1GAQB

Crystal structure of the complex between ferredoxin and ferredoxin-nadp+ reductase
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
98
structure length
98
Chain Sequence
ATYNVKLITPEGEVELQVPDDVYILDQAEEDGIDLPYSCRAGSCSSCAGKVVSGSVDQSDQSYLDDGQIADGWVLTCHAYPTSDVVIETHKEEELTGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERREDOXIN-NADP+ REDUCTASE
publication title Structure of the electron transfer complex between ferredoxin and ferredoxin-NADP(+) reductase.
pubmed doi rcsb
source organism Zea mays
molecule tags Oxidoreductase/electron transport
total genus 10
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2000-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1gaqB00
3AECB 3VR8B 1GAQB 2L83A 1NYRA 1YQ3B 5EE1A 1GPXA 1WYGA 1JWAD 1NVID 1FXIA 2G1EA 2JQRB 2WP9B 2L52A 3NVVA 4N6EB 1R7SA 2BS3B 3AE7B 1N60A 1RM6C 2PVGC 4ITKA 1FXAA 3ETRA 3AE2B 1FRRA 1WGKA 1RWSA 3HVZA 2OHFA 3AB5A 1ZXIA 1ZOYB 1YJIA 1KRHA 5EE9A 1NEKB 2PKOA 3AN1A 1FFVA 3AEFB 5H92C 2LEKA 3FAHA 1TKGA 1WRIA 1PDXA 2PIAA 2E3TA 2JX5A 1L5PA 2BT6A 3HUIA 3P4PB 1IUEA 3SR6A 1XLPA 3VRAB 3ABVB 3AE1B 3AH7A 3B2FA 1SB3C 1L6VA 3DWGC 3DWMA 3P1MA 4YSYB 4YTNB 1QOBA 1SF0A 1J7CA 5C3JB 2FBWB 1EWYC 3NVZA 4HROA 3P4QB 5EE0A 1CJEA 4P6VF 2WDQB 1KFYB 2BS4B 1JALA 4ZOHC 2QIEB 3PO0A 4ZHOA 3AEGB 4N59A 1DOXA 2WDRB 3NRZA 1QLBB 2M19A 3AM9A 1PUTA 1TJEA 5GXGB 1OFFA 3SFEB 3VRBB 3AEDB 3NS1A 1DOYA 1XLOA 3WCQA 1CZPA 2Y5CA 2WDVB 3AE9B 1I7HA 1OQQA 2H88B 3ZYYX 1QOAA 1E6EB 2WU2B 4KX6B 5AUKA 5G5HA 1J7AA 3NVWA 3VR9B 1DOIA 4US9A 3AE5B 2B76B 3AEBB 4JWUC 4A9AA 1E10A 1L6UA 2W3SA 3SFDB 2MJEA 1AWDA 4FXCA 1AYFA 5H8YE 1ZP0B 1FO4A 3AV8A 3P4SB 1RFKA 4WWMA 4IDIA 1ZUD2 1XLNA 1N61A 5EE3A 5C2TB 3W5VB 2CJOA 1QF6A 1E9MA 1JWBD 2Q5WD 1N5XA 2WQYB 3B9JA 1ROEA 1J7BA 2K9XA 3L4PA 4N58A 4C7YA 1F0ZA 4ZHPA 3AEEB 1NYQA 4LTUA 3AE8B 4YTPB 3AE4B 4JWSC 4YSXB 1TKEA 2W54A 1JROA 1JQ4A 1YQ4B 3P4RB 1NENB 1FMAD 1JW9D 1YJJA 2KMMA 1N63A 1DGJA 1V97A 3W9CB 4C80A 3BIID 3P63A 2H89B 1E0ZA 1SIJA 3EUB2 4JX1C 1VLBA 2ACZB 2WLBA 3AEAB 4US8A 2CJNA 3HRDD 4YT0B 5AUIA 1QOFA 1TYGB 1UWMA 2HTME 1L0VB 1N62A 4HRSA 1T3QA 4WQMA 1PFDA 2DWQA 5MPOA 1A70A 1FFUA 1B9RA 1XO3A 3AE3B 4C7ZA 2QJLA 3CWIA 1WWTA 1KF6B 1QOGA 2WS3B 1NI3A 2DBYA 1OQRA 2EKIA 2K5PA 1FIQA 3KWLA 1QT9A 2N0SB 3CIRB 4USAA 2MJDA 2PVOD 2WU5B 3B2GA 3RPFC 2KAJA 1E7PB 1FRDA 3W5UB 2BS2B 3NVYA 2M56B 1XLQA 2MH7A 2W3RA 1N5WA 4YSZB 2MJ3A 1JRPA 3AMZA 1FM0D 1V8CA 1RYJA 2W55A 4YXDB 1VJKA 1WXQA 3AE6B 1TKYA 3FC4A 1VDVA 2K22A 5G5GA 4YTMB 2AX5A 3LXFA 3LB8C 2CU3A
chains in the Genus database with same CATH superfamily
4NJCA 3MJWA 5DPWA 2Z0EB 1EO6A 3JSVB 2DZMA 3NVVA 3VHTC 1SE3A 1C4CA 1V1PA 2PVGC 1V2YA 1IPGA 5AZFA 2CHWA 1I4XA 1FRRA 4IM0A 2GB1A 4DQOC 4DWFA 2IO2B 4XDDA 4KVGB 3ZXVA 4BKGA 2JYTA 4WURA 3ONSA 3L13A 1LO5D 4O1NA 1K51A 4ZOHC 2ASQA 3QAQA 4GMVA 5BO4B 2WXRA 3SDLC 2PLPA 2L0FA 2KQ4X 2G4DB 2ZCBA 3ZYYX 4HPPA 4L2YA 2L3ZA 2LRWA 2LVPA 3ZNHB 1Q10A 4ARIA 1K50A 4AJYB 2M1MA 2QC8A 1YOVB 3GP7A 3U2SC 4AQ7A 1YX5B 3P42A 2LD9A 4OHJA 3Q14C 4KKIA 3PS6A 3A4RA 4TUUA 4BKSA 2KVRA 5AUIA 2R61A 4OZCA 3ALBA 1PQSA 3L08A 2WNMA 1SJED 2OEDA 1FIQA 2RD0A 1OGWA 3EFUA 3B2GA 4RGOS 4W9JA 1JRPA 3FC4A 4WJQA 3LB8C 2CU3A 3LDZE 3AI5A 3LYYA 1UZXB 4ASWC 3ZIMA 2KJHB 1R4MB 3QWZB 3Q69A 1N60A 3DDCB 3EGRA 3IG3A 2BKRB 3NS8A 1ZOYB 3DBRB 2LEKA 1PDXA 1FXTB 3HUIA 2FIFA 4K81A 1OTRB 3QCAA 2MBQA 2UYZB 3NG0A 4IWPA 1WI0A 1PGBA 3PZ8A 4A3OA 2MBHA 3Q6BA 5KHQA 3CSFA 3DVGX 3AM9A 3PHXB 3PSEB 3AEDB 4KZ0A 2KTRA 4XDCA 2KLGA 1SGHA 4KX6B 3SEBA 3PZ7A 2DYMA 1E10A 4AS1A 1WGGA 2O6VA 3SFDB 3DBHI 3QC8B 2G4SA 3W5VB 3GE8C 3EFCA 4CQNA 4M0WB 4IWQA 1WSPA 2BWES 3TEZA 2TSSA 2KMMA 4TSSA 5JHBA 1C4AA 4S0RA 1SE9A 2LHEA 2ZVNA 4WJNA 3T3OA 4ANWA 2INNE 4AP4C 1ISNA 2XN9C 1WR1A 1B9RA 2WXFA 1KF6B 2X8XX 2KTRB 1WXMA 4RNAA 2KN5A 4USAA 2IGDA 2MJDA 1TS2A 4C56C 2ON8A 4HDOA 4I6NB 4WAFA 4HCNB 1V49A 5D6JB 2L00B 3DHHC 2KFKA 2KXJA 1UBQA 3RD2A 2WXLA 2G45B 5EE9A 2KACA 4P7IA 1J0GA 4CHKA 1I35A 3RI7C 3U52E 3VRAB 4CO7A 4IW0A 1T0QC 4NPNA 5C3JB 2N1VA 1J7CA 3V60A 2WXJA 3ZNID 5LXIB 4N59A 4NAWA 1I4HA 1GG3A 1XLOA 1YD8U 2Y5CA 4KGTA 4GIVA 5AUKA 3Q8AA 4LK0M 2DHZA 2MX2A 4AJWA 4WWOA 2BB5A 2CU1A 1B1ZA 1KH0A 4LLGM 2R2OA 1TY0A 4NJ7A 2KDMA 4C7YA 1E90A 5JH5C 4YTPB 4WQOB 2NPTB 1UELA 1ZKHA 5AZHA 1F77A 1VZ6A 2IO0B 2K8HA 5IKCM 1I42A 1T0RC 2CHXA 1HZ5A 1T3QA 1OQYA 2FAZA 5BYQA 4B0EA 2DWQA 2LGYA 1OEYJ 1YMHE 3CWIA 2LVOA 3ZTDA 2I1KA 5JHAA 4YWGG 4HPMB 2ZW1A 1PYWD 2FCNA 1V8CA 3TEYA 3QX1A 1WXQA 1F9JA 2GBMA 2K22A 3X0WA 2ZCCA 1P9DU 5FR6A 2LASA 1WYGA 3KLSX 3PT2B 1FXIA 4OVZA 1TZ1A 2Y5PA 2AYOB 4WIPA 1UF0A 4LNNA 5H92C 3I5JC 2JVCA 4B6WA 2KWDA 1MG4A 2RDGA 1XD3B 4FJYA 3N1YC 1T0SC 2QSDA 1VZ8A 4M01A 1FNWA 4ZHOA 3KVFB 3ZUNA 2WDRB 4KGSA 3RCZA 1WIAA 1PUTA 2V9HA 1OQQA 4MT5A 2NBUA 5E6OA 2MQJA 4JWUC 4KGRA 2SEBD 1LFDA 1ZP0B 3UQAA 1RFKA 3N32A 5BMGA 5BYRA 3IBEA 2KDFB 4IC7B 3WA0A 1ROEA 2A5UA 1WMHB 3L4PA 4ZRQA 3VTWA 1F0ZA 3RUIB 1ET6A 1JROA 3R2TA 4KKJA 3NHEB 1YJJA 3RULA 5I4DA 4HEA1 1E0ZA 3EUB2 2CR5A 4JX1C 3BY4B 3X23A 4A20A 1M94A 3PVLA 2KZRA 4B95A 3Q8FA 3RT3B 2WS3B 4JQWC 2WU5B 1E7PB 3IT6B 4L1BA 4YSZB 1R4NB 2KDEB 1D6EC 1KLUD 1E7VA 1TKYA 2J0MA 4HPLB 3DOWA 2DX5B 3DBHB 4FADA 3T9LA 2LGSA 2LJ5A 4OZAA 2K6DB 1JCKB 1R7SA 5C1ZA 3IXSA 2ICIA 3BVMA 1E8YA 3OAWA 1KRHA 2VRRB 1NEKB 3EC8A 4EOYA 1P3QU 3Q3FA 1L0YB 4FLHA 1TKGA 2GBKA 1C76A 1P1AA 1Q0WB 1KOTA 2KTFA 3P2BA 4LJOB 1QOBA 1SF0A 1ACCA 3P4QB 4XE0A 4ZRJA 2KNBA 2D3AA 4LDTB 2L1AA 2K8BA 4OVUA 1JWUD 3DVGY 2FCSA 1MFWA 2WDVB 2O2VA 2K0PA 2MLBA 4US9A 4AWJA 1X1MA 3NY5A 1D3ZA 5D7GA 2W3SA 4I6PA 4F8CB 1V80A 1WJNA 1XLNA 5C2TB 1TIFA 3ZTCA 3ZQ4A 1YIWA 2WQYB 5AZGA 4CYEA 