2AQ3B

Crystal structure of t-cell receptor v beta domain variant complexed with superantigen sec3
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
234
structure length
234
Chain Sequence
b'SQPDPMPDDLHKSSEFTGTMGNMKYLYDDHYVSATKVKSVDKFLAHDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKDGKVTGGKTCMYGGITKHEGNHFDNGNLQNVLVRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T-cell receptor beta chain V
publication title Structural basis of affinity maturation and intramolecular cooperativity in a protein-protein interaction.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 64
structure length 234
sequence length 234
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2005-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
B PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2aq3B02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2aq3B01
3MFGA 2R61A 1TS5A 4BWGB 1PZID 2IJ0A 4OHJA 4RFBA 4RH6A 1S5ED 1EWCA 1BCPB 1EEFD 4Z9CB 3DWQA 3R2TA 1BCPD 1L0XB 1S5BD 1STEA 3BVZA 3SEBA 2NTSA 5TSSA 1FNUA 2ICIA 1PTOF 5ELCA 1B44D 2SEBD 1SBBB 5D3DA 1PTOD 3R2IA 4RHSA 1XXGA 4L63B 1RD9D 2RDHA 1I4PA 2XRSD 2AQ3B 3BZDB 1I4XA 1S5CD 1F77A 2Z8LA 5ELBA 2QILA 1XTCD 1CK1A 1LT6D 1TY2A 1KTKA 3O13A 3MC0B 3BVGA 4L6TB 4O1NA 1CHQD 1SEBD 1D5ZC 1SJHD 3CHBD 1JWSD 1LTSD 4RGNA 5FKAC 1EFID 1JR0D 1RF2D 1CQVA 1S5FD 1PTOC 3URYA 1YN3A 2QEJC 2WV6D 1TS4A 1BCPF 1TS2A 1LT3D 1LT5D 1I4GA 4NZLB 3OWEB 3EA6A 4RHRA 2RDGA 1KLGD 1JCKB 2IPKD 1LTTD 1PRTB 1PZJD 1QILA 1AW7A 1LO5D 1JWMD 1FGBD 1BXTA 1M4VA 1PRTD 4RGTA 1KLUD 1LTRD 2XRQD 1UUPA 1LTID 2J4XA 3EFXD 1EEID 1RDPD 1S5DD 3GP7A 1FNVA 5ELFA 1BCPC 1DYQA 1JWUD 2XN9C 4ZYSA 1V1PA 1EU3A 1SE3A 4TSSA 1YN5A 4RGMA 3W2DA 1LTGD 1ESFA 1MD2D 1HA5A 1LLRD 1ET6A 1TS3A 1UNSA 1FD7D 2CHBD 2G9HD 1EU4A 3KLSX 1I4RA 1PRTF 5D3IB 4DXGA 1TY0A 1V1OA 1JQYD 1GOZA 1PZKD 1SXTA 2XNAC 1AN8A 1I4QA 1T5XD 1DJRD 5ELEA 4K6LA 1YN4A 1HXYD 1ENFA 4RCOA 3V05A 3BYTB 1HQRD 1PTOB 4C56C 1PYWD 1SE2A 4UDUC 1ET9A 1LTAD 1SE4A 5FK9C 5I4DA 4RGOS 1V1PB 3TSSA 1LT4D 3DWAA 1D6EC 1CHPD 1LTBD 2AQ2B 1PTOH 5ELDA 1B1ZA 2TSSA 1FNWA 1SJED 2O2LD 3BVMA 4DXFA 1D5XC 1I4HA 3R8BA 1PRTC 3DWPA 1HTLD 2NTTA 2AQ1B 1CT1D 1RCVD 1G8ZD 3BYYB 1L0YB 1D5MC
chains in the Genus database with same CATH superfamily
5EBCA 4B3SL 3KBXA 1MVKA 1JE4A 2BYVE 3RNBC 3A33B 1ISNA 5A2QL 2I5LX 5KHQA 2INDC 2G5DA 1EWCA 4CDCC 1RJTA 2JQOA 2RKSA 4QUFA 1BUIC 1T0QC 4IM2A 4NJ7A 3AB5A 2JX5A 1MSHA 2RVLA 1PH5A 3RZOB 4CKBA 4A20A 1WXAA 3NK9A 3RNAC 2SDFA 3QIJA 4B3RQ 2BYEA 1STEA 2UUCQ 3J7A5 3HOVG 3I4MH 1SBBB 4DV0L 1GC6A 2NVTH 1ZXHA 2WIIB 3I70A 2ENBA 3HGBA 1VQKA 5EE1A 4HJGE 1GAQB 3S14H 1Y56A 2EXZA 1S72A 4OZCA 1ZDVA 2G1EA 3NTIA 1C9OA 1Y1WH 4B0EA 4AUQC 2FJ2A 1ZP0B 2M1MA 3HOYB 5JHBA 1CK1A 3K57A 3H91A 2KTFA 4POFA 1WXSA 1K53A 2ALYB 3VHTC 3EFUA 4DKAC 2WXQA 1D5ZC 1EQRA 4LFCL 4KY5A 4AOFA 2OEDA 2Q2UA 4DR2L 2ZVNA 4P1BC 2JA9A 3WOFA 1YHBA 5KRUA 1BCPF 1WH3A 3J7AV 1SR3A 1WCMH 2C7HA 3OMGA 2DENB 2UUAQ 2F52A 3MHBA 4C3HH 3ERSX 2E2IH 2KVZA 2OJWA 1Z7TA 2EELA 4HCEA 1JT8A 1P7FA 5E6OA 2J7QB 5IIFA 2DJFC 5C0XG 5HG2A 2MUYA 2OCEA 3DLLA 3U8ZA 1CFMA 3J81j 3ZQ4A 1EUVB 2A6HD 3HZXA 1BVSA 4NP5A 2B8GA 2KDEB 1SNCA 2N78A 4A3CG 4JK1C 3A8JE 2PNHA 3AE3B 3ND9A 4RG1A 2FE8A 2OWOA 1C3TA 3Q8AA 2BCOA 5IOIA 3V60A 2PI2E 4BBNF 3DHQA 2MW5A 4EFOA 4DUYL 4DV4L 3A5ZB 3T1HQ 1WTPA 1DOMA 3J80L 4K2KA 1TXYA 1WTXA 4L5RC 4BZAA 1I42A 2L4NA 1V49A 1TGZB 2NVYH 4FBJB 1AH9A 1V43A 2NS5A 1I4RA 1TY0A 2V1CC 1E8ZA 3H3VH 2ZNVC 3GZNI 4G0NB 4POGA 1UE7A 1DOXA 4FXKC 3DWGC 2RSNA 4GN5A 4YL8A 1SMYC 1TKEA 4RCOA 1TWCB 2K8HA 3P4QB 3L9AX 2KDFB 1PFDA 3G4SA 1BMLC 4DV7L 1LTAD 5BN4A 4K5WA 4H0LC 2I46A 1V1PB 1W6JA 1PFSA 2N4FA 3NE5B 5IGCA 4JC0A 1Y1VH 2PEAA 4EKUA 1IHZA 4WJNA 4KDLB 2FCSA 1Q10A 3CPFA 1U4RA 2IY5B 1C76A 4GNXC 1S3OA 3LWEA 1WF9A 1YJ9A 2KMAA 3HOWG 4ZRKA 5GXGB 2AQ1B 3BG3A 1CZWA 3V96A 3CC2A 2PE6B 1R4NB 2Q2HA 3PLVA 3S2DH 4A3KG 2EE1A 4C2MB 5M5WB 5CHVC 3GD7A 2HTHA 2NB0A 1MJEA 2IBIB 1EM7A 2JSVX 1VQ9A 2XIWA 1NNXA 4DAMA 3M4YA 3J80c 1P98A 5DPRA 3M9BA 4P16A 2KKCA 1EWYC 1J5EQ 4XYQA 4JOIC 2K5PA 3MHZA 4M02A 4A93H 2NBUA 2A8VA 4PZ6A 4TQ0A 2W55A 3QWZB 4K7SA 2NVXB 2IGDA 3TEZA 2EY6A 3T51B 3BVZA 4JYAQ 1GB4A 1H95A 2K6DB 1UD7A 5TSSA 3MWYW 3AI5A 2ICIA 4HIOA 1WI5A 2VW9A 1WJNA 2Z6KA 4F8CB 1FCCC 2QJLA 1K0RA 4LJPB 1VQDA 3PMFA 5FO9B 4LFCQ 2PCFB 3PLUA 1WI0A 4I6PA 1L0WA 4HIDA 1WTRA 1EY5A 1RTNA 4NPSA 3CCSA 3WWVA 3VR2A 1N9WA 1PH6A 2LVQA 2V4IB 2CKHB 2OT2A 4IJLA 3PIPA 4O0AA 1QVGA 2MBBB 2PKOA 1KTKA 4K8IA 4R8IA 2RSOA 4DU9A 3K58A 3CRKC 1XLQA 4HPMB 4II2B 3AXCA 5M3FH 2VH1A 2DZJA 3CMMB 2OTJA 5IP9G 5C3JB 2VB2X 4TKNA 3QR8A 3UDXA 1PTOC 2B76B 2J42A 2FMCA 2YYZA 3T3OA 4ZK9B 5HKHA 4DGZA 3O65B 2DUDA 4NJCA 3AE5B 2HJ8A 2VUMG 1SFOH 3A74A 3NJTA 4K81A 4E74A 2F3IA 4WQOB 3TS0A 1XQQA 1QUQB 1PRTB 2YTXA 2KWUB 4KZCA 5KHOA 3CIRB 1LO5D 2JWUA 4L1BA 3B1LX 2PYKA 3GQBA 5M5XH 1G91A 2J0KA 2WQYB 3TMPB 1PRTD 4KK7A 3PO2H 3A9KA 1WXMA 2W54A 2TMPA 1LTID 4DV4Q 5G5GA 2PMZB 3J81E 3W1SA 3ONSA 5C44H 3Q24A 4PK1A 3VRBB 3F2DA 3NP8A 1G6ZA 1WRDB 4KHPL 3GOEA 4HJ8A 2JN4A 3DBLI 2N9LA 3P63A 2F0TA 1EWHA 1A3VA 3EROA 2LJIA 5M3MG 3WDNA 4TRDA 4ZRJA 