOB 3ND8A 4BWGB 1XXGA 1UWXA 2MJDA 1N61A 2DN8A 5H8YE 3X3NA 1EEID 3S1MB 2K9XA 2F0GA 3IKJA 3TZUA 1QOBA 1LT5D 3C1FA 4AQ7A 5COYA 1KLGD 1DOLA 4G7OC 4KV6A 4C3IG 3LWUA 1MHXA 1EEFD 1EY5A 4CGYB 5BMIA 4NMZA 5CV4A 3G7LA 1GUTA 1YQ3B 1HCZA 3IFDA 4HKZE 4KD4A 4OL7A 1Q90A 2N0SB 4E6IA 1IW7C 1FMAD 1DM0B 2F0EA 1DOKA 2D2CC 1TS5A 4ZUJA 1EZ6A 1EY4A 2EYMA 3HGBA 2JU6X 5I2YA 5LHY1 3OWEB 1TU2B 4QUFA 3E9SA 3AE9B 4KY6A 1P7EA 4G7ZC 1FRRA 2K32A 1GUOA 3IXSA 2L11A 1HZ5A 4RCNA 1C8CA 2F0QA 2IGHA 2JZPA 4HRSA 2TSSA 3I9V1 4KI0A 1I6VC 1PLFA 1WTXA 4PMWA 1OQRA 2K6AA 2J0TD 4MHEA 1JWSD 4YIJA 4TMAB 1CZWA 3NZ3A 1CA6A 2NN6G 3TEZA 1S5ED 4XDCA 3FPPA 2JA6B 1CK1A 1RDPD 4OO1G 5JJZA 1TWAB 5CV8A 2D62A 2JXMB 2PLPA 3OWFA 3I90A 1STNA 1FEHA 4A3GB 3H6MA 3C3LA 4DK1A 2XRQD 3C1EA 2R61A 1LTAD 4HSPA 2F3WA 1JRPA 5IIFA 3SDZA 2E6XA 3AE1B 2NZ1D 2PNRC 2FBWB 4L23A 2BA1A 2KECA 2BYTA 3PUWA 1CZGA 3AB9A 4ZYSA 2V4IB 4NZLB 1WD0A 1A3TA 2R6GA 2E2HB 1Q3LA 2NBFA 4IFDJ 3T53B 2JP1A 1MBYA 2I2YA 4KN4C 1Y8NB 3A55A 4OO1I 1JB3A 2MH7A 5BN4A 2KHSA 2L1AA 1SMYC 3KQ4A 4ZK9B 5DM73 5M9OA 3HRDD 5K36G 3FILB 5EE1A 3IL8A 2ZW1A 1Z7TA 3NWTA 3SE0A 2A73B 2WXGA 4C3HG 2LS01 3FC4A 1IW7D 3CIRB 1EYCA 1E0BA 3P63A 3NVVA 3BK1A 2K5QA 2XVSA 1B2TA 2LFIA 2F1MA 3S16B 5EKIA 4DAPA 5KNBA 1BUVT 3OMCA 2EYHA 2ZT9C 3FKIB 3N6RA 1EY9A 3GO5A 5I9PA 3AEAB 4UDUC 3I4MB 1MD2D 3RZDB 3OIPA 1V97A 4C56C 3TDQA 1STGA 2RVLA 3FAHA 2WXIA 1TY0A 1ZDVA 3Q8FA 5C0XG 4G57A 4P2CB 3KLSA 2DYMA 5FO7B 3M7GA 2WB1B 4Q2JA 2CJNA 1I4PA 4N6EB 2JXTA 1WTRA 2KCCA 2KACA 1N62A 2MJ8A 2KOLA 3ABVB 3DWMA 1UAPA 1NUCA 3H8HA 4ZHOA 4TQ1A 3G6JB 1SAPA 1GHJA 1J7BA 1I3QB 5J22A 5KNCA 3NP8A 3NSWA 1G2TA 1JROA 2WP8J 4LJZC 1N60A 1Z47A 4LLGM 4ZUIA 2SEBD 4ITKA 3TEWA 1BNZA 2HDMA 3T4AC 1WD1A 1LT4D 1TY2A 4J8QA 2H89B 2KEEA 4U673 1ESFA 2B8FA 2IL8A 