2KZRA

Solution nmr structure of ubiquitin thioesterase otu1 (ec 3.1.2.-) from mus musculus, northeast structural genomics consortium target mmt2a
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
86
structure length
86
Chain Sequence
WRVRCKAKGGTHLLQGLSSRTRLRELQGQIAAITGIAPGSQRILVGYPPECLDLSDRDITLGDLPIQSGDMLIVEEDQTRPKASPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin thioesterase OTU1
publication title Northeast Structural Genomics Consortium Target MmT2A
rcsb
source organism Mus musculus
molecule tags Hydrolase
total genus 13
structure length 86
sequence length 86
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2010-06-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2kzrA00
2LVQA 2KN5A 5HKHA 4MSQB 4II3B 4AOFA 3AU4A 3L17A 3DPDA 4I6NB 2IO0B 2FCMA 2IBIB 5L95C 5AZHA 2G3QB 2MP2A 3RT3B 3ZDMC 4BOZB 5CHVC 1PQSA 2D2QA 2IY0B 3HHMA 4EZJA 5DPWA 2YLMA 3DBSA 3IG3A 3VH4B 1YQBA 1J19A 4JQWC 4K7UA 3H7SA 3DOWA 3DCGA 2V3SA 2KWUB 2M1MA 3WAOA 5C1ZA 4KZ0A 3U7DA 3UGBB 2L0TA 2N7EA 3A4SC 2N9PC 4IUMB 4DBGA 3DVNU 2JT4B 4DDID 2PPHA 2GOWA 3R7QA 4MJSB 2B3AA 3KVFB 2L0FA 1YIWA 2JXXA 4BKSA 4KDIC 3PV1A 1ZW7A 3JVZX 2LJ5A 5D7GA 3ZDTA 3IFWB 4CO7A 3EECA 2JZZA 5JHAA 3H1UA 2C60A 2WWZA 4ZRJA 1YX5B 2IZVB 3AI5A 4URKA 4KIKB 4E3CA 2A5UA 2IO1B 3APDA 1WE7A 2L05A 4HK2A 2LZ6A 1WIAA 1RAXA 2WDTB 1WF9A 3ZNID 4JLCA 1WX9A 3TIXA 2KK8A 1KOTA 3VUWA 4NJ7A 2GBKA 4G3XB 1WMHA 1OQYA 2C7HA 5L83A 4WWNA 2KFJA 2KWVB 2AL3A 1LFDA 5LXHA 3QJZA 4ANWA 3TMPB 2KX3A 3UIPB 4AWJA 2KLCA 4ZYNA 3X23A 4ANUA 1YX6B 1NBFC 3T8MA 4AP4C 3VUXA 2L7RA 1R4NI 2C7MB 4NY0A 2BWES 2DYMA 3H9DA 4TV3A 1GG3A 2MWSB 2O6VA 1UGMA 3PS6A 3PHXB 2O2VA 4W9HA 3DVGY 2R2OA 4CHKA 4A3PA 2MX2A 4RM9A 3WIMA 3KUCB 4II2B 4IM3A 4GSWA 2DYBA 4FHJA 3W1SA 2D10A 2NR2A 2K6DB 4AJYB 2XBBC 2CR5A 4AUQC 2KFKA 4ANVA 4PYUA 4GXBA 2DX5B 2FCNA 2L76A 1GC7A 1E7VA 2PE6B 2L00B 4HCPB 3PPAA 1Z5SB 1Z2MA 1V49A 2NBVB 3A9JA 2DHZA 3QC8B 2KJHB 4K7WA 3EHVA 3WAMA 4DWFA 4F1SA 2MP2B 2BKFA 2DYOA 3VHTC 2ZCCA 2GMIC 2N1WA 2MLBA 1V5OA 3H6NA 2LWPA 3PTFC 4FHKA 2KTRB 3L13A 1XD3B 3ZTCA 2J7QB 2FCSA 2REXA 1OTRB 3L08A 3V60A 2L3ZA 4A3OA 1Q0WB 2D3GA 3ZIMA 1T0YA 4HDQA 5G2NA 2KC1A 3L54A 3A9KB 4KV2A 3UQBA 4FADA 2JRHA 2KDIA 1S1QB 3H7PB 4OVVA 2ZPNA 3DBLI 1RFAA 2K8BA 4KZCA 3OJ3A 1Q1OA 1WGRA 1E8XA 2KQSA 3EFUA 3CSTA 4NNJB 3JSVA 1KJTA 4FN2A 2KDEB 5IAAC 3VAWA 4MGIE 4MGZE 5DPTA 4LDTD 3O65B 4JGHB 2D07B 1ISNA 2BPSA 3QQ8B 4GIVA 4P7IA 4TUUA 1WJNA 2Z0EB 4NAWB 2K6QA 3ML8A 3W1SC 3BY4B 2KDBA 4EOYA 2ZVOA 5DPSA 4DXAB 3U8ZA 3VFKA 2DZMA 1WMHB 4I6PA 2A4ZA 2NPTA 2DZJA 2HJ8A 3PLVA 3UINB 1E8WA 2JUOA 2IO3B 5CTRC 4NQKE 3DBRI 4FJZA 2L8JA 4IW0A 3GZNI 1P98A 4W9EA 3PSEB 3AULA 4OVUA 1WRDB 3A1QA 1WZ3A 1AARA 3NHEB 2RGFA 4ZRIA 2KQ7A 3CMMB 1V2YA 3PREA 1FXTB 1XQQA 2QHOA 2O6VB 4W9CA 2Y5BB 3ZW3A 3QK0A 2BYEA 5CHFA 2FIFA 4W9FA 2EMTA 3KYDD 1EUVB 4FBJB 2KZRA 2WX1A 2G4SA 3VTUA 1RLFA 3NS8A 4HCNB 2FIDA 4MGKE 1WM2A 3QCAA 1IP9A 4KSLC 3ENEA 4EFOA 1WH3A 1Y8RC 2RPQA 1E8ZA 3VH3B 1GC6A 1J8CA 3KW5B 2JY6A 2XK5A 2KFKB 4GDLA 4GU2A 2LGDA 1WGGA 1TGZB 2DAJA 4BBNF 4LJOB 2M4NA 3OLMD 2DENB 2PJHA 2BYVE 3PRZA 2J0KA 4WJQA 4E71A 1TTNA 1E7UA 4DHJD 5E6NA 2MA9B 1V6EA 2AEHA 1LM8B 3PVLA 5LLIA 3HK0A 4FLHA 1WGHA 3L0WB 4BOSC 3W1YA 5CX3A 4BVUC 4EZLA 4DHJB 2LVOA 4WJPA 4F8CB 1ZKHA 2IYDB 4TKNA 5FR6A 3QHTA 1HE8A 2CU1A 4MDKE 4GB9A 4GDKB 3ZNZB 1X1MA 3VXWA 4WWPA 3KUZA 3MTNB 2Z59B 2AWTA 3VTVA 2Z0DB 2OJRA 4J6IA 2KTFA 3JSVB 2ZJDA 2LRUA 2K25A 4MEMA 4M8MA 3S2AA 1WZ0A 3ALBA 3SHQA 2CS4A 3WA0A 4DK5A 2EMSA 4BFRA 3UQAA 3N3KB 3RYTA 4IWPA 1MG8A 4GOCA 2JWZA 4W9IA 3QAQA 1A5RA 1SIFA 3A4RA 2J0JA 3IBEA 4CYEA 2NPTB 3ZRFA 3VQIA 3ECIA 3MJWA 4GMVA 2XEWA 5DPRA 3B1LX 4W9GA 1WR6E 2FCQA 3UIOB 3WANA 1RRBA 4ANXA 3ZO5B 1WXMA 1P3QU 3A1QB 4KSKC 1TZ1A 1M94A 5D2MB 2RD0A 2D11A 2PEAA 4MJSA 5J17A 3B0AA 2N1VA 3D32A 5G55A 2J0MA 2G45B 1SGHA 1V9JA 2NBWB 2GBNA 4ZRKA 2BGFA 2LUEA 4IG7B 5AZGA 5KHOA 4W9JA 3QWZB 3M62B 4BKSD 4EZKA 2CHXA 4FA6A 5E6PA 2LXAA 1NI2A 3NZSA 1EO6A 3N32A 4KIKA 4WAAA 3C0RB 1SE9A 4G0NB 4BKTA 5EDSA 3UF8A 2BYFA 2KJ6A 3K9OB 4IWOA 2WX0A 1I42A 1WR1A 4EUTA 1C3TA 4LCDE 4HVBA 3R7RA 1OEYA 4KVGB 3BINA 3L10B 1F9JA 2MBEA 4DDGD 1WGYA 4WWOA 1P9DU 2LD9A 1CMXB 3GOEA 5CHWA 3RD2A 2ZCBA 4WQOB 4B9KA 1D3ZA 1WM3A 2FUHB 3R3MA 3VVWB 3PRPB 2IY1B 2NVUI 3AXCA 3JYUA 2MBQA 4DHZE 4MH0E 3Q3JA 2AL6A 2KWCA 3OAWA 4MM3A 2JZ3B 3P2BA 3PHWB 4PS3A 2KMAA 2WYQA 5LXIB 4ICUA 3T9LA 4RMAA 2CHZA 3ZUNA 2K8CA 2JPHA 2FNJB 3DVGX 2HTHA 4ICVA 3ZVVA 3QIJA 4AJWA 2O6VD 2EKEC 3MHSD 3RCZA 4KDLB 2ZZPB 3WAPA 2KJRA 1WI0A 4K1RB 4GGQA 2KOXA 3RZWC 4DHZB 2JF5A 2LGXA 1E5WA 2K1FA 3DDCB 1S3SG 2PE9A 2ZNVC 1J0GA 3EC8A 1P0RA 4HPMB 4XC2A 4B95A 3APFA 3V6EB 4PYZA 2O2VB 4MELA 1UZXB 3QARA 3V6CB 3B08A 4IWQA 1Q5WB 2ASQA 3TBLD 3ZNHB 1H8CA 2KDFB 2KO3A 2MQJA 3I3TB 3U30A 2LXCA 3ZNGC 3DBHI 5D94A 2W9NA 1WXSA 1UH6A 2MBBB 3HM6X 4K81A 3LDZE 4WJNA 2DZIA 2ZEQA 2C7NB 2MW5A 2VRRB 2KTRA 1V5TA 4IM2A 1EF5A 3DQVA 1YD8U 2MSED 3M63B 1OGWA 1UBIA 1GUAB 1L7YA 3A33B 3A9JB 2GBMA 2RR9A 2KNBA 3A9KA 3H7PA 4HWIB 4IC7B 4W9KA 3KYCD 4K7SA 2CHWA 4FULA 3M95A 5C23A 4F7ZA 1WFYA 4HJKA 5AEKB 1UELA 2K8HA 4JL9A 4ASWC 1LXDA 2KLGA 2OOBB 1KLVA 2NBUA 5JH5C 1QZEA 1WGDA 1OEYJ 2LGYA 2ZNVB 4JIOU 2MCNB 3QX1A 3SU8X 3WALA 3VTWA 2MBOA 4EEWA 2AYOB 2LRWA 3RUIB 2N7DA 3VUYA 4RM8A 4XX5A 3N30A 4N9F4 4NQLB 5E6OA 5JZEB 4NAWA 4YL8A 3IHPC 4LJPB 3NY5A 3HM3A 2ZVNA 3APCA 4M8NA 5AZFA 3SD5A 4E74A 1NDDA 4M0WB 2C9WB 2N4FA 2FAZA 3KUDB 2UWQA 1WJ6A 1YJ1A 2CKHB 2DZKA 2K39A 3PT2B 4XZ4A 1IPGA 1U4AA 2KXJA 4GN1A 1EF1A 3L16A 1H4RA 3LJ3A 5J2RA 3ZTDA 1V86A 4MGYE 2C5LC 3IVFA 3PGEA 5D6JB 1GJZA 3X0WA 3ZKJC 2V4LA 2G4DB 1WJ4A 3M3JA 2YVCA 2JVCA 1BT0A 2HE7A 2UYZB 2I1JA 3NOBA 1WY8A 3Q3FA 1C1YB 2KANA 4IM0A 3TCAA 4W9DA 3DVNV 3VDZA 3ZRCA 2M8SA 1V80A 2KKCA 1I35A 3OJ4B 4B6WA 1GNUA 3PZDA 4MSMB 2GBRA 2LASA 1WJUA 3R66C 3V62A 2BWFA 2MRPA 3SDLC 5IA7A 1WXAA 4A20A 5BO4B 4PS7A 4I6LB 4WJOA 1G6JA 3QA8A 1VCBA 2BF8B 2JRIB 1E8YA 1UD7A 2M0XA 2ZPYA 5GMVA 3ONSA 5KHQA 3CF6E 3HIZA 1R4MI 2GBJA 4BKGA 2KX0A 4EKUA 4HLEA 5JHBA 1WX7A 2KC2A 4BBNC 2XK5B 4GDLB 1KM7A 3RZFA 1VD2A 3JW0X 4ZDVA 3K9PB 1P1AA 1L2NA 3ZLZA 3PLUA 1LQBA 3NZUA 1JRUA 2KMCA 1WE6A 2M17A 4NPNA 3ML9A 4W9LA 2KD0A 4TQ0A 4G50A 4G11A 4HPLB 4FJVB 1WYWB 4GDKA 1WX8A 2N9XA 4NJ6A 4HDOA 2R2QA 1V81A 2IO2B 2KVRA 2NS5A 2MBHA 2LVPA 1E90A 3AU5A 4X57B 2N9EB 2HD5B 5TR5A 2BKRB 1ZGUB 5J18A 1TBEA 1WXVA 1IYFA 3V61A 3RULA 4TQ1A 3CSFA 1XT9B 3PRMB 1K8RB 4FJYA 3TJPA 3TL5A 2LI5A 2NCNA 2I1KA 2KHWB 2V1YA 4HXDA 4PS8A 5DCNA 4LDTB 1UBQA 2DAFA 3KH0A 2RSUA
chains in the Genus database with same CATH superfamily
