2BKRB

Nedd8 nedp1 complex
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
77
structure length
77
Chain Sequence
SMLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVLHLVLALRGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of Nedd8 Ubiquitin Discrimination by the Deneddylating Enzyme Nedp1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein-binding/hydrolase
molecule keywords SENTRIN-SPECIFIC PROTEASE 8
total genus 22
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2005-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2bkrB00
4NY0A 5AZHA 3DVGY 3N3KB 4F7ZA 2KJ6A 3N30A 3P2BA 4W9CA 2EMSA 2M0XA 3DBSA 1TTNA 3L54A 4K81A 2N9XA 3ZO5B 4E74A 4IG7B 3H1UA 3PLUA 2DAFA 3AI5A 2XK5B 3M95A 4AUQC 2KZRA 3C0RB 3QCAA 4IM2A 5CHFA 5BO4B 2OOBB 1GG3A 2G45B 2JRIB 4KDLB 3S2AA 2KWCA 4DHJB 5EDSA 1EO6A 2R2OA 2UYZB 2LJ5A 2J7QB 2KMAA 4ASWC 3B0AA 1UD7A 3TCAA 2FCQA 4ZYNA 5IA7A 2GBKA 4KSKC 1WH3A 2ZNVC 4W9EA 2KFKB 4K7UA 4GSWA 2DZIA 2R2QA 1S3SG 2O6VD 3PPAA 2I1JA 1MG8A 2KXJA 3ECIA 1YJ1A 2LGYA 4WAAA 2FCMA 5HKHA 1YQBA 2REXA 3DVNU 2J0KA 4JGHB 3VAWA 1LQBA 3KUCB 1I35A 3A9KA 5AZGA 4JL9A 2JY6A 2MW5A 3UINB 2RSUA 3ALBA 4YL8A 3VUWA 2DZKA 2M8SA 3JSVA 2LD9A 3DQVA 5TR5A 3ZVVA 1WGDA 4BBNF 4MJSA 1GNUA 2LWPA 2KWVB 3PHXB 2HD5B 3VTUA 3ZDMC 1V9JA 1WE7A 2KO3A 2LVPA 3B08A 1VCBA 4EZJA 2CHZA 3DCGA 4URKA 3A1QA 5G2NA 5DCNA 2MBQA 2NBUA 1WR6E 2AL3A 3L13A 1E8ZA 4IWPA 2L0FA 4BOZB 4AJYB 4EKUA 2C7HA 2KANA 2GBMA 2MP2A 3ZUNA 3X23A 2IBIB 3V6EB 4LDTB 3VVWB 3KW5B 5C1ZA 1YX6B 2MLBA 3A1QB 3R3MA 4WWNA 4NNJB 2MRPA 4MH0E 3OAWA 1E7VA 2CU1A 4MSQB 1WIAA 4WJOA 1Q0WB 4KSLC 2C9WB 4CYEA 2K8HA 2XK5A 1WF9A 4XX5A 3CF6E 2EMTA 2KTRA 4NQKE 3PTFC 3A9JB 3ZNID 4K7SA 4DWFA 3DOWA 2KDEB 2KFJA 3DVNV 4WWOA 2C60A 1L7YA 3B1LX 2KOXA 4GB9A 4WQOB 3U7DA 2KFKA 3W1YA 3RULA 1E8XA 4MM3A 3U30A 2GBRA 2HE7A 3QQ8B 2DYOA 2PE6B 4AOFA 1OTRB 4W9LA 5CTRC 2PEAA 2FAZA 3L08A 3SDLC 2HTHA 3GOEA 3BINA 3PGEA 4MJSB 5E6NA 1WJUA 3OLMD 1RFAA 2EKEC 2K25A 1X1MA 4LDTD 4DHZE 5GMVA 2KHWB 2UWQA 3PV1A 1V86A 4HLEA 1GC7A 3PREA 3L0WB 1P9DU 2NBWB 2CS4A 1ZGUB 2RGFA 4OVVA 4JQWC 1UELA 2L8JA 4HPMB 2KDFB 3A33B 4FJYA 3H6NA 2D07B 4BKTA 2N1VA 4ANUA 1RAXA 4MGYE 1UH6A 3L16A 2IO1B 2YLMA 2MCNB 2KKCA 4A20A 2JZZA 1K8RB 2FCNA 3H7SA 2A5UA 3A9JA 3NY5A 2MBBB 1TZ1A 1WY8A 3BY4B 4JLCA 2BYVE 4IW0A 2A4ZA 2V3SA 2ZVNA 4EZKA 4MGIE 2ZCBA 4JIOU 2IZVB 3ENEA 3NS8A 2GBJA 2AYOB 2DENB 1QZEA 2D3GA 2Y5BB 3PHWB 3QC8B 1ZKHA 2KN5A 3ZKJC 3X0WA 3EHVA 3DBLI 3Q3JA 3UGBB 4GOCA 3UIOB 1WXSA 3APFA 4M0WB 2D2QA 1U4AA 1E8WA 2K39A 4GN1A 4PS8A 1OQYA 2N1WA 3HIZA 3PVLA 1WYWB 1WZ3A 1L2NA 3T8MA 4FULA 2ZNVB 3VXWA 3PRZA 4PYZA 1IP9A 4IM3A 4HCPB 4WJNA 3MJWA 4MELA 3LJ3A 2BWES 3ZLZA 4AP4C 3NHEB 5CHWA 5D7GA 5LXIB 1C1YB 3APCA 2MBHA 4A3PA 2L7RA 3VUYA 5JHBA 4DK5A 1A5RA 2IO2B 4GGQA 4IC7B 4W9IA 3VTVA 4NPNA 2I1KA 5IAAC 3MTNB 3DVGX 4ANXA 1EUVB 4TV3A 3O65B 4X57B 1C3TA 2ZPYA 1E90A 2KC1A 1NI2A 2NPTA 2WYQA 5DPSA 4BKSD 3RCZA 3UQBA 2LVQA 4RM8A 1WGYA 3CSFA 2LVOA 3AULA 1WGHA 4BVUC 2KTFA 3H9DA 3L17A 5LLIA 1TBEA 2C7MB 3V6CB 3I3TB 2MX2A 4BKGA 1V6EA 1R4MI 1P3QU 1XT9B 3OJ3A 3SHQA 2K1FA 3H7PB 1YD8U 4EFOA 1HE8A 2M4NA 2O6VA 4W9FA 2RPQA 4HWIB 1Z5SB 1XQQA 1FXTB 3RYTA 4NJ6A 1KM7A 1KJTA 2K6DB 1TGZB 4GXBA 4HK2A 4A3OA 3DBRI 2KJRA 3M62B 2KTRB 1F9JA 4J6IA 4HPLB 1RLFA 3K9OB 2IO3B 5D6JB 2MWSB 3A4SC 1Q1OA 3R7RA 3QJZA 1BT0A 4FN2A 3AU5A 4E71A 5FR6A 1ISNA 3AU4A 3H7PA 3V61A 5J18A 2MA9B 2Z59B 1S1QB 2D11A 2IYDB 2NBVB 2WX1A 2GBNA 3QWZB 3VH3B 3ZRCA 1WX7A 4MGZE 2GOWA 4I6PA 3PZDA 4I6NB 4ZRIA 4HXDA 1AARA 4FJVB 2KX0A 3KYCD 5E6OA 3VQIA 4XC2A 1EF1A 1R4NI 3VTWA 1V81A 1P1AA 3A4RA 3KYDD 2NCNA 4MGKE 2NVUI 2LZ6A 4FHKA 4BBNC 5AZFA 4P7IA 1V80A 1XD3B 1Q5WB 2B3AA 2Z0EB 1M94A 4WJQA 3ZTCA 3JVZX 2CKHB 2HJ8A 2BYEA 2K6QA 5L95C 1D3ZA 1KLVA 2N7EA 2N9EB 4ICVA 5G55A 3QIJA 2K8CA 4NAWB 1WX9A 3QARA 3VFKA 2LRWA 3TIXA 3KUDB 3U8ZA 2FIFA 1GC6A 4FBJB 3PRPB 3W1SC 2O6VB 2W9NA 3VUXA 4BKSA 3HK0A 3WAOA 2DZJA 2IY1B 4W9KA 4EZLA 4ZDVA 2AL6A 2G3QB 5J2RA 4BFRA 4GIVA 3APDA 4M8MA 2V1YA 1RRBA 2JT4B 3OJ4B 1UBIA 5CHVC 2KX3A 4II2B 4G3XB 2C5LC 3QK0A 2CHXA 3NZUA 1SE9A 4KDIC 3WA0A 1V5TA 4IUMB 1IPGA 1T0YA 1JRUA 3W1SA 4WWPA 2J0JA 2KNBA 4M8NA 2Z0DB 4PS7A 1ZW7A 1WRDB 3L10B 3QA8A 3EECA 2JUOA 3JSVB 4DDGD 2JZ3B 1WI0A 2NS5A 2KLGA 3RUIB 4DBGA 4TQ0A 4IWOA 4G11A 2K8BA 4OVUA 3V62A 2IY0B 4HJKA 4RM9A 4BOSC 3DDCB 1J19A 3RT3B 2M1MA 1P0RA 3PT2B 3ML9A 4DHJD 4EEWA 2CR5A 2N4FA 4XZ4A 2MBEA 4TUUA 4LCDE 2G4DB 1WJ6A 1WFYA 2PJHA 3RZFA 2MP2B 3RD2A 2MBOA 4GDKB 1GJZA 1WXAA 4KZ0A 2ZEQA 3Q3FA 3WIMA 2ZCCA 4AJWA 4HDQA 1OGWA 1LXDA 1OEYA 3IFWB 4ANWA 2BGFA 3EFUA 1UGMA 3IVFA 4G0NB 1P98A 4ICUA 2KK8A 3ZTDA 4ZRJA 4W9GA 4DHZB 2DYMA 2ZPNA 4IWQA 4RMAA 3DPDA 2FCSA 3WANA 2VRRB 1WJ4A 3IG3A 4LJPB 1OEYJ 1SIFA 2MQJA 3A9KB 4ZRKA 5C23A 2N7DA 3VH4B 3ZIMA 2CHWA 3WALA 3NZSA 4CO7A 1LM8B 1GUAB 3MHSD 2KQSA 1KOTA 1I42A 3HHMA 1NDDA 3IBEA 1WR1A 3KVFB 4AWJA 2J0MA 4FJZA 5DPRA 4KIKB 1WE6A 1WM3A 3ML8A 2KWUB 3SD5A 2BWFA 3UIPB 3WAPA 2KDIA 1CMXB 2AEHA 2JPHA 3M3JA 5JHAA 4B6WA 3PLVA 3ZNHB 1V49A 2ZZPB 3QX1A 4N9F4 1WMHA 2O2VA 4W9DA 1YX5B 1J8CA 1NBFC 4FA6A 4I6LB 2NPTB 4F8CB 4PS3A 3HM6X 2JF5A 2JWZA 2LXAA 3AXCA 2JVCA 3CMMB 2QHOA 4LJOB 3VDZA 2DHZA 2FIDA 2KLCA 5DPWA 3LDZE 2XEWA 5JH5C 4W9JA 1SGHA 1YIWA 2LASA 1WXMA 4FHJA 4MSMB 2RD0A 1WM2A 1WMHB 2O2VB 4E3CA 5JZEB 5KHQA 2LRUA 5E6PA 2JXXA 4HVBA 5DPTA 3JYUA 4W9HA 4KZCA 3PS6A 4CHKA 4MEMA 5KHOA 3UF8A 2WDTB 3V60A 2JRHA 1WJNA 1LFDA 4B95A 2ZJDA 3NOBA 2L00B 1E8YA 4FLHA 3QHTA 4II3B 4TKNA 3JW0X 3D32A 2LUEA 4HDOA 1WZ0A 2PE9A 1VD2A 3KUZA 4KVGB 3TMPB 2KDBA 2KVRA 1H4RA 4IM0A 1EF5A 5D94A 3WAMA 2FNJB 2D10A 2KMCA 2RR9A 2BPSA 2L3ZA 3K9PB 3QAQA 2L76A 1IYFA 5J17A 3M63B 4ANVA 4GDLB 4K1RB 1Y8RC 2KC2A 1E5WA 2M17A 2WX0A 2ASQA 4NQLB 4PYUA 4WJPA 3R7QA 3T9LA 3GZNI 3KH0A 1UZXB 3RZWC 1E7UA 4TQ1A 1UBQA 2FUHB 3DBHI 4NJ7A 4F1SA 1Z2MA 1WGGA 2LGDA 2V4LA 5L83A 4HCNB 5D2MB 1PQSA 4GU2A 2LI5A 1J0GA 2LXCA 4K7WA 1G6JA 3PRMB 1WX8A 4G50A 3EC8A 1V2YA 2GMIC 2LGXA 3ZNGC 4KIKA 1WXVA 2DAJA 3CSTA 3ZRFA 4EOYA 4NAWA 2PPHA 4B9KA 2N9PC 4GDLA 2ZVOA 5CX3A 3ONSA 2NR2A 3PSEB 3ZDTA 3R66C 4DXAB 4GMVA 2C7NB 2KD0A 2MSED 2L0TA 4KV2A 2DYBA 2AWTA 2KJHB 2WWZA 2XBBC 3TJPA 2DX5B 2BYFA 2IO0B 2BF8B 2YVCA 4FADA 3IHPC 3TL5A 2BKFA 3N32A 2G4SA 4MDKE 2KQ7A 3SU8X 3UQAA 1H8CA 2DZMA 3HM3A 2BKRB 3ZNZB 4EUTA 5AEKB 5LXHA 1V5OA 4GDKA 2OJRA 4DDID 2L05A 3ZW3A 1WGRA 3VHTC 3TBLD
chains in the Genus database with same CATH superfamily
