2KZRA

Solution nmr structure of ubiquitin thioesterase otu1 (ec 3.1.2.-) from mus musculus, northeast structural genomics consortium target mmt2a
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
86
structure length
86
Chain Sequence
WRVRCKAKGGTHLLQGLSSRTRLRELQGQIAAITGIAPGSQRILVGYPPECLDLSDRDITLGDLPIQSGDMLIVEEDQTRPKASPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Ubiquitin thioesterase OTU1
publication title Northeast Structural Genomics Consortium Target MmT2A
rcsb
source organism Mus musculus
total genus 13
structure length 86
sequence length 86
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2010-06-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2kzrA00
3RT3B 3PPAA 4ZYNA 1FXTB 5E6OA 3SD5A 4HPLB 2KK8A 2LI5A 2RR9A 3A1QB 3PLVA 3RZFA 2BPSA 3AU5A 3S2AA 2MP2A 1Y8RC 1WE6A 1C1YB 3QARA 3ZRCA 1E8WA 4MM3A 2GBRA 5HKHA 2KHWB 2D10A 2O2VB 2ZPNA 4GB9A 4KZCA 5IAAC 5J17A 4CO7A 1WH3A 2K39A 2LRUA 2O6VB 4FADA 4TUUA 4ANUA 3EC8A 4HK2A 1OEYA 2I1JA 2RPQA 1WIAA 4MGIE 2DYBA 3PGEA 4A3PA 2FCNA 2M8SA 2C60A 1XD3B 3IFWB 1EO6A 4W9DA 1D3ZA 1S3SG 4G50A 4W9HA 4W9FA 2L0FA 3OLMD 2WDTB 5DPRA 4ZRKA 2KD0A 3D32A 2LVPA 3UQAA 2GBKA 1TTNA 1V2YA 2LASA 3EECA 3PREA 3X23A 2MP2B 2L00B 4NY0A 3JVZX 2LUEA 2DAFA 4JL9A 3V62A 4FBJB 4CYEA 2IBIB 1WJUA 3TIXA 2LRWA 3VDZA 4F8CB 1WZ0A 2Y5BB 3L08A 1KOTA 2YVCA 3RD2A 2KX3A 2ZZPB 4DHZB 2OJRA 2N7DA 2KMAA 2FAZA 4IM2A 2JY6A 2G3QB 2EMTA 1F9JA 5LLIA 2WYQA 2KTFA 2KOXA 1RAXA 3PZDA 4KIKB 3HHMA 5AZHA 4B9KA 1OQYA 1P0RA 1SE9A 2KXJA 2K8CA 5D94A 3V60A 1UBQA 2DAJA 4BBNF 4HPMB 1E7VA 2J0KA 4AWJA 1GG3A 3IG3A 3R3MA 4FN2A 2BYEA 4M8MA 4MGYE 2ZCCA 2YLMA 2DYMA 2KC1A 5JH5C 2BGFA 2GBJA 5L95C 4IWPA 3ZNID 5GMVA 4I6PA 4NJ7A 2J0JA 1GNUA 4BFRA 2IO2B 2FCSA 3KYDD 4IG7B 1M94A 2DZMA 1WGHA 3ZNZB 3K9PB 1UH6A 4DDGD 3ZVVA 3RYTA 2NPTA 3B0AA 2R2OA 3KW5B 2IY1B 5AZGA 2IZVB 1L7YA 1I35A 2DENB 2KJRA 3L0WB 1MG8A 4IW0A 2AWTA 1WRDB 3W1SC 4W9JA 2IYDB 1YJ1A 2KDFB 3W1YA 4E71A 4FJYA 4LCDE 4LJPB 4KSLC 1WGRA 2BKFA 3MJWA 3KUZA 4AJWA 4DBGA 1WI0A 3TMPB 2MBQA 2WWZA 3LDZE 2LD9A 1OTRB 4LDTD 2UWQA 4K7SA 5DPTA 4HLEA 2XBBC 1Z5SB 3Q3FA 4W9GA 3TBLD 3M63B 2JZZA 2MQJA 4GOCA 4GU2A 1L2NA 1HE8A 3A1QA 1P9DU 5CHWA 4ZRIA 3UINB 2KNBA 3DVNV 1QZEA 1RRBA 3DCGA 4ZRJA 2FIFA 4FULA 2CU1A 3AU4A 2PPHA 4RMAA 2KX0A 3BY4B 2KQSA 2NPTB 2N4FA 3QHTA 4BOZB 2A5UA 2LGDA 1ZKHA 3QJZA 4NJ6A 2KDEB 1XT9B 2IY0B 5D7GA 3IVFA 4W9IA 2LWPA 4N9F4 2RSUA 2KFJA 3APFA 3PHWB 4NAWA 3I3TB 1VCBA 4W9CA 1Q0WB 4B6WA 3PT2B 3AXCA 1P1AA 3R66C 4HJKA 3R7RA 3M3JA 1GJZA 4DXAB 4II3B 1J8CA 1Q5WB 4HCNB 1LQBA 2ZNVC 3KYCD 3CSFA 3M62B 3L16A 4JQWC 1LXDA 2MW5A 3NS8A 1K8RB 4W9KA 5KHOA 3VXWA 3NOBA 4FLHA 2MX2A 4DHJB 4TQ1A 3L10B 2C7HA 1OGWA 2KDIA 3PRZA 4TV3A 1WR6E 2N9PC 1J19A 1WX9A 3KH0A 2JF5A 4GDKA 2LZ6A 4PS7A 5TR5A 4EEWA 1EF5A 1SIFA 3DVGY 2G4SA 2CS4A 2VRRB 4IWQA 5FR6A 4ANXA 4GGQA 2REXA 2Z59B 3JW0X 4A3OA 2AL6A 3ZUNA 2QHOA 3L13A 4OVUA 2K8BA 4NAWB 4HXDA 1WR1A 3NZUA 1H8CA 5G55A 4AOFA 2UYZB 1E8ZA 2V3SA 2EKEC 3DQVA 1NDDA 2MA9B 2BYFA 1Z2MA 2LXAA 2NS5A 4B95A 4KIKA 2FIDA 3QA8A 4URKA 5KHQA 4HVBA 2L0TA 4IWOA 4NPNA 4IC7B 1T0YA 4MEMA 2MRPA 2RD0A 4FA6A 3JSVA 2BF8B 2HTHA 2IO0B 4CHKA 3VHTC 1UGMA 2KTRA 4HDOA 4GDKB 4JGHB 2MWSB 5L83A 5DPSA 1BT0A 2KLGA 3VH4B 1UZXB 4MGKE 1PQSA 3VTVA 1WYWB 3QAQA 5LXIB 1XQQA 2JVCA 1ISNA 2EMSA 4ANVA 3ZLZA 5IA7A 2IO3B 3X0WA 3A9KA 3A9JB 3L17A 2JUOA 3DPDA 2ZPYA 2DZKA 3SHQA 1A5RA 2FNJB 2ZVNA 2KKCA 3ML9A 4M0WB 2D2QA 4LJOB 4XC2A 3VUWA 3QK0A 3ZTCA 1WX8A 3U8ZA 4HCPB 5CHFA 1IPGA 2JZ3B 2Z0DB 4X57B 3SU8X 2LGXA 3A4SC 2BWFA 4TQ0A 3JSVB 3N30A 3ENEA 4W9EA 3H9DA 4GDLB 4IM0A 2KVRA 3ML8A 3WA0A 1AARA 4NQLB 2D07B 3NZSA 2KTRB 4MDKE 3MTNB 4NNJB 3DOWA 2L7RA 3DBHI 2KO3A 2LXCA 2N1WA 4MJSA 4RM9A 3WANA 3ONSA 2FUHB 3KUCB 3EHVA 3A9KB 4DK5A 1RLFA 1R4NI 5BO4B 1GC7A 4WQOB 3PTFC 2L05A 2MCNB 3ZO5B 1WE7A 2BYVE 2CHWA 4K7WA 2HD5B 1YX5B 1H4RA 4MSMB 3IBEA 4ANWA 1V6EA 3CMMB 4KSKC 2KFKA 1WM2A 1E8YA 1WY8A 3WAPA 2PEAA 4WWOA 2KWCA 4JIOU 1J0GA 4EZKA 2KJHB 2K8HA 4EKUA 1V81A 4ICVA 2JWZA 2MLBA 3ZNGC 3T9LA 2AEHA 2CHZA 4K7UA 2C7MB 3ALBA 1E5WA 3WALA 2D11A 3H7PA 3RULA 1I42A 3DBRI 4WJQA 4MJSB 3TL5A 1YIWA 1TBEA 4W9LA 1WMHA 1KM7A 3GZNI 2LJ5A 3N32A 4KVGB 4KV2A 2JT4B 2K25A 4WJOA 2N9XA 4II2B 3UIPB 1KLVA 2FCQA 4TKNA 1CMXB 4EUTA 1WXAA 1WF9A 2G4DB 5AZFA 2M1MA 3NY5A 2G45B 1KJTA 5CTRC 2K6QA 2ZEQA 4E74A 3VTWA 3A4RA 1X1MA 2KANA 3LJ3A 2KFKB 4GN1A 2GBMA 4BKSD 4BOSC 4IM3A 4WWPA 4WJPA 2KQ7A 2B3AA 3EFUA 3VTUA 3H7SA 4YL8A 2DZJA 2O6VD 3H1UA 2M0XA 2L8JA 3RZWC 2CKHB 1E90A 2DZIA 3H7PB 4OVVA 4G0NB 2BKRB 4FJVB 5C1ZA 1NBFC 2M4NA 2MBOA 2NR2A 4ICUA 5CX3A 4EZJA 1EF1A 1WMHB 1WXSA 2OOBB 2WX1A 3KVFB 4G3XB 4BKGA 4ZDVA 2XEWA 2NBUA 4ASWC 5JZEB 3H6NA 1V49A 2DHZA 4WAAA 3VQIA 1VD2A 2KC2A 3W1SA 2CR5A 2GMIC 2Z0EB 3P2BA 1UD7A 2XK5A 3PVLA 4HDQA 5CHVC 1JRUA 2PE6B 2W9NA 1V80A 4AP4C 1V86A 4F1SA 3NHEB 1YQBA 4P7IA 3ZW3A 1RFAA 3HM3A 3JYUA 1OEYJ 3A33B 3A9JA 5D6JB 3CF6E 1E7UA 3WIMA 4I6NB 4PS3A 3U30A 4DHZE 4FHKA 3B08A 4WJNA 3PRPB 2DX5B 1ZW7A 4NQKE 1WXVA 3IHPC 4GDLA 3WAMA 2C5LC 1YX6B 3QWZB 2M17A 4KDIC 2N1VA 4K1RB 2KWVB 3UQBA 1WJ6A 4E3CA 3CSTA 1WJ4A 2NBWB 3MHSD 2XK5B 4WWNA 3RUIB 4XX5A 4GSWA 2NBVB 2DYOA 2PJHA 3RCZA 1EUVB 1GC6A 2J0MA 2L76A 5C23A 3R7QA 2AL3A 5E6PA 4MELA 3QCAA 4PYUA 3ZRFA 4BBNC 2NVUI 3DBLI 3PS6A 3QQ8B 3WAOA 2V4LA 4AJYB 3QC8B 4KZ0A 2ASQA 4FHJA 1LFDA 2BWES 2L3ZA 4PS8A 1UBIA 2MBHA 2MBEA 3B1LX 2PE9A 2KDBA 5D2MB 3VUYA 4IUMB 2AYOB 2GBNA 3OJ4B 2J7QB 1V5OA 3C0RB 3PSEB 3TCAA 5LXHA 2KZRA 3PHXB 3HM6X 5E6NA 4EOYA 1GUAB 4M8NA 2KMCA 3APCA 5DCNA 4G11A 4KDLB 1R4MI 1P3QU 1P98A 2CHXA 4FJZA 3T8MA 3ZNHB 2KN5A 1IYFA 4MSQB 1WGDA 1S1QB 2ZNVB 3VVWB 5JHBA 3N3KB 3UIOB 4AUQC 1SGHA 3V6EB 2IO1B 5JHAA 3ZIMA 4EFOA 1V9JA 4I6LB 1YD8U 2K6DB 2JRIB 1V5TA 3O65B 2LVOA 3AULA 1WZ3A 5EDSA 1TGZB 2K1FA 4MGZE 3BINA 4XZ4A 1WFYA 2ZCBA 3VUXA 4RM8A 3DVNU 1E8XA 2FCMA 2A4ZA 2WX0A 3OJ3A 4PYZA 4EZLA 2RGFA 5G2NA 1ZGUB 3L54A 3UGBB 3ZTDA 3PLUA 3DDCB 3KUDB 5J18A 3ECIA 1WXMA 3U7DA 1TZ1A 5DPWA 5AEKB 1WGGA 2JRHA 3PV1A 1UELA 2KWUB 2ZJDA 4JLCA 3UF8A 2HJ8A 4GMVA 2N9EB 3V6CB 4DHJD 1NI2A 4HWIB 4BVUC 3APDA 3ZKJC 3K9OB 2R2QA 2KLCA 2ZVOA 4BKTA 4K81A 4J6IA 3QIJA 3HK0A 2MBBB 4MH0E 3VAWA 5J2RA 3HIZA 3DVGX 3QX1A 3Q3JA 3V61A 2N7EA 3M95A 2NCNA 2LGYA 3ZDMC 4F7ZA 2GOWA 1LM8B 2V1YA 3OAWA 4DDID 4BKSA 3AI5A 2JPHA 1WGYA 2O2VA 1U4AA 3TJPA 1IP9A 3VH3B 3DBSA 1G6JA 2JXXA 3ZDTA 4DWFA 2D3GA 3SDLC 2C9WB 2O6VA 2KJ6A 2MSED 4A20A 4LDTB 2C7NB 1C3TA 1WM3A 2LVQA 4GIVA 1WJNA 3PRMB 3GOEA 3VFKA 1WX7A 2I1KA 1Q1OA 4GXBA 2HE7A
chains in the Genus database with same CATH superfamily
