3R8BA

Crystal structure of staphylococcal enterotoxin b in complex with an affinity matured mouse tcr vbeta8.2 protein, g5-8
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
236
structure length
224
Chain Sequence
SQPDPKPDELHKSSKFTGLMENMKVLYDDNHVSAINVKSIDQFLYFDLIYSIKDTKLGNYDNVRVEFKNKDLADKYKDKYVDVFGANYYYQCYFSKRKTCMYGGVTEHNGNQLDKYRSITVRVFEDGKNLLSFDVQTNKKKVTAQELDYLTRHYLVKNKKLYEFNNSPYETGYIKFIENENSFWYDMMPAPGDKFDQSKYLMMYNDNKMVDSKDVKIEVYLTTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin/immune system
molecule keywords Enterotoxin type B
publication title Molecular basis of a million-fold affinity maturation process in a protein-protein interaction.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 70
structure length 224
sequence length 236
chains with identical sequence C, E, G, I, K, M, O
ec nomenclature
pdb deposition date 2011-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3r8bA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3r8bA01
1D5MC 1M4VA 1BXTA 1PZID 1RF2D 4L6TB 1EU4A 2QEJC 1EEFD 1LTAD 1EWCA 1PTOB 4DXGA 1JR0D 1KTKA 1PYWD 1HQRD 1MD2D 3KLSX 1RDPD 3DWPA 1EEID 1I4PA 4OHJA 1D5ZC 1G8ZD 1LT5D 1D6EC 1LTRD 1SJED 2G9HD 4RGTA 1SE3A 3BVGA 1ET9A 1JWSD 4RGOS 1S5ED 1TY0A 2TSSA 1KLUD 5FKAC 1EU3A 1PTOF 5I4DA 3MC0B 2ICIA 1BCPF 3BZDB 1CT1D 1B1ZA 5TSSA 3BYYB 1T5XD 1S5CD 1V1OA 1XXGA 3TSSA 1TS4A 4RH6A 2SEBD 3GP7A 3O13A 1FD7D 1KLGD 2AQ3B 2NTTA 3OWEB 1I4RA 4NZLB 4L63B 1AW7A 1PRTF 1DYQA 2XRSD 1SE4A 4RGMA 1RCVD 1JWMD 1V1PA 1FNWA 4C56C 2RDGA 1LLRD 1JQYD 1CK1A 1LT3D 1HTLD 1L0XB 1PZKD 2CHBD 2WV6D 1JWUD 1LTTD 5ELBA 2AQ1B 1D5XC 2R61A 1S5DD 1I4HA 5ELCA 1FGBD 1BCPC 1BCPD 1S5BD 1SE2A 1SBBB 1ET6A 3V05A 1UNSA 2XNAC 1YN3A 1CHQD 1B44D 1RD9D 1JCKB 2IPKD 4K6LA 1YN5A 1SJHD 1DJRD 2QILA 2IJ0A 1LT6D 4DXFA 1TS2A 1V1PB 3R2IA 1STEA 4RGNA 1L0YB 1CQVA 1LT4D 3BYTB 4RFBA 3BVMA 4Z9CB 1AN8A 1PRTC 1PRTD 1GOZA 1SXTA 2NTSA 1I4XA 2XRQD 1LTGD 3SEBA 3EA6A 1PTOH 3BVZA 4UDUC 4BWGB 1PTOC 1HA5A 1PTOD 2RDHA 1YN4A 1XTCD 1F77A 3DWAA 3W2DA 1HXYD 1LTSD 1FNVA 1TS5A 1ESFA 2O2LD 3DWQA 4TSSA 1I4QA 1LTBD 1TS3A 1EFID 1S5FD 1BCPB 2Z8LA 1PZJD 4RHSA 3URYA 4RHRA 1LO5D 3EFXD 3CHBD 3R2TA 4RCOA 5ELDA 1LTID 3R8BA 1I4GA 1UUPA 2AQ2B 1FNUA 2J4XA 5ELEA 1QILA 2XN9C 1SEBD 4ZYSA 5ELFA 1CHPD 5FK9C 1ENFA 5D3DA 5D3IB 1PRTB 4O1NA 1TY2A 3MFGA
chains in the Genus database with same CATH superfamily
1UWMA 1TWGH 4AJYB 1EU4A 3Q22A 3NJTA 2K5NA 4EFOA 2WB1G 4OIJA 2KCNA 1P7FA 3KYDD 4KN4C 3QOJA 5J22A 4FNFA 1L4DB 2J53A 3M4QA 3DLLA 3ICEA 2WB1B 3K9PB 4H2AA 4LTUA 5IP7G 3P4QB 1VQFA 2N78A 3PPAA 1TWFB 2PI2A 2IO3B 3RULA 4RGTA 1P98A 4A8XC 2X69A 1S4ZA 2PZWA 4NMZA 1MHXA 1E7ZA 2BA0A 1EWIA 4B3TQ 4OEMB 1JOQA 1R7SA 2GBKA 2XTIA 4HDOA 4OWWB 2JA7G 4R9WA 4M02A 5LMNQ 1X3PA 5CX3A 4C7ZA 3R3MA 2K0PA 1CT1D 2JA7B 4NXML 5M3MG 2XGTA 5AZFA 2BYFA 2Z59B 3HVDA 2HJ8A 4LW1A 5M3MB 5IYCH 1SSOA 3T53B 3BK1A 3S17H 3G71A 2D0OA 1YJ1A 4DV1L 4GGQA 1S40A 3DHIC 4KKJA 3TJPA 2EYJA 2KLGA 4HCNB 3T9LA 2HT1A 4IWOA 1R4PB 2RR9A 4OIKA 1XPRA 4YWGG 5LMUL 1U4AA 2KQ3A 4MNOA 3J7AV 4B9KA 3M95A 2MBQA 3PSEB 1V1PA 1W2BA 2K5WA 3TMEA 2WX1A 4WJNA 2UUCL 1WGHA 4CO7A 3AULA 2F0PA 5I6YA 2RF4A 1J5EL 3RZOB 3NE5B 4IPGA 4JOIA 3C1EA 2JEBI 4IJLA 1V9PA 1HH2P 4GN4B 1E8XA 3I73A 3AE7B 1C8CA 4PS3A 4FXDA 2N0SB 3N1ZC 2FHTA 2KC1A 2EDGA 3HRZC 1HUNA 2YTYA 1UE6A 1CJEA 1DM0B 3WAPA 2KFKB 3ONSA 1S3OA 2QILA 2IJ0A 3HOYG 1ASZA 2LXAA 1WXAA 4GDLB 3HOYB 3QC8B 3HOWH 1OQRA 1WGYA 3APCA 1CQVA 1QNUA 3N20C 4FF4A 1MHHE 2KUMA 4ANVA 1K53A 4KJOA 3IAM1 1RTOA 1PMRA 3CMAA 1VS0A 4K0KL 2KN5A 2PE9A 2BQQA 3HG9A 4QMGA 3N1YC 1JC7A 4JYAL 2MA9B 2DX5B 3FPPA 2WXOA 2L0CA 4GN5A 5HGQA 5C4HA 2OXPA 2F3IA 2RDFA 1FNVA 3F1ZA 1MI0A 2KX3A 2WDTB 3NVYA 5G5HA 3VXWA 2BA1A 2CQOA 1BO0A 1QWYA 2E74C 2FFKB 4KJNA 2NN6G 3TDQA 1C76A 2D07B 4F87A 1TKGA 3AEDB 1NYQA 3J81L 5JJKA 3URYA 1RLFA 2GBMA 1EOVA 3R2TA 5JJIA 5HURA 1JJCB 2E5LQ 3L2PA 5ELDA 4BA1I 4L5SA 4KGSA 2J0TD 3L7ZC 4FA6A 2DNCA 2E2DC 3PZ7A 1IW7D 2VQEQ 1IGDA 2WXJA 3M4OB 3PF5A 4NNJB 1ZKOA 1SNCA 2D2CC 4HMIA 2Z6KC 2G45B 4RCNA 2MEKA 1I50B 1I3QH 1M4VA 4ZHPA 1RHPA 3T1HL 2N7EA 2M9VA 1S1QB 1IYUA 4GIVA 4PYUA 3BS1A 2G4SA 1DOKA 1K8GA 3K5MA 3ZGZA 4XYCA 3D4RA 3I72A 4C4VA 3AB9A 2ZW0A 4XT1B 1SGHA 3QX1A 4ABNA 2QSDA 4K14A 3CWIA 2F0UA 4B3RQ 1II3A 2UUAL 1Q10A 2I46A 4KY7A 3LXFA 4RF1A 2TSSA 3QCAA 4E6IA 5IP9G 2N9PC 2ZJPA 3BK2A 3P2BA 2ZCCA 2QMTA 5IYDG 3MC0B 2OOBB 1N32Q 2YLMA 5KNBA 1QLBB 5GAHC 3K5OA 3NWSA 2IDYA 4F7ZA 1J0GA 4TQ0A 1Q1OA 2KCCA 3HZXA 4HTHA 2K33A 4BY1H 1T0YA 4MGIE 4DV7Q 2RBMA 3PUWA 2V4IB 3MTNB 4IFDI 4HXDA 3MXPA 2B8GA 5AJ3Q 2WXRA 1H9RA 1YBYA 4DA2A 3UQAA 5I9OA 3HVZA 2HQLA 5IWAQ 1JB7A 1YNTE 2K9XA 3MHSD 1I94L 4LJOB 4D2KA 3E9SA 2A74C 2HCIA 3OWEB 1UEBA 2X6GA 1WGGA 1IBXB 2K03A 1TKEA 4YCWA 4CDCC 3OTOQ 1N60A 2B2WA 1E90A 5IYBG 4JC0A 1JWMD 1G6ZA 2L52A 2KCTA 1HTPA 4B9XA 4C56C 4JV5L 1WR6E 5T1GA 5JPNC 2JA5H 4LF9Q 4BXXG 1BF4A 3GE3C 1DOMA 4JBWA 3V6CB 5ELCA 3PO2H 2KOXA 2D0PA 5JXVA 3A9JB 2LVOA 1HPCA 4DBGA 1UNSA 2LY7A 1TXYA 4J6HA 3AEAB 2K6AA 3AMZA 4K5VA 4XZ4A 3G48A 3LB8C 2J7ZA 1TYGB 2MNAA 1W6JA 4J6IA 4A55A 2DYOA 2NS5A 1PV4A 1IP9A 4MH8A 4ANUA 5MPOA 3RUZA 2QEXA 5FJ8H 2KX0A 