4JWUC

Crystal structure of cytochrome p450cam-putidaredoxin complex
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
106
structure length
106
Chain Sequence
SKVVYVSHDGTRRELDVACGVSLMQAAVSNGIYDIVGDCGGSASCATCHVYVNEAFTDKVPAANEREIGMLESVTAELKPNSRLCCQIIMTPELDGIVVDVPDRQW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/electron transport
molecule keywords Camphor 5-monooxygenase
publication title Structural basis for effector control and redox partner recognition in cytochrome P450.
pubmed doi rcsb
source organism Pseudomonas putida
total genus 29
structure length 106
sequence length 106
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4jwuC00
1XLQA 1PDXA 1R7SA 1L6UA 1YJIA 2MJ3A 3AE6B 2DBYA 1E7PB 2G1EA 1N61A 1V8CA 2WDQB 2WLBA 3AEEB 4ZHOA 1DOYA 1J7BA 1ZOYB 1DGJA 3AEFB 4C7YA 1E10A 1XLNA 2FBWB 5EE9A 4HROA 2W55A 3NVVA 3SFEB 1N62A 2DWQA 3AV8A 2AX5A 1YJJA 3LB8C 4HRSA 2PVOD 3W5UB 2EKIA 3B2FA 5EE1A 3AE7B 1FXAA 5G5GA 1ZXIA 3ETRA 4YXDB 3AE4B 1SIJA 5EE0A 5AUKA 3AN1A 3AE1B 1PUTA 4LTUA 4A9AA 3VR9B 1GAQB 4YTNB 2JX5A 2M19A 3CIRB 2W54A 2HTME 2KAJA 1TJEA 3AE8B 3EUB2 3NS1A 4P6VF 2Q5WD 2PKOA 3AECB 3DWGC 1J7CA 2WU2B 1ROEA 4USAA 3AEDB 3AE3B 1JRPA 1DOIA 1NVID 1WRIA 2N0SB 1FMAD 1TKGA 3AH7A 1N5WA 1E9MA 4C7ZA 1QF6A 2M56B 2WU5B 1E6EB 4JX1C 3HRDD 5AUIA 3FAHA 5C2TB 2OHFA 3HUIA 1SF0A 2WS3B 3AB5A 3NVWA 1TKYA 2L52A 3WCQA 2K9XA 1JALA 3HVZA 4WQMA 5MPOA 2MJEA 5H8YE 4US8A 1CJEA 1NYQA 3L4PA 1WXQA 3PO0A 4KX6B 1NEKB 3ZYYX 3SR6A 3FC4A 1E0ZA 4YSXB 1AWDA 1WWTA 2H88B 5EE3A 1SB3C 1WYGA 1J7AA 4JWUC 1N5XA 1QOFA 1TKEA 3AMZA 3NRZA 3AE5B 1QLBB 1T3QA 1FM0D 2H89B 2L83A 3KWLA 1QOBA 1OQRA 1XLPA 1AYFA 1JW9D 1FXIA 1RFKA 3ABVB 2BS4B 3P4RB 4FXCA 2BS3B 3NVYA 3P63A 3BIID 1F0ZA 1KFYB 2WQYB 4YSYB 1GPXA 1NENB 1V97A 3B9JA 2QIEB 4YTMB 3AE9B 1NI3A 1XO3A 3NVZA 4N58A 1ZUD2 1FFVA 2K22A 4JWSC 1N60A 1QT9A 1PFDA 3RPFC 2QJLA 5H92C 3LXFA 4ZHPA 1N63A 2JQRB 4ZOHC 3CWIA 1L5PA 2BS2B 4YT0B 1UWMA 3P4QB 2CU3A 3B2GA 5G5HA 1FFUA 2MH7A 2K5PA 2CJOA 1JWAD 2LEKA 1XLOA 2PIAA 3AE2B 4N59A 3VRBB 1FO4A 2E3TA 1FRRA 3AM9A 1NYRA 3VR8B 3W9CB 1EWYC 1JWBD 3P1MA 1YQ3B 3AEBB 1OFFA 1VDVA 3P4PB 2KMMA 1RYJA 2MJDA 1YQ4B 1QOAA 2BT6A 4YSZB 1RWSA 5C3JB 1FRDA 1JQ4A 3SFDB 3AEGB 1CZPA 1VJKA 2B76B 1ZP0B 3P4SB 1WGKA 1JROA 1FIQA 1IUEA 4ITKA 3DWMA 1I7HA 2ACZB 2PVGC 4US9A 3W5VB 1OQQA 2WDVB 1RM6C 2Y5CA 3VRAB 2W3RA 2W3SA 3AEAB 1TYGB 4C80A 1DOXA 4WWMA 1L0VB 5GXGB 1KRHA 4IDIA 4YTPB 1QOGA 2WDRB 1B9RA 2WP9B 4N6EB 2CJNA 1L6VA 1KF6B 1VLBA 1A70A
chains in the Genus database with same CATH superfamily
2IGHA 2KKCA 1OGWA 5G2NA 2K3UA 5TR5A 3WANA 4LNFA 3Q8AA 1FXTB 2I1KA 3AEFB 1XEEA 3BYTB 2IZVB 3DHHC 4IW0A 4AOFA 2PPHA 1PGXA 2MSED 2M19A 3H9DA 1WJNA 3AE8B 3DWGC 2CU1A 1ACCA 3MHSD 3AEDB 5BYSA 1WH3A 3WAOA 3AH7A 4K3CA 2W9NA 5DPSA 1WE7A 3WCQA 1TGZB 2VH2A 3NOBA 3HM6X 1L0XB 2KVRA 3ZRCA 3Q8BA 2R2QA 3BVZA 2JVCA 3NVYA 1P98A 5JHAA 1GC7A 4I6LB 1V2YA 2BVCA 1S1QB 1P7FA 1J8CA 4ZHPA 4L1BA 3UIPB 2JYEA 2PLPA 4KZCA 1WSPA 3LJ3A 4DDID 4BKSD 1JWAD 1XLOA 2MBHA 3EFUA 3P1MA 3P4PB 1RLFA 4HPMB 3VXWA 2RPQA 4YSZB 5IOIA 5FK9C 2R2OA 5LXHA 2GRIA 3DOWA 4GOCA 2W3RA 2KNBA 2O2VA 3I3TB 1VRAB 4YTPB 2WP9B 3T9LA 3OAWA 4AJYB 2BWES 1R7SA 2FNJB 1TY0A 2DBYA 4F8CB 4J3OD 4NZLB 1N61A 1JWSD 1E10A 1C4CA 2DZMA 2MCNB 3AV8A 1NDDA 3W5UB 5JH5C 1TZ1A 2IO2B 4P16A 4ANVA 3KH0A 2JWUA 3SDLC 4EEWA 4KDIC 2L05A 1FPYA 1E90A 1N5WA 2QHOA 2WS3B 1WR6E 4RFBA 5AZGA 2RD0A 2D3GA 4XWTA 4MH8A 4DXGA 3PO0A 2Y3AA 1NEKB 1MPEA 4MGZE 1AWDA 3QA8A 2WXHA 2A5UA 4MACA 1FM0D 1UBIA 3HVDA 4CQNA 2BS4B 2BS3B 2LXAA 3B1LX 4YSYB 2N9PC 2LHDA 4HPPA 1FFVA 4XYCA 2D3CA 4TSSA 2LVOA 4ICUA 5CHFA 1YN5A 2ZJDA 2ZVOA 3KUCB 1WXVA 2MEKA 2NTSA 4N59A 1WM3A 2WXKA 1I4HA 4DK5A 3B08A 2W82A 4KDLB 1RWSA 2GOWA 4XX5A 1ENFA 3SFDB 2EKEC 5G55A 2J4XA 3PZ8A 1WIAA 2CHXA 2ZCCA 4RF1A 1E7VA 4RGOS 3RNGC 3VRAB 1B9RA 4MGKE 3PLVA 3TSSA 3OJ4B 4HKZE 1MHHE 3RNEC 4BZAA 5J18A 3BY4B 2L7RA 3ZTDA 3AXCA 3VUWA 5E6OA 3UQBA 2O6VB 2KTRB 3N3KB 3AE4B 4A9AA 1VR9A 2WXLA 3AECB 1QKZA 3BWUD 1WY8A 1NVID 4JIOU 3DDCB 2K1FA 2PTLA 4AWJA 2NVUI 4A55A 3FAHA 4N9F4 2EMTA 3DBRI 1R4MB 2KYWA 1TTNA 2RDBC 3MP9A 3NZUA 1V49A 4CHKA 1SB3C 3MJWA 2YEPF 1WX8A 3DQVA 1QOBA 2V4LA 3BVMA 1QZEA 4ZRJA 1LGRA 2Z0EB 1WGGA 2JU6X 2PMVA 2C7MB 3RPFC 1QT9A 2IGGA 2CKHB 1U4AA 4AQ7A 3KWVA 2B3AA 5BMGA 1OTRB 3DBSA 4S0RA 5G5HA 1E7UA 3TEZA 1YQ4B 4LJPB 4TQ0A 1FRDA 2L00B 1WI0A 4WWOA 2J0KA 2MBBB 1BMLC 4FJVB 4WWMA 4GLSC 1QOGA 2KDIA 2KWCA 2PE9A 2BYEA 2KX3A 2FIDA 1J19A 2L8JA 2LRWA 2ZPNA 1V1PB 4K3BA 1KLVA 5D3DA 4JE3B 4HROA 1KTKA 3IG3A 2KT7A 2J53A 4KGTA 1FNVA 4FLHA 2FCMA 2KJRA 3VR9B 3WA0A 2JX5A 3GZNB 3ZXRA 2PKOA 3KLSX 1LFDA 4GB9A 4IWOA 1FNUA 3SU8X 1E8XA 4K7UA 2Y5BB 1E6EB 3UGBB 1PGBA 3HUIA 4NQKE 2MJEA 2JUOA 2BPSA 1ET6A 4B95A 2IYDB 3PRPB 2JWZA 3VVWB 1MJDA 3L10B 3A1QB 2D5GA 3QCAA 2INNE 2V4IB 3V61A 2ON8A 3TEXA 3P63A 2JRIB 2QIEB 1YX6B 4OZAA 1TZOA 1WJ6A 5DCNA 2X38A 1F2RI 4DXAB 3PSEB 2BQQA 1Q5WB 1F1HA 1T5XD 3IAS1 4TMAB 3RNCC 5J17A 1FD6A 4W9DA 2PIAA 2WHIA 3DVNV 2JZ3B 2I38A 1VDVA 3PTFC 4G3XB 2GLSA 2KMCA 3C8YA 1I4RA 3BK1A 3RMKC 1ZP0B 1C78A 3ECIA 1WGKA 2DZKA 4LLGM 5IP4D 2BW2A 3W1SA 3DWMA 4US9A 3U2SC 3W5VB 2LD9A 5BO4B 1SIFA 2IJ0A 1L6VA 5GMVA 4HRSA 2M17A 1PDXA 2MA9B 1QILA 3ZGZA 2MJ3A 3M62B 5L95C 1J7BA 4HEA1 2I1JA 3H6NA 2W55A 1WR1A 2LGIA 2ZEQA 4DHJD 4HJGE 2O6VA 4LDTB 4RF0A 2RR9A 3B2FA 2KTFA 3H1UA 3KW5B 2KTRA 1AARA 1YMHE 2L0FA 1HEZE 1MHXA 2WNMA 3KUDB 1GAQB 4YTNB 3EUB2 4EZJA 3E9SA 1UWXA 4TUUA 3V60A 1D5ZC 2VH1A 4RMAA 2D10A 1QF6A 5BMIA 2M56B 5AEKB 1WFYA 5MPOA 2DYOA 5H8YE 1WYWB 2MWSB 5IN7A 2CS4A 3L4PA 1X1MA 4OVVA 5E6PA 3VHTC 3ZNGC 3SR6A 3H8HA 5EE3A 5BMHA 3R2TA 2L83A 4GN1A 