1VD2A

Solution structure of the pb1 domain of pkciota
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
89
structure length
89
Chain Sequence
GPLGSQVRVKAYYRGDIMITHFEPSISFEGLCNEVRDMCSFDNEQLFTMKWIDEEGDPCTVSSQLELEEAFRLYELNKDSELLIHVFPC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of atypical protein kinase C PB1 domain and its mode of interaction with ZIP/p62 and MEK5
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Protein kinase C, iota type
total genus 12
structure length 89
sequence length 89
ec nomenclature ec 2.7.11.13: Protein kinase C.
pdb deposition date 2004-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00564 PB1 PB1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1vd2A00
5KHQA 2LXCA 3HM6X 2KJRA 2FAZA 3LDZE 2KK8A 1Q5WB 4CO7A 4MSMB 1WFYA 1E8ZA 2KFJA 1KOTA 2DHZA 2EMSA 3B0AA 2XBBC 2BWES 4GXBA 3NY5A 2ZJDA 2WWZA 2KD0A 2KQSA 3HK0A 4M0WB 1WI0A 2LD9A 2KWVB 3DDCB 1UD7A 3DPDA 4BKTA 3NS8A 3KUDB 2JUOA 2I1JA 3RCZA 3ML9A 4HWIB 3A4RA 1UZXB 4ANWA 3NZUA 1V5OA 2ZPNA 1OQYA 4XZ4A 2GBMA 4GN1A 1GG3A 4MELA 4PS7A 3ZKJC 2VRRB 3UINB 3N3KB 1OTRB 2PEAA 1LQBA 3HHMA 3BY4B 4GDLA 4II3B 5KHOA 1WJUA 2AEHA 4KDLB 1MG8A 3UQBA 2KJ6A 2D11A 1PQSA 2WYQA 3PRZA 4K1RB 5IAAC 4B6WA 5D6JB 3QJZA 4GOCA 4BOSC 1L7YA 2NBWB 2KVRA 2BWFA 1YIWA 2N1WA 3RT3B 2BGFA 2DAFA 2J0JA 5E6PA 1V9JA 2BYVE 2V3SA 3W1SC 1BT0A 5TR5A 5HKHA 2BKFA 3B1LX 3N32A 2Z59B 2DX5B 2HJ8A 4IUMB 2XK5A 3PRPB 1XQQA 3TMPB 3CSFA 1GC7A 2GBKA 2ASQA 2RGFA 3UIOB 2N4FA 2CHWA 4W9GA 3ALBA 4W9KA 5IA7A 5LXIB 2B3AA 5DPWA 1VCBA 4HCNB 2GBRA 4ICVA 3DCGA 4HPMB 3EECA 2C60A 3M3JA 2A4ZA 1FXTB 4WJNA 3DBRI 4ANXA 4F7ZA 2CU1A 4MGYE 3KUCB 2RR9A 3L10B 4HXDA 4AOFA 2L0TA 1ZKHA 1WGGA 2CKHB 3ZNGC 5CHWA 2L76A 4BVUC 3QIJA 3RZFA 3ENEA 3QCAA 2I1KA 2JZ3B 3PLVA 4ZRJA 1NBFC 3WALA 1I42A 4NY0A 1KJTA 2C7NB 3ZRCA 3AI5A 2RPQA 3K9OB 4HCPB 1QZEA 3OAWA 1A5RA 2A5UA 2BKRB 2LWPA 2AL3A 3A9KA 3AULA 3DVNU 4I6LB 2NBUA 3QQ8B 4MGZE 3SD5A 2KHWB 2KO3A 5CX3A 4HDQA 4I6PA 3S2AA 3NHEB 4WJOA 1J0GA 3VUWA 3R7RA 4WQOB 4IWOA 2M17A 1E8WA 2D2QA 2D10A 3RYTA 3IG3A 4BOZB 1WGDA 2M8SA 3L13A 4DDGD 2FIDA 2C7HA 4MGKE 3ZW3A 4ASWC 5J2RA 2KDFB 3UF8A 4FBJB 1WE7A 5CHVC 1X1MA 4GU2A 2KDEB 3ECIA 4E74A 4FHKA 2KKCA 2OJRA 4FJZA 2KWCA 2EMTA 2JVCA 3QC8B 4BKSD 4NAWB 3WAMA 2N1VA 2MQJA 1EUVB 4FJVB 3EFUA 4K81A 1RFAA 3A33B 2V1YA 4MJSA 2XK5B 2ZPYA 3L54A 3SDLC 4TUUA 3RZWC 1SIFA 1WIAA 2O6VA 1WZ0A 3UIPB 4IM0A 3WIMA 4FHJA 2KFKB 2DZMA 2L05A 2MBHA 1YQBA 4MGIE 3JYUA 4J6IA 3RULA 3H7PA 3KW5B 4A3OA 3A1QA 1WE6A 4NJ6A 3V60A 2WX1A 4TKNA 2DYBA 3ZDTA 2L7RA 3IBEA 3ZNHB 2ZZPB 4EFOA 3A9KB 2DZIA 3U30A 4A3PA 2KTRB 3VFKA 2JF5A 2LJ5A 3VDZA 3V62A 4GB9A 5CTRC 4MJSB 1GUAB 4FJYA 4ZRIA 2JXXA 4RM9A 3O65B 3DOWA 3PV1A 4KIKB 5L83A 4WJQA 4JIOU 2KDIA 1P98A 2KFKA 4BBNF 5FR6A 2IO2B 4PYUA 1WX8A 2G45B 2LVOA 3OJ3A 2K6QA 2BYFA 3KYCD 3QARA 3T8MA 3PTFC 1V49A 4DHJD 3M95A 4YL8A 4EZKA 1WM2A 5EDSA 3ZRFA 2BF8B 5C1ZA 3PREA 1T0YA 2NS5A 5C23A 2FUHB 3DQVA 4WWNA 4BFRA 2DAJA 5J18A 1JRUA 1OEYJ 4KIKA 3ZNID 2C5LC 2PE6B 2G4SA 4M8MA 4W9JA 2O2VB 2CS4A 2GBNA 5E6OA 4AJWA 3NOBA 1LFDA 2ZCBA 1J19A 2NR2A 1V86A 1EO6A 2MRPA 2K39A 3DVNV 2Z0DB 4GDKA 4NJ7A 1E90A 3D32A 5AZHA 1WYWB 3PZDA 4IW0A 3LJ3A 2JT4B 2WX0A 1UBIA 2M0XA 3DBLI 1V80A 2MBEA 4M8NA 2FCMA 2HE7A 3H7PB 3R3MA 4MEMA 2C9WB 3KVFB 3VTUA 2LVQA 5G2NA 3OLMD 2KLGA 5JHAA 3W1YA 1TTNA 1RLFA 2LVPA 4XC2A 3GZNI 4DDID 4OVUA 1CMXB 5LXHA 1KLVA 2K8BA 4URKA 2IZVB 1XT9B 2KN5A 2NPTB 1IYFA 4JGHB 1WY8A 4NNJB 2EKEC 2FCNA 3CF6E 5DPTA 3NZSA 2MLBA 3H7SA 1NDDA 2G4DB 3P2BA 3VUYA 2AWTA 1TGZB 1YJ1A 3A9JB 2IYDB 4E3CA 3EC8A 2O6VB 3ZNZB 1WZ3A 3L17A 2J7QB 3MHSD 2MBOA 2RSUA 2MW5A 3N30A 3Q3FA 5AZGA 1IP9A 4ZDVA 2JPHA 4W9FA 2Z0EB 4EKUA 1SGHA 4LJPB 2G3QB 3DVGY 1LM8B 3DBHI 3PVLA 1P1AA 2C7MB 4IWQA 4BKSA 3UQAA 4NAWA 5DPRA 3QAQA 1Q0WB 4GIVA 3ML8A 4KSLC 4MSQB 1GJZA 2MP2B 3ZVVA 2DYOA 4NPNA 1WM3A 2L0FA 1UELA 3KYDD 4PYZA 4N9F4 3M63B 2K8CA 1J8CA 3VXWA 2KTRA 2JY6A 3R66C 4IM2A 2LASA 2MSED 4NQLB 2GOWA 4FULA 2MCNB 2L8JA 2LI5A 4G11A 4AJYB 4GSWA 1NI2A 4A20A 4EOYA 3WANA 4K7SA 4GMVA 3WA0A 2FNJB 3RD2A 4DXAB 2KMAA 2M1MA 3PGEA 4MDKE 2IO1B 4EZLA 4LCDE 2D07B 3ZIMA 3H6NA 5DCNA 1YX5B 2KWUB 4HK2A 4GGQA 1V2YA 1E8YA 2FIFA 1OEYA 1GNUA 3VHTC 3VH4B 3QHTA 5J17A 4GDKB 1OGWA 3ZO5B 2IY1B 3TL5A 3ZLZA 1SE9A 1P0RA 4JL9A 2MWSB 4K7WA 4DHZE 1WR1A 3MTNB 4LJOB 1Y8RC 3WAOA 2W9NA 1XD3B 3PRMB 3V6CB 3DBSA 3U7DA 4LDTD 2K25A 4LDTB 3H1UA 4B95A 4IG7B 2GMIC 2NBVB 1YX6B 2D3GA 2N7EA 4KVGB 1AARA 3APDA 4BBNC 2MX2A 3CMMB 4CYEA 1RRBA 2IY0B 2LXAA 1C3TA 3X0WA 2PE9A 2O6VD 4P7IA 2KOXA 4MH0E 2KMCA 1ZGUB 4FA6A 1YD8U 2Y5BB 2AL6A 3TBLD 5D94A 4ANUA 2KZRA 4KDIC 3CSTA 2JRIB 4DHZB 1EF1A 1R4MI 4FN2A 3VQIA 5GMVA 3HIZA 2DENB 2DYMA 4II2B 2MA9B 4PS3A 3A9JA 2L00B 2ZVOA 2KX0A 3L08A 1WJNA 2BYEA 2J0KA 3DVGX 3JSVB 4NQKE 1H8CA 2ZNVB 1TBEA 4E71A 2CHZA 2ZCCA 3ZTCA 5AEKB 1WGYA 1E7UA 2FCQA 4XX5A 2J0MA 4DK5A 1WXMA 4KZ0A 2N7DA 4TQ1A 5E6NA 3U8ZA 3TIXA 2KJHB 5D2MB 3X23A 1KM7A 4RM8A 5G55A 3ONSA 5JZEB 1TZ1A 1UBQA 2KDBA 2ZEQA 2KC1A 1EF5A 4ANVA 3W1SA 4CHKA 3UGBB 4W9IA 2K6DB 1S1QB 1P3QU 2LRWA 2KX3A 1WF9A 2MBQA 1U4AA 2LRUA 2M4NA 2NCNA 3A4SC 3I3TB 3PLUA 2YLMA 1WRDB 1WJ6A 3PHXB 1ZW7A 2ZNVC 5LLIA 3QX1A 2NVUI 1WR6E 3VH3B 4DWFA 3JW0X 2HTHA 3IVFA 4I6NB 4ZRKA 3B08A 2DZKA 4W9CA 4F1SA 4G0NB 1LXDA 3APCA 2K8HA 4KZCA 5BO4B 2AYOB 3K9PB 3TJPA 4MM3A 4IM3A 4WWOA 3IHPC 3HM3A 4HLEA 2XEWA 4HVBA 3QWZB 4B9KA 2LGDA 3PT2B 1WX9A 3C0RB 4KV2A 2QHOA 3RUIB 4EZJA 3SHQA 4ZYNA 2JZZA 1GC6A 1WMHA 4PS8A 4AP4C 1WXAA 3AXCA 4G3XB 2GBJA 1V81A 3JVZX 3VTWA 2NPTA 3QK0A 3APFA 3WAPA 3T9LA 4JQWC 5DPSA 4AUQC 2JWZA 2LGXA 3IFWB 1WX7A 1I35A 4FADA 1R4NI 4G50A 3SU8X 1Z5SB 2CR5A 1WGHA 2KTFA 4BKGA 2REXA 4W9DA 2LZ6A 3V6EB 2WDTB 3PPAA 1V5TA 4IWPA 3V61A 4EUTA 2N9XA 3L16A 3AU4A 4WJPA 4W9LA 3M62B 4JLCA 1HE8A 2R2QA 2PJHA 3VTVA 3OJ4B 2IBIB 2KXJA 2K1FA 1WH3A 1C1YB 2FCSA 2UYZB 1WXSA 3Q3JA 1WXVA 1E5WA 5L95C 1E7VA 3EHVA 1WJ4A 2L3ZA 4IC7B 4KSKC 2PPHA 2DZJA 2JRHA 1M94A 2KC2A 5JH5C 3ZTDA 2BPSA 3QA8A 4HJKA 1G6JA 1P9DU 3ZUNA 2MBBB 3KUZA 2KLCA 4AWJA 4K7UA 1S3SG 3VUXA 3ZDMC 4X57B 2ZVNA 3PSEB 3KH0A 2YVCA 3AU5A 4OVVA 3TCAA 5AZFA 4TQ0A 1F9JA 2V4LA 1IPGA 2HD5B 2R2OA 2UWQA 1UGMA 3H9DA 4W9HA 2N9EB 3VVWB 4ICUA 1WGRA 4GDLB 5CHFA 4EEWA 1Z2MA 3A1QB 4DBGA 1H4RA 4WAAA 3PS6A 2IO0B 5JHBA 2RD0A 1V6EA 4HPLB 2CHXA 1ISNA 2IO3B 1E8XA 5D7GA 1Q1OA 3GOEA 2KNBA 2LGYA 4F8CB 3MJWA 1WMHB 3R7QA 3PHWB 4RMAA 1L2NA 1VD2A 2OOBB 2N9PC 2KQ7A 4FLHA 1D3ZA 4DHJB 2KANA 4TV3A 1RAXA 4W9EA 3JSVA 2O2VA 3VAWA 4HDOA 2MP2A 2LUEA 3BINA 3L0WB 4WWPA 1UH6A 1K8RB
chains in the Genus database with same CATH superfamily
