4JWUC

Crystal structure of cytochrome p450cam-putidaredoxin complex
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
106
structure length
106
Chain Sequence
SKVVYVSHDGTRRELDVACGVSLMQAAVSNGIYDIVGDCGGSASCATCHVYVNEAFTDKVPAANEREIGMLESVTAELKPNSRLCCQIIMTPELDGIVVDVPDRQW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for effector control and redox partner recognition in cytochrome P450.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Oxidoreductase/electron transport
molecule keywords Camphor 5-monooxygenase
total genus 29
structure length 106
sequence length 106
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4jwuC00
1QOGA 2L52A 3RPFC 3AEEB 5MPOA 1JQ4A 2CJNA 2M56B 3P4PB 1AWDA 1CZPA 1PDXA 3NVYA 1UWMA 1KFYB 1L6UA 2LEKA 3P1MA 1PUTA 3DWMA 1YJIA 2WP9B 3W9CB 4C7YA 5EE9A 1SIJA 2WS3B 3ABVB 3NRZA 1E6EB 4KX6B 4JWUC 1QF6A 1JWAD 1OQRA 1TKEA 4YSXB 1JROA 1JWBD 5EE1A 2QIEB 1FFVA 1N62A 3SR6A 3AE5B 3CWIA 4ZOHC 1ZUD2 1PFDA 2Q5WD 4HROA 3SFEB 4C80A 1QOAA 4LTUA 4US9A 2KMMA 1L6VA 5H92C 4YSZB 3CIRB 1FO4A 2WDVB 1XLPA 3AB5A 3HUIA 5H8YE 2QJLA 3AECB 2G1EA 3P4RB 3AE7B 3KWLA 3AE3B 5AUKA 5C2TB 3VR9B 1JRPA 2PVOD 2WU5B 3VR8B 3LXFA 1WGKA 5EE3A 4JX1C 4WWMA 3HRDD 2W54A 3W5VB 1WRIA 3HVZA 1VJKA 1XLOA 1YQ4B 1WYGA 2OHFA 3B9JA 3AEAB 4IDIA 4JWSC 1DOXA 2W55A 1QOFA 1RFKA 2PIAA 1XLNA 1ZOYB 1NYQA 2JQRB 1F0ZA 2B76B 5EE0A 3VRBB 2BS3B 3NVVA 3AE2B 3W5UB 4YTPB 2W3SA 1J7BA 1TJEA 1WWTA 4YT0B 2E3TA 1I7HA 1EWYC 3DWGC 1OQQA 2K22A 3ETRA 2CJOA 1WXQA 3VRAB 1OFFA 1NENB 1E7PB 1T3QA 2MH7A 3NS1A 4N58A 1FIQA 1KF6B 1J7AA 1FXAA 1QOBA 2JX5A 4WQMA 1JW9D 1ZXIA 2CU3A 5AUIA 1E0ZA 2W3RA 3AH7A 3L4PA 3FAHA 2K5PA 4FXCA 4YTNB 3AEBB 3B2GA 1NEKB 2WDRB 2M19A 3AM9A 3BIID 1ZP0B 2BS2B 1R7SA 1N5WA 1FRRA 1XO3A 2KAJA 1FMAD 2WU2B 1QLBB 1SF0A 1NVID 3AEFB 4ZHOA 3AE8B 1E10A 2WDQB 1N60A 2K9XA 1FRDA 2EKIA 1NI3A 1RWSA 1YQ3B 1E9MA 1L0VB 1QT9A 2N0SB 2WQYB 4US8A 2DWQA 1N61A 3AV8A 4N59A 4USAA 1RYJA 1NYRA 3PO0A 1GAQB 1N63A 3NVWA 1B9RA 2H88B 1CJEA 1YJJA 5GXGB 4A9AA 1N5XA 3SFDB 3AE1B 1DGJA 1JALA 2HTME 1DOIA 3AMZA 1FM0D 1IUEA 1GPXA 3AEDB 3AEGB 3B2FA 4YSYB 3FC4A 4ITKA 1AYFA 1SB3C 2PVGC 1L5PA 1ROEA 3AE4B 4C7ZA 2ACZB 1J7CA 4P6VF 1V97A 2BT6A 2BS4B 2DBYA 3P4SB 1V8CA 3P63A 5G5GA 1VDVA 2AX5A 3AE6B 3AN1A 3WCQA 3AE9B 1RM6C 1XLQA 1FXIA 4YXDB 2MJ3A 3NVZA 4ZHPA 3P4QB 1TKYA 1KRHA 2H89B 5G5HA 4HRSA 2WLBA 4YTMB 2MJEA 2Y5CA 3LB8C 5C3JB 3EUB2 2MJDA 1A70A 2L83A 3ZYYX 1FFUA 1DOYA 2FBWB 1VLBA 2PKOA 1TYGB 4N6EB 1TKGA
chains in the Genus database with same CATH superfamily
3PLUA 2FAZA 1WMHA 4RFBA 4FA6A 2KYWA 4OZBA 1OQRA 2QMTA 3RZFA 2XN9C 2J0MA 3UQAA 5L95C 2RSUA 5D3IB 3I3TB 4A6QA 2D10A 5H92C 4L23A 3GE8C 1XLPA 2UYZB 3AECB 1GOZA 3AE3B 4HK2A 3ZXRA 3DBRI 2IGHA 5EE3A 4JX1C 3B9JA 2OHFA 1XLNA 4YWGG 3PREA 2KD0A 4XGAB 4FJVB 1OQQA 1WXQA 1MG4A 1QOBA 3R66C 2FCNA 4KKJA 2ZEQA 2KQ4X 3URYA 1R7SA 3PS6A 5E6JA 4DK5A 1MI0A 1Y8RC 3CMMB 4PYUA 1GAQB 2FIDA 2M0XA 2MW5A 3NZ3A 1T0YA 2RD0A 3VTWA 3KWVA 2N9EB 3R2IA 4YSYB 3ZKJC 2JF5A 1GNUA 2BW2A 3AULA 1WI0A 1V97A 2LMCA 4XWWA 1CK1A 4OZCA 4IW0A 1FXIA 2RDGA 5EDSA 3VUYA 2DZMA 2W9NA 1WH3A 2NMQA 2WGSA 2FE8A 4GMVA 3RNGC 3UF8A 5BMGA 1KOTA 4HKZE 2E6XA 3V60A 1Z2MA 2BKFA 1JWSD 3GZNB 3MJWA 4YSZB 3CIRB 1C1YB 2MBOA 5E6OA 2KACA 4HDOA 3OWEB 2ZCBA 5AEKB 5JHBA 2W55A 3OAWA 4KIKA 3IFWB 2BS3B 3EECA 4YTPB 4MEMA 2ONQA 3DQVA 3PRMB 3O13A 5AZHA 3ETRA 4E3CA 1JWUD 4NJCA 4BKTA 2J0KA 3X0WA 1FIQA 4MGKE 2LGXA 4KDIC 1NEKB 2INPE 1WYWB 3DVGX 3ZJVA 4DHZE 4F1SA 2I2YA 3DDCB 1Q5WB 4KVGB 1OTRB 1L0VB 2N0SB 1FEHA 4GOCA 4RMAA 1V1OA 4OHJA 4LNIA 1JALA 3FILB 3B2FA 1SB3C 2LGSA 2MEKA 3M3JA 3ZRFA 4NY0A 2VZKD 2HDEA 4LLGM 4DQOC 1XLQA 1G6JA 2ZVNA 3P4QB 4LCDE 1KRHA 1WSPA 3WAMA 1VLBA 5KHQA 2CHXA 4IM2A 5BMIA 1XT9B 2JU6X 5IAAC 2FCMA 4HCNB 3DBLB 4BVUC 4YSXB 4K3BA 2NR2A 3TEZA 4MSMB 4K7UA 5BMHA 2KQSA 1FFVA 1JMLA 5IA7A 3VH3B 5LNK1 1Q0WB 2GBMA 2V3NA 1WM3A 4EZKA 4RGMA 1ZPSA 4GDKB 2WXRA 1V80A 2LASA 1WR1A 3V05A 2ZPYA 2INCC 3RT3B 5IP4D 4AUQC 2CHWA 2JXTA 1GC7A 2NPTA 4RNAA 1WX8A 2K22A 3N9YC 4TQ0A 1WM2A 3DBRB 3GOEA 1WJ6A 1E8XA 4JGHB 3MHSD 3Q2AC 3HHMA 2AL6A 3KUZA 3V6EB 3Q3MC 3ZUNA 4GB9A 4F8CB 2WDTB 4K7SA 2CHZA 1R4MB 1FD6A 4G3XB 1SJED 4MGYE 2GBRA 1N5WA 2IO1B 4MDKE 1FRDA 1YN5A 5IKCM 2WQYB 4EOYA 1M94A 1UZXB 1ZKHA 4JQWC 2NTSA 3SFDB 2MBQA 4Q2JA 3QARA 5L83A 3C8YA 3BINA 5G2NA 3AI5A 3PHWB 4HCPB 2NCNA 1KJTA 1V8CA 3L10B 2IJ0A 2NPTB 2AX5A 3QC8B 2KOXA 4HWIB 2AWTA 2KJHB 1JRUA 3L08A 2D2QA 2HJ8A 1F2RI 2AQ2B 3K9PB 4A3PA 1FFUA 3PV1A 1E6EB 2L52A 4HKQA 3P4PB 1CZPA 2Y5BB 1VR9A 2ASQA 4C7YA 2LI5A 3L16A 4I6PA 1WXSA 1T0QC 2KTFA 2ZVOA 4RF0A 2KJ6A 3H9DA 5TSSA 2DAJA 3A9KB 2WYQA 4KSLC 4LDTD 4FULA 5AUKA 3NOBA 1QILA 3UIOB 2SAKA 2WU5B 3VR8B 4WWMA 3HRDD 2BGFA 4IDIA 2JYTA 1UWXA 1K53A 1ZDXA 3HM3A 5JH5C 3C19A 2J42A 3UQBA 4EKUA 1WWTA 2VRRB 2E3TA 2KN5A 4HPPA 3JYUA 3PZ8A 2PW9A 2JX5A 4G0NB 4K3CA 2Z0EB 1WMHB 5HFYA 2KZRA 4ZRKA 1SF0A 1VZ8A 4ZHOA 2WDQB 1N60A 1QKZA 3QCAA 2DX5B 4LNKA 4AP4C 4N59A 2WWZA 4MM3B 2FIFA 1WGGA 3ZDTA 2Y5PA 1LO5D 1C4AA 1D5MC 2HTME 4TSSA 4II3B 2CKHB 2M17A 3NS8A 3MHZA 1KLGD 1J7CA 2G9HD 2MX2A 2L0FA 3A9JB 5LXHA 3ZJTA 4MJSB 4FJZA 3MC9A 2NS5A 3VFKA 4HRSA 4YTMB 4RF1A 1R4MI 2EELA 2K8CA 1UD7A 1T0RC 2WXQA 3KUDB 2XBBC 1YNTE 1HA5A 2NTTA 1PUTA 3DWMA 2DLBA 1TKEA 3PRZA 1AN8A 2GBJA 4GLSC 3VTUA 1FNVA 4IC7B 1WJUA 4KZCA 2LFIA 2LHDA 4BOSC 4TQ1A 1MFWA 1K51A 2QDFA 1IP9A 3PTFC 3U52E 2PE9A 1JRPA 2PVOD 4OVVA 2ZPNA 4NQLB 1P7FA 4HEA1 2L05A 1J7BA 1EO6A 3PZ7A 1XF5L 3DWGC 4M0WB 4OZAA 1E7PB 2W82A 1JW9D 1ZXIA 3EFUA 2WXGA 3ZW3A 3DOWA 3Q3FA 4HJKA 3D32A 1E10A 4MH8A 3BK1A 5FKAC 4AS1A 1N61A 4BKGA 1TZ1A 1MJDA 2H88B 2MBHA 2WXFA 1IUEA 4HPLB 