3TP7A 1B53A 4BA2I 1SMYD 3TEYA 4DU9A 4YSXB 3EVQA 5KGUA 3RLFA 2D9UA 1B1ZA 3AE4B 2N7JA 3E56A 4J3OD 1VZ8A 4DAYA 4A3FB 4WORA 4FVMA 2WNMA 4TQ0A 2EJMA 1WTPA 4RA8A 1CFMA 3SFDB 5F2DA 1LT6D 3MWYW 4RAUC 2BB6A 4X3UA 1E0ZA 1DOXA 1SNDA 5JEAG 1YNNC 4K2LA 4X3TA 4BBSB 1U4RA 2L0CA 1PZID 5LNK1 2ACZB 1V8CA 3P75A 2V4DA 1FIQA 2QSDA 1EYDA 1PUTA 1ROEA 3BDLA 2MPMA 2IWHA 3NVYA 4ME5A 4KY5A 1EWYC 1B3AA 3D6CA 3J80E 1WRIA 4HEDA 1A3VA 1V1PB 2EJFC 3HOZB 4IOIE 2B2WA 1Q1BA 1T6BX 1STHA 4HMJA 2BE5C 3K58A 3BVGA 3BWUD 5A2QL 1BO0A 2INNE 1DZ1A 1DXMA 2OEDA 1AP0A 1T3QA 5CV7A 1EY0A 3CHBD 1PDXA 1GAQB 4M1UB 1GHKA 1F9QA 1L0YB 2WACA 3W5UB 2L4NA 1PTOC 4XDDA 4ZOHC 5HFYA 1SSOA 2W55A 2BS3B 4HEA1 3Q8BA 1X32A 2B2VC 4KKTA 5D14A 2WXRA 3P7JA 5EBDA 5CBEE 3MP9A 3HVZA 3S2DB 1XEEA 3OW7A 1GPXA 1JMLA 1K53A 1YQ4B 2AUJD 1EQVA 4J6HA 4KK7A 1L4ZB 2B2WC 2N55A 3W2DA 1XWEA 1NEKB 3SK8A 1VDVA 4USAA 5J39A 4OO1H 1TWHB 4QUCA 3MZ5A 4PMCA 3M7NA 1D1KA 1K8MA 3M4YA 1RWSA 5KRUA 3NXWA 4FNFA 2F0FA 2X6GA 1LABA 4RHSA 4K5XA 5CYUA 2GI9A 2SOBA 1SYDA 4WQMA 3PUYA 1AZPA 4DXFA 3S1NB 4KY7A 1XX8A 2YEPF 1FCLA 5FR3A 2NVTB 2XRSD 1SYCA 3OHXC 3RFZB 1CHQD 2AQ1B 1J8IA 1HXYD 1YNND 1ILQA 3ZGZA 4IUPA 2JA7B 1EIHA 1WYGA 4RKBA 2MP1A 1QNUA 4XQJA 5I2XA 1JWAD 1Y8OB 5BN3A 2BT6A 3K5MA 1B50A 1BCPC 1S5CD 3SXHA 3NBIA 4IUVA 1PFBA 3P4RB 5EE9A 4XE0A 1VF7A 3X3MA 3B9JA 2A68C 4NAWB 2J7ZA 1QT9A 2XWJB 2WV6D 2BE5D 1II3A 3NRZA 1YMHE 3L9AX 5BYQA 4H13C 4K5VA 3CWIA 2O5JC 3T3OA 3EJIA 3GV6A 2MUYA 3LXFA 3ERQA 3VYTA 1JOKA 4IURA 2N9LA 4ZRPA 5ELDA 2ENBA 3S2HB 1PTOD 1STEA 1ZE3D 5D3IB 1V1OA 3U2SC 3A8IE 3PUVA 2C5CA 1TS2A 1U4PA 1XCQL 2RQXA 3NQIA 2CJOA 2D5GA 1HHVA 1E2VA 2IX1A 3BDOA 5JPNC 3VR8B 3MFYA 4KGSA 4BA1I 2B2TA 2R93B 1K51A 4S3SA 4OZCA 2WLBA 1IYUA 1F9SA 1RD9D 2OT2A 2EDGA 2QDBA 3HP3A 4F88A 1PTOB 3ETRA 