2AQ3B

Crystal structure of t-cell receptor v beta domain variant complexed with superantigen sec3
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
234
structure length
234
Chain Sequence
SQPDPMPDDLHKSSEFTGTMGNMKYLYDDHYVSATKVKSVDKFLAHDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKDGKVTGGKTCMYGGITKHEGNHFDNGNLQNVLVRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T-cell receptor beta chain V
publication title Structural basis of affinity maturation and intramolecular cooperativity in a protein-protein interaction.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 64
structure length 234
sequence length 234
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2005-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
B PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2aq3B02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2aq3B01
1SEBD 2QEJC 1LTAD 1LTBD 1ET6A 1HQRD 1SBBB 2TSSA 1HTLD 1EEID 1FNVA 5ELFA 1BXTA 1KLGD 1LT5D 1I4RA 4RGNA 1RD9D 3BVMA 2QILA 1LT6D 1SJHD 2O2LD 1B44D 1JQYD 2AQ1B 1L0YB 1SE4A 3BZDB 4OHJA 1ET9A 1QILA 1TS2A 1SJED 3MFGA 1RF2D 2NTSA 1HXYD 1PZKD 1FNUA 4K6LA 4RH6A 1I4XA 3V05A 1PYWD 2WV6D 4UDUC 4C56C 1LTSD 4BWGB 1FNWA 1CHQD 1BCPC 1LTGD 1RCVD 1EEFD 3SEBA 1LT4D 1PTOD 2AQ2B 2XNAC 1PRTB 1S5CD 4RGOS 3CHBD 4L6TB 3DWPA 1PTOH 1FGBD 4L63B 1CHPD 1PRTF 1LLRD 1TS5A 3BYTB 5ELBA 1V1OA 1YN4A 1SE3A 1S5BD 1AW7A 4RGMA 1V1PA 3EA6A 1UNSA 3BYYB 3TSSA 1LTRD 5I4DA 4DXFA 3URYA 1DYQA 2RDHA 1BCPF 3DWAA 1PTOC 2CHBD 5FK9C 1EFID 4ZYSA 1ENFA 1L0XB 1BCPB 2XRSD 1I4QA 1TS4A 1TS3A 1I4HA 2AQ3B 5ELEA 1PZJD 3KLSX 1HA5A 2XRQD 1G8ZD 5ELCA 1MD2D 5FKAC 1D6EC 2IJ0A 1D5XC 5TSSA 3R2TA 1CT1D 1UUPA 1LTTD 4O1NA 1TY2A 1SXTA 5D3DA 1PRTD 4NZLB 2XN9C 1YN3A 4RCOA 2SEBD 5D3IB 1RDPD 1F77A 1JWSD 1STEA 4RHRA 1CQVA 3MC0B 1D5ZC 4RHSA 5ELDA 1S5FD 3OWEB 3W2DA 1GOZA 4DXGA 1EU3A 2Z8LA 1TY0A 1EU4A 1T5XD 1I4GA 4RFBA 1PRTC 2RDGA 1JWMD 1EWCA 1DJRD 2J4XA 1B1ZA 1XXGA 2ICIA 2IPKD 1S5ED 3BVZA 3R2IA 4RGTA 1BCPD 1AN8A 1KLUD 1LT3D 1D5MC 3DWQA 1JWUD 2NTTA 1YN5A 1PZID 2G9HD 1M4VA 1SE2A 1V1PB 3R8BA 1JCKB 1PTOF 1CK1A 3GP7A 1XTCD 4TSSA 3BVGA 1FD7D 4Z9CB 1I4PA 1JR0D 1PTOB 2R61A 1S5DD 3EFXD 1KTKA 3O13A 1LO5D 1ESFA 1LTID
chains in the Genus database with same CATH superfamily
2BCOA 2L4NA 5E6JA 1SEBD 2KQ3A 1TT5B 1KL9A 1AE3A 2FCQA 1GB1A 4FHKA 2VB3X 3VYTA 1HNZL 4BKSD 1T5EA 1KLGD 1N34Q 3AFQA 5E7NA 1RD9D 2QILA 2R92G 4JI6L 2JZZA 3CRKC 1L2FA 4EGVA 4KV2A 4KK7A 4HCSA 2ZT9C 1SE4A 4PZ7A 2FAZA 2KN4A 2LXKA 2EDGA 1PV4A 2INPE 2RBMA 2JX5A 2MEKA 1SE9A 4A93G 3ND8A 1X6OA 2KTRA 1RF2D 4KD3A 4KY7A 4NXML 1PZKD 2P5ZX 2XWBB 1Q12A 3D4RA 3JYUA 2IBIB 2MJ3A 3BINA 1V5TA 1G51A 1VQJA 2F0MA 2SNMA 2EY6A 1GM5A 1NCVA 4DAYA 4S17A 4QJFA 2G9DA 1M90C 4NNJB 2BB5A 3ZJUA 4HDOA 4K7WA 4K8JA 1SB3C 3H6NA 2NVYH 2BTEA 3FKYA 4RKLA 1PRTB 2RSOA 4RGOS 3SVMA 1TWAH 4NB3A 5JJLA 2W82A 1NE3A 3QOLA 2Q8TA 2VQFQ 1IBLL 1ZYRD 1FEHA 2KQ7A 3VHTC 2F0DA 4JI8L 2O6VA 5FR3A 1JMLA 1YN4A 3HZXA 1KRTA 3TP6A 4BKGA 4RGMA 4FF2A 2L00B 2RSNA 2Z4IA 4JBMA 2N55A 3Q23A 4J8QA 4JG2A 3HOYH 1J6QA 2WIIB 2KEEA 4G7HC 1TJEA 2O2VA 5E6PA 3GQBA 3KOJA 1RJTA 2EXZA 5FK9C 1PGBA 1L1OC 5KYLA 3BK2A 4POFA 4JX1C 1YHAA 2F0KA 1B70B 1TQOA 1KNAA 3A74A 3NELA 5M3MB 4A3GB 4J6IA 4DV5Q 4ZRJA 3I4MH 4LF7Q 3CWIA 3K5OA 4CBVA 2LUEA 3WOFA 2JU6X 4MM3B 5C44H 1WR1A 1O7IA 4JI0Q 1F52A 4HPPA 3AEEB 3GV3A 3S15B 2KJ6A 4RCNA 5C5MA 3ZYYX 4CKEA 3MHZA 3C46A 5K5PA 2JA7H 4YIJA 3CU7A 2D3AA 3MA2B 5CHWA 1K9MC 2LHEA 2UUBL 3GTLB 1YIJA 1HZ5A 3NTKA 1YEZA 3L13A 4YSXB 2K8CA 1X9NA 2F3WA 1DD2A 2KLCA 1MSHA 1SNMA 4B3TQ 4NMZA 2N4FA 4DR1L 3ZKJC 2YV5A 4DXGA 4A3MG 5JHAA 1IBXA 2PPHA 1BBUA 3KLRA 3PO0A 4GU2A 1F9RA 4DPGA 3AE3B 3RZDH 3VYSA 3NG0A 3DDCB 3EUB2 2KX0A 3N52A 2LD9A 5M3FG 2K50A 2NN6I 3BG3A 1OQQA 5D65A 1P16A 1RKNA 2A6ED 3APDA 1WCMB 3P4RB 4ITKA 3L10B 4I7AA 2ZPNA 3ZTCA 4U673 5JEAG 2VW9A 3R8BA 3NHHA 4WIPA 1CK1A 2L32A 4A75A 2N49A 3WDNA 2ASQA 2WXJA 5JZEB 1XTCD 2WKCA 3PUYA 1IGCA 1K52A 2BW2A 1KIXA 1GO3E 4WH4A 2IGHA 2JA5G 2R92H 2IHEA 3IAM1 2FINB 5CV9A 1ICFB 2CR5A 2H5XA 3D3RA 4WJNA 5AUIA 5DEHA 2LFNA 3P75A 4WORA 4A93H 5J39A 1DXMA 3PO2G 2IX0A 2LEKA 3KYDD 2K0PA 2EZVA 2ICEC 2B63B 1NYRA 3A8IE 4LNOA 2DNCA 4M8NA 5KNBA 4RF1A 3AMZA 4KKTA 1CA6A 3HOVH 2KFKB 1DOYA 1C78A 1K53A 1IUEA 2LHDA 2L1AA 5L83A 2F0FA 4N9TA 4A3JH 2RDFA 4JI2Q 3LWUA 4IW0A 1OQRA 4YXDB 4A3OA 1S40A 3ZNGC 2XBBC 1JWBD 3QHTA 4PG3A 1UBIA 5JEAJ 4DF7A 1XLOA 4P73A 2MBHA 4YSZB 2FIDA 4YY3Q 3RI7C 4USAA 4XQNA 4IWQA 2NVXB 2KK8A 2BA1A 4TQUS 3M3YB 1FYCA 1XO3A 1A70A 4JPBW 2K6DB 3VQIA 5JVG3 2D07B 3S1MH 4DR6Q 4IOAA 2CJNA 4KGTA 2F0LA 4IPHA 2INNE 3WAPA 5C4XB 1YHQA 4QL5A 2NWGA 3EA6A 1WJNA 4WFN3 2I46A 4MTNA 1I6HH 2I38A 4BS9A 3TSSA 2AKWB 4DV6Q 2WB1E 5G5GA 4DXFA 2HQLA 2KWUB 2WFWA 1K83B 2MFIA 1E7VA 2N9PC 2GN5A 3IG3A 2OHFA 4A9AA 4HSPA 2R7ZH 4MSQB 3I55A 1A62A 1UE7A 4OWTB 5M5XH 3NQTA 3UE1A 1VQ8A 4JI5Q 2DJFC 4KJOA 3D0FA 2E2IB 1NAPA 5IYBG 2F0HA 3CD6A 2MO1A 2DLBA 2IX3A 1Q86C 2L8JA 2FCSA 2KECA 3S2DB 1SE8A 1IGDA 5AEKB 2WXIA 1QOAA 2CWPA 3JAMc 3E5SA 4EX5A 3RLNA 2MNAA 1SXTA 2WS3B 1HZBA 3NUCA 2F0QA 1EIHA 1FFVA 1JB3A 1X3EA 1A3TA 1QJOA 2XVSA 4QAYA 