5HI1A 4NQKE 4ARCA 3AEDB 3AEGB 3L13A 2MA9B 2G4DB 1UF0A 2QC8A 2N9XA 4W9JA 4IWOA 1IBXB 4JL9A 3IT6B 1ZGUB 1Q10A 2BTEA 1AW7A 2MLBA 4D2KA 3DHGC 4F7ZA 3Q14C 1TKYA 1SIFA 4DWFA 2KFKB 2WLBA 4HJGE 2L83A 3IAM1 2WDRB 1TYGB 3LDZE 2HTHA 3PGEA 1GJZA 2WP9B 5EE9A 1SIJA 2KTRA 2YLMA 1SBBB 2G45B 1H8CA 3GP7A 3M63B 2KTRB 2IGDA 5JZEB 3V62A 2QCZA 3OJ4B 2KWDA 3RN9C 3KVFB 4C80A 3HUIA 2G1EA 3VR9B 1TS4A 3QAQA 2KVZA 1V5TA 5LXIB 2LRWA 3VTVA 1EU4A 3PSEB 3LYYA 3H7PA 3W1SA 1P1AA 3FILA 1EWYC 2N7JA 1VZ7A 1BMLC 3U7DA 4GU2A 2BQQA 2D3AA 3ZJUA 2GRIA 2WXJA 5D94A 4A8XC 2FUHB 4ZYSA 1L4DB 3A1QB 1NVID 3N3KB 4W9FA 2LVPA 2KWCA 3I5JC 2LD9A 2DZKA 4US8A 4OVZA 3RNEC 1B9RA 2LZ6A 2RGFA 5C23A 3AE1B 2BYEA 5TR5A 4OW0A 5D3DA 3P4SB 3P63A 4K7WA 1B1ZA 3N32A 3VVWB 2YEPF 3T8MA 3GB1A 4ZYNA 2KFJA 3TEYA 3TUOA 1VZ6A 3EUB2 1IYFA 2Z8LA 1C79A 1TKGA 2CU1A 4JLCA 2LJ5A 3ZLZA 4B0MA 1EF1A 2GBKA 1UBQA 3NHEB 4GIVA 3ABVB 2KWVB 4O1NA 2FNJB 4S17A 1JROA 4MGIE 2QIEB 4KZ0A 3DPDA 3SFEB 4US9A 2ZNVC 3Q69A 4LNNA 2DHZA 5C2TB 3SDLC 5HKHA 1MVKA 1WGKA 2JXXA 5KHOA 2YVCA 2D3BA 3N20C 5J17A 3BY4B 5EE0A 1IBXA 1HTOA 1HEZE 3GS2A 1EF5A 1XD3B 4X57B 3A4RA 1RLFA 1SE4A 2C7HA 1OFFA 1T3QA 4M8MA 1KF6B 3R8BA 3W2DA 3AEBB 3EHVA 5T8IA 3E9SA 2M19A 3AM9A 3KLSX 2M4NA 1C9FA 3EC8A 3AE7B 1FRRA 1CQVA 3OG5A 1QLBB 1VCBA 2G3QB 3ZXVA 1UGMA 1H4RA 1WRDB 1XQQA 2XK5B 4XZ4A 1HTQA 1V86A 1U4AA 4XDDA 2MCNB 5CHWA 4XE0A 2JUOA 3AE6B 4RCOA 1IPGA 4BBNC 2V9HA 4FJYA 1UUPA 1J19A 4KDLB 2MJDA 2N9LA 1V1PA 4N6EB 4EFOA 2J0JA 4IWPA 1LGRA 2IO2B 2N7DA 3MTNB 2GLSA 1WXVA 2JWUA 1JWMD 1QOAA 3KYCD 3AXCA 3Q8AA 4WIPA 2LXAA 2L76A 2RPVA 3JW0X 2GI9A 2M0AA 3BZDB 1ISNA 1YQ4B 1I4HA 4JWSC 2BYFA 1TY2A 2O2VA 4KSKC 2MP2B 3Q3JA 4EZLA 3T3NA 5D2MB 1MPEA 2LWPA 2X38A 2C7MB 4XWTA 2C60A 3EA6A 5LLIA 2ZW1A 1LQBA 4A20A 3WA0A 2AEHA 3FAHA 1IGDA 2HE7A 2ICIA 4XX5A 3JSVB 3OJ3A 4IKGA 3BIID 2PLPA 4W9DA 2WU2B 4M00A 3AE8B 5DCNA 3N1ZC 3NG0A 2MHJA 1DGJA 4MM3A 2L32A 2BYTA 4WJNA 4RGNA 5BYQA 2XEWA 1C78A 3VUWA 2L8JA 4GDKA 1WX9A 1AARA 2GMIC 3AN1A 1WXMA 1GC6A 1EU3A 1F9JA 2ON8A 5G5HA 3U30A 4DBGA 2Y5CA 2M8SA 3VQIA 1WJNA 1TGZB 5HG2A 2MWSB 1QOGA 2WX0A 4HXDA 1CMXB 1MHXA 2IGGA 3NVYA 4PYZA 1TS3A 3W9CB 1FCCC 3DCGA 4ACFA 4W9GA 2KK8A 4TKNA 3APDA 2LXCA 3DVGY 1YN4A 2IDYA 2V0GA 3N30A 4I6NB 1KM7A 1ZE3D 2OJRA 3CWIA 1SEBD 1PFDA 4JPSA 4LTUA 2QHOA 3L0WB 1FO4A 4B0EA 2I1JA 4WH4A 5IN7A 1N6ZA 3R3MA 4LK0M 4C4VA 3NJTA 2LGIA 3KYDD 4WAFA 4FN2A 1I4GA 2FCSA 1L2NA 4AWJA 3UGBB 1RFKA 1E90A 3VRBB 4LJPB 1HE8A 4AOFA 4PT5A 1XCQL 4ZRQA 3V3XA 3ECIA 4DDGD 3DBHB 3R7RA 4ZRJA 4WQMA 1YJ1A 3ML8A 4EZJA 3L4PA 3VHTC 5IOIA 1PGAA 1YN3A 4CO7A 1XO3A 3HVDA 3B1LX 1I4XA 2ZNVB 1TZOA 3U2SC 3M95A 2DWQA 2L0TA 3AV8A 5CTRC 3ZNID 3P2BA 1WGRA 3IVFA 1N5XA 2LUEA 2JZPA 1FM0D 2YEPB 4BKSA 2I1KA 1Q1OA 2WXOA 4DDID 1S1QB 2B3AA 1OQYA 2ACZB 2DAFA 2QILA 1C77A 4P6VF 2BT6A 3ZRCA 5AZGA 2V3SA 2J7QB 3O65B 1UGJA 3ZVVA 3RNFC 2K0PA 4PS8A 2R61A 4LJOB 4BFRA 2O2VB 1ESFA 3BWUD 1RRBA 2KMAA 2WXHA 3PZDA 1TT5B 2KHWB 2M56B 1BXTA 1UWMA 3P1MA 4WJPA 4URKA 2FUG1 1OEYJ 3MC8A 1IGCA 1T6BX 2GBNA 2OJWA 1WE7A 2JRHA 3FKYA 3T3OA 4ZOHC 1D6EC 2NVUI 3WANA 2DZJA 1F2RC 1WXAA 1D4BA 1NI2A 3PRPB 3RYTA 1WYGA 3H1UA 2JQRB 3MJ5A 2MBEA 2WXKA 2V1YA 1JCKB 4TMAB 3APFA 1WF9A 2DNFA 1TJEA 3HM6X 1SXTA 3DHIC 4GDLB 2DYOA 4RM9A 3H7PB 4A90A 3ALBA 1E8WA 2OOBB 2Z59B 4E74A 4OVUA 4FBJB 1P0RA 1E7UA 2BB5A 2D07B 1OEYA 5GMVA 3SEBA 3MP9A 3TEXA 3M62B 2N7EA 3TSSA 2BS2B 4MSQB 4M0WA 2PEAA 1RAXA 1YQ3B 3JSVA 2LVOA 5CHVC 1RYJA 4IWQA 3PO0A 3UINB 4EE2A 4IOIE 1J8CA 4IUMB 2JZZA 1GPXA 3P42A 2ZJDA 2RR9A 3N1YC 2K1FA 5J18A 4XYCA 4ASWC 2WHIA 2IPKD 1E7VA 1VDVA 4LNOA 2PJHA 4GGQA 2XNAC 4ZDVA 2IBIB 4FADA 3DBLI 2NBVB 1S3SG 1ET6A 5D6JB 2A5UA 1DOYA 2J53A 4NAMA 5DPSA 5MPOA 2CJNA 3QX1A 5D7GA 1V49A 1YJIA 2IO3B 2K8HA 2WS3B 3NRZA 3VAWA 1X1MA 1K50A 4DXFA 4DHZB 2IY0B 4W9IA 3KW5B 4L1BA 1TY0A 1SGHA 4P7IA 3IBEA 4ANWA 1PQSA 4LNFA 4WURA 2EKEC 3I9V1 4P1CC 3H7SA 5DPWA 3Q6BA 1GG3A 2G4SA 1UBIA 2NBWB 4ANVA 1E5WA 2ZW0A 5DPRA 3RMKC 4ICUA 4QAYA 2AYOB 2RMMA 3I63C 2KDEB 2CJOA 4WWOA 2AQ1B 1J7AA 4DXGA 2K5PA 1I4QA 4KGSA 1ET9A 3E56A 4K81A 3RUIB 3B08A 2KMCA 3MFGA 2WXNA 1K8RB 1UELA 1WY8A 4NNJB 3UIPB 2N4FA 2OEDA 3Q8EA 1I35A 2JYEA 4ITKA 5FK9C 2PE6B 3TCAA 2D3GA 4C7ZA 3QWZB 1FNUA 3RNBC 3BVGA 2KDMA 1C4CA 3DBSA 4ARIA 2L00B 1ZDVA 2MBBB 3WAOA 3MC0B 1FXTB 2FCQA 4ZRPA 2PKOA 3WALA 1JQ4A 1P7EA 2WX1A 1NBFC 1PDXA 1L6UA 4G50A 1L0XB 4M8NA 1V81A 2IY1B 3KH0A 3L17A 2V3PA 4BZAA 2KDIA 1QZEA 2INDC 2LUMA 3TJPA 4MJSA 3ZGZA 3SR6A 3A1QA 1ZUD2 4II2B 1YQBA 4NJ6A 1BUIC 3LJ3A 4W9KA 1ZW7A 2KNBA 3PLVA 3P4RB 3ZNHB 3QQ8B 4NJ7A 2CS4A 2LVQA 3IG3A 1SSNA 4MELA 3AU4A 2V4LA 3W5VB 4PK1A 2PIAA 1NYQA 1WX7A 3AE2B 1Y56A 1YIWA 1T0SC 2RDBC 2JZ3B 3RFZB 5E6NA 4MT5A 1TIFA 3NS1A 3QA8A 4K1RB 4FXCA 2MQJA 2HD5B 2K6DB 1MHHE 4WWPA 4B9KA 4MGZE 1EWCA 2KAJA 1FMAD 3AEFB 3NY5A 2K9XA 3SHQA 1BT0A 1RFAA 4HVBA 2IZVB 1KH0A 1N63A 4NZLB 2BWES 3RD2A 4IG7B 4A9AA 2LGDA 1DOIA 1P9DU 3FC4A 2X8XX 4M01A 5G55A 2JVCA 2R2OA 4L2YA 1ROEA 3ENEA 3QK0A 1V6EA 3TMPB 5AZFA 2L1AA 4NAWA 2LHEA 1L4ZB 2XK5A 3A9KA 4YXDB 1WIAA 3NVZA 3ML9A 1KTKA 3W1SC 4TUUA 2MSED 2WXMA 2REXA 3HK0A 5BYRA 2UU7A 1SE2A 1AWDA 1KFYB 2KJRA 4WJQA 3RZWC 3U4EG 4WQOB 3KUCB 4DHJD 1YMHE 3BVZA 1JWAD 4C00A 3TL5A 2EMTA 5C1ZA 2KFKA 4ICVA 2JT4B 2KDBA 1V1PB 3RI7C 5JXVA 2KMMA 3U8ZA 5H8YE 2LRUA 3C0RB 2TSSA 3KWLA 1F52A 2EMSA 1WGHA 3LXFA 2K8BA 3CF6E 4KV2A 3DVNU 4C4VB 3BYTB 1WE6A 3AEAB 3PHXB 4W9LA 2KT7A 3J9CA 2JWZA 4J3OD 1ZOYB 2K6QA 2O6VA 2KX3A 4S0RA 1M4VA 1QQRA 1D5ZC 3AU5A 4H2AA 4BBNF 1I42A 1HZ6A 4KKIA 2VH2A 2BB6A 4HLEA 3CSTA 4N58A 3R7QA 2VH1A 5DPTA 3IHPC 4YTNB 3B2GA 1K52A 3CSFA 3PPAA 4EEWA 4CHKA 2C7NB 2D5GA 3BK2A 1NI3A 1RWSA 3IXSA 