2AQ3B

Crystal structure of t-cell receptor v beta domain variant complexed with superantigen sec3
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
234
structure length
234
Chain Sequence
SQPDPMPDDLHKSSEFTGTMGNMKYLYDDHYVSATKVKSVDKFLAHDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKDGKVTGGKTCMYGGITKHEGNHFDNGNLQNVLVRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords T-cell receptor beta chain V
publication title Structural basis of affinity maturation and intramolecular cooperativity in a protein-protein interaction.
pubmed doi rcsb
source organism Mus musculus
total genus 64
structure length 234
sequence length 234
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2005-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
B PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2aq3B02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2aq3B01
1PZID 2XNAC 1ET6A 5ELEA 1YN4A 1B1ZA 1KTKA 3DWAA 1EU4A 1PRTD 1SXTA 4K6LA 1SJHD 5ELBA 3V05A 1I4PA 1HQRD 1UUPA 1EU3A 1S5CD 1RDPD 1TS2A 5ELCA 4L63B 1AN8A 1LTRD 1PYWD 1PTOH 1HTLD 1CT1D 1S5FD 1SE3A 3BVGA 3EFXD 3KLSX 4O1NA 4RGTA 3EA6A 1TS3A 1EWCA 2Z8LA 3URYA 1JWUD 2IJ0A 1LTID 1I4QA 4BWGB 4TSSA 4Z9CB 1L0XB 1DYQA 2CHBD 1LT5D 3O13A 3TSSA 1YN5A 3DWQA 1XTCD 1PRTF 3SEBA 4ZYSA 1AW7A 2AQ2B 1PRTC 1PZKD 1TS5A 3DWPA 1DJRD 1ENFA 1EEFD 3MC0B 1LTSD 1RF2D 3MFGA 4UDUC 1JWMD 4DXGA 1CK1A 1LLRD 1FNUA 1SE4A 2AQ1B 2ICIA 1JQYD 5FKAC 2RDGA 4RHSA 2NTSA 3BYYB 5D3IB 1ESFA 2AQ3B 4RHRA 1CQVA 4OHJA 1RCVD 2J4XA 1RD9D 2SEBD 5FK9C 1I4HA 4RGNA 1HA5A 5ELDA 1CHQD 4RCOA 1JCKB 4DXFA 3BYTB 3BVMA 2TSSA 2XRQD 1T5XD 2RDHA 4RGOS 5ELFA 1D6EC 1UNSA 1TY0A 4RGMA 1LT4D 1LTAD 3R8BA 3GP7A 5D3DA 1TY2A 5I4DA 2WV6D 1L0YB 1FNVA 1SJED 1KLGD 2XRSD 1D5XC 2O2LD 1G8ZD 2NTTA 1PTOB 1TS4A 1BCPB 1CHPD 1PTOF 1BCPF 1D5MC 1SE2A 4RH6A 1PTOC 1BCPC 1LTTD 3R2TA 1FNWA 1V1PA 2QILA 1B44D 2G9HD 1PTOD 1BCPD 1HXYD 1KLUD 2IPKD 3BZDB 3W2DA 1LTGD 1EEID 1V1PB 1S5BD 1PZJD 4NZLB 1MD2D 3CHBD 1JR0D 1STEA 3BVZA 1M4VA 1S5ED 1I4RA 1XXGA 1SEBD 2R61A 1EFID 1LT6D 1D5ZC 1I4GA 1QILA 1FGBD 1ET9A 1V1OA 4C56C 1F77A 1PRTB 3OWEB 1BXTA 1LO5D 1S5DD 4L6TB 1LT3D 4RFBA 2XN9C 3R2IA 2QEJC 1GOZA 1SBBB 5TSSA 1LTBD 1JWSD 1FD7D 1YN3A 1I4XA
chains in the Genus database with same CATH superfamily
3SK5A 1FRRA 4JI4L 2R7DA 3S1NB 3UDFA 2MQJA 3ENEA 2E75C 1O78A 4R4OA 4II3B 1EQVA 1WCMG 4XYOA 3I4NB 1IPGA 4EE2A 3NWSA 3W1SC 1E10A 3Q3JA 4CYEA 1LABA 1HTLD 1CT1D 3AYHB 3KLSA 1H9MA 2NBWB 1VCIA 4Q0FA 1MSHA 4LF9L 4LDTD 2IJ0A 1SAPA 1P0RA 2ZEQA 3H0GB 1HRJA 3HM6X 5C23A 1N63A 4POGA 1HZ9A 3DM1A 5C4JB 4KMUC 3GE8C 2JWUA 3K9OB 5KYIA 1WYGA 2RDBC 5LXHA 3HGBA 1SYEA 1F9JA 2M0XA 3MZ5A 1UWMA 4B3MQ 2I5LX 1J7BA 2ZPYA 4X6AH 4XWWA 1XWEA 2WLBA 3SR6A 3LDZE 2MFIA 4WORA 4NMZA 4JYAL 4ZDVA 2MBQA 1GO3E 1VQ5A 4RHSA 3CC4A 2NTSA 3BYYB 2WU5B 3VA7A 5C44G 1P7EA 4N58A 1VDZA 4OX9Q 4RWSC 1TWAB 1W6JA 2D07B 3SFDB 4O0AA 1X65A 2BW2A 5ELDA 4MNOA 1DGSA 2I38A 4DK1A 4JOIC 3CCJA 2ZTEA 1YJWA 2ZXRA 4AJYB 1ZUD2 4WJWA 2RDHA 1X9NA 3AEGB 2R7ZG 1A3VA 1VQ9A 4OELB 1D6EC 3HOWH 1D2BA 2QA4A 2JZZA 3S14B 2LEKA 2M8SA 2KN4A 1LTAD 1Z6HA 2LHDA 3H7PB 2UWQA 5D3DA 5DAUA 1VLBA 4JG2A 3RLNA 5IOIA 1A3UA 1PDQA 5CV8A 4EZLA 1TZOA 1A0IA 2C5LC 2D3BA 2RA4A 1OEYJ 4UPAA 1C4AA 2NCNA 2GN5A 1C9OA 3F2UA 2WXKA 2NYZD 1G8ZD 4BBSB 2V1YA 4DV7Q 3T8MA 5AZGA 4YTMB 2NB0A 2M17A 2RD0A 5H92C 4LF9Q 1E9MA 3GOEA 3CAMA 4A93B 2BA1A 2RCFA 1V43A 4KD4A 4ACFA 5C0XH 3VR5A 4LF4Q 3M4QA 3PGZA 1QOAA 1O80A 1K53A 1HNXL 1Q90A 2NVXB 2I1JA 2KN5A 4C7YA 3MWYW 3DQVA 5J39A 3I5JC 2D62A 4IZ8A 2YTVA 1KLUD 5E1FA 1MG4A 4REZA 3W2DA 2N0SB 3H3VH 4RMAA 1W6KA 1WTWA 4RF0A 2N1VA 4AYBB 4C3IB 3LYYA 1VD2A 3RN5A 4JYAQ 5AUIA 4NAMA 1QOFA 1WYDA 4LMQD 1I4RA 2SNMA 1AARA 1XXGA 2F3WA 1VQHA 1R4QB 3J80i 1LT6D 4GOPA 1R9TB 1C7YA 4A3GG 2KDIA 2KTFA 1GUAB 2XEWA 1QOHA 1PDXA 4WJPA 3ZKJC 4KKIA 2GI9A 3V6CB 3HG9A 2DYBA 2EPBA 3RLOA 1B9MA 3S2DB 2I07B 4RFBA 3I3TB 5CBEE 2M56B 4HJ9A 1A5RA 1CZPA 1X32A 1BQQT 2PE9A 4K1RB 2FCSA 3UINB 3PO0A 4C3JH 4JI7L 3OJ3A 2L32A 5ELBA 1S72A 1UWXA 1WXAA 3TEYA 2HHHQ 3L0OA 3IRBA 1PVOA 1VQ6A 2EXZA 1PFBA 3EFXD 3R7RA 1GUOA 3Q0AA 1XCTL 2JYOA 2LVPA 3S17H 5M5XH 3FHWA 2CHBD 4NDXA 2K05A 2ZXOA 4LFCL 2VUMG 2B8GA 3OW7A 4PG3A 5C3JB 4PZ8A 3E6ZX 3SEBA 4O42A 3TL5A 4IWOA 2YEPF 2LGIA 1J6QA 1C48A 1MPEA 3S1MH 4KDIC 1EEFD 4JPBW 3MXNA 1SGHA 4A3IH 1BKBA 2PZTA 4HCEA 2O6VB 2PMZB 2Z1CA 1AH9A 3MC8A 4DV0Q 2L00B 2F52A 4MJSB 2K33A 4IUMB 2L7RA 1FCLA 4IFDI 2G1EA 2F0KA 1W2BA 2X6LA 1PFNA 3PO2H 3S1RB 4HJGE 3CMMB 5A35A 1L2FA 1T5EA 2RHQB 2HIVA 4HN7A 1EWYC 3W3AA 1KM7A 2R92H 1WIAA 4DK5A 1CI3M 2G3QB 1ZKHA 1FIQA 4DXFA 2WYQA 1D4BA 1EIHA 1FRDA 2D5GA 4WQOB 4NXNL 2K6AA 2M9VA 2JXTA 1V80A 3G71A 3HZXA 3TEHB 5CV4A 2EY2A 2Z6KC 4JI2Q 4A3FB 2IGHA 4A90A 4CO7A 1OXXK 4G7HC 2C9OA 4PYUA 1SYFA 4ZHPA 4N9F4 2UUBL 3VYRA 3R8BA 2NS5A 2K0PA 1FXTB 1WJ4A 4JE3B 4J1MA 4JI7Q 4NB3A 2LGYA 2JSVX 2JU6X 4K7SA 1N36L 3H09A 4IUTA 1LACA 2XWJB 4IDIA 4NXML 4UHVA 2ZVNA 1FXIA 2IX0A 1TT5B 2O2LD 3MAQA 2EKEC 1AE2A 3A1QA 2UUCQ 4OO1G 1XO3A 2A73B 4QL5A 1VDVA 4RH6A 3A8KE 4DR4L 2KQ7A 2K1BA 2KNBA 3TMEA 3R2TA 3D4WA 1N32L 1B3AA 1EY7A 3AXCA 4EQ5A 4IKGA 4KV2A 