2KN5A 5HKHA 3GB1A 4YXDB 1L0VB 1PGXA 2MP2A 3RT3B 1KTKA 3DBSA 2LFIA 3IG3A 4JQWC 4K7UA 2V3SA 2KWUB 4USAA 1C79A 3VR9B 3UGBB 2L0TA 3RNCC 4US8A 2QILA 4IUMB 4DBGA 4DDID 3R2TA 2PPHA 2GOWA 4MJSB 2B3AA 3KVFB 3PV1A 4KX6B 4PT5A 4K3CA 3EECA 1FO4A 2I2YA 3H1UA 2C60A 4ZRJA 3AI5A 3SFEB 4E3CA 2A5UA 2L05A 1WIAA 2WDTB 3AB5A 3ZNID 2KK8A 4QAYA 1JMLA 1KOTA 4NJ7A 2RDBC 4BZAA 2EELA 3T3OA 4WWNA 2KFJA 2AL3A 2YEPB 1VLBA 1IGDA 1SE4A 1YN5A 5AUIA 3T8MA 1R4NI 4NY0A 5BYSA 4TV3A 2WXHA 1GG3A 3VR8B 3NVWA 3PS6A 3DVGY 1RWSA 4GSWA 1UGJA 1GAQB 3W1SA 1DOIA 2GI9A 2NR2A 2XBBC 4AUQC 2KFKA 4PYUA 2CJNA 2AQ3B 3Q14C 2ONQA 2QJLA 1Z5SB 3WAMA 2DHZA 2WXGA 3RNGC 1OQRA 3U7ZA 2GMIC 2N1WA 2MLBA 1C9FA 4LTUA 4FHKA 2KTRB 2J7QB 1OTRB 1VZ6A 3L08A 2L3ZA 3ZIMA 4HDQA 5G2NA 3UQBA 1S1QB 2J4XA 3E9SA 5FR3A 5BYRA 2IJ0A 3PZ8A 1Q1OA 1WGRA 1E8XA 3CSTA 4NNJB 1ESFA 3VAWA 5BMGA 2W3SA 4RF1A 4MGZE 4JGHB 2D07B 2NMQA 1SB3C 1WJNA 4NAWB 3ML8A 3BY4B 4HPPA 4EOYA 5DPSA 3VFKA 2QCZA 4I6PA 3Q3MC 2A4ZA 2PVOD 2HJ8A 1EWYC 3DHIC 3R8BA 1E8WA 2JUOA 2IO3B 2L8JA 1XCTL 4LNFA 4W9EA 1XLQA 3PO0A 4OVUA 2WXNA 1RYJA 3CMMB 2L52A 3TEXA 1VR9A 3ZW3A 1EUVB 2KDMA 2KZRA 1XCQL 2WX1A 3VTUA 2FIDA 2Y5CA 3ENEA 4WAFA 3FKYA 1E8ZA 1GC6A 3KW5B 4LNKA 4GDLA 5H92C 2M4NA 3RNAC 1F1HA 4WJQA 1TTNA 1E7UA 4DHJD 5LLIA 3HK0A 4EZLA 2WDRB 4DHJB 2KYWA 4NJCA 1BUIC 2BVCA 3C19A 4GDKB 1DYQA 3LXFA 3R2IA 3O13A 4WWPA 3KUZA 2Z59B 1AYFA 2L1AA 3VTVA 5BMIA 1N6ZA 4XE0A 1K50A 4ITKA 1NYRA 2K25A 3AE2B 4MEMA 3ALBA 1QILA 2EMSA 1XF5L 3RYTA 1C77A 2WP9B 1JWAD 1GB1A 1A5RA 2J0JA 4CYEA 4W9GA 2NTSA 2J52A 1SF0A 2FCQA 3WANA 2LMCA 1P7EA 3WCQA 4KSKC 2K9XA 2D11A 2PEAA 3B0AA 3D32A 1FFVA 5G55A 1SGHA 2GBNA 1K51A 3N1XC 4HROA 2BGFA 4FA6A 3CWIA 2WXFA 1L6UA 1ZDVA 3UF8A 2KJ6A 2MHJA 3EUB2 3K9OB 2WX0A 1I42A 3R7RA 1OEYA 4KVGB 2MBEA 4DDGD 1XLPA 2LD9A 1CMXB 5CHWA 2WDQB 1WM3A 3BYTB 3R3MA 1C78A 1NI3A 3AE8B 4ZHOA 2NVUI 2R61A 4MM3A 4PS3A 1B9RA 1PFDA 2KMAA 1AW7A 5LXIB 4ICUA 3T9LA 3N20C 4C4VA 2CHZA 1STEA 3DVGX 2RPVA 3ZVVA 1B1ZA 2ON8A 3RCZA 4KDLB 4N59A 3WAPA 1WGKA 1L4DB 4L1BA 3IT6B 3ZXRA 1E5WA 1FNWA 2ZNVC 4B95A 3APFA 1UZXB 3B08A 1C4AA 1Q5WB 2CU3A 1QF6A 4P1BC 2MQJA 3U30A 3FILA 2KQ4X 3GP7A 4RGMA 2LXCA 5AUKA 5D94A 1UH6A 1WYGA 2MBBB 3LDZE 2DZIA 1FMAD 2C7NB 2MW5A 1VJKA 2G1EA 1V5TA 2JYEA 1EF5A 3M63B 1L7YA 1OFFA 2IGGA 3A9KA 3H7PA 4HWIB 4IC7B 5C23A 3KYCD 4K7SA 2K8HA 2XN9C 4JL9A 1LXDA 2KLGA 4AS1A 2OOBB 1WGDA 3DBLB 3QX1A 1KFYB 3SU8X 3VTWA 2LRWA 3RUIB 2N7DA 1GOZA 4RGNA 2WLBA 2LGSA 5JZEB 1JCKB 3I5JC 2ZVNA 2H88B 3KWVA 3ZXVA 4XZ4A 2CKHB 2DZKA 1IPGA 1JWBD 1J7BA 1U4AA 1FXIA 1EF1A 3L16A 1L5PA 5J2RA 2M0AA 2WXJA 3DBRB 3Q3OC 3GZNB 3PGEA 3X0WA 3ZKJC 3AEGB 3M3JA 1F2RI 2JVCA 2HE7A 2UYZB 1TKYA 3DVNV 2RDGA 4M01A 2KKCA 4HJGE 3IXSA 3PZDA 2CJOA 2GLSA 3NZ3A 2JWUA 1MVKA 2INCC 2AQ1B 3ETRA 5BYQA 3BWUD 3BZDB 4B0MA 2BW2A 4KGRA 2N9LA 1N5WA 2KT7A 3CF6E 2GBJA 1EM7A 2D3AA 2WQYB 3ZQ4A 4GDLB 3MHZA 4DQOC 3RZFA 2D3BA 1VD2A 3JW0X 1L2NA 1P1AA 1D5XC 1LQBA 3I63C 4NPNA 4G50A 4G11A 4ZOHC 4D2KA 3EFCA 4HDOA 2E6XA 2R2QA 3NJTA 2MBHA 2BBCA 4X57B 2G9HD 5EE3A 3SEBA 2BKRB 1TBEA 2LI5A 1E7PB 2MH7A 2JX5A 2WGSA 4LDTB 2DAFA 4BOZB 2LVQA 4MSQB 1CJEA 3L17A 5AZHA 5H8YE 2G3QB 4US9A 4A6QA 1PQSA 4EZJA 2YLMA 3NG0A 2IPKD 4YSZB 3WAOA 3U7DA 4LNNA 2N7EA 5HG2A 1HA5A 2L83A 2L0FA 2JXXA 4BKSA 4KDIC 1ZW7A 2LJ5A 5D7GA 3FAHA 3IFWB 4HRSA 2JZZA 2BT6A 1FNUA 5JHAA 2IZVB 1KF6B 4HK2A 3H8HA 1WF9A 4N58A 4JLCA 1WX9A 2QEJC 3VUWA 4R3DA 2GBKA 4G3XB 1FXAA 4Q2JA 1I4PA 2BS4B 4ANWA 3TMPB 2KX3A 4AWJA 4MM3B 4ANUA 1NBFC 4AQ7A 3EA6A 3VUXA 3SFDB 2L7RA 2BWES 2MWSB 2VH1A 2IDYA 3PHXB 4W9HA 1FD6A 2WU5B 4XDDA 1FCLA 3WIMA 3KUCB 4FHJA 4RFBA 2K6DB 4ANVA 2L76A 1GC7A 2PE6B 1TZOA 3FILB 4HCPB 1HEZE 5EE0A 1V49A 2HJ1A 3QC8B 2KJHB 2J42A 2ZCCA 2WXMA 3PTFC 1SE2A 4RGTA 1E0ZA 1KRHA 2WDVB 4WH4A 1IBXA 3L54A 3A9KB 2DBYA 3H7PB 3DBLI 1RFAA 1QT9A 3OJ3A 4CQNA 4MGIE 4LK0M 4XGAB 4TUUA 1KH0A 1C4CA 3W1SC 2K6QA 1IGCA 2DZMA 1WMHB 1ET9A 2DZJA 3I57A 5CTRC 1J7CA 3N1ZC 3DBRI 4FJZA 3GZNI 3PSEB 1YMHE 1AARA 1JRPA 1V2YA 1YN3A 2QHOA 4HKZE 4C7YA 2BYEA 1J7AA 5CHFA 4W9FA 3AEFB 3MJ5A 3B9JA 3OWEB 3Q8BA 1OQQA 2FE8A 2V9HA 3AEEB 1IP9A 2BQQA 3MC0B 1Y8RC 2WXPA 2WXOA 2JU6X 1M4VA 3VH3B 1J8CA 2XK5A 1BMLC 4OZCA 1WGGA 2DAJA 1CQVA 4BBNF 3OLMD 2DENB 2PJHA 4JX1C 3PRZA 1TY0A 3PVLA 4BOSC 3Q8CA 4F8CB 1ZKHA 5FR6A 3QHTA 1HE8A 2ZW1A 3HVZA 1UWXA 3B2FA 5C3JB 4REZA 3JSVB 1I7HA 3ZYYX 4XYCA 3S2AA 1WZ0A 3SHQA 1JALA 3UQAA 3ABVB 4IWPA 2ICIA 4OZAA 2VZKD 2RDHA 1SIFA 3IBEA 3ZGZA 2NPTB 3ZRFA 2VZKB 2M56B 1WR6E 1XLNA 1WXMA 1M94A 2ACZB 2X8XX 5D2MB 5J17A 2J0MA 2Z8LA 3AEBB 1V9JA 2JXTA 3J9CA 3RMKC 2LUEA 4IG7B 5KHOA 4BKSD 1SSNA 2CHXA 2QMTA 4KKJA 1HZ5A 3TEZA 4WAAA 3BVMA 4BKTA 3DHGC 1ZXIA 2QSDA 4EUTA 1C3TA 2N9KA 1WGYA 2K5PA 4M00A 5IN7A 3VVWB 3PRPB 2IY1B 3JYUA 4DHZE 4MH0E 3OAWA 5TSSA 2HTME 4RMAA 5GXGB 3ZUNA 2FNJB 3QIJA 3AE1B 4AJWA 1UUPA 4YTNB 2ZZPB 1WI0A 1TY2A 3RZWC 1IUEA 4DHZB 2WXRA 1P0RA 4HPMB 3V6EB 4MELA 3QARA 2ASQA 1H8CA 1XXGA 3Q3NC 1SE3A 4C56C 2LEKA 3HRDD 3LB8C 1WXSA 3HM6X 1YN4A 2Y5PA 2AQ2B 4C80A 2MSED 1GUAB 1PYWD 1JWMD 3VRAB 3UI3A 4W9KA 4F7ZA 3KWLA 1UNSA 4H2AA 1TKEA 1CK1A 1IBXB 3WALA 4RM8A 3N30A 4NQLB 3PZ7A 4C7ZA 1HXYD 2W82A 1SIJA 3DWMA 3SD5A 3RI7C 4E74A 3RNEC 4KGSA 3URYA 2C9WB 3KUDB 3N1YC 4RCOA 2UWQA 3PT2B 3NVVA 3T3NA 4MT5A 1H4RA 3LJ3A 1WRIA 2JSVX 1HZ6A 3ZTDA 2C5LC 1GJZA 1N61A 1I4HA 1PGAA 1BT0A 2I1JA 1C1YB 4W9DA 3ZRCA 1V80A 1I35A 4B6WA 2W54A 3R66C 1MI0A 5G5HA 3RPFC 3SDLC 5IA7A 1FCCC 4I6LB 2BB6A 3QA8A 1VCBA 2BF8B 2KACA 4RF0A 2ZPYA 4XWWA 3HIZA 2K0PA 1ZXHA 1DOXA 3CIRB 4BBNC 2XK5B 4FXCA 4K3BA 1KM7A 2PIAA 4GLSC 3ZLZA 2KMCA 3LYYA 5FK9C 2WU2B 4TQ0A 2N9XA 2IO2B 4NAMA 2KVRA 1E90A 2N9EB 5TR5A 5J18A 1WXVA 3V61A 3RULA 4TQ1A 4FJYA 1XT9B 1K8RB 2NCNA 4JPSA 2V1YA 4PS8A 1ENFA 5DCNA 4A9AA 2WHIA 4WURA 1UF0A 3KH0A 3AN1A 2RSUA 1E9MA 4P16A 3DPDA 4I6NB 1T0QC 4IOIE 2IBIB 5L95C 3ZDMC 5CHVC 2D2QA 2IY0B 1A70A 1YQBA 2M1MA 3Q6BA 2PKOA 3A4SC 2N9PC 2PW9A 2KMMA 3R7QA 2BTEA 1JW9D 3JVZX 4JWUC 3ZDTA 1N63A 4MH8A 3P4PB 2PTLA 2IO1B 1WE7A 1RAXA 2W3RA 1WMHA 5L83A 3RN9C 3U4EG 2KWVB 3AM9A 4ZRPA 5LXHA 3QJZA 4XDCA 3UIPB 4WWMA 2O2VA 4JWSC 2R2OA 4CHKA 2MX2A 4RM9A 1I4XA 2DYBA 1TS2A 1P7FA 2D10A 4AJYB 2DX5B 2KVZA 2FCNA 2OEDA 1N5XA 3PPAA 1KLGD 2NBVB 1Z2MA 2IGDA 3A9JA 4K7WA 4DWFA 2DYOA 4YTMB 3H6NA 2LWPA 4OW0A 3L13A 1XD3B 3ZTCA 2WXKA 3V60A 4OHJA 1Q0WB 1T0YA 4YWGG 4KKIA 2XNAC 3ZJTA 2JRHA 4OVVA 2K8BA 1F2RC 4DXGA 3NVYA 3IAS1 3JSVA 1KJTA 4FN2A 2KDEB 1QOBA 4LDTD 1ISNA 2BPSA 4GIVA 2HDEA 4P7IA 2LHEA 4A55A 2ZVOA 3RNBC 4DXAB 1RFKA 1KLUD 2NPTA 3RFZB 5EE1A 3PLVA 3GS2A 4IW0A 1WSPA 2RGFA 1T5XD 4EE2A 3PREA 1FXTB 2O6VB 4W9CA 3AE9B 1FNVA 2EMTA 3BVZA 4FBJB 2N7JA 4LNOA 2G4SA 3NS8A 4HCNB 4MGKE 1WM2A 1F52A 4YTPB 2D3CA 4EFOA 1V8CA 1WH3A 3U52E 2Q5WD 2JY6A 3P42A 4GU2A 5LNK1 2LGDA 2WXLA 3B2GA 2V3NA 1JROA 1MPEA 2J0KA 4E71A 2MJDA 1V6EA 1C76A 1SBBB 3DHHC 1YQ3B 4FLHA 3W1YA 4BVUC 2LVOA 4WJPA 2CU1A 4MDKE 3ZNZB 1X1MA 3VXWA 3MTNB 2AWTA 2WXIA 4ARIA 4J6IA 2KTFA 2ZJDA 2LRUA 2PLPA 3WA0A 4DK5A 4BFRA 1F0ZA 3W2DA 2JQRB 4W9IA 1TKGA 3RNFC 1I4GA 1NEKB 2JZPA 1D6EC 3ECIA 4GMVA 2XEWA 4RH6A 4P6VF 3W5UB 4ANXA 3ZO5B 1P3QU 3A1QB 1TZ1A 2N1VA 2G45B 1FRRA 5JXVA 1JWSD 4EZKA 3QWZB 3M62B 2PMVA 2LXAA 1GPXA 1NI2A 1LO5D 3NZSA 1EO6A 3N32A 4KIKA 1SE9A 4G0NB 5EDSA 3AEDB 2BYFA 1E10A 3BINA 4WWOA 1V1PA 1P9DU 3GOEA 2ZCBA 4WQOB 1D3ZA 3GE3C 1T3QA 1L4ZB 2MBQA 1PGBA 3Q3JA 2AL6A 2KWCA 4PK1A 2JZ3B 3PHWB 2LJIA 2BS2B 4WIPA 4B0EA 5HHDG 3TEYA 2JPHA 3TSSA 2B76B 2EKEC 2KJRA 1ROEA 2KOXA 2M19A 2LGXA 2K1FA 3DDCB 1S3SG 2PE9A 3EC8A 4XC2A 4PYZA 2O2VB 2BB5A 4IWQA 3ZNHB 3TBLD 3DWGC 2KDFB 2KO3A 1DOYA 3DBHI 3AEAB 4K81A 1YNTE 4WJNA 2VRRB 4IM2A 1N60A 3DQVA 1YD8U 1UBIA 3A33B 3A9JB 2GBMA 1QOGA 2KNBA 1XLOA 3BYYB 4FULA 3M95A 5AEKB 1UELA 3MP9A 1QZEA 1OEYJ 2SEBD 2ZNVB 2MCNB 3HUIA 2MBOA 2AYOB 1LGRA 4XX5A 5HFYA 1TS5A 5I4DA 3U2SC 3TUOA 4YL8A 3NY5A 1AWDA 1NDDA 2V4IB 4M0WB 2N4FA 2FAZA 1WJ6A 2K39A 1YOVB 