3QIJA 1V2YA 4USAA 2R2QA 3NVWA 1CJEA 2JY6A 2KX0A 2WXIA 4IM3A 2AL3A 2PVGC 4MACA 3AE4B 3WAPA 4DHJB 1E8YA 1VRAB 1ACCA 4ANXA 1WZ0A 2KLCA 3A33B 3VDZA 1F1HA 2KLGA 3WCQA 2KO3A 3RCZA 2HJ1A 3KQ4A 3QJZA 4GXBA 3LB8C 4G11A 1C76A 3AEEB 5I4DA 2LEKA 2J52A 2PTLA 2PMVA 2KWUB 3ZNZB 3QHTA 2DYBA 4RGOS 1JWBD 5FR6A 2RPQA 3ZTCA 2Q5WD 1LM8B 1WGYA 4HROA 4M02A 1OGWA 4W9HA 2PPHA 3AB5A 2QJLA 3ZNGC 2AQ3B 2BPSA 4I6LB 4AJWA 4A55A 4AJYB 4R3DA 1WFYA 1VJKA 1UH6A 2DYMA 3NZUA 4RH6A 1GB1A 3RNAC 1R4NI 1SE9A 2N9PC 2ZZPB 3VRAB 4AQ7A 3ONSA 3TBLD 2Z0DB 1T5XD 5E6PA 2CU3A 1E0ZA 3AH7A 3WIMA 3DHHC 2KN4A 2O6VD 3Q8FA 2KDFB 2BVCA 4IM0A 3W1YA 3HIZA 4ZRIA 3NZSA 3GZNI 5CX3A 2KC1A 2EKIA 1WGDA 2JRIB 1L0YB 1ZXHA 2D11A 2GB1A 4KIKB 3Q8BA 3IAS1 4JE3B 3PVLA 1AYFA 3BYYB 1YOVB 2BBCA 4GSWA 1TS2A 1LFDA 2DBYA 5G5GA 1HQRD 4XC2A 4HDQA 3AE9B 2KC2A 4ZHPA 3VH4B 3B0AA 2CR5A 3N1XC 3SD5A 2MJEA 3L54A 2I38A 1D5XC 1A70A 1D3ZA 3ZYYX 2FBWB 4LDTB 4BKSD 1I4PA 4RM8A 2WXPA 3PT2B 1WR6E 1PGXA 4DXAB 2Y3AA 1KLUD 1PYWD 4WWNA 3DBHI 1DYQA 4XDCA 3ZO5B 1P3QU 2C9WB 3H6NA 1FNWA 4JWUC 5CHFA 5BO4B 5EE1A 4HPMB 1I4RA 4JIOU 2QEJC 2K39A 3NUHB 1N62A 3AE5B 1C3TA 2KXJA 1L6VA 3OLMD 2ZCCA 1NDDA 2K25A 1SJHD 1FPYA 1TBEA 5J2RA 2L7RA 3X23A 1ENFA 2O6VB 4UDUC 1XLOA 1DOXA 1LXDA 3ZIMA 3SU8X 4FHJA 1QOFA 1V9JA 1R4NB 3DVNV 4MH0E 1WJ4A 2B76B 1XEEA 4TV3A 3V61A 4CYEA 1I7HA 1EUVB 1XCTL 4N9F4 2JPHA 2MH7A 4C56C 1GB4A 1EM7A 2QSDA 1FCLA 1YX5B 2W3RA 1GUAB 2JSVX 3S2AA 2BWFA 1TS5A 4PS3A 4BOZB 4KGRA 2MP2A 3RULA 3TEWA 2BF8B 1YJJA 2WNMA 5FR3A 4A3OA 3GE3C 1V5OA 2LJIA 1L5PA 4FLHA 1Z5SB 2KVRA 4ANUA 2MRPA 2BS4B 1HZ5A 4WJOA 3UI3A 4P1BC 1WZ3A 2N1VA 1F77A 1L7YA 2IO0B 2H89B 4FHKA 4RGTA 5C3JB 1F0ZA 4YT0B 4GDLA 3APCA 3RPFC 4NPNA 1SE3A 3A4SC 4KX6B 1J0GA 1QF6A 3EFCA 4E71A 4J6IA 2IYDB 3U7ZA 1E8ZA 2WXLA 3JVZX 2WDVB 5HHDG 2D3CA 3RNCC 2W54A 4W9EA 1WRIA 3HVZA 3ZQ4A 3TIXA 4YL8A 1HXYD 2N9KA 4WAAA 1STEA 3NVVA 2KANA 3I57A 3W5UB 5JHAA 1A5RA 1XXGA 1KLVA 3R2TA 1MG8A 2DENB 3T9LA 1FXAA 4P16A 3Q3OC 5AUIA 3EGRA 4NAWB 2K3UA 4EUTA 1PGBA 3BVMA 1VD2A 1ZP0B 2N1WA 4REZA 2INNE 3IT4B 2DZIA 2KQ7A 4GN1A 5BYSA 4PS7A 3V6CB 2NBUA 2BKRB 2LGYA 1E9MA 1P98A 1QT9A 1NYRA 2M1MA 2KKCA 5GXGB 2J4XA 4W9CA 3Q8CA 1YX6B 3AMZA 2L3ZA 2SEBD 3VUXA 3A9JA 4KGTA 1C4PA 1YD8U 3VXWA 3K9OB 2UWQA 2RDHA 2VZKB 1UNSA 1RM6C 2GOWA 5IO9A 2MJ3A 4BAXA 2C5LC 2V4IB 4B95A 4CQNA 2BYVE 3ZTDA 4B6WA 3ZDMC 1TTNA 2A4ZA 3H8HA 2W3SA 3Q3NC 1NENB
chains in the Genus database with same CATH topology
1QOGA 2WXQA 1MHXA 1SE2A 4RFBA 2IGGA 1AWDA 3NVYA 1KFYB 1HA5A 1TS3A 1YNTE 1PUTA 2NTTA 3DWMA 4OZBA 3W9CB 3U4EG 1FCCC 2DLBA 1YMHE 3BVZA 1JWAD 1OQRA 1TKEA 1AN8A 2QMTA 2XN9C 1YN4A 2IDYA 2V0GA 1ZE3D 1V1PB 3CWIA 4GLSC 1SEBD 1PFDA 5D3IB 5JXVA 1FNVA 4A6QA 4JPSA 4LTUA 2LFIA 2KMMA 2LHDA 4TQ1A 4L23A 5H92C 4B0EA 1K51A 4WH4A 1FO4A 1XLPA 5H8YE 3AECB 2TSSA 1GOZA 3AE3B 3KWLA 3U52E 4LK0M 1JRPA 2PVOD 3LXFA 2LGIA 2IGHA 5EE3A 4JX1C 4WAFA 1P7FA 1I4GA 3B9JA 2OHFA 3BYTB 3AEAB 1RFKA 3J9CA 1XLNA 4J3OD 1ZOYB 4YWGG 3VRBB 4HEA1 1M4VA 1QQRA 1D5ZC 1J7BA 4H2AA 3PZ7A 1XCQL 1XF5L 3DWGC 4OZAA 4PT5A 4ZRQA 3V3XA 1HZ6A 1OQQA 1WXQA 4KKIA 2BB6A 1E7PB 4N58A 2W82A 1QOBA 4WQMA 1JW9D 1ZXIA 3L4PA 4KKJA 2WXGA 4YTNB 3B2GA 1K52A 2KQ4X 1PGAA 1YN3A 3URYA 1R7SA 1XO3A 1E10A 4MH8A 3HVDA 5E6JA 2D5GA 3BK2A 3BK1A 1MI0A 5FKAC 1NI3A 1RWSA 1I4XA 3IXSA 4AS1A 1TZOA 3U2SC 2DWQA 1N61A 3AV8A 4USAA 1GAQB 3NVWA 2H88B 1CJEA 2WXFA 1N5XA 3NZ3A 2JZPA 1FM0D 1IUEA 2YEPB 5HI1A 4ARCA 3KWVA 3R2IA 3AEDB 3AEGB 4YSYB 2WXIA 2BW2A 2PVGC 4MACA 2WXOA 3AE4B 2ACZB 2QILA 1C77A 1VRAB 1V97A 1ACCA 2BT6A 4P6VF 2LMCA 4XWWA 1IBXB 1CK1A 3IT6B 3WCQA 4OZCA 1UGJA 1Q10A 2K0PA 1FXIA 2BTEA 2R61A 1AW7A 2RDGA 3KQ4A 4D2KA 1TKYA 1ESFA 2WLBA 3LB8C 2NMQA 3BWUD 4HJGE 2L83A 3IAM1 1C76A 2WDRB 2WXHA 1TYGB 3AEEB 2FE8A 2M56B 1BXTA 5I4DA 1UWMA 5BMGA 2LEKA 3P1MA 2J52A 2PTLA 2WP9B 4HKZE 2PMVA 5EE9A 1SIJA 2E6XA 1SBBB 2FUG1 3GP7A 1IGCA 1T6BX 2IGDA 4RGOS 1JWBD 1JWSD 2KWDA 3T3OA 4ZOHC 2Q5WD 1D6EC 4HROA 4C80A 4YSZB 1F2RC 3CIRB 3AB5A 3HUIA 2QJLA 2AQ3B 2G1EA 1D4BA 2KACA 3OWEB 3VR9B 4A55A 1TS4A 4R3DA 1VJKA 1WYGA 2W55A 2DYMA 2JQRB 3MJ5A 4RH6A 1GB1A 2WXKA 2BS3B 1JCKB 4TMAB 1EU4A 4YTPB 3LYYA 3W1SA 3FILA 2ONQA 1TJEA 1SXTA 1EWYC 4GDLB 3O13A 2DYOA 2N7JA 1VZ7A 3ETRA 1BMLC 3VRAB 1JWUD 4A90A 4AQ7A 4NJCA 1FIQA 1T5XD 2CU3A 1E0ZA 3AH7A 2BB5A 2KN4A 3Q8FA 1NEKB 2INPE 3SEBA 3ZJUA 2GRIA 2WXJA 3MP9A 3TEXA 4A8XC 4ZYSA 3ZJVA 3TSSA 2BS2B 1L4DB 4M0WA 2I2YA 1NVID 2EKIA 1L0YB 1YQ3B 1ZXHA 1L0VB 2N0SB 4US8A 1FEHA 4OVZA 1RYJA 2GB1A 3PO0A 1B9RA 4EE2A 1V1OA 4IOIE 3AE1B 3Q8BA 3IAS1 1JALA 4OHJA 3FILB 1GPXA 3P42A 4JE3B 3B2FA 4OW0A 1AYFA 3BYYB 1SB3C 5D3DA 2BBCA 1TS2A 2MEKA 2DBYA 3P4SB 2IPKD 3P63A 5G5GA 1VDVA 2VZKD 1B1ZA 1HQRD 2HDEA 2YEPF 3AE9B 4LLGM 4DQOC 1XLQA 2XNAC 4ZHPA 3GB1A 3P4QB 1KRHA 3TEYA 1WSPA 3TUOA 2MJEA 1VZ6A 3EUB2 1ET6A 1D5XC 1A70A 2I38A 3ZYYX 1DOYA 2FBWB 1VLBA 2J53A 2Z8LA 1C79A 1TKGA 4NAMA 4B0MA 1I4PA 5BMIA 5MPOA 2WXPA 2CJNA 1PGXA 5D7GA 2Y3AA 2JU6X 1KLUD 1YJIA 1PYWD 2WS3B 1DYQA 3ABVB 4XDCA 3NRZA 1FNWA 1K50A 4JWUC 4O1NA 4DXFA 4YSXB 1JROA 3TEZA 5EE1A 4L1BA 1TY0A 5BMHA 1I4RA 2QIEB 1FFVA 1JMLA 2QEJC 3NUHB 1N62A 3AE5B 3SFEB 4WURA 4US9A 1L6VA 5LNK1 2V3NA 3I9V1 3Q69A 4RGMA 1SJHD 1ZPSA 4GDKB 2WXRA 5C2TB 1MVKA 1WGKA 1ENFA 4UDUC 1XLOA 1DOXA 3V05A 2ZW0A 1QOFA 2B76B 1XEEA 2JXTA 5EE0A 1IBXA 1HEZE 2RMMA 3GS2A 4RNAA 1I7HA 1XCTL 2K22A 3N9YC 4TQ0A 2CJOA 1SE4A 1OFFA 2AQ1B 2MH7A 1T3QA 4C56C 1EM7A 1GB4A 1KF6B 1J7AA 2QSDA 1FCLA 3R8BA 2W3RA 4DXGA 2K5PA 3W2DA 1I4QA 3AEBB 5T8IA 2JSVX 4KGSA 1ET9A 3E9SA 3E56A 2M19A 3AM9A 1FD6A 3KLSX 1C9FA 1SJED 1TS5A 3AE7B 1N5WA 1FRRA 1CQVA 1QLBB 1FRDA 1YN5A 3MFGA 2WXNA 4KGRA 