3H7PB 3A1QA 5E4WC 1CQVA 4B0EA 5TR5A 5JEAH 3ERQA 2R6GA 3S14B 1VQIA 4C1NK 2MUYA 3NBHA 2K14A 4B3SL 1YNND 2O5IC 4DV3L 3L3OC 4P1BC 1DJRD 4HJKA 2BF8B 1YJ1A 4AQYQ 5KNCA 2MW5A 2KDEB 1KLUD 4ANUA 4C3JH 1H9KA 4G7ZC 1D5MC 3S1RB 3HKZB 3NVVA 4LFAL 2JA9A 3VUWA 3HFZB 3L0WB 2KQSA 4S0RA 1GKHA 3K81C 2VUMG 4TSSA 1GC6A 3L0OA 1ZPSA 1P0RA 2ZJQA 1MKHA 2NB0A 2WX0A 2WP8J 1JR0D 2KHSA 3PO3B 1XD3B 4UY8C 2KYWA 2MQJA 1ESFA 1LTID 1TS3A 3MVVA 1YITA 3GOEA 3U4VA 3AU7A 2YU9H 5C6AA 3CC7A 2DJGC 4IPCA 4HCEA 3NWSA 1GD7A 1NBWA 3HOWG 4OEMB 4MIUA 3DEPA 1MHHE 2JN4A 2WAQG 3BVMA 4PMCA 3AEFB 1LT6D 2UUAL 4R4OA 2O2LD 2HQEA 4G4KA 5EKIA 5EPLA 4C2MH 4A3FG 2UXBL 3K5LA 4IO9A 1VQMA 5GMVA 3V6EB 3HOXH 3F2DA 1M94A 3WIMA 4FJYA 3EC8A 3S1NH 3KUCB 5C4HA 2NTSA 4NDXA 4PNYA 2BWES 3N9YC 1E0BA 1PYWD 5M5WH 2M17A 2NVTB 4WJ4A 5I6YA 3DOWA 3PZ7A 1DGSA 2KZRA 1UE5A 4LWCA 3TMEA 3D6WA 3H8HA 5ELNA 2Z0EB 2LGXA 1QCBD 4LF9Q 1VQCA 2JVCA 3KYHC 2E76C 4FADA 4QB4A 1ASYA 1VQNA 2LRWA 5D2MB 3I63C 3AEDB 1EO6A 4HK2A 2DUDA 4JI1L 2D11A 4KY6A 1L4DB 3TBLD 4AUQC 4CO7A 5M5YB 3PTFC 5LLIA 1DGJA 1E8YA 4GN5A 5IT9c 4B3ML 3DBRB 2CQAA 2WP9B 5LMNL 4IUMB 3DWAA 2AX5A 4LF8L 3S2AA 3VYRA 4HJAA 1EUJA 1T3QA 2UUCQ 4ZYSA 3DWMA 4BOSC 3VUYA 2BOSA 3BJUA 1WMHB 2WNMA 4PYUA 1EWHA 2FMMA 4PZ8A 3W5OA 3L2PA 1BR9A 2AQ3B 1Y1VH 2WXGA 1LM8B 1GAQB 4HKQA 2PE9A 3UDXA 4LK0M 1JICA 4N8X1 1SDFA 1SN8A 2EMSA 2QEXA 4R8NA 3V61A 4KKUA 3H0GG 5FKAC 4GN1A 1ZXHA 2OEOA 3VFKA 3R2TA 1E8WA 1S4ZA 1XMQL 5EE9A 4BBSG 4G11A 2L83A 4M02A 5CYUA 2JJQA 3I57A 3CW2C 4ILWA 4BY7G 1MG4A 2LS01 4FXGC 1HR0W 3V3XA 2GBJA 2QHOA 1H9JA 1AWDA 2PZUA 4ICUA 3OAWA 2Z8LA 3NP8A 3CC2A 3OLMD 4KSLC 1Y14B 5JVH3 4XWWA 4PMWA 2J4XA 2WU5B 3N1YC 5C3EB 3BVZA 2B2TC 1C1YB 3PZ8A 2K6AA 5C4ZA 3I5JC 2KNBA 2CHZA 2IO1B 3QJZA 3QJYA 5DNFA 5EKKA 1NJIC 4GLSC 2EE1A 3C8YA 4HMIA 2K8HA 5E3FA 2PW9A 2JA6G 2QMTA 4XYCA 1GUWA 3N6RA 3LGJA 1G6PA 2F4IA 1J7CA 4A3IH 5IGEA 4BBRB 4OGQC 3BDCA 2DZKA 4IUQA 4QIWB 2QGQA 2V0GA 1OQYA 3GD7A 2DAFA 1QZGA 3ONAB 4OELB 2ZTEA 1AYFA 2L0TA 2LXCA 3UDFA 1HHVA 1NR4A 1DM0B 2PJHA 3GTGH 5J17A 2M2LA 1HJPA 2LVPA 4BY1B 4UAIA 3AULA 4IQZA 1WD0A 4LAAA 4C3HB 1F2YA 4OO1G 3DQVA 4KGSA 3AEBB 5BYSA 1TT2A 5IGFA 1EIGA 4ZRKA 4I6NB 4JE3B 3I3TB 2F0UA 2JA8B 3PS6A 3W9CB 2JQRB 3X0WA 3MFGA 1WJUA 5CHVC 1MIUA 1IBKQ 5LMNW 1WM3A 4K6LA 2PI2E 4HEA1 4HJGE 4RNAA 4A3DG 3A9JA 1ZEQX 5J3BA 1EQTA 5CGKA 5HG2A 3RZWC 1C4PA 1JWAD 3BIID 4LFCL 1BCPC 2PE6B 1UWXA 2OJRA 4RAUC 5NUCA 2GLSA 3B0AA 1E2WA 2QKIC 3QA8A 3SEBA 5HI1A 1LT4D 1KD1C 2BE5D 2M0AA 2REXA 2MJDA 3CHBD 4DR5Q 3NS1A 1PTOH 4LF5L 1A3UA 3SU8X 1YNXA 1TGZB 4FF1A 3GTMH 4DFAA 4UP7A 3U9OA 4EQNA 4JYAL 2PEAA 4P1CC 3KQ4A 1A0IA 1V1PA 2DYBA 4NQLB 3WAOA 1Y1WG 1WRDB 1EY8A 4CGYB 2N3SA 2M0XA 4L2YA 2ES2A 1HPCA 1FCCC 1VQLA 1MVKA 1EFID 4WJQA 1QNUA 2AYOB 4HTHA 3PUVA 2JUOA 3EVQA 2VQEQ 1WTXA 4G0NB 1VQAA 1FCLA 1U4MA 1VMPA 3VR6A 2M00A 2XRSD 3AB9A 3CIRB 1V8CA 2F0SA 3HKSA 1Q1EA 4B9XA 4OL7A 3FPUB 3V62A 2C7HA 1XCQL 3G48A 3DM1A 2Y5PA 3PV1A 4X66Q 3AB5A 4AYBB 1XX8A 4H7BA 4B08A 1MD2D 4WRDA 3S17H 4X64Q 4IPDA 1I94L 3HHMA 1F2LA 1JORA 2GB1A 2F0VA 3A8JE 3GTJH 4JGHB 2KBNA 3H7SA 3UI3A 4ANWA 1Q90A 3KF6B 3FAHA 2A4ZA 4JBJA 4FJVB 2YTYA 4IC7B 4OZAA 4C3IG 1Q8IA 3HOUH 5DCNA 3V6CB 4JI7Q 1NMFA 3ERSX 1H9RA 1TWHH 3DHHC 2R2QA 3HVZA 3NHEB 3O65B 1XLNA 2SDFA 1QVCA 5JPMC 4LNKA 1TWFH 4B6WA 1GUTA 3EQLC 4JLCA 3T1HQ 3HM3A 3M9BA 1C9OA 3R2IA 3RNFC 1KQSA 4GSWA 1BCPD 3CRLC 3T3OA 1FVIA 4MH8A 1MPEA 2XEWA 4BA2I 2NBVB 3M62B 1SE2A 4KHVA 2WDQB 3HUIA 4DR3Q 2BGFA 4LJOB 1G291 2PNHA 3RNUA 1P98A 4FO2A 3W3AA 3PF5A 5IP7G 4A3BB 1SLJA 3R7RA 4EQ5A 2L05A 1LABA 1XNQQ 5AZGA 1OXXK 1CKMA 2N8NA 1FXTB 3V2TA 2C5LC 2JYEA 4B95A 1LTBD 1VQKA 2EPBA 1F2ZA 2LI5A 3CPFA 4P7IA 1HTLD 3HIZA 3EHVA 4LF6Q 4LUOA 4LUZA 2KQ4X 1LT5D 1G2TA 4DV2Q 1KXLA 4MM3A 3HGBA 2F4VQ 1IL2A 2JP1A 4RGNA 4IDIA 3HKZE 4OIJA 3I8ZA 2I5HA 3PIP3 3TUOA 1VD2A 1Y8OB 2LXAA 1EY5A 2A19A 4GDLA 3CMEA 3KBXA 4N58A 1OTRB 2K7VA 1TWGB 1L0VB 1SJED 2XSCA 1TYGB 3DHQA 2E2JH 1D1KA 3QO2A 1X1MA 1R4PB 3RN5A 2B2YC 3GTKB 3AEVA 3WCQA 4ABNA 2LMCB 1EQRA 3VR5A 2WACA 4B3TL 4NAMA 1LTGD 1I50B 3FPPA 5BYRA 1PH1A 4LK1C 4A3KB 5DPSA 2L5TA 4MN3A 4OZBA 1BVSA 3SFDB 5FJ8G 2NVUI 5IGDA 4K2LA 2K4KA 4HDQA 4TKOB 2R7FA 1HTQA 2BBCA 5BMHA 2CS4A 3NS8A 2I5LX 2L15A 3I73A 3KBGA 5EAYA 3PZDA 3STBC 2F0NA 2HTME 3VTUA 1U4LA 4DV1L 4ZCKA 1VDVA 1STBA 4K3BA 2IDYA 3VRBB 4DBGA 1G91A 3KF8A 2OTJA 1GC7A 4TQ0A 1SYCA 1LTLA 1VQHA 2K5DA 3ZNZB 2JYTA 4YCUA 2MX2A 2PTLA 2PI2A 2EJGC 2W3RA 3TBIB 1V1QA 1BCPB 2NPTB 2G1EA 4HCPB 1FD6A 1SSNA 3UDIA 3PUWA 4J3OD 4H13C 2N9KA 2EKEC 1JOKA 1LQBA 1QKZA 3JC66 4GOPB 2FJ2A 1EL0A 1GJXA 1STNA 2UU9Q 5DPTA 5GROA 1JJGA 5BMGA 5TSSA 2KFKA 1YIWA 3D32A 4N9PA 3IHPC 1C9FA 1XQQA 4IPGA 3U4EG 1V80A 3NE5B 1C4CA 2WXRA 2XN9C 4DV0Q 1C7YA 1XTDA 1EIYB 4FP5D 4DGZA 1D7QA 1N61A 3SHLA 3TCAA 4JI2L 2KX3A 3PHWB 1A5RA 5ISRA 1E1TA 1VJKA 3P4QB 1TVXA 1VF7A 2A6HC 3APCA 1CQFA 5IE8A 3E6ZX 2LGDA 4ASWC 3UF8A 3HOYG 2ENBA 2JK8A 2MO0A 4KVGB 5LL6S 3X3NA 4UP9A 4X3KA 4YCWA 5D6JB 2YLMA 4PQXA 3I4OA 4X65L 1E22A 3GTOH 2N9LA 3LB8C 2LY7A 1LT3D 4A3GH 5AJ3Q 3DWQA 1RTNA 2B2VA 5M3MH 4DR6L 1C4QA 1YN5A 4YTPB 1M4VA 3E0JA 1WR6E 3SK5A 3TN2A 4GNXB 4HMJA 3RCZA 