5AUKA

Crystal structure of the ga-substituted ferredoxin
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
96
structure length
96
Chain Sequence
ASYTVKLITPDGESSIECSDDTYILDAAEEAGLDLPYSCRAGACSTCAGKITAGSVDQSDQSFLDDDQIEAGYVLTCVAYPTSDCTIETHKEEDLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Ferredoxin-1
publication title X-ray Structure and Nuclear Magnetic Resonance Analysis of the Interaction Sites of the Ga-Substituted Cyanobacterial Ferredoxin
pubmed doi rcsb
source organism Synechocystis sp. (strain pcc 6803 / kazusa)
total genus 23
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2015-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 5aukA00
1TYGB 4JWSC 4US9A 3VRAB 4C7ZA 2WU2B 1L5PA 1YQ3B 5C3JB 1ROEA 2WDRB 3B2GA 2WP9B 3AE8B 1L6UA 5MPOA 3SFEB 3B2FA 2ACZB 1YJJA 4YTNB 2CJNA 3AEEB 2QIEB 1FXAA 1TJEA 1XLOA 2LEKA 1DOXA 1DOYA 3AM9A 1XLPA 1GAQB 1QOFA 1SF0A 2B76B 1V8CA 1JRPA 1WRIA 2WQYB 3HRDD 1F0ZA 3EUB2 4WQMA 3LXFA 4JWUC 3ABVB 1N63A 1JW9D 1SB3C 2PVOD 2BS4B 5G5HA 2MJEA 1XLQA 3DWGC 1GPXA 1TKEA 2AX5A 1E7PB 1RYJA 2DWQA 1QLBB 2BS3B 2MJDA 4N58A 1N61A 4C7YA 1PFDA 3AEGB 1IUEA 3PO0A 3W9CB 4JX1C 4US8A 2K22A 2MJ3A 1AYFA 3FAHA 3P4PB 1TKGA 5EE0A 1I7HA 2K9XA 3KWLA 3FC4A 3P4SB 3VR9B 3WCQA 1FO4A 2OHFA 3AN1A 5G5GA 3AMZA 3P4QB 1QOAA 1DGJA 4HROA 3AE5B 1L0VB 1KRHA 3BIID 1OQQA 1QOGA 1N5XA 1NVID 3AEFB 3DWMA 4YSYB 4C80A 4KX6B 1E9MA 1E10A 2H89B 4N6EB 1WYGA 1JALA 3SR6A 4IDIA 2WDVB 3AE2B 1FM0D 1KFYB 2N0SB 2Q5WD 4YSXB 1B9RA 1L6VA 1VDVA 2G1EA 2WS3B 3AE4B 4YTMB 1T3QA 1ZOYB 1J7CA 2W54A 2Y5CA 1VJKA 2KAJA 3AE6B 1ZXIA 1J7BA 5AUIA 2BS2B 4FXCA 1NEKB 1JWAD 3SFDB 5AUKA 4WWMA 1NYQA 3AE1B 1CJEA 3AH7A 1FFUA 5C2TB 1TKYA 1V97A 1RM6C 1SIJA 1NI3A 2L83A 1OFFA 3AE3B 1EWYC 1YJIA 2EKIA 4ITKA 1E0ZA 3CIRB 1UWMA 2CU3A 1PUTA 1YQ4B 2QJLA 3P63A 1FFVA 1WGKA 3AEDB 2L52A 3P4RB 4YSZB 1NYRA 3AEBB 1NENB 3B9JA 2JX5A 3NRZA 4YTPB 3ETRA 2W3SA 2WLBA 1QOBA 1ZUD2 3VRBB 4HRSA 1FRRA 1XLNA 1AWDA 1JROA 2BT6A 2PIAA 1JQ4A 4A9AA 1ZP0B 5H8YE 2MH7A 3LB8C 3NVYA 3NVWA 3ZYYX 2H88B 2W55A 3AE7B 1FMAD 5EE3A 2M56B 5H92C 1PDXA 3HUIA 2JQRB 1R7SA 2WDQB 2WU5B 1A70A 2KMMA 1RFKA 3P1MA 1JWBD 3AECB 3CWIA 4ZOHC 3W5VB 1RWSA 5EE9A 1VLBA 2W3RA 2CJOA 3AE9B 3VR8B 1DOIA 5GXGB 2DBYA 4YXDB 4ZHPA 4LTUA 1WXQA 1N5WA 4YT0B 1OQRA 2E3TA 1N60A 3NS1A 4ZHOA 3NVVA 1J7AA 2HTME 3AB5A 1FRDA 3AV8A 1E6EB 3RPFC 1CZPA 2K5PA 3AEAB 4N59A 3W5UB 1QF6A 2PVGC 2FBWB 3L4PA 1XO3A 4USAA 4P6VF 3NVZA 1N62A 1FXIA 1KF6B 1FIQA 3HVZA 1WWTA 2M19A 5EE1A 1QT9A 2PKOA
chains in the Genus database with same CATH superfamily
5JHBA 1YQ3B 1V1PA 1WE6A 5D94A 3EGRA 2SAKA 2V0GA 3SFEB 3S2AA 2C7NB 3OLMD 1ZE3D 4DDID 4OZAA 2KANA 4PS7A 3R8BA 1F0ZA 3OJ3A 3H9DA 3UINB 3H6NA 1V9JA 4BAXA 3H1UA 4G11A 3LYYA 3L54A 4ZRJA 2KWDA 1AYFA 2KZRA 3KWLA 3RD2A 2LVOA 3P4QB 1QOAA 1V5TA 4MGKE 4PS8A 4GIVA 2PEAA 1A5RA 2WDVB 2N0SB 1KFYB 3DHGC 1FCLA 2KAJA 1ZXIA 2IJ0A 3PRMB 4WJQA 2KLGA 2PTLA 4F8CB 1CJEA 3ZIMA 4LNOA 2C7HA 1HEZE 2EMSA 1QOBA 1ISNA 5H8YE 2IGGA 2MW5A 1SE3A 3Q3NC 1PQSA 4LLGM 1WR6E 1WSPA 2LFIA 4REZA 2ZW1A 5GXGB 3GZNB 4YXDB 4KIKB 1V81A 2N9LA 4FJVB 1C76A 4KZCA 4KKIA 3KVFB 2K5PA 4M02A 4W9EA 1WGHA 4W9DA 3NVZA 2AQ3B 1ENFA 5EE1A 1V6EA 1GG3A 1L5PA 3W1YA 3A1QA 4ANUA 1KTKA 1WRDB 3B2GA 1V1PB 2LGSA 1L6UA 4RGOS 2V4IB 2YVCA 3B1LX 1XLPA 2ZPNA 1V8CA 4MELA 3H8HA 3PRPB 1N63A 3NJTA 3U30A 1JW9D 4KV2A 3V62A 1UELA 5LNK1 3WALA 3RN9C 2N7EA 3NY5A 2KHWB 4JX1C 4IM3A 3TUOA 4M0WA 2JF5A 4CO7A 2N1VA 3KYCD 1WYGA 1JALA 4XDCA 5FR6A 1L6VA 4S17A 2J0KA 3AE4B 3PRZA 1OEYA 2J0JA 2RDHA 4EZKA 1TS3A 3MTNB 4R3DA 4FJZA 1FD6A 1OFFA 1LM8B 2I38A 3V05A 3B0AA 2BYVE 3C19A 1N6ZA 4RCOA 1VZ6A 4LDTD 5BYQA 1NENB 1GUAB 3HVDA 4EEWA 1EWCA 2DLBA 3V6CB 3WAOA 1TY2A 1TZ1A 3Q3OC 1VZ8A 3VXWA 4DHZB 3PHXB 4IKGA 2IGDA 2LMCA 1RRBA 2WXHA 5EE3A 2K3UA 2K8CA 2N9PC 3HUIA 4HCPB 3ZRFA 4II3B 2KMMA 3P1MA 3IG3A 2PE9A 1VLBA 4B0EA 2DYBA 4ZHPA 2Z0EB 1WXQA 3O65B 1OQRA 2KJRA 2KXJA 1AARA 2HD5B 2GBNA 5LLIA 2QMTA 3A1QB 1S3SG 3RNBC 4HKQA 1YJJA 2MBEA 2W9NA 2LUEA 1QOFA 1UGMA 2KTRA 1Y8RC 5GMVA 3IXSA 1BUIC 3I5JC 2LD9A 3RMKC 2KO3A 3RZFA 2E6XA 3IHPC 1ET6A 2JWUA 2J7QB 4RGTA 2KMAA 2L1AA 2ZEQA 1L0VB 1OQQA 1QOGA 4HKZE 1WXAA 1F52A 4JPSA 2KTFA 3SR6A 2GB1A 4LNKA 4YSXB 3ZNGC 4AP4C 1WX8A 3QIJA 3UIOB 1WM3A 4FXCA 5G55A 4DHJB 1NEKB 1JWAD 3SFDB 4WWMA 2L05A 3W1SA 3PPAA 1PUTA 4GDKB 4CQNA 4G50A 3P4RB 5T8IA 2V9HA 2J53A 2LHEA 5CX3A 3GE3C 2WLBA 2MSED 2KJ6A 4PYZA 2G9HD 1WX7A 1WZ3A 2K8BA 2M17A 3NZSA 2C5LC 3E9SA 2W55A 1TS2A 3N3KB 3IBEA 4K7WA 1YD8U 1AW7A 1R7SA 5D3DA 1ZW7A 2MA9B 4EUTA 1D5MC 4LTUA 2BPSA 2M4NA 3NVVA 4M00A 2KWCA 1F9JA 1HZ5A 3DBLB 1XO3A 4USAA 2V1YA 1T0SC 4DXFA 2GOWA 3H7PB 5BYSA 1R4MI 4B95A 2KKCA 2MLBA 1T5XD 4GOCA 4IUMB 3B2FA 3WA0A 2AYOB 2EKEC 2CKHB 3ML8A 2V3SA 3CF6E 2B76B 3UIPB 2WQYB 1CK1A 1JCKB 1ACCA 2KTRB 2D10A 3O13A 2IO1B 2X38A 1Q5WB 3L08A 3DWGC 2JRHA 1GPXA 2INCC 1D6EC 4N58A 1RYJA 1P7EA 5IA7A 2K6QA 1PFDA 1Q10A 3FILA 4KGRA 5FKAC 3C0RB 2K9XA 3K9OB 3U52E 5EDSA 1YN5A 2N9XA 4E71A 2IY0B 4OVZA 1TS5A 4IW0A 2MQJA 2DHZA 4IDIA 3ZTCA 1B9RA 2LJIA 2MX2A 1T3QA 1OGWA 2INDC 1SBBB 1F1HA 4MSQB 2KYWA 2Y5BB 2MRPA 2KX3A 2LZ6A 5JHAA 1WJNA 4P1CC 1I4RA 3A9KA 2BBCA 1EWYC 2L76A 1P1AA 1UGJA 4FJYA 5D3IB 2Z0DB 5IKCM 3AEBB 2GBJA 2RPVA 5HHDG 3NRZA 2FCQA 3R7RA 1HTQA 3VRBB 4NJ6A 4KKJA 1E8XA 4ANXA 3BWUD 3Q8CA 1FMAD 2DZMA 1WJUA 5AZFA 2EMTA 4PYUA 2JYTA 2W3RA 1WXSA 3VR8B 3DBHB 3ENEA 4MSMB 1N5WA 3AB5A 3Q8FA 4FBJB 3Q2AC 4JQWC 1EO6A 2LASA 3EECA 2FCNA 3P63A 3PZ7A 2GBRA 4B9KA 5D6JB 2HE7A 1MG4A 1ROEA 3U8ZA 2KWUB 4AWJA 2KD0A 3FKYA 2BB6A 2JZPA 1WM2A 2ACZB 2D2QA 2ZW0A 2KDIA 1XLOA 3L0WB 3A9JA 3TCAA 4GSWA 2KQ4X 1JRPA 5AZHA 2VZKB 2V3NA 