4JWUC

Crystal structure of cytochrome p450cam-putidaredoxin complex
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
106
structure length
106
Chain Sequence
SKVVYVSHDGTRRELDVACGVSLMQAAVSNGIYDIVGDCGGSASCATCHVYVNEAFTDKVPAANEREIGMLESVTAELKPNSRLCCQIIMTPELDGIVVDVPDRQW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Camphor 5-monooxygenase
publication title Structural basis for effector control and redox partner recognition in cytochrome P450.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Oxidoreductase/electron transport
total genus 29
structure length 106
sequence length 106
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4jwuC00
5C2TB 3AE3B 1XO3A 1F0ZA 1L6UA 2W55A 2WDVB 1TYGB 3DWGC 1FFUA 1PDXA 3AE6B 1KRHA 3KWLA 1FXIA 2MJ3A 1DOYA 5EE3A 1FM0D 4YTNB 2CU3A 1XLNA 1WYGA 4ITKA 3NVZA 1OQRA 1JRPA 3VR8B 1YQ3B 2KAJA 1WXQA 1N60A 2JX5A 2M19A 1XLOA 3AN1A 4JX1C 3RPFC 3VRBB 3AE2B 4JWSC 1E0ZA 1SB3C 1JQ4A 2LEKA 3P63A 5C3JB 1QOAA 3NRZA 1AYFA 3SFEB 4LTUA 1L5PA 3P1MA 2WU5B 4USAA 4P6VF 2OHFA 1L0VB 2G1EA 1ZOYB 1SIJA 1E9MA 3AB5A 4KX6B 1JROA 3VR9B 1CZPA 3NVWA 3AEGB 3CIRB 1FIQA 1FMAD 4YTPB 5AUIA 1WGKA 1J7CA 2CJNA 1N5WA 3P4SB 1UWMA 1NI3A 3AM9A 1YJIA 3B9JA 1SF0A 4ZHOA 1FXAA 1QOFA 2WQYB 4WQMA 1YJJA 4HRSA 1FO4A 1IUEA 1R7SA 2BS4B 2HTME 3B2FA 5EE1A 3AE4B 4ZHPA 2QIEB 3AEAB 4N6EB 2Y5CA 1VLBA 2CJOA 3ETRA 1EWYC 2E3TA 1XLQA 3AE9B 4N59A 2N0SB 1NEKB 2AX5A 3P4PB 2PKOA 3HVZA 3NVYA 1OQQA 2EKIA 4YSYB 2BT6A 2BS2B 1GAQB 1JW9D 2MJDA 2WU2B 1GPXA 3FAHA 1ROEA 1TKEA 2PIAA 3ZYYX 2JQRB 3LB8C 1DGJA 3AEEB 4FXCA 4YSXB 3B2GA 1RWSA 2MH7A 1PUTA 1NVID 2PVOD 3P4QB 1B9RA 1E6EB 3DWMA 1QLBB 2FBWB 4ZOHC 3NS1A 4A9AA 2BS3B 4C7ZA 2W3SA 2Q5WD 3BIID 1VDVA 3AE8B 2L52A 4HROA 3W9CB 1RM6C 3W5UB 1WWTA 1QT9A 2B76B 2K9XA 5EE0A 1TKYA 2DBYA 3AE5B 3AECB 3P4RB 3VRAB 1ZXIA 3SR6A 3HRDD 1A70A 2M56B 2W3RA 1DOIA 2WDRB 4IDIA 5G5GA 2QJLA 3AEFB 2MJEA 5AUKA 4YXDB 4YTMB 1OFFA 3WCQA 5MPOA 4WWMA 1RYJA 1NYRA 2WP9B 1T3QA 3EUB2 1YQ4B 5EE9A 4YT0B 5H8YE 3AE1B 1QOBA 4US9A 2ACZB 1JWBD 3W5VB 1RFKA 3HUIA 1N62A 1J7BA 3CWIA 1N5XA 5H92C 2WS3B 1CJEA 4N58A 1E10A 2L83A 3AH7A 3AV8A 1PFDA 4C80A 2K22A 1V8CA 3AEBB 3PO0A 1KF6B 1VJKA 1FRDA 1JWAD 3AEDB 5G5HA 4JWUC 1DOXA 3NVVA 1J7AA 1ZP0B 1FFVA 1FRRA 1V97A 2PVGC 3L4PA 2W54A 2K5PA 1NENB 1ZUD2 2H89B 1I7HA 1KFYB 3AE7B 4C7YA 1N63A 1XLPA 3ABVB 3SFDB 1N61A 3LXFA 1TKGA 2H88B 2WLBA 2WDQB 1QOGA 3FC4A 1TJEA 1NYQA 1L6VA 5GXGB 1WRIA 1AWDA 1E7PB 4YSZB 4US8A 1JALA 1QF6A 2KMMA 3AMZA 2DWQA
chains in the Genus database with same CATH superfamily
4B9KA 3NZSA 3AE6B 3RN9C 1FM0D 1XCTL 2ZNVB 3VR8B 1K8RB 2M19A 1MFWA 2KN4A 3H7PA 1TS2A 3NRZA 1L5PA 4XC2A 1C4PA 3L0WB 2OHFA 3CIRB 3TEYA 2BWFA 1IGCA 1IUEA 3WAMA 2QIEB 3AE9B 2N0SB 3WAPA 2RDGA 1C77A 2MJDA 4M02A 1UD7A 3IBEA 3FAHA 1RLFA 4FXCA 1KM7A 1UWXA 2MEKA 2PVOD 2BVCA 2D3GA 2FBWB 2JZZA 1P9DU 4HPLB 2FCQA 2NVUI 2XK5B 3VQIA 1WWTA 3VHTC 3AECB 5IAAC 1ZXIA 3A4SC 1HA5A 3VH3B 2KVRA 2V1YA 3AEFB 3EFCA 1WI0A 5D2MB 1T3QA 2ZZPB 4B0EA 2L32A 4DXFA 4IW0A 3TEZA 5L95C 5H92C 2WS3B 1HTOA 1PFDA 3DBSA 1DOXA 1FCCC 3ENEA 1V97A 4ZYSA 1GOZA 4GDLA 2LMCA 3APDA 1ZUD2 1XD3B 2VRRB 2BYEA 2INCC 1WM3A 3H1UA 2YEPF 5BYSA 2KTRA 5L83A 4C00A 1WR1A 3VH4B 1XO3A 1GJZA 2DYOA 2AQ1B 2V3PA 4XZ4A 2IGGA 4GDKA 4AOFA 2G3QB 1JMLA 4KVGB 3RZWC 1N60A 1WXSA 3CF6E 3L13A 3VTWA 4MELA 1AYFA 1EO6A 2GBKA 2KO3A 2ZCCA 2BBCA 1EWCA 2DZJA 4M01A 4MH8A 1CZPA 2NS5A 4DXAB 1WGKA 2Z0DB 3HK0A 2D10A 1YJJA 2WXHA 1GB4A 3B2FA 2WX1A 1EF1A 2ZCBA 4P1CC 1ZXHA 1XLQA 3MC8A 1IBXA 1T0QC 4ZRKA 1S3SG 3U7ZA 5LNK1 4A90A 3Q3OC 3M62B 1E8XA 2JWUA 5CHFA 4L23A 2KX3A 3PLUA 3PRPB 1JWSD 2QHOA 2WXOA 2KVZA 5I4DA 2INDC 2BKRB 1OGWA 3EGRA 2ACZB 2JXTA 4WQOB 4AWJA 1CJEA 2A5UA 3QJZA 5HFYA 4HKZE 2K6QA 1TS3A 4JWUC 2K6DB 2K3UA 3R2IA 4FJZA 4MGIE 2KTFA 3AE7B 1I7HA 2FUHB 2A4ZA 4IM3A 4WJQA 3ABVB 2MX2A 3VXWA 2UU7A 1TKGA 4IOIE 4YSZB 5JHAA 3W1SA 2HDEA 2KK8A 3C8YA 3ZXRA 5LLIA 1NBFC 4NNJB 4WAAA 1L6UA 2KYWA 2NPTA 3M3JA 4NQLB 1JRUA 5FK9C 4IUMB 1SE9A 2ZW0A 4ICUA 3L10B 5IKCM 2JF5A 3Q8EA 3SFEB 3GE8C 1FNVA 4BBNC 5IN7A 1ZOYB 3VR9B 3ECIA 2GBNA 2GOWA 3KYDD 3ZJTA 5DPRA 1C3TA 1QQRA 3BWUD 4AUQC 2L0FA 2MHJA 1UH6A 5EE1A 4ZHPA 4IKGA 1WGYA 1EWYC 1P98A 1DYQA 1NEKB 5FKAC 1V80A 2AEHA 2PE9A 4W9CA 1SE4A 4YSXB 2UWQA 1WSPA 2MBQA 3P4QB 1C76A 1QLBB 1A5RA 1VD2A 3O65B 3KH0A 2KQSA 3LDZE 1M94A 3Q3NC 4UDUC 2L3ZA 2PE6B 3BINA 5D3IB 5CTRC 5CX3A 4W9LA 2KDMA 3BK2A 3JVZX 4BKSA 3I63C 1YMHE 3UINB 3CMMB 3WAOA 3AU4A 3A1QA 4K3CA 3A9KB 2J0JA 2KKCA 1WZ3A 2K39A 1XF5L 3TL5A 3I57A 4F1SA 1ESFA 1LXDA 2IPKD 3AULA 2CHWA 2JRHA 1WXAA 3HIZA 3NZUA 4AJWA 2LHDA 1V9JA 1ZP0B 3VVWB 1F2RC 1V86A 2JPHA 4GB9A 4W9KA 3SHQA 4FLHA 4NJ7A 4WWNA 3JSVA 5AZHA 4LCDE 4CQNA 3AI5A 3B1LX 1EF5A 2Y5PA 4TV3A 1DOYA 2ZNVC 1ZGUB 1GG3A 4BOSC 2CU3A 4J6IA 4W9DA 4P16A 4YWGG 2O2VB 1KJTA 1EUVB 1JRPA 4A3OA 1YN4A 2LHEA 3X23A 1XLOA 3AN1A 3T3OA 2PLPA 3VTUA 4ANUA 2ZVNA 3ZNZB 2KJHB 1OTRB 2DYBA 5BMIA 2LVQA 2GBRA 2WXPA 3PT2B 2IGHA 3AEGB 1G6JA 3QX1A 2WGSA 5J17A 1R7SA 2JZ3B 1I4GA 2WDTB 1HEZE 4FULA 1YD8U 1OQQA 2KMCA 1J8CA 2J53A 1T0YA 3KQ4A 3ZYYX 3SD5A 3AEEB 3H7PB 2MH7A 4RMAA 3DBHI 3B0AA 2L0TA 3BIID 1R4NB 1V2YA 1IGDA 2EELA 4PS3A 1E8YA 2D3BA 3NS8A 1BT0A 5MPOA 3RT3B 4L1BA 1EM7A 3EUB2 2PMVA 5EE9A 2FCNA 3DBRI 4MJSA 2RSUA 1N5XA 1SIFA 3Q3FA 5J18A 4CYEA 3QHTA 2C7HA 1FRRA 3L17A 2ON8A 4HJKA 4B95A 1KFYB 4HPMB 2I2YA 4KZ0A 3PSEB 2NMQA 2C60A 1E7PB 1WGHA 2N9KA 4KDLB 3U30A 1AN8A 2W9NA 2LVPA 3OAWA 3P42A 1STEA 3JW0X 4FBJB 1WXQA 1F9JA 4JWSC 1SB3C 2IO3B 1E7VA 4KV2A 3ZGZA 2OEDA 3EHVA 4LTUA 4K81A 4PS7A 2LD9A 2WU5B 1YJ1A 4EZKA 4E3CA 1FIQA 3P4SB 1NI3A 2KTRB 1QOFA 2NBUA 1CK1A 4K7WA 2PW9A 2HTME 