2AQ3B

Crystal structure of t-cell receptor v beta domain variant complexed with superantigen sec3
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
234
structure length
234
Chain Sequence
SQPDPMPDDLHKSSEFTGTMGNMKYLYDDHYVSATKVKSVDKFLAHDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKDGKVTGGKTCMYGGITKHEGNHFDNGNLQNVLVRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T-cell receptor beta chain V
publication title Structural basis of affinity maturation and intramolecular cooperativity in a protein-protein interaction.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 64
structure length 234
sequence length 234
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2005-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
B PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2aq3B02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2aq3B01
2QEJC 3BYYB 5ELCA 1LTBD 2AQ2B 4RHSA 1B1ZA 1S5DD 1PYWD 1S5BD 1HXYD 1TS2A 1JCKB 5ELEA 3R2TA 4TSSA 1YN5A 1BCPB 5ELDA 1PTOB 4OHJA 4RH6A 1EU3A 4RGOS 1KLUD 1UNSA 1TS3A 3O13A 2Z8LA 1SE2A 4UDUC 3OWEB 4RHRA 3BVMA 3V05A 1KTKA 1MD2D 1LT4D 1F77A 1BCPC 1LTGD 4C56C 1EEFD 1PTOC 3SEBA 1JR0D 1D5MC 1PRTD 1SE4A 1JWSD 4Z9CB 1FNWA 5ELFA 3MFGA 3R8BA 1S5ED 1KLGD 1LTAD 3DWQA 4RGMA 3KLSX 1TS5A 2G9HD 2XN9C 1L0XB 1LTRD 2WV6D 1CT1D 1M4VA 1S5CD 1STEA 1TY2A 2TSSA 4K6LA 4DXGA 5FK9C 1ENFA 2NTSA 3DWAA 2IJ0A 4RGNA 3MC0B 5TSSA 1LT6D 1EFID 1LTSD 1XTCD 1V1OA 1HTLD 1FNUA 1YN3A 1RF2D 1CHPD 1JWUD 3BYTB 1ESFA 1SE3A 1D6EC 4DXFA 1CHQD 2QILA 2XRSD 1B44D 1CQVA 3URYA 1JQYD 1I4PA 1FNVA 2SEBD 1RD9D 2AQ3B 1LLRD 1LT3D 1YN4A 1CK1A 3EA6A 1PTOH 1PZID 1SJED 1BCPD 1PRTF 3EFXD 1EEID 1PTOD 1D5ZC 2XNAC 3CHBD 1D5XC 4ZYSA 1LT5D 3DWPA 2RDHA 1LTID 2RDGA 1QILA 1DYQA 1HA5A 1PZJD 1BCPF 1V1PA 1JWMD 1PZKD 1SXTA 2J4XA 2O2LD 3BVZA 4O1NA 3BVGA 1ET9A 5ELBA 1LTTD 1AW7A 1GOZA 2NTTA 1EWCA 1FGBD 4L6TB 1SBBB 3BZDB 1EU4A 5FKAC 1PRTB 2IPKD 1G8ZD 2R61A 2AQ1B 3GP7A 4RGTA 3W2DA 4RCOA 3R2IA 1I4XA 3TSSA 4BWGB 1FD7D 1HQRD 1SEBD 1I4RA 1ET6A 1I4HA 1PRTC 4L63B 4NZLB 1S5FD 1AN8A 1XXGA 1TY0A 1DJRD 2XRQD 5D3IB 1I4QA 1PTOF 1LO5D 1T5XD 1SJHD 1V1PB 4RFBA 2ICIA 1BXTA 1RDPD 1UUPA 1RCVD 1TS4A 5D3DA 5I4DA 1L0YB 2CHBD 1I4GA
chains in the Genus database with same CATH superfamily
3EBEA 4AYBE 1HNZL 2JA7H 4LUZA 3NP8A 4DR4Q 2DN8A 3GTQH 3CU7A 1YHAA 3LDZE 3NJTA 1OXUA 4W9KA 4HJAA 1N5XA 1ONLA 4LNIA 3Q2AC 3DWMA 2N55A 5DLQE 1JALA 4ZDVA 2RDFA 5C4ZA 3X3NA 1O7YA 1UNSA 4F87A 4Y7NB 3GE3C 2OF1A 1PYSB 2E5LQ 2KZRA 3E56A 1LT4D 1E0BA 3FHWA 2R2QA 1WTXA 1R4NI 3PUYA 1EWYC 4LF5L 2R7ZH 3AM9A 3P2BA 4B3SL 4D2KA 4IPDA 4M0WB 1CZWA 3DPDA 1BUVT 3PO3B 2QIEB 4JI8Q 5ELFA 1RWSA 3MFGA 3AEBB 3FC4A 3S17H 1EZ6A 3N9YC 2ZM6L 1K8GA 2OQ0A 4J3OD 3ZXVA 2M2LA 3PVLA 2VY3A 3ND8A 2W3SA 1E24A 1W3SA 4DR2Q 4YWLA 2D07B 3UIOB 2KX0A 1GO3E 2W82A 3VR9B 3UDGA 1EUJA 1J9OA 1ENFA 3QC8B 3LGJA 3J7AV 4DAYB 1KC8C 4HROA 1IBLQ 5C3EG 2C35B 1LTSD 2TMPA 1UWVA 4XZ4A 5C5LA 1PH8A 1JOQA 4IURA 2KACA 2E2JB 1JMLA 1SE3A 3I56A 3HOVH 1I3QH 3K58A 3FILB 5CV7A 2XRSD 1PH7A 2DJFC 3Q8EA 3NTHA 5C23A 1FNVA 4OGQC 3TREA 2BH2A 3QAQA 4MGZE 2GN5A 2KN5A 4A3IH 3DBRB 3VA5A 2MP2B 4O42A 4KKIA 2A69C 2JEBI 3SVMA 4IKGA 5AUIA 2WXFA 3OW2A 2NPTB 2RMMA 2F0OA 3IL8A 1WTQA 1VQGA 3CHBD 2AUJD 1GXDC 1V9PA 3AFPA 1Q1EA 3KLRA 2NVTB 4RF0A 2CJOA 3KUCB 5JEAH 4GOCA 4A93G 1C4CA 3AU4A 4HKQA 3ZRFA 3U9SA 1WXAA 4BKGA 3I7FA 3QARA 1ET9A 2N7EA 1KIXA 2DYMA 3EUB2 3PRZA 3A7AB 2V0GA 4L1BA 3U9OA 3CCLA 2K9XA 2UXBQ 1IL2A 4KY6A 4MELA 5BR8L 2KWUB 3K5MA 3SFEB 4PMWA 4TRDA 2EY5A 5IWAL 2DBYA 3DHQA 4IUNA 3AE2B 3NZ3A 3AEGB 3S1QB 3PF5A 1VQLA 4DR6Q 3K8AA 2INDC 2NMQA 5J3BA 1I4HA 4ZQ3A 3H3VC 3FEWX 3EECA 1STHA 3ABVB 4K14A 1VQ6A 3TBIB 4IFDG 4MM3B 4OVUA 2F0EA 1LO5D 1T5XD 2Z0SA 2LGXA 1XMOL 4X3UA 3OPOA 4NP5A 1EYAA 2KCNA 2ZXOA 3J81E 5AUKA 2ZJRA 2EYJA 3T1HL 5T1IA 3NELA 5LLIA 4A3MB 3M4YA 2K22A 5L83A 5IIFA 2RCNA 3S2HB 2PCFB 3FRPB 3DBLI 3EFCA 1TS2A 3PREA 2VUMG 4I7AA 2KNBA 1H4RA 2EELA 3DHIC 3L2PA 4J6HA 4CKBA 2BKFA 2N7JA 1LV9A 3E3XA 5MPOA 4YTMB 1WTOA 1IHZA 1I50B 1O7IA 3PQIA 2P5ZX 3KFUA 1KM7A 3AI5A 3APCA 1Y69U 4B9XA 2B63H 4ANWA 4P72A 2JXXA 3M9BA 3EN2A 2M0XA 1MD2D 2V9HA 4FF4A 5EE1A 5JJKA 4CJ2C 1TWHB 1BCPC 4DUZL 2V4LA 1PTOC 1RYJA 1TKWB 5M5YH 3OYYA 3DWGC 1MJEA 3P1MA 3MTSA 3DCGA 3MJ5A 1WOCA 3RNAC 2CWPA 2FJ2A 1VQNA 1OQRA 2KHIA 2PNHA 4RGMA 3H9DA 1TS5A 4P2CB 2G9HD 1H95A 3T1YQ 1LTRD 2DAFA 1CT1D 3NTKA 1N34Q 2YEPF 1YIJA 1I94Q 2HD3A 2I46A 4BBSG 1FCLA 1V5OA 4C7YA 1GHKA 3N52A 2L5TA 3S1MB 3DWAA 2PMZE 4II3B 3DVNU 3D4WA 1XPRA 3K80C 2CH4A 1NTGA 1LT6D 4ZHPA 1XPOA 4ABNA 4P71A 3UI3A 5C4XG 4A3OA 2EIFA 2HCIA 2Y3AA 1RF2D 3GTOH 3ZTCA 2JT4B 4ANVA 2BW2A 3NEMA 3AE7B 2Z4IA 1WYWB 1WFYA 4LDTB 4NAWA 4EUTA 1WXSA 1PFSA 2GBJA 4DNIA 2PQEA 3TEZA 1Y1VB 4K1RB 2UUAQ 3HOZH 2NS5A 3L16A 4W9FA 4CDDC 3QR8A 1NEKB 4ZHOA 4QB4A 3U4VA 1EQQA 4OO1G 1MGSA 1HTPA 2UXDL 4A3JB 1ZGUB 3PT2B 3OAWA 1ZW7A 3I70A 1VQAA 5EKKA 5LL6X 2V4IB 1GJZA 4IWQA 3QJZA 4MH8A 2G4SA 2RDGA 3PV1A 3RUIB 5FOBB 2J0TD 1ENCA 2KDBA 2R92G 1JWMD 4IWPA 4FULA 4P1CC 3RFZB 1EF1A 1KAAA 2WDQB 4URKA 1ILPA 3OOCA 3E5SA 4BAXA 3EJIA 4HMIA 1BDOA 1EY8A 2WP9B 2MHVA 4UP8A 