2BKRB

Nedd8 nedp1 complex
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
77
structure length
77
Chain Sequence
SMLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVLHLVLALRGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SENTRIN-SPECIFIC PROTEASE 8
publication title Structural Basis of Nedd8 Ubiquitin Discrimination by the Deneddylating Enzyme Nedp1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein-binding/hydrolase
total genus 22
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2005-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2bkrB00
2EKEC 4W9HA 4NJ7A 2JUOA 2KXJA 3AXCA 4ZRJA 3LJ3A 1LM8B 1WZ0A 3T9LA 1BT0A 3R7QA 4FHJA 1MG8A 5AZHA 1Q0WB 2OJRA 1I42A 4CYEA 1WXAA 1RRBA 3ALBA 1UH6A 2GBKA 2JPHA 3EHVA 1GNUA 4HWIB 4IWPA 2CS4A 2K6DB 4I6PA 2D07B 3PT2B 2C5LC 1WY8A 4W9KA 3H7SA 3ZKJC 1S1QB 2AWTA 1P0RA 2NBUA 5CTRC 1WMHA 4FA6A 4NJ6A 4LCDE 2CHXA 2I1KA 3B08A 4ANXA 3HK0A 3D32A 3V62A 2CHZA 1E8YA 2NPTB 3V6EB 3DBSA 1I35A 4RM8A 1WE6A 3UIOB 2ZNVC 2RGFA 3KW5B 1AARA 2Z0DB 3L54A 4GGQA 4AOFA 3ZNZB 2MW5A 3TBLD 2MLBA 3W1SA 3QAQA 4GU2A 1TGZB 2Z0EB 1XT9B 2IO0B 2ZVNA 3NOBA 3H7PA 2Y5BB 3ZIMA 3RZFA 4HLEA 1WXVA 2BYEA 4JLCA 4X57B 3ZNHB 4IUMB 4JGHB 2DX5B 3PLVA 3VH4B 1SIFA 2M4NA 3R66C 4PYUA 2KKCA 2LD9A 3KYDD 5IA7A 3ZNGC 3GOEA 2AL3A 1UZXB 1RLFA 4MGKE 4PS3A 4TKNA 3ZVVA 4BBNC 1E5WA 3VTVA 4KDIC 4PYZA 3B1LX 3PHXB 4J6IA 1IPGA 3SD5A 1Q5WB 3JYUA 1GC6A 2O2VB 3DVNU 3VHTC 1LFDA 2DZMA 4XZ4A 4W9IA 3WAPA 2KTRA 2KC1A 4JL9A 3JSVA 4DDID 4DHJD 2GBRA 3HM3A 2MBBB 3DVNV 2MRPA 4EZKA 3EC8A 2LGYA 2MP2A 2OOBB 1Y8RC 3A1QA 4EFOA 2IO1B 3U30A 2N9PC 2KC2A 2MX2A 1GG3A 4GDLB 4A3OA 2IO2B 2N9EB 3RUIB 2XK5A 3R3MA 2JY6A 2DAFA 4IM3A 2DYOA 2JVCA 3A9JB 4NNJB 4DHZE 2L8JA 4WQOB 5J2RA 1WJ6A 2N9XA 4IWOA 1WXSA 2KZRA 2HJ8A 1WX9A 5KHOA 3TMPB 2BYFA 4FJYA 4G3XB 2CHWA 2NCNA 4HXDA 1TZ1A 2RSUA 2LVOA 3TJPA 5L95C 5E6OA 1V6EA 3QJZA 4IM2A 2MSED 1S3SG 3ZTDA 4URKA 1JRUA 2FNJB 3QA8A 2PJHA 3RYTA 3AI5A 1E90A 4KDLB 4N9F4 2KWCA 4IWQA 3DCGA 2O6VA 1Z5SB 2BKRB 2LXAA 3QC8B 3QWZB 3V6CB 4K7WA 2GBNA 1V86A 4GDKB 4JQWC 2C9WB 2ZCCA 3PVLA 4HDOA 2LJ5A 4HPMB 2JT4B 1YIWA 4HPLB 1R4NI 4F8CB 4K7SA 2KMCA 3CMMB 3L17A 3R7RA 2KWVB 1J19A 1WGHA 4CO7A 2DAJA 4ZRIA 3U7DA 5CHWA 1OEYJ 4MH0E 1TTNA 3VQIA 2XBBC 3WANA 2VRRB 3ECIA 4BKSD 4KSKC 1P9DU 5J18A 3ML9A 4NAWB 4MGZE 4NQLB 2K8BA 1GJZA 2LI5A 5LXHA 2JRIB 2NS5A 5D6JB 2KD0A 5FR6A 2CU1A 2J0JA 4FULA 5D94A 2A4ZA 2KJRA 5JHBA 3GZNI 5BO4B 2C60A 1OQYA 3L16A 2L76A 3KUZA 2PE9A 3H6NA 4W9GA 5EDSA 2LUEA 1E8WA 4TUUA 5GMVA 5D2MB 3JVZX 1UD7A 2DZKA 1C3TA 4WJNA 3A9KA 1WJUA 1XD3B 3QARA 1GC7A 5AEKB 1E7VA 3NZUA 3APFA 3PHWB 1RFAA 1YD8U 3RCZA 2D11A 4BOZB 1FXTB 2GBJA 2W9NA 2WDTB 4XX5A 4PS8A 3KVFB 2C7HA 4I6NB 2KDEB 2ASQA 3OJ3A 3EFUA 2KDBA 3APCA 3PZDA 5JHAA 3MTNB 2M17A 1WE7A 4F7ZA 2DZJA 4PS7A 2N7DA 3W1YA 1V9JA 3QX1A 4WJQA 3H7PB 3ENEA 1UBIA 4P7IA 4KZCA 4XC2A 3HIZA 4G0NB 4MSQB 4DBGA 3K9PB 2KLGA 3L0WB 2IY0B 1EO6A 3AU5A 2MBQA 4LJOB 3QHTA 2KANA 4HCPB 3APDA 3O65B 3T8MA 2DYMA 3WIMA 3LDZE 4IM0A 1VD2A 3S2AA 3QQ8B 4RM9A 1K8RB 4WAAA 1C1YB 2LXCA 3H1UA 4MJSA 2B3AA 4IC7B 4WWPA 4BFRA 4LJPB 4BBNF 2RPQA 1WGYA 2RD0A 1HE8A 2NBWB 3BINA 4HK2A 1WJ4A 2N7EA 2JWZA 4MM3A 3V60A 4K81A 1WR1A 2LRWA 4RMAA 4B95A 4AWJA 4GMVA 2PPHA 4WJOA 2AEHA 2KOXA 3WALA 1WGDA 2KQSA 3VXWA 4GSWA 4MELA 3BY4B 3AU4A 2MP2B 2HD5B 2LVQA 3A1QB 3RULA 4DXAB 2L0TA 4FBJB 4KIKA 2BWFA 1V80A 2LZ6A 2ZNVB 1RAXA 4DWFA 2GMIC 2ZJDA 4W9FA 4MGIE 5CHVC 4TV3A 2XK5B 2MCNB 3B0AA 3ZRCA 1WJNA 5E6PA 2D3GA 4LDTB 3VFKA 3VTUA 5DPSA 4E3CA 2K1FA 3ZDTA 2LRUA 4WJPA 1V2YA 1WRDB 2YVCA 1D3ZA 2YLMA 4YL8A 1WXMA 3NHEB 4K7UA 3A33B 3SU8X 1P1AA 2KTFA 3UGBB 3CSFA 2KMAA 5JZEB 3DQVA 4W9EA 5DPTA 1IYFA 2IZVB 2EMTA 3X0WA 2QHOA 3ZW3A 1M94A 3ZO5B 1KOTA 2KO3A 2CR5A 1UBQA 2KJHB 3OJ4B 2D10A 3UQAA 2N4FA 3RT3B 2ZPYA 1LXDA 4W9DA 3ONSA 4AJWA 3HM6X 1L2NA 2IY1B 3HHMA 1V5OA 2O6VB 3A4SC 3N3KB 2J0KA 2GOWA 3M62B 1GUAB 2LGDA 5KHQA 1WR6E 1YX5B 1SE9A 2KNBA 2DENB 3Q3JA 4BOSC 2JXXA 1R4MI 3V61A 3JW0X 3UIPB 1TBEA 3DBHI 3CSTA 3MJWA 4M8MA 4ANWA 3PS6A 3QK0A 3A4RA 4BKTA 2G3QB 2MBEA 2NR2A 1F9JA 3PREA 4EUTA 4I6LB 2MWSB 1WH3A 2KJ6A 3DDCB 1ZW7A 2ZEQA 4EKUA 1V81A 1OTRB 2DYBA 1WYWB 2KWUB 4HDQA 2FCQA 3ZLZA 4DHZB 1ISNA 4GOCA 4WWNA 4M0WB 2JZZA 4GXBA 5TR5A 3PPAA 2C7MB 1H4RA 1NDDA 2KK8A 4FJVB 4NQKE 4EZJA 3VVWB 1IP9A 3RD2A 2PE6B 3ZNID 4DDGD 3NY5A 1YX6B 3A9KB 4ZRKA 1E7UA 2ZVOA 3P2BA 2KFKA 3PRZA 3L10B 1QZEA 4GB9A 2A5UA 1E8XA 3K9OB 4OVVA 5AZFA 3DBLI 3SDLC 4GN1A 2LGXA 4HJKA 4ICVA 4AJYB 4IG7B 1WI0A 4KZ0A 2LASA 4ASWC 4M8NA 1WMHB 3VUWA 2NBVB 4KVGB 1J8CA 1PQSA 2N1WA 1X1MA 2G4SA 1EUVB 3IVFA 4BKSA 2K8HA 2MA9B 1E8ZA 3OAWA 2HTHA 5CHFA 4FN2A 5LXIB 2FAZA 2FIDA 2J0MA 5JH5C 4FADA 4AUQC 3UQBA 2EMSA 4HVBA 3DVGY 3VTWA 2K25A 1WM3A 2WX1A 5J17A 3OLMD 4GIVA 2JF5A 2BWES 2BPSA 1H8CA 1WX8A 2R2QA 3DVGX 3VDZA 3X23A 2CKHB 2Z59B 3TL5A 3ZUNA 2K39A 2KDFB 3KYCD 4II3B 4MJSB 2KLCA 2NPTA 1KJTA 2C7NB 2R2OA 3I3TB 4NY0A 4TQ1A 2J7QB 3IG3A 1NI2A 2LVPA 3VH3B 3VAWA 3PV1A 5HKHA 4JIOU 1A5RA 5E6NA 4EZLA 1ZKHA 1OEYA 1V49A 1CMXB 3PLUA 5DPWA 3KUCB 1UELA 2KTRB 3TIXA 4MGYE 4A20A 2XEWA 4F1SA 2BGFA 3JSVB 2KX0A 3NZSA 3SHQA 2K6QA 4B9KA 1WZ3A 2HE7A 2WX0A 2MQJA 3QCAA 2NVUI 4HCNB 2JZ3B 2UWQA 4KIKB 5C23A 4A3PA 3NS8A 1Z2MA 4LDTD 2UYZB 1LQBA 2DZIA 4BVUC 3DPDA 3EECA 4ICUA 2K8CA 2L00B 3PTFC 2MBHA 2KDIA 3IFWB 2GBMA 1NBFC 2BKFA 2KX3A 2V3SA 1ZGUB 4OVUA 3PGEA 1EF1A 4E74A 5G55A 2IO3B 4EEWA 3PSEB 3Q3FA 3L08A 2WYQA 3N32A 4K1RB 5C1ZA 4II2B 2O2VA 1OGWA 3MHSD 4CHKA 3U8ZA 3L13A 2FCSA 3C0RB 1XQQA 2KQ7A 3CF6E 4MSMB 2PEAA 3DBRI 4MDKE 1YJ1A 2DHZA 2BYVE 2O6VD 4ANUA 3WAOA 2FIFA 2RR9A 2LWPA 4DHJB 5DPRA 4E71A 2KVRA 1WGGA 1SGHA 4GDLA 4G11A 4WWOA 1WM2A 3ZDMC 1WGRA 4ZYNA 2I1JA 3IHPC 4W9LA 1P3QU 3A9JA 3WA0A 2BF8B 2FCMA 4W9JA 2JRHA 1KLVA 2IBIB 2L7RA 4FLHA 4KSLC 1WF9A 1U4AA 4BKGA 3PRMB 3DOWA 4AP4C 2L05A 3M95A 4EOYA 5L83A 2ZZPB 3RZWC 4B6WA 2KN5A 3UF8A 4ZDVA 3PRPB 3VUYA 2L0FA 2G45B 2V4LA 4IW0A 2REXA 2AYOB 1EF5A 2FUHB 2V1YA 3QIJA 2ZPNA 3ML8A 5IAAC 1V5TA 3VUXA 3IBEA 2N1VA 4FJZA 3KH0A 3WAMA 4DK5A 1WX7A 4G50A 1L7YA 1P98A 5DCNA 2G4DB 4NPNA 2KHWB 2WWZA 3H9DA 2FCNA 3AULA 2D2QA 4FHKA 1UGMA 4GDKA 2AL6A 5G2NA 4ANVA 1VCBA 2L3ZA 1Q1OA 3KUDB 3M3JA 4W9CA 1G6JA 1J0GA 3M63B 1WIAA 5D7GA 5CX3A 2M1MA 4TQ0A 2IYDB 2KFKB 2KFJA 3W1SC 2M8SA 3ZRFA 3N30A 1KM7A 1T0YA 2MBOA 2ZCBA 5AZGA 1WFYA 4NAWA 2M0XA 5LLIA 3TCAA 4KV2A 1YQBA 3ZTCA 4MEMA 3UINB
chains in the Genus database with same CATH superfamily