5HG2A 1NI2A 4TMAB 1VLBA 1MJDA 4GDKB 4M0WA 1TKEA 3V6CB 3NZ3A 3R2TA 4HCPB 3R7QA 2NR2A 2W82A 4F7ZA 2DHZA 3NS1A 2BW2A 1WJ6A 2N9LA 2LGDA 2DZIA 3PTFC 3ZNHB 3VTVA 4HEA1 3VRAB 3N20C 5EDSA 3MP9A 2W3RA 2JWZA 1HQRD 2QMTA 3R7RA 1RYJA 1NYRA 2K25A 2KMAA 2C5LC 3WANA 3Q3MC 3Q6BA 2AYOB 4MGZE 1MPEA 1WX9A 4HLEA 1J7BA 2BQQA 4WH4A 3S2AA 2PJHA 4LNOA 1WE7A 3BVZA 4BZAA 1WRDB 4XWTA 1D4BA 2N4FA 1NENB 1QZEA 3K9PB 5CHVC 2WDQB 4QAYA 3PGEA 1WY8A 2EMSA 4DHZB 3QQ8B 3RD2A 4PK1A 2MP2A 5DCNA 4W9FA 4D2KA 1TYGB 2KZRA 1ZPSA 2RR9A 1TTNA 4EUTA 3UGBB 1UGMA 3UF8A 5T8IA 1GC7A 4JX1C 3M95A 1C9FA 4ARCA 4MGKE 5DPWA 3LJ3A 4USAA 3KUCB 4DHJB 4KX6B 4MH0E 5AUIA 3H6NA 4REZA 4NPNA 3AM9A 1FXAA 3DVNU 3RZFA 3W2DA 3W1YA 2BPSA 2CJOA 3ZNID 2BF8B 2WXJA 2NPTB 1PYWD 3E56A 2MW5A 2JQRB 1L7YA 3MFGA 1I35A 1C4CA 2QCZA 3BK1A 2FIFA 4KZCA 3HVDA 2LJ5A 2FCSA 1TY2A 4TUUA 1MVKA 3QC8B 4HPPA 3NY5A 5JXVA 4AJYB 2O6VA 2N7JA 4YT0B 2QC8A 4IWQA 4TQ0A 1U4AA 2LGXA 3HUIA 2ZJDA 3Q2AC 4YL8A 4LNFA 2Y5BB 2WNMA 3PV1A 2AQ2B 1WF9A 1FRDA 5JZEB 4HWIB 3NG0A 4PT5A 2PVGC 4OZAA 4A55A 1BMLC 2DX5B 2V4LA 5G2NA 4KIKA 2AL6A 2KN5A 3R8BA 1TJEA 3EC8A 3NJTA 4II3B 2KJ6A 4BKGA 4OVUA 1QILA 3B08A 3A1QB 2M17A 4WJPA 1D3ZA 3WIMA 1F52A 3NHEB 1E7UA 1E0ZA 3GOEA 3OJ3A 2RMMA 4TKNA 5C3JB 1WJ4A 4RGTA 4P1BC 2KFKA 1R4MI 1OEYA 1WR6E 1E8WA 1WX8A 3BY4B 3PZ8A 3H7SA 2G4DB 2WQYB 3DQVA 3JSVB 2D2QA 3L54A 1WM2A 1LM8B 2LVOA 2V9HA 3A4RA 3IAM1 3B2GA 4G0NB 1QKZA 1VR9A 3DWMA 2BS3B 2LXAA 1SE3A 1T6BX 1SBBB 3SU8X 3ZXVA 3SEBA 5BMGA 2K9XA 5EE0A 2JVCA 2DBYA 2VH1A 4L2YA 5KHOA 1I4XA 2D11A 3I9V1 2QSDA 1OFFA 3TSSA 4K7SA 5G55A 5AZGA 3N1YC 1NDDA 3CWIA 4ASWC 3MJ5A 1KF6B 3AEDB 1JWAD 4WWPA 5C23A 3E9SA 2KWDA 1SJED 2K5PA 1KLUD 4BKTA 2R61A 3ZUNA 5IO9A 1OQYA 1I4RA 3BZDB 3MC0B 5C2TB 3RFZB 2LXCA 2WDVB 3KWLA 2DNFA 2ONQA 2QDFA 1H8CA 1IPGA 2PEAA 2LI5A 5KHQA 1YQ3B 1C1YB 1D6EC 4I6LB 4FN2A 1QOAA 1E5WA 3P1MA 2V0GA 1WIAA 4P6VF 5HKHA 4HK2A 5IOIA 2GRIA 4WWOA 3OWEB 2KXJA 4JIOU 1UBIA 2C7MB 1WMHA 2V3SA 3T9LA 3RUIB 4A6QA 2OOBB 1GPXA 2ASQA 1V1PA 3Q8AA 1ZKHA 3RNBC 3D32A 3R66C 4K3BA 2HTHA 2HE7A 1UZXB 2HJ1A 1BXTA 2K8HA 3W9CB 2QEJC 4ANWA 1X1MA 2KQ7A 1ZE3D 1V49A 4IDIA 2ZW1A 2J42A 5AUKA 1GUAB 3QWZB 2WP9B 1C4AA 3KWVA 1L4DB 2IO2B 3FKYA 1C79A 4M0WB 2KWCA 3KYCD 4N58A 2Y3AA 1VRAB 2MBBB 2WXQA 1VJKA 2BYFA 1YN3A 3N32A 3T3NA 1P1AA 3SFDB 2J4XA 3IAS1 3LXFA 2H88B 4FJVB 4OHJA 4XDDA 5HHDG 2WXKA 1WRIA 2M0XA 5IP4D 2IO1B 2KMMA 2WXNA 2BYTA 1K51A 4TQ1A 4M00A 1TIFA 2L05A 3ZJUA 1PDXA 4C4VA 1L4ZB 2Z59B 1SEBD 4LDTB 4W9IA 1WGDA 1V6EA 4RH6A 2JYTA 4W9EA 1VZ8A 2MBOA 1L0VB 2YEPB 4RM9A 1SIJA 3UI3A 1UNSA 3W1SC 4YTPB 2K8BA 3PRZA 2VZKB 1VZ6A 2NCNA 4NAMA 3AE4B 2MP2B 4MACA 4C56C 4N9F4 5LXIB 3ETRA 4F8CB 2PKOA 3QCAA 3DBHB 3NVYA 4YSYB 1FCLA 5DPTA 1L0YB 4G50A 4KKIA 3I3TB 4ICVA 2WXMA 1PUTA 3ZDTA 4LNIA 4S0RA 1MHHE 4HCNB 1JWMD 2W3SA 3ONSA 1SSNA 4KSLC 3UIOB 3RNFC 3AE5B 3DBRB 4PS8A 1YX6B 4II2B 1UGJA 2DLBA 2RDHA 1T0RC 1PQSA 3TJPA 1VCBA 1I4HA 2WYQA 3W5VB 1TBEA 2I1JA 1N62A 4E74A 1FXTB 4HKQA 2HJ8A 4EZJA 4C80A 3SDLC 1EU4A 1XEEA 3L4PA 2JY6A 2KC1A 2WXGA 2CHXA 2GLSA 4FJYA 1JALA 1FD6A 1Z5SB 3APCA 2SEBD 3Q3JA 4GSWA 1ZW7A 2O6VB 3Q8FA 3ZNGC 3I5JC 4XE0A 2GI9A 2MBEA 4GOCA 1FFUA 2MJ3A 1YIWA 4W9GA 1YN5A 2J0MA 2G9HD 1CMXB 1JQ4A 3RULA 3L08A 2D3CA 1S1QB 2WXFA 4KIKB 2NTSA 3NVWA 1KLGD 1J7CA 1N5WA 4GMVA 1M4VA 4DXGA 4KGRA 1YOVB 1LGRA 2JSVX 3P4PB 3HVZA 2M0AA 4MM3A 2BB6A 4JE3B 2BS2B 3TUOA 2WU2B 5CHWA 4GDLB 3MHZA 3VDZA 3IXSA 1E90A 2AQ3B 5AZFA 2KFKB 1WZ0A 4EOYA 2Q5WD 4NQKE 2L1AA 2V4IB 2Z0EB 1V81A 2N7EA 1MG4A 3N30A 1HTQA 2N1WA 4WWMA 3GP7A 4E71A 4PYUA 4MSMB 4DHJD 1N6ZA 4MT5A 2K22A 3ZTCA 1J0GA 1YQBA 3NVVA 3PREA 3HM3A 2KLCA 1MG8A 3NOBA 3FC4A 4ARIA 1YX5B 4IM0A 1IBXB 2DWQA 4CO7A 2N9PC 4IWOA 2G45B 2L8JA 2WXLA 3M63B 2REXA 2OJRA 2RGFA 4AS1A 5EE3A 5DPSA 1WYGA 3NVZA 4R3DA 4G3XB 4FHJA 2IDYA 2IO0B 3RPFC 1ZDXA 3EECA 3P63A 4MSQB 3U4EG 3U8ZA 2FNJB 5D7GA 1WGRA 4I6NB 2G1EA 2RPQA 2WX0A 4HVBA 4BFRA 2L7RA 4GGQA 1YJIA 2J7QB 5BYRA 1VZ7A 1Y56A 4MDKE 2Y5CA 1WJUA 4BVUC 3VUXA 2FAZA 3APFA 5LXHA 3T8MA 1AW7A 3DVGX 1BUIC 4ACFA 4A3PA 4XX5A 2LWPA 4BKSD 4XDCA 2LFIA 5E6JA 3TEWA 2GBMA 1UBQA 2BWES 4S17A 4DHZE 2L52A 4RM8A 4GXBA 1QT9A 3IT4B 3PVLA 3TIXA 4RGMA 2ZEQA 4NJ6A 3C0RB 3U2SC 2DENB 1WMHB 1SXTA 5H8YE 3QK0A 4LJPB 1QOBA 4LNNA 1AARA 2LRUA 3GZNI 2CS4A 2RD0A 5D6JB 1V5TA 1V1PB 1EU3A 3FILA 2JYEA 3HM6X 1XT9B 4XYCA 1J7AA 2L76A 4RGOS 3ZTDA 1Q0WB 4OZCA 3DCGA 4C7YA 4OZBA 1XLPA 4OVZA 3PRMB 2RPVA 2MLBA 4FADA 5J2RA 3MTNB 1F2RI 1P7FA 3RNCC 4JL9A 2XNAC 1V5OA 2G4SA 2NBVB 3Q14C 2N1VA 1P3QU 4DQOC 3RNGC 3OLMD 3DBLI 5E6PA 2M8SA 1R4MB 3KVFB 2KAJA 4DBGA 1T0SC 4HJGE 3VRBB 1UUPA 3ZJVA 2IBIB 2LRWA 1MHXA 3ZKJC 1WXVA 5JHBA 1I42A 1F77A 1LQBA 1P0RA 2KJRA 3QA8A 2TSSA 1E9MA 3Q8BA 1WFYA 4ZHOA 2NBWB 3ALBA 2ZPYA 3DHGC 3IVFA 3AEAB 4N6EB 2KACA 2MCNB 1PGXA 4DWFA 4C4VB 2AX5A 2IGDA 4XWWA 3N1ZC 2IJ0A 4JGHB 2DYMA 5C1ZA 5GMVA 2PIAA 3DOWA 2WWZA 1WGGA 1E6EB 4ZOHC 4WURA 5AEKB 3IT6B 4W9JA 3V6EB 2XN9C 4NAWA 1VDVA 3N1XC 1JCKB 4NJCA 1RM6C 4AP4C 2N9EB 3PZ7A 1TKYA 5IA7A 3L16A 2M56B 1K50A 4RNAA 4YTMB 2INPE 1RAXA 1IYFA 4J3OD 4JPSA 4ZRIA 3ZRCA 3AE1B 5BMHA 2Z8LA 2K8CA 1FPYA 2C7NB 1JWBD 1GNUA 1HXYD 2MRPA 4EEWA 4EE2A 4P7IA 4URKA 2GB1A 3DPDA 1D5XC 2HD5B 3MC9A 1N63A 1I4QA 3TEXA 2E6XA 1HZ6A 3QIJA 1GC6A 4HRSA 1SE2A 1KTKA 2W55A 4HDQA 1ISNA 1H4RA 2EMTA 3PZDA 1XQQA 4ITKA 3BVMA 3H9DA 3A9JA 3A33B 3HHMA 2XBBC 3VFKA 4ZDVA 4WJOA 2B3AA 1FEHA 1UELA 3ZW3A 1J19A 1SJHD 1JROA 2CJNA 3ZQ4A 3ZVVA 3B9JA 2MWSB 3EA6A 1UF0A 4MJSB 2I38A 4JLCA 4X57B 1YNTE 3V05A 4EZLA 1L0XB 1HE8A 2IY1B 4I6PA 3KW5B 1NVID 3RYTA 3TMPB 3RCZA 3OJ4B 4HROA 1WX7A 3H8HA 4WIPA 3P4RB 1K53A 4K7UA 3SR6A 2FCMA 1A70A 4YXDB 