1VD2A

Solution structure of the pb1 domain of pkciota
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
89
structure length
89
Chain Sequence
GPLGSQVRVKAYYRGDIMITHFEPSISFEGLCNEVRDMCSFDNEQLFTMKWIDEEGDPCTVSSQLELEEAFRLYELNKDSELLIHVFPC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Protein kinase C, iota type
publication title Solution structure of atypical protein kinase C PB1 domain and its mode of interaction with ZIP/p62 and MEK5
pubmed doi rcsb
source organism Homo sapiens
total genus 12
structure length 89
sequence length 89
ec nomenclature ec 2.7.11.13: Protein kinase C.
pdb deposition date 2004-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00564 PB1 PB1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1vd2A00
1C3TA 2KFJA 2GBKA 4MM3A 2FCQA 3B0AA 1V2YA 3QQ8B 4KDIC 1WR1A 2MLBA 3V6CB 2IBIB 2K8CA 2K25A 4MH0E 3R7QA 4M8NA 3RUIB 3VAWA 3APDA 4W9KA 2M17A 3A9KB 2LI5A 2BPSA 2LRUA 2I1JA 1UELA 1CMXB 3MHSD 2AL6A 3A4RA 3MJWA 4BKGA 2DX5B 3ML8A 5AEKB 2R2QA 2C7NB 3JW0X 1X1MA 4NPNA 3ZIMA 4MGIE 3CSTA 4NY0A 3RYTA 4OVUA 2M4NA 4CHKA 2FCSA 4CYEA 2L05A 2V3SA 2JRHA 4IM2A 3W1SA 1V9JA 2LGDA 3ZTDA 1WMHA 4BKTA 3T8MA 1P1AA 2NR2A 1R4MI 2YVCA 3M63B 4W9CA 5DPTA 3WAPA 2UWQA 3M62B 4N9F4 3AXCA 2MSED 2B3AA 2ZEQA 2OOBB 4ICVA 1EF5A 4E71A 4GMVA 1KOTA 1E7UA 3NHEB 3ZNZB 2MRPA 4PS3A 3ONSA 1WRDB 3V61A 3VXWA 1V80A 4GN1A 1WM3A 2LXCA 3TCAA 1WX8A 1SGHA 5D94A 2N9PC 3NY5A 3ECIA 4K81A 2AYOB 1WE7A 2FAZA 4RM9A 1G6JA 2DAFA 4MELA 2V4LA 2M0XA 1P9DU 3ZNID 1AARA 3O65B 5C1ZA 2ZNVB 2NS5A 2LD9A 4WJPA 3CMMB 1WY8A 3PHWB 5J2RA 1VCBA 1WX7A 2KX0A 5LXIB 1LFDA 2KFKB 2O6VA 3RT3B 1SE9A 2MBEA 2ZPYA 3Q3JA 2L0FA 3EHVA 2KNBA 3A1QA 3RZFA 2KHWB 2LGYA 5LXHA 1D3ZA 2AEHA 3ZVVA 2EMTA 4TQ0A 1E8WA 2HJ8A 5HKHA 2D07B 2N7DA 3PREA 1Z5SB 1R4NI 1WXSA 2D3GA 3QIJA 3WA0A 4W9LA 1ZW7A 2IO1B 3H9DA 2KQSA 2ZVOA 2ZNVC 4HWIB 4F1SA 2ZVNA 3UIPB 1Q1OA 2LXAA 3V60A 1V6EA 2NCNA 5DPSA 1YJ1A 2CHWA 3H6NA 3KUDB 1UZXB 2KQ7A 2PEAA 3QJZA 3SDLC 4ANVA 4ANXA 3UQAA 5DCNA 3T9LA 1Q0WB 2PE6B 2N7EA 4MJSA 5CHVC 4II2B 2C7MB 2N9XA 4ANUA 5L95C 3QHTA 1UD7A 3AI5A 1J19A 2DZKA 1UH6A 2RPQA 4E74A 5AZHA 3VDZA 3VUXA 4JL9A 1RAXA 1K8RB 4II3B 2V1YA 1F9JA 3QK0A 2R2OA 1FXTB 1RLFA 2J0MA 3IFWB 4GGQA 2ASQA 4A3PA 1EO6A 4B6WA 4HVBA 2O2VA 2KMCA 3L54A 3R3MA 5D2MB 4LJOB 2BYFA 3JSVA 2J7QB 4K7UA 2BWFA 4EZKA 4WQOB 2MQJA 2CHZA 4AJYB 3DOWA 2XK5B 5E6PA 3ENEA 4FA6A 2FNJB 4MEMA 2NVUI 2NBUA 3TBLD 2KKCA 2MCNB 5CHWA 4AOFA 1XD3B 2OJRA 3UF8A 4W9IA 3LDZE 1V5OA 4IUMB 4OVVA 1WXVA 1WJUA 2JWZA 1L2NA 2HTHA 2IY1B 2NBWB 2C9WB 4HJKA 4KVGB 3H7PB 5GMVA 2MP2B 3SHQA 5G55A 2KTFA 2FCNA 1P3QU 2HD5B 2KDFB 1YIWA 2KZRA 2MX2A 3IG3A 5KHOA 4MGKE 4EZJA 2KK8A 5L83A 4RM8A 1GUAB 4AUQC 2KDIA 2L8JA 4IC7B 4IW0A 3RCZA 2NPTB 3WIMA 4LCDE 2WX0A 4DK5A 3KUZA 5EDSA 2N1VA 2KWVB 4WJOA 2IYDB 4DBGA 4GB9A 4WWNA 2JXXA 3PLVA 2DHZA 4XX5A 3U30A 2G4DB 1UBQA 5DPRA 1E8XA 3JYUA 3Q3FA 3UIOB 3PS6A 3RULA 2DYMA 3EECA 3A9KA 2MW5A 3N32A 3PRZA 4FHJA 3AULA 3QWZB 4NNJB 5FR6A 3DBLI 5CX3A 1J0GA 5JHAA 1V5TA 3PVLA 2GOWA 4I6PA 4TUUA 4WJNA 3H1UA 2Z59B 1EUVB 1WR6E 4NJ7A 3B08A 2LVQA 3UINB 3N3KB 3DVNU 2PJHA 1M94A 3A4SC 4DDGD 3VHTC 2IY0B 2LVPA 5CHFA 4IM0A 4A20A 1WX9A 1KJTA 4W9DA 2JPHA 2MWSB 3AU4A 2KANA 2UYZB 4X57B 1WGRA 4GDKB 2M1MA 5BO4B 4J6IA 3I3TB 1GG3A 3EC8A 4CO7A 3D32A 5E6NA 2KLCA 2D2QA 4B9KA 2KO3A 4GDLB 4HPLB 3DVGY 4XC2A 2LVOA 4IWOA 2DYOA 3W1YA 3V6EB 1IP9A 3DPDA 1BT0A 1WGDA 4HCNB 4LJPB 3EFUA 4AWJA 3ZNHB 2AWTA 2HE7A 2L0TA 4TV3A 5J18A 3WANA 1WM2A 1H4RA 3PRMB 3VQIA 1GC7A 1V49A 2RGFA 2L3ZA 5D6JB 4I6NB 3DCGA 1TTNA 3LJ3A 2KWUB 2FIDA 5JHBA 3QAQA 2IO2B 2BYVE 1L7YA 1OQYA 2ZCBA 3K9OB 3PV1A 1JRUA 1ZKHA 1J8CA 2KTRA 2CU1A 2LASA 3A33B 4MGYE 3L16A 3VH3B 5CTRC 3QA8A 1GC6A 2Z0DB 2REXA 5LLIA 3APFA 4EKUA 3DQVA 4TKNA 2ZPNA 2D10A 1A5RA 2LGXA 3ZLZA 3VTUA 2GMIC 2KN5A 4PYUA 2EKEC 4KIKB 4NAWB 4GXBA 4RMAA 2G45B 3L17A 4K1RB 1SIFA 2K6DB 3ML9A 5TR5A 4EFOA 1E7VA 2IZVB 3BY4B 4KZCA 3ZDTA 4M8MA 3HM6X 4HPMB 1VD2A 2KJ6A 1YQBA 1E5WA 2AL3A 3NOBA 4BKSD 1YX5B 3OLMD 3PTFC 5D7GA 4EOYA 3QCAA 2MBBB 2ZZPB 2MBHA 3A9JB 4EZLA 2NBVB 2DZJA 2RSUA 4HDQA 4JLCA 1GJZA 3PT2B 2MBQA 3L08A 3VUYA 4F7ZA 4BBNC 2RD0A 2M8SA 2LRWA 2Z0EB 3SU8X 1YX6B 1RRBA 2WX1A 1UBIA 1XT9B 2PE9A 1TBEA 3M3JA 4BOSC 3QC8B 4B95A 2K8HA 4LDTD 4W9FA 2O2VB 1KM7A 1E90A 3MTNB 3BINA 3IHPC 4K7SA 1NI2A 4P7IA 4WJQA 2DENB 4KSKC 4ZRJA 3U7DA 3DDCB 2GBRA 4IWQA 1EF1A 3ZTCA 3CF6E 4JQWC 2XK5A 4WAAA 3ZRFA 4YL8A 2G4SA 4E3CA 4ZRKA 2BYEA 3PHXB 4FN2A 2XEWA 2PPHA 2Y5BB 4FJVB 4MDKE 3X23A 4DHZE 1OGWA 4FBJB 3ZUNA 4EUTA 1TGZB 2ZCCA 2L00B 3HIZA 4G50A 3M95A 2K6QA 3ALBA 4GIVA 2C5LC 3VVWB 3ZNGC 3KVFB 4HK2A 2WDTB 3ZDMC 3DVNV 1IPGA 1KLVA 1WF9A 3H7PA 2FCMA 2KC1A 2MP2A 4PS7A 4W9JA 1WE6A 1Z2MA 2WWZA 1WGGA 2KDEB 4IG7B 4ZDVA 2JT4B 2K1FA 4ASWC 1I42A 3R7RA 1LXDA 5JH5C 3L13A 2NPTA 4FLHA 4MSQB 1GNUA 1WYWB 2BKFA 2JY6A 2L76A 1OEYJ 3TMPB 5G2NA 1WZ3A 1S1QB 3PSEB 4PS8A 3PZDA 4W9EA 1IYFA 2KJRA 2LJ5A 3DBRI 3IVFA 3PRPB 4K7WA 4HDOA 1WIAA 4G11A 4TQ1A 1WMHB 3IBEA 3TJPA 2VRRB 3PPAA 4FULA 5KHQA 2K8BA 3S2AA 2KLGA 3AU5A 3WAMA 4AP4C 5IA7A 2QHOA 1P98A 4JIOU 3ZO5B 2JRIB 5AZFA 2MA9B 3UQBA 3VFKA 2LUEA 4HCPB 2KXJA 1PQSA 1I35A 1MG8A 3SD5A 3B1LX 3OJ4B 2IO3B 2KJHB 4M0WB 2KWCA 4IWPA 4DDID 4G0NB 3JVZX 1WFYA 3OAWA 3TL5A 4DHJB 4GSWA 5E6OA 1WGYA 1P0RA 4KSLC 1T0YA 3W1SC 5JZEB 1TZ1A 4ZYNA 3KYDD 2I1KA 2N1WA 4GDKA 2GBMA 2XBBC 2W9NA 1E8YA 4GU2A 3X0WA 3NZSA 4KDLB 5IAAC 1V86A 1WI0A 3DBHI 4I6LB 2N4FA 1E8ZA 3OJ3A 4GDLA 4BKSA 2KMAA 4LDTB 5J17A 3C0RB 2DZMA 1WGHA 2IO0B 1WXMA 2N9EB 1Y8RC 3ZW3A 3VTVA 1LM8B 1WXAA 2BF8B 2KDBA 4WWPA 2K39A 3H7SA 1WJNA 1NDDA 2O6VB 1QZEA 4G3XB 4FJYA 3A1QB 2DZIA 3R66C 2KFKA 3WALA 3PGEA 2C7HA 2J0KA 3VTWA 2D11A 2KTRB 4W9HA 1WZ0A 4FJZA 2KVRA 4IM3A 3TIXA 2JVCA 5DPWA 4PYZA 2CR5A 1C1YB 2WYQA 4DXAB 3L10B 3L0WB 2CS4A 4ANWA 3GOEA 3QARA 1Q5WB 3ZRCA 2J0JA 3HHMA 3WAOA 1ZGUB 3ZKJC 4AJWA 3DVGX 2ZJDA 3GZNI 2KOXA 3KH0A 2DYBA 3QX1A 1H8CA 3HK0A 3KYCD 3NS8A 4W9GA 4KIKA 4BOZB 4NAWA 1WH3A 4MJSB 1U4AA 4NQKE 4MSMB 2FIFA 1S3SG 2KX3A 1LQBA 2KD0A 4DWFA 4NQLB 4DHJD 4KV2A 3PLUA 2LWPA 3P2BA 2A4ZA 4JGHB 1HE8A 2KC2A 3KUCB 2JZZA 5AZGA 2DAJA 1OTRB 3RZWC 3VUWA 3V62A 4BFRA 3KW5B 2GBJA 1WJ4A 4BVUC 2CHXA 4FADA 3VH4B 2BKRB 4KZ0A 4ZRIA 2JF5A 2GBNA 3UGBB 2MBOA 3A9JA 2EMSA 3K9PB 4HXDA 2L7RA 1NBFC 3JSVB 4EEWA 3DBSA 1WJ6A 4XZ4A 4DHZB 4GOCA 1V81A 4BBNF 2C60A 3NZUA 5C23A 1YD8U 2O6VD 2CKHB 2JZ3B 4WWOA 4URKA 2YLMA 4ICUA 3HM3A 2RR9A 4MGZE 2BGFA 3CSFA 4F8CB 2A5UA 4A3OA 4HLEA 4FHKA 1XQQA 2LZ6A 1RFAA 4NJ6A 2JUOA 3RD2A 3APCA 2G3QB 3N30A 1UGMA 1OEYA 2BWES 1ISNA 2FUHB 3U8ZA
chains in the Genus database with same CATH superfamily