4W9HA 2JUOA 1LM8B 1BT0A 4FHJA 3KWLA 2BB5A 3PT2B 1WY8A 3RNBC 3H7SA 5CTRC 5EE1A 1QOAA 4FA6A 4NJ6A 4LCDE 2I1KA 2ZNVC 4US9A 3ZNZB 3TBLD 1XT9B 2JYEA 2ZVNA 3P4SB 4ITKA 5HI1A 3IAS1 2PVGC 3ZIMA 2PKOA 3RZFA 4JLCA 4ZHOA 2YEPB 3OG5A 1SIFA 2M4NA 2LD9A 2LGIA 5IA7A 3ZNGC 3GOEA 1RLFA 2IGDA 4MGKE 4BBNC 1K51A 2DNFA 4KDIC 4PYZA 3B1LX 1IPGA 1QOBA 1GC6A 3P63A 3ETRA 1LFDA 4N59A 2DZMA 4XZ4A 2INCC 2KTRA 2KC1A 2IDYA 2MBBB 5BMGA 4EZKA 3EC8A 2OOBB 4EFOA 1E0ZA 3U30A 2N9PC 2MX2A 4GDLB 2BB6A 3I57A 4A90A 2JVCA 1VRAB 2KAJA 4DHZE 2BTEA 2KZRA 5E6JA 2VZKB 4FJYA 1R4MB 3TJPA 5L95C 4K3CA 1S3SG 1FM0D 5HFYA 2K22A 1M4VA 2PJHA 3AI5A 3NUHB 3MC9A 1E90A 2I38A 1TKYA 2KWCA 1JCKB 1ZDVA 4K7WA 2GBNA 2WHIA 3TEWA 2J52A 4DXGA 2DLBA 2L32A 4HPMB 2JT4B 1R4NI 1C76A 1V1PA 2KWVB 1WGHA 4L23A 4CO7A 4ZRIA 4JWSC 4IDIA 4MH0E 1L6VA 2XBBC 3RN9C 4BKSD 3ML9A 4LNNA 1FD6A 2LI5A 2JRIB 1SJHD 3MFGA 2ON8A 2CU1A 4FULA 5D94A 2KJRA 2YEPF 2C60A 4K3BA 1D5ZC 1RYJA 1UD7A 2DZKA 2X8XX 4C56C 5AEKB 3APFA 1J7CA 2OEDA 1XLPA 3U2SC 5EE0A 2C7HA 2BS2B 2KDBA 3PZDA 3MTNB 2DZJA 1L5PA 2GB1A 4DQOC 3W1YA 1V9JA 1HEZE 1FXIA 3HIZA 2WXHA 3K9PB 1C77A 2KLGA 3V3XA 2IY0B 3AU5A 1UF0A 1N6ZA 1HQRD 2EKIA 3APDA 4HCPB 2DYMA 1ZUD2 4RM9A 3EFCA 4WAAA 2LXCA 1D5XC 4WWPA 4LJPB 1TIFA 2LUMA 1HE8A 3BINA 4HK2A 1WJ4A 4MM3A 4OZBA 4RH6A 5BYRA 1YN5A 5JXVA 3BYYB 4H2AA 2LRWA 3AE2B 1E7PB 4WJOA 2KQSA 4MELA 3RULA 4DXAB 2INNE 2BBCA 2ZNVB 4MGIE 5CHVC 2MCNB 3UI3A 3Q3NC 2G1EA 3Q8BA 4LDTB 5DPSA 1TS4A 1FNWA 3AMZA 4E3CA 1N61A 4PK1A 3NHEB 4ZHPA 2Z8LA 3SU8X 5IN7A 2KTFA 2AQ2B 3DQVA 4AS1A 2QHOA 3ZO5B 2KO3A 2CR5A 2MEKA 3OJ4B 3UQAA 4AJWA 2WXLA 2IY1B 1MHXA 3HHMA 2AQ1B 2GOWA 2J42A 3DHGC 3DWMA 1SE9A 3Q3JA 1N60A 2JYTA 1WSPA 1J7BA 3RMKC 3PS6A 3QK0A 4BKTA 3RNAC 2QJLA 1IGCA 3DDCB 4QAYA 1CJEA 4KX6B 4DHZB 4GOCA 4WWNA 4M0WB 3PPAA 1H4RA 4FJVB 4NQKE 3FKYA 2WXNA 3SDLC 2A5UA 5AZFA 3DBLI 4B0EA 4AQ7A 2LGXA 4ICVA 4IG7B 4KZ0A 1WMHB 4RGMA 1X1MA 4BKSA 1E8ZA 1XO3A 2FIDA 5EE9A 4C4VA 4O1NA 2WX1A 2BPSA 3NVZA 1H8CA 2KDFB 2K9XA 2NPTA 1KJTA 1EU3A 4NY0A 3IG3A 2LVPA 4MM3B 1YNTE 1I4PA 4JIOU 1ROEA 4OHJA 4MH8A 5DPWA 3SEBA 4BZAA 4MGYE 4A20A 3NZSA 5IKCM 2MQJA 4BVUC 3BVMA 3RI7C 1DOYA 3EECA 4ICUA 2K8CA 3PTFC 3PZ8A 2MBHA 3NVYA 3AE9B 2KX3A 2V3SA 4OVUA 3PGEA 5G55A 4A8XC 3PSEB 1I4GA 4K1RB 1XLNA 1V97A 3U8ZA 1N63A 2FCSA 3CF6E 4MSMB 1CZPA 2BYVE 2O6VD 4XDCA 2KVRA 1SGHA 1ENFA 2K0PA 3A9JA 4JE3B 1L0XB 3P42A 1KLVA 2L7RA 4KSLC 1U4AA 1SB3C 4IW0A 2D3BA 3QIJA 4FXCA 4DK5A 3WAMA 5D3DA 1L7YA 5DCNA 4FHKA 2FCNA 3H8HA 2CJOA 1VCBA 2N0SB 3GZNB 5CX3A 2M1MA 4TQ0A 2IYDB 3AECB 2V3NA 1K52A 1KM7A 2MBOA 1T0QC 1WFYA 4NAWA 3BWUD 2RDBC 1YQBA 4MEMA 3AXCA 4ZRJA 3Q8CA 1WZ0A 5AZHA 1I42A 4C4VB 2JPHA 4HWIB 3Q69A 2CS4A 1TZOA 4YTMB 2C5LC 3BZDB 3ZKJC 4N6EB 2V9HA 1P0RA 1GPXA 3D32A 3V62A 2CHZA 2NPTB 3V6EB 1I35A 2H89B 1NYRA 3R2TA 1AARA 1HZ5A 2KQ4X 2IO0B 2KT7A 3NOBA 3H7PA 2Y5BB 3RNGC 4KGRA 3FC4A 1F2RI 4IUMB 4JGHB 4PYUA 1WYGA 3NVVA 1UZXB 1XCTL 1Q5WB 5FK9C 1SIJA 4UDUC 3ZGZA 1FCCC 2JQRB 1OFFA 4JL9A 2LGYA 3A1QA 2IO1B 4L2YA 1NI3A 2E3TA 4XWTA 1YMHE 2XK5A 4M01A 1JWUD 3R3MA 3Q8AA 5TSSA 1RWSA 3A9JB 5J2RA 4IWOA 2RMMA 1WXSA 2HJ8A 1WX9A 5KHOA 2MJ3A 4G3XB 1TZ1A 1R7SA 5EE3A 5E6OA 1CK1A 3QJZA 1GB1A 1JQ4A 4URKA 3GE3C 1AN8A 1JRUA 2FNJB 4NAMA 4N9F4 4LK0M 2O6VA 2NMQA 3E56A 2BKRB 3EUB2 3V6CB 4MT5A 1XCQL 1V86A 2V3PA 1SE2A 4JQWC 2JWUA 2X38A 4HDOA 2LJ5A 4HPLB 3TEYA 2KMCA 2QCZA 3T3OA 2DAJA 2MJEA 3VR8B 3VQIA 3WANA 4A9AA 2VRRB 3IT4B 4KSKC 4NAWB 4MGZE 4NQLB 1GJZA 2BS3B 2NS5A 1C78A 3L16A 2L76A 3H6NA 5EDSA 2LUEA 5GMVA 3JVZX 2EELA 1C3TA 3A9KA 1XD3B 4OZCA 1JWAD 4IOIE 1RFAA 1GB4A 4HKQA 1YD8U 3RCZA 4ACFA 2D11A 3B2GA 2QIEB 1FXTB 2W9NA 2WDTB 1TYGB 4I6NB 3V05A 1E6EB 1KRHA 1ZE3D 2BVCA 1FIQA 4PS7A 1P7EA 1YN4A 3ZXRA 3H7PB 3ZQ4A 3KQ4A 4KZCA 4MSQB 4XE0A 3DHIC 3Q8EA 3KLSX 3L0WB 2MBQA 4LJOB 2QC8A 3O65B 3WIMA 4S17A 3S2AA 3QQ8B 3ABVB 1C1YB 2W82A 4BFRA 2RPQA 2RD0A 3AE3B 2N7EA 1WR1A 2QDFA 4RMAA 2BW2A 4GMVA 2AEHA 1WGDA 1C4PA 2HD5B 3A1QB 3AB5A 4KIKA 1V80A 4NZLB 1RAXA 4L1BA 1OQQA 4KGSA 3RNEC 2XK5B 3B0AA 3ZRCA 4C7YA 2D3GA 3VFKA 2WXQA 3ZDTA 2LRUA 4WJPA 1V2YA 2YVCA 4DXFA 3GB1A 2IJ0A 4K7UA 3OWEB 1P1AA 3CSFA 4WURA 2IZVB 3X0WA 1UGJA 2KMMA 2D10A 2N4FA 3RT3B 1J7AA 3ONSA 2WGSA 1L2NA 2ACZB 1V5OA 2O6VB 2J0KA 3FILA 4RGNA 2LGDA 1RM6C 1WR6E 1R4MI 1A70A 1TBEA 1WRIA 3CSTA 1T3QA 2E6XA 3Q6BA 2NR2A 1F9JA 2MWSB 4RF0A 1WXQA 1OTRB 2PIAA 2ZW0A 4HDQA 3ZLZA 4GXBA 2C7MB 1I4RA 1NDDA 1TJEA 4REZA 3AEGB 2KK8A 4OW0A 4RFBA 3VVWB 2PE6B 4HJGE 3NY5A 1FFUA 1YX6B 3A9KB 4ZRKA 2ZVOA 2JX5A 3L10B 3K9OB 4HJKA 4AJYB 4M8NA 2NBVB 1P7FA 1PQSA 2D3CA 3IVFA 3AE4B 2WQYB 3CWIA 3OAWA 4YT0B 2J0MA 2AQ3B 4FADA 1DGJA 1TT5B 3DVGY 3VTWA 2QSDA 5J17A 1ZXIA 2JF5A 1QLBB 1EWYC 4P6VF 2N9KA 3DVGX 4ARCA 2K39A 3AE6B 1FNUA 4II3B 2ONQA 1AYFA 1DOIA 2R2OA 3I3TB 2WXJA 5BMIA 5HHDG 1NI2A 3VH3B 1A5RA 1ZKHA 3PLUA 3N20C 1LO5D 1QQRA 2KTRB 3TIXA 2XEWA 4F1SA 3SHQA 5IO9A 2K6QA 2FBWB 1WZ3A 2HE7A 4HCNB 4KIKB 2JZ3B 1Z2MA 4P1CC 1MFWA 4E74A 1EF1A 3AM9A 1JW9D 4II2B 2O2VA 3N1XC 1OGWA 3MHSD 4CHKA 3AEFB 3L13A 1XQQA 3BVGA 1HZ6A 1XF5L 1FO4A 4KGTA 2KN4A 1WGGA 1UUPA 1WM2A 1WGRA 4ZYNA 2I1JA 3IHPC 3WA0A 5BMHA 1V1PB 2VH1A 3IAM1 2IGHA 3LYYA 3RZWC 2L0FA 4TSSA 4HKZE 1ZP0B 2AYOB 2FUHB 4YSZB 2ZPNA 3KH0A 1C9FA 4MACA 3C19A 2OHFA 2KHWB 3H9DA 4GDKA 2L3ZA 4W9CA 4CQNA 1D4BA 3M63B 2MH7A 3HVZA 3TEXA 2M8SA 1MHHE 2ZCBA 2RDGA 3TCAA 2M0XA 4A55A 3BK1A 3UINB 4NJ7A 2WNMA 4NJCA 2KXJA 2M56B 3LJ3A 2R61A 1PDXA 1TS2A 3R7QA 1MG8A 4IWPA 3AEBB 5IP4D 2D07B 2PW9A 4W9KA 2ICIA 1S1QB 1GAQB 2AWTA 4RGTA 2CHXA 4ANXA 3HK0A 1VR9A 1E8YA 1WE6A 2RGFA 3KW5B 2Z0DB 3L54A 1L0VB 3QAQA 4GU2A 1TGZB 3T3NA 2D5GA 4RGOS 4HLEA 1WXVA 2BYEA 4X57B 2L1AA 4LNOA 4S0RA 3URYA 3PLVA 3VH4B 3KYDD 2AL3A 4TKNA 4PS3A 3VTVA 2M0AA 1F0ZA 2O2VB 2QILA 4W9IA 3WAPA 3JSVA 4DDID 4DHJD 2MP2A 2KC2A 2N9EB 1F1HA 5H92C 2LEKA 2DYOA 2L8JA 1WJ6A 2N9XA 1YQ3B 3TMPB 2BYFA 1FNVA 3WCQA 4WH4A 2CHWA 1JMLA 2NCNA 4HXDA 2K5PA 2RSUA 3DBHB 3J9CA 3B2FA 3ZTDA 3DHHC 2WU5B 3EA6A 3QA8A 4XDDA 2WXMA 3RYTA 4Q2JA 3RNCC 4IWQA 5H8YE 3RPFC 1YQ4B 3QWZB 2N9LA 4GDKB 2M19A 2TSSA 4WAFA 4R3DA 4WIPA 1ZXHA 3CMMB 1KFYB 3GP7A 3TUOA 1J19A 4KKIA 2OJWA 2WXFA 3Q14C 4JPSA 3ECIA 2G9HD 1BUIC 2B76B 2VH2A 3R2IA 1HTQA 1PGBA 5FR6A 2JU6X 5JHBA 3GZNI 5BO4B 1QOFA 2BT6A 4W9GA 4HROA 1WJUA 3P4PB 1E7VA 3ZXVA 4BOZB 5GXGB 2GBJA 1L4DB 4XX5A 4PS8A 3KVFB 2KDEB 3OJ3A 3EFUA 5T8IA 2WP9B 5JHAA 1WE7A 4F7ZA 3GS2A 2N7DA 3QX1A 3W2DA 4XWWA 1UBIA 4G0NB 4DBGA 1XLOA 1EO6A 1ET6A 3QHTA 1JRPA 3T8MA 1VD2A 1TY0A 1K8RB 3H1UA 1DYQA 2B3AA 2INDC 2LFIA 3EGRA 2NBWB 2WU2B 3V60A 4IKGA 4B95A 4AWJA 3WALA 2KOXA 4LNFA 2HTME 1QT9A 1N5XA 3BY4B 2MP2B 3BYTB 4FBJB 2L0TA 2SAKA 2FUG1 1KF6B 3DBRB 2LZ6A 4DWFA 1QF6A 2ZJDA 4W9FA 1YOVB 1XEEA 3I5JC 3VTUA 3AE5B 3SFDB 1WRDB 1D3ZA 1BMLC 1UWMA 1AWDA 1YJIA 3UGBB 5JZEB 2W54A 5DPTA 2NTSA 1IYFA 3ZW3A 2EMTA 1M94A 4ZOHC 1DOXA 2KJHB 1UBQA 5D3IB 4W9DA 1OQRA 3HM6X 3RFZB 1E10A 1MPEA 2N7JA 5KHQA 1YX5B 2KNBA 3ZJUA 1NYQA 2BS4B 2KWDA 3NJTA 2WDVB 4ZRQA 5C3JB 2L83A 3W9CB 2QMTA 3U4EG 2MBEA 4EUTA 3PREA 4I6LB 5G5GA 1WH3A 2KJ6A 1ZW7A 3O13A 2DYBA 4YSXB 1ISNA 1N5WA 2FE8A 3P1MA 4B0MA 1VZ7A 5TR5A 4C80A 2ZW1A 1L4ZB 4EZJA 2WXGA 1IP9A 3N9YC 3ZNID 2IPKD 4C00A 4GB9A 2KFKA 1HXYD 4OVVA 5C2TB 1WI0A 4KVGB 2WS3B 1E9MA 1J8CA 1SEBD 2N1WA 1ESFA 2WXPA 1NVID 2K8HA 5LXIB 5CHFA 1RFKA 4FN2A 2FAZA 5JH5C 2KYWA 4AUQC 3UQBA 3AE7B 3OLMD 3BVZA 1SXTA 1T6BX 1WX8A 2R2QA 3I63C 3VDZA 2CKHB 3TL5A 3MHZA 3KYCD 3E9SA 2KLCA 2LHEA 3PV1A 3N1YC 5HKHA 1OEYA 1V49A 4J3OD 2XN9C 1UELA 1K53A 2KX0A 2LGSA 4B9KA 1IUEA 2WX0A 1KLGD 4A3PA 2UWQA 3NS8A 1ET9A 1IGDA 1LQBA 2DZIA 2L00B 1I4QA 1FCLA 1SE4A 2KDIA 2GBMA 1ZGUB 2DBYA 2IO3B 4EEWA 3Q3FA 3L08A 4KKJA 1PGXA 3C0RB 2KQ7A 2PEAA 1YJ1A 5FKAC 1V1OA 3WAOA 1KLUD 4HRSA 1FRRA 2FIFA 2RR9A 4DHJB 5DPRA 4E71A 4G11A 4WWOA 4PT5A 1QKZA 3ZDMC 1B9RA 3TEZA 4W9LA 1JALA 3GE8C 1FEHA 4C7ZA 2FCMA 4RNAA 1WF9A 2GLSA 4BKGA 3DOWA 4AP4C 2L05A 1R4NB 5L83A 3BK2A 4WWMA 2KN5A 2HJ1A 4ZDVA 3VUYA 2REXA 4N58A 1KH0A 3VUXA 3ML8A 3IBEA 4WQMA 2N1VA 4FJZA 