2KD0A 2XEWA 4LDTD 1FNWA 1Q5WB 5D94A 3WALA 1T5XD 2KNBA 4MM3B 1ET6A 1SGHA 2SAKA 1RFKA 3MJWA 4NY0A 1D5ZC 3AH7A 3X0WA 3ZDMC 2VZKD 3AEBB 5FR6A 2DZMA 2ICIA 4DDGD 1XXGA 1FFVA 4RCOA 2JUOA 1WH3A 3Q69A 2H89B 2CU1A 4LLGM 3ML9A 3PHXB 1QOGA 4US8A 1RFAA 1NYQA 5GXGB 1AWDA 2JRIB 4KGSA 3PPAA 3O13A 4NZLB 1OEYJ 2KQ4X 4CHKA 3VUYA 4A20A 4FHKA 5FR3A 1MI0A 1FXIA 1GB1A 2ZPNA 1B1ZA 2GBJA 4YTNB 1XLNA 1F1HA 3K9OB 3NUHB 2OJWA 4B0MA 4OVVA 4W9HA 4Q2JA 1Q10A 2LEKA 5E6NA 1TT5B 3GB1A 2X8XX 4GU2A 4BBNF 4IWPA 4O1NA 2QILA 3AB5A 1KH0A 3IG3A 3QAQA 2XK5A 4ZRJA 4DK5A 4GLSC 4PYZA 2N7DA 4M8MA 2DZKA 1KOTA 2DAFA 2E3TA 3ZO5B 4N59A 3KUZA 3CSFA 3IFWB 3ZLZA 2IY0B 2EKIA 3PHWB 2BT6A 1GAQB 2LUEA 4A8XC 1ROEA 4B6WA 4JQWC 2DAJA 2J0KA 4MEMA 1DGJA 3N3KB 1RWSA 1P7EA 1V1OA 3PLVA 3JYUA 2O6VD 1XCQL 5JH5C 3WA0A 2CR5A 2M4NA 1LFDA 2C9WB 2PTLA 2B76B 2BTEA 4KDIC 2BKFA 5E6OA 3DDCB 2WDRB 1KLVA 2MJEA 4G11A 3WCQA 1TZOA 2BGFA 2M1MA 2J52A 4RFBA 2KHWB 4ZRPA 2INNE 3P2BA 2D5GA 2UYZB 1CQVA 4WJNA 2FUG1 2MBHA 3CSTA 3UIPB 3PO0A 4EFOA 1ZDVA 2K1FA 3U7DA 2EKEC 2W54A 2YLMA 4DDID 2VH2A 4RF0A 2FE8A 4M8NA 3ZIMA 3C19A 5TR5A 1N61A 1ACCA 2WLBA 3DHHC 2KFJA 2V3NA 1TS5A 3AMZA 3DVGY 3LYYA 3ML8A 1WXMA 1F0ZA 3DWGC 2GMIC 1KRHA 4IG7B 3UQAA 2IYDB 4FA6A 4GN1A 3UQBA 3FILB 1TY0A 2WXIA 3RNEC 1PGBA 1RRBA 2KDIA 2BB5A 3U52E 3Q8CA 4WQMA 2BS4B 1JWUD 2MA9B 2AWTA 2WXRA 2KT7A 2WHIA 1JW9D 1LO5D 4ZRQA 1WE6A 3RNAC 1C78A 2JXXA 3VAWA 2AL3A 1B9RA 2JT4B 1Q1OA 4A9AA 4LK0M 3AE8B 3PS6A 3W5UB 4H2AA 5HI1A 3V60A 2KDFB 2FIDA 3HRDD 2D3AA 2D07B 1R4NI 2LASA 4KGTA 2LUMA 4K1RB 2BYVE 1YQ4B 4US9A 3V62A 4RGNA 2R2QA 3EFUA 5TSSA 2L83A 3AV8A 2KOXA 4ZYNA 2RDBC 5G5HA 4KSKC 4MGYE 4GIVA 4NAWB 3N9YC 1TS4A 3KUDB 1Z2MA 1QF6A 3V61A 3AE3B 1D5MC 1ENFA 1PGAA 3RMKC 3J9CA 2YVCA 3ZRFA 2K0PA 1E8ZA 2CKHB 4HXDA 1OQRA 2JX5A 1IP9A 3AE2B 4IC7B 4HDOA 3IHPC 3TBLD 2IZVB 3BYTB 3BYYB 1TGZB 2KANA 2NTTA 3KLSX 4AQ7A 1WYWB 1FMAD 2KLGA 3RI7C 1UWMA 1HZ5A 1FNUA 1SF0A 1Y8RC 2KWUB 1WJNA 1FO4A 4WAFA 2KDBA 4ANXA 5BYQA 3VUWA 4EKUA 2JU6X 3A9KA 3AXCA 3GS2A 2KC2A 3A9JB 3LB8C 2KX0A 3DHIC 1K52A 2MQJA 3DVNV 2KWVB 1ET9A 4XGAB 2I1KA 2CHZA 4TSSA 1L2NA 4C7ZA 4LNKA 5D3DA 1I4PA 3V3XA 3TCAA 2R2OA 4KKJA 3GZNB 1DOIA 2KDEB 4IM2A 5G5GA 2QJLA 4BOZB 4OW0A 2N9XA 2PPHA 2L00B 3BVGA 2JZPA 4RF1A 3MHSD 5BO4B 4BAXA 2O2VA 3R3MA 1E10A 3AU5A 1V8CA 2MSED 2LJIA 4ANVA 3GE3C 2X38A 2ZVOA 2LGYA 2LZ6A 4LJOB 2LGIA 1L6VA 3URYA 3QARA 1TZ1A 3DBLB 2LGSA 3OG5A
chains in the Genus database with same CATH topology
1SE2A 1KTKA 2W55A 3ZJUA 1AN8A 1PDXA 3AE6B 1FM0D 1XCTL 4ITKA 3BVMA 1L4ZB 3P42A 3VR8B 1STEA 1WXQA 2M19A 1SEBD 4JWSC 2KN4A 1SB3C 1TS2A 3ZGZA 2OEDA 3NRZA 4LTUA 1FEHA 1L5PA 4RH6A 2JYTA 2WU5B 1C4PA 1VZ8A 2OHFA 1L0VB 1SJHD 2YEPB 1SIJA 1JROA 3UI3A 1UNSA 1FIQA 3CIRB 4YTPB 2CJNA 3P4SB 3TEYA 1NI3A 3ZQ4A 3B9JA 2VZKB 1VZ6A 1QOFA 1CK1A 4NAMA 2PW9A 1IGCA 1IUEA 3EA6A 2HTME 3AE4B 5HG2A 4MACA 2QIEB 4C56C 2I38A 4TMAB 1VLBA 3ETRA 3AE9B 2N0SB 2PKOA 1YNTE 2RDGA 3V05A 3NVYA 4GDKB 1L0XB 4M0WA 4YSYB 1C77A 2MJDA 1FCLA 1L0YB 3FAHA 1TKEA 4KKIA 3NZ3A 3R2TA 2WXMA 4FXCA 1PUTA 1UWXA 2W82A 1NVID 2MEKA 2PVOD 2FBWB 3NS1A 1MHHE 2BW2A 1JWMD 2N9LA 2W3SA 4HROA 1SSNA 3VQIA 1WWTA 3H8HA 3AE5B 3AECB 4WIPA 3P4RB 4HEA1 3VRAB 1K53A 1ZXIA 3SR6A 1HA5A 1A70A 1UGJA 3MP9A 2W3RA 2DLBA 2RDHA 3AEFB 4YXDB 1HQRD 1FNWA 2QMTA 1RYJA 1NYRA 1T3QA 1T5XD 4B0EA 1I4HA 4MM3B 1ET6A 2L32A 1MPEA 2SAKA 4DXFA 3W5VB 1RFKA 1N62A 1J7BA 3TEZA 5H92C 2WS3B 4HKQA 1D5ZC 3AH7A 4WH4A 1PFDA 4C80A 2VZKD 3AEBB 2ICIA 1EU4A 1DOXA 3BVZA 1FCCC 1XEEA 1XXGA 1FFVA 1V97A 3L4PA 4RCOA 4ZYSA 1GOZA 2WXGA 4XWTA 2LMCA 1D4BA 3Q69A 1NENB 1ZUD2 2H89B 4LLGM 2YEPF 2WDQB 1QOGA 4US8A 1NYQA 5GXGB 5BYSA 1AWDA 1JALA 4KGSA 1FD6A 2SEBD 3O13A 4NZLB 2KQ4X 1XO3A 3Q8FA 4D2KA 4XE0A 1TYGB 2DYOA 2GI9A 2AQ1B 2V3PA 1FFUA 5FR3A 1MI0A 1ZPSA 1FXIA 2MJ3A 1GB1A 2IGGA 1YN5A 1B1ZA 4YTNB 1XLNA 3NUHB 2G9HD 5T8IA 1JMLA 4B0MA 4JX1C 1N60A 1JQ4A 4Q2JA 1C9FA 1Q10A 2LEKA 4ARCA 3GB1A 1AYFA 4USAA 4O1NA 2BBCA 1EWCA 2WXFA 2QILA 3AB5A 4KX6B 1KH0A 2NTSA 4MH8A 1CZPA 3NVWA 5AUIA 4REZA 4GLSC 1KLGD 1WGKA 1J7CA 1N5WA 3AM9A 1M4VA 1FXAA 1YJJA 4HRSA 2WXHA 1GB4A 3B2FA 4DXGA 4KGRA 3W2DA 2CJOA 1ZXHA 2E3TA 1XLQA 4N59A 2WXJA 2JSVX 3P4PB 3HVZA 2M0AA 1PYWD 1IBXA 2BB6A 2EKIA 3E56A 4JE3B 2BT6A 2BS2B 1GAQB 2WU2B 3TUOA 4A8XC 1ROEA 2JQRB 3MHZA 4GDLB 3MFGA 1C4CA 3IXSA 1DGJA 3BK1A 1RWSA 1P7EA 2AQ3B 3HVDA 3U7ZA 1V1OA 5LNK1 4A90A 1XCQL 2Q5WD 1TY2A 2L1AA 2V4IB 1MVKA 2JWUA 2PTLA 4L23A 2B76B 2BTEA 1JWSD 2WXOA 5JXVA 2WDRB 5I4DA 2MJEA 3WCQA 4WWMA 3GP7A 1TZOA 2N7JA 2J52A 3EGRA 4YT0B 4RFBA 4ZRPA 4TQ0A 2INNE 2D5GA 2ACZB 1CQVA 3HUIA 2JXTA 2FUG1 1CJEA 4MT5A 2WNMA 2AQ2B 2K22A 3PO0A 1ZDVA 5HFYA 4HKZE 1FRDA 1TS3A 4JWUC 3NVVA 2K3UA 4PT5A 2PVGC 3R2IA 4OZAA 4A55A 2W54A 3AE7B 1I7HA 4RF0A 2FE8A 1BMLC 3ABVB 1N61A 1ACCA 1TKGA 2WLBA 3FC4A 3R8BA 4IOIE 1TJEA 4YSZB 4ARIA 3W1SA 2HDEA 2V3NA 1TS5A 3AMZA 3C8YA 2DWQA 1IBXB 3LYYA 1F0ZA 1QILA 1L6UA 3DWGC 2WXLA 1KRHA 4AS1A 5EE3A 1WYGA 5FK9C 3NVZA 4R3DA 2IDYA 1E0ZA 3RPFC 1ZDXA 3U4EG 2ZW0A 3FILB 3P63A 1TY0A 2WXIA 2RMMA 5C3JB 3Q8EA 5D7GA 3SFEB 4RGTA 1FNVA 1PGBA 2G1EA 1ZOYB 3VR9B 2BB5A 3U52E 3PZ8A 3ZJTA 1YJIA 5BYRA 1VZ7A 1QQRA 2WQYB 3BWUD 3Q8CA 4WQMA 1Y56A 2BS4B 5EE1A 4ZHPA 4IKGA 2Y5CA 1JWUD 1EWYC 1DYQA 1NEKB 5FKAC 2WXRA 1AW7A 1JW9D 1BUIC 1LO5D 4ZRQA 3IAM1 1SE4A 4XDCA 4YSXB 3B2GA 2LFIA 5E6JA 3TEWA 1QKZA 1C78A 1VR9A 1WSPA 3P4QB 1B9RA 1C76A 3DWMA 1QLBB 4A9AA 2BS3B 4LK0M 3AE8B 2L52A 1SE3A 1T6BX 4UDUC 1SBBB 3SEBA 5BMGA 3W5UB 2K9XA 1QT9A 3IT4B 4H2AA 5D3IB 5EE0A 2DBYA 5HI1A 2KDMA 3HRDD 3BK2A 4L2YA 4RGMA 1I4XA 1YMHE 3I9V1 2QSDA 1OFFA 3TSSA 4KGTA 3U2SC 2LUMA 1SXTA 1YQ4B 5H8YE 1QOBA 4US9A 