3LYYA

Crystal structure of the mucbp domain of the adhesion protein pepe_0118 from pediococcus pentosaceus. northeast structural genomics consortium target id ptr41a
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
102
structure length
102
Chain Sequence
THATSTETIHYVNEDGDQVFEDGGGKLDFTRTVTIDDVTNEVVEYGEWTPVTDDEFAAVTSPDKDGYTPDTSEVAAQKPDMTDGPDGTVKDVEVTVTYTANP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords Adhesion exoprotein
publication title Crystal structure of the MucBP domain of the adhesion protein PEPE_0118 from Pediococcus pentosaceus. Northeast Structural Genomics Consortium target id PtR41A
rcsb
source organism Pediococcus pentosaceus
total genus 17
structure length 102
sequence length 102
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17966 Mub_B2 Mub B2-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.460 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3lyyA00
3I57A 4MT5A 3NZ3A 2LFIA 3LYYA 3Q69A
chains in the Genus database with same CATH superfamily
3PHXB 3RNGC 2AQ2B 1PGAA 2KDFB 1FNVA 2BQQA 1QT9A 2LVPA 1OEYA 1V2YA 4HLEA 3HM6X 1PGXA 1QQRA 4WJNA 3P4PB 4XC2A 2PE6B 1FFVA 2LUEA 4KIKA 1G6JA 1UF0A 2BYVE 1P9DU 2J4XA 2WDTB 4LNFA 1KTKA 5JHBA 2FNJB 4MELA 4A20A 1ENFA 5D3IB 4II2B 3QHTA 2QDFA 2HDEA 4OZCA 3RNBC 2A4ZA 4HEA1 1E90A 4OVZA 1L6VA 1YOVB 2JXXA 1K53A 4X57B 1JWSD 3V6EB 3SU8X 3ZJTA 3IHPC 1C1YB 2WXHA 3ZKJC 4B0MA 4W9KA 1UH6A 1WXSA 3RPFC 2DZJA 2KDEB 1NYQA 1EO6A 2TSSA 3B08A 1FXIA 2VZKB 1XD3B 1R4NB 3R2TA 5E6JA 1X1MA 5AUKA 2KDIA 2INDC 1PFDA 2IO1B 1S1QB 3ZLZA 3KWVA 3SDLC 1F0ZA 4M02A 3GZNB 3PTFC 2UWQA 2MLBA 5C2TB 1WR6E 2ZW1A 3E9SA 2CR5A 5CHVC 1NBFC 1UUPA 3QJZA 1OQYA 4HRSA 4ACFA 3LB8C 4BOZB 5HKHA 4W9HA 1UWMA 2ZPNA 1WGYA 2N0SB 3ZXRA 1Q10A 4ZRKA 3NS8A 4OHJA 4IM3A 3UIPB 2BS3B 1PGBA 4IW0A 4KKIA 3RYTA 3NRZA 2C60A 3RT3B 4MSMB 1IP9A 1F2RC 1DOIA 3QIJA 2KQ4X 1QZEA 2FCMA 2WXKA 1WE6A 3HIZA 1YNTE 2GOWA 2WDQB 2KZRA 2XEWA 1VZ7A 2OEDA 4BKSA 2W3RA 4HJGE 1N62A 2PMVA 3FILA 5IAAC 3TIXA 3BK2A 3HVZA 2L0TA 2JRIB 3Q3OC 2MHJA 2L76A 1E10A 2JUOA 1HQRD 2FIDA 3IT6B 2W9NA 3W1YA 4DDID 2WGSA 3H9DA 1EF5A 3TSSA 3Q3JA 3A1QA 1LO5D 1P1AA 2K0PA 1FD6A 2GBNA 3Q3MC 1T0RC 5TR5A 3VUWA 1RM6C 1TKYA 3DOWA 3VQIA 5JZEB 2JT4B 2RPQA 4GIVA 4B95A 2MRPA 1HZ5A 1ZDXA 4IG7B 3B0AA 4USAA 2E6XA 5TSSA 3GE8C 2BWES 5L95C 4KKJA 1Q5WB 1OEYJ 3GZNI 1LFDA 1I4HA 2V9HA 2XNAC 3MHZA 5IO9A 4QAYA 4L23A 2X38A 1TKGA 2LGIA 2KTRA 4A90A 2RSUA 2KOXA 2KXJA 1KLVA 2W54A 2IYDB 2GLSA 2YLMA 2KJHB 5AEKB 2WXRA 1WF9A 2KDMA 1R7SA 3ZRCA 2R61A 2JYTA 4AJWA 4EUTA 2M19A 2KLGA 2LGDA 2IO2B 3AEFB 4XE0A 2NPTA 2FCSA 4NAWA 3DPDA 1T3QA 2VH1A 2JZ3B 1V5TA 1WMHB 3N1ZC 1UBIA 5GMVA 1V5OA 2O2VB 2HE7A 2GBRA 3DBRB 1TIFA 2CJOA 1E9MA 2RMMA 4FLHA 1V1OA 3BY4B 4MGIE 5D3DA 2DZKA 3AE5B 3BIID 4HK2A 1KOTA 4FHJA 1T6BX 2ON8A 3M3JA 4IM2A 5E6NA 1B9RA 3QAQA 1KJTA 2D3BA 1PQSA 4EKUA 1N5WA 3X0WA 2Q5WD 1FRRA 2BBCA 4IWOA 5DPSA 1L2NA 2KWVB 2GI9A 4JX1C 3DBLB 2WDVB 3JW0X 3I5JC 4XGAB 3ZO5B 2VRRB 5IA7A 2DWQA 2LUMA 3T3OA 3ZQ4A 1WSPA 4M0WB 2INCC 5LNK1 2K3UA 1DOXA 1GUAB 1WXMA 3EECA 2DZIA 1N60A 3BVZA 2GMIC 3LYYA 4BKTA 1MPEA 1NI2A 2CJNA 5HI1A 3WIMA 2DYBA 4FHKA 5BYRA 2PVGC 4K1RB 4TQ0A 4W9LA 1V97A 2PIAA 2Z0EB 2KFKA 2PE9A 2GBMA 2SEBD 5GXGB 1LQBA 2DHZA 3NVYA 2UYZB 4NQLB 1DYQA 2I38A 2W3SA 2KDBA 4JGHB 4TMAB 2Z59B 2ASQA 2NBWB 4XZ4A 3V6CB 1VRAB 1K52A 3RZFA 2BWFA 1JCKB 2CHXA 1GC6A 3FC4A 2RPVA 5T8IA 3APFA 1HZ6A 1UGMA 3RNFC 3R7QA 3RFZB 2B3AA 1F9JA 3L16A 4RGNA 3IAM1 4WJPA 4TSSA 1IBXA 1C3TA 1FXAA 1WZ3A 2D3CA 4WJQA 2INNE 4YXDB 1GPXA 2L00B 2QC8A 3SD5A 3H8HA 