3RT3B 3PPAA 2MHJA 5E6OA 4HPLB 3A1QB 2BPSA 2MP2A 3QARA 2Z8LA 1E8WA 4MM3A 2D10A 4GB9A 3AE1B 4CO7A 1WH3A 1NI3A 2K39A 4RF0A 3CWIA 2DYBA 2FCNA 1XXGA 2LFIA 4N59A 1XD3B 4W9DA 1EO6A 1T0RC 1WGKA 1QOFA 4ZYSA 1D3ZA 4G50A 4W9FA 2L0FA 2WDTB 2PIAA 1TS5A 2GLSA 2LVPA 3Q6BA 4OVZA 3UQAA 2LASA 3BK1A 3IT4B 3EECA 3PREA 3X23A 4NY0A 1SF0A 2LUEA 4KKIA 4CYEA 2JYTA 4F8CB 4JE3B 2Y5BB 3L08A 1V97A 5IKCM 2KWDA 4DHZB 3RNAC 2G3QB 2D5GA 4IKGA 2NTTA 1JALA 2LHDA 1I4QA 5AZHA 2KXJA 4HPMB 2J0KA 2J53A 4M8MA 4NZLB 1QLBB 5GMVA 1MFWA 4BFRA 2FCSA 2K0PA 3BVZA 3AEFB 5FR3A 3K9PB 3ZVVA 3RYTA 5EE0A 3L0WB 1F0ZA 3W1YA 5T8IA 4LCDE 4KSLC 2BKFA 3MJWA 4AJWA 4DBGA 1WI0A 3LDZE 4LDTD 4OW0A 5DPTA 4DQOC 4HLEA 1Z5SB 3M63B 2JZZA 4GU2A 3A1QA 1YN3A 4FXCA 1YMHE 3DCGA 4ZRJA 4FULA 3ZXRA 1K50A 3QHTA 4BOZB 4ZOHC 2N7JA 1P7EA 4HPPA 4YT0B 1XT9B 1FNVA 2LWPA 3I3TB 5IP4D 3AXCA 3V05A 1KF6B 2WU2B 4II3B 1V8CA 4HCNB 1LQBA 5KHOA 2V3PA 3Q8AA 2MX2A 3L10B 1OGWA 1ROEA 2W3SA 1YN4A 3KH0A 2LZ6A 4PS7A 1KTKA 1EF5A 1SIFA 3DVGY 2CS4A 4GGQA 1SEBD 1YQ3B 2Z59B 2AL6A 5HI1A 2K8BA 2N9LA 4N58A 5G55A 4AOFA 3AB5A 1E8ZA 1ZUD2 2V3SA 3LXFA 1TS2A 2BYFA 2LXAA 3NVYA 4KKJA 3I63C 2LUMA 4NPNA 2MRPA 3N1XC 2RD0A 3AEBB 2PVOD 3JSVA 2L1AA 2HTHA 5IOIA 1EM7A 2LGSA 2KTRA 4JGHB 1PYWD 4GDKB 4MT5A 5DPSA 4REZA 3VH4B 2HJ1A 1UZXB 2LGIA 3QAQA 1HXYD 2IO3B 3X0WA 3DPDA 1A5RA 2FNJB 5D3IB 3ML9A 4M0WB 1V1OA 2WXGA 5CHFA 1IPGA 2QMTA 2Z0DB 4P1BC 1L5PA 2LGXA 4TQ0A 2BWFA 3N9YC 3ENEA 3BVGA 2OHFA 4NQLB 2D07B 3MTNB 2CJOA 3ZXVA 2KO3A 2G1EA 2LXCA 1CZPA 3A9KB 3P4SB 1R4NI 4C4VB 4KGRA 1MVKA 3PTFC 3UI3A 1TKGA 2HD5B 4MSMB 1J7BA 1V6EA 2ON8A 3SFEB 1E9MA 3L4PA 1BMLC 1N60A 4ARCA 2W55A 4EKUA 2PKOA 1T6BX 2JWZA 2CHZA 4K7UA 3Q3NC 4MJSB 3TL5A 3NVZA 1YIWA 2GB1A 4W9LA 1FIQA 3GZNI 4PK1A 2LJ5A 2JT4B 4ACFA 4II2B 2INDC 4L23A 2RPVA 4B0MA 2QSDA 1WF9A 2G4DB 2M1MA 3FILA 1NEKB 1UWXA 1YJJA 2ONQA 4E74A 5LNK1 4IOIE 3OG5A 2K22A 4WWPA 1EU3A 3VRBB 2DZJA 2O6VD 3U2SC 1E90A 2DZIA 3H7PB 4G0NB 4R3DA 4DXGA 2M4NA 2MBOA 2NR2A 1DOXA 1WXSA 4XDCA 1QF6A 2INCC 1ZOYB 2NBUA 1PFDA 4WAAA 4NJCA 3W1SA 4HDQA 2Z0EB 5CHVC 3B2GA 1C78A 3JYUA 4HROA 1D5XC 2JX5A 2SEBD 3CF6E 3WIMA 4HKQA 1C76A 4M0WA 4ZRPA 2LJIA 1UNSA 1WXVA 3IHPC 3WAMA 2N1VA 1HZ6A 1WJ6A 4P6VF 2BS4B 4GSWA 2NBVB 2DYOA 2L76A 3AE5B 3ZRFA 1SE3A 3HVDA 5FKAC 4C4VA 3TEWA 2NVUI 4FHJA 1UBIA 1OQQA 2KDBA 2GBNA 3OJ4B 3TCAA 3PHXB 3NVWA 1JWSD 1GUAB 4M8NA 2VZKD 1KLGD 3J9CA 1P98A 3T8MA 3LB8C 1GPXA 1FFUA 1FCCC 1S1QB 3AE8B 4Q2JA 2DLBA 1D4BA 2H88B 3N3KB 5H8YE 5JHBA 4AUQC 3V6EB 4EFOA 1Y56A 2K6DB 1V5TA 2LVOA 3P4PB 5EDSA 2K1FA 3BINA 3RN9C 1RM6C 2ZCBA 4RM8A 3DVNU 2A4ZA 3BWUD 5G2NA 5HG2A 2ZW1A 3ZTDA 5J18A 1WXMA 1R7SA 2DBYA 2DNFA 1VR9A 3EFCA 2PLPA 4DHJD 1XCQL 2WS3B 1D5MC 3P63A 2KLCA 4BKTA 4J6IA 4MH0E 3VAWA 2Y3AA 3AMZA 1PGXA 2ZW0A 3Q3JA 1SXTA 1TS4A 2GOWA 2BS2B 2V1YA 1I7HA 4DDID 5BMGA 2JPHA 1WGYA 2O2VA 3TJPA 2OEDA 3VH3B 4DWFA 4JWUC 2D3GA 3AEDB 2KJ6A 4A20A 3NG0A 2C7NB 1WM3A 2L52A 1WJNA 3SEBA 1Y8RC 5EE1A 1Q1OA 3PZ7A 4ZYNA 3PLVA 2NTSA 1WE6A 1R4MB 3GE3C 5FK9C 2GBRA 4YTPB 1HQRD 1EWCA 3N1ZC 4KZCA 1IGDA 3SFDB 2R61A 2LRUA 2O6VB 4FADA 4LNKA 1UF0A 2I1JA 4MGIE 1WIAA 3O13A 3PGEA 1AYFA 4A3PA 3P4QB 5C3JB 1S3SG 3ZJUA 2QCZA 3OLMD 4ZRKA 1TTNA 1V2YA 2MP2B 2IGDA 3HVZA 3JVZX 4MM3B 3V62A 4FBJB 2WXFA 4YSYB 3VDZA 1TYGB 1KOTA 4B0EA 3RD2A 2ZZPB 2FUG1 2OJRA 2N7DA 2KMAA 2JY6A 4XE0A 3DHGC 2QJLA 4KIKB 3HHMA 1YNTE 2WLBA 1P0RA 4BBNF 2K8CA 1UBQA 4KGSA 4MGYE 4XGAB 1M4VA 4K3CA 2DYMA 4C7ZA 2KC1A 5JH5C 5L95C 1WXQA 2YEPB 3ZNID 3MFGA 1GNUA 4IG7B 2W3RA 1SB3C 3ZNZB 1WWTA 1UH6A 3KW5B 5AZGA 1L7YA 1FEHA 2KJRA 3I57A 3U52E 3T3NA 5BMHA 3R8BA 3AE3B 2KDFB 4E71A 2AQ2B 4LJPB 2VZKB 3KUZA 1I4HA 4HEA1 3Q3FA 3TBLD 1L2NA 1HE8A 2WXHA 3ZYYX 2KNBA 3DVNV 1JCKB 4HKZE 4RMAA 2KX0A 3BY4B 4DXFA 1WSPA 2LGDA 1VJKA 2RSUA 2PMVA 3URYA 2KFJA 3APFA 3PHWB 4NAWA 3IT6B 4B6WA 1IGCA 2W82A 3R7RA 3M3JA 1GJZA 1J8CA 4OZAA 2UU7A 2ZNVC 3Q8CA 3CSFA 4M02A 2MW5A 3NS8A 4W9KA 3AV8A 4DHJB 2C7HA 1SJED 3PRZA 1WR6E 1MHXA 3AE2B 1WX9A 1YQ4B 5TR5A 1K52A 4IWQA 2G4SA 4ANXA 1JQ4A 3TEXA 4HJGE 2I2YA 3ZUNA 2QHOA 2J42A 1WR1A 3NZUA 1H8CA 3B2FA 3DHIC 3Q14C 2J4XA 3PO0A 1Z2MA 1BUIC 4KIKA 2FIDA 3QA8A 4URKA 2L0TA 1JMLA 1T0YA 4IC7B 2CJNA 4CHKA 1WYGA 3VHTC 1UGMA 4USAA 2WXJA 1FCLA 4MGKE 1PQSA 1VLBA 2EMSA 4ANVA 5IA7A 3ZLZA 2JUOA 4LJOB 1RFKA 2JQRB 3ZTCA 1HA5A 3AE4B 1ZDVA 2JSVX 3V3XA 1YJIA 4X57B 3SU8X 1YN5A 3JSVB 2CU3A 1F52A 3N30A 4W9EA 3H9DA 2I38A 1KRHA 3AE7B 4MDKE 2KTRB 2L7RA 3DBHI 5AUKA 2N1WA 4RM9A 3WANA 4WIPA 1PUTA 2GRIA 2L05A 1WE7A 1YOVB 1MPEA 4K7WA 3IBEA 4KSKC 2KFKA 1WM2A 3WAPA 2PEAA 2KWCA 1T0SC 1P7FA 2KJHB 4EZKA 2D3CA 3BVMA 1L6UA 2C7MB 3ALBA 3WALA 2D11A 5I4DA 4WJQA 3VR8B 4M00A 1WMHA 4WJOA 3BYYB 2K25A 2WXPA 2N9XA 5C2TB 3UIPB 1KLVA 2FCQA 4EUTA 1CMXB 3CIRB 1WXAA 2K3UA 5CTRC 2ZEQA 3A4RA 2BTEA 1BXTA 3BYTB 2GBMA 4IM3A 4WJPA 2M0XA 1XEEA 1FNUA 2L8JA 1ACCA 2INNE 4OVVA 2EELA 2H89B 1EF1A 2WX1A 3MC9A 5HHDG 2XEWA 5JZEB 3H6NA 1V49A 2DHZA 3VQIA 2CR5A 3P2BA 1F2RC 3DWGC 3FILB 1SIJA 1V80A 3NUHB 1V86A 4F1SA 1YQBA 4P7IA 3A33B 5D6JB 1E7UA 4FHKA 1GOZA 4WJNA 4NQKE 4RGNA 1KFYB 1YX6B 2QC8A 4K1RB 2KWVB 4LTUA 1UUPA 2NBWB 3MHSD 3MP9A 4XX5A 2V4IB 2J0MA 2IGHA 3R7QA 1JWAD 2AL3A 5E6PA 1PDXA 3AE9B 4RGMA 3DBLI 3QQ8B 4AJYB 3KQ4A 3QC8B 1JWUD 4PS8A 3DBRB 2MBHA 3OWEB 1SSNA 4GLSC 3R2IA 2AYOB 3PSEB 3PZ8A 5E6NA 1CQVA 2KMCA 1R4MI 3KLSX 1HZ5A 4ARIA 2JWUA 2KN5A 1FXIA 1V9JA 1YD8U 2WXRA 3AULA 1WZ3A 3ZJTA 4MGZE 1SE4A 1T3QA 3VUXA 1I4GA 1E8XA 1ZGUB 3PLUA 3ETRA 3KUDB 3ECIA 3U7DA 1TZ1A 5DPWA 1F1HA 5AEKB 1HTOA 3PV1A 2ZJDA 1E0ZA 1L4ZB 1I4PA 2L83A 4A6QA 1NI2A 3C19A 4H2AA 5BYRA 3APDA 1AN8A 1VRAB 1FM0D 2WDQB 3MC8A 3HK0A 4OZCA 3HIZA 1ENFA 2N7EA 3M95A 3Q8FA 2NCNA 2LGYA 2JXTA 4WAFA 2INPE 1LM8B 4D2KA 2LHEA 3TEZA 1N5XA 1G6JA 3ZDTA 2WP9B 3W2DA 3SDLC 2C9WB 4LDTB 2LVQA 4GIVA 3PRMB 3GOEA 3TEYA 4KDLB 4N6EB 1FXTB 3SD5A 2KK8A 2LI5A 2RR9A 3AU5A 3S2AA 4YXDB 1C1YB 1N5WA 3ZRCA 4K3BA 2MH7A 1TT5B 2O2VB 1TJEA 2IGGA 2M0AA 1WRIA 2AQ1B 5J17A 4ANUA 2BVCA 3EC8A 1OEYA 2RPQA 1ZE3D 2V3NA 3Q8EA 5E6JA 1LGRA 2KD0A 3D32A 2VH1A 1AW7A 4JL9A 2IBIB 1C4PA 1WZ0A 5EE9A 2WXQA 2BBCA 3EUB2 3RNEC 2KX3A 3GP7A 2EMTA 2WXOA 2KTFA 2KOXA 2B76B 1RAXA 4B9KA 1SE9A 5D94A 3V60A 2DAJA 1E7VA 4AWJA 3NVVA 1FXAA 3IG3A 3R3MA 4FN2A 2ICIA 2BYEA 4XDDA 2ZCCA 4AS1A 3EA6A 2YLMA 4ITKA 2GBJA 1MI0A 4I6PA 4NJ7A 2J0JA 1C4AA 2JZPA 1XLPA 4ZHPA 2IO2B 3KYDD 2DZMA 1WGHA 1JW9D 3C8YA 2NPTA 3B0AA 1N61A 1I35A 2DENB 3RNBC 1WRDB 5JXVA 1GB4A 1ZXHA 2HDEA 4FJYA 3NZ3A 2MEKA 2RMMA 3TMPB 1GB1A 2LD9A 2XBBC 4W9GA 1P9DU 5CHWA 2FIFA 4S0RA 2CU1A 3AU4A 4C80A 2A5UA 3NJTA 3BK2A 1L0YB 2KDEB 1F2RI 2W54A 5D7GA 4C7YA 4L1BA 4W9IA 3WCQA 4N9F4 4P16A 1VCBA 4W9CA 3R66C 4HJKA 4DXAB 4JQWC 3VXWA 1LXDA 1K8RB 3NOBA 4FLHA 4TQ1A 3FKYA 4RH6A 2M19A 1SJHD 1MHHE 2MJDA 5FR6A 1IUEA 1TZOA 4OVUA 4JWSC 1STEA 4NAWB 3RNFC 2UYZB 3DQVA 2NS5A 5BMIA 5KHQA 4IWOA 3W5VB 4MEMA 4FA6A 3HUIA 1GAQB 2IO0B 1R4NB 2AQ3B 5L83A 3AE6B 1BT0A 2KLGA 3VRAB 3VTVA 1XQQA 3A9JB 4XWTA 2ZPYA 4ZRQA 3SHQA 2K5PA 4BZAA 2D2QA 3VUWA 4XC2A 3VR9B 3QK0A 2BT6A 1WX8A 2WXIA 4HCPB 2JZ3B 3I9V1 3GZNB 1IBXA 3A4SC 4GDLB 2KVRA 3ML8A 1WX7A 1AARA 3WA0A 3NZSA 3BIID 3DOWA 4AQ7A 4YTMB 2BW2A 1C9FA 2Q5WD 3KUCB 1RLFA 2TSSA 5BO4B 1GC7A 4WQOB 3ZO5B 2BYVE 1FRDA 1V1PA 2CHWA 1YX5B 4ANWA 4LNNA 1E8YA 1WY8A 4RF1A 4KX6B 4WWOA 4JIOU 2K8HA 4P1CC 1V81A 4ICVA 2PVGC 3T9LA 1TKEA 3RULA 3DBRI 1TBEA 4KV2A 1KM7A 4KVGB 2RDGA 5HFYA 2QILA 1PGAA 4TKNA 5AZFA 3NY5A 1E6EB 3VTWA 3R2TA 1X1MA 2KANA 3LJ3A 2KFKB 4GN1A 1VDVA 4BOSC 3HRDD 2KQ7A 2B3AA 2AX5A 3VTUA 3H7SA 3W9CB 5G5HA 3RZWC 4YSZB 3ZJVA 5C1ZA 4FJVB 1ZDXA 4ICUA 5CX3A 1WMHB 4G3XB 2KVZA 2OOBB 4BKGA 4ZDVA 3E9SA 4ASWC 4M01A 4QAYA 1VD2A 2GMIC 1UD7A 2XK5A 3PVLA 2W9NA 2FE8A 3HM3A 1OEYJ 3A9JA 3EGRA 4PT5A 1J7CA 3U30A 4DHZE 1L0VB 2BB5A 2MJ3A 4LNIA 2LEKA 3LYYA 3PRPB 4RGOS 4GDLA 3AEGB 2KAJA 1N63A 3CSTA 1WJ4A 4S17A 4WWNA 3RUIB 3RCZA 2PJHA 2DWQA 1EUVB 5C23A 4PYUA 4BBNC 1K51A 4A90A 3GB1A 