3R8BA

Crystal structure of staphylococcal enterotoxin b in complex with an affinity matured mouse tcr vbeta8.2 protein, g5-8
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
236
structure length
224
Chain Sequence
SQPDPKPDELHKSSKFTGLMENMKVLYDDNHVSAINVKSIDQFLYFDLIYSIKDTKLGNYDNVRVEFKNKDLADKYKDKYVDVFGANYYYQCYFSKRKTCMYGGVTEHNGNQLDKYRSITVRVFEDGKNLLSFDVQTNKKKVTAQELDYLTRHYLVKNKKLYEFNNSPYETGYIKFIENENSFWYDMMPAPGDKFDQSKYLMMYNDNKMVDSKDVKIEVYLTTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Enterotoxin type B
publication title Molecular basis of a million-fold affinity maturation process in a protein-protein interaction.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Toxin/immune system
total genus 70
structure length 224
sequence length 236
chains with identical sequence C, E, G, I, K, M, O
ec nomenclature
pdb deposition date 2011-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3r8bA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3r8bA01
1CQVA 2XN9C 1CT1D 5FK9C 1YN3A 2RDGA 1TS5A 2AQ2B 2IJ0A 1AN8A 3TSSA 2CHBD 3URYA 1LTBD 3DWPA 1EWCA 1L0YB 2O2LD 1EFID 5ELBA 3R8BA 1LT6D 1TS3A 1LTAD 1RDPD 3BZDB 5ELEA 1YN5A 1EEID 1QILA 1SE4A 3SEBA 4Z9CB 1V1PB 2XRQD 4K6LA 1EEFD 1D5XC 3KLSX 4DXFA 1PZJD 1YN4A 1SE2A 1LTRD 1D6EC 1PTOD 1LT3D 1HQRD 5I4DA 1JQYD 1LTTD 1PTOH 1SJHD 1UUPA 1PRTF 2AQ1B 1SXTA 1HA5A 1S5CD 1FD7D 1SJED 1I4HA 1KLGD 2RDHA 1I4QA 1PRTB 1PTOF 1S5FD 1V1PA 1I4GA 1LT4D 2NTSA 1FNUA 1I4XA 4NZLB 1LO5D 1RD9D 2QEJC 1M4VA 1PTOB 1ET9A 1SEBD 1BCPF 4UDUC 1XXGA 4RFBA 1TS4A 1CK1A 1F77A 3OWEB 5TSSA 1PRTD 1PYWD 3GP7A 1BCPB 2XRSD 5D3IB 5ELCA 1PZKD 1KLUD 3BVGA 1UNSA 3DWQA 1L0XB 1PZID 3BVZA 4TSSA 1T5XD 4RH6A 1EU4A 3V05A 1JCKB 4RCOA 3W2DA 1DYQA 1S5BD 1FNWA 1B44D 1S5DD 4OHJA 1AW7A 4RHRA 1BXTA 1BCPD 2QILA 3EFXD 4RHSA 1LTGD 1EU3A 1B1ZA 1ENFA 1TS2A 1HXYD 3R2TA 1V1OA 4RGNA 5FKAC 2TSSA 4O1NA 1HTLD 4L6TB 2G9HD 4ZYSA 4L63B 3MFGA 5ELFA 3DWAA 3BYYB 1S5ED 2WV6D 2XNAC 4RGMA 2NTTA 1DJRD 1JWMD 1JWSD 1ESFA 1XTCD 1LLRD 5D3DA 4DXGA 1KTKA 1TY0A 4BWGB 3EA6A 2ICIA 2AQ3B 1D5MC 1RCVD 1PRTC 3BVMA 1JWUD 3R2IA 1MD2D 2R61A 3O13A 1LT5D 3MC0B 1D5ZC 1G8ZD 1STEA 2IPKD 4RGOS 2J4XA 1PTOC 4C56C 1RF2D 1TY2A 1CHPD 1FGBD 3BYTB 5ELDA 1BCPC 1SBBB 1SE3A 1I4RA 2SEBD 1ET6A 1GOZA 1I4PA 1LTSD 1JR0D 1CHQD 3CHBD 4RGTA 1FNVA 1LTID 2Z8LA
chains in the Genus database with same CATH superfamily
5G5GA 5JPMC 2JA6H 2WU2B 4HSPA 5FR3A 4DR3Q 3F2CA 4DV4L 1Y69U 3F1ZA 5C4ZA 3W5UB 4JI7Q 4KKIA 4MACA 1QUQA 4JI0Q 1G51A 1LM0A 4JC0A 3R93A 3K0YA 3DWPA 3C46A 4TQUS 2WXHA 3B6YA 3A5UA 2L7RA 4HJ8A 2IX1A 2C5CA 1C78A 4PS7A 3A8KE 1KJTA 3UF8A 3ALBA 3PCOB 4YWKA 3M3YB 3KFUA 2RMMA 2A19A 4E6IA 3HOXB 1WXQA 1KRSA 1WCMH 2DAFA 3NZ3A 2AMCB 4YHHQ 1VJKA 1OXSC 4A75A 2LGDA 2KDMA 2RR9A 2E2HH 3DBHI 4C3IB 1CFMA 1X3PA 5T1GA 5I2YA 4A3LH 2D3AA 2B76B 3M85A 3MFYA 2RPQA 2JUOA 5H1SE 2D10A 2VXWA 1WH3A 1II3A 3TUOA 4IM0A 4MGKE 1HFGA 1FGUA 3HEJA 3GTMH 2WDQB 1HZAA 4YSZB 2NS5A 5DPSA 2NBFA 3GTLB 1S5CD 4XC2A 1KC8C 5CYUA 1T0QC 1K53A 4APVA 2Y5PA 1X54A 3AM9A 1WTWA 3U9OA 2I38A 3LYYA 1TJEA 1T0RC 2OXPA 2MA9B 3E6ZX 3JAME 1LO5D 1RD9D 3A74A 3V6EB 2XWBB 2PW5A 4NQKE 2A5UA 2PLPA 4OONA 3DMUA 1D4BA 5CMDA 4GLAC 5ISRA 1WGKA 2LMCA 2UWQA 4GOPA 4LW1A 1N33L 2K0PA 4M00A 1MI0A 3SDLC 3TEYA 1OXTA 2H89B 4IKGA 3U4ZA 1DYQA 2QCPX 2CCZA 4U68A 3ZXRA 2K50A 2UUBL 3AEDB 3RN9C 1MIUA 3DUZA 3QJZA 2NBVB 1KLVA 2K22A 1ZDXA 4JV5Q 1KH0A 4AJYB 3PUWA 1Q8IA 3PRPB 4S0RA 4BBRH 3V3XA 3ZO5B 1WI0A 3JSVB 1I3QH 2VZKD 1DOXA 4MELA 3H6NA 4FADA 3UE0A 1QZGA 4CDDC 2I0QA 1TKGA 2FCMA 2MBHA 2VH2A 1MHWC 4RWSC 4WJOA 4ZRKA 5C0XG 3K8AA 3A9JA 3MTNB 4KKUA 1G6ZA 1XX8A 5C4JB 4XDCA 1PFDA 1TIID 3TZUA 5D14A 1JWMD 1DCZA 1YIJA 1QVFA 3NUHB 3IG3A 4DK0A 3M62B 3PRZA 2C5LC 4DV0L 1JALA 4KV6A 1D5MC 4GB9A 1GKHA 1G291 4IURA 3MHBA 4GS3A 2MJDA 3RZFA 2N1WA 3GO5A 1VDZA 1Q8KA 2RA4A 4KSLC 5DEHA 4OWXB 1I6HH 3NVZA 1A0IA 4B95A 2F0JA 5D65A 1YJNA 1RWSA 1Y1WB 3DBRB 5GROA 1CM9A 3BWUD 4XDDA 5E3FA 2BYEA 2K8HA 1F9RA 2ALYB 4F1SA 5EKLA 2NMQA 4XGAB 1Y14B 1AE3A 2XVSA 3X23A 3HRZC 1LACA 3CCRA 2HQEA 2JXXA 4ZRPA 2JN4A 1EFWA 2AL3A 3S1MH 1J19A 5AJ3Q 2D3CA 3NK9A 2BS2B 2D5DA 3OMCA 2E3TA 5JH5C 3MXPA 3NS8A 4JI4L 5C5LA 2JP1A 3KUPA 3NRZA 4FXCA 2ZTCA 2LXKA 5EE3A 4DHZB 2MRPA 5E6OA 3W1SA 1GPXA 1WJJA 4UP7A 1VQ6A 4ZRQA 5LXIB 1F0ZA 2A8VA 3M9BA 2IY1B 4ODGA 2QW7A 4NP5A 1Q86C 1VZ8A 2R7ZH 2PW7A 3J7AV 1C77A 4J3OD 5L95C 4P71A 3GE3C 3KW5B 2JA6G 1G6PA 4DBGA 3KBXA 3W1GA 3D0FA 2K14A 1E22A 5IGBA 3I2ZA 3K9OB 1M90C 4AWJA 1AZQA 4CJ1B 4B3ML 2GMIC 4IC7B 2JA8B 4P1CC 3S1RH 2L1AA 4A3IH 3PO2B 3N30A 1WTQA 1CI3M 3VVWB 1JB7A 4IPHA 2E74C 1WTXA 3RZWC 3JW0X 4DR1Q 3A0JA 3CPWA 2KACA 1WCMG 3AU5A 1VQ5A 5FR6A 1YNTE 1JJGA 1PGXA 1I4GA 4M8NA 3U4VA 2PI2E 4A3LG 1HE8A 1SROA 3ICEA 1P98A 4EQNA 4PV1C 3CCUA 3PLVA 1WMHA 2R3ZA 1FPYA 2LI5A 2G3QB 3AYHB 4R1JA 3DDCB 2UYZB 2BDNA 3RUIB 5D3IB 2ON8A 3VUYA 3V61A 3S2HH 5JJZA 3VYSA 3H3VC 2CFMA 3AEFB 4BBNC 2VZKB 4HXDA 3A8IE 1BBUA 4DV4Q 3FPUB 2J0TD 1IW7D 3I70A 5TR5A 2ZXRA 1B44D 2BA0A 3A54A 3QG1A 1X65A 3GTOB 2UXCQ 1S1QB 2E2HB 2LRWA 5CGKA 1Z5SB 1EYDA 1SMYC 1AYFA 1EUVB 5HI1A 1R4QB 4R4IA 4YXDB 4IPDA 4TRDA 2AEHA 2GI9A 1WTHA 