5AUKA

Crystal structure of the ga-substituted ferredoxin
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
96
structure length
96
Chain Sequence
ASYTVKLITPDGESSIECSDDTYILDAAEEAGLDLPYSCRAGACSTCAGKITAGSVDQSDQSFLDDDQIEAGYVLTCVAYPTSDCTIETHKEEDLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferredoxin-1
publication title X-ray Structure and Nuclear Magnetic Resonance Analysis of the Interaction Sites of the Ga-Substituted Cyanobacterial Ferredoxin
pubmed doi rcsb
source organism Synechocystis sp. (strain pcc 6803 / kazusa)
molecule tags Electron transport
total genus 23
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2015-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 5aukA00
4YSXB 1KFYB 2FBWB 2W54A 1WGKA 4YT0B 3B2FA 3AEDB 5AUKA 3WCQA 1JWBD 1FO4A 4LTUA 3W9CB 4FXCA 2BS4B 3AEBB 3AM9A 1ZXIA 5MPOA 1SF0A 2WU5B 4YTPB 4ZHOA 1N5XA 2WDQB 2WLBA 1VLBA 1YJJA 1J7AA 2AX5A 1QLBB 1L5PA 1TKGA 3AH7A 3EUB2 1QOGA 3NVVA 1TYGB 2MH7A 2OHFA 5GXGB 2L83A 1FM0D 1SIJA 2H88B 2EKIA 1RWSA 5H92C 3P4QB 2PVGC 1XO3A 3RPFC 3VRBB 1FMAD 1CJEA 1KF6B 1WWTA 2WS3B 4YSZB 1PFDA 4HRSA 4C80A 3NS1A 3B2GA 3AE7B 1FFVA 3NVZA 1XLNA 3AB5A 4A9AA 1TKEA 1PDXA 3HVZA 3P4SB 1XLPA 2MJ3A 1R7SA 2N0SB 2WP9B 1TKYA 2Y5CA 5EE1A 1JROA 2M56B 1DOXA 2MJDA 3AEEB 3AE2B 2JX5A 1DOYA 4KX6B 3AMZA 1RFKA 2M19A 3AE5B 1V97A 1E10A 2PIAA 1NYRA 1DOIA 4YSYB 4WQMA 1N62A 5G5GA 2ACZB 1YJIA 1JWAD 1OQRA 2K5PA 1GAQB 1XLQA 1JQ4A 4WWMA 3SFEB 1IUEA 4US9A 1E9MA 1V8CA 2WU2B 3BIID 3AV8A 5C2TB 3NRZA 1QOFA 1FRRA 1AWDA 1OFFA 4ITKA 3HRDD 2CJOA 1F0ZA 2L52A 1ROEA 1NYQA 1QOAA 1QF6A 2KMMA 3L4PA 1JALA 2W3RA 1JRPA 3P1MA 3ZYYX 1ZOYB 3KWLA 1NEKB 3NVYA 2WDRB 4P6VF 4N6EB 5AUIA 3AE1B 2DWQA 3HUIA 3P4PB 1SB3C 4C7YA 3SR6A 1KRHA 4HROA 2E3TA 1QT9A 1FXIA 1FFUA 1N60A 1L6UA 1XLOA 4USAA 2CU3A 3NVWA 2JQRB 3CIRB 3CWIA 4JWSC 4YTMB 2LEKA 1VJKA 3AE8B 3AEAB 2PKOA 1FXAA 3AEGB 1L6VA 3B9JA 3AECB 2HTME 3AE4B 2CJNA 2W3SA 1VDVA 1RYJA 1TJEA 1WRIA 2W55A 2WDVB 3AEFB 3PO0A 5EE3A 4US8A 2BS2B 4YXDB 3LXFA 2PVOD 2Q5WD 1EWYC 2KAJA 1NI3A 2QIEB 1E6EB 1UWMA 1NENB 1T3QA 3VR8B 1E0ZA 1JW9D 2B76B 5G5HA 3W5VB 5EE9A 3LB8C 4N58A 1YQ3B 1QOBA 1J7CA 3SFDB 1OQQA 1WXQA 1DGJA 5H8YE 1GPXA 1RM6C 3ABVB 1E7PB 1I7HA 1N5WA 1N61A 3AE3B 2DBYA 4YTNB 3AN1A 1A70A 1ZP0B 3FAHA 4JWUC 1FRDA 1AYFA 4C7ZA 2QJLA 3DWMA 1N63A 4N59A 3VR9B 2BT6A 1YQ4B 5EE0A 1ZUD2 2K9XA 2MJEA 3VRAB 2BS3B 2G1EA 3P4RB 1PUTA 1L0VB 1CZPA 4ZHPA 3DWGC 3P63A 1WYGA 2K22A 5C3JB 4JX1C 3W5UB 3AE6B 4IDIA 2H89B 2WQYB 1NVID 3AE9B 4ZOHC 1B9RA 1J7BA 3ETRA 3FC4A 1FIQA
chains in the Genus database with same CATH superfamily
3DQVA 2N7EA 2C7HA 3AEDB 3MP9A 3RCZA 3PZDA 3ZW3A 4KZCA 4YTPB 4A6QA 4K1RB 4LDTD 3EGRA 3N1YC 1WX8A 4EFOA 2IO0B 4NJ6A 4A3PA 5JXVA 4C80A 3ZRFA 3ZDTA 1YJ1A 2WXMA 4RFBA 2N0SB 1JROA 2DLBA 2PLPA 4IWOA 4RGMA 1AN8A 5CHVC 1XQQA 1CQVA 2JYTA 3R2IA 4A55A 4KZ0A 1MHHE 2WXKA 2LGSA 1JRUA 1Q10A 2ZJDA 2PTLA 3BYYB 5JZEB 2KWUB 1AWDA 2MW5A 1I4QA 1WR1A 2BYEA 2LVQA 2OOBB 1JALA 2V4LA 4II3B 4LLGM 5CHWA 4OVZA 4HPMB 4AWJA 2KQSA 2I1KA 3TEZA 1WMHA 2JQRB 1SIFA 3GZNB 2L7RA 2KQ7A 2AQ3B 4WIPA 3HK0A 3RZWC 5J17A 3Q8AA 2GBMA 2AL6A 4EKUA 2NPTA 2GBRA 2ZVNA 1QKZA 4MJSA 4XWTA 4MEMA 2AQ1B 3TL5A 1I7HA 4LJOB 1TS5A 4HVBA 1KOTA 1WF9A 2JZ3B 3PHXB 1WMHB 1XCTL 2C7MB 3DBHI 4BOSC 4E3CA 1FEHA 2WHIA 3OAWA 4K3BA 4WWOA 1YN3A 2D3GA 3VUYA 3R7QA 4W9FA 2V9HA 2NPTB 4MACA 1P0RA 3KQ4A 5MPOA 2ZNVC 4HPPA 4MJSB 1BT0A 1XXGA 3TBLD 3N9YC 3ZDMC 1TGZB 1ZKHA 3P4QB 4YSZB 1FMAD 1BUIC 2OJWA 4MGYE 1WSPA 1C76A 3H8HA 2X38A 3BVMA 2NBVB 1WFYA 3QA8A 3P4SB 3EC8A 1R7SA 5EE1A 5TR5A 1V2YA 1JWMD 2N4FA 3AMZA 1V97A 2FIFA 1ZGUB 5IOIA 4WQMA 1SE2A 1WR6E 3O65B 2WXIA 4WWMA 2WU2B 2DZMA 2RPVA 2UU7A 2QILA 2BTEA 2L52A 4GGQA 2J42A 2N9LA 3ZIMA 2RDHA 2LUMA 4HROA 4AUQC 4L23A 4XZ4A 4USAA 4KGRA 3S2AA 1YQBA 2PE6B 4YTMB 3DBLB 1P7FA 2ONQA 3Q8BA 3ZJVA 3TCAA 1RYJA 2WDTB 1BMLC 2W82A 2GI9A 1J7CA 3APDA 2LZ6A 4FJVB 1RM6C 3QAQA 1WZ3A 4YTNB 1C9FA 2DYMA 2EMSA 1H4RA 4GIVA 1N63A 3VR9B 4OW0A 4BBNF 3UINB 4MT5A 3TJPA 1WYGA 2IPKD 3JVZX 5L83A 2IJ0A 4LNFA 1B9RA 1E5WA 2O6VA 3WCQA 1FO4A 4BKSD 2ZW0A 4HCNB 2LXAA 2KFJA 3KUZA 4FHJA 3W1SA 4FN2A 3V3XA 1QLBB 4W9IA 4G50A 1L5PA 1YOVB 5EDSA 3Q14C 4PS3A 2REXA 4MELA 5JHAA 1FXTB 4LNOA 3MHSD 3GE8C 4IWPA 4JL9A 4ZRQA 2E6XA 5FR3A 4I6PA 2O6VB 3UF8A 1NYRA 1GB4A 3U7ZA 1WJNA 4BZAA 1JQ4A 3BZDB 3R2TA 1J0GA 1V8CA 2KDBA 1QOFA 3QWZB 1ET6A 1M94A 1ZOYB 3KWLA 1NEKB 3R66C 2KFKA 3L0WB 1OGWA 3SR6A 4ZRJA 3ZNGC 1KJTA 2INCC 3QK0A 2PKOA 1T0SC 2LRUA 2W3SA 2WDVB 3ZJTA 2KZRA 1D6EC 5J18A 1SJED 3GP7A 3DCGA 5D3IB 2BB6A 2UYZB 2KYWA 3TMPB 2N9EB 3KW5B 4XE0A 1G6JA 3OJ4B 2KFKB 5IA7A 1XT9B 1WE6A 2QJLA 3T8MA 4N59A 3MJ5A 2JWUA 2ZNVB 4ARCA 2K9XA 2MJEA 4II2B 1E7VA 4FHKA 1ET9A 1WM3A 3DWGC 4RM8A 4M0WB 3U8ZA 3A4SC 2LHEA 4IDIA 4NJCA 2KNBA 2L05A 3MHZA 4YSXB 4YT0B 1D5XC 3B2FA 3KWVA 4UDUC 3J9CA 3W9CB 3LDZE 3AEBB 1N5XA 1RFAA 3VTUA 3ZTCA 1I42A 1ZXHA 2KC1A 2DAFA 3WAMA 4FJYA 2PVGC 1ZDXA 4GU2A 2YLMA 3KUDB 1P7EA 4JLCA 3DHGC 2GLSA 2WXPA 4PT5A 5JHBA 4E71A 2V0GA 1PYWD 4RMAA 3DPDA 2PIAA 1WGRA 3CSFA 1F2RI 1SGHA 1GAQB 1E7UA 4LNIA 3H6NA 2PPHA 2R2QA 5BMGA 5D2MB 1PGAA 4ARIA 1TY0A 2KMMA 3V62A 4N6EB 1V1PA 4HDQA 3VXWA 5BYQA 2XN9C 4ZYSA 3CIRB 4RF0A 3ZUNA 2QEJC 1KLVA 2INDC 2WX0A 2RMMA 2CJNA 4X57B 1CK1A 3U4EG 4DHZE 2JWZA 3X23A 3RUIB 4IUMB 2MLBA 1V1OA 2KO3A 2RR9A 3OLMD 3NZSA 3KLSX 1AARA 1MG4A 4AS1A 2JPHA 3AN1A 2Y5BB 2RDGA 1GB1A 2KC2A 2ZEQA 2BB5A 1ZP0B 5TSSA 1C79A 1V1PB 3PT2B 1UBIA 2ZW1A 1WX9A 2CU1A 2ZCBA 4JX1C 3W5UB 3MC0B 3RNCC 1V86A 1J7BA 2D3CA 3FC4A 1FIQA 3FKYA 1ZE3D 3L54A 5C23A 3R7RA 4PYUA 2BS4B 1TS3A 2JYEA 3A33B 1YN5A 3GB1A 4XWWA 2H88B 1R4NI 1RWSA 5IP4D 3KYDD 