3S1NH 3Q6BA 4C7ZA 2M00A 3BIID 3NTIA 3QAQA 2IBIB 2VH2A 1AEXA 1H9SB 2D0PA 1R4NB 1FPYA 4XT1B 3T4AC 3CCMA 2Y5CA 2K25A 1HNZL 1K51A 3DCGA 3HRDD 1WXSA 2DENB 3WOEA 3BJUA 4POFA 1OXUA 5KRUA 3K7UC 2BKRB 3KUDB 2SDFA 4BY1G 1ET9A 3ND9A 1VQPA 2BWES 2WDTB 1QWYA 2JRHA 1WE6A 1F77A 2MQHA 2PNRC 4S17A 4HEA1 2R6GA 3T13A 4W9DA 2L5TA 2L3ZA 1CM9A 4LNKA 2EJGC 2VNUD 3MEFA 3WAOA 5JAVA 3PS6A 1KABA 1SBBB 4AWJA 3H9DA 3RZWC 1D1IA 2W3SA 1EQRA 4A3MB 3N9YC 4KN4C 4GKKL 3NVWA 1C4QA 1EU4A 1PRTD 4N9PA 5IT9E 2MBEA 1C78A 1BT0A 4A75A 2BYFA 5LNK1 1XMOL 2CFMA 2KD0A 1S5CD 2BDOA 3F1ZA 3WA0A 2QDLA 3BVGA 1XLPA 4URKA 1ML0D 4IURA 2BQQA 1UELA 1M90C 3F2DA 1NYRA 2Q2IA 1B9NA 5FLXL 2LXKA 3B6YA 1EIYB 2WIIB 3AM9A 3E9HA 1JWBD 2DLBA 5JOBA 2L1AA 1CKNA 1YHAA 3D6CA 2FCQA 1VQEA 1XTCD 3M3YH 1SF0A 4FHKA 3KF6B 3ER0A 1YJJA 1ILQA 3C0RB 1XF5L 3P4RB 3S14H 2IL8A 2FCMA 1TS5A 2ACZB 1DOIA 4ANUA 1E5WA 2V0GA 1N32Q 5GQOA 3D0FA 2FAZA 3I73A 2L05A 2WXJA 2JEAI 4DAVA 2DUDA 1H9JA 3PIOA 3PUXA 1GPXA 1FYCA 4KZCA 1CK1A 2DYOA 4B95A 4DU9A 4MN3A 5E6NA 1CKMA 3FKIB 4P72A 1LFDA 4A20A 1BUIC 2VXWA 2R2QA 1HNWL 1YX5B 2Q2UA 2WXHA 2BPSA 2MJ8A 3PO3B 1E7UA 5DPSA 1HNZQ 1KDCA 4MTKA 2QC8A 3DHHC 4DQOC 5CYUA 4I65A 1JORA 1VJKA 2L55A 1RYJA 2BA0A 3L16A 2KX0A 3TCAA 4AP4C 4CQNA 2MUYA 5C4ZA 3I8ZA 2X38A 4NW2A 3NQIA 3J7AV 4PZ6A 1EY5A 1UBQA 5IYCH 5KNDA 4TQUS 1O7ZA 2OXPA 5M3FB 5IGEA 1A3TA 3DLLA 4XDDA 4IOIE 4HR7B 3E3XA 3AE6B 1SNOA 3KYDD 3Q69A 3T1YL 4F7XA 3ZYYX 2X6GA 2ZT9C 1IBLQ 1FJGL 1TY2A 3PF5A 5JVG3 3KBXA 1H9RA 1M1KC 4ASWC 3PIPA 3E0JA 1R9TH 3JAML 4LFBQ 4JI6L 1KFYB 4EQNA 5C0XI 1TWCB 3G4SA 4DR1Q 3DBRI 3U8ZA 2KECA 1Q5WB 5EKIA 2A68C 1SR3A 5F2DA 5IWAL 4LNQA 1OFFA 1HUMA 2WINB 2WX1A 3QJYA 3SDLC 3FVQA 1HR0W 1JC7A 2BCOA 3P7JA 1L1OB 1Y1VB 2BDNA 4B3TL 3J7YW 3H3VI 1Y56A 4BKSD 5JEAJ 2XIWA 1EM7A 2FUHB 1GHKA 1U5KA 5C4HA 3KJPA 4A6QA 4EGVA 4A93G 4IUPA 3P42A 2CH4A 2PNHA 1Y1WB 4IUVA 3MFYA 2OT2A 4NJ6A 4M0WB 1LQBA 2YV5A 1CA5A 4HJ8A 1JR0D 1I94L 1QUQA 3HOVG 2QSDA 3LWUA 2VB2X 3A0JA 2I5MX 3ITPA 4J8QA 2NVQB 3OWFA 4KKSA 3HEJA 1GB4A 4B9KA 1HNWQ 4C2MH 5M5WB 2NBUA 1V1OA 4A3DH 3H7SA 4EFOA 2F0WA 3ZTCA 1Q3LA 1HUNA 3W1YA 2GRIA 4KY5A 3SK4A 4W9JA 4MSMB 3RUZA 1NDDA 4IPDA 3AQQA 4WJNA 1QVFA 2FCNA 4IUQA 4FXDA 1GOZA 1STHA 2B63H 4BBNF 3C1EA 4GN1A 1YNJC 2F0PA 3IT4B 1YN3A 1E3PA 4JI5L 3I4MB 2JXMB 1GJXA 1DGJA 1K8RB 4OGQC 4GDLA 3VDZA 4YSXB 5TR5A 3DVGY 4JGHB 1G2SA 1PTOH 2N1WA 4DNRB 2KK8A 3T1YQ 4R3DA 4X66L 3PRMB 1F9PA 1IKMA 4IFDJ 2EQSA 3KW5B 3QHTA 1IW7D 4O2DA 2WP9B 4K8IA 2KA7A 4ZUJA 3TP6A 5GMVA 2CU3A 3QK0A 5LMUL 3KUPA 2K5WA 1B4OA 4IM0A 1PRTF 3PIO3 3HOXB 3RNAC 4ZRZA 4A3FH 1WTXA 3Q14C 2AQ2B 4M1UB 2UXCL 3ZRFA 1GUGA 3KVFB 2K8HA 2LKVA 3HS0C 1RF2D 1XJVA 2V3NA 3HOZG 1H8CA 2LZ6A 3EIVA 1LLRD 1FVIA 1F2RI 1HZAA 2JA5B 4M00A 2IY1B 1B53A 4ZQ3A 3R66C 2B2TA 2KJHB 2SOBA 4ZLTF 3NWTA 1SMYC 3CPFA 3I4LA 4P74A 1PLFA 2WAQB 4KK7A 2IGGA 2K4KA 2KJ6A 3U2SC 1J0GA 3VXWA 4TKNA 2SEBD 2IO3B 4D2KA 1YJIA 4WIPA 5CORA 4ICUA 5EE1A 3CCUA 4NPSA 1E8WA 2O2VA 1QKZA 1NCVA 4OEMB 4JX1C 3I4OA 4GNXC 2EYPA 3OSOA 3S15B 5IYBH 1ZGUB 5HHDG 5J2RA 3VYSA 2FBWB 2K8BA 3K7AB 4JBMA 1NMFA 2W82A 3DPDA 3PIP3 4JI0L 1Y8RC 1TJEA 4BKTA 1UGJA 1YI2A 1PUTA 3J81E 3ZNHB 4A3JG 2JA7H 2L0TA 4OWWB 4CKCA 4QIWE 2M2LA 4A55A 1U4RA 2GBMA 1B2TA 4XZ4A 4K5VA 2KHJA 3WIMA 2K5QA 2L8JA 3UI2A 3VRBB 3TS2A 2Y5PA 1JALA 2DJFC 1TVXA 1F1HA 3FPPA 4MEMA 5IODA 2E5LL 1WOCA 5LXIB 1CSPA 2I2YA 1LTTD 4GOPB 2I5HA 2DJGC 4JL9A 1FNWA 1IP9A 3PUVA 1Q81C 1SB3C 1F2YA 4OZBA 2IO0B 4OZCA 3OOCA 1PFSA 2F0QA 5LMUQ 2LJIA 4OL7A 1GUWA 3KOJA 2HCCA 2UXCQ 1CTMA 2NWGA 2RF4A 1FMAD 3PPAA 4MM3A 4ZHOA 3P1HA 3X3MA 2NZOA 2QDBA 4YCWA 4P1BC 3ZNZB 2HD3A 2VS1A 1YIWA 1NE3A 2CHWA 2EY6A 3A55A 3DHQA 3GZNB 4MH8A 1CZGA 3TREA 5JZEB 2GBRA 1JICA 2H4OA 2M1MA 4L5TA 4B3RL 3VRAB 3U7DA 1NR2A 1EY0A 4GLVB 1L4ZB 1UE7A 1Z5SB 2AKWB 1KD1C 1FD6A 2WGSA 4XE0A 2KHSA 4I7ZC 3IFTA 5IP7H 3W1SA 1PGBA 2D3GA 5J18A 3PREA 1IHZA 2E6XA 2IDYA 1MIUA 5GADC 1QG7A 1Q10A 5CBAE 4A3CH 4A3OA 1SXTA 4RNAA 2A19A 5IP4D 4RM9A 4OW0A 4DKAC 3MXNB 2YVCA 3M63B 3WAPA 5FR3A 1TS2A 1IBKQ 2EYLA 3EECA 2A69C 3NZSA 2LRUA 4PYZA 3URYA 3GTJH 3CWIA 1E0BA 5M3MH 3SDZA 4Z9CB 4L23A 1K3BC 4ZRIA 2DNFA 2CR5A 3K8AA 1XPRA 3BINA 5H8YE 4YXDB 3RNCC 4HMIA 4DFAA 5C6AA 1F2LA 2D0OA 4UP7A 5M9OA 4Q5VA 3HHMA 4B0EA 1QE6A 5M3FH 2UXBL 4LLGM 2F0EA 3ZDMC 2F0LA 3DBRB 3DOWA 5BO4B 4UDUC 5JEAH 1EUVB 2R93G 4HIOA 3TJPA 1FNUA 2JA9A 4GDKA 4P75A 4KSLC 3V60A 3KDFA 2BB6A 1P8LA 4C3HG 3CCLA 5EQ0A 1ZDXA 4JOIA 4Q2JA 2LHEA 1MKHA 1X1MA 4LJPB 2IW3A 2MX2A 1CQVA 2G5DA 4OWXB 1OQRA 5KNCA 1R7SA 4DV6Q 3QOLA 3A56A 3TDQA 1WD0A 2B3GA 2PQAA 1V9JA 5IGBA 5C1ZA 4RGNA 2H1EA 1X3PA 4C1NI 1EL0A 2ZM6Q 1SFOH 4HDQA 3NS1A 3RZFA 3T53B 3UE0A 4YSZB 1EZ8A 4B3RQ 3RZDH 2RBMA 2KFKA 4KKUA 5KEEA 5KYLA 4DHJB 3GTMH 3L08A 5T1IA 1FL0A 2L76A 2JYTA 2MEKA 1UNSA 4BKSA 2ZXPA 3TZUA 4B9WA 3K81C 4HIMA 2NVQH 1JOKA 5FLXc 3AMZA 2B2UC 4C3JB 1EY8A 4DV3Q 1VZ6A 3PT2B 2INPE 3A7LA 1MHWC 4FXKC 4DAPA 2KCCA 4BY7H 2ZNVB 1SRUA 1D5XC 3D4RA 3UE1A 4XWTA 2N4FA 1EZ6A 3Q8DA 2QKIC 4GKJL 2JZ3B 2JA6G 3OLMD 1HTPA 4FN2A 2F0IA 3P63A 2ONQA 1NBWA 1ZYRD 1A62A 3LGJA 4G4KA 2A68D 3S17B 4A3KH 1PGXA 2HDMA 4JI8Q 5M5XB 1KJTA 2G4DB 1RODA 4LF6Q 