2WXGA 3DVGY 1WVLA 4YIJA 2B3AA 1OQQA 4JIOU 1LT4D 2G1EA 2RGFA 2OT2A 4IUMB 3Q0AA 3ZIMA 4IQZA 1IGCA 4OWXB 2M8SA 4RM8A 3UDFA 2N4FA 4WWPA 4EEWA 2RHQB 1I5FA 2XIWA 4MN3A 1M94A 3DVGX 3E56A 3DUZA 4FO2A 4BZAA 2KTRA 4RKBA 5JEAG 3S2HB 4NY0A 2AMCB 3MXNA 5LL6S 2F3WA 1R4MB 1EL0A 4JGHB 4DAVA 2KZRA 1YNXA 4WWNA 4IUTA 4OX9Q 4C2MB 5CHFA 4K2KA 5CV9A 3S1MH 4W9HA 2FINB 1TZOA 5C2TB 2ID0A 4A3BG 1IYVA 5D14A 5C23A 1WYGA 3PCOB 4C3HH 4KIKA 1FPYA 1R4QB 4W9CA 4A3BB 1MG8A 1HQMC 5FLXc 1VQ9A 4DAYA 3GTQH 4IM3A 3ZDMC 3VFKA 2J4XA 4HIKA 5IT9c 1WTXA 1D4BA 4RWSC 2PQAA 3VYTA 4YSZB 2HQEA 3TEYA 4CJ0B 4PZ6A 1PA6A 2GI9A 3P1HA 3IRBA 2M2LA 1V86A 2R6GA 2OQ0A 2D10A 5DPWA 2CW0D 1GKHA 2RSNA 4AQYL 3KWVA 1FRRA 3EECA 1L4ZB 2V3NA 1ZGUB 2O6VB 3VDYA 5EPJA 4E71A 4P71A 4LK0M 1ROEA 3JC66 2ZJDA 4L5QA 1J6QA 5CYUA 3EC8A 4S17A 3T56B 5FO7B 3FC4A 3EN2A 4PZ8A 3RD4A 2EY1A 2L12A 1ENAA 1TY0A 3GTJB 4LUVA 1BDOA 1NCVA 2I5HA 1I6VC 2C7HA 2WXFA 1VQLA 5FR6A 2L4NA 3K81C 4KKUA 3G6EA 1GC6A 3SR6A 4K5WA 4FBJB 5JEAJ 1Q8IA 3PRPB 4PQXA 1ZE3D 5COYA 3WOEA 2QCZA 2Q8TA 2UUBQ 2KCMA 5BN3A 4YY3Q 3PUZA 3S14B 2KBNA 2E6XA 3CQZH 4FJYA 3MJWA 5IKCM 3KF8A 4R4CA 3DBHB 3K7UC 3TREA 1FCLA 1E3PA 1AW7A 4TKNA 1IBKQ 1ASYA 1F9SA 2E2HH 4NDXA 1WTPA 4IPHA 1O7YA 5BMHA 1TQOA 1GB4A 4C3IH 3HKZG 5EPLA 3A8KE 3W1SC 4K6DA 1Q3LA 1L1OA 2JJQA 3HKZB 4FULA 1OXXK 2F03A 4MM3A 1RFKA 2Z6BA 4FYDA 1ZYRD 2QDFA 1SBBB 2IBIB 2Y5PA 4AJWA 3VRAB 1V5OA 4B3TL 4ZRIA 1BUVT 1J7CA 3X23A 2LXCA 2B8FA 3UDXA 5LMNL 3TEXA 4A3KG 3M4PA 1V1PB 1KDAA 2Q2TA 1VZ8A 4GOPA 4A3FH 2R7ZG 3NP8A 4A3KB 3S16H 1S3SG 2NVUI 3TIXA 1L0YB 1X54A 3MXUA 3AU4A 1A0IA 3BVMA 2R7ZB 2WS3B 3D3RA 1WR1A 2HD3A 4DR6Q 1GOZA 2NVXH 1EY4A 1E1OA 3N30A 1XLPA 4HRSA 3ABVB 1O7ZA 3H15A 1C78A 3A7LA 2F0NA 2XEWA 3CSFA 1HA5A 2RDHA 4JI2Q 4A6QA 2K22A 1V6EA 2IGDA 4KVGB 4U673 2VL6A 1XYIA 4DHZE 1F2ZA 3WAOA 1BCPB 3STBC 3STBD 5KRUA 1JWBD 1OQYA 5FLXE 1F0ZA 3A8IE 4HCEA 2L9HA 1VQJA 3L17A 5EE0A 2JQRB 4W9JA 5IT9E 3N6RA 5LNK1 2L1AA 1YOVB 3DOWA 4A20A 1SN8A 2D5GA 5FK9C 2IX1A 4AYBE 2N49A 1SROA 3IT6B 4WORA 4OW0A 1XPOA 3M9BA 4K8JA 1LUZA 2JXXA 2K8HA 1C4AA 4O1NA 1DGSA 4A93H 3HOZH 2FBWB 1MHWC 1VCBA 2ASQA 3T3NA 1PDQA 2B63G 1ZW7A 4L5TA 2IO1B 5GQOA 3T51B 1YITA 1PH7A 1AP0A 2M4NA 2B63B 1EWHA 1PTOB 1HHVA 1B8AA 3CP0A 5TR5A 3KLSX 4L2YA 4P6VF 3RUIB 2NN6I 3ZQ4A 3ERQA 2FJ2A 4DXAB 4UP9A 4ZQ3A 5JVG3 3DVNU 1ZDXA 3A56A 3DEPA 1PGXA 5HI1A 1WFYA 4V0BA 4TUUA 3ALBA 2A6HC 5C44G 5IP4D 1NI3A 3S1NB 1VQKA 1KH0A 3AEEB 1GAQB 5C44B 5I6WA 5K36G 2E5LL 4IO9A 3ND8A 5TSSA 4A3EB 1BBWA 3M7GA 4GSWA 5E7NA 1RKNA 4C4VB 4EGVA 5I2YA 1TGZB 2LASA 1WCMH 1IBMQ 1P7EA 3EVQA 2GBJA 4G50A 5CV8A 2OWOA 3E5SA 5IN7A 4DAMA 2IHEA 1CZWA 1I4RA 5C0XG 2RSUA 4DR5L 3RZDB 3Q3JA 4DR7Q 4ASWC 2Q5WD 1DYQA 1KLVA 3OHXC 4RGMA 2QF7A 1WXQA 3MHBA 3I57A 4BY7G 1FNWA 2L1BA 4IUUA 3VR3A 3U7ZA 2EY6A 4WRDA 1PH3A 2WYQA 2O4XA 2D11A 1HTLD 1A2UA 1G91A 1EF1A 4PNYA 2BW2A 2BVCA 2I1KA 2WLBA 4NXNQ 3DHGC 2LI5A 3QIJA 2IGGA 2AQ1B 5BYSA 2KO3A 4M8AA 1R4NI 1KC8C 4WWMA 2NCNA 3ZRCA 4B3RL 3KWLA 1EUJA 2A1AA 4LNIA 2JEAI 3EIVA 4S3SA 1IYJB 4DUZQ 4HKQA 3RLNA 1L6UA 4FXCA 3AQQA 2GBRA 5C4JH 1ZUD2 1BR9A 1N32L 5ELOA 4X3TA 2KVMA 2KENA 2EXZA 3UI2A 4O2DA 4DV7L 2XSCA 1STYA 4IN3A 3WIMA 5H92C 4DV6Q 1V8QA 5AJ3L 4FHKA 5BMIA 4ZUJA 2ZPNA 1VJKA 5IWAL 4L23A 1XNRQ 3ZXVA 4IKGA 2GOWA 3PGZA 3L0OA 2V1CC 3J81j 5GXGB 1OXVA 1U0LA 4ARIA 1T0RC 2JK8A 1TWCB 2K5VA 3OTOL 4N58A 3CD6A 4I7ZC 2BYEA 2IL8A 3DWQA 3P7JA 5T1IA 2K39A 1C48A 1E2ZA 3RLOA 1TS3A 1BBUA 5M5XH 2B2YA 2EVBA 4KD3A 4JI4Q 3FKYA 1VQ6A 3S15H 2ZCBA 3ERSX 2WX0A 1PZJD 4EQOA 2AL6A 1E5WA 3Q14C 3ULLA 4K81A 4B3MQ 2ZEQA 4YSYB 2KTRB 4YCVA 3S1QH 1TR5A 4AH6A 3MXNB 1WJUA 2KMAA 2A4ZA 1PGBA 4BBNF 2C35B 3KLRA 5C3EG 2CHWA 1Z5SB 4XX5A 1G291 2UU7A 5EKLA 3A5UA 1K0RA 3OMGA 5C3EB 3BWUD 3Q8FA 3KJOA 1C0AA 2Q2HA 1VQEA 4O42A 2ZNVC 4M8NA 3A4RA 4KIKB 1JWAD 1F2MA 4BBRH 3NVWA 4MSQB 4DAYB 4YXDB 4FDBA 2BKFA 1CTMA 1DCZA 4YSXB 1PH8A 1HQRD 1N36Q 1ZXHA 1K0SA 1BVSA 2PQAB 3U4VA 2F0SA 1SIJA 1K9MC 2VY3A 1UBIA 1XLQA 2LGXA 1XTDA 4X3KA 3D4WA 4GZYC 4K2LA 1OTRB 3ZJUA 1S5ED 3ML8A 5CBEE 3A74A 1YQBA 5DCNA 2LKVA 3T3OA 2L83A 4EOYA 2BE5C 2BE5D 1JJGA 3T1YQ 3U30A 4TQUS 2MQJA 3GTLB 2ZVOA 2B39A 3ITPA 2LFIA 3AE3B 1H9SA 4ZKBB 2F0TA 1AFPA 1BQQT 1XMOL 3AFPA 3UDGA 1VDZA 3D4DA 2KMCA 5D6JB 3NTKA 3W1YA 5J18A 3RFZB 4JW0A 5LMNW 2WDRB 2EYMA 1STNA 3DQVA 4HPMB 2NVTB 2KDMA 5J17A 4P1CC 3FEWX 3F2UA 3A54A 2PVGC 2HDLA 1EQQA 1GG3A 4X57B 3RYTA 1GPXA 3OIPA 1ISNA 4KHZA 1CSQA 1AYFA 3JSVB 2Y0SE 4F7XA 3TS0A 4G57A 1R9TH 4GMVA 4KY5A 1VQDA 4X66Q 3VHTC 1D1KA 3DBLB 2PZUA 2OHFA 5EKIA 2PW7A 1O7LA 1SE9A 3I4NH 1NNXA 4YHHQ 3KUZA 1CUKA 1T9HA 1H4RA 2KHWB 2Q8IB 2MBEA 3KF8B 4GU2A 2L05A 3KDFB 2JYEA 5EPKA 4JI1Q 3RNUA 4OZBA 2F0HA 1A15A 5M5YH 1LTLA 3AE8B 3RNEC 1YIJA 2NBFA 3U4ZA 4RGNA 1PFMA 3H6MA 3Q23A 1LGRA 1YEZA 3SE0A 1L1OB 4HK2A 1AN8A 4MM3B 2VZKD 2UUBL 1SYGA 4A3JG 4IFDH 3EA6A 1LQBA 4A3DH 4ZRQA 4A3JB 1EM7A 3RT3B 4PMWA 1HR0W 2PEAA 3UDIA 1IBKL 4P1BC 3ZO5B 1MSGA 2PKOA 4GOPB 2RCFA 1RTNA 4TSSA 1SNDA 3CAMA 1GD7A 2ZPYA 4MJSB 1S5FD 2ZM6Q 4LF5L 3Q3MC 3GTOH 3IKJA 1K8MA 3A1QA 4DV3Q 1D3ZA 3IFWB 4NPNA 4M0WA 2QDBA 1VD2A 2BWES 1RODA 2G5DA 2YYZA 4KTAA 2ZVNA 4ZYSA 2R93G 2A6EC 1YJ9A 