1VD2A

Solution structure of the pb1 domain of pkciota
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
89
structure length
89
Chain Sequence
GPLGSQVRVKAYYRGDIMITHFEPSISFEGLCNEVRDMCSFDNEQLFTMKWIDEEGDPCTVSSQLELEEAFRLYELNKDSELLIHVFPC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of atypical protein kinase C PB1 domain and its mode of interaction with ZIP/p62 and MEK5
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Protein kinase C, iota type
total genus 12
structure length 89
sequence length 89
ec nomenclature ec 2.7.11.13: Protein kinase C.
pdb deposition date 2004-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00564 PB1 PB1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1vd2A00
2NPTB 2RR9A 4YL8A 4W9DA 4FHJA 4E71A 2KO3A 2KQSA 4TQ1A 3L54A 2O2VB 2KC2A 3OAWA 2L0FA 4HK2A 3IHPC 2KWVB 1WGRA 4AUQC 3A9JB 2XEWA 3SDLC 2ZNVC 3ZDTA 5IA7A 5LXIB 3JSVB 2FCNA 4K7WA 1KLVA 1E8ZA 2A4ZA 2EKEC 1J0GA 2WX0A 1RRBA 3IFWB 3PLVA 2LVOA 4HVBA 4FLHA 4G50A 2C7MB 4PYUA 3CSFA 1P3QU 2DYOA 1SE9A 2LD9A 3L16A 3QIJA 4MSMB 4B6WA 2KANA 3QJZA 2LXAA 1R4NI 2JZ3B 4W9LA 5DCNA 3IG3A 4RM9A 3KUZA 5DPSA 3I3TB 4GB9A 4JL9A 1GG3A 5G55A 3DBRI 1QZEA 2CU1A 3SHQA 2L00B 3CSTA 2YVCA 4WAAA 1J19A 1E8YA 1YD8U 2IO0B 3WANA 1WXSA 2LASA 3ZDMC 2KVRA 1UBIA 4E74A 4W9FA 2K39A 5DPTA 1EUVB 2AL6A 2C60A 3RD2A 2BF8B 4KDLB 4CHKA 4ANWA 4AP4C 1UBQA 1M94A 4HCNB 1V5OA 3QC8B 3W1SA 3L08A 2PE6B 4OVUA 5FR6A 2K1FA 2HTHA 3QA8A 3U8ZA 4A20A 2UWQA 4NJ7A 3PRPB 1MG8A 2AWTA 2JT4B 4MGZE 2LXCA 1KOTA 3LJ3A 1OEYA 3NOBA 2C7NB 2O6VD 2JVCA 2RD0A 4TQ0A 3H1UA 4FJVB 1X1MA 3DQVA 4PYZA 2IY1B 3ENEA 5KHOA 2MW5A 3OLMD 2LVQA 4WJQA 1E5WA 2KFJA 1T0YA 4GGQA 4IM2A 3APDA 3V61A 3UINB 2FIDA 2FAZA 3PZDA 3DVGY 3HK0A 3JYUA 4PS8A 3VQIA 3VDZA 3VUYA 1J8CA 2ZPNA 2J0JA 2GOWA 1UELA 2ASQA 1G6JA 2MQJA 4MSQB 5JH5C 2L3ZA 2GBRA 2IY0B 3CMMB 1WGGA 2M17A 4GU2A 1H8CA 2LGXA 3N30A 1OQYA 1ZKHA 4ANXA 4XZ4A 4ICVA 5D7GA 5E6PA 2CR5A 3DDCB 3MHSD 2L05A 3O65B 1Q0WB 2IO3B 3KH0A 5BO4B 4GIVA 4BKSD 2IYDB 1OEYJ 1Y8RC 3B08A 3L0WB 3B1LX 1YX5B 1BT0A 2JUOA 3QCAA 2JZZA 4II3B 3UIOB 4B95A 4MH0E 2KN5A 5TR5A 3R7RA 1L7YA 4BOZB 2KX3A 4TV3A 1P9DU 4ICUA 4PS7A 4MGIE 1JRUA 2MBBB 4HLEA 3A33B 4DHZB 2D11A 4I6PA 4EFOA 2XK5B 4EZKA 2KC1A 4W9CA 3DVNU 3OJ3A 5AZGA 4KSLC 3T9LA 3WAMA 1WYWB 2JWZA 4KIKA 4WWPA 3PTFC 5AEKB 4P7IA 2NPTA 1E8XA 1WZ3A 1D3ZA 3VH4B 4BKSA 5C1ZA 4ZRIA 3R66C 3NY5A 2LRUA 1TGZB 1TBEA 2LUEA 2RPQA 4X57B 1S1QB 4MJSA 3VTWA 3P2BA 1AARA 1VD2A 3SD5A 3KW5B 3PVLA 2MBHA 1XD3B 3QARA 1WXMA 4KSKC 1ZW7A 3EC8A 2KMCA 3ZW3A 1TTNA 3QWZB 3AXCA 2B3AA 4BOSC 1WR6E 2MLBA 2MA9B 4BBNC 1Z2MA 2ZZPB 4OVVA 2KHWB 4GXBA 2WWZA 3ML9A 3WALA 2JF5A 4IG7B 3DOWA 1WXVA 2A5UA 2CHXA 2CHZA 4K7SA 4TUUA 3WAOA 4CO7A 4ZRJA 2EMTA 3PHWB 3H7SA 4EOYA 1RAXA 2N9XA 3EHVA 2YLMA 3L13A 3DPDA 4KV2A 2ZVOA 2ZEQA 3A9KA 5DPWA 2NS5A 4URKA 2GBJA 4ZRKA 3KUCB 5C23A 3WAPA 5CTRC 3RYTA 4DDGD 1HE8A 3ECIA 3GOEA 2LI5A 3S2AA 2JRHA 4G3XB 1P1AA 2KQ7A 1Z5SB 3U30A 5HKHA 4MM3A 4M8NA 4GSWA 4MGKE 5IAAC 5J18A 5LLIA 3PSEB 3VVWB 2BYVE 2BWES 2GBNA 3R7QA 1YJ1A 5CHWA 4DHJD 4NAWA 4BKTA 2GBMA 4NNJB 2ZNVB 3QHTA 3ZLZA 3Q3FA 1FXTB 2R2OA 2J0KA 4E3CA 2ZCBA 1WJUA 4ZDVA 2LWPA 3APCA 1U4AA 4RMAA 3EECA 4I6NB 1P0RA 4K81A 2L76A 2L7RA 5E6NA 4I6LB 2GMIC 4DHJB 1WM3A 1V81A 2GBKA 3KYDD 4LJOB 3UQBA 2M8SA 1YIWA 3ZKJC 1WJ4A 4KZ0A 2N7DA 3MJWA 2Z59B 3C0RB 3R3MA 2G4SA 2N4FA 2ZJDA 1EF5A 5E6OA 5JHBA 3VXWA 1XT9B 3VUWA 4FJYA 2KDFB 3KYCD 4DBGA 3HM6X 3PV1A 5J2RA 2CS4A 1WGHA 2DYMA 4G0NB 1EF1A 4JIOU 4IWPA 4ZYNA 2M0XA 3X0WA 4W9JA 3VH3B 3ZUNA 1UH6A 2DYBA 2DHZA 1SIFA 3PRMB 1VCBA 3DVGX 2XBBC 5JZEB 3NZSA 2WDTB 2M4NA 1V6EA 1PQSA 5J17A 4IM0A 1C3TA 2LVPA 1NBFC 4GDLA 3ZO5B 4W9HA 3ZIMA 3AI5A 4M0WB 2VRRB 5LXHA 4CYEA 3VTVA 2NR2A 3DBHI 3QX1A 4LCDE 3B0AA 2BKRB 2N9PC 3MTNB 1WIAA 3PGEA 4LJPB 2FCQA 4KIKB 4B9KA 2DAJA 1ISNA 4IUMB 4EZLA 4EZJA 2PE9A 4GDKA 1A5RA 2G45B 4FJZA 4LDTB 3ML8A 3ONSA 5D6JB 2KK8A 3JW0X 1WF9A 2K8BA 4IWOA 1IYFA 3SU8X 3PREA 3ZNHB 2BGFA 3A9KB 3PHXB 4MJSB 1F9JA 1OTRB 2NBWB 3RT3B 2J7QB 2DAFA 4GN1A 1SGHA 1UGMA 3V6EB 4MEMA 4HCPB 2KWUB 3ZTDA 3DBLI 3L10B 4WWNA 2N9EB 1WM2A 2IZVB 4ASWC 2EMSA 4MELA 1WI0A 2Y5BB 4MGYE 1Q5WB 2KTFA 3A1QA 2MWSB 2LRWA 4AOFA 1UD7A 4NQLB 3V60A 2WX1A 2CHWA 2V3SA 4WWOA 2KOXA 5CHFA 2LGYA 1LFDA 3TIXA 3VFKA 3W1YA 1V49A 3TJPA 1WMHB 2V4LA 3DVNV 3Q3JA 2ZCCA 4NQKE 2DZJA 4HDOA 2MX2A 1LQBA 2MBOA 4IWQA 1UZXB 2WYQA 2D2QA 2QHOA 3L17A 1NI2A 2AEHA 1TZ1A 3JSVA 3H7PA 5L83A 5D94A 4HPMB 5JHAA 3RUIB 1WGDA 4TKNA 4A3PA 3NHEB 3U7DA 4A3OA 5DPRA 2RSUA 3N3KB 4JGHB 4K7UA 4RM8A 4XX5A 2PJHA 1EO6A 1WJ6A 5D2MB 4HXDA 3OJ4B 4NJ6A 2N1WA 4AJWA 2O6VA 2DZMA 3K9OB 1Q1OA 1YQBA 4HPLB 3BINA 1RLFA 2KJ6A 4AWJA 2KTRA 3A4RA 4AJYB 1P98A 4NAWB 3TMPB 4EUTA 4BKGA 3EFUA 3TBLD 3UIPB 1K8RB 2KNBA 2BKFA 3AU5A 1WH3A 3M95A 1V2YA 2DZKA 2KZRA 1V5TA 3NZUA 2KFKB 4IM3A 2D10A 4BFRA 3H9DA 1V9JA 3TL5A 5L95C 2D07B 3M62B 3RULA 4FULA 3APFA 3ZRFA 3IVFA 3DBSA 4II2B 1CMXB 1ZGUB 3PT2B 1I42A 3UQAA 3WIMA 2KLGA 4K1RB 3UF8A 2MP2B 2REXA 5GMVA 3ZRCA 2FUHB 3VHTC 1E7VA 2JY6A 4EEWA 3M63B 3TCAA 1WX8A 4GMVA 1GUAB 1GC6A 1YX6B 3UGBB 3VTUA 1R4MI 2JXXA 3PS6A 4FBJB 3CF6E 4F1SA 2MBQA 4G11A 3D32A 2KX0A 2K8HA 2IO2B 1H4RA 2FIFA 2KDIA 1IP9A 3T8MA 4GDKB 3QK0A 2DZIA 4KVGB 2BYFA 2OJRA 2ZVNA 1E7UA 4W9EA 3M3JA 3QQ8B 2KJHB 1LM8B 1OGWA 2AYOB 2KMAA 2NBVB 2R2QA 2RGFA 3A9JA 1WE7A 2AL3A 4W9GA 4DHZE 2K6QA 3KVFB 3RZWC 4KDIC 2N1VA 3BY4B 3HHMA 4WJPA 4HDQA 4W9KA 5KHQA 2KXJA 4FA6A 2JRIB 4NPNA 2I1JA 2J0MA 2L8JA 3PLUA 1GNUA 2K8CA 1V80A 3A4SC 2MSED 5CX3A 1WJNA 3QAQA 1WX9A 2K6DB 2CKHB 2KFKA 3X23A 4WJOA 4F8CB 3AULA 2MRPA 1S3SG 2C9WB 4HWIB 2O2VA 4GDLB 4HJKA 4WJNA 5AZHA 3RCZA 2Z0EB 2G4DB 2JPHA 1GJZA 1WR1A 4XC2A 2IO1B 1LXDA 1WXAA 3ALBA 4FHKA 2KD0A 4FN2A 2XK5A 1WX7A 2MP2A 4LDTD 3W1SC 3ZTCA 4ANVA 4BBNF 3VUXA 3AU4A 4FADA 3V6CB 2NVUI 2MCNB 4BVUC 3H6NA 1GC7A 2KJRA 1KJTA 3JVZX 2V1YA 3PRZA 4DXAB 4DDID 1WRDB 1V86A 2BYEA 4M8MA 3KUDB 2LGDA 2HJ8A 5CHVC 1C1YB 2KLCA 2O6VB 3HM3A 4IC7B 4J6IA 3WA0A 1XQQA 3ZNID 1L2NA 3VAWA 2BPSA 4GOCA 4PS3A 4W9IA 2BWFA 1WMHA 2KWCA 3ZVVA 2HD5B 3PPAA 3IBEA 3ZNGC 2C7HA 1IPGA 4JLCA 4DK5A 2C5LC 2KTRB 3LDZE 3N32A 4WQOB 1E90A 3GZNI 2PPHA 3H7PB 4DWFA 1WGYA 3A1QB 2N7EA 2D3GA 2G3QB 2Z0DB 1WZ0A 1NDDA 1WY8A 2L0TA 2K25A 2KDBA 2DENB 2NBUA 2LZ6A 4NY0A 2W9NA 2ZPYA 5AZFA 4EKUA 1WFYA 1RFAA 5G2NA 3ZNZB 2M1MA 2UYZB 5EDSA 2KKCA 2IBIB 2NCNA 3RZFA 2OOBB 2FCSA 2LJ5A 1WE6A 1I35A 4IW0A 2KDEB 4MDKE 4KZCA 4JQWC 1E8WA 2MBEA 4F7ZA 3K9PB 2DX5B 4ANUA 3NS8A 2I1KA 2FNJB 2PEAA 2HE7A 3HIZA 2FCMA 3V62A 3DCGA 1KM7A 4N9F4
chains in the Genus database with same CATH superfamily
