2BKRB

Nedd8 nedp1 complex
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
77
structure length
77
Chain Sequence
SMLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVLHLVLALRGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein-binding/hydrolase
molecule keywords SENTRIN-SPECIFIC PROTEASE 8
publication title Structural Basis of Nedd8 Ubiquitin Discrimination by the Deneddylating Enzyme Nedp1
pubmed doi rcsb
source organism Homo sapiens
total genus 22
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2005-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2bkrB00
2IO3B 3ZDTA 2GBJA 2DYMA 3EECA 4AJWA 3P2BA 2N1WA 2ZPNA 3K9PB 1TBEA 1WXSA 3PLVA 1SGHA 3TIXA 2RR9A 4EKUA 3JYUA 3ZTDA 3ZIMA 2KANA 3DVNV 3DOWA 1V5TA 3EC8A 2G3QB 4I6NB 4WWPA 2CHZA 2JPHA 4W9HA 4BKSD 2RPQA 4MSQB 4EZJA 1BT0A 1P0RA 5JHAA 4W9EA 1V5OA 1Y8RC 1IP9A 2KJ6A 4IG7B 2K25A 4KSKC 4ZRIA 4DK5A 2WWZA 1WMHB 4EOYA 2LJ5A 2LXCA 4GGQA 3QX1A 4GU2A 3VDZA 2WYQA 4DDGD 4EUTA 3K9OB 4JLCA 2DZMA 1E8YA 3PZDA 2KMCA 4PS8A 4JGHB 3TCAA 3RD2A 2C9WB 2LWPA 3DBHI 5JH5C 2K8CA 3DVNU 2MCNB 4HK2A 1S1QB 2W9NA 3BINA 4URKA 4B6WA 2AEHA 2M17A 5AZFA 2KKCA 2B3AA 4PYZA 3KW5B 2Z0DB 2AYOB 3V62A 5LXIB 3N32A 1V49A 5E6OA 3UIPB 3R7QA 1WFYA 3R3MA 2KDBA 2L3ZA 5IA7A 2KJRA 5D6JB 1P3QU 2BWES 1H4RA 3L08A 3V6EB 4BOSC 2KVRA 2REXA 5G2NA 3BY4B 2KFKA 3L17A 2DYBA 4W9LA 2D07B 2K39A 2MBEA 2JT4B 3NZSA 4ZYNA 1OTRB 1WY8A 5EDSA 5DPWA 2KC1A 2JF5A 2KFKB 2C7MB 3EFUA 4I6LB 4IM3A 3TMPB 4HXDA 5TR5A 1Q1OA 1YX5B 4KV2A 2IBIB 4F8CB 2JRIB 3U30A 2R2OA 4NJ6A 4KSLC 3PT2B 1WIAA 1EO6A 2NVUI 3HHMA 1V81A 4NQKE 4GDLA 3HIZA 4WWOA 5J18A 2KLCA 2Z59B 4HPLB 2KTRA 3DQVA 3A4SC 3VH3B 2FIFA 4ZRKA 1WGRA 3OJ3A 4XZ4A 3DPDA 1VD2A 3AU5A 1ISNA 2JUOA 2R2QA 5DPSA 4GDLB 5D7GA 4BKSA 4A3PA 4TV3A 2O2VA 2XK5A 5GMVA 2IO0B 1E90A 2FIDA 2KWVB 4MGIE 2AL3A 2G4SA 4FN2A 1WM3A 3M62B 4DHJB 3PRMB 1WGGA 3MTNB 2C7NB 3A1QA 2BKRB 4FJYA 3RCZA 3ZNZB 3GZNI 2KLGA 2O2VB 3KUDB 2XK5B 1XD3B 3WAPA 3ZVVA 5HKHA 2JZZA 2ZCBA 2RGFA 3QQ8B 5AEKB 4ANUA 3HM3A 2ZNVC 1TTNA 3PVLA 1YJ1A 5IAAC 4FULA 2KQSA 3U8ZA 2MBBB 3PV1A 2J0JA 1WGDA 3H1UA 4PS3A 4BVUC 4AOFA 4OVVA 4NJ7A 1I35A 2LVQA 3RUIB 5DCNA 2CKHB 3QC8B 4XX5A 3VAWA 2K6QA 2VRRB 4MGZE 2M0XA 4HDQA 3PS6A 1WXVA 5E6PA 3ZTCA 4DDID 2ZCCA 3MJWA 4M8NA 3IBEA 4IWOA 1HE8A 3WA0A 2FUHB 3A9KB 4TQ0A 3V6CB 4K7UA 3PRZA 2JWZA 3CMMB 1P1AA 3B08A 1YIWA 4LCDE 5D94A 4E71A 3O65B 4BFRA 3AU4A 1EUVB 3W1SA 2JY6A 1WX8A 2KX0A 3ZLZA 3QA8A 1V6EA 4DHZB 1GJZA 2KDEB 1QZEA 2ZJDA 1NI2A 4WJOA 2ZVOA 1WR1A 2LRUA 3B0AA 3I3TB 4K81A 4KIKB 4EEWA 4IWPA 2I1KA 2GBRA 3VFKA 3APFA 2K1FA 3A9JA 2AL6A 2GBNA 3L13A 2PEAA 4GXBA 2OJRA 4GB9A 1OEYA 1WJUA 2BYFA 4IWQA 2DZIA 3JSVA 3D32A 3IFWB 3OJ4B 2RSUA 1UH6A 3CSTA 2M8SA 3SU8X 1GG3A 2MWSB 2EMTA 2UWQA 3ECIA 4J6IA 3U7DA 4P7IA 3QJZA 2LXAA 1E8XA 2KJHB 4MELA 2NCNA 1WJ4A 2FCSA 5E6NA 2C7HA 3GOEA 3JSVB 2EKEC 4RMAA 3UF8A 4BBNF 3IG3A 1YQBA 4GIVA 4K1RB 3C0RB 3DVGY 3QCAA 5AZGA 3ZO5B 3W1SC 2Z0EB 3VUXA 2N7EA 2CS4A 3N30A 5CTRC 2L0FA 3T9LA 2GBMA 4WWNA 2BPSA 2D3GA 2L7RA 4WQOB 3H7SA 4A20A 1S3SG 3HK0A 4HVBA 3X23A 4HLEA 3H7PA 2MQJA 4W9GA 3L10B 5CX3A 5BO4B 2MW5A 4GN1A 3NHEB 2IY1B 3TJPA 3R7RA 5L95C 1WXAA 1GNUA 1WJNA 2CR5A 5AZHA 3H7PB 2L05A 2C60A 4DXAB 2Y5BB 2MP2A 1K8RB 3JVZX 1GUAB 1WE6A 4G0NB 4KDLB 2N7DA 4MM3A 2V4LA 5G55A 2BYVE 2BGFA 3NZUA 4TUUA 1YX6B 2LI5A 2MP2B 3H9DA 4XC2A 2LGYA 5KHQA 3QARA 4DWFA 1UBQA 3DDCB 3IVFA 2MRPA 3CSFA 5DPTA 2JRHA 2IO2B 1Q5WB 2KXJA 4AWJA 2MBHA 3KYCD 4DHZE 2L0TA 2BF8B 3NY5A 1IYFA 3OLMD 2PE6B 3NS8A 1WGYA 4KVGB 5J2RA 2L00B 1LXDA 4E3CA 4FLHA 4NY0A 1P98A 2KD0A 4MJSA 4W9JA 3RYTA 3ZKJC 2K6DB 4WJPA 3WALA 2KTRB 4BKGA 1UGMA 3DBSA 1OGWA 4RM9A 3PGEA 5C1ZA 3RULA 1WX7A 4I6PA 2LRWA 1CMXB 4PS7A 1WF9A 4HCPB 4A3OA 3TBLD 4CHKA 3A33B 2IZVB 2KWUB 2A5UA 1E7UA 4MGKE 4KZ0A 5J17A 2DAFA 2KHWB 3KH0A 2J0MA 3B1LX 2NBUA 3RZFA 4W9DA 4HWIB 5LLIA 3A1QB 3M3JA 2KN5A 3PHXB 2PJHA 4KDIC 4DBGA 2V1YA 4HDOA 1WYWB 4IM2A 4YL8A 1GC6A 4LDTD 1D3ZA 1WZ0A 1TGZB 4W9FA 3ZW3A 2CHXA 4FADA 2FNJB 3MHSD 4MSMB 1LM8B 4ANVA 4B9KA 2EMSA 1WM2A 2DZKA 2HJ8A 2C5LC 4NAWA 4LJPB 3N3KB 4AP4C 2NR2A 2FAZA 2IY0B 3DBRI 4ICVA 3L54A 3VVWB 4ZRJA 1WRDB 1WJ6A 2GOWA 3UGBB 2YVCA 1F9JA 5D2MB 3QK0A 3VTUA 2UYZB 3AULA 4G3XB 2JVCA 2D2QA 2KK8A 4NAWB 2N9EB 4PYUA 3UQBA 4W9IA 5JZEB 1P9DU 2KO3A 4ASWC 1RAXA 3AI5A 1H8CA 2ZVNA 1LFDA 1X1MA 3DCGA 2ZEQA 1E8ZA 3PREA 4M8MA 4W9CA 5CHVC 3DVGX 3VTWA 1T0YA 1KLVA 2N9PC 2I1JA 2G45B 3APDA 2GBKA 3QIJA 1RLFA 2L76A 1LQBA 2M1MA 4II2B 5C23A 2DAJA 3CF6E 3WIMA 2J7QB 1EF5A 2O6VD 4ANWA 1E7VA 3IHPC 1JRUA 1NDDA 1UBIA 4NNJB 2DHZA 4FHKA 2LGDA 3R66C 5JHBA 4JIOU 1AARA 3A9JB 3PSEB 2L8JA 3RT3B 3RZWC 2FCNA 2LZ6A 2LASA 3HM6X 4LJOB 1Z2MA 1ZGUB 3PPAA 3Q3JA 4HPMB 4ZDVA 3WAOA 1L7YA 3L16A 4G11A 4GOCA 3ZRCA 1UZXB 4FA6A 4NQLB 2MSED 1WMHA 1WI0A 2NBWB 3V61A 4DHJD 1L2NA 2DZJA 3ENEA 2KQ7A 2CU1A 5CHWA 2MLBA 3DBLI 4N9F4 3WAMA 4MEMA 3ZNID 1GC7A 2ASQA 3NOBA 4GMVA 1M94A 1Q0WB 1SE9A 4MDKE 2WX1A 1ZKHA 1UELA 3T8MA 1PQSA 1V86A 1WX9A 2N9XA 2N4FA 3SDLC 2MA9B 1OQYA 1EF1A 2HTHA 4RM8A 2N1VA 4W9KA 5KHOA 4HCNB 3M63B 1G6JA 2KX3A 1U4AA 3ZNGC 2NBVB 3PTFC 2WX0A 4LDTB 4NPNA 2CHWA 3ZUNA 4EZLA 1I42A 1E5WA 1KM7A 1V80A 2FCMA 2KNBA 2KMAA 2PPHA 2HE7A 3M95A 3Q3FA 4JL9A 4E74A 1MG8A 5LXHA 1TZ1A 2NS5A 3KVFB 4X57B 2ZZPB 4M0WB 3VUYA 2ZPYA 1SIFA 2DENB 1E8WA 1VCBA 2BWFA 1ZW7A 2KZRA 3ML9A 2D11A 1J19A 4F7ZA 4BBNC 3H6NA 2LUEA 2V3SA 4FBJB 3KYDD 3PLUA 4WJQA 5DPRA 3VTVA 3VH4B 2BKFA 2KWCA 1RRBA 1Z5SB 4II3B 4TQ1A 4BKTA 2K8HA 1XT9B 2OOBB 2BYEA 4K7SA 2O6VA 4FHJA 3QHTA 2IYDB 3AXCA 3SD5A 3ZRFA 2WDTB 4GSWA 3LDZE 4AJYB 4BOZB 1UD7A 3SHQA 2HD5B 3ALBA 2M4NA 2MBQA 3APCA 1V9JA 4EFOA 3UINB 4WJNA 4MJSB 4MH0E 2O6VB 1R4MI 1WR6E 2DYOA 4ANXA 3QAQA 2ZNVB 4CO7A 3LJ3A 1OEYJ 2AWTA 3KUCB 1J0GA 3ZDMC 3UQAA 3L0WB 3W1YA 4OVUA 3VQIA 3PRPB 3ML8A 2A4ZA 4FJZA 4IUMB 1YD8U 2NPTA 2XBBC 4AUQC 1WXMA 2PE9A 2LVPA 1R4NI 3S2AA 1WE7A 4WAAA 1C1YB 1XQQA 4ICUA 3ONSA 2KTFA 4HJKA 2NPTB 2J0KA 2FCQA 3QWZB 3VUWA 2LD9A 2MBOA 5CHFA 4F1SA 2KDFB 5L83A 4EZKA 4GDKA 4CYEA 3V60A 2G4DB 2KC2A 1A5RA 2KOXA 4MGYE 1IPGA 4G50A 4K7WA 4B95A 2KFJA 3OAWA 1KJTA 3TL5A 4FJVB 2XEWA 2K8BA 3KUZA 4GDKB 1V2YA 2RD0A 3A4RA 3VXWA 1FXTB 2JZ3B 2LVOA 2MX2A 3A9KA 3WANA 2D10A 4KZCA 1J8CA 2LGXA 5FR6A 3X0WA 2IO1B 1RFAA 3VHTC 3ZNHB 4IW0A 1C3TA 2GMIC 1KOTA 1WGHA 4TKNA 4JQWC 3PHWB 3JW0X 2KDIA 4IM0A 2DX5B 3UIOB 2YLMA 2QHOA 4KIKA 3EHVA 4IC7B 1NBFC 2JXXA 1WH3A 1WZ3A
chains in the Genus database with same CATH superfamily
