4B9KA

Pvhl-elob-eloc complex_(2s,4r)-1-(3-amino-2-methylbenzoyl)-4-hydroxy-n-(4-(4-methylthiazol-5-yl)benzyl)pyrrolidine-2-carboxamide bound
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
104
structure length
101
Chain Sequence
MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGEGFTSQTARPQAPATVGLAFRADTFEALIEPFSSPPELPDVMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords TRANSCRIPTION ELONGATION FACTOR B POLYPEPTIDE 2
publication title Small-Molecule Inhibitors of the Interaction between the E3 Ligase Vhl and Hif1 Alpha
pubmed doi rcsb
source organism Homo sapiens
total genus 24
structure length 101
sequence length 104
chains with identical sequence D, G, J
ec nomenclature
pdb deposition date 2012-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4b9kA00
2GBMA 3PPAA 2LVQA 2NBUA 4AUQC 2JUOA 2HJ8A 2QHOA 3SDLC 3R3MA 2ZNVC 5IAAC 5EDSA 3PLVA 3WALA 4E74A 2ZNVB 3KUDB 3PT2B 1R4MI 1KJTA 1V86A 1UBIA 1X1MA 3RCZA 2Y5BB 4GXBA 1WM3A 2RR9A 4WJOA 3IG3A 1UELA 4GDLB 4BKSD 2XEWA 3VQIA 1WGHA 1WJNA 1PQSA 2BKFA 1LXDA 3VTVA 3UINB 5J18A 2HE7A 2MP2B 1J19A 3DVGX 1IP9A 2NVUI 1RLFA 2G4SA 2N4FA 4I6LB 3NY5A 3U8ZA 2G45B 1P1AA 4G11A 3L16A 2AWTA 4FULA 4ICVA 4CYEA 2A4ZA 4A3PA 1OTRB 5DCNA 1EF5A 4FLHA 1RRBA 4W9FA 1RFAA 2PE6B 4HDQA 4LCDE 2PPHA 2O2VA 1NDDA 4MGIE 3ZUNA 2KTRB 1V5TA 1WRDB 1WMHA 1K8RB 4AP4C 3W1SA 3QAQA 3P2BA 2Z0DB 1YIWA 1ZGUB 2CS4A 1WI0A 4GSWA 5DPWA 2EKEC 1JRUA 2G4DB 3ML8A 2FIFA 4FADA 3OLMD 4W9EA 1SGHA 3DCGA 1XD3B 3H7SA 4B95A 3DVNV 3VDZA 1ZW7A 4RM9A 4CO7A 4NAWB 4F7ZA 4EFOA 2PJHA 1WE7A 4FHKA 3CF6E 4JGHB 2KKCA 3QJZA 3A9KA 3O65B 2DYOA 4WWOA 5FR6A 3VTWA 2PE9A 3I3TB 1P3QU 2KJ6A 4K81A 3TBLD 2ZZPB 2BWFA 3NHEB 3DPDA 4F8CB 2XK5B 5LXHA 4EEWA 1GG3A 1WYWB 1WJUA 3LJ3A 3V62A 4IUMB 4ANWA 3H7PA 2IO3B 1UH6A 1OEYJ 2EMTA 3Q3FA 2KLGA 5DPSA 4AOFA 2KFKB 4FN2A 4XZ4A 1EF1A 3SU8X 1TZ1A 3HM6X 2NBWB 1U4AA 2KDFB 3DOWA 2YVCA 1UBQA 3IHPC 4BVUC 2LGXA 4ZRKA 4LDTD 3OAWA 2KDEB 4DWFA 2K6DB 4K7SA 1EUVB 4OVUA 3ZO5B 3ZRFA 3APDA 2R2OA 1V2YA 3PRMB 2K8BA 3N32A 4M8NA 2KWVB 3IVFA 5AZHA 1Q1OA 2R2QA 3DVNU 3WIMA 3KW5B 3KH0A 3VH3B 4MELA 1IYFA 3TIXA 5KHOA 3HK0A 4WJQA 4PS8A 2LASA 1WF9A 2C60A 3ZRCA 3HHMA 2JY6A 1MG8A 4HVBA 1Z2MA 5IA7A 2KK8A 3QWZB 3SHQA 4IC7B 1NI2A 4TKNA 4IW0A 3RD2A 5D2MB 2KD0A 2KN5A 2KOXA 4XC2A 2DAFA 4ANXA 4HCPB 1WR1A 4MH0E 4DXAB 3PSEB 2AYOB 4PYZA 3X0WA 3NZUA 2GMIC 4OVVA 1V49A 3ZTCA 4PYUA 1ZKHA 2BWES 3QARA 1V5OA 4KIKA 4WWPA 4ASWC 4DK5A 1WZ0A 1L7YA 4DHZB 1VCBA 2KC1A 2LVPA 2WWZA 5C1ZA 2ZEQA 5L83A 1XT9B 4W9HA 4A3OA 1WX8A 3H9DA 4B6WA 4ICUA 4X57B 3W1YA 3ONSA 3K9OB 2FUHB 4E3CA 4W9LA 2M0XA 2KMAA 4W9GA 2CU1A 2NS5A 2NPTB 2KANA 3EHVA 2GBKA 1WM2A 2KC2A 4JQWC 3EC8A 3DBLI 3VTUA 3PS6A 2JT4B 2ZJDA 5JHAA 1H8CA 2M17A 2DAJA 3BINA 2JZZA 3KUCB 3A1QB 1P9DU 3A4RA 1E5WA 1D3ZA 1WJ4A 4NQKE 3A9JB 4PS7A 1KOTA 2BYEA 3ZTDA 3B0AA 1WJ6A 3KYCD 2IBIB 2KX3A 2DZIA 1C1YB 1YX5B 2D10A 3UGBB 3QA8A 2N9XA 2IY0B 1UGMA 2MBBB 2UWQA 1TGZB 3M62B 3C0RB 3VHTC 2KWUB 3A4SC 2KDIA 3DQVA 2FCQA 2GBRA 2KJRA 3DDCB 2BYVE 2D3GA 4ZRJA 2MBEA 2L76A 3HIZA 3QCAA 4LDTB 5G2NA 1TTNA 3MTNB 4KVGB 3RT3B 3UIPB 3VUXA 3VVWB 4ZDVA 4GDLA 3CSFA 3WA0A 3ZNZB 2MBHA 2WX1A 4KV2A 1Q0WB 4NJ7A 5LLIA 3VXWA 1GNUA 1GUAB 2MP2A 1V6EA 2DYMA 2G3QB 4FJZA 3A9KB 5E6OA 4F1SA 1J8CA 4IM0A 3DBRI 3KYDD 1WY8A 4K7WA 1OEYA 3AI5A 1J0GA 4LJOB 4MM3A 3ZDMC 5BO4B 2BKRB 1WX7A 4BOSC 3DBSA 4BBNC 4G50A 2CHZA 4TV3A 1S1QB 2I1JA 2IO0B 4TQ0A 4TUUA 4IM3A 1YX6B 5D6JB 3T9LA 3M63B 1WXMA 3LDZE 4I6PA 4TQ1A 4DDID 1LM8B 1TBEA 4LJPB 3PVLA 4M8MA 1V81A 2ZCBA 1E8ZA 2KQ7A 4G0NB 2A5UA 3A33B 4KDIC 3OJ3A 2N9PC 3NS8A 5E6PA 4KZ0A 4AWJA 3QIJA 4J6IA 1GC7A 5JH5C 4BBNF 4HK2A 4K1RB 4MJSB 1OGWA 3WAMA 2VRRB 1YD8U 2XBBC 2MQJA 4KZCA 1E7VA 2JVCA 2GOWA 2KHWB 2V4LA 2FCNA 4NY0A 1WIAA 3UF8A 3Q3JA 4HPLB 3R7QA 4DHJD 3PLUA 3ZW3A 3ENEA 4W9CA 3RUIB 2ASQA 4ZRIA 2O6VA 3CMMB 1KM7A 1AARA 2DHZA 2RSUA 4NAWA 4CHKA 3PGEA 3GZNI 2KXJA 2OOBB 5C23A 2MBOA 3PTFC 5TR5A 2JZ3B 3AU4A 2BGFA 2LD9A 2D2QA 1F9JA 1R4NI 2WDTB 2RD0A 4FHJA 2XK5A 1P98A 3PHWB 5DPTA 3IFWB 5AZGA 3UQAA 2OJRA 3JW0X 3PZDA 4N9F4 3RULA 4BFRA 1Z5SB 2DZKA 4HDOA 2KFJA 3KVFB 3AXCA 2KNBA 2N7EA 2CHXA 2LXAA 3DBHI 5JHBA 2KFKA 2MX2A 3V61A 4FJVB 4AJWA 4ZYNA 4ANUA 2Z59B 2V3SA 2NCNA 3RYTA 3ZNGC 2K39A 3MJWA 1Y8RC 1E7UA 3QC8B 4JIOU 4WAAA 2C5LC 5GMVA 4W9KA 4EUTA 1UZXB 3ZNID 2KDBA 4EZJA 4GDKB 2L05A 2AL3A 3EFUA 2HD5B 4WJNA 2O6VD 2DZJA 4YL8A 5CHVC 3WANA 2J0JA 3PRZA 2Z0EB 1CMXB 2IZVB 2HTHA 3OJ4B 1OQYA 3NOBA 4HJKA 3VAWA 4FJYA 1YQBA 2K25A 4HPMB 2D11A 2BF8B 1S3SG 4G3XB 3RZWC 4EOYA 4DDGD 3NZSA 4MGZE 3TCAA 2K8HA 3U7DA 2KX0A 3VFKA 3TL5A 3JYUA 3VH4B 2JRIB 1IPGA 2BYFA 2N1VA 4GU2A 5L95C 3CSTA 1LQBA 2ZPYA 2WYQA 2J7QB 2V1YA 1G6JA 3JSVA 3ZVVA 1GJZA 4HXDA 3AULA 4KDLB 2KLCA 2KMCA 5CTRC 2ZVOA 4EZLA 1BT0A 2CHWA 2I1KA 2C9WB 2MA9B 2LGDA 2K1FA 1V80A 2LRWA 1WGGA 2O2VB 2LI5A 2JRHA 2L0TA 3PV1A 3W1SC 3T8MA 2REXA 1WMHB 2C7NB 2RPQA 1Q5WB 3PHXB 4DBGA 4GN1A 2FIDA 5CX3A 3EECA 3RZFA 2FCSA 2MSED 3L54A 4BOZB 2LWPA 4DHJB 4BKGA 4MDKE 4XX5A 2N9EB 4GIVA 2NPTA 2RGFA 2LXCA 2KO3A 1WH3A 2K6QA 4WQOB 3L0WB 1ISNA 4HLEA 3K9PB 4JL9A 2K8CA 2LZ6A 4DHZE 2KQSA 2IO2B 4A20A 3A1QA 3TMPB 2ZVNA 4II2B 2IO1B 3X23A 3A9JA 3GOEA 3IBEA 4KSKC 4W9DA 5CHWA 1A5RA 1RAXA 3V6EB 2L8JA 4MGYE 1WX9A 4AJYB 1I35A 3UIOB 3L17A 2ZPNA 2MBQA 3KUZA 4JLCA 1UD7A 3WAPA 3ZLZA 2JF5A 3H7PB 4MSQB 3WAOA 3ZDTA 5LXIB 2M8SA 2KZRA 3VUYA 2L00B 2KTRA 2FNJB 2W9NA 1GC6A 2GBNA 2JXXA 3JVZX 3M95A 1NBFC 4IWPA 3APCA 1SE9A 1E8XA 1WXVA 1YJ1A 2B3AA 1WE6A 1WGDA 2D07B 3APFA 3MHSD 1I42A 1EO6A 2EMSA 2O6VB 4E71A 4IG7B 1M94A 2MW5A 2UYZB 4RMAA 3UQBA 4GGQA 2NR2A 2C7HA 2LJ5A 4GB9A 2CR5A 2J0MA 3B1LX 1FXTB 1WZ3A 2ZCCA 3L10B 5E6NA 4EZKA 2C7MB 2FCMA 2MLBA 4EKUA 3U30A 3DVGY 2NBVB 3R7RA 3TJPA 5D7GA 2KJHB 2WX0A 2YLMA 2AEHA 4IM2A 3ML9A 4I6NB 3S2AA 4GMVA 4HCNB 3PREA 1WGRA 1WFYA 3VUWA 1WXSA 2DENB 5DPRA 2JWZA 2M4NA 2DX5B 2DYBA 4ANVA 1T0YA 4NNJB 2J0KA 4W9JA 4B9KA 3BY4B 3QX1A 1XQQA 2FAZA 1WR6E 2LVOA 3L13A 3QQ8B 4BKTA 4P7IA 4MJSA 5G55A 5CHFA 2M1MA 1LFDA 2N7DA 4MGKE 2LGYA 2JPHA 2GBJA 5AEKB 3B08A 2L7RA 4IWOA 1V9JA 4KIKB 1HE8A 2LRUA 5JZEB 3ECIA 3L08A 2KVRA 1P0RA 3PRPB 3D32A 2MWSB 1E8YA 3ZKJC 3QHTA 4PS3A 5HKHA 5KHQA 1L2NA 3ZIMA 3ALBA 3N30A 5J2RA 4KSLC 2CKHB 2L0FA 1QZEA 4URKA 4WJPA 1KLVA 1SIFA 2N1WA 1E8WA 3H6NA 4NJ6A 4GOCA 1WXAA 4MSMB 4FBJB 5J17A 3HM3A 1VD2A 4BKSA 4IWQA 2KWCA 2DZMA 2LUEA 3N3KB 4NQLB 3AU5A 2MCNB 4W9IA 4K7UA 1E90A 3QK0A 4HWIB 4II3B 3V60A 1WGYA 2IY1B 2AL6A 2KTFA 2BPSA 3JSVB 1H4RA 3M3JA 3SD5A 5D94A 3R66C 1C3TA 2PEAA 4NPNA 3V6CB 3H1UA 4M0WB 4MEMA 2L3ZA 3ZNHB 4FA6A 4RM8A 4GDKA 4WWNA 5AZFA 2IYDB 2MRPA
chains in the Genus database with same CATH superfamily