2K22A 3ZJUA 4MGYE 1D4BA 5D3DA 3IT4B 5T8IA 2V4LA 1WJ4A 2YVCA 4GN1A 4IM0A 2KANA 2YEPF 1FPYA 3C8YA 1D5ZC 3OJ4B 5E6JA 4MSMB 2GBRA 1WJUA 4M02A 3V62A 1V1OA 4BAXA 2BWFA 2PVGC 1WXAA 1HTQA 1T0RC 5BO4B 4PS7A 1G6JA 4LLGM 2JYTA 1E8YA 1UD7A 5GMVA 1V97A 2AX5A 1R4MI 4BKGA 2KX0A 4EKUA 1F77A 4HLEA 4ACFA 1WX7A 2KC2A 4ZDVA 3K9PB 2D5GA 3PLUA 3NZUA 1JRUA 5IP4D 1WE6A 2M17A 1Y56A 4ZYSA 3ML9A 2KD0A 3IAM1 5EE9A 1NENB 1V81A 3V05A 2VH2A 2INNE 3V3XA 4OZBA 2LVPA 3AU5A 1ZGUB 4JE3B 3CSFA 3TL5A 4P1CC 3TJPA 2LGIA 1VDVA 2KHWB 3BIID 1UBQA 3HVDA 2IGHA 4II3B 4AOFA 3AU4A 1DGJA 2IO0B 1YJJA 2FCMA 1C4PA 1MHHE 3HHMA 5DPWA 1FM0D 3VH4B 1J19A 3H7SA 4TSSA 2SAKA 3ZJVA 1ZOYB 3DOWA 3E56A 3DCGA 1WXQA 1ZE3D 5C1ZA 3MC9A 4KZ0A 3AH7A 1PUTA 2MJEA 2KN4A 3DVNU 2JT4B 5MPOA 1SXTA 1YIWA 2MJ3A 2H89B 4CO7A 3N9YC 1ET6A 2WWZA 1YX5B 2UU7A 1K53A 4URKA 4KIKB 1I4QA 3APDA 2LZ6A 3SR6A 3TIXA 1L6VA 2DWQA 2FBWB 1OQYA 1V1PB 2C7HA 2QIEB 1LFDA 2WNMA 3P63A 5BMHA 3BK1A 2KLCA 2N0SB 4ZYNA 3X23A 1YX6B 2EKIA 1TT5B 4AP4C 1SEBD 2V3PA 2C7MB 2DYMA 3H9DA 2O6VA 1UGMA 2WXQA 1FIQA 1EU4A 4A3PA 1CZPA 4II2B 4IM3A 3AE6B 5D3IB 2FUG1 1SJHD 3KLSX 2WS3B 2CR5A 4GXBA 3EGRA 1E7VA 2L00B 4MACA 1QOFA 1VZ8A 3EHVA 4F1SA 2MP2B 2BKFA 3VHTC 1V5OA 1XO3A 2FCSA 2REXA 4A3OA 4NZLB 2D3GA 2BS3B 3OG5A 2KC1A 4S17A 4KV2A 1T6BX 4FADA 2KDIA 1GB4A 2ZPNA 4KZCA 4TMAB 1SJED 2KQSA 3EFUA 2OJWA 5IAAC 2LHDA 5DPTA 3O65B 1TJEA 3AE7B 3QQ8B 2Z0EB 2KDBA 3U8ZA 3AE5B 2W55A 4L2YA 3UINB 1JQ4A 4XWTA 4NQKE 4YT0B 5G5GA 1P98A 3AE3B 3AULA 1WRDB 3A1QA 1WZ3A 2TSSA 3NHEB 4ZRIA 2KQ7A 1TS3A 1EWCA 1XQQA 4ZHPA 2Y5BB 3QK0A 2FIFA 3KYDD 2K3UA 3NVZA 4O1NA 1RLFA 3QCAA 4KSLC 2GB1A 1NYQA 2RPQA 1MFWA 4IDIA 1QOAA 5C2TB 1E6EB 3W9CB 2KFKB 1TGZB 3AMZA 4LJOB 2BYVE 1TS4A 1ZPSA 1YQ4B 1FRDA 5E6NA 2MA9B 2AEHA 1LM8B 3NRZA 3W5VB 3NUHB 1WGHA 3L0WB 5HI1A 5CX3A 2KWDA 2IYDB 4TKNA 4C00A 2OHFA 4GB9A 2DLBA 2RMMA 2Z0DB 2OJRA 1JWUD 4L23A 4HEA1 4M8MA 2CS4A 3N3KB 2L32A 1MG8A 4GOCA 3MFGA 2JWZA 3QAQA 1ZP0B 2KAJA 3A4RA 1WWTA 3DBHB 3AE4B 3VQIA 3MJWA 3VRBB 5DPRA 3B1LX 3UIOB 2I38A 2BYTA 1D5MC 1RRBA 3Q69A 3Q8FA 2RD0A 4MJSA 2NBWB 4ZRKA 5AZGA 4W9JA 1FFUA 5E6PA 4YSXB 1PDXA 1Q10A 3C0RB 1BXTA 4IWOA 1WR1A 4LCDE 3AV8A 4HVBA 4M0WA 3L10B 1F9JA 1VZ7A 3Q8EA 1L0YB 4IKGA 3RD2A 4B9KA 1UWMA 2FUHB 1EU3A 3BVGA 1I4RA 3AXCA 2INPE 3P2BA 2WYQA 4A90A 4KGTA 4RGOS 2K8CA 4ICVA 2HTHA 2O6VD 3MHSD 1R4NB 1N62A 3P4RB 4OVZA 2NTTA 1YJIA 4K1RB 1QLBB 4ZRQA 4GGQA 2JF5A 3BK2A 1J0GA 1QQRA 1NVID 3V6CB 2X38A 4UDUC 3FC4A 3AECB 3I3TB 1MG4A 4N6EB 3ZNGC 2W9NA 1ACCA 2ZEQA 1FEHA 1QKZA 2KTRA 1R4MB 2V0GA 1MJDA 4J3OD 1OGWA 1HTOA 3KQ4A 4WQMA 4DXFA 2RR9A 4S0RA 2CHWA 1WFYA 4HJKA 1T0SC 4ASWC 1KLVA 2NBUA 5JH5C 1L0XB 3MC8A 5IO9A 2LGYA 4JIOU 4EEWA 1HQRD 3VUYA 3I9V1 4N9F4 5E6OA 4NAWA 2LUMA 3IHPC 3L4PA 4LJPB 1R7SA 3HM3A 3APCA 4M8NA 5AZFA 1VRAB 1ZUD2 2INDC 1YJ1A 4A8XC 3Q2AC 2KXJA 5IKCM 2J53A 1TIFA 1V86A 1XEEA 3P4QB 3IVFA 3Q8AA 5D6JB 5FKAC 4C4VB 2QC8A 2G4DB 4YSYB 2ZW0A 4ARCA 2E3TA 3NOBA 3Q3FA 1WY8A 3TCAA 3VDZA 3NS1A 2M8SA 2QDFA 1GNUA 2LASA 2GRIA 2MRPA 3TEWA 4A20A 1MHXA 4WJOA 2MEKA 4HKQA 2JRIB 2Y3AA 2M0XA 5KHQA 3ONSA 2DNFA 1TYGB 5JHBA 5IOIA 4W9LA 1AN8A 4LNIA 4HPLB 4FJVB 1WYWB 4GDKA 1WX8A 3P4SB 4NJ6A 4RNAA 2NS5A 1RM6C 2HD5B 1K52A 3GE8C 1IYFA 3PRMB 2I1KA 4HXDA 3P1MA 1ZDXA
chains in the Genus database with same CATH topology
2LVQA 2KN5A 5HKHA 4MSQB 4II3B 4AOFA 3AU4A 3L17A 3DPDA 4I6NB 2IO0B 2FCMA 2IBIB 5L95C 5AZHA 2G3QB 2MP2A 3RT3B 3ZDMC 4BOZB 5CHVC 1PQSA 2D2QA 2IY0B 3HHMA 4EZJA 5DPWA 2YLMA 3DBSA 3IG3A 3VH4B 1YQBA 1J19A 4JQWC 4K7UA 3H7SA 3DOWA 3DCGA 2V3SA 2KWUB 2M1MA 3WAOA 5C1ZA 4KZ0A 3U7DA 3UGBB 2L0TA 2N7EA 3A4SC 2N9PC 4IUMB 4DBGA 3DVNU 2JT4B 4DDID 2PPHA 2GOWA 3R7QA 4MJSB 2B3AA 3KVFB 2L0FA 1YIWA 2JXXA 4BKSA 4KDIC 3PV1A 1ZW7A 3JVZX 2LJ5A 5D7GA 3ZDTA 3IFWB 4CO7A 3EECA 2JZZA 5JHAA 3H1UA 2C60A 2WWZA 4ZRJA 1YX5B 2IZVB 3AI5A 4URKA 4KIKB 4E3CA 2A5UA 2IO1B 3APDA 1WE7A 2L05A 4HK2A 2LZ6A 1WIAA 1RAXA 2WDTB 1WF9A 3ZNID 4JLCA 1WX9A 3TIXA 2KK8A 1KOTA 3VUWA 4NJ7A 2GBKA 4G3XB 1WMHA 1OQYA 2C7HA 5L83A 4WWNA 2KFJA 2KWVB 2AL3A 1LFDA 5LXHA 3QJZA 4ANWA 3TMPB 2KX3A 3UIPB 4AWJA 2KLCA 4ZYNA 3X23A 4ANUA 1YX6B 1NBFC 3T8MA 4AP4C 3VUXA 2L7RA 1R4NI 2C7MB 4NY0A 2BWES 2DYMA 3H9DA 4TV3A 1GG3A 2MWSB 2O6VA 1UGMA 3PS6A 3PHXB 2O2VA 4W9HA 3DVGY 2R2OA 4CHKA 4A3PA 2MX2A 4RM9A 3WIMA 3KUCB 4II2B 4IM3A 4GSWA 2DYBA 4FHJA 3W1SA 2D10A 2NR2A 2K6DB 4AJYB 2XBBC 2CR5A 4AUQC 2KFKA 4ANVA 4PYUA 4GXBA 2DX5B 2FCNA 2L76A 1GC7A 1E7VA 2PE6B 2L00B 4HCPB 3PPAA 1Z5SB 1Z2MA 1V49A 2NBVB 3A9JA 2DHZA 3QC8B 2KJHB 4K7WA 3EHVA 3WAMA 4DWFA 4F1SA 2MP2B 2BKFA 2DYOA 3VHTC 2ZCCA 2GMIC 2N1WA 2MLBA 1V5OA 3H6NA 2LWPA 3PTFC 4FHKA 2KTRB 3L13A 1XD3B 3ZTCA 2J7QB 2FCSA 2REXA 1OTRB 3L08A 3V60A 2L3ZA 4A3OA 1Q0WB 2D3GA 3ZIMA 1T0YA 4HDQA 5G2NA 2KC1A 3L54A 3A9KB 4KV2A 3UQBA 4FADA 2JRHA 2KDIA 1S1QB 3H7PB 4OVVA 2ZPNA 3DBLI 1RFAA 2K8BA 4KZCA 3OJ3A 1Q1OA 1WGRA 1E8XA 2KQSA 3EFUA 3CSTA 4NNJB 3JSVA 1KJTA 4FN2A 2KDEB 5IAAC 3VAWA 4MGIE 4MGZE 5DPTA 4LDTD 3O65B 4JGHB 2D07B 1ISNA 2BPSA 3QQ8B 4GIVA 4P7IA 4TUUA 1WJNA 2Z0EB 4NAWB 2K6QA 3ML8A 3W1SC 3BY4B 2KDBA 4EOYA 2ZVOA 5DPSA 4DXAB 3U8ZA 3VFKA 2DZMA 1WMHB 4I6PA 2A4ZA 2NPTA 2DZJA 2HJ8A 3PLVA 3UINB 1E8WA 2JUOA 2IO3B 5CTRC 4NQKE 3DBRI 4FJZA 2L8JA 4IW0A 3GZNI 1P98A 4W9EA 3PSEB 3AULA 4OVUA 1WRDB 3A1QA 1WZ3A 1AARA 3NHEB 2RGFA 4ZRIA 2KQ7A 3CMMB 1V2YA 3PREA 1FXTB 1XQQA 2QHOA 2O6VB 4W9CA 2Y5BB 3ZW3A 3QK0A 2BYEA 5CHFA 2FIFA 4W9FA 2EMTA 3KYDD 1EUVB 4FBJB 2KZRA 2WX1A 2G4SA 3VTUA 1RLFA 3NS8A 4HCNB 2FIDA 4MGKE 1WM2A 3QCAA 1IP9A 4KSLC 3ENEA 4EFOA 1WH3A 1Y8RC 2RPQA 1E8ZA 3VH3B 1GC6A 1J8CA 3KW5B 2JY6A 2XK5A 2KFKB 4GDLA 4GU2A 2LGDA 1WGGA 1TGZB 2DAJA 4BBNF 4LJOB 2M4NA 3OLMD 2DENB 2PJHA 2BYVE 3PRZA 2J0KA 4WJQA 4E71A 1TTNA 1E7UA 4DHJD 5E6NA 2MA9B 1V6EA 2AEHA 1LM8B 3PVLA 5LLIA 3HK0A 4FLHA 1WGHA 3L0WB 4BOSC 3W1YA 5CX3A 4BVUC 4EZLA 4DHJB 2LVOA 4WJPA 4F8CB 1ZKHA 2IYDB 4TKNA 5FR6A 3QHTA 1HE8A 2CU1A 4MDKE 4GB9A 4GDKB 3ZNZB 1X1MA 3VXWA 4WWPA 3KUZA 3MTNB 2Z59B 2AWTA 3VTVA 2Z0DB 2OJRA 4J6IA 2KTFA 3JSVB 2ZJDA 2LRUA 2K25A 4MEMA 4M8MA 3S2AA 1WZ0A 3ALBA 3SHQA 2CS4A 3WA0A 4DK5A 2EMSA 4BFRA 3UQAA 3N3KB 3RYTA 4IWPA 1MG8A 4GOCA 2JWZA 4W9IA 3QAQA 1A5RA 1SIFA 3A4RA 2J0JA 3IBEA 4CYEA 2NPTB 3ZRFA 3VQIA 3ECIA 3MJWA 4GMVA 2XEWA 5DPRA 3B1LX 4W9GA 1WR6E 2FCQA 3UIOB 3WANA 1RRBA 4ANXA 3ZO5B 1WXMA 1P3QU 3A1QB 4KSKC 1TZ1A 1M94A 5D2MB 2RD0A 2D11A 2PEAA 4MJSA 5J17A 3B0AA 2N1VA 3D32A 5G55A 2J0MA 2G45B 1SGHA 1V9JA 2NBWB 2GBNA 4ZRKA 2BGFA 2LUEA 4IG7B 5AZGA 5KHOA 4W9JA 3QWZB 3M62B 4BKSD 4EZKA 2CHXA 4FA6A 5E6PA 2LXAA 1NI2A 3NZSA 1EO6A 3N32A 4KIKA 4WAAA 3C0RB 1SE9A 4G0NB 4BKTA 5EDSA 3UF8A 2BYFA 2KJ6A 3K9OB 4IWOA 2WX0A 1I42A 1WR1A 4EUTA 1C3TA 4LCDE 4HVBA 3R7RA 1OEYA 4KVGB 3BINA 3L10B 1F9JA 2MBEA 4DDGD 1WGYA 4WWOA 1P9DU 2LD9A 1CMXB 3GOEA 5CHWA 3RD2A 2ZCBA 4WQOB 4B9KA 1D3ZA 1WM3A 2FUHB 3R3MA 3VVWB 3PRPB 2IY1B 2NVUI 3AXCA 3JYUA 2MBQA 4DHZE 4MH0E 3Q3JA 2AL6A 2KWCA 3OAWA 4MM3A 2JZ3B 3P2BA 3PHWB 4PS3A 2KMAA 2WYQA 5LXIB 4ICUA 3T9LA 4RMAA 2CHZA 3ZUNA 2K8CA 2JPHA 2FNJB 3DVGX 2HTHA 4ICVA 3ZVVA 3QIJA 4AJWA 2O6VD 2EKEC 3MHSD 3RCZA 4KDLB 2ZZPB 3WAPA 2KJRA 1WI0A 4K1RB 4GGQA 2KOXA 3RZWC 4DHZB 2JF5A 2LGXA 1E5WA 2K1FA 3DDCB 1S3SG 2PE9A 2ZNVC 1J0GA 3EC8A 1P0RA 4HPMB 