2ZCBA 2NVUI 1GNUA 2IO0B 3KW5B 1FNUA 3RNCC 1SE4A 1XLPA 2JSVX 1HEZE 4MGYE 3DBLI 4KX6B 1JWMD 4XDDA 2V3PA 2LXAA 3QCAA 5DPRA 3R66C 4DHJD 3Q8CA 3U4EG 2KN4A 4LNOA 1JMLA 5IKCM 3AEAB 4J3OD 2K8HA 4FXCA 1ZP0B 4KZ0A 3AEDB 2BB6A 5G55A 2PJHA 5CHWA 4HPMB 2J0KA 2KX3A 1F1HA 4WWMA 2CKHB 1V81A 4ANXA 1FCCC 3LDZE 2M17A 3AV8A 1V6EA 1TJEA 3NVVA 4Q2JA 3KUCB 1TT5B 2MJDA 3MHSD 4WWPA 4MJSA 3VRBB 3ZXVA 2GBJA 3IAS1 2N7JA 4BFRA 1SE2A 4RH6A 1YJ1A 2K6QA 4IUMB 4LNIA 1WFYA 1NYRA 2KTFA 1ZGUB 4YSZB 1TY0A 1SGHA 1E0ZA 2M4NA 1YN4A 2MP2A 4P6VF 4KIKB 2L7RA 2N9EB 1UBQA 1E8YA 3PRZA 2FCNA 4BOSC 1E8XA 4B6WA 2KMCA 1C79A 2G9HD 3BINA 3LJ3A 5EDSA 2L3ZA 1IPGA 4CYEA 3PV1A 3TL5A 3M63B 3ZJUA 4UDUC 1XXGA 1AYFA 3OLMD 5CHFA 1V86A 1UNSA 3AU4A 2Y5PA 4HJKA 2WXOA 3DCGA 1XT9B 1HE8A 2RDGA 4C7YA 4BAXA 1BXTA 1N5XA 3SR6A 2MQJA 1KFYB 3BYTB 5G2NA 3NVWA 2K25A 3ML9A 1XLNA 1XO3A 5BMGA 4JQWC 3HRDD 2HTHA 2DBYA 3NG0A 4DWFA 4MM3A 4C4VA 4WWOA 2AYOB 5HG2A 4XX5A 4LNKA 2LI5A 3DVGX 4NPNA 3VTWA 2ZNVC 3PO0A 1D5ZC 2LGYA 5HHDG 2LJIA 2PPHA 1LM8B 4M8NA 2N1WA 2K22A 3MC8A 1TS5A 3AB5A 4DBGA 3WAMA 2D10A 1Y8RC 4N6EB 3X23A 2NTTA 3PGEA 3I57A 3AE2B 1E7VA 1SE9A 3H6NA 1HXYD 5AZFA 4L1BA 1WXQA 4NNJB 4RMAA 3GOEA 2H88B 2N7DA 1OFFA 4P1BC 1SSNA 3VUYA 1D3ZA 4HPPA 2KHWB 2K8CA 1QOFA 2BS4B 2OJRA 4HPLB 2ONQA 2AX5A 3NZSA 1TS2A 4K81A 4ANVA 4DQOC 2ZEQA 5AZGA 4AJYB 4PYUA 1D6EC 1XCQL 1ZXIA 4WH4A 1J19A 2X8XX 3FILB 4GDLA 3QQ8B 4ITKA 3RNAC 2HD5B 4J6IA 3NOBA 3U7DA 5C1ZA 3H1UA 3RD2A 1C4AA 1AW7A 1E7PB 4ASWC 2JX5A 2DYMA 4ARIA 2LD9A 1I35A 3ZVVA 4C80A 1P0RA 4YWGG 1WRIA 4WJOA 3H7PA 3R2IA 4FJZA 1HA5A 4EFOA 1SBBB 2FUG1 3CSFA 3B2FA 4ZHPA 2KMMA 4E71A 4GDKB 5EE9A 2Y5CA 3IVFA 2KC2A 1UELA 1CZPA 3KVFB 4KSKC 4KV2A 2DLBA 4NAMA 1YX5B 1J8CA 2IGHA 2DAFA 4GN1A 2NMQA 3PREA 3GS2A 2KACA 2W82A 3U30A 4IKGA 5IOIA 1IUEA 1L5PA 3BVGA 4R3DA 2D3GA 2WQYB 3QARA 2LEKA 2KTRB 5DPWA 2VZKD 1L0VB 5DCNA 5JHAA 4MGZE 1WI0A 1WGRA 2D11A 2RDBC 2D3AA 3L17A 3L0WB 1E8ZA 4W9CA 1FM0D 4MH8A 1SJHD 3U2SC 2NPTB 5KHOA 4NAWB 4B0EA 3ZNHB 1J7CA 3I3TB 1XF5L 2KX0A 3RZWC 3NHEB 2WXJA 4DXAB 4K7UA 4ZRJA 3M62B 2Z8LA 3MFGA 4I6PA 1JWBD 1NDDA 5IN7A 3I63C 1WJ6A 4N58A 2MBEA 3WAOA 3PPAA 4ZYNA 4ZRPA 1ZOYB 1FMAD 3AMZA 2O6VB 3QX1A 3V61A 2WYQA 4MGKE 4BZAA 3MTNB 1V49A 1R4NI 1DGJA 3UQBA 3A33B 4LDTD 2V3SA 2IGGA 1P98A 5D7GA 4GB9A 1C9FA 2KANA 1QOGA 3OAWA 1ZXHA 3QA8A 3DBHB 1R4MB 2N4FA 4GOCA 2BGFA 4MSQB 4RCOA 3WAPA 1OGWA 1WE7A 1V1PA 4OZAA 3IBEA 1C4PA 4RNAA 2WX1A 4M01A 2QILA 2IBIB 2LMCA 4EOYA 5BYSA 4YSXB 4RGOS 2LFIA 3B9JA 1D5XC 4M00A 4A55A 3UF8A 1ET9A 3DDCB 3N1YC 1WJNA 3AI5A 3VTUA 1VD2A 2CU1A 2M0XA 3SHQA 4D2KA 3OG5A 2ZJDA 2KK8A 3DWMA 4AUQC 1YD8U 3ZDMC 4IOIE 2V1YA 1ET6A 3U8ZA 2MWSB 4YL8A 2IDYA 4NY0A 4HROA 1KLUD 4TV3A 3AE9B 2QJLA 2XK5B 4II3B 1V80A 4H2AA 2DX5B 3Q8FA 2WXFA 1IYFA 4W9EA 4GGQA 3T8MA 1GAQB 4HKQA 1YN5A 2R2QA 3NJTA 1P3QU 5HFYA 3TMPB 4P7IA 1IBXB 1F77A 2BYEA 1K8RB 1H8CA 4KSLC 2KO3A 4XYCA 2AL3A 1TS4A 4ZRIA 4XWTA 1JW9D 3ZNZB 2MJEA 4LTUA 5G5GA 4A8XC 1GG3A 3IT4B 1MFWA 1YX6B 2MH7A 5L83A 4KZCA 2MBHA 1ZE3D 2ZW0A 1KF6B 4KDIC 1UZXB 4FBJB 3PT2B 3P4QB 3TBLD 4JPSA 2QEJC 4YTMB 3Q8AA 3TEYA 1KM7A 1VR9A 1EWYC 1QLBB 3VAWA 3OJ4B 3PHWB 3KQ4A 3VRAB 4ZHOA 2L83A 4CQNA 5E6OA 3MJWA 3KWLA 1K51A 1Z2MA 2BW2A 1XLOA 1I42A 3E56A 2V4IB 1ZW7A 3MC9A 3W5UB 4LK0M 3MC0B 4RF1A 1PDXA 3A9JB 4EZKA 3L13A 2KAJA 4OZBA 3DBRI 5DPTA 1WJUA 2PVOD 2M0AA 2D2QA 2BB5A 5J18A 1WJ4A 2BYTA 1Q1OA 3FAHA 4LJPB 4YSYB 4MJSB 4W9JA 2J0MA 2KVRA 2Y5BB 3RULA 4A3OA 1PYWD 1J0GA 1YMHE 2NCNA 4P1CC 3W5VB 2KWDA 4JLCA 2C7NB 2WXPA 2IGDA 5BYQA 2JF5A 2ZPYA 4S17A 1FNWA 4JIOU 2MP2B 2ZCCA 5H92C 