5H8YE 4REZA 3NG0A 2FAZA 5D3IB 4ARCA 2OJWA 1Q5WB 4CO7A 1WFYA 1C76A 2DHZA 2D3BA 3B0AA 1XXGA 2XBBC 3I57A 1L0VB 4LNNA 2LD9A 3DPDA 4BKTA 4ZYSA 2I1JA 1T3QA 3OWEB 3W2DA 4ANWA 3NZUA 4LNKA 5HHDG 4NJCA 4Q2JA 1IUEA 4XZ4A 4FXCA 2YEPB 3NVZA 2MJ3A 3HVDA 4II3B 5EE0A 5KHOA 4KDLB 3DBLB 1PQSA 5IAAC 4B6WA 3QJZA 3DWGC 1GAQB 2NBWB 2KVRA 3AV8A 1J7BA 3LXFA 2N1WA 4HRSA 2BGFA 2JU6X 2V3SA 2BKFA 3N32A 2Z59B 4IUMB 3PRPB 1SJED 3CSFA 2ASQA 2K5PA 2RGFA 1PDXA 2N4FA 2V3PA 3BYYB 1VCBA 4HCNB 2GBRA 2L83A 2RDGA 3EECA 1TS3A 1FXTB 2CJOA 2JYEA 4ANXA 1WWTA 3BIID 3IAM1 1FM0D 3W9CB 2LHDA 2L0TA 3QIJA 4C80A 3TEZA 4OW0A 3RZFA 3ENEA 1FCCC 2JZ3B 3MC8A 3WALA 1NBFC 2WU2B 1I42A 4NY0A 2C7NB 3ZRCA 4OVZA 1XCQL 1TIFA 3AULA 4I6LB 5CX3A 3S2AA 1HQRD 1E7PB 3B2GA 2WXOA 4WH4A 3L13A 4BOZB 2FIDA 1YNTE 2BS2B 1RWSA 1VZ8A 3BK1A 4E74A 1VDVA 2KWCA 2EMTA 2BQQA 3AEDB 3KWVA 1OQQA 3WAMA 1QLBB 2HJ1A 4MJSA 2XK5B 3T3NA 2NTSA 2KFKB 2DZMA 2L05A 2MBHA 5HFYA 1YQBA 3JYUA 3RULA 3A1QA 4NJ6A 3ZDTA 3E9SA 3ZNHB 3E56A 1CQVA 3RI7C 4A3PA 2LJ5A 5CTRC 4MJSB 4RM9A 3DOWA 2YEPF 1P98A 2KFKA 2IO2B 1D5ZC 2K6QA 3T8MA 4EZKA 4TMAB 3P42A 2DAJA 1HXYD 3EFCA 2PE6B 1NYQA 1LFDA 1JWAD 3CWIA 4AQ7A 3PO0A 3AM9A 3P4SB 2Z0DB 3D32A 3EA6A 4IW0A 3RNGC 3LJ3A 1UBIA 4AS1A 2QCZA 3BYTB 2HE7A 1JW9D 3R3MA 2C9WB 3KVFB 3OLMD 4HROA 4USAA 4DDID 1KTKA 1KLVA 2K8BA 1FNVA 2FCNA 4JWSC 2MLBA 1NDDA 3P2BA 1D5MC 3A9JB 2IYDB 1CJEA 3EC8A 2O6VB 3L17A 2BW2A 1ZE3D 2MW5A 4W9FA 2Z0EB 3OG5A 4EKUA 1J7AA 1SGHA 2KAJA 3Q8CA 4NAWA 4MSQB 3TEYA 2L0FA 1UELA 4PYZA 4S17A 2W55A 2K8CA 2JX5A 1J8CA 2KTRA 1DGJA 4YTPB 2L8JA 4GSWA 1JWUD 2IJ0A 1KH0A 5IO9A 2BYTA 3NS1A 4MDKE 4EZLA 2D07B 3H6NA 2WGSA 2KWUB 1JQ4A 2E3TA 2FIFA 3VHTC 3VH4B 3FILA 2IY1B 3Q6BA 3TL5A 1P0RA 4DHZE 3MTNB 1GB4A 4WURA 4L23A 3WAOA 3DBSA 1EU3A 2NBVB 3APDA 1D5XC 2N9KA 3CMMB 2LXAA 1C3TA 3X0WA 2PE9A 2O6VD 1UWXA 2DLBA 4FA6A 4KDIC 4UDUC 2QDFA 3CSTA 2JRIB 1XLOA 3Q69A 1R4MI 5LNK1 3VQIA 3AEAB 3HIZA 2DENB 2L00B 2ZVOA 2QIEB 1QQRA 4NQKE 3T3OA 4J3OD 2ZCCA 3ZTCA 4OHJA 5IP4D 2I2YA 5E6NA 3U8ZA 1JALA 1NEKB 5D2MB 3X23A 1KM7A 3ABVB 4N58A 4RM8A 4RFBA 2LUMA 3DHGC 4CHKA 3W1SA 3UGBB 2RMMA 3I3TB 4YSXB 3A4SC 3W5UB 1WRDB 1WJ6A 3NVVA 3PHXB 2ZNVC 1WR6E 3VH3B 5FR3A 1ENFA 2WXLA 2HTHA 4I6NB 3B08A 1MG4A 4F1SA 3Q8EA 2AYOB 4PT5A 4IM3A 3RNAC 1DOYA 3P4RB 2LGDA 3PT2B 4KV2A 3RUIB 3FILB 1RFKA 3GE8C 3JVZX 4MH8A 4HEA1 5EE9A 4ZRPA 2WQYB 2NPTA 2D3AA 2TSSA 1CZPA 3APFA 4JX1C 4JQWC 5DPSA 4OZAA 4AUQC 1TY2A 1FXAA 2KTFA 2REXA 2LZ6A 2NMQA 3PPAA 1P7EA 4IWPA 5BMHA 2N9XA 2DWQA 1SIJA 2RPVA 4WJPA 2PTLA 1XLNA 2D5GA 3B9JA 2W3RA 1FNWA 3OJ4B 1FRDA 2KXJA 1WXSA 4A9AA 1WJ4A 2L3ZA 2JRHA 3L4PA 1D6EC 2KC2A 3R8BA 1PGBA 2WS3B 1FD6A 2MBBB 1SF0A 1K53A 1K52A 3ZDMC 3RNBC 3PSEB 4IOIE 3TCAA 3AECB 1UGMA 3GS2A 1ZPSA 5CHFA 1SEBD 1Z2MA 4HPLB 1V6EA 3RNCC 4HKZE 2FE8A 3R7QA 4JPSA 3KLSX 1L2NA 3BVZA 4HPPA 1PUTA 1VD2A 2PVOD 3N1XC 2N9PC 3MJ5A 4FLHA 4ZOHC 4W9EA 3JSVA 2MP2A 4MT5A 3BINA 1N6ZA 1IP9A 3MFGA 1D4BA 5KHQA 5BYSA 3LDZE 2KK8A 4NAMA 3UI3A 1ROEA 2KFJA 2RDBC 4HKQA 2BWES 4GXBA 2ZJDA 2KD0A 3HK0A 4M0WB 2KWVB 3DDCB 1SE2A 1N61A 2MH7A 3RCZA 2SAKA 4RF0A 1KLGD 3DWMA 2BT6A 2GBMA 4PS7A 1OTRB 3BZDB 3URYA 2PEAA 3HHMA 4P1CC 5T8IA 2H88B 2QJLA 5G5GA 1YN3A 2D11A 3PRZA 5D6JB 4GOCA 3N1YC 1L5PA 1YIWA 4KKJA 1N5WA 2J0JA 2BYVE 2QEJC 3W1SC 1BT0A 2KT7A 1JCKB 2WXQA 2XK5A 1XQQA 2GBKA 3U4EG 3UIOB 5LXIB 5DPWA 2C60A 2A4ZA 3DBRI 4F7ZA 4AOFA 1ZKHA 2CKHB 2L76A 4BVUC 2KMMA 4RNAA 1J7CA 3EGRA 1YOVB 3QCAA 3PLVA 1VRAB 1KJTA 3Q8FA 2RPQA 4HCPB 1QZEA 3OAWA 1JRPA 1HA5A 2A5UA 3DVNU 2AL3A 5BMIA 2M19A 4HDQA 1C4PA 4WJOA 1T6BX 3R7RA 4WQOB 1WGDA 2M8SA 4ASWC 1KFYB 3TEXA 3RN9C 5CHVC 1X1MA 4GU2A 2KDMA 3QC8B 2JVCA 4NAWB 2MQJA 4FJVB 2LGIA 5IOIA 4K81A 1UWMA 1PGAA 2ZPYA 4NZLB 3L54A 3SDLC 2O6VA 3MHZA 2VH1A 3WIMA 4C7ZA 2LJIA 3GP7A 1SJHD 4A90A 3KW5B 1F77A 4A3OA 1K50A 2WX1A 2LEKA 4TKNA 3VRBB 3IBEA 2ZZPB 4EFOA 2AQ2B 3U30A 1LO5D 3VFKA 2JF5A 3VDZA 4A6QA 5JXVA 2NTTA 2WDQB 4FJYA 2JXXA 4WJQA 2KDIA 4IDIA 5FR6A 4PYUA 3IAS1 3QARA 3KYCD 3AE9B 1WM2A 5EDSA 5IKCM 3AE1B 4WWNA 5J18A 3P1MA 3B2FA 2C5LC 1B1ZA 2X8XX 4M8MA 2ON8A 2PW9A 2ZCBA 1XO3A 1EO6A 2MRPA 4GDKA 1E90A 1WYWB 3PZDA 4L1BA 2M0XA 2D3CA 2N7JA 3H8HA 4K3BA 3GE3C 5JHAA 3W1YA 3O13A 3SFEB 4GLSC 2LVPA 4XC2A 3GZNI 1YQ3B 2IGGA 3KQ4A 3AE6B 1TKGA 2WNMA 2Q5WD 5AUIA 2AWTA 3J9CA 3AB5A 2RSUA 4RF1A 4C4VA 3RMKC 1LM8B 3DBHI 3PVLA 4XWTA 1P1AA 4GIVA 1Q0WB 4KSLC 4N9F4 3BK2A 3HVZA 1CK1A 2JY6A 4NQLB 2LI5A 4XGAB 4EOYA 3WANA 2EELA 4GMVA 1ZUD2 2KMAA 1E10A 4YTNB 3PGEA 4LCDE 4GGQA 1V2YA 1TYGB 3QHTA 3ZGZA 3ZO5B 2G9HD 3ZLZA 1SE9A 1Y56A 4LJOB 2W9NA 1R7SA 2L32A 4LDTD 4C00A 2GMIC 2WXJA 1AARA 2MX2A 2WDVB 2IY0B 2Y5CA 3RNEC 4P7IA 2OHFA 1L0YB 4MH0E 2KMCA 1ZGUB 2Y5BB 2GLSA 4DHZB 1EF1A 1Q10A 1YJIA 4M01A 2DYMA 4PS3A 3A9JA 4BAXA 3L08A 2WDRB 2INCC 3DVGX 2WLBA 2ZNVB 1TBEA 3SFDB 1WGYA 1E7UA 1FRRA 4DK5A 3SEBA 1NVID 2N7DA 3TIXA 2KJHB 1FNUA 1F2RI 5JZEB 1BUIC 4RGTA 4ANVA 2KN4A 1WF9A 2MBQA 1DYQA 1NI3A 2CU3A 5LLIA 3QX1A 4MACA 4DWFA 2K3UA 4QAYA 3ZJUA 4XDCA 3IVFA 2DZKA 4W9CA 4WAFA 1LXDA 1YN5A 3K9PB 3TJPA 1C4CA 4HLEA 3IHPC 3HM3A 2XEWA 2V4IB 3LB8C 4EZJA 1C4AA 3I9V1 1WYGA 4AP4C 3KWLA 5G5HA 1WXAA 1ZDXA 1V81A 1M4VA 1WXQA 3P4PB 1N63A 3AMZA 2JZPA 3W5VB 3WAPA 1ZDVA 2LGXA 1WX7A 4JWUC 1UGJA 2CR5A 1HZ5A 4BKGA 1JROA 2WDTB 4EUTA 1V5TA 4H2AA 4W9LA 4JLCA 1HE8A 3DHHC 1JWBD 2K1FA 1WH3A 1C1YB 5L95C 1E5WA 4S0RA 1E7VA 4IC7B 2LMCA 4KSKC 1FXIA 2DZJA 4YT0B 4WIPA 1M94A 3R2TA 3ZTDA 4HJKA 3ZUNA 3KUZA 5E6JA 1I4XA 3VUXA 1QOBA 4X57B 3AU5A 5AZFA 1P7FA 2V4LA 1IPGA 4ZHOA 2R2OA 2N9EB 3VVWB 4ICUA 4EEWA 2EKIA 1ESFA 4WAAA 2WXNA 4OZBA 2RD0A 1I4RA 2IO3B 2XNAC 2ZW1A 1Q1OA 1WSPA 3GOEA 2KNBA 4F8CB 4ACFA 3VR9B 1AWDA 2ZW0A 4TV3A 2WXFA 1UNSA 1I4PA 2O2VA 2YVCA 1K8RB 5C3JB 1STEA 2LXCA 2KJRA 2BBCA 4MSMB 1MI0A 1E8ZA 1KOTA 2UU7A 4MM3B 2KQSA 4TSSA 3NS8A 3KUDB 2WHIA 2JUOA 5HI1A 1GOZA 1TZOA 2R61A 3ML9A 2LFIA 4HWIB 3A4RA 1UZXB 1V5OA 1TT5B 4C7YA 1OQYA 3P63A 3WCQA 5D3DA 4GN1A 4O1NA 4MELA 2MHJA 5I4DA 2GRIA 3N3KB 4RGMA 1LQBA 3BY4B 4GDLA 2PLPA 2OEDA 3UQBA 2N9LA 2WYQA 4K1RB 2ONQA 1AW7A 3IXSA 4ZRQA 1SE4A 2BWFA 1TY0A 4M0WA 3AEBB 5TR5A 3BVMA 3B1LX 4YXDB 2DX5B 2HJ8A 2BTEA 2WXMA 4W9GA 1B9RA 5IA7A 4XWWA 2B3AA 3DCGA 4HPMB 4WJNA 3SR6A 4MGYE 2RR9A 4HXDA 3ZNGC 2IGDA 3Q8BA 2B76B 2I1KA 2BB6A 1PGXA 3FC4A 2BKRB 2LWPA 2NBUA 3QQ8B 4B0EA 3SD5A 2KHWB 2KO3A 1I4HA 2K0PA 4I6PA 3NHEB 1DOXA 1J0GA 3VUWA 3RNFC 1E8WA 3AN1A 3RYTA 3IG3A 3PZ7A 4DDGD 2C7HA 5J2RA 2V0GA 3UF8A 4FBJB 1WE7A 2SEBD 2KDEB 4FHKA 2KKCA 2OJRA 4FJZA 1JWMD 4BKSD 1VJKA 2FBWB 2N1VA 2BS3B 4WQMA 3BWUD 1ZOYB 2V1YA 4P16A 4DXFA 3BVGA 3UIPB 4IM0A 1WGKA 4MGIE 4D2KA 4J6IA 1L6UA 1WE6A 1L6VA 3V60A 2MJDA 4LNOA 1KRHA 5BYRA 2DZIA 4RGOS 3HRDD 4B0MA 4M02A 3V62A 3FAHA 4GB9A 1RM6C 1GUAB 1GB1A 1FMAD 3O65B 4IKGA 2WP9B 1YN4A 3FKYA 1IGCA 2W82A 1IBXA 3OJ3A 1QOGA 2G45B 2QC8A 3VRAB 4DHJD 3M95A 5C2TB 5C1ZA 1F0ZA 1T0YA 3U2SC 5C23A 2FUHB 3DQVA 5EE3A 4BFRA 1F2RC 1SB3C 2J42A 1A70A 4W9JA 2CS4A 2GBNA 4AJWA 3I63C 1PYWD 3NOBA 1J19A 2NR2A 2K39A 3IT6B 1TJEA 5AZHA 2JT4B 2WX0A 1MHXA 3DBLI 1SE3A 1V80A 4M8NA 1EWYC 1L4ZB 3VTUA 4MEMA 3Q2AC 1RLFA 2IZVB 1XT9B 4JGHB 3AEFB 3CF6E 4KGSA 2WU5B 3Q3MC 5DPTA 3H7SA 2G4DB 4XE0A 1HTQA 3VUYA 1TGZB 1YJ1A 2FUG1 2JXTA 3ZNZB 1AN8A 3MHSD 3N30A 3Q3FA 5BMGA 4ZDVA 2WXHA 4LJPB 2G3QB 2X38A 2IPKD 3N1ZC 2C7MB 1SSNA 4BKSA 5DPRA 3QAQA 1GJZA 1PFDA 2MP2B 3MC0B 2DYOA 4NPNA 1V1PA 2MSED 2GOWA 2MCNB 5GXGB 2W54A 4A20A 2MEKA 4K7SA 1FCLA 1TKYA 3RD2A 4DXAB 2M1MA 2H89B 3ZIMA 1YX5B 3ZYYX 1E8YA 3AE5B 1GNUA 1MJDA 3DBRB 1OGWA 1C79A 5MPOA 1WR1A 2J52A 3I5JC 1T0QC 2KYWA 1QF6A 2K25A 4LDTB 3H1UA 4IG7B 1YX6B 3EUB2 4ZHPA 4CQNA 1RRBA 1YD8U 2AL6A 4ANUA 2KZRA 1TS5A 3AE8B 4KX6B 5GMVA 2MA9B 1WJNA 2BYEA 2J0KA 2AX5A 2CHZA 3AE7B 2AQ3B 5AEKB 2FCQA 1TKEA 4KZ0A 3N20C 1R4MB 3ONSA 1NENB 2IDYA 2K6DB 1S1QB 1P3QU 2LRWA 2KX3A 3NZ3A 3PLUA 2JYTA 4YSYB 1FEHA 1K51A 2YLMA 4P6VF 1QT9A 1T0RC 2XN9C 2NVUI 3JW0X 