2RR9A 4W9DA 5FK9C 1OFFA 2KQSA 3PZ8A 2L0FA 3IHPC 2KWVB 2XEWA 3ZDTA 5LXIB 2ZW0A 4K7WA 4G50A 3CSFA 4J3OD 2LD9A 2KAJA 4M00A 1ENFA 4B0MA 2JZ3B 2BS3B 1QKZA 3I3TB 4JL9A 1QZEA 2L00B 3CSTA 4WAAA 1J19A 1YD8U 3WANA 1NENB 1UBIA 2K39A 1L5PA 1YN5A 2BF8B 3MP9A 4KDLB 4CHKA 4AP4C 1UBQA 4HCNB 4TSSA 1V5OA 3QC8B 2QC8A 2PE6B 4ITKA 1V1PA 1HEZE 3NOBA 2JVCA 5KHOA 2AX5A 2FIDA 2FAZA 3FKYA 4N59A 1QOGA 4OZAA 2J0JA 3NG0A 1UELA 2ASQA 1G6JA 2MQJA 4YTNB 5JH5C 3N1ZC 1MG4A 2M0AA 1NI3A 1I4XA 2M17A 4GU2A 3N30A 1B9RA 2K9XA 1TZOA 1ZKHA 4ICVA 2BBCA 2CR5A 3O65B 1K53A 4GIVA 4BKSD 2IYDB 1Y8RC 3B08A 3L0WB 1ZXHA 4L1BA 3B1LX 4XWWA 2JUOA 3ETRA 4MH0E 2KN5A 2WNMA 4BOZB 1P9DU 2HJ1A 4ICUA 2MBBB 1UWXA 1B1ZA 5AZGA 4KSLC 3IT6B 1WYWB 4KIKA 2OJWA 2NPTA 1FIQA 3KWVA 3VH4B 2VH2A 3R66C 2L32A 2LRUA 1TBEA 1GB4A 1L0VB 3Q8FA 3VTWA 3P2BA 2MBHA 1XD3B 2MA9B 2KHWB 2MJ3A 3AE3B 3NJTA 2A5UA 3KWLA 3H7SA 2R61A 1L6UA 2YLMA 2WDVB 3GS2A 3L13A 3AE7B 3P42A 3ZQ4A 5DPWA 1M4VA 4BZAA 3KUCB 2J4XA 5C23A 3WAPA 1PUTA 4DDGD 1HE8A 3T3OA 3ECIA 3GOEA 4AS1A 3PO0A 1FD6A 1P1AA 2KQ7A 1Z5SB 3KLSX 4M8NA 4MGKE 5IAAC 5J18A 5LLIA 2BWES 1FXAA 1YJ1A 2FUG1 1VDVA 4XYCA 1FXTB 2R2OA 3TUOA 1YOVB 2QDFA 2L52A 4RMAA 3EECA 2L7RA 3IAS1 2M8SA 1YIWA 1WJ4A 5EE1A 3U7ZA 2N7DA 3W5UB 3R3MA 2G4SA 1YMHE 1YQ4B 1KLGD 2WQYB 1NYRA 2DYMA 4RGTA 1EF1A 4IWPA 4ZYNA 2M0XA 3X0WA 2DYBA 3L4PA 2J52A 3PRMB 1VCBA 4XGAB 1MHXA 2K3UA 1C77A 1ZPSA 1V6EA 1PQSA 1C3TA 2LVPA 1NBFC 4RGOS 1L6VA 3ZIMA 3Q8BA 3AECB 2L1AA 3VTVA 2NR2A 3QX1A 3C19A 2BKRB 1WIAA 1T0RC 2E6XA 4RF1A 1K52A 4EZJA 4K3BA 4KX6B 3ONSA 4M01A 3C8YA 1SXTA 3DWGC 3ABVB 3PREA 3ZNHB 3PHXB 1UWMA 1SB3C 1SF0A 1OQRA 2JQRB 2DAFA 4HCPB 3IT4B 1WM2A 4ASWC 4TMAB 2EMSA 1WI0A 3OWEB 3P4PB 3A1QA 3DBHB 2V3SA 2KOXA 4YSXB 3TIXA 3W1YA 1V49A 4EE2A 3DVNV 3Q3JA 1WRIA 2MX2A 1Y56A 2QHOA 3L17A 1TZ1A 3H7PA 5L83A 1ET9A 4HPMB 3SFDB 3B2GA 1WGDA 3AM9A 4TKNA 3NHEB 4A3OA 5DPRA 2RSUA 1HZ5A 4RM8A 3AEAB 4NJCA 4AJWA 3K9OB 1Q1OA 4RFBA 1JWUD 1RLFA 3A4RA 4AJYB 1P98A 3FC4A 2BVCA 4C00A 3NZUA 4UDUC 1T0SC 3H9DA 3RULA 4II2B 1CMXB 1JWMD 3MC0B 3ZRCA 1E7VA 3TCAA 3Q3NC 3MC8A 3UGBB 5BYRA 4F1SA 4G11A 3D32A 5MPOA 3AE9B 3I5JC 3P63A 5H8YE 3W5VB 4A90A 2WLBA 3EUB2 3N1XC 2K6QA 2PTLA 2DLBA 2N1VA 3HHMA 2ACZB 4W9KA 2PKOA 1F0ZA 4NPNA 2L8JA 2K8CA 1WXQA 3GE8C 3QAQA 4WJOA 2INCC 2W3SA 4GDLB 4HJKA 4WJNA 2G4DB 1N5WA 2WGSA 4FHKA 4FN2A 2XK5A 1WX7A 2MP2A 1GOZA 3W1SC 3ZTCA 4ZHOA 1ESFA 3AU4A 1TS5A 4A55A 4FADA 2NVUI 3H6NA 3JVZX 4DDID 4M8MA 3KUDB 2LGDA 3HM3A 2WXHA 3VRAB 1XCQL 1SIJA 3ZVVA 1WMHA 2KWCA 2IGDA 1WWTA 4DQOC 3PPAA 1YQ3B 4JLCA 3GZNI 2PPHA 2V9HA 5IP4D 1WGYA 3A1QB 2G3QB 2Z0DB 1WY8A 3AEEB 2KDBA 2NBUA 3NUHB 2W9NA 1HA5A 1SE4A 1RFAA 2M1MA 5EDSA 2KKCA 2IBIB 2LJ5A 2KDEB 4MDKE 4KZCA 3Q69A 2MBEA 2X38A 2JYEA 3B2FA 1RYJA 3HIZA 2KVZA 3DCGA 1KM7A 4N9F4 4E71A 3L54A 2O2VB 3T3NA 1FMAD 4LNFA 4AUQC 3JSVB 1TIFA 2WX0A 3IFWB 2LVOA 3W9CB 2C7MB 2WXIA 2DYOA 1C76A 3BYTB 1Q10A 2ONQA 1SE9A 3L16A 2KANA 3TEYA 4W9LA 5DPSA 2RMMA 3GB1A 1FRDA 2CU1A 2IO0B 2KN4A 3ZDMC 1DOYA 5DPTA 4S17A 2AL6A 1N63A 4ANWA 1J7BA 1HQRD 4OVUA 3U8ZA 3Q3OC 2K1FA 3J9CA 3PRPB 3R2IA 3LJ3A 2O6VD 2RD0A 2WXRA 1X1MA 3O13A 3ENEA 3RNBC 3OLMD 2LVQA 1XXGA 2KFJA 3APDA 4QAYA 3PZDA 3HK0A 3JYUA 4PS8A 3VUYA 2Q5WD 2L3ZA 4OHJA 2IY0B 2W82A 4P6VF 1JCKB 2MH7A 2LGXA 3BK2A 2LEKA 2WXQA 5D7GA 3V3XA 5E6PA 1L4ZB 2L05A 3Q8EA 4HRSA 1Q0WB 2IO3B 1N61A 2WXKA 1AYFA 1OEYJ 3NRZA 2J42A 1YX5B 1BT0A 2H88B 3QCAA 2JZZA 4B95A 1DOIA 1L7YA 1QOBA 1MVKA 1D5ZC 1JRUA 3N9YC 2D11A 2XK5B 3RNCC 1QOAA 3WAMA 1R7SA 3PZ7A 4P7IA 1WZ3A 3AV8A 1V8CA 4ZRIA 2ON8A 2DBYA 3Q3MC 1TGZB 2RPQA 4X57B 4MJSA 4RGMA 3P4RB 1VD2A 4USAA 3KW5B 3PVLA 3QARA 3AE4B 1WXMA 1ZW7A 3EC8A 2KMCA 1DGJA 3AXCA 3AEGB 4BOSC 2MLBA 1XEEA 4A8XC 4OVVA 2WWZA 2JF5A 1QT9A 2MHJA 2CHZA 3WAOA 4CO7A 3GE3C 2W54A 1RAXA 2PIAA 3AH7A 3EHVA 4EOYA 3VR8B 2ZVOA 2ZEQA 4KGSA 3SEBA 2Y5PA 1SEBD 4K3CA 1E7PB 2AQ3B 3S2AA 1YN4A 4MM3A 1MJDA 4ACFA 1V97A 4ZOHC 2CJOA 1CQVA 5CHWA 4NAWA 2GBMA 3EFCA 3E56A 4RCOA 3Q3FA 1ZUD2 4P16A 2ZCBA 3APCA 1U4AA 1P0RA 3AE5B 2L76A 2GMIC 4DHJB 2K22A 3OG5A 1WM3A 2MEKA 1L4DB 4LJOB 3ZKJC 1NVID 3MJWA 1EF5A 5JHBA 2KDFB 5G5HA 4DBGA 3HM6X 2CS4A 4G0NB 3RI7C 1J7AA 1KLUD 3VH3B 4YXDB 3ZUNA 1UH6A 1SIFA 2XBBC 2LHDA 5EE0A 4IM0A 1IGDA 2YEPB 4GDLA 1LGRA 2WXPA 3ZO5B 1KH0A 4M0WB 1YJIA 4CYEA 5GXGB 3DBHI 4LCDE 3MTNB 1T5XD 2DAJA 4EZLA 1TJEA 4WH4A 3HVZA 4FJZA 5D6JB 2ZW1A 1WF9A 2K8BA 1IYFA 3FAHA 1IUEA 1ET6A 3SU8X 3A9KB 2WXNA 4MJSB 2LFIA 5AUKA 1SGHA 4MEMA 3DBLI 1JRPA 4HROA 2N9EB 1AW7A 4MELA 2N9KA 5BMIA 2Y5BB 5FR3A 2KTFA 5BYQA 1E10A 2WX1A 1LFDA 5T8IA 4RF0A 1FCLA 2MBOA 3RPFC 2AEHA 2INNE 5JHAA 3RUIB 3TEWA 2OEDA 4HJGE 3MJ5A 4A3PA 3LB8C 5D3DA 4JGHB 3N3KB 4K7UA 4MM3B 3BVMA 2PJHA 1TS2A 1EO6A 1WJ6A 5D2MB 4HXDA 3OJ4B 2WHIA 2DZMA 4OZBA 2EELA 2KQ4X 3EFUA 3TBLD 3UIPB 1K8RB 1BMLC 1QQRA 3M95A 2KZRA 2KFKB 4IM3A 3TL5A 4S0RA 1FXIA 3ZRFA 3IAM1 2M19A 3WIMA 2PMVA 2KLGA 3UF8A 3ZYYX 2FUHB 3VHTC 2QMTA 1WX8A 1YX6B 1PGBA 2JXXA 3PS6A 3CF6E 3UI3A 2K8HA 2IO2B 1H4RA 2FIFA 2KDIA 3T8MA 4LK0M 4JPSA 4W9EA 3M3JA 3ZJTA 2IPKD 3V05A 1LM8B 1OGWA 2AYOB 2KMAA 4DHZE 1WE7A 3NZ3A 4KDIC 1IBXA 4HDQA 5KHQA 2KXJA 4FA6A 2JRIB 1GNUA 1L0XB 2K6DB 2KFKA 3X23A 1I4QA 1S3SG 1MFWA 2O2VA 2Z0EB 2GB1A 1VZ7A 5AUIA 5LNK1 3ZGZA 2QILA 1WXAA 4MACA 2KD0A 4BBNF 2IGHA 2JXTA 3V6CB 2MCNB 3PRZA 5BMHA 2V1YA 3W2DA 4DXAB 1V86A 2BTEA 2KLCA 3DHIC 4IC7B 4J6IA 4OVZA 1XQQA 3SFEB 4YTMB 3VAWA 2NTSA 4PS3A 2BB5A 1I4HA 2WXMA 2BWFA 4P1CC 1VZ8A 3ZNGC 2C7HA 4DK5A 2KTRB 3N32A 1E90A 3I57A 2N7EA 1WZ0A 4JX1C 1NDDA 2DENB 3RNFC 2LZ6A 4NY0A 5AZFA 3AEBB 1WFYA 2OHFA 2UYZB 2OOBB 1I35A 3U52E 2Y3AA 4C80A 2BW2A 4JQWC 1FFVA 4ANUA 3BVGA 2FNJB 2PEAA 2HE7A 3V62A 2D3BA 2NPTB 4FHJA 2KO3A 4CQNA 4HK2A 4HEA1 1WGRA 5IA7A 3A9JB 2ZNVC 1E8ZA 3Q8CA 2EKEC 1J0GA 1RRBA 2HDEA 3ZJUA 1P3QU 1I4GA 1YNTE 5DCNA 3IG3A 1XCTL 1GG3A 5G55A 3SHQA 2YVCA 4XDDA 1E8YA 2Y5CA 1WXSA 2LASA 1F52A 2JZPA 4W9FA 1PFDA 1C78A 3RD2A 1M94A 1DOXA 5EE9A 3GZNB 2HTHA 1F2RC 4NJ7A 4WURA 4C7ZA 4MGZE 1KOTA 1OEYA 2C7NB 3RNAC 2NTTA 4TQ0A 4PYZA 3DQVA 4FXCA 2IY1B 3AE6B 3NVZA 4XDCA 4IM2A 2PVGC 1GAQB 3DVGY 1D4BA 2GOWA 4H2AA 4MSQB 2GBRA 1NEKB 3CMMB 1WGGA 1H8CA 3E9SA 3TEZA 4ANXA 4WIPA 4IDIA 3DHGC 3MHSD 5BO4B 2WXGA 3KH0A 5I4DA 1PYWD 1ZDVA 4II3B 2V3PA 5TR5A 3AB5A 4TV3A 3EGRA 4PS7A 4DHZB 4EZKA 4W9CA 3OJ3A 5TSSA 1TKEA 3HRDD 3GP7A 1STEA 3N1YC 3PTFC 5AEKB 1FM0D 4BKSA 1XLNA 1XF5L 1ZOYB 2WXLA 1S1QB 1AARA 2N7JA 4JWUC 3ZW3A 2Z8LA 3QWZB 2WU5B 4RGNA 4BBNC 1Z2MA 1TKGA 2ZZPB 2RPVA 3ML9A 3Q8AA 4IG7B 5BYSA 4KGRA 2CJNA 1WXVA 2CHXA 4K7SA 2SEBD 4ZRJA 3PHWB 1JWSD 2N9XA 2VH1A 4OZCA 4C4VB 4C7YA 3A9KA 2LGIA 4URKA 1OQQA 1N60A 4ZRKA 2WXFA 5CTRC 2RDGA 1I4PA 1VLBA 1N6ZA 5H92C 2I2YA 5HKHA 4G3XB 1NYQA 3U30A 1AN8A 1A70A 1KFYB 4N6EB 5D3IB 2GBNA 4DHJD 1E6EB 4NNJB 4ZRPA 3QHTA 3NVWA 3ZLZA 1YN3A 2J0KA 4E3CA 4A9AA 2LWPA 2FBWB 4I6LB 1JALA 1K51A 1XO3A 1V81A 2WP9B 2PLPA 3KYDD 4L23A 3ZJVA 3VRBB 2Z59B 5E6OA 3VXWA 1XT9B 3VUWA 4FJYA 2K5PA 5J2RA 1IBXB 1PGXA 5HFYA 4W9JA 1MI0A 2DHZA 2AQ2B 2WDTB 2G9HD 2M4NA 5J17A 1C4AA 4WAFA 4W9HA 3NVVA 3AI5A 2LHEA 5LXHA 4LNIA 4P1BC 3RNGC 2N9PC 2JWUA 2BT6A 4B9KA 2WU2B 4D2KA 4IUMB 1A5RA 4GDKA 2G45B 4LDTB 3ML8A 4XWTA 2KK8A 4IWOA 4NZLB 2BGFA 1PDXA 1F9JA 1OTRB 2NBWB 2E3TA 3RT3B 1KF6B 1UGMA 3ZTDA 2KWUB 3L10B 4WWNA 2GRIA 2IZVB 1EWYC 3AEFB 1VZ6A 4MGYE 5EE3A 1MPEA 2MWSB 2WS3B 1UD7A 4LNKA 2H89B 4WWOA 3U4EG 3TJPA 1WMHB 1KTKA 2ZCCA 2JSVX 1LQBA 2WYQA 4IKGA 1UUPA 4HKQA 5D94A 4PT5A 3B9JA 4KGTA 3EA6A 2N1WA 2O6VA 1YQBA 3CIRB 3BINA 2KT7A 1HZ6A 4NAWB 4EUTA 4BKGA 1EU3A 2NMQA 2DZKA 4BFRA 2D10A 2D07B 4FULA 3IVFA 3CWIA 2QSDA 3LXFA 4AQ7A 2MP2B 3P1MA 2CU3A 3M63B 4EEWA 4GMVA 1GUAB 1TY2A 2QEJC 1R4MI 1QLBB 2KX0A 3MFGA 1EWCA 4GDKB 4KKIA 4YSYB 1QF6A 2OJRA 2ZVNA 1E7UA 1SSNA 1DYQA 2KJHB 2RGFA 2NBVB 2AL3A 4WJPA 2I1JA 1N5XA 2J0MA 2J53A 3PLUA 1F77A 1V80A 1WJNA 1WX9A 3AE8B 4F8CB 3AULA 2C9WB 4HWIB 2IDYA 4YTPB 5AZHA 5C2TB 