3P4RB 4C4VB 5BYRA 4WWNA 4LK0M 3ENEA 4NPNA 4LCDE 1P9DU 3QX1A 4FULA 5JHBA 4JL9A 1FNWA 4B0MA 2INDC 3ZNHB 1F52A 1YQBA 2WXOA 4I6PA 3W9CB 4KZ0A 4NQLB 4M8NA 4F7ZA 3IHPC 3CSFA 1CZPA 3V3XA 4P1BC 4IUMB 4M01A 1HTOA 1PGAA 4P1CC 2KDBA 2RMMA 1I7HA 2NS5A 3ALBA 2GB1A 3IFWB 2WDVB 2LZ6A 1P3QU 1V1OA 2LWPA 2LVPA 4OZCA 4A20A 1L4ZB 1XLQA 1PQSA 4M02A 1SJED 1L6UA 4AS1A 2V1YA 2G1EA 2WDQB 1V1PA 4II2B 4DXFA 1TIFA 4W9CA 3DVGY 1GG3A 1EWCA 1XCQL 1D4BA 5EE1A 2PEAA 3OLMD 4IG7B 1ZXHA 4MT5A 3AN1A 4LTUA 1C9FA 4K81A 1KLGD 3AI5A 1UBQA 2N1VA 4FJZA 2Q5WD 3HIZA 1VZ8A 1E5WA 3W2DA 1ZPSA 4PT5A 2I2YA 2OHFA 1JALA 1C4PA 1UH6A 3KVFB 3I5JC 4W9FA 3PGEA 4E74A 1G6JA 3A1QA 3NRZA 3A9KA 3AE5B 2QDFA 2R61A 2ZNVC 4G11A 3Q8FA 2JSVX 3R2IA 4CO7A 4NJ6A 3BIID 1KFYB 1B1ZA 4WAFA 3VDZA 1LM8B 3FILB 3ZQ4A 4XE0A 4WURA 4KKJA 2GI9A 3EECA 2G4SA 4YT0B 2CJOA 3MJ5A 1NYRA 5HG2A 1I4PA 4BVUC 1RYJA 1YN4A 2DZIA 2KX0A 4BFRA 3AEGB 2N7DA 3Q3MC 3R3MA 2LGSA 4TV3A 1L2NA 4IDIA 2RDHA 3HHMA 5LXIB 2KVZA 4KGSA 5J2RA 4ARCA 4RH6A 2SEBD 3Q3OC 4BAXA 4BKTA 4URKA 1V8CA 2Y5PA 3OG5A 1ZOYB 1CMXB 5TSSA 1N62A 2PE6B 2KQ4X 4FA6A 2EKIA 2Z59B 2KMAA 2KO3A 4KSLC 1GB4A 3ZJTA 4X57B 1R4MI 3PRMB 3Q14C 4K1RB 4BOSC 1ESFA 2MBOA 2SAKA 1FMAD 2N9LA 1Y56A 2NMQA 2KOXA 4F1SA 4ACFA 3TEYA 3JSVB 2IO1B 3TBLD 1E0ZA 4AP4C 2DLBA 4RM9A 2QEJC 3CF6E 1WYGA 4ZRIA 3ZRFA 1FEHA 2K6QA 1KJTA 3NHEB 4C4VA 4W9HA 3APFA 4MM3A 1E8ZA 1EF1A 1XQQA 2KLGA 1YN3A 1N60A 1K53A 1SE9A 3UQAA 4IWPA 1XCTL 3P4QB 2HJ8A 1WJUA 2L1AA 1KOTA 1V5TA 5LLIA 4HJKA 2NTTA 1P1AA 3ZUNA 1JWMD 5C3JB 4W9GA 1I4XA 5KHOA 2IPKD 3PRZA 4XZ4A 4IKGA 3Q3JA 4NJ7A 1I42A 1OQYA 1OQQA 4DBGA 1K50A 3BZDB 4MGIE 5GXGB 3URYA 2FE8A 1WMHB 4PS3A 3C19A 1KF6B 2KZRA 3VQIA 4LDTD 4DDGD 1GJZA 1DGJA 5I4DA 2WX1A 5LNK1 3GZNI 3ZIMA 2DWQA 3BINA 4WAAA 3K9PB 1WX9A 2ZCBA 3RNAC 3E56A 2RPVA 5IO9A 3EHVA 4YXDB 4UDUC 2KWUB 5EE0A 3VAWA 2KDFB 2WXMA 4JQWC 2LGYA 1J7CA 3RNFC 3ML9A 1JRPA 1M94A 1DOIA 4W9JA 5AUIA 4JX1C 3VUYA 3OJ3A 2C7NB 1SE2A 4ICVA 1SE3A 5JXVA 4XGAB 3B0AA 4RGMA 4KX6B 2G3QB 1Q10A 1L7YA 1EM7A 1WE6A 2K8HA 1Z2MA 2NPTB 1VCBA 1T3QA 2ZW1A 5BYQA 3T8MA 2QCZA 2KANA 1WXSA 4RGNA 3W1YA 4B6WA 3FILA 1NI3A 4H2AA 2XBBC 2DYMA 3RN9C 5H92C 4DHZE 2KWVB 2MP2B 2JQRB 1E8YA 4RGTA 2BS2B 4MDKE 2KN5A 2E6XA 2C5LC 2K5PA 3AE2B 3P42A 2HDEA 2E3TA 3JW0X 4BBNF 2DHZA 1SJHD 2D3AA 2JF5A 1QOAA 2L32A 4ANWA 4PS7A 4FJYA 2IDYA 3L08A 3JVZX 2K8BA 4WJNA 2DNFA 3W1SC 2G4DB 2V0GA 1KRHA 4QAYA 2VZKD 1A70A 2G45B 1V5OA 4HXDA 4OVUA 3EA6A 3NG0A 2JT4B 3QAQA 3SHQA 3PS6A 3PPAA 3I63C 2WXPA 2WDTB 4PYUA 3RUIB 4KKIA 3FKYA 1GNUA 4MSMB 1PUTA 1T0QC 2KAJA 1TJEA 4J6IA 3EGRA 4HPLB 5CHWA 3U7DA 4LNKA 4GU2A 1E8WA 1WRIA 1WRDB 3KUZA 4G0NB 1EO6A 3N1XC 2QSDA 4JLCA 4GSWA 4OVZA 2LGDA 1D3ZA 4WQMA 2AQ2B 3JSVA 2J42A 4MEMA 2AQ1B 1K51A 1WXMA 2HD5B 1N5XA 1I35A 2LI5A 1ZW7A 1ZE3D 1K52A 2OEDA 4ZRPA 4B0EA 1NI2A 2QILA 1F0ZA 3QIJA 4WJOA 1TBEA 2GMIC 4IOIE 3AE9B 1AN8A 4N58A 3RNBC 4II3B 3DHIC 2LRUA 3DPDA 3X23A 3MC0B 3GB1A 3A4RA 2MBEA 3IT6B 4NNJB 2N9KA 2N1WA 1PYWD 4DHZB 3AM9A 4EE2A 1HXYD 1EWYC 1Q0WB 2BT6A 1JQ4A 4B9KA 2NBWB 1J0GA 3SEBA 3HM3A 4ITKA 1BUIC 3TUOA 2ACZB 4AJWA 1C76A 1IGCA 2Z8LA 2M1MA 1WMHA 4N6EB 2PJHA 1RAXA 2PW9A 5L83A 3AE6B 3KQ4A 2UYZB 3MC8A 1C4AA 4C7YA 1GB1A 1XLNA 1N6ZA 3ZNZB 1GUAB 1TS2A 2DAFA 4OZBA 2JY6A 2KLCA 5AUKA 3A33B 1RFAA 3ZTCA 3A9JB 3GOEA 3M95A 3Q8EA 4USAA 4JPSA 1UUPA 1SF0A 3O65B 3NUHB 2N4FA 3WAPA 3NZ3A 1GC6A 4CYEA 3RT3B 3S2AA 2OJRA 3NY5A 3RYTA 1TS3A 1J7AA 3K9OB 2NPTA 1TKEA 3Q8CA 5HFYA 4OW0A 4ANUA 2ZW0A 3VTWA 2H89B 1JWUD 2N7JA 2J0JA 3ABVB 1VZ6A 4WWPA 2WQYB 1V97A 1C79A 5D3IB 3T3OA 1GOZA 2HJ1A 2BYVE 2FAZA 4XWWA 4S17A 1JMLA 2FUHB 2K22A 4MGYE 2QMTA 4ZRKA 2K0PA 2MP2A 2BGFA 2VRRB 3TCAA 3CWIA 3RFZB 2O2VB 1CK1A 2CU3A 3WALA 1DYQA 2KDMA 3VR8B 1LQBA 2KXJA 3NS8A 2KMMA 4IM2A 2YVCA 1R4NB 1HZ5A 3TJPA 2LJ5A 1VD2A 2M8SA 3Q3NC 1MG8A 4A3PA 1SBBB 2D2QA 1F9JA 2K6DB 3TEWA 3AEAB 3H7PB 4TKNA 2C9WB 2BBCA 4M0WB 1LO5D 1HA5A 2CJNA 1VLBA 4PK1A 1YJIA 3DVGX 1BT0A 1DOYA 1WGRA 3BYYB 3P2BA 2FBWB 3LB8C 2N9XA 3VFKA 2N7EA 4MSQB 2LASA 1VZ7A 2NBVB 1SEBD 1XT9B 4P6VF 4L2YA 3AU5A 2LMCA 2LJIA 3AE3B 1YIWA 2N0SB 2O6VD 1S3SG 2WU5B 3AB5A 2L52A 3X0WA 2KFKB 3APDA 3APCA 3R7RA 1WXQA 3O13A 3DVNU 3LDZE 1H4RA 3ML8A 2MHJA 2ICIA 3GP7A 4OHJA 4RM8A 3ZDTA 3IBEA 2EELA 3B9JA 3WAMA 3V05A 1JCKB 1XXGA 2L0TA 3V6EB 2MRPA 4JWSC 1V86A 1NBFC 4EKUA 2DZJA 4HDOA 4HDQA 2FCQA 1QQRA 1UELA 1YJ1A 3RZWC 1UNSA 2AL3A 5CTRC 1SSNA 1YQ3B 1SE4A 2M0XA 4L23A 1HZ6A 4FADA 3BVGA 4YWGG 4BOZB 1VJKA 2LHEA 1HTQA 1FIQA 1TS4A 2KJHB 4A90A 1YNTE 3U8ZA 3PZDA 2JYTA 1IP9A 3DBHB 1TYGB 3TIXA 4C80A 1DOXA 1C3TA 1MVKA 2OOBB 1IYFA 3ZJVA 1XD3B 2WLBA 1K8RB 2KHWB 3QC8B 1Q1OA 1F2RC 1WZ3A 3Q3FA 3SFEB 3QARA 1YJJA 3AE7B 5CX3A 2IGDA 4A6QA 4IM0A 1SIJA 2KC1A 4YL8A 5FR6A 3IAM1 3NS1A 3RCZA 3A9JA 3NZSA 1EU4A 1L0YB 5IAAC 1TKGA 1UGJA 3HRDD 2NR2A 1TKYA 3HK0A 2FUG1 2GBJA 2WYQA 4US8A 3UINB 1CJEA 3ZYYX 1WGDA 4GDKB 3VTVA 2LVQA 4REZA 1I4GA 3N1ZC 5FR3A 3BK2A 1OQRA 3R7QA 1XLPA 1JW9D 1FXIA 2ONQA 4ZYSA 4FXCA 5C23A 2K39A 4YTMB 4HKQA 4EOYA 1V80A 2EMSA 3Q2AC 2YEPB 4EZKA 2AL6A 2BB6A 3UI3A 3ZDMC 4IC7B 3N20C 2KK8A 3CSTA 3V62A 2LUMA 4A3OA 3PREA 2KFJA 3ZXVA 1ISNA 2MH7A 2CHWA 2LEKA 2D07B 2KACA 2V3SA 2N9EB 3VRBB 4KV2A 3DHGC 1FRRA 4KGRA 4GIVA 4C00A 3AEBB 3ZO5B 3RZFA 2XEWA 1LXDA 1JRUA 2MX2A 1HQRD 3R66C 4WH4A 3PHWB 2Y5CA 3DBLB 3H7PA 4DHJB 4M0WA 1L0VB 2GBKA 5DPWA 2JRHA 1D6EC 3TL5A 4E3CA 1M4VA 4ZHOA 3Q69A 5IKCM 4LNIA 2WXFA 5IA7A 1STEA 2J52A 5EE9A 5HI1A 3NVVA 2CHZA 4G50A 3M63B 2LGXA 1Z5SB 2FCNA 1ZXIA 4FHKA 2AEHA 1UZXB 3AE1B 3U7ZA 4BBNC 5D7GA 2WXQA 5E6JA 4GDLB 2C7HA 2XK5B 2WXNA 3PV1A 1UGMA 1SXTA 4W9KA 1E9MA 4C7ZA 4ARIA 3HVZA 3IVFA 1WJ4A 4ASWC 2KFKA 