1CK1A 4NY0A 5AZHA 3T3OA 2V0GA 2N9XA 3AI5A 4HKZE 1FRDA 4UDUC 5CHFA 5BO4B 4KDLB 1GG3A 2G45B 2JRIB 1QOFA 3KWVA 5HG2A 1UD7A 2PW9A 1C78A 3DHHC 1WH3A 2QDFA 4N59A 4B0MA 2DZIA 2I1JA 3ECIA 1F0ZA 2LGYA 4WAAA 3RNFC 4C4VB 2AQ3B 3VAWA 1LQBA 3AEGB 2WNMA 3AH7A 2JY6A 2RSUA 2SEBD 3ALBA 4YL8A 4RGTA 3VUWA 1T0RC 2LD9A 3JSVA 3RNGC 3ZVVA 2HTME 4KKJA 5TR5A 2G9HD 4BBNF 1GNUA 2KWVB 2HD5B 2LVPA 3B08A 2NTSA 3NZ3A 2VZKD 3IAS1 1XLNA 1MHHE 3L13A 2L0FA 4ACFA 4WURA 2DLBA 1ACCA 2LJIA 2WU5B 4EKUA 2KANA 3MP9A 2GBMA 3NJTA 3BYTB 4XGAB 3ZUNA 2MEKA 1YX6B 2MLBA 3AEBB 4NNJB 3Q8CA 3P1MA 1WIAA 4ARCA 2GB1A 2C9WB 3SFEB 2PVOD 4XDDA 1ZDXA 2EMTA 2KTRA 3ZNID 2WQYB 2WDQB 2KOXA 1AYFA 3FILB 3E9SA 2KFKA 5E6JA 4MM3A 4AOFA 2HE7A 3QQ8B 2PE6B 4KGTA 4W9LA 3W9CB 1IGDA 4YTMB 3BWUD 3MFGA 4DHZE 1I4QA 1BUIC 1DOIA 1MVKA 1TZOA 3PREA 1I4GA 1SF0A 1F1HA 5BYQA 4JPSA 1JWSD 4OVVA 4JQWC 4MM3B 4K3BA 1YNTE 1V97A 2IO1B 2YLMA 2KKCA 2WXIA 3TEWA 3H7SA 3E56A 3ENEA 4H2AA 4P1CC 1ZKHA 2KN5A 3DBLI 4GOCA 4M0WB 4GN1A 4JE3B 4XE0A 1DYQA 1NYQA 2N1WA 1WZ3A 4KKIA 3T8MA 3VXWA 2L32A 3ZLZA 2KYWA 4AP4C 3U7ZA 2MJEA 3APCA 2MBHA 2V4IB 1WXQA 4W9IA 4NPNA 3TEZA 4HEA1 5IAAC 5IKCM 4TV3A 1C3TA 2ZPYA 1E90A 1NI2A 5DPSA 4YWGG 3UQBA 2D3AA 4YT0B 3RCZA 1WGYA 3SFDB 3CSFA 2LVOA 1WGHA 1JMLA 2D5GA 2C7MB 2LGSA 1KLGD 1R4MI 4ZYSA 1XT9B 2K1FA 2Y5CA 2KN4A 1Z5SB 1SJED 2K6DB 1FIQA 1TGZB 3N20C 3M62B 2RPVA 4HPLB 1RLFA 1I4XA 3OG5A 3Q2AC 4FN2A 2AQ1B 5FR6A 3H7PA 2Z59B 1VZ6A 2XNAC 1WX7A 2WXMA 4LLGM 3DWGC 4FJVB 2KX0A 3KYCD 1SEBD 4TMAB 3VTWA 4YSXB 2BYTA 3KYDD 2NCNA 3LB8C 2LZ6A 3HUIA 4P7IA 1V80A 1I4RA 1Q5WB 3AEAB 2HJ8A 5EE0A 5BMIA 1KLVA 2NTTA 3QIJA 2K8CA 3VFKA 2FUG1 2LRWA 4HKQA 1QOBA 2FIFA 4MACA 2O6VB 1JWBD 3IT4B 1RWSA 3Q8EA 4RGNA 4ZDVA 5J2RA 4M8MA 2SAKA 5CHVC 1IGCA 4G3XB 2C5LC 3QK0A 1SE9A 4RCOA 1V5TA 3WA0A 3WCQA 2DWQA 1T0YA 1FNUA 2M0AA 4PS7A 3ZXVA 3QA8A 4P1BC 4XWWA 3JSVB 1N5XA 4TQ0A 4IWOA 4OVUA 2RMMA 3RT3B 1LO5D 3P4RB 4DHJD 4EEWA 2CR5A 4LCDE 2K0PA 2PJHA 4RGOS 3EUB2 2J52A 4L2YA 3Q3FA 3IFWB 3EFUA 3NVVA 3IVFA 4DHZB 4IWQA 4BAXA 2VRRB 3N9YC 1SIFA 3ZJUA 2I2YA 3BVZA 4O1NA 1PUTA 3N1YC 1GUAB 5LNK1 1ZUD2 1I42A 3KVFB 4B0EA 4FJZA 4S0RA 1T0QC 4PK1A 2WXNA 2BWFA 1HQRD 4ARIA 1ESFA 1SB3C 3NVYA 3AE7B 1V49A 2ZZPB 3KLSX 3QX1A 4W9DA 4FA6A 4J3OD 1EU3A 3ZJTA 3VDZA 1NYRA 2DHZA 5DPWA 3LDZE 2XEWA 5JH5C 1SGHA 2LASA 2BTEA 1WXMA 1WM2A 1BMLC 3DWMA 2AX5A 3RFZB 3JYUA 1XLPA 4CHKA 3V60A 1F77A 2L00B 4FLHA 3QHTA 4TKNA 3V05A 1A70A 4HDOA 3J9CA 1KLUD 2KVRA 2L52A 3SEBA 4WAFA 2KMCA 2JYEA 3N1ZC 4FXCA 2L76A 1IYFA 4GDLB 3RI7C 1Y8RC 2KC2A 1ZXIA 4C00A 3ZYYX 1BXTA 1N63A 1UBQA 2FUHB 2HDEA 5L83A 1L0YB 1PQSA 1G6JA 4D2KA 1UWXA 1WX8A 1FCLA 2WXQA 4KIKA 3GE3C 4B9KA 1VR9A 2QIEB 3PSEB 1E7PB 2QMTA 1HZ6A 4KV2A 2DYBA 3R8BA 2BF8B 3MC8A 3OWEB 1FFVA 2BKFA 3KWLA 4MDKE 3SU8X 4OZCA 4EUTA 4JWUC 2L05A 2MH7A 1OFFA 4M00A 3RNBC 1C79A 4F7ZA 4ZHPA 4W9CA 4RNAA 2M0XA 2K9XA 4ZHOA 1TTNA 1HTOA 1TYGB 3V3XA 4IG7B 4Q2JA 5BMHA 2DAFA 2XK5B 1SJHD 5MPOA 3LYYA 3C0RB 3QCAA 2OOBB 2PMVA 4ASWC 4CQNA 2FCQA 4C80A 4W9EA 2KFKB 2HJ1A 3DHGC 1ENFA 2KXJA 2FCMA 5HKHA 1YQBA 2ZW1A 2ZW0A 3KUCB 1QOGA 1I35A 2MW5A 2QEJC 2W3SA 3DQVA 2FE8A 1WGDA 2LWPA 3VTUA 4C56C 1VCBA 2EKIA 3A1QA 2AL3A 1HZ5A 1E8ZA 4IWPA 3IAM1 4AJYB 2MP2A 1LGRA 3X23A 1JWAD 2IBIB 4LDTB 3VVWB 4US9A 2BS3B 3R3MA 4WWNA 2MRPA 1E7VA 2WXPA 2CU1A 2XK5A 3Q69A 1QLBB 2BS4B 2JU6X 1YQ3B 2KDEB 3DVNV 3PZ7A 4IKGA 1STEA 4WQOB 3W1YA 3T3NA 1E8XA 3L08A 1WJUA 3OLMD 4A8XC 1VRAB 2UWQA 3PV1A 2J42A 4N58A 2TSSA 3VR8B 3L0WB 1VLBA 3GB1A 1ZGUB 4K3CA 1ROEA 1UELA 4HPMB 4FJYA 3H6NA 2D07B 5HHDG 3RN9C 3W2DA 3L16A 2MCNB 4A20A 1FNWA 1K8RB 1FCCC 2A5UA 1P7EA 1FXIA 2A4ZA 4MGIE 1IUEA 2GBJA 2AYOB 1QZEA 3PHWB 3QC8B 4KGRA 3X0WA 3EHVA 3Q3JA 3UIOB 3APFA 3TSSA 1E8WA 4PS8A 1OQYA 3Q6BA 2BB6A 3R2TA 3PVLA 1WYWB 3MHZA 1YQ4B 1L2NA 1SE2A 2L83A 4WQMA 1IP9A 4IM3A 3MJWA 3LJ3A 3PO0A 5LXIB 2L7RA 1QILA 2IO2B 4GGQA 2IJ0A 2I1KA 4ANXA 3DVGX 4EE2A 3O65B 1KF6B 1XF5L 2WYQA 4RM8A 4BVUC 1GB1A 5LLIA 1R4NB 2INPE 3OJ3A 2IGGA 1JW9D 1QOAA 4C7ZA 2KVZA 2QILA 3N1XC 4W9FA 3P4QB 1TKGA 1KTKA 1ZPSA 2KJRA 4RH6A 2BT6A 2IO3B 1EM7A 3A4SC 2QJLA 2W82A 1BT0A 2BQQA 3AU5A 4E71A 4US8A 3AU4A 1J7AA 5J18A 3HRDD 1RFKA 1QQRA 4MGZE 2GOWA 3PZDA 5G5HA 5E6OA 3TEYA 1PDXA 4XC2A 5H8YE 3A4RA 3RNEC 4AQ7A 2NVUI 3CIRB 2WXGA 4FHKA 4BBNC 5AZFA 1XD3B 2JX5A 4WJQA 4L23A 2N7EA 1T3QA 1NI3A 4NAWB 3TIXA 2QCZA 2IDYA 4LNIA 3MC0B 4BZAA 3ZGZA 4BKSA 5C3JB 3HK0A 1EU4A 2IY1B 4EZLA 3BK1A 3R2IA 2V1YA 2WS3B 1UBIA 4II2B 2KT7A 3NZUA 4KDIC 3AEFB 1JRUA 2D3BA 1GOZA 5FK9C 2JZ3B 2NS5A 1D4BA 1RM6C 4G11A 2IY0B 2WXRA 3DDCB 1J19A 2VH2A 3PT2B 3ML9A 3I63C 2N4FA 3IXSA 1TKYA 1WJ6A 1WFYA 2B76B 2MJDA 2MP2B 3RD2A 2MBOA 3CWIA 3AE6B 1GJZA 5IP4D 3AE9B 4AJWA 1CQVA 1OEYA 4G0NB 4ICUA 3RPFC 2N7JA 4ZRJA 4W9GA 2DYMA 4RMAA 5JXVA 3FC4A 3W5VB 1WJ4A 3IG3A 4LNOA 1OEYJ 3A9KB 1L5PA 3NG0A 2N7DA 3VH4B 4YSYB 1KFYB 1L0XB 3MHSD 1DOXA 1T0SC 1WM3A 2N0SB 1YMHE 2D3CA 2KWUB 1CMXB 5JHAA 3M3JA 3ZNHB 3GP7A 1UUPA 1YX5B 1MFWA 4I6LB 3AEDB 2NPTB 2JWZA 2LXAA 2JVCA 3CMMB 4LJOB 1XLQA 2KLCA 2MJ3A 1YIWA 4FHJA 2WDRB 1WMHB 2O2VB 4E3CA 5KHQA 2LRUA 5E6PA 5DPTA 4W9HA 2ONQA 3UF8A 1C9FA 2JRHA 1LFDA 2INNE 3NOBA 1E8YA 2X38A 1WWTA 3TMPB 2KDMA 2WHIA 4IM0A 2RR9A 2BPSA 2L3ZA 4YSZB 1B9RA 1R4MB 3AE8B 1E5WA 2WX0A 4WJPA 4PYUA 3GZNI 1E7UA 4TQ1A 1TKEA 2JZPA 4NJ7A 2V4LA 3AN1A 1J0GA 1TY2A 2LXCA 3PRMB 1UNSA 1V2YA 1WRIA 3ZRFA 2CJNA 4NAWA 4QAYA 2N9PC 4GDLA 2ZVOA 2Z8LA 3C8YA 3NS1A 1VDVA 2NR2A 4GMVA 2JXTA 2L0TA 2WWZA 2XBBC 3IHPC 3TL5A 3N32A 1MJDA 1J7BA 2JWUA 2BKRB 3I57A 3P4PB 5LXHA 1V5OA 1YN3A 4DDID 3VHTC 3TBLD 3DVGY 4OVZA 2KJ6A 4ITKA 3ZO5B 5T8IA 4ZRPA 3PLUA 1PGAA 3DBRB 3P42A 2KZRA 4XDCA 3EGRA 1SIJA 4DHJB 2MHJA 1EO6A 3EFCA 2UYZB 3B0AA 3AE5B 4ZYNA 5IA7A 2GBKA 4P6VF 2ON8A 1I4HA 4K7UA 3B2FA 4GSWA 3ZQ4A 1S3SG 3PPAA 1MG8A 1YJ1A 2YEPB 2BB5A 3GE8C 4HJGE 2REXA 2VH1A 5I4DA 2VZKB 1RYJA 3UINB 5D3DA 3NVWA 4MJSA 4HPPA 3ZDMC 3HVDA 1V9JA 4L1BA 4C4VA 4EZJA 3DCGA 4URKA 5DCNA 2MBQA 2NBUA 1JRPA 1XLOA 2XN9C 1UWMA 1IBXA 3V6EB 1PGBA 3KW5B 5C1ZA 4JWSC 1L6VA 4MH0E 3OAWA 2LFIA 4KSLC 2N9LA 1HEZE 3KQ4A 5C2TB 1WF9A 5BYSA 3PTFC 1N60A 2QC8A 3A9JB 4K7SA 4DWFA 3DOWA 4AS1A 2C60A 1XEEA 2GLSA 3B1LX 1QT9A 4GB9A 1V1OA 3U30A 2GBRA 2DYOA 2LMCA 2FAZA 2H89B 2LHEA 3BINA 5TSSA 3PGEA 5E6NA 1RFAA 2EKEC 1YOVB 2K25A 5GMVA 1VZ7A 2KHWB 1V86A 1GC7A 1MPEA 1M4VA 4NJCA 1P9DU 1FM0D 2CS4A 2LGIA 1NENB 2GRIA 2PTLA 2N1VA 4ANUA 1TY0A 4MGYE 2JZZA 2FCNA 1D5ZC 2WGSA 3NY5A 1TZ1A 1WY8A 1GB4A 3BY4B 1P7FA 2BYVE 1VJKA 4LNNA 2E6XA 2ZVNA 4JX1C 1GPXA 2ZCBA 2IZVB 1ET9A 2WXKA 2Y5BB 3ZKJC 3UGBB 1YN4A 1WXSA 2INCC 2D2QA 1U4AA 1E0ZA 2K39A 3HIZA 1T5XD 1N5WA 4HCPB 4WJNA 2CU3A 4MELA 3NHEB 2WXFA 1TIFA 1L4ZB 1C1YB 3VUYA 5JHBA 2EELA 3VTVA 3MTNB 1EUVB 2K3UA 2KAJA 2KC1A 2NPTA 4BKSD 3TUOA 3AULA 3EA6A 2KTFA 3H9DA 1TBEA 1FPYA 3AV8A 2MX2A 4NAMA 4BKGA 1V6EA 2Q5WD 2KMMA 3SHQA 3BYYB 4USAA 4EFOA 1HE8A 2O6VA 2RPQA 2WDVB 1XQQA 3RYTA 1KM7A 1KH0A 4GXBA 4HK2A 4A3OA 1NVID 2KTRB 2UU7A 1FNVA 1F9JA 2LEKA 3K9OB 1Q1OA 3R7RA 3QJZA 3TEXA 3V61A 2MA9B 2D11A 2IYDB 3VH3B 2IPKD 3QWZB 3IT6B 2BBCA 4I6PA 4ZRQA 1AARA 3VQIA 4ZOHC 3I9V1 4MH8A 4MGKE 3AMZA 2B3AA 2Z0EB 3ZTCA 1D3ZA 3JVZX 2CKHB 5L95C 1AW7A 2BW2A 1L4DB 1FXAA 2YEPF 2N9EB 4ICVA 1C4CA 1WX9A 2PLPA 3QARA 3KUDB 3U8ZA 2J4XA 3UI3A 2K5PA 1GC6A 4FBJB 3PRPB 4S17A 3W1SC 2W9NA 2WXHA 3WAOA 2DZJA 3APDA 2JT4B 1FO4A 1GAQB 4IUMB 3BIID 4WWPA 2J0JA 2KNBA 3L4PA 2Z0DB 4M8NA 1ZW7A 1WRDB 2BS2B 3DBLB 1HTQA 4DDGD 1WI0A 1F2RI 4HROA 3RUIB 1C76A 4BOSC 3AE3B 3V62A 4HJKA 4RM9A 1OQRA 3NVZA 2M1MA 1P0RA 1UF0A 2DBYA 4XZ4A 1C4AA 1F52A 5FKAC 2G4DB 4KZ0A 3LXFA 4LNFA 2ZCCA 4OHJA 4HDQA 1LXDA 2J53A 4ANWA 1P98A 3B2GA 3MJ5A 2WXOA 2ZPNA 2FCSA 3WANA 3Q3OC 2MQJA 5C23A 3ZIMA 3WALA 1QKZA 2W55A 1LM8B 3FKYA 1Q10A 2KQSA 2QSDA 1NDDA 3IBEA 1OQQA 2J0MA 4KIKB 1JCKB 2OEDA 1WE6A 3ML8A 4OZAA 3SD5A 1JROA 3UIPB 3WAPA 1CJEA 3FILA 1SE3A 4B6WA 4RF1A 1SBBB 1SSNA 1J8CA 1NBFC 4F8CB 1ET6A 4PS3A 1L6UA 2FIDA 4PT5A 4W9JA 2CJOA 2RD0A 5JZEB 3Q8AA 2JXXA 2E3TA 4KZCA 3PS6A 4MEMA 5KHOA 2ZJDA 4II3B 