2ASQA 2BWES 2L3ZA 1RYJA 2BS3B 3Q69A 4A9AA 2MBEA 2V9HA 1FRRA 1ET6A 5D2MB 4IUMB 3RMKC 2WXLA 4A55A 1V5OA 2KZRA 1CK1A 3IAS1 4EOYA 3APCA 1P3QU 3RI7C 2CHXA 2PTLA 3ZNHB 1IYFA 4MSQB 1WGDA 2XN9C 5JHAA 1E10A 3AEAB 1B1ZA 1DGJA 1J7AA 1TGZB 4O1NA 4XZ4A 1WFYA 3MC0B 2N9KA 2Y5CA 2WX0A 2GI9A 2WHIA 2RGFA 1JROA 2JU6X 3UGBB 1FMAD 3DDCB 4JX1C 2WXMA 4TMAB 4US8A 1WGGA 2RDBC 2IJ0A 2HJ8A 4GMVA 4JPSA 4HWIB 1KLUD 1XLQA 2E6XA 3ZKJC 3K9OB 4ZHOA 2ZVOA 1MG4A 1XCTL 3QIJA 2MBBB 5J2RA 3DVGX 5BYSA 1DOIA 3OAWA 2KMMA 3NRZA 4BKSA 2N0SB 2EKIA 1IP9A 1U4AA 3DBSA 4A8XC 4WH4A 3RNGC 1FO4A 3P1MA 4US9A 1KH0A 1C3TA 1XO3A 3VFKA 2RDHA 2I1KA 1FPYA 4WURA 2HTME 4WQMA 2BB6A 2BYTA 3RZFA 3Q2AC 3U7ZA 4BAXA 2L32A 2PW9A 5HKHA 2KHWB 1PGBA 2ZPNA 3AM9A 2JYEA 5IAAC 3RNCC 4TUUA 2WU5B 3W5UB 4HK2A 4MACA 2WQYB 1L4DB 2C60A 2M8SA 3IFWB 1AWDA 1HEZE 1I4RA 3TUOA 4W9HA 3SR6A 5DPRA 2WNMA 1NYQA 2GBKA 1OFFA 2L00B 2G9HD 2V0GA 3KWLA 1QILA 3MJ5A 2DAFA 5H92C 3ABVB 2KACA 1C77A 2X38A 1WJUA 3TIXA 2LRWA 1TIFA 2YVCA 3B9JA 1HTQA 2FAZA 4IM2A 1UGJA 1F9JA 5LLIA 1UWMA 2WYQA 3N20C 3PZDA 3GE8C 1JWMD 1OQYA 1GG3A 4HRSA 2K9XA 3GS2A 1C4CA 3MHZA 3N1YC 4WWMA 2BGFA 4IWPA 1M94A 2D3BA 1TKYA 4DDGD 3H8HA 2R2OA 2IY1B 2IZVB 4YTNB 1MG8A 4IW0A 2AWTA 3W1SC 4W9JA 2IYDB 1DOYA 1YJ1A 4C56C 1TS3A 1XLNA 3DWMA 1WGRA 2LMCA 2MBQA 2WWZA 1OTRB 2UWQA 4K7SA 2MQJA 4GOCA 4IDIA 4ZRIA 3UINB 3AEEB 3I5JC 1QZEA 1RRBA 2PPHA 2MJEA 2KQSA 2NPTB 2N4FA 4C00A 1ZKHA 3QJZA 4NJ6A 1L6VA 2IY0B 3IVFA 4UDUC 1F77A 2NMQA 2WXNA 1Q0WB 3PT2B 1P1AA 5IO9A 4YSXB 3IXSA 1Q5WB 3KYCD 3M62B 3L16A 2M56B 4XYCA 2KDIA 4TV3A 2QIEB 2N9PC 1J19A 4GDKA 5BYQA 2JF5A 4EEWA 4OZBA 1SE2A 2FBWB 2VRRB 3AECB 1ZPSA 2REXA 4A3OA 3JW0X 3L13A 5GXGB 4HXDA 1A70A 2EKEC 1NDDA 2MA9B 3DBHB 4B95A 3RPFC 4HVBA 5G5GA 3U4EG 1MJDA 2BF8B 3Q8BA 4HDOA 2MWSB 2KT7A 1WYWB 1EU4A 5LXIB 2JVCA 1ISNA 3A9KA 3L17A 2XNAC 2DZKA 2ZVNA 2KKCA 3P42A 1C79A 3U8ZA 4KGTA 3ZGZA 1VZ6A 4IM0A 1JRPA 1QOAA 4NNJB 3E56A 1ZP0B 2QDFA 4MJSA 3ONSA 4LNFA 5TSSA 2FUHB 3EHVA 3NS1A 1JWBD 4DK5A 1N6ZA 4LLGM 2MCNB 3Q3MC 2BQQA 1H4RA 3CMMB 5EE3A 2E3TA 1IBXB 2SAKA 1J0GA 4YWGG 3ZQ4A 4LK0M 1D6EC 2MLBA 3ZNGC 2AEHA 1E5WA 1NENB 3H7PA 1I42A 1D5ZC 3N32A 1TY2A 1L0XB 1XF5L 2OJWA 2VH2A 1T0QC 2G45B 1V1PB 1KJTA 2WXKA 2K6QA 5AUIA 4BKSD 3T3OA 1FD6A 1CJEA 1DYQA 2WDVB 1VZ8A 1ESFA 2X8XX 3EFUA 4YL8A 1XLOA 3H1UA 2CKHB 2BKRB 3BZDB 1NBFC 2ACZB 4EZJA 1QQRA 3KVFB 3DBLB 4OHJA 2KC2A 1I4XA 1JRUA 2PE6B 4AP4C 5MPOA 3NHEB 3ZW3A 1RFAA 1QOGA 3AH7A 2KDMA 1Q10A 4I6NB 4PS3A 1EWYC 3IAM1 1QOBA 3DHHC 3B08A 2DX5B 1ZW7A 2C5LC 2KN4A 3QWZB 2M17A 4KDIC 5D3DA 1RWSA 1FFVA 3UQBA 1N62A 4E3CA 1QT9A 3Q3OC 2XK5B 2YEPF 3FC4A 1GC6A 4L2YA 4RGTA 4TSSA 4MELA 3QCAA 2IPKD 3FAHA 3PS6A 3WAOA 2V4LA 1FNWA 5IN7A 4KZ0A 1LFDA 4LNOA 1T5XD 2WGSA 1LO5D 3B1LX 1NYRA 2PE9A 3VUYA 2J7QB 3C0RB 5LXHA 1OQRA 3HM6X 3RFZB 1ZXIA 1TY0A 1K53A 5DCNA 4G11A 1NVID 4FJZA 2ZNVB 3VVWB 4EE2A 1E7PB 3UIOB 1SGHA 2IO1B 1SBBB 2D3AA 3ZIMA 4I6LB 2JRIB 2IDYA 2FCMA 3OJ3A 2KQ4X 4PYZA 4J3OD 4EZLA 3L54A 1VZ7A 2JRHA 1UELA 2KWUB 4JLCA 3UF8A 3V6CB 2N9EB 1B9RA 1ET9A 4BVUC 2R2QA 2WDRB 3KWVA 3TSSA 1QKZA 4K81A 2KYWA 4NAMA 3QX1A 3V61A 2Y5PA 3P4RB 2QEJC 3ZDMC 4F7ZA 4RNAA 4RCOA 3AI5A 4MH8A 2JXXA 4XWWA 4RFBA 2O6VA 3AN1A 2MSED 2J52A 4CQNA 3O65B 4GXBA 2HE7A
chains in the Genus database with same CATH topology
3RT3B 3PPAA 4ZYNA 1FXTB 5E6OA 3SD5A 4HPLB 2KK8A 2LI5A 2RR9A 3A1QB 3PLVA 3RZFA 2BPSA 3AU5A 3S2AA 2MP2A 1Y8RC 1WE6A 1C1YB 3QARA 3ZRCA 1E8WA 4MM3A 2GBRA 5HKHA 2KHWB 2D10A 2O2VB 2ZPNA 4GB9A 4KZCA 5IAAC 5J17A 4CO7A 1WH3A 2K39A 2LRUA 2O6VB 4FADA 4TUUA 4ANUA 3EC8A 4HK2A 1OEYA 2I1JA 2RPQA 1WIAA 4MGIE 2DYBA 3PGEA 4A3PA 2FCNA 2M8SA 2C60A 1XD3B 3IFWB 1EO6A 4W9DA 1D3ZA 1S3SG 4G50A 4W9HA 4W9FA 2L0FA 3OLMD 2WDTB 5DPRA 4ZRKA 2KD0A 3D32A 2LVPA 3UQAA 2GBKA 1TTNA 1V2YA 2LASA 3EECA 3PREA 3X23A 2MP2B 2L00B 4NY0A 3JVZX 2LUEA 2DAFA 4JL9A 3V62A 4FBJB 4CYEA 2IBIB 1WJUA 3TIXA 2LRWA 3VDZA 4F8CB 1WZ0A 2Y5BB 3L08A 1KOTA 2YVCA 3RD2A 2KX3A 2ZZPB 4DHZB 2OJRA 2N7DA 2KMAA 2FAZA 4IM2A 2JY6A 2G3QB 2EMTA 1F9JA 5LLIA 2WYQA 2KTFA 2KOXA 1RAXA 3PZDA 4KIKB 3HHMA 5AZHA 4B9KA 1OQYA 1P0RA 1SE9A 2KXJA 2K8CA 5D94A 3V60A 1UBQA 2DAJA 4BBNF 4HPMB 1E7VA 2J0KA 4AWJA 1GG3A 3IG3A 3R3MA 4FN2A 2BYEA 4M8MA 4MGYE 2ZCCA 2YLMA 2DYMA 2KC1A 5JH5C 2BGFA 2GBJA 5L95C 4IWPA 3ZNID 5GMVA 4I6PA 4NJ7A 2J0JA 1GNUA 4BFRA 2IO2B 2FCSA 3KYDD 4IG7B 1M94A 2DZMA 1WGHA 3ZNZB 3K9PB 1UH6A 4DDGD 3ZVVA 3RYTA 2NPTA 3B0AA 2R2OA 3KW5B 2IY1B 5AZGA 2IZVB 1L7YA 1I35A 2DENB 2KJRA 3L0WB 1MG8A 4IW0A 2AWTA 1WRDB 3W1SC 4W9JA 2IYDB 1YJ1A 2KDFB 3W1YA 4E71A 4FJYA 4LCDE 4LJPB 4KSLC 1WGRA 2BKFA 3MJWA 3KUZA 4AJWA 4DBGA 1WI0A 3TMPB 2MBQA 2WWZA 3LDZE 2LD9A 1OTRB 4LDTD 2UWQA 4K7SA 5DPTA 4HLEA 2XBBC 1Z5SB 3Q3FA 4W9GA 3TBLD 3M63B 2JZZA 2MQJA 4GOCA 4GU2A 1L2NA 1HE8A 3A1QA 1P9DU 5CHWA 4ZRIA 3UINB 2KNBA 3DVNV 1QZEA 1RRBA 3DCGA 4ZRJA 2FIFA 4FULA 2CU1A 3AU4A 2PPHA 4RMAA 2KX0A 3BY4B 2KQSA 2NPTB 2N4FA 3QHTA 4BOZB 2A5UA 2LGDA 1ZKHA 3QJZA 4NJ6A 2KDEB 1XT9B 2IY0B 5D7GA 3IVFA 4W9IA 2LWPA 4N9F4 2RSUA 2KFJA 3APFA 3PHWB 4NAWA 3I3TB 1VCBA 4W9CA 1Q0WB 4B6WA 3PT2B 3AXCA 1P1AA 3R66C 4HJKA 3R7RA 3M3JA 1GJZA 4DXAB 4II3B 1J8CA 1Q5WB 4HCNB 1LQBA 2ZNVC 3KYCD 3CSFA 3M62B 3L16A 4JQWC 1LXDA 2MW5A 3NS8A 1K8RB 4W9KA 5KHOA 3VXWA 3NOBA 4FLHA 2MX2A 4DHJB 4TQ1A 3L10B 2C7HA 1OGWA 2KDIA 3PRZA 4TV3A 1WR6E 2N9PC 1J19A 1WX9A 3KH0A 2JF5A 4GDKA 2LZ6A 4PS7A 5TR5A 4EEWA 1EF5A 1SIFA 3DVGY 2G4SA 2CS4A 2VRRB 4IWQA 5FR6A 4ANXA 4GGQA 2REXA 2Z59B 3JW0X 4A3OA 2AL6A 3ZUNA 2QHOA 3L13A 4OVUA 2K8BA 4NAWB 4HXDA 1WR1A 3NZUA 1H8CA 5G55A 4AOFA 2UYZB 1E8ZA 2V3SA 2EKEC 3DQVA 1NDDA 2MA9B 2BYFA 1Z2MA 2LXAA 2NS5A 4B95A 4KIKA 2FIDA 3QA8A 4URKA 5KHQA 4HVBA 2L0TA 4IWOA 4NPNA 4IC7B 1T0YA 4MEMA 2MRPA 2RD0A 4FA6A 3JSVA 2BF8B 2HTHA 2IO0B 4CHKA 3VHTC 1UGMA 2KTRA 4HDOA 4GDKB 4JGHB 2MWSB 5L83A 5DPSA 1BT0A 2KLGA 3VH4B 1UZXB 4MGKE 1PQSA 3VTVA 1WYWB 3QAQA 5LXIB 1XQQA 2JVCA 1ISNA 2EMSA 4ANVA 3ZLZA 5IA7A 2IO3B 3X0WA 3A9KA 3A9JB 3L17A 2JUOA 3DPDA 2ZPYA 2DZKA 3SHQA 1A5RA 2FNJB 2ZVNA 2KKCA 3ML9A 4M0WB 2D2QA 4LJOB 4XC2A 3VUWA 3QK0A 3ZTCA 1WX8A 3U8ZA 4HCPB 5CHFA 1IPGA 2JZ3B 2Z0DB 4X57B 3SU8X 2LGXA 3A4SC 2BWFA 4TQ0A 3JSVB 3N30A 3ENEA 4W9EA 3H9DA 4GDLB 4IM0A 2KVRA 3ML8A 3WA0A 1AARA 4NQLB 2D07B 3NZSA 2KTRB 4MDKE 3MTNB 4NNJB 3DOWA 2L7RA 3DBHI 2KO3A 2LXCA 2N1WA 4MJSA 4RM9A 3WANA 3ONSA 2FUHB 3KUCB 3EHVA 3A9KB 4DK5A 1RLFA 1R4NI 5BO4B 1GC7A 4WQOB 3PTFC 2L05A 2MCNB 3ZO5B 1WE7A 2BYVE 2CHWA 4K7WA 2HD5B 1YX5B 1H4RA 4MSMB 3IBEA 4ANWA 1V6EA 3CMMB 4KSKC 2KFKA 1WM2A 1E8YA 1WY8A 3WAPA 2PEAA 4WWOA 2KWCA 4JIOU 1J0GA 4EZKA 2KJHB 2K8HA 4EKUA 1V81A 4ICVA 2JWZA 2MLBA 3ZNGC 3T9LA 2AEHA 2CHZA 4K7UA 2C7MB 3ALBA 1E5WA 3WALA 2D11A 3H7PA 3RULA 1I42A 3DBRI 4WJQA 4MJSB 3TL5A 1YIWA 1TBEA 4W9LA 1WMHA 1KM7A 3GZNI 2LJ5A 3N32A 4KVGB 4KV2A 2JT4B 2K25A 4WJOA 2N9XA 4II2B 3UIPB 1KLVA 2FCQA 4TKNA 1CMXB 4EUTA 1WXAA 1WF9A 2G4DB 5AZFA 2M1MA 3NY5A 2G45B 1KJTA 5CTRC 2K6QA 2ZEQA 4E74A 3VTWA 3A4RA 1X1MA 2KANA 3LJ3A 2KFKB 4GN1A 2GBMA 4BKSD 4BOSC 4IM3A 4WWPA 4WJPA 2KQ7A 2B3AA 3EFUA 3VTUA 3H7SA 4YL8A 2DZJA 2O6VD 3H1UA 2M0XA 2L8JA 3RZWC 2CKHB 1E90A 2DZIA 3H7PB 4OVVA 4G0NB 2BKRB 4FJVB 5C1ZA 1NBFC 2M4NA 2MBOA 2NR2A 4ICUA 5CX3A 4EZJA 1EF1A 1WMHB 1WXSA 2OOBB 2WX1A 3KVFB 