2E75C 3ZJTA 5H1SE 5C4ZA 5ELFA 3MFYA 4GLSC 1U4PA 4ZUIA 1Q81C 3TBIB 2DJGC 4CJ2C 2R93B 1FRDA 4BBSH 2AL3A 4MGZE 1PRTB 3QR8A 2KWCA 1K51A 3AE1B 3PREA 1UEAB 1FFVA 4DR6L 3TEWA 1EWCA 2MW5A 3GTMB 2Q2UA 1TTNA 3CCQA 4CDDC 1JR0D 1TWAH 3MVVA 4LUZA 2GLSA 4XWTA 2NBWB 3PGEA 4JI2L 1FEHA 2HHHL 3FKIH 5KYIA 2Z6KA 3HUIA 1D6EC 1SJED 2VH2A 3MP9A 4A3GG 3S2AA 1EYCA 3T8MA 2IX3A 1A2TA 3SVMA 3I8ZA 2LWPA 1MPEA 2FUHB 4BBNC 1UELA 2ICIA 1SFOH 5KHQA 2BBCA 2L00B 4A3IH 1WXSA 3NUHB 2SOBA 1MJEA 2REXA 4C1NK 3CMEA 5HFYA 1TWHB 1WY8A 1Q12A 3WAMA 5NUCA 1WJNA 1IL2A 4OVUA 3J9CA 4P75A 1XEEA 3UI3A 5G5GA 2HDEA 1WYDA 4G4KA 2RD0A 4KD4A 3NS1A 1JALA 1GM5A 1QT9A 2KC2A 3M7NA 2F0KA 3CMMB 2RCNA 2LMCB 4A3MG 3X3MA 2A73B 3AE5B 4NKLA 2N1VA 4A3MB 2KQ7A 3RCZA 4PG3A 4QY7A 2KOLA 4LFBQ 2OEOA 5AFWA 4FF3A 4II2B 3K6OA 1LTTD 4DNTB 1HCZA 3NVZA 4K3BA 5GAGC 2F0DA 2R61A 1C1YB 3HFZB 4Q0FA 1X56A 1S5BD 2E2IH 2W3SA 4MTKA 3RNBC 2SDFA 3RMHA 2JA8G 5IOCA 2WHIA 3I4MG 4CGYB 3BZKA 1MFWA 2WXQA 3B0AA 1FXIA 3RI7C 1J8CA 3S1RH 2JA8B 3AMUA 1TS2A 2CKZB 3H3VI 3I4MB 2MCNB 1NAPA 4DK3C 3NG0A 1VZ7A 3QG1A 3PIPA 2JN4A 1EY0A 1YJWA 5C0XI 2HTHA 1CQFA 3QK0A 1IBML 2NBVB 3UGBB 3TP6A 2VNUD 3QHTA 1A63A 4I6NB 4DR7L 1NMGA 4P72A 3VUYA 1N9WA 2F1MA 5CV6A 1FGUA 2N88A 3FP9A 1U4LA 4HJ9A 4LF8Q 5IP7H 1L0VB 1TWFH 2L3ZA 4NJ7A 2XK5A 3NXWA 2HIXA 2DZIA 2INCC 1WSPA 4B9WA 4I6PA 1WZ0A 2K25A 4NXNL 4C1NI 3SFDB 4DK0A 4RHSA 5JJLA 1CSPA 2YTXA 4A3CG 3CHBD 1QG7A 1HR0Q 1UE5A 2UU9Q 2Z9HA 2JA7H 1JMCA 1N34Q 1I4GA 2CCZA 1X3QA 1KL9A 1GUTA 4DUZL 2F4VQ 4DR3Q 3V61A 1WIAA 3CKIB 2GRIA 3A33B 1WM2A 4LDTD 2N3SA 3J80c 2YU9B 4R8IA 1Q46A 5EQ0A 2LJ5A 4IDIA 3TEHB 3ETRA 2IO2B 1D5MC 1Y1VG 4DV6L 2C60A 4C80A 3U50C 1WTVA 4N8FA 1VQ5A 2FCNA 4KN7C 1Y1VB 4NB3A 3PIP3 2GA4B 1XNRL 2L7RA 4AS1A 2LJIA 2UWQA 3H91A 4PMCA 1SYBA 3AFQA 3BDCA 2HJ1A 2ALYB 1CKNA 4JQWC 4KZCA 3PRZA 3RZOH 3P1MA 2WNMA 4FF2A 1KNEA 2G9HD 4ZRZA 4ARCA 3CCUA 4QL5A 4HCSA 3KUPA 3I63C 4KDIC 2F0MA 4DHZB 4JI4L 2F0IA 5JHAA 2WAQE 3I7FA 2J7QB 5BO4B 1F2RI 1PTOF 2MHVA 3K7AH 1PH5A 2FUG1 3IBEA 4OVVA 2RSOA 1WXVA 2NR2A 1C3TA 3I90A 4B3ML 3CCRA 3NBHA 1H9MA 1KFYB 2WWZA 3U4EG 1B1ZA 4EUTA 5CR3A 1ONLA 2DNFA 4JE3B 1QZHA 2KNBA 3CSTA 1S5CD 4IZ8A 3HOYH 4AYBG 4BOSC 2PMZE 2ES2A 1FFUA 1NVID 1N5XA 4AYBB 2MO0A 4JI5Q 2R2OA 2QIEB 2CJNA 2PW9A 4QF4A 4ACFA 2H88B 5T8IA 3NHHA 3X3NA 3BINA 1Q5WB 1Y1WG 3SD5A 4IG7B 2B2UA 4E74A 4XQNA 1H9SB 3VR9B 4G7HC 1Y1WB 1ICWA 1N36L 1CK1A 3N3KB 5IE8A 1ILPA 1MI2A 1C7YA 1D5XC 3IL8A 5DEHA 2G4DB 1VQHA 2NN6H 2NYZD 3KOJA 3QAQA 1PHJA 5AZHA 1AEXA 4DN4M 2JQOA 2KEDA 4QIWB 3L3OC 5GADC 1RD9D 3F2CA 2QJLA 5HG2A 1BOSA 2F4IA 3RR5A 4K6LA 3T1YL 4Q2JA 2D3AA 1XPUA 1NENB 1B4OA 3HRDD 1QZGA 3HOVG 1EZ8A 1TJEA 4YT0B 2MH7A 1WMHA 3M4OH 2WGSA 3HOVB 1XX8A 3K5LA 1DOXA 3VA7A 1IZ6A 5FLXL 1Q1EA 1H95A 1HNZQ 2LZ6A 3KK7A 2WQYB 2WXHA 1EQVA 2OTLA 4R3DA 1WXMA 1EF5A 4REZA 3TBLD 1WFQA 3SEBA 5IT9L 1G2SA 2BH8A 2X8XX 4FVMA 4A3OA 2IWHA 4HJAA 3C3LA 5HKHA 1Q90A 3Q8DA 1UH6A 1F9RA 2VXWA 4L8JA 3ZVVA 1EY9A 4DV5Q 2OJRA 3CXCA 1WH3A 2VH1A 3A55A 1GJXA 4EQNA 5L95C 3ZUNA 1BNZA 1F2YA 1PYBA 4X66L 4G11A 2BYTA 4LLGM 2X6LA 3RPFC 4MELA 4F1SA 3W5VB 4XQJA 1J8IA 2NB0A 3GD7A 3N52A 1E2WA 3RLFA 2F0VA 4YHHL 1PH9A 3S1MB 3R8BA 3DHQA 4JBJA 5IYDH 3BIID 3GE8C 1NR2A 2L5TA 4DK6C 3KUCB 4JI1L 3OYYA 1LV9A 4KZ0A 4NJCA 3E6ZX 4HN7A 1J19A 4F88A 3J80E 1X1MA 5EKKA 1JMLA 1PQSA 5K5PA 1YHQA 3ZTCA 1YQ4B 4JI8Q 5FOBB 3PVLA 4QQBX 2DY7A 3QJYA 4YL8A 4H02A 1RF2D 2CHXA 1N62A 3EHVA 3A1QB 3NS8A 4YTMB 1M8AA 2QC8A 4DNIA 3QB3A 4KSLC 4BS9A 5E6NA 4M0WB 3B6YA 1EIHA 3QARA 3OG5A 5DAUA 5IYBH 1NTGA 1TIID 2YEPB 2K8CA 2KA7A 1K3RA 3ONAB 2LVPA 1LTRD 4RGOS 4BXXH 2FNJB 3PUVA 2JZPA 2CQAA 2R7DA 4K7UA 1UGMA 2PJHA 1KLUD 2YTVA 5FKAC 4OO1G 2Z1CA 4A3PA 2UXBQ 4DV3L 2ZTCA 1XMQQ 3SXHA 4DNRB 3S2DH 4EQPA 3GB1A 2XWBB 4HJ5A 2F0GA 4LFCL 2OCEA 4QUFA 1WM3A 2D3GA 3B2GA 4FJVB 1VQ8A 4PMBA 2AKWB 4XXEA 2VRRB 3GZNB 4G0NB 3ZDTA 1WTWA 4LK1C 2JA6G 2CWAA 3EROA 1KABA 2J0KA 5KHOA 2RA4A 4ODGA 2KHJA 3DVNV 1Q1BA 2JA6B 4KGTA 3S2HH 2DJFC 1U4MA 3AM9A 2N9LA 2P5ZX 1E0ZA 5JEAH 4CBVA 1J9OA 3CQZB 4XTCS 5A35A 4EE2A 5GMVA 2XWJB 1WX7A 4DAPA 3GTGB 3Q3FA 2RPVA 3KBXA 3QA8A 3D32A 3T13A 4OONA 2B2TC 1GUOA 1S5DD 2HUGA 3CC7A 3AEVA 3UE0A 3I3TB 3ZNGC 1TT2A 4JG2A 3AE9B 1H8CA 1STAA 2AUKA 4A3BH 2DLBA 2EIFA 5M5WH 3SK5A 3JSVA 5C3JB 1MVKA 1UAPA 3MC9A 3NK9A 1HZCA 3NHEB 2IPKD 3L4PA 4HJGE 4LNNA 4PK1A 3DM3A 3NBIA 3PZDA 5HHDG 4EVOA 3C0RB 1SIFA 1HNXQ 4USAA 2V4LA 3KDFA 2IYDB 1KRSA 4XYOA 4RFBA 4CKEA 2EELA 1FXTB 1E7VA 1ZDVA 3GOEA 1VQCA 3PT2B 3J7YW 5IAAC 3WOFA 3A9KA 2CFMA 2VW9A 4LFAQ 1QQRA 3H3VC 2F0OA 1F9QA 1HXYD 1K83H 2Y0SG 1F9PA 4DV0Q 3C46A 1O7IA 1F9JA 3H0GH 2EE1A 5J39A 2L76A 4LJPB 3LDZE 3VRBB 3NQTA 1CM9A 2Y0SB 1CFMA 2MJEA 3TL5A 3VR6A 4LFBL 4XQQA 4DF7A 4QAYA 2QCPX 2CWPA 3EBEA 4PZ7A 3HEJA 4DV4Q 3GTJH 3CCMA 3A5ZB 2RMMA 2ZW1A 3P63A 3DBSA 4RHRA 2N9XA 2MSED 3GQBA 1MBYA 1Y8PB 2VQFQ 1Q8KA 3ZW3A 3NY5A 3NWTA 4MJSA 2EMTA 3T16A 3GDEA 3L16A 2EPBA 5IGBA 3A4SC 1E7PB 1YJJA 3VR5A 4GKJQ 2WKDA 3UQBA 1BMLC 1Z2MA 2XK5B 2L15A 5D94A 3S14H 4CQNA 1KOTA 5IIFA 4KHVA 2CS4A 4BKSD 1PZID 3H8HA 4DPGA 4Y7NB 1YJNA 3WA0A 1KDCA 4DXGA 1V5TA 2FCQA 4PYZA 2KWVB 1XWEA 3PF4A 2LSSA 1AH9A 2PVOD 1EEID 