1V2YA 2X8XX 1FO4A 4BZAA 3V6CB 3RNBC 2K8CA 4MH0E 4M8NA 1ENFA 3RUIB 3APDA 4W9KA 3A9KB 2LI5A 3C8YA 4ZYSA 3P4PB 3BVZA 3MJWA 3NRZA 3DHGC 5HG2A 1WXQA 1V8CA 4NPNA 4DXFA 4CHKA 2WXNA 4YWGG 5IKCM 2V3SA 4IM2A 3Q8FA 3N1YC 2D3BA 1WMHA 1I4PA 1NYRA 3N1ZC 1P1AA 3M63B 5DPTA 3NS1A 1EU4A 1SE4A 2L1AA 2WGSA 3AXCA 4GMVA 1E7PB 3EFCA 2MRPA 1WRDB 3TUOA 2K22A 3Q3OC 1SGHA 2SAKA 3NY5A 1M4VA 3ECIA 1I4XA 4K81A 4MACA 1P9DU 3ZNID 3O65B 3AEDB 5C1ZA 3CMMB 1XCTL 3PHWB 2KX0A 2RPVA 2ON8A 2KFKB 1N61A 2MBEA 2ZPYA 4XWWA 2L0FA 2KNBA 4YTNB 2EMTA 1E8WA 1EU3A 1Z5SB 1ZUD2 4W9LA 3TSSA 2IO1B 1IUEA 2ZNVC 4F1SA 2ZVNA 2LXAA 1V6EA 3KUDB 4ANXA 5DCNA 4S17A 2PE6B 2E3TA 4LNOA 2Z8LA 2DZKA 3H8HA 1KRHA 1ZDXA 1FXTB 1E6EB 4A3PA 4HVBA 4KKIA 2O2VA 3R3MA 4LJOB 2BWFA 1R7SA 1FNVA 4WQOB 3B9JA 2AQ1B 3DOWA 2NBUA 4AOFA 2WNMA 1XD3B 3LDZE 3BK1A 3AE6B 1WXVA 4HJKA 5EE3A 4OZAA 2MP2B 4RF1A 5G55A 2FCNA 5G5GA 4MGKE 4AS1A 2K0PA 4IC7B 3U2SC 4DK5A 2FUG1 2IYDB 2WP9B 4WWNA 2DHZA 1YN5A 3PS6A 3DWMA 3I9V1 5G5HA 3EECA 3A9KA 1DGJA 1J0GA 4KGTA 1ZXHA 2ACZB 2M56B 4I6PA 4WJNA 2Z59B 1YJIA 1WR6E 3B08A 2XNAC 2LVQA 3P4SB 3DVNU 3FAHA 3I5JC 4DDGD 3VHTC 1HQRD 2PKOA 4X57B 2BB5A 2QJLA 4GDKB 1YN4A 3B2FA 1GG3A 3EC8A 4B9KA 2LJIA 5E6JA 4GDLB 4XC2A 2LVOA 3W1YA 2WXFA 1RM6C 3ZJVA 3EFUA 3WCQA 2AWTA 2I38A 5J18A 3RNGC 3AE1B 3R2IA 3VR8B 3AE7B 4I6NB 3DCGA 1NENB 1PYWD 2FIDA 3Q8AA 2IO2B 3GE3C 3MC0B 2KTRA 3A33B 5BMGA 2J52A 4A90A 3VTUA 3DHIC 2KN5A 4C4VA 3P63A 1WYGA 2KT7A 4K1RB 1SIFA 3ML9A 2PVOD 2IDYA 3BY4B 4ACFA 4N59A 5IO9A 4HPMB 3HVDA 2GRIA 1YQBA 4BKSD 2INCC 1YX5B 2ZZPB 2MBHA 3A9JB 3L08A 4A9AA 3SU8X 1GPXA 4B95A 4LDTD 1E90A 4K7SA 3IHPC 4P7IA 4RH6A 2YEPF 3U7DA 3DDCB 4IWQA 3RNAC 2OJWA 4JQWC 3ZRFA 4YL8A 4ZRKA 2BYEA 1UGJA 3PHXB 4FJVB 2INPE 2PPHA 3X23A 4DHZE 4FBJB 5BMHA 1OGWA 3ZUNA 1GB4A 4EUTA 4YTMB 3ALBA 3NVWA 3DVNV 1BXTA 1KLVA 2MP2A 4K3CA 4W9JA 3MFGA 4JPSA 1Z2MA 2WWZA 1JWSD 4IG7B 2Q5WD 4ZDVA 1L5PA 2K1FA 4FLHA 2L76A 3TMPB 1WZ3A 3OWEB 1S1QB 1N6ZA 3NVVA 3DBRI 4G11A 3Q8EA 3IBEA 3TJPA 1R4MB 3GE8C 3S2AA 3AU5A 1ZXIA 3ZGZA 1J7CA 3U4EG 1P98A 3ZO5B 5AZFA 4JE3B 2MA9B 2LUEA 3R2TA 3B1LX 2IO3B 2KJHB 2KWCA 4G0NB 2H89B 4BAXA 1I4RA 3RFZB 1P0RA 1T0YA 4YXDB 5JZEB 2I1KA 2N1WA 4GDKA 2DNFA 2GBMA 2XBBC 4KGRA 4KDLB 3DBHI 2WDQB 1QILA 4GDLA 3RN9C 4DXGA 2N9EB 1E9MA 3LB8C 2N9KA 4O1NA 2ZW0A 3Q69A 2C7HA 4IM3A 3TIXA 5DPWA 3TEXA 3EGRA 3W9CB 4ANWA 4LNKA 3AH7A 2J0JA 3WAOA 1C76A 3ZKJC 4AJWA 1VLBA 3GZNI 2JYEA 3KH0A 2DYBA 3QX1A 3HK0A 4W9GA 4MJSB 2HDEA 4M02A 1S3SG 2KX3A 1LQBA 1MG4A 3P2BA 4OZBA 4JGHB 1HE8A 3VRAB 1LO5D 1D6EC 3DWGC 4ZHOA 4FXCA 4BFRA 1ZOYB 4FADA 3VH4B 1UWMA 2WS3B 3A9JA 4OVZA 4HXDA 1IGDA 1WJ6A 4BBNF 2BS2B 4ARIA 1YD8U 1YJJA 4L2YA 2HJ1A 4URKA 4ICUA 4ZRPA 3Q2AC 2RR9A 4MGZE 2MHJA 4P1BC 2A5UA 3RI7C 1SE2A 4NJ6A 2KYWA 3RNEC 3RD2A 2WXPA 1UGMA 1NEKB 5GXGB 3FILB 2FUHB 3U8ZA 1K53A 2W3SA 3QQ8B 1V1PA 4KDIC 3AE5B 1WR1A 2MLBA 2IBIB 2K25A 2J4XA 5JXVA 5MPOA 2UU7A 4YT0B 3VAWA 2LUMA 2M17A 2BPSA 2QDFA 1UELA 2CJNA 1L0XB 3A4RA 2KWDA 1FFUA 5AEKB 3JW0X 4D2KA 2KMMA 3ZIMA 2FCSA 2L05A 3W1SA 1V9JA 5AUIA 2LGDA 1TS5A 4BKTA 3T8MA 4XDDA 2YVCA 3WAPA 4N58A 4ARCA 2QCZA 3NHEB 5BYRA 3ZNZB 2HTME 4NZLB 1AWDA 3AV8A 3BVMA 1WX8A 2KVZA 2N9PC 3W2DA 1WE7A 2FAZA 2DAFA 2V4LA 1WWTA 1F2RC 1I4GA 2ZNVB 2LD9A 1IGCA 1VCBA 5LXIB 1MFWA 3J9CA 3AEAB 2BS4B 2NTTA 4C80A 5IN7A 1R4NI 3QIJA 2WXGA 4K3BA 1YN3A 3WA0A 1Q10A 3U52E 2ZVOA 4HWIB 1LGRA 3UIPB 1Q1OA 3ZJTA 1FCCC 1YJ1A 3H6NA 3SDLC 1UZXB 3T9LA 1Q0WB 4MJSA 5CHVC 4LK0M 5L95C 3W5VB 3QHTA 3AI5A 2LHEA 1UH6A 2RPQA 1MVKA 5AZHA 1RAXA 1K8RB 3SR6A 3QK0A 4XWTA 1RLFA 4GGQA 5H92C 2ASQA 3IXSA 1XXGA 3ABVB 3L54A 4XE0A 2J7QB 4QAYA 2CHZA 5E6PA 4FA6A 2FNJB 2CJOA 2MJ3A 5CHWA 1FXAA 2JWZA 3MP9A 1L0VB 1JWMD 1L2NA 2HTHA 3Q8BA 5GMVA 3H7PB 2N0SB 1SJED 2D5GA 3SHQA 1P3QU 1CZPA 2KK8A 4AUQC 1PGXA 2KDIA 3FILA 1TY2A 3WIMA 4LCDE 4JX1C 1FCLA 1XLNA 4GB9A 4YSYB 2JXXA 3PLVA 1JRPA 5DPRA 1E8XA 3ETRA 3RULA 2DYMA 2SEBD 3PRZA 1N5XA 2WXIA 5JHAA 1V5TA 1XLPA 3PVLA 2GOWA 3H1UA 4L23A 1PFDA 4NJ7A 2LGIA 3AE8B 2PJHA 2IY0B 3VR9B 2MWSB 3AEEB 2UYZB 2KQ4X 1KH0A 3I3TB 2D2QA 2KO3A 1WGDA 4LJPB 5EE0A 3PRMB 3VQIA 3ZJUA 2RGFA 2L3ZA 3ZXRA 3LJ3A 2KWUB 3QAQA 3AEGB 2BYVE 3MJ5A 3K9OB 3PV1A 1ZKHA 1J8CA 2LASA 5C2TB 1GC6A 5LLIA 3DQVA 5D3DA 2ZPNA 3CIRB 1A5RA 2EKEC 1NI3A 2JQRB 2G45B 1I4QA 5TR5A 2ONQA 2IZVB 3BVGA 1RWSA 1UWXA 1UUPA 4M8MA 4JWSC 1XO3A 3HM6X 1JCKB 4YTPB 1KLUD 1E5WA 2GB1A 3QCAA 2W54A 2RSUA 1EWYC 1GJZA 3PT2B 3NZ3A 1UF0A 2RD0A 2M8SA 2Z0EB 1RRBA 1XT9B 4BOSC 2K8HA 4W9FA 4WURA 2V3NA 1K52A 1EF1A 2K5PA 2G4SA 4E3CA 1C9FA 3PZ8A 1TGZB 2L00B 1HXYD 1OQQA 4GIVA 3KVFB 2WDTB 3GP7A 3H7PA 2KC1A 4PS7A 2Y5PA 3ZQ4A 1WE6A 3RMKC 2KDEB 1KF6B 1K50A 4OHJA 4ASWC 3MC8A 1GNUA 1OEYJ 1HTQA 4PS8A 4W9EA 4R3DA 2KJRA 4K7WA 3IAS1 1F77A 3IVFA 3PRPB 4TQ1A 3PPAA 3Q6BA 4JIOU 3UQBA 3VFKA 4HCPB 4RF0A 1I35A 3PO0A 1TY0A 3SD5A 1XF5L 3OAWA 2QSDA 1JMLA 4GSWA 3P4QB 5E6OA 1WGYA 1BUIC 4ZYNA 3KYDD 5IAAC 2KN4A 4WAFA 4B0MA 1E8ZA 4HKZE 4BKSA 2KMAA 5J17A 2VZKD 1F52A 2QC8A 4RCOA 1D5XC 3H7SA 4PT5A 2BT6A 4G3XB 4FJYA 3UI3A 2KFKA 3PGEA 2J0KA 4W9HA 4FJZA 2CR5A 1JW9D 4DXAB 3L10B 1VRAB 1HA5A 3GOEA 2KOXA 1FXIA 3HUIA 3NS8A 4BOZB 1QF6A 4TMAB 1WH3A 2KD0A 4DWFA 3N9YC 3VRBB 2A4ZA 2KC2A 3KUCB 3KW5B 4BVUC 1T6BX 4KZ0A 2MBOA 2L7RA 1NBFC 3URYA 4EEWA 1TKEA 3DBSA 1CQVA 5C23A 2O6VD 2JZ3B 2YLMA 2PVGC 2GLSA 4LTUA 3N1XC 4HLEA 1WSPA 2LZ6A 1L4DB 5BYSA 3HRDD 1RFKA 3N30A 1I7HA 3B2GA 2BWES 4US9A 1C3TA 2KFJA 2FCQA 3MC9A 5EE9A 3R7QA 1AN8A 1DOXA 2AQ2B 2I1JA 5D3IB 2WXJA 1CMXB 2AL6A 3V05A 2R2QA 2C7NB 2CU3A 3IT4B 4OW0A 3NVYA 1X1MA 1F0ZA 4MGIE 3CSTA 4NY0A 4OVUA 2M4NA 1ESFA 1UNSA 1FD6A 1SEBD 4W9CA 5FKAC 1R4MI 1FEHA 2PTLA 2UWQA 2PIAA 4N9F4 4M01A 2XN9C 2OOBB 1EF5A 1FNUA 1E7UA 3I63C 1N62A 1TZOA 1VR9A 3V61A 3AN1A 1V80A 4GN1A 1TS3A 1WM3A 2LXCA 1SB3C 2GI9A 4RM9A 1G6JA 4MELA 1AARA 1VZ6A 2NS5A 4WJPA 1WRIA 2W55A 1WY8A 5J2RA 1L4ZB 2W82A 1GB1A 1WX7A 2Y5CA 1Y56A 4J3OD 3Q3JA 5EE1A 1EWCA 2LGYA 4WIPA 5LXHA 1D3ZA 2AEHA 2LEKA 3ZVVA 4TQ0A 2N7DA 3PREA 1WXSA 2D3GA 1QT9A 3L4PA 2KQSA 4M00A 1TJEA 3V60A 3AEFB 1ZE3D 2NCNA 2KQ7A 1FM0D 2N7EA 4II2B 2C7MB 2N9XA 4ANUA 1J19A 4XGAB 3VUXA 4II3B 2EELA 2J0MA 3IFWB 4B6WA 1P7EA 3ZYYX 5D2MB 4EZKA 2MQJA 4HRSA 4MEMA 5I4DA 2KKCA 1C79A 2B76B 2OJRA 4A6QA 4IDIA 4W9IA 1V5OA 4OVVA 1E10A 1WJUA 3AB5A 2C9WB 4KVGB 1FMAD 3RPFC 2KTFA 2KZRA 2KDFB 2MEKA 4EZJA 5L83A 4IW0A 1QLBB 5EDSA 2NPTB 1QKZA 1TYGB 4DBGA 2KWVB 1GOZA 3DBLB 4WJOA 1YQ4B 1AYFA 3U30A 3LYYA 1UBQA 3JYUA 1KLGD 2V0GA 2G1EA 2MW5A 3R8BA 1IBXB 4FHJA 5FR6A 3AE3B 1TS4A 3DBLI 1C77A 3T3OA 1T0QC 1EUVB 1TS2A 4OZCA 3UINB 3I57A 3N3KB 2JSVX 1M94A 1BMLC 5HI1A 2JZPA 2LVPA 5CHFA 4A20A 1KJTA 4W9DA 2JPHA 5BO4B 1FFVA 4J6IA 1GAQB 4CO7A 3D32A 5E6NA 5H8YE 2KLCA 1JROA 3NUHB 2DYOA 1FIQA 3V6EB 3DPDA 1BT0A 1OFFA 2HE7A 2L0TA 3SEBA 3AE4B 2BW2A 1V49A 2BVCA 1TTNA 3KQ4A 1OQYA 2ZCBA 1JRUA 4P16A 3VH3B 3L16A 5CTRC 2REXA 4TKNA 2J53A 2BTEA 2LGXA 3AMZA 2IJ0A 2PW9A 4PYUA 3T3NA 2AX5A 1L6UA 4GXBA 4RMAA 3IAM1 3L17A 2BS3B 4EFOA 4XYCA 3AECB 4C7YA 1QOAA 1T0SC 4WWMA 2AL3A 3NOBA 2WU5B 3OLMD 3PTFC 1V97A 5D7GA 4EOYA 2MBBB 2I2YA 2ZW1A 1C78A 2MBQA 4BBNC 2LRWA 1YX6B 2WX1A 2Y3AA 1UBIA 2PE9A 1TBEA 3NJTA 2JYTA 2O2VB 2BQQA 1NI2A 2DENB 4KSKC 2IGGA 4ZRJA 3AE2B 2WXHA 2GBRA 3Q8CA 3ZTCA 3CF6E 4WAAA 2G9HD 4FN2A 2XEWA 4LNNA 4MM3B 2IPKD 3HIZA 4US8A 3ZNGC 2C5LC 3VVWB 4NJCA 1N63A 3KWLA 1IPGA 1WF9A 2FCMA 3N20C 2VZKB 2L83A 1WGGA 3E56A 4A55A 4ZRQA 3R7RA 5JH5C 4MSQB 2NPTA 1WYWB 2BKFA 1JQ4A 1EM7A 1AW7A 5G2NA 2BYTA 3FC4A 4HROA 3EA6A 1DOIA 2VRRB 4FULA 5KHQA 2K8BA 1IBXA 2H88B 1SSNA 1CJEA 1HTOA 1XLQA 3BK2A 1PQSA 3SFEB 2WXLA 2R61A 3OJ4B 1OQRA 4DDID 4M0WB 3TL5A 2JX5A 4RNAA 4MT5A 1TZ1A 1NVID 3X0WA 3NZSA 1V86A 2N4FA 4LDTB 2DZMA 1WXMA 1Y8RC 3VTVA 1WXAA 2BF8B 2WDVB 1MPEA 2KDBA 4WWPA 1C4CA 1WJNA 3KLSX 2O6VB 3RNCC 3U7ZA 1QZEA 3A1QB 2DZIA 1RYJA 4HJGE 3WALA 2V4IB 2KTRB 1PGBA 2D3AA 1WZ0A 3TEYA 