4G3XB 4BKGA 4ZDVA 2XEWA 2NBUA 4ASWC 5JZEB 3H6NA 1V49A 2DHZA 4WAAA 3VQIA 1VD2A 2KC2A 3W1SA 2CR5A 2GMIC 2Z0EB 3P2BA 1UD7A 2XK5A 3PVLA 4HDQA 5CHVC 1JRUA 2PE6B 2W9NA 1V80A 4AP4C 1V86A 4F1SA 3NHEB 1YQBA 4P7IA 3ZW3A 1RFAA 3HM3A 3JYUA 1OEYJ 3A33B 3A9JA 5D6JB 3CF6E 1E7UA 3WIMA 4I6NB 4PS3A 3U30A 4DHZE 4FHKA 3B08A 4WJNA 3PRPB 2DX5B 1ZW7A 4NQKE 1WXVA 3IHPC 4GDLA 3WAMA 2C5LC 1YX6B 3QWZB 2M17A 4KDIC 2N1VA 4K1RB 2KWVB 3UQBA 1WJ6A 4E3CA 3CSTA 1WJ4A 2NBWB 3MHSD 2XK5B 4WWNA 3RUIB 4XX5A 4GSWA 2NBVB 2DYOA 2PJHA 3RCZA 1EUVB 1GC6A 2J0MA 2L76A 5C23A 3R7QA 2AL3A 5E6PA 4MELA 3QCAA 4PYUA 3ZRFA 4BBNC 2NVUI 3DBLI 3PS6A 3QQ8B 3WAOA 2V4LA 4AJYB 3QC8B 4KZ0A 2ASQA 4FHJA 1LFDA 2BWES 2L3ZA 4PS8A 1UBIA 2MBHA 2MBEA 3B1LX 2PE9A 2KDBA 5D2MB 3VUYA 4IUMB 2AYOB 2GBNA 3OJ4B 2J7QB 1V5OA 3C0RB 3PSEB 3TCAA 5LXHA 2KZRA 3PHXB 3HM6X 5E6NA 4EOYA 1GUAB 4M8NA 2KMCA 3APCA 5DCNA 4G11A 4KDLB 1R4MI 1P3QU 1P98A 2CHXA 4FJZA 3T8MA 3ZNHB 2KN5A 1IYFA 4MSQB 1WGDA 1S1QB 2ZNVB 3VVWB 5JHBA 3N3KB 3UIOB 4AUQC 1SGHA 3V6EB 2IO1B 5JHAA 3ZIMA 4EFOA 1V9JA 4I6LB 1YD8U 2K6DB 2JRIB 1V5TA 3O65B 2LVOA 3AULA 1WZ3A 5EDSA 1TGZB 2K1FA 4MGZE 3BINA 4XZ4A 1WFYA 2ZCBA 3VUXA 4RM8A 3DVNU 1E8XA 2FCMA 2A4ZA 2WX0A 3OJ3A 4PYZA 4EZLA 2RGFA 5G2NA 1ZGUB 3L54A 3UGBB 3ZTDA 3PLUA 3DDCB 3KUDB 5J18A 3ECIA 1WXMA 3U7DA 1TZ1A 5DPWA 5AEKB 1WGGA 2JRHA 3PV1A 1UELA 2KWUB 2ZJDA 4JLCA 3UF8A 2HJ8A 4GMVA 2N9EB 3V6CB 4DHJD 1NI2A 4HWIB 4BVUC 3APDA 3ZKJC 3K9OB 2R2QA 2KLCA 2ZVOA 4BKTA 4K81A 4J6IA 3QIJA 3HK0A 2MBBB 4MH0E 3VAWA 5J2RA 3HIZA 3DVGX 3QX1A 3Q3JA 3V61A 2N7EA 3M95A 2NCNA 2LGYA 3ZDMC 4F7ZA 2GOWA 1LM8B 2V1YA 3OAWA 4DDID 4BKSA 3AI5A 2JPHA 1WGYA 2O2VA 1U4AA 3TJPA 1IP9A 3VH3B 3DBSA 1G6JA 2JXXA 3ZDTA 4DWFA 2D3GA 3SDLC 2C9WB 2O6VA 2KJ6A 2MSED 4A20A 4LDTB 2C7NB 1C3TA 1WM3A 2LVQA 4GIVA 1WJNA 3PRMB 3GOEA 3VFKA 1WX7A 2I1KA 1Q1OA 4GXBA 2HE7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RT3 B;  3PPA A;  4ZYN A;  1FXT B;  5E6O A;  3SD5 A;  4HPL B;  2KK8 A;  2LI5 A;  2RR9 A;  3A1Q B;  3PLV A;  3RZF A;  2BPS A;  3AU5 A;  3S2A A;  2MP2 A;  1Y8R C;  1WE6 A;  1C1Y B;  3QAR A;  3ZRC A;  1E8W A;  4MM3 A;  2GBR A;  5HKH A;  2KHW B;  2D10 A;  2O2V B;  2ZPN A;  4GB9 A;  4KZC A;  5IAA C;  5J17 A;  4CO7 A;  1WH3 A;  2K39 A;  2LRU A;  2O6V B;  4FAD A;  4TUU A;  4ANU A;  3EC8 A;  4HK2 A;  1OEY A;  2I1J A;  2RPQ A;  1WIA A;  4MGI E;  2DYB A;  3PGE A;  4A3P A;  2FCN A;  2M8S A;  2C60 A;  1XD3 B;  3IFW B;  1EO6 A;  4W9D A;  1D3Z A;  1S3S G;  4G50 A;  4W9H A;  4W9F A;  2L0F A;  3OLM D;  2WDT B;  5DPR A;  4ZRK A;  2KD0 A;  3D32 A;  2LVP A;  3UQA A;  2GBK A;  1TTN A;  1V2Y A;  2LAS A;  3EEC A;  3PRE A;  3X23 A;  2MP2 B;  2L00 B;  4NY0 A;  3JVZ X;  2LUE A;  2DAF A;  4JL9 A;  3V62 A;  4FBJ B;  4CYE A;  2IBI B;  1WJU A;  3TIX A;  2LRW A;  3VDZ A;  4F8C B;  1WZ0 A;  2Y5B B;  3L08 A;  1KOT A;  2YVC A;  3RD2 A;  2KX3 A;  2ZZP B;  4DHZ B;  2OJR A;  2N7D A;  2KMA A;  2FAZ A;  4IM2 A;  2JY6 A;  2G3Q B;  2EMT A;  1F9J A;  5LLI A;  2WYQ A;  2KTF A;  2KOX A;  1RAX A;  3PZD A;  4KIK B;  3HHM A;  5AZH A;  4B9K A;  1OQY A;  1P0R A;  1SE9 A;  2KXJ A;  2K8C A;  5D94 A;  3V60 A;  1UBQ A;  2DAJ A;  4BBN F;  4HPM B;  1E7V A;  2J0K A;  4AWJ A;  1GG3 A;  3IG3 A;  3R3M A;  4FN2 A;  2BYE A;  4M8M A;  4MGY E;  2ZCC A;  2YLM A;  2DYM A;  2KC1 A;  5JH5 C;  2BGF A;  2GBJ A;  5L95 C;  4IWP A;  3ZNI D;  5GMV A;  4I6P A;  4NJ7 A;  2J0J A;  1GNU A;  4BFR A;  2IO2 B;  2FCS A;  3KYD D;  4IG7 B;  1M94 A;  2DZM A;  1WGH A;  3ZNZ B;  3K9P B;  1UH6 A;  4DDG D;  3ZVV A;  3RYT A;  2NPT A;  3B0A A;  2R2O A;  3KW5 B;  2IY1 B;  5AZG A;  2IZV B;  1L7Y A;  1I35 A;  2DEN B;  2KJR A;  3L0W B;  1MG8 A;  4IW0 A;  2AWT A;  1WRD B;  3W1S C;  4W9J A;  2IYD B;  1YJ1 A;  2KDF B;  3W1Y A;  4E71 A;  4FJY A;  4LCD E;  4LJP B;  4KSL C;  1WGR A;  2BKF A;  3MJW A;  3KUZ A;  4AJW A;  4DBG A;  1WI0 A;  3TMP B;  2MBQ A;  2WWZ A;  3LDZ E;  2LD9 A;  1OTR B;  4LDT D;  2UWQ A;  4K7S A;  5DPT A;  4HLE A;  2XBB C;  1Z5S B;  3Q3F A;  4W9G A;  3TBL D;  3M63 B;  2JZZ A;  2MQJ A;  4GOC A;  4GU2 A;  1L2N A;  1HE8 A;  3A1Q A;  1P9D U;  5CHW A;  4ZRI A;  3UIN B;  2KNB A;  3DVN V;  1QZE A;  1RRB A;  3DCG A;  4ZRJ A;  2FIF A;  4FUL A;  2CU1 A;  3AU4 A;  2PPH A;  4RMA A;  2KX0 A;  3BY4 B;  2KQS A;  2NPT B;  2N4F A;  3QHT A;  4BOZ B;  2A5U A;  2LGD A;  1ZKH A;  3QJZ A;  4NJ6 A;  2KDE B;  1XT9 B;  2IY0 B;  5D7G A;  3IVF A;  4W9I A;  2LWP A;  4N9F 4;  2RSU A;  2KFJ A;  3APF A;  3PHW B;  4NAW A;  3I3T B;  1VCB A;  4W9C A;  1Q0W B;  4B6W A;  3PT2 B;  3AXC A;  1P1A A;  3R66 C;  4HJK A;  3R7R A;  3M3J A;  1GJZ A;  4DXA B;  4II3 B;  1J8C A;  1Q5W B;  4HCN B;  1LQB A;  2ZNV C;  3KYC D;  3CSF A;  3M62 B;  3L16 A;  4JQW C;  1LXD A;  2MW5 A;  3NS8 A;  1K8R B;  4W9K A;  5KHO A;  3VXW A;  3NOB A;  4FLH A;  2MX2 A;  4DHJ B;  4TQ1 A;  3L10 B;  2C7H A;  1OGW A;  2KDI A;  3PRZ A;  4TV3 A;  1WR6 E;  2N9P C;  1J19 A;  1WX9 A;  3KH0 A;  2JF5 A;  4GDK A;  2LZ6 A;  4PS7 A;  5TR5 A;  4EEW A;  1EF5 A;  1SIF A;  3DVG Y;  2G4S A;  2CS4 A;  2VRR B;  4IWQ A;  5FR6 A;  4ANX A;  4GGQ A;  2REX A;  2Z59 B;  3JW0 X;  4A3O A;  2AL6 A;  3ZUN A;  2QHO A;  3L13 A;  4OVU A;  2K8B A;  4NAW B;  4HXD A;  1WR1 A;  3NZU A;  1H8C A;  5G55 A;  4AOF A;  2UYZ B;  1E8Z A;  2V3S A;  2EKE C;  3DQV A;  1NDD A;  2MA9 B;  2BYF A;  1Z2M A;  2LXA A;  2NS5 A;  4B95 A;  4KIK A;  2FID A;  3QA8 A;  4URK A;  5KHQ A;  4HVB A;  2L0T A;  4IWO A;  4NPN A;  4IC7 B;  1T0Y A;  4MEM A;  2MRP A;  2RD0 A;  4FA6 A;  3JSV A;  2BF8 B;  2HTH A;  2IO0 B;  4CHK A;  3VHT C;  1UGM A;  2KTR A;  4HDO A;  4GDK B;  4JGH B;  2MWS B;  5L83 A;  5DPS A;  1BT0 A;  2KLG A;  3VH4 B;  1UZX B;  4MGK E;  1PQS A;  3VTV A;  1WYW B;  3QAQ A;  5LXI B;  1XQQ A;  2JVC A;  1ISN A;  2EMS A;  4ANV A;  3ZLZ A;  5IA7 A;  2IO3 B;  3X0W A;  3A9K A;  3A9J B;  3L17 A;  2JUO A;  3DPD A;  2ZPY A;  2DZK A;  3SHQ A;  1A5R A;  2FNJ B;  2ZVN A;  2KKC A;  3ML9 A;  4M0W B;  2D2Q A;  4LJO B;  4XC2 A;  3VUW A;  3QK0 A;  3ZTC A;  1WX8 A;  3U8Z A;  4HCP B;  5CHF A;  1IPG A;  2JZ3 B;  2Z0D B;  4X57 B;  3SU8 X;  2LGX A;  3A4S C;  2BWF A;  4TQ0 A;  3JSV B;  3N30 A;  3ENE A;  4W9E A;  3H9D A;  4GDL B;  4IM0 A;  2KVR A;  3ML8 A;  3WA0 A;  1AAR A;  4NQL B;  2D07 B;  3NZS A;  2KTR B;  4MDK E;  3MTN B;  4NNJ B;  3DOW A;  2L7R A;  3DBH I;  2KO3 A;  2LXC A;  2N1W A;  4MJS A;  4RM9 A;  3WAN A;  3ONS A;  2FUH B;  3KUC B;  3EHV A;  3A9K B;  4DK5 A;  1RLF A;  1R4N I;  5BO4 B;  1GC7 A;  4WQO B;  3PTF C;  2L05 A;  2MCN B;  3ZO5 B;  1WE7 A;  2BYV E;  2CHW A;  4K7W A;  2HD5 B;  1YX5 B;  1H4R A;  4MSM B;  3IBE A;  4ANW A;  1V6E A;  3CMM B;  4KSK C;  2KFK A;  1WM2 A;  1E8Y A;  1WY8 A;  3WAP A;  2PEA A;  4WWO A;  2KWC A;  4JIO U;  1J0G A;  4EZK A;  2KJH B;  2K8H A;  4EKU A;  1V81 A;  4ICV A;  2JWZ A;  2MLB A;  3ZNG C;  3T9L A;  2AEH A;  2CHZ A;  4K7U A;  2C7M B;  3ALB A;  1E5W A;  3WAL A;  2D11 A;  3H7P A;  3RUL A;  1I42 A;  3DBR I;  4WJQ A;  4MJS B;  3TL5 A;  1YIW A;  1TBE A;  4W9L A;  1WMH A;  1KM7 A;  3GZN I;  2LJ5 A;  3N32 A;  4KVG B;  4KV2 A;  2JT4 B;  2K25 A;  4WJO A;  2N9X A;  4II2 B;  3UIP B;  1KLV A;  2FCQ A;  4TKN A;  1CMX B;  4EUT