2AQ3B

Crystal structure of t-cell receptor v beta domain variant complexed with superantigen sec3
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
234
structure length
234
Chain Sequence
SQPDPMPDDLHKSSEFTGTMGNMKYLYDDHYVSATKVKSVDKFLAHDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKDGKVTGGKTCMYGGITKHEGNHFDNGNLQNVLVRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of affinity maturation and intramolecular cooperativity in a protein-protein interaction.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords T-cell receptor beta chain V
total genus 64
structure length 234
sequence length 234
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2005-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
B PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2aq3B02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2aq3B01
2NTTA 1PRTC 1LLRD 1LTID 1RCVD 4RHRA 3OWEB 1SE3A 1HTLD 1PTOB 2SEBD 1TS3A 1TS2A 1JCKB 1PTOH 1I4XA 1KLGD 1F77A 1BCPD 3BZDB 1S5FD 2QEJC 3DWAA 3BYYB 1HXYD 2CHBD 4OHJA 5FK9C 1TY2A 3DWQA 1UUPA 1LTAD 3URYA 1XTCD 4O1NA 3R8BA 3EFXD 3R2IA 1I4HA 1CHQD 5ELFA 1LTSD 1JWSD 1JWMD 4RGNA 2G9HD 1B1ZA 1PTOC 4L6TB 1SE2A 1DYQA 1D5XC 1I4RA 5TSSA 2AQ2B 1TY0A 1D6EC 4RH6A 1LT6D 3W2DA 5ELEA 1TS4A 3R2TA 5ELDA 1ESFA 1LTBD 1SEBD 1B44D 1RDPD 4RGOS 1S5DD 5D3IB 5FKAC 1G8ZD 3BYTB 4Z9CB 5I4DA 1BCPB 3SEBA 1EU4A 4BWGB 1GOZA 2RDGA 5ELCA 2IPKD 1CK1A 4C56C 4ZYSA 1FNVA 1LTTD 2QILA 1KLUD 1HQRD 1S5BD 2R61A 1LT3D 1LTGD 1V1PB 2AQ1B 1SJHD 1EFID 1I4PA 4RHSA 1MD2D 3V05A 2Z8LA 3TSSA 1FNUA 1ET6A 1BXTA 1T5XD 4RCOA 1BCPF 4K6LA 1LO5D 1CHPD 3MC0B 5ELBA 1HA5A 1EWCA 1L0XB 1PZKD 1EEFD 1PTOF 5D3DA 1PRTB 1YN5A 1V1PA 1AW7A 1SJED 3BVMA 2NTSA 3BVGA 1BCPC 1D5MC 1KTKA 1DJRD 1S5ED 2IJ0A 4RGMA 1PRTF 1ET9A 1JR0D 1XXGA 4RGTA 3CHBD 1RF2D 1FD7D 1L0YB 3O13A 1LT4D 2XN9C 1PZID 2RDHA 1S5CD 3KLSX 1TS5A 4L63B 1CT1D 1LT5D 2O2LD 1STEA 1V1OA 1JWUD 1PTOD 2TSSA 1FGBD 4RFBA 1SE4A 4UDUC 1AN8A 1SBBB 1PRTD 1PYWD 4TSSA 2XRQD 2XRSD 1LTRD 1EEID 1ENFA 1FNWA 1M4VA 4DXFA 3GP7A 1PZJD 1D5ZC 4DXGA 2ICIA 3BVZA 1EU3A 1CQVA 1RD9D 1JQYD 4NZLB 3MFGA 1UNSA 1I4GA 2J4XA 1QILA 1YN3A 2AQ3B 3EA6A 1YN4A 1SXTA 2WV6D 1I4QA 3DWPA 2XNAC
chains in the Genus database with same CATH superfamily
5JHBA 1PRTC 2JQOA 2C5CA 4FHJA 1S4ZA 2F0EA 5CV9A 5IP7G 2KHWB 1PTOB 2IO1B 2AWTA 1X9NA 5C3WA 2K50A 1RKNA 2NVYB 1UWXA 2M19A 3C19A 3Q3JA 3V60A 2UXBL 3TZUA 2VL6A 2R7ZH 2WAQG 4C3HG 1X3PA 3HKSA 4DV0Q 1OTCA 4LF8L 1J7BA 4P1BC 5EJWA 1E7UA 2CHBD 3EQLC 4OZCA 2K5NA 1E3PA 4K5VA 2H88B 2VZKB 3NEMA 2NVTH 3RFZB 1IYFA 5ELFA 4FBJB 3PIPA 2UWQA 2ES2A 3PVLA 1PA6A 1EYGA 2K1BA 1U0LA 1PTOC 1YNXA 4DNRB 2INCC 1I4RA 2EQSA 2K52A 4GDKA 2WKCA 2PE9A 4KHPQ 3TDQA 4C3JH 4XT1B 5ELEA 2HJ8A 2YU9B 3ABVB 1TS4A 3IT6B 3GE3C 4LF9Q 1XPOA 2F52A 1RDPD 3K0XA 4C00A 3OTOQ 4LDTB 2WXMA 2KUMA 2A68D 2HUGA 1VQ5A 4J15A 2Z9HA 4ZUIA 1BCPB 4DKAC 4BWGB 4HCPB 3ZNID 1X3EA 4KKTA 2IHEA 4CJ1B 1WSPA 2BGFA 4R4TA 3KDFB 1Z2MA 4IW0A 2IO0B 1ISNA 1TWCB 4LMQD 3W5OA 1EOVA 2VZKD 3FILA 1RJTA 1YX6B 3ONAB 3QJYA 3T1YQ 4A3FB 5FJ8H 1PDXA 2CW0C 1N5XA 4L5RC 4CDDC 3W1BA 3IKJA 5G5HA 1T5XD 3SFEB 3A0JA 3J81E 2JPHA 4G50A 1CZGA 4ZHOA 4R8NA 4KKIA 5D3DA 1L0WA 5EQ0A 4HJ8A 4JI7L 1TBEA 5IP9H 2IBIB 2K6QA 2RDBC 3IT4B 4IPDA 1DOYA 1K3RA 3TS2A 1V86A 1PFDA 2H5XA 2D11A 1VQOA 4Y7NB 3PS6A 3PREA 2L32A 2CJNA 4DR4L 3AV8A 5KNCA 4US9A 3SFDB 1X3FA 1MG8A 3E6ZX 3GO5A 2BB6A 2M9VA 1HNZL 1NMFA 2N55A 1VZ6A 5M3FB 3AE5B 1MSHA 3RN9C 4IM0A 4BA2I 4C3JB 2K8CA 1Z9FA 2HCCA 4LNQA 1FXAA 4MIUA 5LMNL 1V9JA 1C0AA 2K5HA 3Q6SA 5G3LF 1XLOA 2IY1B 3K9PB 3CPWA 2F0TA 2LXAA 1LM8B 2L1BA 5BN5A 1MHWC 1CSQA 1PFNA 1HPCA 2ZJRA 1LTLA 3G4SA 3HOXH 4QCLA 3SK5A 1RM6C 1VQEA 3VHTC 4ULLA 3SXHA 3D0FA 1SNPA 3F8TA 1CM9A 3JAME 2GVBA 4X66Q 4A3FH 2WACA 5C4JB 3CC2A 2UXBQ 4IPGA 3IVFA 2QW7A 4HEDA 5GAEC 1FJGQ 5E7NA 1G6ZA 2F0LA 4I6LB 1TKWB 1DOKA 2NZHA 3QK0A 4N9TA 1HUMA 2A6ED 3HG9A 2V3SA 3DBLB 1SYFA 4EE2A 4YSZB 3TEWA 3FRPB 1KRHA 1G6JA 5CORA 3OWEB 4FADA 2D5DA 2O6VD 3OW7A 2LGSA 2OJWA 2QDFA 2WP9B 3N1XC 3S16B 5C2TB 1I3QH 4IALA 4A3MB 1XO3A 1J8CA 4EZKA 2KVRA 2F0VA 4S0RA 2LHDA 5HURA 3IRBA 3GTKH 1H9SB 1S5FD 2LXCA 2MQJA 3ZO5B 4JBJA 2Q2TA 1WZ0A 1IGDA 2MHJA 1NE3A 4YIJA 3OTOL 1HHVA 2KCNA 5JVH3 4GNXA 1HUNA 1UGJA 4ARIA 4PZ8A 5M3FH 1JWMD 3PUYA 3UE0A 3G7LA 2G9HD 5D6JB 3OIPA 2ALYB 1N62A 2WNMA 1VQ4A 4A3EG 3ZW3A 2AQ2B 2RCFA 4JI5L 2MPMA 1B4OA 1QNKA 5MPOA 1SMYD 1IZ6A 3NELA 1WTHA 4CDFC 4JI3Q 1H9MA 1VQNA 3S14B 2E2DC 4LTUA 2D2CC 1BT0A 5M9OA 2L15A 1P1AA 1S5DD 4C80A 2SDFA 1PH7A 1RIPA 4ME3A 3APDA 3QA8A 2ZVNA 3HOXB 3D4WA 4PT5A 5CV6A 2RHSB 4TVAB 3VR2A 1LM0A 1XMQL 2EELA 2VZAA 5LNK1 4A3IG 3GTGB 4LW1A 2V0GA 4OO1H 3QG1A 1MVKA 2XIWA 4M02A 1V81A 5EPJA 4A90A 2ZTEA 3D31A 2C60A 2WS3B 1Z47A 2IGDA 3ONSA 2NUCA 2HIVA 3KUCB 4QIWE 4BKSD 1A62A 1ILPA 1EQVA 2LJIA 2X8XX 4B9KA 1XPRA 2JXXA 4TUUA 3F2BA 2ZXOA 2WB1E 4NNJB 4NDXA 4A3BG 3FMCA 1CHPD 5CHFA 2WXOA 2V4DA 3PUWA 3HOUB 4LF5L 3CCMA 1FO4A 2N9EB 3ZQ4A 2IX0A 1Q5WB 2SAKA 3NBHA 2JA7G 4XWWA 3ND8A 2KKCA 2HIXA 2TMPA 3CCSA 2V9HA 1TKEA 2KWVB 3ZJTA 2NB0A 4BY7G 2Z0SA 1SE9A 3AE7B 2OCEA 2K01A 2MFIA 5M5YH 3RZOH 4WFN3 4A6QA 2OQ0A 