2KZRA

Solution nmr structure of ubiquitin thioesterase otu1 (ec 3.1.2.-) from mus musculus, northeast structural genomics consortium target mmt2a
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
86
structure length
86
Chain Sequence
b'WRVRCKAKGGTHLLQGLSSRTRLRELQGQIAAITGIAPGSQRILVGYPPECLDLSDRDITLGDLPIQSGDMLIVEEDQTRPKASPS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin thioesterase OTU1
molecule tags Hydrolase
source organism Mus musculus
publication title Northeast Structural Genomics Consortium Target MmT2A
rcsb
total genus 13
structure length 86
sequence length 86
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2010-06-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2kzrA00
3QHTA 4W9HA 5DPRA 1D3ZA 1Z5SB 2WWZA 1OEYJ 1L2NA 1CMXB 3B1LX 2RD0A 3N32A 3R3MA 2R2OA 4GN1A 2KMCA 3PTFC 4JGHB 3VH4B 3ZTCA 1I42A 2CHZA 3N3KB 5AZGA 2KJRA 3RYTA 3TBLD 2KQ7A 2M8SA 4FLHA 4TUUA 2K6DB 2KX0A 1E7VA 4I6PA 4KIKA 1E8WA 1ZKHA 2KHWB 3VAWA 2D3GA 4GDLA 2CHWA 4WWOA 2N9PC 4ZRJA 4ZRKA 3AI5A 4HWIB 4F8CB 1UBIA 1UBQA 1ZW7A 3A4SC 4G11A 2IBIB 2R2QA 2Z0DB 4URKA 4MGYE 3ENEA 3HM6X 4EZJA 2L3ZA 1KJTA 2JUOA 2Z59B 3PRZA 2KWVB 3TCAA 5D94A 1PQSA 1WYWB 2FIFA 4BKGA 1X1MA 2GBRA 2MP2A 2DHZA 2KTFA 1WR1A 5E6NA 2L8JA 1EO6A 2M17A 4WAAA 3RULA 2BWFA 4II2B 2FCQA 4FN2A 3DVGX 2BWES 3APDA 4M8NA 5CHFA 4AJYB 2V3SA 1P1AA 3A9JB 4NJ6A 5JHBA 3ZUNA 2ZNVC 2L05A 3A4RA 1Q1OA 2GBMA 1WGRA 3PLVA 3P2BA 5JHAA 4F7ZA 1E8XA 4HCPB 4PYZA 3WAOA 4TQ0A 2KD0A 4II3B 1GJZA 3BY4B 2NBVB 3JSVA 4HDOA 1VCBA 2KC1A 2O6VB 1V9JA 4E71A 2KX3A 3CSTA 4EUTA 4K81A 3H9DA 3DVGY 3OJ4B 3H1UA 2N1VA 4P7IA 2KFKB 3ZKJC 1TZ1A 3PHXB 2A5UA 2FAZA 4BBNF 3B0AA 3HK0A 4W9KA 1TBEA 5L83A 2DZKA 2MCNB 3MJWA 1SE9A 5HKHA 1YX5B 4W9EA 4HK2A 3QWZB 2CS4A 2GBNA 3CSFA 4IUMB 1V5OA 3AU5A 1E8ZA 4RM8A 4EKUA 4MDKE 2JPHA 2LVPA 4E3CA 1WJ6A 2N4FA 3H7PB 4BVUC 3RD2A 3NS8A 4FHJA 3S2AA 4NQLB 2WX1A 3Q3JA 4W9DA 4W9GA 1WM2A 4GIVA 3VFKA 3LDZE 5D2MB 1C3TA 2YLMA 3QX1A 1WGGA 4DDGD 3PS6A 2GOWA 1Q0WB 2AEHA 3KUCB 4B9KA 4ANUA 1EUVB 2LGDA 3DBSA 3R66C 2MBOA 1J0GA 3L10B 1V49A 3DDCB 4MGZE 3RCZA 3I3TB 1WE7A 2K8CA 2DYMA 3WAMA 2MBQA 2JRHA 4I6LB 2I1JA 3PRPB 5LLIA 2BYVE 2AYOB 3L16A 3PHWB 1J8CA 4NPNA 3RUIB 1S1QB 3KH0A 4HCNB 3PLUA 4IW0A 4ANWA 3UIPB 1WZ0A 2KK8A 3VXWA 3A9KB 4DHJD 4NJ7A 1WGYA 1WX9A 2LRUA 2BGFA 1GUAB 2C7HA 1UZXB 4DK5A 2EKEC 1YIWA 4MJSA 2NPTA 4CHKA 2LASA 2JRIB 3C0RB 2HD5B 2ZCCA 4FJVB 4OVUA 3IG3A 5AZHA 2MW5A 2IO3B 1LFDA 3JW0X 4EEWA 5J17A 3UQAA 4HVBA 1HE8A 1SGHA 4W9CA 2MA9B 4IM0A 2ZJDA 2HJ8A 4KIKB 4G3XB 1WIAA 3VTVA 1WR6E 2DX5B 1Z2MA 2GMIC 2LWPA 5J18A 3CF6E 3A9KA 3UIOB 4EZKA 2KNBA 3M62B 1NI2A 4W9JA 2B3AA 1J19A 4M0WB 4LJPB 2FIDA 3APFA 3UF8A 4N9F4 2CR5A 4FADA 3IBEA 3M63B 3QK0A 2D10A 5GMVA 3X23A 1XT9B 3OAWA 1YX6B 1JRUA 2V1YA 2ZVOA 3PT2B 4WJPA 2MRPA 1MG8A 3APCA 3IHPC 2BKRB 4IC7B 4RMAA 2D2QA 4FBJB 3ALBA 2KOXA 1WXVA 2J0JA 2K8HA 4GMVA 2NPTB 3LJ3A 3WANA 1V80A 2KTRA 1LM8B 2ZVNA 4PS7A 3O65B 2LJ5A 4I6NB 2D11A 2L00B 3VUYA 2IO2B 3UINB 4DXAB 1E90A 1RFAA 4IM3A 3GZNI 2LGYA 3ML9A 3QIJA 3SU8X 3V6CB 2LVQA 3TIXA 3H7SA 4NAWA 4A20A 2ASQA 2RR9A 1P3QU 3A33B 4ICVA 1E7UA 1V5TA 1WGHA 4EZLA 2N9XA 2DZIA 4J6IA 5LXHA 2LZ6A 1GNUA 2LI5A 3PSEB 1M94A 5IAAC 4TV3A 3QAQA 3ZW3A 5LXIB 2KKCA 5JH5C 5BO4B 1G6JA 5KHQA 3VTUA 2O2VB 2DYBA 1QZEA 2K39A 2K6QA 4HJKA 4KVGB 4XC2A 3T9LA 2D07B 3N30A 2G3QB 4WJOA 5JZEB 2K8BA 3PREA 3DOWA 2KXJA 4GSWA 3NOBA 1ZGUB 4M8MA 2J0MA 2KO3A 3SD5A 4ANXA 4HPLB 3OJ3A 3QQ8B 2KJ6A 2XEWA 3PPAA 3VH3B 2VRRB 4KZCA 3IVFA 2DZMA 2NS5A 4ZRIA 4E74A 2C5LC 2UWQA 2JF5A 2LUEA 1WMHA 3ZTDA 4HPMB 3ZDMC 2PPHA 4FA6A 4MSMB 1GC7A 4F1SA 2MP2B 4MH0E 1WE6A 1RRBA 2G45B 2V4LA 2KFJA 1H8CA 1AARA 1XD3B 2LD9A 3HM3A 4PS3A 3ZVVA 2FNJB 2KQSA 2ZPYA 3VQIA 5CTRC 2IY1B 1GG3A 2LXCA 3V61A 5AEKB 4W9FA 2KLGA 2PE6B 3H7PA 3L13A 5DPTA 1RAXA 3DBRI 3DCGA 2KJHB 3DVNU 2O2VA 1UD7A 2G4SA 5DPSA 4AUQC 4BKTA 4LDTD 2K1FA 2N1WA 5G55A 3U7DA 2EMSA 2DENB 4NY0A 2JVCA 3T8MA 3V60A 1Q5WB 1WRDB 2DZJA 4FJYA 4KV2A 1NBFC 4GGQA 4MGIE 1UELA 3VDZA 2DYOA 3QCAA 2L76A 1OTRB 1WFYA 4B6WA 1IYFA 2KDEB 1R4NI 4JLCA 3ZLZA 1K8RB 1UGMA 4B95A 3AULA 3NY5A 4IWPA 1NDDA 1XQQA 3NZUA 1R4MI 2ZEQA 2REXA 4IWQA 4PYUA 3CMMB 5E6PA 5AZFA 3W1SA 2PJHA 3AXCA 4ZYNA 2KDIA 1WJNA 1WH3A 2O6VA 1ISNA 2C9WB 4GU2A 2KANA 2Z0EB 4KSLC 1TTNA 5FR6A 3RZFA 4NNJB 3VUXA 5D6JB 1BT0A 1C1YB 1OQYA 2BYFA 3WALA 4DDID 2JT4B 5L95C 5TR5A 1WF9A 3ZNHB 3WA0A 1I35A 4LDTB 3KYCD 4HXDA 3IFWB 1V6EA 3K9OB 3DPDA 3OLMD 3A9JA 5DCNA 3SHQA 4GOCA 2JZZA 3ZRCA 3JVZX 4JQWC 4NQKE 2I1KA 4BFRA 1KLVA 2MX2A 5KHOA 4WWPA 2RGFA 1V2YA 5C1ZA 2JY6A 2KDFB 2BKFA 5G2NA 3QC8B 2CHXA 3QA8A 2RSUA 4TKNA 3RT3B 4A3PA 2G4DB 3DBHI 1VD2A 2MBHA 2MWSB 1WJUA 1KOTA 3U8ZA 3PRMB 5CX3A 5J2RA 3KVFB 4GDKA 3R7RA 3WIMA 2A4ZA 2KDBA 4FJZA 3V6EB 2BPSA 2LGXA 3U30A 4MELA 1RLFA 2MSED 2LRWA 2LXAA 3KUDB 1OEYA 2K25A 3KW5B 2C7MB 4GXBA 2KFKA 4BKSA 4K7SA 4MJSB 2L7RA 2AL6A 3D32A 3VVWB 2QHOA 2M0XA 2AL3A 1YQBA 3AU4A 2PEAA 2EMTA 3HHMA 2KWCA 4PS8A 2NR2A 1FXTB 3MHSD 2HE7A 1F9JA 2CKHB 2OOBB 3L08A 4MGKE 1WXSA 2XBBC 3X0WA 1IPGA 1P98A 2KZRA 4HDQA 2FUHB 3MTNB 4JIOU 2KLCA 1P9DU 2JXXA 4BBNC 2XK5B 2L0FA 3B08A 3TJPA 3A1QA 3ZO5B 4GDLB 2O6VD 1A5RA 1GC6A 3UQBA 3ECIA 1WY8A 2DAJA 1SIFA 4FHKA 4XZ4A 4BKSD 1LXDA 2FCMA 3EECA 2KVRA 1WMHB 1WX8A 3ZIMA 4W9LA 3ZNGC 1T0YA 2NCNA 4DHZE 1IP9A 4GDKB 3K9PB 5CHWA 4ANVA 3GOEA 1H4RA 2KC2A 2IYDB 3EC8A 4MEMA 5IA7A 2XK5A 4BOZB 4AOFA 1WM3A 2FCNA 2FCSA 2GBJA 2M1MA 3EHVA 3JSVB 1WJ4A 3QJZA 2WYQA 2IZVB 2MQJA 5D7GA 2PE9A 3DVNV 4KZ0A 1LQBA 4LCDE 3VTWA 3R7QA 1E8YA 1L7YA 1V81A 2AWTA 4W9IA 3L54A 2NBWB 2NBUA 3ONSA 4ZDVA 4LJOB 1KM7A 1WX7A 2KTRB 3W1YA 3V62A 1TGZB 2J0KA 3ZRFA 3ZNZB 2W9NA 3KYDD 2JZ3B 2MBBB 2BYEA 4IWOA 4ASWC 3DBLI 4EFOA 2C60A 3PZDA 2IO0B 1WXMA 3SDLC 4JL9A 4HLEA 1WGDA 2J7QB 3PV1A 2MBEA 3HIZA 4MM3A 2DAFA 1U4AA 2KWUB 3A1QB 4FULA 5EDSA 4EOYA 4KDIC 2ZPNA 3PVLA 3QARA 4IG7B 1V86A 3NHEB 4G50A 5C23A 4AJWA 4GB9A 2IO1B 2M4NA 4CYEA 4DHJB 3W1SC 3ZNID 3L17A 3H6NA 3BINA 4CO7A 3ZDTA 4RM9A 1S3SG 1WI0A 2N7EA 3PGEA 2LVOA 4XX5A 4DHZB 4DWFA 3ML8A 4WQOB 3L0WB 2ZZPB 2L0TA 3M3JA 2ZNVB 2NVUI 2WX0A 1Y8RC 2C7NB 2GBKA 4TQ1A 4WJNA 3JYUA 1OGWA 1EF5A 2MLBA 5E6OA 4YL8A 3M95A 4NAWB 4OVVA 2WDTB 4KDLB 4KSKC 2N7DA 3Q3FA 1EF1A 4X57B 4K7WA 3VHTC 2UYZB 2CU1A 3KUZA 4IM2A 2YVCA 3UGBB 4MSQB 3EFUA 4BOSC 1E5WA 2KN5A 2N9EB 2KMAA 2JWZA 4WJQA 4A3OA 5DPWA 4G0NB 1P0RA 3NZSA 4K7UA 3VUWA 3TL5A 4AP4C 4WWNA 1UH6A 5CHVC 1YJ1A 4ICUA 2HTHA 3RZWC 3TMPB 1WXAA 3DQVA 2IY0B 2RPQA 3WAPA 4K1RB 2OJRA 2ZCBA 4AWJA 2Y5BB 4DBGA 1YD8U 2BF8B 1WZ3A
chains in the Genus database with same CATH superfamily