1TT5B 2JVCA 3O13A 4PYZA 1SJHD 2WYQA 1MHXA 1FRDA 3L0WB 1Q5WB 2WQYB 4C4VB 1A70A 1H8CA 3KYCD 1U4AA 4MSMB 4NQLB 4DHJD 3CWIA 4KV2A 2JXTA 4EE2A 4RGOS 4CQNA 2JZZA 2GBJA 1WJ4A 2CHXA 2JF5A 2OHFA 3K9PB 3JSVB 1SF0A 4XZ4A 4GOCA 1V81A 2WLBA 3NZUA 3HM3A 3V3XA 2BGFA 3CSFA 3BWUD 4FHKA 1XQQA 2KAJA 1RFAA 3APCA 3NG0A 1TIFA 1OEYA 2MH7A 2K3UA 2PLPA 2MJDA 2GBKA 2WHIA 4MM3A 3B0AA 2QEJC 2RMMA 3Q3NC 4JWUC 5IOIA 1L6VA 2LRUA 3MHSD 4BKGA 2DX5B 3ML8A 4WQMA 1L0YB 3RYTA 4CYEA 2MJEA 2JRHA 3ZTDA 4GLSC 1ZDVA 2NR2A 3BYYB 2TSSA 3E9SA 1E0ZA 3M62B 2MSED 2B3AA 2ZEQA 4ICVA 4E71A 1F1HA 1KOTA 4Q2JA 2WXOA 2ICIA 4M0WA 4PS3A 3ONSA 4YSZB 3VXWA 2IGDA 3RNFC 3TCAA 2W3RA 5D94A 4ZHPA 4REZA 4NAMA 2AYOB 2DLBA 2M0XA 1K51A 4USAA 1FRRA 3GB1A 2JWUA 4RGTA 1NYQA 5FR3A 2WXMA 1LFDA 2O6VA 3RT3B 1SE9A 1J7BA 3EHVA 4S0RA 3A1QA 3RZFA 2KHWB 1D4BA 2HJ8A 5HKHA 2D07B 2VH1A 1T0RC 1ZW7A 1XCQL 1CK1A 1N60A 4ITKA 3H9DA 4AQ7A 2YEPB 1C4PA 5DPSA 2CHWA 3QJZA 4ANVA 2PEAA 3BIID 3UQAA 4N6EB 2DBYA 2LHDA 1UD7A 4E74A 1PDXA 1SIJA 3VDZA 4JL9A 2V1YA 1F9JA 4LNIA 1V1OA 2R2OA 4IOIE 3MHZA 1EO6A 1ROEA 2KMCA 3IT6B 3EUB2 3Q3MC 2AQ3B 2BYFA 3JSVA 4K7UA 1PGAA 2XK5B 3ENEA 2NVUI 2LMCA 3TBLD 2MCNB 4PK1A 3UF8A 4IUMB 1YOVB 1YQ3B 1SXTA 2NBWB 2IY1B 3FKYA 4HKQA 1QOBA 5KHOA 2HD5B 2MX2A 1YIWA 3IG3A 4RM8A 1GUAB 3NVZA 1V1PB 2L8JA 3RCZA 2WX0A 3KUZA 2N1VA 2FBWB 2IGHA 5AUKA 3P4RB 4XX5A 2G4DB 2N9LA 3DBRB 3Q3FA 3UIOB 1HZ5A 3N32A 5FK9C 3TEWA 4P6VF 3AULA 3QWZB 4NNJB 5CX3A 1DYQA 3SFDB 1C4AA 4C00A 4TUUA 4YSXB 2WXQA 2X38A 2NMQA 2QMTA 3AE9B 3A4SC 4L1BA 1HZ6A 1SE3A 4A8XC 1P7FA 4IM0A 1WX9A 3AU4A 2KANA 2QILA 1WGRA 1VDVA 2M1MA 1VZ7A 3AM9A 3DBHB 1F2RI 1ZPSA 3GS2A 4KKJA 4HPLB 3DVGY 4IWOA 1ZP0B 3KWVA 1IP9A 1FPYA 3LXFA 4HCNB 4IKGA 1VJKA 2V3PA 4AWJA 3ZNHB 2WXKA 1QOGA 2BB6A 4TV3A 3WANA 1WM2A 1H4RA 4RGMA 1GC7A 4MH8A 1TKGA 5D6JB 5JHBA 2FE8A 1L7YA 1KFYB 3BYTB 2WU2B 2CU1A 4MGYE 1I4HA 4XDCA 3QA8A 4TSSA 2Z0DB 1TKYA 3P42A 3APFA 4EKUA 3GZNB 2D10A 2J42A 3ZLZA 2GMIC 2L52A 4KIKB 4NAWB 1T5XD 2L32A 2K6DB 5T8IA 1E7VA 4KX6B 4KZCA 3ZDTA 4KGSA 4C7ZA 5BMIA 1B1ZA 1VD2A 2KJ6A 1N5WA 2DWQA 2RDBC 1QQRA 4EZLA 2NBVB 2DZJA 4HDQA 4JLCA 2PMVA 3VUYA 4LLGM 1ET6A 4F7ZA 4HEA1 1FNWA 3AEBB 3M3JA 3QC8B 1KM7A 4H2AA 3MTNB 3BINA 4WJQA 3ZXVA 2XK5A 1JWBD 1QOFA 4MDKE 2Y5BB 5BYQA 5HFYA 1YNTE 2ZCCA 4AJYB 4G50A 3M95A 2K6QA 2LGSA 1T3QA 2INNE 3ZDMC 4HK2A 2QIEB 4RFBA 2KACA 2KDMA 2VH2A 2JT4B 1I42A 4HPPA 1LXDA 3L13A 2JY6A 1B9RA 1STEA 3PSEB 1IYFA 3PZDA 2K9XA 2LJ5A 4RGNA 4HDOA 1WIAA 1WMHB 2LFIA 4AP4C 2KLGA 3WAMA 5IA7A 2QHOA 4C56C 2RDGA 2JRIB 2INDC 2KXJA 1MG8A 2E6XA 2BBCA 4IWPA 3JVZX 1WFYA 2V9HA 2JU6X 4DHJB 5TSSA 3W1SC 4KSLC 4WH4A 2W9NA 1E8YA 4GU2A 1WI0A 1JWUD 5LNK1 4I6LB 3OJ3A 1VZ8A 1WGKA 3C0RB 1WGHA 2IO0B 2WXRA 3ZW3A 1LM8B 1MJDA 2K39A 1ACCA 1JWAD 1NDDA 3HVZA 3R66C 1ET9A 3VTWA 2D11A 4ZOHC 1R4NB 1MHHE 2KVRA 1DOYA 1C1YB 3Q14C 2EKIA 2CS4A 3DHHC 3QARA 3ZRCA 3HHMA 1ZGUB 3DVGX 2ZJDA 3PZ7A 4KIKA 2M19A 4NAWA 2N7JA 4NQKE 2FIFA 3PLUA 2LWPA 1XLOA 1HEZE 1PUTA 5HHDG 5AZGA 2D3CA 1XEEA 1SBBB 2DAJA 1OTRB 3RZWC 3VUWA 3V62A 5IP4D 2OEDA 1JALA 2BKRB 4ZRIA 4B0EA 2GBNA 3UGBB 2EMSA 4DQOC 3BZDB 2NTSA 4DHZB 2RDHA 2C60A 1KTKA 4UDUC 2CKHB 1YMHE 3TEZA 4WWOA 2M0AA 4F8CB 4A3OA 3P1MA 3C19A 4P1CC 1D5MC 4LNFA 2WDRB 3OG5A 2JUOA 2G3QB 1MI0A 5C3JB 1ISNA 1D5ZC 3W5UB 1J7AA
chains in the Genus database with same CATH topology
1C3TA 2KFJA 2GBKA 4MM3A 2FCQA 3B0AA 1V2YA 3QQ8B 4KDIC 1WR1A 2MLBA 3V6CB 2IBIB 2K8CA 2K25A 4MH0E 3R7QA 4M8NA 3RUIB 3VAWA 3APDA 4W9KA 2M17A 3A9KB 2LI5A 2BPSA 2LRUA 2I1JA 1UELA 1CMXB 3MHSD 2AL6A 3A4RA 3MJWA 4BKGA 2DX5B 3ML8A 5AEKB 2R2QA 2C7NB 3JW0X 1X1MA 4NPNA 3ZIMA 4MGIE 3CSTA 4NY0A 3RYTA 4OVUA 2M4NA 4CHKA 2FCSA 4CYEA 2L05A 2V3SA 2JRHA 4IM2A 3W1SA 1V9JA 2LGDA 3ZTDA 1WMHA 4BKTA 3T8MA 1P1AA 2NR2A 1R4MI 2YVCA 3M63B 4W9CA 5DPTA 3WAPA 2UWQA 3M62B 4N9F4 3AXCA 2MSED 2B3AA 2ZEQA 2OOBB 4ICVA 1EF5A 4E71A 4GMVA 1KOTA 1E7UA 3NHEB 3ZNZB 2MRPA 4PS3A 3ONSA 1WRDB 3V61A 3VXWA 1V80A 4GN1A 1WM3A 2LXCA 3TCAA 1WX8A 1SGHA 5D94A 2N9PC 3NY5A 3ECIA 4K81A 2AYOB 1WE7A 2FAZA 4RM9A 1G6JA 2DAFA 4MELA 2V4LA 2M0XA 1P9DU 3ZNID 1AARA 3O65B 5C1ZA 2ZNVB 2NS5A 2LD9A 4WJPA 3CMMB 1WY8A 3PHWB 5J2RA 1VCBA 1WX7A 2KX0A 5LXIB 1LFDA 2KFKB 2O6VA 3RT3B 1SE9A 2MBEA 2ZPYA 3Q3JA 2L0FA 3EHVA 2KNBA 3A1QA 3RZFA 2KHWB 2LGYA 5LXHA 1D3ZA 2AEHA 3ZVVA 2EMTA 4TQ0A 1E8WA 2HJ8A 5HKHA 2D07B 2N7DA 3PREA 1Z5SB 1R4NI 1WXSA 2D3GA 3QIJA 3WA0A 4W9LA 1ZW7A 2IO1B 3H9DA 2KQSA 2ZVOA 2ZNVC 4HWIB 4F1SA 2ZVNA 3UIPB 1Q1OA 2LXAA 3V60A 1V6EA 2NCNA 5DPSA 1YJ1A 2CHWA 3H6NA 3KUDB 1UZXB 2KQ7A 2PEAA 3QJZA 3SDLC 4ANVA 4ANXA 3UQAA 5DCNA 3T9LA 1Q0WB 2PE6B 2N7EA 4MJSA 5CHVC 4II2B 2C7MB 2N9XA 4ANUA 5L95C 3QHTA 1UD7A 3AI5A 1J19A 2DZKA 1UH6A 2RPQA 4E74A 5AZHA 3VDZA 3VUXA 4JL9A 1RAXA 1K8RB 4II3B 2V1YA 1F9JA 3QK0A 2R2OA 1FXTB 1RLFA 2J0MA 3IFWB 4GGQA 2ASQA 4A3PA 1EO6A 4B6WA 4HVBA 2O2VA 2KMCA 3L54A 3R3MA 5D2MB 4LJOB 2BYFA 3JSVA 2J7QB 4K7UA 2BWFA 4EZKA 4WQOB 2MQJA 2CHZA 4AJYB 3DOWA 2XK5B 5E6PA 3ENEA 4FA6A 2FNJB 4MEMA 2NVUI 2NBUA 3TBLD 2KKCA 2MCNB 5CHWA 4AOFA 1XD3B 2OJRA 3UF8A 4W9IA 3LDZE 1V5OA 4IUMB 4OVVA 1WXVA 1WJUA 2JWZA 1L2NA 2HTHA 2IY1B 2NBWB 2C9WB 4HJKA 4KVGB 3H7PB 5GMVA 2MP2B 3SHQA 5G55A 2KTFA 2FCNA 1P3QU 2HD5B 2KDFB 1YIWA 2KZRA 2MX2A 3IG3A 5KHOA 4MGKE 4EZJA 2KK8A 5L83A 4RM8A 1GUAB 4AUQC 2KDIA 2L8JA 4IC7B 4IW0A 3RCZA 2NPTB 3WIMA 4LCDE 2WX0A 4DK5A 3KUZA 5EDSA 2N1VA 2KWVB 4WJOA 2IYDB 4DBGA 4GB9A 4WWNA 2JXXA 3PLVA 2DHZA 4XX5A 3U30A 2G4DB 1UBQA 5DPRA 1E8XA 3JYUA 3Q3FA 3UIOB 3PS6A 3RULA 2DYMA 3EECA 3A9KA 2MW5A 3N32A 3PRZA 4FHJA 3AULA 3QWZB 4NNJB 5FR6A 3DBLI 5CX3A 1J0GA 5JHAA 1V5TA 3PVLA 2GOWA 4I6PA 4TUUA 4WJNA 3H1UA 2Z59B 1EUVB 1WR6E 4NJ7A 3B08A 2LVQA 3UINB 3N3KB 3DVNU 2PJHA 1M94A 3A4SC 4DDGD 3VHTC 2IY0B 2LVPA 5CHFA 4IM0A 4A20A 1WX9A 1KJTA 4W9DA 2JPHA 2MWSB 3AU4A 2KANA 2UYZB 4X57B 1WGRA 4GDKB 2M1MA 5BO4B 4J6IA 3I3TB 1GG3A 3EC8A 4CO7A 3D32A 5E6NA 2KLCA 2D2QA 4B9KA 2KO3A 4GDLB 4HPLB 3DVGY 4XC2A 2LVOA 4IWOA 2DYOA 3W1YA 3V6EB 1IP9A 3DPDA 1BT0A 1WGDA 4HCNB 4LJPB 3EFUA 4AWJA 3ZNHB 2AWTA 2HE7A 2L0TA 4TV3A 5J18A 3WANA 1WM2A 1H4RA 3PRMB 3VQIA 1GC7A 1V49A 2RGFA 2L3ZA 5D6JB 4I6NB 3DCGA 1TTNA 3LJ3A 2KWUB 2FIDA 5JHBA 3QAQA 2IO2B 2BYVE 1L7YA 1OQYA 2ZCBA 3K9OB 3PV1A 1JRUA 1ZKHA 1J8CA 2KTRA 2CU1A 2LASA 3A33B 4MGYE 3L16A 3VH3B 5CTRC 3QA8A 1GC6A 2Z0DB 2REXA 5LLIA 3APFA 4EKUA 3DQVA 4TKNA 2ZPNA 2D10A 1A5RA 2LGXA 3ZLZA 3VTUA 2GMIC 2KN5A 4PYUA 2EKEC 4KIKB 4NAWB 4GXBA 4RMAA 2G45B 3L17A 4K1RB 1SIFA 2K6DB 3ML9A 5TR5A 4EFOA 1E7VA 2IZVB 3BY4B 4KZCA 3ZDTA 4M8MA 3HM6X 4HPMB 1VD2A 2KJ6A 1YQBA 1E5WA 2AL3A 3NOBA 4BKSD 1YX5B 3OLMD 3PTFC 5D7GA 4EOYA 3QCAA 2MBBB 2ZZPB 2MBHA 3A9JB 4EZLA 2NBVB 2DZJA 2RSUA 4HDQA 4JLCA 1GJZA 3PT2B 2MBQA 3L08A 3VUYA 4F7ZA 4BBNC 2RD0A 2M8SA 2LRWA 2Z0EB 3SU8X 1YX6B 1RRBA 2WX1A 1UBIA 1XT9B 2PE9A 1TBEA 3M3JA 4BOSC 3QC8B 4B95A 2K8HA 4LDTD 4W9FA 2O2VB 1KM7A 1E90A 3MTNB 3BINA 3IHPC 4K7SA 1NI2A 4P7IA 4WJQA 2DENB 4KSKC 4ZRJA 3U7DA 3DDCB 2GBRA 4IWQA 1EF1A 3ZTCA 3CF6E 4JQWC 2XK5A 4WAAA 3ZRFA 4YL8A 2G4SA 4E3CA 4ZRKA 2BYEA 3PHXB 4FN2A 2XEWA 2PPHA 2Y5BB 4FJVB 4MDKE 3X23A 4DHZE 1OGWA 4FBJB 3ZUNA 4EUTA 1TGZB 2ZCCA 2L00B 3HIZA 4G50A 3M95A 2K6QA 3ALBA 4GIVA 2C5LC 3VVWB 3ZNGC 3KVFB 4HK2A 2WDTB 3ZDMC 3DVNV 1IPGA 1KLVA 