4ZHPA 1GJZA 1WR1A 4XC2A 3ALBA 4M0WA 1VR9A 4LDTD 4GLSC 4ANVA 3VUXA 1ZXIA 2KJRA 2HJ8A 5CHVC 1C1YB 2BS4B 4JE3B 3WA0A 3ZNID 1L2NA 3NVYA 2BPSA 4W9IA 1IGCA 4ARIA 2RDHA 2I38A 2HD5B 1V1OA 3Q14C 3IBEA 4IOIE 1ZDXA 4O1NA 2INPE 3N20C 4DWFA 2HTME 1QILA 1TS3A 4ARCA 3ZNZB 3TSSA 4RNAA 2NCNA 4IW0A 4M02A 3K9PB 2DX5B 2WXOA 3NS8A 4DXFA 1SBBB 2RDBC 1CJEA 4MT5A 1E9MA 2UU7A 3BWUD 1WSPA 4YL8A 1HTOA 3AEDB 3DBRB 1C79A 4TQ1A 2KC2A 3OAWA 3HUIA 3SDLC 3LYYA 1KLVA 1TYGB 2FCNA 2A4ZA 3MHZA 3PLVA 4HVBA 2XNAC 4FLHA 4PYUA 3QIJA 4MSMB 4B6WA 1C4PA 3QJZA 2LXAA 1R4NI 4RM9A 1JMLA 3KUZA 4GB9A 3MC9A 4N58A 1C9FA 3DBRI 1RFKA 1YJJA 2KVRA 5E6JA 4E74A 1EUVB 2XN9C 2C60A 1N62A 2K0PA 4ZYSA 1HTQA 3Q2AC 3W1SA 3L08A 1E0ZA 3SR6A 5FR6A 3QA8A 4A20A 4WWMA 2UWQA 1MG8A 2AWTA 2JT4B 2LXCA 3U2SC 1P7FA 3FILA 3H1UA 4FJVB 4REZA 1SJED 5IOIA 2MW5A 3P4SB 4WJQA 1E5WA 4GGQA 1T0YA 5BMGA 3V61A 3UINB 1F1HA 4LNNA 3VQIA 3VDZA 1J8CA 2ZPNA 1JWBD 1VRAB 3AMZA 3I63C 2N0SB 1HXYD 3I9V1 4OW0A 5G5GA 3R8BA 2ICIA 4C56C 1OQYA 4XZ4A 3P4QB 4PK1A 2INDC 2JX5A 3DDCB 4US8A 4L2YA 1EU4A 2KDMA 1ACCA 1MHHE 4LTUA 1PGAA 3UIOB 1TY0A 1UGJA 3R7RA 4HLEA 2KX3A 4MGIE 5C3JB 3A33B 1V1PB 4I6PA 4EFOA 4YSZB 2KC1A 3DVNU 3T9LA 2JWZA 4WWPA 3RMKC 2DNFA 3ZXVA 1E8XA 1D3ZA 4LLGM 1T3QA 5C1ZA 1FFUA 1LO5D 2BYTA 3NY5A 2G1EA 2LUEA 4HKZE 1EM7A 3SD5A 1TKYA 4KSKC 4NAMA 1I4RA 1TTNA 1BUIC 1P7EA 2B3AA 2LUMA 1WR6E 1I7HA 4GXBA 1F2RI 3WALA 1T6BX 3DOWA 4TUUA 1CK1A 2EMTA 3DPDA 4KV2A 2PVOD 1J7CA 2IJ0A 2NS5A 2GBJA 2X8XX 1FO4A 5JXVA 3RYTA 2IGGA 2LI5A 2JRHA 1KRHA 4GSWA 1FNUA 3PSEB 2WXJA 1JWAD 2BQQA 2LGSA 3Q6BA 2D3CA 1WYGA 3VVWB 2BYVE 3R7QA 2BS2B 1XLOA 3ZXRA 4BKTA 2ZNVB 3H8HA 4KKJA 2W3RA 4ZDVA 1WJUA 2L83A 4I6NB 2GI9A 4K81A 5E6NA 3AE1B 1D6EC 5IN7A 4MH8A 2GBKA 3UQBA 2GLSA 4KZ0A 3C0RB 2N4FA 2ZJDA 4B0EA 1UF0A 3KYCD 1JW9D 1R4NB 3PV1A 1WGHA 2LJIA 1FEHA 4JIOU 2V4IB 3BIID 2MJEA 1R4MB 3DVGX 5JZEB 3NZSA 3RN9C 2EKIA 1FNVA 5FKAC 4JWSC 1VJKA 5IO9A 2VRRB 2KMMA 1FCCC 2W55A 3KQ4A 3BK1A 3B0AA 1AWDA 3PGEA 4LJPB 4HPPA 4RH6A 4R3DA 2FCQA 4KIKB 1SJHD 1ISNA 2PE9A 1K50A 3JW0X 1SE3A 2J7QB 4GN1A 3V6EB 3RFZB 1FRRA 1L0YB 1ROEA 1Q5WB 4BAXA 2LRWA 2LMCA 3DHHC 2QIEB 4NQLB 3V60A 3WCQA 4AOFA 1GPXA 2CHWA 5CHFA 2LGYA 3VFKA 2D5GA 3RNEC 2V4LA 4NQKE 2DZJA 3IXSA 4HDOA 4IWQA 1UZXB 2D2QA 1NI2A 2QCZA 3JSVA 1C4CA 2PW9A 2M56B 2KWDA 1UNSA 3U7DA 3BYYB 4XX5A 4A6QA 2SAKA 4NJ6A 3AN1A 4HPLB 4AWJA 2KJ6A 1T0QC 1TS4A 2KTRA 1D5MC 3TMPB 1FNWA 2V0GA 2KNBA 2BKFA 3AU5A 1WH3A 4Q2JA 3BZDB 1V2YA 1V5TA 5L95C 1V9JA 3M62B 5HHDG 5HI1A 2AQ1B 3APFA 1D5XC 4WQMA 3DBSA 3PT2B 1ZGUB 1I42A 1FPYA 3UQAA 2WDQB 4K1RB 4YT0B 2REXA 5GMVA 3DWMA 2YEPF 2JY6A 4ZRQA 1GC6A 2V3NA 1RM6C 3VTUA 4US9A 4FBJB 2MJDA 2MBQA 2WDRB 2KYWA 1IP9A 3QK0A 2DZIA 3URYA 4KVGB 2BYFA 3VR9B 3QQ8B 2TSSA 1QOFA 2JYTA 5HG2A 3TEXA 4W9GA 2R2QA 3A9JA 2JU6X 3KVFB 3RZWC 3BY4B 4XE0A 2VZKD 2D3AA 2VZKB 5IKCM 3A4SC 2MSED 5CX3A 2CKHB 1TT5B 2MRPA 2DWQA 3RCZA 2JPHA 1WGKA 2IO1B 1LXDA 1ZP0B 2FE8A 2N9LA 3NS1A 1XLPA 3HVDA 4BVUC 1GC7A 4LNOA 1KJTA 1BXTA 1JQ4A 1WRDB 2BYEA 2KACA 2B76B 3FILB 2O6VB 3R2TA 1ZE3D 4GOCA 4DXGA 1XLQA 1CZPA 2QJLA 1SE2A 1IPGA 1JROA 2C5LC 3LDZE 4WQOB 1RWSA 3H7PB 2D3GA 3BVZA 2BB6A 2L0TA 2K25A 3DBLB 2ZPYA 4EKUA 5G2NA 3AE2B 4YWGG 3RZFA 2FCSA 1WE6A 4C4VA 1E8WA 1GB1A 4F7ZA 2I1KA 2FCMA
chains in the Genus database with same CATH topology
2NPTB 2RR9A 4YL8A 4W9DA 4FHJA 4E71A 2KO3A 2KQSA 4TQ1A 3L54A 2O2VB 2KC2A 3OAWA 2L0FA 4HK2A 3IHPC 2KWVB 1WGRA 4AUQC 3A9JB 2XEWA 3SDLC 2ZNVC 3ZDTA 5IA7A 5LXIB 3JSVB 2FCNA 4K7WA 1KLVA 1E8ZA 2A4ZA 2EKEC 1J0GA 2WX0A 1RRBA 3IFWB 3PLVA 2LVOA 4HVBA 4FLHA 4G50A 2C7MB 4PYUA 3CSFA 1P3QU 2DYOA 1SE9A 2LD9A 3L16A 3QIJA 4MSMB 4B6WA 2KANA 3QJZA 2LXAA 1R4NI 2JZ3B 4W9LA 5DCNA 3IG3A 4RM9A 3KUZA 5DPSA 3I3TB 4GB9A 4JL9A 1GG3A 5G55A 3DBRI 1QZEA 2CU1A 3SHQA 2L00B 3CSTA 2YVCA 4WAAA 1J19A 1E8YA 1YD8U 2IO0B 3WANA 1WXSA 2LASA 3ZDMC 2KVRA 1UBIA 4E74A 4W9FA 2K39A 5DPTA 1EUVB 2AL6A 2C60A 3RD2A 2BF8B 4KDLB 4CHKA 4ANWA 4AP4C 1UBQA 1M94A 4HCNB 1V5OA 3QC8B 3W1SA 3L08A 2PE6B 4OVUA 5FR6A 2K1FA 2HTHA 3QA8A 3U8ZA 4A20A 2UWQA 4NJ7A 3PRPB 1MG8A 2AWTA 2JT4B 4MGZE 2LXCA 1KOTA 3LJ3A 1OEYA 3NOBA 2C7NB 2O6VD 2JVCA 2RD0A 4TQ0A 3H1UA 4FJVB 1X1MA 3DQVA 4PYZA 2IY1B 3ENEA 5KHOA 2MW5A 3OLMD 2LVQA 4WJQA 1E5WA 2KFJA 1T0YA 4GGQA 4IM2A 3APDA 3V61A 3UINB 2FIDA 2FAZA 3PZDA 3DVGY 3HK0A 3JYUA 4PS8A 3VQIA 3VDZA 3VUYA 1J8CA 2ZPNA 2J0JA 2GOWA 1UELA 2ASQA 1G6JA 2MQJA 4MSQB 5JH5C 2L3ZA 2GBRA 2IY0B 3CMMB 1WGGA 2M17A 4GU2A 1H8CA 2LGXA 3N30A 1OQYA 1ZKHA 4ANXA 4XZ4A 4ICVA 5D7GA 5E6PA 2CR5A 3DDCB 3MHSD 2L05A 3O65B 1Q0WB 2IO3B 3KH0A 5BO4B 4GIVA 4BKSD 2IYDB 1OEYJ 1Y8RC 3B08A 3L0WB 3B1LX 1YX5B 1BT0A 2JUOA 3QCAA 2JZZA 4II3B 3UIOB 4B95A 4MH0E 2KN5A 5TR5A 3R7RA 1L7YA 4BOZB 2KX3A 4TV3A 1P9DU 4ICUA 4PS7A 4MGIE 1JRUA 2MBBB 4HLEA 3A33B 4DHZB 2D11A 4I6PA 4EFOA 2XK5B 4EZKA 2KC1A 4W9CA 3DVNU 3OJ3A 5AZGA 4KSLC 3T9LA 3WAMA 1WYWB 2JWZA 4KIKA 4WWPA 3PTFC 5AEKB 4P7IA 2NPTA 1E8XA 1WZ3A 1D3ZA 3VH4B 4BKSA 5C1ZA 4ZRIA 3R66C 3NY5A 2LRUA 1TGZB 1TBEA 2LUEA 2RPQA 4X57B 1S1QB 4MJSA 3VTWA 3P2BA 1AARA 1VD2A 3SD5A 3KW5B 3PVLA 2MBHA 1XD3B 3QARA 1WXMA 4KSKC 1ZW7A 3EC8A 2KMCA 3ZW3A 1TTNA 3QWZB 3AXCA 2B3AA 4BOSC 1WR6E 2MLBA 2MA9B 4BBNC 1Z2MA 2ZZPB 4OVVA 2KHWB 4GXBA 2WWZA 3ML9A 3WALA 2JF5A 4IG7B 3DOWA 1WXVA 2A5UA 2CHXA 2CHZA 4K7SA 4TUUA 3WAOA 4CO7A 4ZRJA 2EMTA 3PHWB 3H7SA 4EOYA 1RAXA 2N9XA 3EHVA 2YLMA 3L13A 3DPDA 4KV2A 2ZVOA 2ZEQA 3A9KA 5DPWA 2NS5A 4URKA 2GBJA 4ZRKA 3KUCB 5C23A 3WAPA 5CTRC 3RYTA 4DDGD 1HE8A 3ECIA 3GOEA 2LI5A 3S2AA 2JRHA 4G3XB 1P1AA 2KQ7A 1Z5SB 3U30A 5HKHA 4MM3A 4M8NA 4GSWA 4MGKE 5IAAC 5J18A 5LLIA 3PSEB 3VVWB 2BYVE 2BWES 2GBNA 3R7QA 1YJ1A 5CHWA 4DHJD 4NAWA 4BKTA 2GBMA 4NNJB 2ZNVB 3QHTA 3ZLZA 3Q3FA 1FXTB 2R2OA 2J0KA 4E3CA 2ZCBA 1WJUA 4ZDVA 2LWPA 3APCA 1U4AA 4RMAA 3EECA 4I6NB 1P0RA 4K81A 2L76A 2L7RA 5E6NA 4I6LB 2GMIC 4DHJB 1WM3A 1V81A 2GBKA 3KYDD 4LJOB 3UQBA 2M8SA 1YIWA 3ZKJC 1WJ4A 4KZ0A 2N7DA 3MJWA 2Z59B 3C0RB 3R3MA 2G4SA 2N4FA 2ZJDA 1EF5A 5E6OA 5JHBA 3VXWA 1XT9B 3VUWA 4FJYA 2KDFB 3KYCD 4DBGA 3HM6X 3PV1A 5J2RA 2CS4A 1WGHA 2DYMA 4G0NB 1EF1A 4JIOU 4IWPA 4ZYNA 2M0XA 3X0WA 4W9JA 3VH3B 3ZUNA 1UH6A 2DYBA 2DHZA 1SIFA 3PRMB 1VCBA 3DVGX 2XBBC 5JZEB 3NZSA 2WDTB 2M4NA 1V6EA 1PQSA 5J17A 4IM0A 1C3TA 2LVPA 1NBFC 4GDLA 3ZO5B 4W9HA 3ZIMA 3AI5A 4M0WB 2VRRB 5LXHA 4CYEA 3VTVA 2NR2A 3DBHI 3QX1A 4LCDE 3B0AA 2BKRB 2N9PC 3MTNB 1WIAA 3PGEA 4LJPB 2FCQA 4KIKB 4B9KA 2DAJA 1ISNA 4IUMB 4EZLA 4EZJA 2PE9A 4GDKA 1A5RA 2G45B 4FJZA 4LDTB 3ML8A 3ONSA 5D6JB 2KK8A 3JW0X 1WF9A 2K8BA 4IWOA 1IYFA 3SU8X 3PREA 3ZNHB 2BGFA 3A9KB 3PHXB 4MJSB 1F9JA 1OTRB 2NBWB 3RT3B 2J7QB 2DAFA 4GN1A 1SGHA 1UGMA 3V6EB 4MEMA 4HCPB 2KWUB 3ZTDA 3DBLI 3L10B 4WWNA 2N9EB 1WM2A 2IZVB 4ASWC 2EMSA 4MELA 1WI0A 2Y5BB 4MGYE 1Q5WB 2KTFA 3A1QA 2MWSB 2LRWA 4AOFA 1UD7A 4NQLB 3V60A 2WX1A 2CHWA 2V3SA 4WWOA 2KOXA 5CHFA 2LGYA 1LFDA 3TIXA 3VFKA 3W1YA 1V49A 3TJPA 1WMHB 2V4LA 3DVNV 3Q3JA 2ZCCA 4NQKE 2DZJA 4HDOA 2MX2A 1LQBA 2MBOA 4IWQA 1UZXB 2WYQA 2D2QA 2QHOA 3L17A 1NI2A 2AEHA 1TZ1A 3JSVA 3H7PA 5L83A 5D94A 4HPMB 5JHAA 3RUIB 1WGDA 4TKNA 4A3PA 3NHEB 3U7DA 4A3OA 5DPRA 2RSUA 3N3KB 4JGHB 4K7UA 4RM8A 4XX5A 2PJHA 1EO6A 1WJ6A 5D2MB 4HXDA 3OJ4B 4NJ6A 2N1WA 4AJWA 2O6VA 2DZMA 3K9OB 1Q1OA 1YQBA 4HPLB 