3QHTA 3ETRA 4W9HA 2G9HD 1Z5SB 2WWZA 1Y56A 2MEKA 2RD0A 3N32A 5HI1A 2KMCA 4P1BC 4JGHB 5AZGA 2KJRA 1JQ4A 4FLHA 1E10A 4TUUA 4HJGE 3N9YC 3DHHC 4WWOA 1RFKA 3U4EG 1NENB 4OZCA 4ZRKA 2IBIB 4EZJA 1KJTA 3AE7B 1PQSA 1WYWB 2FIFA 4RNAA 1ET9A 1X1MA 4YTNB 2GBRA 2DHZA 2L8JA 2M17A 1TT5B 3RULA 2BWFA 2FCQA 1TS5A 3MP9A 2WHIA 3FAHA 1V1OA 2K3UA 4AJYB 2V3SA 1VJKA 2ONQA 1GOZA 5JHAA 1OFFA 4PYZA 2MHJA 1GJZA 2HDEA 1AN8A 4NZLB 4S0RA 3TSSA 1V9JA 2BW2A 3CSTA 4EUTA 4NJCA 3H1UA 1P7FA 3ZKJC 2OHFA 3PHXB 2A5UA 4W9KA 4M01A 1TBEA 2RDHA 3BIID 5L83A 2DZKA 2MCNB 1KLUD 3VR8B 2OJWA 1NI3A 1P7EA 5HKHA 3QWZB 2GBNA 4IUMB 3AU5A 3BZDB 4RM8A 2V4IB 1E6EB 1R4NB 4MDKE 1HTQA 2WXHA 4ZOHC 2WDQB 3VR9B 3H7PB 4BVUC 1K53A 2V9HA 3NS8A 4FHJA 3CIRB 4NQLB 3HUIA 4GIVA 1C3TA 3PS6A 1Q0WB 1EUVB 3R66C 2MBOA 1F2RI 3AE3B 4MGZE 3DDCB 2DNFA 1TY2A 1WE7A 3WAMA 2JRHA 1HA5A 3I9V1 3PRPB 5LLIA 5H8YE 3PHWB 1J8CA 1L0VB 3RUIB 4IDIA 3AEFB 3B2GA 3UIPB 3VRBB 3VXWA 3Q6BA 2LRUA 2BGFA 1UZXB 2QC8A 2RDGA 1FPYA 2LASA 3NZ3A 4L23A 1R7SA 4OVUA 2MW5A 2IO3B 3UQAA 4W9CA 2E3TA 1Q10A 1PGAA 2LWPA 1Z2MA 2HTME 2KQ4X 1UWMA 2B3AA 4LJPB 3UF8A 1MVKA 2CR5A 4HRSA 4FADA 3IBEA 4XDDA 1OQRA 2YEPF 1T3QA 1YX6B 1XEEA 3APCA 4IC7B 5EE1A 3NVVA 4FBJB 1PGBA 2KOXA 2K8HA 3EGRA 3AE5B 4C4VB 2KTRA 4US9A 2W3RA 2IO2B 1E90A 4IM3A 3GZNI 4RH6A 2EELA 2E6XA 2ASQA 1V5TA 4HKQA 1GNUA 2LI5A 2X38A 4TV3A 3ZW3A 4HJKA 3T9LA 2K6QA 2KACA 4XC2A 2D07B 1KF6B 2PKOA 2L83A 3DOWA 4P1CC 2NTTA 3ZYYX 4YT0B 3SD5A 4KGTA 3VH3B 4E74A 1FCCC 1ACCA 3IT6B 4L2YA 1L5PA 1DOXA 1GC7A 2MP2B 1I4XA 2G45B 1ESFA 2KFJA 1AARA 1BMLC 2ZPYA 2IY1B 1GG3A 1IUEA 4AUQC 2M19A 1FIQA 1Q5WB 1WRDB 4FJYA 4KV2A 4WIPA 1WWTA 2DYOA 2I2YA 4RGNA 1WFYA 2GI9A 3CWIA 2V3NA 3AULA 3GZNB 4IWPA 1R4MI 4IWQA 5E6PA 1B1ZA 3W1SA 4ZYNA 3Q3OC 2KDIA 4J3OD 1C9FA 3SR6A 1SB3C 2C9WB 4TMAB 4GU2A 2Z0EB 1TTNA 4NNJB 3RNFC 2BYFA 3WALA 4K3BA 1AYFA 1F1HA 5C2TB 1HXYD 1WF9A 2DWQA 2J52A 1XO3A 1V6EA 4WQMA 1VZ8A 2BB6A 3SHQA 2K5PA 2JZZA 3ZRCA 3JVZX 3Q69A 4JQWC 1JW9D 2I1KA 4BFRA 4US8A 5C1ZA 2BKFA 4TKNA 2IGDA 1T0RC 4A3PA 1VD2A 1WJUA 2GB1A 3U8ZA 3PRMB 5CX3A 3KVFB 4FJZA 3V6EB 3NVWA 2LJIA 2LXAA 2K25A 4GXBA 3URYA 1V1PB 2QIEB 2V3PA 3D32A 3DBLB 2AL3A 3FILB 2PEAA 2TSSA 3HHMA 2NR2A 1FXTB 2CKHB 3DWGC 1ZDVA 4MGKE 2LHEA 1WXSA 1IPGA 1P98A 4HDQA 4JIOU 1P9DU 1XLQA 2JXXA 2KLCA 2XK5B 3TJPA 4RGMA 3A1QA 4GDLB 3AMZA 1A5RA 3ECIA 4XZ4A 2RPVA 1LXDA 2FCMA 2AQ3B 4LTUA 4WWMA 4WH4A 2KVRA 1WX8A 4IOIE 5BYSA 4W9LA 4OW0A 3DWMA 5G5HA 4GLSC 1XXGA 2KDMA 4M02A 4BOZB 1GPXA 4AOFA 3AE8B 2GBJA 3JSVB 3QJZA 2PE9A 2AX5A 1IGDA 4KZ0A 1DYQA 1LQBA 3R7QA 1V81A 4W9IA 3Q8AA 2RMMA 4N59A 1KM7A 1WX7A 2KTRB 2Q5WD 3ZRFA 2W9NA 4ASWC 1WRIA 3DBLI 4JX1C 4XWTA 4JL9A 2DAFA 4USAA 2KWUB 4EOYA 4KDIC 1N62A 1YJIA 3MFGA 1DOYA 2BS4B 4DXFA 3ZJVA 2D3AA 1S3SG 1WI0A 1E7PB 1EWYC 4XX5A 2LGSA 1T0QC 2C7NB 3JYUA 1TY0A 5E6OA 4KSKC 4A55A 1YN5A 3RNBC 3KUZA 3EFUA 3TEYA 2N9EB 2JWZA 1JRPA 1YMHE 4A3OA 5DPWA 3AEEB 3NZSA 1V8CA 4AP4C 4WWNA 4LLGM 1VR9A 1YOVB 1HZ6A 3P4QB 3WAPA 4K1RB 2OJRA 3IFWB 3TUOA 3AE2B 5DPRA 3VRAB 1L2NA 1OEYJ 3BYTB 2ZW1A 1FNUA 3PTFC 3VH4B 2CHZA 3N3KB 3RYTA 1SEBD 3TBLD 1E7VA 4KIKA 1VRAB 3VAWA 1ZUD2 2N9PC 2CJOA 1FRRA 1UBQA 1UBIA 2J53A 2JX5A 2Z59B 3W9CB 3BVMA 2KWVB 3TCAA 3AEAB 4BKGA 1SE4A 1WR1A 1EO6A 5BYQA 4KX6B 1V1PA 4II2B 4HPPA 4FN2A 3T3NA 2BWES 3ZGZA 4M8NA 5JHBA 3ZUNA 3P2BA 2Y3AA 2JWUA 4TQ0A 2KD0A 3I57A 3JSVA 4C7YA 1VCBA 3H9DA 3DBRB 3DVGY 2N1VA 4P7IA 2KFKB 2BS3B 2FAZA 2VZKD 1IBXB 1YN4A 2FE8A 2WXJA 2N9LA 1YX5B 4W9EA 5HHDG 1L6VA 1A70A 3CSFA 2FUG1 2WU5B 1QOBA 1E8ZA 2L32A 3PZ8A 5MPOA 2JPHA 1AWDA 3NVZA 4C56C 5GXGB 3Q3JA 4W9DA 4W9GA 1E9MA 3QX1A 2WNMA 1WGGA 2GOWA 4B9KA 3MC8A 2LGDA 2WXNA 3DBSA 1J0GA 2MJEA 3L10B 2N7JA 4M0WA 1HEZE 2K8CA 3C19A 3B2FA 1I4HA 3GP7A 4REZA 4NPNA 3KH0A 2PMVA 4YSZB 3N1XC 3PLUA 4ZYSA 1FNVA 3A9KB 4OZAA 1GUAB 3ZXRA 2EKEC 2NPTA 3FKYA 1JMLA 4FJVB 2IGGA 3IG3A 1CJEA 1LFDA 4EEWA 4HVBA 1HE8A 3EFCA 1NVID 4IM0A 2ZJDA 2HJ8A 4KIKB 4G3XB 2KNBA 1NI2A 2N9KA 1J19A 4M0WB 3Q8EA 3MJ5A 4N9F4 1FXIA 3X23A 1XLPA 3AEDB 1MHHE 4O1NA 2ZVOA 3IHPC 4ZHOA 5FK9C 3ALBA 1LM8B 2ZVNA 2JZPA 4PS7A 1K51A 2D11A 2L00B 1OQQA 4DXAB 3UINB 3QIJA 3SU8X 4N58A 3H7SA 2DLBA 2RR9A 1WGHA 1JWUD 4EZLA 4JWSC 2N9XA 1FO4A 1GB4A 2LZ6A 3PSEB 2MJDA 5LXIB 5BO4B 4XWWA 2O2VB 1QZEA 3N30A 2G3QB 4P16A 5JZEB 4XE0A 3NOBA 1ZGUB 3RNGC 4MH8A 2J0MA 4ANXA 4HPLB 3QQ8B 3PPAA 2VRRB 4KZCA 3IVFA 2V0GA 4D2KA 1WMHA 3ZDMC 2PPHA 4MSMB 5D3IB 4MH0E 2WS3B 1VZ6A 1CQVA 2LD9A 2LFIA 4PS3A 5CTRC 4LNFA 2LXCA 2H88B 4W9FA 2KLGA 2RDBC 3H7PA 1RAXA 1SF0A 2IGHA 2K1FA 3U7DA 1WSPA 1HTOA 1XCQL 2DENB 2JVCA 1N5XA 2DZJA 1UELA 1OTRB 3LB8C 1IYFA 1R4NI 2CU3A 3ZLZA 2WU2B 3NY5A 1KFYB 2QCZA 3NZUA 2ZEQA 1PDXA 2D5GA 2QMTA 2INDC 3AXCA 5FR6A 1KH0A 3VUXA 1ZDXA 1C1YB 1YN3A 2JT4B 5L95C 2K0PA 3KYCD 4HXDA 4C00A 1VLBA 3OLMD 2INNE 1N6ZA 1KLVA 2GRIA 2MX2A 5KHOA 4WWPA 1V2YA 3Q8CA 4OHJA 3H8HA 3AECB 5FKAC 2MWSB 1KOTA 4GDKA 3KW5B 4BKSA 1MFWA 4K7SA 2AL6A 3VVWB 3AU4A 3V05A 2EMTA 4PS8A 2KWCA 1SJHD 2OOBB 3L08A 2KMMA 1MPEA 2KZRA 4ZRPA 4TSSA 2L0FA 1SBBB 2O6VD 5T8IA 2DAJA 1SIFA 3FILA 1EU3A 3ZNGC 2NCNA 1PYWD 1IP9A 4H2AA 5C3JB 5CHWA 2YEPB 4ANVA 1H4RA 2KC2A 3Q8BA 1TKGA 4MEMA 2XK5A 5IN7A 1WM3A 3P4SB 4IKGA 3TEXA 1D4BA 2PLPA 1GB1A 4A90A 5D7GA 3AM9A 3IT4B 2NBUA 1I7HA 5IKCM 3BVZA 3ONSA 4ZDVA 1TGZB 2J0KA 3ABVB 4ZHPA 1JWSD 2NTSA 3KYDD 2JZ3B 2MBBB 3U2SC 4IWOA 4B0EA 2C60A 4YWGG 3RFZB 3SDLC 4HLEA 2JU6X 2MBEA 4MM3A 3P1MA 1ZE3D 3A1QB 1C79A 4ITKA 1FD6A 3NHEB 4G50A 2IO1B 3BINA 3ZDTA 3PGEA 2N7EA 4DWFA 4DHZB 3ML8A 1B9RA 3LXFA 2ZZPB 5EE3A 5EE0A 2WX0A 1K52A 4TQ1A 2WDTB 2JSVX 3Q3FA 4K7WA 3VHTC 1JWBD 2CU1A 2YVCA 3L4PA 3UGBB 4MSQB 1N61A 4L1BA 1YQ3B 1YJ1A 4ICUA 3TMPB 1ZP0B 3BVGA 2WXGA 4ARCA 2B76B 4DBGA 4GDKB 1YD8U 4M00A 1WZ3A 1I4QA 2W82A 2LHDA 1CMXB 2R2OA 4GN1A 1D5MC 1LGRA 1I42A 3PZ7A 2QEJC 2KQ7A 2M8SA 2K6DB 2KX0A 2QDFA 2SAKA 4I6PA 1ZKHA 3UI3A 4ZRQA 4ZRJA 1VZ7A 3AI5A 4HWIB 3Q8FA 2BB5A 4LNKA 2Z0DB 3ENEA 3HM6X 3PRZA 1I4RA 2KTFA 2D3CA 2LEKA 1XCTL 1EM7A 2PTLA 3A9JB 4NJ6A 1N63A 2BVCA 2L05A 3A4RA 1WGRA 2WGSA 4F7ZA 1E8XA 4HCPB 1TS2A 4HDOA 2O6VB 1L0XB 4E71A 2WXFA 3OJ4B 4LNNA 1TZ1A 1SSNA 4BBNF 4MACA 4C7ZA 2PVGC 3BK2A 5HG2A 3RI7C 2CS4A 1V97A 2W55A 3V3XA 4EKUA 1D5ZC 2BTEA 5I4DA 3RD2A 3T3OA 3S2AA 3BYYB 3VFKA 1WM2A 3LDZE 5D2MB 3R2TA 3KUCB 4MT5A 3RCZA 3I3TB 2DYMA 2BYVE 2AYOB 3L16A 1S1QB 4ANWA 4WURA 2KK8A 1TIFA 1C4AA 4NJ7A 3OWEB 1WX9A 1SE2A 1YNTE 2C7HA 3EUB2 2WXMA 1QOGA 4MJSA 1T5XD 1YIWA 4KKJA 5E6JA 3C0RB 2HD5B 2ZCCA 4CQNA 5AZHA 1SXTA 3IXSA 2MA9B 1JALA 1HQRD 1WIAA 3SEBA 3VTVA 2DX5B 2XN9C 3A9KA 2NMQA 3UIOB 3M62B 4W9JA 2WXPA 1DGJA 3QK0A 5GMVA 2KAJA 3MC0B 3OAWA 1XT9B 4WAFA 2MRPA 1QOAA 2BKRB 4RMAA 4JE3B 3GE8C 4PT5A 5G5GA 2BS2B 1WYGA 3WANA 1JROA 1V80A 1QILA 4NAMA 2WXQA 3AV8A 3SFDB 4I6NB 4QAYA 4S17A 3HVZA 1FFVA 1ZOYB 3V6CB 2LVQA 4YSYB 4NAWA 4A20A 1P3QU 4ICVA 1E7UA 4J6IA 5IO9A 2W3SA 2AQ2B 1TKEA 5IAAC 3AE1B 3N20C 5JH5C 4WJOA 3KWLA 1D5XC 3PREA 2J42A 4GSWA 1XLOA 2KO3A 2KJ6A 2VH2A 1GAQB 2C5LC 2M56B 2LUEA 5H92C 1TYGB 4AQ7A 4FA6A 1TS3A 4F1SA 1E0ZA 3AE6B 1WE6A 1RRBA 2V4LA 1H8CA 1XD3B 3ZVVA 1EU4A 2KQSA 4Q2JA 1KRHA 2PE6B 3L13A 5DPTA 5DPSA 1UD7A 3IAS1 2N1WA 4NY0A 3V60A 1NBFC 4GGQA 4MGIE 2LUMA 3VDZA 4MM3B 4ARIA 5AUIA 3B9JA 2OEDA 2KDEB 4JLCA 1K8RB 1JCKB 1LO5D 1FFUA 1UGMA 1NDDA 3WCQA 3TEWA 4P6VF 2PJHA 2O6VA 1ISNA 2KANA 2JYEA 1UUPA 5D6JB 4LNIA 1OQYA 4DDID 3Q14C 5TR5A 3ZNHB 4RGTA 5IP4D 3WA0A 1I35A 4LDTB 3BK1A 3NRZA 1FMAD 2BYTA 3DPDA 3GB1A 4GOCA 1AW7A 1XF5L 4NQKE 3U7ZA 1UF0A 2K9XA 2G1EA 5G2NA 3QC8B 3QA8A 2WXKA 2L52A 1DOIA 2MBHA 3TEZA 3U52E 2M0AA 2WXRA 1PUTA 3R7RA 3WIMA 2LGXA 5LNK1 4MELA 2MSED 3KUDB 1OEYA 2C7MB 3AN1A 2L1AA 2L7RA 4XYCA 2QHOA 2M0XA 1YQBA 1YJJA 4RGOS 2KT7A 3MHSD 2HE7A 3EA6A 3X0WA 3ZQ4A 1QOFA 2FUHB 4BBNC 3N1ZC 3RNEC 3ZO5B 3BWUD 5BMHA 2ACZB 1GC6A 4KGRA 4FHKA 3LYYA 2INPE 4BKSD 4FXCA 3EECA 3ZIMA 2Y5CA 3P4RB 2MH7A 4A8XC 1FRDA 3K9PB 3GOEA 5D3DA 3EC8A 