1GAQB

Crystal structure of the complex between ferredoxin and ferredoxin-nadp+ reductase
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
98
structure length
98
Chain Sequence
ATYNVKLITPEGEVELQVPDDVYILDQAEEDGIDLPYSCRAGSCSSCAGKVVSGSVDQSDQSYLDDGQIADGWVLTCHAYPTSDVVIETHKEEELTGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/electron transport
molecule keywords FERREDOXIN-NADP+ REDUCTASE
publication title Structure of the electron transfer complex between ferredoxin and ferredoxin-NADP(+) reductase.
pubmed doi rcsb
source organism Zea mays
total genus 10
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2000-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1gaqB00
2QIEB 1A70A 1FFVA 3AE8B 2HTME 1E0ZA 3AEGB 3ZYYX 1E7PB 1XLOA 2EKIA 1R7SA 2W55A 1JALA 2DBYA 3AECB 3AH7A 3BIID 4LTUA 1ZOYB 1PUTA 2WDQB 3DWMA 1CZPA 1YJJA 1RYJA 3AE6B 1J7CA 1IUEA 4IDIA 1SF0A 3B2GA 5EE1A 1B9RA 1NVID 2CJOA 3AEEB 1L5PA 4US8A 1E10A 1L0VB 1F0ZA 1OQQA 2ACZB 2PKOA 3RPFC 3VR9B 1GPXA 2OHFA 4YTMB 1NI3A 2BS3B 1WYGA 3DWGC 1FO4A 1FXAA 3AE5B 2BS2B 1GAQB 3AE9B 1ZUD2 4WQMA 1XLQA 3P4SB 2JQRB 3NVYA 1NYQA 4C7YA 1VLBA 4JWSC 1YJIA 1N61A 4YTPB 2MH7A 1N5XA 1N5WA 1ZP0B 3P4PB 5GXGB 1FMAD 4A9AA 1UWMA 3NVWA 2G1EA 3P4RB 1JW9D 5AUKA 1TJEA 3AE2B 1CJEA 1QLBB 1DOYA 3ABVB 1KFYB 2LEKA 2W3SA 3AEFB 1QOBA 2BS4B 2KAJA 1N60A 3WCQA 2Q5WD 1DGJA 3KWLA 1YQ4B 3PO0A 3AEDB 1DOIA 2L83A 3ETRA 4YSXB 1XLNA 2WDRB 1JQ4A 4HRSA 4YTNB 2BT6A 1VDVA 1N63A 4US9A 2JX5A 3SFDB 1I7HA 3B9JA 2MJEA 1FM0D 2WQYB 3W5UB 1VJKA 1FXIA 3NRZA 3P4QB 1OFFA 1SIJA 3NS1A 1ZXIA 4USAA 1ROEA 1FFUA 2N0SB 1KF6B 3AEAB 3SFEB 4ZOHC 1TYGB 3HRDD 2DWQA 5G5GA 3AMZA 2KMMA 3W5VB 1YQ3B 3VRAB 2K5PA 4YT0B 2W3RA 2M19A 3EUB2 1JWAD 3AEBB 1L6UA 3CIRB 3FC4A 1JRPA 2E3TA 1FRDA 5EE0A 5EE9A 2WP9B 5G5HA 3AM9A 1N62A 1QF6A 2WU2B 3AB5A 3B2FA 2AX5A 1EWYC 1XLPA 2Y5CA 1J7BA 1QOFA 2WDVB 3W9CB 1TKGA 2K22A 2MJDA 1PFDA 2M56B 3LXFA 3SR6A 4JX1C 4YXDB 1SB3C 2H88B 2WLBA 4YSYB 5AUIA 3VR8B 1WXQA 2QJLA 1DOXA 3AE1B 5MPOA 1NEKB 3AE7B 4YSZB 1E6EB 1NENB 1WRIA 2K9XA 2WS3B 3AN1A 4HROA 4C80A 1J7AA 5H92C 1QT9A 1T3QA 3AV8A 4C7ZA 4WWMA 1TKYA 2FBWB 3NVZA 1RWSA 1FRRA 3P1MA 4KX6B 5H8YE 1XO3A 2B76B 4N58A 4FXCA 3FAHA 5C2TB 3CWIA 4JWUC 3LB8C 2L52A 4P6VF 1JWBD 2PVGC 4N6EB 3HUIA 4N59A 3NVVA 2WU5B 4ZHOA 1V8CA 1FIQA 1JROA 3P63A 3VRBB 4ZHPA 1RM6C 1WWTA 1QOGA 1KRHA 3L4PA 2PIAA 2H89B 1WGKA 3HVZA 2PVOD 1PDXA 3AE4B 3AE3B 4ITKA 1OQRA 1RFKA 1AYFA 2MJ3A 1E9MA 2CJNA 5C3JB 1QOAA 5EE3A 1L6VA 1AWDA 1V97A 1NYRA 2CU3A 1TKEA 2W54A
chains in the Genus database with same CATH superfamily
1P9DU 2HTME 4EE2A 2DHZA 2EKIA 4D2KA 4A55A 3BVZA 4LJOB 3WAOA 5J17A 2R2QA 4HJKA 4M8MA 4GU2A 4HXDA 4GMVA 2PKOA 2OJWA 3PT2B 2OHFA 2G45B 2WYQA 2Z0EB 4EZJA 2IY1B 3DWGC 4FHKA 2MBEA 4BZAA 2BS2B 3H7PA 1TZ1A 2K3UA 5D3DA 1Q1OA 1FMAD 4OW0A 4RGMA 5HFYA 3AE2B 2LGYA 4B95A 3WCQA 2KMCA 3UQBA 1I4QA 5GMVA 3A4RA 3PHXB 1A5RA 2XEWA 3KYDD 3B9JA 1TGZB 2M8SA 5LXHA 3W5UB 1FXIA 1L0YB 1WZ0A 2KN5A 3A9KB 3H1UA 2ZCBA 3FILA 3T3NA 4KSLC 3V6EB 1D5ZC 3M3JA 3ZDMC 4NY0A 1L6UA 4NJCA 1YQBA 3AB5A 2KFJA 1Y8RC 1WM2A 3NG0A 2W82A 1J7BA 2DYOA 2WLBA 4YSYB 3L13A 1C79A 5CHVC 5IP4D 2KWUB 2KX0A 2PEAA 4YSZB 1E6EB 1NENB 2LD9A 3AV8A 3TIXA 2NVUI 1UWXA 2WXNA 1FRRA 1RRBA 3CWIA 2D11A 3B0AA 3Q3FA 3NVVA 4ZHPA 2G4DB 2WX0A 3ZUNA 5E6OA 3L4PA 1WX8A 2Y5PA 1X1MA 2LGXA 2D10A 2JU6X 3DVGY 1AWDA 4F1SA 3GZNB 1R7SA 4ANXA 2XK5B 4NAWB 2LI5A 4RNAA 2CU1A 5KHQA 4WAAA 3ML8A 3NZUA 4LLGM 1UGMA 4RMAA 3VQIA 4OZAA 1SBBB 3R7RA 2BYFA 3T8MA 3ZKJC 1JW9D 1KFYB 4MSQB 4G0NB 2KLCA 2L3ZA 2RMMA 4RFBA 1E5WA 4JIOU 1Q0WB 4KGTA 1LFDA 2J4XA 3B08A 2RDGA 3N9YC 1NI2A 3L16A 4L1BA 3R7QA 4KIKB 4P7IA 4AJYB 4YWGG 1UGJA 4MGYE 4WJNA 3W5VB 2KQ7A 2WWZA 4ACFA 3IHPC 3R66C 4II2B 4XE0A 1QF6A 4HDQA 5J18A 4EZLA 2Y5CA 2D3GA 3LXFA 2I1JA 3ZNGC 3MC0B 3DBHB 4S0RA 3HHMA 3ALBA 4XZ4A 2IJ0A 2L32A 1J7AA 3ZXRA 1WH3A 1SSNA 3DPDA 1RWSA 2BKFA 2M0XA 3OWEB 4OHJA 4N6EB 3TMPB 3WIMA 1RFAA 2WX1A 2X8XX 2DENB 3U52E 2PIAA 2H89B 2KWDA 2MA9B 3DBLI 1KOTA 3OAWA 2YLMA 1GUAB 1ZW7A 1HA5A 3ZNID 4TUUA 3W2DA 4TQ1A 1XF5L 1D5MC 4HKQA 3APDA 2JT4B 1NVID 2D3BA 3BY4B 3Q6BA 2DX5B 1YMHE 5IA7A 1FO4A 1GC7A 2K8CA 2C7HA 1ENFA 4CQNA 3P4SB 1ISNA 1STEA 4LK0M 1ZDXA 2G9HD 2K1FA 4A9AA 1YIWA 1HXYD 4H2AA 3T3OA 3JVZX 3ZRCA 4KDLB 3PO0A 1WGHA 3APCA 4JLCA 1LXDA 4E74A 1GC6A 2KDEB 1UH6A 3P4QB 1F2RI 1SIJA 4ZRPA 4C56C 3WA0A 1I4HA 3GB1A 2JSVX 3ZRFA 5FR6A 3KUCB 3ZJVA 2AQ1B 3WANA 1C4AA 2DYBA 3LJ3A 1EWYC 1XLPA 3OG5A 4LNIA 3M62B 4JX1C 4YXDB 2KACA 2QILA 2LGIA 2BB6A 5AUIA 2DLBA 4NAMA 2BKRB 3AU5A 3K9PB 2JWZA 1WJ6A 2ZW0A 4EEWA 4C7ZA 1CQVA 2RSUA 4N58A 2B76B 3FAHA 4OVUA 2QSDA 2IBIB 2WU5B 4NAWA 3W1SA 2GMIC 1KRHA 2L00B 2KX3A 3X0WA 3BYTB 4TQ0A 3N30A 2MJ3A 1V2YA 4IKGA 2AEHA 3ZXVA 4BAXA 3DHIC 4RF1A 3PRMB 5BMGA 4HLEA 2GBNA 3ZTCA 3RT3B 2KJRA 1P7EA 4C7YA 1WJNA 2INCC 1XLOA 4LTUA 2MBQA 4HCPB 1FEHA 2KDFB 3PTFC 3PZ7A 2L76A 1WI0A 5KHOA 3VR9B 2WGSA 2WXIA 1WR6E 3BINA 4LCDE 3HIZA 3P42A 1WYWB 1UD7A 4NQLB 3RNFC 3MJWA 4KIKA 2G1EA 3PSEB 1QLBB 1DGJA 3QWZB 2GBJA 1FNUA 2W9NA 4XC2A 3A9JB 3KYCD 2MRPA 2I1KA 3BWUD 1MJDA 3PV1A 1IPGA 3C19A 1FFUA 3SD5A 4KDIC 2WXHA 2INDC 3QARA 1C1YB 3AMZA 2R61A 4YT0B 3NOBA 3LDZE 1V80A 5EE0A 1E90A 3DBLB 4TMAB 3CSFA 2SAKA 3H8HA 2WXKA 2BYVE 5AZFA 1OGWA 4MSMB 2IGGA 1VCBA 4I6LB 4RH6A 2PMVA 1QOGA 1L4DB 3TSSA 5TSSA 2M17A 2BVCA 1TT5B 2ZW1A 3AXCA 1JWMD 2DAJA 1E9MA 3PREA 3RFZB 1NYRA 4DXGA 1I4RA 2FCQA 2XNAC 3UINB 2KANA 3GOEA 2LXAA 3DBSA 1BT0A 2KJ6A 4AJWA 1L0VB 1GPXA 1OQQA 4AS1A 2BS3B 4PT5A 2FNJB 2Y3AA 3AE9B 1GAQB 4WQMA 4MGIE 3P2BA 1N61A 1V1PB 1GG3A 3VDZA 3VH3B 1C78A 3RNGC 3RNCC 2PPHA 2C60A 1JRUA 4EUTA 2MX2A 5DCNA 