1VD2A

Solution structure of the pb1 domain of pkciota
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
89
structure length
89
Chain Sequence
GPLGSQVRVKAYYRGDIMITHFEPSISFEGLCNEVRDMCSFDNEQLFTMKWIDEEGDPCTVSSQLELEEAFRLYELNKDSELLIHVFPC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein kinase C, iota type
publication title Solution structure of atypical protein kinase C PB1 domain and its mode of interaction with ZIP/p62 and MEK5
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 12
structure length 89
sequence length 89
ec nomenclature ec 2.7.11.13: Protein kinase C.
pdb deposition date 2004-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00564 PB1 PB1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1vd2A00
3PZDA 2LXAA 1Z2MA 2RD0A 3AU5A 3ML9A 2K6QA 2FIFA 4M8MA 1F9JA 3LDZE 3WAMA 1WGGA 3RYTA 3RZFA 2ZEQA 3MJWA 3ZTCA 3NZUA 4NQKE 3WIMA 2NS5A 3UGBB 2QHOA 1X1MA 4ZRKA 3UF8A 3TCAA 1J19A 3KUDB 3PT2B 4HK2A 3KW5B 3ZNZB 2KD0A 2LGDA 1TGZB 4W9FA 3PLUA 2KK8A 5JHBA 2FCSA 4MH0E 3VVWB 2YVCA 2PJHA 2BWFA 2K6DB 4ANVA 3OAWA 3ZVVA 1RLFA 2MA9B 2RPQA 4GDLA 4K7UA 3AI5A 1L2NA 2DX5B 2XEWA 4PS3A 2V4LA 4W9JA 4A3OA 4E74A 4AOFA 4LCDE 3DBSA 3ZTDA 1U4AA 4IWPA 2BPSA 1V6EA 2N1WA 3APFA 2K1FA 3N32A 2G3QB 3D32A 1AARA 3CMMB 2BYVE 3AULA 5E6NA 4G0NB 5CHVC 3HIZA 3A4SC 3L0WB 2HTHA 2KFKA 3DVGY 4RMAA 3VH4B 3WANA 1WX9A 2KC1A 5C1ZA 1BT0A 4AP4C 4BOZB 1PQSA 2J7QB 5JZEB 3TIXA 4BKTA 2BF8B 3M95A 4II2B 4ICVA 1RAXA 4AUQC 1ISNA 3BINA 4WJQA 1EF5A 2I1KA 1NDDA 3V61A 1YQBA 2JPHA 3KUCB 3QC8B 1OEYA 3CF6E 1GJZA 5J2RA 2R2OA 2KFJA 5HKHA 5KHOA 1V81A 3N30A 2IO0B 2KMCA 1OGWA 3VQIA 4MJSA 2WDTB 5FR6A 5GMVA 3QJZA 5C23A 3QAQA 2GBMA 5IA7A 4E71A 4W9GA 5D2MB 1XD3B 3VFKA 3PTFC 2DZIA 5D94A 1MG8A 2N4FA 1GC6A 4EZLA 3QHTA 3NY5A 3PHWB 1WI0A 2M8SA 2BKRB 3KYCD 3IFWB 2L05A 4KSKC 5E6PA 4MGZE 3R7RA 1JRUA 3SDLC 1FXTB 3TL5A 2JF5A 1WMHA 2MBOA 4KDIC 1EF1A 3UINB 2K8HA 4K7WA 2IY1B 2N9PC 4YL8A 1E8YA 3DVGX 2IYDB 4EEWA 3ALBA 4ZRJA 1P3QU 3EFUA 4B95A 3BY4B 4BBNF 3P2BA 3L10B 2DENB 1GC7A 3ZDTA 3M63B 3M62B 4IWOA 4TV3A 3ZNHB 4EFOA 1Y8RC 2JVCA 3U30A 1WXMA 4XZ4A 4FJVB 1WE7A 2NBUA 3RD2A 3S2AA 3ZDMC 2KXJA 1WE6A 2XBBC 2CHZA 1WJ6A 4JL9A 5DPRA 4G50A 5LLIA 3DCGA 3CSTA 4MSQB 2KWUB 3W1SC 2KKCA 3PSEB 2AEHA 2G4DB 3L16A 1V5TA 3ZNID 4ZRIA 3WALA 4AJYB 3KYDD 3GZNI 1G6JA 4F1SA 3UIPB 1OQYA 1UH6A 3HM3A 2FNJB 3O65B 3JVZX 1WX8A 3WAOA 3ZRFA 1KOTA 3PVLA 1Q0WB 2IZVB 3KH0A 3IG3A 3QIJA 3Q3JA 3W1SA 1C1YB 1YD8U 4GB9A 3X0WA 4ANWA 1S3SG 2MQJA 1V9JA 1WZ3A 1E8ZA 3B1LX 2R2QA 2N7EA 4HDQA 2WWZA 1SGHA 2MWSB 1WH3A 4EZJA 2KJRA 1V2YA 1I42A 3R7QA 2Z0DB 3PREA 2JY6A 3H9DA 3NS8A 4A20A 3R66C 1V86A 2KJ6A 4GDKB 5AZHA 2FCNA 4I6PA 4JGHB 4W9IA 4NQLB 4IG7B 1WJUA 4ANXA 3LJ3A 2KNBA 2D3GA 1UGMA 3QARA 4XX5A 2JUOA 2KWVB 3A9JB 3WAPA 2IO1B 2K25A 2MW5A 4W9DA 4DDID 5D6JB 2DYOA 3VUYA 3OJ3A 2DAFA 2PPHA 3A1QB 2KOXA 4ANUA 2KTFA 2AL6A 4HDOA 2MBEA 3PRPB 4K1RB 2K8CA 2Y5BB 3VH3B 5BO4B 3H7PB 4LDTD 1D3ZA 1Q1OA 4JIOU 2LJ5A 1WXVA 1QZEA 2MP2B 1WJNA 3SHQA 2KWCA 5CHWA 2FCQA 5CX3A 4HLEA 1RFAA 4CYEA 1UBIA 1WXAA 2CHXA 2RR9A 5LXHA 4DHZB 3A33B 1WIAA 4IWQA 4DWFA 3VXWA 1YX5B 3B0AA 2L0FA 4K81A 2L8JA 4OVUA 3V60A 2NCNA 1TZ1A 2C60A 4ZYNA 1SE9A 4TQ1A 1E8WA 1WM2A 2MRPA 5DPSA 2W9NA 2ZNVB 3H6NA 1WGDA 5LXIB 1SIFA 2EMSA 1M94A 2JRIB 4GN1A 3PRMB 4DDGD 2JXXA 3ECIA 2DHZA 3A9KB 1J0GA 1RRBA 1WGRA 5E6OA 2BWES 3JSVB 3L13A 2GBRA 1XQQA 1LXDA 4FBJB 1YX6B 3SD5A 1V80A 4HPMB 1R4MI 2KC2A 4FHJA 3PPAA 5L83A 4NY0A 3CSFA 4DHJB 2CU1A 1UD7A 2ASQA 3IHPC 1LQBA 4ICUA 3ZNGC 2FUHB 3DOWA 4FJYA 3ZKJC 4FHKA 5G2NA 2L3ZA 3PGEA 4J6IA 3DBRI 4WAAA 2C7MB 2NPTB 5DPTA 4W9CA 2DZKA 4PYUA 4MGKE 1CMXB 1P98A 3VHTC 4W9EA 4BKGA 3V62A 3DBLI 3PRZA 2LVPA 5D7GA 1EO6A 1WZ0A 2KLCA 4ZDVA 4IM2A 3ZLZA 3MTNB 4W9HA 4GU2A 5CTRC 1E8XA 3DQVA 2LWPA 3NOBA 2BYEA 5J17A 2BGFA 2V3SA 2XK5B 3JW0X 4HWIB 4M0WB 2ZPNA 2JZZA 2K39A 4RM8A 2D2QA 4NNJB 4CHKA 5AZGA 2LZ6A 4CO7A 1Q5WB 4DK5A 2KDEB 1R4NI 3L17A 4MEMA 2GMIC 4EOYA 1P9DU 4IM3A 1P0RA 1LFDA 2MCNB 2UWQA 4FULA 3PHXB 2ZCCA 2HE7A 4WJPA 1NBFC 4A3PA 5CHFA 4BBNC 3WA0A 4LJOB 3ONSA 4MGYE 3C0RB 4P7IA 4GDKA 2KLGA 2LGXA 2ZVOA 5IAAC 3VDZA 2ZZPB 4W9KA 3QQ8B 2NBVB 1GNUA 5EDSA 2DAJA 1WJ4A 2LI5A 3A9JA 2GBNA 2L00B 4DXAB 1H8CA 1ZGUB 4KZ0A 3DBHI 4HVBA 2O6VB 4B6WA 4BOSC 3M3JA 1WXSA 3A1QA 1KLVA 1NI2A 1E5WA 4NAWB 2NVUI 3RUIB 3T9LA 1V49A 4GGQA 5JH5C 2AWTA 2A5UA 2WYQA 4E3CA 3OLMD 2A4ZA 2LASA 4FLHA 1S1QB 3QA8A 3K9OB 3H7PA 2NR2A 4NPNA 3RULA 2M17A 3QWZB 2MP2A 2LRWA 3ZRCA 2HD5B 3PS6A 2KDIA 2FCMA 1KJTA 3VTUA 1P1AA 2D11A 2IO3B 3ZUNA 1XT9B 4KZCA 3UQAA 3H7SA 2C7HA 2BKFA 3AU4A 4KIKB 2N1VA 2ZNVC 3OJ4B 3NZSA 4F7ZA 4BKSA 5L95C 3DVNU 1EUVB 4DBGA 4DHZE 5J18A 3RCZA 3UQBA 2KN5A 3ZW3A 2V1YA 4JQWC 2CR5A 2IO2B 2M1MA 2LUEA 3DVNV 1WM3A 1OEYJ 2KX0A 2N9EB 4FN2A 2KTRB 2JT4B 3K9PB 3QX1A 4HCNB 4AJWA 2RSUA 3A9KA 1E90A 2GBJA 1YIWA 1E7VA 3JSVA 2J0MA 1WRDB 2L7RA 2DZJA 2KQSA 4FADA 3DPDA 2CHWA 3QK0A 4FA6A 1A5RA 2C9WB 4BKSD 2O2VB 4TKNA 4WWPA 4EKUA 2JZ3B 2DZMA 1UELA 4MDKE 4NJ6A 4MGIE 1V5OA 2ZVNA 3HK0A 4FJZA 3X23A 1I35A 2Z0EB 2DYMA 4GMVA 1IP9A 3APDA 4GXBA 4LDTB 4MM3A 2NPTA 1WY8A 3PV1A 3EECA 2MX2A 1WR6E 3H1UA 4GIVA 3V6CB 3MHSD 4B9KA 1WGHA 1E7UA 1HE8A 2MBHA 2KQ7A 3RT3B 4WJNA 1IPGA 2PE6B 2LVOA 2KX3A 2KANA 2Z59B 2LVQA 2FAZA 2YLMA 4HPLB 2LD9A 1WFYA 2KJHB 4RM9A 5TR5A 2LGYA 2FIDA 5AZFA 3ZIMA 4DHJD 1C3TA 2ZJDA 3RZWC 2WX0A 4XC2A 1IYFA 2KMAA 1GG3A 2XK5A 2J0JA 3ENEA 3NHEB 4PS8A 3TBLD 5JHAA 2PE9A 4G11A 4OVVA 2D10A 2MSED 2CKHB 4GDLB 3APCA 2EMTA 2NBWB 4JLCA 4W9LA 3VTWA 4I6NB 4WJOA 2ZPYA 3JYUA 2RGFA 3GOEA 4PS7A 1TTNA 2G45B 4ASWC 4BVUC 1ZKHA 2MBBB 2N7DA 1VD2A 2KDBA 1Z5SB 4GOCA 5KHQA 2REXA 4WWOA 3SU8X 4HCPB 4URKA 2J0KA 3VTVA 5DCNA 4N9F4 1OTRB 2KO3A 2KVRA 1ZW7A 4M8NA 2K8BA 3KUZA 2AYOB 3L54A 2D07B 2G4SA 2KHWB 2DYBA 4II3B 4X57B 4HXDA 2L0TA 4KDLB 4TUUA 4KVGB 2KFKB 3PLVA 1YJ1A 2BYFA 2VRRB 1J8CA 4IC7B 3A4RA 2HJ8A 2L76A 3IBEA 1UZXB 1VCBA 4WQOB 2O6VA 1WYWB 2KZRA 1TBEA 1K8RB 3T8MA 4NAWA 2EKEC 3EC8A 3VUXA 3ZO5B 4WWNA 3Q3FA 2CS4A 3TJPA 3L08A 2C7NB 4EUTA 1GUAB 2OJRA 3AXCA 4NJ7A 3EHVA 3KVFB 4K7SA 3TMPB 2MLBA 4KSLC 2LXCA 4BFRA 1WX7A 3HM6X 4MJSB 4TQ0A 2JRHA 2AL3A 3ML8A 3DDCB 3VAWA 3VUWA 4KIKA 4AWJA 2M4NA 3UIOB 2GBKA 2GOWA 4IW0A 4MSMB 4PYZA 2O6VD 4F8CB 2M0XA 2ZCBA 2OOBB 1UBQA 3HHMA 3W1YA 2WX1A 3I3TB 2I1JA 2JWZA 5G55A 4G3XB 1L7YA 4IM0A 2LRUA 3U7DA 1LM8B 4EZKA 3U8ZA 3V6EB 3N3KB 4MELA 2KTRA 1WMHB 2PEAA 4LJPB 2IY0B 2MBQA 3IVFA 1WR1A 1T0YA 5AEKB 4I6LB 2N9XA 2C5LC 1WGYA 4HJKA 3R3MA 4KV2A 3QCAA 4GSWA 1KM7A 1WF9A 5DPWA 2B3AA 3B08A 2O2VA 4IUMB 2IBIB 1H4RA 2UYZB 2KDFB
chains in the Genus database with same CATH superfamily