3BINA 1RLFA 2KJ6A 4AWJA 2KTRA 3A4RA 4AJYB 1P98A 4NAWB 3TMPB 4EUTA 4BKGA 3EFUA 3TBLD 3UIPB 1K8RB 2KNBA 2BKFA 3AU5A 1WH3A 3M95A 1V2YA 2DZKA 2KZRA 1V5TA 3NZUA 2KFKB 4IM3A 2D10A 4BFRA 3H9DA 1V9JA 3TL5A 5L95C 2D07B 3M62B 3RULA 4FULA 3APFA 3ZRFA 3IVFA 3DBSA 4II2B 1CMXB 1ZGUB 3PT2B 1I42A 3UQAA 3WIMA 2KLGA 4K1RB 3UF8A 2MP2B 2REXA 5GMVA 3ZRCA 2FUHB 3VHTC 1E7VA 2JY6A 4EEWA 3M63B 3TCAA 1WX8A 4GMVA 1GUAB 1GC6A 1YX6B 3UGBB 3VTUA 1R4MI 2JXXA 3PS6A 4FBJB 3CF6E 4F1SA 2MBQA 4G11A 3D32A 2KX0A 2K8HA 2IO2B 1H4RA 2FIFA 2KDIA 1IP9A 3T8MA 4GDKB 3QK0A 2DZIA 4KVGB 2BYFA 2OJRA 2ZVNA 1E7UA 4W9EA 3M3JA 3QQ8B 2KJHB 1LM8B 1OGWA 2AYOB 2KMAA 2NBVB 2R2QA 2RGFA 3A9JA 1WE7A 2AL3A 4W9GA 4DHZE 2K6QA 3KVFB 3RZWC 4KDIC 2N1VA 3BY4B 3HHMA 4WJPA 4HDQA 4W9KA 5KHQA 2KXJA 4FA6A 2JRIB 4NPNA 2I1JA 2J0MA 2L8JA 3PLUA 1GNUA 2K8CA 1V80A 3A4SC 2MSED 5CX3A 1WJNA 3QAQA 1WX9A 2K6DB 2CKHB 2KFKA 3X23A 4WJOA 4F8CB 3AULA 2MRPA 1S3SG 2C9WB 4HWIB 2O2VA 4GDLB 4HJKA 4WJNA 5AZHA 3RCZA 2Z0EB 2G4DB 2JPHA 1GJZA 1WR1A 4XC2A 2IO1B 1LXDA 1WXAA 3ALBA 4FHKA 2KD0A 4FN2A 2XK5A 1WX7A 2MP2A 4LDTD 3W1SC 3ZTCA 4ANVA 4BBNF 3VUXA 3AU4A 4FADA 3V6CB 2NVUI 2MCNB 4BVUC 3H6NA 1GC7A 2KJRA 1KJTA 3JVZX 2V1YA 3PRZA 4DXAB 4DDID 1WRDB 1V86A 2BYEA 4M8MA 3KUDB 2LGDA 2HJ8A 5CHVC 1C1YB 2KLCA 2O6VB 3HM3A 4IC7B 4J6IA 3WA0A 1XQQA 3ZNID 1L2NA 3VAWA 2BPSA 4GOCA 4PS3A 4W9IA 2BWFA 1WMHA 2KWCA 3ZVVA 2HD5B 3PPAA 3IBEA 3ZNGC 2C7HA 1IPGA 4JLCA 4DK5A 2C5LC 2KTRB 3LDZE 3N32A 4WQOB 1E90A 3GZNI 2PPHA 3H7PB 4DWFA 1WGYA 3A1QB 2N7EA 2D3GA 2G3QB 2Z0DB 1WZ0A 1NDDA 1WY8A 2L0TA 2K25A 2KDBA 2DENB 2NBUA 2LZ6A 4NY0A 2W9NA 2ZPYA 5AZFA 4EKUA 1WFYA 1RFAA 5G2NA 3ZNZB 2M1MA 2UYZB 5EDSA 2KKCA 2IBIB 2NCNA 3RZFA 2OOBB 2FCSA 2LJ5A 1WE6A 1I35A 4IW0A 2KDEB 4MDKE 4KZCA 4JQWC 1E8WA 2MBEA 4F7ZA 3K9PB 2DX5B 4ANUA 3NS8A 2I1KA 2FNJB 2PEAA 2HE7A 3HIZA 2FCMA 3V62A 3DCGA 1KM7A 4N9F4
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NPT B;  2RR9 A;  4YL8 A;  4W9D A;  4FHJ A;  4E71 A;  2KO3 A;  2KQS A;  4TQ1 A;  3L54 A;  2O2V B;  2KC2 A;  3OAW A;  2L0F A;  4HK2 A;  3IHP C;  2KWV B;  1WGR A;  4AUQ C;  3A9J B;  2XEW A;  3SDL C;  2ZNV C;  3ZDT A;  5IA7 A;  5LXI B;  3JSV B;  2FCN A;  4K7W A;  1KLV A;  1E8Z A;  2A4Z A;  2EKE C;  1J0G A;  2WX0 A;  1RRB A;  3IFW B;  3PLV A;  2LVO A;  4HVB A;  4FLH A;  4G50 A;  2C7M B;  4PYU A;  3CSF A;  1P3Q U;  2DYO A;  1SE9 A;  2LD9 A;  3L16 A;  3QIJ A;  4MSM B;  4B6W A;  2KAN A;  3QJZ A;  2LXA A;  1R4N I;  2JZ3 B;  4W9L A;  5DCN A;  3IG3 A;  4RM9 A;  3KUZ A;  5DPS A;  3I3T B;  4GB9 A;  4JL9 A;  1GG3 A;  5G55 A;  3DBR I;  1QZE A;  2CU1 A;  3SHQ A;  2L00 B;  3CST A;  2YVC A;  4WAA A;  1J19 A;  1E8Y A;  1YD8 U;  2IO0 B;  3WAN A;  1WXS A;  2LAS A;  3ZDM C;  2KVR A;  1UBI A;  4E74 A;  4W9F A;  2K39 A;  5DPT A;  1EUV B;  2AL6 A;  2C60 A;  3RD2 A;  2BF8 B;  4KDL B;  4CHK A;  4ANW A;  4AP4 C;  1UBQ A;  1M94 A;  4HCN B;  1V5O A;  3QC8 B;  3W1S A;  3L08 A;  2PE6 B;  4OVU A;  5FR6 A;  2K1F A;  2HTH A;  3QA8 A;  3U8Z A;  4A20 A;  2UWQ A;  4NJ7 A;  3PRP B;  1MG8 A;  2AWT A;  2JT4 B;  4MGZ E;  2LXC A;  1KOT A;  3LJ3 A;  1OEY A;  3NOB A;  2C7N B;  2O6V D;  2JVC A;  2RD0 A;  4TQ0 A;  3H1U A;  4FJV B;  1X1M A;  3DQV A;  4PYZ A;  2IY1 B;  3ENE A;  5KHO A;  2MW5 A;  3OLM D;  2LVQ A;  4WJQ A;  1E5W A;  2KFJ A;  1T0Y A;  4GGQ A;  4IM2 A;  3APD A;  3V61 A;  3UIN B;  2FID A;  2FAZ A;  3PZD A;  3DVG Y;  3HK0 A;  3JYU A;  4PS8 A;  3VQI A;  3VDZ A;  3VUY A;  1J8C A;  2ZPN A;  2J0J A;  2GOW A;  1UEL A;  2ASQ A;  1G6J A;  2MQJ A;  4MSQ B;  5JH5 C;  2L3Z A;  2GBR A;  2IY0 B;  3CMM B;  1WGG A;  2M17 A;  4GU2 A;  1H8C A;  2LGX A;  3N30 A;  1OQY A;  1ZKH A;  4ANX A;  4XZ4 A;  4ICV A;  5D7G A;  5E6P A;  2CR5 A;  3DDC B;  3MHS D;  2L05 A;  3O65 B;  1Q0W B;  2IO3 B;  3KH0 A;  5BO4 B;  4GIV A;  4BKS D;  2IYD B;  1OEY J;  1Y8R C;  3B08 A;  3L0W B;  3B1L X;  1YX5 B;  1BT0 A;  2JUO A;  3QCA A;  2JZZ A;  4II3 B;  3UIO B;  4B95 A;  4MH0 E;  2KN5 A;  5TR5 A;  3R7R A;  1L7Y A;  4BOZ B;  2KX3 A;  4TV3 A;  1P9D U;  4ICU A;  4PS7 A;  4MGI E;  1JRU A;  2MBB B;  4HLE A;  3A33 B;  4DHZ B;  2D11 A;  4I6P A;  4EFO A;  2XK5 B;  4EZK A;  2KC1 A;  4W9C A;  3DVN U;  3OJ3 A;  5AZG A;  4KSL C;  3T9L A;  3WAM A;  1WYW B;  2JWZ A;  4KIK A;  4WWP A;  3PTF C;  5AEK B;  4P7I A;  2NPT A;  1E8X A;  1WZ3 A;  1D3Z A;  3VH4 B;  4BKS A;  5C1Z A;  4ZRI A;  3R66 C;  3NY5 A;  2LRU A;  1TGZ B;  1TBE A;  2LUE A;  2RPQ A;  4X57 B;  1S1Q B;  4MJS A;  3VTW A;  3P2B A;  1AAR A;  1VD2 A;  3SD5 A;  3KW5 B;  3PVL A;  2MBH A;  1XD3 B;  3QAR A;  1WXM A;  4KSK C;  1ZW7 A;  3EC8 A;  2KMC A;  3ZW3 A;  1TTN A;  3QWZ B;  3AXC A;  2B3A A;  4BOS C;  1WR6 E;  2MLB A;  2MA9 B;  4BBN C;  1Z2M A;  2ZZP B;  4OVV A;  2KHW B;  4GXB A;  2WWZ A;  3ML9 A;  3WAL A;  2JF5 A;  4IG7 B;  3DOW A;  1WXV A;  2A5U A;  2CHX A;  2CHZ A;  4K7S A;  4TUU A;  3WAO A;  4CO7 A;  4ZRJ A;  2EMT A;  3PHW B;  3H7S A;  4EOY A;  1RAX A;  2N9X A;  3EHV A;  2YLM A;  3L13 A;  3DPD A;  4KV2 A;  2ZVO A;  2ZEQ A;  3A9K A;  5DPW A;  2NS5 A;  4URK A;  2GBJ A;  4ZRK A;  3KUC B;  5C23 A;  3WAP A;  5CTR C;  3RYT A;  4DDG D;  1HE8 A;  3ECI A;  3GOE A;  2LI5 A;  3S2A A;  2JRH A;  4G3X B;  1P1A A;  2KQ7 A;  1Z5S B;  3U30 A;  5HKH A;  4MM3 A;  4M8N A;  4GSW A;  4MGK E;  5IAA C;  5J18 A;  5LLI A;  3PSE B;  3VVW B;  2BYV E;  2BWE S;  2GBN A;  3R7Q A;  1YJ1 A;  5CHW A;  4DHJ D;  4NAW A;  4BKT A;  2GBM A;  4NNJ B;  2ZNV B;  3QHT A;  3ZLZ A;  3Q3F A;  1FXT B;  2R2O A;  2J0K A;  4E3C A;  2ZCB A;  1WJU A;  4ZDV A;  2LWP A;  3APC A;  1U4A A;  4RMA A;  3EEC A;  4I6N B;  1P0R A;  4K81 A;  2L76 A;  2L7R A;  5E6N A;  4I6L B;  2GMI C;  4DHJ B;  1WM3 A;  1V81 A;  2GBK A;  3KYD D;  4LJO B;  3UQB A;  2M8S A;  1YIW A;  3ZKJ C;  1WJ4 A;  4KZ0 A;  2N7D A;  3MJW A;  2Z59 B;  3C0R B;  3R3M A;  2G4S A;  2N4F A;  2ZJD A;  1EF5 A;  5E6O A;  5JHB A;  3VXW A;  1XT9 B;  3VUW A;  4FJY A;  2KDF B;  3KYC D;  4DBG A;  3HM6 X;  3PV1 A;  5J2R A;  2CS4 A;  1WGH A;  2DYM A;  4G0N B;  1EF1 A;  4JIO U;  4IWP A;  4ZYN A;  2M0X A;  3X0W A;  4W9J A;  3VH3 B;  3ZUN A;  1UH6 A;  2DYB A;  2DHZ A;  1SIF A;  3PRM B;  1VCB A;  3DVG X;  2XBB C;  5JZE B;  3NZS A;  2WDT B;  2M4N A;  1V6E A;  1PQS A;  5J17 A;  4IM0 A;  1C3T A;  2LVP A;  1NBF C;  4GDL A;  3ZO5 B;  4W9H A;  3ZIM A;  3AI5 A;  4M0W B;  2VRR B;  5LXH A;  4CYE A;  3VTV A;  2NR2 A;  3DBH I;  3QX1 A;  4LCD E;  3B0A A;  2BKR B;  2N9P C;  3MTN B;  1WIA A;  3PGE A;  4LJP B;  2FCQ A;  4KIK B;  4B9K A;  2DAJ A;  1ISN A;  4IUM B;  4EZL A;  4EZJ A;  2PE9 A;  4GDK A;  1A5R A;  2G45 B;  4FJZ A;  4LDT B;  3ML8 A;  3ONS A;  5D6J B;  2KK8 A;  3JW0 X;  1WF9 A;  2K8B A;  4IWO A;  1IYF A;  3SU8 X;  3PRE A;  3ZNH B;  2BGF A;  3A9K B;  3PHX B;  4MJS B;  1F9J A;  1OTR B;  2NBW B;  3RT3 B;  2J7Q B;  2DAF A;  4GN1 A;  1SGH A;  1UGM A;  3V6E B;  4MEM A;  4HCP B;  2KWU B;  3ZTD A;  3DBL I;  3L10 B;  4WWN A;  2N9E B;  1WM2 A;  2IZV B;  4ASW C;  2EMS A;  4MEL A;  1WI0 A;  2Y5B B;  4MGY E;  1Q5W B;  2KTF A;  3A1Q A;  2MWS B;  2LRW A;  4AOF A;  1UD7 A;  4NQL B;  3V60 A;  2WX1 A;  2CHW A;  2V3S A;  4WWO A;  2KOX A;  5CHF A;  2LGY A;  1LFD A;  3TIX A;  3VFK A;  