2BKRB

Nedd8 nedp1 complex
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
77
structure length
77
Chain Sequence
SMLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVLHLVLALRGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of Nedd8 Ubiquitin Discrimination by the Deneddylating Enzyme Nedp1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein-binding/hydrolase
molecule keywords SENTRIN-SPECIFIC PROTEASE 8
total genus 22
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2005-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2bkrB00
2PE9A 2MBOA 4WWPA 3KUZA 1TGZB 4IUMB 3CMMB 2DZIA 4EZJA 4J6IA 3KH0A 1IP9A 4G50A 3IVFA 5C1ZA 2JRHA 4BFRA 2K6QA 5KHOA 1NI2A 4FJYA 4AWJA 2KDIA 2KMCA 4HDQA 2KKCA 2AYOB 3X0WA 1E7UA 2KMAA 3ZIMA 1XD3B 4KZCA 4XC2A 2FAZA 4MJSA 2L76A 1EF5A 2ZCCA 2BPSA 3VUYA 4IW0A 3L17A 1WM2A 2KO3A 5LXHA 4BKSA 2CHXA 1R4MI 2PPHA 2KHWB 4YL8A 2IY1B 3EECA 4HCNB 2CS4A 4IG7B 2AL3A 2KXJA 2KWVB 4ANUA 3S2AA 4DXAB 4LCDE 4FHKA 5LXIB 3AULA 2KC1A 2LRWA 4M8MA 2BF8B 3DDCB 1V81A 3V61A 4GDLA 1S1QB 1RFAA 5DCNA 2LVOA 2MBEA 1A5RA 3OJ3A 4E74A 1I35A 4BVUC 4I6LB 3RULA 1F9JA 3JVZX 4DBGA 3OJ4B 2IBIB 3DVGY 4NY0A 3UIOB 3ONSA 4GDKB 3DVNU 1WXMA 2LASA 3A9JB 3SHQA 2J0JA 1NBFC 2FCSA 4K81A 2GBKA 4MGYE 1GG3A 3NOBA 1WGRA 4K7WA 4NAWA 4KSLC 4TUUA 5G55A 2RGFA 2K8BA 2O6VA 1WJUA 4AP4C 2KJHB 4PS7A 4XX5A 4WJPA 4EEWA 4MELA 4EZKA 5L95C 4KDIC 5IA7A 2C7MB 3HHMA 4MGZE 3VUXA 2LXCA 2FCNA 4FULA 3WIMA 1OQYA 2N1WA 4ICVA 2GOWA 2YLMA 5D7GA 3P2BA 3VQIA 4W9HA 2ASQA 3PPAA 4A3PA 1V6EA 4HVBA 1V2YA 4LDTD 2KDFB 2ZJDA 2GBNA 3W1SA 2C60A 4OVUA 2HJ8A 2N9XA 3Q3JA 3JSVB 3VH3B 1V5OA 4W9IA 4W9FA 2UYZB 3B0AA 1RAXA 3UQBA 2LGYA 4CO7A 1SGHA 3JYUA 3M3JA 3ZTCA 3KYCD 4W9LA 2KN5A 3APDA 5GMVA 3X23A 3ML9A 2LGDA 1WM3A 3ZNID 1P1AA 3BY4B 3H7SA 3KW5B 1GUAB 2N7EA 3QARA 4ASWC 4KV2A 3PRMB 3ZNZB 4DWFA 2KWUB 3OAWA 2M0XA 2L7RA 3DOWA 3UQAA 4EUTA 3HK0A 2G4DB 4HCPB 2L8JA 2EKEC 1P3QU 3WA0A 1WI0A 3NZUA 1WR1A 2K6DB 2KVRA 4ANVA 3APCA 1E5WA 3KYDD 4K1RB 3ZO5B 1X1MA 4GOCA 5AEKB 3DVGX 2ZEQA 4XZ4A 4FLHA 2D2QA 2L00B 4EKUA 2XK5A 1J8CA 1WE6A 2XK5B 4FN2A 1WX8A 4GIVA 1L2NA 2EMTA 2I1JA 2FUHB 2MQJA 2Z59B 3N32A 4E71A 3M63B 2K1FA 4FJVB 4HK2A 4ZRKA 3HM6X 4IC7B 4GU2A 1J0GA 1WR6E 2MP2B 1OGWA 2EMSA 1MG8A 2N4FA 3A9JA 1UBIA 1WZ3A 4MSQB 5CX3A 2HTHA 4MGKE 5FR6A 4ZYNA 2JUOA 2LI5A 2C9WB 1H8CA 3L0WB 2KD0A 4RM8A 4W9EA 3ZDMC 1UH6A 4AJYB 4I6PA 4WWNA 2BYEA 2LWPA 2R2OA 2KWCA 2RSUA 2NCNA 3AU5A 3VXWA 2GBJA 2WX1A 1K8RB 1M94A 1E8WA 3DPDA 4ZRIA 4HLEA 4MGIE 4GGQA 4MJSB 1WFYA 4ANWA 2I1KA 2O2VB 1YQBA 2JZ3B 3B1LX 1KM7A 3AI5A 3NS8A 3MHSD 2CR5A 2FIFA 3QCAA 3BINA 2BKRB 2ZPYA 1WY8A 2K25A 2QHOA 1Z2MA 2PJHA 2D10A 2VRRB 2KDBA 3DBHI 4LJOB 4NJ6A 3L08A 3CSTA 2LJ5A 2JY6A 5G2NA 3IFWB 3RD2A 3CF6E 2M1MA 3SU8X 3WAOA 1SIFA 2CKHB 2IY0B 3ML8A 3H6NA 4HPLB 2LVPA 3APFA 2DYBA 3QX1A 3RZWC 2KFJA 3K9PB 2KANA 3VTUA 2KTFA 5DPTA 4DDGD 3ALBA 2DAJA 3IHPC 3V60A 4DDID 3ZNGC 1RLFA 4B95A 2DAFA 3ECIA 5DPWA 4II3B 3TJPA 3H1UA 3QAQA 2MSED 2AWTA 4MEMA 3R3MA 5E6NA 4GN1A 4PS8A 4E3CA 5IAAC 2D11A 2KQSA 1EF1A 1H4RA 3A33B 3GOEA 4TQ1A 4ZRJA 3IG3A 1J19A 4DHZB 4W9JA 3PGEA 4BBNC 4G0NB 1OEYA 1E8XA 1P9DU 1WJ4A 2BWFA 4IWQA 2IZVB 4IM0A 1JRUA 1T0YA 1D3ZA 1GC7A 4IWPA 2DZKA 3DBRI 4DK5A 2KDEB 1P98A 2MBHA 3L16A 4G11A 1KJTA 1L7YA 1FXTB 1LFDA 4A3OA 3PVLA 4AOFA 2XBBC 2YVCA 1C1YB 1RRBA 2K8HA 2J0MA 2Y5BB 1UZXB 4G3XB 4WQOB 1Q5WB 4WJNA 1WGGA 2REXA 1S3SG 1WGHA 2CHWA 2MWSB 2CU1A 3N30A 1Y8RC 3I3TB 2DZMA 4FJZA 4WJQA 4GB9A 3R7RA 5JHAA 1UD7A 3KVFB 4A20A 2KLCA 4PYZA 4II2B 3TIXA 2NBWB 3NZSA 4HPMB 1YD8U 5D6JB 1LXDA 2NS5A 3PV1A 4GMVA 1WZ0A 4EFOA 5EDSA 1BT0A 3PRZA 2Z0EB 3QC8B 1WXVA 3RT3B 2JF5A 3L13A 4GDLB 4X57B 5E6PA 4N9F4 2Z0DB 2L05A 5HKHA 2BYVE 4TV3A 2FCQA 5CHWA 3ZUNA 4AJWA 4EOYA 3TL5A 1UGMA 5JHBA 1KLVA 1YX5B 3ZRCA 2JZZA 2HD5B 2BGFA 3TBLD 2NBVB 4LJPB 2V1YA 3UF8A 3TMPB 2ZZPB 3Q3FA 3U7DA 2KZRA 4URKA 5AZFA 2NPTA 3H7PA 3MTNB 5BO4B 4K7UA 2L0FA 3PREA 4KVGB 4ANXA 3EC8A 3HIZA 1UBQA 2O6VB 4K7SA 3VHTC 2KX3A 1HE8A 2J7QB 2LGXA 2RD0A 3QK0A 2W9NA 4LDTB 3WALA 1VCBA 1EUVB 2MBBB 1VD2A 2ZVNA 2WWZA 1Z5SB 4HWIB 4WWOA 5AZGA 3VUWA 3PT2B 2RR9A 3DVNV 2G45B 3DQVA 3PS6A 4KIKA 5TR5A 3W1YA 2D07B 3NHEB 4W9DA 4BBNF 1V5TA 3ZLZA 1UELA 1WGDA 4FHJA 4IM3A 1WF9A 4DHJB 1PQSA 1XT9B 3V6CB 2LXAA 3NY5A 5LLIA 3ZVVA 5L83A 3JSVA 4EZLA 2ZNVC 3M95A 3QJZA 4JIOU 1U4AA 2DZJA 4RM9A 1V49A 2DYOA 1YX6B 3UGBB 4F1SA 2C5LC 3VH4B 2C7NB 2KFKB 1WRDB 3ENEA 3KUCB 3PLUA 1GJZA 3ZKJC 1EO6A 4JQWC 4DHZE 4JGHB 4WJOA 3T8MA 2MCNB 2KJRA 2RPQA 1WX9A 4OVVA 3UINB 3VTWA 1WX7A 2C7HA 2V3SA 4CHKA 2LVQA 3U30A 3UIPB 4BOSC 2IO2B 2DYMA 4TKNA 3A4RA 1CMXB 1GC6A 1WMHB 2KLGA 4HJKA 3KUDB 1WMHA 4HXDA 2AL6A 2PE6B 2OOBB 3W1SC 3DBSA 4NQLB 1WYWB 3IBEA 2KK8A 1WGYA 2KX0A 2LUEA 2MX2A 4MM3A 1NDDA 2N1VA 3AXCA 1R4NI 3RUIB 3RZFA 2JPHA 3K9OB 2A4ZA 2KNBA 1ZW7A 2M4NA 4CYEA 1WH3A 2G3QB 3R66C 3LDZE 1P0RA 1ZGUB 2IO3B 4BKSD 2JT4B 2BWES 4KSKC 5J2RA 5C23A 2LZ6A 2MRPA 3PTFC 2ZNVB 3A1QB 1TZ1A 2N9EB 3C0RB 4FBJB 3A1QA 3ZTDA 4PS3A 2ZPNA 1XQQA 2N7DA 2JXXA 2V4LA 2WX0A 3DBLI 3PRPB 4B9KA 4F8CB 4ZDVA 2KC2A 4NJ7A 4ICUA 5JZEB 3JW0X 4M0WB 4BKGA 3OLMD 4FA6A 4P7IA 3V62A 2KOXA 3VTVA 1OTRB 3T9LA 3VAWA 4KZ0A 1YJ1A 2MW5A 3D32A 4W9CA 2FNJB 2LRUA 3QHTA 3QIJA 4KIKB 1WJNA 2GBMA 2FCMA 2KTRA 2IO0B 2KTRB 1ISNA 4NNJB 3DCGA 1QZEA 3PZDA 2IO1B 1ZKHA 2NBUA 3ZNHB 1TTNA 2ZCBA 3R7QA 2O6VD 2O2VA 1I42A 2L0TA 4W9GA 4KDLB 1E8ZA 2G4SA 4W9KA 5DPSA 2MLBA 5JH5C 2DHZA 1IYFA 1WE7A 3ZDTA 2D3GA 2B3AA 4PYUA 3L10B 4AUQC 2GMIC 4TQ0A 3O65B 4FADA 4NPNA 2N9PC 3QA8A 3RCZA 4MH0E 2WYQA 1TBEA 2UWQA 5CHVC 3VFKA 1LQBA 4NQKE 3AU4A 3A4SC 3VVWB 5DPRA 3WAMA 1WXAA 2BYFA 2ZVOA 1KOTA 4IM2A 3TCAA 5AZHA 3QQ8B 2FIDA 1AARA 1E7VA 3A9KA 4GDKA 5E6OA 3A9KB 2M17A 2M8SA 4JL9A 3WAPA 4BOZB 3HM3A 2KJ6A 2DENB 2K8CA 2JRIB 3EFUA 2DX5B 5KHQA 3PSEB 4HDOA 3MJWA 2NPTB 3H7PB 3N3KB 3SD5A 2IYDB 2OJRA 3RYTA 5CHFA 2JWZA 3ZW3A 1LM8B 4NAWB 1V9JA 1WJ6A 3CSFA 4WAAA 1WXSA 3L54A 4IWOA 3ZRFA 2K39A 3LJ3A 3GZNI 3V6EB 4RMAA 1WIAA 3EHVA 3QWZB 4GSWA 2NVUI 1IPGA 2PEAA 4BKTA 1C3TA 1G6JA 1E90A 2AEHA 1V86A 2BKFA 2R2QA 3VDZA 4GXBA 3WANA 1GNUA 1Q0WB 2LD9A 1SE9A 2J0KA 2MA9B 1OEYJ 1E8YA 3B08A 2NR2A 4DHJD 3M62B 2MP2A 3PHXB 3PLVA 4M8NA 1V80A 4I6NB 4MDKE 2GBRA 4MSMB 3PHWB 2JVCA 2XEWA 1YIWA 5CTRC 3SDLC 3U8ZA 5J17A 5D94A 4B6WA 2L3ZA 2CHZA 2A5UA 5D2MB 3H9DA 4F7ZA 2MBQA 4JLCA 5J18A 2HE7A 2KFKA 2KQ7A 2WDTB 1Q1OA
chains in the Genus database with same CATH superfamily