2EXDA 2KQSA 4CDFC 3L08A 1GC7A 3N1ZC 3QX1A 4A3KB 1CJEA 3DWAA 1V49A 1YQ4B 3M95A 4YY3Q 4F7XA 3SHQA 4PT5A 1WGRA 1JE4A 1MJDA 3S2AA 2EYLA 3K5MA 3KYDD 1V86A 3PQIA 1N36L 2IHFA 2JZ3B 1A8VA 1STAA 1NMFA 1PH9A 4C3JH 4BBRG 4YCUA 4P74A 4BXXH 2WXKA 1VQJA 3EA6A 5EBDA 1ZPSA 3NELA 3LGJA 2Y0SE 1R9TH 1IBLQ 3O13A 3MC0B 1L2NA 2O5JC 3WAPA 1Y8NB 3J81c 3W1YA 1WXVA 2PW9A 3L7ZC 3GOEA 1WJUA 2E5LL 4FJYA 3T8MA 5J1ZA 5HURA 3S2DH 1EY6A 4EZLA 4OELB 1RLFA 2MWSB 1X56A 1NNXA 3P1MA 4RNAA 1CHPD 1D1KA 2FXQA 2AWTA 3RZOB 3IAM1 4ULLA 1RAXA 2JRHA 1HHVA 2EMSA 2QKIC 2LY7A 3M7GA 1K8AC 3A56A 1ZXIA 1MPEA 1N33Q 2MSED 3BK1A 4KDLB 4BBRB 3DBRI 2KLCA 1VQHA 1NMGA 3U7DA 1KD1C 4NPNA 1A5RA 2XTIA 1FL0A 2MHVA 1GC6A 1Q82C 2DZIA 3BZCA 2ZVOA 4FHKA 4Q2JA 1YVCA 2L5TA 3KUCB 4PS8A 1VQBA 2Z4HA 2OJWA 2OF1A 2EYPA 3GTGB 3L10B 1EF1A 4ZRZA 3PGZA 5KIXA 5CHFA 3VDYA 2YEPB 4C4VB 1UD7A 4IM2A 4TQ1A 1EOVA 4K5XA 2UU7A 1F9QA 2F0DA 4PNYA 3CCVA 4XT1B 2K8BA 4JGHB 1K73C 5BR8Q 1GVPA 1YNJD 4N9PA 1Q46A 1JT8A 3L13A 1EQTA 3ZJVA 1TT2A 1ZYRD 1PTOH 2D62A 2LMCB 3PLUA 1UUPA 3D4WA 4X65L 2BDOA 3TQYA 1J7CA 5GMVA 1GNUA 4QIWB 3SD5A 3JC66 2R7ZG 1NI3A 1KDCA 4EZJA 2ZJPA 5GAEC 2M2LA 4KIKA 1YITA 1K0SA 3P7JA 3ZIMA 1P16A 1I4XA 2WAQB 4LJZC 3S1MB 1IKMA 1E8YA 2K9XA 3W1SC 2R92G 3S1QH 2L3ZA 1CSQA 1ET9A 3A1QB 3I4LA 1STHA 4B3TL 3N3KB 4P16A 2A69D 2L4NA 3OWEB 4JI5Q 2PZWA 4A3IG 2PQAA 4K7SA 3TZDA 2QC8A 3S9WA 3T4AC 4R3DA 4FULA 2BQQA 3F2UA 4OZAA 1QJOA 4TSSA 4WWMA 4QY7A 3RNCC 4NDXA 1QOBA 1UE6A 2NR2A 1S5BD 1AWDA 3A7AB 5IIFA 4K2KA 3GTJH 1GUAB 3JYUA 4JOIA 4A3JB 1HZ6A 3T16A 2DZJA 2J0JA 1X1MA 2F1MA 1NCVA 3PIO3 2PMZE 1ENFA 3BZKA 4IUMB 2IO1B 1UGJA 4HROA 2R92B 1OXVA 1ZYRC 5FO7B 2K39A 2H5XA 2BA1A 2F0OA 2KVZA 2SAKA 2G9HD 4ZYSA 4L63B 4YL8A 2F0MA 3MWYW 1I42A 1NUCA 4LTUA 4CKBA 1HTPA 3IFTA 3RLFA 3NTHA 1RJTA 3LWEA 1BO0A 4HCEA 3X0WA 3QOJA 2FFKB 1TU2B 2K5DA 3RNUA 4LFBL 3QC8B 3V62A 5IY0A 4BKTA 2A69C 2V4LA 4K5VA 3MZ5A 2RSUA 4IWQA 4HR7B 2QCZA 1LV9A 1YZ6A 4DAPA 4YIJA 5KNDA 5C3EB 1GAQB 3RCZA 3CSFA 2K7VA 3AE9B 3VQIA 3LB8C 3UIOB 1VMPA 1PMRA 3HZXA 4G7OC 4G57A 1H8CA 3QA8A 2B2TA 5HGQA 1FMAD 4JG2A 2RHQB 2ASBA 1FIQA 3BYTB 4C3JG 5CV6A 1SFOB 4XX5A 1E8XA 2LRUA 4DR4L 3NWSA 4FBJB 4JI2L 2CQAA 2G4DB 3PGEA 4BBNF 2H88B 4JLCA 2E2DC 2J7ZA 2KEDA 4CGYB 3ND8A 1NAPA 2LGYA 1OXUA 3KF6A 2ZVNA 4IQZA 3AEGB 2N4FA 5IOIA 4GN1A 2RDGA 3FKYA 4CJ2C 4EUTA 1SF0A 1OGWA 4IUPA 2BYTA 1HR0L 1HNWQ 2PVGC 2RD0A 2NVXB 3H3VI 4E71A 1RDPD 1NEKB 3LJ3A 4HJGE 1JMLA 5D7GA 1Y1VH 4C3JB 4MJSB 1I35A 1AH9A 2DJFC 4DPGA 2ZJRA 4JWUC 1F9PA 5IGEA 2I5MX 5JXVA 3CW2C 3RN2A 2B39A 4WQOB 2N9LA 4IUTA 1D2BA 1UF0A 1VF5C 3CC7A 1N36Q 3RYTA 2V3SA 5IGDA 3AE7B 3VYUA 1B9MA 1WIAA 5CV8A 2A73B 1JRUA 5L83A 4H7BA 3TS2A 5M5YB 3HOYH 1PFMA 3QQ8B 4YCVA 5KGUA 1ROEA 4G0NB 4R9WA 4MZ9A 4IOAA 3JAMi 3QO2A 2RVLA 2F4VQ 2NTSA 3NTIA 4POGA 1BUIC 4BKGA 3E5SA 3UQAA 1IP9A 1GUOA 2QEJC 1C9FA 3Q22A 2GBKA 2OEDA 3AMZA 2F0FA 3CIRB 1B4OA 4IN3A 1F77A 2PQEA 5TSSA 5JEAH 2VQFQ 2K25A 2PE6B 2V1YA 2MQJA 3N20C 3PF5A 3FHWA 1EYCA 2LASA 1WTOA 4IPCA 3DWQA 1B3AA 1I5FA 4G11A 3S14H 4RH6A 2CR5A 3T9LA 3CQZB 3R7QA 1R4MB 2CWAA 3L9AX 2MBBB 3S17H 3TCAA 3TBLD 2MJ3A 3EFXD 2IO0B 4QB4A 2EJFC 1LTLA 3NUCA 2M4NA 1V1OA 2K05A 3SE0A 3NBHA 4DV3L 2GBNA 1STYA 3OMGA 1TWAB 1WGGA 2O2VA 3I55A 4G3XB 2QIEB 2RDFA 3TRZA 4P73A 1LABA 1HUNA 3MXNA 5JVG3 3U52E 2KLGA 4A76A 2LEKA 2HHHL 4FXGC 1DXMA 4GN5A 2HT1A 2B63B 2IYDB 2WXFA 3O65B 1ESFA 3WOFA 3K57A 2DY8A 2L11A 3ERSX 3RD4A 1WXSA 3AE4B 4YWGG 1FR3A 2K52A 4P72A 3B1LX 1MG8A 3DVGY 1U5KA 4DHJD 3L4PA 3BVMA 4PK1A 1S40A 2D07B 1WX8A 1IKLA 1UELA 4JI7L 3Q3MC 1G6JA 4JI0L 2LJIA 4K8JA 1STEA 4ARIA 1KDAA 4B3RQ 2NBWB 2BH2A 3Q3JA 1QE6A 1UE5A 1N5WA 1XNRL 1L5PA 1RFKA 1O78A 1Q1BA 1MKHA 1N9WA 1BOSA 2QDBA 1BVSA 3G71A 4KX6B 1SBBB 5D6JB 1F2RC 4YHHL 3NP8A 1A2TA 4POFA 1S72A 4K2LA 1UGMA 2KFJA 4JPSA 4HIDA 2JSOA 4GOCA 4HKQA 3M3YH 3HOXH 2UU9Q 2Z0DB 5EAYA 4C2MH 2JWUA 3IAS1 1PH3A 2KANA 4I6LB 4C3IH 4IJHA 3CCMA 4RM8A 1T0YA 2DYBA 2OJRA 3HKSA 3ML8A 1K8RB 1GB4A 3A55A 3U58A 1PFBA 4DR2Q 5IE8A 3NS1A 1VQAA 3FAHA 4PYZA 3I63C 4RA8A 3SEBA 3I3CA 3SK6A 4LNNA 4KI0A 2WXQA 3GTLH 3TP5A 2N8NA 4N58A 1GJZA 1XPUA 2DJGC 4P1BC 4RKBA 4JBMA 3L16A 3PMFA 1YHQA 4DFAA 1L0WA 1H95A 1P0RA 2BYFA 3TS0A 1LT3D 1XLOA 3K5OA 5I6YA 1BF4A 2M8SA 1JQYD 2PQAB 2J0MA 2AQ1B 4BOZB 4AP4C 1Y1VG 4GDKA 4CO7A 2IGDA 4L2YA 2KXJA 2N7EA 2WP9B 3TP6A 4JV5L 4A4IA 1WFYA 1N60A 1EIFA 1Y8RC 3LNNA 1M4VA 5J22A 1GJXA 3FKIG 2CHXA 3NJTA 1BR9A 2Z4IA 2PZTA 3PIOA 2WB1B 1S4ZA 2RPVA 3D4DA 5L37A 1XD3B 3HOYG 1VF7A 1IBKL 2JPHA 4RMFA 3MJ5A 3G6JB 1F52A 1V8QA 1E8ZA 2K3UA 3HM3A 3W2DA 3BJUA 1RKNA 1SIFA 4EE2A 3VTUA 2BWES 1VQKA 4HAEA 5G3LD 1WTPA 1EU3A 1LTGD 2ZJQA 5IODA 3HKZB 3OPOA 3VR5A 5C4JH 4ALPA 1E7ZA 5JEAG 4JIOU 1HXYD 3IT6B 2WQYB 4N59A 1R4MI 3P42A 1XCQL 1FFVA 1WD1A 2XSCA 2PPBC 3FKIB 1TT5B 1L4ZB 3VYRA 3KVFB 4YWMA 3AE3B 2WNMA 3SVMA 3HGBA 2R6GA 2RF4A 4DGZA 1E5WA 4GGQA 4X3UA 4DHJB 1S5ED 4KGTA 2L8JA 4S17A 4W9JA 1Q90A 4LDTD 2UXDL 2LUMA 4XIGS 1WM3A 1H9SA 2KA7A 2EOTA 1LLRD 5AJ3L 4XQQA 4Y7NB 5JJKA 1EIGA 2WS3B 4HPLB 1Y1WH 3DQVA 3GDEA 1PDQA 2N78A 3PZ7A 5AZFA 4HIMA 3M4YA 2AYOB 3Q3OC 3BS1A 2L05A 5M5XB 1EYGA 2JE6I 5CV7A 1PH5A 2YTXA 4BA1I 2PE9A 3KF6B 