3E6ZX 4FXKC 1SJED 4H2AA 3HOUB 3E0JA 4C3JB 2EY1A 1RYJA 1K52A 2X69A 1E2WA 1U4LA 3MEHA 1F2MA 2WQYB 5EGTA 1L6UA 1H9JA 5CV5A 4DGZA 4QMGA 5A35A 2VXWA 4OIKA 4A3JB 2WIIB 1PFDA 1KRHA 1SIJA 1DONA 1NR2A 1F2LA 1F9PA 1HTLD 1JALA 1L6VA 4TSSA 2BW2A 3Q8AA 5J1ZA 2B63B 3BVZA 3CU7A 3ZJTA 4IUQA 3DMUA 3BDCA 1D5ZC 1CHPD 4FXGC 4NW2A 2JSVX 3NVZA 5DAUA 3K7AB 3V05A 3AN1A 1C77A 4JPSA 4K6LA 4JWUC 2LY7A 1HEZE 2SNMA 4GLSC 1BCPD 3DXJC 4M0WA 1S5BD 1SNCA 1RHPA 4QIWB 3PIO3 3U4EG 5E6JA 3U9SA 2JE6I 3DWQA 4BY1B 4YT0B 2A68D 3RMHA 1LTTD 3BS1A 3W5VB 2WP9B 3OIQA 1JCKB 5JAVA 3SR1A 1EOTA 4C2MB 2Y0SB 3IAM1 1BCPB 3L3OC 1I6HB 1SB3C 2PW9A 3P1MA 2QILA 1A2UA 4FF1A 1WTWA 2K01A 2LEKA 1X3PA 4OGQC 4O42A 2K5DA 1J7CA 3EA6A 1YN5A 4RWSC 1HQMC 5HG2A 1TWCB 5T1GA 3J81L 4HCSA 1SSNA 2BS4B 5HHDG 4LK1C 5C3JB 4IUUA 1PGBA 2Y5PA 3Q8EA 1SEBD 4WIPA 2EE1A 5CORA 2WXNA 1QOFA 3A8JE 1KF6B 4C1NK 3D4WA 2L12A 4IUNA 1JQ4A 3HOVB 2RA4A 4ABNA 1ZYRC 1SE2A 2AWNA 5EE3A 1KLUD 3RZOB 1Q1EA 1F2RC 5FLXE 3KWVA 1QWYA 4A55A 3NQTA 5I6YA 5KEEA 3EROA 2JWUA 3DUZA 4K8IA 5ELFA 5EPJA 1BMLC 3QJYA 5JVG3 3PV0A 2WXJA 3GS2A 1GUGA 2HCIA 1ML0D 5I4DA 1K8OA 4XIGS 4A90A 4A3DB 4IDIA 4JX1C 3GTJB 2J53A 1F9RA 2B8GA 2JX5A 3D4DA 3TN2A 1ZXTA 1CJEA 3HOXB 2GA4B 5HGTA 4TRDA 1J9OA 3AEEB 1HUMA 2KQ4X 4I65A 2F0DA 5D3DA 5FO9B 1ZXIA 2JSOA 4G4KA 2BS2B 2NVYB 3EQLC 4LK0M 3DWPA 1SYBA 3A54A 2F0HA 3D6WA 2CHBD 5E3FA 2KWDA 5JPMC 3P4SB 1TS3A 4DAVA 1UUPA 5ELCA 2WINB 3AB5A 2V3NA 2C9OA 5HURA 3EUB2 1KNAA 1CM9A 4RFBA 3PUXA 3TUOA 3MHBA 1FFUA 1V1PA 2YU9B 5H92C 5M5WB 3DM1A 1QOHA 4JBWA 1GJXA 2LUMA 3NUHB 3IT6B 1VR9A 4DK0A 1N63A 5M5XB 1VF5C 2WDRB 3VR9B 2L55A 1BOSA 1TT2A 3V3XA 4N58A 2GB1A 3AMUA 3JAME 1LTID 1KH0A 2RKSA 5EJWA 1OXXK 1EY8A 3SEBA 3FDTA 1Q12A 3P4PB 1PMRA 2NUCA 1BF4A 2I07B 1G2SA 4HAEA 3OPOA 2WU2B 3NBHA 