2WQYB 3TEWA 2OEDA 1YJJA 3SFDB 2NTSA 2WNMA 3Q8EA 2JYEA 4XDDA 5FR3A 4ITKA 4Q2JA 5FK9C 2LJIA 1L5PA 4C7ZA 3C8YA 2BS4B 1HZ5A 1V8CA 3UI3A 1FNUA 2IJ0A 2AX5A 3BVGA 3AE6B 2KDMA 4XE0A 1C4CA 4ARIA 4RCOA 1F77A 1ZDVA 1UUPA 2H89B 1F2RI 2AQ2B 3MC0B 4RGTA 5C3JB 2MJDA 4ZRPA 2N9LA 1FFUA 1F0ZA 2PKOA 1V1PA 4N6EB 4YT0B 1E6EB 2L52A 3RPFC 4HKQA 1JQ4A 1P7EA 3P4PB 1CZPA 1PDXA 1L6UA 1VR9A 4C7YA 1L0XB 1SE3A 2V3PA 4KX6B 1QF6A 4RF0A 2LUMA 5TSSA 3U7ZA 3ZGZA 3SR6A 2JWUA 2WXLA 1ZUD2 1JWMD 1QOAA 1BUIC 2WDVB 3Q8AA 4WIPA 3P4RB 5HHDG 5AUKA 1QILA 2SAKA 2WU5B 3VR8B 2RPVA 1SSNA 2GI9A 2M0AA 3BZDB 4WWMA 3HRDD 2W54A 3W5VB 1WRIA 2JYTA 1YQ4B 3HVZA 4IDIA 1I4HA 4JWSC 3ZQ4A 1UWXA 1K53A 1TY2A 2PIAA 1HXYD 1ZDXA 1NYQA 2N9KA 1STEA 2J42A 3NVVA 3AE2B 1Y56A 3I57A 3W5UB 1MPEA 3T3NA 1WWTA 2X38A 2E3TA 1XXGA 4XWTA 3RFZB 3PZ8A 3EA6A 4MT5A 2ZW1A 3NS1A 3R2TA 2PW9A 1FXAA 4P16A 2JX5A 5AUIA 3FAHA 4FXCA 3EGRA 4NAWB 1IGDA 2K3UA 1MHHE 2ICIA 1PGBA 3BVMA 4IKGA 5HFYA 3BIID 1ZP0B 1EWCA 2PLPA 4REZA 2KAJA 1FMAD 2WU2B 1SF0A 2INNE 1VZ8A 3AEFB 3IT4B 3AE8B 4ZHOA 2WDQB 1N60A 1QKZA 2K9XA 5BYSA 1E9MA 1QT9A 4N59A 4MM3B 1KH0A 1NYRA 1N63A 2Y5PA 4NZLB 1LO5D 5GXGB 1C4AA 2J4XA 4A9AA 1D5MC 3Q8CA 1DGJA 2HTME 3AMZA 1DOIA 2L32A 4TSSA 2BYTA 2SEBD 3FC4A 4KGTA 4L2YA 4RGNA 1C4PA 5BYQA 1ROEA 1C78A 2G9HD 1J7CA 1KLGD 3MHZA 2RDHA 2VZKB 3ZJTA 1UNSA 3AN1A 1RM6C 2L1AA 4YXDB 2LHEA 1L4ZB 2MJ3A 3NVZA 1EU3A 2V4IB 1KTKA 2ON8A 4CQNA 2WXMA 5G5HA 4HRSA 4YTMB 4RF1A 2Y5CA 3VQIA 2EELA 3H8HA 5HG2A 2W3SA 5BYRA 1NENB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QOG A;  2L52 A;  3RPF C;  3AEE B;  5MPO A;  1JQ4 A;  2CJN A;  2M56 B;  3P4P B;  1AWD A;  1CZP A;  1PDX A;  3NVY A;  1UWM A;  1KFY B;  1L6U A;  2LEK A;  3P1M A;  1PUT A;  3DWM A;  1YJI A;  2WP9 B;  3W9C B;  4C7Y A;  5EE9 A;  1SIJ A;  2WS3 B;  3ABV B;  3NRZ A;  1E6E B;  4KX6 B;  4JWU C;  1QF6 A;  1JWA D;  1OQR A;  1TKE A;  4YSX B;  1JRO A;  1JWB D;  5EE1 A;  2QIE B;  1FFV A;  1N62 A;  3SR6 A;  3AE5 B;  3CWI A;  4ZOH C;  1ZUD 2;  1PFD A;  2Q5W D;  4HRO A;  3SFE B;  4C80 A;  1QOA A;  4LTU A;  4US9 A;  2KMM A;  1L6V A;  5H92 C;  4YSZ B;  3CIR B;  1FO4 A;  2WDV B;  1XLP A;  3AB5 A;  3HUI A;  5H8Y E;  2QJL A;  3AEC B;  2G1E A;  3P4R B;  3AE7 B;  3KWL A;  3AE3 B;  5AUK A;  5C2T B;  3VR9 B;  1JRP A;  2PVO D;  2WU5 B;  3VR8 B;  3LXF A;  1WGK A;  5EE3 A;  4JX1 C;  4WWM A;  3HRD D;  2W54 A;  3W5V B;  1WRI A;  3HVZ A;  1VJK A;  1XLO A;  1YQ4 B;  1WYG A;  2OHF A;  3B9J A;  3AEA B;  4IDI A;  4JWS C;  1DOX A;  2W55 A;  1QOF A;  1RFK A;  2PIA A;  1XLN A;  1ZOY B;  1NYQ A;  2JQR B;  1F0Z A;  2B76 B;  5EE0 A;  3VRB B;  2BS3 B;  3NVV A;  3AE2 B;  3W5U B;  4YTP B;  2W3S A;  1J7B A;  1TJE A;  1WWT A;  4YT0 B;  2E3T A;  1I7H A;  1EWY C;  3DWG C;  1OQQ A;  2K22 A;  3ETR A;  2CJO A;  1WXQ A;  3VRA B;  1OFF A;  1NEN B;  1E7P B;  1T3Q A;  2MH7 A;  3NS1 A;  4N58 A;  1FIQ A;  1KF6 B;  1J7A A;  1FXA A;  1QOB A;  2JX5 A;  4WQM A;  1JW9 D;  1ZXI A;  2CU3 A;  5AUI A;  1E0Z A;  2W3R A;  3AH7 A;  3L4P A;  3FAH A;  2K5P A;  4FXC A;  4YTN B;  3AEB B;  3B2G A;  1NEK B;  2WDR B;  2M19 A;  3AM9 A;  3BII D;  1ZP0 B;  2BS2 B;  1R7S A;  1N5W A;  1FRR A;  1XO3 A;  2KAJ A;  1FMA D;  2WU2 B;  1QLB B;  1SF0 A;  1NVI D;  3AEF B;  4ZHO A;  3AE8 B;  1E10 A;  2WDQ B;  1N60 A;  2K9X A;  1FRD A;  2EKI A;  1NI3 A;  1RWS A;  1YQ3 B;  1E9M A;  1L0V B;  1QT9 A;  2N0S B;  2WQY B;  4US8 A;  2DWQ A;  1N61 A;  3AV8 A;  4N59 A;  4USA A;  1RYJ A;  1NYR A;  3PO0 A;  1GAQ B;  1N63 A;  3NVW A;  1B9R A;  2H88 B;  1CJE A;  1YJJ A;  5GXG B;  4A9A A;  1N5X A;  3SFD B;  3AE1 B;  1DGJ A;  1JAL A;  2HTM E;  1DOI A;  3AMZ A;  1FM0 D;  1IUE A;  1GPX A;  3AED B;  3AEG B;  3B2F A;  4YSY B;  3FC4 A;  4ITK A;  1AYF A;  1SB3 C;  2PVG C;  1L5P A;  1ROE A;  3AE4 B;  4C7Z A;  2ACZ B;  1J7C A;  4P6V F;  1V97 A;  2BT6 A;  2BS4 B;  2DBY A;  3P4S B;  1V8C A;  3P63 A;  5G5G A;  1VDV A;  2AX5 A;  3AE6 B;  3AN1 A;  3WCQ A;  3AE9 B;  1RM6 C;  1XLQ A;  1FXI A;  4YXD B;  2MJ3 A;  3NVZ A;  4ZHP A;  3P4Q B;  1TKY A;  1KRH A;  2H89 B;  5G5H A;  4HRS A;  2WLB A;  4YTM B;  2MJE A;  2Y5C A;  3LB8 C;  5C3J B;  3EUB 2;  2MJD A;  1A70 A;  2L83 A;  3ZYY X;  1FFU A;  1DOY A;  2FBW B;  1VLB A;  2PKO A;  1TYG B;  4N6E B;  1TKG A; 
#chains in the Genus database with same CATH topology
 3PLU A;  2FAZ A;  1WMH A;  4RFB A;  4FA6 A;  2KYW A;  4OZB A;  1OQR A;  2QMT A;  3RZF A;  2XN9 C;  2J0M A;  3UQA A;  5L95 C;  2RSU A;  5D3I B;  3I3T B;  4A6Q A;  2D10 A;  5H92 C;  4L23 A;  3GE8 C;  1XLP A;  2UYZ B;  3AEC B;  1GOZ A;  3AE3 B;  4HK2 A;  3ZXR A;  3DBR I;  2IGH A;  5EE3 A;  4JX1 C;  3B9J A;  2OHF A;  1XLN A;  4YWG G;  3PRE A;  2KD0 A;  4XGA B;  4FJV B;  1OQQ A;  1WXQ A;  1MG4 A;  1QOB A;  3R66 C;  2FCN A;  4KKJ A;  2ZEQ A;  2KQ4 X;  3URY A;  1R7S A;  3PS6 A;  5E6J A;  4DK5 A;  1MI0 A;  1Y8R C;  3CMM B;  4PYU A;  1GAQ B;  2FID A;  2M0X A;  2MW5 A;  3NZ3 A;  1T0Y A;  2RD0 A;  3VTW A;  3KWV A;  2N9E B;  3R2I A;  4YSY B;  3ZKJ C;  2JF5 A;  1GNU A;  2BW2 A;  3AUL A;  1WI0 A;  1V97 A;  2LMC A;  4XWW A;  1CK1 A;  4OZC A;  4IW0 A;  1FXI A;  2RDG A;  5EDS A;  3VUY A;  2DZM A;  2W9N A;  1WH3 A;  2NMQ A;  2WGS A;  2FE8 A;  4GMV A;  3RNG C;  3UF8 A;  5BMG A;  1KOT A;  4HKZ E;  2E6X A;  3V60 A;  1Z2M A;  2BKF A;  1JWS D;  3GZN B;  3MJW A;  4YSZ B;  3CIR B;  1C1Y B;  2MBO A;  5E6O A;  2KAC A;  4HDO A;  3OWE B;  2ZCB A;  5AEK B;  5JHB A;  2W55 A;  3OAW A;  4KIK A;  3IFW B;  2BS3 B;  3EEC A;  4YTP B;  4MEM A;  2ONQ A;  3DQV A;  3PRM B;  3O13 A;  5AZH A;  3ETR A;  4E3C A;  1JWU D;  4NJC A;  4BKT A;  2J0K