3U30A 5KYIA 1SNDA 1RRBA 4ITKA 1TXYA 3SK4A 2ON8A 5LXHA 1NENB 3HOUG 1UWMA 2JWZA 1E7UA 5M5XB 1RHPA 3LNNA 3GZNB 4GKJL 4BBNF 1HH2P 2O6VA 1XNQQ 4ZRKA 3ZYYX 4BWGB 1SROA 3GTGB 2SNSA 4M8AA 2F0IA 1PRTC 2KQ4X 2CVRA 4ILWA 4NZLB 3I91A 1UE7A 4DK1A 4C3IB 3GB1A 2C5LC 2D0OA 3PHXB 1HZ9A 4MJSA 5IYDH 1C4AA 1WGKA 3BIID 2ICIA 3MAQA 3Q24A 2G4DB 1WM2A 1UUPA 4UY8C 4LNOA 3W5OA 1E2WA 1FGUA 3FPPA 3ERSX 1Y56A 2QEJC 1XWEA 2XGTA 1NI2A 3BK1A 1RLFA 3TP7A 1UWXA 3SXHA 1QQRA 1SYFA 1Q1BA 4C2MH 2OWOA 1IZ6A 1SIJA 1AP0A 2VRRB 2IHEA 1CZGA 1LGRA 4RGOS 1KLUD 2E76C 4DV4L 3O13A 3MC9A 1RTNA 1RFKA 2ZPNA 5IYBG 2BYTA 3DMUA 4BA2I 1Q12A 1SNPA 3M4OH 2V3SA 3PGEA 4DHZE 1DD2A 3ZTDA 1FIQA 1YNNC 2PE6B 3B9JA 3KLSA 2RKSA 3TZUA 1N32L 1G6ZA 4ALPA 4LUOA 1XQQA 2C9WB 3EHVA 1D5MC 4QY7A 4JI0Q 2AL3A 4C3HH 1JWSD 3NWSA 4Z9CB 4LFBQ 5CHFA 4DK5A 2WWZA 2JZPA 5E4WC 2RSNA 4OO1I 3UI2A 1XNRQ 2NN6H 3AE1B 4HTHA 5IN7A 3MHSD 2WV6D 1F2MA 3RNGC 4A3CH 1M4VA 4RM9A 2H1EA 3KH0A 1FFUA 2G1EA 3D31A 2K1FA 1JRUA 1RFAA 4C3JB 4LF6L 4Y7NH 3AB5A 2E2HH 1K8RB 4N9F4 1Z5SB 1ZOYB 5I6WA 3GO5A 3CP0A 3ML8A 4RNAA 1T9HA 3OW7A 1GHJA 1PFDA 1HTOA 2X8XX 3DUZA 2MSED 3RCZA 2UUCL 1JWUD 2N7DA 1L0VB 4KGRA 3MXNA 3L0WB 1GB4A 2HQLA 1K51A 2N9XA 1STAA 1K50A 1CQVA 5CYUA 4HK2A 2KEDA 1M1KC 3X3MA 2PZUA 1WGGA 5IGGA 4E6IA 4R8NA 1R4NB 1WX9A 3T51B 4LF7Q 2JZ3B 4IOIE 4BKTA 3VFKA 2K25A 2DENB 1EFWA 4US8A 3DVGY 4RF1A 2ZJQA 4BKSA 2WKDA 2Y0SB 3W9CB 1VQFA 2N9KA 4FJVB 4AOFA 3MWYW 4G11A 4X65L 3NE5B 4MACA 2Q2IA 3GTMB 3PSEB 3EGRA 3RULA 3M3YB 4O1NA 3ZNID 1Q8KA 2IX0A 4KHZA 2FCNA 3RZFA 3PMFA 1MHHE 3RZWC 5C0XJ 2K6QA 4WWPA 2WB1G 3NBIA 4R3DA 1WMHB 2XIWA 4NKLA 2N9EB 1VCBA 2WINB 2K3UA 2K28A 4G3XB 1V8QA 1HR0L 3H09A 2ASBA 1XEEA 1XPUA 4MEMA 3V3XA 3U4EG 3CW2C 5CBAE 5H1SE 3KDFB 3I9V1 4YY3Q 3KBXA 4FXKC 3IHPC 3Q14C 1Q82C 4W9JA 4LWCA 4ZUJA 1L6VA 2PLPA 1IBKL 4A3PA 1ZYRC 2ZVNA 3L3OC 5J1ZA 1EIGA 1WVLA 3AFQA 3RZOB 1V81A 2O6VB 4L63B 1HFNA 3EQLC 3OG5A 3A74A 3NQIA 1TY0A 4MN3A 1FXIA 1KF6B 2OCEA 1EY6A 2A69D 1SJHD 5KEEA 5L37A 2UU7A 4B95A 1IXRA 2QJLA 1LYLA 1JICA 5ISRA 1UGJA 3RI7C 1I4GA 4KHPQ 2IYDB 5LL6S 4RMAA 4F7XA 2CHWA 3S1QH 2N9LA 3E0JA 1T0SC 4NJCA 2KMCA 3ZJTA 2PI2E 2MUYA 1VQEA 2I1KA 3ALBA 2PI2A 3KF6B 5ELEA 4AJYB 2SOBA 3UDFA 5E4XA 2N78A 3CSTA 2JA6H 5HI1A 5KHQA 2YV5A 2L8JA 3JSVA 1F2RI 3O65B 1Y1WH 1TWFH 5E1FA 1E1OA 4HJ5A 5CX3A 4RWSC 3MEHA 3OWEB 4JI7L 4K0KL 2AKWB 3KF8A 4DK6C 4LFCL 1BVSA 1QE6A 1N36L 4AH6A 4C56C 5JJLA 3SEBA 2LFNA 4LDTD 4G7OC 3FKIH 2JA8H 1WGDA 2PPHA 3WAPA 1TYGB 3R93A 1P98A 2D9UA 4HIMA 5CORA 3V6EB 2V3PA 2WXMA 2IO2B 2KA7A 4K8IA 5M3FH 4JI5L 4PMCA 4KDIC 5C44H 4AYBG 2WP8J 1B9NA 1GUSA 3AQQA 1I50H 4CKCA 2E6XA 1UF0A 1KDAA 3UIPB 2L12A 2K8BA 1WIAA 2F0WA 2HTME 3PZ7A 3AE5B 2F0GA 1V8CA 5C3EB 3VR2A 2CKZB 2F4VQ 2EYMA 1YQ4B 2E8GA 4DV0L 1ZDVA 3J81L 3BYTB 2IBIB 2EZVA 2ZT9C 5J22A 4IJLA 1II3A 3PSIA 4BBRG 1ZE3D 1B3QA 2Q2UA 2CU3A 5FJ8H 1GUOA 1Z47A 3VYTA 1L6UA 4AWJA 1CK1A 2O5IC 2F0PA 2XWBB 2Z1CA 4NXNL 1BCPD 1LUZA 2N1VA 3A7LA 1PTOD 4OIKA 1A70A 3I4MG 4DAPA 1SR3A 2KFKA 1NJIC 2KCMA 5EPJA 2K8HA 1VCIA 5CV8A 2KAJA 4HLEA 1N5WA 4G7ZC 3MC8A 2RR9A 4A93B 1NAPA 1PH3A 1J5EL 2BYEA 2FUG1 2PKOA 1HFGA 2KVMA 4S17A 4JI1Q 2LD9A 2XK5B 1Y1VH 1NI3A 2K01A 1AW7A 3ZO5B 4A3DH 3BZCA 3GTJB 3J7ZC 1WJ6A 2LHEA 4G4KA 4GMVA 5CTRC 3AMUA 1SBBB 4LFAL 1MG4A 1EU4A 1SYBA 1ZP0B 4JYAL 1UELA 1I7HA 2IPKD 2JF5A 1UBIA 2VZKD 1B7YB 3I4NG 2K32A 2F0QA 2LSSA 2RGFA 3R7RA 3GP7A 4OWTB 1V5TA 3KYDD 3I73A 2JY6A 4JCVE 2JRHA 4BY7G 2I0QA 2K39A 3IFWB 3OJ3A 5EPLA 4ICVA 4B6WA 5AJ3Q 5F2DA 2RD0A 1E8ZA 3TS0A 4R4OA 4ICUA 2L7RA 1I6HH 2VH1A 1GUTA 1E7VA 2G9DA 3BZKA 1HRJA 2FFKB 1YVCA 1I5FA 1FJGQ 2J42A 4DDGD 1HUMA 3NVZA 1PQSA 4DWFA 2JA5H 5IYCG 2BOSA 3VR3A 3P4SB 1J19A 4C1NI 5D7GA 5IGCA 5KNDA 3K57A 3VYSA 1STBA 2WAQE 2PE9A 2IW3A 3NVWA 3HIZA 2R93H 3RT3B 3A56A 3V62A 5G5HA 1LTBD 1FEHA 2B3GA 4K2KA 5CV5A 3GTGH 2B2UC 4WH4A 2DZJA 2CR5A 4OX9L 4YWMA 1L0WA 1AZQA 3L13A 4A20A 3U4ZA 2VUMB 2JYOA 4QF4A 1F9JA 1B50A 1B4OA 1FXAA 3HM3A 4OEMB 1VZ6A 5FLMH 3CCEA 3PHWB 4DU9A 3M7NA 3TL5A 4PYZA 1YJ9A 1B2TA 2NBFA 2NVUI 3IBEA 3IAM1 2M4NA 1QKZA 2KJHB 2ZPYA 2NZOA 2D11A 2F0SA 2GLSA 3BVMA 4ZRQA 3GTPH 1KRTA 4R8IA 1V80A 1A3TA 3ZVVA 4ME5A 2IO3B 3Q3JA 2F3IA 4H02A 1KAWA 1EM7A 4QCLA 3VTUA 1PRTD 1V2YA 1WE6A 4IUMB 4KJOA 2F3VA 1X3GA 5FR6A 3ZDTA 3G6JB 2MBHA 4IFDJ 4A3FG 4JL9A 3FPUB 1WRIA 3OIQA 1F9QA 3IAS1 2MH7A 2L0FA 2UUBQ 5FK9C 1PA6A 4BBSB 2WX1A 2O2VA 1WYGA 2KHWB 5JVH3 2RHQB 2HIXA 1HNXL 1F2LA 4GOPB 3S15B 2JPHA 3BWUD 4K3BA 5JOBA 5C5MA 4A3GG 2RCFA 5I6YA 4JI4Q 3U7DA 1V1OA 2WKCA 1VQ5A 1FD6A 2Y5CA 2ZTCA 5C4XB 2EYPA 2KHSA 3CC2A 1EOTA 4B9KA 3PZ8A 1HJPA 3Q69A 3HVDA 1JWAD 1L1OA 4FHKA 3URYA 3K0XA 3J7A5 1MJDA 2FIFA 4A3BG 1ZXIA 4ZKBB 3J9CA 3ZNHB 2NVYB 5M5WH 3FMCA 4LF8L 5EDSA 2HD5B 3PCOB 1GD7A 4KK7A 2JP1A 3ZXRA 5AFWA 1EYCA 3B1LX 1UH6A 3ONAB 3FDTA 4DV1L 3CF6E 1QNUA 3KUPA 4OELB 2O6VD 3PO2H 2A19A 4TKOB 1V49A 4HXDA 4XE0A 2A5HA 4JI2Q 3P75A 1SYEA 1V1PA 1HZAA 1WJJA 2HTHA 2R92B 5AZFA 2CHZA 4YWKA 1FRRA 3UE0A 4GSWA 3W1SA 3MXGA 3MA2B 1P1AA 2BKRB 4F1SA 1QF6A 4J15A 1VZ7A 1IBXA 3A9JB 1SMYC 5CV6A 5G5GA 3QJYA 4DR7L 1WF9A 4W9GA 1PH1A 1EWHA 3HOWH 2JYTA 2QC8A 3FAHA 4A3LH 4KKJA 4LCDE 1XLPA 