3R8BA

Crystal structure of staphylococcal enterotoxin b in complex with an affinity matured mouse tcr vbeta8.2 protein, g5-8
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
236
structure length
224
Chain Sequence
SQPDPKPDELHKSSKFTGLMENMKVLYDDNHVSAINVKSIDQFLYFDLIYSIKDTKLGNYDNVRVEFKNKDLADKYKDKYVDVFGANYYYQCYFSKRKTCMYGGVTEHNGNQLDKYRSITVRVFEDGKNLLSFDVQTNKKKVTAQELDYLTRHYLVKNKKLYEFNNSPYETGYIKFIENENSFWYDMMPAPGDKFDQSKYLMMYNDNKMVDSKDVKIEVYLTTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Enterotoxin type B
publication title Molecular basis of a million-fold affinity maturation process in a protein-protein interaction.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Toxin/immune system
total genus 70
structure length 224
sequence length 236
chains with identical sequence C, E, G, I, K, M, O
ec nomenclature
pdb deposition date 2011-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3r8bA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3r8bA01
1V1PB 2QEJC 1G8ZD 1CK1A 1CT1D 3R2TA 1KLUD 1I4GA 2Z8LA 4OHJA 4RH6A 1BCPB 2XN9C 2XRSD 1SE4A 1S5FD 1RCVD 2QILA 3R2IA 1LTBD 3TSSA 4Z9CB 2WV6D 3CHBD 1LT4D 2NTTA 2J4XA 1UNSA 4RHRA 3BVMA 2SEBD 1KLGD 1LTAD 4L63B 2RDHA 1PZID 1I4RA 1LT6D 1S5DD 1UUPA 1I4QA 1TY2A 2TSSA 1MD2D 5D3IB 1KTKA 1BCPF 1PRTF 1LTGD 1PYWD 4RCOA 3URYA 1LTTD 1SE3A 3SEBA 1TY0A 1SEBD 1LLRD 1B44D 1ET9A 1JQYD 4K6LA 1V1PA 2XRQD 1CHQD 3KLSX 1PRTB 3DWQA 4C56C 1L0XB 1FNUA 1QILA 1S5BD 4DXGA 1SJHD 4RGNA 5ELEA 1YN5A 1BCPC 2AQ2B 1L0YB 3EFXD 1CQVA 4RGMA 5TSSA 4ZYSA 1D5XC 2RDGA 1CHPD 1F77A 2XNAC 3DWPA 1BXTA 1T5XD 2IPKD 3MFGA 1SBBB 1PTOB 3BVZA 3BVGA 1EEID 1DJRD 1JWUD 2IJ0A 5ELCA 4NZLB 1S5CD 1LT3D 1D5ZC 1DYQA 4RGTA 1HTLD 5ELFA 1ESFA 1PZJD 1BCPD 3R8BA 1FD7D 1EEFD 1PRTD 2R61A 4BWGB 1YN3A 1I4HA 1XXGA 1M4VA 1LTSD 4DXFA 5ELDA 1AN8A 1D5MC 1LTID 1JCKB 1AW7A 1V1OA 3EA6A 1S5ED 5I4DA 1TS2A 4TSSA 2ICIA 1HA5A 1XTCD 1HXYD 1PTOF 1PRTC 1LTRD 3W2DA 1PTOH 4UDUC 1FNVA 4L6TB 2AQ3B 5D3DA 1GOZA 2G9HD 4RGOS 3DWAA 2NTSA 1EU3A 1EWCA 1EFID 1PZKD 3BYYB 3OWEB 5FKAC 1D6EC 5FK9C 1JWSD 1JR0D 1FGBD 3BZDB 1EU4A 1I4XA 1RDPD 1LT5D 2O2LD 1FNWA 1PTOC 3O13A 1ENFA 1RD9D 1TS4A 3MC0B 1SXTA 1I4PA 1HQRD 1RF2D 4RHSA 1TS5A 1YN4A 1JWMD 1STEA 2CHBD 3GP7A 1LO5D 1SJED 5ELBA 3BYTB 1B1ZA 1ET6A 4RFBA 1SE2A 2AQ1B 1TS3A 1PTOD 3V05A 4O1NA
chains in the Genus database with same CATH superfamily
1V5OA 4TQUS 3B2FA 1HQMC 3IFDA 2OQ0A 1HFNA 4HROA 1FXTB 3NG0A 1CT1D 3UE0A 1QLBB 3QARA 4X3UA 3AEGB 3ZTCA 4RKLA 1C78A 2ACZB 3T16A 4IO9A 1A15A 3A8JE 4X64Q 2JA6H 4GN1A 5IOIA 3DM3A 2SNSA 2OJRA 3BDLA 3DUZA 4ZHPA 3VR6A 3FKIH 2KDBA 4OWTB 4UPAA 4A3JG 3MXUA 2KBNA 3HKZB 5C4XG 4DR2Q 1P3QU 3VA7A 2AKWB 3AH7A 3BWUD 4WWOA 2NVXB 3KWLA 1MD2D 4JI4Q 2JYOA 4QB4A 3Q69A 1JW9D 3DBRB 2JJQA 4LW1A 3TZUA 4KN4C 4BBRB 2MH7A 2VQFQ 5D2MB 1Q8IA 5C4JB 4JI5Q 1EY7A 3NTHA 1HR0Q 3NHHA 1Q3LA 3GTPB 3W1SC 1IP9A 3I4MB 4MGYE 3SEBA 2WIIB 4NXNL 5CYUA 4IM2A 1U4LA 1U4MA 5CHFA 4AJYB 1JQYD 2R93G 1E2ZA 1U4RA 3T4AC 2E74C 3EC8A 5CMDA 4EUTA 3ETRA 2NS5A 2Q8RE 1N5WA 3SDZA 3LWEA 2L83A 4TQ0A 1EUVB 3H7PB 2L4NA 3HM3A 3U4EG 4PK1A 4MN3A 2Y3AA 3TZDA 1K50A 1TZOA 1YIJA 1VQAA 2IX1A 4AH6A 1SYCA 4LNQA 5IE8A 4EE2A 3H3VH 4XT3B 2RGFA 3BY4B 4NAWB 3K5OA 1TWFH 2VS1A 3FVQA 2KMAA 3N20C 4N8X1 2B63G 1YJ1A 4JI2L 1IYVA 3HUIA 3OJ4B 5ELCA 4P6VF 3D8GA 4FBJB 5IYBG 3ECIA 3UINB 3AN1A 1VZ8A 4A3MH 1FD7D 1QCBD 5DLQE 4BBSB 2MFIA 1EF5A 2RSOA 1J7CA 3ZLZA 2XWJB 4ULLA 1RWSA 3PIP3 4Q0FA 1E8YA 2L0CA 2GBJA 2V3SA 4BKTA 4G4KA 1YNTE 1K8MA 3DM1A 2KFKA 3DBHI 2BE5D 4DR6Q 1X3QA 1SNOA 3I90A 3RZDB 4ZHOA 4DHZB 3BZCA 2AQ3B 2QF7A 2R2OA 1I3QB 3UE1A 1OXXK 3HOWB 1RM6C 4MDKE 3EJIA 5KEEA 5TR5A 2GVAA 4OVZA 3M9BA 2QMTA 2PQAB 1BDOA 1JWSD 1YJ9A 2IW3A 5JEAG 1VDVA 3I9V1 4G3XB 1K8AC 3CCRA 2CCZA 3NRZA 4X65L 2JUOA 1FNWA 3CRLC 4BY7B 2WNMA 4MJSA 3H6NA 4N9F4 4AJWA 2A73B 1R4MB 3MHZA 2QDLA 3D32A 4NQLB 1QZHA 1N34L 4POGA 4KZ0A 1SXTA 1AYFA 4DDGD 2BH8A 2UUAL 1FCCC 4NP5A 4W9IA 2PYKA 2KMMA 1OO9B 1EY6A 1ZPSA 2CHBD 4JOIC 1A3VA 4NAMA 2J52A 4K3BA 4O2DA 4C3IB 1WXQA 3APCA 1VQFA 4HN7A 2K5DA 2R6GA 1SMXA 5EAYA 2FCSA 2JZPA 2L7RA 2WXGA 5FJ8H 2QEJC 1YOVB 1DGJA 1QOBA 4NXNQ 4WFN3 3AU7A 1Q82C 3PIOA 2JSOA 3PSEB 1NVID 2HIXA 4K8IA 2Z59B 4HSPA 2XRSD 4FJZA 2WGSA 4HIMA 4FN2A 1YD8U 2Q8TA 4QIWB 5DPSA 1S5FD 5F2DA 1AE2A 2QILA 2KCCA 3T53B 2MBBB 1VRAB 4A20A 2JEAI 3KYCD 3CMAA 3T3NA 2E2JH 4A3BG 5A2QE 3S15H 5E6OA 1UAPA 3F1ZA 4OX9L 2IL8A 1A5RA 2JA7B 3QB3A 2Z4HA 2DZJA 3L16A 3U7DA 2AWOA 4BBRH 2RDFA 2N7EA 3KK7A 5C4JH 4M1UB 3A1QB 4C3HH 3JAML 2PO4A 2JT4B 3I4MH 4HCPB 4MT5A 5M5YB 4JI2Q 4JI0L 5J22A 2KDFB 4BKSD 5JPMC 2NBFA 3TP7A 3PV1A 1LM8B 1K0RA 2Z0DB 2RBMA 4P16A 5K36G 2Y0SG 3BK2A 2DX5B 4QAYA 4LDTB 1ET9A 5JJKA 1LGRA 3ZRFA 1CHQD 2B2VA 5JJZA 3ML9A 1DM0B 1WFQA 1VZ7A 2DNFA 4TKOB 2WXRA 4RGNA 4UP9A 1XJVA 1OTRB 1E0BA 4DKAC 2Z4IA 4DR5L 3KYDD 4BS9A 2FMMA 1BVSA 2B29A 2F0FA 3TDQA 1WRIA 4CKEA 1V8QA 1R9TH 1NY4A 1CQVA 1KAAA 4OIJA 4PQXA 2LUEA 3T13A 1D5XC 1VQCA 3HS0C 2EJMA 4NKLA 2N8NA 1WXVA 2WP9B 1CKMA 2WU5B 4QY7A 3UGBB 3HOXG 2K28A 2PE6B 4BBSH 4LJOB 4OZCA 1LT3D 5FLMG 3GDEA 3RN5A 2Z6KA 1I42A 1C76A 4RGTA 4X65Q 1HTLD 3L7ZC 3CC2A 1PZJD 1BCPD 