4RGNA 5TSSA 1XF5L 3CWIA 3I57A 1ESFA 1V1PB 2IPKD 2L83A 3AV8A 3MJ5A 1EU3A 1KF6B 3FILA 2JYEA 3AEDB 1JWAD 5G5HA 3E9SA 2LHDA 1J7AA 1ZP0B 2KWDA 1F2RC 4RGOS 1SJED 2K5PA 1KLUD 4NAWB 3N9YC 4OZCA 4C7YA 1TS4A 4OZBA 1XLPA 2R61A 4OVZA 2RPVA 1QF6A 1I4RA 3BZDB 3MC0B 1F2RI 5C2TB 3AE3B 3RFZB 4CQNA 1P7FA 2WDVB 1D5MC 1ENFA 1PGAA 2XNAC 3J9CA 3KWLA 2K0PA 2Y5PA 1DOYA 2ONQA 2CU3A 4DQOC 4P16A 4YWGG 1OQRA 1JRPA 1YQ3B 2KAJA 2JX5A 1YN4A 2LHEA 3T3OA 1XLOA 3AN1A 4HJGE 2PLPA 3VRBB 3AE2B 1D6EC 1UUPA 3ZJVA 1MHXA 1QOAA 3BYTB 3BYYB 3P1MA 2V0GA 1F77A 5BMIA 4P6VF 2NTTA 3KLSX 2GRIA 2WXPA 2TSSA 1E9MA 3OWEB 4AQ7A 2IGHA 3AEGB 3Q8BA 1FMAD 4ZHOA 1UWMA 1HZ5A 1FNUA 1SF0A 1FO4A 1R7SA 4WAFA 3AEAB 4N6EB 1I4GA 2KACA 1HEZE 1PGXA 5BYQA 2AX5A 2IGDA 4XWWA 1OQQA 2IJ0A 4A6QA 2JU6X 2J53A 2DYMA 3GS2A 1GPXA 3KQ4A 3ZYYX 2PIAA 3LB8C 1V1PA 3Q8AA 3AEEB 1K52A 2MH7A 1ET9A 1E6EB 4ZOHC 4WURA 3IT6B 4TSSA 4C7ZA 2XN9C 3BIID 1IGDA 2EELA 1BXTA 1VDVA 1JCKB 4NJCA 3W9CB 1RM6C 5D3DA 1I4PA 3V3XA 3PZ7A 1TKYA 2QEJC 4KKJA 2M56B 1ZE3D 1DOIA 4IDIA 1K50A 2ZW1A 2QJLA 5G5GA 2J42A 4RNAA 5AUKA 4YTMB 5MPOA 2INPE 4OW0A 4L1BA 1EM7A 4J3OD 4JPSA 2WP9B 3EUB2 1C4AA 3KWVA 2PMVA 1L4DB 5EE9A 3AE1B 3BVGA 5BMHA 2JZPA 2Z8LA 1C79A 4RF1A 1JWBD 1N5XA 4N58A 1E10A 1HXYD 2Y3AA 1VRAB 1V8CA 2WXQA 2LJIA 1VJKA 2X38A 4EE2A 1FRRA 2ON8A 1YN3A 2GB1A 1D5XC 1KFYB 1N63A 2I2YA 3T3NA 1I4QA 3TEXA 2E6XA 1HZ6A 3SFDB 2LGIA 2J4XA 3IAS1 3LXFA 2H88B 2NMQA 4OHJA 4XDDA 5HHDG 1L6VA 2WXKA 1WRIA 1E7PB 3URYA 2KMMA 2WXNA 2BYTA 1K51A 2N9KA 4TQ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C2T B;  3AE3 B;  1XO3 A;  1F0Z A;  1L6U A;  2W55 A;  2WDV B;  1TYG B;  3DWG C;  1FFU A;  1PDX A;  3AE6 B;  1KRH A;  3KWL A;  1FXI A;  2MJ3 A;  1DOY A;  5EE3 A;  1FM0 D;  4YTN B;  2CU3 A;  1XLN A;  1WYG A;  4ITK A;  3NVZ A;  1OQR A;  1JRP A;  3VR8 B;  1YQ3 B;  2KAJ A;  1WXQ A;  1N60 A;  2JX5 A;  2M19 A;  1XLO A;  3AN1 A;  4JX1 C;  3RPF C;  3VRB B;  3AE2 B;  4JWS C;  1E0Z A;  1SB3 C;  1JQ4 A;  2LEK A;  3P63 A;  5C3J B;  1QOA A;  3NRZ A;  1AYF A;  3SFE B;  4LTU A;  1L5P A;  3P1M A;  2WU5 B;  4USA A;  4P6V F;  2OHF A;  1L0V B;  2G1E A;  1ZOY B;  1SIJ A;  1E9M A;  3AB5 A;  4KX6 B;  1JRO A;  3VR9 B;  1CZP A;  3NVW A;  3AEG B;  3CIR B;  1FIQ A;  1FMA D;  4YTP B;  5AUI A;  1WGK A;  1J7C A;  2CJN A;  1N5W A;  3P4S B;  1UWM A;  1NI3 A;  3AM9 A;  1YJI A;  3B9J A;  1SF0 A;  4ZHO A;  1FXA A;  1QOF A;  2WQY B;  4WQM A;  1YJJ A;  4HRS A;  1FO4 A;  1IUE A;  1R7S A;  2BS4 B;  2HTM E;  3B2F A;  5EE1 A;  3AE4 B;  4ZHP A;  2QIE B;  3AEA B;  4N6E B;  2Y5C A;  1VLB A;  2CJO A;  3ETR A;  1EWY C;  2E3T A;  1XLQ A;  3AE9 B;  4N59 A;  2N0S B;  1NEK B;  2AX5 A;  3P4P B;  2PKO A;  3HVZ A;  3NVY A;  1OQQ A;  2EKI A;  4YSY B;  2BT6 A;  2BS2 B;  1GAQ B;  1JW9 D;  2MJD A;  2WU2 B;  1GPX A;  3FAH A;  1ROE A;  1TKE A;  2PIA A;  3ZYY X;  2JQR B;  3LB8 C;  1DGJ A;  3AEE B;  4FXC A;  4YSX B;  3B2G A;  1RWS A;  2MH7 A;  1PUT A;  1NVI D;  2PVO D;  3P4Q B;  1B9R A;  1E6E B;  3DWM A;  1QLB B;  2FBW B;  4ZOH C;  3NS1 A;  4A9A A;  2BS3 B;  4C7Z A;  2W3S A;  2Q5W D;  3BII D;  1VDV A;  3AE8 B;  2L52 A;  4HRO A;  3W9C B;  1RM6 C;  3W5U B;  1WWT A;  1QT9 A;  2B76 B;  2K9X A;  5EE0 A;  1TKY A;  2DBY A;  3AE5 B;  3AEC B;  3P4R B;  3VRA B;  1ZXI A;  3SR6 A;  3HRD D;  1A70 A;  2M56 B;  2W3R A;  1DOI A;  2WDR B;  4IDI A;  5G5G A;  2QJL A;  3AEF B;  2MJE A;  5AUK A;  4YXD B;  4YTM B;  1OFF A;  3WCQ A;  5MPO A;  4WWM A;  1RYJ A;  1NYR A;  2WP9 B;  1T3Q A;  3EUB 2;  1YQ4 B;  5EE9 A;  4YT0 B;  5H8Y E;  3AE1 B;  1QOB A;  4US9 A;  2ACZ B;  1JWB D;  3W5V B;  1RFK A;  3HUI A;  1N62 A;  1J7B A;  3CWI A;  1N5X A;  5H92 C;  2WS3 B;  1CJE A;  4N58 A;  1E10 A;  2L83 A;  3AH7 A;  3AV8 A;  1PFD A;  4C80 A;  2K22 A;  1V8C A;  3AEB B;  3PO0 A;  1KF6 B;  1VJK A;  1FRD A;  1JWA D;  3AED B;  5G5H A;  4JWU C;  1DOX A;  3NVV A;  1J7A A;  1ZP0 B;  1FFV A;  1FRR A;  1V97 A;  2PVG C;  3L4P A;  2W54 A;  2K5P A;  1NEN B;  1ZUD 2;  2H89 B;  1I7H A;  1KFY B;  3AE7 B;  4C7Y A;  1N63 A;  1XLP A;  3ABV B;  3SFD B;  1N61 A;  3LXF A;  1TKG A;  2H88 B;  2WLB A;  2WDQ B;  1QOG A;  3FC4 A;  1TJE A;  1NYQ A;  1L6V A;  5GXG B;  1WRI A;  1AWD A;  1E7P B;  4YSZ B;  4US8 A;  1JAL A;  1QF6 A;  2KMM A;  3AMZ A;  2DWQ A; 
#chains in the Genus database with same CATH topology
 4B9K A;  3NZS A;  3AE6 B;  3RN9 C;  1FM0 D;  1XCT L;  2ZNV B;  3VR8 B;  1K8R B;  2M19 A;  1MFW A;  2KN4 A;  3H7P A;  1TS2 A;  3NRZ A;  1L5P A;  4XC2 A;  1C4P A;  3L0W B;  2OHF A;  3CIR B;  3TEY A;  2BWF A;  1IGC A;  1IUE A;  3WAM A;  2QIE B;  3AE9 B;  2N0S B;  3WAP A;  2RDG A;  1C77 A;  2MJD A;  4M02 A;  1UD7 A;  3IBE A;  3FAH A;  1RLF A;  4FXC A;  1KM7 A;  1UWX A;  2MEK A;  2PVO D;  2BVC A;  2D3G A;  2FBW B;  2JZZ A;  1P9D U;  4HPL B;  2FCQ A;  2NVU I;  2XK5 B;  3VQI A;  1WWT A;  3VHT C;  3AEC B;  5IAA C;  1ZXI A;  3A4S C;  1HA5 A;  3VH3 B;  2KVR A;  2V1Y A;  3AEF B;  3EFC A;  1WI0 A;  5D2M B;  1T3Q A;  2ZZP B;  4B0E A;  2L32 A;  4DXF A;  4IW0 A;  3TEZ A;  5L95 C;  5H92 C;  2WS3 B;  1HTO A;  1PFD A;  3DBS A;  1DOX A;  1FCC C;  3ENE A;  1V97 A;  4ZYS A;  1GOZ A;  4GDL A;  2LMC A;  3APD A;  1ZUD 2;  1XD3 B;  2VRR B;  2BYE A;  2INC C;  1WM3 A;  3H1U A;  2YEP F;  5BYS A;  2KTR A;  5L83 A;  4C00 A;  1WR1 A;  3VH4 B;  1XO3 A;  1GJZ A;  2DYO A;  2AQ1 B;  2V3P A;  4XZ4 A;  2IGG A;  4GDK A;  4AOF A;  2G3Q B;  1JML A;  4KVG B;  3RZW C;  1N60 A;  1WXS A;  3CF6 E;  3L13 A;  3VTW A;  4MEL A;  1AYF A;  1EO6 A;  2GBK A;  2KO3 A;  2ZCC A;  2BBC A;  1EWC A;  2DZJ A;  4M01 A;  4MH8 A;  1CZP A;  2NS5 A;  4DXA