2GVBA 3DWMA 4FHJA 4R1JA 1LLRD 1V9PA 3C1EA 2NN6G 3OOCA 3H0GH 1Y8PB 1UNSA 3QG1A 3ICEA 1PLFA 1H9SA 1WTWA 2WLBA 2FUHB 1CTMA 4XQJA 3GE3C 2V3PA 1AZPA 5IT9c 3ULLA 3RMKC 1GO3E 5C3EH 2EY5A 3CQZH 2BKFA 1VDZA 4FXDA 2EVBA 3X3NA 3D6WA 1A0IA 1DOLA 2KFKA 3WCQA 5ELEA 1U5KA 3JAML 2L0FA 1I3QB 3OIPA 4IUQA 4M1UB 4B9WA 1YNTE 4IM0A 4XE0A 3WIMA 2FNJB 3UI3A 4K0KL 1HZ5A 3NXWA 4G7HC 4UY8C 2FIDA 1SE4A 3Q2AC 2IW3A 4II3B 3KFUA 3NQIA 4BBSB 4TMAB 4CJ2C 1QVCA 1NBWA 1FVIA 1ZYRC 2M00A 3T13A 3RFZB 1RM6C 5IE8A 1FPYA 3N3KB 3HOXH 2CU3A 1G51A 3PHXB 3BVMA 2KJXA 4GN1A 2JYOA 3GTJB 1KLVA 3R8BA 3DWPA 1PMRA 1WTHA 2DJGC 3H7PA 2KQ7A 2K1FA 4ME5A 3BYYB 1NJIC 3B0AA 3RLNA 4KN4C 3KJPA 1PDXA 1XEEA 3D32A 3DVGY 1EFWA 3HRDD 2QHOA 3HOVH 4IOIE 4JLCA 1BR9A 4HDOA 4A3KB 3B2GA 4FLHA 3W3AA 3F2BA 1TWGH 5C4ZA 1PGAA 2DYMA 2ZCBA 2CU1A 3P4RB 1SNQA 3PO3B 2INCC 2LUEA 3QHTA 2LGYA 3A9JA 2O4XA 4LUOA 5T1IA 1XNQL 4LTUA 3D8GA 3DWQA 2CWPA 3V2TA 3STBC 5EKLA 1CSQA 2RCNA 1IL8A 4NXNL 3JAMc 3G6JB 5FJ8G 3RNFC 2WS3B 2M0XA 4L63B 1J7CA 2LVOA 2CKZB 2BYTA 3AE7B 2XRSD 1RHPA 2EYHA 2KT7A 1H9MA 4EE2A 3CCUA 3ZRCA 3RCZA 2NZHA 4XDXA 3D4WA 4LF7Q 1N32L 2EMSA 2B63G 4N9PA 4XIGS 1BO0A 3W1YA 3FPPA 2YEPF 4AS1A 1CZGA 2UU9L 5L37A 3AE9B 3KW5B 1H9RA 1GUTA 1SEBD 5C0XH 4TUUA 3OSOA 4JL9A 3H6MA 5T1GA 1BF4A 1YX5B 4XT1B 2WACA 1VQ7A 2E6XA 4KHVA 4OX9Q 3LX0A 1O78A 1I4GA 3EA6A 4A3CH 1BBUA 1IYVA 3V6CB 2L76A 5C23A 4ACFA 1JCKB 2H1EA 4LNQA 2V1YA 2LXAA 2VUMB 4TQUS 4KHPQ 2J0MA 4LF9L 3MTNB 4MDKE 2QGQA 2E2JB 1YZ6A 2XGTA 1QNUA 1LTRD 3ML8A 5NUCA 1IBXA 2JEBI 1PXUA 4IQZA 4DV6L 4XYCA 2N49A 3PZ8A 4ZHPA 4PS7A 4JI1L 4OEMB 4IURA 1E7VA 5DNFA 1WD1A 2B2VA 3KJOA 1MIUA 1QB5D 2XN9C 2E5LL 3ND8A 1YJ1A 3AEBB 3JSVA 2YTYA 4YWKA 2QIEB 2MCNB 4MJSB 2DLBA 4J1MA 4JQWC 5J22A 3MP9A 1RYJA 5LL6X 3AE2B 3PQIA 3HG9A 3K7AH 3ZXVA 4YSZB 1RIPA 2KQ3A 1ESFA 5EPJA 3KUPA 3OTOQ 3ZIMA 5M5YH 2A5HA 1GXDC 3T56B 4DR7Q 3X0WA 3D3RA 2A6EC 3AU7A 1UBQA 1EY8A 2FAZA 3APFA 3N1XC 1G6PA 3BZKA 4JBWA 2BT6A 4X64Q 4GOPA 3UDIA 3A8IE 2QEXA 5JVH3 1V1OA 1VQ4A 2NZ1D 1PZKD 4R9WA 2J53A 2Z0EB 4LDTB 1I6VC 2WX1A 4UP8A 4IZ8A 1HUNA 3HVZA 5J1ZA 1K83B 3HOWH 2IO1B 2Z6BA 2MSED 4IW0A 1HZBA 3VUXA 4LDTD 1NAPA 4X66Q 1ZPSA 2ASBA 4C56C 4A3JG 1Q8KA 4DR1L 4RGOS 3RLFA 1VQAA 1DONA 3DBRI 1OEYA 2PW5A 2B2YA 2Q2IA 1CA5A 4YTNB 1M90C 1KRHA 4XX5A 4AQYL 4QQBX 3I4NG 1WFYA 1BDOA 1W3SA 3K59A 3H3VC 4QF4A 5ELOA 1NI3A 4OO1H 2L52A 2B2UA 3MHSD 1WWTA 4BWGB 4F87A 2JE6I 3DM3A 2Y5BB 4X62L 3RNGC 2G3QB 4US8A 4DV3Q 3GTLH 1PV4A 1B7YB 4NMZA 4OGQC 4ZOHC 1EWIA 4M00A 2ZCCA 5H8YE 1JQ4A 3S1RH 4N8FA 3IT4B 4KJNA 3X23A 2DY7A 4IFDH 2NTSA 4CKEA 1IKMA 3KWVA 2UU9Q 3A7AB 3RZWC 2L7RA 1JMCA 2F0FA 2UXBL 5IODA 1H4RA 3L0WB 3U30A 1RD9D 2CJOA 1NR4A 1FRRA 4DDGD 3PZ7A 3FHWA 1YOVB 1MHHE 1Y14B 1O7YA 3F2UA 5CYUA 1WGGA 1L1OA 5ISRA 2ZNVB 2JA8B 2LXJA 3CU7A 4JBJA 5CTRC 5E6JA 4K2LA 4HAEA 1C4AA 4ULLA 2PMVA 5AZGA 3FKYA 4MSMB 4A3OA 5IGBA 4X3KA 1UBIA 4RGNA 5FLMG 3NS1A 3B9JA 3GTQB 1Z9FA 4JBMA 2IGHA 3A7LA 1UWMA 3ALBA 2QEJC 1SMYD 3PIO3 3T8MA 2BWFA 2MP1A 2ZXRA 3L0OA 2QW7A 5C4XH 3ZW3A 3HK0A 1HZ6A 4HROA 3IAS1 4GNXB 1V1QA 5AZFA 1WYWB 3JYUA 3N1YC 1IPGA 5M3MH 4DR6L 1N60A 1QF6A 3SFEB 4HEA1 2L15A 1IYUA 3TP6A 2I1JA 4M0WA 2NN6H 1ENCA 1MSGA 1NUCA 2J4XA 4X3TA 4PV1C 1WGDA 4XQQA 4LF4L 3OAWA 3K5LA 1DYQA 1JWUD 3KBGA 1D1KA 4K7UA 4DV5L 3H3VI 4DHZB 5HFYA 1JOOA 4L5QA 2N9EB 3T9LA 1GUOA 3E0JA 4XZ4A 2WFWA 5IGEA 4IWQA 1CKNA 2QKIC 2EJFC 4P73A 4BY7B 1PQSA 1QVFA 5ELNA 1PH1A 1IBLL 4A3MB 2XWBB 2G9HD 3M4OH 3EUB2 1NEKB 5HHDG 2PZUA 2KVMA 5BMGA 1PH4A 4DR1Q 1EIFA 1X9NA 1PRTF 2EIFA 5D3IB 3Q8CA 3SHQA 3M85A 3VTUA 1N61A 1K8OA 2Y0SE 5IP4D 4YCWA 5C4JB 3PCOB 4PMBA 3B6YA 1N34Q 2KA7A 3ZJYC 4LF5L 4A3FG 3AU4A 2UXDL 3V05A 3TEWA 4KSKC 3JVZX 1PTOB 1UGMA 1SE2A 2MHVA 4UDUC 5LHY1 1WZ3A 4G50A 1N33Q 1DZ1A 1EYGA 4BKSA 3SK6A 1N6ZA 4EZJA 2AQ2B 1PUTA 2BE5C 3K9PB 4YIJA 1MBYA 2YU9B 1QOBA 2ZT9C 2K6QA 4XQNA 1T6BX 4DAYB 1AEXA 4OWXB 2DZIA 3SU8X 3I4NB 2VY3A 3MFGA 1JORA 1GKHA 2K05A 4QY7A 2BQQA 3CCRA 4H13C 4ODGA 4N9TA 5FJ8H 1L4DB 3G71A 4ICUA 3RUIB 3NY5A 4YTMB 3NEMA 3PPAA 2AUKA 3T1YL 1N5WA 4LLGM 2PIAA 3ETRA 1UE1A 2EJGC 1I6HB 4R4CA 2FBWB 1VQPA 2B63H 3QAQA 4LK0M 2K39A 1OGWA 2J0JA 1FO4A 3SDZA 2JWZA 3NVVA 2UXCQ 2GRIA 1EUJA 4WJ3M 4ASWC 2LXCA 1U4MA 4LNNA 2HCCA 4W9JA 2WINB 3Q14C 3WAPA 2A74C 2F0SA 3NHHA 3VYUA 2ZM6L 4P6VF 2R7ZG 2EXDA 2R92H 3J7ZC 5EPLA 3MZ5A 1JC7A 4ME3A 1OQRA 2PI2A 1X3FA 2KENA 1WD0A 2O5IC 4HPLB 4KD3A 1KNAA 1CHQD 1C77A 4HN7A 4C7YA 3PHWB 4YT0B 3F8TA 1YN3A 3PUZA 3URYA 5JEAG 4DR6Q 1WJ4A 4G11A 2JA5H 1D1IA 4FF4A 3CSTA 5DM73 3S17H 3OWEB 1NI2A 2A19A 4K14A 2D3BA 4LNIA 2KO3A 1JW9D 3RYTA 3RN9C 3N52A 5CHWA 2K50A 2KCMA 3U52E 1V8CA 2MQHA 4NAWB 4JI3L 5HGQA 2XEWA 3HOYG 1AWDA 2UYZB 5C5MA 2DWQA 4BKSD 4K7WA 3J9CA 2LGDA 4WJOA 2HD3A 2NCNA 1L7YA 3DBSA 1D4BA 3IAYA 4IM3A 1SYFA 2I0QA 3Q3MC 1RDPD 4H02A 1KFYB 1P3QU 4TVAB 1VDVA 1WJ6A 4W9GA 3U50C 1EYAA 3CCQA 5T8IA 5IY0A 5H1SE 1VQJA 1E5WA 1JWBD 2MBHA 4Y7NB 1C78A 3GTKB 1WE7A 2JQRB 1ICWA 3QJYA 2ZJRA 5GAHC 4B3ML 3M3YH 4KMUC 2W3SA 4KZ0A 2Z1CA 5C6AA 3STBD 1TS3A 4BAXA 4IUMB 4A3JH 3VUWA 1D8LA 3RZDB 3K6OA 2D3GA 1HEZE 4WJPA 3NELA 2IHFA 5BMHA 2WB1E 2C5LC 5KNBA 2JVCA 2IT1A 1EOTA 