5T1GA 1LACA 3I4MG 2N9EB 2HT1A 1ESRA 4PZ6A 4DV6L 4MHEA 2C7MB 3S15H 3VR4A 5C44G 3I4NB 3NZ3A 3W1BA 2IO3B 4ARIA 5HY6A 3FILA 1WGHA 3C2PA 4QCLA 1ET6A 4HIOA 1UWMA 1KAWA 1U4RA 4DA2A 1M8AA 1A63A 1YX5B 2JA7G 3GTLH 2JRIB 1VQGA 2OTLA 2L76A 1SNPA 2K75A 4DUYQ 3NVWA 3LNNA 2QIEB 4IUUA 3P42A 4W9KA 3G6JB 4REZA 4KMUC 1CUKA 4QQBX 2IHFA 3CQZB 1ZGUB 1B4OA 3A5ZB 4QUFA 3GE3C 4JC0A 3S2HB 4K5XA 2RD0A 3FDTA 1R4MI 3N3KB 2LZ6A 3RNAC 1GNUA 3N30A 4C4VB 1BDOA 3CPWA 3AMUA 1K8AC 3H7PA 3N1ZC 4LJZC 3OW2A 4QIWE 1XNRQ 3RNEC 3M85A 2F3VA 4ZHPA 1WCMH 4H02A 3DBHB 1FNWA 1T0QC 4G50A 5GQOA 2WU2B 3B1LX 3ZDTA 2CWAA 1VRAB 1RCVD 3PRMB 2QC8A 4R1JA 2QCPX 3QB3A 2AQ2B 2XNAC 2VS1A 1HH2P 5IGGA 4MTKA 1SRUA 4HAEA 4K0KQ 1ROEA 1PH8A 2V3SA 3VR3A 4Y52H 3GDEA 4L63B 2IGGA 2WXPA 4AQYL 1VZ7A 2Z1CA 3OWFA 4YWLA 1N33Q 1WFYA 4GOCA 3PUXA 4N6EB 3PIO3 2D2CC 4ZUJA 5IAAC 3NOBA 5LXIB 1UNSA 2GMIC 2EJMA 4KN7C 5G3LF 2IGDA 1PXUA 1WYGA 3J7AF 3DHIC 3AE2B 1BCPF 1FPYA 2A69C 2B63H 4A3CG 3T4AC 2KEDA 4BXXH 5D94A 1Q46A 3J80L 5FOBB 4DV7L 4ZYNA 2PW5A 2UXCQ 3S1QB 3DVNV 5CHFA 2BKRB 1V5OA 4KHPL 3HOVG 3G71A 4FJZA 1I4HA 3BDLA 1F1HA 3QWZB 4A3JG 2YEPF 3B08A 1ML0D 1CKNA 3PQIA 3CP0A 4X6AH 3BWUD 1OEYA 2JXTA 2H88B 1D6EC 2K5VA 3I91A 3KJPA 1A6XA 1TY2A 2NVXH 5KEEA 2W9NA 3L7ZC 1VQPA 4A4IA 2F1MA 2Z59B 3KDFB 1HZ9A 1ZXTA 3E0EA 3M3YH 4ACFA 2I1JA 3A7LA 2MJ8A 2KFJA 2L0CA 4KKIA 4NW2A 3J7ZC 2ZPYA 1GPXA 2V1YA 4P16A 3TEXA 3TEWA 2N7EA 1VS0A 5C4XH 4C1NI 4LNIA 3RD2A 3EIVA 1JQ4A 1EU3A 1GVPA 1V8QA 4XIGS 3UIPB 1SYGA 3G6EA 4AYBE 2GBMA 2X38A 2HHHL 4O42A 1CKOA 2LSSA 5C3XA 2O4XA 3HOZB 2L0FA 3RUZA 1K83H 2HIVA 2RF4A 3HS0C 2EYFA 1IW7C 1Q8KA 3W1GA 2N88A 1YVCA 1ILQA 1B3AA 4DR7Q 5T8IA 5AFWA 4MSMB 1O7LA 1YQBA 2R7ZG 3A9KB 4LFBL 4IUVA 3LDZE 2E2IH 1K8OA 3PGEA 1JMCA 1OEYJ 5D14A 4FHJA 2WLBA 4GDKA 1N6ZA 4L23A 3KK7A 3T16A 3S2DH 2SAKA 1KH0A 1WMHA 2LGSA 4RMAA 3CAMA 4IKGA 1QUQB 2NZOA 2B2WA 4KD4A 2RVLA 2A69D 1Q81C 4CYEA 2G5DA 4JPSA 3A7AB 2ID0A 4V190 2KDBA 4HRSA 3SXHA 4JI3Q 2GBKA 2GI9A 1K0SA 3EROA 3W1SA 2DBYA 1VQ5A 2X8XX 1E2VA 3K6OA 1YJIA 4HWIB 1JALA 3RZFA 5IYDH 3QAQA 3S14H 3NK9A 1O7ZA 3RN2A 2GA4B 3P1HA 1STYA 3P7JA 1WE6A 2BYFA 1K51A 3H91A 3JAME 1X3FA 2JT4B 3ZVVA 1EIFA 5LMUL 3NVZA 2DAJA 3FKIB 2WDTB 3CCRA 3S1RH 2VNUD 4KIKB 1A3VA 1STGA 4C3JG 2Q2UA 1MGSA 2D2QA 3OPOA 1E7UA 3L17A 1IYUA 1N32L 4I7ZC 1G6ZA 4A3CH 3PO3H 3TJPA 2ALYB 4MDKE 3SR6A 2N7DA 5ELBA 3BYTB 2KN5A 4J6HA 4HCNB 3E3XA 3ZTDA 1GUAB 3L4PA 2KXJA 3M7NA 3S9WA 4L5QA 2DY7A 3IKJA 1SYFA 4A76A 2KTFA 1E8XA 4XT3B 3M4OB 4PS3A 2K52A 3CF6E 4LLGM 4YHHQ 1RAXA 1SIJA 3CKIB 1WI5A 1TZOA 1I4QA 5GAHC 4MH0E 4NY0A 4HPLB 4OONA 2ZNVC 2BYEA 1EYAA 2L7RA 2FCMA 3T9LA 4JI4Q 3HOXG 4PMBA 2ZVNA 3CMAA 1I42A 2VL6A 2K25A 1Y69U 2NZHA 2NVTH 2M1MA 4GGQA 5COYA 4QY7A 4NJCA 3A5UA 1BNZA 4IJLA 3OOCA 5BN5A 4NQKE 1R7SA 4NZLB 1ENAA 1Y56A 3MZ5A 1PUTA 5DAUA 1E5WA 1K3BC 4X62L 4YTMB 4CJ0B 2F03A 1WXMA 2YVCA 4YWGG 4M8AA 1N5WA 3LXFA 2HIXA 3J80c 1RDPD 2ZM6Q 3CF5A 1F77A 2B8GA 4E6IA 1DZ1A 3VR8B 1LYLA 4WWOA 3RFZB 2EXDA 5GADC 3Q3JA 2NBUA 5M5YH 3DVNU 4GMVA 3K7AB 3IFTA 5GXGB 4RGTA 4X3TA 2KCMA 2PZTA 5FO8B 4I6LB 3VH3B 3IL8A 5H8YE 2C5CA 2LJ5A 3U30A 1IKLA 4MGZE 1PZID 1NTGA 2G9HD 2A5HA 1LV9A 5EGTA 4US9A 3GP7A 2O6VD 1SMYC 2C9OA 3TZDA 3MHSD 4IOIE 1Y1VG 2E5LQ 4GIVA 1L1OB 3J7AV 2LASA 4A90A 4EKUA 4ZAIA 1KTKA 3Q8EA 1YZ6A 5IT9E 1N62A 3ITPA 2PO4A 2DZMA 5AZFA 1RTOA 1PH2A 2KCTA 1K8GA 1EEID 3K57A 5ELFA 2HJ8A 3SFEB 5FLXE 4HEDA 3PSEB 5EDSA 5GAEC 1SNDA 4FF4A 2LJIA 1P1AA 1SMXA 1SJHD 2WXHA 2K32A 2XGTA 1FIQA 4IM2A 5C5LA 5C2TB 1KAAA 2GOWA 3KF6A 3BZDB 2N0SB 1SSOA 1KLVA 3CCVA 1Q82C 2KA7A 1TS2A 2Y0SB 1JT8A 3RD4A 5BR8L 1F2RC 5C3EH 1AZQA 1F2RI 3KWVA 1HR0L 4R3DA 5CV6A 4JI7L 4FYDA 1LTSD 4YSYB 2XK5B 1Z6HA 3AN1A 5IOIA 1HNZQ 4N9F4 4W9JA 2HD5B 3SK8A 1K3RA 2MLBA 1R9TB 4TKNA 4FXCA 3QG1A 1ZKHA 2D3BA 4JI6Q 1UGMA 4W9LA 3P20A 2H4OA 1IP9A 1QVGA 1S72A 3H94A 4YWMA 4AH6A 4L5SA 2XIWA 2A73B 2CKZB 2R92B 4AS1A 1WJ4A 4BBRH 1K73C 5L95C 5CTRC 3ZDMC 4UHVA 2KENA 1FJGL 1TIFA 3DBLI 5T1IA 4A3IG 5IODA 1IYVA 1QZEA 2M56B 1Q7YC 1IBMQ 1A2UA 5IO9A 4NXMQ 4A93B 1SIFA 3SK4A 3J81L 3M3JA 2K39A 1YMHE 2KTRB 3OW7A 3OIPA 4FNFA 4L5TA 4BY1H 1T6BX 4AIMA 2ZCCA 4C3HH 3HEJA 2ZVOA 1ENFA 4DAPA 1ZUD2 2NYZD 2D5GA 4KKJA 1WGGA 2JA8H 3IRBA 1IBLQ 2KAJA 4DQOC 1PZJD 4JI8Q 1N5XA 2F0GA 1J8IA 4J1MA 2J0MA 1E2ZA 4NXNL 2DYMA 3AE4B 2O6VB 1IZ6A 3Q22A 3JAMi 3SD5A 4A8XC 1VQEA 4ALPA 2ZTDA 3TEZA 2N1WA 3KVFB 2EYHA 1JW9D 2AWNA 2MH7A 4FF3A 3VTVA 1WF9A 2QF7A 2MP2A 3TEHB 5IWAQ 2E2HB 4ICVA 3MAQA 1FR3A 2X69A 3WOEA 1SROA 1V9PA 3EN2A 1JRPA 1WXVA 1SAPA 4KDLB 3D4DA 2ZJPA 3U50C 3TP5A 1OXTA 1XPOA 1V81A 3V60A 4DUZL 3MC0B 2IZVB 1Q3LA 2PMVA 3GB1A 4K3CA 3VR9B 2RQXA 1S5FD 3DVGY 4WJ3M 4RA8A 3M7GA 1MJEA 3ABVB 2KMMA 2BVCA 2PLPA 4UP8A 1EQQA 2FBWB 5IP9H 2KJRA 4DAVA 4M0WB 1KFYB 2ZCBA 5I9PA 2ICIA 3RN9C 1HZAA 4DK5A 3A56A 1QWYA 1YOVB 5FO9B 4R8IA 4YT0B 1KRSA 2D62A 2NTTA 2UUBQ 3AI5A 1JCKB 4I65A 1HQMC 1QOHA 1K0RA 3D31A 4JV5L 1UF0A 2WDVB 2CHWA 3FRPB 1EY6A 4IWOA 2WQYB 1EZ6A 3FHWA 5MPOA 1F9SA 4DR1Q 2UXDL 4A3PA 2G45B 2WHIA 2WB1G 3P4PB 5FLMH 2J0JA 2F0PA 4A3MB 2NPTA 3T1YQ 5CBEE 3AE6B 1UD7A 1LTAD 1IBXB 2DZIA 4A3LH 1MG8A 3R3OA 2JPHA 5C3JB 2K33A 