4POGA 2H1EA 4C3JG 4GKKQ 2QA4A 4A76A 1SYFA 4PS7A 4C3JB 4LF8L 1VR9A 4BOZB 3FHWA 1KM7A 3TEZA 3KYHC 5M3FH 2K28A 3H6NA 3PO3G 4GLVB 2B29A 4H7BA 4HEA1 2LFNA 3VA5A 1V43A 2KJRA 2WINB 4M01A 1FO4A 3PO3B 2KD0A 2WP8J 1HR0L 4W9EA 1PH6A 3K57A 1KQSA 2UU9L 1Q0WB 1KF6B 5CORA 1N34L 2K32A 4DFAA 5KIXA 3M85A 5C4XG 2KANA 1EIGA 2B2VA 4A3KH 2F4VL 4ZOHC 1P8LA 4DR3L 1CKNB 3SHQA 1FMAD 2R7ZH 1SAPA 1KRTA 5C4XB 1EO6A 1ZOYB 3GP7A 4DKAC 4RKLA 1XJVA 2N7JA 5IODA 2KVZA 5C3XA 3ZJYC 3KBGA 4QUCA 2ASBA 5KGUA 1F2RC 2NTTA 3RMKC 5IGFA 4N9TA 3HOUG 3P75A 4NZLB 2DY8A 4LF6Q 3Q6SA 5CV5A 4DDGD 3PSIA 1BUIC 5JJZA 5LLIA 3D6CA 3HOUB 3NBHB 1RCVD 2EYFA 2FMCA 3HOXG 2UXDQ 4UPAA 2BF8B 4KKIA 4LNFA 1WJ6A 4G7ZC 1JQYD 4II3B 3HOXB 3DDCB 4W9DA 4W9GA 4HVBA 3PQIA 2A6HD 1O80A 1JRUA 2BDOA 4LAAA 2M56B 4H13C 4A3EG 1B53A 2D5DA 2LMCA 3MAQA 2H5XA 2WXLA 4HPPA 1YNNC 1YNND 3I4LA 2BB6A 1IXRA 4CKBA 1ACCA 5CV4A 5EAYA 1VMCA 4L5RC 2PLPA 4CDFC 1WJJA 2VQEL 3EJIA 1P16A 1GO3E 1LT6D 1SR3A 1VQOA 1QVCA 4FF1A 1WWTA 2JPHA 1TVXA 4CJ1B 2ZJRA 4NXMQ 1Z6HA 2KDEB 4B3SQ 1JT8A 2GVAA 1WI5A 2KQ4X 2NMQA 4NQKE 4R4OA 2B76B 4AWJA 4EZKA 1GUWA 4JI5L 1JICA 3I9V1 3VR2A 2V9HA 1X32A 5E3FA 2KWDA 2MBHA 2B63H 2Z0DB 3H7PA 1B3QA 1PTOH 3BVZA 1K8RB 3N32A 1A62A 4UDUC 4WH4A 2EZVA 3TP8A 5JOBA 3JAMc 4TV3A 1XTCD 3DWAA 4LF7Q 2EQSA 3ECIA 3GV3A 4KLKA 1G6PA 1TT5B 2O2LD 5M9OA 1WMHB 3KLSA 2BS2B 2BGFA 2CHZA 1DGJA 5E6OA 2VUMG 1VQGA 4IWPA 5IA7A 4EQ5A 2MJ8A 3GTKB 2KN4A 2VUMB 4GNXC 1P0RA 1DD2A 2OEDA 1VDVA 4I6LB 3S1NH 3C19A 4E3CA 2BS3B 3AU7A 3SFEB 2EJGC 5C44H 4JBMA 3HGBA 2D9UA 4APVA 3S15B 2OTJA 4HSPA 4JI6Q 5K36H 1FCCC 4MGKE 3FRPB 5C1ZA 2YV5A 4M8MA 3UIOB 5I2XA 1ENFA 4K1RB 4U68A 3S1QB 4WIPA 2EYOA 3HKSA 3H3VH 2L0TA 1AZPA 4OZCA 3WANA 1FXAA 3I70A 4UHVA 2F0LA 3SR1A 1HNZL 3CCSA 4ZRJA 3RZDH 4WJQA 1EEFD 5C0XH 3AB5A 2ON8A 2JRHA 4AUQC 4WJPA 2DZJA 4LF9L 1L1OC 4K0KQ 3DM1A 4HKZE 2KK8A 1VMPA 1YJIA 2ONQA 4J3OD 4BY7H 4JL9A 1WD1A 3VTWA 3B2FA 3RN2A 4DV5L 4US8A 4ALPA 4JWUC 4ZKCB 3J80i 2IT1A 4LF4Q 2DGYA 1Z9FA 2AWOA 4QB4A 4HIMA 4XDCA 1PH4A 5IGCA 2Y5CA 5BMGA 2V4DA 3LNNA 1K73C 2NVQB 1EY6A 4F8MA 2JU6X 3BZDB 1CZGA 1VQMA 2PNRC 2V1YA 4N59A 5DNFA 1J7BA 3IAYA 3V3XA 1C4CA 4XE0A 2KECA 5BR8Q 1R4MI 2EJMA 1YX5B 1AWDA 1LM0A 1HFGA 4RAUC 3RN5A 1D1IA 1LYLA 3TSSA 2E3TA 1Y8RC 1WE6A 1HNWQ 2NWGA 3P4PB 2F3VA 2F0EA 2AQ3B 4JI8L 1WOCA 3OOCA 1JE5A 3AEFB 3NZSA 2DBYA 3KJPA 4O0AA 5HGTA 4JI0Q 4YTPB 3LJ3A 4MIUA 1SE4A 4JPBW 1I6HB 1IHZA 1PH1A 4OX9L 3OLMD 1MGSA 1YZ6A 1N5WA 4LNQA 3E0JA 3TS2A 1E24A 1L0XB 2D3CA 3CF5A 2WV6D 2K5HA 2KHIA 1RM6C 5GAEC 2LGIA 1UD7A 4CHTB 1ZXIA 4OO1I 4WQMA 2BS4B 1HTOA 1VQIA 2GB1A 1SE2A 2WAQG 3DBRB 4K7WA 2F52A 1R9TB 1DOLA 1HRJA 1WRDB 3BZCA 3H94A 1Q7YC 1CHQD 1B44D 2WAQB 2KDFB 4ZHOA 4IUNA 3GZNI 1NJIC 3OAWA 1RIPA 4DK5A 2I0QA 1L6VA 1ZXTA 1X65A 3OW2A 3F8TA 3R2IA 1XMQL 2R92G 3BDLA 2MUYA 2E2JH 4ULLA 1V2YA 4XYQA 1VF5C 3BYTB 1NE3A 5C3EH 2R92B 2EYLA 2AWNA 1CA5A 2PMZB 2AWTA 2MHJA 3BY4B 2CVRA 4Z9CB 4JLCA 3RD2A 3TMPB 3S24A 2G9DA 1VQBA 3PHWB 4WWOA 1LACA 4AIMA 2L32A 5HY6A 5C6AA 4KV2A 1CKOA 1SYDA 1SMYC 1SMYD 2MPMA 2QDLA 5CV7A 3JAME 2JE6I 1E8ZA 2O5IC 4W9IA 1C4PA 4OELB 4URKA 2GBNA 2WU5B 2WACA 2BH2A 4LNKA 2E76C 1YN4A 2MJ3A 4P2CB 3CPWA 4DR4Q 1ESFA 1WTQA 4ZRKA 1NI2A 2JWZA 3SK4A 5DM63 3M3YB 1GUGA 1RL2A 3GO5A 2MBOA 2K7VA 3M3JA 1UE7A 2QKIC 4KKSA 1FVIA 2BTEA 2PMVA 2FE8A 1J7AA 5CBAE 3Q3OC 1RAXA 3EFUA 3WCQA 3EFXD 2ZTEA 2PZTA 2LGDA 3MEFA 3A9KB 3DBHI 1DXMA 1UUPA 5DLQE 1QILA 3VH4B 3GV6A 4AP4C 1NSNS 1B9RA 2ZTDA 2NBUA 4NW2A 4A75A 4J1MA 1FD6A 3GTPB 4YY3L 2RPQA 1F1HA 2QHOA 4R4QA 2EKEC 4A3LG 2K8BA 2R2QA 2EY2A 3TRZA 3QIAA 2N9EB 2NVTH 1CA6A 3OSOA 1BXTA 4BBSG 3N9YC 1V9JA 5A2QE 2K3UA 4JX1C 2KEEA 2WFWA 4IM0A 1V49A 3MZ5A 1T5EA 3K59A 4BBSB 1JROA 1LXDA 2KAJA 1KTKA 2JWUA 1MD2D 4B08A 1RFAA 1PXUA 4XDXA 1RJTA 4LFAL 2MRPA 3D8GA 1BT0A 4HIOA 1BBXC 4P16A 4MEMA 5CGKA 4DV0L 4WJ4A 1JORA 2EJFC 1XLOA 2VB2X 1PUTA 1JOKA 1RRBA 2NVYB 3K8AA 3FKIG 3EGRA 5G55A 3N1XC 4IOAA 2A6ED 3PUXA 3FPUB 2WIIB 3FKIB 1VQ7A 5FLMG 1Y56A 2PPBC 3ZKJC 2DENB 2R3ZA 2VQFL 4DV2Q 4QJFA 2Y5BB 3KUDB 1YQ3B 3W9CB 4FADA 5BN4A 4AOFA 2WDQB 3T4AC 3P4SB 4N8X1 1SFOB 4GKJL 3C1FA 3LWUA 2MX2A 2ZNVB 1O78A 5DPSA 2I5MX 4ITKA 3IFDA 1TWGB 2DZKA 2V3SA 4L63B 3CPFA 3SGIA 2JZ3B 2F0QA 1QOBA 4EZJA 5JHBA 1SNPA 4MSMB 2N1WA 3OPOA 5J3BA 1XQQA 3Q24A 1CZPA 5ELBA 4GKKL 5E6PA 1I4HA 4LJZC 3K80C 4AQ7A 1XT9B 3U7DA 3CF6E 1YX6B 2KFJA 2AYOB 1TKYA 3QO2A 5KEEA 3L10B 2L11A 2O2VA 4MACA 4NP5A 1G2TA 1TBEA 3JVZX 5E4WC 2YVCA 1CKMA 2LUEA 1KD1C 5IYCG 2E2IB 1SF0A 4IUVA 3OJ3A 2EYHA 2WXPA 2Z4HA 2R93H 1XCQL 5G3LF 4MGYE 4JWSC 2BYVE 1MKHA 3V2TA 4IOIE 2M00A 3CCEA 3S17B 3K9OB 1PFBA 2A5UA 5IGGA 3ZLZA 3S1RB 1GVPA 4KHPQ 4N9F4 2NTSA 1T6BX 4ICUA 2PO4A 1V80A 4JI7Q 3PS6A 4DGZA 2DUDA 3GTMH 3QWZB 3ZNHB 4WURA 5J2RA 4LF6L 1E8WA 3J80L 1MJDA 3IXSA 4RMFA 2UXDL 1TS5A 5JAVA 2O5JC 2IGHA 2KKCA 3CCJA 3L13A 4IWQA 3RNCC 3ZNZB 3ZYYX 5JZEB 3VH3B 4X6AH 2IZVB 3OWFA 4ID6A 4A3GH 5EE9A 1FYCA 1SYCA 3TUOA 1OEYJ 4MHEA 1B70B 3H7PB 3R66C 5IGDA 1EYGA 2K1FA 1QVFA 1EY8A 3DXJC 1HE8A 1PDXA 4XT3B 3X0WA 1TWHH 5H8YE 3HOWG 1QOAA 1WTOA 3V60A 2M0XA 3ML9A 1A8VA 3HOWB 3KLWA 2VZKB 4B3SL 1GUSA 4H0LC 2KDIA 1E1TA 1YIWA 4IURA 2IY0B 3TZDA 