2NTTA 4HEA1 3P2BA 2ZPNA 2AQ3B 1PGBA 1TBEA 1SGHA 4PK1A 4GLSC 3ZIMA 3NVWA 3DOWA 1V5TA 3PZ8A 3EC8A 4JWSC 2G3QB 4WWPA 2CHZA 5JHAA 2HDEA 1V5OA 3U4EG 4KSKC 1JCKB 2LXCA 1ET9A 2WDQB 4JLCA 1D4BA 3DBHI 2K8CA 1S1QB 2W9NA 1JMLA 4URKA 4B6WA 2AEHA 1B1ZA 2Z0DB 1STEA 3V62A 2PIAA 3Q8BA 5E6OA 3R7QA 2BB6A 2KDBA 5D6JB 2BWES 1F77A 1FO4A 4LLGM 3L17A 2BBCA 1TS3A 4BZAA 4W9LA 2D07B 4LNOA 2G9HD 4ZYNA 4YSXB 3BWUD 5EDSA 3MHZA 2JF5A 2C7MB 2Y5PA 2R2OA 2NVUI 3HIZA 4HPLB 2IGGA 4XZ4A 2R61A 5DPSA 2L32A 4BKSA 1ZPSA 4BAXA 2BTEA 4TSSA 2WDVB 2FIDA 1Y56A 4MGIE 1FXAA 4FN2A 3PRMB 1WGGA 3GZNI 3ZVVA 1JWSD 2QDFA 2JZZA 2ZCBA 2RGFA 3HM3A 5G5HA 3J9CA 3HRDD 2QJLA 2Q5WD 2J0JA 3H1UA 2IJ0A 1I35A 2L83A 3RUIB 5DCNA 2K6QA 4MGZE 4DDID 4MACA 3IBEA 4TQ0A 3V6CB 2V9HA 4LCDE 3B08A 4ITKA 4BFRA 2JY6A 1WX8A 4WAFA 4JE3B 1GJZA 2ZVOA 2Y3AA 1DGJA 3B0AA 3I3TB 4EEWA 1M4VA 1YJJA 4IWPA 3VFKA 3APFA 2K1FA 3A9JA 2OJWA 2AL6A 3ZQ4A 2PEAA 5C3JB 4KGTA 1WJUA 2MJ3A 3OJ4B 3ECIA 4J6IA 5HFYA 4P7IA 4R3DA 3QJZA 1I4RA 1E8XA 2KJHB 5D3IB 1WJ4A 5E6NA 4RMAA 4BBNF 4K1RB 3C0RB 4KGRA 2WXOA 2N7EA 2CS4A 3C8YA 1P7FA 4HVBA 5CX3A 5BO4B 3AE7B 3TJPA 3ETRA 4N58A 5IN7A 1GNUA 2L05A 4DXAB 2Y5BB 1GUAB 5H92C 1PYWD 2N7DA 2JWUA 3RNBC 2V4LA 1SXTA 2BYVE 1QLBB 1LO5D 3H9DA 2WXRA 4XC2A 2PW9A 3RNGC 1D5MC 3CSFA 3NUHB 1VZ8A 4HJGE 3MC8A 5EE0A 2KXJA 4DHZE 2BYTA 1V1PA 3NS8A 2L00B 3KLSX 4FLHA 3P63A 2DNFA 4NY0A 4W9JA 3PO0A 3ZKJC 1FIQA 1FNUA 1QOAA 4RM9A 5C1ZA 1V1PB 3NVVA 2J53A 1C77A 1PDXA 1E7UA 2WXGA 4L1BA 2DAFA 2KHWB 3RZFA 4W9DA 2K22A 5LLIA 3A1QB 3M3JA 2KN5A 4M02A 1TKGA 4AS1A 5GXGB 3AH7A 1CZPA 1WZ0A 3AEBB 1RM6C 2CHXA 2INCC 4FADA 4MSMB 4B9KA 2EMSA 2BB5A 2IY0B 2GOWA 1F9JA 2Z8LA 3RPFC 2JVCA 2KK8A 5FKAC 2QEJC 4XWWA 1RAXA 2ZVNA 1TS5A 4W9CA 3PREA 3DVGX 3VTWA 1T0YA 2N9PC 5C23A 4ANWA 3RNCC 3WIMA 1E7VA 3IHPC 1JRUA 3BVGA 4K3CA 1UBIA 1IUEA 4JIOU 2J42A 1E0ZA 2FCNA 2LZ6A 1JWBD 4LNFA 2LASA 3VR9B 1FD6A 3L16A 2YEPB 1K50A 5EE1A 1WMHA 3Q3NC 2QILA 3W5UB 2DZJA 2KQ4X 5CHWA 1SF0A 3V3XA 1EWYC 1M94A 4MDKE 2INNE 3T8MA 1V86A 3CIRB 1ACCA 2N4FA 1UWXA 3FKYA 1OQYA 1EF1A 4UDUC 4RM8A 1QQRA 1U4AA 2NBVB 4LDTB 4MT5A 3ZUNA 4EZLA 1E5WA 1TIFA 4E74A 2PPHA 3M95A 3Q3FA 1ZXIA 2D3CA 1QOGA 2WNMA 2LHEA 2ZZPB 1JQ4A 1XO3A 2DENB 1E8WA 1IBXA 3ML9A 2D11A 1J19A 4BBNC 5BMGA 1ROEA 4FBJB 4WJQA 3VH4B 1Z5SB 1YJIA 2DLBA 1IBXB 3ZRFA 1I4GA 4GSWA 4M01A 4AJYB 4BOZB 1JWAD 2HD5B 3ALBA 1YQ3B 3AE1B 4EFOA 2ICIA 4MH0E 3KWLA 2ZNVB 4WQMA 2AWTA 3KUCB 1J0GA 3UQAA 5HG2A 4OVUA 3GB1A 3ML8A 1FRRA 2A4ZA 1YD8U 1TY2A 3SEBA 3TSSA 1HZ6A 1WSPA 3AEEB 4HJKA 3VUWA 2FCQA 1L6VA 1WGKA 4A55A 3V60A 3L4PA 4G50A 4B95A 1KRHA 4S17A 2IDYA 2RDHA 2CJNA 3TL5A 5FR3A 1D5ZC 3KUZA 1N60A 1V2YA 4C56C 3A4RA 3VXWA 1FXTB 2LVOA 3A9KA 3X0WA 3KWVA 5IP4D 4IW0A 1KOTA 4JQWC 2V4IB 3GZNB 4IM0A 3Q2AC 1DOIA 4IC7B 1NBFC 2IO3B 2GBJA 4LNNA 3EECA 3AEGB 1XLOA 2N1WA 3FC4A 3K9PB 1WXSA 2MJEA 2NMQA 4YTPB 2DBYA 4EKUA 3JYUA 3P4RB 3BYTB 3DVNV 1AYFA 3ZYYX 4BKSD 2JPHA 4W9HA 4MSQB 1P0RA 1IP9A 4W9EA 3MC9A 1E6EB 4IG7B 2K25A 2TSSA 4ZRIA 4EOYA 2LJ5A 4GGQA 3QX1A 4GU2A 4DDGD 2WYQA 2M0AA 4IOIE 1AN8A 3GS2A 4DXGA 4EE2A 4H2AA 2DZMA 1VJKA 3PZDA 2KMCA 3RD2A 3DVNU 4HK2A 4NZLB 1SE3A 2AYOB 4WURA 2K0PA 2MJDA 2G1EA 3R3MA 2BS4B 1SIJA 2GRIA 1F0ZA 2KJRA 1P3QU 3V6EB 2KVRA 5G2NA 2KFKA 1ENFA 1XCTL 1KLGD 2JT4B 3NZSA 2W55A 1WY8A 5DPWA 2KFKB 4HXDA 3U52E 1Q1OA 1YX5B 4KV2A 2IBIB 2JRIB 3DBLB 4KSLC 1WIAA 1EO6A 3R2IA 1DYQA 4P16A 1V81A 4M00A 4KKIA 2KTRA 3DQVA 4JPSA 2FIFA 4ZRKA 4XWTA 1WGRA 3OJ3A 1I4QA 3AU5A 1ISNA 2R2QA 5D7GA 4A9AA 2XK5A 5GMVA 4ARCA 4A90A 2IO0B 4N59A 2G4SA 2LJIA 1L5PA 3RCZA 3BZDB 2XK5B 1XF5L 3WCQA 3C19A 1JALA 1FM0D 3QQ8B 2ZNVC 4C7ZA 1FNVA 3U8ZA 2EKIA 2MBBB 1A70A 4NJ7A 1SEBD 2LVQA 3QC8B 2VRRB 4QAYA 1I7HA 2M0XA 4HDQA 1WXVA 5E6PA 3ZTCA 3MJWA 3WA0A 5D94A 1P1AA 3SFDB 3SFEB 2KX0A 3ZLZA 3QA8A 1V6EA 3DWGC 4DQOC 2KAJA 1FRDA 2GBRA 2GBNA 4GB9A 1OQRA 2DZIA 3JSVA 3D32A 3U7DA 2EMTA 2UWQA 3IT4B 1MI0A 4OHJA 3R2TA 2FCSA 3JSVB 2EKEC 3UF8A 5BMIA 3IG3A 1YQBA 1NENB 4GIVA 3QCAA 3NJTA 2Z0EB 3N30A 3Q6BA 1FEHA 2GBMA 4JX1C 2D3GA 3AECB 2L7RA 4WQOB 1S3SG 2JXTA 4HLEA 1BUIC 3R7RA 1T5XD 3Q69A 3DWMA 1QKZA 1K8RB 4HKZE 4MM3A 1KLUD 3NZUA 5IKCM 1YX6B 1YN5A 2LI5A 5KHQA 1PGAA 3FILA 2VH2A 4MM3B 4ACFA 1HZ5A 4AWJA 2L0TA 3MFGA 2PE6B 4KVGB 2MH7A 3FILB 2WQYB 4MJSA 3WALA 1E7PB 1UGMA 3DBSA 2M56B 1OGWA 3AM9A 4ZHOA 1WF9A 4A3OA 3BK1A 1T3QA 2KWUB 2A5UA 2MHJA 3OWEB 4KZ0A 5AUIA 5J17A 1N6ZA 3KH0A 5IOIA 1Q10A 1MJDA 1N5XA 4P1BC 4LDTD 2W54A 4W9FA 3NVYA 4ANVA 2DZKA 3VRBB 4LJPB 4ICVA 1J7BA 1F2RC 3BYYB 3B9JA 3VTUA 3KQ4A 4G3XB 2D2QA 1FMAD 2N9EB 3UQBA 5JZEB 1P9DU 4WWMA 3RI7C 3IXSA 1LFDA 3DCGA 2ZEQA 2VZKB 2I1JA 2G45B 4CQNA 1GB1A 2ZW1A 3CF6E 3RNAC 3EA6A 4NNJB 2LGDA 1SE2A 3BVMA 3I57A 3A9JB 4OW0A 3N9YC 3RT3B 3RZWC 4LJOB 4HPMB 3Q3JA 1WXQA 4FA6A 1JW9D 3LB8C 4DHJD 5C2TB 5FK9C 2KQ7A 3DBLI 3WAMA 1YN3A 2LGSA 1GC7A 4GMVA 1UELA 2MA9B 4ZYSA 4W9KA 4HCNB 5BYQA 4ZRQA 3ZNGC 3PTFC 1CQVA 1RFKA 4M0WA 2KMAA 4JL9A 1NEKB 4L2YA 1C4CA 5MPOA 5LXHA 1TZ1A 2E6XA 2NS5A 1MHHE 4X57B 4M0WB 3VUYA 1T0RC 2BVCA 1ZW7A 2V3PA 1I4HA 1I4PA 3VTVA 2BKFA 1VRAB 4II3B 4RCOA 4BKTA 3O13A 1XT9B 2OOBB 1FFVA 2O6VA 3QHTA 2PMVA 2PVOD 1UGJA 4XGAB 2MBQA 4YTNB 3LYYA 3V05A 3UINB 2O6VB 1WR6E 1KFYB 2DYOA 2VH1A 3L0WB 3W1YA 1EM7A 3PRPB 2SAKA 2H88B 2NPTA 2PE9A 1C78A 3P4QB 1WE7A 1ZXHA 2RMMA 4ICUA 3ONSA 2NPTB 2BS3B 2V3NA 5IO9A 2JZPA 1NI3A 5CHFA 1WWTA 2KDFB 3AEDB 2RPVA 1A5RA 2KOXA 4MGYE 3AE2B 1IPGA 4O1NA 2XEWA 2K8BA 2FUG1 3UI3A 2JZ3B 2MX2A 2D10A 2LGXA 1XLQA 1ESFA 5EE3A 1L4ZB 1WGHA 1YMHE 2SEBD 4RFBA 2WGSA 3N1XC 1PUTA 3Q14C 2QHOA 5G5GA 4C7YA 4KIKA 4WWOA 1XLNA 2DYMA 1MHXA 4US9A 1DOYA 1TZOA 4K3BA 2RR9A 3T3OA 3ZTDA 1MFWA 1JROA 1B9RA 4EZJA 2RPQA 2ONQA 2KJ6A 3RNEC 2WWZA 1WMHB 4RGMA 3AE6B 5H8YE 4EUTA 2LGIA 3K9OB 1E8YA 2LUMA 2C9WB 2LWPA 5JH5C 2MCNB 1YQ4B 1TS4A 3N20C 2KN4A 2XNAC 2KKCA 2B3AA 4PYZA 3KW5B 1C4PA 1ZP0B 4YTMB 5LXIB 4ZRPA 3AB5A 2KMMA 1V97A 3BK2A 5IA7A 2N7JA 3U7ZA 1MG4A 2DYBA 4B0EA 2K39A 2MBEA 3SR6A 3P4SB 5LNK1 1HQRD 3AMZA 4I6LB 3EFUA 3TMPB 5TR5A 1WRIA 3VRAB 2HTME 5BMHA 5BYSA 4KX6B 4GDLA 2EELA 2KLCA 2Z59B 3Q8CA 1R7SA 3IAS1 1TKEA 1E9MA 2JYEA 1HTQA 4GDLB 3ZJTA 2J52A 4A3PA 4TV3A 3RMKC 2O2VA 1FPYA 1K51A 4OZBA 4DHJB 4FJYA 2BKRB 3ZNZB 2KLGA 2O2VB 2GB1A 1XD3B 3WAPA 2WP9B 1C4AA 5AEKB 1TTNA 1L0XB 1N62A 1YJ1A 4YT0B 1FFUA 4FULA 3DHIC 3PV1A 1WGDA 4FXCA 4BVUC 2WU5B 4PS3A 2CKHB 1XEEA 2W82A 4XX5A 1BMLC 1KF6B 2I2YA 1AW7A 1GAQB 2FUHB 3A9KB 1T0SC 3CMMB 4OVZA 2QIEB 3O65B 1LGRA 3AU4A 3Q8EA 1QILA 2WXFA 1V8CA 2WXQA 2J4XA 1EWCA 1NI2A 4NJCA 4WJOA 1WR1A 2LRUA 2BT6A 1R4NB 1AWDA 3E9SA 1L0YB 1XCQL 2KDMA 3L13A 4GXBA 1OEYA 1TKYA 4HRSA 4RH6A 2WU2B 2RSUA 1UH6A 2M8SA 3SU8X 2MWSB 2LXAA 4MELA 3GOEA 4RF1A 3TEZA 3B2GA 4XE0A 5HHDG 3ZO5B 5AZGA 3W1SC 3VUXA 2L0FA 3H8HA 2L1AA 2OEDA 5I4DA 4A20A 3HK0A 4W9GA 2MQJA 3L10B 3AE8B 2MW5A 2OHFA 2D3AA 3B2FA 5AZHA 2CR5A 3JVZX 2ACZB 2VZKD 5G55A 2BGFA 4TUUA 3AEFB 2LGYA 4OZCA 3QARA 4DWFA 1UBQA 3DDCB 1UWMA 2MRPA 5DPTA 2IO2B 4KKJA 2MBHA 1SJHD 3NY5A 1IYFA 3OLMD 1N61A 4WH4A 5J2RA 4E3CA 4OZAA 1P98A 2KD0A 2WXNA 3N1YC 2K6DB 4WJPA 2KTRB 3PGEA 3RULA 3ZXVA 1CMXB 4PS7A 4US8A 2KWDA 4LTUA 3TBLD 3A33B 2IZVB 3CWIA 4MGKE 3ZJVA 2NBUA 1SB3C 4NAMA 4USAA 4HWIB 5AUKA 1F52A 3PHXB 4KDIC 4DBGA 4IM2A 1TGZB 1F1HA 2FNJB 3MHSD 3GE3C 4HKQA 1WM2A 2PKOA 1I4XA 2C5LC 4NAWA 4AP4C 3N3KB 2FAZA 5HI1A 4ZRJA 1J7AA 1WJ6A 3NVZA 1MVKA 3UGBB 2PLPA 2YVCA 5D2MB 3QK0A 5JXVA 2UYZB 2RDBC 4NAWB 3LXFA 4PYUA 4ZOHC 1KTKA 2HJ1A 4J3OD 2KO3A 4M8MA 4XDDA 1QT9A 4MH8A 1SBBB 3QIJA 2DAJA 1HA5A 2J7QB 1EF5A 2O6VD 2W3SA 2GI9A 1SJED 5JHBA 3PSEB 1HEZE 2L8JA 2BS2B 1Z2MA 1ZGUB 3TEXA 2D5GA 4RGNA 1JWUD 2JQRB 3WAOA 1L7YA 2WXLA 1UZXB 4NQLB 2MSED 1WI0A 3V61A 3ENEA 2CU1A 3W9CB 4P6VF 4N9F4 4MEMA 3NOBA 1Q0WB 1SE9A 1SE4A 1PQSA 2JX5A 1WX9A 2N9XA 3SDLC 3RN9C 1K53A 2M19A 4IKGA 1BXTA 1G6JA 1XLPA 3AE4B 2CHWA 1EU3A 2W3RA 1V80A 2FCMA 1IGDA 1VDVA 3AE5B 1MPEA 3KVFB 2BQQA 1VCBA 2IGHA 2KZRA 3DHHC 4F7ZA 4JWUC 1IGCA 3H6NA 3KYDD 3PLUA 5DPRA 2IGDA 2KWCA 3Q8FA 2AX5A 