A;  3X0W A;  1FIQ A;  4MGK E;  2LGX A;  4KDI C;  1NEK B;  2INP E;  1WYW B;  3DVG X;  3ZJV A;  4DHZ E;  4F1S A;  2I2Y A;  3DDC B;  1Q5W B;  4KVG B;  1OTR B;  1L0V B;  2N0S B;  1FEH A;  4GOC A;  4RMA A;  1V1O A;  4OHJ A;  4LNI A;  1JAL A;  3FIL B;  3B2F A;  1SB3 C;  2LGS A;  2MEK A;  3M3J A;  3ZRF A;  4NY0 A;  2VZK D;  2HDE A;  4LLG M;  4DQO C;  1XLQ A;  1G6J A;  2ZVN A;  3P4Q B;  4LCD E;  1KRH A;  1WSP A;  3WAM A;  1VLB A;  5KHQ A;  2CHX A;  4IM2 A;  5BMI A;  1XT9 B;  2JU6 X;  5IAA C;  2FCM A;  4HCN B;  3DBL B;  4BVU C;  4YSX B;  4K3B A;  2NR2 A;  3TEZ A;  4MSM B;  4K7U A;  5BMH A;  2KQS A;  1FFV A;  1JML A;  5IA7 A;  3VH3 B;  5LNK 1;  1Q0W B;  2GBM A;  2V3N A;  1WM3 A;  4EZK A;  4RGM A;  1ZPS A;  4GDK B;  2WXR A;  1V80 A;  2LAS A;  1WR1 A;  3V05 A;  2ZPY A;  2INC C;  3RT3 B;  5IP4 D;  4AUQ C;  2CHW A;  2JXT A;  1GC7 A;  2NPT A;  4RNA A;  1WX8 A;  2K22 A;  3N9Y C;  4TQ0 A;  1WM2 A;  3DBR B;  3GOE A;  1WJ6 A;  1E8X A;  4JGH B;  3MHS D;  3Q2A C;  3HHM A;  2AL6 A;  3KUZ A;  3V6E B;  3Q3M C;  3ZUN A;  4GB9 A;  4F8C B;  2WDT B;  4K7S A;  2CHZ A;  1R4M B;  1FD6 A;  4G3X B;  1SJE D;  4MGY E;  2GBR A;  1N5W A;  2IO1 B;  4MDK E;  1FRD A;  1YN5 A;  5IKC M;  2WQY B;  4EOY A;  1M94 A;  1UZX B;  1ZKH A;  4JQW C;  2NTS A;  3SFD B;  2MBQ A;  4Q2J A;  3QAR A;  5L83 A;  3C8Y A;  3BIN A;  5G2N A;  3AI5 A;  3PHW B;  4HCP B;  2NCN A;  1KJT A;  1V8C A;  3L10 B;  2IJ0 A;  2NPT B;  2AX5 A;  3QC8 B;  2KOX A;  4HWI B;  2AWT A;  2KJH B;  1JRU A;  3L08 A;  2D2Q A;  2HJ8 A;  1F2R I;  2AQ2 B;  3K9P B;  4A3P A;  1FFU A;  3PV1 A;  1E6E B;  2L52 A;  4HKQ A;  3P4P B;  1CZP A;  2Y5B B;  1VR9 A;  2ASQ A;  4C7Y A;  2LI5 A;  3L16 A;  4I6P A;  1WXS A;  1T0Q C;  2KTF A;  2ZVO A;  4RF0 A;  2KJ6 A;  3H9D A;  5TSS A;  2DAJ A;  3A9K B;  2WYQ A;  4KSL C;  4LDT D;  4FUL A;  5AUK A;  3NOB A;  1QIL A;  3UIO B;  2SAK A;  2WU5 B;  3VR8 B;  4WWM A;  3HRD D;  2BGF A;  4IDI A;  2JYT A;  1UWX A;  1K53 A;  1ZDX A;  3HM3 A;  5JH5 C;  3C19 A;  2J42 A;  3UQB A;  4EKU A;  1WWT A;  2VRR B;  2E3T A;  2KN5 A;  4HPP A;  3JYU A;  3PZ8 A;  2PW9 A;  2JX5 A;  4G0N B;  4K3C A;  2Z0E B;  1WMH B;  5HFY A;  2KZR A;  4ZRK A;  1SF0 A;  1VZ8 A;  4ZHO A;  2WDQ B;  1N60 A;  1QKZ A;  3QCA A;  2DX5 B;  4LNK A;  4AP4 C;  4N59 A;  2WWZ A;  4MM3 B;  2FIF A;  1WGG A;  3ZDT A;  2Y5P A;  1LO5 D;  1C4A A;  1D5M C;  2HTM E;  4TSS A;  4II3 B;  2CKH B;  2M17 A;  3NS8 A;  3MHZ A;  1KLG D;  1J7C A;  2G9H D;  2MX2 A;  2L0F A;  3A9J B;  5LXH A;  3ZJT A;  4MJS B;  4FJZ A;  3MC9 A;  2NS5 A;  3VFK A;  4HRS A;  4YTM B;  4RF1 A;  1R4M I;  2EEL A;  2K8C A;  1UD7 A;  1T0R C;  2WXQ A;  3KUD B;  2XBB C;  1YNT E;  1HA5 A;  2NTT A;  1PUT A;  3DWM A;  2DLB A;  1TKE A;  3PRZ A;  1AN8 A;  2GBJ A;  4GLS C;  3VTU A;  1FNV A;  4IC7 B;  1WJU A;  4KZC A;  2LFI A;  2LHD A;  4BOS C;  4TQ1 A;  1MFW A;  1K51 A;  2QDF A;  1IP9 A;  3PTF C;  3U52 E;  2PE9 A;  1JRP A;  2PVO D;  4OVV A;  2ZPN A;  4NQL B;  1P7F A;  4HEA 1;  2L05 A;  1J7B A;  1EO6 A;  3PZ7 A;  1XF5 L;  3DWG C;  4M0W B;  4OZA A;  1E7P B;  2W82 A;  1JW9 D;  1ZXI A;  3EFU A;  2WXG A;  3ZW3 A;  3DOW A;  3Q3F A;  4HJK A;  3D32 A;  1E10 A;  4MH8 A;  3BK1 A;  5FKA C;  4AS1 A;  1N61 A;  4BKG A;  1TZ1 A;  1MJD A;  2H88 B;  2MBH A;  2WXF A;  1IUE A;  4HPL B;  5HI1 A;  4NQK E;  4ARC A;  3AED B;  3AEG B;  3L13 A;  2MA9 B;  2G4D B;  1UF0 A;  2QC8 A;  2N9X A;  4W9J A;  4IWO A;  1IBX B;  4JL9 A;  3IT6 B;  1ZGU B;  1Q10 A;  2BTE A;  1AW7 A;  2MLB A;  4D2K A;  3DHG C;  4F7Z A;  3Q14 C;  1TKY A;  1SIF A;  4DWF A;  2KFK B;  2WLB A;  4HJG E;  2L83 A;  3IAM 1;  2WDR B;  1TYG B;  3LDZ E;  2HTH A;  3PGE A;  1GJZ A;  2WP9 B;  5EE9 A;  1SIJ A;  2KTR A;  2YLM A;  1SBB B;  2G45 B;  1H8C A;  3GP7 A;  3M63 B;  2KTR B;  2IGD A;  5JZE B;  3V62 A;  2QCZ A;  3OJ4 B;  2KWD A;  3RN9 C;  3KVF B;  4C80 A;  3HUI A;  2G1E A;  3VR9 B;  1TS4 A;  3QAQ A;  2KVZ A;  1V5T A;  5LXI B;  2LRW A;  3VTV A;  1EU4 A;  3PSE B;  3LYY A;  3H7P A;  3W1S A;  1P1A A;  3FIL A;  1EWY C;  2N7J A;  1VZ7 A;  1BML C;  3U7D A;  4GU2 A;  2BQQ A;  2D3A A;  3ZJU A;  2GRI A;  2WXJ A;  5D94 A;  4A8X C;  2FUH B;  4ZYS A;  1L4D B;  3A1Q B;  1NVI D;  3N3K B;  4W9F A;  2LVP A;  2KWC A;  3I5J C;  2LD9 A;  2DZK A;  4US8 A;  4OVZ A;  3RNE C;  1B9R A;  2LZ6 A;  2RGF A;  5C23 A;  3AE1 B;  2BYE A;  5TR5 A;  4OW0 A;  5D3D A;  3P4S B;  3P63 A;  4K7W A;  1B1Z A;  3N32 A;  3VVW B;  2YEP F;  3T8M A;  3GB1 A;  4ZYN A;  2KFJ A;  3TEY A;  3TUO A;  1VZ6 A;  3EUB 2;  1IYF A;  2Z8L A;  1C79 A;  1TKG A;  2CU1 A;  4JLC A;  2LJ5 A;  3ZLZ A;  4B0M A;  1EF1 A;  2GBK A;  1UBQ A;  3NHE B;  4GIV A;  3ABV B;  2KWV B;  4O1N A;  2FNJ B;  4S17 A;  1JRO A;  4MGI E;  2QIE B;  4KZ0 A;  3DPD A;  3SFE B;  4US9 A;  2ZNV C;  3Q69 A;  4LNN A;  2DHZ A;  5C2T B;  3SDL C;  5HKH A;  1MVK A;  1WGK A;  2JXX A;  5KHO A;  2YVC A;  2D3B A;  3N20 C;  5J17 A;  3BY4 B;  5EE0 A;  1IBX A;  1HTO A;  1HEZ E;  3GS2 A;  1EF5 A;  1XD3 B;  4X57 B;  3A4R A;  1RLF A;  1SE4 A;  2C7H A;  1OFF A;  1T3Q A;  4M8M A;  1KF6 B;  3R8B A;  3W2D A;  3AEB B;  3EHV A;  5T8I A;  3E9S A;  2M19 A;  3AM9 A;  3KLS X;  2M4N A;  1C9F A;  3EC8 A;  3AE7 B;  1FRR A;  1CQV A;  3OG5 A;  1QLB B;  1VCB A;  2G3Q B;  3ZXV A;  1UGM A;  1H4R A;  1WRD B;  1XQQ A;  2XK5 B;  4XZ4 A;  1HTQ A;  1V86 A;  1U4A A;  4XDD A;  2MCN B;  5CHW A;  4XE0 A;  2JUO A;  3AE6 B;  4RCO A;  1IPG A;  4BBN C;  2V9H A;  4FJY A;  1UUP A;  1J19 A;  4KDL B;  2MJD A;  2N9L A;  1V1P A;  4N6E B;  4EFO A;  2J0J A;  4IWP A;  1LGR A;  2IO2 B;  2N7D A;  3MTN B;  2GLS A;  1WXV