3S14B 4ARCA 3TSSA 4O1NA 3K5LA 2VUMB 1DCZA 3LB8C 2WXHA 1VLBA 4ILWA 3D31A 4KKSA 2HTME 1STBA 2KCNA 4OIJA 3LX0A 1YNTE 4IUTA 5C4JB 3J9CA 1R4PB 1ZYRD 1A2TA 1DGJA 3B2GA 3RUZA 2VNUD 1TIID 3I8ZA 1W6KA 1FNUA 2PPBC 1RTOA 2M0AA 1CT1D 2G9HD 3UI2A 1JWBD 3GTMB 5HI1A 1PRTC 1V43A 4OW0A 2BOSA 1Y56A 1UEAB 1WWTA 4L6TB 1ENCA 1JQYD 5ELEA 2LGIA 2AX5A 1QLBB 1QE6A 1B9RA 2OXPA 1XLPA 2KVMA 4EQOA 3EFXD 4F7XA 2JA8B 3N9YC 1EWHA 4R9WA 3VYSA 1LO5D 4K14A 4FF3A 4PNYA 3R8BA 1RKNA 1B4OA 2IJ0A 2H88B 4ZKBB 2Q8TA 2O2LD 4HN7A 4IZ8A 1PZKD 1I4GA 2WXKA 2PZUA 4L63B 5MPOA 1RJTA 4C1NI 3NWSA 2OHFA 4BY7B 3AV8A 1ET9A 1I4XA 3MXUA 3M85A 1HFGA 5IT9E 3BYYB 3SVMA 2EELA 1EFID 4Z9CB 2KUMA 3SK5A 2FINB 2K1BA 4A8XC 1JC7A 3GTQB 2WXQA 2OF1A 2A6ED 2KMMA 2V0GA 4ZRQA 1I50B 1SJHD 2BCOA 3AH7A 1WXQA 1ENFA 1ZDXA 3GQBA 3I4NB 5JVH3 1WGKA 1IUEA 2PVGC 2DY7A 4PV1C 1AFPA 1OXTA 2FMMA 4PQXA 1ET6A 4LAAA 5CMDA 1E6EB 5KNDA 5EPLA 5E4XA 3AM9A 3BYTB 1NYRA 3Q22A 1WTQA 4XTCS 3A56A 4LMQD 4EVOA 1O7ZA 5BYSA 1Z6HA 2RSOA 2Z4HA 2Y3AA 2IX0A 1FRDA 2X6LA 3VA5A 2PTLA 4IFDG 4ZHPA 4KGTA 1QB5D 5BMHA 2NTSA 3MXGA 2F0MA 2J42A 1C79A 3SK6A 1JWUD 1STYA 3MXNA 1J7AA 2F4IA 1IKMA 1PTOH 1XTCD 3D4RA 3AEBB 5IGFA 4WRDA 2QEJC 1QJOA 1QQRA 5IODA 2RMMA 5DEHA 1YNJC 2XWBB 1H9SB 3AECB 1SYGA 4GDKB 2B2VA 2W3SA 2F0LA 3MAQA 3QWNA 4FXDA 3CRKC 1PRTD 3BVMA 1GUWA 2DNEA 2INPE 3D3RA 2HQEA 1K50A 4B08A 3CKIB 4GDLB 2E2JB 4CHTB 1IBXB 2KEDA 5IGBA 4YSZB 2E74C 4IFDI 2RPVA 3BK2A 1F2RI 3DWAA 4JWSC 2FE8A 1YN4A 1FO4A 1SNOA 1XF5L 5D7GA 1MGSA 1UGJA 1VMPA 3R93A 3GTPB 3FMCA 1PRTB 1DOYA 2FMCA 3OOCA 4FF4A 1AW7A 2TMPA 3IAS1 1DOIA 4ULLA 2ONQA 2QIEB 3HKZB 4XQQA 2F0SA 4R3DA 2JEAI 2IDYA 1FD6A 4DA2A 1I4HA 1B9MA 4ZLTF 5FK9C 1Y69U 3D8GA 3KK7A 3VR5A 2JYOA 2M00A 2FHTA 3NK9A 4FYDA 1BDOA 3VA7A 2LHEA 4NJCA 2PVOD 3J7AF 1MPEA 