3AE3B 1TJEA 2K8HA 1YN4A 1TT5B 2QC8A 4FHJA 1L4DB 1TYGB 2IYDB 3SD5A 3Q8AA 2UU7A 3LDZE 3SHQA 2M4NA 2PTLA 1WYGA 2AQ2B 4MJSB 3VR8B 3DHGC 1L0VB 1VZ7A 1V1OA 2NTSA 3P4PB 3VQIA 2QMTA 4FJZA 4IUMB 1YOVB 2XBBC 4AUQC 1WXMA 5E6JA 2LVPA 1R4NI 4C00A 2WS3B 4WIPA 1JWMD 1C1YB 1XQQA 2J0KA 3QWZB 2MBOA 4F1SA 5L83A 4EZKA 4LK0M 4GDKA 5TSSA 3IT6B 1ZDVA 2G4DB 3AV8A 3HUIA 4DXFA 3OAWA 4GDKB 2WLBA 4LNKA 4KZCA 2IO1B 1RFAA 2GMIC 3JW0X 2KVZA 4ZHPA 2DX5B 1GOZA 3Q3MC 3EHVA 3ZW3A 1WZ3A 3ZDTA 1ZOYB 3T3NA 4AJWA 3PLVA 3BVZA 3TIXA 2KANA 4IDIA 2KACA 2WXJA 4I6NB 1BT0A 1Y8RC 3DBRB 4RGTA 4DK5A 2K3UA 2N9LA 3VDZA 1ET6A 2DWQA 4PS8A 3TCAA 4JGHB 3BIID 1C76A 5T8IA 1UNSA 2E3TA 3BINA 2M17A 5AZFA 1F2RI 1V49A 3N32A 3UIPB 1WFYA 2L3ZA 3RFZB 2V0GA 1H4RA 3L08A 4BOSC 2REXA 3NG0A 3BY4B 3E56A 4ARIA 3ABVB 4RF0A 2X8XX 4HPPA 1CK1A 1OTRB 3AE9B 2KC1A 4IM3A 3AN1A 4F8CB 1N5WA 3U30A 4NJ6A 3PT2B 4YSZB 1NYQA 3P1MA 3HHMA 4NQKE 5J18A 3VH3B 2PVGC 3A4SC 3NRZA 1ZDXA 2LMCA 3DPDA 3ZXRA 2ON8A 1VD2A 2JUOA 3MJ5A 3EFCA 1E90A 2KWVB 3IAM1 2AL3A 1WM3A 3M62B 3MTNB 2C7NB 3A1QA 1GPXA 3I5JC 3KUDB 4KGSA 5HKHA 1FCCC 2QCZA 4ANUA 1FNWA 1C79A 2INDC 3PVLA 5IAAC 2XN9C 1QOFA 2KQSA 4AOFA 4OVVA 2JYTA 2H89B 4D2KA 3VAWA 2BW2A 1ZUD2 1QOBA 3PS6A 2ZCCA 4M8NA 4S0RA 4IWOA 1HE8A 1R4MB 4K7UA 3PRZA 2JWZA 1UUPA 1YIWA 3EUB2 5D3DA 4E71A 1EUVB 3W1SA 1K52A 1RWSA 4RGOS 4DHZB 2KDEB 4YXDB 1QZEA 2ZJDA 4K81A 4KIKB 3FAHA 2I1KA 3MP9A 4XDCA 1D6EC 2YEPF 3NS1A 2OJRA 4RNAA 2BYFA 4IWQA 3GE8C 2L52A 3IFWB 3CSTA 1GG3A 2D3BA 2KT7A 2WXKA 1P7EA 3GP7A 2NCNA 2C7HA 1ZE3D 3TEYA 2KYWA 4HROA 3DVGY 5CTRC 3T9LA 4WWNA 2BPSA 2CU3A 2B76B 3H7SA 4YSYB 3X23A 3H7PA 4GN1A 1T6BX 3NHEB 2IY1B 4AQ7A 2WXHA 3N1ZC 5L95C 1WXAA 1WJNA 1GB4A 3H7PB 2C60A 1KH0A 2MP2A 3U2SC 1WE6A 4G0NB 4KDLB 1T0QC 2MP2B 3IVFA 1XXGA 2JRHA 3I63C 1Q5WB 2LFIA 4YWGG 3TEWA 3KYCD 2BF8B 1WGYA 2WDRB 1LXDA 2INPE 1OQQA 2JU6X 2FBWB 3RYTA 3DBHB 4BKGA 4L23A 1WX7A 4I6PA 2LRWA 4HCPB 4CHKA 3MC0B 2J0MA 1N63A 3B1LX 1C9FA 2PJHA 2V1YA 2K9XA 4HDOA 1WYWB 4YL8A 1GC6A 1D3ZA 2RDGA 2IPKD 4PT5A 1LM8B 2HJ8A 2N0SB 3I9V1 2NR2A 3DBRI 3L54A 3VVWB 4TMAB 1WRDB 2CJOA 1PFDA 2MEKA 2Y5CA 3AULA 4B0MA 2FE8A 3HVDA 4W9IA 4ASWC 2X38A 3AI5A 1H8CA 1X1MA 1E8ZA 5CHVC 1KLVA 3APDA 2GBKA 1RLFA 2L76A 1HXYD 1LQBA 2M1MA 4II2B 1VLBA 1NDDA 3R8BA 4XYCA 2DHZA 4FHKA 3R66C 1AARA 4C4VA 2GLSA 3HM6X 3ZGZA 3PPAA 4ZDVA 2LHDA 4G11A 2JSVX 4GOCA 1D5XC 3W2DA 3ZRCA 4C4VB 2NBWB 1L2NA 2I38A 1VZ6A 1TY0A 2MLBA 3ZNID 2ASQA 2WX1A 1ZKHA 3AEAB 3NZ3A 2WHIA 1L6UA 2HTHA 2N1VA 1UF0A 5KHOA 2ZW0A 3M63B 2KX3A 3RNFC 2WX0A 4NPNA 4A8XC 1I42A 1KM7A 2K5PA 2KNBA 1FXIA 3W5VB 2HE7A 2QSDA 1MG8A 2AQ1B 1E10A 2ZPYA 1SIFA 2BWFA 1QF6A 1YNTE 1PGXA 2LUEA 2V3SA 1NVID 1RRBA 4TQ1A 1VR9A 3OG5A 2BYEA 4K7SA 2WXPA 3AXCA 3ZJUA 2WDTB 1UD7A 3APCA 3PZ7A 1V9JA 3URYA 1NYRA 4Q2JA 4WJNA 5BYRA 1R4MI 4ANXA 1CJEA 3QAQA 1TS2A 4CO7A 3LJ3A 1OEYJ 3ZDMC 1EU4A 3EGRA 2N9KA 4A6QA 2LEKA 1HTOA 1OFFA 4C80A 1RYJA 3S2AA 4WAAA 2WXIA 2KTFA 2WXMA 1J7CA 2LD9A 3HVZA 1FCLA 4CYEA 3Q3OC 2KC2A 4P1CC 4K7WA 1JRPA 2KFJA 3TUOA 1KJTA 5EE9A 4FJVB 4REZA 4N6EB 2RD0A 3P42A 3WANA 1J8CA 5FR6A 3VHTC 3ZNHB 4LNIA 1C3TA 4TKNA 1SSNA 3PHWB 2KDIA 1DOXA 3UIOB 2YLMA 2JXXA 1WH3A
chains in the Genus database with same CATH topology
2IO3B 3ZDTA 2GBJA 2DYMA 3EECA 4AJWA 3P2BA 2N1WA 2ZPNA 3K9PB 1TBEA 1WXSA 3PLVA 1SGHA 3TIXA 2RR9A 4EKUA 3JYUA 3ZTDA 3ZIMA 2KANA 3DVNV 3DOWA 1V5TA 3EC8A 2G3QB 4I6NB 4WWPA 2CHZA 2JPHA 4W9HA 4BKSD 2RPQA 4MSQB 4EZJA 1BT0A 1P0RA 5JHAA 4W9EA 1V5OA 1Y8RC 1IP9A 2KJ6A 4IG7B 2K25A 4KSKC 4ZRIA 4DK5A 2WWZA 1WMHB 4EOYA 2LJ5A 2LXCA 4GGQA 3QX1A 4GU2A 3VDZA 2WYQA 4DDGD 4EUTA 3K9OB 4JLCA 2DZMA 1E8YA 3PZDA 2KMCA 4PS8A 4JGHB 3TCAA 3RD2A 2C9WB 2LWPA 3DBHI 5JH5C 2K8CA 3DVNU 2MCNB 4HK2A 1S1QB 2W9NA 3BINA 4URKA 4B6WA 2AEHA 2M17A 5AZFA 2KKCA 2B3AA 4PYZA 3KW5B 2Z0DB 2AYOB 3V62A 5LXIB 3N32A 1V49A 5E6OA 3UIPB 3R7QA 1WFYA 3R3MA 2KDBA 2L3ZA 5IA7A 2KJRA 5D6JB 1P3QU 2BWES 1H4RA 3L08A 3V6EB 4BOSC 2KVRA 2REXA 5G2NA 3BY4B 2KFKA 3L17A 2DYBA 4W9LA 2D07B 2K39A 2MBEA 2JT4B 3NZSA 4ZYNA 1OTRB 1WY8A 5EDSA 5DPWA 2KC1A 2JF5A 2KFKB 2C7MB 3EFUA 4I6LB 4IM3A 3TMPB 4HXDA 5TR5A 1Q1OA 1YX5B 4KV2A 2IBIB 4F8CB 2JRIB 3U30A 2R2OA 4NJ6A 4KSLC 3PT2B 1WIAA 1EO6A 2NVUI 3HHMA 1V81A 4NQKE 4GDLA 3HIZA 4WWOA 5J18A 2KLCA 2Z59B 4HPLB 2KTRA 3DQVA 3A4SC 3VH3B 2FIFA 4ZRKA 1WGRA 3OJ3A 4XZ4A 3DPDA 1VD2A 3AU5A 1ISNA 2JUOA 2R2QA 5DPSA 4GDLB 5D7GA 4BKSA 4A3PA 4TV3A 2O2VA 2XK5A 5GMVA 2IO0B 1E90A 2FIDA 2KWVB 4MGIE 2AL3A 2G4SA 4FN2A 1WM3A 3M62B 4DHJB 3PRMB 1WGGA 3MTNB 2C7NB 3A1QA 2BKRB 4FJYA 3RCZA 3ZNZB 3GZNI 2KLGA 2O2VB 3KUDB 2XK5B 1XD3B 3WAPA 3ZVVA 5HKHA 2JZZA 2ZCBA 2RGFA 3QQ8B 5AEKB 4ANUA 3HM3A 2ZNVC 1TTNA 3PVLA 1YJ1A 5IAAC 4FULA 2KQSA 3U8ZA 2MBBB 3PV1A 2J0JA 1WGDA 3H1UA 4PS3A 4BVUC 4AOFA 4OVVA 4NJ7A 1I35A 2LVQA 3RUIB 5DCNA 2CKHB 3QC8B 4XX5A 3VAWA 2K6QA 2VRRB 4MGZE 2M0XA 4HDQA 3PS6A 1WXVA 5E6PA 3ZTCA 4DDID 2ZCCA 3MJWA 4M8NA 3IBEA 4IWOA 1HE8A 3WA0A 2FUHB 3A9KB 4TQ0A 3V6CB 4K7UA 3PRZA 2JWZA 3CMMB 1P1AA 3B08A 1YIWA 4LCDE 5D94A 4E71A 3O65B 4BFRA 3AU4A 1EUVB 3W1SA 2JY6A 1WX8A 2KX0A 3ZLZA 3QA8A 1V6EA 4DHZB 1GJZA 2KDEB 1QZEA 2ZJDA 1NI2A 4WJOA 2ZVOA 1WR1A 2LRUA 3B0AA 3I3TB 4K81A 4KIKB 4EEWA 4IWPA 2I1KA 2GBRA 3VFKA 3APFA 2K1FA 3A9JA 2AL6A 2GBNA 3L13A 2PEAA 4GXBA 2OJRA 4GB9A 1OEYA 1WJUA 2BYFA 4IWQA 2DZIA 3JSVA 3D32A 3IFWB 3OJ4B 2RSUA 1UH6A 3CSTA 2M8SA 3SU8X 1GG3A 2MWSB 2EMTA 2UWQA 3ECIA 4J6IA 3U7DA 4P7IA 3QJZA 2LXAA 1E8XA 2KJHB 4MELA 2NCNA 1WJ4A 2FCSA 5E6NA 2C7HA 3GOEA 3JSVB 2EKEC 4RMAA 3UF8A 4BBNF 3IG3A 1YQBA 4GIVA 4K1RB 3C0RB 3DVGY 3QCAA 5AZGA 3ZO5B 3W1SC 2Z0EB 3VUXA 2N7EA 2CS4A 3N30A 5CTRC 2L0FA 3T9LA 2GBMA 4WWNA 2BPSA 2D3GA 2L7RA 4WQOB 3H7SA 4A20A 1S3SG 3HK0A 4HVBA 3X23A 4HLEA 3H7PA 2MQJA 4W9GA 3L10B 5CX3A 5BO4B 2MW5A 4GN1A 3NHEB 2IY1B 3TJPA 3R7RA 5L95C 1WXAA 1GNUA 1WJNA 2CR5A 5AZHA 3H7PB 2L05A 2C60A 4DXAB 2Y5BB 2MP2A 1K8RB 3JVZX 1GUAB 1WE6A 4G0NB 4KDLB 2N7DA 4MM3A 2V4LA 5G55A 2BYVE 2BGFA 3NZUA 4TUUA 1YX6B 2LI5A 2MP2B 3H9DA 4XC2A 2LGYA 5KHQA 3QARA 4DWFA 1UBQA 3DDCB 3IVFA 2MRPA 3CSFA 5DPTA 2JRHA 2IO2B 1Q5WB 2KXJA 4AWJA 2MBHA 3KYCD 4DHZE 2L0TA 2BF8B 3NY5A 1IYFA 3OLMD 2PE6B 3NS8A 1WGYA 4KVGB 5J2RA 2L00B 1LXDA 4E3CA 4FLHA 4NY0A 1P98A 2KD0A 4MJSA 4W9JA 3RYTA 3ZKJC 2K6DB 4WJPA 3WALA 2KTRB 4BKGA 1UGMA 3DBSA 1OGWA 4RM9A 3PGEA 5C1ZA 3RULA 1WX7A 4I6PA 2LRWA 1CMXB 4PS7A 1WF9A 4HCPB 4A3OA 3TBLD 4CHKA 3A33B 2IZVB 2KWUB 2A5UA 1E7UA 4MGKE 4KZ0A 5J17A 2DAFA 2KHWB 3KH0A 2J0MA 3B1LX 2NBUA 3RZFA 4W9DA 4HWIB 5LLIA 3A1QB 3M3JA 2KN5A 3PHXB 2PJHA 4KDIC 4DBGA 2V1YA 4HDOA 1WYWB 4IM2A 4YL8A 1GC6A 4LDTD 1D3ZA 1WZ0A 1TGZB 4W9FA 3ZW3A 2CHXA 4FADA 2FNJB 3MHSD 4MSMB 1LM8B 4ANVA 4B9KA 2EMSA 1WM2A 2DZKA 2HJ8A 2C5LC 4NAWA 4LJPB 3N3KB 4AP4C 2NR2A 2FAZA 2IY0B 3DBRI 4ICVA 3L54A 3VVWB 4ZRJA 1WRDB 1WJ6A 2GOWA 3UGBB 2YVCA 1F9JA 5D2MB 3QK0A 3VTUA 2UYZB 3AULA 4G3XB 2JVCA 2D2QA 2KK8A 4NAWB 2N9EB 4PYUA 3UQBA 4W9IA 5JZEB 1P9DU 2KO3A 4ASWC 1RAXA 3AI5A 1H8CA 2ZVNA 1LFDA 1X1MA 3DCGA 2ZEQA 1E8ZA 3PREA 4M8MA 4W9CA 5CHVC 3DVGX 3VTWA 1T0YA 1KLVA 2N9PC 2I1JA 2G45B 3APDA 2GBKA 3QIJA 1RLFA 2L76A 1LQBA 2M1MA 4II2B 5C23A 2DAJA 3CF6E 3WIMA 2J7QB 1EF5A 2O6VD 4ANWA 1E7VA 3IHPC 1JRUA 1NDDA 1UBIA 4NNJB 2DHZA 4FHKA 2LGDA 3R66C 5JHBA 