3W1Y A;  1V49 A;  3TJP A;  1WMH B;  2V4L A;  3DVN V;  3Q3J A;  2ZCC A;  4NQK E;  2DZJ A;  4HDO A;  2MX2 A;  1LQB A;  2MBO A;  4IWQ A;  1UZX B;  2WYQ A;  2D2Q A;  2QHO A;  3L17 A;  1NI2 A;  2AEH A;  1TZ1 A;  3JSV A;  3H7P A;  5L83 A;  5D94 A;  4HPM B;  5JHA A;  3RUI B;  1WGD A;  4TKN A;  4A3P A;  3NHE B;  3U7D A;  4A3O A;  5DPR A;  2RSU A;  3N3K B;  4JGH B;  4K7U A;  4RM8 A;  4XX5 A;  2PJH A;  1EO6 A;  1WJ6 A;  5D2M B;  4HXD A;  3OJ4 B;  4NJ6 A;  2N1W A;  4AJW A;  2O6V A;  2DZM A;  3K9O B;  1Q1O A;  1YQB A;  4HPL B;  3BIN A;  1RLF A;  2KJ6 A;  4AWJ A;  2KTR A;  3A4R A;  4AJY B;  1P98 A;  4NAW B;  3TMP B;  4EUT A;  4BKG A;  3EFU A;  3TBL D;  3UIP B;  1K8R B;  2KNB A;  2BKF A;  3AU5 A;  1WH3 A;  3M95 A;  1V2Y A;  2DZK A;  2KZR A;  1V5T A;  3NZU A;  2KFK B;  4IM3 A;  2D10 A;  4BFR A;  3H9D A;  1V9J A;  3TL5 A;  5L95 C;  2D07 B;  3M62 B;  3RUL A;  4FUL A;  3APF A;  3ZRF A;  3IVF A;  3DBS A;  4II2 B;  1CMX B;  1ZGU B;  3PT2 B;  1I42 A;  3UQA A;  3WIM A;  2KLG A;  4K1R B;  3UF8 A;  2MP2 B;  2REX A;  5GMV A;  3ZRC A;  2FUH B;  3VHT C;  1E7V A;  2JY6 A;  4EEW A;  3M63 B;  3TCA A;  1WX8 A;  4GMV A;  1GUA B;  1GC6 A;  1YX6 B;  3UGB B;  3VTU A;  1R4M I;  2JXX A;  3PS6 A;  4FBJ B;  3CF6 E;  4F1S A;  2MBQ A;  4G11 A;  3D32 A;  2KX0 A;  2K8H A;  2IO2 B;  1H4R A;  2FIF A;  2KDI A;  1IP9 A;  3T8M A;  4GDK B;  3QK0 A;  2DZI A;  4KVG B;  2BYF A;  2OJR A;  2ZVN A;  1E7U A;  4W9E A;  3M3J A;  3QQ8 B;  2KJH B;  1LM8 B;  1OGW A;  2AYO B;  2KMA A;  2NBV B;  2R2Q A;  2RGF A;  3A9J A;  1WE7 A;  2AL3 A;  4W9G A;  4DHZ E;  2K6Q A;  3KVF B;  3RZW C;  4KDI C;  2N1V A;  3BY4 B;  3HHM A;  4WJP A;  4HDQ A;  4W9K A;  5KHQ A;  2KXJ A;  4FA6 A;  2JRI B;  4NPN A;  2I1J A;  2J0M A;  2L8J A;  3PLU A;  1GNU A;  2K8C A;  1V80 A;  3A4S C;  2MSE D;  5CX3 A;  1WJN A;  3QAQ A;  1WX9 A;  2K6D B;  2CKH B;  2KFK A;  3X23 A;  4WJO A;  4F8C B;  3AUL A;  2MRP A;  1S3S G;  2C9W B;  4HWI B;  2O2V A;  4GDL B;  4HJK A;  4WJN A;  5AZH A;  3RCZ A;  2Z0E B;  2G4D B;  2JPH A;  1GJZ A;  1WR1 A;  4XC2 A;  2IO1 B;  1LXD A;  1WXA A;  3ALB A;  4FHK A;  2KD0 A;  4FN2 A;  2XK5 A;  1WX7 A;  2MP2 A;  4LDT D;  3W1S C;  3ZTC A;  4ANV A;  4BBN F;  3VUX A;  3AU4 A;  4FAD A;  3V6C B;  2NVU I;  2MCN B;  4BVU C;  3H6N A;  1GC7 A;  2KJR A;  1KJT A;  3JVZ X;  2V1Y A;  3PRZ A;  4DXA B;  4DDI D;  1WRD B;  1V86 A;  2BYE A;  4M8M A;  3KUD B;  2LGD A;  2HJ8 A;  5CHV C;  1C1Y B;  2KLC A;  2O6V B;  3HM3 A;  4IC7 B;  4J6I A;  3WA0 A;  1XQQ A;  3ZNI D;  1L2N A;  3VAW A;  2BPS A;  4GOC A;  4PS3 A;  4W9I A;  2BWF A;  1WMH A;  2KWC A;  3ZVV A;  2HD5 B;  3PPA A;  3IBE A;  3ZNG C;  2C7H A;  1IPG A;  4JLC A;  4DK5 A;  2C5L C;  2KTR B;  3LDZ E;  3N32 A;  4WQO B;  1E90 A;  3GZN I;  2PPH A;  3H7P B;  4DWF A;  1WGY A;  3A1Q B;  2N7E A;  2D3G A;  2G3Q B;  2Z0D B;  1WZ0 A;  1NDD A;  1WY8 A;  2L0T A;  2K25 A;  2KDB A;  2DEN B;  2NBU A;  2LZ6 A;  4NY0 A;  2W9N A;  2ZPY A;  5AZF A;  4EKU A;  1WFY A;  1RFA A;  5G2N A;  3ZNZ B;  2M1M A;  2UYZ B;  5EDS A;  2KKC A;  2IBI B;  2NCN A;  3RZF A;  2OOB B;  2FCS A;  2LJ5 A;  1WE6 A;  1I35 A;  4IW0 A;  2KDE B;  4MDK E;  4KZC A;  4JQW C;  1E8W A;  2MBE A;  4F7Z A;  3K9P B;  2DX5 B;  4ANU A;  3NS8 A;  2I1K A;  2FNJ B;  2PEA A;  2HE7 A;  3HIZ A;  2FCM A;  3V62 A;  3DCG A;  1KM7 A;  4N9F 4; 
#chains in the Genus database with same CATH topology
 2RR9 A;  4W9D A;  5FK9 C;  1OFF A;  2KQS A;  3PZ8 A;  2L0F A;  3IHP C;  2KWV B;  2XEW A;  3ZDT A;  5LXI B;  2ZW0 A;  4K7W A;  4G50 A;  3CSF A;  4J3O D;  2LD9 A;  2KAJ A;  4M00 A;  1ENF A;  4B0M A;  2JZ3 B;  2BS3 B;  1QKZ A;  3I3T B;  4JL9 A;  1QZE A;  2L00 B;  3CST A;  4WAA A;  1J19 A;  1YD8 U;  3WAN A;  1NEN B;  1UBI A;  2K39 A;  1L5P A;  1YN5 A;  2BF8 B;  3MP9 A;  4KDL B;  4CHK A;  4AP4 C;  1UBQ A;  4HCN B;  4TSS A;  1V5O A;  3QC8 B;  2QC8 A;  2PE6 B;  4ITK A;  1V1P A;  1HEZ E;  3NOB A;  2JVC A;  5KHO A;  2AX5 A;  2FID A;  2FAZ A;  3FKY A;  4N59 A;  1QOG A;  4OZA A;  2J0J A;  3NG0 A;  1UEL A;  2ASQ A;  1G6J A;  2MQJ A;  4YTN B;  5JH5 C;  3N1Z C;  1MG4 A;  2M0A A;  1NI3 A;  1I4X A;  2M17 A;  4GU2 A;  3N30 A;  1B9R A;  2K9X A;  1TZO A;  1ZKH A;  4ICV A;  2BBC A;  2CR5 A;  3O65 B;  1K53 A;  4GIV A;  4BKS D;  2IYD B;  1Y8R C;  3B08 A;  3L0W B;  1ZXH A;  4L1B A;  3B1L X;  4XWW A;  2JUO A;  3ETR A;  4MH0 E;  2KN5 A;  2WNM A;  4BOZ B;  1P9D U;  2HJ1 A;  4ICU A;  2MBB B;  1UWX A;  1B1Z A;  5AZG A;  4KSL C;  3IT6 B;  1WYW B;  4KIK A;  2OJW A;  2NPT A;  1FIQ A;  3KWV A;  3VH4 B;  2VH2 A;  3R66 C;  2L32 A;  2LRU A;  1TBE A;  1GB4 A;  1L0V B;  3Q8F A;  3VTW A;  3P2B A;  2MBH A;  1XD3 B;  2MA9 B;  2KHW B;  2MJ3 A;  3AE3 B;  3NJT A;  2A5U A;  3KWL A;  3H7S A;  2R61 A;  1L6U A;  2YLM A;  2WDV B;  3GS2 A;  3L13 A;  3AE7 B;  3P42 A;  3ZQ4 A;  5DPW A;  1M4V A;  4BZA A;  3KUC B;  2J4X A;  5C23 A;  3WAP A;  1PUT A;  4DDG D;  1HE8 A;  3T3O A;  3ECI A;  3GOE A;  4AS1 A;  3PO0 A;  1FD6 A;  1P1A A;  2KQ7 A;  1Z5S B;  3KLS X;  4M8N A;  4MGK E;  5IAA C;  5J18 A;  5LLI A;  2BWE S;  1FXA A;  1YJ1 A;  2FUG 1;  1VDV A;  4XYC A;  1FXT B;  2R2O A;  3TUO A;  1YOV B;  2QDF A;  2L52 A;  4RMA A;  3EEC A;  2L7R A;  3IAS 1;  2M8S A;  1YIW A;  1WJ4 A;  5EE1 A;  3U7Z A;  2N7D A;  3W5U B;  3R3M A;  2G4S A;  1YMH E;  1YQ4 B;  1KLG D;  2WQY B;  1NYR A;  2DYM A;  4RGT A;  1EF1 A;  4IWP A;  4ZYN A;  2M0X A;  3X0W A;  2DYB A;  3L4P A;  2J52 A;  3PRM B;  1VCB A;  4XGA B;  1MHX A;  2K3U A;  1C77 A;  1ZPS A;  1V6E A;  1PQS A;  1C3T A;  2LVP A;  1NBF C;  4RGO S;  1L6V A;  3ZIM A;  3Q8B A;  3AEC B;  2L1A A;  3VTV A;  2NR2 A;  3QX1 A;  3C19 A;  2BKR B;  1WIA A;  1T0R C;  2E6X A;  4RF1 A;  1K52 A;  4EZJ A;  4K3B A;  4KX6 B;  3ONS A;  4M01 A;  3C8Y A;  1SXT A;  3DWG C;  3ABV B;  3PRE A;  3ZNH B;  3PHX B;  1UWM A;  1SB3 C;  1SF0 A;  1OQR A;  2JQR B;  2DAF A;  4HCP B;  3IT4 B;  1WM2 A;  4ASW C;  4TMA B;  2EMS A;  1WI0 A;  3OWE B;  3P4P B;  3A1Q A;  3DBH B;  2V3S A;  2KOX A;  4YSX B;  3TIX A;  3W1Y A;  1V49 A;  4EE2 A;  3DVN V;  3Q3J A;  1WRI A;  2MX2 A;  1Y56 A;  2QHO A;  3L17 A;  1TZ1 A;  3H7P A;  5L83 A;  1ET9 A;  4HPM B;  3SFD B;  3B2G A;  1WGD A;  3AM9 A;  4TKN A;  3NHE B;  4A3O A;  5DPR A;  2RSU A;  1HZ5 A;  4RM8 A;  3AEA B;  4NJC A;  4AJW A;  3K9O B;  1Q1O A;  4RFB A;  1JWU D;  1RLF A;  3A4R A;  4AJY B;  1P98 A;  3FC4 A;  2BVC A;  4C00 A;  3NZU A;  4UDU C;  1T0S C;  3H9D A;  3RUL A;  4II2 B;  1CMX B;  1JWM D;  3MC0 B;  3ZRC A;  1E7V A;  3TCA A;  3Q3N C;  3MC8 A;  3UGB B;  5BYR A;  4F1S A;  4G11 A;  3D32 A;  5MPO A;  3AE9 B;  3I5J C;  3P63 A;  5H8Y E;  3W5V B;  4A90 A;  2WLB A;  3EUB 2;  3N1X C;  2K6Q A;  2PTL A;  2DLB A;  2N1V A;  3HHM A;  2ACZ B;  4W9K A;  2PKO A;  1F0Z A;  4NPN A;  2L8J A;  2K8C A;  1WXQ A;  3GE8 C;  3QAQ A;  4WJO A;  2INC C;  2W3S A;  4GDL B;  4HJK A;  4WJN A;  2G4D B;  1N5W A;  2WGS A;  4FHK A;  4FN2 A;  2XK5 A;  1WX7 A;  2MP2 A;  1GOZ A;  3W1S C;  3ZTC A;  4ZHO A;  1ESF A;  3AU4 A;  1TS5 A;  4A55 A;  4FAD A;  2NVU I;  3H6N A;  3JVZ X;  4DDI D;  4M8M A;  3KUD B;  2LGD A;  3HM3 A;  2WXH A;  3VRA B;  1XCQ L;  1SIJ A;  3ZVV A;  1WMH A;  2KWC A;  2IGD A;  