2WXLA 1JOOA 3CMAA 2BVCA 1YJJA 2KTRB 4OZCA 4XQJA 1VQOA 2L55A 4EGVA 5T8IA 4FA6A 5JOBA 3A5ZB 3X3MA 1SAPA 4V190 2I2YA 3S17B 4II3B 2WX1A 4C00A 2K1FA 1VQ7A 3DBSA 1LTID 2N55A 4CQNA 5IT9c 3CC2A 2NVTB 2E2IB 4GU2A 1JMCA 2I1KA 5AUKA 1CT1D 3P63A 4YTPB 2ZW0A 2ZXPA 3K6OA 1WZ0A 2KWUB 1QNUA 3URYA 4KD4A 1HNZL 4DR1L 4JI6Q 1N5XA 2JYTA 3U8ZA 2WXIA 1YNND 3KDFB 3OSOA 4DV3Q 3EBEA 4ZUJA 2GLSA 5FO8B 2JA8H 2K1BA 4H0LC 1SYGA 3PO2H 4GLXA 1U4LA 2OQ0A 3CRLC 2F52A 4ARCA 3RNAC 3APDA 1JOKA 5CV9A 2LUEA 4LNOA 3HOXG 2L15A 2B2YA 2N1VA 1SE2A 1VQCA 4C3IG 2R7FA 2VH1A 4N9F4 4WJNA 4FN2A 1Q3LA 1RM6C 1Q7YC 3PUVA 1E3PA 2A6EC 1SXTA 5JAVA 1Z9FA 3AEBB 1STNA 2KWCA 3TN2A 1I4HA 2MFIA 4ZUIA 2UXCL 2K6AA 2AWOA 2WXPA 1K83B 2LXCA 3PRMB 3T51B 2EYHA 1NE3A 3STBC 3RNGC 2Q5WD 3MHSD 5D2MB 2LWPA 1O7LA 1XNRQ 4ZK9B 4D2KA 1E0ZA 1CKNB 1WTRA 4NMZA 4B9KA 1WZ3A 3A7LA 4DAVA 4DAYA 4LF9Q 1FD6A 3JVZX 4XT3B 5IGFA 1R4PB 3J80L 4C2MB 3GTOH 3NBHB 3TMEA 2B3GA 5ELOA 1TWFB 2K5PA 4YY3L 1VQGA 2PI2A 2Z6BA 2OTLA 3FILA 3WALA 3P75A 2O2VB 3OIPA 2HDEA 1XTDA 4FF3A 2G9DA 2REXA 3BVZA 3LXFA 4A3GH 2IZVB 3PS6A 3PO0A 1XLNA 3E9HA 3TDQA 1T3QA 3KLRA 4EQPA 4A3KH 1AW7A 1F2RI 4BKSA 1AZPA 4UP8A 2HDMA 1IBLL 2B2UC 1ILPA 4QJFA 5AZHA 1YBYA 1JW9D 4DXAB 1HR0W 3C2PA 4LDTB 1HTLD 3RI7C 2PNRC 1QB5D 2NZHA 4KY6A 4X3TA 3F2BA 3I4MB 2JWZA 2LD9A 1UWVA 4PQXA 4QCLA 3TREA 1E1OA 1QKZA 3D6WA 3J80c 3VR3A 1JWSD 4OGQC 1FFUA 1EZ8A 3CRKC 2V3PA 4HCNB 3VHTC 2FCQA 2X69A 2KYWA 4WJ3M 1HZ9A 2IO3B 3EGRA 3Q0AA 3WOEA 3RZOH 3B0AA 3KF8B 4OL7A 5EBCA 2H4OA 4FNFA 1YJ9A 5C4XB 4KZ0A 3OHXC 5FLMH 2AWNA 2M9VA 2C7MB 2DNEA 4C56C 3H7PB 1YHAA 2LFNA 1AFPA 1EIHA 1VZ7A 2KK8A 2DNCA 5GAGC 4ILWA 3H3VH 4LNIA 2FMMA 2XIWA 2Q2TA 2YU9B 3PF4A 1TWCB 2HCCA 1SE3A 4IFDI 4MSQB 1Y1WG 3H94A 1P7EA 2J42A 3GTGH 1MJCA 5BR8L 1W3SA 1IBKQ 4PYUA 1FNVA 1SE4A 1EF5A 2TMPA 2F0LA 2KOLA 3HOWB 4DUZQ 4K0KQ 1JJCB 2XN9C 2BW2A 2WGSA 2WLBA 5DPRA 1LGRA 1X3QA 4GNXC 4UP9A 4A3EH 5LMNW 1BBWA 2KC2A 5CC4A 2EYJA 2ACZB 1IBXA 3KQ4A 1SYCA 2WIIB 2UXBQ 2KFKA 2KQ4X 4H44C 1G91A 5C23A 3PV1A 2SNMA 2Z9HA 2L32A 4GDKB 3R3MA 3FP9A 1KL9A 1WE7A 4I7AA 2XK5B 1C7YA 3KK7A 4K6LA 2EELA 3FMCA 3KLSX 4IW0A 2F0TA 3I73A 4JI5L 1YN4A 4XE0A 1HPCA 2UXDQ 2MP2A 4ZRIA 4JBJA 2VZAA 3OTOL 5J18A 3IFWB 4YCWA 1A62A 4CDCC 3N9YC 3IBEA 4WAAA 1JB3A 3U7ZA 2NVYB 4IOIE 1X32A 3BINA 3D32A 1LUZA 1SNMA 2JA8G 1SJED 2HDLA 2WP8J 1E90A 3PO2G 4GXBA 4MHEA 4KHPQ 1V1PA 3CCJA 1FM0D 1DGSA 2BBCA 4J6IA 2F0GA 2K32A 5EE0A 2N9EB 5IYDH 1DOLA 1SNOA 2ASQA 5MPOA 1IL2A 1FRRA 1WOCA 2PNHA 4HJ5A 1GUSA 1E9MA 5EJWA 2ZPNA 2FJ2A 4A3JH 3FRPB 4DV1L 3PSIA 2D2CC 1MHHE 1PYBA 1SYDA 3I7FA 4JK1C 5LL6S 1GD7A 5EQ0A 3CWIA 2R92H 4BKSD 3CKIB 2B2YC 5G55A 4G50A 5EKIA 2HD5B 1VLBA 4HCSA 3Q3NC 4ANVA 3RN5A 4L5TA 5CV5A 5C2TB 3B2FA 4B9WA 4GNXB 1HNZQ 2XBBC 3WCQA 1IGCA 4XQNA 3KWLA 2KWVB 3HUIA 4QGUA 2Z6KA 1C48A 3B08A 3AMUA 2MW5A 3KH0A 2ZXOA 1NYQA 1ACCA 3E3XA 2AKWB 5CHWA 3BK2A 1EZ6A 1M94A 4TV3A 3EJIA 2EYOA 3NHHA 1N61A 3QJYA 3A33B 4A3GG 1NVID 1HZ5A 1UH6A 4ANXA 1BMLC 2R7DA 5C3EH 5C3XA 4A3KG 3VRBB 1OEYA 2WACA 3H6MA 1H9MA 3BDLA 1ICWA 1C4PA 5M9OA 3ZNHB 1L1OA 4AUQC 1T9HA 1QG7A 3EROA 2ZTEA 4GSWA 1FJGQ 5E6NA 3BIID 3J80E 5JZEB 3J81L 1K8MA 1SFOH 1NI2A 4TQ0A 1G8ZD 3GV6A 3SK4A 1MJEA 2WDTB 1T0SC 2BS3B 4RKLA 2KX0A 1HNWL 1EY7A 2NBUA 2LGSA 3L0OA 4A3GB 3W9CB 4Q0FA 2KJHB 3VFKA 3RMKC 2LVOA 1KM7A 3Q2AC 1ZXTA 2QEXA 1K8OA 2YYZA 1V5TA 1TWGB 1E6EB 4ZKBB 1JR0D 2NVQB 1D1IA 3DM1A 2K5QA 1GG3A 2NVXH 4QAYA 2N9XA 4WURA 4KY7A 5FLMG 2M19A 3SFDB 3SDZA 4JYAQ 1QVCA 4GOPC 2V1CC 4A3CH 4WAFA 4OEMB 4KHZA 3VR8B 4KKSA 2AQ2B 2IJ0A 2CHBD 1LTBD 4ME3A 5IP4D 2JX5A 1CTMA 1XEEA 2V4DA 2PCFB 1JJ2A 2I1JA 2J7QB 2KQ3A 3GTQB 4L5SA 2GB1A 4QIWE 1LTAD 5ELEA 4A3DB 2F4VL 1OO9B 2IW3A 2EKEC 5DPTA 1QILA 3J7ZC 4REZA 3ZLZA 1QUQB 1HTOA 1IW7C 1EY4A 4KIKB 2QMTA 4ICVA 5M5YH 3G4SA 2WAQE 3K0XA 1JWAD 5EDSA 2VQFL 3GQBA 3UI3A 4A3EG 2O5IC 1HA6A 1QWYA 4JI1Q 1LTRD 1D6EC 3Q69A 4HWIB 1J8CA 4DAYB 2DX5B 3HOUB 1VMCA 3K80C 2M1MA 4X3SA 3GB1A 5FLXc 1ASYA 2N49A 1KIXA 2PKOA 2FCNA 4M8AA 2EXZA 3NVYA 1ASZA 2EJMA 2QHOA 4KJOA 1H9KA 5F2DA 2GBJA 3Q8EA 4P75A 3H0GB 4J8QA 2YLMA 4US9A 1NJIC 3CQZH 1S3SG 2WAQG 2R2OA 2MO1A 4A3EB 4IUQA 3MP9A 3CF6E 3GP7A 2XRSD 2GOWA 4ME5A 4CKEA 3MAQA 3C1FA 4DV2L 2MLBA 4XWWA 2ATWA 5G2NA 5I6WA 1NR2A 1TWAH 1IYVA 1SB3C 2PZUA 1EU4A 4GKJQ 1JCKB 4WIPA 1RHPA 3ZQ4A 5IYDG 2QGQA 1PV4A 4LF4Q 2PTLA 3Q8FA 4GOPB 4M0WA 4A3MB 3CXCA 3IVFA 4A90A 1LQBA 2B63H 4CHKA 2VUMB 2KUMA 2GVBA 4A3JG 4B3RL 3QCAA 4B9XA 4EKUA 5FKAC 3TP7A 3PREA 2WXGA 2BKFA 2EMTA 2C9OA 4K7UA 4UPAA 1TZOA 4RF1A 3ENEA 4I6NB 1RTOA 3ZYYX 1A70A 3DHIC 3FEWX 3EFUA 1PGAA 1YX6B 3K7AB 1EOTA 3RUZA 1TGZB 1Y56A 1Z6HA 4JL9A 4WH4A 5IYBH 1EY5A 1IYFA 4RGMA 3OTOQ 1J9OA 4DV6Q 4CJ0B 4FF2A 2F0VA 1XNQL 1F9JA 2VQEL 4OVVA 5D3DA 4WWPA 3ZTCA 3A9JB 3VR6A 4A3FB 1FCLA 2WWZA 4BS9A 3TEXA 2UU9L 1LT5D 2I07B 5HY6A 1YNJC 2IX3A 2J4XA 3MVVA 4IM3A 2C7HA 1SNPA 5C3EG 1JOQA 1VQDA 1SYBA 4XYOA 2Z6KC 5A35A 3MJWA 1PFSA 4DR2L 2PPHA 4C1NI 2HE7A 2KFKB 4KJNA 2WU5B 1L2FA 4L1BA 4YTMB 1GUTA 3W3AA 4OIKA 2L0TA 4TVAB 4DV1Q 2BCOA 2JF5A 1BDOA 4L8JA 1WF9A 4USAA 1IGDA 2K04A 2L9HA 1MG4A 2HD3A 2EIFA 3WA0A 1KFYB 4DF7A 2OWOA 4RF0A 1W6JA 1UWXA 1I7HA 2FBWB 4XWTA 