1D3ZA 1L4DB 5CHVC 4RNAA 2BS3B 2YEPB 1I4PA 2MBBB 4EE2A 1VCBA 4IM0A 3GOEA 2FAZA 3FILB 3FC4A 3P2BA 3AN1A 1JWSD 3DWMA 3P42A 4KSKC 4D2KA 4FLHA 4WQOB 1SE9A 4AUQC 1HE8A 4XC2A 4MT5A 3JYUA 4W9GA 2Y5CA 1EF1A 3PGEA 1KJTA 2KFKA 1LGRA 1YOVB 5AUKA 3RUIB 1FFUA 2L83A 1RM6C 4HJGE 1K51A 3V60A 2DYOA 3CSFA 3V3XA 1I4QA 2IDYA 2ZVOA 1T0RC 5TSSA 4GDLA 5TR5A 1C79A 3HHMA 3QX1A 3T8MA 4AJWA 2FE8A 4W9IA 1KH0A 2JUOA 3VDZA 1UUPA 3ZNHB 4II2B 2J52A 3TL5A 2W82A 5IP4D 1UWXA 4IC7B 1MVKA 2E3TA 2M0XA 1FNWA 1J7AA 4RGMA 4TQ0A 3AV8A 1KOTA 2UWQA 3DBRB 3HVZA 4CYEA 1LXDA 1QQRA 4JWSC 3HM3A 3ZDMC 2Y3AA 1LFDA 2K8HA 1WJ4A 4L1BA 2MHJA 2PLPA 2B3AA 2JSVX 1WF9A 2RDBC 4NY0A 1GAQB 1XCTL 2R2QA 1R4NB 3A9JB 4UDUC 2KACA 3LXFA 3ZNZB 1TKEA 1YN4A 2DZKA 4WJNA 1PYWD 4I6NB 1TS4A 3ZNID 2PMVA 4MM3B 3P4PB 3TEZA 4DK5A 2L0TA 3QC8B 2Y5PA 1NDDA 1TIFA 2ZPYA 5AEKB 2GMIC 2C7MB 5HFYA 4F7ZA 1SGHA 1C4AA 4X57B 3KUZA 1G6JA 2I2YA 5C2TB 2KFKB 1TKYA 1Z5SB 2DNFA 4K1RB 4HLEA 4BZAA 4NAWA 4KVGB 1MI0A 3TMPB 4W9JA 2KQ7A 4K3BA 2FCMA 2RR9A 2PIAA 1JQ4A 3U2SC 4GU2A 4DXGA 2KWVB 4OZCA 4P1BC 3J9CA 3MFGA 3D32A 1A70A 1VD2A 4ZOHC 3KUDB 1E8ZA 4S0RA 4IWOA 3Q8AA 3MHSD 1WI0A 3JVZX 5J2RA 1FPYA 5IN7A 3LDZE 4P16A 5DPRA 4XE0A 4LJPB 2I1JA 3IT4B 3TBLD 3TEXA 3L16A 5JXVA 3KYDD 2CR5A 1GNUA 4C7ZA 3VRAB 1NBFC 5CTRC 2K6DB 2LRUA 2BF8B 2WX0A 1M94A 2G4DB 1TTNA 4DWFA 2BQQA 3BK2A 1SF0A 1YX6B 3N1XC 4ANWA 3OG5A 4WWPA 2BWES 2RMMA 3PZ8A 3RNCC 2LGIA 3N1ZC 3NZ3A 1MG8A 2WXJA 4BKSD 1IBXB 3KUCB 2BYEA 2KMCA 2QILA 4MJSA 3VR9B 1FO4A 5FR3A 2QCZA 2RD0A 2QC8A 1E7VA 1KRHA 3MC0B 4KX6B 5E6OA 1E10A 2CHZA 4MGIE 2Q5WD 4HPPA 1SE2A 1UD7A 1ET9A 3SD5A 1I35A 1E7UA 3VHTC 2LGYA 5BYRA 3AH7A 2BVCA 3QHTA 3Q8BA 2O6VD 3M95A 3Q3JA 4XGAB 3BINA 1C4PA 2BGFA 1NYRA 4P7IA 2JX5A 1FNUA 1OQYA 4NAWB 2BKRB 2D3AA 2WXNA 1XLNA 4RGNA 1C4CA 1YJ1A 3LB8C 4NPNA 3NVWA 1WXVA 3BYTB 2C60A 2WXGA 5BMHA 1UNSA 2MWSB 4HPMB 2SEBD 1C9FA 4A6QA 3PLVA 2ONQA 4ZHOA 2R61A 2WNMA 4GMVA 3DCGA 4W9CA 1UBQA 1FIQA 2WU2B 1KM7A 2PE6B 1YNTE 2OOBB 1FXTB 5LXHA 3AE8B 2ZJDA 2FIFA 1FXAA 5E6PA 1WGYA 1DOYA 3AM9A 4K7UA 4C4VA 3QQ8B 4TSSA 2MJEA 2TSSA 3MC9A 2NBUA 3SEBA 3ZVVA 1IUEA 3FAHA 1TKGA 1P7FA 2OHFA 3R66C 3DQVA 3BIID 4MJSB 1L2NA 1BXTA 4GLSC 1YN3A 3AE2B 4EZJA 3PVLA 1WJ6A 1WX9A 1WR1A 4EFOA 1VJKA 4KGTA 2LVPA 2KN5A 1JRUA 2DZIA 5C23A 2KX0A 1P9DU 4MGZE 4NAMA 1UF0A 3EC8A 4M0WB 3AXCA 2NBWB 1H4RA 3B9JA 3ETRA 1WFYA 3BVZA 3C8YA 3QCAA 3VQIA 2KNBA 4A9AA 3N9YC 5BO4B 3V61A 1PDXA 3ZUNA 2QSDA 4C56C 2JQRB 2LUMA 2WDQB 4FADA 4WAFA 2D3GA 4A20A 2PPHA 1CMXB 1WGRA 3ZKJC 3SDLC 2NR2A 2D07B 3R2IA 2NMQA 3L10B 1SJED 3W5UB 3VFKA 3DBLI 2RGFA 4WWOA 4P6VF 1FXIA 2GRIA 3GE8C 5C3JB 1XD3B 4DDGD 2NPTA 3DVGY 4BBNC 4HDOA 3ZJTA 3T3OA 2HJ1A 1XT9B 4LJOB 3RNAC 4LK0M 3L17A 4BOZB 1HQRD 3BVMA 4RM8A 2IBIB 3EUB2 4ARCA 2IO0B 5L95C 2NTTA 3QARA 4DBGA 4C7YA 3GP7A 4OZBA 4RH6A 3RNGC 1TT5B 5DCNA 3AMZA 1DGJA 1L0YB 1V1OA 1NVID 3K9PB 1SXTA 2LVQA 2OJRA 4JIOU 1I4HA 1PGBA 1AN8A 3JW0X 5BMGA 3U4EG 3QWZB 1K50A 1SSNA 4HDQA 2BWFA 3DDCB 3TSSA 2N7JA 4W9HA 1QZEA 5E6NA 1MHHE 1K8RB 4L2YA 1SIJA 3VUYA 3R3MA 2O2VA 3Q14C 1T6BX 4IWQA 1U4AA 3Q6BA 3TIXA 2WX1A 4WURA 3VAWA 3VUXA 2N4FA 2V4LA 1AWDA 1JROA 4PT5A 4HXDA 1R4MB 3AE7B 3TEYA 2L32A 3CWIA 3EHVA 3N30A 3W5VB 1RWSA 4YWGG 1WXMA 2R2OA 1DOIA 4HPLB 2JY6A 3GB1A 2VH1A 1N60A 1CZPA 3PHWB 1QF6A 4TQ1A 4BKSA 1TY0A 2NBVB 3T3NA 2FIDA 4MDKE 4MEMA 4KDIC 2WP9B 3B08A 3OJ4B 3EA6A 4YTNB 2IYDB 2WXOA 2LWPA 2PJHA 2AQ1B 4BOSC 1P0RA 1ZPSA 1IGCA 3RNFC 2DYMA 5KHOA 1L4ZB 3CMMB 1C1YB 1QLBB 2BYFA 4H2AA 3W9CB 3DOWA 4HJKA 2D5GA 3I3TB 4BBNF 2J42A 4WWNA 2L3ZA 2FNJB 2J4XA 2V3PA 2MEKA 1MPEA 1D4BA 1J19A 2WS3B 4XWTA 1YIWA 2Z8LA 5J17A 4DHJD 2WXRA 2ZZPB 3WANA 3ZGZA 1V97A 4MACA 4HVBA 2YEPF 3VTWA 4KSLC 3W2DA 3HK0A 3Q3MC 4BKGA 2M8SA 4BKTA 3IAM1 4YL8A 2O2VB 4A3OA 2L52A 4YSZB 4EKUA 1X1MA 4GB9A 4A8XC 2CS4A 2JYEA 3V6EB 4DXAB 3ONSA 1ZUD2 4RF0A 2XK5A 3ZYYX 1NI2A 2LXAA 4GN1A 3A9KB 4LNIA 2BTEA 2DBYA 5IOIA 1LQBA 1MJDA 1I42A 1EUVB 4N59A 2DAJA 3L4PA 4AJYB 3AI5A 2G3QB 3DBRI 1KF6B 2G45B 4BFRA 5DPSA 4RM9A 1YX5B 2PKOA 1TYGB 2NVUI 4N9F4 4EOYA 1WGDA 3A4RA 1SE4A 2JRIB 1EU3A 4K81A 1P98A 2QIEB 4L23A 4KZ0A 3RYTA 1R4NI 3EFCA 3QAQA 4JWUC 4XX5A 3APDA 1V86A 1E7PB 3M63B 3WAMA 4AQ7A 1IP9A 1QKZA 1I7HA 3NG0A 3NZUA 1VRAB 3ZO5B 3R7QA 5HI1A 5FK9C 2WXQA 1E9MA 1RAXA 5BMIA 4PK1A 4B6WA 4I6LB 5HG2A 1VDVA 1V49A 1J7CA 4M8MA 4FULA 2AWTA 4HCNB 1HXYD 1K53A 2CHWA 4RFBA 2CHXA 1WMHA 4W9KA 2QHOA 4TUUA 1M4VA 4LDTB 5JH5C 2WWZA 4JL9A 3DVGX 1WGGA 1BT0A 5D7GA 4A90A 4TMAB 2D3BA 5H92C 4F1SA 2JXTA 3KW5B 3AE9B 2KLCA 3I57A 1GOZA 3URYA 3I9V1 3RPFC 2KDBA 2KDFB 2LXCA 1N62A 4GDLB 2WXFA 1QT9A 3APCA 2WXIA 4AS1A 2GBMA 5MPOA 4JLCA 3RULA 2D11A 1H8CA 1DOXA 5D2MB 2L7RA 2XN9C 1FNVA 2BB5A 3GZNI 2LI5A 1J0GA 2VZKD 2NTSA 3ABVB 3MJ5A 3UF8A 5G5HA 3Q3FA 4O1NA 1L7YA 1E8WA 3PO0A 2L8JA 1JMLA 3UQAA 3WCQA 2LGDA 2MBQA 3ZQ4A 2AL3A 5CHWA 3A33B 1N5XA 3AU5A 2RSUA 2H89B 1XXGA 5L83A 3JSVA 1STEA 3KQ4A 1MHXA 2NCNA 4YTMB 4JGHB 2XNAC 2KDEB 3AE6B 4AOFA 3Q69A 5DPWA 2KFJA 1RLFA 1KLGD 1NI3A 1WMHB 2MBHA 2HTHA 2EKIA 4GXBA 2LHDA 2KN4A 4J3OD 1WGKA 2ON8A 3SHQA 2A5UA 3N1YC 2W3SA 1FRRA 4E3CA 4OHJA 4KGSA 2BYTA 4HK2A 4ZDVA 2EELA 1Z2MA 1IGDA 4MGYE 4WIPA 3ZJUA 1OEYJ 1JWBD 5EE9A 1YMHE 4HWIB 1SEBD 3R2TA 4FN2A 3RFZB 2FUHB 3TEWA 2KT7A 2QEJC 2HTME 1FRDA 4LNNA 2ZNVB 2UU7A 4US9A 2KVZA 3ECIA 4EZLA 1WIAA 3EFUA 5HKHA 4J6IA 4ACFA 2JWZA 3AEEB 3RI7C 3PTFC 2A4ZA 3HIZA 3TJPA 2JVCA 3PT2B 3WIMA 3KWVA 2IO2B 2OEDA 3RT3B 4DQOC 2K39A 2DWQA 2HDEA 1N61A 5G2NA 3KLSX 4IWPA 4G0NB 5EE0A 4GDKA 2M0AA 4NJCA 3P4SB 3RCZA 3VH4B 3AE5B 2IY1B 4C80A 1S1QB 3SU8X 4YSYB 4K7SA 2WXLA 2IGHA 1YQBA 3JSVB 4WAAA 3AU4A 1JWUD 1UZXB 2W54A 3X23A 3NOBA 4MH0E 