5CV7A 1IL8A 1IYJB 3ULLA 4DK6C 5EPKA 1RFAA 4MTNA 1EYAA 1K8GA 2GB1A 3BZDB 4B3SQ 2LRWA 1V5OA 5BYQA 2JUOA 4XQNA 5C5MA 3S1MB 3Q8EA 2A1AA 4GSWA 4DBGA 3NVZA 4G11A 4A3IB 4K3BA 3N52A 1V1QA 4AQYL 2WACA 1O7IA 2BH2A 3ZNID 4GLXA 1HHVA 3ZIMA 5BMHA 5FO8B 2K14A 2KEDA 2MBHA 4A3LG 2XBBC 2KAJA 4TV3A 4F87A 4HWIB 1D5ZC 4BA1I 1YBYA 5JVH3 4NJCA 4JWSC 3PO2B 1IBXA 3ZUNA 1WJJA 3IAYA 2MJ3A 1YOVB 3L9AX 5I6WA 2QEJC 3PRZA 2WB1G 2R92B 1B9RA 1K0SA 1CKNB 1KDBA 3SR1A 2IGDA 2K1FA 4WJ3M 3CCQA 2JA5H 3RZOH 4BXXG 1PV4A 4BBNC 4HVBA 3TEXA 3JAMc 5E4WC 3L0WB 2IYDB 2NR2A 2WHIA 3CQZH 1HQRD 1V86A 1QB5D 4NPNA 4W9FA 2V4IB 2UXDL 1YD8U 1VQ8A 4GXBA 5EBCA 1SYDA 1VQDA 4EUTA 1XQQA 3G6JB 2RSOA 4IJLA 3KLSX 4RGTA 4BBRH 4DNIA 4BA2I 1WX9A 4ZYNA 3GDEA 1EWCA 3ERSX 2YU9H 2N3SA 3ZXRA 2EE1A 4ZCKA 2OF1A 4WFN3 4LTUA 1HH2P 2CS4A 4K3CA 1WXQA 1WCMH 4DR3L 3TRZA 4II2B 2K01A 3RMHA 4GKJQ 4X3KA 2MO0A 2DNEA 3TN2A 3ICEA 1GNUA 1NENB 1PRTC 1ZPSA 2DWQA 1DJRD 2A4ZA 5CHVC 1WTQA 3J7ZC 5IOCA 1C4CA 2J0MA 2K5PA 2F0FA 3MFGA 2AWNA 1WD1A 1PHJA 1WGKA 1C79A 5IKCM 3QC8B 3VFKA 3K0XA 1YZ6A 1XNQQ 1JMCA 3CRKC 5E6PA 2MNAA 2LMCA 3K5LA 1KNAA 2QEXA 5L37A 3AE5B 3HKZG 4X57B 1OXSC 1RD9D 3RD4A 4PMWA 1R4NI 4QB4A 1SMYD 5JPNC 3L13A 4WJ4A 2WAQG 2WXLA 4RCOA 1ENCA 3W5OA 2A6ED 1F9RA 3BVMA 3GTOB 2EYJA 1HR0L 4A8XC 5ELFA 3PVLA 2AL3A 3P2BA 2MRPA 4RGMA 4H2AA 3UIPB 5HGQA 1D3ZA 1Z47A 1FXAA 3UQAA 2LSSA 2KOLA 4EQPA 4QF4A 4LNNA 2D3AA 2JX5A 3PSEB 3TMPB 3U52E 2R7ZH 4H02A 2L4NA 2F0GA 5GROA 3W5UB 5LL6S 5EPLA 3J81i 4WWPA 3VR8B 1WTOA 2W3RA 4ILWA 1QUQB 1B8AA 1RL2A 3GQBA 1CHPD 3E5SA 3OYYA 1IKLA 1FGUA 1PXUA 2KLGA 2K5HA 2WU2B 3DDCB 2EZVA 4WAAA 4YIJA 2IWHA 4RF1A 3OPOA 1UAPA 3ZJTA 1GJZA 3GV6A 5JXVA 3K80C 3SD5A 3TS0A 4AUQC 1EY6A 2B2VC 3GS2A 3WANA 2M19A 1B44D 4QY7A 4DV1Q 3M3YB 1T0SC 3NUCA 3CCRA 2OWOA 3F2BA 1V1PB 4OWTB 4HIKA 1PZJD 1YJ1A 2WDRB 2H5XA 3E9SA 4KDLB 5T1GA 4JI4Q 4DV2L 5KIXA 4DR6L 3V61A 4LUZA 3SHLA 5HGTA 4GDLB 3VR2A 2Z0SA 1L5PA 1OTCA 5IGCA 1NTGA 1K73C 2KLCA 1DOYA 2LGSA 2XGTA 1QILA 1TWGH 4FULA 2JP1A 2BS3B 1O7YA 3OIPA 4UP9A 4DUZL 4IC7B 4ICVA 4LJOB 4RMFA 4B6WA 1RFKA 1LO5D 1PH9A 4FO2A 4DV4L 4JVZA 2R3ZA 4F88A 5ELOA 2K9XA 4X3UA 4HPMB 1O7LA 3GTQH 1WFQA 2B2YA 3U9OA 3Q8AA 3DVNU 1B1ZA 1Y8PB 3UQBA 1Y69U 5G55A 4G7OC 1XTDA 1HR0Q 4JBJA 4DK3C 2N7EA 4E71A 3MEHA 4WQMA 3M3JA 4ARCA 1AN8A 1V97A 3WWVA 1B7YB 1STBA 4KX6B 2JA8H 2L11A 2VZKD 1V8CA 3EA6A 3Q8BA 4FXCA 2DBYA 1YQ3B 3Q24A 1I4QA 2INCC 4HJKA 1JB3A 5CV9A 4PZ7A 1WGHA 3HOWG 2CKHB 2TMPA 2A69D 1KH0A 4L5RC 1JRPA 1DYQA 2GBKA 5FO7B 4KKTA 3NSWA 5G3LD 3B2GA 4A4IA 3JYUA 4PV1C 4HCPB 4MZ9A 5FLMH 4LCDE 1EUJA 3HOYG 2EY5A 3DWPA 2O2VB 2MWSB 2B29A 2J0JA 3DHIC 1Q1OA 5CHFA 1CA6A 2SAKA 3RYTA 4RM8A 1HZCA 2RDGA 4ID6A 4P71A 5C0XG 1WJUA 5D3IB 1X3EA 2LFNA 3C2PA 1EYDA 1J8IA 1IW7C 4DHZE 1RJTA 2GBJA 4NP5A 1EYGA 1I35A 3L17A 3NRZA 2F0UA 2PW7A 4IN3A 1WE7A 1KOTA 1LYLA 4MDKE 2KUMA 4RKLA 1YHBA 2PW5A 4R4TA 4C2MB 1GUSA 2N9KA 5IGDA 4LFAL 4A3DB 3BYTB 1NVID 3IG3A 1JE4A 4YL8A 4YCVA 1OO9B 3VVWB 4EOYA 1OGWA 3HOUB 1OTRB 5GAEC 2FHTA 1RLFA 5M5YH 2KC1A 4H13C 2GOWA 3WDNA 1QNUA 2B76B 4JV5L 2KOXA 2B63B 1ZW7A 3A9KA 1HNXQ 4P16A 2AYOB 5A2QE 1C76A 2YTXA 1QOGA 4QMGA 1N61A 2BF8B 1E22A 1MGSA 4QIWB 1L0YB 1YVCA 4KN7C 4MM3B 1IYFA 2F3VA 1P3QU 2K5NA 1S1QB 1N9WA 3NZUA 5MPOA 1EQTA 1VQBA 1PTOB 4P1CC 3ZJVA 2Y0SG 4OONA 3PLUA 1KLVA 1EOTA 1FM0D 2FIDA 3Q6SA 3T51B 2MP2A 1J8CA 2QILA 3RNBC 2EYHA 2F1MA 2DZJA 1JE5A 3A4RA 3W1GA 2DY7A 5KNBA 4X65L 4GZYC 1WM3A 4OO1H 2ZCBA 3Q2AC 4KSKC 5BYRA 3V62A 3VR9B 5BN3A 1JQ4A 1SROA 4XQJA 4YCUA 3T3OA 1LUZA 3AH7A 1ZKOA 2BVCA 3T9LA 5LL6X 4X62L 2F3IA 1D8LA 2F0TA 3BZKA 2BS4B 1STEA 2KVZA 2KTRA 3QCAA 2PI2E 1PH5A 1YITA 5AZFA 3P20A 1GVPA 1AE3A 1GD7A 3PCOB 5JJLA 2DAJA 2N9PC 4J15A 1Q46A 3PZDA 5DM73 2WXNA 4ZKCB 1DXMA 2P5ZX 3S2HH 4IW0A 4LFCQ 3L10B 3PHWB 2NVTH 4IOAA 3WALA 2BE5D 3K6OA 3PO2G 3CKIB 4BY1H 4N6EB 4WJQA 1UE6A 1RAXA 4L2YA 4LNOA 5C4XG 4H44C 4A3EH 1WJNA 4W9KA 3RT3B 2Y0SE 1V9PA 3RULA 3GV3A 1VF7A 4GDKB 4FADA 3KDFB 1ESRA 1VQIA 4MHEA 4BWGB 3H6MA 3SK6A 3UDXA 2JA7B 1BMLC 1JT8A 1T6BX 3T16A 4DR2L 2N7JA 5JHAA 2Z0EB 3M95A 5IP9H 2QMTA 5IA7A 1RHPA 3TSSA 5JJIA 3QQ8B 5CV6A 3GTOH 5C3EB 1UH6A 2DZIA 3B2FA 2PQAB 1Q82C 4HKQA 1N34L 1E6EB 4FBJB 1JWAD 2B2WC 2WDQB 2KFKB 3TIXA 1JWMD 4NXNQ 2NVYB 1N33L 2ICIA 2NMQA 2WXIA 2SNSA 2BOSA 4X65Q 2KACA 3AU5A 2LFIA 4JPSA 4XYCA 3EQLC 1BVSA 1WXVA 3S9WA 5EJWA 2VH1A 3U30A 1H4RA 2AQ3B 1CUKA 5G3LF 4GNXA 2UUBQ 2Y5BB 3AEFB 1RCVD 2LVQA 1N60A 2O6VD 3KLRA 2LXAA 1N36Q 1Y8NB 1I42A 3I4NG 4A3BH 4NXMQ 1XD3B 3I2ZA 2IT1A 2UUAL 1I7HA 3GZNI 3H0GG 3NK9A 3TEZA 5EKLA 2PVOD 2AMCB 4DR4Q 3J9CA 2UU7A 4DN4M 1TGZB 4ZUIA 4IUNA 1XLQA 4GN5A 4JBWA 5CTRC 3N3KB 4AJWA 3CSFA 4FVMA 3ZLZA 4FF4A 2RQXA 3L7ZC 1MJCA 2KCNA 3I90A 3LX0A 1JB7A 2D10A 2DX5B 2CHZA 4DNTB 1NI2A 3AEAB 4R8IA 1XEEA 3D6WA 2DHZA 5I9OA 4BS9A 1BCPB 2PPBC 1EWIA 2JPHA 4XGAB 4R4QA 3AULA 3GTJB 3QJZA 4CDFC 4UP8A 2EIFA 5M3MB 2E2IB 1OQQA 1KHIA 3NBHA 2KDFB 4GOPC 1IBXB 4LUVA 3M7NA 5D94A 1XT9B 3V6EB 4HSVA 3GTKH 3VR4A 3QWNA 1LXDA 3SU8X 1DOXA 1NSNS 1S5BD 1F52A 1STGA 2BB5A 1FO4A 3CMAA 3VHTC 4GKKQ 1DM0B 5D65A 1TR5A 4XTCS 5AUKA 2ZTCA 3V96A 1QZEA 4NY0A 1XMOQ 2A6HC 1ZYRC 2JSOA 2Z0DB 