4ICVA 3IFWB 3JSVA 2IPKD 4M0WA 3PLUA 3DHGC 4DDGD 4ICUA 2J52A 4G3XB 4C00A 1VJKA 4OVVA 4URKA 2K9XA 2I1JA 4PYZA 2V4LA 4ZOHC 1WM2A 1Q0WB 1RFAA 2MW5A 3WANA 5LXHA 3N3KB 3A4RA 4PK1A 4ZDVA 5J2RA 2EELA 4HDQA 4DXFA 3HUIA 2N9KA 3R8BA 3UIOB 1T5XD 3ALBA 3ZW3A 2WNMA 2BPSA 1EUVB 2JYEA 2JQRB 4HXDA 3IG3A 1P7EA 2EMSA 3SFEB 2KFJA 2KQ7A 1FIQA 3EFUA 4US9A 3PSEB 3S2AA 1C78A 2WP9B 3QWZB 4K7SA 4MM3B 4C4VB 2V3NA 3VUXA 1A5RA 1KRHA 1HTQA 2BS2B 2L32A 3BZDB 2BTEA 1WXVA 4ANUA 4KVGB 5G5HA 2WLBA 1C4CA 1SF0A 1SIFA 3AE1B 2A5UA 4W9IA 3U52E 4O1NA 2BYFA 5JXVA 3AXCA 3ENEA 1FFUA 4GU2A 2QCZA 3WA0A 4IM0A 1ZKHA 4MH0E 3ZRFA 4N59A 2JWUA 4N9F4 2MX2A 3WALA 3U7ZA 4BBNF 2KC1A 3ZNGC 2WU2B 3Q3NC 2K5PA 1EF1A 1KLGD 1GC7A 1JRPA 4WIPA 5LXIB 2WXMA 1FEHA 4IWPA 2H89B 3NVZA 4NZLB 3RMKC 3VHTC 1SJED 2LGXA 2NBVB 3Q6BA 2QIEB 3DQVA 4GSWA 3M95A 2GBKA 1IGCA 1JWAD 1YJJA 3P2BA 3HK0A 3TUOA 3ZDTA 1VZ6A 2IY0B 1K50A 1L4ZB 4ANWA 1VCBA 2DAJA 1E7UA 4GDLB 3TEWA 2DENB 1STEA 1WYGA 1B1ZA 1TY2A 2YEPF 3MJ5A 1SEBD 1WR1A 4MDKE 4WURA 1TZOA 1WYWB 1VLBA 2IY1B 1JWUD 1WGKA 3WCQA 1TZ1A 5JH5C 3EC8A 3PRMB 4AOFA 4KDLB 2MEKA 1RRBA 3HHMA 2KT7A 2ZVOA 1J7BA 1UD7A 3AN1A 1S3SG 2BT6A 2ICIA 2GRIA 1MJDA 1L4DB 3AE7B 1L0XB 3AU5A 2KQSA 2AWTA 2N9XA 1ESFA 2KYWA 5E6PA 2WXIA 4I6LB 1I7HA 4CHKA 3MP9A 4W9GA 1CQVA 4YTNB 2JRHA 3EGRA 3AE4B 2UU7A 4PS8A 2FE8A 2L8JA 2KN5A 2FCQA 3VDZA 4JE3B 2RR9A 3ZJVA 1CJEA 2ZVNA 1LGRA 1EWCA 3R7RA 3NUHB 5MPOA 2L52A 2G45B 3KH0A 4RM9A 2NTSA 3CF6E 3L10B 1E6EB 2N9PC 4YT0B 3EFCA 3SEBA 3P4SB 5D6JB 2REXA 2C9WB 1ZUD2 4BKGA 2J0JA 1ROEA 3PVLA 4NJ7A 1Z5SB 4CO7A 1D4BA 1T0SC 2HJ8A 4HVBA 2SAKA 3GE3C 2QSDA 3ECIA 2L0FA 4M8MA 3A1QB 1WRDB 2V0GA 1TBEA 2AQ1B 2FIFA 1SB3C 2EKIA 2IO3B 3UGBB 3DVNV 2K1FA 2LRUA 3JYUA 3V60A 1SXTA 1N63A 2BF8B 3A9KA 2K8BA 4EZLA 2QMTA 3K9PB 3KYCD 2QHOA 3ABVB 3CIRB 2HJ1A 1N6ZA 4BKSD 2DNFA 1UWXA 1GB1A 3I9V1 2WXNA 1HTOA 1WGHA 4F1SA 5C23A 1I4PA 2WXGA 5AZHA 4FA6A 1UGJA 4RF0A 4ZYSA 2D5GA 3KUZA 1M94A 2C7MB 3PZ7A 3CWIA 1V1PB 1WY8A 3ZTDA 2LGSA 3O65B 4WQMA 2PTLA 1TGZB 3AEEB 2YEPB 3NY5A 2WWZA 1FCLA 3C8YA 4NJ6A 2MA9B 4ZRQA 3UQAA 2OJWA 4HCNB 4AP4C 1E5WA 2DYOA 5EE3A 2LZ6A 1RLFA 2KMAA 2PEAA 2ZNVB 4W9FA 2LXCA 1WX7A 2IJ0A 3UI3A 4AWJA 1ACCA 3VR8B 1C76A 1ISNA 2LJ5A 1Y56A 1DOYA 1ZPSA 4AS1A 4DK5A 1MHXA 1BUIC 4LDTB 1I4XA 3W1SC 3DVNU 3VVWB 2EKEC 3Q69A 1AN8A 1QOBA 3KLSX 1CK1A 3ETRA 1WGDA 4EE2A 3RCZA 3GP7A 1WM3A 2WXQA 2W55A 3PRPB 2JVCA 1PUTA 5FR3A 2KJ6A 4OW0A 2ZZPB 1KH0A 2MJ3A 3BK1A 3R3MA 1XCTL 3AULA 1H4RA 4GDKA 3AE6B 4FN2A 4F8CB 4B9KA 3N20C 4WAFA 4F7ZA 1NEKB 2NBUA 1RFKA 3QC8B 3ZIMA 3T3NA 2LASA 2G4DB 3L08A 4K3BA 3TJPA 4HWIB 3L4PA 2JWZA 1RWSA 3V05A 1TYGB 2WS3B 3B1LX 3P42A 3ZTCA 3BVMA 2LVOA 4C7ZA 2G4SA 4WQOB 2M8SA 4A9AA 2FBWB 2L05A 2O6VD 2PLPA 3N32A 4XWWA 4G11A 4HDOA 2N9LA 3D32A 4DXGA 2KFKB 1WX9A 1JQ4A 2J7QB 2PKOA 4KGTA 3W9CB 1T0QC 2EMTA 2JY6A 1ZDVA 2KNBA 4L2YA 3ZUNA 1XQQA 2RD0A 5LLIA 3EUB2 4AQ7A 1WX8A 1QOAA 1M4VA 4PS7A 2D07B 1FXTB 4TQ1A 2E3TA 1EU3A 1WIAA 3Q2AC 3C19A 1WH3A 3PS6A 2G3QB 4A3PA 1BMLC 2Z0DB 1MI0A 2KJRA 2C5LC 3DHIC 1AWDA 4KGSA 3KYDD 1JRUA 3CMMB 2O6VA 3EHVA 3B2GA 4G50A 3JVZX 4TUUA 2I1KA 2Y3AA 3UINB 3IXSA 4S0RA 3AECB 3K9OB 1E8WA 1YQBA 3BWUD 4E3CA 3VH3B 3RNEC 1A70A 1WZ0A 1MVKA 2CHWA 3C0RB 2KWCA 1VZ8A 4EZJA 3JSVB 3DBSA 5H8YE 4FJVB 3GB1A 1OQRA 1VDVA 4LLGM 2PW9A 1V8CA 3J9CA 2RDHA 4IWQA 2MBBB 2DZMA 1R4MI 3DBHI 4GXBA 4FADA 1CMXB 1SIJA 4NJCA 3CSTA 1QF6A 1I4RA 3OWEB 3AEBB 5EE1A 2AL6A 5D2MB 5FK9C 3SFDB 1XEEA 3ML8A 1P7FA 2JU6X 4K3CA 2JZZA 4FJYA 4A6QA 1BT0A 2MBOA 5FR6A 2BKFA 1RAXA 3Q14C 1WMHA 1D5MC 2O2VA 3P63A 2B76B 2OOBB 4RGTA 5C3JB 