4X64L 1GB4A 1YEZA 4L63B 3JAMi 2CJOA 1BUVT 1ENAA 3BU2A 3DBRI 1IBML 2W82A 1XYIA 1HNZQ 4PYZA 1HE8A 4GKKL 1GHKA 4OZAA 2ZXRA 3SGIA 5JJLA 1PYWD 1ZKHA 2HDEA 3H94A 3QJZA 4R4CA 2KNBA 1PXUA 4YHHL 3K5MA 3FHWA 1ZP0B 2RQXA 2ZEQA 5IAAC 2WB1B 2IY5B 3RLOA 1JWAD 2G3QB 3GTJB 4PYUA 5GAGC 3LXFA 4TMAB 2A69D 1L4DB 1H9JA 3I3CA 4FXKC 2XEWA 2L0FA 5C4XH 2EYLA 2K9XA 3AE6B 2INNE 1A2UA 4WJPA 3TBLD 1E7ZA 4REZA 1PLFA 1VQBA 4IOAA 2MW5A 2PTLA 4JK1C 5IA7A 1ZXHA 3TP5A 3M3JA 2MUYA 2NVYH 2J7QB 4DXAB 1YNNC 1BUIC 1KH0A 3UDFA 5C23A 2R7ZB 3SR6A 2E2HH 5L37A 3K80C 2WP8J 2JA7H 1SR3A 3RMKC 1CZWA 3I73A 1BKBA 1EZ8A 5J1ZA 3VAWA 1IBXB 1EUVB 2E74C 2BH8A 5IWAQ 2KCCA 3M4QA 1YMHE 2IZVB 4WWPA 2RBMA 1T0YA 1YNTE 1CHQD 2YVCA 3CC4A 1IP9A 2PI2A 4XYOA 1E5WA 5GADC 2IY0B 1NENB 1N32L 4J6IA 3O65B 1VMPA 2QA4A 5I9OA 2JX5A 2Y0SB 4ILWA 1E0ZA 2H89B 4ANWA 1LABA 5K36G 1N63A 4RNAA 1U9RA 1ESFA 2EYOA 4IFDJ 1GUGA 2KVZA 3M63B 3BYTB 2MBBB 4BBNC 1C4CA 3SVMA 3U7DA 1XJVA 1PFMA 5J17A 2K5WA 3QO2A 1EIHA 1YBYA 3GTJH 4LUOA 2RDFA 4R3DA 2LJ5A 1EWYC 1JORA 1TWCH 1Y8PB 1XLPA 3X23A 3NS8A 3DPDA 1QCBD 4LFCQ 3C2PA 4JV5Q 2AWOA 2E76C 1F9JA 2MBHA 1YQ3B 1SYGA 4K5XA 3MFYA 3U50C 2ZPYA 4HJ7A 2YYZA 4DFAA 2WXHA 1KAAA 1N34Q 2M00A 3WAOA 1EY5A 1DM0B 3J7ZC 3A54A 3FP9A 5KYLA 3QWNA 2HJ1A 2KT7A 3EGRA 2AUJD 4GSWA 4RKLA 3T8MA 2IGGA 2W3RA 3FPPA 4AJYB 4K2LA 4U68A 4WJQA 1JQ4A 1HTQA 4HXDA 2EYJA 3WAPA 2HD5B 3UE1A 3GTMB 2PQAA 4X64Q 2JA7B 2C7HA 2KQ3A 4W9DA 3CAMA 3NUCA 4XDDA 2B2UA 4OWXB 3EIVA 3K8AA 2W55A 4BZAA 4OXPA 2KBNA 3U4ZA 2F3WA 1K73C 1R4QB 3BVGA 4MH0E 1EYCA 4JG2A 1ACCA 2BKRB 2N9PC 2IO3B 2BS4B 3L3OC 1IUEA 2RPVA 4JPBW 2KMMA 2LGYA 1J7CA 4B08A 3NHHA 4FDBA 3L13A 3QIAA 1WIAA 2RD0A 2NZ1D 3K57A 4IFDG 4GZYC 3CU7A 5M5WH 2A5HA 3PO3G 4QY7A 1ZGUB 1E7VA 2E75C 3AULA 1HNWQ 4OW0A 2W9NA 1QE6A 4RFBA 1L5PA 2LI5A 4G3XB 3AEFB 4A3IB 2I07B 1FFVA 1GUOA 5C0XG 4B0EA 1EEID 4W9JA 4FF4A 5DEHA 2Q8TA 3PPAA 4XXEA 3TP6A 1PH1A 1YJ9A 1D5ZC 3BJUA 2M4NA 4DHJD 1MG4A 2UYZB 2KVMA 1N33L 3CC7A 4A3KG 4FYDA 1JQYD 3I56A 2DUDA 5K36H 1WR1A 2MCNB 2UUBL 3Q8BA 3KYHC 1YJ1A 2DY7A 3L0WB 1PQSA 1YHAA 1FCCC 1U4LA 2DENB 2CFMA 1ZEQX 1NTGA 1SE3A 1EQTA 3NWSA 1I3QB 4A3MH 3H15A 2C7MB 3E0JA 3KBGA 5I2XA 4GNXC 1PFBA 3GTMH 1KLGD 3GTKB 3S1QH 2EY2A 4KTAA 1FM0D 3VYTA 5FLXL 3S2AA 2IW3A 3S1RH 1U4RA 2PPHA 1FMAD 2JA8G 5C3EG 3P4SB 5IT9c 1ZE3D 1FXIA 4X3SA 4YCWA 1W6KA 2B2TA 4IOIE 2F03A 2G4DB 1MGSA 3B1LX 1WJUA 3E3XA 4DV5L 2N49A 5LL6S 1STBA 5EPKA 1UEAB 3X3MA 3OW2A 2R7ZG 1WM2A 4RF1A 1DYQA 3T56B 1NDDA 3RLFA 1K0RA 1TY0A 1J6QA 3NBHB 3S14H 1KJTA 1WE6A 4QL5A 4A3BH 1V43A 4DV6L 4A3IH 4LF9L 1KDBA 1SEBD 5BN3A 3LJ3A 2D2QA 3P4RB 1G8ZD 1ONLA 3CRLC 5I4DA 3MTSA 3J7YW 3AN1A 3G48A 4AQYQ 1Z7TA 3H3VC 1OXXK 3S1MH 1OGWA 2FIFA 1N61A 2MBOA 2PW7A 1YIWA 3QHTA 3VR6A 1U4MA 2JEBI 4ANUA 2M56B 3HKZE 5FO8B 2D9UA 2LS01 1PHJA 1KIXA 4RF0A 2BTEA 3W9CB 1OFFA 1VQIA 4PQXA 2L83A 2CCZA 3V05A 3VXWA 1C48A 4OWTB 1AE2A 2RSNA 1JT8A 4KGRA 4JI1L 3PO2G 3HOUH 5ELBA 3S1QB 3PLVA 3TMPB 5IYBG 2WXFA 4HK2A 1S3SG 3ZDMC 4DR1Q 2JXTA 5E6NA 2JA8H 2CS4A 3W3AA 5F2DA 3UQAA 2VY3A 2K32A 1W3SA 1VQLA 2QKIC 4FXDA 3IXSA 1Q8KA 1ZYRD 1YZ6A 2NVQH 1B8AA 4YTMB 3PV1A 5CHVC 3MHZA 1FRRA 2R6GA 1BBWA 5C44G 4A3BB 3RUIB 4BKTA 2O2LD 5G5GA 4UP8A 1VS0A 5IT9L 4E74A 2J7ZA 2PQAB 3U8ZA 1MI0A 1D1KA 4NAMA 2QCPX 3FPUB 4A3JB 3TUOA 2BS3B 4MZ9A 1OXSC 2B2TC 3J81j 2BE5C 3OWFA 2NN6G 3VR8B 1WOCA 3S1MB 1R4NB 5HG2A 5G55A 4EQPA 1QOHA 1WFQA 4WJOA 3M3YB 2JT4B 1V8CA 1MHHE 1EWHA 2GVAA 2PVGC 1RD9D 2Q5WD 5C4XB 1L1OC 5EE1A 2O5IC 1UNSA 4XYQA 3JSVA 5CR3A 4JPSA 4N6EB 1FFUA 2PEAA 3M62B 3AFPA 5BYSA 2LASA 1RLFA 4NKLA 3RNAC 2C9OA 5CC4A 1LV9A 1I4QA 2JZPA 4HROA 4DAMA 3BY4B 5ISRA 5CX3A 2HHHL 4P75A 1R4PB 1YJIA 1I35A 4RCNA 4MGYE 2MJ3A 4JW0A 4BY1G 1N33Q 1SDFA 2MHVA 3H7SA 4ME5A 2E2HB 1T3QA 3E9SA 1EL0A 2JJQA 3BZDB 2JA8B 3DDCB 3IBEA 3RT3B 1YJWA 1NMGA 3DWAA 5JEAJ 3DXJC 1H95A 1F2MA 3ZTCA 2PZWA 1VR9A 1Q1OA 1UGMA 1F9QA 2WAQE 1GB1A 4XYCA 1JALA 1T0QC 2L05A 1ZYRC 3R3OA 4ZDVA 4JX1C 3RLNA 1WX9A 3CMEA 4N59A 1TJEA 1F2YA 3GDEA 4A3JH 4KHVA 1PH8A 1EF5A 4R4QA 5D3IB 5IODA 4YWMA 3C1EA 4A3DG 3APFA 2JRHA 1I94Q 4YXDB 1DOIA 2DWQA 3W1GA 4H0LC 4JI1Q 5IGDA 1G91A 4XX5A 2LFNA 2IPKD 1IKMA 3RN2A 3GTOH 2PYKA 4A4IA 2G1EA 4PS8A 1QJOA 5E3FA 1VQ8A 4BBSG 4ICUA 4LK0M 2LRUA 4XQJA 2PIAA 2R61A 3GD7A 1LACA 4PNYA 3UDXA 1LT3D 2DYMA 2LMCA 1Y14B 3A7LA 3Q3OC 4YWGG 2KMCA 1TXYA 4US8A 1AEXA 3ALBA 2FCQA 3L54A 2F3IA 3Q8AA 3Q0AA 4MT5A 2BQQA 4K6LA 1EF1A 4J3OD 2KX3A 2WU2B 3QQ8B 4OIJA 3P4QB 5IGGA 3IFDA 1WX7A 4WRDA 1TKGA 3L17A 4DDGD 2C5LC 4HJ5A 5KHQA 1YIJA 5G2NA 4XIGS 1B9RA 2DLBA 3H3VI 1D5MC 4II2B 3SE0A 3KWLA 4P74A 3B2GA 4NPNA 3QIJA 4JYAQ 1WYGA 4K7WA 2N88A 2UXCQ 3PT2B 3CHBD 2Z6KA 5HY6A 2IWHA 3DEOA 1WTQA 4H13C 1WWTA 2MO0A 4WURA 2XN9C 4DR1L 2F0UA 5M5WB 2AYOB 1V8QA 1N60A 4A3OA 1S5CD 2B2UC 3N32A 2R7DA 4MSQB 4A3MG 4C3IG 1J19A 1SIJA 2BF8B 2R3ZA 3E9IA 1PTOD 3HFZB 2TSSA 1IBMQ 2MA9B 4GB9A 2L4NA 2D3CA 1AN8A 4TSSA 1M90C 1IL8A 1II3A 5IYDG 2R93G 2HQEA 4HIOA 3GTOB 3PSEB 2LGIA 3BIID 3ZGZA 3ZKJC 2K75A 3OIQA 3TQYA 1PV4A 3M7GA 3RD2A 3MFGA 4MGIE 1STAA 3N30A 2EY5A 4IUNA 1A70A 2M2LA 3HUIA 2LWPA 3NENA 3T13A 3B08A 4CBVA 3HVZA 5HI1A 1YQBA 3ZNHB 3DWPA 