1BXTA 1HCZA 2BS4B 3K5MA 3OJ3A 2J7ZA 4GOPA 5M3FB 2RGFA 3DBSA 3HOUG 2K5HA 2ZEQA 4ARCA 1EYDA 1NEKB 5I2XA 2BYTA 2V4IB 2DN8A 2Z9HA 1WX9A 1G6JA 3BS1A 2PW7A 5E6NA 1GB4A 1MFWA 2ACZB 3IT6B 2AL3A 5BMIA 1FL0A 5A35A 1I7HA 1SNCA 4DV0L 2WXNA 2LFIA 2JA5B 1FNUA 1E7ZA 2H1EA 5ELOA 1J5EL 4JOIA 5IYCH 4X57B 1MHWC 4CJ2C 3R7QA 4F8MA 2EVBA 3NPPA 3W5VB 3GTQH 4PYZA 3K8AA 2QDLA 3PV0A 3G4SA 2WGSA 3PO2B 4A3BH 4CDEC 4HJ7A 3AQQA 1FGBD 3IFDA 1RIPA 2F0IA 1O7YA 4ANVA 3TS2A 2NVQB 1SE3A 4TRDA 4PV1C 1AARA 5KRUA 2BS2B 1C79A 3AU4A 5KHOA 3K5NA 5AJ3L 4GNXA 5K36H 4B9KA 4ME5A 1YD8U 3UE0A 3H3VH 3Q2AC 4B3RL 1BQQT 3IAS1 1DYQA 4CHKA 1WZ3A 1PTOC 4GKKL 4N8FA 2SOBA 3EECA 4F1SA 5EBDA 3UDGA 4D2KA 2QJLA 1P9DU 1FO4A 1TS4A 3QC8B 1TWGH 2NUCA 4ZUIA 1MSGA 1WVLA 2VH2A 1WGDA 1HA5A 2C7NB 3TL5A 4JK1C 1OGWA 3APFA 3GTKH 4BBNC 1PH5A 3MXPA 5M5WB 3MEFA 4B0MA 3TZUA 3DBLB 1L7YA 2NMQA 3SR1A 3RNGC 1VQ9A 4GKJQ 2DHZA 2WYQA 1I50H 3FP9A 3J81c 1E90A 4MNOA 4A3KH 1BF4A 2C9WB 4MGYE 2G3QB 4WAFA 2D10A 2Q2HA 4C4VA 4Q2JA 4JWUC 2I07B 3K59A 1VR9A 5CV7A 2CJOA 1EUVB 3EGRA 1WTWA 5HHDG 4RHRA 2BDNA 2EYMA 1RRBA 3NZUA 4LUVA 2K5PA 1Z9FA 4H2AA 1V2YA 5IIFA 3UIOB 3QWNA 4MZ9A 3OTOQ 1NR2A 1HRJA 2JWUA 2KJHB 4RG1A 1JJ2A 1ONLA 3PRZA 3NQIA 1H8CA 4E71A 4WJWA 3WWVA 1N34L 3KH0A 2JF5A 3ZJVA 1NYQA 5JH5C 2LVOA 5BYQA 2L9HA 4ID6A 2KO3A 2J0KA 4ZLTF 4L5RC 3I72A 1O78A 2K6QA 3PLVA 5EKLA 4JVZA 1J19A 5C0XH 2MJEA 5DPRA 4MJSB 4Z9CB 3EFXD 2NCNA 1EY7A 1EY0A 1QVFA 2WX1A 5G5HA 4A20A 1ZP0B 3HRZC 4DV3Q 3J7YW 2ZJDA 2NBWB 4CDCC 3DLLA 3CC4A 3ICEA 5G3LD 1X54A 2KVRA 2SNSA 3IXSA 1N8RC 1YJNA 5IP4D 2VQFL 4KI0A 4OO1I 1FRDA 3AM9A 1WX8A 3EFCA 1CFMA 4OWXB 1IHZA 2JYOA 3F8TA 3I4LA 2VUMB 2OT2A 3SHQA 2I2YA 3VTWA 5CC4A 4W9GA 3ULPA 1DOMA 4XT1B 1JB7A 4MELA 2JQOA 2PVGC 2IY5B 4NPNA 4PS8A 2B2UA 1AP0A 3WALA 4BWGB 1TKGA 4IWPA 1J0GA 3VA5A 2F52A 5JJZA 2L1BA 4A3GG 1T0SC 5M3MG 1EEFD 3HOWB 4DV5L 1V43A 4R4CA 2UUAQ 2OQ0A 1GUGA 2WAQB 4XTCS 4B9WA 4LF7L 1HE8A 2AWTA 2KCCA 3I4NH 2N7JA 2UXBQ 4K6DA 2L55A 1XMOQ 1CA5A 2ZW1A 3M95A 4EZKA 4DR2Q 3RLOA 4JI0L 4A3FB 2K9XA 2WXMA 3A9KA 4ZKBB 2ON8A 2Y0SE 3RZOB 3OHXC 3I90A 4DNIA 1SFOB 1V86A 2PQAB 2B3AA 3ETRA 3TREA 3NY5A 2A1AA 2X6LA 1TXYA 2FHTA 4BKSA 1HNWL 1WXAA 5C4JB 3I56A 2KOXA 3CQZH 4IFDG 4U68A 1L0XB 1H9SB 1QUQA 3A4RA 3S2HH 3WA0A 3L9AX 3UQAA 4WAAA 2KHIA 3R93A 1E24A 3EBEA 1AFPA 4HSVA 1RWSA 2OQKA 4IUTA 5ELCA 4CDFC 2GVBA 3PVLA 4JI1Q 1LM0A 4FLHA 4C7YA 2J52A 4QMGA 4AJYB 1EWIA 3GZNI 4B3MQ 1D5XC 2F0JA 5EPKA 1B9RA 1QOFA 1WCMG 1CZGA 4IUNA 4O1NA 5LMNQ 5DPWA 4RM9A 5E1FA 1PH9A 4LF8Q 2VZKD 3QIJA 2SEBD 2HDLA 4O0AA 3FC4A 5KHQA 3I9V1 2Z6KA 1S1QB 4II3B 1IPGA 4NP5A 3DXJC 1HFNA 2RSUA 3PLUA 3KLSA 4KIKA 1PMRA 1D5ZC 1KABA 3Q6SA 5IOCA 5HURA 2MPMA 1VF5C 2K5NA 1GHKA 1EM7A 5IGBA 1KJTA 1STHA 2BPSA 2OJWA 4RFBA 1I4GA 3KYCD 1PRTC 4AOFA 4XXEA 4Y7NB 1Y8NB 2DGYA 4IFDJ 2A5UA 1EWCA 2L3ZA 2E3TA 1B7YB 1VLBA 3MP9A 5I6WA 2Z6BA 3H0GB 1W2BA 1FXIA 4G3XB 1XMQQ 2K1BA 3SK6A 1YNJC 2B63G 4BXXG 2L12A 1JROA 4ANXA 2PQEA 4HJ9A 3S1QH 1QOGA 4A3EB 4BBSB 1UGJA 2YEPB 4QGUA 3MTNB 4OIKA 3ER0A 3KUZA 2KVZA 3E9SA 1B8AA 3UGBB 4BY7B 2FUG1 3RPFC 4XQJA 2G4SA 4FN2A 3H6MA 3S24A 2CU3A 4F88A 2DZJA 1V49A 2B2UC 3NBIA 3O13A 4DAMA 1WWTA 3ZXVA 1UEAB 3A0JA 3T3NA 2BKFA 1K8MA 3SE0A 4FXDA 2WXOA 1ISNA 3CSTA 4DDID 4YY3L 5F2DA 4HIMA 1MI2A 1QNKA 1PFNA 2HE7A 1D2BA 5IN7A 4P75A 1I3QB 3OIQA 2ZJRA 3VDYA 1L0YB 5C4XG 1WE7A 2KANA 3AH7A 1LUZA 1E10A 3KJOA 4FXKC 4PS7A 3HOZH 1PYBA 5KIXA 1XLQA 2LVQA 3NVYA 2JA6B 2NR2A 4WWNA 1FRRA 3OMGA 1T0YA 1I4XA 2HTHA 2ZM6L 4M8MA 2F0OA 2K5QA 4R4IA 3STBD 2N78A 2QDFA 3Q8BA 1XEEA 1L5PA 2RHSB 2IY0B 1C0AA 2OCEA 4P6VF 3RT3B 1STAA 3TMPB 2CHXA 4JI5L 3MXGA 4G7OC 4UPAA 1EF5A 1CHPD 4IFDH 2HJ1A 5C23A 1ENCA 1HTPA 5J1ZA 4XWTA 1YHBA 3BZKA 3ZXRA 3MC8A 3BYYB 1LTRD 1SYDA 3ND9A 1Q10A 2Z6KC 3URYA 3VYUA 3LX0A 2RDBC 4AJWA 3MXUA 1L1OA 4A3DB 3Q3NC 4WQMA 3CCEA 4LFCQ 1QB5D 2IW3A 3A9JB 1UZXB 2LWPA 1D1IA 1ZYRC 1W6KA 1B3QA 1WYWB 5EE3A 1GUSA 3ML8A 1HNXQ 1YJ9A 5IYDG 1ZW7A 3FMCA 1TTNA 4LF5Q 5ELEA 1ZDVA 2INDC 3RNBC 2E74C 4GN4B 3RLFA 1GG3A 4TUUA 1I35A 3HVDA 3FKIH 4OVVA 2A6HD 3T13A 2PNRC 4MGKE 2IJ0A 4F7ZA 1CT1D 1UUPA 1Y1WB 3HKZG 5D3DA 3H1UA 2BA0A 1KC8C 4JW0A 1B9MA 4RCOA 1ILPA 1UBQA 2CKHB 4A55A 4IUPA 3AECB 1N9WA 2W3SA 2R2OA 1SYBA 3PO3G 3GE8C 2V4DA 2XK5A 3TDQA 2MHVA 2KC1A 1P7FA 2FNJB 2OF1A 3OWEB 2MBBB 4BBNF 4JBKA 4E74A 4OX9Q 3Q8FA 1SR3A 2MP1A 3CCJA 1XYIA 4CQNA 3TS0A 5A2QE 1NENB 1EWYC 4KX6B 1JWMD 3MHBA 5CV4A 4M1UB 4S3SA 1I94Q 3M4OH 2MBOA 4KDIC 2Q8RE 1DOXA 4HLEA 2NN6G 3GZNB 3QK0A 2R93B 1FXAA 2DX5B 2EKIA 2QW7A 5EE0A 4HJ5A 2YTVA 3P1MA 5I2YA 3RNCC 2B2VC 3P2BA 3EJIA 3SDLC 2GRIA 2TMPA 3OG5A 2MBEA 4C3IB 1IBML 2AMCB 2CVRA 4DR4Q 4LMQD 3U9SA 4FULA 1U0LA 1PFDA 4DK6C 2WXQA 4HROA 2CQOA 5M9OA 3M63B 3NTIA 2K05A 3VAWA 4OWWB 1OXUA 4KJNA 1F0ZA 5DM63 2RR9A 4FBJB 4GS3A 2A6EC 1TWCB 4ME3A 3KFUA 1H4RA 4K7UA 3I7FA 2V1CC 1R4QB 5CV8A 4LF9L 1A2TA 4ZDVA 2D0OA 2INCC 1VCIA 3ZJTA 1TIID 2DNEA 2Q8IB 4KLKA 2K28A 1JOOA 3TP7A 4EE2A 2AQ1B 3K7AH 3K0YA 2PYKA 2JZ3B 3JAML 2OEDA 3AEAB 3UQBA 1OFFA 2CH4W 1IXRA 4QUCA 1R4NI 5IWAL 2FMCA 3S16B 1PGXA 4MEMA 1WTHA 4KN4C 3GTOB 1VQ7A 2EYOA 2J7QB 2XTIA 2KC2A 2Y5CA 2ZXPA 3AYHB 4UDUC 4L1BA 