B;  1WGK A;  2Z0D B;  3HK0 A;  2D10 A;  1YJJ A;  2WXH A;  1GB4 A;  3B2F A;  2WX1 A;  1EF1 A;  2ZCB A;  4P1C C;  1ZXH A;  1XLQ A;  3MC8 A;  1IBX A;  1T0Q C;  4ZRK A;  1S3S G;  3U7Z A;  5LNK 1;  4A90 A;  3Q3O C;  3M62 B;  1E8X A;  2JWU A;  5CHF A;  4L23 A;  2KX3 A;  3PLU A;  3PRP B;  1JWS D;  2QHO A;  2WXO A;  2KVZ A;  5I4D A;  2IND C;  2BKR B;  1OGW A;  3EGR A;  2ACZ B;  2JXT A;  4WQO B;  4AWJ A;  1CJE A;  2A5U A;  3QJZ A;  5HFY A;  4HKZ E;  2K6Q A;  1TS3 A;  4JWU C;  2K6D B;  2K3U A;  3R2I A;  4FJZ A;  4MGI E;  2KTF A;  3AE7 B;  1I7H A;  2FUH B;  2A4Z A;  4IM3 A;  4WJQ A;  3ABV B;  2MX2 A;  3VXW A;  2UU7 A;  1TKG A;  4IOI E;  4YSZ B;  5JHA A;  3W1S A;  2HDE A;  2KK8 A;  3C8Y A;  3ZXR A;  5LLI A;  1NBF C;  4NNJ B;  4WAA A;  1L6U A;  2KYW A;  2NPT A;  3M3J A;  4NQL B;  1JRU A;  5FK9 C;  4IUM B;  1SE9 A;  2ZW0 A;  4ICU A;  3L10 B;  5IKC M;  2JF5 A;  3Q8E A;  3SFE B;  3GE8 C;  1FNV A;  4BBN C;  5IN7 A;  1ZOY B;  3VR9 B;  3ECI A;  2GBN A;  2GOW A;  3KYD D;  3ZJT A;  5DPR A;  1C3T A;  1QQR A;  3BWU D;  4AUQ C;  2L0F A;  2MHJ A;  1UH6 A;  5EE1 A;  4ZHP A;  4IKG A;  1WGY A;  1EWY C;  1P98 A;  1DYQ A;  1NEK B;  5FKA C;  1V80 A;  2AEH A;  2PE9 A;  4W9C A;  1SE4 A;  4YSX B;  2UWQ A;  1WSP A;  2MBQ A;  3P4Q B;  1C76 A;  1QLB B;  1A5R A;  1VD2 A;  3O65 B;  3KH0 A;  2KQS A;  3LDZ E;  1M94 A;  3Q3N C;  4UDU C;  2L3Z A;  2PE6 B;  3BIN A;  5D3I B;  5CTR C;  5CX3 A;  4W9L A;  2KDM A;  3BK2 A;  3JVZ X;  4BKS A;  3I63 C;  1YMH E;  3UIN B;  3CMM B;  3WAO A;  3AU4 A;  3A1Q A;  4K3C A;  3A9K B;  2J0J A;  2KKC A;  1WZ3 A;  2K39 A;  1XF5 L;  3TL5 A;  3I57 A;  4F1S A;  1ESF A;  1LXD A;  2IPK D;  3AUL A;  2CHW A;  2JRH A;  1WXA A;  3HIZ A;  3NZU A;  4AJW A;  2LHD A;  1V9J A;  1ZP0 B;  3VVW B;  1F2R C;  1V86 A;  2JPH A;  4GB9 A;  4W9K A;  3SHQ A;  4FLH A;  4NJ7 A;  4WWN A;  3JSV A;  5AZH A;  4LCD E;  4CQN A;  3AI5 A;  3B1L X;  1EF5 A;  2Y5P A;  4TV3 A;  1DOY A;  2ZNV C;  1ZGU B;  1GG3 A;  4BOS C;  2CU3 A;  4J6I A;  4W9D A;  4P16 A;  4YWG G;  2O2V B;  1KJT A;  1EUV B;  1JRP A;  4A3O A;  1YN4 A;  2LHE A;  3X23 A;  1XLO A;  3AN1 A;  3T3O A;  2PLP A;  3VTU A;  4ANU A;  2ZVN A;  3ZNZ B;  2KJH B;  1OTR B;  2DYB A;  5BMI A;  2LVQ A;  2GBR A;  2WXP A;  3PT2 B;  2IGH A;  3AEG B;  1G6J A;  3QX1 A;  2WGS A;  5J17 A;  1R7S A;  2JZ3 B;  1I4G A;  2WDT B;  1HEZ E;  4FUL A;  1YD8 U;  1OQQ A;  2KMC A;  1J8C A;  2J53 A;  1T0Y A;  3KQ4 A;  3ZYY X;  3SD5 A;  3AEE B;  3H7P B;  2MH7 A;  4RMA A;  3DBH I;  3B0A A;  2L0T A;  3BII D;  1R4N B;  1V2Y A;  1IGD A;  2EEL A;  4PS3 A;  1E8Y A;  2D3B A;  3NS8 A;  1BT0 A;  5MPO A;  3RT3 B;  4L1B A;  1EM7 A;  3EUB 2;  2PMV A;  5EE9 A;  2FCN A;  3DBR I;  4MJS A;  2RSU A;  1N5X A;  1SIF A;  3Q3F A;  5J18 A;  4CYE A;  3QHT A;  2C7H A;  1FRR A;  3L17 A;  2ON8 A;  4HJK A;  4B95 A;  1KFY B;  4HPM B;  2I2Y A;  4KZ0 A;  3PSE B;  2NMQ A;  2C60 A;  1E7P B;  1WGH A;  2N9K A;  4KDL B;  3U30 A;  1AN8 A;  2W9N A;  2LVP A;  3OAW A;  3P42 A;  1STE A;  3JW0 X;  4FBJ B;  1WXQ A;  1F9J A;  4JWS C;  1SB3 C;  2IO3 B;  1E7V A;  4KV2 A;  3ZGZ A;  2OED A;  3EHV A;  4LTU A;  4K81 A;  4PS7 A;  2LD9 A;  2WU5 B;  1YJ1 A;  4EZK A;  4E3C A;  1FIQ A;  3P4S B;  1NI3 A;  2KTR B;  1QOF A;  2NBU A;  1CK1 A;  4K7W A;  2PW9 A;  2HTM E;  5HG2 A;  1NI2 A;  4TMA B;  1VLB A;  1MJD A;  4GDK B;  4M0W A;  1TKE A;  3V6C B;  3NZ3 A;  3R2T A;  4HCP B;  3R7Q A;  2NR2 A;  2W82 A;  4F7Z A;  2DHZ A;  3NS1 A;  2BW2 A;  1WJ6 A;  2N9L A;  2LGD A;  2DZI A;  3PTF C;  3ZNH B;  3VTV A;  4HEA 1;  3VRA B;  3N20 C;  5EDS A;  3MP9 A;  2W3R A;  2JWZ A;  1HQR D;  2QMT A;  3R7R A;  1RYJ A;  1NYR A;  2K25 A;  2KMA A;  2C5L C;  3WAN A;  3Q3M C;  3Q6B A;  2AYO B;  4MGZ E;  1MPE A;  1WX9 A;  4HLE A;  1J7B A;  2BQQ A;  4WH4 A;  3S2A A;  2PJH A;  4LNO A;  1WE7 A;  3BVZ A;  4BZA A;  1WRD B;  4XWT A;  1D4B A;  2N4F A;  1NEN B;  1QZE A;  3K9P B;  5CHV C;  2WDQ B;  4QAY A;  3PGE A;  1WY8 A;  2EMS A;  4DHZ B;  3QQ8 B;  3RD2 A;  4PK1 A;  2MP2 A;  5DCN A;  4W9F A;  4D2K A;  1TYG B;  2KZR A;  1ZPS A;  2RR9 A;  1TTN A;  4EUT A;  3UGB B;  1UGM A;  3UF8 A;  5T8I A;  1GC7 A;  4JX1 C;  3M95 A;  1C9F A;  4ARC A;  4MGK E;  5DPW A;  3LJ3 A;  4USA A;  3KUC B;  4DHJ B;  4KX6 B;  4MH0 E;  5AUI A;  3H6N A;  4REZ A;  4NPN A;  3AM9 A;  1FXA A;  3DVN U;  3RZF A;  3W2D A;  3W1Y A;  2BPS A;  2CJO A;  3ZNI D;  2BF8 B;  2WXJ A;  2NPT B;  1PYW D;  3E56 A;  2MW5 A;  2JQR B;  1L7Y A;  3MFG A;  1I35 A;  1C4C A;  2QCZ A;  3BK1 A;  2FIF A;  4KZC A;  3HVD A;  2LJ5 A;  2FCS A;  1TY2 A;  4TUU A;  1MVK A;  3QC8 B;  4HPP A;  3NY5 A;  5JXV A;  4AJY B;  2O6V A;  2N7J A;  4YT0 B;  2QC8 A;  4IWQ A;  4TQ0 A;  1U4A A;  2LGX A;  3HUI A;  2ZJD A;  3Q2A C;  4YL8 A;  4LNF A;  2Y5B B;  2WNM A;  3PV1 A;  2AQ2 B;  1WF9 A;  1FRD A;  5JZE B;  4HWI B;  3NG0 A;  4PT5 A;  2PVG C;  4OZA A;  4A55 A;  1BML C;  2DX5 B;  2V4L A;  5G2N A;  4KIK A;  2AL6 A;  2KN5 A;  3R8B A;  1TJE A;  3EC8 A;  3NJT A;  4II3 B;  2KJ6 A;  4BKG A;  4OVU A;  1QIL A;  3B08 A;  3A1Q B;  2M17 A;  4WJP A;  1D3Z A;  3WIM A;  1F52 A;  3NHE B;  1E7U A;  1E0Z A;  3GOE A;  3OJ3 A;  2RMM A;  4TKN A;  5C3J B;  1WJ4 A;  4RGT A;  4P1B C;  2KFK A;  1R4M I;  1OEY A;  1WR6 E;  1E8W A;  1WX8 A;  3BY4 B;  3PZ8 A;  3H7S A;  2G4D B;  2WQY B;  3DQV A;  3JSV B;  2D2Q A;  3L54 A;  1WM2 A;  1LM8 B;  2LVO A;  2V9H A;  3A4R A;  3IAM 1;  3B2G A;  4G0N B;  1QKZ A;  1VR9 A;  3DWM A;  2BS3 B;  2LXA A;  1SE3 A;  1T6B X;  1SBB B;  3SU8 X;  3ZXV A;  3SEB A;  5BMG A;  2K9X A;  5EE0 A;  2JVC A;  2DBY A;  2VH1 A;  4L2Y A;  5KHO A;  