4K8JA 5KYLA 1HHVA 4K3CA 3VFKA 2BA1A 2L9HA 3L54A 3S1RB 3W3AA 2INPE 1N34Q 1AP0A 3G4SA 2DJFC 4DK6C 5C4ZA 2UUAQ 1VQ7A 5J2RA 2KHIA 5J3BA 3J7ZC 4A3DH 3HZXA 2BF8B 1RL2A 5IYCH 4I6LB 3ZDMC 1RJTA 1PYBA 1FR3A 3TS2A 4IUVA 3OTOL 2JRIB 3KF8A 4V0BA 2F0UA 4WWPA 4K7UA 4ACFA 1EFID 1M1KC 2M0AA 3VQIA 2JVCA 2KDEB 4BY7H 2PW9A 3IAS1 1KLVA 4ARCA 1O80A 1K8RB 1QOFA 3W1BA 2HT1A 1EU4A 3LJ3A 1I4XA 1MIUA 2LI5A 1XLPA 4WJ3M 3V3XA 1MG8A 3CD6A 1EWYC 3KVFB 2FAZA 2LS01 1JRPA 3GTOH 4M8MA 1L0WA 4KTAA 2L32A 2ZNVB 4OX9Q 2HHHL 4HR7B 3N9YC 2F4VL 3Q3FA 2FHTA 2CS4A 1U4PA 4A8XC 3RD2A 2QHOA 1EY5A 1WE7A 1W6KA 2RD0A 2WS3B 3GP7A 2HQLA 1WTQA 4XQJA 1LFDA 2ZNVC 3DXJC 3G48A 3OWFA 4LFCL 4JI0Q 3SK5A 1B50A 3VDZA 1H4RA 5G5HA 1F0ZA 4GLSC 4DN4M 2M00A 3H0GB 4ZRZA 2K14A 4A3KB 1PDXA 1V43A 2D9UA 1L1OB 2Z1CA 4A3CG 1STGA 3HG9A 1GHJA 2CW0D 5BN3A 1IBKL 3H6MA 4A3GG 3Q3JA 2V0GA 3NQTA 4EQPA 3MHBA 4DR5Q 1XLNA 5BN5A 5ELOA 4A3FG 3A9KB 1EFWA 4KY5A 3PHWB 1G291 4PZ6A 2BYVE 1H9SA 3APFA 1YBYA 5M5YH 4KHPL 1ZUD2 1KLGD 3Q14C 3M95A 3PUZA 2OJWA 3O65B 4PT5A 2CVRA 4YCUA 2CFMA 1GUSA 1LM0A 5EE3A 4AS1A 2WXFA 3RNGC 1F2YA 3IFWB 1BCPF 5H8YE 3I4NH 4WJOA 4DDID 4GOPC 3W1SA 1AE3A 3E0JA 3P4SB 1VF7A 1ZP0B 3W5VB 1SE3A 2LEKA 2MBHA 2RSUA 1B8AA 1FD6A 3CXCA 3N1YC 2MGSA 4XYQA 2I5LX 3KJPA 1N63A 5G3LD 2EKIA 4H0LC 3FKYA 4TQ1A 1PRTB 5CV5A 4MGKE 2O6VA 1NYQA 1AEXA 1FNUA 1T0SC 1TKEA 3PCOB 3J9CA 2DYMA 4K81A 4DR7L 2WXIA 4A9AA 1KH0A 2WYQA 1L5PA 1R7SA 2VB3X 1NUCA 2PMZE 3KWVA 3OTOQ 2REXA 3NS8A 1HTQA 1WTXA 1WJUA 2WINB 5E3FA 3RZOB 3U8ZA 1EYAA 4G11A 3M7GA 2OQKA 1D3ZA 4XE0A 2KMCA 3MJ5A 2ZVNA 2MQJA 3S1RH 2BOSA 4B6WA 2CHZA 4II3B 1WYDA 3L2PA 1H9KA 1VQKA 4A3IB 3E3XA 1F9SA 3JAMc 1CZPA 3DVGY 3P2BA 4WJPA 3PO2B 2L11A 1X54A 1SB3C 1GB4A 2BYTA 2KHJA 3K7UC 2F4VQ 2ALYB 1PH9A 1UELA 1XT9B 2K5VA 2ZPYA 1ZEQX 5JEAJ 2Y5PA 4YT0B 1S4ZA 2WXOA 2N49A 2DWQA 1UEAB 2K39A 4TMAB 1HA5A 2LKVA 3ZGZA 1HXYD 2E75C 2EYMA 4EKUA 3MWYW 4LFCQ 3DWMA 5BMGA 3K57A 2VH2A 3AI5A 5IYDG 3KUDB 2K03A 4FYDA 1IHZA 1AARA 1DOLA 4YCVA 3ICEA 2KWDA 1VQDA 3AFQA 5D65A 5FK9C 2JPHA 3PIPA 4XYCA 1WSPA 4RM8A 4KI0A 1IBKQ 3TP5A 2H89B 3U2SC 2IGDA 3Q8BA 2PQAA 4HPLB 4MTNA 2F0KA 4ZK9B 4FF2A 1GAQB 4GDKB 3A4SC 2KKCA 2A5UA 2HDEA 4LK1C 4UY8C 4UHVA 3E9IA 3EBEA 1KNEA 5JVG3 4DFAA 4KHPQ 1JOKA 1WTOA 2D11A 3HOUB 2AUKA 5J39A 4JOIA 2CHWA 3FHWA 4XQQA 2KQ7A 3VTWA 4IM3A 1STEA 1RHPA 4LJPB 1STBA 4ME5A 4A3KH 2FCQA 3T51B 1I94L 3Q8EA 1RKNA 2D0PA 3OOCA 4AYBG 4J15A 2B2YA 2PPBC 5G3LF 4W9HA 3J81L 3NVYA 2D0OA 2MP1A 4C3JB 1IUEA 2QKIC 2WX1A 1YI2A 3NZUA 2A1AA 4RH6A 1BCPB 3G7LA 3I73A 4FF1A 4A3BH 2EDGA 4A75A 3UDGA 1WJNA 2JA8B 4BZAA 1LABA 1SFOH 2MA9B 1E3PA 4DR7Q 1J7BA 1SF0A 1XYIA 3PZ7A 3S2AA 1L6VA 3VR3A 2N9XA 1R4NB 1VLBA 3IG3A 3E9SA 2KTRB 1C48A 5E6JA 3FEWX 4OW0A 3V6EB 2L15A 1O7IA 4JI7L 2AEHA 1P0RA 1IPGA 4WQMA 1R4PB 3PLVA 2KJHB 4YTPB 3ZXRA 5AUKA 1GUAB 5AZGA 4GKKL 1V5TA 2EXDA 1D4BA 2WAQG 3ND9A 3I4LA 3A1QA 4ZRQA 3PO3G 2Q2TA 2MCNB 4CDFC 5IOCA 4LUZA 1F2MA 5IT9c 1E8ZA 4JI3L 2EELA 1MG4A 5C2TB 3UDIA 4OO1H 4YWMA 3AB9A 3A9JA 3CCVA 1TIFA 1QILA 3U4ZA 2E5LL 1G6ZA 4GN3B 4WJQA 2L00B 3DWGC 2VZKD 4FADA 4DV0L 1HZBA 1DXMA 1PH5A 5HKHA 1X65A 3C0RB 2JA6G 2A6HD 3M4PA 3CCEA 2WWZA 2RDGA 4DV1Q 1C9OA 4B3SL 1JE5A 1EWIA 1YIWA 1NBWA 2PCFB 1HNXL 3FILB 3FKIG 4A3IH 2I2YA 4XTCS 1JWUD 4JBKA 3AM9A 1A70A 4PYUA 1X9NA 2LGYA 1E2WA 1E8XA 4FXDA 1S40A 4HCNB 2NYZD 2F03A 3IBEA 4RAUC 3NOBA 3GE8C 2NZOA 2EMSA 1WI5A 1RFKA 2RA4A 4MM3A 4NJ7A 1X55A 3VHTC 3K5MA 2LGXA 2ZJPA 2X8XX 1E1TA 5H92C 1JOQA 2NUCA 2K5NA 1V1OA 2JA5H 1ILPA 2KTFA 4R8IA 2X6LA 2JY6A 5CV8A 4IJHA 2ZJRA 5KNDA 4UP8A 4LWCA 1TVXA 1H95A 4EGVA 2QEXA 5COYA 5HG2A 2NVTB 4LLGM 4LF9L 2KN4A 4ZKBB 1Y1VB 1I94Q 5CV7A 3D31A 4YWKA 4CDDC 5ISRA 2QDFA 2YEPF 2KXJA 3QAQA 5FR6A 2KCNA 1ISNA 1ML0D 4ALPA 1WR6E 5CBEE 1VQ6A 1J19A 3HOVB 3IVFA 3MC9A 2F1MA 2NB0A 1EUJA 1RIPA 2WB1E 4WORA 4A76A 1II3A 2A69D 1QJOA 3AE4B 1BBUA 3O13A 3HOUH 4HPMB 3N52A 3L4PA 3GZNB 1TS4A 3NBHB 4WQOB 2VY3A 5LMNL 4FA6A 4KIKA 4B3RL 2K25A 4A3MG 4EOYA 4JI7Q 3F8TA 4FF4A 4LFAL 3ERSX 2ASQA 2K8HA 4HCEA 1JB3A 4RA8A 1SE8A 4GKKQ 4A55A 2B2UA 5BR8L 4QCLA 1YNND 2JEBI 4C3JH 5T8IA 2KFJA 1SSNA 4K5XA 4YCWA 2M2LA 1XPUA 1SE2A 4X3KA 4JWUC 5JHBA 1TS3A 4O1NA 5I2YA 2RHQB 5KHOA 2LVOA 3N3KB 3M3YH 1BKBA 2KCTA 2WKCA 1DOMA 4IPCA 3OIPA 4MNOA 1QZGA 3ND8A 3NWTA 1G6JA 2RCNA 2E5LQ 1RCVD 2XIWA 3A54A 3ZYYX 4DV0Q 2BBCA 3S14B 2KX0A 1PGXA 3PO0A 4P1BC 3S1QB 4L63B 4B3SQ 2WDVB 1BR9A 3DBLI 3VYSA 2TSSA 2KDMA 1IBXB 5D3IB 1XMOL 4IUTA 1RTNA 5T1GA 4GOPA 3HIZA 1P98A 4WAAA 5CX3A 3STBC 1SNPA 1YHBA 5HGTA 1Q7YC 4RCOA 3HVDA 1KL9A 1V9PA 4A4IA 1LTTD 1EQQA 5FO7B 1KIXA 1R4QB 5D14A 3KBGA 3A5UA 5FJ8G 1NI3A 4G7HC 2YU9B 2MHJA 1WGRA 3KDFB 3K0XA 1FFVA 5ELEA 4GNXB 1YN5A 3GTQH 4PMBA 3CKIB 1YHQA 3J7AF 4RCNA 4Q2JA 2WDTB 5TSSA 2EYJA 3RULA 1SDFA 4LF9Q 1YNJC 3J80i 1U4AA 2BYEA 4GOCA 4GNXC 3E0EA 2WXKA 5C3EH 2JYEA 3U50C 2XBBC 3VR2A 1L7YA 2KANA 1KOTA 4IDIA 1J6QA 4BBRG 1QWYA 1BO0A 4X62L 1D5ZC 4C3HG 1X6OA 4KLKA 1JMLA 4MHEA 3I4MG 1QKZA 5C3XA 1WX8A 2KACA 2ON8A 4W9DA 2DENB 2F52A 5CV4A 2ZJQA 1ILQA 5LMNQ 2ZW0A 5DCNA 3NEMA 1X1MA 2CHXA 2AUJD 4KV6A 4H2AA 4DNTB 1EIYB 4B3RQ 4L5QA 3NS1A 1WMHB 1RTOA 5CV6A 5I4DA 2DLBA 4IOIE 2LGSA 