1X65A 1CHQD 2UUCL 2RHQB 3KLWA 3DHGC 3R3MA 3R66C 2AWOA 2D0PA 2XWJB 3J80E 4JL9A 1N36Q 1CZWA 1HZ6A 4W9EA 1QOBA 4K5WA 4M0WA 3ZIMA 1S3OA 2F0WA 2D5DA 1V6EA 2RCFA 2CU1A 2E6XA 5GAGC 4H0LC 2D3CA 2EOTA 4R4TA 1NSNS 4ZRPA 1S5BD 3ONSA 1DCZA 1M1KC 4GDLB 5C3WA 2Q5WD 3GTPB 4GN3B 4GB9A 3RMHA 3CCQA 4ZRIA 4DV4Q 1QLBB 1PLFA 5J18A 3U2SC 1CMXB 3M4QA 2WXKA 2Y3AA 4CKCA 4J15A 1PH4A 3MJWA 3Q8AA 1CTMA 3ECIA 2VY3A 3C1FA 1YQ4B 2M4NA 3Q3MC 4EFOA 2BH2A 1V9JA 1L4ZB 4XGAB 1A8VA 2PVOD 4GLAC 3T1YL 1MJCA 5HGTA 5EE1A 2I5MX 2WAQE 4X3UA 3KLSX 3PUZA 2XRQD 1WGYA 1G8ZD 1UWVA 3W1YA 3M4YA 1WTQA 2ZXRA 1OXSC 2HCIA 2K5WA 3ALBA 4EUTA 5C3EG 3NTHA 1QQRA 3I70A 4DV1Q 1V97A 4NAWB 1II3A 2MRPA 2W54A 1X55A 3KW5B 4HKZE 1PFBA 4KZ0A 3L08A 1LTTD 1HZCA 2EELA 1L6VA 1J8CA 2VB2X 4ULLA 1R9TH 1R4MB 4LJPB 4BZAA 1WYDA 3KF8B 4EQOA 1PHJA 3DMUA 1VQ4A 4XDXA 5D3IB 1WI0A 2N9XA 2ZZPB 3HRDD 1IW7D 3Q69A 1G2SA 5HKHA 2KOLA 1W3SA 4FVMA 2NN6H 4AP4C 4XC2A 2HUGA 1B53A 3W2DA 4BBRG 1AH9A 2DENB 2Z0SA 4YWKA 1TKYA 1PYSB 4W9FA 2I0QA 3Q24A 1PFSA 1S3SG 2L52A 4BKTA 3JSVB 4HPMB 2J0TD 4BY1G 2GBRA 1KOTA 1Y8PB 1JWUD 1WTVA 4C3HG 1Y8RC 2FIFA 2KDFB 2KDMA 1Q1OA 1XT9B 3B2GA 1D3ZA 1YX6B 4XDDA 3N1XC 1WZ0A 4IM0A 2JA8G 3DBRI 2NVYB 1LFDA 5IT9L 3B6YA 4K81A 1TWAB 1YNNC 3FVQA 4IURA 4C80A 4APVA 1DOKA 1PRTF 1IBKL 2CH4A 3NZSA 1IYJB 1DOIA 4P74A 5EQ0A 3MXNB 5CBAE 2B2WC 5FLXL 1T0RC 1OXVA 2E2HH 2KMCA 3IT4B 1HFGA 5AUKA 5L37A 3RUIB 5LL6X 3HOYB 2B29A 3ZO5B 1WM2A 4X65Q 2ATWA 1WXQA 4JBWA 3E9IA 1L2NA 4LF4Q 1EOVA 2VXWA 1J7AA 2DY8A 3W1SC 3RULA 4DR5L 3N20C 5G2NA 2KKCA 1JE5A 1IL8A 2A68C 1E7PB 1PQSA 1XCTL 2KT7A 4XDCA 5E6OA 1HTOA 4CDDC 1EZ8A 1C8CA 4GKJL 1PDQA 2HDMA 1PGAA 3J81j 1VCBA 3I4MB 4IALA 2KACA 1QILA 3IFWB 5LNK1 2NBFA 1IKMA 1C77A 3EFUA 5C44B 4Q0FA 3V05A 5IP9G 2EQSA 4W9DA 3AE1B 1EYGA 4K7SA 4TMAB 3FILB 3U52E 2EIFA 4MT5A 4M00A 2VQEL 2JA7B 2L11A 2BB6A 2OOBB 1K50A 1VQBA 1X3PA 1SGHA 2RKSA 3TP8A 1ZKOA 1S5CD 3M4PA 5KNDA 4L6TB 2JEAI 1F2MA 3DWPA 1L6UA 4XYQA 4K14A 3OTOL 3OYYA 1JE4A 3UI2A 4AYBG 2LRUA 4GXBA 4NKLA 4X66L 4A3MH 4LNFA 1SNQA 2JXXA 1Q0WB 4X64L 5FLMG 5FO7B 1U4AA 1L0WA 1R4NB 2KD0A 2BDOA 4OVUA 4WQOB 3CCLA 3PHXB 4A3LG 1W6JA 4K2KA 2IO2B 4BVUC 5M3FH 3MFYA 4MJSA 3OSOA 3RZDB 1VMCA 1X3GA 1HNWQ 2B76B 1QZHA 1WSPA 4DWFA 1F9JA 1TBEA 3PMFA 3OJ4B 2JZPA 4KSKC 1UAPA 3UINB 4EEWA 4DXAB 4IG7B 4FDBA 2IWHA 3I3CA 2UWQA 1WGKA 1D8LA 2GVAA 2KJXA 2JA5H 2DYOA 4ZKCB 1KM7A 4HXDA 1MHXA 3H09A 3X23A 3T1HL 4XE0A 5H1SE 4K1RB 4NJ7A 1OTCA 1C4AA 5IYCG 1NDDA 1WJJA 4DHJD 2D9UA 3A54A 2EY1A 3PGZA 4JIOU 4LW1A 4A6QA 1P8LA 3OMCA 3J80i 5JPNC 3PO2H 3PIPA 4JWSC 4WWMA 2BT6A 2MCNB 1O80A 4QF4A 4DV7Q 4DR3L 2A68D 3PPAA 4IM3A 4A3BG 3PCOB 3SDZA 2B8FA 2DNFA 2NVQH 4KHPQ 3K0XA 4L8JA 3NENA 3BZCA 3NSWA 2KUMA 4DAYB 3HM6X 5BN4A 1XNQL 4F7XA 2B39A 3HOVB 1SYEA 1SMYD 3C0RB 2PMZB 3BU2A 1Z47A 3K7UC 2UU7A 4A3JB 1UE6A 5K36G 4HVBA 1SNOA 2MSED 3ZUNA 1CKNB 1TR5A 2IPKD 2R3ZA 2OWOA 1S5ED 4LF6L 5EPJA 3B2FA 3NJTA 4WWPA 2B2TA 3SGIA 2AL6A 3RYTA 4DV2L 2F4VL 2OXPA 1JRUA 1XMOL 1PH3A 5DM73 3ZRFA 4DR2L 4DU9A 1BKBA 1RLFA 5JXVA 4HIKA 2O2VB 5IA7A 1FD7D 2PQAA 1OO9B 3PSIA 3LYYA 2M9VA 1S5DD 2WDRB 1AN8A 1LO5D 3S1MB 3A8KE 1GJZA 1UE1A 1H9SA 1Z7TA 1HUMA 4X3SA 4W9CA 2LMCA 3MTSA 2IT1A 2HHHQ 4XZ4A 2KCNA 1SBBB 2Q2IA 1I6HB 4A3KG 3ZW3A 4DN4M 2ZNVB 1U9RA 4GLVB 2QSDA 4WURA 1I4RA 3CCSA 1QF6A 3TEYA 2EJFC 2H89B 4LFBQ 5JJKA 1B44D 2R7ZB 1WRIA 2JE6I 1I5FA 4P72A 5M5XB 2V9HA 1PH7A 5I9OA 1B50A 5IYBH 1XPUA 5H92C 1NBFC 3H15A 4GDKB 2K8BA 1U4PA 3QR8A 3J81E 3AV8A 2IY1B 5FLXc 1KHIA 1AEXA 2CW0C 2WV6D 1E3PA 3L54A 3D4WA 1GUOA 2FUHB 2KMAA 2JRHA 5JAVA 1Z5SB 4AQ7A 1YQ3B 2CFMA 1T9HA 4DDGD 5E4XA 4DHJB 1SF0A 3GS2A 4HJ8A 4ZQ3A 1E1OA 1ICWA 5C0XG 1JC7A 3VH4B 2DWQA 1LLRD 1TS5A 4A3EG 4II2B 1WGRA 2UU9L 2D3GA 4DHZB 3DUZA 5IY0A 1ZOYB 1HA6A 2O5JC 5LMUQ 4E3CA 4IN3A 3T8MA 3DCGA 2A74C 2BE5C 2VRRB 2AEHA 3U7ZA 3F1ZA 4KV6A 2E8GA 4C3JB 3IBEA 2QDBA 1F9QA 1N32Q 4CHTB 3KUPA 2V4LA 3MJ5A 5IGCA 2VUMH 4TV3A 1BBWA 1WFQA 2IO0B 3H3VC 3H3VI 4DK3C 1TKEA 1YNTE 1ACCA 3Q8CA 3AEGB 2KWVB 4KY5A 1BO0A 3ULJA 1PA6A 1P7EA 2ONQA 3TIXA 4V0BA 1FGUA 4K8IA 2K04A 1WX7A 3CSFA 3C19A 1EY4A 2YU9B 3WANA 3HOWH 3G7LA 1WJ6A 4RMFA 5JOBA 5C0XJ 2MWSB 4K5VA 1EY9A 1WTRA 4N59A 4YCVA 2FCNA 3Q14C 1PDXA 3I4NG 4DK1A 3Q8DA 4A3FH 5CX3A 2HDEA 1E8ZA 3D8GA 2K01A 4HIDA 3V96A 1XPRA 4C2MB 1K8RB 1LGRA 2KDIA 4MACA 4RM8A 1EU4A 3RZOH 1T5XD 3WAMA 1J9OA 1SFOH 3BK1A 3HOXB 5CR3A 2MHJA 2WWZA 3S1NB 2CW0D 1UEBA 1XXGA 3AE7B 5C4JH 3B9JA 5LXHA 1C76A 4DUYL 2RMMA 4TQ1A 4P2CB 1WD1A 2EYJA 3C3LA 2ZW0A 2WINB 1AE2A 4X62Q 4OW0A 1RFKA 2BS3B 1VQOA 4WJOA 3T53B 4Q5VA 1KDBA 3VXWA 3PIOA 2R61A 1NNXA 4RKBA 2LKVA 3QCAA 1BUIC 2JY6A 2RA4A 2FFKB 3U4ZA 3ULLA 3FEWX 2QEJC 1XNRL 2TSSA 1TKWB 4GLXA 1HNXL 1VZ6A 3ENEA 4M01A 4LNNA 2IL8A 1X3QA 1CI3M 4RWSC 4BA1I 4GOPC 5C0XI 3JW0X 5C1ZA 2Q2TA 4YTNB 2C60A 2K03A 2JEBI 2RPVA 4K0KL 1VQFA 1RYJA 2KVMA 3DWGC 3NWTA 2QA4A 1VQ6A 1N33L 4OHJA 3LWEA 5IKCM 1C3TA 3Q3OC 4Y7NH 1XF5L 2PPBC 5D7GA 1Y1VB 4F87A 3PRPB 2BH8A 3K80C 1H95A 3D6CA 2J53A 3H0GH 3QARA 3U7DA 5HFYA 4RH6A 2B2YA 4JOIC 4HR7B 4EVOA 3F2BA 3HK0A 2AUJD 3A1QB 4C56C 3Q6BA 4A3EH 4BBSH 3NEMA 4B3SQ 3F2CA 4JQWC 3TQYA 3ZNHB 4BY7H 2UXCL 4KKSA 