4JWUC

Crystal structure of cytochrome p450cam-putidaredoxin complex
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
106
structure length
106
Chain Sequence
b'SKVVYVSHDGTRRELDVACGVSLMQAAVSNGIYDIVGDCGGSASCATCHVYVNEAFTDKVPAANEREIGMLESVTAELKPNSRLCCQIIMTPELDGIVVDVPDRQW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Camphor 5-monooxygenase
publication title Structural basis for effector control and redox partner recognition in cytochrome P450.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Oxidoreductase/electron transport
total genus 29
structure length 106
sequence length 106
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4jwuC00
1WWTA 4N6EB 2M56B 1JROA 2JX5A 1KFYB 2W3SA 1NEKB 2WU2B 3AE8B 1QOFA 3L4PA 3AE4B 5AUKA 1OQQA 1JALA 2FBWB 3NVYA 1OFFA 1N5XA 1TKGA 1WXQA 1DOYA 1VJKA 4FXCA 2K9XA 2L52A 3AE6B 1XLOA 1YQ3B 2CJOA 2MJ3A 1SIJA 1V8CA 2MJEA 1DGJA 1I7HA 3AE3B 3AM9A 3HRDD 3NS1A 1PUTA 1ZXIA 1DOXA 1IUEA 2DWQA 1EWYC 1NYRA 1RFKA 2CU3A 2WS3B 3P4PB 1XO3A 3VRAB 2BT6A 4YSYB 1E9MA 2K5PA 3FAHA 1J7CA 2EKIA 1J7BA 1JW9D 1AYFA 1L6UA 3DWGC 2E3TA 2WLBA 3NVZA 3SFEB 1N5WA 2W55A 1WYGA 2H88B 1PDXA 3AE2B 3PO0A 2G1EA 3W5VB 4US8A 2MH7A 3AEFB 4LTUA 1FIQA 4ZHOA 2PVGC 3AEBB 2L83A 1FRRA 3SR6A 1JWAD 4ZHPA 1QOAA 2WP9B 3AE1B 1N61A 2WU5B 2WDVB 4YTNB 1FRDA 4JX1C 5MPOA 3WCQA 1JQ4A 1JWBD 2LEKA 5H92C 1QF6A 1QLBB 1WGKA 2WDRB 3AH7A 1TJEA 2W54A 3HUIA 2WQYB 1NENB 3VRBB 4ITKA 1JRPA 2WDQB 1E0ZA 3EUB2 2B76B 1FXIA 2BS2B 2MJDA 3AMZA 3LXFA 1FXAA 1FFVA 3AEAB 4ZOHC 5EE1A 1TKYA 1SF0A 2CJNA 3AV8A 3AB5A 3W5UB 1DOIA 4YXDB 1PFDA 4N58A 1CZPA 1QT9A 4JWUC 1F0ZA 1SB3C 1CJEA 1YJJA 5EE0A 4C7YA 4JWSC 3ABVB 4WWMA 1ZOYB 2ACZB 4YT0B 1N62A 1YJIA 3NRZA 1YQ4B 5H8YE 5G5HA 5EE9A 1RM6C 1VDVA 3P4RB 3AN1A 2PIAA 2K22A 1TKEA 1V97A 3AECB 4N59A 1FO4A 4IDIA 1B9RA 1E10A 1N60A 4C7ZA 3ETRA 1UWMA 1E7PB 3CWIA 3B9JA 4P6VF 1XLPA 2QIEB 2BS3B 5EE3A 3AE7B 4YSZB 3NVVA 3ZYYX 2Q5WD 2H89B 3AEDB 3FC4A 1WRIA 1FMAD 1RYJA 3AE5B 1R7SA 3KWLA 3CIRB 3NVWA 2QJLA 2Y5CA 2KMMA 1NVID 4C80A 1TYGB 2N0SB 1N63A 4HRSA 3SFDB 1E6EB 1KF6B 1L0VB 2KAJA 2PVOD 3HVZA 4USAA 4KX6B 1T3QA 3VR8B 4YTMB 1GPXA 3LB8C 2M19A 2HTME 1FFUA 2AX5A 1L6VA 1J7AA 1ZUD2 3W9CB 1FM0D 1L5PA 1NI3A 1ZP0B 3P4QB 5C3JB 3RPFC 1GAQB 1QOBA 2W3RA 1QOGA 2PKOA 5AUIA 1RWSA 1A70A 4US9A 2OHFA 1OQRA 3B2FA 3P1MA 1VLBA 2BS4B 1NYQA 3P4SB 5G5GA 4YTPB 3AE9B 2JQRB 1KRHA 3DWMA 2DBYA 3BIID 3VR9B 5GXGB 5C2TB 4HROA 3AEEB 3P63A 1AWDA 4YSXB 4A9AA 1ROEA 1XLQA 3AEGB 1XLNA 4WQMA 3B2GA
chains in the Genus database with same CATH superfamily
2IO1B 2RD0A 2WX1A 2GBJA 4E3CA 3IFWB 2RDHA 4GGQA 1NBFC 2HE7A 1V8CA 4II2B 1DGJA 1GNUA 1RFKA 4XX5A 3RNEC 1WI0A 3WAPA 3Q14C 4KZCA 4S17A 3KUCB 1ACCA 1L4ZB 4WQOB 1L7YA 2BF8B 1JWAD 3DBLB 4JGHB 4AWJA 1FRDA 3ZGZA 1IGCA 1P7FA 2WXRA 3RI7C 5J18A 1WE7A 4DK5A 2JUOA 1WXMA 2I2YA 3W1SA 3H7PB 2J7QB 4ZOHC 2DLBA 4C00A 1I4PA 3QA8A 3W5UB 2KK8A 1TGZB 1SB3C 1YJJA 4HCPB 4LDTD 2OOBB 3V05A 2MSED 1ET6A 2CU1A 1WX8A 4IC7B 1BMLC 5HKHA 2LGDA 4FULA 2BWFA 1V97A 4XWTA 1V5OA 1WFYA 3BZDB 1T0SC 2INNE 4TMAB 5FR6A 4P6VF 4D2KA 2ZNVC 2KDMA 2Q5WD 2FUHB 1RYJA 5HFYA 4RGNA 1E8XA 2QSDA 4EE2A 4H2AA 2KMMA 4ZYSA 2UU7A 1KM7A 4YL8A 3GZNI 2IDYA 3KUDB 5IKCM 4OZCA 2HTME 1KLGD 3QWZB 2MA9B 3B2FA 3KLSX 1D4BA 1DYQA 4YTPB 2KKCA 3NOBA 2J0JA 2PEAA 2YEPF 2RMMA 5CHWA 2ZPNA 5IOIA 1N5XA 1H8CA 1L0YB 2MX2A 3T9LA 3AE3B 2KX3A 2LXCA 1E9MA 1IGDA 2K5PA 1J7CA 1CK1A 1IPGA 4TKNA 2LGYA 3DHHC 4MSMB 1XEEA 4PS8A 5BYSA 3C8YA 1XCQL 4NAMA 4OVVA 4ZHPA 2IBIB 4K81A 1HTOA 2WU5B 3P42A 3NUHB 4ITKA 2CHWA 1WJ6A 2RR9A 3GS2A 1MHHE 1V5TA 4K1RB 4MGIE 1QT9A 2KDBA 4KDIC 1X1MA 3L0WB 4BFRA 3A4SC 3QJZA 3P4RB 2GBNA 1XCTL 3BINA 1EM7A 3Q8EA 5EE3A 3HHMA 2LRWA 1SGHA 4J3OD 2V9HA 2NR2A 4NY0A 3L08A 4HEA1 3ONSA 2KVZA 4A20A 4USAA 1GPXA 3VR8B 2MW5A 3WANA 1ZUD2 1E8ZA 3DVGX 3P4QB 4ZRPA 2K3UA 1OQYA 2M0AA 3RD2A 2KHWB 1V6EA 4FLHA 2RDGA 4YSXB 3O13A 4RGOS 2WXQA 1HTQA 3AEGB 2MRPA 1WWTA 1QOFA 1V1OA 3MC0B 4W9FA 3U30A 2J52A 1OFFA 4OVZA 4WURA 4CQNA 3DBLI 2O2VB 3A1QB 1C4PA 1JCKB 2D5GA 3JSVB 2N1WA 2JZZA 3Q3JA 3MJ5A 2JYEA 3RCZA 2KQ7A 3AEFB 2XNAC 3DBHB 3DVNV 4R3DA 1K51A 3H6NA 3IT6B 1I4HA 2IYDB 1VD2A 2X8XX 3ZO5B 4RNAA 4LLGM 1WSPA 2KDIA 3MP9A 4P16A 4DXFA 4BOZB 1GG3A 1WXAA 3PLUA 2MBHA 1WY8A 2JSVX 1WYWB 3AV8A 3AB5A 4YXDB 5J2RA 3Q3MC 2WGSA 1PQSA 3B1LX 3DHGC 5EE0A 2OEDA 5CTRC 2ACZB 4ARIA 3ZDMC 5JH5C 4ANVA 3CSTA 2V4IB 4EZJA 3AN1A 4YWGG 5BMIA 3ZNGC 4HWIB 3N1ZC 4N59A 1B9RA 3ETRA 1B1ZA 2K25A 3B9JA 2BYTA 1T0RC 3NVWA 1GC7A 2LVQA 2ZNVB 4XDDA 2QJLA 2Y5CA 3VDZA 1U4AA 5FKAC 5AZHA 4RGMA 4OZAA 3GOEA 1WM3A 4GXBA 3ALBA 1WXVA 4NQLB 1KOTA 1L5PA 3PZ7A 1YN3A 2BQQA 3WALA 3PTFC 1HEZE 1TS3A 2KACA 3JVZX 4ZDVA 1IBXA 3L10B 3DCGA 3BK1A 4L2YA 5H8YE 1SBBB 3KYCD 4LNOA 1AW7A 1WMHA 5DPTA 1L4DB 2ONQA 1TTNA 3PS6A 3V60A 1SJHD 3R2IA 2BKRB 4ICVA 4MGYE 1RRBA 1EWYC 3V3XA 1HQRD 1J7BA 1JW9D 3UINB 2V3NA 4C4VB 4B6WA 4ZHOA 5C23A 2UWQA 4FBJB 1QF6A 4W9KA 3TEZA 2XK5B 2AWTA 1KTKA 1FXAA 3RT3B 1XT9B 5JHBA 2BBCA 4ASWC 5E6NA 3IG3A 1KLVA 1V1PA 3MFGA 3U8ZA 2IO2B 4JWSC 4LDTB 2L3ZA 1WXSA 1MI0A 3N20C 2WX0A 2MP2B 2MLBA 2A4ZA 3AECB 3UGBB 3A9JB 1OGWA 1SE4A 2IJ0A 3BVGA 2H89B 1R7SA 3MHSD 5FR3A 4MELA 1V49A 3W1YA 3ZVVA 1TYGB 2YVCA 5E6JA 1PGAA 4WJOA 4HPLB 1MPEA 5LNK1 2QCZA 3RPFC 3TIXA 4XYCA 2LZ6A 3N1YC 3P4SB 3ZRCA 4A3PA 1VCBA 1YX5B 4HK2A 2DBYA 3BIID 2L32A 4KKIA 2WDTB 3L13A 4ANWA 4N6EB 4EKUA 4E71A 4TSSA 5TSSA 3AE4B 3DBHI 5IP4D 1YOVB 4HKZE 4NAWA 3VHTC 3PGEA 1YQBA 2DYOA 4L1BA 4G3XB 3P2BA 3QX1A 2O6VA 3PT2B 4CYEA 2CS4A 2WP9B 3AE1B 3I5JC 2INDC 4FJYA 3APCA 1F77A 3HUIA 2RPQA 1E0ZA 3EUB2 1FXIA 3AMZA 1BUIC 4MEMA 4L23A 4UDUC 5AEKB 1LO5D 4WAAA 1SF0A 2V3PA 