4HTHA 4W9KA 4LFAQ 2I07B 4KZCA 5FR3A 1HZAA 3GD7A 1C8CA 1V86A 2LHDA 1RFAA 2PVGC 4Y7NH 2R7DA 2N55A 5BR8Q 1SYEA 5C1ZA 1Y69U 3HOVH 2O4XA 3NSWA 1EWCA 2DY7A 1YJWA 1Z6HA 4M0WB 3VUWA 4H44C 1D7QA 3MFYA 1XEEA 1K52A 4DV3L 3AEFB 2KENA 3NK9A 2JWUA 3CSFA 4O42A 1ASZA 1WXMA 3ZNID 3HOZB 1E0ZA 2PNHA 3FDTA 2N1WA 1GUNA 2Z6KC 4UP7A 1QQRA 1TTNA 4UAIA 1ENFA 4BBSG 4KHVA 3HRZC 4B08A 2OTLA 1MSGA 2AL6A 2E3TA 2HCCA 4GDKA 1SMYD 2LSSA 4II2B 4DAPA 2LXKA 5LL6S 1B9MA 3CIRB 2J0JA 2PNRC 2A68C 3NUHB 2BQQA 2MO1A 3J81j 2KEDA 1XMOQ 1KRHA 5ELBA 1T0QC 3W5UB 5C44B 3D6CA 2OHFA 5BYQA 3RFZB 3OIQA 4PS8A 3T9LA 3ZTDA 4H7BA 4YIJA 4A3DG 2JQOA 2AQ1B 1VQIA 2PMZB 3RNCC 1V1PB 1I5FA 3JW0X 3CAMA 3AE9B 5IA7A 2LXJA 3DMUA 5IYCG 2KCMA 5GADC 1J9OA 3ZJUA 3L3OC 4JI1Q 2N88A 3BDOA 2ZJDA 4R4TA 2JSVX 3S14H 3JAME 3PT2B 2JQRB 1RAXA 4P2CB 2DAFA 2KLGA 3S1QH 1C1YB 4BY7G 1HZ9A 1B53A 2B2WC 2HUGA 3TS0A 3J7AV 2WFWA 2G4DB 3QG1A 4DNIA 2NTTA 2YTVA 1AFPA 4K7WA 1HZCA 4EEWA 4DU9A 3S1NH 2HE7A 2EQSA 2Y0SE 1PGAA 2W3RA 1PZID 1YVCA 1F9JA 5D94A 1GG3A 3P4PB 2M4NA 4GDLB 5AUIA 3PGEA 1B9NA 2KTRA 1SNDA 5BYRA 2FJ2A 3BG3A 1IL8A 5HFYA 5LL6X 1JICA 2D3AA 2INCC 1CI3M 4BOSC 4X62Q 2XEWA 2HD5B 1WGYA 4USAA 1TWCB 2HD3A 2R7ZH 1BBXC 2K75A 2N4FA 4ZKCB 1YJIA 2CKZB 4LFBL 4OZAA 1DONA 4GKJL 5IGEA 4A93B 3M3JA 3I8ZA 2UXCL 1PH4A 3AXCA 3GTMB 4R4OA 4RF0A 2LUMA 1P7EA 2K5PA 1O7ZA 5IGCA 1E8WA 2O2VA 3U30A 3FAHA 1T5XD 3MFGA 1O7YA 2R92B 3MXNB 3VA5A 4DPGA 4HK2A 3GTLB 4LF5L 3APDA 3RNAC 1LUZA 1VQBA 1LQBA 2BKRB 2OEDA 3TQYA 2VB2X 4DV3Q 4BY1B 2LRWA 3RN9C 2MUYA 2IBIB 1IYJB 4E6IA 1E2VA 3R3OA 2A6EC 1GHKA 2KYWA 4I6NB 2UUCL 2K8BA 2PI2E 1WE6A 2EPBA 2HDLA 4BWGB 1Z9FA 3A56A 3I4NG 2IO2B 3M85A 4IKGA 2H5XA 4ICVA 1AW7A 1VJKA 1Z5SB 4U673 2JXMB 3EA6A 1MI0A 2BA0A 2BW2A 4CDCC 3ABVB 5FLXc 1WFYA 1GUOA 2SNMA 4L5RC 1G6PA 1GB1A 1EYDA 3NY5A 4GB9A 2N3SA 5HY6A 1TWAB 1STHA 2CQAA 1WTWA 3HOZH 2VUMB 1NENB 2PZWA 3BYYB 1K53A 3WALA 4F7ZA 2BWES 4XGAB 3MXGA 2PKOA 3R3MA 4A3OA 5IT9E 3TL5A 5DAUA 3HKSA 3B08A 3L08A 3LGJA 2J0KA 3QOLA 1N8RC 1I50B 2LY7A 1UGMA 4EZKA 4JPBW 3S24A 3RUIB 1ZXIA 4C2MB 4IM0A 4GLVB 3H8HA 4LAAA 3D4WA 1Q8KA 1C77A 1QF6A 1XLQA 2HQEA 1MHHE 1WJ4A 1WZ0A 4P73A 1CFMA 3NELA 2V4IB 4U68A 4US8A 2W82A 1IGDA 1FL0A 3Q3NC 3PUYA 5HHDG 1B9RA 2MBOA 2M0XA 3C3LA 5IO9A 5MPOA 2B2TC 1WTRA 3ZO5B 4NY0A 2PJHA 2F0SA 2Z8LA 4IQZA 1I6VC 5IWAL 2RMMA 4GGQA 5M3MB 3EQLC 1JB7A 2HJ1A 1OEYA 3H09A 4LFBQ 5M5XB 3EVQA 4GKJQ 3VYTA 2Y5BB 4BOZB 4HLEA 3R2IA 1MJDA 2R3ZA 2J0TD 2UXCQ 2UXBL 2C7NB 4IG7B 5KHQA 2MNAA 4A3EB 3HOYB 4MGIE 2EXZA 2PW5A 2WV6D 5IP7H 3CCUA 3H7SA 1QNKA 4HMIA 1QOHA 3K9PB 1XCQL 2SEBD 3VH3B 4LNNA 1SROA 3B1LX 1S5DD 4IUNA 1PH8A 3S16H 1YQ4B 3PHXB 4FLHA 1GJZA 1TY2A 2RSNA 2EZVA 1SYDA 3GV6A 4OWWB 2KAJA 1BQQT 1ZOYB 1EY0A 1TWCH 1ZYRC 4MH8A 2ID0A 2Q2UA 1HPCA 1SNMA 2WDQB 3CSTA 4IPGA 2UUCQ 2XK5A 2B2YC 4A3KG 1VQEA 4CKBA 1XD3B 1SEBD 4MSQB 1SLJA 2IY5B 5CC4A 3ULPA 3W5OA 1KM7A 2INDC 3GO5A 3NXWA 3R7QA 5HURA 3P1HA 3U4VA 3CCJA 2DN8A 1Y8OB 2WB1B 2O5IC 4NQKE 1L0VB 3AE6B 2AQ2B 2NVXH 3EUB2 3I55A 2JRHA 4XYOA 3GTLH 3EFXD 3F2UA 3KDFA 1CKNB 3SGIA 3CF5A 2JYTA 5G5GA 4ZYSA 4GNXA 4HJAA 1OGWA 3U58A 4FJYA 1IW7C 4IUQA 2F0QA 1A8VA 1AZPA 3GTPH 2BB5A 3PVLA 2V3NA 1O7LA 2WXMA 2Q2HA 1SRUA 1WCMB 2IJ0A 3VH4B 2UXDL 3C46A 4PS7A 2A4ZA 3VR4A 4S0RA 1YMHE 3B6YA 1Q46A 4C4VA 1JWBD 4YSZB 2IZVB 3GTGB 4DXFA 1LTID 2PPHA 1JCKB 3V6CB 3KQ4A 2BDOA 1YJNA 4Q5VA 2RDBC 2G1EA 3IT4B 3H3VI 4GSWA 4JW0A 4KV2A 1P9DU 1K8OA 3EIVA 4OO1G 1CA5A 1UGJA 1I6HB 3HVZA 5EKKA 4JE3B 5KYIA 2G9HD 1XPRA 2NTSA 2LXCA 2KQ3A 4HIKA 4M8AA 2MLBA 3VXWA 2NVYB 1V9JA 4H13C 4QUCA 5IWAQ 3P63A 2F0WA 4P71A 3DHGC 4JYAL 1FGBD 2LGDA 2QJLA 1N62A 2CU3A 1JJ2A 3K0YA 4A3IG 2K05A 1EY4A 2UXBQ 3JC66 2D07B 1RD9D 2Q8IB 2VZAA 3RZDH 3J81E 1WXSA 4NPNA 1YQ3B 3CC4A 5J1ZA 3U9SA 1I3QH 3HOWH 2BYFA 1JWMD 2F0VA 1PXUA 2YTXA 4F88A 3Q0AA 2KQSA 4B9WA 1BBWA 1B7YB 3KLRA 2WU2B 2WHIA 2JA5G 4LNKA 2VXWA 3MJWA 5M3MH 3IXSA 1P7FA 1V6EA 4DV5L 2KUMA 1YHAA 1W2BA 1PLFA 5I2XA 1HZ6A 1E9MA 2NCNA 3GTKB 3M4QA 2B2WA 1MJEA 3M4YA 1DOIA 4B95A 2EYPA 3KUZA 5C0XG 1EF1A 2F0JA 1O78A 2YVCA 3RUZA 2EE1A 1HNZL 4C3IH 1TGZB 1WGGA 1K73C 3P1MA 2NR2A 3HOUG 3AE2B 4KDLB 1D1KA 2E2IB 4QQBX 3NVWA 4RF1A 5GROA 3WOEA 5DNFA 2E76C 3AB5A 1K83B 2R7FA 5K5PA 4DBGA 1KHIA 4KKUA 2B2UC 4P75A 2UXDQ 2Z0EB 2DJGC 1LTGD 3QK0A 4BKGA 3QC8B 1CTMA 1VQ4A 2V3PA 5E6PA 1VD2A 3VUYA 2MSED 2WDRB 2E2DC 3BZKA 3GOEA 1CZGA 4B3ML 4C3JG 1PH1A 1D2BA 2OCEA 3MC8A 1TWGB 2KX3A 4J6IA 2H88B 3DWQA 3NVZA 2MPMA 5JXVA 4HDQA 3VAWA 1U9RA 2JA7H 1UD7A 2F3WA 4IUUA 2VNUD 1L1OC 4OVVA 5DPRA 4C80A 3CPFA 1WCMH 1FRDA 4KD3A 1HA6A 3AFPA 5M3FB 3NHEB 4P1CC 2JN4A 2CWAA 2XNAC 2CKHB 4W9LA 2GLSA 3T1YL 3A8KE 1TQOA 1GUGA 2BE5C 3BU2A 3BS1A 1KAWA 4IOCA 3CF6E 5JZEB 4XWWA 3DEPA 3TREA 3K6OA 1YNXA 2ZXPA 1YITA 4JYAQ 2DUDA 4JVZA 2MO0A 1L2NA 5DM73 3WANA 1GXDC 1B4OA 1HH2P 3VR5A 4J1MA 2FUHB 1WX7A 4GN5A 4K6DA 1PRTC 5IODA 3PUWA 4N9PA 2ES2A 1HR0W 3EECA 4XDCA 1P8LA 2NVYH 1KNAA 3H7PA 4R9WA 1MBYA 4JG2A 1JROA 2AYOB 1CJEA 1HNWL 5EE9A 2Y0SB 2CR5A 2J0MA 2F0DA 2MP2B 1G91A 2RKSA 1EQRA 1VQPA 4NAWA 4NJCA 2CH4W 1JR0D 2ZW1A 2D62A 2M9VA 3U9OA 1YX6B 1LT5D 5C3EG 2NN6H 4DAMA 5FOBB 3K9OB 3NP8A 4R4CA 3W9CB 4AQ7A 2GA4B 