A;  2JWU A;  1JWM D;  1QOA A;  3KYC D;  3AXC A;  3Q8A A;  4WIP A;  2LXA A;  2L76 A;  2RPV A;  3JW0 X;  2GI9 A;  2M0A A;  3BZD B;  1ISN A;  1YQ4 B;  1I4H A;  4JWS C;  2BYF A;  1TY2 A;  2O2V A;  4KSK C;  2MP2 B;  3Q3J A;  4EZL A;  3T3N A;  5D2M B;  1MPE A;  2LWP A;  2X38 A;  2C7M B;  4XWT A;  2C60 A;  3EA6 A;  5LLI A;  2ZW1 A;  1LQB A;  4A20 A;  3WA0 A;  2AEH A;  3FAH A;  1IGD A;  2HE7 A;  2ICI A;  4XX5 A;  3JSV B;  3OJ3 A;  4IKG A;  3BII D;  2PLP A;  4W9D A;  2WU2 B;  4M00 A;  3AE8 B;  5DCN A;  3N1Z C;  3NG0 A;  2MHJ A;  1DGJ A;  4MM3 A;  2L32 A;  2BYT A;  4WJN A;  4RGN A;  5BYQ A;  2XEW A;  1C78 A;  3VUW A;  2L8J A;  4GDK A;  1WX9 A;  1AAR A;  2GMI C;  3AN1 A;  1WXM A;  1GC6 A;  1EU3 A;  1F9J A;  2ON8 A;  5G5H A;  3U30 A;  4DBG A;  2Y5C A;  2M8S A;  3VQI A;  1WJN A;  1TGZ B;  5HG2 A;  2MWS B;  1QOG A;  2WX0 A;  4HXD A;  1CMX B;  1MHX A;  2IGG A;  3NVY A;  4PYZ A;  1TS3 A;  3W9C B;  1FCC C;  3DCG A;  4ACF A;  4W9G A;  2KK8 A;  4TKN A;  3APD A;  2LXC A;  3DVG Y;  1YN4 A;  2IDY A;  2V0G A;  3N30 A;  4I6N B;  1KM7 A;  1ZE3 D;  2OJR A;  3CWI A;  1SEB D;  1PFD A;  4JPS A;  4LTU A;  2QHO A;  3L0W B;  1FO4 A;  4B0E A;  2I1J A;  4WH4 A;  5IN7 A;  1N6Z A;  3R3M A;  4LK0 M;  4C4V A;  3NJT A;  2LGI A;  3KYD D;  4WAF A;  4FN2 A;  1I4G A;  2FCS A;  1L2N A;  4AWJ A;  3UGB B;  1RFK A;  1E90 A;  3VRB B;  4LJP B;  1HE8 A;  4AOF A;  4PT5 A;  1XCQ L;  4ZRQ A;  3V3X A;  3ECI A;  4DDG D;  3DBH B;  3R7R A;  4ZRJ A;  4WQM A;  1YJ1 A;  3ML8 A;  4EZJ A;  3L4P A;  3VHT C;  5IOI A;  1PGA A;  1YN3 A;  4CO7 A;  1XO3 A;  3HVD A;  3B1L X;  1I4X A;  2ZNV B;  1TZO A;  3U2S C;  3M95 A;  2DWQ A;  2L0T A;  3AV8 A;  5CTR C;  3ZNI D;  3P2B A;  1WGR A;  3IVF A;  1N5X A;  2LUE A;  2JZP A;  1FM0 D;  2YEP B;  4BKS A;  2I1K A;  1Q1O A;  2WXO A;  4DDI D;  1S1Q B;  2B3A A;  1OQY A;  2ACZ B;  2DAF A;  2QIL A;  1C77 A;  4P6V F;  2BT6 A;  3ZRC A;  5AZG A;  2V3S A;  2J7Q B;  3O65 B;  1UGJ A;  3ZVV A;  3RNF C;  2K0P A;  4PS8 A;  2R61 A;  4LJO B;  4BFR A;  2O2V B;  1ESF A;  3BWU D;  1RRB A;  2KMA A;  2WXH A;  3PZD A;  1TT5 B;  2KHW B;  2M56 B;  1BXT A;  1UWM A;  3P1M A;  4WJP A;  4URK A;  2FUG 1;  1OEY J;  3MC8 A;  1IGC A;  1T6B X;  2GBN A;  2OJW A;  1WE7 A;  2JRH A;  3FKY A;  3T3O A;  4ZOH C;  1D6E C;  2NVU I;  3WAN A;  2DZJ A;  1F2R C;  1WXA A;  1D4B A;  1NI2 A;  3PRP B;  3RYT A;  1WYG A;  3H1U A;  2JQR B;  3MJ5 A;  2MBE A;  2WXK A;  2V1Y A;  1JCK B;  4TMA B;  3APF A;  1WF9 A;  2DNF A;  1TJE A;  3HM6 X;  1SXT A;  3DHI C;  4GDL B;  2DYO A;  4RM9 A;  3H7P B;  4A90 A;  3ALB A;  1E8W A;  2OOB B;  2Z59 B;  4E74 A;  4OVU A;  4FBJ B;  1P0R A;  1E7U A;  2BB5 A;  2D07 B;  1OEY A;  5GMV A;  3SEB A;  3MP9 A;  3TEX A;  3M62 B;  2N7E A;  3TSS A;  2BS2 B;  4MSQ B;  4M0W A;  2PEA A;  1RAX A;  1YQ3 B;  3JSV A;  2LVO A;  5CHV C;  1RYJ A;  4IWQ A;  3PO0 A;  3UIN B;  4EE2 A;  4IOI E;  1J8C A;  4IUM B;  2JZZ A;  1GPX A;  3P42 A;  2ZJD A;  2RR9 A;  3N1Y C;  2K1F A;  5J18 A;  4XYC A;  4ASW C;  2WHI A;  2IPK D;  1E7V A;  1VDV A;  4LNO A;  2PJH A;  4GGQ A;  2XNA C;  4ZDV A;  2IBI B;  4FAD A;  3DBL I;  2NBV B;  1S3S G;  1ET6 A;  5D6J B;  2A5U A;  1DOY A;  2J53 A;  4NAM A;  5DPS A;  5MPO A;  2CJN A;  3QX1 A;  5D7G A;  1V49 A;  1YJI A;  2IO3 B;  2K8H A;  2WS3 B;  3NRZ A;  3VAW A;  1X1M A;  1K50 A;  4DXF A;  4DHZ B;  2IY0 B;  4W9I A;  3KW5 B;  4L1B A;  1TY0 A;  1SGH A;  4P7I A;  3IBE A;  4ANW A;  1PQS A;  4LNF A;  4WUR A;  2EKE C;  3I9V 1;  4P1C C;  3H7S A;  5DPW A;  3Q6B A;  1GG3 A;  2G4S A;  1UBI A;  2NBW B;  4ANV A;  1E5W A;  2ZW0 A;  5DPR A;  3RMK C;  4ICU A;  4QAY A;  2AYO B;  2RMM A;  3I63 C;  2KDE B;  2CJO A;  4WWO A;  2AQ1 B;  1J7A A;  4DXG A;  2K5P A;  1I4Q A;  4KGS A;  1ET9 A;  3E56 A;  4K81 A;  3RUI B;  3B08 A;  2KMC A;  3MFG A;  2WXN A;  1K8R B;  1UEL A;  1WY8 A;  4NNJ B;  3UIP B;  2N4F A;  2OED A;  3Q8E A;  1I35 A;  2JYE A;  4ITK A;  5FK9 C;  2PE6 B;  3TCA A;  2D3G A;  4C7Z A;  3QWZ B;  1FNU A;  3RNB C;  3BVG A;  2KDM A;  1C4C A;  3DBS A;  4ARI A;  2L00 B;  1ZDV A;  2MBB B;  3WAO A;  3MC0 B;  1FXT B;  2FCQ A;  4ZRP A;  2PKO A;  3WAL A;  1JQ4 A;  1P7E A;  2WX1 A;  1NBF C;  1PDX A;  1L6U A;  4G50 A;  1L0X B;  4M8N A;  1V81 A;  2IY1 B;  3KH0 A;  3L17 A;  2V3P A;  4BZA A;  2KDI A;  1QZE A;  2IND C;  2LUM A;  3TJP A;  4MJS A;  3ZGZ A;  3SR6 A;  3A1Q A;  1ZUD 2;  4II2 B;  1YQB A;  4NJ6 A;  1BUI C;  3LJ3 A;  4W9K A;  1ZW7 A;  2KNB A;  3PLV A;  3P4R B;  3ZNH B;  3QQ8 B;  4NJ7 A;  2CS4 A;  2LVQ A;  3IG3 A;  1SSN A;  4MEL A;  3AU4 A;  2V4L A;  3W5V B;  4PK1 A;  2PIA A;  1NYQ A;  1WX7 A;  3AE2 B;  1Y56 A;  1YIW A;  1T0S C;  2RDB C;  2JZ3 B;  3RFZ B;  5E6N A;  4MT5 A;  1TIF A;  3NS1 A;  3QA8 A;  4K1R B;  4FXC A;  2MQJ A;  2HD5 B;  2K6D B;  1MHH E;  4WWP A;  4B9K A;  4MGZ E;  1EWC A;  2KAJ A;  1FMA D;  3AEF B;  3NY5 A;  2K9X A;  3SHQ A;  1BT0 A;  1RFA A;  4HVB A;  2IZV B;  1KH0 A;  1N63 A;  4NZL B;  2BWE S;  3RD2 A;  4IG7 B;  4A9A A;  2LGD A;  1DOI A;  1P9D U;  3FC4 A;  2X8X X;  4M01 A;  5G55 A;  2JVC A;  2R2O A;  4L2Y A;  1ROE A;  3ENE A;  3QK0 A;  1V6E A;  3TMP B;  5AZF A;  2L1A A;  4NAW A;  2LHE A;  1L4Z B;  2XK5 A;  3A9K A;  4YXD B;  1WIA A;  3NVZ A;  3ML9 A;  1KTK A;  3W1S C;  4TUU A;  2MSE D;  2WXM A;  2REX A;  3HK0 A;  5BYR A;  2UU7 A;  1SE2 A;  1AWD A;  1KFY B;  2KJR A;  4WJQ A;  3RZW C;  3U4E G;  4WQO B;  3KUC B;  4DHJ D;  1YMH E;  3BVZ A;  1JWA D;  4C00 A;  3TL5 A;  2EMT A;  5C1Z A;  2KFK A;  4ICV A;  2JT4 B;  2KDB A;  1V1P B;  3RI7 C;  5JXV A;  2KMM A;  3U8Z A;  5H8Y E;  2LRU A;  3C0R B;  2TSS A;  