1ZKHA 4JWUC 1RAXA 1ZW7A 2JT4B 3AI5A 4WWMA 1N62A 2DZIA 1D5MC 2YLMA 2K22A 2KJ6A 1N60A 1UWMA 4KGTA 1UF0A 2BS3B 5DCNA 2BGFA 3ZJTA 2I1JA 5IO9A 5CHFA 4G11A 4RMAA 1Q0WB 2G9HD 1NVID 2MHJA 2LGIA 3ZIMA 2GOWA 4PYZA 2KWCA 1T3QA 3TSSA 4BBNC 3LB8C 2XN9C 5I4DA 2UYZB 1FM0D 2AEHA 5C3JB 4RM9A 1OQRA 4ARCA 3U52E 2JZ3B 3U4EG 4HKQA 3ZXRA 2D07B 4BKTA 3PPAA 2FIDA 4MH0E 2ON8A 3AE8B 2VZKD 3H9DA 2LWPA 1WGYA 3Q8CA 1UWXA 1XLOA 2MJ3A 2KZRA 2LUEA 1ZXIA 3X0WA 2INCC 2WXJA 1SJED 2WLBA 4KGSA 2W55A 4MGKE 1VR9A 2BKFA 4I6PA 1SIFA 3AEBB 4B0MA 4KVGB 4YTNB 2HJ1A 2PW9A 3A33B 2WDQB 1FNUA 4WH4A 4PT5A 1ZDVA 1SE3A 4A90A 2NCNA 3ZTDA 3WAOA 3E9SA 2KOXA 3ZQ4A 1E90A 4TQ0A 1YQ4B 2AYOB 1RLFA 3Q8BA 1VDVA 3DDCB 1FO4A 3UIPB 2BYVE 3APFA 3M95A 2HDEA 4A8XC 2DAFA 2O6VD 2QHOA 2R2QA 3HK0A 4IOIE 1AN8A 3EHVA 2BWES 4I6LB 3D32A 2N0SB 4HRSA 1E7VA 1WZ3A 4GDKA 3QK0A 4PYUA 1F1HA 2V3SA 4BKSA 1KH0A 3VTUA 4DDID 5BO4B 1NI3A 1P1AA 4MJSA 1GAQB 3LJ3A 1F2RC 2JY6A 4WJNA 1FNVA 2JQRB 2KWUB 3FKYA 1TIFA 1Y56A 3EA6A 1JRUA 2BPSA 2M17A 5C1ZA 3AEEB 4IM2A 1M94A 1QKZA 2ZCCA 2K8BA 5HI1A 3K9OB 2N7EA 5IA7A 4BVUC 4W9EA 1J8CA 1WXQA 5E6OA 1C3TA 1SIJA 2NMQA 2MJEA 3N1XC 2N9XA 4JL9A 1V86A 1EF5A 3WAMA 1JWUD 2AL3A 1JMLA 2KFJA 4W9LA 3SFEB 4LJPB 3AE2B 4NJCA 4ANUA 4M8MA 2KWDA 4LCDE 5TR5A 1NDDA 4IKGA 2WHIA 5IN7A 4AQ7A 5DPRA 4ZRIA 1V81A 2PE6B 4BKGA 3BWUD 1LM8B 1K8RB 3AEAB 4PS3A 1TKYA 4BAXA 4REZA 3DPDA 5EDSA 1IYFA 5CX3A 1D5ZC 4KIKB 3DHIC 1TZOA 1WH3A 3URYA 2AQ3B 2V1YA 2DENB 3IXSA 3NVVA 3HM3A 3VUWA 1MJDA 3AEDB 4MH8A 1ZPSA 3DVGY 3IHPC 3RZFA 3IBEA 1GB1A 3ML9A 2KN5A 5E6PA 2FCNA 2M19A 3SU8X 1MG4A 2A5UA 3JYUA 3VTWA 2K8CA 4MT5A 4B95A 3OWEB 2JWUA 2IGDA 1WX9A 2BYFA 4IWPA 2LVPA 4DBGA 2TSSA 3RMKC 2J42A 2WS3B 3DQVA 1LGRA 1XF5L 2WWZA 3FILA 1NEKB 2FIFA 2KVRA 1GC6A 4S0RA 4IWQA 1C76A 2GBRA 3C0RB 4A55A 2FAZA 3B08A 1I7HA 1LFDA 3DBSA 3AM9A 4GMVA 2KO3A 2NPTB 1XO3A 1E8WA 3Q8FA 2FCSA 2C7NB 2EKIA 3HM6X 2ZVNA 3UQBA 2KWVB 1GUAB 1UUPA 1N5WA 4FJZA 3NG0A 2IY0B 2MH7A 4BKSD 2Y5PA 4XE0A 2R2OA 3V62A 1C78A 5DPWA 2L83A 2J53A 3SD5A 1N61A 2WDVB 1FD6A 2BTEA 4W9DA 4ICUA 4AUQC 4MGZE 2W54A 4GOCA 4B9KA 3SHQA 4RM8A 3TMPB 3I63C 4N58A 4IG7B 3OJ3A 4W9IA 3NHEB 2INPE 4F7ZA 1LQBA 2MBOA 2DYMA 1EO6A 3AXCA 3KUZA 1UELA 4DXAB 2ZCBA 1ZGUB 5G55A 2N9LA 1UH6A 1E5WA 2LASA 4W9JA 4EEWA 2NBVB 2JU6X 2Y3AA 1WJ4A 5AZGA 4DHJB 3LYYA 1Q1OA 2IPKD 2BB6A 3VUXA 4O1NA 3QAQA 4I6NB 4MM3A 3L16A 4TUUA 3HVZA 1YIWA 3BK2A 3IAS1 1ZP0B 3MC9A 1QOGA 1VRAB 4DDGD 2OHFA 5BMGA 3Q2AC 3AE9B 1Q5WB 3J9CA 4WAFA 2LUMA 4ZYNA 1EUVB 1AWDA 4NZLB 1S1QB 2N1VA 3TBLD 1EF1A 2PLPA 3W1SC 1OEYJ 3ZKJC 1YMHE 2VZKB 3R2TA 3DVNU 2K9XA 2D3AA 2K6DB 3NS1A 3QHTA 1IUEA 1PGXA 2KTRB 4URKA 2WXHA 2D11A 4KV2A 2FCMA 3NVZA 3PZDA 2KDFB 3TUOA 1QQRA 4DWFA 3PO0A 5LXIB 3W5VB 3Q6BA 1ZXHA 4LTUA 4K7WA 2E6XA 4DXGA 1TY0A 4PS7A 2LMCA 4RCOA 1J0GA 3ML8A 4JX1C 5L83A 3S2AA 1IP9A 3KW5B 1WGKA 2WDRB 2KMAA 1NENB 3ZJVA 4WJQA 3C19A 2O2VA 2I1KA 1YN4A 3EC8A 3A1QA 4HCNB 2V4LA 3JSVA 4OHJA 2D3CA 1F0ZA 1OEYA 2YEPB 4CO7A 2MBBB 1YN5A 4C56C 4NAWB 1YJ1A 4RH6A 1I4RA 2KC1A 4AJWA 1WX7A 5JHAA 5BMHA 3PRPB 4A3OA 1E10A 4A6QA 4P7IA 3IT4B 2PPHA 3RNCC 5KHQA 3AE7B 2C7MB 3FC4A 1WRIA 3PSEB 4W9GA 3KQ4A 4RFBA 3NS8A 2KNBA 3V6CB 4JE3B 2WXPA 3TEWA 1WE6A 3ZNHB 2J0KA 2LD9A 2W3RA 4ZRQA 1A70A 2IO3B 1KJTA 1KRHA 2EKEC 1GJZA 1FPYA 3HIZA 2N9EB 5D3IB 2JZPA 3O65B 3MHZA 2JX5A 3MC8A 4LNKA 1WIAA 1CMXB 3U2SC 1OQQA 3R66C 2LGXA 2DAJA 3VAWA 3PREA 1K50A 2D2QA 2VRRB 3VTVA 1SE2A 2KT7A 4EZKA 2KN4A 2WXGA 2KJRA 3QCAA 3RN9C 1I4GA 2E3TA 3N30A 2KFKA 2SAKA 4M0WB 5J17A 3NJTA 4P1CC 1WF9A 2D10A 4GDLB 2GBKA 3H7SA 3WCQA 1JQ4A 1JWBD 5HG2A 2OJWA 2PTLA 2QC8A 3HVDA 1UZXB 3DBRB 3SDLC 2CJNA 1FCLA 1PGBA 2ICIA 4ZRJA 3WA0A 4KZ0A 2NTTA 4Q2JA 5D94A 3GB1A 4IW0A 1T0QC 4C4VA 3BYYB 3R7RA 1P0RA 3KVFB 2LJIA 2PIAA 4MDKE 3A9KB 2ZVOA 3T3OA 2XK5A 2G4SA 3ZYYX 5JZEB 3N32A 1V2YA 4HDQA 4KGRA 1F2RI 3GE8C 1R4NB 3B0AA 1C79A 4AOFA 2KANA 4CHKA 1WM2A 2JRHA 2PVOD 3ECIA 4KX6B 1FFUA 3W9CB 3NZUA 1C4CA 5D2MB 1QOBA 2MP2A 2PE9A 3L17A 2BS4B 1NYQA 3DWMA 2M1MA 2M8SA 2NVUI 2MBQA 3A9JA 3Q8AA 4GB9A 4OVUA 3APDA 1K53A 3VH4B 2K6QA 4HJKA 1UBIA 1SE9A 3R7QA 3I3TB 4RF1A 1V80A 2DWQA 3KWVA 4DHZB 2JYTA 1WGGA 2CHZA 3K9PB 1MFWA 2QEJC 3M3JA 4NJ7A 4AS1A 1UGJA 3RULA 2LGSA 2IY1B 2ZPYA 1FEHA 3AH7A 1C77A 3ZRFA 3VRBB 2KLCA 3VXWA 1JWSD 4XC2A 3ZUNA 4ACFA 3CSFA 1PYWD 1A5RA 4G50A 2KD0A 2WXFA 5FK9C 2EMSA 2EELA 4NQKE 2WYQA 3BY4B 2K8HA 2KLGA 3KH0A 4MSQB 5DPSA 2M4NA 3CMMB 2JXTA 3I57A 4LK0M 4IDIA 3UIOB 4RGTA 1ESFA 3R3MA 2N9KA 4WIPA 2L0TA 2K39A 1ISNA 1C4AA 4DQOC 2AX5A 4FHJA 4TV3A 3TJPA 1VLBA 2D3GA 2DZKA 1VZ6A 4WWOA 4EFOA 3P63A 3IVFA 2W9NA 3NZ3A 2M56B 1JROA 4FA6A 3W2DA 2L1AA 4HJGE 3E56A 1L2NA 2KDEB 2L76A 2VH2A 3KYDD 2MWSB 5G2NA 1VZ8A 1WRDB 1NYRA 2M0XA 3RYTA 3VRAB 4KKJA 3DBRI 2JF5A 4HDOA 1WYGA 2REXA 2RDBC 2NS5A 3SR6A 1N6ZA 3LDZE 2LEKA 5H92C 2N7JA 3JW0X 1JRPA 4ZRKA 3TCAA 4KSKC 1UD7A 3FILB 4EOYA 1PFDA 2GBMA 2BW2A 3T3NA 4C7YA 1P98A 2MCNB 4JQWC 3VFKA 4XWWA 1D3ZA 4J6IA 3Q3FA 3QC8B 1R4NI 1FXTB 3NRZA 1E7UA 3OG5A 5G5HA 4HPPA 3QIJA 1ET9A 2RGFA 4EUTA 4HPMB 1WR1A 2LRUA 3UF8A 1FMAD 2JWZA 2GLSA 2OJRA 5LXHA 1EU4A 4AP4C 1E6EB 1L0VB 3ZTCA 2KAJA 3PLVA 4YTMB 1WJNA 4M02A 1Z5SB 1FNWA 2G45B 2PKOA 4US9A 4AJYB 2C9WB 5GXGB 5LLIA 1UNSA 3H7PA 4DHZE 1D6EC 1T5XD 2AL6A 4A9AA 1XLNA 3B2GA 2W3SA 4IUMB 1KFYB 2XEWA 3T8MA 1D5XC 3NVYA 2FBWB 1VJKA 4FXCA 2WXMA 2L52A 3AE6B 1M4VA 4BZAA 2KYWA 3X23A 5HHDG 2I38A 2ZEQA 3P4PB 2EMTA 1T0YA 2BT6A 4K7UA 4W9CA 4MM3B 2WXIA 3TEXA 2L00B 1PDXA 4US8A 2QILA 1FIQA 3PRZA 1HA5A 2L8JA 1SSNA 2XBBC 4GIVA 2J4XA 3RUIB 2JRIB 2ZZPB 3PHWB 2DHZA 3BVMA 1ENFA 1EWCA 2L7RA 2KJHB 1P9DU 5EE1A 4K7SA 3SEBA 3VQIA 1CJEA 3ABVB 2ZJDA 