2W3SA 3TSSA 1WX7A 1CQVA 2Q5WD 3PO0A 2PMVA 1P98A 2G4DB 4NPNA 3V61A 3ZYYX 2D2QA 5G2NA 1UGMA 4ANVA 1WGKA 2SEBD 1Q1OA 2PLPA 3KUDB 3M3JA 1G6JA 1WIAA 1FFVA 3W1SC 2KFKB 2I2YA 3ZRFA 3N30A 1FPYA 1T0YA 5AZGA 4KV2A 3ZTCA 2EKEC 1WWTA 1K50A 2BYTA 4M0WA 3T9LA 4HEA1 3VR9B 1FXAA 1Q0WB 2OJRA 2V4IB 4CYEA 1WXAA 1RRBA 3ALBA 1UH6A 2GBKA 3EHVA 1GNUA 1V8CA 2K6DB 4I6PA 2KDMA 1EM7A 3B9JA 1ZDXA 1HA5A 2NBUA 4LLGM 1EWCA 1WMHA 3B08A 3I9V1 4GLSC 3ZJTA 1MJDA 3NRZA 1MVKA 1D5MC 3AEEB 3DBSA 4RM8A 3UIOB 4AOFA 4GGQA 2MW5A 3W1SA 2MLBA 3SFEB 2Z0EB 2D3AA 5HG2A 2AX5A 2WDRB 3ZNHB 1T0RC 3AV8A 2DX5B 2Y3AA 3VRBB 3Q2AC 4XYCA 3R66C 2KKCA 2JSVX 3ZVVA 3AH7A 3BIID 1E5WA 3PHXB 2WXRA 4J6IA 3L4PA 3SD5A 2V0GA 3JYUA 1TKGA 3DVNU 3VHTC 1NEKB 3C8YA 2LMCA 2CU3A 1TY2A 2LJIA 5G5HA 1SSNA 2GBRA 3HM3A 3DVNV 3HUIA 2MRPA 1Y8RC 1XXGA 3CIRB 1IBXA 4USAA 3Q3OC 1GG3A 4A3OA 2IO2B 3RUIB 3MP9A 2JY6A 2DAFA 4IM3A 4NNJB 3FILB 2QEJC 4WQOB 1JROA 1VLBA 2LVOA 1Q10A 4LTUA 1V6EA 4IM2A 2MSED 2H88B 2BQQA 4RCOA 4KDLB 3IT6B 3DCGA 1Z5SB 2LXAA 2PVOD 3QC8B 2C9WB 2ZCCA 3PVLA 2IGGA 4D2KA 1YIWA 4F8CB 4K7SA 3L17A 3R7RA 5IOIA 3U7DA 5CHWA 1OEYJ 2GRIA 1TTNA 1P9DU 1T0SC 1TS3A 5J18A 2K8BA 3DBLB 5LXHA 1ACCA 5D6JB 2KD0A 2J0JA 2A4ZA 1F2RC 1OQYA 4ARIA 1TS5A 1JWMD 3AEAB 3KUZA 3VRAB 2PE9A 1E8WA 4TUUA 5D2MB 3P4QB 4US8A 4WJNA 3QARA 1GC7A 3NZUA 3PHWB 2JZPA 1SJED 2INPE 1ZOYB 2ASQA 3APCA 5AUIA 1GOZA 2M17A 1VZ6A 2WXIA 5FR3A 3AE1B 4WJQA 3ENEA 4P7IA 4XC2A 1I4XA 3IXSA 4P1BC 2KANA 1KTKA 2WDQB 3LDZE 4IM0A 1D6EC 3FAHA 1UNSA 4HPPA 3SR6A 3LB8C 4MJSA 4IC7B 2RDHA 4ZRPA 4BBNF 1WGYA 5BYQA 4YTNB 2JWZA 4K81A 2W3RA 5BYSA 2PPHA 2WXOA 3VXWA 2NTTA 1L6UA 4GSWA 2JXTA 3AU4A 3MC0B 2LVQA 3MC8A 5I4DA 2J53A 5LNK1 2BWFA 1IBXB 2GMIC 4TV3A 1PGAA 1XLQA 2K3UA 1WJNA 5E6PA 1YN3A 2J4XA 2K1FA 3NS1A 2VZKD 2MHJA 2L52A 2YLMA 4YL8A 1WXMA 3A33B 1F52A 2KMAA 4W9EA 1SBBB 1KOTA 3P4RB 2WXKA 3ZJVA 2ZPYA 1LXDA 2LHDA 4ZYSA 3A4SC 3N3KB 4TMAB 3M62B 1GUAB 3MJ5A 4OVZA 2DENB 1PFDA 1C79A 2JXXA 3W5VB 4BOSC 3JW0X 3UIPB 1SE3A 3DBHI 1YJJA 3MJWA 4M8MA 4ANWA 3A4RA 4JX1C 1N62A 1ZPSA 1EU4A 2G3QB 1T5XD 2KACA 2RPVA 4LNKA 4P16A 2ZEQA 4EKUA 1V81A 1WYWB 2KWUB 2FCQA 1PUTA 2JZZA 1FMAD 5AUKA 3RD2A 2CJNA 4DDGD 1E7UA 3PRZA 3P2BA 1QOGA 1QZEA 1E8XA 3DWGC 4GN1A 2LASA 4ASWC 3VUWA 4M00A 3HVDA 3NG0A 3Q8FA 4BAXA 1HTOA 2G4SA 1EUVB 2DWQA 1I4HA 2MA9B 2HTHA 3LXFA 2WLBA 2EMSA 4EE2A 4HVBA 4YSYB 1UWXA 2K25A 1WM3A 3Q3MC 4GIVA 2BWES 3X23A 1AW7A 2Z59B 3ZUNA 3KWVA 3U7ZA 4MJSB 1JWBD 2C7NB 2Y5CA 4TQ1A 2J7QB 1JWSD 3VAWA 5E6NA 4EZLA 2MJDA 1CMXB 1I7HA 2W55A 3AE8B 1MI0A 3RNFC 1LGRA 3KUCB 2BGFA 3JSVB 1MG4A 3N1ZC 4A6QA 1QILA 3QCAA 2NVUI 5C23A 4LDTD 4XGAB 2UYZB 3DPDA 3IFWB 1NBFC 2BKFA 1F77A 1BXTA 1STEA 1SF0A 2WYQA 3N32A 5C1ZA 1VDVA 3DBRI 4MDKE 4YWGG 2GI9A 4M02A 2DHZA 3PZ7A 4ANUA 1PYWD 1L0YB 4JWUC 2LWPA 3NVWA 4GDLA 4RF1A 3R8BA 1P3QU 2BF8B 3HRDD 4W9JA 2JRHA 2IBIB 4FLHA 1VJKA 4YTPB 3PRMB 2PTLA 3M95A 2KVZA 4EOYA 2ZZPB 5MPOA 4B6WA 3UF8A 2UU7A 3PRPB 1NENB 2G45B 2V4LA 2XNAC 1EF5A 2V1YA 5IAAC 1V5TA 1TKEA 4G50A 4OZAA 3AEDB 2WWZA 3AULA 1FRDA 2AL6A 2HDEA 3AN1A 3U52E 1J0GA 3NZ3A 1B1ZA 5D7GA 4LNIA 2KFJA 2Y5PA 1VZ8A 1Y56A 3W5UB 5LLIA 1C4CA 4YXDB 1C4AA
chains in the Genus database with same CATH topology
2EKEC 4W9HA 4NJ7A 2JUOA 2KXJA 3AXCA 4ZRJA 3LJ3A 1LM8B 1WZ0A 3T9LA 1BT0A 3R7QA 4FHJA 1MG8A 5AZHA 1Q0WB 2OJRA 1I42A 4CYEA 1WXAA 1RRBA 3ALBA 1UH6A 2GBKA 2JPHA 3EHVA 1GNUA 4HWIB 4IWPA 2CS4A 2K6DB 4I6PA 2D07B 3PT2B 2C5LC 1WY8A 4W9KA 3H7SA 3ZKJC 1S1QB 2AWTA 1P0RA 2NBUA 5CTRC 1WMHA 4FA6A 4NJ6A 4LCDE 2CHXA 2I1KA 3B08A 4ANXA 3HK0A 3D32A 3V62A 2CHZA 1E8YA 2NPTB 3V6EB 3DBSA 1I35A 4RM8A 1WE6A 3UIOB 2ZNVC 2RGFA 3KW5B 1AARA 2Z0DB 3L54A 4GGQA 4AOFA 3ZNZB 2MW5A 3TBLD 2MLBA 3W1SA 3QAQA 4GU2A 1TGZB 2Z0EB 1XT9B 2IO0B 2ZVNA 3NOBA 3H7PA 2Y5BB 3ZIMA 3RZFA 4HLEA 1WXVA 2BYEA 4JLCA 4X57B 3ZNHB 4IUMB 4JGHB 2DX5B 3PLVA 3VH4B 1SIFA 2M4NA 3R66C 4PYUA 2KKCA 2LD9A 3KYDD 5IA7A 3ZNGC 3GOEA 2AL3A 1UZXB 1RLFA 4MGKE 4PS3A 4TKNA 3ZVVA 4BBNC 1E5WA 3VTVA 4KDIC 4PYZA 3B1LX 3PHXB 4J6IA 1IPGA 3SD5A 1Q5WB 3JYUA 1GC6A 2O2VB 3DVNU 3VHTC 1LFDA 2DZMA 4XZ4A 4W9IA 3WAPA 2KTRA 2KC1A 4JL9A 3JSVA 4DDID 4DHJD 2GBRA 3HM3A 2MBBB 3DVNV 2MRPA 4EZKA 3EC8A 2LGYA 2MP2A 2OOBB 1Y8RC 3A1QA 4EFOA 2IO1B 3U30A 2N9PC 2KC2A 2MX2A 1GG3A 4GDLB 4A3OA 2IO2B 2N9EB 3RUIB 2XK5A 3R3MA 2JY6A 2DAFA 4IM3A 2DYOA 2JVCA 3A9JB 4NNJB 4DHZE 2L8JA 4WQOB 5J2RA 1WJ6A 2N9XA 4IWOA 1WXSA 2KZRA 2HJ8A 1WX9A 5KHOA 3TMPB 2BYFA 4FJYA 4G3XB 2CHWA 2NCNA 4HXDA 1TZ1A 2RSUA 2LVOA 3TJPA 5L95C 5E6OA 1V6EA 3QJZA 4IM2A 2MSED 1S3SG 3ZTDA 4URKA 1JRUA 2FNJB 3QA8A 2PJHA 3RYTA 3AI5A 1E90A 4KDLB 4N9F4 2KWCA 4IWQA 3DCGA 2O6VA 1Z5SB 2BKRB 2LXAA 3QC8B 3QWZB 3V6CB 4K7WA 2GBNA 1V86A 4GDKB 4JQWC 2C9WB 2ZCCA 3PVLA 4HDOA 2LJ5A 4HPMB 2JT4B 1YIWA 4HPLB 1R4NI 4F8CB 4K7SA 2KMCA 3CMMB 3L17A 3R7RA 2KWVB 1J19A 1WGHA 4CO7A 2DAJA 4ZRIA 3U7DA 5CHWA 1OEYJ 4MH0E 1TTNA 3VQIA 2XBBC 3WANA 2VRRB 3ECIA 4BKSD 4KSKC 1P9DU 5J18A 3ML9A 4NAWB 4MGZE 4NQLB 2K8BA 1GJZA 2LI5A 5LXHA 2JRIB 2NS5A 5D6JB 2KD0A 5FR6A 2CU1A 2J0JA 4FULA 5D94A 2A4ZA 2KJRA 5JHBA 3GZNI 5BO4B 2C60A 1OQYA 3L16A 2L76A 3KUZA 2PE9A 3H6NA 4W9GA 5EDSA 2LUEA 1E8WA 4TUUA 5GMVA 5D2MB 3JVZX 1UD7A 2DZKA 1C3TA 4WJNA 3A9KA 1WJUA 1XD3B 3QARA 1GC7A 5AEKB 1E7VA 3NZUA 3APFA 3PHWB 1RFAA 1YD8U 3RCZA 2D11A 4BOZB 1FXTB 2GBJA 2W9NA 2WDTB 4XX5A 4PS8A 3KVFB 2C7HA 4I6NB 2KDEB 2ASQA 3OJ3A 3EFUA 2KDBA 3APCA 3PZDA 5JHAA 3MTNB 2M17A 1WE7A 4F7ZA 2DZJA 4PS7A 2N7DA 3W1YA 1V9JA 3QX1A 4WJQA 3H7PB 3ENEA 1UBIA 4P7IA 4KZCA 4XC2A 3HIZA 4G0NB 4MSQB 4DBGA 3K9PB 2KLGA 3L0WB 2IY0B 1EO6A 3AU5A 2MBQA 4LJOB 3QHTA 2KANA 4HCPB 3APDA 3O65B 3T8MA 2DYMA 3WIMA 3LDZE 4IM0A 1VD2A 3S2AA 3QQ8B 4RM9A 1K8RB 4WAAA 1C1YB 2LXCA 3H1UA 4MJSA 2B3AA 4IC7B 4WWPA 4BFRA 4LJPB 4BBNF 2RPQA 1WGYA 2RD0A 1HE8A 2NBWB 3BINA 4HK2A 1WJ4A 2N7EA 2JWZA 4MM3A 3V60A 4K81A 1WR1A 2LRWA 4RMAA 4B95A 4AWJA 4GMVA 2PPHA 4WJOA 2AEHA 2KOXA 3WALA 1WGDA 2KQSA 3VXWA 4GSWA 4MELA 3BY4B 3AU4A 2MP2B 2HD5B 2LVQA 3A1QB 3RULA 4DXAB 2L0TA 4FBJB 4KIKA 2BWFA 1V80A 2LZ6A 2ZNVB 1RAXA 4DWFA 2GMIC 2ZJDA 4W9FA 4MGIE 5CHVC 4TV3A 2XK5B 2MCNB 3B0AA 3ZRCA 1WJNA 5E6PA 2D3GA 4LDTB 3VFKA 3VTUA 5DPSA 4E3CA 2K1FA 3ZDTA 2LRUA 4WJPA 1V2YA 1WRDB 2YVCA 1D3ZA 2YLMA 4YL8A 1WXMA 3NHEB 4K7UA 3A33B 3SU8X 1P1AA 2KTFA 3UGBB 3CSFA 2KMAA 5JZEB 3DQVA 4W9EA 5DPTA 1IYFA 2IZVB 2EMTA 3X0WA 2QHOA 3ZW3A 1M94A 3ZO5B 1KOTA 2KO3A 2CR5A 1UBQA 2KJHB 3OJ4B 2D10A 3UQAA 2N4FA 3RT3B 2ZPYA 1LXDA 4W9DA 3ONSA 4AJWA 3HM6X 1L2NA 2IY1B 3HHMA 1V5OA 2O6VB 3A4SC 3N3KB 2J0KA 2GOWA 3M62B 1GUAB 2LGDA 5KHQA 1WR6E 1YX5B 1SE9A 2KNBA 2DENB 3Q3JA 4BOSC 2JXXA 1R4MI 3V61A 3JW0X 3UIPB 1TBEA 3DBHI 3CSTA 3MJWA 4M8MA 4ANWA 3PS6A 3QK0A 3A4RA 4BKTA 2G3QB 2MBEA 2NR2A 1F9JA 3PREA 4EUTA 4I6LB 2MWSB 1WH3A 2KJ6A 3DDCB 1ZW7A 2ZEQA 4EKUA 1V81A 1OTRB 2DYBA 1WYWB 2KWUB 4HDQA 2FCQA 3ZLZA 4DHZB 1ISNA 4GOCA 4WWNA 4M0WB 2JZZA 4GXBA 5TR5A 3PPAA 2C7MB 1H4RA 1NDDA 2KK8A 4FJVB 4NQKE 4EZJA 3VVWB 1IP9A 3RD2A 2PE6B 3ZNID 4DDGD 3NY5A 1YX6B 3A9KB 4ZRKA 1E7UA 2ZVOA 3P2BA 2KFKA 3PRZA 3L10B 1QZEA 4GB9A 2A5UA 1E8XA 3K9OB 4OVVA 5AZFA 3DBLI 3SDLC 4GN1A 2LGXA 4HJKA 4ICVA 4AJYB 4IG7B 1WI0A 4KZ0A 2LASA 4ASWC 4M8NA 1WMHB 3VUWA 2NBVB 4KVGB 1J8CA 1PQSA 2N1WA 1X1MA 2G4SA 1EUVB 