2INDC 1F1HA 4ZRKA 5IN7A 4G0NB 5BO4B 3APCA 1E6EB 2Y5PA 4WWOA 4HVBA 1WX9A 2BVCA 3P4QB 3SHQA 4R3DA 4ZYNA 2IGHA 1GC6A 5EE1A 1HTOA 2J53A 4G3XB 2GBJA 1L0XB 3AXCA 3VTWA 1I7HA 2WXRA 3T9LA 2RDHA 3AEGB 1I35A 3AEEB 4G50A 1WGHA 1QKZA 4W9DA 3V6EB 4WWPA 3V61A 4EE2A 3AU4A 3VTVA 3DBHB 3MP9A 2IBIB 2UYZB 2FCSA 2ACZB 1XF5L 3EHVA 5BYQA 3ZXRA 4N6EB 2PPHA 3DHIC 1YJJA 1FPYA 4LNFA 5FKAC 2BPSA 1VLBA 1P9DU 4AWJA 1R4NB 1S3SG 4K7UA 3NUHB 2QSDA 4US8A 3KH0A 2QILA 4OVVA 4TQ0A 2E6XA 1F9JA 3MC9A 2HD5B 1BMLC 3H9DA 3U7ZA 4W9HA 4GDLB 4XDDA 4DBGA 3PS6A 2KWDA 2CHXA 2HTME 2LGYA 1WMHB 1WRIA 3AH7A 1F52A 2JWUA 2OOBB 4YWGG 3VAWA 4HDOA 1XEEA 1C9FA 2LUEA 3L0WB 2L52A 3HM6X 1QILA 1JWSD 2JQRB 1I4GA 4C56C 1T0SC 1C77A 2EMSA 2GI9A 3NY5A 2WWZA 1WI0A 1QOFA 1UD7A 1AYFA 4LNIA 2DBYA 4YTMB 2ZPNA 1IBXB 2VH2A 1GG3A 2V9HA 3ZKJC 3NJTA 1EWCA 2K22A 2VRRB 3UINB 3Q8AA 2Y3AA 1WJUA 2AEHA 1MG8A 1OFFA 3Q3NC 2KJ6A 2M0AA 4BOSC 1N62A 1L7YA 3RT3B 2DAFA 5E6PA 3NVYA 1V9JA 5HKHA 3TMPB 1GC7A 4KKIA 2CHWA 3ALBA 4W9KA 4ICVA 3M3JA 5TSSA 2CU1A 3KUCB 3L10B 1ZXHA 1WGGA 5CHWA 2PMVA 2N0SB 4ZRJA 3LYYA 3AI5A 1ACCA 3K9OB 1A5RA 3ETRA 1YMHE 3A9KA 4MGZE 5FK9C 1E0ZA 3VR8B 1ET9A 4IWOA 2M17A 2D2QA 2D10A 2KVZA 3GB1A 4MGKE 3ZW3A 2KDFB 1TS2A 1V1PB 3V05A 3ZQ4A 1MHHE 3ECIA 1C78A 2K9XA 4RGNA 1EUVB 2PIAA 4A55A 3EFUA 1RFAA 3A33B 4TUUA 3RZWC 1SIFA 1WIAA 2QMTA 1WZ0A 4FHJA 1ZXIA 4KGRA 3AE3B 3CIRB 3GZNB 3H7PA 1RYJA 4US9A 4LTUA 5AUKA 4ARIA 4YSZB 2I38A 2DYBA 2L7RA 2J4XA 3A9KB 2WXGA 2INNE 2KTRB 3ZXVA 4ZRIA 3PV1A 1HEZE 4KIKB 5L83A 4LK0M 4JIOU 4HJGE 1FFUA 4BBNF 1WX8A 2LVOA 2BYFA 3PTFC 1V49A 4YL8A 3ZRFA 2BF8B 3PREA 2NS5A 2ICIA 2JSVX 1JRUA 1MVKA 1OEYJ 4KIKA 3ZNID 2G4SA 5E6OA 2O2VB 4KGTA 1SXTA 4XYCA 1V86A 3DVNV 4NJ7A 3AE2B 4N59A 2MBEA 4WWMA 1VZ7A 2FCMA 3H7PB 1LGRA 2LVQA 4ITKA 5G2NA 2KLGA 4A8XC 1TTNA 1EU4A 4OVUA 1CMXB 5LXHA 1OQRA 4URKA 2NPTB 2KN5A 1IYFA 1WY8A 4NNJB 2EKEC 1IGDA 3ZJVA 3NZSA 4E3CA 4P1BC 3PZ8A 3R2IA 1WZ3A 2J7QB 2MBOA 5AZGA 1N5XA 2JPHA 4BZAA 5HG2A 3DVGY 1SBBB 2AQ1B 2PVGC 1VR9A 4IWQA 3UQAA 3ML8A 3U52E 3ZVVA 4PK1A 2M56B 1WM3A 3KYDD 3M63B 3VXWA 3R66C 4IM2A 2LASA 1I4QA 4FULA 4G11A 4AJYB 1NI2A 4L2YA 1FIQA 3WA0A 2FNJB 3RPFC 2IO1B 5DCNA 3NRZA 4HK2A 1OEYA 1N60A 1BXTA 5J17A 1HZ6A 2LGSA 4GDKB 2HDEA 1L4DB 2MWSB 4K7WA 4RH6A 1Y8RC 1V1OA 1XD3B 3PRMB 3V6CB 2BS4B 3U7DA 2WXKA 4B95A 2KQ4X 2D3GA 2LHEA 2N7EA 4KVGB 4BBNC 4CYEA 1MPEA 2KOXA 3TBLD 5D94A 4FN2A 3IT4B 4II2B 1XCTL 3TSSA 2KX0A 2PKOA 3JSVB 1H8CA 3Q3OC 4E71A 4XX5A 2J0MA 1WXMA 1FFVA 4TQ1A 1XLPA 2Z8LA 3C8YA 5G55A 1TZ1A 1UBQA 2KDBA 2ZEQA 2KC1A 3AE4B 1EF5A 2V3NA 4W9IA 1NYRA 1U4AA 2M4NA 2NCNA 2LRUA 1VZ6A 2VZKD 1ZW7A 3HUIA 3ZJTA 4RCOA 4KZCA 2K8HA 4MM3A 4K3CA 2L1AA 3QWZB 4B9KA 3C0RB 2QHOA 1YQ4B 1TS4A 2JZZA 1E9MA 1WMHA 4PS8A 3RFZB 3NVWA 1ZP0B 3Q14C 1V97A 3QK0A 4M00A 3TEWA 2MJEA 1GPXA 2JWZA 1FO4A 3IFWB 1MFWA 3N9YC 4FADA 1R4NI 3SU8X 1Z5SB 3V3XA 1JMLA 2DNFA 2KACA 2WXPA 3L16A 2G1EA 3M62B 4DXGA 2R2QA 2PJHA 3Q3JA 1WXVA 4LLGM 4OZCA 1KLUD 1DOIA 4JE3B 2VZKB 2CJNA 5JH5C 3QA8A 1G6JA 1KF6B 4C4VB 2KLCA 2WXIA 1ET6A 2ZVNA 5H92C 1QOAA 4DQOC 1UF0A 1EM7A 2W3SA 2UWQA 1WGRA 3A1QB 1H4RA 5JHBA 2IO0B 2GB1A 1ISNA 3TUOA 1E8XA 5D7GA 3MJWA 3C19A 3PHWB 1T5XD 2INPE 4RMAA 1V8CA 2KQ7A 1UUPA 2BB5A 1D3ZA 4DHJB 2KANA 1RAXA 4JL9A 1XLQA 1UH6A
chains in the Genus database with same CATH topology
5KHQA 2LXCA 3HM6X 2KJRA 2FAZA 3LDZE 2KK8A 1Q5WB 4CO7A 4MSMB 1WFYA 1E8ZA 2KFJA 1KOTA 2DHZA 2EMSA 3B0AA 2XBBC 2BWES 4GXBA 3NY5A 2ZJDA 2WWZA 2KD0A 2KQSA 3HK0A 4M0WB 1WI0A 2LD9A 2KWVB 3DDCB 1UD7A 3DPDA 4BKTA 3NS8A 3KUDB 2JUOA 2I1JA 3RCZA 3ML9A 4HWIB 3A4RA 1UZXB 4ANWA 3NZUA 1V5OA 2ZPNA 1OQYA 4XZ4A 2GBMA 4GN1A 1GG3A 4MELA 4PS7A 3ZKJC 2VRRB 3UINB 3N3KB 1OTRB 2PEAA 1LQBA 3HHMA 3BY4B 4GDLA 4II3B 5KHOA 1WJUA 2AEHA 4KDLB 1MG8A 3UQBA 2KJ6A 2D11A 1PQSA 2WYQA 3PRZA 4K1RB 5IAAC 4B6WA 5D6JB 3QJZA 4GOCA 4BOSC 1L7YA 2NBWB 2KVRA 2BWFA 1YIWA 2N1WA 3RT3B 2BGFA 2DAFA 2J0JA 5E6PA 1V9JA 2BYVE 2V3SA 3W1SC 1BT0A 5TR5A 5HKHA 2BKFA 3B1LX 3N32A 2Z59B 2DX5B 2HJ8A 4IUMB 2XK5A 3PRPB 1XQQA 3TMPB 3CSFA 1GC7A 2GBKA 2ASQA 2RGFA 3UIOB 2N4FA 2CHWA 4W9GA 3ALBA 4W9KA 5IA7A 5LXIB 2B3AA 5DPWA 1VCBA 4HCNB 2GBRA 4ICVA 3DCGA 4HPMB 3EECA 2C60A 3M3JA 2A4ZA 1FXTB 4WJNA 3DBRI 4ANXA 4F7ZA 2CU1A 4MGYE 3KUCB 2RR9A 3L10B 4HXDA 4AOFA 2L0TA 1ZKHA 1WGGA 2CKHB 3ZNGC 5CHWA 2L76A 4BVUC 3QIJA 3RZFA 3ENEA 3QCAA 2I1KA 2JZ3B 3PLVA 4ZRJA 1NBFC 3WALA 1I42A 4NY0A 1KJTA 2C7NB 3ZRCA 3AI5A 2RPQA 3K9OB 4HCPB 1QZEA 3OAWA 1A5RA 2A5UA 2BKRB 2LWPA 2AL3A 3A9KA 3AULA 3DVNU 4I6LB 2NBUA 3QQ8B 4MGZE 3SD5A 2KHWB 2KO3A 5CX3A 4HDQA 4I6PA 3S2AA 3NHEB 4WJOA 1J0GA 3VUWA 3R7RA 4WQOB 4IWOA 2M17A 1E8WA 2D2QA 2D10A 3RYTA 3IG3A 4BOZB 1WGDA 2M8SA 3L13A 4DDGD 2FIDA 2C7HA 4MGKE 3ZW3A 4ASWC 5J2RA 2KDFB 3UF8A 4FBJB 1WE7A 5CHVC 1X1MA 4GU2A 2KDEB 3ECIA 4E74A 4FHKA 2KKCA 2OJRA 4FJZA 2KWCA 2EMTA 2JVCA 3QC8B 4BKSD 4NAWB 3WAMA 2N1VA 2MQJA 1EUVB 4FJVB 3EFUA 4K81A 1RFAA 3A33B 2V1YA 4MJSA 2XK5B 2ZPYA 3L54A 3SDLC 4TUUA 3RZWC 1SIFA 1WIAA 2O6VA 1WZ0A 3UIPB 4IM0A 3WIMA 4FHJA 2KFKB 2DZMA 2L05A 2MBHA 1YQBA 4MGIE 3JYUA 4J6IA 3RULA 3H7PA 3KW5B 4A3OA 3A1QA 1WE6A 4NJ6A 3V60A 2WX1A 4TKNA 2DYBA 3ZDTA 2L7RA 3IBEA 3ZNHB 2ZZPB 4EFOA 3A9KB 2DZIA 3U30A 4A3PA 2KTRB 3VFKA 2JF5A 2LJ5A 3VDZA 3V62A 4GB9A 5CTRC 4MJSB 1GUAB 4FJYA 4ZRIA 2JXXA 4RM9A 3O65B 3DOWA 3PV1A 4KIKB 5L83A 4WJQA 4JIOU 2KDIA 1P98A 2KFKA 4BBNF 5FR6A 2IO2B 4PYUA 1WX8A 2G45B 2LVOA 3OJ3A 2K6QA 2BYFA 3KYCD 3QARA 3T8MA 3PTFC 1V49A 4DHJD 3M95A 4YL8A 4EZKA 1WM2A 5EDSA 3ZRFA 2BF8B 5C1ZA 3PREA 1T0YA 2NS5A 5C23A 2FUHB 3DQVA 4WWNA 4BFRA 2DAJA 5J18A 1JRUA 1OEYJ 4KIKA 3ZNID 2C5LC 2PE6B 2G4SA 4M8MA 4W9JA 2O2VB 2CS4A 2GBNA 5E6OA 4AJWA 3NOBA 1LFDA 2ZCBA 1J19A 2NR2A 1V86A 1EO6A 2MRPA 2K39A 3DVNV 2Z0DB 4GDKA 4NJ7A 1E90A 3D32A 5AZHA 1WYWB 3PZDA 4IW0A 3LJ3A 2JT4B 2WX0A 1UBIA 2M0XA 3DBLI 1V80A 2MBEA 4M8NA 2FCMA 2HE7A 3H7PB 3R3MA 4MEMA 2C9WB 3KVFB 3VTUA 2LVQA 5G2NA 3OLMD 2KLGA 5JHAA 3W1YA 1TTNA 1RLFA 2LVPA 4XC2A 3GZNI 4DDID 4OVUA 1CMXB 5LXHA 1KLVA 2K8BA 4URKA 2IZVB 1XT9B 2KN5A 2NPTB 1IYFA 4JGHB 1WY8A 4NNJB 2EKEC 2FCNA 3CF6E 5DPTA 3NZSA 2MLBA 3H7SA 1NDDA 2G4DB 3P2BA 3VUYA 2AWTA 1TGZB 1YJ1A 3A9JB 2IYDB 4E3CA 3EC8A 2O6VB 3ZNZB 1WZ3A 3L17A 2J7QB 3MHSD 2MBOA 2RSUA 2MW5A 3N30A 3Q3FA 5AZGA 1IP9A 4ZDVA 2JPHA 4W9FA 2Z0EB 4EKUA 1SGHA 4LJPB 2G3QB 3DVGY 1LM8B 3DBHI 3PVLA 1P1AA 2C7MB 4IWQA 4BKSA 3UQAA 4NAWA 5DPRA 3QAQA 1Q0WB 4GIVA 3ML8A 4KSLC 4MSQB 1GJZA 2MP2B 3ZVVA 2DYOA 4NPNA 1WM3A 2L0FA 1UELA 3KYDD 4PYZA 4N9F4 3M63B 2K8CA 1J8CA 3VXWA 2KTRA 2JY6A 3R66C 4IM2A 2LASA 2MSED 4NQLB 2GOWA 4FULA 2MCNB 2L8JA 2LI5A 4G11A 4AJYB 4GSWA 1NI2A 4A20A 4EOYA 3WANA 4K7SA 4GMVA 3WA0A 2FNJB 3RD2A 4DXAB 2KMAA 2M1MA 3PGEA 4MDKE 2IO1B 4EZLA 4LCDE 2D07B 3ZIMA 3H6NA 5DCNA 1YX5B 2KWUB 4HK2A 4GGQA 1V2YA 1E8YA 2FIFA 1OEYA 1GNUA 3VHTC 3VH4B 3QHTA 5J17A 4GDKB 1OGWA 3ZO5B 2IY1B 3TL5A 3ZLZA 1SE9A 1P0RA 4JL9A 2MWSB 4K7WA 4DHZE 1WR1A 3MTNB 4LJOB 1Y8RC 3WAOA 2W9NA 1XD3B 3PRMB 3V6CB 3DBSA 3U7DA 4LDTD 2K25A 4LDTB 3H1UA 4B95A 4IG7B 2GMIC 2NBVB 1YX6B 2D3GA 2N7EA 4KVGB 1AARA 3APDA 4BBNC 2MX2A 3CMMB 4CYEA 1RRBA 2IY0B 2LXAA 1C3TA 3X0WA 2PE9A 2O6VD 4P7IA 2KOXA 4MH0E 2KMCA 1ZGUB 4FA6A 1YD8U 2Y5BB 2AL6A 3TBLD 5D94A 4ANUA 2KZRA 4KDIC 3CSTA 2JRIB 4DHZB 