2MBOA 2BW2A 4IUMB 1KRHA 3Q3MC 3KH0A 3IVFA 5KHOA 3EA6A 2KDIA 4P1BC 4N6EB 2KKCA 2AQ2B 2KMAA 3ZIMA 1FRDA 4KZCA 3VUYA 4IW0A 3L17A 5LXHA 1R4MI 4NJCA 2CS4A 2ONQA 2KXJA 4ANUA 2LRWA 2OEDA 1KF6B 4YWGG 4B0MA 4GDLA 4BZAA 1RFAA 3LB8C 1SSNA 2L1AA 4BVUC 4S17A 4GDKB 1WXMA 1SEBD 1L6VA 2J42A 4K3CA 2I2YA 2RGFA 2K8BA 3HRDD 4C56C 3C8YA 4WJPA 1L0YB 2FCNA 3ZJUA 1JCKB 1KTKA 3AE3B 2GOWA 4YTMB 3P2BA 4JE3B 3VQIA 1FD6A 4W9HA 2ASQA 1FIQA 1V2YA 2J4XA 2GBNA 4OVUA 2HJ8A 4W9FA 4Q2JA 1RAXA 3JYUA 4HKZE 3X23A 3ZNID 1WM3A 3MP9A 3FILA 1IBXA 3W9CB 3ZNZB 4EE2A 2KWUB 3UQAA 4EUTA 1WI0A 3NZUA 3KYDD 1E5WA 1SE4A 3ZO5B 2E6XA 4FLHA 3BVZA 3ABVB 4EKUA 4A90A 5FK9C 4RH6A 1TJEA 1TKGA 3N32A 4HK2A 2K1FA 4IC7B 4GU2A 3AE1B 4ZRQA 1UBIA 1WZ3A 5CX3A 1H8CA 3L0WB 1HXYD 2INPE 4W9EA 5GXGB 2GRIA 2R2OA 3B9JA 3KWVA 2WGSA 2GBJA 2WX1A 1E8WA 4WH4A 2Y5PA 2O2VB 1CK1A 2JZ3B 3B1LX 1KM7A 4IKGA 4FXCA 3BVGA 5EE1A 4DXFA 1WY8A 1C76A 2K25A 1SE2A 2L32A 1Z2MA 2PMVA 3CSTA 2MJDA 5G2NA 1GAQB 2H88B 2IY0B 1XXGA 1L0XB 1YN5A 3VTUA 4DDGD 3ALBA 1JWAD 1RLFA 4II3B 3BK1A 3ZXRA 3QAQA 1YOVB 3NJTA 2INDC 3GS2A 1F52A 3BVMA 4PS8A 4E3CA 3ZJVA 1HA5A 3AE6B 3GOEA 4TQ1A 4USAA 2RDHA 3RI7C 1P9DU 2BWFA 4IWQA 1T0YA 1GC7A 2KDMA 2JSVX 3P42A 1SF0A 4G11A 2BTEA 5AUKA 4AOFA 3PVLA 2XBBC 1UUPA 3AE7B 2TSSA 4KX6B 1Q5WB 4WJNA 1WGHA 2CHWA 4MH8A 1Y8RC 1I4XA 2K5PA 2L52A 4GB9A 1ZOYB 2KLCA 4PYZA 2N0SB 3TIXA 2NBWB 4HROA 4HPMB 1YD8U 2NS5A 3PV1A 1WZ0A 4WIPA 1BT0A 2Z0EB 1WXVA 3AEAB 5TSSA 3MFGA 1K50A 2FCQA 2EELA 4EOYA 3TL5A 1VZ6A 2JZZA 5EE9A 3U7DA 2SEBD 1JWMD 3RNFC 3PREA 1ZE3D 1JALA 3EC8A 2NMQA 3TUOA 1UBQA 5LNK1 2LGXA 1VCBA 3DVNV 1ENFA 3PS6A 1YMHE 3IT4B 3EGRA 3HVDA 2JZPA 2WDRB 1V5TA 2LJIA 1J7AA 1UELA 3P63A 1WGDA 4IM3A 1WF9A 4HPPA 4DHJB 3V6CB 5LLIA 3JSVA 4EZLA 3NVWA 5BMIA 2ZNVC 1XEEA 3QJZA 1U4AA 3AN1A 1MPEA 3SFEB 1YX6B 1TY0A 2C5LC 2UU7A 3ENEA 1GJZA 3ZKJC 2QIEB 1CQVA 4JGHB 1TT5B 2MCNB 2Z8LA 3VTWA 2V3SA 3DBLB 4TKNA 3A4RA 3OG5A 1WMHB 3AM9A 3AE8B 4ZYSA 3U2SC 2AL6A 5BMGA 2OOBB 1TIFA 2KK8A 2LUEA 4OVZA 2MX2A 4ITKA 2N9KA 3BK2A 4DQOC 2A4ZA 4YT0B 4CYEA 1WH3A 3R66C 3GB1A 1P0RA 2IO3B 2XN9C 2KWDA 1TZ1A 2N9EB 3C0RB 1VR9A 2JXXA 2NTSA 2WX0A 4ICUA 4M0WB 5AUIA 3N20C 4WQMA 2RMMA 3Q8AA 1FCCC 3AE2B 1SIJA 4W9CA 2OJWA 2FNJB 4KIKB 1XLPA 3PO0A 2FCMA 1RM6C 2HTME 2KTRA 3PZDA 1ZKHA 1K51A 4B0EA 1XLOA 2MLBA 1FXAA 2DHZA 1WE7A 4PYUA 4NPNA 1MI0A 4MH0E 1TBEA 2UWQA 2WLBA 1WXAA 2BYFA 3MHZA 3O13A 3EUB2 1C77A 1XF5L 1AARA 5E6OA 2M17A 3RMKC 3HM3A 2DENB 3EFUA 1LGRA 3AMZA 3MJWA 3H7PB 3N3KB 2WS3B 2LGIA 4NAWB 1XLQA 1STEA 3V05A 3L54A 4P16A 4LLGM 2KMMA 2XNAC 4BKTA 1JWSD 1GPXA 1K53A 2J0KA 4J3OD 4M8NA 3M62B 3PHXB 1V97A 5CTRC 3SDLC 1YIWA 4B6WA 2L3ZA 2A5UA 3H9DA 2MBQA 2HE7A 2D3AA 4ARIA 2PE9A 2WXFA 1V1PB 1TGZB 2BVCA 4J6IA 3VR8B 5FR3A 1NI2A 2BS4B 1EU4A 2KMCA 1JWBD 2FBWB 1XD3B 4XC2A 2YEPF 2FAZA 2L76A 1R7SA 2KO3A 2KHWB 2IY1B 3EECA 1PFDA 3NRZA 1F0ZA 3Q8BA 3IT6B 1TKYA 4M8MA 3ZQ4A 2BF8B 3DDCB 2BS3B 2I38A 5DCNA 1YJJA 2LVOA 2MBEA 3OJ3A 2WP9B 1VLBA 4E74A 1FM0D 2WDQB 4I6LB 3RULA 3TEYA 3VRAB 4ACFA 4JX1C 3A9JB 2J0JA 1NBFC 3EFCA 2GBKA 4MGYE 5FKAC 1GG3A 1PDXA 2MJEA 2OHFA 3NOBA 4RGNA 1WGRA 4K7WA 3RNGC 2PVOD 2WXKA 1WJUA 3NG0A 4AP4C 4PS7A 4MELA 4KDIC 4FULA 3WIMA 5D3DA 5EE0A 1OQYA 1D5XC 2YLMA 1DGJA 2YEPB 1F2RI 2N9XA 1B9RA 3VH3B 1V5OA 2N9LA 2UYZB 1AWDA 3B0AA 4RGTA 1CZPA 2PIAA 5IO9A 1SGHA 3KYCD 1FRRA 2Q5WD 4P1CC 3KW5B 2N7EA 3QARA 4ASWC 3NS1A 4DWFA 1NEKB 2RDBC 2L7RA 2AX5A 1P3QU 1TZOA 2K6DB 4K1RB 3AH7A 1V8CA 3DHIC 2ZEQA 3R8BA 4MM3B 1FMAD 1RYJA 2XK5A 4FN2A 1GB4A 2VZKB 1WSPA 1L2NA 1XO3A 2W82A 2MQJA 4FJVB 2M0AA 4ZRKA 3HM6X 1KH0A 2M19A 2EMSA 1ACCA 2HTHA 4MGKE 1DOYA 3WCQA 2KD0A 3SFDB 4AJYB 2JQRB 2LWPA 4YTNB 2LHEA 2BB5A 2NCNA 1YN3A 3SEBA 1M94A 4ZRIA 4HLEA 4MGIE 2PVGC 4GGQA 4MJSB 1WFYA 1YQBA 1IGCA 3AI5A 3MHSD 3BINA 3U7ZA 2QHOA 2PJHA 1E7PB 2KDBA 3L08A 2JY6A 1FO4A 2CKHB 2LVPA 3APFA 2WU5B 2KFJA 1D5ZC 1D5MC 5H8YE 4REZA 5DPTA 2WXLA 4IOIE 3IHPC 3V60A 3ZNGC 5DPWA 5T8IA 1YQ3B 3H1UA 3P4PB 1RWSA 4HKQA 5E6NA 4GN1A 3N1YC 1ZUD2 3NZ3A 4C7YA 4WURA 2INNE 1I4GA 3PGEA 1E8XA 1WJ4A 2IZVB 4IM0A 1SE3A 2KACA 5IOIA 3L16A 3TSSA 1KJTA 1FXTB 2YVCA 1C1YB 1YNTE 2K8HA 2Y5BB 4WQOB 4P6VF 2LHDA 2REXA 1S3SG 2MWSB 5BMHA 2X38A 3BZDB 1EM7A 4O1NA 4US9A 5G5GA 5D6JB 1LXDA 3PRZA 1QLBB 3RT3B 2JF5A 3L13A 4GDLB 2WXRA 5HKHA 3ZUNA 3Q14C 4AJWA 3MC0B 5JHBA 1EWYC 1YX5B 3ZRCA 2HD5B 3TBLD 4LJPB 3UF8A 2V1YA 4C00A 3TMPB 1I4HA 4URKA 2QEJC 3H7PA 4XGAB 1C9FA 2KX3A 1HE8A 2J7QB 2MBBB 5AZGA 4WWOA 4CQNA 3DHHC 2V9HA 2JWUA 4JPSA 2KQ4X 4FHJA 2BS2B 5L83A 3ZVVA 2DZJA 2FUG1 2K9XA 4F1SA 3VH4B 2D3CA 3PLUA 1EO6A 3FILB 4JQWC 4OVVA 3UINB 1FNWA 1WX7A 2C7HA 3H8HA 2LVQA 3P4QB 1GC6A 2KLGA 4HJKA 3KUDB 1WMHA 4NQLB 3BYTB 2KX0A 1IUEA 3RUIB 4XWTA 2JPHA 3K9OB 1SB3C 2KNBA 1WXQA 5IKCM 2M4NA 3BYYB 1YJIA 2JT4B 5EE3A 2ZNVB 3A1QB 4FBJB 4YSZB 2CJNA 3A1QA 3ZTDA 4PS3A 2ZPNA 3DBLI 2V4LA 4ZDVA 4F8CB 2KC2A 3E9SA 4M0WA 1ROEA 4BKGA 4P7IA 3V62A 1KLUD 3T9LA 3CWIA 1V1PA 3R2IA 1YJ1A 3AE9B 2KTRB 1QZEA 4HEA1 1OQRA 3ZNHB 3AE4B 3R7QA 3DBHB 2L0TA 3HVZA 4W9KA 2M56B 1IYFA 2W55A 4FADA 2D3GA 2WXOA 2GMIC 2WXJA 2N9PC 3QA8A 3RCZA 4AQ7A 4C4VA 2SAKA 4C4VB 4NQKE 3A4SC 5DPRA 1KOTA 3I57A 1MHHE 1BXTA 1EU3A 2BBCA 2V3NA 4GDKA 4JL9A 4D2KA 2K8CA 2JRIB 2DX5B 2KT7A 2Y3AA 3PSEB 4TMAB 2NPTB 3SR6A 2IYDB 3RYTA 4LTUA 1V9JA 1WGKA 2MJ3A 2GB1A 4WAAA 3ZRFA 4IWOA 4RF1A 2K39A 1Q10A 4L2YA 2W54A 3FC4A 3V6EB 4LNKA 3QWZB 1C3TA 2PEAA 1V86A 3I63C 5HFYA 2K22A 1GNUA 1L0VB 3AECB 2HJ1A 2LD9A 2WXGA 1SE9A 1OEYJ 3B08A 3U52E 4AS1A 2HDEA 4I6NB 1BUIC 5J17A 1N5XA 2XEWA 1UGJA 5D94A 2CHZA 2RPVA 4JLCA 3M95A 2KQ7A 1VZ7A 1Q1OA 4H2AA 3KUZA 3CMMB 2DZIA 4EZJA 1TS3A 3DWGC 4G50A 3GE3C 5C1ZA 1PGAA 2JRHA 4BFRA 2K6QA 4OZBA 2DNFA 1M4VA 4AWJA 2IPKD 4JWUC 3X0WA 1E7UA 2W3SA 5HHDG 4MJSA 2BPSA 4A8XC 4BKSA 2PPHA 4YL8A 4HCNB 4DXAB 4FHKA 5LXIB 2KC1A 2CU3A 4YXDB 4UDUC 3JVZX 4DBGA 3UIOB 1AN8A 1P7EA 3ONSA 3DVNU 2LASA 3LXFA 2EKIA 4K81A 1DOIA 1ET6A 2QSDA 2O6VA 1JWUD 4LNOA 4XX5A 4EEWA 5IA7A 3HHMA 3VUXA 3Q8CA 4A55A 1N5WA 4A3PA 3V3XA 2C60A 3Q3JA 1MG4A 4W9IA 3RNAC 3UQBA 2LGYA 1NENB 3ZTCA 1C79A 1P1AA 3HUIA 4KV2A 4YTPB 3PRMB 3OAWA 2M0XA 5C3JB 2CJOA 4HCPB 2L8JA 2V3PA 3WA0A 1WR1A 3MC8A 4HRSA 3N9YC 3APCA 1X1MA 4GOCA 3DVGX 2LFIA 1VZ8A 2D2QA 2WXIA 2WXMA 1WE6A 1HZ5A 1SXTA 2XK5B 1AW7A 3I9V1 4DXGA 2IGDA 4E71A 3Q3NC 1J0GA 1WR6E 2MP2B 1OGWA 1MG8A 2WDVB 3Q69A 2JX5A 4ZYNA 2LI5A 2C9WB 4QAYA 3ZDMC 1UH6A 3GP7A 4I6PA 4MACA 4WWNA 4RFBA 4LNIA 2KWCA 1MFWA 1E0ZA 3VXWA 5IN7A 1K8RB 3DPDA 3LYYA 2I1KA 3DBRB 4ANWA 4OW0A 3AV8A 2X8XX 4OZAA 1J7BA 4PT5A 2BKRB 2QJLA 2ZPYA 1ET9A 2D10A 2VRRB 4JWSC 1JROA 4LJOB 4RNAA 3W2DA 2LJ5A 3Q8FA 1QOAA 1ZP0B 4WAFA 3CF6E 1T6BX 2M1MA 3ML8A 4HPLB 3QX1A 2GI9A 1D4BA 3AEEB 4RF0A 1K52A 1XCQL 1EWCA 2KN4A 2LUMA 1DOXA 3ZXVA 2DAFA 1NVID 1HTQA 1UNSA 2MSED 2DBYA 4MEMA 3R3MA 2WHIA 1ZPSA 4RCOA 2KQSA 1EF1A 1H4RA 3A33B 3MC9A 4ZRJA 3IG3A 1J19A 3Q6BA 4DHZB 3FKYA 3VRBB 4G0NB 1R4NB 4ZHPA 1OEYA 1D3ZA 4IWPA 2DZKA 3IAM1 1HQRD 4DK5A 2KDEB 1P98A 2INCC 3N1ZC 1L7YA 4A3OA 1RRBA 1L4ZB 1NYRA 2J0MA 1UZXB 4G3XB 1WGGA 3E56A 3DHGC 3P1MA 2BB6A 3N30A 3I3TB 1HTOA 1ESFA 4L1BA 2DZMA 4WWMA 4FJZA 4WJQA 1UD7A 4A20A 1AYFA 4II2B 1KLGD 3NVYA 3NZSA 5EDSA 2V0GA 2Y5CA 1J7CA 1OFFA 1D6EC 3TEWA 4N9F4 2Z0DB 2L05A 2D5GA 2BYVE 4TV3A 2J53A 1UGMA 3TEXA 2GLSA 2BGFA 5AZFA 1QKZA 2NPTA 4K7UA 2L0FA 4KVGB 3HIZA 2O6VB 3MJ5A 3UI3A 3WALA 3QK0A 4XYCA 4DHZE 2W9NA 1EUVB 1VD2A 4RGMA 3AEGB 2RR9A 3PT2B 3DQVA 4KIKA 2D07B 4LK0M 4BBNF 3ZLZA 1SJED 5I4DA 2LXAA 2H89B 3NVZA 4JIOU 2DYOA 3UGBB 2PLPA 1UWMA 1WRDB 1E6EB 1SJHD 1VDVA 2AQ1B 4NAMA 4WJOA 3T8MA 4GLSC 1WX9A 4CHKA 3TEZA 3U30A 1FEHA 3OWEB 2IDYA 1QOGA 4HXDA 5G5HA 5D3IB 1WYWB 1WGYA 3PZ7A 4MM3A 2N1VA 3AXCA 2VH2A 2PTLA 1L4DB 1CJEA 1ZW7A 3NUHB 3RNBC 3LDZE 1ZGUB 2BWES 5J2RA 5C23A 2MRPA 3NVVA 3N1XC 1JMLA 1R4MB 1XQQA 2N7DA 3PRPB 4B9KA 5JZEB 4R3DA 3KQ4A 3OLMD 4YSXB 2G1EA 3VAWA 2J52A 5E6JA 2LRUA 1WJNA 2GBMA 4S0RA 2IO0B 4NNJB 1VJKA 4KGTA 1A70A 1TTNA 3PZ8A 1UWXA 3URYA 2O2VA 1QOBA 1E8ZA 1N61A 4L23A 2JYEA 3ZDTA 4AUQC 2B3AA 