3IVFA 4BKSA 2K8HA 2MA9B 1E8ZA 3OAWA 2HTHA 5CHFA 4FN2A 5LXIB 2FAZA 2FIDA 2J0MA 5JH5C 4FADA 4AUQC 3UQBA 2EMSA 4HVBA 3DVGY 3VTWA 2K25A 1WM3A 2WX1A 5J17A 3OLMD 4GIVA 2JF5A 2BWES 2BPSA 1H8CA 1WX8A 2R2QA 3DVGX 3VDZA 3X23A 2CKHB 2Z59B 3TL5A 3ZUNA 2K39A 2KDFB 3KYCD 4II3B 4MJSB 2KLCA 2NPTA 1KJTA 2C7NB 2R2OA 3I3TB 4NY0A 4TQ1A 2J7QB 3IG3A 1NI2A 2LVPA 3VH3B 3VAWA 3PV1A 5HKHA 4JIOU 1A5RA 5E6NA 4EZLA 1ZKHA 1OEYA 1V49A 1CMXB 3PLUA 5DPWA 3KUCB 1UELA 2KTRB 3TIXA 4MGYE 4A20A 2XEWA 4F1SA 2BGFA 3JSVB 2KX0A 3NZSA 3SHQA 2K6QA 4B9KA 1WZ3A 2HE7A 2WX0A 2MQJA 3QCAA 2NVUI 4HCNB 2JZ3B 2UWQA 4KIKB 5C23A 4A3PA 3NS8A 1Z2MA 4LDTD 2UYZB 1LQBA 2DZIA 4BVUC 3DPDA 3EECA 4ICUA 2K8CA 2L00B 3PTFC 2MBHA 2KDIA 3IFWB 2GBMA 1NBFC 2BKFA 2KX3A 2V3SA 1ZGUB 4OVUA 3PGEA 1EF1A 4E74A 5G55A 2IO3B 4EEWA 3PSEB 3Q3FA 3L08A 2WYQA 3N32A 4K1RB 5C1ZA 4II2B 2O2VA 1OGWA 3MHSD 4CHKA 3U8ZA 3L13A 2FCSA 3C0RB 1XQQA 2KQ7A 3CF6E 4MSMB 2PEAA 3DBRI 4MDKE 1YJ1A 2DHZA 2BYVE 2O6VD 4ANUA 3WAOA 2FIFA 2RR9A 2LWPA 4DHJB 5DPRA 4E71A 2KVRA 1WGGA 1SGHA 4GDLA 4G11A 4WWOA 1WM2A 3ZDMC 1WGRA 4ZYNA 2I1JA 3IHPC 4W9LA 1P3QU 3A9JA 3WA0A 2BF8B 2FCMA 4W9JA 2JRHA 1KLVA 2IBIB 2L7RA 4FLHA 4KSLC 1WF9A 1U4AA 4BKGA 3PRMB 3DOWA 4AP4C 2L05A 3M95A 4EOYA 5L83A 2ZZPB 3RZWC 4B6WA 2KN5A 3UF8A 4ZDVA 3PRPB 3VUYA 2L0FA 2G45B 2V4LA 4IW0A 2REXA 2AYOB 1EF5A 2FUHB 2V1YA 3QIJA 2ZPNA 3ML8A 5IAAC 1V5TA 3VUXA 3IBEA 2N1VA 4FJZA 3KH0A 3WAMA 4DK5A 1WX7A 4G50A 1L7YA 1P98A 5DCNA 2G4DB 4NPNA 2KHWB 2WWZA 3H9DA 2FCNA 3AULA 2D2QA 4FHKA 1UGMA 4GDKA 2AL6A 5G2NA 4ANVA 1VCBA 2L3ZA 1Q1OA 3KUDB 3M3JA 4W9CA 1G6JA 1J0GA 3M63B 1WIAA 5D7GA 5CX3A 2M1MA 4TQ0A 2IYDB 2KFKB 2KFJA 3W1SC 2M8SA 3ZRFA 3N30A 1KM7A 1T0YA 2MBOA 2ZCBA 5AZGA 1WFYA 4NAWA 2M0XA 5LLIA 3TCAA 4KV2A 1YQBA 3ZTCA 4MEMA 3UINB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EKE C;  4W9H A;  4NJ7 A;  2JUO A;  2KXJ A;  3AXC A;  4ZRJ A;  3LJ3 A;  1LM8 B;  1WZ0 A;  3T9L A;  1BT0 A;  3R7Q A;  4FHJ A;  1MG8 A;  5AZH A;  1Q0W B;  2OJR A;  1I42 A;  4CYE A;  1WXA A;  1RRB A;  3ALB A;  1UH6 A;  2GBK A;  2JPH A;  3EHV A;  1GNU A;  4HWI B;  4IWP A;  2CS4 A;  2K6D B;  4I6P A;  2D07 B;  3PT2 B;  2C5L C;  1WY8 A;  4W9K A;  3H7S A;  3ZKJ C;  1S1Q B;  2AWT A;  1P0R A;  2NBU A;  5CTR C;  1WMH A;  4FA6 A;  4NJ6 A;  4LCD E;  2CHX A;  2I1K A;  3B08 A;  4ANX A;  3HK0 A;  3D32 A;  3V62 A;  2CHZ A;  1E8Y A;  2NPT B;  3V6E B;  3DBS A;  1I35 A;  4RM8 A;  1WE6 A;  3UIO B;  2ZNV C;  2RGF A;  3KW5 B;  1AAR A;  2Z0D B;  3L54 A;  4GGQ A;  4AOF A;  3ZNZ B;  2MW5 A;  3TBL D;  2MLB A;  3W1S A;  3QAQ A;  4GU2 A;  1TGZ B;  2Z0E B;  1XT9 B;  2IO0 B;  2ZVN A;  3NOB A;  3H7P A;  2Y5B B;  3ZIM A;  3RZF A;  4HLE A;  1WXV A;  2BYE A;  4JLC A;  4X57 B;  3ZNH B;  4IUM B;  4JGH B;  2DX5 B;  3PLV A;  3VH4 B;  1SIF A;  2M4N A;  3R66 C;  4PYU A;  2KKC A;  2LD9 A;  3KYD D;  5IA7 A;  3ZNG C;  3GOE A;  2AL3 A;  1UZX B;  1RLF A;  4MGK E;  4PS3 A;  4TKN A;  3ZVV A;  4BBN C;  1E5W A;  3VTV A;  4KDI C;  4PYZ A;  3B1L X;  3PHX B;  4J6I A;  1IPG A;  3SD5 A;  1Q5W B;  3JYU A;  1GC6 A;  2O2V B;  3DVN U;  3VHT C;  1LFD A;  2DZM A;  4XZ4 A;  4W9I A;  3WAP A;  2KTR A;  2KC1 A;  4JL9 A;  3JSV A;  4DDI D;  4DHJ D;  2GBR A;  3HM3 A;  2MBB B;  3DVN V;  2MRP A;  4EZK A;  3EC8 A;  2LGY A;  2MP2 A;  2OOB B;  1Y8R C;  3A1Q A;  4EFO A;  2IO1 B;  3U30 A;  2N9P C;  2KC2 A;  2MX2 A;  1GG3 A;  4GDL B;  4A3O A;  2IO2 B;  2N9E B;  3RUI B;  2XK5 A;  3R3M A;  2JY6 A;  2DAF A;  4IM3 A;  2DYO A;  2JVC A;  3A9J B;  4NNJ B;  4DHZ E;  2L8J A;  4WQO B;  5J2R A;  1WJ6 A;  2N9X A;  4IWO A;  1WXS A;  2KZR A;  2HJ8 A;  1WX9 A;  5KHO A;  3TMP B;  2BYF A;  4FJY A;  4G3X B;  2CHW A;  2NCN A;  4HXD A;  1TZ1 A;  2RSU A;  2LVO A;  3TJP A;  5L95 C;  5E6O A;  1V6E A;  3QJZ A;  4IM2 A;  2MSE D;  1S3S G;  3ZTD A;  4URK A;  1JRU A;  2FNJ B;  3QA8 A;  2PJH A;  3RYT A;  3AI5 A;  1E90 A;  4KDL B;  4N9F 4;  2KWC A;  4IWQ A;  3DCG A;  2O6V A;  1Z5S B;  2BKR B;  2LXA A;  3QC8 B;  3QWZ B;  3V6C B;  4K7W A;  2GBN A;  1V86 A;  4GDK B;  4JQW C;  2C9W B;  2ZCC A;  3PVL A;  4HDO A;  2LJ5 A;  4HPM B;  2JT4 B;  1YIW A;  4HPL B;  1R4N I;  4F8C B;  4K7S A;  2KMC A;  3CMM B;  3L17 A;  3R7R A;  2KWV B;  1J19 A;  1WGH A;  4CO7 A;  2DAJ A;  4ZRI A;  3U7D A;  5CHW A;  1OEY J;  4MH0 E;  1TTN A;  3VQI A;  2XBB C;  3WAN A;  2VRR B;  3ECI A;  4BKS D;  4KSK C;  1P9D U;  5J18 A;  3ML9 A;  4NAW B;  4MGZ E;  4NQL B;  2K8B A;  1GJZ A;  2LI5 A;  5LXH A;  2JRI B;  2NS5 A;  5D6J B;  2KD0 A;  5FR6 A;  2CU1 A;  2J0J A;  4FUL A;  5D94 A;  2A4Z A;  2KJR A;  5JHB A;  3GZN I;  5BO4 B;  2C60 A;  1OQY A;  3L16 A;  2L76 A;  3KUZ A;  2PE9 A;  3H6N A;  4W9G A;  5EDS A;  2LUE A;  1E8W A;  4TUU A;  5GMV A;  5D2M B;  3JVZ X;  1UD7 A;  2DZK A;  1C3T A;  4WJN A;  3A9K A;  1WJU A;  1XD3 B;  3QAR A;  1GC7 A;  5AEK B;  1E7V A;  3NZU A;  3APF A;  3PHW B;  1RFA A;  1YD8 U;  3RCZ A;  2D11 A;  4BOZ B;  1FXT B;  2GBJ A;  2W9N A;  2WDT B;  4XX5 A;  4PS8 A;  3KVF B;  2C7H A;  4I6N B;  2KDE B;  2ASQ A;  3OJ3 A;  3EFU A;  2KDB A;  3APC A;  3PZD A;  5JHA A;  3MTN B;  2M17 A;  1WE7 A;  4F7Z A;  2DZJ A;  4PS7 A;  2N7D A;  3W1Y A;  1V9J A;  3QX1 A;  4WJQ A;  3H7P B;  3ENE A;  1UBI A;  4P7I A;  4KZC A;  4XC2 A;  3HIZ A;  4G0N B;  4MSQ B;  4DBG A;  3K9P B;  2KLG A;  3L0W B;  2IY0 B;  1EO6 A;  3AU5 A;  2MBQ A;  4LJO B;  3QHT A;  2KAN A;  4HCP B;  3APD A;  3O65 B;  3T8M A;  2DYM A;  3WIM A;  3LDZ E;  4IM0 A;  1VD2 A;  3S2A A;  3QQ8 B;  4RM9 A;  1K8R B;  4WAA A;  1C1Y B;  2LXC A;  3H1U A;  4MJS A;  2B3A A;  4IC7 B;  4WWP A;  4BFR A;  4LJP B;  4BBN F;  2RPQ A;  1WGY A;  2RD0 A;  1HE8 A;  2NBW B;  3BIN A;  4HK2 A;  1WJ4 A;  2N7E A;  2JWZ A;  4MM3 A;  3V60 A;  4K81 A;  1WR1 A;  2LRW A;  4RMA A;  4B95 A;  4AWJ A;  4GMV A;  2PPH A;  4WJO A;  2AEH A;  2KOX A;  3WAL A;  1WGD A;  2KQS A;  3VXW A;  4GSW A;  4MEL A;  3BY4 B;  3AU4 A;  2MP2 B;  2HD5 B;  2LVQ A;  3A1Q B;  3RUL A;  4DXA B;  2L0T A;  4FBJ B;  4KIK A;  2BWF A;  1V80 A;  2LZ6 A;  2ZNV B;  1RAX A;  4DWF A;  2GMI C;  2ZJD A;  4W9F A;  4MGI E;  5CHV C;  4TV3 A;  2XK5 B;  2MCN B;  3B0A A;  3ZRC A;  1WJN A;  5E6P A;  2D3G A;  4LDT B;  3VFK A;  3VTU A;  5DPS A;  4E3C A;  2K1F A;  3ZDT A;  2LRU A;  4WJP A;  1V2Y A;  1WRD B;  2YVC A;  1D3Z A;  2YLM A;  4YL8 A;  1WXM A;  3NHE B;  4K7U A;  3A33 B;  3SU8 X;  1P1A A;  2KTF A;  3UGB B;  3CSF A;  2KMA A;  5JZE B;  3DQV A;  4W9E A;  5DPT A;  1IYF A;  2IZV B;  2EMT A;  3X0W A;  2QHO A;  3ZW3 A;  1M94 A;  3ZO5 B;  1KOT A;  2KO3 A;  2CR5 A;  1UBQ A;  2KJH B;  3OJ4 B;  2D10 A;  3UQA A;  2N4F A;  3RT3 B;  2ZPY A;  1LXD A;  4W9D A;  3ONS A;  4AJW A;  3HM6 X;  1L2N A;  2IY1 B;  3HHM A;  1V5O A;  2O6V B;  3A4S C;  3N3K B;  2J0K A;  2GOW A;  3M62 B;  1GUA B;  2LGD A;  5KHQ A;  1WR6 E;  1YX5 B;  1SE9 A;  2KNB A;  2DEN B;  3Q3J A;  4BOS C;  2JXX A;  1R4M I;  3V61 A;  3JW0 X;  3UIP B;  1TBE A;  3DBH I;  3CST A;  3MJW A;  4M8M A;  4ANW A;  3PS6 A;  3QK0 A;  3A4R A;  4BKT A;  2G3Q B;  2MBE A;  2NR2 A;  1F9J A;  3PRE A;  4EUT A;  4I6L B;  2MWS B;  1WH3 A;  2KJ6 A;  3DDC B;  1ZW7 A;  2ZEQ A;  4EKU A;  1V81 A;  1OTR B;  2DYB A;  1WYW B;  2KWU