3N1ZC 2D3CA 2KHWB 3PRZA 3R8BA 2L83A 1UBQA 4K3BA 5HHDG 1I7HA 4RGTA 2WHIA 1SJHD 4B0MA 2N0SB 4ZRIA 2Z59B 4MT5A 2VZKD 3IFWB 4WJPA 2IO1B 3VTUA 3ZW3A 2IYDB 2KVZA 2HJ8A 2PE6B 3NY5A 1WSPA 1JWAD 2B3AA 3Q14C 1YN5A 1BMLC 4EZKA 1Q10A 1QOFA 5AZHA 3MC9A 1DOXA 4DDGD 2BB5A 2JF5A 4HCNB 3NS8A 1R4MB 2I2YA 2PVGC 4XDDA 2RPQA 1JROA 4CO7A 1GB4A 5JH5C 3M63B 4ARIA 1JWSD 1UBIA 1HE8A 1FNVA 1WGKA 2Z8LA 4M8NA 1AYFA 3O65B 1MHXA 2JYEA 4OVZA 2AYOB 3RZWC 3UF8A 2M4NA 4X57B 4AQ7A 3OJ4B 1VRAB 1FCLA 2MSED 2N9KA 2YEPF 3BK2A 2ZNVB 4JE3B 3LYYA 4YTMB 2N1WA 3A9JA 2C7MB 1WF9A 1YX6B 1XLQA 4FHJA 5JXVA 1AARA 1ZKHA 2J52A 3OJ3A 4IW0A 1N5XA 1UWMA 2QCZA 3PLVA 4IC7B 4BBNF 1XEEA 4MH8A 2LEKA 4GGQA 3PZ8A 4GN1A 4ANVA 3EFUA 3VTWA 2L0TA 2G4SA 4HRSA 4GLSC 2MHJA 3SHQA 1D4BA 1MHHE 1S3SG 3TEZA 5G5GA 3KQ4A 4P1BC 4HDOA 3RYTA 3T9LA 4DXFA 3Q3JA 2WP9B 1I35A 3IT4B 1F1HA 4G11A 3TCAA 4WQOB 2N9LA 4L2YA 4WH4A 4FADA 3PS6A 5MPOA 2RDBC 3TUOA 3BK1A 4DDID 2V3SA 1J19A 3L17A 1SE3A 3A1QB 3P1MA 4A20A 1Z5SB 2ASQA 1V8CA 3GP7A 2KOXA 2WXLA 2OEDA 2HE7A 3TEWA 3R3MA 2BQQA 1T5XD 5BYSA 1TKEA 2QIEB 2K6QA 3AEGB 3EC8A 4B0EA 3BIID 1V1PA 3DWMA 1SF0A 4US8A 2ICIA 2KVRA 4JGHB 1K53A 1AN8A 4W9EA 1T0SC 3QJZA 4JWSC 1WE7A 2O2VB 4A6QA 1R4NB 1CJEA 2INNE 1WM3A 4GB9A 2ZNVC 2IPKD 2JPHA 4C4VB 2BYTA 2Z0DB 4R3DA 4PYZA 1KLVA 1FM0D 2NTTA 1VJKA 3NRZA 1OFFA 1ZXIA 1OEYA 1ROEA 2BBCA 3N32A 4ZOHC 2INPE 2GLSA 2ZVNA 4I6PA 1F77A 3EA6A 4E3CA 3HVDA 1YQ3B 4GDLB 2W3RA 2M19A 2FE8A 4XWTA 1L7YA 1TS4A 4WAFA 3RD2A 2WXRA 4EKUA 5J2RA 2VH2A 4JL9A 4ASWC 3DOWA 2LGDA 2JZZA 3PRPB 3RI7C 1V1OA 4BFRA 4KKJA 1L2NA 1WXSA 1V5OA 4ANWA 5H92C 1XCTL 3S2AA 1K8RB 3EECA 4FXCA 2JXTA 4KVGB 1FNWA 1HTOA 3HUIA 1I4XA 1ET6A 2O6VD 2LJ5A 1ZXHA 2CHWA 4LNOA 5C3JB 5CHWA 3U4EG 4BKSD 4A3OA 2C7NB 2W54A 4EOYA 1LGRA 3NZSA 3P63A 4IM0A 4J3OD 5HG2A 1CZPA 1Y56A 1TTNA 4DQOC 5LXIB 2VH1A 5DPSA 5HI1A 5DPRA 3VUYA 1FXAA 2K8HA 2PLPA 1WGRA 1NYQA 5GXGB 1TJEA 3L0WB 2PE9A 2HD5B 3ABVB 1DOYA 1VR9A 2LVPA 2LVQA 2WDTB 2LMCA 2LASA 1ZGUB 4PYUA 1DOIA 1SJED 3CMMB 1MPEA 2OOBB 1V49A 1SIFA 4USAA 1KF6B 4CHKA 2WXGA 2DWQA 2KMMA 4ZRJA 3A9KA 4URKA 2GI9A 3ONSA 3W1SC 1KJTA 3NJTA 3A1QA 4FN2A 2O6VB 3MJ5A 4PK1A 2AX5A 5AZGA 1TBEA 1WFYA 2N7EA 2SEBD 1GB1A 5CX3A 3DVNU 4OZBA 2L1AA 2LHDA 2KKCA 3V3XA 4IG7B 1L4ZB 1QT9A 3U7ZA 2R2OA 1WGGA 2JRHA 1VZ6A 2N7JA 3M95A 4JWUC 3LB8C 4HPMB 2RPVA 2K8BA 4OZCA 2ZPNA 4A3PA 2DAFA 4FA6A 1LQBA 2GBKA 5D2MB 5D7GA 1OQRA 2CJNA 1QOAA 4KGSA 5LLIA 2N4FA 1I42A 1EU3A 1H4RA 3PGEA 3JYUA 3ZYYX 1JALA 2O2VA 1PUTA 1U4AA 5BMIA 2WDQB 2WXOA 3AE6B 1RYJA 2MP2B 2ONQA 3QAQA 2XK5A 2CJOA 3Q8AA 3RPFC 3JSVB 3GE8C 3K9OB 2BGFA 2BYEA 1EO6A 3DVNV 3Q69A 1WMHB 4C4VA 1ZUD2 3C8YA 4TV3A 2MH7A 1N5WA 4XYCA 3A33B 2KDMA 5CTRC 1WXVA 1HZ6A 3IAS1 4GDLA 2LUEA 4M0WB 4S17A 4PS7A 2KT7A 2A4ZA 4FJZA 2KC2A 2YVCA 1WX9A 1HEZE 4K7SA 1TY2A 5D3IB 4RF0A 2LVOA 3HRDD 2JY6A 3BZDB 2QEJC 4HVBA 1ET9A 1V5TA 1YNTE 2J0JA 2WNMA 3CIRB 3NZ3A 4JQWC 3VTVA 5E6PA 2WU2B 2KWCA 4K81A 4P16A 3PPAA 3Q2AC 1TS5A 2ZVOA 2BWFA 5IKCM 1HQRD 1WXQA 2V4IB 3Q8EA 2MLBA 3AE1B 2HDEA 1WRIA 4BKGA 4RGOS 2IO2B 4W9DA 2XN9C 1HTQA 5H8YE 3ZDTA 4P6VF 1RAXA 2NS5A 4W9KA 3TL5A 1WR1A 1SEBD 3KVFB 3KLSX 1KTKA 1LM8B 2UWQA 3Q8FA 3SFEB 1WX7A 2CR5A 2LUMA 4MM3B 2KJHB 3R2IA 2JZ3B 2DBYA 4BBNC 2LZ6A 4REZA 4ICVA 2J7QB 1LO5D 3ML9A 2CHXA 4IDIA 1B9RA 3HM3A 5IO9A 5BMHA 1TZOA 1NI3A 2IO0B 1IGCA 4M02A 2V1YA 4W9FA 4NNJB 3AI5A 3B1LX 4ZDVA 1WY8A 1QZEA 1SE2A 2MQJA 3ZIMA 2AL3A 3J9CA 1UZXB 3N20C 2FIDA 5I4DA 3RCZA 1XT9B 2EELA 1GNUA 3ZNZB 3JW0X 2I38A 2WDRB 4KV2A 4IM2A 1MG8A 2BPSA 2O6VA 4US9A 4IUMB 2CKHB 3Q3NC 1YOVB 4AP4C 1SGHA 1CK1A 2NTSA 3TEYA 4BKSA 1EUVB 4DHJD 1E8WA 4DXAB 3AEBB 3FC4A 1G6JA 3QA8A 4MJSB 4NPNA 2FUG1 3QHTA 1VD2A 2GBMA 1I4GA 1SB3C 4A8XC 1E8YA 1V81A 2KXJA 3AN1A 5CHFA 2V0GA 1FD6A 3V05A 1TKYA 1KLGD 1YN3A 2LWPA 4FLHA 5TR5A 3WAMA 2XBBC 4N59A 4LNFA 4ZHOA 3KH0A 1F52A 2DZKA 2MP2A 4NJ7A 3JSVA 2PVOD 2KTRB 4IWPA 1WMHA 3X23A 2REXA 1Q5WB 4GIVA 3IXSA 4I6NB 4TSSA 1PGAA 3D32A 3VVWB 4N9F4 2D2QA 1MFWA 1WZ3A 3KW5B 4PS3A 3IBEA 1Z2MA 1IUEA 2LXCA 5DPWA 4LJPB 3I63C 4GSWA 5DPTA 5HKHA 4M0WA 3ZJTA 3PVLA 4LDTD 4DHJB 4FBJB 1C77A 1M4VA 3P4PB 4W9LA 1ZE3D 1HZ5A 3H9DA 4G3XB 4K3CA 1QOBA 1YQ4B 2LRUA 5E6JA 3VAWA 4MGZE 4XGAB 1XLNA 4WWOA 1T0QC 1ZDVA 4L23A 1VDVA 2KO3A 2GB1A 1S1QB 3ZQ4A 2M1MA 3EHVA 2KNBA 1FCCC 2EMTA 1QKZA 2HJ1A 3AEAB 4XWWA 2HTHA 1EWCA 3TEXA 1XCQL 1MI0A 2DYMA 2KWVB 3DCGA 5FKAC 4KZCA 3VRAB 3URYA 1JRPA 4KKIA 1C76A 2AQ3B 4E71A 3KUDB 5L83A 2RGFA 1WXAA 3W9CB 1TKGA 2M56B 4W9JA 1K50A 1TY0A 3NHEB 3E56A 3QK0A 5IAAC 3RUIB 2KDIA 2BW2A 2C9WB 3DBHI 1TIFA 4MM3A 2ZPYA 3RNEC 2N9PC 5C2TB 4M00A 2C5LC 4EFOA 4F8CB 2WXFA 2D5GA 2J0KA 5IN7A 4PS8A 4F7ZA 1KH0A 4LDTB 2NBVB 2J42A 3ENEA 1KM7A 2UU7A 1D3ZA 2AL6A 3AE8B 1E0ZA 2MCNB 3MP9A 3O13A 1OQYA 3CSTA 2ON8A 2LFIA 5EE1A 1E10A 3MHSD 4AOFA 1WJUA 1SE9A 1WE6A 5G55A 4WJQA 3QIJA 3C0RB 5BO4B 3NVYA 2MW5A 3R2TA 4UDUC 3DBRI 3WALA 4OVVA 4RM8A 1JMLA 3U2SC 3ZVVA 1C3TA 2L0FA 3V61A 2CS4A 2WXPA 1P7FA 2IY0B 2JVCA 4J6IA 1JCKB 1ACCA 1N63A 4IWQA 2MJEA 4MJSA 2D07B 2N1VA 2FCNA 2RD0A 4II3B 4RM9A 3U8ZA 4ZRKA 1WXMA 3PZDA 4IM3A 4WJOA 4MEMA 4TKNA 4MGKE 4GDKB 5G5HA 2E3TA 3MHZA 3I9V1 1PYWD 2Y5BB 4WURA 3WAPA 1FXTB 2K22A 1PFDA 2JXXA 3I3TB 3SR6A 2L8JA 2IGDA 3QQ8B 3AE7B 2KTRA 2WS3B 3QC8B 1KLUD 3NVZA 2NMQA 1XO3A 2M0AA 2PW9A 4MACA 1C4PA 2MBHA 3VUWA 1RM6C 3Q3MC 2NR2A 4XDCA 1E7VA 1DYQA 1QILA 5FR3A 1PDXA 4RCOA 3GS2A 1L6VA 1TS2A 1SXTA 2TSSA 4DHZE 4IWOA 2LHEA 2JRIB 3AECB 3VXWA 2EKEC 3VHTC 1YJJA 5C1ZA 1J7CA 1BXTA 1L5PA 2ACZB 1WRDB 2MEKA 3ECIA 1YN4A 1T0YA 2J0MA 2JYTA 3Q8BA 3P4RB 3UGBB 3APFA 3AEFB 2BS4B 2GRIA 4YSXB 2VRRB 4YTNB 2BT6A 4DK5A 2KYWA 2KFKB 2A5UA 1H8CA 3ZNHB 