4TQ0A 3L10B 4ZHOA 1FXIA 3VFKA 3WAMA 2ZVOA 1V1OA 4IM2A 1E7VA 1T0QC 2ZW1A 3A9KA 3A9KB 2M8SA 3WAPA 2VZKD 1TKEA 4HJGE 1GOZA 1GB1A 3KWLA 3SD5A 2OJRA 3ZW3A 2JWZA 3P4RB 1LM8B 1WWTA 1L5PA 3CSFA 3LJ3A 2D3BA 3EHVA 4GSWA 2NVUI 1QILA 4XDDA 2AEHA 1G6JA 1FFUA 4GXBA 3WANA 1PUTA 3Q8EA 1Q0WB 1QQRA 3I5JC 2QC8A 3RN9C 1QOFA 2QCZA 4MDKE 4IDIA 4MSMB 2L83A 3U8ZA 4F7ZA 5D2MB 4LNFA 2KFKA 3C19A 2WDTB 4WWPA 2WQYB 1IP9A 4FJYA 1C4AA 4RGOS 4HDQA 3J9CA 3RPFC 1PGXA 2AYOB 2WXQA 1QF6A 1EF5A 2ZCCA 1WM2A 3ZYYX 2CHXA 2DLBA 1HZ6A 4IG7B 2AL3A 2KWVB 3S2AA 4LCDE 3T3NA 3AULA 1TY2A 1V81A 4A9AA 3V61A 1S1QB 1A5RA 4PK1A 1WYGA 1I35A 1F9JA 3GE8C 3OJ4B 2IBIB 3DVGY 4NY0A 3SHQA 3RNCC 2FCSA 2LMCA 3B2GA 4NAWA 4KSLC 1B1ZA 4TUUA 4OZCA 5G55A 1F2RC 2KJHB 2WXNA 4EZKA 5L95C 2C7MB 4MGZE 2LXCA 3ETRA 2N1WA 2ICIA 4ICVA 5D7GA 1N60A 4XDCA 3B2FA 3PPAA 1V6EA 4HVBA 4LDTD 2KDFB 2ZJDA 3W1SA 3JSVB 4CO7A 3M3JA 4W9LA 2E3TA 2KN5A 3APDA 2WU2B 5GMVA 3IAS1 3ML9A 2LGDA 3BY4B 3H7SA 1GUAB 1PYWD 4M01A 1XLNA 4MT5A 2FE8A 3ZJTA 3DOWA 3HK0A 2G4DB 1Y56A 2EKEC 3DWMA 2KVRA 2PW9A 4ANVA 4M02A 3R2TA 1N62A 5AEKB 3CIRB 4XZ4A 5HI1A 2L00B 3AEFB 1J8CA 1I4RA 4XWWA 5JXVA 1WX8A 1I7HA 4GIVA 2EMTA 2I1JA 2FUHB 2Z59B 2B76B 3M63B 1XCTL 1C78A 4YSYB 2N4FA 3A9JA 4MSQB 3T3OA 5FR6A 4A6QA 2JUOA 4RM8A 1F77A 2BYEA 4C80A 3W5UB 2MH7A 5IP4D 2RSUA 3AU5A 1T0RC 2K0PA 1RFKA 1HEZE 3NS8A 2CR5A 2FIFA 3QCAA 4C7ZA 3AB5A 3L4PA 3DBHI 4NJ6A 3IFWB 3RD2A 3WAOA 3SU8X 1SIFA 3IXSA 3H6NA 1FNUA 2MEKA 2DYBA 3RZWC 3K9PB 2G9HD 1FFVA 2KANA 2QILA 2KTFA 4K3BA 2K3UA 4DDID 2DAJA 1E10A 4B95A 3ECIA 2VH1A 3TJPA 2AWTA 1T3QA 1FNVA 2ON8A 1MVKA 5BYSA 5IAAC 4KKJA 2D11A 3AE5B 2DWQA 3VR9B 1TYGB 2WXHA 4W9JA 3Q2AC 4BBNC 1VRAB 1I4QA 1JRUA 1TS5A 3AEBB 3DBRI 4ARCA 1TS4A 2IGHA 2MBHA 4TSSA 2JXTA 1MJDA 2IGGA 1LFDA 4BAXA 2N7JA 3RFZB 4N58A 1MHXA 1ZDVA 3ZGZA 2CU1A 3U4EG 5JHAA 3BIID 3R7RA 3KVFB 4KGSA 4ZOHC 2BT6A 1ZDXA 1ZXIA 4XE0A 4GMVA 4EFOA 1JQ4A 1F1HA 2MHJA 1FCLA 2LEKA 3QC8B 3GZNB 4X57B 5E6PA 1SBBB 1TS2A 5CHWA 1KLVA 2JYTA 3AEDB 2AQ3B 4M00A 2NBVB 2ZW0A 2ZZPB 3Q3FA 2KZRA 1JW9D 5BYRA 3MTNB 5BO4B 4LNNA 4ANXA 2WNMA 4K7SA 3VHTC 5BYQA 2RD0A 4LDTB 2ZVNA 4HWIB 2WWZA 1FPYA 1Z5SB 3VUWA 4NZLB 2G45B 5TR5A 3W1YA 1N63A 3NHEB 1KFYB 2LGSA 4W9DA 4KKIA 2QMTA 1PQSA 1XT9B 3NY5A 2QDFA 4RM9A 1V49A 2C7NB 5HG2A 2KFKB 3KUCB 1N6ZA 2KJRA 2RPQA 1IBXB 2KAJA 2KVZA 3P4SB 5MPOA 3UIPB 4BOSC 2IO2B 2DYMA 3Q3OC 2PKOA 1CMXB 4OHJA 1OQQA 2NTTA 2PE6B 4US8A 3W1SC 3DBSA 3IBEA 1NDDA 3KLSX 1R4NI 3RZFA 2G3QB 2ACZB 4BKSD 1UF0A 3FAHA 4KSKC 1C4PA 1QT9A 2KYWA 2LZ6A 3PTFC 1L6UA 2BQQA 4NJ7A 2V4IB 3JW0X 4FA6A 2KOXA 1ZXHA 3VTVA 1BMLC 1OTRB 1WRIA 4KZ0A 2MW5A 2IJ0A 3D32A 3QHTA 3QIJA 4KGRA 1NYQA 1P7FA 1ISNA 3DCGA 1DYQA 2IO1B 2NBUA 2W3RA 2WXPA 2ZCBA 2O6VD 4W9GA 4KDLB 2G4SA 1YN4A 5DPSA 5JH5C 1PGBA 3O65B 1E9MA 4N59A 2WYQA 5CHVC 1LQBA 3AU4A 3VVWB 3TCAA 5AZHA 3W5VB 3QQ8B 2FIDA 4BOZB 2KJ6A 5KHQA 1LO5D 1JRPA 4HDOA 1YQ4B 3RNEC 1T5XD 4ZRPA 5CHFA 1WJ6A 1I4PA 1WXSA 3GZNI 4RMAA 1WIAA 3BWUD 2BYTA 1IPGA 1T0SC 2JU6X 1I42A 1E90A 2BKFA 2R2QA 3VDZA 2R61A 1IGDA 1NI3A 2MA9B 1E8YA 2RDGA 2NR2A 4DHJD 2MP2A 3PLVA 1C4CA 1V80A 2GBRA 3PHWB 2JVCA 5H92C 5J18A 5C2TB
chains in the Genus database with same CATH topology
2PE9A 2MBOA 4WWPA 3KUZA 1TGZB 4IUMB 3CMMB 2DZIA 4EZJA 4J6IA 3KH0A 1IP9A 4G50A 3IVFA 5C1ZA 2JRHA 4BFRA 2K6QA 5KHOA 1NI2A 4FJYA 4AWJA 2KDIA 2KMCA 4HDQA 2KKCA 2AYOB 3X0WA 1E7UA 2KMAA 3ZIMA 1XD3B 4KZCA 4XC2A 2FAZA 4MJSA 2L76A 1EF5A 2ZCCA 2BPSA 3VUYA 4IW0A 3L17A 1WM2A 2KO3A 5LXHA 4BKSA 2CHXA 1R4MI 2PPHA 2KHWB 4YL8A 2IY1B 3EECA 4HCNB 2CS4A 4IG7B 2AL3A 2KXJA 2KWVB 4ANUA 3S2AA 4DXAB 4LCDE 4FHKA 5LXIB 3AULA 2KC1A 2LRWA 4M8MA 2BF8B 3DDCB 1V81A 3V61A 4GDLA 1S1QB 1RFAA 5DCNA 2LVOA 2MBEA 1A5RA 3OJ3A 4E74A 1I35A 4BVUC 4I6LB 3RULA 1F9JA 3JVZX 4DBGA 3OJ4B 2IBIB 3DVGY 4NY0A 3UIOB 3ONSA 4GDKB 3DVNU 1WXMA 2LASA 3A9JB 3SHQA 2J0JA 1NBFC 2FCSA 4K81A 2GBKA 4MGYE 1GG3A 3NOBA 1WGRA 4K7WA 4NAWA 4KSLC 4TUUA 5G55A 2RGFA 2K8BA 2O6VA 1WJUA 4AP4C 2KJHB 4PS7A 4XX5A 4WJPA 4EEWA 4MELA 4EZKA 5L95C 4KDIC 5IA7A 2C7MB 3HHMA 4MGZE 3VUXA 2LXCA 2FCNA 4FULA 3WIMA 1OQYA 2N1WA 4ICVA 2GOWA 2YLMA 5D7GA 3P2BA 3VQIA 4W9HA 2ASQA 3PPAA 4A3PA 1V6EA 4HVBA 1V2YA 4LDTD 2KDFB 2ZJDA 2GBNA 3W1SA 2C60A 4OVUA 2HJ8A 2N9XA 3Q3JA 3JSVB 3VH3B 1V5OA 4W9IA 4W9FA 2UYZB 3B0AA 1RAXA 3UQBA 2LGYA 4CO7A 1SGHA 3JYUA 3M3JA 3ZTCA 3KYCD 4W9LA 2KN5A 3APDA 5GMVA 3X23A 3ML9A 2LGDA 1WM3A 3ZNID 1P1AA 3BY4B 3H7SA 3KW5B 1GUAB 2N7EA 3QARA 4ASWC 4KV2A 3PRMB 3ZNZB 4DWFA 2KWUB 3OAWA 2M0XA 2L7RA 3DOWA 3UQAA 4EUTA 3HK0A 2G4DB 4HCPB 2L8JA 2EKEC 1P3QU 3WA0A 1WI0A 3NZUA 1WR1A 2K6DB 2KVRA 4ANVA 3APCA 1E5WA 3KYDD 4K1RB 3ZO5B 1X1MA 4GOCA 5AEKB 3DVGX 2ZEQA 4XZ4A 4FLHA 2D2QA 2L00B 4EKUA 2XK5A 1J8CA 1WE6A 2XK5B 4FN2A 1WX8A 4GIVA 1L2NA 2EMTA 2I1JA 2FUHB 2MQJA 2Z59B 3N32A 4E71A 3M63B 2K1FA 4FJVB 4HK2A 4ZRKA 3HM6X 4IC7B 4GU2A 1J0GA 1WR6E 2MP2B 1OGWA 2EMSA 1MG8A 2N4FA 3A9JA 1UBIA 1WZ3A 4MSQB 5CX3A 2HTHA 4MGKE 5FR6A 4ZYNA 2JUOA 2LI5A 2C9WB 1H8CA 3L0WB 2KD0A 4RM8A 4W9EA 3ZDMC 1UH6A 4AJYB 4I6PA 4WWNA 2BYEA 2LWPA 2R2OA 2KWCA 2RSUA 2NCNA 3AU5A 3VXWA 2GBJA 2WX1A 1K8RB 1M94A 1E8WA 3DPDA 4ZRIA 4HLEA 4MGIE 4GGQA 4MJSB 1WFYA 4ANWA 2I1KA 2O2VB 1YQBA 2JZ3B 3B1LX 1KM7A 3AI5A 3NS8A 3MHSD 2CR5A 2FIFA 3QCAA 3BINA 2BKRB 2ZPYA 1WY8A 2K25A 2QHOA 1Z2MA 2PJHA 2D10A 2VRRB 2KDBA 3DBHI 4LJOB 4NJ6A 3L08A 3CSTA 2LJ5A 2JY6A 5G2NA 3IFWB 3RD2A 3CF6E 2M1MA 3SU8X 3WAOA 1SIFA 2CKHB 2IY0B 3ML8A 3H6NA 4HPLB 2LVPA 3APFA 2DYBA 3QX1A 3RZWC 2KFJA 3K9PB 2KANA 3VTUA 2KTFA 5DPTA 4DDGD 3ALBA 2DAJA 3IHPC 3V60A 4DDID 3ZNGC 1RLFA 4B95A 2DAFA 3ECIA 5DPWA 4II3B 3TJPA 3H1UA 3QAQA 2MSED 2AWTA 4MEMA 3R3MA 5E6NA 4GN1A 4PS8A 4E3CA 5IAAC 2D11A 2KQSA 1EF1A 1H4RA 3A33B 3GOEA 4TQ1A 4ZRJA 3IG3A 1J19A 4DHZB 4W9JA 3PGEA 4BBNC 4G0NB 1OEYA 1E8XA 1P9DU 1WJ4A 2BWFA 4IWQA 2IZVB 4IM0A 1JRUA 1T0YA 1D3ZA 1GC7A 4IWPA 2DZKA 3DBRI 4DK5A 2KDEB 1P98A 2MBHA 3L16A 4G11A 1KJTA 1L7YA 1FXTB 1LFDA 4A3OA 3PVLA 4AOFA 2XBBC 2YVCA 1C1YB 1RRBA 2K8HA 2J0MA 2Y5BB 1UZXB 4G3XB 4WQOB 1Q5WB 4WJNA 1WGGA 2REXA 1S3SG 1WGHA 2CHWA 2MWSB 2CU1A 3N30A 1Y8RC 3I3TB 2DZMA 4FJZA 4WJQA 4GB9A 3R7RA 5JHAA 1UD7A 3KVFB 4A20A 2KLCA 4PYZA 4II2B 3TIXA 2NBWB 3NZSA 4HPMB 1YD8U 5D6JB 1LXDA 2NS5A 3PV1A 4GMVA 1WZ0A 4EFOA 5EDSA 1BT0A 3PRZA 2Z0EB 3QC8B 1WXVA 3RT3B 2JF5A 3L13A 4GDLB 4X57B 5E6PA 4N9F4 2Z0DB 2L05A 5HKHA 2BYVE 4TV3A 2FCQA 5CHWA 3ZUNA 4AJWA 4EOYA 3TL5A 1UGMA 5JHBA 1KLVA 1YX5B 3ZRCA 2JZZA 2HD5B 2BGFA 3TBLD 2NBVB 4LJPB 2V1YA 3UF8A 3TMPB 2ZZPB 3Q3FA 3U7DA 2KZRA 4URKA 5AZFA 2NPTA 3H7PA 3MTNB 5BO4B 4K7UA 2L0FA 3PREA 4KVGB 4ANXA 3EC8A 3HIZA 1UBQA 2O6VB 4K7SA 3VHTC 2KX3A 1HE8A 2J7QB 2LGXA 2RD0A 3QK0A 2W9NA 4LDTB 3WALA 1VCBA 1EUVB 2MBBB 1VD2A 2ZVNA 2WWZA 1Z5SB 4HWIB 4WWOA 5AZGA 3VUWA 3PT2B 2RR9A 3DVNV 2G45B 3DQVA 3PS6A 4KIKA 5TR5A 3W1YA 2D07B 3NHEB 4W9DA 4BBNF 1V5TA 3ZLZA 1UELA 1WGDA 4FHJA 4IM3A 1WF9A 4DHJB 1PQSA 1XT9B 3V6CB 2LXAA 3NY5A 5LLIA 3ZVVA 5L83A 3JSVA 4EZLA 2ZNVC 3M95A 3QJZA 4JIOU 1U4AA 2DZJA 4RM9A 1V49A 2DYOA 1YX6B 3UGBB 4F1SA 2C5LC 3VH4B 2C7NB 2KFKB 1WRDB 3ENEA 3KUCB 3PLUA 1GJZA 3ZKJC 1EO6A 4JQWC 4DHZE 4JGHB 4WJOA 3T8MA 2MCNB 2KJRA 2RPQA 1WX9A 4OVVA 3UINB 3VTWA 1WX7A 2C7HA 2V3SA 4CHKA 2LVQA 3U30A 3UIPB 4BOSC 