4MGIE 3ZQ4A 1PTOD 3NBHB 2C35B 4H44C 4OX9L 1LXDA 2BWFA 4EZLA 4WJPA 2GBNA 4R9WA 4W9IA 2HCCA 2Y5BB 2R93G 4LFAQ 2EYPA 1V1OA 4NJ6A 4POGA 3NXWA 4YL8A 2K22A 2NZ1D 4O2DA 1CM9A 3VA7A 1DONA 2JSVX 5BR8Q 4GNXC 1X32A 3ZRCA 2X6GA 3ZGZA 1N63A 1WTOA 3KDFA 1HR0Q 3RR5A 1D4BA 2G4DB 2KWDA 3ML9A 3DEOA 4IZ8A 4DR4L 1ZE3D 1CJEA 3PREA 2ZTCA 2Z4HA 1KF6B 1XLPA 2J42A 3DM3A 4FA6A 2F3IA 1I3QH 3PF4A 1UH6A 1NY4A 3TRZA 1VZ8A 1TU2B 4IOCA 4EQPA 3CMMB 1FFUA 1FMAD 1ZDXA 3A4SC 1JOQA 4NPSA 1NUCA 1GXDC 1RL2A 2IYDB 5BN3A 2JA6H 3VUXA 4BFRA 3NRZA 3HOZG 5FR6A 5BO4B 1FJGQ 2RPQA 4KTAA 1ASZA 4P71A 1UELA 3AXCA 3J81i 3RMKC 1EFWA 4C7ZA 1DOLA 4A3IB 1MI0A 3K9OB 3ZJYC 3GTQB 1H9MA 4XYOA 3W5UB 5AZHA 4DR7L 4KGRA 4LCDE 4DK0A 3CXCA 5JJIA 4LDTD 1YJJA 4OXPA 1EOTA 3GTGB 3AFPA 4OO1H 2EMTA 3LJ3A 1NMGA 4LNQA 3DBHI 4RHSA 5ELDA 1RODA 1E0ZA 1YJWA 1TY0A 2EY5A 3VR2A 4DNTB 4NXNQ 1C48A 1U5KA 1EQVA 1KRHA 1N36L 5HGQA 2PIAA 1B9NA 3P4SB 2RCNA 4A3DH 1B1ZA 4DNRB 3ZNID 2AUKA 2WKDA 3CCUA 2I1KA 2KLGA 4BOZB 4TVAB 4JI3L 3AU5A 4URKA 2PKOA 3X3MA 1CSQA 2MP2B 4ZK9B 4PT5A 4US8A 2LUMA 2W55A 1RM6C 1XJVA 3BVGA 2IX1A 2MBQA 1GHJA 4DUZQ 4DV4L 1NI2A 3JVZX 3C1EA 3H9DA 1PTOB 1Q1BA 1BT0A 3T51B 2M8SA 3K58A 1HEZE 1E9MA 3FKIG 2PMZE 1AZPA 3GTMB 1TZ1A 1Y1WH 5J2RA 2HD3A 4ODGA 1HQRD 1BUVT 3QX1A 2F0EA 1FNVA 1BOSA 5CORA 2N1VA 3E56A 4XQQA 4BAXA 2WXFA 4CKBA 1NVID 4KZCA 1KNEA 5DLQE 4NAWA 4JV5Q 1JQYD 1QG7A 4KHZA 2M19A 4IJHA 2YTXA 3AE8B 2FE8A 1CZPA 1ET9A 1MJDA 2UXDQ 2YYZA 2ASBA 1HXYD 3K9PB 1BBXC 2R93H 2WB1B 3S17B 2QCZA 1KDAA 4EOYA 3VDZA 3KUDB 1VQDA 3MEHA 2CCZA 1HUNA 1QT9A 4I6PA 4YHHL 3GTJB 1WY8A 1J7BA 4ZHOA 1BMLC 2LXJA 4C3IH 2F0TA 4PK1A 1JJCB 3U8ZA 1QE6A 4DKAC 5KYIA 5KGUA 3HOUB 2VZAA 1YI2A 3QOJA 2PZWA 1N60A 1NI3A 3DVGX 3JSVA 4JI4L 4LDTB 1K28A 3DPDA 2WXLA 1TWHB 1IYFA 4ZOHC 2JXMB 3F2UA 1E6EB 4G57A 1AW7A 2Z0DB 3VVWB 1TWCH 2AHOB 2E2DC 1TWFB 5LHY1 1WXSA 3Q0AA 3A33B 2ZXOA 3MWYW 2KHJA 3E9HA 5I4DA 4OZCA 1J5EQ 3PT2B 2RDHA 4JCVE 2CHBD 1B2TA 1RHPA 3L16A 1A15A 3HP3A 4W9HA 1YBYA 2MA9B 1EYCA 3CCMA 3A55A 2BYVE 3MC9A 4IFDI 3GO5A 1I6VC 3BY4B 3MXNA 1WTPA 2B3GA 4GZYC 3U58A 5CMDA 5IP7H 2K1FA 4C00A 3S16H 1PH6A 3N32A 2KWCA 2EY2A 2VZKB 4ZRQA 1X56A 4LF4L 2A8VA 1VDZA 4DHZE 3J7A5 1ZXIA 3QQ8B 3AE9B 3T56B 2KHWB 4B3RQ 5EJWA 2JWZA 1PRTD 1FM0D 5G55A 5EBCA 3KWLA 2JSOA 3I2ZA 1Z2MA 3BDOA 1YN3A 4GKKQ 4XX5A 2LGIA 3IAYA 3P63A 1GUNA 3IVFA 1JWSD 1STEA 1YNJD 2V3NA 3HG9A 4OVZA 4AWJA 2LGYA 2E5LL 1XWEA 2EYLA 3AE5B 5A2QL 4EZJA 2FXQA 4CJ1B 3VRAB 3GTPH 1GOZA 2VH1A 2PCFB 2K3UA 1PFMA 5CV5A 1WOCA 2RDGA 1RFAA 5JHBA 1Q5WB 3NUHB 1PVOA 2E2JB 4JYAQ 1WH3A 1WIAA 1KDCA 5J22A 1CSPA 4F8CB 3ZLZA 3Q3FA 2V3PA 2UYZB 1V1PB 1PTOF 5FJ8H 4R4QA 4HN7A 3QIAA 4RF0A 3GV6A 2BQQA 2E75C 2R7DA 1F9PA 1EF1A 2MGSA 2NS5A 1MBYA 4LTUA 2Y0SG 3J9CA 4ZRZA 1P3QU 1I4PA 2MQHA
chains in the Genus database with same CATH topology
2BCOA 2L4NA 5E6JA 1SEBD 2KQ3A 1GB1A 2VB3X 3VYTA 1T5EA 1KLGD 1RD9D 2QILA 3CRKC 4EGVA 4KK7A 4HCSA 2ZT9C 1SE4A 2KN4A 2INPE 2EDGA 2RBMA 2JX5A 2MEKA 3ND8A 1RF2D 4KD3A 4KY7A 1PZKD 2XWBB 1Q12A 3D4RA 2MJ3A 2SNMA 2F0MA 2EY6A 1NCVA 4DAYA 2G9DA 2BB5A 3ZJUA 4K8JA 1SB3C 2BTEA 4RKLA 1PRTB 2RSOA 4RGOS 3SVMA 2W82A 3QOLA 2Q8TA 1ZYRD 1FEHA 2F0DA 5FR3A 1JMLA 1YN4A 3HZXA 3TP6A 4RGMA 4FF2A 2RSNA 2Z4IA 2N55A 3Q23A 4J8QA 1TJEA 2WIIB 2KEEA 4G7HC 3GQBA 1RJTA 2EXZA 5FK9C 1PGBA 5KYLA 3BK2A 4JX1C 2F0KA 4A3GB 1TQOA 1KNAA 5M3MB 3CWIA 3K5OA 4CBVA 3WOFA 2JU6X 4MM3B 3AEEB 3GV3A 3S15B 4RCNA 5C5MA 3ZYYX 4CKEA 3MHZA 3C46A 5K5PA 4YIJA 3CU7A 3MA2B 2LHEA 3GTLB 1HZ5A 3NTKA 4YSXB 2F3WA 1DD2A 1MSHA 1SNMA 4NMZA 4DXGA 1IBXA 3PO0A 3KLRA 1F9RA 3AE3B 3VYSA 3EUB2 3N52A 2NN6I 3BG3A 1OQQA 5D65A 1RKNA 2A6ED 3P4RB 1WCMB 4ITKA 4U673 5JEAG 3R8BA 3NHHA 4WIPA 1CK1A 2L32A 3WDNA 2WXJA 1XTCD 2WKCA 3PUYA 1IGCA 1K52A 2BW2A 4WH4A 2IGHA 3IAM1 2FINB 5CV9A 5AUIA 3D3RA 5DEHA 2LFNA 3P75A 4WORA 5J39A 1DXMA 2IX0A 2LEKA 2K0PA 2EZVA 2ICEC 2B63B 1NYRA 3A8IE 2DNCA 5KNBA 4RF1A 3AMZA 4KKTA 1CA6A 1DOYA 1C78A 1K53A 1IUEA 2LHDA 2L1AA 2F0FA 4N9TA 2RDFA 3LWUA 1OQRA 4YXDB 1JWBD 5JEAJ 4DF7A 1XLOA 4YSZB 4USAA 4XQNA 2NVXB 2BA1A 4TQUS 3M3YB 1FYCA 1XO3A 1A70A 3VQIA 5JVG3 2CJNA 4KGTA 2F0LA 2INNE 5C4XB 2NWGA 3EA6A 4WFN3 2I46A 2I38A 4BS9A 3TSSA 5G5GA 4DXFA 1K83B 2OHFA 4A9AA 4HSPA 3NQTA 4KJOA 2E2IB 1NAPA 2F0HA 2DLBA 2IX3A 2KECA 3S2DB 1IGDA 2WXIA 1QOAA 3E5SA 1SXTA 2WS3B 3NUCA 2F0QA 1EIHA 1FFVA 1JB3A 1A3TA 1QJOA 2XVSA 5E4WC 1CQVA 4B0EA 5JEAH 3ERQA 2R6GA 3S14B 4C1NK 2MUYA 3NBHA 1YNND 2O5IC 3L3OC 1DJRD 5KNCA 1KLUD 1H9KA 4G7ZC 1D5MC 3S1RB 3HKZB 3NVVA 4TSSA 1ZPSA 2NB0A 2WP8J 1JR0D 2KHSA 3PO3B 1ESFA 1LTID 1TS3A 3MVVA 3AU7A 5C6AA 4HCEA 3NWSA 4MIUA 3DEPA 1MHHE 3BVMA 4PMCA 3AEFB 1LT6D 2O2LD 2HQEA 4G4KA 5EKIA 5EPLA 3K5LA 5C4HA 2NTSA 4NDXA 4PNYA 3N9YC 1E0BA 1PYWD 2NVTB 5I6YA 3PZ7A 3TMEA 3D6WA 3H8HA 1QCBD 2E76C 4QB4A 3AEDB 4KY6A 1L4DB 5M5YB 1DGJA 2CQAA 2WP9B 3DWAA 2AX5A 3VYRA 1T3QA 3DWMA 4ZYSA 2BOSA 2WNMA 1EWHA 2FMMA 1BR9A 2AQ3B 2WXGA 1GAQB 4HKQA 4LK0M 1JICA 1SDFA 4R8NA 4KKUA 5FKAC 1ZXHA 2OEOA 3R2TA 1S4ZA 5EE9A 2L83A 5CYUA 3I57A 4ILWA 2LS01 4FXGC 3V3XA 1H9JA 1AWDA 2PZUA 2Z8LA 3NP8A 5JVH3 4XWWA 4PMWA 2J4XA 2WU5B 5C3EB 3BVZA 2B2TC 3PZ8A 2K6AA 