1ZDVA 4KKJA 2RD0A 3LDZE 3WAMA 3RZFA 1CK1A 1QOBA 2J53A 4ITKA 3UGBB 3AEAB 3Q8EA 3UF8A 2LFIA 1J19A 4LLGM 1TS3A 2KD0A 1WXQA 5AUKA 5JXVA 4HROA 3VVWB 2PJHA 3W5UB 2K6DB 3OAWA 2N9LA 2XEWA 4PS3A 4W9JA 4LCDE 3ZTDA 2LGSA 1FMAD 2BPSA 2N1WA 1GB1A 1AARA 1I4XA 3CMMB 2KFKA 4RMAA 3PZ7A 5C1ZA 1BT0A 2WDQB 3TIXA 3M95A 3Q3MC 1YQBA 3BVMA 3KUCB 1ZOYB 2KFJA 4P1BC 4KGRA 3VQIA 3QAQA 1OQQA 4E71A 4C7YA 5D2MB 2QILA 3N1ZC 1T6BX 2N4FA 1GC6A 4DXFA 3NY5A 5MPOA 3TEXA 4KSKC 3R7RA 4A8XC 2JYEA 3SDLC 3RN9C 2JF5A 1EF1A 3UINB 3AN1A 1L4DB 1E8YA 4C7ZA 1MFWA 4ZRJA 3EFUA 4B95A 3GS2A 4BBNF 2DENB 3ZNHB 2CU3A 2LMCA 3RD2A 2CJOA 1WJ6A 1WRIA 4MSQB 1F0ZA 3PSEB 3L16A 1V5TA 4AJYB 3KYDD 1G6JA 3CWIA 3O65B 1QF6A 1WX8A 5BMIA 2HJ1A 3ZJTA 3Q3JA 1C1YB 5FK9C 2N7EA 1SGHA 3Q2AC 4EZJA 5IN7A 1V2YA 3R7QA 3N1YC 3PREA 2JY6A 2WXGA 3R66C 4I6PA 4OHJA 1WJUA 5TSSA 2KNBA 1UGMA 3Q6BA 4HEA1 2KWVB 3A9JB 2K25A 5D6JB 1YOVB 3OJ3A 2PPHA 2Q5WD 2MBEA 2VH2A 4N6EB 4CQNA 1D3ZA 4LDTD 1Q1OA 1QZEA 5BYRA 1WJNA 4XDCA 3U52E 4RGOS 1JWSD 3B9JA 2W82A 3B0AA 2L0FA 3V60A 1ACCA 4ZYNA 1I4QA 1SE9A 2MRPA 3MHZA 2W9NA 2ZNVB 3H6NA 2BYTA 1FM0D 2V0GA 1J0GA 3AEBB 5E6OA 3L13A 1XQQA 1SBBB 2ONQA 1YX6B 3SD5A 1AWDA 1V80A 2KVZA 1IBXB 5L83A 2NTSA 3CSFA 1TT5B 2WLBA 4DHJB 3I9V1 1YN3A 1C79A 5C3JB 2QC8A 1N61A 1P7FA 1MPEA 1OQRA 2C7MB 3IT4B 1YJJA 5BMHA 3PRZA 2WDRB 1CQVA 1TS4A 4IM2A 3DWMA 1J7AA 1E8XA 1VZ7A 2KWDA 3DQVA 2BYEA 2V3SA 3AEEB 1MHXA 2V3NA 2K39A 4RM8A 4CHKA 5AZGA 3AE9B 2KDEB 4REZA 2GMIC 1P0RA 2MCNB 2UWQA 1NEKB 2ZCCA 1SEBD 3ONSA 2ICIA 2LGXA 2ZVOA 1ZXHA 2ZZPB 1K50A 1L0YB 1YJIA 2NBVB 3U2SC 4WURA 3ZJUA 2K9XA 2LI5A 2L00B 1ZGUB 4KZ0A 4UDUC 2O6VB 4B6WA 4BOSC 3RUIB 2GI9A 2NVUI 3T9LA 4GGQA 3AECB 2WYQA 4E3CA 2A4ZA 2LASA 1BMLC 4NPNA 3FKYA 3DHGC 2KDIA 3VTUA 1P1AA 1ENFA 2IO3B 1XT9B 3UQAA 2C7HA 4KIKB 5L95C 3DVNU 4DBGA 1EWCA 4KGSA 3ZW3A 2M1MA 2KX0A 3U4EG 3MP9A 2TSSA 1JMLA 2N9EB 2KTRB 2LHDA 3AE7B 4A9AA 3A9KA 1PDXA 3SFDB 1YIWA 3JSVA 2KQSA 2CHWA 2WXQA 4S0RA 4FA6A 4EKUA 2DZMA 2ON8A 4NJ6A 5GXGB 4FJZA 2V4IB 3W2DA 3KLSX 4LDTB 4MM3A 3HUIA 4M01A 5IKCM 1XCTL 4B9KA 1E7UA 2KQ7A 3RT3B 2Y3AA 4IOIE 1STEA 2PE6B 4JE3B 2WXJA 2PIAA 2LEKA 2YLMA 1FRDA 2WDVB 1JW9D 5AZFA 1IYFA 2L52A 2XK5A 1BXTA 3ZJVA 4OVVA 1XEEA 4GDLB 2EMTA 4JLCA 5KHQA 2REXA 3SU8X 3RNGC 5DCNA 4M8NA 4MT5A 1ZW7A 4O1NA 3KUZA 2D07B 2NMQA 2B76B 1FXIA 2HTME 1WYWB 1FD6A 4JPSA 3BWUD 3TUOA 1M4VA 4NAWA 2KAJA 4WWNA 2C7NB 2N7JA 1JWAD 3AXCA 4HJGE 4MJSB 1AW7A 2AL3A 3DDCB 3VAWA 3IAS1 2M4NA 2GBKA 4IW0A 2ZCBA 2OOBB 5H8YE 3W1YA 2WX1A 3P63A 1DOYA 5G55A 2QDFA 2XN9C 4EZKA 1LM8B 1MI0A 1FRRA 3U8ZA 3N3KB 1E10A 2PEAA 3DBLB 2WXKA 1E6EB 3QCAA 4GSWA 1KM7A 5DPWA 3TEZA 1UWXA 3MJ5A 3ML9A 4M8MA 1WGGA 2ZEQA 3MJWA 1DOIA 1BUIC 2NS5A 3VRAB 1TKEA 2WQYB 3TCAA 3RNAC 4ZYSA 4LNNA 5JHBA 2FCSA 4MH0E 1MHHE 2FBWB 2RPQA 2KT7A 2N0SB 1RFKA 1JRPA 2FUG1 2PMVA 2V4LA 4HRSA 4E74A 4AOFA 4IWPA 1TZOA 3BVZA 3N32A 3D32A 2WXRA 1NENB 4G0NB 5CHVC 3HIZA 2WXOA 3VH4B 4BOZB 1PQSA 5JZEB 2VZKD 2JQRB 2LUMA 4WJQA 1EF5A 2EKIA 2JPHA 3QC8B 1OEYA 1P7EA 5KHOA 1D6EC 2IO0B 2KMCA 1OGWA 5E6JA 5C23A 5GMVA 3QJZA 3P4RB 4D2KA 1XD3B 3NVYA 1V1PA 4LNKA 2DZIA 3KQ4A 4P16A 3O13A 4EZLA 5T8IA 4L23A 3V3XA 3PHWB 1WI0A 3KYCD 2BKRB 3HVZA 2L05A 4JWUC 1JRUA 3PO0A 1FXTB 2JSVX 3ZXVA 1WMHA 1GPXA 1RWSA 4KDIC 3N9YC 1C76A 2IY1B 3Q8BA 1F1HA 2Y5CA 3DVGX 4B0MA 4K3BA 4RF0A 2J42A 3W9CB 1YMHE 3L10B 3ZDTA 3M63B 1WE7A 3ZDMC 2BS3B 1WE6A 3W5VB 2CHZA 4G50A 3DCGA 2L1AA 3MC0B 4YSYB 3W1SC 2AEHA 2X38A 2EELA 4C4VB 1UH6A 1I4PA 4S17A 1KOTA 2L32A 3KH0A 3IG3A 3QIJA 3W1SA 1YD8U 4GB9A 1C4AA 2JXTA 2MQJA 1UF0A 1V9JA 1ET6A 4HDQA 1WH3A 1I42A 2KJRA 2Z0DB 5EE9A 5G5HA 4USAA 1KLUD 1RM6C 1R4NB 3HRDD 1CJEA 4IG7B 4YTMB 4HPPA 3NJTA 2D3GA 3VUYA 2AL6A 4K1RB 2Y5BB 3AEDB 3VH3B 2FE8A 2IGHA 1WXVA 3SHQA 2WXIA 2FCQA 4XWWA 4HLEA 1VZ8A 2RR9A 1AYFA 1L6UA 2J4XA 1YX5B 1F2RI 3FILA 2NCNA 1XLNA 1EU4A 3GE8C 4TQ1A 1E8WA 2KACA 5DPSA 1SIFA 2EMSA 2JRIB 4ARIA 2GBRA 2JYTA 2KN4A 4BZAA 3P42A 2KC2A 3PPAA 4YSZB 1TYGB 2M0AA 1XO3A 3ZYYX 4B0EA 1UD7A 3IHPC 1LQBA 3ZNGC 1PGXA 3ZKJC 2IGGA 1WGKA 3OWEB 5DPTA 4W9CA 2PKOA 4PYUA 1CMXB 1LO5D 2RMMA 4NJCA 4W9EA 3RNFC 1XF5L 3HVDA 4WWMA 3ZLZA 4GU2A 5CTRC 5J17A 4M0WB 2JZZA 2D2QA 1NVID 1R4NI 1P9DU 1TIFA 4C80A 2HE7A 2DBYA 2RPVA 2WXMA 4WH4A 4OVZA 3C0RB 4P7IA 1Y56A 4GDKA 2OJWA 1IGCA 2AQ2B 1GNUA 5G5GA 2DAJA 4IKGA 1WJ4A 2IDYA 3I63C 1H8CA 5EE0A 3R8BA 3A1QA 1E5WA 1V49A 1KLGD 2AWTA 3OLMD 1S1QB 3H7PA 3QWZB 2MP2A 1Q10A 2HD5B 4RGNA 2FCMA 4KZCA 4TMAB 4BKSA 4DHZE 2KN5A 3BZDB 2LJIA 2DLBA 2LGIA 1N5XA 1J7CA 3VRBB 1E7PB 1FIQA 4C56C 2J0MA 2L7RA 2DZJA 4FXCA 3DPDA 2WU5B 3DWGC 4BKSD 2O2VB 5BYSA 2BW2A 2JZ3B 1YN4A 3FAHA 4MGIE 2ZVNA 2N9KA 2DYMA 2V3PA 2NPTA 3PV1A 2MX2A 1WR6E 2X8XX 3V6CB 1ESFA 2W54A 2MBHA 2RDBC 1EU3A 1YNTE 2KANA 4XE0A 2LVQA 2LD9A 1B9RA 4RM9A 3ZIMA 1C3TA 2ZJDA 2KMAA 1GG3A 4RGTA 2OEDA 4G11A 2GRIA 1TKYA 4W9LA 1SB3C 3B2FA 2RGFA 2G45B 4ASWC 2MBBB 2KDBA 1L0XB 1Z5SB 4URKA 3VTVA 1ZE3D 3AE1B 3EGRA 4N9F4 5I4DA 2K8BA 3B2GA 1PYWD 2G4SA 2KHWB 4X57B 1D5MC 4KDLB 2KFKB 3AH7A 1YJ1A 2BYFA 2VRRB 4IC7B 2L76A 1QOGA 1FNWA 4L2YA 2LHEA 3Q3FA 4L1BA 4EUTA 2JWUA 3Q69A 4NJ7A 1YQ3B 3AV8A 4R3DA 3KVFB 2XNAC 4K7SA 4KSLC 3P4QB 3E56A 1JALA 3Q8AA 1R4MB 4ZHPA 3DHHC 2V9HA 3HHMA 1UNSA 2JWZA 1L7YA 3U7DA 3DBRB 4AS1A 4MELA 3GE3C 1HA5A 4LJPB 2IY0B 1SE2A 1J7BA 1WR1A 3AE5B 1N63A 4BAXA 2N9XA 3R3MA 4KV2A 3KWVA 2INNE 1EWYC 3B08A 4JWSC 2Z8LA 2LXAA 3EFCA 2JU6X 3RYTA 3SFEB 3NZUA 3WIMA 2RDGA 4WIPA 3MFGA 1X1MA 1D5ZC 4ZRKA 5AUIA 3PT2B 4HK2A 1TY2A 3KW5B 2LGDA 1TGZB 3GZNB 3PLUA 1D4BA 1N6ZA 3H8HA 4YTPB 2WXNA 2BWFA 4ANVA 3ZVVA 1RLFA 4K7UA 3AI5A 2KQ4X 1L2NA 2YEPF 5H92C 4A3OA 1GB4A 3DBSA 1RYJA 1FFVA 1V6EA 3LXFA 2K1FA 2J52A 1F2RC 1FNVA 2MJEA 4OZCA 5EE3A 4K3CA 3TSSA 5E6NA 3A4SC 3T3OA 2HTHA 3DVGY 4DXGA 2IGDA 1D5XC 2KC1A 4NZLB 4AP4C 2QMTA 1NYQA 1SE3A 4ZRPA 4BKTA 2BF8B 4ICVA 1VR9A 1QILA 3BINA 1HTQA 3V61A 2MH7A 3CF6E 2R2OA 5HKHA 1E9MA 5HFYA 1L5PA 4W9GA 4XWTA 5D94A 1JWUD 1MG8A 4HKZE 2YEPB 5E6PA 3UI3A 3IFWB 3TL5A 2MBOA 4C4VA 2HDEA 1HQRD 2IYDB 3NS1A 3ALBA 4EEWA 1P3QU 4OZAA 1AN8A 1GC7A 3M62B 2JVCA 3U30A 1WXMA 3ZQ4A 1V1OA 3S2AA 2KXJA 2G1EA 1L4ZB 5LLIA 3CSTA 2KWUB 2KYWA 2QSDA 3ZNID 4ZRIA 3WALA 3GZNI 3UIPB 1OQYA 3WAOA 2FNJB 3ZRFA 1HZ6A 1S3SG 1I4HA 1E8ZA 3WCQA 1PUTA 2R2QA 3VR9B 4P1CC 1VZ6A 1A70A 4A20A 1V86A 2KJ6A 2FCNA 2VH1A 4NQLB 4ANXA 3QARA 1TY0A 1L0VB 3N20C 2JUOA 2MW5A 2DYOA 2DNFA 2QEJC 2KTFA 2NTTA 3PRPB 3VR8B 2K8CA 5C2TB 4JIOU 2LJ5A 4PK1A 1CZPA 1WXAA 3IXSA 1WIAA 4DWFA 4K81A 4OVUA 2WP9B 1TZ1A 2C60A 1JROA 3ETRA 4OZBA 1WM2A 3AM9A 2WXHA 1WGDA 3SEBA 5LXIB 4GN1A 1XLQA 4GLSC 2GB1A 3KWLA 4RF1A 4DDGD 5IO9A 3A9KB 1WGRA 2BWES 3JSVB 1LXDA 4FBJB 2KDMA 1T0SC 2I38A 4FHJA 2QIEB 2BS2B 4YXDB 2ASQA 4ICUA 2E6XA 5BMGA 1NYRA 3J9CA 4FJYA 4KGTA 1MVKA 4MM3B 3RPFC 2WGSA 2Y5PA 2MHJA 4US9A 2DZKA 1P98A 2ACZB 3EUB2 4BKGA 3V62A 3DBLI 2W3SA 1TS5A 4MH8A 1C9FA 1HTOA 1WZ0A 2KLCA 4IDIA 4ZDVA 1SXTA 3MTNB 1SSNA 5D3IB 3GP7A 2XK5B 3JW0X 4HWIB 2ZPNA 4NNJB 2K22A 2LZ6A 4DK5A 1Q5WB 3L17A 4EOYA 4IM3A 1XCQL 1LFDA 3PHXB 1NBFC 4A3PA 4BBNC 3NZ3A 4W9KA 1T0QC 3L4PA 5EDSA 3TEWA 3A9JA 2GBNA 4KKIA 4ZHOA 3M3JA 1WXSA 3URYA 1NI2A 4NAWB 2A5UA 2K0PA 3AE3B 1K52A 4FLHA 3AE4B 3IT6B 1C4CA 3QA8A 4DQOC 2NR2A 3RULA 3AB5A 2LRWA 2QCZA 1SJED 3PS6A 3U7ZA 3ZUNA 2BKFA 3RNEC 2N1VA 2ZNVC 3NVVA 4F7ZA 3V05A 1E0ZA 2IJ0A 4A6QA 1EUVB 1FO4A 3P4PB 3UQBA 2I2YA 2CR5A 2IO2B 5FR3A 1FEHA 1OEYJ 5D3DA 1ZXIA 2RDHA 4FN2A 4HCNB 2JT4B 3K9PB 4AJWA 1QOFA 1E90A 2GBJA 1E7VA 3N1XC 3QK0A 1IBXA 1A5RA 2C9WB 2K3UA 4ZOHC 4TKNA 2WHIA 1JWMD 1LGRA 4AQ7A 1UELA 4WAFA 1V5OA 1WYGA 1I35A 1IP9A 3APDA 1WY8A 3GB1A 3H1UA 4GIVA 2WS3B 1WGHA 1HE8A 2LVOA 2KX3A 3CIRB 2BBCA 4HPLB 2KJHB 2FIDA 4DHJD 3RZWC 4XC2A 5FKAC 2BB5A 3ENEA 3NHEB 4PS8A 5JHAA 2PE9A 4N58A 4RNAA 1DYQA 2MSED 2CKHB 2VZKB 3APCA 3VTWA 3JYUA 3GOEA 4BVUC 1ZKHA 2N7DA 1VD2A 4HCPB 4YSXB 2KVRA 2BVCA 1PGAA 1ET9A 2DYBA 4M00A 