2IO2B 2DYMA 4TKNA 3A4RA 1CMXB 1GC6A 1WMHB 2KLGA 4HJKA 3KUDB 1WMHA 4HXDA 2AL6A 2PE6B 2OOBB 3W1SC 3DBSA 4NQLB 1WYWB 3IBEA 2KK8A 1WGYA 2KX0A 2LUEA 2MX2A 4MM3A 1NDDA 2N1VA 3AXCA 1R4NI 3RUIB 3RZFA 2JPHA 3K9OB 2A4ZA 2KNBA 1ZW7A 2M4NA 4CYEA 1WH3A 2G3QB 3R66C 3LDZE 1P0RA 1ZGUB 2IO3B 4BKSD 2JT4B 2BWES 4KSKC 5J2RA 5C23A 2LZ6A 2MRPA 3PTFC 2ZNVB 3A1QB 1TZ1A 2N9EB 3C0RB 4FBJB 3A1QA 3ZTDA 4PS3A 2ZPNA 1XQQA 2N7DA 2JXXA 2V4LA 2WX0A 3DBLI 3PRPB 4B9KA 4F8CB 4ZDVA 2KC2A 4NJ7A 4ICUA 5JZEB 3JW0X 4M0WB 4BKGA 3OLMD 4FA6A 4P7IA 3V62A 2KOXA 3VTVA 1OTRB 3T9LA 3VAWA 4KZ0A 1YJ1A 2MW5A 3D32A 4W9CA 2FNJB 2LRUA 3QHTA 3QIJA 4KIKB 1WJNA 2GBMA 2FCMA 2KTRA 2IO0B 2KTRB 1ISNA 4NNJB 3DCGA 1QZEA 3PZDA 2IO1B 1ZKHA 2NBUA 3ZNHB 1TTNA 2ZCBA 3R7QA 2O6VD 2O2VA 1I42A 2L0TA 4W9GA 4KDLB 1E8ZA 2G4SA 4W9KA 5DPSA 2MLBA 5JH5C 2DHZA 1IYFA 1WE7A 3ZDTA 2D3GA 2B3AA 4PYUA 3L10B 4AUQC 2GMIC 4TQ0A 3O65B 4FADA 4NPNA 2N9PC 3QA8A 3RCZA 4MH0E 2WYQA 1TBEA 2UWQA 5CHVC 3VFKA 1LQBA 4NQKE 3AU4A 3A4SC 3VVWB 5DPRA 3WAMA 1WXAA 2BYFA 2ZVOA 1KOTA 4IM2A 3TCAA 5AZHA 3QQ8B 2FIDA 1AARA 1E7VA 3A9KA 4GDKA 5E6OA 3A9KB 2M17A 2M8SA 4JL9A 3WAPA 4BOZB 3HM3A 2KJ6A 2DENB 2K8CA 2JRIB 3EFUA 2DX5B 5KHQA 3PSEB 4HDOA 3MJWA 2NPTB 3H7PB 3N3KB 3SD5A 2IYDB 2OJRA 3RYTA 5CHFA 2JWZA 3ZW3A 1LM8B 4NAWB 1V9JA 1WJ6A 3CSFA 4WAAA 1WXSA 3L54A 4IWOA 3ZRFA 2K39A 3LJ3A 3GZNI 3V6EB 4RMAA 1WIAA 3EHVA 3QWZB 4GSWA 2NVUI 1IPGA 2PEAA 4BKTA 1C3TA 1G6JA 1E90A 2AEHA 1V86A 2BKFA 2R2QA 3VDZA 4GXBA 3WANA 1GNUA 1Q0WB 2LD9A 1SE9A 2J0KA 2MA9B 1OEYJ 1E8YA 3B08A 2NR2A 4DHJD 3M62B 2MP2A 3PHXB 3PLVA 4M8NA 1V80A 4I6NB 4MDKE 2GBRA 4MSMB 3PHWB 2JVCA 2XEWA 1YIWA 5CTRC 3SDLC 3U8ZA 5J17A 5D94A 4B6WA 2L3ZA 2CHZA 2A5UA 5D2MB 3H9DA 4F7ZA 2MBQA 4JLCA 5J18A 2HE7A 2KFKA 2KQ7A 2WDTB 1Q1OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PE9 A;  2MBO A;  4WWP A;  3KUZ A;  1TGZ B;  4IUM B;  3CMM B;  2DZI A;  4EZJ A;  4J6I A;  3KH0 A;  1IP9 A;  4G50 A;  3IVF A;  5C1Z A;  2JRH A;  4BFR A;  2K6Q A;  5KHO A;  1NI2 A;  4FJY A;  4AWJ A;  2KDI A;  2KMC A;  4HDQ A;  2KKC A;  2AYO B;  3X0W A;  1E7U A;  2KMA A;  3ZIM A;  1XD3 B;  4KZC A;  4XC2 A;  2FAZ A;  4MJS A;  2L76 A;  1EF5 A;  2ZCC A;  2BPS A;  3VUY A;  4IW0 A;  3L17 A;  1WM2 A;  2KO3 A;  5LXH A;  4BKS A;  2CHX A;  1R4M I;  2PPH A;  2KHW B;  4YL8 A;  2IY1 B;  3EEC A;  4HCN B;  2CS4 A;  4IG7 B;  2AL3 A;  2KXJ A;  2KWV B;  4ANU A;  3S2A A;  4DXA B;  4LCD E;  4FHK A;  5LXI B;  3AUL A;  2KC1 A;  2LRW A;  4M8M A;  2BF8 B;  3DDC B;  1V81 A;  3V61 A;  4GDL A;  1S1Q B;  1RFA A;  5DCN A;  2LVO A;  2MBE A;  1A5R A;  3OJ3 A;  4E74 A;  1I35 A;  4BVU C;  4I6L B;  3RUL A;  1F9J A;  3JVZ X;  4DBG A;  3OJ4 B;  2IBI B;  3DVG Y;  4NY0 A;  3UIO B;  3ONS A;  4GDK B;  3DVN U;  1WXM A;  2LAS A;  3A9J B;  3SHQ A;  2J0J A;  1NBF C;  2FCS A;  4K81 A;  2GBK A;  4MGY E;  1GG3 A;  3NOB A;  1WGR A;  4K7W A;  4NAW A;  4KSL C;  4TUU A;  5G55 A;  2RGF A;  2K8B A;  2O6V A;  1WJU A;  4AP4 C;  2KJH B;  4PS7 A;  4XX5 A;  4WJP A;  4EEW A;  4MEL A;  4EZK A;  5L95 C;  4KDI C;  5IA7 A;  2C7M B;  3HHM A;  4MGZ E;  3VUX A;  2LXC A;  2FCN A;  4FUL A;  3WIM A;  1OQY A;  2N1W A;  4ICV A;  2GOW A;  2YLM A;  5D7G A;  3P2B A;  3VQI A;  4W9H A;  2ASQ A;  3PPA A;  4A3P A;  1V6E A;  4HVB A;  1V2Y A;  4LDT D;  2KDF B;  2ZJD A;  2GBN A;  3W1S A;  2C60 A;  4OVU A;  2HJ8 A;  2N9X A;  3Q3J A;  3JSV B;  3VH3 B;  1V5O A;  4W9I A;  4W9F A;  2UYZ B;  3B0A A;  1RAX A;  3UQB A;  2LGY A;  4CO7 A;  1SGH A;  3JYU A;  3M3J A;  3ZTC A;  3KYC D;  4W9L A;  2KN5 A;  3APD A;  5GMV A;  3X23 A;  3ML9 A;  2LGD A;  1WM3 A;  3ZNI D;  1P1A A;  3BY4 B;  3H7S A;  3KW5 B;  1GUA B;  2N7E A;  3QAR A;  4ASW C;  4KV2 A;  3PRM B;  3ZNZ B;  4DWF A;  2KWU B;  3OAW A;  2M0X A;  2L7R A;  3DOW A;  3UQA A;  4EUT A;  3HK0 A;  2G4D B;  4HCP B;  2L8J A;  2EKE C;  1P3Q U;  3WA0 A;  1WI0 A;  3NZU A;  1WR1 A;  2K6D B;  2KVR A;  4ANV A;  3APC A;  1E5W A;  3KYD D;  4K1R B;  3ZO5 B;  1X1M A;  4GOC A;  5AEK B;  3DVG X;  2ZEQ A;  4XZ4 A;  4FLH A;  2D2Q A;  2L00 B;  4EKU A;  2XK5 A;  1J8C A;  1WE6 A;  2XK5 B;  4FN2 A;  1WX8 A;  4GIV A;  1L2N A;  2EMT A;  2I1J A;  2FUH B;  2MQJ A;  2Z59 B;  3N32 A;  4E71 A;  3M63 B;  2K1F A;  4FJV B;  4HK2 A;  4ZRK A;  3HM6 X;  4IC7 B;  4GU2 A;  1J0G A;  1WR6 E;  2MP2 B;  1OGW A;  2EMS A;  1MG8 A;  2N4F A;  3A9J A;  1UBI A;  1WZ3 A;  4MSQ B;  5CX3 A;  2HTH A;  4MGK E;  5FR6 A;  4ZYN A;  2JUO A;  2LI5 A;  2C9W B;  1H8C A;  3L0W B;  2KD0 A;  4RM8 A;  4W9E A;  3ZDM C;  1UH6 A;  4AJY B;  4I6P A;  4WWN A;  2BYE A;  2LWP A;  2R2O A;  2KWC A;  2RSU A;  2NCN A;  3AU5 A;  3VXW A;  2GBJ A;  2WX1 A;  1K8R B;  1M94 A;  1E8W A;  3DPD A;  4ZRI A;  4HLE A;  4MGI E;  4GGQ A;  4MJS B;  1WFY A;  4ANW A;  2I1K A;  2O2V B;  1YQB A;  2JZ3 B;  3B1L X;  1KM7 A;  3AI5 A;  3NS8 A;  3MHS D;  2CR5 A;  2FIF A;  3QCA A;  3BIN A;  2BKR B;  2ZPY A;  1WY8 A;  2K25 A;  2QHO A;  1Z2M A;  2PJH A;  2D10 A;  2VRR B;  2KDB A;  3DBH I;  4LJO B;  4NJ6 A;  3L08 A;  3CST A;  2LJ5 A;  2JY6 A;  5G2N A;  3IFW B;  3RD2 A;  3CF6 E;  2M1M A;  3SU8 X;  3WAO A;  1SIF A;  2CKH B;  2IY0 B;  3ML8 A;  3H6N A;  4HPL B;  2LVP A;  3APF A;  2DYB A;  3QX1 A;  3RZW C;  2KFJ A;  3K9P B;  2KAN A;  3VTU A;  2KTF A;  5DPT A;  4DDG D;  3ALB A;  2DAJ A;  3IHP C;  3V60 A;  4DDI D;  3ZNG C;  1RLF A;  4B95 A;  2DAF A;  3ECI A;  5DPW A;  4II3 B;  3TJP A;  3H1U A;  3QAQ A;  2MSE D;  2AWT A;  4MEM A;  3R3M A;  5E6N A;  4GN1 A;  4PS8 A;  4E3C A;  5IAA C;  2D11 A;  2KQS A;  1EF1 A;  1H4R A;  3A33 B;  3GOE A;  4TQ1 A;  4ZRJ A;  3IG3 A;  1J19 A;  4DHZ B;  4W9J A;  3PGE A;  4BBN C;  4G0N B;  1OEY A;  1E8X A;  1P9D U;  1WJ4 A;  2BWF A;  4IWQ A;  2IZV B;  4IM0 A;  1JRU A;  1T0Y A;  1D3Z A;  1GC7 A;  4IWP A;  2DZK A;  3DBR I;  4DK5 A;  2KDE B;  1P98 A;  2MBH A;  3L16 A;  4G11 A;  1KJT A;  1L7Y A;  1FXT B;  1LFD A;  4A3O A;  3PVL A;  4AOF A;  2XBB C;  2YVC A;  1C1Y B;  1RRB A;  2K8H A;  2J0M A;  2Y5B B;  1UZX B;  4G3X B;  4WQO B;  1Q5W B;  4WJN A;  1WGG A;  2REX A;  1S3S G;  1WGH A;  2CHW A;  2MWS B;  2CU1 A;  3N30 A;  1Y8R C;  3I3T B;  2DZM A;  4FJZ A;  4WJQ A;  4GB9 A;  3R7R A;  5JHA A;  1UD7 A;  3KVF B;  4A20 A;  2KLC A;  4PYZ A;  4II2 B;  3TIX A;  2NBW B;  3NZS A;  4HPM B;  1YD8 U;  5D6J B;  1LXD A;  2NS5 A;  3PV1 A;  4GMV A;  1WZ0 A;  4EFO A;  5EDS A;  1BT0 A;  3PRZ A;  2Z0E B;  3QC8 B;  1WXV A;  3RT3 B;  2JF5 A;  3L13 A;  4GDL B;  4X57 B;  5E6P A;  4N9F 4;  2Z0D B;  2L05 A;  5HKH A;  2BYV E;  4TV3 A;  2FCQ A;  5CHW A;  3ZUN A;  4AJW A;  4EOY A;  3TL5 A;  1UGM A;  5JHB A;  1KLV A;  1YX5 B;  3ZRC A;  2JZZ A;  2HD5 B;  2BGF A;  3TBL D;  2NBV B;  4LJP B;  2V1Y A;  3UF8 A;  3TMP B;  2ZZP B;  3Q3F A;  3U7D A;  2KZR A;  4URK A;  5AZF A;  2NPT A;  3H7P A;  3MTN B;  5BO4 B;  4K7U A;  2L0F A;  3PRE A;  4KVG B;  4ANX A;  3EC8 A;  3HIZ A;  1UBQ A;  2O6V B;  4K7S A;  3VHT C;  2KX3 A;  1HE8 A;  2J7Q B;  2LGX A;  2RD0 A;  3QK0 A;  2W9N A;  4LDT B;  3WAL A;  1VCB A;  1EUV B;  2MBB B;  1VD2 A;  2ZVN A;  2WWZ A;  1Z5S B;  4HWI B;  4WWO A;  5AZG A;  3VUW A;  3PT2 B;  2RR9 A;  3DVN V;  2G45 B;  3DQV A;  3PS6 A;  4KIK A;  5TR5 A;  3W1Y