2BW2A 2BS2B 5LXIB 1C77A 3AE1B 5JZEB 3ZJVA 1VZ7A 2N1WA 4ICUA 1TBEA 2RDGA 2HJ8A 1E0ZA 3PLUA 2WXPA 3PV1A 4IG7B 4W9FA 4YTPB 3BZDB 3GS2A 3H7PA 2BT6A 3RZWC 2L0FA 3QA8A 1TZOA 2MH7A 4RF1A 4XWWA 5KHQA 2DENB 2D3CA 2G4SA 4LCDE 3AULA 4LNFA 1ZDVA 1GJZA 3W1SC 4ASWC 4K3CA 1BMLC 1XF5L 2YLMA 3MJWA 1ZGUB 3PSEB 4XZ4A 4PS3A 2LJ5A 5IO9A 2PVGC 2FBWB 2XBBC 1FEHA 1I4GA 4DHZE 3UI3A 3DHHC 4WH4A 1F77A 2WDRB 2L00B 3HM6X 4NQLB 1PGXA 1SJHD 2LGXA 1KLUD 2CJNA 2LEKA 1E90A 3BVGA 3Q8EA 2JZZA 1SB3C 2PVOD 2BS4B 1XLQA 1UH6A 2JXXA 2IZVB 2AX5A 2MJDA 2KQSA 4ICVA 2X8XX 4ANVA 1WE7A 4JE3B 4US8A 2K22A 1KLVA 4NNJB 4RMAA 4WJOA 5G5GA 4E74A 4ZYSA 3ZTDA 4N6EB 3IFWB 1ZOYB 4C4VB 1TGZB 1GC7A 1J7BA 1MFWA 3H7SA 4ZRIA 4BVUC 1NYQA 1EF5A 2K1FA 2KK8A 3AE3B 1ZKHA 4NJ7A 2WHIA 2CU3A 2KVRA 1YQ4B 2ICIA 4A3PA 2WYQA 4MH8A 1P3QU 2KJHB 4HRSA 5DPTA 5E6JA 2K0PA 3OAWA 4OVUA 1RFKA 3WAPA 3ZDTA 3DBSA 1IPGA 4ARIA 3E56A 2DAFA 4FHJA 4YT0B 2WDTB 3I63C 1XQQA 4TKNA 3RNEC 1E6EB 2N9KA 2GBKA 1XCQL 4A55A 3ML9A 3QJZA 3BK1A 1FCCC 1WZ0A 4ZRKA 1HA5A 2M19A 4G3XB 5I4DA 2ASQA 1GB4A 3VTVA 4KDLB 1DYQA 4NQKE 1WH3A 3PREA 3N32A 2N7DA 3ALBA 1Q1OA 3DBHI 1C3TA 2KDMA 1PGAA 2MCNB 1WRIA 3HRDD 1QILA 2DX5B 4ZRQA 2IO3B 1OTRB 4WQMA 1XEEA 2M1MA 1WYWB 1HTOA 1LO5D 2FUG1 4M8NA 3ZLZA 3MP9A 3AEGB 1GC6A 2J0MA 2MJ3A 2BKFA 3N20C 4WJPA 2KC2A 5IAAC 4OW0A 2NPTB 2CU1A 3AEFB 4I6PA 1FM0D 4CHKA 5AZGA 1T0QC 3U7DA 4Q2JA 2DZJA 3APFA 3MHZA 4GGQA 2Z59B 1ESFA 1T0YA 2MP2A 3MC8A 3DVNU 2O6VA 3X0WA 4XYCA 3ZXRA 1YJIA 3CIRB 3ZW3A 2AEHA 2WGSA 2QJLA 1ZDXA 3AEDB 3IVFA 2AQ2B 5CHFA 1L0XB 4M01A 4OVVA 1JWMD 3LJ3A 1HZ6A 3IAS1 1D5XC 1F2RC 2MBOA 2FCSA 1I4XA 3NVYA 2INNE 2M56B 2WU5B 1V2YA 3AECB 1VR9A 2CJOA 3UGBB 1E5WA 3BYYB 1B1ZA 2JT4B 2KC1A 4FHKA 4HEA1 2LRWA 4MM3A 1WWTA 2JZ3B 1Y56A 1SIFA 3NS8A 3OWEB 3L13A 1K52A 3ZRCA 3M3JA 2IPKD 1TJEA 3IT6B 2UYZB 2N9EB 3QK0A 1IYFA 3CSTA 4IM2A 4NZLB 2RPQA 5J18A 1UBIA 3PS6A 1E8YA 3ZXVA 1WY8A 4QAYA 3KH0A 3VTUA 3A4SC 4IOIE 3BY4B 2JU6X 4HROA 1EU4A 3M62B 3U7ZA 4URKA 3DVNV 2OJWA 2INPE 2I1KA 4ZRPA 2G1EA 1CQVA 2GLSA 2JPHA 3DHIC 1RFAA 2XEWA 5AUIA 1C78A 2WXKA 2GI9A 1GB1A 2K25A 2MP2B 2WXMA 2O6VB 2C9WB 1V5OA 4ITKA 2AL6A 2NS5A 1UWMA 1FFVA 1Q0WB 1V80A 3PZDA 2VH2A 4C00A 2VRRB 3VVWB 2ZVNA 2KOXA 3DPDA 3NHEB 1ZP0B 1ZXHA 2ZCBA 3UQBA 1F2RI 2H88B 3VUWA 4ZYNA 2PW9A 3T9LA 4FA6A 2ZCCA 4TV3A 4KIKA 3VH3B 3NS1A 5C1ZA 2QDFA 3NUHB 3AEAB 1D5ZC 4XDDA 1J8CA 4B0MA 2ZNVC 4W9LA 2XK5B 1EM7A 1IBXA 2REXA
chains in the Genus database with same CATH topology
3PZ7A 4US9A 5C3JB 1YQ3B 1V1PA 1ROEA 3EGRA 2SAKA 2BB6A 2JZPA 2V0GA 3SFEB 3ZJTA 3T3OA 2ACZB 3AEEB 2ZW0A 1ZE3D 1XLOA 4LK0M 2KQ4X 4OZAA 1HQRD 3BVMA 1JRPA 3R8BA 1F0ZA 2VZKB 3EUB2 3KWVA 4ARCA 2V3NA 2OEDA 4DQOC 2NTTA 1L4DB 4RNAA 2DWQA 2BS3B 2HDEA 1N61A 2YEPB 3LYYA 4C7YA 3GP7A 1I4PA 4OZBA 2KWDA 3KLSX 4RH6A 4EE2A 1AYFA 5EE0A 3FILB 2M0AA 4NJCA 3KWLA 3FC4A 3P4SB 3AN1A 3AMZA 3P4QB 1QOAA 1DGJA 1L0YB 3AE5B 1JWSD 3DWMA 1V1OA 1NVID 3P42A 4D2KA 4YSYB 1SXTA 4C80A 1I4HA 2WDVB 2WXLA 2N0SB 1KFYB 1PGBA 2IGHA 1AN8A 4MT5A 5BMGA 3U4EG 1FCLA 1JWUD 2W54A 1K50A 2Y5CA 1SSNA 3TSSA 2KAJA 1ZXIA 2BW2A 2IJ0A 2BS2B 2N7JA 2PTLA 1C77A 1MHHE 5AUKA 3AE1B 1CJEA 1FFUA 3ZJVA 4L2YA 1VZ7A 1RM6C 1SIJA 2L83A 4HJGE 1K51A 2RDGA 1E0ZA 2WXPA 1T6BX 2DYOA 3V3XA 1I4QA 2IDYA 4WURA 4YTPB 1HEZE 3BZDB 3GS2A 5TSSA 1QOBA 1C79A 1AWDA 1JROA 2BT6A 4PT5A 5H8YE 2IGGA 1TZOA 2FE8A 2MH7A 4RF1A 4XWWA 1SE3A 1KH0A 3AE7B 3TEYA 2L32A 4LLGM 1UUPA 1WSPA 3CWIA 3W5VB 1RWSA 1ZDVA 2LFIA 2J52A 4REZA 4YWGG 2W82A 2ZW1A 1DOIA 5GXGB 3GB1A 4YXDB 1UWXA 1MVKA 2E3TA 1N60A 2N9LA 1FNWA 1J7AA 1C76A 1BMLC 1XF5L 4RGMA 4TQ0A 3AV8A 4KKIA 1CZPA 2K5PA 1QF6A 2PVGC 2FBWB 4TQ1A 1FEHA 3NVZA 1I4GA 1TY0A 3HVZA 2AQ3B 1ENFA 5EE1A 1QQRA 4JWSC 3UI3A 3T3NA 1L5PA 1KTKA 4WH4A 2Y3AA 1F77A 2WDRB 3B2GA 1V1PB 2WP9B 1L6UA 1PGXA 1SJHD 4L1BA 4RGOS 3EA6A 4YTNB 2PLPA 2WXOA 1KLUD 2CJNA 2V4IB 2JSVX 2LEKA 1XLPA 2AQ1B 1GAQB 1XCTL 3BVGA 1V8CA 1ZPSA 3H8HA 1IGCA 4UDUC 2KACA 3LXFA 3Q8EA 1N63A 1JW9D 1SB3C 2PVOD 2DYMA 2BS4B 1XLQA 5LNK1 1TKEA 1YN4A 1L4ZB 2AX5A 2MJDA 1QLBB 1PYWD 4H2AA 1TS4A 4JE3B 4JX1C 3W9CB 2PMVA 2K22A 4MM3B 3TUOA 4US8A 3P4PB 3TEZA 4M0WA 5G5GA 2D5GA 2J42A 4ZYSA 2Y5PA 2J4XA 4N6EB 1WYGA 2V3PA 1JALA 2MEKA 1MPEA 4XDCA 5HFYA 1D4BA 1L6VA 2WS3B 3AE4B 4XWTA 1ZOYB 1C4AA 2RDHA 1TS3A 1J7BA 2Z8LA 2WXRA 2I2YA 4R3DA 1NYQA 3ZGZA 1FD6A 5C2TB 1TKYA 1V97A 3AE3B 4MACA 1OFFA 2YEPF 2I38A 3W2DA 3V05A 2CU3A 3IAM1 1YQ4B 2ICIA 4RCOA 1VZ6A 2L52A 5BYQA 4YSZB 1MI0A 1NENB 3HVDA 4A8XC 1EWCA 2DLBA 4MH8A 2JYEA 1TY2A 1ZUD2 4RF0A 1VZ8A 4HRSA 5E6JA 2K0PA 2PIAA 1JQ4A 3U2SC 4IKGA 2IGDA 2LMCA 4DXGA 4OZCA 3ZYYX 2WXHA 3J9CA 5EE3A 2K3UA 3HUIA 3MFGA 1A70A 2KMMA 1RFKA 3P1MA 4ZOHC 1VLBA 3Q8AA 4ARIA 2BTEA 4B0EA 2DBYA 3E56A 4ZHPA 1WXQA 4YT0B 1OQRA 4P16A 1E6EB 2N9KA 4XE0A 4N59A 1XCQL 4A55A 3IT4B 3L4PA 3TEXA 3BK1A 1FCCC 5JXVA 1KF6B 1HA5A 2M19A 2QMTA 2PKOA 1TYGB 3VRAB 4C7ZA 5I4DA 1GB4A 1SE4A 1DYQA 1EU3A 4HKQA 1YJJA 2QIEB 3BK2A 2KDMA 1QOFA 1SF0A 4L23A 1PGAA 1WRIA 3HRDD 3IXSA 1BUIC 1QILA 4ZRQA 4WQMA 2RMMA 3PZ8A 1XEEA 4JWUC 2LGIA 1LO5D 2E6XA 3NZ3A 2FUG1 1E7PB 1ET6A 2WXJA 3MP9A 3AEGB 4AQ7A 2JWUA 2MJ3A 1IBXB 1QKZA 4RGTA 1I7HA 2QILA 3VR9B 1FO4A 5FR3A 1VRAB 2L1AA 4OW0A 1L0VB 1KRHA 1OQQA 1QOGA 3AEFB 4HKZE 5HI1A 3MC0B 2WXQA 1E9MA 4KX6B 4JPSA 5FK9C 5BMIA 1E10A 3SR6A 2GB1A 1FM0D 2Q5WD 4YSXB 1SE2A 1VDVA 5HG2A 1ET9A 4Q2JA 1J7CA 3MHZA 5BYRA 1ESFA 1HXYD 1K53A 4FXCA 1NEKB 4RFBA 1JWAD 3SFDB 4WWMA 3AH7A 3Q8BA 3W1SA 1YJIA 1M4VA 3CIRB 1PUTA 2QJLA 4GDKB 4CQNA 1ZDXA 3AEDB 1C4PA 3P4RB 1NYRA 5T8IA 2JX5A 2J53A 2AQ2B 1FNUA 1L0XB 2LHEA 4NAWB 2WLBA 1JWMD 2WXNA 1XLNA 1HZ6A 2G9HD 3IAS1 5D7GA 1D5XC 4RGNA 4A90A 1C4CA 