3EFUA 2D5GA 2ZZPB 2CKHB 1STEA 3ZJUA 2IGGA 4ASWC 4OHJA 1TKYA 4WWPA 2JSVX 1DOXA 1T5XD 2AEHA 3DOWA 2DZIA 2O6VD 4WWNA 3MTNB 1WGGA 4FADA 1SE4A 2MBBB 5DPSA 1K51A 2UWQA 1C4AA 2DAJA 2HE7A 3HRDD 4MSMB 2BPSA 3H7SA 1JRPA 2KN4A 2VH2A 4GLSC 1KLGD 2G9HD 4KIKA 4JQWC 3L08A 3I57A 2L3ZA 1WGYA 2LMCA 4DXGA 2FCMA 2SAKA 1VJKA 5KHOA 3AU4A 2BF8B 2PJHA 2J53A 2M4NA 2VZKB 4XC2A 2NTSA 4MM3A 2KAJA 1NI3A 3PZ8A 2DX5B 2BW2A 3E56A 3LB8C 4ZRKA 2QDFA 4W9KA 3UQAA 3APFA 1WY8A 2NCNA 4RGTA 4DQOC 4C7ZA 2KLCA 4GDLA 4KIKB 1YQ4B 1TBEA 3QQ8B 1KH0A 2NVUI 4GSWA 3AE9B 4ZOHC 3KUCB 4WURA 2KT7A 2IYDB 4MM3B 3BY4B 3IT4B 4LTUA 4IC7B 1F52A 1E8YA 4I6NB 2K0PA 1JWSD 3AM9A 3UGBB 1ISNA 1HZ5A 1Q1OA 2WLBA 5BMHA 2XBBC 5C1ZA 1J8CA 4C00A 1YX5B 3KYCD 4GDLB 3ZNHB 1E90A 4M00A 3IXSA 3V6CB 2AQ2B 1PDXA 1RRBA 2EKEC 4BAXA 3V61A 4EZKA 3A1QB 4YWGG 1MPEA 3ZKJC 2EMTA 3SD5A 4AOFA 5IO9A 1IUEA 4KVGB 2IGDA 1SEBD 4J6IA 1WZ0A 1ROEA 1P9DU 3L4PA 4O1NA 3T9LA 2BKFA 4B6WA 1ACCA 1QT9A 2KWDA 2BVCA 1K53A 4W9CA 1FXAA 2CHZA 4AJYB 5IN7A 1UBQA 2KX3A 4RGOS 1MI0A 4TQ0A 3L16A 5FKAC 3ZXRA 4DBGA 3MC9A 1YMHE 1T3QA 1YN4A 4JE3B 3W5VB 1P98A 1LQBA 1WXQA 2TSSA 2MX2A 5BYSA 1E7PB 2K6QA 1V6EA 2DBYA 3Q8EA 2B3AA 2KOXA 1GC7A 4S0RA 2K39A 1LM8B 2L0FA 3P4RB 3HHMA 4WJOA 1LXDA 2MSED 3N20C 3GE3C 4HKZE 3RNGC 2MBEA 1LGRA 2FBWB 2XK5A 3TUOA 2BYVE 2JZPA 1HXYD 2C7NB 1L2NA 1ZXIA 2N9PC 3RYTA 3H9DA 3VHTC 1IPGA 4LNNA 3UI3A 2MEKA 2N7DA 3AXCA 1MJDA 3DBRI 2QCZA 2EKIA 3IVFA 3AULA 2FUG1 3IT6B 3NS8A 2I1JA 2FNJB 2DYBA 2WP9B 1GG3A 1OQYA 3N1ZC 1SXTA 1FPYA 2XK5B 3BK1A 3EFCA 3ZQ4A 2KDEB 1WH3A 3NZUA 3BIID 2M0AA 5C2TB 2K25A 4MGZE 2NMQA 3SDLC 1FD6A 2V4IB 2IZVB 3W1YA 1TS4A 3P1MA 5AUIA 2LJIA 2QHOA 3OJ3A 4WQOB 1KRHA 1D3ZA 4KKJA 5DPRA 1N60A 3DBSA 2CU3A 3DHHC 3CWIA 2LFIA 2LEKA 4P1BC 1UGMA 4F8CB 2HTME 1VRAB 3LXFA 3DDCB 1B1ZA 2VZKD 2GBJA 4KDLB 2GBKA 2XNAC 1KM7A 5EE9A 4KGTA 1UWXA 4C4VB 4KKIA 2WYQA 4IM2A 4N9F4 4JWUC 2MRPA 1EO6A 3DWMA 2KDFB 3P2BA 2AL3A 1ZW7A 4F1SA 3VRAB 1Z5SB 2INPE 1PUTA 4TSSA 2KHWB 1I35A 5HI1A 4WJNA 1GC6A 5AZFA 1SSNA 3RULA 2L00B 2M0XA 3ETRA 3NG0A 1WGKA 3GS2A 5DPTA 2BYFA 4REZA 2QC8A 3K9PB 4OZAA 3VDZA 2GBNA 3EUB2 3VTWA 3NVVA 4IG7B 1E8WA 4XGAB 3WALA 3RNAC 4DWFA 3AE7B 1FFVA 2DENB 4A9AA 3IG3A 2QSDA 3NZ3A 2MJ3A 5LXIB 1HTQA 3DVGX 1R4MI 2M56B 2MJDA 3AE2B 4B95A 1T0YA 4XX5A 3ML9A 3BVZA 4YSYB 4H2AA 1FCLA 3H1UA 1V5OA 4DDGD 1JWUD 1FNVA 3AU5A 3AV8A 4S17A 3O13A 2JRHA 4NY0A 1HTOA 2J0MA 4DK5A 1K8RB 2W3RA 2WDRB 4DHJB 3PHWB 1FXIA 1K50A 5BMIA 3B1LX 3AEAB 3AE8B 2QMTA 5CTRC 1Y56A 1SE3A 4RNAA 3L13A 1WYWB 1PQSA 1IYFA 2LD9A 2LGXA 2V3PA 2N1VA 1UNSA 4XDCA 3JW0X 4MSQB 1HQRD 1OEYA 4N58A 4M8NA 4MH0E 3SFDB 3RT3B 1GUAB 1HE8A 3ZNZB 2DYOA 2MBQA 1A70A 3IHPC 1NBFC 2J7QB 1JMLA 4MGKE 2PMVA 1X1MA 4W9DA 5EE0A 4M0WA 3BWUD 4IM0A 3P63A 3DHIC 5C3JB 2RD0A 2HDEA 1KLUD 3AE6B 4CQNA 2C9WB 1KFYB 2KXJA 1HZ6A 3PREA 5E6NA 3T3NA 2KN5A 4XYCA 1YJJA 4B0EA 2MQJA 2KMAA 2MH7A 2KKCA 4IOIE 1SIJA 2MBHA 4QAYA 3NY5A 4HRSA 3NS1A 4DXAB 3PGEA 1YX6B 1YNTE 4NQLB 2D3BA 2JX5A 2KDMA 3PVLA 4HJKA 1WXSA 2ZPYA 3VH3B 4G11A 1N6ZA 1WGHA 1J19A 2NBUA 2BBCA 1SBBB 4HWIB 4P7IA 1GJZA 3ALBA 3RZFA 3NRZA 1OFFA 5I4DA 1QZEA 4P16A 3DBHB 2K1FA 4NNJB 2HJ8A 2KDIA 3AE1B 3P4PB 2V3SA 2WWZA 1L7YA 4TKNA 2KLGA 1EU3A 3B9JA 2LI5A 2X8XX 3GOEA 5E6OA 2O2VA 2W55A 5EE3A 1SE9A 5E6PA 3BYTB 3A9JA 5T8IA 2W9NA 3Q69A 1N61A 1YIWA 3Q8FA 4MDKE 1VR9A 4W9GA 2I38A 2J0JA 3CMMB 4IKGA 3M63B 3R3MA 1DYQA 4RF1A 1QQRA 2JRIB 3QCAA 2YVCA 3LYYA 5LXHA 2IO2B 2O2VB 2JXXA 3U52E 2K3UA 2Z59B 4FA6A 1UH6A 2W54A 4B0MA 5AUKA 4C56C 1D5ZC 2A4ZA 2JU6X 3A9JB 3GZNI 2G4DB 4LNKA 3RNBC 1YD8U 2Z0DB 5GXGB 1LO5D 1F2RC 1V80A 2K8BA 2KMCA 3PLUA 4PS7A 4BFRA 2KWVB 4XDDA 2WXNA 2WS3B 3AB5A 5DPWA 1VZ7A 4K81A 5FR6A 1GNUA 2FCQA 3JSVA 3AE5B 2D10A 2K8CA 1WJ4A 5IKCM 3OG5A 3DVGY 3NOBA 1YJIA 1EF1A 1OQRA 2KK8A 1MVKA 2V3NA 2DHZA 1VZ8A 2WGSA 3C0RB 1IBXA 2HD5B 4RCOA 4IWQA 5DCNA 3FILA 4JGHB 2N9KA 2IBIB 4BOZB 1XLOA 4DHJD 5G2NA 4EOYA 3JSVB 2LVPA 2Y5PA 4P1CC 1WRIA 4US8A 4YXDB 2Q5WD 2LHDA 1WXVA 4NAWA 1UWMA 3BVGA 2WXJA 4K3CA 3CF6E 1IBXB 1N5WA 3AE3B 2CR5A 3FILB 1WXAA 1D5MC 1EM7A 1UD7A 2J0KA 2LGDA 2BT6A 3IBEA 4CO7A 1UELA 2RGFA 5E6JA 2K22A 3RD2A 3KVFB 4HCPB 1KTKA 2L76A 3BK2A 5AZHA 4TUUA 3Q3MC 4NAWB 1I4GA 1JWBD 3DBLI 4YL8A 4D2KA 2N1WA 4ANXA 2FUHB 3L10B 3ZRCA 3QIJA 1BXTA 3IFWB 3A9KA 2LJ5A 1QOGA 2JY6A 3I3TB 4K7SA 3ZLZA 3QHTA 5FK9C 3TEXA 1WWTA 1UZXB 5AZGA 2D11A 3A1QA 3MJWA 3U2SC 1M4VA 1XLPA 2G45B 5LNK1 1NDDA 1F9JA 1MHXA 2A5UA 2WXLA 3BINA 1E8XA 5JH5C 4AP4C 4GB9A 1MFWA 2LASA 5BO4B 3A9KB 4ZRPA 4ITKA 2CJOA 1QF6A 4P6VF 4TMAB 4BKTA 1I4HA 2E3TA 3DVNV 1L6UA 2ON8A 4AJWA 4LCDE 3RFZB 1V5TA 3W2DA 1EU4A 4RGNA 4ZHOA 2IY1B 3URYA 2L1AA 1OTRB 1NENB 3VR8B 1FCCC 4EE2A 4J3OD 1YQ3B 3Q6BA 2C5LC 5H8YE 3N32A 3VUXA 4ANVA 2INNE 2MWSB 4ANUA 1EF5A 2D2QA 1ZUD2 3VAWA 5D94A 3Q8CA 1MG8A 2KVRA 1Y8RC 4PK1A 1NI2A 1C77A 3N3KB 4TV3A 5D7GA 2EELA 2R61A 1C4PA 4OZCA 1SJHD 4A8XC 3ZVVA 2GOWA 5H92C 1PFDA 2KTRA 1XLNA 1TKEA 4OZBA 3AEEB 4DDID 3WIMA 4I6LB 3EA6A 2MBOA 3W1SC 2IDYA 4OVVA 5CHFA 2AWTA 3NUHB 2PEAA 2WXFA 2L8JA 3VQIA 2ICIA 4US9A 3TIXA 1L4DB 1FRRA 3V6EB 2LVOA 5LLIA 1WM2A 3PPAA 4RH6A 4HXDA 2KTRB 2MA9B 2WNMA 4HJGE 3PRMB 3NVWA 4IW0A 1CMXB 3V60A 3ZTDA 1L6VA 1WRDB 4BBNC 1ESFA 4BVUC 4ACFA 1HA5A 1EWYC 2ZPNA 4RM9A 2BYTA 4C4VA 1R4NB 4GDKA 4KSLC 3C19A 3PLVA 3N1XC 4MGIE 4JIOU 4OVUA 2YEPF 3FAHA 1UGJA 3RN9C 3UIOB 2BQQA 4KGSA 3APCA 2Z8LA 4ZYNA 3WA0A 3VH4B 3DVNU 4EZJA 1K52A 4KSKC 4CHKA 2D3AA 1Z2MA 4M8MA 1TTNA 3VTVA 1V49A 3RI7C 1VD2A 3UQBA 3HM6X 3TSSA 4GDKB 1XD3B 2VRRB 3SHQA 4GOCA 4AQ7A 1Q0WB 4G3XB 2M1MA 1FM0D 1I4RA 2N9XA 5HFYA 3KH0A 1XO3A 1CJEA 2KJHB 3VUWA 4K7UA 3HVZA 5D6JB 1XCQL 2IO1B 1T6BX 3M95A 