5AUKA

Crystal structure of the ga-substituted ferredoxin
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
96
structure length
96
Chain Sequence
ASYTVKLITPDGESSIECSDDTYILDAAEEAGLDLPYSCRAGACSTCAGKITAGSVDQSDQSFLDDDQIEAGYVLTCVAYPTSDCTIETHKEEDLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray Structure and Nuclear Magnetic Resonance Analysis of the Interaction Sites of the Ga-Substituted Cyanobacterial Ferredoxin
pubmed doi rcsb
source organism Synechocystis sp. (strain pcc 6803 / kazusa)
molecule tags Electron transport
molecule keywords Ferredoxin-1
total genus 23
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2015-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 5aukA00
1AYFA 1KRHA 1RM6C 2PKOA 2WU5B 2FBWB 4N59A 1FIQA 1A70A 2H88B 2N0SB 2PVOD 3AH7A 1QOAA 1XLNA 1NVID 1PUTA 4A9AA 5C2TB 3NVWA 1FXIA 1E7PB 3PO0A 3LB8C 1E9MA 3AV8A 5AUKA 3NS1A 3SFDB 4ZOHC 2BS2B 1EWYC 5EE3A 1E6EB 2W54A 2CU3A 3SFEB 3W5UB 4ZHOA 3DWGC 3AE2B 2HTME 2KMMA 2QIEB 3P4SB 1WXQA 3AE8B 1YQ3B 1JROA 1ROEA 3B2FA 3NVVA 1XLQA 3AE7B 3B9JA 1YQ4B 3HUIA 1DOIA 1QOGA 1XO3A 4US9A 1E0ZA 1PDXA 3FAHA 1JW9D 2WDQB 5EE9A 3SR6A 4C7ZA 1XLOA 3RPFC 1QLBB 1QOFA 1V97A 3AMZA 3AE4B 3KWLA 1TKGA 4WWMA 4YTNB 3WCQA 2BS3B 3NVZA 4P6VF 5H8YE 1WYGA 3FC4A 2W55A 3CWIA 1N5XA 1KF6B 2JQRB 2WS3B 2Y5CA 4JX1C 4JWSC 4LTUA 2LEKA 1OQQA 5GXGB 5H92C 4ZHPA 1RFKA 2E3TA 2WDVB 1QT9A 1JQ4A 1CZPA 2WP9B 3W5VB 1JRPA 2MJ3A 3HVZA 2EKIA 2W3RA 4YXDB 1NYRA 3AE9B 1JALA 2MJDA 3AEDB 4YTPB 3AE3B 1FXAA 1N60A 3AE5B 2PVGC 1GAQB 3P4QB 1TYGB 3LXFA 5EE1A 1RWSA 1J7AA 3ZYYX 1VLBA 1J7CA 3AB5A 4N58A 1L6UA 3AEEB 3AEBB 1FM0D 3AEGB 1L5PA 2M56B 1N62A 1L6VA 4YSYB 1VJKA 2W3SA 2K9XA 4YSXB 2WDRB 3AEAB 2K5PA 2BS4B 2PIAA 1KFYB 3AE6B 3DWMA 4US8A 2WU2B 3W9CB 3AM9A 3ABVB 1FFUA 4KX6B 2L52A 4YSZB 4USAA 1FRRA 3ETRA 5G5GA 1QOBA 2DBYA 5G5HA 1QF6A 3VRBB 5EE0A 4YTMB 3BIID 1XLPA 3VR8B 2Q5WD 2K22A 2OHFA 2KAJA 2M19A 2G1EA 1V8CA 3AN1A 4WQMA 2JX5A 3AE1B 3AECB 5C3JB 1TKEA 2WLBA 1NEKB 3AEFB 2ACZB 3NVYA 1TKYA 4HRSA 4IDIA 1OQRA 2CJOA 1J7BA 1FO4A 1NYQA 1ZP0B 1SIJA 1WGKA 1ZOYB 3CIRB 1B9RA 1NI3A 1RYJA 2WQYB 1DGJA 1WRIA 1ZUD2 1ZXIA 1FFVA 1L0VB 1YJJA 4FXCA 3VR9B 2AX5A 2MJEA 4C80A 2B76B 3P1MA 1N61A 1OFFA 1N63A 1NENB 1GPXA 2CJNA 1JWBD 2H89B 2QJLA 2DWQA 3EUB2 3HRDD 3NRZA 3P63A 1T3QA 3L4PA 2L83A 5AUIA 4ITKA 1FMAD 2MH7A 3P4PB 1IUEA 1TJEA 3B2GA 1I7HA 1AWDA 1N5WA 1YJIA 1DOYA 1FRDA 5MPOA 1CJEA 1VDVA 3VRAB 4JWUC 4HROA 1UWMA 4N6EB 1F0ZA 4C7YA 1WWTA 1DOXA 1SB3C 1PFDA 2BT6A 3P4RB 1E10A 1SF0A 4YT0B 1JWAD 1R7SA
chains in the Genus database with same CATH superfamily
2FBWB 1YMHE 1WFYA 2BGFA 2PVOD 3RNBC 4WURA 4W9KA 2N9EB 1TBEA 5D3DA 2R61A 4NNJB 3VHTC 1E6EB 2IZVB 3M62B 3X0WA 3S2AA 1XLQA 2G45B 1R4MI 4NAWA 1K53A 3RPFC 3A9JB 4OVZA 1XQQA 2ZVNA 2A4ZA 4IOIE 2DNFA 1WYWB 1WR6E 3EHVA 1EM7A 1RFKA 2E3TA 4JLCA 2JPHA 2GBRA 2K25A 2W3RA 3U2SC 3R66C 1N60A 3LXFA 1L7YA 4W9JA 2LXAA 4OVUA 1MVKA 2UWQA 1L6UA 4KV2A 1WJUA 4YSXB 1N62A 2K9XA 2WDRB 2K5PA 3HHMA 2PIAA 2IO1B 3AI5A 3RNEC 1SE3A 4OVVA 2HE7A 2JX5A 5C3JB 1RLFA 3DOWA 4XDCA 5DCNA 3NVYA 3Q3FA 1MFWA 4WWOA 2ONQA 3DBHB 1L0XB 4HLEA 2KO3A 2LGIA 1FFVA 1E7UA 3OLMD 4DHZB 1R4NB 1BMLC 3VR9B 2ZW0A 5FK9C 2B76B 1N63A 1GPXA 1WF9A 3P63A 1OTRB 3UIPB 1QQRA 3DBHI 1FMAD 1CQVA 3ZKJC 4HROA 4BVUC 3QHTA 1KLGD 1WM3A 4K1RB 1SF0A 1NBFC 1AYFA 2J7QB 1T5XD 4M02A 2KDMA 3ZXVA 3GP7A 4C4VB 4CO7A 2RSUA 5FKAC 2AYOB 3R2IA 4ZHOA 3V62A 2XNAC 1SXTA 2KN4A 1WXQA 4TKNA 3MJ5A 4ACFA 1TS4A 2KC2A 4DHJB 2FAZA 1WMHB 2LJIA 5CHWA 4MGIE 3N9YC 3P2BA 3VTVA 5CTRC 2WXMA 1L4ZB 3FC4A 1UGJA 1OQQA 2WDVB 3UQBA 5T8IA 2DX5B 2C60A 4MDKE 3AE9B 1TS3A 4K81A 1YX5B 1UBQA 2L1AA 3SU8X 4URKA 1UD7A 2WU2B 1D5MC 1YN5A 3D32A 3BY4B 2KYWA 3Q69A 4FLHA 1I4RA 1VR9A 2LXCA 2K39A 2M19A 3H1UA 2FCQA 3ZUNA 4GGQA 1TKYA 2BYVE 2CJOA 3T9LA 2NS5A 4IM3A 1L0VB 2O6VB 4M00A 2ZEQA 4OZBA 1C4AA 3U7DA 3ZVVA 1I35A 2KX0A 1V1OA 4OHJA 4JPSA 3VVWB 4BKSD 1E7VA 4ANUA 3PPAA 2J53A 2OOBB 3VUYA 3RNCC 2R2QA 2I2YA 3PRMB 2WXHA 4GMVA 4YT0B 2INCC 2LWPA 1TT5B 2JU6X 3L10B 4LNIA 2NPTB 3EC8A 4KGRA 4GB9A 4EZKA 3P4SB 3PT2B 5IA7A 1TIFA 2WXLA 5JHBA 4IC7B 1G6JA 1GJZA 1ZPSA 1D6EC 4NJ6A 2MW5A 1MHHE 3E56A 2GB1A 4J3OD 3CWIA 4KKIA 1WXAA 2JZZA 3VTUA 4TUUA 4MJSB 1WJ4A 3N1ZC 3W5VB 4FJYA 3VTWA 4DXFA 5E6NA 1UNSA 3RYTA 1J7CA 2MBBB 3V61A 4ZRIA 1AW7A 3AEAB 3QARA 3AE6B 4I6PA 1GB1A 3ZNID 4AUQC 1QOBA 2MEKA 2K6QA 2OHFA 2G1EA 3GS2A 3AECB 2NBVB 4IDIA 3VUXA 4NAWB 4HRSA 1EU3A 2YEPF 3IXSA 3KUDB 2AEHA 1S1QB 4W9FA 4FBJB 4K7UA 4DDID 2AX5A 1Q1OA 1B1ZA 2D3GA 4W9LA 4W9GA 1T3QA 4LJOB 2RD0A 2W82A 3P4PB 3JW0X 2L7RA 3Q14C 1WX8A 1PQSA 1WX9A 1GB4A 1OQYA 1YQBA 1C9FA 4DXGA 4AS1A 1R4NI 3HK0A 3I63C 2WU5B 2LUMA 3DQVA 3RFZB 1QOAA 4XE0A 1FXIA 2NTSA 3IHPC 3SFDB 4OW0A 4A3OA 1GC6A 5HKHA 3KYDD 3OAWA 5CX3A 2NVUI 1WJ6A 4C7ZA 3IAS1 2IY1B 3K9PB 5BYQA 3ZTCA 4ARCA 4YTNB 1CMXB 2IJ0A 4MELA 4WWNA 3Q3MC 2DYBA 3APCA 1V1PB 3BVGA 2NBUA 2K8BA 1JRPA 2MJ3A 3OWEB 3ONSA 1FXAA 2PVGC 1RRBA 2LRWA 1T6BX 3ZNZB 3B08A 4W9EA 1VLBA 5IOIA 4TMAB 1L5PA 1C78A 4MGKE 3X23A 4LK0M 3L16A 1E8XA 3RD2A 1FRRA 1HZ6A 3PS6A 5BO4B 1FCCC 1WZ0A 3HIZA 1L2NA 1YJ1A 1C1YB 1TKEA 1XT9B 1HTOA 3EA6A 4REZA 2K0PA 4LJPB 1J7BA 1MJDA 1ZP0B 1HEZE 1NI3A 5LLIA 4XC2A 1EF5A 2MJEA 3MFGA 1XCQL 2HD5B 2WHIA 2PW9A 3EFCA 4RM8A 3TSSA 2KJ6A 2WXIA 4F7ZA 1H8CA 2KLGA 3T3OA 1XXGA 4P1BC 4HVBA 2KJHB 1AWDA 1WJNA 1V80A 3ZXRA 1SB3C 2K8HA 2WGSA 5BYSA 2H88B 1IGCA 3Q6BA 1WXVA 1QZEA 1PUTA 4K3CA 4NAMA 3PO0A 2XK5B 3K9OB 4GDKB 2XK5A 3L0WB 4IW0A 3ZTDA 1XCTL 2N7JA 2M1MA 4UDUC 1SJHD 2AL6A 2KFKB 4WQOB 5IP4D 4US9A 4L23A 1WX7A 2X38A 2VZKB 4LNFA 1JW9D 1UELA 4LDTD 3APFA 3NZSA 1ZDVA 2R2OA 3DBRI 2KACA 3QQ8B 