3KWL A;  1F52 A;  2EMS A;  1WGH A;  3LXF A;  2K8B A;  3CF6 E;  4KV2 A;  3DVN U;  4C4V B;  3BYT B;  1WE6 A;  3AEA B;  3PHX B;  4W9L A;  2KT7 A;  3J9C A;  2JWZ A;  4J3O D;  1ZOY B;  2K6Q A;  2O6V A;  2KX3 A;  4S0R A;  1M4V A;  1QQR A;  1D5Z C;  3AU5 A;  4H2A A;  4BBN F;  1I42 A;  1HZ6 A;  4KKI A;  2VH2 A;  2BB6 A;  4HLE A;  3CST A;  4N58 A;  3R7Q A;  2VH1 A;  5DPT A;  3IHP C;  4YTN B;  3B2G A;  1K52 A;  3CSF A;  3PPA A;  4EEW A;  4CHK A;  2C7N B;  2D5G A;  3BK2 A;  1NI3 A;  1RWS A;  3IXS A;  3QIJ A;  1V2Y A;  4USA A;  2R2Q A;  3NVW A;  1CJE A;  2JY6 A;  2KX0 A;  2WXI A;  4IM3 A;  2AL3 A;  2PVG C;  4MAC A;  3AE4 B;  3WAP A;  4DHJ B;  1E8Y A;  1VRA B;  1ACC A;  4ANX A;  1WZ0 A;  2KLC A;  3A33 B;  3VDZ A;  1F1H A;  2KLG A;  3WCQ A;  2KO3 A;  3RCZ A;  2HJ1 A;  3KQ4 A;  3QJZ A;  4GXB A;  3LB8 C;  4G11 A;  1C76 A;  3AEE B;  5I4D A;  2LEK A;  2J52 A;  2PTL A;  2PMV A;  2KWU B;  3ZNZ B;  3QHT A;  2DYB A;  4RGO S;  1JWB D;  5FR6 A;  2RPQ A;  3ZTC A;  2Q5W D;  1LM8 B;  1WGY A;  4HRO A;  4M02 A;  1OGW A;  4W9H A;  2PPH A;  3AB5 A;  2QJL A;  3ZNG C;  2AQ3 B;  2BPS A;  4I6L B;  4AJW A;  4A55 A;  4AJY B;  4R3D A;  1WFY A;  1VJK A;  1UH6 A;  2DYM A;  3NZU A;  4RH6 A;  1GB1 A;  3RNA C;  1R4N I;  1SE9 A;  2N9P C;  2ZZP B;  3VRA B;  4AQ7 A;  3ONS A;  3TBL D;  2Z0D B;  1T5X D;  5E6P A;  2CU3 A;  1E0Z A;  3AH7 A;  3WIM A;  3DHH C;  2KN4 A;  2O6V D;  3Q8F A;  2KDF B;  2BVC A;  4IM0 A;  3W1Y A;  3HIZ A;  4ZRI A;  3NZS A;  3GZN I;  5CX3 A;  2KC1 A;  2EKI A;  1WGD A;  2JRI B;  1L0Y B;  1ZXH A;  2D11 A;  2GB1 A;  4KIK B;  3Q8B A;  3IAS 1;  4JE3 B;  3PVL A;  1AYF A;  3BYY B;  1YOV B;  2BBC A;  4GSW A;  1TS2 A;  1LFD A;  2DBY A;  5G5G A;  1HQR D;  4XC2 A;  4HDQ A;  3AE9 B;  2KC2 A;  4ZHP A;  3VH4 B;  3B0A A;  2CR5 A;  3N1X C;  3SD5 A;  2MJE A;  3L54 A;  2I38 A;  1D5X C;  1A70 A;  1D3Z A;  3ZYY X;  2FBW B;  4LDT B;  4BKS D;  1I4P A;  4RM8 A;  2WXP A;  3PT2 B;  1WR6 E;  1PGX A;  4DXA B;  2Y3A A;  1KLU D;  1PYW D;  4WWN A;  3DBH I;  1DYQ A;  4XDC A;  3ZO5 B;  1P3Q U;  2C9W B;  3H6N A;  1FNW A;  4JWU C;  5CHF A;  5BO4 B;  5EE1 A;  4HPM B;  1I4R A;  4JIO U;  2QEJ C;  2K39 A;  3NUH B;  1N62 A;  3AE5 B;  1C3T A;  2KXJ A;  1L6V A;  3OLM D;  2ZCC A;  1NDD A;  2K25 A;  1SJH D;  1FPY A;  1TBE A;  5J2R A;  2L7R A;  3X23 A;  1ENF A;  2O6V B;  4UDU C;  1XLO A;  1DOX A;  1LXD A;  3ZIM A;  3SU8 X;  4FHJ A;  1QOF A;  1V9J A;  1R4N B;  3DVN V;  4MH0 E;  1WJ4 A;  2B76 B;  1XEE A;  4TV3 A;  3V61 A;  4CYE A;  1I7H A;  1EUV B;  1XCT L;  4N9F 4;  2JPH A;  2MH7 A;  4C56 C;  1GB4 A;  1EM7 A;  2QSD A;  1FCL A;  1YX5 B;  2W3R A;  1GUA B;  2JSV X;  3S2A A;  2BWF A;  1TS5 A;  4PS3 A;  4BOZ B;  4KGR A;  2MP2 A;  3RUL A;  3TEW A;  2BF8 B;  1YJJ A;  2WNM A;  5FR3 A;  4A3O A;  3GE3 C;  1V5O A;  2LJI A;  1L5P A;  4FLH A;  1Z5S B;  2KVR A;  4ANU A;  2MRP A;  2BS4 B;  1HZ5 A;  4WJO A;  3UI3 A;  4P1B C;  1WZ3 A;  2N1V A;  1F77 A;  1L7Y A;  2IO0 B;  2H89 B;  4FHK A;  4RGT A;  5C3J B;  1F0Z A;  4YT0 B;  4GDL A;  3APC A;  3RPF C;  4NPN A;  1SE3 A;  3A4S C;  4KX6 B;  1J0G A;  1QF6 A;  3EFC A;  4E71 A;  4J6I A;  2IYD B;  3U7Z A;  1E8Z A;  2WXL A;  3JVZ X;  2WDV B;  5HHD G;  2D3C A;  3RNC C;  2W54 A;  4W9E A;  1WRI A;  3HVZ A;  3ZQ4 A;  3TIX A;  4YL8 A;  1HXY D;  2N9K A;  4WAA A;  1STE A;  3NVV A;  2KAN A;  3I57 A;  3W5U B;  5JHA A;  1A5R A;  1XXG A;  1KLV A;  3R2T A;  1MG8 A;  2DEN B;  3T9L A;  1FXA A;  4P16 A;  3Q3O C;  5AUI A;  3EGR A;  4NAW B;  2K3U A;  4EUT A;  1PGB A;  3BVM A;  1VD2 A;  1ZP0 B;  2N1W A;  4REZ A;  2INN E;  3IT4 B;  2DZI A;  2KQ7 A;  4GN1 A;  5BYS A;  4PS7 A;  3V6C B;  2NBU A;  2BKR B;  2LGY A;  1E9M A;  1P98 A;  1QT9 A;  1NYR A;  2M1M A;  2KKC A;  5GXG B;  2J4X A;  4W9C A;  3Q8C A;  1YX6 B;  3AMZ A;  2L3Z A;  2SEB D;  3VUX A;  3A9J A;  4KGT A;  1C4P A;  1YD8 U;  3VXW A;  3K9O B;  2UWQ A;  2RDH A;  2VZK B;  1UNS A;  1RM6 C;  2GOW A;  5IO9 A;  2MJ3 A;  4BAX A;  2C5L C;  2V4I B;  4B95 A;  4CQN A;  2BYV E;  3ZTD A;  4B6W A;  3ZDM C;  1TTN A;  2A4Z A;  3H8H A;  2W3S A;  3Q3N C;  1NEN B; 
#chains in the Genus database with same CATH homology
 1QOG A;  2WXQ A;  1MHX A;  1SE2 A;  4RFB A;  2IGG A;  1AWD A;  3NVY A;  1KFY B;  1HA5 A;  1TS3 A;  1YNT E;  1PUT A;  2NTT A;  3DWM A;  4OZB A;  3W9C B;  3U4E G;  1FCC C;  2DLB A;  1YMH E;  3BVZ A;  1JWA D;  1OQR A;  1TKE A;  1AN8 A;  2QMT A;  2XN9 C;  1YN4 A;  2IDY A;  2V0G A;  1ZE3 D;  1V1P B;  3CWI A;  4GLS C;  1SEB D;  1PFD A;  5D3I B;  5JXV A;  1FNV A;  4A6Q A;  4JPS A;  4LTU A;  2LFI A;  2KMM A;  2LHD A;  4TQ1 A;  4L23 A;  5H92 C;  4B0E A;  1K51 A;  4WH4 A;  1FO4 A;  1XLP A;  5H8Y E;  3AEC B;  2TSS A;  1GOZ A;  3AE3 B;  3KWL A;  3U52 E;  4LK0 M;  1JRP A;  2PVO D;  3LXF A;  2LGI A;  2IGH A;  5EE3 A;  4JX1 C;  4WAF A;  1P7F A;  1I4G A;  3B9J A;  2OHF A;  3BYT B;  3AEA B;  1RFK A;  3J9C A;  1XLN A;  4J3O D;  1ZOY B;  4YWG G;  3VRB B;  4HEA 1;  1M4V A;  1QQR A;  1D5Z C;  1J7B A;  4H2A A;  3PZ7 A;  1XCQ L;  1XF5 L;  3DWG C;  4OZA A;  4PT5 A;  4ZRQ A;  3V3X A;  1HZ6 A;  1OQQ A;  1WXQ A;  4KKI A;  2BB6 A;  1E7P B;  4N58 A;  2W82 A;  1QOB A;  4WQM A;  1JW9 D;  1ZXI A;  3L4P A;  4KKJ A;  2WXG A;  4YTN B;  3B2G A;  1K52 A;  2KQ4 X;  1PGA A;  1YN3 A;  3URY A;  1R7S A;  1XO3 A;  1E10 A;  4MH8 A;  3HVD A;  5E6J A;  2D5G A;  3BK2 A;  3BK1 A;  1MI0 A;  5FKA C;  1NI3 A;  1RWS A;  1I4X A;  3IXS A;  4AS1 A;  1TZO A;  3U2S C;  2DWQ A;  1N61 A;  3AV8 A;  4USA A;  1GAQ B;  3NVW A;  2H88 B;  1CJE A;  2WXF A;  1N5X A;  3NZ3 A;  2JZP A;  1FM0 D;  1IUE A;  2YEP B;  