4ZHPA 4QAYA 3APFA 5T8IA 2L8JA 1SXTA 4KIKB 4MSMB 4C00A 1WY8A 2WLBA 2ACZB 4OW0A 3H9DA 1E8XA 2LGXA 4HWIB 1QOFA 3M3JA 2C7NB 3R2IA 3RNCC 2YVCA 3OJ3A 5MPOA 2KMCA 2MCNB 1FFUA 1MVKA 4DXFA 2QDFA 2EKIA 2YEPF 3Q3NC 2C5LC 4IUMB 5D3DA 1AW7A 2O2VB 1WX7A 1BXTA 1FM0D 1WGYA 2REXA 4EEWA 4MGZE 2AQ3B 4EZKA 3R7RA 2Z8LA 1WGHA 2JZ3B 2JSVX 1AN8A 3GZNI 2QMTA 4M8NA 1RM6C 4DBGA 2JU6X 3OLMD 2D10A 3AB5A 1I4RA 2EMTA 2KT7A 3PRZA 3H6NA 4II3B 3R7QA 2PIAA 2MW5A 1PGXA 5FKAC 3D32A 3DWGC 2WX0A 2ZNVB 1NBFC 1UH6A 2LZ6A 2FCMA 4MH0E 1IBXA 3I9V1 4XWWA 3MHSD 2L0TA 3ZDTA 3ZVVA 5IOIA 4MSQB 3B08A 2RMMA 4PS3A 4NQKE 2N7DA 2JPHA 2ZPYA 3HVDA 1CK1A 2E6XA 5CX3A 2MJEA 2DYOA 2DYBA 2GBRA 2ZZPB 1KJTA 1QF6A 1I4GA 2N4FA 5BMHA 1ZE3D 1ZGUB 2LUEA 2LXAA 2NVUI 5CHVC 5E6JA 4ARCA 3APCA 3TUOA 1QQRA 3OG5A 1UNSA 1IBXB 2UWQA 2OJRA 2KJ6A 2QCZA 4FA6A 3APDA 2M17A 1V1PB 2MBBB 1FCLA 2WDTB 3W1YA 1TS4A 4W9KA 4RF0A 3CIRB 1E8WA 1MHHE 2MP2A 1F52A 1UGMA 1T0YA 4HXDA 4LTUA 3VR8B 1GAQB 2NTTA 4GSWA 1KTKA 1YQ3B 1LXDA 2XBBC 2JRIB 2IGGA 3C8YA 1GUAB 5IO9A 3ETRA 3VUXA 4PT5A 2KX0A 2PMVA 4GU2A 4G11A 2K1FA 1RFAA 1VCBA 1WRIA 2K8CA 2LJIA 4LJPB 2NTSA 2E3TA 4W9IA 1WYWB 1IP9A 3AH7A 2XNAC 3PV1A 2L76A 2QHOA 5EE0A 1CJEA 1TGZB 1Q5WB 3PO0A 3C19A 2MP2B 3A9JA 5HG2A 3VRBB 3MTNB 4D2KA 1WX9A 1WFYA 4HLEA 2AWTA 1E6EB 1WGDA 4W9FA 2B3AA 3UIOB 5EE3A 1XXGA 2K9XA 4N58A 4GLSC 1WE6A 3AE8B 4RM8A 4KV2A 4ZYNA 1JQ4A 5JXVA 1RAXA 5BMIA 1FMAD 1JW9D 3VUWA 2H89B 4FN2A 2MRPA 1GC7A 3N20C 4K3CA 2N9PC 1C1YB 2BYEA 2MHJA 3N30A 3A9JB 1NI3A 4WJOA 1WXVA 4ANXA 3TSSA 4AOFA 4NZLB 1FPYA 3N9YC 5G5GA 1GOZA 1EU3A 1GNUA 4TKNA 2I38A 2WP9B 3TL5A 2L52A 2HE7A 4RFBA 2KDIA 4BOZB 3MP9A 1UD7A 4BZAA 3L54A 4J3OD 3K9OB 2J7QB 3M63B 3PRMB 2VZKB 3R3MA 3BWUD 3ML8A 3OJ4B 2O6VB 1XLPA 4I6LB 3DWMA 1L6VA 4H2AA 3RFZB 1WJ6A 3GOEA 2FBWB 1WM2A 4FHJA 1XT9B 4BVUC 2C7MB 3W1SC 1KLVA 2D2QA 1STEA 3IHPC 3SFEB 3VDZA 3MJ5A 1K52A 2KDBA 4ZYSA 4BKSD 5J18A 4A9AA 5LLIA 3GZNB 1FO4A 4DHZB 3VQIA 1YN3A 4A6QA 2BTEA 3HM3A 4NNJB 3AE4B 4YSXB 3RZFA 2EMSA 5TR5A 2I2YA 4DHJB 2JXXA 2C60A 2WYQA 3BIID 2V3NA 3I57A 1FNUA 1EF1A 2KFJA 3Q3MC 2LGIA 4HVBA 3GE3C 2JRHA 4YT0B 3AU5A 2IGHA 3ZNZB 2WXOA 3HIZA 1L0VB 3U8ZA 4ACFA 4GDKA 4DDID 2KFKB 1NI2A 4HKQA 2QJLA 4MGYE 1FEHA 3ZW3A 3O13A 4ANVA 3KH0A 1QT9A 4GGQA 5J2RA 2GOWA 3EECA 2GBJA 2PPHA 4W9CA 2FE8A 1MHXA 2JUOA 2WGSA 1VJKA 3AE6B 1IGCA 1L4DB 1RLFA 2WXNA 2L83A 3DBSA 3KYDD 5JZEB 1JWAD 2R2QA 3E9SA 1NVID 2GLSA 1TT5B 1TY2A 1TS5A 2WXPA 1FXAA 3IFWB 4NAWB 4ICVA 1MI0A 3KUDB 3AN1A 2CS4A 3ECIA 1U4AA 4DK5A 2WXQA 2J42A 5J17A 1QILA 1L5PA 2IDYA 5D94A 2RGFA 3ZNGC 2O6VD 3P1MA 1ZDVA 1EF5A 2IYDB 3QARA 4YSYB 5KHOA 2KJRA 2IPKD 2KD0A 1YJ1A 3H1UA 2ZVOA 3W2DA 4BBNC 3UI3A 3QIJA 2IBIB 4K7SA 1DOXA 4G50A 1TJEA 3M95A 2LXCA 1VD2A 4JPSA 1ZXHA 1CZPA 2V3SA 4PYZA 5G5HA 3AE5B 3CF6E 1FNVA 4MJSA 3BK1A 2BBCA 1P98A 3P4SB 3NZSA 1ZUD2 3KW5B 3JVZX 4IKGA 4RMAA 1WJUA 1ZDXA 3NOBA 4MACA 4WWPA 4JWSC 2ZJDA 4XX5A 4K1RB 4DHJD 1YQ4B 4EZLA 4NJ6A 1DGJA 2JF5A 3U7DA 1JRUA 3WALA 4B9KA 3A1QA 4US8A 3HRDD 2EKEC 4G3XB 4RM9A 2INCC 4IG7B 1V9JA 1QOGA 3ZRCA 3RNAC 1SE4A 2RR9A 3A9KA 1FRDA 2M56B 1T6BX 3KUCB 3AMZA 1RYJA 3B1LX 3BVZA 2ZEQA 3Q8CA 4P16A 2DZKA 4MJSB 3KWVA 5EE1A 1E8ZA 2N1WA 2GRIA 1WH3A 1FCCC 1H8CA 5LNK1 1VZ7A 4F7ZA 1JWMD 3VTUA 2Z0DB 2OHFA 4PYUA 1L7YA 2J0JA 1I4PA 4TQ1A 4WH4A 2D3GA 1WM3A 3SR6A 4MEMA 3ABVB 1SSNA 3AE1B 3B2FA 3VFKA 4BBNF 1EWYC 3T3NA 4P6VF 2DENB 2WDQB 2JXTA 2AL3A 2QIEB 3KYCD 4XC2A 1R4MI 4TV3A 2M19A 3A9KB 1UBIA 2IO3B 3BVGA 3E56A 3MC9A 1ZW7A 3AE9B 2RPVA 4RF1A 3NVWA 3JW0X 2LGDA 1TBEA 1YQBA 4M02A 1L6UA 2D07B 2DZIA 1ENFA 1SE2A 1ZPSA 2DAJA 3EA6A 1E9MA 1JWBD 2GI9A 2AQ1B 3L17A 3RMKC 3URYA 3P63A 1WJ4A 1FD6A 2YEPB 4XGAB 3L0WB 1YN4A 4N9F4 4ZRPA 1A70A 3HM6X 1V5TA 1MG8A 1D5XC 1M4VA 3QJZA 1OQRA 2K25A 1Y56A 3RPFC 2FCQA 3QA8A 4BFRA 2LRUA 3NVYA 2Y3AA 2RPQA 3M62B 2AX5A 4ZRKA 2VH1A 4A3PA 2OJWA 3JYUA 4ICUA 2JYEA 4PS8A 1CQVA 2BYFA 4YL8A 3ZRFA 5IN7A 3UF8A 3U7ZA 1TZOA 2W9NA 1C4PA 2ZNVC 3AEFB 2KVZA 2A4ZA 4FBJB 4K7UA 1T5XD 1WGRA 2JX5A 3PRPB 3ZLZA 2WXKA 2NBVB 3SHQA 5CHWA 1XCQL 4II2B 1GC6A 5L83A 4UDUC 4RCOA 4S17A 5HI1A 3VH4B 3BYYB 3RNBC 4GXBA 3WANA 3ML9A 1HA5A 3LJ3A 3OWEB 3MFGA 5HFYA 3ZDMC 2D3BA 2OOBB 3TEWA 2KO3A 1WZ0A 1WF9A 4JL9A 5H8YE 3AV8A 2KWCA 5DCNA 4WWMA 1Q1OA 3PHWB 2CJOA 4XZ4A 2HD5B 1BT0A 2PJHA 1RRBA 1HE8A 3QHTA 3AU4A 4LDTD 3N1XC 2KLCA 1TKEA 2W54A 4GDLA 1HXYD 2G9HD 1L4ZB 4FULA 4KDLB 1VLBA 4PS7A 5G55A 1XEEA 2SAKA 1HQRD 2N7JA 4L23A 3A4SC 1V1OA 2W82A 2J52A 2KHWB 4JGHB 1PFDA 3RZWC 1CMXB 4A8XC 5C23A 1XO3A 1TTNA 1HEZE 2JY6A 3PLVA 4MGKE 2DBYA 1UGJA 3V05A 2V4LA 5IA7A 1XLQA 2W3RA 4MELA 1H4RA 1N5WA 1MJDA 4MGIE 2D5GA 1BMLC 3TIXA 1KM7A 1TS3A 4W9EA 4F1SA 1SIFA 3Q8EA 1F1HA 4GDLB 1Y8RC 3VTVA 1ZXIA 2M0AA 2N9KA 2N9EB 2PKOA 2D11A 4EKUA 3FAHA 5HKHA 2JZPA 1F2RC 4BAXA 2BT6A 3DCGA 4YTNB 1PGAA 3K9PB 1QZEA 2CHZA 3IT4B 1KFYB 2L7RA 1EWCA 1YN5A 3KUZA 4RGMA 1QLBB 1OFFA 3TCAA 3B0AA 3V61A 5D2MB 2EELA 4J6IA 3T8MA 3VR9B 5L95C 1KLGD 3MC8A 2KC2A 2M0XA 1UUPA 3Q3JA 4EUTA 1WZ3A 1JMLA 5DPRA 2HTHA 1J7BA 3NZ3A 3GB1A 3AEEB 4LNKA 1C79A 3TEXA 2WXGA 1C78A 3P4RB 1EM7A 4P1BC 3R8BA 3W9CB 4KZCA 2INPE 4HCPB 4FHKA 1LM8B 4W9LA 2INDC 4GB9A 3N1ZC 4NQLB 3DVNU 4E74A 2NCNA 2MA9B 2G3QB 2C7HA 3H8HA 1WR6E 2BQQA 1ET9A 1C9FA 4M0WA 2N0SB 2XEWA 5IAAC 3TJPA 5G2NA 2FNJB 2BGFA 4MH8A 4HJKA 3DHGC 3O65B 3DBLI 4RGTA 3PZDA 2LVQA 2IY0B 2KN4A 2NMQA 2WXIA 4ITKA 4X57B 1AARA 4BOSC 1V6EA 2JWZA 1FFVA 3HHMA 3RNFC 4MDKE 1E5WA 1WRDB 2UU7A 1K8RB 3H7SA 4B0MA 3IAM1 1R4NI 1ESFA 1D5MC 3I63C 2NBWB 2K6QA 2GMIC 4BKTA 3RNEC 2DZJA 2WX1A 2IZVB 2AQ2B 3MC0B 3WCQA 1IGDA 3R66C 3ZXRA 1LQBA 5EDSA 1VR9A 2WU2B 3N3KB 3VXWA 1EU4A 1J7AA 2IY1B 2V3PA 5CHFA 