4XDCA 4K7SA 1MG4A 4HCPB 4YSXB 4I6NB 1T0RC 3OWEB 4JWUC 4M8MA 3RULA 2V3NA 1IGDA 3A4SC 3KWLA 3EC8A 3MTNB 1YOVB 2IY1B 1ZKHA 4HK2A 1GPXA 4LNOA 2BKRB 2BYTA 1FCCC 2V3PA 1HE8A 4EZLA 3NVZA 1YD8U 3R8BA 3TMPB 1PFDA 2LFIA 3N9YC 3LXFA 2ASQA 3MC9A 3GE8C 4ZOHC 2JXTA 1T0YA 5AZFA 5E6NA 2G9HD 2ZPYA 1MI0A 4W9IA 2JZPA 1T0SC 1ZDXA 3LYYA 3PZ7A 3N30A 1JROA 2D3BA 4ANXA 4Q2JA 2YLMA 2RDGA 1H8CA 2WDRB 1UF0A 3ZLZA 4PYZA 5EDSA 3AEEB 5DPRA 2IBIB 2KQSA 1P0RA 2AX5A 1FXAA 3PLUA 3ETRA 2XNAC 4MH0E 3U52E 4EUTA 5HHDG 2W54A 2HTME 4A8XC 2DAJA 4FN2A 2WGSA 1IBXB 1ROEA 5FKAC 5JZEB 3PT2B 4EFOA 3ZNID 1Y8RC 1YX5B 3NVWA 3AU4A 2RSUA 2KC2A 4NAMA 3U30A 1IPGA 2NCNA 1NYQA 1WX7A 2J0MA 2DENB 4GDKA 2H88B 1WWTA 2IO3B 2REXA 2D11A 1EF5A 3IXSA 4KIKB 2C60A 4WJPA 1UD7A 3L13A 3MHZA 1AYFA 1RFKA 1RRBA 1SGHA 2KDEB 1KH0A 4NY0A 1C1YB 1NENB 5D2MB 3UIOB 2MLBA 1XO3A 2UU7A 4GMVA 1F77A 1ZDVA 4MELA 2KN4A 1R4NI 1L5PA 2M4NA 4IWQA 3B2GA 1FFUA 1V6EA 3AULA 1V81A 4D2KA 1FO4A 2DX5B 4BKGA 1TY2A 2MJDA 2WX0A 4MJSB 2HTHA 2B76B 3P4SB 1IUEA 2KWDA 2V9HA 3RD2A 1C77A 3NJTA 3WIMA 1AW7A 4NAWB 2BB5A 2INPE 3VH4B 4DQOC 2MQJA 4IM3A 3MFGA 4GGQA 4NJCA 3PHXB 3RI7C 2X8XX 2WWZA 1P7EA 1KM7A 1E7PB 1D5XC 3L17A 3VTUA 2L3ZA 3QJZA 2DYBA 4HLEA 4PS8A 2PVOD 3GE3C 2UWQA 3KYCD 3A9KB 3CIRB 4GDLA 1WXAA 2XK5A 4ZDVA 1T6BX 2ZZPB 2WU2B 2WXRA 3PVLA 2INCC 3ZVVA 1TT5B 2GBRA 5C2TB 2BKFA 2K9XA 1FCLA 1EUVB 3N32A 4HVBA 2K8CA 1D5MC 2IY0B 3N1YC 2HE7A 5KHQA 3D32A 4K7WA 2WXIA 2MBQA 3DBRB 2BTEA 3I9V1 4W9LA 3L0WB 4E71A 4TQ1A 2QC8A 3ONSA 2XN9C 3L54A 4R3DA 2JPHA 4XDDA 2K25A 4RCOA 1ZGUB 2KQ7A 2CR5A 4FBJB 2Z0DB 3QQ8B 3I57A 1JWBD 2M0AA 1WGHA 2AQ3B 5C1ZA 2AYOB 3DBHI 3U4EG 1CQVA 4O1NA 1WF9A 4GXBA 3QK0A 3GS2A 1ET9A 3L16A 2PVGC 4XC2A 5D94A 4DWFA 4AUQC 2W3SA 1I4QA 4LNNA 2FCSA 2GBNA 2BWFA 3AMZA 5AZHA 4RNAA 3VUXA 4M00A 4P7IA 3V6CB 3JYUA 4KSKC 3QHTA 1BXTA 5G5GA 3QWZB 1L4DB 2OJWA 3KYDD 1A5RA 1IBXA 2KD0A 1EU3A 2A4ZA 2IO0B 2GBMA 2NBUA 4MM3B 3VH3B 1V9JA 3UF8A 3J9CA 2JXXA 2KJ6A 4ZYNA 1MFWA 2WXJA 2LXCA 1KLUD 3FC4A 4WQOB 4HCNB 4KIKA 1WZ0A 1QOFA 2BF8B 2ZNVB 5CHVC 4HWIB 1QLBB 2J7QB 4WIPA 5DPTA 3EFCA 2AWTA 3H7SA 2FIFA 2WXGA 1ZUD2 4LJOB 2MW5A 4KVGB 2QJLA 4FHJA 5D6JB 5HKHA 1OEYJ 2LUEA 1N63A 4JGHB 2JZZA 5T8IA 3M3JA 2RGFA 1UWMA 2BYFA 2ZVNA 3Q6BA 3T3NA 4W9EA 3IT4B 2TSSA 4WJQA 1XF5L 3ZKJC 3DBLI 1OFFA 4BKSA 2VZKB 3CMMB 4MJSA 2L76A 3ZJUA 4ZRQA 3C0RB 4C56C 1WM2A 1RM6C 4NAWA 3DCGA 3SD5A 3ZW3A 1WGYA 1OEYA 1TS5A
chains in the Genus database with same CATH topology
3ZGZA 1PDXA 1QILA 1D6EC 2IGHA 1M4VA 2MJ3A 2K3UA 4ZHOA 3Q69A 2WXFA 3EA6A 3Q8AA 1J7BA 4HEA1 1STEA 3AEFB 2J52A 5EE9A 5HI1A 1XEEA 3BYTB 2W55A 3NVVA 2LGIA 2WXPA 4HJGE 4RF0A 3B2FA 4KKIA 1ZXIA 1YMHE 1HEZE 1PGXA 1MHXA 2WNMA 3AE1B 1PUTA 3U7ZA 1GAQB 4YTNB 5D7GA 2M19A 2WXQA 5E6JA 4GDLB 2KAJA 1TJEA 3AE8B 3EUB2 2WXNA 3DWGC 3E9SA 3EGRA 1ACCA 1UWXA 3AEDB 5BYSA 1D5ZC 1SXTA 1WRIA 3AH7A 1QF6A 1E9MA 4C7ZA 5BMIA 2M56B 2QSDA 3WCQA 4ARIA 3HVZA 4OVZA 4WQMA 5MPOA 2AQ2B 2DYOA 4XDCA 5H8YE 2J42A 3L4PA 3SR6A 2AQ1B 4YSXB 3H8HA 1K51A 1L0XB 5EE3A 3OWEB 4JWUC 1N5XA 2V3NA 1IGDA 5BMHA 1ZE3D 3Q8BA 1K52A 2OEDA 2L83A 3KWLA 3R2TA 4ZRPA 4B0EA 2QILA 3BVZA 3P4RB 3NVYA 1F0ZA 5BYRA 1GPXA 4IOIE 3AE9B 4LK0M 2BYTA 1FCCC 2V3PA 1AN8A 3NVZA 4N58A 1P7FA 3R8BA 1PFDA 2LFIA 3N9YC 3LXFA 3MC0B 4ZHPA 4L1BA 3GB1A 2JYEA 2PLPA 2VZKD 4ZOHC 2JXTA 1FNWA 3IT6B 2N9KA 4B0MA 1WSPA 1PYWD 2G9HD 1JWAD 1XLOA 1MI0A 2WXOA 3AM9A 3W9CB 4EE2A 1HXYD 1EWYC 3P1MA 3P4PB 2JZPA 1ZDXA 3LYYA 2BT6A 4YSZB 1JQ4A 1CZPA 5FK9C 3PZ7A 2GRIA 1JROA 3SEBA 3V3XA 1PGAA 2RMMA 4ITKA 1BUIC 3TUOA 1I7HA 2ACZB 2GB1A 2WDVB 1C76A 1IGCA 4Q2JA 2Z8LA 2W3RA 1V1OA 2RDGA 4OZCA 1VRAB 4YTPB 2WDRB 1L4ZB 2WP9B 4N6EB 1XLQA 2PW9A 1R7SA 1L6UA 1SJED 1TY0A 3AE6B 2DBYA 3KQ4A 4AS1A 4J3OD 2G1EA 1N61A 2WDQB 3AEEB 1V1PA 4NZLB 1JWSD 1C4AA 4C7YA 4DXFA 1E10A 1GB1A 1XLNA 1C4CA 1EWCA 1XCQL 1TS2A 3AV8A 2AX5A 4HRSA 1D4BA 4OZBA 3W5UB 5EE1A 1FXAA 3ETRA 2XNAC 1ZXHA 4MT5A 4P16A 3U52E 5AUKA 3AN1A 4LTUA 5HHDG 1C9FA 2JWUA 1KLGD 2W54A 2HTME 4A8XC 2Q5WD 1IBXB 1ROEA 3Q8EA 4USAA 5FKAC 1VZ8A 4JPSA 3W2DA 1ZPSA 1N5WA 4PT5A 2I2YA 2OHFA 1UUPA 1SF0A 2WS3B 3NVWA 1JALA 1C4PA 3NUHB 4RFBA 4XWTA 4MH8A 4NAMA 4DXGA 3NZ3A 1NYQA 3PO0A 2Y3AA 1NEKB 1MPEA 1AWDA 1WWTA 2H88B 5HFYA 2WXHA 1TS3A 1J7AA 1TKEA 3IXSA 3Q8CA 3NRZA 3AE5B 4MACA 1FM0D 4OW0A 3HVDA 2ZW0A 2R61A 2H89B 1JWUD 2JSVX 3Q8FA 3MHZA 2N7JA 3ABVB 1AYFA 1RFKA 3R2IA 4CQNA 2BS4B 1VZ6A 2BS3B 1KH0A 3BIID 1KFYB 2WQYB 1B1ZA 4YSYB 1NENB 1V97A 1C79A 4WAFA 5D3IB 3T3OA 1GOZA 1XO3A 3FILB 2LHDA 4XWWA 3ZQ4A 1JMLA 4XE0A 1FFVA 2K22A 2QMTA 4TSSA 1F77A 2K0PA 1ZDVA 4WURA 2KN4A 1YN5A 4KKJA 2GI9A 3CWIA 3RFZB 1L5PA 4YT0B 1CK1A 2CU3A 3B2GA 1FFUA 2MEKA 4D2KA 2CJOA 2NTSA 4N59A 2WXKA 1FO4A 3MJ5A 1NYRA 1DYQA 2KDMA 5HG2A 3VR8B 1I4HA 1I4PA 2KMMA 1RYJA 1TY2A 2MJDA 2W82A 1YN4A 1RWSA 1ENFA 3SFDB 3AEGB 2B76B 1HZ5A 3P4SB 2J4XA 3PZ8A 1IUEA 2KWDA 1C77A 4RF1A 4RGOS 1SBBB 3VRAB 1AW7A 4NAWB 3TEWA 2BB5A 3AEAB 2INPE 4DQOC 2BBCA 1B9RA 4IDIA 1LO5D 2RDHA 3MFGA 4NJCA 1HA5A 3TSSA 2CJNA 4KGSA 1VLBA 1P7EA 4HKZE 4RH6A 4ARCA 2SEBD 1MHHE 1YJIA 1E7PB 1V8CA 1D5XC 1DOYA 2Y5PA 3BYYB 1ZOYB 5TSSA 2FBWB 1N62A 2KQ4X 3LB8C 2PVOD 2EKIA 1VZ7A 3AE4B 1GB4A 1SEBD 3ZJTA 4A9AA 3CIRB 1VR9A 2WXLA 4P6VF 4L2YA 1T6BX 3AECB 2LMCA 1QKZA 2LJIA 2WU2B 2WXRA 1ESFA 3BWUD 3AE3B 1NVID 2N0SB 2SAKA 1FMAD 2PTLA 2WU5B 4A55A 5C2TB 3FAHA 2N9LA 3AB5A 1Y56A 2NMQA 2L52A 2K9XA 1FCLA 3TEYA 1D5MC 1WXQA 3O13A 1E0ZA 2DLBA 2QEJC 3MP9A 1SB3C 1WYGA 2YEPF 2WXIA 1FEHA 2ICIA 1QOBA 3GP7A 4OHJA 2BTEA 3BVMA 3I9V1 2EELA 3B9JA 4TQ1A 3V05A 2XN9C 1JCKB 1XXGA 1YN3A 4R3DA 2JU6X 2PMVA 4XDDA 4JWSC 3RPFC 1N60A 1QT9A 2IGGA 1K53A 4AQ7A 3KWVA 4RCOA 