1EF1A 1R4MI 4FN2A 3VQIA 5GMVA 3HIZA 2DENB 2DYMA 4II2B 2MA9B 4PS3A 3A9JA 2L00B 2ZVOA 2KX0A 3L08A 1WJNA 2BYEA 2J0KA 3DVGX 3JSVB 4NQKE 1H8CA 2ZNVB 1TBEA 4E71A 2CHZA 2ZCCA 3ZTCA 5AEKB 1WGYA 1E7UA 2FCQA 4XX5A 2J0MA 4DK5A 1WXMA 4KZ0A 2N7DA 4TQ1A 5E6NA 3U8ZA 3TIXA 2KJHB 5D2MB 3X23A 1KM7A 4RM8A 5G55A 3ONSA 5JZEB 1TZ1A 1UBQA 2KDBA 2ZEQA 2KC1A 1EF5A 4ANVA 3W1SA 4CHKA 3UGBB 4W9IA 2K6DB 1S1QB 1P3QU 2LRWA 2KX3A 1WF9A 2MBQA 1U4AA 2LRUA 2M4NA 2NCNA 3A4SC 3I3TB 3PLUA 2YLMA 1WRDB 1WJ6A 3PHXB 1ZW7A 2ZNVC 5LLIA 3QX1A 2NVUI 1WR6E 3VH3B 4DWFA 3JW0X 2HTHA 3IVFA 4I6NB 4ZRKA 3B08A 2DZKA 4W9CA 4F1SA 4G0NB 1LXDA 3APCA 2K8HA 4KZCA 5BO4B 2AYOB 3K9PB 3TJPA 4MM3A 4IM3A 4WWOA 3IHPC 3HM3A 4HLEA 2XEWA 4HVBA 3QWZB 4B9KA 2LGDA 3PT2B 1WX9A 3C0RB 4KV2A 2QHOA 3RUIB 4EZJA 3SHQA 4ZYNA 2JZZA 1GC6A 1WMHA 4PS8A 4AP4C 1WXAA 3AXCA 4G3XB 2GBJA 1V81A 3JVZX 3VTWA 2NPTA 3QK0A 3APFA 3WAPA 3T9LA 4JQWC 5DPSA 4AUQC 2JWZA 2LGXA 3IFWB 1WX7A 1I35A 4FADA 1R4NI 4G50A 3SU8X 1Z5SB 2CR5A 1WGHA 2KTFA 4BKGA 2REXA 4W9DA 2LZ6A 3V6EB 2WDTB 3PPAA 1V5TA 4IWPA 3V61A 4EUTA 2N9XA 3L16A 3AU4A 4WJPA 4W9LA 3M62B 4JLCA 1HE8A 2R2QA 2PJHA 3VTVA 3OJ4B 2IBIB 2KXJA 2K1FA 1WH3A 1C1YB 2FCSA 2UYZB 1WXSA 3Q3JA 1WXVA 1E5WA 5L95C 1E7VA 3EHVA 1WJ4A 2L3ZA 4IC7B 4KSKC 2PPHA 2DZJA 2JRHA 1M94A 2KC2A 5JH5C 3ZTDA 2BPSA 3QA8A 4HJKA 1G6JA 1P9DU 3ZUNA 2MBBB 3KUZA 2KLCA 4AWJA 4K7UA 1S3SG 3VUXA 3ZDMC 4X57B 2ZVNA 3PSEB 3KH0A 2YVCA 3AU5A 4OVVA 3TCAA 5AZFA 4TQ0A 1F9JA 2V4LA 1IPGA 2HD5B 2R2OA 2UWQA 1UGMA 3H9DA 4W9HA 2N9EB 3VVWB 4ICUA 1WGRA 4GDLB 5CHFA 4EEWA 1Z2MA 3A1QB 4DBGA 1H4RA 4WAAA 3PS6A 2IO0B 5JHBA 2RD0A 1V6EA 4HPLB 2CHXA 1ISNA 2IO3B 1E8XA 5D7GA 1Q1OA 3GOEA 2KNBA 2LGYA 4F8CB 3MJWA 1WMHB 3R7QA 3PHWB 4RMAA 1L2NA 1VD2A 2OOBB 2N9PC 2KQ7A 4FLHA 1D3ZA 4DHJB 2KANA 4TV3A 1RAXA 4W9EA 3JSVA 2O2VA 3VAWA 4HDOA 2MP2A 2LUEA 3BINA 3L0WB 4WWPA 1UH6A 1K8RB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KHQ A;  2LXC A;  3HM6 X;  2KJR A;  2FAZ A;  3LDZ E;  2KK8 A;  1Q5W B;  4CO7 A;  4MSM B;  1WFY A;  1E8Z A;  2KFJ A;  1KOT A;  2DHZ A;  2EMS A;  3B0A A;  2XBB C;  2BWE S;  4GXB A;  3NY5 A;  2ZJD A;  2WWZ A;  2KD0 A;  2KQS A;  3HK0 A;  4M0W B;  1WI0 A;  2LD9 A;  2KWV B;  3DDC B;  1UD7 A;  3DPD A;  4BKT A;  3NS8 A;  3KUD B;  2JUO A;  2I1J A;  3RCZ A;  3ML9 A;  4HWI B;  3A4R A;  1UZX B;  4ANW A;  3NZU A;  1V5O A;  2ZPN A;  1OQY A;  4XZ4 A;  2GBM A;  4GN1 A;  1GG3 A;  4MEL A;  4PS7 A;  3ZKJ C;  2VRR B;  3UIN B;  3N3K B;  1OTR B;  2PEA A;  1LQB A;  3HHM A;  3BY4 B;  4GDL A;  4II3 B;  5KHO A;  1WJU A;  2AEH A;  4KDL B;  1MG8 A;  3UQB A;  2KJ6 A;  2D11 A;  1PQS A;  2WYQ A;  3PRZ A;  4K1R B;  5IAA C;  4B6W A;  5D6J B;  3QJZ A;  4GOC A;  4BOS C;  1L7Y A;  2NBW B;  2KVR A;  2BWF A;  1YIW A;  2N1W A;  3RT3 B;  2BGF A;  2DAF A;  2J0J A;  5E6P A;  1V9J A;  2BYV E;  2V3S A;  3W1S C;  1BT0 A;  5TR5 A;  5HKH A;  2BKF A;  3B1L X;  3N32 A;  2Z59 B;  2DX5 B;  2HJ8 A;  4IUM B;  2XK5 A;  3PRP B;  1XQQ A;  3TMP B;  3CSF A;  1GC7 A;  2GBK A;  2ASQ A;  2RGF A;  3UIO B;  2N4F A;  2CHW A;  4W9G A;  3ALB A;  4W9K A;  5IA7 A;  5LXI B;  2B3A A;  5DPW A;  1VCB A;  4HCN B;  2GBR A;  4ICV A;  3DCG A;  4HPM B;  3EEC A;  2C60 A;  3M3J A;  2A4Z A;  1FXT B;  4WJN A;  3DBR I;  4ANX A;  4F7Z A;  2CU1 A;  4MGY E;  3KUC B;  2RR9 A;  3L10 B;  4HXD A;  4AOF A;  2L0T A;  1ZKH A;  1WGG A;  2CKH B;  3ZNG C;  5CHW A;  2L76 A;  4BVU C;  3QIJ A;  3RZF A;  3ENE A;  3QCA A;  2I1K A;  2JZ3 B;  3PLV A;  4ZRJ A;  1NBF C;  3WAL A;  1I42 A;  4NY0 A;  1KJT A;  2C7N B;  3ZRC A;  3AI5 A;  2RPQ A;  3K9O B;  4HCP B;  1QZE A;  3OAW A;  1A5R A;  2A5U A;  2BKR B;  2LWP A;  2AL3 A;  3A9K A;  3AUL A;  3DVN U;  4I6L B;  2NBU A;  3QQ8 B;  4MGZ E;  3SD5 A;  2KHW B;  2KO3 A;  5CX3 A;  4HDQ A;  4I6P A;  3S2A A;  3NHE B;  4WJO A;  1J0G A;  3VUW A;  3R7R A;  4WQO B;  4IWO A;  2M17 A;  1E8W A;  2D2Q A;  2D10 A;  3RYT A;  3IG3 A;  4BOZ B;  1WGD A;  2M8S A;  3L13 A;  4DDG D;  2FID A;  2C7H A;  4MGK E;  3ZW3 A;  4ASW C;  5J2R A;  2KDF B;  3UF8 A;  4FBJ B;  1WE7 A;  5CHV C;  1X1M A;  4GU2 A;  2KDE B;  3ECI A;  4E74 A;  4FHK A;  2KKC A;  2OJR A;  4FJZ A;  2KWC A;  2EMT A;  2JVC A;  3QC8 B;  4BKS D;  4NAW B;  3WAM A;  2N1V A;  2MQJ A;  1EUV B;  4FJV B;  3EFU A;  4K81 A;  1RFA A;  3A33 B;  2V1Y A;  4MJS A;  2XK5 B;  2ZPY A;  3L54 A;  3SDL C;  4TUU A;  3RZW C;  1SIF A;  1WIA A;  2O6V A;  1WZ0 A;  3UIP B;  4IM0 A;  3WIM A;  4FHJ A;  2KFK B;  2DZM A;  2L05 A;  2MBH A;  1YQB A;  4MGI E;  3JYU A;  4J6I A;  3RUL A;  3H7P A;  3KW5 B;  4A3O A;  3A1Q A;  1WE6 A;  4NJ6 A;  3V60 A;  2WX1 A;  4TKN A;  2DYB A;  3ZDT A;  2L7R A;  3IBE A;  3ZNH B;  2ZZP B;  4EFO A;  3A9K B;  2DZI A;  3U30 A;  4A3P A;  2KTR B;  3VFK A;  2JF5 A;  2LJ5 A;  3VDZ A;  3V62 A;  4GB9 A;  5CTR C;  4MJS B;  1GUA B;  4FJY A;  4ZRI A;  2JXX A;  4RM9 A;  3O65 B;  3DOW A;  3PV1 A;  4KIK B;  5L83 A;  4WJQ A;  4JIO U;  2KDI A;  1P98 A;  2KFK A;  4BBN F;  5FR6 A;  2IO2 B;  4PYU A;  1WX8 A;  2G45 B;  2LVO A;  3OJ3 A;  2K6Q A;  2BYF A;  3KYC D;  3QAR A;  3T8M A;  3PTF C;  1V49 A;  4DHJ D;  3M95 A;  4YL8 A;  4EZK A;  1WM2 A;  5EDS A;  3ZRF A;  2BF8 B;  5C1Z A;  3PRE A;  1T0Y A;  2NS5 A;  5C23 A;  2FUH B;  3DQV A;  4WWN A;  4BFR A;  2DAJ A;  5J18 A;  1JRU A;  1OEY J;  4KIK A;  3ZNI D;  2C5L C;  2PE6 B;  2G4S A;  4M8M A;  4W9J A;  2O2V B;  2CS4 A;  2GBN A;  5E6O A;  4AJW A;  3NOB A;  1LFD A;  2ZCB A;  1J19 A;  2NR2 A;  1V86 A;  1EO6 A;  2MRP A;  2K39 A;  3DVN V;  2Z0D B;  4GDK A;  4NJ7 A;  1E90 A;  3D32 A;  5AZH A;  1WYW B;  3PZD A;  4IW0 A;  3LJ3 A;  2JT4 B;  2WX0 A;  1UBI A;  2M0X A;  3DBL I;  1V80 A;  2MBE A;  4M8N A;  2FCM A;  2HE7 A;  3H7P B;  3R3M A;  4MEM A;  2C9W B;  3KVF B;  3VTU A;  2LVQ A;  5G2N A;  3OLM D;  2KLG A;  5JHA A;  3W1Y A;  1TTN A;  1RLF A;  2LVP A;  4XC2 A;  3GZN I;  4DDI D;  4OVU A;  1CMX B;  5LXH A;  1KLV A;  2K8B A;  4URK A;  2IZV B;  1XT9 B;  2KN5 A;  2NPT B;  1IYF A;  4JGH B;  1WY8 A;  4NNJ B;  2EKE C;  2FCN A;  3CF6 E;  5DPT A;  3NZS A;  2MLB A;  3H7S A;  1NDD A;  2G4D B;  3P2B A;  3VUY A;  2AWT A;  1TGZ B;  1YJ1 A;  3A9J B;  2IYD B;  4E3C A;  3EC8 A;  2O6V B;  3ZNZ B;  1WZ3 A;  3L17 A;  2J7Q B;  3MHS D;  2MBO A;  2RSU A;  2MW5 A;  3N30 A;  3Q3F A;  5AZG A;  1IP9 A;  4ZDV A;  2JPH A;  4W9F A;  2Z0E B;  4EKU A;  1SGH A;  4LJP B;  2G3Q B;  3DVG Y;  1LM8 B;  3DBH I;  3PVL A;  1P1A A;  2C7M B;  4IWQ A;  4BKS A;  3UQA A;  4NAW A;  5DPR A;  3QAQ A;  1Q0W B;  4GIV A;  3ML8 A;  4KSL C;  4MSQ B;  1GJZ A;  2MP2 B;  3ZVV A;  2DYO A;  4NPN A;  1WM3 A;  2L0F A;  1UEL A;  3KYD D;  4PYZ A;  4N9F 4;  3M63 B;  2K8C A;  1J8C A;  3VXW A;  2KTR A;  2JY6 A;  3R66 C;  4IM2 A;  2LAS A;  2MSE D;  4NQL B;  2GOW A;  4FUL A;  2MCN B;  2L8J A;  2LI5 A;  4G11 A;  4AJY B;  4GSW A;  1NI2 A;  4A20 A;  4EOY A;  3WAN A;  4K7S A;  4GMV A;  3WA0 A;  2FNJ B;  3RD2 A;  4DXA B;  2KMA A;  2M1M A;  3PGE A;  4MDK E;  2IO1 B;  4EZL A;  4LCD E;  2D07 B;  3ZIM A;  3H6N A;  5DCN A;  1YX5 B;  2KWU B;  4HK2 A;  4GGQ A;  1V2Y A;  1E8Y A;  2FIF A;  1OEY A;  1GNU A;  3VHT C;  3VH4 B;  3QHT A;  5J17 A;  4GDK B;  1OGW A;  3ZO5 B;  2IY1 B;  3TL5 A;  3ZLZ A;  1SE9 A;  