4II3B 4KVGB 3NRZA 1J8CA 2HJ8A 1HXYD 1UZXB 2ZW1A 4WQOB 3Q8CA 2O6VA 1FPYA 2MJDA 1TBEA 3T8MA 3VUXA 3ZO5B 1SE4A 3TJPA 2MJ3A 4XDDA 2CJNA 3EHVA 1SJHD 4WQMA 3TMPB 2MLBA 2LXCA 4BFRA 1WX7A 3HM6X 3TEYA 3NG0A 1UGJA 2K5PA 4KIKA 1I4RA 4AWJA 3UIOB 1V1PB 2O6VD 4F8CB 2M0XA 1UBQA 2JX5A 2I1JA 4G3XB 4IM0A 2PVOD 1HZ5A 1WMHB 2KTRA 2MBQA 2WXFA 1T0YA 4I6LB 2C5LC 3NVWA 1FFUA 1WF9A 2PVGC 2B3AA 3PZ8A 1WWTA 1N62A 1H4RA 2IBIB 5EE1A 3I57A 2OHFA 1VJKA 3PZDA 1Z2MA 2QJLA 3AU5A 2K6QA 2FIFA 1F9JA 3ZTCA 4NQKE 3MC9A 2QHOA 2D5GA 3KUDB 3ZNZB 4W9FA 1SF0A 2KK8A 2YVCA 2WU2B 3RNCC 4ARCA 4GDLA 2MA9B 2DX5B 5LNK1 4XYCA 1U4AA 3NVZA 3LB8C 3APFA 2GLSA 2G3QB 3T3NA 2BYVE 3AULA 3L0WB 2SAKA 3WANA 1WX9A 1T0RC 2J7QB 1K53A 4II2B 1RAXA 2E3TA 4AUQC 1VDVA 1ISNA 3RFZB 2I1KA 1NDDA 3NUHB 1GJZA 5J2RA 4OW0A 2BS4B 1V81A 3N30A 3FILB 3AMZA 1JQ4A 1NI3A 4MJSA 4US8A 2WDTB 5FR6A 2GBMA 5IA7A 5HG2A 1IGDA 3VFKA 3PTFC 4LK0M 3QHTA 1JWBD 3ZXRA 2M8SA 4MGZE 1T3QA 2MEKA 3I5JC 3Q3NC 2K8HA 4K7WA 2N9PC 4A55A 4YL8A 3BY4B 3P2BA 4IWOA 4TV3A 4EFOA 1Y8RC 4XZ4A 4FJVB 2NBUA 3EA6A 2AX5A 2XBBC 1QLBB 3BYTB 4JL9A 5DPRA 2KKCA 4YT0B 4C00A 1TS2A 2G4DB 4M02A 4HKQA 1DOXA 4F1SA 2INPE 3HM3A 3JVZX 2AQ3B 1Q0WB 2IZVB 3PVLA 2SEBD 1UWMA 3ZGZA 3X0WA 1GOZA 4ANWA 2PLPA 1WZ3A 4ACFA 3B1LX 2WWZA 2MWSB 3R2IA 1VRAB 3H9DA 3NS8A 2IPKD 4GDKB 5AZHA 4JGHB 4W9IA 4A90A 2PTLA 3BYYB 2D3BA 3LJ3A 4RGMA 5BYQA 2BTEA 4XX5A 1I4GA 1ZP0B 3WAPA 2IO1B 3BK1A 4DDID 4W9DA 4LNIA 2DAFA 1V8CA 3A1QB 2KOXA 4ANUA 4HDOA 2DWQA 4TSSA 2M19A 3DBHB 5BO4B 3H7PB 2KMMA 2MP2B 2KWCA 5CHWA 1I7HA 5CX3A 1RFAA 1WSPA 4CYEA 1UBIA 2CHXA 5LXHA 1KRHA 4DHZB 3A33B 4IWQA 3RI7C 3VXWA 4JX1C 3AEGB 2L8JA 1FXAA 1M94A 4LTUA 4LNFA 3PRMB 1UUPA 2JXXA 3ECIA 2DHZA 1RRBA 2BT6A 4EE2A 5HHDG 2G9HD 4QAYA 4HPMB 1R4MI 4NY0A 2CU1A 4LNOA 2H89B 2FUHB 3DOWA 4FHKA 5G2NA 2L3ZA 3PGEA 4J6IA 3DBRI 4WAAA 2NPTB 3SR6A 1QKZA 4MGKE 3VHTC 1C4PA 1TJEA 1B1ZA 1QT9A 2LVPA 5D7GA 1EO6A 3RNBC 4W9HA 3IAM1 3BVGA 3NOBA 2LWPA 4KX6B 2BGFA 1KF6B 1PFDA 1OFFA 5IOIA 2W55A 1IUEA 4CO7A 1SIJA 2M56B 4MEMA 2BB6A 4FULA 4WJPA 5CHFA 3WA0A 4LJOB 4MGYE 1KFYB 2KLGA 5IAAC 3VDZA 1MJDA 2INCC 1QQRA 3AE2B 3QQ8B 3Q8FA 4DXAB 3DBHI 4HVBA 3BIID 1KLVA 3P1MA 5JH5C 2BQQA 3MC8A 3K9OB 4RFBA 2M17A 1YN5A 3ZRCA 2AQ1B 4N59A 1KJTA 1ZUD2 2D11A 1FCCC 3H7SA 3BK2A 1N5WA 3AU4A 3NZSA 3OJ4B 4PT5A 3ABVB 2ZW0A 5J18A 3RCZA 4J3OD 2V1YA 4JQWC 2W3RA 4ZRQA 3DVNV 2LUEA 1WM3A 3AEFB 3QX1A 2RSUA 4NAMA 1R7SA 1WRDB 4FADA 2R61A 3Q14C 4H2AA 1C78A 1YQ4B 4WWPA 1GAQB 2D3CA 4MDKE 3HK0A 3X23A 3C19A 2Z0EB 4GMVA 1C77A 1KTKA 2WXLA 4GXBA 1JCKB 3EECA 2PW9A 3MHSD 1N60A 4WJNA 1IPGA 3RMKC 2Z59B 4RH6A 2FAZA 1F52A 1WFYA 5TR5A 2LGYA 2WX0A 3OG5A 1FNUA 4XGAB 2J0JA 3AE6B 4M0WA 1XXGA 3TBLD 5HI1A 2D10A 4Q2JA 2NBWB 4I6NB 1F77A 2UU7A 4WJOA 2ZPYA 4PS7A 1MG4A 1TTNA 4RCOA 4GOCA 4WWOA 2J0KA 3Q3OC 1ZPSA 1OTRB 2KO3A 3L54A 2AYOB 3LYYA 4HXDA 2L0TA 4TUUA 3FC4A 3PLVA 1QOAA 1K51A 3A4RA 3IBEA 1VCBA 1ROEA 2KZRA 1EM7A 1K8RB 2D3AA 3E9SA 2EKEC 3EC8A 1TKGA 2CS4A 3L08A 1T5XD 2JZPA 1GUAB 2OJRA 3AE8B 2H88B 3R2TA 1PGBA 1DGJA 4P6VF 4TQ0A 2JRHA 3ML8A 1ZDXA 3VUWA 3C8YA 3DHIC 4MACA 2GOWA 4MSMB 4PYZA 4YTNB 1XLPA 1L6VA 2WNMA 1V97A 3I3TB 2LRUA 4YWGG 3V6EB 3P4SB 1FCLA 5IP4D 3IVFA 5AEKB 2WXPA 1KH0A 1VLBA 2INDC 1WGYA 4HJKA 1HEZE 4IUMB 2O2VA 2UYZB 1XLOA 2L83A 2KDFB
chains in the Genus database with same CATH topology
3PZDA 2LXAA 1Z2MA 2RD0A 3AU5A 3ML9A 2K6QA 2FIFA 4M8MA 1F9JA 3LDZE 3WAMA 1WGGA 3RYTA 3RZFA 2ZEQA 3MJWA 3ZTCA 3NZUA 4NQKE 3WIMA 2NS5A 3UGBB 2QHOA 1X1MA 4ZRKA 3UF8A 3TCAA 1J19A 3KUDB 3PT2B 4HK2A 3KW5B 3ZNZB 2KD0A 2LGDA 1TGZB 4W9FA 3PLUA 2KK8A 5JHBA 2FCSA 4MH0E 3VVWB 2YVCA 2PJHA 2BWFA 2K6DB 4ANVA 3OAWA 3ZVVA 1RLFA 2MA9B 2RPQA 4GDLA 4K7UA 3AI5A 1L2NA 2DX5B 2XEWA 4PS3A 2V4LA 4W9JA 4A3OA 4E74A 4AOFA 4LCDE 3DBSA 3ZTDA 1U4AA 4IWPA 2BPSA 1V6EA 2N1WA 3APFA 2K1FA 3N32A 2G3QB 3D32A 1AARA 3CMMB 2BYVE 3AULA 5E6NA 4G0NB 5CHVC 3HIZA 3A4SC 3L0WB 2HTHA 2KFKA 3DVGY 4RMAA 3VH4B 3WANA 1WX9A 2KC1A 5C1ZA 1BT0A 4AP4C 4BOZB 1PQSA 2J7QB 5JZEB 3TIXA 4BKTA 2BF8B 3M95A 4II2B 4ICVA 1RAXA 4AUQC 1ISNA 3BINA 4WJQA 1EF5A 2I1KA 1NDDA 3V61A 1YQBA 2JPHA 3KUCB 3QC8B 1OEYA 3CF6E 1GJZA 5J2RA 2R2OA 2KFJA 5HKHA 5KHOA 1V81A 3N30A 2IO0B 2KMCA 1OGWA 3VQIA 4MJSA 2WDTB 5FR6A 5GMVA 3QJZA 5C23A 3QAQA 2GBMA 5IA7A 4E71A 4W9GA 5D2MB 1XD3B 3VFKA 3PTFC 2DZIA 5D94A 1MG8A 2N4FA 1GC6A 4EZLA 3QHTA 3NY5A 3PHWB 1WI0A 2M8SA 2BKRB 3KYCD 3IFWB 2L05A 4KSKC 5E6PA 4MGZE 3R7RA 1JRUA 3SDLC 1FXTB 3TL5A 2JF5A 1WMHA 2MBOA 4KDIC 1EF1A 3UINB 2K8HA 4K7WA 2IY1B 2N9PC 4YL8A 1E8YA 3DVGX 2IYDB 4EEWA 3ALBA 4ZRJA 1P3QU 3EFUA 4B95A 3BY4B 4BBNF 3P2BA 3L10B 2DENB 1GC7A 3ZDTA 3M63B 3M62B 4IWOA 4TV3A 3ZNHB 4EFOA 1Y8RC 2JVCA 3U30A 1WXMA 4XZ4A 4FJVB 1WE7A 2NBUA 3RD2A 3S2AA 3ZDMC 2KXJA 1WE6A 2XBBC 2CHZA 1WJ6A 4JL9A 5DPRA 4G50A 5LLIA 3DCGA 3CSTA 4MSQB 2KWUB 3W1SC 2KKCA 3PSEB 2AEHA 2G4DB 3L16A 1V5TA 3ZNID 4ZRIA 3WALA 4AJYB 3KYDD 3GZNI 1G6JA 4F1SA 3UIPB 1OQYA 1UH6A 3HM3A 2FNJB 3O65B 3JVZX 1WX8A 3WAOA 3ZRFA 1KOTA 3PVLA 1Q0WB 2IZVB 3KH0A 3IG3A 3QIJA 3Q3JA 3W1SA 1C1YB 1YD8U 4GB9A 3X0WA 4ANWA 1S3SG 2MQJA 1V9JA 1WZ3A 1E8ZA 3B1LX 2R2QA 2N7EA 4HDQA 2WWZA 1SGHA 2MWSB 1WH3A 4EZJA 2KJRA 1V2YA 1I42A 3R7QA 2Z0DB 3PREA 2JY6A 3H9DA 3NS8A 4A20A 3R66C 1V86A 2KJ6A 4GDKB 5AZHA 2FCNA 4I6PA 4JGHB 4W9IA 4NQLB 4IG7B 1WJUA 4ANXA 3LJ3A 2KNBA 2D3GA 1UGMA 3QARA 4XX5A 2JUOA 2KWVB 3A9JB 3WAPA 2IO1B 2K25A 2MW5A 4W9DA 4DDID 5D6JB 2DYOA 3VUYA 3OJ3A 2DAFA 2PPHA 3A1QB 2KOXA 4ANUA 2KTFA 2AL6A 4HDOA 2MBEA 3PRPB 4K1RB 2K8CA 2Y5BB 3VH3B 5BO4B 3H7PB 4LDTD 1D3ZA 1Q1OA 4JIOU 2LJ5A 1WXVA 1QZEA 2MP2B 1WJNA 3SHQA 2KWCA 5CHWA 2FCQA 5CX3A 4HLEA 1RFAA 4CYEA 1UBIA 1WXAA 2CHXA 2RR9A 5LXHA 4DHZB 3A33B 1WIAA 4IWQA 4DWFA 3VXWA 1YX5B 3B0AA 2L0FA 4K81A 2L8JA 4OVUA 3V60A 2NCNA 1TZ1A 2C60A 4ZYNA 1SE9A 4TQ1A 1E8WA 1WM2A 2MRPA 5DPSA 2W9NA 2ZNVB 3H6NA 1WGDA 5LXIB 1SIFA 2EMSA 1M94A 2JRIB 4GN1A 3PRMB 4DDGD 2JXXA 3ECIA 2DHZA 3A9KB 1J0GA 1RRBA 1WGRA 5E6OA 2BWES 3JSVB 3L13A 2GBRA 1XQQA 1LXDA 4FBJB 1YX6B 3SD5A 1V80A 4HPMB 1R4MI 2KC2A 4FHJA 3PPAA 5L83A 4NY0A 3CSFA 4DHJB 2CU1A 1UD7A 2ASQA 3IHPC 1LQBA 4ICUA 3ZNGC 2FUHB 3DOWA 4FJYA 3ZKJC 4FHKA 5G2NA 2L3ZA 3PGEA 4J6IA 3DBRI 4WAAA 2C7MB 2NPTB 5DPTA 4W9CA 2DZKA 4PYUA 4MGKE 1CMXB 1P98A 3VHTC 4W9EA 4BKGA 3V62A 3DBLI 3PRZA 2LVPA 5D7GA 1EO6A 1WZ0A 2KLCA 4ZDVA 4IM2A 3ZLZA 3MTNB 4W9HA 4GU2A 5CTRC 1E8XA 3DQVA 2LWPA 3NOBA 2BYEA 5J17A 2BGFA 2V3SA 2XK5B 3JW0X 4HWIB 4M0WB 2ZPNA 2JZZA 2K39A 4RM8A 2D2QA 4NNJB 4CHKA 5AZGA 2LZ6A 4CO7A 1Q5WB 4DK5A 2KDEB 1R4NI 3L17A 4MEMA 2GMIC 4EOYA 1P9DU 4IM3A 1P0RA 1LFDA 2MCNB 2UWQA 4FULA 3PHXB 2ZCCA 2HE7A 4WJPA 1NBFC 4A3PA 5CHFA 4BBNC 3WA0A 4LJOB 3ONSA 4MGYE 3C0RB 4P7IA 4GDKA 2KLGA 2LGXA 2ZVOA 5IAAC 3VDZA 2ZZPB 4W9KA 3QQ8B 2NBVB 1GNUA 5EDSA 2DAJA 1WJ4A 2LI5A 3A9JA 2GBNA 2L00B 4DXAB 1H8CA 1ZGUB 4KZ0A 3DBHI 4HVBA 2O6VB 4B6WA 4BOSC 3M3JA 1WXSA 3A1QA 1KLVA 1NI2A 1E5WA 4NAWB 2NVUI 3RUIB 3T9LA 1V49A 4GGQA 5JH5C 2AWTA 2A5UA 2WYQA 4E3CA 3OLMD 2A4ZA 2LASA 4FLHA 1S1QB 3QA8A 3K9OB 3H7PA 2NR2A 4NPNA 3RULA 2M17A 3QWZB 2MP2A 2LRWA 3ZRCA 2HD5B 3PS6A 2KDIA 2FCMA 1KJTA 3VTUA 1P1AA 2D11A 2IO3B 3ZUNA 1XT9B 4KZCA 3UQAA 3H7SA 2C7HA 2BKFA 3AU4A 4KIKB 2N1VA 2ZNVC 3OJ4B 3NZSA 4F7ZA 4BKSA 5L95C 3DVNU 1EUVB 4DBGA 4DHZE 