2JVCA 2Y5CA 5G55A 4S0RA 4ZHPA 5D94A 3QJZA 4BKSA 2MRPA 4AQ7A 4YXDB 2MBEA 3GE8C 2J42A 3WANA 2FE8A 5EE1A 4GOCA 3RMKC 3R2TA 1HZ5A 1JMLA 1WM2A 3AEGB 3PLVA 4I6NB 2G9HD 4ANXA 1E90A 2JZPA 1KFYB 4HCPB 2DENB 2N4FA 5AZGA 4WH4A 2C5LC 3R7QA 4GLSC 5BMGA 4I6LB 1XLPA 1JCKB 4N9F4 2KQ4X 4W9IA 4WQMA 4NY0A 2ACZB 3CSFA 2FCSA 4W9HA 2KVZA 4FULA 4P7IA 3RZFA 3TEZA 2QHOA 2OJRA 1DGJA 1ZKHA 4FXCA 1K50A 4KZ0A 3VFKA 4MH8A 5J17A 3ZNHB 4IG7B 4KKJA 3PVLA 1WSPA 4MACA 1Q5WB 5AUIA 3APDA 1RFAA 4EZLA 3IFWB 1EF1A 5LXHA 2M17A 1WWTA 3O65B 2BT6A 3BVZA 1C79A 1V81A 3ZW3A 2QDFA 5C2TB 4PS8A 2AQ3B 2RMMA 3W5UB 1JWUD 3AE2B 3DWGC 2KMMA 4HPMB 3AU5A 3W1SA 3HUIA 3U7ZA 1HXYD 2BF8B 1FNVA 4KIKB 1WH3A 2WDQB 3I3TB 3N20C 2GBKA 4EE2A 4DHZE 4XZ4A 4HPLB 1N5XA 1KF6B 2WS3B 4J6IA 5D2MB 2JZ3B 2ZPYA 1Y56A 2KMCA 2KHWB 1V5TA 2J52A 3KUCB 2EMTA 3AEDB 1FNUA 3JVZX 2RPQA 2N1WA 2GRIA 4RMAA 4N58A 5L95C 1IBXB 4ZRPA 2DAJA 1C4PA 4A55A 4B0MA 3ABVB 3WAMA 2MA9B 4YSZB 1WE6A 2VRRB 5EE0A 4YTMB 1SE4A 4BZAA 3DBRB 2BWFA 2O2VA 4ANVA 4IKGA 1WGHA 4XWTA 2Z0EB 4PYZA 2J4XA 3WALA 2DHZA 1SEBD 1T0RC 3CIRB 2O2VB 1V9JA 1ZXIA 2ZCCA 1UUPA 2C7MB 3IBEA 1N61A 3RNFC 1VD2A 4GXBA 1JWBD 3EUB2 2DWQA 4ICVA 4RCOA 1EO6A 1LXDA 1TJEA 2KWVB 4JWUC 2IY0B 1BXTA 4MT5A 4KIKA 2C7NB 1XD3B 4AOFA 1PFDA 1QF6A 1JWSD 2V3SA 1KRHA 4A6QA 3EFUA 1OEYJ 3ZO5B 3TEWA 1EWYC 2W54A 3SHQA 3ZQ4A 3R7RA 2DYMA 3QX1A 2Y5PA 3NVVA 3B2FA 3NZ3A 5C1ZA 5GMVA 2NBWB 2Y5BB 1XO3A 3B0AA 2V4IB 3QIJA 4FN2A 3AMZA 4AJYB 2BBCA 2ZJDA 1F77A 5H8YE 1YN4A 3KUZA 4KVGB 4ZDVA 3V05A 1TTNA 4B95A 5TSSA 4TQ1A 3RNGC 1WGDA 3TUOA 5IN7A 3HVZA 4NQLB 1QILA 2MP2B 2A5UA 1D4BA 4NJCA 4G0NB 4HEA1 4PT5A 2WXOA 2GLSA 1FM0D 4YSYB 1A5RA 3N32A 2ICIA 2DZMA 2LVQA 1FFUA 3SEBA 2INPE 4P1CC 4EFOA 3VR8B 2CKHB 3JYUA 2N7DA 2MP2A 3AXCA 4HJGE 4Q2JA 4M8MA 1J19A 1OQRA 2CR5A 1VRAB 2K3UA 2ON8A 4M0WA 3BK1A 1WRIA 2LGXA 4C00A 2REXA 3J9CA 3Q8CA 3KWVA 1GUAB 3HRDD 4WAFA 4A3PA 3MC8A 1QKZA 1ZDXA 4HDOA 4A8XC 4AJWA 1TGZB 1C4CA 5DPRA 4N6EB 5KHOA 2KTFA 3AEFB 3KQ4A 3UGBB 1JWMD 3AH7A 4IWOA 2EMSA 1WE7A 1XLNA 3ML8A 4A9AA 2MBOA 3NVWA 5AUKA 4D2KA 3ALBA 1KLUD 4DDGD 3AU4A 2KNBA 2QIEB 2MBQA 1K51A 2V1YA 1SE9A 1QOGA 4A90A 1IP9A 2BKFA 3UF8A 3AE4B 4RM9A 3MP9A 1FEHA 4LTUA 4X57B 2LEKA 3PGEA 3ZJTA 1S3SG 3N30A 4II2B 4DXAB 2HJ1A 2PLPA 1CZPA 2DZKA 3I9V1 5E6OA 4HKQA 3CF6E 1NYRA 2N9XA 3HM3A 1BUIC 4S17A 2RDGA 3RCZA 4E3CA 3H6NA 2QSDA 4FA6A 3PHXB 3Q2AC 3VAWA 3UQAA 1V2YA 2VZKD 2M0AA 5G5GA 4LDTB 4KDLB 5G5HA 1YIWA 2FIDA 4WJOA 4GDLB 1V8CA 3V6CB 3NOBA 4LNNA 4ZRQA 2C9WB 4RFBA 1F2RC 3GZNI 4M0WB 2PEAA 1FO4A 4GN1A 1V6EA 3BYYB 1L0YB 2XBBC 4H2AA 3URYA 2IGHA 2BYEA 4ITKA 2ZCBA 2KDFB 1N5WA 3Q3OC 3TEYA 3H7SA 1I4HA 1YD8U 1AN8A 3BYTB 3A9JA 2LGYA 2FUHB 2PE9A 4FHKA 1NVID 4ASWC 2IYDB 1ET9A 2IDYA 3AV8A 3DBSA 3A1QA 4LNKA 5EE3A 4EEWA 3N3KB 4BKGA 1HA5A 4F1SA 2K6DB 4HK2A 4TV3A 2MWSB 5D6JB 1V5OA 2AQ1B 3KVFB 5EE9A 1XLOA 3WAOA 1TKGA 2RR9A 3NUHB 4JWSC 2GBJA 2GOWA 5GXGB 2ZNVC 2BKRB 3HM6X 2IBIB 3H9DA 2M8SA 4MH0E 2I1KA 4OZCA 1E8WA 3P4QB 3MHZA 1J7AA 3V60A 2LASA 3AEBB 2M56B 2KVRA 2BS4B 2ZPNA 2G4SA 3ETRA 4XX5A 2V3PA 1SE2A 2PJHA 4C56C 5IAAC 1Z5SB 1C77A 2AWTA 5TR5A 2KT7A 2O6VD 1YJJA 4NQKE 4PK1A 2CJNA 2IO3B 3W1YA 3LDZE 4HPPA 4KSKC 4IWQA 4FJZA 1ENFA 2MH7A 2JRHA 2G4DB 2WXGA 1D5XC 1DOYA 3PSEB 4DHJD 1EWCA 3C19A 1JWAD 3MC0B 1R7SA 4JGHB 1I4QA 1RM6C 4N59A 2ASQA 2KN5A 2W9NA 1A70A 2WXJA 1GOZA 4DBGA 1E9MA 2D2QA 3NS1A 4G11A 1PGXA 2NPTA 3A33B 3SFEB 3L17A 2HTME 2D5GA 3A4SC 1YQ4B 3RULA 3FAHA 5AZFA 2WWZA 5BMIA 2BYTA 4TSSA 4WWMA 3WCQA 2G3QB 3E9SA 1I42A 4GIVA 3FKYA 1JRUA 4JX1C 4GDLA 4EKUA 5DPTA 4XWWA 2D10A 5L83A 3CSTA 1WXSA 2MJDA 2BTEA 5C23A 2LFIA 2M4NA 3PZ8A 2WXQA 1TZOA 4NZLB 1LFDA 4EOYA 1T0SC 1FPYA 3DHHC 1P3QU 4KZCA 3H7PB 2QCZA 2X8XX 1HE8A 2WXNA 4WAAA 1P9DU 3TMPB 4DK5A 1LO5D 3JSVA 1WGKA 1R4MB 3PTFC 1B9RA 1MPEA 1RYJA 1I4XA 1TY0A 3DCGA 3DVGY 1PGBA 1T0QC 2LRUA 1NENB 1FD6A 1KH0A 1I4GA 2KFJA 2MQJA 2GBMA 2KLCA 3NG0A 4MJSA 1IUEA 1J0GA 2JUOA 3KW5B 4HXDA 2WXPA 5MPOA 2HJ8A 4BOZB 2LVOA 1F0ZA 5JHAA 1SGHA 2NCNA 3EECA 1DYQA 4W9CA 1ESFA 2PKOA 2I1JA 1E5WA 2JYEA 4WWPA 2WXFA 4EUTA 2KC1A 1P0RA 2BS2B 1KJTA 4R3DA 1F9JA 3ECIA 4DWFA 2KWCA 1E0ZA 4JIOU 1PDXA 4IM2A 1L4DB 2CU1A 4MEMA 2D3CA 4K7SA 4JL9A 1P98A 4P6VF 3U4EG 1UWXA 1QT9A 2D11A 2WXRA 4HKZE 2QMTA 3A9KB 2MBHA 4YTPB 1OGWA 1WZ3A 2JRIB 2UYZB 3AB5A 2L32A 4XGAB 5BYRA 2ZZPB 4AP4C 3NY5A 3N1YC 3HVDA 3TIXA 3BIID 3V6EB 2KAJA 3AN1A 4HJKA 1E8ZA 2RPVA 1NEKB 2IO2B 2MLBA 2VH2A 2IGDA 2LI5A 2ZW1A 2GI9A 1XEEA 4K7WA 2IGGA 4JQWC 1UZXB 1OFFA 3DDCB 4WJQA 4IWPA 1VCBA 2L83A 5BMHA 4TQ0A 3FILA 1EUVB 2V0GA 2LUEA 4MSMB 4QAYA 3VRAB 2LGDA 2QILA 4ZYSA 3PHWB 2BW2A 1E10A 4CHKA 4JE3B 1FCLA 2J0JA 1HQRD 2KDEB 2B3AA 2QEJC 3H8HA 4BBNF 4BBNC 4ZYNA 4FHJA 1X1MA 4G3XB 3RI7C 2MSED 1GC7A 3B9JA 2LVPA 5D7GA 4MGZE 2SEBD 1XF5L 4B0EA 3A1QB 1QOFA 2L76A 3BVMA 1K8RB 2RDHA 5AZHA 3VQIA 2L00B 3ZLZA 2JXTA 1U4AA 1ZGUB 2W55A 2JQRB 2YLMA 3ZJVA 2L8JA 1AARA 4NJ7A 5H92C 1YNTE 3L13A 3IVFA 1KOTA 3T8MA 3W1SC 3NS8A 2INDC 2UU7A 1E8YA 2NTTA 5LXIB 3ZRCA 2D07B 2FIFA 2WX0A 3RUIB 1L6VA 3VH4B 3DHIC 4US8A 1M94A 1MI0A 1Z2MA 4KX6B 4RF1A 2RDBC 2DBYA 4ZRKA 1SIFA 5HG2A 5D3IB 1Q0WB 1WY8A 2JY6A 3BZDB 2KK8A 4CYEA 1F52A 4PS7A 2LD9A 5EDSA 1ZOYB 1ZW7A 3PZ7A 3PZDA 1ZUD2 3CMMB 3VH3B 2YVCA 1J8CA 4C80A 4RGTA 4ARIA 2JSVX 4LNOA 3QK0A 2L0TA 1V86A 4WIPA 3B2GA 2KWDA 1I7HA 2LMCA 4BOSC 1FRDA 2SAKA 4NPNA 2Z59B 4G50A 2LGSA 1N6ZA 4PS3A 1MG8A 3DVNV 2ZVOA 1Q10A 2QC8A 1WI0A 2CU3A 2KWUB 2YEPB 3PREA 3U8ZA 1JROA 2C7HA 2KFKA 3GE3C 3TEXA 3ZNGC 2JT4B 1NI2A 2KKCA 3GOEA 3O13A 4KSLC 3UIOB 3EGRA 1YOVB 3NJTA 2NR2A 2KTRA 2DLBA 1SSNA 2FUG1 4ANWA 2M0XA 4MM3B 3OG5A 3TCAA 3DBLB 4RGNA 1JALA 2INNE 3AULA 3KYCD 4KGTA 