4B9KA

Pvhl-elob-eloc complex_(2s,4r)-1-(3-amino-2-methylbenzoyl)-4-hydroxy-n-(4-(4-methylthiazol-5-yl)benzyl)pyrrolidine-2-carboxamide bound
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
104
structure length
101
Chain Sequence
MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGEGFTSQTARPQAPATVGLAFRADTFEALIEPFSSPPELPDVMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCRIPTION ELONGATION FACTOR B POLYPEPTIDE 2
publication title Small-Molecule Inhibitors of the Interaction between the E3 Ligase Vhl and Hif1 Alpha
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 24
structure length 101
sequence length 104
chains with identical sequence D, G, J
ec nomenclature
pdb deposition date 2012-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4b9kA00
3ZNZB 1WGGA 1XQQA 2C60A 3D32A 1GC6A 4RMAA 2GMIC 2BGFA 1S3SG 4BKTA 4K1RB 4I6LB 3L08A 3EHVA 3QQ8B 2ZVNA 5CTRC 3UIPB 3APCA 2KWVB 3DQVA 2AL6A 4DWFA 2CKHB 1VD2A 2LXCA 3DPDA 3PREA 2MSED 5JHBA 1OQYA 2HE7A 3WA0A 2KHWB 1RAXA 1J0GA 3A4RA 1P1AA 4DDGD 2FCMA 2ZPYA 3DBHI 3ZDTA 1WY8A 4I6PA 2FAZA 3IHPC 1TGZB 3PS6A 5AEKB 1WJ6A 3L17A 3WAMA 1E8ZA 4N9F4 4FN2A 4X57B 2DAJA 2WYQA 1TZ1A 4XC2A 5KHOA 1Q1OA 4DHJD 2V3SA 2YVCA 1UD7A 3OLMD 1PQSA 4G3XB 2LGDA 3PZDA 3R7QA 3TCAA 5DPRA 3ZRFA 1E8YA 2KN5A 4W9KA 3QX1A 2MBQA 3APDA 4HCNB 1WF9A 3ZTCA 4I6NB 2KMCA 3NZUA 4WJNA 3B0AA 3RZWC 2J0KA 4JIOU 2NBVB 2NPTB 4IWQA 4WJPA 2KDFB 1XD3B 1WH3A 2K8BA 1BT0A 4NPNA 4EOYA 3ZUNA 2L8JA 4F8CB 4ASWC 2RD0A 4URKA 1P0RA 3R7RA 1UH6A 4PYZA 1V49A 2M1MA 2N4FA 3KH0A 4KSKC 5D2MB 3UQBA 2CHZA 3A9JB 2G3QB 3KUZA 2M17A 3IVFA 5BO4B 2L05A 2L3ZA 2M8SA 1WGRA 2M0XA 4A3PA 1ZKHA 2CR5A 1KLVA 1UZXB 4KVGB 3QARA 4PS8A 3SD5A 3IFWB 3Q3FA 1I42A 5HKHA 1WGDA 2ZPNA 1YQBA 1K8RB 4F7ZA 1WE7A 2ASQA 4J6IA 2MBEA 2RR9A 2KTRB 3H6NA 2G4DB 3WAPA 2MW5A 2J0MA 2KXJA 3W1YA 2K39A 1I35A 4XX5A 2KDBA 5JH5C 4KIKB 3DBSA 2HD5B 2KLCA 1KOTA 2PJHA 4BKSD 4M0WB 2GBKA 2XK5B 2LXAA 4WJOA 4GDLB 4LJPB 4FBJB 1Z5SB 2JF5A 2NBUA 4MJSA 2HJ8A 3W1SC 4KSLC 1V80A 3B08A 4CHKA 1WR1A 4W9HA 2FIFA 3X0WA 3ZW3A 3LJ3A 4FA6A 1WI0A 2CHWA 1V2YA 2ZJDA 3ML9A 5AZGA 3ALBA 3VH3B 1X1MA 1JRUA 4GGQA 3ZIMA 1TTNA 1RRBA 2N9EB 5FR6A 4ANUA 2M4NA 5LXIB 2EKEC 4MM3A 4E74A 1C3TA 4G11A 2NVUI 2LVQA 3ZVVA 2A4ZA 5D6JB 3GZNI 4ZDVA 2MX2A 3PRZA 2DZMA 3CMMB 2BPSA 4HPLB 5EDSA 4IW0A 1H4RA 5CHWA 3RT3B 4TQ0A 4GSWA 4EZJA 3X23A 2JXXA 2N1VA 2KMAA 4ICUA 4BVUC 4HJKA 2IZVB 2KD0A 4KDIC 1UBQA 4GXBA 3V60A 2BYVE 2BWES 3PGEA 4EZKA 3ZRCA 2D2QA 2KX0A 3QWZB 2KQ7A 2K8HA 3DBRI 2D11A 2JRIB 2MBBB 2NPTA 4HLEA 3ECIA 4AP4C 3ZTDA 2KZRA 3IG3A 3PRPB 3DBLI 3W1SA 2MA9B 3A4SC 1WXMA 3ZKJC 3JW0X 3UINB 4FJZA 2NBWB 4PS7A 1P98A 2I1JA 4DK5A 2IBIB 3PHXB 3WANA 4BKSA 3EC8A 2LI5A 4MSMB 4MJSB 1WFYA 2Y5BB 1GJZA 1G6JA 3AULA 3H7PB 3NY5A 4FJVB 1WMHB 1ZGUB 2GBJA 2FUHB 3NOBA 3NHEB 3P2BA 2V1YA 3GOEA 2IY1B 4PS3A 3VQIA 3L13A 1WX9A 3A9JA 3PLVA 2K6QA 2QHOA 3TL5A 4W9IA 4BOZB 3JSVA 4HDQA 4K7WA 5G2NA 4WWNA 3S2AA 2D3GA 4CO7A 2KK8A 2HTHA 4NY0A 3QC8B 2MWSB 4MH0E 2LZ6A 3U7DA 2FCSA 3IBEA 3V6EB 5E6PA 1R4MI 3H1UA 4K7SA 4BBNF 2C7NB 3RCZA 3N30A 2KTRA 3RD2A 3APFA 3ZNHB 1OEYJ 3PSEB 4EEWA 1Q5WB 4KIKA 2KJRA 3PT2B 2ZNVB 1WIAA 1FXTB 1WJUA 1YD8U 3KW5B 3M63B 1CMXB 2EMTA 4GIVA 4DHZE 2AEHA 2XEWA 5G55A 4BKGA 2XK5A 1KM7A 4GDLA 3V61A 4NNJB 2LRUA 1H8CA 2FNJB 2KX3A 5DPSA 1QZEA 2MP2B 2KWUB 2KDIA 4AJWA 3KVFB 4MGKE 3UF8A 1LQBA 1WM2A 2WWZA 4DBGA 1E8XA 2MLBA 2KLGA 3DCGA 3L0WB 4ANVA 1E7UA 2NCNA 2PE9A 2JT4B 1WXVA 3VDZA 5IA7A 3PVLA 4IC7B 1MG8A 1WGHA 1EO6A 4DDID 3EFUA 3PPAA 2DENB 3HM6X 1ISNA 4RM9A 4W9EA 4JL9A 2IYDB 4BOSC 2LRWA 4LDTB 4OVVA 4WAAA 4ZYNA 1WGYA 5JHAA 3U30A 2R2OA 3JSVB 3VXWA 4ICVA 2DZJA 5CX3A 4LCDE 4NQLB 3T9LA 2AL3A 1T0YA 2JPHA 1HE8A 3RZFA 3HIZA 3MJWA 1RFAA 3UGBB 3VAWA 1P3QU 3VUWA 4AJYB 2BYFA 4WWOA 4BBNC 4FLHA 1XT9B 3H9DA 3ONSA 3PRMB 4HCPB 1TBEA 2R2QA 2N7EA 2CS4A 4EZLA 5JZEB 2BF8B 4HDOA 3PLUA 3JVZX 3V62A 2VRRB 2ZNVC 1WE6A 2DX5B 2JUOA 2O2VB 3CSTA 4GU2A 1V5OA 3ZDMC 3HM3A 5DPTA 2CU1A 3TIXA 3AI5A 2IO0B 3H7PA 2LASA 2DZIA 1WMHA 2KOXA 1S1QB 1UGMA 4K7UA 5E6OA 1L7YA 4GOCA 4WWPA 2ZEQA 3VUXA 1M94A 2V4LA 4WJQA 4LDTD 3RYTA 2KQSA 2LGXA 3LDZE 4KZCA 4GB9A 4IM3A 4TV3A 3QK0A 2K1FA 2PPHA 5TR5A 2KFKB 4A3OA 2KJHB 1J8CA 3NS8A 4GDKA 3A9KB 2MBHA 3TMPB 3HK0A 4IWOA 4ZRIA 2O6VB 1U4AA 2W9NA 3R3MA 2L0TA 2LD9A 1E5WA 4MEMA 1V81A 5IAAC 3VFKA 4W9JA 1WZ0A 2J7QB 3H7SA 4E71A 4HPMB 2WDTB 2XBBC 3A33B 3KYCD 5GMVA 5D94A 1A5RA 2AWTA 2C9WB 4NAWB 3ZNID 2MCNB 1SGHA 5C23A 2N1WA 4W9DA 2JZ3B 2DHZA 4HWIB 2BWFA 4LJOB 4IM2A 3PHWB 3QJZA 2MP2A 3UQAA 3JYUA 4W9GA 4YL8A 2CHXA 2KKCA 4ANWA 3RUIB 1WXSA 4MGIE 2D10A 2L0FA 3SU8X 3WALA 1C1YB 3ZNGC 4KDLB 2I1KA 2N9XA 2BYEA 2NS5A 3CF6E 3T8MA 2D07B 4FJYA 5L83A 3U8ZA 2KVRA 4M8NA 2DYMA 2FCNA 4PYUA 2L7RA 2O6VD 2UYZB 3I3TB 3TJPA 3M3JA 2FIDA 2LWPA 5AZHA 3DVNV 2OOBB 4II3B 3M95A 2LGYA 1GUAB 1OEYA 4GDKB 1F9JA 4IG7B 2ZCBA 4W9CA 3L10B 3VHTC 4TKNA 3VVWB 1WX7A 3HHMA 3MHSD 2IO2B 4B9KA 2LVOA 5C1ZA 4HXDA 2RGFA 2YLMA 4JGHB 2K25A 2MRPA 3UIOB 3VUYA 2JVCA 4FULA 4FADA 1WZ3A 3KYDD 4BFRA 2JZZA 4AOFA 3SDLC 3Q3JA 5LLIA 1WM3A 4K81A 2O2VA 3N3KB 3VTVA 2ZZPB 2KO3A 3N32A 1RLFA 3QIJA 4FHKA 3WAOA 1YJ1A 3DOWA 1SE9A 2IO1B 5AZFA 4A20A 5DPWA 2B3AA 2Z0EB 5KHQA 1V5TA 3KUDB 3WIMA 3QA8A 2Z0DB 2RSUA 4EFOA 3DVNU 1VCBA 2C7HA 4IM0A 5E6NA 4II2B 4DHZB 3L54A 4G50A 2L76A 1WRDB 1YIWA 3SHQA 4G0NB 4AUQC 3AU4A 4EUTA 1LFDA 2KFJA 3OAWA 3KUCB 2G4SA 1IP9A 1NDDA 4CYEA 1EF1A 3ENEA 3B1LX 2K8CA 2MQJA 4XZ4A 1NBFC 1Y8RC 2A5UA 2KFKA 4IWPA 5D7GA 1LXDA 2JWZA 2C5LC 3K9PB 1UBIA 4IUMB 3A9KA 2UWQA 4NJ7A 2N9PC 2O6VA 1P9DU 2IO3B 4HK2A 4RM8A 3PV1A 2DZKA 2L00B 4JQWC 3M62B 2DYOA 2K6DB 1IYFA 1WJ4A 2MBOA 2REXA 2GBNA 2LJ5A 4E3CA 4KV2A 1EF5A 5DCNA 5L95C 2EMSA 2JRHA 3QHTA 4NAWA 4EKUA 4M8MA 4MELA 1WR6E 1WJNA 3AU5A 3L16A 4GMVA 2BKRB 3O65B 4ANXA 3K9OB 1LM8B 4F1SA 1WXAA 3CSFA 3V6CB 3BINA 2GBMA 1Z2MA 2PE6B 1J19A 2PEAA 4HVBA 3A1QA 2C7MB 2BKFA 3NZSA 3AXCA 4MGZE 4MGYE 5J18A 5J2RA 4AWJA 1E90A 1YX5B 1D3ZA 1UELA 1NI2A 1OGWA 2N7DA 2KDEB 2LVPA 3VTUA 2AYOB 4TQ1A 1Q0WB 3DVGX 4W9LA 2IY0B 1AARA 2LUEA 4TUUA 4WQOB 4B95A 1GC7A 4KZ0A 1GG3A 2KTFA 2ZCCA 1E8WA 5CHVC 1E7VA 4ZRKA 2KJ6A 5J17A 1KJTA 2NR2A 2WX1A 3QCAA 1V9JA 2RPQA 2JY6A 3VTWA 3VH4B 3TBLD 2DAFA 2KNBA 3DVGY 3OJ4B 4OVUA 3RULA 4MDKE 3BY4B 3ML8A 1V86A 4NQKE 1IPGA 2KANA 2Z59B 3DDCB 4DXAB 3EECA 1V6EA 1ZW7A 3QAQA 1YX6B 1EUVB 4B6WA 5LXHA 4FHJA 1OTRB 3MTNB 2GBRA 4JLCA 2WX0A 4ZRJA 2FCQA 1SIFA 2J0JA 1WX8A 2KC2A 1GNUA 3PTFC 2KC1A 2OJRA 3OJ3A 2KWCA 4P7IA 3ZO5B 3ZLZA 5CHFA 2G45B 2DYBA 3A1QB 1WYWB 4GN1A 3R66C 4W9FA 2GOWA 4DHJB 2ZVOA 3C0RB 4MSQB 1L2NA 4NJ6A 1R4NI
chains in the Genus database with same CATH superfamily