5BMGA 1QQRA 1XCTL 3P4QB 2L1AA 5G5HA 1UNSA 3TEZA 1SSNA 3I57A 1JWBD 2M0AA 2AQ3B 1YQ3B 1SE4A 2NTTA 1YQ4B 3U4EG 4L23A 1HZ6A 1JWMD 5C3JB 1CQVA 3BVGA 4TQ0A 1FRDA 4YWGG 4O1NA 1I4XA 1VJKA 2LHEA 2IPKD 3GS2A 1FIQA 4IKGA 1TS4A 4A90A 1ET9A 2PVGC 1OQQA 1YNTE 1K50A 3BZDB 2JYTA 1BMLC 2W3SA 1I4QA 1TYGB 4C80A 1DOXA 4WWMA 5GXGB 3URYA 4GLSC 1QOGA 1MVKA 2FE8A 1KF6B 3AMZA 3ZJVA 3VQIA 4RNAA 2WLBA 1V1PB 1DGJA 5I4DA 5LNK1 1F2RC 5D3DA 4JE3B 4HROA 3SFEB 1KTKA 2DWQA 1YJJA 2J53A 3AE7B 1BXTA 4KGTA 5G5GA 1FNVA 3E56A 2IGDA 4A6QA 2RPVA 1L4DB 4YXDB 4UDUC 1SIJA 5EE0A 3VR9B 2JX5A 2WXMA 3IAM1 3NS1A 2PKOA 3KLSX 1IBXA 1J7CA 1EU4A 1FNUA 1L0YB 1EU3A 1JRPA 1DOIA 1TKGA 1UGJA 4MM3B 5AUIA 1E6EB 4JX1C 3HRDD 1PGBA 3HUIA 1SE2A 1TKYA 3J9CA 2FUG1 1SE3A 5JXVA 2MJEA 2WXJA 4US8A 1KLUD 4RGMA 1CJEA 4KX6B 3ZYYX 3FC4A 1ET6A 1Q10A 1EM7A 4GDKB 1QOFA 4REZA 1QLBB 1I4GA 1T3QA 2D5GA 2ZW1A 5FR3A 3BK2A 2INNE 1OQRA 2V4IB 1XLPA 1JW9D 4WIPA 1FXIA 2ONQA 5BYQA 2ON8A 4ZYSA 4FXCA 3TEXA 3P63A 4RGNA 4OZAA 2QIEB 4YTMB 1TZOA 4HKQA 3FILA 1NI3A 2YEPB 2WXGA 4H2AA 2X38A 1ZUD2 2BB6A 3UI3A 2DYMA 1F2RI 2QJLA 5H92C 1T5XD 1N63A 2JQRB 3IAS1 5T8IA 2LUMA 4TMAB 4RGTA 2BS2B 1FD6A 1UWMA 3T3NA 2E6XA 2MH7A 2K5PA 2LEKA 2PIAA 2KACA 2HDEA 3AE2B 2TSSA 3IT4B 3P42A 1XF5L 2E3TA 1FRRA 3VRBB 4KGRA 2I38A 1SJHD 3AEBB 1VDVA 1OFFA 1QOAA 2L32A 2VZKB 3C8YA 1I4RA 3ZJUA 3BK1A 4ZRQA 1ZP0B 1C78A 1WGKA 2IDYA 4C56C 4LLGM 2BW2A 3W1SA 3DWMA 1HQRD 4WH4A 4US9A 3U2SC 3W5VB 1RM6C 2Y5CA 2V0GA 4M0WA 1L0VB 1KRHA 2IJ0A 1L6VA 1TS5A 1A70A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XLQ A;  1PDX A;  1R7S A;  1L6U A;  1YJI A;  2MJ3 A;  3AE6 B;  2DBY A;  1E7P B;  2G1E A;  1N61 A;  1V8C A;  2WDQ B;  2WLB A;  3AEE B;  4ZHO A;  1DOY A;  1J7B A;  1ZOY B;  1DGJ A;  3AEF B;  4C7Y A;  1E10 A;  1XLN A;  2FBW B;  5EE9 A;  4HRO A;  2W55 A;  3NVV A;  3SFE B;  1N62 A;  2DWQ A;  3AV8 A;  2AX5 A;  1YJJ A;  3LB8 C;  4HRS A;  2PVO D;  3W5U B;  2EKI A;  3B2F A;  5EE1 A;  3AE7 B;  1FXA A;  5G5G A;  1ZXI A;  3ETR A;  4YXD B;  3AE4 B;  1SIJ A;  5EE0 A;  5AUK A;  3AN1 A;  3AE1 B;  1PUT A;  4LTU A;  4A9A A;  3VR9 B;  1GAQ B;  4YTN B;  2JX5 A;  2M19 A;  3CIR B;  2W54 A;  2HTM E;  2KAJ A;  1TJE A;  3AE8 B;  3EUB 2;  3NS1 A;  4P6V F;  2Q5W D;  2PKO A;  3AEC B;  3DWG C;  1J7C A;  2WU2 B;  1ROE A;  4USA A;  3AED B;  3AE3 B;  1JRP A;  1DOI A;  1NVI D;  1WRI A;  2N0S B;  1FMA D;  1TKG A;  3AH7 A;  1N5W A;  1E9M A;  4C7Z A;  1QF6 A;  2M56 B;  2WU5 B;  1E6E B;  4JX1 C;  3HRD D;  5AUI A;  3FAH A;  5C2T B;  2OHF A;  3HUI A;  1SF0 A;  2WS3 B;  3AB5 A;  3NVW A;  1TKY A;  2L52 A;  3WCQ A;  2K9X A;  1JAL A;  3HVZ A;  4WQM A;  5MPO A;  2MJE A;  5H8Y E;  4US8 A;  1CJE A;  1NYQ A;  3L4P A;  1WXQ A;  3PO0 A;  4KX6 B;  1NEK B;  3ZYY X;  3SR6 A;  3FC4 A;  1E0Z A;  4YSX B;  1AWD A;  1WWT A;  2H88 B;  5EE3 A;  1SB3 C;  1WYG A;  1J7A A;  4JWU C;  1N5X A;  1QOF A;  1TKE A;  3AMZ A;  3NRZ A;  3AE5 B;  1QLB B;  1T3Q A;  1FM0 D;  2H89 B;  2L83 A;  3KWL A;  1QOB A;  1OQR A;  1XLP A;  1AYF A;  1JW9 D;  1FXI A;  1RFK A;  3ABV B;  2BS4 B;  3P4R B;  4FXC A;  2BS3 B;  3NVY A;  3P63 A;  3BII D;  1F0Z A;  1KFY B;  2WQY B;  4YSY B;  1GPX A;  1NEN B;  1V97 A;  3B9J A;  2QIE B;  4YTM B;  3AE9 B;  1NI3 A;  1XO3 A;  3NVZ A;  4N58 A;  1ZUD 2;  1FFV A;  2K22 A;  4JWS C;  1N60 A;  1QT9 A;  1PFD A;  3RPF C;  2QJL A;  5H92 C;  3LXF A;  4ZHP A;  1N63 A;  2JQR B;  4ZOH C;  3CWI A;  1L5P A;  2BS2 B;  4YT0 B;  1UWM A;  3P4Q B;  2CU3 A;  3B2G A;  5G5H A;  1FFU A;  2MH7 A;  2K5P A;  2CJO A;  1JWA D;  2LEK A;  1XLO A;  2PIA A;  3AE2 B;  4N59 A;  3VRB B;  1FO4 A;  2E3T A;  1FRR A;  3AM9 A;  1NYR A;  3VR8 B;  3W9C B;  1EWY C;  1JWB D;  3P1M A;  1YQ3 B;  3AEB B;  1OFF A;  1VDV A;  3P4P B;  2KMM A;  1RYJ A;  2MJD A;  1YQ4 B;  1QOA A;  2BT6 A;  4YSZ B;  1RWS A;  5C3J B;  1FRD A;  1JQ4 A;  3SFD B;  3AEG B;  1CZP A;  1VJK A;  2B76 B;  1ZP0 B;  3P4S B;  1WGK A;  1JRO A;  1FIQ A;  1IUE A;  4ITK A;  3DWM A;  1I7H A;  2ACZ B;  2PVG C;  4US9 A;  3W5V B;  1OQQ A;  2WDV B;  1RM6 C;  2Y5C A;  3VRA B;  2W3R A;  2W3S A;  3AEA B;  1TYG B;  4C80 A;  1DOX A;  4WWM A;  1L0V B;  5GXG B;  1KRH A;  4IDI A;  4YTP B;  1QOG A;  2WDR B;  1B9R A;  2WP9 B;  4N6E B;  2CJN A;  1L6V A;  1KF6 B;  1VLB A;  1A70 A; 
#chains in the Genus database with same CATH topology
 2IGH A;  2KKC A;  1OGW A;  5G2N A;  2K3U A;  5TR5 A;  3WAN A;  4LNF A;  3Q8A A;  1FXT B;  2I1K A;  3AEF B;  1XEE A;  3BYT B;  2IZV B;  3DHH C;  4IW0 A;  4AOF A;  2PPH A;  1PGX A;  2MSE D;  2M19 A;  3H9D A;  1WJN A;  3AE8 B;  3DWG C;  2CU1 A;  1ACC A;  3MHS D;  3AED B;  5BYS A;  1WH3 A;  3WAO A;  3AH7 A;  4K3C A;  2W9N A;  5DPS A;  1WE7 A;  3WCQ A;  1TGZ B;  2VH2 A;  3NOB A;  3HM6 X;  1L0X B;  2KVR A;  3ZRC A;  3Q8B A;  2R2Q A;  3BVZ A;  2JVC A;  3NVY A;  1P98 A;  5JHA A;  1GC7 A;  4I6L B;  1V2Y A;  2BVC A;  1S1Q B;  1P7F A;  1J8C A;  4ZHP A;  4L1B A;  3UIP B;  2JYE A;  2PLP A;  4KZC A;  1WSP A;  3LJ3 A;  4DDI D;  4BKS D;  1JWA D;  1XLO A;  2MBH A;  3EFU A;  3P1M A;  3P4P B;  1RLF A;  4HPM B;  3VXW A;  2RPQ A;  4YSZ B;  5IOI A;  5FK9 C;  2R2O A;  5LXH A;  2GRI A;  3DOW A;  4GOC A;  2W3R A;  2KNB A;  2O2V A;  3I3T B;  1VRA B;  4YTP B;  2WP9 B;  3T9L A;  3OAW A;  4AJY B;  2BWE S;  1R7S A;  2FNJ B;  1TY0 A;  2DBY A;  4F8C B;  4J3O D;  4NZL B;  1N61 A;  1JWS D;  1E10 A;  1C4C A;  2DZM A;  2MCN B;  3AV8 A;  1NDD A;  3W5U B;  5JH5 C;  1TZ1 A;  2IO2 B;  4P16 A;  4ANV A;  3KH0 A;  2JWU A;  3SDL C;  4EEW A;  4KDI C;  2L05 A;  1FPY A;  1E90 A;  1N5W A;  2QHO A;  2WS3 B;  1WR6 E;  4RFB A;  5AZG A;  2RD0 