3PPAA 2WXPA 3GE3C 2JUOA 1JW9D 3SDLC 5EDSA 1KH0A 4Q2JA 1V1PA 2OHFA 2ZNVB 3PT2B 1J7BA 5I4DA 2WGSA 4LTUA 2JX5A 1YJIA 2Y5BB 1WM3A 2BB5A 3IG3A 1UELA 3BVGA 2KWDA 3P42A 4BKSD 1WGHA 1WJNA 5BMGA 5J18A 3KLSX 2RPVA 2NVUI 2N4FA 4G11A 3P4SB 3NVWA 4A3PA 4FLHA 1J7CA 1RFAA 1E7PB 2INDC 1J7AA 3ZUNA 4DXGA 3QAQA 3ML8A 4OHJA 1NVID 4W9EA 2PVOD 3DCGA 1ZW7A 4JE3B 1QOBA 4CO7A 4F7ZA 1WE7A 1L0VB 5FR6A 2PE9A 1JWAD 1F2RI 1P3QU 1T3QA 1TT5B 2KJ6A 3TBLD 3NHEB 5LXHA 1WJUA 1UWXA 3NVYA 1UH6A 2EMTA 4XZ4A 4ARCA 4RF0A 2PIAA 2QIEB 3DOWA 2YVCA 3IHPC 4BVUC 2LGXA 4ZRKA 4LDTD 1C4PA 2KDEB 4DWFA 4OVUA 1EUVB 2VH2A 3ZO5B 3FKYA 2R2OA 1V2YA 3RN9C 1TY2A 3R8BA 3IVFA 3Q3NC 2R2QA 1JWMD 2CU3A 1N60A 3RNFC 4MELA 3HK0A 4PS8A 1XEEA 1WF9A 3T3OA 1HQRD 1MG8A 5AUIA 4HVBA 5IA7A 4TKNA 3RD2A 1I4HA 4HCPB 4J3OD 4MH0E 4B0MA 3PSEB 2AYOB 1NI3A 4PYZA 3X0WA 3TEWA 4L2YA 3ZTCA 4A90A 3Q6BA 2ACZB 2BWES 3QARA 4WWPA 3GB1A 1C79A 2JZPA 3MP9A 2KC1A 5C1ZA 2Q5WD 2WXIA 4W9HA 4B6WA 4H2AA 3R2IA 2WXNA 2KMAA 1SE4A 4XE0A 2KANA 3EHVA 3DHGC 4PT5A 1ET9A 1WM2A 2KC2A 2BYTA 3EC8A 3DBLI 1TS4A 3VTUA 2ZW1A 1H8CA 2ZJDA 2M17A 2DAJA 3W2DA 2MJDA 1E5WA 1XLQA 3A9JB 3AE6B 1KOTA 2BYEA 2IGHA 3KYCD 2IBIB 1C1YB 1YX5B 2D10A 3NG0A 3QA8A 4ZRPA 1TGZB 2KWUB 4ACFA 2KAJA 4ARIA 2D3GA 3O13A 1V8CA 1TTNA 3MTNB 4KVGB 4GDLA 1F52A 2L1AA 2ONQA 2MBHA 1Q0WB 1C77A 2MP2A 1V6EA 2G3QB 2XNAC 4OZCA 1J0GA 4MM3A 2LJIA 4G50A 2CHZA 4TV3A 1TIFA 2PTLA 4TUUA 4TQ1A 3LDZE 3P1MA 1NYQA 3PVLA 1E8ZA 4G0NB 3DBRB 3OJ3A 2N9PC 5E6PA 4KZ0A 3U52E 3QIJA 4ZRQA 2GLSA 5HI1A 1OGWA 1FO4A 4C00A 1ZE3D 4NY0A 2V4LA 2JWUA 4HPLB 2K22A 4DHJD 3RUIB 3CMMB 2DHZA 3GZNI 2OOBB 4S0RA 1JALA 2D2QA 1F9JA 1TKEA 2RD0A 3Q8AA 2XK5A 3PZDA 3RULA 4NJCA 1C4AA 2DZKA 3AXCA 2Y5PA 2N7EA 3AE1B 3LYYA 4FJVB 1L6UA 2V3SA 3MJWA 3OWEB 5GMVA 2C5LC 4EUTA 1UZXB 3ZNID 2KDBA 4GDKB 2WU5B 1L4ZB 5CHVC 4YSYB 4YWGG 2J0JA 3PRZA 1EU4A 1CMXB 1TY0A 1DGJA 2MJ3A 1S3SG 3RZWC 2V3PA 2W55A 4DDGD 4MGZE 3TCAA 2K8HA 4AQ7A 1UNSA 2KX0A 2JRIB 2N1VA 2BYFA 2WXQA 1VJKA 1VZ8A 3BK1A 2V1YA 4M01A 3ZVVA 4KDLB 3AULA 2CHWA 1P7FA 2I1KA 3RNGC 1GOZA 4LLGM 1V80A 2V9HA 3LXFA 1WGGA 1I4QA 2JRHA 2CJNA 3BVZA 2REXA 3T8MA 1WMHB 1Q5WB 3PHXB 3GE8C 2FIDA 4EE2A 3RZFA 4BKGA 1QT9A 1C9FA 4A9AA 1DOIA 3DWGC 1WGKA 4HLEA 3FILA 3TMPB 3GOEA 5CHWA 3IBEA 4W9DA 2SAKA 3V6EB 2WXHA 1XF5L 3L17A 3UIOB 2JF5A 4XDCA 4HKQA 1T0QC 3WAOA 2VH1A 3VUYA 2L00B 2KTRA 2XN9C 4O1NA 1DYQA 3M95A 3APCA 1SE9A 2B3AA 2D07B 2W3RA 1I42A 1EO6A 2O6VB 2JQRB 2H89B 4WAFA 2J0MA 2K0PA 1FXTB 1WZ3A 2ZCCA 3B1LX 2HDEA 1LO5D 2AEHA 3MFGA 1JRPA 1SXTA 4GMVA 4HCNB 1WXSA 2DENB 4C7YA 4RGMA 4ANVA 1T0YA 4NNJB 4B9KA 3E56A 1LGRA 2FAZA 2LVOA 5G5HA 3L13A 4BKTA 1EWCA 2WXGA 2LGIA 4P7IA 2LGYA 2JPHA 1JWUD 2DNFA 1WXQA 1UGJA 1V9JA 1HE8A 2HTME 3PRPB 1DOXA 1C78A 1E8YA 3ZKJC 2RDHA 3QHTA 1L2NA 5J2RA 4KSLC 4US9A 1PGXA 3U7ZA 3AEEB 4FBJB 5JHAA 1E8WA 4GOCA 5EE3A 5J17A 2L83A 1E90A 3QK0A 2INNE 2IY1B 2JYEA 1CK1A 5BYQA 1KRHA 4NPNA 4MH8A 3ZNHB 4KZCA 4P1CC 4WWNA 5AZFA 2MRPA 2GBMA 2LVQA 2NBUA 2QHOA 3PLVA 3KUDB 3ZGZA 4HKZE 3RCZA 3V05A 1SBBB 3VQIA 1PQSA 2INCC 4XDDA 3VTVA 3UINB 4PK1A 2HE7A 3DVGX 1J19A 1IP9A 1R4MB 1RLFA 3U8ZA 3TEXA 3L16A 3RNBC 3GS2A 4WURA 5DCNA 4HDQA 2PE6B 3W5VB 2O2VA 1KTKA 1NDDA 1F0ZA 1K8RB 2FBWB 3P2BA 1RFKA 1YIWA 1WI0A 4GSWA 4YSZB 3OLMD 2D3AA 3BVMA 1XD3B 2ON8A 1SIJA 3DVNV 1AWDA 2WXOA 1Y56A 1EU3A 4FHKA 3W9CB 3A9KA 4WWOA 5G5GA 1WYGA 3VTWA 1ESFA 2ZZPB 2BWFA 1UF0A 3N20C 4EEWA 2NTTA 4ANWA 4YSXB 3NVZA 3V62A 1NYRA 3SFDB 1B1ZA 1BMLC 3AEDB 5DPSA 4AOFA 3NZ3A 3ZJVA 4KX6B 4KKJA 3SU8X 2PKOA 2KDFB 5MPOA 1UBQA 2GRIA 4LNFA 2K6DB 3T3NA 3APDA 4XYCA 2K8BA 2MEKA 1Q1OA 3BYYB 4ITKA 2PVGC 5D3DA 1IYFA 5KHOA 2L32A 2QEJC 2WXRA 3Q14C 3FAHA 2BS4B 3AEAB 1K53A 1IBXA 3QWZB 3SHQA 1NI2A 3Q8EA 3TEYA 2KN5A 4LNOA 1JWSD 2X8XX 2GMIC 2OEDA 3VR9B 4DK5A 1L7YA 4WWMA 1VCBA 2ZEQA 3RPFC 2D5GA 1WX8A 2JU6X 3H9DA 2J53A 4X57B 4HJGE 1FD6A 1WSPA 1KFYB 2CU1A 2NPTB 2LMCA 2GBKA 1TZOA 2WXFA 3KUCB 4BAXA 1D3ZA 1VZ6A 1WJ4A 4PS7A 2VZKD 3ZTDA 1FMAD 1WJ6A 3UGBB 2N9XA 3TEZA 1UGMA 1GAQB 4WH4A 3A4SC 5D3IB 2KDIA 4B0EA 2HJ1A 4MT5A 3QCAA 2E3TA 3VXWA 3EA6A 5IO9A 4FJZA 3DHHC 2LUMA 5E6OA 2WLBA 1WY8A 4K7WA 3LB8C 2EKIA 5EE0A 4BBNC 2BBCA 1BUIC 4IM3A 5D6JB 1WRIA 1WXMA 1Q10A 1TBEA 4M8MA 2CJOA 1V81A 2A5UA 4OZAA 3A33B 4KDIC 1FFUA 4HPPA 1GC7A 4K1RB 4MJSB 4RGTA 4N6EB 3AE4B 2VRRB 1F2RC 1E7VA 2KHWB 3UF8A 1YN3A 2FCNA 1WIAA 3VRAB 3R7QA 3PLUA 1FXAA 4W9CA 1CZPA 1AARA 3PZ8A 2KXJA 5C23A 5H92C 3P4PB 1R4NI 4P1BC 5DPTA 3FC4A 3I5JC 2M56B 1MHXA 3U4EG 3KVFB 3DBHI 4P6VF 2CHXA 2LXAA 5JHBA 4ZYNA 4ANUA 2Z59B 3RYTA 4K3CA 1E7UA 1JCKB 4JIOU 4REZA 2L05A 2I2YA 2O6VD 1FCCC 2QSDA 1IUEA 2RMMA 2IZVB 2HTHA 4HJKA 3EFCA 4WIPA 1YQBA 2WQYB 4G3XB 3VH4B 5L95C 3I57A 4GU2A 3CSTA 1LQBA 2WYQA 3ZJUA 3JSVA 2BT6A 4HXDA 2ZVOA 1BT0A 1ACCA 1UWMA 1SE3A 2G1EA 1I4GA 1K52A 3AE2B 3Q8CA 1HTOA 4DBGA 2WXJA 1T0RC 1MPEA 4JPSA 3L54A 3J9CA 1GB4A 4XX5A 2N9EB 3CIRB 3H8HA 1PGAA 2RDGA 3RFZB 2KO3A 4UDUC 1ISNA 4NZLB 3K9PB 1TJEA 4A20A 3IT4B 2ZVNA 5LNK1 4II2B 1OQQA 3A9JA 1A5RA 4ZOHC 1WX9A 1V1OA 3KQ4A 1I35A 2PMVA 2MBQA 4JLCA 3H7PB 5LXIB 1GC6A 2GBNA 4C56C 1E8XA 1YJ1A 5IP4D 1WE6A 2IJ0A 1WGDA 5IN7A 2MW5A 4RMAA 3NRZA 4GGQA 4GB9A 1A70A 2FCMA 1ENFA 3U30A 4XGAB 2YLMA 4I6NB 3S2AA 4M02A 1WFYA 1F1HA 3VUWA 2JWZA 2M0AA 2DYBA 3AE9B 1PDXA 3Q3MC 4LNNA 3VR8B 3QQ8B 3KWVA 2JSVX 1N5XA 3MHZA 1LFDA 2N7DA 2VZKB 1SSNA 4KIKB 3L08A 3D32A 5KHQA 2X38A 2KDMA 3URYA 3ALBA 4WJPA 1KLVA 2PW9A 4NJ6A 2R61A 3EGRA 1WXAA 1VD2A 4BKSA 4IWQA 2KWCA 4NQLB 1VZ7A 4W9IA 1E9MA 4K7UA 2BQQA 4II3B 1BXTA 2BPSA 4RNAA 3R66C 2WXKA 2DWQA 3V6CB 3IXSA 4M0WB 5T8IA 1I4PA 4RM8A 4GDKA 2IYDB 3BZDB 4AUQC 2HJ8A 5IAAC 2ZNVC 5C3JB 4RGOS 3WALA 1TS2A 2H88B 5HHDG 1X1MA 3AECB 3IAS1 1D4BA 1VR9A 1ZUD2 2BKFA 1JWBD 1LXDA 2G4SA 2MJEA 1P1AA 4FULA 4IOIE 1OTRB 1EF5A 1YOVB 3EUB2 2PPHA 3BYTB 4MGIE 2KTRB 3CWIA 1WRDB 1WMHA 4AP4C 4RFBA 1FCLA 2Z0DB 1ZGUB 1YJJA 5DPWA 1JRUA 1SB3C 2YEPF 3BIID 2FIFA 4FADA 2K9XA 1SGHA 4XWWA 4NAWB 1QLBB 2PJHA 1ET6A 4JGHB 4C4VB 1ZP0B 2W54A 2INPE 3O65B 2DYOA 3DPDA 2PLPA 5EE1A 1GG3A 1WYWB 4LNKA 3SFEB 1OEYJ 3Q3FA 4QAYA 2KFKB 2FE8A 1N6ZA 1TZ1A 5BMHA 1YN5A 1E10A 3HM6X 1EWYC 3NJTA 1U4AA 2WNMA 3OAWA 3ZQ4A 1NEKB 3PRMB 1D5ZC 1MG4A 2KWVB 3N1ZC 5AZHA 2BTEA 3DVNU 1MI0A 3KW5B 3KH0A 3MC9A 4WJQA 3P63A 2ICIA 2WDQB 1L5PA 2KK8A 4IC7B 1B9RA 4IW0A 4DQOC 5D2MB 2KD0A 4DXAB 3NZUA 4OW0A 1V49A 1ZKHA 3N1XC 4JWSC 3AE8B 1V5OA 2QILA 1WZ0A 2LFIA 2LHDA 3ONSA 1VDVA 3K9OB 2FUHB 4E3CA 2K5PA 4A8XC 1YMHE 3B2FA 4JQWC 2N9LA 3AMZA 1PUTA 3BINA 5AUKA 2JZZA 3A1QB 1ZDXA 2BS2B 3W5UB 3P4QB 1FRRA 2KX3A 3RNEC 3N9YC 2IY0B 2QMTA 1I7HA 3DBLB 5GXGB 3C0RB 1MVKA 3DQVA 2FCQA 2GBRA 2KJRA 3DDCB 2L76A 3VUXA 3RT3B 3VVWB 3UIPB 2L52A 5EE9A 2Z8LA 2WX1A 4NJ7A 1GNUA 1GUAB 3Q69A 3A9KB 1J8CA 4IM0A 3DBRI 1SEBD 3AI5A 4HROA 3Q2AC 4LJOB 2BKRB 1WX7A 2IO0B 4TQ0A 4DDID 4I6PA 1LM8B 5JXVA 2KQ7A 1ROEA 1DOYA 2J4XA 3NS8A 5BYSA 4HK2A 2GOWA 4JX1C 3ZW3A 2WS3B 3ENEA 2ASQA 4ZRIA 2RSUA 4A6QA 3PGEA 1AW7A 1QKZA 4YTPB 2KMMA 3ETRA 2JZ3B 3AU4A 5FR3A 1QOAA 4FHJA 5AZGA 3JW0X 4GLSC 4BFRA 3GZNB 4HDOA 2KNBA 3MC0B 2MX2A 1AN8A 1YQ3B 2NCNA 2QDFA 4YTMB 1FNWA 1EM7A 4WAAA 4EZJA 1MHHE 2AL3A 2HD5B 4YL8A 1N63A 1V1PB 1OQYA 4USAA 3NOBA 1ZXIA 1I4RA 3PZ7A 3V3XA 2D11A 2BF8B 4EOYA 3NZSA 1PFDA 3ZXVA 3TL5A 1P7EA 1IPGA 1CJEA 2J7QB 1GJZA 2QJLA 1TKYA 5CTRC 4EZLA 2K1FA 2EELA 4TMAB 2LRWA 3B9JA 2LI5A 1HZ5A 2L0TA 3PV1A 1JROA 1HA5A 2C7NB 5CX3A 3EECA 4BOZB 4MDKE 2WHIA 2GI9A 4GIVA 2NPTA 2LXCA 1WH3A 4WQOB 4JL9A 2K8CA 2LZ6A 2FUG1 2IO2B 2KQSA 4DHZE 1FEHA 1YN4A 3IAM1 4KSKC 1UUPA 1HZ6A 4AJYB 1FFVA 1YQ4B 1IGDA 3KUZA 1UD7A 3WAPA 3AV8A 2M8SA 3AEGB 1XCTL 2W9NA 4IWPA 1WXVA 1K51A 1R7SA 2EMSA 2Y3AA 4E71A 1M94A 2KVZA 2UYZB 1L0YB 2CR5A 1STEA 4EZKA 1N61A 2WDVB 2NBVB 2KJHB 2WX0A 3AEFB 4RF1A 3ML9A 2AQ3B 2DLBA 1RYJA 3AH7A 1WGRA 1N62A 5DPRA 5IOIA 1FPYA 2DX5B 2QC8A 3BY4B 2DBYA 3QX1A 