3LXFA 4IN3A 2XTIA 1UGMA 4KIKA 3HOUB 1JROA 4LJPB 4LJOB 1F2RC 3GTMH 2E2DC 4LNKA 4DR3Q 4KZ0A 4M8MA 3PIP3 1C0AA 4W9IA 2E74C 1SAPA 5BN4A 1YOVB 2LXAA 3H0GH 3JAMi 4XWTA 2L83A 1L1OC 3BS1A 5FLXc 1K0RA 1VF7A 3H7PB 1DJRD 1K28A 1WY8A 3RZDB 4IJHA 2M19A 2WXPA 4W9CA 1K0SA 4B3MQ 2F0MA 5EE0A 2CQAA 4A9AA 2PQAA 2ZTEA 4GNXC 2OJRA 2VQEQ 5A2QE 4JBMA 1HZBA 4HDQA 3NVVA 4JI0L 4JVZA 2AWNA 4WAAA 2C9OA 4RHSA 1EY5A 1S5DD 3RPFC 3W1YA 3MXPA 1SYGA 2K5DA 1S5BD 1HXYD 3DBHI 5KRUA 3LX0A 4GDLB 2FINB 2N9PC 3W1SC 1FO4A 2UU9L 2BPSA 5C4JH 4DV5L 2FMMA 1WJ4A 3L10B 2LMCB 2KWDA 1WE7A 3VUYA 4W9HA 3T56B 4A6QA 2JZZA 1ROEA 1FYCA 5DPTA 4ACFA 1MI0A 4PT5A 1IW7C 1ZYRD 4QIWE 4K5XA 2BB5A 2BDOA 2EMTA 4OZAA 3LWUA 4G50A 2A68C 2W54A 3CKIB 4KGSA 3UQAA 4GLVB 3NENA 1P7EA 1MSHA 4LF7L 2B8GA 3C46A 1B9RA 3VYRA 3S1NH 4QQBX 2FAZA 3DHGC 3I5JC 2DX5B 2A6EC 2F1MA 2AWOA 4A3KH 2XWJB 2OOBB 1MSGA 1LM8B 4KKSA 2K5WA 2G5DA 2N8NA 3IFDA 3T4AC 4HEA1 2O2VB 3FKYA 2KUMA 4LF9L 2LUMA 1J7CA 1CA5A 1PDXA 3S14H 5HGTA 2FUHB 1FNUA 1WX7A 2C5CA 2IY1B 1WXQA 1D6EC 5G3LD 4DUYQ 1BKBA 3Q0AA 1I6VC 4S0RA 2CH4W 1WGRA 1KL9A 3FP9A 3H8HA 4XXEA 2K03A 3OMGA 4JPBW 2LKVA 5IGFA 3RUZA 1S1QB 2J0JA 4HJKA 4KZCA 4YSYB 1EWIA 1WD1A 2EYHA 2KTFA 4LNNA 2CQOA 1Y8RC 4DNRB 1SJED 2K75A 4ULLA 2IY0B 3KJOA 2F0LA 4KDLB 4GNXB 2WXOA 5GAGC 1JE4A 5EPKA 4JV5Q 1L4ZB 5M3MH 2PTLA 2Z59B 1N60A 2KKCA 3QX1A 1AE3A 1ICFB 4DV2L 1HA5A 4MSMB 4PMBA 1YJ1A 1A5RA 2D2CC 1VQ8A 4PV1C 1PH2A 5J39A 1ILQA 1YJWA 2V4DA 2AUKA 2WB1B 5FO7B 1VMCA 4X66Q 4JI6L 4HCSA 4G0NB 4MZ9A 4CDFC 1Q3LA 1K53A 2R7ZG 4Y52H 4POGA 4K7UA 4X64L 1G8ZD 1ML0D 4ZK9B 1M90C 4KKUA 4GKKL 1SSNA 3CMMB 5G2NA 1OTCA 5E6PA 3U58A 1D8LA 4JI3Q 1SN8A 1TVXA 5IP9H 4DR5Q 4JX1C 3TEXA 3WCQA 1E90A 2OQKA 4WJQA 4NPNA 1WTHA 2JN4A 5BN3A 1LACA 3B2GA 2PJHA 3NOBA 2WXLA 3S9WA 3GV6A 3GTJH 1G2TA 2XRQD 1F1HA 1ZKOA 4B08A 1MHWC 3NVYA 3VR8B 2KVZA 2LGIA 1QB5D 3DQVA 3HOYH 2M56B 2KHJA 1RCVD 1TS4A 2E75C 3I3TB 1VQCA 4G7HC 2D5DA 1Q46A 3HOVG 2ZJPA 1YQBA 1OTRB 1SFOB 1FFVA 2JQRB 5GQOA 1YNTE 2IX1A 4KV2A 4DHJD 5LMNQ 4V190 1XJVA 4A3IG 1J8CA 1PYWD 3RN2A 2KDMA 3DVGX 2LGDA 4NY0A 3CSFA 1JC7A 1JJ2A 2WXHA 1VDZA 1K8MA 4A3EH 1VQ7A 1SYDA 5JPMC 1HNWL 4MNOA 3P4QB 4W9LA 3QOLA 5JEAG 2HHHL 2EOTA 3J80c 2EJGC 1NBWA 3Q23A 4IWOA 1GKHA 5L95C 4NDXA 4XT1B 5C3JB 2KC2A 2BBCA 4C4VA 1KNEA 3HP3A 1YJJA 4LAAA 3RNUA 3S1RB 1CI3M 2Q2TA 1O80A 3SR6A 4YT0B 3TUOA 1S5CD 1YIWA 3QQ8B 3F1ZA 4AYBB 3ONSA 2ICEC 2D5GA 3CIRB 5LXIB 1XLOA 3WA0A 4K5WA 2PW7A 4DV6Q 1GM5A 2HT1A 1XT9B 2CU1A 1SSOA 2L15A 3TDQA 5K36H 3PO0A 1KDBA 4X62L 4KSKC 5FLXL 2ZCBA 2X6GA 4YHHL 4JC0A 5CR3A 3RYTA 1YX6B 3ZDMC 3HOXH 1ESFA 1AZPA 1WXMA 1XLQA 3LJ3A 2NVXB 2LVQA 4KD3A 1CHQD 2KO3A 3F2DA 1HZ6A 1PMRA 4BBRB 3PUXA 2AMCB 2LVOA 2CFMA 1RD9D 1QOBA 3VH3B 2IX3A 4BOSC 3ZRCA 1VQHA 1BQQT 3KQ4A 1CUKA 3TIXA 3VR5A 1TU2B 3QG1A 3BU2A 3E9HA 2C7HA 4RA8A 1BT0A 3H7SA 3KYCD 2DNCA 2GVAA 4B0EA 2N49A 2NR2A 3K7AH 1QVFA 4GIVA 4IUUA 3U8ZA 1GUWA 1N33L 2OEDA 1LTLA 2BWES 1C4QA 3I4MB 5LNK1 5LMUL 2W9NA 3DWPA 2PVOD 2BA0A 2IWHA 5AJ3L 1Y8OB 4APVA 4L5SA 1SGHA 3AH7A 2EY1A 2AWTA 4EZJA 5J18A 2B63G 4MTNA 2UXCL 3IRBA 2B76B 1KJTA 3HZXA 4KN4C 4JWUC 3NRZA 1MHXA 3KWLA 2K52A 4ZRPA 3ZNZB 2WU2B 5AEKB 3I4NB 2I2YA 1U9RA 1IBML 3CPFA 3VUXA 4DV3Q 4OZBA 2V1YA 4JBKA 4LK0M 4P16A 5KNCA 4BS9A 2QSDA 1UAPA 4TUUA 4HIKA 3VDZA 5GAEC 1G51A 5M9OA 4BY7B 1WXVA 2W3RA 5AZHA 3S2AA 3TCAA 3VUWA 1DCZA 3ZIMA 2BTEA 2N0SB 3MXUA 5C1ZA 1YBYA 3RD4A 3J80i 1RM6C 3SFDB 1S72A 1TWAH 1I4QA 3I4OA 1DOXA 3MVVA 3GOEA 3K59A 2ZNVC 4DK0A 1EY9A 1BXTA 3P7JA 1VZ8A 5IOCA 4IW0A 1SE9A 3ZKJC 2KOLA 4JPSA 2J7QB 3CQZB 1SLJA 3BYYB 3L0OA 5IE8A 3RD2A 3HOZG 1L4DB 2XVSA 1GJXA 2LFIA 2PNRC 2I07B 2L76A 5TR5A 3GTKB 2PO4A 4A55A 3HG9A 1XO3A 2R7FA 1BCPB 1VF5C 3VTVA 2JVCA 1PTOB 1KRHA 2WXKA 1SMYD 2B3AA 3CCUA 4FF1A 1R9TB 2ZJDA 1QG7A 4BY1H 4QL5A 2Z8LA 2X6LA 1RTOA 1YEZA 2CWAA 4KHVA 1ASYA 3GTLB 3OIPA 4IG7B 4IALA 1C1YB 3I4LA 4CDCC 2JRIB 3J7AF 5IODA 2IY5B 5CHVC 2F0VA 3RMHA 1AYFA 3E9IA 1YJIA 2BB6A 1WTPA 4HPLB 5IGEA 2K5VA 3R8BA 2VZKB 4KY7A 3ZUNA 4E3CA 4HKZE 3E0EA 3W5VB 2WAQG 4XDCA 4A3FB 2J7ZA 2QCPX 4KN7C 3TQYA 3WIMA 2MQJA 1E2VA 3IKJA 5J17A 1E0ZA 4LF4Q 1N63A 5IP7G 4HSVA 3MJWA 2NB0A 3N1YC 4O0AA 2IJ0A 3S16H 1H9SA 4YIJA 1ASZA 5JZEB 4NB3A 3DLLA 2YTYA 4A3GB 4YWGG 2QDFA 3BY4B 2IO1B 4KD4A 5A2QL 5GMVA 5IYDG 4DAMA 3U2SC 3T53B 4NQLB 3CC7A 1B44D 2K1BA 1WCMG 3P1HA 1CA6A 2OHFA 3OLMD 3RMKC 4A3BB 1X3QA 3H94A 3SDZA 1WM3A 2MJ3A 3PTFC 2DGYA 3EA6A 4CGYB 2ZXPA 3IAYA 1AARA 2BWFA 2ZNVB 1JWBD 1BR9A 1IW7D 3EFXD 1VD2A 4N58A 4WWOA 1TWCB 4IUQA 3PRMB 1C9OA 1VQDA 5C2TB 4ZYSA 1QOGA 2EVBA 4J8QA 1TWGB 1QLBB 2A68D 3MZ5A 4GZYC 2ASQA 3EFUA 3L54A 1WSPA 1J0GA 4AQYQ 2OXPA 4FXGC 2J4XA 1GUAB 3AE4B 2D3GA 2C60A 3P4PB 2EKIA 2PMZB 3OTOL 2JEAI 3APFA 1Q8IA 1U0LA 1NDDA 4R4CA 4O2DA 1HEZE 4RKLA 1GOZA 3PO3H 2FNJB 1FGBD 2GBRA 1KLVA 2JQOA 2VQEL 1VR9A 4UAIA 3OSOA 1PRTB 4NAWB 3IT6B 1R4QB 4C3HG 2MHJA 4HJ9A 2AQ1B 3ZW3A 2RHSB 2NN6G 2L3ZA 2LASA 1Q81C 4A3CG 1TT5B 2LVPA 2A6HC 2BH8A 3A1QA 4FN2A 4OWXB 4B3RQ 3T3OA 5T1GA 2OJWA 4TV3A 2MJDA 4BZAA 1ENAA 1EQTA 4RG1A 3TP8A 2IZVB 3GE8C 4JLCA 3V61A 2E2JH 3I57A 3G7LA 1ZKHA 2LS01 4FA6A 1D1KA 2K50A 4RFBA 2Q8IB 2K5HA 