A;  2D3G A;  4XWT A;  4MH8 A;  4DXG A;  3PO0 A;  2Y3A A;  1NEK B;  1MPE A;  4MGZ E;  1AWD A;  3QA8 A;  2WXH A;  2A5U A;  4MAC A;  1FM0 D;  1UBI A;  3HVD A;  4CQN A;  2BS4 B;  2BS3 B;  2LXA A;  3B1L X;  4YSY B;  2N9P C;  2LHD A;  4HPP A;  1FFV A;  4XYC A;  2D3C A;  4TSS A;  2LVO A;  4ICU A;  5CHF A;  1YN5 A;  2ZJD A;  2ZVO A;  3KUC B;  1WXV A;  2MEK A;  2NTS A;  4N59 A;  1WM3 A;  2WXK A;  1I4H A;  4DK5 A;  3B08 A;  2W82 A;  4KDL B;  1RWS A;  2GOW A;  4XX5 A;  1ENF A;  3SFD B;  2EKE C;  5G55 A;  2J4X A;  3PZ8 A;  1WIA A;  2CHX A;  2ZCC A;  4RF1 A;  1E7V A;  4RGO S;  3RNG C;  3VRA B;  1B9R A;  4MGK E;  3PLV A;  3TSS A;  3OJ4 B;  4HKZ E;  1MHH E;  3RNE C;  4BZA A;  5J18 A;  3BY4 B;  2L7R A;  3ZTD A;  3AXC A;  3VUW A;  5E6O A;  3UQB A;  2O6V B;  2KTR B;  3N3K B;  3AE4 B;  4A9A A;  1VR9 A;  2WXL A;  3AEC B;  1QKZ A;  3BWU D;  1WY8 A;  1NVI D;  4JIO U;  3DDC B;  2K1F A;  2PTL A;  4AWJ A;  2NVU I;  4A55 A;  3FAH A;  4N9F 4;  2EMT A;  3DBR I;  1R4M B;  2KYW A;  1TTN A;  2RDB C;  3MP9 A;  3NZU A;  1V49 A;  4CHK A;  1SB3 C;  3MJW A;  2YEP F;  1WX8 A;  3DQV A;  1QOB A;  2V4L A;  3BVM A;  1QZE A;  4ZRJ A;  1LGR A;  2Z0E B;  1WGG A;  2JU6 X;  2PMV A;  2C7M B;  3RPF C;  1QT9 A;  2IGG A;  2CKH B;  1U4A A;  4AQ7 A;  3KWV A;  2B3A A;  5BMG A;  1OTR B;  3DBS A;  4S0R A;  5G5H A;  1E7U A;  3TEZ A;  1YQ4 B;  4LJP B;  4TQ0 A;  1FRD A;  2L00 B;  1WI0 A;  4WWO A;  2J0K A;  2MBB B;  1BML C;  4FJV B;  4WWM A;  4GLS C;  1QOG A;  2KDI A;  2KWC A;  2PE9 A;  2BYE A;  2KX3 A;  2FID A;  1J19 A;  2L8J A;  2LRW A;  2ZPN A;  1V1P B;  4K3B A;  1KLV A;  5D3D A;  4JE3 B;  4HRO A;  1KTK A;  3IG3 A;  2KT7 A;  2J53 A;  4KGT A;  1FNV A;  4FLH A;  2FCM A;  2KJR A;  3VR9 B;  3WA0 A;  2JX5 A;  3GZN B;  3ZXR A;  2PKO A;  3KLS X;  1LFD A;  4GB9 A;  4IWO A;  1FNU A;  3SU8 X;  1E8X A;  4K7U A;  2Y5B B;  1E6E B;  3UGB B;  1PGB A;  3HUI A;  4NQK E;  2MJE A;  2JUO A;  2BPS A;  1ET6 A;  4B95 A;  2IYD B;  3PRP B;  2JWZ A;  3VVW B;  1MJD A;  3L10 B;  3A1Q B;  2D5G A;  3QCA A;  2INN E;  2V4I B;  3V61 A;  2ON8 A;  3TEX A;  3P63 A;  2JRI B;  2QIE B;  1YX6 B;  4OZA A;  1TZO A;  1WJ6 A;  5DCN A;  2X38 A;  1F2R I;  4DXA B;  3PSE B;  2BQQ A;  1Q5W B;  1F1H A;  1T5X D;  3IAS 1;  4TMA B;  3RNC C;  5J17 A;  1FD6 A;  4W9D A;  2PIA A;  2WHI A;  3DVN V;  2JZ3 B;  2I38 A;  1VDV A;  3PTF C;  4G3X B;  2GLS A;  2KMC A;  3C8Y A;  1I4R A;  3BK1 A;  3RMK C;  1ZP0 B;  1C78 A;  3ECI A;  1WGK A;  2DZK A;  4LLG M;  5IP4 D;  2BW2 A;  3W1S A;  3DWM A;  4US9 A;  3U2S C;  3W5V B;  2LD9 A;  5BO4 B;  1SIF A;  2IJ0 A;  1L6V A;  5GMV A;  4HRS A;  2M17 A;  1PDX A;  2MA9 B;  1QIL A;  3ZGZ A;  2MJ3 A;  3M62 B;  5L95 C;  1J7B A;  4HEA 1;  2I1J A;  3H6N A;  2W55 A;  1WR1 A;  2LGI A;  2ZEQ A;  4DHJ D;  4HJG E;  2O6V A;  4LDT B;  4RF0 A;  2RR9 A;  3B2F A;  2KTF A;  3H1U A;  3KW5 B;  2KTR A;  1AAR A;  1YMH E;  2L0F A;  1HEZ E;  1MHX A;  2WNM A;  3KUD B;  1GAQ B;  4YTN B;  3EUB 2;  4EZJ A;  3E9S A;  1UWX A;  4TUU A;  3V60 A;  1D5Z C;  2VH1 A;  4RMA A;  2D10 A;  1QF6 A;  5BMI A;  2M56 B;  5AEK B;  1WFY A;  5MPO A;  2DYO A;  5H8Y E;  1WYW B;  2MWS B;  5IN7 A;  2CS4 A;  3L4P A;  1X1M A;  4OVV A;  5E6P A;  3VHT C;  3ZNG C;  3SR6 A;  3H8H A;  5EE3 A;  5BMH A;  3R2T A;  2L83 A;  4GN1 A;  3P4R B;  4C4V B;  5BYR A;  4WWN A;  4LK0 M;  3ENE A;  4NPN A;  4LCD E;  1P9D U;  3QX1 A;  4FUL A;  5JHB A;  4JL9 A;  1FNW A;  4B0M A;  2IND C;  3ZNH B;  1F52 A;  1YQB A;  2WXO A;  4I6P A;  3W9C B;  4KZ0 A;  4NQL B;  4M8N A;  4F7Z A;  3IHP C;  3CSF A;  1CZP A;  3V3X A;  4P1B C;  4IUM B;  4M01 A;  1HTO A;  1PGA A;  4P1C C;  2KDB A;  2RMM A;  1I7H A;  2NS5 A;  3ALB A;  2GB1 A;  3IFW B;  2WDV B;  2LZ6 A;  1P3Q U;  1V1O A;  2LWP A;  2LVP A;  4OZC A;  4A20 A;  1L4Z B;  1XLQ A;  1PQS A;  4M02 A;  1SJE D;  1L6U A;  4AS1 A;  2V1Y A;  2G1E A;  2WDQ B;  1V1P A;  4II2 B;  4DXF A;  1TIF A;  4W9C A;  3DVG Y;  1GG3 A;  1EWC A;  1XCQ L;  1D4B A;  5EE1 A;  2PEA A;  3OLM D;  4IG7 B;  1ZXH A;  4MT5 A;  3AN1 A;  4LTU A;  1C9F A;  4K81 A;  1KLG D;  3AI5 A;  1UBQ A;  2N1V A;  4FJZ A;  2Q5W D;  3HIZ A;  1VZ8 A;  1E5W A;  3W2D A;  1ZPS A;  4PT5 A;  2I2Y A;  2OHF A;  1JAL A;  1C4P A;  1UH6 A;  3KVF B;  3I5J C;  4W9F A;  3PGE A;  4E74 A;  1G6J A;  3A1Q A;  3NRZ A;  3A9K A;  3AE5 B;  2QDF A;  2R61 A;  2ZNV C;  4G11 A;  3Q8F A;  2JSV X;  3R2I A;  4CO7 A;  4NJ6 A;  3BII D;  1KFY B;  1B1Z A;  4WAF A;  3VDZ A;  1LM8 B;  3FIL B;  3ZQ4 A;  4XE0 A;  4WUR A;  4KKJ A;  2GI9 A;  3EEC A;  2G4S A;  4YT0 B;  2CJO A;  3MJ5 A;  1NYR A;  5HG2 A;  1I4P A;  4BVU C;  1RYJ A;  1YN4 A;  2DZI A;  2KX0 A;  4BFR A;  3AEG B;  2N7D A;  3Q3M C;  3R3M A;  2LGS A;  4TV3 A;  1L2N A;  4IDI A;  2RDH A;  3HHM A;  5LXI B;  2KVZ A;  4KGS A;  5J2R A;  4ARC A;  4RH6 A;  2SEB D;  3Q3O C;  4BAX A;  4BKT A;  4URK A;  1V8C A;  2Y5P A;  3OG5 A;  1ZOY B;  1CMX B;  5TSS A;  1N62 A;  2PE6 B;  2KQ4 X;  4FA6 A;  2EKI A;  2Z59 B;  2KMA A;  2KO3 A;  4KSL C;  1GB4 A;  3ZJT A;  4X57 B;  1R4M I;  3PRM B;  3Q14 C;  4K1R B;  4BOS C;  1ESF A;  2MBO A;  2SAK A;  1FMA D;  2N9L A;  1Y56 A;  2NMQ A;  2KOX A;  4F1S A;  4ACF A;  3TEY A;  3JSV B;  2IO1 B;  3TBL D;  1E0Z A;  4AP4 C;  2DLB A;  4RM9 A;  2QEJ C;  3CF6 E;  1WYG A;  4ZRI A;  3ZRF A;  1FEH A;  2K6Q A;  1KJT A;  3NHE B;  4C4V A;  4W9H A;  3APF A;  4MM3 A;  1E8Z A;  1EF1 A;  1XQQ A;  2KLG A;  1YN3 A;  1N60 A;  1K53 A;  1SE9 A;  3UQA A;  4IWP A;  1XCT L;  3P4Q B;  2HJ8 A;  1WJU A;  2L1A A;  1KOT A;  1V5T A;  5LLI A;  4HJK A;  2NTT A;  1P1A A;  3ZUN A;  1JWM D;  5C3J B;  4W9G A;  