1WGGA 1F52A 4DQOC 4A8XC 1S3SG 3AE7B 4K1RB 4I6LB 1HQRD 5CTRC 2XN9C 5MPOA 1BMLC 5E6JA 5JXVA 2MSED 5JHBA 4IDIA 3I63C 3U4EG 4DDGD 4I6PA 2FAZA 4EE2A 1YJIA 2DLBA 1WJ6A 4FN2A 1VZ7A 1SF0A 2DAJA 1V8CA 4XC2A 1JROA 4DHJD 2V3SA 1UD7A 2LGDA 3PZDA 5IN7A 1MHXA 3TCAA 4W9KA 5BYQA 1IBXA 1QF6A 3B0AA 4L1BA 3FILB 1T0QC 1DOXA 4WJPA 1ZP0B 4KGSA 2K8BA 4RF1A 3AECB 2K0PA 1HTQA 2V3NA 4EOYA 1C78A 1D5ZC 4ASWC 2RD0A 1L5PA 1P0RA 1I4XA 1F77A 3BWUD 4LNNA 2W55A 5D2MB 4KSKC 3UQBA 2CHZA 2M17A 2M8SA 1WGRA 3OG5A 2CR5A 4PS8A 3SD5A 3IFWB 1P7EA 1WGDA 2MHJA 1NVID 1YQ4B 3V05A 1HZ6A 2CU3A 2ASQA 2MBEA 3AEFB 3WAPA 2J0MA 3W1YA 2JQRB 3N1YC 2KLCA 4NJCA 2BQQA 5GXGB 1M4VA 2GBKA 2JYTA 3U2SC 4GDLB 4LJPB 3IAM1 1XLPA 2NBUA 3AEBB 2HJ8A 3R2TA 3B08A 3NG0A 4W9HA 3LJ3A 1RFKA 3VH3B 1JRUA 1X1MA 1TTNA 1MVKA 2EKEC 1A70A 2LGSA 4MM3A 2LVQA 2DZMA 2BPSA 2KT7A 1FCCC 3BVMA 1I7HA 4IOIE 3RI7C 2IZVB 1WRIA 4C7YA 3QWZB 4AP4C 2MA9B 3ZKJC 4ZHPA 1I4HA 1P98A 1V1PB 4BKSA 1B9RA 3RMKC 1PGXA 5FKAC 4MJSB 1WFYA 4A55A 1CQVA 1G6JA 1WMHB 2GBJA 2FUHB 3NHEB 1WX9A 1EU4A 1IGCA 3J9CA 1HTOA 2NTTA 2G1EA 1NYRA 4W9IA 5EE3A 4HROA 2GI9A 3RNFC 2WXJA 2WXMA 4WWNA 4CO7A 3URYA 4MH0E 1ZUD2 1ZDVA 3AEEB 3V6EB 1PDXA 4BBNF 4K7SA 1L6VA 3RCZA 3N30A 3ZNHB 4EEWA 5C2TB 3UI3A 1UF0A 2ZNVB 1FXTB 1WJUA 1YD8U 3KW5B 2EMTA 3RNCC 2XEWA 1K50A 1I4GA 2WGSA 4NNJB 1D4BA 2MH7A 1H8CA 2KX3A 2QEJC 5DPSA 1QKZA 1QZEA 2KWUB 4HPPA 4AJWA 4YTNB 3LB8C 1C9FA 2YEPB 2WWZA 2MLBA 3EFCA 1E7UA 1WXVA 3VDZA 5IA7A 4ACFA 3BK2A 1EO6A 3EFUA 4BOSC 4LDTB 4OVVA 2RDBC 3U30A 4AQ7A 3JSVB 3VXWA 4ICVA 2DZJA 2QIEB 3HIZA 1P3QU 2ACZB 3ONSA 5IP4D 1STEA 3HVZA 4WAFA 2Y5PA 3V62A 3Q8EA 3BZDB 3N9YC 3SEBA 2JUOA 3ZDMC 1F2RI 2CU1A 4YT0B 2SEBD 2WLBA 4YSZB 2LASA 4NAMA 2ZEQA 2LMCA 2V4LA 5HHDG 4LDTD 2LGXA 1PYWD 4KZCA 5H92C 2PPHA 1PUTA 1XF5L 3NS8A 3A9KB 1FNUA 4IWOA 2O6VB 4XGAB 1U4AA 3RN9C 4JPSA 3OWEB 4LNKA 1V81A 3VFKA 2D3CA 4A9AA 3P4RB 3AE4B 1AWDA 3LYYA 2D3BA 1SJHD 2JZ3B 4HWIB 2M56B 4MT5A 4IM2A 3PHWB 3QJZA 2MP2A 3UQAA 3JYUA 4QAYA 4YL8A 4ARIA 4ANWA 1PGBA 3RUIB 1TS3A 2D10A 3SU8X 2KYWA 5BMIA 1E7PB 2I1KA 2BYEA 3CF6E 2D07B 4FJYA 2PVGC 4PYUA 2L7RA 2O6VD 4KX6B 3NVZA 3RNAC 2PW9A 3M3JA 3DVNV 2OOBB 3M95A 3VHTC 1T0RC 4TKNA 3VVWB 3MHSD 4HXDA 4JGHB 2EKIA 4JWUC 2J42A 2JVCA 3KYDD 3RFZB 4AOFA 2BB6A 4KGTA 1WM3A 4K81A 2O2VA 5AUKA 2ZZPB 4FHKA 3WAOA 4ZOHC 1YJ1A 3DOWA 2B3AA 3P63A 1VCBA 5D3DA 5E6NA 4IM0A 2J4XA 4DHZB 4G50A 1BUIC 3C19A 3SHQA 3AU4A 1SSNA 5C3JB 1LFDA 2KFJA 3OAWA 2W3RA 1N60A 1IP9A 3NZ3A 1EF1A 3ENEA 1YQ3B 4XZ4A 3NUHB 3I57A 1NBFC 1Y8RC 3GZNB 4XYCA 1L4ZB 2X8XX 2FUG1 1QLBB 2LHEA 1QQRA 4Q2JA 2BB5A 2KACA 3DBRB 1N61A 5FR3A 1EF5A 3DBLB 2KWDA 4EKUA 4NAWA 3AU5A 2QC8A 1FEHA 2IJ0A 1TKGA 1LM8B 1YNTE 1WXAA 3CSFA 4JX1C 1Z2MA 2PE6B 4ZYSA 3BVGA 3NZSA 4KKJA 5J2RA 1SIJA 4C00A 1OGWA 4RGOS 4OZAA 2AYOB 4B95A 4TUUA 1IBXB 1UUPA 4KZ0A 4R3DA 3BYTB 1E8WA 4YTMB 2I2YA 2KJ6A 2WX1A 2RPQA 1AN8A 3TBLD 1T0SC 3ML8A 3KWLA 1TKEA 1IGDA 4L23A 4B6WA 3MTNB 2FCQA 2MJ3A 1QILA 2WDVB 1SEBD 1GNUA 2KC1A 2KN4A 3ZXVA 4P7IA 3WCQA 3ZO5B 5IO9A 5CHFA 1NYQA 1HXYD 1WYWB 4GN1A 3R66C 1RM6C 5H8YE 2KQ4X 4MSQB 1EU3A 2L52A 1VRAB 2IGGA 1NEKB 3D32A 2RDHA 4RMAA 2BGFA 2KDMA 2JWUA 3L08A 1QOGA 3APCA 3DQVA 2AL6A 3P4SB 2CKHB 3DPDA 2ZW0A 1OQYA 2HE7A 2H88B 3WA0A 1RAXA 1J0GA 3A4RA 1PFDA 3DBHI 1K51A 1SE4A 4UDUC 2WQYB 3IHPC 2QJLA 4MM3B 1YMHE 3WAMA 1E8ZA 4N9F4 4X57B 1TZ1A 1OQQA 5KHOA 2YVCA 3OLMD 1AYFA 1PQSA 4OHJA 4WURA 3ZRFA 3APDA 4HCNB 4OZBA 1FD6A 3ZTCA 3NZUA 2INDC 4M0WA 2J0KA 2NBVB 2KDFB 1XD3B 1BT0A 2WXHA 4F8CB 2YEPF 2QILA 4URKA 1UH6A 4PYZA 1V49A 2M1MA 3KH0A 3KLSX 3Q14C 3KUZA 1F2RC 2M0XA 1UZXB 4KVGB 3QARA 4M00A 1TS5A 2W54A 3EUB2 2B76B 5HKHA 1C77A 2ZPNA 1K8RB 4P1BC 4M01A 4YSXB 3DHGC 2K39A 1I35A 2KDBA 3DBSA 4XWWA 2PJHA 2W3SA 1LGRA 4BKSD 4WJOA 1FNVA 3P42A 2JF5A 2ON8A 3P1MA 2CJOA 3X0WA 1WI0A 2CHWA 1V2YA 3DBHB 4GGQA 2N9EB 5FR6A 4E74A 1C3TA 2NVUI 4ZDVA 2MX2A 2OHFA 4HPLB 3O13A 4EZJA 4BVUC 1RYJA 3T3OA 1UBQA 1TS4A 4GXBA 1FM0D 2BYVE 3PGEA 1D5MC 4TMAB 2Y5CA 2D2QA 4N58A 2KX0A 2PIAA 2NPTA 1RWSA 3ZTDA 3PRPB 3IG3A 3A4SC 3JW0X 3MP9A 4PS7A 2IBIB 2N0SB 3WANA 1VZ8A 4MSMB 2Y5BB 1ZGUB 1SBBB 2XNAC 3TL5A 3TEXA 2BS2B 4MH8A 4BOZB 4K7WA 4A6QA 5G2NA 4C4VA 4NY0A 3QC8B 4P16A 2LZ6A 2WXQA 2FCSA 2V9HA 3MC8A 1R4MI 3H1UA 4USAA 4K3BA 2KTRA 1E0ZA 1OEYJ 3PSEB 1Q5WB 2KJRA 3PT2B 1WIAA 3M63B 4GIVA 2AEHA 1KM7A 1YJJA 3V61A 4L2YA 4CQNA 3NJTA 4K3CA 2FNJB 2I38A 2MP2B 4C7ZA 2V3PA 1MG4A 1C4AA 2WXNA 3L0WB 4ZRQA 2NCNA 4YTPB 2JT4B 1L4DB 1JCKB 3TSSA 1ISNA 1YN4A 4JL9A 2LRWA 4ZYNA 4LCDE 2WHIA 2AL3A 1NENB 4WIPA 1T0YA 3UGBB 3VAWA 4AJYB 1F1HA 4BBNC 4FLHA 3H9DA 4HCPB 5AUIA 5JZEB 2BF8B 4HDOA 3JVZX 2AX5A 2DX5B 2O2VB 4GU2A 3HM3A 2IO0B 1LO5D 3H7PA 3DHIC 1S1QB 4K7UA 4WWPA 1M94A 1UWMA 2K3UA 1JRPA 3B2FA 4TV3A 3QK0A 2WXRA 1VZ6A 2MBHA 1DYQA 3BVZA 3P4PB 1ET9A 1IUEA 5G5HA 2WNMA 3AE6B 1WZ0A 4E71A 4HPMB 4PT5A 2XBBC 3NVWA 2AWTA 2C9WB 4NAWB 4KGRA 1SGHA 2N1WA 4W9DA 1L6UA 1CZPA 4YWGG 1MHHE 3PZ8A 3HRDD 4MGIE 3GE8C 4KDLB 1UWXA 2N9XA 3T8MA 2M19A 2KVRA 2M0AA 3CWIA 2V0GA 2UYZB 3TJPA 1P7FA 2FIDA 3RNGC 2QDFA 1OEYA 1FNWA 4GDKB 4M02A 4IG7B 1I4PA 4W9CA 2IO2B 3AE8B 2RGFA 2X38A 1L0YB 3UIOB 4FULA 1JWSD 1WZ3A 5HG2A 4BFRA 2JZZA 3Q6BA 3SDLC 3Q3JA 5LLIA 3VTVA 3N32A 2KO3A 1CK1A 1N5XA 2IO1B 5AZFA 4DXGA 2PTLA 3WIMA 3QA8A 4C56C 2RSUA 3AE1B 1D5XC 1SB3C 2KAJA 2WXIA 4P6VF 1ROEA 1NDDA 4CYEA 2K8CA 4FXCA 2KFKA 2A5UA 1LXDA 2JWZA 3K9PB 3U7ZA 4IUMB 2WDRB 2JXTA 2UWQA 4NJ7A 2N9PC 2IO3B 2DZKA 3M62B 2REXA 5DCNA 2JRHA 3QHTA 1WJNA 4GMVA 4OZCA 4N59A 3MHZA 3V6CB 3PZ7A 1KLUD 1R7SA 3Q3OC 2H89B 1J19A 3T3NA 4HVBA 3AXCA 4MGZE 4MGYE 5J18A 1YX5B 1CJEA 4TQ1A 4ARCA 2IY0B 1GC7A 3RPFC 3AN1A 4ZRKA 1KJTA 1V9JA 1V97A 2JY6A 3RULA 3AMZA 4OVUA 2RDGA 3BY4B 1V86A 3R8BA 2KANA 4DXAB 3QAQA 1YX6B 5LXHA 1FMAD 1OTRB 4FHJA 2GBRA 4JLCA 4ZRJA 2L1AA 1SIFA 4MACA 1KFYB 3Q3MC 1WX8A 1XXGA 2KWCA 3A1QB 4H2AA 2ZVOA 1L2NA 4NJ6A 1SE3A 1R4NI 1E9MA 3W5VB 3ZNZB 3QQ8B 3EHVA 3GE3C 2AQ1B 3HUIA 3UIPB 1UNSA 3BK1A 2KHWB 2WS3B 2K9XA 3GS2A 1P1AA 2ZPYA 3ZDTA 1TGZB 4N6EB 5HI1A 2ZW1A 1FO4A 1Q1OA 4LNFA 1L0VB 4G3XB 3R7QA 1GB1A 5DPRA 2KN5A 2MBQA 4BZAA 1WF9A 1QT9A 3H8HA 4I6NB 3SFEB 4WJNA 3AE5B 3RZWC 4JIOU 2NPTB 1KF6B 4RGTA 4NPNA 1XLOA 2L8JA 4ZHOA 4TSSA 1EWCA 4DXFA 2OJWA 3FKYA 3KQ4A 1HZ5A 5EE1A 3IVFA 5BO4B 2L05A 4A3PA 1ZKHA 2Q5WD 1KLVA 2V4IB 3AEGB 3VRAB 2LUMA 4C4VB 1I42A 1YQBA 2IPKD 1R4NB 4J6IA 2WXLA 2KTRB 4RGMA 3H6NA 2G4DB 1TKYA 2KXJA 5JH5C 2HD5B 1Z5SB 4MJSA 2WP9B 4KSLC 2MJEA 3EA6A 1WR1A 2BVCA 2FIFA 3TEZA 3AE2B 1L0XB 2ZJDA 3IXSA 3ALBA 1FCLA 3BYYB 2WXGA 1KTKA 2W82A 2PKOA 4G11A 1J7AA 3ZVVA 3BIID 3PRZA 3CMMB 5LNK1 5CHWA 3RT3B 4TQ0A 1GPXA 1XO3A 2SAKA 3P4QB 4YXDB 2N1VA 4GLSC 3AM9A 1N6ZA 2KD0A 3V60A 1YOVB 1ZOYB 2BWES 4EZKA 3ZRCA 2BYTA 2KQ7A 2K8HA 2GRIA 2D11A 2MBBB 2QSDA 2VH2A 1KLGD 4LK0M 3UINB 4RCOA 2I1JA 3PHXB 1JQ4A 3Q8AA 1GJZA 1GB4A 3AULA 3H7PB 1YN3A 1FFVA 1XLNA 3NOBA 3P2BA 2V1YA 3GOEA 3AEDB 3L13A 3A9JA 1MJDA 4OW0A 2K6QA 2QHOA 5EE9A 2ONQA 3JSVA 4HDQA 3S2AA 1ZXHA 2BTEA 2KK8A 2HTHA 1ET6A 3U7DA 5E6PA 1WXQA 2AQ3B 4WH4A 3RD2A 3APFA 2HTME 2D5GA 5EE0A 4KIKA 4DHZE 5G55A 2OEDA 2XK5A 3CIRB 3EGRA 1D6EC 1OQRA 3UF8A 1TZOA 2K5PA 2LGIA 1LQBA 1WM2A 4DBGA 5TSSA 3VR8B 3ZJUA 3PVLA 3GP7A 4IC7B 3NRZA 1WGHA 4DDID 3PPAA 2DENB 2IYDB 5JHAA 1WGYA 2R2OA 1JMLA 1TY0A 3AE9B 2JPHA 3IT4B 3MJWA 3VUWA 1XT9B 1NI3A 3PRMB 2R2QA 2N7EA 2CS4A 4EZLA 2Z8LA 1V1OA 2KMMA 2VRRB 2LJIA 1WE6A 1V5OA 3V3XA 1J7BA 5DPTA 2VH1A 3TIXA 2VZKB 3Q69A 2DZIA 1UGMA 5E6OA 1FXIA 1L7YA 2TSSA 2KQSA 3LDZE 4IM3A 5TR5A 2K1FA 2KFKB 4A3OA 1J8CA 3IAS1 4HRSA 2GLSA 3HK0A 4NZLB 4AS1A 2JZPA 4ZRIA 3R3MA 3NVVA 2AQ2B 2LD9A 2N9KA 4XDCA 5I4DA 3KYCD 5GMVA 1A5RA 5C23A 4LJOB 2BWFA 2GB1A 4W9GA 2CHXA 2KKCA 1TIFA 2L0FA 3WALA 3ZNGC 2NS5A 4BAXA 3U8ZA 4M8NA 2DYMA 2FCNA 3MC9A 3I3TB 1J7CA 2BS3B 2LWPA 4II3B 1GUAB 2LGYA 2ZCBA 3AH7A 2BT6A 2E6XA 5C1ZA 1Y56A 2LVOA 