2JSVX 1HZBA 3CU7A 3MXGA 3R3OA 3NSWA 4BKTA 2JP1A 2PCFB 1LABA 1OXSC 1WI0A 2LRWA 4A3MH 4HDQA 1I4PA 1QVGA 4DU9A 1Y8OB 4LF7L 3D31A 1QOHA 3SU8X 1PFDA 1X3GA 4DK1A 1JJ2A 1NEKB 2LXJA 4PV1C 5J1ZA 3KF6A 3MWYW 4FP5D 4I65A 1NMFA 2ATWA 5M3MH 1WGRA 2OQKA 3S9WA 2KACA 3NQIA 4ILWA 1QUQA 4KSKC 1BCPF 3PV1A 4GN3B 4C00A 2JA8H 3I4MH 2B3GA 3U9SA 2INDC 1WGDA 1EQTA 3K7AB 4JI6L 3PUYA 1GNUA 2JY6A 3A8JE 1ESRA 2M0AA 1PH2A 1MJCA 1HZ9A 4X65Q 2W3RA 5KNCA 3O13A 3VR4A 2V3PA 2WXKA 1FD7D 2HD5B 1I7HA 5FR3A 2C9OA 4TKOB 1I3QB 3CRKC 2RKSA 1DONA 1QNKA 4GDKA 3VTUA 4KDLB 3HP3A 2XRSD 3CRLC 3Q8CA 1KAAA 4ANXA 3I4OA 2RDGA 1EFWA 2LD9A 2AEHA 1KJTA 1KHIA 1A3VA 2EXDA 4DR2Q 2LHDA 4GB9A 2GVBA 1IUEA 3K0YA 3IG3A 1ZPSA 4X3SA 4M00A 1VQAA 4X3UA 2DNEA 3V05A 4ZDVA 2JYOA 5GROA 1EIFA 1Q86C 3ENEA 2FIFA 3LYYA 4LF4L 2MJDA 3CC2A 2QW7A 3I91A 4A3CH 1YN5A 4S0RA 4BY1G 3WDNA 4LMQD 1K3BC 2BDNA 1OO9B 1CI3M 4BY1B 3K58A 5E1FA 2JRIB 1AZQA 2B2TA 1L2FA 5BR8L 2YU9H 4XGAB 4IM2A 4ZRPA 2PPHA 4NAWB 2K5DA 2TMPA 2PW5A 1IW7C 1HNWL 3PRMB 1TZ1A 1LTGD 4X62Q 1NBFC 1STBA 4G3XB 1Y1VH 1PYSB 3DEOA 4BWGB 3SHLA 2IW3A 3A7AB 2KLCA 2KTFA 4DR5Q 2O6VD 2JA5G 4JI0L 3KVFB 1F77A 3DBRI 4N6EB 3WALA 3OW7A 2JA5B 3FDTA 4FLHA 1UZXB 1LTBD 3PO2G 3PZ8A 3IT4B 3FMCA 4HWIB 1PGAA 2KVRA 2NZ1D 3PO2B 2BWFA 5JVH3 4KK7A 1N63A 2D2QA 3B9JA 1STHA 2I2YA 3TP7A 3W1SA 1N8RC 1XF5L 3ND9A 1N33Q 4QGUA 3Q8AA 3PV0A 4YCUA 1Y69U 3G4SA 2AQ2B 5G3LD 4ZCKA 4BVUC 4R4IA 1IPGA 4XDDA 5FJ8G 3JAMi 3KW5B 4RG1A 5FO9B 1I50H 4A9AA 2K1BA 3F2BA 4WJ3M 2LUMA 4HMJA 3FILA 2BB5A 1R4NB 4FN2A 1C77A 4LNOA 4NPSA 3AE4B 3P4RB 3DBLI 2AHOB 3PLUA 4KY6A 4JI3Q 3RNGC 2IX0A 2NZOA 4I7AA 3W5OA 2K4KA 1SYEA 3J81c 3L0WB 1YHAA 2C5LC 3IHPC 4MH0E 4ZYNA 2AX5A 3SDLC 3AYHB 1Y1WH 1XNQQ 1Q82C 1EY5A 1U4RA 3Q69A 4L1BA 1D5ZC 4IUPA 1FR3A 4DR4L 5IP9H 1NUCA 3I3CA 4C3HG 4OL7A 2N55A 4BKSA 4IUQA 4LWCA 1X6OA 4C3HB 4EZLA 2UYZB 1EU3A 3TCAA 2DAFA 1L7YA 3GTQB 4J8QA 2Y3AA 4EX5A 4X64Q 3I2ZA 1QE6A 2H4OA 1HFNA 5IY0A 2K6DB 1VZ6A 5BYRA 4LDTB 3I55A 3HOVH 3E3XA 2WXMA 1TS4A 2VZAA 4LCDE 2OF1A 2WKCA 4KKTA 1YI2A 3S2DB 2MP2A 4RNAA 4JOIC 3CCLA 1LFDA 2FAZA 4HCPB 1HJPA 3KYCD 4IALA 1OFFA 4UAIA 2ICEC 2MFIA 3U52E 1E8YA 3VUWA 3ZRFA 1E0BA 2JA9A 2PQEA 3W5UB 1LLRD 2ZM6L 4DR1Q 1IBLQ 3PLVA 3KH0A 5EGTA 2SAKA 4TRDA 2KT7A 1QZEA 3H09A 2INNE 2KJHB 1UF0A 1BCPC 1BCPD 1VRAB 3O65B 5AEKB 1JQ4A 2NPTB 2A68C 2A68D 3BDOA 1L2NA 2Z0EB 2JX5A 3F2DA 4P7IA 1YN3A 1RWSA 5CC4A 1AE3A 2E8GA 4NQLB 2LEKA 1P3QU 4HPLB 1KIXA 4ICVA 1Z47A 1STEA 4DV2L 5M5WB 4WAAA 1SNMA 4HJ8A 5D2MB 4GXBA 4TQ1A 3LGJA 1XMOQ 3NELA 2W55A 1QKZA 5JPMC 1B2TA 3LX0A 4JVZA 3KFUA 1LM8B 3B1LX 5AUIA 4TMAB 4HJKA 4DDID 2GMIC 1ILQA 4C2MH 3A0JA 3NUCA 2O2VB 5C5LA 2WB1E 2CW0C 2KXJA 2EMSA 2J0MA 2IHFA 4C3IG 1PTOC 1PTOD 3NTIA 2UXCQ 2E2HB 1D2BA 3QQ8B 2HIVA 4OXPA 1K8AC 5I9PA 2G3QB 4C3IB 1LTSD 4WJOA 1I4QA 2XVSA 1XO3A 3APFA 3VQIA 3H0GG 1ZP0B 4NAMA 1K83B 2RHSB 3SK6A 1L5PA 2J0JA 4DUYQ 3H0GB 1QCBD 1SNQA 3VAWA 2R7FA 1LTID 1PFSA 4H44C 4OO1H 3U8ZA 4N9PA 4OWTB 1FNUA 1QJOA 1H9KA 3J7AF 2N9KA 4A3FG 4R8NA 1ICFB 3Q8EA 1FL0A 3ZXRA 4A3FB 1F2LA 3S16B 5D3DA 4W9FA 1UWVA 3G7LA 4GNXA 1T3QA 2L55A 1EIYB 1E10A 4R4TA 5BYQA 3AEBB 2B2UC 4HR7B 1NDDA 2JA6H 2NVXB 2KMMA 2HTME 4ZLTF 3J81E 2QEJC 5CTRC 4KHPL 4B0MA 3ER0A 3V6EB 4F8CB 1D8LA 4JI7L 1PYWD 3E9IA 4ZAIA 3NZUA 1KDBA 2PIAA 3DWPA 2NZHA 4GS3A 3GTGH 1VQNA 3RN9C 4OHJA 4XWWA 2ZXOA 4HJ7A 1ENCA 1W6KA 4YWLA 1LT5D 5D65A 2C5CA 2DYBA 1DOYA 1B50A 1I42A 1SE3A 3BVGA 1ET9A 3PTFC 5BN5A 2D62A 1IYFA 2I38A 2F0WA 2I1JA 2M1MA 2A8VA 3L9AX 4R1JA 3UF8A 5I4DA 4LF5Q 4GLAC 1C9FA 1S72A 1WYWB 3K0XA 4UP8A 5M3FG 1KNAA 4P74A 2H89B 1ZYRC 1DZ1A 2C7NB 4CYEA 5M3FB 2DZMA 2B2WC 1V1OA 1MIUA 4K3CA 1PFNA 1XXGA 4K8IA 4B6WA 2HCCA 2W82A 4A93G 3HOZG 3MHZA 5LXHA 1QF6A 3QOLA 2SEBD 1A6XA 2ZZPB 2JZZA 4BAXA 1BKBA 4A93B 3VYSA 3HOZB 1KLGD 2KJ6A 1GUNA 3KF6B 1WX8A 1XLNA 2SNSA 1WJ4A 4DHJD 3E9HA 2D3BA 1PRTF 1K50A 1QUQB 1ML0D 1HZAA 1WTHA 1AARA 1YVCA 1FJGQ 3DWGC 4W9KA 5LHY1 2JXMB 3BU2A 5FO8B 1GXDC 1OEYA 3ZNID 2JVCA 1JWUD 2J42A 3K5NA 4POFA 3MC8A 1UGJA 2HHHQ 4B0EA 1C79A 5EBCA 1ET6A 2DAJA 3JAML 4XC2A 1SE8A 5E6JA 2FCMA 4GDKB 4CDEC 3L54A 3AV8A 1SJHD 1DJRD 4JK1C 3AI5A 5JH5C 1IKLA 3OMCA 1WD0A 3SDZA 1WCMG 1NBWA 1IL8A 3LWEA 1DOIA 1VCIA 3TZUA 3U2SC 4A90A 4DQOC 1WCMB 1TKWB 2A5HA 3W1BA 4X65L 2KWUB 1N61A 4A4IA 4Y7NH 3IAS1 1V81A 4Y52H 4WAFA 1FM0D 4IJHA 1UE1A 2K05A 4HEDA 5C3WA 2M19A 3H9DA 4GOCA 3AU5A 4K7SA 3VDZA 3J7ZC 4ME5A 1K8OA 4YTNB 1C4QA 4C7YA 3RNFC 2VS1A 5ELNA 3ULJA 4C3JH 3EFCA 2MGSA 2WXNA 3V62A 2CKHB 2XBBC 5A2QL 4DR2L 2K14A 2ZJQA 5L83A 1E2VA 1LO5D 2HDMA 3PO3H 4RCOA 2LVQA 3DHHC 3QJZA 2RDBC 5LL6X 1F52A 4ME3A 3CC4A 1U5KA 4QIWE 2XN9C 1B9MA 1G51A 1SEBD 5ELEA 5C4JB 2IY1B 3AXCA 1SMXA 4KGRA 4DV1Q 1A70A 5C4XH 2WXIA 4YWMA 3KQ4A 3IFTA 1JRPA 5LMUQ 1KXLA 1T0SC 2CH4W 4L6TB 3UIPB 1SLJA 3AE6B 3U58A 2KDBA 4X62L 3HIZA 3HOUH 2WU2B 3R7QA 3BG3A 1JW9D 3PIOA 2UUCQ 1P1AA 2INPE 1RDPD 5CHVC 1JE4A 3HOXH 1WZ3A 1J5EQ 1EYDA 2I5LX 3MJ5A 4PS8A 5C5MA 4BA2I 2C7MB 2EYPA 5EBDA 5M5XB 3W1GA 1UWXA 3FILB 3FAHA 2ZXPA 4FXGC 1Y8NB 2K6QA 4HLEA 4A3EH 4BY7B 4JBKA 1XCTL 3HK0A 1D7QA 1G6JA 2JSOA 4V190 5IO9A 4KV6A 4GLXA 1N33L 1VF7A 3TN2A 3RZWC 2LGYA 4IC7B 3R93A 1T5XD 