1I4X A;  2D11 A;  3I9V 1;  2QSD A;  1OFF A;  3TSS A;  4K7S A;  5G55 A;  5AZG A;  3N1Y C;  1NDD A;  3CWI A;  4ASW C;  3MJ5 A;  1KF6 B;  3AED B;  1JWA D;  4WWP A;  5C23 A;  3E9S A;  2KWD A;  1SJE D;  2K5P A;  1KLU D;  4BKT A;  2R61 A;  3ZUN A;  5IO9 A;  1OQY A;  1I4R A;  3BZD B;  3MC0 B;  5C2T B;  3RFZ B;  2LXC A;  2WDV B;  3KWL A;  2DNF A;  2ONQ A;  2QDF A;  1H8C A;  1IPG A;  2PEA A;  2LI5 A;  5KHQ A;  1YQ3 B;  1C1Y B;  1D6E C;  4I6L B;  4FN2 A;  1QOA A;  1E5W A;  3P1M A;  2V0G A;  1WIA A;  4P6V F;  5HKH A;  4HK2 A;  5IOI A;  2GRI A;  4WWO A;  3OWE B;  2KXJ A;  4JIO U;  1UBI A;  2C7M B;  1WMH A;  2V3S A;  3T9L A;  3RUI B;  4A6Q A;  2OOB B;  1GPX A;  2ASQ A;  1V1P A;  3Q8A A;  1ZKH A;  3RNB C;  3D32 A;  3R66 C;  4K3B A;  2HTH A;  2HE7 A;  1UZX B;  2HJ1 A;  1BXT A;  2K8H A;  3W9C B;  2QEJ C;  4ANW A;  1X1M A;  2KQ7 A;  1ZE3 D;  1V49 A;  4IDI A;  2ZW1 A;  2J42 A;  5AUK A;  1GUA B;  3QWZ B;  2WP9 B;  1C4A A;  3KWV A;  1L4D B;  2IO2 B;  3FKY A;  1C79 A;  4M0W B;  2KWC A;  3KYC D;  4N58 A;  2Y3A A;  1VRA B;  2MBB B;  2WXQ A;  1VJK A;  2BYF A;  1YN3 A;  3N32 A;  3T3N A;  1P1A A;  3SFD B;  2J4X A;  3IAS 1;  3LXF A;  2H88 B;  4FJV B;  4OHJ A;  4XDD A;  5HHD G;  2WXK A;  1WRI A;  2M0X A;  5IP4 D;  2IO1 B;  2KMM A;  2WXN A;  2BYT A;  1K51 A;  4TQ1 A;  4M00 A;  1TIF A;  2L05 A;  3ZJU A;  1PDX A;  4C4V A;  1L4Z B;  2Z59 B;  1SEB D;  4LDT B;  4W9I A;  1WGD A;  1V6E A;  4RH6 A;  2JYT A;  4W9E A;  1VZ8 A;  2MBO A;  1L0V B;  2YEP B;  4RM9 A;  1SIJ A;  3UI3 A;  1UNS A;  3W1S C;  4YTP B;  2K8B A;  3PRZ A;  2VZK B;  1VZ6 A;  2NCN A;  4NAM A;  3AE4 B;  2MP2 B;  4MAC A;  4C56 C;  4N9F 4;  5LXI B;  3ETR A;  4F8C B;  2PKO A;  3QCA A;  3DBH B;  3NVY A;  4YSY B;  1FCL A;  5DPT A;  1L0Y B;  4G50 A;  4KKI A;  3I3T B;  4ICV A;  2WXM A;  1PUT A;  3ZDT A;  4LNI A;  4S0R A;  1MHH E;  4HCN B;  1JWM D;  2W3S A;  3ONS A;  1SSN A;  4KSL C;  3UIO B;  3RNF C;  3AE5 B;  3DBR B;  4PS8 A;  1YX6 B;  4II2 B;  1UGJ A;  2DLB A;  2RDH A;  1T0R C;  1PQS A;  3TJP A;  1VCB A;  1I4H A;  2WYQ A;  3W5V B;  1TBE A;  2I1J A;  1N62 A;  4E74 A;  1FXT B;  4HKQ A;  2HJ8 A;  4EZJ A;  4C80 A;  3SDL C;  1EU4 A;  1XEE A;  3L4P A;  2JY6 A;  2KC1 A;  2WXG A;  2CHX A;  2GLS A;  4FJY A;  1JAL A;  1FD6 A;  1Z5S B;  3APC A;  2SEB D;  3Q3J A;  4GSW A;  1ZW7 A;  2O6V B;  3Q8F A;  3ZNG C;  3I5J C;  4XE0 A;  2GI9 A;  2MBE A;  4GOC A;  1FFU A;  2MJ3 A;  1YIW A;  4W9G A;  1YN5 A;  2J0M A;  2G9H D;  1CMX B;  1JQ4 A;  3RUL A;  3L08 A;  2D3C A;  1S1Q B;  2WXF A;  4KIK B;  2NTS A;  3NVW A;  1KLG D;  1J7C A;  1N5W A;  4GMV A;  1M4V A;  4DXG A;  4KGR A;  1YOV B;  1LGR A;  2JSV X;  3P4P B;  3HVZ A;  2M0A A;  4MM3 A;  2BB6 A;  4JE3 B;  2BS2 B;  3TUO A;  2WU2 B;  5CHW A;  4GDL B;  3MHZ A;  3VDZ A;  3IXS A;  1E90 A;  2AQ3 B;  5AZF A;  2KFK B;  1WZ0 A;  4EOY A;  2Q5W D;  4NQK E;  2L1A A;  2V4I B;  2Z0E B;  1V81 A;  2N7E A;  1MG4 A;  3N30 A;  1HTQ A;  2N1W A;  4WWM A;  3GP7 A;  4E71 A;  4PYU A;  4MSM B;  4DHJ D;  1N6Z A;  4MT5 A;  2K22 A;  3ZTC A;  1J0G A;  1YQB A;  3NVV A;  3PRE A;  3HM3 A;  2KLC A;  1MG8 A;  3NOB A;  3FC4 A;  4ARI A;  1YX5 B;  4IM0 A;  1IBX B;  2DWQ A;  4CO7 A;  2N9P C;  4IWO A;  2G45 B;  2L8J A;  2WXL A;  3M63 B;  2REX A;  2OJR A;  2RGF A;  4AS1 A;  5EE3 A;  5DPS A;  1WYG A;  3NVZ A;  4R3D A;  4G3X B;  4FHJ A;  2IDY A;  2IO0 B;  3RPF C;  1ZDX A;  3EEC A;  3P63 A;  4MSQ B;  3U4E G;  3U8Z A;  2FNJ B;  5D7G A;  1WGR A;  4I6N B;  2G1E A;  2RPQ A;  2WX0 A;  4HVB A;  4BFR A;  2L7R A;  4GGQ A;  1YJI A;  2J7Q B;  5BYR A;  1VZ7 A;  1Y56 A;  4MDK E;  2Y5C A;  1WJU A;  4BVU C;  3VUX A;  2FAZ A;  3APF A;  5LXH A;  3T8M A;  1AW7 A;  3DVG X;  1BUI C;  4ACF A;  4A3P A;  4XX5 A;  2LWP A;  4BKS D;  4XDC A;  2LFI A;  5E6J A;  3TEW A;  2GBM A;  1UBQ A;  2BWE S;  4S17 A;  4DHZ E;  2L52 A;  4RM8 A;  4GXB A;  1QT9 A;  3IT4 B;  3PVL A;  3TIX A;  4RGM A;  2ZEQ A;  4NJ6 A;  3C0R B;  3U2S C;  2DEN B;  1WMH B;  1SXT A;  5H8Y E;  3QK0 A;  4LJP B;  1QOB A;  4LNN A;  1AAR A;  2LRU A;  3GZN I;  2CS4 A;  2RD0 A;  5D6J B;  1V5T A;  1V1P B;  1EU3 A;  3FIL A;  2JYE A;  3HM6 X;  1XT9 B;  4XYC A;  1J7A A;  2L76 A;  4RGO S;  3ZTD A;  1Q0W B;  4OZC A;  3DCG A;  4C7Y A;  4OZB A;  1XLP A;  4OVZ A;  3PRM B;  2RPV A;  2MLB A;  4FAD A;  5J2R A;  3MTN B;  1F2R I;  1P7F A;  3RNC C;  4JL9 A;  2XNA C;  1V5O A;  2G4S A;  2NBV B;  3Q14 C;  2N1V A;  1P3Q U;  4DQO C;  3RNG C;  3OLM D;  3DBL I;  5E6P A;  2M8S A;  1R4M B;  3KVF B;  2KAJ A;  4DBG A;  1T0S C;  4HJG E;  3VRB B;  1UUP A;  3ZJV A;  2IBI B;  2LRW A;  1MHX A;  3ZKJ C;  1WXV A;  5JHB A;  1I42 A;  1F77 A;  1LQB A;  1P0R A;  2KJR A;  3QA8 A;  2TSS A;  1E9M A;  3Q8B A;  1WFY A;  4ZHO A;  2NBW B;  3ALB A;  2ZPY A;  3DHG C;  3IVF A;  3AEA B;  4N6E B;  2KAC A;  2MCN B;  1PGX A;  4DWF A;  4C4V B;  2AX5 A;  2IGD A;  4XWW A;  3N1Z C;  2IJ0 A;  4JGH B;  2DYM A;  5C1Z A;  5GMV A;  2PIA A;  3DOW A;  2WWZ A;  1WGG A;  1E6E B;  4ZOH C;  4WUR A;  5AEK B;  3IT6 B;  4W9J A;  3V6E B;  2XN9 C;  4NAW A;  1VDV A;  3N1X C;  1JCK B;  4NJC A;  1RM6 C;  4AP4 C;  2N9E B;  3PZ7 A;  1TKY A;  5IA7 A;  3L16 A;  2M56 B;  1K50 A;  4RNA A;  4YTM B;  2INP E;  1RAX A;  1IYF A;  4J3O D;  4JPS A;  4ZRI A;  3ZRC A;  3AE1 B;  5BMH A;  2Z8L A;  2K8C A;  1FPY A;  2C7N B;  1JWB D;  1GNU A;  1HXY D;  2MRP A;  4EEW A;  4EE2 A;  4P7I A;  4URK A;  2GB1 A;  3DPD A;  1D5X C;  2HD5 B;  3MC9 A;  1N63 A;  1I4Q A;  3TEX A;  2E6X A;  1HZ6 A;  3QIJ A;  1GC6 A;  4HRS A;  1SE2 A;  1KTK A;  2W55 A;  4HDQ A;  1ISN A;  1H4R A;  2EMT A;  3PZD A;  