1I4X A;  5KHO A;  2IPK D;  3PRZ A;  4XZ4 A;  4IKG A;  3Q3J A;  4NJ7 A;  1I42 A;  1OQY A;  1OQQ A;  4DBG A;  1K50 A;  3BZD B;  4MGI E;  5GXG B;  3URY A;  2FE8 A;  1WMH B;  4PS3 A;  3C19 A;  1KF6 B;  2KZR A;  3VQI A;  4LDT D;  4DDG D;  1GJZ A;  1DGJ A;  5I4D A;  2WX1 A;  5LNK 1;  3GZN I;  3ZIM A;  2DWQ A;  3BIN A;  4WAA A;  3K9P B;  1WX9 A;  2ZCB A;  3RNA C;  3E56 A;  2RPV A;  5IO9 A;  3EHV A;  4YXD B;  4UDU C;  2KWU B;  5EE0 A;  3VAW A;  2KDF B;  2WXM A;  4JQW C;  2LGY A;  1J7C A;  3RNF C;  3ML9 A;  1JRP A;  1M94 A;  1DOI A;  4W9J A;  5AUI A;  4JX1 C;  3VUY A;  3OJ3 A;  2C7N B;  1SE2 A;  4ICV A;  1SE3 A;  5JXV A;  4XGA B;  3B0A A;  4RGM A;  4KX6 B;  2G3Q B;  1Q10 A;  1L7Y A;  1EM7 A;  1WE6 A;  2K8H A;  1Z2M A;  2NPT B;  1VCB A;  1T3Q A;  2ZW1 A;  5BYQ A;  3T8M A;  2QCZ A;  2KAN A;  1WXS A;  4RGN A;  3W1Y A;  4B6W A;  3FIL A;  1NI3 A;  4H2A A;  2XBB C;  2DYM A;  3RN9 C;  5H92 C;  4DHZ E;  2KWV B;  2MP2 B;  2JQR B;  1E8Y A;  4RGT A;  2BS2 B;  4MDK E;  2KN5 A;  2E6X A;  2C5L C;  2K5P A;  3AE2 B;  3P42 A;  2HDE A;  2E3T A;  3JW0 X;  4BBN F;  2DHZ A;  1SJH D;  2D3A A;  2JF5 A;  1QOA A;  2L32 A;  4ANW A;  4PS7 A;  4FJY A;  2IDY A;  3L08 A;  3JVZ X;  2K8B A;  4WJN A;  2DNF A;  3W1S C;  2G4D B;  2V0G A;  1KRH A;  4QAY A;  2VZK D;  1A70 A;  2G45 B;  1V5O A;  4HXD A;  4OVU A;  3EA6 A;  3NG0 A;  2JT4 B;  3QAQ A;  3SHQ A;  3PS6 A;  3PPA A;  3I63 C;  2WXP A;  2WDT B;  4PYU A;  3RUI B;  4KKI A;  3FKY A;  1GNU A;  4MSM B;  1PUT A;  1T0Q C;  2KAJ A;  1TJE A;  4J6I A;  3EGR A;  4HPL B;  5CHW A;  3U7D A;  4LNK A;  4GU2 A;  1E8W A;  1WRI A;  1WRD B;  3KUZ A;  4G0N B;  1EO6 A;  3N1X C;  2QSD A;  4JLC A;  4GSW A;  4OVZ A;  2LGD A;  1D3Z A;  4WQM A;  2AQ2 B;  3JSV A;  2J42 A;  4MEM A;  2AQ1 B;  1K51 A;  1WXM A;  2HD5 B;  1N5X A;  1I35 A;  2LI5 A;  1ZW7 A;  1ZE3 D;  1K52 A;  2OED A;  4ZRP A;  4B0E A;  1NI2 A;  2QIL A;  1F0Z A;  3QIJ A;  4WJO A;  1TBE A;  2GMI C;  4IOI E;  3AE9 B;  1AN8 A;  4N58 A;  3RNB C;  4II3 B;  3DHI C;  2LRU A;  3DPD A;  3X23 A;  3MC0 B;  3GB1 A;  3A4R A;  2MBE A;  3IT6 B;  4NNJ B;  2N9K A;  2N1W A;  1PYW D;  4DHZ B;  3AM9 A;  4EE2 A;  1HXY D;  1EWY C;  1Q0W B;  2BT6 A;  1JQ4 A;  4B9K A;  2NBW B;  1J0G A;  3SEB A;  3HM3 A;  4ITK A;  1BUI C;  3TUO A;  2ACZ B;  4AJW A;  1C76 A;  1IGC A;  2Z8L A;  2M1M A;  1WMH A;  4N6E B;  2PJH A;  1RAX A;  2PW9 A;  5L83 A;  3AE6 B;  3KQ4 A;  2UYZ B;  3MC8 A;  1C4A A;  4C7Y A;  1GB1 A;  1XLN A;  1N6Z A;  3ZNZ B;  1GUA B;  1TS2 A;  2DAF A;  4OZB A;  2JY6 A;  2KLC A;  5AUK A;  3A33 B;  1RFA A;  3ZTC A;  3A9J B;  3GOE A;  3M95 A;  3Q8E A;  4USA A;  4JPS A;  1UUP A;  1SF0 A;  3O65 B;  3NUH B;  2N4F A;  3WAP A;  3NZ3 A;  1GC6 A;  4CYE A;  3RT3 B;  3S2A A;  2OJR A;  3NY5 A;  3RYT A;  1TS3 A;  1J7A A;  3K9O B;  2NPT A;  1TKE A;  3Q8C A;  5HFY A;  4OW0 A;  4ANU A;  2ZW0 A;  3VTW A;  2H89 B;  1JWU D;  2N7J A;  2J0J A;  3ABV B;  1VZ6 A;  4WWP A;  2WQY B;  1V97 A;  1C79 A;  5D3I B;  3T3O A;  1GOZ A;  2HJ1 A;  2BYV E;  2FAZ A;  4XWW A;  4S17 A;  1JML A;  2FUH B;  2K22 A;  4MGY E;  2QMT A;  4ZRK A;  2K0P A;  2MP2 A;  2BGF A;  2VRR B;  3TCA A;  3CWI A;  3RFZ B;  2O2V B;  1CK1 A;  2CU3 A;  3WAL A;  1DYQ A;  2KDM A;  3VR8 B;  1LQB A;  2KXJ A;  3NS8 A;  2KMM A;  4IM2 A;  2YVC A;  1R4N B;  1HZ5 A;  3TJP A;  2LJ5 A;  1VD2 A;  2M8S A;  3Q3N C;  1MG8 A;  4A3P A;  1SBB B;  2D2Q A;  1F9J A;  2K6D B;  3TEW A;  3AEA B;  3H7P B;  4TKN A;  2C9W B;  2BBC A;  4M0W B;  1LO5 D;  1HA5 A;  2CJN A;  1VLB A;  4PK1 A;  1YJI A;  3DVG X;  1BT0 A;  1DOY A;  1WGR A;  3BYY B;  3P2B A;  2FBW B;  3LB8 C;  2N9X A;  3VFK A;  2N7E A;  4MSQ B;  2LAS A;  1VZ7 A;  2NBV B;  1SEB D;  1XT9 B;  4P6V F;  4L2Y A;  3AU5 A;  2LMC A;  2LJI A;  3AE3 B;  1YIW A;  2N0S B;  2O6V D;  1S3S G;  2WU5 B;  3AB5 A;  2L52 A;  3X0W A;  2KFK B;  3APD A;  3APC A;  3R7R A;  1WXQ A;  3O13 A;  3DVN U;  3LDZ E;  1H4R A;  3ML8 A;  2MHJ A;  2ICI A;  3GP7 A;  4OHJ A;  4RM8 A;  3ZDT A;  3IBE A;  2EEL A;  3B9J A;  3WAM A;  3V05 A;  1JCK B;  1XXG A;  2L0T A;  3V6E B;  2MRP A;  4JWS C;  1V86 A;  1NBF C;  4EKU A;  2DZJ A;  4HDO A;  4HDQ A;  2FCQ A;  1QQR A;  1UEL A;  1YJ1 A;  3RZW C;  1UNS A;  2AL3 A;  5CTR C;  1SSN A;  1YQ3 B;  1SE4 A;  2M0X A;  4L23 A;  1HZ6 A;  4FAD A;  3BVG A;  4YWG G;  4BOZ B;  1VJK A;  2LHE A;  1HTQ A;  1FIQ A;  1TS4 A;  2KJH B;  4A90 A;  1YNT E;  3U8Z A;  3PZD A;  2JYT A;  1IP9 A;  3DBH B;  1TYG B;  3TIX A;  4C80 A;  1DOX A;  1C3T A;  1MVK A;  2OOB B;  1IYF A;  3ZJV A;  1XD3 B;  2WLB A;  1K8R B;  2KHW B;  3QC8 B;  1Q1O A;  1F2R C;  1WZ3 A;  3Q3F A;  3SFE B;  3QAR A;  1YJJ A;  3AE7 B;  5CX3 A;  2IGD A;  4A6Q A;  4IM0 A;  1SIJ A;  2KC1 A;  4YL8 A;  5FR6 A;  3IAM 1;  3NS1 A;  3RCZ A;  3A9J A;  3NZS A;  1EU4 A;  1L0Y B;  5IAA C;  1TKG A;  1UGJ A;  3HRD D;  2NR2 A;  1TKY A;  3HK0 A;  2FUG 1;  2GBJ A;  2WYQ A;  4US8 A;  3UIN B;  1CJE A;  3ZYY X;  1WGD A;  4GDK B;  3VTV A;  2LVQ A;  4REZ A;  1I4G A;  3N1Z C;  5FR3 A;  3BK2 A;  1OQR A;  3R7Q A;  1XLP A;  1JW9 D;  1FXI A;  2ONQ A;  4ZYS A;  4FXC A;  5C23 A;  2K39 A;  4YTM B;  4HKQ A;  4EOY A;  1V80 A;  2EMS A;  3Q2A C;  2YEP B;  4EZK A;  2AL6 A;  2BB6 A;  3UI3 A;  3ZDM C;  4IC7 B;  3N20 C;  2KK8 A;  3CST A;  3V62 A;  2LUM A;  4A3O A;  3PRE A;  2KFJ A;  3ZXV A;  1ISN A;  2MH7 A;  2CHW A;  2LEK A;  2D07 B;  2KAC A;  2V3S A;  2N9E B;  3VRB B;  4KV2 A;  3DHG C;  1FRR A;  4KGR A;  4GIV A;  4C00 A;  3AEB B;  3ZO5 B;  3RZF A;  2XEW A;  1LXD A;  1JRU A;  2MX2 A;  1HQR D;  3R66 C;  4WH4 A;  3PHW B;  2Y5C A;  3DBL B;  3H7P A;  