4HTHA 2XNAC 4P73A 1U4PA 4BXXG 4OWWB 2HDMA 4KV6A 1NEKB 1QOAA 3HIZA 3P2BA 4A76A 4K7UA 3K7UC 1FCLA 3S1RB 4LJZC 3U9OA 5IP7H 4A3PA 5LXHA 2WGSA 1NAPA 2Y5CA 3VVWB 1PDQA 2BW2A 3WOEA 3BYYB 1HXYD 4OIKA 3KJOA 2DZMA 2E5LQ 4DK1A 1E7PB 1VQDA 2JA6B 3T1HQ 1XCQL 2O2VB 3AEEB 5CMDA 2OF1A 2W3SA 3WWVA 5BR8L 4H2AA 4XWTA 3GTQB 3Q3NC 1VQGA 3UIPB 4BKGA 4L2YA 1N32Q 1KQSA 2G45B 1SN8A 2F4IA 1X65A 1IBLQ 1H9SA 1WM3A 4UP9A 2Q8IB 3K6OA 3I4OA 2L11A 1EM7A 3PUZA 2DZJA 2HDLA 4UP7A 2KDBA 4F8MA 3AM9A 1SNDA 1WXSA 2L8JA 4IG7B 2K3UA 3ML8A 5DPTA 3CKIB 2LVQA 2N9XA 5BMGA 3ZYYX 1WJJA 1K9MC 1TWGB 4YL8A 3CMAA 3DWGC 4KKSA 3VH4B 4KD4A 2AL3A 1XCTL 1K53A 3NSWA 2WIIB 4C56C 1UE5A 5GMVA 5J18A 3GTPH 1K8MA 1I50H 4OONA 4JI6Q 1L1OA 1HQRD 4C1NI 5BO4B 1E0BA 3VR9B 1V1PB 1GC6A 4DAPA 1MI2A 2QGQA 4CDEC 5I2YA 2EXZA 3APCA 3VYSA 1YX5B 4MGZE 1AP0A 4EQOA 1JMCA 3N20C 3NWTA 5KHOA 3DBHI 4WQOB 4IM3A 2DNEA 2D62A 4POFA 1WCMH 4S17A 1Q12A 2B8FA 1YN5A 5C3EH 5CV8A 2BWFA 4DA2A 1YJJA 4AP4C 3AEBB 1KNAA 1SJED 3UF8A 1STYA 3RNCC 4O2DA 4C7YA 4Q0FA 5C4XG 2JWUA 3CRKC 4JI4Q 4DHZB 2NVQB 3CPFA 3FAHA 2L12A 1JRUA 3NTHA 3RZWC 2PE6B 3DUZA 1IBXA 2A69C 3AYHB 1AH9A 1R7SA 2ZTDA 2MBEA 2INDC 4LNIA 1Y1WH 1XQQA 3NVWA 1STEA 3C0RB 4A9AA 2EE1A 2K14A 1FGBD 5LMNW 2KOXA 1V5OA 4ZRIA 5HHDG 5EAYA 2DGYA 1TWGH 2UXCL 4NXNL 4ASWC 1YD8U 1B70B 2EMSA 1WD0A 4ODGA 2NVXH 2K6AA 4XDXA 2F4VQ 3M3YH 1D8LA 1C8CA 4DGZA 1FL0A 3GTPB 4AIMA 1XD3B 1I50B 2EYPA 2JA5B 4DV4L 2B8GA 3M4YA 3AU7A 2WXJA 1VQHA 1YN3A 4DR2L 5KEEA 4DV1L 5CV4A 1YN4A 4P2CB 3FC4A 2OHFA 3I70A 4RM8A 4B0MA 4G7ZC 1V97A 2VQEQ 1DOXA 4DAVA 4LF4Q 1EO6A 3EFCA 3KW5B 1OXUA 2Z0DB 4GKJQ 3U7ZA 2K03A 3UDGA 5IY0A 1N8RC 1SYEA 1WCMB 2DYBA 3MHBA 4N9PA 5IOIA 1VMCA 3TEHB 5C3JB 3QR8A 2V4LA 3JW0X 3FKIG 4AUQC 3EVQA 4B3RQ 2Q2UA 2FCMA 4DWFA 5EE3A 3PRZA 4OHJA 1TY2A 2UXDQ 1LTAD 1SRUA 4KKUA 3URYA 3K81C 5K5PA 2FIDA 1GD7A 3R8BA 3TREA 4EZJA 1O7IA 2QF7A 1LTSD 1DZ1A 2LXKA 4GGQA 3GS2A 4AYBB 4AQ7A 2KHJA 1LXDA 2OT2A 3DOWA 2ASQA 3R66C 1Y1WB 4TV3A 1YNND 1JC7A 2JK8A 3SK6A 3QAQA 2J0KA 2F0SA 3LWUA 2KC1A 4M8MA 1SNQA 4HVBA 3A8JE 4AS1A 2GRIA 1JOOA 4K5WA 1OQYA 5ELNA 3VR3A 4ZUJA 2UUAQ 2VB2X 4WWOA 3ZJUA 2N9LA 1FNVA 3N52A 2CH4A 4FULA 3W1SA 1NNXA 4B9WA 3JSVB 1GPXA 3ERQA 2BYTA 2PO4A 3STBC 1F9RA 1XNRQ 1E1TA 2B76B 2L52A 4A3LG 2B63B 1E8YA 1VZ8A 4RHSA 2AEHA 1KRTA 1K8GA 4PK1A 2Z8LA 4BOSC 2REXA 1T6BX 2A8VA 5G3LD 4IC7B 1WTVA 4KN4C 3K59A 1NYRA 2Y0SE 4G57A 1HR0Q 1I42A 1SFOB 3C46A 4X57B 3MXPA 4HIDA 3RCZA 3CXCA 4DUYL 3PLUA 3RYTA 1VD2A 2F0HA 1SIFA 2X6LA 3NE5B 1ENCA 3ER0A 1ROEA 4URKA 2Y5PA 2OEOA 1WXQA 4OL7A 3WOFA 5IYBH 4L5SA 4V190 4HPLB 1C9FA 1D4BA 3VUYA 1S5ED 2DBYA 3I90A 4EGVA 4K0KQ 1JR0D 5DAUA 3A8KE 4RGTA 3NY5A 2WXPA 1Q1EA 4PG3A 1L2FA 1BMLC 2K5VA 4HDQA 1WD1A 4FA6A 3BDCA 2QMTA 4JIOU 1KF6B 2CVRA 2F0FA 1Y56A 2KDIA 4L23A 1WH3A 2A5UA 2ONQA 4ZLTF 3H1UA 2N7JA 1B9NA 1K28A 3CWIA 2CR5A 2EOTA 1K0SA 1MIUA 2FUHB 5IO9A 3EROA 3AEVA 4DV2L 1G2TA 1ENFA 4B6WA 2JSVX 4NMZA 2EMTA 2W54A 2WXGA 1PZJD 2GBJA 1GUSA 3N6RA 1MBYA 1Q1BA 4DQOC 2Z6BA 3CCRA 4NZLB 1VQFA 2KEEA 2J4XA 2B63H 3AXCA 1EY0A 3PRPB 1O80A 5EKLA 3HOVB 2WDVB 1C76A 2BS2B 3Q3FA 1J0GA 2NBVB 3WIMA 2WV6D 2KN5A 1BBUA 4O1NA 3AFQA 4WJ4A 1J8IA 3CCEA 2D0OA 3D32A 4XC2A 1EIGA 1HTLD 2EPBA 3DBSA 1L6UA 1X54A 3AMZA 1TT2A 4WJNA 5JOBA 1SSOA 3SD5A 4LF6L 5DPSA 1X6OA 3TP8A 1K50A 3TP7A 1L1OB 1KFYB 2V4IB 1UD7A 4MTNA 1TT5B 3KYDD 3PGEA 3OLMD 4DHJB 2V1YA 2JA6H 4N8X1 3OMGA 2GN5A 1ASYA 3MC8A 3AE2B 3GTQH 4AYBE 4GN5A 2FCNA 4XQQA 4A55A 4KZCA 3H0GG 3TEXA 1YHBA 4JCVE 3HOZG 2DJFC 1B1ZA 2R7FA 3J80L 3AB5A 3RI7C 5CBAE 4N8FA 4F1SA 1AFPA 3LYYA 1PFSA 3MVVA 2JN4A 3A5UA 3M7NA 1JW9D 3R2TA 5LMUQ 1WVLA 1H9RA 4X3TA 1K8AC 1RRBA 4OZBA 1AE3A 4GLAC 1ASZA 3OJ4B 4KN7C 4K14A 4MEMA 4RA8A 1T0SC 2I0QA 4QGUA 2VW9A 1E2WA 1JJ2A 1WGGA 1ZDVA 5IYCH 5GAHC 2WINB 2CU3A 5E6JA 2QJLA 1YNJC 2A1AA 5BYRA 2LMCB 1EIYB 1LTTD 1HNXL 1RWSA 2KXJA 1A15A 3KJPA 1F2LA 5FLXc 1EQQA 3HOVH 5JJKA 5H8YE 1UEBA 3TMEA 3I9V1 1EFID 3I8ZA 3KDFA 2KANA 2D07B 2KZRA 3F2CA 1UF0A 3TSSA 4DBGA 1EOTA 1F9PA 2NBFA 1WI0A 2VB3X 1WTOA 5EKIA 3TIXA 2K0PA 1JJGA 4X6AH 1HA5A 4FO2A 2CHWA 4CKBA 5C3EB 3BK2A 3P7JA 1K8RB 1RFKA 2ZW1A 1P8LA 1T0RC 1EQRA 2ENBA 3QCAA 4KVGB 1KRSA 3EUB2 3V3XA 1TWAB 3QC8B 4B9XA 2DNCA 2BE5D 3Q8EA 1OEYJ 4DV7L 4F7ZA 4H7BA 4HJ9A 1EY7A 3PSIA 4HEA1 3J9CA 4IURA 2F0PA 2I1JA 1XNQQ 1C9OA 4M8NA 2GOWA 3MZ5A 1VQJA 1PZID 3PRMB 3VRAB 2L3ZA 3VTVA 3AU5A 3CF6E 4FVMA 3KLWA 1PVOA 1CT1D 1LT5D 2B2VA 3RNGC 1HH2P 1YITA 4J8QA 3S1NB 4L8JA 2BH2A 3EJIA 2D10A 4LFAL 2NVXB 4QMGA 4XGAB 1WRIA 4TQUS 4CKEA 5KNBA 4NW2A 1IYUA 4DXFA 3L16A 1Y1VG 1FXTB 5TR5A 1HQMC 4ZAIA 3GP7A 5LL6X 3D6CA 1R9TH 2JA5H 3HOZH 2LY7A 4BAXA 3L0OA 1J5EQ 2E2JH 3MAQA 1EU3A 1CQVA 2VS1A 2L76A 2KDFB 1XT9B 3OPOA 2ZM6Q 4LWCA 3DVGY 3E5SA 3RULA 2JYEA 4JC0A 1PUTA 2ATWA 1GC7A 1UBQA 3PIO3 5IKCM 1CI3M 1CJEA 1SROA 3W1SC 3T3OA 5JAVA 3DVNV 3UI3A 3VRBB 3SK4A 4G7OC 2JA9A 2JP1A 2NYZD 3E0EA 2PW9A 4R8IA 4PMCA 4YWLA 4HLEA 2CU1A 2QSDA 2JE6I 1P98A 2JVCA 2AUKA 1FR3A 2A68C 3VR5A 3K9OB 2E5LL 3CSFA 2E2IB 1A2TA 4LNFA 4APVA 2VQFL 2F1MA 4CJ2C 4C2MH 3GB1A 2ZT9C 1DD2A 4JI7Q 4KHZA 4RGNA 4LF6Q 2OWOA 3I4NB 2F0OA 1JB3A 2XBBC 3B9JA 1IBLL 4RH6A 