1XQQA 3WCQA 4KKIA 3RNAC 4MJSA 5G55A 3UI3A 1FXIA 1TS5A 1E0ZA 2GBJA 5AEKB 4YXDB 2K3UA 3ECIA 3AE3B 2KVRA 1P0RA 2MWSB 1D5MC 4PS3A 1KLGD 1L6VA 3N30A 3ZIMA 2LEKA 4URKA 1SIFA 3H6NA 4MSMB 3HM3A 2MH7A 2MCNB 2DZMA 2IGDA 3N3KB 3AU5A 2WU2B 4HWIB 3V60A 1QILA 2AL6A 3JSVB 3M3JA 1H4RA 3SD5A 5D94A 1C3TA 4M00A 2PEAA 1RWSA 2N0SB 3C8YA 2L3ZA 4L1BA 3ABVB 3BK2A 4RGNA 3R3MA 4N59A 4E74A 2WDRB 1TYGB 1R4MI 1KJTA 1V86A 1UBIA 2BW2A 2V4IB 4GXBA 2RR9A 4WJOA 1NENB 4GDLB 2XEWA 3KWLA 2MP2B 4RH6A 4I6LB 3NUHB 3NY5A 2G45B 4IKGA 3ZJTA 2AWTA 4ICVA 4MM3B 4CYEA 2A4ZA 1RRBA 4W9FA 4LCDE 1QQRA 1V5TA 3NVVA 1OQRA 3W1SA 1VLBA 2IDYA 4FXCA 2GB1A 2CS4A 2EKEC 2G4DB 4KGRA 2JXTA 4AS1A 3H7SA 4B95A 3VDZA 4RM9A 4OVZA 4BZAA 4EFOA 2NMQA 3CF6E 2KKCA 3QJZA 1FNVA 3P4RB 2OJWA 2TSSA 3I3TB 4K81A 4F8CB 2XK5B 1L0XB 5BYRA 3LJ3A 3RI7C 4IUMB 3H7PA 2IO3B 1L4DB 3RMKC 2KLGA 2ZW0A 2AQ1B 4FN2A 1EF1A 2UU7A 1M4VA 4KGTA 1T0SC 2NBWB 1IGCA 1TS3A 2WP9B 5E6JA 1XXGA 2J52A 4K7SA 3ZRFA 3N32A 4M8NA 3IT6B 2BVCA 1T6BX 3WIMA 1QF6A 3VH3B 3TIXA 2AX5A 2LASA 2C60A 3ZRCA 3HHMA 2JY6A 1Z2MA 1XCQL 3HUIA 1KLUD 2KOXA 4XC2A 2DAFA 3TSSA 4ANXA 1HXYD 1WR1A 1WWTA 4OVVA 1FRDA 4PYUA 2Y5CA 4KIKA 4ASWC 2KQ4X 1XLOA 4DHZB 2LVPA 2WWZA 3GP7A 2WXMA 1JQ4A 5L83A 2J42A 2JYTA 1XT9B 4A3OA 4ICUA 3W1YA 2E6XA 1SJED 4W9LA 2M0XA 2AQ2B 2NS5A 4W9GA 2KT7A 2NTSA 2BB6A 3PS6A 2JT4B 1GB1A 3AB5A 2MHJA 2KYWA 3FILB 1P9DU 3A4RA 5TSSA 1D6EC 2LGSA 3HVDA 3I63C 4M0WA 4OZBA 4NQKE 2D3CA 2N7JA 2V3NA 3B0AA 1HEZE 1XLPA 2DZIA 1OFFA 5IKCM 2MBBB 2UWQA 3M62B 3VHTC 2YEPB 1N5WA 2BS3B 2BYVE 3AM9A 4ZRJA 2MBEA 3HIZA 4LDTB 5G2NA 2IGGA 4ZDVA 3CSFA 3OG5A 3WA0A 3ZNZB 4HEA1 4KV2A 5LLIA 4MACA 2DYMA 2WXLA 4F1SA 2V0GA 2B76B 1XLNA 3KYDD 3ZYYX 1OEYA 3Q3OC 1YNTE 3ZDMC 2KACA 5BO4B 1ZDVA 4BOSC 1ZPSA 3DBSA 1PGBA 1S1QB 2I1JA 3C19A 1YX6B 3T9LA 3M63B 1T5XD 1SE2A 4LJPB 4XWTA 1QOGA 2ZCBA 3L4PA 4AWJA 3HRDD 4J6IA 5JH5C 4BBNF 2IPKD 4TSSA 2W3SA 3WAMA 1YD8U 2XBBC 2MQJA 2JVCA 1GPXA 3SR6A 3Q3JA 4KGSA 1C4CA 2O6VA 2I38A 1KM7A 4CHKA 4NAWA 5FK9C 4C4VA 2W82A 3U2SC 2MBOA 3PTFC 5TR5A 4YT0B 1D5XC 2BGFA 2LD9A 3AN1A 2WDTB 1P98A 3PHWB 2KN4A 3IFWB 1I4XA 3UQAA 2OJRA 5HG2A 4N9F4 4YTNB 1Z5SB 2KFJA 4ZHPA 3E9SA 2KFKA 3V61A 3ZXRA 4AJWA 3DHIC 3R2TA 3ZNGC 1SJHD 2K39A 1Y8RC 1R4NB 3QC8B 4W9KA 1AYFA 1V97A 3EFUA 3Q8FA 4WJNA 4US8A 4HRSA 2DZJA 3DBHB 3WANA 2Z0EB 4N58A 3Q8BA 4LK0M 4L23A 3OJ4B 1VRAB 3VAWA 1TKGA 4FJYA 3BWUD 2K25A 4HPMB 3U7DA 3VFKA 1MFWA 3JYUA 2SEBD 2ZPYA 1K50A 1G6JA 5H8YE 2RDBC 3PO0A 2KLCA 2KMCA 1QOFA 2C9WB 2MA9B 2LGDA 4LNIA 2O2VB 3B2GA 2M19A 3W1SC 1MJDA 2RPQA 4GN1A 3AEBB 2FCSA 2MSED 2LWPA 4DHJB 1F77A 2G9HD 2RGFA 2K6QA 3AE7B 3L0WB 3A1QA 4S17A 2IO1B 3NS1A 3X23A 1RAXA 1FNUA 2L8JA 4MGYE 3MJ5A 4C7ZA 2ZPNA 3ZLZA 4MSQB 3ZDTA 4DXFA 2KZRA 2FNJB 3MC8A 2JXXA 3JVZX 4P16A 1NBFC 1PYWD 1FM0D 4C80A 3APFA 3MHSD 5BMIA 1SF0A 4IG7B 3UQBA 5HFYA 2NR2A 2C7HA 2LJ5A 5E6NA 3L10B 4NAMA 4CQNA 2C7MB 2MLBA 4EKUA 3TUOA 3DVGY 3R7RA 3TJPA 5D7GA 4D2KA 1ZXHA 2LHEA 4IM2A 3I9V1 4ZYSA 3PREA 1JMLA 4WQMA 2M4NA 1IBXB 3HVZA 5FKAC 2J0KA 4W9JA 1WR6E 4R3DA 3RNCC 5CHFA 2M1MA 4RCOA 4MGKE 1XO3A 3SEBA 3B08A 1CQVA 2L7RA 4IWOA 2LRUA 5JZEB 1ZOYB 1HTQA 5HKHA 1KF6B 4JWUC 2CKHB 2N9KA 3DWMA 2L0FA 1QZEA 2N1WA 5C2TB 4A55A 1C76A 2LUEA 3VRBB 1E6EB 1WGYA 3AE5B 2KTFA 4IDIA 3N1YC 1RM6C 2QCZA 2D3BA 3H1UA 4K3BA 4MEMA 1FIQA 4FA6A 4ZHOA
chains in the Genus database with same CATH topology
2GBMA 3PPAA 2LVQA 2NBUA 4AUQC 2JUOA 2HJ8A 2QHOA 3SDLC 3R3MA 2ZNVC 5IAAC 5EDSA 3PLVA 3WALA 4E74A 2ZNVB 3KUDB 3PT2B 1R4MI 1KJTA 1V86A 1UBIA 1X1MA 3RCZA 2Y5BB 4GXBA 1WM3A 2RR9A 4WJOA 3IG3A 1UELA 4GDLB 4BKSD 2XEWA 3VQIA 1WGHA 1WJNA 1PQSA 2BKFA 1LXDA 3VTVA 3UINB 5J18A 2HE7A 2MP2B 1J19A 3DVGX 1IP9A 2NVUI 1RLFA 2G4SA 2N4FA 4I6LB 3NY5A 3U8ZA 2G45B 1P1AA 4G11A 3L16A 2AWTA 4FULA 4ICVA 4CYEA 2A4ZA 4A3PA 1OTRB 5DCNA 1EF5A 4FLHA 1RRBA 4W9FA 1RFAA 2PE6B 4HDQA 4LCDE 2PPHA 2O2VA 1NDDA 4MGIE 3ZUNA 2KTRB 1V5TA 1WRDB 1WMHA 1K8RB 4AP4C 3W1SA 3QAQA 3P2BA 2Z0DB 1YIWA 1ZGUB 2CS4A 1WI0A 4GSWA 5DPWA 2EKEC 1JRUA 2G4DB 3ML8A 2FIFA 4FADA 3OLMD 4W9EA 1SGHA 3DCGA 1XD3B 3H7SA 4B95A 3DVNV 3VDZA 1ZW7A 4RM9A 4CO7A 4NAWB 4F7ZA 4EFOA 2PJHA 1WE7A 4FHKA 3CF6E 4JGHB 2KKCA 3QJZA 3A9KA 3O65B 2DYOA 4WWOA 5FR6A 3VTWA 2PE9A 3I3TB 1P3QU 2KJ6A 4K81A 3TBLD 2ZZPB 2BWFA 3NHEB 3DPDA 4F8CB 2XK5B 5LXHA 4EEWA 1GG3A 1WYWB 1WJUA 3LJ3A 3V62A 4IUMB 4ANWA 3H7PA 2IO3B 1UH6A 1OEYJ 2EMTA 3Q3FA 2KLGA 5DPSA 4AOFA 2KFKB 4FN2A 4XZ4A 1EF1A 3SU8X 1TZ1A 3HM6X 2NBWB 1U4AA 2KDFB 3DOWA 2YVCA 1UBQA 3IHPC 4BVUC 2LGXA 4ZRKA 4LDTD 3OAWA 2KDEB 4DWFA 2K6DB 4K7SA 1EUVB 4OVUA 3ZO5B 3ZRFA 3APDA 2R2OA 1V2YA 3PRMB 2K8BA 3N32A 4M8NA 2KWVB 3IVFA 5AZHA 1Q1OA 2R2QA 3DVNU 3WIMA 3KW5B 3KH0A 3VH3B 4MELA 1IYFA 3TIXA 5KHOA 3HK0A 4WJQA 4PS8A 2LASA 1WF9A 2C60A 3ZRCA 3HHMA 2JY6A 1MG8A 4HVBA 1Z2MA 5IA7A 2KK8A 3QWZB 3SHQA 4IC7B 1NI2A 4TKNA 4IW0A 3RD2A 5D2MB 2KD0A 2KN5A 2KOXA 4XC2A 2DAFA 4ANXA 4HCPB 1WR1A 4MH0E 4DXAB 3PSEB 2AYOB 4PYZA 3X0WA 3NZUA 2GMIC 4OVVA 1V49A 3ZTCA 4PYUA 1ZKHA 2BWES 3QARA 1V5OA 4KIKA 4WWPA 4ASWC 4DK5A 1WZ0A 1L7YA 4DHZB 1VCBA 2KC1A 2LVPA 2WWZA 5C1ZA 2ZEQA 5L83A 1XT9B 4W9HA 4A3OA 1WX8A 3H9DA 4B6WA 4ICUA 4X57B 3W1YA 3ONSA 3K9OB 2FUHB 4E3CA 4W9LA 2M0XA 2KMAA 4W9GA 2CU1A 2NS5A 2NPTB 2KANA 3EHVA 2GBKA 1WM2A 2KC2A 4JQWC 3EC8A 3DBLI 3VTUA 3PS6A 2JT4B 2ZJDA 5JHAA 1H8CA 2M17A 2DAJA 3BINA 2JZZA 3KUCB 3A1QB 1P9DU 3A4RA 1E5WA 1D3ZA 1WJ4A 4NQKE 3A9JB 4PS7A 1KOTA 2BYEA 3ZTDA 3B0AA 1WJ6A 3KYCD 2IBIB 2KX3A 2DZIA 1C1YB 1YX5B 2D10A 3UGBB 3QA8A 2N9XA 2IY0B 1UGMA 2MBBB 2UWQA 1TGZB 3M62B 3C0RB 3VHTC 2KWUB 3A4SC 2KDIA 3DQVA 2FCQA 2GBRA 2KJRA 3DDCB 2BYVE 2D3GA 4ZRJA 2MBEA 2L76A 3HIZA 3QCAA 4LDTB 5G2NA 1TTNA 3MTNB 4KVGB 3RT3B 3UIPB 3VUXA 3VVWB 4ZDVA 4GDLA 3CSFA 3WA0A 3ZNZB 2MBHA 2WX1A 4KV2A 1Q0WB 4NJ7A 5LLIA 3VXWA 1GNUA 1GUAB 2MP2A 1V6EA 2DYMA 2G3QB 4FJZA 3A9KB 5E6OA 4F1SA 1J8CA 4IM0A 3DBRI 3KYDD 1WY8A 4K7WA 1OEYA 3AI5A 1J0GA 4LJOB 4MM3A 3ZDMC 5BO4B 2BKRB 1WX7A 4BOSC 3DBSA 4BBNC 4G50A 2CHZA 4TV3A 1S1QB 2I1JA 2IO0B 4TQ0A 4TUUA 4IM3A 1YX6B 5D6JB 3T9LA 3M63B 1WXMA 3LDZE 4I6PA 4TQ1A 4DDID 1LM8B 1TBEA 4LJPB 3PVLA 4M8MA 1V81A 2ZCBA 1E8ZA 2KQ7A 4G0NB 2A5UA 3A33B 4KDIC 3OJ3A 2N9PC 3NS8A 5E6PA 4KZ0A 4AWJA 3QIJA 4J6IA 1GC7A 5JH5C 4BBNF 4HK2A 4K1RB 4MJSB 1OGWA 3WAMA 2VRRB 1YD8U 2XBBC 2MQJA 4KZCA 1E7VA 2JVCA 2GOWA 2KHWB 2V4LA 2FCNA 4NY0A 1WIAA 3UF8A 3Q3JA 4HPLB 3R7QA 4DHJD 3PLUA 3ZW3A 3ENEA 4W9CA 3RUIB 2ASQA 4ZRIA 2O6VA 3CMMB 1KM7A 1AARA 2DHZA 2RSUA 4NAWA 4CHKA 3PGEA 3GZNI 2KXJA 2OOBB 5C23A 2MBOA 3PTFC 5TR5A 2JZ3B 3AU4A 2BGFA 2LD9A 2D2QA 1F9JA 1R4NI 2WDTB 2RD0A 4FHJA 2XK5A 1P98A 3PHWB 5DPTA 3IFWB 5AZGA 3UQAA 2OJRA 3JW0X 3PZDA 4N9F4 3RULA 4BFRA 1Z5SB 2DZKA 4HDOA 2KFJA 3KVFB 3AXCA 2KNBA 2N7EA 2CHXA 2LXAA 3DBHI 5JHBA 2KFKA 2MX2A 3V61A 4FJVB 4AJWA 4ZYNA 4ANUA 2Z59B 2V3SA 2NCNA 3RYTA 3ZNGC 2K39A 3MJWA 1Y8RC 1E7UA 3QC8B 4JIOU 4WAAA 2C5LC 5GMVA 4W9KA 4EUTA 1UZXB 3ZNID 2KDBA 4EZJA 4GDKB 2L05A 2AL3A 3EFUA 2HD5B 4WJNA 2O6VD 2DZJA 4YL8A 5CHVC 3WANA 2J0JA 3PRZA 2Z0EB 1CMXB 2IZVB 2HTHA 3OJ4B 1OQYA 3NOBA 4HJKA 3VAWA 4FJYA 1YQBA 2K25A 4HPMB 2D11A 2BF8B 1S3SG 4G3XB 3RZWC 4EOYA 4DDGD 3NZSA 4MGZE 3TCAA 2K8HA 3U7DA 2KX0A 3VFKA 3TL5A 3JYUA 3VH4B 2JRIB 1IPGA 2BYFA 2N1VA 4GU2A 5L95C 3CSTA 1LQBA 2ZPYA 2WYQA 