1LV9A 2L1BA 2H4OA 5FOBB 2NTTA 4NKLA 1QILA 3J80L 3TP5A 4XWWA 4WWMA 3EGRA 5KIXA 4FP5D 3GTKB 2EY2A 1BR9A 4CKBA 3NTKA 1D5MC 1O80A 1G6ZA 5M3FB 1R4QB 2KJXA 2D5DA 1RF2D 5M5YB 1JOOA 4XT3B 3TP8A 3U7ZA 4X3KA 3I72A 2IGDA 4F87A 2PZWA 3MVVA 5LL6S 3PMFA 2WDVB 5EQ0A 4JK1C 5C3XA 1BUIC 2F0UA 2H1EA 2R92B 1D6EC 2Q5WD 4CJ2C 2ZW0A 3MHZA 1KFYB 4OHJA 1BBXC 4ZQ3A 1ACCA 1LT3D 1AZQA 5AFWA 2K33A 5EBCA 4Q0FA 4ZRZA 3C46A 3GB1A 2QMTA 1YNJD 4D2KA 3AE5B 2BDOA 2YYZA 1L0XB 3J7YW 2EVBA 1TKYA 1F77A 1OXVA 1OQQA 1RM6C 3Q24A 5C3EB 5G3LD 2K03A 4U68A 4KX6B 1PGAA 1MI2A 4J1MA 3L4PA 3R2TA 2Z8LA 1SNPA 4JE3B 1QNKA 1E2ZA 4KJOA 5C4HA 1FR3A 5ELBA 4XXEA 2MGSA 4WJWA 2ZXOA 2K28A 3W3AA 4K8JA 4KD3A 3U52E 4KKUA 2WAQB 3N52A 1A70A 2K3UA 1YN3A 3SK4A 3ZJVA 4B0EA 2DLBA 1O7YA 1SE4A 1CA5A 1YJIA 4A9AA 1QOAA 4HR7B 1IGDA 3WOFA 4ODGA 1ESRA 2GRIA 1WSPA 3TZDA 4IN3A 4R8IA 2VZKD 4RHRA 5C4XB 3F2UA 1FYCA 4RF0A 1SDFA 2E76C 2F0JA 2Z1CA 3Q8CA 4RGNA 4A3KB 3H91A 4L2YA 2F0IA 3T3NA 4HCEA 5C5LA 1RODA 1PFNA 4IKGA 1GOZA 1LTGD 3H94A 2VZKB 3S9WA 1TWGB 3WCQA 2J4XA 5DNFA 3T16A 2WKDA 3BZDB 2E2DC 1S4ZA 4A3EB 3ONAB 5D65A 4C80A 2DNCA 4HTHA 2HCCA 4EQPA 4R8NA 1FFVA 2ID0A 3HVDA 3H3VC 1HZ6A 4HSVA 4C3IB 2WXOA 3KLSX 1KDAA 2FJ2A 3GV3A 3NE5B 1LLRD 1IL8A 3KWLA 4AS1A 1KDCA 1DYQA 2ZXPA 4ARIA 3AE2B 3NUCA 3IFTA 4MT5A 3I3CA 1JR0D 4CKEA 3LNNA 4ZKCB 3DEOA 2Z4IA 1XYIA 1VZ6A 4EE2A 2WXPA 2FUG1 5T8IA 4A3IB 5IGEA 1MHHE 1PTOF 3KLRA 4IFDH 3E5SA 2F0WA 1D2BA 2G1EA 4RNAA 3NPPA 5AUIA 2JYTA 1NVID 1JE4A 2WXFA 5BN5A 4C3JG 2KAJA 2A74C 2MHVA 4DXGA 3S15B 1H9KA 3A7LA 1I7HA 2G9DA 1VJKA 2E3TA 1ENAA 1SYFA 3MXPA 1O78A 3QOLA 1PYWD 1B44D 2HUGA 5C6AA 1T5XD 2A69C 1FM0D 4YSYB 3Q23A 2IGGA 3GD7A 5EPKA 2XNAC 5CV9A 3VYUA 1HUNA 1LTRD 5FO8B 2R3ZA 4CQNA 1WTOA 4H44C 4EQNA 4QCLA 4QB4A 3DEPA 3SFEB 2XN9C 1AEXA 