4XC2A 4B95A 3APFA 3V6EB 4PYZA 2O2VB 4MELA 1UZXB 3QARA 3V6CB 3B08A 4IWQA 1Q5WB 2ASQA 3TBLD 3ZNHB 1H8CA 2KDFB 2KO3A 2MQJA 3I3TB 3U30A 2LXCA 3ZNGC 3DBHI 5D94A 2W9NA 1WXSA 1UH6A 2MBBB 3HM6X 4K81A 3LDZE 4WJNA 2DZIA 2ZEQA 2C7NB 2MW5A 2VRRB 2KTRA 1V5TA 4IM2A 1EF5A 3DQVA 1YD8U 2MSED 3M63B 1OGWA 1UBIA 1GUAB 1L7YA 3A33B 3A9JB 2GBMA 2RR9A 2KNBA 3A9KA 3H7PA 4HWIB 4IC7B 4W9KA 3KYCD 4K7SA 2CHWA 4FULA 3M95A 5C23A 4F7ZA 1WFYA 4HJKA 5AEKB 1UELA 2K8HA 4JL9A 4ASWC 1LXDA 2KLGA 2OOBB 1KLVA 2NBUA 5JH5C 1QZEA 1WGDA 1OEYJ 2LGYA 2ZNVB 4JIOU 2MCNB 3QX1A 3SU8X 3WALA 3VTWA 2MBOA 4EEWA 2AYOB 2LRWA 3RUIB 2N7DA 3VUYA 4RM8A 4XX5A 3N30A 4N9F4 4NQLB 5E6OA 5JZEB 4NAWA 4YL8A 3IHPC 4LJPB 3NY5A 3HM3A 2ZVNA 3APCA 4M8NA 5AZFA 3SD5A 4E74A 1NDDA 4M0WB 2C9WB 2N4FA 2FAZA 3KUDB 2UWQA 1WJ6A 1YJ1A 2CKHB 2DZKA 2K39A 3PT2B 4XZ4A 1IPGA 1U4AA 2KXJA 4GN1A 1EF1A 3L16A 1H4RA 3LJ3A 5J2RA 3ZTDA 1V86A 4MGYE 2C5LC 3IVFA 3PGEA 5D6JB 1GJZA 3X0WA 3ZKJC 2V4LA 2G4DB 1WJ4A 3M3JA 2YVCA 2JVCA 1BT0A 2HE7A 2UYZB 2I1JA 3NOBA 1WY8A 3Q3FA 1C1YB 2KANA 4IM0A 3TCAA 4W9DA 3DVNV 3VDZA 3ZRCA 2M8SA 1V80A 2KKCA 1I35A 3OJ4B 4B6WA 1GNUA 3PZDA 4MSMB 2GBRA 2LASA 1WJUA 3R66C 3V62A 2BWFA 2MRPA 3SDLC 5IA7A 1WXAA 4A20A 5BO4B 4PS7A 4I6LB 4WJOA 1G6JA 3QA8A 1VCBA 2BF8B 2JRIB 1E8YA 1UD7A 2M0XA 2ZPYA 5GMVA 3ONSA 5KHQA 3CF6E 3HIZA 1R4MI 2GBJA 4BKGA 2KX0A 4EKUA 4HLEA 5JHBA 1WX7A 2KC2A 4BBNC 2XK5B 4GDLB 1KM7A 3RZFA 1VD2A 3JW0X 4ZDVA 3K9PB 1P1AA 1L2NA 3ZLZA 3PLUA 1LQBA 3NZUA 1JRUA 2KMCA 1WE6A 2M17A 4NPNA 3ML9A 4W9LA 2KD0A 4TQ0A 4G50A 4G11A 4HPLB 4FJVB 1WYWB 4GDKA 1WX8A 2N9XA 4NJ6A 4HDOA 2R2QA 1V81A 2IO2B 2KVRA 2NS5A 2MBHA 2LVPA 1E90A 3AU5A 4X57B 2N9EB 2HD5B 5TR5A 2BKRB 1ZGUB 5J18A 1TBEA 1WXVA 1IYFA 3V61A 3RULA 4TQ1A 3CSFA 1XT9B 3PRMB 1K8RB 4FJYA 3TJPA 3TL5A 2LI5A 2NCNA 2I1KA 2KHWB 2V1YA 4HXDA 4PS8A 5DCNA 4LDTB 1UBQA 2DAFA 3KH0A 2RSUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LVQ A;  2KN5 A;  5HKH A;  4MSQ B;  4II3 B;  4AOF A;  3AU4 A;  3L17 A;  3DPD A;  4I6N B;  2IO0 B;  2FCM A;  2IBI B;  5L95 C;  5AZH A;  2G3Q B;  2MP2 A;  3RT3 B;  3ZDM C;  4BOZ B;  5CHV C;  1PQS A;  2D2Q A;  2IY0 B;  3HHM A;  4EZJ A;  5DPW A;  2YLM A;  3DBS A;  3IG3 A;  3VH4 B;  1YQB A;  1J19 A;  4JQW C;  4K7U A;  3H7S A;  3DOW A;  3DCG A;  2V3S A;  2KWU B;  2M1M A;  3WAO A;  5C1Z A;  4KZ0 A;  3U7D A;  3UGB B;  2L0T A;  2N7E A;  3A4S C;  2N9P C;  4IUM B;  4DBG A;  3DVN U;  2JT4 B;  4DDI D;  2PPH A;  2GOW A;  3R7Q A;  4MJS B;  2B3A A;  3KVF B;  2L0F A;  1YIW A;  2JXX A;  4BKS A;  4KDI C;  3PV1 A;  1ZW7 A;  3JVZ X;  2LJ5 A;  5D7G A;  3ZDT A;  3IFW B;  4CO7 A;  3EEC A;  2JZZ A;  5JHA A;  3H1U A;  2C60 A;  2WWZ A;  4ZRJ A;  1YX5 B;  2IZV B;  3AI5 A;  4URK A;  4KIK B;  4E3C A;  2A5U A;  2IO1 B;  3APD A;  1WE7 A;  2L05 A;  4HK2 A;  2LZ6 A;  1WIA A;  1RAX A;  2WDT B;  1WF9 A;  3ZNI D;  4JLC A;  1WX9 A;  3TIX A;  2KK8 A;  1KOT A;  3VUW A;  4NJ7 A;  2GBK A;  4G3X B;  1WMH A;  1OQY A;  2C7H A;  5L83 A;  4WWN A;  2KFJ A;  2KWV B;  2AL3 A;  1LFD A;  5LXH A;  3QJZ A;  4ANW A;  3TMP B;  2KX3 A;  3UIP B;  4AWJ A;  2KLC A;  4ZYN A;  3X23 A;  4ANU A;  1YX6 B;  1NBF C;  3T8M A;  4AP4 C;  3VUX A;  2L7R A;  1R4N I;  2C7M B;  4NY0 A;  2BWE S;  2DYM A;  3H9D A;  4TV3 A;  1GG3 A;  2MWS B;  2O6V A;  1UGM A;  3PS6 A;  3PHX B;  2O2V A;  4W9H A;  3DVG Y;  2R2O A;  4CHK A;  4A3P A;  2MX2 A;  4RM9 A;  3WIM A;  3KUC B;  4II2 B;  4IM3 A;  4GSW A;  2DYB A;  4FHJ A;  3W1S A;  2D10 A;  2NR2 A;  2K6D B;  4AJY B;  2XBB C;  2CR5 A;  4AUQ C;  2KFK A;  4ANV A;  4PYU A;  4GXB A;  2DX5 B;  2FCN A;  2L76 A;  1GC7 A;  1E7V A;  2PE6 B;  2L00 B;  4HCP B;  3PPA A;  1Z5S B;  1Z2M A;  1V49 A;  2NBV B;  3A9J A;  2DHZ A;  3QC8 B;  2KJH B;  4K7W A;  3EHV A;  3WAM A;  4DWF A;  4F1S A;  2MP2 B;  2BKF A;  2DYO A;  3VHT C;  2ZCC A;  2GMI C;  2N1W A;  2MLB A;  1V5O A;  3H6N A;  2LWP A;  3PTF C;  4FHK A;  2KTR B;  3L13 A;  1XD3 B;  3ZTC A;  2J7Q B;  2FCS A;  2REX A;  1OTR B;  3L08 A;  3V60 A;  2L3Z A;  4A3O A;  1Q0W B;  2D3G A;  3ZIM A;  1T0Y A;  4HDQ A;  5G2N A;  2KC1 A;  3L54 A;  3A9K B;  4KV2 A;  3UQB A;  4FAD A;  2JRH A;  2KDI A;  1S1Q B;  3H7P B;  4OVV A;  2ZPN A;  3DBL I;  1RFA A;  2K8B A;  4KZC A;  3OJ3 A;  1Q1O A;  1WGR A;  1E8X A;  2KQS A;  3EFU A;  3CST A;  4NNJ B;  3JSV A;  1KJT A;  4FN2 A;  2KDE B;  5IAA C;  3VAW A;  4MGI E;  4MGZ E;  5DPT A;  4LDT D;  3O65 B;  4JGH B;  2D07 B;  1ISN A;  2BPS A;  3QQ8 B;  4GIV A;  4P7I A;  4TUU A;  1WJN A;  2Z0E B;  4NAW B;  2K6Q A;  3ML8 A;  3W1S C;  3BY4 B;  2KDB A;  4EOY A;  2ZVO A;  5DPS A;  4DXA B;  3U8Z A;  3VFK A;  2DZM A;  1WMH B;  4I6P A;  2A4Z A;  2NPT A;  2DZJ A;  2HJ8 A;  3PLV A;  3UIN B;  1E8W A;  2JUO A;  2IO3 B;  5CTR C;  4NQK E;  3DBR I;  4FJZ A;  2L8J A;  4IW0 A;  3GZN I;  1P98 A;  4W9E A;  3PSE B;  3AUL A;  4OVU A;  1WRD B;  3A1Q A;  1WZ3 A;  1AAR A;  3NHE B;  2RGF A;  4ZRI A;  2KQ7 A;  3CMM B;  1V2Y A;  3PRE A;  1FXT B;  1XQQ A;  2QHO A;  2O6V B;  4W9C A;  2Y5B B;  3ZW3 A;  3QK0 A;  2BYE A;  5CHF A;  2FIF A;  4W9F A;  2EMT A;  3KYD D;  1EUV B;  4FBJ B;  2KZR A;  2WX1 A;  2G4S A;  3VTU A;  1RLF A;  3NS8 A;  4HCN B;  2FID A;  4MGK E;  1WM2 A;  3QCA A;  1IP9 A;  4KSL C;  3ENE A;  4EFO A;  1WH3 A;  1Y8R C;  2RPQ A;  1E8Z A;  3VH3 B;  1GC6 A;  1J8C A;  3KW5 B;  2JY6 A;  2XK5 A;  2KFK B;  4GDL A;  4GU2 A;  2LGD A;  1WGG A;  1TGZ B;  2DAJ A;  4BBN F;  4LJO B;  2M4N A;  3OLM D;  2DEN B;  2PJH A;  2BYV E;  3PRZ A;  2J0K A;  4WJQ A;  4E71 A;  1TTN A;  1E7U A;  4DHJ D;  5E6N A;  2MA9 B;  1V6E A;  2AEH A;  1LM8 B;  3PVL A;  5LLI A;  3HK0 A;  4FLH A;  1WGH A;  3L0W B;  4BOS C;  3W1Y A;  5CX3 A;  4BVU C;  4EZL A;  4DHJ B;  2LVO A;  4WJP A;  4F8C B;  1ZKH A;  2IYD B;  4TKN A;  5FR6 A;  3QHT A;  1HE8 A;  2CU1 A;  4MDK E;  4GB9 A;  4GDK B;  3ZNZ B;  1X1M A;  3VXW A;  4WWP A;  3KUZ A;  3MTN B;  2Z59 B;  2AWT A;  3VTV A;  2Z0D B;  2OJR A;  4J6I A;  2KTF A;  3JSV B;  2ZJD A;  2LRU A;  2K25 A;  4MEM A;  4M8M A;  3S2A A;  1WZ0 A;  3ALB A;  3SHQ A;  2CS4 A;  3WA0 A;  4DK5 A;  2EMS A;  4BFR A;  3UQA A;  3N3K B;  3RYT A;  4IWP A;  1MG8 A;  4GOC A;  2JWZ A;  4W9I A;  3QAQ A;  1A5R A;  1SIF A;  3A4R A;  2J0J A;  3IBE A;  4CYE A;  2NPT B;  3ZRF A;  3VQI A;  3ECI A;  3MJW A;  4GMV A;  2XEW A;  5DPR A;  3B1L X;  4W9G A;  1WR6 E;  2FCQ A;  3UIO B;  3WAN A;  1RRB A;  4ANX A;  3ZO5 B;  1WXM A;  1P3Q U;  3A1Q B;  4KSK C;  1TZ1 A;  1M94 A;  5D2M B;  2RD0 A;  2D11 A;  2PEA A;  4MJS A;  5J17 A;  3B0A A;  2N1V A;  3D32 A;  5G55 A;  2J0M A;  2G45 B;  1SGH A;  1V9J A;  2NBW B;  2GBN A;  4ZRK A;  2BGF A;  2LUE A;  4IG7 B;  5AZG A;  5KHO A;  4W9J A;  3QWZ B;  3M62 B;  4BKS D;  4EZK A;  2CHX A;  4FA6 A;  5E6P A;  2LXA A;  1NI2 A;  3NZS A;  1EO6 A;  3N32 A;  4KIK A;  4WAA A;  3C0R B;  1SE9 A;  4G0N B;  4BKT A;  5EDS A;  3UF8 A;  2BYF A;  2KJ6 A;  3K9O B;  4IWO A;  2WX0 A;  1I42 A;  1WR1 A;  4EUT A;  1C3T A;  4LCD E;  4HVB A;  3R7R A;  1OEY A;  4KVG B;  3BIN A;  3L10 B;  1F9J A;  2MBE A;  4DDG D;  1WGY A;  4WWO A;  1P9D U;  2LD9 A;  1CMX B;  3GOE A;  5CHW A;  3RD2 A;  2ZCB A;  4WQO B;  4B9K A;  1D3Z A;  1WM3 A;  2FUH B;  3R3M A;  3VVW B;  3PRP B;  2IY1 