1F2RC 3E9SA 3LB8C 3NVYA 1I4XA 3NVWA 2W55A 4TMAB 1TS2A 2INNE 2M56B 5H92C 3BYTB 1AW7A 1R7SA 2WXGA 2WU5B 5D3DA 1UNSA 5BMHA 3AECB 2SEBD 2JXTA 1VR9A 2CJOA 3AE9B 1C9FA 4A6QA 1D5MC 3I57A 3BYYB 1GOZA 4LTUA 1B1ZA 2ONQA 3URYA 4ZHOA 2R61A 3NVVA 2WNMA 3I9V1 3RPFC 1HZ5A 4HEA1 1XO3A 4USAA 1N62A 4GDLB 2WXFA 1FIQA 4DXFA 1WWTA 5BYSA 1QT9A 2WU2B 1Y56A 2WXIA 1T5XD 1YNTE 3OWEB 4AS1A 1K52A 3AE8B 5MPOA 3B2FA 2IPKD 1FXAA 1TJEA 1DOXA 2XN9C 3IT6B 1FNVA 3AM9A 1DOYA 2BB5A 2B76B 2WQYB 1CK1A 2VZKD 1JCKB 1ACCA 2NTSA 3O13A 3ABVB 3MJ5A 4NZLB 2X38A 4TSSA 5G5HA 2MJEA 3DWGC 1GPXA 1D6EC 4O1NA 2TSSA 4N58A 1RYJA 1P7EA 3SEBA 1PFDA 1Q10A 3FILA 1IUEA 3PO0A 3FAHA 4KGRA 1JMLA 5FKAC 1TKGA 4IOIE 1P7FA 2K9XA 3WCQA 2JU6X 2OHFA 3ZQ4A 3U52E 1YN5A 4HROA 1EU4A 3U7ZA 3BIID 1N5XA 4OVZA 1BXTA 1TS5A 2H89B 1XXGA 2INPE 4GLSC 1YN3A 4IDIA 3AE2B 1B9RA 1STEA 3KQ4A 2LJIA 1MHXA 4ZRPA 2G1EA 1CQVA 4YTMB 1T3QA 2XNAC 1SBBB 1VJKA 4KGTA 3AE6B 5AUIA 1C78A 3Q69A 2WXKA 2GI9A 1GB1A 1I4RA 1KLGD 1NI3A 2BBCA 2WXMA 1EWYC 2EKIA 4ITKA 1UGJA 1UWMA 2LHDA 2KN4A 5D3IB 4J3OD 1FFVA 1WGKA 4NAMA 3AEBB 2RPVA 2ON8A 3B9JA 5HHDG 3NRZA 3ETRA 2W3SA 3BVZA 3VRBB 3C8YA 1FRRA 3VQIA 4KKJA 4A9AA 1ZP0B 3N9YC 1ZXHA 4OHJA 4KGSA 2BYTA 2EELA 3BWUD 3Q8CA 1F2RI 2H88B 1IGDA 1FMAD 2PW9A 1PDXA 2QSDA 4WIPA 2JQRB 2LUMA 2WDQB 4C56C 3ZJUA 1JWBD 4WAFA 2JYTA 5EE9A 2W3RA 1YMHE 1SEBD 3R2TA 3VR8B 3RFZB 1N5WA 3TEWA 2QEJC 3NS1A 3R2IA 2HTME 3AB5A 1FRDA 2NMQA 3Q8FA 3NUHB 3AEAB 1SJED 3W5UB 1D5ZC 4XDDA 4B0MA 4P6VF 2GRIA 1FXIA 1EM7A 1IBXA 3P63A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TYG B;  4JWS C;  4US9 A;  3VRA B;  4C7Z A;  2WU2 B;  1L5P A;  1YQ3 B;  5C3J B;  1ROE A;  2WDR B;  3B2G A;  2WP9 B;  3AE8 B;  1L6U A;  5MPO A;  3SFE B;  3B2F A;  2ACZ B;  1YJJ A;  4YTN B;  2CJN A;  3AEE B;  2QIE B;  1FXA A;  1TJE A;  1XLO A;  2LEK A;  1DOX A;  1DOY A;  3AM9 A;  1XLP A;  1GAQ B;  1QOF A;  1SF0 A;  2B76 B;  1V8C A;  1JRP A;  1WRI A;  2WQY B;  3HRD D;  1F0Z A;  3EUB 2;  4WQM A;  3LXF A;  4JWU C;  3ABV B;  1N63 A;  1JW9 D;  1SB3 C;  2PVO D;  2BS4 B;  5G5H A;  2MJE A;  1XLQ A;  3DWG C;  1GPX A;  1TKE A;  2AX5 A;  1E7P B;  1RYJ A;  2DWQ A;  1QLB B;  2BS3 B;  2MJD A;  4N58 A;  1N61 A;  4C7Y A;  1PFD A;  3AEG B;  1IUE A;  3PO0 A;  3W9C B;  4JX1 C;  4US8 A;  2K22 A;  2MJ3 A;  1AYF A;  3FAH A;  3P4P B;  1TKG A;  5EE0 A;  1I7H A;  2K9X A;  3KWL A;  3FC4 A;  3P4S B;  3VR9 B;  3WCQ A;  1FO4 A;  2OHF A;  3AN1 A;  5G5G A;  3AMZ A;  3P4Q B;  1QOA A;  1DGJ A;  4HRO A;  3AE5 B;  1L0V B;  1KRH A;  3BII D;  1OQQ A;  1QOG A;  1N5X A;  1NVI D;  3AEF B;  3DWM A;  4YSY B;  4C80 A;  4KX6 B;  1E9M A;  1E10 A;  2H89 B;  4N6E B;  1WYG A;  1JAL A;  3SR6 A;  4IDI A;  2WDV B;  3AE2 B;  1FM0 D;  1KFY B;  2N0S B;  2Q5W D;  4YSX B;  1B9R A;  1L6V A;  1VDV A;  2G1E A;  2WS3 B;  3AE4 B;  4YTM B;  1T3Q A;  1ZOY B;  1J7C A;  2W54 A;  2Y5C A;  1VJK A;  2KAJ A;  3AE6 B;  1ZXI A;  1J7B A;  5AUI A;  2BS2 B;  4FXC A;  1NEK B;  1JWA D;  3SFD B;  5AUK A;  4WWM A;  1NYQ A;  3AE1 B;  1CJE A;  3AH7 A;  1FFU A;  5C2T B;  1TKY A;  1V97 A;  1RM6 C;  1SIJ A;  1NI3 A;  2L83 A;  1OFF A;  3AE3 B;  1EWY C;  1YJI A;  2EKI A;  4ITK A;  1E0Z A;  3CIR B;  1UWM A;  2CU3 A;  1PUT A;  1YQ4 B;  2QJL A;  3P63 A;  1FFV A;  1WGK A;  3AED B;  2L52 A;  3P4R B;  4YSZ B;  1NYR A;  3AEB B;  1NEN B;  3B9J A;  2JX5 A;  3NRZ A;  4YTP B;  3ETR A;  2W3S A;  2WLB A;  1QOB A;  1ZUD 2;  3VRB B;  4HRS A;  1FRR A;  1XLN A;  1AWD A;  1JRO A;  2BT6 A;  2PIA A;  1JQ4 A;  4A9A A;  1ZP0 B;  5H8Y E;  2MH7 A;  3LB8 C;  3NVY A;  3NVW A;  3ZYY X;  2H88 B;  2W55 A;  3AE7 B;  1FMA D;  5EE3 A;  2M56 B;  5H92 C;  1PDX A;  3HUI A;  2JQR B;  1R7S A;  2WDQ B;  2WU5 B;  1A70 A;  2KMM A;  1RFK A;  3P1M A;  1JWB D;  3AEC B;  3CWI A;  4ZOH C;  3W5V B;  1RWS A;  5EE9 A;  1VLB A;  2W3R A;  2CJO A;  3AE9 B;  3VR8 B;  1DOI A;  5GXG B;  2DBY A;  4YXD B;  4ZHP A;  4LTU A;  1WXQ A;  1N5W A;  4YT0 B;  1OQR A;  2E3T A;  1N60 A;  3NS1 A;  4ZHO A;  3NVV A;  1J7A A;  2HTM E;  3AB5 A;  1FRD A;  3AV8 A;  1E6E B;  3RPF C;  1CZP A;  2K5P A;  3AEA B;  4N59 A;  3W5U B;  1QF6 A;  2PVG C;  2FBW B;  3L4P A;  1XO3 A;  4USA A;  4P6V F;  3NVZ A;  1N62 A;  1FXI A;  1KF6 B;  1FIQ A;  3HVZ A;  1WWT A;  2M19 A;  5EE1 A;  1QT9 A;  2PKO A; 
#chains in the Genus database with same CATH topology
 5JHB A;  1YQ3 B;  1V1P A;  1WE6 A;  5D94 A;  3EGR A;  2SAK A;  2V0G A;  3SFE B;  3S2A A;  2C7N B;  3OLM D;  1ZE3 D;  4DDI D;  4OZA A;  2KAN A;  4PS7 A;  3R8B A;  1F0Z A;  3OJ3 A;  3H9D A;  3UIN B;  3H6N A;  1V9J A;  4BAX A;  3H1U A;  4G11 A;  3LYY A;  3L54 A;  4ZRJ A;  2KWD A;  1AYF A;  2KZR A;  3KWL A;  3RD2 A;  2LVO A;  3P4Q B;  1QOA A;  1V5T A;  4MGK E;  4PS8 A;  4GIV A;  2PEA A;  1A5R A;  2WDV B;  2N0S B;  1KFY B;  3DHG C;  1FCL A;  2KAJ A;  1ZXI A;  2IJ0 A;  3PRM B;  4WJQ A;  2KLG A;  2PTL A;  4F8C B;  1CJE A;  3ZIM A;  4LNO A;  2C7H A;  1HEZ E;  2EMS A;  1QOB A;  1ISN A;  5H8Y E;  2IGG A;  2MW5 A;  1SE3 A;  3Q3N C;  1PQS A;  4LLG M;  1WR6 E;  1WSP A;  2LFI A;  4REZ A;  2ZW1 A;  5GXG B;  3GZN B;  4YXD B;  4KIK B;  1V81 A;  2N9L A;  4FJV B;  1C76 A;  4KZC A;  4KKI A;  3KVF B;  2K5P A;  4M02 A;  4W9E A;  1WGH A;  4W9D A;  3NVZ A;  2AQ3 B;  1ENF A;  5EE1 A;  1V6E A;  1GG3 A;  1L5P A;  3W1Y A;  3A1Q A;  4ANU A;  1KTK A;  1WRD B;  3B2G A;  1V1P B;  2LGS A;  1L6U A;  4RGO S;  2V4I B;  2YVC A;  3B1L X;  1XLP A;  2ZPN A;  1V8C A;  4MEL A;  3H8H A;  3PRP B;  1N63 A;  3NJT A;  3U30 A;  1JW9 D;  4KV2 A;  3V62 A;  1UEL A;  5LNK 1;  3WAL A;  3RN9 C;  2N7E A;  3NY5 A;  2KHW B;  4JX1 C;  4IM3 