5C4ZA 3QJYA 5DNFA 5EKKA 4GLSC 2EE1A 3C8YA 4HMIA 5E3FA 2PW9A 2QMTA 1GUWA 3N6RA 2F4IA 1J7CA 5IGEA 4BBRB 4OGQC 3BDCA 4IUQA 4QIWB 2V0GA 3GD7A 3ONAB 1AYFA 1HHVA 1NR4A 1DM0B 2M2LA 4BY1B 4UAIA 4IQZA 1WD0A 4LAAA 4C3HB 1F2YA 4OO1G 4KGSA 3AEBB 5BYSA 1TT2A 5IGFA 1EIGA 4JE3B 2F0UA 2JA8B 3W9CB 2JQRB 3MFGA 4RNAA 4K6LA 4HEA1 4HJGE 1ZEQX 5CGKA 1EQTA 5HG2A 1C4PA 1JWAD 3BIID 1BCPC 1UWXA 4RAUC 5NUCA 1E2WA 2QKIC 3SEBA 5HI1A 1LT4D 2BE5D 2M0AA 2MJDA 3CHBD 3NS1A 1PTOH 1A3UA 4FF1A 4DFAA 4EQNA 3U9OA 3KQ4A 1V1PA 1EY8A 4CGYB 4L2YA 1HPCA 1FCCC 1MVKA 1EFID 1QNUA 4HTHA 3PUVA 3EVQA 1FCLA 1WTXA 1U4MA 1VMPA 3VR6A 2M00A 2XRSD 3AB9A 3CIRB 1V8CA 2F0SA 1Q1EA 4B9XA 4OL7A 3FPUB 1XCQL 2Y5PA 3DM1A 3AB5A 4AYBB 1XX8A 4H7BA 4B08A 1MD2D 4WRDA 1F2LA 1JORA 2GB1A 2F0VA 3A8JE 3UI3A 1Q90A 3FAHA 4OZAA 4C3IG 1Q8IA 1H9RA 3HVZA 1XLNA 2SDFA 5JPMC 1GUTA 3EQLC 3R2IA 1BCPD 3CRLC 3T3OA 4MH8A 1MPEA 4BA2I 1SE2A 4KHVA 2WDQB 3HUIA 1G291 4FO2A 3W3AA 4A3BB 1LABA 1OXXK 3V2TA 2JYEA 1LTBD 2EPBA 1F2ZA 1HTLD 2KQ4X 1LT5D 1G2TA 3HGBA 4IDIA 2JP1A 4RGNA 4OIJA 3I8ZA 3PIP3 3TUOA 1Y8OB 1EY5A 3KBXA 4N58A 2K7VA 1TWGB 1L0VB 1SJED 2XSCA 1TYGB 3DHQA 1D1KA 3QO2A 1R4PB 2B2YC 3GTKB 3WCQA 4ABNA 2LMCB 3VR5A 2WACA 4NAMA 5BYRA 1LTGD 1I50B 3FPPA 4LK1C 4A3KB 2L5TA 4MN3A 4OZBA 3SFDB 5IGDA 4K2LA 4TKOB 2BBCA 5BMHA 3I73A 3KBGA 2F0NA 2HTME 1U4LA 1VDVA 1STBA 2IDYA 3VRBB 1G91A 3KF8A 4TQ0A 1SYCA 2K5DA 2JYTA 2PTLA 2EJGC 2W3RA 3TBIB 1BCPB 1FD6A 2G1EA 1SSNA 3PUWA 4J3OD 4H13C 2N9KA 1JOKA 1QKZA 2FJ2A 1EL0A 1GJXA 1STNA 5BMGA 5TSSA 4N9PA 1C9FA 3U4EG 3NE5B 1C4CA 2WXRA 2XN9C 4FP5D 4DGZA 1N61A 3SHLA 5ISRA 1VJKA 3P4QB 1TVXA 1VF7A 2A6HC 1CQFA 3E6ZX 2ENBA 5LL6S 3X3NA 4X3KA 4PQXA 3LB8C 2N9LA 2LY7A 1LT3D 1YN5A 3DWQA 1RTNA 2B2VA 4YTPB 1C4QA 1M4VA 3E0JA 3SK5A 3TN2A 4HMJA 5T1GA 1LACA 1ESRA 4MHEA 3VR4A 3I4NB 3NZ3A 4ARIA 3FILA 3C2PA 4QCLA 1ET6A 1UWMA 4DA2A 1U4RA 1M8AA 1SNPA 3NVWA 3LNNA 2QIEB 4IUUA 3P42A 3G6JB 4REZA 4KMUC 3CQZB 1B4OA 4QUFA 3S2HB 4K5XA 3FDTA 1BDOA 3AMUA 4LJZC 4ZHPA 3M85A 2F3VA 1FNWA 2WU2B 1VRAB 1RCVD 2QCPX 3QB3A 2AQ2B 2XNAC 5IGGA 4HAEA 1ROEA 3VR3A 4L63B 2IGGA 2WXPA 1VZ7A 2Z1CA 3OWFA 4N6EB 3PUXA 3PIO3 2D2CC 4ZUJA 1UNSA 2EJMA 4KN7C 5G3LF 2IGDA 1PXUA 1WYGA 3J7AF 3AE2B 1BCPF 2A69C 3T4AC 2KEDA 3J80L 5FOBB 2PW5A 3S1QB 1I4HA 3BDLA 2YEPF 1ML0D 3BWUD 2JXTA 2H88B 1D6EC 3I91A 1A6XA 1TY2A 5KEEA 3L7ZC 2F1MA 1ZXTA 3A7LA 2MJ8A 4KKIA 2L0CA 4NW2A 1GPXA 4P16A 3TEXA 3TEWA 4C1NI 1JQ4A 1EU3A 1V8QA 4XIGS 1SYGA 2X38A 4O42A 5C3XA 3HOZB 2O4XA 3RUZA 3HS0C 2EYFA 1IW7C 2N88A 1ILQA 1B3AA 5T8IA 5AFWA 1O7LA 4IUVA 1K8OA 5D14A 2WLBA 4L23A 3KK7A 2SAKA 1KH0A 4IKGA 2B2WA 4KD4A 2RVLA 2A69D 4JPSA 3A7AB 2ID0A 4V190 4HRSA 3SXHA 2GI9A 3EROA 3W1SA 2DBYA 1E2VA 3K6OA 1YJIA 1JALA 3NK9A 1O7ZA 2GA4B 3P1HA 1STYA 3P7JA 1K51A 3H91A 3JAME 3NVZA 3FKIB 2VNUD 1A3VA 1STGA 4C3JG 1MGSA 3OPOA 1IYUA 4I7ZC 1G6ZA 3SR6A 5ELBA 3BYTB 4J6HA 3L4PA 3M7NA 3S9WA 2DY7A 3IKJA 1SYFA 4XT3B 3M4OB 4LLGM 1SIJA 3CKIB 1TZOA 1I4QA 1EYAA 4PMBA 1Y69U 4NJCA 5COYA 1BNZA 3OOCA 5BN5A 4NZLB 1R7SA 1ENAA 1Y56A 3MZ5A 1PUTA 5DAUA 4YTMB 4CJ0B 2F03A 4YWGG 4M8AA 1N5WA 3LXFA 1DZ1A 1RDPD 3VR8B 1F77A 2B8GA 4E6IA 3RFZB 3K7AB 3IFTA 5GXGB 4RGTA 4X3TA 2PZTA 5FO8B 3IL8A 5H8YE 2C5CA 1IKLA 1PZID 2G9HD 2A5HA 1LV9A 5EGTA 4US9A 3GP7A 1SMYC 2C9OA 3TZDA 4IOIE 3J7AV 4A90A 4ZAIA 1KTKA 3Q8EA 5IT9E 1N62A 3ITPA 2PO4A 1RTOA 1EEID 3K57A 5ELFA 3SFEB 5FLXE 4HEDA 1SNDA 4FF4A 2LJIA 1SJHD 2WXHA 2K32A 1FIQA 5C5LA 5C2TB 1KAAA 3BZDB 2N0SB 1SSOA 2KA7A 1TS2A 2Y0SB 3RD4A 1F2RC 1AZQA 1F2RI 3KWVA 4R3DA 5CV6A 4FYDA 1LTSD 4YSYB 3AN1A 1Z6HA 3SK8A 1R9TB 4FXCA 3QG1A 3P20A 2H4OA 3H94A 2R92B 4AS1A 2XIWA 2A73B 5T1IA 1IYVA 5IODA 2M56B 1A2UA 4A93B 3SK4A 3J81L 1YMHE 3OW7A 3OIPA 4FNFA 1T6BX 3HEJA 4DAPA 1ENFA 1ZUD2 2NYZD 2D5GA 4KKJA 2KAJA 4DQOC 1PZJD 1N5XA 2F0GA 1J8IA 4J1MA 1E2ZA 2DYMA 3AE4B 3Q22A 4A8XC 2EYHA 1JW9D 2AWNA 2MH7A 4FF3A 2QF7A 2E2HB 3MAQA 1FR3A 2X69A 3WOEA 1JRPA 1SAPA 3D4DA 3TP5A 1OXTA 3MC0B 3GB1A 1Q3LA 2PMVA 3VR9B 2RQXA 1S5FD 4RA8A 3M7GA 3ABVB 2KMMA 2PLPA 2FBWB 4DAVA 1KFYB 5I9PA 2ICIA 3A56A 1QWYA 5FO9B 4R8IA 4YT0B 2D62A 2NTTA 1JCKB 4I65A 1HQMC 1QOHA 3D31A 2WDVB 3FRPB 1EY6A 2WQYB 1EZ6A 5MPOA 1F9SA 3P4PB 3AE6B 2F0PA 4A3MB 5CBEE 1LTAD 1IBXB 3R3OA 5C3JB 2K33A 1BXTA 1HCZA 2BS4B 3K5MA 2J7ZA 5M3FB 4ARCA 1EYDA 1NEKB 5I2XA 2BYTA 2V4IB 2DN8A 3BS1A 2PW7A 1GB4A 2ACZB 3IT6B 5BMIA 5A35A 1I7HA 1SNCA 2WXNA 2LFIA 2JA5B 1FNUA 2H1EA 4CJ2C 4F8MA 2EVBA 3NPPA 3W5VB 3PV0A 3PO2B 1FGBD 3IFDA 2F0IA 1O7YA 2NVQB 1SE3A 4TRDA 4PV1C 5KRUA 2BS2B 1C79A 3K5NA 5K36H 4ME5A 1BQQT 3IAS1 1DYQA 1PTOC 2SOBA 5EBDA 4D2KA 2QJLA 1FO4A 1TS4A 2NUCA 4ZUIA 1MSGA 1WVLA 1HA5A 4JK1C 3MXPA 5M5WB 4B0MA 3TZUA 2NMQA 3SR1A 1BF4A 4WAFA 4Q2JA 4JWUC 2I07B 3K59A 1VR9A 5CV7A 2CJOA 3EGRA 1WTWA 5HHDG 4RHRA 2BDNA 2EYMA 2K5PA 4H2AA 5IIFA 3QWNA 1NR2A 1HRJA 2JWUA 1ONLA 3NQIA 4WJWA 3ZJVA 1NYQA 5BYQA 2L9HA 4ID6A 4ZLTF 3I72A 1O78A 5EKLA 2MJEA 5C0XH 4Z9CB 3EFXD 1EY7A 1EY0A 5G5HA 1ZP0B 3HRZC 3J7YW 5G3LD 2SNSA 3IXSA 4KI0A 4OO1I 1FRDA 3AM9A 1CFMA 1IHZA 2JYOA 3I4LA 2VUMB 2OT2A 2I2YA 5CC4A 1DOMA 4XT1B 2PVGC 2B2UA 1AP0A 4BWGB 1TKGA 3VA5A 5JJZA 2L1BA 1EEFD 3HOWB 1V43A 4XTCS 