2ZCCA 2EY1A 4XTCS 5FK9C 1GUWA 1YN3A 1CKMA 4OVZA 5BYQA 4A8XC 1TS5A 2F0PA 2QA4A 1XPRA 2E76C 3ABVB 2HIVA 1PHJA 1EWCA 4L5QA 3WAMA 1BQQT 1U4RA 1WRIA 1IYJB 5M3MH 4OW0A 5C44B 1SRUA 3M4QA 4HN7A 3RULA 4CHTB 1HRJA 1WY8A 4NPSA 2ZM6Q 3H91A 3Q8DA 4MM3A 3CF5A 1XLQA 2W55A 1V1PB 2K33A 3QWNA 5DM63 3J81E 2Q2HA 2JYEA 5FO9B 1PH1A 1SN8A 3TJPA 1PLFA 4OWTB 4A3CG 1LFDA 5I9PA 1PTOD 2KMCA 2RHSB 2JRIB 5JJIA 2HIXA 5I4DA 1B9NA 1WE6A 3UDXA 1ZOYB 1C9OA 3KLWA 2VRRB 2A74C 2BOSA 1KLGD 1XJVA 2YEPF 2KMAA 3MC9A 2A1AA 2KX3A 2GA4B 2JA5H 2JVCA 5EKKA 1K51A 2MNAA 5LMUQ 3EC8A 4P2CB 4LNKA 3DWMA 3VR2A 1YX5B 1CA5A 1ZE3D 1E7PB 3LWUA 2JJQA 1J8IA 1TS4A 2FMCA 4HSVA 3EECA 2J52A 4JQWC 3BDCA 3C1EA 2DNFA 3APFA 4HJ9A 2IX0A 3GD7A 1F2YA 4A3OA 4AYBG 1KLUD 4A3PA 3CCQA 2Q8IB 3ZRFA 4M01A 4NAWA 3FKIH 1WMHB 1T5XD 1L6VA 4X66Q 4FVMA 1UE7A 1L1OB 4KGRA 1A2UA 2N7DA 4FXKC 3EN2A 3VA5A 3R2TA 3U2SC 3VYTA 1ENCA 1VQNA 3NE5B 2VNUD 4J6HA 4Y7NH 2F0WA 2LZ6A 4MH8A 3AEEB 4LNFA 4M8MA 4ZHPA 1MVKA 4AH6A 2B2VA 4HK2A 4NJ7A 3PUXA 2B2WA 5KYIA 4HCPB 3I3TB 5GXGB 2L00B 3IRBA 2ICEC 4AYBB 3IAYA 3K9PB 2VW9A 5M5XH 2JZZA 2ZTDA 4IFDH 1KRTA 1J7AA 1F9SA 3RLNA 1BKBA 2B63G 4ID6A 2QJLA 4DXGA 2AQ3B 4R8NA 4N8X1 4TUUA 3ETRA 3NBIA 3ZNGC 2K01A 3R66C 4XYQA 2CJOA 4OVUA 2NPTA 5H92C 3ZDTA 2BGFA 1OTCA 3TMPB 3GTKB 4JI6L 4IPGA 4K81A 4MIUA 1V43A 1KAAA 5IYBG 4LFAL 3K58A 2MQHA 2NVTH 5EE1A 2KVMA 2E2IH 4KGSA 2E8GA 3SU8X 2B29A 1A6XA 2XEWA 1FO4A 1YMHE 2HJ1A 4WORA 4OO1I 1EYAA 2WXRA 3R7RA 5BN5A 2SDFA 3RNBC 2GRIA 4FXDA 4DV2Q 2V4IB 1CQVA 2KENA 3P20A 3RD2A 1EQVA 1PYSB 1JWBD 2F0QA 1A3VA 4PS3A 3TL5A 3OIQA 2F0HA 3BG3A 4RM9A 1HNXQ 4B0MA 2MJ8A 3AN1A 2O2LD 4KN4C 1EFID 4JOIC 5ELBA 1IL8A 2EYMA 3R8BA 4LLGM 1LT6D 4W9GA 1IYUA 4KKJA 4IFDJ 1U9RA 3D4RA 3HRDD 2NWGA 4LF9L 2D3GA 2XRQD 4X6AH 1QLBB 2N7JA 2EY2A 2RCFA 3MHZA 1EEFD 1TWHB 3IKJA 2DYOA 5EPJA 4LCDE 2WXMA 1K83H 4P7IA 4AS1A 3N1XC 3CC4A 4ITKA 1B2TA 1XNQQ 4HLEA 3A8JE 2VQEQ 2WB1E 1B53A 3AU7A 5M3MG 1A63A 3MC8A 1SJHD 4MEMA 5LXHA 3GV3A 1HZCA 3PO3B 1H4RA 4AJWA 4QMGA 2MH7A 4XDXA 5I9OA 2W9NA 3VTWA 4FYDA 4DV5Q 1C76A 3NPPA 1TWFH 2A6HD 3I4OA 4N9TA 4F88A 2X8XX 2X38A 2BTEA 3CSTA 2DZMA 4TKOB 2FNJB 3VH4B 1H9JA 1SNQA 4FO2A 1L4DB 3HKZE 4JWSC 4M0WB 1FYCA 4UDUC 4DR5L 3A4SC 1T5EA 2I5HA 3U9SA 3P4PB 2B2TC 4DR6Q 2KN4A 4MGZE 1VD2A 4F87A 2Z59B 2FINB 2EY6A 2WXOA 3PV0A 2WB1G 5M3MB 4NKLA 1CZWA 2ID0A 1UNSA 2EVBA 4IG7B 1JICA 1VQ4A 1WJ6A 2DYMA 2Z0SA 2JA5G 3I4MH 4RHRA 4C7ZA 1BCPD 1KQSA 1M8AA 4EX5A 2KDBA 4LF8Q 2JQOA 2L12A 1CQFA 1XMQQ 4IUUA 1V5OA 3HKZG 4EQ5A 4L6TB 1KF6B 2IGGA 1XQQA 2EDGA 2AX5A 4R4TA 4DNIA 2A6HC 1WXMA 5J39A 4P6VF 5C4XH 1O7ZA 2XNAC 4NB3A 4US8A 2WDRB 4CKCA 1DONA 1TKWB 3AXCA 3TIXA 1XTCD 2A68D 2JA5B 2C9WB 4PG3A 2JEAI 3ZJTA 5J3BA 1DOYA 3J80i 4K0KL 3Q6BA 3IFDA 4BWGB 4DUZL 4MH0E 2KCCA 2CKZB 2BYVE 1RCVD 2QDLA 2J53A 2YU9H 1GUNA 1TWCH 4GLSC 4JX1C 4EFOA 4LUOA 2LJ5A 3BY4B 4HVBA 5E4XA 2E6XA 2KKCA 2KJRA 1D5ZC 3ONSA 1I6VC 2IPKD 3VA7A 1X3EA 2UXBL 4X57B 2LKVA 1RF2D 3KLSA 2DN8A 1QQRA 1CMXB 4ANUA 3D8GA 2LXJA 3HOWH 2FUG1 2M00A 4IFDG 4NNJB 5ELDA 1BCPC 1BNZA 2JA7H 4DV7L 2D0OA 3M7NA 3DVGX 4A55A 4WJPA 4IALA 3G6EA 3SGIA 3OOCA 1EQQA 1I4PA 5IO9A 1LTSD 1V1QA 5AUIA 2B2WC 4DWFA 5IT9L 1MI2A 3W5VB 2O6VA 4QF4A 2UUAL 3I4NH 2Z0EB 2CW0D 1X3FA 5IYCH 1ZDVA 4J1MA 1UEBA 3D31A 5CORA 5M5WB 3OW2A 4X62L 5DLQE 3JAMc 5IGCA 3SK8A 1FRDA 3DVNU 3I91A 3N6RA 2NN6I 5E4WC 3TSSA 3VTVA 3DLLA 1D7QA 2W3SA 3AU4A 3P4QB 1SNCA 1UAPA 1UBIA 4LF6L 1PXUA 4KHPL 2A68C 4A93H 5DNFA 3TEZA 2RSOA 3SFEB 1KAWA 3NVVA 4F8CB 2NVYH 1NTGA 2BS4B 4LNQA 2ZCBA 1NENB 4O0AA 3M4OB 2PYKA 2K5VA 1UE1A 2RGFA 2IY0B 2X6LA 2MJEA 2DHZA 1IXRA 3S1NB 5JHAA 3SK5A 1F2ZA 2R93H 3NENA 1Y8OB 2F3WA 1E2ZA 4I65A 2NUCA 4ABNA 2IY5B 3OJ3A 2UUCQ 4KVGB 4ZRJA 1FCCC 5K5PA 3OW7A 2QSDA 3OYYA 5KYLA 4W9CA 4GLVB 2AUKA 2KHJA 4L5RC 3VR4A 2CW0C 2K6QA 1HQMC 4LFAQ 5K36H 4CYEA 4I6PA 3PSEB 4A3BB 5G5HA 3AE6B 3OG5A 1GXDC 4LK1C 4G4KA 3HOZB 3ZJUA 1PH4A 2WXJA 4G7HC 1D3ZA 3NQTA 1RTNA 5HG2A 1BCPB 4DU9A 1NBFC 3J7AF 1OXXK 5C4HA 2EQSA 2WFWA 1E7VA 3WANA 1N32Q 2RBMA 4ZDVA 2F0IA 3V05A 3B9JA 3ZW3A 4BA2I 1FJGL 5ELNA 1TKYA 3L0WB 2ENBA 1STGA 1VS0A 1E1TA 3T1HL 1JROA 1X6OA 2Q2IA 3T53B 2KJ6A 3DHHC 3FDTA 1JRPA 5IOCA 4RGNA 2EJGC 3AI5A 1A15A 3X3NA 1QZHA 1U4MA 1Z2MA 2AL6A 4HTHA 2KAJA 3BDOA 2OTJA 4BY7B 3GZNB 4NAMA 5BYRA 1QF6A 2NPTB 2KCMA 3KBGA 5ELFA 5M3FH 3GE8C 4UAIA 5KRUA 3I4MG 1AP0A 2CU1A 3VH3B 4K3BA 2Q2UA 2NTTA 1YNNC 2LHDA 4M02A 3C8YA 1W6KA 4IJLA 3KUDB 4B3SQ 3SXHA 3PHWB 3MTSA 1EY0A 3MXNB 3C3LA 1C1YB 1C0AA 1ZUD2 2ICIA 2INCC 4JYAL 2KVRA 2MHJA 1RIPA 2D0PA 3V2TA 4GKKL 2K4KA 3G7LA 5KNBA 2WYQA 1TWGH 2KT7A 4RGOS 3CPFA 2NVQH 1XT9B 1Z47A 4A9AA 3ULJA 2KOXA 3CMEA 5C4XG 3CCSA 3L54A 3K7UC 4QL5A 2XGTA 3H15A 5IGGA 4JI3L 4DR5Q 1EO6A 3QIJA 3MEFA 1A3UA 1DD2A 2O6VD 3DHGC 3P2BA 2K03A 3S15B 1SLJA 2OT2A 2SEBD 1SNDA 4HDQA 2KEEA 5BMIA 1HEZE 1CHQD 4UHVA 1LYLA 3TBIB 4GN3B 4JI1L 3N1YC 3GTQH 3ZUNA 4HPMB 4A3DH 4LAAA 2GVAA 2K75A 1TBEA 2CQOA 4C4VA 4ANWA 1WJNA 1WGHA 3MXGA 3W5OA 4GMVA 2Q8TA 3NEMA 3HOWG 3UINB 3PT2B 1SYEA 2NVUI 4MGYE 1UWMA 1EUJA 2JA7G 1ENAA 1JE5A 2FAZA 3EHVA 2ZNVB 1Q12A 4H02A 5AEKB 3HOUH 3CU7A 4NXMQ 3OJ4B 2NYZD 4MNOA 2RCNA 4NW2A 3H9DA 4DHZE 4V0BA 