5J18A 3RCZA 3UQBA 2KN5A 3ZW3A 2V1YA 4JQWC 2CR5A 2IO2B 2M1MA 2LUEA 3DVNV 1WM3A 1OEYJ 2KX0A 2N9EB 4FN2A 2KTRB 2JT4B 3K9PB 3QX1A 4HCNB 4AJWA 2RSUA 3A9KA 1E90A 2GBJA 1YIWA 1E7VA 3JSVA 2J0MA 1WRDB 2L7RA 2DZJA 2KQSA 4FADA 3DPDA 2CHWA 3QK0A 4FA6A 1A5RA 2C9WB 4BKSD 2O2VB 4TKNA 4WWPA 4EKUA 2JZ3B 2DZMA 1UELA 4MDKE 4NJ6A 4MGIE 1V5OA 2ZVNA 3HK0A 4FJZA 3X23A 1I35A 2Z0EB 2DYMA 4GMVA 1IP9A 3APDA 4GXBA 4LDTB 4MM3A 2NPTA 1WY8A 3PV1A 3EECA 2MX2A 1WR6E 3H1UA 4GIVA 3V6CB 3MHSD 4B9KA 1WGHA 1E7UA 1HE8A 2MBHA 2KQ7A 3RT3B 4WJNA 1IPGA 2PE6B 2LVOA 2KX3A 2KANA 2Z59B 2LVQA 2FAZA 2YLMA 4HPLB 2LD9A 1WFYA 2KJHB 4RM9A 5TR5A 2LGYA 2FIDA 5AZFA 3ZIMA 4DHJD 1C3TA 2ZJDA 3RZWC 2WX0A 4XC2A 1IYFA 2KMAA 1GG3A 2XK5A 2J0JA 3ENEA 3NHEB 4PS8A 3TBLD 5JHAA 2PE9A 4G11A 4OVVA 2D10A 2MSED 2CKHB 4GDLB 3APCA 2EMTA 2NBWB 4JLCA 4W9LA 3VTWA 4I6NB 4WJOA 2ZPYA 3JYUA 2RGFA 3GOEA 4PS7A 1TTNA 2G45B 4ASWC 4BVUC 1ZKHA 2MBBB 2N7DA 1VD2A 2KDBA 1Z5SB 4GOCA 5KHQA 2REXA 4WWOA 3SU8X 4HCPB 4URKA 2J0KA 3VTVA 5DCNA 4N9F4 1OTRB 2KO3A 2KVRA 1ZW7A 4M8NA 2K8BA 3KUZA 2AYOB 3L54A 2D07B 2G4SA 2KHWB 2DYBA 4II3B 4X57B 4HXDA 2L0TA 4KDLB 4TUUA 4KVGB 2KFKB 3PLVA 1YJ1A 2BYFA 2VRRB 1J8CA 4IC7B 3A4RA 2HJ8A 2L76A 3IBEA 1UZXB 1VCBA 4WQOB 2O6VA 1WYWB 2KZRA 1TBEA 1K8RB 3T8MA 4NAWA 2EKEC 3EC8A 3VUXA 3ZO5B 4WWNA 3Q3FA 2CS4A 3TJPA 3L08A 2C7NB 4EUTA 1GUAB 2OJRA 3AXCA 4NJ7A 3EHVA 3KVFB 4K7SA 3TMPB 2MLBA 4KSLC 2LXCA 4BFRA 1WX7A 3HM6X 4MJSB 4TQ0A 2JRHA 2AL3A 3ML8A 3DDCB 3VAWA 3VUWA 4KIKA 4AWJA 2M4NA 3UIOB 2GBKA 2GOWA 4IW0A 4MSMB 4PYZA 2O6VD 4F8CB 2M0XA 2ZCBA 2OOBB 1UBQA 3HHMA 3W1YA 2WX1A 3I3TB 2I1JA 2JWZA 5G55A 4G3XB 1L7YA 4IM0A 2LRUA 3U7DA 1LM8B 4EZKA 3U8ZA 3V6EB 3N3KB 4MELA 2KTRA 1WMHB 2PEAA 4LJPB 2IY0B 2MBQA 3IVFA 1WR1A 1T0YA 5AEKB 4I6LB 2N9XA 2C5LC 1WGYA 4HJKA 3R3MA 4KV2A 3QCAA 4GSWA 1KM7A 1WF9A 5DPWA 2B3AA 3B08A 2O2VA 4IUMB 2IBIB 1H4RA 2UYZB 2KDFB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PZD A;  2LXA A;  1Z2M A;  2RD0 A;  3AU5 A;  3ML9 A;  2K6Q A;  2FIF A;  4M8M A;  1F9J A;  3LDZ E;  3WAM A;  1WGG A;  3RYT A;  3RZF A;  2ZEQ A;  3MJW A;  3ZTC A;  3NZU A;  4NQK E;  3WIM A;  2NS5 A;  3UGB B;  2QHO A;  1X1M A;  4ZRK A;  3UF8 A;  3TCA A;  1J19 A;  3KUD B;  3PT2 B;  4HK2 A;  3KW5 B;  3ZNZ B;  2KD0 A;  2LGD A;  1TGZ B;  4W9F A;  3PLU A;  2KK8 A;  5JHB A;  2FCS A;  4MH0 E;  3VVW B;  2YVC A;  2PJH A;  2BWF A;  2K6D B;  4ANV A;  3OAW A;  3ZVV A;  1RLF A;  2MA9 B;  2RPQ A;  4GDL A;  4K7U A;  3AI5 A;  1L2N A;  2DX5 B;  2XEW A;  4PS3 A;  2V4L A;  4W9J A;  4A3O A;  4E74 A;  4AOF A;  4LCD E;  3DBS A;  3ZTD A;  1U4A A;  4IWP A;  2BPS A;  1V6E A;  2N1W A;  3APF A;  2K1F A;  3N32 A;  2G3Q B;  3D32 A;  1AAR A;  3CMM B;  2BYV E;  3AUL A;  5E6N A;  4G0N B;  5CHV C;  3HIZ A;  3A4S C;  3L0W B;  2HTH A;  2KFK A;  3DVG Y;  4RMA A;  3VH4 B;  3WAN A;  1WX9 A;  2KC1 A;  5C1Z A;  1BT0 A;  4AP4 C;  4BOZ B;  1PQS A;  2J7Q B;  5JZE B;  3TIX A;  4BKT A;  2BF8 B;  3M95 A;  4II2 B;  4ICV A;  1RAX A;  4AUQ C;  1ISN A;  3BIN A;  4WJQ A;  1EF5 A;  2I1K A;  1NDD A;  3V61 A;  1YQB A;  2JPH A;  3KUC B;  3QC8 B;  1OEY A;  3CF6 E;  1GJZ A;  5J2R A;  2R2O A;  2KFJ A;  5HKH A;  5KHO A;  1V81 A;  3N30 A;  2IO0 B;  2KMC A;  1OGW A;  3VQI A;  4MJS A;  2WDT B;  5FR6 A;  5GMV A;  3QJZ A;  5C23 A;  3QAQ A;  2GBM A;  5IA7 A;  4E71 A;  4W9G A;  5D2M B;  1XD3 B;  3VFK A;  3PTF C;  2DZI A;  5D94 A;  1MG8 A;  2N4F A;  1GC6 A;  4EZL A;  3QHT A;  3NY5 A;  3PHW B;  1WI0 A;  2M8S A;  2BKR B;  3KYC D;  3IFW B;  2L05 A;  4KSK C;  5E6P A;  4MGZ E;  3R7R A;  1JRU A;  3SDL C;  1FXT B;  3TL5 A;  2JF5 A;  1WMH A;  2MBO A;  4KDI C;  1EF1 A;  3UIN B;  2K8H A;  4K7W A;  2IY1 B;  2N9P C;  4YL8 A;  1E8Y A;  3DVG X;  2IYD B;  4EEW A;  3ALB A;  4ZRJ A;  1P3Q U;  3EFU A;  4B95 A;  3BY4 B;  4BBN F;  3P2B A;  3L10 B;  2DEN B;  1GC7 A;  3ZDT A;  3M63 B;  3M62 B;  4IWO A;  4TV3 A;  3ZNH B;  4EFO A;  1Y8R C;  2JVC A;  3U30 A;  1WXM A;  4XZ4 A;  4FJV B;  1WE7 A;  2NBU A;  3RD2 A;  3S2A A;  3ZDM C;  2KXJ A;  1WE6 A;  2XBB C;  2CHZ A;  1WJ6 A;  4JL9 A;  5DPR A;  4G50 A;  5LLI A;  3DCG A;  3CST A;  4MSQ B;  2KWU B;  3W1S C;  2KKC A;  3PSE B;  2AEH A;  2G4D B;  3L16 A;  1V5T A;  3ZNI D;  4ZRI A;  3WAL A;  4AJY B;  3KYD D;  3GZN I;  1G6J A;  4F1S A;  3UIP B;  1OQY A;  1UH6 A;  3HM3 A;  2FNJ B;  3O65 B;  3JVZ X;  1WX8 A;  3WAO A;  3ZRF A;  1KOT A;  3PVL A;  1Q0W B;  2IZV B;  3KH0 A;  3IG3 A;  3QIJ A;  3Q3J A;  3W1S A;  1C1Y B;  1YD8 U;  4GB9 A;  3X0W A;  4ANW A;  1S3S G;  2MQJ A;  1V9J A;  1WZ3 A;  1E8Z A;  3B1L X;  2R2Q A;  2N7E A;  4HDQ A;  2WWZ A;  1SGH A;  2MWS B;  1WH3 A;  4EZJ A;  2KJR A;  1V2Y A;  1I42 A;  3R7Q A;  2Z0D B;  3PRE A;  2JY6 A;  3H9D A;  3NS8 A;  4A20 A;  3R66 C;  1V86 A;  2KJ6 A;  4GDK B;  5AZH A;  2FCN A;  4I6P A;  4JGH B;  4W9I A;  4NQL B;  4IG7 B;  1WJU A;  4ANX A;  3LJ3 A;  2KNB A;  2D3G A;  1UGM A;  3QAR A;  4XX5 A;  2JUO A;  2KWV B;  3A9J B;  3WAP A;  2IO1 B;  2K25 A;  2MW5 A;  4W9D A;  4DDI D;  5D6J B;  2DYO A;  3VUY A;  3OJ3 A;  2DAF A;  2PPH A;  3A1Q B;  2KOX A;  4ANU A;  2KTF A;  2AL6 A;  4HDO A;  2MBE A;  3PRP B;  4K1R B;  2K8C A;  2Y5B B;  3VH3 B;  5BO4 B;  3H7P B;  4LDT D;  1D3Z A;  1Q1O A;  4JIO U;  2LJ5 A;  1WXV A;  1QZE A;  2MP2 B;  1WJN A;  3SHQ A;  2KWC A;  5CHW A;  2FCQ A;  5CX3 A;  4HLE A;  1RFA A;  4CYE A;  1UBI A;  1WXA A;  2CHX A;  2RR9 A;  5LXH A;  4DHZ B;  3A33 B;  1WIA A;  4IWQ A;  4DWF A;  3VXW A;  1YX5 B;  3B0A A;  2L0F A;  4K81 A;  2L8J A;  4OVU A;  3V60 A;  2NCN A;  1TZ1 A;  2C60 A;  4ZYN A;  1SE9 A;  4TQ1 A;  1E8W A;  1WM2 A;  2MRP A;  5DPS A;  2W9N A;  2ZNV B;  3H6N A;  1WGD A;  5LXI B;  1SIF A;  2EMS A;  1M94 A;  2JRI B;  4GN1 A;  3PRM B;  4DDG D;  2JXX A;  3ECI A;  2DHZ A;  3A9K B;  1J0G A;  1RRB A;  1WGR A;  5E6O A;  2BWE S;  3JSV B;  3L13 A;  2GBR A;  1XQQ A;  1LXD A;  4FBJ B;  1YX6 B;  3SD5 A;  1V80 A;  4HPM B;  1R4M I;  2KC2 A;  4FHJ A;  3PPA A;  5L83 A;  4NY0 A;  3CSF A;  4DHJ B;  2CU1 A;  1UD7 A;  2ASQ A;  3IHP C;  1LQB A;  4ICU A;  3ZNG C;  2FUH B;  3DOW A;  4FJY A;  3ZKJ C;  4FHK A;  5G2N A;  2L3Z A;  3PGE A;  4J6I A;  3DBR I;  4WAA A;  2C7M B;  2NPT B;  5DPT A;  4W9C A;  2DZK A;  4PYU A;  4MGK E;  1CMX B;  1P98 A;  3VHT C;  4W9E A;  4BKG A;  3V62 A;  3DBL I;  3PRZ A;  2LVP A;  5D7G A;  1EO6 A;  1WZ0 A;  2KLC A;  4ZDV A;  4IM2 A;  3ZLZ A;  3MTN B;  4W9H A;  4GU2 A;  5CTR C;  1E8X A;  3DQV A;  2LWP A;  3NOB A;  2BYE A;  5J17 A;  2BGF A;  2V3S A;  2XK5 B;  3JW0 X;  4HWI B;  4M0W B;  2ZPN A;  2JZZ A;  2K39 A;  4RM8 A;  2D2Q A;  4NNJ B;  4CHK A;  5AZG A;  2LZ6 A;  4CO7 A;  1Q5W B;  4DK5 A;  2KDE B;  1R4N I;  3L17 A;  4MEM A;  2GMI C;  4EOY A;  1P9D U;  4IM3 A;  1P0R A;  1LFD A;  2MCN B;  2UWQ A;  4FUL A;  3PHX B;  2ZCC A;  2HE7 A;  4WJP A;  1NBF C;  4A3P A;  5CHF A;  4BBN C;  3WA0 A;  4LJO B;  3ONS A;  4MGY E;  3C0R B;  4P7I A;  4GDK A;  2KLG A;  2LGX A;  2ZVO A;  5IAA C;  3VDZ A;  2ZZP B;  4W9K A;  3QQ8 B;  2NBV B;  1GNU A;  5EDS A;  2DAJ A;  1WJ4 A;  2LI5 A;  3A9J A;  2GBN A;  2L00 B;  4DXA B;  1H8C A;  1ZGU B;  4KZ0 A;  3DBH I;  4HVB A;  2O6V B;  4B6W A;  4BOS C;  3M3J A;  1WXS A;  3A1Q A;  1KLV A;  1NI2 A;  