B;  4HDQ A;  2FCQ A;  3ZLZ A;  4DHZ B;  1ISN A;  4GOC A;  4WWN A;  4M0W B;  2JZZ A;  4GXB A;  5TR5 A;  3PPA A;  2C7M B;  1H4R A;  1NDD A;  2KK8 A;  4FJV B;  4NQK E;  4EZJ A;  3VVW B;  1IP9 A;  3RD2 A;  2PE6 B;  3ZNI D;  4DDG D;  3NY5 A;  1YX6 B;  3A9K B;  4ZRK A;  1E7U A;  2ZVO A;  3P2B A;  2KFK A;  3PRZ A;  3L10 B;  1QZE A;  4GB9 A;  2A5U A;  1E8X A;  3K9O B;  4OVV A;  5AZF A;  3DBL I;  3SDL C;  4GN1 A;  2LGX A;  4HJK A;  4ICV A;  4AJY B;  4IG7 B;  1WI0 A;  4KZ0 A;  2LAS A;  4ASW C;  4M8N A;  1WMH B;  3VUW A;  2NBV B;  4KVG B;  1J8C A;  1PQS A;  2N1W A;  1X1M A;  2G4S A;  1EUV B;  3IVF A;  4BKS A;  2K8H A;  2MA9 B;  1E8Z A;  3OAW A;  2HTH A;  5CHF A;  4FN2 A;  5LXI B;  2FAZ A;  2FID A;  2J0M A;  5JH5 C;  4FAD A;  4AUQ C;  3UQB A;  2EMS A;  4HVB A;  3DVG Y;  3VTW A;  2K25 A;  1WM3 A;  2WX1 A;  5J17 A;  3OLM D;  4GIV A;  2JF5 A;  2BWE S;  2BPS A;  1H8C A;  1WX8 A;  2R2Q A;  3DVG X;  3VDZ A;  3X23 A;  2CKH B;  2Z59 B;  3TL5 A;  3ZUN A;  2K39 A;  2KDF B;  3KYC D;  4II3 B;  4MJS B;  2KLC A;  2NPT A;  1KJT A;  2C7N B;  2R2O A;  3I3T B;  4NY0 A;  4TQ1 A;  2J7Q B;  3IG3 A;  1NI2 A;  2LVP A;  3VH3 B;  3VAW A;  3PV1 A;  5HKH A;  4JIO U;  1A5R A;  5E6N A;  4EZL A;  1ZKH A;  1OEY A;  1V49 A;  1CMX B;  3PLU A;  5DPW A;  3KUC B;  1UEL A;  2KTR B;  3TIX A;  4MGY E;  4A20 A;  2XEW A;  4F1S A;  2BGF A;  3JSV B;  2KX0 A;  3NZS A;  3SHQ A;  2K6Q A;  4B9K A;  1WZ3 A;  2HE7 A;  2WX0 A;  2MQJ A;  3QCA A;  2NVU I;  4HCN B;  2JZ3 B;  2UWQ A;  4KIK B;  5C23 A;  4A3P A;  3NS8 A;  1Z2M A;  4LDT D;  2UYZ B;  1LQB A;  2DZI A;  4BVU C;  3DPD A;  3EEC A;  4ICU A;  2K8C A;  2L00 B;  3PTF C;  2MBH A;  2KDI A;  3IFW B;  2GBM A;  1NBF C;  2BKF A;  2KX3 A;  2V3S A;  1ZGU B;  4OVU A;  3PGE A;  1EF1 A;  4E74 A;  5G55 A;  2IO3 B;  4EEW A;  3PSE B;  3Q3F A;  3L08 A;  2WYQ A;  3N32 A;  4K1R B;  5C1Z A;  4II2 B;  2O2V A;  1OGW A;  3MHS D;  4CHK A;  3U8Z A;  3L13 A;  2FCS A;  3C0R B;  1XQQ A;  2KQ7 A;  3CF6 E;  4MSM B;  2PEA A;  3DBR I;  4MDK E;  1YJ1 A;  2DHZ A;  2BYV E;  2O6V D;  4ANU A;  3WAO A;  2FIF A;  2RR9 A;  2LWP A;  4DHJ B;  5DPR A;  4E71 A;  2KVR A;  1WGG A;  1SGH A;  4GDL A;  4G11 A;  4WWO A;  1WM2 A;  3ZDM C;  1WGR A;  4ZYN A;  2I1J A;  3IHP C;  4W9L A;  1P3Q U;  3A9J A;  3WA0 A;  2BF8 B;  2FCM A;  4W9J A;  2JRH A;  1KLV A;  2IBI B;  2L7R A;  4FLH A;  4KSL C;  1WF9 A;  1U4A A;  4BKG A;  3PRM B;  3DOW A;  4AP4 C;  2L05 A;  3M95 A;  4EOY A;  5L83 A;  2ZZP B;  3RZW C;  4B6W A;  2KN5 A;  3UF8 A;  4ZDV A;  3PRP B;  3VUY A;  2L0F A;  2G45 B;  2V4L A;  4IW0 A;  2REX A;  2AYO B;  1EF5 A;  2FUH B;  2V1Y A;  3QIJ A;  2ZPN A;  3ML8 A;  5IAA C;  1V5T A;  3VUX A;  3IBE A;  2N1V A;  4FJZ A;  3KH0 A;  3WAM A;  4DK5 A;  1WX7 A;  4G50 A;  1L7Y A;  1P98 A;  5DCN A;  2G4D B;  4NPN A;  2KHW B;  2WWZ A;  3H9D A;  2FCN A;  3AUL A;  2D2Q A;  4FHK A;  1UGM A;  4GDK A;  2AL6 A;  5G2N A;  4ANV A;  1VCB A;  2L3Z A;  1Q1O A;  3KUD B;  3M3J A;  4W9C A;  1G6J A;  1J0G A;  3M63 B;  1WIA A;  5D7G A;  5CX3 A;  2M1M A;  4TQ0 A;  2IYD B;  2KFK B;  2KFJ A;  3W1S C;  2M8S A;  3ZRF A;  3N30 A;  1KM7 A;  1T0Y A;  2MBO A;  2ZCB A;  5AZG A;  1WFY A;  4NAW A;  2M0X A;  5LLI A;  3TCA A;  4KV2 A;  1YQB A;  3ZTC A;  4MEM A;  3UIN B; 
#chains in the Genus database with same CATH topology
 4W9H A;  2JUO A;  1LM8 B;  1BT0 A;  4FHJ A;  3KWL A;  2BB5 A;  3PT2 B;  1WY8 A;  3RNB C;  3H7S A;  5CTR C;  5EE1 A;  1QOA A;  4FA6 A;  4NJ6 A;  4LCD E;  2I1K A;  2ZNV C;  4US9 A;  3ZNZ B;  3TBL D;  1XT9 B;  2JYE A;  2ZVN A;  3P4S B;  4ITK A;  5HI1 A;  3IAS 1;  2PVG C;  3ZIM A;  2PKO A;  3RZF A;  4JLC A;  4ZHO A;  2YEP B;  3OG5 A;  1SIF A;  2M4N A;  2LD9 A;  2LGI A;  5IA7 A;  3ZNG C;  3GOE A;  1RLF A;  2IGD A;  4MGK E;  4BBN C;  1K51 A;  2DNF A;  4KDI C;  4PYZ A;  3B1L X;  1IPG A;  1QOB A;  1GC6 A;  3P63 A;  3ETR A;  1LFD A;  4N59 A;  2DZM A;  4XZ4 A;  2INC C;  2KTR A;  2KC1 A;  2IDY A;  2MBB B;  5BMG A;  4EZK A;  3EC8 A;  2OOB B;  4EFO A;  1E0Z A;  3U30 A;  2N9P C;  2MX2 A;  4GDL B;  2BB6 A;  3I57 A;  4A90 A;  2JVC A;  1VRA B;  2KAJ A;  4DHZ E;  2BTE A;  2KZR A;  5E6J A;  2VZK B;  4FJY A;  1R4M B;  3TJP A;  5L95 C;  4K3C A;  1S3S G;  1FM0 D;  5HFY A;  2K22 A;  1M4V A;  2PJH A;  3AI5 A;  3NUH B;  3MC9 A;  1E90 A;  2I38 A;  1TKY A;  2KWC A;  1JCK B;  1ZDV A;  4K7W A;  2GBN A;  2WHI A;  3TEW A;  2J52 A;  4DXG A;  2DLB A;  2L32 A;  4HPM B;  2JT4 B;  1R4N I;  1C76 A;  1V1P A;  2KWV B;  1WGH A;  4L23 A;  4CO7 A;  4ZRI A;  4JWS C;  4IDI A;  4MH0 E;  1L6V A;  2XBB C;  3RN9 C;  4BKS D;  3ML9 A;  4LNN A;  1FD6 A;  2LI5 A;  2JRI B;  1SJH D;  3MFG A;  2ON8 A;  2CU1 A;  4FUL A;  5D94 A;  2KJR A;  2YEP F;  2C60 A;  4K3B A;  1D5Z C;  1RYJ A;  1UD7 A;  2DZK A;  2X8X X;  4C56 C;  5AEK B;  3APF A;  1J7C A;  2OED A;  1XLP A;  3U2S C;  5EE0 A;  2C7H A;  2BS2 B;  2KDB A;  3PZD A;  3MTN B;  2DZJ A;  1L5P A;  2GB1 A;  4DQO C;  3W1Y A;  1V9J A;  1HEZ E;  1FXI A;  3HIZ A;  2WXH A;  3K9P B;  1C77 A;  2KLG A;  3V3X A;  2IY0 B;  3AU5 A;  1UF0 A;  1N6Z A;  1HQR D;  2EKI A;  3APD A;  4HCP B;  2DYM A;  1ZUD 2;  4RM9 A;  3EFC A;  4WAA A;  2LXC A;  1D5X C;  4WWP A;  4LJP B;  1TIF A;  2LUM A;  1HE8 A;  3BIN A;  4HK2 A;  1WJ4 A;  4MM3 A;  4OZB A;  4RH6 A;  5BYR A;  1YN5 A;  5JXV A;  3BYY B;  4H2A A;  2LRW A;  3AE2 B;  1E7P B;  4WJO A;  2KQS A;  4MEL A;  3RUL A;  4DXA B;  2INN E;  2BBC A;  2ZNV B;  4MGI E;  5CHV C;  2MCN B;  3UI3 A;  3Q3N C;  2G1E A;  3Q8B A;  4LDT B;  5DPS A;  1TS4 A;  1FNW A;  3AMZ A;  4E3C A;  1N61 A;  4PK1 A;  3NHE B;  4ZHP A;  2Z8L A;  3SU8 X;  5IN7 A;  2KTF A;  2AQ2 B;  3DQV A;  4AS1 A;  2QHO A;  3ZO5 B;  2KO3 A;  2CR5 A;  2MEK A;  3OJ4 B;  3UQA A;  4AJW A;  2WXL A;  2IY1 B;  1MHX A;  3HHM A;  2AQ1 B;  2GOW A;  2J42 A;  3DHG C;  3DWM A;  1SE9 A;  3Q3J A;  1N60 A;  2JYT A;  1WSP A;  1J7B A;  3RMK C;  3PS6 A;  3QK0 A;  4BKT A;  3RNA C;  2QJL A;  1IGC A;  3DDC B;  4QAY A;  1CJE A;  4KX6 B;  4DHZ B;  4GOC A;  4WWN A;  4M0W B;  3PPA A;  1H4R A;  4FJV B;  4NQK E;  3FKY A;  2WXN A;  3SDL C;  2A5U A;  5AZF A;  3DBL I;  4B0E A;  4AQ7 A;  2LGX A;  4ICV A;  4IG7 B;  4KZ0 A;  1WMH B;  4RGM A;  1X1M A;  4BKS A;  1E8Z A;  1XO3 A;  2FID A;  5EE9 A;  4C4V A;  4O1N A;  2WX1 A;  2BPS A;  3NVZ A;  1H8C A;  2KDF B;  2K9X A;  2NPT A;  1KJT A;  1EU3 A;  4NY0 A;  3IG3 A;  2LVP A;  4MM3 B;  1YNT E;  1I4P A;  4JIO U;  1ROE A;  4OHJ A;  4MH8 A;  5DPW A;  3SEB A;  4BZA A;  4MGY E;  4A20 A;  3NZS A;  5IKC M;  2MQJ A;  4BVU C;  3BVM A;  3RI7 C;  1DOY A;  3EEC A;  4ICU A;  2K8C A;  3PTF C;  3PZ8 A;  2MBH A;  3NVY A;  3AE9 B;  2KX3 A;  2V3S A;  4OVU A;  3PGE A;  5G55 A;  4A8X C;  3PSE B;  1I4G A;  4K1R B;  1XLN A;  1V97 A;  3U8Z A;  1N63 A;  2FCS A;  3CF6 E;  4MSM B;  1CZP A;  2BYV E;  2O6V D;  4XDC A;  2KVR A;  1SGH A;  1ENF A;  2K0P A;  3A9J A;  4JE3 B;  1L0X B;  3P42 A;  1KLV A;  2L7R A;  4KSL C;  1U4A A;  1SB3 C;  4IW0 A;  2D3B A;  3QIJ A;  4FXC A;  4DK5 A;  3WAM A;  5D3D A;  1L7Y A;  5DCN A;  4FHK A;  2FCN A;  3H8H A;  2CJO A;  1VCB A;  2N0S B;  3GZN B;  5CX3 A;  2M1M A;  4TQ0 A;  2IYD B;  3AEC B;  2V3N A;  1K52 