2J7QB 2V1YA 1G6JA 3JSVA 3ZVVA 1GJZA 4HXDA 3AULA 4KDLB 2KLCA 2KMCA 5CTRC 2ZVOA 4EZLA 1BT0A 2CHWA 2I1KA 2C9WB 2MA9B 2LGDA 2K1FA 1V80A 2LRWA 1WGGA 2O2VB 2LI5A 2JRHA 2L0TA 3PV1A 3W1SC 3T8MA 2REXA 1WMHB 2C7NB 2RPQA 1Q5WB 3PHXB 4DBGA 4GN1A 2FIDA 5CX3A 3EECA 3RZFA 2FCSA 2MSED 3L54A 4BOZB 2LWPA 4DHJB 4BKGA 4MDKE 4XX5A 2N9EB 4GIVA 2NPTA 2RGFA 2LXCA 2KO3A 1WH3A 2K6QA 4WQOB 3L0WB 1ISNA 4HLEA 3K9PB 4JL9A 2K8CA 2LZ6A 4DHZE 2KQSA 2IO2B 4A20A 3A1QA 3TMPB 2ZVNA 4II2B 2IO1B 3X23A 3A9JA 3GOEA 3IBEA 4KSKC 4W9DA 5CHWA 1A5RA 1RAXA 3V6EB 2L8JA 4MGYE 1WX9A 4AJYB 1I35A 3UIOB 3L17A 2ZPNA 2MBQA 3KUZA 4JLCA 1UD7A 3WAPA 3ZLZA 2JF5A 3H7PB 4MSQB 3WAOA 3ZDTA 5LXIB 2M8SA 2KZRA 3VUYA 2L00B 2KTRA 2FNJB 2W9NA 1GC6A 2GBNA 2JXXA 3JVZX 3M95A 1NBFC 4IWPA 3APCA 1SE9A 1E8XA 1WXVA 1YJ1A 2B3AA 1WE6A 1WGDA 2D07B 3APFA 3MHSD 1I42A 1EO6A 2EMSA 2O6VB 4E71A 4IG7B 1M94A 2MW5A 2UYZB 4RMAA 3UQBA 4GGQA 2NR2A 2C7HA 2LJ5A 4GB9A 2CR5A 2J0MA 3B1LX 1FXTB 1WZ3A 2ZCCA 3L10B 5E6NA 4EZKA 2C7MB 2FCMA 2MLBA 4EKUA 3U30A 3DVGY 2NBVB 3R7RA 3TJPA 5D7GA 2KJHB 2WX0A 2YLMA 2AEHA 4IM2A 3ML9A 4I6NB 3S2AA 4GMVA 4HCNB 3PREA 1WGRA 1WFYA 3VUWA 1WXSA 2DENB 5DPRA 2JWZA 2M4NA 2DX5B 2DYBA 4ANVA 1T0YA 4NNJB 2J0KA 4W9JA 4B9KA 3BY4B 3QX1A 1XQQA 2FAZA 1WR6E 2LVOA 3L13A 3QQ8B 4BKTA 4P7IA 4MJSA 5G55A 5CHFA 2M1MA 1LFDA 2N7DA 4MGKE 2LGYA 2JPHA 2GBJA 5AEKB 3B08A 2L7RA 4IWOA 1V9JA 4KIKB 1HE8A 2LRUA 5JZEB 3ECIA 3L08A 2KVRA 1P0RA 3PRPB 3D32A 2MWSB 1E8YA 3ZKJC 3QHTA 4PS3A 5HKHA 5KHQA 1L2NA 3ZIMA 3ALBA 3N30A 5J2RA 4KSLC 2CKHB 2L0FA 1QZEA 4URKA 4WJPA 1KLVA 1SIFA 2N1WA 1E8WA 3H6NA 4NJ6A 4GOCA 1WXAA 4MSMB 4FBJB 5J17A 3HM3A 1VD2A 4BKSA 4IWQA 2KWCA 2DZMA 2LUEA 3N3KB 4NQLB 3AU5A 2MCNB 4W9IA 4K7UA 1E90A 3QK0A 4HWIB 4II3B 3V60A 1WGYA 2IY1B 2AL6A 2KTFA 2BPSA 3JSVB 1H4RA 3M3JA 3SD5A 5D94A 3R66C 1C3TA 2PEAA 4NPNA 3V6CB 3H1UA 4M0WB 4MEMA 2L3ZA 3ZNHB 4FA6A 4RM8A 4GDKA 4WWNA 5AZFA 2IYDB 2MRPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GBM A;  3PPA A;  2LVQ A;  2NBU A;  4AUQ C;  2JUO A;  2HJ8 A;  2QHO A;  3SDL C;  3R3M A;  2ZNV C;  5IAA C;  5EDS A;  3PLV A;  3WAL A;  4E74 A;  2ZNV B;  3KUD B;  3PT2 B;  1R4M I;  1KJT A;  1V86 A;  1UBI A;  1X1M A;  3RCZ A;  2Y5B B;  4GXB A;  1WM3 A;  2RR9 A;  4WJO A;  3IG3 A;  1UEL A;  4GDL B;  4BKS D;  2XEW A;  3VQI A;  1WGH A;  1WJN A;  1PQS A;  2BKF A;  1LXD A;  3VTV A;  3UIN B;  5J18 A;  2HE7 A;  2MP2 B;  1J19 A;  3DVG X;  1IP9 A;  2NVU I;  1RLF A;  2G4S A;  2N4F A;  4I6L B;  3NY5 A;  3U8Z A;  2G45 B;  1P1A A;  4G11 A;  3L16 A;  2AWT A;  4FUL A;  4ICV A;  4CYE A;  2A4Z A;  4A3P A;  1OTR B;  5DCN A;  1EF5 A;  4FLH A;  1RRB A;  4W9F A;  1RFA A;  2PE6 B;  4HDQ A;  4LCD E;  2PPH A;  2O2V A;  1NDD A;  4MGI E;  3ZUN A;  2KTR B;  1V5T A;  1WRD B;  1WMH A;  1K8R B;  4AP4 C;  3W1S A;  3QAQ A;  3P2B A;  2Z0D B;  1YIW A;  1ZGU B;  2CS4 A;  1WI0 A;  4GSW A;  5DPW A;  2EKE C;  1JRU A;  2G4D B;  3ML8 A;  2FIF A;  4FAD A;  3OLM D;  4W9E A;  1SGH A;  3DCG A;  1XD3 B;  3H7S A;  4B95 A;  3DVN V;  3VDZ A;  1ZW7 A;  4RM9 A;  4CO7 A;  4NAW B;  4F7Z A;  4EFO A;  2PJH A;  1WE7 A;  4FHK A;  3CF6 E;  4JGH B;  2KKC A;  3QJZ A;  3A9K A;  3O65 B;  2DYO A;  4WWO A;  5FR6 A;  3VTW A;  2PE9 A;  3I3T B;  1P3Q U;  2KJ6 A;  4K81 A;  3TBL D;  2ZZP B;  2BWF A;  3NHE B;  3DPD A;  4F8C B;  2XK5 B;  5LXH A;  4EEW A;  1GG3 A;  1WYW B;  1WJU A;  3LJ3 A;  3V62 A;  4IUM B;  4ANW A;  3H7P A;  2IO3 B;  1UH6 A;  1OEY J;  2EMT A;  3Q3F A;  2KLG A;  5DPS A;  4AOF A;  2KFK B;  4FN2 A;  4XZ4 A;  1EF1 A;  3SU8 X;  1TZ1 A;  3HM6 X;  2NBW B;  1U4A A;  2KDF B;  3DOW A;  2YVC A;  1UBQ A;  3IHP C;  4BVU C;  2LGX A;  4ZRK A;  4LDT D;  3OAW A;  2KDE B;  4DWF A;  2K6D B;  4K7S A;  1EUV B;  4OVU A;  3ZO5 B;  3ZRF A;  3APD A;  2R2O A;  1V2Y A;  3PRM B;  2K8B A;  3N32 A;  4M8N A;  2KWV B;  3IVF A;  5AZH A;  1Q1O A;  2R2Q A;  3DVN U;  3WIM A;  3KW5 B;  3KH0 A;  3VH3 B;  4MEL A;  1IYF A;  3TIX A;  5KHO A;  3HK0 A;  4WJQ A;  4PS8 A;  2LAS A;  1WF9 A;  2C60 A;  3ZRC A;  3HHM A;  2JY6 A;  1MG8 A;  4HVB A;  1Z2M A;  5IA7 A;  2KK8 A;  3QWZ B;  3SHQ A;  4IC7 B;  1NI2 A;  4TKN A;  4IW0 A;  3RD2 A;  5D2M B;  2KD0 A;  2KN5 A;  2KOX A;  4XC2 A;  2DAF A;  4ANX A;  4HCP B;  1WR1 A;  4MH0 E;  4DXA B;  3PSE B;  2AYO B;  4PYZ A;  3X0W A;  3NZU A;  2GMI C;  4OVV A;  1V49 A;  3ZTC A;  4PYU A;  1ZKH A;  2BWE S;  3QAR A;  1V5O A;  4KIK A;  4WWP A;  4ASW C;  4DK5 A;  1WZ0 A;  1L7Y A;  4DHZ B;  1VCB A;  2KC1 A;  2LVP A;  2WWZ A;  5C1Z A;  2ZEQ A;  5L83 A;  1XT9 B;  4W9H A;  4A3O A;  1WX8 A;  3H9D A;  4B6W A;  4ICU A;  4X57 B;  3W1Y A;  3ONS A;  3K9O B;  2FUH B;  4E3C A;  4W9L A;  2M0X A;  2KMA A;  4W9G A;  2CU1 A;  2NS5 A;  2NPT B;  2KAN A;  3EHV A;  2GBK A;  1WM2 A;  2KC2 A;  4JQW C;  3EC8 A;  3DBL I;  3VTU A;  3PS6 A;  2JT4 B;  2ZJD A;  5JHA A;  1H8C A;  2M17 A;  2DAJ A;  3BIN A;  2JZZ A;  3KUC B;  3A1Q B;  1P9D U;  3A4R A;  1E5W A;  1D3Z A;  1WJ4 A;  4NQK E;  3A9J B;  4PS7 A;  1KOT A;  2BYE A;  3ZTD A;  3B0A A;  1WJ6 A;  3KYC D;  2IBI B;  2KX3 A;  2DZI A;  1C1Y B;  1YX5 B;  2D10 A;  3UGB B;  3QA8 A;  2N9X A;  2IY0 B;  1UGM A;  2MBB B;  2UWQ A;  1TGZ B;  3M62 B;  3C0R B;  3VHT C;  2KWU B;  3A4S C;  2KDI A;  3DQV A;  2FCQ A;  2GBR A;  2KJR A;  3DDC B;  2BYV E;  2D3G A;  4ZRJ A;  2MBE A;  2L76 A;  3HIZ A;  3QCA A;  4LDT B;  5G2N A;  1TTN A;  3MTN B;  4KVG B;  3RT3 B;  3UIP B;  3VUX A;  3VVW B;  4ZDV A;  4GDL A;  3CSF A;  3WA0 A;  3ZNZ B;  2MBH A;  2WX1 A;  4KV2 A;  1Q0W B;  4NJ7 A;  5LLI A;  3VXW A;  1GNU A;  1GUA B;  2MP2 A;  1V6E A;  2DYM A;  2G3Q B;  4FJZ A;  3A9K B;  5E6O A;  4F1S A;  1J8C A;  4IM0 A;  3DBR I;  3KYD D;  1WY8 A;  4K7W A;  1OEY A;  3AI5 A;  1J0G A;  4LJO B;  4MM3 A;  3ZDM C;  5BO4 B;  2BKR B;  1WX7 A;  4BOS C;  3DBS A;  4BBN C;  4G50 A;  2CHZ A;  4TV3 A;  1S1Q B;  2I1J A;  2IO0 B;  4TQ0 A;  4TUU A;  4IM3 A;  1YX6 B;  5D6J B;  3T9L A;  3M63 B;  1WXM A;  3LDZ E;  4I6P A;  4TQ1 A;  4DDI D;  1LM8 B;  1TBE A;  4LJP B;  3PVL A;  4M8M A;  1V81 A;  2ZCB A;  1E8Z A;  2KQ7 A;  4G0N B;  2A5U A;  3A33 B;  4KDI C;  3OJ3 A;  2N9P C;  3NS8 A;  5E6P A;  4KZ0 A;  4AWJ A;  3QIJ A;  4J6I A;  1GC7 A;  5JH5 C;  4BBN F;  4HK2 A;  4K1R B;  4MJS B;  1OGW A;  3WAM A;  2VRR B;  1YD8 U;  2XBB C;  2MQJ A;  4KZC A;  1E7V A;  2JVC A;  2GOW A;  2KHW B;  2V4L A;  2FCN A;  4NY0 A;  1WIA A;  3UF8 A;  3Q3J A;  4HPL B;  3R7Q A;  4DHJ D;  3PLU A;  3ZW3 A;  3ENE A;  4W9C A;  3RUI B;  2ASQ A;  4ZRI A;  2O6V A;  3CMM B;  1KM7 A;  1AAR A;  2DHZ A;  2RSU A;  4NAW A;  4CHK A;  3PGE A;  3GZN I;  2KXJ A;  2OOB B;  5C23 A;  2MBO A;  3PTF C;  5TR5 A;  2JZ3 B;  3AU4 A;  2BGF A;  2LD9 A;  2D2Q A;  1F9J A;  1R4N I;  2WDT B;  2RD0 A;  4FHJ A;  2XK5 A;  1P98 A;  3PHW B;  5DPT A;  3IFW B;  5AZG A;  3UQA A;  2OJR A;  3JW0 X;  3PZD A;  4N9F 4;  3RUL A;  4BFR A;  1Z5S B;  2DZK A;  4HDO A;  2KFJ A;  3KVF B;  3AXC A;  2KNB A;  2N7E A;  2CHX A;  2LXA A;  3DBH I;  5JHB A;  2KFK A;  2MX2 A;  3V61 A;  4FJV B;  4AJW A;  4ZYN A;  4ANU A;  2Z59 B;  2V3S A;  2NCN A;  3RYT A;  3ZNG C;  2K39 A;  3MJW A;  1Y8R C;  1E7U A;  3QC8 B;  4JIO U;  4WAA A;  2C5L C;  5GMV A;  4W9K A;  4EUT A;  1UZX B;  3ZNI D;  