4JIOU 1AARA 3A9JB 3PSEB 2L8JA 3RT3B 3RZWC 2FCNA 2LZ6A 2LASA 3HM6X 4LJOB 1Z2MA 1ZGUB 3PPAA 3Q3JA 4HPMB 4ZDVA 3WAOA 1L7YA 3L16A 4G11A 4GOCA 3ZRCA 1UZXB 4FA6A 4NQLB 2MSED 1WMHA 1WI0A 2NBWB 3V61A 4DHJD 1L2NA 2DZJA 3ENEA 2KQ7A 2CU1A 5CHWA 2MLBA 3DBLI 4N9F4 3WAMA 4MEMA 3ZNID 1GC7A 2ASQA 3NOBA 4GMVA 1M94A 1Q0WB 1SE9A 4MDKE 2WX1A 1ZKHA 1UELA 3T8MA 1PQSA 1V86A 1WX9A 2N9XA 2N4FA 3SDLC 2MA9B 1OQYA 1EF1A 2HTHA 4RM8A 2N1VA 4W9KA 5KHOA 4HCNB 3M63B 1G6JA 2KX3A 1U4AA 3ZNGC 2NBVB 3PTFC 2WX0A 4LDTB 4NPNA 2CHWA 3ZUNA 4EZLA 1I42A 1E5WA 1KM7A 1V80A 2FCMA 2KNBA 2KMAA 2PPHA 2HE7A 3M95A 3Q3FA 4JL9A 4E74A 1MG8A 5LXHA 1TZ1A 2NS5A 3KVFB 4X57B 2ZZPB 4M0WB 3VUYA 2ZPYA 1SIFA 2DENB 1E8WA 1VCBA 2BWFA 1ZW7A 2KZRA 3ML9A 2D11A 1J19A 4F7ZA 4BBNC 3H6NA 2LUEA 2V3SA 4FBJB 3KYDD 3PLUA 4WJQA 5DPRA 3VTVA 3VH4B 2BKFA 2KWCA 1RRBA 1Z5SB 4II3B 4TQ1A 4BKTA 2K8HA 1XT9B 2OOBB 2BYEA 4K7SA 2O6VA 4FHJA 3QHTA 2IYDB 3AXCA 3SD5A 3ZRFA 2WDTB 4GSWA 3LDZE 4AJYB 4BOZB 1UD7A 3SHQA 2HD5B 3ALBA 2M4NA 2MBQA 3APCA 1V9JA 4EFOA 3UINB 4WJNA 4MJSB 4MH0E 2O6VB 1R4MI 1WR6E 2DYOA 4ANXA 3QAQA 2ZNVB 4CO7A 3LJ3A 1OEYJ 2AWTA 3KUCB 1J0GA 3ZDMC 3UQAA 3L0WB 3W1YA 4OVUA 3VQIA 3PRPB 3ML8A 2A4ZA 4FJZA 4IUMB 1YD8U 2NPTA 2XBBC 4AUQC 1WXMA 2PE9A 2LVPA 1R4NI 3S2AA 1WE7A 4WAAA 1C1YB 1XQQA 4ICUA 3ONSA 2KTFA 4HJKA 2NPTB 2J0KA 2FCQA 3QWZB 3VUWA 2LD9A 2MBOA 5CHFA 4F1SA 2KDFB 5L83A 4EZKA 4GDKA 4CYEA 3V60A 2G4DB 2KC2A 1A5RA 2KOXA 4MGYE 1IPGA 4G50A 4K7WA 4B95A 2KFJA 3OAWA 1KJTA 3TL5A 4FJVB 2XEWA 2K8BA 3KUZA 4GDKB 1V2YA 2RD0A 3A4RA 3VXWA 1FXTB 2JZ3B 2LVOA 2MX2A 3A9KA 3WANA 2D10A 4KZCA 1J8CA 2LGXA 5FR6A 3X0WA 2IO1B 1RFAA 3VHTC 3ZNHB 4IW0A 1C3TA 2GMIC 1KOTA 1WGHA 4TKNA 4JQWC 3PHWB 3JW0X 2KDIA 4IM0A 2DX5B 3UIOB 2YLMA 2QHOA 4KIKA 3EHVA 4IC7B 1NBFC 2JXXA 1WH3A 1WZ3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IO3 B;  3ZDT A;  2GBJ A;  2DYM A;  3EEC A;  4AJW A;  3P2B A;  2N1W A;  2ZPN A;  3K9P B;  1TBE A;  1WXS A;  3PLV A;  1SGH A;  3TIX A;  2RR9 A;  4EKU A;  3JYU A;  3ZTD A;  3ZIM A;  2KAN A;  3DVN V;  3DOW A;  1V5T A;  3EC8 A;  2G3Q B;  4I6N B;  4WWP A;  2CHZ A;  2JPH A;  4W9H A;  4BKS D;  2RPQ A;  4MSQ B;  4EZJ A;  1BT0 A;  1P0R A;  5JHA A;  4W9E A;  1V5O A;  1Y8R C;  1IP9 A;  2KJ6 A;  4IG7 B;  2K25 A;  4KSK C;  4ZRI A;  4DK5 A;  2WWZ A;  1WMH B;  4EOY A;  2LJ5 A;  2LXC A;  4GGQ A;  3QX1 A;  4GU2 A;  3VDZ A;  2WYQ A;  4DDG D;  4EUT A;  3K9O B;  4JLC A;  2DZM A;  1E8Y A;  3PZD A;  2KMC A;  4PS8 A;  4JGH B;  3TCA A;  3RD2 A;  2C9W B;  2LWP A;  3DBH I;  5JH5 C;  2K8C A;  3DVN U;  2MCN B;  4HK2 A;  1S1Q B;  2W9N A;  3BIN A;  4URK A;  4B6W A;  2AEH A;  2M17 A;  5AZF A;  2KKC A;  2B3A A;  4PYZ A;  3KW5 B;  2Z0D B;  2AYO B;  3V62 A;  5LXI B;  3N32 A;  1V49 A;  5E6O A;  3UIP B;  3R7Q A;  1WFY A;  3R3M A;  2KDB A;  2L3Z A;  5IA7 A;  2KJR A;  5D6J B;  1P3Q U;  2BWE S;  1H4R A;  3L08 A;  3V6E B;  4BOS C;  2KVR A;  2REX A;  5G2N A;  3BY4 B;  2KFK A;  3L17 A;  2DYB A;  4W9L A;  2D07 B;  2K39 A;  2MBE A;  2JT4 B;  3NZS A;  4ZYN A;  1OTR B;  1WY8 A;  5EDS A;  5DPW A;  2KC1 A;  2JF5 A;  2KFK B;  2C7M B;  3EFU A;  4I6L B;  4IM3 A;  3TMP B;  4HXD A;  5TR5 A;  1Q1O A;  1YX5 B;  4KV2 A;  2IBI B;  4F8C B;  2JRI B;  3U30 A;  2R2O A;  4NJ6 A;  4KSL C;  3PT2 B;  1WIA A;  1EO6 A;  2NVU I;  3HHM A;  1V81 A;  4NQK E;  4GDL A;  3HIZ A;  4WWO A;  5J18 A;  2KLC A;  2Z59 B;  4HPL B;  2KTR A;  3DQV A;  3A4S C;  3VH3 B;  2FIF A;  4ZRK A;  1WGR A;  3OJ3 A;  4XZ4 A;  3DPD A;  1VD2 A;  3AU5 A;  1ISN A;  2JUO A;  2R2Q A;  5DPS A;  4GDL B;  5D7G A;  4BKS A;  4A3P A;  4TV3 A;  2O2V A;  2XK5 A;  5GMV A;  2IO0 B;  1E90 A;  2FID A;  2KWV B;  4MGI E;  2AL3 A;  2G4S A;  4FN2 A;  1WM3 A;  3M62 B;  4DHJ B;  3PRM B;  1WGG A;  3MTN B;  2C7N B;  3A1Q A;  2BKR B;  4FJY A;  3RCZ A;  3ZNZ B;  3GZN I;  2KLG A;  2O2V B;  3KUD B;  2XK5 B;  1XD3 B;  3WAP A;  3ZVV A;  5HKH A;  2JZZ A;  2ZCB A;  2RGF A;  3QQ8 B;  5AEK B;  4ANU A;  3HM3 A;  2ZNV C;  1TTN A;  3PVL A;  1YJ1 A;  5IAA C;  4FUL A;  2KQS A;  3U8Z A;  2MBB B;  3PV1 A;  2J0J A;  1WGD A;  3H1U A;  4PS3 A;  4BVU C;  4AOF A;  4OVV A;  4NJ7 A;  1I35 A;  2LVQ A;  3RUI B;  5DCN A;  2CKH B;  3QC8 B;  4XX5 A;  3VAW A;  2K6Q A;  2VRR B;  4MGZ E;  2M0X A;  4HDQ A;  3PS6 A;  1WXV A;  5E6P A;  3ZTC A;  4DDI D;  2ZCC A;  3MJW A;  4M8N A;  3IBE A;  4IWO A;  1HE8 A;  3WA0 A;  2FUH B;  3A9K B;  4TQ0 A;  3V6C B;  4K7U A;  3PRZ A;  2JWZ A;  3CMM B;  1P1A A;  3B08 A;  1YIW A;  4LCD E;  5D94 A;  4E71 A;  3O65 B;  4BFR A;  3AU4 A;  1EUV B;  3W1S A;  2JY6 A;  1WX8 A;  2KX0 A;  3ZLZ A;  3QA8 A;  1V6E A;  4DHZ B;  1GJZ A;  2KDE B;  1QZE A;  2ZJD A;  1NI2 A;  4WJO A;  2ZVO A;  1WR1 A;  2LRU A;  3B0A A;  3I3T B;  4K81 A;  4KIK B;  4EEW A;  4IWP A;  2I1K A;  2GBR A;  3VFK A;  3APF A;  2K1F A;  3A9J A;  2AL6 A;  2GBN A;  3L13 A;  2PEA A;  4GXB A;  2OJR A;  4GB9 A;  1OEY A;  1WJU A;  2BYF A;  4IWQ A;  2DZI A;  3JSV A;  3D32 A;  3IFW B;  3OJ4 B;  2RSU A;  1UH6 A;  3CST A;  2M8S A;  3SU8 X;  1GG3 A;  2MWS B;  2EMT A;  2UWQ A;  3ECI A;  4J6I A;  3U7D A;  4P7I A;  3QJZ A;  2LXA A;  1E8X A;  2KJH B;  4MEL A;  2NCN A;  1WJ4 A;  2FCS A;  5E6N A;  2C7H A;  3GOE A;  3JSV B;  2EKE C;  4RMA A;  3UF8 A;  4BBN F;  3IG3 A;  1YQB A;  4GIV A;  4K1R B;  3C0R B;  3DVG Y;  3QCA A;  5AZG A;  3ZO5 B;  3W1S C;  2Z0E B;  3VUX A;  2N7E A;  2CS4 A;  3N30 A;  5CTR C;  2L0F A;  3T9L A;  2GBM A;  4WWN A;  2BPS A;  2D3G A;  2L7R A;  4WQO B;  3H7S A;  4A20 A;  1S3S G;  3HK0 A;  4HVB A;  3X23 A;  4HLE A;  3H7P A;  2MQJ A;  4W9G A;  3L10 B;  5CX3 A;  5BO4 B;  2MW5 A;  4GN1 A;  3NHE B;  2IY1 B;  3TJP A;  3R7R A;  5L95 C;  1WXA A;  1GNU A;  1WJN A;  2CR5 A;  5AZH A;  3H7P B;  2L05 A;  2C60 A;  4DXA B;  2Y5B B;  2MP2 A;  1K8R B;  3JVZ X;  1GUA B;  1WE6 A;  4G0N B;  4KDL B;  2N7D A;  4MM3 A;  2V4L A;  5G55 A;  2BYV E;  2BGF A;  3NZU A;  4TUU A;  1YX6 B;  2LI5 A;  2MP2 B;  3H9D A;  4XC2 A;  2LGY A;  5KHQ A;  3QAR A;  4DWF A;  1UBQ A;  3DDC B;  3IVF A;  2MRP A;  3CSF A;  5DPT A;  2JRH A;  2IO2 B;  1Q5W B;  2KXJ A;  4AWJ A;  2MBH A;  3KYC D;  4DHZ E;  2L0T A;  2BF8 B;  3NY5 A;  1IYF A;  3OLM D;  2PE6 B;  3NS8 A;  1WGY A;  4KVG B;  5J2R A;  2L00 B;  1LXD A;  4E3C A;  4FLH A;  4NY0 A;  1P98 A;  2KD0 A;  4MJS A;  4W9J A;  3RYT A;  3ZKJ C;  2K6D B;  4WJP A;  3WAL A;  2KTR B;  4BKG A;  1UGM A;  3DBS A;  1OGW A;  4RM9 A;  3PGE A;  5C1Z A;  3RUL A;  1WX7 A;  4I6P A;  2LRW A;  1CMX B;  4PS7 A;  1WF9 A;  4HCP B;  4A3O A;  3TBL D;  4CHK A;  3A33 B;  2IZV B;  2KWU B;  2A5U A;  1E7U A;  4MGK E;  4KZ0 A;  5J17 A;  2DAF A;  2KHW B;  3KH0 A;  2J0M A;  3B1L X;  2NBU A;  3RZF A;  4W9D A;  4HWI B;  5LLI A;  3A1Q B;  3M3J A;  2KN5 A;  3PHX B;  2PJH A;  4KDI C;  4DBG A;  2V1Y A;  4HDO A;  1WYW B;  4IM2 A;  4YL8 A;  1GC6 A;  4LDT D;  1D3Z A;  1WZ0 A;  1TGZ B;  4W9F A;  3ZW3 A;  2CHX A;  4FAD A;  2FNJ B;  3MHS D;  4MSM B;  1LM8 B;  4ANV A;  4B9K A;  2EMS A;  1WM2 A;  2DZK A;  2HJ8 A;  2C5L C;  4NAW A;  4LJP B;  3N3K B;  4AP4 C;  2NR2 A;  2FAZ A;  2IY0 B;  3DBR I;  4ICV A;  3L54 A;  3VVW B;  4ZRJ A;  1WRD B;  1WJ6 A;  2GOW A;  3UGB B;  2YVC A;  1F9J A;  5D2M B;  3QK0 A;  3VTU A;  2UYZ B;  3AUL A;  4G3X B;  2JVC A;  2D2Q A;  2KK8 A;  4NAW B;  2N9E B;  4PYU A;  3UQB A;  4W9I A;  5JZE B;  1P9D U;  2KO3 A;  4ASW C;  1RAX A;  3AI5 A;  1H8C A;  2ZVN A;  1LFD A;  1X1M A;  3DCG A;  2ZEQ A;  1E8Z A;  3PRE A;  4M8M A;  4W9C A;  5CHV C;  3DVG X;  3VTW A;  1T0Y A;  1KLV A;  2N9P C;  2I1J A;  2G45 B;  3APD A;  2GBK A;  3QIJ A;  1RLF A;  2L76 A;  1LQB A;  2M1M A;  4II2 B;  5C23 A;  2DAJ A;  3CF6 E;  3WIM A;  2J7Q B;  1EF5 A;  2O6V D;  4ANW A;  1E7V A;  3IHP C;  1JRU A;  1NDD A;  1UBI A;  4NNJ B;  2DHZ A;  4FHK A;  2LGD A;  3R66 C;  5JHB A;  4JIO U;  1AAR A;  3A9J B;  3PSE B;  2L8J A;  3RT3 B;  3RZW C;  2FCN A;  2LZ6 A;  2LAS A;  3HM6 X;  4LJO B;  1Z2M A;  1ZGU B;  3PPA A;  3Q3J A;  4HPM B;  4ZDV A;  3WAO A;  1L7Y A;  3L16 A;  4G11 A;  4GOC A;  3ZRC A;  1UZX B;  4FA6 A;  4NQL B;  2MSE D;  1WMH A;  1WI0 A;  2NBW B;  3V61 A;  4DHJ D;  1L2N A;  2DZJ A;  3ENE A;  2KQ7 A;  2CU1 A;  5CHW A;  2MLB A;  3DBL I;  4N9F 4;  3WAM A;  4MEM A;  3ZNI D;  1GC7 A;  2ASQ A;  3NOB A;  4GMV A;  1M94 A;  1Q0W B;  1SE9 A;  4MDK E;  2WX1 A;  1ZKH A;  1UEL A;  3T8M A;  1PQS A;  1V86 A;  1WX9 A;  2N9X A;  2N4F A;  3SDL C;  2MA9 B;  1OQY A;  1EF1 A;  2HTH A;  4RM8 A;  2N1V A;  4W9K A;  5KHO A;  4HCN B;  3M63 B;  1G6J A;  2KX3 A;  1U4A A;  3ZNG C;  2NBV B;  3PTF C;  2WX0 A;  4LDT B;  4NPN A;  2CHW A;  3ZUN A;  4EZL A;  1I42 A;  1E5W A;  1KM7 A;  1V80 A;  2FCM A;  2KNB A;  2KMA A;  2PPH A;  2HE7 A;  3M95 A;  3Q3F A;  4JL9 A;  4E74 A;  1MG8 A;  5LXH A;  1TZ1 A;  2NS5 A;  3KVF B;  4X57 B;  2ZZP B;  4M0W B;  3VUY A;  2ZPY A;  1SIF A;  2DEN B;  1E8W A;  1VCB A;  2BWF A;  1ZW7 A;  2KZR A;  3ML9 A;  2D11 A;  1J19 A;  4F7Z A;  4BBN C;  3H6N A;  2LUE A;  2V3S A;  4FBJ B;  3KYD D;  3PLU A;  4WJQ A;  5DPR A;  3VTV A;  3VH4 B;  2BKF A;  2KWC A;  1RRB A;  1Z5S B;  4II3 B;  4TQ1 A;  4BKT A;  2K8H A;  1XT9 B;  2OOB B;  2BYE A;  4K7S A;  2O6V A;  4FHJ A;  3QHT A;  2IYD B;  3AXC A;  3SD5 A;  3ZRF A;  2WDT B;  4GSW A;  3LDZ E;  4AJY B;  4BOZ B;  1UD7 A;  3SHQ A;  2HD5 B;  3ALB A;  2M4N A;  2MBQ A;  3APC A;  1V9J A;  4EFO A;  3UIN B;  4WJN A;  4MJS B;  4MH0 E;  2O6V B;  1R4M I;  1WR6 E;  2DYO A;  4ANX A;  3QAQ A;  2ZNV B;  4CO7 A;  3LJ3 A;  1OEY J;  2AWT A;  3KUC B;  1J0G A;  3ZDM C;  3UQA A;  3L0W B;  3W1Y A;  4OVU A;  3VQI A;  3PRP B;  3ML8 A;  2A4Z A;  4FJZ A;  4IUM B;  1YD8 U;  2NPT A;  2XBB C;  4AUQ C;  1WXM A;  2PE9 A;  2LVP A;  1R4N I;  3S2A A;  1WE7 A;  4WAA A;  1C1Y B;  1XQQ A;  4ICU A;  3ONS A;  2KTF A;  4HJK A;  2NPT B;  2J0K A;  2FCQ A;  3QWZ B;  3VUW A;  2LD9 A;  2MBO A;  5CHF A;  4F1S A;  2KDF B;  5L83 A;  4EZK A;  4GDK A;  4CYE A;  3V60 A;  2G4D B;  2KC2 A;  1A5R A;  2KOX A;  4MGY E;  1IPG A;  4G50 A;  4K7W A;  4B95 A;  2KFJ A;  3OAW A;  1KJT A;  3TL5 A;  4FJV B;  2XEW A;  2K8B A;  3KUZ A;  4GDK B;  1V2Y A;  2RD0 A;  3A4R A;  3VXW A;  1FXT B;  2JZ3 B;  2LVO A;  2MX2 A;  3A9K A;  3WAN A;  2D10 A;  4KZC A;  1J8C A;  2LGX A;  5FR6 A;  3X0W A;  2IO1 B;  1RFA A;  3VHT C;  3ZNH B;  4IW0 A;  1C3T A;  2GMI C;  1KOT A;  1WGH A;  4TKN A;  4JQW C;  3PHW B;  3JW0 X;  2KDI A;  4IM0 A;  2DX5 B;  3UIO B;  2YLM A;  2QHO A;  4KIK A;  3EHV A;  4IC7 B;  1NBF C;  2JXX A;  1WH3 A;  1WZ3 A; 
#chains in the Genus database with same CATH topology
 2NTT A;  4HEA 1;  3P2B A;  2ZPN A;  2AQ3 B;  1PGB A;  1TBE A;  1SGH A;  4PK1 A;  4GLS C;  3ZIM A;  3NVW A;  3DOW A;  1V5T A;  3PZ8 A;  3EC8 A;  4JWS C;  2G3Q B;  4WWP A;  2CHZ A;  5JHA A;  2HDE A;  1V5O A;  3U4E G;  4KSK C;  1JCK B;  2LXC A;  1ET9 A;  2WDQ B;  4JLC A;  1D4B A;  3DBH I;  2K8C A;  1S1Q B;  2W9N A;  1JML A;  4URK A;  4B6W A;  2AEH A;  1B1Z A;  2Z0D B;  1STE A;  3V62 A;  2PIA A;  3Q8B A;  5E6O A;  3R7Q A;  2BB6 A;  2KDB A;  5D6J B;  2BWE S;  1F77 A;  1FO4 A;  4LLG M;  3L17 A;  2BBC A;  1TS3 A;  4BZA A;  4W9L A;  2D07 B;  4LNO A;  2G9H D;  4ZYN A;  4YSX B;  3BWU D;  5EDS A;  3MHZ A;  2JF5 A;  2C7M B;  2Y5P A;  2R2O A;  2NVU I;  3HIZ A;  4HPL B;  2IGG A;  4XZ4 A;  2R61 A;  5DPS A;  2L32 A;  4BKS A;  1ZPS A;  4BAX A;  2BTE A;  4TSS A;  2WDV B;  2FID A;  1Y56 A;  4MGI E;  1FXA A;  4FN2 A;  3PRM B;  1WGG A;  3GZN I;  3ZVV A;  1JWS D;  2QDF A;  2JZZ A;  2ZCB A;  2RGF A;  3HM3 A;  5G5H A;  3J9C A;  3HRD D;  2QJL A;  2Q5W D;  2J0J A;  3H1U A;  2IJ0 A;  1I35 A;  2L83 A;  3RUI B;  5DCN A;  2K6Q A;  4MGZ E;  4DDI D;  4MAC A;  3IBE A;  4TQ0 A;  3V6C B;  2V9H A;  4LCD E;  3B08 A;  4ITK A;  4BFR A;  2JY6 A;  1WX8 A;  4WAF A;  4JE3 B;  1GJZ A;  2ZVO A;  2Y3A A;  1DGJ A;  3B0A A;  3I3T B;  4EEW A;  1M4V A;  1YJJ A;  4IWP A;  3VFK A;  3APF A;  2K1F A;  3A9J A;  2OJW A;  2AL6 A;  3ZQ4 A;  2PEA A;  5C3J B;  4KGT A;  1WJU A;  2MJ3 A;  3OJ4 B;  3ECI A;  4J6I A;  5HFY A;  4P7I A;  4R3D A;  3QJZ A;  1I4R A;  1E8X A;  2KJH B;  5D3I B;  1WJ4 A;  5E6N A;  4RMA A;  4BBN F;  4K1R B;  3C0R B;  4KGR A;  2WXO A;  2N7E A;  2CS4 A;  3C8Y A;  1P7F A;  4HVB A;  5CX3 A;  5BO4 B;  3AE7 B;  3TJP A;  3ETR A;  4N58 A;  5IN7 A;  1GNU A;  2L05 A;  4DXA B;  2Y5B B;  1GUA B;  5H92 C;  1PYW D;  2N7D A;  2JWU A;  3RNB C;  2V4L A;  1SXT A;  2BYV E;  1QLB B;  1LO5 D;  3H9D A;  2WXR A;  4XC2 A;  2PW9 A;  3RNG C;  1D5M C;  3CSF A;  3NUH B;  1VZ8 A;  4HJG E;  3MC8 A;  5EE0 A;  2KXJ A;  4DHZ E;  2BYT A;  1V1P A;  3NS8 A;  2L00 B;  3KLS X;  4FLH A;  3P63 A;  2DNF A;  4NY0 A;  4W9J A;  3PO0 A;  3ZKJ C;  1FIQ A;  1FNU A;  1QOA A;  4RM9 A;  5C1Z A;  1V1P B;  3NVV A;  2J53 A;  1C77 A;  1PDX A;  1E7U A;  2WXG A;  4L1B A;  2DAF A;  2KHW B;  3RZF A;  4W9D A;  2K22 A;  5LLI A;  3A1Q B;  3M3J A;  2KN5 A;  4M02 A;  1TKG A;  4AS1 A;  5GXG B;  3AH7 A;  1CZP A;  1WZ0 A;  3AEB B;  1RM6 C;  2CHX A;  2INC C;  4FAD A;  4MSM B;  4B9K A;  2EMS A;  2BB5 A;  2IY0 B;  2GOW A;  1F9J A;  2Z8L A;  3RPF C;  2JVC A;  2KK8 A;  5FKA C;  2QEJ C;  4XWW A;  1RAX A;  2ZVN A;  1TS5 A;  4W9C A;  3PRE A;  3DVG X;  3VTW A;  1T0Y A;  2N9P C;  5C23 A;  4ANW A;  3RNC C;  3WIM A;  1E7V A;  3IHP C;  1JRU A;  3BVG A;  4K3C A;  1UBI A;  1IUE A;  4JIO U;  2J42 A;  1E0Z A;  2FCN A;  2LZ6 A;  1JWB D;  4LNF A;  2LAS A;  3VR9 B;  1FD6 A;  3L16 A;  2YEP B;  1K50 A;  5EE1 A;  1WMH A;  3Q3N C;  2QIL A;  3W5U B;  2DZJ A;  2KQ4 X;  5CHW A;  1SF0 A;  3V3X A;  1EWY C;  1M94 A;  4MDK E;  2INN E;  3T8M A;  1V86 A;  3CIR B;  1ACC A;  2N4F A;  1UWX A;  3FKY A;  1OQY A;  1EF1 A;  4UDU C;  4RM8 A;  1QQR A;  1U4A A;  2NBV B;  4LDT B;  4MT5 A;  3ZUN A;  4EZL A;  1E5W A;  1TIF A;  4E74 A;  2PPH A;  3M95 A;  3Q3F A;  1ZXI A;  2D3C A;  1QOG A;  2WNM A;  2LHE A;  2ZZP B;  1JQ4 A;  1XO3 A;  2DEN B;  1E8W A;  1IBX A;  3ML9 A;  2D11 A;  1J19 A;  4BBN C;  5BMG A;  1ROE A;  4FBJ B;  4WJQ A;  3VH4 B;  1Z5S B;  1YJI A;  2DLB A;  1IBX B;  3ZRF A;  1I4G A;  4GSW A;  4M01 A;  4AJY B;  4BOZ B;  1JWA D;  2HD5 B;  3ALB A;  1YQ3 B;  3AE1 B;  4EFO A;  2ICI A;  4MH0 E;  3KWL A;  2ZNV B;  4WQM A;  2AWT A;  3KUC B;  1J0G A;  3UQA A;  5HG2 A;  4OVU A;  3GB1 A;  3ML8 A;  1FRR A;  2A4Z A;  1YD8 U;  1TY2 A;  3SEB A;  3TSS A;  1HZ6 A;  1WSP A;  3AEE B;  4HJK A;  3VUW A;  2FCQ A;  1L6V A;  1WGK A;  