4NQKE 4IC7B 1JROA 3BYYB 2JZPA 2CS4A 2OHFA 2AQ3B 3VTVA 5J17A 1IGDA 3A4SC 2K6DB 2HTME 3URYA 1NENB 1L7YA 1FO4A 2LRWA 3Q3FA 4LNNA 4W9DA 4DHJB 3APDA 2XK5A 1U4AA 4K7WA 2XN9C 2LVQA 3T9LA 1YJIA 2LHDA 3AH7A 3ZYYX 2WDRB 5D94A 2K39A 4YTPB 5FKAC 2KWUB 1YN3A 1F2RI 4HCPB 3APCA 4GLSC 4BVUC 2BKRB 3LXFA 4PT5A 4E74A 3RUIB 3TCAA 2KKCA 3NZUA 5BMHA 1L0YB 3PZ8A 4DHZB 2CU3A 3HVDA 2RGFA 3PZDA 3QK0A 2MCNB 2INPE 3W1SA 2WXLA 1EU4A 4HKZE 2WHIA 5BMIA 4RFBA 3O13A 4RM8A 2BVCA 3AE8B 2GB1A 1GB4A 2FAZA 4EEWA 3EA6A 1AARA 2JPHA 5AUIA 3RI7C 1OQQA 2KLCA 1JALA 3Q8BA 2G1EA 3P4RB 2KVZA 2R2OA 3ZGZA 1NI3A 3V62A 1YQ3B 3VXWA 4XDCA 4LJOB 1GOZA 2LWPA 4DHZE 3KUDB 4MT5A 3A9JA 4KGRA 2VH2A 1WWTA 3DWGC 2WX0A 3VFKA 1GJZA 3NZ3A 2JXTA 4OVUA 1TKEA 4US8A 3P1MA 3L54A 4LCDE 1I4GA 3V3XA 4FULA 4C56C 4ARCA 3VH4B 4TKNA 2NS5A 4GMVA 1J7AA 2XBBC 3N9YC 2MBQA 4WWNA 1I4QA 1LXDA 4P16A 2CHZA 2M1MA 3PLVA 2J42A 4WAAA 3OJ3A 4BBNC 4I6NB 5CX3A 1FRDA 1WGGA 5CTRC 2J53A 3FKYA 1C77A 3Q8EA 4PS3A 1MG4A 1L6UA 3W2DA 3AM9A 3AE3B 1OTRB 1YIWA 5I4DA 2LHEA 3NS1A 3TEXA 2N1VA 2N7EA 3ONSA 5BO4B 2YVCA 1SE3A 5EE0A 4IDIA 5IP4D 3H7SA 4MEMA 3RN9C 4RGMA 1NVID 3TEZA 1FPYA 1TS3A 1MG8A 1V9JA 3H7PB 1YQ4B 4JWUC 2M56B 1N61A 2AEHA 3DHHC 1QKZA 1RYJA 2KD0A 2ACZB 2IZVB 4G0NB 1MHHE 3AEGB 2I2YA 1T0YA 3N30A 4JWSC 2L1AA 2NR2A 3A9KB 4JL9A 2C7HA 2MSED 1EM7A 4MACA 1XLQA 1F52A 3N1XC 3DVGY 2FUHB 1TTNA 1WXAA 5KHQA 3ZNID 1QILA 4REZA 3VR9B 2WU5B 3HM3A
chains in the Genus database with same CATH topology
1JW9D 1Y56A 1DOYA 1ZPSA 2AQ2B 2MJEA 4AS1A 1PGAA 4LTUA 5G5GA 1FNVA 1QT9A 1MHXA 4WWMA 1BUIC 1I4XA 4A8XC 3IT4B 1PGXA 1QQRA 3P4PB 2MH7A 3Q69A 1AN8A 1FFVA 1FCCC 1QOBA 3KLSX 1CK1A 3AV8A 3ETRA 1ZE3D 2ZW0A 1KF6B 1TJEA 4EE2A 3NVVA 4Q2JA 3GP7A 2J4XA 2WXQA 3P4QB 2W55A 1PUTA 4JPSA 5FR3A 1KTKA 2QEJC 4OW0A 4YTMB 3Q8AA 2MJDA 3TEYA 1KH0A 1VR9A 2MJ3A 3BK1A 1ENFA 1EWYC 3VRBB 1QLBB 1XCTL 5D3IB 3IAS1 2N7JA 3KQ4A 3VRAB 3AE6B 2L83A 1SE2A 4ZHOA 4RH6A 2HDEA 4CQNA 4OZCA 4HEA1 4WAFA 4OVZA 1NYRA 1L6VA 1K53A 4YSZB 3KWLA 1TY0A 1NEKB 1JWSD 1K51A 1RFKA 2BW2A 1XLOA 3T3NA 3E56A 2V4IB 3ZJTA 1E0ZA 1YN4A 3W5UB 2WXHA 4LK0M 3MC0B 4RF1A 1PDXA 4B0MA 4P6VF 3L4PA 3RPFC 1RWSA 2KAJA 1TYGB 2WS3B 4OZBA 3V05A 3P42A 4C7ZA 3BVMA 1NYQA 2TSSA 2PVOD 1FXIA 2M0AA 2VZKB 3R2TA 5AUKA 5E6JA 4A9AA 2FBWB 2PLPA 4XWWA 1PFDA 2BB5A 1C79A 3KWVA 2G9HD 1F0ZA 2N9LA 4DXGA 2BYTA 3FAHA 4YSYB 3ZJUA 5C2TB 4UDUC 1JQ4A 1XXGA 2PKOA 1AYFA 4KGTA 3W9CB 2ZW1A 3E9SA 1UNSA 1PYWD 1UUPA 2Y5PA 2WXOA 1YMHE 1ZDVA 2RDGA 4HRSA 4C7YA 3W5VB 4L2YA 1BXTA 1N5XA 3SR6A 3EUB2 2KWDA 3LB8C 4AQ7A 1KFYB 1QOAA 2WXPA 3BYTB 2IGDA 1M4VA 5BYQA 1UWMA 1FNWA 3NVWA 5H92C 1XLNA 1XO3A 5BMGA 4TQ1A 3HRDD 2N0SB 2DBYA 2E3TA 1EU3A 1Q10A 2IPKD 4M0WA 5HG2A 1BMLC 4OHJA 2BS3B 1MI0A 2J52A 1PGBA 1VJKA 2K9XA 4KKIA 3NRZA 1AWDA 3PO0A 1D5ZC 1F2RC 4KGSA 1DOIA 4ZOHC 2KQ4X 5HHDG 2LJIA 3B2GA 2WXKA 2Y3AA 1YNTE 3IXSA 2WDQB 3AECB 2EELA 4DXFA 2K22A 1TS5A 3HUIA 2N9KA 1VZ7A 3R8BA 3AB5A 1T5XD 2OEDA 2W3RA 4HJGE 1N62A 2PMVA 2WNMA 3BWUD 2JYEA 2JQRB 3FILA 3BK2A 4N6EB 1P7EA 3HVZA 2NTTA 3SFEB 1A70A 1FIQA 3I57A 3AE2B 1E10A 4US9A 1MVKA 1HQRD 1C78A 1HXYD 1VZ8A 2WP9B 4L1BA 3IT6B 2WU5B 1WXQA 5H8YE 4MM3B 2V3NA 2H88B 3GB1A 1OFFA 1OQRA 1VDVA 2PW9A 1KRHA 4LLGM 1V8CA 1SSNA 3J9CA 2RDHA 2BS2B 2L32A 3TSSA 3BZDB 1LO5D 1SIJA 4NJCA 2BTEA 1QF6A 5G5HA 1QOFA 2WLBA 2BS4B 2ONQA 1I4RA 2AX5A 2K0PA 1C4CA 1SF0A 1FD6A 3AE1B 3OWEB 3AEBB 5EE1A 1TS2A 5FK9C 3SFDB 1XEEA 1P7FA 1RM6C 4DQOC 2JU6X 1TKYA 4O1NA 3U52E 3VQIA 5JXVA 1D6EC 1XCQL 1ZXIA 4WH4A 4A6QA 1FFUA 1HZ5A 1ZDXA 4USAA 3FILB 1D5MC 2E6XA 5TSSA 3P63A 4KKJA 4ITKA 