2KDB A;  4EZJ A;  4GDK B;  2L05 A;  2AL3 A;  3EFU A;  2HD5 B;  4WJN A;  2O6V D;  2DZJ A;  4YL8 A;  5CHV C;  3WAN A;  2J0J A;  3PRZ A;  2Z0E B;  1CMX B;  2IZV B;  2HTH A;  3OJ4 B;  1OQY A;  3NOB A;  4HJK A;  3VAW A;  4FJY A;  1YQB A;  2K25 A;  4HPM B;  2D11 A;  2BF8 B;  1S3S G;  4G3X B;  3RZW C;  4EOY A;  4DDG D;  3NZS A;  4MGZ E;  3TCA A;  2K8H A;  3U7D A;  2KX0 A;  3VFK A;  3TL5 A;  3JYU A;  3VH4 B;  2JRI B;  1IPG A;  2BYF A;  2N1V A;  4GU2 A;  5L95 C;  3CST A;  1LQB A;  2ZPY A;  2WYQ A;  2J7Q B;  2V1Y A;  1G6J A;  3JSV A;  3ZVV A;  1GJZ A;  4HXD A;  3AUL A;  4KDL B;  2KLC A;  2KMC A;  5CTR C;  2ZVO A;  4EZL A;  1BT0 A;  2CHW A;  2I1K A;  2C9W B;  2MA9 B;  2LGD A;  2K1F A;  1V80 A;  2LRW A;  1WGG A;  2O2V B;  2LI5 A;  2JRH A;  2L0T A;  3PV1 A;  3W1S C;  3T8M A;  2REX A;  1WMH B;  2C7N B;  2RPQ A;  1Q5W B;  3PHX B;  4DBG A;  4GN1 A;  2FID A;  5CX3 A;  3EEC A;  3RZF A;  2FCS A;  2MSE D;  3L54 A;  4BOZ B;  2LWP A;  4DHJ B;  4BKG A;  4MDK E;  4XX5 A;  2N9E B;  4GIV A;  2NPT A;  2RGF A;  2LXC A;  2KO3 A;  1WH3 A;  2K6Q A;  4WQO B;  3L0W B;  1ISN A;  4HLE A;  3K9P B;  4JL9 A;  2K8C A;  2LZ6 A;  4DHZ E;  2KQS A;  2IO2 B;  4A20 A;  3A1Q A;  3TMP B;  2ZVN A;  4II2 B;  2IO1 B;  3X23 A;  3A9J A;  3GOE A;  3IBE A;  4KSK C;  4W9D A;  5CHW A;  1A5R A;  1RAX A;  3V6E B;  2L8J A;  4MGY E;  1WX9 A;  4AJY B;  1I35 A;  3UIO B;  3L17 A;  2ZPN A;  2MBQ A;  3KUZ A;  4JLC A;  1UD7 A;  3WAP A;  3ZLZ A;  2JF5 A;  3H7P B;  4MSQ B;  3WAO A;  3ZDT A;  5LXI B;  2M8S A;  2KZR A;  3VUY A;  2L00 B;  2KTR A;  2FNJ B;  2W9N A;  1GC6 A;  2GBN A;  2JXX A;  3JVZ X;  3M95 A;  1NBF C;  4IWP A;  3APC A;  1SE9 A;  1E8X A;  1WXV A;  1YJ1 A;  2B3A A;  1WE6 A;  1WGD A;  2D07 B;  3APF A;  3MHS D;  1I42 A;  1EO6 A;  2EMS A;  2O6V B;  4E71 A;  4IG7 B;  1M94 A;  2MW5 A;  2UYZ B;  4RMA A;  3UQB A;  4GGQ A;  2NR2 A;  2C7H A;  2LJ5 A;  4GB9 A;  2CR5 A;  2J0M A;  3B1L X;  1FXT B;  1WZ3 A;  2ZCC A;  3L10 B;  5E6N A;  4EZK A;  2C7M B;  2FCM A;  2MLB A;  4EKU A;  3U30 A;  3DVG Y;  2NBV B;  3R7R A;  3TJP A;  5D7G A;  2KJH B;  2WX0 A;  2YLM A;  2AEH A;  4IM2 A;  3ML9 A;  4I6N B;  3S2A A;  4GMV A;  4HCN B;  3PRE A;  1WGR A;  1WFY A;  3VUW A;  1WXS A;  2DEN B;  5DPR A;  2JWZ A;  2M4N A;  2DX5 B;  2DYB A;  4ANV A;  1T0Y A;  4NNJ B;  2J0K A;  4W9J A;  4B9K A;  3BY4 B;  3QX1 A;  1XQQ A;  2FAZ A;  1WR6 E;  2LVO A;  3L13 A;  3QQ8 B;  4BKT A;  4P7I A;  4MJS A;  5G55 A;  5CHF A;  2M1M A;  1LFD A;  2N7D A;  4MGK E;  2LGY A;  2JPH A;  2GBJ A;  5AEK B;  3B08 A;  2L7R A;  4IWO A;  1V9J A;  4KIK B;  1HE8 A;  2LRU A;  5JZE B;  3ECI A;  3L08 A;  2KVR A;  1P0R A;  3PRP B;  3D32 A;  2MWS B;  1E8Y A;  3ZKJ C;  3QHT A;  4PS3 A;  5HKH A;  5KHQ A;  1L2N A;  3ZIM A;  3ALB A;  3N30 A;  5J2R A;  4KSL C;  2CKH B;  2L0F A;  1QZE A;  4URK A;  4WJP A;  1KLV A;  1SIF A;  2N1W A;  1E8W A;  3H6N A;  4NJ6 A;  4GOC A;  1WXA A;  4MSM B;  4FBJ B;  5J17 A;  3HM3 A;  1VD2 A;  4BKS A;  4IWQ A;  2KWC A;  2DZM A;  2LUE A;  3N3K B;  4NQL B;  3AU5 A;  2MCN B;  4W9I A;  4K7U A;  1E90 A;  3QK0 A;  4HWI B;  4II3 B;  3V60 A;  1WGY A;  2IY1 B;  2AL6 A;  2KTF A;  2BPS A;  3JSV B;  1H4R A;  3M3J A;  3SD5 A;  5D94 A;  3R66 C;  1C3T A;  2PEA A;  4NPN A;  3V6C B;  3H1U A;  4M0W B;  4MEM A;  2L3Z A;  3ZNH B;  4FA6 A;  4RM8 A;  4GDK A;  4WWN A;  5AZF A;  2IYD B;  2MRP A; 
#chains in the Genus database with same CATH topology
 3PPA A;  2WXP A;  3GE3 C;  2JUO A;  1JW9 D;  3SDL C;  5EDS A;  1KH0 A;  4Q2J A;  1V1P A;  2OHF A;  2ZNV B;  3PT2 B;  1J7B A;  5I4D A;  2WGS A;  4LTU A;  2JX5 A;  1YJI A;  2Y5B B;  1WM3 A;  2BB5 A;  3IG3 A;  1UEL A;  3BVG A;  2KWD A;  3P42 A;  4BKS D;  1WGH A;  1WJN A;  5BMG A;  5J18 A;  3KLS X;  2RPV A;  2NVU I;  2N4F A;  4G11 A;  3P4S B;  3NVW A;  4A3P A;  4FLH A;  1J7C A;  1RFA A;  1E7P B;  2IND C;  1J7A A;  3ZUN A;  4DXG A;  3QAQ A;  3ML8 A;  4OHJ A;  1NVI D;  4W9E A;  2PVO D;  3DCG A;  1ZW7 A;  4JE3 B;  1QOB A;  4CO7 A;  4F7Z A;  1WE7 A;  1L0V B;  5FR6 A;  2PE9 A;  1JWA D;  1F2R I;  1P3Q U;  1T3Q A;  1TT5 B;  2KJ6 A;  3TBL D;  3NHE B;  5LXH A;  1WJU A;  1UWX A;  3NVY A;  1UH6 A;  2EMT A;  4XZ4 A;  4ARC A;  4RF0 A;  2PIA A;  2QIE B;  3DOW A;  2YVC A;  3IHP C;  4BVU C;  2LGX A;  4ZRK A;  4LDT D;  1C4P A;  2KDE B;  4DWF A;  4OVU A;  1EUV B;  2VH2 A;  3ZO5 B;  3FKY A;  2R2O A;  1V2Y A;  3RN9 C;  1TY2 A;  3R8B A;  3IVF A;  3Q3N C;  2R2Q A;  1JWM D;  2CU3 A;  1N60 A;  3RNF C;  4MEL A;  3HK0 A;  4PS8 A;  1XEE A;  1WF9 A;  3T3O A;  1HQR D;  1MG8 A;  5AUI A;  4HVB A;  5IA7 A;  4TKN A;  3RD2 A;  1I4H A;  4HCP B;  4J3O D;  4MH0 E;  4B0M A;  3PSE B;  2AYO B;  1NI3 A;  4PYZ A;  3X0W A;  3TEW A;  4L2Y A;  3ZTC A;  4A90 A;  3Q6B A;  2ACZ B;  2BWE S;  3QAR A;  4WWP A;  3GB1 A;  1C79 A;  2JZP A;  3MP9 A;  2KC1 A;  5C1Z A;  2Q5W D;  2WXI A;  4W9H A;  4B6W A;  4H2A A;  3R2I A;  2WXN A;  2KMA A;  1SE4 A;  4XE0 A;  2KAN A;  3EHV A;  3DHG C;  4PT5 A;  1ET9 A;  1WM2 A;  2KC2 A;  2BYT A;  3EC8 A;  3DBL I;  1TS4 A;  3VTU A;  2ZW1 A;  1H8C A;  2ZJD A;  2M17 A;  2DAJ A;  3W2D A;  2MJD A;  1E5W A;  1XLQ A;  3A9J B;  3AE6 B;  1KOT A;  2BYE A;  2IGH A;  3KYC D;  2IBI B;  1C1Y B;  1YX5 B;  2D10 A;  3NG0 A;  3QA8 A;  4ZRP A;  1TGZ B;  2KWU B;  4ACF A;  2KAJ A;  4ARI A;  2D3G A;  3O13 A;  1V8C A;  1TTN A;  3MTN B;  4KVG B;  4GDL A;  1F52 A;  2L1A A;  2ONQ A;  2MBH A;  1Q0W B;  1C77 A;  2MP2 A;  1V6E A;  2G3Q B;  2XNA C;  4OZC A;  1J0G A;  4MM3 A;  2LJI A;  4G50 A;  2CHZ A;  4TV3 A;  1TIF A;  2PTL A;  4TUU A;  4TQ1 A;  3LDZ E;  3P1M A;  1NYQ A;  3PVL A;  1E8Z A;  4G0N B;  3DBR B;  3OJ3 A;  2N9P C;  5E6P A;  4KZ0 A;  3U52 E;  3QIJ A;  4ZRQ A;  2GLS A;  5HI1 A;  1OGW A;  1FO4 A;  4C00 A;  1ZE3 D;  4NY0 A;  2V4L A;  2JWU A;  4HPL B;  2K22 A;  4DHJ D;  3RUI B;  3CMM B;  2DHZ A;  3GZN I;  2OOB B;  4S0R A;  1JAL A;  2D2Q A;  1F9J A;  1TKE A;  2RD0 A;  3Q8A A;  2XK5 A;  3PZD A;  3RUL A;  4NJC A;  1C4A A;  2DZK A;  3AXC A;  2Y5P A;  2N7E A;  3AE1 B;  3LYY A;  4FJV B;  1L6U A;  2V3S A;  3MJW A;  3OWE B;  5GMV A;  2C5L C;  4EUT A;  1UZX B;  3ZNI D;  2KDB A;  4GDK B;  2WU5 B;  1L4Z B;  5CHV C;  4YSY B;  4YWG G;  2J0J A;  3PRZ A;  1EU4 A;  1CMX B;  1TY0 A;  1DGJ A;  2MJ3 A;  1S3S G;  3RZW C;  2V3P A;  2W55 A;  4DDG D;  4MGZ E;  3TCA A;  2K8H A;  4AQ7 A;  1UNS A;  2KX0 A;  2JRI B;  2N1V A;  2BYF A;  2WXQ A;  1VJK A;  1VZ8 A;  3BK1 A;  2V1Y A;  4M01 A;  3ZVV A;  4KDL B;  3AUL A;  2CHW A;  1P7F A;  2I1K A;  3RNG C;  1GOZ A;  4LLG M;  1V80 A;  2V9H A;  3LXF A;  1WGG A;  1I4Q A;  2JRH A;  2CJN A;  3BVZ A;  2REX A;  3T8M A;  1WMH B;  1Q5W B;  3PHX B;  3GE8 C;  2FID A;  4EE2 A;  3RZF A;  4BKG A;  1QT9 A;  1C9F A;  4A9A A;  1DOI A;  3DWG C;  1WGK A;  4HLE A;  3FIL A;  3TMP B;  3GOE A;  5CHW A;  3IBE A;  4W9D A;  2SAK A;  3V6E B;  2WXH A;  1XF5 L;  3L17 A;  3UIO B;  2JF5 A;  4XDC A;  4HKQ A;  1T0Q C;  3WAO A;  2VH1 A;  3VUY A;  2L00 B;  2KTR A;  2XN9 C;  4O1N A;  1DYQ A;  3M95 A;  3APC A;  1SE9 A;  2B3A A;  2D07 B;  2W3R A;  1I42 A;  1EO6 A;  2O6V B;  2JQR B;  2H89 B;  4WAF A;  2J0M A;  2K0P A;  1FXT B;  1WZ3 A;  2ZCC A;  3B1L X;  2HDE A;  1LO5 D;  