2QILA 1V5OA 1JWSD 3EHVA 1E7UA 3I3TB 2Q5WD 4R3DA 4ANUA 2KANA 3ZJUA 1V86A 1N63A 4PK1A 3W1SA 1V97A 4DDGD 4C80A 1SIJA 3FKYA 2M4NA 1K53A 3V6EB 4AUQC 5TSSA 1WE7A 2JZZA 2CKHB 2HTME 1TYGB 1P7EA 1LGRA 4HRSA 4WQMA 3BINA 3WAPA 3CSTA 4RGNA 3MHZA 1DYQA 1A5RA 3KWLA 3V3XA 2MEKA 2FUHB 4JE3B 4E71A 2KK8A 2IO1B 2GBNA 2BPSA 2NPTA 4LNOA 3PLUA 1Z5SB 3J9CA 2WXMA 2FIDA 2KWUB 2J0KA 4LCDE 2BYTA 3ZKJC 3HVZA 1YJIA 4GN1A 3TMPB 3VUYA 1YX6B 4M8MA 1J8CA 3PGEA 3WAOA 4E3CA 4LNIA 3P4PB 4ZDVA 1IUEA 1SEBD 4JIOU 3GS2A 1J19A 3NVZA 1Z2MA 1GB4A 1JALA 2PW9A 3AEGB 3U30A 2DAFA 3IVFA 1XCTL 2HJ1A 4P1CC 2WXHA 4DXGA 5BYSA 2KMAA 2N7EA 2VZKD 4HDQA 3QK0A 1IYFA 4A90A 2B76B 3AEBB 4OVVA 1I4QA 4GDKB 2VH2A 1AWDA 2LFIA 3PREA 1WXSA 2KC1A 1N61A 2KKCA 2XK5A 1N5XA 3SD5A 2NS5A 1S3SG 4KSLC 3ZGZA 2NR2A 2DLBA 1NENB 1N6ZA 5AEKB 4K3BA 2BVCA 2J4XA 1NDDA 3WIMA 3NZUA 3BYTB 2PE9A 3AEAB 1G6JA 3ZJVA 2HJ8A 2CJNA 1S1QB 2LI5A 5GMVA 2FUG1 2C9WB 3CMMB 4ZRIA 4C7ZA 5DPSA 2PTLA 1WMHA 2DNFA 1YNTE 2KAJA 1HTOA 2MH7A 2BYVE 3QQ8B 2X38A 4WAAA 1XQQA 3LXFA 3DVNV 2LUMA 3AECB 3WAMA 2LMCA 3VAWA 4URKA 1GPXA 2XK5B 1SJHD 3PTFC 1XF5L 1D4BA 4N6EB 2JQRB 3SU8X 3C0RB 1GJZA 1WX8A 2BS3B 3RN9C 4EFOA 3KQ4A 1WGKA 5DPTA 2KYWA 4EZJA 5E6PA 5E6NA 2JT4B 3Q8BA 2L05A 3ZO5B 3DPDA 4JLCA 2KQ7A 3UINB 5CTRC 4IM2A 2BS4B 3DQVA 2K3UA 3NS1A 3DHIC 2K39A 4WJPA 4GOCA 1VRAB 1QOAA 3A1QB 4HKZE 2J53A 3DBLB 1DOIA 5IP4D 4TMAB 5HHDG 1GB1A 2MBEA 1P0RA 1D5ZC 4DXAB 1SBBB 4REZA 1F2RI 4RH6A 3UQBA 1NYQA 2MBOA 3PPAA 5FK9C 3BK2A 3ENEA 4LNFA 2ONQA 3DBRI 4KDIC 3VVWB 2YLMA 3VH3B 1C3TA 4HK2A 2ZW0A 2LWPA 2IJ0A 2KX3A 4G0NB 4WWNA 4XWTA 3FILA 2RDHA 3W5UB 2MWSB 2JWUA 4KIKA 3AULA 2MJ3A 4YXDB 2W55A 3RYTA 2KQSA 2MSED 4C4VA 1P7FA 1NYRA 4M00A 3L16A 1BUIC 2G1EA 2BF8B 4FJZA 2HDEA 2WWZA 3AE7B 4IWOA 1MPEA 4IM3A 3NJTA 3AE2B 3HK0A 3RNGC 1RWSA 2BWFA 4KSKC 2N9LA 3UIPB 1HTQA 4OZBA 1WXAA 2V1YA 4NY0A 1SB3C 4EE2A 1HZ6A 3Q3OC 4HROA 2V4IB 1C77A 4MM3A 2PE6B 2RDBC 3FILB 1V81A 2BW2A 2N9XA 3A33B 3NRZA 4XYCA 1L2NA 3IAS1 5GXGB 4FJVB 1DOYA 2RSUA 3L10B 1I7HA 1UWXA 2H88B 3TBLD 4C4VB 2KOXA 3H7PA 4W9HA 2AL6A 2M8SA 4W9DA 2LHDA 4FXCA 1AYFA 4TQ0A 3V62A 3BZDB 4IDIA 3AXCA 4K7WA 4Q2JA 2BB6A 3JSVA 4IOIE 2ZPNA 3B9JA 1EUVB 2QEJC 3UGBB 3S2AA 5FR3A 2BKFA 2D3CA 2WHIA 5LXHA 2I1JA 3NUHB 1L0XB 1UWMA 3ZJTA 2AEHA 4MM3B 1N62A 2L32A 1QKZA 2PEAA 1OEYA 3AE3B 4DHZE 2Z59B 1WWTA 3V6CB 2K5PA 4W9GA 2KWVB 3U4EG 2PVOD 5D3IB 2BS2B 3H7PB 4HJGE 2Y5BB 4NAMA 3Q2AC 4A55A 2V0GA 1VDVA 4YTMB
chains in the Genus database with same CATH topology
4NJCA 1IGCA 1L4DB 2WXNA 2L83A 4RGTA 1JWAD 3E9SA 1NVID 4OZAA 3NVVA 1JCKB 1R7SA 2KN4A 3IXSA 1SE3A 1C4CA 2ICIA 2NMQA 1TY2A 3BVMA 1V1PA 2PVGC 2WXIA 4ITKA 1TS5A 2WXPA 1FXAA 4NAWB 1I4XA 1FRRA 1MI0A 1KRHA 2GB1A 1NEKB 3AN1A 4DQOC 1FFVA 1L0YB 1TKGA 4XDDA 4B0MA 2WXQA 2J42A 1QILA 1L5PA 3IAM1 1ESFA 1C76A 2IDYA 1D5MC 3P1MA 1ZDVA 4YSYB 1QOBA 1SF0A 2IPKD 1ACCA 2JYTA 4WURA 3P4QB 1LO5D 4XE0A 4O1NA 1K51A 3W2DA 4ZOHC 3UI3A 1DOXA 2AQ2B 2L1AA 2WXRA 1TJEA 2PLPA 1JWUD 4JPSA 2KQ4X 1ZXHA 3MC0B 3WCQA 1CZPA 1IGDA 2WDVB 3ZYYX 1VR9A 2WU2B 5G5HA 1EU4A 1J7AA 4L2YA 2K0PA 2V3PA 4US9A 3AE5B 1FNVA 5D7GA 2W3SA 2QILA 3BK1A 2BBCA 3P4SB 1ZUD2 1XLNA 5C2TB 1JWSD 4IKGA 1Q10A 4ARIA 1K50A 3ZQ4A 2Q5WD 1ZDXA 2WQYB 4MACA 4R3DA 4ZHPA 3GP7A 4JWSC 5T8IA 3U2SC 4AQ7A 1SXTA 1YQ4B 3ZJUA 1N63A 3P42A 1DGJA 1V97A 3W1SA 4C80A 4OHJA 1SIJA 2WLBA 2ACZB 4KKIA 4US8A 4OW0A 1K53A 3HRDD 5TSSA 5AUIA 2R61A 1QOFA 1TYGB 2HTME 1P7EA 4OZCA 4HRSA 3R2IA 4WQMA 5MPOA 2WNMA 1FFUA 1SJED 4RGNA 2OEDA 1QOGA 3MHZA 1MVKA 4DXFA 1SE4A 1DYQA 2EKIA 2YEPF 1FIQA 3KWLA 3V3XA 2MEKA 3B2GA 5D3DA 1AW7A 1FRDA 4JE3B 4RGOS 2M56B 1T6BX 1BXTA 1JRPA 3AMZA 1FM0D 1RYJA 3BVZA 3FC4A 3Q8CA 4P16A 3J9CA 2WXMA 3LB8C 2CU3A 2AQ3B 3KWVA 5EE1A 3LYYA 2Z8LA 2GRIA 2JSVX 1FCCC 1AN8A 5LNK1 2BYTA 2QMTA 1N60A 1VZ7A 1RM6C 3Q69A 2JU6X 3EGRA 1JWMD 3HVZA 2OHFA 3AB5A 1I4RA 1YJIA 1ZOYB 1I4PA 2LEKA 4TQ1A 1PDXA 2PIAA 4WH4A 1PGXA 5FKAC 3HUIA 3P4PB 1IUEA 1SEBD 3SR6A 3ABVB 1SSNA 3AE1B 3B2FA 3DWGC 3GS2A 1EWYC 3NVZA 3T3NA 1IBXA 4P6VF 3I9V1 1GB4A 2WDQB 1PGBA 4XWWA 1JALA 2PW9A 2JXTA 2QIEB 3PZ8A 3AEGB 2M19A 3AM9A 1XCTL 3AEDB 2RMMA 3BVGA 3E56A 4XDCA 2WXHA 3AE9B 2RPVA 4DXGA 5BYSA 4RF1A 4KX6B 3SEBA 2VZKD 3NVWA 3PZ7A 3HVDA 1CK1A 2DYMA 4A90A 2B76B 2E6XA 3AEBB 1I4QA 1E10A 1L6UA 4GDKB 4AS1A 3SFDB 2MJEA 2DYOA 1AWDA 2LFIA 1ENFA 1N61A 1SE2A 1ZPSA 3EA6A 3W5VB 1QF6A 1I4GA 1E9MA 1JWBD 5BMHA 1ZE3D 1N5XA 4CQNA 1WSPA 2GI9A 3ZGZA 2AQ1B 3TEZA 2TSSA 2DLBA 1NENB 2KMMA 4TSSA 3URYA 1C4AA 3P63A 2J4XA 5E6JA 3BYTB 2LHEA 4ARCA 3TUOA 3AEAB 1QQRA 3ZJVA 2CJNA 3T3OA 1UNSA 1FD6A 2INNE 1IBXB 2FUG1 2YEPB 2XN9C 1YN4A 4ZRPA 1A70A 1B9RA 1V1PB 1FCLA 4C7ZA 2WXFA 1D5XC 1KF6B 1M4VA 1TS4A 4RF0A 1OQRA 2PTLA 4RNAA 1Y56A 3CIRB 4USAA 2IGDA 1YNTE 2MJDA 3RPFC 1TS2A 2KAJA 1MHHE 3NVYA 2MH7A 2Y3AA 2X38A 4C56C 2ON8A 2AX5A 3LXFA 4LTUA 2LUMA 3AECB 3VR8B 1GAQB 2LMCA 2NTTA 1KTKA 1YQ3B 4WAFA 1GPXA 1SJHD 1D4BA 1XF5L 4N6EB 2JQRB 2IGGA 2JYEA 2BS3B 3C8YA 1CQVA 3KQ4A 3ETRA 1WGKA 2WXLA 3U7ZA 4PT5A 2PMVA 2KACA 5EE9A 1TZOA 3AEFB 1C4PA 1T5XD 1WRIA 2LJIA 3Q8BA 2NTSA 2E3TA 2JX5A 3U52E 3VRAB 2WXKA 3AH7A 2XNAC 5C3JB 1XCQL 1J7CA 5EE0A 1CJEA 2BS4B 3PO0A 2WXJA 4N59A 4UDUC 4RCOA 5HI1A 3BYYB 5HG2A 4D2KA 1I4HA 2K3UA 3VRBB 3NS1A 1HA5A 1XLOA 2Y5CA 3OWEB 4KGTA 1VRAB 1QOAA 1E6EB 3MFGA 4HKZE 5AUKA 3Q8AA 2J53A 4LK0M 5HFYA 1DOIA 3TEWA 4TMAB 5HHDG 1GB1A 5H8YE 3AV8A 4WWMA 1D5ZC 1SBBB 5EE3A 2BB5A 4LLGM 1B1ZA 1KH0A 2CJOA 4REZA 1XXGA 1TY0A 1F2RI 2K9XA 2KDMA 4GLSC 4N58A 4RH6A 4C7YA 1NYQA 4YTPB 3AE8B 1TKEA 2W54A 3BK2A 5FK9C 1HXYD 2G9HD 1JQ4A 5JXVA 5BMIA 1FMAD 1JW9D 2ONQA 1L4ZB 1F77A 1VZ6A 2H89B 1VLBA 1XEEA 2SAKA 1HQRD 2N7JA 4L23A 