3J81i 2JA9A 5JHBA 3I4NG 1WYWB 3APCA 3DCGA 3RZDH 5IYCG 4EOYA 2KHSA 4DK6C 3QB3A 3D3RA 1CA6A 4DXFA 1YJWA 2K5WA 1NBWA 4KDIC 2JEBI 3L17A 1Q1EA 3DM3A 4ZCKA 4AQYQ 3CMMB 4HDOA 1RRBA 1JQ4A 4W9LA 1TR5A 3H0GH 4DK1A 4KHVA 1C4AA 2DUDA 1M1KC 5T1IA 4A93G 5BMGA 2OEOA 4GKJL 4KKTA 2JA7B 1WJ4A 1FD7D 1HUMA 3A1QA 4LF4L 3RLOA 3NZUA 5IT9E 2K6DB 2MUYA 4WJQA 4LFCL 2BT6A 4W9IA 1FNUA 4YWLA 1ILQA 5E6PA 3I4NB 2CKHB 2W3RA 1BCPF 5JJLA 2R93G 2DWQA 2VS1A 4DV7Q 2PVOD 3G48A 1OQYA 1X55A 4B08A 4DUYQ 4A3MH 2N3SA 2MX2A 3T13A 1HCZA 4WRDA 2MEKA 2ZPYA 5ELCA 4OX9Q 4XZ4A 1PZKD 2VUMH 2D2QA 1Q5WB 1SIJA 4FJZA 4ICUA 2UUAQ 4A93B 3HM6X 4GN4B 4DV6L 1D8LA 3A9KA 5LL6X 4DR7Q 4X62Q 4AQ7A 3VRAB 3ER0A 5K36G 1BXTA 1WX9A 3K7AH 1IBML 3PVLA 1LXDA 3CP0A 3DBLB 4LF6Q 2DLBA 4OXPA 1ZW7A 2INDC 1YOVB 1TVXA 4JPBW 4HIKA 1F1HA 2R93B 2BB5A 5J2RA 4YT0B 3QK0A 3MFGA 1YQBA 4A3FH 1I94L 5G3LF 3J7YW 5BN3A 1UBQA 4DAMA 3Q3FA 1TKEA 2WV6D 2VB2X 3GZNI 3KOJA 4XXEA 1VR9A 3QOLA 2BB6A 1H9RA 4CBVA 5JVH3 3Q23A 3UIPB 5I2XA 4OO1H 1P8LA 3T1YL 1J5EL 4X64L 2G45B 1WX7A 3HVDA 1TYGB 4KN7C 2IWHA 2O6VB 4FP5D 1CKOA 3MEHA 5M3FG 2KCNA 1H9SB 5EGTA 3TEHB 3UI2A 4AIMA 4IWPA 1T6BX 1E24A 4C80A 1TQOA 3U50C 3NG0A 1WM2A 1HTQA 4C3HH 1UEAB 4JI8Q 4PMCA 3HFZB 2ZM6L 3C19A 3HOVH 1E0BA 1PA6A 2A5HA 1WRDB 1F2MA 1BUVT 3FVQA 2W82A 1YIWA 4OZBA 2Y3AA 5C44H 1SMYD 2IDYA 4PMBA 2Z8LA 5IP9H 3SR6A 5BN4A 2C60A 3PZ8A 1I50B 1K28A 4H13C 4URKA 5HFYA 2FIFA 3T3NA 1KOTA 1NSNS 5M3FB 4U673 1B70B 2L0CA 4MJSA 3T1HQ 4G7ZC 4NXNQ 2MO0A 2BKRB 3KWVA 4K7WA 4R4CA 1ZEQX 2WKCA 1YQ3B 4F7ZA 3J7A5 1SYFA 2JA6B 4IOCA 2E75C 5LMUL 2INPE 3S16H 2FIDA 1ML0D 2YV5A 4A3DG 4QUCA 3K59A 4FF4A 2DAJA 2W54A 4WWOA 3S24A 1D5XC 1NYRA 2KQ7A 1PQSA 5FLXL 1EQRA 1QZEA 3NHEB 2KN5A 3HOUG 2KCTA 1WCMB 1QOGA 1RL2A 1V9PA 2F4IA 4K6DA 2LGIA 4GKKQ 4X66L 3NOBA 1DZ1A 3CD6A 3I9V1 2LXAA 4LF7L 2VL6A 4EQOA 1SDFA 2C35B 1WR1A 4II2B 3DWGC 3RT3B 2HTHA 1HZBA 3GTMB 2F03A 3QR8A 2MBQA 3M63B 4JI3Q 5LLIA 1F2LA 2KTFA 1CUKA 3ITPA 1QOHA 1DGJA 1V80A 1XXGA 3H0GG 3V60A 1MFWA 1PH7A 4JCVE 1PYWD 3UDGA 4H2AA 4FDBA 5AZGA 2M0AA 2JU6X 2I5LX 2WHIA 4J15A 3DXJC 3K5NA 4NJCA 4DNRB 4GZYC 4JE3B 4HJ7A 3ND9A 2YVCA 4LJOB 2F0KA 1FNWA 4BOSC 1QOAA 3FILB 3RZDB 2FCSA 3BU2A 4M1UB 1ZXHA 4MGIE 2OQKA 5E7NA 4E74A 3T3OA 1TS2A 1VQEA 1NY4A 3RMHA 3E0EA 1QCBD 3NQIA 4A3MG 2G5DA 1WGYA 3U4EG 2RKSA 3ML9A 4AOFA 4YSYB 2VUMG 1Z7TA 3VDZA 1V8CA 2MPMA 3KYHC 2CHZA 3DBLI 4ZHOA 2K28A 4HEA1 1C4CA 5EE9A 5KHQA 1WI5A 1XYIA 1AARA 1AEXA 2FE8A 1WSPA 1K50A 4W9HA 3ZVVA 3T56B 5C0XI 2PEAA 2B3AA 1I3QB 3GTKH 2KWDA 1PDXA 3Q6SA 1VCIA 1SSNA 1FXIA 1X3GA 1SE8A 2CH4W 3AFQA 2Y0SG 1XO3A 3H1UA 1MGSA 2UUBQ 4K14A 5KHOA 1JWUD 1MD2D 4PZ6A 4HMIA 3L3OC 1OEYJ 4WFN3 4A3FG 4MTKA 2WX0A 1WR6E 5CR3A 1HNXL 4KK7A 5HGTA 4LFCQ 2JZPA 3I57A 2NN6H 4HRSA 1OQQA 4TMAB 2KHIA 1N6ZA 1TY2A 3VAWA 3AQQA 4OO1G 1ZKHA 3J9CA 3IHPC 1VQFA 1E8WA 1I6HB 3ZDMC 3CHBD 4NY0A 2Z1CA 1QT9A 2L1BA 3UE1A 1TXYA 2Y0SB 3HHMA 3QAQA 2KMMA 3TP8A 4RAUC 4DV0Q 5E1FA 1K8GA 3IXSA 4MDKE 1G2SA 1BBXC 4C7YA 1MSHA 4BBSH 4W9EA 4C3HG 1N63A 1EWHA 4ZOHC 3KJOA 1AN8A 1TWHH 2JYOA 2RSNA 1IBMQ 4DV5L 3ULPA 3E9SA 2SNSA 3HOVG 2ZJDA 1TS3A 4DNTB 1L6UA 3BZDB 3AULA 1YEZA 3K5LA 1KDBA 4HEDA 5AFWA 3OLMD 1CZGA 2N0SB 5C44G 1N62A 5IWAL 2PJHA 4KLKA 3PO3H 4X3KA 5IP9G 1I94Q 3V6CB 5IP7H 3OWFA 1XMOL 1IBXB 1GO3E 4L23A 4DR6L 1WYDA 1PZJD 3F8TA 1HJPA 4FF1A 3Q14C 5NUCA 1FEHA 1U4AA 4LWCA 4B6WA 2A4ZA 1LTTD 4JI4Q 3T1YQ 1J5EQ 4X64Q 4C3HB 4DK3C 2R7ZB 1WWTA 4HKZE 3NTKA 1TZ1A 4KSKC 3B2GA 1L1OC 4JW0A 1V81A 2KDEB 2IT1A 2FHTA 2RDHA 2MP2B 1I4QA 3HOVB 2OOBB 4KZCA 1N34L 1S5FD 4N6EB 3A9KB 1YNXA 1VDVA 4LF8L 1P9DU 4BFRA 5DPWA 1DOMA 3LX0A 1XMQL 1K52A 2RDBC 2M17A 5CHVC 5LNK1 2I46A 4QUFA 2M56B 2D11A 3P4SB 3FPPA 3S1RB 4A3IB 4HMJA 2F0UA 5KNCA 5A2QL 3Q24A 2D9UA 1PRTD 2LHEA 4KV2A 5E6JA 4F8MA 3CAMA 4R4QA 1SSOA 3ZNZB 4B3MQ 2KC1A 1KABA 1V6EA 1EWIA 4LF5L 1VCBA 1PZID 2G4SA 2V9HA 3CCLA 4AYBE 2ZW1A 4RCOA 1K0RA 1BT0A 2FUHB 1KRHA 3S16B 4OHJA 2BF8B 3HP3A 1K3BC 2QILA 4RHSA 4DDID 4LUVA 1CSPA 3H09A 4PZ7A 3S2HB 1IUEA 2VB3X 5FLXE 4JVZA 1P1AA 4ACFA 2PO4A 4N8FA 2NB0A 4O1NA 1V9JA 4BXXG 5IN7A 1MBYA 2LVPA 1QNKA 5CX3A 3PUYA 3ZNID 3PIP3 3QIAA 3NY5A 2EYFA 3PHXB 1DM0B 4K5WA 1DJRD 2MGSA 5LHY1 1KHIA 1EWYC 2J0KA 3AV8A 1HFNA 3U30A 1RFAA 2IL8A 2PMZB 1TY0A 3NWTA 2WINB 2KTRA 5IAAC 1PRTC 3R2IA 2MBOA 4DQOC 3M3JA 1B8AA 3AEVA 3NXWA 4LF7Q 4UY8C 4A20A 2F0NA 3HG9A 1PTOC 3E9IA 1KXLA 4GDLA 4DK5A 5C1ZA 3RFZB 1J0GA 3GTPH 1ESRA 5M5WH 2JXTA 2Y5BB 2MP1A 1ISNA 4IO9A 1R9TB 5BO4B 2JSVX 1I4RA 5J17A 1ET6A 4DN4M 3DEPA 1KNAA 3ERQA 5BYSA 2N9PC 3PPAA 2V3NA 3HS0C 4JBKA 2HCIA 2NZOA 3FC4A 3S2DB 5EPKA 3RR5A 5H8YE 3KDFA 4ZAIA 1R4NB 2NN6G 3TEWA 4IUNA 3I72A 5EPLA 4RG1A 4JBWA 4R4OA 1EIYB 2UUCL 3M4OH 1UZXB 1Q1OA 1WYGA 3VUXA 3S1NH 3HIZA 2E5LQ 3ZGZA 1ZGUB 1MHXA 3I56A 2JQRB 3LDZE 5HHDG 2ZEQA 2ZZPB 2K8CA 1O80A 3K81C 4OIJA 4Z9CB 1YI2A 3NSWA 1SE9A 2RQXA 3ZTDA 4BBSG 2N9KA 3PUZA 2WKDA 2DENB 2INNE 1PH8A 5C3WA 4RMAA 1HQRD 3P1HA 1KNEA 3ZRCA 1GM5A 1J6QA 1YHBA 2QDFA 3AFPA 5LMNL 1WGDA 2IGHA 5CBAE 4K3CA 4A3BH 3D6CA 3DEOA 1N32L 4Q5VA 5COYA 3AB5A 1CKNA 3HOZH 3UDIA 1IZ6A 3PO3G 3MA2B 5IA7A 5IP7G 1GHJA 1NR4A 1FVIA 1PRTB 4O42A 2GBMA 5FOBB 4W9KA 1ZP0B 