A;  1WXA A;  1WF9 A;  2G4D B;  5AZF A;  2M1M A;  3NY5 A;  2G45 B;  1KJT A;  5CTR C;  2K6Q A;  2ZEQ A;  4E74 A;  3VTW A;  3A4R A;  1X1M A;  2KAN A;  3LJ3 A;  2KFK B;  4GN1 A;  2GBM A;  4BKS D;  4BOS C;  4IM3 A;  4WWP A;  4WJP A;  2KQ7 A;  2B3A A;  3EFU A;  3VTU A;  3H7S A;  4YL8 A;  2DZJ A;  2O6V D;  3H1U A;  2M0X A;  2L8J A;  3RZW C;  2CKH B;  1E90 A;  2DZI A;  3H7P B;  4OVV A;  4G0N B;  2BKR B;  4FJV B;  5C1Z A;  1NBF C;  2M4N A;  2MBO A;  2NR2 A;  4ICU A;  5CX3 A;  4EZJ A;  1EF1 A;  1WMH B;  1WXS A;  2OOB B;  2WX1 A;  3KVF B;  4G3X B;  4BKG A;  4ZDV A;  2XEW A;  2NBU A;  4ASW C;  5JZE B;  3H6N A;  1V49 A;  2DHZ A;  4WAA A;  3VQI A;  1VD2 A;  2KC2 A;  3W1S A;  2CR5 A;  2GMI C;  2Z0E B;  3P2B A;  1UD7 A;  2XK5 A;  3PVL A;  4HDQ A;  5CHV C;  1JRU A;  2PE6 B;  2W9N A;  1V80 A;  4AP4 C;  1V86 A;  4F1S A;  3NHE B;  1YQB A;  4P7I A;  3ZW3 A;  1RFA A;  3HM3 A;  3JYU A;  1OEY J;  3A33 B;  3A9J A;  5D6J B;  3CF6 E;  1E7U A;  3WIM A;  4I6N B;  4PS3 A;  3U30 A;  4DHZ E;  4FHK A;  3B08 A;  4WJN A;  3PRP B;  2DX5 B;  1ZW7 A;  4NQK E;  1WXV A;  3IHP C;  4GDL A;  3WAM A;  2C5L C;  1YX6 B;  3QWZ B;  2M17 A;  4KDI C;  2N1V A;  4K1R B;  2KWV B;  3UQB A;  1WJ6 A;  4E3C A;  3CST A;  1WJ4 A;  2NBW B;  3MHS D;  2XK5 B;  4WWN A;  3RUI B;  4XX5 A;  4GSW A;  2NBV B;  2DYO A;  2PJH A;  3RCZ A;  1EUV B;  1GC6 A;  2J0M A;  2L76 A;  5C23 A;  3R7Q A;  2AL3 A;  5E6P A;  4MEL A;  3QCA A;  4PYU A;  3ZRF A;  4BBN C;  2NVU I;  3DBL I;  3PS6 A;  3QQ8 B;  3WAO A;  2V4L A;  4AJY B;  3QC8 B;  4KZ0 A;  2ASQ A;  4FHJ A;  1LFD A;  2BWE S;  2L3Z A;  4PS8 A;  1UBI A;  2MBH A;  2MBE A;  3B1L X;  2PE9 A;  2KDB A;  5D2M B;  3VUY A;  4IUM B;  2AYO B;  2GBN A;  3OJ4 B;  2J7Q B;  1V5O A;  3C0R B;  3PSE B;  3TCA A;  5LXH A;  2KZR A;  3PHX B;  3HM6 X;  5E6N A;  4EOY A;  1GUA B;  4M8N A;  2KMC A;  3APC A;  5DCN A;  4G11 A;  4KDL B;  1R4M I;  1P3Q U;  1P98 A;  2CHX A;  4FJZ A;  3T8M A;  3ZNH B;  2KN5 A;  1IYF A;  4MSQ B;  1WGD A;  1S1Q B;  2ZNV B;  3VVW B;  5JHB A;  3N3K B;  3UIO B;  4AUQ C;  1SGH A;  3V6E B;  2IO1 B;  5JHA A;  3ZIM A;  4EFO A;  1V9J A;  4I6L B;  1YD8 U;  2K6D B;  2JRI B;  1V5T A;  3O65 B;  2LVO A;  3AUL A;  1WZ3 A;  5EDS A;  1TGZ B;  2K1F A;  4MGZ E;  3BIN A;  4XZ4 A;  1WFY A;  2ZCB A;  3VUX A;  4RM8 A;  3DVN U;  1E8X A;  2FCM A;  2A4Z A;  2WX0 A;  3OJ3 A;  4PYZ A;  4EZL A;  2RGF A;  5G2N A;  1ZGU B;  3L54 A;  3UGB B;  3ZTD A;  3PLU A;  3DDC B;  3KUD B;  5J18 A;  3ECI A;  1WXM A;  3U7D A;  1TZ1 A;  5DPW A;  5AEK B;  1WGG A;  2JRH A;  3PV1 A;  1UEL A;  2KWU B;  2ZJD A;  4JLC A;  3UF8 A;  2HJ8 A;  4GMV A;  2N9E B;  3V6C B;  4DHJ D;  1NI2 A;  4HWI B;  4BVU C;  3APD A;  3ZKJ C;  3K9O B;  2R2Q A;  2KLC A;  2ZVO A;  4BKT A;  4K81 A;  4J6I A;  3QIJ A;  3HK0 A;  2MBB B;  4MH0 E;  3VAW A;  5J2R A;  3HIZ A;  3DVG X;  3QX1 A;  3Q3J A;  3V61 A;  2N7E A;  3M95 A;  2NCN A;  2LGY A;  3ZDM C;  4F7Z A;  2GOW A;  1LM8 B;  2V1Y A;  3OAW A;  4DDI D;  4BKS A;  3AI5 A;  2JPH A;  1WGY A;  2O2V A;  1U4A A;  3TJP A;  1IP9 A;  3VH3 B;  3DBS A;  1G6J A;  2JXX A;  3ZDT A;  4DWF A;  2D3G A;  3SDL C;  2C9W B;  2O6V A;  2KJ6 A;  2MSE D;  4A20 A;  4LDT B;  2C7N B;  1C3T A;  1WM3 A;  2LVQ A;  4GIV A;  1WJN A;  3PRM B;  3GOE A;  3VFK A;  1WX7 A;  2I1K A;  1Q1O A;  4GXB A;  2HE7 A; 
#chains in the Genus database with same CATH topology
 3RT3 B;  3PPA A;  2MHJ A;  5E6O A;  4HPL B;  3A1Q B;  2BPS A;  2MP2 A;  3QAR A;  2Z8L A;  1E8W A;  4MM3 A;  2D10 A;  4GB9 A;  3AE1 B;  4CO7 A;  1WH3 A;  1NI3 A;  2K39 A;  4RF0 A;  3CWI A;  2DYB A;  2FCN A;  1XXG A;  2LFI A;  4N59 A;  1XD3 B;  4W9D A;  1EO6 A;  1T0R C;  1WGK A;  1QOF A;  4ZYS A;  1D3Z A;  4G50 A;  4W9F A;  2L0F A;  2WDT B;  2PIA A;  1TS5 A;  2GLS A;  2LVP A;  3Q6B A;  4OVZ A;  3UQA A;  2LAS A;  3BK1 A;  3IT4 B;  3EEC A;  3PRE A;  3X23 A;  4NY0 A;  1SF0 A;  2LUE A;  4KKI A;  4CYE A;  2JYT A;  4F8C B;  4JE3 B;  2Y5B B;  3L08 A;  1V97 A;  5IKC M;  2KWD A;  4DHZ B;  3RNA C;  2G3Q B;  2D5G A;  4IKG A;  2NTT A;  1JAL A;  2LHD A;  1I4Q A;  5AZH A;  2KXJ A;  4HPM B;  2J0K A;  2J53 A;  4M8M A;  4NZL B;  1QLB B;  5GMV A;  1MFW A;  4BFR A;  2FCS A;  2K0P A;  3BVZ A;  3AEF B;  5FR3 A;  3K9P B;  3ZVV A;  3RYT A;  5EE0 A;  3L0W B;  1F0Z A;  3W1Y A;  5T8I A;  4LCD E;  4KSL C;  2BKF A;  3MJW A;  4AJW A;  4DBG A;  1WI0 A;  3LDZ E;  4LDT D;  4OW0 A;  5DPT A;  4DQO C;  4HLE A;  1Z5S B;  3M63 B;  2JZZ A;  4GU2 A;  3A1Q A;  1YN3 A;  4FXC A;  1YMH E;  3DCG A;  4ZRJ A;  4FUL A;  3ZXR A;  1K50 A;  3QHT A;  4BOZ B;  4ZOH C;  2N7J A;  1P7E A;  4HPP A;  4YT0 B;  1XT9 B;  1FNV A;  2LWP A;  3I3T B;  5IP4 D;  3AXC A;  3V05 A;  1KF6 B;  2WU2 B;  4II3 B;  1V8C A;  4HCN B;  1LQB A;  5KHO A;  2V3P A;  3Q8A A;  2MX2 A;  3L10 B;  1OGW A;  1ROE A;  2W3S A;  1YN4 A;  3KH0 A;  2LZ6 A;  4PS7 A;  1KTK A;  1EF5 A;  1SIF A;  3DVG Y;  2CS4 A;  4GGQ A;  1SEB D;  1YQ3 B;  2Z59 B;  2AL6 A;  5HI1 A;  2K8B A;  2N9L A;  4N58 A;  5G55 A;  4AOF A;  3AB5 A;  1E8Z A;  1ZUD 2;  2V3S A;  3LXF A;  1TS2 A;  2BYF A;  2LXA A;  3NVY A;  4KKJ A;  3I63 C;  2LUM A;  4NPN A;  2MRP A;  3N1X C;  2RD0 A;  3AEB B;  2PVO D;  3JSV A;  2L1A A;  2HTH A;  5IOI A;  1EM7 A;  2LGS A;  2KTR A;  4JGH B;  1PYW D;  4GDK B;  4MT5 A;  5DPS A;  4REZ A;  3VH4 B;  2HJ1 A;  1UZX B;  2LGI A;  3QAQ A;  1HXY D;  2IO3 B;  3X0W A;  3DPD A;  1A5R A;  2FNJ B;  5D3I B;  3ML9 A;  4M0W B;  1V1O A;  2WXG A;  5CHF A;  1IPG A;  2QMT A;  2Z0D B;  4P1B C;  1L5P A;  2LGX A;  4TQ0 A;  2BWF A;  3N9Y C;  3ENE A;  3BVG A;  2OHF A;  4NQL B;  2D07 B;  3MTN B;  2CJO A;  3ZXV A;  2KO3 A;  2G1E A;  2LXC A;  1CZP A;  3A9K B;  3P4S B;  1R4N I;  4C4V B;  4KGR A;  1MVK A;  3PTF C;  3UI3 A;  1TKG A;  2HD5 B;  4MSM B;  1J7B A;  1V6E A;  2ON8 A;  3SFE B;  1E9M A;  3L4P A;  1BML C;  1N60 A;  4ARC A;  2W55 A;  4EKU A;  2PKO A;  1T6B X;  2JWZ A;  2CHZ A;  4K7U A;  3Q3N C;  4MJS B;  3TL5 A;  3NVZ A;  1YIW A;  2GB1 A;  4W9L A;  1FIQ A;  3GZN I;  4PK1 A;  2LJ5 A;  2JT4 B;  4ACF A;  4II2 B;  2IND C;  4L23 A;  2RPV A;  4B0M A;  2QSD A;  1WF9 A;  2G4D B;  2M1M A;  3FIL A;  1NEK B;  1UWX A;  1YJJ A;  2ONQ A;  4E74 A;  5LNK 1;  4IOI E;  3OG5 A;  2K22 A;  4WWP A;  1EU3 A;  3VRB B;  2DZJ A;  2O6V D;  3U2S C;  1E90 A;  2DZI A;  3H7P B;  4G0N B;  4R3D A;  4DXG A;  2M4N A;  2MBO A;  2NR2 A;  1DOX A;  1WXS A;  4XDC A;  1QF6 A;  2INC C;  1ZOY B;  2NBU A;  1PFD A;  4WAA A;  4NJC A;  3W1S A;  4HDQ A;  2Z0E B;  5CHV C;  3B2G A;  1C78 A;  3JYU A;  4HRO A;  1D5X C;  2JX5 A;  2SEB D;  3CF6 E;  3WIM A;  4HKQ A;  1C76 A;  4M0W A;  4ZRP A;  2LJI A;  1UNS A;  1WXV A;  3IHP C;  3WAM A;  2N1V A;  1HZ6 A;  1WJ6 A;  4P6V F;  2BS4 B;  4GSW A;  2NBV B;  2DYO A;  2L76 A;  3AE5 B;  3ZRF A;  1SE3 A;  3HVD A;  5FKA C;  4C4V A;  3TEW A;  2NVU I;  4FHJ A;  1UBI A;  1OQQ A;  2KDB A;  2GBN A;  3OJ4 B;  3TCA A;  3PHX B;  3NVW A;  1JWS D;  1GUA B;  4M8N A;  2VZK D;  1KLG D;  3J9C A;  1P98 A;  3T8M A;  3LB8 C;  1GPX A;  1FFU A;  1FCC C;  1S1Q B;  3AE8 B;  4Q2J A;  2DLB A;  1D4B A;  2H88 B;  3N3K B;  5H8Y E;  5JHB A;  4AUQ C;  3V6E B;  4EFO A;  1Y56 A;  2K6D B;  1V5T A;  2LVO A;  