3NVYA 2JJQA 1K50A 4K6LA 1HXYD 4A3EG 1T5EA 1OXTA 1X3EA 2JXMB 1FEHA 4JPSA 4PMCA 3W5VB 1LM0A 2CH4A 1NMFA 2H5XA 2L83A 2QCPX 4K3BA 4A3GB 2G4SA 5ELDA 2WU2B 3RZFA 1LACA 1WYGA 4M01A 2LVPA 3Q69A 2XK5B 1IL2A 1HTLD 4MEMA 2Q8IB 4WWOA 3FILA 4V190 2KX3A 3H09A 5KYIA 1SNDA 1B8AA 1KDBA 3S15H 1JRUA 1ZEQX 3S1MB 1ZW7A 4RH6A 1RWSA 2KTRA 5IWAL 2LMCB 1J0GA 1K9MC 4BBRB 4KKTA 4C1NI 5E4WC 2X8XX 4XWTA 5CV5A 4NXMQ 1FRDA 2ZM6Q 2NPTB 2EOTA 3HOUH 3PZDA 2A73B 3VR9B 1WJJA 3OMCA 4OXPA 1V9JA 4M8MA 1K0SA 1OXSC 5JPMC 4GKKQ 4N59A 4NAMA 1JB3A 1F2MA 5C0XI 3MFYA 4H2AA 3QARA 3VUYA 2K5WA 5FLMH 1ZKHA 3Q23A 3RPFC 5EBDA 4IOAA 4KKSA 3HM3A 2LD9A 2YEPB 1EY7A 2FXQA 4FDBA 5DLQE 2A6ED 2QILA 5ELBA 2PPBC 4JI5Q 3WAMA 2KLGA 5G2NA 5AZHA 1I35A 2BA0A 2R7ZB 3IVFA 1DGSA 3JAMi 4JI0Q 1PHJA 1IW7C 3IT6B 4FULA 4JI3Q 2BH2A 3KH0A 5IP7G 2MJDA 4DHJB 4R3DA 1NR2A 4L23A 2VB3X 5IYBG 2WDQB 5AJ3Q 3S16B 4B3TL 1X32A 4AQ7A 2WKDA 4LNKA 4DHJD 2D5GA 4W9EA 4PS3A 2RDFA 4HVBA 2CFMA 1LTTD 3AV8A 4LNOA 2KN5A 1P0RA 3CCVA 1V6EA 3UQBA 1LV9A 4KDIC 3K0YA 1WRIA 2BGFA 5AEKB 2JP1A 3NS8A 1YIJA 1GHJA 2XTIA 3G48A 3GTPB 3FILB 3LWUA 4B3MQ 1QZHA 4DAPA 1X65A 1UELA 4ZRPA 4QB4A 2KTRB 2O6VB 3IAM1 1FNVA 2IGGA 4L5SA 2Y5PA 2IX1A 1V1PA 5AUKA 5DPWA 2Q8RE 1FM0D 2O6VD 4Q5VA 1WTOA 2O5JC 1EIGA 1R7SA 1VQIA 1TKGA 1QG7A 5E1FA 1MD2D 4YCVA 4A3FH 1SRUA 1Q1EA 2YVCA 3AEDB 3H8HA 5BYSA 4DV2L 5EGTA 2KDMA 5KNDA 2PW9A 4IALA 2QDFA 1EY6A 4WH4A 4HIMA 3TL5A 4B6WA 5EQ0A 1GM5A 5DCNA 3AEEB 2F0NA 1R9TH 3ZDTA 4O2DA 3UDFA 2MRPA 1NCVA 3VR6A 1PFNA 1ACCA 1XMQL 3GO5A 3DHHC 3Q3JA 1B3AA 3Q8EA 3E0EA 3CMEA 4HMJA 3TS2A 1VLBA 2C7MB 3AMZA 4OO1I 5CX3A 1I50B 4ZLTF 5FK9C 4QIWE 3SK4A 1IGCA 4A3EB 1CJEA 2JXTA 1YNND 1XNRQ 1V5OA 3PO0A 3PF5A 2K5DA 1HNWQ 1CHPD 1LTBD 2KHJA 2OEOA 1VD2A 2JY6A 2ACZB 4FJZA 2K5HA 2F0DA 1J9OA 2JZ3B 2MPMA 5JJIA 4LK1C 2KVRA 1X6OA 3VDYA 1NE3A 3HOZB 2BB5A 4XGAB 4JI7L 4IFDI 2HHHQ 2X69A 3GTMB 2R3ZA 3PT2B 2IJ0A 1WMHB 2M2LA 1WTQA 4WURA 4GN3B 4B08A 4NQLB 4JI4Q 5GADC 3VR4A 3CXCA 1HNXQ 2IDYA 1QZEA 1WOCA 2F0WA 2RA4A 3PSIA 2AMCB 1YHQA 4BBSG 2K8CA 3BJUA 1J19A 3ML9A 4I6NB 3TP5A 4B3SQ 4JVZA 2RDBC 2ZJDA 4YHHL 4HDQA 2JRHA 2R7FA 1E10A 4IUUA 1PTOF 4BA1I 3BU2A 3TREA 1QUQA 3RZOH 2PVOD 3PTFC 3R2IA 2QA4A 5K36G 5BN5A 1YVCA 4I65A 2V0GA 5JEAH 3R3OA 4LF8L 4DR4L 1I4PA 2WP9B 3N1ZC 2J0TD 1I4XA 2Z0SA 3EBEA 4OONA 4B3TQ 1VQ6A 1C7YA 1HTOA 1L2NA 3QOJA 4RCNA 5COYA 5BYQA 4E3CA 1BT0A 3PO3G 5TR5A 4DV0Q 4C80A 1KIXA 3BVGA 5IYCG 1JJCB 4LF6L 1GUNA 3UI2A 1T9HA 1FFVA 3HOYH 1EYDA 3FDTA 3KOJA 4YY3L 1NYQA 3EVQA 3MJWA 3Q8BA 1MJCA 4AYBE 2EKEC 1VRAB 5KIXA 4XT3B 4MH0E 1RTOA 2IO0B 5BMIA 2GLSA 1CQFA 1QCBD 3NVZA 1T0RC 3IXSA 2RQXA 1PYSB 4PZ8A 4EQPA 3K9OB 3CPWA 4KIKB 1CUKA 3V6EB 1VS0A 4J6HA 2K22A 2KK8A 2L55A 1OQYA 2MBEA 4F1SA 1FMAD 1XCQL 1U4PA 2BE5D 4ZCKA 4HR7B 1Q3LA 1S40A 2C60A 1AW7A 2K3UA 4JWSC 1DGJA 4DR2Q 3I5JC 2M0AA 2RPVA 3DBHI 3KVFB 2VL6A 4MM3B 3BINA 2RBMA 4QCLA 4HCSA 5JJLA 4ID6A 2ZXPA 2VRRB 1VCIA 4X65L 4HCPB 3SVMA 1SIFA 3E9IA 1SMXA 1CA6A 1VQ5A 4TV3A 3IKJA 4OL7A 4LUZA 4HJ7A 5IT9L 2F0GA 3FP9A 3Q0AA 2VQFL 3W1BA 4EEWA 1HA5A 3MEFA 4OZBA 2J7ZA 4P7IA 4LFBL 4G3XB 2F4VL 4FF2A 3L17A 3I72A 1YNXA 1C0AA 2R93G 4ZYNA 1KXLA 2AYOB 1V97A 4OWTB 3P4PB 4A55A 4DUYQ 1DJRD 1E8YA 3HS0C 4MSQB 3IFWB 2PPHA 3LDZE 4GMVA 2BS3B 2GBJA 1OQQA 5I9PA 2E74C 4NNJB 4WIPA 2WXFA 3P1MA 4EVOA 1A5RA 2CH4W 1TWCH 2Y0SG 2LFNA 1SROA 4YWMA 2ZJQA 2JZZA 4KI0A 3RNEC 3Q8FA 1EIYB 4KVGB 2JUOA 1YI2A 1YNJD 2QDBA 1D5XC 2ZTEA 1TQOA 3OWFA 2JYTA 4K6DA 4A3BB 2GBRA 2WWZA 3P42A 3ABVB 2Z4HA 1FNUA 4GLXA 3UIOB 4DV7Q 3KQ4A 3LXFA 5CV8A 2CQAA 2JYEA 2KAJA 2WXGA 4YHHQ 4RKBA 5GROA 3SGIA 4P75A 3MXPA 1Q81C 4C2MH 4BS9A 5M5WH 1HHVA 1VZ8A 2PJHA 1FIQA 5IYDH 2WXRA 3S9WA 3PRPB 4CQNA 3U4EG 5MPOA 4LF8Q 5G55A 1LUZA 4FHKA 5E6NA 1IUEA 3PUXA 2ZXOA 3A56A 3NPPA 4IUVA 4IN3A 3KYCD 4MT5A 3NUHB 2D9UA 2LHDA 1SDFA 5D3DA 5A2QE 5JJKA 2OOBB 1WVLA 2NVXH 5IP7H 1HRJA 2F0VA 1QE6A 1GHKA 3FEWX 4V0BA 3CP0A 4GU2A 5J2RA 1LGRA 3EJIA 1EO6A 2AQ3B 3CC7A 1QJOA 2INPE 4ZUJA 4A3PA 4BKTA 1JWAD 1IYJB 4OVUA 1JE5A 1MGSA 1F2LA 1LT6D 2RCFA 2EY2A 3KF6B 1TJEA 1XCTL 2MWSB 2N7EA 4W9KA 1SSOA 4PYUA 4BOZB 4JI8L 5I2XA 3CCEA 3PIOA 3KUCB 4DV1L 3CHBD 3UIPB 1D3ZA 4PG3A 1E1OA 4HMIA 3JC66 1PH9A 5LNK1 3MXUA 2JU6X 4MJSA 1EFID 2F0PA 3QIAA 4X3UA 5JHAA 2ATWA 4DWFA 2AX5A 2JZPA 2KDBA 3AE6B 1MJDA 1TKYA 5DPTA 4RHRA 4HTHA 1P8LA 2E2HB 4GGQA 4P2CB 2OHFA 3VYTA 1RFKA 1HA6A 2UUBL 1Y8RC 3RNCC 1C4PA 1TIFA 2JA8G 2KHIA 1QOFA 1A15A 2F3WA 3BDOA 5C5LA 1CSPA 2WXMA 1CKOA 2D3AA 5LLIA 1JALA 2EPBA 3PVLA 2HJ1A 1XWEA 4P72A 3MVVA 1K73C 4BXXG 2C7NB 2LGIA 2KOXA 1A3UA 4R4IA 3C3LA 2B3AA 4HJKA 2V9HA 3P7JA 1IBML 1C8CA 1K3RA 1WFQA 2VZAA 2N7JA 1TWFB 2PO4A 2WXIA 4C7ZA 4TQ1A 3W2DA 1X56A 3OPOA 1EZ6A 1WM3A 4ZRZA 2N3SA 2F3VA 3NBHB 5GAGC 1K8AC 3IG3A 1FD6A 4EQOA 2KQSA 3E5SA 3VH4B 1H9JA 1A8VA 3S1NB 3EQLC 2WAQG 2A4ZA 3DEOA 4MGKE 3EC8A 1HUMA 5FLXL 1Q46A 1RODA 2B2WC 3HUIA 4MZ9A 1VQLA 1JROA 4WORA 5CBEE 2F0MA 1PGXA 2XBBC 2IX3A 3AYHB 1F9RA 4M8AA 2R93B 3VYSA 3D6CA 1YN4A 1C4QA 3FKIG 2OJRA 3E9SA 1QT9A 3ZGZA 3MA2B 2WX0A 3J80E 3DMUA 3N30A 4RM9A 1AYFA 1IW7D 3GZNB 1I3QH 3GTOB 2PVGC 1LT4D 4BY7G 2WB1G 4FO2A 2G4DB 2N9PC 5CMDA 4Y52H 2F0QA 4A3MG 