1E5W A;  4NAW B;  2NVU I;  3RUI B;  3T9L A;  1V49 A;  4GGQ A;  5JH5 C;  2AWT A;  2A5U A;  2WYQ A;  4E3C A;  3OLM D;  2A4Z A;  2LAS A;  4FLH A;  1S1Q B;  3QA8 A;  3K9O B;  3H7P A;  2NR2 A;  4NPN A;  3RUL A;  2M17 A;  3QWZ B;  2MP2 A;  2LRW A;  3ZRC A;  2HD5 B;  3PS6 A;  2KDI A;  2FCM A;  1KJT A;  3VTU A;  1P1A A;  2D11 A;  2IO3 B;  3ZUN A;  1XT9 B;  4KZC A;  3UQA A;  3H7S A;  2C7H A;  2BKF A;  3AU4 A;  4KIK B;  2N1V A;  2ZNV C;  3OJ4 B;  3NZS A;  4F7Z A;  4BKS A;  5L95 C;  3DVN U;  1EUV B;  4DBG A;  4DHZ E;  5J18 A;  3RCZ A;  3UQB A;  2KN5 A;  3ZW3 A;  2V1Y A;  4JQW C;  2CR5 A;  2IO2 B;  2M1M A;  2LUE A;  3DVN V;  1WM3 A;  1OEY J;  2KX0 A;  2N9E B;  4FN2 A;  2KTR B;  2JT4 B;  3K9P B;  3QX1 A;  4HCN B;  4AJW A;  2RSU A;  3A9K A;  1E90 A;  2GBJ A;  1YIW A;  1E7V A;  3JSV A;  2J0M A;  1WRD B;  2L7R A;  2DZJ A;  2KQS A;  4FAD A;  3DPD A;  2CHW A;  3QK0 A;  4FA6 A;  1A5R A;  2C9W B;  4BKS D;  2O2V B;  4TKN A;  4WWP A;  4EKU A;  2JZ3 B;  2DZM A;  1UEL A;  4MDK E;  4NJ6 A;  4MGI E;  1V5O A;  2ZVN A;  3HK0 A;  4FJZ A;  3X23 A;  1I35 A;  2Z0E B;  2DYM A;  4GMV A;  1IP9 A;  3APD A;  4GXB A;  4LDT B;  4MM3 A;  2NPT A;  1WY8 A;  3PV1 A;  3EEC A;  2MX2 A;  1WR6 E;  3H1U A;  4GIV A;  3V6C B;  3MHS D;  4B9K A;  1WGH A;  1E7U A;  1HE8 A;  2MBH A;  2KQ7 A;  3RT3 B;  4WJN A;  1IPG A;  2PE6 B;  2LVO A;  2KX3 A;  2KAN A;  2Z59 B;  2LVQ A;  2FAZ A;  2YLM A;  4HPL B;  2LD9 A;  1WFY A;  2KJH B;  4RM9 A;  5TR5 A;  2LGY A;  2FID A;  5AZF A;  3ZIM A;  4DHJ D;  1C3T A;  2ZJD A;  3RZW C;  2WX0 A;  4XC2 A;  1IYF A;  2KMA A;  1GG3 A;  2XK5 A;  2J0J A;  3ENE A;  3NHE B;  4PS8 A;  3TBL D;  5JHA A;  2PE9 A;  4G11 A;  4OVV A;  2D10 A;  2MSE D;  2CKH B;  4GDL B;  3APC A;  2EMT A;  2NBW B;  4JLC A;  4W9L A;  3VTW A;  4I6N B;  4WJO A;  2ZPY A;  3JYU A;  2RGF A;  3GOE A;  4PS7 A;  1TTN A;  2G45 B;  4ASW C;  4BVU C;  1ZKH A;  2MBB B;  2N7D A;  1VD2 A;  2KDB A;  1Z5S B;  4GOC A;  5KHQ A;  2REX A;  4WWO A;  3SU8 X;  4HCP B;  4URK A;  2J0K A;  3VTV A;  5DCN A;  4N9F 4;  1OTR B;  2KO3 A;  2KVR A;  1ZW7 A;  4M8N A;  2K8B A;  3KUZ A;  2AYO B;  3L54 A;  2D07 B;  2G4S A;  2KHW B;  2DYB A;  4II3 B;  4X57 B;  4HXD A;  2L0T A;  4KDL B;  4TUU A;  4KVG B;  2KFK B;  3PLV A;  1YJ1 A;  2BYF A;  2VRR B;  1J8C A;  4IC7 B;  3A4R A;  2HJ8 A;  2L76 A;  3IBE A;  1UZX B;  1VCB A;  4WQO B;  2O6V A;  1WYW B;  2KZR A;  1TBE A;  1K8R B;  3T8M A;  4NAW A;  2EKE C;  3EC8 A;  3VUX A;  3ZO5 B;  4WWN A;  3Q3F A;  2CS4 A;  3TJP A;  3L08 A;  2C7N B;  4EUT A;  1GUA B;  2OJR A;  3AXC A;  4NJ7 A;  3EHV A;  3KVF B;  4K7S A;  3TMP B;  2MLB A;  4KSL C;  2LXC A;  4BFR A;  1WX7 A;  3HM6 X;  4MJS B;  4TQ0 A;  2JRH A;  2AL3 A;  3ML8 A;  3DDC B;  3VAW A;  3VUW A;  4KIK A;  4AWJ A;  2M4N A;  3UIO B;  2GBK A;  2GOW A;  4IW0 A;  4MSM B;  4PYZ A;  2O6V D;  4F8C B;  2M0X A;  2ZCB A;  2OOB B;  1UBQ A;  3HHM A;  3W1Y A;  2WX1 A;  3I3T B;  2I1J A;  2JWZ A;  5G55 A;  4G3X B;  1L7Y A;  4IM0 A;  2LRU A;  3U7D A;  1LM8 B;  4EZK A;  3U8Z A;  3V6E B;  3N3K B;  4MEL A;  2KTR A;  1WMH B;  2PEA A;  4LJP B;  2IY0 B;  2MBQ A;  3IVF A;  1WR1 A;  1T0Y A;  5AEK B;  4I6L B;  2N9X A;  2C5L C;  1WGY A;  4HJK A;  3R3M A;  4KV2 A;  3QCA A;  4GSW A;  1KM7 A;  1WF9 A;  5DPW A;  2B3A A;  3B08 A;  2O2V A;  4IUM B;  2IBI B;  1H4R A;  2UYZ B;  2KDF B; 
#chains in the Genus database with same CATH topology
 1ZDV A;  4KKJ A;  2RD0 A;  3LDZ E;  3WAM A;  3RZF A;  1CK1 A;  1QOB A;  2J53 A;  4ITK A;  3UGB B;  3AEA B;  3Q8E A;  3UF8 A;  2LFI A;  1J19 A;  4LLG M;  1TS3 A;  2KD0 A;  1WXQ A;  5AUK A;  5JXV A;  4HRO A;  3VVW B;  2PJH A;  3W5U B;  2K6D B;  3OAW A;  2N9L A;  2XEW A;  4PS3 A;  4W9J A;  4LCD E;  3ZTD A;  2LGS A;  1FMA D;  2BPS A;  2N1W A;  1GB1 A;  1AAR A;  1I4X A;  3CMM B;  2KFK A;  4RMA A;  3PZ7 A;  5C1Z A;  1BT0 A;  2WDQ B;  3TIX A;  3M95 A;  3Q3M C;  1YQB A;  3BVM A;  3KUC B;  1ZOY B;  2KFJ A;  4P1B C;  4KGR A;  3VQI A;  3QAQ A;  1OQQ A;  4E71 A;  4C7Y A;  5D2M B;  2QIL A;  3N1Z C;  1T6B X;  2N4F A;  1GC6 A;  4DXF A;  3NY5 A;  5MPO A;  3TEX A;  4KSK C;  3R7R A;  4A8X C;  2JYE A;  3SDL C;  3RN9 C;  2JF5 A;  1EF1 A;  3UIN B;  3AN1 A;  1L4D B;  1E8Y A;  4C7Z A;  1MFW A;  4ZRJ A;  3EFU A;  4B95 A;  3GS2 A;  4BBN F;  2DEN B;  3ZNH B;  2CU3 A;  2LMC A;  3RD2 A;  2CJO A;  1WJ6 A;  1WRI A;  4MSQ B;  1F0Z A;  3PSE B;  3L16 A;  1V5T A;  4AJY B;  3KYD D;  1G6J A;  3CWI A;  3O65 B;  1QF6 A;  1WX8 A;  5BMI A;  2HJ1 A;  3ZJT A;  3Q3J A;  1C1Y B;  5FK9 C;  2N7E A;  1SGH A;  3Q2A C;  4EZJ A;  5IN7 A;  1V2Y A;  3R7Q A;  3N1Y C;  3PRE A;  2JY6 A;  2WXG A;  3R66 C;  4I6P A;  4OHJ A;  1WJU A;  5TSS A;  2KNB A;  1UGM A;  3Q6B A;  4HEA 1;  2KWV B;  3A9J B;  2K25 A;  5D6J B;  1YOV B;  3OJ3 A;  2PPH A;  2Q5W D;  2MBE A;  2VH2 A;  4N6E B;  4CQN A;  1D3Z A;  4LDT D;  1Q1O A;  1QZE A;  5BYR A;  1WJN A;  4XDC A;  3U52 E;  4RGO S;  1JWS D;  3B9J A;  2W82 A;  3B0A A;  2L0F A;  3V60 A;  1ACC A;  4ZYN A;  1I4Q A;  1SE9 A;  2MRP A;  3MHZ A;  2W9N A;  2ZNV B;  3H6N A;  2BYT A;  1FM0 D;  2V0G A;  1J0G A;  3AEB B;  5E6O A;  3L13 A;  1XQQ A;  1SBB B;  2ONQ A;  1YX6 B;  3SD5 A;  1AWD A;  1V80 A;  2KVZ A;  1IBX B;  5L83 A;  2NTS A;  3CSF A;  1TT5 B;  2WLB A;  4DHJ B;  3I9V 1;  1YN3 A;  1C79 A;  5C3J B;  2QC8 A;  1N61 A;  1P7F A;  1MPE A;  1OQR A;  2C7M B;  3IT4 B;  1YJJ A;  5BMH A;  3PRZ A;  2WDR B;  1CQV A;  1TS4 A;  4IM2 A;  3DWM A;  1J7A A;  1E8X A;  1VZ7 A;  2KWD A;  3DQV A;  2BYE A;  2V3S A;  3AEE B;  1MHX A;  2V3N A;  2K39 A;  4RM8 A;  4CHK A;  5AZG A;  3AE9 B;  2KDE B;  4REZ A;  2GMI C;  1P0R A;  2MCN B;  2UWQ A;  1NEK B;  2ZCC A;  1SEB D;  3ONS A;  2ICI A;  2LGX A;  2ZVO A;  1ZXH A;  2ZZP B;  1K50 A;  1L0Y B;  1YJI A;  2NBV B;  3U2S C;  4WUR A;  3ZJU A;  2K9X A;  2LI5 A;  2L00 B;  1ZGU B;  4KZ0 A;  4UDU C;  2O6V B;  4B6W A;  4BOS C;  3RUI B;  2GI9 A;  2NVU I;  3T9L A;  4GGQ A;  3AEC B;  2WYQ A;  4E3C A;  2A4Z A;  2LAS A;  1BML C;  4NPN A;  3FKY A;  3DHG C;  2KDI A;  3VTU A;  1P1A A;  1ENF A;  2IO3 B;  1XT9 B;  3UQA A;  2C7H A;  4KIK B;  5L95 C;  3DVN U;  4DBG A;  1EWC A;  4KGS A;  3ZW3 A;  2M1M A;  2KX0 A;  3U4E G;  3MP9 A;  2TSS A;  1JML A;  2N9E B;  2KTR B;  2LHD A;  3AE7 B;  4A9A A;  3A9K A;  1PDX A;  3SFD B;  1YIW A;  3JSV A;  2KQS A;  2CHW A;  2WXQ A;  4S0R A;  4FA6 A;  4EKU A;  2DZM A;  2ON8 A;  4NJ6 A;  5GXG B;  4FJZ A;  2V4I B;  3W2D A;  3KLS X;  4LDT B;  4MM3 A;  3HUI A;  4M01 A;  5IKC M;  1XCT L;  4B9K A;  1E7U A;  2KQ7 A;  3RT3 B;  2Y3A A;  4IOI E;  1STE A;  2PE6 B;  4JE3 B;  2WXJ A;  2PIA A;  2LEK A;  2YLM A;  1FRD A;  2WDV B;  1JW9 D;  5AZF A;  1IYF A;  2L52 A;  2XK5 A;  1BXT A;  3ZJV A;  4OVV A;  1XEE A;  4GDL B;  2EMT A;  4JLC A;  5KHQ A;  2REX A;  3SU8 X;  3RNG C;  5DCN A;  4M8N A;  4MT5 A;  1ZW7 A;  4O1N A;  3KUZ A;  2D07 B;  2NMQ A;  2B76 B;  1FXI A;  2HTM E;  1WYW B;  1FD6 A;  4JPS A;  3BWU D;  3TUO A;  1M4V A;  4NAW A;  2KAJ A;  4WWN A;  2C7N B;  2N7J A;  1JWA D;  3AXC A;  4HJG E;  4MJS B;  1AW7 A;  2AL3 A;  3DDC B;  3VAW A;  3IAS 1;  2M4N A;  2GBK A;  4IW0 A;  2ZCB A;  2OOB B;  5H8Y E;  3W1Y A;  2WX1 A;  3P63 A;  1DOY A;  