2WDRB 2WXLA 1BUIC 2FCSA 2LGIA 1WJ4A 3PO0A 4JPSA 3AH7A 2IZVB 2MQJA 3I63C 3NJTA 3ZXVA 3J9CA 3DVNV 3VTWA 4C80A 1L7YA 2AWTA 2Z8LA 3V62A 1JWMD 3ZNZB 2UU7A 3P42A 4C4VA 1WXMA 4YXDB 2IPKD 1WGDA 1FNWA 4FULA 4HROA 5EDSA 4XGAB 3MC9A 3PVLA 4IG7B 1V86A 2N0SB 4AJWA 4GB9A 2BBCA 2M4NA 4CYEA 5IOIA 3W1SC 2GLSA 3L17A 3H6NA 4R3DA 2VH1A 2H89B 4RM9A 1C77A 4WQOB 3L0WB 2L0TA 2ZNVB 2KWDA 1Y8RC 4OZBA 2GBKA 1J7CA 1T0SC 1EF5A 1OGWA 2MLBA 3HVDA 2WDVB 4YL8A 4OVVA 3ZJUA 4KDLB 2N7DA 4X57B 3P63A 2UYZB 2QILA 4BOSC 2KMAA 4WJQA 4G0NB 3N1YC 3VUWA 3TL5A 4LNOA 2HTHA 1WXAA 4PK1A 2IY0B 2RPQA 1RYJA 2ZCBA 4AWJA 2Y5BB 2BF8B 4HEA1 1T6BX 1D3ZA 3KLSX 3B1LX 3R3MA 3AE4B 3ZTCA 3C8YA 3W2DA 5TSSA 1SE3A 1E8WA 2KHWB 2D3GA 4GDLA 2CHWA 4UDUC 4A9AA 2DBYA 4F8CB 1QQRA 1ZW7A 3A4SC 4G11A 2R2QA 4URKA 4MGYE 2JUOA 2L3ZA 1NEKB 2JQRB 2INCC 5D94A 1C4CA 2MP2A 5E6NA 1BXTA 4WAAA 4XDCA 3RPFC 4KKIA 1L4DB 1ZPSA 2HJ1A 1C78A 2BT6A 3DVGX 3APDA 5CHFA 3RNAC 1P1AA 2KN4A 2ZNVC 1Q1OA 2GBMA 3E9SA 3PLVA 1M4VA 1FM0D 3WAOA 4II3B 3BY4B 2NBVB 2KC1A 2IDYA 2KX3A 4K81A 3FC4A 1ET6A 2PIAA 3B0AA 3HK0A 3MJWA 1SE9A 4BZAA 4HK2A 4K3CA 1R4MB 1V5OA 2LVPA 4E3CA 1WJ6A 5JXVA 2N4FA 3MHZA 1WXQA 2WX1A 4RF0A 4DQOC 1C76A 1TS4A 2YLMA 4DDGD 1KLGD 2AEHA 1NYQA 3SFEB 4ANUA 1V49A 2MBQA 5BMIA 4I6LB 3OG5A 2I1JA 3Q3NC 4AS1A 4HCNB 2WP9B 4IW0A 1WZ0A 4DHJD 1WGYA 2PW9A 2ZW0A 4DK5A 1FEHA 3GE3C 4CHKA 3E56A 1TZOA 4OVZA 2JRIB 3JW0X 5J17A 1N60A 1EWCA 1SGHA 4B0MA 1WR6E 3AEBB 2GMIC 5J18A 1J7AA 3CF6E 4EZKA 2EKIA 2LMCA 1SIJA 3W5VB 2FIDA 3APFA 2BQQA 2ON8A 3M63B 2D10A 2FBWB 1UNSA 1JWAD 4BAXA 1JRUA 1MHXA 1N5WA 2V1YA 3PT2B 4WJPA 1MG8A 2D2QA 1F52A 2KVZA 1I4PA 1WXVA 2J0JA 4GMVA 2NPTB 1ZXIA 3LJ3A 1TKYA 3O65B 2LJ5A 3VUYA 3R8BA 2WQYB 1RFAA 3ML9A 2LGYA 2JYTA 3TIXA 2X8XX 3A33B 4EE2A 1FXAA 4JWUC 1YQ4B 2DZIA 5LXHA 1L6UA 1WGKA 3RN9C 5BMGA 1M94A 3Q3MC 3W5UB 3ZJTA 1PGXA 3QAQA 1ROEA 2KKCA 1G6JA 5KHQA 3VTUA 2DYBA 2K39A 4KVGB 4DXGA 3DHGC 2K8BA 2KXJA 4M8MA 1UGJA 3OJ3A 2XEWA 4A6QA 1D6EC 1UWXA 2DZMA 2NS5A 4ZRIA 1L4ZB 3GS2A 3KQ4A 4ACFA 2UWQA 2JF5A 1RM6C 2I38A 3ZTDA 1TJEA 4HPMB 3DHIC 3HM3A 2FNJB 3NUHB 3VQIA 3V61A 5AEKB 3DBRI 3DCGA 3DVNU 2KJHB 4BKTA 2O2VA 2G4SA 3Q2AC 1ZXHA 2AQ1B 4LDTD 5G55A 2Y5PA 2EMSA 3T8MA 4KGSA 3QCAA 2L76A 2K22A 4B6WA 2ICIA 1KTKA 4B95A 5FR3A 5EE9A 1XQQA 2REXA 4PYUA 3P4PB 3CMMB 5AZFA 2R61A 1XLNA 1QLBB 1WJNA 1WH3A 1MI0A 2MJ3A 4KSLC 3RZFA 1PFDA 2VZKB 4YTMB 1L0YB 1BT0A 1HZ5A 3HRDD 2W54A 1CK1A 3K9OB 3A9JA 4YTPB 5DCNA 1IBXA 3RNCC 3AEGB 2RGFA 2JY6A 1QKZA 2KDFB 4N6EB 2CHXA 1NYRA 2RSUA 1MJDA 3RT3B 2G4DB 3DBHI 3NG0A 3AE9B 5J2RA 2J4XA 1C4PA 2A4ZA 2KDBA 2BPSA 3U30A 1RLFA 2LRWA 3AB5A 1IGCA 4RF1A 2KFKA 1RWSA 4MJSB 3KWVA 2D3BA 1F9JA 1FCLA 2XBBC 3RMKC 2IJ0A 1ENFA 3MTNB 3R2IA 3B08A 2WXIA 3I5JC 4YSXB 3UQBA 2WLBA 1WY8A 5BYRA 3DBHB 2SEBD 1WMHB 1T0YA 4DHZE 4RFBA 1QT9A 2IYDB 5IA7A 4RCOA 2WXOA 2FCNA 1F2RC 2M1MA 2QJLA 3EHVA 1F77A 1STEA 2WYQA 3NS1A 4LCDE 1E8YA 3L54A 2NBWB 4LJOB 3W1YA 1K50A 2BYEA 4EFOA 3PZDA 2IO0B 2J7QB 3PV1A 4LK0M 3HIZA 1MG4A 1U4AA 4HKZE 2ZPNA 3QARA 5C23A 4DHJB 3ZNID 5AUKA 4CO7A 1J7BA 2LVOA 2PVOD 3M3JA 1QF6A 2NVUI 2XNAC 1I4GA 2JXTA 4WJNA 5HFYA 3M95A 4NAWB 3NVYA 1EF1A 3IAM1 1F0ZA 2KYWA 4IM2A 2CJNA 1CZPA 1E5WA 2KN5A 2QSDA 1P0RA 1SJED 4K7UA 1UH6A 5CHVC 3RZWC 3O13A 1VDVA 3DQVA
chains in the Genus database with same CATH topology
3QHTA 4W9HA 5DPRA 1D3ZA 1Z5SB 2WWZA 1OEYJ 1L2NA 1CMXB 3B1LX 2RD0A 3N32A 3R3MA 2R2OA 4GN1A 2KMCA 3PTFC 4JGHB 3VH4B 3ZTCA 1I42A 2CHZA 3N3KB 5AZGA 2KJRA 3RYTA 3TBLD 2KQ7A 2M8SA 4FLHA 4TUUA 2K6DB 2KX0A 1E7VA 4I6PA 4KIKA 1E8WA 1ZKHA 2KHWB 3VAWA 2D3GA 4GDLA 2CHWA 4WWOA 2N9PC 4ZRJA 4ZRKA 3AI5A 4HWIB 4F8CB 1UBIA 1UBQA 1ZW7A 3A4SC 4G11A 2IBIB 2R2QA 2Z0DB 4URKA 4MGYE 3ENEA 3HM6X 4EZJA 2L3ZA 1KJTA 2JUOA 2Z59B 3PRZA 2KWVB 3TCAA 5D94A 1PQSA 1WYWB 2FIFA 4BKGA 1X1MA 2GBRA 2MP2A 2DHZA 2KTFA 1WR1A 5E6NA 2L8JA 1EO6A 2M17A 4WAAA 3RULA 2BWFA 4II2B 2FCQA 4FN2A 3DVGX 2BWES 3APDA 4M8NA 5CHFA 4AJYB 2V3SA 1P1AA 3A9JB 4NJ6A 5JHBA 3ZUNA 2ZNVC 2L05A 3A4RA 1Q1OA 2GBMA 1WGRA 3PLVA 3P2BA 5JHAA 4F7ZA 1E8XA 4HCPB 4PYZA 3WAOA 4TQ0A 2KD0A 4II3B 1GJZA 3BY4B 2NBVB 3JSVA 4HDOA 1VCBA 2KC1A 2O6VB 1V9JA 4E71A 2KX3A 3CSTA 4EUTA 4K81A 3H9DA 3DVGY 3OJ4B 3H1UA 2N1VA 4P7IA 2KFKB 3ZKJC 1TZ1A 3PHXB 2A5UA 2FAZA 4BBNF 3B0AA 3HK0A 4W9KA 1TBEA 5L83A 2DZKA 2MCNB 3MJWA 1SE9A 5HKHA 1YX5B 4W9EA 4HK2A 3QWZB 2CS4A 2GBNA 3CSFA 4IUMB 1V5OA 3AU5A 1E8ZA 4RM8A 4EKUA 4MDKE 2JPHA 2LVPA 4E3CA 1WJ6A 2N4FA 3H7PB 4BVUC 3RD2A 3NS8A 4FHJA 3S2AA 4NQLB 2WX1A 3Q3JA 4W9DA 4W9GA 1WM2A 4GIVA 3VFKA 3LDZE 5D2MB 1C3TA 2YLMA 3QX1A 1WGGA 4DDGD 3PS6A 2GOWA 1Q0WB 2AEHA 3KUCB 4B9KA 4ANUA 1EUVB 2LGDA 3DBSA 3R66C 2MBOA 1J0GA 3L10B 1V49A 3DDCB 4MGZE 3RCZA 3I3TB 1WE7A 2K8CA 2DYMA 3WAMA 2MBQA 2JRHA 4I6LB 2I1JA 3PRPB 5LLIA 2BYVE 2AYOB 3L16A 3PHWB 1J8CA 4NPNA 3RUIB 1S1QB 3KH0A 4HCNB 3PLUA 4IW0A 4ANWA 3UIPB 1WZ0A 2KK8A 3VXWA 3A9KB 4DHJD 4NJ7A 1WGYA 1WX9A 2LRUA 2BGFA 1GUAB 2C7HA 1UZXB 4DK5A 2EKEC 1YIWA 4MJSA 2NPTA 4CHKA 2LASA 2JRIB 3C0RB 2HD5B 2ZCCA 4FJVB 4OVUA 3IG3A 5AZHA 2MW5A 2IO3B 1LFDA 3JW0X 4EEWA 5J17A 3UQAA 4HVBA 1HE8A 1SGHA 4W9CA 2MA9B 4IM0A 2ZJDA 2HJ8A 4KIKB 4G3XB 1WIAA 3VTVA 1WR6E 2DX5B 1Z2MA 2GMIC 2LWPA 5J18A 3CF6E 3A9KA 3UIOB 4EZKA 2KNBA 3M62B 1NI2A 4W9JA 2B3AA 1J19A 4M0WB 4LJPB 2FIDA 3APFA 3UF8A 4N9F4 2CR5A 4FADA 3IBEA 3M63B 3QK0A 2D10A 5GMVA 3X23A 1XT9B 3OAWA 1YX6B 1JRUA 2V1YA 2ZVOA 3PT2B 4WJPA 2MRPA 1MG8A 3APCA 3IHPC 2BKRB 4IC7B 4RMAA 2D2QA 4FBJB 3ALBA 2KOXA 1WXVA 2J0JA 2K8HA 4GMVA 2NPTB 3LJ3A 3WANA 1V80A 2KTRA 1LM8B 2ZVNA 4PS7A 3O65B 2LJ5A 4I6NB 2D11A 2L00B 3VUYA 2IO2B 3UINB 4DXAB 1E90A 1RFAA 4IM3A 3GZNI 2LGYA 3ML9A 3QIJA 3SU8X 3V6CB 2LVQA 3TIXA 3H7SA 4NAWA 4A20A 2ASQA 2RR9A 1P3QU 3A33B 4ICVA 1E7UA 1V5TA 1WGHA 4EZLA 2N9XA 2DZIA 4J6IA 5LXHA 2LZ6A 1GNUA 2LI5A 3PSEB 1M94A 5IAAC 4TV3A 3QAQA 3ZW3A 5LXIB 2KKCA 5JH5C 5BO4B 1G6JA 5KHQA 3VTUA 2O2VB 2DYBA 1QZEA 2K39A 2K6QA 4HJKA 4KVGB 4XC2A 3T9LA 2D07B 3N30A 2G3QB 4WJOA 5JZEB 2K8BA 3PREA 3DOWA 2KXJA 4GSWA 3NOBA 1ZGUB 4M8MA 2J0MA 2KO3A 3SD5A 4ANXA 4HPLB 3OJ3A 3QQ8B 2KJ6A 2XEWA 3PPAA 3VH3B 2VRRB 4KZCA 3IVFA 2DZMA 2NS5A 4ZRIA 4E74A 2C5LC 2UWQA 2JF5A 2LUEA 1WMHA 3ZTDA 4HPMB 3ZDMC 2PPHA 4FA6A 4MSMB 1GC7A 4F1SA 2MP2B 4MH0E 1WE6A 1RRBA 2G45B 2V4LA 2KFJA 1H8CA 1AARA 1XD3B 2LD9A 3HM3A 4PS3A 3ZVVA 2FNJB 2KQSA 2ZPYA 3VQIA 5CTRC 2IY1B 1GG3A 2LXCA 3V61A 5AEKB 4W9FA 2KLGA 2PE6B 3H7PA 3L13A 5DPTA 1RAXA 3DBRI 3DCGA 2KJHB 3DVNU 2O2VA 1UD7A 2G4SA 5DPSA 4AUQC 4BKTA 4LDTD 2K1FA 2N1WA 5G55A 3U7DA 2EMSA 2DENB 4NY0A 2JVCA 3T8MA 3V60A 1Q5WB 1WRDB 2DZJA 4FJYA 4KV2A 1NBFC 4GGQA 4MGIE 1UELA 3VDZA 2DYOA 3QCAA 2L76A 1OTRB 1WFYA 4B6WA 1IYFA 2KDEB 1R4NI 4JLCA 3ZLZA 1K8RB 1UGMA 4B95A 3AULA 3NY5A 4IWPA 1NDDA 1XQQA 3NZUA 1R4MI 2ZEQA 2REXA 4IWQA 4PYUA 3CMMB 5E6PA 5AZFA 3W1SA 2PJHA 3AXCA 4ZYNA 2KDIA 1WJNA 1WH3A 2O6VA 1ISNA 2C9WB 4GU2A 2KANA 2Z0EB 4KSLC 1TTNA 5FR6A 3RZFA 4NNJB 3VUXA 5D6JB 1BT0A 1C1YB 1OQYA 2BYFA 3WALA 4DDID 2JT4B 5L95C 5TR5A 1WF9A 3ZNHB 3WA0A 1I35A 4LDTB 3KYCD 4HXDA 3IFWB 1V6EA 3K9OB 3DPDA 3OLMD 3A9JA 5DCNA 3SHQA 4GOCA 2JZZA 3ZRCA 3JVZX 4JQWC 4NQKE 2I1KA 4BFRA 1KLVA 2MX2A 5KHOA 4WWPA 2RGFA 1V2YA 5C1ZA 2JY6A 2KDFB 2BKFA 5G2NA 3QC8B 2CHXA 3QA8A 2RSUA 4TKNA 3RT3B 4A3PA 2G4DB 3DBHI 