2B76B 1I4HA 4RGTA 4N59A 2JWUA 2XNAC 3MHZA 3U7ZA 5C3JB 1C4AA 1AW7A 4L23A 2X38A 1TKGA 1E7PB 1JROA 2WU2B 2K5PA 2JX5A 2DYMA 4ARIA 3BYYB 1KLGD 2JZPA 2LGIA 4C80A 4YWGG 2OHFA 1JRPA 4A90A 1WRIA 2AQ3B 4WIPA 2WXMA 1FEHA 1IGDA 3R2IA 2W54A 2HTME 3URYA 1NENB 1FO4A 2H89B 2WXRA 1HA5A 2KDMA 3NVZA 4NZLB 2FUG1 1SBBB 1R7SA 1SJED 3B2FA 4ZHPA 2KMMA 2R61A 2JYTA 4GDKB 5EE9A 2Y5CA 2QIEB 2M19A 2XN9C 1CZPA 1IGCA 3AEFB 1JWAD 1YJJA 1YJIA 2DLBA 2LHDA 3AH7A 4NAMA 4XE0A 3ZYYX 2WDRB 2IGHA 3TUOA 1VZ6A 1K50A 1L4ZB 1T3QA 2NMQA 3GS2A 2KACA 4GDLB 3TEWA 4YTPB 5FKAC 2W82A 1STEA 4IKGA 2CJOA 1WYGA 1IUEA 1E9MA 1YN3A 1B1ZA 1F2RI 1TY2A 2RMMA 2YEPF 1L5PA 4GLSC 3BVGA 3MJ5A 1V1OA 4R3DA 1SEBD 5D3DA 2WQYB 3LXFA 4PT5A 2LEKA 4WURA 1TZOA 2VZKD 3AE5B 5BMHA 1L0VB 1L0YB 3BIID 3PZ8A 2CU3A 1T6BX 3HVDA 2ON8A 1VLBA 2INPE 3W1SA 2WXLA 1EU4A 4HKZE 1B9RA 1JWUD 1WGKA 3WCQA 1N5WA 5BMIA 4RFBA 2Q5WD 2MEKA 1FRRA 2BBCA 3O13A 1J7BA 1FM0D 3AN1A 1SJHD 2BT6A 2ICIA 4MH8A 2GRIA 3U2SC 2GI9A 4JX1C 1L4DB 3AE7B 3AE8B 4NAWB 2GB1A 1GB4A 4B0EA 1J7CA 3EA6A 1L0XB 1XF5L 2WDVB 5AUIA 1ESFA 1OQQA 2WXJA 2WXIA 1JALA 2Z8LA 3MFGA 3Q8BA 2G1EA 2DWQA 2LUMA 3T3OA 3P4RB 3ZQ4A 1WSPA 1JWBD 5LNK1 2K3UA 3ZGZA 1NI3A 1DOXA 1I7HA 1YQ3B 4N58A 3MP9A 4XDCA 1GOZA 1CQVA 4YTNB 1N60A 3BVZA 3EGRA 4MT5A 3LYYA 4ZRPA 3AE4B 1ZOYB 4KGRA 1FMAD 1WWTA 2FE8A 1MPEA 3AMZA 4JE3B 3ZJVA 2CJNA 1CJEA 3DWGC 5HI1A 1EWCA 5BYRA 2PVGC 3NZ3A 4TQ0A 3NUHB 1V97A 5MPOA 2PIAA 2L52A 2JXTA 1DGJA 1TKEA 4US8A 2NTSA 3P1MA 1E6EB 1I4GA 2SEBD 4YT0B 5GXGB 3V3XA 4C56C 4ARCA 3SEBA 3P4SB 3NVYA 2IGGA 1ZUD2 5D7GA 1C9FA 1J7AA 1ROEA 3N9YC 1QOGA 1I4QA 1DYQA 4P16A 1ZXHA 1D4BA 2I38A 2W3SA 2SAKA 4TMAB 4RCOA 2QSDA 2J42A 1VRAB 1V1PA 1K52A 2V0GA 4OZAA 1JCKB 2AQ1B 1C4PA 4RNAA 3FC4A 2RPVA 5T8IA 1FRDA 1SB3C 2EKIA 2J53A 2QILA 1HZ6A 3RFZB 2LMCA 5BYSA 4YSXB 4RGOS 2LFIA 1C77A 1SXTA 3B9JA 1N63A 3Q8EA 4RGNA 3IAM1 1L6UA 1D5XC 2QMTA 4TSSA 3W2DA 4A55A 1ET9A 3AM9A 1IBXA 3AE3B 3ABVB 3CIRB 5I4DA 1UWXA 1FXAA 2LHEA 1GB1A 3I9V1 3NS1A 3TEXA 2INNE 4D2KA 2WXNA 4YXDB 1GPXA 1SE3A 3H8HA 5EE0A 1I4PA 2WXGA 3DWMA 1UGJA 4RF0A 4ZYSA 4IDIA 4RGMA 4IOIE 2D5GA 1NVID 3TEZA 1TS3A 1FNUA 1SE4A 1XLPA 2JSVX 1HEZE 1ET6A 1YQ4B 3PZ7A 3CWIA 4JWUC 2M56B 4KX6B 1N61A 1V1PB 2IDYA 1JWMD 1QKZA 1RYJA 4XDDA 2V3PA 4HROA 1KLUD 3AE9B 4WQMA 2PTLA 2ACZB 2QJLA 3AEEB 4H2AA 2YEPB 3Q8FA 2WXFA 3Q8CA 1MHHE 3AEGB 3U4EG 2KN4A 2I2YA 1FCLA 1JMLA 4JWSC 3C8YA 2L1AA 1GAQB 3AEAB 4ZRQA 4HKQA 1YN5A 5HFYA 1EM7A 4J3OD 1XLQA 2DYOA 4FXCA 1ZP0B 4MACA 5EE3A 3AEDB 2BB6A 1IBXB 1F77A 2IJ0A 3UI3A 1ACCA 1QILA 4REZA 3VR8B 3VR9B 1C76A 1TS4A 4XWTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I57 A;  4MT5 A;  3NZ3 A;  2LFI A;  3LYY A;  3Q69 A; 
#chains in the Genus database with same CATH topology
 3PHX B;  3RNG C;  2AQ2 B;  1PGA A;  2KDF B;  1FNV A;  2BQQ A;  1QT9 A;  2LVP A;  1OEY A;  1V2Y A;  4HLE A;  3HM6 X;  1PGX A;  1QQR A;  4WJN A;  3P4P B;  4XC2 A;  2PE6 B;  1FFV A;  2LUE A;  4KIK A;  1G6J A;  1UF0 A;  2BYV E;  1P9D U;  2J4X A;  2WDT B;  4LNF A;  1KTK A;  5JHB A;  2FNJ B;  4MEL A;  4A20 A;  1ENF A;  5D3I B;  4II2 B;  3QHT A;  2QDF A;  2HDE A;  4OZC A;  3RNB C;  2A4Z A;  4HEA 1;  1E90 A;  4OVZ A;  1L6V A;  1YOV B;  2JXX A;  1K53 A;  4X57 B;  1JWS D;  3V6E B;  3SU8 X;  3ZJT A;  3IHP C;  1C1Y B;  2WXH A;  3ZKJ C;  4B0M A;  4W9K A;  1UH6 A;  1WXS A;  3RPF C;  2DZJ A;  2KDE B;  1NYQ A;  1EO6 A;  2TSS A;  3B08 A;  1FXI A;  2VZK B;  1XD3 B;  1R4N B;  3R2T A;  5E6J A;  1X1M A;  5AUK A;  2KDI A;  2IND C;  1PFD A;  2IO1 B;  1S1Q B;  3ZLZ A;  3KWV A;  3SDL C;  1F0Z