1LFDA 4KX6B 3M62B 1WGDA 2M19A 2ACZB 3ZGZA 3TEWA 2K5PA 4GXBA 5AEKB 1IGDA 4A20A 3QJZA 3SFEB 1E9MA 4B9KA 3QC8B 1T0RC 3RNEC 4HPLB 3Q3NC 2K6DB 3M3JA 2DWQA 2J52A 3AI5A 4K7WA 1WI0A 2JUOA 1D4BA 2YEPB 2G3QB 1FNUA 1VDVA 3PO0A 1VCBA 2JF5A 3VVWB 3PV1A 1E6EB 2B76B 3RNFC 5G5HA 1WJ6A 1IGCA 2L32A 1QOBA 2AYOB 1OQQA 3CSTA 1DGJA 1F1HA 4A3OA 2M17A 2M8SA 3I5JC 5HG2A 2KWCA 3PSEB 1FRDA 1AYFA 1U4AA 2BGFA 2LUEA 4HKQA 4HEA1 1L0VB 3V05A 1EWCA 2G4SA 2KJ6A 2NBWB 2PW9A 3QX1A 2ASQA 1NVID 1V81A 1XEEA 2CHWA 4FXCA 3MC8A 1SF0A 4CYEA 2WDQB 3SU8X 1WXMA 2WXGA 3PZ7A 4A90A 3RPFC 3VRBB 1PGBA 1C3TA 1XF5L 3X0WA 4G0NB 2SEBD 3NVZA 1JCKB 3Q2AC 1GOZA 3H7PA 2Z0EB 3T3OA 1P1AA 4ICVA 2GMIC 3EECA 1N62A 3Q3FA 2NTTA 3NHEB 1RAXA 1H8CA 2NR2A 2JT4B 2PE9A 1WIAA 4W9JA 4NQKE 1QILA 1TY2A 3PRZA 1NYQA 1TIFA 2ZVOA 2RPQA 3OWEB 2LXCA 3NVYA 4PS8A 4C7YA 4ZDVA 4MH8A 2KJRA 3K9OB 1VZ6A 2NS5A 3H7PB 4HDOA 4WJPA 5HHDG 2IO3B 2MHJA 2OEDA 3AE4B 4WAFA 1S3SG 2Y3AA 2FIDA 3DBRB 4F7ZA 2HTHA 1UUPA 4FULA 1GPXA 2GRIA 2KANA 4KDIC 3PRPB 3MFGA 3PS6A 3NJTA 1TZOA 2WXHA 2BS3B 3HM3A 3L17A 3VFKA 4BKGA 4TQ1A 4ZHPA 1CZPA 4IM3A 3B0AA 3LJ3A 2JVCA 2KTFA 2FE8A 2KD0A 1PGXA 3EHVA 1S1QB 2OJRA 4GN1A 5IAAC 1I4PA 4LDTB 3R8BA 1VLBA 1L0XB 1TKGA 3AH7A 1TYGB 2OHFA 1AW7A 1T0QC 2WX1A 2L83A 1WJUA 2LRWA 3WAPA 1KF6B 3UIPB 3P42A 3B2GA 1TZ1A 4KV2A 2KACA 2KX0A 2FAZA 1DOYA 1L0YB 1RFKA 2DNFA 5G5GA 1JWAD 1XLQA 2VH1A 5GMVA 1OEYJ 4HLEA 1F0ZA 3IAM1 3C8YA 4NZLB 4GMVA 5KHQA 2RSUA 2MP2A 4Q2JA 3ECIA 2BKRB 3HUIA 4M01A 4URKA 4NPNA 4ANWA 2FCNA 2LGIA 4FBJB 4E74A 4EUTA 3AEGB 2C60A 3AEFB 3ENEA 1HEZE 2BS2B 1IP9A 2PVOD 4EEWA 3U7DA 3WANA 4WAAA 3B08A 2R2OA 2XEWA 1ENFA 4EZLA 4LJPB 3A4RA 2N7JA 4DHZB 1L4ZB 2KVZA 2MP2B 5BYRA 5J2RA 1RLFA 1R4MB 2V1YA 5HKHA 1FNWA 4M02A 2D07B 4NAMA 2LWPA 4DXFA 2DZJA 4WJQA 2WXOA 3E9SA 2RDBC 4W9LA 3ZNID 1WE7A 2WU5B 2I2YA 2KQ4X 3IAS1 4NJ7A 2AX5A 1J7AA 3PTFC 1UF0A 3SEBA 2WXRA 1TT5B 1WX7A 4L1BA 4LK0M 2WXQA 3JYUA 2J4XA 2FCSA 1I4XA 3QARA 3RMKC 2Y5CA 3Q3JA 2CHXA 4W9EA 3U30A 1E10A 1DOIA 2DZKA 4W9HA 2IGHA 4JPSA 3N30A 1C1YB 2BWFA 1C4CA 1F77A 4FLHA 1E8ZA 1QOAA 3ONSA 4L2YA 5G55A 4WH4A 5CX3A 3ZYYX 2BWES 1SB3C 1A5RA 5L95C 1FFUA 4HK2A 4R3DA 2JZZA 4JWSC 3WAOA 2IY0B 3HVDA 3Q3OC 3ZXVA 3AECB 1TJEA 2K8HA 4BKSA 2GB1A 2QIEB 1E0ZA 1JW9D 4PYZA 3ZO5B 3I63C 2L0TA 3TEYA 3ABVB 1TS2A 1P3QU 1V9JA 4FJZA 4ICUA 2CS4A 2HJ1A 5D3DA 3ML8A 3D32A 2MCNB 3HIZA 2G1EA 1ZPSA 2JXTA 1EUVB 2ZCCA 4ZRIA 1Q5WB 2H89B 1ZDVA 2LGYA 2WQYB 3I9V1 1C78A
chains in the Genus database with same CATH topology
1KFYB 1ZE3D 3AEDB 3MP9A 1HZ6A 2BS4B 3T3NA 1TS3A 2JYEA 4GDKB 4YTPB 3TSSA 4A6QA 4AQ7A 1YJJA 3EGRA 4B0EA 1YN5A 2MH7A 3GB1A 1FM0D 4IOIE 1I4RA 4XWWA 1SIJA 2H88B 5HFYA 1RWSA 1XO3A 1CJEA 2D5GA 5JXVA 4HRSA 4C80A 3NS1A 1STEA 3ZJUA 2IGGA 2WXMA 1YNTE 3HVZA 4RFBA 1XCQL 2N0SB 4OHJA 1TKYA 1JROA 2JSVX 1T6BX 2DLBA 2PLPA 1DOXA 1T5XD 2JX5A 2KDMA 1AN8A 4KX6B 4RGMA 2M19A 1CQVA 2JYTA 3R2IA 4A55A 2ACZB 3ZGZA 3TEWA 2K5PA 1MHHE 1IGDA 2WXKA 3SFEB 1SE4A 2BBCA 1SBBB 1Q10A 1E9MA 1K51A 1C4AA 2PTLA 3BYYB 3NRZA 1AWDA 1OFFA 5I4DA 3HRDD 1I4QA 4P16A 1JALA 1JRPA 2KN4A 4GLSC 3AE1B 1KLGD 2DWQA 2G9HD 3P4PB 4LLGM 2J52A 4OVZA 3I57A 3TEZA 2LMCA 4DXGA 2JQRB 2SAKA 1VJKA 1D4BA 2YEPB 1FNUA 3B9JA 1EU3A 1VDVA 2W55A 2VZKB 2AQ3B 2J53A 3PO0A 4WIPA 5EE3A 2NTSA 2KAJA 1NI3A 3PZ8A 3Q8AA 1E6EB 3BYTB 2B76B 2BW2A 5G5HA 3E56A 1IGCA 2L32A 3LB8C 5T8IA 1QOBA 1QKZA 4XWTA 1OQQA 1DGJA 2AQ1B 3Q69A 1I7HA 1N61A 5HG2A 4RGTA 1TS5A 3Q8FA 4DQOC 1VR9A 1FRDA 1AYFA 4C7ZA 2I38A 4HKQA 4IKGA 1YQ4B 1DYQA 4RF1A 1QQRA 4HEA1 1XCTL 1L0VB 3V05A 1EWCA 1FEHA 2PW9A 1KH0A 3LYYA 1NVID 3AE9B 4ZOHC 1XEEA 4WURA 3U52E 2K3UA 4MM3B 2W54A 4B0MA 1YN3A 5AUKA 4C56C 1D5ZC 3IT4B 4LTUA 2JU6X 4FXCA 2K0PA 1JWSD 3AM9A 3KQ4A 1SF0A 4MACA 5MPOA 2WDQB 1HZ5A 5BMHA 2WLBA 1XXGA 2WXGA 3N9YC 5GXGB 1LO5D 1F2RC 3PZ7A 4A90A 4GDLB 4XDDA 3RPFC 3P4QB 3VRBB 2WXNA 4YSZB 1FMAD 2WS3B 1BUIC 1PGBA 1WSPA 1C76A 1XF5L 3H8HA 2SEBD 3NVZA 2X38A 1JCKB 2AQ2B 3AB5A 3BVMA 3IXSA 1VZ7A 1GOZA 1PDXA 3P4SB 1R7SA 5EE1A 4YWGG 3T3OA 1MPEA 1JWMD 3AMZA 3AE5B 1V97A 4WQMA 1N62A 2NTTA 1YJIA 1OQRA 1SE2A 1MVKA 2V3NA 2WXIA 4WWMA 1IUEA 2WU2B 1VZ8A 2IGDA 1SEBD 2RPVA 2QILA 1IBXA 1QILA 4RCOA 2BTEA 2L52A 1TY2A 1ROEA 1NYQA 3L4PA 3OWEB 3FILA 3NVYA 2J42A 4O1NA 2N9LA 2N9KA 2RDHA 4C7YA 2LUMA 4MH8A 4HROA 1ACCA 1QT9A 2KWDA 4L23A 1VZ6A 1XLOA 4USAA 4KGRA 1K53A 4YTMB 5HHDG 1FXAA 1P7FA 2ONQA 3Q8BA 3ZJVA 2Y5PA 2OEDA 3AE4B 4RGOS 4TQ0A 1MI0A 1RYJA 1WRIA 4WAFA 4US8A 5FKAC 1BMLC 4YXDB 2Y3AA 2Q5WD 2LHDA 2W82A 1YMHE 1UWMA 3BVGA 1T3QA 1YN4A 4JE3B 3W5VB 2GI9A 2WXJA 1J7CA 1UUPA 1WXQA 2TSSA 1GPXA 5BYSA 1RM6C 2GRIA 1E7PB 1IBXB 1N5WA 3AE3B 2DBYA 3Q8EA 4YTNB 1C9FA 2DYMA 3FILB 1D5MC 1EM7A 3MFGA 1N63A 3VR9B 4OW0A 2BT6A 1TZOA 2WXHA 2BS3B 3P4RB 4TQ1A 4ZHPA 1CZPA 4MT5A 5E6JA 1WYGA 2K22A 2IPKD 4HKZE 2FE8A 2IJ0A 1KTKA 3BK2A 1B9RA 1PGXA 2FBWB 3TUOA 3WCQA 4NAWB 1I4GA 1JWBD 1FO4A 2JZPA 2ZW0A 4D2KA 1HXYD 1ZXIA 1I4PA 3R8BA 3W1SA 1BXTA 1VLBA 1L0XB 3UI3A 3V3XA 1QLBB 1L5PA 1TKGA 2MEKA 3AH7A 1QOGA 1TYGB 2OHFA 1AW7A 2L83A 5FK9C 3TEXA 2EKIA 1KF6B 1WWTA 3P42A 3B2GA 2FUG1 3IT6B 3U2SC 1M4VA 1XLPA 5LNK1 2WP9B 4ZRQA 2KACA 2E6XA 5FR3A 1DOYA 1MHXA 1L0YB 1SXTA 1RFKA 2WXLA 1NYRA 3BK1A 3ZQ4A 5G5GA 1GB4A 3U7ZA 1JWAD 1XLQA 1JQ4A 3BZDB 3R2TA 1V8CA 3BIID 2M0AA 5C2TB 1QOFA 4ZRPA 2NMQA 4ITKA 1ET6A 2CJOA 1F0ZA 1FD6A 2V4IB 1QF6A 3IAM1 3C8YA 1TS4A 4NZLB 3P1MA 1ZOYB 3KWLA 1NEKB 4Q2JA 5AUIA 4P6VF 2LJIA 4TMAB 3HUIA 1I4HA 3SR6A 1KRHA 4KKJA 2E3TA 1N60A 1L6UA 2ON8A 2CU3A 2LGIA 3CWIA 2LFIA 2LEKA 3RFZB 2PKOA 3AEGB 3W2DA 1EU4A 2HTME 4RGNA 4ZHOA 2W3SA 3AEFB 1VRAB 1HEZE 2WDVB 3ZJTA 2BS2B 3URYA 3LXFA 2PVOD 2L1AA 1B1ZA 2VZKD 1D6EC 