3P4P B;  5EDS A;  2K1F A;  3BIN A;  3RN9 C;  1RM6 C;  2ZCB A;  4RM8 A;  3DVN U;  2A4Z A;  3BWU D;  5G2N A;  5HG2 A;  2ZW1 A;  3ZTD A;  5J18 A;  1WXM A;  1R7S A;  2DBY A;  2DNF A;  1VR9 A;  3EFC A;  2PLP A;  4DHJ D;  1XCQ L;  2WS3 B;  1D5M C;  3P63 A;  2KLC A;  4BKT A;  4J6I A;  4MH0 E;  3VAW A;  2Y3A A;  3AMZ A;  1PGX A;  2ZW0 A;  3Q3J A;  1SXT A;  1TS4 A;  2GOW A;  2BS2 B;  2V1Y A;  1I7H A;  4DDI D;  5BMG A;  2JPH A;  1WGY A;  2O2V A;  3TJP A;  2OED A;  3VH3 B;  4DWF A;  4JWU C;  2D3G A;  3AED B;  2KJ6 A;  4A20 A;  3NG0 A;  2C7N B;  1WM3 A;  2L52 A;  1WJN A;  3SEB A;  1Y8R C;  5EE1 A;  1Q1O A;  3PZ7 A;  4ZYN A;  3PLV A;  2NTS A;  1WE6 A;  1R4M B;  3GE3 C;  5FK9 C;  2GBR A;  4YTP B;  1HQR D;  1EWC A;  3N1Z C;  4KZC A;  1IGD A;  3SFD B;  2R61 A;  2LRU A;  2O6V B;  4FAD A;  4LNK A;  1UF0 A;  2I1J A;  4MGI E;  1WIA A;  3O13 A;  3PGE A;  1AYF A;  4A3P A;  3P4Q B;  5C3J B;  1S3S G;  3ZJU A;  2QCZ A;  3OLM D;  4ZRK A;  1TTN A;  1V2Y A;  2MP2 B;  2IGD A;  3HVZ A;  3JVZ X;  4MM3 B;  3V62 A;  4FBJ B;  2WXF A;  4YSY B;  3VDZ A;  1TYG B;  1KOT A;  4B0E A;  3RD2 A;  2ZZP B;  2FUG 1;  2OJR A;  2N7D A;  2KMA A;  2JY6 A;  4XE0 A;  3DHG C;  2QJL A;  4KIK B;  3HHM A;  1YNT E;  2WLB A;  1P0R A;  4BBN F;  2K8C A;  1UBQ A;  4KGS A;  4MGY E;  4XGA B;  1M4V A;  4K3C A;  2DYM A;  4C7Z A;  2KC1 A;  5JH5 C;  5L95 C;  1WXQ A;  2YEP B;  3ZNI D;  3MFG A;  1GNU A;  4IG7 B;  2W3R A;  1SB3 C;  3ZNZ B;  1WWT A;  1UH6 A;  3KW5 B;  5AZG A;  1L7Y A;  1FEH A;  2KJR A;  3I57 A;  3U52 E;  3T3N A;  5BMH A;  3R8B A;  3AE3 B;  2KDF B;  4E71 A;  2AQ2 B;  4LJP B;  2VZK B;  3KUZ A;  1I4H A;  4HEA 1;  3Q3F A;  3TBL D;  1L2N A;  1HE8 A;  2WXH A;  3ZYY X;  2KNB A;  3DVN V;  1JCK B;  4HKZ E;  4RMA A;  2KX0 A;  3BY4 B;  4DXF A;  1WSP A;  2LGD A;  1VJK A;  2RSU A;  2PMV A;  3URY A;  2KFJ A;  3APF A;  3PHW B;  4NAW A;  3IT6 B;  4B6W A;  1IGC A;  2W82 A;  3R7R A;  3M3J A;  1GJZ A;  1J8C A;  4OZA A;  2UU7 A;  2ZNV C;  3Q8C A;  3CSF A;  4M02 A;  2MW5 A;  3NS8 A;  4W9K A;  3AV8 A;  4DHJ B;  2C7H A;  1SJE D;  3PRZ A;  1WR6 E;  1MHX A;  3AE2 B;  1WX9 A;  1YQ4 B;  5TR5 A;  1K52 A;  4IWQ A;  2G4S A;  4ANX A;  1JQ4 A;  3TEX A;  4HJG E;  2I2Y A;  3ZUN A;  2QHO A;  2J42 A;  1WR1 A;  3NZU A;  1H8C A;  3B2F A;  3DHI C;  3Q14 C;  2J4X A;  3PO0 A;  1Z2M A;  1BUI C;  4KIK A;  2FID A;  3QA8 A;  4URK A;  2L0T A;  1JML A;  1T0Y A;  4IC7 B;  2CJN A;  4CHK A;  1WYG A;  3VHT C;  1UGM A;  4USA A;  2WXJ A;  1FCL A;  4MGK E;  1PQS A;  1VLB A;  2EMS A;  4ANV A;  5IA7 A;  3ZLZ A;  2JUO A;  4LJO B;  1RFK A;  2JQR B;  3ZTC A;  1HA5 A;  3AE4 B;  1ZDV A;  2JSV X;  3V3X A;  1YJI A;  4X57 B;  3SU8 X;  1YN5 A;  3JSV B;  2CU3 A;  1F52 A;  3N30 A;  4W9E A;  3H9D A;  2I38 A;  1KRH A;  3AE7 B;  4MDK E;  2KTR B;  2L7R A;  3DBH I;  5AUK A;  2N1W A;  4RM9 A;  3WAN A;  4WIP A;  1PUT A;  2GRI A;  2L05 A;  1WE7 A;  1YOV B;  1MPE A;  4K7W A;  3IBE A;  4KSK C;  2KFK A;  1WM2 A;  3WAP A;  2PEA A;  2KWC A;  1T0S C;  1P7F A;  2KJH B;  4EZK A;  2D3C A;  3BVM A;  1L6U A;  2C7M B;  3ALB A;  3WAL A;  2D11 A;  5I4D A;  4WJQ A;  3VR8 B;  4M00 A;  1WMH A;  4WJO A;  3BYY B;  2K25 A;  2WXP A;  2N9X A;  5C2T B;  3UIP B;  1KLV A;  2FCQ A;  4EUT A;  1CMX B;  3CIR B;  1WXA A;  2K3U A;  5CTR C;  2ZEQ A;  3A4R A;  2BTE A;  1BXT A;  3BYT B;  2GBM A;  4IM3 A;  4WJP A;  2M0X A;  1XEE A;  1FNU A;  2L8J A;  1ACC A;  2INN E;  4OVV A;  2EEL A;  2H89 B;  1EF1 A;  2WX1 A;  3MC9 A;  5HHD G;  2XEW A;  5JZE B;  3H6N A;  1V49 A;  2DHZ A;  3VQI A;  2CR5 A;  3P2B A;  1F2R C;  3DWG C;  3FIL B;  1SIJ A;  1V80 A;  3NUH B;  1V86 A;  4F1S A;  1YQB A;  4P7I A;  3A33 B;  5D6J B;  1E7U A;  4FHK A;  1GOZ A;  4WJN A;  4NQK E;  4RGN A;  1KFY B;  1YX6 B;  2QC8 A;  4K1R B;  2KWV B;  4LTU A;  1UUP A;  2NBW B;  3MHS D;  3MP9 A;  4XX5 A;  2V4I B;  2J0M A;  2IGH A;  3R7Q A;  1JWA D;  2AL3 A;  5E6P A;  1PDX A;  3AE9 B;  4RGM A;  3DBL I;  3QQ8 B;  4AJY B;  3KQ4 A;  3QC8 B;  1JWU D;  4PS8 A;  3DBR B;  2MBH A;  3OWE B;  1SSN A;  4GLS C;  3R2I A;  2AYO B;  3PSE B;  3PZ8 A;  5E6N A;  1CQV A;  2KMC A;  1R4M I;  3KLS X;  1HZ5 A;  4ARI A;  2JWU A;  2KN5 A;  1FXI A;  1V9J A;  1YD8 U;  2WXR A;  3AUL A;  1WZ3 A;  3ZJT A;  4MGZ E;  1SE4 A;  1T3Q A;  3VUX A;  1I4G A;  1E8X A;  1ZGU B;  3PLU A;  3ETR A;  3KUD B;  3ECI A;  3U7D A;  1TZ1 A;  5DPW A;  1F1H A;  5AEK B;  1HTO A;  3PV1 A;  2ZJD A;  1E0Z A;  1L4Z B;  1I4P A;  2L83 A;  4A6Q A;  1NI2 A;  3C19 A;  4H2A A;  5BYR A;  3APD A;  1AN8 A;  1VRA B;  1FM0 D;  2WDQ B;  3MC8 A;  3HK0 A;  4OZC A;  3HIZ A;  1ENF A;  2N7E A;  3M95 A;  3Q8F A;  2NCN A;  2LGY A;  2JXT A;  4WAF A;  2INP E;  1LM8 B;  4D2K A;  2LHE A;  3TEZ A;  1N5X A;  1G6J A;  3ZDT A;  2WP9 B;  3W2D A;  3SDL C;  2C9W B;  4LDT B;  2LVQ A;  4GIV A;  3PRM B;  3GOE A;  3TEY A;  4KDL B;  4N6E B;  1FXT B;  3SD5 A;  2KK8 A;  2LI5 A;  2RR9 A;  3AU5 A;  3S2A A;  4YXD B;  1C1Y B;  1N5W A;  3ZRC A;  4K3B A;  2MH7 A;  1TT5 B;  2O2V B;  1TJE A;  2IGG A;  2M0A A;  1WRI A;  2AQ1 B;  5J17 A;  4ANU A;  2BVC A;  3EC8 A;  1OEY A;  2RPQ A;  1ZE3 D;  2V3N A;  3Q8E A;  5E6J A;  1LGR A;  2KD0 A;  3D32 A;  2VH1 A;  1AW7 A;  4JL9 A;  2IBI B;  1C4P A;  1WZ0 A;  5EE9 A;  2WXQ A;  2BBC A;  3EUB 2;  3RNE C;  2KX3 A;  3GP7 A;  2EMT A;  2WXO A;  2KTF A;  2KOX A;  2B76 B;  1RAX A;  4B9K A;  1SE9 A;  5D94 A;  3V60 A;  2DAJ A;  1E7V A;  4AWJ A;  3NVV A;  1FXA A;  3IG3 A;  3R3M A;  4FN2 A;  2ICI A;  2BYE A;  4XDD A;  2ZCC A;  4AS1 A;  3EA6 A;  2YLM A;  4ITK A;  2GBJ A;  1MI0 A;  4I6P A;  4NJ7 A;  2J0J A;  1C4A A;  2JZP A;  1XLP A;  4ZHP A;  2IO2 B;  3KYD D;  2DZM A;  1WGH A;  1JW9 D;  3C8Y A;  2NPT A;  3B0A A;  1N61 A;  1I35 A;  2DEN B;  3RNB C;  1WRD B;  5JXV A;  1GB4 A;  1ZXH A;  2HDE A;  4FJY A;  3NZ3 A;  2MEK A;  2RMM A;  3TMP B;  1GB1 A;  2LD9 A;  2XBB C;  4W9G A;  1P9D U;  5CHW A;  2FIF A;  4S0R A;  2CU1 A;  3AU4 A;  4C80 A;  2A5U A;  3NJT A;  3BK2 A;  1L0Y B;  2KDE B;  1F2R I;  2W54 A;  5D7G A;  4C7Y A;  4L1B A;  4W9I A;  3WCQ A;  4N9F 4;  4P16 A;  1VCB A;  4W9C A;  3R66 C;  4HJK A;  4DXA B;  4JQW C;  3VXW A;  1LXD A;  1K8R B;  3NOB A;  4FLH A;  4TQ1 A;  3FKY A;  4RH6 A;  2M19 A;  1SJH D;  1MHH E;  2MJD A;  5FR6 A;  1IUE A;  1TZO A;  4OVU A;  4JWS C;  1STE A;  4NAW B;  3RNF C;  2UYZ B;  3DQV A;  2NS5 A;  5BMI A;  5KHQ A;  4IWO A;  3W5V B;  4MEM A;  4FA6 A;  3HUI A;  1GAQ B;  2IO0 B;  1R4N B;  2AQ3 B;  5L83 A;  3AE6 B;  1BT0 A;  2KLG A;  3VRA B;  3VTV A;  1XQQ A;  3A9J B;  4XWT A;  2ZPY A;  4ZRQ A;  3SHQ A;  2K5P A;  4BZA A;  2D2Q A;  3VUW A;  4XC2 A;  3VR9 B;  3QK0 A;  2BT6 A;  1WX8 A;  2WXI A;  4HCP B;  2JZ3 B;  3I9V 1;  3GZN B;  1IBX A;  3A4S C;  4GDL B;  2KVR A;  3ML8 A;  1WX7 A;  1AAR A;  3WA0 A;  3NZS A;  3BII D;  3DOW A;  4AQ7 A;  4YTM B;  2BW2 A;  1C9F A;  2Q5W D;  3KUC B;  1RLF A;  2TSS A;  5BO4 B;  1GC7 A;  4WQO B;  3ZO5 B;  2BYV E;  1FRD A;  1V1P A;  2CHW A;  1YX5 B;  4ANW A;  4LNN A;  1E8Y A;  1WY8 A;  4RF1 A;  4KX6 B;  4WWO A;  4JIO U;  2K8H A;  4P1C C;  1V81 A;  4ICV A;  2PVG C;  3T9L A;  1TKE A;  3RUL A;  3DBR I;  1TBE A;  4KV2 A;  1KM7 A;  4KVG B;  2RDG A;  5HFY