2O2LD 2PTLA 3FRPB 2Y0SB 1EY9A 2EDGA 4BBSH 2CWAA 1TVXA 5C0XJ 4K0KQ 2IO3B 4DF7A 4YCUA 1N5XA 2MO1A 1STBA 1XLPA 1BQQT 4YWLA 3GTJH 1C4CA 1UEBA 1IGDA 1TS5A 1LABA 4JG2A 3ZNGC 5CGKA 2L12A 2NBFA 4OHJA 4RFBA 1ZGUB 3PRMB 1VMCA 3L10B 3ZKJC 3GB1A 1STNA 1E7ZA 1LFDA 2I5HA 3MC9A 3PIP3 1KJTA 3E56A 5FLXc 2XVSA 1XPOA 2WYQA 4A3KH 1U4AA 3I2ZA 2E8GA 1M1KC 2B29A 4EGVA 1QWYA 1L0XB 3AH7A 3PO3H 2ASQA 2CW0C 2D3CA 4OZAA 1CMXB 3CF5A 3M3JA 5DM63 4C3IG 4GNXA 3FVQA 5IYCH 4FADA 1EYCA 4JI8Q 4DK1A 1E2WA 1SE9A 4W9DA 2JA6B 2HDLA 2F1MA 1HZAA 3BK2A 2GVAA 3BZDB 1XNQQ 1DXMA 1S5CD 1STAA 2IL8A 2D2QA 2M56B 3U7ZA 3NZSA 5IN7A 2DX5B 1CM9A 2F0KA 3WANA 3BK1A 4TKOB 2DAJA 2Q5WD 2PW7A 1GVPA 4NXNQ 4NQKE 3I3CA 5C1ZA 2PE9A 2WXPA 1SJHD 3RUZA 1K8GA 2NVQB 4IUTA 1LTSD 3ITPA 1EL0A 1OFFA 2EYMA 1ASZA 5FKAC 1S5FD 2MP2B 4HRSA 1WSPA 4A4IA 5AFWA 2F0OA 1N32Q 1E0BA 4F7ZA 4KY6A 4EZLA 4BKGA 3PS6A 4IDIA 4JV5L 3QB3A 2N1VA 2B2TC 3M4PA 3S24A 2HIVA 1L6UA 3NVWA 5IP9H 4I6LB 2DYBA 1D5MC 1JWMD 2FMMA 3UDGA 1Q8IA 4KTAA 1C9FA 4MTKA 1Z5SB 3B2FA 4WAAA 3CCLA 3T16A 1KLUD 2VUMH 2KN4A 3ZXRA 3ZLZA 2OXPA 3AFQA 1XPRA 1A62A 2BB6A 2W9NA 1VQHA 1S5DD 2E2JH 5EAYA 2MX2A 2KCCA 3K0XA 2KJHB 2ZEQA 1GUAB 3I4OA 4LF9Q 3S2HB 4ARCA 1V2YA 2EZVA 4G4KA 3A8KE 5L83A 1KABA 3NSWA 2A5UA 3ZYYX 1F9SA 3I7FA 3ONAB 3IFTA 4DV6Q 2H4OA 4JI1Q 1SYDA 2A6HC 4J15A 3DBLB 4DAYA 4YWGG 4MGZE 5JXVA 1ILQA 2E5LQ 4A3IB 1H9KA 3AEFB 4OELB 3KLSX 1J7AA 2BF8B 4IKGA 5JOBA 2GOWA 4S0RA 3SFDB 3ZJVA 1N36L 1KDAA 5E4XA 4IOCA 5D2MB 2WAQB 4RF0A 5JZEB 2JEAI 4IFDJ 1IXRA 3GE8C 2LFIA 4DK6C 5C3XA 3HIZA 3ZJTA 1ENFA 1FGUA 1XPUA 3QC8B 4J3OD 4C1NK 4LJOB 2KZRA 3U9OA 4B0MA 1PYWD 4HSVA 2ZTDA 3EIVA 1HH2P 1K83H 5CBAE 1ZDXA 1A3TA 1F2YA 3FKIB 3HVDA 1ZXTA 5EDSA 1V86A 4OIJA 1KNEA 4UAIA 1QKZA 2YV5A 3K81C 3H15A 4IUNA 1DOIA 5M9OA 1XLNA 2RF4A 4OW0A 1SJED 3E3XA 3PGZA 2KNBA 2WB1B 3JAME 1AP0A 2K0PA 2KQ4X 1STYA 1TWAB 1GC7A 3N20C 3VR3A 2FINB 4NY0A 4KKJA 1FJGL 4DQOC 2VXWA 2K9XA 3L7ZC 3U4ZA 3I4MG 4CBVA 1FYCA 3DDCB 1JOKA 4AQYQ 2AWTA 3M63B 3HKZE 2KJRA 2VZKB 2X6GA 1U0LA 4PQXA 4A3GG 1Y1WG 2KEEA 5EPKA 3SEBA 1WTVA 2DNFA 3S2AA 3V3XA 1D2BA 4JGHB 2NYZD 1TTNA 2VZKD 1N62A 3ZTDA 1PTOD 1C79A 2FFKB 3VA5A 1PYBA 1DOKA 1PH3A 1HFNA 4X62Q 2K8BA 4LNFA 4NAWA 3WALA 1MPEA 2K04A 2EQSA 4C3IB 2JF5A 4FP5D 3P75A 4FNFA 2JRIB 2NMQA 1YD8U 2CCZA 2BKRB 1ML0D 5IKCM 1IP9A 4WRDA 1SNPA 4BBRG 1WCMG 4AIMA 4C3HG 2J52A 3MC0B 1Q5WB 3CMAA 4DUZL 1MG8A 2VH2A 3AULA 4MH8A 3V62A 3B08A 5BR8L 2UXBQ 3GTGB 1XF5L 3KLSA 2JA8H 2KHWB 3VQIA 1X54A 2MBOA 1PA6A 1M94A 4FA6A 3PV1A 3S1QB 2JA7B 1IBKL 3PV0A 4CDEC 4BXXH 4ANXA 2LI5A 1EIHA 1V80A 3D0FA 4A3DB 2N1WA 1IZ6A 2UWQA 3L54A 5BO4B 3GTQH 2X38A 4DR3L 3TEYA 5KGUA 5E7NA 2BTEA 3QO2A 2LRWA 3SR6A 4C4VB 2HQEA 3J80i 2MQJA 4PMWA 1F9JA 2NBVB 4K3CA 4MHEA 4AYBG 1CKMA 3AMUA 2KANA 5EE9A 4A75A 4P74A 3AE4B 2K6AA 1K52A 4BVUC 1UUPA 4HK2A 3D4DA 1XD3B 3PUWA 2DZMA 2K5VA 2LEKA 1SNMA 1II3A 2CJNA 1TWHB 2K28A 1SYBA 1AZQA 4GSWA 1JB7A 2NWGA 2HIXA 1WE6A 4IJHA 4DK5A 3Q6BA 5CR3A 1SE3A 5C3WA 1YJIA 2WXHA 3CC4A 3KDFA 1IKLA 2BVCA 2F0EA 2F4IA 3FKIH 1F9PA 1WY8A 2XK5A 3AM9A 5IOCA 2FCNA 3DPDA 4YSXB 3W1GA 4LF4Q 5I6YA 4WWPA 2RR9A 1OXVA 4KD4A 1ZYRD 3AE1B 2ON8A 4BY7H 1KC8C 4DV5Q 3ZNHB 3T53B 1JQYD 1EZ8A 5LMNL 1WGHA 2LMCA 3R7RA 1AN8A 2RHSB 4A3MH 3QJZA 1KDCA 2AWOA 1EQTA 1Y1VG 1YJNA 1E7UA 2CHWA 3H7SA 4P71A 1RAXA 2NPTA 4JI2L 4OIKA 1IBLQ 3MXNB 5C4JH 2F0IA 1SF0A 1OEYJ 1R4NI 4BY1B 2CHZA 4GN4B 1D6EC 2L0TA 4CJ0B 1PTOH 1STHA 1FNWA 1LTLA 2K75A 3I4LA 2M4NA 2Z6KC 4LF5Q 3LYYA 1OTCA 2UXDQ 4BFRA 1VCBA 3TP8A 3DBRB 3UE1A 4JIOU 5I9OA 5D65A 2A69C 2R61A 4B3RL 2UUCL 2YU9H 5E6PA 3G7LA 2MJ8A 1TKWB 3SK8A 3DVGX 4QIWB 1S5ED 3PUVA 1KRSA 1XTDA 2LHEA 3BDCA 3T3NA 2NUCA 3I4NH 3TCAA 1ICFB 2CVRA 4CDDC 4R4OA 3A4RA 4GXBA 4EX5A 2AKWB 1R4QB 1HR0W 3I4MB 2NVTB 4IC7B 2V3NA 4ILWA 5F2DA 3VAWA 3RN5A 3S14B 2ZJPA 1PVOA 1Q82C 3NZ3A 1I6HH 1HTQA 3NG0A 4DUZQ 3KDFB 1Y1WB 3HOZG 2ZPYA 4DA2A 5BR8Q 3TBLD 1UF0A 3T1YQ 3ZTCA 4US9A 3AFPA 4H44C 2L00B 1IBKQ 3U58A 1TZOA 4JX1C 2WU5B 1XTCD 2UUAL 3AEAB 1LYLA 4M8NA 1K3BC 4DBGA 1I7HA 1MG4A 4I7AA 2O6VA 3IHPC 3AECB 1MHWC 4XC2A 4L2YA 3VDZA 1WCMB 1A70A 2K5NA 3W1SC 3Q6SA 4C3HB 1VF7A 2E2IB 4WJQA 2KC1A 4N8X1 4NW2A 1TS2A 2NR2A 4L8JA 2REXA 2K32A 3KF8B 4DNTB 4S3SA 3J81L 1V81A 4RMAA 4WWMA 1KLGD 5JPNC 2B39A 1EF5A 4DK3C 1WGKA 3HFZB 4LJZC 4HLEA 3D31A 1OO9B 5G3LF 3DCGA 3N32A 4HKZE 4B9KA 4LMQD 5IGFA 3ZVVA 1XT9B 1E8XA 1B3QA 5EJWA 1BXTA 2EYJA 4RGTA 2G9DA 1Q7YC 3DVNU 4C3JG 1R4MI 3T1HL 5IO9A 4AYBB 3TIXA 4KV6A 1O7LA 4DNIA 2YLMA 3H9DA 1KF6B 1WX8A 3H0GG 2GBNA 3LB8C 2BS4B 2E76C 4FJVB 1VMPA 2D2CC 3X3MA 5DAUA 5FOBB 4PZ7A 1KRTA 4TSSA 3GV6A 1HCZA 3I57A 4RKLA 5C3EG 2IX0A 1SLJA 2NVYB 3NWTA 3OHXC 3CRLC 3NTKA 2Z0DB 1KM7A 1ET6A 1RKNA 1VR9A 3GS2A 2CW0D 1X3PA 2V4LA 2HQLA 1TT2A 4I7ZC 5KNCA 4Y7NH 3GTKH 4IG7B 4YTPB 5CHFA 4F88A 4DXGA 3K5OA 3KUZA 1WMHA 3J81c 1BBXC 3RZDH 1WGRA 3I9V1 1ZOYB 4RF1A 3HOXG 2MHJA 5H92C 1HZ9A 1Y8OB 3BZCA 5JVG3 1L4ZB 2WHIA 1Y1VB 1LXDA 1L2FA 3DM1A 4DN4M 4XYOA 4LUVA 1Q12A 4IPHA 4UP9A 3PRZA 2BH8A 4ANUA 3H94A 2D10A 1B4OA 2KFJA 3ZDMC 2M9VA 1B1ZA 3S2DB 4DXFA 2L1BA 1J5EL 5AUIA 2K14A 1Q0WB 4A9AA 1RCVD 4A3GH 3CCJA 4GLAC 4L5TA 5A35A 3RNUA 