1VD2A 2MBHA 2MWSB 1WJUA 1KOTA 3U8ZA 3PRMB 5CX3A 5J2RA 3KVFB 4GDKA 3R7RA 3WIMA 2A4ZA 2KDBA 4FJZA 3V6EB 2BPSA 2LGXA 3U30A 4MELA 1RLFA 2MSED 2LRWA 2LXAA 3KUDB 1OEYA 2K25A 3KW5B 2C7MB 4GXBA 2KFKA 4BKSA 4K7SA 4MJSB 2L7RA 2AL6A 3D32A 3VVWB 2QHOA 2M0XA 2AL3A 1YQBA 3AU4A 2PEAA 2EMTA 3HHMA 2KWCA 4PS8A 2NR2A 1FXTB 3MHSD 2HE7A 1F9JA 2CKHB 2OOBB 3L08A 4MGKE 1WXSA 2XBBC 3X0WA 1IPGA 1P98A 2KZRA 4HDQA 2FUHB 3MTNB 4JIOU 2KLCA 1P9DU 2JXXA 4BBNC 2XK5B 2L0FA 3B08A 3TJPA 3A1QA 3ZO5B 4GDLB 2O6VD 1A5RA 1GC6A 3UQBA 3ECIA 1WY8A 2DAJA 1SIFA 4FHKA 4XZ4A 4BKSD 1LXDA 2FCMA 3EECA 2KVRA 1WMHB 1WX8A 3ZIMA 4W9LA 3ZNGC 1T0YA 2NCNA 4DHZE 1IP9A 4GDKB 3K9PB 5CHWA 4ANVA 3GOEA 1H4RA 2KC2A 2IYDB 3EC8A 4MEMA 5IA7A 2XK5A 4BOZB 4AOFA 1WM3A 2FCNA 2FCSA 2GBJA 2M1MA 3EHVA 3JSVB 1WJ4A 3QJZA 2WYQA 2IZVB 2MQJA 5D7GA 2PE9A 3DVNV 4KZ0A 1LQBA 4LCDE 3VTWA 3R7QA 1E8YA 1L7YA 1V81A 2AWTA 4W9IA 3L54A 2NBWB 2NBUA 3ONSA 4ZDVA 4LJOB 1KM7A 1WX7A 2KTRB 3W1YA 3V62A 1TGZB 2J0KA 3ZRFA 3ZNZB 2W9NA 3KYDD 2JZ3B 2MBBB 2BYEA 4IWOA 4ASWC 3DBLI 4EFOA 2C60A 3PZDA 2IO0B 1WXMA 3SDLC 4JL9A 4HLEA 1WGDA 2J7QB 3PV1A 2MBEA 3HIZA 4MM3A 2DAFA 1U4AA 2KWUB 3A1QB 4FULA 5EDSA 4EOYA 4KDIC 2ZPNA 3PVLA 3QARA 4IG7B 1V86A 3NHEB 4G50A 5C23A 4AJWA 4GB9A 2IO1B 2M4NA 4CYEA 4DHJB 3W1SC 3ZNID 3L17A 3H6NA 3BINA 4CO7A 3ZDTA 4RM9A 1S3SG 1WI0A 2N7EA 3PGEA 2LVOA 4XX5A 4DHZB 4DWFA 3ML8A 4WQOB 3L0WB 2ZZPB 2L0TA 3M3JA 2ZNVB 2NVUI 2WX0A 1Y8RC 2C7NB 2GBKA 4TQ1A 4WJNA 3JYUA 1OGWA 1EF5A 2MLBA 5E6OA 4YL8A 3M95A 4NAWB 4OVVA 2WDTB 4KDLB 4KSKC 2N7DA 3Q3FA 1EF1A 4X57B 4K7WA 3VHTC 2UYZB 2CU1A 3KUZA 4IM2A 2YVCA 3UGBB 4MSQB 3EFUA 4BOSC 1E5WA 2KN5A 2N9EB 2KMAA 2JWZA 4WJQA 4A3OA 5DPWA 4G0NB 1P0RA 3NZSA 4K7UA 3VUWA 3TL5A 4AP4C 4WWNA 1UH6A 5CHVC 1YJ1A 4ICUA 2HTHA 3RZWC 3TMPB 1WXAA 3DQVA 2IY0B 2RPQA 3WAPA 4K1RB 2OJRA 2ZCBA 4AWJA 2Y5BB 4DBGA 1YD8U 2BF8B 1WZ3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QHT A;  4W9H A;  5DPR A;  1D3Z A;  1Z5S B;  2WWZ A;  1OEY J;  1L2N A;  1CMX B;  3B1L X;  2RD0 A;  3N32 A;  3R3M A;  2R2O A;  4GN1 A;  2KMC A;  3PTF C;  4JGH B;  3VH4 B;  3ZTC A;  1I42 A;  2CHZ A;  3N3K B;  5AZG A;  2KJR A;  3RYT A;  3TBL D;  2KQ7 A;  2M8S A;  4FLH A;  4TUU A;  2K6D B;  2KX0 A;  1E7V A;  4I6P A;  4KIK A;  1E8W A;  1ZKH A;  2KHW B;  3VAW A;  2D3G A;  4GDL A;  2CHW A;  4WWO A;  2N9P C;  4ZRJ A;  4ZRK A;  3AI5 A;  4HWI B;  4F8C B;  1UBI A;  1UBQ A;  1ZW7 A;  3A4S C;  4G11 A;  2IBI B;  2R2Q A;  2Z0D B;  4URK A;  4MGY E;  3ENE A;  3HM6 X;  4EZJ A;  2L3Z A;  1KJT A;  2JUO A;  2Z59 B;  3PRZ A;  2KWV B;  3TCA A;  5D94 A;  1PQS A;  1WYW B;  2FIF A;  4BKG A;  1X1M A;  2GBR A;  2MP2 A;  2DHZ A;  2KTF A;  1WR1 A;  5E6N A;  2L8J A;  1EO6 A;  2M17 A;  4WAA A;  3RUL A;  2BWF A;  4II2 B;  2FCQ A;  4FN2 A;  3DVG X;  2BWE S;  3APD A;  4M8N A;  5CHF A;  4AJY B;  2V3S A;  1P1A A;  3A9J B;  4NJ6 A;  5JHB A;  3ZUN A;  2ZNV C;  2L05 A;  3A4R A;  1Q1O A;  2GBM A;  1WGR A;  3PLV A;  3P2B A;  5JHA A;  4F7Z A;  1E8X A;  4HCP B;  4PYZ A;  3WAO A;  4TQ0 A;  2KD0 A;  4II3 B;  1GJZ A;  3BY4 B;  2NBV B;  3JSV A;  4HDO A;  1VCB A;  2KC1 A;  2O6V B;  1V9J A;  4E71 A;  2KX3 A;  3CST A;  4EUT A;  4K81 A;  3H9D A;  3DVG Y;  3OJ4 B;  3H1U A;  2N1V A;  4P7I A;  2KFK B;  3ZKJ C;  1TZ1 A;  3PHX B;  2A5U A;  2FAZ A;  4BBN F;  3B0A A;  3HK0 A;  4W9K A;  1TBE A;  5L83 A;  2DZK A;  2MCN B;  3MJW A;  1SE9 A;  5HKH A;  1YX5 B;  4W9E A;  4HK2 A;  3QWZ B;  2CS4 A;  2GBN A;  3CSF A;  4IUM B;  1V5O A;  3AU5 A;  1E8Z A;  4RM8 A;  4EKU A;  4MDK E;  2JPH A;  2LVP A;  4E3C A;  1WJ6 A;  2N4F A;  3H7P B;  4BVU C;  3RD2 A;  3NS8 A;  4FHJ A;  3S2A A;  4NQL B;  2WX1 A;  3Q3J A;  4W9D A;  4W9G A;  1WM2 A;  4GIV A;  3VFK A;  3LDZ E;  5D2M B;  1C3T A;  2YLM A;  3QX1 A;  1WGG A;  4DDG D;  3PS6 A;  2GOW A;  1Q0W B;  2AEH A;  3KUC B;  4B9K A;  4ANU A;  1EUV B;  2LGD A;  3DBS A;  3R66 C;  2MBO A;  1J0G A;  3L10 B;  1V49 A;  3DDC B;  4MGZ E;  3RCZ A;  3I3T B;  1WE7 A;  2K8C A;  2DYM A;  3WAM A;  2MBQ A;  2JRH A;  4I6L B;  2I1J A;  3PRP B;  5LLI A;  2BYV E;  2AYO B;  3L16 A;  3PHW B;  1J8C A;  4NPN A;  3RUI B;  1S1Q B;  3KH0 A;  4HCN B;  3PLU A;  4IW0 A;  4ANW A;  3UIP B;  1WZ0 A;  2KK8 A;  3VXW A;  3A9K B;  4DHJ D;  4NJ7 A;  1WGY A;  1WX9 A;  2LRU A;  2BGF A;  1GUA B;  2C7H A;  1UZX B;  4DK5 A;  2EKE C;  1YIW A;  4MJS A;  2NPT A;  4CHK A;  2LAS A;  2JRI B;  3C0R B;  2HD5 B;  2ZCC A;  4FJV B;  4OVU A;  3IG3 A;  5AZH A;  2MW5 A;  2IO3 B;  1LFD A;  3JW0 X;  4EEW A;  5J17 A;  3UQA A;  4HVB A;  1HE8 A;  1SGH A;  4W9C A;  2MA9 B;  4IM0 A;  2ZJD A;  2HJ8 A;  4KIK B;  4G3X B;  1WIA A;  3VTV A;  1WR6 E;  2DX5 B;  1Z2M A;  2GMI C;  2LWP A;  5J18 A;  3CF6 E;  3A9K A;  3UIO B;  4EZK A;  2KNB A;  3M62 B;  1NI2 A;  4W9J A;  2B3A A;  1J19 A;  4M0W B;  4LJP B;  2FID A;  3APF A;  3UF8 A;  4N9F 4;  2CR5 A;  4FAD A;  3IBE A;  3M63 B;  3QK0 A;  2D10 A;  5GMV A;  3X23 A;  1XT9 B;  3OAW A;  1YX6 B;  1JRU A;  2V1Y A;  2ZVO A;  3PT2 B;  4WJP A;  2MRP A;  1MG8 A;  3APC A;  3IHP C;  2BKR B;  4IC7 B;  4RMA A;  2D2Q A;  4FBJ B;  3ALB A;  2KOX A;  1WXV A;  2J0J A;  2K8H A;  4GMV A;  2NPT B;  3LJ3 A;  3WAN A;  1V80 A;  2KTR A;  1LM8 B;  2ZVN A;  4PS7 A;  3O65 B;  2LJ5 A;  4I6N B;  2D11 A;  2L00 B;  3VUY A;  2IO2 B;  3UIN B;  4DXA B;  1E90 A;  1RFA A;  4IM3 A;  3GZN I;  2LGY A;  3ML9 A;  3QIJ A;  3SU8 X;  3V6C B;  2LVQ A;  3TIX A;  3H7S A;  4NAW A;  4A20 A;  2ASQ A;  2RR9 A;  1P3Q U;  3A33 B;  4ICV A;  1E7U A;  1V5T A;  1WGH A;  4EZL A;  2N9X A;  2DZI A;  4J6I A;  5LXH A;  2LZ6 A;  1GNU A;  2LI5 A;  3PSE B;  1M94 A;  5IAA C;  4TV3 A;  3QAQ A;  3ZW3 A;  5LXI B;  2KKC A;  5JH5 C;  5BO4 B;  1G6J A;  5KHQ A;  3VTU A;  2O2V B;  2DYB A;  1QZE A;  2K39 A;  2K6Q A;  4HJK A;  4KVG B;  4XC2 A;  3T9L A;  2D07 B;  3N30 A;  2G3Q B;  4WJO A;  5JZE B;  2K8B A;  3PRE A;  3DOW A;  2KXJ A;  4GSW A;  3NOB A;  1ZGU B;  4M8M A;  2J0M A;  2KO3 A;  3SD5 A;  4ANX A;  4HPL B;  3OJ3 A;  3QQ8 B;  2KJ6 A;  2XEW A;  3PPA A;  3VH3 B;  2VRR B;  4KZC A;  3IVF A;  2DZM A;  2NS5 A;  4ZRI A;  4E74 A;  2C5L C;  2UWQ A;  2JF5 A;  2LUE A;  1WMH A;  3ZTD A;  4HPM B;  3ZDM C;  2PPH A;  4FA6 A;  4MSM B;  1GC7 A;  4F1S A;  2MP2 B;  4MH0 E;  1WE6 A;  1RRB A;  2G45 B;  2V4L A;  2KFJ A;  1H8C A;  1AAR A;  1XD3 B;  2LD9 A;  3HM3 A;  4PS3 A;  3ZVV A;  2FNJ B;  2KQS A;  2ZPY A;  3VQI A;  5CTR C;  2IY1 B;  1GG3 A;  2LXC A;  3V61 A;  5AEK B;  4W9F A;  2KLG A;  2PE6 B;  3H7P A;  3L13 A;  5DPT A;  1RAX A;  3DBR I;  3DCG A;  2KJH B;  3DVN U;  2O2V A;  1UD7 A;  2G4S A;  5DPS A;  4AUQ C;  4BKT A;  4LDT D;  2K1F A;  2N1W A;  5G55 A;  3U7D A;  2EMS A;  2DEN B;  4NY0 A;  2JVC A;  3T8M A;  3V60 A;  1Q5W B;  1WRD B;  2DZJ A;  4FJY A;  4KV2 A;  1NBF C;  4GGQ A;  4MGI E;  1UEL A;  3VDZ A;  2DYO A;  3QCA A;  2L76 A;  1OTR B;  1WFY A;  4B6W A;  1IYF A;  2KDE B;  1R4N I;  4JLC A;  3ZLZ A;  1K8R B;  1UGM A;  4B95 A;  3AUL A;  3NY5 A;  4IWP A;  1NDD A;  1XQQ A;  3NZU A;  1R4M I;  2ZEQ A;  2REX A;  4IWQ A;  4PYU A;  3CMM B;  5E6P A;  5AZF A;  3W1S A;  2PJH A;  3AXC A;  4ZYN A;  2KDI A;  1WJN A;  1WH3 A;  2O6V A;  1ISN A;  2C9W B;  4GU2 A;  2KAN A;  2Z0E B;  4KSL