2KYWA 4GS3A 4LW1A 5J3BA 3WAMA 3QA8A 1I5FA 2DZMA 3MC9A 3J80L 3OW2A 2ICEC 2UU9L 3OWEB 4ZK9B 1WX8A 3AE4B 5CX3A 1NUCA 3HOVH 4L6TB 1E2WA 2V3PA 4OVZA 3H15A 4BBSG 3S24A 5TSSA 1SFOB 1IL2A 3ZXVA 4TKOB 2ES2A 2UUAQ 3RZDB 3UDGA 3GTPH 1QZGA 1UD7A 5EDSA 1SNCA 2VB3X 2RSNA 3GTMB 1WX7A 1SN8A 1UUPA 2IO1B 4ALPA 2KWVB 4K0KL 3QIAA 1YJNA 1P9DU 1WRDB 3RN2A 1SNQA 4L63B 1YJ9A 1C8CA 3J7A5 4QUCA 3AV8A 5E7NA 4FF3A 3KQ4A 1KDAA 1XMQL 2D11A 2WQYB 3KUZA 2KQ3A 1E8ZA 1ENAA 2PLPA 1YNXA 1D7QA 2HUGA 3BDCA 1K52A 4AYBG 2LMCB 4C3IG 4BY7B 2GVAA 3ONSA 3DWQA 1RM6C 4PS8A 2KJRA 4HAEA 3VH4B 4W9LA 3HOUH 4ZYSA 3VTVA 2BTEA 5DPTA 4CJ2C 1H9KA 4R4CA 2L52A 2LXCA 3AU4A 3NQTA 3EROA 4A3KB 3P75A 2KHIA 2EMSA 5D14A 1F2ZA 4FA6A 4FF1A 3M85A 5LMNW 4W9GA 2B8FA 5JJKA 4YWGG 1P1AA 3HKSA 2KWDA 2QDFA 1TIFA 4MIUA 4L1BA 2K28A 1FJGQ 2ZJPA 5FJ8G 2ATWA 1EFWA 1OEYA 2BGFA 3H3VC 2K50A 5EKKA 4HXDA 2C5CA 4JI6Q 1GC6A 2C60A 1CHQD 2OQ0A 1KRHA 5IWAQ 5LHY1 1L7YA 2BH8A 4I6PA 3B08A 1AYFA 3RNEC 2J7ZA 1T5XD 3QWZB 2ZJDA 1BOSA 3PUWA 4B3TQ 3NENA 2WXGA 2XK5A 1TY0A 3PRPB 1GXDC 1LT4D 4HPLB 4U68A 2J42A 2K7VA 3SHQA 3C8YA 3RZOB 4IM3A 1DOKA 2PPHA 2N8NA 3NY5A 5D2MB 4LUOA 4WH4A 2NN6G 1WVLA 3CQZB 3ND8A 4K0KQ 4G0NB 2XRSD 1Q1BA 2FUG1 5JH5C 1T0RC 2J7QB 3NTKA 2KVMA 1XYIA 1I94Q 2A6EC 1PTOF 2EXDA 4BBRB 3OTOL 4FHJA 1UE1A 4K14A 4A3JH 4JBKA 3CW2C 4OO1I 2YU9B 4YSYB 4DDID 2D9UA 2QF7A 2A5UA 5E3FA 2KX3A 4TQ1A 1E0ZA 1YNNC 4RAUC 4C1NK 1A8VA 1NI3A 3WOFA 1WGGA 4CDDC 3AECB 2N55A 4TUUA 5E6JA 1WCMB 4ZRPA 3S2AA 1HA6A 4XQQA 3BS1A 1BO0A 4L5SA 3SE0A 3ZRCA 4IJHA 1X54A 2PTLA 1K3RA 2MJEA 3M7GA 5IAAC 1J7CA 1EF1A 4A3FG 4JI5Q 4KTAA 2KWCA 1S5ED 2Q5WD 2RPVA 3PZ7A 2CH4W 2WS3B 4R8NA 5C3EH 3CU7A 3N1ZC 2MLBA 2L83A 1M94A 1P16A 4HJ7A 2O5IC 1CSQA 4X66Q 3M4PA 4JIOU 1ZXTA 3SXHA 4YTNB 3U9SA 1IUEA 2I1KA 1F2RC 1WZ3A 1JJGA 3VR6A 1LTBD 3GB1A 4QQBX 2NVYH 4KIKA 3A9JA 5FLXE 5C44B 1IBML 2WXFA 4K6LA 5JJZA 1I4PA 1V6EA 2VL6A 4L8JA 4UAIA 4P7IA 1VR9A 2CHXA 1PYWD 3PHXB 1C4PA 1S5FD 2K5VA 5IYBG 2KANA 4TRDA 2G9DA 3A54A 5AJ3L 1E7ZA 3NP8A 3DEPA 1WY8A 4LF7L 3NVYA 1PYBA 1XPOA 2R7ZB 1LT5D 1EOVA 3U7ZA 2K75A 2ZZPB 3X0WA 1U4PA 2PZUA 4JQWC 5EGTA 3FP9A 2PEAA 1GHJA 3DHGC 4DR7L 4LF8L 1TWHH 1WI0A 2OEDA 3BY4B 2L9HA 5BN4A 2LGXA 3PZ8A 1C9FA 2INNE 3NPPA 4W9HA 4HK2A 3Q8CA 4JI0Q 2HT1A 3A9KB 4A3MG 4KGTA 4DHZB 1BBUA 3EGRA 5BMIA 2WP8J 5G2NA 2R93H 2RR9A 4L5QA 2IHEA 3Q22A 4CHTB 1I4HA 2E2IH 1WWTA 3K5MA 2CU1A 2IZVB 4G7ZC 3KYCD 4RKBA 4C3HH 3BDOA 5DPRA 3Q8FA 3GTGB 2AWOA 2I0QA 4W9CA 3RPFC 2BT6A 1TWGB 1PH3A 1EY4A 2E8GA 4S3SA 2K8CA 3X3NA 4JI3L 4LK1C 3JAME 2E5LQ 1ZDVA 4DDGD 4WAFA 2MP2B 1IYUA 2JVCA 3H6NA 2DZKA 3ZGZA 3MTSA 5NUCA 3GTQB 5GXGB 5BYSA 2MA9B 4EX5A 3OJ4B 1WXMA 3S1QH 3K5OA 2IY5B 2M0AA 2VZAA 3IFWB 2B2VA 3VUWA 5K5PA 1JW9D 3FKIG 1B50A 4CKBA 2KTRB 4ANVA 2JA8B 2JF5A 1BCPF 2K3UA 2AUKA 1WYWB 5I9PA 4B08A 1VZ7A 1SNDA 3AMUA 3PO3G 2H89B 3CIRB 1QVGA 3NTHA 1H9SA 4LF7Q 4KGSA 3A1QB 2EKIA 2K52A 5AEKB 4DF7A 4DWFA 3KFUA 3M4YA 4GLAC 4KI0A 1J5EL 5DPWA 1HE8A 2ASBA 3EN2A 2DY8A 1PQSA 1TKYA 1LTGD 1OQYA 1VMPA 1VQ7A 3FILA 3ZVVA 4BVUC 3GTLH 1Z7TA 4IPCA 4LF5L 4PT5A 1ACCA 2F0SA 3FPUB 2VUMB 1JMLA 1WR1A 4HCNB 5M3FG 3TP8A 4HLEA 3ECIA 3MP9A 4DAYA 1WF9A 4W9EA 4OIJA 4TQ0A 5BR8L 5K36G 5JEAG 4CDEC 1GG3A 3RNGC 4BOZB 1ZEQX 2VQFL 2O5JC 2F4VL 3K57A 2A6HD 3QR8A 4EEWA 2CWPA 5DCNA 2CJNA 4A3LH 4FJYA 4K8JA 4QAYA 3ONAB 2MBBB 2PZWA 4LDTB 1CKOA 4FXGC 1Q12A 2FJ2A 1KTKA 3JC66 3APFA 2FFKB 2UXBQ 1Y1VG 2O4XA 1J19A 1STYA 1E7VA 1FFVA 2KKCA 2DGYA 2NVUI 1EU3A 3NVVA 1KL9A 3FRPB 5ELCA 5H1SE 5M5YB 2PJHA 2E76C 4K5XA 1G6JA 4O1NA 2KJXA 4XYQA 2KDMA 2OOBB 2E2JB 4C4VA 1UF0A 1Y1WG 4PS7A 1PFDA 2DAFA 1VF5C 1GUTA 4GNXB 1SIJA 1VQFA 4G50A 2B2TC 3STBD 3T1HL 3ML8A 1ZE3D 1IXRA 4GN4B 1U4LA 2BE5C 2PYKA 1TKGA 3U4VA 2V3SA 5JPMC 1AW7A 1U4AA 4HJAA 4DV5L 3NG0A 3BK1A 1UWVA 1BBXC 3BDLA 4FLHA 1V5TA 3H1UA 2NPTA 3M62B 4KV6A 1QLBB 1JQYD 2HD5B 3AFPA 1K83B 1N8RC 4IFDG 1HJPA 5EE0A 1VRAB 4WWNA 3D4DA 3ERQA 3CXCA 3FDTA 1QCBD 2CVRA 1U0LA 4RHRA 4DUYL 1K50A 3J80c 2E3TA 1EIFA 4LF5Q 3OIQA 3NUHB 3I4MG 3X23A 2F0MA 3NE5B 1T9HA 5A2QL 4KHPL 2KCTA 5G5HA 4C00A 2KENA 2WKCA 3EBEA 1NAPA 2Z9HA 1XNRL 2K32A 5HFYA 1SNPA 1E1OA 4R4IA 1EQQA 4GB9A 2XTIA 1D1KA 4USAA 3KBGA 3PF4A 3RUIB 3MJWA 2TSSA 5IYDG 5DM63 2NZ1D 1VQGA 3QOJA 2E2HH 1TYGB 2W54A 5EE3A 2FMMA 4HMJA 2V9HA 1MFWA 1MHXA 3NBHB 4QJFA 3S2HB 4NNJB 3HOXG 2NVTB 4LK0M 3ZJUA 4OX9L 4BY1B 3NHEB 5I4DA 4E6IA 4IM2A 4H0LC 3B9JA 2PO4A 1CQFA 4DHJD 4A3EB 1Y8OB 3IT6B 4NKLA 4KJNA 2VRRB 1SJED 4MSQB 5HKHA 4KJOA 2KQ4X 2JA5G 1W3SA 2HQLA 2WB1E 4AQYQ 2F4IA 2Z6KA 1XCQL 1E1TA 1NY4A 1KQSA 1PTOC 2FNJB 4OVUA 2FXQA 1C3TA 2X69A 2OEOA 5C44H 2PMVA 3CRLC 2KZRA 3N1YC 2WXMA 1YNND 1VQNA 4DV5Q 1VQCA 1NJIC 4WWOA 3HIZA 1BDOA 1VZ8A 2VW9A 1YIJA 3B1LX 4DV7L 1ICFB 1L0VB 2JN4A 3BVZA 2ZW0A 4R1JA 3F2CA 4HRSA 3AN1A 1DONA 1LGRA 2C35B 2UXDQ 2AEHA 4US8A 4LF4L 4DUYQ 1FGBD 4AOFA 3BG3A 2F0JA 2IX3A 5I2XA 1BXTA 4P6VF 1PYSB 4KHPQ 1LT3D 4LNFA 1A2UA 2RHSB 1XNRQ 4A3BB 1XPUA 1E90A 2BYEA 4DR3Q 2OQKA 1TZ1A 3APDA 1JWSD 5CR3A 1FD7D 2CCZA 2FE8A 3QG1A 1TTNA 4KGRA 4OVVA 3O65B 2C7NB 1AP0A 3VTUA 3L4PA 1NNXA 3HKZE 4K7UA 2HDLA 1PMRA 4JI1L 1IYVA 3DBHB 1M8AA 1AZQA 2JK8A 1Z9FA 1WI5A 