1V1OA 1HZ5A 1T3QA 2W82A 2J52A 2ZW0A 5BYQA 4B0EA 1PFDA 2DWQA 2IJ0A 4A8XC 1XO3A 1YMHE 1HEZE 3CWIA 4XWTA 1NI3A 3FILA 2DBYA 2RDHA 3TSSA 1UGJA 4NZLB 4YWGG 3V05A 3W5UB 2JWUA 2ZW1A 1XLQA 2W3RA 1PYWD 1N5WA 2MJ3A 4YXDB 1V8CA 2W55A 3N9YC 3TEYA 1WXQA 2D5GA 2K22A 5G5GA 1GOZA 1BMLC 1P7FA 1EU3A 1NYRA 1WYGA 2I38A 3KLSX 1BUIC 1FXIA 2G1EA 2WP9B 2L52A 4OVZA 1TS3A 4RFBA 2Y5PA 2HDEA 3MP9A 3AE7B 3Q8EA 1MPEA 4WIPA 4GDLB 3AE2B 1RWSA 1ZXIA 2N9LA 4J3OD 2M0AA 2N9KA 2PKOA 5H92C 2VZKB 4OZBA 3BWUD 3FAHA 2KWDA 2JZPA 1F2RC 2BT6A 2RDGA 1XLPA 3DWMA 1SB3C 1L6VA 4YTNB 4H2AA 1HZ6A 1PGAA 4EE2A 3RFZB 2FBWB 2QSDA 4HROA 1VZ8A 2V4IB 3IT4B 1C77A 1FNWA 1KFYB 1EWCA 3FILB 4ZHOA 1YN5A 2BW2A 4RGMA 2WDRB 3NRZA 1QLBB 4KGSA 1PUTA 3IAS1 1STEA 5GXGB 1OFFA 3SFEB 1DOYA 3MJ5A 1K52A 1I7HA 1OQQA 1UWXA 2EELA 2H88B 4MT5A 4ZYSA 3VR9B 1KLGD 4JWUC 4KGRA 4A9AA 2LHDA 2SEBD 1UUPA 4FXCA 1AYFA 4TQ0A 1ZP0B 1FO4A 3VQIA 1RFKA 3BZDB 4IDIA 4Q2JA 5BMGA 5BYRA 2BB6A 1JMLA 4IOIE 3B9JA 1YN3A 1ROEA 1J7BA 3L4PA 3NZ3A 4ZRQA 3GB1A 4A6QA 2BTEA 3AEEB 1F0ZA 2QEJC 1C79A 3AE4B 4YSXB 3TEXA 2I2YA 1ET6A 1JROA 2WXGA 1C78A 3R2TA 3P4RB 1EM7A 4KKJA 3R8BA 1YJJA 5I4DA 3W9CB 5FR3A 2INPE 3BIID 2V3NA 4HEA1 3I57A 1FNUA 1E0ZA 3EUB2 2LGIA 4JX1C 3NUHB 4YT0B 2IGHA 1L0XB 1UWMA 3ZJTA 2WXOA 1L0VB 4MM3B 1N62A 2L32A 1QKZA 3AE3B 4HKQA 3Q8FA 3H8HA 2QJLA 1WWTA 1ET9A 1FEHA 2WS3B 1C9FA 2K5PA 3O13A 1QT9A 2N0SB 4M0WA 3U4EG 2PVOD 2WU5B 5D3IB 1E7PB 3IT6B 4L1BA 2BS2B 4HJGE 4MH8A 4YSZB 2FE8A 1D6EC 1MHXA 4NAMA 4A55A 1KLUD 1VJKA 3AE6B 1TKYA 2V0GA 1VDVA 4YTMB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AEC B;  3VR8 B;  1GAQ B;  2L83 A;  1NYR A;  1YQ3 B;  5EE1 A;  1GPX A;  1WYG A;  1JWA D;  1NVI D;  1FXI A;  2G1E A;  2JQR B;  2WP9 B;  2L52 A;  3NVV A;  4N6E B;  1R7S A;  2BS3 B;  3AE7 B;  1N60 A;  1RM6 C;  2PVG C;  4ITK A;  1FXA A;  3ETR A;  3AE2 B;  1FRR A;  1WGK A;  1RWS A;  3HVZ A;  2OHF A;  3AB5 A;  1ZXI A;  1ZOY B;  1YJI A;  1KRH A;  5EE9 A;  1NEK B;  2PKO A;  3AN1 A;  1FFV A;  3AEF B;  5H92 C;  2LEK A;  3FAH A;  1TKG A;  1WRI A;  1PDX A;  2PIA A;  2E3T A;  2JX5 A;  1L5P A;  2BT6 A;  3HUI A;  3P4P B;  1IUE A;  3SR6 A;  1XLP A;  3VRA B;  3ABV B;  3AE1 B;  3AH7 A;  3B2F A;  1SB3 C;  1L6V A;  3DWG C;  3DWM A;  3P1M A;  4YSY B;  4YTN B;  1QOB A;  1SF0 A;  1J7C A;  5C3J B;  2FBW B;  1EWY C;  3NVZ A;  4HRO A;  3P4Q B;  5EE0 A;  1CJE A;  4P6V F;  2WDQ B;  1KFY B;  2BS4 B;  1JAL A;  4ZOH C;  2QIE B;  3PO0 A;  4ZHO A;  3AEG B;  4N59 A;  1DOX A;  2WDR B;  3NRZ A;  1QLB B;  2M19 A;  3AM9 A;  1PUT A;  1TJE A;  5GXG B;  1OFF A;  3SFE B;  3VRB B;  3AED B;  3NS1 A;  1DOY A;  1XLO A;  3WCQ A;  1CZP A;  2Y5C A;  2WDV B;  3AE9 B;  1I7H A;  1OQQ A;  2H88 B;  3ZYY X;  1QOA A;  1E6E B;  2WU2 B;  4KX6 B;  5AUK A;  5G5H A;  1J7A A;  3NVW A;  3VR9 B;  1DOI A;  4US9 A;  3AE5 B;  2B76 B;  3AEB B;  4JWU C;  4A9A A;  1E10 A;  1L6U A;  2W3S A;  3SFD B;  2MJE A;  1AWD A;  4FXC A;  1AYF A;  5H8Y E;  1ZP0 B;  1FO4 A;  3AV8 A;  3P4S B;  1RFK A;  4WWM A;  4IDI A;  1ZUD 2;  1XLN A;  1N61 A;  5EE3 A;  5C2T B;  3W5V B;  2CJO A;  1QF6 A;  1E9M A;  1JWB D;  2Q5W D;  1N5X A;  2WQY B;  3B9J A;  1ROE A;  1J7B A;  2K9X A;  3L4P A;  4N58 A;  4C7Y A;  1F0Z A;  4ZHP A;  3AEE B;  1NYQ A;  4LTU A;  3AE8 B;  4YTP B;  3AE4 B;  4JWS C;  4YSX B;  1TKE A;  2W54 A;  1JRO A;  1JQ4 A;  1YQ4 B;  3P4R B;  1NEN B;  1FMA D;  1JW9 D;  1YJJ A;  2KMM A;  1N63 A;  1DGJ A;  1V97 A;  3W9C B;  4C80 A;  3BII D;  3P63 A;  2H89 B;  1E0Z A;  1SIJ A;  3EUB 2;  4JX1 C;  1VLB A;  2ACZ B;  2WLB A;  3AEA B;  4US8 A;  2CJN A;  3HRD D;  4YT0 B;  5AUI A;  1QOF A;  1TYG B;  1UWM A;  2HTM E;  1L0V B;  1N62 A;  4HRS A;  1T3Q A;  4WQM A;  1PFD A;  2DWQ A;  5MPO A;  1A70 A;  1FFU A;  1B9R A;  1XO3 A;  3AE3 B;  4C7Z A;  2QJL A;  3CWI A;  1WWT A;  1KF6 B;  1QOG A;  2WS3 B;  1NI3 A;  2DBY A;  1OQR A;  2EKI A;  2K5P A;  1FIQ A;  3KWL A;  1QT9 A;  2N0S B;  3CIR B;  4USA A;  2MJD A;  2PVO D;  2WU5 B;  3B2G A;  3RPF C;  2KAJ A;  1E7P B;  1FRD A;  3W5U B;  2BS2 B;  3NVY A;  2M56 B;  1XLQ A;  2MH7 A;  2W3R A;  1N5W A;  4YSZ B;  2MJ3 A;  1JRP A;  3AMZ A;  1FM0 D;  1V8C A;  1RYJ A;  2W55 A;  4YXD B;  1VJK A;  1WXQ A;  3AE6 B;  1TKY A;  3FC4 A;  1VDV A;  2K22 A;  5G5G A;  4YTM B;  2AX5 A;  3LXF A;  3LB8 C;  2CU3 A; 
#chains in the Genus database with same CATH topology
 4NJC A;  3MJW A;  5DPW A;  2Z0E B;  1EO6 A;  3JSV B;  2DZM A;  3NVV A;  3VHT C;  1SE3 A;  1C4C A;  1V1P A;  2PVG C;  1V2Y A;  1IPG A;  5AZF A;  2CHW A;  1I4X A;  1FRR A;  4IM0 A;  2GB1 A;  4DQO C;  4DWF A;  2IO2 B;  4XDD A;  4KVG B;  3ZXV A;  4BKG A;  2JYT A;  4WUR A;  3ONS A;  3L13 A;  1LO5 D;  4O1N A;  1K51 A;  4ZOH C;  2ASQ A;  3QAQ A;  4GMV A;  5BO4 B;  2WXR A;  3SDL C;  2PLP A;  2L0F A;  2KQ4 X;  2G4D B;  2ZCB A;  3ZYY X;  4HPP A;  4L2Y A;  2L3Z A;  2LRW A;  2LVP A;  3ZNH B;  1Q10 A;  4ARI A;  1K50 A;  4AJY B;  2M1M A;  2QC8 A;  1YOV B;  3GP7 A;  3U2S C;  4AQ7 A;  1YX5 B;  3P42 A;  2LD9 A;  4OHJ A;  3Q14 C;  4KKI A;  3PS6 A;  3A4R A;  4TUU A;  4BKS A;  2KVR A;  5AUI A;  2R61 A;  4OZC A;  3ALB A;  1PQS A;  3L08 A;  2WNM A;  1SJE D;  2OED A;  1FIQ A;  2RD0 A;  1OGW A;  3EFU A;  3B2G A;  4RGO S;  4W9J A;  1JRP A;  3FC4 A;  4WJQ A;  3LB8 C;  2CU3 A;  3LDZ E;  3AI5 A;  3LYY A;  1UZX B;  4ASW C;  3ZIM A;  2KJH B;  1R4M B;  3QWZ B;  3Q69 A;  1N60 A;  3DDC B;  3EGR A;  3IG3 A;  2BKR B;  3NS8 A;  1ZOY B;  3DBR B;  2LEK A;  1PDX A;  1FXT B;  3HUI A;  2FIF A;  4K81 A;  1OTR B;  3QCA A;  2MBQ A;  2UYZ B;  3NG0 A;  4IWP A;  1WI0 A;  1PGB A;  3PZ8 A;  4A3O A;  2MBH A;  3Q6B A;  5KHQ A;  3CSF A;  3DVG X;  3AM9 A;  3PHX B;  3PSE B;  3AED B;  4KZ0 A;  2KTR A;  4XDC A;  2KLG A;  1SGH A;  4KX6 B;  3SEB A;  3PZ7 A;  2DYM A;  1E10 A;  4AS1 A;  1WGG A;  2O6V A;  3SFD B;  3DBH I;  3QC8 B;  2G4S A;  3W5V B;  3GE8 C;  3EFC A;  4CQN A;  4M0W B;  4IWQ A;  1WSP A;  2BWE S;  3TEZ A;  2TSS A;  2KMM A;  4TSS A;  5JHB A;  1C4A A;  4S0R A;  1SE9 A;  2LHE A;  2ZVN A;  4WJN A;  3T3O A;  4ANW A;  2INN E;  4AP4 C;  1ISN A;  2XN9 C;  1WR1 A;  1B9R A;  2WXF A;  1KF6 B;  2X8X X;  2KTR B;  1WXM A;  4RNA A;  2KN5 A;  4USA A;  2IGD A;  2MJD A;  1TS2 A;  4C56 C;  2ON8 A;  4HDO A;  4I6N B;  4WAF A;  4HCN B;  1V49 A;  5D6J B;  2L00 B;  3DHH C;  2KFK A;  2KXJ A;  1UBQ A;  3RD2 A;  2WXL A;  2G45 B;  5EE9 A;  2KAC A;  4P7I A;  1J0G A;  4CHK A;  1I35 A;  3RI7 C;  3U52 E;  3VRA B;  4CO7 A;  4IW0 A;  1T0Q C;  4NPN A;  5C3J B;  2N1V A;  1J7C A;  3V60 A;  2WXJ A;  3ZNI D;  5LXI B;  4N59 A;  4NAW A;  1I4H A;  1GG3 A;  1XLO A;  1YD8 U;  2Y5C A;  4KGT A;  4GIV A;  5AUK A;  3Q8A A;  4LK0 M;  2DHZ A;  2MX2 A;  4AJW A;  4WWO A;  2BB5 A;  2CU1 A;  1B1Z A;  1KH0 A;  4LLG M;  2R2O A;  1TY0 A;  4NJ7 A;  2KDM A;  4C7Y A;  1E90 A;  5JH5 C;  4YTP B;  4WQO B;  2NPT B;  1UEL A;  1ZKH A;  5AZH A;  1F77 A;  1VZ6 A;  2IO0 B;  2K8H A;  5IKC M;  1I42 A;  1T0R C;  2CHX A;  1HZ5 A;  1T3Q A;  1OQY A;  2FAZ A;  5BYQ A;  4B0E A;  2DWQ A;  2LGY A;  1OEY J;  1YMH E;  3CWI A;  2LVO A;  3ZTD A;  2I1K A;  5JHA A;  4YWG G;  4HPM B;  2ZW1 A;  1PYW D;  2FCN A;  1V8C A;  3TEY A;  3QX1 A;  1WXQ A;  1F9J A;  2GBM A;  2K22 A;  3X0W A;  2ZCC A;  1P9D U;  5FR6 A;  2LAS A;  1WYG A;  3KLS X;  3PT2 B;  1FXI A;  4OVZ A;  1TZ1 A;  2Y5P A;  2AYO B;  4WIP A;  1UF0 A;  4LNN A;  5H92 C;  3I5J C;  2JVC A;  4B6W A;  2KWD A;  1MG4 A;  2RDG A;  1XD3 B;  4FJY A;  3N1Y C;  1T0S C;  2QSD A;  1VZ8 A;  4M01 A;  1FNW A;  4ZHO A;  3KVF B;  3ZUN A;  2WDR B;  4KGS A;  3RCZ A;  1WIA A;  1PUT A;  2V9H A;  1OQQ A;  4MT5 A;  2NBU A;  5E6O A;  2MQJ A;  4JWU C;  4KGR A;  2SEB D;  1LFD A;  1ZP0 B;  3UQA A;  1RFK A;  3N32 A;  5BMG A;  5BYR A;  3IBE A;  2KDF B;  4IC7 B;  3WA0 A;  1ROE A;  2A5U A;  1WMH B;  3L4P A;  4ZRQ A;  3VTW A;  1F0Z A;  3RUI B;  1ET6 A;  1JRO A;  3R2T A;  4KKJ A;  3NHE B;  1YJJ A;  3RUL A;  5I4D A;  4HEA 1;  1E0Z A;  3EUB 2;  2CR5 A;  4JX1 C;  3BY4 B;  3X23 A;  4A20 A;  1M94 A;  3PVL A;  2KZR A;  4B95 A;  3Q8F A;  3RT3 B;  2WS3 B;  4JQW C;  2WU5 B;  1E7P B;  3IT6 B;  4L1B A;  4YSZ B;  1R4N B;  2KDE B;  1D6E C;  1KLU D;  1E7V A;  1TKY A;  2J0M A;  4HPL B;  3DOW A;  2DX5 B;  3DBH B;  4FAD A;  3T9L A;  2LGS A;  2LJ5 A;  4OZA A;  2K6D B;  1JCK B;  1R7S A;  5C1Z A;  3IXS A;  2ICI A;  3BVM A;  1E8Y A;  3OAW A;  1KRH A;  2VRR B;  1NEK B;  3EC8 A;  4EOY A;  1P3Q U;  3Q3F A;  1L0Y B;  4FLH A;  1TKG A;  2GBK A;  1C76 A;  1P1A A;  1Q0W B;  1KOT A;  2KTF A;  3P2B A;  4LJO B;  1QOB A;  1SF0 A;  1ACC A;  3P4Q B;  4XE0 A;  4ZRJ A;  2KNB A;  2D3A A;  4LDT B;  2L1A A;  2K8B A;  4OVU A;  1JWU D;  3DVG Y;  2FCS A;  1MFW A;  2WDV B;  2O2V A;  2K0P A;  2MLB A;  4US9 A;  4AWJ A;  1X1M A;  3NY5 A;  1D3Z A;  5D7G A;  2W3S A;  4I6P A;  4F8C B;  1V80 A;  1WJN A;  1XLN A;  5C2T B;  1TIF A;  3ZTC A;  3ZQ4 A;  1YIW A;  2WQY B;  5AZG A;  4CYE A;  4ZHP A;  4QAY A;  3APF A;  5T8I A;  2L8J A;  1SXT A;  4KIK B;  4MSM B;  4C00 A;  1WY8 A;  2WLB A;  2ACZ B;  4OW0 A;  3H9D A;  1E8X A;  2LGX A;  4HWI B;  1QOF A;  3M3J A;  2C7N B;  3R2I A;  3RNC C;  2YVC A;  3OJ3 A;  5MPO A;  2KMC A;  2MCN B;  1FFU A;  1MVK A;  4DXF A;  2QDF A;  2EKI A;  2YEP F;  3Q3N C;  2C5L C;  4IUM B;  5D3D A;  1AW7 A;  2O2V B;  1WX7 A;  1BXT A;  1FM0 D;  1WGY A;  2REX A;  4EEW A;  4MGZ E;  2AQ3 B;  4EZK A;  3R7R A;  2Z8L A;  1WGH A;  2JZ3 B;  2JSV X;  1AN8 A;  3GZN I;  2QMT A;  4M8N A;  1RM6 C;  4DBG A;  2JU6 X;  3OLM D;  2D10 A;  3AB5 A;  1I4R A;  2EMT A;  2KT7 A;  3PRZ A;  3H6N A;  4II3 B;  3R7Q A;  2PIA A;  2MW5 A;  1PGX A;  5FKA C;  3D32 A;  3DWG C;  2WX0 A;  2ZNV B;  1NBF C;  1UH6 A;  2LZ6 A;  2FCM A;  4MH0 E;  1IBX A;  3I9V 1;  4XWW A;  3MHS D;  2L0T A;  3ZDT A;  3ZVV A;  5IOI A;  4MSQ B;  3B08 A;  2RMM A;  4PS3 A;  4NQK E;  2N7D A;  2JPH A;  2ZPY A;  3HVD A;  1CK1 A;  2E6X A;  5CX3 A;  2MJE A;  2DYO A;  2DYB A;  2GBR A;  2ZZP B;  1KJT A;  1QF6 A;  1I4G A;  2N4F A;  5BMH A;  1ZE3 D;  1ZGU B;  2LUE A;  2LXA A;  2NVU I;  5CHV C;  5E6J A;  4ARC A;  3APC A;  3TUO A;  1QQR A;  3OG5 A;  1UNS A;  1IBX B;  2UWQ A;  2OJR A;  2KJ6 A;  2QCZ A;  4FA6 A;  3APD A;  2M17 A;  1V1P B;  2MBB B;  1FCL A;  2WDT B;  3W1Y A;  1TS4 A;  4W9K A;  4RF0 A;  3CIR B;  1E8W A;  1MHH E;  2MP2 A;  1F52 A;  1UGM A;  1T0Y A;  4HXD A;  4LTU A;  3VR8 B;  1GAQ B;  2NTT A;  4GSW A;  1KTK A;  1YQ3 B;  1LXD A;  2XBB C;  2JRI B;  2IGG A;  3C8Y A;  1GUA B;  5IO9 A;  3ETR A;  3VUX A;  4PT5 A;  2KX0 A;  2PMV A;  4GU2 A;  4G11 A;  2K1F A;  1RFA A;  1VCB A;  1WRI A;  2K8C A;  2LJI A;  4LJP B;  2NTS A;  2E3T A;  4W9I A;  1WYW B;  1IP9 A;  3AH7 A;  2XNA C;  3PV1 A;  2L76 A;  2QHO A;  5EE0 A;  1CJE A;  1TGZ B;  1Q5W B;  3PO0 A;  3C19 A;  2MP2 B;  3A9J A;  5HG2 A;  3VRB B;  3MTN B;  4D2K A;  1WX9 A;  1WFY A;  4HLE A;  2AWT A;  1E6E B;  1WGD A;  4W9F A;  2B3A A;  3UIO B;  5EE3 A;  1XXG A;  2K9X A;  4N58 A;  4GLS C;  1WE6 A;  3AE8 B;  4RM8 A;  4KV2 A;  4ZYN A;  1JQ4 A;  5JXV A;  1RAX A;  5BMI A;  1FMA D;  1JW9 D;  3VUW A;  2H89 B;  4FN2 A;  2MRP A;  1GC7 A;  3N20 C;  4K3C A;  2N9P C;  1C1Y B;  2BYE A;  2MHJ A;  3N30 A;  3A9J B;  1NI3 A;  4WJO A;  1WXV A;  4ANX A;  3TSS A;  4AOF A;  4NZL B;  1FPY A;  3N9Y C;  5G5G