2N7EA 2WDTB 3PRPB 3WIMA 1ZE3D 4XYCA 2KX3A 2KJRA 1IBXA 2XEWA 2RGFA 4W9DA 4L2YA 2PE6B 3W9CB 1YX6B 1WGYA 3Q8AA 4FJVB 2LJ5A 2Q5WD 3LJ3A 3TL5A 3ENEA 2K1FA 2D3BA 2XN9C 1WGRA 1IYFA 2WX1A 1Y8RC 1SIJA 2JWUA 3NHEB 3ZDTA 2EKEC 3RN9C 2AL3A 4MGYE 4CQNA 5E6JA 2DZIA 2QJLA 1LGRA 2DZJA 3QAQA 2LZ6A 3RNAC 4MM3A 2WNMA 1ZXHA 3KH0A 2KQ7A 3MHSD 1WMHA 2J0KA 4C4VA 3B1LX 1UWMA 3OJ3A 4M01A 2KDBA 3BINA 3QWZB 1DOXA 1C76A 3VDZA 1ACCA 5IKCM 2K8CA 3TJPA 4II3B 3OJ4B 1NDDA 1TS5A 4EZJA 2KQSA 5CHFA 1SJED 3AE8B 2Z8LA 1ROEA 3ZRFA 5JH5C 5CHVC 1TZ1A 1WRDB 3TBLD 2KANA 3DVNU 4L1BA 5FR6A 2WYQA 2HDEA 2IPKD 3Q3NC 3L54A 2JYTA 3LYYA 4XDDA 1SBBB 3QC8B 3FILB 2KMAA 2V4LA 3M63B 5FR3A 2DAFA 2FNJB 5IO9A 4FADA 3RT3B 1TS2A 2BYFA 2MHJA 3MTNB 1WIAA 3V3XA 5HI1A 2BQQA 1FXTB 1D5ZC 2AQ2B 3AE5B 3AE3B 5AEKB 1ET6A 3JSVB 2N9PC 2OJWA 4E71A 2NMQA 1PGAA 3VUWA 2JF5A 2ZNVB 2W3SA 2CHZA 2KDIA 1MHXA 4BFRA 2Y3AA 2CHWA 4YWGG 3VRBB 4GU2A 2GBNA 2K22A 5LNK1 3QA8A 2V9HA 3R8BA 3A4RA 3Q8BA 1I4PA 1KM7A 3DHGC 2CHXA 2WLBA 5DPWA 1GNUA 1UBIA 1STEA 1NYQA 5JZEB 4E74A 2WQYB 2JWZA 4RH6A 4ZRJA 3L08A 4WJPA 3IT4B 2WXKA 3L4PA 2L05A 3MJWA 4IM0A 4KGSA 1YN3A 1UF0A 3DVGX 3KLSX 2PTLA 1CJEA 1KTKA 4YL8A 1RAXA 4HDQA 1KLVA 4ICUA 1LQBA 2MCNB 1JQ4A 4HWIB 2D3AA 2LHDA 3A9KA 1FIQA 3LB8C 2LHEA 2N1VA 4RGOS 3C0RB 1UH6A 3U52E 4B6WA 1YQ3B 1CK1A 2TSSA 3AE7B 2PMVA 1UGMA 3ZGZA 4F8CB 2BVCA 1QLBB 1V97A 1BT0A 5JXVA 1T0YA 3ML9A 2E6XA 3KWLA 3W2DA 5DPSA 2BS3B 4B9KA 3M95A 2O6VA 1LM8B 3Q8FA 3MC9A 4PYUA 4GDKA 5I4DA 3M3JA 2EELA 3UINB 4GSWA 1F2RI 1TY2A 2KOXA 1GAQB 1M4VA 1WGGA 1GG3A 1V49A 3PLUA 4O1NA 3QCAA 3AEEB 4RGMA 2FCNA 1WXMA 1VZ7A 3I57A 3R3MA 3AM9A 2BPSA 4USAA 5E6PA 1P1AA 1P7EA 3IAM1 4WJNA 3AE1B 3H7PA 3I5JC 3WAPA 4RNAA 2V3NA 1F1HA 5HFYA 1ISNA 4MSQB 3PV1A 3IT6B 2DYOA 1IPGA 3C8YA 4K3BA 2H89B 1PYWD 3NRZA 1IGDA 3P42A 2FCMA 3ZJUA 2KXJA 1VDVA 3NZUA 1K52A 2Z0DB 3SDLC 3DBLI 2N9LA 4P16A 2J0MA 2N0SB 1HTQA 5HHDG 2BB5A 2BB6A 1E7PB 1MG4A 4ZOHC 4HCNB 4IUMB 2JXXA 2BWES 1DOIA 2I38A 5G2NA 3SR6A 5J18A 3WA0A 4OZAA 2KZRA 3NVZA 2GMIC 1WYGA 2L3ZA 4M8NA 3RZWC 3T3NA 2PPHA 3ZDMC 2WP9B 4BKTA 2EKIA 3DPDA 3SD5A 1TYGB 1RWSA 4LCDE 1WR1A 1C3TA 3BK2A 3ZYYX 4LLGM 1FNWA 2MX2A 2L0FA 1V1PA 1VJKA 3IG3A 1EU4A 3DWMA 3ZIMA 4BAXA 4A20A 2L52A 3Q3JA 2N9KA 3GB1A 4AWJA 3BWUD 3PRZA 3UI3A 3GZNB 2OEDA 1D3ZA 1H4RA 1P7FA 3N1XC 4RF0A 3P1MA 3U30A 3VXWA 2HTHA 4DQOC 4KDIC 2KD0A 2CS4A 1YJIA 2KTRB 2VH1A 5J2RA 3Q8EA 4C7YA 2IO0B 1VZ6A 5KHQA 1OEYA 1VZ8A 3P4RB
chains in the Genus database with same CATH topology
2FBWB 1YMHE 5BYSA 2H88B 1IGCA 2PVOD 1NVID 1PUTA 4WURA 4NAMA 1ET9A 2IDYA 3PO0A 3AV8A 5D3DA 2R61A 1Q10A 4GDKB 5EE3A 1E6EB 1XCTL 2CU3A 2YEPB 2N7JA 1HA5A 4UDUC 1SJHD 1JROA 1XLQA 4US9A 4L23A 3TEXA 2X38A 2VZKB 1K53A 1JW9D 5EE9A 2AQ1B 1XLOA 3RPFC 4OVZA 3O13A 1ZDVA 4IOIE 1TKGA 3EGRA 2KACA 3NUHB 2Y5CA 2DLBA 1SSNA 4JWSC 2FUG1 5GXGB 4ZHPA 1EM7A 1RFKA 2E3TA 4MM3B 4AQ7A 2W3RA 4YXDB 4OZCA 4RGNA 3U2SC 1JALA 2J42A 1N60A 2FE8A 3P4QB 3LXFA 5EE1A 2INNE 4KGTA 3MHZA 1J7AA 1MVKA 3R2TA 1ZE3D 1HZ5A 1L6UA 1JMLA 3AEBB 3AEGB 1IBXA 2M56B 4YSXB 1N62A 2G9HD 2K9XA 2WDRB 2K5PA 2BS4B 2JZPA 2PIAA 1KFYB 4L2YA 3W9CB 4WH4A 3ETRA 1SE3A 2V3PA 3Q8AA 4GLSC 5BMGA 1SE2A 1XLPA 2Q5WD 1JCKB 2KQ4X 4WQMA 4C56C 2JX5A 5C3JB 4XDCA 3NVYA 2ACZB 1C77A 2XN9C 2ONQA 3TEZA 1L0XB 1SIJA 2JWUA 1DGJA 2LGIA 1FFVA 4CQNA 1YJJA 5E6JA 1BMLC 1K50A 2ZW0A 4FXCA 4MH8A 5FK9C 3VR9B 2B76B 1N63A 1GPXA 2CJNA 2QJLA 4KKJA 3P63A 1WSPA 1QQRA 4MACA 2WNMA 5AUIA 1FMAD 1ZXHA 1ENFA 2MH7A 2WXGA 1D5XC 1DOYA 1CQVA 1EWCA 4HROA 1UWMA 1KLGD 1WWTA 1DOXA 1C76A 2BT6A 3BVZA 1SF0A 1ACCA 1JWAD 1C79A 1R7SA 1AYFA 3MC0B 1I4QA 1RM6C 4N59A 1T5XD 1A70A 2KDMA 2WXJA 1GOZA 3GP7A 5C2TB 1TS5A 1E9MA 5FKAC 3NS1A 2AQ3B 1PGXA 3R2IA 4ZHOA 3SFEB 2RMMA 3W5UB 2XNAC 1JWUD 3AE2B 3DWGC 2HTME 2KMMA 1SXTA 2D5GA 2KN4A 1SJED 1WXQA 3AE8B 3W1SA 2Z8LA 1ROEA 3MJ5A 1TS4A 3HUIA 1YQ4B 3U7ZA 1HXYD 4L1BA 1FNVA 2HDEA 2LJIA 2WDQB 3FAHA 2IPKD 4EE2A 5BMIA 2BYTA 4TSSA 3N9YC 2JYTA 3LYYA 4WWMA 4XDDA 3WCQA 1SBBB 3FILB 5FR3A 3E9SA 2WXMA 1L4ZB 3FC4A 1N5XA 1KF6B 2WS3B 4JX1C 1UGJA 1TS2A 1OQQA 2WDVB 1Y56A 3V3XA 4XWWA 5T8IA 5HI1A 2J52A 3AE9B 2MJDA 3AEDB 1FNUA 1D5ZC 2AQ2B 3AE5B 3AE3B 1ET6A 2GRIA 2BTEA 1TS3A 2LFIA 4N58A 1IBXB 3PZ8A 2NMQA 1PGAA 4ZRPA 2WXQA 2L1AA 2W3SA 1TZOA 4NZLB 1C4PA 1MHXA 2WU2B 4B0MA 4A55A 1D5MC 1YN5A 3ABVB 4YSZB 3Q69A 2Y3AA 4YWGG 3VRBB 5EE0A 4YTMB 1I4RA 1SE4A 1VR9A 2WXNA 2K22A 5LNK1 2M19A 3R8BA 3Q8BA 1I4PA 2WLBA 4IKGA 1TKYA 2CJOA 4XWTA 1LO5D 1STEA 2J4XA 1NYQA 1WGKA 1B9RA 3CIRB 1SEBD 1MPEA 1RYJA 1I4XA 1TY0A 1ZXIA 2WQYB 1UUPA 1L0VB 4OZBA 1C4AA 1PGBA 1N61A 4RH6A 1NENB 1FD6A 1KH0A 1JWBD 3EUB2 2DWQA 1I4GA 3IT4B 4RCOA 2WXKA 3L4PA 1V1OA 4OHJA 4JPSA 1IUEA 4KGSA 1YN3A 1TJEA 2WXPA 3KLSX 2PTLA 1CJEA 5MPOA 1KTKA 2J53A 4JWUC 2I2YA 1BXTA 1F0ZA 4MT5A 2WXHA 1PFDA 1QF6A 1JWSD 1JQ4A 4YT0B 1DYQA 1ESFA 1KRHA 2LHDA 2PKOA 1FIQA 4A6QA 2JU6X 2JYEA 2WXFA 3LB8C 2LHEA 4RGOS 3TEWA 4KGRA 2BS2B 1EWYC 2W54A 4R3DA 3U52E 3ZQ4A 3P4SB 2DYMA 1YQ3B 2Y5PA 3B2FA 1CK1A 3NVVA 3NZ3A 2WXLA 2TSSA 3AE7B 2PMVA 1XO3A 1E0ZA 3ZGZA 1PDXA 1ZPSA 1D6EC 2V4IB 1L4DB 1QLBB 1V97A 1MHHE 3AMZA 5JXVA 3E56A 2BBCA 2E6XA 3KWLA 3W2DA 2BS3B 4P6VF 1F77A 5H8YE 2GB1A 4J3OD 1YN4A 3CWIA 3U4EG 3V05A 3Q8FA 4KKIA 1UWXA 5TSSA 5I4DA 4TQ1A 1QT9A 3TUOA 2EELA 3W5VB 2WXRA 3HVZA 4HKZE 1F2RI 1TY2A 2QMTA 4YTPB 1QILA 4DXFA 1GAQB 1D4BA 1M4VA 1UNSA 4NJCA 4HEA1 1J7CA 4PT5A 3AB5A 2L32A 4O1NA 2WXOA 3AEEB 1FM0D 4YSYB 5BYRA 4RGMA 1AW7A 3AEAB 1VZ7A 3AE6B 3I57A 2ICIA 1GB1A 3AM9A 1FFUA 3SEBA 4USAA 2INPE 1QOBA 3HVDA 2MEKA 1P7EA 3BIID 3IAM1 3VR8B 2OHFA 2KAJA 3AN1A 2G1EA 3GS2A 3AE1B 3AECB 4HJGE 2RPVA 4Q2JA 1NEKB 4IDIA 4HRSA 