4A55 A;  3V60 A;  3L4P A;  4G50 A;  4B95 A;  1KRH A;  4S17 A;  2IDY A;  2RDH A;  2CJN A;  3TL5 A;  5FR3 A;  1D5Z C;  3KUZ A;  1N60 A;  1V2Y A;  4C56 C;  3A4R A;  3VXW A;  1FXT B;  2LVO A;  3A9K A;  3X0W A;  3KWV A;  5IP4 D;  4IW0 A;  1KOT A;  4JQW C;  2V4I B;  3GZN B;  4IM0 A;  3Q2A C;  1DOI A;  4IC7 B;  1NBF C;  2IO3 B;  2GBJ A;  4LNN A;  3EEC A;  3AEG B;  1XLO A;  2N1W A;  3FC4 A;  3K9P B;  1WXS A;  2MJE A;  2NMQ A;  4YTP B;  2DBY A;  4EKU A;  3JYU A;  3P4R B;  3BYT B;  3DVN V;  1AYF A;  3ZYY X;  4BKS D;  2JPH A;  4W9H A;  4MSQ B;  1P0R A;  1IP9 A;  4W9E A;  3MC9 A;  1E6E B;  4IG7 B;  2K25 A;  2TSS A;  4ZRI A;  4EOY A;  2LJ5 A;  4GGQ A;  3QX1 A;  4GU2 A;  4DDG D;  2WYQ A;  2M0A A;  4IOI E;  1AN8 A;  3GS2 A;  4DXG A;  4EE2 A;  4H2A A;  2DZM A;  1VJK A;  3PZD A;  2KMC A;  3RD2 A;  3DVN U;  4HK2 A;  4NZL B;  1SE3 A;  2AYO B;  4WUR A;  2K0P A;  2MJD A;  2G1E A;  3R3M A;  2BS4 B;  1SIJ A;  2GRI A;  1F0Z A;  2KJR A;  1P3Q U;  3V6E B;  2KVR A;  5G2N A;  2KFK A;  1ENF A;  1XCT L;  1KLG D;  2JT4 B;  3NZS A;  2W55 A;  1WY8 A;  5DPW A;  2KFK B;  4HXD A;  3U52 E;  1Q1O A;  1YX5 B;  4KV2 A;  2IBI B;  2JRI B;  3DBL B;  4KSL C;  1WIA A;  1EO6 A;  3R2I A;  1DYQ A;  4P16 A;  1V81 A;  4M00 A;  4KKI A;  2KTR A;  3DQV A;  4JPS A;  2FIF A;  4ZRK A;  4XWT A;  1WGR A;  3OJ3 A;  1I4Q A;  3AU5 A;  1ISN A;  2R2Q A;  5D7G A;  4A9A A;  2XK5 A;  5GMV A;  4ARC A;  4A90 A;  2IO0 B;  4N59 A;  2G4S A;  2LJI A;  1L5P A;  3RCZ A;  3BZD B;  2XK5 B;  1XF5 L;  3WCQ A;  3C19 A;  1JAL A;  1FM0 D;  3QQ8 B;  2ZNV C;  4C7Z A;  1FNV A;  3U8Z A;  2EKI A;  2MBB B;  1A70 A;  4NJ7 A;  1SEB D;  2LVQ A;  3QC8 B;  2VRR B;  4QAY A;  1I7H A;  2M0X A;  4HDQ A;  1WXV A;  5E6P A;  3ZTC A;  3MJW A;  3WA0 A;  5D94 A;  1P1A A;  3SFD B;  3SFE B;  2KX0 A;  3ZLZ A;  3QA8 A;  1V6E A;  3DWG C;  4DQO C;  2KAJ A;  1FRD A;  2GBR A;  2GBN A;  4GB9 A;  1OQR A;  2DZI A;  3JSV A;  3D32 A;  3U7D A;  2EMT A;  2UWQ A;  3IT4 B;  1MI0 A;  4OHJ A;  3R2T A;  2FCS A;  3JSV B;  2EKE C;  3UF8 A;  5BMI A;  3IG3 A;  1YQB A;  1NEN B;  4GIV A;  3QCA A;  3NJT A;  2Z0E B;  3N30 A;  3Q6B A;  1FEH A;  2GBM A;  4JX1 C;  2D3G A;  3AEC B;  2L7R A;  4WQO B;  1S3S G;  2JXT A;  4HLE A;  1BUI C;  3R7R A;  1T5X D;  3Q69 A;  3DWM A;  1QKZ A;  1K8R B;  4HKZ E;  4MM3 A;  1KLU D;  3NZU A;  5IKC M;  1YX6 B;  1YN5 A;  2LI5 A;  5KHQ A;  1PGA A;  3FIL A;  2VH2 A;  4MM3 B;  4ACF A;  1HZ5 A;  4AWJ A;  2L0T A;  3MFG A;  2PE6 B;  4KVG B;  2MH7 A;  3FIL B;  2WQY B;  4MJS A;  3WAL A;  1E7P B;  1UGM A;  3DBS A;  2M56 B;  1OGW A;  3AM9 A;  4ZHO A;  1WF9 A;  4A3O A;  3BK1 A;  1T3Q A;  2KWU B;  2A5U A;  2MHJ A;  3OWE B;  4KZ0 A;  5AUI A;  5J17 A;  1N6Z A;  3KH0 A;  5IOI A;  1Q10 A;  1MJD A;  1N5X A;  4P1B C;  4LDT D;  2W54 A;  4W9F A;  3NVY A;  4ANV A;  2DZK A;  3VRB B;  4LJP B;  4ICV A;  1J7B A;  1F2R C;  3BYY B;  3B9J A;  3VTU A;  3KQ4 A;  4G3X B;  2D2Q A;  1FMA D;  2N9E B;  3UQB A;  5JZE B;  1P9D U;  4WWM A;  3RI7 C;  3IXS A;  1LFD A;  3DCG A;  2ZEQ A;  2VZK B;  2I1J A;  2G45 B;  4CQN A;  1GB1 A;  2ZW1 A;  3CF6 E;  3RNA C;  3EA6 A;  4NNJ B;  2LGD A;  1SE2 A;  3BVM A;  3I57 A;  3A9J B;  4OW0 A;  3N9Y C;  3RT3 B;  3RZW C;  4LJO B;  4HPM B;  3Q3J A;  1WXQ A;  4FA6 A;  1JW9 D;  3LB8 C;  4DHJ D;  5C2T B;  5FK9 C;  2KQ7 A;  3DBL I;  3WAM A;  1YN3 A;  2LGS A;  1GC7 A;  4GMV A;  1UEL A;  2MA9 B;  4ZYS A;  4W9K A;  4HCN B;  5BYQ A;  4ZRQ A;  3ZNG C;  3PTF C;  1CQV A;  1RFK A;  4M0W A;  2KMA A;  4JL9 A;  1NEK B;  4L2Y A;  1C4C A;  5MPO A;  5LXH A;  1TZ1 A;  2E6X A;  2NS5 A;  1MHH E;  4X57 B;  4M0W B;  3VUY A;  1T0R C;  2BVC A;  1ZW7 A;  2V3P A;  1I4H A;  1I4P A;  3VTV A;  2BKF A;  1VRA B;  4II3 B;  4RCO A;  4BKT A;  3O13 A;  1XT9 B;  2OOB B;  1FFV A;  2O6V A;  3QHT A;  2PMV A;  2PVO D;  1UGJ A;  4XGA B;  2MBQ A;  4YTN B;  3LYY A;  3V05 A;  3UIN B;  2O6V B;  1WR6 E;  1KFY B;  2DYO A;  2VH1 A;  3L0W B;  3W1Y A;  1EM7 A;  3PRP B;  2SAK A;  2H88 B;  2NPT A;  2PE9 A;  1C78 A;  3P4Q B;  1WE7 A;  1ZXH A;  2RMM A;  4ICU A;  3ONS A;  2NPT B;  2BS3 B;  2V3N A;  5IO9 A;  2JZP A;  1NI3 A;  5CHF A;  1WWT A;  2KDF B;  3AED B;  2RPV A;  1A5R A;  2KOX A;  4MGY E;  3AE2 B;  1IPG A;  4O1N A;  2XEW A;  2K8B A;  2FUG 1;  3UI3 A;  2JZ3 B;  2MX2 A;  2D10 A;  2LGX A;  1XLQ A;  1ESF A;  5EE3 A;  1L4Z B;  1WGH A;  1YMH E;  2SEB D;  4RFB A;  2WGS A;  3N1X C;  1PUT A;  3Q14 C;  2QHO A;  5G5G A;  4C7Y A;  4KIK A;  4WWO A;  1XLN A;  2DYM A;  1MHX A;  4US9 A;  1DOY A;  1TZO A;  4K3B A;  2RR9 A;  3T3O A;  3ZTD A;  1MFW A;  1JRO A;  1B9R A;  4EZJ A;  2RPQ A;  2ONQ A;  2KJ6 A;  3RNE C;  2WWZ A;  1WMH B;  4RGM A;  3AE6 B;  5H8Y E;  4EUT A;  2LGI A;  3K9O B;  1E8Y A;  2LUM A;  2C9W B;  2LWP A;  5JH5 C;  2MCN B;  1YQ4 B;  1TS4 A;  3N20 C;  2KN4 A;  2XNA C;  2KKC A;  2B3A A;  4PYZ A;  3KW5 B;  1C4P A;  1ZP0 B;  4YTM B;  5LXI B;  4ZRP A;  3AB5 A;  2KMM A;  1V97 A;  3BK2 A;  5IA7 A;  2N7J A;  3U7Z A;  1MG4 A;  2DYB A;  4B0E A;  2K39 A;  2MBE A;  3SR6 A;  3P4S B;  5LNK 1;  1HQR D;  3AMZ A;  4I6L B;  3EFU A;  3TMP B;  5TR5 A;  1WRI A;  3VRA B;  2HTM E;  5BMH A;  5BYS A;  4KX6 B;  4GDL A;  2EEL A;  2KLC A;  2Z59 B;  3Q8C A;  1R7S A;  3IAS 1;  1TKE A;  1E9M A;  2JYE A;  1HTQ A;  4GDL B;  3ZJT A;  2J52 A;  4A3P A;  4TV3 A;  3RMK C;  2O2V A;  1FPY A;  1K51 A;  4OZB A;  4DHJ B;  4FJY A;  2BKR B;  3ZNZ B;  2KLG A;  2O2V B;  2GB1 A;  1XD3 B;  3WAP A;  2WP9 B;  1C4A A;  5AEK B;  1TTN A;  1L0X B;  1N62 A;  1YJ1 A;  4YT0 B;  1FFU A;  4FUL A;  3DHI C;  3PV1 A;  1WGD A;  4FXC A;  4BVU C;  2WU5 B;  4PS3 A;  2CKH B;  1XEE A;  2W82 A;  4XX5 A;  1BML C;  1KF6 B;  2I2Y A;  1AW7 A;  1GAQ B;  2FUH B;  3A9K B;  1T0S C;  3CMM B;  4OVZ A;  2QIE B;  3O65 B;  1LGR A;  3AU4 A;  3Q8E A;  1QIL A;  2WXF A;  1V8C A;  2WXQ A;  2J4X A;  1EWC A;  1NI2 A;  4NJC A;  4WJO A;  1WR1 A;  2LRU A;  2BT6 A;  1R4N B;  1AWD A;  3E9S A;  1L0Y B;  1XCQ L;  2KDM A;  3L13 A;  4GXB A;  1OEY A;  1TKY A;  4HRS A;  4RH6 A;  2WU2 B;  2RSU A;  1UH6 A;  2M8S A;  3SU8 X;  2MWS B;  2LXA A;  4MEL A;  3GOE A;  4RF1 A;  3TEZ A;  3B2G A;  4XE0 A;  5HHD G;  3ZO5 B;  5AZG A;  3W1S C;  3VUX A;  2L0F A;  3H8H A;  2L1A A;  2OED A;  5I4D A;  4A20 A;  3HK0 A;  4W9G A;  2MQJ A;  3L10 B;  3AE8 B;  2MW5 A;  2OHF A;  2D3A A;  3B2F A;  5AZH A;  2CR5 A;  3JVZ X;  2ACZ B;  2VZK D;  5G55 A;  2BGF A;  4TUU A;  3AEF B;  2LGY A;  4OZC A;  3QAR A;  4DWF A;  1UBQ A;  3DDC B;  1UWM A;  2MRP A;  5DPT A;  2IO2 B;  4KKJ A;  2MBH A;  1SJH D;  3NY5 A;  1IYF A;  3OLM D;  1N61 A;  4WH4 A;  5J2R A;  4E3C A;  4OZA A;  1P98 A;  2KD0 A;  2WXN A;  3N1Y C;  2K6D B;  4WJP A;  2KTR B;  3PGE A;  3RUL A;  3ZXV A;  1CMX B;  4PS7 A;  4US8 A;  2KWD A;  4LTU A;  3TBL D;  3A33 B;  2IZV B;  3CWI A;  4MGK E;  3ZJV A;  2NBU A;  1SB3 C;  4NAM A;  4USA A;  4HWI B;  5AUK A;  1F52 A;  3PHX B;  4KDI C;  4DBG A;  4IM2 A;  1TGZ B;  1F1H A;  2FNJ B;  3MHS D;  3GE3 C;  4HKQ A;  1WM2 A;  2PKO A;  1I4X A;  2C5L C;  4NAW A;  4AP4 C;  3N3K B;  2FAZ A;  5HI1 A;  4ZRJ A;  1J7A A;  1WJ6 A;  3NVZ A;  1MVK A;  3UGB B;  2PLP A;  2YVC A;  5D2M B;  3QK0 A;  5JXV A;  2UYZ B;  2RDB C;  4NAW B;  3LXF A;  4PYU A;  4ZOH C;  1KTK A;  2HJ1 A;  4J3O D;  2KO3 A;  4M8M A;  4XDD A;  1QT9 A;  4MH8 A;  1SBB B;  3QIJ A;  2DAJ A;  1HA5 A;  2J7Q B;  1EF5 A;  2O6V D;  2W3S A;  2GI9 A;  1SJE D;  5JHB A;  3PSE B;  1HEZ E;  2L8J A;  2BS2 B;  1Z2M A;  1ZGU B;  3TEX A;  2D5G A;  4RGN A;  1JWU D;  2JQR B;  3WAO A;  1L7Y A;  2WXL A;  1UZX B;  4NQL B;  2MSE D;  1WI0 A;  3V61 A;  3ENE A;  2CU1 A;  3W9C B;  4P6V F;  4N9F 4;  4MEM A;  3NOB A;  1Q0W B;  1SE9 A;  1SE4 A;  1PQS A;  2JX5 A;  1WX9 A;  2N9X A;  3SDL C;  3RN9 C;  1K53 A;  2M19 A;  4IKG A;  1BXT A;  1G6J A;  1XLP A;  3AE4 B;  2CHW A;  1EU3 A;  2W3R A;  1V80 A;  2FCM A;  1IGD A;  1VDV A;  3AE5 B;  1MPE A;  3KVF B;  2BQQ A;  1VCB A;  2IGH A;  2KZR A;  3DHH C;  4F7Z A;  4JWU C;  1IGC A;  3H6N A;  3KYD D;  3PLU A;  5DPR A;  2IGD A;  2KWC A;  3Q8F A;  2AX5 A;  3AE3 B;  1TJE A;  2K8H A;  1YN4 A;  1TT5 B;  2QC8 A;  4FHJ A;  1L4D B;  1TYG B;  2IYD B;  3SD5 A;  3Q8A A;  2UU7 A;  3LDZ E;  3SHQ A;  2M4N A;  2PTL A;  1WYG A;  2AQ2 B;  4MJS B;  3VR8 B;  3DHG C;  1L0V B;  1VZ7 A;  1V1O A;  2NTS A;  3P4P B;  3VQI A;  2QMT A;  4FJZ A;  4IUM B;  1YOV B;  2XBB C;  4AUQ C;  1WXM A;  5E6J A;  2LVP A;  1R4N I;  4C00 A;  2WS3 B;  4WIP A;  1JWM D;  1C1Y B;  1XQQ A;  2J0K A;  3QWZ B;  2MBO A;  4F1S A;  5L83 A;  4EZK A;  4LK0 M;  4GDK A;  5TSS A;  3IT6 B;  1ZDV A;  2G4D B;  3AV8 A;  3HUI A;  4DXF A;  3OAW A;  4GDK B;  2WLB A;  4LNK A;  4KZC A;  2IO1 B;  1RFA A;  2GMI C;  3JW0 X;  2KVZ A;  4ZHP A;  2DX5 B;  1GOZ A;  3Q3M C;  3EHV A;  3ZW3 A;  1WZ3 A;  3ZDT A;  1ZOY B;  3T3N A;  4AJW A;  3PLV A;  3BVZ A;  3TIX A;  2KAN A;  4IDI A;  2KAC A;  2WXJ A;  4I6N B;  1BT0 A;  1Y8R C;  3DBR B;  4RGT A;  4DK5 A;  2K3U A;  2N9L A;  3VDZ A;  1ET6 A;  2DWQ A;  4PS8 A;  3TCA A;  4JGH B;  3BII D;  1C76 A;  5T8I A;  1UNS A;  2E3T A;  3BIN A;  2M17 A;  5AZF A;  1F2R I;  1V49 A;  3N32 A;  3UIP B;  1WFY A;  2L3Z A;  3RFZ B;  2V0G A;  1H4R A;  3L08 A;  4BOS C;  2REX A;  3NG0 A;  3BY4 B;  3E56 A;  4ARI A;  3ABV B;  4RF0 A;  2X8X X;  4HPP A;  1CK1 A;  1OTR B;  3AE9 B;  2KC1 A;  4IM3 A;  3AN1 A;  4F8C B;  1N5W A;  3U30 A;  4NJ6 A;  3PT2 B;  4YSZ B;  1NYQ A;  3P1M A;  3HHM A;  4NQK E;  5J18 A;  3VH3 B;  2PVG C;  3A4S C;  3NRZ A;  1ZDX A;  2LMC A;  3DPD A;  3ZXR A;  2ON8 A;  1VD2 A;  2JUO A;  3MJ5 A;  3EFC A;  1E90 A;  2KWV B;  3IAM 1;  2AL3 A;  1WM3 A;  3M62 B;  3MTN B;  2C7N B;  3A1Q A;  1GPX A;  3I5J C;  3KUD B;  4KGS A;  5HKH A;  1FCC C;  2QCZ A;  4ANU A;  1FNW A;  1C79 A;  2IND C;  3PVL A;  5IAA C;  2XN9 C;  1QOF A;  2KQS A;  4AOF A;  4OVV A;  2JYT A;  2H89 B;  4D2K A;  3VAW A;  2BW2 A;  1ZUD 2;  1QOB A;  3PS6 A;  2ZCC A;  4M8N A;  4S0R A;  4IWO A;  1HE8 A;  1R4M B;  4K7U A;  3PRZ A;  2JWZ A;  1UUP A;  1YIW A;  3EUB 2;  5D3D A;  4E71 A;  1EUV B;  3W1S A;  1K52 A;  1RWS A;  4RGO S;  4DHZ B;  2KDE B;  4YXD B;  1QZE A;  2ZJD A;  4K81 A;  4KIK B;  3FAH A;  2I1K A;  3MP9 A;  4XDC A;  1D6E C;  2YEP F;  3NS1 A;  2OJR A;  4RNA A;  2BYF A;  4IWQ A;  3GE8 C;  2L52 A;  3IFW B;  3CST A;  1GG3 A;  2D3B A;  2KT7 A;  2WXK A;  1P7E A;  3GP7 A;  2NCN A;  2C7H A;  1ZE3 D;  3TEY A;  2KYW A;  4HRO A;  3DVG Y;  5CTR C;  3T9L A;  4WWN A;  2BPS A;  2CU3 A;  2B76 B;  3H7S A;  4YSY B;  3X23 A;  3H7P A;  4GN1 A;  1T6B X;  3NHE B;  2IY1 B;  4AQ7 A;  2WXH A;  3N1Z C;  5L95 C;  1WXA A;  1WJN A;  1GB4 A;  3H7P B;  2C60 A;  1KH0 A;  2MP2 A;  3U2S C;  1WE6 A;  4G0N B;  4KDL B;  1T0Q C;  2MP2 B;  3IVF A;  1XXG A;  2JRH A;  3I63 C;  1Q5W B;  2LFI A;  4YWG G;  3TEW A;  3KYC D;  2BF8 B;  1WGY A;  2WDR B;  1LXD A;  2INP E;  1OQQ A;  2JU6 X;  2FBW B;  3RYT A;  3DBH B;  4BKG A;  4L23 A;  1WX7 A;  4I6P A;  2LRW A;  4HCP B;  4CHK A;  3MC0 B;  2J0M A;  1N63 A;  3B1L X;  1C9F A;  2PJH A;  2V1Y A;  2K9X A;  4HDO A;  1WYW B;  4YL8 A;  1GC6 A;  1D3Z A;  2RDG A;  2IPK D;  4PT5 A;  1LM8 B;  2HJ8 A;  2N0S B;  3I9V 1;  2NR2 A;  3DBR I;  3L54 A;  3VVW B;  4TMA B;  1WRD B;  2CJO A;  1PFD A;  2MEK A;  2Y5C A;  3AUL A;  4B0M A;  2FE8 A;  3HVD A;  4W9I A;  4ASW C;  2X38 A;  3AI5 A;  1H8C A;  1X1M A;  1E8Z A;  5CHV C;  1KLV A;  3APD A;  2GBK A;  1RLF A;  2L76 A;  1HXY D;  1LQB A;  2M1M A;  4II2 B;  1VLB A;  1NDD A;  3R8B A;  4XYC A;  2DHZ A;  4FHK A;  3R66 C;  1AAR A;  4C4V A;  2GLS A;  3HM6 X;  3ZGZ A;  3PPA A;  4ZDV A;  2LHD A;  4G11 A;  2JSV X;  4GOC A;  1D5X C;  3W2D A;  3ZRC A;  4C4V B;  2NBW B;  1L2N A;  2I38 A;  1VZ6 A;  1TY0 A;  2MLB A;  3ZNI D;  2ASQ A;  2WX1 A;  1ZKH A;  3AEA B;  3NZ3 A;  2WHI A;  1L6U A;  2HTH A;  2N1V A;  1UF0 A;  5KHO A;  2ZW0 A;  3M63 B;  2KX3 A;  3RNF C;  2WX0 A;  4NPN A;  4A8X C;  1I42 A;  1KM7 A;  2K5P A;  2KNB A;  1FXI A;  3W5V B;  2HE7 A;  2QSD A;  1MG8 A;  2AQ1 B;  1E10 A;  2ZPY A;  1SIF A;  2BWF A;  1QF6 A;  1YNT E;  1PGX A;  2LUE A;  2V3S A;  1NVI D;  1RRB A;  4TQ1 A;  1VR9 A;  3OG5 A;  2BYE A;  4K7S A;  2WXP A;  3AXC A;  3ZJU A;  2WDT B;  1UD7 A;  3APC A;  3PZ7 A;  1V9J A;  3URY A;  1NYR A;  4Q2J A;  4WJN A;  5BYR A;  1R4M I;  4ANX A;  1CJE A;  3QAQ A;  1TS2 A;  4CO7 A;  3LJ3 A;  1OEY J;  3ZDM C;  1EU4 A;  3EGR A;  2N9K A;  4A6Q A;  2LEK A;  1HTO A;  1OFF A;  4C80 A;  1RYJ A;  3S2A A;  4WAA A;  2WXI A;  2KTF A;  2WXM A;  1J7C A;  2LD9 A;  3HVZ A;  1FCL A;  4CYE A;  3Q3O C;  2KC2 A;  4P1C C;  4K7W A;  1JRP A;  2KFJ A;  3TUO A;  1KJT A;  5EE9 A;  4FJV B;  4REZ A;  4N6E B;  2RD0 A;  3P42 A;  3WAN A;  1J8C A;  5FR6 A;  3VHT C;  3ZNH B;  4LNI A;  1C3T A;  4TKN A;  1SSN A;  3PHW B;  2KDI A;  1DOX A;  3UIO B;  2YLM A;  2JXX A;  1WH3 A; 
#chains in the Genus database with same CATH homology
 2IO3 B;  3ZDT A;  2GBJ A;  2DYM A;  3EEC A;  4AJW A;  3P2B A;  2N1W A;  2ZPN A;  3K9P B;  1TBE A;  1WXS A;  3PLV A;  1SGH A;  3TIX A;  2RR9 A;  4EKU A;  3JYU A;  3ZTD A;  3ZIM A;  2KAN A;  3DVN V;  3DOW A;  1V5T A;  3EC8 A;  2G3Q B;  4I6N B;  4WWP A;  2CHZ A;  2JPH A;  4W9H A;  4BKS D;  2RPQ A;  4MSQ B;  4EZJ A;  1BT0 A;  1P0R A;  5JHA A;  4W9E A;  1V5O A;  1Y8R C;  1IP9 A;  2KJ6 A;  4IG7 B;  2K25 A;  4KSK C;  4ZRI A;  4DK5 A;  2WWZ A;  1WMH B;  4EOY A;  2LJ5 A;  2LXC A;  4GGQ A;  3QX1 A;  4GU2 A;  3VDZ A;  2WYQ A;  4DDG D;  4EUT A;  3K9O B;  4JLC A;  2DZM A;  1E8Y A;  3PZD A;  2KMC A;  4PS8 A;  4JGH B;  3TCA A;  3RD2 A;  2C9W B;  2LWP A;  3DBH I;  5JH5 C;  2K8C A;  3DVN U;  2MCN B;  4HK2 A;  1S1Q B;  2W9N A;  3BIN A;  4URK A;  4B6W A;  2AEH A;  2M17 A;  5AZF A;  2KKC A;  2B3A A;  4PYZ A;  3KW5 B;  2Z0D B;  2AYO B;  3V62 A;  5LXI B;  3N32 A;  1V49 A;  5E6O A;  3UIP B;  3R7Q A;  1WFY A;  3R3M A;  2KDB A;  2L3Z A;  5IA7 A;  2KJR A;  5D6J B;  1P3Q U;  2BWE S;  1H4R A;  3L08 A;  3V6E B;  4BOS C;  2KVR A;  2REX A;  5G2N A;  3BY4 B;  2KFK A;  3L17 A;  2DYB A;  4W9L A;  2D07 B;  2K39 A;  2MBE A;  2JT4 B;  3NZS A;  4ZYN A;  1OTR B;  1WY8 A;  5EDS A;  5DPW A;  2KC1 A;  2JF5 A;  2KFK B;  2C7M B;  3EFU A;  4I6L B;  4IM3 A;  3TMP B;  4HXD A;  5TR5 A;  1Q1O A;  1YX5 B;  4KV2 A;  2IBI B;  4F8C B;  2JRI B;  3U30 A;  2R2O A;  4NJ6 A;  4KSL C;  3PT2 B;  1WIA A;  1EO6 A;  2NVU I;  3HHM A;  1V81 A;  4NQK E;  4GDL A;  3HIZ A;  4WWO A;  5J18 A;  2KLC A;  2Z59 B;  4HPL B;  2KTR A;  3DQV A;  3A4S C;  3VH3 B;  2FIF A;  4ZRK A;  1WGR A;  3OJ3 A;  4XZ4 A;  3DPD A;  1VD2 A;  3AU5 A;  1ISN A;  2JUO A;  2R2Q A;  5DPS A;  4GDL B;  5D7G A;  4BKS A;  4A3P A;  4TV3 A;  2O2V A;  2XK5 A;  5GMV A;  2IO0 B;  1E90 A;  2FID A;  2KWV B;  4MGI E;  2AL3 A;  2G4S A;  4FN2 A;  1WM3 A;  3M62 B;  4DHJ B;  3PRM B;  1WGG A;  3MTN B;  2C7N B;  3A1Q A;  2BKR B;  4FJY A;  3RCZ A;  3ZNZ B;  3GZN I;  2KLG A;  2O2V B;  3KUD B;  2XK5 B;  1XD3 B;  3WAP A;  3ZVV A;  5HKH A;  2JZZ A;  2ZCB A;  2RGF A;  3QQ8 B;  5AEK B;  4ANU A;  3HM3 A;  2ZNV C;  1TTN A;  3PVL A;  1YJ1 A;  5IAA C;  4FUL A;  2KQS A;  3U8Z A;  2MBB B;  3PV1 A;  2J0J A;  1WGD A;  3H1U A;  4PS3 A;  4BVU C;  4AOF A;  4OVV A;  4NJ7 A;  1I35 A;  2LVQ A;  3RUI B;  5DCN A;  2CKH B;  3QC8 B;  4XX5 A;  3VAW A;  2K6Q A;  2VRR B;  4MGZ E;  2M0X A;  4HDQ A;  3PS6 A;  1WXV A;  5E6P A;  3ZTC A;  4DDI D;  2ZCC A;  3MJW A;  4M8N A;  3IBE A;  4IWO A;  1HE8 A;  3WA0 A;  2FUH B;  3A9K B;  4TQ0 A;  3V6C B;  4K7U A;  3PRZ A;  2JWZ A;  3CMM B;  1P1A A;  3B08 A;  1YIW A;  4LCD E;  5D94 A;  4E71 A;  3O65 B;  4BFR A;  3AU4 A;  1EUV B;  3W1S A;  2JY6 A;  1WX8 A;  2KX0 A;  3ZLZ A;  3QA8 A;  1V6E A;  4DHZ B;  1GJZ A;  2KDE B;  1QZE A;  2ZJD A;  1NI2 A;  4WJO A;  2ZVO A;  1WR1 A;  2LRU A;  3B0A A;  3I3T B;  4K81 A;  4KIK B;  4EEW A;  4IWP A;  2I1K A;  2GBR A;  3VFK A;  3APF A;  2K1F A;  3A9J A;  2AL6 A;  2GBN A;  3L13 A;  2PEA A;  4GXB A;  2OJR A;  4GB9 A;  1OEY A;  1WJU A;  2BYF A;  4IWQ A;  2DZI A;  3JSV A;  3D32 A;  3IFW B;  3OJ4 B;  2RSU A;  1UH6 A;  3CST A;  2M8S A;  3SU8 X;  1GG3 A;  2MWS B;  2EMT A;  2UWQ A;  3ECI A;  4J6I A;  3U7D A;  4P7I A;  3QJZ A;  2LXA A;  1E8X A;  2KJH B;  4MEL A;  2NCN A;  1WJ4 A;  2FCS A;  5E6N A;  2C7H A;  3GOE A;  3JSV B;  2EKE C;  4RMA A;  3UF8 A;  4BBN F;  3IG3 A;  1YQB A;  4GIV A;  4K1R B;  3C0R B;  3DVG Y;  3QCA A;  5AZG A;  3ZO5 B;  3W1S C;  2Z0E B;  3VUX A;  2N7E A;  2CS4 A;  3N30 A;  5CTR C;  2L0F A;  3T9L A;  2GBM A;  4WWN A;  2BPS A;  2D3G A;  2L7R A;  4WQO B;  3H7S A;  4A20 A;  1S3S G;  3HK0 A;  4HVB A;  3X23 A;  4HLE A;  3H7P A;  2MQJ A;  4W9G A;  3L10 B;  5CX3 A;  5BO4 B;  2MW5 A;  4GN1 A;  3NHE B;  2IY1 B;  3TJP A;  3R7R A;  5L95 C;  1WXA A;  1GNU A;  1WJN A;  2CR5 A;  5AZH A;  3H7P B;  2L05 A;  2C60 A;  4DXA B;  2Y5B B;  2MP2 A;  1K8R B;  3JVZ X;  1GUA B;  1WE6 A;  4G0N B;  4KDL B;  2N7D A;  4MM3 A;  2V4L A;  5G55 A;  2BYV E;  2BGF A;  3NZU A;  4TUU A;  1YX6 B;  2LI5 A;  2MP2 B;  3H9D A;  4XC2 A;  2LGY A;  5KHQ A;  3QAR A;  4DWF A;  1UBQ A;  3DDC B;  3IVF A;  2MRP A;  3CSF A;  5DPT A;  2JRH A;  2IO2 B;  1Q5W B;  2KXJ A;  4AWJ A;  2MBH A;  3KYC D;  4DHZ E;  2L0T A;  2BF8 B;  3NY5 A;  1IYF A;  3OLM D;  2PE6 B;  3NS8 A;  1WGY A;  4KVG B;  5J2R A;  2L00 B;  1LXD A;  4E3C A;  4FLH A;  4NY0 A;  1P98 A;  2KD0 A;  4MJS A;  4W9J A;  3RYT A;  3ZKJ C;  2K6D B;  4WJP A;  3WAL A;  2KTR B;  4BKG A;  1UGM A;  3DBS A;  1OGW A;  4RM9 A;  3PGE A;  5C1Z A;  3RUL A;  1WX7 A;  4I6P A;  2LRW A;  1CMX B;  4PS7 A;  1WF9 A;  4HCP B;  4A3O A;  3TBL D;  4CHK A;  3A33 B;  2IZV B;  2KWU B;  2A5U A;  1E7U A;  4MGK E;  4KZ0 A;  5J17 A;  2DAF A;  2KHW B;  3KH0 A;  2J0M A;  3B1L X;  2NBU A;  3RZF A;  4W9D A;  4HWI B;  5LLI A;  3A1Q B;  3M3J A;  2KN5 A;  3PHX B;  2PJH A;  4KDI C;  4DBG A;  2V1Y A;  4HDO A;  1WYW B;  4IM2 A;  4YL8 A;  1GC6 A;  4LDT D;  1D3Z A;  1WZ0 A;  1TGZ B;  4W9F A;  3ZW3 A;  2CHX A;  4FAD A;  2FNJ B;  3MHS D;  4MSM B;  1LM8 B;  4ANV A;  4B9K A;  2EMS A;  1WM2 A;  2DZK A;  2HJ8 A;  2C5L C;  4NAW A;  4LJP B;  3N3K B;  4AP4 C;  2NR2 A;  2FAZ A;  2IY0 B;  3DBR I;  4ICV A;  3L54 A;  3VVW B;  4ZRJ A;  1WRD B;  1WJ6 A;  2GOW A;  3UGB B;  2YVC A;  1F9J A;  5D2M B;  3QK0 A;  3VTU A;  2UYZ B;  3AUL A;  4G3X B;  2JVC A;  2D2Q A;  2KK8 A;  4NAW B;  2N9E B;  4PYU A;  3UQB A;  4W9I A;  5JZE B;  1P9D U;  2KO3 A;  4ASW C;  1RAX A;  3AI5 A;  1H8C A;  2ZVN A;  1LFD A;  1X1M A;  3DCG A;  2ZEQ A;  1E8Z A;  3PRE A;  4M8M A;  4W9C A;  5CHV C;  3DVG X;  3VTW A;  1T0Y A;  1KLV A;  2N9P C;  2I1J A;  2G45 B;  3APD A;  2GBK A;  3QIJ A;  1RLF A;  2L76 A;  1LQB A;  2M1M A;  4II2 B;  5C23 A;  2DAJ A;  3CF6 E;  3WIM A;  2J7Q B;  1EF5 A;  2O6V D;  4ANW A;  1E7V A;  3IHP C;  1JRU A;  1NDD A;  1UBI A;  4NNJ B;  2DHZ A;  4FHK A;  2LGD A;  3R66 C;  5JHB A;  4JIO U;  1AAR A;  3A9J B;  3PSE B;  2L8J A;  3RT3 B;  3RZW C;  2FCN A;  2LZ6 A;  2LAS A;  3HM6 X;  4LJO B;  1Z2M A;  1ZGU B;  3PPA A;  3Q3J A;  4HPM B;  4ZDV A;  3WAO A;  1L7Y A;  3L16 A;  4G11 A;  4GOC A;  3ZRC A;  1UZX B;  4FA6 A;  4NQL B;  2MSE D;  1WMH A;  1WI0 A;  2NBW B;  3V61 A;  4DHJ D;  1L2N A;  2DZJ A;  3ENE A;  2KQ7 A;  2CU1 A;  5CHW A;  2MLB A;  3DBL I;  4N9F 4;  3WAM A;  4MEM A;  3ZNI D;  1GC7 A;  2ASQ A;  3NOB A;  4GMV A;  1M94 A;  1Q0W B;  1SE9 A;  4MDK E;  2WX1 A;  1ZKH A;  1UEL A;  3T8M A;  1PQS A;  1V86 A;  1WX9 A;  2N9X A;  2N4F A;  3SDL C;  2MA9 B;  1OQY A;  1EF1 A;  2HTH A;  4RM8 A;  2N1V A;  4W9K A;  5KHO A;  4HCN B;  3M63 B;  1G6J A;  2KX3 A;  1U4A A;  3ZNG C;  2NBV B;  3PTF C;  2WX0 A;  4LDT B;  4NPN A;  2CHW A;  3ZUN A;  4EZL A;  1I42 A;  1E5W A;  1KM7 A;  1V80 A;  2FCM A;  2KNB A;  2KMA A;  2PPH A;  2HE7 A;  3M95 A;  3Q3F A;  4JL9 A;  4E74 A;  1MG8 A;  5LXH A;  1TZ1 A;  2NS5 A;  3KVF B;  4X57 B;  2ZZP B;  4M0W B;  3VUY A;  2ZPY A;  1SIF A;  2DEN B;  1E8W A;  1VCB A;  2BWF A;  1ZW7 A;  2KZR A;  3ML9 A;  2D11 A;  1J19 A;  4F7Z A;  4BBN C;  3H6N A;  2LUE A;  2V3S A;  4FBJ B;  3KYD D;  3PLU A;  4WJQ A;  5DPR A;  3VTV A;  3VH4 B;  2BKF A;  2KWC A;  1RRB A;  1Z5S B;  4II3 B;  4TQ1 A;  4BKT A;  2K8H A;  1XT9 B;  2OOB B;  2BYE A;  4K7S A;  2O6V A;  4FHJ A;  3QHT A;  2IYD B;  3AXC A;  3SD5 A;  3ZRF A;  2WDT B;  4GSW A;  3LDZ E;  4AJY B;  4BOZ B;  1UD7 A;  3SHQ A;  2HD5 B;  3ALB A;  2M4N A;  2MBQ A;  3APC A;  1V9J A;  4EFO A;  3UIN B;  4WJN A;  4MJS B;  4MH0 E;  2O6V B;  1R4M I;  1WR6 E;  2DYO A;  4ANX A;  3QAQ A;  2ZNV B;  4CO7 A;  3LJ3 A;  1OEY J;  2AWT A;  3KUC B;  1J0G A;  3ZDM C;  3UQA A;  3L0W B;  3W1Y A;  4OVU A;  3VQI A;  3PRP B;  3ML8 A;  2A4Z A;  4FJZ A;  4IUM B;  1YD8 U;  2NPT A;  2XBB C;  4AUQ C;  1WXM A;  2PE9 A;  2LVP A;  1R4N I;  3S2A A;  1WE7 A;  4WAA A;  1C1Y B;  1XQQ A;  4ICU A;  3ONS A;  2KTF A;  4HJK A;  2NPT B;  2J0K A;  2FCQ A;  3QWZ B;  3VUW A;  2LD9 A;  2MBO A;  5CHF A;  4F1S A;  2KDF B;  5L83 A;  4EZK A;  4GDK A;  4CYE A;  3V60 A;  2G4D B;  2KC2 A;  1A5R A;  2KOX A;  4MGY E;  1IPG A;  4G50 A;  4K7W A;  4B95 A;  2KFJ A;  3OAW A;  1KJT A;  3TL5 A;  4FJV B;  2XEW A;  2K8B A;  3KUZ A;  4GDK B;  1V2Y A;  2RD0 A;  3A4R A;  3VXW A;  1FXT B;  2JZ3 B;  2LVO A;  2MX2 A;  3A9K A;  3WAN A;  2D10 A;  4KZC A;  1J8C A;  2LGX A;  5FR6 A;  3X0W A;  2IO1 B;  1RFA A;  3VHT C;  3ZNH B;  4IW0 A;  1C3T A;  2GMI C;  1KOT A;  1WGH A;  4TKN A;  4JQW C;  3PHW B;  3JW0 X;  2KDI A;  4IM0 A;  2DX5 B;  3UIO B;  2YLM A;  2QHO A;  4KIK A;  3EHV A;  4IC7 B;  1NBF C;  2JXX A;  1WH3 A;  1WZ3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...