2X69A 3IFTA 3S1NH 4EFOA 2CW0D 1UWMA 2GA4B 2VRRB 3PUVA 2MWSB 2O6VB 4ZKCB 5BMIA 1LTBD 4DK6C 1MSGA 3PGZA 2K22A 4TRDA 2FMMA 2HT1A 1HZ6A 1U4AA 4DU9A 2KJ6A 1OQQA 1R9TB 1VCBA 3HOZB 3CIRB 3F2DA 2RGFA 3I3TB 5GXGB 2MP2B 1FD6A 4GN3B 2WDQB 3NJTA 4EKUA 5IN7A 5DCNA 1YOVB 3PO0A 3EFUA 2PNHA 4OVZA 3FILB 1VJKA 1E24A 2N1VA 4JYAL 1Z5SB 4II3B 2C7NB 3UQBA 3NHEB 2FINB 3CCJA 1UH6A 1MD2D 2KACA 4GLSC 2J0JA 1AYFA 2KQ7A 4L1BA 4AWJA 1UBIA 1SFOH 2V3NA 3AI5A 1HEZE 2GBKA 4G11A 3NVYA 2KC2A 1BBXC 4MACA 1CA5A 3A55A 4DDID 2FAZA 3TJPA 4IJHA 4C3HH 1N36Q 2E3TA 4FHKA 1OQRA 4PMWA 2E2IH 3NVZA 2NTSA 3U9SA 4KHPL 1UE1A 1RTNA 4I65A 4JI4L 5JEAH 5LMNQ 3MEHA 4LNNA 1A5RA 3IAS1 2FMCA 1A3TA 3Q23A 3I4NH 1FD7D 1WI5A 1L0YB 1LT4D 3CQZB 2KJHB 4M01A 3HGBA 1EY9A 4W9FA 1NI3A 1R4MI 4BVUC 1CKOA 1EY8A 3JAML 1GG3A 1SGHA 2A73B 1IHZA 2AL6A 1PH5A 1ICWA 5ELOA 3SU8X 2LZ6A 2BBCA 4DV7Q 5A2QL 4DR5L 1PH2A 2EY6A 4NPSA 5DM63 3MHSD 1VQCA 2B2YA 4EVOA 1TIFA 3OG5A 2N9KA 3L7ZC 1XMOL 4H44C 5FLMG 3NPPA 1FNWA 3T16A 2WYQA 3ICEA 4ZCKA 3QARA 1L2NA 3IL8A 2ZJPA 4DV4Q 1EY6A 4TQ0A 3HZXA 4KGTA 2JEAI 1I4GA 3NOBA 2D0PA 1Y8OB 1YVCA 4LFAQ 1WTWA 4E3CA 2AQ3B 2N8NA 2B3AA 2YV5A 4DV1Q 4B3ML 2LUEA 1X3GA 4M1UB 2QEXA 2ZNVC 2RVLA 3AMUA 3WA0A 1QWYA 2PLPA 3U30A 4NAWB 3VTWA 1LLRD 3BDLA 3S2HB 3WANA 4HSPA 1C78A 1O7YA 4WH4A 1XPUA 1WTRA 2KA7A 3MC9A 2K8BA 1F77A 2RSOA 3CCLA 2OTJA 3H91A 3AECB 1GO3E 3EHVA 1X55A 1PH3A 4JI0L 5M3FG 4EX5A 4CDCC 3G6JB 4LF7L 3HM3A 3ZLZA 4C4VB 5CV5A 4CKCA 4HJGE 3PO2H 4HDOA 2RSUA 2WXIA 1JB7A 4DR6Q 3GV3A 4GN4B 2XTIA 1CFMA 1IW7D 3CQZH 2FJ2A 3DM1A 3DBRB 3I63C 3WCQA 2DAFA 1KM7A 1DONA 4YCVA 1Q10A 4N9F4 4JBKA 1STHA 1K51A 4EOYA 1GNUA 4NB3A 2F3VA 4IO9A 4NJCA 4P71A 2BYVE 2VQFQ 4R1JA 2LKVA 1PH6A 4WJWA 3ZXRA 1GM5A 1XTDA 1TGZB 4JI5Q 3VTUA 1GOZA 1ML0D 5T1GA 4OVVA 2YTYA 4ITKA 3AU4A 1D2BA 1Q3LA 1DOLA 2I5LX 1X56A 3H09A 4IJLA 1TWFH 3V96A 1IYJB 3M85A 2VH1A 4X62L 3H9DA 3KVFB 2FBWB 2NS5A 1WYWB 1B3QA 3EBEA 1DOMA 3VUXA 2KTRB 4IWPA 4JOIC 2JZZA 4DV3Q 1VQ9A 1DCZA 3ZJYC 5LLIA 5JPMC 1HRJA 2PVOD 1XEEA 4JQWC 4WWNA 3BG3A 1OXVA 4HMIA 1SNCA 1NYQA 2KTFA 3KYCD 3LB8C 2BOSA 3MC0B 3F2UA 4KSKC 1ZUD2 4QUCA 4LUVA 3RNBC 1WZ3A 3S15B 4BY7B 2ZPNA 4JVZA 1V1PA 4DUZL 1TWAH 4P16A 1HJPA 1JE5A 2Q8RE 2UXDL 1WF9A 5CBEE 1FRDA 1N9WA 2ASBA 2F4VL 1F1HA 4DK0A 4DR5Q 3PO2B 3HOUG 5T1IA 2WHIA 5AZHA 3RN5A 3ZRCA 1WE7A 4QUFA 3TEYA 4BY1H 4JI2L 1AWDA 3MJ5A 3R7QA 1XXGA 2ID0A 2L00B 3I4LA 2KD0A 1AZPA 1VQ7A 3NZ3A 1WY8A 2BPSA 2NMQA 4NY0A 2CH4W 1F9SA 3KLSX 5NUCA 2CQOA 1IW7C 4IQZA 1WRDB 2Z59B 4KGSA 5IWAL 2EJMA 2XVSA 5FO9B 2A6HC 4K1RB 4GKJL 4GXBA 3KLRA 3DQVA 1W2BA 3A4RA 4DR7Q 4ZYNA 3U58A 1HZBA 3TCAA 3DLLA 4HCEA 3A9KB 2GBNA 3DCGA 1E2VA 4PS7A 2PNRC 5IYCG 2EXDA 1GJXA 1M4VA 2WDTB 2D5GA 2ZCCA 2PQEA 4KJOA 3SDZA 2E2JB 1O7LA 1I6VC 2E6XA 3OSOA 4A3JG 4DF7A 1IL2A 4JE3B 4W9HA 1Y1WG 4OVUA 2NN6H 1SNOA 2WB1G 4LF7Q 3HKZB 1VQMA 3DBLI 2DX5B 2NTTA 3KF6A 1GJZA 4K2KA 5IT9E 1ZXIA 4MM3B 4OO1I 3KUZA 1HZ9A 1TZ1A 4YTPB 1KOTA 1I4XA 4R4OA 5EGTA 1I94L 1EZ6A 2X38A 5CV7A 3PZDA 4B3MQ 4ANXA 2AWNA 3VDZA 3V6EB 3KUPA 4LCDE 1FVIA 2ZVOA 4BY1B 4JBWA 5HGQA 4C2MB 3T4AC 2VXWA 4DNTB 2JUOA 2M17A 3WALA 3MP9A 1AARA 1W6JA 4RM9A 1D5XC 1ZXTA 2XWBB 3KF8B 1LT6D 3W2DA 2KLGA 2L7RA 4CHKA 5FR3A 4IDIA 2JY6A 2I1KA 1BQQT 2L5TA 3OMCA 1L7YA 2OJRA 1EY4A 4ZOHC 4YCUA 2ZTCA 4KV2A 3SHQA 1C7YA 3J80c 4DR6L 2NVUI 2Y0SG 4KY7A 4TKOB 5DLQE 3NVVA 2K6DB 4GU2A 2NN6I 4MJSA 1SE8A 2Y5BB 4DV0L 4HCNB 1DXMA 1HZ5A 1A0IA 4F88A 4A93H 5IYDH 2JYTA 2CKHB 4E6IA 4YY3L 1I7HA 3NP8A 1TTNA 2MJDA 3ULPA 3Q8FA 1E10A 3A8IE 4DNIA 5AEKB 4A3DB 5FR6A 1C3TA 2K5DA 3PMFA 2ZW0A 4DPGA 1MHXA 3NRZA 4HMJA 5AUIA 2AQ1B 4FJVB 4WIPA 3K7AH 4EQ5A 1WGHA 2OXPA 5C4ZA 3M9BA 2Q2IA 4X65Q 1D7QA 2HQLA 1PGAA 2VUMG 2JZ3B 2KFKB 2BA0A 3MWYW 4MELA 4KK7A 2R92B 4K3BA 5JJIA 2MRPA 4L5TA 2GI9A 3X3NA 2WAQB 4C3HB 4JBMA 4UAIA 3KH0A 4HJKA 4ABNA 3BZCA 2ZXPA 1FYCA 5D65A 2CQAA 2Z4HA 5KGUA 3DHIC 4Q2JA 4BBRH 3V61A 3DHQA 1STGA 2JSOA 5JPNC 1PRTF 1C4QA 1ET9A 3L10B 1CKMA 1SLJA 5FLXE 1P16A 3RNFC 1VQPA 2GB1A 1KAWA 4DUZQ 2RDHA 1F2ZA 2G9DA 4I7ZC 1GUNA 1NCVA 5FLMH 3ZXVA 4A3LH 2B63G 5C0XH 4IN3A 3ULJA 4BA1I 1E8WA 4RMAA 1BR9A 2L9HA 1Q81C 2DZIA 1SYBA 2PZUA 3ERSX 3PCOB 3UDIA 4HKZE 1CTMA 4PZ7A 1C4PA 4ANVA 4GOPC 2J52A 5AUKA 3OAWA 1N34L 1TYGB 2UUBQ 5LXIB 4F8CB 5EPLA 3DWMA 3I72A 2PMVA 3BVZA 2D3BA 1Q7YC 2UUCL 5JH5C 1B2TA 3CP0A 1SAPA 2MNAA 4S3SA 4MSMB 4PZ6A 2JA6G 4ZK9B 2JXMB 1UELA 2Z4IA 3CCUA 4G0NB 4AYBG 2CWAA 1R4MB 2XK5A 3G71A 1LUZA 3STBD 3T9LA 3S2HH 3Q6BA 4KI0A 4RWSC 2KCTA 2PMZB 3H0GH 2J0MA 1PGBA 2Y3AA 1ZPSA 2NCNA 3NK9A 1TS3A 5JEAG 2F0WA 3FVQA 1FPYA 4N58A 4HR7B 5AZGA 2EYHA 1NJIC 1CSPA 4CO7A 4K3CA 3J7A5 4YWKA 5LHY1 4P72A 1F2RI 2MX2A 4FJZA 2N0SB 2G4SA 3C1FA 2AX5A 3ENEA 2QEJC 5HKHA 3J81c 4IZ8A 3L9AX 3OHXC 2B39A 3HRZC 3ETRA 3I5JC 3V6CB 5C0XI 2N1WA 5CGKA 4X66L 3DM3A 1HNWL 2UU9Q 1Y8NB 3R7RA 1IBKQ 4C1NK 4KMUC 1FJGL 4FF1A 2MP1A 4MHEA 1Z6HA 5HFYA 4B3SL 5EDSA 1I6HH 3HOXG 3TS0A 4IFDI 4DR3Q 3N3KB 2EYMA 3HOVG 5IGFA 2K05A 2WKDA 4IUTA 3PHWB 3PUXA 5E6OA 5ELDA 4GDLA 1QF6A 3HP3A 4RGOS 2VNUD 1SMXA 2KJXA 2PW5A 2DAJA 1EU4A 2WXRA 2X6GA 4C3IB 1GXDC 4GNXB 3PF5A 1WTXA 1TWFB 4I7AA 1J5EL 1ZW7A 5C5MA 2O2VA 4ARCA 