A;  1KM7 A;  2MBO A;  1T0Q C;  1WFY A;  4NAW A;  3BWU D;  2RDB C;  1YQB A;  4MEM A;  3AXC A;  4ZRJ A;  3Q8C A;  1WZ0 A;  5AZH A;  1I42 A;  4C4V B;  2JPH A;  4HWI B;  3Q69 A;  2CS4 A;  1TZO A;  4YTM B;  2C5L C;  3BZD B;  3ZKJ C;  4N6E B;  2V9H A;  1P0R A;  1GPX A;  3D32 A;  3V62 A;  2CHZ A;  2NPT B;  3V6E B;  1I35 A;  2H89 B;  1NYR A;  3R2T A;  1AAR A;  1HZ5 A;  2KQ4 X;  2IO0 B;  2KT7 A;  3NOB A;  3H7P A;  2Y5B B;  3RNG C;  4KGR A;  3FC4 A;  1F2R I;  4IUM B;  4JGH B;  4PYU A;  1WYG A;  3NVV A;  1UZX B;  1XCT L;  1Q5W B;  5FK9 C;  1SIJ A;  4UDU C;  3ZGZ A;  1FCC C;  2JQR B;  1OFF A;  4JL9 A;  2LGY A;  3A1Q A;  2IO1 B;  4L2Y A;  1NI3 A;  2E3T A;  4XWT A;  1YMH E;  2XK5 A;  4M01 A;  1JWU D;  3R3M A;  3Q8A A;  5TSS A;  1RWS A;  3A9J B;  5J2R A;  4IWO A;  2RMM A;  1WXS A;  2HJ8 A;  1WX9 A;  5KHO A;  2MJ3 A;  4G3X B;  1TZ1 A;  1R7S A;  5EE3 A;  5E6O A;  1CK1 A;  3QJZ A;  1GB1 A;  1JQ4 A;  4URK A;  3GE3 C;  1AN8 A;  1JRU A;  2FNJ B;  4NAM A;  4N9F 4;  4LK0 M;  2O6V A;  2NMQ A;  3E56 A;  2BKR B;  3EUB 2;  3V6C B;  4MT5 A;  1XCQ L;  1V86 A;  2V3P A;  1SE2 A;  4JQW C;  2JWU A;  2X38 A;  4HDO A;  2LJ5 A;  4HPL B;  3TEY A;  2KMC A;  2QCZ A;  3T3O A;  2DAJ A;  2MJE A;  3VR8 B;  3VQI A;  3WAN A;  4A9A A;  2VRR B;  3IT4 B;  4KSK C;  4NAW B;  4MGZ E;  4NQL B;  1GJZ A;  2BS3 B;  2NS5 A;  1C78 A;  3L16 A;  2L76 A;  3H6N A;  5EDS A;  2LUE A;  5GMV A;  3JVZ X;  2EEL A;  1C3T A;  3A9K A;  1XD3 B;  4OZC A;  1JWA D;  4IOI E;  1RFA A;  1GB4 A;  4HKQ A;  1YD8 U;  3RCZ A;  4ACF A;  2D11 A;  3B2G A;  2QIE B;  1FXT B;  2W9N A;  2WDT B;  1TYG B;  4I6N B;  3V05 A;  1E6E B;  1KRH A;  1ZE3 D;  2BVC A;  1FIQ A;  4PS7 A;  1P7E A;  1YN4 A;  3ZXR A;  3H7P B;  3ZQ4 A;  3KQ4 A;  4KZC A;  4MSQ B;  4XE0 A;  3DHI C;  3Q8E A;  3KLS X;  3L0W B;  2MBQ A;  4LJO B;  2QC8 A;  3O65 B;  3WIM A;  4S17 A;  3S2A A;  3QQ8 B;  3ABV B;  1C1Y B;  2W82 A;  4BFR A;  2RPQ A;  2RD0 A;  3AE3 B;  2N7E A;  1WR1 A;  2QDF A;  4RMA A;  2BW2 A;  4GMV A;  2AEH A;  1WGD A;  1C4P A;  2HD5 B;  3A1Q B;  3AB5 A;  4KIK A;  1V80 A;  4NZL B;  1RAX A;  4L1B A;  1OQQ A;  4KGS A;  3RNE C;  2XK5 B;  3B0A A;  3ZRC A;  4C7Y A;  2D3G A;  3VFK A;  2WXQ A;  3ZDT A;  2LRU A;  4WJP A;  1V2Y A;  2YVC A;  4DXF A;  3GB1 A;  2IJ0 A;  4K7U A;  3OWE B;  1P1A A;  3CSF A;  4WUR A;  2IZV B;  3X0W A;  1UGJ A;  2KMM A;  2D10 A;  2N4F A;  3RT3 B;  1J7A A;  3ONS A;  2WGS A;  1L2N A;  2ACZ B;  1V5O A;  2O6V B;  2J0K A;  3FIL A;  4RGN A;  2LGD A;  1RM6 C;  1WR6 E;  1R4M I;  1A70 A;  1TBE A;  1WRI A;  3CST A;  1T3Q A;  2E6X A;  3Q6B A;  2NR2 A;  1F9J A;  2MWS B;  4RF0 A;  1WXQ A;  1OTR B;  2PIA A;  2ZW0 A;  4HDQ A;  3ZLZ A;  4GXB A;  2C7M B;  1I4R A;  1NDD A;  1TJE A;  4REZ A;  3AEG B;  2KK8 A;  4OW0 A;  4RFB A;  3VVW B;  2PE6 B;  4HJG E;  3NY5 A;  1FFU A;  1YX6 B;  3A9K B;  4ZRK A;  2ZVO A;  2JX5 A;  3L10 B;  3K9O B;  4HJK A;  4AJY B;  4M8N A;  2NBV B;  1P7F A;  1PQS A;  2D3C A;  3IVF A;  3AE4 B;  2WQY B;  3CWI A;  3OAW A;  4YT0 B;  2J0M A;  2AQ3 B;  4FAD A;  1DGJ A;  1TT5 B;  3DVG Y;  3VTW A;  2QSD A;  5J17 A;  1ZXI A;  2JF5 A;  1QLB B;  1EWY C;  4P6V F;  2N9K A;  3DVG X;  4ARC A;  2K39 A;  3AE6 B;  1FNU A;  4II3 B;  2ONQ A;  1AYF A;  1DOI A;  2R2O A;  3I3T B;  2WXJ A;  5BMI A;  5HHD G;  1NI2 A;  3VH3 B;  1A5R A;  1ZKH A;  3PLU A;  3N20 C;  1LO5 D;  1QQR A;  2KTR B;  3TIX A;  2XEW A;  4F1S A;  3SHQ A;  5IO9 A;  2K6Q A;  2FBW B;  1WZ3 A;  2HE7 A;  4HCN B;  4KIK B;  2JZ3 B;  1Z2M A;  4P1C C;  1MFW A;  4E74 A;  1EF1 A;  3AM9 A;  1JW9 D;  4II2 B;  2O2V A;  3N1X C;  1OGW A;  3MHS D;  4CHK A;  3AEF B;  3L13 A;  1XQQ A;  3BVG A;  1HZ6 A;  1XF5 L;  1FO4 A;  4KGT A;  2KN4 A;  1WGG A;  1UUP A;  1WM2 A;  1WGR A;  4ZYN A;  2I1J A;  3IHP C;  3WA0 A;  5BMH A;  1V1P B;  2VH1 A;  3IAM 1;  2IGH A;  3LYY A;  3RZW C;  2L0F A;  4TSS A;  4HKZ E;  1ZP0 B;  2AYO B;  2FUH B;  4YSZ B;  2ZPN A;  3KH0 A;  1C9F A;  4MAC A;  3C19 A;  2OHF A;  2KHW B;  3H9D A;  4GDK A;  2L3Z A;  4W9C A;  4CQN A;  1D4B A;  3M63 B;  2MH7 A;  3HVZ A;  3TEX A;  2M8S A;  1MHH E;  2ZCB A;  2RDG A;  3TCA A;  2M0X A;  4A55 A;  3BK1 A;  3UIN B;  4NJ7 A;  2WNM A;  4NJC A;  2KXJ A;  2M56 B;  3LJ3 A;  2R61 A;  1PDX A;  1TS2 A;  3R7Q A;  1MG8 A;  4IWP A;  3AEB B;  5IP4 D;  2D07 B;  2PW9 A;  4W9K A;  2ICI A;  1S1Q B;  1GAQ B;  2AWT A;  4RGT A;  2CHX A;  4ANX A;  3HK0 A;  1VR9 A;  1E8Y A;  1WE6 A;  2RGF A;  3KW5 B;  2Z0D B;  3L54 A;  1L0V B;  3QAQ A;  4GU2 A;  1TGZ B;  3T3N A;  2D5G A;  4RGO S;  4HLE A;  1WXV A;  2BYE A;  4X57 B;  2L1A A;  4LNO A;  4S0R A;  3URY A;  3PLV A;  3VH4 B;  3KYD D;  2AL3 A;  4TKN A;  4PS3 A;  3VTV A;  2M0A A;  1F0Z A;  2O2V B;  2QIL A;  4W9I A;  3WAP A;  3JSV A;  4DDI D;  4DHJ D;  2MP2 A;  2KC2 A;  2N9E B;  1F1H A;  5H92 C;  2LEK A;  2DYO A;  2L8J A;  1WJ6 A;  2N9X A;  1YQ3 B;  3TMP B;  2BYF A;  1FNV A;  3WCQ A;  4WH4 A;  2CHW A;  1JML A;  2NCN A;  4HXD A;  2K5P A;  2RSU A;  3DBH B;  3J9C A;  3B2F A;  3ZTD A;  3DHH C;  2WU5 B;  3EA6 A;  3QA8 A;  4XDD A;  2WXM A;  3RYT A;  4Q2J A;  3RNC C;  4IWQ A;  5H8Y E;  3RPF C;  1YQ4 B;  3QWZ B;  2N9L A;  4GDK B;  2M19 A;  2TSS A;  4WAF A;  4R3D A;  4WIP A;  1ZXH A;  3CMM B;  1KFY B;  3GP7 A;  3TUO A;  1J19 A;  4KKI A;  2OJW A;  2WXF A;  3Q14 C;  4JPS A;  3ECI A;  2G9H D;  1BUI C;  2B76 B;  2VH2 A;  3R2I A;  1HTQ A;  1PGB A;  5FR6 A;  2JU6 X;  5JHB A;  3GZN I;  5BO4 B;  1QOF A;  2BT6 A;  4W9G A;  4HRO A;  1WJU A;  3P4P B;  1E7V A;  3ZXV A;  4BOZ B;  5GXG B;  2GBJ A;  1L4D B;  4XX5 A;  4PS8 A;  3KVF B;  2KDE B;  3OJ3 A;  3EFU A;  5T8I A;  2WP9 B;  5JHA A;  1WE7 A;  4F7Z A;  3GS2 A;  2N7D A;  3QX1 A;  3W2D A;  4XWW A;  1UBI A;  4G0N B;  4DBG A;  1XLO A;  1EO6 A;  1ET6 A;  3QHT A;  1JRP A;  3T8M A;  1VD2 A;  1TY0 A;  1K8R B;  3H1U A;  1DYQ A;  2B3A A;  2IND C;  2LFI A;  3EGR A;  2NBW B;  2WU2 B;  3V60 A;  4IKG A;  4B95 A;  4AWJ A;  3WAL A;  2KOX A;  4LNF A;  2HTM E;  1QT9 A;  1N5X A;  3BY4 B;  2MP2 B;  3BYT B;  4FBJ B;  2L0T A;  2SAK A;  2FUG 1;  1KF6 B;  3DBR B;  2LZ6 A;  4DWF A;  1QF6 A;  2ZJD A;  4W9F A;  1YOV B;  1XEE A;  3I5J C;  3VTU A;  3AE5 B;  3SFD B;  1WRD B;  1D3Z A;  1BML C;  1UWM A;  1AWD A;  1YJI A;  3UGB B;  5JZE B;  2W54 A;  5DPT A;  2NTS A;  1IYF A;  3ZW3 A;  2EMT A;  1M94 A;  4ZOH C;  1DOX A;  2KJH B;  1UBQ A;  5D3I B;  4W9D A;  1OQR A;  3HM6 X;  3RFZ B;  1E10 A;  1MPE A;  2N7J A;  5KHQ A;  1YX5 B;  2KNB A;  3ZJU A;  1NYQ A;  2BS4 B;  2KWD A;  3NJT A;  2WDV B;  4ZRQ A;  5C3J B;  2L83 A;  3W9C B;  2QMT A;  3U4E G;  2MBE A;  4EUT A;  3PRE A;  4I6L B;  5G5G A;  1WH3 A;  2KJ6 A;  1ZW7 A;  3O13 A;  2DYB A;  4YSX B;  1ISN A;  1N5W A;  2FE8 A;  3P1M A;  4B0M A;  1VZ7 A;  5TR5 A;  4C80 A;  2ZW1 A;  1L4Z B;  4EZJ A;  2WXG A;  1IP9 A;  3N9Y C;  3ZNI D;  2IPK D;  4C00 A;  4GB9 A;  2KFK A;  1HXY D;  4OVV A;  5C2T B;  1WI0 A;  4KVG B;  2WS3 B;  1E9M A;  1J8C A;  1SEB D;  2N1W A;  1ESF A;  2WXP A;  1NVI D;  2K8H A;  5LXI B;  5CHF A;  1RFK A;  4FN2 A;  2FAZ A;  5JH5 C;  2KYW A;  4AUQ C;  3UQB A;  3AE7 B;  3OLM D;  3BVZ A;  1SXT A;  1T6B X;  1WX8 A;  2R2Q A;  3I63 C;  3VDZ A;  2CKH B;  