B;  2NVU I;  3AXC A;  3JYU A;  2MBQ A;  4DHZ E;  4MH0 E;  3Q3J A;  2AL6 A;  2KWC A;  3OAW A;  4MM3 A;  2JZ3 B;  3P2B A;  3PHW B;  4PS3 A;  2KMA A;  2WYQ A;  5LXI B;  4ICU A;  3T9L A;  4RMA A;  2CHZ A;  3ZUN A;  2K8C A;  2JPH A;  2FNJ B;  3DVG X;  2HTH A;  4ICV A;  3ZVV A;  3QIJ A;  4AJW A;  2O6V D;  2EKE C;  3MHS D;  3RCZ A;  4KDL B;  2ZZP B;  3WAP A;  2KJR A;  1WI0 A;  4K1R B;  4GGQ A;  2KOX A;  3RZW C;  4DHZ B;  2JF5 A;  2LGX A;  1E5W A;  2K1F A;  3DDC B;  1S3S G;  2PE9 A;  2ZNV C;  1J0G A;  3EC8 A;  1P0R A;  4HPM B;  4XC2 A;  4B95 A;  3APF A;  3V6E B;  4PYZ A;  2O2V B;  4MEL A;  1UZX B;  3QAR A;  3V6C B;  3B08 A;  4IWQ A;  1Q5W B;  2ASQ A;  3TBL D;  3ZNH B;  1H8C A;  2KDF B;  2KO3 A;  2MQJ A;  3I3T B;  3U30 A;  2LXC A;  3ZNG C;  3DBH I;  5D94 A;  2W9N A;  1WXS A;  1UH6 A;  2MBB B;  3HM6 X;  4K81 A;  3LDZ E;  4WJN A;  2DZI A;  2ZEQ A;  2C7N B;  2MW5 A;  2VRR B;  2KTR A;  1V5T A;  4IM2 A;  1EF5 A;  3DQV A;  1YD8 U;  2MSE D;  3M63 B;  1OGW A;  1UBI A;  1GUA B;  1L7Y A;  3A33 B;  3A9J B;  2GBM A;  2RR9 A;  2KNB A;  3A9K A;  3H7P A;  4HWI B;  4IC7 B;  4W9K A;  3KYC D;  4K7S A;  2CHW A;  4FUL A;  3M95 A;  5C23 A;  4F7Z A;  1WFY A;  4HJK A;  5AEK B;  1UEL A;  2K8H A;  4JL9 A;  4ASW C;  1LXD A;  2KLG A;  2OOB B;  1KLV A;  2NBU A;  5JH5 C;  1QZE A;  1WGD A;  1OEY J;  2LGY A;  2ZNV B;  4JIO U;  2MCN B;  3QX1 A;  3SU8 X;  3WAL A;  3VTW A;  2MBO A;  4EEW A;  2AYO B;  2LRW A;  3RUI B;  2N7D A;  3VUY A;  4RM8 A;  4XX5 A;  3N30 A;  4N9F 4;  4NQL B;  5E6O A;  5JZE B;  4NAW A;  4YL8 A;  3IHP C;  4LJP B;  3NY5 A;  3HM3 A;  2ZVN A;  3APC A;  4M8N A;  5AZF A;  3SD5 A;  4E74 A;  1NDD A;  4M0W B;  2C9W B;  2N4F A;  2FAZ A;  3KUD B;  2UWQ A;  1WJ6 A;  1YJ1 A;  2CKH B;  2DZK A;  2K39 A;  3PT2 B;  4XZ4 A;  1IPG A;  1U4A A;  2KXJ A;  4GN1 A;  1EF1 A;  3L16 A;  1H4R A;  3LJ3 A;  5J2R A;  3ZTD A;  1V86 A;  4MGY E;  2C5L C;  3IVF A;  3PGE A;  5D6J B;  1GJZ A;  3X0W A;  3ZKJ C;  2V4L A;  2G4D B;  1WJ4 A;  3M3J A;  2YVC A;  2JVC A;  1BT0 A;  2HE7 A;  2UYZ B;  2I1J A;  3NOB A;  1WY8 A;  3Q3F A;  1C1Y B;  2KAN A;  4IM0 A;  3TCA A;  4W9D A;  3DVN V;  3VDZ A;  3ZRC A;  2M8S A;  1V80 A;  2KKC A;  1I35 A;  3OJ4 B;  4B6W A;  1GNU A;  3PZD A;  4MSM B;  2GBR A;  2LAS A;  1WJU A;  3R66 C;  3V62 A;  2BWF A;  2MRP A;  3SDL C;  5IA7 A;  1WXA A;  4A20 A;  5BO4 B;  4PS7 A;  4I6L B;  4WJO A;  1G6J A;  3QA8 A;  1VCB A;  2BF8 B;  2JRI B;  1E8Y A;  1UD7 A;  2M0X A;  2ZPY A;  5GMV A;  3ONS A;  5KHQ A;  3CF6 E;  3HIZ A;  1R4M I;  2GBJ A;  4BKG A;  2KX0 A;  4EKU A;  4HLE A;  5JHB A;  1WX7 A;  2KC2 A;  4BBN C;  2XK5 B;  4GDL B;  1KM7 A;  3RZF A;  1VD2 A;  3JW0 X;  4ZDV A;  3K9P B;  1P1A A;  1L2N A;  3ZLZ A;  3PLU A;  1LQB A;  3NZU A;  1JRU A;  2KMC A;  1WE6 A;  2M17 A;  4NPN A;  3ML9 A;  4W9L A;  2KD0 A;  4TQ0 A;  4G50 A;  4G11 A;  4HPL B;  4FJV B;  1WYW B;  4GDK A;  1WX8 A;  2N9X A;  4NJ6 A;  4HDO A;  2R2Q A;  1V81 A;  2IO2 B;  2KVR A;  2NS5 A;  2MBH A;  2LVP A;  1E90 A;  3AU5 A;  4X57 B;  2N9E B;  2HD5 B;  5TR5 A;  2BKR B;  1ZGU B;  5J18 A;  1TBE A;  1WXV A;  1IYF A;  3V61 A;  3RUL A;  4TQ1 A;  3CSF A;  1XT9 B;  3PRM B;  1K8R B;  4FJY A;  3TJP A;  3TL5 A;  2LI5 A;  2NCN A;  2I1K A;  2KHW B;  2V1Y A;  4HXD A;  4PS8 A;  5DCN A;  4LDT B;  1UBQ A;  2DAF A;  3KH0 A;  2RSU A; 
#chains in the Genus database with same CATH topology
 2KN5 A;  5HKH A;  3GB1 A;  4YXD B;  1L0V B;  1PGX A;  2MP2 A;  3RT3 B;  1KTK A;  3DBS A;  2LFI A;  3IG3 A;  4JQW C;  4K7U A;  2V3S A;  2KWU B;  4USA A;  1C79 A;  3VR9 B;  3UGB B;  2L0T A;  3RNC C;  4US8 A;  2QIL A;  4IUM B;  4DBG A;  4DDI D;  3R2T A;  2PPH A;  2GOW A;  4MJS B;  2B3A A;  3KVF B;  3PV1 A;  4KX6 B;  4PT5 A;  4K3C A;  3EEC A;  1FO4 A;  2I2Y A;  3H1U A;  2C60 A;  4ZRJ A;  3AI5 A;  3SFE B;  4E3C A;  2A5U A;  2L05 A;  1WIA A;  2WDT B;  3AB5 A;  3ZNI D;  2KK8 A;  4QAY A;  1JML A;  1KOT A;  4NJ7 A;  2RDB C;  4BZA A;  2EEL A;  3T3O A;  4WWN A;  2KFJ A;  2AL3 A;  2YEP B;  1VLB A;  1IGD A;  1SE4 A;  1YN5 A;  5AUI A;  3T8M A;  1R4N I;  4NY0 A;  5BYS A;  4TV3 A;  2WXH A;  1GG3 A;  3VR8 B;  3NVW A;  3PS6 A;  3DVG Y;  1RWS A;  4GSW A;  1UGJ A;  1GAQ B;  3W1S A;  1DOI A;  2GI9 A;  2NR2 A;  2XBB C;  4AUQ C;  2KFK A;  4PYU A;  2CJN A;  2AQ3 B;  3Q14 C;  2ONQ A;  2QJL A;  1Z5S B;  3WAM A;  2DHZ A;  2WXG A;  3RNG C;  1OQR A;  3U7Z A;  2GMI C;  2N1W A;  2MLB A;  1C9F A;  4LTU A;  4FHK A;  2KTR B;  2J7Q B;  1OTR B;  1VZ6 A;  3L08 A;  2L3Z A;  3ZIM A;  4HDQ A;  5G2N A;  3UQB A;  1S1Q B;  2J4X A;  3E9S A;  5FR3 A;  5BYR A;  2IJ0 A;  3PZ8 A;  1Q1O A;  1WGR A;  1E8X A;  3CST A;  4NNJ B;  1ESF A;  3VAW A;  5BMG A;  2W3S A;  4RF1 A;  4MGZ E;  4JGH B;  2D07 B;  2NMQ A;  1SB3 C;  1WJN A;  4NAW B;  3ML8 A;  3BY4 B;  4HPP A;  4EOY A;  5DPS A;  3VFK A;  2QCZ A;  4I6P A;  3Q3M C;  2A4Z A;  2PVO D;  2HJ8 A;  1EWY C;  3DHI C;  3R8B A;  1E8W A;  2JUO A;  2IO3 B;  2L8J A;  1XCT L;  4LNF A;  4W9E A;  1XLQ A;  3PO0 A;  4OVU A;  2WXN A;  1RYJ A;  3CMM B;  2L52 A;  3TEX A;  1VR9 A;  3ZW3 A;  1EUV B;  2KDM A;  2KZR A;  1XCQ L;  2WX1 A;  3VTU A;  2FID A;  2Y5C A;  3ENE A;  4WAF A;  3FKY A;  1E8Z A;  1GC6 A;  3KW5 B;  4LNK A;  4GDL A;  5H92 C;  2M4N A;  3RNA C;  1F1H A;  4WJQ A;  1TTN A;  1E7U A;  4DHJ D;  5LLI A;  3HK0 A;  4EZL A;  2WDR B;  4DHJ B;  2KYW A;  4NJC A;  1BUI C;  2BVC A;  3C19 A;  4GDK B;  1DYQ A;  3LXF A;  3R2I A;  3O13 A;  4WWP A;  3KUZ A;  2Z59 B;  1AYF A;  2L1A A;  3VTV A;  5BMI A;  1N6Z A;  4XE0 A;  1K50 A;  4ITK A;  1NYR A;  2K25 A;  3AE2 B;  4MEM A;  3ALB A;  1QIL A;  2EMS A;  1XF5 L;  3RYT A;  1C77 A;  2WP9 B;  1JWA D;  1GB1 A;  1A5R A;  2J0J A;  4CYE A;  4W9G A;  2NTS A;  2J52 A;  1SF0 A;  2FCQ A;  3WAN A;  2LMC A;  1P7E A;  3WCQ A;  4KSK C;  2K9X A;  2D11 A;  2PEA A;  3B0A A;  3D32 A;  1FFV A;  5G55 A;  1SGH A;  2GBN A;  1K51 A;  3N1X C;  4HRO A;  2BGF A;  4FA6 A;  3CWI A;  2WXF A;  1L6U A;  1ZDV A;  3UF8 A;  2KJ6 A;  2MHJ A;  3EUB 2;  3K9O B;  2WX0 A;  1I42 A;  3R7R A;  1OEY A;  4KVG B;  2MBE A;  4DDG D;  1XLP A;  2LD9 A;  1CMX B;  5CHW A;  2WDQ B;  1WM3 A;  3BYT B;  3R3M A;  1C78 A;  1NI3 A;  3AE8 B;  4ZHO A;  2NVU I;  2R61 A;  4MM3 A;  4PS3 A;  1B9R A;  1PFD A;  2KMA A;  1AW7 A;  5LXI B;  4ICU A;  3T9L A;  3N20 C;  4C4V A;  2CHZ A;  1STE A;  3DVG X;  2RPV A;  3ZVV A;  1B1Z A;  2ON8 A;  3RCZ A;  4KDL B;  4N59 A;  3WAP A;  1WGK A;  1L4D B;  4L1B A;  3IT6 B;  3ZXR A;  1E5W A;  1FNW A;  2ZNV C;  4B95 A;  3APF A;  1UZX B;  3B08 A;  1C4A A;  1Q5W B;  2CU3 A;  1QF6 A;  4P1B C;  2MQJ A;  3U30 A;  3FIL A;  2KQ4 X;  3GP7 A;  4RGM A;  2LXC A;  5AUK A;  5D94 A;  1UH6 A;  1WYG A;  2MBB B;  3LDZ E;  2DZI A;  1FMA D;  2C7N B;  2MW5 A;  1VJK A;  2G1E A;  1V5T A;  2JYE A;  1EF5 A;  3M63 B;  1L7Y A;  1OFF A;  2IGG A;  3A9K A;  3H7P A;  4HWI B;  4IC7 B;  5C23 A;  3KYC D;  4K7S A;  2K8H A;  2XN9 C;  4JL9 A;  1LXD A;  2KLG A;  4AS1 A;  2OOB B;  1WGD A;  3DBL B;  3QX1 A;  1KFY B;  3SU8 X;  3VTW A;  2LRW A;  3RUI B;  2N7D A;  1GOZ A;  4RGN A;  2WLB A;  2LGS A;  5JZE B;  1JCK B;  3I5J C;  2ZVN A;  2H88 B;  3KWV A;  3ZXV A;  4XZ4 A;  2CKH B;  2DZK A;  1IPG