1FIQA 1ZE3D 3VUYA 4FADA 2N7JA 1RLFA 3RNEC 4A20A 1SE9A 2Z0EB 2E3TA 1V5TA 3KUDB 3PO0A 4EFOA 3ZJVA 5IOIA 3AV8A 3L54A 3Q8FA 4KKIA 2L76A 1YIWA 4G0NB 3I5JC 2G4SA 3B1LX 2MQJA 4IWPA 4J3OD 3ZYYX 1KH0A 1P9DU 4RM8A 2DYOA 1WJ4A 3FAHA 1JWUD 3TEWA 4LNIA 2ICIA 4E3CA 4KV2A 5L95C 1E6EB 1T3QA 4M8MA 1I4QA 1GOZA 3B2GA 4ANXA 3K9OB 4REZA 4JWSC 1EM7A 2IGHA 4IKGA 3MJ5A 2C7MB 2K22A 1D3ZA 1NI2A 1YN5A 2LVPA 1VDVA 1Q0WB 4W9LA 2LUEA 1AARA 4WQOB 1GG3A 1R4MB 2KTFA 2ZCCA 1E7VA 3KWVA 5J17A 1C76A 1VLBA 2NR2A 3QCAA 2DAFA 2KNBA 3DVGY 4MDKE 2WDQB 2UU7A 1MPEA 2LEKA 4A90A 1EUVB 3W2DA 2WX0A 5IKCM 1HEZE 1I4RA 2J0JA 2INPE 2OJRA 1DOIA 2MJDA 2DYBA 3E56A 4XE0A 4W9FA 2GOWA 3C0RB 4HKQA 2PLPA 1XQQA 2C60A 5BMHA 1GC6A 2GMIC 4BKTA 3C8YA 2QCZA 3DWGC 2ZVNA 4B0MA 1F0ZA 2KWVB 4DWFA 1VD2A 2LXCA 3N20C 3PREA 1SE2A 1T5XD 3DHHC 3LXFA 2IGDA 2FCMA 3ZXRA 2LHDA 1WY8A 1Q10A 2DWQA 3NVYA 3PS6A 5AEKB 3L17A 3N1ZC 4WQMA 2WYQA 4LLGM 2INNE 3TEYA 1E8YA 3Q2AC 1QOAA 3QX1A 2KMCA 1WSPA 4IWQA 1SJED 2WU2B 1VJKA 1WH3A 1N63A 3AEAB 1C79A 2KVZA 3I9V1 3W9CB 1VR9A 2R61A 3ZUNA 1XLQA 4ITKA 3R7RA 2N4FA 5HFYA 3A9JB 2G3QB 2L3ZA 5G5GA 3Q3FA 4F7ZA 1WE7A 3VRBB 2RR9A 3ETRA 2MW5A 1TJEA 2Y3AA 2DBYA 4XX5A 4KIKB 1TY2A 1KOTA 3SR6A 1XCQL 4M0WB 2JSVX 2XK5B 2LXAA 4FBJB 1ENFA 3W1SC 1V80A 3TUOA 4CHKA 1QOFA 3ZW3A 4D2KA 4FA6A 3ML9A 2EELA 4XDDA 5AZGA 3ZIMA 2BS4B 2G9HD 4F1SA 3U52E 4ANUA 1RRBA 5LXIB 2M4NA 3SFDB 2A4ZA 5D6JB 3GZNI 5EDSA 4IW0A 2DNFA 1H4RA 4HJGE 4GSWA 3X23A 2JXXA 2KMAA 4ICUA 1AW7A 4HJKA 4KDIC 3MFGA 4US9A 3DBRI 3FILA 2JRIB 4HLEA 3ECIA 2KZRA 3MC0B 3DBLI 3W1SA 2BW2A 2HJ1A 1WXMA 1EWYC 3ABVB 4FJZA 2NBWB 4DK5A 4S17A 3W5UB 1PGAA 1XCTL 3EC8A 2LI5A 2RPVA 1ESFA 2L83A 3NY5A 4FJVB 3FC4A 4PS3A 1C4CA 2IY1B 3VQIA 3PLVA 4B0EA 5BMGA 5BYRA 1DOYA 2D3GA 2MWSB 5FK9C 3IBEA 3Q8CA 1JW9D 2L32A 2C7NB 1WYGA 2INCC 1JWMD 2JX5A 2NTSA 2WU5B 2FE8A 1CMXB 4BKGA 3AB5A 4GDLA 1HA5A 2LRUA 4HKZE 4S0RA 1N62A 4RFBA 2KDIA 3KVFB 4MGKE 2QMTA 3B9JA 1E8XA 2JYEA 2KLGA 3DCGA 1N5WA 1C4PA 1T6BX 4ANVA 2PE9A 1MG8A 1ZXIA 3HM6X 4RM9A 4W9EA 4WAAA 5CX3A 4NQLB 3T9LA 1OFFA 1HE8A 3RZFA 4ZRPA 1RFAA 2BYFA 4WWOA 1JWBD 1K53A 1TBEA 3PLUA 2ZNVC 4HEA1 1UGJA 3CSTA 1V1PA 3AI5A 1B1ZA 4XWTA 1ACCA 1E10A 1WMHA 2KOXA 4C80A 4GOCA 3VUXA 4WJQA 3RYTA 2WXKA 1GAQB 4GB9A 2KJHB 4GDKA 3TMPB 2RMMA 2PVOD 4US8A 2W9NA 2L0TA 1K52A 1E5WA 3ZQ4A 4MEMA 1ZPSA 5IAAC 4W9JA 2J7QB 3H7SA 3IT6B 2WDTB 3NS1A 1FFUA 1WWTA 1FRRA 3A33B 5D94A 1MI0A 3ZNID 2J53A 2MCNB 2DHZA 3ZGZA 3VR9B 1WXSA 1JALA 5BYSA 3Q8BA 1C1YB 4OVZA 5L83A 1WGKA 2J52A 1BXTA 5AZHA 1F9JA 3L10B 1WX7A 3HHMA 4B9KA 4PK1A 2YLMA 1QOBA 2K25A 2MRPA 4WWMA 1XEEA 3N3KB 3QIJA 5DPWA 5KHQA 2Z0DB 1JWAD 3DVNU 2C7HA 4II2B 2WXFA 1FRDA 1FXAA 1WRDB 4AUQC 4EUTA 3HVDA 3KUCB 5D7GA 2CJNA 1KRHA 2C5LC 1UBIA 1MFWA 5D3IB 3A9KA 4RNAA 2O6VA 3RNBC 4LTUA 2D3AA 4HK2A 3PV1A 3ZJTA 2L00B 4JQWC 2K6DB 1IYFA 2MBOA 3AE3B 2GBNA 2LJ5A 4LNOA 2EMSA 4MELA 1WR6E 3R2IA 1ZDXA 3L16A 2BKRB 2IDYA 3O65B 3N1XC 2NMQA 2BBCA 1SXTA 3BINA 2GBMA 2PEAA 3A1QA 2BKFA 4AWJA 1DGJA 1E90A 1UELA 2N7DA 2KDEB 3VTUA 1TT5B 2LFIA 2HDEA 3DVGX 5CHVC 2WXOA 2JU6X 3VTWA 1FPYA 3VH4B 3OJ4B 3Q3NC 4NQKE 2MEKA 1IPGA 3DDCB 2Z59B 3E9SA 3EECA 4RF0A 1V6EA 1ZW7A 2VZKD 4YSYB 2WXPA 4O1NA 4JE3B 3GB1A 2FBWB 4RGNA 2KC2A 3PTFC 3OJ3A 1TYGB 3ZLZA 3L4PA 2N9LA 2G45B 5T8IA 4P1CC 3DWMA 2PMVA 4DHJB 1TS2A 4RH6A
chains in the Genus database with same CATH topology
3ZNZB 1WGGA 1XQQA 2C60A 3D32A 1GC6A 4RMAA 2GMIC 2BGFA 1S3SG 4BKTA 4K1RB 4I6LB 3L08A 3EHVA 3QQ8B 2ZVNA 5CTRC 3UIPB 3APCA 2KWVB 3DQVA 2AL6A 4DWFA 2CKHB 1VD2A 2LXCA 3DPDA 3PREA 2MSED 5JHBA 1OQYA 2HE7A 3WA0A 2KHWB 1RAXA 1J0GA 3A4RA 1P1AA 4DDGD 2FCMA 2ZPYA 3DBHI 3ZDTA 1WY8A 4I6PA 2FAZA 3IHPC 1TGZB 3PS6A 5AEKB 1WJ6A 3L17A 3WAMA 1E8ZA 4N9F4 4FN2A 4X57B 2DAJA 2WYQA 1TZ1A 4XC2A 5KHOA 1Q1OA 4DHJD 2V3SA 2YVCA 1UD7A 3OLMD 1PQSA 4G3XB 2LGDA 3PZDA 3R7QA 3TCAA 5DPRA 3ZRFA 1E8YA 2KN5A 4W9KA 3QX1A 2MBQA 3APDA 4HCNB 1WF9A 3ZTCA 4I6NB 2KMCA 3NZUA 4WJNA 3B0AA 3RZWC 2J0KA 4JIOU 2NBVB 2NPTB 4IWQA 4WJPA 2KDFB 1XD3B 1WH3A 2K8BA 1BT0A 4NPNA 4EOYA 3ZUNA 2L8JA 4F8CB 4ASWC 2RD0A 4URKA 1P0RA 3R7RA 1UH6A 4PYZA 1V49A 2M1MA 2N4FA 3KH0A 4KSKC 5D2MB 3UQBA 2CHZA 3A9JB 2G3QB 3KUZA 2M17A 3IVFA 5BO4B 2L05A 2L3ZA 2M8SA 1WGRA 2M0XA 4A3PA 1ZKHA 2CR5A 1KLVA 1UZXB 4KVGB 3QARA 4PS8A 3SD5A 3IFWB 3Q3FA 1I42A 5HKHA 1WGDA 2ZPNA 1YQBA 1K8RB 4F7ZA 1WE7A 2ASQA 4J6IA 2MBEA 2RR9A 2KTRB 3H6NA 2G4DB 3WAPA 2MW5A 2J0MA 2KXJA 3W1YA 2K39A 1I35A 4XX5A 2KDBA 5JH5C 4KIKB 3DBSA 2HD5B 2KLCA 1KOTA 2PJHA 4BKSD 4M0WB 2GBKA 2XK5B 2LXAA 4WJOA 4GDLB 4LJPB 4FBJB 1Z5SB 2JF5A 2NBUA 4MJSA 2HJ8A 3W1SC 4KSLC 1V80A 3B08A 4CHKA 1WR1A 4W9HA 2FIFA 3X0WA 3ZW3A 3LJ3A 4FA6A 1WI0A 2CHWA 1V2YA 2ZJDA 3ML9A 5AZGA 3ALBA 3VH3B 1X1MA 1JRUA 4GGQA 3ZIMA 1TTNA 1RRBA 2N9EB 5FR6A 4ANUA 2M4NA 5LXIB 2EKEC 4MM3A 4E74A 1C3TA 4G11A 2NVUI 2LVQA 3ZVVA 2A4ZA 5D6JB 3GZNI 4ZDVA 2MX2A 3PRZA 2DZMA 3CMMB 2BPSA 4HPLB 5EDSA 4IW0A 1H4RA 5CHWA 3RT3B 4TQ0A 4GSWA 4EZJA 3X23A 2JXXA 2N1VA 2KMAA 4ICUA 4BVUC 4HJKA 2IZVB 2KD0A 4KDIC 1UBQA 4GXBA 3V60A 2BYVE 2BWES 3PGEA 4EZKA 3ZRCA 2D2QA 2KX0A 3QWZB 2KQ7A 2K8HA 3DBRI 2D11A 2JRIB 2MBBB 2NPTA 4HLEA 3ECIA 4AP4C 3ZTDA 2KZRA 3IG3A 3PRPB 3DBLI 3W1SA 2MA9B 3A4SC 1WXMA 3ZKJC 3JW0X 3UINB 4FJZA 2NBWB 4PS7A 1P98A 2I1JA 4DK5A 2IBIB 3PHXB 3WANA 4BKSA 3EC8A 2LI5A 4MSMB 4MJSB 1WFYA 2Y5BB 1GJZA 1G6JA 3AULA 3H7PB 3NY5A 4FJVB 1WMHB 1ZGUB 2GBJA 2FUHB 3NOBA 3NHEB 3P2BA 2V1YA 3GOEA 2IY1B 4PS3A 3VQIA 3L13A 1WX9A 3A9JA 3PLVA 2K6QA 2QHOA 3TL5A 4W9IA 4BOZB 3JSVA 4HDQA 4K7WA 5G2NA 4WWNA 3S2AA 2D3GA 4CO7A 2KK8A 2HTHA 4NY0A 3QC8B 2MWSB 4MH0E 2LZ6A 3U7DA 2FCSA 3IBEA 3V6EB 5E6PA 1R4MI 3H1UA 4K7SA 4BBNF 2C7NB 3RCZA 3N30A 2KTRA 3RD2A 3APFA 3ZNHB 1OEYJ 3PSEB 4EEWA 1Q5WB 4KIKA 2KJRA 3PT2B 2ZNVB 1WIAA 1FXTB 1WJUA 1YD8U 3KW5B 3M63B 1CMXB 2EMTA 4GIVA 4DHZE 2AEHA 2XEWA 5G55A 4BKGA 2XK5A 1KM7A 4GDLA 3V61A 4NNJB 2LRUA 1H8CA 2FNJB 2KX3A 5DPSA 1QZEA 2MP2B 2KWUB 2KDIA 4AJWA 3KVFB 4MGKE 3UF8A 1LQBA 1WM2A 2WWZA 4DBGA 1E8XA 2MLBA 2KLGA 3DCGA 3L0WB 4ANVA 1E7UA 2NCNA 2PE9A 2JT4B 1WXVA 3VDZA 5IA7A 3PVLA 4IC7B 1MG8A 1WGHA 1EO6A 4DDID 3EFUA 3PPAA 2DENB 3HM6X 1ISNA 4RM9A 4W9EA 4JL9A 2IYDB 4BOSC 2LRWA 4LDTB 4OVVA 4WAAA 4ZYNA 1WGYA 5JHAA 3U30A 2R2OA 3JSVB 3VXWA 4ICVA 2DZJA 5CX3A 4LCDE 4NQLB 3T9LA 2AL3A 1T0YA 2JPHA 1HE8A 3RZFA 3HIZA 3MJWA 1RFAA 3UGBB 3VAWA 1P3QU 3VUWA 4AJYB 2BYFA 4WWOA 4BBNC 4FLHA 1XT9B 3H9DA 3ONSA 3PRMB 4HCPB 1TBEA 2R2QA 2N7EA 2CS4A 4EZLA 5JZEB 2BF8B 4HDOA 3PLUA 3JVZX 3V62A 2VRRB 2ZNVC 1WE6A 2DX5B 2JUOA 2O2VB 3CSTA 4GU2A 1V5OA 3ZDMC 3HM3A 5DPTA 2CU1A 3TIXA 3AI5A 2IO0B 3H7PA 2LASA 2DZIA 1WMHA 2KOXA 1S1QB 1UGMA 4K7UA 5E6OA 1L7YA 4GOCA 4WWPA 2ZEQA 3VUXA 1M94A 2V4LA 4WJQA 4LDTD 3RYTA 2KQSA 2LGXA 3LDZE 4KZCA 4GB9A 4IM3A 4TV3A 3QK0A 2K1FA 2PPHA 5TR5A 2KFKB 4A3OA 2KJHB 1J8CA 3NS8A 4GDKA 3A9KB 2MBHA 3TMPB 3HK0A 4IWOA 4ZRIA 2O6VB 1U4AA 2W9NA 3R3MA 2L0TA 2LD9A 1E5WA 4MEMA 1V81A 5IAAC 3VFKA 4W9JA 1WZ0A 2J7QB 3H7SA 4E71A 4HPMB 2WDTB 2XBBC 3A33B 3KYCD 5GMVA 5D94A 1A5RA 2AWTA 2C9WB 4NAWB 3ZNID 2MCNB 1SGHA 5C23A 2N1WA 4W9DA 2JZ3B 2DHZA 4HWIB 2BWFA 4LJOB 4IM2A 3PHWB 3QJZA 2MP2A 3UQAA 3JYUA 4W9GA 4YL8A 2CHXA 2KKCA 4ANWA 3RUIB 1WXSA 4MGIE 2D10A 2L0FA 3SU8X 3WALA 1C1YB 3ZNGC 4KDLB 2I1KA 2N9XA 2BYEA 2NS5A 