1WF9A 3H7PA 2FCMA 2KC1A 2MP2A 4PS7A 4W9JA 1WE6A 1Z2MA 2WWZA 1WGGA 2KDEB 4IG7B 4ZDVA 2JT4B 2K1FA 4ASWC 1I42A 3R7RA 1LXDA 5JH5C 3L13A 2NPTA 4FLHA 4MSQB 1GNUA 1WYWB 2BKFA 2JY6A 2L76A 1OEYJ 3TMPB 5G2NA 1WZ3A 1S1QB 3PSEB 4PS8A 3PZDA 4W9EA 1IYFA 2KJRA 2LJ5A 3DBRI 3IVFA 3PRPB 4K7WA 4HDOA 1WIAA 4G11A 4TQ1A 1WMHB 3IBEA 3TJPA 2VRRB 3PPAA 4FULA 5KHQA 2K8BA 3S2AA 2KLGA 3AU5A 3WAMA 4AP4C 5IA7A 2QHOA 1P98A 4JIOU 3ZO5B 2JRIB 5AZFA 2MA9B 3UQBA 3VFKA 2LUEA 4HCPB 2KXJA 1PQSA 1I35A 1MG8A 3SD5A 3B1LX 3OJ4B 2IO3B 2KJHB 4M0WB 2KWCA 4IWPA 4DDID 4G0NB 3JVZX 1WFYA 3OAWA 3TL5A 4DHJB 4GSWA 5E6OA 1WGYA 1P0RA 4KSLC 1T0YA 3W1SC 5JZEB 1TZ1A 4ZYNA 3KYDD 2I1KA 2N1WA 4GDKA 2GBMA 2XBBC 2W9NA 1E8YA 4GU2A 3X0WA 3NZSA 4KDLB 5IAAC 1V86A 1WI0A 3DBHI 4I6LB 2N4FA 1E8ZA 3OJ3A 4GDLA 4BKSA 2KMAA 4LDTB 5J17A 3C0RB 2DZMA 1WGHA 2IO0B 1WXMA 2N9EB 1Y8RC 3ZW3A 3VTVA 1LM8B 1WXAA 2BF8B 2KDBA 4WWPA 2K39A 3H7SA 1WJNA 1NDDA 2O6VB 1QZEA 4G3XB 4FJYA 3A1QB 2DZIA 3R66C 2KFKA 3WALA 3PGEA 2C7HA 2J0KA 3VTWA 2D11A 2KTRB 4W9HA 1WZ0A 4FJZA 2KVRA 4IM3A 3TIXA 2JVCA 5DPWA 4PYZA 2CR5A 1C1YB 2WYQA 4DXAB 3L10B 3L0WB 2CS4A 4ANWA 3GOEA 3QARA 1Q5WB 3ZRCA 2J0JA 3HHMA 3WAOA 1ZGUB 3ZKJC 4AJWA 3DVGX 2ZJDA 3GZNI 2KOXA 3KH0A 2DYBA 3QX1A 1H8CA 3HK0A 3KYCD 3NS8A 4W9GA 4KIKA 4BOZB 4NAWA 1WH3A 4MJSB 1U4AA 4NQKE 4MSMB 2FIFA 1S3SG 2KX3A 1LQBA 2KD0A 4DWFA 4NQLB 4DHJD 4KV2A 3PLUA 2LWPA 3P2BA 2A4ZA 4JGHB 1HE8A 2KC2A 3KUCB 2JZZA 5AZGA 2DAJA 1OTRB 3RZWC 3VUWA 3V62A 4BFRA 3KW5B 2GBJA 1WJ4A 4BVUC 2CHXA 4FADA 3VH4B 2BKRB 4KZ0A 4ZRIA 2JF5A 2GBNA 3UGBB 2MBOA 3A9JA 2EMSA 3K9PB 4HXDA 2L7RA 1NBFC 3JSVB 4EEWA 3DBSA 1WJ6A 4XZ4A 4DHZB 4GOCA 1V81A 4BBNF 2C60A 3NZUA 5C23A 1YD8U 2O6VD 2CKHB 2JZ3B 4WWOA 4URKA 2YLMA 4ICUA 3HM3A 2RR9A 4MGZE 2BGFA 3CSFA 4F8CB 2A5UA 4A3OA 4HLEA 4FHKA 1XQQA 2LZ6A 1RFAA 4NJ6A 2JUOA 3RD2A 3APCA 2G3QB 3N30A 1UGMA 1OEYA 2BWES 1ISNA 2FUHB 3U8ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1C3T A;  2KFJ A;  2GBK A;  4MM3 A;  2FCQ A;  3B0A A;  1V2Y A;  3QQ8 B;  4KDI C;  1WR1 A;  2MLB A;  3V6C B;  2IBI B;  2K8C A;  2K25 A;  4MH0 E;  3R7Q A;  4M8N A;  3RUI B;  3VAW A;  3APD A;  4W9K A;  2M17 A;  3A9K B;  2LI5 A;  2BPS A;  2LRU A;  2I1J A;  1UEL A;  1CMX B;  3MHS D;  2AL6 A;  3A4R A;  3MJW A;  4BKG A;  2DX5 B;  3ML8 A;  5AEK B;  2R2Q A;  2C7N B;  3JW0 X;  1X1M A;  4NPN A;  3ZIM A;  4MGI E;  3CST A;  4NY0 A;  3RYT A;  4OVU A;  2M4N A;  4CHK A;  2FCS A;  4CYE A;  2L05 A;  2V3S A;  2JRH A;  4IM2 A;  3W1S A;  1V9J A;  2LGD A;  3ZTD A;  1WMH A;  4BKT A;  3T8M A;  1P1A A;  2NR2 A;  1R4M I;  2YVC A;  3M63 B;  4W9C A;  5DPT A;  3WAP A;  2UWQ A;  3M62 B;  4N9F 4;  3AXC A;  2MSE D;  2B3A A;  2ZEQ A;  2OOB B;  4ICV A;  1EF5 A;  4E71 A;  4GMV A;  1KOT A;  1E7U A;  3NHE B;  3ZNZ B;  2MRP A;  4PS3 A;  3ONS A;  1WRD B;  3V61 A;  3VXW A;  1V80 A;  4GN1 A;  1WM3 A;  2LXC A;  3TCA A;  1WX8 A;  1SGH A;  5D94 A;  2N9P C;  3NY5 A;  3ECI A;  4K81 A;  2AYO B;  1WE7 A;  2FAZ A;  4RM9 A;  1G6J A;  2DAF A;  4MEL A;  2V4L A;  2M0X A;  1P9D U;  3ZNI D;  1AAR A;  3O65 B;  5C1Z A;  2ZNV B;  2NS5 A;  2LD9 A;  4WJP A;  3CMM B;  1WY8 A;  3PHW B;  5J2R A;  1VCB A;  1WX7 A;  2KX0 A;  5LXI B;  1LFD A;  2KFK B;  2O6V A;  3RT3 B;  1SE9 A;  2MBE A;  2ZPY A;  3Q3J A;  2L0F A;  3EHV A;  2KNB A;  3A1Q A;  3RZF A;  2KHW B;  2LGY A;  5LXH A;  1D3Z A;  2AEH A;  3ZVV A;  2EMT A;  4TQ0 A;  1E8W A;  2HJ8 A;  5HKH A;  2D07 B;  2N7D A;  3PRE A;  1Z5S B;  1R4N I;  1WXS A;  2D3G A;  3QIJ A;  3WA0 A;  4W9L A;  1ZW7 A;  2IO1 B;  3H9D A;  2KQS A;  2ZVO A;  2ZNV C;  4HWI B;  4F1S A;  2ZVN A;  3UIP B;  1Q1O A;  2LXA A;  3V60 A;  1V6E A;  2NCN A;  5DPS A;  1YJ1 A;  2CHW A;  3H6N A;  3KUD B;  1UZX B;  2KQ7 A;  2PEA A;  3QJZ A;  3SDL C;  4ANV A;  4ANX A;  3UQA A;  5DCN A;  3T9L A;  1Q0W B;  2PE6 B;  2N7E A;  4MJS A;  5CHV C;  4II2 B;  2C7M B;  2N9X A;  4ANU A;  5L95 C;  3QHT A;  1UD7 A;  3AI5 A;  1J19 A;  2DZK A;  1UH6 A;  2RPQ A;  4E74 A;  5AZH A;  3VDZ A;  3VUX A;  4JL9 A;  1RAX A;  1K8R B;  4II3 B;  2V1Y A;  1F9J A;  3QK0 A;  2R2O A;  1FXT B;  1RLF A;  2J0M A;  3IFW B;  4GGQ A;  2ASQ A;  4A3P A;  1EO6 A;  4B6W A;  4HVB A;  2O2V A;  2KMC A;  3L54 A;  3R3M A;  5D2M B;  4LJO B;  2BYF A;  3JSV A;  2J7Q B;  4K7U A;  2BWF A;  4EZK A;  4WQO B;  2MQJ A;  2CHZ A;  4AJY B;  3DOW A;  2XK5 B;  5E6P A;  3ENE A;  4FA6 A;  2FNJ B;  4MEM A;  2NVU I;  2NBU A;  3TBL D;  2KKC A;  2MCN B;  5CHW A;  4AOF A;  1XD3 B;  2OJR A;  3UF8 A;  4W9I A;  3LDZ E;  1V5O A;  4IUM B;  4OVV A;  1WXV A;  1WJU A;  2JWZ A;  1L2N A;  2HTH A;  2IY1 B;  2NBW B;  2C9W B;  4HJK A;  4KVG B;  3H7P B;  5GMV A;  2MP2 B;  3SHQ A;  5G55 A;  2KTF A;  2FCN A;  1P3Q U;  2HD5 B;  2KDF B;  1YIW A;  2KZR A;  2MX2 A;  3IG3 A;  5KHO A;  4MGK E;  4EZJ A;  2KK8 A;  5L83 A;  4RM8 A;  1GUA B;  4AUQ C;  2KDI A;  2L8J A;  4IC7 B;  4IW0 A;  3RCZ A;  2NPT B;  3WIM A;  4LCD E;  2WX0 A;  4DK5 A;  3KUZ A;  5EDS A;  2N1V A;  2KWV B;  4WJO A;  2IYD B;  4DBG A;  4GB9 A;  4WWN A;  2JXX A;  3PLV A;  2DHZ A;  4XX5 A;  3U30 A;  2G4D B;  1UBQ A;  5DPR A;  1E8X A;  3JYU A;  3Q3F A;  3UIO B;  3PS6 A;  3RUL A;  2DYM A;  3EEC A;  3A9K A;  2MW5 A;  3N32 A;  3PRZ A;  4FHJ A;  3AUL A;  3QWZ B;  4NNJ B;  5FR6 A;  3DBL I;  5CX3 A;  1J0G A;  5JHA A;  1V5T A;  3PVL A;  2GOW A;  4I6P A;  4TUU A;  4WJN A;  3H1U A;  2Z59 B;  1EUV B;  1WR6 E;  4NJ7 A;  3B08 A;  2LVQ A;  3UIN B;  3N3K B;  3DVN U;  2PJH A;  1M94 A;  3A4S C;  4DDG D;  3VHT C;  2IY0 B;  2LVP A;  5CHF A;  4IM0 A;  4A20 A;  1WX9 A;  1KJT A;  4W9D A;  2JPH A;  2MWS B;  3AU4 A;  2KAN A;  2UYZ B;  4X57 B;  1WGR A;  4GDK B;  2M1M A;  5BO4 B;  4J6I A;  3I3T B;  1GG3 A;  3EC8 A;  4CO7 A;  3D32 A;  5E6N A;  2KLC A;  2D2Q A;  4B9K A;  2KO3 A;  4GDL B;  4HPL B;  3DVG Y;  4XC2 A;  2LVO A;  4IWO A;  2DYO A;  3W1Y A;  3V6E B;  1IP9 A;  3DPD A;  1BT0 A;  1WGD A;  4HCN B;  4LJP B;  3EFU A;  4AWJ A;  3ZNH B;  2AWT A;  2HE7 A;  2L0T A;  4TV3 A;  5J18 A;  3WAN A;  1WM2 A;  1H4R A;  3PRM B;  3VQI A;  1GC7 A;  1V49 A;  2RGF A;  2L3Z A;  5D6J B;  4I6N B;  3DCG A;  1TTN A;  3LJ3 A;  2KWU B;  2FID A;  5JHB A;  3QAQ A;  2IO2 B;  2BYV E;  1L7Y A;  1OQY A;  2ZCB A;  3K9O B;  3PV1 A;  1JRU A;  1ZKH A;  1J8C A;  2KTR A;  2CU1 A;  2LAS A;  3A33 B;  4MGY E;  3L16 A;  3VH3 B;  5CTR C;  3QA8 A;  1GC6 A;  2Z0D B;  2REX A;  5LLI A;  3APF A;  4EKU A;  3DQV A;  4TKN A;  2ZPN A;  2D10 A;  1A5R A;  2LGX A;  3ZLZ A;  3VTU A;  2GMI C;  2KN5 A;  4PYU A;  2EKE C;  4KIK B;  4NAW B;  4GXB A;  4RMA A;  2G45 B;  3L17 A;  4K1R B;  1SIF A;  2K6D B;  3ML9 A;  5TR5 A;  4EFO A;  1E7V A;  2IZV B;  3BY4 B;  4KZC A;  3ZDT A;  4M8M A;  3HM6 X;  4HPM B;  1VD2 A;  2KJ6 A;  1YQB A;  1E5W A;  2AL3 A;  3NOB A;  4BKS D;  1YX5 B;  3OLM D;  3PTF C;  5D7G A;  4EOY A;  3QCA A;  2MBB B;  2ZZP B;  2MBH A;  3A9J B;  4EZL A;  2NBV B;  2DZJ A;  2RSU A;  4HDQ A;  4JLC A;  1GJZ A;  3PT2 B;  2MBQ A;  3L08 A;  3VUY A;  4F7Z A;  4BBN C;  2RD0 A;  2M8S A;  2LRW A;  2Z0E B;  3SU8 X;  1YX6 B;  1RRB A;  2WX1 A;  1UBI A;  1XT9 B;  2PE9 A;  1TBE A;  3M3J A;  4BOS C;  3QC8 B;  4B95 A;  2K8H A;  4LDT D;  4W9F A;  2O2V B;  1KM7 A;  1E90 A;  3MTN B;  3BIN