A;  3TUO A;  4M0W A;  2JF5 A;  4CO7 A;  2N1V A;  3KYC D;  1WYG A;  1JAL A;  4XDC A;  5FR6 A;  1L6V A;  4S17 A;  2J0K A;  3AE4 B;  3PRZ A;  1OEY A;  2J0J A;  2RDH A;  4EZK A;  1TS3 A;  3MTN B;  4R3D A;  4FJZ A;  1FD6 A;  1OFF A;  1LM8 B;  2I38 A;  3V05 A;  3B0A A;  2BYV E;  3C19 A;  1N6Z A;  4RCO A;  1VZ6 A;  4LDT D;  5BYQ A;  1NEN B;  1GUA B;  3HVD A;  4EEW A;  1EWC A;  2DLB A;  3V6C B;  3WAO A;  1TY2 A;  1TZ1 A;  3Q3O C;  1VZ8 A;  3VXW A;  4DHZ B;  3PHX B;  4IKG A;  2IGD A;  2LMC A;  1RRB A;  2WXH A;  5EE3 A;  2K3U A;  2K8C A;  2N9P C;  3HUI A;  4HCP B;  3ZRF A;  4II3 B;  2KMM A;  3P1M A;  3IG3 A;  2PE9 A;  1VLB A;  4B0E A;  2DYB A;  4ZHP A;  2Z0E B;  1WXQ A;  3O65 B;  1OQR A;  2KJR A;  2KXJ A;  1AAR A;  2HD5 B;  2GBN A;  5LLI A;  2QMT A;  3A1Q B;  1S3S G;  3RNB C;  4HKQ A;  1YJJ A;  2MBE A;  2W9N A;  2LUE A;  1QOF A;  1UGM A;  2KTR A;  1Y8R C;  5GMV A;  3IXS A;  1BUI C;  3I5J C;  2LD9 A;  3RMK C;  2KO3 A;  3RZF A;  2E6X A;  3IHP C;  1ET6 A;  2JWU A;  2J7Q B;  4RGT A;  2KMA A;  2L1A A;  2ZEQ A;  1L0V B;  1OQQ A;  1QOG A;  4HKZ E;  1WXA A;  1F52 A;  4JPS A;  2KTF A;  3SR6 A;  2GB1 A;  4LNK A;  4YSX B;  3ZNG C;  4AP4 C;  1WX8 A;  3QIJ A;  3UIO B;  1WM3 A;  4FXC A;  5G55 A;  4DHJ B;  1NEK B;  1JWA D;  3SFD B;  4WWM A;  2L05 A;  3W1S A;  3PPA A;  1PUT A;  4GDK B;  4CQN A;  4G50 A;  3P4R B;  5T8I A;  2V9H A;  2J53 A;  2LHE A;  5CX3 A;  3GE3 C;  2WLB A;  2MSE D;  2KJ6 A;  4PYZ A;  2G9H D;  1WX7 A;  1WZ3 A;  2K8B A;  2M17 A;  3NZS A;  2C5L C;  3E9S A;  2W55 A;  1TS2 A;  3N3K B;  3IBE A;  4K7W A;  1YD8 U;  1AW7 A;  1R7S A;  5D3D A;  1ZW7 A;  2MA9 B;  4EUT A;  1D5M C;  4LTU A;  2BPS A;  2M4N A;  3NVV A;  4M00 A;  2KWC A;  1F9J A;  1HZ5 A;  3DBL B;  1XO3 A;  4USA A;  2V1Y A;  1T0S C;  4DXF A;  2GOW A;  3H7P B;  5BYS A;  1R4M I;  4B95 A;  2KKC A;  2MLB A;  1T5X D;  4GOC A;  4IUM B;  3B2F A;  3WA0 A;  2AYO B;  2EKE C;  2CKH B;  3ML8 A;  2V3S A;  3CF6 E;  2B76 B;  3UIP B;  2WQY B;  1CK1 A;  1JCK B;  1ACC A;  2KTR B;  2D10 A;  3O13 A;  2IO1 B;  2X38 A;  1Q5W B;  3L08 A;  3DWG C;  2JRH A;  1GPX A;  2INC C;  1D6E C;  4N58 A;  1RYJ A;  1P7E A;  5IA7 A;  2K6Q A;  1PFD A;  1Q10 A;  3FIL A;  4KGR A;  5FKA C;  3C0R B;  2K9X A;  3K9O B;  3U52 E;  5EDS A;  1YN5 A;  2N9X A;  4E71 A;  2IY0 B;  4OVZ A;  1TS5 A;  4IW0 A;  2MQJ A;  2DHZ A;  4IDI A;  3ZTC A;  1B9R A;  2LJI A;  2MX2 A;  1T3Q A;  1OGW A;  2IND C;  1SBB B;  1F1H A;  4MSQ B;  2KYW A;  2Y5B B;  2MRP A;  2KX3 A;  2LZ6 A;  5JHA A;  1WJN A;  4P1C C;  1I4R A;  3A9K A;  2BBC A;  1EWY C;  2L76 A;  1P1A A;  1UGJ A;  4FJY A;  5D3I B;  2Z0D B;  5IKC M;  3AEB B;  2GBJ A;  2RPV A;  5HHD G;  3NRZ A;  2FCQ A;  3R7R A;  1HTQ A;  3VRB B;  4NJ6 A;  4KKJ A;  1E8X A;  4ANX A;  3BWU D;  3Q8C A;  1FMA D;  2DZM A;  1WJU A;  5AZF A;  2EMT A;  4PYU A;  2JYT A;  2W3R A;  1WXS A;  3VR8 B;  3DBH B;  3ENE A;  4MSM B;  1N5W A;  3AB5 A;  3Q8F A;  4FBJ B;  3Q2A C;  4JQW C;  1EO6 A;  2LAS A;  3EEC A;  2FCN A;  3P63 A;  3PZ7 A;  2GBR A;  4B9K A;  5D6J B;  2HE7 A;  1MG4 A;  1ROE A;  3U8Z A;  2KWU B;  4AWJ A;  2KD0 A;  3FKY A;  2BB6 A;  2JZP A;  1WM2 A;  2ACZ B;  2D2Q A;  2ZW0 A;  2KDI A;  1XLO A;  3L0W B;  3A9J A;  3TCA A;  4GSW A;  2KQ4 X;  1JRP A;  5AZH A;  2VZK B;  2V3N A;  1D3Z A;  1L4D B;  5CHV C;  4RNA A;  2BS3 B;  2YEP B;  1I4P A;  2MBB B;  4EE2 A;  1VCB A;  4IM0 A;  3GOE A;  2FAZ A;  3FIL B;  3FC4 A;  3P2B A;  3AN1 A;  1JWS D;  3DWM A;  3P42 A;  4KSK C;  4D2K A;  4FLH A;  4WQO B;  1SE9 A;  4AUQ C;  1HE8 A;  4XC2 A;  4MT5 A;  3JYU A;  4W9G A;  2Y5C A;  1EF1 A;  3PGE A;  1KJT A;  2KFK A;  1LGR A;  1YOV B;  5AUK A;  3RUI B;  1FFU A;  2L83 A;  1RM6 C;  4HJG E;  1K51 A;  3V60 A;  2DYO A;  3CSF A;  3V3X A;  1I4Q A;  2IDY A;  2ZVO A;  1T0R C;  5TSS A;  4GDL A;  5TR5 A;  1C79 A;  3HHM A;  3QX1 A;  3T8M A;  4AJW A;  2FE8 A;  4W9I A;  1KH0 A;  2JUO A;  3VDZ A;  1UUP A;  3ZNH B;  4II2 B;  2J52 A;  3TL5 A;  2W82 A;  5IP4 D;  1UWX A;  4IC7 B;  1MVK A;  2E3T A;  2M0X A;  1FNW A;  1J7A A;  4RGM A;  4TQ0 A;  3AV8 A;  1KOT A;  2UWQ A;  3DBR B;  3HVZ A;  4CYE A;  1LXD A;  1QQR A;  4JWS C;  3HM3 A;  3ZDM C;  2Y3A A;  1LFD A;  2K8H A;  1WJ4 A;  4L1B A;  2MHJ A;  2PLP A;  2B3A A;  2JSV X;  1WF9 A;  2RDB C;  4NY0 A;  1GAQ B;  1XCT L;  2R2Q A;  1R4N B;  3A9J B;  4UDU C;  2KAC A;  3LXF A;  3ZNZ B;  1TKE A;  1YN4 A;  2DZK A;  4WJN A;  1PYW D;  4I6N B;  1TS4 A;  3ZNI D;  2PMV A;  4MM3 B;  3P4P B;  3TEZ A;  4DK5 A;  2L0T A;  3QC8 B;  2Y5P A;  1NDD A;  1TIF A;  2ZPY A;  5AEK B;  2GMI C;  2C7M B;  5HFY A;  4F7Z A;  1SGH A;  1C4A A;  4X57 B;  3KUZ A;  1G6J A;  2I2Y A;  5C2T B;  2KFK B;  1TKY A;  1Z5S B;  2DNF A;  4K1R B;  4HLE A;  4BZA A;  4NAW A;  4KVG B;  1MI0 A;  3TMP B;  4W9J A;  2KQ7 A;  4K3B A;  2FCM A;  2RR9 A;  2PIA A;  1JQ4 A;  3U2S C;  4GU2 A;  4DXG A;  2KWV B;  4OZC A;  4P1B C;  3J9C A;  3MFG A;  3D32 A;  1A70 A;  1VD2 A;  4ZOH C;  3KUD B;  1E8Z A;  4S0R A;  4IWO A;  3Q8A A;  3MHS D;  1WI0 A;  3JVZ X;  5J2R A;  1FPY A;  5IN7 A;  3LDZ E;  4P16 A;  5DPR A;  4XE0 A;  4LJP B;  2I1J A;  3IT4 B;  3TBL D;  3TEX A;  3L16 A;  5JXV A;  3KYD D;  2CR5 A;  1GNU A;  4C7Z A;  3VRA B;  1NBF C;  5CTR C;  2K6D B;  2LRU A;  2BF8 B;  2WX0 A;  1M94 A;  2G4D B;  1TTN A;  4DWF A;  2BQQ A;  3BK2 A;  1SF0 A;  1YX6 B;  3N1X C;  4ANW A;  3OG5 A;  4WWP A;  2BWE S;  2RMM A;  3PZ8 A;  3RNC C;  2LGI A;  3N1Z C;  3NZ3 A;  1MG8 A;  2WXJ A;  4BKS D;  1IBX B;  3KUC B;  2BYE A;  2KMC A;  2QIL A;  4MJS A;  3VR9 B;  1FO4 A;  5FR3 A;  2QCZ A;  2RD0 A;  2QC8 A;  1E7V A;  1KRH A;  3MC0 