3RI7C 3RCZA 4EZKA 2WAQE 2Z8LA 1JWUD 1SYBA 4K2LA 5LMNL 2CQAA 3E9IA 1ASZA 3GTGH 2B2WA 5IT9L 2VY3A 4HIDA 2KHWB 1UE5A 1BUVT 4AH6A 1L0XB 2HJ8A 3PGEA 4M8NA 4MGIE 2JE6I 2F03A 3KWVA 4WURA 4IPHA 4JK1C 3AB9A 4IUUA 4LJZC 4V0BA 3APCA 3V3XA 4PMBA 1PZKD 1A15A 2HHHL 3S16H 1NYQA 4FJVB 3ZQ4A 4W9IA 1MVKA 3I70A 4A3GH 2QCPX 3D3RA 1RWSA 4IWQA 4HEDA 1X55A 4RA8A 2CJOA 1SE9A 1ICWA 2AUJD 1LM0A 4A9AA 2XK5B 1KAWA 1K9MC 3GTKB 3HOYH 1ROEA 5HURA 4U673 1GM5A 1PH8A 3KWLA 4ULLA 3EFCA 2GBNA 1UEAB 2ZVOA 2ALYB 3ABVB 3IVFA 2AX5A 1WH3A 1KAAA 2JYEA 4G3XB 1NBFC 2OHFA 3EVQA 1JJCB 4DV0L 2YTYA 3HOVB 3CCSA 1HTQA 1E2ZA 1TWFH 4GN3B 5ELNA 1NEKB 5DNFA 3MJ5A 2VUMH 2W9NA 1VQ4A 2N9EB 3HK0A 4XX5A 3SFEB 3JAMi 3CC2A 3GTPB 2WV6D 5LLIA 2BWFA 1U9RA 2OCEA 4JI1Q 3FKYA 2Q8RE 4P73A 3GD7A 4HPPA 4DV2Q 4DR6Q 4X64L 1D5MC 1SE2A 5LMNQ 1V2YA 1BCPC 4JI2L 1GUNA 2KQSA 5CMDA 1WTVA 1YNTE 2N7DA 3EFUA 1Q7YC 1L4DB 2JA8G 4DUZQ 5KGUA 4XC2A 1EYCA 3DXJC 1Q0WB 2INDC 3K9PB 3P4QB 4MGZE 4M8AA 3RD2A 1Q8KA 4DV4Q 1A63A 4KIKB 3I63C 3PSIA 2RKSA 4HDOA 4NAWA 3RN9C 4ARIA 2CW0C 3A9JB 3I72A 4X3TA 2E2JH 4ABNA 3P4SB 3CHBD 5FLMG 1BR9A 2UUCL 3IL8A 3VH3B 1EY9A 4IWPA 1A70A 1K0RA 2FIFA 1OXTA 3AE8B 3TZDA 1GB1A 1UEBA 2Q8IB 4GIVA 1KRTA 1SSOA 4C3JG 1PRTB 3HOZB 3TQYA 1VQJA 1DCZA 1WZ0A 2LASA 1I6HH 3U50C 2EJFC 4LNIA 2Q8TA 2KCMA 2EY1A 1BBWA 2J53A 1L1OC 4KY7A 5CHWA 4JW0A 2K03A 1K83H 2G4SA 1YN4A 4HROA 4FDBA 1SJHD 3V05A 4F1SA 2Y3AA 4XT3B 4K5WA 2LXJA 4PQXA 2KVRA 1DZ1A 2Z59B 4US9A 5E6OA 3DBLB 3C1FA 4MELA 1LTRD 2NUCA 1HZ5A 1TS3A 2A5HA 3AU7A 1E7PB 2MJDA 2Q2HA 3VAWA 5JHBA 5KHQA 5EPJA 5C4XH 2LD9A 2JT4B 4YWKA 4A3IG 4KZ0A 5FOBB 4EVOA 2N49A 4TMAB 4AS1A 4M01A 2OTLA 5IO9A 4X64Q 3CMEA 1X56A 2LY7A 3RR5A 2KWUB 5G5GA 3CC7A 1K28A 4A3JB 1UGMA 3DEOA 4J6HA 4MGKE 3EUB2 4LFAQ 2BYTA 3KH0A 1ZXHA 1PH1A 3MHBA 1N5WA 2D3CA 2PI2A 4XIGS 3KJOA 5FKAC 1KC8C 2R92G 4J6IA 4LAAA 1Y14B 4DK0A 4JV5Q 2A74C 1J9OA 2NBVB 4OHJA 3T3NA 1SYCA 2MO1A 3NBIA 1L0WA 5FK9C 4OXPA 3A33B 2EYMA 3M4OH 1HA5A 1YMHE 2XWBB 2L0CA 3VYUA 2WDVB 4JCVE 3JSVA 1X3QA 2ZJRA 1JRUA 1C0AA 5C3WA 4RGOS 4HTHA 3R3OA 5GAHC 2LJ5A 4JWUC 1SYGA 3I4NH 3UGBB 2Z4HA 1PH6A 2JY6A 3C46A 2W55A 2HQEA 4ME3A 3GP7A 2K04A 3PUYA 2B3AA 3H0GH 1I50B 2DNCA 3E56A 3FILB 3IHPC 4MH0E 5AZHA 4DR5L 5C4JH 5ISRA 1SMXA 1G2TA 2R2OA 2NTTA 4X62Q 4AQ7A 3MA2B 1MBYA 4RCNA 2K22A 4OZAA 4A3EG 3SVMA 3J81L 1ASYA 1HQMC 2CWAA 2MPMA 4CBVA 4DAYB 1YHQA 1WMHA 3VQIA 4CHKA 3N30A 4F8CB 4H7BA 4N9TA 3K5NA 4GLSC 1CZWA 4EZJA 4GMVA 3ULJA 1IGDA 1TKWB 4FYDA 4Y52H 3DVGX 1IBLL 1PTOD 1KRSA 2KO3A 3QB3A 5IP9G 1EEID 3AEVA 4LFBL 4ZOHC 1KXLA 2EVBA 4DR1L 3DVNV 5C5LA 3BU2A 3V2TA 1ONLA 1TWAH 3UI3A 4LWCA 1DOLA 5C3XA 1EF5A 2B2YC 1TWHB 2HIXA 1M4VA 3IFDA 5IN7A 4MACA 3K0YA 2GVBA 3KF8A 3C3LA 1QT9A 1SEBD 4C56C 1I4GA 3JVZX 1E24A 1XLNA 2AWTA 1F9QA 3R7QA 4C4VB 4TVAB 1FEHA 1WR6E 2R93B 3L3OC 1F0ZA 4DR2Q 2WFWA 3I56A 1VQOA 2XN9C 3A5ZB 1TXYA 2Q2TA 4GOCA 4C3HB 4K6DA 3VTWA 3I9V1 2IO2B 3QX1A 4EQOA 2A8VA 3D31A 2OTJA 2QCZA 5ELEA 3I3CA 1EO6A 2YLMA 2WXPA 3I91A 4A3BG 4ZKBB 1N34Q 3R93A 2RCNA 1K8AC 1QZHA 1TQOA 1E8YA 1HCZA 4BBSH 4OIKA 2QHOA 2NPTB 1SE3A 3HFZB 1N33Q 3ZDTA 1BF4A 4DGZA 4CJ0B 2JRIB 3CF5A 4A93H 1HTOA 1LTID 3DWGC 1I6VC 2LUEA 3LJ3A 2KDBA 3N6RA 3S1QB 2L0FA 2MBOA 4DR5Q 3ALBA 2N9LA 3O13A 5J1ZA 3HRZC 2JQOA 4B9XA 2NVXH 2E2DC 1YN5A 1VMCA 2ON8A 1LM8B 4BKGA 1K8OA 1VQAA 2PE6B 1YX6B 4R9WA 2KC2A 3ZTDA 5GAGC 2X8XX 1V8QA 1XX8A 2KXJA 1MG8A 2K6QA 1ENFA 3TP5A 3SGIA 4C3IH 1HFGA 1Q1EA 1UZXB 2BBCA 1G6PA 1IGCA 4KVGB 3L2PA 5AFWA 2JA6B 3R3MA 5KHOA 2M4NA 2ZW1A 1XLOA 3GTLB 4YY3L 1WTHA 3STBC 2N88A 3CPWA 3MXUA 2RSUA 1JJ2A 2Z6BA 3S2DH 1I3QB 4DXAB 5IYCG 1AZPA 5E4XA 3CCEA 2KMMA 3OAWA 4PK1A 4HCSA 4WRDA 1WM2A 3K59A 2ZTDA 3DBSA 1JCKB 4NJ7A 1II3A 3NELA 3OHXC 4KKJA 2JZPA 2XRQD 5FJ8H 3LB8C 5IIFA 1MJDA 4ZRKA 3HVZA 1SSNA 4B0MA 1SE8A 4PS3A 1U4MA 5FO9B 4F8MA 3K58A 1L6UA 3PV1A 3CD6A 5IT9c 4KD3A 1C77A 1T0YA 1SLJA 2PQEA 1STNA 1Z2MA 1DOMA 3VA5A 4FF2A 5EBDA 1JOOA 3HOZH 2WB1B 4CKEA 3VDYA 1TS4A 3P1MA 2L1BA 3I55A 1VQLA 1T3QA 1ZP0B 3BK2A 2J52A 3W5VB 2NN6H 2F0OA 3G48A 1V1PA 2JJQA 2WKDA 2HDEA 1ILPA 2B2UA 2UU9Q 3H7PA 3U4EG 1E2VA 2G9HD 3AEEB 1BCPD 2E74C 2WXQA 1HEZE 5DEHA 4DAMA 4A3DG 2QW7A 3DMUA 3FC4A 5J22A 1FCCC 3NJTA 3ZO5B 3S1RH 1TT2A 3Q23A 5J17A 1V49A 3HOUG 4AYBE 2MCNB 1R4MI 2RPQA 3M9BA 3A74A 2N9XA 2N78A 3FAHA 1F2MA 2B63G 1N5XA 2CW0D 3ZJYC 2HE7A 2R61A 1EFID 1X6OA 3NXWA 3H94A 4YY3Q 4I6LB 3QARA 2RGFA 2ZNVC 3DWMA 1XMQQ 3RLFA 2F0DA 1EIGA 4PMCA 2C7MB 4N8FA 3HM3A 3Q3NC 4HKZE 4BFRA 4ZRJA 3VUXA 2ENBA 3CP0A 2EJMA 1CJEA 2ASQA 5CC4A 4GU2A 3HVDA 1AWDA 2IHFA 2MH7A 4I6NB 3MHSD 4IPGA 4AIMA 4S0RA 3E0EA 4XDCA 1ET6A 3MTNB 1DD2A 3DWAA 3BWUD 1SNMA 3HKZB 2PCFB 4MGYE 2E2HB 3NHHA 2MGSA 4Y7NB 3UDIA 1RDPD 2VQEL 2HTME 4JLCA 3VUYA 1C1YB 2H88B 4YHHL 3A4SC 2KFJA 3AFQA 3PMFA 5CGKA 3GO5A 3UIOB 3OMGA 4A3PA 3Q3FA 3LWEA 3HUIA 1X3FA 2ID0A 1V81A 2R7FA 5IY0A 1LTSD 1FR3A 4G57A 2JXXA 5D6JB 1IBKL 1K8MA 2PW9A 1PFMA 2AQ1B 1I50H 2PMZE 2YYZA 1ZOYB 2WXOA 3NZ3A 3Q3MC 2V4DA 1RKNA 2NZHA 5T8IA 3B0AA 3U4ZA 1E8XA 1YQ4B 3L54A 3W9CB 3WCQA 4K2KA 4C80A 3IXSA 4RG1A 3VYTA 3TBIB 2KDEB 4P2CB 2GMIC 1WSPA 3D32A 3H91A 2J4XA 3AI5A 5I6YA 3A7AB 1CFMA 3IBEA 