5G55 A;  2QDF A;  2XN9 C;  4EZK A;  1LM8 B;  1MI0 A;  1FRR A;  3U8Z A;  3N3K B;  1E10 A;  2PEA A;  3DBL B;  2WXK A;  1E6E B;  3QCA A;  4GSW A;  1KM7 A;  5DPW A;  3TEZ A;  1UWX A;  3MJ5 A;  3ML9 A;  4M8M A;  1WGG A;  2ZEQ A;  3MJW A;  1DOI A;  1BUI C;  2NS5 A;  3VRA B;  1TKE A;  2WQY B;  3TCA A;  3RNA C;  4ZYS A;  4LNN A;  5JHB A;  2FCS A;  4MH0 E;  1MHH E;  2FBW B;  2RPQ A;  2KT7 A;  2N0S B;  1RFK A;  1JRP A;  2FUG 1;  2PMV A;  2V4L A;  4HRS A;  4E74 A;  4AOF A;  4IWP A;  1TZO A;  3BVZ A;  3N32 A;  3D32 A;  2WXR A;  1NEN B;  4G0N B;  5CHV C;  3HIZ A;  2WXO A;  3VH4 B;  4BOZ B;  1PQS A;  5JZE B;  2VZK D;  2JQR B;  2LUM A;  4WJQ A;  1EF5 A;  2EKI A;  2JPH A;  3QC8 B;  1OEY A;  1P7E A;  5KHO A;  1D6E C;  2IO0 B;  2KMC A;  1OGW A;  5E6J A;  5C23 A;  5GMV A;  3QJZ A;  3P4R B;  4D2K A;  1XD3 B;  3NVY A;  1V1P A;  4LNK A;  2DZI A;  3KQ4 A;  4P16 A;  3O13 A;  4EZL A;  5T8I A;  4L23 A;  3V3X A;  3PHW B;  1WI0 A;  3KYC D;  2BKR B;  3HVZ A;  2L05 A;  4JWU C;  1JRU A;  3PO0 A;  1FXT B;  2JSV X;  3ZXV A;  1WMH A;  1GPX A;  1RWS A;  4KDI C;  3N9Y C;  1C76 A;  2IY1 B;  3Q8B A;  1F1H A;  2Y5C A;  3DVG X;  4B0M A;  4K3B A;  4RF0 A;  2J42 A;  3W9C B;  1YMH E;  3L10 B;  3ZDT A;  3M63 B;  1WE7 A;  3ZDM C;  2BS3 B;  1WE6 A;  3W5V B;  2CHZ A;  4G50 A;  3DCG A;  2L1A A;  3MC0 B;  4YSY B;  3W1S C;  2AEH A;  2X38 A;  2EEL A;  4C4V B;  1UH6 A;  1I4P A;  4S17 A;  1KOT A;  2L32 A;  3KH0 A;  3IG3 A;  3QIJ A;  3W1S A;  1YD8 U;  4GB9 A;  1C4A A;  2JXT A;  2MQJ A;  1UF0 A;  1V9J A;  1ET6 A;  4HDQ A;  1WH3 A;  1I42 A;  2KJR A;  2Z0D B;  5EE9 A;  5G5H A;  4USA A;  1KLU D;  1RM6 C;  1R4N B;  3HRD D;  1CJE A;  4IG7 B;  4YTM B;  4HPP A;  3NJT A;  2D3G A;  3VUY A;  2AL6 A;  4K1R B;  2Y5B B;  3AED B;  3VH3 B;  2FE8 A;  2IGH A;  1WXV A;  3SHQ A;  2WXI A;  2FCQ A;  4XWW A;  4HLE A;  1VZ8 A;  2RR9 A;  1AYF A;  1L6U A;  2J4X A;  1YX5 B;  1F2R I;  3FIL A;  2NCN A;  1XLN A;  1EU4 A;  3GE8 C;  4TQ1 A;  1E8W A;  2KAC A;  5DPS A;  1SIF A;  2EMS A;  2JRI B;  4ARI A;  2GBR A;  2JYT A;  2KN4 A;  4BZA A;  3P42 A;  2KC2 A;  3PPA A;  4YSZ B;  1TYG B;  2M0A A;  1XO3 A;  3ZYY X;  4B0E A;  1UD7 A;  3IHP C;  1LQB A;  3ZNG C;  1PGX A;  3ZKJ C;  2IGG A;  1WGK A;  3OWE B;  5DPT A;  4W9C A;  2PKO A;  4PYU A;  1CMX B;  1LO5 D;  2RMM A;  4NJC A;  4W9E A;  3RNF C;  1XF5 L;  3HVD A;  4WWM A;  3ZLZ A;  4GU2 A;  5CTR C;  5J17 A;  4M0W B;  2JZZ A;  2D2Q A;  1NVI D;  1R4N I;  1P9D U;  1TIF A;  4C80 A;  2HE7 A;  2DBY A;  2RPV A;  2WXM A;  4WH4 A;  4OVZ A;  3C0R B;  4P7I A;  1Y56 A;  4GDK A;  2OJW A;  1IGC A;  2AQ2 B;  1GNU A;  5G5G A;  2DAJ A;  4IKG A;  1WJ4 A;  2IDY A;  3I63 C;  1H8C A;  5EE0 A;  3R8B A;  3A1Q A;  1E5W A;  1V49 A;  1KLG D;  2AWT A;  3OLM D;  1S1Q B;  3H7P A;  3QWZ B;  2MP2 A;  1Q10 A;  2HD5 B;  4RGN A;  2FCM A;  4KZC A;  4TMA B;  4BKS A;  4DHZ E;  2KN5 A;  3BZD B;  2LJI A;  2DLB A;  2LGI A;  1N5X A;  1J7C A;  3VRB B;  1E7P B;  1FIQ A;  4C56 C;  2J0M A;  2L7R A;  2DZJ A;  4FXC A;  3DPD A;  2WU5 B;  3DWG C;  4BKS D;  2O2V B;  5BYS A;  2BW2 A;  2JZ3 B;  1YN4 A;  3FAH A;  4MGI E;  2ZVN A;  2N9K A;  2DYM A;  2V3P A;  2NPT A;  3PV1 A;  2MX2 A;  1WR6 E;  2X8X X;  3V6C B;  1ESF A;  2W54 A;  2MBH A;  2RDB C;  1EU3 A;  1YNT E;  2KAN A;  4XE0 A;  2LVQ A;  2LD9 A;  1B9R A;  4RM9 A;  3ZIM A;  1C3T A;  2ZJD A;  2KMA A;  1GG3 A;  4RGT A;  2OED A;  4G11 A;  2GRI A;  1TKY A;  4W9L A;  1SB3 C;  3B2F A;  2RGF A;  2G45 B;  4ASW C;  2MBB B;  2KDB A;  1L0X B;  1Z5S B;  4URK A;  3VTV A;  1ZE3 D;  3AE1 B;  3EGR A;  4N9F 4;  5I4D A;  2K8B A;  3B2G A;  1PYW D;  2G4S A;  2KHW B;  4X57 B;  1D5M C;  4KDL B;  2KFK B;  3AH7 A;  1YJ1 A;  2BYF A;  2VRR B;  4IC7 B;  2L76 A;  1QOG A;  1FNW A;  4L2Y A;  2LHE A;  3Q3F A;  4L1B A;  4EUT A;  2JWU A;  3Q69 A;  4NJ7 A;  1YQ3 B;  3AV8 A;  4R3D A;  3KVF B;  2XNA C;  4K7S A;  4KSL C;  3P4Q B;  3E56 A;  1JAL A;  3Q8A A;  1R4M B;  4ZHP A;  3DHH C;  2V9H A;  3HHM A;  1UNS A;  2JWZ A;  1L7Y A;  3U7D A;  3DBR B;  4AS1 A;  4MEL A;  3GE3 C;  1HA5 A;  4LJP B;  2IY0 B;  1SE2 A;  1J7B A;  1WR1 A;  3AE5 B;  1N63 A;  4BAX A;  2N9X A;  3R3M A;  4KV2 A;  3KWV A;  2INN E;  1EWY C;  3B08 A;  4JWS C;  2Z8L A;  2LXA A;  3EFC A;  2JU6 X;  3RYT A;  3SFE B;  3NZU A;  3WIM A;  2RDG A;  4WIP A;  3MFG A;  1X1M A;  1D5Z C;  4ZRK A;  5AUI A;  3PT2 B;  4HK2 A;  1TY2 A;  3KW5 B;  2LGD A;  1TGZ B;  3GZN B;  3PLU A;  1D4B A;  1N6Z A;  3H8H A;  4YTP B;  2WXN A;  2BWF A;  4ANV A;  3ZVV A;  1RLF A;  4K7U A;  3AI5 A;  2KQ4 X;  1L2N A;  2YEP F;  5H92 C;  4A3O A;  1GB4 A;  3DBS A;  1RYJ A;  1FFV A;  1V6E A;  3LXF A;  2K1F A;  2J52 A;  1F2R C;  1FNV A;  2MJE A;  4OZC A;  5EE3 A;  4K3C A;  3TSS A;  5E6N A;  3A4S C;  3T3O A;  2HTH A;  3DVG Y;  4DXG A;  2IGD A;  1D5X C;  2KC1 A;  4NZL B;  4AP4 C;  2QMT A;  1NYQ A;  1SE3 A;  4ZRP A;  4BKT A;  2BF8 B;  4ICV A;  1VR9 A;  1QIL A;  3BIN A;  1HTQ A;  3V61 A;  2MH7 A;  3CF6 E;  2R2O A;  5HKH A;  1E9M A;  5HFY A;  1L5P A;  4W9G A;  4XWT A;  5D94 A;  1JWU D;  1MG8 A;  4HKZ E;  2YEP B;  5E6P A;  3UI3 A;  3IFW B;  3TL5 A;  2MBO A;  4C4V A;  2HDE A;  1HQR D;  2IYD B;  3NS1 A;  3ALB A;  4EEW A;  1P3Q U;  4OZA A;  1AN8 A;  1GC7 A;  3M62 B;  2JVC A;  3U30 A;  1WXM A;  3ZQ4 A;  1V1O A;  3S2A A;  2KXJ A;  2G1E A;  1L4Z B;  5LLI A;  3CST A;  2KWU B;  2KYW A;  2QSD A;  3ZNI D;  4ZRI A;  3WAL A;  3GZN I;  3UIP B;  1OQY A;  3WAO A;  2FNJ B;  3ZRF A;  1HZ6 A;  1S3S G;  1I4H A;  1E8Z A;  3WCQ A;  1PUT A;  2R2Q A;  3VR9 B;  4P1C C;  1VZ6 A;  1A70 A;  4A20 A;  1V86 A;  2KJ6 A;  2FCN A;  2VH1 A;  4NQL B;  4ANX A;  3QAR A;  1TY0 A;  1L0V B;  3N20 C;  2JUO A;  2MW5 A;  2DYO A;  2DNF A;  2QEJ C;  2KTF A;  2NTT A;  3PRP B;  3VR8 B;  2K8C A;  5C2T B;  4JIO U;  2LJ5 A;  4PK1 A;  1CZP A;  1WXA A;  3IXS A;  1WIA A;  4DWF A;  4K81 A;  4OVU A;  2WP9 B;  1TZ1 A;  2C60 A;  1JRO A;  3ETR A;  4OZB A;  1WM2 A;  3AM9 A;  2WXH A;  1WGD A;  3SEB A;  5LXI B;  4GN1 A;  1XLQ A;  4GLS C;  2GB1 A;  3KWL A;  4RF1 A;  4DDG D;  5IO9 A;  3A9K B;  1WGR A;  2BWE S;  3JSV B;  1LXD A;  4FBJ B;  2KDM A;  1T0S C;  2I38 A;  4FHJ A;  2QIE B;  2BS2 B;  4YXD B;  2ASQ A;  4ICU A;  2E6X A;  5BMG A;  1NYR A;  3J9C A;  4FJY A;  4KGT A;  1MVK A;  4MM3 B;  3RPF C;  2WGS A;  2Y5P A;  2MHJ A;  4US9 A;  2DZK A;  1P98 A;  2ACZ B;  3EUB 2;  4BKG A;  3V62 A;  3DBL I;  2W3S A;  1TS5 A;  4MH8 A;  1C9F A;  1HTO A;  1WZ0 A;  2KLC A;  4IDI A;  4ZDV A;  1SXT A;  3MTN B;  1SSN A;  5D3I B;  3GP7 A;  2XK5 B;  3JW0 X;  4HWI B;  2ZPN A;  4NNJ B;  2K22 A;  2LZ6 A;  4DK5 A;  1Q5W B;  3L17 A;  4EOY A;  4IM3 A;  1XCQ L;  1LFD A;  3PHX B;  1NBF C;  4A3P A;  4BBN C;  3NZ3 A;  4W9K A;  1T0Q C;  3L4P A;  5EDS A;  3TEW A;  3A9J A;  2GBN A;  4KKI A;  4ZHO A;  3M3J A;  1WXS A;  3URY A;  1NI2 A;  4NAW B;  2A5U A;  2K0P A;  3AE3 B;  1K52 A;  4FLH A;  3AE4 B;  3IT6 B;  1C4C A;  3QA8 A;  4DQO C;  2NR2 A;  3RUL A;  3AB5 A;  2LRW A;  2QCZ A;  1SJE D;  3PS6 A;  3U7Z A;  3ZUN A;  2BKF A;  3RNE C;  2N1V A;  2ZNV C;  3NVV A;  4F7Z A;  3V05 A;  1E0Z A;  2IJ0 A;  4A6Q A;  1EUV B;  1FO4 A;  3P4P B;  3UQB A;  2I2Y A;  2CR5 A;  2IO2 B;  5FR3 A;  1FEH