3D8GA 5KIXA 1FGUA 4A3FG 3G6EA 2ZJQA 3I4MG 1PGXA 3QX1A 4WAAA 1QZHA 2KDEB 4ICVA 3KWVA 1KLUD 4J6HA 1DGJA 4KIKB 2WWZA 4J1MA 1JICA 2NPTA 2B29A 2KCMA 2YEPF 4POGA 1A6XA 2DY8A 1IXRA 1MFWA 2BVCA 2I38A 2G5DA 4DN4M 1OO9B 2M8SA 4YY3Q 2KWUB 4D2KA 2MSED 3JYUA 5C5LA 2K4KA 5EBCA 1KD1C 2IYDB 3S15H 2WU5B 5J2RA 4BY7H 2ZNVB 5IOCA 4HSVA 1KXLA 3S2DH 2DNFA 1CMXB 3P1HA 3U2SC 1QLBB 4ACFA 5IP4D 1KL9A 4QB4A 1V9PA 1H8CA 1MPEA 3AH7A 3H6MA 2BB5A 2B2WA 3AE3B 4DV6Q 3A9JB 4HJAA 1TIID 4XTCS 5FOBB 2F0MA 1NY4A 2CWPA 2ZM6L 3K5LA 3HOWH 3TRZA 4BXXH 1S1QB 4G4KA 3HRDD 3FKIH 1BO0A 4C4VA 5DNFA 1ZDXA 1C1YB 1MJDA 1P0RA 3MA2B 3PZ8A 4B3TQ 1PYSB 2WX1A 3NG0A 4R9WA 1V1OA 3AEAB 1HTPA 1JWUD 5DM73 2V3PA 3W5VB 2KWCA 4DAYB 3ZJVA 1WX8A 4BS9A 2ZZPB 1SBBB 4LF5Q 2L55A 5AFWA 3OJ3A 2K8HA 1B7YB 1LTRD 4LJOB 5IGBA 3IFWB 3Q8CA 1G6PA 1ZOYB 1XLNA 3HKZG 3UIOB 5EKKA 2I46A 4O0AA 2KQ4X 3GQBA 3L4PA 4EEWA 4KJNA 4OO1G 3S9WA 3RNEC 1Q0WB 1JE4A 2MQHA 5E4XA 2FUG1 2SNSA 1JWBD 2B3GA 2KWDA 2HTME 1CUKA 4ZRJA 1XF5L 4BBRG 5CHWA 2KMAA 4ID6A 2K7VA 2IHFA 3V62A 1GAQB 2OOBB 3BK1A 1HZAA 3OOCA 3S17H 1Q46A 1KDAA 2JU6X 1XX8A 3ZVVA 3M4PA 3AE1B 3PZ7A 3W1YA 1RCVD 1IYVA 4BBNF 1WR6E 2E8GA 2C35B 3F1ZA 3S2DB 3SK8A 2WXKA 1TS2A 3AEGB 4LDTD 1K83B 4K6DA 5BN4A 4FF2A 2A19A 4OX9Q 3FEWX 3H7PA 1KLVA 4GS3A 4W9CA 3VUWA 2IL8A 3KF8A 1F52A 3DMUA 3PIP3 1GUAB 1VQAA 1TZOA 1MKHA 4QQBX 2RMMA 2WXNA 3DWQA 1WJNA 2YEPB 5FJ8G 1ZKOA 2LVOA 2K39A 3PQIA 4A3KH 1I4HA 1N5WA 2XGTA 2P5ZX 1GHJA 3FKIB 4A75A 2LEKA 2RR9A 1KABA 3NTIA 3N1YC 1SE2A 4ZKBB 5M3MG 3P42A 4W9GA 5TSSA 1WGYA 4YSXB 5JHAA 1A63A 2KX0A 4RMFA 3LWEA 2QIEB 4CQNA 5EE0A 2BDNA 2RF4A 4LUZA 4GIVA 4IUUA 3NS1A 5FKAC 1G2SA 3CMMB 1AZQA 3MXGA 4CGYB 1RL2A 4DUYQ 1IBKL 4KD3A 2QCZA 5C6AA 3PHXB 4A93B 2GBMA 1JMLA 4DHZE 4B3SQ 5A2QE 2J53A 1SNMA 2RDGA 4IUMB 1EYDA 2INPE 4ZYSA 1WJ4A 4A3DH 5C0XJ 2UU7A 3QB3A 4I6NB 4MN3A 1A3VA 2A6EC 2LXJA 2QILA 4NP5A 3GZNB 3MJWA 4YTNB 3K7AB 1QOFA 2BDOA 3S17B 4WJ3M 4YT0B 4IFDH 2MP2A 3DVNU 5DPRA 1EYAA 3S24A 3I4NG 3SR1A 2R92H 1NUCA 2Z1CA 3TBIB 1SB3C 1ESRA 4KX6B 1L0XB 1PZKD 3ZUNA 4DK3C 2EJGC 1Q86C 2KDMA 1TU2B 3DEPA 3NTKA 1Q82C 3CW2C 4BOZB 1XMOQ 4BBRB 4LJPB 2WX0A 1GUTA 2IJ0A 2B2VC 2BYFA 4A3KB 3RR5A 1BVSA 2SNMA 4LFCL 3KK7A 5HGTA 4FF3A 4A3CG 2O5JC 1QUQB 1HCZA 2XWJB 5J39A 3M4OH 1RF2D 3DHHC 2FE8A 1VQKA 1RTOA 2AMCB 1H9KA 5T8IA 2KLCA 2F0IA 4HIKA 1YQ4B 2WQYB 2R2OA 5FO7B 3UI2A 1TR5A 2KO3A 2Z0EB 2N7EA 4JGHB 1NI2A 4IWOA 5JVG3 1VDZA 5AJ3Q 2BCOA 1CKNB 5BR8Q 4UDUC 3I4MB 1UE7A 4GLXA 1SSNA 2K1FA 2ZJDA 1LGRA 2XRQD 5L83A 2MEKA 4NQLB 3KLSA 1WMHB 3I7FA 1T5EA 3RZDB 3HVDA 3Q22A 3VFKA 2GBRA 4IUQA 2ICIA 3HK0A 4ZRKA 1VF5C 2IX1A 4W9IA 3IAYA 3Q3MC 3RD4A 4K8JA 2F0GA 5I6WA 2JA5G 2EKEC 1M94A 3HOYH 3EECA 3T1YL 4DV3L 3GTLB 3U4VA 1YJNA 1SXTA 5CYUA 2LGXA 3H0GB 4FP5D 1BOSA 2CHXA 1HFGA 4RHRA 4YSYB 3B2FA 4IUVA 1HTOA 3WAMA 4ZHPA 5LMUL 2SEBD 1TWHH 3UINB 2EZVA 1CQFA 1FIQA 1GKHA 3ITPA 5IGCA 2DHZA 3WDNA 2PJHA 2OQKA 3J80i 5JJZA 3VA7A 1V80A 4LAAA 1QKZA 5E4WC 1P7FA 1TQOA 2BA1A 1G51A 3FKYA 4DR4Q 2O4XA 4JI2Q 2NBWB 4XE0A 1XTCD 4A3GH 2IDYA 4W9EA 5C1ZA 1HNXQ 3M4OB 4IPCA 1QZGA 3TN2A 3R2IA 4HAEA 4Y52H 1L6VA 1SF0A 3RPFC 4HIMA 3IHPC 1C4AA 2JF5A 1D3ZA 3KBXA 1I6HB 1GVPA 5CTRC 2JRIB 4AOFA 4HWIB 5DPWA 1H4RA 2JYOA 1WGRA 4EZLA 1P9DU 4EUTA 1QT9A 3M95A 4HN7A 2MO1A 3I4MH 2YTVA 1S72A 2MJEA 4GDKB 4JI8L 4HPMB 4K81A 2R2QA 3DVGX 4QIWB 2PCFB 4C3IH 5I6YA 3RZDH 4A93G 1WGKA 4FLHA 4JI6L 2KFKA 5H1SE 3VR4A 3AE4B 4BKSA 1QB5D 3QOJA 2F0KA 2K25A 1A3UA 2ICEC 5IE8A 2N4FA 2HCIA 2NPTB 4MTKA 4XT3B 3DBHB 1U5KA 5KRUA 3QWZB 2PPBC 3VQIA 1XNQL 1NBWA 4NXNQ 1SMYC 1XWEA 1LTGD 1S3OA 1M1KC 2QHOA 2NZOA 5C44B 5M3MH 2HTHA 4R4IA 3P63A 3T3NA 3D4DA 4JI3L 1ET6A 4WQMA 1WMHA 3SHLA 1UZXB 4TQ1A 4B95A 4RCOA 2V1CC 3VA5A 2LUMA 3A9KA 4M00A 1VCIA 1CKNA 2NWGA 2KN4A 2MBQA 1QQRA 2K33A 1ILQA 3LGJA 1QZEA 1PTOF 4F7XA 4PMBA 2VUMH 4DR7L 3VYUA 4NXML 2N7DA 4AQYL 3HOWG 2A6HD 3A4SC 4KKJA 2IGHA 1BDOA 2L0CA 2PI2E 3Q24A 4LF4L 1NR4A 1I5FA 1E9MA 3LNNA 5AJ3L 1KTKA 4HRSA 1HA6A 4BBSH 3HOWB 3K0YA 4G7HC 1HZCA 5J22A 3ZIMA 3NZUA 4O42A 2J0TD 3O13A 2GLSA 2I5HA 4MDKE 2RCNA 1JRPA 2IO2B 3MEFA 1WYDA 4DAYA 1TS5A 2QC8A 2A74C 2MLBA 1Q90A 2PMZE 4AJWA 4JL9A 2K5PA 2KAJA 4F87A 3JC66 2ZCBA 4IOCA 3Q8DA 3PO3H 4MM3A 3X0WA 1LQBA 2I2YA 3JAMc 5A35A 1K3BC 1QG7A 3MXNA 4FJYA 2LD9A 3EN2A 1DGSA 2KENA 1ICFB 1XMQQ 1BNZA 1QVFA 2VQEL 2KTRA 1UWVA 1E8ZA 4A3CH 1V2YA 2EKIA 3A7AB 3J80E 1VQ6A 3JVZX 3H8HA 4KDIC 1HFNA 4CHTB 1IPGA 2WFWA 3NBIA 5M3MB 2KFJA 1Y1VB 4X65L 4LNKA 2B2YC 1BF4A 3MTNB 2H1EA 5IIFA 1K8OA 1JJCB 1QOGA 4IM2A 3DHGC 1QOBA 4K7SA 1STNA 3GZNI 5D2MB 4B3RL 4RG1A 4GOPB 1K83H 1OEYA 2D3GA 4DR2Q 2WXQA 1E1OA 1X32A 2RKSA 1PTOH 2VUMB 2DJGC 4Q5VA 3ZNGC 5GROA 1BCPD 1NR2A 1T9HA 4YHHQ 4LFBL 3N9YC 1O7ZA 3Q14C 5IP9G 3PIOA 4KIKA 1Y69U 4RAUC 4FXCA 2Q2HA 1RHPA 3VDYA 4KDLB 1WCMG 2EVBA 3CCVA 1E6EB 4RKBA 4JI8Q 4BBSB 3MXUA 4OGQC 4OEMB 5E6PA 4JWUC 2AHOB 2F0JA 4UY8C 4ZQ3A 1JWSD 2NVTB 2CHZA 4L5QA 2KQSA 4X3UA 1UAPA 2N3SA 4L6TB 1V49A 3OYYA 4MH8A 5M5XB 5EBDA 3EC8A 1YI2A 4GDLB 2ON8A 1D6EC 2HHHQ 3HOYG 3H3VH 3H6NA 2R93B 4AH6A 2YU9H 1B44D 3T51B 4EQNA 4HKQA 1TKYA 4GKKQ 3C8YA 4XDCA 3SEBA 2YTXA 1N36L 4NAWA 2K28A 1QUQA 