A;  2D07 B;  3NHE B;  4W9D A;  4BBN F;  1V5T A;  3ZLZ A;  1UEL A;  1WGD A;  4FHJ A;  4IM3 A;  1WF9 A;  4DHJ B;  1PQS A;  1XT9 B;  3V6C B;  2LXA A;  3NY5 A;  5LLI A;  3ZVV A;  5L83 A;  3JSV A;  4EZL A;  2ZNV C;  3M95 A;  3QJZ A;  4JIO U;  1U4A A;  2DZJ A;  4RM9 A;  1V49 A;  2DYO A;  1YX6 B;  3UGB B;  4F1S A;  2C5L C;  3VH4 B;  2C7N B;  2KFK B;  1WRD B;  3ENE A;  3KUC B;  3PLU A;  1GJZ A;  3ZKJ C;  1EO6 A;  4JQW C;  4DHZ E;  4JGH B;  4WJO A;  3T8M A;  2MCN B;  2KJR A;  2RPQ A;  1WX9 A;  4OVV A;  3UIN B;  3VTW A;  1WX7 A;  2C7H A;  2V3S A;  4CHK A;  2LVQ A;  3U30 A;  3UIP B;  4BOS C;  2IO2 B;  2DYM A;  4TKN A;  3A4R A;  1CMX B;  1GC6 A;  1WMH B;  2KLG A;  4HJK A;  3KUD B;  1WMH A;  4HXD A;  2AL6 A;  2PE6 B;  2OOB B;  3W1S C;  3DBS A;  4NQL B;  1WYW B;  3IBE A;  2KK8 A;  1WGY A;  2KX0 A;  2LUE A;  2MX2 A;  4MM3 A;  1NDD A;  2N1V A;  3AXC A;  1R4N I;  3RUI B;  3RZF A;  2JPH A;  3K9O B;  2A4Z A;  2KNB A;  1ZW7 A;  2M4N A;  4CYE A;  1WH3 A;  2G3Q B;  3R66 C;  3LDZ E;  1P0R A;  1ZGU B;  2IO3 B;  4BKS D;  2JT4 B;  2BWE S;  4KSK C;  5J2R A;  5C23 A;  2LZ6 A;  2MRP A;  3PTF C;  2ZNV B;  3A1Q B;  1TZ1 A;  2N9E B;  3C0R B;  4FBJ B;  3A1Q A;  3ZTD A;  4PS3 A;  2ZPN A;  1XQQ A;  2N7D A;  2JXX A;  2V4L A;  2WX0 A;  3DBL I;  3PRP B;  4B9K A;  4F8C B;  4ZDV A;  2KC2 A;  4NJ7 A;  4ICU A;  5JZE B;  3JW0 X;  4M0W B;  4BKG A;  3OLM D;  4FA6 A;  4P7I A;  3V62 A;  2KOX A;  3VTV A;  1OTR B;  3T9L A;  3VAW A;  4KZ0 A;  1YJ1 A;  2MW5 A;  3D32 A;  4W9C A;  2FNJ B;  2LRU A;  3QHT A;  3QIJ A;  4KIK B;  1WJN A;  2GBM A;  2FCM A;  2KTR A;  2IO0 B;  2KTR B;  1ISN A;  4NNJ B;  3DCG A;  1QZE A;  3PZD A;  2IO1 B;  1ZKH A;  2NBU A;  3ZNH B;  1TTN A;  2ZCB A;  3R7Q A;  2O6V D;  2O2V A;  1I42 A;  2L0T A;  4W9G A;  4KDL B;  1E8Z A;  2G4S A;  4W9K A;  5DPS A;  2MLB A;  5JH5 C;  2DHZ A;  1IYF A;  1WE7 A;  3ZDT A;  2D3G A;  2B3A A;  4PYU A;  3L10 B;  4AUQ C;  2GMI C;  4TQ0 A;  3O65 B;  4FAD A;  4NPN A;  2N9P C;  3QA8 A;  3RCZ A;  4MH0 E;  2WYQ A;  1TBE A;  2UWQ A;  5CHV C;  3VFK A;  1LQB A;  4NQK E;  3AU4 A;  3A4S C;  3VVW B;  5DPR A;  3WAM A;  1WXA A;  2BYF A;  2ZVO A;  1KOT A;  4IM2 A;  3TCA A;  5AZH A;  3QQ8 B;  2FID A;  1AAR A;  1E7V A;  3A9K A;  4GDK A;  5E6O A;  3A9K B;  2M17 A;  2M8S A;  4JL9 A;  3WAP A;  4BOZ B;  3HM3 A;  2KJ6 A;  2DEN B;  2K8C A;  2JRI B;  3EFU A;  2DX5 B;  5KHQ A;  3PSE B;  4HDO A;  3MJW A;  2NPT B;  3H7P B;  3N3K B;  3SD5 A;  2IYD B;  2OJR A;  3RYT A;  5CHF A;  2JWZ A;  3ZW3 A;  1LM8 B;  4NAW B;  1V9J A;  1WJ6 A;  3CSF A;  4WAA A;  1WXS A;  3L54 A;  4IWO A;  3ZRF A;  2K39 A;  3LJ3 A;  3GZN I;  3V6E B;  4RMA A;  1WIA A;  3EHV A;  3QWZ B;  4GSW A;  2NVU I;  1IPG A;  2PEA A;  4BKT A;  1C3T A;  1G6J A;  1E90 A;  2AEH A;  1V86 A;  2BKF A;  2R2Q A;  3VDZ A;  4GXB A;  3WAN A;  1GNU A;  1Q0W B;  2LD9 A;  1SE9 A;  2J0K A;  2MA9 B;  1OEY J;  1E8Y A;  3B08 A;  2NR2 A;  4DHJ D;  3M62 B;  2MP2 A;  3PHX B;  3PLV A;  4M8N A;  1V80 A;  4I6N B;  4MDK E;  2GBR A;  4MSM B;  3PHW B;  2JVC A;  2XEW A;  1YIW A;  5CTR C;  3SDL C;  3U8Z A;  5J17 A;  5D94 A;  4B6W A;  2L3Z A;  2CHZ A;  2A5U A;  5D2M B;  3H9D A;  4F7Z A;  2MBQ A;  4JLC A;  5J18 A;  2HE7 A;  2KFK A;  2KQ7 A;  2WDT B;  1Q1O A; 
#chains in the Genus database with same CATH topology
 2MBO A;  2BW2 A;  4IUM B;  1KRH A;  3Q3M C;  3KH0 A;  3IVF A;  5KHO A;  3EA6 A;  2KDI A;  4P1B C;  4N6E B;  2KKC A;  2AQ2 B;  2KMA A;  3ZIM A;  1FRD A;  4KZC A;  3VUY A;  4IW0 A;  3L17 A;  5LXH A;  1R4M I;  4NJC A;  2CS4 A;  2ONQ A;  2KXJ A;  4ANU A;  2LRW A;  2OED A;  1KF6 B;  4YWG G;  4B0M A;  4GDL A;  4BZA A;  1RFA A;  3LB8 C;  1SSN A;  2L1A A;  4BVU C;  4S17 A;  4GDK B;  1WXM A;  1SEB D;  1L6V A;  2J42 A;  4K3C A;  2I2Y A;  2RGF A;  2K8B A;  3HRD D;  4C56 C;  3C8Y A;  4WJP A;  1L0Y B;  2FCN A;  3ZJU A;  1JCK B;  1KTK A;  3AE3 B;  2GOW A;  4YTM B;  3P2B A;  4JE3 B;  3VQI A;  1FD6 A;  4W9H A;  2ASQ A;  1FIQ A;  1V2Y A;  2J4X A;  2GBN A;  4OVU A;  2HJ8 A;  4W9F A;  4Q2J A;  1RAX A;  3JYU A;  4HKZ E;  3X23 A;  3ZNI D;  1WM3 A;  3MP9 A;  3FIL A;  1IBX A;  3W9C B;  3ZNZ B;  4EE2 A;  2KWU B;  3UQA A;  4EUT A;  1WI0 A;  3NZU A;  3KYD D;  1E5W A;  1SE4 A;  3ZO5 B;  2E6X A;  4FLH A;  3BVZ A;  3ABV B;  4EKU A;  4A90 A;  5FK9 C;  4RH6 A;  1TJE A;  1TKG A;  3N32 A;  4HK2 A;  2K1F A;  4IC7 B;  4GU2 A;  3AE1 B;  4ZRQ A;  1UBI A;  1WZ3 A;  5CX3 A;  1H8C A;  3L0W B;  1HXY D;  2INP E;  4W9E A;  5GXG B;  2GRI A;  2R2O A;  3B9J A;  3KWV A;  2WGS A;  2GBJ A;  2WX1 A;  1E8W A;  4WH4 A;  2Y5P A;  2O2V B;  1CK1 A;  2JZ3 B;  3B1L X;  1KM7 A;  4IKG A;  4FXC A;  3BVG A;  5EE1 A;  4DXF A;  1WY8 A;  1C76 A;  2K25 A;  1SE2 A;  2L32 A;  1Z2M A;  2PMV A;  3CST A;  2MJD A;  5G2N A;  1GAQ B;  2H88 B;  2IY0 B;  1XXG A;  1L0X B;  1YN5 A;  3VTU A;  4DDG D;  3ALB A;  1JWA D;  1RLF A;  4II3 B;  3BK1 A;  3ZXR A;  3QAQ A;  1YOV B;  3NJT A;  2IND C;  3GS2 A;  1F52 A;  3BVM A;  4PS8 A;  4E3C A;  3ZJV A;  1HA5 A;  3AE6 B;  3GOE A;  4TQ1 A;  4USA A;  2RDH A;  3RI7 C;  1P9D U;  2BWF A;  4IWQ A;  1T0Y A;  1GC7 A;  2KDM A;  2JSV X;  3P42 A;  1SF0 A;  4G11 A;  2BTE A;  5AUK A;  4AOF A;  3PVL A;  2XBB C;  1UUP A;  3AE7 B;  2TSS A;  4KX6 B;  1Q5W B;  4WJN A;  1WGH A;  2CHW A;  4MH8 A;  1Y8R C;  1I4X A;  2K5P A;  2L52 A;  4GB9 A;  1ZOY B;  2KLC A;  4PYZ A;  2N0S B;  3TIX A;  2NBW B;  4HRO A;  4HPM B;  1YD8 U;  2NS5 A;  3PV1 A;  1WZ0 A;  4WIP A;  1BT0 A;  2Z0E B;  1WXV A;  3AEA B;  5TSS A;  3MFG A;  1K50 A;  2FCQ A;  2EEL A;  4EOY A;  3TL5 A;  1VZ6 A;  2JZZ A;  5EE9 A;  3U7D A;  2SEB D;  1JWM D;  3RNF C;  3PRE A;  1ZE3 D;  1JAL A;  3EC8 A;  2NMQ A;  3TUO A;  1UBQ A;  5LNK 1;  2LGX A;  1VCB A;  3DVN V;  1ENF A;  3PS6 A;  1YMH E;  3IT4 B;  3EGR A;  3HVD A;  2JZP A;  2WDR B;  1V5T A;  2LJI A;  1J7A A;  1UEL A;  3P63 A;  1WGD A;  4IM3 A;  1WF9 A;  4HPP A;  4DHJ B;  3V6C B;  5LLI A;  3JSV A;  4EZL A;  3NVW A;  5BMI A;  2ZNV C;  1XEE A;  3QJZ A;  1U4A A;  3AN1 A;  1MPE A;  3SFE B;  1YX6 B;  1TY0 A;  2C5L C;  2UU7 A;  3ENE A;  1GJZ A;  3ZKJ C;  2QIE B;  1CQV A;  4JGH B;  1TT5 B;  2MCN B;  2Z8L A;  3VTW A;  2V3S A;  3DBL B;  4TKN A;  3A4R A;  3OG5 A;  1WMH B;  3AM9 A;  3AE8 B;  4ZYS A;  3U2S C;  2AL6 A;  5BMG A;  2OOB B;  1TIF A;  2KK8 A;  2LUE A;  4OVZ A;  2MX2 A;  4ITK A;  2N9K A;  3BK2 A;  4DQO C;  2A4Z A;  4YT0 B;  4CYE A;  1WH3 A;  3R66 C;  3GB1 A;  1P0R A;  2IO3 B;  2XN9 C;  2KWD A;  1TZ1 A;  2N9E B;  3C0R B;  1VR9 A;  2JXX A;  2NTS A;  2WX0 A;  4ICU A;  4M0W B;  5AUI A;  3N20 C;  4WQM A;  2RMM A;  3Q8A A;  1FCC C;  3AE2 B;  1SIJ A;  4W9C A;  2OJW A;  2FNJ B;  4KIK B;  1XLP A;  3PO0 A;  2FCM A;  1RM6 C;  2HTM E;  2KTR A;  3PZD A;  1ZKH A;  1K51 A;  4B0E A;  1XLO A;  2MLB A;  1FXA A;  2DHZ A;  1WE7 A;  4PYU A;  4NPN A;  1MI0 A;  4MH0 E;  1TBE A;  2UWQ A;  2WLB A;  1WXA A;  2BYF A;  3MHZ A;  3O13 A;  3EUB 2;  1C77 A;  1XF5 L;  1AAR A;  5E6O A;  2M17 A;  3RMK C;  3HM3 A;  2DEN B;  3EFU A;  1LGR A;  3AMZ A;  3MJW A;  3H7P B;  3N3K B;  2WS3 B;  2LGI A;  4NAW B;  1XLQ A;  1STE A;  3V05 A;  3L54 A;  4P16 A;  4LLG M;  2KMM A;  2XNA C;  4BKT