1NENB 3VR8B 1SJED 2XNAC 1FCCC 3GP7A 5EE9A 4EE2A 4J3OD 1YQ3B 4KGTA 5D3IB 1ENFA 2BB6A 5H8YE 1UWXA 2N7JA 4KKIA 4XE0A 1L4ZB 4JWUC 2INNE 5BYRA 2QJLA 3DWMA 4N59A 2JWUA 3MJ5A 4ARCA 1FNWA 1ZUD2 2K9XA 2MJEA 3VRAB 2INPE 1ET9A 1PUTA 4TSSA 3DWGC 5HI1A 3Q8CA 4NAMA 2LHEA 4IDIA 4NJCA 4DXFA 1SSNA 3ETRA 3MHZA 4YSXB 4YT0B 1WGKA 1D5XC 2WXOA 3B2FA 3GS2A 3KWVA 4UDUC 3J9CA 3W9CB 1C77A 3E9SA 4REZA 5D7GA 3AEBB 2WU5B 2EELA 2I2YA 2KQ4X 1N5XA 2R61A 3IAS1 1C4PA 1ZXHA 2AX5A 1J7AA 1SJHD 4OZCA 4OZAA 3SEBA 4A8XC 3EUB2 2WXRA 3NVVA 4L1BA 4LK0M 5H92C 2WXQA 2PVGC 1ZDXA 1PFDA 1P7EA 2J4XA 3AE7B 1FFVA 1XLNA 4A9AA 2WXPA 1TKEA 1I4XA 2QSDA 3NZ3A 4PT5A 2MJ3A 2V0GA 1PYWD 2Y5CA 2M56B 4OZBA 2MJDA 3AEEB 3AE2B 3EA6A 1E10A 2PIAA 3BVZA 1DOIA 4YSYB 4H2AA 2IDYA 2IGHA 3NUHB 4JPSA 1FCLA 1F2RI 2WXFA 3VQIA 1GAQB 2ICIA 1JWUD 1FNVA 4US9A 1L4DB 3I9V1 1C4CA 3AV8A 5BMGA 3O13A 1FRRA 1F77A 1PGAA 1QOAA 4L2YA 4ARIA 1TY0A 2KMMA 4WH4A 2W3RA 3ZYYX 4RH6A 2WDRB 4N6EB 1V1PA 1SB3C 5BYQA 2XN9C 4ZYSA 1FXIA 1FFUA 1K50A 4R3DA 2WNMA 4HJGE 5BMIA 3NVWA 3CIRB 4JWSC 3AEAB 3AE8B 2QMTA 4RF0A 3HVDA 2QEJC 1Y56A 1L6VA 1SE3A 4RNAA 1ESFA 3AECB 2RMMA 2CJNA 1TJEA 2V3PA 1HA5A 1UNSA 2GB1A 4XDCA 1CK1A 3U4EG 1EWYC 2QIEB 1HQRD 1E0ZA 1JW9D 2BYTA 4N58A 1V1OA 3SFDB 3TEYA 3KLSX 3ABVB 4AS1A 1TS2A 3AN1A 2RDGA 2DYOA 1GB1A 1A70A 5D3DA 2BB5A 1JMLA 1ZP0B 2YEPF 3FAHA 1UGJA 5TSSA 1C79A 1V1PB 2PMVA 4KGSA 5EE0A 2ZW1A 2Z8LA 4M0WA 2G1EA 3BWUD 1ZPSA 2JXTA 3P63A 1K52A 5C3JB 2HDEA 4JX1C 1KLUD 3AE6B 3W5UB 4CQNA 2H89B 1ZDVA 2WQYB 3MC0B 1J7BA 1C78A 3FC4A 1FIQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YSX B;  1KFY B;  2FBW B;  2W54 A;  1WGK A;  4YT0 B;  3B2F A;  3AED B;  5AUK A;  3WCQ A;  1JWB D;  1FO4 A;  4LTU A;  3W9C B;  4FXC A;  2BS4 B;  3AEB B;  3AM9 A;  1ZXI A;  5MPO A;  1SF0 A;  2WU5 B;  4YTP B;  4ZHO A;  1N5X A;  2WDQ B;  2WLB A;  1VLB A;  1YJJ A;  1J7A A;  2AX5 A;  1QLB B;  1L5P A;  1TKG A;  3AH7 A;  3EUB 2;  1QOG A;  3NVV A;  1TYG B;  2MH7 A;  2OHF A;  5GXG B;  2L83 A;  1FM0 D;  1SIJ A;  2H88 B;  2EKI A;  1RWS A;  5H92 C;  3P4Q B;  2PVG C;  1XO3 A;  3RPF C;  3VRB B;  1FMA D;  1CJE A;  1KF6 B;  1WWT A;  2WS3 B;  4YSZ B;  1PFD A;  4HRS A;  4C80 A;  3NS1 A;  3B2G A;  3AE7 B;  1FFV A;  3NVZ A;  1XLN A;  3AB5 A;  4A9A A;  1TKE A;  1PDX A;  3HVZ A;  3P4S B;  1XLP A;  2MJ3 A;  1R7S A;  2N0S B;  2WP9 B;  1TKY A;  2Y5C A;  5EE1 A;  1JRO A;  2M56 B;  1DOX A;  2MJD A;  3AEE B;  3AE2 B;  2JX5 A;  1DOY A;  4KX6 B;  3AMZ A;  1RFK A;  2M19 A;  3AE5 B;  1V97 A;  1E10 A;  2PIA A;  1NYR A;  1DOI A;  4YSY B;  4WQM A;  1N62 A;  5G5G A;  2ACZ B;  1YJI A;  1JWA D;  1OQR A;  2K5P A;  1GAQ B;  1XLQ A;  1JQ4 A;  4WWM A;  3SFE B;  1IUE A;  4US9 A;  1E9M A;  1V8C A;  2WU2 B;  3BII D;  3AV8 A;  5C2T B;  3NRZ A;  1QOF A;  1FRR A;  1AWD A;  1OFF A;  4ITK A;  3HRD D;  2CJO A;  1F0Z A;  2L52 A;  1ROE A;  1NYQ A;  1QOA A;  1QF6 A;  2KMM A;  3L4P A;  1JAL A;  2W3R A;  1JRP A;  3P1M A;  3ZYY X;  1ZOY B;  3KWL A;  1NEK B;  3NVY A;  2WDR B;  4P6V F;  4N6E B;  5AUI A;  3AE1 B;  2DWQ A;  3HUI A;  3P4P B;  1SB3 C;  4C7Y A;  3SR6 A;  1KRH A;  4HRO A;  2E3T A;  1QT9 A;  1FXI A;  1FFU A;  1N60 A;  1L6U A;  1XLO A;  4USA A;  2CU3 A;  3NVW A;  2JQR B;  3CIR B;  3CWI A;  4JWS C;  4YTM B;  2LEK A;  1VJK A;  3AE8 B;  3AEA B;  2PKO A;  1FXA A;  3AEG B;  1L6V A;  3B9J A;  3AEC B;  2HTM E;  3AE4 B;  2CJN A;  2W3S A;  1VDV A;  1RYJ A;  1TJE A;  1WRI A;  2W55 A;  2WDV B;  3AEF B;  3PO0 A;  5EE3 A;  4US8 A;  2BS2 B;  4YXD B;  3LXF A;  2PVO D;  2Q5W D;  1EWY C;  2KAJ A;  1NI3 A;  2QIE B;  1E6E B;  1UWM A;  1NEN B;  1T3Q A;  3VR8 B;  1E0Z A;  1JW9 D;  2B76 B;  5G5H A;  3W5V B;  5EE9 A;  3LB8 C;  4N58 A;  1YQ3 B;  1QOB A;  1J7C A;  3SFD B;  1OQQ A;  1WXQ A;  1DGJ A;  5H8Y E;  1GPX A;  1RM6 C;  3ABV B;  1E7P B;  1I7H A;  1N5W A;  1N61 A;  3AE3 B;  2DBY A;  4YTN B;  3AN1 A;  1A70 A;  1ZP0 B;  3FAH A;  4JWU C;  1FRD A;  1AYF A;  4C7Z A;  2QJL A;  3DWM A;  1N63 A;  4N59 A;  3VR9 B;  2BT6 A;  1YQ4 B;  5EE0 A;  1ZUD 2;  2K9X A;  2MJE A;  3VRA B;  2BS3 B;  2G1E A;  3P4R B;  1PUT A;  1L0V B;  1CZP A;  4ZHP A;  3DWG C;  3P63 A;  1WYG A;  2K22 A;  5C3J B;  4JX1 C;  3W5U B;  3AE6 B;  4IDI A;  2H89 B;  2WQY B;  1NVI D;  3AE9 B;  4ZOH C;  1B9R A;  1J7B A;  3ETR A;  3FC4 A;  1FIQ A; 
#chains in the Genus database with same CATH topology
 3DQV A;  2N7E A;  2C7H A;  3AED B;  3MP9 A;  3RCZ A;  3PZD A;  3ZW3 A;  4KZC A;  4YTP B;  4A6Q A;  4K1R B;  4LDT D;  3EGR A;  3N1Y C;  1WX8 A;  4EFO A;  2IO0 B;  4NJ6 A;  4A3P A;  5JXV A;  4C80 A;  3ZRF A;  3ZDT A;  1YJ1 A;  2WXM A;  4RFB A;  2N0S B;  1JRO A;  2DLB A;  2PLP A;  4IWO A;  4RGM A;  1AN8 A;  5CHV C;  1XQQ A;  1CQV A;  2JYT A;  3R2I A;  4A55 A;  4KZ0 A;  1MHH E;  2WXK A;  2LGS A;  1JRU A;  1Q10 A;  2ZJD A;  2PTL A;  3BYY B;  5JZE B;  2KWU B;  1AWD A;  2MW5 A;  1I4Q A;  1WR1 A;  2BYE A;  2LVQ A;  2OOB B;  1JAL A;  2V4L A;  4II3 B;  4LLG M;  5CHW A;  4OVZ A;  4HPM B;  4AWJ A;  2KQS A;  2I1K A;  3TEZ A;  1WMH A;  2JQR B;  1SIF A;  3GZN B;  2L7R A;  2KQ7 A;  2AQ3 B;  4WIP A;  3HK0 A;  3RZW C;  5J17 A;  3Q8A A;  2GBM A;  2AL6 A;  4EKU A;  2NPT A;  2GBR A;  2ZVN A;  1QKZ A;  4MJS A;  4XWT A;  4MEM A;  2AQ1 B;  3TL5 A;  1I7H A;  4LJO B;  1TS5 A;  4HVB A;  1KOT A;  1WF9 A;  2JZ3 B;  3PHX B;  1WMH B;  1XCT L;  2C7M B;  3DBH I;  4BOS C;  4E3C A;  1FEH A;  2WHI A;  3OAW A;  4K3B A;  4WWO A;  1YN3 A;  2D3G A;  3VUY A;  3R7Q A;  4W9F A;  2V9H A;  2NPT B;  4MAC A;  1P0R A;  3KQ4 A;  5MPO A;  2ZNV C;  4HPP A;  4MJS B;  1BT0 A;  1XXG A;  3TBL D;  3N9Y C;  3ZDM C;  1TGZ B;  