1ZE3D 3EFUA 3H8HA 2GI9A 1WGHA 2MQJA 1RM6C 4GSWA 3ZNID 1TKEA 2QDFA 1IBXB 4FADA 3MJWA 1E8YA 3N9YC 5BYQA 5D6JB 4RF0A 4B0EA 4EZLA 1WMHB 2C5LC 2HD5B 2NBUA 2KX0A 1HZ5A 2ASQA 4K3BA 2IGGA 3RZWC 2Z8LA 1J7AA 4F1SA 3RFZB 4KIKA 5G5GA 3P1MA 1XXGA 4II3B 2KTFA 2FNJB 3M62B 2N9PC 2PMVA 3GE3C 1FCCC 4ANXA 3OJ4B 1YD8U 2JXXA 2WU2B 1I4QA 3L4PA 3ZNZB 1JALA 1T6BX 2BB5A 1DOYA 1TY2A 1YQ3B 2CJOA 3EGRA 3QQ8B 4KSLC 1R4MB 2CU3A 1MHXA 1V1PB 3FAHA 4P1BC 2DYBA 1YNTE 2WXKA 2Z0DB 4HVBA 1BXTA 1WR6E 2H88B 2CKHB 1QILA 3PRMB 3NY5A 4G0NB 3UI3A 3BVZA 1C9FA 3BYTB 1F9JA 1QLBB 1TJEA 3LXFA 1FFVA 2B3AA 2NPTA 1WGDA 2LJ5A 3AU4A 1ZOYB 2G4DB 4K3CA 3RNBC 5D3DA 1WJUA 4MACA 5D7GA 2Y5BB 2VH1A 3U7DA 1JWMD 3VH3B 2SEBD 3GP7A 2KQSA 2R61A 4C7ZA 2KFKB 3CWIA 4BOSC 2QIEB 3EECA 5KHOA 4YSZB 1OTRB 2FUG1 3AE5B 3KWLA 3CIRB 1I35A 1LXDA 3RNAC 1F52A 1Z2MA 2DX5B 4C80A 1N63A 4HLEA 1KF6B 3U7ZA 1L6VA 2K1FA 3CF6E 3RNGC 4FJVB 4M01A 3VUYA 2ZW0A 4JLCA 2JVCA 1K52A 4HXDA 3VR9B 1ZDXA 2MEKA 1I42A 2O6VB 1P3QU 1ROEA 4IM3A 5AUKA 2AQ2B 5CHVC 1WZ0A 3OLMD 4FHKA 1TT5B 3DOWA 1S3SG 5IAAC 1TKGA 3HRDD 4TQ1A 2LVOA 1STEA 2PJHA 1NI2A 4LNFA 2GB1A 1TBEA 2N7DA 2FE8A 3QARA 2C60A 2G1EA 2Z59B 3I9V1 2PVGC 1I4XA 2WXNA 1FRRA 1SXTA 1H4RA 1QOAA 3ZDTA 2HTHA 2W82A 4F8CB 3ZXVA 1GOZA 3V6EB 1Y8RC 2BS2B 2CHXA 1C1YB 1MG8A 3TL5A 1HZ6A 2IO0B 2CR5A 3ZJUA 3L54A 2BVCA 2KTRA 5T8IA 2L0FA 4WWPA 4FN2A 4KDLB 1AARA 4YT0B 1HE8A 4JPSA 4JIOU 4NJ6A 2X38A 1YJIA 2LI5A 1CQVA 3EFCA 3PVLA 2KXJA 2Z0EB 4NNJB 1V9JA 1SEBD 1HXYD 1TS5A 2G3QB 2NTSA 5BYRA 3IAM1 3WIMA 1MVKA 3A4RA 2GRIA 2D3BA 1XQQA 2KC2A 4M8NA 2K0PA 5JXVA 3SFDB 2IGHA 2LHEA 3ZW3A 4LJOB 3OAWA 4PK1A 3ENEA 2LXAA 2DZMA 2QMTA 1VZ7A 4XDCA 2ZW1A 5AUIA 1RWSA 2KQ4X 1XD3B 4WWNA 2AQ1B 2DZJA 5GMVA 1R4MI 1TS4A 4XGAB 1XLQA 1J19A 3GZNB 1QZEA 2BYEA 1BT0A 3AU5A 3RNFC 2L05A 4OW0A 2V0GA 2IZVB 4WJPA 1PUTA 1DOXA 2J0MA 3AULA 4LNIA 4YSYB 1TZ1A 1AYFA 1L6UA 3DWGC 2C7HA 3Q69A 3H1UA 2N4FA 3V61A 3PHXB 1EU3A 4XZ4A 5MPOA 3VVWB 2KMCA 2WQYB 3Q3OC 3ZLZA 3TEYA 4M00A 2B76B 2MJDA 4X57B 4DHJD 4BBNF 4LNNA 4E74A 5AZFA 3N3KB 1DOIA 2WNMA 1CZPA 2RSUA 1RFAA 4GN1A 4GDKB 3NZSA 2WXOA 3PV1A 1TS2A 3M63B 4MJSB 4M0WA 5EE9A 4GDLA 2FCQA 1KLUD 1Q10A 3PZ8A 1E7PB 1XLPA 2DNFA 4OZBA 3UQAA 4W9HA 4IWOA 2MBEA 1GB4A 2LHDA 4GU2A 1WGRA 4N9F4 2GMIC 1UGMA 3R8BA 3Q3NC 2JPHA 4GLSC 4IM0A 2HJ8A 2WXLA 1YX6B 4QAYA 1UBQA 2RPVA 1P7EA 2LFIA 1L0XB 3MTNB 1G6JA 3A9KA 5C2TB 4HROA 5L95C 4NPNA 2NBWB 4WQMA
chains in the Genus database with same CATH topology
4N6EB 2W3SA 2PLPA 1KFYB 4TSSA 5TSSA 1D5XC 1YMHE 3AE4B 2VZKB 3NVYA 2FBWB 3R2TA 2RDHA 1VJKA 4FXCA 4HKZE 2K9XA 2WXMA 2L52A 3AE6B 1M4VA 1V8CA 1DGJA 3NS1A 5HHDG 1IUEA 2I38A 1PGXA 1RFKA 3P4PB 2BT6A 4MM3B 2WXIA 2WXHA 3TEXA 2DYOA 3NVZA 3TUOA 4L1BA 1QQRA 1PDXA 3PO0A 3W5VB 4US8A 1ACCA 1L4ZB 1ZXHA 2QILA 4LTUA 1FIQA 2E6XA 4DXGA 1TY0A 4RCOA 2LMCA 1HA5A 1SSNA 1JWAD 2WP9B 3AE1B 2J4XA 1FRDA 4JX1C 3ZGZA 1F77A 1IGCA 1WGKA 2WDRB 1P7FA 2WXRA 3HUIA 1NENB 1ENFA 3BVMA 3ZJVA 1E0ZA 3EUB2 1FXIA 3AMZA 1BUIC 3W1SA 4L23A 2I2YA 1EWCA 4UDUC 1LO5D 1YN4A 4ZOHC 2DLBA 5EE1A 1I4PA 1SF0A 3W5UB 2V3PA 4OHJA 4JWUC 3SEBA 1F0ZA 2YEPB 3VQIA 1SB3C 1CJEA 1YJJA 3ABVB 4WWMA 1ZE3D 3H8HA 1YN5A 3V05A 4C56C 1ET6A 4NAWB 1N62A 4RH6A 2GI9A 1I4RA 1BMLC 1RM6C 1D5MC 2K22A 1TKEA 1V97A 5BMHA 1IBXB 4XWTA 1E10A 3BZDB 4A6QA 1N60A 3N9YC 2INNE 1UWMA 3IT4B 4KGTA 4TMAB 4P6VF 4D2KA 2BS3B 2KDMA 3AE7B 2Q5WD 5BYQA 3FC4A 1WRIA 1RYJA 3ZJTA 5HFYA 4RF0A 4B0EA 4RGNA 2QSDA 4EE2A 2G9HD 4H2AA 2KMMA 1NVID 2LGIA 4ZYSA 3KQ4A 4RFBA 1HZ5A 4JE3B 1T3QA 2IDYA 2WXPA 3TSSA 3TEWA 3LB8C 2IGGA 2XN9C 5I4DA 4OZCA 2HTME 2Z8LA 1J7AA 1FM0D 1KLGD 5C3JB 3RFZB 2W3RA 4ZRQA 1A70A 5G5GA 3P1MA 1OQRA 3B2FA 3KLSX 1D4BA 1XXGA 4ARCA 3U52E 1DYQA 4YTPB 1KRHA 3U4EG 4HKQA 2PMVA 5D3IB 2JZPA 1FCCC 2ON8A 2YEPF 3MHZA 2JX5A 2RMMA 2WU2B 3AE8B 1I4QA 2VZKD 3U2SC 3L4PA 1OQQA 1JALA 1T6BX 2BB5A 1N5XA 1DOYA 3Q8CA 1L0YB 1UWXA 1TY2A 1XLOA 1YQ3B 2CJOA 2MJ3A 1K50A 3AE3B 1SE2A 1ZXIA 3EGRA 2KN4A 2WXGA 2CU3A 2WXJA 1MHXA 1V1PB 1E9MA 1IGDA 2K5PA 1J7CA 3FAHA 1CK1A 1YNTE 1I4GA 1SJED 2WXKA 2E3TA 2WLBA 4KGSA 1BXTA 2W55A 2SAKA 2H88B 1XEEA 1VR9A 1QILA 5BYSA 3AEBB 3C8YA 1XCQL 4NAMA 4B0MA 4ZHPA 4GDLB 3UI3A 2WU5B 3BVZA 4YTNB 3P42A 1C9FA 3WCQA 3BYTB 1JQ4A 1JWBD 2PW9A 5HG2A 1QLBB 3NUHB 1TJEA 2PTLA 4ITKA 3HVDA 2WDQB 3GS2A 1FNUA 3LXFA 1FFVA 4WH4A 4PT5A 2CJNA 1FCLA 1ZDVA 1MHHE 1PGBA 2ICIA 1SE3A 4A90A 1QT9A 3E9SA 2NTTA 4Q2JA 3GB1A 3ZQ4A 1ZOYB 5D3DA 3BYYB 4TQ0A 4MACA 5D7GA 1YQ4B 1JWMD 3Q8BA 2LJIA 1VDVA 2SEBD 3P4RB 2PIAA 3GP7A 1FO4A 2R61A 1XCTL 4C7ZA 1EM7A 3CWIA 3Q8EA 2HDEA 2QIEB 4A8XC 3T3OA 5EE3A 4YSZB 3ZYYX 2FUG1 3AE5B 3KWLA 3CIRB 4KGRA 4IOIE 4J3OD 1AN8A 1F2RI 4C80A 1C79A 2N0SB 1N63A 4HRSA 4HEA1 1KF6B 2PVOD 3U7ZA 4USAA 1GPXA 4KX6B 3VR8B 1FFUA 3W9CB 1L6VA 1ZUD2 1KH0A 1NI3A 3P4QB 1C4CA 1GAQB 1QOBA 4ZRPA 2K3UA 1F2RC 2ZW0A 1FNVA 2BS4B 2M0AA 1NYQA 3DWMA 2JQRB 1K52A 3VR9B 1Y56A 1ZDXA 2MEKA 2RDGA 3EA6A 3Q8AA 3AEEB 4YSXB 1QKZA 3O13A 4RGOS 2WXQA 1ROEA 3AEGB 5HI1A 1WWTA 1K53A 5AUKA 2AQ2B 1QOFA 1V1OA 3MC0B 2J52A 1OFFA 1TKGA 4OVZA 1WXQA 4WURA 4CQNA 1SIJA 2NMQA 3HRDD 2MJEA 1C4PA 1JCKB 2D5GA 4RF1A 4TQ1A 1STEA 2DWQA 3KWVA 1JWUD 2JYTA 2GB1A 1JMLA 3MJ5A 3SFEB 2QEJC 3AE2B 2FE8A 2G1EA 4NJCA 4AS1A 2JYEA 3AEFB 2XNAC 3I9V1 2PVGC 4R3DA 2KWDA 1UGJA 1I4XA 2WXNA 1FRRA 1K51A 3IT6B 1SXTA 4IKGA 1I4HA 1QOAA 1FEHA 2W82A 4AQ7A 4RNAA 1GOZA 3AH7A 4LLGM 1WSPA 1C77A 3MP9A 3VRBB 4P16A 4DXFA 2BS2B 3BWUD 1JWSD 3AEAB 2JSVX 1TKYA 1HZ6A 3AV8A 3AB5A 4YXDB 3ZJUA 1PYWD 5T8IA 4REZA 2WXFA 5EE0A 2OEDA 5FK9C 2ACZB 4ARIA 4YT0B 4JPSA 2EELA 2X38A 1D5ZC 1YJIA 1CQVA 2V4IB 2JXTA 3AN1A 4YWGG 1TZOA 3I57A 5BMIA 4LK0M 3URYA 4N59A 4IDIA 