3JW0X 1TJEA 1UGJA 2PE9A 1VD2A 3KUZA 4WH4A 4KVGB 1H4RA 1EF5A 5D94A 3WAMA 2FNJB 2D10A 1YN5A 1JQ4A 3QAQA 3AM9A 4K1RB 4YXDB 3T9LA 1NEKB 2M17A 2ASQA 4NQLB 3KH0A 1TS2A 3RZWC 2ICIA 3DBHI 1D5XC 1Z2MA 4R3DA 1WGGA 4HCNB 5D2MB 4TSSA 4GU2A 2LI5A 4K7WA 4DXFA 1DGJA 3EC8A 2LGXA 4M01A 2DAJA 2PPHA 3BVMA 4XYCA 2Y3AA 1TS5A 3ONSA 5IO9A 3ZDTA 3R66C 2C7NB 2KD0A 3SR6A 1ZXHA 2AWTA 5IOIA 2BYFA 4FADA 2AQ2B 2G4SA 1H8CA 3HM3A 3ZNZB 3DHIC 4YTNB 1SXTA 3Q8BA 3ZW3A 2L1AA 3AB5A 2PKOA 3N3KB 3N30A 3DBHB 3P2BA 2EMSA 3AE1B 3DBSA 1WYGA 3L54A 1ZOYB 4K81A 2W3RA 3Q3MC 4E74A 1I7HA 3H1UA 3M95A 4AUQC 2X8XX 4IM2A 1F2RC 4XWTA 5EDSA 3S2AA 2KWCA 2R2OA 2H88B 2LJ5A 2J7QB 2KMAA 1IBXB 3TCAA 1V1PB 4KSKC 4YTPB 2ZNVC 2R2QA 2O6VD 1VZ8A 1I4PA 4KX6B 3DVNU 2J0KA 2LUMA 1XXGA 4JGHB 3A9KA 5AZGA 2V9HA 4JL9A 4RF0A 2DZKA 2M8SA 3AE4B 4MT5A 3PHXB 1WE7A 2KO3A 2WXLA 1CZPA 2CHZA 5G2NA 2KQ4X 1WR6E 4BOZB 1K50A 2C7HA 1TS4A 3U4EG 2KACA 3A1QB 2ACZB 1XCQL 4MSQB 1HXYD 4WJOA 1Q0WB 1DOYA 3ETRA 4CYEA 2K8HA 4XX5A 2KWDA 2INDC 3CF6E 4NQKE 1L0VB 1D5MC 1FMAD 1AN8A 1SE4A 2KFJA 4WWOA 1L7YA 1C77A 3U7DA 3NUHB 3RULA 1PFDA 1OTRB 5CTRC 2PEAA 3SDLC 2HTHA 1EWYC 3GOEA 2PIAA 4MJSB 2W54A 1FD6A 1HA5A 2WU2B 2R61A 1X1MA 4LDTD 1K53A 3Q14C 5BYRA 4HLEA 2M56B 5H92C 3ABVB 2NBWB 2OJWA 3RMKC 2RGFA 4OZBA 4A6QA 2L8JA 4IOIE 2KDFB 3A33B 4BKTA 3ZJVA 4C7YA 1RAXA 2RDGA 2BVCA 1UH6A 4HRSA 2V3NA 3A9JA 2WXJA 2MBBB 3P4SB 4JLCA 4IW0A 2V3SA 4EZKA 4JIOU 3BZDB 3NS8A 2N9KA 2DENB 2D3GA 3BVGA 1TS3A 3RNCC 4FULA 2ZNVB 3PRZA 4PYZA 3U52E 3VRBB 1ZDVA 2BWES 3B9JA 4GLSC 5CHWA 5D7GA 4A3PA 4IDIA 4DK5A 1A5RA 4IC7B 4X57B 1T6BX 2NMQA 5G5GA 2LVQA 1MHXA 3L17A 3V6CB 3I3TB 4RGMA 2GI9A 1P3QU 1FEHA 1N6ZA 3H7PB 1YD8U 4WWMA 1WGKA 2M4NA 4HWIB 1XO3A 1FXTB 1E6EB 4NJ6A 1KJTA 3DBRI 3GS2A 1KRHA 4OW0A 2G1EA 4J6IA 1N62A 5IN7A 5D6JB 2MWSB 5AUKA 3FAHA 5GXGB 3VR9B 2K22A 4RFBA 1J7CA 1ISNA 2I38A 1S1QB 2WX1A 2NBVB 2GBNA 3ZRCA 2WP9B 4I6NB 4ZRIA 2IGDA 4HXDA 2Y5PA 1EF1A 1R4NI 5BMGA 1V81A 1K52A 1P1AA 3W5UB 3NRZA 1M94A 1TT5B 5EE3A 2BYEA 2K6QA 2V3PA 3Q8FA 5G55A 4P16A 3U2SC 5HI1A 1WSPA 2WLBA 3BK2A 1YJIA 3VUXA 3PZ8A 3O13A 4W9KA 4N6EB 2AL6A 2G3QB 1FFUA 4BFRA 4GIVA 1RRBA 3GZNB 3OJ4B 2KX3A 2CHXA 1IPGA 3W1SA 1AWDA 3L10B 3EECA 2JUOA 3VRAB 2KLGA 4DBGA 2IGHA 2K8BA 3AE2B 5AUIA 2MBEA 4TUUA 3MC9A 3RZFA 3C19A 1PGXA 4GDKB 1V1PA 2JSVX 3HVZA 1WXAA 2ZEQA 3WIMA 1OGWA 1R7SA 1ZE3D 2BGFA 1UGMA 4M0WA 2KK8A 3ZTDA 4NZLB 3DPDA 2OHFA 2RDBC 4LJPB 4ZRKA 2CHWA 3NZSA 1JALA 4CO7A 2M19A 1KOTA 3HHMA 1E10A 1N61A 1WR1A 4AWJA 4WIPA 5DPRA 1JWMD 2DNFA 3RNAC 3ZXRA 2PVGC 2KDIA 2AEHA 2JPHA 3PLVA 4N9F4 1WMHA 2O2VA 4A9AA 3AECB 3HM6X 5EE1A 2JF5A 3AXCA 1PYWD 2QHOA 4DQOC 1V8CA 1D6EC 4MSMB 3AEEB 2LHDA 4HVBA 2WDTB 4B95A 1WJNA 1E9MA 1K51A 3D32A 2LUEA 1WZ0A 3Q3NC 2KDBA 1C4PA 2FBWB 2JYTA 4DXGA 4A90A 4LTUA 1Y56A 4A55A 3K9PB 1YJJA 5J17A 3M63B 4ANVA 1MI0A 3R7QA 1UZXB 1EWCA 3URYA 4F1SA 1JWUD 2LGDA 5HFYA 1ZP0B 1FRRA 5FR3A 4G50A 3ZNGC 2GMIC 1MG4A 1WXVA 3CSTA 4EOYA 1XCTL 4M02A 4LNKA 5CX3A 4DXAB 2MSED 2KJHB 3TJPA 2DX5B 4LK0M 2IO0B 5D3IB 2YVCA 5EE9A 3P63A 1QF6A 3UQAA 2KQ7A 4REZA 2DZMA 3I5JC 2JQRB 1B1ZA 5AEKB 2RDHA 4GDKA 2OJRA 3H8HA 4KGSA 1WGRA
chains in the Genus database with same CATH topology
4NY0A 5AZHA 3DVGY 3N3KB 4F7ZA 2KJ6A 3N30A 3P2BA 4W9CA 2EMSA 2M0XA 3DBSA 1TTNA 3L54A 4K81A 2N9XA 3ZO5B 4E74A 4IG7B 3H1UA 3PLUA 2DAFA 3AI5A 2XK5B 3M95A 4AUQC 2KZRA 3C0RB 3QCAA 4IM2A 5CHFA 5BO4B 2OOBB 1GG3A 2G45B 2JRIB 4KDLB 3S2AA 2KWCA 4DHJB 5EDSA 1EO6A 2R2OA 2UYZB 2LJ5A 2J7QB 2KMAA 4ASWC 3B0AA 1UD7A 3TCAA 2FCQA 4ZYNA 5IA7A 2GBKA 4KSKC 1WH3A 2ZNVC 4W9EA 2KFKB 4K7UA 4GSWA 2DZIA 2R2QA 1S3SG 2O6VD 3PPAA 2I1JA 1MG8A 2KXJA 3ECIA 1YJ1A 2LGYA 4WAAA 2FCMA 5HKHA 1YQBA 2REXA 3DVNU 2J0KA 4JGHB 3VAWA 1LQBA 3KUCB 1I35A 3A9KA 5AZGA 4JL9A 2JY6A 2MW5A 3UINB 2RSUA 3ALBA 4YL8A 3VUWA 2DZKA 2M8SA 3JSVA 2LD9A 3DQVA 5TR5A 3ZVVA 1WGDA 4BBNF 4MJSA 1GNUA 2LWPA 2KWVB 3PHXB 2HD5B 3VTUA 3ZDMC 1V9JA 1WE7A 2KO3A 2LVPA 3B08A 1VCBA 4EZJA 2CHZA 3DCGA 4URKA 3A1QA 5G2NA 5DCNA 2MBQA 2NBUA 1WR6E 2AL3A 3L13A 1E8ZA 4IWPA 2L0FA 4BOZB 4AJYB 4EKUA 2C7HA 2KANA 2GBMA 2MP2A 3ZUNA 3X23A 2IBIB 3V6EB 4LDTB 3VVWB 3KW5B 5C1ZA 1YX6B 2MLBA 3A1QB 3R3MA 4WWNA 4NNJB 2MRPA 4MH0E 3OAWA 1E7VA 2CU1A 4MSQB 1WIAA 4WJOA 1Q0WB 4KSLC 2C9WB 4CYEA 2K8HA 2XK5A 1WF9A 4XX5A 3CF6E 2EMTA 2KTRA 4NQKE 3PTFC 3A9JB 3ZNID 4K7SA 4DWFA 3DOWA 2KDEB 2KFJA 3DVNV 4WWOA 2C60A 1L7YA 3B1LX 2KOXA 4GB9A 4WQOB 3U7DA 2KFKA 3W1YA 3RULA 1E8XA 4MM3A 3U30A 2GBRA 2HE7A 3QQ8B 2DYOA 2PE6B 4AOFA 1OTRB 4W9LA 5CTRC 2PEAA 2FAZA 3L08A 3SDLC 2HTHA 3GOEA 3BINA 3PGEA 4MJSB 5E6NA 1WJUA 3OLMD 1RFAA 2EKEC 2K25A 1X1MA 4LDTD 4DHZE 5GMVA 2KHWB 2UWQA 3PV1A 1V86A 4HLEA 1GC7A 3PREA 3L0WB 1P9DU 2NBWB 2CS4A 1ZGUB 2RGFA 4OVVA 4JQWC 1UELA 2L8JA 4HPMB 2KDFB 3A33B 4FJYA 3H6NA 2D07B 4BKTA 2N1VA 4ANUA 1RAXA 4MGYE 1UH6A 3L16A 2IO1B 2YLMA 2MCNB 2KKCA 4A20A 2JZZA 1K8RB 2FCNA 3H7SA 2A5UA 3A9JA 3NY5A 2MBBB 1TZ1A 1WY8A 3BY4B 4JLCA 2BYVE 4IW0A 2A4ZA 2V3SA 2ZVNA 4EZKA 4MGIE 2ZCBA 4JIOU 2IZVB 3ENEA 3NS8A 2GBJA 2AYOB 2DENB 1QZEA 2D3GA 2Y5BB 3PHWB 3QC8B 1ZKHA 2KN5A 3ZKJC 3X0WA 3EHVA 3DBLI 3Q3JA 3UGBB 4GOCA 3UIOB 1WXSA 3APFA 4M0WB 2D2QA 1U4AA 1E8WA 2K39A 4GN1A 4PS8A 1OQYA 2N1WA 3HIZA 3PVLA 1WYWB 1WZ3A 1L2NA 3T8MA 4FULA 2ZNVB 3VXWA 3PRZA 4PYZA 1IP9A 4IM3A 4HCPB 4WJNA 3MJWA 4MELA 3LJ3A 2BWES 3ZLZA 4AP4C 3NHEB 5CHWA 5D7GA 5LXIB 1C1YB 3APCA 2MBHA 4A3PA 2L7RA 3VUYA 5JHBA 4DK5A 1A5RA 2IO2B 4GGQA 4IC7B 4W9IA 3VTVA 4NPNA 2I1KA 5IAAC 3MTNB 3DVGX 4ANXA 1EUVB 4TV3A 3O65B 4X57B 1C3TA 2ZPYA 1E90A 2KC1A 1NI2A 2NPTA 2WYQA 5DPSA 4BKSD 3RCZA 3UQBA 2LVQA 4RM8A 1WGYA 3CSFA 2LVOA 3AULA 1WGHA 4BVUC 2KTFA 3H9DA 3L17A 5LLIA 1TBEA 2C7MB 3V6CB 3I3TB 2MX2A 4BKGA 1V6EA 1R4MI 1P3QU 1XT9B 3OJ3A 3SHQA 2K1FA 3H7PB 1YD8U 4EFOA 1HE8A 2M4NA 2O6VA 4W9FA 2RPQA 4HWIB 1Z5SB 1XQQA 1FXTB 3RYTA 4NJ6A 1KM7A 1KJTA 2K6DB 1TGZB 4GXBA 4HK2A 4A3OA 3DBRI 2KJRA 3M62B 2KTRB 1F9JA 4J6IA 4HPLB 1RLFA 3K9OB 2IO3B 5D6JB 2MWSB 3A4SC 1Q1OA 3R7RA 3QJZA 1BT0A 4FN2A 3AU5A 4E71A 5FR6A 1ISNA 3AU4A 3H7PA 3V61A 5J18A 2MA9B 2Z59B 1S1QB 2D11A 2IYDB 2NBVB 2WX1A 2GBNA 3QWZB 3VH3B 3ZRCA 1WX7A 4MGZE 2GOWA 4I6PA 3PZDA 4I6NB 4ZRIA 4HXDA 1AARA 4FJVB 2KX0A 3KYCD 5E6OA 3VQIA 4XC2A 1EF1A 1R4NI 3VTWA 1V81A 1P1AA 3A4RA 3KYDD 2NCNA 4MGKE 2NVUI 2LZ6A 4FHKA 4BBNC 5AZFA 4P7IA 1V80A 1XD3B 1Q5WB 2B3AA 2Z0EB 1M94A 4WJQA 3ZTCA 3JVZX 2CKHB 2HJ8A 2BYEA 2K6QA 5L95C 1D3ZA 1KLVA 2N7EA 2N9EB 4ICVA 5G55A 3QIJA 2K8CA 4NAWB 1WX9A 3QARA 3VFKA 2LRWA 3TIXA 3KUDB 3U8ZA 2FIFA 1GC6A 4FBJB 3PRPB 3W1SC 2O6VB 2W9NA 3VUXA 4BKSA 3HK0A 3WAOA 2DZJA 2IY1B 4W9KA 4EZLA 4ZDVA 2AL6A 2G3QB 5J2RA 4BFRA 4GIVA 3APDA 4M8MA 2V1YA 1RRBA 2JT4B 3OJ4B 1UBIA 5CHVC 2KX3A 4II2B 4G3XB 2C5LC 3QK0A 2CHXA 3NZUA 1SE9A 4KDIC 3WA0A 1V5TA 4IUMB 1IPGA 1T0YA 1JRUA 3W1SA 4WWPA 2J0JA 2KNBA 4M8NA 2Z0DB 4PS7A 1ZW7A 1WRDB 3L10B 3QA8A 3EECA 2JUOA 3JSVB 4DDGD 2JZ3B 1WI0A 2NS5A 2KLGA 3RUIB 4DBGA 4TQ0A 4IWOA 4G11A 2K8BA 4OVUA 3V62A 2IY0B 4HJKA 4RM9A 4BOSC 3DDCB 1J19A 3RT3B 2M1MA 1P0RA 3PT2B 3ML9A 4DHJD 4EEWA 2CR5A 2N4FA 4XZ4A 2MBEA 4TUUA 4LCDE 2G4DB 1WJ6A 1WFYA 2PJHA 3RZFA 2MP2B 3RD2A 2MBOA 4GDKB 1GJZA 1WXAA 4KZ0A 2ZEQA 3Q3FA 3WIMA 2ZCCA 4AJWA 4HDQA 1OGWA 1LXDA 1OEYA 3IFWB 4ANWA 2BGFA 