1ZKH A;  3P4Q B;  4YSZ B;  1FMA D;  1BUI C;  2OJW A;  4MGY E;  1WSP A;  1C76 A;  3H8H A;  2X38 A;  3BVM A;  2NBV B;  1WFY A;  3QA8 A;  3P4S B;  3EC8 A;  1R7S A;  5EE1 A;  5TR5 A;  1V2Y A;  1JWM D;  2N4F A;  3AMZ A;  1V97 A;  2FIF A;  1ZGU B;  5IOI A;  4WQM A;  1SE2 A;  1WR6 E;  3O65 B;  2WXI A;  4WWM A;  2WU2 B;  2DZM A;  2RPV A;  2UU7 A;  2QIL A;  2BTE A;  2L52 A;  4GGQ A;  2J42 A;  2N9L A;  3ZIM A;  2RDH A;  2LUM A;  4HRO A;  4AUQ C;  4L23 A;  4XZ4 A;  4USA A;  4KGR A;  3S2A A;  1YQB A;  2PE6 B;  4YTM B;  3DBL B;  1P7F A;  2ONQ A;  3Q8B A;  3ZJV A;  3TCA A;  1RYJ A;  2WDT B;  1BML C;  2W82 A;  2GI9 A;  1J7C A;  3APD A;  2LZ6 A;  4FJV B;  1RM6 C;  3QAQ A;  1WZ3 A;  4YTN B;  1C9F A;  2DYM A;  2EMS A;  1H4R A;  4GIV A;  1N63 A;  3VR9 B;  4OW0 A;  4BBN F;  3UIN B;  4MT5 A;  3TJP A;  1WYG A;  2IPK D;  3JVZ X;  5L83 A;  2IJ0 A;  4LNF A;  1B9R A;  1E5W A;  2O6V A;  3WCQ A;  1FO4 A;  4BKS D;  2ZW0 A;  4HCN B;  2LXA A;  2KFJ A;  3KUZ A;  4FHJ A;  3W1S A;  4FN2 A;  3V3X A;  1QLB B;  4W9I A;  4G50 A;  1L5P A;  1YOV B;  5EDS A;  3Q14 C;  4PS3 A;  2REX A;  4MEL A;  5JHA A;  1FXT B;  4LNO A;  3MHS D;  3GE8 C;  4IWP A;  4JL9 A;  4ZRQ A;  2E6X A;  5FR3 A;  4I6P A;  2O6V B;  3UF8 A;  1NYR A;  1GB4 A;  3U7Z A;  1WJN A;  4BZA A;  1JQ4 A;  3BZD B;  3R2T A;  1J0G A;  1V8C A;  2KDB A;  1QOF A;  3QWZ B;  1ET6 A;  1M94 A;  1ZOY B;  3KWL A;  1NEK B;  3R66 C;  2KFK A;  3L0W B;  1OGW A;  3SR6 A;  4ZRJ A;  3ZNG C;  1KJT A;  2INC C;  3QK0 A;  2PKO A;  1T0S C;  2LRU A;  2W3S A;  2WDV B;  3ZJT A;  2KZR A;  1D6E C;  5J18 A;  1SJE D;  3GP7 A;  3DCG A;  5D3I B;  2BB6 A;  2UYZ B;  2KYW A;  3TMP B;  2N9E B;  3KW5 B;  4XE0 A;  1G6J A;  3OJ4 B;  2KFK B;  5IA7 A;  1XT9 B;  1WE6 A;  2QJL A;  3T8M A;  4N59 A;  3MJ5 A;  2JWU A;  2ZNV B;  4ARC A;  2K9X A;  2MJE A;  4II2 B;  1E7V A;  4FHK A;  1ET9 A;  1WM3 A;  3DWG C;  4RM8 A;  4M0W B;  3U8Z A;  3A4S C;  2LHE A;  4IDI A;  4NJC A;  2KNB A;  2L05 A;  3MHZ A;  4YSX B;  4YT0 B;  1D5X C;  3B2F A;  3KWV A;  4UDU C;  3J9C A;  3W9C B;  3LDZ E;  3AEB B;  1N5X A;  1RFA A;  3VTU A;  3ZTC A;  1I42 A;  1ZXH A;  2KC1 A;  2DAF A;  3WAM A;  4FJY A;  2PVG C;  1ZDX A;  4GU2 A;  2YLM A;  3KUD B;  1P7E A;  4JLC A;  3DHG C;  2GLS A;  2WXP A;  4PT5 A;  5JHB A;  4E71 A;  2V0G A;  1PYW D;  4RMA A;  3DPD A;  2PIA A;  1WGR A;  3CSF A;  1F2R I;  1SGH A;  1GAQ B;  1E7U A;  4LNI A;  3H6N A;  2PPH A;  2R2Q A;  5BMG A;  5D2M B;  1PGA A;  4ARI A;  1TY0 A;  2KMM A;  3V62 A;  4N6E B;  1V1P A;  4HDQ A;  3VXW A;  5BYQ A;  2XN9 C;  4ZYS A;  3CIR B;  4RF0 A;  3ZUN A;  2QEJ C;  1KLV A;  2IND C;  2WX0 A;  2RMM A;  2CJN A;  4X57 B;  1CK1 A;  3U4E G;  4DHZ E;  2JWZ A;  3X23 A;  3RUI B;  4IUM B;  2MLB A;  1V1O A;  2KO3 A;  2RR9 A;  3OLM D;  3NZS A;  3KLS X;  1AAR A;  1MG4 A;  4AS1 A;  2JPH A;  3AN1 A;  2Y5B B;  2RDG A;  1GB1 A;  2KC2 A;  2ZEQ A;  2BB5 A;  1ZP0 B;  5TSS A;  1C79 A;  1V1P B;  3PT2 B;  1UBI A;  2ZW1 A;  1WX9 A;  2CU1 A;  2ZCB A;  4JX1 C;  3W5U B;  3MC0 B;  3RNC C;  1V86 A;  1J7B A;  2D3C A;  3FC4 A;  1FIQ A;  3FKY A;  1ZE3 D;  3L54 A;  5C23 A;  3R7R A;  4PYU A;  2BS4 B;  1TS3 A;  2JYE A;  3A33 B;  1YN5 A;  3GB1 A;  4XWW A;  2H88 B;  1R4N I;  1RWS A;  5IP4 D;  3KYD D;  3EFU A;  2D5G A;  2ZZP B;  2CKH B;  1STE A;  3ZJU A;  2IGG A;  4ASW C;  4OHJ A;  1TKY A;  4WWP A;  2JSV X;  1DOX A;  1T5X D;  2AEH A;  3DOW A;  2DZI A;  2O6V D;  4WWN A;  3MTN B;  1WGG A;  4FAD A;  1SE4 A;  2MBB B;  5DPS A;  1K51 A;  2UWQ A;  1C4A A;  2DAJ A;  2HE7 A;  3HRD D;  4MSM B;  2BPS A;  3H7S A;  1JRP A;  2KN4 A;  2VH2 A;  4GLS C;  1KLG D;  2G9H D;  4KIK A;  4JQW C;  3L08 A;  3I57 A;  2L3Z A;  1WGY A;  2LMC A;  4DXG A;  2FCM A;  2SAK A;  1VJK A;  5KHO A;  3AU4 A;  2BF8 B;  2PJH A;  2J53 A;  2M4N A;  2VZK B;  4XC2 A;  2NTS A;  4MM3 A;  2KAJ A;  1NI3 A;  3PZ8 A;  2DX5 B;  2BW2 A;  3E56 A;  3LB8 C;  4ZRK A;  2QDF A;  4W9K A;  3UQA A;  3APF A;  1WY8 A;  2NCN A;  4RGT A;  4DQO C;  4C7Z A;  2KLC A;  4GDL A;  4KIK B;  1YQ4 B;  1TBE A;  3QQ8 B;  1KH0 A;  2NVU I;  4GSW A;  3AE9 B;  4ZOH C;  3KUC B;  4WUR A;  2KT7 A;  2IYD B;  4MM3 B;  3BY4 B;  3IT4 B;  4LTU A;  4IC7 B;  1F52 A;  1E8Y A;  4I6N B;  2K0P A;  1JWS D;  3AM9 A;  3UGB B;  1ISN A;  1HZ5 A;  1Q1O A;  2WLB A;  5BMH A;  2XBB C;  5C1Z A;  1J8C A;  4C00 A;  1YX5 B;  3KYC D;  4GDL B;  3ZNH B;  1E90 A;  4M00 A;  3IXS A;  3V6C B;  2AQ2 B;  1PDX A;  1RRB A;  2EKE C;  4BAX A;  3V61 A;  4EZK A;  3A1Q B;  4YWG G;  1MPE A;  3ZKJ C;  2EMT A;  3SD5 A;  4AOF A;  5IO9 A;  1IUE A;  4KVG B;  2IGD A;  1SEB D;  4J6I A;  1WZ0 A;  1ROE A;  1P9D U;  3L4P A;  4O1N A;  3T9L A;  2BKF A;  4B6W A;  1ACC A;  1QT9 A;  2KWD A;  2BVC A;  1K53 A;  4W9C A;  1FXA A;  2CHZ A;  4AJY B;  5IN7 A;  1UBQ A;  2KX3 A;  4RGO S;  1MI0 A;  4TQ0 A;  3L16 A;  5FKA C;  3ZXR A;  4DBG A;  3MC9 A;  1YMH E;  1T3Q A;  1YN4 A;  4JE3 B;  3W5V B;  1P98 A;  1LQB A;  1WXQ A;  2TSS A;  2MX2 A;  5BYS A;  1E7P B;  2K6Q A;  1V6E A;  2DBY A;  3Q8E A;  2B3A A;  2KOX A;  1GC7 A;  4S0R A;  2K39 A;  1LM8 B;  2L0F A;  3P4R B;  3HHM A;  4WJO A;  1LXD A;  2MSE D;  3N20 C;  3GE3 C;  4HKZ E;  3RNG C;  2MBE A;  1LGR A;  2FBW B;  2XK5 A;  3TUO A;  2BYV E;  2JZP A;  1HXY D;  2C7N B;  1L2N A;  1ZXI A;  2N9P C;  3RYT A;  3H9D A;  3VHT C;  1IPG A;  4LNN A;  3UI3 A;  2MEK A;  2N7D A;  3AXC A;  1MJD A;  3DBR I;  2QCZ A;  2EKI A;  3IVF A;  3AUL A;  2FUG 1;  3IT6 B;  3NS8 A;  2I1J A;  2FNJ B;  2DYB A;  2WP9 B;  1GG3 A;  1OQY A;  3N1Z C;  1SXT A;  1FPY A;  2XK5 B;  3BK1 A;  3EFC A;  3ZQ4 A;  2KDE B;  1WH3 A;  3NZU A;  