1HNZQ 4URKA 3TN2A 2HHHQ 2BS4B 1EIGA 4BAXA 3OLMD 4DK1A 4JGHB 4JI8L 1J7AA 1V80A 3SR6A 3LDZE 4FP5D 4EZLA 3I56A 1LV9A 3BYTB 5AJ3L 1PH7A 4E74A 3CC7A 2B2TA 1VQ5A 3ALBA 1PTOD 1ESRA 1WY8A 2K5QA 1EOVA 1TKYA 4OL7A 1CK1A 1Y8PB 1L4ZB 4N9TA 3HOVG 1X3PA 3AULA 3D4DA 3ERQA 5IIFA 1XCTL 1UWVA 1SE4A 2JP1A 1C4CA 2P5ZX 3AE7B 4LJZC 3PRZA 4ODGA 1JC7A 1IBLL 2E2IH 2KWVB 5BMHA 2EY2A 4CJ2C 1KQSA 1Y56A 2UUBL 1K83H 5FLXE 3HFZB 1DCZA 3BJUA 4KSLC 5BN4A 3H0GH 3VDYA 2G5DA 3T1YQ 2WXJA 2N9KA 4LNIA 2NVQB 3Q6SA 2PW7A 2EVBA 2KHSA 2JK8A 2Q2IA 4CDEC 2FCNA 2KVZA 4ZRPA 3ZNZB 1TWGH 3RD4A 1WYGA 4WH4A 4P74A 1LXDA 4KKTA 1SNCA 4OWXB 3CW2C 4PZ8A 3I3TB 3QJZA 1AWDA 2PEAA 3RYTA 3TMPB 3H91A 2DNEA 3T8MA 4C56C 2W54A 1YNJD 2HTME 2J7ZA 1STYA 1XX8A 3J80L 4JBMA 1A62A 3A7LA 2OXPA 3IFTA 5M3FH 4HWIB 3JSVB 1BCPC 3MEHA 1U0LA 5CBAE 5E6NA 1PYSB 3NUCA 3DEOA 1N6ZA 4F8MA 2QW7A 4KX6B 2IYDB 2IPKD 1HNWQ 2NPTB 1NSNS 3PLUA 3VYRA 3PRPB 3BVZA 4L5TA 3A55A 5GAHC 2YV5A 3BINA 3KF6B 4NDXA 3U7ZA 4DQOC 4DGZA 2L8JA 3KH0A 4I7ZC 2V4DA 2F0OA 3EN2A 4HKZE 4BXXH 2R61A 1QT9A 1HJPA 1F2RC 4EQNA 1UWMA 1I4HA 1B2TA 1YQBA 1DD2A 5ELDA 3RLFA 4JPSA 2LFNA 3ULJA 4A3PA 1V2YA 2I1JA 3VR9B 1XWEA 4RNAA 4JI8Q 5IAAC 2DYOA 3RZOH 2K52A 2K7VA 1PV4A 3MTSA 2R7ZG 2JZ3B 2DYBA 2ZPNA 1PTOF 2F0TA 1F9PA 2A74C 5AJ3Q 3CMEA 4L6TB 3B2GA 1EOTA 1GOZA 1TR5A 1CM9A 3DOWA 1NYRA 4ASWC 4HMJA 3T3OA 3DQVA 3H9DA 1NCVA 5E7NA 5JVH3 5H1SE 4DHJD 3PO2H 1TT2A 2VRRB 4FXGC 4WJ4A 3S17B 5C3JB 2A68D 4BBNF 3FRPB 3K81C 1IBLQ 3C1FA 3N32A 1Y1WB 1K8GA 3CQZB 2C7MB 1S72A 4CKCA 1U5KA 3WAPA 4C00A 1SGHA 1QUQB 2UUBQ 5FO8B 4HJKA 3S2HB 1V81A 4ABNA 1FJGL 1QNUA 1RF2D 2CW0C 2KJXA 1TS5A 3Q8FA 1ICFB 4DUYL 4FVMA 1VR9A 2G9DA 1RODA 3P7JA 1WTVA 4ANVA 1SJED 2JU6X 4DA2A 4ZRKA 2AMCB 3UI2A 5C0XJ 4RFBA 2NBUA 3Q6BA 5CORA 4KD4A 4AP4C 4KN7C 2FNJB 4BA1I 5IP9H 1VDZA 3MEFA 1PVOA 1PFSA 1VQLA 4M01A 3RNBC 1I4GA 4L8JA 3ULLA 5C0XH 1L4DB 1WXAA 1RLFA 3K80C 5AFWA 1PMRA 4IFDH 3HOZG 1VMPA 1FMAD 2QCZA 2EJFC 4LCDE 4IURA 4JC0A 3F2DA 3S2DB 4YTMB 5I9OA 4L23A 3ZDTA 1KD1C 2KVRA 3B0AA 1BUIC 5L83A 1LTAD 1VQOA 1X3EA 3TUOA 5L95C 1LT6D 2KWUB 3TEYA 3N30A 5GQOA 4OVUA 4K5WA 5EBDA 2K3UA 2MEKA 4IOAA 1F9QA 3LXFA 2JA8H 3SXHA 1EQVA 2IY1B 2KEEA 1LLRD 4JI3Q 4IWOA 1B44D 2K4KA 5EQ0A 3AEVA 3AU4A 3DHHC 3ENEA 5JAVA 3N1XC 1GVPA 3PS6A 1T5EA 4JX1C 1L1OA 1WZ3A 1DOKA 1OXSC 3N6RA 1A6XA 1VQJA 2ICEC 2N7DA 2BDNA 2R2QA 2INNE 1NMFA 3PMFA 2DY8A 3A9KA 1EIFA 4OXPA 2GBKA 1GO3E 2N78A 5BO4B 1HCZA 5IP7G 3UIPB 1HNXQ 2M56B 1E1OA 2K1FA 1TU2B 2D5DA 1PTOB 4ME3A 2K6DB 5KNCA 3DBHB 4YWLA 3UQBA 1STAA 4V190 1W3SA 1V8CA 2O6VD 4IZ8A 2YLMA 1IYUA 1WTHA 1ZKOA 4OO1I 1FXAA 4L1BA 3LNNA 3T56B 2L0TA 1XXGA 3D0FA 4WAFA 4K2KA 5EJWA 3LX0A 4DV7L 4AQYL 2DZKA 4BVUC 3J81c 1FJGQ 5IGBA 1TS2A 4DK0A 3DLLA 4DUYQ 1BNZA 1ONLA 4EQOA 3J7A5 1KFYB 2BVCA 2BGFA 1AH9A 1OTCA 3J80c 1PH6A 2MW5A 3HKZG 1T3QA 3ITPA 3GE3C 3TEHB 1ZE3D 3N1ZC 2K5HA 3DVNU 1GC7A 5FKAC 1EY8A 2FMCA 3D4RA 2KJ6A 1Z7TA 4EVOA 3E9HA 2A8VA 1Y1WH 2AWNA 4J3OD 1F52A 1SIFA 1IBML 2Z6BA 2KECA 1C4QA 2OF1A 1S3SG 1P16A 3TMEA 2L3ZA 3DVNV 2YEPB 2O2LD 1ACCA 3NWSA 3VVWB 5KIXA 2IT1A 3AE8B 3HGBA 2RPQA 4M8NA 3X23A 2EY6A 2JE6I 2WP8J 5C3WA 1J8CA 1OXUA 2NVTH 2JA6B 3TEXA 4FO2A 1HQRD 5AEKB 1Y1VH 4P72A 2L1AA 3DBSA 1PUTA 1VZ6A 1N36L 1TKGA 5GMVA 3FKIB 3Q23A 2GBRA 1HUNA 3KFUA 5GAGC 1L2FA 3M7NA 3DDCB 3P42A 2FIDA 5C0XI 4G7ZC 4G0NB 2SOBA 3ZXVA 3HEJA 3Q3MC 3QQ8B 3ZJTA 2MBQA 3S2DH 2FIFA 3PUXA 2PZTA 3SHLA 1H9JA 4BKSA 2XN9C 1Z2MA 2I38A 3RMHA 2GVBA 3AV8A 2IHFA 2E8GA 4IWPA 1CSPA 2E6XA 3CHBD 2W55A 4QF4A 1OEYJ 1BMLC 1ZYRD 2VZKB 3EHVA 1E22A 5KRUA 4KY7A 3JYUA 4TVAB 2XGTA 2MQHA 4AOFA 1UUPA 1I4QA 3AYHB 2WQYB 1WJ6A 1JE4A 5FO9B 3HOWG 3X0WA 2I0QA 4DHJB 2QCPX 3EGRA 4ARIA 1TWFB 3Q3OC 2MJEA 4E71A 2L0FA 1R4NI 3UIOB 1Y8RC 2O5JC 4TKNA 2K32A 4ANUA 1NDDA 5M3MG 2D3GA 4AQYQ 4DV7Q 3TEWA 1L0XB 3RN2A 1EY9A 1X32A 3KUPA 2I5HA 1L6UA 1ZDVA 4MSMB 4A3MB 3LWUA 1F2RI 1V49A 1S1QB 1WI0A 4WURA 3CCMA 5E4WC 2AWTA 4B9KA 3KF8B 1P1AA 3ZUNA 1IXRA 4IJLA 2UU7A 2X38A 2OWOA 1WOCA 3PREA 2X69A 3QIJA 4KVGB 1B70B 4JI6L 1F1HA 4JK1C 2A5HA 2C9WB 4C3IG 2JXXA 3I70A 1DJRD 4DUZL 2QIEB 3KJOA 4KK7A 4HIDA 1IBMQ 1EYCA 4DR4L 2IO1B 1EQTA 2C60A 3LYYA 4S3SA 1CSQA 4YTNB 4ZYNA 4HDOA 2YU9H 1NJIC 1Q0WB 2B39A 3QJYA 1FO4A 3BDCA 1KABA 1JWAD 3PZ8A 2BWFA 4MACA 1FYCA 2B8FA 4PMCA 4GLXA 3ZW3A 1A2UA 2OEOA 2WB1G 5C5MA 3UDXA 2A69C 3QA8A 4KGTA 4DR6L 1N36Q 2H1EA 2K6AA 1SYFA 1T0RC 2N0SB 3OHXC 1FNVA 4GZYC 2JA7G 4FF3A 1I7HA 5C23A 3JVZX 3FMCA 3CWIA 1PZKD 1JQ4A 5EGTA 1VQHA 2ZTCA 1WCMG 3S1MB 2DBYA 2RQXA 2CWPA 3P4RB 2FFKB 3NZSA 1STNA 1QE6A 2OT2A 1E7PB 3V60A 1YNNC 3FILA 4BFRA 3A7AB 3V96A 2AL3A 2PVOD 4DR1L 1H9SB 4REZA 4A90A 3H1UA 3PRMB 3RLNA 2B8GA 1GC6A 3SFDB 5DPTA 1ZXTA 5A35A 1YJJA 4MELA 1I4PA 3A74A 3EROA 3V2TA 4CYEA 2MJ8A 4A3LH 1JJCB 3SK4A 1QUQA 1JOOA 2D2CC 4ZLTF 2E2JB 3S15B 5AZFA 4DAVA 3ZIMA 1ET6A 1A3UA 3PGZA 4N59A 3GZNI 1OQRA 3V05A 2HIVA 3RLOA 2EIFA 4C3HB 1G8ZD 1PFBA 4R4QA 3SVMA 1KLUD 2O6VB 3TEZA 3C2PA 2N9LA 1E10A 2ZTDA 1IKMA 4DXAB 4WJNA 3I4OA 4CJ0B 4G50A 4XDXA 1T9HA 4LK0M 1VQ8A 3QIAA 2WX0A 3G6JB 3SU8X 1EIHA 4MH0E 1Q1OA 4HXDA 3HP3A 4KJNA 4W9GA 5C44H 4RHRA 2RDHA 2NN6G 3NBHA 1QZEA 4JI6Q 1WGHA 1D8LA 5M5WB 