3EFUA 1UGMA 3IVFA 4G0NB 1P98A 4ICUA 2KK8A 3ZTDA 4ZRJA 4W9GA 4DHZB 2DYMA 2ZPNA 4IWQA 4RMAA 3DPDA 2FCSA 3WANA 2VRRB 1WJ4A 3IG3A 4LJPB 1OEYJ 1SIFA 2MQJA 3A9KB 4ZRKA 5C23A 2N7DA 3VH4B 3ZIMA 2CHWA 3WALA 3NZSA 4CO7A 1LM8B 1GUAB 3MHSD 2KQSA 1KOTA 1I42A 3HHMA 1NDDA 3IBEA 1WR1A 3KVFB 4AWJA 2J0MA 4FJZA 5DPRA 4KIKB 1WE6A 1WM3A 3ML8A 2KWUB 3SD5A 2BWFA 3UIPB 3WAPA 2KDIA 1CMXB 2AEHA 2JPHA 3M3JA 5JHAA 4B6WA 3PLVA 3ZNHB 1V49A 2ZZPB 3QX1A 4N9F4 1WMHA 2O2VA 4W9DA 1YX5B 1J8CA 1NBFC 4FA6A 4I6LB 2NPTB 4F8CB 4PS3A 3HM6X 2JF5A 2JWZA 2LXAA 3AXCA 2JVCA 3CMMB 2QHOA 4LJOB 3VDZA 2DHZA 2FIDA 2KLCA 5DPWA 3LDZE 2XEWA 5JH5C 4W9JA 1SGHA 1YIWA 2LASA 1WXMA 4FHJA 4MSMB 2RD0A 1WM2A 1WMHB 2O2VB 4E3CA 5JZEB 5KHQA 2LRUA 5E6PA 2JXXA 4HVBA 5DPTA 3JYUA 4W9HA 4KZCA 3PS6A 4CHKA 4MEMA 5KHOA 3UF8A 2WDTB 3V60A 2JRHA 1WJNA 1LFDA 4B95A 2ZJDA 3NOBA 2L00B 1E8YA 4FLHA 3QHTA 4II3B 4TKNA 3JW0X 3D32A 2LUEA 4HDOA 1WZ0A 2PE9A 1VD2A 3KUZA 4KVGB 3TMPB 2KDBA 2KVRA 1H4RA 4IM0A 1EF5A 5D94A 3WAMA 2FNJB 2D10A 2KMCA 2RR9A 2BPSA 2L3ZA 3K9PB 3QAQA 2L76A 1IYFA 5J17A 3M63B 4ANVA 4GDLB 4K1RB 1Y8RC 2KC2A 1E5WA 2M17A 2WX0A 2ASQA 4NQLB 4PYUA 4WJPA 3R7QA 3T9LA 3GZNI 3KH0A 1UZXB 3RZWC 1E7UA 4TQ1A 1UBQA 2FUHB 3DBHI 4NJ7A 4F1SA 1Z2MA 1WGGA 2LGDA 2V4LA 5L83A 4HCNB 5D2MB 1PQSA 4GU2A 2LI5A 1J0GA 2LXCA 4K7WA 1G6JA 3PRMB 1WX8A 4G50A 3EC8A 1V2YA 2GMIC 2LGXA 3ZNGC 4KIKA 1WXVA 2DAJA 3CSTA 3ZRFA 4EOYA 4NAWA 2PPHA 4B9KA 2N9PC 4GDLA 2ZVOA 5CX3A 3ONSA 2NR2A 3PSEB 3ZDTA 3R66C 4DXAB 4GMVA 2C7NB 2KD0A 2MSED 2L0TA 4KV2A 2DYBA 2AWTA 2KJHB 2WWZA 2XBBC 3TJPA 2DX5B 2BYFA 2IO0B 2BF8B 2YVCA 4FADA 3IHPC 3TL5A 2BKFA 3N32A 2G4SA 4MDKE 2KQ7A 3SU8X 3UQAA 1H8CA 2DZMA 3HM3A 2BKRB 3ZNZB 4EUTA 5AEKB 5LXHA 1V5OA 4GDKA 2OJRA 4DDID 2L05A 3ZW3A 1WGRA 3VHTC 3TBLD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NY0 A;  5AZH A;  3DVG Y;  3N3K B;  4F7Z A;  2KJ6 A;  3N30 A;  3P2B A;  4W9C A;  2EMS A;  2M0X A;  3DBS A;  1TTN A;  3L54 A;  4K81 A;  2N9X A;  3ZO5 B;  4E74 A;  4IG7 B;  3H1U A;  3PLU A;  2DAF A;  3AI5 A;  2XK5 B;  3M95 A;  4AUQ C;  2KZR A;  3C0R B;  3QCA A;  4IM2 A;  5CHF A;  5BO4 B;  2OOB B;  1GG3 A;  2G45 B;  2JRI B;  4KDL B;  3S2A A;  2KWC A;  4DHJ B;  5EDS A;  1EO6 A;  2R2O A;  2UYZ B;  2LJ5 A;  2J7Q B;  2KMA A;  4ASW C;  3B0A A;  1UD7 A;  3TCA A;  2FCQ A;  4ZYN A;  5IA7 A;  2GBK A;  4KSK C;  1WH3 A;  2ZNV C;  4W9E A;  2KFK B;  4K7U A;  4GSW A;  2DZI A;  2R2Q A;  1S3S G;  2O6V D;  3PPA A;  2I1J A;  1MG8 A;  2KXJ A;  3ECI A;  1YJ1 A;  2LGY A;  4WAA A;  2FCM A;  5HKH A;  1YQB A;  2REX A;  3DVN U;  2J0K A;  4JGH B;  3VAW A;  1LQB A;  3KUC B;  1I35 A;  3A9K A;  5AZG A;  4JL9 A;  2JY6 A;  2MW5 A;  3UIN B;  2RSU A;  3ALB A;  4YL8 A;  3VUW A;  2DZK A;  2M8S A;  3JSV A;  2LD9 A;  3DQV A;  5TR5 A;  3ZVV A;  1WGD A;  4BBN F;  4MJS A;  1GNU A;  2LWP A;  2KWV B;  3PHX B;  2HD5 B;  3VTU A;  3ZDM C;  1V9J A;  1WE7 A;  2KO3 A;  2LVP A;  3B08 A;  1VCB A;  4EZJ A;  2CHZ A;  3DCG A;  4URK A;  3A1Q A;  5G2N A;  5DCN A;  2MBQ A;  2NBU A;  1WR6 E;  2AL3 A;  3L13 A;  1E8Z A;  4IWP A;  2L0F A;  4BOZ B;  4AJY B;  4EKU A;  2C7H A;  2KAN A;  2GBM A;  2MP2 A;  3ZUN A;  3X23 A;  2IBI B;  3V6E B;  4LDT B;  3VVW B;  3KW5 B;  5C1Z A;  1YX6 B;  2MLB A;  3A1Q B;  3R3M A;  4WWN A;  4NNJ B;  2MRP A;  4MH0 E;  3OAW A;  1E7V A;  2CU1 A;  4MSQ B;  1WIA A;  4WJO A;  1Q0W B;  4KSL C;  2C9W B;  4CYE A;  2K8H A;  2XK5 A;  1WF9 A;  4XX5 A;  3CF6 E;  2EMT A;  2KTR A;  4NQK E;  3PTF C;  3A9J B;  3ZNI D;  4K7S A;  4DWF A;  3DOW A;  2KDE B;  2KFJ A;  3DVN V;  4WWO A;  2C60 A;  1L7Y A;  3B1L X;  2KOX A;  4GB9 A;  4WQO B;  3U7D A;  2KFK A;  3W1Y A;  3RUL A;  1E8X A;  4MM3 A;  3U30 A;  2GBR A;  2HE7 A;  3QQ8 B;  2DYO A;  2PE6 B;  4AOF A;  1OTR B;  4W9L A;  5CTR C;  2PEA A;  2FAZ A;  3L08 A;  3SDL C;  2HTH A;  3GOE A;  3BIN A;  3PGE A;  4MJS B;  5E6N A;  1WJU A;  3OLM D;  1RFA A;  2EKE C;  2K25 A;  1X1M A;  4LDT D;  4DHZ E;  5GMV A;  2KHW B;  2UWQ A;  3PV1 A;  1V86 A;  4HLE A;  1GC7 A;  3PRE A;  3L0W B;  1P9D U;  2NBW B;  2CS4 A;  1ZGU B;  2RGF A;  4OVV A;  4JQW C;  1UEL A;  2L8J A;  4HPM B;  2KDF B;  3A33 B;  4FJY A;  3H6N A;  2D07 B;  4BKT A;  2N1V A;  4ANU A;  1RAX A;  4MGY E;  1UH6 A;  3L16 A;  2IO1 B;  2YLM A;  2MCN B;  2KKC A;  4A20 A;  2JZZ A;  1K8R B;  2FCN A;  3H7S A;  2A5U A;  3A9J A;  3NY5 A;  2MBB B;  1TZ1 A;  1WY8 A;  3BY4 B;  4JLC A;  2BYV E;  4IW0 A;  2A4Z A;  2V3S A;  2ZVN A;  4EZK A;  4MGI E;  2ZCB A;  4JIO U;  2IZV B;  3ENE A;  3NS8 A;  2GBJ A;  2AYO B;  2DEN B;  1QZE A;  2D3G A;  2Y5B B;  3PHW B;  3QC8 B;  1ZKH A;  2KN5 A;  3ZKJ C;  3X0W A;  3EHV A;  3DBL I;  3Q3J A;  3UGB B;  4GOC A;  3UIO B;  1WXS A;  3APF A;  4M0W B;  2D2Q A;  1U4A A;  1E8W A;  2K39 A;  4GN1 A;  4PS8 A;  1OQY A;  2N1W A;  3HIZ A;  3PVL A;  1WYW B;  1WZ3 A;  1L2N A;  3T8M A;  4FUL A;  2ZNV B;  3VXW A;  3PRZ A;  4PYZ A;  1IP9 A;  4IM3 A;  4HCP B;  4WJN A;  3MJW A;  4MEL A;  3LJ3 A;  2BWE S;  3ZLZ A;  4AP4 C;  3NHE B;  5CHW A;  5D7G A;  5LXI B;  1C1Y B;  3APC A;  2MBH A;  4A3P A;  2L7R A;  3VUY A;  5JHB A;  4DK5 A;  1A5R A;  2IO2 B;  4GGQ A;  4IC7 B;  4W9I A;  3VTV A;  4NPN A;  2I1K A;  5IAA C;  3MTN B;  3DVG X;  4ANX A;  1EUV B;  4TV3 A;  3O65 B;  4X57 B;  1C3T A;  2ZPY A;  1E90 A;  2KC1 A;  1NI2 A;  2NPT A;  2WYQ A;  5DPS A;  4BKS D;  3RCZ A;  3UQB A;  2LVQ A;  4RM8 A;  1WGY A;  3CSF A;  2LVO A;  3AUL A;  1WGH A;  4BVU C;  2KTF A;  3H9D A;  3L17 A;  5LLI A;  1TBE A;  2C7M B;  3V6C B;  3I3T B;  2MX2 A;  4BKG A;  1V6E A;  1R4M I;  1P3Q U;  1XT9 B;  3OJ3 A;  3SHQ A;  2K1F A;  3H7P B;  1YD8 U;  4EFO A;  1HE8 A;  2M4N A;  2O6V A;  4W9F A;  2RPQ A;  4HWI B;  1Z5S B;  1XQQ A;  1FXT B;  3RYT A;  4NJ6 A;  1KM7 A;  1KJT A;  2K6D B;  1TGZ B;  4GXB A;  4HK2 A;  4A3O A;  3DBR I;  2KJR A;  3M62 B;  2KTR B;  1F9J A;  4J6I A;  4HPL B;  1RLF A;  3K9O B;  2IO3 B;  5D6J B;  2MWS B;  3A4S C;  1Q1O A;  3R7R A;  3QJZ A;  1BT0 A;  4FN2 A;  3AU5 A;  4E71 A;  5FR6 A;  1ISN A;  3AU4 A;  3H7P A;  3V61 A;  5J18 A;  2MA9 B;  2Z59 B;  1S1Q B;  2D11 A;  2IYD B;  2NBV B;  2WX1 A;  2GBN A;  3QWZ B;  3VH3 B;  3ZRC A;  1WX7 A;  4MGZ E;  2GOW A;  4I6P A;  3PZD A;  4I6N B;  4ZRI A;  4HXD A;  1AAR A;  4FJV B;  2KX0 A;  3KYC D;  5E6O A;  3VQI A;  4XC2 A;  1EF1 A;  1R4N I;  3VTW A;  1V81 A;  1P1A A;  3A4R A;  3KYD D;  2NCN A;  4MGK E;  2NVU I;  2LZ6 A;  4FHK A;  4BBN C;  5AZF A;  4P7I A;  1V80 A;  1XD3 B;  1Q5W B;  2B3A A;  2Z0E B;  1M94 A;  4WJQ A;  3ZTC A;  3JVZ X;  2CKH B;  2HJ8 A;  2BYE A;  2K6Q A;  5L95 C;  1D3Z A;  1KLV A;  2N7E A;  2N9E B;  4ICV A;  5G55 A;  3QIJ A;  2K8C A;  4NAW B;  1WX9 A;  3QAR A;  3VFK A;  2LRW A;  3TIX A;  3KUD B;  3U8Z A;  2FIF A;  1GC6 A;  4FBJ B;  3PRP B;  3W1S C;  2O6V B;  2W9N A;  3VUX A;  4BKS A;  3HK0 A;  3WAO A;  2DZJ A;  2IY1 B;  4W9K A;  4EZL A;  4ZDV A;  2AL6 A;  2G3Q B;  5J2R A;  4BFR A;  4GIV A;  3APD A;  4M8M A;  2V1Y A;  1RRB A;  2JT4 B;  3OJ4 B;  1UBI A;  5CHV C;  2KX3 A;  4II2 B;  4G3X B;  2C5L C;  3QK0 A;  2CHX A;  3NZU A;  1SE9 A;  4KDI C;  3WA0 A;  1V5T A;  4IUM B;  1IPG A;  1T0Y A;  1JRU A;  3W1S A;  4WWP A;  2J0J A;  2KNB A;  4M8N A;  2Z0D B;  4PS7 A;  1ZW7 A;  1WRD B;  3L10 B;  3QA8 A;  3EEC A;  2JUO A;  3JSV B;  4DDG D;  2JZ3 B;  1WI0 A;  2NS5 A;  2KLG A;  3RUI B;  4DBG A;  4TQ0 A;  4IWO A;  4G11 A;  2K8B A;  4OVU A;  3V62 A;  2IY0 B;  4HJK A;  4RM9 A;  4BOS C;  3DDC B;  1J19 A;  3RT3 B;  2M1M A;  1P0R A;  3PT2 B;  3ML9 A;  4DHJ D;  4EEW A;  2CR5 A;  2N4F A;  4XZ4 A;  2MBE A;  4TUU A;  4LCD E;  2G4D B;  1WJ6 A;  1WFY A;  2PJH A;  3RZF A;  2MP2 B;  3RD2 A;  2MBO A;  4GDK B;  1GJZ A;  1WXA A;  4KZ0 A;  2ZEQ A;  3Q3F A;  3WIM A;  2ZCC A;  4AJW A;  4HDQ A;  1OGW A;  1LXD A;  1OEY A;  3IFW B;  4ANW A;  2BGF A;  3EFU A;  1UGM A;  3IVF A;  4G0N B;  1P98 A;  4ICU A;  2KK8 A;  3ZTD A;  4ZRJ A;  4W9G A;  4DHZ B;  2DYM A;  2ZPN A;  4IWQ A;  4RMA A;  3DPD A;  2FCS A;  3WAN A;  2VRR B;  1WJ4 A;  3IG3 A;  4LJP B;  1OEY J;  1SIF A;  2MQJ A;  3A9K B;  4ZRK A;  5C23 A;  2N7D A;  3VH4 B;  3ZIM A;  2CHW A;  3WAL A;  3NZS A;  4CO7 A;  1LM8 B;  1GUA B;  3MHS D;  2KQS A;  1KOT A;  1I42 A;  3HHM A;  1NDD A;  3IBE A;  1WR1 A;  3KVF B;  4AWJ A;  2J0M A;  4FJZ A;  5DPR A;  4KIK B;  1WE6 A;  1WM3 A;  3ML8 A;  2KWU B;  3SD5 A;  2BWF A;  3UIP B;  3WAP A;  2KDI A;  1CMX B;  2AEH A;  2JPH A;  3M3J A;  5JHA A;  4B6W A;  3PLV A;  3ZNH B;  1V49 A;  2ZZP B;  3QX1 A;  4N9F 4;  1WMH A;  2O2V A;  4W9D A;  1YX5 B;  1J8C A;  1NBF C;  4FA6 A;  4I6L B;  2NPT B;  4F8C B;  4PS3 A;  3HM6 X;  2JF5 A;  2JWZ A;  2LXA A;  3AXC A;  2JVC A;  3CMM B;  2QHO A;  4LJO B;  3VDZ A;  2DHZ A;  2FID A;  2KLC A;  5DPW A;  3LDZ E;  2XEW A;  5JH5 C;  4W9J A;  1SGH A;  1YIW A;  2LAS A;  1WXM A;  4FHJ A;  4MSM B;  2RD0 A;  1WM2 A;  1WMH B;  2O2V B;  4E3C A;  5JZE B;  5KHQ A;  2LRU A;  5E6P A;  2JXX A;  4HVB A;  5DPT A;  3JYU A;  4W9H A;  4KZC A;  3PS6 A;  4CHK A;  4MEM A;  5KHO A;  3UF8 A;  2WDT B;  3V60 A;  2JRH A;  1WJN A;  1LFD A;  4B95 A;  2ZJD A;  3NOB A;  2L00 B;  1E8Y A;  4FLH A;  3QHT A;  4II3 B;  4TKN A;  3JW0 X;  3D32 A;  2LUE A;  4HDO A;  1WZ0 A;  2PE9 A;  1VD2 A;  3KUZ A;  4KVG B;  3TMP B;  2KDB A;  2KVR A;  1H4R A;  4IM0 A;  1EF5 A;  5D94 A;  3WAM A;  2FNJ B;  2D10 A;  2KMC A;  2RR9 A;  2BPS A;  2L3Z A;  3K9P B;  3QAQ A;  2L76 A;  1IYF A;  5J17 A;  3M63 B;  4ANV A;  4GDL B;  4K1R B;  1Y8R C;  2KC2 A;  1E5W A;  2M17 A;  2WX0 A;  2ASQ A;  4NQL B;  4PYU A;  4WJP A;  3R7Q A;  3T9L A;  3GZN I;  3KH0 A;  1UZX B;  3RZW C;  1E7U A;  4TQ1 A;  1UBQ A;  2FUH B;  3DBH I;  4NJ7 A;  4F1S A;  1Z2M A;  1WGG A;  2LGD A;  2V4L A;  5L83 A;  4HCN B;  5D2M B;  1PQS A;  4GU2 A;  2LI5 A;  1J0G A;  2LXC A;  4K7W A;  1G6J A;  3PRM B;  1WX8 A;  4G50 A;  3EC8 A;  1V2Y A;  2GMI C;  2LGX A;  3ZNG C;  4KIK A;  1WXV A;  2DAJ A;  3CST A;  3ZRF A;  4EOY A;  4NAW A;  2PPH A;  4B9K A;  2N9P C;  4GDL A;  2ZVO A;  5CX3 A;  3ONS A;  2NR2 A;  3PSE B;  3ZDT A;  3R66 C;  4DXA B;  4GMV A;  2C7N B;  2KD0 A;  2MSE D;  2L0T A;  4KV2 A;  2DYB A;  2AWT A;  2KJH B;  2WWZ A;  2XBB C;  3TJP A;  2DX5 B;  2BYF A;  2IO0 B;  2BF8 B;  2YVC A;  4FAD A;  3IHP C;  3TL5 A;  2BKF A;  3N32 A;  2G4S A;  4MDK E;  2KQ7 A;  3SU8 X;  3UQA A;  1H8C A;  2DZM A;  3HM3 A;  2BKR B;  3ZNZ B;  4EUT A;  5AEK B;  5LXH A;  1V5O A;  4GDK A;  2OJR A;  4DDI D;  2L05 A;  3ZW3 A;  1WGR A;  3VHT C;  3TBL D; 
#chains in the Genus database with same CATH topology
 1CK1 A;  4NY0 A;  5AZH A;  3T3O A;  2V0G A;  2N9X A;  3AI5 A;  4HKZ E;  1FRD A;  4UDU C;  5CHF A;  5BO4 B;  4KDL B;  1GG3 A;  2G45 B;  2JRI B;  1QOF A;  3KWV A;  5HG2 A;  1UD7 A;  2PW9 A;  1C78 A;  3DHH C;  1WH3 A;  2QDF A;  4N59 A;  4B0M A;  2DZI A;  2I1J A;  3ECI A;  1F0Z A;  2LGY A;  4WAA A;  3RNF C;  4C4V B;  2AQ3 B;  3VAW A;  1LQB A;  3AEG B;  2WNM A;  3AH7 A;  2JY6 A;  2RSU A;  2SEB D;  3ALB A;  4YL8 A;  4RGT A;  3VUW A;  1T0R C;  2LD9 A;  3JSV A;  3RNG C;  3ZVV A;  2HTM E;  4KKJ A;  5TR5 A;  2G9H D;  4BBN F;  1GNU A;  2KWV B;  2HD5 B;  2LVP A;  3B08 A;  2NTS A;  3NZ3 A;  2VZK D;  3IAS 1;  1XLN A;  1MHH E;  3L13 A;  2L0F A;  4ACF A;  4WUR A;  2DLB A;  1ACC A;  2LJI A;  2WU5 B;  4EKU A;  2KAN A;  3MP9 A;  2GBM A;  3NJT A;  3BYT B;  4XGA B;  3ZUN A;  2MEK A;  1YX6 B;  2MLB A;  3AEB B;  4NNJ B;  3Q8C A;  3P1M A;  1WIA A;  4ARC A;  2GB1 A;  2C9W B;  3SFE B;  2PVO D;  4XDD A;  1ZDX A;  2EMT A;  2KTR A;  3ZNI D;  2WQY B;  2WDQ B;  2KOX A;  1AYF A;  3FIL B;  3E9S A;  2KFK A;  5E6J A;  4MM3 A;  4AOF A;  2HE7 A;  3QQ8 B;  2PE6 B;  4KGT A;  4W9L A;  3W9C B;  1IGD A;  4YTM B;  3BWU D;  3MFG A;  4DHZ E;  1I4Q A;  1BUI C;  1DOI A;  1MVK A;  1TZO A;  3PRE A;  1I4G A;  1SF0 A;  1F1H A;  5BYQ A;  4JPS A;  1JWS D;  4OVV A;  4JQW C;  4MM3 B;  4K3B A;  1YNT E;  1V97 A;  2IO1 B;  2YLM A;  2KKC A;  2WXI A;  3TEW A;  3H7S A;  3E56 A;  3ENE A;  4H2A A;  4P1C C;  1ZKH A;  2KN5 A;  3DBL I;  4GOC A;  4M0W B;  4GN1 A;  4JE3 B;  4XE0 A;  1DYQ A;  1NYQ A;  2N1W A;  1WZ3 A;  4KKI A;  3T8M A;  3VXW A;  2L32 A;  3ZLZ A;  2KYW A;  4AP4 C;  3U7Z A;  2MJE A;  3APC A;  2MBH A;  2V4I B;  1WXQ A;  4W9I A;  4NPN A;  3TEZ A;  4HEA 1;  5IAA C;  5IKC M;  4TV3 A;  1C3T A;  2ZPY A;  1E90 A;  1NI2 A;  5DPS A;  4YWG G;  3UQB A;  2D3A A;  4YT0 B;  3RCZ A;  1WGY A;  3SFD B;  3CSF A;  2LVO A;  1WGH A;  1JML A;  2D5G A;  2C7M B;  2LGS A;  1KLG D;  1R4M I;  4ZYS A;  1XT9 B;  2K1F A;  2Y5C A;  2KN4 A;  1Z5S B;  1SJE D;  2K6D B;  1FIQ A;  1TGZ B;  3N20 C;  3M62 B;  2RPV A;  4HPL B;  1RLF A;  1I4X A;  3OG5 A;  3Q2A C;  4FN2 A;  2AQ1 B;  5FR6 A;  3H7P A;  2Z59 B;  1VZ6 A;  2XNA C;  1WX7 A;  2WXM A;  4LLG M;  3DWG C;  4FJV B;  2KX0 A;  3KYC D;  1SEB D;  4TMA B;  3VTW A;  4YSX B;  2BYT A;  3KYD D;  2NCN A;  3LB8 C;  2LZ6 A;  3HUI A;  4P7I A;  1V80 A;  1I4R A;  1Q5W B;  3AEA B;  2HJ8 A;  5EE0 A;  5BMI A;  1KLV A;  2NTT A;  3QIJ A;  2K8C A;  3VFK A;  2FUG 1;  2LRW A;  4HKQ A;  1QOB A;  2FIF A;  4MAC A;  2O6V B;  1JWB D;  3IT4 B;  1RWS A;  3Q8E A;  4RGN A;  4ZDV A;  5J2R A;  4M8M A;  2SAK A;  5CHV C;  1IGC A;  4G3X B;  2C5L C;  3QK0 A;  1SE9 A;  4RCO A;  1V5T A;  3WA0 A;  3WCQ A;  2DWQ A;  1T0Y A;  1FNU A;  2M0A A;  4PS7 A;  3ZXV A;  3QA8 A;  4P1B C;  4XWW A;  3JSV B;  1N5X A;  4TQ0 A;  4IWO A;  4OVU A;  2RMM A;  3RT3 B;  1LO5 D;  3P4R B;  4DHJ D;  4EEW A;  2CR5 A;  4LCD E;  2K0P A;  2PJH A;  4RGO S;  3EUB 2;  2J52 A;  4L2Y A;  3Q3F A;  3IFW B;  3EFU A;  3NVV A;  3IVF A;  4DHZ B;  4IWQ A;  4BAX A;  2VRR B;  3N9Y C;  1SIF A;  3ZJU A;  2I2Y A;  3BVZ A;  4O1N A;  1PUT A;  3N1Y C;  1GUA B;  5LNK 1;  1ZUD 2;  1I42 A;  3KVF B;  4B0E A;  4FJZ A;  4S0R A;  1T0Q C;  4PK1 A;  2WXN A;  2BWF A;  1HQR D;  4ARI A;  1ESF A;  1SB3 C;  3NVY A;  3AE7 B;  1V49 A;  2ZZP B;  3KLS X;  3QX1 A;  4W9D A;  4FA6 A;  4J3O D;  1EU3 A;  3ZJT A;  3VDZ A;  1NYR A;  2DHZ A;  5DPW A;  3LDZ E;  2XEW A;  5JH5 C;  1SGH A;  2LAS A;  2BTE A;  1WXM A;  1WM2 A;  1BML C;  3DWM A;  2AX5 A;  3RFZ B;  3JYU A;  1XLP A;  4CHK A;  3V60 A;  1F77 A;  2L00 B;  4FLH A;  3QHT A;  4TKN A;  3V05 A;  1A70 A;  4HDO A;  3J9C A;  1KLU D;  2KVR A;  2L52 A;  3SEB A;  4WAF A;  2KMC A;  2JYE A;  3N1Z C;  4FXC A;  2L76 A;  1IYF A;  4GDL B;  3RI7 C;  1Y8R C;  2KC2 A;  1ZXI A;  4C00 A;  3ZYY X;  1BXT