3CF6E 4KLKA 4K7WA 3EHVA 2MSED 2PVGC 2G45B 4K81A 2JEBI 2D2CC 3LXFA 4FNFA 4MT5A 5DLQE 1QF6A 4A3MH 3GE3C 2JA7G 2AHOB 4NQKE 1PH2A 2NBFA 1GAQB 3OTOQ 2GLSA 3P4PB 1A6XA 2O6VA 2KMAA 4KY6A 2OJWA 3OG5A 4MJSA 4ANXA 4ZAIA 5C3EG 3RFZB 4X3SA 4DA2A 3MVVA 1J7AA 2B39A 1MI0A 1HPCA 3J7AF 3AE3B 4HJ5A 1G51A 4ME5A 5C2TB 1L6VA 2V1CC 3PUZA 2ZPNA 3H8HA 1FNVA 4NAWB 2ZM6L 1MHHE 2L12A 3OMCA 3J81j 4IG7B 2KEEA 2VQEQ 2LUMA 2MHJA 4J3OD 3FMCA 2LVOA 4DPGA 1L2NA 3RNUA 4I7AA 1EWHA 1LTLA 4YHHQ 3T56B 4IOCA 1YEZA 1WTRA 1KIXA 2AL6A 3DBHI 4N8X1 2EMTA 2RVLA 1QQRA 4N59A 1R4PB 2KMCA 3U58A 1S4ZA 4KHVA 3W1BA 3FKIH 3JW0X 2KT7A 1UBIA 5FR6A 1LV9A 2IPKD 4DV3L 1MJEA 1WJ6A 3PO3H 1KNEA 4F7ZA 3HOWB 3J80E 2IX1A 3S16B 3Q3OC 4NZLB 3NEMA 1FFUA 1MD2D 2JWZA 4A3GB 1IBMQ 5BN5A 2QIEB 2WX0A 2HJ1A 2WXRA 3N1XC 2C7HA 1MI2A 5IP7G 3ZNGC 3AE2B 3EC8A 4M8MA 2FMCA 3TUOA 4XDXA 4JI8L 3HOYB 5L95C 2FINB 1VCBA 1HZ6A 4LF6L 4A3CG 2DYMA 2XVSA 4APVA 5AJ3Q 1HFNA 1IZ6A 4YTPB 2HCIA 3ULPA 4CDCC 2ZJQA 4B3SL 5HI1A 4BOSC 5EAYA 1QVCA 1QOBA 1G91A 4A76A 3C19A 5K36H 3N20C 1VS0A 3DUZA 3MXGA 1PZID 2XNAC 4PNYA 4CGYB 4UY8C 2LWPA 5M3MG 4E3CA 2JA6H 1JROA 1TWCH 2K6DB 4DR7Q 4LF8Q 2QJLA 2C9WB 3NS8A 1TWFB 3HP3A 1T0QC 5IGFA 4V190 1NR4A 1I3QH 1PH7A 2BYVE 3ETRA 3J81c 2XSCA 1RTNA 5HY6A 4BAXA 4TSSA 2CKZB 1Y1VH 5C0XJ 2EYFA 3AE9B 3BZCA 2CQOA 2RDFA 5I2YA 4YWLA 3I57A 4FJZA 1SDFA 2V4LA 4E74A 1B70B 4QUFA 4XXEA 2BS2B 2LGDA 2YEPB 2I46A 1Y1WH 3UF8A 5IE8A 3MC0B 2QGQA 4YWMA 2MW5A 3TP7A 3JSVB 1WRIA 1RTOA 4DXGA 1PGAA 4EKUA 1RIPA 3KK7A 1SE4A 1NMGA 4QGUA 3SK8A 3PQIA 4JI3Q 1VQMA 1TIID 3RMKC 3PTFC 3IKJA 1N62A 2Y0SB 5M5WH 3G6EA 2EELA 1ESFA 1STAA 1KF6B 1QJOA 3NOBA 4IALA 3I7FA 3G7LA 2WNMA 4IQZA 1ZXIA 3FEWX 4BXXH 2EOTA 1WGRA 2ZCCA 3PLVA 3KF6A 2D5DA 3AE7B 2LS01 5D7GA 1PH4A 4IFDH 4ODGA 2IY0B 3IAM1 1S3OA 3A8IE 3AE1B 2WWZA 3MXPA 2MP1A 4JC0A 1WMHB 1G291 3I4MH 2PKOA 1R4MB 3DM3A 1RRBA 3A8JE 1N6ZA 1TBEA 4BY7G 3AEBB 1Q86C 3TBLD 2OJRA 1XNQL 1VQKA 2PIAA 1I6HB 1P98A 4GGQA 2F0HA 4IO9A 3VR3A 3F8TA 2EDGA 4ITKA 1J5EQ 4ZRQA 2REXA 2GA4B 2F0VA 1S40A 5IYDH 2BKFA 5HG2A 1GC7A 2J0TD 4A3KG 1AFPA 4KHZA 3IAS1 3ML9A 1KLGD 2K5DA 2NN6I 1Q8IA 1S3SG 3D8GA 1GKHA 1SIFA 1OXVA 2J0KA 3HOXH 1WGYA 2MHVA 4QCLA 1JOQA 1BNZA 2D2QA 1G6ZA 2JQRB 3KF8B 5C4XB 3DBLI 4B3ML 5BR8Q 2LI5A 1WGDA 2KBNA 2L15A 1X3GA 4FP5D 3RNFC 5COYA 1H95A 4NQLB 3AB5A 3A5UA 2K39A 5EE9A 2VQFQ 3QO2A 2F4VQ 2EYOA 4HSPA 3KLWA 1P7FA 1QNKA 1HXYD 3LNNA 4ANWA 4Y7NH 1WTPA 1TKEA 3TEWA 1YNJD 1MSGA 5L83A 2HTHA 5IGGA 1TU2B 3CSTA 4WJOA 4WWMA 1PA6A 4DV6L 3N32A 3AEDB 1ISNA 1HZBA 1F9SA 2DN8A 1CMXB 2Z4IA 2RMMA 1L1OA 2F0NA 5BMGA 1B3QA 4M02A 3MHZA 1WFYA 5CV5A 3S15H 3EJIA 4CJ1B 3PV0A 3K7AH 3CCVA 4DV1L 3QIJA 1S5DD 4YT0B 3R2IA 3KYHC 2UYZB 1A2TA 3M4OB 1YQBA 3KUCB 3T1HQ 3ZW3A 4BBRG 2VZKB 4BZAA 4M0WA 1I4XA
chains in the Genus database with same CATH topology
3SK5A 1FRRA 3S1NB 2E75C 1O78A 1EQVA 4XYOA 3I4NB 4EE2A 1E10A 3NWSA 1LABA 1HTLD 1CT1D 3KLSA 1H9MA 1VCIA 4Q0FA 1MSHA 2IJ0A 1SAPA 3H0GB 1HRJA 1N63A 3DM1A 5C4JB 4KMUC 2JWUA 5KYIA 1WYGA 3HGBA 1SYEA 3MZ5A 1UWMA 1J7BA 4XWWA 1XWEA 2WLBA 3SR6A 4WORA 4NMZA 4RHSA 2NTSA 3BYYB 2WU5B 3VA7A 1P7EA 4N58A 1VDZA 4RWSC 1TWAB 1W6JA 3SFDB 2BW2A 5ELDA 2I38A 4DK1A 2ZXRA 1ZUD2 4WJWA 2RDHA 3AEGB 1A3VA 1D6EC 1D2BA 2LEKA 3S14B 2KN4A 1LTAD 1Z6HA 2LHDA 5D3DA 5DAUA 1VLBA 1A3UA 1PDQA 5CV8A 2RA4A 1C4AA 3F2UA 2WXKA 2NYZD 1G8ZD 4BBSB 4YTMB 2NB0A 5H92C 1E9MA 4A93B 2BA1A 1V43A 4KD4A 5C0XH 3VR5A 1QOAA 1O80A 1K53A 2NVXB 1Q90A 4C7YA 3MWYW 5J39A 2D62A 4IZ8A 1KLUD 5E1FA 4REZA 3W2DA 2N0SB 1W6KA 1WTWA 4RF0A 4AYBB 4C3IB 3LYYA 5AUIA 4NAMA 1QOFA 4LMQD 1I4RA 2SNMA 1XXGA 2F3WA 1R4QB 1R9TB 1LT6D 1QOHA 1PDXA 4KKIA 2GI9A 3HG9A 2EPBA 1B9MA 3S2DB 2I07B 4RFBA 5CBEE 2M56B 1CZPA 1X32A 1BQQT 3PO0A 2L32A 5ELBA 1UWXA 3TEYA 2EXZA 1PFBA 3EFXD 1GUOA 3Q0AA 1XCTL 2JYOA 2CHBD 4NDXA 2K05A 2ZXOA 2B8GA 3OW7A 5C3JB 3E6ZX 3SEBA 4O42A 2YEPF 2LGIA 1C48A 1MPEA 1EEFD 3MXNA 4HCEA 2PZTA 2PMZB 2Z1CA 2K33A 1FCLA 4IFDI 2G1EA 2F0KA 2X6LA 1PFNA 3S1RB 4HJGE 5A35A 1T5EA 4HN7A 1EWYC 3W3AA 1CI3M 1FIQA 4DXFA 1D4BA 1EIHA 1FRDA 2D5GA 2K6AA 2M9VA 2JXTA 3HZXA 5CV4A 2EY2A 4A3FB 2IGHA 4A90A 1OXXK 4G7HC 2C9OA 1SYFA 4ZHPA 3VYRA 3R8BA 2K0PA 4JE3B 4J1MA 2JSVX 2JU6X 3H09A 4IUTA 1LACA 2XWJB 4IDIA 1FXIA 2IX0A 2O2LD 3MAQA 4OO1G 1XO3A 2A73B 1VDVA 4RH6A 3A8KE 2K1BA 3TMEA 3R2TA 3D4WA 1B3AA 1EY7A 4IKGA 4C7ZA 2M00A 3BIID 3NTIA 1AEXA 1H9SB 4XT1B 3T4AC 2Y5CA 1K51A 3HRDD 3WOEA 1OXUA 5KRUA 2SDFA 1ET9A 3ND9A 1QWYA 1F77A 2PNRC 4HEA1 2R6GA 3T13A 2L5TA 1CM9A 2EJGC 2VNUD 5JAVA 1KABA 1SBBB 1D1IA 2W3SA 4A3MB 3N9YC 4KN4C 3NVWA 1C4QA 1EU4A 1PRTD 4N9PA 5IT9E 1C78A 5LNK1 1S5CD 2BDOA 3BVGA 1XLPA 1ML0D 4IURA 1NYRA 1B9NA 5FLXL 2WIIB 3AM9A 2DLBA 1JWBD 5JOBA 2L1AA 3D6CA 1XTCD 1SF0A 1YJJA 1ILQA 1XF5L 3P4RB 2IL8A 2V0GA 1TS5A 2ACZB 1DOIA 2WXJA 3I73A 2JEAI 4DAVA 1H9JA 3PUXA 1GPXA 1FYCA 1CK1A 2DYOA 4DU9A 4MN3A 3FKIB 1BUIC 2VXWA 2WXHA 2MJ8A 3PO3B 1KDCA 4DQOC 5CYUA 4I65A 1JORA 1VJKA 2L55A 1RYJA 2BA0A 4CQNA 2MUYA 5C4ZA 3I8ZA 2X38A 4NW2A 3NQIA 3J7AV 1EY5A 5KNDA 4TQUS 1O7ZA 2OXPA 5M3FB 5IGEA 1A3TA 4XDDA 4IOIE 4HR7B 3Q69A 3AE6B 1SNOA 4F7XA 3ZYYX 2X6GA 2ZT9C 1TY2A 5JVG3 3KBXA 