3BII D;  2M0A A;  5C2T B;  2K25 A;  4MGZ E;  2NMQ A;  3SDL C;  1FD6 A;  2V4I B;  2IZV B;  3W1Y A;  1TS4 A;  3P1M A;  5AUI A;  2LJI A;  2QHO A;  3OJ3 A;  4WQO B;  1KRH A;  1D3Z A;  4KKJ A;  5DPR A;  1N60 A;  3DBS A;  2CU3 A;  3DHH C;  3CWI A;  2LFI A;  2LEK A;  4P1B C;  1UGM A;  4F8C B;  2HTM E;  1VRA B;  3LXF A;  3DDC B;  1B1Z A;  2VZK D;  2GBJ A;  4KDL B;  2GBK A;  2XNA C;  1KM7 A;  5EE9 A;  4KGT A;  1UWX A;  4C4V B;  4KKI A;  2WYQ A;  4IM2 A;  4N9F 4;  4JWU C;  2MRP A;  1EO6 A;  3DWM A;  2KDF B;  3P2B A;  2AL3 A;  1ZW7 A;  4F1S A;  3VRA B;  1Z5S B;  2INP E;  1PUT A;  4TSS A;  2KHW B;  1I35 A;  5HI1 A;  4WJN A;  1GC6 A;  5AZF A;  1SSN A;  3RUL A;  2L00 B;  2M0X A;  3ETR A;  3NG0 A;  1WGK A;  3GS2 A;  5DPT A;  2BYF A;  4REZ A;  2QC8 A;  3K9P B;  4OZA A;  3VDZ A;  2GBN A;  3EUB 2;  3VTW A;  3NVV A;  4IG7 B;  1E8W A;  4XGA B;  3WAL A;  3RNA C;  4DWF A;  3AE7 B;  1FFV A;  2DEN B;  4A9A A;  3IG3 A;  2QSD A;  3NZ3 A;  2MJ3 A;  5LXI B;  1HTQ A;  3DVG X;  1R4M I;  2M56 B;  2MJD A;  3AE2 B;  4B95 A;  1T0Y A;  4XX5 A;  3ML9 A;  3BVZ A;  4YSY B;  4H2A A;  1FCL A;  3H1U A;  1V5O A;  4DDG D;  1JWU D;  1FNV A;  3AU5 A;  3AV8 A;  4S17 A;  3O13 A;  2JRH A;  4NY0 A;  1HTO A;  2J0M A;  4DK5 A;  1K8R B;  2W3R A;  2WDR B;  4DHJ B;  3PHW B;  1FXI A;  1K50 A;  5BMI A;  3B1L X;  3AEA B;  3AE8 B;  2QMT A;  5CTR C;  1Y56 A;  1SE3 A;  4RNA A;  3L13 A;  1WYW B;  1PQS A;  1IYF A;  2LD9 A;  2LGX A;  2V3P A;  2N1V A;  1UNS A;  4XDC A;  3JW0 X;  4MSQ B;  1HQR D;  1OEY A;  4N58 A;  4M8N A;  4MH0 E;  3SFD B;  3RT3 B;  1GUA B;  1HE8 A;  3ZNZ B;  2DYO A;  2MBQ A;  1A70 A;  3IHP C;  1NBF C;  2J7Q B;  1JML A;  4MGK E;  2PMV A;  1X1M A;  4W9D A;  5EE0 A;  4M0W A;  3BWU D;  4IM0 A;  3P63 A;  3DHI C;  5C3J B;  2RD0 A;  2HDE A;  1KLU D;  3AE6 B;  4CQN A;  2C9W B;  1KFY B;  2KXJ A;  1HZ6 A;  3PRE A;  5E6N A;  3T3N A;  2KN5 A;  4XYC A;  1YJJ A;  4B0E A;  2MQJ A;  2KMA A;  2MH7 A;  2KKC A;  4IOI E;  1SIJ A;  2MBH A;  4QAY A;  3NY5 A;  4HRS A;  3NS1 A;  4DXA B;  3PGE A;  1YX6 B;  1YNT E;  4NQL B;  2D3B A;  2JX5 A;  2KDM A;  3PVL A;  4HJK A;  1WXS A;  2ZPY A;  3VH3 B;  4G11 A;  1N6Z A;  1WGH A;  1J19 A;  2NBU A;  2BBC A;  1SBB B;  4HWI B;  4P7I A;  1GJZ A;  3ALB A;  3RZF A;  3NRZ A;  1OFF A;  5I4D A;  1QZE A;  4P16 A;  3DBH B;  2K1F A;  4NNJ B;  2HJ8 A;  2KDI A;  3AE1 B;  3P4P B;  2V3S A;  2WWZ A;  1L7Y A;  4TKN A;  2KLG A;  1EU3 A;  3B9J A;  2LI5 A;  2X8X X;  3GOE A;  5E6O A;  2O2V A;  2W55 A;  5EE3 A;  1SE9 A;  5E6P A;  3BYT B;  3A9J A;  5T8I A;  2W9N A;  3Q69 A;  1N61 A;  1YIW A;  3Q8F A;  4MDK E;  1VR9 A;  4W9G A;  2I38 A;  2J0J A;  3CMM B;  4IKG A;  3M63 B;  3R3M A;  1DYQ A;  4RF1 A;  1QQR A;  2JRI B;  3QCA A;  2YVC A;  3LYY A;  5LXH A;  2IO2 B;  2O2V B;  2JXX A;  3U52 E;  2K3U A;  2Z59 B;  4FA6 A;  1UH6 A;  2W54 A;  4B0M A;  5AUK A;  4C56 C;  1D5Z C;  2A4Z A;  2JU6 X;  3A9J B;  3GZN I;  2G4D B;  4LNK A;  3RNB C;  1YD8 U;  2Z0D B;  5GXG B;  1LO5 D;  1F2R C;  1V80 A;  2K8B A;  2KMC A;  3PLU A;  4PS7 A;  4BFR A;  2KWV B;  4XDD A;  2WXN A;  2WS3 B;  3AB5 A;  5DPW A;  1VZ7 A;  4K81 A;  5FR6 A;  1GNU A;  2FCQ A;  3JSV A;  3AE5 B;  2D10 A;  2K8C A;  1WJ4 A;  5IKC M;  3OG5 A;  3DVG Y;  3NOB A;  1YJI A;  1EF1 A;  1OQR A;  2KK8 A;  1MVK A;  2V3N A;  2DHZ A;  1VZ8 A;  2WGS A;  3C0R B;  1IBX A;  2HD5 B;  4RCO A;  4IWQ A;  5DCN A;  3FIL A;  4JGH B;  2N9K A;  2IBI B;  4BOZ B;  1XLO A;  4DHJ D;  5G2N A;  4EOY A;  3JSV B;  2LVP A;  2Y5P A;  4P1C C;  1WRI A;  4US8 A;  4YXD B;  2Q5W D;  2LHD A;  1WXV A;  4NAW A;  1UWM A;  3BVG A;  2WXJ A;  4K3C A;  3CF6 E;  1IBX B;  1N5W A;  3AE3 B;  2CR5 A;  3FIL B;  1WXA A;  1D5M C;  1EM7 A;  1UD7 A;  2J0K A;  2LGD A;  2BT6 A;  3IBE A;  4CO7 A;  1UEL A;  2RGF A;  5E6J A;  2K22 A;  3RD2 A;  3KVF B;  4HCP B;  1KTK A;  2L76 A;  3BK2 A;  5AZH A;  4TUU A;  3Q3M C;  4NAW B;  1I4G A;  1JWB D;  3DBL I;  4YL8 A;  4D2K A;  2N1W A;  4ANX A;  2FUH B;  3L10 B;  3ZRC A;  3QIJ A;  1BXT A;  3IFW B;  3A9K A;  2LJ5 A;  1QOG A;  2JY6 A;  3I3T B;  4K7S A;  3ZLZ A;  3QHT A;  5FK9 C;  3TEX A;  1WWT A;  1UZX B;  5AZG A;  2D11 A;  3A1Q A;  3MJW A;  3U2S C;  1M4V A;  1XLP A;  2G45 B;  5LNK 1;  1NDD A;  1F9J A;  1MHX A;  2A5U A;  2WXL A;  3BIN A;  1E8X A;  5JH5 C;  4AP4 C;  4GB9 A;  1MFW A;  2LAS A;  5BO4 B;  3A9K B;  4ZRP A;  4ITK A;  2CJO A;  1QF6 A;  4P6V F;  4TMA B;  4BKT A;  1I4H A;  2E3T A;  3DVN V;  1L6U A;  2ON8 A;  4AJW A;  4LCD E;  3RFZ B;  1V5T A;  3W2D A;  1EU4 A;  4RGN A;  4ZHO A;  2IY1 B;  3URY A;  2L1A A;  1OTR B;  1NEN B;  3VR8 B;  1FCC C;  4EE2 A;  4J3O D;  1YQ3 B;  3Q6B A;  2C5L C;  5H8Y E;  3N32 A;  3VUX A;  4ANV A;  2INN E;  2MWS B;  4ANU A;  1EF5 A;  2D2Q A;  1ZUD 2;  3VAW A;  5D94 A;  3Q8C A;  1MG8 A;  2KVR A;  1Y8R C;  4PK1 A;  1NI2 A;  1C77 A;  3N3K B;  4TV3 A;  5D7G A;  2EEL A;  2R61 A;  1C4P A;  4OZC A;  1SJH D;  4A8X C;  3ZVV A;  2GOW A;  5H92 C;  1PFD A;  2KTR A;  1XLN A;  1TKE A;  4OZB A;  3AEE B;  4DDI D;  3WIM A;  4I6L B;  3EA6 A;  2MBO A;  3W1S C;  2IDY A;  4OVV A;  5CHF A;  2AWT A;  3NUH B;  2PEA A;  2WXF A;  2L8J A;  3VQI A;  2ICI A;  4US9 A;  3TIX A;  1L4D B;  1FRR A;  3V6E B;  2LVO A;  5LLI A;  1WM2 A;  3PPA A;  4RH6 A;  4HXD A;  2KTR B;  2MA9 B;  2WNM A;  4HJG E;  3PRM B;  3NVW A;  4IW0 A;  1CMX B;  3V60 A;  3ZTD A;  1L6V A;  1WRD B;  4BBN C;  1ESF A;  4BVU C;  4ACF A;  1HA5 A;  1EWY C;  2ZPN A;  4RM9 A;  2BYT A;  4C4V A;  1R4N B;  4GDK A;  4KSL C;  3C19 A;  3PLV A;  3N1X C;  4MGI E;  4JIO U;  4OVU A;  2YEP F;  3FAH A;  1UGJ A;  3RN9 C;  3UIO B;  