1GUGA 2WAQB 4B9WA 2N7JA 2KCCA 4K6DA 2L55A 1CA5A 2ZW1A 4A3FB 2K9XA 2WXMA 4ZKBB 2ON8A 3RZOB 3OHXC 3I90A 1SFOB 3ETRA 2X6LA 2FHTA 5C4JB 4IFDG 4U68A 1H9SB 1L0XB 3L9AX 3R93A 1AFPA 4HSVA 1RWSA 5ELCA 4IUTA 4C7YA 2J52A 4QMGA 1D5XC 2F0JA 5EPKA 1B9RA 1QOFA 4O1NA 1CZGA 4IUNA 5E1FA 2VZKD 2SEBD 2HDLA 3FC4A 3I9V1 4NP5A 3DXJC 1HFNA 3KLSA 1PMRA 1D5ZC 1KABA 3Q6SA 5IOCA 5HURA 2MPMA 1VF5C 1EM7A 1GHKA 5IGBA 1STHA 4RFBA 1I4GA 1PRTC 4XXEA 4Y7NB 1Y8NB 2E3TA 4IFDJ 1EWCA 1VLBA 3MP9A 5I6WA 3H0GB 1FXIA 2K1BA 3SK6A 1YNJC 1JROA 2L12A 2PQEA 1QOGA 1UGJA 4A3EB 4BBSB 2YEPB 4OIKA 3E9SA 4BY7B 2FUG1 3RPFC 4XQJA 3H6MA 2CU3A 4F88A 2B2UC 3NBIA 3O13A 1WWTA 1UEAB 3T3NA 1K8MA 3SE0A 4FXDA 2WXOA 5F2DA 1MI2A 1QNKA 1PFNA 1D2BA 1I3QB 3OIQA 1L0YB 1E10A 3AH7A 4FXKC 5KIXA 1XLQA 3NVYA 2JA6B 1FRRA 3OMGA 1I4XA 2F0OA 2K5QA 3Q8BA 1XEEA 1L5PA 4P6VF 1STAA 3MXGA 4G7OC 1CHPD 4IFDH 1ENCA 1HTPA 5J1ZA 4XWTA 3BYYB 1LTRD 1SYDA 3ND9A 1Q10A 3URYA 3VYUA 3LX0A 3MXUA 4A3DB 4WQMA 1QB5D 2IW3A 5EE3A 1D1IA 1ZYRC 1W6KA 1GUSA 3FMCA 5ELEA 1ZDVA 2E74C 3RLFA 3HVDA 2A6HD 3T13A 2PNRC 2IJ0A 1CT1D 1UUPA 1Y1WB 5D3DA 2BA0A 1ILPA 1B9MA 4RCOA 4A55A 4IUPA 3AECB 2W3SA 1SYBA 2V4DA 3TDQA 2MHVA 1P7FA 2OF1A 3OWEB 3Q8FA 2MP1A 1XYIA 4CQNA 5A2QE 1NENB 1EWYC 4KX6B 1JWMD 3MHBA 5CV4A 4M1UB 4S3SA 1DOXA 2Q8RE 2NN6G 2R93B 1FXAA 2EKIA 5EE0A 3P1MA 5I2YA 2B2VC 3EJIA 2GRIA 2TMPA 4C3IB 2CVRA 4LMQD 3U9SA 1PFDA 2WXQA 4HROA 5M9OA 3NTIA 2K05A 1OXUA 4KJNA 1F0ZA 5DM63 2A6EC 1TWCB 1R4QB 5CV8A 1A2TA 1VCIA 3ZJTA 1TIID 2DNEA 2Q8IB 2K28A 1JOOA 3TP7A 4EE2A 2AQ1B 3K0YA 2PYKA 3AEAB 3JAML 2OEDA 1OFFA 4QUCA 2FMCA 3S16B 1PGXA 4KN4C 3GTOB 2EYOA 2Y5CA 2ZXPA 4UDUC 4L1BA 1CHQD 2AWOA 2XWJB 3J80E 1CZWA 1HZ6A 1QOBA 4K5WA 4M0WA 2F0WA 2D5DA 2E6XA 4H0LC 2EOTA 1NSNS 4ZRPA 1S5BD 1DCZA 4GDLB 5C3WA 2Q5WD 3GTPB 3RMHA 1QLBB 1PLFA 3U2SC 2Y3AA 2WXKA 4CKCA 3Q8AA 1CTMA 3C1FA 1YQ4B 1L4ZB 2PVOD 5EE1A 5HGTA 4X3UA 3KLSX 3PUZA 2XRQD 1G8ZD 3M4YA 1WTQA 2ZXRA 1OXSC 2HCIA 2K5WA 3NTHA 1QQRA 3I70A 1V97A 4NAWB 1II3A 2W54A 4HKZE 1PFBA 1LTTD 2EELA 1L6VA 2VB2X 4ULLA 4EQOA 3DMUA 3HRDD 4XDXA 5D3IB 3Q69A 1IW7D 1G2SA 2KOLA 2NN6H 4FVMA 2HUGA 1B53A 3W2DA 1TKYA 3Q24A 2L52A 2J0TD 1Y8PB 1JWUD 1WTVA 4C3HG 2KDMA 3B2GA 4XDDA 2NVYB 5IT9L 1TWAB 1YNNC 3FVQA 4IURA 4C80A 1DOKA 1PRTF 1DOIA 5EQ0A 5CBAE 5FLXL 2B2WC 1OXVA 5AUKA 3IT4B 1HFGA 5LL6X 3HOYB 1WXQA 4JBWA 2VXWA 1J7AA 2DY8A 2A68C 1IL8A 1E7PB 1XCTL 4XDCA 1EZ8A 1C8CA 1PDQA 2HDMA 1PGAA 3I4MB 4IALA 2KACA 1QILA 5LNK1 2NBFA 1IKMA 1C77A 5C44B 4Q0FA 3V05A 3AE1B 4TMAB 3FILB 3U52E 4MT5A 2JA7B 2L11A 2BB6A 1K50A 1X3PA 2RKSA 3TP8A 1ZKOA 1S5CD 5KNDA 4L6TB 2JEAI 1F2MA 3DWPA 1L6UA 4XYQA 4K14A 3UI2A 1JE4A 4NKLA 1SNQA 5FO7B 2BDOA 1W6JA 4K2KA 3MFYA 3OSOA 3RZDB 1VMCA 2B76B 1WSPA 3PMFA 2JZPA 1UAPA 2IWHA 3I3CA 1WGKA 2KJXA 2DYOA 4ZKCB 1MHXA 3H09A 4XE0A 1C4AA 2D9UA 3A54A 2EY1A 4A6QA 3OMCA 5JPNC 4JWSC 4WWMA 2BT6A 1O80A 4QF4A 2A68D 3SDZA 2B8FA 4L8JA 3NSWA 2KUMA 5BN4A 3HOVB 4F7XA 2B39A 1SYEA 1SMYD 2PMZB 1Z47A 4A3JB 5K36G 1SNOA 1TR5A 2IPKD 2R3ZA 1S5ED 3B2FA 5EPJA 2B2TA 2OXPA 5DM73 4DU9A 5JXVA 1FD7D 1OO9B 3LYYA 2M9VA 1S5DD 2WDRB 1AN8A 1LO5D 3S1MB 3A8KE 1Z7TA 1H9SA 1HUMA 4X3SA 2LMCA 3MTSA 2IT1A 2KCNA 1SBBB 1I6HB 4DN4M 1U9RA 4WURA 2QSDA 1I4RA 1QF6A 3TEYA 2EJFC 2H89B 1B44D 2R7ZB 1WRIA 2JE6I 5M5XB 5I9OA 1B50A 5H92C 4GDKB 1U4PA 3J81E 3AV8A 1AEXA 2CW0C 2WV6D 3D4WA 1GUOA 5JAVA 4AQ7A 1YQ3B 5E4XA 1SF0A 3GS2A 4ZQ3A 1ICWA 5C0XG 1JC7A 2DWQA 1LLRD 1TS5A 3DUZA 1ZOYB 1HA6A 2O5JC 4IN3A 2A74C 2BE5C 3U7ZA 4KV6A 4C3JB 2QDBA 1F9QA 4CHTB 3KUPA 3MJ5A 5IGCA 3H3VC 1TKEA 1YNTE 1ACCA 3Q8CA 3AEGB 4KY5A 1BO0A 1P7EA 2ONQA 4V0BA 4K8IA 2K04A 1EY4A 2YU9B 3G7LA 5JOBA 5C0XJ 4K5VA 1EY9A 1WTRA 4N59A 1PDXA 4DK1A 2HDEA 3D8GA 2K01A 3V96A 4C2MB 4MACA 1EU4A 1T5XD 1J9OA 3BK1A 3HOXB 5CR3A 3S1NB 2CW0D 1XXGA 3AE7B 3B9JA 1C76A 2RMMA 4TQ1A 4P2CB 1WD1A 2EYJA 3C3LA 2ZW0A 2WINB 4OW0A 1RFKA 2BS3B 3T53B 4Q5VA 1KDBA 2R61A 4RKBA 2LKVA 1BUIC 2RA4A 2FFKB 3FEWX 2QEJC 2TSSA 1TKWB 1VZ6A 2IL8A 4BA1I 1X3QA 1CI3M 4RWSC 5C0XI 4YTNB 2K03A 2JEBI 2RPVA 1RYJA 3DWGC 2KVMA 3NWTA 4OHJA 3LWEA 1XF5L 2PPBC 5D7GA 1Y1VB 4F87A 3D6CA 2J53A 5HFYA 4RH6A 2B2YA 4EVOA 4HR7B 3TEZA 2AUJD 4C56C 4KKSA 3ZQ4A 1PTOD 4H44C 4R9WA 2HCCA 2EYPA 1V1OA 3NXWA 2K22A 2NZ1D 1CM9A 3VA7A 1DONA 2JSVX 1X32A 2X6GA 3ZGZA 1N63A 1WTOA 1D4BA 2KWDA 3DEOA 4IZ8A 1ZE3D 1CJEA 2Z4HA 1KF6B 1XLPA 2J42A 1VZ8A 1TU2B 4EQPA 1FFUA 1FMAD 1ZDXA 1JOQA 1NUCA 1GXDC 5BN3A 3NRZA 4KTAA 4C7ZA 1DOLA 4A3IB 1MI0A 3GTQB 1H9MA 4XYOA 3W5UB 4KGRA 4DK0A 1YJJA 1EOTA 3GTGB 4OO1H 4RHSA 5ELDA 1RODA 1E0ZA 1TY0A 2EY5A 3VR2A 4DNTB 1C48A 1KRHA 1EQVA 2PIAA 1B9NA 3P4SB 1B1ZA 4DNRB 2AUKA 2WKDA 2PKOA 3X3MA 4PT5A 4US8A 4ZK9B 2LUMA 2W55A 1RM6C 3BVGA 2IX1A 1GHJA 3C1EA 1PTOB 1Q1BA 3T51B 3K58A 1HEZE 1E9MA 3GTMB 1AZPA 4ODGA 1HQRD 1BUVT 2F0EA 1FNVA 1BOSA 5CORA 3E56A 4XQQA 2WXFA 4CKBA 1NVID 1KNEA 1JQYD 1QG7A 4KHZA 2M19A 3AE8B 2FE8A 1CZPA 1ET9A 2YYZA 1HXYD 1BBXC 2WB1B 3S17B 1KDAA 3MEHA 1HUNA 1QT9A 3GTJB 1J7BA 4ZHOA 1BMLC 2F0TA 1QE6A 3HOUB 5KYIA 5KGUA 3QOJA 2PZWA 1N60A 1NI3A 2WXLA 1TWHB 4ZOHC 2JXMB 3F2UA 1E6EB 4G57A 1AW7A 2E2DC 1TWFB 5LHY1 3Q0AA 2ZXOA 3MWYW 5I4DA 4OZCA 2RDHA