5CV7A 4JYAL 3N9YC 3DUZA 1RFAA 2IYDB 1DM0B 4OWWB 2MLBA 4A93B 2INNE 1PH2A 4CJ1B 2NVUI 1ZKOA 1U4LA 2K52A 3OYYA 4JW0A 3ULPA 3WOEA 1K51A 2GI9A 2RD0A 1YQBA 2ONQA 4GDLB 3S1MH 2ZW1A 2FCQA 1SSNA 3PUYA 1XO3A 4BBRH 4EUTA 3PF4A 2F0LA 1ONLA 4KIKA 5ELCA 1E6EB 4A3BG 5IWAQ 1S4ZA 2Q8TA 1HTPA 2K7VA 1XXGA 2I07B 4CHKA 3Q3NC 2ICEC 3P20A 4GKJL 4ZDVA 2BDOA 3L2PA 4PYZA 4MM3A 5M3FB 1MI2A 4FJYA 4IPDA 1FXAA 4K5VA 1Q86C 3NUCA 4XWWA 2QSDA 3SK5A 2K1BA 4MN3A 1WXVA 4DXAB 2GB1A 4QGUA 4AWJA 1F9QA 1GPXA 3A5UA 2N8NA 1SYCA 3H1UA 1KD1C 3OJ3A 1SFOB 2R7ZH 3Q3FA 1PH7A 2B2VC 1UGJA 3M7GA 2KMMA 4MGIE 3A1QA 2KUMA 1A2UA 3L4PA 1GJXA 3FC4A 2FUG1 1W6KA 1O7ZA 4OVVA 2BWES 1HPCA 3K80C 1SIJA 3OG5A 2L11A 2QF7A 3EN2A 5M5XB 1NDDA 2LZ6A 4WWNA 1SGHA 3UQAA 3S16H 3VXWA 1WGYA 1NSNS 3PO2B 3UINB 2GA4B 1E8WA 2MO0A 4CDFC 1FGBD 5IGGA 5C44B 2WXNA 4JI6L 3C2PA 2XRQD 4MTNA 3TZUA 1DCZA 3I63C 4LAAA 4GOPC 3ENEA 3SD5A 3EFXD 1BBWA 1ROEA 4OVZA 2JXXA 1EEID 2C9WB 1YEZA 2KC2A 4WAFA 4C3JB 1BCPC 3QK0A 3GTPH 3Q22A 1VZ7A 4S17A 1TYGB 1EU3A 4R8NA 5BN3A 1YITA 1S1QB 3H0GB 4ZHOA 5EE3A 4FYDA 2NN6I 4QL5A 1UAPA 3HM6X 2DGYA 3DEPA 1J8CA 3AN1A 2B2YC 4DK0A 5L95C 5C3EB 1J8IA 4JCVE 4PNYA 3CQZB 2L8JA 1GJZA 1EU4A 3RLOA 3TZDA 3KLRA 2D62A 1TBEA 4Q2JA 4RMFA 1LQBA 2WXOA 3OW7A 3U2SC 1RLFA 2BBCA 1GOZA 4HJ9A 3L3OC 2KWDA 2K01A 1E3PA 2B2UC 3AQQA 1NY4A 1I4QA 3TMEA 1ZUD2 3BWUD 3CCMA 2NBWB 1G291 5J18A 2R7DA 3PREA 1B50A 4DV2Q 1HQMC 3BYTB 4ABNA 4O42A 5LMNW 3F1ZA 4BBNC 4IO9A 2N7DA 1FL0A 5JEAJ 3HOXB 1NTGA 4HPPA 3CSFA 3CWIA 4AJYB 4OO1G 3K5NA 1Z2MA 1SYGA 4IWOA 3ZO5B 2BYFA 2KACA 2HUGA 1I50H 2A1AA 1QOGA 3A1QB 3BIID 2AHOB 1XMQQ 1OTRB 4UHVA 4A3EH 4FVMA 2N55A 1BKBA 1KAAA 2AL3A 1X3QA 3HOVB 2ZPNA 2DNEA 1MFWA 1K28A 1ASYA 4EQNA 4IPCA 2KWVB 1TWGB 2WDVB 2PZTA 1BNZA 5D14A 3KF6A 1YJJA 1NYRA 2KDIA 1PZID 4HJAA 4K8JA 4IFDG 1AARA 1E7PB 1FR3A 3HOZH 2D07B 3C46A 4NKLA 1L1OC 2G45B 3GTMH 4GKJQ 3Q8DA 1WX9A 1Y8NB 2VNUD 1UZXB 3OLMD 3RI7C 4KJOA 2OQ0A 1JICA 2Y5CA 4JI7Q 1HE8A 1J6QA 4GDKA 4LF7L 4EZKA 4A76A 3APCA 1UE6A 2KBNA 5G5HA 3HP3A 3MC8A 3VH3B 2A68C 3MAQA 3SR1A 3OW2A 2ZVOA 2R2OA 1F1HA 4AJWA 3HKZG 2MBQA 1VQEA 2DAFA 4OX9L 2HTME 3KLWA 5E3FA 2WXKA 3O13A 3TRZA 4LCDE 1E2ZA 5LXIB 2QDLA 5C4XG 3V61A 1XMOL 4IUPA 4RA8A 1G2TA 1B9RA 4J8QA 5HI1A 2N88A 2KX0A 2WXLA 4DR4Q 2LS01 2KOLA 2EY1A 4QMGA 1R4MB 1TS4A 4C3JH 1FXTB 4JI6Q 3P2BA 3EFCA 4NZLB 4FF3A 2LRUA 3NBHA 1I94L 3E6ZX 4A3LG 2JA6G 4EOYA 4F8MA 4LF6Q 1QQRA 1B9MA 3J7AF 3NTHA 1Q1BA 4YY3Q 2FHTA 1YIWA 3NHEB 4YXDB 5IYBH 4IPGA 2HDEA 1M4VA 1VQ8A 1DD2A 3BS1A 3ZRFA 2PLPA 3VR5A 2V3SA 3OTOL 4KY7A 5C2TB 1B70B 3WA0A 5EKKA 1Y69U 4DR5L 4GZYC 3D4RA 4EQ5A 4DR7L 2A69D 1T0YA 2MJ3A 4KSLC 5CV6A 5ELFA 3K7AB 2MH7A 3K5MA 5C4HA 1RRBA 2AL6A 2HT1A 4X64L 5M5YB 5D6JB 2NZOA 5J3BA 1Q1OA 2W82A 1VQOA 4RGMA 3SXHA 3L16A 4GDKB 3AEGB 3R93A 3DQVA 3L08A 4JBKA 3DOWA 1E2VA 4USAA 3LNNA 4X66L 1EY0A 4X65Q 1EQVA 3UF8A 4ZRIA 4NDXA 3CKIB 1VF5C 3DVNV 4ZRQA 1WR1A 3HOWB 4GLSC 2K33A 5IGDA 1L6VA 3A9KB 1SAPA 1STGA 2AUJD 2VQFQ 1YX6B 1T3QA 4ITKA 5KEEA 2L05A 1V8QA 2WP8J 4LFBQ 3VVWB 1TZ1A 2F4VQ 1UWVA 2KLCA 4KHZA 3QA8A 5GMVA 5FR3A 2L1AA 1RL2A 1K8RB 1ILPA 2ZZPB 2ES2A 4J6IA 1KHIA 5BYRA 3I3TB 4A3IG 5HURA 4DV3L 4APVA 2MEKA 2NTTA 4ZUIA 1VQMA 1GNUA 1CT1D 1H9SB 1HNZL 1XX8A 1MHXA 1L0YB 2GBKA 4RAUC 3A54A 3TSSA 1J7BA 2FCMA 3VA7A 4W9IA 1W2BA 2E2DC 3TDQA 4MIUA 3DHGC 4A3BH 3GTLB 4KGSA 4LWCA 5JAVA 3S1RB 2KFKB 1KQSA 3ER0A 3I91A 2L0CA 4Z9CB 2MP2A 3PSEB 3PGEA 2KEDA 5LL6S 2MGSA 4AH6A 2IY0B 4E71A 3A55A 3R2TA 2R92G 1K8MA 1DOYA 2E3TA 1VQCA 4GS3A 1SNOA 2I2YA 1B44D 1QNKA 2E75C 2C35B 1XMOQ 2IO2B 4UPAA 3W5OA 2ZW0A 1N63A 2KXJA 2SAKA 3H7PB 4P1CC 3TQYA 1F77A 3R66C 4ZKBB 4REZA 2JA5G 4KGTA 1B53A 2KCNA 3ZNZB 1X3GA 3HKZB 1TU2B 4MACA 1I94Q 1O7IA 1HR0L 2DZKA 4ICVA 2VQEL 5K36H 2Z4IA 1KL9A 4L6TB 1WR6E 4QAYA 5EE0A 2D0PA 2PZWA 1GB1A 3M4QA 3M95A 3ZUNA 5DPSA 3L13A 5C4XB 2KCTA 1GG3A 3A9JB 1E0ZA 4A8XC 1IYFA 2PMZE 1F2ZA 1WIAA 1TR5A 4E6IA 1B9NA 3F2CA 1GUGA 2RDGA 4DR5Q 1XYIA 4HWIB 3P4SB 5M3MB 2D5DA 4DV1Q 2N0SB 1SYEA 2JSOA 1QILA 2M8SA 2E2HH 2H89B 1CZPA 5G3LD 4R4QA 2Q2TA 1GD7A 1KOTA 2B3GA 3VFKA 2LUMA 4QJFA 1TIID 1F2RC 2FIFA 1UEAB 2Y3AA 3U7DA 4JOIA 5K5PA 2UUBQ 2JA7G 2KWCA 2IY1B 4HEDA 3DBHB 2MA9B 2HCIA 4ZYSA 4A3DG 5CV9A 1E1TA 3IL8A 4PS8A 4LW1A 1WXQA 1A2TA 2I1KA 1EOVA 1UE5A 2GN5A 1KAWA 3K8AA 3M4OB 1M8AA 2BA1A 1N34L 4W9FA 3EECA 1HJPA 1HZCA 1TWFH 2K25A 4D2KA 2EYLA 2RMMA 4F7XA 1SN8A 3W9CB 1IBMQ 4CYEA 3SE0A 4CKCA 4WQMA 2K03A 1N33L 3HEJA 2MJEA 3IBEA 4W9HA 3ZNID 3S1NH 3RD2A 4URKA 5IT9E 4MELA 5IA7A 1IBXB 1E24A 2WKCA 2F03A 3RR5A 3M7NA 2XSCA 3I90A 1C48A 5I6WA 4K1RB 2AWNA 1AE2A 1HNZQ 2LASA 2AEHA 3AU5A 4A90A 1PH8A 1ET9A 2R93H 3JSVB 3CF6E 3MXGA 2CS4A 3TBIB 3UE0A 1P7EA 4LFAL 1FCLA 3J81i 1EQQA 1KH0A 1V5TA 2LJ5A 2O2VA 5GQOA 3U9SA 2R2QA 4MNOA 1P1AA 3GTOH 4ZKCB 2I5MX 1G8ZD 3BY4B 3HOUG 2L5TA 2H88B 2LGXA 2SNMA 5CC4A 4BOSC 4GOPB 3WAOA 2DBYA 2F0JA 2UXCL 2C5CA 2B63B 1YNNC 3QWNA 1X1MA 4KGRA 1BCPB 4HSPA 2WXJA 3HHMA 2OF1A 3C1FA 4GB9A 2L9HA 4BY1G 3ULJA 1I5FA 3C8YA 1JJGA 4DNRB 4ANWA 4Q0FA 3E9HA 1UH6A 1BCPD 1S5BD 2BDNA 4HIKA 4GOCA 4N9F4 4QUCA 1HR0Q 1S3SG 2VQEQ 1GUWA 3KYDD 3ZJUA 1VQGA 2LXKA 2R92B 4RHSA 2LWPA 