1ZDXA 4FDBA 1R9TB 3FC4A 4DUZQ 5C6AA 2GN5A 4KMUC 2BH2A 4DR4Q 1RRBA 3ZNHB 1E7ZA 1GPXA 2ZTEA 4NW2A 1OQQA 4LF4L 3NE5B 5DEHA 2PTLA 1ZKHA 2WXPA 1PH3A 2K9XA 4OGQC 1F9RA 2ZXRA 2VH1A 4DXGA 2RVLA 1XNRL 2LVQA 1JALA 3MAQA 4PG3A 3L17A 4CGYB 2CJOA 1KDCA 4DWFA 2KWCA 3CPWA 1J0GA 4ZUJA 5L37A 1NTGA 3WIMA 4A3DB 2NVUI 4ICUA 3VTUA 3HM6X 1TIID 4HJ8A 4C1NK 5IKCM 2W9NA 4XX5A 1SBBB 1NEKB 4LF5Q 2F0NA 1PDQA 1M90C 4LF6L 4M02A 1EEID 1NI2A 4FHKA 1QVGA 2V1YA 3PF4A 3Q2AC 1IBXA 1CZWA 3H0GG 3R66C 1ENAA 4KSKC 4DR1Q 1YX5B 2HTHA 4A93H 3BIID 3L0WB 3NTIA 4RWSC 1TJEA 1PRTD 1QG7A 3GTMH 4IW0A 1VQNA 4CBVA 3P4QB 3K8AA 2DZIA 1M4VA 1E7UA 2NBVB 3SFEB 3PV0A 2CU1A 5I6WA 1K28A 3ONAB 4PZ7A 1WM2A 2D3BA 1S5ED 1A63A 1JJGA 2V9HA 2FINB 2C9OA 3IKJA 2R92H 1XTCD 4IWQA 3GTOB 2J53A 3ZRCA 3SE0A 4K14A 4XQNA 3S1MH 4BY1H 1XNQL 2LMCB 5M3FG 4RGOS 1HTOA 2IGGA 3A8IE 4DV6L 1WWTA 1SMYC 3GB1A 5DPWA 1NBFC 1NR2A 3OWEB 4E3CA 2F0IA 2WACA 4IN3A 2ZZPB 3Q8CA 1NNXA 1XMQL 2E2HB 1GNUA 1BF4A 1MHXA 4DK3C 3KBXA 1H9MA 4HCSA 3D3RA 1FPYA 2F0EA 3ZQ4A 4L5SA 4WRDA 3AU5A 3SR1A 2JZZA 2LJ5A 3GQBA 4P7IA 2VL6A 2RF4A 5C5LA 1KDAA 3VUXA 3DHIC 2QC8A 1ASYA 3OPOA 3MC0B 2LVPA 3I72A 4J8QA 1NMGA 4A3JB 3PTFC 3EFCA 4BXXG 1E24A 3K59A 1KC8C 5C4XB 1TWAH 5HI1A 2KC1A 2VUMH 2PZUA 3QO2A 5C4HA 1WMHA 5EPJA 3G71A 3QR8A 3F2BA 2WXQA 2PQEA 1NAPA 5IP4D 2JX5A 1GUTA 5LMNW 3K5NA 4LF4Q 2C5LC 4A6QA 2M1MA 1DZ1A 3A9JB 3NVVA 3TBIB 3MA2B 2R93B 2D2QA 3OSOA 4OHJA 1I50H 3I4NB 1G2TA 4M0WA 2JXTA 3M62B 4ZDVA 4MGZE 2L05A 1Z47A 5LMUL 2LRUA 3AEBB 2HJ8A 4C2MH 1LTBD 3PO2G 1XNRQ 5ELNA 1KJTA 1TXYA 5M5WH 1SIJA 3RR5A 5EKLA 4G7OC 4AYBE 2NMQA 5JHAA 2KHWB 4NMZA 4DAYB 2VW9A 2PMVA 4F7XA 1ZGUB 1N5XA 2LFIA 2ZCCA 2KQ4X 3J80E 4LF6Q 2B63B 1KTKA 4KKIA 2K1BA 4I7AA 4K2LA 2KK8A 1PRTF 4MM3B 3BK1A 1WD0A 1PYWD 3URYA 5M5XH 4W9CA 2Z0SA 3VRBB 3Q8DA 2BPSA 2GB1A 3I2ZA 4A3EH 3HOYH 3EFUA 1V1PA 2K8CA 5IP9G 1VQGA 2G3QB 5G2NA 1S5BD 2XWBB 3IT6B 2A19A 1SJHD 4DV2L 3TCAA 5JJIA 2CJNA 1FRRA 1CKOA 1N33L 3IL8A 2WAQE 2LJIA 4QUFA 4IFDG 1C0AA 1XNQQ 3RNUA 3QHTA 1ROEA 1UBQA 4DV6Q 1MHWC 4QJFA 1DOXA 4GLAC 3BVGA 1XMQQ 3CMMB 5T1IA 2MX2A 4ILWA 4OIKA 2KNBA 4NZLB 3SHQA 3W1YA 2RCFA 4GDLA 2L52A 2K04A 1KRTA 1B3AA 5LXHA 1DYQA 1Y14B 1XO3A 5ELFA 3ZKJC 1Q86C 4I65A 4CHTB 5D7GA 5CHWA 4KIKB 4KHZA 2IO0B 3DVGX 1X56A 3TBLD 5LNK1 3M4OB 3QX1A 1AN8A 1D5MC 1E7VA 2JA8G 4OZBA 4TV3A 2MWSB 1IKLA 4RKBA 3H15A 1CQFA 3WDNA 3DBRI 2C7HA 4K7SA 4PYZA 4WWNA 4TSSA 3CU7A 1N60A 1LTRD 2YYZA 1UE6A 4W9JA 2K33A 4OEMB 3CCQA 5IT9L 4KGSA 2MHVA 4GN4B 2E2HH 4PS3A 1XTDA 4RG1A 4GXBA 3HHMA 2DNCA 5EPLA 3K7AB 4QMGA 3GV3A 4YWGG 2UU9L 5BMIA 3MP9A 3GS2A 4IUMB 4FNFA 3MXNA 3GTGH 2D5GA 3BZDB 4B0EA 3OW7A 4ZQ3A 5LMUQ 2DHZA 2L1BA 1RDPD 4QL5A 3TP8A 1YEZA 1QVCA 1SYBA 4A3JH 1C7YA 1DOYA 5C4XH 5LHY1 3OAWA 4PV1C 4A3BB 2ENBA 1SN8A 4GS3A 2ZXOA 4OONA 3I91A 4JV5L 1T0YA 1SFOB 1I6HH 5G55A 2K01A 4NXML 4YY3L 2KO3A 3AE1B 4CQNA 4GOPB 2HDMA 3L13A 1EZ6A 1A3TA 1MI2A 1FGUA 2LWPA 3KLWA 4DK5A 4AWJA 3W1GA 1Q5WB 1MFWA 1VF5C 2I5MX 2R93H 1UE7A 4K0KL 1N32L 3IRBA 4ITKA 2HCIA 2DAJA 5J17A 3C19A 3NPPA 4DV5Q 3AECB 2ZM6L 3RZWC 3RI7C 4NB3A 3CCLA 3F2CA 1V97A 2JWZA 1UE1A 2UWQA 3DBLB 1BT0A 1WR1A 2Z9HA 1EL0A 3NZ3A 1WRDB 5DM63 3DCGA 3AE3B 1A2TA 2L12A 4DV2Q 1UWXA 4HJGE 2C35B 4Z9CB 5IY0A 1Y1WG 3AEAB 3WAMA 1N33Q 1MPEA 2B63H 1IGCA 3BVMA 1UH6A 1ENCA 5JPNC 3DPDA 2IO3B 4LUOA 5IYBH 3QWZB 1I4RA 2D3CA 3H94A 3HOXB 4M00A 1J8IA 4ID6A 2EYHA 2SDFA 4K5VA 1RYJA 1Y1VG 2IWHA 5IGFA 1R4MI 3ONSA 4LUVA 4X3TA 3GTJB 5A2QL 3GTKH 4B3MQ 2ATWA 4DR3L 3JAMi 1B3QA 1WGDA 2LASA 4H02A 1VS0A 5BYSA 5D6JB 3V62A 3KLSX 2TMPA 4JWSC 5CHVC 3AMUA 1Y8NB 2IHEA 3OG5A 1JMCA 1GUWA 2BT6A 3KOJA 2BCOA 3RCZA 1H8CA 3P75A 3P20A 3MTNB 1E90A 3PF5A 2CH4A 2KJRA 3KLSA 4K1RB 3STBD 2XSCA 1KXLA 2M17A 2RR9A 4EX5A 2MJDA 2KA7A 2GMIC 3E56A 2JA5B 1CHPD 1EM7A 3LB8C 4DV1L 5JEAH 1IZ6A 1QB5D 4JQWC 4MTKA 1HUMA 2LHEA 4HPPA 4N6EB 3NTKA 2WKDA 4HAEA 2UU9Q 3VRAB 3K58A 4HIOA 5EE0A 1UZXB 2EOTA 1UE5A 1KF6B 1Q1EA 3M4OH 1E5WA 5JH5C 1PFNA 3R8BA 4RMFA 2K6QA 1MVKA 1PGBA 1EEFD 2LGIA 1YN3A 4R8NA 2KDIA 4XC2A 4AUQC 4PNYA 3CRKC 3Q22A 2I46A 2V1CC 3HKZE 3OMCA 2I1KA 4LNOA 3RMKC 4JV5Q 3VR8B 3WOFA 1OFFA 1MGSA 4OELB 4NXMQ 4YY3Q 2N1VA 3T1HL 1PH2A 3RNEC 2ICIA 3K5LA 3NBIA 1QVFA 3PZDA 3K7AH 3S9WA 3Q24A 2JA9A 3SK8A 3UDFA 3A4RA 5E4XA 4CO7A 1A0IA 3OW2A 2H4OA 1PA6A 4K0KQ 1N32Q 2WLBA 2QGQA 3J7YW 1CKNA 2MRPA 3QWNA 2ZM6Q 4DNRB 4B3TL 5M9OA 2LMCA 3TP6A 2VQEL 1JORA 4NPSA 3KYHC 2OTJA 2FUG1 1SAPA 4APVA 2WXHA 2PE9A 2IX3A 4A3GB 4ZRJA 3RNFC 3R7RA 2KN5A 4HEA1 3M3YB 1AZQA 1OXTA 4A3FB 2KVMA 1JT8A 3A33B 3I57A 1XPOA 2SAKA 5EE1A 2KD0A 5CV9A 4LF8L 4WWMA 1KRSA 3A5ZB 4EQ5A 5CGKA 1IL2A 1YN4A 4HJ9A 2Y5CA 1FM0D 1C79A 4XIGS 4F87A 5K36H 1HEZE 2B3AA 4JLCA 1J5EL 3OJ3A 3WWVA 1YZ6A 1PQSA 2WXLA 2AHOB 2KT7A 1SSOA 3B9JA 2EKEC 4CHKA 4D2KA 1S3OA 3WAOA 4F1SA 5EDSA 3R2TA 4DR3Q 1IYFA 1VCBA 4G57A 2FCMA 4JIOU 3IAM1 2L55A 2FXQA 2NN6I 5CR3A 4S17A 2ZT9C 4XXEA 2B76B 1F2ZA 4YXDB 1MJCA 2DZMA 1WD1A 2IDYA 2PLPA 4W9EA 4DHZE 1CMXB 2O2VB 1UBIA 4IC7B 3ZVVA 3OMGA 5EKIA 2GBNA 3HOXH 2J4XA 3NJTA 4FXCA 4DV4L 1EO6A 1G51A 4EZJA 3MVVA 5FLMH 1HE8A 4X66L 1PFMA 4KY6A 2BS2B 4FXKC 3GTQB 3GTJH 1PFDA 4L2YA 4DAYA 1F2LA 1SNQA 4F8CB 