A;  1JWS D;  1GPX A;  1K53 A;  2J0K A;  4J3O D;  4M8N A;  3M62 B;  3PHX B;  1V97 A;  5CTR C;  3SDL C;  1YIW A;  4B6W A;  2L3Z A;  2A5U A;  3H9D A;  2MBQ A;  2HE7 A;  2D3A A;  4ARI A;  2PE9 A;  2WXF A;  1V1P B;  1TGZ B;  2BVC A;  4J6I A;  3VR8 B;  5FR3 A;  1NI2 A;  2BS4 B;  1EU4 A;  2KMC A;  1JWB D;  2FBW B;  1XD3 B;  4XC2 A;  2YEP F;  2FAZ A;  2L76 A;  1R7S A;  2KO3 A;  2KHW B;  2IY1 B;  3EEC A;  1PFD A;  3NRZ A;  1F0Z A;  3Q8B A;  3IT6 B;  1TKY A;  4M8M A;  3ZQ4 A;  2BF8 B;  3DDC B;  2BS3 B;  2I38 A;  5DCN A;  1YJJ A;  2LVO A;  2MBE A;  3OJ3 A;  2WP9 B;  1VLB A;  4E74 A;  1FM0 D;  2WDQ B;  4I6L B;  3RUL A;  3TEY A;  3VRA B;  4ACF A;  4JX1 C;  3A9J B;  2J0J A;  1NBF C;  3EFC A;  2GBK A;  4MGY E;  5FKA C;  1GG3 A;  1PDX A;  2MJE A;  2OHF A;  3NOB A;  4RGN A;  1WGR A;  4K7W A;  3RNG C;  2PVO D;  2WXK A;  1WJU A;  3NG0 A;  4AP4 C;  4PS7 A;  4MEL A;  4KDI C;  4FUL A;  3WIM A;  5D3D A;  5EE0 A;  1OQY A;  1D5X C;  2YLM A;  1DGJ A;  2YEP B;  1F2R I;  2N9X A;  1B9R A;  3VH3 B;  1V5O A;  2N9L A;  2UYZ B;  1AWD A;  3B0A A;  4RGT A;  1CZP A;  2PIA A;  5IO9 A;  1SGH A;  3KYC D;  1FRR A;  2Q5W D;  4P1C C;  3KW5 B;  2N7E A;  3QAR A;  4ASW C;  3NS1 A;  4DWF A;  1NEK B;  2RDB C;  2L7R A;  2AX5 A;  1P3Q U;  1TZO A;  2K6D B;  4K1R B;  3AH7 A;  1V8C A;  3DHI C;  2ZEQ A;  3R8B A;  4MM3 B;  1FMA D;  1RYJ A;  2XK5 A;  4FN2 A;  1GB4 A;  2VZK B;  1WSP A;  1L2N A;  1XO3 A;  2W82 A;  2MQJ A;  4FJV B;  2M0A A;  4ZRK A;  3HM6 X;  1KH0 A;  2M19 A;  2EMS A;  1ACC A;  2HTH A;  4MGK E;  1DOY A;  3WCQ A;  2KD0 A;  3SFD B;  4AJY B;  2JQR B;  2LWP A;  4YTN B;  2LHE A;  2BB5 A;  2NCN A;  1YN3 A;  3SEB A;  1M94 A;  4ZRI A;  4HLE A;  4MGI E;  2PVG C;  4GGQ A;  4MJS B;  1WFY A;  1YQB A;  1IGC A;  3AI5 A;  3MHS D;  3BIN A;  3U7Z A;  2QHO A;  2PJH A;  1E7P B;  2KDB A;  3L08 A;  2JY6 A;  1FO4 A;  2CKH B;  2LVP A;  3APF A;  2WU5 B;  2KFJ A;  1D5Z C;  1D5M C;  5H8Y E;  4REZ A;  5DPT A;  2WXL A;  4IOI E;  3IHP C;  3V60 A;  3ZNG C;  5DPW A;  5T8I A;  1YQ3 B;  3H1U A;  3P4P B;  1RWS A;  4HKQ A;  5E6N A;  4GN1 A;  3N1Y C;  1ZUD 2;  3NZ3 A;  4C7Y A;  4WUR A;  2INN E;  1I4G A;  3PGE A;  1E8X A;  1WJ4 A;  2IZV B;  4IM0 A;  1SE3 A;  2KAC A;  5IOI A;  3L16 A;  3TSS A;  1KJT A;  1FXT B;  2YVC A;  1C1Y B;  1YNT E;  2K8H A;  2Y5B B;  4WQO B;  4P6V F;  2LHD A;  2REX A;  1S3S G;  2MWS B;  5BMH A;  2X38 A;  3BZD B;  1EM7 A;  4O1N A;  4US9 A;  5G5G A;  5D6J B;  1LXD A;  3PRZ A;  1QLB B;  3RT3 B;  2JF5 A;  3L13 A;  4GDL B;  2WXR A;  5HKH A;  3ZUN A;  3Q14 C;  4AJW A;  3MC0 B;  5JHB A;  1EWY C;  1YX5 B;  3ZRC A;  2HD5 B;  3TBL D;  4LJP B;  3UF8 A;  2V1Y A;  4C00 A;  3TMP B;  1I4H A;  4URK A;  2QEJ C;  3H7P A;  4XGA B;  1C9F A;  2KX3 A;  1HE8 A;  2J7Q B;  2MBB B;  5AZG A;  4WWO A;  4CQN A;  3DHH C;  2V9H A;  2JWU A;  4JPS A;  2KQ4 X;  4FHJ A;  2BS2 B;  5L83 A;  3ZVV A;  2DZJ A;  2FUG 1;  2K9X A;  4F1S A;  3VH4 B;  2D3C A;  3PLU A;  1EO6 A;  3FIL B;  4JQW C;  4OVV A;  3UIN B;  1FNW A;  1WX7 A;  2C7H A;  3H8H A;  2LVQ A;  3P4Q B;  1GC6 A;  2KLG A;  4HJK A;  3KUD B;  1WMH A;  4NQL B;  3BYT B;  2KX0 A;  1IUE A;  3RUI B;  4XWT A;  2JPH A;  3K9O B;  1SB3 C;  2KNB A;  1WXQ A;  5IKC M;  2M4N A;  3BYY B;  1YJI A;  2JT4 B;  5EE3 A;  2ZNV B;  3A1Q B;  4FBJ B;  4YSZ B;  2CJN A;  3A1Q A;  3ZTD A;  4PS3 A;  2ZPN A;  3DBL I;  2V4L A;  4ZDV A;  4F8C B;  2KC2 A;  3E9S A;  4M0W A;  1ROE A;  4BKG A;  4P7I A;  3V62 A;  1KLU D;  3T9L A;  3CWI A;  1V1P A;  3R2I A;  1YJ1 A;  3AE9 B;  2KTR B;  1QZE A;  4HEA 1;  1OQR A;  3ZNH B;  3AE4 B;  3R7Q A;  3DBH B;  2L0T A;  3HVZ A;  4W9K A;  2M56 B;  1IYF A;  2W55 A;  4FAD A;  2D3G A;  2WXO A;  2GMI C;  2WXJ A;  2N9P C;  3QA8 A;  3RCZ A;  4AQ7 A;  4C4V A;  2SAK A;  4C4V B;  4NQK E;  3A4S C;  5DPR A;  1KOT A;  3I57 A;  1MHH E;  1BXT A;  1EU3 A;  2BBC A;  2V3N A;  4GDK A;  4JL9 A;  4D2K A;  2K8C A;  2JRI B;  2DX5 B;  2KT7 A;  2Y3A A;  3PSE B;  4TMA B;  2NPT B;  3SR6 A;  2IYD B;  3RYT A;  4LTU A;  1V9J A;  1WGK A;  2MJ3 A;  2GB1 A;  4WAA A;  3ZRF A;  4IWO A;  4RF1 A;  2K39 A;  1Q10 A;  4L2Y A;  2W54 A;  3FC4 A;  3V6E B;  4LNK A;  3QWZ B;  1C3T A;  2PEA A;  1V86 A;  3I63 C;  5HFY A;  2K22 A;  1GNU A;  1L0V B;  3AEC B;  2HJ1 A;  2LD9 A;  2WXG A;  1SE9 A;  1OEY J;  3B08 A;  3U52 E;  4AS1 A;  2HDE A;  4I6N B;  1BUI C;  5J17 A;  1N5X A;  2XEW A;  1UGJ A;  5D94 A;  2CHZ A;  2RPV A;  4JLC A;  3M95 A;  2KQ7 A;  1VZ7 A;  1Q1O A;  4H2A A;  3KUZ A;  3CMM B;  2DZI A;  4EZJ A;  1TS3 A;  3DWG C;  4G50 A;  3GE3 C;  5C1Z A;  1PGA A;  2JRH A;  4BFR A;  2K6Q A;  4OZB A;  2DNF A;  1M4V A;  4AWJ A;  2IPK D;  4JWU C;  3X0W A;  1E7U A;  2W3S A;  5HHD G;  4MJS A;  2BPS A;  4A8X C;  4BKS A;  2PPH A;  4YL8 A;  4HCN B;  4DXA B;  4FHK A;  5LXI B;  2KC1 A;  2CU3 A;  4YXD B;  4UDU C;  3JVZ X;  4DBG A;  3UIO B;  1AN8 A;  1P7E A;  3ONS A;  3DVN U;  2LAS A;  3LXF A;  2EKI A;  4K81 A;  1DOI A;  1ET6 A;  2QSD A;  2O6V A;  1JWU D;  4LNO A;  4XX5 A;  4EEW A;  5IA7 A;  3HHM A;  3VUX A;  3Q8C A;  4A55 A;  1N5W A;  4A3P A;  3V3X A;  2C60 A;  3Q3J A;  1MG4 A;  4W9I A;  3RNA C;  3UQB A;  2LGY A;  1NEN B;  3ZTC A;  1C79 A;  1P1A A;  3HUI A;  4KV2 A;  4YTP B;  3PRM B;  3OAW A;  2M0X A;  5C3J B;  2CJO A;  4HCP B;  2L8J A;  2V3P A;  3WA0 A;  1WR1 A;  3MC8 A;  4HRS A;  3N9Y C;  3APC A;  1X1M A;  4GOC A;  3DVG X;  2LFI A;  1VZ8 A;  2D2Q A;  2WXI A;  2WXM A;  1WE6 A;  1HZ5 A;  1SXT A;  2XK5 B;  1AW7 A;  3I9V 1;  4DXG A;  2IGD A;  4E71 A;  3Q3N C;  1J0G A;  1WR6 E;  2MP2 B;  1OGW A;  1MG8 A;  2WDV B;  3Q69 A;  2JX5 A;  4ZYN A;  2LI5 A;  2C9W B;  4QAY A;  3ZDM C;  1UH6 A;  3GP7 A;  4I6P A;  4MAC A;  4WWN A;  4RFB A;  4LNI A;  2KWC A;  1MFW A;  1E0Z A;  3VXW A;  5IN7 A;  1K8R B;  3DPD A;  3LYY A;  2I1K A;  3DBR B;  4ANW A;  4OW0 A;  3AV8 A;  2X8X X;  4OZA A;  1J7B A;  4PT5 A;  2BKR B;  2QJL A;  2ZPY A;  1ET9 A;  2D10 A;  2VRR B;  4JWS C;  1JRO A;  4LJO B;  4RNA A;  3W2D A;  2LJ5 A;  3Q8F A;  1QOA A;  1ZP0 B;  4WAF A;  3CF6 E;  1T6B X;  2M1M A;  3ML8 A;  4HPL B;  3QX1 A;  2GI9 A;  1D4B A;  3AEE B;  4RF0 A;  1K52 A;  1XCQ L;  1EWC A;  2KN4 A;  2LUM A;  1DOX A;  3ZXV A;  2DAF A;  1NVI D;  1HTQ A;  1UNS A;  2MSE D;  2DBY A;  4MEM A;  3R3M A;  2WHI A;  1ZPS A;  4RCO A;  2KQS A;  1EF1 A;  1H4R A;  3A33 B;  3MC9 A;  4ZRJ A;  3IG3 A;  1J19 A;  3Q6B A;  4DHZ B;  3FKY A;  3VRB B;  4G0N B;  1R4N B;  4ZHP A;  1OEY A;  1D3Z A;  4IWP A;  2DZK A;  3IAM 1;  1HQR D;  4DK5 A;  2KDE B;  1P98 A;  2INC C;  3N1Z C;  1L7Y A;  4A3O A;  1RRB A;  1L4Z B;  1NYR A;  2J0M A;  1UZX B;  4G3X B;  1WGG A;  3E56 A;  3DHG C;  3P1M A;  2BB6 A;  3N30 A;  3I3T B;  1HTO A;  1ESF A;  4L1B A;  2DZM A;  4WWM A;  4FJZ A;  4WJQ A;  1UD7 A;  4A20 A;  1AYF A;  4II2 B;  1KLG D;  3NVY A;  3NZS A;  5EDS A;  2V0G A;  2Y5C A;  1J7C A;  1OFF A;  1D6E C;  3TEW A;  4N9F 4;  2Z0D B;  2L05 A;  2D5G A;  2BYV E;  4TV3 A;  2J53 A;  1UGM A;  3TEX A;  2GLS A;  2BGF A;  5AZF A;  1QKZ A;  2NPT A;  4K7U A;  2L0F A;  4KVG B;  3HIZ A;  2O6V B;  3MJ5 A;  3UI3 A;  3WAL A;  3QK0 A;  4XYC A;  4DHZ E;  2W9N A;  1EUV B;  1VD2 A;  4RGM A;  3AEG B;  