4C4VA 2OTLA 1F2RI 1ZXIA 2RDHA 3HKSA 4ZAIA 2M19A 2JK8A 4KLKA 3ECIA 1P9DU 4A3LH 2JA6H 1TY2A 1XLOA 2EKIA 1F0ZA 2JA5B 4O1NA 1NENB 2WGSA 3S17B 1B2TA 2BOSA 4IWPA 3MTSA 1H8CA 2W3RA 1JR0D 1RF2D 1CQVA 1GUSA 1P16A 4NB3A 4G7ZC 1AE3A 2D0OA 4RWSC 4G7OC 2DYOA 5CORA 2PQEA 4FXCA 3UGBB 1LT5D 3FPUB 3GV3A 2NVQH 1MI0A 1YQ3B 3RULA 2V4DA 2C9OA 3AEVA 4DDID 4GIVA 3I55A 3T4AC 2IPKD 3G6EA 1PZJD 3N6RA 3QCAA 2O2VB 2P5ZX 3TJPA 4GLVB 3QQ8B 4WFN3 4X6AH 1ESRA 2EJMA 3AE8B 1WX7A 4N58A 3P1HA 1L1OB 1L5PA 2QCZA 4FF1A 4N6EB 2DN8A 4JV5Q 4XDCA 2PQAA 3MXNA 3VTVA 1LM8B 2PNRC 1JRPA 3KUDB 3M3YB 3C19A 4ARIA 1U9RA 3DXJC 3MEHA 3NOBA 3OIQA 3C0RB 3VR8B 3KYHC 4A3JB 3LGJA 2KD0A 3S2HH 5FO8B 1VQFA 2HDMA 3KK7A 4WJWA 4JPBW 5LMUL 5LXHA 1FD7D 2QMTA 2GBMA 2Z59B 1T0SC 1OXXK 2A68D 3AB9A 3RN2A 1N8RC 1FXIA 3A4SC 2N9KA 3MJ5A 3APDA 4KV2A 2L3ZA 5FO7B 4LFAQ 2XNAC 1SXTA 4A3IH 2DNCA 3SDLC 1PFMA 2CR5A 1T5XD 2SOBA 4M0WB 1ENAA 2RHQB 1E22A 4ANVA 5D7GA 2HD5B 1X55A 3TUOA 3A0JA 5HY6A 1L0VB 1AFPA 1NMGA 3NRZA 5JH5C 1VJKA 2YTVA 5FLXE 3DWAA 1N36Q 1O80A 2WDRB 4H7BA 4HXDA 3I73A 3EGRA 3RT3B 1G6JA 4NPNA 2LSSA 3QOLA 2EYPA 1I4HA 1CKNB 1PRTC 2EYFA 3TN2A 4NXML 3CAMA 4K5XA 3IRBA 2B2WA 2F0HA 3S15B 2BW2A 1QZGA 4W9LA 4XXEA 4DPGA 4A6QA 1EY4A 1NBFC 2KJ6A 1F52A 4GKKL 2N9XA 3NWSA 2VS1A 4DAVA 1UWXA 1TWAH 3HOUB 3H6NA 4C00A 1D7QA 1A63A 3TEHB 1EEFD 4HJ5A 3M62B 2JPHA 3SHLA 2QC8A 4ZQ3A 2PQAB 5JJZA 2EYOA 1YNJC 4X3SA 3KF8A 1WYDA 4JI5L 2X6LA 4NJ6A 4W9CA 4G57A 3I56A 1FJGQ 2SEBD 1FFUA 4JI0L 4JWUC 2WDTB 2IWHA 3TP7A 1YBYA 4U68A 4BA2I 1WZ0A 1CI3M 2ID0A 2BPSA 3Q3OC 1QOHA 2LY7A 1C1YB 5AJ3L 4A93G 1E90A 3VTWA 2Z8LA 3RD4A 4C3IH 2UU7A 3ERQA 4KX6B 4KN7C 2HE7A 3FAHA 3I8ZA 5J39A 1EF1A 1E9MA 1JWSD 2ZTCA 3R7QA 3RMHA 2WAQE 1PGBA 2LKVA 1OXUA 3CW2C 1MKHA 4CGYB 4DFAA 1VQBA 4U673 1VQNA 1WJUA 4X57B 2WV6D 1LT3D 3GTGH 3VYRA 1PDQA 1SE8A 3KWLA 3CD6A 1A6XA 2RPQA 1Z6HA 4FXGC 2DY8A 3QX1A 4YSYB 3S1QH 2SNSA 3J7YW 2JA7H 4DHZE 3FMCA 1ZE3D 5M3FG 4A3DH 2K4KA 2EMTA 5J17A 1YHAA 2L32A 4PT5A 2KHSA 2DHZA 1VZ6A 1R4PB 2OQKA 2I38A 4B95A 3K7UC 3TEXA 1BOSA 4AP4C 5LMUQ 4DR3Q 2JT4B 3GP7A 1TT5B 5D94A 4KKUA 2Z9HA 4WJ4A 1JJ2A 2F0UA 2CHXA 1YMHE 2LGSA 4A3FB 2R6GA 3NZUA 4MGYE 1YN5A 1TWHH 2KECA 5FR6A 1Q90A 3JW0X 1JOQA 1BUVT 2M17A 1LTGD 2B2TA 3PO2G 4CO7A 3U4VA 1Z47A 5KYLA 1R9TB 3IFDA 2D11A 5EKIA 5DEHA 5GAEC 2CHBD 5C44G 1QLBB 1XJVA 1JMLA 2B8FA 3NENA 1HFGA 3GDEA 3NBIA 4B9XA 3BDLA 1XNRL 2KMCA 3EHVA 2CQOA 4KKIA 4FN2A 4RNAA 1HNWL 2WNMA 4ALPA 4XDDA 2RSUA 2RGFA 1QOAA 4GDLA 3NQTA 1YJWA 4JE3B 4HKQA 4RM8A 1G2SA 1HQRD 2GMIC 2XWJB 2MNAA 2HHHL 1SB3C 5I4DA 2KYWA 4XTCS 3DHIC 1PFBA 3VRAB 5CV4A 3LJ3A 2IZVB 4R4TA 3OJ4B 3HRZC 4UP7A 5LMNQ 4HCNB 3R3MA 2IHEA 4JI4L 1YQ4B 2TSSA 2K5QA 1HNXL 5HGTA 5IYDG 4CHTB 4BY1H 3W5UB 1NVID 5IAAC 4JI2Q 5I2YA 1WM2A 2BS2B 2MFIA
chains in the Genus database with same CATH topology
5EBCA 1MVKA 3KBXA 1JE4A 5A2QL 1EWCA 1RJTA 2RKSA 4QUFA 1BUIC 3AB5A 2JX5A 1MSHA 2RVLA 3RZOB 4CKBA 3NK9A 2SDFA 1STEA 1SBBB 1ZXHA 2WIIB 3I70A 2ENBA 3HGBA 5EE1A 4HJGE 1GAQB 1Y56A 2EXZA 1ZDVA 2G1EA 3NTIA 4B0EA 2FJ2A 1ZP0B 3HOYB 1CK1A 3K57A 3H91A 1K53A 2WXQA 1D5ZC 4KY5A 2OEDA 3WOFA 5KRUA 1BCPF 3J7AV 3OMGA 3MHBA 1Z7TA 2EELA 4HCEA 1P7FA 5IIFA 5HG2A 5C0XG 2MUYA 1CFMA 3ZQ4A 2A6HD 3HZXA 4NP5A 2B8GA 1SNCA 4JK1C 3A8JE 3AE3B 3ND9A 2FE8A 3Q8AA 2BCOA 3DHQA 1WTPA 1DOMA 3J80L 4K2KA 1WTXA 2L4NA 1V43A 1I4RA 1TY0A 1DOXA 4FXKC 3DWGC 2RSNA 1SMYC 1TKEA 4RCOA 1TWCB 3P4QB 3L9AX 1PFDA 1BMLC 1LTAD 5BN4A 4K5WA 4H0LC 2I46A 1V1PB 1W6JA 3NE5B 5IGCA 1IHZA 1Q10A 1U4RA 1C76A 3LWEA 5GXGB 2AQ1B 3V96A 3BG3A 1CZWA 2EE1A 4C2MB 5M5WB 3GD7A 2NB0A 2JSVX 1EM7A 2XIWA 3M4YA 4P16A 1EWYC 4XYQA 3MHZA 2K5PA 4TQ0A 2W55A 2NVXB 2IGDA 3TEZA 2EY6A 3T51B 3BVZA 1GB4A 5TSSA 3MWYW 2ICIA 1FCCC 2QJLA 3PMFA 5FO9B 2PCFB 1WTRA 1EY5A 1RTNA 3VR2A 2V4IB 2OT2A 2PKOA 1KTKA 4K8IA 4R8IA 2RSOA 4DU9A 3K58A 3CRKC 1XLQA 1QF6A 5C3JB 2VB2X 1PTOC 2B76B 2J42A 2FMCA 2YYZA 3T3OA 4ZK9B 4DGZA 4NJCA 3AE5B 1PRTB 3CIRB 1LO5D 2JWUA 4L1BA 2PYKA 3GQBA 1G91A 2WQYB 1PRTD 4KK7A 2W54A 2TMPA 1LTID 5G5GA 2PMZB 3J81E 3W1SA 3Q24A 3VRBB 3NP8A 1G6ZA 2N9LA 3P63A 2F0TA 1EWHA 1A3VA 3EROA 2LJIA 3WDNA 4TRDA 3DWMA 1LLRD 3C1EA 2NN6G 3OOCA 1Y8PB 1UNSA 3QG1A 1PLFA 1H9SA 1WTWA 1CTMA 4XQJA 2V3PA 1AZPA 2EY5A 1VDZA 4FXDA 2EVBA 3X3NA 3D6WA 3WCQA 1DOLA 5ELEA 3JAML 1I3QB 3OIPA 4IUQA 4M1UB 4B9WA 1YNTE 4XE0A 3UI3A 1HZ5A 3NXWA 4G7HC 1SE4A 2IW3A 4TMAB 3NQIA 4BBSB 4CJ2C 1ZYRC 2M00A 3T13A 3RFZB 1RM6C 2CU3A 3BVMA 2KJXA 2JYOA 3GTJB 3R8BA 3DWPA 1PMRA 4ME5A 3BYYB 1XEEA 4KN4C 1PDXA 3HRDD 1BR9A 4A3KB 3B2GA 3W3AA 5C4ZA 1PGAA 2DYMA 3P4RB 1SNQA 3PO3B 2O4XA 5T1IA 4LTUA 3D8GA 3DWQA 3V2TA 5EKLA 1IL8A 3G6JB 2WS3B 4L63B 1J7CA 2BYTA 2XRSD 1RHPA 2EYHA 1H9MA 4EE2A 4XDXA 3D4WA 4N9PA 4XIGS 1BO0A 3FPPA 2YEPF 4AS1A 1CZGA 3AE9B 1H9RA 1GUTA 1SEBD 5C0XH 3OSOA 3H6MA 5T1GA 1BF4A 4XT1B 2WACA 2E6XA 4KHVA 3LX0A 1O78A 1I4GA 3EA6A 1IYVA 1JCKB 2H1EA 2VUMB 4TQUS 2E2JB 1IBXA 1QNUA 1LTRD 5NUCA 2JEBI 1PXUA 4IQZA 4ZHPA 3PZ8A 4IURA 5DNFA 1WD1A 2B2VA 1QB5D 2XN9C 3AEBB 3ND8A 2QIEB 2DLBA 4J1MA 5J22A 3MP9A 1RYJA 5LL6X 3AE2B 3HG9A 4YSZB 2KQ3A 1ESFA 5EPJA 3KUPA 2A5HA 1GXDC 3T56B 3D3RA 2A6EC 3AU7A 1EY8A 