2AEH A;  3MFG A;  1JRP A;  1SXT A;  4GMV A;  4HCN B;  1WXS A;  2DEN B;  4C7Y A;  4RGM A;  4ANV A;  1T0Y A;  4NNJ B;  4B9K A;  3E56 A;  1LGR A;  2FAZ A;  2LVO A;  5G5H A;  3L13 A;  4BKT A;  1EWC A;  2WXG A;  2LGI A;  4P7I A;  2LGY A;  2JPH A;  1JWU D;  2DNF A;  1WXQ A;  1UGJ A;  1V9J A;  1HE8 A;  2HTM E;  3PRP B;  1DOX A;  1C78 A;  1E8Y A;  3ZKJ C;  2RDH A;  3QHT A;  1L2N A;  5J2R A;  4KSL C;  4US9 A;  1PGX A;  3U7Z A;  3AEE B;  4FBJ B;  5JHA A;  1E8W A;  4GOC A;  5EE3 A;  5J17 A;  2L83 A;  1E90 A;  3QK0 A;  2INN E;  2IY1 B;  2JYE A;  1CK1 A;  5BYQ A;  1KRH A;  4NPN A;  4MH8 A;  3ZNH B;  4KZC A;  4P1C C;  4WWN A;  5AZF A;  2MRP A;  2GBM A;  2LVQ A;  2NBU A;  2QHO A;  3PLV A;  3KUD B;  3ZGZ A;  4HKZ E;  3RCZ A;  3V05 A;  1SBB B;  3VQI A;  1PQS A;  2INC C;  4XDD A;  3VTV A;  3UIN B;  4PK1 A;  2HE7 A;  3DVG X;  1J19 A;  1IP9 A;  1R4M B;  1RLF A;  3U8Z A;  3TEX A;  3L16 A;  3RNB C;  3GS2 A;  4WUR A;  5DCN A;  4HDQ A;  2PE6 B;  3W5V B;  2O2V A;  1KTK A;  1NDD A;  1F0Z A;  1K8R B;  2FBW B;  3P2B A;  1RFK A;  1YIW A;  1WI0 A;  4GSW A;  4YSZ B;  3OLM D;  2D3A A;  3BVM A;  1XD3 B;  2ON8 A;  1SIJ A;  3DVN V;  1AWD A;  2WXO A;  1Y56 A;  1EU3 A;  4FHK A;  3W9C B;  3A9K A;  4WWO A;  5G5G A;  1WYG A;  3VTW A;  1ESF A;  2ZZP B;  2BWF A;  1UF0 A;  3N20 C;  4EEW A;  2NTT A;  4ANW A;  4YSX B;  3NVZ A;  3V62 A;  1NYR A;  3SFD B;  1B1Z A;  1BML C;  3AED B;  5DPS A;  4AOF A;  3NZ3 A;  3ZJV A;  4KX6 B;  4KKJ A;  3SU8 X;  2PKO A;  2KDF B;  5MPO A;  1UBQ A;  2GRI A;  4LNF A;  2K6D B;  3T3N A;  3APD A;  4XYC A;  2K8B A;  2MEK A;  1Q1O A;  3BYY B;  4ITK A;  2PVG C;  5D3D A;  1IYF A;  5KHO A;  2L32 A;  2QEJ C;  2WXR A;  3Q14 C;  3FAH A;  2BS4 B;  3AEA B;  1K53 A;  1IBX A;  3QWZ B;  3SHQ A;  1NI2 A;  3Q8E A;  3TEY A;  2KN5 A;  4LNO A;  1JWS D;  2X8X X;  2GMI C;  2OED A;  3VR9 B;  4DK5 A;  1L7Y A;  4WWM A;  1VCB A;  2ZEQ A;  3RPF C;  2D5G A;  1WX8 A;  2JU6 X;  3H9D A;  2J53 A;  4X57 B;  4HJG E;  1FD6 A;  1WSP A;  1KFY B;  2CU1 A;  2NPT B;  2LMC A;  2GBK A;  1TZO A;  2WXF A;  3KUC B;  4BAX A;  1D3Z A;  1VZ6 A;  1WJ4 A;  4PS7 A;  2VZK D;  3ZTD A;  1FMA D;  1WJ6 A;  3UGB B;  2N9X A;  3TEZ A;  1UGM A;  1GAQ B;  4WH4 A;  3A4S C;  5D3I B;  2KDI A;  4B0E A;  2HJ1 A;  4MT5 A;  3QCA A;  2E3T A;  3VXW A;  3EA6 A;  5IO9 A;  4FJZ A;  3DHH C;  2LUM A;  5E6O A;  2WLB A;  1WY8 A;  4K7W A;  3LB8 C;  2EKI A;  5EE0 A;  4BBN C;  2BBC A;  1BUI C;  4IM3 A;  5D6J B;  1WRI A;  1WXM A;  1Q10 A;  1TBE A;  4M8M A;  2CJO A;  1V81 A;  2A5U A;  4OZA A;  3A33 B;  4KDI C;  1FFU A;  4HPP A;  1GC7 A;  4K1R B;  4MJS B;  4RGT A;  4N6E B;  3AE4 B;  2VRR B;  1F2R C;  1E7V A;  2KHW B;  3UF8 A;  1YN3 A;  2FCN A;  1WIA A;  3VRA B;  3R7Q A;  3PLU A;  1FXA A;  4W9C A;  1CZP A;  1AAR A;  3PZ8 A;  2KXJ A;  5C23 A;  5H92 C;  3P4P B;  1R4N I;  4P1B C;  5DPT A;  3FC4 A;  3I5J C;  2M56 B;  1MHX A;  3U4E G;  3KVF B;  3DBH I;  4P6V F;  2CHX A;  2LXA A;  5JHB A;  4ZYN A;  4ANU A;  2Z59 B;  3RYT A;  4K3C A;  1E7U A;  1JCK B;  4JIO U;  4REZ A;  2L05 A;  2I2Y A;  2O6V D;  1FCC C;  2QSD A;  1IUE A;  2RMM A;  2IZV B;  2HTH A;  4HJK A;  3EFC A;  4WIP A;  1YQB A;  2WQY B;  4G3X B;  3VH4 B;  5L95 C;  3I57 A;  4GU2 A;  3CST A;  1LQB A;  2WYQ A;  3ZJU A;  3JSV A;  2BT6 A;  4HXD A;  2ZVO A;  1BT0 A;  1ACC A;  1UWM A;  1SE3 A;  2G1E A;  1I4G A;  1K52 A;  3AE2 B;  3Q8C A;  1HTO A;  4DBG A;  2WXJ A;  1T0R C;  1MPE A;  4JPS A;  3L54 A;  3J9C A;  1GB4 A;  4XX5 A;  2N9E B;  3CIR B;  3H8H A;  1PGA A;  2RDG A;  3RFZ B;  2KO3 A;  4UDU C;  1ISN A;  4NZL B;  3K9P B;  1TJE A;  4A20 A;  3IT4 B;  2ZVN A;  5LNK 1;  4II2 B;  1OQQ A;  3A9J A;  1A5R A;  4ZOH C;  1WX9 A;  1V1O A;  3KQ4 A;  1I35 A;  2PMV A;  2MBQ A;  4JLC A;  3H7P B;  5LXI B;  1GC6 A;  2GBN A;  4C56 C;  1E8X A;  1YJ1 A;  5IP4 D;  1WE6 A;  2IJ0 A;  1WGD A;  5IN7 A;  2MW5 A;  4RMA A;  3NRZ A;  4GGQ A;  4GB9 A;  1A70 A;  2FCM A;  1ENF A;  3U30 A;  4XGA B;  2YLM A;  4I6N B;  3S2A A;  4M02 A;  1WFY A;  1F1H A;  3VUW A;  2JWZ A;  2M0A A;  2DYB A;  3AE9 B;  1PDX A;  3Q3M C;  4LNN A;  3VR8 B;  3QQ8 B;  3KWV A;  2JSV X;  1N5X A;  3MHZ A;  1LFD A;  2N7D A;  2VZK B;  1SSN A;  4KIK B;  3L08 A;  3D32 A;  5KHQ A;  2X38 A;  2KDM A;  3URY A;  3ALB A;  4WJP A;  1KLV A;  2PW9 A;  4NJ6 A;  2R61 A;  3EGR A;  1WXA A;  1VD2 A;  4BKS A;  4IWQ A;  2KWC A;  4NQL B;  1VZ7 A;  4W9I A;  1E9M A;  4K7U A;  2BQQ A;  4II3 B;  1BXT A;  2BPS A;  4RNA A;  3R66 C;  2WXK A;  2DWQ A;  3V6C B;  3IXS A;  4M0W B;  5T8I A;  1I4P A;  4RM8 A;  4GDK A;  2IYD B;  3BZD B;  4AUQ C;  2HJ8 A;  5IAA C;  2ZNV C;  5C3J B;  4RGO S;  3WAL A;  1TS2 A;  2H88 B;  5HHD G;  1X1M A;  3AEC B;  3IAS 1;  1D4B A;  1VR9 A;  1ZUD 2;  2BKF A;  1JWB D;  1LXD A;  2G4S A;  2MJE A;  1P1A A;  4FUL A;  4IOI E;  1OTR B;  1EF5 A;  1YOV B;  3EUB 2;  2PPH A;  3BYT B;  4MGI E;  2KTR B;  3CWI A;  1WRD B;  1WMH A;  4AP4 C;  4RFB A;  1FCL A;  2Z0D B;  1ZGU B;  1YJJ A;  5DPW A;  1JRU A;  1SB3 C;  2YEP F;  3BII D;  2FIF A;  4FAD A;  2K9X A;  1SGH A;  4XWW A;  4NAW B;  1QLB B;  2PJH A;  1ET6 A;  4JGH B;  4C4V B;  1ZP0 B;  2W54 A;  2INP E;  3O65 B;  2DYO A;  3DPD A;  2PLP A;  5EE1 A;  1GG3 A;  1WYW B;  4LNK A;  3SFE B;  1OEY J;  3Q3F A;  4QAY A;  2KFK B;  2FE8 A;  1N6Z A;  1TZ1 A;  5BMH A;  1YN5 A;  1E10 A;  3HM6 X;  1EWY C;  3NJT A;  1U4A A;  2WNM A;  3OAW A;  3ZQ4 A;  1NEK B;  3PRM B;  1D5Z C;  1MG4 A;  2KWV B;  3N1Z C;  5AZH A;  2BTE A;  3DVN U;  1MI0 A;  3KW5 B;  3KH0 A;  3MC9 A;  4WJQ A;  3P63 A;  2ICI A;  2WDQ B;  1L5P A;  2KK8 A;  4IC7 B;  1B9R A;  4IW0 A;  4DQO C;  5D2M B;  2KD0 A;  4DXA B;  3NZU A;  4OW0 A;  1V49 A;  1ZKH A;  3N1X C;  4JWS C;  3AE8 B;  1V5O A;  2QIL A;  1WZ0 A;  2LFI A;  2LHD A;  3ONS A;  1VDV A;  3K9O B;  2FUH B;  4E3C A;  2K5P A;  4A8X C;  1YMH E;  3B2F A;  4JQW C;  2N9L A;  3AMZ A;  1PUT A;  3BIN A;  5AUK A;  2JZZ A;  3A1Q B;  1ZDX A;  2BS2 B;  3W5U B;  3P4Q B;  1FRR A;  2KX3 A;  3RNE C;  3N9Y C;  2IY0 B;  2QMT A;  1I7H A;  3DBL B;  5GXG B;  3C0R B;  1MVK A;  3DQV A;  2FCQ A;  2GBR A;  2KJR A;  3DDC B;  2L76 A;  3VUX A;  3RT3 B;  3VVW B;  3UIP B;  2L52 A;  5EE9 A;  2Z8L A;  2WX1 A;  4NJ7 A;  1GNU A;  1GUA B;  3Q69 A;  3A9K B;  1J8C A;  4IM0 A;  3DBR I;  1SEB D;  3AI5 A;  4HRO A;  3Q2A C;  4LJO B;  2BKR B;  1WX7 A;  2IO0 B;  4TQ0 A;  4DDI D;  4I6P A;  1LM8 B;  5JXV A;  2KQ7 A;  1ROE A;  1DOY A;  2J4X A;  3NS8 A;  5BYS A;  4HK2 A;  2GOW A;  4JX1 C;  3ZW3 A;  2WS3 B;  3ENE A;  2ASQ A;  4ZRI A;  2RSU A;  4A6Q A;  3PGE A;  1AW7 A;  1QKZ A;  4YTP B;  2KMM A;  3ETR A;  2JZ3 B;  3AU4 A;  5FR3 A;  1QOA A;  4FHJ A;  5AZG A;  3JW0 X;  4GLS C;  4BFR A;  3GZN B;  4HDO A;  2KNB A;  3MC0 B;  2MX2 A;  1AN8 A;  1YQ3 B;  2NCN A;  2QDF A;  4YTM B;  1FNW A;  1EM7 A;  4WAA A;  4EZJ A;  1MHH E;  2AL3 A;  2HD5 B;  4YL8 A;  1N63 A;  1V1P B;  1OQY A;  4USA A;  3NOB A;  1ZXI A;  1I4R A;  3PZ7 A;  3V3X A;  2D11 A;  2BF8 B;  4EOY A;  3NZS A;  1PFD A;  3ZXV A;  3TL5 A;  1P7E A;  1IPG A;  1CJE A;  2J7Q B;  1GJZ A;  2QJL A;  1TKY A;  5CTR C;  4EZL A;  2K1F A;  2EEL A;  4TMA B;  2LRW A;  3B9J A;  2LI5 A;  1HZ5 A;  2L0T A;  3PV1 A;  1JRO A;  