4NAWB 1EU3A 2IGDA 2YEPF 1OQRA 3IXSA 4RNAA 1VRAB 2K3UA 2V3NA 2ON8A 4M0WA 2ZW1A 2GI9A 3BK1A 1XEEA 5HFYA 1WRIA 3IT6B 2DYOA 3J9CA 2AX5A 3Q8CA 2IGGA 3C8YA 1OFFA 3KWVA 2H89B 3HRDD 1PYWD 1B1ZA 3NRZA 1T3QA 4WAFA 1IGDA 2L83A 1QKZA 3P42A 5BMHA 2W82A 4TQ0A 1ZDXA 3P4PB 3FILA 4A8XC 2V0GA 3ZJUA 1C4CA 1VDVA 3VRAB 1GB4A 2QILA 4ZYSA 1C9FA 4N6EB 1K52A 4DXGA 4AS1A 2BW2A 1E10A 3AEFB 3KQ4A 2N9LA 4JE3B 2WU5B 1JWMD 4P16A 2LUMA 1FCLA 2N0SB 3AH7A 3RFZB 1HQRD 1QOAA 5HHDG 1XLNA 2BB5A 2BB6A 2QEJC 4XE0A 4A9AA 3H8HA 3NVWA 1FXIA 1E7PB 5AUKA 2NTSA 3SFDB 4ZOHC 4D2KA 1KLUD 4OW0A 2QIEB 1K51A 3B9JA 1DOIA 1QOGA 2I38A 5D7GA 4A90A 2SEBD 1XF5L 4B0EA 3SR6A 3IAS1 4C7ZA 1QOFA 5BYQA 3BVMA 2RDHA 3AE4B 3VQIA 4ARCA 3MP9A 4YTNB 4OZAA 1FEHA 3NVZA 1WYGA 2IJ0A 2JXTA 2W55A 2JQRB 4LTUA 3ZJVA 2LEKA 3T3NA 3ZJTA 5H92C 2PLPA 1CZPA 1V1PB 2WP9B 3BVGA 3I9V1 1JRPA 1YNTE 2MJ3A 2EKIA 4HKQA 1NYRA 3OWEB 1FXAA 2PVGC 1BUIC 1T6BX 1TYGB 1RWSA 2RDGA 3BK2A 3ZYYX 1VLBA 2NTTA 4LLGM 1FNWA 4TMAB 2QSDA 1L5PA 1V1PA 1L6VA 1VJKA 1EU4A 1C78A 3DWMA 4US8A 4LK0M 1MI0A 2VZKD 2M0AA 2L52A 4KX6B 4RF1A 1FRRA 1HZ6A 5G5GA 2DBYA 5G5HA 5HG2A 1FCCC 2N9KA 5D3IB 3GB1A 4GDLB 1V8CA 3BWUD 3UI3A 4ZRQA 1TKEA 3BZDB 4RFBA 1F2RC 2OEDA 3EA6A 4REZA 2K0PA 1J7BA 1FO4A 1ZP0B 1P7FA 1ZOYB 3PZ7A 1HEZE 1NI3A 1ZUD2 3BYYB 4RF0A 4C80A 2MJEA 3MFGA 1XCQL 3P1MA 4RGTA 4ARIA 2JSVX 2PW9A 1L0YB 4H2AA 3URYA 3TSSA 2IGHA 2WXIA 4DQOC 4ITKA 4WIPA 3T3OA 1XXGA 3B2GA 2KWDA 1I7HA 1AWDA 1N5WA 1YJIA 2LMCA 1FRDA 2SAKA 3TEYA 1I4HA 3Q8EA 4C7YA 1VZ6A 1AN8A 1VZ8A 1SB3C 3P4RB 3BYTB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AYF A;  1KRH A;  1RM6 C;  2PKO A;  2WU5 B;  2FBW B;  4N59 A;  1FIQ A;  1A70 A;  2H88 B;  2N0S B;  2PVO D;  3AH7 A;  1QOA A;  1XLN A;  1NVI D;  1PUT A;  4A9A A;  5C2T B;  3NVW A;  1FXI A;  1E7P B;  3PO0 A;  3LB8 C;  1E9M A;  3AV8 A;  5AUK A;  3NS1 A;  3SFD B;  4ZOH C;  2BS2 B;  1EWY C;  5EE3 A;  1E6E B;  2W54 A;  2CU3 A;  3SFE B;  3W5U B;  4ZHO A;  3DWG C;  3AE2 B;  2HTM E;  2KMM A;  2QIE B;  3P4S B;  1WXQ A;  3AE8 B;  1YQ3 B;  1JRO A;  1ROE A;  3B2F A;  3NVV A;  1XLQ A;  3AE7 B;  3B9J A;  1YQ4 B;  3HUI A;  1DOI A;  1QOG A;  1XO3 A;  4US9 A;  1E0Z A;  1PDX A;  3FAH A;  1JW9 D;  2WDQ B;  5EE9 A;  3SR6 A;  4C7Z A;  1XLO A;  3RPF C;  1QLB B;  1QOF A;  1V97 A;  3AMZ A;  3AE4 B;  3KWL A;  1TKG A;  4WWM A;  4YTN B;  3WCQ A;  2BS3 B;  3NVZ A;  4P6V F;  5H8Y E;  1WYG A;  3FC4 A;  2W55 A;  3CWI A;  1N5X A;  1KF6 B;  2JQR B;  2WS3 B;  2Y5C A;  4JX1 C;  4JWS C;  4LTU A;  2LEK A;  1OQQ A;  5GXG B;  5H92 C;  4ZHP A;  1RFK A;  2E3T A;  2WDV B;  1QT9 A;  1JQ4 A;  1CZP A;  2WP9 B;  3W5V B;  1JRP A;  2MJ3 A;  3HVZ A;  2EKI A;  2W3R A;  4YXD B;  1NYR A;  3AE9 B;  1JAL A;  2MJD A;  3AED B;  4YTP B;  3AE3 B;  1FXA A;  1N60 A;  3AE5 B;  2PVG C;  1GAQ B;  3P4Q B;  1TYG B;  3LXF A;  5EE1 A;  1RWS A;  1J7A A;  3ZYY X;  1VLB A;  1J7C A;  3AB5 A;  4N58 A;  1L6U A;  3AEE B;  3AEB B;  1FM0 D;  3AEG B;  1L5P A;  2M56 B;  1N62 A;  1L6V A;  4YSY B;  1VJK A;  2W3S A;  2K9X A;  4YSX B;  2WDR B;  3AEA B;  2K5P A;  2BS4 B;  2PIA A;  1KFY B;  3AE6 B;  3DWM A;  4US8 A;  2WU2 B;  3W9C B;  3AM9 A;  3ABV B;  1FFU A;  4KX6 B;  2L52 A;  4YSZ B;  4USA A;  1FRR A;  3ETR A;  5G5G A;  1QOB A;  2DBY A;  5G5H A;  1QF6 A;  3VRB B;  5EE0 A;  4YTM B;  3BII D;  1XLP A;  3VR8 B;  2Q5W D;  2K22 A;  2OHF A;  2KAJ A;  2M19 A;  2G1E A;  1V8C A;  3AN1 A;  4WQM A;  2JX5 A;  3AE1 B;  3AEC B;  5C3J B;  1TKE A;  2WLB A;  1NEK B;  3AEF B;  2ACZ B;  3NVY A;  1TKY A;  4HRS A;  4IDI A;  1OQR A;  2CJO A;  1J7B A;  1FO4 A;  1NYQ A;  1ZP0 B;  1SIJ A;  1WGK A;  1ZOY B;  3CIR B;  1B9R A;  1NI3 A;  1RYJ A;  2WQY B;  1DGJ A;  1WRI A;  1ZUD 2;  1ZXI A;  1FFV A;  1L0V B;  1YJJ A;  4FXC A;  3VR9 B;  2AX5 A;  2MJE A;  4C80 A;  2B76 B;  3P1M A;  1N61 A;  1OFF A;  1N63 A;  1NEN B;  1GPX A;  2CJN A;  1JWB D;  2H89 B;  2QJL A;  2DWQ A;  3EUB 2;  3HRD D;  3NRZ A;  3P63 A;  1T3Q A;  3L4P A;  2L83 A;  5AUI A;  4ITK A;  1FMA D;  2MH7 A;  3P4P B;  1IUE A;  1TJE A;  3B2G A;  1I7H A;  1AWD A;  1N5W A;  1YJI A;  1DOY A;  1FRD A;  5MPO A;  1CJE A;  1VDV A;  3VRA B;  4JWU C;  4HRO A;  1UWM A;  4N6E B;  1F0Z A;  4C7Y A;  1WWT A;  1DOX A;  1SB3 C;  1PFD A;  2BT6 A;  3P4R B;  1E10 A;  1SF0 A;  4YT0 B;  1JWA D;  1R7S A; 
#chains in the Genus database with same CATH topology
 2FBW B;  1YMH E;  1WFY A;  2BGF A;  2PVO D;  3RNB C;  4WUR A;  4W9K A;  2N9E B;  1TBE A;  5D3D A;  2R61 A;  4NNJ B;  3VHT C;  1E6E B;  2IZV B;  3M62 B;  3X0W A;  3S2A A;  1XLQ A;  2G45 B;  1R4M I;  4NAW A;  1K53 A;  3RPF C;  3A9J B;  4OVZ A;  1XQQ A;  2ZVN A;  2A4Z A;  4IOI E;  2DNF A;  1WYW B;  1WR6 E;  3EHV A;  1EM7 A;  1RFK A;  2E3T A;  4JLC A;  2JPH A;  2GBR A;  2K25 A;  2W3R A;  3U2S C;  3R66 C;  1N60 A;  3LXF A;  1L7Y A;  4W9J A;  2LXA A;  4OVU A;  1MVK A;  2UWQ A;  1L6U A;  4KV2 A;  1WJU A;  4YSX B;  1N62 A;  2K9X A;  2WDR B;  2K5P A;  3HHM A;  2PIA A;  2IO1 B;  3AI5 A;  3RNE C;  1SE3 A;  4OVV A;  2HE7 A;  2JX5 A;  5C3J B;  1RLF A;  3DOW A;  4XDC A;  5DCN A;  3NVY A;  3Q3F A;  1MFW A;  4WWO A;  2ONQ A;  3DBH B;  1L0X B;  4HLE A;  2KO3 A;  2LGI A;  1FFV A;  1E7U A;  3OLM D;  4DHZ B;  1R4N B;  1BML C;  3VR9 B;  2ZW0 A;  5FK9 C;  2B76 B;  1N63 A;  1GPX A;  1WF9 A;  3P63 A;  1OTR B;  3UIP B;  1QQR A;  3DBH I;  1FMA D;  1CQV A;  3ZKJ C;  4HRO A;  4BVU C;  3QHT A;  1KLG D;  1WM3 A;  4K1R B;  1SF0 A;  1NBF C;  1AYF A;  2J7Q B;  1T5X D;  4M02 A;  2KDM A;  3ZXV A;  3GP7 A;  4C4V B;  4CO7 A;  2RSU A;  5FKA C;  2AYO B;  3R2I A;  4ZHO A;  3V62 A;  2XNA C;  1SXT A;  2KN4 A;  