3CF6E 3T8MA 2D07B 4FJYA 5L83A 3U8ZA 2KVRA 4M8NA 2DYMA 2FCNA 4PYUA 2L7RA 2O6VD 2UYZB 3I3TB 3TJPA 3M3JA 2FIDA 2LWPA 5AZHA 3DVNV 2OOBB 4II3B 3M95A 2LGYA 1GUAB 1OEYA 4GDKB 1F9JA 4IG7B 2ZCBA 4W9CA 3L10B 3VHTC 4TKNA 3VVWB 1WX7A 3HHMA 3MHSD 2IO2B 4B9KA 2LVOA 5C1ZA 4HXDA 2RGFA 2YLMA 4JGHB 2K25A 2MRPA 3UIOB 3VUYA 2JVCA 4FULA 4FADA 1WZ3A 3KYDD 4BFRA 2JZZA 4AOFA 3SDLC 3Q3JA 5LLIA 1WM3A 4K81A 2O2VA 3N3KB 3VTVA 2ZZPB 2KO3A 3N32A 1RLFA 3QIJA 4FHKA 3WAOA 1YJ1A 3DOWA 1SE9A 2IO1B 5AZFA 4A20A 5DPWA 2B3AA 2Z0EB 5KHQA 1V5TA 3KUDB 3WIMA 3QA8A 2Z0DB 2RSUA 4EFOA 3DVNU 1VCBA 2C7HA 4IM0A 5E6NA 4II2B 4DHZB 3L54A 4G50A 2L76A 1WRDB 1YIWA 3SHQA 4G0NB 4AUQC 3AU4A 4EUTA 1LFDA 2KFJA 3OAWA 3KUCB 2G4SA 1IP9A 1NDDA 4CYEA 1EF1A 3ENEA 3B1LX 2K8CA 2MQJA 4XZ4A 1NBFC 1Y8RC 2A5UA 2KFKA 4IWPA 5D7GA 1LXDA 2JWZA 2C5LC 3K9PB 1UBIA 4IUMB 3A9KA 2UWQA 4NJ7A 2N9PC 2O6VA 1P9DU 2IO3B 4HK2A 4RM8A 3PV1A 2DZKA 2L00B 4JQWC 3M62B 2DYOA 2K6DB 1IYFA 1WJ4A 2MBOA 2REXA 2GBNA 2LJ5A 4E3CA 4KV2A 1EF5A 5DCNA 5L95C 2EMSA 2JRHA 3QHTA 4NAWA 4EKUA 4M8MA 4MELA 1WR6E 1WJNA 3AU5A 3L16A 4GMVA 2BKRB 3O65B 4ANXA 3K9OB 1LM8B 4F1SA 1WXAA 3CSFA 3V6CB 3BINA 2GBMA 1Z2MA 2PE6B 1J19A 2PEAA 4HVBA 3A1QA 2C7MB 2BKFA 3NZSA 3AXCA 4MGZE 4MGYE 5J18A 5J2RA 4AWJA 1E90A 1YX5B 1D3ZA 1UELA 1NI2A 1OGWA 2N7DA 2KDEB 2LVPA 3VTUA 2AYOB 4TQ1A 1Q0WB 3DVGX 4W9LA 2IY0B 1AARA 2LUEA 4TUUA 4WQOB 4B95A 1GC7A 4KZ0A 1GG3A 2KTFA 2ZCCA 1E8WA 5CHVC 1E7VA 4ZRKA 2KJ6A 5J17A 1KJTA 2NR2A 2WX1A 3QCAA 1V9JA 2RPQA 2JY6A 3VTWA 3VH4B 3TBLD 2DAFA 2KNBA 3DVGY 3OJ4B 4OVUA 3RULA 4MDKE 3BY4B 3ML8A 1V86A 4NQKE 1IPGA 2KANA 2Z59B 3DDCB 4DXAB 3EECA 1V6EA 1ZW7A 3QAQA 1YX6B 1EUVB 4B6WA 5LXHA 4FHJA 1OTRB 3MTNB 2GBRA 4JLCA 2WX0A 4ZRJA 2FCQA 1SIFA 2J0JA 1WX8A 2KC2A 1GNUA 3PTFC 2KC1A 2OJRA 3OJ3A 2KWCA 4P7IA 3ZO5B 3ZLZA 5CHFA 2G45B 2DYBA 3A1QB 1WYWB 4GN1A 3R66C 4W9FA 2GOWA 4DHJB 2ZVOA 3C0RB 4MSQB 1L2NA 4NJ6A 1R4NI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZNZ B;  1WGG A;  1XQQ A;  2C60 A;  3D32 A;  1GC6 A;  4RMA A;  2GMI C;  2BGF A;  1S3S G;  4BKT A;  4K1R B;  4I6L B;  3L08 A;  3EHV A;  3QQ8 B;  2ZVN A;  5CTR C;  3UIP B;  3APC A;  2KWV B;  3DQV A;  2AL6 A;  4DWF A;  2CKH B;  1VD2 A;  2LXC A;  3DPD A;  3PRE A;  2MSE D;  5JHB A;  1OQY A;  2HE7 A;  3WA0 A;  2KHW B;  1RAX A;  1J0G A;  3A4R A;  1P1A A;  4DDG D;  2FCM A;  2ZPY A;  3DBH I;  3ZDT A;  1WY8 A;  4I6P A;  2FAZ A;  3IHP C;  1TGZ B;  3PS6 A;  5AEK B;  1WJ6 A;  3L17 A;  3WAM A;  1E8Z A;  4N9F 4;  4FN2 A;  4X57 B;  2DAJ A;  2WYQ A;  1TZ1 A;  4XC2 A;  5KHO A;  1Q1O A;  4DHJ D;  2V3S A;  2YVC A;  1UD7 A;  3OLM D;  1PQS A;  4G3X B;  2LGD A;  3PZD A;  3R7Q A;  3TCA A;  5DPR A;  3ZRF A;  1E8Y A;  2KN5 A;  4W9K A;  3QX1 A;  2MBQ A;  3APD A;  4HCN B;  1WF9 A;  3ZTC A;  4I6N B;  2KMC A;  3NZU A;  4WJN A;  3B0A A;  3RZW C;  2J0K A;  4JIO U;  2NBV B;  2NPT B;  4IWQ A;  4WJP A;  2KDF B;  1XD3 B;  1WH3 A;  2K8B A;  1BT0 A;  4NPN A;  4EOY A;  3ZUN A;  2L8J A;  4F8C B;  4ASW C;  2RD0 A;  4URK A;  1P0R A;  3R7R A;  1UH6 A;  4PYZ A;  1V49 A;  2M1M A;  2N4F A;  3KH0 A;  4KSK C;  5D2M B;  3UQB A;  2CHZ A;  3A9J B;  2G3Q B;  3KUZ A;  2M17 A;  3IVF A;  5BO4 B;  2L05 A;  2L3Z A;  2M8S A;  1WGR A;  2M0X A;  4A3P A;  1ZKH A;  2CR5 A;  1KLV A;  1UZX B;  4KVG B;  3QAR A;  4PS8 A;  3SD5 A;  3IFW B;  3Q3F A;  1I42 A;  5HKH A;  1WGD A;  2ZPN A;  1YQB A;  1K8R B;  4F7Z A;  1WE7 A;  2ASQ A;  4J6I A;  2MBE A;  2RR9 A;  2KTR B;  3H6N A;  2G4D B;  3WAP A;  2MW5 A;  2J0M A;  2KXJ A;  3W1Y A;  2K39 A;  1I35 A;  4XX5 A;  2KDB A;  5JH5 C;  4KIK B;  3DBS A;  2HD5 B;  2KLC A;  1KOT A;  2PJH A;  4BKS D;  4M0W B;  2GBK A;  2XK5 B;  2LXA A;  4WJO A;  4GDL B;  4LJP B;  4FBJ B;  1Z5S B;  2JF5 A;  2NBU A;  4MJS A;  2HJ8 A;  3W1S C;  4KSL C;  1V80 A;  3B08 A;  4CHK A;  1WR1 A;  4W9H A;  2FIF A;  3X0W A;  3ZW3 A;  3LJ3 A;  4FA6 A;  1WI0 A;  2CHW A;  1V2Y A;  2ZJD A;  3ML9 A;  5AZG A;  3ALB A;  3VH3 B;  1X1M A;  1JRU A;  4GGQ A;  3ZIM A;  1TTN A;  1RRB A;  2N9E B;  5FR6 A;  4ANU A;  2M4N A;  5LXI B;  2EKE C;  4MM3 A;  4E74 A;  1C3T A;  4G11 A;  2NVU I;  2LVQ A;  3ZVV A;  2A4Z A;  5D6J B;  3GZN I;  4ZDV A;  2MX2 A;  3PRZ A;  2DZM A;  3CMM B;  2BPS A;  4HPL B;  5EDS A;  4IW0 A;  1H4R A;  5CHW A;  3RT3 B;  4TQ0 A;  4GSW A;  4EZJ A;  3X23 A;  2JXX A;  2N1V A;  2KMA A;  4ICU A;  4BVU C;  4HJK A;  2IZV B;  2KD0 A;  4KDI C;  1UBQ A;  4GXB A;  3V60 A;  2BYV E;  2BWE S;  3PGE A;  4EZK A;  3ZRC A;  2D2Q A;  2KX0 A;  3QWZ B;  2KQ7 A;  2K8H A;  3DBR I;  2D11 A;  2JRI B;  2MBB B;  2NPT A;  4HLE A;  3ECI A;  4AP4 C;  3ZTD A;  2KZR A;  3IG3 A;  3PRP B;  3DBL I;  3W1S A;  2MA9 B;  3A4S C;  1WXM A;  3ZKJ C;  3JW0 X;  3UIN B;  4FJZ A;  2NBW B;  4PS7 A;  1P98 A;  2I1J A;  4DK5 A;  2IBI B;  3PHX B;  3WAN A;  4BKS A;  3EC8 A;  2LI5 A;  4MSM B;  4MJS B;  1WFY A;  2Y5B B;  1GJZ A;  1G6J A;  3AUL A;  3H7P B;  3NY5 A;  4FJV B;  1WMH B;  1ZGU B;  2GBJ A;  2FUH B;  3NOB A;  3NHE B;  3P2B A;  2V1Y A;  3GOE A;  2IY1 B;  4PS3 A;  3VQI A;  3L13 A;  1WX9 A;  3A9J A;  3PLV A;  2K6Q A;  2QHO A;  3TL5 A;  4W9I A;  4BOZ B;  3JSV A;  4HDQ A;  4K7W A;  5G2N A;  4WWN A;  3S2A A;  2D3G A;  4CO7 A;  2KK8 A;  2HTH A;  4NY0 A;  3QC8 B;  2MWS B;  4MH0 E;  2LZ6 A;  3U7D A;  2FCS A;  3IBE A;  3V6E B;  5E6P A;  1R4M I;  3H1U A;  4K7S A;  4BBN F;  2C7N B;  3RCZ A;  3N30 A;  2KTR A;  3RD2 A;  3APF A;  3ZNH B;  1OEY J;  3PSE B;  4EEW A;  1Q5W B;  4KIK A;  2KJR A;  3PT2 B;  2ZNV B;  1WIA A;  1FXT B;  1WJU A;  1YD8 U;  3KW5 B;  3M63 B;  1CMX B;  2EMT A;  4GIV A;  4DHZ E;  2AEH A;  2XEW A;  5G55 A;  4BKG A;  2XK5 A;  1KM7 A;  4GDL A;  3V61 A;  4NNJ B;  2LRU A;  1H8C A;  2FNJ B;  2KX3 A;  5DPS A;  1QZE A;  2MP2 B;  2KWU B;  2KDI A;  4AJW A;  3KVF B;  4MGK E;  3UF8 A;  1LQB A;  1WM2 A;  2WWZ A;  4DBG A;  1E8X A;  2MLB A;  2KLG A;  3DCG A;  3L0W B;  4ANV A;  1E7U A;  2NCN A;  2PE9 A;  2JT4 B;  1WXV A;  3VDZ A;  5IA7 A;  3PVL A;  4IC7 B;  1MG8 A;  1WGH A;  1EO6 A;  4DDI D;  3EFU A;  3PPA A;  2DEN B;  3HM6 X;  1ISN A;  4RM9 A;  4W9E A;  4JL9 A;  2IYD B;  4BOS C;  2LRW A;  4LDT B;  4OVV A;  4WAA A;  4ZYN A;  1WGY A;  5JHA A;  3U30 A;  2R2O A;  3JSV B;  3VXW A;  4ICV A;  2DZJ A;  5CX3 A;  4LCD E;  4NQL B;  3T9L A;  2AL3 A;  1T0Y A;  2JPH A;  1HE8 A;  3RZF A;  3HIZ A;  3MJW A;  1RFA A;  3UGB B;  3VAW A;  1P3Q U;  3VUW A;  4AJY B;  2BYF A;  4WWO A;  4BBN C;  4FLH A;  1XT9 B;  3H9D A;  3ONS A;  3PRM B;  4HCP B;  1TBE A;  2R2Q A;  2N7E A;  2CS4 A;  4EZL A;  5JZE B;  2BF8 B;  4HDO A;  3PLU A;  3JVZ X;  3V62 A;  2VRR B;  2ZNV C;  1WE6 A;  2DX5 B;  2JUO A;  2O2V B;  3CST A;  4GU2 A;  1V5O A;  3ZDM C;  3HM3 A;  5DPT A;  2CU1 A;  3TIX A;  3AI5 A;  2IO0 B;  3H7P A;  2LAS A;  2DZI A;  1WMH A;  2KOX A;  1S1Q B;  1UGM A;  4K7U A;  5E6O A;  1L7Y A;  4GOC A;  4WWP A;  2ZEQ A;  3VUX A;  1M94 A;  2V4L A;  4WJQ A;  4LDT D;  3RYT A;  2KQS A;  2LGX A;  3LDZ E;  4KZC A;  4GB9 A;  4IM3 A;  4TV3 A;  3QK0 A;  2K1F A;  2PPH A;  5TR5 A;  2KFK B;  4A3O A;  2KJH B;  1J8C A;  3NS8 A;  4GDK A;  3A9K B;  2MBH A;  3TMP B;  3HK0 A;  4IWO A;  4ZRI A;  2O6V B;  1U4A A;  2W9N A;  3R3M A;  2L0T A;  2LD9 A;  1E5W A;  4MEM A;  