A;  3IHP C;  4K7S A;  1NI2 A;  4P7I A;  4WJQ A;  2DEN B;  4KSK C;  4ZRJ A;  3U7D A;  3DDC B;  2GBR A;  4IWQ A;  1EF1 A;  3ZTC A;  3CF6 E;  4JQW C;  2XK5 A;  4WAA A;  3ZRF A;  4YL8 A;  2G4S A;  4E3C A;  4ZRK A;  2BYE A;  3PHX B;  4FN2 A;  2XEW A;  2PPH A;  2Y5B B;  4FJV B;  4MDK E;  3X23 A;  4DHZ E;  1OGW A;  4FBJ B;  3ZUN A;  4EUT A;  1TGZ B;  2ZCC A;  2L00 B;  3HIZ A;  4G50 A;  3M95 A;  2K6Q A;  3ALB A;  4GIV A;  2C5L C;  3VVW B;  3ZNG C;  3KVF B;  4HK2 A;  2WDT B;  3ZDM C;  3DVN V;  1IPG A;  1KLV A;  1WF9 A;  3H7P A;  2FCM A;  2KC1 A;  2MP2 A;  4PS7 A;  4W9J A;  1WE6 A;  1Z2M A;  2WWZ A;  1WGG A;  2KDE B;  4IG7 B;  4ZDV A;  2JT4 B;  2K1F A;  4ASW C;  1I42 A;  3R7R A;  1LXD A;  5JH5 C;  3L13 A;  2NPT A;  4FLH A;  4MSQ B;  1GNU A;  1WYW B;  2BKF A;  2JY6 A;  2L76 A;  1OEY J;  3TMP B;  5G2N A;  1WZ3 A;  1S1Q B;  3PSE B;  4PS8 A;  3PZD A;  4W9E A;  1IYF A;  2KJR A;  2LJ5 A;  3DBR I;  3IVF A;  3PRP B;  4K7W A;  4HDO A;  1WIA A;  4G11 A;  4TQ1 A;  1WMH B;  3IBE A;  3TJP A;  2VRR B;  3PPA A;  4FUL A;  5KHQ A;  2K8B A;  3S2A A;  2KLG A;  3AU5 A;  3WAM A;  4AP4 C;  5IA7 A;  2QHO A;  1P98 A;  4JIO U;  3ZO5 B;  2JRI B;  5AZF A;  2MA9 B;  3UQB A;  3VFK A;  2LUE A;  4HCP B;  2KXJ A;  1PQS A;  1I35 A;  1MG8 A;  3SD5 A;  3B1L X;  3OJ4 B;  2IO3 B;  2KJH B;  4M0W B;  2KWC A;  4IWP A;  4DDI D;  4G0N B;  3JVZ X;  1WFY A;  3OAW A;  3TL5 A;  4DHJ B;  4GSW A;  5E6O A;  1WGY A;  1P0R A;  4KSL C;  1T0Y A;  3W1S C;  5JZE B;  1TZ1 A;  4ZYN A;  3KYD D;  2I1K A;  2N1W A;  4GDK A;  2GBM A;  2XBB C;  2W9N A;  1E8Y A;  4GU2 A;  3X0W A;  3NZS A;  4KDL B;  5IAA C;  1V86 A;  1WI0 A;  3DBH I;  4I6L B;  2N4F A;  1E8Z A;  3OJ3 A;  4GDL A;  4BKS A;  2KMA A;  4LDT B;  5J17 A;  3C0R B;  2DZM A;  1WGH A;  2IO0 B;  1WXM A;  2N9E B;  1Y8R C;  3ZW3 A;  3VTV A;  1LM8 B;  1WXA A;  2BF8 B;  2KDB A;  4WWP A;  2K39 A;  3H7S A;  1WJN A;  1NDD A;  2O6V B;  1QZE A;  4G3X B;  4FJY A;  3A1Q B;  2DZI A;  3R66 C;  2KFK A;  3WAL A;  3PGE A;  2C7H A;  2J0K A;  3VTW A;  2D11 A;  2KTR B;  4W9H A;  1WZ0 A;  4FJZ A;  2KVR A;  4IM3 A;  3TIX A;  2JVC A;  5DPW A;  4PYZ A;  2CR5 A;  1C1Y B;  2WYQ A;  4DXA B;  3L10 B;  3L0W B;  2CS4 A;  4ANW A;  3GOE A;  3QAR A;  1Q5W B;  3ZRC A;  2J0J A;  3HHM A;  3WAO A;  1ZGU B;  3ZKJ C;  4AJW A;  3DVG X;  2ZJD A;  3GZN I;  2KOX A;  3KH0 A;  2DYB A;  3QX1 A;  1H8C A;  3HK0 A;  3KYC D;  3NS8 A;  4W9G A;  4KIK A;  4BOZ B;  4NAW A;  1WH3 A;  4MJS B;  1U4A A;  4NQK E;  4MSM B;  2FIF A;  1S3S G;  2KX3 A;  1LQB A;  2KD0 A;  4DWF A;  4NQL B;  4DHJ D;  4KV2 A;  3PLU A;  2LWP A;  3P2B A;  2A4Z A;  4JGH B;  1HE8 A;  2KC2 A;  3KUC B;  2JZZ A;  5AZG A;  2DAJ A;  1OTR B;  3RZW C;  3VUW A;  3V62 A;  4BFR A;  3KW5 B;  2GBJ A;  1WJ4 A;  4BVU C;  2CHX A;  4FAD A;  3VH4 B;  2BKR B;  4KZ0 A;  4ZRI A;  2JF5 A;  2GBN A;  3UGB B;  2MBO A;  3A9J A;  2EMS A;  3K9P B;  4HXD A;  2L7R A;  1NBF C;  3JSV B;  4EEW A;  3DBS A;  1WJ6 A;  4XZ4 A;  4DHZ B;  4GOC A;  1V81 A;  4BBN F;  2C60 A;  3NZU A;  5C23 A;  1YD8 U;  2O6V D;  2CKH B;  2JZ3 B;  4WWO A;  4URK A;  2YLM A;  4ICU A;  3HM3 A;  2RR9 A;  4MGZ E;  2BGF A;  3CSF A;  4F8C B;  2A5U A;  4A3O A;  4HLE A;  4FHK A;  1XQQ A;  2LZ6 A;  1RFA A;  4NJ6 A;  2JUO A;  3RD2 A;  3APC A;  2G3Q B;  3N30 A;  1UGM A;  1OEY A;  2BWE S;  1ISN A;  2FUH B;  3U8Z A; 
#chains in the Genus database with same CATH topology
 1V2Y A;  2X8X X;  1FO4 A;  4BZA A;  3V6C B;  3RNB C;  2K8C A;  4MH0 E;  4M8N A;  1ENF A;  3RUI B;  3APD A;  4W9K A;  3A9K B;  2LI5 A;  3C8Y A;  4ZYS A;  3P4P B;  3BVZ A;  3MJW A;  3NRZ A;  3DHG C;  5HG2 A;  1WXQ A;  1V8C A;  4NPN A;  4DXF A;  4CHK A;  2WXN A;  4YWG G;  5IKC M;  2V3S A;  4IM2 A;  3Q8F A;  3N1Y C;  2D3B A;  1WMH A;  1I4P A;  1NYR A;  3N1Z C;  1P1A A;  3M63 B;  5DPT A;  3NS1 A;  1EU4 A;  1SE4 A;  2L1A A;  2WGS A;  3AXC A;  4GMV A;  1E7P B;  3EFC A;  2MRP A;  1WRD B;  3TUO A;  2K22 A;  3Q3O C;  1SGH A;  2SAK A;  3NY5 A;  1M4V A;  3ECI A;  1I4X A;  4K81 A;  4MAC A;  1P9D U;  3ZNI D;  3O65 B;  3AED B;  5C1Z A;  3CMM B;  1XCT L;  3PHW B;  2KX0 A;  2RPV A;  2ON8 A;  2KFK B;  1N61 A;  2MBE A;  2ZPY A;  4XWW A;  2L0F A;  2KNB A;  4YTN B;  2EMT A;  1E8W A;  1EU3 A;  1Z5S B;  1ZUD 2;  4W9L A;  3TSS A;  2IO1 B;  1IUE A;  2ZNV C;  4F1S A;  2ZVN A;  2LXA A;  1V6E A;  3KUD B;  4ANX A;  5DCN A;  4S17 A;  2PE6 B;  2E3T A;  4LNO A;  2Z8L A;  2DZK A;  3H8H A;  1KRH A;  1ZDX A;  1FXT B;  1E6E B;  4A3P A;  4HVB A;  4KKI A;  2O2V A;  3R3M A;  4LJO B;  2BWF A;  1R7S A;  1FNV A;  4WQO B;  3B9J A;  2AQ1 B;  3DOW A;  2NBU A;  4AOF A;  2WNM A;  1XD3 B;  3LDZ E;  3BK1 A;  3AE6 B;  1WXV A;  4HJK A;  5EE3 A;  4OZA A;  2MP2 B;  4RF1 A;  5G55 A;  2FCN A;  5G5G A;  4MGK E;  4AS1 A;  2K0P A;  4IC7 B;  3U2S C;  4DK5 A;  2FUG 1;  2IYD B;  2WP9 B;  4WWN A;  2DHZ A;  1YN5 A;  3PS6 A;  3DWM A;  3I9V 1;  5G5H A;  3EEC A;  3A9K A;  1DGJ A;  1J0G A;  4KGT A;  1ZXH A;  2ACZ B;  2M56 B;  4I6P A;  4WJN A;  2Z59 B;  1YJI A;  1WR6 E;  3B08 A;  2XNA C;  2LVQ A;  3P4S B;  3DVN U;  3FAH A;  3I5J C;  4DDG D;  3VHT C;  1HQR D;  2PKO A;  4X57 B;  2BB5 A;  2QJL A;  4GDK B;  1YN4 A;  3B2F A;  1GG3 A;  3EC8 A;  4B9K A;  2LJI A;  5E6J A;  4GDL B;  4XC2 A;  2LVO A;  3W1Y A;  2WXF A;  1RM6 C;  3ZJV A;  3EFU A;  3WCQ A;  2AWT A;  2I38 A;  5J18 A;  3RNG C;  3AE1 B;  3R2I A;  3VR8 B;  3AE7 B;  4I6N B;  3DCG A;  1NEN B;  1PYW D;  2FID A;  3Q8A A;  2IO2 B;  3GE3 C;  3MC0 B;  2KTR A;  3A33 B;  5BMG A;  2J52 A;  4A90 A;  3VTU A;  3DHI C;  2KN5 A;  4C4V A;  3P63 A;  1WYG A;  2KT7 A;  4K1R B;  1SIF A;  3ML9 A;  2PVO D;  2IDY A;  3BY4 B;  4ACF A;  4N59 A;  5IO9 A;  4HPM B;  3HVD A;  2GRI A;  1YQB A;  4BKS D;  2INC C;  1YX5 B;  2ZZP B;  2MBH A;  3A9J B;  3L08 A;  4A9A A;  3SU8 X;  1GPX A;  4B95 A;  4LDT D;  1E90 A;  4K7S A;  3IHP C;  4P7I A;  4RH6 A;  2YEP F;  3U7D A;  3DDC B;  4IWQ A;  3RNA C;  2OJW A;  4JQW C;  3ZRF A;  4YL8 A;  4ZRK A;  2BYE A;  1UGJ A;  3PHX B;  4FJV B;  2INP E;  2PPH A;  3X23 A;  4DHZ E;  4FBJ B;  5BMH A;  1OGW A;  3ZUN A;  1GB4 A;  4EUT A;  4YTM B;  3ALB A;  3NVW A;  3DVN V;  1BXT A;  1KLV A;  2MP2 A;  4K3C A;  4W9J A;  3MFG A;  4JPS A;  1Z2M A;  2WWZ A;  1JWS D;  4IG7 B;  2Q5W D;  4ZDV A;  1L5P A;  2K1F A;  4FLH A;  2L76 A;  3TMP B;  1WZ3 A;  3OWE B;  1S1Q B;  1N6Z A;  3NVV A;  3DBR I;  4G11 A;  3Q8E A;  3IBE A;  3TJP A;  1R4M B;  3GE8 C;  3S2A A;  3AU5 A;  1ZXI A;  3ZGZ A;  1J7C A;  3U4E G;  1P98 A;  3ZO5 B;  5AZF A;  4JE3 B;  2MA9 B;  2LUE A;  3R2T A;  3B1L X;  2IO3 B;  2KJH B;  2KWC A;  4G0N B;  2H89 B;  4BAX A;  1I4R A;  3RFZ B;  1P0R A;  1T0Y A;  4YXD B;  5JZE B;  2I1K A;  2N1W A;  4GDK A;  2DNF A;  2GBM A;  2XBB C;  4KGR A;  4KDL B;  3DBH I;  2WDQ B;  1QIL A;  4GDL A;  3RN9 C;  4DXG A;  2N9E B;  1E9M A;  3LB8 C;  2N9K A;  4O1N A;  2ZW0 A;  3Q69 A;  2C7H A;  4IM3 A;  3TIX A;  5DPW A;  3TEX A;  3EGR A;  3W9C B;  4ANW A;  4LNK A;  3AH7 A;  2J0J A;  3WAO A;  1C76 A;  3ZKJ C;  4AJW A;  1VLB A;  3GZN I;  2JYE A;  3KH0 A;  2DYB A;  3QX1 A;  3HK0 A;  4W9G A;  4MJS B;  2HDE A;  4M02 A;  1S3S G;  2KX3 A;  1LQB A;  1MG4 A;  3P2B A;  4OZB A;  4JGH