1WXQ A;  4TKN A;  3MJ5 A;  4ACF A;  1TS4 A;  2KC2 A;  4DHJ B;  2FAZ A;  1WMH B;  2LJI A;  5CHW A;  4MGI E;  3N9Y C;  3P2B A;  3VTV A;  5CTR C;  2WXM A;  1L4Z B;  3FC4 A;  1UGJ A;  1OQQ A;  2WDV B;  3UQB A;  5T8I A;  2DX5 B;  2C60 A;  4MDK E;  3AE9 B;  1TS3 A;  4K81 A;  1YX5 B;  1UBQ A;  2L1A A;  3SU8 X;  4URK A;  1UD7 A;  2WU2 B;  1D5M C;  1YN5 A;  3D32 A;  3BY4 B;  2KYW A;  3Q69 A;  4FLH A;  1I4R A;  1VR9 A;  2LXC A;  2K39 A;  2M19 A;  3H1U A;  2FCQ A;  3ZUN A;  4GGQ A;  1TKY A;  2BYV E;  2CJO A;  3T9L A;  2NS5 A;  4IM3 A;  1L0V B;  2O6V B;  4M00 A;  2ZEQ A;  4OZB A;  1C4A A;  3U7D A;  3ZVV A;  1I35 A;  2KX0 A;  1V1O A;  4OHJ A;  4JPS A;  3VVW B;  4BKS D;  1E7V A;  4ANU A;  3PPA A;  2J53 A;  2OOB B;  3VUY A;  3RNC C;  2R2Q A;  2I2Y A;  3PRM B;  2WXH A;  4GMV A;  4YT0 B;  2INC C;  2LWP A;  1TT5 B;  2JU6 X;  3L10 B;  4LNI A;  2NPT B;  3EC8 A;  4KGR A;  4GB9 A;  4EZK A;  3P4S B;  3PT2 B;  5IA7 A;  1TIF A;  2WXL A;  5JHB A;  4IC7 B;  1G6J A;  1GJZ A;  1ZPS A;  1D6E C;  4NJ6 A;  2MW5 A;  1MHH E;  3E56 A;  2GB1 A;  4J3O D;  3CWI A;  4KKI A;  1WXA A;  2JZZ A;  3VTU A;  4TUU A;  4MJS B;  1WJ4 A;  3N1Z C;  3W5V B;  4FJY A;  3VTW A;  4DXF A;  5E6N A;  1UNS A;  3RYT A;  1J7C A;  2MBB B;  3V61 A;  4ZRI A;  1AW7 A;  3AEA B;  3QAR A;  3AE6 B;  4I6P A;  1GB1 A;  3ZNI D;  4AUQ C;  1QOB A;  2MEK A;  2K6Q A;  2OHF A;  2G1E A;  3GS2 A;  3AEC B;  2NBV B;  4IDI A;  3VUX A;  4NAW B;  4HRS A;  1EU3 A;  2YEP F;  3IXS A;  3KUD B;  2AEH A;  1S1Q B;  4W9F A;  4FBJ B;  4K7U A;  4DDI D;  2AX5 A;  1Q1O A;  1B1Z A;  2D3G A;  4W9L A;  4W9G A;  1T3Q A;  4LJO B;  2RD0 A;  2W82 A;  3P4P B;  3JW0 X;  2L7R A;  3Q14 C;  1WX8 A;  1PQS A;  1WX9 A;  1GB4 A;  1OQY A;  1YQB A;  1C9F A;  4DXG A;  4AS1 A;  1R4N I;  3HK0 A;  3I63 C;  2WU5 B;  2LUM A;  3DQV A;  3RFZ B;  1QOA A;  4XE0 A;  1FXI A;  2NTS A;  3IHP C;  3SFD B;  4OW0 A;  4A3O A;  1GC6 A;  5HKH A;  3KYD D;  3OAW A;  5CX3 A;  2NVU I;  1WJ6 A;  4C7Z A;  3IAS 1;  2IY1 B;  3K9P B;  5BYQ A;  3ZTC A;  4ARC A;  4YTN B;  1CMX B;  2IJ0 A;  4MEL A;  4WWN A;  3Q3M C;  2DYB A;  3APC A;  1V1P B;  3BVG A;  2NBU A;  2K8B A;  1JRP A;  2MJ3 A;  3OWE B;  3ONS A;  1FXA A;  2PVG C;  1RRB A;  2LRW A;  1T6B X;  3ZNZ B;  3B08 A;  4W9E A;  1VLB A;  5IOI A;  4TMA B;  1L5P A;  1C78 A;  4MGK E;  3X23 A;  4LK0 M;  3L16 A;  1E8X A;  3RD2 A;  1FRR A;  1HZ6 A;  3PS6 A;  5BO4 B;  1FCC C;  1WZ0 A;  3HIZ A;  1L2N A;  1YJ1 A;  1C1Y B;  1TKE A;  1XT9 B;  1HTO A;  3EA6 A;  4REZ A;  2K0P A;  4LJP B;  1J7B A;  1MJD A;  1ZP0 B;  1HEZ E;  1NI3 A;  5LLI A;  4XC2 A;  1EF5 A;  2MJE A;  3MFG A;  1XCQ L;  2HD5 B;  2WHI A;  2PW9 A;  3EFC A;  4RM8 A;  3TSS A;  2KJ6 A;  2WXI A;  4F7Z A;  1H8C A;  2KLG A;  3T3O A;  1XXG A;  4P1B C;  4HVB A;  2KJH B;  1AWD A;  1WJN A;  1V80 A;  3ZXR A;  1SB3 C;  2K8H A;  2WGS A;  5BYS A;  2H88 B;  1IGC A;  3Q6B A;  1WXV A;  1QZE A;  1PUT A;  4K3C A;  4NAM A;  3PO0 A;  2XK5 B;  3K9O B;  4GDK B;  2XK5 A;  3L0W B;  4IW0 A;  3ZTD A;  1XCT L;  2N7J A;  2M1M A;  4UDU C;  1SJH D;  2AL6 A;  2KFK B;  4WQO B;  5IP4 D;  4US9 A;  4L23 A;  1WX7 A;  2X38 A;  2VZK B;  4LNF A;  1JW9 D;  1UEL A;  4LDT D;  3APF A;  3NZS A;  1ZDV A;  2R2O A;  3DBR I;  2KAC A;  3QQ8 B;  2JVC A;  2Y5C A;  5G55 A;  4S0R A;  4ZHP A;  5D94 A;  3QJZ A;  4BKS A;  2MRP A;  4AQ7 A;  4YXD B;  2MBE A;  3GE8 C;  2J42 A;  3WAN A;  2FE8 A;  5EE1 A;  4GOC A;  3RMK C;  3R2T A;  1HZ5 A;  1JML A;  1WM2 A;  3AEG B;  3PLV A;  4I6N B;  2G9H D;  4ANX A;  1E90 A;  2JZP A;  1KFY B;  4HCP B;  2DEN B;  2N4F A;  5AZG A;  4WH4 A;  2C5L C;  3R7Q A;  4GLS C;  5BMG A;  4I6L B;  1XLP A;  1JCK B;  4N9F 4;  2KQ4 X;  4W9I A;  4WQM A;  4NY0 A;  2ACZ B;  3CSF A;  2FCS A;  4W9H A;  2KVZ A;  4FUL A;  4P7I A;  3RZF A;  3TEZ A;  2QHO A;  2OJR A;  1DGJ A;  1ZKH A;  4FXC A;  1K50 A;  4KZ0 A;  3VFK A;  4MH8 A;  5J17 A;  3ZNH B;  4IG7 B;  4KKJ A;  3PVL A;  1WSP A;  4MAC A;  1Q5W B;  5AUI A;  3APD A;  1RFA A;  4EZL A;  3IFW B;  1EF1 A;  5LXH A;  2M17 A;  1WWT A;  3O65 B;  2BT6 A;  3BVZ A;  1C79 A;  1V81 A;  3ZW3 A;  2QDF A;  5C2T B;  4PS8 A;  2AQ3 B;  2RMM A;  3W5U B;  1JWU D;  3AE2 B;  3DWG C;  2KMM A;  4HPM B;  3AU5 A;  3W1S A;  3HUI A;  3U7Z A;  1HXY D;  2BF8 B;  1FNV A;  4KIK B;  1WH3 A;  2WDQ B;  3I3T B;  3N20 C;  2GBK A;  4EE2 A;  4DHZ E;  4XZ4 A;  4HPL B;  1N5X A;  1KF6 B;  2WS3 B;  4J6I A;  5D2M B;  2JZ3 B;  2ZPY A;  1Y56 A;  2KMC A;  2KHW B;  1V5T A;  2J52 A;  3KUC B;  2EMT A;  3AED B;  1FNU A;  3JVZ X;  2RPQ A;  2N1W A;  2GRI A;  4RMA A;  4N58 A;  5L95 C;  1IBX B;  4ZRP A;  2DAJ A;  1C4P A;  4A55 A;  4B0M A;  3ABV B;  3WAM A;  2MA9 B;  4YSZ B;  1WE6 A;  2VRR B;  5EE0 A;  4YTM B;  1SE4 A;  4BZA A;  3DBR B;  2BWF A;  2O2V A;  4ANV A;  4IKG A;  1WGH A;  4XWT A;  2Z0E B;  4PYZ A;  2J4X A;  3WAL A;  2DHZ A;  1SEB D;  1T0R C;  3CIR B;  2O2V B;  1V9J A;  1ZXI A;  2ZCC A;  1UUP A;  2C7M B;  3IBE A;  1N61 A;  3RNF C;  1VD2 A;  4GXB A;  1JWB D;  3EUB 2;  2DWQ A;  4ICV A;  4RCO A;  1EO6 A;  1LXD A;  1TJE A;  2KWV B;  4JWU C;  2IY0 B;  1BXT A;  4MT5 A;  4KIK A;  2C7N B;  1XD3 B;  4AOF A;  1PFD A;  1QF6 A;  1JWS D;  2V3S A;  1KRH A;  4A6Q A;  3EFU A;  1OEY J;  3ZO5 B;  3TEW A;  1EWY C;  2W54 A;  3SHQ A;  3ZQ4 A;  3R7R A;  2DYM A;  3QX1 A;  2Y5P A;  3NVV A;  3B2F A;  3NZ3 A;  5C1Z A;  5GMV A;  2NBW B;  2Y5B B;  1XO3 A;  3B0A A;  2V4I B;  3QIJ A;  4FN2 A;  3AMZ A;  4AJY B;  2BBC A;  2ZJD A;  1F77 A;  5H8Y E;  1YN4 A;  3KUZ A;  4KVG B;  4ZDV A;  3V05 A;  1TTN A;  4B95 A;  5TSS A;  4TQ1 A;  3RNG C;  1WGD A;  3TUO A;  5IN7 A;  