4JBWA 2BT6A 3A8IE 5JVH3 1V1OA 2NZ1D 1PZKD 4R9WA 2J53A 1I6VC 4IZ8A 1HUNA 3HVZA 5J1ZA 1K83B 1NAPA 1ZPSA 4C56C 4RGOS 3RLFA 1DONA 2PW5A 2B2YA 1CA5A 4YTNB 1KRHA 1BDOA 3H3VC 3K59A 4QF4A 1NI3A 4OO1H 2L52A 2B2UA 1WWTA 4BWGB 4F87A 2JE6I 4US8A 4NMZA 4OGQC 4ZOHC 1JQ4A 5H8YE 3IT4B 4KJNA 2DY7A 4IFDH 2NTSA 4CKEA 1IKMA 3KWVA 3A7AB 2F0FA 5IODA 1RD9D 2CJOA 1NR4A 1FRRA 3PZ7A 1MHHE 1O7YA 3F2UA 5CYUA 5ISRA 2JA8B 3CU7A 5E6JA 4K2LA 4HAEA 1C4AA 4ULLA 2PMVA 5IGBA 4X3KA 4RGNA 3NS1A 3B9JA 3GTQB 2IGHA 3A7LA 1UWMA 2QEJC 1SMYD 3PIO3 2MP1A 2ZXRA 1HZ6A 4HROA 3IAS1 1N60A 3SFEB 4HEA1 1IYUA 3TP6A 4M0WA 2NN6H 1ENCA 1MSGA 1NUCA 2J4XA 4X3TA 4PV1C 4XQQA 3K5LA 1DYQA 1JWUD 3KBGA 1D1KA 5HFYA 1JOOA 1GUOA 3E0JA 5IGEA 2QKIC 4BY7B 2EJFC 4A3MB 2XWBB 2G9HD 3EUB2 1NEKB 5HHDG 2PZUA 2KVMA 5BMGA 1PRTF 5D3IB 3Q8CA 3M85A 1N61A 1K8OA 5C4JB 4PMBA 2KA7A 3V05A 3TEWA 1PTOB 1SE2A 2MHVA 4UDUC 5LHY1 1DZ1A 3SK6A 2AQ2B 1PUTA 2BE5C 4YIJA 1MBYA 2YU9B 1QOBA 2ZT9C 4XQNA 1T6BX 1AEXA 3I4NB 3MFGA 1JORA 2K05A 2WLBA 4H13C 4ODGA 4N9TA 4YTMB 1L4DB 2AUKA 1N5WA 4LLGM 2PIAA 3ETRA 2EJGC 1I6HB 2FBWB 4LK0M 1FO4A 3SDZA 3NVVA 2GRIA 1U4MA 2HCCA 2WINB 2A74C 2F0SA 3NHHA 3VYUA 4P6VF 5EPLA 3MZ5A 1JC7A 1OQRA 1WD0A 2O5IC 4KD3A 1KNAA 1CHQD 1C77A 4HN7A 4C7YA 4YT0B 1YN3A 3PUZA 3URYA 5JEAG 1D1IA 4FF4A 5DM73 3OWEB 4K14A 1JW9D 3N52A 3U52E 1V8CA 4NAWB 1AWDA 5C5MA 2DWQA 3J9CA 1D4BA 3IAYA 1SYFA 1RDPD 1KFYB 1VDVA 5T8IA 1EYAA 1JWBD 4Y7NB 1C78A 3GTKB 2JQRB 1ICWA 3QJYA 4KMUC 2W3SA 2Z1CA 5C6AA 1TS3A 3RZDB 3K6OA 1HEZE 5BMHA 5KNBA 2IT1A 1EOTA 3NVYA 1K50A 4K6LA 1HXYD 1T5EA 1OXTA 1FEHA 2JXMB 4JPSA 3W5VB 4PMCA 2L83A 2QCPX 4A3GB 2WU2B 5ELDA 1LACA 1WYGA 3Q69A 1HTLD 2Q8IB 3FILA 4V190 4OZCA 3H09A 5KYIA 1SNDA 1KDBA 5BYQA 1ZEQX 3S1MB 4RH6A 1RWSA 2LMCB 4BBRB 4KKTA 4C1NI 5E4WC 4XWTA 5CV5A 1FRDA 2EOTA 2A73B 3VR9B 3OMCA 1OXSC 5JPMC 4N59A 4NAMA 1JB3A 1F2MA 5C0XI 3MFYA 4H2AA 2K5WA 3Q23A 3RPFC 5EBDA 4KKSA 2YEPB 1EY7A 5ELBA 2PPBC 2A6ED 2QILA 2BA0A 2R7ZB 1IW7C 3IT6B 2MJDA 4R3DA 1NR2A 4L23A 2VB3X 2WDQB 3S16B 1X32A 4AQ7A 2WKDA 2D5GA 2RDFA 1LTTD 3AV8A 1LV9A 3K0YA 1WRIA 2JP1A 1GHJA 3GTPB 3FILB 3LWUA 4DAPA 4ZRPA 4QB4A 3IAM1 1FNVA 2IGGA 2Y5PA 2IX1A 1V1PA 5AUKA 2Q8RE 1FM0D 4Q5VA 1WTOA 2O5JC 1EIGA 1R7SA 1TKGA 1QG7A 5E1FA 1MD2D 1Q1EA 3AEDB 3H8HA 5BYSA 5EGTA 2KDMA 5KNDA 2PW9A 4IALA 1EY6A 4WH4A 5EQ0A 3AEEB 2F0NA 1NCVA 3VR6A 1PFNA 1ACCA 3GO5A 1B3AA 3Q8EA 4HMJA 1VLBA 3AMZA 4OO1I 1I50B 4ZLTF 5FK9C 3SK4A 1IGCA 4A3EB 1CJEA 2JXTA 1YNND 3PO0A 2K5DA 1CHPD 1LTBD 2OEOA 2ACZB 2F0DA 1J9OA 2MPMA 4LK1C 3HOZB 2BB5A 4IFDI 2X69A 3GTMB 2R3ZA 2IJ0A 2M2LA 1WTQA 4WURA 4B08A 3VR4A 2IDYA 2F0WA 2RA4A 3TP5A 1E10A 4IUUA 1PTOF 4BA1I 2PVOD 3R2IA 5K36G 5BN5A 4I65A 2V0GA 5JEAH 3R3OA 1I4PA 2WP9B 2J0TD 1I4XA 3QOJA 4RCNA 5COYA 4C80A 3BVGA 1GUNA 3UI2A 1FFVA 1NYQA 1EYDA 3FDTA 3EVQA 3Q8BA 1VRAB 5KIXA 4XT3B 1RTOA 5BMIA 1CQFA 1QCBD 3NVZA 3IXSA 2RQXA 4EQPA 4J6HA 2K22A 2L55A 1FMAD 1XCQL 1U4PA 2BE5D 2K3UA 4HR7B 1Q3LA 4IOIE 4JWSC 1AW7A 1DGJA 2M0AA 2RPVA 4MM3B 2RBMA 4QCLA 4HCSA 4ID6A 2ZXPA 1VCIA 3SVMA 1CA6A 3IKJA 4OL7A 5IT9L 2F0GA 3Q0AA 1HA5A 4OZBA 2J7ZA 4FF2A 3I72A 1V97A 4A55A 3P4PB 1DJRD 3HS0C 2BS3B 1OQQA 5I9PA 2E74C 4WIPA 2WXFA 3P1MA 4EVOA 2LFNA 4KI0A 3Q8FA 1YNJD 2QDBA 1D5XC 2JYTA 1TQOA 3OWFA 4K6DA 4A3BB 3P42A 3ABVB 2Z4HA 1FNUA 3KQ4A 3LXFA 5CV8A 2CQAA 2JYEA 2KAJA 2WXGA 4RKBA 3MXPA 4BS9A 1VZ8A 1HHVA 4CQNA 1FIQA 2WXRA 3S9WA 3U4EG 5MPOA 1IUEA 3PUXA 2ZXOA 3A56A 3NPPA 4IUVA 4IN3A 4MT5A 3NUHB 2D9UA 2LHDA 1SDFA 5D3DA 5A2QE 1WVLA 1HRJA 2F0VA 1QE6A 1GHKA 3FEWX 4V0BA 3EJIA 2AQ3B 1QJOA 2INPE 4ZUJA 1JWAD 1MGSA 1F2LA 1LT6D 2EY2A 1TJEA 1XCTL 1SSOA 5I2XA 3CHBD 4HMIA 5LNK1 3MXUA 2JU6X 1EFID 2F0PA 3QIAA 4X3UA 2AX5A 2JZPA 3AE6B 1TKYA 4RHRA 4HTHA 2E2HB 4P2CB 2OHFA 3VYTA 1RFKA 1HA6A 1C4PA 2WXMA 1QOFA 1A15A 2F3WA 3BDOA 5C5LA 1JALA 2EPBA 2LGIA 1XWEA 3MVVA 1A3UA 3C3LA 3P7JA 1C8CA 2N7JA 1TWFB 2PO4A 2WXIA 4C7ZA 4TQ1A 3W2DA 3OPOA 1EZ6A 4ZRZA 2F3VA 1FD6A 4EQOA 3E5SA 1H9JA 3S1NB 3EQLC 3DEOA 1HUMA 5FLXL 1RODA 2B2WC 3HUIA 1JROA 1PGXA 4WORA 5CBEE 2F0MA 2IX3A 1F9RA 4M8AA 2R93B 3VYSA 3D6CA 1YN4A 1C4QA 3E9SA 1QT9A 3ZGZA 3MA2B 3J80E 3DMUA 1AYFA 1IW7D 3GTOB 2PVGC 1LT4D 4FO2A 5CMDA 2F0QA 2O2LD 2PTLA 3FRPB 2Y0SB 1EY9A 2EDGA 1TVXA 5C0XJ 4DF7A 1N5XA 1STBA 1XLPA 1BQQT 1C4CA 1IGDA 1TS5A 1LABA 5CGKA 2L12A 2NBFA 4OHJA 4RFBA 1VMCA 3GB1A 1STNA 3PIP3 3E56A 2XVSA 4EGVA 1QWYA 1L0XB 3AH7A 2CW0C 4OZAA 5DM63 4C3IG 3FVQA 1EYCA 4DK1A 1E2WA 2JA6B 2HDLA 2F1MA 3BK2A 3BZDB 3U7ZA 1DXMA 1S5CD 1STAA 2IL8A 2M56B 1CM9A 2F0KA 3BK1A 4TKOB 2Q5WD 2PW7A 3I3CA 2WXPA 1SJHD 3RUZA 1OFFA 2NVQB 4IUTA 1LTSD 3ITPA 1EL0A 2EYMA 5FKAC 1S5FD 4HRSA 1WSPA 5AFWA 2F0OA 1E0BA 4KY6A 4IDIA 3QB3A 2B2TC 1L6UA 3NVWA 1JWMD 2FMMA 1C9FA 1Q8IA 4KTAA 3B2FA 3T16A 1KLUD 2KN4A 2OXPA 2BB6A 1S5DD 2KCCA 3S2HB 4ARCA 2EZVA 4G4KA 3A8KE 1KABA 3NSWA 3ZYYX 1F9SA 3ONAB 3IFTA 2H4OA 1SYDA 2A6HC 4DAYA 4YWGG 5JXVA 1ILQA 4A3IB 1H9KA 3AEFB 3KLSX 1J7AA 4IKGA 5JOBA 3SFDB 1KDAA 5E4XA 2WAQB 4RF0A 2JEAI 4IFDJ 2LFIA 5C3XA 3ZJTA 1ENFA 4J3OD 4C1NK 3U9OA 4B0MA 1PYWD 4HSVA 1ZDXA 5CBAE 1A3TA 1F2YA 3FKIB 3HVDA 1ZXTA 4OIJA 1KNEA 4UAIA 1QKZA 4IUNA 1DOIA 5M9OA 1XLNA 