C;  1TTN A;  5FR6 A;  3RZF A;  4NNJ B;  3VUX A;  5D6J B;  1BT0 A;  1C1Y B;  1OQY A;  2BYF A;  3WAL A;  4DDI D;  2JT4 B;  5L95 C;  5TR5 A;  1WF9 A;  3ZNH B;  3WA0 A;  1I35 A;  4LDT B;  3KYC D;  4HXD A;  3IFW B;  1V6E A;  3K9O B;  3DPD A;  3OLM D;  3A9J A;  5DCN A;  3SHQ A;  4GOC A;  2JZZ A;  3ZRC A;  3JVZ X;  4JQW C;  4NQK E;  2I1K A;  4BFR A;  1KLV A;  2MX2 A;  5KHO A;  4WWP A;  2RGF A;  1V2Y A;  5C1Z A;  2JY6 A;  2KDF B;  2BKF A;  5G2N A;  3QC8 B;  2CHX A;  3QA8 A;  2RSU A;  4TKN A;  3RT3 B;  4A3P A;  2G4D B;  3DBH I;  1VD2 A;  2MBH A;  2MWS B;  1WJU A;  1KOT A;  3U8Z A;  3PRM B;  5CX3 A;  5J2R A;  3KVF B;  4GDK A;  3R7R A;  3WIM A;  2A4Z A;  2KDB A;  4FJZ A;  3V6E B;  2BPS A;  2LGX A;  3U30 A;  4MEL A;  1RLF A;  2MSE D;  2LRW A;  2LXA A;  3KUD B;  1OEY A;  2K25 A;  3KW5 B;  2C7M B;  4GXB A;  2KFK A;  4BKS A;  4K7S A;  4MJS B;  2L7R A;  2AL6 A;  3D32 A;  3VVW B;  2QHO A;  2M0X A;  2AL3 A;  1YQB A;  3AU4 A;  2PEA A;  2EMT A;  3HHM A;  2KWC A;  4PS8 A;  2NR2 A;  1FXT B;  3MHS D;  2HE7 A;  1F9J A;  2CKH B;  2OOB B;  3L08 A;  4MGK E;  1WXS A;  2XBB C;  3X0W A;  1IPG A;  1P98 A;  2KZR A;  4HDQ A;  2FUH B;  3MTN B;  4JIO U;  2KLC A;  1P9D U;  2JXX A;  4BBN C;  2XK5 B;  2L0F A;  3B08 A;  3TJP A;  3A1Q A;  3ZO5 B;  4GDL B;  2O6V D;  1A5R A;  1GC6 A;  3UQB A;  3ECI A;  1WY8 A;  2DAJ A;  1SIF A;  4FHK A;  4XZ4 A;  4BKS D;  1LXD A;  2FCM A;  3EEC A;  2KVR A;  1WMH B;  1WX8 A;  3ZIM A;  4W9L A;  3ZNG C;  1T0Y A;  2NCN A;  4DHZ E;  1IP9 A;  4GDK B;  3K9P B;  5CHW A;  4ANV A;  3GOE A;  1H4R A;  2KC2 A;  2IYD B;  3EC8 A;  4MEM A;  5IA7 A;  2XK5 A;  4BOZ B;  4AOF A;  1WM3 A;  2FCN A;  2FCS A;  2GBJ A;  2M1M A;  3EHV A;  3JSV B;  1WJ4 A;  3QJZ A;  2WYQ A;  2IZV B;  2MQJ A;  5D7G A;  2PE9 A;  3DVN V;  4KZ0 A;  1LQB A;  4LCD E;  3VTW A;  3R7Q A;  1E8Y A;  1L7Y A;  1V81 A;  2AWT A;  4W9I A;  3L54 A;  2NBW B;  2NBU A;  3ONS A;  4ZDV A;  4LJO B;  1KM7 A;  1WX7 A;  2KTR B;  3W1Y A;  3V62 A;  1TGZ B;  2J0K A;  3ZRF A;  3ZNZ B;  2W9N A;  3KYD D;  2JZ3 B;  2MBB B;  2BYE A;  4IWO A;  4ASW C;  3DBL I;  4EFO A;  2C60 A;  3PZD A;  2IO0 B;  1WXM A;  3SDL C;  4JL9 A;  4HLE A;  1WGD A;  2J7Q B;  3PV1 A;  2MBE A;  3HIZ A;  4MM3 A;  2DAF A;  1U4A A;  2KWU B;  3A1Q B;  4FUL A;  5EDS A;  4EOY A;  4KDI C;  2ZPN A;  3PVL A;  3QAR A;  4IG7 B;  1V86 A;  3NHE B;  4G50 A;  5C23 A;  4AJW A;  4GB9 A;  2IO1 B;  2M4N A;  4CYE A;  4DHJ B;  3W1S C;  3ZNI D;  3L17 A;  3H6N A;  3BIN A;  4CO7 A;  3ZDT A;  4RM9 A;  1S3S G;  1WI0 A;  2N7E A;  3PGE A;  2LVO A;  4XX5 A;  4DHZ B;  4DWF A;  3ML8 A;  4WQO B;  3L0W B;  2ZZP B;  2L0T A;  3M3J A;  2ZNV B;  2NVU I;  2WX0 A;  1Y8R C;  2C7N B;  2GBK A;  4TQ1 A;  4WJN A;  3JYU A;  1OGW A;  1EF5 A;  2MLB A;  5E6O A;  4YL8 A;  3M95 A;  4NAW B;  4OVV A;  2WDT B;  4KDL B;  4KSK C;  2N7D A;  3Q3F A;  1EF1 A;  4X57 B;  4K7W A;  3VHT C;  2UYZ B;  2CU1 A;  3KUZ A;  4IM2 A;  2YVC A;  3UGB B;  4MSQ B;  3EFU A;  4BOS C;  1E5W A;  2KN5 A;  2N9E B;  2KMA A;  2JWZ A;  4WJQ A;  4A3O A;  5DPW A;  4G0N B;  1P0R A;  3NZS A;  4K7U A;  3VUW A;  3TL5 A;  4AP4 C;  4WWN A;  1UH6 A;  5CHV C;  1YJ1 A;  4ICU A;  2HTH A;  3RZW C;  3TMP B;  1WXA A;  3DQV A;  2IY0 B;  2RPQ A;  3WAP A;  4K1R B;  2OJR A;  2ZCB A;  4AWJ A;  2Y5B B;  4DBG A;  1YD8 U;  2BF8 B;  1WZ3 A; 
#chains in the Genus database with same CATH topology
 3QHT A;  3ETR A;  4W9H A;  2G9H D;  1Z5S B;  2WWZ A;  1Y56 A;  2MEK A;  2RD0 A;  3N32 A;  5HI1 A;  2KMC A;  4P1B C;  4JGH B;  5AZG A;  2KJR A;  1JQ4 A;  4FLH A;  1E10 A;  4TUU A;  4HJG E;  3N9Y C;  3DHH C;  4WWO A;  1RFK A;  3U4E G;  1NEN B;  4OZC A;  4ZRK A;  2IBI B;  4EZJ A;  1KJT A;  3AE7 B;  1PQS A;  1WYW B;  2FIF A;  4RNA A;  1ET9 A;  1X1M A;  4YTN B;  2GBR A;  2DHZ A;  2L8J A;  2M17 A;  1TT5 B;  3RUL A;  2BWF A;  2FCQ A;  1TS5 A;  3MP9 A;  2WHI A;  3FAH A;  1V1O A;  2K3U A;  4AJY B;  2V3S A;  1VJK A;  2ONQ A;  1GOZ A;  5JHA A;  1OFF A;  4PYZ A;  2MHJ A;  1GJZ A;  2HDE A;  1AN8 A;  4NZL B;  4S0R A;  3TSS A;  1V9J A;  2BW2 A;  3CST A;  4EUT A;  4NJC A;  3H1U A;  1P7F A;  3ZKJ C;  2OHF A;  3PHX B;  2A5U A;  4W9K A;  4M01 A;  1TBE A;  2RDH A;  3BII D;  5L83 A;  2DZK A;  2MCN B;  1KLU D;  3VR8 B;  2OJW A;  1NI3 A;  1P7E A;  5HKH A;  3QWZ B;  2GBN A;  4IUM B;  3AU5 A;  3BZD B;  4RM8 A;  2V4I B;  1E6E B;  1R4N B;  4MDK E;  1HTQ A;  2WXH A;  4ZOH C;  2WDQ B;  3VR9 B;  3H7P B;  4BVU C;  1K53 A;  2V9H A;  3NS8 A;  4FHJ A;  3CIR B;  4NQL B;  3HUI A;  4GIV A;  1C3T A;  3PS6 A;  1Q0W B;  1EUV B;  3R66 C;  2MBO A;  1F2R I;  3AE3 B;  4MGZ E;  3DDC B;  2DNF A;  1TY2 A;  1WE7 A;  3WAM A;  2JRH A;  1HA5 A;  3I9V 1;  3PRP B;  5LLI A;  5H8Y E;  3PHW B;  1J8C A;  1L0V B;  3RUI B;  4IDI A;  3AEF B;  3B2G A;  3UIP B;  3VRB B;  3VXW A;  3Q6B A;  2LRU A;  2BGF A;  1UZX B;  2QC8 A;  2RDG A;  1FPY A;  2LAS A;  3NZ3 A;  4L23 A;  1R7S A;  4OVU A;  2MW5 A;  2IO3 B;  3UQA A;  4W9C A;  2E3T A;  1Q10 A;  1PGA A;  2LWP A;  1Z2M A;  2HTM E;  2KQ4 X;  1UWM A;  2B3A A;  4LJP B;  3UF8 A;  1MVK A;  2CR5 A;  4HRS A;  4FAD A;  3IBE A;  4XDD A;  1OQR A;  2YEP F;  1T3Q A;  1YX6 B;  1XEE A;  3APC A;  4IC7 B;  5EE1 A;  3NVV A;  4FBJ B;  1PGB A;  2KOX A;  2K8H A;  3EGR A;  3AE5 B;  4C4V B;  2KTR A;  4US9 A;  2W3R A;  2IO2 B;  1E90 A;  4IM3 A;  3GZN I;  4RH6 A;  2EEL A;  2E6X A;  2ASQ A;  1V5T A;  4HKQ A;  1GNU A;  2LI5 A;  2X38 A;  4TV3 A;  3ZW3 A;  4HJK A;  3T9L A;  2K6Q A;  2KAC A;  4XC2 A;  2D07 B;  1KF6 B;  2PKO A;  2L83 A;  3DOW A;  4P1C C;  2NTT A;  3ZYY X;  4YT0 B;  3SD5 A;  4KGT A;  3VH3 B;  4E74 A;  1FCC C;  1ACC A;  3IT6 B;  4L2Y A;  1L5P A;  1DOX A;  1GC7 A;  2MP2 B;  1I4X A;  2G45 B;  1ESF A;  2KFJ A;  1AAR A;  1BML C;  2ZPY A;  2IY1 B;  1GG3 A;  1IUE A;  4AUQ C;  2M19 A;  1FIQ A;  1Q5W B;  1WRD B;  4FJY A;  4KV2 A;  4WIP A;  1WWT A;  2DYO A;  2I2Y A;  4RGN A;  1WFY A;  2GI9 A;  3CWI A;  2V3N A;  3AUL A;  3GZN B;  4IWP A;  1R4M I;  4IWQ A;  5E6P A;  1B1Z A;  3W1S A;  4ZYN A;  3Q3O C;  2KDI A;  4J3O D;  1C9F A;  3SR6 A;  1SB3 C;  2C9W B;  4TMA B;  4GU2 A;  2Z0E B;  1TTN A;  4NNJ B;  3RNF C;  2BYF A;  3WAL A;  4K3B A;  1AYF A;  1F1H A;  5C2T B;  1HXY D;  1WF9 A;  2DWQ A;  2J52 A;  1XO3 A;  1V6E A;  4WQM A;  1VZ8 A;  2BB6 A;  3SHQ A;  2K5P A;  2JZZ A;  3ZRC A;  3JVZ X;  3Q69 A;  4JQW C;  1JW9 D;  2I1K A;  4BFR A;  4US8 A;  5C1Z A;  2BKF A;  4TKN A;  2IGD A;  1T0R C;  4A3P A;  1VD2 A;  1WJU A;  2GB1 A;  3U8Z A;  3PRM B;  5CX3 A;  3KVF B;  4FJZ A;  3V6E B;  3NVW A;  2LJI A;  2LXA A;  2K25 A;  4GXB A;  3URY A;  1V1P B;  2QIE B;  2V3P A;  3D32 A;  3DBL B;  2AL3 A;  3FIL B;  2PEA A;  2TSS A;  3HHM A;  2NR2 A;  1FXT B;  2CKH B;  3DWG C;  1ZDV A;  4MGK E;  2LHE A;  1WXS A;  1IPG A;  1P98 A;  4HDQ A;  4JIO U;  1P9D U;  1XLQ A;  2JXX A;  2KLC A;  2XK5 B;  3TJP A;  4RGM A;  3A1Q A;  4GDL B;  3AMZ A;  1A5R A;  3ECI A;  4XZ4 A;  2RPV A;  1LXD A;  2FCM A;  2AQ3 B;  4LTU A;  4WWM A;  4WH4 A;  2KVR A;  1WX8 A;  4IOI E;  5BYS A;  4W9L A;  4OW0 A;  3DWM A;  5G5H A;  4GLS C;  1XXG A;  2KDM A;  4M02 A;  4BOZ B;  1GPX A;  4AOF A;  3AE8 B;  2GBJ A;  3JSV B;  3QJZ A;  2PE9 A;  