1HA5 A;  2C7N B;  5CX3 A;  3EEC A;  4BOZ B;  4MDK E;  2WHI A;  2GI9 A;  4GIV A;  2NPT A;  2LXC A;  1WH3 A;  4WQO B;  4JL9 A;  2K8C A;  2LZ6 A;  2FUG 1;  2IO2 B;  2KQS A;  4DHZ E;  1FEH A;  1YN4 A;  3IAM 1;  4KSK C;  1UUP A;  1HZ6 A;  4AJY B;  1FFV A;  1YQ4 B;  1IGD A;  3KUZ A;  1UD7 A;  3WAP A;  3AV8 A;  2M8S A;  3AEG B;  1XCT L;  2W9N A;  4IWP A;  1WXV A;  1K51 A;  1R7S A;  2EMS A;  2Y3A A;  4E71 A;  1M94 A;  2KVZ A;  2UYZ B;  1L0Y B;  2CR5 A;  1STE A;  4EZK A;  1N61 A;  2WDV B;  2NBV B;  2KJH B;  2WX0 A;  3AEF B;  4RF1 A;  3ML9 A;  2AQ3 B;  2DLB A;  1RYJ A;  3AH7 A;  1WGR A;  1N62 A;  5DPR A;  5IOI A;  1FPY A;  2DX5 B;  2QC8 A;  3BY4 B;  2DBY A;  3QX1 A;  1XQQ A;  3WCQ A;  4KKI A;  3RNA C;  4MJS A;  5G55 A;  3UI3 A;  1FXI A;  1TS5 A;  1E0Z A;  2GBJ A;  5AEK B;  4YXD B;  2K3U A;  3ECI A;  3AE3 B;  2KVR A;  1P0R A;  2MWS B;  1D5M C;  4PS3 A;  1KLG D;  1L6V A;  3N30 A;  3ZIM A;  2LEK A;  4URK A;  1SIF A;  3H6N A;  4MSM B;  3HM3 A;  2MH7 A;  2MCN B;  2DZM A;  2IGD A;  3N3K B;  3AU5 A;  2WU2 B;  4HWI B;  3V60 A;  1QIL A;  2AL6 A;  3JSV B;  3M3J A;  1H4R A;  3SD5 A;  5D94 A;  1C3T A;  4M00 A;  2PEA A;  1RWS A;  2N0S B;  3C8Y A;  2L3Z A;  4L1B A;  3ABV B;  3BK2 A;  4RGN A;  3R3M A;  4N59 A;  4E74 A;  2WDR B;  1TYG B;  1R4M I;  1KJT A;  1V86 A;  1UBI A;  2BW2 A;  2V4I B;  4GXB A;  2RR9 A;  4WJO A;  1NEN B;  4GDL B;  2XEW A;  3KWL A;  2MP2 B;  4RH6 A;  4I6L B;  3NUH B;  3NY5 A;  2G45 B;  4IKG A;  3ZJT A;  2AWT A;  4ICV A;  4MM3 B;  4CYE A;  2A4Z A;  1RRB A;  4W9F A;  4LCD E;  1QQR A;  1V5T A;  3NVV A;  1OQR A;  3W1S A;  1VLB A;  2IDY A;  4FXC A;  2GB1 A;  2CS4 A;  2EKE C;  2G4D B;  4KGR A;  2JXT A;  4AS1 A;  3H7S A;  4B95 A;  3VDZ A;  4RM9 A;  4OVZ A;  4BZA A;  4EFO A;  2NMQ A;  3CF6 E;  2KKC A;  3QJZ A;  1FNV A;  3P4R B;  2OJW A;  2TSS A;  3I3T B;  4K81 A;  4F8C B;  2XK5 B;  1L0X B;  5BYR A;  3LJ3 A;  3RI7 C;  4IUM B;  3H7P A;  2IO3 B;  1L4D B;  3RMK C;  2KLG A;  2ZW0 A;  2AQ1 B;  4FN2 A;  1EF1 A;  2UU7 A;  1M4V A;  4KGT A;  1T0S C;  2NBW B;  1IGC A;  1TS3 A;  2WP9 B;  5E6J A;  1XXG A;  2J52 A;  4K7S A;  3ZRF A;  3N32 A;  4M8N A;  3IT6 B;  2BVC A;  1T6B X;  3WIM A;  1QF6 A;  3VH3 B;  3TIX A;  2AX5 A;  2LAS A;  2C60 A;  3ZRC A;  3HHM A;  2JY6 A;  1Z2M A;  1XCQ L;  3HUI A;  1KLU D;  2KOX A;  4XC2 A;  2DAF A;  3TSS A;  4ANX A;  1HXY D;  1WR1 A;  1WWT A;  4OVV A;  1FRD A;  4PYU A;  2Y5C A;  4KIK A;  4ASW C;  2KQ4 X;  1XLO A;  4DHZ B;  2LVP A;  2WWZ A;  3GP7 A;  2WXM A;  1JQ4 A;  5L83 A;  2J42 A;  2JYT A;  1XT9 B;  4A3O A;  4ICU A;  3W1Y A;  2E6X A;  1SJE D;  4W9L A;  2M0X A;  2AQ2 B;  2NS5 A;  4W9G A;  2KT7 A;  2NTS A;  2BB6 A;  3PS6 A;  2JT4 B;  1GB1 A;  3AB5 A;  2MHJ A;  2KYW A;  3FIL B;  1P9D U;  3A4R A;  5TSS A;  1D6E C;  2LGS A;  3HVD A;  3I63 C;  4M0W A;  4OZB A;  4NQK E;  2D3C A;  2N7J A;  2V3N A;  3B0A A;  1HEZ E;  1XLP A;  2DZI A;  1OFF A;  5IKC M;  2MBB B;  2UWQ A;  3M62 B;  3VHT C;  2YEP B;  1N5W A;  2BS3 B;  2BYV E;  3AM9 A;  4ZRJ A;  2MBE A;  3HIZ A;  4LDT B;  5G2N A;  2IGG A;  4ZDV A;  3CSF A;  3OG5 A;  3WA0 A;  3ZNZ B;  4HEA 1;  4KV2 A;  5LLI A;  4MAC A;  2DYM A;  2WXL A;  4F1S A;  2V0G A;  2B76 B;  1XLN A;  3KYD D;  3ZYY X;  1OEY A;  3Q3O C;  1YNT E;  3ZDM C;  2KAC A;  5BO4 B;  1ZDV A;  4BOS C;  1ZPS A;  3DBS A;  1PGB A;  1S1Q B;  2I1J A;  3C19 A;  1YX6 B;  3T9L A;  3M63 B;  1T5X D;  1SE2 A;  4LJP B;  4XWT A;  1QOG A;  2ZCB A;  3L4P A;  4AWJ A;  3HRD D;  4J6I A;  5JH5 C;  4BBN F;  2IPK D;  4TSS A;  2W3S A;  3WAM A;  1YD8 U;  2XBB C;  2MQJ A;  2JVC A;  1GPX A;  3SR6 A;  3Q3J A;  4KGS A;  1C4C A;  2O6V A;  2I38 A;  1KM7 A;  4CHK A;  4NAW A;  5FK9 C;  4C4V A;  2W82 A;  3U2S C;  2MBO A;  3PTF C;  5TR5 A;  4YT0 B;  1D5X C;  2BGF A;  2LD9 A;  3AN1 A;  2WDT B;  1P98 A;  3PHW B;  2KN4 A;  3IFW B;  1I4X A;  3UQA A;  2OJR A;  5HG2 A;  4N9F 4;  4YTN B;  1Z5S B;  2KFJ A;  4ZHP A;  3E9S A;  2KFK A;  3V61 A;  3ZXR A;  4AJW A;  3DHI C;  3R2T A;  3ZNG C;  1SJH D;  2K39 A;  1Y8R C;  1R4N B;  3QC8 B;  4W9K A;  1AYF A;  1V97 A;  3EFU A;  3Q8F A;  4WJN A;  4US8 A;  4HRS A;  2DZJ A;  3DBH B;  3WAN A;  2Z0E B;  4N58 A;  3Q8B A;  4LK0 M;  4L23 A;  3OJ4 B;  1VRA B;  3VAW A;  1TKG A;  4FJY A;  3BWU D;  2K25 A;  4HPM B;  3U7D A;  3VFK A;  1MFW A;  3JYU A;  2SEB D;  2ZPY A;  1K50 A;  1G6J A;  5H8Y E;  2RDB C;  3PO0 A;  2KLC A;  2KMC A;  1QOF A;  2C9W B;  2MA9 B;  2LGD A;  4LNI A;  2O2V B;  3B2G A;  2M19 A;  3W1S C;  1MJD A;  2RPQ A;  4GN1 A;  3AEB B;  2FCS A;  2MSE D;  2LWP A;  4DHJ B;  1F77 A;  2G9H D;  2RGF A;  2K6Q A;  3AE7 B;  3L0W B;  3A1Q A;  4S17 A;  2IO1 B;  3NS1 A;  3X23 A;  1RAX A;  1FNU A;  2L8J A;  4MGY E;  3MJ5 A;  4C7Z A;  2ZPN A;  3ZLZ A;  4MSQ B;  3ZDT A;  4DXF A;  2KZR A;  2FNJ B;  3MC8 A;  2JXX A;  3JVZ X;  4P16 A;  1NBF C;  1PYW D;  1FM0 D;  4C80 A;  3APF A;  3MHS D;  5BMI A;  1SF0 A;  4IG7 B;  3UQB A;  5HFY A;  2NR2 A;  2C7H A;  2LJ5 A;  5E6N A;  3L10 B;  4NAM A;  4CQN A;  2C7M B;  2MLB A;  4EKU A;  3TUO A;  3DVG Y;  3R7R A;  3TJP A;  5D7G A;  4D2K A;  1ZXH A;  2LHE A;  4IM2 A;  3I9V 1;  4ZYS A;  3PRE A;  1JML A;  4WQM A;  2M4N A;  1IBX B;  3HVZ A;  5FKA C;  2J0K A;  4W9J A;  1WR6 E;  4R3D A;  3RNC C;  5CHF A;  2M1M A;  4RCO A;  4MGK E;  1XO3 A;  3SEB A;  3B08 A;  1CQV A;  2L7R A;  4IWO A;  2LRU A;  5JZE B;  1ZOY B;  1HTQ A;  5HKH A;  1KF6 B;  4JWU C;  2CKH B;  2N9K A;  3DWM A;  2L0F A;  1QZE A;  2N1W A;  5C2T B;  4A55 A;  1C76 A;  2LUE A;  3VRB B;  1E6E B;  1WGY A;  3AE5 B;  2KTF A;  4IDI A;  3N1Y C;  1RM6 C;  2QCZ A;  2D3B A;  3H1U A;  4K3B A;  4MEM A;  1FIQ A;  4FA6 A;  4ZHO A; 
#chains in the Genus database with same CATH homology
 2GBM A;  3PPA A;  2LVQ A;  2NBU A;  4AUQ C;  2JUO A;  2HJ8 A;  2QHO A;  3SDL C;  3R3M A;  2ZNV C;  5IAA C;  5EDS A;  3PLV A;  3WAL A;  4E74 A;  2ZNV B;  3KUD B;  3PT2 B;  1R4M I;  1KJT A;  1V86 A;  1UBI A;  1X1M A;  3RCZ A;  2Y5B B;  4GXB A;  1WM3 A;  2RR9 A;  4WJO A;  3IG3 A;  1UEL A;  4GDL B;  4BKS D;  2XEW A;  3VQI A;  1WGH A;  1WJN A;  1PQS A;  2BKF A;  1LXD A;  3VTV A;  3UIN B;  5J18 A;  2HE7 A;  2MP2 B;  1J19 A;  3DVG X;  1IP9 A;  2NVU I;  1RLF A;  2G4S A;  2N4F A;  4I6L B;  3NY5 A;  3U8Z A;  2G45 B;  1P1A A;  4G11 A;  3L16 A;  2AWT A;  4FUL A;  4ICV A;  4CYE A;  2A4Z A;  4A3P A;  1OTR B;  5DCN A;  1EF5 A;  4FLH A;  1RRB A;  4W9F A;  1RFA A;  2PE6 B;  4HDQ A;  4LCD E;  2PPH A;  2O2V A;  1NDD A;  4MGI E;  3ZUN A;  2KTR B;  1V5T A;  1WRD B;  1WMH A;  1K8R B;  4AP4 C;  3W1S A;  3QAQ A;  3P2B A;  2Z0D B;  1YIW A;  1ZGU B;  2CS4 A;  1WI0 A;  4GSW A;  5DPW A;  2EKE C;  1JRU A;  2G4D B;  3ML8 A;  2FIF A;  4FAD A;  3OLM D;  4W9E A;  1SGH A;  3DCG A;  1XD3 B;  3H7S A;  4B95 A;  3DVN V;  3VDZ A;  1ZW7 A;  4RM9 A;  4CO7 A;  4NAW B;  4F7Z A;  4EFO A;  2PJH A;  1WE7 A;  4FHK A;  3CF6 E;  4JGH B;  2KKC A;  3QJZ A;  3A9K A;  3O65 B;  2DYO A;  4WWO A;  5FR6 A;  3VTW A;  2PE9 A;  3I3T B;  1P3Q U;  2KJ6 A;  4K81 A;  3TBL D;  2ZZP B;  2BWF A;  3NHE B;  3DPD A;  4F8C B;  2XK5 B;  5LXH A;  4EEW A;  1GG3 A;  1WYW B;  1WJU A;  3LJ3 A;  3V62 A;  4IUM B;  4ANW A;  3H7P A;  2IO3 B;  1UH6 A;  1OEY