1UUPA 3L54A 4ZYNA 1K52A 2J53A 4FJVB 5BYQA 1AW7A 2KK8A 4JPSA 4BOZB 2N9XA 3E9SA 4YL8A 3IVFA 1PGXA 1XXGA 2K9XA 3PLUA 4C80A 1GOZA 3OLMD 2QC8A 1IGDA 1MG4A 3U7DA 3TBLD 2K25A 2WXMA 3I5JC 2PJHA 3I57A 5JHBA 3DBRB 3HVZA 3AE3B 4ITKA 1RFKA 3RN9C 1V97A 4GOCA 1JQ4A 2MBOA 3KWVA 1FFVA 3VFKA 2W55A 4FULA 1ZOYB 3AU4A 2YEPB 3AULA 4B6WA 4WIPA 4M01A 2NBWB 4HWIB 2N7DA 2V4LA 3RNBC 2GOWA 2IDYA 3AE5B 2ZEQA 2BTEA 2LGSA 4HPLB 4CYEA 3FKYA 2L7RA 2ZZPB 3UQAA 1T6BX 2E6XA 1ESFA 1XQQA 2NPTB 2D3AA 2Q5WD 3KWLA 1NBFC 3HM6X 4LNNA 1OEYJ 3W1YA 3ETRA 4GDKA 4BVUC 3CF6E 2NBUA 3QCAA 1EM7A 2JX5A 1P3QU 4B9KA 2WQYB 3IG3A 2JWUA 2QHOA 4DBGA 3TJPA 4HEA1 3RMKC 4LNKA 2K0PA 5JHAA 4AUQC 3MTNB 2KMAA 2K5PA 2RR9A 1B1ZA 5EE9A 1YJ1A 1GJZA 3IAM1 5EDSA 5G2NA 3MFGA 1P1AA 1IYFA 2MBBB 2WDVB 3GE3C 3EFCA 2KD0A 2MWSB 2H88B 1NEKB 2RDHA 1WIAA 4ICUA 2DNFA 2FBWB 3L10B 4KGRA 4DWFA 2L05A 2LRWA 1R4MI 3VRBB 2WXJA 4RGNA 2KZRA 4GXBA 5IOIA 4AWJA 3AE4B 3DVGX 1TS3A 2AQ2B 3H7SA 1C4CA 2CU3A 1WJ4A 4K1RB 4P1CC 3SEBA 1IP9A 1PGBA 5T8IA 4W9HA 5AEKB 4QAYA 1FPYA 1IBXB 1P98A 3SU8X 2QMTA 3SDLC 2V3PA 5E6NA 1J0GA 1WYGA 4HK2A 2K6DB 2JQRB 2KQSA 1V6EA 1XD3B 1YJIA 4YTPB 3KUZA 2KFKA 3NVWA 4G50A 2DZMA 3VH4B 1N6ZA 1N60A 1L0XB 2IO3B 1MVKA 3AEDB 1RLFA 2ZJDA 1J8CA 2V3NA 3H7PB 2DZIA 3EGRA 4W9IA 4C00A 2G3QB 3RULA 1E8XA 2AWTA 4Q2JA 3ZTDA 3QX1A 1OTRB 1YD8U 3Q8CA 1EU4A 1E7UA 4K7UA 3ZJUA 3MC8A 5JZEB 3N3KB 3B2FA 4DHZB 1QQRA 2MJDA 1CMXB 3FILB 3VR8B 2DZJA 3PHWB 3L08A 4HPPA 2V9HA 2CHZA 2X38A 4HROA 3V62A 1P0RA 3VUXA 4WWMA 4KX6B 2N9EB 2PTLA 4KZ0A 2L52A 2IGHA 4W9GA 3UIOB 1M94A 1FIQA 3DQVA 2JUOA 3RZFA 1UELA 4ZRQA 3A4SC 4MELA 2LJIA 4ZYSA 1SE4A 1VZ8A 5EE3A 2FUHB 3H6NA 1A70A 4NZLB 4WWPA 2KDBA 3BVGA 1E7PB 3U30A 3AH7A 3NUHB 3DDCB 4WWNA 1D5XC 2NPTA 2KQ4X 3B2GA 1F0ZA 3AEEB 3UI3A 1PQSA 1V86A 2WXQA 3ZO5B 1VZ7A 5D6JB 1JWUD 1VLBA 3HK0A 1ZP0B 5L95C 1NDDA 5AUKA 2QDFA 4ANUA 4HJGE 1WGDA 2W3SA 2KAJA 3BYYB 3ZLZA 1EF5A 1R4NI 3DHGC 2EMSA 2GBRA 3GZNI 1K51A 4ARCA 1F9JA 3BVMA 4MDKE 3SFDB 2OJRA 2FAZA 3V6CB 3Q3OC 3NS1A 1I4PA 4O1NA 1WGYA 1UF0A 1T0RC 1TYGB 4XX5A 4W9CA 1BUIC 3DHHC 1YX5B 5FK9C 3EUB2 1EF1A 4A90A 2KN4A 1FRDA 1UNSA 4NQKE 3AM9A 1N62A 1D6EC 2BWES 5BYRA 4K7WA 4HKZE 1E8ZA 2FCMA 4BOSC 2KTFA 2KLGA 2QJLA 1ZPSA 3N1XC 2BF8B 5D94A 1T3QA 2UYZB 2IZVB 2NCNA 1C9FA 1V9JA 1JWBD 4MH0E 2JZPA 5LNK1 4NJ6A 3IT6B 2FIFA 1F2RC 1WWTA 2K39A 4IOIE 4BKTA 5C23A 1IBXA 3N1YC 2VZKB 4KSKC 3V60A 2ZCCA 3UIPB 3RNAC 2FCSA 2KC1A 4FJYA 3ZGZA
chains in the Genus database with same CATH topology
1TS2A 1SXTA 2TSSA 2HTME 2XNAC 3ZYYX 4EE2A 2EKIA 1JALA 2LHEA 3AECB 4A55A 4D2KA 3BVZA 1PUTA 5BMIA 2WDQB 2WXOA 1YJJA 1RYJA 3AE6B 1J7CA 2ONQA 1BXTA 2CJOA 1L5PA 3Q8AA 1L0VB 1GPXA 1OQQA 2ACZB 2PKOA 3RPFC 2MEKA 2OHFA 4AS1A 2BS3B 4PT5A 3DWGC 1YN4A 3Q69A 2Y3AA 2BS2B 1GAQB 3AE9B 1ZUD2 4WQMA 2JYTA 3C8YA 2K3UA 5D3DA 1N61A 2MH7A 1N5WA 1V1PB 1FMAD 3Q8BA 4OW0A 4RGMA 3P4RB 1C78A 2KDMA 5HFYA 3AE2B 3AEFB 2BS4B 3WCQA 1HZ6A 2GRIA 3R8BA 3IAS1 2L83A 1I4QA 4YSXB 4YTNB 5HHDG 2BT6A 1I7HA 3B9JA 3W5UB 1FXIA 1L0YB 4RGTA 1HEZE 1SJHD 5D3IB 1TY2A 2N0SB 4B0MA 4MT5A 2VZKD 4RF0A 3FILA 3T3NA 1UUPA 3HRDD 1D5ZC 3BZDB 2QEJC 1ET9A 1K52A 1YNTE 1WSPA 1JWAD 1L6UA 2J53A 2WNMA 3CIRB 3NZ3A 4NJCA 5BYQA 1AW7A 1YN5A 1BMLC 2WU2B 3AB5A 4P16A 4JPSA 2W82A 1J7BA 1Q10A 1QOFA 1TS5A 2DYOA 3E9SA 2WLBA 4YSYB 1C79A 1HQRD 1WXQA 2V4IB 3Q8EA 1DOXA 1PGXA 3AE1B 1XXGA 2BB5A 4YSZB 1E6EB 2HDEA 1NENB 1WRIA 2K9XA 4C80A 4RGOS 3AV8A 1UWXA 2WXNA 2XN9C 1FRRA 1GOZA 5H8YE 2I2YA 3CWIA 1IGDA 4P6VF 2PVGC 4XDDA 3NVVA 4ZHPA 1JROA 1SEBD 1GB4A 2WXMA 3L4PA 4ARIA 3KLSX 3I57A 1KTKA 2Y5PA 1JWSD 1FNVA 1WGKA 3Q8FA 3HVZA 2Z8LA 3SFEB 3AE3B 4ITKA 1RFKA 1AYFA 1MHXA 2JU6X 1AWDA 2JYEA 1V97A 4OVZA 2LUMA 4MM3B 1JQ4A 3KWVA 1FFVA 3R2IA 2W55A 1R7SA 4AQ7A 2DBYA 4REZA 1ZOYB 4NAWB 1VRAB 2YEPB 1LO5D 1FCLA 2N9KA 2YEPF 3BK2A 4RNAA 4WIPA 4IDIA 1B9RA 4JE3B 3LYYA 5BMHA 4YTMB 1TZOA 1NI3A 1IGCA 2IDYA 4LLGM 3AE5B 2BTEA 3VQIA 1XLQA 4OZAA 5JXVA 2J52A 1SBBB 1N5XA 1UWMA 1SE2A 1T6BX 1JW9D 2E6XA 1ESFA 1XEEA 3J9CA 1KFYB 2LEKA 4MH8A 2RMMA 2Q5WD 3KWLA 4RFBA 2EELA 3PZ8A 5I4DA 4KGTA 2I38A 3ETRA 2WDRB 2J4XA 4HRSA 2RDGA 3N9YC 1EM7A 4US9A 2JX5A 4GLSC 2WQYB 4L1BA 2JWUA 1D4BA 1CK1A 1MHHE 4HEA1 3TEZA 2NTSA 3TEYA 2K0PA 4YWGG 5G5GA 3KQ4A 1UGJA 3W5VB 2K5PA 3AEBB 3FC4A 1B1ZA 5EE9A 4DXFA 2WP9B 3IAM1 3IT4B 4XE0A 1QF6A 3MFGA 2Y5CA 2FUG1 2WDVB 2N9LA 4L2YA 3LXFA 4WH4A 3MC0B 1I4GA 1SB3C 2H88B 4A8XC 5MPOA 1NEKB 2RDHA 3TUOA 3BK1A 2IJ0A 3AN1A 2V0GA 2L32A 1J7AA 1FD6A 1SSNA 1SE3A 3V05A 1TKYA 1KLGD 1YN3A 1RWSA 2FBWB 3P1MA 4KGRA 3OWEB 4OHJA 4N6EB 4N59A 4ZHOA 1V8CA 3VRBB 3GP7A 2WXJA 3U52E 2WXLA 4RGNA 2OEDA 2PIAA 2H89B 2PVOD 3AE4B 3TEWA 2KWDA 1T5XD 1TS3A 5BYSA 2AQ2B 2CU3A 1C4CA 1TKEA 2QIEB 3SEBA 1HA5A 3IXSA 1PGBA 3AEGB 4TSSA 5T8IA 4B0EA 3BIID 4TQ1A 3W2DA 1PGAA 1XF5L 1D5MC 1V1PA 4HKQA 3DWMA 1IUEA 1SF0A 1NVID 4US8A 2ICIA 1IBXB 2QMTA 1YMHE 2V3PA 1WYGA 4M0WA 1FO4A 1K53A 1AN8A 3ZJTA 4CQNA 1ENFA 3P4SB 2JQRB 4JWSC 1STEA 1C77A 1M4VA 1YJIA 1ZDXA 2G9HD 4LK0M 3P4PB 4YTPB 4A9AA 1ZE3D 1HZ5A 3NVWA 4A6QA 1HXYD 4H2AA 3T3OA 1CJEA 2INNE 1QOBA 1N60A 1L0XB 1YQ4B 3PO0A 1MVKA 3AEDB 5E6JA 1XLNA 2IPKD 2V3NA 1ZDVA 4L23A 1VDVA 3EGRA 2BYTA 4R3DA 2GB1A 1FM0D 3ZQ4A 2NTTA 1VJKA 3NRZA 1F2RI 3P4QB 1OFFA 1SIJA 4Q2JA 1ZXIA 4ZRPA 1FCCC 1ROEA 2BBCA 1QKZA 3AEAB 3Q8CA 4XWWA 4C56C 4ZOHC 2INPE 1EU4A 1EWCA 3TEXA 1XCQL 1I4HA 1MI0A 2DYMA 2JSVX 3GB1A 1F77A 3EA6A 3HVDA 5FKAC 1YQ3B 2AQ1B 4GDLB 3VRAB 3ZJVA 2W3RA 2M19A 3URYA 2FE8A 3ZJUA 4XWTA 1TS4A 1JRPA 4WAFA 2WXRA 4KKIA 1C76A 2AQ3B 1C4AA 3B2FA 1EWYC 1XLPA 1QQRA 3W9CB 1TKGA 2MJDA 2M56B 4JX1C 4YXDB 2KACA 2QILA 3FILB 1K50A 2LGIA 1TY0A 2BB6A 5AUIA 3VR8B 3E56A 