1K52A 3NQIA 2LVPA 5GQOA 1QNUA 1E90A 1VZ7A 1KHIA 4W9LA 2UUCQ 4PS3A 2QDLA 4KLKA 2MJ8A 1O78A 4NJ6A 2LFIA 3ECIA 1SYDA 3P4PB 3UGBB 1KC8C 4M8AA 2UUAL 1JOQA 1V1QA 4QJFA 1RAXA 3NUHB 4KY6A 3L2PA 1I4PA 4DV2Q 3A33B 4GN1A 2Z6KC 1RYJA 4A20A 3K5NA 1FNUA 3GOEA 5JXVA 2SOBA 2WDRB 3CSTA 4GOPA 4MJSB 1EWIA 1BCPF 4UHVA 4C3JG 1LO5D 1EFWA 3NQTA 1EWCA 5JZEB 2XK5B 4X3KA 3RMHA 2RPQA 2I5MX 1P7EA 2KEDA 1AW7A 3PTFC 1NVID 3R3MA 1S40A 2FHTA 3V2TA 2KJRA 2NBUA 1Y8RC 4Y7NH 1LYLA 2RA4A 1BCPC 1MJEA 4U673 1DJRD 4ALPA 4JV5L 1PMRA 3U4EG 2LRWA 3PF4A 1G291 1E2ZA 3KOJA 3MXNB 3AEDB 4MNOA 4MGKE 3AB9A 3U52E 2L1AA 4TKNA 3K58A 5M5XH 4DR3L 1WXVA 4NXMQ 5EE9A 4GOCA 2M0XA 3ZTDA 3CCQA 2MH7A 2R93H 4B3TL 3FDTA 4K0KL 3J81L 4KSLC 2KHIA 1E22A 2PZTA 4FXGC 3LX0A 3K5OA 5AZFA 1V6EA 2NR2A 3P75A 4OELB 1SE4A 5COYA 3A1QA 4M0WB 1WGDA 1XNRL 2DYOA 4A8XC 4K8IA 1N6ZA 3B0AA 4QAYA 2LHEA 4IWQA 2KHSA 4JI0Q 5BYQA 4DK5A 5BMHA 4GMVA 3E56A 3ND9A 4LK1C 1X1MA 3TZDA 3AE8B 1P3QU 4BFRA 3RNUA 4XZ4A 2RHQB 3ML9A 1HR0L 5KYIA 3P1MA 3HOYB 1QVGA 2FXQA 2IX3A 1QILA 5C4JH 2UU9L 3NXWA 3GTLH 1NBFC 3R93A 3H7PB 3GV6A 1VF7A 3BZKA 3D6WA 1J7AA 4ZRPA 2WLBA 2N78A 4FN2A 1F2RC 1VDVA 1TWHB 1LTID 1QVCA 2EY1A 4CJ0B 4P6VF 1FEHA 2DN8A 2EYFA 3KFUA 4NJ7A 4A3GG 1JCKB 2M1MA 1A8VA 3TEZA 4CYEA 3S16H 1WJ6A 4USAA 1LFDA 2KECA 2D3AA 1R4NI 1VRAB 1C79A 1XLQA 2H4OA 2J42A 1OTRB 5FK9C 3HEJA 5E1FA 1YHQA 4A3GB 1WXMA 3IAM1 4KY5A 1KDCA 1UUPA 3KUDB 1M8AA 5D7GA 2CKZB 4FNFA 4C7ZA 3J7AV 1NSNS 3EFXD 1C77A 2ACZB 4X62Q 4E71A 2BYEA 3B6YA 4LNOA 4LFBQ 2C9WB 2IT1A 2WXLA 3A1QB 4M0WA 3Q69A 2PKOA 2L0TA 2JWZA 3E9HA 2EJFC 2K5QA 4LF8Q 3LDZE 4PV1C 3ZDTA 5KNDA 3TL5A 4Z9CB 1PH4A 2QDBA 2YLMA 2B2WC 1E8XA 4WWMA 3I91A 3ZRFA 1D1IA 1PH9A 2F0DA 3QOLA 3I2ZA 1F0ZA 3RZFA 3C3LA 3A9JA 5ELCA 1CK1A 4JWSC 2HE7A 1TVXA 3HS0C 1J9OA 1V5TA 3GE8C 1X3QA 2OTLA 3CD6A 2FNJB 3T1HL 1WXAA 3GTGH 1SYCA 4DV5Q 2LGDA 1S5BD 4WORA 5IGEA 1EUJA 5C44H 5L95C 4IPHA 1SJHD 1VLBA 3Q2AC 4P1CC 4IUPA 3CF5A 2LSSA 4JLCA 3I57A 2F0QA 2HD3A 1IKLA 2K04A 4A3EB 1BXTA 3BWUD 1WFYA 2DZKA 3BINA 3KF6B 1CA6A 2BT6A 1IGCA 2KYWA 1B53A 3AE9B 2JQRB 4P7IA 4OX9L 1EIFA 2OEDA 1EEFD 1OXTA 2O6VA 3BDOA 2EIFA 1PRTB 2R92G 4GLVB 3D3RA 3PV0A 2EDGA 3BVMA 4ZRQA 4KZ0A 5C3XA 5D94A 2MGSA 4QF4A 3L08A 5C4HA 2A4ZA 1UE6A 4RGMA 2KK8A 1RODA 5H92C 4UPAA 1JROA 1B50A 1L0VB 2FFKB 2XSCA 1MJCA 4XQNA 1B9MA 3BS1A 1WTPA 3RZOB 5M5YB 3KQ4A 4W9KA 2KOLA 5D14A 2BWES 2GMIC 4HPPA 3J7AF 3VH3B 4H02A 2AKWB 3RUZA 4I6PA 1CZPA 4NQKE 1B3AA 3PO3B 1PYBA 4ZRZA 1PRTD 3A74A 2XRSD 3D4RA 3P20A 3IG3A 3T53B 3HHMA 3SDLC 1RFAA 3HM6X 3ZNZB 2F0NA 3J81i 5I9PA 4JOIA 4WAFA 3ULLA 4DXGA 5J3BA 1Q8IA 1GUWA 3I55A 1HR0W 3A56A 1L4ZB 2FCSA 1Y1VH 4V0BA 3VYRA 1JOKA 1YNJD 3AQQA 4HCSA 3N1ZC 3EA6A 1KNEA 2VH2A 3NZSA 3W5UB 4A3EH 3A5ZB 2BKFA 2M0AA 4IKGA 4LLGM
chains in the Genus database with same CATH topology
1PRTC 2C5CA 1S4ZA 2F0EA 5CV9A 1PTOB 5C3WA 1UWXA 1RKNA 2NVYB 2M19A 3TZUA 4C3HG 1X3PA 1J7BA 5EJWA 2CHBD 3EQLC 4OZCA 4K5VA 2H88B 2VZKB 3RFZB 5ELFA 2K1BA 1PTOC 4DNRB 1I4RA 2WKCA 3TDQA 4XT1B 5ELEA 3ABVB 2YU9B 1TS4A 3IT6B 1RDPD 2WXMA 2KUMA 2A68D 2HUGA 4ZUIA 1BCPB 4BWGB 4KKTA 4CJ1B 1WSPA 1TWCB 4LMQD 2VZKD 3FILA 1RJTA 3ONAB 3QJYA 4A3FB 1PDXA 2CW0C 1N5XA 3IKJA 5G5HA 1T5XD 3SFEB 3J81E 1CZGA 4ZHOA 4R8NA 4KKIA 5D3DA 5EQ0A 3IT4B 1DOYA 1PFDA 4Y7NB 4US9A 2L32A 2CJNA 3AV8A 3SFDB 5KNCA 3E6ZX 3GO5A 2BB6A 2M9VA 2N55A 1VZ6A 5M3FB 3AE5B 1MSHA 4BA2I 4C3JB 2HCCA 1FXAA 4MIUA 1XLOA 5G3LF 3Q6SA 2F0TA 2L1BA 5BN5A 1PFNA 1HPCA 4QCLA 3SK5A 1RM6C 4ULLA 3SXHA 3JAME 1SNPA 1FCCC 1CM9A 2WACA 5C4JB 4HEDA 1G6ZA 2F0LA 1TKWB 1DOKA 4N9TA 1HUMA 2A6ED 3HG9A 1SYFA 4EE2A 4YSZB 3TEWA 3FRPB 1KRHA 5CORA 3OWEB 2D5DA 2WP9B 3OW7A 3S16B 5C2TB 4A3MB 4IALA 1XO3A 2F0VA 2LHDA 5HURA 1H9SB 1S5FD 1IGDA 4YIJA 1HHVA 2KCNA 5JVH3 1HUNA 1UGJA 4ARIA 1JWMD 3PUYA 3G7LA 2G9HD 3OIPA 1N62A 2WNMA 2AQ2B 2MPMA 1B4OA 1QNKA 5MPOA 1SMYD 1H9MA 4LTUA 3S14B 2E2DC 2D2CC 5M9OA 1S5DD 4C80A 2SDFA 3HOXB 3D4WA 4PT5A 5CV6A 3VR2A 2EELA 5LNK1 3GTGB 2V0GA 4OO1H 3QG1A 1MVKA 2XIWA 5EPJA 4A90A 3D31A 2WS3B 1Z47A 2IGDA 2NUCA 1ILPA 1EQVA 2LJIA 2ZXOA 4NDXA 3FMCA 1CHPD 2WXOA 3HOUB 2V4DA 3PUWA 1FO4A 3ZQ4A 2IX0A 2SAKA 3NBHA 4XWWA 3ND8A 2TMPA 3ZJTA 1TKEA 2NB0A 3AE7B 2K01A 4WFN3 4A6QA 1GB4A 4L63B 2CJOA 1BUVT 1ENAA 2W82A 1XYIA 1GHKA 4OZAA 2ZXRA 1PYWD 2HDEA 3H94A 1PXUA 3K5MA 1ZP0B 2RQXA 2WB1B 1JWAD 3GTJB 3LXFA 4TMAB 2A69D 1L4DB 1H9JA 3I3CA 4FXKC 2EYLA 2K9XA 3AE6B 2INNE 1A2UA 4REZA 1PLFA 2PTLA 4JK1C 1ZXHA 3TP5A 2MUYA 1YNNC 1BUIC 1KH0A 2R7ZB 3SR6A 2WP8J 1CZWA 3I73A 1EZ8A 5J1ZA 1IBXB 2E74C 2KCCA 1YMHE 2RBMA 1YNTE 1CHQD 4XYOA 1NENB 1VMPA 5I9OA 2JX5A 2Y0SB 4ILWA 1E0ZA 2H89B 1LABA 5K36G 1N63A 4RNAA 1U9RA 1ESFA 2EYOA 4IFDJ 1GUGA 3BYTB 1C4CA 3SVMA 1PFMA 2K5WA 3QO2A 1EIHA 2RDFA 4R3DA 1EWYC 1JORA 1Y8PB 1XLPA 1QCBD 3C2PA 2AWOA 2E76C 1YQ3B 1SYGA 4K5XA 3MFYA 2YYZA 4DFAA 2WXHA 1KAAA 2M00A 1EY5A 1DM0B 3A54A 5KYLA 3EGRA 3QWNA 2AUJD 4RKLA 2IGGA 2W3RA 3FPPA 4K2LA 4U68A 1JQ4A 2EYJA 3GTMB 2JA7B 2KQ3A 3NUCA 4XDDA 2B2UA 2W55A 2F3WA 1R4QB 3BVGA 1EYCA 1ACCA 2BS4B 3L3OC 1IUEA 2RPVA 2KMMA 1J7CA 4B08A 3NHHA 3QIAA 2NZ1D 3K57A 4IFDG 4GZYC 3CU7A 2A5HA 4OW0A 2E75C 1QE6A 4RFBA 