1P0R A;  4JL9 A;  2MWS B;  4K7W A;  4DHZ E;  1WR1 A;  3MTN B;  4LJO B;  1Y8R C;  3WAO A;  2W9N A;  1XD3 B;  3PRM B;  3V6C B;  3DBS A;  3U7D A;  4LDT D;  2K25 A;  4LDT B;  3H1U A;  4B95 A;  4IG7 B;  2GMI C;  2NBV B;  1YX6 B;  2D3G A;  2N7E A;  4KVG B;  1AAR A;  3APD A;  4BBN C;  2MX2 A;  3CMM B;  4CYE A;  1RRB A;  2IY0 B;  2LXA A;  1C3T A;  3X0W A;  2PE9 A;  2O6V D;  4P7I A;  2KOX A;  4MH0 E;  2KMC A;  1ZGU B;  4FA6 A;  1YD8 U;  2Y5B B;  2AL6 A;  3TBL D;  5D94 A;  4ANU A;  2KZR A;  4KDI C;  3CST A;  2JRI B;  4DHZ B;  1EF1 A;  1R4M I;  4FN2 A;  3VQI A;  5GMV A;  3HIZ A;  2DEN B;  2DYM A;  4II2 B;  2MA9 B;  4PS3 A;  3A9J A;  2L00 B;  2ZVO A;  2KX0 A;  3L08 A;  1WJN A;  2BYE A;  2J0K A;  3DVG X;  3JSV B;  4NQK E;  1H8C A;  2ZNV B;  1TBE A;  4E71 A;  2CHZ A;  2ZCC A;  3ZTC A;  5AEK B;  1WGY A;  1E7U A;  2FCQ A;  4XX5 A;  2J0M A;  4DK5 A;  1WXM A;  4KZ0 A;  2N7D A;  4TQ1 A;  5E6N A;  3U8Z A;  3TIX A;  2KJH B;  5D2M B;  3X23 A;  1KM7 A;  4RM8 A;  5G55 A;  3ONS A;  5JZE B;  1TZ1 A;  1UBQ A;  2KDB A;  2ZEQ A;  2KC1 A;  1EF5 A;  4ANV A;  3W1S A;  4CHK A;  3UGB B;  4W9I A;  2K6D B;  1S1Q B;  1P3Q U;  2LRW A;  2KX3 A;  1WF9 A;  2MBQ A;  1U4A A;  2LRU A;  2M4N A;  2NCN A;  3A4S C;  3I3T B;  3PLU A;  2YLM A;  1WRD B;  1WJ6 A;  3PHX B;  1ZW7 A;  2ZNV C;  5LLI A;  3QX1 A;  2NVU I;  1WR6 E;  3VH3 B;  4DWF A;  3JW0 X;  2HTH A;  3IVF A;  4I6N B;  4ZRK A;  3B08 A;  2DZK A;  4W9C A;  4F1S A;  4G0N B;  1LXD A;  3APC A;  2K8H A;  4KZC A;  5BO4 B;  2AYO B;  3K9P B;  3TJP A;  4MM3 A;  4IM3 A;  4WWO A;  3IHP C;  3HM3 A;  4HLE A;  2XEW A;  4HVB A;  3QWZ B;  4B9K A;  2LGD A;  3PT2 B;  1WX9 A;  3C0R B;  4KV2 A;  2QHO A;  3RUI B;  4EZJ A;  3SHQ A;  4ZYN A;  2JZZ A;  1GC6 A;  1WMH A;  4PS8 A;  4AP4 C;  1WXA A;  3AXC A;  4G3X B;  2GBJ A;  1V81 A;  3JVZ X;  3VTW A;  2NPT A;  3QK0 A;  3APF A;  3WAP A;  3T9L A;  4JQW C;  5DPS A;  4AUQ C;  2JWZ A;  2LGX A;  3IFW B;  1WX7 A;  1I35 A;  4FAD A;  1R4N I;  4G50 A;  3SU8 X;  1Z5S B;  2CR5 A;  1WGH A;  2KTF A;  4BKG A;  2REX A;  4W9D A;  2LZ6 A;  3V6E B;  2WDT B;  3PPA A;  1V5T A;  4IWP A;  3V61 A;  4EUT A;  2N9X A;  3L16 A;  3AU4 A;  4WJP A;  4W9L A;  3M62 B;  4JLC A;  1HE8 A;  2R2Q A;  2PJH A;  3VTV A;  3OJ4 B;  2IBI B;  2KXJ A;  2K1F A;  1WH3 A;  1C1Y B;  2FCS A;  2UYZ B;  1WXS A;  3Q3J A;  1WXV A;  1E5W A;  5L95 C;  1E7V A;  3EHV A;  1WJ4 A;  2L3Z A;  4IC7 B;  4KSK C;  2PPH A;  2DZJ A;  2JRH A;  1M94 A;  2KC2 A;  5JH5 C;  3ZTD A;  2BPS A;  3QA8 A;  4HJK A;  1G6J A;  1P9D U;  3ZUN A;  2MBB B;  3KUZ A;  2KLC A;  4AWJ A;  4K7U A;  1S3S G;  3VUX A;  3ZDM C;  4X57 B;  2ZVN A;  3PSE B;  3KH0 A;  2YVC A;  3AU5 A;  4OVV A;  3TCA A;  5AZF A;  4TQ0 A;  1F9J A;  2V4L A;  1IPG A;  2HD5 B;  2R2O A;  2UWQ A;  1UGM A;  3H9D A;  4W9H A;  2N9E B;  3VVW B;  4ICU A;  1WGR A;  4GDL B;  5CHF A;  4EEW A;  1Z2M A;  3A1Q B;  4DBG A;  1H4R A;  4WAA A;  3PS6 A;  2IO0 B;  5JHB A;  2RD0 A;  1V6E A;  4HPL B;  2CHX A;  1ISN A;  2IO3 B;  1E8X A;  5D7G A;  1Q1O A;  3GOE A;  2KNB A;  2LGY A;  4F8C B;  3MJW A;  1WMH B;  3R7Q A;  3PHW B;  4RMA A;  1L2N A;  1VD2 A;  2OOB B;  2N9P C;  2KQ7 A;  4FLH A;  1D3Z A;  4DHJ B;  2KAN A;  4TV3 A;  1RAX A;  4W9E A;  3JSV A;  2O2V A;  3VAW A;  4HDO A;  2MP2 A;  2LUE A;  3BIN A;  3L0W B;  4WWP A;  1UH6 A;  1K8R B; 
#chains in the Genus database with same CATH topology
 5H8Y E;  4REZ A;  3NG0 A;  2FAZ A;  5D3I B;  4ARC A;  2OJW A;  1Q5W B;  4CO7 A;  1WFY A;  1C76 A;  2DHZ A;  2D3B A;  3B0A A;  1XXG A;  2XBB C;  3I57 A;  1L0V B;  4LNN A;  2LD9 A;  3DPD A;  4BKT A;  4ZYS A;  2I1J A;  1T3Q A;  3OWE B;  3W2D A;  4ANW A;  3NZU A;  4LNK A;  5HHD G;  4NJC A;  4Q2J A;  1IUE A;  4XZ4 A;  4FXC A;  2YEP B;  3NVZ A;  2MJ3 A;  3HVD A;  4II3 B;  5EE0 A;  5KHO A;  4KDL B;  3DBL B;  1PQS A;  5IAA C;  4B6W A;  3QJZ A;  3DWG C;  1GAQ B;  2NBW B;  2KVR A;  3AV8 A;  1J7B A;  3LXF A;  2N1W A;  4HRS A;  2BGF A;  2JU6 X;  2V3S A;  2BKF A;  3N32 A;  2Z59 B;  4IUM B;  3PRP B;  1SJE D;  3CSF A;  2ASQ A;  2K5P A;  2RGF A;  1PDX A;  2N4F A;  2V3P A;  3BYY B;  1VCB A;  4HCN B;  2GBR A;  2L83 A;  2RDG A;  3EEC A;  1TS3 A;  1FXT B;  2CJO A;  2JYE A;  4ANX A;  1WWT A;  3BII D;  3IAM 1;  1FM0 D;  3W9C B;  2LHD A;  2L0T A;  3QIJ A;  4C80 A;  3TEZ A;  4OW0 A;  3RZF A;  3ENE A;  1FCC C;  2JZ3 B;  3MC8 A;  3WAL A;  1NBF C;  2WU2 B;  1I42 A;  4NY0 A;  2C7N B;  3ZRC A;  4OVZ A;  1XCQ L;  1TIF A;  3AUL A;  4I6L B;  5CX3 A;  3S2A A;  1HQR D;  1E7P B;  3B2G A;  2WXO A;  4WH4 A;  3L13 A;  4BOZ B;  2FID A;  1YNT E;  2BS2 B;  1RWS A;  1VZ8 A;  3BK1 A;  4E74 A;  1VDV A;  2KWC A;  2EMT A;  2BQQ A;  3AED B;  3KWV A;  1OQQ A;  3WAM A;  1QLB B;  2HJ1 A;  4MJS A;  2XK5 B;  3T3N A;  2NTS A;  2KFK B;  2DZM A;  2L05 A;  2MBH A;  5HFY A;  1YQB A;  3JYU A;  3RUL A;  3A1Q A;  4NJ6 A;  3ZDT A;  3E9S A;  3ZNH B;  3E56 A;  1CQV A;  3RI7 C;  4A3P A;  2LJ5 A;  5CTR C;  4MJS B;  4RM9 A;  3DOW A;  2YEP F;  1P98 A;  2KFK A;  2IO2 B;  1D5Z C;  2K6Q A;  3T8M A;  4EZK A;  4TMA B;  3P42 A;  2DAJ A;  1HXY D;  3EFC A;  2PE6 B;  1NYQ A;  1LFD A;  1JWA D;  3CWI A;  4AQ7 A;  3PO0 A;  3AM9 A;  3P4S B;  2Z0D B;  3D32 A;  3EA6 A;  4IW0 A;  3RNG C;  3LJ3 A;  1UBI A;  4AS1 A;  2QCZ A;  3BYT B;  2HE7 A;  1JW9 D;  3R3M A;  2C9W B;  3KVF B;  3OLM D;  4HRO A;  4USA A;  4DDI D;  1KTK A;  1KLV A;  2K8B A;  1FNV A;  2FCN A;  4JWS C;  2MLB A;  1NDD A;  3P2B A;  1D5M C;  3A9J B;  2IYD B;  1CJE A;  3EC8 A;  2O6V B;  3L17 A;  2BW2 A;  1ZE3 D;  2MW5 A;  4W9F A;  2Z0E B;  3OG5 A;  4EKU A;  1J7A A;  1SGH A;  2KAJ A;  3Q8C A;  4NAW A;  4MSQ B;  3TEY A;  2L0F A;  1UEL A;  4PYZ A;  4S17 A;  2W55 A;  2K8C A;  2JX5 A;  1J8C A;  2KTR A;  1DGJ A;  4YTP B;  2L8J A;  4GSW A;  1JWU D;  2IJ0 A;  1KH0 A;  5IO9 A;  2BYT A;  3NS1 A;  4MDK E;  4EZL A;  2D07 B;  3H6N A;  2WGS A;  2KWU B;  1JQ4 A;  2E3T A;  2FIF A;  3VHT C;  3VH4 B;  3FIL A;  2IY1 B;  3Q6B A;  3TL5 A;  1P0R A;  4DHZ E;  3MTN B;  1GB4 A;  4WUR A;  4L23 A;  3WAO A;  3DBS A;  1EU3 A;  2NBV B;  3APD A;  1D5X C;  2N9K A;  3CMM B;  2LXA A;  1C3T A;  3X0W A;  2PE9 A;  2O6V D;  1UWX A;  2DLB A;  4FA6 A;  4KDI C;  4UDU C;  2QDF A;  3CST A;  2JRI B;  1XLO A;  3Q69 A;  1R4M I;  5LNK 1;  3VQI A;  3AEA B;  3HIZ A;  2DEN B;  2L00 B;  2ZVO A;  2QIE B;  1QQR A;  4NQK E;  3T3O A;  4J3O D;  2ZCC A;  3ZTC A;  4OHJ A;  5IP4 D;  2I2Y A;  5E6N A;  3U8Z A;  1JAL A;  1NEK B;  5D2M B;  3X23 A;  1KM7 A;  3ABV B;  4N58 A;  4RM8 A;  4RFB A;  2LUM A;  3DHG C;  4CHK A;  3W1S A;  3UGB B;  2RMM A;  3I3T B;  4YSX B;  3A4S C;  3W5U B;  1WRD B;  1WJ6 A;  3NVV A;  3PHX B;  2ZNV C;  1WR6 E;  3VH3 B;  5FR3 A;  1ENF A;  2WXL A;  2HTH A;  4I6N B;  3B08 A;  1MG4 A;  4F1S A;  3Q8E A;  2AYO B;  4PT5 A;  4IM3 A;  3RNA C;  1DOY A;  3P4R B;  2LGD A;  3PT2 B;  4KV2 A;  3RUI B;  3FIL B;  1RFK A;  3GE8 C;  3JVZ X;  4MH8 A;  4HEA 1;  5EE9 A;  4ZRP A;  2WQY B;  2NPT A;  2D3A A;  2TSS A;  1CZP A;  3APF A;  4JX1 C;  4JQW C;  5DPS A;  4OZA A;  4AUQ C;  1TY2 A;  1FXA A;  2KTF A;  2REX A;  2LZ6 A;  2NMQ A;  3PPA A;  1P7E A;  4IWP A;  5BMH A;  2N9X A;  2DWQ A;  1SIJ A;  2RPV A;  4WJP A;  