3TL5 A;  3MHZ A;  3KYC D;  3E9S A;  2KLC A;  2LHE A;  3PV1 A;  3N1Y C;  5HKH A;  1OEY A;  1V49 A;  4J3O D;  2XN9 C;  1UEL A;  1K53 A;  2KX0 A;  2LGS A;  4B9K A;  1IUE A;  2WX0 A;  1KLG D;  4A3P A;  2UWQ A;  3NS8 A;  1ET9 A;  1IGD A;  1LQB A;  2DZI A;  2L00 B;  1I4Q A;  1FCL A;  1SE4 A;  2KDI A;  2GBM A;  1ZGU B;  2DBY A;  2IO3 B;  4EEW A;  3Q3F A;  3L08 A;  4KKJ A;  1PGX A;  3C0R B;  2KQ7 A;  2PEA A;  1YJ1 A;  5FKA C;  1V1O A;  3WAO A;  1KLU D;  4HRS A;  1FRR A;  2FIF A;  2RR9 A;  4DHJ B;  5DPR A;  4E71 A;  4G11 A;  4WWO A;  4PT5 A;  1QKZ A;  3ZDM C;  1B9R A;  3TEZ A;  4W9L A;  1JAL A;  3GE8 C;  1FEH A;  4C7Z A;  2FCM A;  4RNA A;  1WF9 A;  2GLS A;  4BKG A;  3DOW A;  4AP4 C;  2L05 A;  1R4N B;  5L83 A;  3BK2 A;  4WWM A;  2KN5 A;  2HJ1 A;  4ZDV A;  3VUY A;  2REX A;  4N58 A;  1KH0 A;  3VUX A;  3ML8 A;  3IBE A;  4WQM A;  2N1V A;  4FJZ A;  2W3S A;  3TSS A;  1WX7 A;  1CQV A;  2Q5W D;  3PO0 A;  2PMV A;  1P98 A;  2G4D B;  4NPN A;  3V61 A;  3ZYY X;  2D2Q A;  5G2N A;  1UGM A;  4ANV A;  1WGK A;  2SEB D;  1Q1O A;  2PLP A;  3KUD B;  3M3J A;  1G6J A;  1WIA A;  1FFV A;  3W1S C;  2KFK B;  2I2Y A;  3ZRF A;  3N30 A;  1FPY A;  1T0Y A;  5AZG A;  4KV2 A;  3ZTC A;  2EKE C;  1WWT A;  1K50 A;  2BYT A;  4M0W A;  3T9L A;  4HEA 1;  3VR9 B;  1FXA A;  1Q0W B;  2OJR A;  2V4I B;  4CYE A;  1WXA A;  1RRB A;  3ALB A;  1UH6 A;  2GBK A;  3EHV A;  1GNU A;  1V8C A;  2K6D B;  4I6P A;  2KDM A;  1EM7 A;  3B9J A;  1ZDX A;  1HA5 A;  2NBU A;  4LLG M;  1EWC A;  1WMH A;  3B08 A;  3I9V 1;  4GLS C;  3ZJT A;  1MJD A;  3NRZ A;  1MVK A;  1D5M C;  3AEE B;  3DBS A;  4RM8 A;  3UIO B;  4AOF A;  4GGQ A;  2MW5 A;  3W1S A;  2MLB A;  3SFE B;  2Z0E B;  2D3A A;  5HG2 A;  2AX5 A;  2WDR B;  3ZNH B;  1T0R C;  3AV8 A;  2DX5 B;  2Y3A A;  3VRB B;  3Q2A C;  4XYC A;  3R66 C;  2KKC A;  2JSV X;  3ZVV A;  3AH7 A;  3BII D;  1E5W A;  3PHX B;  2WXR A;  4J6I A;  3L4P A;  3SD5 A;  2V0G A;  3JYU A;  1TKG A;  3DVN U;  3VHT C;  1NEK B;  3C8Y A;  2LMC A;  2CU3 A;  1TY2 A;  2LJI A;  5G5H A;  1SSN A;  2GBR A;  3HM3 A;  3DVN V;  3HUI A;  2MRP A;  1Y8R C;  1XXG A;  3CIR B;  1IBX A;  4USA A;  3Q3O C;  1GG3 A;  4A3O A;  2IO2 B;  3RUI B;  3MP9 A;  2JY6 A;  2DAF A;  4IM3 A;  4NNJ B;  3FIL B;  2QEJ C;  4WQO B;  1JRO A;  1VLB A;  2LVO A;  1Q10 A;  4LTU A;  1V6E A;  4IM2 A;  2MSE D;  2H88 B;  2BQQ A;  4RCO A;  4KDL B;  3IT6 B;  3DCG A;  1Z5S B;  2LXA A;  2PVO D;  3QC8 B;  2C9W B;  2ZCC A;  3PVL A;  2IGG A;  4D2K A;  1YIW A;  4F8C B;  4K7S A;  3L17 A;  3R7R A;  5IOI A;  3U7D A;  5CHW A;  1OEY J;  2GRI A;  1TTN A;  1P9D U;  1T0S C;  1TS3 A;  5J18 A;  2K8B A;  3DBL B;  5LXH A;  1ACC A;  5D6J B;  2KD0 A;  2J0J A;  2A4Z A;  1F2R C;  1OQY A;  4ARI A;  1TS5 A;  1JWM D;  3AEA B;  3KUZ A;  3VRA B;  2PE9 A;  1E8W A;  4TUU A;  5D2M B;  3P4Q B;  4US8 A;  4WJN A;  3QAR A;  1GC7 A;  3NZU A;  3PHW B;  2JZP A;  1SJE D;  2INP E;  1ZOY B;  2ASQ A;  3APC A;  5AUI A;  1GOZ A;  2M17 A;  1VZ6 A;  2WXI A;  5FR3 A;  3AE1 B;  4WJQ A;  3ENE A;  4P7I A;  4XC2 A;  1I4X A;  3IXS A;  4P1B C;  2KAN A;  1KTK A;  2WDQ B;  3LDZ E;  4IM0 A;  1D6E C;  3FAH A;  1UNS A;  4HPP A;  3SR6 A;  3LB8 C;  4MJS A;  4IC7 B;  2RDH A;  4ZRP A;  4BBN F;  1WGY A;  5BYQ A;  4YTN B;  2JWZ A;  4K81 A;  2W3R A;  5BYS A;  2PPH A;  2WXO A;  3VXW A;  2NTT A;  1L6U A;  4GSW A;  2JXT A;  3AU4 A;  3MC0 B;  2LVQ A;  3MC8 A;  5I4D A;  2J53 A;  5LNK 1;  2BWF A;  1IBX B;  2GMI C;  4TV3 A;  1PGA A;  1XLQ A;  2K3U A;  1WJN A;  5E6P A;  1YN3 A;  2J4X A;  2K1F A;  3NS1 A;  2VZK D;  2MHJ A;  2L52 A;  2YLM A;  4YL8 A;  1WXM A;  3A33 B;  1F52 A;  2KMA A;  4W9E A;  1SBB B;  1KOT A;  3P4R B;  2WXK A;  3ZJV A;  2ZPY A;  1LXD A;  2LHD A;  4ZYS A;  3A4S C;  3N3K B;  4TMA B;  3M62 B;  1GUA B;  3MJ5 A;  4OVZ A;  2DEN B;  1PFD A;  1C79 A;  2JXX A;  3W5V B;  4BOS C;  3JW0 X;  3UIP B;  1SE3 A;  3DBH I;  1YJJ A;  3MJW A;  4M8M A;  4ANW A;  3A4R A;  4JX1 C;  1N62 A;  1ZPS A;  1EU4 A;  2G3Q B;  1T5X D;  2KAC A;  2RPV A;  4LNK A;  4P16 A;  2ZEQ A;  4EKU A;  1V81 A;  1WYW B;  2KWU B;  2FCQ A;  1PUT A;  2JZZ A;  1FMA D;  5AUK A;  3RD2 A;  2CJN A;  4DDG D;  1E7U A;  3PRZ A;  3P2B A;  1QOG A;  1QZE A;  1E8X A;  3DWG C;  4GN1 A;  2LAS A;  4ASW C;  3VUW A;  4M00 A;  3HVD A;  3NG0 A;  3Q8F A;  4BAX A;  1HTO A;  2G4S A;  1EUV B;  2DWQ A;  1I4H A;  2MA9 B;  2HTH A;  3LXF A;  2WLB A;  2EMS A;  4EE2 A;  4HVB A;  4YSY B;  1UWX A;  2K25 A;  1WM3 A;  3Q3M C;  4GIV A;  2BWE S;  3X23 A;  1AW7 A;  2Z59 B;  3ZUN A;  3KWV A;  3U7Z A;  4MJS B;  1JWB D;  2C7N B;  2Y5C A;  4TQ1 A;  2J7Q B;  1JWS D;  3VAW A;  5E6N A;  4EZL A;  2MJD A;  1CMX B;  1I7H A;  2W55 A;  3AE8 B;  1MI0 A;  3RNF C;  1LGR A;  3KUC B;  2BGF A;  3JSV B;  1MG4 A;  3N1Z C;  4A6Q A;  1QIL A;  3QCA A;  2NVU I;  5C23 A;  4LDT D;  4XGA B;  2UYZ B;  3DPD A;  3IFW B;  1NBF C;  2BKF A;  1F77 A;  1BXT A;  1STE A;  1SF0 A;  2WYQ A;  3N32 A;  5C1Z A;  1VDV A;  3DBR I;  4MDK E;  4YWG G;  2GI9 A;  4M02 A;  2DHZ A;  3PZ7 A;  4ANU A;  1PYW D;  1L0Y B;  4JWU C;  2LWP A;  3NVW A;  4GDL A;  4RF1 A;  3R8B A;  1P3Q U;  2BF8 B;  3HRD D;  4W9J A;  2JRH A;  2IBI B;  4FLH A;  1VJK A;  4YTP B;  3PRM B;  2PTL A;  3M95 A;  2KVZ A;  4EOY A;  2ZZP B;  5MPO A;  4B6W A;  3UF8 A;  2UU7 A;  3PRP B;  1NEN B;  2G45 B;  2V4L A;  2XNA C;  1EF5 A;  2V1Y A;  5IAA C;  1V5T A;  1TKE A;  4G50 A;  4OZA A;  3AED B;  2WWZ A;  3AUL A;  1FRD A;  2AL6 A;  2HDE A;  3AN1 A;  3U52 E;  1J0G A;  3NZ3 A;  1B1Z A;  5D7G A;  4LNI A;  2KFJ A;  2Y5P A;  1VZ8 A;  1Y56 A;  3W5U B;  5LLI A;  1C4C A;  4YXD B;  1C4A A; 
#chains in the Genus database with same CATH homology
 2EKE C;  4W9H A;  4NJ7 A;  2JUO A;  2KXJ A;  3AXC A;  4ZRJ A;  3LJ3 A;  1LM8 B;  1WZ0 A;  3T9L A;  1BT0 A;  3R7Q A;  4FHJ A;  1MG8 A;  5AZH A;  1Q0W B;  2OJR A;  1I42 A;  4CYE A;  1WXA A;  1RRB A;  3ALB A;  1UH6 A;  2GBK A;  2JPH A;  3EHV A;  1GNU A;  4HWI B;  4IWP A;  2CS4 A;  2K6D B;  4I6P A;  2D07 B;  3PT2 B;  2C5L C;  1WY8 A;  4W9K A;  3H7S A;  3ZKJ C;  1S1Q B;  2AWT A;  1P0R A;  2NBU A;  5CTR C;  1WMH A;  4FA6 A;  4NJ6 A;  4LCD E;  2CHX A;  2I1K A;  3B08 A;  4ANX A;  3HK0 A;  3D32 A;  3V62 A;  2CHZ A;  1E8Y A;  2NPT B;  3V6E B;  3DBS A;  1I35 A;  4RM8 A;  1WE6 A;  3UIO B;  2ZNV C;  2RGF A;  3KW5 B;  1AAR A;  2Z0D B;  3L54 A;  4GGQ A;  4AOF A;  3ZNZ B;  2MW5 A;  3TBL D;  2MLB A;  3W1S A;  3QAQ A;  4GU2 A;  1TGZ B;  2Z0E B;  1XT9 B;  2IO0 B;  2ZVN A;  3NOB A;  3H7P A;  2Y5B B;  3ZIM A;  3RZF A;  4HLE A;  1WXV A;  2BYE A;  4JLC A;  4X57 B;  3ZNH B;  4IUM B;  4JGH B;  2DX5 B;  3PLV A;  3VH4 B;  1SIF A;  2M4N A;  3R66 C;  4PYU A;  2KKC A;  2LD9 A;  3KYD D;  5IA7 A;  3ZNG C;  3GOE A;  2AL3 A;  1UZX B;  1RLF A;  4MGK E;  4PS3 A;  4TKN A;  3ZVV A;  4BBN C;  1E5W A;  3VTV A;  4KDI C;  4PYZ A;  3B1L X;  3PHX B;  4J6I A;  1IPG A;  3SD5 A;  1Q5W B;  3JYU A;  1GC6 A;  2O2V B;  3DVN U;  3VHT C;  1LFD A;  2DZM A;  4XZ4 A;  4W9I A;  3WAP A;  2KTR A;  2KC1 A;  4JL9 A;  3JSV A;  4DDI D;  4DHJ D;  2GBR A;  3HM3 A;  2MBB B;  3DVN V;  2MRP A;  4EZK A;  3EC8 A;  2LGY A;  2MP2 A;  2OOB B;  1Y8R C;  3A1Q A;  4EFO A;  2IO1 B;  