B;  4KX6 B;  5E6O A;  1E10 A;  2CHZ A;  4MGI E;  2Q5W D;  4HPP A;  1SE2 A;  1UD7 A;  1ET9 A;  3SD5 A;  1I35 A;  1E7U A;  3VHT C;  2LGY A;  5BYR A;  3AH7 A;  2BVC A;  3QHT A;  3Q8B A;  2O6V D;  3M95 A;  3Q3J A;  4XGA B;  3BIN A;  1C4P A;  2BGF A;  1NYR A;  4P7I A;  2JX5 A;  1FNU A;  1OQY A;  4NAW B;  2BKR B;  2D3A A;  2WXN A;  1XLN A;  4RGN A;  1C4C A;  1YJ1 A;  3LB8 C;  4NPN A;  3NVW A;  1WXV A;  3BYT B;  2C60 A;  2WXG A;  5BMH A;  1UNS A;  2MWS B;  4HPM B;  2SEB D;  1C9F A;  4A6Q A;  3PLV A;  2ONQ A;  4ZHO A;  2R61 A;  2WNM A;  4GMV A;  3DCG A;  4W9C A;  1UBQ A;  1FIQ A;  2WU2 B;  1KM7 A;  2PE6 B;  1YNT E;  2OOB B;  1FXT B;  5LXH A;  3AE8 B;  2ZJD A;  2FIF A;  1FXA A;  5E6P A;  1WGY A;  1DOY A;  3AM9 A;  4K7U A;  4C4V A;  3QQ8 B;  4TSS A;  2MJE A;  2TSS A;  3MC9 A;  2NBU A;  3SEB A;  3ZVV A;  1IUE A;  3FAH A;  1TKG A;  1P7F A;  2OHF A;  3R66 C;  3DQV A;  3BII D;  4MJS B;  1L2N A;  1BXT A;  4GLS C;  1YN3 A;  3AE2 B;  4EZJ A;  3PVL A;  1WJ6 A;  1WX9 A;  1WR1 A;  4EFO A;  1VJK A;  4KGT A;  2LVP A;  2KN5 A;  1JRU A;  2DZI A;  5C23 A;  2KX0 A;  1P9D U;  4MGZ E;  4NAM A;  1UF0 A;  3EC8 A;  4M0W B;  3AXC A;  2NBW B;  1H4R A;  3B9J A;  3ETR A;  1WFY A;  3BVZ A;  3C8Y A;  3QCA A;  3VQI A;  2KNB A;  4A9A A;  3N9Y C;  5BO4 B;  3V61 A;  1PDX A;  3ZUN A;  2QSD A;  4C56 C;  2JQR B;  2LUM A;  2WDQ B;  4FAD A;  4WAF A;  2D3G A;  4A20 A;  2PPH A;  1CMX B;  1WGR A;  3ZKJ C;  3SDL C;  2NR2 A;  2D07 B;  3R2I A;  2NMQ A;  3L10 B;  1SJE D;  3W5U B;  3VFK A;  3DBL I;  2RGF A;  4WWO A;  4P6V F;  1FXI A;  2GRI A;  3GE8 C;  5C3J B;  1XD3 B;  4DDG D;  2NPT A;  3DVG Y;  4BBN C;  4HDO A;  3ZJT A;  3T3O A;  2HJ1 A;  1XT9 B;  4LJO B;  3RNA C;  4LK0 M;  3L17 A;  4BOZ B;  1HQR D;  3BVM A;  4RM8 A;  2IBI B;  3EUB 2;  4ARC A;  2IO0 B;  5L95 C;  2NTT A;  3QAR A;  4DBG A;  4C7Y A;  3GP7 A;  4OZB A;  4RH6 A;  3RNG C;  1TT5 B;  5DCN A;  3AMZ A;  1DGJ A;  1L0Y B;  1V1O A;  1NVI D;  3K9P B;  1SXT A;  2LVQ A;  2OJR A;  4JIO U;  1I4H A;  1PGB A;  1AN8 A;  3JW0 X;  5BMG A;  3U4E G;  3QWZ B;  1K50 A;  1SSN A;  4HDQ A;  2BWF A;  3DDC B;  3TSS A;  2N7J A;  4W9H A;  1QZE A;  5E6N A;  1MHH E;  1K8R B;  4L2Y A;  1SIJ A;  3VUY A;  3R3M A;  2O2V A;  3Q14 C;  1T6B X;  4IWQ A;  1U4A A;  3Q6B A;  3TIX A;  2WX1 A;  4WUR A;  3VAW A;  3VUX A;  2N4F A;  2V4L A;  1AWD A;  1JRO A;  4PT5 A;  4HXD A;  1R4M B;  3AE7 B;  3TEY A;  2L32 A;  3CWI A;  3EHV A;  3N30 A;  3W5V B;  1RWS A;  4YWG G;  1WXM A;  2R2O A;  1DOI A;  4HPL B;  2JY6 A;  3GB1 A;  2VH1 A;  1N60 A;  1CZP A;  3PHW B;  1QF6 A;  4TQ1 A;  4BKS A;  1TY0 A;  2NBV B;  3T3N A;  2FID A;  4MDK E;  4MEM A;  4KDI C;  2WP9 B;  3B08 A;  3OJ4 B;  3EA6 A;  4YTN B;  2IYD B;  2WXO A;  2LWP A;  2PJH A;  2AQ1 B;  4BOS C;  1P0R A;  1ZPS A;  1IGC A;  3RNF C;  2DYM A;  5KHO A;  1L4Z B;  3CMM B;  1C1Y B;  1QLB B;  2BYF A;  4H2A A;  3W9C B;  3DOW A;  4HJK A;  2D5G A;  3I3T B;  4BBN F;  2J42 A;  4WWN A;  2L3Z A;  2FNJ B;  2J4X A;  2V3P A;  2MEK A;  1MPE A;  1D4B A;  1J19 A;  2WS3 B;  4XWT A;  1YIW A;  2Z8L A;  5J17 A;  4DHJ D;  2WXR A;  2ZZP B;  3WAN A;  3ZGZ A;  1V97 A;  4MAC A;  4HVB A;  2YEP F;  3VTW A;  4KSL C;  3W2D A;  3HK0 A;  3Q3M C;  4BKG A;  2M8S A;  4BKT A;  3IAM 1;  4YL8 A;  2O2V B;  4A3O A;  2L52 A;  4YSZ B;  4EKU A;  1X1M A;  4GB9 A;  4A8X C;  2CS4 A;  2JYE A;  3V6E B;  4DXA B;  3ONS A;  1ZUD 2;  4RF0 A;  2XK5 A;  3ZYY X;  1NI2 A;  2LXA A;  4GN1 A;  3A9K B;  4LNI A;  2BTE A;  2DBY A;  5IOI A;  1LQB A;  1MJD A;  1I42 A;  1EUV B;  4N59 A;  2DAJ A;  3L4P A;  4AJY B;  3AI5 A;  2G3Q B;  3DBR I;  1KF6 B;  2G45 B;  4BFR A;  5DPS A;  4RM9 A;  1YX5 B;  2PKO A;  1TYG B;  2NVU I;  4N9F 4;  4EOY A;  1WGD A;  3A4R A;  1SE4 A;  2JRI B;  1EU3 A;  4K81 A;  1P98 A;  2QIE B;  4L23 A;  4KZ0 A;  3RYT A;  1R4N I;  3EFC A;  3QAQ A;  4JWU C;  4XX5 A;  3APD A;  1V86 A;  1E7P B;  3M63 B;  3WAM A;  4AQ7 A;  1IP9 A;  1QKZ A;  1I7H A;  3NG0 A;  3NZU A;  1VRA B;  3ZO5 B;  3R7Q A;  5HI1 A;  5FK9 C;  2WXQ A;  1E9M A;  1RAX A;  5BMI A;  4PK1 A;  4B6W A;  4I6L B;  5HG2 A;  1VDV A;  1V49 A;  1J7C A;  4M8M A;  4FUL A;  2AWT A;  4HCN B;  1HXY D;  1K53 A;  2CHW A;  4RFB A;  2CHX A;  1WMH A;  4W9K A;  2QHO A;  4TUU A;  1M4V A;  4LDT B;  5JH5 C;  2WWZ A;  4JL9 A;  3DVG X;  1WGG A;  1BT0 A;  5D7G A;  4A90 A;  4TMA B;  2D3B A;  5H92 C;  4F1S A;  2JXT A;  3KW5 B;  3AE9 B;  2KLC A;  3I57 A;  1GOZ A;  3URY A;  3I9V 1;  3RPF C;  2KDB A;  2KDF B;  2LXC A;  1N62 A;  4GDL B;  2WXF A;  1QT9 A;  3APC A;  2WXI A;  4AS1 A;  2GBM A;  5MPO A;  4JLC A;  3RUL A;  2D11 A;  1H8C A;  1DOX A;  5D2M B;  2L7R A;  2XN9 C;  1FNV A;  2BB5 A;  3GZN I;  2LI5 A;  1J0G A;  2VZK D;  2NTS A;  3ABV B;  3MJ5 A;  3UF8 A;  5G5H A;  3Q3F A;  4O1N A;  1L7Y A;  1E8W A;  3PO0 A;  2L8J A;  1JML A;  3UQA A;  3WCQ A;  2LGD A;  2MBQ A;  3ZQ4 A;  2AL3 A;  5CHW A;  3A33 B;  1N5X A;  3AU5 A;  2RSU A;  2H89 B;  1XXG A;  5L83 A;  3JSV A;  1STE A;  3KQ4 A;  1MHX A;  2NCN A;  4YTM B;  4JGH B;  2XNA C;  2KDE B;  3AE6 B;  4AOF A;  3Q69 A;  5DPW A;  2KFJ A;  1RLF A;  1KLG D;  1NI3 A;  1WMH B;  2MBH A;  2HTH A;  2EKI A;  4GXB A;  2LHD A;  2KN4 A;  4J3O D;  1WGK A;  2ON8 A;  3SHQ A;  2A5U A;  3N1Y C;  2W3S A;  1FRR A;  4E3C A;  4OHJ A;  4KGS A;  2BYT A;  4HK2 A;  4ZDV A;  2EEL A;  1Z2M A;  1IGD A;  4MGY E;  4WIP A;  3ZJU A;  1OEY J;  1JWB D;  5EE9 A;  1YMH E;  4HWI B;  1SEB D;  3R2T A;  4FN2 A;  3RFZ B;  2FUH B;  3TEW A;  2KT7 A;  2QEJ C;  2HTM E;  1FRD A;  4LNN A;  2ZNV B;  2UU7 A;  4US9 A;  2KVZ A;  3ECI A;  4EZL A;  1WIA A;  3EFU A;  