2AQ3B 1B9RA 1SEBD 1HXYD 1B1ZA 3ETRA 1TS5A 3B9JA 4RGTA 1ESFA 2NTSA 3IXSA 2BYTA 5BYRA 3NVVA 3IAM1 3AEDB 3NVWA 1MVKA 2GRIA 4MH8A 2N9KA 4XDDA 1ZPSA 2QJLA 2Y5CA 5FKAC 2K0PA 4WIPA 5JXVA 1GB1A 3SFDB 2IGHA 2LHEA 4RGMA 4OZAA 1C4AA 2M19A 4DQOC 2AX5A 1L5PA 2QMTA 3PZ7A 1YN3A 4MT5A 1VZ7A 3OWEB 2ZW1A 4XDCA 5AUIA 1RWSA 2JWUA 1HEZE 1TS3A 2KACA 2KQ4X 1VLBA 2IGDA 1IBXA 1VZ6A 2AQ1B 3BK1A 4L2YA 1TS4A 3P63A 2TSSA 2J42A 2WS3B 1XLQA 5H8YE 3NZ3A 1XF5L 3FILA 2M56B 1JROA 1SBBB 1NEKB 1AW7A 3W2DA 1L4DB 2L1AA 1C76A 2ONQA 4OW0A 4HJGE 3E56A 1SJHD 2V0GA 3R2IA 4A55A 1I7HA 3AM9A 1PUTA 1DOXA 1VZ8A 1EWYC 1NYRA 3V3XA 1HQRD 1XO3A 3VRAB 3Q8FA 4YSYB 2EKIA 1J7BA 4KKJA 1JW9D 1AYFA 1L6UA 3DWGC 2V3NA 1UUPA 1N5WA 3Q69A 1WYGA 2MH7A 2Y5PA 4XE0A 4ZHOA 1C78A 2L83A 2J53A 3SR6A 1EU3A 1N61A 2WDVB 1FD6A 5MPOA 2BTEA 2LEKA 5H92C 1QF6A 2W54A 2N7JA 2WQYB 3TEZA 1JRPA 3TEYA 1KTKA 2B76B 2MJDA 1FXAA 2BBCA 3FILB 1DOIA 2WNMA 1PFDA 4N58A 1CZPA 1V1PA 3MFGA 3T3NA 2BW2A 4C7YA 2INPE 4JWSC 4GDKB 2DYMA 4XWWA 1MI0A 2WXOA 1TS2A 3NRZA 4M0WA 5G5HA 5EE9A 2N9LA 3AECB 1KLUD 1Q10A 1ET9A 3PZ8A 1E7PB 2JU6X 1XLPA 2Y3AA 4OZBA 1SE4A 2IJ0A 3BVGA 2H89B 3LYYA 2IPKD 1FMAD 2BB6A 1GB4A 1R7SA 4O1NA 2LHDA 5FR3A 1TYGB 3R8BA 1EU4A 5E6JA 1PGAA 1E6EB 1L0VB 2KAJA 3HVZA 4YTMB 4GLSC 2WXLA 3BK2A 3IAS1 1MPEA 5LNK1 1ZP0B 3RPFC 2RPVA 1P7EA 2LFIA 1L0XB 1FNWA 1QOGA 1VRAB 2PKOA 4US9A 2OHFA 5BMGA 3P4SB 3AE9B 2DBYA 3BIID 3J9CA 2L32A 4WAFA 5GXGB 1UNSA 5C2TB 4HROA 4KKIA 2LUMA 1AWDA 4NZLB 1D6EC 1T5XD 4A9AA 1XLNA 4WQMA 3B2GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WWT A;  4N6E B;  2M56 B;  1JRO A;  2JX5 A;  1KFY B;  2W3S A;  1NEK B;  2WU2 B;  3AE8 B;  1QOF A;  3L4P A;  3AE4 B;  5AUK A;  1OQQ A;  1JAL A;  2FBW B;  3NVY A;  1OFF A;  1N5X A;  1TKG A;  1WXQ A;  1DOY A;  1VJK A;  4FXC A;  2K9X A;  2L52 A;  3AE6 B;  1XLO A;  1YQ3 B;  2CJO A;  2MJ3 A;  1SIJ A;  1V8C A;  2MJE A;  1DGJ A;  1I7H A;  3AE3 B;  3AM9 A;  3HRD D;  3NS1 A;  1PUT A;  1ZXI A;  1DOX A;  1IUE A;  2DWQ A;  1EWY C;  1NYR A;  1RFK A;  2CU3 A;  2WS3 B;  3P4P B;  1XO3 A;  3VRA B;  2BT6 A;  4YSY B;  1E9M A;  2K5P A;  3FAH A;  1J7C A;  2EKI A;  1J7B A;  1JW9 D;  1AYF A;  1L6U A;  3DWG C;  2E3T A;  2WLB A;  3NVZ A;  3SFE B;  1N5W A;  2W55 A;  1WYG A;  2H88 B;  1PDX A;  3AE2 B;  3PO0 A;  2G1E A;  3W5V B;  4US8 A;  2MH7 A;  3AEF B;  4LTU A;  1FIQ A;  4ZHO A;  2PVG C;  3AEB B;  2L83 A;  1FRR A;  3SR6 A;  1JWA D;  4ZHP A;  1QOA A;  2WP9 B;  3AE1 B;  1N61 A;  2WU5 B;  2WDV B;  4YTN B;  1FRD A;  4JX1 C;  5MPO A;  3WCQ A;  1JQ4 A;  1JWB D;  2LEK A;  5H92 C;  1QF6 A;  1QLB B;  1WGK A;  2WDR B;  3AH7 A;  1TJE A;  2W54 A;  3HUI A;  2WQY B;  1NEN B;  3VRB B;  4ITK A;  1JRP A;  2WDQ B;  1E0Z A;  3EUB 2;  2B76 B;  1FXI A;  2BS2 B;  2MJD A;  3AMZ A;  3LXF A;  1FXA A;  1FFV A;  3AEA B;  4ZOH C;  5EE1 A;  1TKY A;  1SF0 A;  2CJN A;  3AV8 A;  3AB5 A;  3W5U B;  1DOI A;  4YXD B;  1PFD A;  4N58 A;  1CZP A;  1QT9 A;  4JWU C;  1F0Z A;  1SB3 C;  1CJE A;  1YJJ A;  5EE0 A;  4C7Y A;  4JWS C;  3ABV B;  4WWM A;  1ZOY B;  2ACZ B;  4YT0 B;  1N62 A;  1YJI A;  3NRZ A;  1YQ4 B;  5H8Y E;  5G5H A;  5EE9 A;  1RM6 C;  1VDV A;  3P4R B;  3AN1 A;  2PIA A;  2K22 A;  1TKE A;  1V97 A;  3AEC B;  4N59 A;  1FO4 A;  4IDI A;  1B9R A;  1E10 A;  1N60 A;  4C7Z A;  3ETR A;  1UWM A;  1E7P B;  3CWI A;  3B9J A;  4P6V F;  1XLP A;  2QIE B;  2BS3 B;  5EE3 A;  3AE7 B;  4YSZ B;  3NVV A;  3ZYY X;  2Q5W D;  2H89 B;  3AED B;  3FC4 A;  1WRI A;  1FMA D;  1RYJ A;  3AE5 B;  1R7S A;  3KWL A;  3CIR B;  3NVW A;  2QJL A;  2Y5C A;  2KMM A;  1NVI D;  4C80 A;  1TYG B;  2N0S B;  1N63 A;  4HRS A;  3SFD B;  1E6E B;  1KF6 B;  1L0V B;  2KAJ A;  2PVO D;  3HVZ A;  4USA A;  4KX6 B;  1T3Q A;  3VR8 B;  4YTM B;  1GPX A;  3LB8 C;  2M19 A;  2HTM E;  1FFU A;  2AX5 A;  1L6V A;  1J7A A;  1ZUD 2;  3W9C B;  1FM0 D;  1L5P A;  1NI3 A;  1ZP0 B;  3P4Q B;  5C3J B;  3RPF C;  1GAQ B;  1QOB A;  2W3R A;  1QOG A;  2PKO A;  5AUI A;  1RWS A;  1A70 A;  4US9 A;  2OHF A;  1OQR A;  3B2F A;  3P1M A;  1VLB A;  2BS4 B;  1NYQ A;  3P4S B;  5G5G A;  4YTP B;  3AE9 B;  2JQR B;  1KRH A;  3DWM A;  2DBY A;  3BII D;  3VR9 B;  5GXG B;  5C2T B;  4HRO A;  3AEE B;  3P63 A;  1AWD A;  4YSX B;  4A9A A;  1ROE A;  1XLQ A;  3AEG B;  1XLN A;  4WQM A;  3B2G A; 
#chains in the Genus database with same CATH topology
 2IO1 B;  2RD0 A;  2WX1 A;  2GBJ A;  4E3C A;  3IFW B;  2RDH A;  4GGQ A;  1NBF C;  2HE7 A;  1V8C A;  4II2 B;  1DGJ A;  1GNU A;  1RFK A;  4XX5 A;  3RNE C;  1WI0 A;  3WAP A;  3Q14 C;  4KZC A;  4S17 A;  3KUC B;  1ACC A;  1L4Z B;  4WQO B;  1L7Y A;  2BF8 B;  1JWA D;  3DBL B;  4JGH B;  4AWJ A;  1FRD A;  3ZGZ A;  1IGC A;  1P7F A;  2WXR A;  3RI7 C;  5J18 A;  1WE7 A;  4DK5 A;  2JUO A;  1WXM A;  2I2Y A;  3W1S A;  3H7P B;  2J7Q B;  4ZOH C;  2DLB A;  4C00 A;  1I4P A;  3QA8 A;  3W5U B;  2KK8 A;  1TGZ B;  1SB3 C;  1YJJ A;  4HCP B;  4LDT D;  2OOB B;  3V05 A;  2MSE D;  1ET6 A;  2CU1 A;  1WX8 A;  4IC7 B;  1BML C;  5HKH A;  2LGD A;  4FUL A;  2BWF A;  1V97 A;  4XWT A;  1V5O A;  1WFY A;  3BZD B;  1T0S C;  2INN E;  4TMA B;  5FR6 A;  4P6V F;  4D2K A;  2ZNV C;  2KDM A;  2Q5W D;  2FUH B;  1RYJ A;  5HFY A;  4RGN A;  1E8X A;  2QSD A;  4EE2 A;  4H2A A;  2KMM A;  4ZYS A;  2UU7 A;  1KM7 A;  4YL8 A;  3GZN I;  2IDY A;  3KUD B;  5IKC M;  4OZC A;  2HTM E;  1KLG D;  3QWZ B;  2MA9 B;  3B2F A;  3KLS X;  1D4B A;  1DYQ A;  4YTP B;  2KKC A;  3NOB A;  2J0J A;  2PEA A;  2YEP F;  2RMM A;  5CHW A;  2ZPN A;  5IOI A;  1N5X A;  1H8C A;  1L0Y B;  2MX2 A;  3T9L A;  3AE3 B;  2KX3 A;  2LXC A;  1E9M A;  1IGD A;  2K5P A;  1J7C A;  1CK1 A;  1IPG