4DHJ B;  4M0W A;  1L0V B;  2GBK A;  5DPW A;  2JRH A;  1D6E C;  3TL5 A;  4E3C A;  1M4V A;  4ZHO A;  3Q69 A;  5IKC M;  4LNI A;  2WXF A;  5IA7 A;  1STE A;  2J52 A;  5EE9 A;  5HI1 A;  3NVV A;  2CHZ A;  4G50 A;  3M63 B;  2LGX A;  1Z5S B;  2FCN A;  1ZXI A;  4FHK A;  2AEH A;  1UZX B;  3AE1 B;  3U7Z A;  4BBN C;  5D7G A;  2WXQ A;  5E6J A;  4GDL B;  2C7H A;  2XK5 B;  2WXN A;  3PV1 A;  1UGM A;  1SXT A;  4W9K A;  1E9M A;  4C7Z A;  4ARI A;  3HVZ A;  3IVF A;  1WJ4 A;  4ASW C;  2KFK A;  4XDC A;  4K7S A;  1MG4 A;  4HCP B;  4YSX B;  4I6N B;  1T0R C;  3OWE B;  4JWU C;  4M8M A;  3RUL A;  2V3N A;  1IGD A;  3A4S C;  3KWL A;  3EC8 A;  3MTN B;  1YOV B;  2IY1 B;  1ZKH A;  4HK2 A;  1GPX A;  4LNO A;  2BKR B;  2BYT A;  1FCC C;  2V3P A;  1HE8 A;  4EZL A;  3NVZ A;  1YD8 U;  3R8B A;  3TMP B;  1PFD A;  2LFI A;  3N9Y C;  3LXF A;  2ASQ A;  3MC9 A;  3GE8 C;  4ZOH C;  2JXT A;  1T0Y A;  5AZF A;  5E6N A;  2G9H D;  2ZPY A;  1MI0 A;  4W9I A;  2JZP A;  1T0S C;  1ZDX A;  3LYY A;  3PZ7 A;  3N30 A;  1JRO A;  2D3B A;  4ANX A;  4Q2J A;  2YLM A;  2RDG A;  1H8C A;  2WDR B;  1UF0 A;  3ZLZ A;  4PYZ A;  5EDS A;  3AEE B;  5DPR A;  2IBI B;  2KQS A;  1P0R A;  2AX5 A;  1FXA A;  3PLU A;  3ETR A;  2XNA C;  4MH0 E;  3U52 E;  4EUT A;  5HHD G;  2W54 A;  2HTM E;  4A8X C;  2DAJ A;  4FN2 A;  2WGS A;  1IBX B;  1ROE A;  5FKA C;  5JZE B;  3PT2 B;  4EFO A;  3ZNI D;  1Y8R C;  1YX5 B;  3NVW A;  3AU4 A;  2RSU A;  2KC2 A;  4NAM A;  3U30 A;  1IPG A;  2NCN A;  1NYQ A;  1WX7 A;  2J0M A;  2DEN B;  4GDK A;  2H88 B;  1WWT A;  2IO3 B;  2REX A;  2D11 A;  1EF5 A;  3IXS A;  4KIK B;  2C60 A;  4WJP A;  1UD7 A;  3L13 A;  3MHZ A;  1AYF A;  1RFK A;  1RRB A;  1SGH A;  2KDE B;  1KH0 A;  4NY0 A;  1C1Y B;  1NEN B;  5D2M B;  3UIO B;  2MLB A;  1XO3 A;  2UU7 A;  4GMV A;  1F77 A;  1ZDV A;  4MEL A;  2KN4 A;  1R4N I;  1L5P A;  2M4N A;  4IWQ A;  3B2G A;  1FFU A;  1V6E A;  3AUL A;  1V81 A;  4D2K A;  1FO4 A;  2DX5 B;  4BKG A;  1TY2 A;  2MJD A;  2WX0 A;  4MJS B;  2HTH A;  2B76 B;  3P4S B;  1IUE A;  2KWD A;  2V9H A;  3RD2 A;  1C77 A;  3NJT A;  3WIM A;  1AW7 A;  4NAW B;  2BB5 A;  2INP E;  3VH4 B;  4DQO C;  2MQJ A;  4IM3 A;  3MFG A;  4GGQ A;  4NJC A;  3PHX B;  3RI7 C;  2X8X X;  2WWZ A;  1P7E A;  1KM7 A;  1E7P B;  1D5X C;  3L17 A;  3VTU A;  2L3Z A;  3QJZ A;  2DYB A;  4HLE A;  4PS8 A;  2PVO D;  3GE3 C;  2UWQ A;  3KYC D;  3A9K B;  3CIR B;  4GDL A;  1WXA A;  2XK5 A;  4ZDV A;  1T6B X;  2ZZP B;  2WU2 B;  2WXR A;  3PVL A;  2INC C;  3ZVV A;  1TT5 B;  2GBR A;  5C2T B;  2BKF A;  2K9X A;  1FCL A;  1EUV B;  3N32 A;  4HVB A;  2K8C A;  1D5M C;  2IY0 B;  3N1Y C;  2HE7 A;  5KHQ A;  3D32 A;  4K7W A;  2WXI A;  2MBQ A;  3DBR B;  2BTE A;  3I9V 1;  4W9L A;  3L0W B;  4E71 A;  4TQ1 A;  2QC8 A;  3ONS A;  2XN9 C;  3L54 A;  4R3D A;  2JPH A;  4XDD A;  2K25 A;  4RCO A;  1ZGU B;  2KQ7 A;  2CR5 A;  4FBJ B;  2Z0D B;  3QQ8 B;  3I57 A;  1JWB D;  2M0A A;  1WGH A;  2AQ3 B;  5C1Z A;  2AYO B;  3DBH I;  3U4E G;  1CQV A;  4O1N A;  1WF9 A;  4GXB A;  3QK0 A;  3GS2 A;  1ET9 A;  3L16 A;  2PVG C;  4XC2 A;  5D94 A;  4DWF A;  4AUQ C;  2W3S A;  1I4Q A;  4LNN A;  2FCS A;  2GBN A;  2BWF A;  3AMZ A;  5AZH A;  4RNA A;  3VUX A;  4M00 A;  4P7I A;  3V6C B;  3JYU A;  4KSK C;  3QHT A;  1BXT A;  5G5G A;  3QWZ B;  1L4D B;  2OJW A;  3KYD D;  1A5R A;  1IBX A;  2KD0 A;  1EU3 A;  2A4Z A;  2IO0 B;  2GBM A;  2NBU A;  4MM3 B;  3VH3 B;  1V9J A;  3UF8 A;  3J9C A;  2JXX A;  2KJ6 A;  4ZYN A;  1MFW A;  2WXJ A;  2LXC A;  1KLU D;  3FC4 A;  4WQO B;  4HCN B;  4KIK A;  1WZ0 A;  1QOF A;  2BF8 B;  2ZNV B;  5CHV C;  4HWI B;  1QLB B;  2J7Q B;  4WIP A;  5DPT A;  3EFC A;  2AWT A;  3H7S A;  2FIF A;  2WXG A;  1ZUD 2;  4LJO B;  2MW5 A;  4KVG B;  2QJL A;  4FHJ A;  5D6J B;  5HKH A;  1OEY J;  2LUE A;  1N63 A;  4JGH B;  2JZZ A;  5T8I A;  3M3J A;  2RGF A;  1UWM A;  2BYF A;  2ZVN A;  3Q6B A;  3T3N A;  4W9E A;  3IT4 B;  2TSS A;  4WJQ A;  1XF5 L;  3ZKJ C;  3DBL I;  1OFF A;  4BKS A;  2VZK B;  3CMM B;  4MJS A;  2L76 A;  3ZJU A;  4ZRQ A;  3C0R B;  4C56 C;  1WM2 A;  1RM6 C;  4NAW A;  3DCG A;  3SD5 A;  3ZW3 A;  1WGY A;  1OEY A;  1TS5 A; 
#chains in the Genus database with same CATH homology
 3ZGZ A;  1PDX A;  1QIL A;  1D6E C;  2IGH A;  1M4V A;  2MJ3 A;  2K3U A;  4ZHO A;  3Q69 A;  2WXF A;  3EA6 A;  3Q8A A;  1J7B A;  4HEA 1;  1STE A;  3AEF B;  2J52 A;  5EE9 A;  5HI1 A;  1XEE A;  3BYT B;  2W55 A;  3NVV A;  2LGI A;  2WXP A;  4HJG E;  4RF0 A;  3B2F A;  4KKI A;  1ZXI A;  1YMH E;  1HEZ E;  1PGX A;  1MHX A;  2WNM A;  3AE1 B;  1PUT A;  3U7Z A;  1GAQ B;  4YTN B;  5D7G A;  2M19 A;  2WXQ A;  5E6J A;  4GDL B;  2KAJ A;  1TJE A;  3AE8 B;  3EUB 2;  2WXN A;  3DWG C;  3E9S A;  3EGR A;  1ACC A;  1UWX A;  3AED B;  5BYS A;  1D5Z C;  1SXT A;  1WRI A;  3AH7 A;  1QF6 A;  1E9M A;  4C7Z A;  5BMI A;  2M56 B;  2QSD A;  3WCQ A;  4ARI A;  3HVZ A;  4OVZ A;  4WQM A;  5MPO A;  2AQ2 B;  2DYO A;  4XDC A;  5H8Y E;  2J42 A;  3L4P A;  3SR6 A;  2AQ1 B;  4YSX B;  3H8H A;  1K51 A;  1L0X B;  5EE3 A;  3OWE B;  4JWU C;  1N5X A;  2V3N A;  1IGD A;  5BMH A;  1ZE3 D;  3Q8B A;  1K52 A;  2OED A;  2L83 A;  3KWL A;  3R2T A;  4ZRP A;  4B0E A;  2QIL A;  3BVZ A;  3P4R B;  3NVY A;  1F0Z A;  5BYR A;  1GPX A;  4IOI E;  3AE9 B;  4LK0 M;  2BYT A;  1FCC C;  2V3P A;  1AN8 A;  3NVZ A;  4N58 A;  1P7F A;  3R8B A;  1PFD A;  2LFI A;  3N9Y C;  3LXF A;  3MC0 B;  4ZHP A;  4L1B A;  3GB1 A;  2JYE A;  2PLP A;  2VZK D;  4ZOH C;  2JXT A;  1FNW A;  3IT6 B;  2N9K A;  4B0M A;  1WSP A;  1PYW D;  2G9H D;  1JWA D;  1XLO A;  1MI0 A;  2WXO A;  3AM9 A;  3W9C B;  4EE2 A;  1HXY D;  1EWY C;  3P1M A;  3P4P B;  2JZP