A;  1JWB D;  1J7B A;  1U4A A;  1FXI A;  1EF1 A;  3L16 A;  1L5P A;  5J2R A;  2M0A A;  2WXJ A;  3DBR B;  3Q3O C;  3GZN B;  3PGE A;  3X0W A;  3ZKJ C;  3AEG B;  3M3J A;  1F2R I;  2JVC A;  2HE7 A;  2UYZ B;  1TKY A;  3DVN V;  2RDG A;  4M01 A;  2KKC A;  4HJG E;  3IXS A;  3PZD A;  2CJO A;  2GLS A;  3NZ3 A;  2JWU A;  1MVK A;  2INC C;  2AQ1 B;  3ETR A;  5BYQ A;  3BWU D;  3BZD B;  4B0M A;  2BW2 A;  4KGR A;  2N9L A;  1N5W A;  2KT7 A;  3CF6 E;  2GBJ A;  1EM7 A;  2D3A A;  2WQY B;  3ZQ4 A;  4GDL B;  3MHZ A;  4DQO C;  3RZF A;  2D3B A;  1VD2 A;  3JW0 X;  1L2N A;  1P1A A;  1D5X C;  1LQB A;  3I63 C;  4NPN A;  4G50 A;  4G11 A;  4ZOH C;  4D2K A;  3EFC A;  4HDO A;  2E6X A;  2R2Q A;  3NJT A;  2MBH A;  2BBC A;  4X57 B;  2G9H D;  5EE3 A;  3SEB A;  2BKR B;  1TBE A;  2LI5 A;  1E7P B;  2MH7 A;  2JX5 A;  2WGS A;  4LDT B;  2DAF A;  4BOZ B;  2LVQ A;  4MSQ B;  1CJE A;  3L17 A;  5AZH A;  5H8Y E;  2G3Q B;  4US9 A;  4A6Q A;  1PQS A;  4EZJ A;  2YLM A;  3NG0 A;  2IPK D;  4YSZ B;  3WAO A;  3U7D A;  4LNN A;  2N7E A;  5HG2 A;  1HA5 A;  2L83 A;  2L0F A;  2JXX A;  4BKS A;  4KDI C;  1ZW7 A;  2LJ5 A;  5D7G A;  3FAH A;  3IFW B;  4HRS A;  2JZZ A;  2BT6 A;  1FNU A;  5JHA A;  2IZV B;  1KF6 B;  4HK2 A;  3H8H A;  1WF9 A;  4N58 A;  4JLC A;  1WX9 A;  2QEJ C;  3VUW A;  4R3D A;  2GBK A;  4G3X B;  1FXA A;  4Q2J A;  1I4P A;  2BS4 B;  4ANW A;  3TMP B;  2KX3 A;  4AWJ A;  4MM3 B;  4ANU A;  1NBF C;  4AQ7 A;  3EA6 A;  3VUX A;  3SFD B;  2L7R A;  2BWE S;  2MWS B;  2VH1 A;  2IDY A;  3PHX B;  4W9H A;  1FD6 A;  2WU5 B;  4XDD A;  1FCL A;  3WIM A;  3KUC B;  4FHJ A;  4RFB A;  2K6D B;  4ANV A;  2L76 A;  1GC7 A;  2PE6 B;  1TZO A;  3FIL B;  4HCP B;  1HEZ E;  5EE0 A;  1V49 A;  2HJ1 A;  3QC8 B;  2KJH B;  2J42 A;  2ZCC A;  2WXM A;  3PTF C;  1SE2 A;  4RGT A;  1E0Z A;  1KRH A;  2WDV B;  4WH4 A;  1IBX A;  3L54 A;  3A9K B;  2DBY A;  3H7P B;  3DBL I;  1RFA A;  1QT9 A;  3OJ3 A;  4CQN A;  4MGI E;  4LK0 M;  4XGA B;  4TUU A;  1KH0 A;  1C4C A;  3W1S C;  2K6Q A;  1IGC A;  2DZM A;  1WMH B;  1ET9 A;  2DZJ A;  3I57 A;  5CTR C;  1J7C A;  3N1Z C;  3DBR I;  4FJZ A;  3GZN I;  3PSE B;  1YMH E;  1AAR A;  1JRP A;  1V2Y A;  1YN3 A;  2QHO A;  4HKZ E;  4C7Y A;  2BYE A;  1J7A A;  5CHF A;  4W9F A;  3AEF B;  3MJ5 A;  3B9J A;  3OWE B;  3Q8B A;  1OQQ A;  2FE8 A;  2V9H A;  3AEE B;  1IP9 A;  2BQQ A;  3MC0 B;  1Y8R C;  2WXP A;  2WXO A;  2JU6 X;  1M4V A;  3VH3 B;  1J8C A;  2XK5 A;  1BML C;  4OZC A;  1WGG A;  2DAJ A;  1CQV A;  4BBN F;  3OLM D;  2DEN B;  2PJH A;  4JX1 C;  3PRZ A;  1TY0 A;  3PVL A;  4BOS C;  3Q8C A;  4F8C B;  1ZKH A;  5FR6 A;  3QHT A;  1HE8 A;  2ZW1 A;  3HVZ A;  1UWX A;  3B2F A;  5C3J B;  4REZ A;  3JSV B;  1I7H A;  3ZYY X;  4XYC A;  3S2A A;  1WZ0 A;  3SHQ A;  1JAL A;  3UQA A;  3ABV B;  4IWP A;  2ICI A;  4OZA A;  2VZK D;  2RDH A;  1SIF A;  3IBE A;  3ZGZ A;  2NPT B;  3ZRF A;  2VZK B;  2M56 B;  1WR6 E;  1XLN A;  1WXM A;  1M94 A;  2ACZ B;  2X8X X;  5D2M B;  5J17 A;  2J0M A;  2Z8L A;  3AEB B;  1V9J A;  2JXT A;  3J9C A;  3RMK C;  2LUE A;  4IG7 B;  5KHO A;  4BKS D;  1SSN A;  2CHX A;  2QMT A;  4KKJ A;  1HZ5 A;  3TEZ A;  4WAA A;  3BVM A;  4BKT A;  3DHG C;  1ZXI A;  2QSD A;  4EUT A;  1C3T A;  2N9K A;  1WGY A;  2K5P A;  4M00 A;  5IN7 A;  3VVW B;  3PRP B;  2IY1 B;  3JYU A;  4DHZ E;  4MH0 E;  3OAW A;  5TSS A;  2HTM E;  4RMA A;  5GXG B;  3ZUN A;  2FNJ B;  3QIJ A;  3AE1 B;  4AJW A;  1UUP A;  4YTN B;  2ZZP B;  1WI0 A;  1TY2 A;  3RZW C;  1IUE A;  4DHZ B;  2WXR A;  1P0R A;  4HPM B;  3V6E B;  4MEL A;  3QAR A;  2ASQ A;  1H8C A;  1XXG A;  3Q3N C;  1SE3 A;  4C56 C;  2LEK A;  3HRD D;  3LB8 C;  1WXS A;  3HM6 X;  1YN4 A;  2Y5P A;  2AQ2 B;  4C80 A;  2MSE D;  1GUA B;  1PYW D;  1JWM D;  3VRA B;  3UI3 A;  4W9K A;  4F7Z A;  3KWL A;  1UNS A;  4H2A A;  1TKE A;  1CK1 A;  1IBX B;  3WAL A;  4RM8 A;  3N30 A;  4NQL B;  3PZ7 A;  4C7Z A;  1HXY D;  2W82 A;  1SIJ A;  3DWM A;  3SD5 A;  3RI7 C;  4E74 A;  3RNE C;  4KGS A;  3URY A;  2C9W B;  3KUD B;  3N1Y C;  4RCO A;  2UWQ A;  3PT2 B;  3NVV A;  3T3N A;  4MT5 A;  1H4R A;  3LJ3 A;  1WRI A;  2JSV X;  1HZ6 A;  3ZTD A;  2C5L C;  1GJZ A;  1N61 A;  1I4H A;  1PGA A;  1BT0 A;  2I1J A;  1C1Y B;  4W9D A;  3ZRC A;  1V80 A;  1I35 A;  4B6W A;  2W54 A;  3R66 C;  1MI0 A;  5G5H A;  3RPF C;  3SDL C;  5IA7 A;  1FCC C;  4I6L B;  2BB6 A;  3QA8 A;  1VCB A;  2BF8 B;  2KAC A;  4RF0 A;  2ZPY A;  4XWW A;  3HIZ A;  2K0P A;  1ZXH A;  1DOX A;  3CIR B;  4BBN C;  2XK5 B;  4FXC A;  4K3B A;  1KM7 A;  2PIA A;  4GLS C;  3ZLZ A;  2KMC A;  3LYY A;  5FK9 C;  2WU2 B;  4TQ0 A;  2N9X A;  2IO2 B;  4NAM A;  2KVR A;  1E90 A;  2N9E B;  5TR5 A;  5J18 A;  1WXV A;  3V61 A;  3RUL A;  4TQ1 A;  4FJY A;  1XT9 B;  1K8R B;  2NCN A;  4JPS A;  2V1Y A;  4PS8 A;  1ENF A;  5DCN A;  4A9A A;  2WHI A;  4WUR A;  1UF0 A;  3KH0 A;  3AN1 A;  2RSU A;  1E9M A;  4P16 A;  3DPD A;  4I6N B;  1T0Q C;  4IOI E;  2IBI B;  5L95 C;  3ZDM C;  5CHV C;  2D2Q A;  2IY0 B;  1A70 A;  1YQB A;  2M1M A;  3Q6B A;  2PKO A;  3A4S C;  2N9P C;  2PW9 A;  2KMM A;  3R7Q A;  2BTE A;  1JW9 D;  3JVZ X;  4JWU C;  3ZDT A;  1N63 A;  4MH8 A;  3P4P B;  2PTL A;  2IO1 B;  1WE7 A;  1RAX A;  2W3R A;  1WMH A;  5L83 A;  3RN9 C;  3U4E G;  2KWV B;  3AM9 A;  4ZRP A;  5LXH A;  3QJZ A;  4XDC A;  3UIP B;  4WWM A;  2O2V A;  4JWS C;  2R2O A;  4CHK A;  2MX2 A;  4RM9 A;  1I4X A;  2DYB A;  1TS2 A;  1P7F A;  2D10 A;  4AJY B;  2DX5 B;  2KVZ A;  2FCN A;  2OED A;  1N5X A;  3PPA A;  1KLG D;  2NBV B;  1Z2M A;  2IGD A;  3A9J A;  4K7W A;  4DWF A;  2DYO A;  4YTM B;  3H6N A;  2LWP A;  4OW0 A;  3L13 A;  1XD3 B;  3ZTC A;  2WXK A;  3V60 A;  4OHJ A;  1Q0W B;  1T0Y A;  4YWG G;  4KKI A;  2XNA C;  3ZJT A;  2JRH A;  4OVV A;  2K8B A;  1F2R C;  4DXG A;  3NVY A;  3IAS 1;  3JSV A;  1KJT A;  4FN2 A;  2KDE B;  1QOB A;  4LDT D;  1ISN A;  2BPS A;  4GIV A;  2HDE A;  4P7I A;  2LHE A;  4A55 A;  2ZVO A;  3RNB C;  4DXA B;  1RFK A;  1KLU D;  2NPT A;  3RFZ B;  5EE1 A;  3PLV A;  3GS2 A;  4IW0 A;  1WSP A;  2RGF A;  1T5X D;  4EE2 A;  3PRE A;  1FXT B;  2O6V B;  4W9C A;  3AE9 B;  1FNV A;  2EMT A;  3BVZ A;  4FBJ B;  2N7J A;  4LNO A;  2G4S A;  3NS8 A;  4HCN B;  4MGK E;  1WM2 A;  1F52 A;  4YTP B;  2D3C A;  4EFO A;  1V8C A;  1WH3 A;  3U52 E;  2Q5W D;  2JY6 A;  3P42 A;  4GU2 A;  5LNK 1;  2LGD A;  2WXL A;  3B2G A;  2V3N A;  1JRO A;  1MPE A;  2J0K A;  4E71 A;  2MJD A;  1V6E A;  1C76 A;  1SBB B;  3DHH C;  1YQ3 B;  4FLH A;  3W1Y A;  4BVU C;  2LVO A;  4WJP A;  2CU1 A;  4MDK E;  3ZNZ B;  1X1M A;  3VXW A;  3MTN B;  2AWT A;  2WXI A;  4ARI A;  4J6I A;  2KTF A;  2ZJD A;  2LRU A;  2PLP A;  3WA0 A;  4DK5 A;  4BFR A;  1F0Z A;  3W2D A;  2JQR B;  4W9I A;  1TKG A;  3RNF C;  1I4G A;  1NEK B;  2JZP A;  1D6E C;  3ECI A;  4GMV A;  2XEW A;  4RH6 A;  4P6V F;  3W5U B;  4ANX A;  3ZO5 B;  1P3Q U;  3A1Q B;  1TZ1 A;  2N1V A;  2G45 B;  1FRR A;  5JXV A;  1JWS D;  4EZK A;  3QWZ B;  3M62 B;  2PMV A;  2LXA A;  1GPX A;  1NI2 A;  1LO5 D;  3NZS A;  1EO6 A;  3N32 A;  4KIK A;  1SE9 A;  4G0N B;  5EDS A;  3AED B;  2BYF A;  1E10 A;  3BIN A;  4WWO A;  1V1P A;  1P9D U;  3GOE A;  2ZCB A;  4WQO B;  1D3Z A;  3GE3 C;  1T3Q A;  1L4Z B;  2MBQ A;  1PGB A;  3Q3J A;  2AL6 A;  2KWC A;  4PK1 A;  