2DLBA 4NAMA 1V1OA 2X38A 4KKJA 4HROA 2BW2A 5H92C 1XCTL 2ZW0A 4C7ZA 4WWMA 1CQVA 4KX6B 4N58A 2B76B 4FXCA 3FAHA 5C2TB 2PTLA 2L52A 2JXTA 2IGHA 2QSDA 1FNWA 3HUIA 1I4XA 1ET6A 2WU5B 3W1SA 1FIQA 1KRHA 2WXFA 2D5GA 4ZRQA 1ZXHA 3BYTB 4TQ0A 2LJIA 1KH0A 4ZYSA 1SE4A 1VZ8A 2MJ3A 4IKGA 2J42A 5C3JB 5EE3A 3U4EG 4RF1A 5BMGA 2W54A 1A70A 1P7EA 3AE8B 4NZLB 3BVGA 4C7YA 1E0ZA 1E7PB 1XLOA 3P63A 4LTUA 3AH7A 3MP9A 3NUHB 4J3OD 1FEHA 1D5XC 3O13A 5HG2A 1CZPA 1Y56A 2ON8A 3PZ7A 2KQ4X 2LFIA 3B2GA 5EE1A 3AEEB 4DQOC 1E10A 1F0ZA 3UI3A 5HI1A 3VR9B 2WXQA 2WXIA 1VZ7A 1FXAA 2PLPA 1JWUD 3NVYA 1NYQA 3R2TA 1VLBA 3P42A 4UDUC 5GXGB 1ZP0B 2G1EA 5AUKA 1TJEA 1QLBB 1JMLA 3ABVB 4HJGE 3U2SC 1VR9A 2W3SA 1DOYA 2KAJA 3BYYB 2LMCA 1DGJA 1FNUA 1P7FA 2WXPA 1DOIA 1K51A 1SJED 4ARCA 3BVMA 1JCKB 1MPEA 1ACCA 1N63A 3SFDB 3BWUD 2MJEA 3NS1A 4USAA 1I4PA 1FFUA 4O1NA 2WXHA 1KF6B 1TYGB 2WXGA 2DWQA 1BUIC 3AMZA 2KMMA 2R61A 2GI9A 4YT0B 5FK9C 3EUB2 4A90A 2KN4A 4GDKB 5G5HA 2E3TA 1FRDA 1UNSA 3MHZA 5EE0A 3AM9A 3MJ5A 3I9V1 1N62A 1D6EC 1PYWD 5BYRA 2AX5A 4WURA 4TMAB 2SEBD 4HKZE 2SAKA 2K22A 1PFDA 3SR6A 3H8HA 1GB1A 2QJLA 2WXKA 2IGDA 1ZPSA 3AE7B 4OZBA 2L1AA 2LHDA 2WS3B 3V3XA 1L4ZB 1QT9A 1T3QA 3U7ZA 1KLUD 3NVZA 2IGGA 2NMQA 1VZ6A 1XO3A 2N7JA 2M0AA 1C9FA 2PW9A 3LB8C 4JWUC 1JWBD 4MACA 2JZPA 4RH6A 1C4PA 5LNK1 3IT6B 2RPVA 1RM6C 2PMVA 1F2RC 1QOGA 1WWTA 1L4DB 4OZCA 3TSSA 4XDCA 4IOIE 5TSSA 1DYQA 1IBXA 1QILA 2VZKB 2ZW1A 5D7GA 5FR3A 1PDXA 1JWMD 1OQRA 4RCOA 1E9MA 2CJNA 3GS2A 1QOAA 4KGSA 1L6VA 3RFZB 1EU3A 1NYRA 4DXGA 1I4RA 3ZGZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QIE B;  1A70 A;  1FFV A;  3AE8 B;  2HTM E;  1E0Z A;  3AEG B;  3ZYY X;  1E7P B;  1XLO A;  2EKI A;  1R7S A;  2W55 A;  1JAL A;  2DBY A;  3AEC B;  3AH7 A;  3BII D;  4LTU A;  1ZOY B;  1PUT A;  2WDQ B;  3DWM A;  1CZP A;  1YJJ A;  1RYJ A;  3AE6 B;  1J7C A;  1IUE A;  4IDI A;  1SF0 A;  3B2G A;  5EE1 A;  1B9R A;  1NVI D;  2CJO A;  3AEE B;  1L5P A;  4US8 A;  1E10 A;  1L0V B;  1F0Z A;  1OQQ A;  2ACZ B;  2PKO A;  3RPF C;  3VR9 B;  1GPX A;  2OHF A;  4YTM B;  1NI3 A;  2BS3 B;  1WYG A;  3DWG C;  1FO4 A;  1FXA A;  3AE5 B;  2BS2 B;  1GAQ B;  3AE9 B;  1ZUD 2;  4WQM A;  1XLQ A;  3P4S B;  2JQR B;  3NVY A;  1NYQ A;  4C7Y A;  1VLB A;  4JWS C;  1YJI A;  1N61 A;  4YTP B;  2MH7 A;  1N5X A;  1N5W A;  1ZP0 B;  3P4P B;  5GXG B;  1FMA D;  4A9A A;  1UWM A;  3NVW A;  2G1E A;  3P4R B;  1JW9 D;  5AUK A;  1TJE A;  3AE2 B;  1CJE A;  1QLB B;  1DOY A;  3ABV B;  1KFY B;  2LEK A;  2W3S A;  3AEF B;  1QOB A;  2BS4 B;  2KAJ A;  1N60 A;  3WCQ A;  2Q5W D;  1DGJ A;  3KWL A;  1YQ4 B;  3PO0 A;  3AED B;  1DOI A;  2L83 A;  3ETR A;  4YSX B;  1XLN A;  2WDR B;  1JQ4 A;  4HRS A;  4YTN B;  2BT6 A;  1VDV A;  1N63 A;  4US9 A;  2JX5 A;  3SFD B;  1I7H A;  3B9J A;  2MJE A;  1FM0 D;  2WQY B;  3W5U B;  1VJK A;  1FXI A;  3NRZ A;  3P4Q B;  1OFF A;  1SIJ A;  3NS1 A;  1ZXI A;  4USA A;  1ROE A;  1FFU A;  2N0S B;  1KF6 B;  3AEA B;  3SFE B;  4ZOH C;  1TYG B;  3HRD D;  2DWQ A;  5G5G A;  3AMZ A;  2KMM A;  3W5V B;  1YQ3 B;  3VRA B;  2K5P A;  4YT0 B;  2W3R A;  2M19 A;  3EUB 2;  1JWA D;  3AEB B;  1L6U A;  3CIR B;  3FC4 A;  1JRP A;  2E3T A;  1FRD A;  5EE0 A;  5EE9 A;  2WP9 B;  5G5H A;  3AM9 A;  1N62 A;  1QF6 A;  2WU2 B;  3AB5 A;  3B2F A;  2AX5 A;  1EWY C;  1XLP A;  2Y5C A;  1J7B A;  1QOF A;  2WDV B;  3W9C B;  1TKG A;  2K22 A;  2MJD A;  1PFD A;  2M56 B;  3LXF A;  3SR6 A;  4JX1 C;  4YXD B;  1SB3 C;  2H88 B;  2WLB A;  4YSY B;  5AUI A;  3VR8 B;  1WXQ A;  2QJL A;  1DOX A;  3AE1 B;  5MPO A;  1NEK B;  3AE7 B;  4YSZ B;  1E6E B;  1NEN B;  1WRI A;  2K9X A;  2WS3 B;  3AN1 A;  4HRO A;  4C80 A;  1J7A A;  5H92 C;  1QT9 A;  1T3Q A;  3AV8 A;  4C7Z A;  4WWM A;  1TKY A;  2FBW B;  3NVZ A;  1RWS A;  1FRR A;  3P1M A;  4KX6 B;  5H8Y E;  1XO3 A;  2B76 B;  4N58 A;  4FXC A;  3FAH A;  5C2T B;  3CWI A;  4JWU C;  3LB8 C;  2L52 A;  4P6V F;  1JWB D;  2PVG C;  4N6E B;  3HUI A;  4N59 A;  3NVV A;  2WU5 B;  4ZHO A;  1V8C A;  1FIQ A;  1JRO A;  3P63 A;  3VRB B;  4ZHP A;  1RM6 C;  1WWT A;  1QOG A;  1KRH A;  3L4P A;  2PIA A;  2H89 B;  1WGK A;  3HVZ A;  2PVO D;  1PDX A;  3AE4 B;  3AE3 B;  4ITK A;  1OQR A;  1RFK A;  1AYF A;  2MJ3 A;  1E9M A;  2CJN A;  5C3J B;  1QOA A;  5EE3 A;  1L6V A;  1AWD A;  1V97 A;  1NYR A;  2CU3 A;  1TKE A;  2W54 A; 
#chains in the Genus database with same CATH topology
 1P9D U;  2HTM E;  4EE2 A;  2DHZ A;  2EKI A;  4D2K A;  4A55 A;  3BVZ A;  4LJO B;  3WAO A;  5J17 A;  2R2Q A;  4HJK A;  4M8M A;  4GU2 A;  4HXD A;  4GMV A;  2PKO A;  2OJW A;  3PT2 B;  2OHF A;  2G45 B;  2WYQ A;  2Z0E B;  4EZJ A;  2IY1 B;  3DWG C;  4FHK A;  2MBE A;  4BZA A;  2BS2 B;  3H7P A;  1TZ1 A;  2K3U A;  5D3D A;  1Q1O A;  1FMA D;  4OW0 A;  4RGM A;  5HFY A;  3AE2 B;  2LGY A;  4B95 A;  3WCQ A;  2KMC A;  3UQB A;  1I4Q A;  5GMV A;  3A4R A;  3PHX B;  1A5R A;  2XEW A;  3KYD D;  3B9J A;  1TGZ B;  2M8S A;  5LXH A;  3W5U B;  1FXI A;  1L0Y B;  1WZ0 A;  2KN5 A;  3A9K B;  3H1U A;  2ZCB A;  3FIL A;  3T3N A;  4KSL C;  3V6E B;  1D5Z C;  3M3J A;  3ZDM C;  4NY0 A;  1L6U A;  4NJC A;  1YQB A;  3AB5 A;  2KFJ A;  1Y8R C;  1WM2 A;  3NG0 A;  2W82 A;  1J7B A;  2DYO A;  2WLB A;  4YSY B;  3L13 A;  1C79 A;  5CHV C;  5IP4 D;  2KWU B;  2KX0 A;  2PEA A;  4YSZ B;  1E6E B;  1NEN B;  2LD9 A;  3AV8 A;  3TIX A;  2NVU I;  1UWX A;  2WXN A;  1FRR A;  1RRB A;  3CWI A;  2D11 A;  3B0A A;  3Q3F A;  3NVV A;  4ZHP A;  2G4D B;  2WX0 A;  3ZUN A;  5E6O A;  3L4P A;  1WX8 A;  2Y5P A;  1X1M A;  2LGX A;  2D10 A;  2JU6 X;  3DVG Y;  1AWD A;  4F1S A;  3GZN B;  1R7S A;  4ANX A;  2XK5 B;  4NAW B;  2LI5 A;  4RNA A;  2CU1 A;  5KHQ A;  