1H9RA 3E0JA 3JAML 1KFYB 4EQNA 5C0XI 1TWCB 2KECA 5EKIA 2A68C 5F2DA 1OFFA 1HUMA 2WINB 3QJYA 3FVQA 1JC7A 2BCOA 3P7JA 1Y1VB 2BDNA 3J7YW 1Y56A 5JEAJ 2XIWA 1EM7A 1GHKA 5C4HA 4A6QA 4EGVA 4IUPA 3P42A 1Y1WB 4IUVA 3MFYA 2OT2A 1CA5A 1JR0D 2QSDA 3LWUA 2VB2X 3ITPA 4J8QA 2NVQB 3OWFA 4KKSA 3HEJA 1GB4A 5M5WB 1V1OA 2F0WA 1Q3LA 1HUNA 2GRIA 4KY5A 3SK4A 3RUZA 4IUQA 4FXDA 1GOZA 1STHA 3C1EA 1YNJC 2F0PA 3IT4B 1YN3A 3I4MB 2JXMB 1GJXA 1DGJA 4OGQC 4YSXB 1G2SA 1PTOH 4DNRB 4R3DA 1F9PA 1IKMA 4IFDJ 1IW7D 2WP9B 4K8IA 2KA7A 4ZUJA 3TP6A 2CU3A 3KUPA 2K5WA 1B4OA 1PRTF 3PIO3 3HOXB 4ZRZA 1WTXA 2AQ2B 4M1UB 1GUGA 2LKVA 3HS0C 1RF2D 2V3NA 1LLRD 1F2RI 2JA5B 1B53A 4ZQ3A 2B2TA 2SOBA 4ZLTF 3NWTA 1SMYC 3I4LA 2IGGA 1PLFA 2WAQB 4KK7A 3U2SC 2SEBD 4D2KA 1YJIA 4WIPA 5CORA 5EE1A 1QKZA 1NCVA 4JX1C 5HHDG 2EYPA 3OSOA 3S15B 3VYSA 2FBWB 3K7AB 2W82A 3PIP3 1TJEA 1UGJA 1PUTA 3J81E 4CKCA 2M2LA 4A55A 1U4RA 1B2TA 4K5VA 2K5QA 3UI2A 3VRBB 2Y5PA 1JALA 1TVXA 3FPPA 5IODA 2I2YA 1LTTD 1FNWA 3PUVA 1SB3C 1F2YA 4OZBA 4OZCA 3OOCA 2F0QA 2LJIA 4OL7A 1GUWA 2HCCA 1FMAD 1CTMA 2NWGA 4ZHOA 3P1HA 3X3MA 2QDBA 2EY6A 3A55A 3DHQA 4MH8A 1CZGA 1JICA 2H4OA 3VRAB 1NR2A 1EY0A 1L4ZB 1FD6A 4XE0A 2KHSA 4I7ZC 3IFTA 3W1SA 1PGBA 1IHZA 2E6XA 2IDYA 1QG7A 1Q10A 5CBAE 1SXTA 4RNAA 4OW0A 5FR3A 1TS2A 2EYLA 2A69C 3URYA 3CWIA 1E0BA 3SDZA 4Z9CB 4L23A 5H8YE 4YXDB 4HMIA 4DFAA 5C6AA 1F2LA 5M9OA 4Q5VA 4B0EA 1QE6A 4LLGM 2F0EA 2F0LA 4UDUC 5JEAH 1FNUA 2BB6A 4C3HG 1ZDXA 5EQ0A 4Q2JA 2LHEA 2IW3A 1CQVA 1OQRA 5KNCA 1R7SA 3QOLA 3A56A 3TDQA 1WD0A 5IGBA 4RGNA 2H1EA 1X3PA 4C1NI 1EL0A 3NS1A 3T53B 4YSZB 1EZ8A 2RBMA 4KKUA 5KEEA 5KYLA 5T1IA 2JYTA 2MEKA 1UNSA 2ZXPA 3TZUA 4B9WA 1JOKA 3AMZA 2B2UC 4C3JB 1EY8A 1VZ6A 2INPE 3A7LA 4DAPA 4FXKC 2KCCA 1D5XC 3D4RA 4XWTA 1EZ6A 2QKIC 1HTPA 2F0IA 3P63A 2ONQA 1ZYRD 3C8YA 4G4KA 1TZOA 3S17B 2A68D 1PGXA 2HDMA 5M5XB 1RODA 5CV7A 1IL8A 5EPKA 2GB1A 1EYAA 3BZDB 5BYQA 4XQNA 5C5MA 3S1MB 3Q8EA 3NVZA 4A3IB 3N52A 2WACA 1HHVA 5BMHA 5FO8B 2KEDA 2KAJA 4F87A 1D5ZC 4BA1I 5JVH3 4NJCA 4JWSC 3PO2B 1IBXA 3IAYA 2MJ3A 3L9AX 5I6WA 2QEJC 1B9RA 2R92B 1KDBA 3SR1A 2IGDA 3TEXA 5E4WC 1HQRD 1QB5D 2V4IB 5EBCA 1SYDA 3G6JB 2RSOA 3KLSX 4RGTA 4BA2I 1EWCA 2EE1A 2OF1A 4WFN3 4LTUA 1WXQA 2K01A 3RMHA 4X3KA 1NENB 2DNEA 3TN2A 1PRTC 1ZPSA 2DWQA 1DJRD 1WTQA 5IOCA 1C4CA 2K5PA 2F0FA 3MFGA 2AWNA 1WD1A 1WGKA 1C79A 3CRKC 2LMCA 3K5LA 1KNAA 3AE5B 1OXSC 1RD9D 3RD4A 4PMWA 4QB4A 1SMYD 5JPNC 2WXLA 4RCOA 1ENCA 2A6ED 1F9RA 3BVMA 3GTOB 2EYJA 4A8XC 5ELFA 4RGMA 4H2AA 1Z47A 1FXAA 2KOLA 4EQPA 4QF4A 2JX5A 3U52E 2L4NA 2F0GA 3W5UB 5LL6S 5EPLA 3VR8B 1WTOA 2W3RA 4ILWA 3GQBA 1CHPD 3E5SA 2WU2B 1IKLA 1PXUA 2EZVA 4YIJA 2IWHA 4RF1A 3OPOA 1UAPA 3ZJTA 3GV6A 5JXVA 1EY6A 2B2VC 3GS2A 2M19A 1B44D 3M3YB 3NUCA 1V1PB 1PZJD 2WDRB 3E9SA 5T1GA 5KIXA 3SHLA 5HGTA 4GDLB 3VR2A 1L5PA 1DOYA 5IGCA 1QILA 2JP1A 2BS3B 1O7YA 3OIPA 1RFKA 1LO5D 4FO2A 2R3ZA 4F88A 2K9XA 4X3UA 1O7LA 2B2YA 3U9OA 3Q8AA 1B1ZA 1Y8PB 1Y69U 4G7OC 3MEHA 4WQMA 4ARCA 1AN8A 1V97A 1STBA 4KX6B 2L11A 2VZKD 1V8CA 3EA6A 3Q8BA 4FXCA 2DBYA 1YQ3B 3Q24A 1I4QA 1JB3A 5CV9A 2TMPA 2A69D 1KH0A 1JRPA 1DYQA 5FO7B 4KKTA 3NSWA 5G3LD 3B2GA 4PV1C 2EY5A 3DWPA 1CA6A 2SAKA 2RDGA 4ID6A 5C0XG 5D3IB 2LFNA 3C2PA 1EYDA 1J8IA 1IW7C 1RJTA 4NP5A 3NRZA 2F0UA 2PW7A 4IN3A 2KUMA 4RKLA 2PW5A 4C2MB 1GUSA 2N9KA 5IGDA 4A3DB 3BYTB 1NVID 1JE4A 1OO9B 3HOUB 2FHTA 4H13C 3WDNA 1QNUA 2B76B 2B63B 4P16A 5A2QE 1C76A 1QOGA 4QMGA 1N61A 1MGSA 4QIWB 1L0YB 4KN7C 4MM3B 2F3VA 5MPOA 1EQTA 1PTOB 3ZJVA 1EOTA 1FM0D 3Q6SA 3T51B 2QILA 2EYHA 2F1MA 5KNBA 2DY7A 4GZYC 5BYRA 4OO1H 3VR9B 5BN3A 1JQ4A 4XQJA 3T3OA 3AH7A 1ZKOA 5LL6X 2F0TA 2BS4B 1STEA 3P20A 5DM73 2WXNA 4ZKCB 1DXMA 2BE5D 3K6OA 3CKIB 4N6EB 4L2YA 4H44C 3GV3A 1VF7A 4GDKB 1ESRA 4MHEA 2JA7B 4BWGB 3H6MA 3SK6A 4A9AA 1T6BX 1BMLC 1C9FA 3T16A 2N7JA 2QMTA 1RHPA 3TSSA 5CV6A 3B2FA 5C3EB 4HKQA 1E6EB 1JWAD 2B2WC 2WDQB 1JWMD 2NVYB 2ICIA 2NMQA 2WXIA 2SNSA 2BOSA 2KACA 4JPSA 2LFIA 3EQLC 3S9WA 5EJWA 2AQ3B 5G3LF 3AEFB 1RCVD 1N60A 3KLRA 1Y8NB 2IT1A 1I7HA 3NK9A 3TEZA 5EKLA 2PVOD 3J9CA 4DN4M 4ZUIA 4IUNA 1XLQA 4JBWA 4FVMA 4FF4A 2RQXA 3L7ZC 2KCNA 3I90A 3LX0A 4DNTB 3AEAB 4R8IA 1XEEA 3D6WA 5I9OA 4BS9A 1BCPB 2PPBC 3GTJB 5M3MB 2E2IB 1OQQA 3NBHA 1IBXB 3M7NA 4HSVA 3VR4A 3QWNA 1DOXA 1NSNS 1S5BD 1STGA 2BB5A 1FO4A 1DM0B 5D65A 1TR5A 4XTCS 5AUKA 3V96A 2A6HC 1ZYRC 2JSOA 3J80L 2ICEC 3OWEB 4ZK9B 3AE4B 1NUCA 4L6TB 1E2WA 2V3PA 4OVZA 5TSSA 1SFOB 4TKOB 3RZDB 1SNCA 2VB3X 2RSNA 3GTMB 1UUPA 3QIAA 1SNQA 4L63B 1C8CA 4QUCA 3AV8A 4FF3A 3KQ4A 1KDAA 2WQYB 2KQ3A 1ENAA 2PLPA 2HUGA 3BDCA 1K52A 2LMCB 4C3IG 4BY7B 3DWQA 1RM6C 4HAEA 4ZYSA 2BTEA 4CJ2C 1H9KA 2L52A 3NQTA 3EROA 4A3KB 3P75A 5D14A 1F2ZA 4FF1A 3M85A 2B8FA 4YWGG 2KWDA 4MIUA 4L1BA 2K28A 3H3VC 5EKKA 2C5CA 1CHQD 1KRHA 5LHY1 1AYFA 2J7ZA 1T5XD 1BOSA 3PUWA 2WXGA 1TY0A 1GXDC 1LT4D 4U68A 2J42A 2K7VA 3RZOB 1DOKA 4WH4A 2NN6G 1WVLA 3CQZB 3ND8A 2XRSD 1Q1BA 2FUG1 3NTKA 2KVMA 1XYIA 2A6EC 1PTOF 4BBRB 4K14A 4OO1I 4YSYB 2YU9B 2D9UA 2QF7A 5E3FA 4TQ1A 1E0ZA 1YNNC 4RAUC 4C1NK 1NI3A 3WOFA 3AECB 2N55A 5E6JA 1WCMB 4ZRPA 1HA6A 4XQQA 3BS1A 1BO0A 3SE0A 2PTLA 2MJEA 3M7GA 1J7CA 4KTAA 1S5ED 2Q5WD 2RPVA 3PZ7A 2WS3B 4R8NA 