3V2TA 4XYOA 2B2YC 2RBMA 2K5PA 2RDHA 1ZEQX 4XYQA 3S17B 3TBIB 1N5XA 2CW0C 3K5NA 4RF1A 3ZYYX 1ZPSA 1BQQT 3DWGC 1XLOA 2OEOA 5C0XJ 3VR3A 5T1IA 1O7LA 1BCPF 2HDLA 1FD7D 2QF7A 3C2PA 4C7ZA 2L32A 1IKLA 1PFMA 1SYEA 2EXZA 3AE6B 3I57A 1JOQA 2BTEA 1QG7A 4C7YA 2EOTA 3A7AB 2N88A 2RSNA 1SBBB 1TJEA 4C3HB 4RGTA 1HRJA 1CI3M 2KDMA 1EL0A 1H9SA 2XIWA 4IQZA 3B2FA 4F8MA 2MJEA 2VB2X 4P16A 1CZPA 3PO3B 2Q8IB 3W1SA 4KMUC 3HOWB 1OO9B 1Q10A 3RD4A 2LMCB 1TWFB 5FLXL 4BBRB 5ISRA 3MA2B 1IBXA 1C4PA 1CQVA 3QO2A 2PCFB 5C4ZA 2F03A 2QJLA 2A6EC 4YXDB 5JOBA 2NB0A 1SF0A 1FXIA 2W54A 3UI3A 2K5WA 3K5OA 4CJ1B 3LYYA 2O5IC 1JW9D 1LTSD 2RDFA 1TZOA 1JORA 5FKAC 1R7SA 4LTUA 2F0OA 2NYZD 2NN6I 1XCTL 1TVXA 1C4AA 1CTMA 2A69D 1EM7A 2L52A 5I6WA 4L8JA 2F0VA 5JEAJ 3VYRA 2WU5B 3AEDB 3GTLB 4IALA 2L9HA 4Q5VA 4B9WA 1D4BA 4TKOB 1V8QA 2A6HC 1GB4A 1DOMA 3K6OA 3NTHA 1PGXA 2M19A 1A6XA 2X38A 1EZ8A 5EKLA 1TR5A 2F0PA 4FF2A 4MH8A 4I7ZC 3QB3A 1MSHA 2CW0D 3R2IA 1PDQA 3TP6A 4N9PA 5CBAE 5G5GA 1ZP0B 2WXLA 1T5EA 1U9RA 1KABA 4KHVA 4WH4A 2F0KA 1B9NA 3BG3A 3ZJUA 1IHZA 3AEGB 2PIAA 1LACA 2K22A 5M3MB 1FXAA 2N9KA 3JAML 1A3UA 3KUPA 1RFKA 5KYLA 2DY8A 3VR2A 1GXDC 1G8ZD 4X3SA 1GB1A 2B39A 2LKVA 3TMEA 4Y7NB 1Y8PB 5JXVA 2EYFA 3MC0B 4L1BA 4N9TA 2AUKA 1C4QA 2F0NA 1Y1WB 5LL6X 2K04A 5C44B 1CQFA 3I91A 3AEFB 2I46A 5TSSA 2BBCA 4WURA 1K83B 4GZYC 3KBXA 1HTPA 4HJGE 1SE3A 1DD2A 1MSGA 1YJJA 2JYEA 2BDNA 5C3WA 3FVQA 1HA6A 1ZUD2 4CBVA 1STAA 3VR4A 5CR3A 3K59A 3P4QB 5EE0A 4A3MB 2F0TA 2MJ3A 1VDZA 1S5DD 5C0XI 3Q69A 2PZTA 4CKCA 5IOCA 4K2KA 1NCVA 1FCCC 3HS0C 4M8AA 1FNVA 1IGCA 1TYGB 2AWOA 2AQ3B 3P1HA 2R7ZB 1DJRD 2JA5B 3IAYA 4WFN3 2A6HD 2K0PA 2PW5A 5A2QE 2XSCA 2J52A 2MEKA 4H0LC 5GXGB 2L83A 2FFKB 3NTIA 3I73A 3TEXA 2IPKD 1I4RA 3W9CB 4B0MA 2BA0A 5IT9L 2L5TA 4ID6A 4HROA 2B2UA 1KNEA 1EYAA 