4WAA A;  3ML8 A;  3NZU A;  4LLG M;  1UGM A;  4RMA A;  3VQI A;  4OZA A;  1SBB B;  3R7R A;  2BYF A;  3T8M A;  3ZKJ C;  1JW9 D;  1KFY B;  4MSQ B;  4G0N B;  2KLC A;  2L3Z A;  2RMM A;  4RFB A;  1E5W A;  4JIO U;  1Q0W B;  4KGT A;  1LFD A;  2J4X A;  3B08 A;  2RDG A;  3N9Y C;  1NI2 A;  3L16 A;  4L1B A;  3R7Q A;  4KIK B;  4P7I A;  4AJY B;  4YWG G;  1UGJ A;  4MGY E;  4WJN A;  3W5V B;  2KQ7 A;  2WWZ A;  4ACF A;  3IHP C;  3R66 C;  4II2 B;  4XE0 A;  1QF6 A;  4HDQ A;  5J18 A;  4EZL A;  2Y5C A;  2D3G A;  3LXF A;  2I1J A;  3ZNG C;  3MC0 B;  3DBH B;  4S0R A;  3HHM A;  3ALB A;  4XZ4 A;  2IJ0 A;  2L32 A;  1J7A A;  3ZXR A;  1WH3 A;  1SSN A;  3DPD A;  1RWS A;  2BKF A;  2M0X A;  3OWE B;  4OHJ A;  4N6E B;  3TMP B;  3WIM A;  1RFA A;  2WX1 A;  2X8X X;  2DEN B;  3U52 E;  2PIA A;  2H89 B;  2KWD A;  2MA9 B;  3DBL I;  1KOT A;  3OAW A;  2YLM A;  1GUA B;  1ZW7 A;  1HA5 A;  3ZNI D;  4TUU A;  3W2D A;  4TQ1 A;  1XF5 L;  1D5M C;  4HKQ A;  3APD A;  2JT4 B;  1NVI D;  2D3B A;  3BY4 B;  3Q6B A;  2DX5 B;  1YMH E;  5IA7 A;  1FO4 A;  1GC7 A;  2K8C A;  2C7H A;  1ENF A;  4CQN A;  3P4S B;  1ISN A;  1STE A;  4LK0 M;  1ZDX A;  2G9H D;  2K1F A;  4A9A A;  1YIW A;  1HXY D;  4H2A A;  3T3O A;  3JVZ X;  3ZRC A;  4KDL B;  3PO0 A;  1WGH A;  3APC A;  4JLC A;  1LXD A;  4E74 A;  1GC6 A;  2KDE B;  1UH6 A;  3P4Q B;  1F2R I;  1SIJ A;  4ZRP A;  4C56 C;  3WA0 A;  1I4H A;  3GB1 A;  2JSV X;  3ZRF A;  5FR6 A;  3KUC B;  3ZJV A;  2AQ1 B;  3WAN A;  1C4A A;  2DYB A;  3LJ3 A;  1EWY C;  1XLP A;  3OG5 A;  4LNI A;  3M62 B;  4JX1 C;  4YXD B;  2KAC A;  2QIL A;  2LGI A;  2BB6 A;  5AUI A;  2DLB A;  4NAM A;  2BKR B;  3AU5 A;  3K9P B;  2JWZ A;  1WJ6 A;  2ZW0 A;  4EEW A;  4C7Z A;  1CQV A;  2RSU A;  4N58 A;  2B76 B;  3FAH A;  4OVU A;  2QSD A;  2IBI B;  2WU5 B;  4NAW A;  3W1S A;  2GMI C;  1KRH A;  2L00 B;  2KX3 A;  3X0W A;  3BYT B;  4TQ0 A;  3N30 A;  2MJ3 A;  1V2Y A;  4IKG A;  2AEH A;  3ZXV A;  4BAX A;  3DHI C;  4RF1 A;  3PRM B;  5BMG A;  4HLE A;  2GBN A;  3ZTC A;  3RT3 B;  2KJR A;  1P7E A;  4C7Y A;  1WJN A;  2INC C;  1XLO A;  4LTU A;  2MBQ A;  4HCP B;  1FEH A;  2KDF B;  3PTF C;  3PZ7 A;  2L76 A;  1WI0 A;  5KHO A;  3VR9 B;  2WGS A;  2WXI A;  1WR6 E;  3BIN A;  4LCD E;  3HIZ A;  3P42 A;  1WYW B;  1UD7 A;  4NQL B;  3RNF C;  3MJW A;  4KIK A;  2G1E A;  3PSE B;  1QLB B;  1DGJ A;  3QWZ B;  2GBJ A;  1FNU A;  2W9N A;  4XC2 A;  3A9J B;  3KYC D;  2MRP A;  2I1K A;  3BWU D;  1MJD A;  3PV1 A;  1IPG A;  3C19 A;  1FFU A;  3SD5 A;  4KDI C;  2WXH A;  2IND C;  3QAR A;  1C1Y B;  3AMZ A;  2R61 A;  4YT0 B;  3NOB A;  3LDZ E;  1V80 A;  5EE0 A;  1E90 A;  3DBL B;  4TMA B;  3CSF A;  2SAK A;  3H8H A;  2WXK A;  2BYV E;  5AZF A;  1OGW A;  4MSM B;  2IGG A;  1VCB A;  4I6L B;  4RH6 A;  2PMV A;  1QOG A;  1L4D B;  3TSS A;  5TSS A;  2M17 A;  2BVC A;  1TT5 B;  2ZW1 A;  3AXC A;  1JWM D;  2DAJ A;  1E9M A;  3PRE A;  3RFZ B;  1NYR A;  4DXG A;  1I4R A;  2FCQ A;  2XNA C;  3UIN B;  2KAN A;  3GOE A;  2LXA A;  3DBS A;  1BT0 A;  2KJ6 A;  4AJW A;  1L0V B;  1GPX A;  1OQQ A;  4AS1 A;  2BS3 B;  4PT5 A;  2FNJ B;  2Y3A A;  3AE9 B;  1GAQ B;  4WQM A;  4MGI E;  3P2B A;  1N61 A;  1V1P B;  1GG3 A;  3VDZ A;  3VH3 B;  1C78 A;  3RNG C;  3RNC C;  2PPH A;  2C60 A;  1JRU A;  4EUT A;  2MX2 A;  5DCN A;  3N1Z C;  2D3C A;  2KHW B;  3PRZ A;  3R8B A;  2L83 A;  1UBQ A;  4K3B A;  5HHD G;  1I7H A;  4RGT A;  2WHI A;  1SJH D;  4B0M A;  2N0S B;  4ZRI A;  2Z59 B;  4MT5 A;  2VZK D;  3IFW B;  4WJP A;  2IO1 B;  3VTU A;  3ZW3 A;  2IYD B;  2KVZ A;  2HJ8 A;  2PE6 B;  3NY5 A;  1WSP A;  1JWA D;  2B3A A;  3Q14 C;  1YN5 A;  1BML C;  4EZK A;  1Q10 A;  1QOF A;  5AZH A;  3MC9 A;  1DOX A;  4DDG D;  2BB5 A;  2JF5 A;  4HCN B;  3NS8 A;  1R4M B;  2I2Y A;  2PVG C;  4XDD A;  2RPQ A;  1JRO A;  4CO7 A;  1GB4 A;  5JH5 C;  3M63 B;  4ARI A;  1JWS D;  1UBI A;  1HE8 A;  1FNV A;  1WGK A;  2Z8L A;  4M8N A;  1AYF A;  3O65 B;  1MHX A;  2JYE A;  4OVZ A;  2AYO B;  3RZW C;  3UF8 A;  2M4N A;  4X57 B;  4AQ7 A;  3OJ4 B;  1VRA B;  1FCL A;  2MSE D;  2N9K A;  2YEP F;  3BK2 A;  2ZNV B;  4JE3 B;  3LYY A;  4YTM B;  2N1W A;  3A9J A;  2C7M B;  1WF9 A;  1YX6 B;  1XLQ A;  4FHJ A;  5JXV A;  1AAR A;  1ZKH A;  2J52 A;  3OJ3 A;  4IW0 A;  1N5X A;  1UWM A;  2QCZ A;  3PLV A;  4IC7 B;  4BBN F;  1XEE A;  4MH8 A;  2LEK A;  4GGQ A;  3PZ8 A;  4GN1 A;  4ANV A;  3EFU A;  3VTW A;  2L0T A;  2G4S A;  4HRS A;  4GLS C;  2MHJ A;  3SHQ A;  1D4B A;  1MHH E;  1S3S G;  3TEZ A;  5G5G A;  3KQ4 A;  4P1B C;  4HDO A;  3RYT A;  3T9L A;  4DXF A;  3Q3J A;  2WP9 B;  1I35 A;  3IT4 B;  1F1H A;  4G11 A;  3TCA A;  4WQO B;  2N9L A;  4L2Y A;  4WH4 A;  4FAD A;  3PS6 A;  5MPO A;  2RDB C;  3TUO A;  3BK1 A;  4DDI D;  2V3S A;  1J19 A;  3L17 A;  1SE3 A;  3A1Q B;  3P1M A;  4A20 A;  1Z5S B;  2ASQ A;  1V8C A;  3GP7 A;  2KOX A;  2WXL A;  2OED A;  2HE7 A;  3TEW A;  3R3M A;  2BQQ A;  1T5X D;  5BYS A;  1TKE A;  2QIE B;  2K6Q A;  3AEG B;  3EC8 A;  4B0E A;  3BII D;  1V1P A;  3DWM A;  1SF0 A;  4US8 A;  2ICI A;  2KVR A;  4JGH B;  1K53 A;  1AN8 A;  4W9E A;  1T0S C;  3QJZ A;  4JWS C;  1WE7 A;  2O2V B;  4A6Q A;  1R4N B;  1CJE A;  2INN E;  1WM3 A;  4GB9 A;  2ZNV C;  2IPK D;  2JPH A;  4C4V B;  2BYT A;  2Z0D B;  4R3D A;  4PYZ A;  1KLV A;  1FM0 D;  2NTT A;  1VJK A;  3NRZ A;  1OFF A;  1ZXI A;  1OEY A;  1ROE A;  2BBC A;  3N32 A;  4ZOH C;  2INP E;  2GLS A;  2ZVN A;  4I6P A;  1F77 A;  3EA6 A;  4E3C A;  3HVD A;  1YQ3 B;  4GDL B;  2W3R A;  2M19 A;  2FE8 A;  4XWT A;  1L7Y A;  1TS4 A;  4WAF A;  3RD2 A;  2WXR A;  4EKU A;  5J2R A;  2VH2 A;  4JL9 A;  4ASW C;  3DOW A;  2LGD A;  2JZZ A;  3PRP B;  3RI7 C;  1V1O