2JZ3 B;  3PHW B;  2LJI A;  2BS2 B;  4WIP A;  4B0E A;  5HHD G;  3TEY A;  2JPH A;  3TSS A;  2B76 B;  2EKE C;  2KJR A;  1ROE A;  2KOX A;  2M19 A;  2LGX A;  2K1F A;  3DDC B;  1S3S G;  2PE9 A;  3EC8 A;  4XC2 A;  4PYZ A;  2O2V B;  2BB5 A;  4IWQ A;  3ZNH B;  3TBL D;  3DWG C;  2KDF B;  2KO3 A;  1DOY A;  3DBH I;  3AEA B;  4K81 A;  1YNT E;  4WJN A;  2VRR B;  4IM2 A;  1N60 A;  3DQV A;  1YD8 U;  1UBI A;  3A33 B;  3A9J B;  2GBM A;  1QOG A;  2KNB A;  1XLO A;  3BYY B;  4FUL A;  3M95 A;  5AEK B;  1UEL A;  3MP9 A;  1QZE A;  1OEY J;  2SEB D;  2ZNV B;  2MCN B;  3HUI A;  2MBO A;  2AYO B;  1LGR A;  4XX5 A;  5HFY A;  1TS5 A;  5I4D A;  3U2S C;  3TUO A;  4YL8 A;  3NY5 A;  1AWD A;  1NDD A;  2V4I B;  4M0W B;  2N4F A;  2FAZ A;  1WJ6 A;  2K39 A;  1YOV B;  2K22 A;  3ZJU A;  4MGY E;  1D4B A;  5D3D A;  3IT4 B;  5T8I A;  2V4L A;  1WJ4 A;  2YVC A;  4GN1 A;  4IM0 A;  2KAN A;  2YEP F;  1FPY A;  3C8Y A;  1D5Z C;  3OJ4 B;  5E6J A;  4MSM B;  2GBR A;  1WJU A;  4M02 A;  3V62 A;  1V1O A;  4BAX A;  2BWF A;  2PVG C;  1WXA A;  1HTQ A;  1T0R C;  5BO4 B;  4PS7 A;  1G6J A;  4LLG M;  2JYT A;  1E8Y A;  1UD7 A;  5GMV A;  1V97 A;  2AX5 A;  1R4M I;  4BKG A;  2KX0 A;  4EKU A;  1F77 A;  4HLE A;  4ACF A;  1WX7 A;  2KC2 A;  4ZDV A;  3K9P B;  2D5G A;  3PLU A;  3NZU A;  1JRU A;  5IP4 D;  1WE6 A;  2M17 A;  1Y56 A;  4ZYS A;  3ML9 A;  2KD0 A;  3IAM 1;  5EE9 A;  1NEN B;  1V81 A;  3V05 A;  2VH2 A;  2INN E;  3V3X A;  4OZB A;  2LVP A;  3AU5 A;  1ZGU B;  4JE3 B;  3CSF A;  3TL5 A;  4P1C C;  3TJP A;  2LGI A;  1VDV A;  2KHW B;  3BII D;  1UBQ A;  3HVD A;  2IGH A;  4II3 B;  4AOF A;  3AU4 A;  1DGJ A;  2IO0 B;  1YJJ A;  2FCM A;  1C4P A;  1MHH E;  3HHM A;  5DPW A;  1FM0 D;  3VH4 B;  1J19 A;  3H7S A;  4TSS A;  2SAK A;  3ZJV A;  1ZOY B;  3DOW A;  3E56 A;  3DCG A;  1WXQ A;  1ZE3 D;  5C1Z A;  3MC9 A;  4KZ0 A;  3AH7 A;  1PUT A;  2MJE A;  2KN4 A;  3DVN U;  2JT4 B;  5MPO A;  1SXT A;  1YIW A;  2MJ3 A;  2H89 B;  4CO7 A;  3N9Y C;  1ET6 A;  2WWZ A;  1YX5 B;  2UU7 A;  1K53 A;  4URK A;  4KIK B;  1I4Q A;  3APD A;  2LZ6 A;  3SR6 A;  3TIX A;  1L6V A;  2DWQ A;  2FBW B;  1OQY A;  1V1P B;  2C7H A;  2QIE B;  1LFD A;  2WNM A;  3P63 A;  5BMH A;  3BK1 A;  2KLC A;  2N0S B;  4ZYN A;  3X23 A;  1YX6 B;  2EKI A;  1TT5 B;  4AP4 C;  1SEB D;  2V3P A;  2C7M B;  2DYM A;  3H9D A;  2O6V A;  1UGM A;  2WXQ A;  1FIQ A;  1EU4 A;  4A3P A;  1CZP A;  4II2 B;  4IM3 A;  3AE6 B;  5D3I B;  2FUG 1;  1SJH D;  3KLS X;  2WS3 B;  2CR5 A;  4GXB A;  3EGR A;  1E7V A;  2L00 B;  4MAC A;  1QOF A;  1VZ8 A;  3EHV A;  4F1S A;  2MP2 B;  2BKF A;  3VHT C;  1V5O A;  1XO3 A;  2FCS A;  2REX A;  4A3O A;  4NZL B;  2D3G A;  2BS3 B;  3OG5 A;  2KC1 A;  4S17 A;  4KV2 A;  1T6B X;  4FAD A;  2KDI A;  1GB4 A;  2ZPN A;  4KZC A;  4TMA B;  1SJE D;  2KQS A;  3EFU A;  2OJW A;  5IAA C;  2LHD A;  5DPT A;  3O65 B;  1TJE A;  3AE7 B;  3QQ8 B;  2Z0E B;  2KDB A;  3U8Z A;  3AE5 B;  2W55 A;  4L2Y A;  3UIN B;  1JQ4 A;  4XWT A;  4NQK E;  4YT0 B;  5G5G A;  1P98 A;  3AE3 B;  3AUL A;  1WRD B;  3A1Q A;  1WZ3 A;  2TSS A;  3NHE B;  4ZRI A;  2KQ7 A;  1TS3 A;  1EWC A;  1XQQ A;  4ZHP A;  2Y5B B;  3QK0 A;  2FIF A;  3KYD D;  2K3U A;  3NVZ A;  4O1N A;  1RLF A;  3QCA A;  4KSL C;  2GB1 A;  1NYQ A;  2RPQ A;  1MFW A;  4IDI A;  1QOA A;  5C2T B;  1E6E B;  3W9C B;  2KFK B;  1TGZ B;  3AMZ A;  4LJO B;  2BYV E;  1TS4 A;  1ZPS A;  1YQ4 B;  1FRD A;  5E6N A;  2MA9 B;  2AEH A;  1LM8 B;  3NRZ A;  3W5V B;  3NUH B;  1WGH A;  3L0W B;  5HI1 A;  5CX3 A;  2KWD A;  2IYD B;  4TKN A;  4C00 A;  2OHF A;  4GB9 A;  2DLB A;  2RMM A;  2Z0D B;  2OJR A;  1JWU D;  4L23 A;  4HEA 1;  4M8M A;  2CS4 A;  3N3K B;  2L32 A;  1MG8 A;  4GOC A;  3MFG A;  2JWZ A;  3QAQ A;  1ZP0 B;  2KAJ A;  3A4R A;  1WWT A;  3DBH B;  3AE4 B;  3VQI A;  3MJW A;  3VRB B;  5DPR A;  3B1L X;  3UIO B;  2I38 A;  2BYT A;  1D5M C;  1RRB A;  3Q69 A;  3Q8F A;  2RD0 A;  4MJS A;  2NBW B;  4ZRK A;  5AZG A;  4W9J A;  1FFU A;  5E6P A;  4YSX B;  1PDX A;  1Q10 A;  3C0R B;  1BXT A;  4IWO A;  1WR1 A;  4LCD E;  3AV8 A;  4HVB A;  4M0W A;  3L10 B;  1F9J A;  1VZ7 A;  3Q8E A;  1L0Y B;  4IKG A;  3RD2 A;  4B9K A;  1UWM A;  2FUH B;  1EU3 A;  3BVG A;  1I4R A;  3AXC A;  2INP E;  3P2B A;  2WYQ A;  4A90 A;  4KGT A;  4RGO S;  2K8C A;  4ICV A;  2HTH A;  2O6V D;  3MHS D;  1R4N B;  1N62 A;  3P4R B;  4OVZ A;  2NTT A;  1YJI A;  4K1R B;  1QLB B;  4ZRQ A;  4GGQ A;  2JF5 A;  3BK2 A;  1J0G A;  1QQR A;  1NVI D;  3V6C B;  2X38 A;  4UDU C;  3FC4 A;  3AEC B;  3I3T B;  1MG4 A;  4N6E B;  3ZNG C;  2W9N A;  1ACC A;  2ZEQ A;  1FEH A;  1QKZ A;  2KTR A;  1R4M B;  2V0G A;  1MJD A;  4J3O D;  1OGW A;  1HTO A;  3KQ4 A;  4WQM A;  4DXF A;  2RR9 A;  4S0R A;  2CHW A;  1WFY A;  4HJK A;  1T0S C;  4ASW C;  1KLV A;  2NBU A;  5JH5 C;  1L0X B;  3MC8 A;  5IO9 A;  2LGY A;  4JIO U;  4EEW A;  1HQR D;  3VUY A;  3I9V 1;  4N9F 4;  5E6O A;  4NAW A;  2LUM A;  3IHP C;  3L4P A;  4LJP B;  1R7S A;  3HM3 A;  3APC A;  4M8N A;  5AZF A;  1VRA B;  1ZUD 2;  2IND C;  1YJ1 A;  4A8X C;  3Q2A C;  2KXJ A;  5IKC M;  2J53 A;  1TIF A;  1V86 A;  1XEE A;  3P4Q B;  3IVF A;  3Q8A A;  5D6J B;  5FKA C;  4C4V B;  2QC8 A;  2G4D B;  4YSY B;  2ZW0 A;  4ARC A;  2E3T A;  3NOB A;  3Q3F A;  1WY8 A;  3TCA A;  3VDZ A;  3NS1 A;  2M8S A;  2QDF A;  1GNU A;  2LAS A;  2GRI A;  2MRP A;  3TEW A;  4A20 A;  1MHX A;  4WJO A;  2MEK A;  4HKQ A;  2JRI B;  2Y3A A;  2M0X A;  5KHQ A;  3ONS A;  2DNF A;  1TYG B;  5JHB A;  5IOI A;  4W9L A;  1AN8 A;  4LNI A;  4HPL B;  4FJV B;  1WYW B;  4GDK A;  1WX8 A;  3P4S B;  4NJ6 A;  4RNA A;  2NS5 A;  1RM6 C;  2HD5 B;  1K52 A;  3GE8 C;  1IYF A;  3PRM B;  2I1K A;  4HXD A;  3P1M A;  1ZDX A; 
#chains in the Genus database with same CATH homology
 2LVQ A;  2KN5 A;  5HKH A;  4MSQ B;  4II3 B;  4AOF A;  3AU4 A;  3L17 A;  3DPD A;  4I6N B;  2IO0 B;  2FCM A;  2IBI B;  5L95 C;  5AZH A;  2G3Q B;  2MP2 A;  3RT3 B;  3ZDM C;  4BOZ B;  5CHV C;  1PQS A;  2D2Q A;  2IY0 B;  3HHM A;  4EZJ A;  5DPW A;  2YLM A;  3DBS A;  3IG3 A;  3VH4 B;  1YQB A;  1J19 A;  4JQW C;  4K7U A;  3H7S A;  3DOW A;  3DCG A;  2V3S A;  2KWU B;  2M1M A;  3WAO A;  5C1Z A;  4KZ0 A;  3U7D A;  3UGB B;  2L0T A;  2N7E A;  3A4S C;  2N9P C;  4IUM B;  4DBG A;  3DVN U;  2JT4 B;  4DDI D;  2PPH A;  2GOW A;  3R7Q A;  4MJS B;  2B3A A;  3KVF B;  2L0F A;  1YIW A;  2JXX A;  4BKS A;  4KDI C;  3PV1 A;  1ZW7 A;  3JVZ X;  2LJ5 A;  5D7G A;  3ZDT A;  3IFW B;  4CO7 A;  3EEC A;  2JZZ A;  5JHA A;  3H1U A;  2C60 A;  2WWZ A;  4ZRJ A;  1YX5 B;  2IZV B;  3AI5 A;  4URK A;  4KIK B;  4E3C A;  2A5U A;  2IO1 B;  3APD A;  1WE7 A;  2L05 A;  4HK2 A;  2LZ6 A;  1WIA A;  1RAX A;  2WDT B;  1WF9 A;  3ZNI D;  4JLC A;  1WX9 A;  3TIX A;  2KK8 A;  1KOT A;  3VUW A;  4NJ7 A;  2GBK A;  4G3X B;  1WMH A;  1OQY A;  2C7H A;  5L83 A;  4WWN A;  2KFJ A;  2KWV B;  2AL3 A;  1LFD A;  5LXH A;  3QJZ A;  4ANW A;  3TMP B;  2KX3 A;  3UIP B;  4AWJ A;  2KLC A;  4ZYN A;  3X23 A;  4ANU A;  1YX6 B;  1NBF C;  3T8M A;  4AP4 C;  3VUX A;  2L7R A;  1R4N I;  2C7M B;  4NY0 A;  2BWE S;  2DYM A;  3H9D A;  4TV3 A;  1GG3 A;  2MWS B;  2O6V A;  1UGM A;  3PS6 A;  3PHX B;  2O2V A;  4W9H A;  3DVG Y;  2R2O A;  4CHK A;  4A3P A;  2MX2 A;  4RM9 A;  3WIM A;  3KUC B;  