4OW0A 1SJED 2WB1B 3JAME 1AP0A 2K0PA 2KQ4X 1STYA 1TWAB 3VR3A 2FINB 4KKJA 4DQOC 2VXWA 2K9XA 3L7ZC 4CBVA 1FYCA 1JOKA 2VZKB 2X6GA 4PQXA 2KEEA 5EPKA 3SEBA 1WTVA 3V3XA 1D2BA 2NYZD 2VZKD 1N62A 1PTOD 1C79A 2FFKB 3VA5A 1HFNA 1DOKA 1MPEA 2K04A 4C3IB 4FP5D 3P75A 4FNFA 2NMQA 1ML0D 4WRDA 1SNPA 4C3HG 2J52A 3MC0B 4MH8A 3GTGB 1XF5L 3KLSA 3VQIA 3S1QB 2JA7B 3PV0A 1EIHA 4A3DB 2X38A 3TEYA 5KGUA 2BTEA 3QO2A 3SR6A 2HQEA 4PMWA 4MHEA 5EE9A 3AMUA 3AE4B 2K6AA 1K52A 1UUPA 3D4DA 3PUWA 2LEKA 1SNMA 1II3A 2CJNA 1TWHB 2K28A 1SYBA 1AZQA 2NWGA 5CR3A 1SE3A 5C3WA 1YJIA 2WXHA 1IKLA 2F0EA 2F4IA 1F9PA 3AM9A 5IOCA 4YSXB 5I6YA 1OXVA 4KD4A 1ZYRD 3AE1B 2ON8A 3T53B 1JQYD 1EZ8A 2LMCA 1AN8A 1KDCA 2AWOA 1EQTA 4OIKA 2F0IA 1SF0A 4BY1B 1D6EC 4CJ0B 1PTOH 1STHA 1FNWA 3I4LA 3LYYA 3TP8A 5I9OA 5D65A 2A69C 2R61A 3G7LA 2MJ8A 1TKWB 3SK8A 4QIWB 1S5ED 3PUVA 2LHEA 3T3NA 3BDCA 2NUCA 2CVRA 1R4QB 3I4MB 2NVTB 2V3NA 4ILWA 5F2DA 3S14B 3NZ3A 1Y1WB 4DA2A 4H44C 1TZOA 4JX1C 2WU5B 1XTCD 3AEAB 1I7HA 3AECB 4L2YA 1WCMB 1A70A 3Q6SA 4C3HB 1VF7A 2E2IB 4NW2A 1TS2A 4L8JA 2K32A 4DNTB 4S3SA 3J81L 4WWMA 1KLGD 5JPNC 2B39A 1WGKA 4LJZC 3D31A 1OO9B 5G3LF 4HKZE 4LMQD 5IGFA 5EJWA 1BXTA 2EYJA 4RGTA 2G9DA 4C3JG 4AYBB 4KV6A 1O7LA 1KF6B 3LB8C 2BS4B 2E76C 1VMPA 2D2CC 3X3MA 5DAUA 5FOBB 4TSSA 3GV6A 1HCZA 3I57A 4RKLA 2IX0A 2NVYB 3NWTA 3OHXC 3CRLC 3NTKA 1ET6A 1RKNA 1VR9A 3GS2A 2CW0D 1X3PA 1TT2A 4I7ZC 5KNCA 4YTPB 4F88A 4DXGA 3K5OA 1BBXC 3I9V1 1ZOYB 4RF1A 5H92C 1Y8OB 5JVG3 1L4ZB 1Y1VB 3DM1A 4DN4M 4XYOA 1Q12A 3H94A 1B4OA 2M9VA 1B1ZA 3S2DB 4DXFA 2L1BA 5AUIA 4A9AA 1RCVD 5A35A 5CV7A 3N9YC 3DUZA 1DM0B 4A93B 2INNE 4CJ1B 1ZKOA 1U4LA 3WOEA 1K51A 2GI9A 2ONQA 4GDLB 2ZW1A 1SSNA 3PUYA 1XO3A 2F0LA 1ONLA 5ELCA 1E6EB 1S4ZA 2Q8TA 1HTPA 2K7VA 1XXGA 2I07B 2ICEC 3P20A 2BDOA 5M3FB 1MI2A 1FXAA 4K5VA 3NUCA 4XWWA 2QSDA 3SK5A 2K1BA 4MN3A 2GB1A 1F9QA 1GPXA 1SYCA 1SFOB 2B2VC 1UGJA 3M7GA 2KMMA 2KUMA 1A2UA 3L4PA 1GJXA 3FC4A 2FUG1 1W6KA 1O7ZA 1HPCA 1SIJA 2L11A 2QF7A 5M5XB 1NSNS 3PO2B 2GA4B 1FGBD 5IGGA 5C44B 2WXNA 3C2PA 2XRQD 3TZUA 1DCZA 4LAAA 3EFXD 1ROEA 4OVZA 1EEID 4WAFA 4C3JB 1BCPC 1VZ7A 3Q22A 1TYGB 1EU3A 4R8NA 5BN3A 3H0GB 4ZHOA 5EE3A 4FYDA 2NN6I 1UAPA 3DEPA 3AN1A 2B2YC 4DK0A 5C3EB 1J8IA 4PNYA 3CQZB 1EU4A 3TZDA 3KLRA 2D62A 4Q2JA 3U2SC 2WXOA 3OW7A 2BBCA 1GOZA 3L3OC 2KWDA 2K01A 2B2UC 3TMEA 1I4QA 1ZUD2 3BWUD 1G291 1B50A 1HQMC 3BYTB 4ABNA 4O42A 3HOXB 5JEAJ 3CWIA 4OO1G 3K5NA 1SYGA 2KACA 2HUGA 3BIID 1QOGA 4FVMA 2N55A 1KAAA 1X3QA 3HOVB 2DNEA 4EQNA 1TWGB 2WDVB 2PZTA 1BNZA 5D14A 1YJJA 1NYRA 1PZID 4IFDG 4K8JA 1E7PB 1FR3A 3C46A 4NKLA 1Y8NB 2VNUD 4KJOA 2Y5CA 1JICA 5G5HA 3HP3A 2A68C 3MAQA 3SR1A 2HTME 5E3FA 2WXKA 3O13A 1E2ZA 4IUPA 4RA8A 1G2TA 1B9RA 4J8QA 5HI1A 2N88A 2WXLA 2LS01 2KOLA 2EY1A 4QMGA 1TS4A 4NZLB 4FF3A 3NBHA 3E6ZX 4F8MA 1QQRA 1B9MA 3J7AF 3NTHA 1Q1BA 2FHTA 4YXDB 2HDEA 1M4VA 1DD2A 3BS1A 2PLPA 3VR5A 4KY7A 5C2TB 5EKKA 1Y69U 4GZYC 3D4RA 2A69D 2MJ3A 5CV6A 5ELFA 3K7AB 2MH7A 3K5MA 5C4HA 5M5YB 2W82A 4RGMA 3SXHA 4GDKB 3AEGB 3R93A 1E2VA 4USAA 3LNNA 1EY0A 1EQVA 4NDXA 3CKIB 1VF5C 4ZRQA 3HOWB 4GLSC 2K33A 5IGDA 1L6VA 1SAPA 1STGA 2AUJD 1T3QA 4ITKA 5KEEA 1V8QA 2WP8J 4KHZA 5FR3A 2L1AA 1ILPA 5BYRA 5HURA 2MEKA 2NTTA 4ZUIA 1CT1D 1H9SB 1XX8A 1MHXA 1L0YB 4RAUC 3A54A 3TSSA 1J7BA 3VA7A 2E2DC 3TDQA 4MIUA 4KGSA 3GTLB 5JAVA 3S1RB 3I91A 2L0CA 4Z9CB 2KEDA 5LL6S 2MGSA 3A55A 3R2TA 1K8MA 1DOYA 2E3TA 1SNOA 2I2YA 1B44D 1QNKA 2E75C 2ZW0A 1N63A 2SAKA 1F77A 4ZKBB 4KGTA 1B53A 2KCNA 3HKZB 1TU2B 4MACA 5K36H 2Z4IA 4L6TB 5EE0A 2PZWA 1GB1A 5C4XB 1E0ZA 4A8XC 1F2ZA 1TR5A 4E6IA 1B9NA 1GUGA 2RDGA 1XYIA 3P4SB 5M3MB 2D5DA 2N0SB 1SYEA 2JSOA 1QILA 2H89B 1CZPA 5G3LD 2LUMA 1TIID 1F2RC 1UEAB 2Y3AA 5K5PA 4HEDA 2HCIA 4ZYSA 5CV9A 3IL8A 1WXQA 1A2TA 3M4OB 1M8AA 2BA1A 4D2KA 2EYLA 2RMMA 4F7XA 3W9CB 3SE0A 4CKCA 4WQMA 2K03A 3HEJA 2MJEA 5IT9E 1IBXB 2F03A 2WKCA 3M7NA 2XSCA 3I90A 1C48A 5I6WA 2AWNA 4A90A 1ET9A 3MXGA 3TBIB 1P7EA 1FCLA 1KH0A 3U9SA 4ZKCB 1G8ZD 2L5TA 2H88B 2SNMA 5CC4A 2DBYA 2F0JA 2C5CA 2B63B 1YNNC 3QWNA 4KGRA 4REZA 1BCPB 4HSPA 2WXJA 3ZJVA 2OF1A 3C1FA 2L9HA 3C8YA 4DNRB 4Q0FA 1BCPD 1S5BD 2BDNA 4QUCA 1GUWA 3ZJUA 2R92B 4RHSA 1F2RI 1ZXIA 2RDHA 4ZAIA 2M19A 1TY2A 1XLOA 2EKIA 1F0ZA 2JA5B 4O1NA 1NENB 3S17B 1B2TA 2BOSA 3MTSA 2W3RA 1JR0D 1RF2D 1CQVA 1GUSA 4G7ZC 2DYOA 4RWSC 4G7OC 5CORA 2PQEA 4FXCA 1LT5D 3FPUB 3GV3A 1YQ3B 1MI0A 2V4DA 2C9OA 3T4AC 2IPKD 1PZJD 3N6RA 4WFN3 1ESRA 2EJMA 3AE8B 4N58A 3P1HA 1L5PA 4FF1A 4N6EB 2DN8A 4XDCA 3MXNA 2PNRC 1JRPA 3M3YB 4ARIA 1U9RA 3DXJC 3MEHA 3OIQA 3VR8B 4A3JB 5FO8B 2HDMA 3KK7A 4WJWA 1FD7D 2QMTA 1OXXK 2A68D 3AB9A 1FXIA 2N9KA 3MJ5A 5FO7B 2XNAC 1SXTA 2DNCA 1PFMA 1T5XD 2SOBA 1ENAA 5D7GA 3TUOA 1L0VB 1AFPA 3NRZA 1VJKA 5FLXE 2WDRB 3DWAA 1O80A 4H7BA 3I73A 3EGRA 3QOLA 3TN2A 2EYPA 1I4HA 3AE7B 1PRTC 2EYFA 3S15B 2BW2A 4US9A 4K5XA 2B2WA 2F0HA 4XXEA 4A6QA 1EY4A 3NWSA 4DAVA 1UWXA 3HOUB 1EEFD 3SHLA 4ZQ3A 5JJZA 2EYOA 1YNJC 4X3SA 3KF8A 2X6LA 4G57A 2SEBD 1FFUA 4JWUC 2IWHA 3TP7A 4U68A 4BA2I 1CI3M 2ID0A 1QOHA 2LY7A 2Z8LA 3RD4A 3ERQA 4KX6B 4KN7C 3FAHA 3I8ZA 5J39A 1E9MA 1JWSD 3RMHA 1PGBA 2LKVA 1OXUA 4CGYB 4DFAA 4U673 2WV6D 1LT3D 3VYRA 1PDQA 3KWLA 1A6XA