3U30 A;  2N9P C;  2KC2 A;  2MX2 A;  1GG3 A;  4GDL B;  4A3O A;  2IO2 B;  2N9E B;  3RUI B;  2XK5 A;  3R3M A;  2JY6 A;  2DAF A;  4IM3 A;  2DYO A;  2JVC A;  3A9J B;  4NNJ B;  4DHZ E;  2L8J A;  4WQO B;  5J2R A;  1WJ6 A;  2N9X A;  4IWO A;  1WXS A;  2KZR A;  2HJ8 A;  1WX9 A;  5KHO A;  3TMP B;  2BYF A;  4FJY A;  4G3X B;  2CHW A;  2NCN A;  4HXD A;  1TZ1 A;  2RSU A;  2LVO A;  3TJP A;  5L95 C;  5E6O A;  1V6E A;  3QJZ A;  4IM2 A;  2MSE D;  1S3S G;  3ZTD A;  4URK A;  1JRU A;  2FNJ B;  3QA8 A;  2PJH A;  3RYT A;  3AI5 A;  1E90 A;  4KDL B;  4N9F 4;  2KWC A;  4IWQ A;  3DCG A;  2O6V A;  1Z5S B;  2BKR B;  2LXA A;  3QC8 B;  3QWZ B;  3V6C B;  4K7W A;  2GBN A;  1V86 A;  4GDK B;  4JQW C;  2C9W B;  2ZCC A;  3PVL A;  4HDO A;  2LJ5 A;  4HPM B;  2JT4 B;  1YIW A;  4HPL B;  1R4N I;  4F8C B;  4K7S A;  2KMC A;  3CMM B;  3L17 A;  3R7R A;  2KWV B;  1J19 A;  1WGH A;  4CO7 A;  2DAJ A;  4ZRI A;  3U7D A;  5CHW A;  1OEY J;  4MH0 E;  1TTN A;  3VQI A;  2XBB C;  3WAN A;  2VRR B;  3ECI A;  4BKS D;  4KSK C;  1P9D U;  5J18 A;  3ML9 A;  4NAW B;  4MGZ E;  4NQL B;  2K8B A;  1GJZ A;  2LI5 A;  5LXH A;  2JRI B;  2NS5 A;  5D6J B;  2KD0 A;  5FR6 A;  2CU1 A;  2J0J A;  4FUL A;  5D94 A;  2A4Z A;  2KJR A;  5JHB A;  3GZN I;  5BO4 B;  2C60 A;  1OQY A;  3L16 A;  2L76 A;  3KUZ A;  2PE9 A;  3H6N A;  4W9G A;  5EDS A;  2LUE A;  1E8W A;  4TUU A;  5GMV A;  5D2M B;  3JVZ X;  1UD7 A;  2DZK A;  1C3T A;  4WJN A;  3A9K A;  1WJU A;  1XD3 B;  3QAR A;  1GC7 A;  5AEK B;  1E7V A;  3NZU A;  3APF A;  3PHW B;  1RFA A;  1YD8 U;  3RCZ A;  2D11 A;  4BOZ B;  1FXT B;  2GBJ A;  2W9N A;  2WDT B;  4XX5 A;  4PS8 A;  3KVF B;  2C7H A;  4I6N B;  2KDE B;  2ASQ A;  3OJ3 A;  3EFU A;  2KDB A;  3APC A;  3PZD A;  5JHA A;  3MTN B;  2M17 A;  1WE7 A;  4F7Z A;  2DZJ A;  4PS7 A;  2N7D A;  3W1Y A;  1V9J A;  3QX1 A;  4WJQ A;  3H7P B;  3ENE A;  1UBI A;  4P7I A;  4KZC A;  4XC2 A;  3HIZ A;  4G0N B;  4MSQ B;  4DBG A;  3K9P B;  2KLG A;  3L0W B;  2IY0 B;  1EO6 A;  3AU5 A;  2MBQ A;  4LJO B;  3QHT A;  2KAN A;  4HCP B;  3APD A;  3O65 B;  3T8M A;  2DYM A;  3WIM A;  3LDZ E;  4IM0 A;  1VD2 A;  3S2A A;  3QQ8 B;  4RM9 A;  1K8R B;  4WAA A;  1C1Y B;  2LXC A;  3H1U A;  4MJS A;  2B3A A;  4IC7 B;  4WWP A;  4BFR A;  4LJP B;  4BBN F;  2RPQ A;  1WGY A;  2RD0 A;  1HE8 A;  2NBW B;  3BIN A;  4HK2 A;  1WJ4 A;  2N7E A;  2JWZ A;  4MM3 A;  3V60 A;  4K81 A;  1WR1 A;  2LRW A;  4RMA A;  4B95 A;  4AWJ A;  4GMV A;  2PPH A;  4WJO A;  2AEH A;  2KOX A;  3WAL A;  1WGD A;  2KQS A;  3VXW A;  4GSW A;  4MEL A;  3BY4 B;  3AU4 A;  2MP2 B;  2HD5 B;  2LVQ A;  3A1Q B;  3RUL A;  4DXA B;  2L0T A;  4FBJ B;  4KIK A;  2BWF A;  1V80 A;  2LZ6 A;  2ZNV B;  1RAX A;  4DWF A;  2GMI C;  2ZJD A;  4W9F A;  4MGI E;  5CHV C;  4TV3 A;  2XK5 B;  2MCN B;  3B0A A;  3ZRC A;  1WJN A;  5E6P A;  2D3G A;  4LDT B;  3VFK A;  3VTU A;  5DPS A;  4E3C A;  2K1F A;  3ZDT A;  2LRU A;  4WJP A;  1V2Y A;  1WRD B;  2YVC A;  1D3Z A;  2YLM A;  4YL8 A;  1WXM A;  3NHE B;  4K7U A;  3A33 B;  3SU8 X;  1P1A A;  2KTF A;  3UGB B;  3CSF A;  2KMA A;  5JZE B;  3DQV A;  4W9E A;  5DPT A;  1IYF A;  2IZV B;  2EMT A;  3X0W A;  2QHO A;  3ZW3 A;  1M94 A;  3ZO5 B;  1KOT A;  2KO3 A;  2CR5 A;  1UBQ A;  2KJH B;  3OJ4 B;  2D10 A;  3UQA A;  2N4F A;  3RT3 B;  2ZPY A;  1LXD A;  4W9D A;  3ONS A;  4AJW A;  3HM6 X;  1L2N A;  2IY1 B;  3HHM A;  1V5O A;  2O6V B;  3A4S C;  3N3K B;  2J0K A;  2GOW A;  3M62 B;  1GUA B;  2LGD A;  5KHQ A;  1WR6 E;  1YX5 B;  1SE9 A;  2KNB A;  2DEN B;  3Q3J A;  4BOS C;  2JXX A;  1R4M I;  3V61 A;  3JW0 X;  3UIP B;  1TBE A;  3DBH I;  3CST A;  3MJW A;  4M8M A;  4ANW A;  3PS6 A;  3QK0 A;  3A4R A;  4BKT A;  2G3Q B;  2MBE A;  2NR2 A;  1F9J A;  3PRE A;  4EUT A;  4I6L B;  2MWS B;  1WH3 A;  2KJ6 A;  3DDC B;  1ZW7 A;  2ZEQ A;  4EKU A;  1V81 A;  1OTR B;  2DYB A;  1WYW B;  2KWU B;  4HDQ A;  2FCQ A;  3ZLZ A;  4DHZ B;  1ISN A;  4GOC A;  4WWN A;  4M0W B;  2JZZ A;  4GXB A;  5TR5 A;  3PPA A;  2C7M B;  1H4R A;  1NDD A;  2KK8 A;  4FJV B;  4NQK E;  4EZJ A;  3VVW B;  1IP9 A;  3RD2 A;  2PE6 B;  3ZNI D;  4DDG D;  3NY5 A;  1YX6 B;  3A9K B;  4ZRK A;  1E7U A;  2ZVO A;  3P2B A;  2KFK A;  3PRZ A;  3L10 B;  1QZE A;  4GB9 A;  2A5U A;  1E8X A;  3K9O B;  4OVV A;  5AZF A;  3DBL I;  3SDL C;  4GN1 A;  2LGX A;  4HJK A;  4ICV A;  4AJY B;  4IG7 B;  1WI0 A;  4KZ0 A;  2LAS A;  4ASW C;  4M8N A;  1WMH B;  3VUW A;  2NBV B;  4KVG B;  1J8C A;  1PQS A;  2N1W A;  1X1M A;  2G4S A;  1EUV B;  3IVF A;  4BKS A;  2K8H A;  2MA9 B;  1E8Z A;  3OAW A;  2HTH A;  5CHF A;  4FN2 A;  5LXI B;  2FAZ A;  2FID A;  2J0M A;  5JH5 C;  4FAD A;  4AUQ C;  3UQB A;  2EMS A;  4HVB A;  3DVG Y;  3VTW A;  2K25 A;  1WM3 A;  2WX1 A;  5J17 A;  3OLM D;  4GIV A;  2JF5 A;  2BWE S;  2BPS A;  1H8C A;  1WX8 A;  2R2Q A;  3DVG X;  3VDZ A;  3X23 A;  2CKH B;  2Z59 B;  3TL5 A;  3ZUN A;  2K39 A;  2KDF B;  3KYC D;  4II3 B;  4MJS B;  2KLC A;  2NPT A;  1KJT A;  2C7N B;  2R2O A;  3I3T B;  4NY0 A;  4TQ1 A;  2J7Q B;  3IG3 A;  1NI2 A;  2LVP A;  3VH3 B;  3VAW A;  3PV1 A;  5HKH A;  4JIO U;  1A5R A;  5E6N A;  4EZL A;  1ZKH A;  1OEY A;  1V49 A;  1CMX B;  3PLU A;  5DPW A;  3KUC B;  1UEL A;  2KTR B;  3TIX A;  4MGY E;  4A20 A;  2XEW A;  4F1S A;  2BGF A;  3JSV B;  2KX0 A;  3NZS A;  3SHQ A;  2K6Q A;  4B9K A;  1WZ3 A;  2HE7 A;  2WX0 A;  2MQJ A;  3QCA A;  2NVU I;  4HCN B;  2JZ3 B;  2UWQ A;  4KIK B;  5C23 A;  4A3P A;  3NS8 A;  1Z2M A;  4LDT D;  2UYZ B;  1LQB A;  2DZI A;  4BVU C;  3DPD A;  3EEC A;  4ICU A;  2K8C A;  2L00 B;  3PTF C;  2MBH A;  2KDI A;  3IFW B;  2GBM A;  1NBF C;  2BKF A;  2KX3 A;  2V3S A;  1ZGU B;  4OVU A;  3PGE A;  1EF1 A;  4E74 A;  5G55 A;  2IO3 B;  4EEW A;  3PSE B;  3Q3F A;  3L08 A;  2WYQ A;  3N32 A;  4K1R B;  5C1Z A;  4II2 B;  2O2V A;  1OGW A;  3MHS D;  4CHK A;  3U8Z A;  3L13 A;  2FCS A;  3C0R B;  1XQQ A;  2KQ7 A;  3CF6 E;  4MSM B;  2PEA A;  3DBR I;  4MDK E;  1YJ1 A;  2DHZ A;  2BYV E;  2O6V D;  4ANU A;  3WAO A;  2FIF A;  2RR9 A;  2LWP A;  4DHJ B;  5DPR A;  4E71 A;  2KVR A;  1WGG A;  1SGH A;  4GDL A;  4G11 A;  4WWO A;  1WM2 A;  3ZDM C;  1WGR A;  4ZYN A;  2I1J A;  3IHP C;  4W9L A;  1P3Q U;  3A9J A;  3WA0 A;  2BF8 B;  2FCM A;  4W9J A;  2JRH A;  1KLV A;  2IBI B;  2L7R A;  4FLH A;  4KSL C;  1WF9 A;  1U4A A;  4BKG A;  3PRM B;  3DOW A;  4AP4 C;  2L05 A;  3M95 A;  4EOY A;  5L83 A;  2ZZP B;  3RZW C;  4B6W A;  2KN5 A;  3UF8 A;  4ZDV A;  3PRP B;  3VUY A;  2L0F A;  2G45 B;  2V4L A;  4IW0 A;  2REX A;  2AYO B;  1EF5 A;  2FUH B;  2V1Y A;  3QIJ A;  2ZPN A;  3ML8 A;  5IAA C;  1V5T A;  3VUX A;  3IBE A;  2N1V A;  4FJZ A;  3KH0 A;  3WAM A;  4DK5 A;  1WX7 A;  4G50 A;  1L7Y A;  1P98 A;  5DCN A;  2G4D B;  4NPN A;  2KHW B;  2WWZ A;  3H9D A;  2FCN A;  3AUL A;  2D2Q A;  4FHK A;  1UGM A;  4GDK A;  2AL6 A;  5G2N A;  4ANV A;  1VCB A;  2L3Z A;  1Q1O A;  3KUD B;  3M3J A;  4W9C A;  1G6J A;  1J0G A;  3M63 B;  1WIA A;  5D7G A;  5CX3 A;  2M1M A;  4TQ0 A;  2IYD B;  2KFK B;  2KFJ A;  3W1S C;  2M8S A;  3ZRF A;  3N30 A;  1KM7 A;  1T0Y A;  2MBO A;  2ZCB A;  5AZG A;  1WFY A;  4NAW A;  2M0X A;  5LLI A;  3TCA A;  4KV2 A;  1YQB A;  3ZTC A;  4MEM A;  3UIN B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...