3HVZ A;  4NQL B;  1QIL A;  2MP2 B;  2A5U A;  1D4B A;  4NJC A;  4G0N B;  4HEA 1;  4PT5 A;  2WXO A;  2GLS A;  1FM0 D;  4YSY B;  1A5R A;  3N32 A;  2ICI A;  2DZM A;  2LVQ A;  1FFU A;  3SEB A;  2INP E;  4P1C C;  4EFO A;  3VR8 B;  2CKH B;  3JYU A;  2N7D A;  2MP2 A;  3AXC A;  4HJG E;  4Q2J A;  4M8M A;  1J19 A;  1OQR A;  2CR5 A;  1VRA B;  2K3U A;  2ON8 A;  4M0W A;  3BK1 A;  1WRI A;  2LGX A;  4C00 A;  2REX A;  3J9C A;  3Q8C A;  3KWV A;  1GUA B;  3HRD D;  4WAF A;  4A3P A;  3MC8 A;  1QKZ A;  1ZDX A;  4HDO A;  4A8X C;  4AJW A;  1TGZ B;  1C4C A;  5DPR A;  4N6E B;  5KHO A;  2KTF A;  3AEF B;  3KQ4 A;  3UGB B;  1JWM D;  3AH7 A;  4IWO A;  2EMS A;  1WE7 A;  1XLN A;  3ML8 A;  4A9A A;  2MBO A;  3NVW A;  5AUK A;  4D2K A;  3ALB A;  1KLU D;  4DDG D;  3AU4 A;  2KNB A;  2QIE B;  2MBQ A;  1K51 A;  2V1Y A;  1SE9 A;  1QOG A;  4A90 A;  1IP9 A;  2BKF A;  3UF8 A;  3AE4 B;  4RM9 A;  3MP9 A;  1FEH A;  4LTU A;  4X57 B;  2LEK A;  3PGE A;  3ZJT A;  1S3S G;  3N30 A;  4II2 B;  4DXA B;  2HJ1 A;  2PLP A;  1CZP A;  2DZK A;  3I9V 1;  5E6O A;  4HKQ A;  3CF6 E;  1NYR A;  2N9X A;  3HM3 A;  1BUI C;  4S17 A;  2RDG A;  3RCZ A;  4E3C A;  3H6N A;  2QSD A;  4FA6 A;  3PHX B;  3Q2A C;  3VAW A;  3UQA A;  1V2Y A;  2VZK D;  2M0A A;  5G5G A;  4LDT B;  4KDL B;  5G5H A;  1YIW A;  2FID A;  4WJO A;  4GDL B;  1V8C A;  3V6C B;  3NOB A;  4LNN A;  4ZRQ A;  2C9W B;  4RFB A;  1F2R C;  3GZN I;  4M0W B;  2PEA A;  1FO4 A;  4GN1 A;  1V6E A;  3BYY B;  1L0Y B;  2XBB C;  4H2A A;  3URY A;  2IGH A;  2BYE A;  4ITK A;  2ZCB A;  2KDF B;  1N5W A;  3Q3O C;  3TEY A;  3H7S A;  1I4H A;  1YD8 U;  1AN8 A;  3BYT B;  3A9J A;  2LGY A;  2FUH B;  2PE9 A;  4FHK A;  1NVI D;  4ASW C;  2IYD B;  1ET9 A;  2IDY A;  3AV8 A;  3DBS A;  3A1Q A;  4LNK A;  5EE3 A;  4EEW A;  3N3K B;  4BKG A;  1HA5 A;  4F1S A;  2K6D B;  4HK2 A;  4TV3 A;  2MWS B;  5D6J B;  1V5O A;  2AQ1 B;  3KVF B;  5EE9 A;  1XLO A;  3WAO A;  1TKG A;  2RR9 A;  3NUH B;  4JWS C;  2GBJ A;  2GOW A;  5GXG B;  2ZNV C;  2BKR B;  3HM6 X;  2IBI B;  3H9D A;  2M8S A;  4MH0 E;  2I1K A;  4OZC A;  1E8W A;  3P4Q B;  3MHZ A;  1J7A A;  3V60 A;  2LAS A;  3AEB B;  2M56 B;  2KVR A;  2BS4 B;  2ZPN A;  2G4S A;  3ETR A;  4XX5 A;  2V3P A;  1SE2 A;  2PJH A;  4C56 C;  5IAA C;  1Z5S B;  1C77 A;  2AWT A;  5TR5 A;  2KT7 A;  2O6V D;  1YJJ A;  4NQK E;  4PK1 A;  2CJN A;  2IO3 B;  3W1Y A;  3LDZ E;  4HPP A;  4KSK C;  4IWQ A;  4FJZ A;  1ENF A;  2MH7 A;  2JRH A;  2G4D B;  2WXG A;  1D5X C;  1DOY A;  3PSE B;  4DHJ D;  1EWC A;  3C19 A;  1JWA D;  3MC0 B;  1R7S A;  4JGH B;  1I4Q A;  1RM6 C;  4N59 A;  2ASQ A;  2KN5 A;  2W9N A;  1A70 A;  2WXJ A;  1GOZ A;  4DBG A;  1E9M A;  2D2Q A;  3NS1 A;  4G11 A;  1PGX A;  2NPT A;  3A33 B;  3SFE B;  3L17 A;  2HTM E;  2D5G A;  3A4S C;  1YQ4 B;  3RUL A;  3FAH A;  5AZF A;  2WWZ A;  5BMI A;  2BYT A;  4TSS A;  4WWM A;  3WCQ A;  2G3Q B;  3E9S A;  1I42 A;  4GIV A;  3FKY A;  1JRU A;  4JX1 C;  4GDL A;  4EKU A;  5DPT A;  4XWW A;  2D10 A;  5L83 A;  3CST A;  1WXS A;  2MJD A;  2BTE A;  5C23 A;  2LFI A;  2M4N A;  3PZ8 A;  2WXQ A;  1TZO A;  4NZL B;  1LFD A;  4EOY A;  1T0S C;  1FPY A;  3DHH C;  1P3Q U;  4KZC A;  3H7P B;  2QCZ A;  2X8X X;  1HE8 A;  2WXN A;  4WAA A;  1P9D U;  3TMP B;  4DK5 A;  1LO5 D;  3JSV A;  1WGK A;  1R4M B;  3PTF C;  1B9R A;  1MPE A;  1RYJ A;  1I4X A;  1TY0 A;  3DCG A;  3DVG Y;  1PGB A;  1T0Q C;  2LRU A;  1NEN B;  1FD6 A;  1KH0 A;  1I4G A;  2KFJ A;  2MQJ A;  2GBM A;  2KLC A;  3NG0 A;  4MJS A;  1IUE A;  1J0G A;  2JUO A;  3KW5 B;  4HXD A;  2WXP A;  5MPO A;  2HJ8 A;  4BOZ B;  2LVO A;  1F0Z A;  5JHA A;  1SGH A;  2NCN A;  3EEC A;  1DYQ A;  4W9C A;  1ESF A;  2PKO A;  2I1J A;  1E5W A;  2JYE A;  4WWP A;  2WXF A;  4EUT A;  2KC1 A;  1P0R A;  2BS2 B;  1KJT A;  4R3D A;  1F9J A;  3ECI A;  4DWF A;  2KWC A;  1E0Z A;  4JIO U;  1PDX A;  4IM2 A;  1L4D B;  2CU1 A;  4MEM A;  2D3C A;  4K7S A;  4JL9 A;  1P98 A;  4P6V F;  3U4E G;  1UWX A;  1QT9 A;  2D11 A;  2WXR A;  4HKZ E;  2QMT A;  3A9K B;  2MBH A;  4YTP B;  1OGW A;  1WZ3 A;  2JRI B;  2UYZ B;  3AB5 A;  2L32 A;  4XGA B;  5BYR A;  2ZZP B;  4AP4 C;  3NY5 A;  3N1Y C;  3HVD A;  3TIX A;  3BII D;  3V6E B;  2KAJ A;  3AN1 A;  4HJK A;  1E8Z A;  2RPV A;  1NEK B;  2IO2 B;  2MLB A;  2VH2 A;  2IGD A;  2LI5 A;  2ZW1 A;  2GI9 A;  1XEE A;  4K7W A;  2IGG A;  4JQW C;  1UZX B;  1OFF A;  3DDC B;  4WJQ A;  4IWP A;  1VCB A;  2L83 A;  5BMH A;  4TQ0 A;  3FIL A;  1EUV B;  2V0G A;  2LUE A;  4MSM B;  4QAY A;  3VRA B;  2LGD A;  2QIL A;  4ZYS A;  3PHW B;  2BW2 A;  1E10 A;  4CHK A;  4JE3 B;  1FCL A;  2J0J A;  1HQR D;  2KDE B;  2B3A A;  2QEJ C;  3H8H A;  4BBN F;  4BBN C;  4ZYN A;  4FHJ A;  1X1M A;  4G3X B;  3RI7 C;  2MSE D;  1GC7 A;  3B9J A;  2LVP A;  5D7G A;  4MGZ E;  2SEB D;  1XF5 L;  4B0E A;  3A1Q B;  1QOF A;  2L76 A;  3BVM A;  1K8R B;  2RDH A;  5AZH A;  3VQI A;  2L00 B;  3ZLZ A;  2JXT A;  1U4A A;  1ZGU B;  2W55 A;  2JQR B;  2YLM A;  3ZJV A;  2L8J A;  1AAR A;  4NJ7 A;  5H92 C;  1YNT E;  3L13 A;  3IVF A;  1KOT A;  3T8M A;  3W1S C;  3NS8 A;  2IND C;  2UU7 A;  1E8Y A;  2NTT A;  5LXI B;  3ZRC A;  2D07 B;  2FIF A;  2WX0 A;  3RUI B;  1L6V A;  3VH4 B;  3DHI C;  4US8 A;  1M94 A;  1MI0 A;  1Z2M A;  4KX6 B;  4RF1 A;  2RDB C;  2DBY A;  4ZRK A;  1SIF A;  5HG2 A;  5D3I B;  1Q0W B;  1WY8 A;  2JY6 A;  3BZD B;  2KK8 A;  4CYE A;  1F52 A;  4PS7 A;  2LD9 A;  5EDS A;  1ZOY B;  1ZW7 A;  3PZ7 A;  3PZD A;  1ZUD 2;  3CMM B;  3VH3 B;  2YVC A;  1J8C A;  4C80 A;  4RGT A;  4ARI A;  2JSV X;  4LNO A;  3QK0 A;  2L0T A;  1V86 A;  4WIP A;  3B2G A;  2KWD A;  1I7H A;  2LMC A;  4BOS C;  1FRD A;  2SAK A;  4NPN A;  