1LT4D 3I5JC 5FJ8H 1E10A 3F2DA 2OHFA 1PTOB 2JT4B 1SEBD 4DDGD 4KTAA 1VRAB 1CK1A 1ZKOA 4BBSB 3EFCA 1VQ9A 1SGHA 1JORA 1U0LA 2LS01 2HUGA 1MSGA 4BY1H 1TTNA 4ZLTF 3E56A 1VQ8A 3BVGA 1U4PA 1K9MC 1L0VB 3S1QB 4BY7H 4X65Q 2P5ZX 3KJPA 3I90A 4DR3L 4LUZA 1X9NA 4B3SL 1GHKA 2KDIA 1TIFA 3N52A 1V2YA 3H8HA 4A6QA 4HJAA 5JEAJ 1WXAA 1PFNA 4ZYNA 4EEWA 1C4QA 1XLPA 3PZDA 4EZKA 1B1ZA 2L52A 4E3CA 2KBNA 2E2JH 2GN5A 2B8FA 5HKHA 2NCNA 3ZJYC 5C5MA 4B3TQ 3EUB2 4O2DA 5DCNA 3WIMA 5IWAQ 1XMOQ 1XWEA 3GTJB 3EQLC 3BYYB 1CZPA 2VY3A 2KHWB 4WJ4A 1FXAA 2WDVB 4C1NK 1ONLA 3H7SA 2EZVA 3KF8A 1SMXA 2KD0A 3QARA 3C0RB 1O7YA 1WTVA 4IUVA 2HTME 4PMWA 1G2TA 4MT5A 1RYJA 2KECA 2ES2A 3H7PA 1KTKA 2CWPA 2G1EA 3SR1A 3JSVA 4TKNA 4KY5A 5A2QE 4R8IA 2X6GA 4GIVA 3DPDA 1P3QU 2ZT9C 3KUZA 2CVRA 2AHOB 3S15H 1N34Q 1O7IA 4XYCA 1S3OA 3CCEA 3OAWA 3AEAB 3MXUA 1Q0WB 3N32A 1XF5L 3ONAB 1A3TA 2IHEA 3IT4B 2CS4A 2L83A 2EPBA 1B9RA 4IZ8A 1VQPA 4NXML 2DBYA 1FGBD 1J7BA 4WWNA 3VR9B 2XWJB 3AB9A 1EY8A 2CHWA 1RODA 4HPPA 1GOZA 2YTVA 5JPNC 1PH6A 3Q8AA 5CV4A 1YD8U 4BAXA 3DHQA 1VQLA 4RGTA 5GQOA 4LFBQ 4W9DA 3KYCD 1IHZA 4LF5Q 4AQYL 3M4PA 3QWZB 4WQMA 2DY7A 5IKCM 3JAML 2KZRA 1B50A 1QVGA 4BZAA 2B2UA 1EL0A 1R7SA 4IDIA 1NDDA 2GBRA 2B8GA 2XK5A 1VQIA 1ICFB 1PUTA 3PTFC 2CU3A 1L0YB 2H1EA 3DBHB 2WXNA 1B3QA 5C3JB 3UDFA 1R4NI 3AE2B 5GAHC 1YN5A 3RNFC 1EEID 3SHLA 1OFFA 3ECIA 5BMHA 3EIVA 4KD3A 1WVLA 1FXTB 4QQBX 1SR3A 4DR4Q 1XCTL 1YJIA 4JI2Q 2LGXA 2DGYA 2B2VC 5DAUA 4DUYL 3RNEC 2F0EA 3AE8B 1B7YB 1W2BA 4OX9L 4BVUC 4MN3A 3EVQA 4ZKCB 4MM3B 1Y1VB 2EKIA 2Y5CA 3HK0A 2BH8A 3GTPB 1PRTF 1Q10A 4MTNA 3A4RA 2PIAA 4DR7L 2LFIA 4NQLB 1HA5A 2EY5A 2IBIB 2L76A 1C3TA 5GADC 3AECB 1HR0Q 2OCEA 2F3IA 1PTOF 2QF7A 2PMVA 4FHJA 2O4XA 4LK0M 2BE5D 4K8IA 4NZLB 3J81j 3AE5B 5D94A 5CBEE 3QHTA 1YJ1A 2HJ8A 3HVZA 1P7FA 4RFBA 3HOYB 2KO3A 4NJ6A 3Q8CA 4A3BG 2EE1A 1V97A 3DOWA 4EVOA 3HOZG 1LM8B 1VZ6A 3NVWA 2LSSA 4FJVB 2R2QA 4GNXA 3ULLA 1DOKA 1Q81C 3VXWA 3WDNA 1K3RA 3AE1B 1L0XB 3UQBA 2F0SA 5C0XH 3WAOA 3WWVA 2F3VA 1XPOA 2KNBA 4S3SA 2N88A 3GS2A 1S5DD 1STBA 3PIPA 5FJ8G 2LVQA 2JY6A 4KMUC 3NZSA 3ZXVA 1HH2P 4B0EA 1Y8PB 2MCNB 3IL8A 4Y52H 2DZKA 2AUJD 3AH7A 4CDEC 1PH2A 4NAWB 4DKAC 2JK8A 4PZ8A 2M0XA 3V96A 2TSSA 2Q8RE 1GB1A 2K5HA 3S14B 1QOFA 4BY1G 2IO2B 1E2VA 4JI8L 2A6ED 2D5GA 4GDLB 4BY7G 3VUWA 2KDFB 1C8CA 2HQLA 4ZQ3A 4RCNA 2CH4A 3L2PA 2BE5C 3STBD 1PVOA 4FLHA 2KJXA 1AE2A 2MBEA 1OTRB 1WFQA 4LJPB 5LMNQ 1WD0A 3Q8BA 1N8RC 1VQMA 1PGBA 3I8ZA 1JC7A 2ONQA 5CTRC 4W9FA 2R61A 4ASWC 2ZNVC 2V0GA 2JXMB 5C6AA 3W1BA 4I7ZC 4NXNL 5DM73 5KEEA 2C7NB 2L0FA 3P4RB 4HIOA 4BY1B 4MSMB 3R3OA 4K1RB 1EM7A 4YSXB 4WJWA 1DOIA 2BPSA 2K5NA 1IPGA 2D3BA 1I50H 3ZKJC 3E0JA 1E7UA 5C0XJ 2BWFA 3RPFC 1GUGA 1EY9A 4DA2A 2HHHQ 1L7YA 1OQRA 4IWOA 4LMQD 3DVNV 2CJNA 2NZ1D 1E2WA 3UGBB 4HJKA 4OWWB 2SOBA 2E2JB 4YTNB 1C79A 2YTYA
chains in the Genus database with same CATH topology
5G5GA 5JPMC 2WU2B 5FR3A 4HSPA 1Y69U 5C4ZA 3W5UB 4MACA 4KKIA 3R93A 3K0YA 3DWPA 3C46A 4TQUS 2WXHA 2IX1A 2C5CA 1C78A 3A8KE 2RMMA 3M3YB 4E6IA 3HOXB 1WXQA 3NZ3A 1VJKA 1OXSC 2KDMA 4C3IB 1CFMA 1X3PA 5T1GA 5I2YA 2B76B 3M85A 3MFYA 2VXWA 1II3A 3TUOA 1HFGA 3HEJA 2WDQB 4YSZB 2NBFA 3GTLB 1S5CD 5CYUA 1K53A 2Y5PA 3LYYA 3AM9A 1WTWA 3U9OA 2I38A 1TJEA 2OXPA 3E6ZX 3JAME 1LO5D 1RD9D 2XWBB 2PW5A 2PLPA 1D4BA 3DMUA 5CMDA 5ISRA 1WGKA 2LMCA 2K0PA 1MI0A 3TEYA 1OXTA 2H89B 4IKGA 1DYQA 2QCPX 4U68A 3AEDB 3DUZA 2K22A 1ZDXA 1KH0A 3PUWA 1Q8IA 3V3XA 1DOXA 2VZKD 1TKGA 4RWSC 5C0XG 4KKUA 1G6ZA 1XX8A 5C4JB 4XDCA 1PFDA 1TIID 3TZUA 5D14A 1JWMD 1DCZA 3NUHB 4DK0A 1JALA 4KV6A 1D5MC 1G291 4IURA 3MHBA 2MJDA 3GO5A 1VDZA 2RA4A 5DEHA 3NVZA 2F0JA 5D65A 1RWSA 1Y1WB 1CM9A 3BWUD 4XDDA 5E3FA 1F9RA 5EKLA 2NMQA 2XVSA 3HRZC 1LACA 4ZRPA 2HQEA 3NK9A 2BS2B 2D5DA 3OMCA 2E3TA 3MXPA 5C5LA 2JP1A 3KUPA 3NRZA 4FXCA 5EE3A 3W1SA 1GPXA 4ZRQA 1F0ZA 4ODGA 4NP5A 1VZ8A 4J3OD 2PW7A 3J7AV 1C77A 3KBXA 5IGBA 1AZQA 4CJ1B 2JA8B 2L1AA 3PO2B 1WTQA 1CI3M 2E74C 1WTXA 2KACA 1YNTE 1PGXA 1I4GA 4EQNA 4PV1C 2R3ZA 2BDNA 5D3IB 2ON8A 5JJZA 3VYSA 3H3VC 3AEFB 2VZKB 3A8IE 3FPUB 2J0TD 1IW7D 3I70A 2ZXRA 1B44D 2BA0A 3A54A 3QG1A 3GTOB 2E2HB 5CGKA 1EYDA 1SMYC 1AYFA 5HI1A 4YXDB 1R4QB 4TRDA 2GI9A 4A3KB 1CJEA 3DWAA 1YQ4B 4F7XA 4PT5A 1JE4A 2EYLA 3K5MA 1STAA 2WXKA 3EA6A 5EBDA 1ZPSA 3O13A 3MC0B 2O5JC 1Y8NB 2PW9A 3L7ZC 5J1ZA 5HURA 1EY6A 3P1MA 4RNAA 1CHPD 1D1KA 3RZOB 3IAM1 4ULLA 1HHVA 2QKIC 2LY7A 3M7GA 3A56A 1ZXIA 1MPEA 3BK1A 4BBRB 2MHVA 4Q2JA 2L5TA 2Z4HA 2OF1A 2EYPA 3GTGB 4ZRZA 5KIXA 2YEPB 4TQ1A 4K5XA 1F9QA 2F0DA 4PNYA 4XT1B 1YNJD 4N9PA 3ZJVA 1EQTA 1TT2A 1ZYRD 1PTOH 2D62A 2LMCB 1UUPA 3D4WA 2BDOA 1J7CA 4QIWB 1NI3A 1KDCA 2M2LA 3P7JA 3S1MB 1I4XA 2WAQB 4LJZC 1IKMA 2K9XA 1ET9A 3I4LA 1STHA 4P16A 2A69D 2L4NA 3OWEB 2PZWA 3TZDA 3S9WA 3T4AC 4R3DA 3F2UA 4OZAA 1QJOA 4TSSA 4WWMA 4NDXA 1QOBA 1S5BD 1AWDA 3A7AB 5IIFA 4K2KA 4A3JB 1HZ6A 3T16A 2F1MA 1NCVA 3PIO3 1ENFA 1UGJA 4HROA 2R92B 1OXVA 1ZYRC 5FO7B 2BA1A 2F0OA 2SAKA 2G9HD 4ZYSA 4L63B 2F0MA 3MWYW 1NUCA 4LTUA 4CKBA 1HTPA 3IFTA 3RLFA 3NTHA 1RJTA 3LWEA 1BO0A 4HCEA 3QOJA 2FFKB 1TU2B 2K5DA 2A69C 4K5VA 3MZ5A 4HR7B 1LV9A 4DAPA 4YIJA 5KNDA 5C3EB 1GAQB 2K7VA 3AE9B 3VQIA 3LB8C 1VMPA 1PMRA 3HZXA 