1WWT A;  4DQO C;  3PPA A;  1YQ3 B;  4JLC A;  3GZN I;  2PPH A;  2V9H A;  5IP4 D;  1WGY A;  3A1Q B;  2G3Q B;  2Z0D B;  1WY8 A;  3AEE B;  2KDB A;  2NBU A;  3NUH B;  2W9N A;  1HA5 A;  1SE4 A;  1RFA A;  2M1M A;  5EDS A;  2KKC A;  2IBI B;  2LJ5 A;  2KDE B;  4MDK E;  4KZC A;  3Q69 A;  2MBE A;  2X38 A;  2JYE A;  3B2F A;  1RYJ A;  3HIZ A;  2KVZ A;  3DCG A;  1KM7 A;  4N9F 4;  4E71 A;  3L54 A;  2O2V B;  3T3N A;  1FMA D;  4LNF A;  4AUQ C;  3JSV B;  1TIF A;  2WX0 A;  3IFW B;  2LVO A;  3W9C B;  2C7M B;  2WXI A;  2DYO A;  1C76 A;  3BYT B;  1Q10 A;  2ONQ A;  1SE9 A;  3L16 A;  2KAN A;  3TEY A;  4W9L A;  5DPS A;  2RMM A;  3GB1 A;  1FRD A;  2CU1 A;  2IO0 B;  2KN4 A;  3ZDM C;  1DOY A;  5DPT A;  4S17 A;  2AL6 A;  1N63 A;  4ANW A;  1J7B A;  1HQR D;  4OVU A;  3U8Z A;  3Q3O C;  2K1F A;  3J9C A;  3PRP B;  3R2I A;  3LJ3 A;  2O6V D;  2RD0 A;  2WXR A;  1X1M A;  3O13 A;  3ENE A;  3RNB C;  3OLM D;  2LVQ A;  1XXG A;  2KFJ A;  3APD A;  4QAY A;  3PZD A;  3HK0 A;  3JYU A;  4PS8 A;  3VUY A;  2Q5W D;  2L3Z A;  4OHJ A;  2IY0 B;  2W82 A;  4P6V F;  1JCK B;  2MH7 A;  2LGX A;  3BK2 A;  2LEK A;  2WXQ A;  5D7G A;  3V3X A;  5E6P A;  1L4Z B;  2L05 A;  3Q8E A;  4HRS A;  1Q0W B;  2IO3 B;  1N61 A;  2WXK A;  1AYF A;  1OEY J;  3NRZ A;  2J42 A;  1YX5 B;  1BT0 A;  2H88 B;  3QCA A;  2JZZ A;  4B95 A;  1DOI A;  1L7Y A;  1QOB A;  1MVK A;  1D5Z C;  1JRU A;  3N9Y C;  2D11 A;  2XK5 B;  3RNC C;  1QOA A;  3WAM A;  1R7S A;  3PZ7 A;  4P7I A;  1WZ3 A;  3AV8 A;  1V8C A;  4ZRI A;  2ON8 A;  2DBY A;  3Q3M C;  1TGZ B;  2RPQ A;  4X57 B;  4MJS A;  4RGM A;  3P4R B;  1VD2 A;  4USA A;  3KW5 B;  3PVL A;  3QAR A;  3AE4 B;  1WXM A;  1ZW7 A;  3EC8 A;  2KMC A;  1DGJ A;  3AXC A;  3AEG B;  4BOS C;  2MLB A;  1XEE A;  4A8X C;  4OVV A;  2WWZ A;  2JF5 A;  1QT9 A;  2MHJ A;  2CHZ A;  3WAO A;  4CO7 A;  3GE3 C;  2W54 A;  1RAX A;  2PIA A;  3AH7 A;  3EHV A;  4EOY A;  3VR8 B;  2ZVO A;  2ZEQ A;  4KGS A;  3SEB A;  2Y5P A;  1SEB D;  4K3C A;  1E7P B;  2AQ3 B;  3S2A A;  1YN4 A;  4MM3 A;  1MJD A;  4ACF A;  1V97 A;  4ZOH C;  2CJO A;  1CQV A;  5CHW A;  4NAW A;  2GBM A;  3EFC A;  3E56 A;  4RCO A;  3Q3F A;  1ZUD 2;  4P16 A;  2ZCB A;  3APC A;  1U4A A;  1P0R A;  3AE5 B;  2L76 A;  2GMI C;  4DHJ B;  2K22 A;  3OG5 A;  1WM3 A;  2MEK A;  1L4D B;  4LJO B;  3ZKJ C;  1NVI D;  3MJW A;  1EF5 A;  5JHB A;  2KDF B;  5G5H A;  4DBG A;  3HM6 X;  2CS4 A;  4G0N B;  3RI7 C;  1J7A A;  1KLU D;  3VH3 B;  4YXD B;  3ZUN A;  1UH6 A;  1SIF A;  2XBB C;  2LHD A;  5EE0 A;  4IM0 A;  1IGD A;  2YEP B;  4GDL A;  1LGR A;  2WXP A;  3ZO5 B;  1KH0 A;  4M0W B;  1YJI A;  4CYE A;  5GXG B;  3DBH I;  4LCD E;  3MTN B;  1T5X D;  2DAJ A;  4EZL A;  1TJE A;  4WH4 A;  3HVZ A;  4FJZ A;  5D6J B;  2ZW1 A;  1WF9 A;  2K8B A;  1IYF A;  3FAH A;  1IUE A;  1ET6 A;  3SU8 X;  3A9K B;  2WXN A;  4MJS B;  2LFI A;  5AUK A;  1SGH A;  4MEM A;  3DBL I;  1JRP A;  4HRO A;  2N9E B;  1AW7 A;  4MEL A;  2N9K A;  5BMI A;  2Y5B B;  5FR3 A;  2KTF A;  5BYQ A;  1E10 A;  2WX1 A;  1LFD A;  5T8I A;  4RF0 A;  1FCL A;  2MBO A;  3RPF C;  2AEH A;  2INN E;  5JHA A;  3RUI B;  3TEW A;  2OED A;  4HJG E;  3MJ5 A;  4A3P A;  3LB8 C;  5D3D A;  4JGH B;  3N3K B;  4K7U A;  4MM3 B;  3BVM A;  2PJH A;  1TS2 A;  1EO6 A;  1WJ6 A;  5D2M B;  4HXD A;  3OJ4 B;  2WHI A;  2DZM A;  4OZB A;  2EEL A;  2KQ4 X;  3EFU A;  3TBL D;  3UIP B;  1K8R B;  1BML C;  1QQR A;  3M95 A;  2KZR A;  2KFK B;  4IM3 A;  3TL5 A;  4S0R A;  1FXI A;  3ZRF A;  3IAM 1;  2M19 A;  3WIM A;  2PMV A;  2KLG A;  3UF8 A;  3ZYY X;  2FUH B;  3VHT C;  2QMT A;  1WX8 A;  1YX6 B;  1PGB A;  2JXX A;  3PS6 A;  3CF6 E;  3UI3 A;  2K8H A;  2IO2 B;  1H4R A;  2FIF A;  2KDI A;  3T8M A;  4LK0 M;  4JPS A;  4W9E A;  3M3J A;  3ZJT A;  2IPK D;  3V05 A;  1LM8 B;  1OGW A;  2AYO B;  2KMA A;  4DHZ E;  1WE7 A;  3NZ3 A;  4KDI C;  1IBX A;  4HDQ A;  5KHQ A;  2KXJ A;  4FA6 A;  2JRI B;  1GNU A;  1L0X B;  2K6D B;  2KFK A;  3X23 A;  1I4Q A;  1S3S G;  1MFW A;  2O2V A;  2Z0E B;  2GB1 A;  1VZ7 A;  5AUI A;  5LNK 1;  3ZGZ A;  2QIL A;  1WXA A;  4MAC A;  2KD0 A;  4BBN F;  2IGH A;  2JXT A;  3V6C B;  2MCN B;  3PRZ A;  5BMH A;  2V1Y A;  3W2D A;  4DXA B;  1V86 A;  2BTE A;  2KLC A;  3DHI C;  4IC7 B;  4J6I A;  4OVZ A;  1XQQ A;  3SFE B;  4YTM B;  3VAW A;  2NTS A;  4PS3 A;  2BB5 A;  1I4H A;  2WXM A;  2BWF A;  4P1C C;  1VZ8 A;  3ZNG C;  2C7H A;  4DK5 A;  2KTR B;  3N32 A;  1E90 A;  3I57 A;  2N7E A;  1WZ0 A;  4JX1 C;  1NDD A;  2DEN B;  3RNF C;  2LZ6 A;  4NY0 A;  5AZF A;  3AEB B;  1WFY A;  2OHF A;  2UYZ B;  2OOB B;  1I35 A;  3U52 E;  2Y3A A;  4C80 A;  2BW2 A;  4JQW C;  1FFV A;  4ANU A;  3BVG A;  2FNJ B;  2PEA A;  2HE7 A;  3V62 A;  2D3B A;  2NPT B;  4FHJ A;  2KO3 A;  4CQN A;  4HK2 A;  4HEA 1;  1WGR A;  5IA7 A;  3A9J B;  2ZNV C;  1E8Z A;  3Q8C A;  2EKE C;  1J0G A;  1RRB A;  2HDE A;  3ZJU A;  1P3Q U;  1I4G A;  1YNT E;  5DCN A;  3IG3 A;  1XCT L;  1GG3 A;  5G55 A;  3SHQ A;  2YVC A;  4XDD A;  1E8Y A;  2Y5C A;  1WXS A;  2LAS A;  1F52 A;  2JZP A;  4W9F A;  1PFD A;  1C78 A;  3RD2 A;  1M94 A;  1DOX A;  5EE9 A;  3GZN B;  2HTH A;  1F2R C;  4NJ7 A;  4WUR A;  4C7Z A;  4MGZ E;  1KOT A;  1OEY A;  2C7N B;  3RNA C;  2NTT A;  4TQ0 A;  4PYZ A;  3DQV A;  4FXC A;  2IY1 B;  3AE6 B;  3NVZ A;  4XDC A;  4IM2 A;  2PVG C;  1GAQ B;  3DVG Y;  1D4B A;  2GOW A;  4H2A A;  4MSQ B;  2GBR A;  1NEK B;  3CMM B;  1WGG A;  1H8C A;  3E9S A;  3TEZ A;  4ANX A;  4WIP A;  4IDI A;  3DHG C;  3MHS D;  5BO4 B;  2WXG A;  3KH0 A;  5I4D A;  1PYW D;  1ZDV A;  4II3 B;  2V3P A;  5TR5 A;  3AB5 A;  4TV3 A;  3EGR A;  4PS7 A;  4DHZ B;  4EZK A;  4W9C A;  3OJ3 A;  5TSS A;  1TKE A;  3HRD D;  3GP7 A;  1STE A;  3N1Y C;  3PTF C;  5AEK B;  1FM0 D;  4BKS A;  1XLN A;  1XF5 L;  1ZOY B;  2WXL A;  1S1Q B;  1AAR A;  2N7J A;  4JWU C;  3ZW3 A;  2Z8L A;  3QWZ B;  2WU5 B;  4RGN A;  4BBN C;  1Z2M A;  1TKG A;  2ZZP B;  2RPV A;  3ML9 A;  3Q8A A;  4IG7 B;  5BYS A;  4KGR A;  2CJN A;  1WXV A;  2CHX A;  4K7S A;  2SEB D;  4ZRJ A;  3PHW B;  1JWS D;  2N9X A;  2VH1 A;  4OZC A;  4C4V B;  4C7Y A;  3A9K A;  2LGI A;  4URK A;  1OQQ A;  1N60 A;  4ZRK A;  2WXF A;  5CTR C;  2RDG A;  1I4P A;  1VLB A;  1N6Z A;  5H92 C;  2I2Y A;  5HKH A;  4G3X B;  1NYQ A;  3U30 A;  1AN8 A;  1A70 A;  1KFY B;  4N6E B;  5D3I B;  2GBN A;  4DHJ D;  1E6E B;  4NNJ B;  4ZRP A;  3QHT A;  3NVW A;  3ZLZ A;  1YN3 A;  2J0K A;  4E3C A;  4A9A A;  2LWP A;  2FBW B;  4I6L B;  1JAL A;  1K51 A;  1XO3 A;  1V81 A;  2WP9 B;  2PLP A;  3KYD D;  4L23 A;  3ZJV A;  3VRB B;  2Z59 B;  5E6O A;  3VXW A;  1XT9 B;  3VUW A;  4FJY A;  2K5P A;  5J2R A;  1IBX B;  1PGX A;  5HFY A;  4W9J A;  1MI0 A;  2DHZ A;  2AQ2 B;  2WDT B;  2G9H D;  2M4N A;  5J17 A;  1C4A A;  4WAF A;  4W9H A;  3NVV A;  3AI5 A;  2LHE A;  5LXH A;  4LNI A;  4P1B C;  3RNG C;  2N9P C;  2JWU A;  2BT6 A;  4B9K A;  2WU2 B;  4D2K A;  4IUM B;  1A5R A;  4GDK A;  2G45 B;  4LDT B;  3ML8 A;  4XWT A;  2KK8 A;  4IWO A;  4NZL B;  2BGF A;  1PDX A;  1F9J A;  1OTR B;  2NBW B;  2E3T A;  3RT3 B;  1KF6 B;  1UGM A;  3ZTD A;  2KWU B;  3L10 B;  4WWN A;  2GRI A;  2IZV B;  1EWY C;  3AEF B;  1VZ6 A;  4MGY E;  5EE3 A;  1MPE A;  2MWS B;  2WS3 B;  1UD7 A;  4LNK A;  2H89 B;  4WWO A;  3U4E G;  3TJP A;  1WMH B;  