2G4SA 1M94A 2J42A 1ZXHA 1TWHB 2L5TA 3ER0A 3TRZA 2Q5WD 3AEDB 4YSXB 2X6GA 4A3LG 4IFDJ 5KNBA 2RPVA 4ZUIA 1WGKA 4YSYB 4X57B 5C3EB 2KLCA 2EY5A 5IGDA 4JL9A 4IPHA 2XRQD 3OYYA 3KW5B 4C7ZA 3RT3B 1ZW7A 3E6ZX 3A0JA 2LXAA 1CUKA 3PQIA 3QOJA 4IPDA 4GU2A 3T1HQ 3VTVA 3QCAA 1EZ8A 4EFOA 2EYFA 1XF5L 4KDIC 4KGRA 1L0YB 4X6AH 2KZRA 2NVQH 5LLIA 2D10A 5KGUA 4ZCKA 4Y52H 2F0GA 1BXTA 3L0OA 1FEHA 1KDBA 3TJPA 4KKSA 4B3TQ 4X3SA 4JCVE 2IY0B 3FP9A 5C44G 2F0LA 4Y7NB 2VQEQ 2BS3B 2OOBB 2NZHA 4QIWE 3L9AX 3KUCB 1VCIA 1E6EB 2ONQA 2IX0A 4N8FA 4ZAIA 4POFA 4FHJA 2XTIA 5IGGA 1C4AA 1XLOA 2KFKB 3MHSD 4US9A 1LTSD 2EY1A 2W3SA 4GIVA 3TIXA 4LF8Q 2FE8A 4YHHL 4W9FA 1K9MC 2GBMA 2QDBA 1FCLA 4LNFA 2UYZB 1OQYA 1GJXA 1TKWB 3W2DA 4CJ1B 5I6YA 3C1EA 1J5EQ 5D3DA 1H9RA 2A6ED 4A3CH 3RPFC 1X3FA 2C5CA 4AYBB 3X3MA 2KOLA 2K0PA 5J18A 4A3GH 1K3RA 4ZRIA 1D6EC 3UQAA 1HTPA 1TBEA 4LTUA 3CP0A 4A3FH 1MSHA 4MJSB 3PUVA 4R1JA 2FBWB 1Q1BA 3V61A 1C3TA 2NWGA 2IGHA 4JBJA 5GXGB 1PTOC 1HZ5A 1Q81C 1DGSA 5GAEC 1XQQA 2ZVOA 3ZJVA 3AQQA 5E1FA 3PIO3 2QA4A 4WIPA 4FJVB 2NBWB 2KC2A 2AX5A 4DV4Q 1EYGA 1OXVA 3IHPC 4A93G 4XWTA 3MZ5A 2BTEA 1LYLA 2F3IA 4RHSA 2L76A 4X66Q 2RHSB 1TZ1A 4LF7L 3WA0A 3I3CA 1LO5D 4XZ4A 2F0PA 1B1ZA 2XK5B 3SD5A 3UF8A 3S1NB 2WAQB 3AE5B 4BBNC 1VQMA 2YTYA 3S17H 2R92G 4RM9A 3PO3B 4I6PA 4NJ6A 3I7FA 3M63B 5EBCA 4BY1G 5FLXL 3CQZH 4PMWA 1PHJA 4JI1L 4N58A 1WM3A 4HKQA 3CCSA 1SYGA 4HVBA 4C7YA 3S2HH 3E5SA 4HSVA 2MP2A 2KOXA 3I63C 3U52E 4RMAA 3TSSA 3J81i 1VMCA 4YL8A 2R7ZB 4MEMA 1LT4D 3L10B 1UF0A 1UNSA 1HFGA 4HEDA 4MIUA 1EWHA 1WVLA 1FXIA 4GMVA 3WCQA 1TWHH 5JOBA 3DHQA 5JJLA 1SE9A 3ZNGC 1GD7A 1Q90A 5NUCA 4TUUA 2K50A 4LMQD 2G45B 2BKFA 2CQOA 4C4VB 3HRDD 4XT1B 1Q10A 2JF5A 2VUMG 2K22A 3X3NA 1D1IA 4IFDI 1N9WA 1TY0A 5HGQA 4K6LA 4KKJA 4R4IA 4BA2I 1T6BX 1WJJA 4B9XA 1NR4A 3IAYA 4YHHQ 2F0HA 2B2VC 4X64L 2LZ6A 2PIAA 1BOSA 4JBWA 3MXPA 5IYDH 4DF7A 1LTLA 2NZ1D 4J6HA 2N9PC 4MZ9A 1WYWB 2M19A 1TYGB 2M8SA 4RGMA 1NE3A 4TRDA 4QGUA 1MKHA 3R93A 3VYUA 1WTPA 2MBEA 1X3GA 1FVIA 2EMTA 1F77A 3DWPA 4DR2L 2PI2A 2ZEQA 1I35A 2QSDA 1WF9A 5EPKA 5CTRC 4ANWA 4JI4L 4AIMA 3AMZA 4C1NI 5AZHA 1S5CD 4IALA 4NNJB 2A6HC 2VQFL 2ASBA 4JI5L 2LD9A 1LACA 4HJ5A 1HR0L 2B3GA 1ESFA 2XVSA 3NENA 4KJOA 4HJ7A 1WIAA 3NQIA 1ICWA 2J7QB 2N7JA 2F0MA 2EYLA 2DGYA 4B0MA 3H3VC 1JRUA 1M8AA 1IW7D 4HRSA 1WH3A 1HRJA 2GRIA 4A3EG 3HOYG 1K0SA 1FFUA 4LF7Q 1C4PA 2EJGC 1G2SA 1TT5B 1PTOH 4UDUC 1GM5A 1V1QA 5I9PA 3HK0A 3AEEB 3JSVA 4ZOHC 2MJ3A 1GKHA 3DWAA 3I5JC 5LXIB 1EU3A 3G6EA 2EYOA 3UI3A 1UEBA 2V4LA 2NPTA 1QOAA 4R3DA 2F4IA 4O0AA 4LDTD 2F3VA 2GOWA 1Q12A 2GI9A 3KF6A 1BUVT 4ANXA 1W6JA 3ZJYC 1FIQA 3PPAA 1SR3A 3SDLC 1C9FA 1K3BC 1WX9A 1VQ9A 5IN7A 2BB6A 3RZFA 3FPPA 3C8YA 3SK6A 4IUPA 2K5WA 2WXNA 3D6WA 3PO3H 2ZCBA 4XDDA 2N9EB 1CA6A 3PSIA 3Q8AA 1QOGA 1K51A 4WJWA 1N61A 3ML8A 3FPUB 4FULA 3S16B
chains in the Genus database with same CATH topology
4TQUS 3B2FA 1HQMC 3IFDA 4HROA 1HFNA 1CT1D 1QLBB 4X3UA 3AEGB 4RKLA 1C78A 2ACZB 3T16A 1A15A 3A8JE 2SNSA 3BDLA 3DUZA 4ZHPA 3VR6A 3MXUA 3HKZB 3AH7A 3BWUD 3VA7A 2NVXB 3KWLA 1MD2D 2JYOA 4QB4A 3Q69A 1JW9D 3TZUA 4KN4C 4BBRB 2MH7A 1Q8IA 5C4JB 3GTPB 1EY7A 3NTHA 3NHHA 1Q3LA 3I4MB 3SEBA 2WIIB 5CYUA 1U4LA 1U4MA 1JQYD 1E2ZA 1U4RA 3T4AC 2E74C 5CMDA 3ETRA 2Q8RE 1N5WA 3SDZA 3LWEA 2L83A 4TQ0A 2L4NA 3U4EG 4MN3A 2Y3AA 3TZDA 1K50A 1TZOA 2IX1A 1SYCA 4EE2A 4XT3B 4NAWB 3K5OA 3FVQA 1IYVA 3HUIA 5ELCA 4P6VF 3D8GA 3AN1A 1VZ8A 1FD7D 1QCBD 4BBSB 2RSOA 1J7CA 2XWJB 4ULLA 1RWSA 3PIP3 4Q0FA 2L0CA 4G4KA 1YNTE 1K8MA 3DM1A 2BE5D 1X3QA 1SNOA 3I90A 3RZDB 4ZHOA 2AQ3B 2QF7A 1I3QB 3HOWB 1OXXK 1RM6C 3EJIA 5KEEA 4OVZA 2QMTA 1BDOA 1JWSD 2IW3A 5JEAG 1VDVA 3I9V1 3NRZA 1FNWA 3CRLC 4BY7B 2WNMA 2A73B 3MHZA 1SXTA 1AYFA 1FCCC 4NP5A 2PYKA 2KMMA 1OO9B 1EY6A 1ZPSA 2CHBD 1A3VA 4NAMA 2J52A 1WXQA 4C3IB 4HN7A 2K5DA 2R6GA 2JZPA 2WXGA 2QEJC 1DGJA 1QOBA 4WFN3 3AU7A 2JSOA 1NVID 4K8IA 4HSPA 2XRSD 2Q8TA 4QIWB 1S5FD 5F2DA 2QILA 3T53B 2KCCA 1VRAB 2JEAI 3T3NA 5A2QE 1UAPA 2IL8A 2JA7B 3QB3A 2Z4HA 2AWOA 2RDFA 3KK7A 4M1UB 3JAML 2PO4A 4MT5A 5M5YB 5J22A 5JPMC 2NBFA 3TP7A 2RBMA 4P16A 5K36G 3BK2A 1ET9A 1CHQD 2B2VA 5JJZA 1DM0B 1VZ7A 2WXRA 4TKOB 4RGNA 1E0BA 2Z4IA 4BS9A 2FMMA 2F0FA 3TDQA 1WRIA 4CKEA 1V8QA 1CQVA 1KAAA 4OIJA 4PQXA 3T13A 1D5XC 3HS0C 2EJMA 4NKLA 2WP9B 2WU5B 2K28A 4OZCA 1LT3D 1C76A 4RGTA 1HTLD 3L7ZC 1PZJD 1BCPD 4K8JA 5KYLA 1HHVA 2BA1A 2L9HA 3S1RB 3W3AA 2INPE 1AP0A 5C4ZA 3HZXA 1RJTA 1FR3A 4IUVA 3KF8A 4V0BA 2F0UA 1EFID 2M0AA 2PW9A 3IAS1 4ARCA 1O80A 1QOFA 1EU4A 1I4XA 1XLPA 3V3XA 1EWYC 2LS01 1JRPA 2L32A 4KTAA 3N9YC 4HR7B 2FHTA 1U4PA 4A8XC 1EY5A 1W6KA 2WS3B 3GP7A 1WTQA 4XQJA 3DXJC 3OWFA 3SK5A 1B50A 1F0ZA 5G5HA 4GLSC 4DN4M 2M00A 3H0GB 4ZRZA 4A3KB 1PDXA 1V43A 2D9UA 2Z1CA 1STGA 3HG9A 1GHJA 2CW0D 5BN3A 3H6MA 2V0GA 3NQTA 4EQPA 3MHBA 1XLNA 5BN5A 4KY5A 1G291 1H9SA 1ZUD2 1KLGD 3PUZA 4PT5A 2CVRA 1GUSA 5EE3A 4AS1A 2WXFA 1F2YA 1BCPF 5H8YE 3W1SA 3P4SB 3E0JA 1VF7A 1ZP0B 3W5VB 1SE3A 2LEKA 1FD6A 2MGSA 4XYQA 1N63A 2EKIA 5G3LD 4TQ1A 4H0LC 1PRTB 5CV5A 1NYQA 1AEXA 1FNUA 1TKEA 3J9CA 2DYMA 2WXIA 4A9AA 1KH0A 1L5PA 1R7SA 2VB3X 1NUCA 3KWVA 1WTXA 2WINB 5E3FA 3RZOB 1EYAA 3M7GA 4XE0A 3MJ5A 2BOSA 1H9KA 4A3IB 1CZPA 