2BQQ A;  4KGS A;  3APC A;  2Z8L A;  4ZYN A;  3WA0 A;  3VH4 B;  3DVN U;  4EZJ A;  1K52 A;  4KSK C;  4CHK A;  2D3A A;  1Z2M A;  4M8M A;  1TTN A;  3VTV A;  1V49 A;  3RI7 C;  1VD2 A;  3UQB A;  3HM6 X;  3TSS A;  4GDK B;  1XD3 B;  2VRR B;  3SHQ A;  4GOC A;  4AQ7 A;  1Q0W B;  4G3X B;  2M1M A;  1FM0 D;  1I4R A;  2N9X A;  5HFY A;  3KH0 A;  1XO3 A;  1CJE A;  2KJH B;  3VUW A;  4K7U A;  3HVZ A;  5D6J B;  1XCQ L;  2IO1 B;  1T6B X;  3M95 A;  1LFD A;  4KX6 B;  3M62 B;  1WGD A;  2M19 A;  2ACZ B;  3ZGZ A;  3TEW A;  2K5P A;  4GXB A;  5AEK B;  1IGD A;  4A20 A;  3QJZ A;  3SFE B;  1E9M A;  4B9K A;  3QC8 B;  1T0R C;  3RNE C;  4HPL B;  3Q3N C;  2K6D B;  3M3J A;  2DWQ A;  2J52 A;  3AI5 A;  4K7W A;  1WI0 A;  2JUO A;  1D4B A;  2YEP B;  2G3Q B;  1FNU A;  1VDV A;  3PO0 A;  1VCB A;  2JF5 A;  3VVW B;  3PV1 A;  1E6E B;  2B76 B;  3RNF C;  5G5H A;  1WJ6 A;  1IGC A;  2L32 A;  1QOB A;  2AYO B;  1OQQ A;  3CST A;  1DGJ A;  1F1H A;  4A3O A;  2M17 A;  2M8S A;  3I5J C;  5HG2 A;  2KWC A;  3PSE B;  1FRD A;  1AYF A;  1U4A A;  2BGF A;  2LUE A;  4HKQ A;  4HEA 1;  1L0V B;  3V05 A;  1EWC A;  2G4S A;  2KJ6 A;  2NBW B;  2PW9 A;  3QX1 A;  2ASQ A;  1NVI D;  1V81 A;  1XEE A;  2CHW A;  4FXC A;  3MC8 A;  1SF0 A;  4CYE A;  2WDQ B;  3SU8 X;  1WXM A;  2WXG A;  3PZ7 A;  4A90 A;  3RPF C;  3VRB B;  1PGB A;  1C3T A;  1XF5 L;  3X0W A;  4G0N B;  2SEB D;  3NVZ A;  1JCK B;  3Q2A C;  1GOZ A;  3H7P A;  2Z0E B;  3T3O A;  1P1A A;  4ICV A;  2GMI C;  3EEC A;  1N62 A;  3Q3F A;  2NTT A;  3NHE B;  1RAX A;  1H8C A;  2NR2 A;  2JT4 B;  2PE9 A;  1WIA A;  4W9J A;  4NQK E;  1QIL A;  1TY2 A;  3PRZ A;  1NYQ A;  1TIF A;  2ZVO A;  2RPQ A;  3OWE B;  2LXC A;  3NVY A;  4PS8 A;  4C7Y A;  4ZDV A;  4MH8 A;  2KJR A;  3K9O B;  1VZ6 A;  2NS5 A;  3H7P B;  4HDO A;  4WJP A;  5HHD G;  2IO3 B;  2MHJ A;  2OED A;  3AE4 B;  4WAF A;  1S3S G;  2Y3A A;  2FID A;  3DBR B;  4F7Z A;  2HTH A;  1UUP A;  4FUL A;  1GPX A;  2GRI A;  2KAN A;  4KDI C;  3PRP B;  3MFG A;  3PS6 A;  3NJT A;  1TZO A;  2WXH A;  2BS3 B;  3HM3 A;  3L17 A;  3VFK A;  4BKG A;  4TQ1 A;  4ZHP A;  1CZP A;  4IM3 A;  3B0A A;  3LJ3 A;  2JVC A;  2KTF A;  2FE8 A;  2KD0 A;  1PGX A;  3EHV A;  1S1Q B;  2OJR A;  4GN1 A;  5IAA C;  1I4P A;  4LDT B;  3R8B A;  1VLB A;  1L0X B;  1TKG A;  3AH7 A;  1TYG B;  2OHF A;  1AW7 A;  1T0Q C;  2WX1 A;  2L83 A;  1WJU A;  2LRW A;  3WAP A;  1KF6 B;  3UIP B;  3P42 A;  3B2G A;  1TZ1 A;  4KV2 A;  2KAC A;  2KX0 A;  2FAZ A;  1DOY A;  1L0Y B;  1RFK A;  2DNF A;  5G5G A;  1JWA D;  1XLQ A;  2VH1 A;  5GMV A;  1OEY J;  4HLE A;  1F0Z A;  3IAM 1;  3C8Y A;  4NZL B;  4GMV A;  5KHQ A;  2RSU A;  2MP2 A;  4Q2J A;  3ECI A;  2BKR B;  3HUI A;  4M01 A;  4URK A;  4NPN A;  4ANW A;  2FCN A;  2LGI A;  4FBJ B;  4E74 A;  4EUT A;  3AEG B;  2C60 A;  3AEF B;  3ENE A;  1HEZ E;  2BS2 B;  1IP9 A;  2PVO D;  4EEW A;  3U7D A;  3WAN A;  4WAA A;  3B08 A;  2R2O A;  2XEW A;  1ENF A;  4EZL A;  4LJP B;  3A4R A;  2N7J A;  4DHZ B;  1L4Z B;  2KVZ A;  2MP2 B;  5BYR A;  5J2R A;  1RLF A;  1R4M B;  2V1Y A;  5HKH A;  1FNW A;  4M02 A;  2D07 B;  4NAM A;  2LWP A;  4DXF A;  2DZJ A;  4WJQ A;  2WXO A;  3E9S A;  2RDB C;  4W9L A;  3ZNI D;  1WE7 A;  2WU5 B;  2I2Y A;  2KQ4 X;  3IAS 1;  4NJ7 A;  2AX5 A;  1J7A A;  3PTF C;  1UF0 A;  3SEB A;  2WXR A;  1TT5 B;  1WX7 A;  4L1B A;  4LK0 M;  2WXQ A;  3JYU A;  2J4X A;  2FCS A;  1I4X A;  3QAR A;  3RMK C;  2Y5C A;  3Q3J A;  2CHX A;  4W9E A;  3U30 A;  1E10 A;  1DOI A;  2DZK A;  4W9H A;  2IGH A;  4JPS A;  3N30 A;  1C1Y B;  2BWF A;  1C4C A;  1F77 A;  4FLH A;  1E8Z A;  1QOA A;  3ONS A;  4L2Y A;  5G55 A;  4WH4 A;  5CX3 A;  3ZYY X;  2BWE S;  1SB3 C;  1A5R A;  5L95 C;  1FFU A;  4HK2 A;  4R3D A;  2JZZ A;  4JWS C;  3WAO A;  2IY0 B;  3HVD A;  3Q3O C;  3ZXV A;  3AEC B;  1TJE A;  2K8H A;  4BKS A;  2GB1 A;  2QIE B;  1E0Z A;  1JW9 D;  4PYZ A;  3ZO5 B;  3I63 C;  2L0T A;  3TEY A;  3ABV B;  1TS2 A;  1P3Q U;  1V9J A;  4FJZ A;  4ICU A;  2CS4 A;  2HJ1 A;  5D3D A;  3ML8 A;  3D32 A;  2MCN B;  3HIZ A;  2G1E A;  1ZPS A;  2JXT A;  1EUV B;  2ZCC A;  4ZRI A;  1Q5W B;  2H89 B;  1ZDV A;  2LGY A;  2WQY B;  3I9V 1;  1C78 A; 
#chains in the Genus database with same CATH homology
 1KFY B;  1ZE3 D;  3AED B;  3MP9 A;  1HZ6 A;  2BS4 B;  3T3N A;  1TS3 A;  2JYE A;  4GDK B;  4YTP B;  3TSS A;  4A6Q A;  4AQ7 A;  1YJJ A;  3EGR A;  4B0E A;  1YN5 A;  2MH7 A;  3GB1 A;  1FM0 D;  4IOI E;  1I4R A;  4XWW A;  1SIJ A;  2H88 B;  5HFY A;  1RWS A;  1XO3 A;  1CJE A;  2D5G A;  5JXV A;  4HRS A;  4C80 A;  3NS1 A;  1STE A;  3ZJU A;  2IGG A;  2WXM A;  1YNT E;  3HVZ A;  4RFB A;  1XCQ L;  2N0S B;  4OHJ A;  1TKY A;  1JRO A;  2JSV X;  1T6B X;  2DLB A;  2PLP A;  1DOX A;  1T5X D;  2JX5 A;  2KDM A;  1AN8 A;  4KX6 B;  4RGM A;  2M19 A;  1CQV A;  2JYT A;  3R2I A;  4A55 A;  2ACZ B;  3ZGZ A;  3TEW A;  2K5P A;  1MHH E;  1IGD A;  2WXK A;  3SFE B;  1SE4 A;  2BBC A;  1SBB B;  1Q10 A;  1E9M A;  1K51 A;  1C4A A;  2PTL A;  3BYY B;  3NRZ A;  1AWD A;  1OFF A;  5I4D A;  3HRD D;  1I4Q A;  4P16 A;  1JAL A;  1JRP A;  2KN4 A;  4GLS C;  3AE1 B;  1KLG D;  2DWQ A;  2G9H D;  3P4P B;  4LLG M;  2J52 A;  4OVZ A;  3I57 A;  3TEZ A;  2LMC A;  4DXG A;  2JQR B;  2SAK A;  1VJK A;  1D4B A;  2YEP B;  1FNU A;  3B9J A;  1EU3 A;  1VDV A;  2W55 A;  2VZK B;  2AQ3 B;  2J53 A;  3PO0 A;  4WIP A;  5EE3 A;  2NTS A;  2KAJ A;  1NI3 A;  3PZ8 A;  3Q8A A;  1E6E B;  3BYT B;  2B76 B;  2BW2 A;  5G5H A;  3E56 A;  1IGC A;  2L32 A;  3LB8 C;  5T8I A;  1QOB A;  1QKZ A;  4XWT A;  1OQQ A;  1DGJ A;  2AQ1 B;  3Q69 A;  1I7H A;  1N61 A;  5HG2 A;  4RGT A;  1TS5 A;  3Q8F A;  4DQO C;  1VR9 A;  1FRD A;  1AYF