2AX5 A;  1IGD A;  4KZ0 A;  1DYQ A;  1LQB A;  3R7Q A;  1V81 A;  4W9I A;  3Q8A A;  2RMM A;  4N59 A;  1KM7 A;  1WX7 A;  2KTR B;  2Q5W D;  3ZRF A;  2W9N A;  4ASW C;  1WRI A;  3DBL I;  4JX1 C;  4XWT A;  4JL9 A;  2DAF A;  4USA A;  2KWU B;  4EOY A;  4KDI C;  1N62 A;  1YJI A;  3MFG A;  1DOY A;  2BS4 B;  4DXF A;  3ZJV A;  2D3A A;  1S3S G;  1WI0 A;  1E7P B;  1EWY C;  4XX5 A;  2LGS A;  1T0Q C;  2C7N B;  3JYU A;  1TY0 A;  5E6O A;  4KSK C;  4A55 A;  1YN5 A;  3RNB C;  3KUZ A;  3EFU A;  3TEY A;  2N9E B;  2JWZ A;  1JRP A;  1YMH E;  4A3O A;  5DPW A;  3AEE B;  3NZS A;  1V8C A;  4AP4 C;  4WWN A;  4LLG M;  1VR9 A;  1YOV B;  1HZ6 A;  3P4Q B;  3WAP A;  4K1R B;  2OJR A;  3IFW B;  3TUO A;  3AE2 B;  5DPR A;  3VRA B;  1L2N A;  1OEY J;  3BYT B;  2ZW1 A;  1FNU A;  3PTF C;  3VH4 B;  2CHZ A;  3N3K B;  3RYT A;  1SEB D;  3TBL D;  1E7V A;  4KIK A;  1VRA B;  3VAW A;  1ZUD 2;  2N9P C;  2CJO A;  1FRR A;  1UBQ A;  1UBI A;  2J53 A;  2JX5 A;  2Z59 B;  3W9C B;  3BVM A;  2KWV B;  3TCA A;  3AEA B;  4BKG A;  1SE4 A;  1WR1 A;  1EO6 A;  5BYQ A;  4KX6 B;  1V1P A;  4II2 B;  4HPP A;  4FN2 A;  3T3N A;  2BWE S;  3ZGZ A;  4M8N A;  5JHB A;  3ZUN A;  3P2B A;  2Y3A A;  2JWU A;  4TQ0 A;  2KD0 A;  3I57 A;  3JSV A;  4C7Y A;  1VCB A;  3H9D A;  3DBR B;  3DVG Y;  2N1V A;  4P7I A;  2KFK B;  2BS3 B;  2FAZ A;  2VZK D;  1IBX B;  1YN4 A;  2FE8 A;  2WXJ A;  2N9L A;  1YX5 B;  4W9E A;  5HHD G;  1L6V A;  1A70 A;  3CSF A;  2FUG 1;  2WU5 B;  1QOB A;  1E8Z A;  2L32 A;  3PZ8 A;  5MPO A;  2JPH A;  1AWD A;  3NVZ A;  4C56 C;  5GXG B;  3Q3J A;  4W9D A;  4W9G A;  1E9M A;  3QX1 A;  2WNM A;  1WGG A;  2GOW A;  4B9K A;  3MC8 A;  2LGD A;  2WXN A;  3DBS A;  1J0G A;  2MJE A;  3L10 B;  2N7J A;  4M0W A;  1HEZ E;  2K8C A;  3C19 A;  3B2F A;  1I4H A;  3GP7 A;  4REZ A;  4NPN A;  3KH0 A;  2PMV A;  4YSZ B;  3N1X C;  3PLU A;  4ZYS A;  1FNV A;  3A9K B;  4OZA A;  1GUA B;  3ZXR A;  2EKE C;  2NPT A;  3FKY A;  1JML A;  4FJV B;  2IGG A;  3IG3 A;  1CJE A;  1LFD A;  4EEW A;  4HVB A;  1HE8 A;  3EFC A;  1NVI D;  4IM0 A;  2ZJD A;  2HJ8 A;  4KIK B;  4G3X B;  2KNB A;  1NI2 A;  2N9K A;  1J19 A;  4M0W B;  3Q8E A;  3MJ5 A;  4N9F 4;  1FXI A;  3X23 A;  1XLP A;  3AED B;  1MHH E;  4O1N A;  2ZVO A;  3IHP C;  4ZHO A;  5FK9 C;  3ALB A;  1LM8 B;  2ZVN A;  2JZP A;  4PS7 A;  1K51 A;  2D11 A;  2L00 B;  1OQQ A;  4DXA B;  3UIN B;  3QIJ A;  3SU8 X;  4N58 A;  3H7S A;  2DLB A;  2RR9 A;  1WGH A;  1JWU D;  4EZL A;  4JWS C;  2N9X A;  1FO4 A;  1GB4 A;  2LZ6 A;  3PSE B;  2MJD A;  5LXI B;  5BO4 B;  4XWW A;  2O2V B;  1QZE A;  3N30 A;  2G3Q B;  4P16 A;  5JZE B;  4XE0 A;  3NOB A;  1ZGU B;  3RNG C;  4MH8 A;  2J0M A;  4ANX A;  4HPL B;  3QQ8 B;  3PPA A;  2VRR B;  4KZC A;  3IVF A;  2V0G A;  4D2K A;  1WMH A;  3ZDM C;  2PPH A;  4MSM B;  5D3I B;  4MH0 E;  2WS3 B;  1VZ6 A;  1CQV A;  2LD9 A;  2LFI A;  4PS3 A;  5CTR C;  4LNF A;  2LXC A;  2H88 B;  4W9F A;  2KLG A;  2RDB C;  3H7P A;  1RAX A;  1SF0 A;  2IGH A;  2K1F A;  3U7D A;  1WSP A;  1HTO A;  1XCQ L;  2DEN B;  2JVC A;  1N5X A;  2DZJ A;  1UEL A;  1OTR B;  3LB8 C;  1IYF A;  1R4N I;  2CU3 A;  3ZLZ A;  2WU2 B;  3NY5 A;  1KFY B;  2QCZ A;  3NZU A;  2ZEQ A;  1PDX A;  2D5G A;  2QMT A;  2IND C;  3AXC A;  5FR6 A;  1KH0 A;  3VUX A;  1ZDX A;  1C1Y B;  1YN3 A;  2JT4 B;  5L95 C;  2K0P A;  3KYC D;  4HXD A;  4C00 A;  1VLB A;  3OLM D;  2INN E;  1N6Z A;  1KLV A;  2GRI A;  2MX2 A;  5KHO A;  4WWP A;  1V2Y A;  3Q8C A;  4OHJ A;  3H8H A;  3AEC B;  5FKA C;  2MWS B;  1KOT A;  4GDK A;  3KW5 B;  4BKS A;  1MFW A;  4K7S A;  2AL6 A;  3VVW B;  3AU4 A;  3V05 A;  2EMT A;  4PS8 A;  2KWC A;  1SJH D;  2OOB B;  3L08 A;  2KMM A;  1MPE A;  2KZR A;  4ZRP A;  4TSS A;  2L0F A;  1SBB B;  2O6V D;  5T8I A;  2DAJ A;  1SIF A;  3FIL A;  1EU3 A;  3ZNG C;  2NCN A;  1PYW D;  1IP9 A;  4H2A A;  5C3J B;  5CHW A;  2YEP B;  4ANV A;  1H4R A;  2KC2 A;  3Q8B A;  1TKG A;  4MEM A;  2XK5 A;  5IN7 A;  1WM3 A;  3P4S B;  4IKG A;  3TEX A;  1D4B A;  2PLP A;  1GB1 A;  4A90 A;  5D7G A;  3AM9 A;  3IT4 B;  2NBU A;  1I7H A;  5IKC M;  3BVZ A;  3ONS A;  4ZDV A;  1TGZ B;  2J0K A;  3ABV B;  4ZHP A;  1JWS D;  2NTS A;  3KYD D;  2JZ3 B;  2MBB B;  3U2S C;  4IWO A;  4B0E A;  2C60 A;  4YWG G;  3RFZ B;  3SDL C;  4HLE A;  2JU6 X;  2MBE A;  4MM3 A;  3P1M A;  1ZE3 D;  3A1Q B;  1C79 A;  4ITK A;  1FD6 A;  3NHE B;  4G50 A;  2IO1 B;  3BIN A;  3ZDT A;  3PGE A;  2N7E A;  4DWF A;  4DHZ B;  3ML8 A;  1B9R A;  3LXF A;  2ZZP B;  5EE3 A;  5EE0 A;  2WX0 A;  1K52 A;  4TQ1 A;  2WDT B;  2JSV X;  3Q3F A;  4K7W A;  3VHT C;  1JWB D;  2CU1 A;  2YVC A;  3L4P A;  3UGB B;  4MSQ B;  1N61 A;  4L1B A;  1YQ3 B;  1YJ1 A;  4ICU A;  3TMP B;  1ZP0 B;  3BVG A;  2WXG A;  4ARC A;  2B76 B;  4DBG A;  4GDK B;  1YD8 U;  4M00 A;  1WZ3 A;  1I4Q A;  2W82 A;  2LHD A;  1CMX B;  2R2O A;  4GN1 A;  1D5M C;  1LGR A;  1I42 A;  3PZ7 A;  2QEJ C;  2KQ7 A;  2M8S A;  2K6D B;  2KX0 A;  2QDF A;  2SAK A;  4I6P A;  1ZKH A;  3UI3 A;  4ZRQ A;  4ZRJ A;  1VZ7 A;  3AI5 A;  4HWI B;  3Q8F A;  2BB5 A;  4LNK A;  2Z0D B;  3ENE A;  3HM6 X;  3PRZ A;  1I4R A;  2KTF A;  2D3C A;  2LEK A;  1XCT L;  1EM7 A;  2PTL A;  3A9J B;  4NJ6 A;  1N63 A;  2BVC A;  2L05 A;  3A4R A;  1WGR A;  2WGS A;  4F7Z A;  1E8X A;  4HCP B;  1TS2 A;  4HDO A;  2O6V B;  1L0X B;  4E71 A;  2WXF A;  3OJ4 B;  4LNN A;  1TZ1 A;  1SSN A;  4BBN F;  4MAC A;  4C7Z A;  2PVG C;  3BK2 A;  5HG2 A;  3RI7 C;  2CS4 A;  1V97 A;  2W55 A;  3V3X A;  4EKU A;  1D5Z C;  2BTE A;  5I4D A;  3RD2 A;  3T3O A;  3S2A A;  3BYY B;  3VFK A;  1WM2 A;  3LDZ E;  5D2M B;  3R2T A;  3KUC B;  4MT5 A;  3RCZ A;  3I3T B;  2DYM A;  2BYV E;  2AYO B;  3L16 A;  1S1Q B;  4ANW A;  4WUR A;  2KK8 A;  1TIF A;  1C4A A;  4NJ7 A;  3OWE B;  1WX9 A;  1SE2 A;  1YNT E;  2C7H A;  3EUB 2;  2WXM A;  1QOG A;  4MJS A;  1T5X D;  1YIW A;  4KKJ A;  5E6J A;  3C0R B;  2HD5 B;  2ZCC A;  4CQN A;  5AZH A;  1SXT A;  3IXS A;  2MA9 B;  1JAL A;  1HQR D;  1WIA A;  3SEB A;  3VTV A;  2DX5 B;  2XN9 C;  3A9K A;  2NMQ A;  3UIO B;  3M62 B;  4W9J A;  2WXP A;  1DGJ A;  3QK0 A;  5GMV A;  2KAJ A;  3MC0 B;  3OAW A;  1XT9 B;  4WAF A;  2MRP A;  1QOA A;  2BKR B;  4RMA A;  4JE3 B;  3GE8 C;  4PT5 A;  5G5G A;  2BS2 B;  1WYG A;  3WAN A;  1JRO A;  1V80 A;  1QIL A;  4NAM A;  2WXQ A;  3AV8 A;  3SFD B;  4I6N B;  4QAY A;  4S17 A;  3HVZ A;  1FFV A;  1ZOY B;  3V6C B;  2LVQ A;  4YSY B;  4NAW A;  4A20 A;  1P3Q U;  4ICV A;  1E7U A;  4J6I A;  5IO9 A;  2W3S A;  2AQ2 B;  1TKE A;  5IAA C;  3AE1 B;  3N20 C;  5JH5 C;  4WJO A;  3KWL A;  1D5X C;  3PRE A;  2J42 A;  4GSW A;  1XLO A;  2KO3 A;  2KJ6 A;  2VH2 A;  1GAQ B;  2C5L C;  2M56 B;  2LUE A;  5H92 C;  1TYG B;  4AQ7 A;  4FA6 A;  1TS3 A;  4F1S A;  1E0Z A;  3AE6 B;  1WE6 A;  1RRB A;  2V4L A;  1H8C A;  1XD3 B;  3ZVV A;  1EU4 A;  2KQS A;  4Q2J A;  1KRH A;  2PE6 B;  3L13 A;  5DPT A;  5DPS A;  1UD7 A;  3IAS 1;  2N1W A;  4NY0 A;  3V60 A;  1NBF C;  4GGQ A;  4MGI E;  2LUM A;  3VDZ A;  4MM3 B;  4ARI A;  5AUI A;  3B9J A;  2OED A;  2KDE B;  4JLC A;  1K8R B;  1JCK B;  1LO5 D;  1FFU A;  1UGM A;  1NDD A;  3WCQ A;  3TEW A;  4P6V F;  2PJH A;  2O6V A;  1ISN A;  2KAN A;  2JYE A;  1UUP A;  5D6J B;  4LNI A;  1OQY A;  4DDI D;  3Q14 C;  5TR5 A;  3ZNH B;  4RGT A;  