A;  4BFR A;  4KKJ A;  1L2N A;  1WXS A;  1V5O A;  4ANW A;  5H92 C;  1XCT L;  3S2A A;  1K8R B;  3EEC A;  4FXC A;  2JXT A;  4KVG B;  1FNW A;  1HTO A;  3HUI A;  1I4X A;  1ET6 A;  2O6V D;  2LJ5 A;  1ZXH A;  2CHW A;  4LNO A;  5C3J B;  5CHW A;  3U4E G;  4BKS D;  4A3O A;  2C7N B;  2W54 A;  4EOY A;  1LGR A;  3NZS A;  3P63 A;  4IM0 A;  4J3O D;  5HG2 A;  1CZP A;  1Y56 A;  1TTN A;  4DQO C;  5LXI B;  2VH1 A;  5DPS A;  5HI1 A;  5DPR A;  3VUY A;  1FXA A;  2K8H A;  2PLP A;  1WGR A;  1NYQ A;  5GXG B;  1TJE A;  3L0W B;  2PE9 A;  2HD5 B;  3ABV B;  1DOY A;  1VR9 A;  2LVP A;  2LVQ A;  2WDT B;  2LMC A;  2LAS A;  1ZGU B;  4PYU A;  1DOI A;  1SJE D;  3CMM B;  1MPE A;  2OOB B;  1V49 A;  1SIF A;  4USA A;  1KF6 B;  4CHK A;  2WXG A;  2DWQ A;  2KMM A;  4ZRJ A;  3A9K A;  4URK A;  2GI9 A;  3ONS A;  3W1S C;  1KJT A;  3NJT A;  3A1Q A;  4FN2 A;  2O6V B;  3MJ5 A;  4PK1 A;  2AX5 A;  5AZG A;  1TBE A;  1WFY A;  2N7E A;  2SEB D;  1GB1 A;  5CX3 A;  3DVN U;  4OZB A;  2L1A A;  2LHD A;  2KKC A;  3V3X A;  4IG7 B;  1L4Z B;  1QT9 A;  3U7Z A;  2R2O A;  1WGG A;  2JRH A;  1VZ6 A;  2N7J A;  3M95 A;  4JWU C;  3LB8 C;  4HPM B;  2RPV A;  2K8B A;  4OZC A;  2ZPN A;  4A3P A;  2DAF A;  4FA6 A;  1LQB A;  2GBK A;  5D2M B;  5D7G A;  1OQR A;  2CJN A;  1QOA A;  4KGS A;  5LLI A;  2N4F A;  1I42 A;  1EU3 A;  1H4R A;  3PGE A;  3JYU A;  3ZYY X;  1JAL A;  2O2V A;  1PUT A;  1U4A A;  5BMI A;  2WDQ B;  2WXO A;  3AE6 B;  1RYJ A;  2MP2 B;  2ONQ A;  3QAQ A;  2XK5 A;  2CJO A;  3Q8A A;  3RPF C;  3JSV B;  3GE8 C;  3K9O B;  2BGF A;  2BYE A;  1EO6 A;  3DVN V;  3Q69 A;  1WMH B;  4C4V A;  1ZUD 2;  3C8Y A;  4TV3 A;  2MH7 A;  1N5W A;  4XYC A;  3A33 B;  2KDM A;  5CTR C;  1WXV A;  1HZ6 A;  3IAS 1;  4GDL A;  2LUE A;  4M0W B;  4S17 A;  4PS7 A;  2KT7 A;  2A4Z A;  4FJZ A;  2KC2 A;  2YVC A;  1WX9 A;  1HEZ E;  4K7S A;  1TY2 A;  5D3I B;  4RF0 A;  2LVO A;  3HRD D;  2JY6 A;  3BZD B;  2QEJ C;  4HVB A;  1ET9 A;  1V5T A;  1YNT E;  2J0J A;  2WNM A;  3CIR B;  3NZ3 A;  4JQW C;  3VTV A;  5E6P A;  2WU2 B;  2KWC A;  4K81 A;  4P16 A;  3PPA A;  3Q2A C;  1TS5 A;  2ZVO A;  2BWF A;  5IKC M;  1HQR D;  1WXQ A;  2V4I B;  3Q8E A;  2MLB A;  3AE1 B;  2HDE A;  1WRI A;  4BKG A;  4RGO S;  2IO2 B;  4W9D A;  2XN9 C;  1HTQ A;  5H8Y E;  3ZDT A;  4P6V F;  1RAX A;  2NS5 A;  4W9K A;  3TL5 A;  1WR1 A;  1SEB D;  3KVF B;  3KLS X;  1KTK A;  1LM8 B;  2UWQ A;  3Q8F A;  3SFE B;  1WX7 A;  2CR5 A;  2LUM A;  4MM3 B;  2KJH B;  3R2I A;  2JZ3 B;  2DBY A;  4BBN C;  2LZ6 A;  4REZ A;  4ICV A;  2J7Q B;  1LO5 D;  3ML9 A;  2CHX A;  4IDI A;  1B9R A;  3HM3 A;  5IO9 A;  5BMH A;  1TZO A;  1NI3 A;  2IO0 B;  1IGC A;  4M02 A;  2V1Y A;  4W9F A;  4NNJ B;  3AI5 A;  3B1L X;  4ZDV A;  1WY8 A;  1QZE A;  1SE2 A;  2MQJ A;  3ZIM A;  2AL3 A;  3J9C A;  1UZX B;  3N20 C;  2FID A;  5I4D A;  3RCZ A;  1XT9 B;  2EEL A;  1GNU A;  3ZNZ B;  3JW0 X;  2I38 A;  2WDR B;  4KV2 A;  4IM2 A;  1MG8 A;  2BPS A;  2O6V A;  4US9 A;  4IUM B;  2CKH B;  3Q3N C;  1YOV B;  4AP4 C;  1SGH A;  1CK1 A;  2NTS A;  3TEY A;  4BKS A;  1EUV B;  4DHJ D;  1E8W A;  4DXA B;  3AEB B;  3FC4 A;  1G6J A;  3QA8 A;  4MJS B;  4NPN A;  2FUG 1;  3QHT A;  1VD2 A;  2GBM A;  1I4G A;  1SB3 C;  4A8X C;  1E8Y A;  1V81 A;  2KXJ A;  3AN1 A;  5CHF A;  2V0G A;  1FD6 A;  3V05 A;  1TKY A;  1KLG D;  1YN3 A;  2LWP A;  4FLH A;  5TR5 A;  3WAM A;  2XBB C;  4N59 A;  4LNF A;  4ZHO A;  3KH0 A;  1F52 A;  2DZK A;  2MP2 A;  4NJ7 A;  3JSV A;  2PVO D;  2KTR B;  4IWP A;  1WMH A;  3X23 A;  2REX A;  1Q5W B;  4GIV A;  3IXS A;  4I6N B;  4TSS A;  1PGA A;  3D32 A;  3VVW B;  4N9F 4;  2D2Q A;  1MFW A;  1WZ3 A;  3KW5 B;  4PS3 A;  3IBE A;  1Z2M A;  1IUE A;  2LXC A;  5DPW A;  4LJP B;  3I63 C;  4GSW A;  5DPT A;  5HKH A;  4M0W A;  3ZJT A;  3PVL A;  4LDT D;  4DHJ B;  4FBJ B;  1C77 A;  1M4V A;  3P4P B;  4W9L A;  1ZE3 D;  1HZ5 A;  3H9D A;  4G3X B;  4K3C A;  1QOB A;  1YQ4 B;  2LRU A;  5E6J A;  3VAW A;  4MGZ E;  4XGA B;  1XLN A;  4WWO A;  1T0Q C;  1ZDV A;  4L23 A;  1VDV A;  2KO3 A;  2GB1 A;  1S1Q B;  3ZQ4 A;  2M1M A;  3EHV A;  2KNB A;  1FCC C;  2EMT A;  1QKZ A;  2HJ1 A;  3AEA B;  4XWW A;  2HTH A;  1EWC A;  3TEX A;  1XCQ L;  1MI0 A;  2DYM A;  2KWV B;  3DCG A;  5FKA C;  4KZC A;  3VRA B;  3URY A;  1JRP A;  4KKI A;  1C76 A;  2AQ3 B;  4E71 A;  3KUD B;  5L83 A;  2RGF A;  1WXA A;  3W9C B;  1TKG A;  2M56 B;  4W9J A;  1K50 A;  1TY0 A;  3NHE B;  3E56 A;  3QK0 A;  5IAA C;  3RUI B;  2KDI A;  2BW2 A;  2C9W B;  3DBH I;  1TIF A;  4MM3 A;  2ZPY A;  3RNE C;  2N9P C;  5C2T B;  4M00 A;  2C5L C;  4EFO A;  4F8C B;  2WXF A;  2D5G A;  2J0K A;  5IN7 A;  4PS8 A;  4F7Z A;  1KH0 A;  4LDT B;  2NBV B;  2J42 A;  3ENE A;  1KM7 A;  2UU7 A;  1D3Z A;  2AL6 A;  3AE8 B;  1E0Z A;  2MCN B;  3MP9 A;  3O13 A;  1OQY A;  3CST A;  2ON8 A;  2LFI A;  5EE1 A;  1E10 A;  3MHS D;  4AOF A;  1WJU A;  1SE9 A;  1WE6 A;  5G55 A;  4WJQ A;  3QIJ A;  3C0R B;  5BO4 B;  3NVY A;  2MW5 A;  3R2T A;  4UDU C;  3DBR I;  3WAL A;  4OVV A;  4RM8 A;  1JML A;  3U2S C;  3ZVV A;  1C3T A;  2L0F A;  3V61 A;  2CS4 A;  2WXP A;  1P7F A;  2IY0 B;  2JVC A;  4J6I A;  1JCK B;  1ACC A;  1N63 A;  4IWQ A;  2MJE A;  4MJS A;  2D07 B;  2N1V A;  2FCN A;  2RD0 A;  4II3 B;  4RM9 A;  3U8Z A;  4ZRK A;  1WXM A;  3PZD A;  4IM3 A;  4WJO A;  4MEM A;  4TKN A;  4MGK E;  4GDK B;  5G5H A;  2E3T A;  3MHZ A;  3I9V 1;  1PYW D;  2Y5B B;  4WUR A;  3WAP A;  1FXT B;  2K22 A;  1PFD A;  2JXX A;  3I3T B;  3SR6 A;  2L8J A;  2IGD A;  3QQ8 B;  3AE7 B;  2KTR A;  2WS3 B;  3QC8 B;  1KLU D;  3NVZ A;  2NMQ A;  1XO3 A;  2M0A A;  2PW9 A;  4MAC A;  1C4P A;  2MBH A;  3VUW A;  1RM6 C;  3Q3M C;  2NR2 A;  4XDC