2Z59 B;  4G50 A;  2LGS A;  1N6Z A;  4PS3 A;  1MG8 A;  3DVN V;  2ZVO A;  1Q10 A;  2QC8 A;  1WI0 A;  2CU3 A;  2KWU B;  2YEP B;  3PRE A;  3U8Z A;  1JRO A;  2C7H A;  2KFK A;  3GE3 C;  3TEX A;  3ZNG C;  2JT4 B;  1NI2 A;  2KKC A;  3GOE A;  3O13 A;  4KSL C;  3UIO B;  3EGR A;  1YOV B;  3NJT A;  2NR2 A;  2KTR A;  2DLB A;  1SSN A;  2FUG 1;  4ANW A;  2M0X A;  4MM3 B;  3OG5 A;  3TCA A;  3DBL B;  4RGN A;  1JAL A;  2INN E;  3AUL A;  3KYC D;  4KGT A;  2N7E A;  2WDT B;  3PRP B;  3WIM A;  1ZE3 D;  4XYC A;  2KX3 A;  2KJR A;  1IBX A;  2XEW A;  2RGF A;  4W9D A;  4L2Y A;  2PE6 B;  3W9C B;  1YX6 B;  1WGY A;  3Q8A A;  4FJV B;  2LJ5 A;  2Q5W D;  3LJ3 A;  3TL5 A;  3ENE A;  2K1F A;  2D3B A;  2XN9 C;  1WGR A;  1IYF A;  2WX1 A;  1Y8R C;  1SIJ A;  2JWU A;  3NHE B;  3ZDT A;  2EKE C;  3RN9 C;  2AL3 A;  4MGY E;  4CQN A;  5E6J A;  2DZI A;  2QJL A;  1LGR A;  2DZJ A;  3QAQ A;  2LZ6 A;  3RNA C;  4MM3 A;  2WNM A;  1ZXH A;  3KH0 A;  2KQ7 A;  3MHS D;  1WMH A;  2J0K A;  4C4V A;  3B1L X;  1UWM A;  3OJ3 A;  4M01 A;  2KDB A;  3BIN A;  3QWZ B;  1DOX A;  1C76 A;  3VDZ A;  1ACC A;  5IKC M;  2K8C A;  3TJP A;  4II3 B;  3OJ4 B;  1NDD A;  1TS5 A;  4EZJ A;  2KQS A;  5CHF A;  1SJE D;  3AE8 B;  2Z8L A;  1ROE A;  3ZRF A;  5JH5 C;  5CHV C;  1TZ1 A;  1WRD B;  3TBL D;  2KAN A;  3DVN U;  4L1B A;  5FR6 A;  2WYQ A;  2HDE A;  2IPK D;  3Q3N C;  3L54 A;  2JYT A;  3LYY A;  4XDD A;  1SBB B;  3QC8 B;  3FIL B;  2KMA A;  2V4L A;  3M63 B;  5FR3 A;  2DAF A;  2FNJ B;  5IO9 A;  4FAD A;  3RT3 B;  1TS2 A;  2BYF A;  2MHJ A;  3MTN B;  1WIA A;  3V3X A;  5HI1 A;  2BQQ A;  1FXT B;  1D5Z C;  2AQ2 B;  3AE5 B;  3AE3 B;  5AEK B;  1ET6 A;  3JSV B;  2N9P C;  2OJW A;  4E71 A;  2NMQ A;  1PGA A;  3VUW A;  2JF5 A;  2ZNV B;  2W3S A;  2CHZ A;  2KDI A;  1MHX A;  4BFR A;  2Y3A A;  2CHW A;  4YWG G;  3VRB B;  4GU2 A;  2GBN A;  2K22 A;  5LNK 1;  3QA8 A;  2V9H A;  3R8B A;  3A4R A;  3Q8B A;  1I4P A;  1KM7 A;  3DHG C;  2CHX A;  2WLB A;  5DPW A;  1GNU A;  1UBI A;  1STE A;  1NYQ A;  5JZE B;  4E74 A;  2WQY B;  2JWZ A;  4RH6 A;  4ZRJ A;  3L08 A;  4WJP A;  3IT4 B;  2WXK A;  3L4P A;  2L05 A;  3MJW A;  4IM0 A;  4KGS A;  1YN3 A;  1UF0 A;  3DVG X;  3KLS X;  2PTL A;  1CJE A;  1KTK A;  4YL8 A;  1RAX A;  4HDQ A;  1KLV A;  4ICU A;  1LQB A;  2MCN B;  1JQ4 A;  4HWI B;  2D3A A;  2LHD A;  3A9K A;  1FIQ A;  3LB8 C;  2LHE A;  2N1V A;  4RGO S;  3C0R B;  1UH6 A;  3U52 E;  4B6W A;  1YQ3 B;  1CK1 A;  2TSS A;  3AE7 B;  2PMV A;  1UGM A;  3ZGZ A;  4F8C B;  2BVC A;  1QLB B;  1V97 A;  1BT0 A;  5JXV A;  1T0Y A;  3ML9 A;  2E6X A;  3KWL A;  3W2D A;  5DPS A;  2BS3 B;  4B9K A;  3M95 A;  2O6V A;  1LM8 B;  3Q8F A;  3MC9 A;  4PYU A;  4GDK A;  5I4D A;  3M3J A;  2EEL A;  3UIN B;  4GSW A;  1F2R I;  1TY2 A;  2KOX A;  1GAQ B;  1M4V A;  1WGG A;  1GG3 A;  1V49 A;  3PLU A;  4O1N A;  3QCA A;  3AEE B;  4RGM A;  2FCN A;  1WXM A;  1VZ7 A;  3I57 A;  3R3M A;  3AM9 A;  2BPS A;  4USA A;  5E6P A;  1P1A A;  1P7E A;  3IAM 1;  4WJN A;  3AE1 B;  3H7P A;  3I5J C;  3WAP A;  4RNA A;  2V3N A;  1F1H A;  5HFY A;  1ISN A;  4MSQ B;  3PV1 A;  3IT6 B;  2DYO A;  1IPG A;  3C8Y A;  4K3B A;  2H89 B;  1PYW D;  3NRZ A;  1IGD A;  3P42 A;  2FCM A;  3ZJU A;  2KXJ A;  1VDV A;  3NZU A;  1K52 A;  2Z0D B;  3SDL C;  3DBL I;  2N9L A;  4P16 A;  2J0M A;  2N0S B;  1HTQ A;  5HHD G;  2BB5 A;  2BB6 A;  1E7P B;  1MG4 A;  4ZOH C;  4HCN B;  4IUM B;  2JXX A;  2BWE S;  1DOI A;  2I38 A;  5G2N A;  3SR6 A;  5J18 A;  3WA0 A;  4OZA A;  2KZR A;  3NVZ A;  2GMI C;  1WYG A;  2L3Z A;  4M8N A;  3RZW C;  3T3N A;  2PPH A;  3ZDM C;  2WP9 B;  4BKT A;  2EKI A;  3DPD A;  3SD5 A;  1TYG B;  1RWS A;  4LCD E;  1WR1 A;  1C3T A;  3BK2 A;  3ZYY X;  4LLG M;  1FNW A;  2MX2 A;  2L0F A;  1V1P A;  1VJK A;  3IG3 A;  1EU4 A;  3DWM A;  3ZIM A;  4BAX A;  4A20 A;  2L52 A;  3Q3J A;  2N9K A;  3GB1 A;  4AWJ A;  3BWU D;  3PRZ A;  3UI3 A;  3GZN B;  2OED A;  1D3Z A;  1H4R A;  1P7F A;  3N1X C;  4RF0 A;  3P1M A;  3U30 A;  3VXW A;  2HTH A;  4DQO C;  4KDI C;  2KD0 A;  2CS4 A;  1YJI A;  2KTR B;  2VH1 A;  5J2R A;  3Q8E A;  4C7Y A;  2IO0 B;  1VZ6 A;  5KHQ A;  1OEY A;  1VZ8 A;  3P4R B; 
#chains in the Genus database with same CATH homology
 2FBW B;  1YMH E;  5BYS A;  2H88 B;  1IGC A;  2PVO D;  1NVI D;  1PUT A;  4WUR A;  4NAM A;  1ET9 A;  2IDY A;  3PO0 A;  3AV8 A;  5D3D A;  2R61 A;  1Q10 A;  4GDK B;  5EE3 A;  1E6E B;  1XCT L;  2CU3 A;  2YEP B;  2N7J A;  1HA5 A;  4UDU C;  1SJH D;  1JRO A;  1XLQ A;  4US9 A;  4L23 A;  3TEX A;  2X38 A;  2VZK B;  1K53 A;  1JW9 D;  5EE9 A;  2AQ1 B;  1XLO A;  3RPF C;  4OVZ A;  3O13 A;  1ZDV A;  4IOI E;  1TKG A;  3EGR A;  2KAC A;  3NUH B;  2Y5C A;  2DLB A;  1SSN A;  4JWS C;  2FUG 1;  5GXG B;  4ZHP A;  1EM7 A;  1RFK A;  2E3T A;  4MM3 B;  4AQ7 A;  2W3R A;  4YXD B;  4OZC A;  4RGN A;  3U2S C;  1JAL A;  2J42 A;  1N60 A;  2FE8 A;  3P4Q B;  3LXF A;  5EE1 A;  2INN E;  4KGT A;  3MHZ A;  1J7A A;  1MVK A;  3R2T A;  1ZE3 D;  1HZ5 A;  1L6U A;  1JML A;  3AEB B;  3AEG B;  1IBX A;  2M56 B;  4YSX B;  1N62 A;  2G9H D;  2K9X A;  2WDR B;  2K5P A;  2BS4 B;  2JZP A;  2PIA A;  1KFY B;  4L2Y A;  3W9C B;  4WH4 A;  3ETR A;  1SE3 A;  2V3P A;  3Q8A A;  4GLS C;  5BMG A;  1SE2 A;  1XLP A;  2Q5W D;  1JCK B;  2KQ4 X;  4WQM A;  4C56 C;  2JX5 A;  5C3J B;  4XDC A;  3NVY A;  2ACZ B;  1C77 A;  2XN9 C;  2ONQ A;  3TEZ A;  1L0X B;  1SIJ A;  2JWU A;  1DGJ A;  2LGI A;  1FFV A;  4CQN A;  1YJJ A;  5E6J A;  1BML C;  1K50 A;  2ZW0 A;  4FXC A;  4MH8 A;  5FK9 C;  3VR9 B;  2B76 B;  1N63 A;  1GPX A;  2CJN A;  2QJL A;  4KKJ A;  3P63 A;  1WSP A;  1QQR A;  4MAC A;  2WNM A;  5AUI A;  1FMA D;  1ZXH A;  