1XQQ A;  4ITK A;  3BVM A;  3H9D A;  3A9J A;  3A33 B;  3HHM A;  2XBB C;  3VFK A;  4ZDV A;  4WJO A;  2B3A A;  1FEH A;  1UEL A;  3ZW3 A;  1J19 A;  1SJH D;  1JRO A;  2CJN A;  3ZQ4 A;  3ZVV A;  3B9J A;  2MWS B;  3EA6 A;  1UF0 A;  4MJS B;  2I38 A;  4JLC A;  4X57 B;  1YNT E;  3V05 A;  4EZL A;  1L0X B;  1HE8 A;  2IY1 B;  4I6P A;  3KW5 B;  1NVI D;  3RYT A;  3TMP B;  3RCZ A;  3OJ4 B;  4HRO A;  1WX7 A;  3H8H A;  4WIP A;  3P4R B;  1K53 A;  4K7U A;  3SR6 A;  2FCM A;  1A70 A;  4YXD B;  2KD0 A;  2XEW A;  4LDT D;  1FNW A;  1Q5W B;  5D94 A;  3WAL A;  1T5X D;  2KNB A;  4MM3 B;  1ET6 A;  1SGH A;  2SAK A;  1RFK A;  3MJW A;  4NY0 A;  1D5Z C;  3AH7 A;  3X0W A;  3ZDM C;  2VZK D;  3AEB B;  5FR6 A;  2DZM A;  2ICI A;  4DDG D;  1XXG A;  1FFV A;  4RCO A;  2JUO A;  1WH3 A;  3Q69 A;  2H89 B;  2CU1 A;  4LLG M;  3ML9 A;  3PHX B;  1QOG A;  4US8 A;  1RFA A;  1NYQ A;  5GXG B;  1AWD A;  2JRI B;  4KGS A;  3PPA A;  3O13 A;  4NZL B;  1OEY J;  2KQ4 X;  4CHK A;  3VUY A;  4A20 A;  4FHK A;  5FR3 A;  1MI0 A;  1FXI A;  1GB1 A;  2ZPN A;  1B1Z A;  2GBJ A;  4YTN B;  1XLN A;  1F1H A;  3K9O B;  3NUH B;  2OJW A;  4B0M A;  4OVV A;  4W9H A;  4Q2J A;  1Q10 A;  2LEK A;  5E6N A;  1TT5 B;  3GB1 A;  2X8X X;  4GU2 A;  4BBN F;  4IWP A;  4O1N A;  2QIL A;  3AB5 A;  1KH0 A;  3IG3 A;  3QAQ A;  2XK5 A;  4ZRJ A;  4DK5 A;  4GLS C;  4PYZ A;  2N7D A;  4M8M A;  2DZK A;  1KOT A;  2DAF A;  2E3T A;  3ZO5 B;  4N59 A;  3KUZ A;  3CSF A;  3IFW B;  3ZLZ A;  2IY0 B;  2EKI A;  3PHW B;  2BT6 A;  1GAQ B;  2LUE A;  4A8X C;  1ROE A;  4B6W A;  4JQW C;  2DAJ A;  2J0K A;  4MEM A;  1DGJ A;  3N3K B;  1RWS A;  1P7E A;  1V1O A;  3PLV A;  3JYU A;  2O6V D;  1XCQ L;  5JH5 C;  3WA0 A;  2CR5 A;  2M4N A;  1LFD A;  2C9W B;  2PTL A;  2B76 B;  2BTE A;  4KDI C;  2BKF A;  5E6O A;  3DDC B;  2WDR B;  1KLV A;  2MJE A;  4G11 A;  3WCQ A;  1TZO A;  2BGF A;  2M1M A;  2J52 A;  4RFB A;  2KHW B;  4ZRP A;  2INN E;  3P2B A;  2D5G A;  2UYZ B;  1CQV A;  4WJN A;  2FUG 1;  2MBH A;  3CST A;  3UIP B;  3PO0 A;  4EFO A;  1ZDV A;  2K1F A;  3U7D A;  2EKE C;  2W54 A;  2YLM A;  4DDI D;  2VH2 A;  4RF0 A;  2FE8 A;  4M8N A;  3ZIM A;  3C19 A;  5TR5 A;  1N61 A;  1ACC A;  2WLB A;  3DHH C;  2KFJ A;  2V3N A;  1TS5 A;  3AMZ A;  3DVG Y;  3LYY A;  3ML8 A;  1WXM A;  1F0Z A;  3DWG C;  2GMI C;  1KRH A;  4IG7 B;  3UQA A;  2IYD B;  4FA6 A;  4GN1 A;  3UQB A;  3FIL B;  1TY0 A;  2WXI A;  3RNE C;  1PGB A;  1RRB A;  2KDI A;  2BB5 A;  3U52 E;  3Q8C A;  4WQM A;  2BS4 B;  1JWU D;  2MA9 B;  2AWT A;  2WXR A;  2KT7 A;  2WHI A;  1JW9 D;  1LO5 D;  4ZRQ A;  1WE6 A;  3RNA C;  1C78 A;  2JXX A;  3VAW A;  2AL3 A;  1B9R A;  2JT4 B;  1Q1O A;  4A9A A;  4LK0 M;  3AE8 B;  3PS6 A;  3W5U B;  4H2A A;  5HI1 A;  3V60 A;  2KDF B;  2FID A;  3HRD D;  2D3A A;  2D07 B;  1R4N I;  2LAS A;  4KGT A;  2LUM A;  4K1R B;  2BYV E;  1YQ4 B;  4US9 A;  3V62 A;  4RGN A;  2R2Q A;  3EFU A;  5TSS A;  2L83 A;  3AV8 A;  2KOX A;  4ZYN A;  2RDB C;  5G5H A;  4KSK C;  4MGY E;  4GIV A;  4NAW B;  3N9Y C;  1TS4 A;  3KUD B;  1Z2M A;  1QF6 A;  3V61 A;  3AE3 B;  1D5M C;  1ENF A;  1PGA A;  3RMK C;  3J9C A;  2YVC A;  3ZRF A;  2K0P A;  1E8Z A;  2CKH B;  4HXD A;  1OQR A;  2JX5 A;  1IP9 A;  3AE2 B;  4IC7 B;  4HDO A;  3IHP C;  3TBL D;  2IZV B;  3BYT B;  3BYY B;  1TGZ B;  2KAN A;  2NTT A;  3KLS X;  4AQ7 A;  1WYW B;  1FMA D;  2KLG A;  3RI7 C;  1UWM A;  1HZ5 A;  1FNU A;  1SF0 A;  1Y8R C;  2KWU B;  1WJN A;  1FO4 A;  4WAF A;  2KDB A;  4ANX A;  5BYQ A;  3VUW A;  4EKU A;  2JU6 X;  3A9K A;  3AXC A;  3GS2 A;  2KC2 A;  3A9J B;  3LB8 C;  2KX0 A;  3DHI C;  1K52 A;  2MQJ A;  3DVN V;  2KWV B;  1ET9 A;  4XGA B;  2I1K A;  2CHZ A;  4TSS A;  1L2N A;  4C7Z A;  4LNK A;  5D3D A;  1I4P A;  3V3X A;  3TCA A;  2R2O A;  4KKJ A;  3GZN B;  1DOI A;  2KDE B;  4IM2 A;  5G5G A;  2QJL A;  4BOZ B;  4OW0 A;  2N9X A;  2PPH A;  2L00 B;  3BVG A;  2JZP A;  4RF1 A;  3MHS D;  5BO4 B;  4BAX A;  2O2V A;  3R3M A;  1E10 A;  3AU5 A;  1V8C A;  2MSE D;  2LJI A;  4ANV A;  3GE3 C;  2X38 A;  2ZVO A;  2LGY A;  2LZ6 A;  4LJO B;  2LGI A;  1L6V A;  3URY A;  3QAR A;  1TZ1 A;  3DBL B;  2LGS A;  3OG5 A; 
#chains in the Genus database with same CATH homology
 1SE2 A;  1KTK A;  2W55 A;  3ZJU A;  1AN8 A;  1PDX A;  3AE6 B;  1FM0 D;  1XCT L;  4ITK A;  3BVM A;  1L4Z B;  3P42 A;  3VR8 B;  1STE A;  1WXQ A;  2M19 A;  1SEB D;  4JWS C;  2KN4 A;  1SB3 C;  1TS2 A;  3ZGZ A;  2OED A;  3NRZ A;  4LTU A;  1FEH A;  1L5P A;  4RH6 A;  2JYT A;  2WU5 B;  1C4P A;  1VZ8 A;  2OHF A;  1L0V B;  1SJH D;  2YEP B;  1SIJ A;  1JRO A;  3UI3 A;  1UNS A;  1FIQ A;  3CIR B;  4YTP B;  2CJN A;  3P4S B;  3TEY A;  1NI3 A;  3ZQ4 A;  3B9J A;  2VZK B;  1VZ6 A;  1QOF A;  1CK1 A;  4NAM A;  2PW9 A;  1IGC A;  1IUE A;  3EA6 A;  2HTM E;  3AE4 B;  5HG2 A;  4MAC A;  2QIE B;  4C56 C;  2I38 A;  4TMA B;  1VLB A;  3ETR A;  3AE9 B;  2N0S B;  2PKO A;  1YNT E;  2RDG A;  3V05 A;  3NVY A;  4GDK B;  1L0X B;  4M0W A;  4YSY B;  1C77 A;  2MJD A;  1FCL A;  1L0Y B;  3FAH A;  1TKE A;  4KKI A;  3NZ3 A;  3R2T A;  2WXM A;  4FXC A;  1PUT A;  1UWX A;  2W82 A;  1NVI D;  2MEK A;  2PVO D;  2FBW B;  3NS1 A;  1MHH E;  2BW2 A;  1JWM D;  2N9L A;  2W3S A;  4HRO A;  1SSN A;  3VQI A;  1WWT A;  3H8H A;  3AE5 B;  3AEC B;  4WIP A;  3P4R B;  4HEA 1;  3VRA B;  1K53 A;  1ZXI A;  3SR6 A;  1HA5 A;  1A70 A;  1UGJ A;  3MP9 A;  2W3R A;  2DLB A;  2RDH A;  3AEF B;  4YXD B;  1HQR D;  1FNW A;  2QMT A;  1RYJ A;  1NYR A;  1T3Q A;  1T5X D;  4B0E A;  1I4H A;  4MM3 B;  1ET6 A;  2L32 A;  1MPE A;  2SAK A;  4DXF A;  3W5V B;  1RFK A;  1N62 A;  1J7B A;  3TEZ A;  5H92 C;  2WS3 B;  4HKQ A;  1D5Z C;  3AH7 