A;  2QIL A;  1PGA A;  4TKN A;  5AZF A;  3NY5 A;  1E6E B;  3VTW A;  3R2T A;  1X1M A;  2KAN A;  3LJ3 A;  2KFK B;  4GN1 A;  1VDV A;  4BOS C;  3HRD D;  2KQ7 A;  2B3A A;  2AX5 A;  3VTU A;  3H7S A;  3W9C B;  5G5H A;  3RZW C;  4YSZ B;  3ZJV A;  5C1Z A;  4FJV B;  1ZDX A;  4ICU A;  5CX3 A;  1WMH B;  4G3X B;  2KVZ A;  2OOB B;  4BKG A;  4ZDV A;  3E9S A;  4ASW C;  4M01 A;  4QAY A;  1VD2 A;  2GMI C;  1UD7 A;  2XK5 A;  3PVL A;  2W9N A;  2FE8 A;  3HM3 A;  1OEY J;  3A9J A;  3EGR A;  4PT5 A;  1J7C A;  3U30 A;  4DHZ E;  1L0V B;  2BB5 A;  2MJ3 A;  4LNI A;  2LEK A;  3LYY A;  3PRP B;  4RGO S;  4GDL A;  3AEG B;  2KAJ A;  1N63 A;  3CST A;  1WJ4 A;  4S17 A;  4WWN A;  3RUI B;  3RCZ A;  2PJH A;  2DWQ A;  1EUV B;  5C23 A;  4PYU A;  4BBN C;  1K51 A;  4A90 A;  3GB1 A;  2ASQ A;  2BWE S;  2L3Z A;  1RYJ A;  2BS3 B;  3Q69 A;  4A9A A;  2MBE A;  2V9H A;  1FRR A;  1ET6 A;  5D2M B;  4IUM B;  3RMK C;  2WXL A;  4A55 A;  1V5O A;  2KZR A;  1CK1 A;  3IAS 1;  4EOY A;  3APC A;  1P3Q U;  3RI7 C;  2CHX A;  2PTL A;  3ZNH B;  1IYF A;  4MSQ B;  1WGD A;  2XN9 C;  5JHA A;  1E10 A;  3AEA B;  1B1Z A;  1DGJ A;  1J7A A;  1TGZ B;  4O1N A;  4XZ4 A;  1WFY A;  3MC0 B;  2N9K A;  2Y5C A;  2WX0 A;  2GI9 A;  2WHI A;  2RGF A;  1JRO A;  2JU6 X;  3UGB B;  1FMA D;  3DDC B;  4JX1 C;  2WXM A;  4TMA B;  4US8 A;  1WGG A;  2RDB C;  2IJ0 A;  2HJ8 A;  4GMV A;  4JPS A;  4HWI B;  1KLU D;  1XLQ A;  2E6X A;  3ZKJ C;  3K9O B;  4ZHO A;  2ZVO A;  1MG4 A;  1XCT L;  3QIJ A;  2MBB B;  5J2R A;  3DVG X;  5BYS A;  1DOI A;  3OAW A;  2KMM A;  3NRZ A;  4BKS A;  2N0S B;  2EKI A;  1IP9 A;  1U4A A;  3DBS A;  4A8X C;  4WH4 A;  3RNG C;  1FO4 A;  3P1M A;  4US9 A;  1KH0 A;  1C3T A;  1XO3 A;  3VFK A;  2RDH A;  2I1K A;  1FPY A;  4WUR A;  2HTM E;  4WQM A;  2BB6 A;  2BYT A;  3RZF A;  3Q2A C;  3U7Z A;  4BAX A;  2L32 A;  2PW9 A;  5HKH A;  2KHW B;  1PGB A;  2ZPN A;  3AM9 A;  2JYE A;  5IAA C;  3RNC C;  4TUU A;  2WU5 B;  3W5U B;  4HK2 A;  4MAC A;  2WQY B;  1L4D B;  2C60 A;  2M8S A;  3IFW B;  1AWD A;  1HEZ E;  1I4R A;  3TUO A;  4W9H A;  3SR6 A;  5DPR A;  2WNM A;  1NYQ A;  2GBK A;  1OFF A;  2L00 B;  2G9H D;  2V0G A;  3KWL A;  1QIL A;  3MJ5 A;  2DAF A;  5H92 C;  3ABV B;  2KAC A;  1C77 A;  2X38 A;  1WJU A;  3TIX A;  2LRW A;  1TIF A;  2YVC A;  3B9J A;  1HTQ A;  2FAZ A;  4IM2 A;  1UGJ A;  1F9J A;  5LLI A;  1UWM A;  2WYQ A;  3N20 C;  3PZD A;  3GE8 C;  1JWM D;  1OQY A;  1GG3 A;  4HRS A;  2K9X A;  3GS2 A;  1C4C A;  3MHZ A;  3N1Y C;  4WWM A;  2BGF A;  4IWP A;  1M94 A;  2D3B A;  1TKY A;  4DDG D;  3H8H A;  2R2O A;  2IY1 B;  2IZV B;  4YTN B;  1MG8 A;  4IW0 A;  2AWT A;  3W1S C;  4W9J A;  2IYD B;  1DOY A;  1YJ1 A;  4C56 C;  1TS3 A;  1XLN A;  3DWM A;  1WGR A;  2LMC A;  2MBQ A;  2WWZ A;  1OTR B;  2UWQ A;  4K7S A;  2MQJ A;  4GOC A;  4IDI A;  4ZRI A;  3UIN B;  3AEE B;  3I5J C;  1QZE A;  1RRB A;  2PPH A;  2MJE A;  2KQS A;  2NPT B;  2N4F A;  4C00 A;  1ZKH A;  3QJZ A;  4NJ6 A;  1L6V A;  2IY0 B;  3IVF A;  4UDU C;  1F77 A;  2NMQ A;  2WXN A;  1Q0W B;  3PT2 B;  1P1A A;  5IO9 A;  4YSX B;  3IXS A;  1Q5W B;  3KYC D;  3M62 B;  3L16 A;  2M56 B;  4XYC A;  2KDI A;  4TV3 A;  2QIE B;  2N9P C;  1J19 A;  4GDK A;  5BYQ A;  2JF5 A;  4EEW A;  4OZB A;  1SE2 A;  2FBW B;  2VRR B;  3AEC B;  1ZPS A;  2REX A;  4A3O A;  3JW0 X;  3L13 A;  5GXG B;  4HXD A;  1A70 A;  2EKE C;  1NDD A;  2MA9 B;  3DBH B;  4B95 A;  3RPF C;  4HVB A;  5G5G A;  3U4E G;  1MJD A;  2BF8 B;  3Q8B A;  4HDO A;  2MWS B;  2KT7 A;  1WYW B;  1EU4 A;  5LXI B;  2JVC A;  1ISN A;  3A9K A;  3L17 A;  2XNA C;  2DZK A;  2ZVN A;  2KKC A;  3P42 A;  1C79 A;  3U8Z A;  4KGT A;  3ZGZ A;  1VZ6 A;  4IM0 A;  1JRP A;  1QOA A;  4NNJ B;  3E56 A;  1ZP0 B;  2QDF A;  4MJS A;  3ONS A;  4LNF A;  5TSS A;  2FUH B;  3EHV A;  3NS1 A;  1JWB D;  4DK5 A;  1N6Z A;  4LLG M;  2MCN B;  3Q3M C;  2BQQ A;  1H4R A;  3CMM B;  5EE3 A;  2E3T A;  1IBX B;  2SAK A;  1J0G A;  4YWG G;  3ZQ4 A;  4LK0 M;  1D6E C;  2MLB A;  3ZNG C;  2AEH A;  1E5W A;  1NEN B;  3H7P A;  1I42 A;  1D5Z C;  3N32 A;  1TY2 A;  1L0X B;  1XF5 L;  2OJW A;  2VH2 A;  1T0Q C;  2G45 B;  1V1P B;  1KJT A;  2WXK A;  2K6Q A;  5AUI A;  4BKS D;  3T3O A;  1FD6 A;  1CJE A;  1DYQ A;  2WDV B;  1VZ8 A;  1ESF A;  2X8X X;  3EFU A;  4YL8 A;  1XLO A;  3H1U A;  2CKH B;  2BKR B;  3BZD B;  1NBF C;  2ACZ B;  4EZJ A;  1QQR A;  3KVF B;  3DBL B;  4OHJ A;  2KC2 A;  1I4X A;  1JRU A;  2PE6 B;  4AP4 C;  5MPO A;  3NHE B;  3ZW3 A;  1RFA A;  1QOG A;  3AH7 A;  2KDM A;  1Q10 A;  4I6N B;  4PS3 A;  1EWY C;  3IAM 1;  1QOB A;  3DHH C;  3B08 A;  2DX5 B;  1ZW7 A;  2C5L C;  2KN4 A;  3QWZ B;  2M17 A;  4KDI C;  5D3D A;  1RWS A;  1FFV A;  3UQB A;  1N62 A;  4E3C A;  1QT9 A;  3Q3O C;  2XK5 B;  2YEP F;  3FC4 A;  1GC6 A;  4L2Y A;  4RGT A;  4TSS A;  4MEL A;  3QCA A;  2IPK D;  3FAH A;  3PS6 A;  3WAO A;  2V4L A;  1FNW A;  5IN7 A;  4KZ0 A;  1LFD A;  4LNO A;  1T5X D;  2WGS A;  1LO5 D;  3B1L X;  1NYR A;  2PE9 A;  3VUY A;  2J7Q B;  3C0R B;  5LXH A;  1OQR A;  3HM6 X;  3RFZ B;  1ZXI A;  1TY0 A;  1K53 A;  5DCN A;  4G11 A;  1NVI D;  4FJZ A;  2ZNV B;  3VVW B;  4EE2 A;  1E7P B;  3UIO B;  1SGH A;  2IO1 B;  1SBB B;  2D3A A;  3ZIM A;  4I6L B;  2JRI B;  2IDY A;  2FCM A;  3OJ3 A;  2KQ4 X;  4PYZ A;  4J3O D;  4EZL A;  3L54 A;  1VZ7 A;  2JRH A;  1UEL A;  2KWU B;  4JLC A;  3UF8 A;  3V6C B;  2N9E B;  1B9R A;  1ET9 A;  4BVU C;  2R2Q A;  2WDR B;  3KWV A;  3TSS A;  1QKZ A;  4K81 A;  2KYW A;  4NAM A;  3QX1 A;  3V61 A;  2Y5P A;  3P4R B;  2QEJ C;  3ZDM C;  4F7Z A;  4RNA A;  4RCO A;  3AI5 A;  4MH8 A;  2JXX A;  4XWW A;  4RFB A;  2O6V A;  3AN1 A;  2MSE D;  2J52 A;  4CQN A;  3O65 B;  4GXB A;  2HE7 A; 
#chains in the Genus database with same CATH homology
 3RT3 B;  3PPA A;  4ZYN A;  1FXT B;  5E6O A;  3SD5 A;  4HPL B;  2KK8 A;  2LI5 A;  2RR9 A;  3A1Q B;  3PLV A;  3RZF A;  2BPS A;  3AU5 A;  3S2A A;  2MP2 A;  1Y8R C;  1WE6 A;  1C1Y B;  3QAR A;  3ZRC A;  1E8W A;  4MM3 A;  2GBR A;  5HKH A;  2KHW B;  2D10 A;  2O2V B;  2ZPN A;  4GB9 A;  4KZC A;  5IAA C;  5J17 A;  4CO7 A;  1WH3 A;  2K39 A;  2LRU A;  2O6V B;  4FAD A;  4TUU A;  4ANU A;  3EC8 A;  4HK2 A;  1OEY A;  2I1J A;  2RPQ A;  1WIA A;  4MGI E;  2DYB A;  3PGE A;  4A3P A;  2FCN A;  2M8S A;  2C60 A;  1XD3 B;  3IFW B;  1EO6 A;  4W9D A;  1D3Z A;  1S3S G;  4G50 A;  4W9H A;  4W9F A;  2L0F A;  3OLM D;  2WDT B;  5DPR A;  4ZRK A;  2KD0 A;  3D32 A;  2LVP A;  3UQA A;  2GBK A;  1TTN A;  1V2Y A;  2LAS A;  3EEC A;  3PRE A;  3X23 A;  2MP2 B;  2L00 B;  4NY0 A;  3JVZ X;  2LUE A;  2DAF A;  4JL9 A;  3V62 A;  4FBJ B;  4CYE A;  2IBI B;  1WJU A;  3TIX A;  2LRW A;  3VDZ A;  4F8C B;  1WZ0 A;  2Y5B B;  3L08 A;  1KOT A;  2YVC A;  3RD2 A;  2KX3 A;  2ZZP B;  4DHZ B;  2OJR A;  2N7D A;  2KMA A;  2FAZ A;  4IM2 A;  2JY6 A;  2G3Q B;  2EMT A;  1F9J A;  5LLI A;  2WYQ A;  2KTF A;  2KOX A;  1RAX A;  3PZD A;  4KIK B;  3HHM A;  5AZH A;  4B9K A;  1OQY A;  1P0R A;  1SE9 A;  2KXJ A;  2K8C A;  5D94 A;  3V60 A;  1UBQ A;  2DAJ A;  4BBN F;  4HPM B;  1E7V A;  2J0K A;  4AWJ A;  1GG3 A;  3IG3 A;  3R3M A;  4FN2 A;  2BYE A;  4M8M A;  4MGY E;  2ZCC A;  2YLM A;  2DYM A;  2KC1 A;  5JH5 C;  2BGF A;  2GBJ A;  5L95 C;  4IWP A;  3ZNI D;  5GMV A;  4I6P A;  