A;  4TKN A;  2LGY A;  3DHH C;  4MSM B;  1XEE A;  4PS8 A;  5BYS A;  3C8Y A;  1XCQ L;  4NAM A;  4OVV A;  4ZHP A;  2IBI B;  4K81 A;  1HTO A;  2WU5 B;  3P42 A;  3NUH B;  4ITK A;  2CHW A;  1WJ6 A;  2RR9 A;  3GS2 A;  1MHH E;  1V5T A;  4K1R B;  4MGI E;  1QT9 A;  2KDB A;  4KDI C;  1X1M A;  3L0W B;  4BFR A;  3A4S C;  3QJZ A;  3P4R B;  2GBN A;  1XCT L;  3BIN A;  1EM7 A;  3Q8E A;  5EE3 A;  3HHM A;  2LRW A;  1SGH A;  4J3O D;  2V9H A;  2NR2 A;  4NY0 A;  3L08 A;  4HEA 1;  3ONS A;  2KVZ A;  4A20 A;  4USA A;  1GPX A;  3VR8 B;  2MW5 A;  3WAN A;  1ZUD 2;  1E8Z A;  3DVG X;  3P4Q B;  4ZRP A;  2K3U A;  1OQY A;  2M0A A;  3RD2 A;  2KHW B;  1V6E A;  4FLH A;  2RDG A;  4YSX B;  3O13 A;  4RGO S;  2WXQ A;  1HTQ A;  3AEG B;  2MRP A;  1WWT A;  1QOF A;  1V1O A;  3MC0 B;  4W9F A;  3U30 A;  2J52 A;  1OFF A;  4OVZ A;  4WUR A;  4CQN A;  3DBL I;  2O2V B;  3A1Q B;  1C4P A;  1JCK B;  2D5G A;  3JSV B;  2N1W A;  2JZZ A;  3Q3J A;  3MJ5 A;  2JYE A;  3RCZ A;  2KQ7 A;  3AEF B;  2XNA C;  3DBH B;  3DVN V;  4R3D A;  1K51 A;  3H6N A;  3IT6 B;  1I4H A;  2IYD B;  1VD2 A;  2X8X X;  3ZO5 B;  4RNA A;  4LLG M;  1WSP A;  2KDI A;  3MP9 A;  4P16 A;  4DXF A;  4BOZ B;  1GG3 A;  1WXA A;  3PLU A;  2MBH A;  1WY8 A;  2JSV X;  1WYW B;  3AV8 A;  3AB5 A;  4YXD B;  5J2R A;  3Q3M C;  2WGS A;  1PQS A;  3B1L X;  3DHG C;  5EE0 A;  2OED A;  5CTR C;  2ACZ B;  4ARI A;  3ZDM C;  5JH5 C;  4ANV A;  3CST A;  2V4I B;  4EZJ A;  3AN1 A;  4YWG G;  5BMI A;  3ZNG C;  4HWI B;  3N1Z C;  4N59 A;  1B9R A;  3ETR A;  1B1Z A;  2K25 A;  3B9J A;  2BYT A;  1T0R C;  3NVW A;  1GC7 A;  2LVQ A;  2ZNV B;  4XDD A;  2QJL A;  2Y5C A;  3VDZ A;  1U4A A;  5FKA C;  5AZH A;  4RGM A;  4OZA A;  3GOE A;  1WM3 A;  4GXB A;  3ALB A;  1WXV A;  4NQL B;  1KOT A;  1L5P A;  3PZ7 A;  1YN3 A;  2BQQ A;  3WAL A;  3PTF C;  1HEZ E;  1TS3 A;  2KAC A;  3JVZ X;  4ZDV A;  1IBX A;  3L10 B;  3DCG A;  3BK1 A;  4L2Y A;  5H8Y E;  1SBB B;  3KYC D;  4LNO A;  1AW7 A;  1WMH A;  5DPT A;  1L4D B;  2ONQ A;  1TTN A;  3PS6 A;  3V60 A;  1SJH D;  3R2I A;  2BKR B;  4ICV A;  4MGY E;  1RRB A;  1EWY C;  3V3X A;  1HQR D;  1J7B A;  1JW9 D;  3UIN B;  2V3N A;  4C4V B;  4B6W A;  4ZHO A;  5C23 A;  2UWQ A;  4FBJ B;  1QF6 A;  4W9K A;  3TEZ A;  2XK5 B;  2AWT A;  1KTK A;  1FXA A;  3RT3 B;  1XT9 B;  5JHB A;  2BBC A;  4ASW C;  5E6N A;  3IG3 A;  1KLV A;  1V1P A;  3MFG A;  3U8Z A;  2IO2 B;  4JWS C;  4LDT B;  2L3Z A;  1WXS A;  1MI0 A;  3N20 C;  2WX0 A;  2MP2 B;  2MLB A;  2A4Z A;  3AEC B;  3UGB B;  3A9J B;  1OGW A;  1SE4 A;  2IJ0 A;  3BVG A;  2H89 B;  1R7S A;  3MHS D;  5FR3 A;  4MEL A;  1V49 A;  3W1Y A;  3ZVV A;  1TYG B;  2YVC A;  5E6J A;  1PGA A;  4WJO A;  4HPL B;  1MPE A;  5LNK 1;  2QCZ A;  3RPF C;  3TIX A;  4XYC A;  2LZ6 A;  3N1Y C;  3P4S B;  3ZRC A;  4A3P A;  1VCB A;  1YX5 B;  4HK2 A;  2DBY A;  3BII D;  2L32 A;  4KKI A;  2WDT B;  3L13 A;  4ANW A;  4N6E B;  4EKU A;  4E71 A;  4TSS A;  5TSS A;  3AE4 B;  3DBH I;  5IP4 D;  1YOV B;  4HKZ E;  4NAW A;  3VHT C;  3PGE A;  1YQB A;  2DYO A;  4L1B A;  4G3X B;  3P2B A;  3QX1 A;  2O6V A;  3PT2 B;  4CYE A;  2CS4 A;  2WP9 B;  3AE1 B;  3I5J C;  2IND C;  4FJY A;  3APC A;  1F77 A;  3HUI A;  2RPQ A;  1E0Z A;  3EUB 2;  1FXI A;  3AMZ A;  1BUI C;  4MEM A;  4L23 A;  4UDU C;  5AEK B;  1LO5 D;  4WAA A;  1SF0 A;  2V3P A;  1ZKH A;  4JWU C;  1RAX A;  1ZW7 A;  2JT4 B;  3AI5 A;  4WWM A;  1N62 A;  2DZI A;  1D5M C;  2YLM A;  2K22 A;  2KJ6 A;  1N60 A;  1UWM A;  4KGT A;  1UF0 A;  2BS3 B;  5DCN A;  2BGF A;  3ZJT A;  2I1J A;  5IO9 A;  5CHF A;  4G11 A;  4RMA A;  1Q0W B;  2G9H D;  1NVI D;  2MHJ A;  2LGI A;  3ZIM A;  2GOW A;  4PYZ A;  2KWC A;  1T3Q A;  3TSS A;  4BBN C;  3LB8 C;  2XN9 C;  5I4D A;  2UYZ B;  1FM0 D;  2AEH A;  5C3J B;  4RM9 A;  1OQR A;  4ARC A;  3U52 E;  2JZ3 B;  3U4E G;  4HKQ A;  3ZXR A;  2D07 B;  4BKT A;  3PPA A;  2FID A;  4MH0 E;  2ON8 A;  3AE8 B;  2VZK D;  3H9D A;  2LWP A;  1WGY A;  3Q8C A;  1UWX A;  1XLO A;  2MJ3 A;  2KZR A;  2LUE A;  1ZXI A;  3X0W A;  2INC C;  2WXJ A;  1SJE D;  2WLB A;  4KGS A;  2W55 A;  4MGK E;  1VR9 A;  2BKF A;  4I6P A;  1SIF A;  3AEB B;  4B0M A;  4KVG B;  4YTN B;  2HJ1 A;  2PW9 A;  3A33 B;  2WDQ B;  1FNU A;  4WH4 A;  4PT5 A;  1ZDV A;  1SE3 A;  4A90 A;  2NCN A;  3ZTD A;  3WAO A;  3E9S A;  2KOX A;  3ZQ4 A;  1E90 A;  4TQ0 A;  1YQ4 B;  2AYO B;  1RLF A;  3Q8B A;  1VDV A;  3DDC B;  1FO4 A;  3UIP B;  2BYV E;  3APF A;  3M95 A;  2HDE A;  4A8X C;  2DAF A;  2O6V D;  2QHO A;  2R2Q A;  3HK0 A;  4IOI E;  1AN8 A;  3EHV A;  2BWE S;  4I6L B;  3D32 A;  2N0S B;  4HRS A;  1E7V A;  1WZ3 A;  4GDK A;  3QK0 A;  4PYU A;  1F1H A;  2V3S A;  4BKS A;  1KH0 A;  3VTU A;  4DDI D;  5BO4 B;  1NI3 A;  1P1A A;  4MJS A;  1GAQ B;  3LJ3 A;  1F2R C;  2JY6 A;  4WJN A;  1FNV A;  2JQR B;  2KWU B;  3FKY A;  1TIF A;  1Y56 A;  3EA6 A;  1JRU A;  2BPS A;  2M17 A;  5C1Z A;  3AEE B;  4IM2 A;  1M94 A;  1QKZ A;  2ZCC A;  2K8B A;  5HI1 A;  3K9O B;  2N7E A;  5IA7 A;  4BVU C;  4W9E A;  1J8C A;  1WXQ A;  5E6O A;  1C3T A;  1SIJ A;  2NMQ A;  2MJE A;  3N1X C;  2N9X A;  4JL9 A;  1V86 A;  1EF5 A;  3WAM A;  1JWU D;  2AL3 A;  1JML A;  2KFJ A;  4W9L A;  3SFE B;  4LJP B;  3AE2 B;  4NJC A;  4ANU A;  4M8M A;  2KWD A;  4LCD E;  5TR5 A;  1NDD A;  4IKG A;  2WHI A;  5IN7 A;  4AQ7 A;  5DPR A;  4ZRI A;  1V81 A;  2PE6 B;  4BKG A;  3BWU D;  1LM8 B;  1K8R B;  3AEA B;  4PS3 A;  1TKY A;  4BAX A;  4REZ A;  3DPD A;  5EDS A;  1IYF A;  5CX3 A;  1D5Z C;  4KIK B;  3DHI C;  1TZO A;  1WH3 A;  3URY A;  2AQ3 B;  2V1Y A;  2DEN B;  3IXS A;  3NVV A;  3HM3 A;  3VUW A;  1MJD A;  3AED B;  4MH8 A;  1ZPS A;  3DVG Y;  3IHP C;  3RZF A;  