B;  1HE8 A;  3VRA B;  1LO5 D;  1D6E C;  3DWG C;  4ZHO A;  4FXC A;  4BFR A;  1ZOY B;  4FAD A;  3VH4 B;  1UWM A;  2WS3 B;  3A9J A;  4OVZ A;  4HXD A;  1IGD A;  1WJ6 A;  4BBN F;  2BS2 B;  4ARI A;  1YD8 U;  1YJJ A;  4L2Y A;  2HJ1 A;  4URK A;  4ICU A;  4ZRP A;  3Q2A C;  2RR9 A;  4MGZ E;  2MHJ A;  4P1B C;  2A5U A;  3RI7 C;  1SE2 A;  4NJ6 A;  2KYW A;  3RNE C;  3RD2 A;  2WXP A;  1UGM A;  1NEK B;  5GXG B;  3FIL B;  2FUH B;  3U8Z A;  1K53 A;  2W3S A;  3QQ8 B;  1V1P A;  4KDI C;  3AE5 B;  1WR1 A;  2MLB A;  2IBI B;  2K25 A;  2J4X A;  5JXV A;  5MPO A;  2UU7 A;  4YT0 B;  3VAW A;  2LUM A;  2M17 A;  2BPS A;  2QDF A;  1UEL A;  2CJN A;  1L0X B;  3A4R A;  2KWD A;  1FFU A;  5AEK B;  3JW0 X;  4D2K A;  2KMM A;  3ZIM A;  2FCS A;  2L05 A;  3W1S A;  1V9J A;  5AUI A;  2LGD A;  1TS5 A;  4BKT A;  3T8M A;  4XDD A;  2YVC A;  3WAP A;  4N58 A;  4ARC A;  2QCZ A;  3NHE B;  5BYR A;  3ZNZ B;  2HTM E;  4NZL B;  1AWD A;  3AV8 A;  3BVM A;  1WX8 A;  2KVZ A;  2N9P C;  3W2D A;  1WE7 A;  2FAZ A;  2DAF A;  2V4L A;  1WWT A;  1F2R C;  1I4G A;  2ZNV B;  2LD9 A;  1IGC A;  1VCB A;  5LXI B;  1MFW A;  3J9C A;  3AEA B;  2BS4 B;  2NTT A;  4C80 A;  5IN7 A;  1R4N I;  3QIJ A;  2WXG A;  4K3B A;  1YN3 A;  3WA0 A;  1Q10 A;  3U52 E;  2ZVO A;  4HWI B;  1LGR A;  3UIP B;  1Q1O A;  3ZJT A;  1FCC C;  1YJ1 A;  3H6N A;  3SDL C;  1UZX B;  3T9L A;  1Q0W B;  4MJS A;  5CHV C;  4LK0 M;  5L95 C;  3W5V B;  3QHT A;  3AI5 A;  2LHE A;  1UH6 A;  2RPQ A;  1MVK A;  5AZH A;  1RAX A;  1K8R B;  3SR6 A;  3QK0 A;  4XWT A;  1RLF A;  4GGQ A;  5H92 C;  2ASQ A;  3IXS A;  1XXG A;  3ABV B;  3L54 A;  4XE0 A;  2J7Q B;  4QAY A;  2CHZ A;  5E6P A;  4FA6 A;  2FNJ B;  2CJO A;  2MJ3 A;  5CHW A;  1FXA A;  2JWZ A;  3MP9 A;  1L0V B;  1JWM D;  1L2N A;  2HTH A;  3Q8B A;  5GMV A;  3H7P B;  2N0S B;  1SJE D;  2D5G A;  3SHQ A;  1P3Q U;  1CZP A;  2KK8 A;  4AUQ C;  1PGX A;  2KDI A;  3FIL A;  1TY2 A;  3WIM A;  4LCD E;  4JX1 C;  1FCL A;  1XLN A;  4GB9 A;  4YSY B;  2JXX A;  3PLV A;  1JRP A;  5DPR A;  1E8X A;  3ETR A;  3RUL A;  2DYM A;  2SEB D;  3PRZ A;  1N5X A;  2WXI A;  5JHA A;  1V5T A;  1XLP A;  3PVL A;  2GOW A;  3H1U A;  4L23 A;  1PFD A;  4NJ7 A;  2LGI A;  3AE8 B;  2PJH A;  2IY0 B;  3VR9 B;  2MWS B;  3AEE B;  2UYZ B;  2KQ4 X;  1KH0 A;  3I3T B;  2D2Q A;  2KO3 A;  1WGD A;  4LJP B;  5EE0 A;  3PRM B;  3VQI A;  3ZJU A;  2RGF A;  2L3Z A;  3ZXR A;  3LJ3 A;  2KWU B;  3QAQ A;  3AEG B;  2BYV E;  3MJ5 A;  3K9O B;  3PV1 A;  1ZKH A;  1J8C A;  2LAS A;  5C2T B;  1GC6 A;  5LLI A;  3DQV A;  5D3D A;  2ZPN A;  3CIR B;  1A5R A;  2EKE C;  1NI3 A;  2JQR B;  2G45 B;  1I4Q A;  5TR5 A;  2ONQ A;  2IZV B;  3BVG A;  1RWS A;  1UWX A;  1UUP A;  4M8M A;  4JWS C;  1XO3 A;  3HM6 X;  1JCK B;  4YTP B;  1KLU D;  1E5W A;  2GB1 A;  3QCA A;  2W54 A;  2RSU A;  1EWY C;  1GJZ A;  3PT2 B;  3NZ3 A;  1UF0 A;  2RD0 A;  2M8S A;  2Z0E B;  1RRB A;  1XT9 B;  4BOS C;  2K8H A;  4W9F A;  4WUR A;  2V3N A;  1K52 A;  1EF1 A;  2K5P A;  2G4S A;  4E3C A;  1C9F A;  3PZ8 A;  1TGZ B;  2L00 B;  1HXY D;  1OQQ A;  4GIV A;  3KVF B;  2WDT B;  3GP7 A;  3H7P A;  2KC1 A;  4PS7 A;  2Y5P A;  3ZQ4 A;  1WE6 A;  3RMK C;  2KDE B;  1KF6 B;  1K50 A;  4OHJ A;  4ASW C;  3MC8 A;  1GNU A;  1OEY J;  1HTQ A;  4PS8 A;  4W9E A;  4R3D A;  2KJR A;  4K7W A;  3IAS 1;  1F77 A;  3IVF A;  3PRP B;  4TQ1 A;  3PPA A;  3Q6B A;  4JIO U;  3UQB A;  3VFK A;  4HCP B;  4RF0 A;  1I35 A;  3PO0 A;  1TY0 A;  3SD5 A;  1XF5 L;  3OAW A;  2QSD A;  1JML A;  4GSW A;  3P4Q B;  5E6O A;  1WGY A;  1BUI C;  4ZYN A;  3KYD D;  5IAA C;  2KN4 A;  4WAF A;  4B0M A;  1E8Z A;  4HKZ E;  4BKS A;  2KMA A;  5J17 A;  2VZK D;  1F52 A;  2QC8 A;  4RCO A;  1D5X C;  3H7S A;  4PT5 A;  2BT6 A;  4G3X B;  4FJY A;  3UI3 A;  2KFK A;  3PGE A;  2J0K A;  4W9H A;  4FJZ A;  2CR5 A;  1JW9 D;  4DXA B;  3L10 B;  1VRA B;  1HA5 A;  3GOE A;  2KOX A;  1FXI A;  3HUI A;  3NS8 A;  4BOZ B;  1QF6 A;  4TMA B;  1WH3 A;  2KD0 A;  4DWF A;  3N9Y C;  3VRB B;  2A4Z A;  2KC2 A;  3KUC B;  3KW5 B;  4BVU C;  1T6B X;  4KZ0 A;  2MBO A;  2L7R A;  1NBF C;  3URY A;  4EEW A;  1TKE A;  3DBS A;  1CQV A;  5C23 A;  2O6V D;  2JZ3 B;  2YLM A;  2PVG C;  2GLS A;  4LTU A;  3N1X C;  4HLE A;  1WSP A;  2LZ6 A;  1L4D B;  5BYS A;  3HRD D;  1RFK A;  3N30 A;  1I7H A;  3B2G A;  2BWE S;  4US9 A;  1C3T A;  2KFJ A;  2FCQ A;  3MC9 A;  5EE9 A;  3R7Q A;  1AN8 A;  1DOX A;  2AQ2 B;  2I1J A;  5D3I B;  2WXJ A;  1CMX B;  2AL6 A;  3V05 A;  2R2Q A;  2C7N B;  2CU3 A;  3IT4 B;  4OW0 A;  3NVY A;  1X1M A;  1F0Z A;  4MGI E;  3CST A;  4NY0 A;  4OVU A;  2M4N A;  1ESF A;  1UNS A;  1FD6 A;  1SEB D;  4W9C A;  5FKA C;  1R4M I;  1FEH A;  2PTL A;  2UWQ A;  2PIA A;  4N9F 4;  4M01 A;  2XN9 C;  2OOB B;  1EF5 A;  1FNU A;  1E7U A;  3I63 C;  1N62 A;  1TZO A;  1VR9 A;  3V61 A;  3AN1 A;  1V80 A;  4GN1 A;  1TS3 A;  1WM3 A;  2LXC A;  1SB3 C;  2GI9 A;  4RM9 A;  1G6J A;  4MEL A;  1AAR A;  1VZ6 A;  2NS5 A;  4WJP A;  1WRI A;  2W55 A;  1WY8 A;  5J2R A;  1L4Z B;  2W82 A;  1GB1 A;  1WX7 A;  2Y5C A;  1Y56 A;  4J3O D;  3Q3J A;  5EE1 A;  1EWC A;  2LGY A;  4WIP A;  5LXH A;  1D3Z A;  2AEH A;  2LEK A;  3ZVV A;  4TQ0 A;  2N7D A;  3PRE A;  1WXS A;  2D3G A;  1QT9 A;  3L4P A;  2KQS A;  4M00 A;  1TJE A;  3V60 A;  3AEF B;  1ZE3 D;  2NCN A;  2KQ7 A;  1FM0 D;  2N7E A;  4II2 B;  2C7M B;  2N9X A;  4ANU A;  1J19 A;  4XGA B;  3VUX A;  4II3 B;  2EEL A;  2J0M A;  3IFW B;  4B6W A;  1P7E A;  3ZYY X;  5D2M B;  4EZK A;  2MQJ A;  4HRS A;  4MEM A;  5I4D A;  2KKC A;  1C79 A;  2B76 B;  2OJR A;  4A6Q A;  4IDI A;  4W9I A;  1V5O A;  4OVV A;  1E10 A;  1WJU A;  3AB5 A;  2C9W B;  4KVG B;  1FMA D;  3RPF C;  2KTF A;  2KZR A;  2KDF B;  2MEK A;  4EZJ A;  5L83 A;  4IW0 A;  1QLB B;  5EDS A;  2NPT B;  1QKZ A;  1TYG B;  4DBG A;  2KWV B;  1GOZ A;  3DBL B;  4WJO A;  1YQ4 B;  1AYF A;  3U30 A;  3LYY A;  1UBQ A;  3JYU A;  1KLG D;  2V0G A;  2G1E A;  2MW5 A;  3R8B A;  1IBX B;  4FHJ A;  5FR6 A;  3AE3 B;  1TS4 A;  3DBL I;  1C77 A;  3T3O A;  1T0Q C;  1EUV B;  1TS2 A;  4OZC A;  3UIN B;  3I57 A;  3N3K B;  2JSV X;  1M94 A;  1BML C;  5HI1 A;  2JZP A;  2LVP A;  5CHF A;  4A20 A;  1KJT A;  4W9D A;  2JPH A;  5BO4 B;  1FFV A;  4J6I A;  1GAQ B;  4CO7 A;  3D32 A;  5E6N A;  5H8Y E;  2KLC A;  1JRO A;  3NUH B;  2DYO A;  1FIQ A;  3V6E B;  3DPD A;  1BT0 A;  1OFF A;  2HE7 A;  2L0T A;  3SEB A;  3AE4 B;  2BW2 A;  1V49 A;  2BVC A;  1TTN A;  3KQ4 A;  1OQY A;  2ZCB A;  1JRU A;  4P16 A;  3VH3 B;  3L16 A;  5CTR C;  2REX A;  4TKN A;  2J53 A;  2BTE A;  2LGX A;  3AMZ A;  2IJ0 A;  2PW9 A;  4PYU A;  3T3N A;  2AX5 A;  1L6U A;  4GXB A;  4RMA A;  3IAM 1;  3L17 A;  2BS3 B;  4EFO A;  4XYC A;  3AEC B;  4C7Y A;  1QOA A;  1T0S C;  4WWM A;  2AL3 A;  3NOB A;  2WU5 B;  3OLM D;  3PTF C;  1V97 A;  5D7G A;  4EOY A;  2MBB B;  2I2Y A;  2ZW1 A;  1C78 A;  2MBQ A;  4BBN C;  2LRW A;  1YX6 B;  2WX1 A;  2Y3A A;  1UBI A;  2PE9 A;  1TBE A;  3NJT A;  2JYT A;  2O2V B;  2BQQ A;  1NI2 A;  2DEN B;  4KSK C;  2IGG A;  4ZRJ A;  3AE2 B;  2WXH A;  2GBR A;  3Q8C A;  3ZTC A;  3CF6 E;  4WAA A;  2G9H D;  4FN2 A;  2XEW A;  4LNN A;  4MM3 B;  2IPK D;  3HIZ A;  4US8 A;  3ZNG C;  2C5L C;  3VVW B;  4NJC A;  1N63 A;  3KWL A;  1IPG A;  1WF9 A;  2FCM A;  3N20 C;  2VZK B;  