4EGVA 2KQ3A 5E4WC 3OMGA 1EQTA 1TKGA 1GUNA 3T51B 3MJ5A 2NVQB 5DM63 1QKZA 1XLQA 4KGRA 5K5PA 4NP5A 2M56B 2E75C 2NMQA 3Q6SA 4G7HC 1C78A 1ZXHA 2B76B 3AE3B 4KKJA 2F3VA 1EY6A 3MTSA 2O4XA 3CQZB 3GTOB 1ONLA 1JICA 1MI0A 1NSNS 3WOEA 4A93B 5IGGA 2Q8RE 1AWDA 3FPUB 2YEPB 3A8KE 1U4MA 3K0YA 1VRAB 1S5FD 3AMZA 1G291 1TKWB 2DBYA 2WXMA 2B2UC 3U9OA 5IGCA 4YWGG 5CC4A 1L4DB 1F2ZA 1RCVD 1W6JA 1D5XC 3C8YA 4US9A 1VCIA 2M9VA 3NVWA 3L7ZC 4DFAA 2ICIA 1OFFA 5KYIA 2EYLA 1X3QA 3H09A 2LFNA 4A6QA 3GTGB 3HEJA 5CV6A 3Q0AA 3QOJA 2LJIA 1GUSA 1KAAA 5C5MA 3T56B 4DF7A 4A3BB 1F2YA 2PKOA 3PZ7A 2K7VA 3URYA 2SDFA 1P7FA 3ND9A 1QCBD 4DQOC 2PO4A 3O13A 2AQ2B 4XWTA 3PO0A 3PIP3 3HG9A 2NN6H 4N59A 1JWMD 3S1QB 4MM3B 4DNTB 4NAMA 4MIUA 2V3PA 4WAFA 1SXTA 1EY7A 3FRPB 3DHQA 1OXSC 2JEBI 2QKIC 1UWMA 4US8A 2EZVA 1M8AA 1PRTF 3V96A 4OVZA 2CQAA 2CVRA 4RKLA 1NAPA 1M4VA 1C48A 3SR6A 3GP7A 1FGBD 1L0VB 2M2LA 4CJ0B 2ON8A 3I70A 2ICEC 2EJGC 3ITPA 1D1IA 2ZXRA 1NYQA 4AYBB 1R9TB 2IX3A 3M3YB 1TKEA 2WKCA 4RCOA 3PO2B 1ZOYB 2EKIA 1H9MA 1QF6A 1SNMA 4UAIA 1VMCA 4MN3A 2WDQB 1N5WA 3VQIA 1C9FA 2EY5A 4RGMA 3AE8B 4BS9A 1WVLA 1UNSA 1NENB 5K36H 3KBGA 1WTVA 2CU3A 3HRZC 1OXUA 3KF8A 1KTKA 3FEWX 3HOYB 3WDNA 4V0BA 2BB5A 1NR4A 1E10A 3R3OA 4XQNA 2PMZB 3H0GB 1G91A 1PXUA 2E2IB 1I4QA 3M4OB 3CRLC 3AU7A 4OZBA 2EYOA 2SNSA 4H7BA 1AYFA 4DN4M 2A5HA 4ZAIA 1EU3A 2SAKA 1E9MA 4KN7C 5IGDA 3P20A 1C4CA 3VRBB 2RDGA 1HFNA 2LMCA 3AE7B 4V190 3QIAA 2EY6A 4DNRB 2WS3B 2DYOA 1H9RA 4P6VF 2LHDA 5I9OA 3LWEA 5C2TB 2QCPX 4NDXA 1NI3A 3P42A 3MFGA 2K05A 2JQRB 2KA7A 2EYPA 4PMBA 1VZ7A 4TQUS 4RGOS 1EWCA 4HKQA 1XO3A 5C0XH 1TS4A 2EPBA 3PUZA 1QOGA 1L5PA 3BIID 4B9XA 2VB3X 4REZA 4YTMB 2EYJA 2W3RA 4PT5A 1ZKOA 3SHLA 2PYKA 4YTNB 3I4LA 2I38A 1PZJD 3IT4B 1LTBD 4K6DA 1C76A 4MACA 5BYRA 1TQOA 3PZ8A 5G3LF 4K5WA