A;  1E7V A;  1DYQ A;  1QIL A;  5FR3 A;  1PDX A;  4RCO A;  3GS2 A;  1L6V A;  1TS2 A;  1SXT A;  2TSS A;  4DHZ E;  4IWO A;  2LHE A;  2JRI B;  3AEC B;  3VXW A;  2EKE C;  3VHT C;  1YJJ A;  5C1Z A;  1J7C A;  1BXT A;  1L5P A;  2ACZ B;  1WRD B;  2MEK A;  3ECI A;  1YN4 A;  1T0Y A;  2J0M A;  2JYT A;  3Q8B A;  3P4R B;  3UGB B;  3APF A;  3AEF B;  2BS4 B;  2GRI A;  4YSX B;  2VRR B;  4YTN B;  2BT6 A;  4DK5 A;  2KYW A;  2KFK B;  2A5U A;  1H8C A;  3ZNH B;  1UUP A;  3L54 A;  4ZYN A;  1K52 A;  2J53 A;  4FJV B;  5BYQ A;  1AW7 A;  2KK8 A;  4JPS A;  4BOZ B;  2N9X A;  3E9S A;  4YL8 A;  3IVF A;  1PGX A;  1XXG A;  2K9X A;  3PLU A;  4C80 A;  1GOZ A;  3OLM D;  2QC8 A;  1IGD A;  1MG4 A;  3U7D A;  3TBL D;  2K25 A;  2WXM A;  3I5J C;  2PJH A;  3I57 A;  5JHB A;  3DBR B;  3HVZ A;  3AE3 B;  4ITK A;  1RFK A;  3RN9 C;  1V97 A;  4GOC A;  1JQ4 A;  2MBO A;  3KWV A;  1FFV A;  3VFK A;  2W55 A;  4FUL A;  1ZOY B;  3AU4 A;  2YEP B;  3AUL A;  4B6W A;  4WIP A;  4M01 A;  2NBW B;  4HWI B;  2N7D A;  2V4L A;  3RNB C;  2GOW A;  2IDY A;  3AE5 B;  2ZEQ A;  2BTE A;  2LGS A;  4HPL B;  4CYE A;  3FKY A;  2L7R A;  2ZZP B;  3UQA A;  1T6B X;  2E6X A;  1ESF A;  1XQQ A;  2NPT B;  2D3A A;  2Q5W D;  3KWL A;  1NBF C;  3HM6 X;  4LNN A;  1OEY J;  3W1Y A;  3ETR A;  4GDK A;  4BVU C;  3CF6 E;  2NBU A;  3QCA A;  1EM7 A;  2JX5 A;  1P3Q U;  4B9K A;  2WQY B;  3IG3 A;  2JWU A;  2QHO A;  4DBG A;  3TJP A;  4HEA 1;  3RMK C;  4LNK A;  2K0P A;  5JHA A;  4AUQ C;  3MTN B;  2KMA A;  2K5P A;  2RR9 A;  1B1Z A;  5EE9 A;  1YJ1 A;  1GJZ A;  3IAM 1;  5EDS A;  5G2N A;  3MFG A;  1P1A A;  1IYF A;  2MBB B;  2WDV B;  3GE3 C;  3EFC A;  2KD0 A;  2MWS B;  2H88 B;  1NEK B;  2RDH A;  1WIA A;  4ICU A;  2DNF A;  2FBW B;  3L10 B;  4KGR A;  4DWF A;  2L05 A;  2LRW A;  1R4M I;  3VRB B;  2WXJ A;  4RGN A;  2KZR A;  4GXB A;  5IOI A;  4AWJ A;  3AE4 B;  3DVG X;  1TS3 A;  2AQ2 B;  3H7S A;  1C4C A;  2CU3 A;  1WJ4 A;  4K1R B;  4P1C C;  3SEB A;  1IP9 A;  1PGB A;  5T8I A;  4W9H A;  5AEK B;  4QAY A;  1FPY A;  1IBX B;  1P98 A;  3SU8 X;  2QMT A;  3SDL C;  2V3P A;  5E6N A;  1J0G A;  1WYG A;  4HK2 A;  2K6D B;  2JQR B;  2KQS A;  1V6E A;  1XD3 B;  1YJI A;  4YTP B;  3KUZ A;  2KFK A;  3NVW A;  4G50 A;  2DZM A;  3VH4 B;  1N6Z A;  1N60 A;  1L0X B;  2IO3 B;  1MVK A;  3AED B;  1RLF A;  2ZJD A;  1J8C A;  2V3N A;  3H7P B;  2DZI A;  3EGR A;  4W9I A;  4C00 A;  2G3Q B;  3RUL A;  1E8X A;  2AWT A;  4Q2J A;  3ZTD A;  3QX1 A;  1OTR B;  1YD8 U;  3Q8C A;  1EU4 A;  1E7U A;  4K7U A;  3ZJU A;  3MC8 A;  5JZE B;  3N3K B;  3B2F A;  4DHZ B;  1QQR A;  2MJD A;  1CMX B;  3FIL B;  3VR8 B;  2DZJ A;  3PHW B;  3L08 A;  4HPP A;  2V9H A;  2CHZ A;  2X38 A;  4HRO A;  3V62 A;  1P0R A;  3VUX A;  4WWM A;  4KX6 B;  2N9E B;  2PTL A;  4KZ0 A;  2L52 A;  2IGH A;  4W9G A;  3UIO B;  1M94 A;  1FIQ A;  3DQV A;  2JUO A;  3RZF A;  1UEL A;  4ZRQ A;  3A4S C;  4MEL A;  2LJI A;  4ZYS A;  1SE4 A;  1VZ8 A;  5EE3 A;  2FUH B;  3H6N A;  1A70 A;  4NZL B;  4WWP A;  2KDB A;  3BVG A;  1E7P B;  3U30 A;  3AH7 A;  3NUH B;  3DDC B;  4WWN A;  1D5X C;  2NPT A;  2KQ4 X;  3B2G A;  1F0Z A;  3AEE B;  3UI3 A;  1PQS A;  1V86 A;  2WXQ A;  3ZO5 B;  1VZ7 A;  5D6J B;  1JWU D;  1VLB A;  3HK0 A;  1ZP0 B;  5L95 C;  1NDD A;  5AUK A;  2QDF A;  4ANU A;  4HJG E;  1WGD A;  2W3S A;  2KAJ A;  3BYY B;  3ZLZ A;  1EF5 A;  1R4N I;  3DHG C;  2EMS A;  2GBR A;  3GZN I;  1K51 A;  4ARC A;  1F9J A;  3BVM A;  4MDK E;  3SFD B;  2OJR A;  2FAZ A;  3V6C B;  3Q3O C;  3NS1 A;  1I4P A;  4O1N A;  1WGY A;  1UF0 A;  1T0R C;  1TYG B;  4XX5 A;  4W9C A;  1BUI C;  3DHH C;  1YX5 B;  5FK9 C;  3EUB 2;  1EF1 A;  4A90 A;  2KN4 A;  1FRD A;  1UNS A;  4NQK E;  3AM9 A;  1N62 A;  1D6E C;  2BWE S;  5BYR A;  4K7W A;  4HKZ E;  1E8Z A;  2FCM A;  4BOS C;  2KTF A;  2KLG A;  2QJL A;  1ZPS A;  3N1X C;  2BF8 B;  5D94 A;  1T3Q A;  2UYZ B;  2IZV B;  2NCN A;  1C9F A;  1V9J A;  1JWB D;  4MH0 E;  2JZP A;  5LNK 1;  4NJ6 A;  3IT6 B;  2FIF A;  1F2R C;  1WWT A;  2K39 A;  4IOI E;  4BKT A;  5C23 A;  1IBX A;  3N1Y C;  2VZK B;  4KSK C;  3V60 A;  2ZCC A;  3UIP B;  3RNA C;  2FCS A;  2KC1 A;  4FJY A;  3ZGZ A; 
#chains in the Genus database with same CATH homology
 1TS2 A;  1SXT A;  2TSS A;  2HTM E;  2XNA C;  3ZYY X;  4EE2 A;  2EKI A;  1JAL A;  2LHE A;  3AEC B;  4A55 A;  4D2K A;  3BVZ A;  1PUT A;  5BMI A;  2WDQ B;  2WXO A;  1YJJ A;  1RYJ A;  3AE6 B;  1J7C A;  2ONQ A;  1BXT A;  2CJO A;  1L5P A;  3Q8A A;  1L0V B;  1GPX A;  1OQQ A;  2ACZ B;  2PKO A;  3RPF C;  2MEK A;  2OHF A;  4AS1 A;  2BS3 B;  4PT5 A;  3DWG C;  1YN4 A;  3Q69 A;  2Y3A A;  2BS2 B;  1GAQ B;  3AE9 B;  1ZUD 2;  4WQM A;  2JYT A;  3C8Y A;  2K3U A;  5D3D A;  1N61 A;  2MH7 A;  1N5W A;  1V1P B;  1FMA D;  3Q8B A;  4OW0 A;  4RGM A;  3P4R B;  1C78 A;  2KDM A;  5HFY A;  3AE2 B;  3AEF B;  2BS4 B;  3WCQ A;  1HZ6 A;  2GRI A;  3R8B A;  3IAS 1;  2L83 A;  1I4Q A;  4YSX B;  4YTN B;  5HHD G;  2BT6 A;  1I7H A;  3B9J A;  3W5U B;  1FXI A;  1L0Y B;  4RGT A;  1HEZ E;  1SJH D;  5D3I B;  1TY2 A;  2N0S B;  4B0M A;  4MT5 A;  2VZK D;  4RF0 A;  3FIL A;  3T3N A;  1UUP A;  3HRD D;  1D5Z C;  3BZD B;  2QEJ C;  1ET9 A;  1K52 A;  1YNT E;  1WSP A;  1JWA D;  1L6U A;  2J53 A;  2WNM A;  3CIR B;  3NZ3 A;  4NJC A;  5BYQ A;  1AW7 A;  1YN5 A;  1BML C;  2WU2 B;  3AB5 A;  4P16 A;  4JPS A;  2W82 A;  1J7B A;  1Q10 A;  1QOF A;  1TS5 A;  2DYO A;  3E9S A;  2WLB A;  4YSY B;  1C79 A;  1HQR D;  1WXQ A;  2V4I B;  3Q8E A;  1DOX A;  1PGX A;  3AE1 B;  1XXG A;  2BB5 A;  4YSZ B;  1E6E B;  2HDE A;  1NEN B;  1WRI A;  2K9X A;  4C80 A;  4RGO S;  3AV8 A;  1UWX A;  2WXN A;  2XN9 C;  1FRR A;  1GOZ A;  