A;  1OEY J;  5D3D A;  1ZXI A;  2RDH A;  4FN2 A;  4HCN B;  2JT4 B;  3K9P B;  4AJW A;  1QOF A;  1E90 A;  2GBJ A;  1E7V A;  3N1X C;  3QK0 A;  1IBX A;  1A5R A;  2C9W B;  2K3U A;  4ZOH C;  4TKN A;  2WHI A;  1JWM D;  1LGR A;  4AQ7 A;  1UEL A;  4WAF A;  1V5O A;  1WYG A;  1I35 A;  1IP9 A;  3APD A;  1WY8 A;  3GB1 A;  3H1U A;  4GIV A;  2WS3 B;  1WGH A;  1HE8 A;  2LVO A;  2KX3 A;  3CIR B;  2BBC A;  4HPL B;  2KJH B;  2FID A;  4DHJ D;  3RZW C;  4XC2 A;  5FKA C;  2BB5 A;  3ENE A;  3NHE B;  4PS8 A;  5JHA A;  2PE9 A;  4N58 A;  4RNA A;  1DYQ A;  2MSE D;  2CKH B;  2VZK B;  3APC A;  3VTW A;  3JYU A;  3GOE A;  4BVU C;  1ZKH A;  2N7D A;  1VD2 A;  4HCP B;  4YSX B;  2KVR A;  2BVC A;  1PGA A;  1ET9 A;  2DYB A;  4M00 A;  4II3 B;  4KVG B;  3NRZ A;  1J8C A;  2HJ8 A;  1HXY D;  1UZX B;  2ZW1 A;  4WQO B;  3Q8C A;  2O6V A;  1FPY A;  2MJD A;  1TBE A;  3T8M A;  3VUX A;  3ZO5 B;  1SE4 A;  3TJP A;  2MJ3 A;  4XDD A;  2CJN A;  3EHV A;  1SJH D;  4WQM A;  3TMP B;  2MLB A;  2LXC A;  4BFR A;  1WX7 A;  3HM6 X;  3TEY A;  3NG0 A;  1UGJ A;  2K5P A;  4KIK A;  1I4R A;  4AWJ A;  3UIO B;  1V1P B;  2O6V D;  4F8C B;  2M0X A;  1UBQ A;  2JX5 A;  2I1J A;  4G3X B;  4IM0 A;  2PVO D;  1HZ5 A;  1WMH B;  2KTR A;  2MBQ A;  2WXF A;  1T0Y A;  4I6L B;  2C5L C;  3NVW A;  1FFU A;  1WF9 A;  2PVG C;  2B3A A;  3PZ8 A;  1WWT A;  1N62 A;  1H4R A;  2IBI B;  5EE1 A;  3I57 A;  2OHF A;  1VJK A;  3PZD A;  1Z2M A;  2QJL A;  3AU5 A;  2K6Q A;  2FIF A;  1F9J A;  3ZTC A;  4NQK E;  3MC9 A;  2QHO A;  2D5G A;  3KUD B;  3ZNZ B;  4W9F A;  1SF0 A;  2KK8 A;  2YVC A;  2WU2 B;  3RNC C;  4ARC A;  4GDL A;  2MA9 B;  2DX5 B;  5LNK 1;  4XYC A;  1U4A A;  3NVZ A;  3LB8 C;  3APF A;  2GLS A;  2G3Q B;  3T3N A;  2BYV E;  3AUL A;  3L0W B;  2SAK A;  3WAN A;  1WX9 A;  1T0R C;  2J7Q B;  1K53 A;  4II2 B;  1RAX A;  2E3T A;  4AUQ C;  1VDV A;  1ISN A;  3RFZ B;  2I1K A;  1NDD A;  3NUH B;  1GJZ A;  5J2R A;  4OW0 A;  2BS4 B;  1V81 A;  3N30 A;  3FIL B;  3AMZ A;  1JQ4 A;  1NI3 A;  4MJS A;  4US8 A;  2WDT B;  5FR6 A;  2GBM A;  5IA7 A;  5HG2 A;  1IGD A;  3VFK A;  3PTF C;  4LK0 M;  3QHT A;  1JWB D;  3ZXR A;  2M8S A;  4MGZ E;  1T3Q A;  2MEK A;  3I5J C;  3Q3N C;  2K8H A;  4K7W A;  2N9P C;  4A55 A;  4YL8 A;  3BY4 B;  3P2B A;  4IWO A;  4TV3 A;  4EFO A;  1Y8R C;  4XZ4 A;  4FJV B;  2NBU A;  3EA6 A;  2AX5 A;  2XBB C;  1QLB B;  3BYT B;  4JL9 A;  5DPR A;  2KKC A;  4YT0 B;  4C00 A;  1TS2 A;  2G4D B;  4M02 A;  4HKQ A;  1DOX A;  4F1S A;  2INP E;  3HM3 A;  3JVZ X;  2AQ3 B;  1Q0W B;  2IZV B;  3PVL A;  2SEB D;  1UWM A;  3ZGZ A;  3X0W A;  1GOZ A;  4ANW A;  2PLP A;  1WZ3 A;  4ACF A;  3B1L X;  2WWZ A;  2MWS B;  3R2I A;  1VRA B;  3H9D A;  3NS8 A;  2IPK D;  4GDK B;  5AZH A;  4JGH B;  4W9I A;  4A90 A;  2PTL A;  3BYY B;  2D3B A;  3LJ3 A;  4RGM A;  5BYQ A;  2BTE A;  4XX5 A;  1I4G A;  1ZP0 B;  3WAP A;  2IO1 B;  3BK1 A;  4DDI D;  4W9D A;  4LNI A;  2DAF A;  1V8C A;  3A1Q B;  2KOX A;  4ANU A;  4HDO A;  2DWQ A;  4TSS A;  2M19 A;  3DBH B;  5BO4 B;  3H7P B;  2KMM A;  2MP2 B;  2KWC A;  5CHW A;  1I7H A;  5CX3 A;  1RFA A;  1WSP A;  4CYE A;  1UBI A;  2CHX A;  5LXH A;  1KRH A;  4DHZ B;  3A33 B;  4IWQ A;  3RI7 C;  3VXW A;  4JX1 C;  3AEG B;  2L8J A;  1FXA A;  1M94 A;  4LTU A;  4LNF A;  3PRM B;  1UUP A;  2JXX A;  3ECI A;  2DHZ A;  1RRB A;  2BT6 A;  4EE2 A;  5HHD G;  2G9H D;  4QAY A;  4HPM B;  1R4M I;  4NY0 A;  2CU1 A;  4LNO A;  2H89 B;  2FUH B;  3DOW A;  4FHK A;  5G2N A;  2L3Z A;  3PGE A;  4J6I A;  3DBR I;  4WAA A;  2NPT B;  3SR6 A;  1QKZ A;  4MGK E;  3VHT C;  1C4P A;  1TJE A;  1B1Z A;  1QT9 A;  2LVP A;  5D7G A;  1EO6 A;  3RNB C;  4W9H A;  3IAM 1;  3BVG A;  3NOB A;  2LWP A;  4KX6 B;  2BGF A;  1KF6 B;  1PFD A;  1OFF A;  5IOI A;  2W55 A;  1IUE A;  4CO7 A;  1SIJ A;  2M56 B;  4MEM A;  2BB6 A;  4FUL A;  4WJP A;  5CHF A;  3WA0 A;  4LJO B;  4MGY E;  1KFY B;  2KLG A;  5IAA C;  3VDZ A;  1MJD A;  2INC C;  1QQR A;  3AE2 B;  3QQ8 B;  3Q8F A;  4DXA B;  3DBH I;  4HVB A;  3BII D;  1KLV A;  3P1M A;  5JH5 C;  2BQQ A;  3MC8 A;  3K9O B;  4RFB A;  2M17 A;  1YN5 A;  3ZRC A;  2AQ1 B;  4N59 A;  1KJT A;  1ZUD 2;  2D11 A;  1FCC C;  3H7S A;  3BK2 A;  1N5W A;  3AU4 A;  3NZS A;  3OJ4 B;  4PT5 A;  3ABV B;  2ZW0 A;  5J18 A;  3RCZ A;  4J3O D;  2V1Y A;  4JQW C;  2W3R A;  4ZRQ A;  3DVN V;  2LUE A;  1WM3 A;  3AEF B;  3QX1 A;  2RSU A;  4NAM A;  1R7S A;  1WRD B;  4FAD A;  2R61 A;  3Q14 C;  4H2A A;  1C78 A;  1YQ4 B;  4WWP A;  1GAQ B;  2D3C A;  4MDK E;  3HK0 A;  3X23 A;  3C19 A;  2Z0E B;  4GMV A;  1C77 A;  1KTK A;  2WXL A;  4GXB A;  1JCK B;  3EEC A;  2PW9 A;  3MHS D;  1N60 A;  4WJN A;  1IPG A;  3RMK C;  2Z59 B;  4RH6 A;  2FAZ A;  1F52 A;  1WFY A;  5TR5 A;  2LGY A;  2WX0 A;  3OG5 A;  1FNU A;  4XGA B;  2J0J A;  3AE6 B;  4M0W A;  1XXG A;  3TBL D;  5HI1 A;  2D10 A;  4Q2J A;  2NBW B;  4I6N B;  1F77 A;  2UU7 A;  4WJO A;  2ZPY A;  4PS7 A;  1MG4 A;  1TTN A;  4RCO A;  4GOC A;  4WWO A;  2J0K A;  3Q3O C;  1ZPS A;  1OTR B;  2KO3 A;  3L54 A;  2AYO B;  3LYY A;  4HXD A;  2L0T A;  4TUU A;  3FC4 A;  3PLV A;  1QOA A;  1K51 A;  3A4R A;  3IBE A;  1VCB A;  1ROE A;  2KZR A;  1EM7 A;  1K8R B;  2D3A A;  3E9S A;  2EKE C;  3EC8 A;  1TKG A;  2CS4 A;  3L08 A;  1T5X D;  2JZP A;  1GUA B;  2OJR A;  3AE8 B;  2H88 B;  3R2T A;  1PGB A;  1DGJ A;  4P6V F;  4TQ0 A;  2JRH A;  3ML8 A;  1ZDX A;  3VUW A;  3C8Y A;  3DHI C;  4MAC A;  2GOW A;  4MSM B;  4PYZ A;  4YTN B;  1XLP A;  1L6V A;  2WNM A;  1V97 A;  3I3T B;  2LRU A;  4YWG G;  3V6E B;  3P4S B;  1FCL A;  5IP4 D;  3IVF A;  5AEK B;  2WXP A;  1KH0 A;  1VLB A;  2IND C;  1WGY A;  4HJK A;  1HEZ E;  4IUM B;  2O2V A;  2UYZ B;  1XLO A;  2L83 A;  2KDF B; 
#chains in the Genus database with same CATH homology
 3PZD A;  2LXA A;  1Z2M A;  2RD0 A;  3AU5 A;  3ML9 A;  2K6Q A;  2FIF A;  4M8M A;  1F9J A;  3LDZ E;  3WAM A;  1WGG A;  3RYT A;  3RZF A;  2ZEQ A;  3MJW A;  3ZTC A;  3NZU A;  4NQK E;  3WIM A;  2NS5 A;  3UGB B;  2QHO A;  1X1M A;  4ZRK A;  3UF8 A;  3TCA A;  1J19 A;  3KUD B;  3PT2 B;  4HK2 A;  3KW5 B;  3ZNZ B;  2KD0 A;  2LGD A;  1TGZ B;  4W9F A;  3PLU A;  2KK8 A;  5JHB A;  2FCS A;  4MH0 E;  3VVW B;  2YVC A;  2PJH A;  2BWF A;  2K6D B;  4ANV A;  3OAW A;  3ZVV A;  1RLF A;  2MA9 B;  2RPQ A;  4GDL A;  4K7U A;  3AI5 A;  1L2N A;  2DX5 B;  2XEW A;  4PS3 A;  2V4L A;  4W9J A;  4A3O A;  4E74 A;  4AOF A;  4LCD E;  3DBS A;  3ZTD A;  1U4A A;  4IWP A;  2BPS A;  1V6E A;  2N1W A;  3APF A;  2K1F A;  3N32 A;  2G3Q B;  3D32 A;  1AAR A;  3CMM B;  2BYV E;  3AUL A;  5E6N A;  4G0N B;  5CHV C;  3HIZ A;  3A4S C;  3L0W B;  2HTH A;  2KFK A;  3DVG Y;  4RMA A;  3VH4 B;  3WAN A;  1WX9 A;  2KC1 A;  5C1Z A;  1BT0 A;  4AP4 C;  4BOZ B;  1PQS A;  2J7Q B;  5JZE B;  3TIX A;  4BKT A;  2BF8 B;  3M95 A;  4II2 B;  4ICV A;  1RAX A;  4AUQ C;  1ISN A;  3BIN A;  4WJQ A;  1EF5 A;  2I1K A;  1NDD A;  3V61 A;  1YQB A;  2JPH A;  3KUC B;  3QC8 B;  1OEY A;  3CF6 E;  1GJZ A;  5J2R A;  2R2O A;  2KFJ A;  5HKH A;  5KHO A;  1V81 A;  3N30 A;  2IO0 B;  2KMC A;  1OGW A;  3VQI A;  4MJS A;  2WDT B;  5FR6 A;  5GMV A;  3QJZ A;  5C23 A;  3QAQ A;  2GBM A;  5IA7 A;  4E71 A;  4W9G A;  5D2M B;  1XD3 B;  3VFK A;  3PTF C;  2DZI A;  5D94 A;  1MG8 A;  2N4F A;  1GC6 