1V81 A;  5IAA C;  3VFK A;  4W9J A;  1WZ0 A;  2J7Q B;  3H7S A;  4E71 A;  4HPM B;  2WDT B;  2XBB C;  3A33 B;  3KYC D;  5GMV A;  5D94 A;  1A5R A;  2AWT A;  2C9W B;  4NAW B;  3ZNI D;  2MCN B;  1SGH A;  5C23 A;  2N1W A;  4W9D A;  2JZ3 B;  2DHZ A;  4HWI B;  2BWF A;  4LJO B;  4IM2 A;  3PHW B;  3QJZ A;  2MP2 A;  3UQA A;  3JYU A;  4W9G A;  4YL8 A;  2CHX A;  2KKC A;  4ANW A;  3RUI B;  1WXS A;  4MGI E;  2D10 A;  2L0F A;  3SU8 X;  3WAL A;  1C1Y B;  3ZNG C;  4KDL B;  2I1K A;  2N9X A;  2BYE A;  2NS5 A;  3CF6 E;  3T8M A;  2D07 B;  4FJY A;  5L83 A;  3U8Z A;  2KVR A;  4M8N A;  2DYM A;  2FCN A;  4PYU A;  2L7R A;  2O6V D;  2UYZ B;  3I3T B;  3TJP A;  3M3J A;  2FID A;  2LWP A;  5AZH A;  3DVN V;  2OOB B;  4II3 B;  3M95 A;  2LGY A;  1GUA B;  1OEY A;  4GDK B;  1F9J A;  4IG7 B;  2ZCB A;  4W9C A;  3L10 B;  3VHT C;  4TKN A;  3VVW B;  1WX7 A;  3HHM A;  3MHS D;  2IO2 B;  4B9K A;  2LVO A;  5C1Z A;  4HXD A;  2RGF A;  2YLM A;  4JGH B;  2K25 A;  2MRP A;  3UIO B;  3VUY A;  2JVC A;  4FUL A;  4FAD A;  1WZ3 A;  3KYD D;  4BFR A;  2JZZ A;  4AOF A;  3SDL C;  3Q3J A;  5LLI A;  1WM3 A;  4K81 A;  2O2V A;  3N3K B;  3VTV A;  2ZZP B;  2KO3 A;  3N32 A;  1RLF A;  3QIJ A;  4FHK A;  3WAO A;  1YJ1 A;  3DOW A;  1SE9 A;  2IO1 B;  5AZF A;  4A20 A;  5DPW A;  2B3A A;  2Z0E B;  5KHQ A;  1V5T A;  3KUD B;  3WIM A;  3QA8 A;  2Z0D B;  2RSU A;  4EFO A;  3DVN U;  1VCB A;  2C7H A;  4IM0 A;  5E6N A;  4II2 B;  4DHZ B;  3L54 A;  4G50 A;  2L76 A;  1WRD B;  1YIW A;  3SHQ A;  4G0N B;  4AUQ C;  3AU4 A;  4EUT A;  1LFD A;  2KFJ A;  3OAW A;  3KUC B;  2G4S A;  1IP9 A;  1NDD A;  4CYE A;  1EF1 A;  3ENE A;  3B1L X;  2K8C A;  2MQJ A;  4XZ4 A;  1NBF C;  1Y8R C;  2A5U A;  2KFK A;  4IWP A;  5D7G A;  1LXD A;  2JWZ A;  2C5L C;  3K9P B;  1UBI A;  4IUM B;  3A9K A;  2UWQ A;  4NJ7 A;  2N9P C;  2O6V A;  1P9D U;  2IO3 B;  4HK2 A;  4RM8 A;  3PV1 A;  2DZK A;  2L00 B;  4JQW C;  3M62 B;  2DYO A;  2K6D B;  1IYF A;  1WJ4 A;  2MBO A;  2REX A;  2GBN A;  2LJ5 A;  4E3C A;  4KV2 A;  1EF5 A;  5DCN A;  5L95 C;  2EMS A;  2JRH A;  3QHT A;  4NAW A;  4EKU A;  4M8M A;  4MEL A;  1WR6 E;  1WJN A;  3AU5 A;  3L16 A;  4GMV A;  2BKR B;  3O65 B;  4ANX A;  3K9O B;  1LM8 B;  4F1S A;  1WXA A;  3CSF A;  3V6C B;  3BIN A;  2GBM A;  1Z2M A;  2PE6 B;  1J19 A;  2PEA A;  4HVB A;  3A1Q A;  2C7M B;  2BKF A;  3NZS A;  3AXC A;  4MGZ E;  4MGY E;  5J18 A;  5J2R A;  4AWJ A;  1E90 A;  1YX5 B;  1D3Z A;  1UEL A;  1NI2 A;  1OGW A;  2N7D A;  2KDE B;  2LVP A;  3VTU A;  2AYO B;  4TQ1 A;  1Q0W B;  3DVG X;  4W9L A;  2IY0 B;  1AAR A;  2LUE A;  4TUU A;  4WQO B;  4B95 A;  1GC7 A;  4KZ0 A;  1GG3 A;  2KTF A;  2ZCC A;  1E8W A;  5CHV C;  1E7V A;  4ZRK A;  2KJ6 A;  5J17 A;  1KJT A;  2NR2 A;  2WX1 A;  3QCA A;  1V9J A;  2RPQ A;  2JY6 A;  3VTW A;  3VH4 B;  3TBL D;  2DAF A;  2KNB A;  3DVG Y;  3OJ4 B;  4OVU A;  3RUL A;  4MDK E;  3BY4 B;  3ML8 A;  1V86 A;  4NQK E;  1IPG A;  2KAN A;  2Z59 B;  3DDC B;  4DXA B;  3EEC A;  1V6E A;  1ZW7 A;  3QAQ A;  1YX6 B;  1EUV B;  4B6W A;  5LXH A;  4FHJ A;  1OTR B;  3MTN B;  2GBR A;  4JLC A;  2WX0 A;  4ZRJ A;  2FCQ A;  1SIF A;  2J0J A;  1WX8 A;  2KC2 A;  1GNU A;  3PTF C;  2KC1 A;  2OJR A;  3OJ3 A;  2KWC A;  4P7I A;  3ZO5 B;  3ZLZ A;  5CHF A;  2G45 B;  2DYB A;  3A1Q B;  1WYW B;  4GN1 A;  3R66 C;  4W9F A;  2GOW A;  4DHJ B;  2ZVO A;  3C0R B;  4MSQ B;  1L2N A;  4NJ6 A;  1R4N I; 
#chains in the Genus database with same CATH topology
 1WGG A;  1F52 A;  4DQO C;  4A8X C;  1S3S G;  3AE7 B;  4K1R B;  4I6L B;  1HQR D;  5CTR C;  2XN9 C;  5MPO A;  1BML C;  5E6J A;  5JXV A;  2MSE D;  5JHB A;  4IDI A;  3I63 C;  3U4E G;  4DDG D;  4I6P A;  2FAZ A;  4EE2 A;  1YJI A;  2DLB A;  1WJ6 A;  4FN2 A;  1VZ7 A;  1SF0 A;  2DAJ A;  1V8C A;  4XC2 A;  1JRO A;  4DHJ D;  2V3S A;  1UD7 A;  2LGD A;  3PZD A;  5IN7 A;  1MHX A;  3TCA A;  4W9K A;  5BYQ A;  1IBX A;  1QF6 A;  3B0A A;  4L1B A;  3FIL B;  1T0Q C;  1DOX A;  4WJP A;  1ZP0 B;  4KGS A;  2K8B A;  4RF1 A;  3AEC B;  2K0P A;  1HTQ A;  2V3N A;  4EOY A;  1C78 A;  1D5Z C;  4ASW C;  2RD0 A;  1L5P A;  1P0R A;  1I4X A;  1F77 A;  3BWU D;  4LNN A;  2W55 A;  5D2M B;  4KSK C;  3UQB A;  2CHZ A;  2M17 A;  2M8S A;  1WGR A;  3OG5 A;  2CR5 A;  4PS8 A;  3SD5 A;  3IFW B;  1P7E A;  1WGD A;  2MHJ A;  1NVI D;  1YQ4 B;  3V05 A;  1HZ6 A;  2CU3 A;  2ASQ A;  2MBE A;  3AEF B;  3WAP A;  2J0M A;  3W1Y A;  2JQR B;  3N1Y C;  2KLC A;  4NJC A;  2BQQ A;  5GXG B;  1M4V A;  2GBK A;  2JYT A;  3U2S C;  4GDL B;  4LJP B;  3IAM 1;  1XLP A;  2NBU A;  3AEB B;  2HJ8 A;  3R2T A;  3B08 A;  3NG0 A;  4W9H A;  3LJ3 A;  1RFK A;  3VH3 B;  1JRU A;  1X1M A;  1TTN A;  1MVK A;  2EKE C;  1A70 A;  2LGS A;  4MM3 A;  2LVQ A;  2DZM A;  2BPS A;  2KT7 A;  1FCC C;  3BVM A;  1I7H A;  4IOI E;  3RI7 C;  2IZV B;  1WRI A;  4C7Y A;  3QWZ B;  4AP4 C;  2MA9 B;  3ZKJ C;  4ZHP A;  1I4H A;  1P98 A;  1V1P B;  4BKS A;  1B9R A;  3RMK C;  1PGX A;  5FKA C;  4MJS B;  1WFY A;  4A55 A;  1CQV A;  1G6J A;  1WMH B;  2GBJ A;  2FUH B;  3NHE B;  1WX9 A;  1EU4 A;  1IGC A;  3J9C A;  1HTO A;  2NTT A;  2G1E A;  1NYR A;  4W9I A;  5EE3 A;  4HRO A;  2GI9 A;  3RNF C;  2WXJ A;  2WXM A;  4WWN A;  4CO7 A;  3URY A;  4MH0 E;  1ZUD 2;  1ZDV A;  3AEE B;  3V6E B;  1PDX A;  4BBN F;  4K7S A;  1L6V A;  3RCZ A;  3N30 A;  3ZNH B;  4EEW A;  5C2T B;  3UI3 A;  1UF0 A;  2ZNV B;  1FXT B;  1WJU A;  1YD8 U;  3KW5 B;  2EMT A;  3RNC C;  2XEW A;  1K50 A;  1I4G A;  2WGS A;  4NNJ B;  1D4B A;  2MH7 A;  1H8C A;  2KX3 A;  2QEJ C;  5DPS A;  1QKZ A;  1QZE A;  2KWU B;  4HPP A;  4AJW A;  4YTN B;  3LB8 C;  1C9F A;  2YEP B;  2WWZ A;  2MLB A;  3EFC A;  1E7U A;  1WXV A;  3VDZ A;  5IA7 A;  4ACF A;  3BK2 A;  1EO6 A;  3EFU A;  4BOS C;  4LDT B;  4OVV A;  2RDB C;  3U30 A;  4AQ7 A;  3JSV B;  3VXW A;  4ICV A;  2DZJ A;  2QIE B;  3HIZ A;  1P3Q U;  2ACZ B;  3ONS A;  5IP4 D;  1STE A;  3HVZ A;  4WAF A;  2Y5P A;  3V62 A;  3Q8E A;  3BZD B;  3N9Y C;  3SEB A;  2JUO A;  3ZDM C;  1F2R I;  2CU1 A;  4YT0 B;  2SEB D;  2WLB A;  4YSZ B;  2LAS A;  4NAM A;  2ZEQ A;  2LMC A;  2V4L A;  5HHD G;  4LDT D;  2LGX A;  1PYW D;  4KZC A;  5H92 C;  2PPH A;  1PUT A;  1XF5 L;  3NS8 A;  3A9K B;  1FNU A;  4IWO A;  2O6V B;  4XGA B;  1U4A A;  3RN9 C;  4JPS A;  3OWE B;  4LNK A;  1V81 A;  3VFK A;  2D3C A;  4A9A A;  3P4R B;  3AE4 B;  1AWD A;  3LYY A;  2D3B A;  1SJH D;  2JZ3 B;  4HWI B;  2M56 B;  4MT5 A;  4IM2 A;  3PHW B;  3QJZ A;  2MP2 A;  3UQA A;  3JYU A;  4QAY A;  4YL8 A;  4ARI A;  4ANW A;  1PGB A;  3RUI B;  1TS3 A;  2D10 A;  3SU8 X;  2KYW A;  5BMI A;  1E7P B;  2I1K A;  2BYE A;  3CF6 E;  2D07 B;  4FJY A;  2PVG C;  4PYU A;  2L7R A;  2O6V D;  4KX6 B;  3NVZ A;  3RNA C;  2PW9 A;  3M3J A;  3DVN V;  2OOB B;  3M95 A;  3VHT C;  1T0R C;  4TKN A;  3VVW B;  3MHS D;  4HXD A;  4JGH B;  2EKI A;  4JWU C;  2J42 A;  2JVC A;  3KYD D;  3RFZ B;  4AOF A;  2BB6 A;  4KGT A;  1WM3 A;  4K81 A;  2O2V A;  5AUK A;  2ZZP B;  4FHK A;  3WAO A;  4ZOH C;  1YJ1 A;  3DOW A;  2B3A A;  3P63 A;  1VCB A;  5D3D A;  5E6N A;  4IM0 A;  2J4X A;  4DHZ B;  4G50 A;  1BUI C;  3C19 A;  3SHQ A;  3AU4 A;  1SSN A;  5C3J B;  1LFD A;  2KFJ A;  3OAW A;  2W3R A;  1N60 A;  1IP9 A;  3NZ3 A;  1EF1 A;  3ENE A;  1YQ3 B;  4XZ4 A;  3NUH B;  3I57 