3IBE A;  1GB1 A;  3ML9 A;  2KN5 A;  5E6P A;  2FCN A;  2M19 A;  3SU8 X;  1MG4 A;  2A5U A;  3JYU A;  3VTW A;  2K8C A;  4MT5 A;  4B95 A;  3OWE B;  2JWU A;  2IGD A;  1WX9 A;  2BYF A;  4IWP A;  2LVP A;  4DBG A;  2TSS A;  3RMK C;  2J42 A;  2WS3 B;  3DQV A;  1LGR A;  1XF5 L;  2WWZ A;  3FIL A;  1NEK B;  2FIF A;  2KVR A;  1GC6 A;  4S0R A;  4IWQ A;  1C76 A;  2GBR A;  3C0R B;  4A55 A;  2FAZ A;  3B08 A;  1I7H A;  1LFD A;  3DBS A;  3AM9 A;  4GMV A;  2KO3 A;  2NPT B;  1XO3 A;  1E8W A;  3Q8F A;  2FCS A;  2C7N B;  2EKI A;  3HM6 X;  2ZVN A;  3UQB A;  2KWV B;  1GUA B;  1UUP A;  1N5W A;  4FJZ A;  3NG0 A;  2IY0 B;  2MH7 A;  4BKS D;  2Y5P A;  4XE0 A;  2R2O A;  3V62 A;  1C78 A;  5DPW A;  2L83 A;  2J53 A;  3SD5 A;  1N61 A;  2WDV B;  1FD6 A;  2BTE A;  4W9D A;  4ICU A;  4AUQ C;  4MGZ E;  2W54 A;  4GOC A;  4B9K A;  3SHQ A;  4RM8 A;  3TMP B;  3I63 C;  4N58 A;  4IG7 B;  3OJ3 A;  4W9I A;  3NHE B;  2INP E;  4F7Z A;  1LQB A;  2MBO A;  2DYM A;  1EO6 A;  3AXC A;  3KUZ A;  1UEL A;  4DXA B;  2ZCB A;  1ZGU B;  5G55 A;  2N9L A;  1UH6 A;  1E5W A;  2LAS A;  4W9J A;  4EEW A;  2NBV B;  2JU6 X;  2Y3A A;  1WJ4 A;  5AZG A;  4DHJ B;  3LYY A;  1Q1O A;  2IPK D;  2BB6 A;  3VUX A;  4O1N A;  3QAQ A;  4I6N B;  4MM3 A;  3L16 A;  4TUU A;  3HVZ A;  1YIW A;  3BK2 A;  3IAS 1;  1ZP0 B;  3MC9 A;  1QOG A;  1VRA B;  4DDG D;  2OHF A;  5BMG A;  3Q2A C;  3AE9 B;  1Q5W B;  3J9C A;  4WAF A;  2LUM A;  4ZYN A;  1EUV B;  1AWD A;  4NZL B;  1S1Q B;  2N1V A;  3TBL D;  1EF1 A;  2PLP A;  3W1S C;  1OEY J;  3ZKJ C;  1YMH E;  2VZK B;  3R2T A;  3DVN U;  2K9X A;  2D3A A;  2K6D B;  3NS1 A;  3QHT A;  1IUE A;  1PGX A;  2KTR B;  4URK A;  2WXH A;  2D11 A;  4KV2 A;  2FCM A;  3NVZ A;  3PZD A;  2KDF B;  3TUO A;  1QQR A;  4DWF A;  3PO0 A;  5LXI B;  3W5V B;  3Q6B A;  1ZXH A;  4LTU A;  4K7W A;  2E6X A;  4DXG A;  1TY0 A;  4PS7 A;  2LMC A;  4RCO A;  1J0G A;  3ML8 A;  4JX1 C;  5L83 A;  3S2A A;  1IP9 A;  3KW5 B;  1WGK A;  2WDR B;  2KMA A;  1NEN B;  3ZJV A;  4WJQ A;  3C19 A;  2O2V A;  2I1K A;  1YN4 A;  3EC8 A;  3A1Q A;  4HCN B;  2V4L A;  3JSV A;  4OHJ A;  2D3C A;  1F0Z A;  1OEY A;  2YEP B;  4CO7 A;  2MBB B;  1YN5 A;  4C56 C;  4NAW B;  1YJ1 A;  4RH6 A;  1I4R A;  2KC1 A;  4AJW A;  1WX7 A;  5JHA A;  5BMH A;  3PRP B;  4A3O A;  1E10 A;  4A6Q A;  4P7I A;  3IT4 B;  2PPH A;  3RNC C;  5KHQ A;  3AE7 B;  2C7M B;  3FC4 A;  1WRI A;  3PSE B;  4W9G A;  3KQ4 A;  4RFB A;  3NS8 A;  2KNB A;  3V6C B;  4JE3 B;  2WXP A;  3TEW A;  1WE6 A;  3ZNH B;  2J0K A;  2LD9 A;  2W3R A;  4ZRQ A;  1A70 A;  2IO3 B;  1KJT A;  1KRH A;  2EKE C;  1GJZ A;  1FPY A;  3HIZ A;  2N9E B;  5D3I B;  2JZP A;  3O65 B;  3MHZ A;  2JX5 A;  3MC8 A;  4LNK A;  1WIA A;  1CMX B;  3U2S C;  1OQQ A;  3R66 C;  2LGX A;  2DAJ A;  3VAW A;  3PRE A;  1K50 A;  2D2Q A;  2VRR B;  3VTV A;  1SE2 A;  2KT7 A;  4EZK A;  2KN4 A;  2WXG A;  2KJR A;  3QCA A;  3RN9 C;  1I4G A;  2E3T A;  3N30 A;  2KFK A;  2SAK A;  4M0W B;  5J17 A;  3NJT A;  4P1C C;  1WF9 A;  2D10 A;  4GDL B;  2GBK A;  3H7S A;  3WCQ A;  1JQ4 A;  1JWB D;  5HG2 A;  2OJW A;  2PTL A;  2QC8 A;  3HVD A;  1UZX B;  3DBR B;  3SDL C;  2CJN A;  1FCL A;  1PGB A;  2ICI A;  4ZRJ A;  3WA0 A;  4KZ0 A;  2NTT A;  4Q2J A;  5D94 A;  3GB1 A;  4IW0 A;  1T0Q C;  4C4V A;  3BYY B;  3R7R A;  1P0R A;  3KVF B;  2LJI A;  2PIA A;  4MDK E;  3A9K B;  2ZVO A;  3T3O A;  2XK5 A;  2G4S A;  3ZYY X;  5JZE B;  3N32 A;  1V2Y A;  4HDQ A;  4KGR A;  1F2R I;  3GE8 C;  1R4N B;  3B0A A;  1C79 A;  4AOF A;  2KAN A;  4CHK A;  1WM2 A;  2JRH A;  2PVO D;  3ECI A;  4KX6 B;  1FFU A;  3W9C B;  3NZU A;  1C4C A;  5D2M B;  1QOB A;  2MP2 A;  2PE9 A;  3L17 A;  2BS4 B;  1NYQ A;  3DWM A;  2M1M A;  2M8S A;  2NVU I;  2MBQ A;  3A9J A;  3Q8A A;  4GB9 A;  4OVU A;  3APD A;  1K53 A;  3VH4 B;  2K6Q A;  4HJK A;  1UBI A;  1SE9 A;  3R7Q A;  3I3T B;  4RF1 A;  1V80 A;  2DWQ A;  3KWV A;  4DHZ B;  2JYT A;  1WGG A;  2CHZ A;  3K9P B;  1MFW A;  2QEJ C;  3M3J A;  4NJ7 A;  4AS1 A;  1UGJ A;  3RUL A;  2LGS A;  2IY1 B;  2ZPY A;  1FEH A;  3AH7 A;  1C77 A;  3ZRF A;  3VRB B;  2KLC A;  3VXW A;  1JWS D;  4XC2 A;  3ZUN A;  4ACF A;  3CSF A;  1PYW D;  1A5R A;  4G50 A;  2KD0 A;  2WXF A;  5FK9 C;  2EMS A;  2EEL A;  4NQK E;  2WYQ A;  3BY4 B;  2K8H A;  2KLG A;  3KH0 A;  4MSQ B;  5DPS A;  2M4N A;  3CMM B;  2JXT A;  3I57 A;  4LK0 M;  4IDI A;  3UIO B;  4RGT A;  1ESF A;  3R3M A;  2N9K A;  4WIP A;  2L0T A;  2K39 A;  1ISN A;  1C4A A;  4DQO C;  2AX5 A;  4FHJ A;  4TV3 A;  3TJP A;  1VLB A;  2D3G A;  2DZK A;  1VZ6 A;  4WWO A;  4EFO A;  3P63 A;  3IVF A;  2W9N A;  3NZ3 A;  2M56 B;  1JRO A;  4FA6 A;  3W2D A;  2L1A A;  4HJG E;  3E56 A;  1L2N A;  2KDE B;  2L76 A;  2VH2 A;  3KYD D;  2MWS B;  5G2N A;  1VZ8 A;  1WRD B;  1NYR A;  2M0X A;  3RYT A;  3VRA B;  4KKJ A;  3DBR I;  2JF5 A;  4HDO A;  1WYG A;  2REX A;  2RDB C;  2NS5 A;  3SR6 A;  1N6Z A;  3LDZ E;  2LEK A;  5H92 C;  2N7J A;  3JW0 X;  1JRP A;  4ZRK A;  3TCA A;  4KSK C;  1UD7 A;  3FIL B;  4EOY A;  1PFD A;  2GBM A;  2BW2 A;  3T3N A;  4C7Y A;  1P98 A;  2MCN B;  4JQW C;  3VFK A;  4XWW A;  1D3Z A;  4J6I A;  3Q3F A;  3QC8 B;  1R4N I;  1FXT B;  3NRZ A;  1E7U A;  3OG5 A;  5G5H A;  4HPP A;  3QIJ A;  1ET9 A;  2RGF A;  4EUT A;  4HPM B;  1WR1 A;  2LRU A;  3UF8 A;  1FMA D;  2JWZ A;  2GLS A;  2OJR A;  5LXH A;  1EU4 A;  4AP4 C;  1E6E B;  1L0V B;  3ZTC A;  2KAJ A;  3PLV A;  4YTM B;  1WJN A;  4M02 A;  1Z5S B;  1FNW A;  2G45 B;  2PKO A;  4US9 A;  4AJY B;  2C9W B;  5GXG B;  5LLI A;  1UNS A;  3H7P A;  4DHZ E;  1D6E C;  1T5X D;  2AL6 A;  4A9A A;  1XLN A;  3B2G A;  2W3S A;  4IUM B;  1KFY B;  2XEW A;  3T8M A;  1D5X C;  