3AEGB 1WGKA 5EE3A 4YWKA 4OZAA 4RF0A 1P9DU 3NPPA 3C8YA 1MG4A 2ENBA 2MO1A 2V0GA 2K50A 4BBRG 1VLBA 2BT6A 2C9WB 3MA2B 4JI3L 3H1UA 2HE7A 4BBRB 4JYAQ 2MWSB 4HSVA 2BCOA 4KX6B 3DPDA 4RMAA 2KFKA 1WRIA 2GN5A 3L08A 4US9A 5DPTA 1V97A 4DHJB 4PT5A 3D0FA 3NTHA 4HROA 2K5PA 4GDLA 1GJZA 2FXQA 2LGSA 1XNQL 5DPRA 2CHBD 1EYAA 4GOPC 1ZKHA 3CCVA 3ZJVA 2OJWA 3GTKH 2MP2B 3OIQA 3PIO3 2VUMH 3M62B 2KJXA 1QOFA 2BOSA 4OVZA 2SNMA 4UP7A 3ZTDA 1MSHA 2NUCA 3GS2A 2ACZB 5IOIA 1U9RA 2JXTA 2AUJD 3H7SA 4KI0A 4DXFA 1E9MA 3VUXA 1HA6A 4X64L 5DM73 2MQHA 3NOBA 1A3UA 1V8CA 2LXKA 4JCVE 4RA8A 1K52A 5C0XJ 3P20A 4JPSA 1HEZE 1OXTA 5CHWA 5F2DA 3T1HQ 1SB3C 1TWCH 1HZ6A 1PRTC 1PRTD 1SXTA 2QGQA 1YD8U 2DYMA 2J52A 2W54A 2XRQD 3B08A 3I5JC 1EQRA 2E2JB 3RNAC 2WDVB 1GUAB 2EY5A 3E0EA 2LHEA 3VTVA 4KMUC 1STGA 3AE2B 5IGEA 4NAWA 1I35A 3MEHA 5ISRA 1E22A 2CJOA 2MBBB 1V1QA 1B3AA 2UUAQ 4FJZA 3I4NG 4WJWA 1EFID 4DR1L 4MT5A 1XD3B 3FVQA 1IBLL 3JW0X 1GB1A 3VR8B 5CMDA 3IVFA 3I4NB 4TVAB 1PLFA 3TP5A 2UXBL 3M4YA 3U9OA 2DWQA 4FHJA 2Z0SA 4UY8C 2NVQH 2B2VC 2A69C 2A69D 3UE1A 3VYUA 5EJWA 3WWVA 2Q8RE 3J7A5 2CH4A 5M5YB 4WFN3 3AN1A 1WX9A 2L8JA 3BJUA 1RYJA 2PI2E 1Z7TA 5KYLA 3HHMA 1YMHE 1JOOA 3JYUA 1L0WA 1WTRA 1I94Q 3G6JB 2LS01 4LUOA 5D3IB 3DWMA 1NY4A 1OXUA 4RM9A 3SK8A 3NENA 4IFDG 1N6ZA 3VYRA 1TY2A 3EUB2 3MFGA 4A3DG 1EZ6A 3M63B 1SSNA 3VVWB 2K01A 4IW0A 1LTAD 4J15A 1WF9A 4A3DB 3Q8BA 3CW2C 3Q6BA 2F0JA 1I6HH 2RVLA 4JV5Q 5AZGA 3MTSA 4DWFA 5G2NA 1A5RA 1SNOA 4HAEA 1AE2A 2UXCL 5AUKA 3HKZE 2ZXRA 1G8ZD 1FIQA 1SRUA 3GTLH 2BKRB 1JWSD 1VQPA 4GNXB 4Q5VA 3PO0A 3GTOB 2MLBA 1QB5D 4NJ6A 1KRHA 1ZEQX 1EOTA 2JYTA 1IBXA 3DMUA 1TIFA 2F0FA 2PYKA 4DUYL 1GC7A 1CMXB 3DCGA 2FIDA 1HNXL 3P42A 3J81i 4IPDA 1WE7A 3BYYB 1M90C 4ZK9B 3NEMA 5EDSA 3QWNA 1NYRA 1JB3A 4MTNA 4HIDA 2N8NA 2R92H 2CU1A 1EWYC 1SDFA 2N7DA 4EKUA 1X3EA 4RH6A 2Z4IA 1GHJA 3D6WA 2IY5B 2JF5A 1NR4A 3A9JA 4B95A 4M1UB 2LRUA 4CHKA 2Q2IA 3NVVA 3I56A 5EE1A 2WP9B 4WQOB 2K04A 3RZFA 4ANWA 4G7OC 2RQXA 1TWAB 4QCLA 3AECB 1X3FA 2A19A 1KAWA 2I07B 4OGQC 1IKMA 1LT3D 1PZKD 2EKIA 1TU2B 4DV4L 3M3YH 2K52A 4CKCA 3PMFA 2JUOA 1FGBD 4MDKE 3V96A 2YEPF 1X55A 2PNHA 4IFDJ 2XNAC 4A3IG 1UBQA 2ZT9C 1OGWA 1JCKB 2PTLA 3HM3A 1YHBA 2KHSA 4A3IB 3UINB 4FXKC 2K75A 3HS0C 3CIRB 4MZ9A 3GTPH 2MP1A 4XIGS 3ULPA 2NPTA 1PVOA 2W9NA 3OJ4B 1HTQA 1C9OA 2KQSA 4AQYQ 4LFCQ 1B9NA 4A3JH 2M17A 4A3LH 1A3TA 1K28A 2B2YC 1OTCA 1HZ5A 1I4XA 2DHZA 1GHKA 2PE6B 3PHXB 1X9NA 4BKGA 1W3SA 5E4XA 2KYWA 2L0FA 2CU3A 3Q2AC 3C2PA 4GN1A 1YNJC 1YNJD 2DN8A 3W2DA 4BFRA 1EY7A 4IPCA 2VB3X 1FJGL 2X38A 1QOGA 4P73A 2CR5A 4IOCA 1B7YB 1HUMA 2NVYH 1EUVB 2Z8LA 3Q3NC 5D7GA 1Y14B 3HM6X 5LXIB 2O6VA 1E6EB 1T0QC 4W9LA 4K5XA 2K5QA 5L37A 5FLMH 3TQYA 2FCSA 4A3GB 1M1KC 3APDA 3NZ3A 5KNDA 1VQ4A 3AH7A 2IO0B 1CHPD 3R7RA 2FMMA 3W3AA 2EOTA 2BPSA 2JT4B 1E7UA 1H9JA 3EQLC 3NRZA
chains in the Genus database with same CATH topology
1UWMA 1EU4A 3Q22A 4OIJA 2KCNA 1P7FA 4KN4C 3QOJA 5J22A 4FNFA 1L4DB 2J53A 4H2AA 2WB1B 4LTUA 3P4QB 1TWFB 4RGTA 4A8XC 2X69A 1S4ZA 2PZWA 4NMZA 1MHXA 2BA0A 1JOQA 1R7SA 4R9WA 1X3PA 2K0PA 1CT1D 2JA7B 3HVDA 5M3MB 1SSOA 3T53B 3BK1A 4KKJA 2EYJA 1R4PB 4OIKA 2KQ3A 3J7AV 1V1PA 2K5WA 3TMEA 2F0PA 5I6YA 3RZOB 3NE5B 3C1EA 2JEBI 3I73A 3AE7B 1C8CA 4FXDA 2N0SB 2FHTA 2EDGA 3HRZC 1HUNA 1CJEA 1DM0B 2QILA 2IJ0A 4GDLB 3HOYB 1OQRA 1CQVA 1QNUA 4FF4A 1MHHE 2KUMA 1K53A 4KJOA 3IAM1 1RTOA 1PMRA 3HG9A 4QMGA 1JC7A 3FPPA 2WXOA 2L0CA 1MI0A 5C4HA 2OXPA 2RDFA 1FNVA 5G5HA 3NVYA 2BA1A 4KJNA 1QWYA 1BO0A 2E74C 2FFKB 3TDQA 2NN6G 1C76A 4KGRA 4F87A 1TKGA 3AEDB 1NYQA 3J81L 3URYA 3R2TA 5HURA 5ELDA 4BA1I 4KGSA 2J0TD 3L7ZC 2DNCA 2E2DC 3PZ7A 1IW7D 1IGDA 2WXJA 3M4OB 1ZKOA 1SNCA 2D2CC 4HMIA 4RCNA 2MEKA 1I50B 1M4VA 4ZHPA 1RHPA 2M9VA 1IYUA 3BS1A 1DOKA 3K5MA 3ZGZA 3D4RA 3I72A 3AB9A 2ZW0A 4XT1B 4ABNA 2QSDA 4K14A 3CWIA 2F0UA 1Q10A 1II3A 3LXFA 4RF1A 2I46A 4KY7A 2TSSA 4E6IA 3BK2A 2QMTA 3MC0B 5KNBA 1QLBB 2IDYA 3K5OA 3NWSA 4TQ0A 2KCCA 3HZXA 4HTHA 2K33A 2RBMA 3PUWA 2V4IB 4IFDI 3MXPA 2B8GA 2WXRA 1H9RA 4DA2A 5I9OA 3HVZA 1YNTE 2K9XA 4D2KA 3E9SA 2A74C 2HCIA 3OWEB 2X6GA 1IBXB 2K03A 1TKEA 1N60A 2B2WA 2L52A 1G6ZA 1JWMD 4C56C 1HTPA 4B9XA 5T1GA 5JPNC 1BF4A 1DOMA 4JBWA 5ELCA 5JXVA 1HPCA 1UNSA 2LY7A 3AEAB 4J6HA 3AMZA 2K6AA 4K5VA 3LB8C 2J7ZA 1TYGB 1W6JA 4A55A 2DYOA 4MH8A 5MPOA 3RUZA 2WXGA 1WVLA 4YIJA 1OQQA 1LT4D 2G1EA 2OT2A 3Q0AA 4IQZA 1IGCA 4MN3A 2XIWA 3E56A 3DUZA 4FO2A 4RKBA 5JEAG 3S2HB 5LL6S 3MXNA 2F3WA 1EL0A 4DAVA 4IUTA 4C2MB 4K2KA 5CV9A 2FINB 1TZOA 5C2TB 2ID0A 1IYVA 5D14A 1WYGA 1R4QB 4A3BB 1HQMC 4DAYA 2J4XA 1WTXA 1D4BA 4RWSC 3VYTA 4YSZB 2HQEA 3TEYA 4CJ0B 2GI9A 3P1HA 2M2LA 2R6GA 2CW0D 2RSNA 3KWVA 1FRRA 1L4ZB 2V3NA 5EPJA 4LK0M 1ROEA 5CYUA 3T56B 5FO7B 3FC4A 3RD4A 2EY1A 2L12A 1ENAA 1TY0A 3GTJB 1BDOA 1NCVA 1I6VC 2WXFA 2L4NA 4KKUA 3SR6A 4K5WA 5JEAJ 1Q8IA 4PQXA 1ZE3D 5COYA 3WOEA 2Q8TA 5BN3A 3PUZA 3S14B 2E6XA 3KF8A 1FCLA 1AW7A 1F9SA 4NDXA 1WTPA 1O7YA 5BMHA 1TQOA 1GB4A 5EPLA 3A8KE 4K6DA 1Q3LA 3HKZB 1OXXK 2F03A 1RFKA 4FYDA 1ZYRD 1SBBB 2Y5PA 3VRAB 1BUVT 1J7CA 2B8FA 3TEXA 1V1PB 1KDAA 1VZ8A 3NP8A 4A3KB 1L0YB 3MXUA 3BVMA 2R7ZB 2WS3B 3D3RA 1GOZA 1EY4A 1XLPA 4HRSA 3ABVB 1O7ZA 1C78A 3A7LA 2F0NA 1HA5A 