A;  1NBF C;  1Y8R C;  3GZN B;  4XYC A;  1L4Z B;  2X8X X;  2FUG 1;  1QLB B;  2LHE A;  1QQR A;  4Q2J A;  2BB5 A;  2KAC A;  3DBR B;  1N61 A;  5FR3 A;  1EF5 A;  3DBL B;  2KWD A;  4EKU A;  4NAW A;  3AU5 A;  2QC8 A;  1FEH A;  2IJ0 A;  1TKG A;  1LM8 B;  1YNT E;  1WXA A;  3CSF A;  4JX1 C;  1Z2M A;  2PE6 B;  4ZYS A;  3BVG A;  3NZS A;  4KKJ A;  5J2R A;  1SIJ A;  4C00 A;  1OGW A;  4RGO S;  4OZA A;  2AYO B;  4B95 A;  4TUU A;  1IBX B;  1UUP A;  4KZ0 A;  4R3D A;  3BYT B;  1E8W A;  4YTM B;  2I2Y A;  2KJ6 A;  2WX1 A;  2RPQ A;  1AN8 A;  3TBL D;  1T0S C;  3ML8 A;  3KWL A;  1TKE A;  1IGD A;  4L23 A;  4B6W A;  3MTN B;  2FCQ A;  2MJ3 A;  1QIL A;  2WDV B;  1SEB D;  1GNU A;  2KC1 A;  2KN4 A;  3ZXV A;  4P7I A;  3WCQ A;  3ZO5 B;  5IO9 A;  5CHF A;  1NYQ A;  1HXY D;  1WYW B;  4GN1 A;  3R66 C;  1RM6 C;  5H8Y E;  2KQ4 X;  4MSQ B;  1EU3 A;  2L52 A;  1VRA B;  2IGG A;  1NEK B;  3D32 A;  2RDH A;  4RMA A;  2BGF A;  2KDM A;  2JWU A;  3L08 A;  1QOG A;  3APC A;  3DQV A;  2AL6 A;  3P4S B;  2CKH B;  3DPD A;  2ZW0 A;  1OQY A;  2HE7 A;  2H88 B;  3WA0 A;  1RAX A;  1J0G A;  3A4R A;  1PFD A;  3DBH I;  1K51 A;  1SE4 A;  4UDU C;  2WQY B;  3IHP C;  2QJL A;  4MM3 B;  1YMH E;  3WAM A;  1E8Z A;  4N9F 4;  4X57 B;  1TZ1 A;  1OQQ A;  5KHO A;  2YVC A;  3OLM D;  1AYF A;  1PQS A;  4OHJ A;  4WUR A;  3ZRF A;  3APD A;  4HCN B;  4OZB A;  1FD6 A;  3ZTC A;  3NZU A;  2IND C;  4M0W A;  2J0K A;  2NBV B;  2KDF B;  1XD3 B;  1BT0 A;  2WXH A;  4F8C B;  2YEP F;  2QIL A;  4URK A;  1UH6 A;  4PYZ A;  1V49 A;  2M1M A;  3KH0 A;  3KLS X;  3Q14 C;  3KUZ A;  1F2R C;  2M0X A;  1UZX B;  4KVG B;  3QAR A;  4M00 A;  1TS5 A;  2W54 A;  3EUB 2;  2B76 B;  5HKH A;  1C77 A;  2ZPN A;  1K8R B;  4P1B C;  4M01 A;  4YSX B;  3DHG C;  2K39 A;  1I35 A;  2KDB A;  3DBS A;  4XWW A;  2PJH A;  2W3S A;  1LGR A;  4BKS D;  4WJO A;  1FNV A;  3P42 A;  2JF5 A;  2ON8 A;  3P1M A;  2CJO A;  3X0W A;  1WI0 A;  2CHW A;  1V2Y A;  3DBH B;  4GGQ A;  2N9E B;  5FR6 A;  4E74 A;  1C3T A;  2NVU I;  4ZDV A;  2MX2 A;  2OHF A;  4HPL B;  3O13 A;  4EZJ A;  4BVU C;  1RYJ A;  3T3O A;  1UBQ A;  1TS4 A;  4GXB A;  1FM0 D;  2BYV E;  3PGE A;  1D5M C;  4TMA B;  2Y5C A;  2D2Q A;  4N58 A;  2KX0 A;  2PIA A;  2NPT A;  1RWS A;  3ZTD A;  3PRP B;  3IG3 A;  3A4S C;  3JW0 X;  3MP9 A;  4PS7 A;  2IBI B;  2N0S B;  3WAN A;  1VZ8 A;  4MSM B;  2Y5B B;  1ZGU B;  1SBB B;  2XNA C;  3TL5 A;  3TEX A;  2BS2 B;  4MH8 A;  4BOZ B;  4K7W A;  4A6Q A;  5G2N A;  4C4V A;  4NY0 A;  3QC8 B;  4P16 A;  2LZ6 A;  2WXQ A;  2FCS A;  2V9H A;  3MC8 A;  1R4M I;  3H1U A;  4USA A;  4K3B A;  2KTR A;  1E0Z A;  1OEY J;  3PSE B;  1Q5W B;  2KJR A;  3PT2 B;  1WIA A;  3M63 B;  4GIV A;  2AEH A;  1KM7 A;  1YJJ A;  3V61 A;  4L2Y A;  4CQN A;  3NJT A;  4K3C A;  2FNJ B;  2I38 A;  2MP2 B;  4C7Z A;  2V3P A;  1MG4 A;  1C4A A;  2WXN A;  3L0W B;  4ZRQ A;  2NCN A;  4YTP B;  2JT4 B;  1L4D B;  1JCK B;  3TSS A;  1ISN A;  1YN4 A;  4JL9 A;  2LRW A;  4ZYN A;  4LCD E;  2WHI A;  2AL3 A;  1NEN B;  4WIP A;  1T0Y A;  3UGB B;  3VAW A;  4AJY B;  1F1H A;  4BBN C;  4FLH A;  3H9D A;  4HCP B;  5AUI A;  5JZE B;  2BF8 B;  4HDO A;  3JVZ X;  2AX5 A;  2DX5 B;  2O2V B;  4GU2 A;  3HM3 A;  2IO0 B;  1LO5 D;  3H7P A;  3DHI C;  1S1Q B;  4K7U A;  4WWP A;  1M94 A;  1UWM A;  2K3U A;  1JRP A;  3B2F A;  4TV3 A;  3QK0 A;  2WXR A;  1VZ6 A;  2MBH A;  1DYQ A;  3BVZ A;  3P4P B;  1ET9 A;  1IUE A;  5G5H A;  2WNM A;  3AE6 B;  1WZ0 A;  4E71 A;  4HPM B;  4PT5 A;  2XBB C;  3NVW A;  2AWT A;  2C9W B;  4NAW B;  4KGR A;  1SGH A;  2N1W A;  4W9D A;  1L6U A;  1CZP A;  4YWG G;  1MHH E;  3PZ8 A;  3HRD D;  4MGI E;  3GE8 C;  4KDL B;  1UWX A;  2N9X A;  3T8M A;  2M19 A;  2KVR A;  2M0A A;  3CWI A;  2V0G A;  2UYZ B;  3TJP A;  1P7F A;  2FID A;  3RNG C;  2QDF A;  1OEY A;  1FNW A;  4GDK B;  4M02 A;  4IG7 B;  1I4P A;  4W9C A;  2IO2 B;  3AE8 B;  2RGF A;  2X38 A;  1L0Y B;  3UIO B;  4FUL A;  1JWS D;  1WZ3 A;  5HG2 A;  4BFR A;  2JZZ A;  3Q6B A;  3SDL C;  3Q3J A;  5LLI A;  3VTV A;  3N32 A;  2KO3 A;  1CK1 A;  1N5X A;  2IO1 B;  5AZF A;  4DXG A;  2PTL A;  3WIM A;  3QA8 A;  4C56 C;  2RSU A;  3AE1 B;  1D5X C;  1SB3 C;  2KAJ A;  2WXI A;  4P6V F;  1ROE A;  1NDD A;  4CYE A;  2K8C A;  4FXC A;  2KFK A;  2A5U A;  1LXD A;  2JWZ A;  3K9P B;  3U7Z A;  4IUM B;  2WDR B;  2JXT A;  2UWQ A;  4NJ7 A;  2N9P C;  2IO3 B;  2DZK A;  3M62 B;  2REX A;  5DCN A;  2JRH A;  3QHT A;  1WJN A;  4GMV A;  4OZC A;  4N59 A;  3MHZ A;  3V6C B;  3PZ7 A;  1KLU D;  1R7S A;  3Q3O C;  2H89 B;  1J19 A;  3T3N A;  4HVB A;  3AXC A;  4MGZ E;  4MGY E;  5J18 A;  1YX5 B;  1CJE A;  4TQ1 A;  4ARC A;  2IY0 B;  1GC7 A;  3RPF C;  3AN1 A;  4ZRK A;  1KJT A;  1V9J A;  1V97 A;  2JY6 A;  3RUL A;  3AMZ A;  4OVU A;  2RDG A;  3BY4 B;  1V86 A;  3R8B A;  2KAN A;  4DXA B;  3QAQ A;  1YX6 B;  5LXH A;  1FMA D;  1OTR B;  4FHJ A;  2GBR A;  4JLC A;  4ZRJ A;  2L1A A;  1SIF A;  4MAC A;  1KFY B;  3Q3M C;  1WX8 A;  1XXG A;  2KWC A;  3A1Q B;  4H2A A;  2ZVO A;  1L2N A;  4NJ6 A;  1SE3 A;  1R4N I;  1E9M A;  3W5V B;  3ZNZ B;  3QQ8 B;  3EHV A;  3GE3 C;  2AQ1 B;  3HUI A;  3UIP B;  1UNS A;  3BK1 A;  2KHW B;  2WS3 B;  2K9X A;  3GS2 A;  1P1A A;  2ZPY A;  3ZDT A;  1TGZ B;  4N6E B;  5HI1 A;  2ZW1 A;  1FO4 A;  1Q1O A;  4LNF A;  1L0V B;  4G3X B;  3R7Q A;  1GB1 A;  5DPR A;  2KN5 A;  2MBQ A;  4BZA A;  1WF9 A;  1QT9 A;  3H8H A;  4I6N B;  3SFE B;  4WJN A;  3AE5 B;  3RZW C;  4JIO U;  2NPT B;  1KF6 B;  4RGT A;  4NPN A;  1XLO A;  2L8J A;  4ZHO A;  4TSS A;  1EWC A;  4DXF A;  2OJW A;  3FKY A;  3KQ4 A;  1HZ5 A;  5EE1 A;  3IVF A;  5BO4 B;  2L05 A;  4A3P A;  1ZKH A;  2Q5W D;  1KLV A;  2V4I B;  3AEG B;  3VRA B;  2LUM A;  4C4V B;  1I42 A;  1YQB A;  2IPK D;  1R4N B;  4J6I A;  2WXL A;  2KTR B;  4RGM A;  3H6N A;  2G4D B;  1TKY A;  2KXJ A;  5JH5 C;  2HD5 B;  1Z5S B;  4MJS A;  2WP9 B;  4KSL C;  2MJE A;  3EA6 A;  1WR1 A;  2BVC A;  2FIF A;  3TEZ A;  3AE2 B;  1L0X B;  2ZJD A;  3IXS A;  3ALB A;  1FCL A;  3BYY B;  2WXG A;  1KTK A;  2W82 A;  2PKO A;  4G11 A;  1J7A A;  3ZVV A;  3BII D;  3PRZ A;  3CMM B;  5LNK 1;  5CHW A;  3RT3 B;  4TQ0 A;  1GPX A;  1XO3 A;  2SAK A;  3P4Q B;  4YXD B;  2N1V A;  4GLS C;  3AM9 A;  1N6Z A;  2KD0 A;  3V60 A;  1YOV B;  1ZOY B;  2BWE S;  4EZK A;  3ZRC A;  2BYT A;  2KQ7 A;  2K8H A;  2GRI A;  2D11 A;  2MBB B;  2QSD A;  2VH2 A;  1KLG D;  4LK0 M;  3UIN B;  4RCO A;  2I1J A;  3PHX B;  1JQ4 A;  3Q8A A;  1GJZ A;  1GB4 A;  3AUL A;  3H7P B;  1YN3 A;  1FFV A;  1XLN A;  3NOB A;  3P2B A;  2V1Y A;  3GOE A;  3AED B;  3L13 A;  3A9J A;  1MJD A;  4OW0 A;  2K6Q A;  2QHO A;  5EE9 A;  2ONQ A;  3JSV A;  4HDQ A;  3S2A A;  1ZXH A;  2BTE A;  2KK8 A;  2HTH A;  1ET6 A;  3U7D A;  5E6P A;  1WXQ A;  2AQ3 B;  4WH4 A;  3RD2 A;  3APF A;  2HTM E;  2D5G A;  5EE0 A;  4KIK A;  4DHZ E;  5G55 A;  2OED A;  2XK5 A;  3CIR B;  3EGR A;  1D6E C;  1OQR A;  3UF8 A;  1TZO A;  2K5P A;  2LGI A;  1LQB A;  1WM2 A;  4DBG A;  5TSS A;  3VR8 B;  3ZJU A;  3PVL A;  3GP7 A;  4IC7 B;  3NRZ A;  1WGH A;  4DDI D;  3PPA A;  2DEN B;  2IYD B;  5JHA A;  1WGY A;  2R2O A;  1JML A;  1TY0 A;  3AE9 B;  2JPH A;  3IT4 B;  3MJW A;  3VUW A;  1XT9 B;  1NI3 A;  3PRM B;  2R2Q A;  2N7E A;  2CS4 A;  4EZL A;  2Z8L A;  1V1O A;  2KMM A;  2VRR