A;  1N63 A;  1UBQ A;  2FUH B;  2HDE A;  5L83 A;  1L0Y B;  1PQS A;  1G6J A;  4D2K A;  1UWX A;  1WX8 A;  1FCL A;  2WXQ A;  4KIK A;  3GE3 C;  4B9K A;  1VR9 A;  2QIE B;  3PSE B;  1E7P B;  2QMT A;  1HZ6 A;  4KV2 A;  2DYB A;  3R8B A;  2BF8 B;  3MC8 A;  3OWE B;  1FFV A;  2BKF A;  3KWL A;  4MDK E;  3SU8 X;  4OZC A;  4EUT A;  4JWU C;  2L05 A;  2MH7 A;  1OFF A;  4M00 A;  3RNB C;  1C79 A;  4F7Z A;  4ZHP A;  4W9C A;  4RNA A;  2M0X A;  2K9X A;  4ZHO A;  1TTN A;  1HTO A;  1TYG B;  3V3X A;  4IG7 B;  4Q2J A;  5BMH A;  2DAF A;  2XK5 B;  1SJH D;  5MPO A;  3LYY A;  3C0R B;  3QCA A;  2OOB B;  2PMV A;  4ASW C;  4CQN A;  2FCQ A;  4C80 A;  4W9E A;  2KFK B;  2HJ1 A;  3DHG C;  1ENF A;  2KXJ A;  2FCM A;  5HKH A;  1YQB A;  2ZW1 A;  2ZW0 A;  3KUC B;  1QOG A;  1I35 A;  2MW5 A;  2QEJ C;  2W3S A;  3DQV A;  2FE8 A;  1WGD A;  2LWP A;  3VTU A;  4C56 C;  1VCB A;  2EKI A;  3A1Q A;  2AL3 A;  1HZ5 A;  1E8Z A;  4IWP A;  3IAM 1;  4AJY B;  2MP2 A;  1LGR A;  3X23 A;  1JWA D;  2IBI B;  4LDT B;  3VVW B;  4US9 A;  2BS3 B;  3R3M A;  4WWN A;  2MRP A;  1E7V A;  2WXP A;  2CU1 A;  2XK5 A;  3Q69 A;  1QLB B;  2BS4 B;  2JU6 X;  1YQ3 B;  2KDE B;  3DVN V;  3PZ7 A;  4IKG A;  1STE A;  4WQO B;  3W1Y A;  3T3N A;  1E8X A;  3L08 A;  1WJU A;  3OLM D;  4A8X C;  1VRA B;  2UWQ A;  3PV1 A;  2J42 A;  4N58 A;  2TSS A;  3VR8 B;  3L0W B;  1VLB A;  3GB1 A;  1ZGU B;  4K3C A;  1ROE A;  1UEL A;  4HPM B;  4FJY A;  3H6N A;  2D07 B;  5HHD G;  3RN9 C;  3W2D A;  3L16 A;  2MCN B;  4A20 A;  1FNW A;  1K8R B;  1FCC C;  2A5U A;  1P7E A;  1FXI A;  2A4Z A;  4MGI E;  1IUE A;  2GBJ A;  2AYO B;  1QZE A;  3PHW B;  3QC8 B;  4KGR A;  3X0W A;  3EHV A;  3Q3J A;  3UIO B;  3APF A;  3TSS A;  1E8W A;  4PS8 A;  1OQY A;  3Q6B A;  2BB6 A;  3R2T A;  3PVL A;  1WYW B;  3MHZ A;  1YQ4 B;  1L2N A;  1SE2 A;  2L83 A;  4WQM A;  1IP9 A;  4IM3 A;  3MJW A;  3LJ3 A;  3PO0 A;  5LXI B;  2L7R A;  1QIL A;  2IO2 B;  4GGQ A;  2IJ0 A;  2I1K A;  4ANX A;  3DVG X;  4EE2 A;  3O65 B;  1KF6 B;  1XF5 L;  2WYQ A;  4RM8 A;  4BVU C;  1GB1 A;  5LLI A;  1R4N B;  2INP E;  3OJ3 A;  2IGG A;  1JW9 D;  1QOA A;  4C7Z A;  2KVZ A;  2QIL A;  3N1X C;  4W9F A;  3P4Q B;  1TKG A;  1KTK A;  1ZPS A;  2KJR A;  4RH6 A;  2BT6 A;  2IO3 B;  1EM7 A;  3A4S C;  2QJL A;  2W82 A;  1BT0 A;  2BQQ A;  3AU5 A;  4E71 A;  4US8 A;  3AU4 A;  1J7A A;  5J18 A;  3HRD D;  1RFK A;  1QQR A;  4MGZ E;  2GOW A;  3PZD A;  5G5H A;  5E6O A;  3TEY A;  1PDX A;  4XC2 A;  5H8Y E;  3A4R A;  3RNE C;  4AQ7 A;  2NVU I;  3CIR B;  2WXG A;  4FHK A;  4BBN C;  5AZF A;  1XD3 B;  2JX5 A;  4WJQ A;  4L23 A;  2N7E A;  1T3Q A;  1NI3 A;  4NAW B;  3TIX A;  2QCZ A;  2IDY A;  4LNI A;  3MC0 B;  4BZA A;  3ZGZ A;  4BKS A;  5C3J B;  3HK0 A;  1EU4 A;  2IY1 B;  4EZL A;  3BK1 A;  3R2I A;  2V1Y A;  2WS3 B;  1UBI A;  4II2 B;  2KT7 A;  3NZU A;  4KDI C;  3AEF B;  1JRU A;  2D3B A;  1GOZ A;  5FK9 C;  2JZ3 B;  2NS5 A;  1D4B A;  1RM6 C;  4G11 A;  2IY0 B;  2WXR A;  3DDC B;  1J19 A;  2VH2 A;  3PT2 B;  3ML9 A;  3I63 C;  2N4F A;  3IXS A;  1TKY A;  1WJ6 A;  1WFY A;  2B76 B;  2MJD A;  2MP2 B;  3RD2 A;  2MBO A;  3CWI A;  3AE6 B;  1GJZ A;  5IP4 D;  3AE9 B;  4AJW A;  1CQV A;  1OEY A;  4G0N B;  4ICU A;  3RPF C;  2N7J A;  4ZRJ A;  4W9G A;  2DYM A;  4RMA A;  5JXV A;  3FC4 A;  3W5V B;  1WJ4 A;  3IG3 A;  4LNO A;  1OEY J;  3A9K B;  1L5P A;  3NG0 A;  2N7D A;  3VH4 B;  4YSY B;  1KFY B;  1L0X B;  3MHS D;  1DOX A;  1T0S C;  1WM3 A;  2N0S B;  1YMH E;  2D3C A;  2KWU B;  1CMX B;  5JHA A;  3M3J A;  3ZNH B;  3GP7 A;  1UUP A;  1YX5 B;  1MFW A;  4I6L B;  3AED B;  2NPT B;  2JWZ A;  2LXA A;  2JVC A;  3CMM B;  4LJO B;  1XLQ A;  2KLC A;  2MJ3 A;  1YIW A;  4FHJ A;  2WDR B;  1WMH B;  2O2V B;  4E3C A;  5KHQ A;  2LRU A;  5E6P A;  5DPT A;  4W9H A;  2ONQ A;  3UF8 A;  1C9F A;  2JRH A;  1LFD A;  2INN E;  3NOB A;  1E8Y A;  2X38 A;  1WWT A;  3TMP B;  2KDM A;  2WHI A;  4IM0 A;  2RR9 A;  2BPS A;  2L3Z A;  4YSZ B;  1B9R A;  1R4M B;  3AE8 B;  1E5W A;  2WX0 A;  4WJP A;  4PYU A;  3GZN I;  1E7U A;  4TQ1 A;  1TKE A;  2JZP A;  4NJ7 A;  2V4L A;  3AN1 A;  1J0G A;  1TY2 A;  2LXC A;  3PRM B;  1UNS A;  1V2Y A;  1WRI A;  3ZRF A;  2CJN A;  4NAW A;  4QAY A;  2N9P C;  4GDL A;  2ZVO A;  2Z8L A;  3C8Y A;  3NS1 A;  1VDV A;  2NR2 A;  4GMV A;  2JXT A;  2L0T A;  2WWZ A;  2XBB C;  3IHP C;  3TL5 A;  3N32 A;  1MJD A;  1J7B A;  2JWU A;  2BKR B;  3I57 A;  3P4P B;  5LXH A;  1V5O A;  1YN3 A;  4DDI D;  3VHT C;  3TBL D;  3DVG Y;  4OVZ A;  2KJ6 A;  4ITK A;  3ZO5 B;  5T8I A;  4ZRP A;  3PLU A;  1PGA A;  3DBR B;  3P42 A;  2KZR A;  4XDC A;  3EGR A;  1SIJ A;  4DHJ B;  2MHJ A;  1EO6 A;  3EFC A;  2UYZ B;  3B0A A;  3AE5 B;  4ZYN A;  5IA7 A;  2GBK A;  4P6V F;  2ON8 A;  1I4H A;  4K7U A;  3B2F A;  4GSW A;  3ZQ4 A;  1S3S G;  3PPA A;  1MG8 A;  1YJ1 A;  2YEP B;  2BB5 A;  3GE8 C;  4HJG E;  2REX A;  2VH1 A;  5I4D A;  2VZK B;  1RYJ A;  3UIN B;  5D3D A;  3NVW A;  4MJS A;  4HPP A;  3ZDM C;  3HVD A;  1V9J A;  4L1B A;  4C4V A;  4EZJ A;  3DCG A;  4URK A;  5DCN A;  2MBQ A;  2NBU A;  1JRP A;  1XLO A;  2XN9 C;  1UWM A;  1IBX A;  3V6E B;  1PGB A;  3KW5 B;  5C1Z A;  4JWS C;  1L6V A;  4MH0 E;  3OAW A;  2LFI A;  4KSL C;  2N9L A;  1HEZ E;  3KQ4 A;  5C2T B;  1WF9 A;  5BYS A;  3PTF C;  1N60 A;  2QC8 A;  3A9J B;  4K7S A;  4DWF A;  3DOW A;  4AS1 A;  2C60 A;  1XEE A;  2GLS A;  3B1L X;  1QT9 A;  4GB9 A;  1V1O A;  3U30 A;  2GBR A;  2DYO A;  2LMC A;  2FAZ A;  2H89 B;  2LHE A;  3BIN A;  5TSS A;  3PGE A;  5E6N A;  1RFA A;  2EKE C;  1YOV B;  2K25 A;  5GMV A;  1VZ7 A;  2KHW B;  1V86 A;  1GC7 A;  1MPE A;  1M4V A;  4NJC A;  1P9D U;  1FM0 D;  2CS4 A;  2LGI A;  1NEN B;  2GRI A;  2PTL A;  2N1V A;  4ANU A;  1TY0 A;  4MGY E;  2JZZ A;  2FCN A;  1D5Z C;  2WGS A;  3NY5 A;  1TZ1 A;  1WY8 A;  1GB4 A;  3BY4 B;  1P7F A;  2BYV E;  1VJK A;  4LNN A;  2E6X A;  2ZVN A;  4JX1 C;  1GPX A;  2ZCB A;  2IZV B;  1ET9 A;  2WXK A;  2Y5B B;  3ZKJ C;  3UGB B;  1YN4 A;  1WXS A;  2INC C;  2D2Q A;  1U4A A;  1E0Z A;  2K39 A;  3HIZ A;  1T5X D;  1N5W A;  4HCP B;  4WJN A;  2CU3 A;  4MEL A;  3NHE B;  2WXF A;  1TIF A;  1L4Z B;  1C1Y B;  3VUY A;  5JHB A;  2EEL A;  3VTV A;  3MTN B;  1EUV B;  2K3U A;  2KAJ A;  2KC1 A;  2NPT A;  4BKS D;  3TUO A;  3AUL A;  3EA6 A;  2KTF A;  3H9D A;  1TBE A;  1FPY A;  3AV8 A;  2MX2 A;  4NAM A;  4BKG A;  1V6E A;  2Q5W D;  2KMM A;  3SHQ A;  3BYY B;  4USA A;  4EFO A;  1HE8 A;  2O6V A;  2RPQ A;  2WDV B;  1XQQ A;  3RYT A;  1KM7 A;  1KH0 A;  4GXB A;  4HK2 A;  4A3O A;  1NVI D;  2KTR B;  2UU7 A;  1FNV A;  1F9J A;  2LEK A;  3K9O B;  1Q1O A;  3R7R A;  3QJZ A;  3TEX A;  3V61 A;  2MA9 B;  2D11 A;  2IYD B;  3VH3 B;  2IPK D;  3QWZ B;  3IT6 B;  2BBC A;  4I6P A;  4ZRQ A;  1AAR A;  3VQI A;  4ZOH C;  3I9V 1;  4MH8 A;  4MGK E;  3AMZ A;  2B3A A;  2Z0E B;  3ZTC A;  1D3Z A;  3JVZ X;  2CKH B;  5L95 C;  1AW7 A;  2BW2 A;  1L4D B;  1FXA A;  2YEP F;  2N9E B;  4ICV A;  1C4C A;  1WX9 A;  2PLP A;  3QAR A;  3KUD B;  3U8Z A;  2J4X A;  3UI3 A;  2K5P A;  1GC6 A;  4FBJ B;  3PRP B;  4S17 A;  3W1S C;  2W9N A;  2WXH A;  3WAO A;  2DZJ A;  3APD A;  2JT4 B;  1FO4 A;  1GAQ B;  4IUM B;  3BII D;  4WWP A;  2J0J A;  2KNB A;  3L4P A;  2Z0D B;  4M8N A;  1ZW7 A;  1WRD