5IP4 D;  3WA0 A;  1I35 A;  4LDT B;  3BK1 A;  3NRZ A;  1FMA D;  2BYT A;  3DPD A;  3GB1 A;  4GOC A;  1AW7 A;  1XF5 L;  4NQK E;  3U7Z A;  1UF0 A;  2K9X A;  2G1E A;  5G2N A;  3QC8 B;  3QA8 A;  2WXK A;  2L52 A;  1DOI A;  2MBH A;  3TEZ A;  3U52 E;  2M0A A;  2WXR A;  1PUT A;  3R7R A;  3WIM A;  2LGX A;  5LNK 1;  4MEL A;  2MSE D;  3KUD B;  1OEY A;  2C7M B;  3AN1 A;  2L1A A;  2L7R A;  4XYC A;  2QHO A;  2M0X A;  1YQB A;  1YJJ A;  4RGO S;  2KT7 A;  3MHS D;  2HE7 A;  3EA6 A;  3X0W A;  3ZQ4 A;  1QOF A;  2FUH B;  4BBN C;  3N1Z C;  3RNE C;  3ZO5 B;  3BWU D;  5BMH A;  2ACZ B;  1GC6 A;  4KGR A;  4FHK A;  3LYY A;  2INP E;  4BKS D;  4FXC A;  3EEC A;  3ZIM A;  2Y5C A;  3P4R B;  2MH7 A;  4A8X C;  1FRD A;  3K9P B;  3GOE A;  5D3D A;  3EC8 A;  2WDR B;  2WXL A;  1BUI C;  2FCS A;  2LGI A;  1WJ4 A;  3PO0 A;  4JPS A;  3AH7 A;  2IZV B;  2MQJ A;  3I63 C;  3NJT A;  3ZXV A;  3J9C A;  3DVN V;  3VTW A;  4C80 A;  1L7Y A;  2AWT A;  2Z8L A;  3V62 A;  1JWM D;  3ZNZ B;  2UU7 A;  3P42 A;  4C4V A;  1WXM A;  4YXD B;  2IPK D;  1WGD A;  1FNW A;  4FUL A;  4HRO A;  5EDS A;  4XGA B;  3MC9 A;  3PVL A;  4IG7 B;  1V86 A;  2N0S B;  4AJW A;  4GB9 A;  2BBC A;  2M4N A;  4CYE A;  5IOI A;  3W1S C;  2GLS A;  3L17 A;  3H6N A;  4R3D A;  2VH1 A;  2H89 B;  4RM9 A;  1C77 A;  4WQO B;  3L0W B;  2L0T A;  2ZNV B;  2KWD A;  1Y8R C;  4OZB A;  2GBK A;  1J7C A;  1T0S C;  1EF5 A;  1OGW A;  2MLB A;  3HVD A;  2WDV B;  4YL8 A;  4OVV A;  3ZJU A;  4KDL B;  2N7D A;  4X57 B;  3P63 A;  2UYZ B;  2QIL A;  4BOS C;  2KMA A;  4WJQ A;  4G0N B;  3N1Y C;  3VUW A;  3TL5 A;  4LNO A;  2HTH A;  1WXA A;  4PK1 A;  2IY0 B;  2RPQ A;  1RYJ A;  2ZCB A;  4AWJ A;  2Y5B B;  2BF8 B;  4HEA 1;  1T6B X;  1D3Z A;  3KLS X;  3B1L X;  3R3M A;  3AE4 B;  3ZTC A;  3C8Y A;  3W2D A;  5TSS A;  1SE3 A;  1E8W A;  2KHW B;  2D3G A;  4GDL A;  2CHW A;  4UDU C;  4A9A A;  2DBY A;  4F8C B;  1QQR A;  1ZW7 A;  3A4S C;  4G11 A;  2R2Q A;  4URK A;  4MGY E;  2JUO A;  2L3Z A;  1NEK B;  2JQR B;  2INC C;  5D94 A;  1C4C A;  2MP2 A;  5E6N A;  1BXT A;  4WAA A;  4XDC A;  3RPF C;  4KKI A;  1L4D B;  1ZPS A;  2HJ1 A;  1C78 A;  2BT6 A;  3DVG X;  3APD A;  5CHF A;  3RNA C;  1P1A A;  2KN4 A;  2ZNV C;  1Q1O A;  2GBM A;  3E9S A;  3PLV A;  1M4V A;  1FM0 D;  3WAO A;  4II3 B;  3BY4 B;  2NBV B;  2KC1 A;  2IDY A;  2KX3 A;  4K81 A;  3FC4 A;  1ET6 A;  2PIA A;  3B0A A;  3HK0 A;  3MJW A;  1SE9 A;  4BZA A;  4HK2 A;  4K3C A;  1R4M B;  1V5O A;  2LVP A;  4E3C A;  1WJ6 A;  5JXV A;  2N4F A;  3MHZ A;  1WXQ A;  2WX1 A;  4RF0 A;  4DQO C;  1C76 A;  1TS4 A;  2YLM A;  4DDG D;  1KLG D;  2AEH A;  1NYQ A;  3SFE B;  4ANU A;  1V49 A;  2MBQ A;  5BMI A;  4I6L B;  3OG5 A;  2I1J A;  3Q3N C;  4AS1 A;  4HCN B;  2WP9 B;  4IW0 A;  1WZ0 A;  4DHJ D;  1WGY A;  2PW9 A;  2ZW0 A;  4DK5 A;  1FEH A;  3GE3 C;  4CHK A;  3E56 A;  1TZO A;  4OVZ A;  2JRI B;  3JW0 X;  5J17 A;  1N60 A;  1EWC A;  1SGH A;  4B0M A;  1WR6 E;  3AEB B;  2GMI C;  5J18 A;  1J7A A;  3CF6 E;  4EZK A;  2EKI A;  2LMC A;  1SIJ A;  3W5V B;  2FID A;  3APF A;  2BQQ A;  2ON8 A;  3M63 B;  2D10 A;  2FBW B;  1UNS A;  1JWA D;  4BAX A;  1JRU A;  1MHX A;  1N5W A;  2V1Y A;  3PT2 B;  4WJP A;  1MG8 A;  2D2Q A;  1F52 A;  2KVZ A;  1I4P A;  1WXV A;  2J0J A;  4GMV A;  2NPT B;  1ZXI A;  3LJ3 A;  1TKY A;  3O65 B;  2LJ5 A;  3VUY A;  3R8B A;  2WQY B;  1RFA A;  3ML9 A;  2LGY A;  2JYT A;  3TIX A;  2X8X X;  3A33 B;  4EE2 A;  1FXA A;  4JWU C;  1YQ4 B;  2DZI A;  5LXH A;  1L6U A;  1WGK A;  3RN9 C;  5BMG A;  1M94 A;  3Q3M C;  3W5U B;  3ZJT A;  1PGX A;  3QAQ A;  1ROE A;  2KKC A;  1G6J A;  5KHQ A;  3VTU A;  2DYB A;  2K39 A;  4KVG B;  4DXG A;  3DHG C;  2K8B A;  2KXJ A;  4M8M A;  1UGJ A;  3OJ3 A;  2XEW A;  4A6Q A;  1D6E C;  1UWX A;  2DZM A;  2NS5 A;  4ZRI A;  1L4Z B;  3GS2 A;  3KQ4 A;  4ACF A;  2UWQ A;  2JF5 A;  1RM6 C;  2I38 A;  3ZTD A;  1TJE A;  4HPM B;  3DHI C;  3HM3 A;  2FNJ B;  3NUH B;  3VQI A;  3V61 A;  5AEK B;  3DBR I;  3DCG A;  3DVN U;  2KJH B;  4BKT A;  2O2V A;  2G4S A;  3Q2A C;  1ZXH A;  2AQ1 B;  4LDT D;  5G55 A;  2Y5P A;  2EMS A;  3T8M A;  4KGS A;  3QCA A;  2L76 A;  2K22 A;  4B6W A;  2ICI A;  1KTK A;  4B95 A;  5FR3 A;  5EE9 A;  1XQQ A;  2REX A;  4PYU A;  3P4P B;  3CMM B;  5AZF A;  2R61 A;  1XLN A;  1QLB B;  1WJN A;  1WH3 A;  1MI0 A;  2MJ3 A;  4KSL C;  3RZF A;  1PFD A;  2VZK B;  4YTM B;  1L0Y B;  1BT0 A;  1HZ5 A;  3HRD D;  2W54 A;  1CK1 A;  3K9O B;  3A9J A;  4YTP B;  5DCN A;  1IBX A;  3RNC C;  3AEG B;  2RGF A;  2JY6 A;  1QKZ A;  2KDF B;  4N6E B;  2CHX A;  1NYR A;  2RSU A;  1MJD A;  3RT3 B;  2G4D B;  3DBH I;  3NG0 A;  3AE9 B;  5J2R A;  2J4X A;  1C4P A;  2A4Z A;  2KDB A;  2BPS A;  3U30 A;  1RLF A;  2LRW A;  3AB5 A;  1IGC A;  4RF1 A;  2KFK A;  1RWS A;  4MJS B;  3KWV A;  2D3B A;  1F9J A;  1FCL A;  2XBB C;  3RMK C;  2IJ0 A;  1ENF A;  3MTN B;  3R2I A;  3B08 A;  2WXI A;  3I5J C;  4YSX B;  3UQB A;  2WLB A;  1WY8 A;  5BYR A;  3DBH B;  2SEB D;  1WMH B;  1T0Y A;  4DHZ E;  4RFB A;  1QT9 A;  2IYD B;  5IA7 A;  4RCO A;  2WXO A;  2FCN A;  1F2R C;  2M1M A;  2QJL A;  3EHV A;  1F77 A;  1STE A;  2WYQ A;  3NS1 A;  4LCD E;  1E8Y A;  3L54 A;  2NBW B;  4LJO B;  3W1Y A;  1K50 A;  2BYE A;  4EFO A;  3PZD A;  2IO0 B;  2J7Q B;  3PV1 A;  4LK0 M;  3HIZ A;  1MG4 A;  1U4A A;  4HKZ E;  2ZPN A;  3QAR A;  5C23 A;  4DHJ B;  3ZNI D;  5AUK A;  4CO7 A;  1J7B A;  2LVO A;  2PVO D;  3M3J A;  1QF6 A;  2NVU I;  2XNA C;  1I4G A;  2JXT A;  4WJN A;  5HFY A;  3M95 A;  4NAW B;  3NVY A;  1EF1 A;  3IAM 1;  1F0Z A;  2KYW A;  4IM2 A;  2CJN A;  1CZP A;  1E5W A;  2KN5 A;  2QSD A;  1P0R A;  1SJE D;  4K7U A;  1UH6 A;  5CHV C;  3RZW C;  3O13 A;  1VDV A;  3DQV A; 
#chains in the Genus database with same CATH homology
 3QHT A;  4W9H A;  5DPR A;  1D3Z A;  1Z5S B;  2WWZ A;  1OEY J;  1L2N A;  1CMX B;  3B1L X;  2RD0 A;  3N32 A;  3R3M A;  2R2O A;  4GN1 A;  2KMC A;  3PTF C;  4JGH B;  3VH4 B;  3ZTC A;  1I42 A;  2CHZ A;  3N3K B;  5AZG A;  2KJR A;  3RYT A;  3TBL D;  2KQ7 A;  2M8S A;  4FLH A;  4TUU A;  2K6D B;  2KX0 A;  1E7V A;  4I6P A;  4KIK A;  1E8W A;  1ZKH A;  2KHW B;  3VAW A;  2D3G A;  4GDL A;  2CHW A;  4WWO A;  2N9P C;  4ZRJ A;  4ZRK A;  3AI5 A;  4HWI B;  4F8C B;  1UBI A;  1UBQ A;  1ZW7 A;  3A4S C;  4G11 A;  2IBI B;  2R2Q A;  2Z0D B;  4URK A;  4MGY E;  3ENE A;  3HM6 X;  4EZJ A;  2L3Z A;  1KJT A;  2JUO A;  2Z59 B;  3PRZ A;  2KWV B;  3TCA A;  5D94 A;  1PQS A;  1WYW B;  2FIF A;  4BKG A;  1X1M A;  2GBR A;  2MP2 A;  2DHZ A;  2KTF A;  1WR1 A;  5E6N A;  2L8J A;  1EO6 A;  2M17 A;  4WAA A;  3RUL A;  2BWF A;  4II2 B;  2FCQ A;  4FN2 A;  3DVG X;  2BWE S;  3APD A;  4M8N A;  5CHF A;  4AJY B;  2V3S A;  1P1A A;  3A9J B;  4NJ6 A;  5JHB A;  3ZUN A;  2ZNV C;  2L05 A;  3A4R A;  1Q1O A;  2GBM A;  1WGR A;  3PLV A;  3P2B A;  5JHA A;  4F7Z A;  1E8X A;  4HCP B;  4PYZ A;  3WAO A;  4TQ0 A;  2KD0 A;  4II3 B;  1GJZ A;  3BY4 B;  2NBV B;  3JSV A;  4HDO A;  1VCB A;  2KC1 A;  2O6V B;  1V9J A;  4E71 A;  2KX3 A;  3CST A;  4EUT A;  4K81 A;  3H9D A;  3DVG Y;  3OJ4 B;  3H1U A;  2N1V A;  4P7I A;  2KFK B;  3ZKJ C;  1TZ1 A;  3PHX B;  2A5U A;  2FAZ A;  4BBN F;  3B0A A;  3HK0 A;  4W9K A;  1TBE A;  5L83 A;  2DZK A;  2MCN B;  3MJW A;  1SE9 A;  5HKH A;  1YX5 B;  4W9E A;  4HK2 A;  3QWZ B;  2CS4 A;  2GBN A;  3CSF A;  4IUM B;  1V5O A;  3AU5 A;  1E8Z A;  4RM8 A;  4EKU A;  4MDK E;  2JPH A;  2LVP A;  4E3C A;  1WJ6 A;  2N4F A;  3H7P B;  4BVU C;  3RD2 A;  3NS8 A;  4FHJ A;  3S2A A;  4NQL B;  2WX1 A;  3Q3J A;  4W9D A;  4W9G A;  1WM2 A;  4GIV A;  3VFK A;  3LDZ E;  5D2M B;  1C3T A;  2YLM A;  3QX1 A;  1WGG A;  4DDG D;  3PS6 A;  2GOW A;  1Q0W B;  2AEH A;  3KUC B;  4B9K A;  4ANU A;  1EUV B;  2LGD A;  3DBS A;  3R66 C;  2MBO A;  1J0G A;  3L10 B;  1V49 A;  3DDC B;  4MGZ E;  3RCZ A;  3I3T B;  1WE7 A;  2K8C A;  2DYM A;  3WAM A;  2MBQ A;  2JRH A;  4I6L B;  2I1J A;  3PRP B;  5LLI A;  2BYV E;  2AYO B;  3L16 A;  3PHW B;  1J8C A;  4NPN A;  3RUI B;  1S1Q B;  3KH0 A;  4HCN B;  3PLU A;  4IW0 A;  4ANW A;  3UIP B;  1WZ0 A;  2KK8 A;  3VXW A;  3A9K B;  4DHJ D;  4NJ7 A;  1WGY A;  1WX9 A;  2LRU A;  2BGF A;  1GUA B;  2C7H A;  1UZX B;  4DK5 A;  2EKE C;  1YIW A;  4MJS A;  2NPT A;  4CHK A;  2LAS A;  2JRI B;  3C0R B;  2HD5 B;  2ZCC A;  4FJV B;  4OVU A;  3IG3 A;  5AZH A;  2MW5 A;  2IO3 B;  1LFD A;  3JW0 X;  4EEW A;  5J17 A;  3UQA A;  4HVB A;  1HE8 A;  1SGH A;  4W9C A;  2MA9 B;  4IM0 A;  2ZJD A;  2HJ8 A;  4KIK B;  4G3X B;  1WIA A;  3VTV A;  1WR6 E;  2DX5 B;  1Z2M A;  2GMI C;  2LWP A;  5J18 A;  3CF6 E;  3A9K A;  3UIO B;  4EZK A;  2KNB A;  3M62 B;  1NI2 A;  4W9J A;  2B3A A;  1J19 A;  4M0W B;  4LJP B;  2FID A;  3APF A;  3UF8 A;  4N9F 4;  2CR5 A;  4FAD A;  3IBE A;  3M63 B;  3QK0 A;  2D10 A;  5GMV A;  3X23 A;  1XT9 B;  3OAW A;  1YX6 B;  1JRU A;  2V1Y A;  2ZVO A;  3PT2 B;  4WJP A;  2MRP A;  1MG8 A;  3APC A;  3IHP C;  2BKR B;  4IC7 B;  4RMA A;  2D2Q A;  4FBJ B;  3ALB A;  2KOX A;  1WXV A;  2J0J A;  2K8H A;  4GMV A;  2NPT B;  3LJ3 A;  3WAN A;  1V80 A;  2KTR A;  1LM8 B;  2ZVN A;  4PS7 A;  3O65 B;  2LJ5 A;  4I6N B;  2D11 A;  2L00 B;  3VUY A;  2IO2 B;  3UIN B;  4DXA B;  1E90 A;  1RFA A;  4IM3 A;  3GZN I;  2LGY A;  3ML9 A;  3QIJ A;  3SU8 X;  3V6C B;  2LVQ A;  3TIX A;  3H7S A;  4NAW A;  4A20 A;  2ASQ A;  2RR9 A;  1P3Q U;  3A33 B;  4ICV A;  1E7U A;  1V5T A;  1WGH A;  4EZL A;  2N9X A;  2DZI A;  4J6I A;  5LXH A;  2LZ6 A;  1GNU A;  2LI5 A;  3PSE B;  1M94 A;  5IAA C;  4TV3 A;  3QAQ A;  3ZW3 A;  5LXI B;  2KKC A;  5JH5 C;  5BO4 B;  1G6J A;  5KHQ A;  3VTU A;  2O2V B;  2DYB A;  1QZE A;  2K39 A;  2K6Q A;  4HJK A;  4KVG B;  4XC2 A;  3T9L A;  2D07 B;  3N30 A;  2G3Q B;  4WJO A;  5JZE B;  2K8B A;  3PRE A;  3DOW A;  2KXJ A;  4GSW A;  3NOB A;  1ZGU B;  4M8M A;  2J0M A;  2KO3 A;  3SD5 A;  4ANX A;  4HPL B;  3OJ3 A;  3QQ8 B;  2KJ6 A;  2XEW A;  3PPA A;  3VH3 B;  2VRR B;  4KZC A;  3IVF A;  2DZM A;  2NS5 A;  4ZRI A;  4E74 A;  2C5L C;  2UWQ A;  2JF5 A;  2LUE A;  1WMH A;  3ZTD A;  4HPM B;  3ZDM C;  2PPH A;  4FA6 A;  4MSM B;  1GC7 A;  4F1S A;  2MP2 B;  4MH0 E;  1WE6 A;  1RRB A;  2G45 B;  2V4L A;  2KFJ A;  1H8C A;  1AAR A;  1XD3 B;  2LD9 A;  3HM3 A;  4PS3 A;  3ZVV A;  2FNJ B;  2KQS A;  2ZPY A;  3VQI A;  5CTR C;  2IY1 B;  1GG3 A;  2LXC A;  3V61 A;  5AEK B;  4W9F A;  2KLG A;  2PE6 B;  3H7P A;  3L13 A;  5DPT A;  1RAX A;  3DBR I;  3DCG A;  2KJH B;  3DVN U;  2O2V A;  1UD7 A;  2G4S A;  5DPS A;  4AUQ C;  4BKT A;  4LDT D;  2K1F A;  2N1W A;  5G55 A;  3U7D A;  2EMS A;  2DEN B;  4NY0 A;  2JVC A;  3T8M A;  3V60 A;  1Q5W B;  1WRD B;  2DZJ A;  4FJY A;  4KV2 A;  1NBF C;  4GGQ A;  4MGI E;  1UEL A;  3VDZ A;  2DYO A;  3QCA A;  2L76 A;  1OTR B;  1WFY A;  4B6W A;  1IYF A;  2KDE B;  1R4N I;  4JLC A;  3ZLZ A;  1K8R B;  1UGM A;  4B95 A;  3AUL A;  3NY5 A;  4IWP A;  1NDD A;  1XQQ A;  3NZU A;  1R4M I;  2ZEQ A;  2REX A;  4IWQ A;  4PYU A;  3CMM B;  5E6P A;  5AZF A;  3W1S A;  2PJH A;  3AXC A;  4ZYN A;  2KDI A;  1WJN A;  1WH3 A;  2O6V A;  1ISN A;  2C9W B;  4GU2 A;  2KAN A;  2Z0E B;  4KSL C;  1TTN A;  5FR6 A;  3RZF A;  4NNJ B;  3VUX A;  5D6J B;  1BT0 A;  1C1Y B;  1OQY A;  2BYF A;  3WAL A;  4DDI D;  2JT4 B;  5L95 C;  5TR5 A;  1WF9 A;  3ZNH B;  3WA0 A;  1I35 A;  4LDT B;  3KYC D;  4HXD A;  3IFW B;  1V6E A;  3K9O B;  3DPD A;  3OLM D;  3A9J A;  5DCN A;  3SHQ A;  4GOC A;  2JZZ A;  3ZRC A;  3JVZ X;  4JQW C;  4NQK E;  2I1K A;  4BFR A;  1KLV A;  2MX2 A;  5KHO A;  4WWP A;  2RGF A;  1V2Y A;  5C1Z A;  2JY6 A;  2KDF B;  2BKF A;  5G2N A;  3QC8 B;  2CHX A;  3QA8 A;  2RSU A;  4TKN A;  3RT3 B;  4A3P A;  2G4D B;  3DBH I;  1VD2 A;  2MBH A;  2MWS B;  1WJU A;  1KOT A;  3U8Z A;  3PRM B;  5CX3 A;  5J2R A;  3KVF B;  4GDK A;  3R7R A;  3WIM A;  2A4Z A;  2KDB A;  4FJZ A;  3V6E B;  2BPS A;  2LGX A;  3U30 A;  4MEL A;  1RLF A;  2MSE D;  2LRW A;  2LXA A;  3KUD B;  1OEY A;  2K25 A;  3KW5 B;  2C7M B;  4GXB A;  2KFK A;  4BKS A;  4K7S A;  4MJS B;  2L7R A;  2AL6 A;  3D32 A;  3VVW B;  2QHO A;  2M0X A;  2AL3 A;  1YQB A;  3AU4 A;  2PEA A;  2EMT A;  3HHM A;  2KWC A;  4PS8 A;  2NR2 A;  1FXT B;  3MHS D;  2HE7 A;  1F9J A;  2CKH B;  2OOB B;  3L08 A;  4MGK E;  1WXS A;  2XBB C;  3X0W A;  1IPG A;  1P98 A;  2KZR A;  4HDQ A;  2FUH B;  3MTN B;  4JIO U;  2KLC A;  1P9D U;  2JXX A;  4BBN C;  2XK5 B;  2L0F A;  3B08 A;  3TJP A;  3A1Q A;  3ZO5 B;  4GDL B;  2O6V D;  1A5R A;  1GC6 A;  3UQB A;  3ECI A;  1WY8 A;  2DAJ A;  1SIF A;  4FHK A;  4XZ4 A;  4BKS D;  1LXD A;  2FCM A;  3EEC A;  2KVR A;  1WMH B;  1WX8 A;  3ZIM A;  4W9L A;  3ZNG C;  1T0Y A;  2NCN A;  4DHZ E;  1IP9 A;  4GDK B;  3K9P B;  5CHW A;  4ANV A;  3GOE A;  1H4R A;  2KC2 A;  2IYD B;  3EC8 A;  4MEM A;  5IA7 A;  2XK5 A;  4BOZ B;  4AOF A;  1WM3 A;  2FCN A;  2FCS A;  2GBJ A;  2M1M A;  3EHV A;  3JSV B;  1WJ4 A;  3QJZ A;  2WYQ A;  2IZV B;  2MQJ A;  5D7G A;  2PE9 A;  3DVN V;  4KZ0 A;  1LQB A;  4LCD E;  3VTW A;  3R7Q A;  1E8Y A;  1L7Y A;  1V81 A;  2AWT A;  4W9I A;  3L54 A;  2NBW B;  2NBU A;  3ONS A;  4ZDV A;  4LJO B;  1KM7 A;  1WX7 A;  2KTR B;  3W1Y A;  3V62 A;  1TGZ B;  2J0K A;  3ZRF A;  3ZNZ B;  2W9N A;  3KYD D;  2JZ3 B;  2MBB B;  2BYE A;  4IWO A;  4ASW C;  3DBL I;  4EFO A;  2C60 A;  3PZD A;  2IO0 B;  1WXM A;  3SDL C;  4JL9 A;  4HLE A;  1WGD A;  2J7Q B;  3PV1 A;  2MBE A;  3HIZ A;  4MM3 A;  2DAF A;  1U4A A;  2KWU B;  3A1Q B;  4FUL A;  5EDS A;  4EOY A;  4KDI C;  2ZPN A;  3PVL A;  3QAR A;  4IG7 B;  1V86 A;  3NHE B;  4G50 A;  5C23 A;  4AJW A;  4GB9 A;  2IO1 B;  2M4N A;  4CYE A;  4DHJ B;  3W1S C;  3ZNI D;  3L17 A;  3H6N A;  3BIN A;  4CO7 A;  3ZDT A;  4RM9 A;  1S3S G;  1WI0 A;  2N7E A;  3PGE A;  2LVO A;  4XX5 A;  4DHZ B;  4DWF A;  3ML8 A;  4WQO B;  3L0W B;  2ZZP B;  2L0T A;  3M3J A;  2ZNV B;  2NVU I;  2WX0 A;  1Y8R C;  2C7N B;  2GBK A;  4TQ1 A;  4WJN A;  3JYU A;  1OGW A;  1EF5 A;  2MLB A;  5E6O A;  4YL8 A;  3M95 A;  4NAW B;  4OVV A;  2WDT B;  4KDL B;  4KSK C;  2N7D A;  3Q3F A;  1EF1 A;  4X57 B;  4K7W A;  3VHT C;  2UYZ B;  2CU1 A;  3KUZ A;  4IM2 A;  2YVC A;  3UGB B;  4MSQ B;  3EFU A;  4BOS C;  1E5W A;  2KN5 A;  2N9E B;  2KMA A;  2JWZ A;  4WJQ A;  4A3O A;  5DPW A;  4G0N B;  1P0R A;  3NZS A;  4K7U A;  3VUW A;  3TL5 A;  4AP4 C;  4WWN A;  1UH6 A;  5CHV C;  1YJ1 A;  4ICU A;  2HTH A;  3RZW C;  3TMP B;  1WXA A;  3DQV A;  2IY0 B;  2RPQ A;  3WAP A;  4K1R B;  2OJR A;  2ZCB A;  4AWJ A;  2Y5B B;  4DBG A;  1YD8 U;  2BF8 B;  1WZ3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...