B;  2LJI A;  1WE6 A;  1V5O A;  3V3X A;  1J7B A;  5DPT A;  2VH1 A;  3TIX A;  2VZK B;  3Q69 A;  2DZI A;  1UGM A;  5E6O A;  1FXI A;  1L7Y A;  2TSS A;  2KQS A;  3LDZ E;  4IM3 A;  5TR5 A;  2K1F A;  2KFK B;  4A3O A;  1J8C A;  3IAS 1;  4HRS A;  2GLS A;  3HK0 A;  4NZL B;  4AS1 A;  2JZP A;  4ZRI A;  3R3M A;  3NVV A;  2AQ2 B;  2LD9 A;  2N9K A;  4XDC A;  5I4D A;  3KYC D;  5GMV A;  1A5R A;  5C23 A;  4LJO B;  2BWF A;  2GB1 A;  4W9G A;  2CHX A;  2KKC A;  1TIF A;  2L0F A;  3WAL A;  3ZNG C;  2NS5 A;  4BAX A;  3U8Z A;  4M8N A;  2DYM A;  2FCN A;  3MC9 A;  3I3T B;  1J7C A;  2BS3 B;  2LWP A;  4II3 B;  1GUA B;  2LGY A;  2ZCB A;  3AH7 A;  2BT6 A;  2E6X A;  5C1Z A;  1Y56 A;  2LVO A;  1FIQ A;  1ZE3 D;  3VUY A;  4FAD A;  2N7J A;  1RLF A;  3RNE C;  4A20 A;  1SE9 A;  2Z0E B;  2E3T A;  1V5T A;  3KUD B;  3PO0 A;  4EFO A;  3ZJV A;  5IOI A;  3AV8 A;  3L54 A;  3Q8F A;  4KKI A;  2L76 A;  1YIW A;  4G0N B;  3I5J C;  2G4S A;  3B1L X;  2MQJ A;  4IWP A;  4J3O D;  3ZYY X;  1KH0 A;  1P9D U;  4RM8 A;  2DYO A;  1WJ4 A;  3FAH A;  1JWU D;  3TEW A;  4LNI A;  2ICI A;  4E3C A;  4KV2 A;  5L95 C;  1E6E B;  1T3Q A;  4M8M A;  1I4Q A;  1GOZ A;  3B2G A;  4ANX A;  3K9O B;  4REZ A;  4JWS C;  1EM7 A;  2IGH A;  4IKG A;  3MJ5 A;  2C7M B;  2K22 A;  1D3Z A;  1NI2 A;  1YN5 A;  2LVP A;  1VDV A;  1Q0W B;  4W9L A;  2LUE A;  1AAR A;  4WQO B;  1GG3 A;  1R4M B;  2KTF A;  2ZCC A;  1E7V A;  3KWV A;  5J17 A;  1C76 A;  1VLB A;  2NR2 A;  3QCA A;  2DAF A;  2KNB A;  3DVG Y;  4MDK E;  2WDQ B;  2UU7 A;  1MPE A;  2LEK A;  4A90 A;  1EUV B;  3W2D A;  2WX0 A;  5IKC M;  1HEZ E;  1I4R A;  2J0J A;  2INP E;  2OJR A;  1DOI A;  2MJD A;  2DYB A;  3E56 A;  4XE0 A;  4W9F A;  2GOW A;  3C0R B;  4HKQ A;  2PLP A;  1XQQ A;  2C60 A;  5BMH A;  1GC6 A;  2GMI C;  4BKT A;  3C8Y A;  2QCZ A;  3DWG C;  2ZVN A;  4B0M A;  1F0Z A;  2KWV B;  4DWF A;  1VD2 A;  2LXC A;  3N20 C;  3PRE A;  1SE2 A;  1T5X D;  3DHH C;  3LXF A;  2IGD A;  2FCM A;  3ZXR A;  2LHD A;  1WY8 A;  1Q10 A;  2DWQ A;  3NVY A;  3PS6 A;  5AEK B;  3L17 A;  3N1Z C;  4WQM A;  2WYQ A;  4LLG M;  2INN E;  3TEY A;  1E8Y A;  3Q2A C;  1QOA A;  3QX1 A;  2KMC A;  1WSP A;  4IWQ A;  1SJE D;  2WU2 B;  1VJK A;  1WH3 A;  1N63 A;  3AEA B;  1C79 A;  2KVZ A;  3I9V 1;  3W9C B;  1VR9 A;  2R61 A;  3ZUN A;  1XLQ A;  4ITK A;  3R7R A;  2N4F A;  5HFY A;  3A9J B;  2G3Q B;  2L3Z A;  5G5G A;  3Q3F A;  4F7Z A;  1WE7 A;  3VRB B;  2RR9 A;  3ETR A;  2MW5 A;  1TJE A;  2Y3A A;  2DBY A;  4XX5 A;  4KIK B;  1TY2 A;  1KOT A;  3SR6 A;  1XCQ L;  4M0W B;  2JSV X;  2XK5 B;  2LXA A;  4FBJ B;  1ENF A;  3W1S C;  1V80 A;  3TUO A;  4CHK A;  1QOF A;  3ZW3 A;  4D2K A;  4FA6 A;  3ML9 A;  2EEL A;  4XDD A;  5AZG A;  3ZIM A;  2BS4 B;  2G9H D;  4F1S A;  3U52 E;  4ANU A;  1RRB A;  5LXI B;  2M4N A;  3SFD B;  2A4Z A;  5D6J B;  3GZN I;  5EDS A;  4IW0 A;  2DNF A;  1H4R A;  4HJG E;  4GSW A;  3X23 A;  2JXX A;  2KMA A;  4ICU A;  1AW7 A;  4HJK A;  4KDI C;  3MFG A;  4US9 A;  3DBR I;  3FIL A;  2JRI B;  4HLE A;  3ECI A;  2KZR A;  3MC0 B;  3DBL I;  3W1S A;  2BW2 A;  2HJ1 A;  1WXM A;  1EWY C;  3ABV B;  4FJZ A;  2NBW B;  4DK5 A;  4S17 A;  3W5U B;  1PGA A;  1XCT L;  3EC8 A;  2LI5 A;  2RPV A;  1ESF A;  2L83 A;  3NY5 A;  4FJV B;  3FC4 A;  4PS3 A;  1C4C A;  2IY1 B;  3VQI A;  3PLV A;  4B0E A;  5BMG A;  5BYR A;  1DOY A;  2D3G A;  2MWS B;  5FK9 C;  3IBE A;  3Q8C A;  1JW9 D;  2L32 A;  2C7N B;  1WYG A;  2INC C;  1JWM D;  2JX5 A;  2NTS A;  2WU5 B;  2FE8 A;  1CMX B;  4BKG A;  3AB5 A;  4GDL A;  1HA5 A;  2LRU A;  4HKZ E;  4S0R A;  1N62 A;  4RFB A;  2KDI A;  3KVF B;  4MGK E;  2QMT A;  3B9J A;  1E8X A;  2JYE A;  2KLG A;  3DCG A;  1N5W A;  1C4P A;  1T6B X;  4ANV A;  2PE9 A;  1MG8 A;  1ZXI A;  3HM6 X;  4RM9 A;  4W9E A;  4WAA A;  5CX3 A;  4NQL B;  3T9L A;  1OFF A;  1HE8 A;  3RZF A;  4ZRP A;  1RFA A;  2BYF A;  4WWO A;  1JWB D;  1K53 A;  1TBE A;  3PLU A;  2ZNV C;  4HEA 1;  1UGJ A;  3CST A;  1V1P A;  3AI5 A;  1B1Z A;  4XWT A;  1ACC A;  1E10 A;  1WMH A;  2KOX A;  4C80 A;  4GOC A;  3VUX A;  4WJQ A;  3RYT A;  2WXK A;  1GAQ B;  4GB9 A;  2KJH B;  4GDK A;  3TMP B;  2RMM A;  2PVO D;  4US8 A;  2W9N A;  2L0T A;  1K52 A;  1E5W A;  3ZQ4 A;  4MEM A;  1ZPS A;  5IAA C;  4W9J A;  2J7Q B;  3H7S A;  3IT6 B;  2WDT B;  3NS1 A;  1FFU A;  1WWT A;  1FRR A;  3A33 B;  5D94 A;  1MI0 A;  3ZNI D;  2J53 A;  2MCN B;  2DHZ A;  3ZGZ A;  3VR9 B;  1WXS A;  1JAL A;  5BYS A;  3Q8B A;  1C1Y B;  4OVZ A;  5L83 A;  1WGK A;  2J52 A;  1BXT A;  5AZH A;  1F9J A;  3L10 B;  1WX7 A;  3HHM A;  4B9K A;  4PK1 A;  2YLM A;  1QOB A;  2K25 A;  2MRP A;  4WWM A;  1XEE A;  3N3K B;  3QIJ A;  5DPW A;  5KHQ A;  2Z0D B;  1JWA D;  3DVN U;  2C7H A;  4II2 B;  2WXF A;  1FRD A;  1FXA A;  1WRD B;  4AUQ C;  4EUT A;  3HVD A;  3KUC B;  5D7G A;  2CJN A;  1KRH A;  2C5L C;  1UBI A;  1MFW A;  5D3I B;  3A9K A;  4RNA A;  2O6V A;  3RNB C;  4LTU A;  2D3A A;  4HK2 A;  3PV1 A;  3ZJT A;  2L00 B;  4JQW C;  2K6D B;  1IYF A;  2MBO A;  3AE3 B;  2GBN A;  2LJ5 A;  4LNO A;  2EMS A;  4MEL A;  1WR6 E;  3R2I A;  1ZDX A;  3L16 A;  2BKR B;  2IDY A;  3O65 B;  3N1X C;  2NMQ A;  2BBC A;  1SXT A;  3BIN A;  2GBM A;  2PEA A;  3A1Q A;  2BKF A;  4AWJ A;  1DGJ A;  1E90 A;  1UEL A;  2N7D A;  2KDE B;  3VTU A;  1TT5 B;  2LFI A;  2HDE A;  3DVG X;  5CHV C;  2WXO A;  2JU6 X;  3VTW A;  1FPY A;  3VH4 B;  3OJ4 B;  3Q3N C;  4NQK E;  2MEK A;  1IPG A;  3DDC B;  2Z59 B;  3E9S A;  3EEC A;  4RF0 A;  1V6E A;  1ZW7 A;  2VZK D;  4YSY B;  2WXP A;  4O1N A;  4JE3 B;  3GB1 A;  2FBW B;  4RGN A;  2KC2 A;  3PTF C;  3OJ3 A;  1TYG B;  3ZLZ A;  3L4P A;  2N9L A;  2G45 B;  5T8I A;  4P1C C;  3DWM A;  2PMV A;  4DHJ B;  1TS2 A;  4RH6 A; 
#chains in the Genus database with same CATH homology
 3ZNZ B;  1WGG A;  1XQQ A;  2C60 A;  3D32 A;  1GC6 A;  4RMA A;  2GMI C;  2BGF A;  1S3S G;  4BKT A;  4K1R B;  4I6L B;  3L08 A;  3EHV A;  3QQ8 B;  2ZVN A;  5CTR C;  3UIP B;  3APC A;  2KWV B;  3DQV A;  2AL6 A;  4DWF A;  2CKH B;  1VD2 A;  2LXC A;  3DPD A;  3PRE A;  2MSE D;  5JHB A;  1OQY A;  2HE7 A;  3WA0 A;  2KHW B;  1RAX A;  1J0G A;  3A4R A;  1P1A A;  4DDG D;  2FCM A;  2ZPY A;  3DBH I;  3ZDT A;  1WY8 A;  4I6P A;  2FAZ A;  3IHP C;  1TGZ B;  3PS6 A;  5AEK B;  1WJ6 A;  3L17 A;  3WAM A;  1E8Z A;  4N9F 4;  4FN2 A;  4X57 B;  2DAJ A;  2WYQ A;  1TZ1 A;  4XC2 A;  5KHO A;  1Q1O A;  4DHJ D;  2V3S A;  2YVC A;  1UD7 A;  3OLM D;  1PQS A;  4G3X B;  2LGD A;  3PZD A;  3R7Q A;  3TCA A;  5DPR A;  3ZRF A;  1E8Y A;  2KN5 A;  4W9K A;  3QX1 A;  2MBQ A;  3APD A;  4HCN B;  1WF9 A;  3ZTC A;  4I6N B;  2KMC A;  3NZU A;  4WJN A;  3B0A A;  3RZW C;  2J0K A;  4JIO U;  2NBV B;  2NPT B;  4IWQ A;  4WJP A;  2KDF B;  1XD3 B;  1WH3 A;  2K8B A;  1BT0 A;  4NPN A;  4EOY A;  3ZUN A;  2L8J A;  4F8C B;  4ASW C;  2RD0 A;  4URK A;  1P0R A;  3R7R A;  1UH6 A;  4PYZ A;  1V49 A;  2M1M A;  2N4F A;  3KH0 A;  4KSK C;  5D2M B;  3UQB A;  2CHZ A;  3A9J B;  2G3Q B;  3KUZ A;  2M17 A;  3IVF A;  5BO4 B;  2L05 A;  2L3Z A;  2M8S A;  1WGR A;  2M0X A;  4A3P A;  1ZKH A;  2CR5 A;  1KLV A;  1UZX B;  4KVG B;  3QAR A;  4PS8 A;  3SD5 A;  3IFW B;  3Q3F A;  1I42 A;  5HKH A;  1WGD A;  2ZPN A;  1YQB A;  1K8R B;  4F7Z A;  1WE7 A;  2ASQ A;  4J6I A;  2MBE A;  