2PTL A;  1XLN A;  2D5G A;  3B9J A;  2W3R A;  1FNW A;  3OJ4 B;  1FRD A;  2KXJ A;  1WXS A;  4A9A A;  1WJ4 A;  2L3Z A;  2JRH A;  3L4P A;  1D6E C;  2KC2 A;  3R8B A;  1PGB A;  2WS3 B;  1FD6 A;  2MBB B;  1SF0 A;  1K53 A;  1K52 A;  3ZDM C;  3RNB C;  3PSE B;  4IOI E;  3TCA A;  3AEC B;  1UGM A;  3GS2 A;  1ZPS A;  5CHF A;  1SEB D;  1Z2M A;  4HPL B;  1V6E A;  3RNC C;  4HKZ E;  2FE8 A;  3R7Q A;  4JPS A;  3KLS X;  1L2N A;  3BVZ A;  4HPP A;  1PUT A;  1VD2 A;  2PVO D;  3N1X C;  2N9P C;  3MJ5 A;  4FLH A;  4ZOH C;  4W9E A;  3JSV A;  2MP2 A;  4MT5 A;  3BIN A;  1N6Z A;  1IP9 A;  3MFG A;  1D4B A;  5KHQ A;  5BYS A;  3LDZ E;  2KK8 A;  4NAM A;  3UI3 A;  1ROE A;  2KFJ A;  2RDB C;  4HKQ A;  2BWE S;  4GXB A;  2ZJD A;  2KD0 A;  3HK0 A;  4M0W B;  2KWV B;  3DDC B;  1SE2 A;  1N61 A;  2MH7 A;  3RCZ A;  2SAK A;  4RF0 A;  1KLG D;  3DWM A;  2BT6 A;  2GBM A;  4PS7 A;  1OTR B;  3BZD B;  3URY A;  2PEA A;  3HHM A;  4P1C C;  5T8I A;  2H88 B;  2QJL A;  5G5G A;  1YN3 A;  2D11 A;  3PRZ A;  5D6J B;  4GOC A;  3N1Y C;  1L5P A;  1YIW A;  4KKJ A;  1N5W A;  2J0J A;  2BYV E;  2QEJ C;  3W1S C;  1BT0 A;  2KT7 A;  1JCK B;  2WXQ A;  2XK5 A;  1XQQ A;  2GBK A;  3U4E G;  3UIO B;  5LXI B;  5DPW A;  2C60 A;  2A4Z A;  3DBR I;  4F7Z A;  4AOF A;  1ZKH A;  2CKH B;  2L76 A;  4BVU C;  2KMM A;  4RNA A;  1J7C A;  3EGR A;  1YOV B;  3QCA A;  3PLV A;  1VRA B;  1KJT A;  3Q8F A;  2RPQ A;  4HCP B;  1QZE A;  3OAW A;  1JRP A;  1HA5 A;  2A5U A;  3DVN U;  2AL3 A;  5BMI A;  2M19 A;  4HDQ A;  1C4P A;  4WJO A;  1T6B X;  3R7R A;  4WQO B;  1WGD A;  2M8S A;  4ASW C;  1KFY B;  3TEX A;  3RN9 C;  5CHV C;  1X1M A;  4GU2 A;  2KDM A;  3QC8 B;  2JVC A;  4NAW B;  2MQJ A;  4FJV B;  2LGI A;  5IOI A;  4K81 A;  1UWM A;  1PGA A;  2ZPY A;  4NZL B;  3L54 A;  3SDL C;  2O6V A;  3MHZ A;  2VH1 A;  3WIM A;  4C7Z A;  2LJI A;  3GP7 A;  1SJH D;  4A90 A;  3KW5 B;  1F77 A;  4A3O A;  1K50 A;  2WX1 A;  2LEK A;  4TKN A;  3VRB B;  3IBE A;  2ZZP B;  4EFO A;  2AQ2 B;  3U30 A;  1LO5 D;  3VFK A;  2JF5 A;  3VDZ A;  4A6Q A;  5JXV A;  2NTT A;  2WDQ B;  4FJY A;  2JXX A;  4WJQ A;  2KDI A;  4IDI A;  5FR6 A;  4PYU A;  3IAS 1;  3QAR A;  3KYC D;  3AE9 B;  1WM2 A;  5EDS A;  5IKC M;  3AE1 B;  4WWN A;  5J18 A;  3P1M A;  3B2F A;  2C5L C;  1B1Z A;  2X8X X;  4M8M A;  2ON8 A;  2PW9 A;  2ZCB A;  1XO3 A;  1EO6 A;  2MRP A;  4GDK A;  1E90 A;  1WYW B;  3PZD A;  4L1B A;  2M0X A;  2D3C A;  2N7J A;  3H8H A;  4K3B A;  3GE3 C;  5JHA A;  3W1Y A;  3O13 A;  3SFE B;  4GLS C;  2LVP A;  4XC2 A;  3GZN I;  1YQ3 B;  2IGG A;  3KQ4 A;  3AE6 B;  1TKG A;  2WNM A;  2Q5W D;  5AUI A;  2AWT A;  3J9C A;  3AB5 A;  2RSU A;  4RF1 A;  4C4V A;  3RMK C;  1LM8 B;  3DBH I;  3PVL A;  4XWT A;  1P1A A;  4GIV A;  1Q0W B;  4KSL C;  4N9F 4;  3BK2 A;  3HVZ A;  1CK1 A;  2JY6 A;  4NQL B;  2LI5 A;  4XGA B;  4EOY A;  3WAN A;  2EEL A;  4GMV A;  1ZUD 2;  2KMA A;  1E10 A;  4YTN B;  3PGE A;  4LCD E;  4GGQ A;  1V2Y A;  1TYG B;  3QHT A;  3ZGZ A;  3ZO5 B;  2G9H D;  3ZLZ A;  1SE9 A;  1Y56 A;  4LJO B;  2W9N A;  1R7S A;  2L32 A;  4LDT D;  4C00 A;  2GMI C;  2WXJ A;  1AAR A;  2MX2 A;  2WDV B;  2IY0 B;  2Y5C A;  3RNE C;  4P7I A;  2OHF A;  1L0Y B;  4MH0 E;  2KMC A;  1ZGU B;  2Y5B B;  2GLS A;  4DHZ B;  1EF1 A;  1Q10 A;  1YJI A;  4M01 A;  2DYM A;  4PS3 A;  3A9J A;  4BAX A;  3L08 A;  2WDR B;  2INC C;  3DVG X;  2WLB A;  2ZNV B;  1TBE A;  3SFD B;  1WGY A;  1E7U A;  1FRR A;  4DK5 A;  3SEB A;  1NVI D;  2N7D A;  3TIX A;  2KJH B;  1FNU A;  1F2R I;  5JZE B;  1BUI C;  4RGT A;  4ANV A;  2KN4 A;  1WF9 A;  2MBQ A;  1DYQ A;  1NI3 A;  2CU3 A;  5LLI A;  3QX1 A;  4MAC A;  4DWF A;  2K3U A;  4QAY A;  3ZJU A;  4XDC A;  3IVF A;  2DZK A;  4W9C A;  4WAF A;  1LXD A;  1YN5 A;  3K9P B;  3TJP A;  1C4C A;  4HLE A;  3IHP C;  3HM3 A;  2XEW A;  2V4I B;  3LB8 C;  4EZJ A;  1C4A A;  3I9V 1;  1WYG A;  4AP4 C;  3KWL A;  5G5H A;  1WXA A;  1ZDX A;  1V81 A;  1M4V A;  1WXQ A;  3P4P B;  1N63 A;  3AMZ A;  2JZP A;  3W5V B;  3WAP A;  1ZDV A;  2LGX A;  1WX7 A;  4JWU C;  1UGJ A;  2CR5 A;  1HZ5 A;  4BKG A;  1JRO A;  2WDT B;  4EUT A;  1V5T A;  4H2A A;  4W9L A;  4JLC A;  1HE8 A;  3DHH C;  1JWB D;  2K1F A;  1WH3 A;  1C1Y B;  5L95 C;  1E5W A;  4S0R A;  1E7V A;  4IC7 B;  2LMC A;  4KSK C;  1FXI A;  2DZJ A;  4YT0 B;  4WIP A;  1M94 A;  3R2T A;  3ZTD A;  4HJK A;  3ZUN A;  3KUZ A;  5E6J A;  1I4X A;  3VUX A;  1QOB A;  4X57 B;  3AU5 A;  5AZF A;  1P7F A;  2V4L A;  1IPG A;  4ZHO A;  2R2O A;  2N9E B;  3VVW B;  4ICU A;  4EEW A;  2EKI A;  1ESF A;  4WAA A;  2WXN A;  4OZB A;  2RD0 A;  1I4R A;  2IO3 B;  2XNA C;  2ZW1 A;  1Q1O A;  1WSP A;  3GOE A;  2KNB A;  4F8C B;  4ACF A;  3VR9 B;  1AWD A;  2ZW0 A;  4TV3 A;  2WXF A;  1UNS A;  1I4P A;  2O2V A;  2YVC A;  1K8R B;  5C3J B;  1STE A;  2LXC A;  2KJR A;  2BBC A;  4MSM B;  1MI0 A;  1E8Z A;  1KOT A;  2UU7 A;  4MM3 B;  2KQS A;  4TSS A;  3NS8 A;  3KUD B;  2WHI A;  2JUO A;  5HI1 A;  1GOZ A;  1TZO A;  2R61 A;  3ML9 A;  2LFI A;  4HWI B;  3A4R A;  1UZX B;  1V5O A;  1TT5 B;  4C7Y A;  1OQY A;  3P63 A;  3WCQ A;  5D3D A;  4GN1 A;  4O1N A;  4MEL A;  2MHJ A;  5I4D A;  2GRI A;  3N3K B;  4RGM A;  1LQB A;  3BY4 B;  4GDL A;  2PLP A;  2OED A;  3UQB A;  2N9L A;  2WYQ A;  4K1R B;  2ONQ A;  1AW7 A;  3IXS A;  4ZRQ A;  1SE4 A;  2BWF A;  1TY0 A;  4M0W A;  3AEB B;  5TR5 A;  3BVM A;  3B1L X;  4YXD B;  2DX5 B;  2HJ8 A;  2BTE A;  2WXM A;  4W9G A;  1B9R A;  5IA7 A;  4XWW A;  2B3A A;  3DCG A;  4HPM B;  4WJN A;  3SR6 A;  4MGY E;  2RR9 A;  4HXD A;  3ZNG C;  2IGD A;  3Q8B A;  2B76 B;  2I1K A;  2BB6 A;  1PGX A;  3FC4 A;  2BKR B;  2LWP A;  2NBU A;  3QQ8 B;  4B0E A;  3SD5 A;  2KHW B;  2KO3 A;  1I4H A;  2K0P A;  4I6P A;  3NHE B;  1DOX A;  1J0G A;  3VUW A;  3RNF C;  1E8W A;  3AN1 A;  3RYT A;  3IG3 A;  3PZ7 A;  4DDG D;  2C7H A;  5J2R A;  2V0G A;  3UF8 A;  4FBJ B;  1WE7 A;  2SEB D;  2KDE B;  4FHK A;  2KKC A;  2OJR A;  4FJZ A;  1JWM D;  4BKS D;  1VJK A;  2FBW B;  2N1V A;  2BS3 B;  4WQM A;  3BWU D;  1ZOY B;  2V1Y A;  4P16 A;  4DXF A;  3BVG A;  3UIP B;  4IM0 A;  1WGK A;  4MGI E;  4D2K A;  4J6I A;  1L6U A;  1WE6 A;  1L6V A;  3V60 A;  2MJD A;  4LNO A;  1KRH A;  5BYR A;  2DZI A;  4RGO S;  3HRD D;  4B0M A;  4M02 A;  3V62 A;  3FAH A;  4GB9 A;  1RM6 C;  1GUA B;  1GB1 A;  1FMA D;  3O65 B;  4IKG A;  2WP9 B;  1YN4 A;  3FKY A;  1IGC A;  2W82 A;  1IBX A;  3OJ3 A;  1QOG A;  2G45 B;  2QC8 A;  3VRA B;  4DHJ D;  3M95 A;  5C2T B;  5C1Z A;  1F0Z A;  1T0Y A;  3U2S C;  5C23 A;  2FUH B;  3DQV A;  5EE3 A;  4BFR A;  1F2R C;  1SB3 C;  2J42 A;  1A70 A;  4W9J A;  2CS4 A;  2GBN A;  4AJW A;  3I63 C;  1PYW D;  3NOB A;  1J19 A;  2NR2 A;  2K39 A;  3IT6 B;  1TJE A;  5AZH A;  2JT4 B;  2WX0 A;  1MHX A;  3DBL I;  1SE3 A;  1V80 A;  4M8N A;  1EWY C;  1L4Z B;  3VTU A;  4MEM A;  3Q2A C;  1RLF A;  2IZV B;  1XT9 B;  4JGH B;  3AEF B;  3CF6 E;  4KGS A;  2WU5 B;  3Q3M C;  5DPT A;  3H7S A;  2G4D B;  4XE0 A;  1HTQ A;  3VUY A;  1TGZ B;  1YJ1 A;  2FUG 1;  2JXT A;  3ZNZ B;  1AN8 A;  3MHS D;  3N30 A;  3Q3F A;  5BMG A;  4ZDV A;  2WXH A;  4LJP B;  2G3Q B;  2X38 A;  2IPK D;  3N1Z C;  2C7M B;  1SSN A;  4BKS A;  5DPR A;  3QAQ A;  1GJZ A;  1PFD A;  2MP2 B;  3MC0 B;  2DYO A;  4NPN A;  1V1P A;  2MSE D;  2GOW A;  