A;  1GOZ A;  1EU3 A;  1GNU A;  4TKN A;  2I38 A;  2WP9 B;  3TL5 A;  2L52 A;  2HE7 A;  4RFB A;  2KDI A;  4BOZ B;  3MP9 A;  1UD7 A;  4BZA A;  3L54 A;  4J3O D;  3K9O B;  2J7Q B;  3M63 B;  3PRM B;  2VZK B;  3R3M A;  3BWU D;  3ML8 A;  3OJ4 B;  2O6V B;  1XLP A;  4I6L B;  3DWM A;  1L6V A;  4H2A A;  3RFZ B;  1WJ6 A;  3GOE A;  2FBW B;  1WM2 A;  4FHJ A;  1XT9 B;  4BVU C;  2C7M B;  3W1S C;  1KLV A;  2D2Q A;  1STE A;  3IHP C;  3SFE B;  3VDZ A;  3MJ5 A;  1K52 A;  2KDB A;  4ZYS A;  4BKS D;  5J18 A;  4A9A A;  5LLI A;  3GZN B;  1FO4 A;  4DHZ B;  3VQI A;  1YN3 A;  4A6Q A;  2BTE A;  3HM3 A;  4NNJ B;  3AE4 B;  4YSX B;  3RZF A;  2EMS A;  5TR5 A;  2I2Y A;  4DHJ B;  2JXX A;  2C60 A;  2WYQ A;  3BII D;  2V3N A;  3I57 A;  1FNU A;  1EF1 A;  2KFJ A;  3Q3M C;  2LGI A;  4HVB A;  3GE3 C;  2JRH A;  4YT0 B;  3AU5 A;  2IGH A;  3ZNZ B;  2WXO A;  3HIZ A;  1L0V B;  3U8Z A;  4ACF A;  4GDK A;  4DDI D;  2KFK B;  1NI2 A;  4HKQ A;  2QJL A;  4MGY E;  1FEH A;  3ZW3 A;  3O13 A;  4ANV A;  3KH0 A;  1QT9 A;  4GGQ A;  5J2R A;  2GOW A;  3EEC A;  2GBJ A;  2PPH A;  4W9C A;  2FE8 A;  1MHX A;  2JUO A;  2WGS A;  1VJK A;  3AE6 B;  1IGC A;  1L4D B;  1RLF A;  2WXN A;  2L83 A;  3DBS A;  3KYD D;  5JZE B;  1JWA D;  2R2Q A;  3E9S A;  1NVI D;  2GLS A;  1TT5 B;  1TY2 A;  1TS5 A;  2WXP A;  1FXA A;  3IFW B;  4NAW B;  4ICV A;  1MI0 A;  3KUD B;  3AN1 A;  2CS4 A;  3ECI A;  1U4A A;  4DK5 A;  2WXQ A;  2J42 A;  5J17 A;  1QIL A;  1L5P A;  2IDY A;  5D94 A;  2RGF A;  3ZNG C;  2O6V D;  3P1M A;  1ZDV A;  1EF5 A;  2IYD B;  3QAR A;  4YSY B;  5KHO A;  2KJR A;  2IPK D;  2KD0 A;  1YJ1 A;  3H1U A;  2ZVO A;  3W2D A;  4BBN C;  3UI3 A;  3QIJ A;  2IBI B;  4K7S A;  1DOX A;  4G50 A;  1TJE A;  3M95 A;  2LXC A;  1VD2 A;  4JPS A;  1ZXH A;  1CZP A;  2V3S A;  4PYZ A;  5G5H A;  3AE5 B;  3CF6 E;  1FNV A;  4MJS A;  3BK1 A;  2BBC A;  1P98 A;  3P4S B;  3NZS A;  1ZUD 2;  3KW5 B;  3JVZ X;  4IKG A;  4RMA A;  1WJU A;  1ZDX A;  3NOB A;  4MAC A;  4WWP A;  4JWS C;  2ZJD A;  4XX5 A;  4K1R B;  4DHJ D;  1YQ4 B;  4EZL A;  4NJ6 A;  1DGJ A;  2JF5 A;  3U7D A;  1JRU A;  3WAL A;  4B9K A;  3A1Q A;  4US8 A;  3HRD D;  2EKE C;  4G3X B;  4RM9 A;  2INC C;  4IG7 B;  1V9J A;  1QOG A;  3ZRC A;  3RNA C;  1SE4 A;  2RR9 A;  3A9K A;  1FRD A;  2M56 B;  1T6B X;  3KUC B;  3AMZ A;  1RYJ A;  3B1L X;  3BVZ A;  2ZEQ A;  3Q8C A;  4P16 A;  2DZK A;  4MJS B;  3KWV A;  5EE1 A;  1E8Z A;  2N1W A;  2GRI A;  1WH3 A;  1FCC C;  1H8C A;  5LNK 1;  1VZ7 A;  4F7Z A;  1JWM D;  3VTU A;  2Z0D B;  2OHF A;  4PYU A;  1L7Y A;  2J0J A;  1I4P A;  4TQ1 A;  4WH4 A;  2D3G A;  1WM3 A;  3SR6 A;  4MEM A;  3ABV B;  1SSN A;  3AE1 B;  3B2F A;  3VFK A;  4BBN F;  1EWY C;  3T3N A;  4P6V F;  2DEN B;  2WDQ B;  2JXT A;  2AL3 A;  2QIE B;  3KYC D;  4XC2 A;  1R4M I;  4TV3 A;  2M19 A;  3A9K B;  1UBI A;  2IO3 B;  3BVG A;  3E56 A;  3MC9 A;  1ZW7 A;  3AE9 B;  2RPV A;  4RF1 A;  3NVW A;  3JW0 X;  2LGD A;  1TBE A;  1YQB A;  4M02 A;  1L6U A;  2D07 B;  2DZI A;  1ENF A;  1SE2 A;  1ZPS A;  2DAJ A;  3EA6 A;  1E9M A;  1JWB D;  2GI9 A;  2AQ1 B;  3L17 A;  3RMK C;  3URY A;  3P63 A;  1WJ4 A;  1FD6 A;  2YEP B;  4XGA B;  3L0W B;  1YN4 A;  4N9F 4;  4ZRP A;  1A70 A;  3HM6 X;  1V5T A;  1MG8 A;  1D5X C;  1M4V A;  3QJZ A;  1OQR A;  2K25 A;  1Y56 A;  3RPF C;  2FCQ A;  3QA8 A;  4BFR A;  2LRU A;  3NVY A;  2Y3A A;  2RPQ A;  3M62 B;  2AX5 A;  4ZRK A;  2VH1 A;  4A3P A;  2OJW A;  3JYU A;  4ICU A;  2JYE A;  4PS8 A;  1CQV A;  2BYF A;  4YL8 A;  3ZRF A;  5IN7 A;  3UF8 A;  3U7Z A;  1TZO A;  2W9N A;  1C4P A;  2ZNV C;  3AEF B;  2KVZ A;  2A4Z A;  4FBJ B;  4K7U A;  1T5X D;  1WGR A;  2JX5 A;  3PRP B;  3ZLZ A;  2WXK A;  2NBV B;  3SHQ A;  5CHW A;  1XCQ L;  4II2 B;  1GC6 A;  5L83 A;  4UDU C;  4RCO A;  4S17 A;  5HI1 A;  3VH4 B;  3BYY B;  3RNB C;  4GXB A;  3WAN A;  3ML9 A;  1HA5 A;  3LJ3 A;  3OWE B;  3MFG A;  5HFY A;  3ZDM C;  2D3B A;  2OOB B;  3TEW A;  2KO3 A;  1WZ0 A;  1WF9 A;  4JL9 A;  5H8Y E;  3AV8 A;  2KWC A;  5DCN A;  4WWM A;  1Q1O A;  3PHW B;  2CJO A;  4XZ4 A;  2HD5 B;  1BT0 A;  2PJH A;  1RRB A;  1HE8 A;  3QHT A;  3AU4 A;  4LDT D;  3N1X C;  2KLC A;  1TKE A;  2W54 A;  4GDL A;  1HXY D;  2G9H D;  1L4Z B;  4FUL A;  4KDL B;  1VLB A;  4PS7 A;  5G55 A;  1XEE A;  2SAK A;  1HQR D;  2N7J A;  4L23 A;  3A4S C;  1V1O A;  2W82 A;  2J52 A;  2KHW B;  4JGH B;  1PFD A;  3RZW C;  1CMX B;  4A8X C;  5C23 A;  1XO3 A;  1TTN A;  1HEZ E;  2JY6 A;  3PLV A;  4MGK E;  2DBY A;  1UGJ A;  3V05 A;  2V4L A;  5IA7 A;  1XLQ A;  2W3R A;  4MEL A;  1H4R A;  1N5W A;  1MJD A;  4MGI E;  2D5G A;  1BML C;  3TIX A;  1KM7 A;  1TS3 A;  4W9E A;  4F1S A;  1SIF A;  3Q8E A;  1F1H A;  4GDL B;  1Y8R C;  3VTV A;  1ZXI A;  2M0A A;  2N9K A;  2N9E B;  2PKO A;  2D11 A;  4EKU A;  3FAH A;  5HKH A;  2JZP A;  1F2R C;  4BAX A;  2BT6 A;  3DCG A;  4YTN B;  1PGA A;  3K9P B;  1QZE A;  2CHZ A;  3IT4 B;  1KFY B;  2L7R A;  1EWC A;  1YN5 A;  3KUZ A;  4RGM A;  1QLB B;  1OFF A;  3TCA A;  3B0A A;  3V61 A;  5D2M B;  2EEL A;  4J6I A;  3T8M A;  3VR9 B;  5L95 C;  1KLG D;  3MC8 A;  2KC2 A;  2M0X A;  1UUP A;  3Q3J A;  4EUT A;  1WZ3 A;  1JML A;  5DPR A;  2HTH A;  1J7B A;  3NZ3 A;  3GB1 A;  3AEE B;  4LNK A;  1C79 A;  3TEX A;  2WXG A;  1C78 A;  3P4R B;  1EM7 A;  4P1B C;  3R8B A;  3W9C B;  4KZC A;  2INP E;  4HCP B;  4FHK A;  1LM8 B;  4W9L A;  2IND C;  4GB9 A;  3N1Z C;  4NQL B;  3DVN U;  4E74 A;  2NCN A;  2MA9 B;  2G3Q B;  2C7H A;  3H8H A;  1WR6 E;  2BQQ A;  1ET9 A;  1C9F A;  4M0W A;  2N0S B;  2XEW A;  5IAA C;  3TJP A;  5G2N A;  2FNJ B;  2BGF A;  4MH8 A;  4HJK A;  3DHG C;  3O65 B;  3DBL I;  4RGT A;  3PZD A;  2LVQ A;  2IY0 B;  