5HI1 A;  4ARC A;  3KWV A;  3R2I A;  3AED B;  3AEG B;  4YSY B;  2WXI A;  2BW2 A;  2PVG C;  4MAC A;  2WXO A;  3AE4 B;  2ACZ B;  2QIL A;  1C77 A;  1VRA B;  1V97 A;  1ACC A;  2BT6 A;  4P6V F;  2LMC A;  4XWW A;  1IBX B;  1CK1 A;  3IT6 B;  3WCQ A;  4OZC A;  1UGJ A;  1Q10 A;  2K0P A;  1FXI A;  2BTE A;  2R61 A;  1AW7 A;  2RDG A;  3KQ4 A;  4D2K A;  1TKY A;  1ESF A;  2WLB A;  3LB8 C;  2NMQ A;  3BWU D;  4HJG E;  2L83 A;  3IAM 1;  1C76 A;  2WDR B;  2WXH A;  1TYG B;  3AEE B;  2FE8 A;  2M56 B;  1BXT A;  5I4D A;  1UWM A;  5BMG A;  2LEK A;  3P1M A;  2J52 A;  2PTL A;  2WP9 B;  4HKZ E;  2PMV A;  5EE9 A;  1SIJ A;  2E6X A;  1SBB B;  2FUG 1;  3GP7 A;  1IGC A;  1T6B X;  2IGD A;  4RGO S;  1JWB D;  1JWS D;  2KWD A;  3T3O A;  4ZOH C;  2Q5W D;  1D6E C;  4HRO A;  4C80 A;  4YSZ B;  1F2R C;  3CIR B;  3AB5 A;  3HUI A;  2QJL A;  2AQ3 B;  2G1E A;  1D4B A;  2KAC A;  3OWE B;  3VR9 B;  4A55 A;  1TS4 A;  4R3D A;  1VJK A;  1WYG A;  2W55 A;  2DYM A;  2JQR B;  3MJ5 A;  4RH6 A;  1GB1 A;  2WXK A;  2BS3 B;  1JCK B;  4TMA B;  1EU4 A;  4YTP B;  3LYY A;  3W1S A;  3FIL A;  2ONQ A;  1TJE A;  1SXT A;  1EWY C;  4GDL B;  3O13 A;  2DYO A;  2N7J A;  1VZ7 A;  3ETR A;  1BML C;  3VRA B;  1JWU D;  4A90 A;  4AQ7 A;  4NJC A;  1FIQ A;  1T5X D;  2CU3 A;  1E0Z A;  3AH7 A;  2BB5 A;  2KN4 A;  3Q8F A;  1NEK B;  2INP E;  3SEB A;  3ZJU A;  2GRI A;  2WXJ A;  3MP9 A;  3TEX A;  4A8X C;  4ZYS A;  3ZJV A;  3TSS A;  2BS2 B;  1L4D B;  4M0W A;  2I2Y A;  1NVI D;  2EKI A;  1L0Y B;  1YQ3 B;  1ZXH A;  1L0V B;  2N0S B;  4US8 A;  1FEH A;  4OVZ A;  1RYJ A;  2GB1 A;  3PO0 A;  1B9R A;  4EE2 A;  1V1O A;  4IOI E;  3AE1 B;  3Q8B A;  3IAS 1;  1JAL A;  4OHJ A;  3FIL B;  1GPX A;  3P42 A;  4JE3 B;  3B2F A;  4OW0 A;  1AYF A;  3BYY B;  1SB3 C;  5D3D A;  2BBC A;  1TS2 A;  2MEK A;  2DBY A;  3P4S B;  2IPK D;  3P63 A;  5G5G A;  1VDV A;  2VZK D;  1B1Z A;  1HQR D;  2HDE A;  2YEP F;  3AE9 B;  4LLG M;  4DQO C;  1XLQ A;  2XNA C;  4ZHP A;  3GB1 A;  3P4Q B;  1KRH A;  3TEY A;  1WSP A;  3TUO A;  2MJE A;  1VZ6 A;  3EUB 2;  1ET6 A;  1D5X C;  1A70 A;  2I38 A;  3ZYY X;  1DOY A;  2FBW B;  1VLB A;  2J53 A;  2Z8L A;  1C79 A;  1TKG A;  4NAM A;  4B0M A;  1I4P A;  5BMI A;  5MPO A;  2WXP A;  2CJN A;  1PGX A;  5D7G A;  2Y3A A;  2JU6 X;  1KLU D;  1YJI A;  1PYW D;  2WS3 B;  1DYQ A;  3ABV B;  4XDC A;  3NRZ A;  1FNW A;  1K50 A;  4JWU C;  4O1N A;  4DXF A;  4YSX B;  1JRO A;  3TEZ A;  5EE1 A;  4L1B A;  1TY0 A;  5BMH A;  1I4R A;  2QIE B;  1FFV A;  1JML A;  2QEJ C;  3NUH B;  1N62 A;  3AE5 B;  3SFE B;  4WUR A;  4US9 A;  1L6V A;  5LNK 1;  2V3N A;  3I9V 1;  3Q69 A;  4RGM A;  1SJH D;  1ZPS A;  4GDK B;  2WXR A;  5C2T B;  1MVK A;  1WGK A;  1ENF A;  4UDU C;  1XLO A;  1DOX A;  3V05 A;  2ZW0 A;  1QOF A;  2B76 B;  1XEE A;  2JXT A;  5EE0 A;  1IBX A;  1HEZ E;  2RMM A;  3GS2 A;  4RNA A;  1I7H A;  1XCT L;  2K22 A;  3N9Y C;  4TQ0 A;  2CJO A;  1SE4 A;  1OFF A;  2AQ1 B;  2MH7 A;  1T3Q A;  4C56 C;  1EM7 A;  1GB4 A;  1KF6 B;  1J7A A;  2QSD A;  1FCL A;  3R8B A;  2W3R A;  4DXG A;  2K5P A;  3W2D A;  1I4Q A;  3AEB B;  5T8I A;  2JSV X;  4KGS A;  1ET9 A;  3E9S A;  3E56 A;  2M19 A;  3AM9 A;  1FD6 A;  3KLS X;  1C9F A;  1SJE D;  1TS5 A;  3AE7 B;  1N5W A;  1FRR A;  1CQV A;  1QLB B;  1FRD A;  1YN5 A;  3MFG A;  2WXN A;  4KGR A;  2WQY B;  3TEW A;  2OED A;  1YJJ A;  3SFD B;  2NTS A;  2WNM A;  3Q8E A;  2JYE A;  4XDD A;  5FR3 A;  4ITK A;  4Q2J A;  5FK9 C;  2LJI A;  1L5P A;  4C7Z A;  3C8Y A;  2BS4 B;  1HZ5 A;  1V8C A;  3UI3 A;  1FNU A;  2IJ0 A;  2AX5 A;  3BVG A;  3AE6 B;  2KDM A;  4XE0 A;  1C4C A;  4ARI A;  4RCO A;  1F77 A;  1ZDV A;  1UUP A;  2H89 B;  1F2R I;  2AQ2 B;  3MC0 B;  4RGT A;  5C3J B;  2MJD A;  4ZRP A;  2N9L A;  1FFU A;  1F0Z A;  2PKO A;  1V1P A;  4N6E B;  4YT0 B;  1E6E B;  2L52 A;  3RPF C;  4HKQ A;  1JQ4 A;  1P7E A;  3P4P B;  1CZP A;  1PDX A;  1L6U A;  1VR9 A;  4C7Y A;  1L0X B;  1SE3 A;  2V3P A;  4KX6 B;  1QF6 A;  4RF0 A;  2LUM A;  5TSS A;  3U7Z A;  3ZGZ A;  3SR6 A;  2JWU A;  2WXL A;  1ZUD 2;  1JWM D;  1QOA A;  1BUI C;  2WDV B;  3Q8A A;  4WIP A;  3P4R B;  5HHD G;  5AUK A;  1QIL A;  2SAK A;  2WU5 B;  3VR8 B;  2RPV A;  1SSN A;  2GI9 A;  2M0A A;  3BZD B;  4WWM A;  3HRD D;  2W54 A;  3W5V B;  1WRI A;  2JYT A;  1YQ4 B;  3HVZ A;  4IDI A;  1I4H A;  4JWS C;  3ZQ4 A;  1UWX A;  1K53 A;  1TY2 A;  2PIA A;  1HXY D;  1ZDX A;  1NYQ A;  2N9K A;  1STE A;  2J42 A;  3NVV A;  3AE2 B;  1Y56 A;  3I57 A;  3W5U B;  1MPE A;  3T3N A;  1WWT A;  2X38 A;  2E3T A;  1XXG A;  4XWT A;  3RFZ B;  3PZ8 A;  3EA6 A;  4MT5 A;  2ZW1 A;  3NS1 A;  3R2T A;  2PW9 A;  1FXA A;  4P16 A;  2JX5 A;  5AUI A;  3FAH A;  4FXC A;  3EGR A;  4NAW B;  1IGD A;  2K3U A;  1MHH E;  2ICI A;  1PGB A;  3BVM A;  4IKG A;  5HFY A;  3BII D;  1ZP0 B;  1EWC A;  2PLP A;  4REZ A;  2KAJ A;  1FMA D;  2WU2 B;  1SF0 A;  2INN E;  1VZ8 A;  3AEF B;  3IT4 B;  3AE8 B;  4ZHO A;  2WDQ B;  1N60 A;  1QKZ A;  2K9X A;  5BYS A;  1E9M A;  1QT9 A;  4N59 A;  4MM3 B;  1KH0 A;  1NYR A;  1N63 A;  2Y5P A;  4NZL B;  1LO5 D;  5GXG B;  1C4A A;  2J4X A;  4A9A A;  1D5M C;  3Q8C A;  1DGJ A;  2HTM E;  3AMZ A;  1DOI A;  2L32 A;  4TSS A;  2BYT A;  2SEB D;  3FC4 A;  4KGT A;  4L2Y A;  4RGN A;  1C4P A;  5BYQ A;  1ROE A;  1C78 A;  2G9H D;  1J7C A;  1KLG D;  3MHZ A;  2RDH A;  2VZK B;  3ZJT A;  1UNS A;  3AN1 A;  1RM6 C;  2L1A A;  4YXD B;  2LHE A;  1L4Z B;  2MJ3 A;  3NVZ A;  1EU3 A;  2V4I B;  1KTK A;  2ON8 A;  4CQN A;  2WXM A;  5G5H A;  4HRS A;  4YTM B;  4RF1 A;  2Y5C A;  3VQI A;  2EEL A;  3H8H A;  5HG2 A;  2W3S A;  5BYR A;  1NEN B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...