4G7OC 4G57A 2B2TA 1FMAD 1FIQA 3BYTB 4C3JG 5CV6A 1SFOB 3NWSA 2CQAA 2H88B 2E2DC 2J7ZA 2KEDA 4CGYB 3ND8A 1NAPA 1OXUA 4IQZA 3AEGB 2RDGA 4CJ2C 1SF0A 4IUPA 2BYTA 2PVGC 2NVXB 1RDPD 1NEKB 4HJGE 1JMLA 5D7GA 4C3JB 4JWUC 1F9PA 5IGEA 5JXVA 2B39A 2N9LA 4IUTA 1D2BA 1VF5C 3AE7B 5IGDA 3VYUA 1B9MA 5CV8A 2A73B 4H7BA 5M5YB 1PFMA 5KGUA 1ROEA 4R9WA 3QO2A 2RVLA 2NTSA 3NTIA 1BUIC 3E5SA 1GUOA 2QEJC 1C9FA 3Q22A 2OEDA 3AMZA 2F0FA 3CIRB 1B4OA 4IN3A 1F77A 2PQEA 5TSSA 5JEAH 1EYCA 1WTOA 3DWQA 1B3AA 4RH6A 3CQZB 3L9AX 2MJ3A 3EFXD 4QB4A 2EJFC 3NUCA 1V1OA 2K05A 3SE0A 3NBHA 1STYA 3OMGA 1TWAB 2QIEB 2RDFA 1LABA 1HUNA 3MXNA 5JVG3 3U52E 2LEKA 4FXGC 1DXMA 2B63B 2WXFA 1ESFA 3WOFA 3K57A 2DY8A 2L11A 3RD4A 3AE4B 4YWGG 1FR3A 3L4PA 3BVMA 1IKLA 2LJIA 4ARIA 4K8JA 1STEA 1KDAA 1QE6A 1N5WA 1L5PA 1RFKA 1O78A 1Q1BA 1BOSA 2QDBA 4KX6B 1SBBB 1F2RC 3NP8A 1A2TA 4K2LA 4JPSA 2JSOA 4HKQA 2JWUA 3IAS1 1GB4A 3A55A 1PFBA 3NS1A 3FAHA 4RA8A 3SEBA 3I3CA 3SK6A 4KI0A 2WXQA 3TP5A 4N58A 4RKBA 3PMFA 4DFAA 1LT3D 1XLOA 3K5OA 5I6YA 1BF4A 1JQYD 2AQ1B 2IGDA 4L2YA 2WP9B 3TP6A 1N60A 3LNNA 1M4VA 5J22A 1GJXA 1BR9A 2Z4IA 2PZTA 2WB1B 1S4ZA 2RPVA 3D4DA 1VF7A 3MJ5A 3G6JB 1V8QA 2K3UA 3W2DA 4EE2A 1RKNA 4HAEA 5G3LD 1WTPA 1EU3A 1LTGD 5IODA 3HKZB 3OPOA 3VR5A 5JEAG 1HXYD 3IT6B 2WQYB 4N59A 3P42A 1XCQL 1FFVA 1WD1A 2XSCA 2PPBC 3FKIB 1L4ZB 3VYRA 3AE3B 2WNMA 3SVMA 3HGBA 2R6GA 4DGZA 4X3UA 1S5ED 4KGTA 1Q90A 2LUMA 4XIGS 1H9SA 2KA7A 2EOTA 1LLRD 4Y7NB 4XQQA 1EIGA 2WS3B 1PDQA 3PZ7A 3M4YA 3BS1A 5M5XB 2JE6I 5CV7A 4BA1I 2WXLA 1JOOA 1YJJA 4OZCA 4XQJA 2L55A 4EGVA 5T8IA 5JOBA 3X3MA 1SAPA 4V190 2I2YA 3S17B 1LTID 2N55A 4CQNA 2NVTB 2E2IB 5AUKA 1CT1D 3P63A 4YTPB 2ZW0A 2ZXPA 3K6OA 1QNUA 3URYA 4KD4A 1N5XA 2JYTA 2WXIA 1YNND 3OSOA 4ZUJA 5FO8B 2K1BA 4H0LC 1SYGA 1U4LA 3CRLC 4ARCA 1JOKA 5CV9A 2B2YA 1SE2A 4C3IG 1Q3LA 1RM6C 3PUVA 2A6EC 1SXTA 5JAVA 3AEBB 1STNA 3TN2A 1I4HA 4ZUIA 2K6AA 2AWOA 2WXPA 1K83B 3T51B 2EYHA 2Q5WD 1O7LA 4ZK9B 4D2KA 1E0ZA 1WTRA 4NMZA 3A7LA 4DAVA 4DAYA 1FD6A 4XT3B 5IGFA 1R4PB 3J80L 4C2MB 3TMEA 1TWFB 2K5PA 3FILA 3P75A 3OIPA 2HDEA 4FF3A 2G9DA 3BVZA 3LXFA 3PO0A 1XLNA 3TDQA 1T3QA 3KLRA 4EQPA 1AW7A 1F2RI 1AZPA 2HDMA 2B2UC 1ILPA 1JW9D 3C2PA 1HTLD 2PNRC 1QB5D 4KY6A 4X3TA 3I4MB 4PQXA 4QCLA 1QKZA 3D6WA 3VR3A 1JWSD 4OGQC 1FFUA 1EZ8A 3CRKC 2V3PA 2X69A 3EGRA 3Q0AA 3WOEA 4OL7A 5EBCA 2H4OA 4FNFA 5C4XB 3OHXC 2AWNA 2M9VA 2DNEA 4C56C 2LFNA 1AFPA 1VZ7A 1EIHA 2DNCA 4ILWA 2FMMA 2XIWA 2YU9B 1TWCB 2HCCA 1SE3A 4IFDI 3H94A 1P7EA 2J42A 1SE4A 1FNVA 2TMPA 2F0LA 2KOLA 3HOWB 2WLBA 2XN9C 2BW2A 1X3QA 5CC4A 2EYJA 2ACZB 1IBXA 3KQ4A 1SYCA 2WIIB 2KQ4X 4H44C 1G91A 2SNMA 2L32A 4GDKB 3KK7A 4K6LA 2EELA 3FMCA 3KLSX 4XE0A 2F0TA 3I73A 1YN4A 1HPCA 3N9YC 1JB3A 3U7ZA 2NVYB 4IOIE 1X32A 1SNMA 1SJED 2HDLA 2WP8J 4MHEA 1V1PA 1FM0D 2BBCA 5EE0A 2F0GA 2K32A 1DOLA 1SNOA 5MPOA 1FRRA 1GUSA 1E9MA 5EJWA 2FJ2A 3FRPB 2D2CC 1MHHE 1SYDA 4JK1C 5LL6S 5EQ0A 3CWIA 3CKIB 2B2YC 5EKIA 1VLBA 4HCSA 5CV5A 5C2TB 3B2FA 4B9WA 3WCQA 1IGCA 4XQNA 3KWLA 3HUIA 1C48A 3AMUA 2ZXOA 1NYQA 1ACCA 3BK2A 1EZ6A 3EJIA 2EYOA 3NHHA 1N61A 3QJYA 1NVID 1HZ5A 1BMLC 5C3XA 3VRBB 2WACA 3H6MA 1H9MA 3BDLA 1ICWA 1C4PA 5M9OA 3EROA 1QG7A 3BIID 3J80E 3J81L 1K8MA 4TQ0A 1G8ZD 3GV6A 3SK4A 2BS3B 4RKLA 1EY7A 4A3GB 3W9CB 4Q0FA 1ZXTA 1K8OA 2YYZA 1TWGB 1E6EB 4ZKBB 1JR0D 2NVQB 1D1IA 3DM1A 2K5QA 4WURA 4KY7A 2M19A 3SFDB 3SDZA 3VR8B 4WAFA 4KHZA 4KKSA 2AQ2B 2IJ0A 2CHBD 1LTBD 2JX5A 1CTMA 1XEEA 2V4DA 2PCFB 2KQ3A 3GTQB 2GB1A 1LTAD 5ELEA 4A3DB 1OO9B 2IW3A 1QILA 4REZA 1IW7C 1EY4A 2QMTA 1JWAD 3GQBA 3UI3A 1HA6A 2O5IC 1QWYA 1LTRD 1D6EC 3Q69A 3HOUB 1VMCA 4X3SA 3GB1A 2PKOA 4M8AA 2EXZA 3NVYA 2EJMA 4KJOA 1H9KA 5F2DA 3Q8EA 3H0GB 4J8QA 4US9A 4A3EB 4IUQA 3MP9A 3GP7A 2XRSD 4ME5A 4CKEA 3MAQA 3C1FA 4XWWA 5I6WA 1NR2A 1IYVA 1SB3C 2PZUA 1EU4A 3ZQ4A 1JCKB 4WIPA 1RHPA 3Q8FA 2PTLA 4M0WA 4A3MB 4A90A 2VUMB 2KUMA 4B9XA 5FKAC 3TP7A 2WXGA 4RF1A 2C9OA 1TZOA 1RTOA 3ZYYX 1A70A 3FEWX 1PGAA 3K7AB 1EOTA 3RUZA 1Y56A 1Z6HA 4WH4A 1EY5A 4RGMA 1J9OA 4CJ0B 4FF2A 2F0VA 5D3DA 3VR6A 4A3FB 1FCLA 4BS9A 3TEXA 1LT5D 2I07B 1YNJC 2IX3A 2J4XA 3MVVA 1SNPA 1JOQA 1SYBA 4XYOA 5A35A 4C1NI 4L1BA 4KJNA 2WU5B 4YTMB 1GUTA 3W3AA 4OIKA 2BCOA 1BDOA 4L8JA 4USAA 1IGDA 2K04A 2L9HA 1KFYB 4DF7A 4RF0A 1W6JA 1UWXA 1I7HA 2FBWB 4XWTA 2EY1A 4XTCS 5FK9C 1GUWA 1YN3A 4OVZA 5BYQA 4A8XC 1TS5A 2F0PA 3ABVB 2E76C 1EWCA 1BQQT 1U4RA 1WRIA 4OW0A 5C44B 4HN7A 4CHTB 1HRJA 3H91A 1XLQA 2W55A 1V1PB 2K33A 3QWNA 5DM63 3J81E 2JYEA 5FO9B 1PLFA 5I9PA 1PTOD 5I4DA 1B9NA 1ZOYB 2A74C 2BOSA 1KLGD 2YEPF 2GA4B 5EKKA 1K51A 4P2CB 3DWMA 3VR2A 1CA5A 1ZE3D 1E7PB 3LWUA 1J8IA 1TS4A 2FMCA 4HSVA 2J52A 3BDCA 3C1EA 2IX0A 3GD7A 1F2YA 1KLUD 2Q8IB 1T5XD 1L6VA 4FVMA 4KGRA 1A2UA 4FXKC 3VA5A 3R2TA 3U2SC 3VYTA 1ENCA 3NE5B 2VNUD 4J6HA 2F0WA 4MH8A 3AEEB 4ZHPA 1MVKA 2B2VA 3PUXA 2B2WA 5KYIA 5GXGB 2ICEC 4AYBB 3IAYA 4IFDH 1J7AA 1F9SA 4ID6A 2QJLA 4DXGA 2AQ3B 4R8NA 3ETRA 3NBIA 2K01A 4XYQA 2CJOA 5H92C 3GTKB 4MIUA 1V43A 1KAAA 3K58A 5EE1A 2KVMA 4KGSA 1A6XA 1FO4A 1YMHE 4WORA 4OO1I 1EYAA 2WXRA 5BN5A 2SDFA 2GRIA 4FXDA 2V4IB 1CQVA 3P20A 1EQVA 1JWBD 2F0QA 1A3VA 3OIQA 2F0HA 3BG3A 4B0MA 2MJ8A 3AN1A 2O2LD 4KN4C 1EFID 5ELBA 4LLGM 1IL8A 