5HKH A;  4J6I A;  4ACF A;  2JWZ A;  3AEE B;  3RI7 C;  3PTF C;  2A4Z A;  3HIZ A;  3TJP A;  2JVC A;  3PT2 B;  3WIM A;  3KWV A;  2IO2 B;  2OED A;  3RT3 B;  4DQO C;  2K39 A;  2DWQ A;  2HDE A;  1N61 A;  5G2N A;  3KLS X;  4IWP A;  4G0N B;  5EE0 A;  4GDK A;  2M0A A;  4NJC A;  3P4S B;  3RCZ A;  3VH4 B;  3AE5 B;  2IY1 B;  4C80 A;  1S1Q B;  3SU8 X;  4YSY B;  4K7S A;  2WXL A;  2IGH A;  1YQB A;  3JSV B;  4WAA A;  3AU4 A;  1JWU D;  1UZX B;  2W54 A;  3X23 A;  3NOB A;  4MH0 E;  2BW2 A;  2BS2 B;  5LXI B;  1C77 A;  3AE1 B;  5JZE B;  3ZJV A;  1VZ7 A;  2N1W A;  4ICU A;  1TBE A;  2RDG A;  2HJ8 A;  1E0Z A;  3PLU A;  2WXP A;  3PV1 A;  4IG7 B;  4W9F A;  4YTP B;  3BZD B;  3GS2 A;  3H7P A;  2BT6 A;  3RZW C;  2L0F A;  3QA8 A;  1TZO A;  2MH7 A;  4RF1 A;  4XWW A;  5KHQ A;  2DEN B;  2D3C A;  2G4S A;  4LCD E;  3AUL A;  4LNF A;  1ZDV A;  1GJZ A;  3W1S C;  4ASW C;  4K3C A;  1BML C;  1XF5 L;  2YLM A;  3MJW A;  1ZGU B;  3PSE B;  4XZ4 A;  4PS3 A;  2LJ5 A;  5IO9 A;  2PVG C;  2FBW B;  2XBB C;  1FEH A;  1I4G A;  4DHZ E;  3UI3 A;  3DHH C;  4WH4 A;  1F77 A;  2WDR B;  2L00 B;  3HM6 X;  4NQL B;  1PGX A;  1SJH D;  2LGX A;  1KLU D;  2CJN A;  2LEK A;  1E90 A;  3BVG A;  3Q8E A;  2JZZ A;  1SB3 C;  2PVO D;  2BS4 B;  1XLQ A;  1UH6 A;  2JXX A;  2IZV B;  2AX5 A;  2MJD A;  2KQS A;  4ICV A;  2X8X X;  4ANV A;  1WE7 A;  4JE3 B;  4US8 A;  2K22 A;  1KLV A;  4NNJ B;  4RMA A;  4WJO A;  5G5G A;  4E74 A;  4ZYS A;  3ZTD A;  4N6E B;  3IFW B;  1ZOY B;  4C4V B;  1TGZ B;  1GC7 A;  1J7B A;  1MFW A;  3H7S A;  4ZRI A;  4BVU C;  1NYQ A;  1EF5 A;  2K1F A;  2KK8 A;  3AE3 B;  1ZKH A;  4NJ7 A;  2WHI A;  2CU3 A;  2KVR A;  1YQ4 B;  2ICI A;  4A3P A;  2WYQ A;  4MH8 A;  1P3Q U;  2KJH B;  4HRS A;  5DPT A;  5E6J A;  2K0P A;  3OAW A;  4OVU A;  1RFK A;  3WAP A;  3ZDT A;  3DBS A;  1IPG A;  4ARI A;  3E56 A;  2DAF A;  4FHJ A;  4YT0 B;  2WDT B;  3I63 C;  1XQQ A;  4TKN A;  3RNE C;  1E6E B;  2N9K A;  2GBK A;  1XCQ L;  4A55 A;  3ML9 A;  3QJZ A;  3BK1 A;  1FCC C;  1WZ0 A;  4ZRK A;  1HA5 A;  2M19 A;  4G3X B;  5I4D A;  2ASQ A;  1GB4 A;  3VTV A;  4KDL B;  1DYQ A;  4NQK E;  1WH3 A;  3PRE A;  3N32 A;  2N7D A;  3ALB A;  1Q1O A;  3DBH I;  1C3T A;  2KDM A;  1PGA A;  2MCN B;  1WRI A;  3HRD D;  1QIL A;  2DX5 B;  4ZRQ A;  2IO3 B;  1OTR B;  4WQM A;  1XEE A;  2M1M A;  1WYW B;  1HTO A;  1LO5 D;  2FUG 1;  4M8N A;  3ZLZ A;  3MP9 A;  3AEG B;  1GC6 A;  2J0M A;  2MJ3 A;  2BKF A;  3N20 C;  4WJP A;  2KC2 A;  5IAA C;  4OW0 A;  2NPT B;  2CU1 A;  3AEF B;  4I6P A;  1FM0 D;  4CHK A;  5AZG A;  1T0Q C;  3U7D A;  4Q2J A;  2DZJ A;  3APF A;  3MHZ A;  4GGQ A;  2Z59 B;  1ESF A;  1T0Y A;  2MP2 A;  3MC8 A;  3DVN U;  2O6V A;  3X0W A;  4XYC A;  3ZXR A;  1YJI A;  3CIR B;  3ZW3 A;  2AEH A;  2WGS A;  2QJL A;  1ZDX A;  3AED B;  3IVF A;  2AQ2 B;  5CHF A;  1L0X B;  4M01 A;  4OVV A;  1JWM D;  3LJ3 A;  1HZ6 A;  3IAS 1;  1D5X C;  1F2R C;  2MBO A;  2FCS A;  1I4X A;  3NVY A;  2INN E;  2M56 B;  2WU5 B;  1V2Y A;  3AEC B;  1VR9 A;  2CJO A;  3UGB B;  1E5W A;  3BYY B;  1B1Z A;  2JT4 B;  2KC1 A;  4FHK A;  4HEA 1;  2LRW A;  4MM3 A;  1WWT A;  2JZ3 B;  1Y56 A;  1SIF A;  3NS8 A;  3OWE B;  3L13 A;  1K52 A;  3ZRC A;  3M3J A;  2IPK D;  1TJE A;  3IT6 B;  2UYZ B;  2N9E B;  3QK0 A;  1IYF A;  3CST A;  4IM2 A;  4NZL B;  2RPQ A;  5J18 A;  1UBI A;  3PS6 A;  1E8Y A;  3ZXV A;  1WY8 A;  4QAY A;  3KH0 A;  3VTU A;  3A4S C;  4IOI E;  3BY4 B;  2JU6 X;  4HRO A;  1EU4 A;  3M62 B;  3U7Z A;  4URK A;  3DVN V;  2OJW A;  2INP E;  2I1K A;  4ZRP A;  2G1E A;  1CQV A;  2GLS A;  2JPH A;  3DHI C;  1RFA A;  2XEW A;  5AUI A;  1C78 A;  2WXK A;  2GI9 A;  1GB1 A;  2K25 A;  2MP2 B;  2WXM A;  2O6V B;  2C9W B;  1V5O A;  4ITK A;  2AL6 A;  2NS5 A;  1UWM A;  1FFV A;  1Q0W B;  1V80 A;  3PZD A;  2VH2 A;  4C00 A;  2VRR B;  3VVW B;  2ZVN A;  2KOX A;  3DPD A;  3NHE B;  1ZP0 B;  1ZXH A;  2ZCB A;  3UQB A;  1F2R I;  2H88 B;  3VUW A;  4ZYN A;  2PW9 A;  3T9L A;  4FA6 A;  2ZCC A;  4TV3 A;  4KIK A;  3VH3 B;  3NS1 A;  5C1Z A;  2QDF A;  3NUH B;  3AEA B;  1D5Z C;  4XDD A;  1J8C A;  4B0M A;  2ZNV C;  4W9L A;  2XK5 B;  1EM7 A;  1IBX A;  2REX A; 
#chains in the Genus database with same CATH homology
 3PZ7 A;  4US9 A;  5C3J B;  1YQ3 B;  1V1P A;  1ROE A;  3EGR A;  2SAK A;  2BB6 A;  2JZP A;  2V0G A;  3SFE B;  3ZJT A;  3T3O A;  2ACZ B;  3AEE B;  2ZW0 A;  1ZE3 D;  1XLO A;  4LK0 M;  2KQ4 X;  4OZA A;  1HQR D;  3BVM A;  1JRP A;  3R8B A;  1F0Z A;  2VZK B;  3EUB 2;  3KWV A;  4ARC A;  2V3N A;  2OED A;  4DQO C;  2NTT A;  1L4D B;  4RNA A;  2DWQ A;  2BS3 B;  2HDE A;  1N61 A;  2YEP B;  3LYY A;  4C7Y A;  3GP7 A;  1I4P A;  4OZB A;  2KWD A;  3KLS X;  4RH6 A;  4EE2 A;  1AYF A;  5EE0 A;  3FIL B;  2M0A A;  4NJC A;  3KWL A;  3FC4 A;  3P4S B;  3AN1 A;  3AMZ A;  3P4Q B;  1QOA A;  1DGJ A;  1L0Y B;  3AE5 B;  1JWS D;  3DWM A;  1V1O A;  1NVI D;  3P42 A;  4D2K A;  4YSY B;  1SXT A;  4C80 A;  1I4H A;  2WDV B;  2WXL A;  2N0S B;  1KFY B;  1PGB A;  2IGH A;  1AN8 A;  4MT5 A;  5BMG A;  3U4E G;  1FCL A;  1JWU D;  2W54 A;  1K50 A;  2Y5C A;  1SSN A;  3TSS A;  2KAJ A;  1ZXI A;  2BW2 A;  2IJ0 A;  2BS2 B;  2N7J A;  2PTL A;  1C77 A;  1MHH E;  5AUK A;  3AE1 B;  1CJE A;  1FFU A;  3ZJV A;  4L2Y A;  1VZ7 A;  1RM6 C;  1SIJ A;  2L83 A;  4HJG E;  1K51 A;  2RDG A;  1E0Z A;  2WXP A;  1T6B X;  2DYO A;  3V3X A;  1I4Q A;  2IDY A;  4WUR A;  4YTP B;  1HEZ E;  3BZD B;  3GS2 A;  5TSS A;  1QOB A;  1C79 A;  1AWD A;  1JRO A;  2BT6 A;  4PT5 A;  5H8Y E;  2IGG A;  1TZO A;  2FE8 A;  2MH7 A;  4RF1 A;  4XWW A;  1SE3 A;  1KH0 A;  3AE7 B;  3TEY A;  2L32 A;  4LLG M;  1UUP A;  1WSP A;  3CWI A;  3W5V B;  