2L83 A;  1WGG A;  3E56 A;  4A55 A;  4ZRQ A;  3R7R A;  5JH5 C;  4MSQ B;  2NPT A;  1WYW B;  2BKF A;  1JQ4 A;  1EM7 A;  1AW7 A;  5G2N A;  2BYT A;  3FC4 A;  4HRO A;  3EA6 A;  1DOI A;  2VRR B;  4FUL A;  5KHQ A;  2K8B A;  1IBX A;  2H88 B;  1SSN A;  1CJE A;  1HTO A;  1XLQ A;  3BK2 A;  1PQS A;  3SFE B;  2WXL A;  2R61 A;  3OJ4 B;  1OQR A;  4DDI D;  4M0W B;  3TL5 A;  2JX5 A;  4RNA A;  4MT5 A;  1TZ1 A;  1NVI D;  3X0W A;  3NZS A;  1V86 A;  2N4F A;  4LDT B;  2DZM A;  1WXM A;  1Y8R C;  3VTV A;  1WXA A;  2BF8 B;  2WDV B;  1MPE A;  2KDB A;  4WWP A;  1C4C A;  1WJN A;  3KLS X;  2O6V B;  3RNC C;  3U7Z A;  1QZE A;  3A1Q B;  2DZI A;  1RYJ A;  4HJG E;  3WAL A;  2V4I B;  2KTR B;  1PGB A;  2D3A A;  1WZ0 A;  3TEY A;  1TT5 B;  2JVC A;  3O13 A;  4PYZ A;  1SJH D;  2WYQ A;  1MHX A;  1FRD A;  3L0W B;  1Q5W B;  2WQY B;  4C4V B;  1A70 A;  1H8C A;  3KYC D;  1U4A A;  4MSM B;  4NQL B;  4DHJ D;  3CWI A;  4KV2 A;  2JXT A;  4EE2 A;  4RGO S;  4CQN A;  2JZZ A;  2GBJ A;  1WJ4 A;  2CHX A;  2JF5 A;  2OHF A;  3K9P B;  3JSV B;  1SF0 A;  4XZ4 A;  4GOC A;  1V81 A;  2WLB A;  3NZU A;  3HM3 A;  3V3X A;  2BGF A;  3CSF A;  3BWU D;  4FHK A;  1XQQ A;  2KAJ A;  1RFA A;  3APC A;  3NG0 A;  1TIF A;  1OEY A;  2MH7 A;  2K3U A;  2PLP A;  2MJD A;  2GBK A;  2WHI A;  4MM3 A;  3B0A A;  2QEJ C;  2RMM A;  3Q3N C;  4JWU C;  5IOI A;  1L6V A;  2LRU A;  3MHS D;  4BKG A;  2DX5 B;  3ML8 A;  4WQM A;  1L0Y B;  3RYT A;  4CYE A;  2MJE A;  2JRH A;  3ZTD A;  4GLS C;  1ZDV A;  2NR2 A;  3BYY B;  2TSS A;  3E9S A;  1E0Z A;  3M62 B;  2MSE D;  2B3A A;  2ZEQ A;  4ICV A;  4E71 A;  1F1H A;  1KOT A;  4Q2J A;  2WXO A;  2ICI A;  4M0W A;  4PS3 A;  3ONS A;  4YSZ B;  3VXW A;  2IGD A;  3RNF C;  3TCA A;  2W3R A;  5D94 A;  4ZHP A;  4REZ A;  4NAM A;  2AYO B;  2DLB A;  2M0X A;  1K51 A;  4USA A;  1FRR A;  3GB1 A;  2JWU A;  4RGT A;  1NYQ A;  5FR3 A;  2WXM A;  1LFD A;  2O6V A;  3RT3 B;  1SE9 A;  1J7B A;  3EHV A;  4S0R A;  3A1Q A;  3RZF A;  2KHW B;  1D4B A;  2HJ8 A;  5HKH A;  2D07 B;  2VH1 A;  1T0R C;  1ZW7 A;  1XCQ L;  1CK1 A;  1N60 A;  4ITK A;  3H9D A;  4AQ7 A;  2YEP B;  1C4P A;  5DPS A;  2CHW A;  3QJZ A;  4ANV A;  2PEA A;  3BII D;  3UQA A;  4N6E B;  2DBY A;  2LHD A;  1UD7 A;  4E74 A;  1PDX A;  1SIJ A;  3VDZ A;  4JL9 A;  2V1Y A;  1F9J A;  4LNI A;  1V1O A;  2R2O A;  4IOI E;  3MHZ A;  1EO6 A;  1ROE A;  2KMC A;  3IT6 B;  3EUB 2;  3Q3M C;  2AQ3 B;  2BYF A;  3JSV A;  4K7U A;  1PGA A;  2XK5 B;  3ENE A;  2NVU I;  2LMC A;  3TBL D;  2MCN B;  4PK1 A;  3UF8 A;  4IUM B;  1YOV B;  1YQ3 B;  1SXT A;  2NBW B;  2IY1 B;  3FKY A;  4HKQ A;  1QOB A;  5KHO A;  2HD5 B;  2MX2 A;  1YIW A;  3IG3 A;  4RM8 A;  1GUA B;  3NVZ A;  1V1P B;  2L8J A;  3RCZ A;  2WX0 A;  3KUZ A;  2N1V A;  2FBW B;  2IGH A;  5AUK A;  3P4R B;  4XX5 A;  2G4D B;  2N9L A;  3DBR B;  3Q3F A;  3UIO B;  1HZ5 A;  3N32 A;  5FK9 C;  3TEW A;  4P6V F;  3AUL A;  3QWZ B;  4NNJ B;  5CX3 A;  1DYQ A;  3SFD B;  1C4A A;  4C00 A;  4TUU A;  4YSX B;  2WXQ A;  2X38 A;  2NMQ A;  2QMT A;  3AE9 B;  3A4S C;  4L1B A;  1HZ6 A;  1SE3 A;  4A8X C;  1P7F A;  4IM0 A;  1WX9 A;  3AU4 A;  2KAN A;  2QIL A;  1WGR A;  1VDV A;  2M1M A;  1VZ7 A;  3AM9 A;  3DBH B;  1F2R I;  1ZPS A;  3GS2 A;  4KKJ A;  4HPL B;  3DVG Y;  4IWO A;  1ZP0 B;  3KWV A;  1IP9 A;  1FPY A;  3LXF A;  4HCN B;  4IKG A;  1VJK A;  2V3P A;  4AWJ A;  3ZNH B;  2WXK A;  1QOG A;  2BB6 A;  4TV3 A;  3WAN A;  1WM2 A;  1H4R A;  4RGM A;  1GC7 A;  4MH8 A;  1TKG A;  5D6J B;  5JHB A;  2FE8 A;  1L7Y A;  1KFY B;  3BYT B;  2WU2 B;  2CU1 A;  4MGY E;  1I4H A;  4XDC A;  3QA8 A;  4TSS A;  2Z0D B;  1TKY A;  3P42 A;  3APF A;  4EKU A;  3GZN B;  2D10 A;  2J42 A;  3ZLZ A;  2GMI C;  2L52 A;  4KIK B;  4NAW B;  1T5X D;  2L32 A;  2K6D B;  5T8I A;  1E7V A;  4KX6 B;  4KZC A;  3ZDT A;  4KGS A;  4C7Z A;  5BMI A;  1B1Z A;  1VD2 A;  2KJ6 A;  1N5W A;  2DWQ A;  2RDB C;  1QQR A;  4EZL A;  2NBV B;  2DZJ A;  4HDQ A;  4JLC A;  2PMV A;  3VUY A;  4LLG M;  1ET6 A;  4F7Z A;  4HEA 1;  1FNW A;  3AEB B;  3M3J A;  3QC8 B;  1KM7 A;  4H2A A;  3MTN B;  3BIN A;  4WJQ A;  3ZXV A;  2XK5 A;  1JWB D;  1QOF A;  4MDK E;  2Y5B B;  5BYQ A;  5HFY A;  1YNT E;  2ZCC A;  4AJY B;  4G50 A;  3M95 A;  2K6Q A;  2LGS A;  1T3Q A;  2INN E;  3ZDM C;  4HK2 A;  2QIE B;  4RFB A;  2KAC A;  2KDM A;  2VH2 A;  2JT4 B;  1I42 A;  4HPP A;  1LXD A;  3L13 A;  2JY6 A;  1B9R A;  1STE A;  3PSE B;  1IYF A;  3PZD A;  2K9X A;  2LJ5 A;  4RGN A;  4HDO A;  1WIA A;  1WMH B;  2LFI A;  4AP4 C;  2KLG A;  3WAM A;  5IA7 A;  2QHO A;  4C56 C;  2RDG A;  2JRI B;  2IND C;  2KXJ A;  1MG8 A;  2E6X A;  2BBC A;  4IWP A;  3JVZ X;  1WFY A;  2V9H A;  2JU6 X;  4DHJ B;  5TSS A;  3W1S C;  4KSL C;  4WH4 A;  2W9N A;  1E8Y A;  4GU2 A;  1WI0 A;  1JWU D;  5LNK 1;  4I6L B;  3OJ3 A;  1VZ8 A;  1WGK A;  3C0R B;  1WGH A;  2IO0 B;  2WXR A;  3ZW3 A;  1LM8 B;  1MJD A;  2K39 A;  1ACC A;  1JWA D;  1NDD A;  3HVZ A;  3R66 C;  1ET9 A;  3VTW A;  2D11 A;  4ZOH C;  1R4N B;  1MHH E;  2KVR A;  1DOY A;  1C1Y B;  3Q14 C;  2EKI A;  2CS4 A;  3DHH C;  3QAR A;  3ZRC A;  3HHM A;  1ZGU B;  3DVG X;  2ZJD A;  3PZ7 A;  4KIK A;  2M19 A;  4NAW A;  2N7J A;  4NQK E;  2FIF A;  3PLU A;  2LWP A;  1XLO A;  1HEZ E;  1PUT A;  5HHD G;  5AZG A;  2D3C A;  1XEE A;  1SBB B;  2DAJ A;  1OTR B;  3RZW C;  3VUW A;  3V62 A;  5IP4 D;  2OED A;  1JAL A;  2BKR B;  4ZRI A;  4B0E A;  2GBN A;  3UGB B;  2EMS A;  4DQO C;  3BZD B;  2NTS A;  4DHZ B;  2RDH A;  2C60 A;  1KTK A;  4UDU C;  2CKH B;  1YMH E;  3TEZ A;  4WWO A;  2M0A A;  4F8C B;  4A3O A;  3P1M A;  3C19 A;  4P1C C;  1D5M C;  4LNF A;  2WDR B;  3OG5 A;  2JUO A;  2G3Q B;  1MI0 A;  5C3J B;  1ISN A;  1D5Z C;  3W5U B;  1J7A A; 
#chains in the Genus database with same CATH homology
 1C3T A;  2KFJ A;  2GBK A;  4MM3 A;  2FCQ A;  3B0A A;  1V2Y A;  3QQ8 B;  4KDI C;  1WR1 A;  2MLB A;  3V6C B;  2IBI B;  2K8C A;  2K25 A;  4MH0 E;  3R7Q A;  4M8N A;  3RUI B;  3VAW A;  3APD A;  4W9K A;  2M17 A;  3A9K B;  2LI5 A;  2BPS A;  2LRU A;  2I1J A;  1UEL A;  1CMX B;  3MHS D;  2AL6 A;  3A4R A;  3MJW A;  4BKG A;  2DX5 B;  3ML8 A;  5AEK B;  2R2Q A;  2C7N B;  3JW0 X;  1X1M A;  4NPN A;  3ZIM A;  4MGI E;  3CST A;  4NY0 A;  3RYT A;  4OVU A;  2M4N A;  4CHK A;  2FCS A;  4CYE A;  2L05 A;  2V3S A;  2JRH A;  4IM2 A;  3W1S A;  1V9J A;  2LGD A;  3ZTD A;  1WMH A;  4BKT A;  3T8M A;  1P1A A;  2NR2 A;  1R4M I;  2YVC A;  3M63 B;  4W9C A;  5DPT A;  3WAP A;  2UWQ A;  3M62 B;  4N9F 4;  3AXC A;  2MSE D;  2B3A A;  2ZEQ A;  2OOB B;  4ICV A;  1EF5 A;  4E71 A;  4GMV A;  1KOT A;  1E7U A;  3NHE B;  3ZNZ B;  2MRP A;  4PS3 A;  3ONS A;  1WRD B;  3V61 A;  3VXW A;  1V80 A;  4GN1 A;  1WM3 A;  2LXC A;  3TCA A;  1WX8 A;  1SGH A;  5D94 A;  2N9P C;  3NY5 A;  3ECI A;  4K81 A;  2AYO B;  1WE7 A;  2FAZ A;  4RM9 A;  1G6J A;  2DAF A;  4MEL A;  2V4L A;  2M0X A;  1P9D U;  3ZNI D;  1AAR A;  3O65 B;  5C1Z A;  2ZNV B;  2NS5 A;  2LD9 A;  4WJP A;  3CMM B;  1WY8 A;  3PHW B;  5J2R A;  1VCB A;  1WX7 A;  2KX0 A;  5LXI B;  1LFD A;  2KFK B;  2O6V A;  3RT3 B;  1SE9 A;  2MBE A;  2ZPY A;  3Q3J A;  2L0F A;  3EHV A;  2KNB A;  3A1Q A;  3RZF A;  2KHW B;  2LGY A;  5LXH A;  1D3Z A;  2AEH A;  3ZVV A;  2EMT A;  4TQ0 A;  1E8W A;  2HJ8 A;  5HKH A;  