A;  4EZL A;  3QHT A;  3NY5 A;  3PHW B;  1WI0 A;  2M8S A;  2BKR B;  3KYC D;  3IFW B;  2L05 A;  4KSK C;  5E6P A;  4MGZ E;  3R7R A;  1JRU A;  3SDL C;  1FXT B;  3TL5 A;  2JF5 A;  1WMH A;  2MBO A;  4KDI C;  1EF1 A;  3UIN B;  2K8H A;  4K7W A;  2IY1 B;  2N9P C;  4YL8 A;  1E8Y A;  3DVG X;  2IYD B;  4EEW A;  3ALB A;  4ZRJ A;  1P3Q U;  3EFU A;  4B95 A;  3BY4 B;  4BBN F;  3P2B A;  3L10 B;  2DEN B;  1GC7 A;  3ZDT A;  3M63 B;  3M62 B;  4IWO A;  4TV3 A;  3ZNH B;  4EFO A;  1Y8R C;  2JVC A;  3U30 A;  1WXM A;  4XZ4 A;  4FJV B;  1WE7 A;  2NBU A;  3RD2 A;  3S2A A;  3ZDM C;  2KXJ A;  1WE6 A;  2XBB C;  2CHZ A;  1WJ6 A;  4JL9 A;  5DPR A;  4G50 A;  5LLI A;  3DCG A;  3CST A;  4MSQ B;  2KWU B;  3W1S C;  2KKC A;  3PSE B;  2AEH A;  2G4D B;  3L16 A;  1V5T A;  3ZNI D;  4ZRI A;  3WAL A;  4AJY B;  3KYD D;  3GZN I;  1G6J A;  4F1S A;  3UIP B;  1OQY A;  1UH6 A;  3HM3 A;  2FNJ B;  3O65 B;  3JVZ X;  1WX8 A;  3WAO A;  3ZRF A;  1KOT A;  3PVL A;  1Q0W B;  2IZV B;  3KH0 A;  3IG3 A;  3QIJ A;  3Q3J A;  3W1S A;  1C1Y B;  1YD8 U;  4GB9 A;  3X0W A;  4ANW A;  1S3S G;  2MQJ A;  1V9J A;  1WZ3 A;  1E8Z A;  3B1L X;  2R2Q A;  2N7E A;  4HDQ A;  2WWZ A;  1SGH A;  2MWS B;  1WH3 A;  4EZJ A;  2KJR A;  1V2Y A;  1I42 A;  3R7Q A;  2Z0D B;  3PRE A;  2JY6 A;  3H9D A;  3NS8 A;  4A20 A;  3R66 C;  1V86 A;  2KJ6 A;  4GDK B;  5AZH A;  2FCN A;  4I6P A;  4JGH B;  4W9I A;  4NQL B;  4IG7 B;  1WJU A;  4ANX A;  3LJ3 A;  2KNB A;  2D3G A;  1UGM A;  3QAR A;  4XX5 A;  2JUO A;  2KWV B;  3A9J B;  3WAP A;  2IO1 B;  2K25 A;  2MW5 A;  4W9D A;  4DDI D;  5D6J B;  2DYO A;  3VUY A;  3OJ3 A;  2DAF A;  2PPH A;  3A1Q B;  2KOX A;  4ANU A;  2KTF A;  2AL6 A;  4HDO A;  2MBE A;  3PRP B;  4K1R B;  2K8C A;  2Y5B B;  3VH3 B;  5BO4 B;  3H7P B;  4LDT D;  1D3Z A;  1Q1O A;  4JIO U;  2LJ5 A;  1WXV A;  1QZE A;  2MP2 B;  1WJN A;  3SHQ A;  2KWC A;  5CHW A;  2FCQ A;  5CX3 A;  4HLE A;  1RFA A;  4CYE A;  1UBI A;  1WXA A;  2CHX A;  2RR9 A;  5LXH A;  4DHZ B;  3A33 B;  1WIA A;  4IWQ A;  4DWF A;  3VXW A;  1YX5 B;  3B0A A;  2L0F A;  4K81 A;  2L8J A;  4OVU A;  3V60 A;  2NCN A;  1TZ1 A;  2C60 A;  4ZYN A;  1SE9 A;  4TQ1 A;  1E8W A;  1WM2 A;  2MRP A;  5DPS A;  2W9N A;  2ZNV B;  3H6N A;  1WGD A;  5LXI B;  1SIF A;  2EMS A;  1M94 A;  2JRI B;  4GN1 A;  3PRM B;  4DDG D;  2JXX A;  3ECI A;  2DHZ A;  3A9K B;  1J0G A;  1RRB A;  1WGR A;  5E6O A;  2BWE S;  3JSV B;  3L13 A;  2GBR A;  1XQQ A;  1LXD A;  4FBJ B;  1YX6 B;  3SD5 A;  1V80 A;  4HPM B;  1R4M I;  2KC2 A;  4FHJ A;  3PPA A;  5L83 A;  4NY0 A;  3CSF A;  4DHJ B;  2CU1 A;  1UD7 A;  2ASQ A;  3IHP C;  1LQB A;  4ICU A;  3ZNG C;  2FUH B;  3DOW A;  4FJY A;  3ZKJ C;  4FHK A;  5G2N A;  2L3Z A;  3PGE A;  4J6I A;  3DBR I;  4WAA A;  2C7M B;  2NPT B;  5DPT A;  4W9C A;  2DZK A;  4PYU A;  4MGK E;  1CMX B;  1P98 A;  3VHT C;  4W9E A;  4BKG A;  3V62 A;  3DBL I;  3PRZ A;  2LVP A;  5D7G A;  1EO6 A;  1WZ0 A;  2KLC A;  4ZDV A;  4IM2 A;  3ZLZ A;  3MTN B;  4W9H A;  4GU2 A;  5CTR C;  1E8X A;  3DQV A;  2LWP A;  3NOB A;  2BYE A;  5J17 A;  2BGF A;  2V3S A;  2XK5 B;  3JW0 X;  4HWI B;  4M0W B;  2ZPN A;  2JZZ A;  2K39 A;  4RM8 A;  2D2Q A;  4NNJ B;  4CHK A;  5AZG A;  2LZ6 A;  4CO7 A;  1Q5W B;  4DK5 A;  2KDE B;  1R4N I;  3L17 A;  4MEM A;  2GMI C;  4EOY A;  1P9D U;  4IM3 A;  1P0R A;  1LFD A;  2MCN B;  2UWQ A;  4FUL A;  3PHX B;  2ZCC A;  2HE7 A;  4WJP A;  1NBF C;  4A3P A;  5CHF A;  4BBN C;  3WA0 A;  4LJO B;  3ONS A;  4MGY E;  3C0R B;  4P7I A;  4GDK A;  2KLG A;  2LGX A;  2ZVO A;  5IAA C;  3VDZ A;  2ZZP B;  4W9K A;  3QQ8 B;  2NBV B;  1GNU A;  5EDS A;  2DAJ A;  1WJ4 A;  2LI5 A;  3A9J A;  2GBN A;  2L00 B;  4DXA B;  1H8C A;  1ZGU B;  4KZ0 A;  3DBH I;  4HVB A;  2O6V B;  4B6W A;  4BOS C;  3M3J A;  1WXS A;  3A1Q A;  1KLV A;  1NI2 A;  1E5W A;  4NAW B;  2NVU I;  3RUI B;  3T9L A;  1V49 A;  4GGQ A;  5JH5 C;  2AWT A;  2A5U A;  2WYQ A;  4E3C A;  3OLM D;  2A4Z A;  2LAS A;  4FLH A;  1S1Q B;  3QA8 A;  3K9O B;  3H7P A;  2NR2 A;  4NPN A;  3RUL A;  2M17 A;  3QWZ B;  2MP2 A;  2LRW A;  3ZRC A;  2HD5 B;  3PS6 A;  2KDI A;  2FCM A;  1KJT A;  3VTU A;  1P1A A;  2D11 A;  2IO3 B;  3ZUN A;  1XT9 B;  4KZC A;  3UQA A;  3H7S A;  2C7H A;  2BKF A;  3AU4 A;  4KIK B;  2N1V A;  2ZNV C;  3OJ4 B;  3NZS A;  4F7Z A;  4BKS A;  5L95 C;  3DVN U;  1EUV B;  4DBG A;  4DHZ E;  5J18 A;  3RCZ A;  3UQB A;  2KN5 A;  3ZW3 A;  2V1Y A;  4JQW C;  2CR5 A;  2IO2 B;  2M1M A;  2LUE A;  3DVN V;  1WM3 A;  1OEY J;  2KX0 A;  2N9E B;  4FN2 A;  2KTR B;  2JT4 B;  3K9P B;  3QX1 A;  4HCN B;  4AJW A;  2RSU A;  3A9K A;  1E90 A;  2GBJ A;  1YIW A;  1E7V A;  3JSV A;  2J0M A;  1WRD B;  2L7R A;  2DZJ A;  2KQS A;  4FAD A;  3DPD A;  2CHW A;  3QK0 A;  4FA6 A;  1A5R A;  2C9W B;  4BKS D;  2O2V B;  4TKN A;  4WWP A;  4EKU A;  2JZ3 B;  2DZM A;  1UEL A;  4MDK E;  4NJ6 A;  4MGI E;  1V5O A;  2ZVN A;  3HK0 A;  4FJZ A;  3X23 A;  1I35 A;  2Z0E B;  2DYM A;  4GMV A;  1IP9 A;  3APD A;  4GXB A;  4LDT B;  4MM3 A;  2NPT A;  1WY8 A;  3PV1 A;  3EEC A;  2MX2 A;  1WR6 E;  3H1U A;  4GIV A;  3V6C B;  3MHS D;  4B9K A;  1WGH A;  1E7U A;  1HE8 A;  2MBH A;  2KQ7 A;  3RT3 B;  4WJN A;  1IPG A;  2PE6 B;  2LVO A;  2KX3 A;  2KAN A;  2Z59 B;  2LVQ A;  2FAZ A;  2YLM A;  4HPL B;  2LD9 A;  1WFY A;  2KJH B;  4RM9 A;  5TR5 A;  2LGY A;  2FID A;  5AZF A;  3ZIM A;  4DHJ D;  1C3T A;  2ZJD A;  3RZW C;  2WX0 A;  4XC2 A;  1IYF A;  2KMA A;  1GG3 A;  2XK5 A;  2J0J A;  3ENE A;  3NHE B;  4PS8 A;  3TBL D;  5JHA A;  2PE9 A;  4G11 A;  4OVV A;  2D10 A;  2MSE D;  2CKH B;  4GDL B;  3APC A;  2EMT A;  2NBW B;  4JLC A;  4W9L A;  3VTW A;  4I6N B;  4WJO A;  2ZPY A;  3JYU A;  2RGF A;  3GOE A;  4PS7 A;  1TTN A;  2G45 B;  4ASW C;  4BVU C;  1ZKH A;  2MBB B;  2N7D A;  1VD2 A;  2KDB A;  1Z5S B;  4GOC A;  5KHQ A;  2REX A;  4WWO A;  3SU8 X;  4HCP B;  4URK A;  2J0K A;  3VTV A;  5DCN A;  4N9F 4;  1OTR B;  2KO3 A;  2KVR A;  1ZW7 A;  4M8N A;  2K8B A;  3KUZ A;  2AYO B;  3L54 A;  2D07 B;  2G4S A;  2KHW B;  2DYB A;  4II3 B;  4X57 B;  4HXD A;  2L0T A;  4KDL B;  4TUU A;  4KVG B;  2KFK B;  3PLV A;  1YJ1 A;  2BYF A;  2VRR B;  1J8C A;  4IC7 B;  3A4R A;  2HJ8 A;  2L76 A;  3IBE A;  1UZX B;  1VCB A;  4WQO B;  2O6V A;  1WYW B;  2KZR A;  1TBE A;  1K8R B;  3T8M A;  4NAW A;  2EKE C;  3EC8 A;  3VUX A;  3ZO5 B;  4WWN A;  3Q3F A;  2CS4 A;  3TJP A;  3L08 A;  2C7N B;  4EUT A;  1GUA B;  2OJR A;  3AXC A;  4NJ7 A;  3EHV A;  3KVF B;  4K7S A;  3TMP B;  2MLB A;  4KSL C;  2LXC A;  4BFR A;  1WX7 A;  3HM6 X;  4MJS B;  4TQ0 A;  2JRH A;  2AL3 A;  3ML8 A;  3DDC B;  3VAW A;  3VUW A;  4KIK A;  4AWJ A;  2M4N A;  3UIO B;  2GBK A;  2GOW A;  4IW0 A;  4MSM B;  4PYZ A;  2O6V D;  4F8C B;  2M0X A;  2ZCB A;  2OOB B;  1UBQ A;  3HHM A;  3W1Y A;  2WX1 A;  3I3T B;  2I1J A;  2JWZ A;  5G55 A;  4G3X B;  1L7Y A;  4IM0 A;  2LRU A;  3U7D A;  1LM8 B;  4EZK A;  3U8Z A;  3V6E B;  3N3K B;  4MEL A;  2KTR A;  1WMH B;  2PEA A;  4LJP B;  2IY0 B;  2MBQ A;  3IVF A;  1WR1 A;  1T0Y A;  5AEK B;  4I6L B;  2N9X A;  2C5L C;  1WGY A;  4HJK A;  3R3M A;  4KV2 A;  3QCA A;  4GSW A;  1KM7 A;  1WF9 A;  5DPW A;  2B3A A;  3B08 A;  2O2V A;  4IUM B;  2IBI B;  1H4R A;  2UYZ B;  2KDF B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...