2RDHA 4A6QA 2K22A 2IGDA 4U673 1XYIA 1F2ZA 1BCPB 5KRUA 1JWBD 5FLXE 1F0ZA 3A8IE 4HCEA 2L9HA 5EE0A 2JQRB 5IT9E 3N6RA 5LNK1 2L1AA 2D5GA 5FK9C 2IX1A 3IT6B 4WORA 4OW0A 4K8JA 1C4AA 4O1NA 2FBWB 3T3NA 1PDQA 3T51B 1AP0A 2B63B 1EWHA 1PTOB 1HHVA 3KLSX 4L2YA 4P6VF 2NN6I 3ZQ4A 3ERQA 2FJ2A 4ZQ3A 5JVG3 1ZDXA 3A56A 3DEPA 1PGXA 5HI1A 4V0BA 2A6HC 1NI3A 3S1NB 1KH0A 3AEEB 1GAQB 5C44B 5I6WA 5K36G 3ND8A 5TSSA 4A3EB 3M7GA 1RKNA 4EGVA 5I2YA 1P7EA 3EVQA 5CV8A 3E5SA 1CZWA 1I4RA 5C0XG 3RZDB 2Q5WD 1DYQA 3OHXC 4RGMA 2QF7A 1WXQA 3MHBA 3I57A 1FNWA 2L1BA 3VR3A 4IUUA 3U7ZA 2EY6A 4WRDA 2O4XA 2WLBA 1HTLD 1A2UA 1G91A 2BW2A 4PNYA 2IGGA 2AQ1B 5BYSA 4M8AA 4WWMA 3KWLA 2JEAI 4S3SA 4HKQA 1L6UA 4FXCA 1ZUD2 1BR9A 4X3TA 2KVMA 2EXZA 3UI2A 2XSCA 1STYA 4IN3A 5H92C 1V8QA 5BMIA 4ZUJA 1VJKA 4L23A 4IKGA 5GXGB 1OXVA 4ARIA 1TWCB 4N58A 4I7ZC 2IL8A 3DWQA 3P7JA 5T1IA 1C48A 1E2ZA 1TS3A 2B2YA 2EVBA 4KD3A 1PZJD 4EQOA 4YSYB 1TR5A 1PGBA 3KLRA 1G291 5EKLA 3OMGA 5C3EB 3BWUD 3Q8FA 4O42A 1JWAD 1F2MA 3NVWA 4YXDB 1CTMA 1DCZA 4YSXB 1HQRD 1ZXHA 1SIJA 1XLQA 2F0SA 4GZYC 4X3KA 3D4WA 4K2LA 3ZJUA 1S5ED 5CBEE 3T3OA 2LKVA 2L83A 2BE5C 2BE5D 4TQUS 3GTLB 2B39A 3ITPA 2LFIA 3AE3B 1H9SA 4ZKBB 2F0TA 1AFPA 1BQQT 1VDZA 3D4DA 3NTKA 3RFZB 2WDRB 2EYMA 1STNA 2NVTB 2KDMA 3FEWX 3F2UA 3A54A 2PVGC 2HDLA 3OIPA 4KHZA 1AYFA 4F7XA 4G57A 4KY5A 1D1KA 2PZUA 2OHFA 5EKIA 2PW7A 1O7LA 2Q8IB 2JYEA 5EPKA 4OZBA 2F0HA 1A15A 3AE8B 2NBFA 4RGNA 1PFMA 3H6MA 3Q23A 3SE0A 1AN8A 4MM3B 2VZKD 1SYGA 4IFDH 3EA6A 4ZRQA 4A3JB 1EM7A 4PMWA 1MSGA 2PKOA 4TSSA 1RTNA 1SNDA 1S5FD 3IKJA 1K8MA 4M0WA 2QDBA 1RODA 2YYZA 4KTAA 4ZYSA 2A6EC 2E75C 3ZJTA 5C4ZA 5ELFA 3MFYA 4GLSC 1U4PA 4ZUIA 2R93B 3TBIB 4CJ2C 1FRDA 1PRTB 1K51A 3AE1B 1UEAB 1FFVA 3TEWA 1EWCA 3GTMB 1JR0D 3MVVA 4XWTA 1FEHA 5KYIA 3HUIA 1D6EC 1SJED 3MP9A 1EYCA 2IX3A 1A2TA 3SVMA 3I8ZA 1MPEA 2ICIA 2BBCA 3NUHB 2SOBA 4C1NK 5HFYA 1TWHB 1Q12A 5NUCA 3J9CA 1XEEA 3UI3A 5G5GA 2HDEA 4G4KA 4KD4A 3NS1A 1JALA 1QT9A 3M7NA 2F0KA 2LMCB 3X3MA 2A73B 3AE5B 4NKLA 4A3MB 2KOLA 2OEOA 5AFWA 4FF3A 3K6OA 1LTTD 4DNTB 1HCZA 3NVZA 2F0DA 2R61A 4Q0FA 1S5BD 2W3SA 2SDFA 3RMHA 4YWGG 5IOCA 1GPXA 2WXQA 4CGYB 1FXIA 2JA8B 3AMUA 1TS2A 3I4MB 1NAPA 1VZ7A 3QG1A 1EY0A 5C0XI 1CQFA 3TP6A 2VNUD 2F1MA 5CV6A 2N88A 1U4LA 1L0VB 3NXWA 1WSPA 4B9WA 3SFDB 4C1NI 4DK0A 4RHSA 3CHBD 1QG7A 1I4GA 1X3QA 1GUTA 3CKIB 2GRIA 2YU9B 4IDIA 4R8IA 5EQ0A 3ETRA 1D5MC 4C80A 1WTVA 4KN7C 1Y1VB 3PIP3 2GA4B 4AS1A 2LJIA 3H91A 4PMCA 1SYBA 3BDCA 3P1MA 2WNMA 4FF2A 1KNEA 2G9HD 4ZRZA 4ARCA 4HCSA 3KUPA 2F0MA 2F0IA 1F2RI 1PTOF 2MHVA 2FUG1 2RSOA 3I90A 1KFYB 3U4EG 3NBHA 1H9MA 1B1ZA 5CR3A 1ONLA 4JE3B 1S5CD 4IZ8A 1FFUA 1NVID 1N5XA 4AYBB 2QIEB 2CJNA 2PW9A 4QF4A 2H88B 5T8IA 3NHHA 3X3NA 2B2UA 4XQNA 1H9SB 3VR9B 4G7HC 1Y1WB 1ICWA 1CK1A 1ILPA 1MI2A 1D5XC 3IL8A 5DEHA 2NN6H 2NYZD 1AEXA 4DN4M 2KEDA 4QIWB 2QJLA 3L3OC 5HG2A 1RD9D 1BOSA 2F4IA 4K6LA 4Q2JA 1NENB 1B4OA 3HRDD 1EZ8A 1TJEA 4YT0B 2MH7A 3HOVB 1XX8A 3K5LA 1DOXA 3VA7A 5FLXL 2WQYB 1Q1EA 2WXHA 3KK7A 1EQVA 4R3DA 4REZA 3SEBA 5IT9L 1G2SA 4FVMA 2IWHA 3C3LA 1Q90A 1F9RA 2VXWA 4L8JA 1EY9A 3A55A 1GJXA 4EQNA 1BNZA 1F2YA 2BYTA 4LLGM 2X6LA 3RPFC 3W5VB 4XQJA 1J8IA 2NB0A 3GD7A 3N52A 1E2WA 3RLFA 2F0VA 3S1MB 3R8BA 3DHQA 3BIID 1NR2A 2L5TA 1LV9A 4NJCA 3E6ZX 4HN7A 4F88A 3J80E 5EKKA 1JMLA 5K5PA 1YQ4B 5FOBB 2DY7A 3QJYA 1RF2D 1N62A 4YTMB 1M8AA 3QB3A 4BS9A 1EIHA 5DAUA 1TIID 2YEPB 2KA7A 3ONAB 1LTRD 4RGOS 3PUVA 2JZPA 2CQAA 1KLUD 5FKAC 4OO1G 2Z1CA 3SXHA 4DNRB 3GB1A 4EQPA 2XWBB 2F0GA 4QUFA 3B2GA 4PMBA 4XXEA 1WTWA 4LK1C 3EROA 1KABA 2RA4A 4ODGA 1Q1BA 2JA6B 4KGTA 1U4MA 3AM9A 2N9LA 1E0ZA 5JEAH 4CBVA 1J9OA 3CQZB 5A35A 4XTCS 4EE2A 2XWJB 4DAPA 3GTGB 2RPVA 3KBXA 3T13A 2B2TC 1GUOA 1S5DD 2HUGA 1TT2A 3AE9B 1STAA 2AUKA 2DLBA 5C3JB 3SK5A 1MVKA 1UAPA 3NK9A 2IPKD 3L4PA 4HJGE 3NBIA 5HHDG 4EVOA 4USAA 4XYOA 4RFBA 4CKEA 2EELA 1ZDVA 3J7YW 3WOFA 1QQRA 3H3VC 2F0OA 1F9QA 1HXYD 3AE6B 1F9PA 3C46A 2EE1A 5J39A 3VRBB 3NQTA 1CM9A 2Y0SB 1CFMA 2MJEA 3VR6A 4XQQA 4DF7A 2QCPX 3HEJA 3P63A 2ZW1A 2RMMA 4RHRA 3GQBA 1MBYA 1Y8PB 3NWTA 3T16A 2EPBA 5IGBA 1E7PB 1YJJA 3VR5A 2WKDA 1BMLC 4CQNA 5IIFA 4KHVA 1PZID 3H8HA 4Y7NB 1KDCA 4DXGA 1XWEA 2PVOD 1EEID 2H1EA 4C3JG 1SYFA 4C3JB 1VR9A 3TEZA 2K28A 4H7BA 4HEA1 2LFNA 3VA5A 1V43A 1FO4A 2WINB 3PO3B 2WP8J 3K57A 1KF6B 5CORA 2K32A 4DFAA 5KIXA 3M85A 1EIGA 2B2VA 4ZOHC 1FMAD 5C4XB 1SAPA 1ZOYB 3GP7A 4RKLA 2N7JA 5IODA 5C3XA 3KBGA 4QUCA 1F2RC 5KGUA 2NTTA 5IGFA 4N9TA 4NZLB 3P75A 2DY8A 3Q6SA 5CV5A 1BUIC 5JJZA 3D6CA 3HOUB 1RCVD 2EYFA 2FMCA 4KKIA 4G7ZC 1JQYD 3HOXB 2A6HD 1O80A 2BDOA 4LAAA 2M56B 4H13C 1B53A 2D5DA 2LMCA 3MAQA 2WXLA 1YNNC 1YNND 3I4LA 2BB6A 4CKBA 1ACCA 5CV4A 1VMCA 2PLPA 3EJIA 1LT6D 4FF1A 1WWTA 1TVXA 4CJ1B 1Z6HA 2KQ4X 2NMQA 2B76B 1GUWA 1JICA 3I9V1 3VR2A 1X32A 5E3FA 2KWDA 1PTOH 3BVZA 4WH4A 4UDUC 2EZVA 3TP8A 5JOBA 1XTCD 3DWAA 3GV3A 2O2LD 5M9OA 3KLSA 2BS2B 1DGJA 3GTKB 2MJ8A 2KN4A 2VUMB 1DD2A 2OEDA 1VDVA 2BS3B 3AU7A 3SFEB 2EJGC 3HGBA 2D9UA 3S15B 4HSPA 5K36H 1FCCC 3FRPB 5I2XA 1ENFA 4U68A 3S1QB 4WIPA 2EYOA 1AZPA 4OZCA 1FXAA 3I70A 2F0LA 3SR1A 1EEFD 5C0XH 3AB5A 2ON8A 3DM1A 4HKZE 1VMPA 1YJIA 2ONQA 4J3OD 1WD1A 3B2FA 4US8A 4JWUC 4ZKCB 2IT1A 4QB4A 