J;  2EMT A;  3Q3F A;  2KLG A;  5DPS A;  4AOF A;  2KFK B;  4FN2 A;  4XZ4 A;  1EF1 A;  3SU8 X;  1TZ1 A;  3HM6 X;  2NBW B;  1U4A A;  2KDF B;  3DOW A;  2YVC A;  1UBQ A;  3IHP C;  4BVU C;  2LGX A;  4ZRK A;  4LDT D;  3OAW A;  2KDE B;  4DWF A;  2K6D B;  4K7S A;  1EUV B;  4OVU A;  3ZO5 B;  3ZRF A;  3APD A;  2R2O A;  1V2Y A;  3PRM B;  2K8B A;  3N32 A;  4M8N A;  2KWV B;  3IVF A;  5AZH A;  1Q1O A;  2R2Q A;  3DVN U;  3WIM A;  3KW5 B;  3KH0 A;  3VH3 B;  4MEL A;  1IYF A;  3TIX A;  5KHO A;  3HK0 A;  4WJQ A;  4PS8 A;  2LAS A;  1WF9 A;  2C60 A;  3ZRC A;  3HHM A;  2JY6 A;  1MG8 A;  4HVB A;  1Z2M A;  5IA7 A;  2KK8 A;  3QWZ B;  3SHQ A;  4IC7 B;  1NI2 A;  4TKN A;  4IW0 A;  3RD2 A;  5D2M B;  2KD0 A;  2KN5 A;  2KOX A;  4XC2 A;  2DAF A;  4ANX A;  4HCP B;  1WR1 A;  4MH0 E;  4DXA B;  3PSE B;  2AYO B;  4PYZ A;  3X0W A;  3NZU A;  2GMI C;  4OVV A;  1V49 A;  3ZTC A;  4PYU A;  1ZKH A;  2BWE S;  3QAR A;  1V5O A;  4KIK A;  4WWP A;  4ASW C;  4DK5 A;  1WZ0 A;  1L7Y A;  4DHZ B;  1VCB A;  2KC1 A;  2LVP A;  2WWZ A;  5C1Z A;  2ZEQ A;  5L83 A;  1XT9 B;  4W9H A;  4A3O A;  1WX8 A;  3H9D A;  4B6W A;  4ICU A;  4X57 B;  3W1Y A;  3ONS A;  3K9O B;  2FUH B;  4E3C A;  4W9L A;  2M0X A;  2KMA A;  4W9G A;  2CU1 A;  2NS5 A;  2NPT B;  2KAN A;  3EHV A;  2GBK A;  1WM2 A;  2KC2 A;  4JQW C;  3EC8 A;  3DBL I;  3VTU A;  3PS6 A;  2JT4 B;  2ZJD A;  5JHA A;  1H8C A;  2M17 A;  2DAJ A;  3BIN A;  2JZZ A;  3KUC B;  3A1Q B;  1P9D U;  3A4R A;  1E5W A;  1D3Z A;  1WJ4 A;  4NQK E;  3A9J B;  4PS7 A;  1KOT A;  2BYE A;  3ZTD A;  3B0A A;  1WJ6 A;  3KYC D;  2IBI B;  2KX3 A;  2DZI A;  1C1Y B;  1YX5 B;  2D10 A;  3UGB B;  3QA8 A;  2N9X A;  2IY0 B;  1UGM A;  2MBB B;  2UWQ A;  1TGZ B;  3M62 B;  3C0R B;  3VHT C;  2KWU B;  3A4S C;  2KDI A;  3DQV A;  2FCQ A;  2GBR A;  2KJR A;  3DDC B;  2BYV E;  2D3G A;  4ZRJ A;  2MBE A;  2L76 A;  3HIZ A;  3QCA A;  4LDT B;  5G2N A;  1TTN A;  3MTN B;  4KVG B;  3RT3 B;  3UIP B;  3VUX A;  3VVW B;  4ZDV A;  4GDL A;  3CSF A;  3WA0 A;  3ZNZ B;  2MBH A;  2WX1 A;  4KV2 A;  1Q0W B;  4NJ7 A;  5LLI A;  3VXW A;  1GNU A;  1GUA B;  2MP2 A;  1V6E A;  2DYM A;  2G3Q B;  4FJZ A;  3A9K B;  5E6O A;  4F1S A;  1J8C A;  4IM0 A;  3DBR I;  3KYD D;  1WY8 A;  4K7W A;  1OEY A;  3AI5 A;  1J0G A;  4LJO B;  4MM3 A;  3ZDM C;  5BO4 B;  2BKR B;  1WX7 A;  4BOS C;  3DBS A;  4BBN C;  4G50 A;  2CHZ A;  4TV3 A;  1S1Q B;  2I1J A;  2IO0 B;  4TQ0 A;  4TUU A;  4IM3 A;  1YX6 B;  5D6J B;  3T9L A;  3M63 B;  1WXM A;  3LDZ E;  4I6P A;  4TQ1 A;  4DDI D;  1LM8 B;  1TBE A;  4LJP B;  3PVL A;  4M8M A;  1V81 A;  2ZCB A;  1E8Z A;  2KQ7 A;  4G0N B;  2A5U A;  3A33 B;  4KDI C;  3OJ3 A;  2N9P C;  3NS8 A;  5E6P A;  4KZ0 A;  4AWJ A;  3QIJ A;  4J6I A;  1GC7 A;  5JH5 C;  4BBN F;  4HK2 A;  4K1R B;  4MJS B;  1OGW A;  3WAM A;  2VRR B;  1YD8 U;  2XBB C;  2MQJ A;  4KZC A;  1E7V A;  2JVC A;  2GOW A;  2KHW B;  2V4L A;  2FCN A;  4NY0 A;  1WIA A;  3UF8 A;  3Q3J A;  4HPL B;  3R7Q A;  4DHJ D;  3PLU A;  3ZW3 A;  3ENE A;  4W9C A;  3RUI B;  2ASQ A;  4ZRI A;  2O6V A;  3CMM B;  1KM7 A;  1AAR A;  2DHZ A;  2RSU A;  4NAW A;  4CHK A;  3PGE A;  3GZN I;  2KXJ A;  2OOB B;  5C23 A;  2MBO A;  3PTF C;  5TR5 A;  2JZ3 B;  3AU4 A;  2BGF A;  2LD9 A;  2D2Q A;  1F9J A;  1R4N I;  2WDT B;  2RD0 A;  4FHJ A;  2XK5 A;  1P98 A;  3PHW B;  5DPT A;  3IFW B;  5AZG A;  3UQA A;  2OJR A;  3JW0 X;  3PZD A;  4N9F 4;  3RUL A;  4BFR A;  1Z5S B;  2DZK A;  4HDO A;  2KFJ A;  3KVF B;  3AXC A;  2KNB A;  2N7E A;  2CHX A;  2LXA A;  3DBH I;  5JHB A;  2KFK A;  2MX2 A;  3V61 A;  4FJV B;  4AJW A;  4ZYN A;  4ANU A;  2Z59 B;  2V3S A;  2NCN A;  3RYT A;  3ZNG C;  2K39 A;  3MJW A;  1Y8R C;  1E7U A;  3QC8 B;  4JIO U;  4WAA A;  2C5L C;  5GMV A;  4W9K A;  4EUT A;  1UZX B;  3ZNI D;  2KDB A;  4EZJ A;  4GDK B;  2L05 A;  2AL3 A;  3EFU A;  2HD5 B;  4WJN A;  2O6V D;  2DZJ A;  4YL8 A;  5CHV C;  3WAN A;  2J0J A;  3PRZ A;  2Z0E B;  1CMX B;  2IZV B;  2HTH A;  3OJ4 B;  1OQY A;  3NOB A;  4HJK A;  3VAW A;  4FJY A;  1YQB A;  2K25 A;  4HPM B;  2D11 A;  2BF8 B;  1S3S G;  4G3X B;  3RZW C;  4EOY A;  4DDG D;  3NZS A;  4MGZ E;  3TCA A;  2K8H A;  3U7D A;  2KX0 A;  3VFK A;  3TL5 A;  3JYU A;  3VH4 B;  2JRI B;  1IPG A;  2BYF A;  2N1V A;  4GU2 A;  5L95 C;  3CST A;  1LQB A;  2ZPY A;  2WYQ A;  2J7Q B;  2V1Y A;  1G6J A;  3JSV A;  3ZVV A;  1GJZ A;  4HXD A;  3AUL A;  4KDL B;  2KLC A;  2KMC A;  5CTR C;  2ZVO A;  4EZL A;  1BT0 A;  2CHW A;  2I1K A;  2C9W B;  2MA9 B;  2LGD A;  2K1F A;  1V80 A;  2LRW A;  1WGG A;  2O2V B;  2LI5 A;  2JRH A;  2L0T A;  3PV1 A;  3W1S C;  3T8M A;  2REX A;  1WMH B;  2C7N B;  2RPQ A;  1Q5W B;  3PHX B;  4DBG A;  4GN1 A;  2FID A;  5CX3 A;  3EEC A;  3RZF A;  2FCS A;  2MSE D;  3L54 A;  4BOZ B;  2LWP A;  4DHJ B;  4BKG A;  4MDK E;  4XX5 A;  2N9E B;  4GIV A;  2NPT A;  2RGF A;  2LXC A;  2KO3 A;  1WH3 A;  2K6Q A;  4WQO B;  3L0W B;  1ISN A;  4HLE A;  3K9P B;  4JL9 A;  2K8C A;  2LZ6 A;  4DHZ E;  2KQS A;  2IO2 B;  4A20 A;  3A1Q A;  3TMP B;  2ZVN A;  4II2 B;  2IO1 B;  3X23 A;  3A9J A;  3GOE A;  3IBE A;  4KSK C;  4W9D A;  5CHW A;  1A5R A;  1RAX A;  3V6E B;  2L8J A;  4MGY E;  1WX9 A;  4AJY B;  1I35 A;  3UIO B;  3L17 A;  2ZPN A;  2MBQ A;  3KUZ A;  4JLC A;  1UD7 A;  3WAP A;  3ZLZ A;  2JF5 A;  3H7P B;  4MSQ B;  3WAO A;  3ZDT A;  5LXI B;  2M8S A;  2KZR A;  3VUY A;  2L00 B;  2KTR A;  2FNJ B;  2W9N A;  1GC6 A;  2GBN A;  2JXX A;  3JVZ X;  3M95 A;  1NBF C;  4IWP A;  3APC A;  1SE9 A;  1E8X A;  1WXV A;  1YJ1 A;  2B3A A;  1WE6 A;  1WGD A;  2D07 B;  3APF A;  3MHS D;  1I42 A;  1EO6 A;  2EMS A;  2O6V B;  4E71 A;  4IG7 B;  1M94 A;  2MW5 A;  2UYZ B;  4RMA A;  3UQB A;  4GGQ A;  2NR2 A;  2C7H A;  2LJ5 A;  4GB9 A;  2CR5 A;  2J0M A;  3B1L X;  1FXT B;  1WZ3 A;  2ZCC A;  3L10 B;  5E6N A;  4EZK A;  2C7M B;  2FCM A;  2MLB A;  4EKU A;  3U30 A;  3DVG Y;  2NBV B;  3R7R A;  3TJP A;  5D7G A;  2KJH B;  2WX0 A;  2YLM A;  2AEH A;  4IM2 A;  3ML9 A;  4I6N B;  3S2A A;  4GMV A;  4HCN B;  3PRE A;  1WGR A;  1WFY A;  3VUW A;  1WXS A;  2DEN B;  5DPR A;  2JWZ A;  2M4N A;  2DX5 B;  2DYB A;  4ANV A;  1T0Y A;  4NNJ B;  2J0K A;  4W9J A;  4B9K A;  3BY4 B;  3QX1 A;  1XQQ A;  2FAZ A;  1WR6 E;  2LVO A;  3L13 A;  3QQ8 B;  4BKT A;  4P7I A;  4MJS A;  5G55 A;  5CHF A;  2M1M A;  1LFD A;  2N7D A;  4MGK E;  2LGY A;  2JPH A;  2GBJ A;  5AEK B;  3B08 A;  2L7R A;  4IWO A;  1V9J A;  4KIK B;  1HE8 A;  2LRU A;  5JZE B;  3ECI A;  3L08 A;  2KVR A;  1P0R A;  3PRP B;  3D32 A;  2MWS B;  1E8Y A;  3ZKJ C;  3QHT A;  4PS3 A;  5HKH A;  5KHQ A;  1L2N A;  3ZIM A;  3ALB A;  3N30 A;  5J2R A;  4KSL C;  2CKH B;  2L0F A;  1QZE A;  4URK A;  4WJP A;  1KLV A;  1SIF A;  2N1W A;  1E8W A;  3H6N A;  4NJ6 A;  4GOC A;  1WXA A;  4MSM B;  4FBJ B;  5J17 A;  3HM3 A;  1VD2 A;  4BKS A;  4IWQ A;  2KWC A;  2DZM A;  2LUE A;  3N3K B;  4NQL B;  3AU5 A;  2MCN B;  4W9I A;  4K7U A;  1E90 A;  3QK0 A;  4HWI B;  4II3 B;  3V60 A;  1WGY A;  2IY1 B;  2AL6 A;  2KTF A;  2BPS A;  3JSV B;  1H4R A;  3M3J A;  3SD5 A;  5D94 A;  3R66 C;  1C3T A;  2PEA A;  4NPN A;  3V6C B;  3H1U A;  4M0W B;  4MEM A;  2L3Z A;  3ZNH B;  4FA6 A;  4RM8 A;  4GDK A;  4WWN A;  5AZF A;  2IYD B;  2MRP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...