3NVY A;  2FBW B;  1VJK A;  4FXC A;  2WXM A;  2L52 A;  3AE6 B;  1M4V A;  4BZA A;  2KYW A;  3X23 A;  5HHD G;  2I38 A;  2ZEQ A;  3P4P B;  2EMT A;  1T0Y A;  2BT6 A;  4K7U A;  4W9C A;  4MM3 B;  2WXI A;  3TEX A;  2L00 B;  1PDX A;  4US8 A;  2QIL A;  1FIQ A;  3PRZ A;  1HA5 A;  2L8J A;  1SSN A;  2XBB C;  4GIV A;  2J4X A;  3RUI B;  2JRI B;  2ZZP B;  3PHW B;  2DHZ A;  3BVM A;  1ENF A;  1EWC A;  2L7R A;  2KJH B;  1P9D U;  5EE1 A;  4K7S A;  3SEB A;  3VQI A;  1CJE A;  3ABV B;  2ZJD A;  1ZE3 D;  3EFU A;  3H8H A;  2GI9 A;  1WGH A;  2MQJ A;  1RM6 C;  4GSW A;  3ZNI D;  1TKE A;  2QDF A;  1IBX B;  4FAD A;  3MJW A;  1E8Y A;  3N9Y C;  5BYQ A;  5D6J B;  4RF0 A;  4B0E A;  4EZL A;  1WMH B;  2C5L C;  2HD5 B;  2NBU A;  2KX0 A;  1HZ5 A;  2ASQ A;  4K3B A;  2IGG A;  3RZW C;  2Z8L A;  1J7A A;  4F1S A;  3RFZ B;  4KIK A;  5G5G A;  3P1M A;  1XXG A;  4II3 B;  2KTF A;  2FNJ B;  3M62 B;  2N9P C;  2PMV A;  3GE3 C;  1FCC C;  4ANX A;  3OJ4 B;  1YD8 U;  2JXX A;  2WU2 B;  1I4Q A;  3L4P A;  3ZNZ B;  1JAL A;  1T6B X;  2BB5 A;  1DOY A;  1TY2 A;  1YQ3 B;  2CJO A;  3EGR A;  3QQ8 B;  4KSL C;  1R4M B;  2CU3 A;  1MHX A;  1V1P B;  3FAH A;  4P1B C;  2DYB A;  1YNT E;  2WXK A;  2Z0D B;  4HVB A;  1BXT A;  1WR6 E;  2H88 B;  2CKH B;  1QIL A;  3PRM B;  3NY5 A;  4G0N B;  3UI3 A;  3BVZ A;  1C9F A;  3BYT B;  1F9J A;  1QLB B;  1TJE A;  3LXF A;  1FFV A;  2B3A A;  2NPT A;  1WGD A;  2LJ5 A;  3AU4 A;  1ZOY B;  2G4D B;  4K3C A;  3RNB C;  5D3D A;  1WJU A;  4MAC A;  5D7G A;  2Y5B B;  2VH1 A;  3U7D A;  1JWM D;  3VH3 B;  2SEB D;  3GP7 A;  2KQS A;  2R61 A;  4C7Z A;  2KFK B;  3CWI A;  4BOS C;  2QIE B;  3EEC A;  5KHO A;  4YSZ B;  1OTR B;  2FUG 1;  3AE5 B;  3KWL A;  3CIR B;  1I35 A;  1LXD A;  3RNA C;  1F52 A;  1Z2M A;  2DX5 B;  4C80 A;  1N63 A;  4HLE A;  1KF6 B;  3U7Z A;  1L6V A;  2K1F A;  3CF6 E;  3RNG C;  4FJV B;  4M01 A;  3VUY A;  2ZW0 A;  4JLC A;  2JVC A;  1K52 A;  4HXD A;  3VR9 B;  1ZDX A;  2MEK A;  1I42 A;  2O6V B;  1P3Q U;  1ROE A;  4IM3 A;  5AUK A;  2AQ2 B;  5CHV C;  1WZ0 A;  3OLM D;  4FHK A;  1TT5 B;  3DOW A;  1S3S G;  5IAA C;  1TKG A;  3HRD D;  4TQ1 A;  2LVO A;  1STE A;  2PJH A;  1NI2 A;  4LNF A;  2GB1 A;  1TBE A;  2N7D A;  2FE8 A;  3QAR A;  2C60 A;  2G1E A;  2Z59 B;  3I9V 1;  2PVG C;  1I4X A;  2WXN A;  1FRR A;  1SXT A;  1H4R A;  1QOA A;  3ZDT A;  2HTH A;  2W82 A;  4F8C B;  3ZXV A;  1GOZ A;  3V6E B;  1Y8R C;  2BS2 B;  2CHX A;  1C1Y B;  1MG8 A;  3TL5 A;  1HZ6 A;  2IO0 B;  2CR5 A;  3ZJU A;  3L54 A;  2BVC A;  2KTR A;  5T8I A;  2L0F A;  4WWP A;  4FN2 A;  4KDL B;  1AAR A;  4YT0 B;  1HE8 A;  4JPS A;  4JIO U;  4NJ6 A;  2X38 A;  1YJI A;  2LI5 A;  1CQV A;  3EFC A;  3PVL A;  2KXJ A;  2Z0E B;  4NNJ B;  1V9J A;  1SEB D;  1HXY D;  1TS5 A;  2G3Q B;  2NTS A;  5BYR A;  3IAM 1;  3WIM A;  1MVK A;  3A4R A;  2GRI A;  2D3B A;  1XQQ A;  2KC2 A;  4M8N A;  2K0P A;  5JXV A;  3SFD B;  2IGH A;  2LHE A;  3ZW3 A;  4LJO B;  3OAW A;  4PK1 A;  3ENE A;  2LXA A;  2DZM A;  2QMT A;  1VZ7 A;  4XDC A;  2ZW1 A;  5AUI A;  1RWS A;  2KQ4 X;  1XD3 B;  4WWN A;  2AQ1 B;  2DZJ A;  5GMV A;  1R4M I;  1TS4 A;  4XGA B;  1XLQ A;  1J19 A;  3GZN B;  1QZE A;  2BYE A;  1BT0 A;  3AU5 A;  3RNF C;  2L05 A;  4OW0 A;  2V0G A;  2IZV B;  4WJP A;  1PUT A;  1DOX A;  2J0M A;  3AUL A;  4LNI A;  4YSY B;  1TZ1 A;  1AYF A;  1L6U A;  3DWG C;  2C7H A;  3Q69 A;  3H1U A;  2N4F A;  3V61 A;  3PHX B;  1EU3 A;  4XZ4 A;  5MPO A;  3VVW B;  2KMC A;  2WQY B;  3Q3O C;  3ZLZ A;  3TEY A;  4M00 A;  2B76 B;  2MJD A;  4X57 B;  4DHJ D;  4BBN F;  4LNN A;  4E74 A;  5AZF A;  3N3K B;  1DOI A;  2WNM A;  1CZP A;  2RSU A;  1RFA A;  4GN1 A;  4GDK B;  3NZS A;  2WXO A;  3PV1 A;  1TS2 A;  3M63 B;  4MJS B;  4M0W A;  5EE9 A;  4GDL A;  2FCQ A;  1KLU D;  1Q10 A;  3PZ8 A;  1E7P B;  1XLP A;  2DNF A;  4OZB A;  3UQA A;  4W9H A;  4IWO A;  2MBE A;  1GB4 A;  2LHD A;  4GU2 A;  1WGR A;  4N9F 4;  2GMI C;  1UGM A;  3R8B A;  3Q3N C;  2JPH A;  4GLS C;  4IM0 A;  2HJ8 A;  2WXL A;  1YX6 B;  4QAY A;  1UBQ A;  2RPV A;  1P7E A;  2LFI A;  1L0X B;  3MTN B;  1G6J A;  3A9K A;  5C2T B;  4HRO A;  5L95 C;  4NPN A;  2NBW B;  4WQM A; 
#chains in the Genus database with same CATH homology
 4N6E B;  2W3S A;  2PLP A;  1KFY B;  4TSS A;  5TSS A;  1D5X C;  1YMH E;  3AE4 B;  2VZK B;  3NVY A;  2FBW B;  3R2T A;  2RDH A;  1VJK A;  4FXC A;  4HKZ E;  2K9X A;  2WXM A;  2L52 A;  3AE6 B;  1M4V A;  1V8C A;  1DGJ A;  3NS1 A;  5HHD G;  1IUE A;  2I38 A;  1PGX A;  1RFK A;  3P4P B;  2BT6 A;  4MM3 B;  2WXI A;  2WXH A;  3TEX A;  2DYO A;  3NVZ A;  3TUO A;  4L1B A;  1QQR A;  1PDX A;  3PO0 A;  3W5V B;  4US8 A;  1ACC A;  1L4Z B;  1ZXH A;  2QIL A;  4LTU A;  1FIQ A;  2E6X A;  4DXG A;  1TY0 A;  4RCO A;  2LMC A;  1HA5 A;  1SSN A;  1JWA D;  2WP9 B;  3AE1 B;  2J4X A;  1FRD A;  4JX1 C;  3ZGZ A;  1F77 A;  1IGC A;  1WGK A;  2WDR B;  1P7F A;  2WXR A;  3HUI A;  1NEN B;  1ENF A;  3BVM A;  3ZJV A;  1E0Z A;  3EUB 2;  1FXI A;  3AMZ A;  1BUI C;  3W1S A;  4L23 A;  2I2Y A;  1EWC A;  4UDU C;  1LO5 D;  1YN4 A;  4ZOH C;  2DLB A;  5EE1 A;  1I4P A;  1SF0 A;  3W5U B;  2V3P A;  4OHJ A;  4JWU C;  3SEB A;  1F0Z A;  2YEP B;  3VQI A;  1SB3 C;  1CJE A;  1YJJ A;  3ABV B;  4WWM A;  1ZE3 D;  3H8H A;  1YN5 A;  3V05 A;  4C56 C;  1ET6 A;  4NAW B;  1N62 A;  4RH6 A;  2GI9 A;  1I4R A;  1BML C;  1RM6 C;  1D5M C;  2K22 A;  1TKE A;  1V97 A;  5BMH A;  1IBX B;  4XWT A;  1E10 A;  3BZD B;  4A6Q A;  1N60 A;  3N9Y C;  2INN E;  1UWM A;  3IT4 B;  4KGT A;  4TMA B;  4P6V F;  4D2K A;  2BS3 B;  2KDM A;  3AE7 B;  2Q5W D;  5BYQ A;  3FC4 A;  1WRI A;  1RYJ A;  3ZJT A;  5HFY A;  4RF0 A;  4B0E A;  4RGN A;  2QSD