2AWOA 4XDCA 5IGCA 2Y5CA 5BMGA 2V4DA 3LNNA 2NVQB 2JU6X 1EY6A 4F8MA 3BZDB 1CZGA 4N59A 2PNRC 3V3XA 5DNFA 1J7BA 3IAYA 1C4CA 2KECA 2EJMA 1AWDA 1HFGA 4RAUC 1D1IA 2E3TA 3TSSA 2NWGA 3P4PB 2F3VA 2F0EA 2AQ3B 3OOCA 3AEFB 2DBYA 5HGTA 4YTPB 4MIUA 1SE4A 1I6HB 1IHZA 1MGSA 1N5WA 3E0JA 1L0XB 2WV6D 1RM6C 4WQMA 2LGIA 1ZXIA 4CHTB 4OO1I 2BS4B 2GB1A 1SE2A 1R9TB 1DOLA 1HRJA 3H94A 1CHQD 1B44D 2WAQB 4ZHOA 4IUNA 1L6VA 1ZXTA 3R2IA 3BDLA 2MUYA 4ULLA 4XYQA 1VF5C 3BYTB 2R92B 2EYLA 2AWNA 1CA5A 2PMZB 2CVRA 4Z9CB 2G9DA 1LACA 2L32A 5C6AA 1SYDA 1SMYC 1SMYD 2MPMA 5CV7A 3JAME 2JE6I 2O5IC 1C4PA 2WU5B 2WACA 2E76C 1YN4A 2MJ3A 4P2CB 1ESFA 1WTQA 3SK4A 5DM63 3M3YB 1GUGA 3GO5A 2K7VA 2QKIC 4KKSA 2BTEA 2PMVA 2FE8A 1J7AA 5CBAE 3WCQA 3EFXD 2PZTA 1DXMA 1UUPA 1QILA 3GV6A 1NSNS 1B9RA 4NW2A 4J1MA 1FD6A 3GTPB 2EY2A 3QIAA 1CA6A 3OSOA 1BXTA 3N9YC 2K3UA 5A2QE 4JX1C 2KEEA 3MZ5A 1T5EA 3K59A 4BBSB 1JROA 2KAJA 1KTKA 2JWUA 1MD2D 4B08A 1PXUA 4XDXA 1RJTA 3D8GA 4P16A 1BBXC 5CGKA 1JORA 2EJFC 1XLOA 2VB2X 1PUTA 1JOKA 2NVYB 3EGRA 2A6ED 3PUXA 3FPUB 2WIIB 3FKIB 1Y56A 2PPBC 2R3ZA 1YQ3B 3W9CB 5BN4A 2WDQB 3T4AC 3P4SB 1SFOB 3C1FA 3LWUA 1O78A 4ITKA 3IFDA 1TWGB 4L63B 2F0QA 1QOBA 1SNPA 3OPOA 3Q24A 1CZPA 5ELBA 1I4HA 4LJZC 4AQ7A 1TKYA 3QO2A 5KEEA 2L11A 4MACA 4NP5A 1G2TA 5E4WC 2E2IB 1SF0A 4IUVA 2EYHA 2WXPA 2Z4HA 1XCQL 5G3LF 4JWSC 4IOIE 3V2TA 2M00A 3S17B 1PFBA 5IGGA 3S1RB 2NTSA 1T6BX 2PO4A 4DGZA 4WURA 3J80L 3IXSA 2IGHA 1TS5A 5JAVA 2O5JC 3ZYYX 3OWFA 4ID6A 5EE9A 1FYCA 1SYCA 3TUOA 4MHEA 5IGDA 1PDXA 1EY8A 3DXJC 4XT3B 5H8YE 1QOAA 1WTOA 3HOWB 2VZKB 1GUSA 4H0LC 4IURA 3TZDA 2JSVX 3CU7A 3MXGA 3R3OA 3NSWA 2JP1A 2PCFB 1LABA 1OXSC 1I4PA 4DU9A 1Y8OB 3D31A 1QOHA 1PFDA 4DK1A 1NEKB 4PV1C 5J1ZA 3MWYW 4FP5D 4I65A 2KACA 3S9WA 3NQIA 4ILWA 1BCPF 3U9SA 1EQTA 3K7AB 3PUYA 3A8JE 1ESRA 2M0AA 2W3RA 5KNCA 3O13A 3VR4A 2V3PA 2WXKA 1FD7D 1I7HA 5FR3A 2C9OA 4TKOB 1I3QB 3CRKC 2RKSA 1DONA 1QNKA 3HP3A 2XRSD 3CRLC 3Q8CA 1KAAA 2RDGA 1A3VA 2LHDA 1IUEA 3K0YA 1ZPSA 4X3SA 4X3UA 2DNEA 3V05A 2JYOA 3LYYA 2MJDA 3I91A 1YN5A 3WDNA 4LMQD 2BDNA 1OO9B 1CI3M 4BY1B 3K58A 5E1FA 1AZQA 2B2TA 4ZRPA 4NAWB 2K5DA 2TMPA 2PW5A 1IW7C 1LTGD 1STBA 3DEOA 4BWGB 3SHLA 2IW3A 3A7AB 1F77A 4N6EB 3OW7A 2JA5B 3FDTA 1LTBD 3PZ8A 3IT4B 3FMCA 1PGAA 2NZ1D 3PO2B 5JVH3 4KK7A 1N63A 3B9JA 1STHA 2I2YA 3TP7A 3W1SA 1XF5L 3ND9A 3Q8AA 3PV0A 1Y69U 2AQ2B 5G3LD 4XDDA 5FO9B 4A9AA 2K1BA 2LUMA 4HMJA 3FILA 2BB5A 1C77A 3AE4B 3P4RB 4KY6A 2IX0A 1SYEA 2AX5A 1EY5A 1U4RA 3Q69A 4L1BA 1D5ZC 4IUPA 1FR3A 1NUCA 3I3CA 4C3HG 4OL7A 2N55A 4IUQA 4C3HB 1EU3A 3GTQB 4J8QA 2Y3AA 1HFNA 1QE6A 2H4OA 1VZ6A 5BYRA 2WXMA 1TS4A 2OF1A 2WKCA 4KKTA 4RNAA 3S2DB 4IALA 1OFFA 4UAIA 2ICEC 3U52E 1E0BA 2PQEA 3W5UB 1LLRD 5EGTA 2SAKA 4TRDA 3H09A 2INNE 1BCPC 1BCPD 1VRAB 1JQ4A 2A68C 2A68D 3BDOA 2JX5A 1YN3A 1RWSA 5CC4A 2LEKA 1Z47A 1STEA 5M5WB 1SNMA 4TQ1A 2W55A 1QKZA 5JPMC 1B2TA 3LX0A 5AUIA 4TMAB 1ILQA 3NUCA 5C5LA 2CW0C 4C3IG 1PTOC 1PTOD 3NTIA 2E2HB 1D2BA 5I9PA 4C3IB 1LTSD 1I4QA 2XVSA 1XO3A 3VQIA 1ZP0B 4NAMA 1K83B 3SK6A 1L5PA 3H0GB 1QCBD 1SNQA 4OO1H 1LTID 4H44C 4N9PA 3J7AF 1FNUA 1QJOA 1H9KA 2N9KA 4R8NA 3Q8EA 4A3FB 1F2LA 3S16B 5D3DA 3G7LA 1T3QA 2L55A 1E10A 5BYQA 3AEBB 2B2UC 4HR7B 2KMMA 2NVXB 2HTME 4ZLTF 3J81E 2QEJC 4B0MA 1PYWD 4ZAIA 1KDBA 2PIAA 3DWPA 4XWWA 4OHJA 2ZXOA 1ENCA 1W6KA 1LT5D 5D65A 2C5CA 1DOYA 1B50A 1SE3A 3BVGA 1ET9A 5BN5A 2D62A 2I38A 2F0WA 3L9AX 1C9FA 5I4DA 1KNAA 2H89B 1ZYRC 1DZ1A 5M3FB 2B2WC 1V1OA 1PFNA 1XXGA 4K8IA 2HCCA 2W82A 3MHZA 1QF6A 3QOLA 2SEBD 1A6XA 4A93B 3VYSA 3HOZB 1KLGD 1GUNA 1XLNA 2SNSA 1PRTF 1K50A 1ML0D 3DWGC 5LHY1 2JXMB 5FO8B 1GXDC 1JWUD 2J42A 3K5NA 1UGJA 4B0EA 1C79A 5EBCA 1ET6A 3JAML 5E6JA 4GDKB 3AV8A 1SJHD 1DJRD 4JK1C 1IKLA 3OMCA 1WD0A 3SDZA 1IL8A 3LWEA 1DOIA 1VCIA 3TZUA 3U2SC 4A90A 4DQOC 1WCMB 1TKWB 2A5HA 1N61A 3IAS1 4WAFA 1FM0D 2K05A 4HEDA 5C3WA 2M19A 4ME5A 1K8OA 4YTNB 1C4QA 4C7YA 2MGSA 2WXNA 5A2QL 1E2VA 1LO5D 2HDMA 4RCOA 5LL6X 5ELEA 2XN9C 1B9MA 1SEBD 5C4JB 1A70A 2WXIA 3KQ4A 3IFTA 1JRPA 4L6TB 2WU2B 3BG3A 1JW9D 2INPE 1RDPD 1JE4A 3MJ5A 1EYDA 5C5MA 4BA2I 2EYPA 5EBDA 5M5XB 1UWXA 3FILB 3FAHA 2ZXPA 4FXGC 1Y8NB 4BY7B 1XCTL 2JSOA 4V190 4KV6A 1VF7A 3TN2A 3R93A 1T5XD 3AEGB 1WGKA 5EE3A 4OZAA 4RF0A 3NPPA 3C8YA 2V0GA 2ENBA 1VLBA 2BT6A 3MA2B 4KX6B 4BBRB 4HSVA 2BCOA 4US9A 1WRIA 1V97A 4PT5A 3NTHA 4HROA 2K5PA 2CHBD 1EYAA 3ZJVA 3OIQA 3PIO3 2KJXA 1QOFA 2BOSA 4OVZA 2SNMA 1MSHA 2NUCA 3GS2A 2ACZB 1U9RA 2JXTA 2AUJD 4KI0A 4DXFA 1E9MA 1HA6A 5DM73 1A3UA 1V8CA 4RA8A 1K52A 5C0XJ 3P20A 4JPSA 1HEZE 1OXTA 5F2DA 4C7ZA 1SB3C 1HZ6A 1PRTC 1SXTA 1PRTD 2J52A 2W54A 2DYMA 4XE0A 2XRQD 2E2JB 2WDVB 2EY5A 2LHEA 4KMUC 1STGA 3AE2B 5IGEA 3MEHA 5ISRA 2CJOA 1B3AA 4WJWA 1EFID 4MT5A 3FVQA 1GB1A 3VR8B 5CMDA 3I4NB 1PLFA 3TP5A 3M4YA 3U9OA 2DWQA 2B2VC 2A69C 2A69D 3VYUA 5EJWA 2Q8RE 5M5YB 4WFN3 3AN1A 1RYJA 1Z7TA 5KYLA 1YMHE 1JOOA 1WTRA 3G6JB 2LS01 5D3IB 3DWMA 1OXUA 3SK8A 4IFDG 3VYRA 1TY2A 3EUB2 3MFGA 1EZ6A 1SSNA 2K01A 1LTAD 3Q8BA 4A3DB 2F0JA 2RVLA 3MTSA 1SNOA 4HAEA 5AUKA 2ZXRA 1G8ZD 1FIQA 1JWSD 4Q5VA 3PO0A 3GTOB 1QB5D 1KRHA 1ZEQX 1EOTA 2JYTA 1IBXA 3DMUA 2F0FA 2PYKA 3P42A 3BYYB 4ZK9B 3QWNA 1NYRA 1JB3A 1EWYC 1SDFA 4RH6A 2Z4IA