1L5PA 3AEFB 4A3IB 2I07B 1FFVA 1GUOA 5C0XG 4B0EA 1EEID 4FF4A 5DEHA 2Q8TA 4XXEA 3TP6A 1D5ZC 2KVMA 4FYDA 1JQYD 5K36H 3Q8BA 2DY7A 1U4LA 1ZEQX 1SE3A 1EQTA 3NWSA 1I3QB 3E0JA 3KBGA 5I2XA 1PFBA 1KLGD 3GTKB 2EY2A 4KTAA 1FM0D 3VYTA 5FLXL 2IW3A 1U4RA 1FMAD 3P4SB 1ZE3D 1FXIA 4X3SA 1W6KA 2B2TA 4IOIE 2F03A 1MGSA 5LL6S 1STBA 5EPKA 1UEAB 3X3MA 4RF1A 1DYQA 3T56B 3RLFA 1TY0A 1V43A 1SEBD 1KDBA 5BN3A 3P4RB 1G8ZD 1ONLA 3CRLC 5I4DA 3MTSA 3J7YW 3AN1A 1Z7TA 3H3VC 1OXXK 1N61A 2PW7A 3VR6A 1U4MA 2JEBI 2M56B 5FO8B 2D9UA 2LS01 4RF0A 2BTEA 3W9CB 1OFFA 4PQXA 2L83A 3V05A 1C48A 2RSNA 4KGRA 5ELBA 3S1QB 2WXFA 2JXTA 3W3AA 5F2DA 2K32A 2QKIC 4FXDA 3IXSA 1ZYRD 4YTMB 3MHZA 1FRRA 2R6GA 4A3BB 2O2LD 5G5GA 5IT9L 2J7ZA 1MI0A 1D1KA 4NAMA 2QCPX 3FPUB 4A3JB 3TUOA 2BS3B 1OXSC 2B2TC 2BE5C 3OWFA 2NN6G 3VR8B 3S1MB 5HG2A 4EQPA 1QOHA 3M3YB 1V8CA 1MHHE 1EWHA 2PVGC 1RD9D 2Q5WD 5C4XB 5EE1A 2O5IC 1UNSA 4XYQA 5CR3A 4JPSA 4N6EB 1FFUA 5BYSA 4NKLA 2C9OA 5CC4A 1LV9A 1I4QA 2JZPA 4HROA 5ISRA 1YJIA 1R4PB 4RCNA 2MJ3A 1SDFA 2MHVA 4ME5A 2E2HB 1T3QA 3E9SA 1EL0A 3BZDB 2JA8B 3DWAA 5JEAJ 3DXJC 1F2MA 2PZWA 1VR9A 1F9QA 1GB1A 1JALA 1ZYRC 3R3OA 4JX1C 4N59A 1TJEA 1F2YA 4KHVA 5D3IB 5IODA 3C1EA 4YXDB 1DOIA 2DWQA 4H0LC 5IGDA 1G91A 2LFNA 2IPKD 1IKMA 2PYKA 2G1EA 1QJOA 5E3FA 4LK0M 4XQJA 2PIAA 2R61A 3GD7A 1LACA 4PNYA 2DYMA 1LT3D 2LMCA 4ZOHC 3A7LA 4YWGG 4US8A 1AEXA 3Q8AA 3Q0AA 4MT5A 4K6LA 4J3OD 2WU2B 4OIJA 3P4QB 5IGGA 3IFDA 4WRDA 1TKGA 4XIGS 1B9RA 2DLBA 1D5MC 3SE0A 3KWLA 3B2GA 1WYGA 2N88A 3CHBD 1WTQA 2IWHA 3DEOA 1WWTA 4H13C 4WURA 2XN9C 2F0UA 5M5WB 1V8QA 1N60A 1S5CD 2B2UC 4C3IG 1SIJA 2R3ZA 1PTOD 2TSSA 2L4NA 1AN8A 4TSSA 1IL8A 1II3A 2HQEA 3GTOB 2LGIA 3BIID 3ZGZA 3OIQA 3M7GA 3MFGA 1STAA 2EY5A 4IUNA 1A70A 2M2LA 3HUIA 3T13A 4CBVA 3HVZA 5HI1A 3DWPA 4HTHA 2XNAC 1U4PA 2HDMA 4KV6A 1NEKB 1QOAA 1FCLA 3S1RB 4LJZC 3U9OA 1NAPA 2Y5CA 1PDQA 2BW2A 3WOEA 3BYYB 1HXYD 4OIKA 4DK1A 1E7PB 2JA6B 1XCQL 3AEEB 5CMDA 2OF1A 2W3SA 4H2AA 4XWTA 3GTQB 4L2YA 2F4IA 1H9SA 2Q8IB 3K6OA 2L11A 1EM7A 3PUZA 2HDLA 4F8MA 3AM9A 1SNDA 2K3UA 3CKIB 5BMGA 3ZYYX 1TWGB 3DWGC 4KKSA 4KD4A 1XCTL 1K53A 3NSWA 2WIIB 4C56C 1K8MA 4C1NI 1HQRD 1E0BA 3VR9B 1V1PB 4DAPA 1MI2A 5I2YA 2EXZA 3VYSA 1AP0A 4EQOA 3NWTA 2DNEA 2D62A 1Q12A 2B8FA 1YN5A 5CV8A 4DA2A 1YJJA 3AEBB 1KNAA 1SJED 1STYA 4C7YA 4Q0FA 2JWUA 3CRKC 2NVQB 3FAHA 2L12A 3NTHA 3DUZA 1IBXA 2A69C 1R7SA 3NVWA 1STEA 4A9AA 2EE1A 1FGBD 5HHDG 1WD0A 4ODGA 2K6AA 4XDXA 1C8CA 4DGZA 3GTPB 1I50B 2EYPA 2JA5B 2B8GA 3M4YA 3AU7A 2WXJA 1YN3A 5KEEA 5CV4A 1YN4A 4P2CB 3FC4A 2OHFA 3I70A 4B0MA 4G7ZC 1V97A 1DOXA 4DAVA 1OXUA 3U7ZA 2K03A 1SYEA 1WCMB 3MHBA 4N9PA 5C3JB 1VMCA 3EVQA 5EE3A 4OHJA 1TY2A 1LTAD 3URYA 4KKUA 5K5PA 3R8BA 2QF7A 1LTSD 1DZ1A 3GS2A 4AYBB 4AQ7A 2OT2A 1Y1WB 1YNND 1JC7A 3SK6A 2F0SA 3LWUA 1SNQA 4AS1A 3A8JE 2GRIA 1JOOA 4K5WA 3VR3A 4ZUJA 2VB2X 3ZJUA 2N9LA 1FNVA 3N52A 3W1SA 4B9WA 1GPXA 3ERQA 2BYTA 2PO4A 1F9RA 2B76B 2L52A 2B63B 1VZ8A 4RHSA 2Z8LA 1T6BX 5G3LD 1WTVA 4KN4C 3K59A 1NYRA 4G57A 1SFOB 3C46A 3MXPA 2F0HA 2X6LA 3NE5B 1ENCA 1ROEA 2Y5PA 2OEOA 1WXQA 4OL7A 3WOFA 4V190 1C9FA 1D4BA 1S5ED 2DBYA 3I90A 4EGVA 1JR0D 5DAUA 3A8KE 4RGTA 2WXPA 1Q1EA 1BMLC 1WD1A 3BDCA 2QMTA 1KF6B 2CVRA 2F0FA 1Y56A 4L23A 2ONQA 4ZLTF 2N7JA 1B9NA 3CWIA 2EOTA 3EROA 1G2TA 1ENFA 2JSVX 4NMZA 2W54A 2WXGA 1PZJD 1GUSA 3N6RA 1MBYA 1Q1BA 4DQOC 4NZLB 2KEEA 2J4XA 1EY0A 1O80A 5EKLA 3HOVB 2WDVB 1C76A 2BS2B 2WV6D 4O1NA 1J8IA 1EIGA 1HTLD 2EPBA 1L6UA 3AMZA 1TT2A 5JOBA 1SSOA 3TP8A 1K50A 3TP7A 1KFYB 2V4IB 3OMGA 3AE2B 4A55A 4XQQA 3TEXA 1B1ZA 3J80L 3AB5A 5CBAE 1AFPA 3LYYA 3MVVA 3M7NA 1JW9D 3R2TA 1WVLA 1H9RA 4X3TA 4OZBA 4KN7C 4K14A 4RA8A 1E2WA 5E6JA 1ZDVA 2WINB 2CU3A 2QJLA 1YNJC 5BYRA 2LMCB 1LTTD 1RWSA 1A15A 1F2LA 5H8YE 3TMEA 3I9V1 1EFID 3I8ZA 3TSSA 1EOTA 1F9PA 2NBFA 2VB3X 1WTOA 5EKIA 2K0PA 1HA5A 4FO2A 4CKBA 5C3EB 3BK2A 3P7JA 1RFKA 2ZW1A 2ENBA 3EUB2 3V3XA 1TWAB 4B9XA 2DNCA 2BE5D 3Q8EA 4H7BA 4HEA1 1EY7A 3J9CA 4IURA 2F0PA 3MZ5A 1PZID 3VRAB 4FVMA 1CT1D 1LT5D 2B2VA 4J8QA 3S1NB 4L8JA 3EJIA 2NVXB 4QMGA 1WRIA 4TQUS 4CKEA 5KNBA 4NW2A 1IYUA 4DXFA 1HQMC 4ZAIA 3GP7A 5LL6X 3D6CA 2LY7A 3MAQA 1EU3A 1CQVA 3OPOA 3E5SA 2JYEA 1PUTA 3PIO3 1CI3M 1CJEA 3T3OA 5JAVA 3UI3A 3VRBB 3SK4A 4G7OC 2JP1A 2NYZD 2PW9A 4R8IA 4PMCA 2QSDA 2JE6I 2AUKA 1FR3A 2A68C 3VR5A 2E2IB 1A2TA 2F1MA 4CJ2C 3GB1A 2ZT9C 1DD2A 4KHZA 4RGNA 3I4NB 2F0OA 1JB3A 3B9JA 4RH6A 2X69A 3IFTA 2CW0D 2GA4B 3PUVA 4ZKCB 5BMIA 1LTBD 1MSGA 2K22A 4TRDA 2FMMA 1HZ6A 4DU9A 1OQQA 1R9TB 3CIRB 3HOZB 5GXGB 1FD6A 2WDQB 3PO0A 4OVZA 3FILB 1VJKA 2FINB 2KACA 4GLSC 1MD2D 1AYFA 4L1BA 2V3NA 1HEZE 3NVYA 1BBXC 4MACA 1CA5A 3A55A 2E3TA 1OQRA 4PMWA 3NVZA 2NTSA 3U9SA 1RTNA 4I65A 5JEAH 3MEHA 3IAS1 2FMCA 1A3TA 3Q23A 1FD7D 1L0YB 1LT4D 3CQZB 3HGBA 1EY9A 1NI3A 1EY8A 3JAML 2A73B 1IHZA 1ICWA 2BBCA 5A2QL 2EY6A 5DM63 2B2YA 4EVOA 2N9KA 3L7ZC 4H44C 3NPPA 1FNWA 3T16A 3IL8A 1EY6A 4TQ0A 3HZXA 4KGTA 2JEAI 1I4GA 1Y8OB 1WTWA 2AQ3B 4M1UB 2RVLA 3AMUA 1QWYA 2PLPA 4NAWB 1LLRD 3BDLA 3S2HB 4HSPA 1C78A 1O7YA 4WH4A 1WTRA 2KA7A 1F77A 2RSOA 3AECB 3H91A 3G6JB 5CV5A 4CKCA 4HJGE 2WXIA 3GV3A 1CFMA 1IW7D 2FJ2A 3DM1A 3WCQA 1DONA 1Q10A 1STHA 1K51A 2F3VA 