3CU7A 2L83A 2O5IC 1ZXTA 3SXHA 4YTNB 3U9SA 1IUEA 1F2RC 3VR6A 1LTBD 3GB1A 5FLXE 5C44B 2WXFA 4K6LA 5JJZA 1I4PA 4L8JA 4UAIA 1VR9A 1PYWD 1C4PA 1S5FD 4TRDA 2G9DA 3A54A 3NP8A 3DEPA 3NVYA 2R7ZB 1LT5D 3U7ZA 1U4PA 2PZUA 5EGTA 1GHJA 2OEDA 2L9HA 5BN4A 3PZ8A 2INNE 3NPPA 3Q8CA 4KGTA 3EGRA 5BMIA 2WP8J 3Q22A 4CHTB 1I4HA 1WWTA 3K5MA 4G7ZC 4RKBA 3BDOA 3Q8FA 3GTGB 2AWOA 3RPFC 2BT6A 1TWGB 1EY4A 4S3SA 3X3NA 3JAME 4LK1C 1ZDVA 4WAFA 1IYUA 3ZGZA 3MTSA 5NUCA 3GTQB 5GXGB 5BYSA 3K5OA 2M0AA 2B2VA 5K5PA 1JW9D 1B50A 4CKBA 2JA8B 1BCPF 2K3UA 2AUKA 5I9PA 4B08A 1VZ7A 1SNDA 3AMUA 2H89B 3CIRB 3NTHA 1H9SA 4KGSA 2EKIA 4DF7A 3M4YA 4KI0A 2DY8A 1TKYA 1LTGD 1VMPA 3FILA 1Z7TA 4PT5A 1ACCA 2F0SA 3FPUB 2VUMB 1JMLA 3TP8A 3MP9A 4DAYA 4OIJA 4TQ0A 5K36G 5JEAG 1ZEQX 2O5JC 3K57A 2A6HD 2CJNA 4K8JA 3ONAB 2PZWA 4FXGC 1Q12A 2FJ2A 1KTKA 2FFKB 2O4XA 1FFVA 1STYA 1EU3A 3NVVA 3FRPB 5M5YB 5ELCA 2E76C 4K5XA 4O1NA 2KJXA 4XYQA 2KDMA 2E2JB 1PFDA 1VF5C 1GUTA 1SIJA 2B2TC 1ZE3D 1U4LA 2BE5C 2PYKA 1TKGA 5JPMC 1AW7A 3BK1A 1BBXC 3BDLA 4KV6A 1QLBB 1JQYD 1K83B 4IFDG 5EE0A 1VRAB 3D4DA 3ERQA 3FDTA 1QCBD 2CVRA 4RHRA 1K50A 3NUHB 2E3TA 3OIQA 2F0MA 3NE5B 5A2QL 5G5HA 2WKCA 1NAPA 2K32A 5HFYA 1SNPA 1D1KA 4USAA 3KBGA 2TSSA 5DM63 2NZ1D 3QOJA 1TYGB 2W54A 5EE3A 2FMMA 4HMJA 1MHXA 3S2HB 2NVTB 4LK0M 3ZJUA 4BY1B 5I4DA 4E6IA 4H0LC 3B9JA 2PO4A 1CQFA 4A3EB 1Y8OB 3IT6B 4NKLA 4KJNA 1SJED 4KJOA 2KQ4X 2F4IA 1XCQL 1PTOC 2X69A 2OEOA 2PMVA 3CRLC 2WXMA 1YNND 1BDOA 1VZ8A 1L0VB 3BVZA 2ZW0A 4HRSA 3AN1A 1DONA 4US8A 1FGBD 3BG3A 2F0JA 2IX3A 5I2XA 1BXTA 4P6VF 1LT3D 1A2UA 4A3BB 1JWSD 5CR3A 1FD7D 2FE8A 3QG1A 4KGRA 1AP0A 3L4PA 2HDLA 1PMRA 1IYVA 1M8AA 1AZQA 2Z8LA 1JWUD 1SYBA 4K2LA 2CQAA 2B2WA 5IT9L 1BUVT 1L0XB 2JE6I 2F03A 3KWVA 4WURA 4JK1C 3AB9A 4IUUA 4LJZC 4V0BA 3V3XA 4PMBA 1PZKD 1A15A 1NYQA 3ZQ4A 1MVKA 3I70A 2QCPX 3D3RA 1RWSA 4HEDA 4RA8A 2CJOA 1ICWA 2AUJD 3GTKB 1ROEA 5HURA 4U673 3KWLA 4ULLA 1UEAB 3ABVB 2AX5A 1KAAA 2JYEA 2OHFA 3EVQA 3HOVB 1E2ZA 1NEKB 5DNFA 3MJ5A 3SFEB 3GTPB 2WV6D 1U9RA 2Q8RE 3GD7A 1D5MC 1SE2A 1BCPC 1GUNA 5CMDA 1WTVA 1YNTE 1L4DB 5KGUA 1EYCA 3DXJC 3P4QB 4M8AA 2RKSA 4ARIA 2CW0C 3I72A 4X3TA 3P4SB 4ABNA 3CHBD 1BR9A 3IL8A 1EY9A 1A70A 1OXTA 3AE8B 3TZDA 1GB1A 2Q8IB 1SSOA 4C3JG 1PRTB 3HOZB 1DCZA 2EJFC 2Q8TA 2EY1A 2J53A 4KY7A 2K03A 1YN4A 4HROA 1SJHD 3V05A 2Y3AA 4XT3B 4K5WA 4PQXA 1DZ1A 4US9A 3C1FA 1LTRD 2NUCA 1HZ5A 1TS3A 2A5HA 3AU7A 1E7PB 2MJDA 5EPJA 4AS1A 5FOBB 4EVOA 4TMAB 2LY7A 5G5GA 4A3JB 3DEOA 4J6HA 3EUB2 2BYTA 1ZXHA 3MHBA 1N5WA 4XIGS 5FKAC 4LAAA 4DK0A 2A74C 1J9OA 4OHJA 3T3NA 1SYCA 3NBIA 5FK9C 2EYMA 1HA5A 1YMHE 2XWBB 2L0CA 3VYUA 2WDVB 1X3QA 5C3WA 4RGOS 4HTHA 3R3OA 4JWUC 1SYGA 2Z4HA 3C46A 2W55A 2HQEA 3GP7A 2K04A 3PUYA 1I50B 2DNCA 3E56A 3FILB 5ISRA 1G2TA 4AQ7A 2NTTA 3MA2B 1MBYA 4RCNA 2K22A 4OZAA 3SVMA 3J81L 1HQMC 2MPMA 4CBVA 3VQIA 4H7BA 4N9TA 3K5NA 4GLSC 1CZWA 1IGDA 1TKWB 4FYDA 1PTOD 3QB3A 4ZOHC 1EEID 2EVBA 5C5LA 3V2TA 1ONLA 3UI3A 1DOLA 5C3XA 2B2YC 1TWHB 3IFDA 1M4VA 4MACA 3K0YA 3KF8A 3C3LA 1QT9A 1SEBD 4C56C 1I4GA 1XLNA 1F9QA 1FEHA 2R93B 3L3OC 1F0ZA 2XN9C 4C3HB 4K6DA 3I9V1 4EQOA 3D31A 5ELEA 3I3CA 2WXPA 3I91A 4ZKBB 3R93A 1TQOA 1HCZA 4OIKA 1SE3A 1BF4A 4DGZA 4CJ0B 3DWGC 1LTID 1I6VC 3N6RA 3S1QB 2N9LA 3O13A 5J1ZA 3HRZC 1YN5A 4B9XA 2ON8A 2E2DC 1VMCA 1K8OA 4R9WA 1V8QA 1XX8A 1ENFA 3TP5A 1HFGA 1Q1EA 2BBCA 1IGCA 5AFWA 2JA6B 2ZW1A 1XLOA 3GTLB 2N88A 3MXUA 1I3QB 2KMMA 1AZPA 5E4XA 4HCSA 4WRDA 3K59A 1JCKB 1II3A 3OHXC 4KKJA 2JZPA 2XRQD 3LB8C 5IIFA 3HVZA 1SSNA 4B0MA 1U4MA 5FO9B 4F8MA 3K58A 1L6UA 4KD3A 1C77A 2PQEA 1STNA 1DOMA 3VA5A 4FF2A 5EBDA 1JOOA 2WB1B 4CKEA 1TS4A 3P1MA 2L1BA 1T3QA 1ZP0B 3BK2A 2J52A 3W5VB 2NN6H 2F0OA 1V1PA 2WKDA 2HDEA 1ILPA 2B2UA 3U4EG 1E2VA 2G9HD 3AEEB 1BCPD 2E74C 2WXQA 1HEZE 5DEHA 3FC4A 3DMUA 5J22A 1FCCC 1TT2A 3Q23A 3FAHA 1F2MA 1N5XA 2CW0D 2R61A 1EFID 3NXWA 3H94A 3DWMA 3RLFA 2F0DA 1EIGA 4PMCA 4HKZE 2ENBA 2EJMA 1CJEA 5CC4A 3HVDA 1AWDA 2MH7A 4XDCA 1ET6A 1DD2A 3DWAA 3BWUD 1SNMA 3HKZB 2PCFB 2E2HB 3NHHA 2MGSA 4Y7NB 1RDPD 2HTME 2H88B 3PMFA 5CGKA 3GO5A 3OMGA 3LWEA 3HUIA 2ID0A 1LTSD 1FR3A 4G57A 1K8MA 2PW9A 1PFMA 2AQ1B 2YYZA 1ZOYB 3NZ3A 2WXOA 2V4DA 1RKNA 5T8IA 1YQ4B 3W9CB 3WCQA 4K2KA 4C80A 3IXSA 3VYTA 3TBIB 4P2CB 1WSPA 3H91A 2J4XA 5I6YA 3A7AB 1CFMA 2PVGC 2JEBI 2D2CC 3LXFA 4FNFA 4MT5A 1QF6A 1GAQB 2NBFA 3P4PB 1A6XA 4KY6A 4ZAIA 3RFZB 4X3SA 4DA2A 3MVVA 1J7AA 2B39A 1MI0A 1HPCA 3J7AF 3AE3B 4ME5A 5C2TB 1L6VA 3PUZA 3H8HA 1FNVA 4NAWB 1MHHE 2L12A 3OMCA 4J3OD 2KEEA 2LUMA 3FMCA 1EWHA 3T56B 1WTRA 2RVLA 1QQRA 4N59A 1R4PB 1S4ZA 4KHVA 1LV9A 2IPKD 1KNEA 3HOWB 3J80E 2IX1A 3S16B 4NZLB 1FFUA 1MD2D 2QIEB 4A3GB 2WXRA 5BN5A 1MI2A 3AE2B 3TUOA 2FMCA 4XDXA 3HOYB 2FINB 1HZ6A 2DYMA 2XVSA 1HFNA 4YTPB 2HCIA 5HI1A 1QOBA 1G91A 5K36H 3DUZA 3MXGA 1PZID 2XNAC 4PNYA 4CGYB 1JROA 2QJLA 1TWFB 3HP3A 5IGFA 4V190 1NR4A 3ETRA 2XSCA 1RTNA 4TSSA 3AE9B 5C0XJ 2EYFA 2RDFA 5I2YA 3I57A 1SDFA 4QUFA 4XXEA 2BS2B 2YEPB 2I46A 3MC0B 3TP7A 1WRIA 1RTOA 4DXGA 1PGAA 1SE4A 3KK7A 3SK8A 1TIID 3IKJA 1N62A 2Y0SB 2EELA 1ESFA 1STAA 1KF6B 1QJOA 4IALA 3G7LA 2WNMA 4IQZA 1ZXIA 3FEWX 2EOTA 2D5DA 3AE7B 2LS01 5D7GA 4IFDH 3IAM1 4ODGA 3A8IE 3AE1B 3MXPA <