1KTK A;  2ZCC A;  2JSV X;  1LQB A;  2WYQ A;  4IKG A;  1UUP A;  4HKQ A;  5D94 A;  4PT5 A;  3B9J A;  4KGT A;  3EA6 A;  2N1W A;  2O6V A;  1YQB A;  3CIR B;  3BIN A;  2KT7 A;  1HZ6 A;  4NAW B;  4EUT A;  4BKG A;  1EU3 A;  2NMQ A;  2DZK A;  4BFR A;  2D10 A;  2D07 B;  4FUL A;  3IVF A;  3CWI A;  2QSD A;  3LXF A;  4AQ7 A;  2MP2 B;  3P1M A;  2CU3 A;  3M63 B;  4EEW A;  4GMV A;  1GUA B;  1TY2 A;  2QEJ C;  1R4M I;  1QLB B;  2KX0 A;  3MFG A;  1EWC A;  4GDK B;  4KKI A;  4YSY B;  1QF6 A;  2OJR A;  2ZVN A;  1E7U A;  1SSN A;  1DYQ A;  2KJH B;  2RGF A;  2NBV B;  2AL3 A;  4WJP A;  2I1J A;  1N5X A;  2J0M A;  2J53 A;  3PLU A;  1F77 A;  1V80 A;  1WJN A;  1WX9 A;  3AE8 B;  4F8C B;  3AUL A;  2C9W B;  4HWI B;  2IDY A;  4YTP B;  5AZH A;  5C2T B;  4ZHP A;  1GJZ A;  1WR1 A;  4XC2 A;  3ALB A;  4M0W A;  1VR9 A;  4LDT D;  4GLS C;  4ANV A;  3VUX A;  1ZXI A;  2KJR A;  2HJ8 A;  5CHV C;  1C1Y B;  2BS4 B;  4JE3 B;  3WA0 A;  3ZNI D;  1L2N A;  3NVY A;  2BPS A;  4W9I A;  1IGC A;  4ARI A;  2RDH A;  2I38 A;  2HD5 B;  1V1O A;  3Q14 C;  3IBE A;  4IOI E;  1ZDX A;  4O1N A;  2INP E;  3N20 C;  4DWF A;  2HTM E;  1QIL A;  1TS3 A;  4ARC A;  3ZNZ B;  3TSS A;  4RNA A;  2NCN A;  4IW0 A;  4M02 A;  3K9P B;  2DX5 B;  2WXO A;  3NS8 A;  4DXF A;  1SBB B;  2RDB C;  1CJE A;  4MT5 A;  1E9M A;  2UU7 A;  3BWU D;  1WSP A;  4YL8 A;  1HTO A;  3AED B;  3DBR B;  1C79 A;  4TQ1 A;  2KC2 A;  3OAW A;  3HUI A;  3SDL C;  3LYY A;  1KLV A;  1TYG B;  2FCN A;  2A4Z A;  3MHZ A;  3PLV A;  4HVB A;  2XNA C;  4FLH A;  4PYU A;  3QIJ A;  4MSM B;  4B6W A;  1C4P A;  3QJZ A;  2LXA A;  1R4N I;  4RM9 A;  1JML A;  3KUZ A;  4GB9 A;  3MC9 A;  4N58 A;  1C9F A;  3DBR I;  1RFK A;  1YJJ A;  2KVR A;  5E6J A;  4E74 A;  1EUV B;  2XN9 C;  2C60 A;  1N62 A;  2K0P A;  4ZYS A;  1HTQ A;  3Q2A C;  3W1S A;  3L08 A;  1E0Z A;  3SR6 A;  5FR6 A;  3QA8 A;  4A20 A;  4WWM A;  2UWQ A;  1MG8 A;  2AWT A;  2JT4 B;  2LXC A;  3U2S C;  1P7F A;  3FIL A;  3H1U A;  4FJV B;  4REZ A;  1SJE D;  5IOI A;  2MW5 A;  3P4S B;  4WJQ A;  1E5W A;  4GGQ A;  1T0Y A;  5BMG A;  3V61 A;  3UIN B;  1F1H A;  4LNN A;  3VQI A;  3VDZ A;  1J8C A;  2ZPN A;  1JWB D;  1VRA B;  3AMZ A;  3I63 C;  2N0S B;  1HXY D;  3I9V 1;  4OW0 A;  5G5G A;  3R8B A;  2ICI A;  4C56 C;  1OQY A;  4XZ4 A;  3P4Q B;  4PK1 A;  2IND C;  2JX5 A;  3DDC B;  4US8 A;  4L2Y A;  1EU4 A;  2KDM A;  1ACC A;  1MHH E;  4LTU A;  1PGA A;  3UIO B;  1TY0 A;  1UGJ A;  3R7R A;  4HLE A;  2KX3 A;  4MGI E;  5C3J B;  3A33 B;  1V1P B;  4I6P A;  4EFO A;  4YSZ B;  2KC1 A;  3DVN U;  3T9L A;  2JWZ A;  4WWP A;  3RMK C;  2DNF A;  3ZXV A;  1E8X A;  1D3Z A;  4LLG M;  1T3Q A;  5C1Z A;  1FFU A;  1LO5 D;  2BYT A;  3NY5 A;  2G1E A;  2LUE A;  4HKZ E;  1EM7 A;  3SD5 A;  1TKY A;  4KSK C;  4NAM A;  1I4R A;  1TTN A;  1BUI C;  1P7E A;  2B3A A;  2LUM A;  1WR6 E;  1I7H A;  4GXB A;  1F2R I;  3WAL A;  1T6B X;  3DOW A;  4TUU A;  1CK1 A;  2EMT A;  3DPD A;  4KV2 A;  2PVO D;  1J7C A;  2IJ0 A;  2NS5 A;  2GBJ A;  2X8X X;  1FO4 A;  5JXV A;  3RYT A;  2IGG A;  2LI5 A;  2JRH A;  1KRH A;  4GSW A;  1FNU A;  3PSE B;  2WXJ A;  1JWA D;  2BQQ A;  2LGS A;  3Q6B A;  2D3C A;  1WYG A;  3VVW B;  2BYV E;  3R7Q A;  2BS2 B;  1XLO A;  3ZXR A;  4BKT A;  2ZNV B;  3H8H A;  4KKJ A;  2W3R A;  4ZDV A;  1WJU A;  2L83 A;  4I6N B;  2GI9 A;  4K81 A;  5E6N A;  3AE1 B;  1D6E C;  5IN7 A;  4MH8 A;  2GBK A;  3UQB A;  2GLS A;  4KZ0 A;  3C0R B;  2N4F A;  2ZJD A;  4B0E A;  1UF0 A;  3KYC D;  1JW9 D;  1R4N B;  3PV1 A;  1WGH A;  2LJI A;  1FEH A;  4JIO U;  2V4I B;  3BII D;  2MJE A;  1R4M B;  3DVG X;  5JZE B;  3NZS A;  3RN9 C;  2EKI A;  1FNV A;  5FKA C;  4JWS C;  1VJK A;  5IO9 A;  2VRR B;  2KMM A;  1FCC C;  2W55 A;  3KQ4 A;  3BK1 A;  3B0A A;  1AWD A;  3PGE A;  4LJP B;  4HPP A;  4RH6 A;  4R3D A;  2FCQ A;  4KIK B;  1SJH D;  1ISN A;  2PE9 A;  1K50 A;  3JW0 X;  1SE3 A;  2J7Q B;  4GN1 A;  3V6E B;  3RFZ B;  1FRR A;  1L0Y B;  1ROE A;  1Q5W B;  4BAX A;  2LRW A;  2LMC A;  3DHH C;  2QIE B;  4NQL B;  3V60 A;  3WCQ A;  4AOF A;  1GPX A;  2CHW A;  5CHF A;  2LGY A;  3VFK A;  2D5G A;  3RNE C;  2V4L A;  4NQK E;  2DZJ A;  3IXS A;  4HDO A;  4IWQ A;  1UZX B;  2D2Q A;  1NI2 A;  2QCZ A;  3JSV A;  1C4C A;  2PW9 A;  2M56 B;  2KWD A;  1UNS A;  3U7D A;  3BYY B;  4XX5 A;  4A6Q A;  2SAK A;  4NJ6 A;  3AN1 A;  4HPL B;  4AWJ A;  2KJ6 A;  1T0Q C;  1TS4 A;  2KTR A;  1D5M C;  3TMP B;  1FNW A;  2V0G A;  2KNB A;  2BKF A;  3AU5 A;  1WH3 A;  4Q2J A;  3BZD B;  1V2Y A;  1V5T A;  5L95 C;  1V9J A;  3M62 B;  5HHD G;  5HI1 A;  2AQ1 B;  3APF A;  1D5X C;  4WQM A;  3DBS A;  3PT2 B;  1ZGU B;  1I42 A;  1FPY A;  3UQA A;  2WDQ B;  4K1R B;  4YT0 B;  2REX A;  5GMV A;  3DWM A;  2YEP F;  2JY6 A;  4ZRQ A;  1GC6 A;  2V3N A;  1RM6 C;  3VTU A;  4US9 A;  4FBJ B;  2MJD A;  2MBQ A;  2WDR B;  2KYW A;  1IP9 A;  3QK0 A;  2DZI A;  3URY A;  4KVG B;  2BYF A;  3VR9 B;  3QQ8 B;  2TSS A;  1QOF A;  2JYT A;  5HG2 A;  3TEX A;  4W9G A;  2R2Q A;  3A9J A;  2JU6 X;  3KVF B;  3RZW C;  3BY4 B;  4XE0 A;  2VZK D;  2D3A A;  2VZK B;  5IKC M;  3A4S C;  2MSE D;  5CX3 A;  2CKH B;  1TT5 B;  2MRP A;  2DWQ A;  3RCZ A;  2JPH A;  1WGK A;  2IO1 B;  1LXD A;  1ZP0 B;  2FE8 A;  2N9L A;  3NS1 A;  1XLP A;  3HVD A;  4BVU C;  1GC7 A;  4LNO A;  1KJT A;  1BXT A;  1JQ4 A;  1WRD B;  2BYE A;  2KAC A;  2B76 B;  3FIL B;  2O6V B;  3R2T A;  1ZE3 D;  4GOC A;  4DXG A;  1XLQ A;  1CZP A;  2QJL A;  1SE2 A;  1IPG A;  1JRO A;  2C5L C;  3LDZ E;  4WQO B;  1RWS A;  3H7P B;  2D3G A;  3BVZ A;  2BB6 A;  2L0T A;  2K25 A;  3DBL B;  2ZPY A;  4EKU A;  5G2N A;  3AE2 B;  4YWG G;  3RZF A;  2FCS A;  1WE6 A;  4C4V A;  1E8W A;  1GB1 A;  4F7Z A;  2I1K A;  2FCM A; 
#chains in the Genus database with same CATH homology
 2NPT B;  2RR9 A;  4YL8 A;  4W9D A;  4FHJ A;  4E71 A;  2KO3 A;  2KQS A;  4TQ1 A;  3L54 A;  2O2V B;  2KC2 A;  3OAW A;  2L0F A;  4HK2 A;  3IHP C;  2KWV B;  1WGR A;  4AUQ C;  3A9J B;  2XEW A;  3SDL C;  2ZNV C;  3ZDT A;  5IA7 A;  5LXI B;  3JSV B;  2FCN A;  4K7W A;  1KLV A;  1E8Z A;  2A4Z A;  2EKE C;  1J0G A;  2WX0 A;  1RRB A;  3IFW B;  3PLV A;  2LVO A;  4HVB A;  4FLH A;  4G50 A;  2C7M B;  4PYU A;  3CSF A;  1P3Q U;  2DYO A;  1SE9 A;  2LD9 A;  3L16 A;  3QIJ A;  4MSM B;  4B6W A;  2KAN A;  3QJZ A;  2LXA A;  1R4N I;  2JZ3 B;  4W9L A;  5DCN A;  3IG3 A;  4RM9 A;  3KUZ A;  5DPS A;  3I3T B;  4GB9 A;  4JL9 A;  1GG3 A;  5G55 A;  3DBR I;  1QZE A;  2CU1 A;  3SHQ A;  2L00 B;  3CST A;  2YVC A;  4WAA A;  1J19 A;  1E8Y A;  1YD8 U;  2IO0 B;  3WAN A;  1WXS A;  2LAS A;  3ZDM C;  2KVR A;  1UBI A;  4E74 A;  4W9F A;  2K39 A;  5DPT A;  1EUV B;  2AL6 A;  2C60 A;  3RD2 A;  2BF8 B;  4KDL B;  4CHK A;  4ANW A;  4AP4 C;  1UBQ A;  1M94 A;  4HCN B;  1V5O A;  3QC8 B;  3W1S A;  3L08 A;  2PE6 B;  4OVU A;  5FR6 A;  2K1F A;  2HTH A;  3QA8 A;  3U8Z A;  4A20 A;  2UWQ A;  4NJ7 A;  3PRP B;  1MG8 A;  2AWT A;  2JT4 B;  4MGZ E;  2LXC A;  1KOT A;  3LJ3 A;  1OEY A;  3NOB A;  2C7N B;  2O6V D;  2JVC A;  2RD0 A;  4TQ0 A;  3H1U A;  4FJV B;  1X1M A;  3DQV A;  4PYZ A;  2IY1 B;  3ENE A;  5KHO A;  2MW5 A;  3OLM D;  2LVQ A;  4WJQ A;  1E5W A;  2KFJ A;  1T0Y A;  4GGQ A;  4IM2 A;  3APD A;  3V61 A;  3UIN B;  2FID A;  2FAZ A;  3PZD A;  3DVG Y;  3HK0 A;  