2KN4 A;  2NMQ A;  2WXI A;  4ITK A;  4X57 B;  1AAR A;  4BOS C;  1V6E A;  2JWZ A;  1FFV A;  3HHM A;  3RNF C;  4MDK E;  1E5W A;  1WRD B;  2UU7 A;  1K8R B;  3H7S A;  4B0M A;  3IAM 1;  1R4N I;  1ESF A;  1D5M C;  3I63 C;  2NBW B;  2K6Q A;  2GMI C;  4BKT A;  3RNE C;  2DZJ A;  2WX1 A;  2IZV B;  2AQ2 B;  3MC0 B;  3WCQ A;  1IGD A;  3R66 C;  3ZXR A;  1LQB A;  5EDS A;  1VR9 A;  2WU2 B;  3N3K B;  3VXW A;  1EU4 A;  1J7A A;  2IY1 B;  2V3P A;  5CHF A;  2QIL A;  1V5O A;  1JWS D;  3EHV A;  1E7U A;  3I3T B;  2Q5W D;  4R3D A;  4ANU A;  2KAN A;  3ZJU A;  1V86 A;  1N63 A;  4PK1 A;  3W1S A;  1V97 A;  4DDG D;  4C80 A;  1SIJ A;  3FKY A;  2M4N A;  1K53 A;  3V6E B;  4AUQ C;  5TSS A;  1WE7 A;  2JZZ A;  2CKH B;  2HTM E;  1TYG B;  1P7E A;  1LGR A;  4HRS A;  4WQM A;  3BIN A;  3WAP A;  3CST A;  4RGN A;  3MHZ A;  1DYQ A;  1A5R A;  3KWL A;  3V3X A;  2MEK A;  2FUH B;  4JE3 B;  4E71 A;  2KK8 A;  2IO1 B;  2GBN A;  2BPS A;  2NPT A;  4LNO A;  3PLU A;  1Z5S B;  3J9C A;  2WXM A;  2FID A;  2KWU B;  2J0K A;  4LCD E;  2BYT A;  3ZKJ C;  3HVZ A;  1YJI A;  4GN1 A;  3TMP B;  3VUY A;  1YX6 B;  4M8M A;  1J8C A;  3PGE A;  3WAO A;  4E3C A;  4LNI A;  3P4P B;  4ZDV A;  1IUE A;  1SEB D;  4JIO U;  3GS2 A;  1J19 A;  3NVZ A;  1Z2M A;  1GB4 A;  1JAL A;  2PW9 A;  3AEG B;  3U30 A;  2DAF A;  3IVF A;  1XCT L;  2HJ1 A;  4P1C C;  2WXH A;  4DXG A;  5BYS A;  2KMA A;  2N7E A;  2VZK D;  4HDQ A;  3QK0 A;  1IYF A;  4A90 A;  2B76 B;  3AEB B;  4OVV A;  1I4Q A;  4GDK B;  2VH2 A;  1AWD A;  2LFI A;  3PRE A;  1WXS A;  2KC1 A;  1N61 A;  2KKC A;  2XK5 A;  1N5X A;  3SD5 A;  2NS5 A;  1S3S G;  4KSL C;  3ZGZ A;  2NR2 A;  2DLB A;  1NEN B;  1N6Z A;  5AEK B;  4K3B A;  2BVC A;  2J4X A;  1NDD A;  3WIM A;  3NZU A;  3BYT B;  2PE9 A;  3AEA B;  1G6J A;  3ZJV A;  2HJ8 A;  2CJN A;  1S1Q B;  2LI5 A;  5GMV A;  2FUG 1;  2C9W B;  3CMM B;  4ZRI A;  4C7Z A;  5DPS A;  2PTL A;  1WMH A;  2DNF A;  1YNT E;  2KAJ A;  1HTO A;  2MH7 A;  2BYV E;  3QQ8 B;  2X38 A;  4WAA A;  1XQQ A;  3LXF A;  3DVN V;  2LUM A;  3AEC B;  3WAM A;  2LMC A;  3VAW A;  4URK A;  1GPX A;  2XK5 B;  1SJH D;  3PTF C;  1XF5 L;  1D4B A;  4N6E B;  2JQR B;  3SU8 X;  3C0R B;  1GJZ A;  1WX8 A;  2BS3 B;  3RN9 C;  4EFO A;  3KQ4 A;  1WGK A;  5DPT A;  2KYW A;  4EZJ A;  5E6P A;  5E6N A;  2JT4 B;  3Q8B A;  2L05 A;  3ZO5 B;  3DPD A;  4JLC A;  2KQ7 A;  3UIN B;  5CTR C;  4IM2 A;  2BS4 B;  3DQV A;  2K3U A;  3NS1 A;  3DHI C;  2K39 A;  4WJP A;  4GOC A;  1VRA B;  1QOA A;  3A1Q B;  4HKZ E;  2J53 A;  3DBL B;  1DOI A;  5IP4 D;  4TMA B;  5HHD G;  1GB1 A;  2MBE A;  1P0R A;  1D5Z C;  4DXA B;  1SBB B;  4REZ A;  1F2R I;  4RH6 A;  3UQB A;  1NYQ A;  2MBO A;  3PPA A;  5FK9 C;  3BK2 A;  3ENE A;  4LNF A;  2ONQ A;  3DBR I;  4KDI C;  3VVW B;  2YLM A;  3VH3 B;  1C3T A;  4HK2 A;  2ZW0 A;  2LWP A;  2IJ0 A;  2KX3 A;  4G0N B;  4WWN A;  4XWT A;  3FIL A;  2RDH A;  3W5U B;  2MWS B;  2JWU A;  4KIK A;  3AUL A;  2MJ3 A;  4YXD B;  2W55 A;  3RYT A;  2KQS A;  2MSE D;  4C4V A;  1P7F A;  1NYR A;  4M00 A;  3L16 A;  1BUI C;  2G1E A;  2BF8 B;  4FJZ A;  2HDE A;  2WWZ A;  3AE7 B;  4IWO A;  1MPE A;  4IM3 A;  3NJT A;  3AE2 B;  3HK0 A;  3RNG C;  1RWS A;  2BWF A;  4KSK C;  2N9L A;  3UIP B;  1HTQ A;  4OZB A;  1WXA A;  2V1Y A;  4NY0 A;  1SB3 C;  4EE2 A;  1HZ6 A;  3Q3O C;  4HRO A;  2V4I B;  1C77 A;  4MM3 A;  2PE6 B;  2RDB C;  3FIL B;  1V81 A;  2BW2 A;  2N9X A;  3A33 B;  3NRZ A;  4XYC A;  1L2N A;  3IAS 1;  5GXG B;  4FJV B;  1DOY A;  2RSU A;  3L10 B;  1I7H A;  1UWX A;  2H88 B;  3TBL D;  4C4V B;  2KOX A;  3H7P A;  4W9H A;  2AL6 A;  2M8S A;  4W9D A;  2LHD A;  4FXC A;  1AYF A;  4TQ0 A;  3V62 A;  3BZD B;  4IDI A;  3AXC A;  4K7W A;  4Q2J A;  2BB6 A;  3JSV A;  4IOI E;  2ZPN A;  3B9J A;  1EUV B;  2QEJ C;  3UGB B;  3S2A A;  5FR3 A;  2BKF A;  2D3C A;  2WHI A;  5LXH A;  2I1J A;  3NUH B;  1L0X B;  1UWM A;  3ZJT A;  2AEH A;  4MM3 B;  1N62 A;  2L32 A;  1QKZ A;  2PEA A;  1OEY A;  3AE3 B;  4DHZ E;  2Z59 B;  1WWT A;  3V6C B;  2K5P A;  4W9G A;  2KWV B;  3U4E G;  2PVO D;  5D3I B;  2BS2 B;  3H7P B;  4HJG E;  2Y5B B;  4NAM A;  3Q2A C;  4A55 A;  2V0G A;  1VDV A;  4YTM B; 
#chains in the Genus database with same CATH homology
 4NJC A;  1IGC A;  1L4D B;  2WXN A;  2L83 A;  4RGT A;  1JWA D;  3E9S A;  1NVI D;  4OZA A;  3NVV A;  1JCK B;  1R7S A;  2KN4 A;  3IXS A;  1SE3 A;  1C4C A;  2ICI A;  2NMQ A;  1TY2 A;  3BVM A;  1V1P A;  2PVG C;  2WXI A;  4ITK A;  1TS5 A;  2WXP A;  1FXA A;  4NAW B;  1I4X A;  1FRR A;  1MI0 A;  1KRH A;  2GB1 A;  1NEK B;  3AN1 A;  4DQO C;  1FFV A;  1L0Y B;  1TKG A;  4XDD A;  4B0M A;  2WXQ A;  2J42 A;  1QIL A;  1L5P A;  3IAM 1;  1ESF A;  1C76 A;  2IDY A;  1D5M C;  3P1M A;  1ZDV A;  4YSY B;  1QOB A;  1SF0 A;  2IPK D;  1ACC A;  2JYT A;  4WUR A;  3P4Q B;  1LO5 D;  4XE0 A;  4O1N A;  1K51 A;  3W2D A;  4ZOH C;  3UI3 A;  1DOX A;  2AQ2 B;  2L1A A;  2WXR A;  1TJE A;  2PLP A;  1JWU D;  4JPS A;  2KQ4 X;  1ZXH A;  3MC0 B;  3WCQ A;  1CZP A;  1IGD A;  2WDV B;  3ZYY X;  1VR9 A;  2WU2 B;  5G5H A;  1EU4 A;  1J7A A;  4L2Y A;  2K0P A;  2V3P A;  4US9 A;  3AE5 B;  1FNV A;  5D7G A;  2W3S A;  2QIL A;  3BK1 A;  2BBC A;  3P4S B;  1ZUD 2;  1XLN A;  5C2T B;  1JWS D;  4IKG A;  1Q10 A;  4ARI A;  1K50 A;  3ZQ4 A;  2Q5W D;  1ZDX A;  2WQY B;  4MAC A;  4R3D A;  4ZHP A;  3GP7 A;  4JWS C;  5T8I A;  3U2S C;  4AQ7 A;  1SXT A;  1YQ4 B;  3ZJU A;  1N63 A;  3P42 A;  1DGJ A;  1V97 A;  3W1S A;  4C80 A;  4OHJ A;  1SIJ A;  2WLB A;  2ACZ B;  4KKI A;  4US8 A;  4OW0 A;  1K53 A;  3HRD D;  5TSS A;  5AUI A;  2R61 A;  1QOF A;  1TYG B;  2HTM E;  1P7E A;  4OZC A;  4HRS A;  3R2I A;  4WQM A;  5MPO A;  