B;  2BS2 B;  3DBL B;  1HTQ A;  4DDG D;  1WI0 A;  1F2R I;  4HRO A;  3RUI B;  1C76 A;  4BOS C;  3AE3 B;  3V62 A;  4HJK A;  4RM9 A;  1OQR A;  3NVZ A;  2M1M A;  1P0R A;  1UF0 A;  2DBY A;  4XZ4 A;  1C4A A;  1F52 A;  5FKA C;  2G4D B;  4KZ0 A;  3LXF A;  4LNF A;  2ZCC A;  4OHJ A;  4HDQ A;  1LXD A;  2J53 A;  4ANW A;  1P98 A;  3B2G A;  3MJ5 A;  2WXO A;  2ZPN A;  2FCS A;  3WAN A;  3Q3O C;  2MQJ A;  5C23 A;  3ZIM A;  3WAL A;  1QKZ A;  2W55 A;  1LM8 B;  3FKY A;  1Q10 A;  2KQS A;  2QSD A;  1NDD A;  3IBE A;  1OQQ A;  2J0M A;  4KIK B;  1JCK B;  2OED A;  1WE6 A;  3ML8 A;  4OZA A;  3SD5 A;  1JRO A;  3UIP B;  3WAP A;  1CJE A;  3FIL A;  1SE3 A;  4B6W A;  4RF1 A;  1SBB B;  1SSN A;  1J8C A;  1NBF C;  4F8C B;  1ET6 A;  4PS3 A;  1L6U A;  2FID A;  4PT5 A;  4W9J A;  2CJO A;  2RD0 A;  5JZE B;  3Q8A A;  2JXX A;  2E3T A;  4KZC A;  3PS6 A;  4MEM A;  5KHO A;  2ZJD A;  4II3 B;  3JW0 X;  1TJE A;  1UGJ A;  2PE9 A;  1VD2 A;  3KUZ A;  4WH4 A;  4KVG B;  1H4R A;  1EF5 A;  5D94 A;  3WAM A;  2FNJ B;  2D10 A;  1YN5 A;  1JQ4 A;  3QAQ A;  3AM9 A;  4K1R B;  4YXD B;  3T9L A;  1NEK B;  2M17 A;  2ASQ A;  4NQL B;  3KH0 A;  1TS2 A;  3RZW C;  2ICI A;  3DBH I;  1D5X C;  1Z2M A;  4R3D A;  1WGG A;  4HCN B;  5D2M B;  4TSS A;  4GU2 A;  2LI5 A;  4K7W A;  4DXF A;  1DGJ A;  3EC8 A;  2LGX A;  4M01 A;  2DAJ A;  2PPH A;  3BVM A;  4XYC A;  2Y3A A;  1TS5 A;  3ONS A;  5IO9 A;  3ZDT A;  3R66 C;  2C7N B;  2KD0 A;  3SR6 A;  1ZXH A;  2AWT A;  5IOI A;  2BYF A;  4FAD A;  2AQ2 B;  2G4S A;  1H8C A;  3HM3 A;  3ZNZ B;  3DHI C;  4YTN B;  1SXT A;  3Q8B A;  3ZW3 A;  2L1A A;  3AB5 A;  2PKO A;  3N3K B;  3N30 A;  3DBH B;  3P2B A;  2EMS A;  3AE1 B;  3DBS A;  1WYG A;  3L54 A;  1ZOY B;  4K81 A;  2W3R A;  3Q3M C;  4E74 A;  1I7H A;  3H1U A;  3M95 A;  4AUQ C;  2X8X X;  4IM2 A;  1F2R C;  4XWT A;  5EDS A;  3S2A A;  2KWC A;  2R2O A;  2H88 B;  2LJ5 A;  2J7Q B;  2KMA A;  1IBX B;  3TCA A;  1V1P B;  4KSK C;  4YTP B;  2ZNV C;  2R2Q A;  2O6V D;  1VZ8 A;  1I4P A;  4KX6 B;  3DVN U;  2J0K A;  2LUM A;  1XXG A;  4JGH B;  3A9K A;  5AZG A;  2V9H A;  4JL9 A;  4RF0 A;  2DZK A;  2M8S A;  3AE4 B;  4MT5 A;  3PHX B;  1WE7 A;  2KO3 A;  2WXL A;  1CZP A;  2CHZ A;  5G2N A;  2KQ4 X;  1WR6 E;  4BOZ B;  1K50 A;  2C7H A;  1TS4 A;  3U4E G;  2KAC A;  3A1Q B;  2ACZ B;  1XCQ L;  4MSQ B;  1HXY D;  4WJO A;  1Q0W B;  1DOY A;  3ETR A;  4CYE A;  2K8H A;  4XX5 A;  2KWD A;  2IND C;  3CF6 E;  4NQK E;  1L0V B;  1D5M C;  1FMA D;  1AN8 A;  1SE4 A;  2KFJ A;  4WWO A;  1L7Y A;  1C77 A;  3U7D A;  3NUH B;  3RUL A;  1PFD A;  1OTR B;  5CTR C;  2PEA A;  3SDL C;  2HTH A;  1EWY C;  3GOE A;  2PIA A;  4MJS B;  2W54 A;  1FD6 A;  1HA5 A;  2WU2 B;  2R61 A;  1X1M A;  4LDT D;  1K53 A;  3Q14 C;  5BYR A;  4HLE A;  2M56 B;  5H92 C;  3ABV B;  2NBW B;  2OJW A;  3RMK C;  2RGF A;  4OZB A;  4A6Q A;  2L8J A;  4IOI E;  2KDF B;  3A33 B;  4BKT A;  3ZJV A;  4C7Y A;  1RAX A;  2RDG A;  2BVC A;  1UH6 A;  4HRS A;  2V3N A;  3A9J A;  2WXJ A;  2MBB B;  3P4S B;  4JLC A;  4IW0 A;  2V3S A;  4EZK A;  4JIO U;  3BZD B;  3NS8 A;  2N9K A;  2DEN B;  2D3G A;  3BVG A;  1TS3 A;  3RNC C;  4FUL A;  2ZNV B;  3PRZ A;  4PYZ A;  3U52 E;  3VRB B;  1ZDV A;  2BWE S;  3B9J A;  4GLS C;  5CHW A;  5D7G A;  4A3P A;  4IDI A;  4DK5 A;  1A5R A;  4IC7 B;  4X57 B;  1T6B X;  2NMQ A;  5G5G A;  2LVQ A;  1MHX A;  3L17 A;  3V6C B;  3I3T B;  4RGM A;  2GI9 A;  1P3Q U;  1FEH A;  1N6Z A;  3H7P B;  1YD8 U;  4WWM A;  1WGK A;  2M4N A;  4HWI B;  1XO3 A;  1FXT B;  1E6E B;  4NJ6 A;  1KJT A;  3DBR I;  3GS2 A;  1KRH A;  4OW0 A;  2G1E A;  4J6I A;  1N62 A;  5IN7 A;  5D6J B;  2MWS B;  5AUK A;  3FAH A;  5GXG B;  3VR9 B;  2K22 A;  4RFB A;  1J7C A;  1ISN A;  2I38 A;  1S1Q B;  2WX1 A;  2NBV B;  2GBN A;  3ZRC A;  2WP9 B;  4I6N B;  4ZRI A;  2IGD A;  4HXD A;  2Y5P A;  1EF1 A;  1R4N I;  5BMG A;  1V81 A;  1K52 A;  1P1A A;  3W5U B;  3NRZ A;  1M94 A;  1TT5 B;  5EE3 A;  2BYE A;  2K6Q A;  2V3P A;  3Q8F A;  5G55 A;  4P16 A;  3U2S C;  5HI1 A;  1WSP A;  2WLB A;  3BK2 A;  1YJI A;  3VUX A;  3PZ8 A;  3O13 A;  4W9K A;  4N6E B;  2AL6 A;  2G3Q B;  1FFU A;  4BFR A;  4GIV A;  1RRB A;  3GZN B;  3OJ4 B;  2KX3 A;  2CHX A;  1IPG A;  3W1S A;  1AWD A;  3L10 B;  3EEC A;  2JUO A;  3VRA B;  2KLG A;  4DBG A;  2IGH A;  2K8B A;  3AE2 B;  5AUI A;  2MBE A;  4TUU A;  3MC9 A;  3RZF A;  3C19 A;  1PGX A;  4GDK B;  1V1P A;  2JSV X;  3HVZ A;  1WXA A;  2ZEQ A;  3WIM A;  1OGW A;  1R7S A;  1ZE3 D;  2BGF A;  1UGM A;  4M0W A;  2KK8 A;  3ZTD A;  4NZL B;  3DPD A;  2OHF A;  2RDB C;  4LJP B;  4ZRK A;  2CHW A;  3NZS A;  1JAL A;  4CO7 A;  2M19 A;  1KOT A;  3HHM A;  1E10 A;  1N61 A;  1WR1 A;  4AWJ A;  4WIP A;  5DPR A;  1JWM D;  2DNF A;  3RNA C;  3ZXR A;  2PVG C;  2KDI A;  2AEH A;  2JPH A;  3PLV A;  4N9F 4;  1WMH A;  2O2V A;  4A9A A;  3AEC B;  3HM6 X;  5EE1 A;  2JF5 A;  3AXC A;  1PYW D;  2QHO A;  4DQO C;  1V8C A;  1D6E C;  4MSM B;  3AEE B;  2LHD A;  4HVB A;  2WDT B;  4B95 A;  1WJN A;  1E9M A;  1K51 A;  3D32 A;  2LUE A;  1WZ0 A;  3Q3N C;  2KDB A;  1C4P A;  2FBW B;  2JYT A;  4DXG A;  4A90 A;  4LTU A;  1Y56 A;  4A55 A;  3K9P B;  1YJJ A;  5J17 A;  3M63 B;  4ANV A;  1MI0 A;  3R7Q A;  1UZX B;  1EWC A;  3URY A;  4F1S A;  1JWU D;  2LGD A;  5HFY A;  1ZP0 B;  1FRR A;  5FR3 A;  4G50 A;  3ZNG C;  2GMI C;  1MG4 A;  1WXV A;  3CST A;  4EOY A;  1XCT L;  4M02 A;  4LNK A;  5CX3 A;  4DXA B;  2MSE D;  2KJH B;  3TJP A;  2DX5 B;  4LK0 M;  2IO0 B;  5D3I B;  2YVC A;  5EE9 A;  3P63 A;  1QF6 A;  3UQA A;  2KQ7 A;  4REZ A;  2DZM A;  3I5J C;  2JQR B;  1B1Z A;  5AEK B;  2RDH A;  4GDK A;  2OJR A;  3H8H A;  4KGS A;  1WGR A; 
#chains in the Genus database with same CATH homology
 4NY0 A;  5AZH A;  3DVG Y;  3N3K B;  4F7Z A;  2KJ6 A;  3N30 A;  3P2B A;  4W9C A;  2EMS A;  2M0X A;  3DBS A;  1TTN A;  3L54 A;  4K81 A;  2N9X A;  3ZO5 B;  4E74 A;  4IG7 B;  3H1U A;  3PLU A;  2DAF A;  3AI5 A;  2XK5 B;  3M95 A;  4AUQ C;  2KZR A;  3C0R B;  3QCA A;  4IM2 A;  5CHF A;  5BO4 B;  2OOB B;  1GG3 A;  2G45 B;  2JRI B;  4KDL B;  3S2A A;  2KWC A;  4DHJ B;  5EDS A;  1EO6 A;  2R2O A;  2UYZ B;  2LJ5 A;  2J7Q B;  2KMA A;  4ASW C;  3B0A A;  1UD7 A;  3TCA A;  2FCQ A;  4ZYN A;  5IA7 A;  2GBK A;  4KSK C;  1WH3 A;  2ZNV C;  4W9E A;  2KFK B;  4K7U A;  4GSW A;  2DZI A;  2R2Q A;  1S3S G;  2O6V D;  3PPA A;  2I1J A;  1MG8 A;  2KXJ A;  3ECI A;  1YJ1 A;  2LGY A;  4WAA A;  2FCM A;  5HKH A;  1YQB A;  2REX A;  3DVN U;  2J0K A;  4JGH B;  3VAW A;  1LQB A;  3KUC B;  1I35 A;  3A9K A;  5AZG A;  4JL9 A;  2JY6 A;  2MW5 A;  3UIN B;  2RSU A;  3ALB A;  4YL8 A;  3VUW A;  2DZK A;  2M8S A;  3JSV A;  2LD9 A;  3DQV A;  5TR5 A;  3ZVV A;  1WGD A;  4BBN F;  4MJS A;  1GNU A;  2LWP A;  2KWV B;  3PHX B;  2HD5 B;  3VTU A;  3ZDM C;  1V9J A;  1WE7 A;  2KO3 A;  2LVP A;  3B08 A;  1VCB A;  4EZJ A;  2CHZ A;  3DCG A;  4URK A;  3A1Q A;  5G2N A;  5DCN A;  2MBQ A;  2NBU A;  1WR6 E;  2AL3 A;  3L13 A;  1E8Z A;  4IWP A;  2L0F A;  4BOZ B;  4AJY B;  4EKU A;  2C7H A;  2KAN A;  2GBM A;  2MP2 A;  3ZUN A;  3X23 A;  2IBI B;  3V6E B;  4LDT B;  3VVW B;  3KW5 B;  5C1Z A;  1YX6 B;  2MLB A;  3A1Q B;  3R3M A;  4WWN A;  4NNJ B;  2MRP A;  4MH0 E;  3OAW A;  1E7V A;  2CU1 A;  