2RR9 A;  2KTR B;  3H6N A;  2G4D B;  3WAP A;  2MW5 A;  2J0M A;  2KXJ A;  3W1Y A;  2K39 A;  1I35 A;  4XX5 A;  2KDB A;  5JH5 C;  4KIK B;  3DBS A;  2HD5 B;  2KLC A;  1KOT A;  2PJH A;  4BKS D;  4M0W B;  2GBK A;  2XK5 B;  2LXA A;  4WJO A;  4GDL B;  4LJP B;  4FBJ B;  1Z5S B;  2JF5 A;  2NBU A;  4MJS A;  2HJ8 A;  3W1S C;  4KSL C;  1V80 A;  3B08 A;  4CHK A;  1WR1 A;  4W9H A;  2FIF A;  3X0W A;  3ZW3 A;  3LJ3 A;  4FA6 A;  1WI0 A;  2CHW A;  1V2Y A;  2ZJD A;  3ML9 A;  5AZG A;  3ALB A;  3VH3 B;  1X1M A;  1JRU A;  4GGQ A;  3ZIM A;  1TTN A;  1RRB A;  2N9E B;  5FR6 A;  4ANU A;  2M4N A;  5LXI B;  2EKE C;  4MM3 A;  4E74 A;  1C3T A;  4G11 A;  2NVU I;  2LVQ A;  3ZVV A;  2A4Z A;  5D6J B;  3GZN I;  4ZDV A;  2MX2 A;  3PRZ A;  2DZM A;  3CMM B;  2BPS A;  4HPL B;  5EDS A;  4IW0 A;  1H4R A;  5CHW A;  3RT3 B;  4TQ0 A;  4GSW A;  4EZJ A;  3X23 A;  2JXX A;  2N1V A;  2KMA A;  4ICU A;  4BVU C;  4HJK A;  2IZV B;  2KD0 A;  4KDI C;  1UBQ A;  4GXB A;  3V60 A;  2BYV E;  2BWE S;  3PGE A;  4EZK A;  3ZRC A;  2D2Q A;  2KX0 A;  3QWZ B;  2KQ7 A;  2K8H A;  3DBR I;  2D11 A;  2JRI B;  2MBB B;  2NPT A;  4HLE A;  3ECI A;  4AP4 C;  3ZTD A;  2KZR A;  3IG3 A;  3PRP B;  3DBL I;  3W1S A;  2MA9 B;  3A4S C;  1WXM A;  3ZKJ C;  3JW0 X;  3UIN B;  4FJZ A;  2NBW B;  4PS7 A;  1P98 A;  2I1J A;  4DK5 A;  2IBI B;  3PHX B;  3WAN A;  4BKS A;  3EC8 A;  2LI5 A;  4MSM B;  4MJS B;  1WFY A;  2Y5B B;  1GJZ A;  1G6J A;  3AUL A;  3H7P B;  3NY5 A;  4FJV B;  1WMH B;  1ZGU B;  2GBJ A;  2FUH B;  3NOB A;  3NHE B;  3P2B A;  2V1Y A;  3GOE A;  2IY1 B;  4PS3 A;  3VQI A;  3L13 A;  1WX9 A;  3A9J A;  3PLV A;  2K6Q A;  2QHO A;  3TL5 A;  4W9I A;  4BOZ B;  3JSV A;  4HDQ A;  4K7W A;  5G2N A;  4WWN A;  3S2A A;  2D3G A;  4CO7 A;  2KK8 A;  2HTH A;  4NY0 A;  3QC8 B;  2MWS B;  4MH0 E;  2LZ6 A;  3U7D A;  2FCS A;  3IBE A;  3V6E B;  5E6P A;  1R4M I;  3H1U A;  4K7S A;  4BBN F;  2C7N B;  3RCZ A;  3N30 A;  2KTR A;  3RD2 A;  3APF A;  3ZNH B;  1OEY J;  3PSE B;  4EEW A;  1Q5W B;  4KIK A;  2KJR A;  3PT2 B;  2ZNV B;  1WIA A;  1FXT B;  1WJU A;  1YD8 U;  3KW5 B;  3M63 B;  1CMX B;  2EMT A;  4GIV A;  4DHZ E;  2AEH A;  2XEW A;  5G55 A;  4BKG A;  2XK5 A;  1KM7 A;  4GDL A;  3V61 A;  4NNJ B;  2LRU A;  1H8C A;  2FNJ B;  2KX3 A;  5DPS A;  1QZE A;  2MP2 B;  2KWU B;  2KDI A;  4AJW A;  3KVF B;  4MGK E;  3UF8 A;  1LQB A;  1WM2 A;  2WWZ A;  4DBG A;  1E8X A;  2MLB A;  2KLG A;  3DCG A;  3L0W B;  4ANV A;  1E7U A;  2NCN A;  2PE9 A;  2JT4 B;  1WXV A;  3VDZ A;  5IA7 A;  3PVL A;  4IC7 B;  1MG8 A;  1WGH A;  1EO6 A;  4DDI D;  3EFU A;  3PPA A;  2DEN B;  3HM6 X;  1ISN A;  4RM9 A;  4W9E A;  4JL9 A;  2IYD B;  4BOS C;  2LRW A;  4LDT B;  4OVV A;  4WAA A;  4ZYN A;  1WGY A;  5JHA A;  3U30 A;  2R2O A;  3JSV B;  3VXW A;  4ICV A;  2DZJ A;  5CX3 A;  4LCD E;  4NQL B;  3T9L A;  2AL3 A;  1T0Y A;  2JPH A;  1HE8 A;  3RZF A;  3HIZ A;  3MJW A;  1RFA A;  3UGB B;  3VAW A;  1P3Q U;  3VUW A;  4AJY B;  2BYF A;  4WWO A;  4BBN C;  4FLH A;  1XT9 B;  3H9D A;  3ONS A;  3PRM B;  4HCP B;  1TBE A;  2R2Q A;  2N7E A;  2CS4 A;  4EZL A;  5JZE B;  2BF8 B;  4HDO A;  3PLU A;  3JVZ X;  3V62 A;  2VRR B;  2ZNV C;  1WE6 A;  2DX5 B;  2JUO A;  2O2V B;  3CST A;  4GU2 A;  1V5O A;  3ZDM C;  3HM3 A;  5DPT A;  2CU1 A;  3TIX A;  3AI5 A;  2IO0 B;  3H7P A;  2LAS A;  2DZI A;  1WMH A;  2KOX A;  1S1Q B;  1UGM A;  4K7U A;  5E6O A;  1L7Y A;  4GOC A;  4WWP A;  2ZEQ A;  3VUX A;  1M94 A;  2V4L A;  4WJQ A;  4LDT D;  3RYT A;  2KQS A;  2LGX A;  3LDZ E;  4KZC A;  4GB9 A;  4IM3 A;  4TV3 A;  3QK0 A;  2K1F A;  2PPH A;  5TR5 A;  2KFK B;  4A3O A;  2KJH B;  1J8C A;  3NS8 A;  4GDK A;  3A9K B;  2MBH A;  3TMP B;  3HK0 A;  4IWO A;  4ZRI A;  2O6V B;  1U4A A;  2W9N A;  3R3M A;  2L0T A;  2LD9 A;  1E5W A;  4MEM A;  1V81 A;  5IAA C;  3VFK A;  4W9J A;  1WZ0 A;  2J7Q B;  3H7S A;  4E71 A;  4HPM B;  2WDT B;  2XBB C;  3A33 B;  3KYC D;  5GMV A;  5D94 A;  1A5R A;  2AWT A;  2C9W B;  4NAW B;  3ZNI D;  2MCN B;  1SGH A;  5C23 A;  2N1W A;  4W9D A;  2JZ3 B;  2DHZ A;  4HWI B;  2BWF A;  4LJO B;  4IM2 A;  3PHW B;  3QJZ A;  2MP2 A;  3UQA A;  3JYU A;  4W9G A;  4YL8 A;  2CHX A;  2KKC A;  4ANW A;  3RUI B;  1WXS A;  4MGI E;  2D10 A;  2L0F A;  3SU8 X;  3WAL A;  1C1Y B;  3ZNG C;  4KDL B;  2I1K A;  2N9X A;  2BYE A;  2NS5 A;  3CF6 E;  3T8M A;  2D07 B;  4FJY A;  5L83 A;  3U8Z A;  2KVR A;  4M8N A;  2DYM A;  2FCN A;  4PYU A;  2L7R A;  2O6V D;  2UYZ B;  3I3T B;  3TJP A;  3M3J A;  2FID A;  2LWP A;  5AZH A;  3DVN V;  2OOB B;  4II3 B;  3M95 A;  2LGY A;  1GUA B;  1OEY A;  4GDK B;  1F9J A;  4IG7 B;  2ZCB A;  4W9C A;  3L10 B;  3VHT C;  4TKN A;  3VVW B;  1WX7 A;  3HHM A;  3MHS D;  2IO2 B;  4B9K A;  2LVO A;  5C1Z A;  4HXD A;  2RGF A;  2YLM A;  4JGH B;  2K25 A;  2MRP A;  3UIO B;  3VUY A;  2JVC A;  4FUL A;  4FAD A;  1WZ3 A;  3KYD D;  4BFR A;  2JZZ A;  4AOF A;  3SDL C;  3Q3J A;  5LLI A;  1WM3 A;  4K81 A;  2O2V A;  3N3K B;  3VTV A;  2ZZP B;  2KO3 A;  3N32 A;  1RLF A;  3QIJ A;  4FHK A;  3WAO A;  1YJ1 A;  3DOW A;  1SE9 A;  2IO1 B;  5AZF A;  4A20 A;  5DPW A;  2B3A A;  2Z0E B;  5KHQ A;  1V5T A;  3KUD B;  3WIM A;  3QA8 A;  2Z0D B;  2RSU A;  4EFO A;  3DVN U;  1VCB A;  2C7H A;  4IM0 A;  5E6N A;  4II2 B;  4DHZ B;  3L54 A;  4G50 A;  2L76 A;  1WRD B;  1YIW A;  3SHQ A;  4G0N B;  4AUQ C;  3AU4 A;  4EUT A;  1LFD A;  2KFJ A;  3OAW A;  3KUC B;  2G4S A;  1IP9 A;  1NDD A;  4CYE A;  1EF1 A;  3ENE A;  3B1L X;  2K8C A;  2MQJ A;  4XZ4 A;  1NBF C;  1Y8R C;  2A5U A;  2KFK A;  4IWP A;  5D7G A;  1LXD A;  2JWZ A;  2C5L C;  3K9P B;  1UBI A;  4IUM B;  3A9K A;  2UWQ A;  4NJ7 A;  2N9P C;  2O6V A;  1P9D U;  2IO3 B;  4HK2 A;  4RM8 A;  3PV1 A;  2DZK A;  2L00 B;  4JQW C;  3M62 B;  2DYO A;  2K6D B;  1IYF A;  1WJ4 A;  2MBO A;  2REX A;  2GBN A;  2LJ5 A;  4E3C A;  4KV2 A;  1EF5 A;  5DCN A;  5L95 C;  2EMS A;  2JRH A;  3QHT A;  4NAW A;  4EKU A;  4M8M A;  4MEL A;  1WR6 E;  1WJN A;  3AU5 A;  3L16 A;  4GMV A;  2BKR B;  3O65 B;  4ANX A;  3K9O B;  1LM8 B;  4F1S A;  1WXA A;  3CSF A;  3V6C B;  3BIN A;  2GBM A;  1Z2M A;  2PE6 B;  1J19 A;  2PEA A;  4HVB A;  3A1Q A;  2C7M B;  2BKF A;  3NZS A;  3AXC A;  4MGZ E;  4MGY E;  5J18 A;  5J2R A;  4AWJ A;  1E90 A;  1YX5 B;  1D3Z A;  1UEL A;  1NI2 A;  1OGW A;  2N7D A;  2KDE B;  2LVP A;  3VTU A;  2AYO B;  4TQ1 A;  1Q0W B;  3DVG X;  4W9L A;  2IY0 B;  1AAR A;  2LUE A;  4TUU A;  4WQO B;  4B95 A;  1GC7 A;  4KZ0 A;  1GG3 A;  2KTF A;  2ZCC A;  1E8W A;  5CHV C;  1E7V A;  4ZRK A;  2KJ6 A;  5J17 A;  1KJT A;  2NR2 A;  2WX1 A;  3QCA A;  1V9J A;  2RPQ A;  2JY6 A;  3VTW A;  3VH4 B;  3TBL D;  2DAF A;  2KNB A;  3DVG Y;  3OJ4 B;  4OVU A;  3RUL A;  4MDK E;  3BY4 B;  3ML8 A;  1V86 A;  4NQK E;  1IPG A;  2KAN A;  2Z59 B;  3DDC B;  4DXA B;  3EEC A;  1V6E A;  1ZW7 A;  3QAQ A;  1YX6 B;  1EUV B;  4B6W A;  5LXH A;  4FHJ A;  1OTR B;  3MTN B;  2GBR A;  4JLC A;  2WX0 A;  4ZRJ A;  2FCQ A;  1SIF A;  2J0J A;  1WX8 A;  2KC2 A;  1GNU A;  3PTF C;  2KC1 A;  2OJR A;  3OJ3 A;  2KWC A;  4P7I A;  3ZO5 B;  3ZLZ A;  5CHF A;  2G45 B;  2DYB A;  3A1Q B;  1WYW B;  4GN1 A;  3R66 C;  4W9F A;  2GOW A;  4DHJ B;  2ZVO A;  3C0R B;  4MSQ B;  1L2N A;  4NJ6 A;  1R4N I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...