2RR9 A;  3PT2 B;  3DQV A;  4KIK A;  2D07 B;  4LK0 M;  4BBN F;  3ZLZ A;  1SJE D;  5I4D A;  2LXA A;  2H89 B;  3NVZ A;  4JIO U;  2DYO A;  3UGB B;  2PLP A;  1UWM A;  1WRD B;  1E6E B;  1SJH D;  1VDV A;  2AQ1 B;  4NAM A;  4WJO A;  3T8M A;  4GLS C;  1WX9 A;  4CHK A;  3TEZ A;  3U30 A;  1FEH A;  3OWE B;  2IDY A;  1QOG A;  4HXD A;  5G5H A;  5D3I B;  1WYW B;  1WGY A;  3PZ7 A;  4MM3 A;  2N1V A;  3AXC A;  2VH2 A;  2PTL A;  1L4D B;  1CJE A;  1ZW7 A;  3NUH B;  3RNB C;  3LDZ E;  1ZGU B;  2BWE S;  5J2R A;  5C23 A;  2MRP A;  3NVV A;  3N1X C;  1JML A;  1R4M B;  1XQQ A;  2N7D A;  3PRP B;  4B9K A;  5JZE B;  4R3D A;  3KQ4 A;  3OLM D;  4YSX B;  2G1E A;  3VAW A;  2J52 A;  5E6J A;  2LRU A;  1WJN A;  2GBM A;  4S0R A;  2IO0 B;  4NNJ B;  1VJK A;  4KGT A;  1A70 A;  1TTN A;  3PZ8 A;  1UWX A;  3URY A;  2O2V A;  1QOB A;  1E8Z A;  1N61 A;  4L23 A;  2JYE A;  3ZDT A;  4AUQ C;  2B3A A;  4TQ0 A;  3L10 B;  4ZHO A;  1FXI A;  3VFK A;  3WAM A;  2ZVO A;  1V1O A;  4IM2 A;  1E7V A;  1T0Q C;  2ZW1 A;  3A9K A;  3A9K B;  2M8S A;  3WAP A;  2VZK D;  1TKE A;  4HJG E;  1GOZ A;  1GB1 A;  3KWL A;  3SD5 A;  2OJR A;  3ZW3 A;  2JWZ A;  3P4R B;  1LM8 B;  1WWT A;  1L5P A;  3CSF A;  3LJ3 A;  2D3B A;  3EHV A;  4GSW A;  2NVU I;  1QIL A;  4XDD A;  2AEH A;  1G6J A;  1FFU A;  4GXB A;  3WAN A;  1PUT A;  3Q8E A;  1Q0W B;  1QQR A;  3I5J C;  2QC8 A;  3RN9 C;  1QOF A;  2QCZ A;  4MDK E;  4IDI A;  4MSM B;  2L83 A;  3U8Z A;  4F7Z A;  5D2M B;  4LNF A;  2KFK A;  3C19 A;  2WDT B;  4WWP A;  2WQY B;  1IP9 A;  4FJY A;  1C4A A;  4RGO S;  4HDQ A;  3J9C A;  3RPF C;  1PGX A;  2AYO B;  2WXQ A;  1QF6 A;  1EF5 A;  2ZCC A;  1WM2 A;  3ZYY X;  2CHX A;  2DLB A;  1HZ6 A;  4IG7 B;  2AL3 A;  2KWV B;  3S2A A;  4LCD E;  3T3N A;  3AUL A;  1TY2 A;  1V81 A;  4A9A A;  3V61 A;  1S1Q B;  1A5R A;  4PK1 A;  1WYG A;  1I35 A;  1F9J A;  3GE8 C;  3OJ4 B;  2IBI B;  3DVG Y;  4NY0 A;  3SHQ A;  3RNC C;  2FCS A;  2LMC A;  3B2G A;  4NAW A;  4KSL C;  1B1Z A;  4TUU A;  4OZC A;  5G55 A;  1F2R C;  2KJH B;  2WXN A;  4EZK A;  5L95 C;  2C7M B;  4MGZ E;  2LXC A;  3ETR A;  2N1W A;  2ICI A;  4ICV A;  5D7G A;  1N60 A;  4XDC A;  3B2F A;  3PPA A;  1V6E A;  4HVB A;  4LDT D;  2KDF B;  2ZJD A;  3W1S A;  3JSV B;  4CO7 A;  3M3J A;  4W9L A;  2E3T A;  2KN5 A;  3APD A;  2WU2 B;  5GMV A;  3IAS 1;  3ML9 A;  2LGD A;  3BY4 B;  3H7S A;  1GUA B;  1PYW D;  4M01 A;  1XLN A;  4MT5 A;  2FE8 A;  3ZJT A;  3DOW A;  3HK0 A;  2G4D B;  1Y56 A;  2EKE C;  3DWM A;  2KVR A;  2PW9 A;  4ANV A;  4M02 A;  3R2T A;  1N62 A;  5AEK B;  3CIR B;  4XZ4 A;  5HI1 A;  2L00 B;  3AEF B;  1J8C A;  1I4R A;  4XWW A;  5JXV A;  1WX8 A;  1I7H A;  4GIV A;  2EMT A;  2I1J A;  2FUH B;  2Z59 B;  2B76 B;  3M63 B;  1XCT L;  1C78 A;  4YSY B;  2N4F A;  3A9J A;  4MSQ B;  3T3O A;  5FR6 A;  4A6Q A;  2JUO A;  4RM8 A;  1F77 A;  2BYE A;  4C80 A;  3W5U B;  2MH7 A;  5IP4 D;  2RSU A;  3AU5 A;  1T0R C;  2K0P A;  1RFK A;  1HEZ E;  3NS8 A;  2CR5 A;  2FIF A;  3QCA A;  4C7Z A;  3AB5 A;  3L4P A;  3DBH I;  4NJ6 A;  3IFW B;  3RD2 A;  3WAO A;  3SU8 X;  1SIF A;  3IXS A;  3H6N A;  1FNU A;  2MEK A;  2DYB A;  3RZW C;  3K9P B;  2G9H D;  1FFV A;  2KAN A;  2QIL A;  2KTF A;  4K3B A;  2K3U A;  4DDI D;  2DAJ A;  1E10 A;  4B95 A;  3ECI A;  2VH1 A;  3TJP A;  2AWT A;  1T3Q A;  1FNV A;  2ON8 A;  1MVK A;  5BYS A;  5IAA C;  4KKJ A;  2D11 A;  3AE5 B;  2DWQ A;  3VR9 B;  1TYG B;  2WXH A;  4W9J A;  3Q2A C;  4BBN C;  1VRA B;  1I4Q A;  1JRU A;  1TS5 A;  3AEB B;  3DBR I;  4ARC A;  1TS4 A;  2IGH A;  2MBH A;  4TSS A;  2JXT A;  1MJD A;  2IGG A;  1LFD A;  4BAX A;  2N7J A;  3RFZ B;  4N58 A;  1MHX A;  1ZDV A;  3ZGZ A;  2CU1 A;  3U4E G;  5JHA A;  3BII D;  3R7R A;  3KVF B;  4KGS A;  4ZOH C;  2BT6 A;  1ZDX A;  1ZXI A;  4XE0 A;  4GMV A;  4EFO A;  1JQ4 A;  1F1H A;  2MHJ A;  1FCL A;  2LEK A;  3QC8 B;  3GZN B;  4X57 B;  5E6P A;  1SBB B;  1TS2 A;  5CHW A;  1KLV A;  2JYT A;  3AED B;  2AQ3 B;  4M00 A;  2NBV B;  2ZW0 A;  2ZZP B;  3Q3F A;  2KZR A;  1JW9 D;  5BYR A;  3MTN B;  5BO4 B;  4LNN A;  4ANX A;  2WNM A;  4K7S A;  3VHT C;  5BYQ A;  2RD0 A;  4LDT B;  2ZVN A;  4HWI B;  2WWZ A;  1FPY A;  1Z5S B;  3VUW A;  4NZL B;  2G45 B;  5TR5 A;  3W1Y A;  1N63 A;  3NHE B;  1KFY B;  2LGS A;  4W9D A;  4KKI A;  2QMT A;  1PQS A;  1XT9 B;  3NY5 A;  2QDF A;  4RM9 A;  1V49 A;  2C7N B;  5HG2 A;  2KFK B;  3KUC B;  1N6Z A;  2KJR A;  2RPQ A;  1IBX B;  2KAJ A;  2KVZ A;  3P4S B;  5MPO A;  3UIP B;  4BOS C;  2IO2 B;  2DYM A;  3Q3O C;  2PKO A;  1CMX B;  4OHJ A;  1OQQ A;  2NTT A;  2PE6 B;  4US8 A;  3W1S C;  3DBS A;  3IBE A;  1NDD A;  3KLS X;  1R4N I;  3RZF A;  2G3Q B;  2ACZ B;  4BKS D;  1UF0 A;  3FAH A;  4KSK C;  1C4P A;  1QT9 A;  2KYW A;  2LZ6 A;  3PTF C;  1L6U A;  2BQQ A;  4NJ7 A;  2V4I B;  3JW0 X;  4FA6 A;  2KOX A;  1ZXH A;  3VTV A;  1BML C;  1OTR B;  1WRI A;  4KZ0 A;  2MW5 A;  2IJ0 A;  3D32 A;  3QHT A;  3QIJ A;  4KGR A;  1NYQ A;  1P7F A;  1ISN A;  3DCG A;  1DYQ A;  2IO1 B;  2NBU A;  2W3R A;  2WXP A;  2ZCB A;  2O6V D;  4W9G A;  4KDL B;  2G4S A;  1YN4 A;  5DPS A;  5JH5 C;  1PGB A;  3O65 B;  1E9M A;  4N59 A;  2WYQ A;  5CHV C;  1LQB A;  3AU4 A;  3VVW B;  3TCA A;  5AZH A;  3W5V B;  3QQ8 B;  2FID A;  4BOZ B;  2KJ6 A;  5KHQ A;  1LO5 D;  1JRP A;  4HDO A;  1YQ4 B;  3RNE C;  1T5X D;  4ZRP A;  5CHF A;  1WJ6 A;  1I4P A;  1WXS A;  3GZN I;  4RMA A;  1WIA A;  3BWU D;  2BYT A;  1IPG A;  1T0S C;  2JU6 X;  1I42 A;  1E90 A;  2BKF A;  2R2Q A;  3VDZ A;  2R61 A;  1IGD A;  1NI3 A;  2MA9 B;  1E8Y A;  2RDG A;  2NR2 A;  4DHJ D;  2MP2 A;  3PLV A;  1C4C A;  1V80 A;  2GBR A;  3PHW B;  2JVC A;  5H92 C;  5J18 A;  5C2T B; 
#chains in the Genus database with same CATH homology
 2PE9 A;  2MBO A;  4WWP A;  3KUZ A;  1TGZ B;  4IUM B;  3CMM B;  2DZI A;  4EZJ A;  4J6I A;  3KH0 A;  1IP9 A;  4G50 A;  3IVF A;  5C1Z A;  2JRH A;  4BFR A;  2K6Q A;  5KHO A;  1NI2 A;  4FJY A;  4AWJ A;  2KDI A;  2KMC A;  4HDQ A;  2KKC A;  2AYO B;  3X0W A;  1E7U A;  2KMA A;  3ZIM A;  1XD3 B;  4KZC A;  4XC2 A;  2FAZ A;  4MJS A;  2L76 A;  1EF5 A;  2ZCC A;  2BPS A;  3VUY A;  4IW0 A;  3L17 A;  1WM2 A;  2KO3 A;  5LXH A;  4BKS A;  2CHX A;  1R4M I;  2PPH A;  2KHW B;  4YL8 A;  2IY1 B;  3EEC A;  4HCN B;  2CS4 A;  4IG7 B;  2AL3 A;  2KXJ A;  2KWV B;  4ANU A;  3S2A A;  4DXA B;  4LCD E;  4FHK A;  5LXI B;  3AUL A;  2KC1 A;  2LRW A;  4M8M A;  2BF8 B;  3DDC B;  1V81 A;  3V61 A;  4GDL A;  1S1Q B;  1RFA A;  5DCN A;  2LVO A;  2MBE A;  1A5R A;  3OJ3 A;  4E74 A;  1I35 A;  4BVU C;  4I6L B;  3RUL A;  1F9J A;  3JVZ X;  4DBG A;  3OJ4 B;  2IBI B;  3DVG Y;  4NY0 A;  3UIO B;  3ONS A;  4GDK B;  3DVN U;  1WXM A;  2LAS A;  3A9J B;  3SHQ A;  2J0J A;  1NBF C;  2FCS A;  4K81 A;  2GBK A;  4MGY E;  1GG3 A;  3NOB A;  1WGR A;  4K7W A;  4NAW A;  4KSL C;  4TUU A;  5G55 A;  2RGF A;  2K8B A;  2O6V A;  1WJU A;  4AP4 C;  2KJH B;  4PS7 A;  4XX5 A;  4WJP A;  4EEW A;  4MEL A;  4EZK A;  5L95 C;  4KDI C;  5IA7 A;  2C7M B;  3HHM A;  4MGZ E;  3VUX A;  2LXC A;  2FCN A;  4FUL A;  3WIM A;  1OQY A;  2N1W A;  4ICV A;  2GOW A;  2YLM A;  5D7G A;  3P2B A;  3VQI A;  4W9H A;  2ASQ A;  3PPA A;  4A3P A;  1V6E A;  4HVB A;  1V2Y A;  4LDT D;  2KDF B;  2ZJD A;  2GBN A;  3W1S A;  