A;  4M02 A;  3GZN B;  3PTF C;  2UWQ A;  2MLB A;  5C2T B;  1WR6 E;  2ZW1 A;  3E9S A;  2CR5 A;  5CHV C;  1NBF C;  1UUP A;  3QJZ A;  1OQY A;  4HRS A;  4ACF A;  3LB8 C;  4BOZ B;  5HKH A;  4W9H A;  1UWM A;  2ZPN A;  1WGY A;  2N0S B;  3ZXR A;  1Q10 A;  4ZRK A;  3NS8 A;  4OHJ A;  4IM3 A;  3UIP B;  2BS3 B;  1PGB A;  4IW0 A;  4KKI A;  3RYT A;  3NRZ A;  2C60 A;  3RT3 B;  4MSM B;  1IP9 A;  1F2R C;  1DOI A;  3QIJ A;  2KQ4 X;  1QZE A;  2FCM A;  2WXK A;  1WE6 A;  3HIZ A;  1YNT E;  2GOW A;  2WDQ B;  2KZR A;  2XEW A;  1VZ7 A;  2OED A;  4BKS A;  2W3R A;  4HJG E;  1N62 A;  2PMV A;  3FIL A;  5IAA C;  3TIX A;  3BK2 A;  3HVZ A;  2L0T A;  2JRI B;  3Q3O C;  2MHJ A;  2L76 A;  1E10 A;  2JUO A;  1HQR D;  2FID A;  3IT6 B;  2W9N A;  3W1Y A;  4DDI D;  2WGS A;  3H9D A;  1EF5 A;  3TSS A;  3Q3J A;  3A1Q A;  1LO5 D;  1P1A A;  2K0P A;  1FD6 A;  2GBN A;  3Q3M C;  1T0R C;  5TR5 A;  3VUW A;  1RM6 C;  1TKY A;  3DOW A;  3VQI A;  5JZE B;  2JT4 B;  2RPQ A;  4GIV A;  4B95 A;  2MRP A;  1HZ5 A;  1ZDX A;  4IG7 B;  3B0A A;  4USA A;  2E6X A;  5TSS A;  3GE8 C;  2BWE S;  5L95 C;  4KKJ A;  1Q5W B;  1OEY J;  3GZN I;  1LFD A;  1I4H A;  2V9H A;  2XNA C;  3MHZ A;  5IO9 A;  4QAY A;  4L23 A;  2X38 A;  1TKG A;  2LGI A;  2KTR A;  4A90 A;  2RSU A;  2KOX A;  2KXJ A;  1KLV A;  2W54 A;  2IYD B;  2GLS A;  2YLM A;  2KJH B;  5AEK B;  2WXR A;  1WF9 A;  2KDM A;  1R7S A;  3ZRC A;  2R61 A;  2JYT A;  4AJW A;  4EUT A;  2M19 A;  2KLG A;  2LGD A;  2IO2 B;  3AEF B;  4XE0 A;  2NPT A;  2FCS A;  4NAW A;  3DPD A;  1T3Q A;  2VH1 A;  2JZ3 B;  1V5T A;  1WMH B;  3N1Z C;  1UBI A;  5GMV A;  1V5O A;  2O2V B;  2HE7 A;  2GBR A;  3DBR B;  1TIF A;  2CJO A;  1E9M A;  2RMM A;  4FLH A;  1V1O A;  3BY4 B;  4MGI E;  5D3D A;  2DZK A;  3AE5 B;  3BII D;  4HK2 A;  1KOT A;  4FHJ A;  1T6B X;  2ON8 A;  3M3J A;  4IM2 A;  5E6N A;  1B9R A;  3QAQ A;  1KJT A;  2D3B A;  1PQS A;  4EKU A;  1N5W A;  3X0W A;  2Q5W D;  1FRR A;  2BBC A;  4IWO A;  5DPS A;  1L2N A;  2KWV B;  2GI9 A;  4JX1 C;  3DBL B;  2WDV B;  3JW0 X;  3I5J C;  4XGA B;  3ZO5 B;  2VRR B;  5IA7 A;  2DWQ A;  2LUM A;  3T3O A;  3ZQ4 A;  1WSP A;  4M0W B;  2INC C;  5LNK 1;  2K3U A;  1DOX A;  1GUA B;  1WXM A;  3EEC A;  2DZI A;  1N60 A;  3BVZ A;  2GMI C;  3LYY A;  4BKT A;  1MPE A;  1NI2 A;  2CJN A;  5HI1 A;  3WIM A;  2DYB A;  4FHK A;  5BYR A;  2PVG C;  4K1R B;  4TQ0 A;  4W9L A;  1V97 A;  2PIA A;  2Z0E B;  2KFK A;  2PE9 A;  2GBM A;  2SEB D;  5GXG B;  1LQB A;  2DHZ A;  3NVY A;  2UYZ B;  4NQL B;  1DYQ A;  2I38 A;  2W3S A;  2KDB A;  4JGH B;  4TMA B;  2Z59 B;  2ASQ A;  2NBW B;  4XZ4 A;  3V6C B;  1VRA B;  1K52 A;  3RZF A;  2BWF A;  1JCK B;  2CHX A;  1GC6 A;  3FC4 A;  2RPV A;  5T8I A;  3APF A;  1HZ6 A;  1UGM A;  3RNF C;  3R7Q A;  3RFZ B;  2B3A A;  1F9J A;  3L16 A;  4RGN A;  3IAM 1;  4WJP A;  4TSS A;  1IBX A;  1C3T A;  1FXA A;  1WZ3 A;  2D3C A;  4WJQ A;  2INN E;  4YXD B;  1GPX A;  2L00 B;  2QC8 A;  3SD5 A;  3H8H A;  2ZCB A;  2NVU I;  1GNU A;  2IO0 B;  3KW5 B;  1FNU A;  3RNC C;  1SE4 A;  1XLP A;  2JSV X;  1HEZ E;  4MGY E;  3DBL I;  4KX6 B;  1JWM D;  4XDD A;  2V3P A;  2LXA A;  3QCA A;  5DPR A;  3R66 C;  4DHJ D;  3Q8C A;  3U4E G;  2KN4 A;  4LNO A;  1JML A;  5IKC M;  3AEA B;  4J3O D;  2K8H A;  4FXC A;  1ZP0 B;  4KZ0 A;  3AED B;  2BB6 A;  5G55 A;  2PJH A;  5CHW A;  4HPM B;  2J0K A;  2KX3 A;  1F1H A;  4WWM A;  2CKH B;  1V81 A;  4ANX A;  1FCC C;  3LDZ E;  2M17 A;  3AV8 A;  1V6E A;  1TJE A;  3NVV A;  4Q2J A;  3KUC B;  1TT5 B;  2MJD A;  3MHS D;  4WWP A;  4MJS A;  3VRB B;  3ZXV A;  2GBJ A;  3IAS 1;  2N7J