A;  4WH4 A;  1PFD A;  4C80 A;  2VZK D;  3AEB B;  2ICI A;  1EU4 A;  1DOX A;  3BVZ A;  1FCC C;  1XEE A;  1XXG A;  1FFV A;  1V97 A;  3L4P A;  4RCO A;  4ZYS A;  1GOZ A;  2WXG A;  4XWT A;  2LMC A;  1D4B A;  3Q69 A;  1NEN B;  1ZUD 2;  2H89 B;  4LLG M;  2YEP F;  2WDQ B;  1QOG A;  4US8 A;  1NYQ A;  5GXG B;  5BYS A;  1AWD A;  1JAL A;  4KGS A;  1FD6 A;  2SEB D;  3O13 A;  4NZL B;  2KQ4 X;  1XO3 A;  3Q8F A;  4D2K A;  4XE0 A;  1TYG B;  2DYO A;  2GI9 A;  2AQ1 B;  2V3P A;  1FFU A;  5FR3 A;  1MI0 A;  1ZPS A;  1FXI A;  2MJ3 A;  1GB1 A;  2IGG A;  1YN5 A;  1B1Z A;  4YTN B;  1XLN A;  3NUH B;  2G9H D;  5T8I A;  1JML A;  4B0M A;  4JX1 C;  1N60 A;  1JQ4 A;  4Q2J A;  1C9F A;  1Q10 A;  2LEK A;  4ARC A;  3GB1 A;  1AYF A;  4USA A;  4O1N A;  2BBC A;  1EWC A;  2WXF A;  2QIL A;  3AB5 A;  4KX6 B;  1KH0 A;  2NTS A;  4MH8 A;  1CZP A;  3NVW A;  5AUI A;  4REZ A;  4GLS C;  1KLG D;  1WGK A;  1J7C A;  1N5W A;  3AM9 A;  1M4V A;  1FXA A;  1YJJ A;  4HRS A;  2WXH A;  1GB4 A;  3B2F A;  4DXG A;  4KGR A;  3W2D A;  2CJO A;  1ZXH A;  2E3T A;  1XLQ A;  4N59 A;  2WXJ A;  2JSV X;  3P4P B;  3HVZ A;  2M0A A;  1PYW D;  1IBX A;  2BB6 A;  2EKI A;  3E56 A;  4JE3 B;  2BT6 A;  2BS2 B;  1GAQ B;  2WU2 B;  3TUO A;  4A8X C;  1ROE A;  2JQR B;  3MHZ A;  4GDL B;  3MFG A;  1C4C A;  3IXS A;  1DGJ A;  3BK1 A;  1RWS A;  1P7E A;  2AQ3 B;  3HVD A;  3U7Z A;  1V1O A;  5LNK 1;  4A90 A;  1XCQ L;  2Q5W D;  1TY2 A;  2L1A A;  2V4I B;  1MVK A;  2JWU A;  2PTL A;  4L23 A;  2B76 B;  2BTE A;  1JWS D;  2WXO A;  5JXV A;  2WDR B;  5I4D A;  2MJE A;  3WCQ A;  4WWM A;  3GP7 A;  1TZO A;  2N7J A;  2J52 A;  3EGR A;  4YT0 B;  4RFB A;  4ZRP A;  4TQ0 A;  2INN E;  2D5G A;  2ACZ B;  1CQV A;  3HUI A;  2JXT A;  2FUG 1;  1CJE A;  4MT5 A;  2WNM A;  2AQ2 B;  2K22 A;  3PO0 A;  1ZDV A;  5HFY A;  4HKZ E;  1FRD A;  1TS3 A;  4JWU C;  3NVV A;  2K3U A;  4PT5 A;  2PVG C;  3R2I A;  4OZA A;  4A55 A;  2W54 A;  3AE7 B;  1I7H A;  4RF0 A;  2FE8 A;  1BML C;  3ABV B;  1N61 A;  1ACC A;  1TKG A;  2WLB A;  3FC4 A;  3R8B A;  4IOI E;  1TJE A;  4YSZ B;  4ARI A;  3W1S A;  2HDE A;  2V3N A;  1TS5 A;  3AMZ A;  3C8Y A;  2DWQ A;  1IBX B;  3LYY A;  1F0Z A;  1QIL A;  1L6U A;  3DWG C;  2WXL A;  1KRH A;  4AS1 A;  5EE3 A;  1WYG A;  5FK9 C;  3NVZ A;  4R3D A;  2IDY A;  1E0Z A;  3RPF C;  1ZDX A;  3U4E G;  2ZW0 A;  3FIL B;  3P63 A;  1TY0 A;  2WXI A;  2RMM A;  5C3J B;  3Q8E A;  5D7G A;  3SFE B;  4RGT A;  1FNV A;  1PGB A;  2G1E A;  1ZOY B;  3VR9 B;  2BB5 A;  3U52 E;  3PZ8 A;  3ZJT A;  1YJI A;  5BYR A;  1VZ7 A;  1QQR A;  2WQY B;  3BWU D;  3Q8C A;  4WQM A;  1Y56 A;  2BS4 B;  5EE1 A;  4ZHP A;  4IKG A;  2Y5C A;  1JWU D;  1EWY C;  1DYQ A;  1NEK B;  5FKA C;  2WXR A;  1AW7 A;  1JW9 D;  1BUI C;  1LO5 D;  4ZRQ A;  3IAM 1;  1SE4 A;  4XDC A;  4YSX B;  3B2G A;  2LFI A;  5E6J A;  3TEW A;  1QKZ A;  1C78 A;  1VR9 A;  1WSP A;  3P4Q B;  1B9R A;  1C76 A;  3DWM A;  1QLB B;  4A9A A;  2BS3 B;  4LK0 M;  3AE8 B;  2L52 A;  1SE3 A;  1T6B X;  4UDU C;  1SBB B;  3SEB A;  5BMG A;  3W5U B;  2K9X A;  1QT9 A;  3IT4 B;  4H2A A;  5D3I B;  5EE0 A;  2DBY A;  5HI1 A;  2KDM A;  3HRD D;  3BK2 A;  4L2Y A;  4RGM A;  1I4X A;  1YMH E;  3I9V 1;  2QSD A;  1OFF A;  3TSS A;  4KGT A;  3U2S C;  2LUM A;  1SXT A;  1YQ4 B;  5H8Y E;  1QOB A;  4US9 A;  4RGN A;  5TSS A;  1XF5 L;  3CWI A;  3I57 A;  1ESF A;  1V1P B;  2IPK D;  2L83 A;  3AV8 A;  3MJ5 A;  1EU3 A;  1KF6 B;  3FIL A;  2JYE A;  3AED B;  1JWA D;  5G5H A;  3E9S A;  2LHD A;  1J7A A;  1ZP0 B;  2KWD A;  1F2R C;  4RGO S;  1SJE D;  2K5P A;  1KLU D;  4NAW B;  3N9Y C;  4OZC A;  4C7Y A;  1TS4 A;  4OZB A;  1XLP A;  2R61 A;  4OVZ A;  2RPV A;  1QF6 A;  1I4R A;  3BZD B;  3MC0 B;  1F2R I;  5C2T B;  3AE3 B;  3RFZ B;  4CQN A;  1P7F A;  2WDV B;  1D5M C;  1ENF A;  1PGA A;  2XNA C;  3J9C A;  3KWL A;  2K0P A;  2Y5P A;  1DOY A;  2ONQ A;  2CU3 A;  4DQO C;  4P16 A;  4YWG G;  1OQR A;  1JRP A;  1YQ3 B;  2KAJ A;  2JX5 A;  1YN4 A;  2LHE A;  3T3O A;  1XLO A;  3AN1 A;  4HJG E;  2PLP A;  3VRB B;  3AE2 B;  1D6E C;  1UUP A;  3ZJV A;  1MHX A;  1QOA A;  3BYT B;  3BYY B;  3P1M A;  2V0G A;  1F77 A;  5BMI A;  4P6V F;  2NTT A;  3KLS X;  2GRI A;  2WXP A;  2TSS A;  1E9M A;  3OWE B;  4AQ7 A;  2IGH A;  3AEG B;  3Q8B A;  1FMA D;  4ZHO A;  1UWM A;  1HZ5 A;  1FNU A;  1SF0 A;  1FO4 A;  1R7S A;  4WAF A;  3AEA B;  4N6E B;  1I4G A;  2KAC A;  1HEZ E;  1PGX A;  5BYQ A;  2AX5 A;  2IGD A;  4XWW A;  1OQQ A;  2IJ0 A;  4A6Q A;  2JU6 X;  2J53 A;  2DYM A;  3GS2 A;  1GPX A;  3KQ4 A;  3ZYY X;  2PIA A;  3LB8 C;  1V1P A;  3Q8A A;  3AEE B;  1K52 A;  2MH7 A;  1ET9 A;  1E6E B;  4ZOH C;  4WUR A;  3IT6 B;  4TSS A;  4C7Z A;  2XN9 C;  3BII D;  1IGD A;  2EEL A;  1BXT A;  1VDV A;  1JCK B;  4NJC A;  3W9C B;  1RM6 C;  5D3D A;  1I4P A;  3V3X A;  3PZ7 A;  1TKY A;  2QEJ C;  4KKJ A;  2M56 B;  1ZE3 D;  1DOI A;  4IDI A;  1K50 A;  2ZW1 A;  2QJL A;  5G5G A;  2J42 A;  4RNA A;  5AUK A;  4YTM B;  5MPO A;  2INP E;  4OW0 A;  4L1B A;  1EM7 A;  4J3O D;  4JPS A;  2WP9 B;  3EUB 2;  1C4A A;  3KWV A;  2PMV A;  1L4D B;  5EE9 A;  3AE1 B;  3BVG A;  5BMH A;  2JZP A;  2Z8L A;  1C79 A;  4RF1 A;  1JWB D;  1N5X A;  4N58 A;  1E10 A;  1HXY D;  2Y3A A;  1VRA B;  1V8C A;  2WXQ A;  2LJI A;  1VJK A;  2X38 A;  4EE2 A;  1FRR A;  2ON8 A;  1YN3 A;  2GB1 A;  1D5X C;  1KFY B;  1N63 A;  2I2Y A;  3T3N A;  1I4Q A;  3TEX A;  2E6X A;  1HZ6 A;  3SFD B;  2LGI A;  2J4X A;  3IAS 1;  3LXF A;  2H88 B;  2NMQ A;  4OHJ A;  4XDD A;  5HHD G;  1L6V A;  2WXK A;  1WRI A;  1E7P B;  3URY A;  2KMM A;  2WXN A;  2BYT A;  1K51 A;  2N9K A;  4TQ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...