4NJCA 2LKVA 4WJWA 1GOZA 1ML0D 5T1GA 4ITKA 1D2BA 1Q3LA 1DOLA 3H09A 3V96A 3M85A 2FBWB 1DOMA 1DCZA 5JPMC 1HRJA 2PVOD 1XEEA 3BG3A 1OXVA 4HMIA 1SNCA 1NYQA 3LB8C 2BOSA 3MC0B 3F2UA 1ZUD2 4QUCA 3S15B 4BY7B 1V1PA 4P16A 2Q8RE 5CBEE 1FRDA 4DK0A 3PO2B 5T1IA 3TEYA 4QUFA 3MJ5A 1AWDA 1XXGA 2ID0A 3I4LA 1AZPA 3NZ3A 2NMQA 1F9SA 3KLSX 5NUCA 1IW7C 4IQZA 4KGSA 2EJMA 2XVSA 5FO9B 2A6HC 3KLRA 4HCEA 1E2VA 2PNRC 1GJXA 1M4VA 2D5GA 2PQEA 4KJOA 3SDZA 2E2JB 1O7LA 1I6VC 2E6XA 3OSOA 4JE3B 4DF7A 2NN6H 1SNOA 3HKZB 2NTTA 4K2KA 5IT9E 1ZXIA 4MM3B 4OO1I 4YTPB 1I4XA 5EGTA 1EZ6A 2X38A 5CV7A 2AWNA 3KUPA 4BY1B 4JBWA 4C2MB 3T4AC 2VXWA 4DNTB 3MP9A 1W6JA 1D5XC 1ZXTA 2XWBB 1LT6D 3W2DA 4IDIA 1BQQT 2L5TA 3OMCA 1EY4A 4KY7A 4TKOB 3NVVA 2NN6I 1DXMA 1HZ5A 4F88A 2JYTA 4E6IA 3Q8FA 1I7HA 3NP8A 1E10A 2MJDA 3A8IE 4A3DB 2K5DA 3PMFA 2ZW0A 1MHXA 3NRZA 4HMJA 5AUIA 2AQ1B 4WIPA 2OXPA 5C4ZA 1PGAA 2BA0A 3MWYW 4KK7A 2R92B 2GI9A 3X3NA 2WAQB 4C3HB 4UAIA 4ABNA 2ZXPA 1FYCA 5D65A 2CQAA 2Z4HA 5KGUA 4Q2JA 3DHQA 1STGA 2JSOA 5JPNC 1PRTF 1C4QA 1ET9A 5FLXE 2GB1A 2RDHA 1F2ZA 2G9DA 4I7ZC 1GUNA 1NCVA 5C0XH 4IN3A 4BA1I 1BR9A 2L9HA 1SYBA 2PZUA 4HKZE 1CTMA 1C4PA 2J52A 5AUKA 1TYGB 5EPLA 3DWMA 3I72A 2PMVA 3BVZA 1B2TA 1SAPA 4S3SA 4ZK9B 2JXMB 2Z4IA 4KI0A 4RWSC 2PMZB 1PGBA 2Y3AA 1ZPSA 3NK9A 5JEAG 1TS3A 2F0WA 3FVQA 4N58A 4HR7B 2EYHA 5LHY1 1F2RI 2N0SB 3C1FA 2AX5A 2QEJC 4IZ8A 3L9AX 3OHXC 2B39A 3HRZC 3ETRA 5C0XI 5CGKA 1Y8NB 4C1NK 4KMUC 4FF1A 2MP1A 4MHEA 1Z6HA 5HFYA 4IFDI 2EYMA 5IGFA 2K05A 2WKDA 4IUTA 3PUXA 5ELDA 1QF6A 3HP3A 4RGOS 2VNUD 2PW5A 2KJXA 1EU4A 2WXRA 2X6GA 4C3IB 1GXDC 1WTXA 1TWFB 4ARCA 5C5MA 3D8GA 5KIXA 1PGXA 3KWVA 1KLUD 4J6HA 1DGJA 4J1MA 1JICA 2YEPF 1A6XA 2DY8A 2I38A 4DN4M 1OO9B 4D2KA 5C5LA 5EBCA 2WU5B 5IOCA 4HSVA 3U2SC 3P1HA 1QLBB 4QB4A 1MPEA 3AH7A 3H6MA 2BB5A 2B2WA 3AE3B 1TIID 4XTCS 5FOBB 2F0MA 3K5LA 1UWMA 3HRDD 5FR3A 4G4KA 1BO0A 5DNFA 1ZDXA 3MA2B 3PZ8A 4R9WA 1V1OA 3AEAB 1HTPA 1JWUD 5DM73 2V3PA 3W5VB 3ZJVA 4BS9A 1SBBB 2L55A 5AFWA 1LTRD 5IGBA 3Q8CA 1ZOYB 1XLNA 5EKKA 2I46A 2KQ4X 3GQBA 3L4PA 4KJNA 4OO1G 3S9WA 1JE4A 5E4XA 2FUG1 2SNSA 1JWBD 2KWDA 2HTME 1XF5L 4ID6A 2K7VA 1GAQB 3BK1A 3OOCA 2JU6X 1KDAA 1XX8A 3AE1B 3PZ7A 1RCVD 1IYVA 3AEGB 3S2DB 3SK8A 2WXKA 1TS2A 1K83B 4K6DA 5BN4A 4FF2A 3FEWX 2IL8A 3KF8A 3DMUA 3PIP3 1TZOA 2RMMA 2WXNA 3DWQA 2YEPB 1ZKOA 1N5WA 1I4HA 1GHJA 3FKIB 2LEKA 1KABA 3NTIA 1SE2A 4ZKBB 3P42A 5TSSA 4YSXB 2QIEB 3LWEA 4CQNA 5EE0A 2BDNA 4IUUA 3NS1A 5FKAC 1G2SA 1AZQA 3MXGA 4CGYB 4KD3A 5C6AA 4A93B 1JMLA 2J53A 5A2QE 1SNMA 2RDGA 1EYDA 2INPE 4ZYSA 5C0XJ 3QB3A 4MN3A 1A3VA 2A6EC 2QILA 4NP5A 4YTNB 3K7AB 1QOFA 2BDOA 3S17B 4YT0B 4IFDH 1EYAA 3SR1A 1NUCA 2Z1CA 3TBIB 1SB3C 1ESRA 4KX6B 1L0XB 1PZKD 2EJGC 2KDMA 1TU2B 3DEPA 3NTKA 4BBRB 1GUTA 2IJ0A 2B2VC 4A3KB 2SNMA 4FF3A 3KK7A 5HGTA 2O5JC 1HCZA 2XWJB 5J39A 1RF2D 2FE8A 1RTOA 1H9KA 5T8IA 2F0IA 1YQ4B 2WQYB 5FO7B 3UI2A 1TR5A 5JVG3 1VDZA 2BCOA 4UDUC 3I4MB 1SSNA 2XRQD 2MEKA 3KLSA 3RZDB 1T5EA 3HVDA 3Q22A 4IUQA 2ICIA 1VF5C 2IX1A 3IAYA 3RD4A 4K8JA 2F0GA 5I6WA 3GTLB 1SXTA 5CYUA 3H0GB 4FP5D 1BOSA 1HFGA 4RHRA 4YSYB 3B2FA 4IUVA 4ZHPA 2SEBD 2EZVA 1CQFA 1FIQA 3ITPA 5IGCA 3WDNA 5JJZA 3VA7A 4LAAA 1QKZA 5E4WC 1P7FA 1TQOA 2BA1A 2O4XA 4XE0A 1XTCD 2IDYA 3M4OB 3TN2A 3R2IA 4HAEA 1L6VA 1SF0A 3RPFC 1C4AA 3KBXA 1I6HB 2JYOA 1QT9A 4HN7A 2MJEA 4GDKB 4QIWB 2PCFB 5I6YA 1WGKA 3VR4A 3AE4B 1QB5D 3QOJA 2F0KA 1A3UA 2ICEC 2HCIA 4XT3B 5KRUA 2PPBC 3VQIA 1SMYC 1XWEA 1LTGD 5C44B 3P63A 3T3NA 3D4DA 1ET6A 4WQMA 3SHLA 4TQ1A 4RCOA 3VA5A 2LUMA 1VCIA 2NWGA 2KN4A 1QQRA 2K33A 1ILQA 1PTOF 4F7XA 4PMBA 3VYUA 2A6HD 2IGHA 1BDOA 2L0CA 3Q24A 1NR4A 1E9MA 3LNNA 1KTKA 4HRSA 1HA6A 3HOWB 3K0YA 4G7HC 5J22A 4O42A 2J0TD 3O13A 1JRPA 4DAYA 1TS5A 2A74C 1Q90A 2K5PA 2KAJA 4F87A 2I2YA 5A35A 1QG7A 3MXNA 1BNZA 2EKIA 3A7AB 3J80E 3H8HA 1HFNA 4CHTB 3NBIA 5M3MB 1Y1VB 2B2YC 1BF4A 2H1EA 5IIFA 1K8OA 1QOGA 1QOBA 1STNA 2WXQA 2RKSA 1X32A 2VUMB 1PTOH 4Q5VA 1BCPD 1NR2A 3N9YC 1O7ZA 1Y69U 4RAUC 4FXCA 1RHPA 2EVBA 1E6EB 4RKBA 4BBSB 3MXUA 4OGQC 4JWUC 2F0JA 4ZQ3A 1JWSD 2NVTB 4X3UA 1UAPA 4L6TB 4MH8A 5M5XB 5EBDA 4GDLB 2ON8A 1D6EC 2R93B 1B44D 3T51B 4EQNA 4HKQA 1TKYA 4XDCA 3C8YA 3SEBA 2K28A 1K52A 3NQIA 1QNUA 1VZ7A 2MJ8A 1O78A 2LFIA 1SYDA 3P4PB 4M8AA 1JOQA 3NUHB 4KY6A 1I4PA 1RYJA 3K5NA 1FNUA 5JXVA 2SOBA 2WDRB 1BCPF 4C3JG 1LO5D 3NQTA 1EWCA 4X3KA 3RMHA 1P7EA 2KEDA 1AW7A 1NVID 2FHTA 3V2TA 2RA4A 1BCPC 4U673 1DJRD 3U4EG 1PMRA 1G291 1E2ZA 3AEDB 3AB9A 3U52E 2L1AA 3K58A 5EE9A 2MH7A 3FDTA 3J81L 4FXGC 2PZTA 3LX0A 3K5OA 3P75A 5COYA 1SE4A 2DYOA 4A8XC 4K8IA 2LHEA 2KHSA 5BYQA 5BMHA 3E56A 3ND9A 4LK1C 3TZDA 3AE8B 5KYIA 3P1MA 3HOYB 2IX3A 1QILA 3NXWA 3R93A 3GV6A 1VF7A 3D6WA 1J7AA 4ZRPA 2WLBA 1F2RC 1VDVA 1TWHB 1LTID 2EY1A 4CJ0B 4P6VF 1FEHA 2DN8A 2EYFA 1JCKB 3TEZA 4USAA 2KECA 1VRAB 1C79A 1XLQA 2H4OA 2J42A 5FK9C 3HEJA 5E1FA 4A3GB 3IAM1 4KKJA 5D7GA 4KY5A 1KDCA 1UUPA 1M8AA 4FNFA 4C7ZA 3J7AV 1NSNS 3EFXD 1C77A 2ACZB 2IT1A 2WXLA 4M0WA 3Q69A 2PKOA 2EJFC 2K5QA 4PV1C 5KNDA 4Z9CB 2QDBA 2B2WC 4WWMA 3I91A 1D1IA 2F0DA 3QOLA 1F0ZA 3C3LA 5ELCA 1CK1A 4JWSC 1TVXA 3HS0C 1J9OA 1X3QA 1SYCA 1S5BD 4WORA 5IGEA 1SJHD 1VLBA 4IUPA 3I57A 2F0QA 3BWUD