2C60 A;  4OVU A;  2HJ8 A;  2N9X A;  3Q3J A;  3JSV B;  3VH3 B;  1V5O A;  4W9I A;  4W9F A;  2UYZ B;  3B0A A;  1RAX A;  3UQB A;  2LGY A;  4CO7 A;  1SGH A;  3JYU A;  3M3J A;  3ZTC A;  3KYC D;  4W9L A;  2KN5 A;  3APD A;  5GMV A;  3X23 A;  3ML9 A;  2LGD A;  1WM3 A;  3ZNI D;  1P1A A;  3BY4 B;  3H7S A;  3KW5 B;  1GUA B;  2N7E A;  3QAR A;  4ASW C;  4KV2 A;  3PRM B;  3ZNZ B;  4DWF A;  2KWU B;  3OAW A;  2M0X A;  2L7R A;  3DOW A;  3UQA A;  4EUT A;  3HK0 A;  2G4D B;  4HCP B;  2L8J A;  2EKE C;  1P3Q U;  3WA0 A;  1WI0 A;  3NZU A;  1WR1 A;  2K6D B;  2KVR A;  4ANV A;  3APC A;  1E5W A;  3KYD D;  4K1R B;  3ZO5 B;  1X1M A;  4GOC A;  5AEK B;  3DVG X;  2ZEQ A;  4XZ4 A;  4FLH A;  2D2Q A;  2L00 B;  4EKU A;  2XK5 A;  1J8C A;  1WE6 A;  2XK5 B;  4FN2 A;  1WX8 A;  4GIV A;  1L2N A;  2EMT A;  2I1J A;  2FUH B;  2MQJ A;  2Z59 B;  3N32 A;  4E71 A;  3M63 B;  2K1F A;  4FJV B;  4HK2 A;  4ZRK A;  3HM6 X;  4IC7 B;  4GU2 A;  1J0G A;  1WR6 E;  2MP2 B;  1OGW A;  2EMS A;  1MG8 A;  2N4F A;  3A9J A;  1UBI A;  1WZ3 A;  4MSQ B;  5CX3 A;  2HTH A;  4MGK E;  5FR6 A;  4ZYN A;  2JUO A;  2LI5 A;  2C9W B;  1H8C A;  3L0W B;  2KD0 A;  4RM8 A;  4W9E A;  3ZDM C;  1UH6 A;  4AJY B;  4I6P A;  4WWN A;  2BYE A;  2LWP A;  2R2O A;  2KWC A;  2RSU A;  2NCN A;  3AU5 A;  3VXW A;  2GBJ A;  2WX1 A;  1K8R B;  1M94 A;  1E8W A;  3DPD A;  4ZRI A;  4HLE A;  4MGI E;  4GGQ A;  4MJS B;  1WFY A;  4ANW A;  2I1K A;  2O2V B;  1YQB A;  2JZ3 B;  3B1L X;  1KM7 A;  3AI5 A;  3NS8 A;  3MHS D;  2CR5 A;  2FIF A;  3QCA A;  3BIN A;  2BKR B;  2ZPY A;  1WY8 A;  2K25 A;  2QHO A;  1Z2M A;  2PJH A;  2D10 A;  2VRR B;  2KDB A;  3DBH I;  4LJO B;  4NJ6 A;  3L08 A;  3CST A;  2LJ5 A;  2JY6 A;  5G2N A;  3IFW B;  3RD2 A;  3CF6 E;  2M1M A;  3SU8 X;  3WAO A;  1SIF A;  2CKH B;  2IY0 B;  3ML8 A;  3H6N A;  4HPL B;  2LVP A;  3APF A;  2DYB A;  3QX1 A;  3RZW C;  2KFJ A;  3K9P B;  2KAN A;  3VTU A;  2KTF A;  5DPT A;  4DDG D;  3ALB A;  2DAJ A;  3IHP C;  3V60 A;  4DDI D;  3ZNG C;  1RLF A;  4B95 A;  2DAF A;  3ECI A;  5DPW A;  4II3 B;  3TJP A;  3H1U A;  3QAQ A;  2MSE D;  2AWT A;  4MEM A;  3R3M A;  5E6N A;  4GN1 A;  4PS8 A;  4E3C A;  5IAA C;  2D11 A;  2KQS A;  1EF1 A;  1H4R A;  3A33 B;  3GOE A;  4TQ1 A;  4ZRJ A;  3IG3 A;  1J19 A;  4DHZ B;  4W9J A;  3PGE A;  4BBN C;  4G0N B;  1OEY A;  1E8X A;  1P9D U;  1WJ4 A;  2BWF A;  4IWQ A;  2IZV B;  4IM0 A;  1JRU A;  1T0Y A;  1D3Z A;  1GC7 A;  4IWP A;  2DZK A;  3DBR I;  4DK5 A;  2KDE B;  1P98 A;  2MBH A;  3L16 A;  4G11 A;  1KJT A;  1L7Y A;  1FXT B;  1LFD A;  4A3O A;  3PVL A;  4AOF A;  2XBB C;  2YVC A;  1C1Y B;  1RRB A;  2K8H A;  2J0M A;  2Y5B B;  1UZX B;  4G3X B;  4WQO B;  1Q5W B;  4WJN A;  1WGG A;  2REX A;  1S3S G;  1WGH A;  2CHW A;  2MWS B;  2CU1 A;  3N30 A;  1Y8R C;  3I3T B;  2DZM A;  4FJZ A;  4WJQ A;  4GB9 A;  3R7R A;  5JHA A;  1UD7 A;  3KVF B;  4A20 A;  2KLC A;  4PYZ A;  4II2 B;  3TIX A;  2NBW B;  3NZS A;  4HPM B;  1YD8 U;  5D6J B;  1LXD A;  2NS5 A;  3PV1 A;  4GMV A;  1WZ0 A;  4EFO A;  5EDS A;  1BT0 A;  3PRZ A;  2Z0E B;  3QC8 B;  1WXV A;  3RT3 B;  2JF5 A;  3L13 A;  4GDL B;  4X57 B;  5E6P A;  4N9F 4;  2Z0D B;  2L05 A;  5HKH A;  2BYV E;  4TV3 A;  2FCQ A;  5CHW A;  3ZUN A;  4AJW A;  4EOY A;  3TL5 A;  1UGM A;  5JHB A;  1KLV A;  1YX5 B;  3ZRC A;  2JZZ A;  2HD5 B;  2BGF A;  3TBL D;  2NBV B;  4LJP B;  2V1Y A;  3UF8 A;  3TMP B;  2ZZP B;  3Q3F A;  3U7D A;  2KZR A;  4URK A;  5AZF A;  2NPT A;  3H7P A;  3MTN B;  5BO4 B;  4K7U A;  2L0F A;  3PRE A;  4KVG B;  4ANX A;  3EC8 A;  3HIZ A;  1UBQ A;  2O6V B;  4K7S A;  3VHT C;  2KX3 A;  1HE8 A;  2J7Q B;  2LGX A;  2RD0 A;  3QK0 A;  2W9N A;  4LDT B;  3WAL A;  1VCB A;  1EUV B;  2MBB B;  1VD2 A;  2ZVN A;  2WWZ A;  1Z5S B;  4HWI B;  4WWO A;  5AZG A;  3VUW A;  3PT2 B;  2RR9 A;  3DVN V;  2G45 B;  3DQV A;  3PS6 A;  4KIK A;  5TR5 A;  3W1Y A;  2D07 B;  3NHE B;  4W9D A;  4BBN F;  1V5T A;  3ZLZ A;  1UEL A;  1WGD A;  4FHJ A;  4IM3 A;  1WF9 A;  4DHJ B;  1PQS A;  1XT9 B;  3V6C B;  2LXA A;  3NY5 A;  5LLI A;  3ZVV A;  5L83 A;  3JSV A;  4EZL A;  2ZNV C;  3M95 A;  3QJZ A;  4JIO U;  1U4A A;  2DZJ A;  4RM9 A;  1V49 A;  2DYO A;  1YX6 B;  3UGB B;  4F1S A;  2C5L C;  3VH4 B;  2C7N B;  2KFK B;  1WRD B;  3ENE A;  3KUC B;  3PLU A;  1GJZ A;  3ZKJ C;  1EO6 A;  4JQW C;  4DHZ E;  4JGH B;  4WJO A;  3T8M A;  2MCN B;  2KJR A;  2RPQ A;  1WX9 A;  4OVV A;  3UIN B;  3VTW A;  1WX7 A;  2C7H A;  2V3S A;  4CHK A;  2LVQ A;  3U30 A;  3UIP B;  4BOS C;  2IO2 B;  2DYM A;  4TKN A;  3A4R A;  1CMX B;  1GC6 A;  1WMH B;  2KLG A;  4HJK A;  3KUD B;  1WMH A;  4HXD A;  2AL6 A;  2PE6 B;  2OOB B;  3W1S C;  3DBS A;  4NQL B;  1WYW B;  3IBE A;  2KK8 A;  1WGY A;  2KX0 A;  2LUE A;  2MX2 A;  4MM3 A;  1NDD A;  2N1V A;  3AXC A;  1R4N I;  3RUI B;  3RZF A;  2JPH A;  3K9O B;  2A4Z A;  2KNB A;  1ZW7 A;  2M4N A;  4CYE A;  1WH3 A;  2G3Q B;  3R66 C;  3LDZ E;  1P0R A;  1ZGU B;  2IO3 B;  4BKS D;  2JT4 B;  2BWE S;  4KSK C;  5J2R A;  5C23 A;  2LZ6 A;  2MRP A;  3PTF C;  2ZNV B;  3A1Q B;  1TZ1 A;  2N9E B;  3C0R B;  4FBJ B;  3A1Q A;  3ZTD A;  4PS3 A;  2ZPN A;  1XQQ A;  2N7D A;  2JXX A;  2V4L A;  2WX0 A;  3DBL I;  3PRP B;  4B9K A;  4F8C B;  4ZDV A;  2KC2 A;  4NJ7 A;  4ICU A;  5JZE B;  3JW0 X;  4M0W B;  4BKG A;  3OLM D;  4FA6 A;  4P7I A;  3V62 A;  2KOX A;  3VTV A;  1OTR B;  3T9L A;  3VAW A;  4KZ0 A;  1YJ1 A;  2MW5 A;  3D32 A;  4W9C A;  2FNJ B;  2LRU A;  3QHT A;  3QIJ A;  4KIK B;  1WJN A;  2GBM A;  2FCM A;  2KTR A;  2IO0 B;  2KTR B;  1ISN A;  4NNJ B;  3DCG A;  1QZE A;  3PZD A;  2IO1 B;  1ZKH A;  2NBU A;  3ZNH B;  1TTN A;  2ZCB A;  3R7Q A;  2O6V D;  2O2V A;  1I42 A;  2L0T A;  4W9G A;  4KDL B;  1E8Z A;  2G4S A;  4W9K A;  5DPS A;  2MLB A;  5JH5 C;  2DHZ A;  1IYF A;  1WE7 A;  3ZDT A;  2D3G A;  2B3A A;  4PYU A;  3L10 B;  4AUQ C;  2GMI C;  4TQ0 A;  3O65 B;  4FAD A;  4NPN A;  2N9P C;  3QA8 A;  3RCZ A;  4MH0 E;  2WYQ A;  1TBE A;  2UWQ A;  5CHV C;  3VFK A;  1LQB A;  4NQK E;  3AU4 A;  3A4S C;  3VVW B;  5DPR A;  3WAM A;  1WXA A;  2BYF A;  2ZVO A;  1KOT A;  4IM2 A;  3TCA A;  5AZH A;  3QQ8 B;  2FID A;  1AAR A;  1E7V A;  3A9K A;  4GDK A;  5E6O A;  3A9K B;  2M17 A;  2M8S A;  4JL9 A;  3WAP A;  4BOZ B;  3HM3 A;  2KJ6 A;  2DEN B;  2K8C A;  2JRI B;  3EFU A;  2DX5 B;  5KHQ A;  3PSE B;  4HDO A;  3MJW A;  2NPT B;  3H7P B;  3N3K B;  3SD5 A;  2IYD B;  2OJR A;  3RYT A;  5CHF A;  2JWZ A;  3ZW3 A;  1LM8 B;  4NAW B;  1V9J A;  1WJ6 A;  3CSF A;  4WAA A;  1WXS A;  3L54 A;  4IWO A;  3ZRF A;  2K39 A;  3LJ3 A;  3GZN I;  3V6E B;  4RMA A;  1WIA A;  3EHV A;  3QWZ B;  4GSW A;  2NVU I;  1IPG A;  2PEA A;  4BKT A;  1C3T A;  1G6J A;  1E90 A;  2AEH A;  1V86 A;  2BKF A;  2R2Q A;  3VDZ A;  4GXB A;  3WAN A;  1GNU A;  1Q0W B;  2LD9 A;  1SE9 A;  2J0K A;  2MA9 B;  1OEY J;  1E8Y A;  3B08 A;  2NR2 A;  4DHJ D;  3M62 B;  2MP2 A;  3PHX B;  3PLV A;  4M8N A;  1V80 A;  4I6N B;  4MDK E;  2GBR A;  4MSM B;  3PHW B;  2JVC A;  2XEW A;  1YIW A;  5CTR C;  3SDL C;  3U8Z A;  5J17 A;  5D94 A;  4B6W A;  2L3Z A;  2CHZ A;  2A5U A;  5D2M B;  3H9D A;  4F7Z A;  2MBQ A;  4JLC A;  5J18 A;  2HE7 A;  2KFK A;  2KQ7 A;  2WDT B;  1Q1O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...