A;  4C7Z A;  2I38 A;  4HKQ A;  4IKG A;  1YQ4 B;  1DYQ A;  4RF1 A;  1QQR A;  4HEA 1;  1XCT L;  1L0V B;  3V05 A;  1EWC A;  1FEH A;  2PW9 A;  1KH0 A;  3LYY A;  1NVI D;  3AE9 B;  4ZOH C;  1XEE A;  4WUR A;  3U52 E;  2K3U A;  4MM3 B;  2W54 A;  4B0M A;  1YN3 A;  5AUK A;  4C56 C;  1D5Z C;  3IT4 B;  4LTU A;  2JU6 X;  4FXC A;  2K0P A;  1JWS D;  3AM9 A;  3KQ4 A;  1SF0 A;  4MAC A;  5MPO A;  2WDQ B;  1HZ5 A;  5BMH A;  2WLB A;  1XXG A;  2WXG A;  3N9Y C;  5GXG B;  1LO5 D;  1F2R C;  3PZ7 A;  4A90 A;  4GDL B;  4XDD A;  3RPF C;  3P4Q B;  3VRB B;  2WXN A;  4YSZ B;  1FMA D;  2WS3 B;  1BUI C;  1PGB A;  1WSP A;  1C76 A;  1XF5 L;  3H8H A;  2SEB D;  3NVZ A;  2X38 A;  1JCK B;  2AQ2 B;  3AB5 A;  3BVM A;  3IXS A;  1VZ7 A;  1GOZ A;  1PDX A;  3P4S B;  1R7S A;  5EE1 A;  4YWG G;  3T3O A;  1MPE A;  1JWM D;  3AMZ A;  3AE5 B;  1V97 A;  4WQM A;  1N62 A;  2NTT A;  1YJI A;  1OQR A;  1SE2 A;  1MVK A;  2V3N A;  2WXI A;  4WWM A;  1IUE A;  2WU2 B;  1VZ8 A;  2IGD A;  1SEB D;  2RPV A;  2QIL A;  1IBX A;  1QIL A;  4RCO A;  2BTE A;  2L52 A;  1TY2 A;  1ROE A;  1NYQ A;  3L4P A;  3OWE B;  3FIL A;  3NVY A;  2J42 A;  4O1N A;  2N9L A;  2N9K A;  2RDH A;  4C7Y A;  2LUM A;  4MH8 A;  4HRO A;  1ACC A;  1QT9 A;  2KWD A;  4L23 A;  1VZ6 A;  1XLO A;  4USA A;  4KGR A;  1K53 A;  4YTM B;  5HHD G;  1FXA A;  1P7F A;  2ONQ A;  3Q8B A;  3ZJV A;  2Y5P A;  2OED A;  3AE4 B;  4RGO S;  4TQ0 A;  1MI0 A;  1RYJ A;  1WRI A;  4WAF A;  4US8 A;  5FKA C;  1BML C;  4YXD B;  2Y3A A;  2Q5W D;  2LHD A;  2W82 A;  1YMH E;  1UWM A;  3BVG A;  1T3Q A;  1YN4 A;  4JE3 B;  3W5V B;  2GI9 A;  2WXJ A;  1J7C A;  1UUP A;  1WXQ A;  2TSS A;  1GPX A;  5BYS A;  1RM6 C;  2GRI A;  1E7P B;  1IBX B;  1N5W A;  3AE3 B;  2DBY A;  3Q8E A;  4YTN B;  1C9F A;  2DYM A;  3FIL B;  1D5M C;  1EM7 A;  3MFG A;  1N63 A;  3VR9 B;  4OW0 A;  2BT6 A;  1TZO A;  2WXH A;  2BS3 B;  3P4R B;  4TQ1 A;  4ZHP A;  1CZP A;  4MT5 A;  5E6J A;  1WYG A;  2K22 A;  2IPK D;  4HKZ E;  2FE8 A;  2IJ0 A;  1KTK A;  3BK2 A;  1B9R A;  1PGX A;  2FBW B;  3TUO A;  3WCQ A;  4NAW B;  1I4G A;  1JWB D;  1FO4 A;  2JZP A;  2ZW0 A;  4D2K A;  1HXY D;  1ZXI A;  1I4P A;  3R8B A;  3W1S A;  1BXT A;  1VLB A;  1L0X B;  3UI3 A;  3V3X A;  1QLB B;  1L5P A;  1TKG A;  2MEK A;  3AH7 A;  1QOG A;  1TYG B;  2OHF A;  1AW7 A;  2L83 A;  5FK9 C;  3TEX A;  2EKI A;  1KF6 B;  1WWT A;  3P42 A;  3B2G A;  2FUG 1;  3IT6 B;  3U2S C;  1M4V A;  1XLP A;  5LNK 1;  2WP9 B;  4ZRQ A;  2KAC A;  2E6X A;  5FR3 A;  1DOY A;  1MHX A;  1L0Y B;  1SXT A;  1RFK A;  2WXL A;  1NYR A;  3BK1 A;  3ZQ4 A;  5G5G A;  1GB4 A;  3U7Z A;  1JWA D;  1XLQ A;  1JQ4 A;  3BZD B;  3R2T A;  1V8C A;  3BII D;  2M0A A;  5C2T B;  1QOF A;  4ZRP A;  2NMQ A;  4ITK A;  1ET6 A;  2CJO A;  1F0Z A;  1FD6 A;  2V4I B;  1QF6 A;  3IAM 1;  3C8Y A;  1TS4 A;  4NZL B;  3P1M A;  1ZOY B;  3KWL A;  1NEK B;  4Q2J A;  5AUI A;  4P6V F;  2LJI A;  4TMA B;  3HUI A;  1I4H A;  3SR6 A;  1KRH A;  4KKJ A;  2E3T A;  1N60 A;  1L6U A;  2ON8 A;  2CU3 A;  2LGI A;  3CWI A;  2LFI A;  2LEK A;  3RFZ B;  2PKO A;  3AEG B;  3W2D A;  1EU4 A;  2HTM E;  4RGN A;  4ZHO A;  2W3S A;  3AEF B;  1VRA B;  1HEZ E;  2WDV B;  3ZJT A;  2BS2 B;  3URY A;  3LXF A;  2PVO D;  2L1A A;  1B1Z A;  2VZK D;  1D6E C;  1NEN B;  3VR8 B;  1SJE D;  2XNA C;  1FCC C;  3GP7 A;  5EE9 A;  4EE2 A;  4J3O D;  1YQ3 B;  4KGT A;  5D3I B;  1ENF A;  2BB6 A;  5H8Y E;  1UWX A;  2N7J A;  4KKI A;  4XE0 A;  1L4Z B;  4JWU C;  2INN E;  5BYR A;  2QJL A;  3DWM A;  4N59 A;  2JWU A;  3MJ5 A;  4ARC A;  1FNW A;  1ZUD 2;  2K9X A;  2MJE A;  3VRA B;  2INP E;  1ET9 A;  1PUT A;  4TSS A;  3DWG C;  5HI1 A;  3Q8C A;  4NAM A;  2LHE A;  4IDI A;  4NJC A;  4DXF A;  1SSN A;  3ETR A;  3MHZ A;  4YSX B;  4YT0 B;  1WGK A;  1D5X C;  2WXO A;  3B2F A;  3GS2 A;  3KWV A;  4UDU C;  3J9C A;  3W9C B;  1C77 A;  3E9S A;  4REZ A;  5D7G A;  3AEB B;  2WU5 B;  2EEL A;  2I2Y A;  2KQ4 X;  1N5X A;  2R61 A;  3IAS 1;  1C4P A;  1ZXH A;  2AX5 A;  1J7A A;  1SJH D;  4OZC A;  4OZA A;  3SEB A;  4A8X C;  3EUB 2;  2WXR A;  3NVV A;  4L1B A;  4LK0 M;  5H92 C;  2WXQ A;  2PVG C;  1ZDX A;  1PFD A;  1P7E A;  2J4X A;  3AE7 B;  1FFV A;  1XLN A;  4A9A A;  2WXP A;  1TKE A;  1I4X A;  2QSD A;  3NZ3 A;  4PT5 A;  2MJ3 A;  2V0G A;  1PYW D;  2Y5C A;  2M56 B;  4OZB A;  2MJD A;  3AEE B;  3AE2 B;  3EA6 A;  1E10 A;  2PIA A;  3BVZ A;  1DOI A;  4YSY B;  4H2A A;  2IDY A;  2IGH A;  3NUH B;  4JPS A;  1FCL A;  1F2R I;  2WXF A;  3VQI A;  1GAQ B;  2ICI A;  1JWU D;  1FNV A;  4US9 A;  1L4D B;  3I9V 1;  1C4C A;  3AV8 A;  5BMG A;  3O13 A;  1FRR A;  1F77 A;  1PGA A;  1QOA A;  4L2Y A;  4ARI A;  1TY0 A;  2KMM A;  4WH4 A;  2W3R A;  3ZYY X;  4RH6 A;  2WDR B;  4N6E B;  1V1P A;  1SB3 C;  5BYQ A;  2XN9 C;  4ZYS A;  1FXI A;  1FFU A;  1K50 A;  4R3D A;  2WNM A;  4HJG E;  5BMI A;  3NVW A;  3CIR B;  4JWS C;  3AEA B;  3AE8 B;  2QMT A;  4RF0 A;  3HVD A;  2QEJ C;  1Y56 A;  1L6V A;  1SE3 A;  4RNA A;  1ESF A;  3AEC B;  2RMM A;  2CJN A;  1TJE A;  2V3P A;  1HA5 A;  1UNS A;  2GB1 A;  4XDC A;  1CK1 A;  3U4E G;  1EWY C;  2QIE B;  1HQR D;  1E0Z A;  1JW9 D;  2BYT A;  4N58 A;  1V1O A;  3SFD B;  3TEY A;  3KLS X;  3ABV B;  4AS1 A;  1TS2 A;  3AN1 A;  2RDG A;  2DYO A;  1GB1 A;  1A70 A;  5D3D A;  2BB5 A;  1JML A;  1ZP0 B;  2YEP F;  3FAH A;  1UGJ A;  5TSS A;  1C79 A;  1V1P B;  2PMV A;  4KGS A;  5EE0 A;  2ZW1 A;  2Z8L A;  4M0W A;  2G1E A;  3BWU D;  1ZPS A;  2JXT A;  3P63 A;  1K52 A;  5C3J B;  2HDE A;  4JX1 C;  1KLU D;  3AE6 B;  3W5U B;  4CQN A;  2H89 B;  1ZDV A;  2WQY B;  3MC0 B;  1J7B A;  1C78 A;  3FC4 A;  1FIQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...