A;  4EE2 A;  2G9H D;  4H2A A;  2KMM A;  1NVI D;  2LGI A;  4ZYS A;  3KQ4 A;  4RFB A;  1HZ5 A;  4JE3 B;  1T3Q A;  2IDY A;  2WXP A;  3TSS A;  3TEW A;  3LB8 C;  2IGG A;  2XN9 C;  5I4D A;  4OZC A;  2HTM E;  2Z8L A;  1J7A A;  1FM0 D;  1KLG D;  5C3J B;  3RFZ B;  2W3R A;  4ZRQ A;  1A70 A;  5G5G A;  3P1M A;  1OQR A;  3B2F A;  3KLS X;  1D4B A;  1XXG A;  4ARC A;  3U52 E;  1DYQ A;  4YTP B;  1KRH A;  3U4E G;  4HKQ A;  2PMV A;  5D3I B;  2JZP A;  1FCC C;  2ON8 A;  2YEP F;  3MHZ A;  2JX5 A;  2RMM A;  2WU2 B;  3AE8 B;  1I4Q A;  2VZK D;  3U2S C;  3L4P A;  1OQQ A;  1JAL A;  1T6B X;  2BB5 A;  1N5X A;  1DOY A;  3Q8C A;  1L0Y B;  1UWX A;  1TY2 A;  1XLO A;  1YQ3 B;  2CJO A;  2MJ3 A;  1K50 A;  3AE3 B;  1SE2 A;  1ZXI A;  3EGR A;  2KN4 A;  2WXG A;  2CU3 A;  2WXJ A;  1MHX A;  1V1P B;  1E9M A;  1IGD A;  2K5P A;  1J7C A;  3FAH A;  1CK1 A;  1YNT E;  1I4G A;  1SJE D;  2WXK A;  2E3T A;  2WLB A;  4KGS A;  1BXT A;  2W55 A;  2SAK A;  2H88 B;  1XEE A;  1VR9 A;  1QIL A;  5BYS A;  3AEB B;  3C8Y A;  1XCQ L;  4NAM A;  4B0M A;  4ZHP A;  4GDL B;  3UI3 A;  2WU5 B;  3BVZ A;  4YTN B;  3P42 A;  1C9F A;  3WCQ A;  3BYT B;  1JQ4 A;  1JWB D;  2PW9 A;  5HG2 A;  1QLB B;  3NUH B;  1TJE A;  2PTL A;  4ITK A;  3HVD A;  2WDQ B;  3GS2 A;  1FNU A;  3LXF A;  1FFV A;  4WH4 A;  4PT5 A;  2CJN A;  1FCL A;  1ZDV A;  1MHH E;  1PGB A;  2ICI A;  1SE3 A;  4A90 A;  1QT9 A;  3E9S A;  2NTT A;  4Q2J A;  3GB1 A;  3ZQ4 A;  1ZOY B;  5D3D A;  3BYY B;  4TQ0 A;  4MAC A;  5D7G A;  1YQ4 B;  1JWM D;  3Q8B A;  2LJI A;  1VDV A;  2SEB D;  3P4R B;  2PIA A;  3GP7 A;  1FO4 A;  2R61 A;  1XCT L;  4C7Z A;  1EM7 A;  3CWI A;  3Q8E A;  2HDE A;  2QIE B;  4A8X C;  3T3O A;  5EE3 A;  4YSZ B;  3ZYY X;  2FUG 1;  3AE5 B;  3KWL A;  3CIR B;  4KGR A;  4IOI E;  4J3O D;  1AN8 A;  1F2R I;  4C80 A;  1C79 A;  2N0S B;  1N63 A;  4HRS A;  4HEA 1;  1KF6 B;  2PVO D;  3U7Z A;  4USA A;  1GPX A;  4KX6 B;  3VR8 B;  1FFU A;  3W9C B;  1L6V A;  1ZUD 2;  1KH0 A;  1NI3 A;  3P4Q B;  1C4C A;  1GAQ B;  1QOB A;  4ZRP A;  2K3U A;  1F2R C;  2ZW0 A;  1FNV A;  2BS4 B;  2M0A A;  1NYQ A;  3DWM A;  2JQR B;  1K52 A;  3VR9 B;  1Y56 A;  1ZDX A;  2MEK A;  2RDG A;  3EA6 A;  3Q8A A;  3AEE B;  4YSX B;  1QKZ A;  3O13 A;  4RGO S;  2WXQ A;  1ROE A;  3AEG B;  5HI1 A;  1WWT A;  1K53 A;  5AUK A;  2AQ2 B;  1QOF A;  1V1O A;  3MC0 B;  2J52 A;  1OFF A;  1TKG A;  4OVZ A;  1WXQ A;  4WUR A;  4CQN A;  1SIJ A;  2NMQ A;  3HRD D;  2MJE A;  1C4P A;  1JCK B;  2D5G A;  4RF1 A;  4TQ1 A;  1STE A;  2DWQ A;  3KWV A;  1JWU D;  2JYT A;  2GB1 A;  1JML A;  3MJ5 A;  3SFE B;  2QEJ C;  3AE2 B;  2FE8 A;  2G1E A;  4NJC A;  4AS1 A;  2JYE A;  3AEF B;  2XNA C;  3I9V 1;  2PVG C;  4R3D A;  2KWD A;  1UGJ A;  1I4X A;  2WXN A;  1FRR A;  1K51 A;  3IT6 B;  1SXT A;  4IKG A;  1I4H A;  1QOA A;  1FEH A;  2W82 A;  4AQ7 A;  4RNA A;  1GOZ A;  3AH7 A;  4LLG M;  1WSP A;  1C77 A;  3MP9 A;  3VRB B;  4P16 A;  4DXF A;  2BS2 B;  3BWU D;  1JWS D;  3AEA B;  2JSV X;  1TKY A;  1HZ6 A;  3AV8 A;  3AB5 A;  4YXD B;  3ZJU A;  1PYW D;  5T8I A;  4REZ A;  2WXF A;  5EE0 A;  2OED A;  5FK9 C;  2ACZ B;  4ARI A;  4YT0 B;  4JPS A;  2EEL A;  2X38 A;  1D5Z C;  1YJI A;  1CQV A;  2V4I B;  2JXT A;  3AN1 A;  4YWG G;  1TZO A;  3I57 A;  5BMI A;  4LK0 M;  3URY A;  4N59 A;  4IDI A;  2AQ3 B;  1B9R A;  1SEB D;  1HXY D;  1B1Z A;  3ETR A;  1TS5 A;  3B9J A;  4RGT A;  1ESF A;  2NTS A;  3IXS A;  2BYT A;  5BYR A;  3NVV A;  3IAM 1;  3AED B;  3NVW A;  1MVK A;  2GRI A;  4MH8 A;  2N9K A;  4XDD A;  1ZPS A;  2QJL A;  2Y5C A;  5FKA C;  2K0P A;  4WIP A;  5JXV A;  1GB1 A;  3SFD B;  2IGH A;  2LHE A;  4RGM A;  4OZA A;  1C4A A;  2M19 A;  4DQO C;  2AX5 A;  1L5P A;  2QMT A;  3PZ7 A;  1YN3 A;  4MT5 A;  1VZ7 A;  3OWE B;  2ZW1 A;  4XDC A;  5AUI A;  1RWS A;  2JWU A;  1HEZ E;  1TS3 A;  2KAC A;  2KQ4 X;  1VLB A;  2IGD A;  1IBX A;  1VZ6 A;  2AQ1 B;  3BK1 A;  4L2Y A;  1TS4 A;  3P63 A;  2TSS A;  2J42 A;  2WS3 B;  1XLQ A;  5H8Y E;  3NZ3 A;  1XF5 L;  3FIL A;  2M56 B;  1JRO A;  1SBB B;  1NEK B;  1AW7 A;  3W2D A;  1L4D B;  2L1A A;  1C76 A;  2ONQ A;  4OW0 A;  4HJG E;  3E56 A;  1SJH D;  2V0G A;  3R2I A;  4A55 A;  1I7H A;  3AM9 A;  1PUT A;  1DOX A;  1VZ8 A;  1EWY C;  1NYR A;  3V3X A;  1HQR D;  1XO3 A;  3VRA B;  3Q8F A;  4YSY B;  2EKI A;  1J7B A;  4KKJ A;  1JW9 D;  1AYF A;  1L6U A;  3DWG C;  2V3N A;  1UUP A;  1N5W A;  3Q69 A;  1WYG A;  2MH7 A;  2Y5P A;  4XE0 A;  4ZHO A;  1C78 A;  2L83 A;  2J53 A;  3SR6 A;  1EU3 A;  1N61 A;  2WDV B;  1FD6 A;  5MPO A;  2BTE A;  2LEK A;  5H92 C;  1QF6 A;  2W54 A;  2N7J A;  2WQY B;  3TEZ A;  1JRP A;  3TEY A;  1KTK A;  2B76 B;  2MJD A;  1FXA A;  2BBC A;  3FIL B;  1DOI A;  2WNM A;  1PFD A;  4N58 A;  1CZP A;  1V1P A;  3MFG A;  3T3N A;  2BW2 A;  4C7Y A;  2INP E;  4JWS C;  4GDK B;  2DYM A;  4XWW A;  1MI0 A;  2WXO A;  1TS2 A;  3NRZ A;  4M0W A;  5G5H A;  5EE9 A;  2N9L A;  3AEC B;  1KLU D;  1Q10 A;  1ET9 A;  3PZ8 A;  1E7P B;  2JU6 X;  1XLP A;  2Y3A A;  4OZB A;  1SE4 A;  2IJ0 A;  3BVG A;  2H89 B;  3LYY A;  2IPK D;  1FMA D;  2BB6 A;  1GB4 A;  1R7S A;  4O1N A;  2LHD A;  5FR3 A;  1TYG B;  3R8B A;  1EU4 A;  5E6J A;  1PGA A;  1E6E B;  1L0V B;  2KAJ A;  3HVZ A;  4YTM B;  4GLS C;  2WXL A;  3BK2 A;  3IAS 1;  1MPE A;  5LNK 1;  1ZP0 B;  3RPF C;  2RPV A;  1P7E A;  2LFI A;  1L0X B;  1FNW A;  1QOG A;  1VRA B;  2PKO A;  4US9 A;  2OHF A;  5BMG A;  3P4S B;  3AE9 B;  2DBY A;  3BII D;  3J9C A;  2L32 A;  4WAF A;  5GXG B;  1UNS A;  5C2T B;  4HRO A;  4KKI A;  2LUM A;  1AWD A;  4NZL B;  1D6E C;  1T5X D;  4A9A A;  1XLN A;  4WQM A;  3B2G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...