1ENF A;  2MH7 A;  2WXG A;  1D5X C;  1DOY A;  1CQV A;  1EWC A;  4HRO A;  1UWM A;  1KLG D;  1WWT A;  1DOX A;  1C76 A;  2BT6 A;  3BVZ A;  1SF0 A;  1ACC A;  1JWA D;  1C79 A;  1R7S A;  1AYF A;  3MC0 B;  1I4Q A;  1RM6 C;  4N59 A;  1T5X D;  1A70 A;  2KDM A;  2WXJ A;  1GOZ A;  3GP7 A;  5C2T B;  1TS5 A;  1E9M A;  5FKA C;  3NS1 A;  2AQ3 B;  1PGX A;  3R2I A;  4ZHO A;  3SFE B;  2RMM A;  3W5U B;  2XNA C;  1JWU D;  3AE2 B;  3DWG C;  2HTM E;  2KMM A;  1SXT A;  2D5G A;  2KN4 A;  1SJE D;  1WXQ A;  3AE8 B;  3W1S A;  2Z8L A;  1ROE A;  3MJ5 A;  1TS4 A;  3HUI A;  1YQ4 B;  3U7Z A;  1HXY D;  4L1B A;  1FNV A;  2HDE A;  2LJI A;  2WDQ B;  3FAH A;  2IPK D;  4EE2 A;  5BMI A;  2BYT A;  4TSS A;  3N9Y C;  2JYT A;  3LYY A;  4WWM A;  4XDD A;  3WCQ A;  1SBB B;  3FIL B;  5FR3 A;  3E9S A;  2WXM A;  1L4Z B;  3FC4 A;  1N5X A;  1KF6 B;  2WS3 B;  4JX1 C;  1UGJ A;  1TS2 A;  1OQQ A;  2WDV B;  1Y56 A;  3V3X A;  4XWW A;  5T8I A;  5HI1 A;  2J52 A;  3AE9 B;  2MJD A;  3AED B;  1FNU A;  1D5Z C;  2AQ2 B;  3AE5 B;  3AE3 B;  1ET6 A;  2GRI A;  2BTE A;  1TS3 A;  2LFI A;  4N58 A;  1IBX B;  3PZ8 A;  2NMQ A;  1PGA A;  4ZRP A;  2WXQ A;  2L1A A;  2W3S A;  1TZO A;  4NZL B;  1C4P A;  1MHX A;  2WU2 B;  4B0M A;  4A55 A;  1D5M C;  1YN5 A;  3ABV B;  4YSZ B;  3Q69 A;  2Y3A A;  4YWG G;  3VRB B;  5EE0 A;  4YTM B;  1I4R A;  1SE4 A;  1VR9 A;  2WXN A;  2K22 A;  5LNK 1;  2M19 A;  3R8B A;  3Q8B A;  1I4P A;  2WLB A;  4IKG A;  1TKY A;  2CJO A;  4XWT A;  1LO5 D;  1STE A;  2J4X A;  1NYQ A;  1WGK A;  1B9R A;  3CIR B;  1SEB D;  1MPE A;  1RYJ A;  1I4X A;  1TY0 A;  1ZXI A;  2WQY B;  1UUP A;  1L0V B;  4OZB A;  1C4A A;  1PGB A;  1N61 A;  4RH6 A;  1NEN B;  1FD6 A;  1KH0 A;  1JWB D;  3EUB 2;  2DWQ A;  1I4G A;  3IT4 B;  4RCO A;  2WXK A;  3L4P A;  1V1O A;  4OHJ A;  4JPS A;  1IUE A;  4KGS A;  1YN3 A;  1TJE A;  2WXP A;  3KLS X;  2PTL A;  1CJE A;  5MPO A;  1KTK A;  2J53 A;  4JWU C;  2I2Y A;  1BXT A;  1F0Z A;  4MT5 A;  2WXH A;  1PFD A;  1QF6 A;  1JWS D;  1JQ4 A;  4YT0 B;  1DYQ A;  1ESF A;  1KRH A;  2LHD A;  2PKO A;  1FIQ A;  4A6Q A;  2JU6 X;  2JYE A;  2WXF A;  3LB8 C;  2LHE A;  4RGO S;  3TEW A;  4KGR A;  2BS2 B;  1EWY C;  2W54 A;  4R3D A;  3U52 E;  3ZQ4 A;  3P4S B;  2DYM A;  1YQ3 B;  2Y5P A;  3B2F A;  1CK1 A;  3NVV A;  3NZ3 A;  2WXL A;  2TSS A;  3AE7 B;  2PMV A;  1XO3 A;  1E0Z A;  3ZGZ A;  1PDX A;  1ZPS A;  1D6E C;  2V4I B;  1L4D B;  1QLB B;  1V97 A;  1MHH E;  3AMZ A;  5JXV A;  3E56 A;  2BBC A;  2E6X A;  3KWL A;  3W2D A;  2BS3 B;  4P6V F;  1F77 A;  5H8Y E;  2GB1 A;  4J3O D;  1YN4 A;  3CWI A;  3U4E G;  3V05 A;  3Q8F A;  4KKI A;  1UWX A;  5TSS A;  5I4D A;  4TQ1 A;  1QT9 A;  3TUO A;  2EEL A;  3W5V B;  2WXR A;  3HVZ A;  4HKZ E;  1F2R I;  1TY2 A;  2QMT A;  4YTP B;  1QIL A;  4DXF A;  1GAQ B;  1D4B A;  1M4V A;  1UNS A;  4NJC A;  4HEA 1;  1J7C A;  4PT5 A;  3AB5 A;  2L32 A;  4O1N A;  2WXO A;  3AEE B;  1FM0 D;  4YSY B;  5BYR A;  4RGM A;  1AW7 A;  3AEA B;  1VZ7 A;  3AE6 B;  3I57 A;  2ICI A;  1GB1 A;  3AM9 A;  1FFU A;  3SEB A;  4USA A;  2INP E;  1QOB A;  3HVD A;  2MEK A;  1P7E A;  3BII D;  3IAM 1;  3VR8 B;  2OHF A;  2KAJ A;  3AN1 A;  2G1E A;  3GS2 A;  3AE1 B;  3AEC B;  4HJG E;  2RPV A;  4Q2J A;  1NEK B;  4IDI A;  4HRS A;  4NAW B;  1EU3 A;  2IGD A;  2YEP F;  1OQR A;  3IXS A;  4RNA A;  1VRA B;  2K3U A;  2V3N A;  2ON8 A;  4M0W A;  2ZW1 A;  2GI9 A;  3BK1 A;  1XEE A;  5HFY A;  1WRI A;  3IT6 B;  2DYO A;  3J9C A;  2AX5 A;  3Q8C A;  2IGG A;  3C8Y A;  1OFF A;  3KWV A;  2H89 B;  3HRD D;  1PYW D;  1B1Z A;  3NRZ A;  1T3Q A;  4WAF A;  1IGD A;  2L83 A;  1QKZ A;  3P42 A;  5BMH A;  2W82 A;  4TQ0 A;  1ZDX A;  3P4P B;  3FIL A;  4A8X C;  2V0G A;  3ZJU A;  1C4C A;  1VDV A;  3VRA B;  1GB4 A;  2QIL A;  4ZYS A;  1C9F A;  4N6E B;  1K52 A;  4DXG A;  4AS1 A;  2BW2 A;  1E10 A;  3AEF B;  3KQ4 A;  2N9L A;  4JE3 B;  2WU5 B;  1JWM D;  4P16 A;  2LUM A;  1FCL A;  2N0S B;  3AH7 A;  3RFZ B;  1HQR D;  1QOA A;  5HHD G;  1XLN A;  2BB5 A;  2BB6 A;  2QEJ C;  4XE0 A;  4A9A A;  3H8H A;  3NVW A;  1FXI A;  1E7P B;  5AUK A;  2NTS A;  3SFD B;  4ZOH C;  4D2K A;  1KLU D;  4OW0 A;  2QIE B;  1K51 A;  3B9J A;  1DOI A;  1QOG A;  2I38 A;  5D7G A;  4A90 A;  2SEB D;  1XF5 L;  4B0E A;  3SR6 A;  3IAS 1;  4C7Z A;  1QOF A;  5BYQ A;  3BVM A;  2RDH A;  3AE4 B;  3VQI A;  4ARC A;  3MP9 A;  4YTN B;  4OZA A;  1FEH A;  3NVZ A;  1WYG A;  2IJ0 A;  2JXT A;  2W55 A;  2JQR B;  4LTU A;  3ZJV A;  2LEK A;  3T3N A;  3ZJT A;  5H92 C;  2PLP A;  1CZP A;  1V1P B;  2WP9 B;  3BVG A;  3I9V 1;  1JRP A;  1YNT E;  2MJ3 A;  2EKI A;  4HKQ A;  1NYR A;  3OWE B;  1FXA A;  2PVG C;  1BUI C;  1T6B X;  1TYG B;  1RWS A;  2RDG A;  3BK2 A;  3ZYY X;  1VLB A;  2NTT A;  4LLG M;  1FNW A;  4TMA B;  2QSD A;  1L5P A;  1V1P A;  1L6V A;  1VJK A;  1EU4 A;  1C78 A;  3DWM A;  4US8 A;  4LK0 M;  1MI0 A;  2VZK D;  2M0A A;  2L52 A;  4KX6 B;  4RF1 A;  1FRR A;  1HZ6 A;  5G5G A;  2DBY A;  5G5H A;  5HG2 A;  1FCC C;  2N9K A;  5D3I B;  3GB1 A;  4GDL B;  1V8C A;  3BWU D;  3UI3 A;  4ZRQ A;  1TKE A;  3BZD B;  4RFB A;  1F2R C;  2OED A;  3EA6 A;  4REZ A;  2K0P A;  1J7B A;  1FO4 A;  1ZP0 B;  1P7F A;  1ZOY B;  3PZ7 A;  1HEZ E;  1NI3 A;  1ZUD 2;  3BYY B;  4RF0 A;  4C80 A;  2MJE A;  3MFG A;  1XCQ L;  3P1M A;  4RGT A;  4ARI A;  2JSV X;  2PW9 A;  1L0Y B;  4H2A A;  3URY A;  3TSS A;  2IGH A;  2WXI A;  4DQO C;  4ITK A;  4WIP A;  3T3O A;  1XXG A;  3B2G A;  2KWD A;  1I7H A;  1AWD A;  1N5W A;  1YJI A;  2LMC A;  1FRD A;  2SAK A;  3TEY A;  1I4H A;  3Q8E A;  4C7Y A;  1VZ6 A;  1AN8 A;  1VZ8 A;  1SB3 C;  3P4R B;  3BYT B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...