3VR4A 4POFA 3BJUA 1OXSC 3BINA 2MO1A 1F52A 3QCAA 3UQBA 4DR1L 3C8YA 3Q3FA 2L55A 1HNZQ 2CHBD 2EKEC 2Z9HA 2GBNA 4GLAC 2YU9B 2VQFL 2A5UA 4IC7B 2LRUA 3SU8X 4M1UB 4DR4L 2GBKA 3K5OA 1T5EA 3R2TA 2NVTH 1IUEA 4ANUA 1YNJC 2GRIA 4QGUA 1WRDB 1C4PA 2RPQA 4Q5VA 2D3CA 1OFFA 3GS2A 3BDLA 1VDVA 1R7SA 4UDUC 4A90A 5E3FA 2Q8RE 4RHRA 2XBBC 1HTQA 2VZAA 4LF5Q 2E5LL 3HKZE 4B3SQ 4MJSB 4EOYA 3L17A 2WXGA 3AE3B 3DM3A 4XYOA 2RPVA 4B9WA 4TQ1A 2ZM6Q 2KTRA 1FNWA 4F7ZA 4ZRIA 1K9MC 4YCUA 1LTAD 1N62A 4JI8L 4IUPA 3ZJYC 2TSSA 2PEAA 2KD0A 3QHTA 1NMGA 2ACZB 2J0MA 1NYQA 3KW5B 5T8IA 4K2LA 4DR2L 3A9KA 5GXGB 2H89B 4NMZA 1IL8A 1QUQA 2BE5C 1QT9A 1YX5B 3HVZA 5TSSA 3F8TA 2V3NA 2DZMA 4PS3A 1MI2A 3F2CA 1IBLL 2FCMA 3Q3OC 3C1FA 4AIMA 1ZUD2 4XGAB 3M4QA 1VJKA 3H6NA 2LGYA 4E74A 3GQBA 4WJOA 1KABA 1SYCA 1U4MA 3UDIA 1GNUA 4YTNB 3TEYA 4A3MH 4DHZB 3TP6A 4K7WA 1CSPA 5KGUA 4W9DA 5DM73 4QJFA 1SIFA 2NN6I 3BDCA 3T13A 3S2HH 1STYA 2OT2A 4A76A 4YL8A 1GC6A 4MHEA 4ZUIA 2KCCA 4ZKCB 1OEYA 3L08A 5D6JB 3K5LA 1AFPA 1HE8A 4N8X1 2KANA 1OO9B 3M4PA 4DR5L 4FNFA 1BBUA 3HRZC 3GTQB 2BT6A 1JOOA 3A8JE 5I9PA 1DXMA 1MKHA 2KBNA 5DCNA 1LT5D 2YTVA 1AE2A 1LTID 1XLNA 4IPGA 4TQUS 2JA6G 3DBLB 3Q8AA 4JWSC 4KX6B 2MCNB 5FO8B 2DWQA 1TWHH 2WXRA 1LM0A 1SXTA 1Y1WG 3DEPA 2ONQA 1V43A 2Y5PA 3NBHA 1G6JA 1K8OA 4X6AH 3Q8BA 5BMHA 3B0AA 3QIAA 4HJ7A 4L2YA 2YYZA 4L6TB 4OWWB 3MXNB 5BR8Q 3FKIG 2JA8G 2R7ZB 2L9HA 5IWAQ 4WJ3M 5DEHA 5LMNL 4YXDB 5BN5A 2UXBL 2F3WA 1NBFC 3RLNA 1S3SG 4EE2A 3I4MH 5M3FG 3S17B 1A0IA 3S1MH 1TGZB 5H92C 3W2DA 1E10A 5C44G 1YJNA 4IOAA 2B2WA 1VQJA 4WJ4A 2Z0EB 1DM0B 2B29A 3MP9A 1IYFA 3TSSA 1I4RA 5H8YE 4LNQA 4RM8A 4BA1I 3PUWA 4XTCS 4DR6L 5HKHA 2YVCA 4IZ8A 4US9A 1XMOQ 4RKBA 1N8RC 4CJ1B 3M85A 3H1UA 3VR6A 3H3VH 4PK1A 2ID0A 4AJWA 3I4NH 3D6CA 2BS2B 2JXTA 4PQXA 4K7SA 4CHKA 3HOVB 1QOAA 2ENBA 3D6WA 4N9TA 2PW9A 1UBQA 5FJ8G 2N88A 3TN2A 5IT9E 1X9NA 4A3JH 4A3IB 1JCKB 1W6KA 3VDYA 1GC7A 1YN5A 2GVBA 3S2DB 1JQ4A 2K04A 5ELDA 1XCQL 2WXQA 4K81A 5IP4D 1VQOA 1E1TA 4EZLA 2JA9A 3A8KE 4DV6L 4OVVA 1PGXA 3PGZA 2WIIB 4DKAC 2BVCA 3MHZA 1EZ8A 3KJPA 2KJXA 2MRPA 5CBEE 3K5NA 3VRAB 2WACA 4DUZQ 1KTKA 1UE5A 4NXMQ 4FF3A 3DXJC 2EYFA 1P8LA 3CQZH 4J6IA 1EEFD 2IL8A 5FLXE 5JAVA 5BMIA 4ARIA 1SMXA 2EY2A 4A3DG 4CHTB 1EO6A 4I6LB 5CGKA 1KFYB 3RLOA 3AB9A 2LXCA 1QJOA 1S5ED 1KLGD 2SNMA 3DWQA 4LJZC 4F88A 5M5XH 2JYEA 2MLBA 4GDKA 1STEA 1PVOA 4ZRZA 3CCJA 1KD1C 1XTDA 3T1YL 1HZCA 4NPSA 1N34L 1YHQA 3GTLH 1FR3A 3G48A 4C3IH 1IKMA 1EIHA 2RDBC 4GXBA 2NTSA 3P20A 1I94L 1RL2A 1K83B 1E7PB 4BBNC 1H9RA 3MC0B 5EJWA 4BXXH 3I72A 4U68A 3JAMc 3B2FA 1EFID 2F0KA 3JSVB 1S40A 2IT1A 1Q1OA 3SD5A 1WI0A 4Q0FA 3UF8A 4ZAIA 3KF8B 1J6QA 2NUCA 5EBDA 2QDLA 4A3FH 2QF7A 2JA5G 2YEPB 3I8ZA 1G2SA 1DGSA 3BK2A 4DHJB 3K81C 2UUAL 3U7ZA 4JOIA 1CKNA 3BDOA 5JEAJ 4H44C 3ULJA 2R93G 2R6GA 3CPWA 3JYUA 1EF5A 4R4IA 3D8GA 3N1ZC 1EEID 3A0JA 1D5ZC 2WFWA 2JJQA 2DUDA 2HDMA 2RDHA 1X3EA 5FLMG 1A6XA 2PIAA 4XDXA 2K8CA 4M8NA 1HR0W 1BCPF 3HK0A 1C78A 4GU2A 2NZHA 3PUZA 3KUZA 4XYQA 3B08A 1U4RA 2B63B 3IVFA 4X57B 5EE3A 5DPRA 2HUGA 4A3BH 2H88B 1EWCA 1H9JA 1EY0A 3I2ZA 1P16A 2HDLA 3NZUA 3EIVA 5M5YB 2CCZA 1TKGA 2VNUD 1VS0A 5C0XH 3MFYA 1G6PA 1H8CA 3C2PA 4GKJQ 4C3JH 1C7YA 2LRWA 4NAMA 1FXTB 4KTAA 4PZ6A 4GN5A 1YNND 1QZHA 1DGJA 1UEBA 2K6AA 1LXDA 3RNBC 1IGCA 4OONA 1XNQL 4AQ7A 2Q8TA 2D2QA 4IM2A 1AN8A 2KFKB 1WYDA 5NUCA 1VMPA 2INPE 4NJ7A 3AXCA 2RSUA 1YHBA 5CHWA 3DOWA 2Z6BA 1TKEA 2GB1A 1JORA 2LZ6A 2KDEB 4JOIC 4M0WA 1OQYA 1T0YA 1RDPD 4UHVA 3HGBA 5IT9c 1Q7YC 4FF2A 1TZ1A 2N1WA 2I5LX 5CMDA 1SNMA 1E2ZA 3A5ZB 1M94A 5K5PA 4R4TA 3HOZB 1P7FA 1J7BA 4CBVA 2EY6A 2HE7A 4L5TA 4DAYA 4GN1A 4DV4Q 4C7ZA 5E6JA 2W55A 3PIOA 2FIDA 1D7QA 3M3YH 1X1MA 1JT8A 1IYJB 1MJCA 1X55A 3AU5A 5C3WA 3NK9A 3NHEB 4DDID 3PO2G 4H2AA 2DZIA 3Q3MC 4H0LC 1F2ZA 5G55A 3FILA 1ZXTA 4WIPA 2D10A 3AEAB 5KNBA 4FXCA 2X69A 1PXUA 2A6HD 2YU9H 3HFZB 2DLBA 4MIUA 4IO9A 3GZNI 2SDFA 2MP2A 1GB1A 2LI5A 4P7IA 3QIJA 4LFBL 2EXZA 3KLSX 3HOWG 2CHXA 2NPTA 4A3LG 1VQ4A 1XNRL 2BQQA 2WAQB 5IGBA 2MBBB 4LF6Q 3RZOH 2M9VA 2H4OA 2AL6A 4UPAA 2KN4A 1ZXHA 1K52A 5CC4A 3HM6X 2FCSA 3H0GG 4ZYNA 3R7QA 2UUCQ 3K7UC 3TBLD 2ZW1A 2L1AA 5E7NA 4MH0E 1CHPD 4KV6A 4LNFA 2KVRA 1YNJD 2DNFA 3J80E 2MP1A 4HIOA 2L0TA 1I4PA 1WCMB 2SEBD 1EYDA 2DNEA 5D2MB 4GB9A 1QOFA 1WGHA 5A35A 1E8WA 2C7MB 1Z9FA 3DDCB 1NMFA 2WGSA 3AEDB 2K5QA 1EIYB 2MW5A 2QMTA 4C2MB 4F8MA 3VXWA 4BKSD 2SAKA 4MM3A 1HA6A 3V60A 1FL0A 1GPXA 5BYQA 4DGZA 1HUNA 2KEEA 3FVQA 1PZKD 3AU7A 3L9AX 4ID6A 3ND9A 1Q5WB 2KOXA 1KNAA 3M4OB 2BYFA 3CCRA 3UGBB 1HR0Q 1V86A 3QA8A 5C0XI 2BE5D 4DAVA 3K9OB 4CO7A 1D1IA 4DXAB 2DJGC 2KDIA 4H7BA 2K5NA 4EZKA 1L1OB 2CW0C 4C3HB 1ZPSA 2DAJA 3NQTA 3NTIA 2ZZPB 4DV7Q 1IBKQ 2JA7G 2NCNA 1CQFA 4YY3L 1MPEA 2L32A 5FR3A 5DPWA 4RCOA 3E9SA 3IXSA 3DHHC 4HPPA 1GG3A 3NXWA 1SEBD 4A3KG 3JVZX 1Y14B 2H5XA 5HURA 5C3EH 5EBCA 3G4SA 3G71A 2OEOA 2L11A 1F9RA 1CKMA 2E2HB 1T0QC 1CM9A 1VQIA 1BNZA 1NVID 3EC8A 3JAML 1Q90A 1YITA 1UZXB 4Q2JA 1V1PB 3A54A 4HAEA 1FCCC 2DYOA 3STBC 5D3DA 4ZCKA 2EYOA 2A1AA 3NUHB 4FHJA 1TY2A 3T9LA 2KX3A 1IBXB 3P42A 5C6AA 1A2TA 3QOJA 2AQ2B 4KHPL 4ASWC 4K3CA 3DM1A 2J53A 3F2BA 2F4IA 2KC1A 4DBGA 2KFJA 3TZDA 2LJIA 3RLFA 1XCTL 4KIKB 