1RWS A;  1ZDV A;  2LFI A;  2J52 A;  4REZ A;  4YWG G;  2W82 A;  2ZW1 A;  1DOI A;  5GXG B;  3GB1 A;  4YXD B;  1UWX A;  1MVK A;  2E3T A;  1N60 A;  2N9L A;  1FNW A;  1J7A A;  1C76 A;  1BML C;  1XF5 L;  4RGM A;  4TQ0 A;  3AV8 A;  4KKI A;  1CZP A;  2K5P A;  1QF6 A;  2PVG C;  2FBW B;  4TQ1 A;  1FEH A;  3NVZ A;  1I4G A;  1TY0 A;  3HVZ A;  2AQ3 B;  1ENF A;  5EE1 A;  1QQR A;  4JWS C;  3UI3 A;  3T3N A;  1L5P A;  1KTK A;  4WH4 A;  2Y3A A;  1F77 A;  2WDR B;  3B2G A;  1V1P B;  2WP9 B;  1L6U A;  1PGX A;  1SJH D;  4L1B A;  4RGO S;  3EA6 A;  4YTN B;  2PLP A;  2WXO A;  1KLU D;  2CJN A;  2V4I B;  2JSV X;  2LEK A;  1XLP A;  2AQ1 B;  1GAQ B;  1XCT L;  3BVG A;  1V8C A;  1ZPS A;  3H8H A;  1IGC A;  4UDU C;  2KAC A;  3LXF A;  3Q8E A;  1N63 A;  1JW9 D;  1SB3 C;  2PVO D;  2DYM A;  2BS4 B;  1XLQ A;  5LNK 1;  1TKE A;  1YN4 A;  1L4Z B;  2AX5 A;  2MJD A;  1QLB B;  1PYW D;  4H2A A;  1TS4 A;  4JE3 B;  4JX1 C;  3W9C B;  2PMV A;  2K22 A;  4MM3 B;  3TUO A;  4US8 A;  3P4P B;  3TEZ A;  4M0W A;  5G5G A;  2D5G A;  2J42 A;  4ZYS A;  2Y5P A;  2J4X A;  4N6E B;  1WYG A;  2V3P A;  1JAL A;  2MEK A;  1MPE A;  4XDC A;  5HFY A;  1D4B A;  1L6V A;  2WS3 B;  3AE4 B;  4XWT A;  1ZOY B;  1C4A A;  2RDH A;  1TS3 A;  1J7B A;  2Z8L A;  2WXR A;  2I2Y A;  4R3D A;  1NYQ A;  3ZGZ A;  1FD6 A;  5C2T B;  1TKY A;  1V97 A;  3AE3 B;  4MAC A;  1OFF A;  2YEP F;  2I38 A;  3W2D A;  3V05 A;  2CU3 A;  3IAM 1;  1YQ4 B;  2ICI A;  4RCO A;  1VZ6 A;  2L52 A;  5BYQ A;  4YSZ B;  1MI0 A;  1NEN B;  3HVD A;  4A8X C;  1EWC A;  2DLB A;  4MH8 A;  2JYE A;  1TY2 A;  1ZUD 2;  4RF0 A;  1VZ8 A;  4HRS A;  5E6J A;  2K0P A;  2PIA A;  1JQ4 A;  3U2S C;  4IKG A;  2IGD A;  2LMC A;  4DXG A;  4OZC A;  3ZYY X;  2WXH A;  3J9C A;  5EE3 A;  2K3U A;  3HUI A;  3MFG A;  1A70 A;  2KMM A;  1RFK A;  3P1M A;  4ZOH C;  1VLB A;  3Q8A A;  4ARI A;  2BTE A;  4B0E A;  2DBY A;  3E56 A;  4ZHP A;  1WXQ A;  4YT0 B;  1OQR A;  4P16 A;  1E6E B;  2N9K A;  4XE0 A;  4N59 A;  1XCQ L;  4A55 A;  3IT4 B;  3L4P A;  3TEX A;  3BK1 A;  1FCC C;  5JXV A;  1KF6 B;  1HA5 A;  2M19 A;  2QMT A;  2PKO A;  1TYG B;  3VRA B;  4C7Z A;  5I4D A;  1GB4 A;  1SE4 A;  1DYQ A;  1EU3 A;  4HKQ A;  1YJJ A;  2QIE B;  3BK2 A;  2KDM A;  1QOF A;  1SF0 A;  4L23 A;  1PGA A;  1WRI A;  3HRD D;  3IXS A;  1BUI C;  1QIL A;  4ZRQ A;  4WQM A;  2RMM A;  3PZ8 A;  1XEE A;  4JWU C;  2LGI A;  1LO5 D;  2E6X A;  3NZ3 A;  2FUG 1;  1E7P B;  1ET6 A;  2WXJ A;  3MP9 A;  3AEG B;  4AQ7 A;  2JWU A;  2MJ3 A;  1IBX B;  1QKZ A;  4RGT A;  1I7H A;  2QIL A;  3VR9 B;  1FO4 A;  5FR3 A;  1VRA B;  2L1A A;  4OW0 A;  1L0V B;  1KRH A;  1OQQ A;  1QOG A;  3AEF B;  4HKZ E;  5HI1 A;  3MC0 B;  2WXQ A;  1E9M A;  4KX6 B;  4JPS A;  5FK9 C;  5BMI A;  1E10 A;  3SR6 A;  2GB1 A;  1FM0 D;  2Q5W D;  4YSX B;  1SE2 A;  1VDV A;  5HG2 A;  1ET9 A;  4Q2J A;  1J7C A;  3MHZ A;  5BYR A;  1ESF A;  1HXY D;  1K53 A;  4FXC A;  1NEK B;  4RFB A;  1JWA D;  3SFD B;  4WWM A;  3AH7 A;  3Q8B A;  3W1S A;  1YJI A;  1M4V A;  3CIR B;  1PUT A;  2QJL A;  4GDK B;  4CQN A;  1ZDX A;  3AED B;  1C4P A;  3P4R B;  1NYR A;  5T8I A;  2JX5 A;  2J53 A;  2AQ2 B;  1FNU A;  1L0X B;  2LHE A;  4NAW B;  2WLB A;  1JWM D;  2WXN A;  1XLN A;  1HZ6 A;  2G9H D;  3IAS 1;  5D7G A;  1D5X C;  4RGN A;  4A90 A;  1C4C A;  1F2R C;  3E9S A;  3LB8 C;  3NVY A;  1I4X A;  3NVW A;  2W55 A;  4TMA B;  1TS2 A;  2INN E;  2M56 B;  5H92 C;  3BYT B;  1AW7 A;  1R7S A;  2WXG A;  2WU5 B;  5D3D A;  1UNS A;  5BMH A;  3AEC B;  2SEB D;  2JXT A;  1VR9 A;  2CJO A;  3AE9 B;  1C9F A;  4A6Q A;  1D5M C;  3I57 A;  3BYY B;  1GOZ A;  4LTU A;  1B1Z A;  2ONQ A;  3URY A;  4ZHO A;  2R61 A;  3NVV A;  2WNM A;  3I9V 1;  3RPF C;  1HZ5 A;  4HEA 1;  1XO3 A;  4USA A;  1N62 A;  4GDL B;  2WXF A;  1FIQ A;  4DXF A;  1WWT A;  5BYS A;  1QT9 A;  2WU2 B;  1Y56 A;  2WXI A;  1T5X D;  1YNT E;  3OWE B;  4AS1 A;  1K52 A;  3AE8 B;  5MPO A;  3B2F A;  2IPK D;  1FXA A;  1TJE A;  1DOX A;  2XN9 C;  3IT6 B;  1FNV A;  3AM9 A;  1DOY A;  2BB5 A;  2B76 B;  2WQY B;  1CK1 A;  2VZK D;  1JCK B;  1ACC A;  2NTS A;  3O13 A;  3ABV B;  3MJ5 A;  4NZL B;  2X38 A;  4TSS A;  5G5H A;  2MJE A;  3DWG C;  1GPX A;  1D6E C;  4O1N A;  2TSS A;  4N58 A;  1RYJ A;  1P7E A;  3SEB A;  1PFD A;  1Q10 A;  3FIL A;  1IUE A;  3PO0 A;  3FAH A;  4KGR A;  1JML A;  5FKA C;  1TKG A;  4IOI E;  1P7F A;  2K9X A;  3WCQ A;  2JU6 X;  2OHF A;  3ZQ4 A;  3U52 E;  1YN5 A;  4HRO A;  1EU4 A;  3U7Z A;  3BII D;  1N5X A;  4OVZ A;  1BXT A;  1TS5 A;  2H89 B;  1XXG A;  2INP E;  4GLS C;  1YN3 A;  4IDI A;  3AE2 B;  1B9R A;  1STE A;  3KQ4 A;  2LJI A;  1MHX A;  4ZRP A;  2G1E A;  1CQV A;  4YTM B;  1T3Q A;  2XNA C;  1SBB B;  1VJK A;  4KGT A;  3AE6 B;  5AUI A;  1C78 A;  3Q69 A;  2WXK A;  2GI9 A;  1GB1 A;  1I4R A;  1KLG D;  1NI3 A;  2BBC A;  2WXM A;  1EWY C;  2EKI A;  4ITK A;  1UGJ A;  1UWM A;  2LHD A;  2KN4 A;  5D3I B;  4J3O D;  1FFV A;  1WGK A;  4NAM A;  3AEB B;  2RPV A;  2ON8 A;  3B9J A;  5HHD G;  3NRZ A;  3ETR A;  2W3S A;  3BVZ A;  3VRB B;  3C8Y A;  1FRR A;  3VQI A;  4KKJ A;  4A9A A;  1ZP0 B;  3N9Y C;  1ZXH A;  4OHJ A;  4KGS A;  2BYT A;  2EEL A;  3BWU D;  3Q8C A;  1F2R I;  2H88 B;  1IGD A;  1FMA D;  2PW9 A;  1PDX A;  2QSD A;  4WIP A;  2JQR B;  2LUM A;  2WDQ B;  4C56 C;  3ZJU A;  1JWB D;  4WAF A;  2JYT A;  5EE9 A;  2W3R A;  1YMH E;  1SEB D;  3R2T A;  3VR8 B;  3RFZ B;  1N5W A;  3TEW A;  2QEJ C;  3NS1 A;  3R2I A;  2HTM E;  3AB5 A;  1FRD A;  2NMQ A;  3Q8F A;  3NUH B;  3AEA B;  1SJE D;  3W5U B;  1D5Z C;  4XDD A;  4B0M A;  4P6V F;  2GRI A;  1FXI A;  1EM7 A;  1IBX A;  3P63 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...