2WNM A;  1FFU A;  1SJE D;  4RGN A;  2OED A;  1QOG A;  3MHZ A;  1MVK A;  4DXF A;  1SE4 A;  1DYQ A;  2EKI A;  2YEP F;  1FIQ A;  3KWL A;  3V3X A;  2MEK A;  3B2G A;  5D3D A;  1AW7 A;  1FRD A;  4JE3 B;  4RGO S;  2M56 B;  1T6B X;  1BXT A;  1JRP A;  3AMZ A;  1FM0 D;  1RYJ A;  3BVZ A;  3FC4 A;  3Q8C A;  4P16 A;  3J9C A;  2WXM A;  3LB8 C;  2CU3 A;  2AQ3 B;  3KWV A;  5EE1 A;  3LYY A;  2Z8L A;  2GRI A;  2JSV X;  1FCC C;  1AN8 A;  5LNK 1;  2BYT A;  2QMT A;  1N60 A;  1VZ7 A;  1RM6 C;  3Q69 A;  2JU6 X;  3EGR A;  1JWM D;  3HVZ A;  2OHF A;  3AB5 A;  1I4R A;  1YJI A;  1ZOY B;  1I4P A;  2LEK A;  4TQ1 A;  1PDX A;  2PIA A;  4WH4 A;  1PGX A;  5FKA C;  3HUI A;  3P4P B;  1IUE A;  1SEB D;  3SR6 A;  3ABV B;  1SSN A;  3AE1 B;  3B2F A;  3DWG C;  3GS2 A;  1EWY C;  3NVZ A;  3T3N A;  1IBX A;  4P6V F;  3I9V 1;  1GB4 A;  2WDQ B;  1PGB A;  4XWW A;  1JAL A;  2PW9 A;  2JXT A;  2QIE B;  3PZ8 A;  3AEG B;  2M19 A;  3AM9 A;  1XCT L;  3AED B;  2RMM A;  3BVG A;  3E56 A;  4XDC A;  2WXH A;  3AE9 B;  2RPV A;  4DXG A;  5BYS A;  4RF1 A;  4KX6 B;  3SEB A;  2VZK D;  3NVW A;  3PZ7 A;  3HVD A;  1CK1 A;  2DYM A;  4A90 A;  2B76 B;  2E6X A;  3AEB B;  1I4Q A;  1E10 A;  1L6U A;  4GDK B;  4AS1 A;  3SFD B;  2MJE A;  2DYO A;  1AWD A;  2LFI A;  1ENF A;  1N61 A;  1SE2 A;  1ZPS A;  3EA6 A;  3W5V B;  1QF6 A;  1I4G A;  1E9M A;  1JWB D;  5BMH A;  1ZE3 D;  1N5X A;  4CQN A;  1WSP A;  2GI9 A;  3ZGZ A;  2AQ1 B;  3TEZ A;  2TSS A;  2DLB A;  1NEN B;  2KMM A;  4TSS A;  3URY A;  1C4A A;  3P63 A;  2J4X A;  5E6J A;  3BYT B;  2LHE A;  4ARC A;  3TUO A;  3AEA B;  1QQR A;  3ZJV A;  2CJN A;  3T3O A;  1UNS A;  1FD6 A;  2INN E;  1IBX B;  2FUG 1;  2YEP B;  2XN9 C;  1YN4 A;  4ZRP A;  1A70 A;  1B9R A;  1V1P B;  1FCL A;  4C7Z A;  2WXF A;  1D5X C;  1KF6 B;  1M4V A;  1TS4 A;  4RF0 A;  1OQR A;  2PTL A;  4RNA A;  1Y56 A;  3CIR B;  4USA A;  2IGD A;  1YNT E;  2MJD A;  3RPF C;  1TS2 A;  2KAJ A;  1MHH E;  3NVY A;  2MH7 A;  2Y3A A;  2X38 A;  4C56 C;  2ON8 A;  2AX5 A;  3LXF A;  4LTU A;  2LUM A;  3AEC B;  3VR8 B;  1GAQ B;  2LMC A;  2NTT A;  1KTK A;  1YQ3 B;  4WAF A;  1GPX A;  1SJH D;  1D4B A;  1XF5 L;  4N6E B;  2JQR B;  2IGG A;  2JYE A;  2BS3 B;  3C8Y A;  1CQV A;  3KQ4 A;  3ETR A;  1WGK A;  2WXL A;  3U7Z A;  4PT5 A;  2PMV A;  2KAC A;  5EE9 A;  1TZO A;  3AEF B;  1C4P A;  1T5X D;  1WRI A;  2LJI A;  3Q8B A;  2NTS A;  2E3T A;  2JX5 A;  3U52 E;  3VRA B;  2WXK A;  3AH7 A;  2XNA C;  5C3J B;  1XCQ L;  1J7C A;  5EE0 A;  1CJE A;  2BS4 B;  3PO0 A;  2WXJ A;  4N59 A;  4UDU C;  4RCO A;  5HI1 A;  3BYY B;  5HG2 A;  4D2K A;  1I4H A;  2K3U A;  3VRB B;  3NS1 A;  1HA5 A;  1XLO A;  2Y5C A;  3OWE B;  4KGT A;  1VRA B;  1QOA A;  1E6E B;  3MFG A;  4HKZ E;  5AUK A;  3Q8A A;  2J53 A;  4LK0 M;  5HFY A;  1DOI A;  3TEW A;  4TMA B;  5HHD G;  1GB1 A;  5H8Y E;  3AV8 A;  4WWM A;  1D5Z C;  1SBB B;  5EE3 A;  2BB5 A;  4LLG M;  1B1Z A;  1KH0 A;  2CJO A;  4REZ A;  1XXG A;  1TY0 A;  1F2R I;  2K9X A;  2KDM A;  4GLS C;  4N58 A;  4RH6 A;  4C7Y A;  1NYQ A;  4YTP B;  3AE8 B;  1TKE A;  2W54 A;  3BK2 A;  5FK9 C;  1HXY D;  2G9H D;  1JQ4 A;  5JXV A;  5BMI A;  1FMA D;  1JW9 D;  2ONQ A;  1L4Z B;  1F77 A;  1VZ6 A;  2H89 B;  1VLB A;  1XEE A;  2SAK A;  1HQR D;  2N7J A;  4L23 A;  1V1O A;  1HZ5 A;  1T3Q A;  2W82 A;  2J52 A;  2ZW0 A;  5BYQ A;  4B0E A;  1PFD A;  2DWQ A;  2IJ0 A;  4A8X C;  1XO3 A;  1YMH E;  1HEZ E;  3CWI A;  4XWT A;  1NI3 A;  3FIL A;  2DBY A;  2RDH A;  3TSS A;  1UGJ A;  4NZL B;  4YWG G;  3V05 A;  3W5U B;  2JWU A;  2ZW1 A;  1XLQ A;  2W3R A;  1PYW D;  1N5W A;  2MJ3 A;  4YXD B;  1V8C A;  2W55 A;  3N9Y C;  3TEY A;  1WXQ A;  2D5G A;  2K22 A;  5G5G A;  1GOZ A;  1BML C;  1P7F A;  1EU3 A;  1NYR A;  1WYG A;  2I38 A;  3KLS X;  1BUI C;  1FXI A;  2G1E A;  2WP9 B;  2L52 A;  4OVZ A;  1TS3 A;  4RFB A;  2Y5P A;  2HDE A;  3MP9 A;  3AE7 B;  3Q8E A;  1MPE A;  4WIP A;  4GDL B;  3AE2 B;  1RWS A;  1ZXI A;  2N9L A;  4J3O D;  2M0A A;  2N9K A;  2PKO A;  5H92 C;  2VZK B;  4OZB A;  3BWU D;  3FAH A;  2KWD A;  2JZP A;  1F2R C;  2BT6 A;  2RDG A;  1XLP A;  3DWM A;  1SB3 C;  1L6V A;  4YTN B;  4H2A A;  1HZ6 A;  1PGA A;  4EE2 A;  3RFZ B;  2FBW B;  2QSD A;  4HRO A;  1VZ8 A;  2V4I B;  3IT4 B;  1C77 A;  1FNW A;  1KFY B;  1EWC A;  3FIL B;  4ZHO A;  1YN5 A;  2BW2 A;  4RGM A;  2WDR B;  3NRZ A;  1QLB B;  4KGS A;  1PUT A;  3IAS 1;  1STE A;  5GXG B;  1OFF A;  3SFE B;  1DOY A;  3MJ5 A;  1K52 A;  1I7H A;  1OQQ A;  1UWX A;  2EEL A;  2H88 B;  4MT5 A;  4ZYS A;  3VR9 B;  1KLG D;  4JWU C;  4KGR A;  4A9A A;  2LHD A;  2SEB D;  1UUP A;  4FXC A;  1AYF A;  4TQ0 A;  1ZP0 B;  1FO4 A;  3VQI A;  1RFK A;  3BZD B;  4IDI A;  4Q2J A;  5BMG A;  5BYR A;  2BB6 A;  1JML A;  4IOI E;  3B9J A;  1YN3 A;  1ROE A;  1J7B A;  3L4P A;  3NZ3 A;  4ZRQ A;  3GB1 A;  4A6Q A;  2BTE A;  3AEE B;  1F0Z A;  2QEJ C;  1C79 A;  3AE4 B;  4YSX B;  3TEX A;  2I2Y A;  1ET6 A;  1JRO A;  2WXG A;  1C78 A;  3R2T A;  3P4R B;  1EM7 A;  4KKJ A;  3R8B A;  1YJJ A;  5I4D A;  3W9C B;  5FR3 A;  2INP E;  3BII D;  2V3N A;  4HEA 1;  3I57 A;  1FNU A;  1E0Z A;  3EUB 2;  2LGI A;  4JX1 C;  3NUH B;  4YT0 B;  2IGH A;  1L0X B;  1UWM A;  3ZJT A;  2WXO A;  1L0V B;  4MM3 B;  1N62 A;  2L32 A;  1QKZ A;  3AE3 B;  4HKQ A;  3Q8F A;  3H8H A;  2QJL A;  1WWT A;  1ET9 A;  1FEH A;  2WS3 B;  1C9F A;  2K5P A;  3O13 A;  1QT9 A;  2N0S B;  4M0W A;  3U4E G;  2PVO D;  2WU5 B;  5D3I B;  1E7P B;  3IT6 B;  4L1B A;  2BS2 B;  4HJG E;  4MH8 A;  4YSZ B;  2FE8 A;  1D6E C;  1MHX A;  4NAM A;  4A55 A;  1KLU D;  1VJK A;  3AE6 B;  1TKY A;  2V0G A;  1VDV A;  4YTM B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...