2EYMA 3R8BA 1LT6D 1IYUA 4KKJA 4IFDJ 1U9RA 3D4RA 3HRDD 2NWGA 2XRQD 1QLBB 2N7JA 3MHZA 2EY2A 1EEFD 1TWHB 3IKJA 2DYOA 5EPJA 2WXMA 4AS1A 4ITKA 1B2TA 3A8JE 3AU7A 1B53A 1SJHD 3GV3A 3PO3B 4QMGA 2MH7A 4XDXA 5I9OA 4FYDA 1C76A 4F88A 2A6HD 3NPPA 2BTEA 4N9TA 2X38A 4TKOB 1H9JA 1SNQA 4FO2A 1L4DB 4JWSC 1FYCA 4UDUC 1T5EA 3P4PB 3U9SA 2B2TC 2KN4A 4F87A 2FINB 2EY6A 2WXOA 3PV0A 5M3MB 4NKLA 1CZWA 2ID0A 1UNSA 2EVBA 1JICA 2DYMA 4RHRA 4C7ZA 1BCPD 1M8AA 2L12A 1CQFA 4IUUA 4L6TB 1KF6B 2IGGA 2EDGA 2AX5A 2A6HC 5J39A 4P6VF 1O7ZA 2XNAC 4US8A 2WDRB 4CKCA 1DONA 1TKWB 1XTCD 2A68D 2JA5B 2JEAI 3ZJTA 1DOYA 3IFDA 4BWGB 2KCCA 1RCVD 2J53A 1GUNA 4GLSC 4JX1C 5E4XA 2E6XA 1D5ZC 1I6VC 2IPKD 3VA7A 2LKVA 1RF2D 3KLSA 2DN8A 1QQRA 3D8GA 2FUG1 2M00A 4IFDG 5ELDA 1BCPC 1BNZA 3M7NA 4A55A 4IALA 3OOCA 1I4PA 1LTSD 5AUIA 2B2WC 5IT9L 1MI2A 3W5VB 4QF4A 2CW0D 1ZDVA 4J1MA 3D31A 5CORA 5M5WB 5IGCA 3SK8A 1FRDA 3I91A 3N6RA 2NN6I 5E4WC 3TSSA 2W3SA 3P4QB 1SNCA 1UAPA 1PXUA 2A68C 5DNFA 3TEZA 2RSOA 3SFEB 3NVVA 2BS4B 1NENB 3M4OB 2PYKA 2X6LA 2MJEA 3S1NB 3SK5A 1F2ZA 1Y8OB 2F3WA 1E2ZA 4I65A 2NUCA 4ABNA 1FCCC 5K5PA 3OW7A 2QSDA 5KYLA 2AUKA 3VR4A 2CW0C 1HQMC 5K36H 5G5HA 4A3BB 3AE6B 1GXDC 4LK1C 4G4KA 3HOZB 3ZJUA 2WXJA 4G7HC 3NQTA 1RTNA 5HG2A 1BCPB 4DU9A 3J7AF 1OXXK 5C4HA 2RBMA 2F0IA 3V05A 3B9JA 4BA2I 1TKYA 2ENBA 1STGA 1JROA 3T53B 3FDTA 1JRPA 5IOCA 4RGNA 2EJGC 1A15A 3X3NA 2KAJA 1U4MA 4HTHA 3BDOA 4BY7B 1QF6A 4NAMA 5BYRA 3KBGA 5ELFA 4UAIA 5KRUA 1AP0A 2NTTA 1YNNC 2LHDA 3C8YA 1W6KA 3SXHA 3MTSA 1EY0A 3C3LA 1ZUD2 2ICIA 3V2TA 3G7LA 5KNBA 4RGOS 4A9AA 1Z47A 5IGGA 1A3UA 1DD2A 2K03A 3S15B 2OT2A 2SEBD 1SNDA 5BMIA 2KEEA 1HEZE 1CHQD 3TBIB 4LAAA 3MXGA 2Q8TA 1SYEA 1UWMA 1ENAA 1Q12A 3CU7A 2NYZD 4NW2A 4V0BA 2KHSA 3QB3A 3D3RA 1CA6A 4DXFA 2K5WA 2JEBI 1Q1EA 1JQ4A 1TR5A 4DK1A 4KHVA 1C4AA 5T1IA 5BMGA 2OEOA 4KKTA 2JA7B 1FD7D 1HUMA 5IT9E 2MUYA 2BT6A 1FNUA 1ILQA 3I4NB 2W3RA 1BCPF 2DWQA 2PVOD 4B08A 3T13A 1HCZA 4WRDA 2MEKA 5ELCA 1PZKD 1SIJA 4A93B 5LL6X 4AQ7A 3VRAB 5K36G 1BXTA 2DLBA 1TVXA 2R93B 2BB5A 4YT0B 3MFGA 5G3LF 3J7YW 5BN3A 1TKEA 2WV6D 2VB2X 4XXEA 1VR9A 3QOLA 2BB6A 1H9RA 4CBVA 5JVH3 3Q23A 5I2XA 4OO1H 3HVDA 1TYGB 4KN7C 2IWHA 4FP5D 3MEHA 2KCNA 3UI2A 1H9SB 5EGTA 1T6BX 4C80A 1TQOA 1UEAB 4PMCA 1E0BA 2A5HA 1F2MA 1BUVT 3FVQA 2W82A 4OZBA 2Y3AA 2IDYA 1SMYD 4PMBA 2Z8LA 3SR6A 5BN4A 3PZ8A 1I50B 4H13C 5HFYA 3T3NA 1NSNS 5M3FB 4U673 2L0CA 4G7ZC 3KWVA 1ZEQX 2WKCA 1YQ3B 1SYFA 2JA6B 2E75C 2INPE 1ML0D 4QUCA 3K59A 4FF4A 2W54A 1D5XC 1NYRA 5FLXL 1QOGA 1WCMB 2F4IA 4K6DA 2LGIA 1DZ1A 3I9V1 4EQOA 1SDFA 3DWGC 3GTMB 2F03A 1F2LA 3ITPA 1QOHA 1DGJA 1XXGA 1PYWD 4H2AA 2M0AA 2JU6X 3DXJC 3K5NA 4NJCA 4DNRB 4GZYC 4JE3B 3ND9A 2F0KA 1FNWA 1QOAA 3FILB 3RZDB 1ZXHA 4M1UB 3T3OA 1TS2A 3RMHA 1QCBD 3NQIA 3U4EG 2RKSA 4YSYB 1Z7TA 1V8CA 2MPMA 4ZHOA 2K28A 4HEA1 1C4CA 5EE9A 1XYIA 1AEXA 2FE8A 1WSPA 1K50A 3T56B 5C0XI 1I3QB 2KWDA 1PDXA 3Q6SA 1VCIA 1SSNA 1FXIA 1XO3A 1MGSA 4K14A 1JWUD 1MD2D 4HMIA 3L3OC 4WFN3 5CR3A 4KK7A 5HGTA 2JZPA 3I57A 2NN6H 4HRSA 1OQQA 4TMAB 1TY2A 4OO1G 3J9CA 1I6HB 3CHBD 2Z1CA 1QT9A 2L1BA 2Y0SB 2KMMA 3TP8A 4RAUC 3IXSA 5E1FA 1G2SA 1BBXC 4C7YA 1MSHA 4C3HG 1N63A 1EWHA 4ZOHC 1AN8A 2JYOA 2RSNA 3E9SA 2SNSA 1TS3A 4DNTB 1L6UA 3BZDB 3K5LA 1KDBA 4HEDA 5AFWA 1CZGA 2N0SB 1N62A 1IBXB 4X3KA 3OWFA 4L23A 1PZJD 4FF1A 5NUCA 1FEHA 1LTTD 4C3HB 2R7ZB 4HKZE 1WWTA 3NTKA 3B2GA 2IT1A 2FHTA 2RDHA 1I4QA 3HOVB 1S5FD 4N6EB 1VDVA 1DOMA 3LX0A 1K52A 5LNK1 2I46A 4QUFA 2M56B 3P4SB 3FPPA 3S1RB 4A3IB 4HMJA 2F0UA 5KNCA 5A2QL 3Q24A 2D9UA 1PRTD 2LHEA 5E6JA 4F8MA 1SSOA 1KABA 1PZID 2ZW1A 4RCOA 1KRHA 3S16B 4OHJA 3HP3A 2QILA 4RHSA 3H09A 3S2HB 1IUEA 2VB3X 5FLXE 2PO4A 2NB0A 4O1NA 1MBYA 1QNKA 3PUYA 3PIP3 3QIAA 2EYFA 1DM0B 4K5WA 1DJRD 2MGSA 5LHY1 1EWYC 3AV8A 1HFNA 2IL8A 2PMZB 1TY0A 3NWTA 2WINB 1PRTC 3R2IA 4DQOC 3NXWA 2F0NA 3HG9A 1PTOC 3RFZB 1ESRA 2JXTA 2MP1A 1R9TB 2JSVX 1I4RA 1ET6A 4DN4M 3DEPA 1KNAA 3ERQA 5BYSA 2V3NA 3HS0C 3FC4A 2HCIA 3S2DB 5EPKA 5H8YE 4ZAIA 2NN6G 3TEWA 4IUNA 3I72A 5EPLA 4JBWA 1WYGA 3ZGZA 1MHXA 2JQRB 5HHDG 1O80A 4OIJA 4Z9CB 3NSWA 2RQXA 2N9KA 3PUZA 2WKDA 2INNE 5C3WA 1HQRD 3P1HA 1KNEA 2IGHA 5CBAE 3D6CA 3DEOA 4Q5VA 5COYA 3AB5A 3MA2B 1GHJA 1NR4A 1PRTB 4O42A 5FOBB 1ZP0B 1LT4D 1E10A 2OHFA 1PTOB 1SEBD 4KTAA 1VRAB 1CK1A 1ZKOA 4BBSB 1JORA 2LS01 2HUGA 1MSGA 4ZLTF 3E56A 3BVGA 1U4PA 1L0VB 3S1QB 3I90A 1GHKA 3N52A 3H8HA 4A6QA 5JEAJ 1PFNA 1C4QA 1XLPA 1B1ZA 2L52A 2B8FA 5C5MA 3EUB2 3GTJB 1XWEA 3EQLC 3BYYB 1CZPA 2WDVB 1FXAA 4C1NK 1ONLA 2EZVA 3KF8A 1O7YA 1WTVA 4IUVA 2HTME 4PMWA 1G2TA 4MT5A 1RYJA 2KECA 1KTKA 2G1EA 3SR1A 4KY5A 5A2QE 4R8IA 2X6GA 2ZT9C 2CVRA 3AEAB 3MXUA 1XF5L 3ONAB 1A3TA 3IT4B 2L83A 1B9RA 2EPBA 4IZ8A 2DBYA 1FGBD 1J7BA 3VR9B 2XWJB 3AB9A 1EY8A 1RODA 1GOZA 5JPNC 3Q8AA 5CV4A 3DHQA 4RGTA 1IHZA 4WQMA 2DY7A 3JAML 1B50A 2B2UA 1EL0A 1R7SA 4IDIA 2B8GA 1PUTA 2CU3A 1L0YB 2H1EA 2WXNA 5C3JB 3AE2B 1YN5A 1EEID 3SHLA 1OFFA 5BMHA 4KD3A 1WVLA 1XCTL 1YJIA 2B2VC 5DAUA 2F0EA 3AE8B 4MN3A 4ZKCB 3EVQA 4MM3B 1Y1VB 2EKIA 2Y5CA 3GTPB 1PRTF 1Q10A 2PIAA 2LFIA 1HA5A 2EY5A 3AECB 1PTOF 2QF7A 2PMVA 2O4XA 4LK0M 2BE5D 4K8IA 4NZLB 3AE5B 5CBEE 3HVZA 1P7FA 4RFBA 3HOYB 3Q8CA 2EE1A 1V97A 4EVOA