A;  4BFR A;  1SE2 A;  4RH6 A;  1YJ1 A;  2K6Q A;  4IUM B;  4LNI A;  1WFY A;  1NYR A;  2KTF A;  1ZGU B;  4YSZ B;  1TY0 A;  1SGH A;  1E0Z A;  2M4N A;  1YN4 A;  2MP2 A;  4P6V F;  4KIK B;  2L7R A;  2N9E B;  1UBQ A;  1E8Y A;  3PRZ A;  2FCN A;  4BOS C;  1E8X A;  4B6W A;  2KMC A;  1C79 A;  2G9H D;  3BIN A;  3LJ3 A;  5EDS A;  2L3Z A;  1IPG A;  4CYE A;  3PV1 A;  3TL5 A;  3M63 B;  3ZJU A;  4UDU C;  1XXG A;  1AYF A;  3OLM D;  5CHF A;  1V86 A;  1UNS A;  3AU4 A;  2Y5P A;  4HJK A;  2WXO A;  3DCG A;  1XT9 B;  1HE8 A;  2RDG A;  4C7Y A;  4BAX A;  1BXT A;  1N5X A;  3SR6 A;  2MQJ A;  1KFY B;  3BYT B;  5G2N A;  3NVW A;  2K25 A;  3ML9 A;  1XLN A;  1XO3 A;  5BMG A;  4JQW C;  3HRD D;  2HTH A;  2DBY A;  3NG0 A;  4DWF A;  4MM3 A;  4C4V A;  4WWO A;  2AYO B;  5HG2 A;  4XX5 A;  4LNK A;  2LI5 A;  3DVG X;  4NPN A;  3VTW A;  2ZNV C;  3PO0 A;  1D5Z C;  2LGY A;  5HHD G;  2LJI A;  2PPH A;  1LM8 B;  4M8N A;  2N1W A;  2K22 A;  3MC8 A;  1TS5 A;  3AB5 A;  4DBG A;  3WAM A;  2D10 A;  1Y8R C;  4N6E B;  3X23 A;  2NTT A;  3PGE A;  3I57 A;  3AE2 B;  1E7V A;  1SE9 A;  3H6N A;  1HXY D;  5AZF A;  4L1B A;  1WXQ A;  4NNJ B;  4RMA A;  3GOE A;  2H88 B;  2N7D A;  1OFF A;  4P1B C;  1SSN A;  3VUY A;  1D3Z A;  4HPP A;  2KHW B;  2K8C A;  1QOF A;  2BS4 B;  2OJR A;  4HPL B;  2ONQ A;  2AX5 A;  3NZS A;  1TS2 A;  4K81 A;  4ANV A;  4DQO C;  2ZEQ A;  5AZG A;  4AJY B;  4PYU A;  1D6E C;  1XCQ L;  1ZXI A;  4WH4 A;  1J19 A;  2X8X X;  3FIL B;  4GDL A;  3QQ8 B;  4ITK A;  3RNA C;  2HD5 B;  4J6I A;  3NOB A;  3U7D A;  5C1Z A;  3H1U A;  3RD2 A;  1C4A A;  1AW7 A;  1E7P B;  4ASW C;  2JX5 A;  2DYM A;  4ARI A;  2LD9 A;  1I35 A;  3ZVV A;  4C80 A;  1P0R A;  4YWG G;  1WRI A;  4WJO A;  3H7P A;  3R2I A;  4FJZ A;  1HA5 A;  4EFO A;  1SBB B;  2FUG 1;  3CSF A;  3B2F A;  4ZHP A;  2KMM A;  4E71 A;  4GDK B;  5EE9 A;  2Y5C A;  3IVF A;  2KC2 A;  1UEL A;  1CZP A;  3KVF B;  4KSK C;  4KV2 A;  2DLB A;  4NAM A;  1YX5 B;  1J8C A;  2IGH A;  2DAF A;  4GN1 A;  2NMQ A;  3PRE A;  3GS2 A;  2KAC A;  2W82 A;  3U30 A;  4IKG A;  5IOI A;  1IUE A;  1L5P A;  3BVG A;  4R3D A;  2D3G A;  2WQY B;  3QAR A;  2LEK A;  2KTR B;  5DPW A;  2VZK D;  1L0V B;  5DCN A;  5JHA A;  4MGZ E;  1WI0 A;  1WGR A;  2D11 A;  2RDB C;  2D3A A;  3L17 A;  3L0W B;  1E8Z A;  4W9C A;  1FM0 D;  4MH8 A;  1SJH D;  3U2S C;  2NPT B;  5KHO A;  4NAW B;  4B0E A;  3ZNH B;  1J7C A;  3I3T B;  1XF5 L;  2KX0 A;  3RZW C;  3NHE B;  2WXJ A;  4DXA B;  4K7U A;  4ZRJ A;  3M62 B;  2Z8L A;  3MFG A;  4I6P A;  1JWB D;  1NDD A;  5IN7 A;  3I63 C;  1WJ6 A;  4N58 A;  2MBE A;  3WAO A;  3PPA A;  4ZYN A;  4ZRP A;  1ZOY B;  1FMA D;  3AMZ A;  2O6V B;  3QX1 A;  3V61 A;  2WYQ A;  4MGK E;  4BZA A;  3MTN B;  1V49 A;  1R4N I;  1DGJ A;  3UQB A;  3A33 B;  4LDT D;  2V3S A;  2IGG A;  1P98 A;  5D7G A;  4GB9 A;  1C9F A;  2KAN A;  1QOG A;  3OAW A;  1ZXH A;  3QA8 A;  3DBH B;  1R4M B;  2N4F A;  4GOC A;  2BGF A;  4MSQ B;  4RCO A;  3WAP A;  1OGW A;  1WE7 A;  1V1P A;  4OZA A;  3IBE A;  1C4P A;  4RNA A;  2WX1 A;  4M01 A;  2QIL A;  2IBI B;  2LMC A;  4EOY A;  5BYS A;  4YSX B;  4RGO S;  2LFI A;  3B9J A;  1D5X C;  4M00 A;  4A55 A;  3UF8 A;  1ET9 A;  3DDC B;  3N1Y C;  1WJN A;  3AI5 A;  3VTU A;  1VD2 A;  2CU1 A;  2M0X A;  3SHQ A;  4D2K A;  3OG5 A;  2ZJD A;  2KK8 A;  3DWM A;  4AUQ C;  1YD8 U;  3ZDM C;  4IOI E;  2V1Y A;  1ET6 A;  3U8Z A;  2MWS B;  4YL8 A;  2IDY A;  4NY0 A;  4HRO A;  1KLU D;  4TV3 A;  3AE9 B;  2QJL A;  2XK5 B;  4II3 B;  1V80 A;  4H2A A;  2DX5 B;  3Q8F A;  2WXF A;  1IYF A;  4W9E A;  4GGQ A;  3T8M A;  1GAQ B;  