4II2 B;  4IM3 A;  4GSW A;  2DYB A;  4FHJ A;  3W1S A;  2D10 A;  2NR2 A;  2K6D B;  4AJY B;  2XBB C;  2CR5 A;  4AUQ C;  2KFK A;  4ANV A;  4PYU A;  4GXB A;  2DX5 B;  2FCN A;  2L76 A;  1GC7 A;  1E7V A;  2PE6 B;  2L00 B;  4HCP B;  3PPA A;  1Z5S B;  1Z2M A;  1V49 A;  2NBV B;  3A9J A;  2DHZ A;  3QC8 B;  2KJH B;  4K7W A;  3EHV A;  3WAM A;  4DWF A;  4F1S A;  2MP2 B;  2BKF A;  2DYO A;  3VHT C;  2ZCC A;  2GMI C;  2N1W A;  2MLB A;  1V5O A;  3H6N A;  2LWP A;  3PTF C;  4FHK A;  2KTR B;  3L13 A;  1XD3 B;  3ZTC A;  2J7Q B;  2FCS A;  2REX A;  1OTR B;  3L08 A;  3V60 A;  2L3Z A;  4A3O A;  1Q0W B;  2D3G A;  3ZIM A;  1T0Y A;  4HDQ A;  5G2N A;  2KC1 A;  3L54 A;  3A9K B;  4KV2 A;  3UQB A;  4FAD A;  2JRH A;  2KDI A;  1S1Q B;  3H7P B;  4OVV A;  2ZPN A;  3DBL I;  1RFA A;  2K8B A;  4KZC A;  3OJ3 A;  1Q1O A;  1WGR A;  1E8X A;  2KQS A;  3EFU A;  3CST A;  4NNJ B;  3JSV A;  1KJT A;  4FN2 A;  2KDE B;  5IAA C;  3VAW A;  4MGI E;  4MGZ E;  5DPT A;  4LDT D;  3O65 B;  4JGH B;  2D07 B;  1ISN A;  2BPS A;  3QQ8 B;  4GIV A;  4P7I A;  4TUU A;  1WJN A;  2Z0E B;  4NAW B;  2K6Q A;  3ML8 A;  3W1S C;  3BY4 B;  2KDB A;  4EOY A;  2ZVO A;  5DPS A;  4DXA B;  3U8Z A;  3VFK A;  2DZM A;  1WMH B;  4I6P A;  2A4Z A;  2NPT A;  2DZJ A;  2HJ8 A;  3PLV A;  3UIN B;  1E8W A;  2JUO A;  2IO3 B;  5CTR C;  4NQK E;  3DBR I;  4FJZ A;  2L8J A;  4IW0 A;  3GZN I;  1P98 A;  4W9E A;  3PSE B;  3AUL A;  4OVU A;  1WRD B;  3A1Q A;  1WZ3 A;  1AAR A;  3NHE B;  2RGF A;  4ZRI A;  2KQ7 A;  3CMM B;  1V2Y A;  3PRE A;  1FXT B;  1XQQ A;  2QHO A;  2O6V B;  4W9C A;  2Y5B B;  3ZW3 A;  3QK0 A;  2BYE A;  5CHF A;  2FIF A;  4W9F A;  2EMT A;  3KYD D;  1EUV B;  4FBJ B;  2KZR A;  2WX1 A;  2G4S A;  3VTU A;  1RLF A;  3NS8 A;  4HCN B;  2FID A;  4MGK E;  1WM2 A;  3QCA A;  1IP9 A;  4KSL C;  3ENE A;  4EFO A;  1WH3 A;  1Y8R C;  2RPQ A;  1E8Z A;  3VH3 B;  1GC6 A;  1J8C A;  3KW5 B;  2JY6 A;  2XK5 A;  2KFK B;  4GDL A;  4GU2 A;  2LGD A;  1WGG A;  1TGZ B;  2DAJ A;  4BBN F;  4LJO B;  2M4N A;  3OLM D;  2DEN B;  2PJH A;  2BYV E;  3PRZ A;  2J0K A;  4WJQ A;  4E71 A;  1TTN A;  1E7U A;  4DHJ D;  5E6N A;  2MA9 B;  1V6E A;  2AEH A;  1LM8 B;  3PVL A;  5LLI A;  3HK0 A;  4FLH A;  1WGH A;  3L0W B;  4BOS C;  3W1Y A;  5CX3 A;  4BVU C;  4EZL A;  4DHJ B;  2LVO A;  4WJP A;  4F8C B;  1ZKH A;  2IYD B;  4TKN A;  5FR6 A;  3QHT A;  1HE8 A;  2CU1 A;  4MDK E;  4GB9 A;  4GDK B;  3ZNZ B;  1X1M A;  3VXW A;  4WWP A;  3KUZ A;  3MTN B;  2Z59 B;  2AWT A;  3VTV A;  2Z0D B;  2OJR A;  4J6I A;  2KTF A;  3JSV B;  2ZJD A;  2LRU A;  2K25 A;  4MEM A;  4M8M A;  3S2A A;  1WZ0 A;  3ALB A;  3SHQ A;  2CS4 A;  3WA0 A;  4DK5 A;  2EMS A;  4BFR A;  3UQA A;  3N3K B;  3RYT A;  4IWP A;  1MG8 A;  4GOC A;  2JWZ A;  4W9I A;  3QAQ A;  1A5R A;  1SIF A;  3A4R A;  2J0J A;  3IBE A;  4CYE A;  2NPT B;  3ZRF A;  3VQI A;  3ECI A;  3MJW A;  4GMV A;  2XEW A;  5DPR A;  3B1L X;  4W9G A;  1WR6 E;  2FCQ A;  3UIO B;  3WAN A;  1RRB A;  4ANX A;  3ZO5 B;  1WXM A;  1P3Q U;  3A1Q B;  4KSK C;  1TZ1 A;  1M94 A;  5D2M B;  2RD0 A;  2D11 A;  2PEA A;  4MJS A;  5J17 A;  3B0A A;  2N1V A;  3D32 A;  5G55 A;  2J0M A;  2G45 B;  1SGH A;  1V9J A;  2NBW B;  2GBN A;  4ZRK A;  2BGF A;  2LUE A;  4IG7 B;  5AZG A;  5KHO A;  4W9J A;  3QWZ B;  3M62 B;  4BKS D;  4EZK A;  2CHX A;  4FA6 A;  5E6P A;  2LXA A;  1NI2 A;  3NZS A;  1EO6 A;  3N32 A;  4KIK A;  4WAA A;  3C0R B;  1SE9 A;  4G0N B;  4BKT A;  5EDS A;  3UF8 A;  2BYF A;  2KJ6 A;  3K9O B;  4IWO A;  2WX0 A;  1I42 A;  1WR1 A;  4EUT A;  1C3T A;  4LCD E;  4HVB A;  3R7R A;  1OEY A;  4KVG B;  3BIN A;  3L10 B;  1F9J A;  2MBE A;  4DDG D;  1WGY A;  4WWO A;  1P9D U;  2LD9 A;  1CMX B;  3GOE A;  5CHW A;  3RD2 A;  2ZCB A;  4WQO B;  4B9K A;  1D3Z A;  1WM3 A;  2FUH B;  3R3M A;  3VVW B;  3PRP B;  2IY1 B;  2NVU I;  3AXC A;  3JYU A;  2MBQ A;  4DHZ E;  4MH0 E;  3Q3J A;  2AL6 A;  2KWC A;  3OAW A;  4MM3 A;  2JZ3 B;  3P2B A;  3PHW B;  4PS3 A;  2KMA A;  2WYQ A;  5LXI B;  4ICU A;  3T9L A;  4RMA A;  2CHZ A;  3ZUN A;  2K8C A;  2JPH A;  2FNJ B;  3DVG X;  2HTH A;  4ICV A;  3ZVV A;  3QIJ A;  4AJW A;  2O6V D;  2EKE C;  3MHS D;  3RCZ A;  4KDL B;  2ZZP B;  3WAP A;  2KJR A;  1WI0 A;  4K1R B;  4GGQ A;  2KOX A;  3RZW C;  4DHZ B;  2JF5 A;  2LGX A;  1E5W A;  2K1F A;  3DDC B;  1S3S G;  2PE9 A;  2ZNV C;  1J0G A;  3EC8 A;  1P0R A;  4HPM B;  4XC2 A;  4B95 A;  3APF A;  3V6E B;  4PYZ A;  2O2V B;  4MEL A;  1UZX B;  3QAR A;  3V6C B;  3B08 A;  4IWQ A;  1Q5W B;  2ASQ A;  3TBL D;  3ZNH B;  1H8C A;  2KDF B;  2KO3 A;  2MQJ A;  3I3T B;  3U30 A;  2LXC A;  3ZNG C;  3DBH I;  5D94 A;  2W9N A;  1WXS A;  1UH6 A;  2MBB B;  3HM6 X;  4K81 A;  3LDZ E;  4WJN A;  2DZI A;  2ZEQ A;  2C7N B;  2MW5 A;  2VRR B;  2KTR A;  1V5T A;  4IM2 A;  1EF5 A;  3DQV A;  1YD8 U;  2MSE D;  3M63 B;  1OGW A;  1UBI A;  1GUA B;  1L7Y A;  3A33 B;  3A9J B;  2GBM A;  2RR9 A;  2KNB A;  3A9K A;  3H7P A;  4HWI B;  4IC7 B;  4W9K A;  3KYC D;  4K7S A;  2CHW A;  4FUL A;  3M95 A;  5C23 A;  4F7Z A;  1WFY A;  4HJK A;  5AEK B;  1UEL A;  2K8H A;  4JL9 A;  4ASW C;  1LXD A;  2KLG A;  2OOB B;  1KLV A;  2NBU A;  5JH5 C;  1QZE A;  1WGD A;  1OEY J;  2LGY A;  2ZNV B;  4JIO U;  2MCN B;  3QX1 A;  3SU8 X;  3WAL A;  3VTW A;  2MBO A;  4EEW A;  2AYO B;  2LRW A;  3RUI B;  2N7D A;  3VUY A;  4RM8 A;  4XX5 A;  3N30 A;  4N9F 4;  4NQL B;  5E6O A;  5JZE B;  4NAW A;  4YL8 A;  3IHP C;  4LJP B;  3NY5 A;  3HM3 A;  2ZVN A;  3APC A;  4M8N A;  5AZF A;  3SD5 A;  4E74 A;  1NDD A;  4M0W B;  2C9W B;  2N4F A;  2FAZ A;  3KUD B;  2UWQ A;  1WJ6 A;  1YJ1 A;  2CKH B;  2DZK A;  2K39 A;  3PT2 B;  4XZ4 A;  1IPG A;  1U4A A;  2KXJ A;  4GN1 A;  1EF1 A;  3L16 A;  1H4R A;  3LJ3 A;  5J2R A;  3ZTD A;  1V86 A;  4MGY E;  2C5L C;  3IVF A;  3PGE A;  5D6J B;  1GJZ A;  3X0W A;  3ZKJ C;  2V4L A;  2G4D B;  1WJ4 A;  3M3J A;  2YVC A;  2JVC A;  1BT0 A;  2HE7 A;  2UYZ B;  2I1J A;  3NOB A;  1WY8 A;  3Q3F A;  1C1Y B;  2KAN A;  4IM0 A;  3TCA A;  4W9D A;  3DVN V;  3VDZ A;  3ZRC A;  2M8S A;  1V80 A;  2KKC A;  1I35 A;  3OJ4 B;  4B6W A;  1GNU A;  3PZD A;  4MSM B;  2GBR A;  2LAS A;  1WJU A;  3R66 C;  3V62 A;  2BWF A;  2MRP A;  3SDL C;  5IA7 A;  1WXA A;  4A20 A;  5BO4 B;  4PS7 A;  4I6L B;  4WJO A;  1G6J A;  3QA8 A;  1VCB A;  2BF8 B;  2JRI B;  1E8Y A;  1UD7 A;  2M0X A;  2ZPY A;  5GMV A;  3ONS A;  5KHQ A;  3CF6 E;  3HIZ A;  1R4M I;  2GBJ A;  4BKG A;  2KX0 A;  4EKU A;  4HLE A;  5JHB A;  1WX7 A;  2KC2 A;  4BBN C;  2XK5 B;  4GDL B;  1KM7 A;  3RZF A;  1VD2 A;  3JW0 X;  4ZDV A;  3K9P B;  1P1A A;  1L2N A;  3ZLZ A;  3PLU A;  1LQB A;  3NZU A;  1JRU A;  2KMC A;  1WE6 A;  2M17 A;  4NPN A;  3ML9 A;  4W9L A;  2KD0 A;  4TQ0 A;  4G50 A;  4G11 A;  4HPL B;  4FJV B;  1WYW B;  4GDK A;  1WX8 A;  2N9X A;  4NJ6 A;  4HDO A;  2R2Q A;  1V81 A;  2IO2 B;  2KVR A;  2NS5 A;  2MBH A;  2LVP A;  1E90 A;  3AU5 A;  4X57 B;  2N9E B;  2HD5 B;  5TR5 A;  2BKR B;  1ZGU B;  5J18 A;  1TBE A;  1WXV A;  1IYF A;  3V61 A;  3RUL A;  4TQ1 A;  3CSF A;  1XT9 B;  3PRM B;  1K8R B;  4FJY A;  3TJP A;  3TL5 A;  2LI5 A;  2NCN A;  2I1K A;  2KHW B;  2V1Y A;  4HXD A;  4PS8 A;  5DCN A;  4LDT B;  1UBQ A;  2DAF A;  3KH0 A;  2RSU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...