A;  1ZDX A;  3LYY A;  2BT6 A;  4YSZ B;  1JQ4 A;  1CZP A;  5FK9 C;  3PZ7 A;  2GRI A;  1JRO A;  3SEB A;  3V3X A;  1PGA A;  2RMM A;  4ITK A;  1BUI C;  3TUO A;  1I7H A;  2ACZ B;  2GB1 A;  2WDV B;  1C76 A;  1IGC A;  4Q2J A;  2Z8L A;  2W3R A;  1V1O A;  2RDG A;  4OZC A;  1VRA B;  4YTP B;  2WDR B;  1L4Z B;  2WP9 B;  4N6E B;  1XLQ A;  2PW9 A;  1R7S A;  1L6U A;  1SJE D;  1TY0 A;  3AE6 B;  2DBY A;  3KQ4 A;  4AS1 A;  4J3O D;  2G1E A;  1N61 A;  2WDQ B;  3AEE B;  1V1P A;  4NZL B;  1JWS D;  1C4A A;  4C7Y A;  4DXF A;  1E10 A;  1GB1 A;  1XLN A;  1C4C A;  1EWC A;  1XCQ L;  1TS2 A;  3AV8 A;  2AX5 A;  4HRS A;  1D4B A;  4OZB A;  3W5U B;  5EE1 A;  1FXA A;  3ETR A;  2XNA C;  1ZXH A;  4MT5 A;  4P16 A;  3U52 E;  5AUK A;  3AN1 A;  4LTU A;  5HHD G;  1C9F A;  2JWU A;  1KLG D;  2W54 A;  2HTM E;  4A8X C;  2Q5W D;  1IBX B;  1ROE A;  3Q8E A;  4USA A;  5FKA C;  1VZ8 A;  4JPS A;  3W2D A;  1ZPS A;  1N5W A;  4PT5 A;  2I2Y A;  2OHF A;  1UUP A;  1SF0 A;  2WS3 B;  3NVW A;  1JAL A;  1C4P A;  3NUH B;  4RFB A;  4XWT A;  4MH8 A;  4NAM A;  4DXG A;  3NZ3 A;  1NYQ A;  3PO0 A;  2Y3A A;  1NEK B;  1MPE A;  1AWD A;  1WWT A;  2H88 B;  5HFY A;  2WXH A;  1TS3 A;  1J7A A;  1TKE A;  3IXS A;  3Q8C A;  3NRZ A;  3AE5 B;  4MAC A;  1FM0 D;  4OW0 A;  3HVD A;  2ZW0 A;  2R61 A;  2H89 B;  1JWU D;  2JSV X;  3Q8F A;  3MHZ A;  2N7J A;  3ABV B;  1AYF A;  1RFK A;  3R2I A;  4CQN A;  2BS4 B;  1VZ6 A;  2BS3 B;  1KH0 A;  3BII D;  1KFY B;  2WQY B;  1B1Z A;  4YSY B;  1NEN B;  1V97 A;  1C79 A;  4WAF A;  5D3I B;  3T3O A;  1GOZ A;  1XO3 A;  3FIL B;  2LHD A;  4XWW A;  3ZQ4 A;  1JML A;  4XE0 A;  1FFV A;  2K22 A;  2QMT A;  4TSS A;  1F77 A;  2K0P A;  1ZDV A;  4WUR A;  2KN4 A;  1YN5 A;  4KKJ A;  2GI9 A;  3CWI A;  3RFZ B;  1L5P A;  4YT0 B;  1CK1 A;  2CU3 A;  3B2G A;  1FFU A;  2MEK A;  4D2K A;  2CJO A;  2NTS A;  4N59 A;  2WXK A;  1FO4 A;  3MJ5 A;  1NYR A;  1DYQ A;  2KDM A;  5HG2 A;  3VR8 B;  1I4H A;  1I4P A;  2KMM A;  1RYJ A;  1TY2 A;  2MJD A;  2W82 A;  1YN4 A;  1RWS A;  1ENF A;  3SFD B;  3AEG B;  2B76 B;  1HZ5 A;  3P4S B;  2J4X A;  3PZ8 A;  1IUE A;  2KWD A;  1C77 A;  4RF1 A;  4RGO S;  1SBB B;  3VRA B;  1AW7 A;  4NAW B;  3TEW A;  2BB5 A;  3AEA B;  2INP E;  4DQO C;  2BBC A;  1B9R A;  4IDI A;  1LO5 D;  2RDH A;  3MFG A;  4NJC A;  1HA5 A;  3TSS A;  2CJN A;  4KGS A;  1VLB A;  1P7E A;  4HKZ E;  4RH6 A;  4ARC A;  2SEB D;  1MHH E;  1YJI A;  1E7P B;  1V8C A;  1D5X C;  1DOY A;  2Y5P A;  3BYY B;  1ZOY B;  5TSS A;  2FBW B;  1N62 A;  2KQ4 X;  3LB8 C;  2PVO D;  2EKI A;  1VZ7 A;  3AE4 B;  1GB4 A;  1SEB D;  3ZJT A;  4A9A A;  3CIR B;  1VR9 A;  2WXL A;  4P6V F;  4L2Y A;  1T6B X;  3AEC B;  2LMC A;  1QKZ A;  2LJI A;  2WU2 B;  2WXR A;  1ESF A;  3BWU D;  3AE3 B;  1NVI D;  2N0S B;  2SAK A;  1FMA D;  2PTL A;  2WU5 B;  4A55 A;  5C2T B;  3FAH A;  2N9L A;  3AB5 A;  1Y56 A;  2NMQ A;  2L52 A;  2K9X A;  1FCL A;  3TEY A;  1D5M C;  1WXQ A;  3O13 A;  1E0Z A;  2DLB A;  2QEJ C;  3MP9 A;  1SB3 C;  1WYG A;  2YEP F;  2WXI A;  1FEH A;  2ICI A;  1QOB A;  3GP7 A;  4OHJ A;  2BTE A;  3BVM A;  3I9V 1;  2EEL A;  3B9J A;  4TQ1 A;  3V05 A;  2XN9 C;  1JCK B;  1XXG A;  1YN3 A;  4R3D A;  2JU6 X;  2PMV A;  4XDD A;  4JWS C;  3RPF C;  1N60 A;  1QT9 A;  2IGG A;  1K53 A;  4AQ7 A;  3KWV A;  4RCO A;  5BMG A;  1QQR A;  1XCT L;  3P4Q B;  2L1A A;  5G5H A;  1UNS A;  3TEZ A;  1SSN A;  3I57 A;  1JWB D;  2M0A A;  2AQ3 B;  1YQ3 B;  1SE4 A;  2NTT A;  1YQ4 B;  3U4E G;  4L23 A;  1HZ6 A;  1JWM D;  5C3J B;  1CQV A;  3BVG A;  4TQ0 A;  1FRD A;  4YWG G;  4O1N A;  1I4X A;  1VJK A;  2LHE A;  2IPK D;  3GS2 A;  1FIQ A;  4IKG A;  1TS4 A;  4A90 A;  1ET9 A;  2PVG C;  1OQQ A;  1YNT E;  1K50 A;  3BZD B;  2JYT A;  1BML C;  2W3S A;  1I4Q A;  1TYG B;  4C80 A;  1DOX A;  4WWM A;  5GXG B;  3URY A;  4GLS C;  1QOG A;  1MVK A;  2FE8 A;  1KF6 B;  3AMZ A;  3ZJV A;  3VQI A;  4RNA A;  2WLB A;  1V1P B;  1DGJ A;  5I4D A;  5LNK 1;  1F2R C;  5D3D A;  4JE3 B;  4HRO A;  3SFE B;  1KTK A;  2DWQ A;  1YJJ A;  2J53 A;  3AE7 B;  1BXT A;  4KGT A;  5G5G A;  1FNV A;  3E56 A;  2IGD A;  4A6Q A;  2RPV A;  1L4D B;  4YXD B;  4UDU C;  1SIJ A;  5EE0 A;  3VR9 B;  2JX5 A;  2WXM A;  3IAM 1;  3NS1 A;  2PKO A;  3KLS X;  1IBX A;  1J7C A;  1EU4 A;  1FNU A;  1L0Y B;  1EU3 A;  1JRP A;  1DOI A;  1TKG A;  1UGJ A;  4MM3 B;  5AUI A;  1E6E B;  4JX1 C;  3HRD D;  1PGB A;  3HUI A;  1SE2 A;  1TKY A;  3J9C A;  2FUG 1;  1SE3 A;  5JXV A;  2MJE A;  2WXJ A;  4US8 A;  1KLU D;  4RGM A;  1CJE A;  4KX6 B;  3ZYY X;  3FC4 A;  1ET6 A;  1Q10 A;  1EM7 A;  4GDK B;  1QOF A;  4REZ A;  1QLB B;  1I4G A;  1T3Q A;  2D5G A;  2ZW1 A;  5FR3 A;  3BK2 A;  2INN E;  1OQR A;  2V4I B;  1XLP A;  1JW9 D;  4WIP A;  1FXI A;  2ONQ A;  5BYQ A;  2ON8 A;  4ZYS A;  4FXC A;  3TEX A;  3P63 A;  4RGN A;  4OZA A;  2QIE B;  4YTM B;  1TZO A;  4HKQ A;  3FIL A;  1NI3 A;  2YEP B;  2WXG A;  4H2A A;  2X38 A;  1ZUD 2;  2BB6 A;  3UI3 A;  2DYM A;  1F2R I;  2QJL A;  5H92 C;  1T5X D;  1N63 A;  2JQR B;  3IAS 1;  5T8I A;  2LUM A;  4TMA B;  4RGT A;  2BS2 B;  1FD6 A;  1UWM A;  3T3N A;  2E6X A;  2MH7 A;  2K5P A;  2LEK A;  2PIA A;  2KAC A;  2HDE A;  3AE2 B;  2TSS A;  3IT4 B;  3P42 A;  1XF5 L;  2E3T A;  1FRR A;  3VRB B;  4KGR A;  2I38 A;  1SJH D;  3AEB B;  1VDV A;  1OFF A;  1QOA A;  2L32 A;  2VZK B;  3C8Y A;  1I4R A;  3ZJU A;  3BK1 A;  4ZRQ A;  1ZP0 B;  1C78 A;  1WGK A;  2IDY A;  4C56 C;  4LLG M;  2BW2 A;  3W1S A;  3DWM A;  1HQR D;  4WH4 A;  4US9 A;  3U2S C;  3W5V B;  1RM6 C;  2Y5C A;  2V0G A;  4M0W A;  1L0V B;  1KRH A;  2IJ0 A;  1L6V A;  1TS5 A;  1A70 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...