4NJ7 A;  2J0J A;  1GNU A;  4BFR A;  2IO2 B;  2FCS A;  3KYD D;  4IG7 B;  1M94 A;  2DZM A;  1WGH A;  3ZNZ B;  3K9P B;  1UH6 A;  4DDG D;  3ZVV A;  3RYT A;  2NPT A;  3B0A A;  2R2O A;  3KW5 B;  2IY1 B;  5AZG A;  2IZV B;  1L7Y A;  1I35 A;  2DEN B;  2KJR A;  3L0W B;  1MG8 A;  4IW0 A;  2AWT A;  1WRD B;  3W1S C;  4W9J A;  2IYD B;  1YJ1 A;  2KDF B;  3W1Y A;  4E71 A;  4FJY A;  4LCD E;  4LJP B;  4KSL C;  1WGR A;  2BKF A;  3MJW A;  3KUZ A;  4AJW A;  4DBG A;  1WI0 A;  3TMP B;  2MBQ A;  2WWZ A;  3LDZ E;  2LD9 A;  1OTR B;  4LDT D;  2UWQ A;  4K7S A;  5DPT A;  4HLE A;  2XBB C;  1Z5S B;  3Q3F A;  4W9G A;  3TBL D;  3M63 B;  2JZZ A;  2MQJ A;  4GOC A;  4GU2 A;  1L2N A;  1HE8 A;  3A1Q A;  1P9D U;  5CHW A;  4ZRI A;  3UIN B;  2KNB A;  3DVN V;  1QZE A;  1RRB A;  3DCG A;  4ZRJ A;  2FIF A;  4FUL A;  2CU1 A;  3AU4 A;  2PPH A;  4RMA A;  2KX0 A;  3BY4 B;  2KQS A;  2NPT B;  2N4F A;  3QHT A;  4BOZ B;  2A5U A;  2LGD A;  1ZKH A;  3QJZ A;  4NJ6 A;  2KDE B;  1XT9 B;  2IY0 B;  5D7G A;  3IVF A;  4W9I A;  2LWP A;  4N9F 4;  2RSU A;  2KFJ A;  3APF A;  3PHW B;  4NAW A;  3I3T B;  1VCB A;  4W9C A;  1Q0W B;  4B6W A;  3PT2 B;  3AXC A;  1P1A A;  3R66 C;  4HJK A;  3R7R A;  3M3J A;  1GJZ A;  4DXA B;  4II3 B;  1J8C A;  1Q5W B;  4HCN B;  1LQB A;  2ZNV C;  3KYC D;  3CSF A;  3M62 B;  3L16 A;  4JQW C;  1LXD A;  2MW5 A;  3NS8 A;  1K8R B;  4W9K A;  5KHO A;  3VXW A;  3NOB A;  4FLH A;  2MX2 A;  4DHJ B;  4TQ1 A;  3L10 B;  2C7H A;  1OGW A;  2KDI A;  3PRZ A;  4TV3 A;  1WR6 E;  2N9P C;  1J19 A;  1WX9 A;  3KH0 A;  2JF5 A;  4GDK A;  2LZ6 A;  4PS7 A;  5TR5 A;  4EEW A;  1EF5 A;  1SIF A;  3DVG Y;  2G4S A;  2CS4 A;  2VRR B;  4IWQ A;  5FR6 A;  4ANX A;  4GGQ A;  2REX A;  2Z59 B;  3JW0 X;  4A3O A;  2AL6 A;  3ZUN A;  2QHO A;  3L13 A;  4OVU A;  2K8B A;  4NAW B;  4HXD A;  1WR1 A;  3NZU A;  1H8C A;  5G55 A;  4AOF A;  2UYZ B;  1E8Z A;  2V3S A;  2EKE C;  3DQV A;  1NDD A;  2MA9 B;  2BYF A;  1Z2M A;  2LXA A;  2NS5 A;  4B95 A;  4KIK A;  2FID A;  3QA8 A;  4URK A;  5KHQ A;  4HVB A;  2L0T A;  4IWO A;  4NPN A;  4IC7 B;  1T0Y A;  4MEM A;  2MRP A;  2RD0 A;  4FA6 A;  3JSV A;  2BF8 B;  2HTH A;  2IO0 B;  4CHK A;  3VHT C;  1UGM A;  2KTR A;  4HDO A;  4GDK B;  4JGH B;  2MWS B;  5L83 A;  5DPS A;  1BT0 A;  2KLG A;  3VH4 B;  1UZX B;  4MGK E;  1PQS A;  3VTV A;  1WYW B;  3QAQ A;  5LXI B;  1XQQ A;  2JVC A;  1ISN A;  2EMS A;  4ANV A;  3ZLZ A;  5IA7 A;  2IO3 B;  3X0W A;  3A9K A;  3A9J B;  3L17 A;  2JUO A;  3DPD A;  2ZPY A;  2DZK A;  3SHQ A;  1A5R A;  2FNJ B;  2ZVN A;  2KKC A;  3ML9 A;  4M0W B;  2D2Q A;  4LJO B;  4XC2 A;  3VUW A;  3QK0 A;  3ZTC A;  1WX8 A;  3U8Z A;  4HCP B;  5CHF A;  1IPG A;  2JZ3 B;  2Z0D B;  4X57 B;  3SU8 X;  2LGX A;  3A4S C;  2BWF A;  4TQ0 A;  3JSV B;  3N30 A;  3ENE A;  4W9E A;  3H9D A;  4GDL B;  4IM0 A;  2KVR A;  3ML8 A;  3WA0 A;  1AAR A;  4NQL B;  2D07 B;  3NZS A;  2KTR B;  4MDK E;  3MTN B;  4NNJ B;  3DOW A;  2L7R A;  3DBH I;  2KO3 A;  2LXC A;  2N1W A;  4MJS A;  4RM9 A;  3WAN A;  3ONS A;  2FUH B;  3KUC B;  3EHV A;  3A9K B;  4DK5 A;  1RLF A;  1R4N I;  5BO4 B;  1GC7 A;  4WQO B;  3PTF C;  2L05 A;  2MCN B;  3ZO5 B;  1WE7 A;  2BYV E;  2CHW A;  4K7W A;  2HD5 B;  1YX5 B;  1H4R A;  4MSM B;  3IBE A;  4ANW A;  1V6E A;  3CMM B;  4KSK C;  2KFK A;  1WM2 A;  1E8Y A;  1WY8 A;  3WAP A;  2PEA A;  4WWO A;  2KWC A;  4JIO U;  1J0G A;  4EZK A;  2KJH B;  2K8H A;  4EKU A;  1V81 A;  4ICV A;  2JWZ A;  2MLB A;  3ZNG C;  3T9L A;  2AEH A;  2CHZ A;  4K7U A;  2C7M B;  3ALB A;  1E5W A;  3WAL A;  2D11 A;  3H7P A;  3RUL A;  1I42 A;  3DBR I;  4WJQ A;  4MJS B;  3TL5 A;  1YIW A;  1TBE A;  4W9L A;  1WMH A;  1KM7 A;  3GZN I;  2LJ5 A;  3N32 A;  4KVG B;  4KV2 A;  2JT4 B;  2K25 A;  4WJO A;  2N9X A;  4II2 B;  3UIP B;  1KLV A;  2FCQ A;  4TKN A;  1CMX B;  4EUT A;  1WXA A;  1WF9 A;  2G4D B;  5AZF A;  2M1M A;  3NY5 A;  2G45 B;  1KJT A;  5CTR C;  2K6Q A;  2ZEQ A;  4E74 A;  3VTW A;  3A4R A;  1X1M A;  2KAN A;  3LJ3 A;  2KFK B;  4GN1 A;  2GBM A;  4BKS D;  4BOS C;  4IM3 A;  4WWP A;  4WJP A;  2KQ7 A;  2B3A A;  3EFU A;  3VTU A;  3H7S A;  4YL8 A;  2DZJ A;  2O6V D;  3H1U A;  2M0X A;  2L8J A;  3RZW C;  2CKH B;  1E90 A;  2DZI A;  3H7P B;  4OVV A;  4G0N B;  2BKR B;  4FJV B;  5C1Z A;  1NBF C;  2M4N A;  2MBO A;  2NR2 A;  4ICU A;  5CX3 A;  4EZJ A;  1EF1 A;  1WMH B;  1WXS A;  2OOB B;  2WX1 A;  3KVF B;  4G3X B;  4BKG A;  4ZDV A;  2XEW A;  2NBU A;  4ASW C;  5JZE B;  3H6N A;  1V49 A;  2DHZ A;  4WAA A;  3VQI A;  1VD2 A;  2KC2 A;  3W1S A;  2CR5 A;  2GMI C;  2Z0E B;  3P2B A;  1UD7 A;  2XK5 A;  3PVL A;  4HDQ A;  5CHV C;  1JRU A;  2PE6 B;  2W9N A;  1V80 A;  4AP4 C;  1V86 A;  4F1S A;  3NHE B;  1YQB A;  4P7I A;  3ZW3 A;  1RFA A;  3HM3 A;  3JYU A;  1OEY J;  3A33 B;  3A9J A;  5D6J B;  3CF6 E;  1E7U A;  3WIM A;  4I6N B;  4PS3 A;  3U30 A;  4DHZ E;  4FHK A;  3B08 A;  4WJN A;  3PRP B;  2DX5 B;  1ZW7 A;  4NQK E;  1WXV A;  3IHP C;  4GDL A;  3WAM A;  2C5L C;  1YX6 B;  3QWZ B;  2M17 A;  4KDI C;  2N1V A;  4K1R B;  2KWV B;  3UQB A;  1WJ6 A;  4E3C A;  3CST A;  1WJ4 A;  2NBW B;  3MHS D;  2XK5 B;  4WWN A;  3RUI B;  4XX5 A;  4GSW A;  2NBV B;  2DYO A;  2PJH A;  3RCZ A;  1EUV B;  1GC6 A;  2J0M A;  2L76 A;  5C23 A;  3R7Q A;  2AL3 A;  5E6P A;  4MEL A;  3QCA A;  4PYU A;  3ZRF A;  4BBN C;  2NVU I;  3DBL I;  3PS6 A;  3QQ8 B;  3WAO A;  2V4L A;  4AJY B;  3QC8 B;  4KZ0 A;  2ASQ A;  4FHJ A;  1LFD A;  2BWE S;  2L3Z A;  4PS8 A;  1UBI A;  2MBH A;  2MBE A;  3B1L X;  2PE9 A;  2KDB A;  5D2M B;  3VUY A;  4IUM B;  2AYO B;  2GBN A;  3OJ4 B;  2J7Q B;  1V5O A;  3C0R B;  3PSE B;  3TCA A;  5LXH A;  2KZR A;  3PHX B;  3HM6 X;  5E6N A;  4EOY A;  1GUA B;  4M8N A;  2KMC A;  3APC A;  5DCN A;  4G11 A;  4KDL B;  1R4M I;  1P3Q U;  1P98 A;  2CHX A;  4FJZ A;  3T8M A;  3ZNH B;  2KN5 A;  1IYF A;  4MSQ B;  1WGD A;  1S1Q B;  2ZNV B;  3VVW B;  5JHB A;  3N3K B;  3UIO B;  4AUQ C;  1SGH A;  3V6E B;  2IO1 B;  5JHA A;  3ZIM A;  4EFO A;  1V9J A;  4I6L B;  1YD8 U;  2K6D B;  2JRI B;  1V5T A;  3O65 B;  2LVO A;  3AUL A;  1WZ3 A;  5EDS A;  1TGZ B;  2K1F A;  4MGZ E;  3BIN A;  4XZ4 A;  1WFY A;  2ZCB A;  3VUX A;  4RM8 A;  3DVN U;  1E8X A;  2FCM A;  2A4Z A;  2WX0 A;  3OJ3 A;  4PYZ A;  4EZL A;  2RGF A;  5G2N A;  1ZGU B;  3L54 A;  3UGB B;  3ZTD A;  3PLU A;  3DDC B;  3KUD B;  5J18 A;  3ECI A;  1WXM A;  3U7D A;  1TZ1 A;  5DPW A;  5AEK B;  1WGG A;  2JRH A;  3PV1 A;  1UEL A;  2KWU B;  2ZJD A;  4JLC A;  3UF8 A;  2HJ8 A;  4GMV A;  2N9E B;  3V6C B;  4DHJ D;  1NI2 A;  4HWI B;  4BVU C;  3APD A;  3ZKJ C;  3K9O B;  2R2Q A;  2KLC A;  2ZVO A;  4BKT A;  4K81 A;  4J6I A;  3QIJ A;  3HK0 A;  2MBB B;  4MH0 E;  3VAW A;  5J2R A;  3HIZ A;  3DVG X;  3QX1 A;  3Q3J A;  3V61 A;  2N7E A;  3M95 A;  2NCN A;  2LGY A;  3ZDM C;  4F7Z A;  2GOW A;  1LM8 B;  2V1Y A;  3OAW A;  4DDI D;  4BKS A;  3AI5 A;  2JPH A;  1WGY A;  2O2V A;  1U4A A;  3TJP A;  1IP9 A;  3VH3 B;  3DBS A;  1G6J A;  2JXX A;  3ZDT A;  4DWF A;  2D3G A;  3SDL C;  2C9W B;  2O6V A;  2KJ6 A;  2MSE D;  4A20 A;  4LDT B;  2C7N B;  1C3T A;  1WM3 A;  2LVQ A;  4GIV A;  1WJN A;  3PRM B;  3GOE A;  3VFK A;  1WX7 A;  2I1K A;  1Q1O A;  4GXB A;  2HE7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...