1W6JA 4A93H 1EU3A 5D14A 2XSCA 5EQ0A 5EKIA 1T0RC 4JI7Q 3JW0X 1TIID 4MT5A 4I65A 4WWMA 5M3MG 4K0KQ 3HEJA 5DNFA 1NR4A 2K4KA 4LFCQ 4A75A 2KK8A 3LWEA 2KT7A 4I6NB 2ES2A 1N36Q 1BUIC 3SDLC 4USAA 1KOTA 5DM63 1LTGD 1YQ3B 5EAYA 4B3TQ 3VA7A 2KXJA 3NS8A 3Q8DA 3B6YA 1MVKA 5BMGA 2K6DB 5GADC 1SE4A 2PQAB 2BF8B 4JI5Q 1YI2A 1NY4A 3KBGA 3EROA 3Q22A 3S2DH 4JW0A 1CSQA 1X3PA 3H91A 3CD6A 2A74C 1VQ9A 1T3QA 2GMIC 1X65A 5DPSA 4DXGA 3WDNA 1K73C 1B53A 2JU6X 3RR5A 5IP9G 1A8VA 1UE6A 5I2YA 5C3XA 3T3NA 4IFDH 1QVGA 2DZKA 3AN1A 3DEOA 4J1MA 2PZWA 5ELOA 2MX2A 1YMHE 5I2XA 4DV0Q 4YCVA 3NSWA 3WAOA 1BF4A 1YN3A 4OXPA 5BYRA 1ZEQX 5E6NA 2F4VL 1KH0A 3A5UA 4REZA 1FMAD 1A3UA 1CKOA 2NYZD 3QK0A 3HKZG 1JQYD 3HOYG 4XC2A 4KLKA 5IT9L 4QIWB 1KXLA 1P9DU 3KUDB 4FO2A 5G3LF 2RVLA 2VUMH 4NXNQ 2LXJA 2MGSA 1YN4A 4XT3B 3PZDA 4GLSC 4JE3B 1PZID 1K83H 2V1CC 1PFNA 1I35A 4P73A 2CKHB 1L2FA 1W2BA 1J5EQ 2PVGC 1PH6A 5IOIA 1KRSA 4FJZA 4N59A 2JA6B 4LW1A 4A3EG 2PW5A 4KKTA 1C8CA 1DOYA 1SNOA 2QCZA 4IDIA 1Y1WB 1TWFB 2KQ3A 3PF4A 4HCPB 4OVZA 4JBJA 1BOSA 1E3PA 2BCOA 3Q6SA 4JI1L 3AULA 2NTTA 4LFAQ 3ULPA 3HUIA 2PMVA 2VW9A 4JYAQ 3V96A 1N61A 1CZPA 3M95A 1K3BC 3FKIB 2JA8B 2I38A 3X0WA 2R61A 4OIJA 1X6OA 3BG3A 2B8FA 3S24A 4C00A 4IUTA 1C77A 2K05A 4BBSH 2KMAA 3S15H 2HQEA 1EIFA 5M3FB 1C79A 1D2BA 5DAUA 1C76A 5C44B 1WGYA 3ZJVA 4GS3A 3VAWA 4EKUA 1WR6E 4XYCA 2AHOB 1S5FD 4HWIB 2MBQA 4FDBA 4FLHA 4QAYA 4EFOA 5C4XH 3MEFA 1TTNA 2REXA 3EVQA 5D3IB 5K36G 4HRSA 3VRBB 4NXML 5CV4A 3N1XC 1WZ3A 3HOXG 2NVYH 4XQQA 1FJGL 4FVMA 1WD0A 4II2B 2Z6KA 1L0YB 4W9EA 4KGTA 3VYUA 3CAMA 2K14A 3D4RA 4HN7A 2NWGA 1EL0A 2MBOA 3KVFB 3M63B 4FP5D 4QMGA 3U50C 2KCTA 3OMCA 4CJ0B 4OX9Q 1QZGA 4OO1H 2EDGA 2IGHA 4R1JA 1PV4A 1D3ZA 4XIGS 2WXIA 4R4QA 2IGDA 1BO0A 1CFMA 1R4PB 2NBVB 5IY0A 4OL7A 1TS3A 2R92H 4HR7B 4WJPA 3C3LA 1IGDA 1YZ6A 4HSPA 2A8VA 4IPCA 1NR2A 2E2IB 1OGWA 2NBUA 3KLWA 3A4SC 5JXVA 3X23A 1S3OA 2D3BA 4XDDA 4F8CB 1VQPA 4E71A 1A62A 2F52A 3NWTA 1QWYA 4ME3A 3D3RA 5AZGA 1XF5L 1Q86C 4A3DB 5HY6A 2Y0SE 3HOUH 2LHDA 3CF5A 4TKNA 3K0YA 3WWVA 4IM3A 5D94A 1HQMC 2B2TA 1ESRA 3WANA 2YLMA 4IFDI 5GAHC 1HNXQ 2G3QB 2UUBL 2QA4A 1TZOA 1JJCB 4JK1C 1E22A 4AP4C 3M7GA 3RZDH 2Z6KC 4LTUA 1JMCA 3CMAA 2BGFA 4GN3B 4JI4L 1WMHA 2R7DA 1WJUA 1PDQA 4GGQA 4ANXA 1I6HB 3N3KB 2F0HA 2EXDA 3AEVA 3TS2A 3KDFA 4UP7A 3SE0A 4C1NK 2F0DA 1K8AC 3OWFA 1DZ1A 2JA5B 2CJNA 4C4VB 2VXWA 4LF8Q 5JHAA 3N30A 3V6CB 2KJ6A 2GBMA 2WYQA 4ODGA 4BOZB 2R93B 3GD7A 5IP7H 4DV1Q 4LMQD 1F9PA 3ENEA 4PYUA 4XQNA 5IYBH 1MBYA 5BO4B 1TR5A 5IGDA 3DBHB 1F0ZA 5ELNA 4BY1G 3QB3A 1SNQA 3J81c 4JI2L 2WHIA 2EQSA 1UD7A 2JXMB 4A4IA 1H9MA 1XYIA 1J8IA 1WCMH 5ELBA 3APDA 5JHBA 1I42A 4DR7Q 2B2TC 2EMSA 3GTPB 5C4HA 2A4ZA 3HHMA 3CWIA 4R9WA 3TJPA 3T16A 1WTWA 1XMQQ 3ER0A 1MIUA 2VL6A 3RNEC 3KWVA 1O7ZA 3KF6A 3TMEA 4KI0A 2L0CA 1Q0WB 4YSXB 2KWVB 5KHOA 3HS0C 1WH3A 1FD7D 3TEHB 1EYGA 2DY7A 1ET6A 4DR3L 3A4RA 2L05A 2PYKA 4GLXA 1QCBD 5IA7A 1GAQB 3PRPB 5E6OA 1K3RA 4K8JA 1QVCA 5HG2A 1EOVA 3W5UB 2F03A 1WZ0A 2KENA 2RQXA 5FO9B 3J80L 3W3AA 3UINB 2A6ED 5KIXA 4WAFA 4B3ML 3ETRA 3HKSA 1ICWA 5IKCM 3NY5A 3CMEA 1EUVB 4KMUC 2Q2HA 2F0UA 2MBEA 4L8JA 2VB2X 3IT4B 3R3OA 4KVGB 4YTPB 2DY8A 5KYLA 4DQOC 1ZDXA 4JBWA 1AEXA 1IYUA 4IUVA 2ALYB 2UU9Q 5M5WB 1M8AA 4DV5Q 2BS4B 4TSSA 3G6EA 1GUGA 2MFIA 2KQ7A 5GROA 4RH6A 2EJFC 1LQBA 2WX0A 2CS4A 3ICEA 4DK3C 3AMZA 2CW0D 1B8AA 3PO2B 3KK7A 1P3QU 2D0PA 2BS3B 1FM0D 2Z0DB 3N32A 1S4ZA 1XX8A 3P4RB 3CCSA 1F77A 1RAXA 1E9MA 2QEXA 3ITPA 3MHBA 1B70B 3PO3G 1A63A 3A55A 4IOCA 4A8XC 2M0AA 3NHHA 3AECB 2NZ1D 2R2OA 1PH5A 4MGYE 4U673 4QUCA 4XX5A 3HOWB 3I63C 5HHDG 1MG8A 4TMAB 1O78A 4HCEA 4RAUC 2M8SA 1JB3A 2MO0A 4IPHA 1AWDA 3STBD 4EQNA 3U52E 4LF9Q 1B3AA 2VB3X 3IFTA 2MJ8A 2XK5A 3J81i 4RMFA 1PYBA 2ZW0A 1R4MI 3D4DA 3H0GB 3A8IE 1BBXC 1HTLD 2NBWB 2IO0B 3SHQA 4JG2A 2UWQA 1SFOH 3R3MA 4MSQB 1V6EA 4WQOB 3UDXA 1YNXA 4LLGM 2NVQB 4DUYL 4HJGE 4YSZB 4JIOU 3KYHC 3GV3A 2IGGA 3SK5A 1CJEA 3I3CA 1H9KA 1U5KA 3QWNA 2O5JC 3RN9C 1LLRD 3PV0A 1RKNA 2MNAA 4DN4M 1E8YA 1IKLA 2QHOA 1VRAB 4DV7L 1XD3B 3VQIA 2L1BA 4HCNB 2M17A 1D5XC 3WOEA 3QWZB 4DV2Q 2F0NA 2BA1A 4JV5L 4JQWC 4N9PA 5I9OA 5C4JB 1PLFA 1DYQA 2MWSB 1PZJD 2G45B 3HRDD 1H9SB 1STNA 4FXDA 1TBEA 3BVGA 1KQSA 2KDFB 4JI6Q 2VS1A 1KHIA 3JAME 1DOLA 3S1RH 4EVOA 1HZ5A 1X32A 3Q8CA 3PLUA 1PH4A 4X64Q 4GKKQ 2GA4B 2FMCA 3AEFB 4X66L 2JSVX 2KECA 4DFAA 3TRZA 4CKEA 5JVG3 1WFQA 2M00A 2JA7B 2GI9A 3AV8A 4NQKE 4RCNA 4P75A 4JI3L 4HJ8A 3S1NB 1D4BA 1PUTA 1JW9D 5JJZA 3OJ4B 4A3KB 1F2YA 2EPBA 3CRLC 4G57A 1PFBA 4ZOHC 2F0FA 2NVXH 3ECIA 3CRKC 4X3SA 3UE1A 4PS7A 4BBRH 3ZQ4A 5LHY1 4V0BA 3S14B 1TJEA 1Z6HA 3ZLZA 2JE6I 4B3TL 5CV9A 1SDFA 3RNFC 1WTRA 2LGSA 1DOKA 3VTWA 3ZNGC 5BYSA 1RIPA 4A3MG 1JJGA 4FBJB 1WJNA 2HCCA 4EX5A 1LABA 1P0RA 1QOHA 1B1ZA 2LEKA 4M00A 4IM0A 1RJTA 3L7ZC 2K7VA 5EE9A 3AYHB 3SK6A 1L2NA 2L52A 4GOPA 1JE5A 4I6PA 3ERQA 1SE8A 4IQZA 4OHJA 1HNWQ 3C1EA 1YD8U 1DONA 4MDKE 1GVPA 1WTVA 1O7LA 1SE2A 1U4LA 2HHHQ 3A1QB 5M3MB 2WDVB 4JGHB 1E5WA 1E7ZA 1DOIA 1FRDA 2XEWA 4PS8A 5IO9A 2D3AA 2LJ5A 3Q8FA 3DBRI 4P74A 2WXNA 4X3TA 2WDTB 1QZEA 2WNMA 3T1HQ 1JR0D 3PS6A 4WRDA 3H6MA 1OQQA 2DYBA 1I3QB 1Z7TA 1OXVA 1X56A 2XN9C 3SR1A 2WS3B 1ACCA 4BY7H 