3JYU A;  4PS8 A;  3VQI A;  3VDZ A;  3VUY A;  1J8C A;  2ZPN A;  2J0J A;  2GOW A;  1UEL A;  2ASQ A;  1G6J A;  2MQJ A;  4MSQ B;  5JH5 C;  2L3Z A;  2GBR A;  2IY0 B;  3CMM B;  1WGG A;  2M17 A;  4GU2 A;  1H8C A;  2LGX A;  3N30 A;  1OQY A;  1ZKH A;  4ANX A;  4XZ4 A;  4ICV A;  5D7G A;  5E6P A;  2CR5 A;  3DDC B;  3MHS D;  2L05 A;  3O65 B;  1Q0W B;  2IO3 B;  3KH0 A;  5BO4 B;  4GIV A;  4BKS D;  2IYD B;  1OEY J;  1Y8R C;  3B08 A;  3L0W B;  3B1L X;  1YX5 B;  1BT0 A;  2JUO A;  3QCA A;  2JZZ A;  4II3 B;  3UIO B;  4B95 A;  4MH0 E;  2KN5 A;  5TR5 A;  3R7R A;  1L7Y A;  4BOZ B;  2KX3 A;  4TV3 A;  1P9D U;  4ICU A;  4PS7 A;  4MGI E;  1JRU A;  2MBB B;  4HLE A;  3A33 B;  4DHZ B;  2D11 A;  4I6P A;  4EFO A;  2XK5 B;  4EZK A;  2KC1 A;  4W9C A;  3DVN U;  3OJ3 A;  5AZG A;  4KSL C;  3T9L A;  3WAM A;  1WYW B;  2JWZ A;  4KIK A;  4WWP A;  3PTF C;  5AEK B;  4P7I A;  2NPT A;  1E8X A;  1WZ3 A;  1D3Z A;  3VH4 B;  4BKS A;  5C1Z A;  4ZRI A;  3R66 C;  3NY5 A;  2LRU A;  1TGZ B;  1TBE A;  2LUE A;  2RPQ A;  4X57 B;  1S1Q B;  4MJS A;  3VTW A;  3P2B A;  1AAR A;  1VD2 A;  3SD5 A;  3KW5 B;  3PVL A;  2MBH A;  1XD3 B;  3QAR A;  1WXM A;  4KSK C;  1ZW7 A;  3EC8 A;  2KMC A;  3ZW3 A;  1TTN A;  3QWZ B;  3AXC A;  2B3A A;  4BOS C;  1WR6 E;  2MLB A;  2MA9 B;  4BBN C;  1Z2M A;  2ZZP B;  4OVV A;  2KHW B;  4GXB A;  2WWZ A;  3ML9 A;  3WAL A;  2JF5 A;  4IG7 B;  3DOW A;  1WXV A;  2A5U A;  2CHX A;  2CHZ A;  4K7S A;  4TUU A;  3WAO A;  4CO7 A;  4ZRJ A;  2EMT A;  3PHW B;  3H7S A;  4EOY A;  1RAX A;  2N9X A;  3EHV A;  2YLM A;  3L13 A;  3DPD A;  4KV2 A;  2ZVO A;  2ZEQ A;  3A9K A;  5DPW A;  2NS5 A;  4URK A;  2GBJ A;  4ZRK A;  3KUC B;  5C23 A;  3WAP A;  5CTR C;  3RYT A;  4DDG D;  1HE8 A;  3ECI A;  3GOE A;  2LI5 A;  3S2A A;  2JRH A;  4G3X B;  1P1A A;  2KQ7 A;  1Z5S B;  3U30 A;  5HKH A;  4MM3 A;  4M8N A;  4GSW A;  4MGK E;  5IAA C;  5J18 A;  5LLI A;  3PSE B;  3VVW B;  2BYV E;  2BWE S;  2GBN A;  3R7Q A;  1YJ1 A;  5CHW A;  4DHJ D;  4NAW A;  4BKT A;  2GBM A;  4NNJ B;  2ZNV B;  3QHT A;  3ZLZ A;  3Q3F A;  1FXT B;  2R2O A;  2J0K A;  4E3C A;  2ZCB A;  1WJU A;  4ZDV A;  2LWP A;  3APC A;  1U4A A;  4RMA A;  3EEC A;  4I6N B;  1P0R A;  4K81 A;  2L76 A;  2L7R A;  5E6N A;  4I6L B;  2GMI C;  4DHJ B;  1WM3 A;  1V81 A;  2GBK A;  3KYD D;  4LJO B;  3UQB A;  2M8S A;  1YIW A;  3ZKJ C;  1WJ4 A;  4KZ0 A;  2N7D A;  3MJW A;  2Z59 B;  3C0R B;  3R3M A;  2G4S A;  2N4F A;  2ZJD A;  1EF5 A;  5E6O A;  5JHB A;  3VXW A;  1XT9 B;  3VUW A;  4FJY A;  2KDF B;  3KYC D;  4DBG A;  3HM6 X;  3PV1 A;  5J2R A;  2CS4 A;  1WGH A;  2DYM A;  4G0N B;  1EF1 A;  4JIO U;  4IWP A;  4ZYN A;  2M0X A;  3X0W A;  4W9J A;  3VH3 B;  3ZUN A;  1UH6 A;  2DYB A;  2DHZ A;  1SIF A;  3PRM B;  1VCB A;  3DVG X;  2XBB C;  5JZE B;  3NZS A;  2WDT B;  2M4N A;  1V6E A;  1PQS A;  5J17 A;  4IM0 A;  1C3T A;  2LVP A;  1NBF C;  4GDL A;  3ZO5 B;  4W9H A;  3ZIM A;  3AI5 A;  4M0W B;  2VRR B;  5LXH A;  4CYE A;  3VTV A;  2NR2 A;  3DBH I;  3QX1 A;  4LCD E;  3B0A A;  2BKR B;  2N9P C;  3MTN B;  1WIA A;  3PGE A;  4LJP B;  2FCQ A;  4KIK B;  4B9K A;  2DAJ A;  1ISN A;  4IUM B;  4EZL A;  4EZJ A;  2PE9 A;  4GDK A;  1A5R A;  2G45 B;  4FJZ A;  4LDT B;  3ML8 A;  3ONS A;  5D6J B;  2KK8 A;  3JW0 X;  1WF9 A;  2K8B A;  4IWO A;  1IYF A;  3SU8 X;  3PRE A;  3ZNH B;  2BGF A;  3A9K B;  3PHX B;  4MJS B;  1F9J A;  1OTR B;  2NBW B;  3RT3 B;  2J7Q B;  2DAF A;  4GN1 A;  1SGH A;  1UGM A;  3V6E B;  4MEM A;  4HCP B;  2KWU B;  3ZTD A;  3DBL I;  3L10 B;  4WWN A;  2N9E B;  1WM2 A;  2IZV B;  4ASW C;  2EMS A;  4MEL A;  1WI0 A;  2Y5B B;  4MGY E;  1Q5W B;  2KTF A;  3A1Q A;  2MWS B;  2LRW A;  4AOF A;  1UD7 A;  4NQL B;  3V60 A;  2WX1 A;  2CHW A;  2V3S A;  4WWO A;  2KOX A;  5CHF A;  2LGY A;  1LFD A;  3TIX A;  3VFK A;  3W1Y A;  1V49 A;  3TJP A;  1WMH B;  2V4L A;  3DVN V;  3Q3J A;  2ZCC A;  4NQK E;  2DZJ A;  4HDO A;  2MX2 A;  1LQB A;  2MBO A;  4IWQ A;  1UZX B;  2WYQ A;  2D2Q A;  2QHO A;  3L17 A;  1NI2 A;  2AEH A;  1TZ1 A;  3JSV A;  3H7P A;  5L83 A;  5D94 A;  4HPM B;  5JHA A;  3RUI B;  1WGD A;  4TKN A;  4A3P A;  3NHE B;  3U7D A;  4A3O A;  5DPR A;  2RSU A;  3N3K B;  4JGH B;  4K7U A;  4RM8 A;  4XX5 A;  2PJH A;  1EO6 A;  1WJ6 A;  5D2M B;  4HXD A;  3OJ4 B;  4NJ6 A;  2N1W A;  4AJW A;  2O6V A;  2DZM A;  3K9O B;  1Q1O A;  1YQB A;  4HPL B;  3BIN A;  1RLF A;  2KJ6 A;  4AWJ A;  2KTR A;  3A4R A;  4AJY B;  1P98 A;  4NAW B;  3TMP B;  4EUT A;  4BKG A;  3EFU A;  3TBL D;  3UIP B;  1K8R B;  2KNB A;  2BKF A;  3AU5 A;  1WH3 A;  3M95 A;  1V2Y A;  2DZK A;  2KZR A;  1V5T A;  3NZU A;  2KFK B;  4IM3 A;  2D10 A;  4BFR A;  3H9D A;  1V9J A;  3TL5 A;  5L95 C;  2D07 B;  3M62 B;  3RUL A;  4FUL A;  3APF A;  3ZRF A;  3IVF A;  3DBS A;  4II2 B;  1CMX B;  1ZGU B;  3PT2 B;  1I42 A;  3UQA A;  3WIM A;  2KLG A;  4K1R B;  3UF8 A;  2MP2 B;  2REX A;  5GMV A;  3ZRC A;  2FUH B;  3VHT C;  1E7V A;  2JY6 A;  4EEW A;  3M63 B;  3TCA A;  1WX8 A;  4GMV A;  1GUA B;  1GC6 A;  1YX6 B;  3UGB B;  3VTU A;  1R4M I;  2JXX A;  3PS6 A;  4FBJ B;  3CF6 E;  4F1S A;  2MBQ A;  4G11 A;  3D32 A;  2KX0 A;  2K8H A;  2IO2 B;  1H4R A;  2FIF A;  2KDI A;  1IP9 A;  3T8M A;  4GDK B;  3QK0 A;  2DZI A;  4KVG B;  2BYF A;  2OJR A;  2ZVN A;  1E7U A;  4W9E A;  3M3J A;  3QQ8 B;  2KJH B;  1LM8 B;  1OGW A;  2AYO B;  2KMA A;  2NBV B;  2R2Q A;  2RGF A;  3A9J A;  1WE7 A;  2AL3 A;  4W9G A;  4DHZ E;  2K6Q A;  3KVF B;  3RZW C;  4KDI C;  2N1V A;  3BY4 B;  3HHM A;  4WJP A;  4HDQ A;  4W9K A;  5KHQ A;  2KXJ A;  4FA6 A;  2JRI B;  4NPN A;  2I1J A;  2J0M A;  2L8J A;  3PLU A;  1GNU A;  2K8C A;  1V80 A;  3A4S C;  2MSE D;  5CX3 A;  1WJN A;  3QAQ A;  1WX9 A;  2K6D B;  2CKH B;  2KFK A;  3X23 A;  4WJO A;  4F8C B;  3AUL A;  2MRP A;  1S3S G;  2C9W B;  4HWI B;  2O2V A;  4GDL B;  4HJK A;  4WJN A;  5AZH A;  3RCZ A;  2Z0E B;  2G4D B;  2JPH A;  1GJZ A;  1WR1 A;  4XC2 A;  2IO1 B;  1LXD A;  1WXA A;  3ALB A;  4FHK A;  2KD0 A;  4FN2 A;  2XK5 A;  1WX7 A;  2MP2 A;  4LDT D;  3W1S C;  3ZTC A;  4ANV A;  4BBN F;  3VUX A;  3AU4 A;  4FAD A;  3V6C B;  2NVU I;  2MCN B;  4BVU C;  3H6N A;  1GC7 A;  2KJR A;  1KJT A;  3JVZ X;  2V1Y A;  3PRZ A;  4DXA B;  4DDI D;  1WRD B;  1V86 A;  2BYE A;  4M8M A;  3KUD B;  2LGD A;  2HJ8 A;  5CHV C;  1C1Y B;  2KLC A;  2O6V B;  3HM3 A;  4IC7 B;  4J6I A;  3WA0 A;  1XQQ A;  3ZNI D;  1L2N A;  3VAW A;  2BPS A;  4GOC A;  4PS3 A;  4W9I A;  2BWF A;  1WMH A;  2KWC A;  3ZVV A;  2HD5 B;  3PPA A;  3IBE A;  3ZNG C;  2C7H A;  1IPG A;  4JLC A;  4DK5 A;  2C5L C;  2KTR B;  3LDZ E;  3N32 A;  4WQO B;  1E90 A;  3GZN I;  2PPH A;  3H7P B;  4DWF A;  1WGY A;  3A1Q B;  2N7E A;  2D3G A;  2G3Q B;  2Z0D B;  1WZ0 A;  1NDD A;  1WY8 A;  2L0T A;  2K25 A;  2KDB A;  2DEN B;  2NBU A;  2LZ6 A;  4NY0 A;  2W9N A;  2ZPY A;  5AZF A;  4EKU A;  1WFY A;  1RFA A;  5G2N A;  3ZNZ B;  2M1M A;  2UYZ B;  5EDS A;  2KKC A;  2IBI B;  2NCN A;  3RZF A;  2OOB B;  2FCS A;  2LJ5 A;  1WE6 A;  1I35 A;  4IW0 A;  2KDE B;  4MDK E;  4KZC A;  4JQW C;  1E8W A;  2MBE A;  4F7Z A;  3K9P B;  2DX5 B;  4ANU A;  3NS8 A;  2I1K A;  2FNJ B;  2PEA A;  2HE7 A;  3HIZ A;  2FCM A;  3V62 A;  3DCG A;  1KM7 A;  4N9F 4; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...