1F9SA 3PO2B 2L11A 1SB3C 1GB4A 2BYTA 1ZEQX 5JEAJ 2Y5PA 4YT0B 1S4ZA 2WXOA 2DWQA 1UEAB 4TMAB 1HA5A 2LKVA 3ZGZA 1HXYD 2E75C 2EYMA 3MWYW 3DWMA 5BMGA 3K57A 2K03A 4FYDA 1IHZA 1DOLA 2KWDA 5D65A 5FK9C 1WSPA 4KI0A 3TP5A 2H89B 3U2SC 2IGDA 3Q8BA 4FF2A 2F0KA 4ZK9B 1GAQB 4GDKB 2HDEA 4LK1C 5JVG3 1KNEA 4DFAA 1JOKA 1WTOA 3HOUB 2AUKA 5J39A 4XQQA 1STEA 1RHPA 1STBA 4ME5A 3T51B 3Q8EA 1RKNA 3OOCA 2B2YA 2PPBC 5G3LF 3J81L 3NVYA 2MP1A 4C3JB 1IUEA 2QKIC 4RH6A 1BCPB 3G7LA 3I73A 4FF1A 2EDGA 2JA8B 1LABA 1J7BA 1SF0A 1XYIA 3PZ7A 1L6VA 3VR3A 1VLBA 5E6JA 3E9SA 1C48A 3FEWX 4OW0A 4YTPB 4WQMA 1R4PB 5AUKA 1D4BA 3ND9A 3I4LA 4ZRQA 5IOCA 1F2MA 2EELA 5C2TB 4OO1H 3AB9A 1QILA 1G6ZA 3DWGC 2VZKD 1DXMA 2A6HD 2RDGA 2PCFB 3FILB 2I2YA 4XTCS 1JWUD 3AM9A 1A70A 1E2WA 4FXDA 2NYZD 2F03A 4RAUC 1RFKA 2RA4A 3K5MA 5H92C 1JOQA 2NUCA 1V1OA 1ILPA 4R8IA 2X6LA 5CV8A 5KNDA 1TVXA 4EGVA 5COYA 5HG2A 2NVTB 4LLGM 2KN4A 4ZKBB 1Y1VB 5CV7A 3D31A 5ISRA 2YEPF 2KCNA 1ML0D 5CBEE 3HOVB 2F1MA 2NB0A 4WORA 1II3A 2A69D 1QJOA 3AE4B 3O13A 3N52A 3L4PA 1TS4A 4FF4A 4HCEA 1JB3A 4RA8A 4A55A 2B2UA 4QCLA 1YNND 2JEBI 5T8IA 1SSNA 4K5XA 2M2LA 4X3KA 1SE2A 4JWUC 1TS3A 4O1NA 5I2YA 2WKCA 1DOMA 3OIPA 3ND8A 3NWTA 1RCVD 2XIWA 3A54A 3ZYYX 2BBCA 3S14B 1PGXA 3PO0A 3S1QB 4L63B 2WDVB 1BR9A 3VYSA 2TSSA 2KDMA 1IBXB 5D3IB 4IUTA 1RTNA 5T1GA 1SNPA 5HGTA 4RCOA 3HVDA 1LTTD 5FO7B 1R4QB 5D14A 3KBGA 1NI3A 4G7HC 2YU9B 1FFVA 5ELEA 1YN5A 4PMBA 3CKIB 3J7AF 4RCNA 4Q2JA 5TSSA 2EYJA 1SDFA 1YNJC 2WXKA 2JYEA 3VR2A 4IDIA 1QWYA 1BO0A 1D5ZC 4C3HG 1JMLA 4MHEA 1QKZA 5C3XA 2KACA 2ON8A 5CV4A 1ILQA 2ZW0A 2AUJD 4KV6A 4H2AA 4DNTB 3NS1A 2DLBA 1RTOA 5CV6A 5I4DA 4IOIE 4HTHA 5FR3A 2I07B 3GD7A 1C8CA 2LHDA 2PVGC 2N55A 1SYEA 1Y69U 2O4XA 3NSWA 1EWCA 2DY7A 1Z6HA 4H44C 3MFYA 1XEEA 1K52A 3AEFB 3NK9A 2JWUA 4O42A 3HOZB 1E0ZA 3FDTA 1GUNA 1QQRA 4UAIA 1ENFA 4KHVA 3HRZC 4B08A 1MSGA 2E3TA 2HCCA 1SMYD 4DAPA 5LL6S 1B9MA 3CIRB 2PNRC 2A68C 2KEDA 1KRHA 3W5UB 5ELBA 5C44B 3D6CA 2OHFA 5BYQA 3RFZB 3OIQA 4H7BA 4YIJA 2AQ1B 2PMZB 1V1PB 3AE9B 3DMUA 3ZJUA 1J9OA 3L3OC 2N88A 3BDOA 2JSVX 3JAME 2JQRB 4P2CB 1B53A 2B2WC 2HUGA 3J7AV 3QG1A 2NTTA 1AFPA 4DU9A 1PGAA 2W3RA 1PZID 3P4PB 4GDLB 5AUIA 1B9NA 1SNDA 5BYRA 2FJ2A 3BG3A 1IL8A 5HFYA 5LL6X 1JICA 1CI3M 4USAA 1TWCB 1BBXC 4ZKCB 1YJIA 4OZAA 1DONA 5IGEA 4A93B 3I8ZA 3GTMB 4RF0A 2LUMA 1P7EA 2K5PA 1O7ZA 5IGCA 3FAHA 1T5XD 3MFGA 1O7YA 2R92B 3VA5A 3GTLB 2OEDA 2VB2X 4BY1B 2MUYA 4E6IA 1E2VA 3R3OA 2A6EC 1GHKA 2EPBA 2HDLA 4BWGB 3A56A 3M85A 4IKGA 1AW7A 1VJKA 2BW2A 4U673 2JXMB 3EA6A 1MI0A 2BA0A 3ABVB 1GUOA 2SNMA 1GB1A 1EYDA 1TWAB 1STHA 2CQAA 1WTWA 2VUMB 1NENB 2PZWA 3BYYB 1K53A 3MXGA 2PKOA 5IT9E 5DAUA 3QOLA 1I50B 2LY7A 1ZXIA 4C2MB 3H8HA 4LAAA 3D4WA 1C77A 1QF6A 1XLQA 2HQEA 1MHHE 1CFMA 2V4IB 4U68A 4US8A 2W82A 1IGDA 3PUYA 5HHDG 1B9RA 3C3LA 5MPOA 2B2TC 1WTRA 2F0SA 2Z8LA 4IQZA 1I6VC 2RMMA 5M3MB 3EQLC 3H09A 5M5XB 3EVQA 3VYTA 3R2IA 2R3ZA 2J0TD 4A3EB 3HOYB 2EXZA 2PW5A 2WV6D 1QNKA 4HMIA 1QOHA 1XCQL 2SEBD 1S5DD 4IUNA 1YQ4B 1TY2A 2RSNA 2EZVA 1SYDA 3GV6A 2KAJA 1BQQT 1ZOYB 1EY0A 1ZYRC 4MH8A 2ID0A 1HPCA 1SNMA 2WDQB 2B2YC 4CKBA 1SEBD 5CC4A 3GO5A 3NXWA 5HURA 3P1HA 2DN8A 1Y8OB 2WB1B 2O5IC 1L0VB 3AE6B 2AQ2B 3EUB2 4XYOA 3EFXD 3F2UA 2JYTA 5G5GA 4ZYSA 1IW7C 4IUQA 2F0QA 2BB5A 1AZPA 2V3NA 1O7LA 2WXMA 1WCMB 2IJ0A 3C46A 3VR4A 1YMHE 1JWBD 4YSZB 3GTGB 4DXFA 1LTID 1JCKB 3KQ4A 2BDOA 4Q5VA 2G1EA 3IT4B 1K8OA 4OO1G 1CA5A 1UGJA 1I6HB 3HVZA 5EKKA 4JE3B 5KYIA 2G9HD 2NTSA 2KQ3A 4M8AA 2NVYB 4H13C 4QUCA 3P63A 2F0WA 1FGBD 2QJLA 1N62A 2CU3A 3K0YA 2K05A 1EY4A 1RD9D 2Q8IB 3J81E 1YQ3B 5J1ZA 3U9SA 1JWMD 2F0VA 1PXUA 4F88A 3Q0AA 4B9WA 3KLRA 2WU2B 2VXWA 3IXSA 1P7FA 2KUMA 1PLFA 5I2XA 1HZ6A 1E9MA 3GTKB 2B2WA 1DOIA 3M4YA 2EYPA 5C0XG 2F0JA 1O78A 3RUZA 2EE1A 3P1MA 3AE2B 1D1KA 2E2IB 3NVWA 4RF1A 3WOEA 5DNFA 2E76C 3AB5A 1K83B 5K5PA 4KKUA 2B2UC 1LTGD 1CTMA 2V3PA 2WDRB 2E2DC 1CZGA 4C3JG 1D2BA 1TWGB 2H88B 3DWQA 3NVZA 2MPMA 5JXVA 1U9RA 2F3WA 4IUUA 2VNUD 4C80A 1FRDA 4KD3A 1HA6A 5M3FB 2XNAC 3A8KE 1TQOA 1GUGA 2BE5C 3BS1A 4XWWA 3DEPA 3K6OA 2ZXPA 5DM73 1GXDC 1B4OA 3VR5A 4J1MA 4K6DA 1PRTC 5IODA 3PUWA 4N9PA 4XDCA 1KNAA 4R9WA 1MBYA 1JROA 1CJEA 5EE9A 2Y0SB 2F0DA 1G91A 2RKSA 4NJCA 1JR0D 2ZW1A 2D62A 2M9VA 3U9OA 1LT5D 2NN6H 5FOBB 3NP8A 3W9CB 4AQ7A 2GA4B 3TN2A 2BS4B 1EIGA 4DK1A 1J7AA 3SR6A 4FP5D 1LV9A 3BYTB 2B2TA 1PTOD 1ESRA 2K5QA 1TKYA 4OL7A 1CK1A 1Y8PB 1L4ZB 4N9TA 1X3PA 3D4DA 3ERQA 5IIFA 1XCTL 1SE4A 2JP1A 1C4CA 3AE7B 4LJZC 4ODGA 1JC7A 5BMHA 2EY2A 4CJ2C 1Y56A 5FLXE 1DCZA 5BN4A 2WXJA 2N9KA 2NVQB 3Q6SA 2PW7A 2EVBA 2KHSA 4ZRPA 3RD4A 1WYGA 4WH4A 4KKTA 1SNCA 1AWDA 3H91A 2DNEA 4C56C 2W54A 1YNJD 2HTME 2J7ZA 1STYA 1XX8A 3J80L 3A7LA 2OXPA 3IFTA 1BCPC 3MEHA 5CBAE 3NUCA 3DEOA 4F8MA 4KX6B 2IPKD 1NSNS 3VYRA 3BVZA 3A55A 4NDXA 3U7ZA 4DQOC 4DGZA 4I7ZC 2V4DA 2F0OA 4HKZE 2R61A 1QT9A 1F2RC 4EQNA 1UWMA 1I4HA 1B2TA 1DD2A 5ELDA 3RLFA 4JPSA 2LFNA 3VR9B 1XWEA 4RNAA 2DYOA 2K7VA 3MTSA 1PTOF 2F0TA 1F9PA 2A74C 4L6TB 3B2GA 1EOTA 1GOZA 1TR5A 1CM9A 1NYRA 4HMJA 3T3OA 1NCVA 5JVH3 1TT2A 4FXGC 3S17B 5C3JB 2A68D 3FRPB 3C1FA 1Y1WB 3CQZB 4CKCA 5FO8B 3S2HB 4ABNA 1QNUA 1RF2D 2CW0C 2KJXA 1TS5A 3Q8FA 4FVMA 1VR9A 2G9DA 1RODA 3P7JA 