2A73B 4FJYA 2KLGA 5EKLA 3H15A 3VHTC 2E2IH 1KDCA 1U4AA 2EYLA 3KOJA 4RGNA 4L5QA 3SHLA 3W1BA 2B2UA 4X62Q 1J7AA 3LYYA 4YHHQ 3NPPA 4ZLTF 1XTCD 2EJMA 3CCQA 4S3SA 1PGBA 3D32A 3M62B 1U4PA 2IHFA 3A9JA 2RF4A 5IYCH 1HPCA 4DXFA 2J0KA 4DF7A 2QILA 3C19A 2KYWA 1Y1VG 4GOPC 1E8XA 2ZVOA 4BVUC 1TQOA 2B2WC 3HKZB 4FYDA 1DOMA 3HOYB 4MGIE 4NJ6A 2J52A 4P1BC 1AH9A 3GTKH 2HIVA 4TQ0A 3N6RA 1L7YA 2KTRB 1LT3D 2KQSA 1PTOH 2ZTDA 4LK1C 3J81j 1N33Q 3T8MA 1R9TH 3NS1A 1UE1A 4A3JG 5LMUQ 1TT2A 4DA2A 1JRPA 3N20C 2FBWB 3SGIA 1IYVA 3H7PA 4HDOA 1RODA 4HVBA 3A9KB 1EY4A 2KJRA 2WLBA 1QUQB 2R3ZA 1X3FA 2UXCQ 2YTXA 2QGQA 4A3EB 3BVZA 1Q10A 3SK8A 1BMLC 4EEWA 4WWNA 4P6VF 1LTTD 1IPGA 3JC66 1OXXK 2OTLA 2B2VA 2VH2A 4HMJA 4N6EB 4AS1A 2LWPA 2LUEA 3AE8B 4PZ8A 1FPYA 4H13C 2K5PA 3IG3A 3M3JA 1A15A 2WU5B 3AE9B 1Z2MA 3VVWB 1IBMQ 2QDBA 4PNYA 2RA4A 1SNCA 4WORA 1JOKA 4GDLA 4PZ7A 3WOFA 2L00B 1NYRA 2OTJA 2KWCA 2MEKA 4EQOA 3J7YW 4RGTA 4DV3L 2UXDQ 2LMCA 3ULLA 1FVIA 3R2IA 1T6BX 1PGAA 1HQRD 4A3GH 4XWWA 2N3SA 4C3IG 3WALA 5HFYA 1XXGA 4N8FA 2FCQA 2WQYB 4K6DA 1PH9A 4HIDA 4M02A 4BXXG 1PTOF 2JSOA 4DNTB 3W1GA 1VQMA 4CQNA 1EY7A 4KJNA 3CCVA 1VQBA 4OW0A 1BBWA 1X54A 3HOXB 3NBHB 2ZEQA 5D65A 2F0JA 2Z4HA 2WXJA 1VLBA 2LY7A 5ELCA 2INNE 3I55A 3ZJUA 2JK8A 1TWCH 2PZTA 3A33B 2MPMA 1TWGH 1STGA 5IAAC 5J2RA 2K33A 2B2VC 2RSOA 1UEAB 3K7AB 4ARCA 3NG0A 2PPBC 2Y5BB 1WWTA 3CXCA 1IP9A 2FXQA 1E6EB 2M1MA 1NE3A 2JWUA 3H3VI 3V05A 1OEYJ 1SB3C 3TEWA 1WR1A 2B39A 3ML9A 5JJIA 1G291 1PHJA 2N4FA 3K9PB 3D0FA 4YCWA 4AUQC 1QNKA 2L4NA 2B2YA 4HEDA 3AE6B 3R66C 4HPMB 5JPNC 3TMPB 3DBSA 4B0MA 4CDEC 3GTOB 4KSLC 1V1QA 1TIFA 2QKIC 3F2UA 2HJ8A 4I7ZC 5COYA 1L0XB 1WI5A 1Y8NB 4EQ5A 4K6LA 4GNXA 3DVNV 3NUCA 1PFMA 5C0XG 1HHVA 4C3JG 2DHZA 4NNJB 3QO2A 3PPAA 1N9WA 4EGVA 4K5VA 1JB7A 1C9FA 4TVAB 3PIPA 4LF4L 3P63A 1WX8A 3ZGZA 4WURA 2FE8A 3NZSA 3OHXC 2WB1E 2O4XA 3K6OA 4M01A 4FADA 3GDEA 4X3KA 1N32Q 1V9JA 2C7NB 2RBMA 4NW2A 5EGTA 1TWAB 1CTMA 1LFDA 2WDRB 5HGQA 1SRUA 4EQPA 4WFN3 1XMQL 2AQ3B 4UP9A 3RN5A 1L5PA 4L5RC 3RNCC 1NNXA 2UYZB 2Y0SG 4L23A 4BFRA 1CMXB 3PIO3 4GDKB 1PRTF 4QUFA 1EQVA 2XNAC 2BDNA 2EE1A 2ATWA 1A2UA 2JX5A 4WJWA 2B2YC 1A3VA 2HDEA 1QILA 4MGKE 3OTOQ 4XQJA 3TP5A 2F0TA 2O2LD 2AEHA 4BY1B 2FHTA 4AQYL 2I1JA 1V97A 2NVQH 1Y8PB 2IDYA 5LMNW 2MJEA 3PLVA 2QW7A 2ZCCA 1GUNA 1NCVA 4OZCA 1R4MB 2X38A 4CYEA 1C48A 3LB8C 4WJNA 3BZDB 5FKAC 4GN4B 2E3TA 3MTNB 3I90A 1C3TA 1B9MA 2ZXRA 2MA9B 3VH4B 2I5MX 3Q3NC 3Q6BA 3WAMA 2K0PA 2Q5WD 2I5HA 4PG3A 5JH5C 1CKNB 2KMMA 1EQRA 1VQKA 2KLCA 1I4XA 4DPGA 1N6ZA 2INCC 2D62A 4X65Q 2HJ1A 2LXKA 1SF0A 2AYOB 2BYVE 2AX5A 4C80A 1TKYA 4LUVA 1NUCA 3V2TA 4B3RL 3CC4A 4MTKA 3S16B 1G91A 2GOWA 3C0RB 4ZRJA 1HCZA 3E6ZX 4DR1Q 3PUVA 3AEEB 3L4PA 4WQMA 2MQHA 2JUOA 1ISNA 1NSNS 4KY5A 1MFWA 5I4DA 1F9SA 1OXTA 3CCMA 2VQFQ
chains in the Genus database with same CATH topology
3NP8A 2DN8A 3CU7A 1OXUA 1N5XA 1ONLA 3DWMA 2N55A 1JALA 2RDFA 5C4ZA 3X3NA 1O7YA 1UNSA 4F87A 4Y7NB 2OF1A 3E56A 1LT4D 1E0BA 1WTXA 3PUYA 1EWYC 3AM9A 4D2KA 1CZWA 1BUVT 3PO3B 2QIEB 3AEBB 5ELFA 1RWSA 3MFGA 3FC4A 1EZ6A 3N9YC 4J3OD 2M2LA 3ND8A 2W3SA 3VR9B 2W82A 1J9OA 1ENFA 3J7AV 4HROA 1LTSD 2TMPA 5C5LA 1JOQA 4IURA 2KACA 2E2JB 1JMLA 1SE3A 3K58A 3FILB 5CV7A 2XRSD 3Q8EA 3NTHA 1FNVA 4OGQC 3VA5A 4O42A 4KKIA 2A69C 2JEBI 3SVMA 4IKGA 5AUIA 2WXFA 2RMMA 2F0OA 3IL8A 1WTQA 3CHBD 2AUJD 1GXDC 1Q1EA 3KLRA 2NVTB 4RF0A 2CJOA 5JEAH 4HKQA 1C4CA 3U9SA 1ET9A 2DYMA 3EUB2 3A7AB 2V0GA 4L1BA 3U9OA 2K9XA 4KY6A 3K5MA 3SFEB 4PMWA 4TRDA 2EY5A 2DBYA 3DHQA 4IUNA 3AE2B 3NZ3A 3AEGB 3S1QB 2NMQA 1I4HA 4ZQ3A 3H3VC 3FEWX 1STHA 3ABVB 4K14A 4IFDG 3TBIB 4MM3B 2F0EA 1LO5D 1T5XD 4X3UA 3OPOA 4NP5A 1EYAA 2KCNA 2ZXOA 3J81E 5AUKA 2EYJA 5T1IA 4A3MB 3M4YA 2K22A 5IIFA 3S2HB 2PCFB 3FRPB 1TS2A 2EELA 4J6HA 4CKBA 2N7JA 1LV9A 5MPOA 4YTMB 1WTOA 1IHZA 1I50B 1Y69U 4B9XA 5EE1A 1MD2D 4FF4A 4CJ2C 1TWHB 1BCPC 1PTOC 1RYJA 1TKWB 3DWGC 3P1MA 3MTSA 3MJ5A 2FJ2A 1OQRA 4RGMA 1TS5A 4P2CB 2G9HD 1LTRD 1CT1D 3NTKA 2YEPF 1FCLA 2I46A 4C7YA 1GHKA 3N52A 2L5TA 3S1MB 3DWAA 3D4WA 4ZHPA 1LT6D 4ABNA 3UI3A 2HCIA 2Y3AA 1RF2D 2BW2A 3AE7B 2Z4IA 2PQEA 3TEZA 1Y1VB 4ZHOA 1NEKB 4QB4A 4OO1G 1MGSA 1HTPA 4A3JB 3I70A 5LL6X 5EKKA 2V4IB 4MH8A 2RDGA 5FOBB 2J0TD 1ENCA 1JWMD 3RFZB 1KAAA 2WDQB 1ILPA 3OOCA 3E5SA 3EJIA 4HMIA 1BDOA 1EY8A 2WP9B 2MHVA 5KYIA 1SNDA 4ITKA 3SK4A 2ON8A 1NENB 1UWMA 5M5XB 1RHPA 3LNNA 3ZYYX 4BWGB 3GTGB 2SNSA 4M8AA 2F0IA 1PRTC 2KQ4X 2CVRA 4ILWA 4NZLB 3I91A 4DK1A 4C3IB 3GB1A 1C4AA 1WGKA 3BIID 2ICIA 3MAQA 3Q24A 1UUPA 1E2WA 3FPPA 1Y56A 2QEJC 1XWEA 3BK1A 3TP7A 1UWXA 3SXHA 1QQRA 1SYFA 1Q1BA 1SIJA 1AP0A 1CZGA 4RGOS 1KLUD 2E76C 3O13A 1RTNA 1RFKA 2BYTA 3DMUA 4BA2I 1Q12A 1SNPA 1DD2A 1FIQA 1YNNC 3B9JA 3KLSA 2RKSA 3TZUA 1G6ZA 1D5MC 1JWSD 3NWSA 4Z9CB 2JZPA 5E4WC 2RSNA 4OO1I 3UI2A 3AE1B 2NN6H 4HTHA 2WV6D 1F2MA 1M4VA 2H1EA 1FFUA 2G1EA 3D31A 4C3JB 3AB5A 1ZOYB 5I6WA 3GO5A 4RNAA 3OW7A 1GHJA 1PFDA 3DUZA 1JWUD 1L0VB 4KGRA 3MXNA 1GB4A 1K51A 1STAA 1K50A 1CQVA 5CYUA 2KEDA 3X3MA 2PZUA 5IGGA 4E6IA 4R8NA 4IOIE 3T51B 4US8A 4RF1A 2WKDA 2Y0SB 3W9CB 2N9KA 3MWYW 3NE5B 4MACA 3GTMB 3EGRA 3M3YB 4O1NA 2IX0A 4KHZA 3PMFA 1MHHE 5C0XJ 3NBIA 4R3DA 2XIWA 4NKLA 2WINB 