2MCN B;  5GXG B;  2W54 A;  4A20 A;  2MEK A;  4K7S A;  1FCL A;  1TKY A;  3RD2 A;  4DXA B;  2M1M A;  2H89 B;  3ZIM A;  1YX5 B;  3ZYY X;  1E8Y A;  3AE5 B;  1GNU A;  1MJD A;  3DBR B;  1OGW A;  1C79 A;  5MPO A;  1WR1 A;  2J52 A;  3I5J C;  1T0Q C;  2KYW A;  1QF6 A;  2K25 A;  4LDT B;  3H1U A;  4IG7 B;  1YX6 B;  3EUB 2;  4ZHP A;  4CQN A;  1RRB A;  1YD8 U;  2AL6 A;  4ANU A;  2KZR A;  1TS5 A;  3AE8 B;  4KX6 B;  5GMV A;  2MA9 B;  1WJN A;  2BYE A;  2J0K A;  2AX5 A;  2CHZ A;  3AE7 B;  2AQ3 B;  5AEK B;  2FCQ A;  1TKE A;  4KZ0 A;  3N20 C;  1R4M B;  3ONS A;  1NEN B;  2IDY A;  2K6D B;  1S1Q B;  1P3Q U;  2LRW A;  2KX3 A;  3NZ3 A;  3PLU A;  2JYT A;  4YSY B;  1FEH A;  1K51 A;  2YLM A;  4P6V F;  1QT9 A;  1T0R C;  2XN9 C;  2NVU I;  3JW0 X;  2IND C;  1F1H A;  4ZRK A;  5IN7 A;  4G0N B;  5BO4 B;  3APC A;  1E6E B;  2Y5P A;  4WWO A;  4HVB A;  1WX9 A;  2BVC A;  3P4Q B;  3SHQ A;  4R3D A;  4ZYN A;  2IGH A;  1GC6 A;  5EE1 A;  1HTO A;  2J53 A;  4G3X B;  2GBJ A;  1L0X B;  3AXC A;  3VTW A;  1I7H A;  2WXR A;  3T9L A;  2RDH A;  3AEG B;  1I35 A;  3AEE B;  4G50 A;  1WGH A;  1QKZ A;  4W9D A;  3V6E B;  4WWP A;  3V61 A;  4EE2 A;  3AU4 A;  3VTV A;  3DBH B;  3MP9 A;  2IBI B;  2UYZ B;  2FCS A;  2ACZ B;  1XF5 L;  3EHV A;  5BYQ A;  3ZXR A;  4N6E B;  2PPH A;  3DHI C;  1YJJ A;  1FPY A;  4LNF A;  5FKA C;  2BPS A;  1VLB A;  1P9D U;  4AWJ A;  1R4N B;  1S3S G;  4K7U A;  3NUH B;  2QSD A;  4US8 A;  3KH0 A;  2QIL A;  4OVV A;  4TQ0 A;  2E6X A;  1F9J A;  3MC9 A;  2HD5 B;  1BML C;  3H9D A;  3U7Z A;  4W9H A;  4GDL B;  4XDD A;  4DBG A;  3PS6 A;  2KWD A;  2CHX A;  2HTM E;  2LGY A;  1WMH B;  1WRI A;  3AH7 A;  1F52 A;  2JWU A;  2OOB B;  4YWG G;  3VAW A;  4HDO A;  1XEE A;  1C9F A;  2LUE A;  3L0W B;  2L52 A;  3HM6 X;  1QIL A;  1JWS D;  2JQR B;  1I4G A;  4C56 C;  1T0S C;  1C77 A;  2EMS A;  2GI9 A;  3NY5 A;  2WWZ A;  1WI0 A;  1QOF A;  1UD7 A;  1AYF A;  4LNI A;  2DBY A;  4YTM B;  2ZPN A;  1IBX B;  2VH2 A;  1GG3 A;  2V9H A;  3ZKJ C;  3NJT A;  1EWC A;  2K22 A;  2VRR B;  3UIN B;  3Q8A A;  2Y3A A;  1WJU A;  2AEH A;  1MG8 A;  1OFF A;  3Q3N C;  2KJ6 A;  2M0A A;  4BOS C;  1N62 A;  1L7Y A;  3RT3 B;  2DAF A;  5E6P A;  3NVY A;  1V9J A;  5HKH A;  3TMP B;  1GC7 A;  4KKI A;  2CHW A;  3ALB A;  4W9K A;  4ICV A;  3M3J A;  5TSS A;  2CU1 A;  3KUC B;  3L10 B;  1ZXH A;  1WGG A;  5CHW A;  2PMV A;  2N0S B;  4ZRJ A;  3LYY A;  3AI5 A;  1ACC A;  3K9O B;  1A5R A;  3ETR A;  1YMH E;  3A9K A;  4MGZ E;  5FK9 C;  1E0Z A;  3VR8 B;  1ET9 A;  4IWO A;  2M17 A;  2D2Q A;  2D10 A;  2KVZ A;  3GB1 A;  4MGK E;  3ZW3 A;  2KDF B;  1TS2 A;  1V1P B;  3V05 A;  3ZQ4 A;  1MHH E;  3ECI A;  1C78 A;  2K9X A;  4RGN A;  1EUV B;  2PIA A;  4A55 A;  3EFU A;  1RFA A;  3A33 B;  4TUU A;  3RZW C;  1SIF A;  1WIA A;  2QMT A;  1WZ0 A;  4FHJ A;  1ZXI A;  4KGR A;  3AE3 B;  3CIR B;  3GZN B;  3H7P A;  1RYJ A;  4US9 A;  4LTU A;  5AUK A;  4ARI A;  4YSZ B;  2I38 A;  2DYB A;  2L7R A;  2J4X A;  3A9K B;  2WXG A;  2INN E;  2KTR B;  3ZXV A;  4ZRI A;  3PV1 A;  1HEZ E;  4KIK B;  5L83 A;  4LK0 M;  4JIO U;  4HJG E;  1FFU A;  4BBN F;  1WX8 A;  2LVO A;  2BYF A;  3PTF C;  1V49 A;  4YL8 A;  3ZRF A;  2BF8 B;  3PRE A;  2NS5 A;  2ICI A;  2JSV X;  1JRU A;  1MVK A;  1OEY J;  4KIK A;  3ZNI D;  2G4S A;  5E6O A;  2O2V B;  4KGT A;  1SXT A;  4XYC A;  1V86 A;  3DVN V;  4NJ7 A;  3AE2 B;  4N59 A;  2MBE A;  4WWM A;  1VZ7 A;  2FCM A;  3H7P B;  1LGR A;  2LVQ A;  4ITK A;  5G2N A;  2KLG A;  4A8X C;  1TTN A;  1EU4 A;  4OVU A;  1CMX B;  5LXH A;  1OQR A;  4URK A;  2NPT B;  2KN5 A;  1IYF A;  1WY8 A;  4NNJ B;  2EKE C;  1IGD A;  3ZJV A;  3NZS A;  4E3C A;  4P1B C;  3PZ8 A;  3R2I A;  1WZ3 A;  2J7Q B;  2MBO A;  5AZG A;  1N5X A;  2JPH A;  4BZA A;  5HG2 A;  3DVG Y;  1SBB B;  2AQ1 B;  2PVG C;  1VR9 A;  4IWQ A;  3UQA A;  3ML8 A;  3U52 E;  3ZVV A;  4PK1 A;  2M56 B;  1WM3 A;  3KYD D;  3M63 B;  3VXW A;  3R66 C;  4IM2 A;  2LAS A;  1I4Q A;  4FUL A;  4G11 A;  4AJY B;  1NI2 A;  4L2Y A;  1FIQ A;  3WA0 A;  2FNJ B;  3RPF C;  2IO1 B;  5DCN A;  3NRZ A;  4HK2 A;  1OEY A;  1N60 A;  1BXT A;  5J17 A;  1HZ6 A;  2LGS A;  4GDK B;  2HDE A;  1L4D B;  2MWS B;  4K7W A;  4RH6 A;  1Y8R C;  1V1O A;  1XD3 B;  3PRM B;  3V6C B;  2BS4 B;  3U7D A;  2WXK A;  4B95 A;  2KQ4 X;  2D3G A;  2LHE A;  2N7E A;  4KVG B;  4BBN C;  4CYE A;  1MPE A;  2KOX A;  3TBL D;  5D94 A;  4FN2 A;  3IT4 B;  4II2 B;  1XCT L;  3TSS A;  2KX0 A;  2PKO A;  3JSV B;  1H8C A;  3Q3O C;  4E71 A;  4XX5 A;  2J0M A;  1WXM A;  1FFV A;  4TQ1 A;  1XLP A;  2Z8L A;  3C8Y A;  5G55 A;  1TZ1 A;  1UBQ A;  2KDB A;  2ZEQ A;  2KC1 A;  3AE4 B;  1EF5 A;  2V3N A;  4W9I A;  1NYR A;  1U4A A;  2M4N A;  2NCN A;  2LRU A;  1VZ6 A;  2VZK D;  1ZW7 A;  3HUI A;  3ZJT A;  4RCO A;  4KZC A;  2K8H A;  4MM3 A;  4K3C A;  2L1A A;  3QWZ B;  4B9K A;  3C0R B;  2QHO A;  1YQ4 B;  1TS4 A;  2JZZ A;  1E9M A;  1WMH A;  4PS8 A;  3RFZ B;  3NVW A;  1ZP0 B;  3Q14 C;  1V97 A;  3QK0 A;  4M00 A;  3TEW A;  2MJE A;  1GPX A;  2JWZ A;  1FO4 A;  3IFW B;  1MFW A;  3N9Y C;  4FAD A;  1R4N I;  3SU8 X;  1Z5S B;  3V3X A;  1JML A;  2DNF A;  2KAC A;  2WXP A;  3L16 A;  2G1E A;  3M62 B;  4DXG A;  2R2Q A;  2PJH A;  3Q3J A;  1WXV A;  4LLG M;  4OZC A;  1KLU D;  1DOI A;  4JE3 B;  2VZK B;  2CJN A;  5JH5 C;  3QA8 A;  1G6J A;  1KF6 B;  4C4V B;  2KLC A;  2WXI A;  1ET6 A;  2ZVN A;  5H92 C;  1QOA A;  4DQO C;  1UF0 A;  1EM7 A;  2W3S A;  2UWQ A;  1WGR A;  3A1Q B;  1H4R A;  5JHB A;  2IO0 B;  2GB1 A;  1ISN A;  3TUO A;  1E8X A;  5D7G A;  3MJW A;  3C19 A;  3PHW B;  1T5X D;  2INP E;  4RMA A;  1V8C A;  2KQ7 A;  1UUP A;  2BB5 A;  1D3Z A;  4DHJ B;  2KAN A;  1RAX A;  4JL9 A;  1XLQ A;  1UH6 A; 
#chains in the Genus database with same CATH homology
 5KHQ A;  2LXC A;  3HM6 X;  2KJR A;  2FAZ A;  3LDZ E;  2KK8 A;  1Q5W B;  4CO7 A;  4MSM B;  1WFY A;  1E8Z A;  2KFJ A;  1KOT A;  2DHZ A;  2EMS A;  3B0A A;  2XBB C;  2BWE S;  4GXB A;  3NY5 A;  2ZJD A;  2WWZ A;  2KD0 A;  2KQS A;  3HK0 A;  4M0W B;  1WI0 A;  2LD9 A;  2KWV B;  3DDC B;  1UD7 A;  3DPD A;  4BKT A;  3NS8 A;  3KUD B;  2JUO A;  2I1J A;  3RCZ A;  3ML9 A;  4HWI B;  3A4R A;  1UZX B;  4ANW A;  3NZU A;  1V5O A;  2ZPN A;  1OQY A;  4XZ4 A;  2GBM A;  4GN1 A;  1GG3 A;  4MEL A;  4PS7 A;  3ZKJ C;  2VRR B;  3UIN B;  3N3K B;  1OTR B;  2PEA A;  1LQB A;  3HHM A;  3BY4 B;  4GDL A;  4II3 B;  5KHO A;  1WJU A;  2AEH A;  4KDL B;  1MG8 A;  3UQB A;  2KJ6 A;  2D11 A;  1PQS A;  2WYQ A;  3PRZ A;  4K1R B;  5IAA C;  4B6W A;  5D6J B;  3QJZ A;  4GOC A;  4BOS C;  1L7Y A;  2NBW B;  2KVR A;  2BWF A;  1YIW A;  2N1W A;  3RT3 B;  2BGF A;  2DAF A;  2J0J A;  5E6P A;  1V9J A;  2BYV E;  2V3S A;  3W1S C;  1BT0 A;  5TR5 A;  5HKH A;  2BKF A;  3B1L X;  3N32 A;  2Z59 B;  2DX5 B;  2HJ8 A;  4IUM B;  2XK5 A;  3PRP B;  1XQQ A;  3TMP B;  3CSF A;  1GC7 A;  2GBK A;  2ASQ A;  2RGF A;  3UIO B;  2N4F A;  2CHW A;  4W9G A;  3ALB A;  4W9K A;  5IA7 A;  5LXI B;  2B3A A;  5DPW A;  1VCB A;  4HCN B;  2GBR A;  4ICV A;  3DCG A;  4HPM B;  3EEC A;  2C60 A;  3M3J A;  2A4Z A;  1FXT B;  4WJN A;  3DBR I;  4ANX A;  4F7Z A;  2CU1 A;  4MGY E;  3KUC B;  2RR9 A;  3L10 B;  4HXD A;  4AOF A;  2L0T A;  1ZKH A;  1WGG A;  2CKH B;  3ZNG C;  5CHW A;  2L76 A;  4BVU C;  