5H8Y E;  2I2Y A;  3CWI A;  1IGD A;  4P6V F;  2PVG C;  4XDD A;  3NVV A;  4ZHP A;  1JRO A;  1SEB D;  1GB4 A;  2WXM A;  3L4P A;  4ARI A;  3KLS X;  3I57 A;  1KTK A;  2Y5P A;  1JWS D;  1FNV A;  1WGK A;  3Q8F A;  3HVZ A;  2Z8L A;  3SFE B;  3AE3 B;  4ITK A;  1RFK A;  1AYF A;  1MHX A;  2JU6 X;  1AWD A;  2JYE A;  1V97 A;  4OVZ A;  2LUM A;  4MM3 B;  1JQ4 A;  3KWV A;  1FFV A;  3R2I A;  2W55 A;  1R7S A;  4AQ7 A;  2DBY A;  4REZ A;  1ZOY B;  4NAW B;  1VRA B;  2YEP B;  1LO5 D;  1FCL A;  2N9K A;  2YEP F;  3BK2 A;  4RNA A;  4WIP A;  4IDI A;  1B9R A;  4JE3 B;  3LYY A;  5BMH A;  4YTM B;  1TZO A;  1NI3 A;  1IGC A;  2IDY A;  4LLG M;  3AE5 B;  2BTE A;  3VQI A;  1XLQ A;  4OZA A;  5JXV A;  2J52 A;  1SBB B;  1N5X A;  1UWM A;  1SE2 A;  1T6B X;  1JW9 D;  2E6X A;  1ESF A;  1XEE A;  3J9C A;  1KFY B;  2LEK A;  4MH8 A;  2RMM A;  2Q5W D;  3KWL A;  4RFB A;  2EEL A;  3PZ8 A;  5I4D A;  4KGT A;  2I38 A;  3ETR A;  2WDR B;  2J4X A;  4HRS A;  2RDG A;  3N9Y C;  1EM7 A;  4US9 A;  2JX5 A;  4GLS C;  2WQY B;  4L1B A;  2JWU A;  1D4B A;  1CK1 A;  1MHH E;  4HEA 1;  3TEZ A;  2NTS A;  3TEY A;  2K0P A;  4YWG G;  5G5G A;  3KQ4 A;  1UGJ A;  3W5V B;  2K5P A;  3AEB B;  3FC4 A;  1B1Z A;  5EE9 A;  4DXF A;  2WP9 B;  3IAM 1;  3IT4 B;  4XE0 A;  1QF6 A;  3MFG A;  2Y5C A;  2FUG 1;  2WDV B;  2N9L A;  4L2Y A;  3LXF A;  4WH4 A;  3MC0 B;  1I4G A;  1SB3 C;  2H88 B;  4A8X C;  5MPO A;  1NEK B;  2RDH A;  3TUO A;  3BK1 A;  2IJ0 A;  3AN1 A;  2V0G A;  2L32 A;  1J7A A;  1FD6 A;  1SSN A;  1SE3 A;  3V05 A;  1TKY A;  1KLG D;  1YN3 A;  1RWS A;  2FBW B;  3P1M A;  4KGR A;  3OWE B;  4OHJ A;  4N6E B;  4N59 A;  4ZHO A;  1V8C A;  3VRB B;  3GP7 A;  2WXJ A;  3U52 E;  2WXL A;  4RGN A;  2OED A;  2PIA A;  2H89 B;  2PVO D;  3AE4 B;  3TEW A;  2KWD A;  1T5X D;  1TS3 A;  5BYS A;  2AQ2 B;  2CU3 A;  1C4C A;  1TKE A;  2QIE B;  3SEB A;  1HA5 A;  3IXS A;  1PGB A;  3AEG B;  4TSS A;  5T8I A;  4B0E A;  3BII D;  4TQ1 A;  3W2D A;  1PGA A;  1XF5 L;  1D5M C;  1V1P A;  4HKQ A;  3DWM A;  1IUE A;  1SF0 A;  1NVI D;  4US8 A;  2ICI A;  1IBX B;  2QMT A;  1YMH E;  2V3P A;  1WYG A;  4M0W A;  1FO4 A;  1K53 A;  1AN8 A;  3ZJT A;  4CQN A;  1ENF A;  3P4S B;  2JQR B;  4JWS C;  1STE A;  1C77 A;  1M4V A;  1YJI A;  1ZDX A;  2G9H D;  4LK0 M;  3P4P B;  4YTP B;  4A9A A;  1ZE3 D;  1HZ5 A;  3NVW A;  4A6Q A;  1HXY D;  4H2A A;  3T3O A;  1CJE A;  2INN E;  1QOB A;  1N60 A;  1L0X B;  1YQ4 B;  3PO0 A;  1MVK A;  3AED B;  5E6J A;  1XLN A;  2IPK D;  2V3N A;  1ZDV A;  4L23 A;  1VDV A;  3EGR A;  2BYT A;  4R3D A;  2GB1 A;  1FM0 D;  3ZQ4 A;  2NTT A;  1VJK A;  3NRZ A;  1F2R I;  3P4Q B;  1OFF A;  1SIJ A;  4Q2J A;  1ZXI A;  4ZRP A;  1FCC C;  1ROE A;  2BBC A;  1QKZ A;  3AEA B;  3Q8C A;  4XWW A;  4C56 C;  4ZOH C;  2INP E;  1EU4 A;  1EWC A;  3TEX A;  1XCQ L;  1I4H A;  1MI0 A;  2DYM A;  2JSV X;  3GB1 A;  1F77 A;  3EA6 A;  3HVD A;  5FKA C;  1YQ3 B;  2AQ1 B;  4GDL B;  3VRA B;  3ZJV A;  2W3R A;  2M19 A;  3URY A;  2FE8 A;  3ZJU A;  4XWT A;  1TS4 A;  1JRP A;  4WAF A;  2WXR A;  4KKI A;  1C76 A;  2AQ3 B;  1C4A A;  3B2F A;  1EWY C;  1XLP A;  1QQR A;  3W9C B;  1TKG A;  2MJD A;  2M56 B;  4JX1 C;  4YXD B;  2KAC A;  2QIL A;  3FIL B;  1K50 A;  2LGI A;  1TY0 A;  2BB6 A;  5AUI A;  3VR8 B;  3E56 A;  2DLB A;  4NAM A;  1V1O A;  2X38 A;  4KKJ A;  4HRO A;  2BW2 A;  5H92 C;  1XCT L;  2ZW0 A;  4C7Z A;  4WWM A;  1CQV A;  4KX6 B;  4N58 A;  2B76 B;  4FXC A;  3FAH A;  5C2T B;  2PTL A;  2L52 A;  2JXT A;  2IGH A;  2QSD A;  1FNW A;  3HUI A;  1I4X A;  1ET6 A;  2WU5 B;  3W1S A;  1FIQ A;  1KRH A;  2WXF A;  2D5G A;  4ZRQ A;  1ZXH A;  3BYT B;  4TQ0 A;  2LJI A;  1KH0 A;  4ZYS A;  1SE4 A;  1VZ8 A;  2MJ3 A;  4IKG A;  2J42 A;  5C3J B;  5EE3 A;  3U4E G;  4RF1 A;  5BMG A;  2W54 A;  1A70 A;  1P7E A;  3AE8 B;  4NZL B;  3BVG A;  4C7Y A;  1E0Z A;  1E7P B;  1XLO A;  3P63 A;  4LTU A;  3AH7 A;  3MP9 A;  3NUH B;  4J3O D;  1FEH A;  1D5X C;  3O13 A;  5HG2 A;  1CZP A;  1Y56 A;  2ON8 A;  3PZ7 A;  2KQ4 X;  2LFI A;  3B2G A;  5EE1 A;  3AEE B;  4DQO C;  1E10 A;  1F0Z A;  3UI3 A;  5HI1 A;  3VR9 B;  2WXQ A;  2WXI A;  1VZ7 A;  1FXA A;  2PLP A;  1JWU D;  3NVY A;  1NYQ A;  3R2T A;  1VLB A;  3P42 A;  4UDU C;  5GXG B;  1ZP0 B;  2G1E A;  5AUK A;  1TJE A;  1QLB B;  1JML A;  3ABV B;  4HJG E;  3U2S C;  1VR9 A;  2W3S A;  1DOY A;  2KAJ A;  3BYY B;  2LMC A;  1DGJ A;  1FNU A;  1P7F A;  2WXP A;  1DOI A;  1K51 A;  1SJE D;  4ARC A;  3BVM A;  1JCK B;  1MPE A;  1ACC A;  1N63 A;  3SFD B;  3BWU D;  2MJE A;  3NS1 A;  4USA A;  1I4P A;  1FFU A;  4O1N A;  2WXH A;  1KF6 B;  1TYG B;  2WXG A;  2DWQ A;  1BUI C;  3AMZ A;  2KMM A;  2R61 A;  2GI9 A;  4YT0 B;  5FK9 C;  3EUB 2;  4A90 A;  2KN4 A;  4GDK B;  5G5H A;  2E3T A;  1FRD A;  1UNS A;  3MHZ A;  5EE0 A;  3AM9 A;  3MJ5 A;  3I9V 1;  1N62 A;  1D6E C;  1PYW D;  5BYR A;  2AX5 A;  4WUR A;  4TMA B;  2SEB D;  4HKZ E;  2SAK A;  2K22 A;  1PFD A;  3SR6 A;  3H8H A;  1GB1 A;  2QJL A;  2WXK A;  2IGD A;  1ZPS A;  3AE7 B;  4OZB A;  2L1A A;  2LHD A;  2WS3 B;  3V3X A;  1L4Z B;  1QT9 A;  1T3Q A;  3U7Z A;  1KLU D;  3NVZ A;  2IGG A;  2NMQ A;  1VZ6 A;  1XO3 A;  2N7J A;  2M0A A;  1C9F A;  2PW9 A;  3LB8 C;  4JWU C;  1JWB D;  4MAC A;  2JZP A;  4RH6 A;  1C4P A;  5LNK 1;  3IT6 B;  2RPV A;  1RM6 C;  2PMV A;  1F2R C;  1QOG A;  1WWT A;  1L4D B;  4OZC A;  3TSS A;  4XDC A;  4IOI E;  5TSS A;  1DYQ A;  1IBX A;  1QIL A;  2VZK B;  2ZW1 A;  5D7G A;  5FR3 A;  1PDX A;  1JWM D;  1OQR A;  4RCO A;  1E9M A;  2CJN A;  3GS2 A;  1QOA A;  4KGS A;  1L6V A;  3RFZ B;  1EU3 A;  1NYR A;  4DXG A;  1I4R A;  3ZGZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...