4MSQ B;  1WIA A;  4WJO A;  1Q0W B;  4KSL C;  2C9W B;  4CYE A;  2K8H A;  2XK5 A;  1WF9 A;  4XX5 A;  3CF6 E;  2EMT A;  2KTR A;  4NQK E;  3PTF C;  3A9J B;  3ZNI D;  4K7S A;  4DWF A;  3DOW A;  2KDE B;  2KFJ A;  3DVN V;  4WWO A;  2C60 A;  1L7Y A;  3B1L X;  2KOX A;  4GB9 A;  4WQO B;  3U7D A;  2KFK A;  3W1Y A;  3RUL A;  1E8X A;  4MM3 A;  3U30 A;  2GBR A;  2HE7 A;  3QQ8 B;  2DYO A;  2PE6 B;  4AOF A;  1OTR B;  4W9L A;  5CTR C;  2PEA A;  2FAZ A;  3L08 A;  3SDL C;  2HTH A;  3GOE A;  3BIN A;  3PGE A;  4MJS B;  5E6N A;  1WJU A;  3OLM D;  1RFA A;  2EKE C;  2K25 A;  1X1M A;  4LDT D;  4DHZ E;  5GMV A;  2KHW B;  2UWQ A;  3PV1 A;  1V86 A;  4HLE A;  1GC7 A;  3PRE A;  3L0W B;  1P9D U;  2NBW B;  2CS4 A;  1ZGU B;  2RGF A;  4OVV A;  4JQW C;  1UEL A;  2L8J A;  4HPM B;  2KDF B;  3A33 B;  4FJY A;  3H6N A;  2D07 B;  4BKT A;  2N1V A;  4ANU A;  1RAX A;  4MGY E;  1UH6 A;  3L16 A;  2IO1 B;  2YLM A;  2MCN B;  2KKC A;  4A20 A;  2JZZ A;  1K8R B;  2FCN A;  3H7S A;  2A5U A;  3A9J A;  3NY5 A;  2MBB B;  1TZ1 A;  1WY8 A;  3BY4 B;  4JLC A;  2BYV E;  4IW0 A;  2A4Z A;  2V3S A;  2ZVN A;  4EZK A;  4MGI E;  2ZCB A;  4JIO U;  2IZV B;  3ENE A;  3NS8 A;  2GBJ A;  2AYO B;  2DEN B;  1QZE A;  2D3G A;  2Y5B B;  3PHW B;  3QC8 B;  1ZKH A;  2KN5 A;  3ZKJ C;  3X0W A;  3EHV A;  3DBL I;  3Q3J A;  3UGB B;  4GOC A;  3UIO B;  1WXS A;  3APF A;  4M0W B;  2D2Q A;  1U4A A;  1E8W A;  2K39 A;  4GN1 A;  4PS8 A;  1OQY A;  2N1W A;  3HIZ A;  3PVL A;  1WYW B;  1WZ3 A;  1L2N A;  3T8M A;  4FUL A;  2ZNV B;  3VXW A;  3PRZ A;  4PYZ A;  1IP9 A;  4IM3 A;  4HCP B;  4WJN A;  3MJW A;  4MEL A;  3LJ3 A;  2BWE S;  3ZLZ A;  4AP4 C;  3NHE B;  5CHW A;  5D7G A;  5LXI B;  1C1Y B;  3APC A;  2MBH A;  4A3P A;  2L7R A;  3VUY A;  5JHB A;  4DK5 A;  1A5R A;  2IO2 B;  4GGQ A;  4IC7 B;  4W9I A;  3VTV A;  4NPN A;  2I1K A;  5IAA C;  3MTN B;  3DVG X;  4ANX A;  1EUV B;  4TV3 A;  3O65 B;  4X57 B;  1C3T A;  2ZPY A;  1E90 A;  2KC1 A;  1NI2 A;  2NPT A;  2WYQ A;  5DPS A;  4BKS D;  3RCZ A;  3UQB A;  2LVQ A;  4RM8 A;  1WGY A;  3CSF A;  2LVO A;  3AUL A;  1WGH A;  4BVU C;  2KTF A;  3H9D A;  3L17 A;  5LLI A;  1TBE A;  2C7M B;  3V6C B;  3I3T B;  2MX2 A;  4BKG A;  1V6E A;  1R4M I;  1P3Q U;  1XT9 B;  3OJ3 A;  3SHQ A;  2K1F A;  3H7P B;  1YD8 U;  4EFO A;  1HE8 A;  2M4N A;  2O6V A;  4W9F A;  2RPQ A;  4HWI B;  1Z5S B;  1XQQ A;  1FXT B;  3RYT A;  4NJ6 A;  1KM7 A;  1KJT A;  2K6D B;  1TGZ B;  4GXB A;  4HK2 A;  4A3O A;  3DBR I;  2KJR A;  3M62 B;  2KTR B;  1F9J A;  4J6I A;  4HPL B;  1RLF A;  3K9O B;  2IO3 B;  5D6J B;  2MWS B;  3A4S C;  1Q1O A;  3R7R A;  3QJZ A;  1BT0 A;  4FN2 A;  3AU5 A;  4E71 A;  5FR6 A;  1ISN A;  3AU4 A;  3H7P A;  3V61 A;  5J18 A;  2MA9 B;  2Z59 B;  1S1Q B;  2D11 A;  2IYD B;  2NBV B;  2WX1 A;  2GBN A;  3QWZ B;  3VH3 B;  3ZRC A;  1WX7 A;  4MGZ E;  2GOW A;  4I6P A;  3PZD A;  4I6N B;  4ZRI A;  4HXD A;  1AAR A;  4FJV B;  2KX0 A;  3KYC D;  5E6O A;  3VQI A;  4XC2 A;  1EF1 A;  1R4N I;  3VTW A;  1V81 A;  1P1A A;  3A4R A;  3KYD D;  2NCN A;  4MGK E;  2NVU I;  2LZ6 A;  4FHK A;  4BBN C;  5AZF A;  4P7I A;  1V80 A;  1XD3 B;  1Q5W B;  2B3A A;  2Z0E B;  1M94 A;  4WJQ A;  3ZTC A;  3JVZ X;  2CKH B;  2HJ8 A;  2BYE A;  2K6Q A;  5L95 C;  1D3Z A;  1KLV A;  2N7E A;  2N9E B;  4ICV A;  5G55 A;  3QIJ A;  2K8C A;  4NAW B;  1WX9 A;  3QAR A;  3VFK A;  2LRW A;  3TIX A;  3KUD B;  3U8Z A;  2FIF A;  1GC6 A;  4FBJ B;  3PRP B;  3W1S C;  2O6V B;  2W9N A;  3VUX A;  4BKS A;  3HK0 A;  3WAO A;  2DZJ A;  2IY1 B;  4W9K A;  4EZL A;  4ZDV A;  2AL6 A;  2G3Q B;  5J2R A;  4BFR A;  4GIV A;  3APD A;  4M8M A;  2V1Y A;  1RRB A;  2JT4 B;  3OJ4 B;  1UBI A;  5CHV C;  2KX3 A;  4II2 B;  4G3X B;  2C5L C;  3QK0 A;  2CHX A;  3NZU A;  1SE9 A;  4KDI C;  3WA0 A;  1V5T A;  4IUM B;  1IPG A;  1T0Y A;  1JRU A;  3W1S A;  4WWP A;  2J0J A;  2KNB A;  4M8N A;  2Z0D B;  4PS7 A;  1ZW7 A;  1WRD B;  3L10 B;  3QA8 A;  3EEC A;  2JUO A;  3JSV B;  4DDG D;  2JZ3 B;  1WI0 A;  2NS5 A;  2KLG A;  3RUI B;  4DBG A;  4TQ0 A;  4IWO A;  4G11 A;  2K8B A;  4OVU A;  3V62 A;  2IY0 B;  4HJK A;  4RM9 A;  4BOS C;  3DDC B;  1J19 A;  3RT3 B;  2M1M A;  1P0R A;  3PT2 B;  3ML9 A;  4DHJ D;  4EEW A;  2CR5 A;  2N4F A;  4XZ4 A;  2MBE A;  4TUU A;  4LCD E;  2G4D B;  1WJ6 A;  1WFY A;  2PJH A;  3RZF A;  2MP2 B;  3RD2 A;  2MBO A;  4GDK B;  1GJZ A;  1WXA A;  4KZ0 A;  2ZEQ A;  3Q3F A;  3WIM A;  2ZCC A;  4AJW A;  4HDQ A;  1OGW A;  1LXD A;  1OEY A;  3IFW B;  4ANW A;  2BGF A;  3EFU A;  1UGM A;  3IVF A;  4G0N B;  1P98 A;  4ICU A;  2KK8 A;  3ZTD A;  4ZRJ A;  4W9G A;  4DHZ B;  2DYM A;  2ZPN A;  4IWQ A;  4RMA A;  3DPD A;  2FCS A;  3WAN A;  2VRR B;  1WJ4 A;  3IG3 A;  4LJP B;  1OEY J;  1SIF A;  2MQJ A;  3A9K B;  4ZRK A;  5C23 A;  2N7D A;  3VH4 B;  3ZIM A;  2CHW A;  3WAL A;  3NZS A;  4CO7 A;  1LM8 B;  1GUA B;  3MHS D;  2KQS A;  1KOT A;  1I42 A;  3HHM A;  1NDD A;  3IBE A;  1WR1 A;  3KVF B;  4AWJ A;  2J0M A;  4FJZ A;  5DPR A;  4KIK B;  1WE6 A;  1WM3 A;  3ML8 A;  2KWU B;  3SD5 A;  2BWF A;  3UIP B;  3WAP A;  2KDI A;  1CMX B;  2AEH A;  2JPH A;  3M3J A;  5JHA A;  4B6W A;  3PLV A;  3ZNH B;  1V49 A;  2ZZP B;  3QX1 A;  4N9F 4;  1WMH A;  2O2V A;  4W9D A;  1YX5 B;  1J8C A;  1NBF C;  4FA6 A;  4I6L B;  2NPT B;  4F8C B;  4PS3 A;  3HM6 X;  2JF5 A;  2JWZ A;  2LXA A;  3AXC A;  2JVC A;  3CMM B;  2QHO A;  4LJO B;  3VDZ A;  2DHZ A;  2FID A;  2KLC A;  5DPW A;  3LDZ E;  2XEW A;  5JH5 C;  4W9J A;  1SGH A;  1YIW A;  2LAS A;  1WXM A;  4FHJ A;  4MSM B;  2RD0 A;  1WM2 A;  1WMH B;  2O2V B;  4E3C A;  5JZE B;  5KHQ A;  2LRU A;  5E6P A;  2JXX A;  4HVB A;  5DPT A;  3JYU A;  4W9H A;  4KZC A;  3PS6 A;  4CHK A;  4MEM A;  5KHO A;  3UF8 A;  2WDT B;  3V60 A;  2JRH A;  1WJN A;  1LFD A;  4B95 A;  2ZJD A;  3NOB A;  2L00 B;  1E8Y A;  4FLH A;  3QHT A;  4II3 B;  4TKN A;  3JW0 X;  3D32 A;  2LUE A;  4HDO A;  1WZ0 A;  2PE9 A;  1VD2 A;  3KUZ A;  4KVG B;  3TMP B;  2KDB A;  2KVR A;  1H4R A;  4IM0 A;  1EF5 A;  5D94 A;  3WAM A;  2FNJ B;  2D10 A;  2KMC A;  2RR9 A;  2BPS A;  2L3Z A;  3K9P B;  3QAQ A;  2L76 A;  1IYF A;  5J17 A;  3M63 B;  4ANV A;  4GDL B;  4K1R B;  1Y8R C;  2KC2 A;  1E5W A;  2M17 A;  2WX0 A;  2ASQ A;  4NQL B;  4PYU A;  4WJP A;  3R7Q A;  3T9L A;  3GZN I;  3KH0 A;  1UZX B;  3RZW C;  1E7U A;  4TQ1 A;  1UBQ A;  2FUH B;  3DBH I;  4NJ7 A;  4F1S A;  1Z2M A;  1WGG A;  2LGD A;  2V4L A;  5L83 A;  4HCN B;  5D2M B;  1PQS A;  4GU2 A;  2LI5 A;  1J0G A;  2LXC A;  4K7W A;  1G6J A;  3PRM B;  1WX8 A;  4G50 A;  3EC8 A;  1V2Y A;  2GMI C;  2LGX A;  3ZNG C;  4KIK A;  1WXV A;  2DAJ A;  3CST A;  3ZRF A;  4EOY A;  4NAW A;  2PPH A;  4B9K A;  2N9P C;  4GDL A;  2ZVO A;  5CX3 A;  3ONS A;  2NR2 A;  3PSE B;  3ZDT A;  3R66 C;  4DXA B;  4GMV A;  2C7N B;  2KD0 A;  2MSE D;  2L0T A;  4KV2 A;  2DYB A;  2AWT A;  2KJH B;  2WWZ A;  2XBB C;  3TJP A;  2DX5 B;  2BYF A;  2IO0 B;  2BF8 B;  2YVC A;  4FAD A;  3IHP C;  3TL5 A;  2BKF A;  3N32 A;  2G4S A;  4MDK E;  2KQ7 A;  3SU8 X;  3UQA A;  1H8C A;  2DZM A;  3HM3 A;  2BKR B;  3ZNZ B;  4EUT A;  5AEK B;  5LXH A;  1V5O A;  4GDK A;  2OJR A;  4DDI D;  2L05 A;  3ZW3 A;  1WGR A;  3VHT C;  3TBL D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...