2K3UA 2K28A 1V8QA 3H09A 1XEEA 3V3XA 3U4EG 5CBAE 3I9V1 3KBXA 4FXKC 1L6VA 4ZUJA 2PLPA 1ZYRC 3L3OC 5J1ZA 1EIGA 1WVLA 3RZOB 4L63B 1HFNA 3EQLC 3NQIA 4MN3A 1TY0A 1FXIA 1KF6B 1EY6A 2A69D 1SJHD 5KEEA 2QJLA 5ISRA 1JICA 1UGJA 1I4GA 5LL6S 4F7XA 2N9LA 3E0JA 4NJCA 3ZJTA 2MUYA 5ELEA 2SOBA 5E4XA 5HI1A 1F2RI 5E1FA 4RWSC 3MEHA 3OWEB 3KF8A 1QE6A 4C56C 3SEBA 2LFNA 4G7OC 1TYGB 3R93A 2D9UA 5CORA 2V3PA 2WXMA 2KA7A 4K8IA 4PMCA 2WP8J 1B9NA 1GUSA 4CKCA 2E6XA 1KDAA 2L12A 2F0WA 2HTME 3PZ7A 3AE5B 2F0GA 1V8CA 5C3EB 3VR2A 2EYMA 1YQ4B 1ZDVA 3J81L 3BYTB 2EZVA 2ZT9C 5J22A 1II3A 1ZE3D 2CU3A 1GUOA 1Z47A 3VYTA 1L6UA 1CK1A 2O5IC 2F0PA 2XWBB 2Z1CA 1BCPD 1PTOD 3A7LA 4OIKA 1A70A 4DAPA 5EPJA 1VCIA 5CV8A 2KAJA 1N5WA 4G7ZC 4A93B 1NAPA 2FUG1 2PKOA 1HFGA 2KVMA 1NI3A 2K01A 1AW7A 2LHEA 3GTJB 4G4KA 3AMUA 1SBBB 1EU4A 1SYBA 1ZP0B 2VZKD 1I7HA 2IPKD 2K32A 2F0QA 3GP7A 3I73A 5EPLA 5F2DA 1GUTA 2G9DA 1HRJA 2FFKB 2J42A 1HUMA 3NVZA 2BOSA 3VR3A 3P4SB 5D7GA 4C1NI 5IGCA 5KNDA 3K57A 3VYSA 1STBA 2IW3A 3NVWA 3A56A 5G5HA 1LTBD 1FEHA 4K2KA 5CV5A 2B2UC 4WH4A 1AZQA 2VUMB 2JYOA 4QF4A 1FXAA 1B50A 1B4OA 1VZ6A 4DU9A 3M7NA 1B2TA 2NBFA 3IAM1 1QKZA 2F0SA 3BVMA 4ZRQA 4R8IA 1A3TA 4ME5A 1EM7A 4QCLA 1PRTD 4KJOA 2F3VA 3G6JB 4IFDJ 3FPUB 1WRIA 3OIQA 1F9QA 3IAS1 2MH7A 5FK9C 4BBSB 1WYGA 5JVH3 3S15B 1F2LA 3BWUD 5JOBA 5C5MA 5I6YA 1V1OA 2WKCA 1FD6A 2Y5CA 5C4XB 2EYPA 2KHSA 1EOTA 3PZ8A 3Q69A 3HVDA 1JWAD 3URYA 1ZXIA 4ZKBB 3J9CA 2NVYB 3FMCA 4KK7A 2JP1A 5AFWA 1EYCA 3ONAB 3FDTA 1QNUA 3KUPA 4TKOB 4XE0A 2A5HA 3P75A 1SYEA 1V1PA 2R92B 1FRRA 3W1SA 3MXGA 3MA2B 1QF6A 1VZ7A 1IBXA 1SMYC 5CV6A 5G5GA 3QJYA 2JYTA 1EWHA 4KKJA 3FAHA 1XLPA 3LXFA 4IN3A 3HOUB 1JROA 1F2RC 2E2DC 3PIP3 2E74C 1SAPA 5BN4A 4XWTA 2L83A 3BS1A 1VF7A 1DJRD 3RZDB 2M19A 2WXPA 2F0MA 5EE0A 2CQAA 4A9AA 5A2QE 3NVVA 2AWNA 2C9OA 4RHSA 1EY5A 1S5DD 3RPFC 3MXPA 1SYGA 2K5DA 1S5BD 1HXYD 5KRUA 3LX0A 4GDLB 2FINB 1FO4A 2FMMA 2LMCB 2KWDA 3T56B 4A6QA 1ROEA 1FYCA 1MI0A 4PT5A 1IW7C 1ZYRD 4K5XA 2BB5A 2BDOA 4OZAA 3LWUA 2A68C 2W54A 3CKIB 4KGSA 1P7EA 1MSHA 2B8GA 3C46A 1B9RA 3VYRA 2A6EC 2F1MA 2AWOA 2XWJB 1MSGA 4KKSA 2K5WA 3T4AC 3IFDA 4HEA1 2KUMA 2LUMA 1J7CA 1CA5A 1PDXA 5HGTA 1FNUA 2C5CA 1WXQA 1D6EC 5G3LD 3Q0AA 1I6VC 3H8HA 4XXEA 2K03A 3OMGA 2LKVA 5IGFA 3RUZA 4YSYB 1WD1A 2EYHA 4DNRB 1SJED 4ULLA 2F0LA 2WXOA 1JE4A 5EPKA 1L4ZB 2PTLA 1N60A 1HA5A 4PMBA 2D2CC 4PV1C 5J39A 1ILQA 2V4DA 2AUKA 2WB1B 5FO7B 1VMCA 4HCSA 1Q3LA 1K53A 1G8ZD 1ML0D 4ZK9B 4KKUA 1SSNA 3WCQA 1TVXA 4JX1C 3TEXA 5BN3A 1LACA 3B2GA 2WXLA 3S9WA 3GV6A 1G2TA 2XRQD 1ZKOA 4B08A 3NVYA 3VR8B 2LGIA 1QB5D 2M56B 1RCVD 1TS4A 2E75C 4G7HC 2JQRB 2D5DA 1SFOB 1FFVA 1YNTE 2IX1A 4V190 1PYWD 2KDMA 1JC7A 2WXHA 1VDZA 1K8MA 1SYDA 5JPMC 3P4QB 3QOLA 5JEAG 2EOTA 2EJGC 3Q23A 4NDXA 4XT1B 5C3JB 2BBCA 1KNEA 3HP3A 1YJJA 4LAAA 3S1RB 1CI3M 1O80A 3SR6A 4YT0B 3TUOA 1S5CD 4AYBB 2ICEC 2D5GA 3CIRB 1XLOA 4K5WA 2PW7A 1SSOA 3TDQA 5K36H 3PO0A 1KDBA 5FLXL 2X6GA 5CR3A 1ESFA 1AZPA 1XLQA 2NVXB 4KD3A 1CHQD 1HZ6A 1PMRA 4BBRB 3PUXA 1RD9D 1QOBA 2IX3A 1BQQT 3KQ4A 3VR5A 1TU2B 3QG1A 4RA8A 2DNCA 4B0EA 4IUUA 1GUWA 2OEDA 1C4QA 3I4MB 5LNK1 3DWPA 2PVOD 2BA0A 2IWHA 1Y8OB 3AH7A 2EY1A 2B76B 3HZXA 4KN4C 4JWUC 3NRZA 1MHXA 3KWLA 4ZRPA 2WU2B 2I2YA 3I4NB 1U9RA 4OZBA 4LK0M 4P16A 5KNCA 4BS9A 2QSDA 1UAPA 5M9OA 4BY7B 2W3RA 1DCZA 2BTEA 2N0SB 3MXUA 3RD4A 1RM6C 3SFDB 1I4QA 1DOXA 3MVVA 3K59A 4DK0A 1EY9A 1BXTA 3P7JA 1VZ8A 5IOCA 2KOLA 4JPSA 3CQZB 3BYYB 1L4DB 2XVSA 1GJXA 2LFIA 2PNRC 2I07B 3GTKB 2PO4A 4A55A 3HG9A 1XO3A 1BCPB 1VF5C 1PTOB 1KRHA 2WXKA 1SMYD 4FF1A 1R9TB 1QG7A 2Z8LA 2X6LA 1RTOA 4KHVA 3GTLB 3OIPA 4IALA 3I4LA 3J7AF 5IODA 2F0VA 3RMHA 1AYFA 1YJIA 2BB6A 1WTPA 5IGEA 3R8BA 2VZKB 4KY7A 4HKZE 3W5VB 4XDCA 4A3FB 2J7ZA 2QCPX 4KN7C 1E2VA 3IKJA 1E0ZA 1N63A 4HSVA 2NB0A 2IJ0A 1H9SA 4YIJA 4A3GB 4YWGG 4KD4A 5A2QL 3U2SC 3T53B 1B44D 2K1BA 3P1HA 1CA6A 2OHFA 4A3BB 1X3QA 3H94A 3SDZA 2MJ3A 3EA6A 4CGYB 2ZXPA 3IAYA 1JWBD 1BR9A 1IW7D 3EFXD 4N58A 1TWCB 4IUQA 5C2TB 4ZYSA 1QOGA 2EVBA 4J8QA 1TWGB 1QLBB 2A68D 3MZ5A 4GZYC 1WSPA 2OXPA 4FXGC 2J4XA 3AE4B 3P4PB 2EKIA 2PMZB 2JEAI 1Q8IA 1HEZE 4RKLA 1GOZA 1FGBD 1VR9A 4UAIA 3OSOA 1PRTB 4NAWB 3IT6B 1R4QB 4C3HG 2AQ1B 2NN6G 2A6HC 3T3OA 5T1GA 2MJDA 1ENAA 1EQTA 3TP8A 3I57A 3G7LA 2LS01 1D1KA 4RFBA 2Q8IB 3VR4A 1OXSC 3C8YA 2L55A 2CHBD 2YU9B 4M1UB 3K5OA 1T5EA 3R2TA 1IUEA 1YNJC 2GRIA 1C4PA 4Q5VA 1OFFA 3GS2A 3BDLA 1VDVA 1R7SA 4UDUC 4A90A 5E3FA 2Q8RE 4RHRA 2WXGA 3AE3B 4XYOA 2RPVA 4B9WA 4TQ1A 1FNWA 1LTAD 1N62A 4IUPA 2TSSA 2ACZB 1NYQA 5T8IA 4K2LA 5GXGB 2H89B 4NMZA 1IL8A 2BE5C 1QT9A 3HVZA 5TSSA 2V3NA 1MI2A 3C1FA 1ZUD2 1VJKA 3GQBA 1KABA 1SYCA 1U4MA 4YTNB 3TEYA 3TP6A 5KGUA 5DM73 2NN6I 3BDCA 3T13A 1STYA 2OT2A 4MHEA 4ZUIA 2KCCA 4ZKCB 3K5LA 1AFPA 1OO9B 4FNFA 3HRZC 3GTQB 2BT6A 1JOOA 3A8JE 5I9PA 1DXMA 1LT5D 1LTID 1XLNA 4KX6B 4TQUS 3Q8AA 4JWSC 5FO8B 2DWQA 2WXRA 1SXTA 3DEPA 2ONQA 1V43A 2Y5PA 3NBHA 1K8OA 3Q8BA 5BMHA 3QIAA 4L2YA 2YYZA 4L6TB 2R7ZB 2L9HA 5DEHA 4YXDB 5BN5A 2F3WA 4EE2A 3S17B 5H92C 1E10A 3W2DA 3MP9A 2B2WA 1DM0B 3TSSA 1I4RA 5H8YE 4BA1I 3PUWA 4XTCS 4IZ8A 4US9A 4RKBA 4CJ1B 3M85A 3VR6A 2ID0A 3D6CA 2BS2B 2JXTA 4PQXA 3HOVB 1QOAA 2ENBA 3D6WA 4N9TA 