3QIJ A;  3RZF A;  3ENE A;  3QCA A;  2I1K A;  2JZ3 B;  3PLV A;  4ZRJ A;  1NBF C;  3WAL A;  1I42 A;  4NY0 A;  1KJT A;  2C7N B;  3ZRC A;  3AI5 A;  2RPQ A;  3K9O B;  4HCP B;  1QZE A;  3OAW A;  1A5R A;  2A5U A;  2BKR B;  2LWP A;  2AL3 A;  3A9K A;  3AUL A;  3DVN U;  4I6L B;  2NBU A;  3QQ8 B;  4MGZ E;  3SD5 A;  2KHW B;  2KO3 A;  5CX3 A;  4HDQ A;  4I6P A;  3S2A A;  3NHE B;  4WJO A;  1J0G A;  3VUW A;  3R7R A;  4WQO B;  4IWO A;  2M17 A;  1E8W A;  2D2Q A;  2D10 A;  3RYT A;  3IG3 A;  4BOZ B;  1WGD A;  2M8S A;  3L13 A;  4DDG D;  2FID A;  2C7H A;  4MGK E;  3ZW3 A;  4ASW C;  5J2R A;  2KDF B;  3UF8 A;  4FBJ B;  1WE7 A;  5CHV C;  1X1M A;  4GU2 A;  2KDE B;  3ECI A;  4E74 A;  4FHK A;  2KKC A;  2OJR A;  4FJZ A;  2KWC A;  2EMT A;  2JVC A;  3QC8 B;  4BKS D;  4NAW B;  3WAM A;  2N1V A;  2MQJ A;  1EUV B;  4FJV B;  3EFU A;  4K81 A;  1RFA A;  3A33 B;  2V1Y A;  4MJS A;  2XK5 B;  2ZPY A;  3L54 A;  3SDL C;  4TUU A;  3RZW C;  1SIF A;  1WIA A;  2O6V A;  1WZ0 A;  3UIP B;  4IM0 A;  3WIM A;  4FHJ A;  2KFK B;  2DZM A;  2L05 A;  2MBH A;  1YQB A;  4MGI E;  3JYU A;  4J6I A;  3RUL A;  3H7P A;  3KW5 B;  4A3O A;  3A1Q A;  1WE6 A;  4NJ6 A;  3V60 A;  2WX1 A;  4TKN A;  2DYB A;  3ZDT A;  2L7R A;  3IBE A;  3ZNH B;  2ZZP B;  4EFO A;  3A9K B;  2DZI A;  3U30 A;  4A3P A;  2KTR B;  3VFK A;  2JF5 A;  2LJ5 A;  3VDZ A;  3V62 A;  4GB9 A;  5CTR C;  4MJS B;  1GUA B;  4FJY A;  4ZRI A;  2JXX A;  4RM9 A;  3O65 B;  3DOW A;  3PV1 A;  4KIK B;  5L83 A;  4WJQ A;  4JIO U;  2KDI A;  1P98 A;  2KFK A;  4BBN F;  5FR6 A;  2IO2 B;  4PYU A;  1WX8 A;  2G45 B;  2LVO A;  3OJ3 A;  2K6Q A;  2BYF A;  3KYC D;  3QAR A;  3T8M A;  3PTF C;  1V49 A;  4DHJ D;  3M95 A;  4YL8 A;  4EZK A;  1WM2 A;  5EDS A;  3ZRF A;  2BF8 B;  5C1Z A;  3PRE A;  1T0Y A;  2NS5 A;  5C23 A;  2FUH B;  3DQV A;  4WWN A;  4BFR A;  2DAJ A;  5J18 A;  1JRU A;  1OEY J;  4KIK A;  3ZNI D;  2C5L C;  2PE6 B;  2G4S A;  4M8M A;  4W9J A;  2O2V B;  2CS4 A;  2GBN A;  5E6O A;  4AJW A;  3NOB A;  1LFD A;  2ZCB A;  1J19 A;  2NR2 A;  1V86 A;  1EO6 A;  2MRP A;  2K39 A;  3DVN V;  2Z0D B;  4GDK A;  4NJ7 A;  1E90 A;  3D32 A;  5AZH A;  1WYW B;  3PZD A;  4IW0 A;  3LJ3 A;  2JT4 B;  2WX0 A;  1UBI A;  2M0X A;  3DBL I;  1V80 A;  2MBE A;  4M8N A;  2FCM A;  2HE7 A;  3H7P B;  3R3M A;  4MEM A;  2C9W B;  3KVF B;  3VTU A;  2LVQ A;  5G2N A;  3OLM D;  2KLG A;  5JHA A;  3W1Y A;  1TTN A;  1RLF A;  2LVP A;  4XC2 A;  3GZN I;  4DDI D;  4OVU A;  1CMX B;  5LXH A;  1KLV A;  2K8B A;  4URK A;  2IZV B;  1XT9 B;  2KN5 A;  2NPT B;  1IYF A;  4JGH B;  1WY8 A;  4NNJ B;  2EKE C;  2FCN A;  3CF6 E;  5DPT A;  3NZS A;  2MLB A;  3H7S A;  1NDD A;  2G4D B;  3P2B A;  3VUY A;  2AWT A;  1TGZ B;  1YJ1 A;  3A9J B;  2IYD B;  4E3C A;  3EC8 A;  2O6V B;  3ZNZ B;  1WZ3 A;  3L17 A;  2J7Q B;  3MHS D;  2MBO A;  2RSU A;  2MW5 A;  3N30 A;  3Q3F A;  5AZG A;  1IP9 A;  4ZDV A;  2JPH A;  4W9F A;  2Z0E B;  4EKU A;  1SGH A;  4LJP B;  2G3Q B;  3DVG Y;  1LM8 B;  3DBH I;  3PVL A;  1P1A A;  2C7M B;  4IWQ A;  4BKS A;  3UQA A;  4NAW A;  5DPR A;  3QAQ A;  1Q0W B;  4GIV A;  3ML8 A;  4KSL C;  4MSQ B;  1GJZ A;  2MP2 B;  3ZVV A;  2DYO A;  4NPN A;  1WM3 A;  2L0F A;  1UEL A;  3KYD D;  4PYZ A;  4N9F 4;  3M63 B;  2K8C A;  1J8C A;  3VXW A;  2KTR A;  2JY6 A;  3R66 C;  4IM2 A;  2LAS A;  2MSE D;  4NQL B;  2GOW A;  4FUL A;  2MCN B;  2L8J A;  2LI5 A;  4G11 A;  4AJY B;  4GSW A;  1NI2 A;  4A20 A;  4EOY A;  3WAN A;  4K7S A;  4GMV A;  3WA0 A;  2FNJ B;  3RD2 A;  4DXA B;  2KMA A;  2M1M A;  3PGE A;  4MDK E;  2IO1 B;  4EZL A;  4LCD E;  2D07 B;  3ZIM A;  3H6N A;  5DCN A;  1YX5 B;  2KWU B;  4HK2 A;  4GGQ A;  1V2Y A;  1E8Y A;  2FIF A;  1OEY A;  1GNU A;  3VHT C;  3VH4 B;  3QHT A;  5J17 A;  4GDK B;  1OGW A;  3ZO5 B;  2IY1 B;  3TL5 A;  3ZLZ A;  1SE9 A;  1P0R A;  4JL9 A;  2MWS B;  4K7W A;  4DHZ E;  1WR1 A;  3MTN B;  4LJO B;  1Y8R C;  3WAO A;  2W9N A;  1XD3 B;  3PRM B;  3V6C B;  3DBS A;  3U7D A;  4LDT D;  2K25 A;  4LDT B;  3H1U A;  4B95 A;  4IG7 B;  2GMI C;  2NBV B;  1YX6 B;  2D3G A;  2N7E A;  4KVG B;  1AAR A;  3APD A;  4BBN C;  2MX2 A;  3CMM B;  4CYE A;  1RRB A;  2IY0 B;  2LXA A;  1C3T A;  3X0W A;  2PE9 A;  2O6V D;  4P7I A;  2KOX A;  4MH0 E;  2KMC A;  1ZGU B;  4FA6 A;  1YD8 U;  2Y5B B;  2AL6 A;  3TBL D;  5D94 A;  4ANU A;  2KZR A;  4KDI C;  3CST A;  2JRI B;  4DHZ B;  1EF1 A;  1R4M I;  4FN2 A;  3VQI A;  5GMV A;  3HIZ A;  2DEN B;  2DYM A;  4II2 B;  2MA9 B;  4PS3 A;  3A9J A;  2L00 B;  2ZVO A;  2KX0 A;  3L08 A;  1WJN A;  2BYE A;  2J0K A;  3DVG X;  3JSV B;  4NQK E;  1H8C A;  2ZNV B;  1TBE A;  4E71 A;  2CHZ A;  2ZCC A;  3ZTC A;  5AEK B;  1WGY A;  1E7U A;  2FCQ A;  4XX5 A;  2J0M A;  4DK5 A;  1WXM A;  4KZ0 A;  2N7D A;  4TQ1 A;  5E6N A;  3U8Z A;  3TIX A;  2KJH B;  5D2M B;  3X23 A;  1KM7 A;  4RM8 A;  5G55 A;  3ONS A;  5JZE B;  1TZ1 A;  1UBQ A;  2KDB A;  2ZEQ A;  2KC1 A;  1EF5 A;  4ANV A;  3W1S A;  4CHK A;  3UGB B;  4W9I A;  2K6D B;  1S1Q B;  1P3Q U;  2LRW A;  2KX3 A;  1WF9 A;  2MBQ A;  1U4A A;  2LRU A;  2M4N A;  2NCN A;  3A4S C;  3I3T B;  3PLU A;  2YLM A;  1WRD B;  1WJ6 A;  3PHX B;  1ZW7 A;  2ZNV C;  5LLI A;  3QX1 A;  2NVU I;  1WR6 E;  3VH3 B;  4DWF A;  3JW0 X;  2HTH A;  3IVF A;  4I6N B;  4ZRK A;  3B08 A;  2DZK A;  4W9C A;  4F1S A;  4G0N B;  1LXD A;  3APC A;  2K8H A;  4KZC A;  5BO4 B;  2AYO B;  3K9P B;  3TJP A;  4MM3 A;  4IM3 A;  4WWO A;  3IHP C;  3HM3 A;  4HLE A;  2XEW A;  4HVB A;  3QWZ B;  4B9K A;  2LGD A;  3PT2 B;  1WX9 A;  3C0R B;  4KV2 A;  2QHO A;  3RUI B;  4EZJ A;  3SHQ A;  4ZYN A;  2JZZ A;  1GC6 A;  1WMH A;  4PS8 A;  4AP4 C;  1WXA A;  3AXC A;  4G3X B;  2GBJ A;  1V81 A;  3JVZ X;  3VTW A;  2NPT A;  3QK0 A;  3APF A;  3WAP A;  3T9L A;  4JQW C;  5DPS A;  4AUQ C;  2JWZ A;  2LGX A;  3IFW B;  1WX7 A;  1I35 A;  4FAD A;  1R4N I;  4G50 A;  3SU8 X;  1Z5S B;  2CR5 A;  1WGH A;  2KTF A;  4BKG A;  2REX A;  4W9D A;  2LZ6 A;  3V6E B;  2WDT B;  3PPA A;  1V5T A;  4IWP A;  3V61 A;  4EUT A;  2N9X A;  3L16 A;  3AU4 A;  4WJP A;  4W9L A;  3M62 B;  4JLC A;  1HE8 A;  2R2Q A;  2PJH A;  3VTV A;  3OJ4 B;  2IBI B;  2KXJ A;  2K1F A;  1WH3 A;  1C1Y B;  2FCS A;  2UYZ B;  1WXS A;  3Q3J A;  1WXV A;  1E5W A;  5L95 C;  1E7V A;  3EHV A;  1WJ4 A;  2L3Z A;  4IC7 B;  4KSK C;  2PPH A;  2DZJ A;  2JRH A;  1M94 A;  2KC2 A;  5JH5 C;  3ZTD A;  2BPS A;  3QA8 A;  4HJK A;  1G6J A;  1P9D U;  3ZUN A;  2MBB B;  3KUZ A;  2KLC A;  4AWJ A;  4K7U A;  1S3S G;  3VUX A;  3ZDM C;  4X57 B;  2ZVN A;  3PSE B;  3KH0 A;  2YVC A;  3AU5 A;  4OVV A;  3TCA A;  5AZF A;  4TQ0 A;  1F9J A;  2V4L A;  1IPG A;  2HD5 B;  2R2O A;  2UWQ A;  1UGM A;  3H9D A;  4W9H A;  2N9E B;  3VVW B;  4ICU A;  1WGR A;  4GDL B;  5CHF A;  4EEW A;  1Z2M A;  3A1Q B;  4DBG A;  1H4R A;  4WAA A;  3PS6 A;  2IO0 B;  5JHB A;  2RD0 A;  1V6E A;  4HPL B;  2CHX A;  1ISN A;  2IO3 B;  1E8X A;  5D7G A;  1Q1O A;  3GOE A;  2KNB A;  2LGY A;  4F8C B;  3MJW A;  1WMH B;  3R7Q A;  3PHW B;  4RMA A;  1L2N A;  1VD2 A;  2OOB B;  2N9P C;  2KQ7 A;  4FLH A;  1D3Z A;  4DHJ B;  2KAN A;  4TV3 A;  1RAX A;  4W9E A;  3JSV A;  2O2V A;  3VAW A;  4HDO A;  2MP2 A;  2LUE A;  3BIN A;  3L0W B;  4WWP A;  1UH6 A;  1K8R B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...