1WTVA 1SJED 2JU6X 4DA2A 3UI2A 5C0XJ 4RFBA 5CORA 4KD4A 4KN7C 4BA1I 1VDZA 1I4GA 4L8JA 5C0XH 1L4DB 5AFWA 1PMRA 4IFDH 1VMPA 1FMAD 2EJFC 4IURA 3S2DB 4YTMB 5I9OA 4L23A 1BUIC 1LTAD 3TUOA 1LT6D 3TEYA 4K5WA 5EBDA 2K3UA 2MEKA 3LXFA 1F9QA 3SXHA 1EQVA 2KEEA 1LLRD 1B44D 5EQ0A 5JAVA 1T5EA 4JX1C 1DOKA 1OXSC 3N6RA 1A6XA 2ICEC 2BDNA 2INNE 3PMFA 2DY8A 1HCZA 2M56B 1TU2B 2D5DA 1PTOB 5KNCA 1STAA 4V190 1V8CA 4IZ8A 1IYUA 1ZKOA 4OO1I 1FXAA 4L1BA 3LNNA 3T56B 1XXGA 4WAFA 4K2KA 5EJWA 3LX0A 5IGBA 1TS2A 4DK0A 1BNZA 1ONLA 4EQOA 1KFYB 1T3QA 3ITPA 1ZE3D 5FKAC 1EY8A 2FMCA 3D4RA 1Z7TA 4EVOA 4J3OD 2AWNA 2KECA 1C4QA 2OF1A 3TMEA 2YEPB 2O2LD 1ACCA 3NWSA 5KIXA 2IT1A 3AE8B 3HGBA 2EY6A 2JE6I 2WP8J 5C3WA 1OXUA 2JA6B 4FO2A 1HQRD 2L1AA 1PUTA 1VZ6A 1TKGA 3FKIB 3Q23A 1HUNA 3M7NA 3P42A 5C0XI 4G7ZC 2SOBA 3HEJA 3ZJTA 3PUXA 3SHLA 2PZTA 1H9JA 2XN9C 2I38A 3RMHA 3AV8A 2E6XA 3CHBD 2W55A 4QF4A 1BMLC 1ZYRD 2VZKB 5KRUA 4KY7A 1UUPA 1I4QA 2WQYB 1JE4A 5FO9B 2QCPX 3EGRA 4ARIA 1TWFB 2MJEA 2O5JC 2K32A 3TEWA 1L0XB 1ZDVA 1EY9A 1X32A 3KUPA 1L6UA 4A3MB 3LWUA 1F2RI 4WURA 5E4WC 2X38A 2X69A 4JK1C 2A5HA 4C3IG 3I70A 1DJRD 2QIEB 3NUHB 4KK7A 4YTNB 1EYCA 3LYYA 1EQTA 4S3SA 2B39A 3QJYA 1FO4A 3BDCA 1KABA 1JWAD 3PZ8A 4MACA 1FYCA 2B8FA 4PMCA 1A2UA 2OEOA 5C5MA 2A69C 4KGTA 2H1EA 2K6AA 1SYFA 2N0SB 3OHXC 1FNVA 4GZYC 4FF3A 1I7HA 3FMCA 3CWIA 1PZKD 1JQ4A 5EGTA 3S1MB 2DBYA 2RQXA 3P4RB 2FFKB 1STNA 1QE6A 2OT2A 1E7PB 1YNNC 3FILA 3A7AB 3V96A 2PVOD 1H9SB 4REZA 4A90A 2B8GA 3SFDB 1ZXTA 5A35A 1YJJA 1I4PA 3EROA 3V2TA 2MJ8A 3SK4A 1JOOA 2D2CC 4ZLTF 2E2JB 3S15B 4DAVA 1ET6A 1A3UA 4N59A 1OQRA 3V05A 4C3HB 1G8ZD 1PFBA 1E10A 3SVMA 1KLUD 3TEZA 3C2PA 2N9LA 1IKMA 4CJ0B 4XDXA 4LK0M 3QIAA 3G6JB 1EIHA 3HP3A 4KJNA 4RHRA 2RDHA 2NN6G 3NBHA 5M5WB 1ZDXA 1R9TB 3FC4A 5C6AA 4KMUC 1GPXA 4NW2A 1OQQA 3NE5B 5DEHA 2PTLA 2WXPA 2K9XA 4OGQC 1F9RA 2ZXRA 4DXGA 2RVLA 1JALA 3MAQA 4CGYB 2CJOA 1KDCA 4ZUJA 4A3DB 1TIID 4C1NK 1SBBB 1NEKB 2F0NA 1PDQA 1EEID 1IBXA 1CZWA 1ENAA 3BIID 3NTIA 4RWSC 1TJEA 1PRTD 1QG7A 4CBVA 3P4QB 3SFEB 1M4VA 3PV0A 5I6WA 3ONAB 1S5ED 2FINB 2C9OA 3IKJA 1XTCD 3GTOB 2J53A 3SE0A 4K14A 4XQNA 2LMCB 4RGOS 2IGGA 3GB1A 3A8IE 1WWTA 1SMYC 1NR2A 3OWEB 2F0IA 2WACA 4IN3A 3Q8CA 2E2HB 1BF4A 1MHXA 3KBXA 1H9MA 4HCSA 3D3RA 3ZQ4A 2F0EA 4WRDA 3SR1A 3GQBA 5C5LA 1KDAA 3OPOA 3MC0B 3I72A 4J8QA 4A3JB 3K59A 5C4XB 5HI1A 2PZUA 3QO2A 5C4HA 5EPJA 2WXQA 2PQEA 1NAPA 2JX5A 1GUTA 3K5NA 4A6QA 1DZ1A 3NVVA 3TBIB 3MA2B 2R93B 3OSOA 4OHJA 3I4NB 1G2TA 4M0WA 2JXTA 1Z47A 3AEBB 1LTBD 1SIJA 5EKLA 4G7OC 2NMQA 4NMZA 2PMVA 4F7XA 1N5XA 2LFIA 2KQ4X 3J80E 2B63B 1KTKA 4KKIA 2K1BA 4K2LA 1PRTF 4MM3B 3BK1A 1WD0A 1PYWD 3URYA 3VRBB 2GB1A 1V1PA 1S5BD 2XWBB 3IT6B 1SJHD 2CJNA 1FRRA 3IL8A 2LJIA 4QUFA 4IFDG 1ROEA 1DOXA 3BVGA 5T1IA 4ILWA 4OIKA 4NZLB 2L52A 2K04A 1B3AA 1DYQA 1XO3A 5ELFA 4I65A 4CHTB 5D7GA 4KHZA 5LNK1 3M4OB 4OZBA 1AN8A 1D5MC 1IKLA 4RKBA 1CQFA 3WDNA 4TSSA 3CU7A 1N60A 1LTRD 2YYZA 2K33A 5IT9L 4KGSA 2MHVA 2DNCA 5EPLA 3K7AB 4QMGA 3GV3A 4YWGG 5BMIA 3MP9A 3GS2A 4FNFA 3MXNA 2D5GA 3BZDB 4B0EA 3OW7A 4ZQ3A 2L1BA 1RDPD 3TP8A 1DOYA 1SYBA 5LHY1 4PV1C 4A3BB 2ENBA 2ZXOA 3I91A 1SFOB 4CQNA 2K01A 3AE1B 2HDMA 1EZ6A 1A3TA 1MI2A 1VF5C 4ITKA 2HCIA 3NPPA 3AECB 1V97A 3NZ3A 1EL0A 5DM63 3AE3B 1A2TA 2L12A 1UWXA 4HJGE 4Z9CB 3AEAB 1MPEA 1IGCA 3BVMA 1ENCA 5JPNC 1I4RA 3H94A 3HOXB 1J8IA 4ID6A 2EYHA 2SDFA 4K5VA 1RYJA 2IWHA 5IGFA 4X3TA 3GTJB 5A2QL 5BYSA 3KLSX 2TMPA 4JWSC 3AMUA 1Y8NB 1GUWA 2BT6A 2BCOA 3P75A 3P20A 3KLSA 2XSCA 2MJDA 2KA7A 3E56A 2JA5B 1CHPD 1EM7A 3LB8C 5JEAH 1QB5D 2LHEA 1HUMA 4N6EB 3NTKA 2WKDA 4HAEA 3VRAB 3K58A 5EE0A 2EOTA 1KF6B 1Q1EA 1PFNA 3R8BA 1MVKA 1PGBA 1EEFD 2LGIA 1YN3A 4R8NA 4PNYA 3CRKC 3Q22A 2I46A 3OMCA 3VR8B 3WOFA 1OFFA 1MGSA 2ICIA 3K5LA 3NBIA 3S9WA 3Q24A 3SK8A 5E4XA 2H4OA 2WLBA 3J7YW 3QWNA 4DNRB 5M9OA 2LMCA 3TP6A 1JORA 2FUG1 1SAPA 2WXHA 2IX3A 4A3GB 4HEA1 3M3YB 1AZQA 1OXTA 4A3FB 2KVMA 3I57A 2SAKA 5EE1A 5CV9A 4WWMA 5CGKA 1YN4A 2Y5CA 1FM0D 1C79A 4XIGS 4F87A 5K36H 1HEZE 2WXLA 1SSOA 3B9JA 4D2KA 3R2TA 4G57A 3IAM1 2L55A 2NN6I 5CR3A 2ZT9C 4XXEA 2B76B 1F2ZA 4YXDB 1WD1A 2IDYA 2PLPA 5EKIA 3OMGA 2J4XA 4FXCA 3MVVA 2BS2B 1PFMA 4KY6A 4FXKC 3GTQB 1PFDA 4L2YA 4DAYA 1F2LA 1SNQA 2J42A 1ZXHA 1TWHB 2L5TA 2Q5WD 4YSXB 3AEDB 2X6GA 4IFDJ 5KNBA 2RPVA 4ZUIA 1WGKA 4YSYB 5C3EB 2EY5A 5IGDA 2XRQD 4C7ZA 3E6ZX 3QOJA 1EZ8A 2EYFA 1XF5L 4KGRA 1L0YB 5KGUA 2F0GA 1BXTA 1FEHA 1KDBA 4KKSA 4X3SA 3TEXA 4Y7NB 2BS3B 2F0LA 3L9AX 1VCIA 1E6EB 2ONQA 2IX0A 4ZAIA 5IGGA 1C4AA 1XLOA 4US9A 1LTSD 2EY1A 2W3SA 2FE8A 2QDBA 1FCLA 1GJXA 1TKWB 3W2DA 4CJ1B 5I6YA 3C1EA 5D3DA 1H9RA 2A6ED 3RPFC 2C5CA 4AYBB 3X3MA 2KOLA 2K0PA 1D6EC 1HTPA 4LTUA 1MSHA 3PUVA 2FBWB 1Q1BA 2NWGA 2IGHA 5GXGB 1PTOC 1HZ5A 3ZJVA 5E1FA 3PIO3 4WIPA 2AX5A 4XWTA 2BTEA 1OXVA 3MZ5A 4RHSA 3I3CA 1LO5D 2F0PA 1B1ZA 3S1NB 2WAQB 3AE5B 3PO3B 5EBCA 5FLXL 4PMWA 4N58A 4HKQA 1SYGA 4C7YA 3U52E 3E5SA 4HSVA 3TSSA 1VMCA 2R7ZB 1LT4D 3WCQA 1UNSA 1HFGA 4HEDA 4MIUA 1EWHA 1WVLA 1FXIA 5JOBA 3DHQA 1Q90A 5NUCA 4LMQD 3HRDD 4XT1B 1Q10A 2K22A 3X3NA 1D1IA 4IFDI 1TY0A 4K6LA 4KKJA 4BA2I 1T6BX 4B9XA 1NR4A 3IAYA 2F0HA 2B2VC 2PIAA 1BOSA 4JBWA 3MXPA 4DF7A 2NZ1D 4J6HA 2M19A 1TYGB 4RGMA