2PW9A 2N88A 3TN2A 5IT9E 4A3IB 1JCKB 1W6KA 1JQ4A 1YN5A 3S2DB 2K04A 5ELDA 1XCQL 2WXQA 3A8KE 1PGXA 3MHZA 2WIIB 1EZ8A 2KJXA 5CBEE 3K5NA 3VRAB 2WACA 1KTKA 4FF3A 3DXJC 2EYFA 1EEFD 2IL8A 5FLXE 5JAVA 5BMIA 4ARIA 2EY2A 4CHTB 5CGKA 1KFYB 3AB9A 1QJOA 1S5ED 1KLGD 2SNMA 4F88A 3DWQA 4LJZC 2JYEA 1STEA 4ZRZA 1IKMA 1FR3A 1EIHA 2NTSA 3P20A 1K83B 1E7PB 1H9RA 3MC0B 5EJWA 3I72A 4U68A 3B2FA 1EFID 2F0KA 2IT1A 4Q0FA 4ZAIA 2NUCA 5EBDA 2YEPB 2QF7A 3I8ZA 1G2SA 3BK2A 3U7ZA 3BDOA 5JEAJ 4H44C 2R6GA 3D8GA 1EEID 1D5ZC 2HDMA 2RDHA 1A6XA 2PIAA 4XDXA 1BCPF 1C78A 3PUZA 4XYQA 1U4RA 2B63B 5EE3A 2HUGA 2H88B 1EWCA 1H9JA 1EY0A 2HDLA 5M5YB 1TKGA 2VNUD 5C0XH 3MFYA 3C2PA 4NAMA 4KTAA 1YNND 1DGJA 2K6AA 1IGCA 4AQ7A 2Q8TA 1AN8A 5NUCA 1VMPA 2INPE 1TKEA 2GB1A 1JORA 4M0WA 1RDPD 3HGBA 4FF2A 5CMDA 1SNMA 1E2ZA 5K5PA 3HOZB 1P7FA 1J7BA 4CBVA 2EY6A 4DAYA 4C7ZA 5E6JA 2W55A 5C3WA 3NK9A 4H2AA 4H0LC 1F2ZA 3FILA 1ZXTA 4WIPA 3AEAB 5KNBA 4FXCA 2X69A 1PXUA 2A6HD 2DLBA 4MIUA 1GB1A 2SDFA 2EXZA 3KLSX 2WAQB 5IGBA 2M9VA 2H4OA 2KN4A 1ZXHA 1K52A 5CC4A 2ZW1A 2L1AA 1CHPD 4KV6A 1YNJD 3J80E 2MP1A 1I4PA 1WCMB 2SEBD 1EYDA 2DNEA 1QOFA 5A35A 3AEDB 2K5QA 2QMTA 4C2MB 4F8MA 2SAKA 1HA6A 1GPXA 5BYQA 4DGZA 1HUNA 2KEEA 3FVQA 1PZKD 3AU7A 3L9AX 4ID6A 3ND9A 1KNAA 3M4OB 5C0XI 2BE5D 4DAVA 1D1IA 4H7BA 2CW0C 4C3HB 1ZPSA 3NQTA 3NTIA 1CQFA 1MPEA 2L32A 5FR3A 4RCOA 3E9SA 3IXSA 3NXWA 1SEBD 5HURA 5EBCA 2OEOA 2L11A 1F9RA 2E2HB 1CM9A 1BNZA 1NVID 3JAML 1Q90A 4Q2JA 1V1PB 3A54A 4HAEA 1FCCC 2DYOA 5D3DA 2EYOA 3NUHB 1TY2A 1IBXB 3P42A 5C6AA 1A2TA 3QOJA 2AQ2B 3DM1A 2J53A 2F4IA 3TZDA 2LJIA 3RLFA 1XCTL 1W6JA 1EU3A 5D14A 2XSCA 5EQ0A 5EKIA 4MT5A 1TIID 4I65A 4WWMA 3HEJA 5DNFA 1NR4A 3LWEA 1BUIC 4USAA 5DM63 1LTGD 1YQ3B 3VA7A 1MVKA 5BMGA 1SE4A 3KBGA 3EROA 3Q22A 1X3PA 3H91A 1T3QA 2A74C 4DXGA 3WDNA 1B53A 2JU6X 5I2YA 5C3XA 3T3NA 4IFDH 3AN1A 3DEOA 4J1MA 2PZWA 1YMHE 5I2XA 3NSWA 1BF4A 1YN3A 5BYRA 1ZEQX 1KH0A 4REZA 1FMAD 1A3UA 2NYZD 1JQYD 5IT9L 4QIWB 4FO2A 5G3LF 2RVLA 1YN4A 3ZJUA 2MGSA 4XT3B 4GLSC 4JE3B 1PZID 1PFNA 2PVGC 4N59A 2JA6B 4KKTA 2PW5A 1C8CA 1DOYA 1SNOA 4IDIA 1Y1WB 1TWFB 2KQ3A 4OVZA 1BOSA 2BCOA 3Q6SA 3HUIA 2NTTA 2PMVA 3V96A 1N61A 1CZPA 3FKIB 2JA8B 2I38A 2R61A 4OIJA 3BG3A 2B8FA 4IUTA 1C77A 2K05A 2HQEA 5M3FB 1C79A 1D2BA 5DAUA 1C76A 5C44B 3ZJVA 1S5FD 3EVQA 5D3IB 5K36G 4HRSA 3VRBB 5CV4A 4XQQA 4FVMA 1WD0A 1L0YB 4KGTA 3VYUA 3D4RA 4HN7A 2NWGA 1EL0A 4FP5D 4QMGA 3OMCA 4CJ0B 4OO1H 2EDGA 2IGHA 4XIGS 2WXIA 2IGDA 1BO0A 1CFMA 1R4PB 4OL7A 1TS3A 4HR7B 3C3LA 1IGDA 4HSPA 2E2IB 1NR2A 5JXVA 4XDDA 3NWTA 1QWYA 3D3RA 1XF5L 4A3DB 2LHDA 3K0YA 1HQMC 2B2TA 1ESRA 4IFDI 1TZOA 4JK1C 3M7GA 4LTUA 1PDQA 1I6HB 2F0HA 3SE0A 4C1NK 2F0DA 1DZ1A 3OWFA 2CJNA 2JA5B 2VXWA 4ODGA 2R93B 3GD7A 4LMQD 1F9PA 4XQNA 1MBYA 1TR5A 5IGDA 1F0ZA 3QB3A 1SNQA 2JXMB 1H9MA 1XYIA 1J8IA 5ELBA 2B2TC 3GTPB 5C4HA 3CWIA 4R9WA 3T16A 1WTWA 3KWVA 1O7ZA 3TMEA 4KI0A 2L0CA 4YSXB 3HS0C 1FD7D 2DY7A 1ET6A 2PYKA 1QCBD 1GAQB 4K8JA 5HG2A 3W5UB 2F03A 2RQXA 5FO9B 3J80L 3W3AA 2A6ED 5KIXA 4WAFA 3ETRA 1ICWA 4KMUC 2F0UA 4L8JA 2VB2X 3IT4B 3R3OA 4YTPB 2DY8A 5KYLA 4DQOC 1ZDXA 4JBWA 1AEXA 1IYUA 4IUVA 5M5WB 1M8AA 2BS4B 4TSSA 1GUGA 4RH6A 2EJFC 3AMZA 2CW0D 3PO2B 3KK7A 2BS3B 1FM0D 1S4ZA 1XX8A 3P4RB 1F77A 1E9MA 3ITPA 3MHBA 3A55A 4A8XC 2M0AA 3NHHA 3AECB 2NZ1D 4U673 4QUCA 5HHDG 3HOWB 4TMAB 1O78A 4HCEA 4RAUC 1JB3A 1AWDA 4EQNA 3U52E 1B3AA 2VB3X 3IFTA 2MJ8A 2ZW0A 3D4DA 3H0GB 3A8IE 1BBXC 1HTLD 4LLGM 2NVQB 4HJGE 4YSZB 2IGGA 3GV3A 3SK5A 1CJEA 3I3CA 1H9KA 3QWNA 2O5JC 1LLRD 3PV0A 1RKNA 4DN4M 1IKLA 1VRAB 3VQIA 2L1BA 1D5XC 3WOEA 2F0NA 2BA1A 4N9PA 5I9OA 5C4JB 1PLFA 1DYQA 1PZJD 3HRDD 1H9SB 1STNA 4FXDA 3BVGA 3JAME 1DOLA 4EVOA 1HZ5A 1X32A 3Q8CA 2GA4B 2FMCA 3AEFB 2JSVX 2KECA 4DFAA 4CKEA 5JVG3 2M00A 2JA7B 2GI9A 3AV8A 4RCNA 1D4BA 3S1NB 1PUTA 1JW9D 5JJZA 4A3KB 1F2YA 2EPBA 3CRLC 4G57A 1PFBA 4ZOHC 2F0FA 3CRKC 4X3SA 3ZQ4A 5LHY1 4V0BA 3S14B 1TJEA 1Z6HA 2JE6I 5CV9A 1SDFA 1WTRA 1DOKA 5BYSA 2HCCA 1LABA 1QOHA 1B1ZA 2LEKA 1RJTA 3L7ZC 2K7VA 5EE9A 3SK6A 2L52A 3ERQA 4IQZA 4OHJA 3C1EA 1DONA 1WTVA 1O7LA 1SE2A 1U4LA 5M3MB 2WDVB 1DOIA 1FRDA 3Q8FA 2WXNA 4X3TA 2WNMA 1JR0D 4WRDA 3H6MA 1OQQA 1I3QB 1Z7TA 1OXVA 2XN9C 3SR1A 2WS3B 1ACCA 2A73B 5EKLA 1KDCA 2EYLA 4RGNA 3SHLA 1J7AA 2B2UA 3LYYA 3NPPA 4ZLTF 1XTCD 2EJMA 1PGBA 4S3SA 1U4PA 1HPCA 4DXFA 4DF7A 2QILA 1TQOA 2B2WC 3HKZB 4FYDA 1DOMA 3HOYB 2J52A 4TQ0A 3N6RA 1LT3D 1PTOH 4LK1C 3NS1A 1TT2A 4DA2A 1JRPA 2FBWB 1IYVA 1RODA 1EY4A 2WLBA 2R3ZA 1Q10A 4A3EB 3BVZA 3SK8A 1BMLC 4P6VF 1LTTD 4N6EB 1OXXK 4AS1A 2B2VA 4HMJA 3AE8B 2K5PA 4H13C 1A15A 2WU5B 3AE9B 2QDBA 4PNYA 2RA4A 1SNCA 4WORA 1JOKA 3WOFA 1NYRA 2MEKA 4EQOA 3J7YW 4RGTA 2LMCA 3R2IA 1T6BX 1PGAA 1HQRD 4XWWA 4C3IG 5HFYA 1XXGA 2WQYB 4K6DA 1PTOF 2JSOA 4DNTB 4CQNA 1EY7A 4KJNA 4OW0A 3HOXB 5D65A 2F0JA 2Z4HA 2WXJA 1VLBA 2LY7A 5ELCA 2INNE 2PZTA 2MPMA 1STGA 2K33A 2B2VC 2RSOA 1UEAB 3K7AB 4ARCA 2PPBC 1WWTA 1E6EB 2JWUA 3V05A 1SB3C 3TEWA 2B39A 1G291 1QNKA 2L4NA 2B2YA 4HEDA 3AE6B 5JPNC 4B0MA 3GTOB 2QKIC 3F2UA 4I7ZC 5COYA 1L0XB 1Y8NB 4K6LA 1PFMA 3NUCA 5C0XG 1HHVA 4C3JG 3QO2A 4EGVA 4K5VA 1C9FA 3P63A 3ZGZA 4WURA 2FE8A 3OHXC 2O4XA 3K6OA 4X3KA 2RBMA