2D07 B;  2N7D A;  3PRE A;  1Z5S B;  1R4N I;  1WXS A;  2D3G A;  3QIJ A;  3WA0 A;  4W9L A;  1ZW7 A;  2IO1 B;  3H9D A;  2KQS A;  2ZVO A;  2ZNV C;  4HWI B;  4F1S A;  2ZVN A;  3UIP B;  1Q1O A;  2LXA A;  3V60 A;  1V6E A;  2NCN A;  5DPS A;  1YJ1 A;  2CHW A;  3H6N A;  3KUD B;  1UZX B;  2KQ7 A;  2PEA A;  3QJZ A;  3SDL C;  4ANV A;  4ANX A;  3UQA A;  5DCN A;  3T9L A;  1Q0W B;  2PE6 B;  2N7E A;  4MJS A;  5CHV C;  4II2 B;  2C7M B;  2N9X A;  4ANU A;  5L95 C;  3QHT A;  1UD7 A;  3AI5 A;  1J19 A;  2DZK A;  1UH6 A;  2RPQ A;  4E74 A;  5AZH A;  3VDZ A;  3VUX A;  4JL9 A;  1RAX A;  1K8R B;  4II3 B;  2V1Y A;  1F9J A;  3QK0 A;  2R2O A;  1FXT B;  1RLF A;  2J0M A;  3IFW B;  4GGQ A;  2ASQ A;  4A3P A;  1EO6 A;  4B6W A;  4HVB A;  2O2V A;  2KMC A;  3L54 A;  3R3M A;  5D2M B;  4LJO B;  2BYF A;  3JSV A;  2J7Q B;  4K7U A;  2BWF A;  4EZK A;  4WQO B;  2MQJ A;  2CHZ A;  4AJY B;  3DOW A;  2XK5 B;  5E6P A;  3ENE A;  4FA6 A;  2FNJ B;  4MEM A;  2NVU I;  2NBU A;  3TBL D;  2KKC A;  2MCN B;  5CHW A;  4AOF A;  1XD3 B;  2OJR A;  3UF8 A;  4W9I A;  3LDZ E;  1V5O A;  4IUM B;  4OVV A;  1WXV A;  1WJU A;  2JWZ A;  1L2N A;  2HTH A;  2IY1 B;  2NBW B;  2C9W B;  4HJK A;  4KVG B;  3H7P B;  5GMV A;  2MP2 B;  3SHQ A;  5G55 A;  2KTF A;  2FCN A;  1P3Q U;  2HD5 B;  2KDF B;  1YIW A;  2KZR A;  2MX2 A;  3IG3 A;  5KHO A;  4MGK E;  4EZJ A;  2KK8 A;  5L83 A;  4RM8 A;  1GUA B;  4AUQ C;  2KDI A;  2L8J A;  4IC7 B;  4IW0 A;  3RCZ A;  2NPT B;  3WIM A;  4LCD E;  2WX0 A;  4DK5 A;  3KUZ A;  5EDS A;  2N1V A;  2KWV B;  4WJO A;  2IYD B;  4DBG A;  4GB9 A;  4WWN A;  2JXX A;  3PLV A;  2DHZ A;  4XX5 A;  3U30 A;  2G4D B;  1UBQ A;  5DPR A;  1E8X A;  3JYU A;  3Q3F A;  3UIO B;  3PS6 A;  3RUL A;  2DYM A;  3EEC A;  3A9K A;  2MW5 A;  3N32 A;  3PRZ A;  4FHJ A;  3AUL A;  3QWZ B;  4NNJ B;  5FR6 A;  3DBL I;  5CX3 A;  1J0G A;  5JHA A;  1V5T A;  3PVL A;  2GOW A;  4I6P A;  4TUU A;  4WJN A;  3H1U A;  2Z59 B;  1EUV B;  1WR6 E;  4NJ7 A;  3B08 A;  2LVQ A;  3UIN B;  3N3K B;  3DVN U;  2PJH A;  1M94 A;  3A4S C;  4DDG D;  3VHT C;  2IY0 B;  2LVP A;  5CHF A;  4IM0 A;  4A20 A;  1WX9 A;  1KJT A;  4W9D A;  2JPH A;  2MWS B;  3AU4 A;  2KAN A;  2UYZ B;  4X57 B;  1WGR A;  4GDK B;  2M1M A;  5BO4 B;  4J6I A;  3I3T B;  1GG3 A;  3EC8 A;  4CO7 A;  3D32 A;  5E6N A;  2KLC A;  2D2Q A;  4B9K A;  2KO3 A;  4GDL B;  4HPL B;  3DVG Y;  4XC2 A;  2LVO A;  4IWO A;  2DYO A;  3W1Y A;  3V6E B;  1IP9 A;  3DPD A;  1BT0 A;  1WGD A;  4HCN B;  4LJP B;  3EFU A;  4AWJ A;  3ZNH B;  2AWT A;  2HE7 A;  2L0T A;  4TV3 A;  5J18 A;  3WAN A;  1WM2 A;  1H4R A;  3PRM B;  3VQI A;  1GC7 A;  1V49 A;  2RGF A;  2L3Z A;  5D6J B;  4I6N B;  3DCG A;  1TTN A;  3LJ3 A;  2KWU B;  2FID A;  5JHB A;  3QAQ A;  2IO2 B;  2BYV E;  1L7Y A;  1OQY A;  2ZCB A;  3K9O B;  3PV1 A;  1JRU A;  1ZKH A;  1J8C A;  2KTR A;  2CU1 A;  2LAS A;  3A33 B;  4MGY E;  3L16 A;  3VH3 B;  5CTR C;  3QA8 A;  1GC6 A;  2Z0D B;  2REX A;  5LLI A;  3APF A;  4EKU A;  3DQV A;  4TKN A;  2ZPN A;  2D10 A;  1A5R A;  2LGX A;  3ZLZ A;  3VTU A;  2GMI C;  2KN5 A;  4PYU A;  2EKE C;  4KIK B;  4NAW B;  4GXB A;  4RMA A;  2G45 B;  3L17 A;  4K1R B;  1SIF A;  2K6D B;  3ML9 A;  5TR5 A;  4EFO A;  1E7V A;  2IZV B;  3BY4 B;  4KZC A;  3ZDT A;  4M8M A;  3HM6 X;  4HPM B;  1VD2 A;  2KJ6 A;  1YQB A;  1E5W A;  2AL3 A;  3NOB A;  4BKS D;  1YX5 B;  3OLM D;  3PTF C;  5D7G A;  4EOY A;  3QCA A;  2MBB B;  2ZZP B;  2MBH A;  3A9J B;  4EZL A;  2NBV B;  2DZJ A;  2RSU A;  4HDQ A;  4JLC A;  1GJZ A;  3PT2 B;  2MBQ A;  3L08 A;  3VUY A;  4F7Z A;  4BBN C;  2RD0 A;  2M8S A;  2LRW A;  2Z0E B;  3SU8 X;  1YX6 B;  1RRB A;  2WX1 A;  1UBI A;  1XT9 B;  2PE9 A;  1TBE A;  3M3J A;  4BOS C;  3QC8 B;  4B95 A;  2K8H A;  4LDT D;  4W9F A;  2O2V B;  1KM7 A;  1E90 A;  3MTN B;  3BIN A;  3IHP C;  4K7S A;  1NI2 A;  4P7I A;  4WJQ A;  2DEN B;  4KSK C;  4ZRJ A;  3U7D A;  3DDC B;  2GBR A;  4IWQ A;  1EF1 A;  3ZTC A;  3CF6 E;  4JQW C;  2XK5 A;  4WAA A;  3ZRF A;  4YL8 A;  2G4S A;  4E3C A;  4ZRK A;  2BYE A;  3PHX B;  4FN2 A;  2XEW A;  2PPH A;  2Y5B B;  4FJV B;  4MDK E;  3X23 A;  4DHZ E;  1OGW A;  4FBJ B;  3ZUN A;  4EUT A;  1TGZ B;  2ZCC A;  2L00 B;  3HIZ A;  4G50 A;  3M95 A;  2K6Q A;  3ALB A;  4GIV A;  2C5L C;  3VVW B;  3ZNG C;  3KVF B;  4HK2 A;  2WDT B;  3ZDM C;  3DVN V;  1IPG A;  1KLV A;  1WF9 A;  3H7P A;  2FCM A;  2KC1 A;  2MP2 A;  4PS7 A;  4W9J A;  1WE6 A;  1Z2M A;  2WWZ A;  1WGG A;  2KDE B;  4IG7 B;  4ZDV A;  2JT4 B;  2K1F A;  4ASW C;  1I42 A;  3R7R A;  1LXD A;  5JH5 C;  3L13 A;  2NPT A;  4FLH A;  4MSQ B;  1GNU A;  1WYW B;  2BKF A;  2JY6 A;  2L76 A;  1OEY J;  3TMP B;  5G2N A;  1WZ3 A;  1S1Q B;  3PSE B;  4PS8 A;  3PZD A;  4W9E A;  1IYF A;  2KJR A;  2LJ5 A;  3DBR I;  3IVF A;  3PRP B;  4K7W A;  4HDO A;  1WIA A;  4G11 A;  4TQ1 A;  1WMH B;  3IBE A;  3TJP A;  2VRR B;  3PPA A;  4FUL A;  5KHQ A;  2K8B A;  3S2A A;  2KLG A;  3AU5 A;  3WAM A;  4AP4 C;  5IA7 A;  2QHO A;  1P98 A;  4JIO U;  3ZO5 B;  2JRI B;  5AZF A;  2MA9 B;  3UQB A;  3VFK A;  2LUE A;  4HCP B;  2KXJ A;  1PQS A;  1I35 A;  1MG8 A;  3SD5 A;  3B1L X;  3OJ4 B;  2IO3 B;  2KJH B;  4M0W B;  2KWC A;  4IWP A;  4DDI D;  4G0N B;  3JVZ X;  1WFY A;  3OAW A;  3TL5 A;  4DHJ B;  4GSW A;  5E6O A;  1WGY A;  1P0R A;  4KSL C;  1T0Y A;  3W1S C;  5JZE B;  1TZ1 A;  4ZYN A;  3KYD D;  2I1K A;  2N1W A;  4GDK A;  2GBM A;  2XBB C;  2W9N A;  1E8Y A;  4GU2 A;  3X0W A;  3NZS A;  4KDL B;  5IAA C;  1V86 A;  1WI0 A;  3DBH I;  4I6L B;  2N4F A;  1E8Z A;  3OJ3 A;  4GDL A;  4BKS A;  2KMA A;  4LDT B;  5J17 A;  3C0R B;  2DZM A;  1WGH A;  2IO0 B;  1WXM A;  2N9E B;  1Y8R C;  3ZW3 A;  3VTV A;  1LM8 B;  1WXA A;  2BF8 B;  2KDB A;  4WWP A;  2K39 A;  3H7S A;  1WJN A;  1NDD A;  2O6V B;  1QZE A;  4G3X B;  4FJY A;  3A1Q B;  2DZI A;  3R66 C;  2KFK A;  3WAL A;  3PGE A;  2C7H A;  2J0K A;  3VTW A;  2D11 A;  2KTR B;  4W9H A;  1WZ0 A;  4FJZ A;  2KVR A;  4IM3 A;  3TIX A;  2JVC A;  5DPW A;  4PYZ A;  2CR5 A;  1C1Y B;  2WYQ A;  4DXA B;  3L10 B;  3L0W B;  2CS4 A;  4ANW A;  3GOE A;  3QAR A;  1Q5W B;  3ZRC A;  2J0J A;  3HHM A;  3WAO A;  1ZGU B;  3ZKJ C;  4AJW A;  3DVG X;  2ZJD A;  3GZN I;  2KOX A;  3KH0 A;  2DYB A;  3QX1 A;  1H8C A;  3HK0 A;  3KYC D;  3NS8 A;  4W9G A;  4KIK A;  4BOZ B;  4NAW A;  1WH3 A;  4MJS B;  1U4A A;  4NQK E;  4MSM B;  2FIF A;  1S3S G;  2KX3 A;  1LQB A;  2KD0 A;  4DWF A;  4NQL B;  4DHJ D;  4KV2 A;  3PLU A;  2LWP A;  3P2B A;  2A4Z A;  4JGH B;  1HE8 A;  2KC2 A;  3KUC B;  2JZZ A;  5AZG A;  2DAJ A;  1OTR B;  3RZW C;  3VUW A;  3V62 A;  4BFR A;  3KW5 B;  2GBJ A;  1WJ4 A;  4BVU C;  2CHX A;  4FAD A;  3VH4 B;  2BKR B;  4KZ0 A;  4ZRI A;  2JF5 A;  2GBN A;  3UGB B;  2MBO A;  3A9J A;  2EMS A;  3K9P B;  4HXD A;  2L7R A;  1NBF C;  3JSV B;  4EEW A;  3DBS A;  1WJ6 A;  4XZ4 A;  4DHZ B;  4GOC A;  1V81 A;  4BBN F;  2C60 A;  3NZU A;  5C23 A;  1YD8 U;  2O6V D;  2CKH B;  2JZ3 B;  4WWO A;  4URK A;  2YLM A;  4ICU A;  3HM3 A;  2RR9 A;  4MGZ E;  2BGF A;  3CSF A;  4F8C B;  2A5U A;  4A3O A;  4HLE A;  4FHK A;  1XQQ A;  2LZ6 A;  1RFA A;  4NJ6 A;  2JUO A;  3RD2 A;  3APC A;  2G3Q B;  3N30 A;  1UGM A;  1OEY A;  2BWE S;  1ISN A;  2FUH B;  3U8Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...