4HKQ A;  1YN5 A;  2R2Q A;  3NJT A;  1P3Q U;  5HFY A;  3TMP B;  4P7I A;  1IBX B;  1F77 A;  2BYE A;  1K8R B;  1H8C A;  4KSL C;  2KO3 A;  4XYC A;  2AL3 A;  1TS4 A;  4ZRI A;  4XWT A;  1JW9 D;  3ZNZ B;  2MJE A;  4LTU A;  5G5G A;  4A8X C;  1GG3 A;  3IT4 B;  1MFW A;  1YX6 B;  2MH7 A;  5L83 A;  4KZC A;  2MBH A;  1ZE3 D;  2ZW0 A;  1KF6 B;  4KDI C;  1UZX B;  4FBJ B;  3PT2 B;  3P4Q B;  3TBL D;  4JPS A;  2QEJ C;  4YTM B;  3Q8A A;  3TEY A;  1KM7 A;  1VR9 A;  1EWY C;  1QLB B;  3VAW A;  3OJ4 B;  3PHW B;  3KQ4 A;  3VRA B;  4ZHO A;  2L83 A;  4CQN A;  5E6O A;  3MJW A;  3KWL A;  1K51 A;  1Z2M A;  2BW2 A;  1XLO A;  1I42 A;  3E56 A;  2V4I B;  1ZW7 A;  3MC9 A;  3W5U B;  4LK0 M;  3MC0 B;  4RF1 A;  1PDX A;  3A9J B;  4EZK A;  3L13 A;  2KAJ A;  4OZB A;  3DBR I;  5DPT A;  1WJU A;  2PVO D;  2M0A A;  2D2Q A;  2BB5 A;  5J18 A;  1WJ4 A;  2BYT A;  1Q1O A;  3FAH A;  4LJP B;  4YSY B;  4MJS B;  4W9J A;  2J0M A;  2KVR A;  2Y5B B;  3RUL A;  4A3O A;  1PYW D;  1J0G A;  1YMH E;  2NCN A;  4P1C C;  3W5V B;  2KWD A;  4JLC A;  2C7N B;  2WXP A;  2IGD A;  5BYQ A;  2JF5 A;  2ZPY A;  4S17 A;  1FNW A;  4JIO U;  2MP2 B;  2ZCC A;  5H92 C;  4ICV A;  3IFW B;  3JSV A;  2IPK D;  4M0W A;  3PLU A;  3DHG C;  4DDG D;  4ICU A;  2J52 A;  4G3X B;  4C00 A;  1VJK A;  4OVV A;  4URK A;  2K9X A;  2I1J A;  4PYZ A;  2V4L A;  4ZOH C;  1WM2 A;  1Q0W B;  1RFA A;  2MW5 A;  3WAN A;  5LXH A;  3N3K B;  3A4R A;  4PK1 A;  4ZDV A;  5J2R A;  2EEL A;  4HDQ A;  4DXF A;  3HUI A;  2N9K A;  3R8B A;  3UIO B;  1T5X D;  3ALB A;  3ZW3 A;  2WNM A;  2BPS A;  1EUV B;  2JYE A;  2JQR B;  4HXD A;  3IG3 A;  1P7E A;  2EMS A;  3SFE B;  2KFJ A;  2KQ7 A;  1FIQ A;  3EFU A;  4US9 A;  3PSE B;  3S2A A;  1C78 A;  2WP9 B;  3QWZ B;  4K7S A;  4MM3 B;  4C4V B;  2V3N A;  3VUX A;  1A5R A;  1KRH A;  1HTQ A;  2BS2 B;  2L32 A;  3BZD B;  2BTE A;  1WXV A;  4ANU A;  4KVG B;  5G5H A;  2WLB A;  1C4C A;  1SF0 A;  1SIF A;  3AE1 B;  2A5U A;  4W9I A;  3U52 E;  4O1N A;  2BYF A;  5JXV A;  3AXC A;  3ENE A;  1FFU A;  4GU2 A;  2QCZ A;  3WA0 A;  4IM0 A;  1ZKH A;  4MH0 E;  3ZRF A;  4N59 A;  2JWU A;  4N9F 4;  2MX2 A;  3WAL A;  3U7Z A;  4BBN F;  2KC1 A;  3ZNG C;  2WU2 B;  3Q3N C;  2K5P A;  1EF1 A;  1KLG D;  1GC7 A;  1JRP A;  4WIP A;  5LXI B;  2WXM A;  1FEH A;  4IWP A;  2H89 B;  3NVZ A;  4NZL B;  3RMK C;  3VHT C;  1SJE D;  2LGX A;  2NBV B;  3Q6B A;  2QIE B;  3DQV A;  4GSW A;  3M95 A;  2GBK A;  1IGC A;  1JWA D;  1YJJ A;  3P2B A;  3HK0 A;  3TUO A;  3ZDT A;  1VZ6 A;  2IY0 B;  1K50 A;  1L4Z B;  4ANW A;  1VCB A;  2DAJ A;  1E7U A;  4GDL B;  3TEW A;  2DEN B;  1STE A;  1WYG A;  1B1Z A;  1TY2 A;  2YEP F;  3MJ5 A;  1SEB D;  1WR1 A;  4MDK E;  4WUR A;  1TZO A;  1WYW B;  1VLB A;  2IY1 B;  1JWU D;  1WGK A;  3WCQ A;  1TZ1 A;  5JH5 C;  3EC8 A;  3PRM B;  4AOF A;  4KDL B;  2MEK A;  1RRB A;  3HHM A;  2KT7 A;  2ZVO A;  1J7B A;  1UD7 A;  3AN1 A;  1S3S G;  2BT6 A;  2ICI A;  2GRI A;  1MJD A;  1L4D B;  3AE7 B;  1L0X B;  3AU5 A;  2KQS A;  2AWT A;  2N9X A;  1ESF A;  2KYW A;  5E6P A;  2WXI A;  4I6L B;  1I7H A;  4CHK A;  3MP9 A;  4W9G A;  1CQV A;  4YTN B;  2JRH A;  3EGR A;  3AE4 B;  2UU7 A;  4PS8 A;  2FE8 A;  2L8J A;  2KN5 A;  2FCQ A;  3VDZ A;  4JE3 B;  2RR9 A;  3ZJV A;  1CJE A;  2ZVN A;  1LGR A;  1EWC A;  3R7R A;  3NUH B;  5MPO A;  2L52 A;  2G45 B;  3KH0 A;  4RM9 A;  2NTS A;  3CF6 E;  3L10 B;  1E6E B;  2N9P C;  4YT0 B;  3EFC A;  3SEB A;  3P4S B;  5D6J B;  2REX A;  2C9W B;  1ZUD 2;  4BKG A;  2J0J A;  1ROE A;  3PVL A;  4NJ7 A;  1Z5S B;  4CO7 A;  1D4B A;  1T0S C;  2HJ8 A;  4HVB A;  2SAK A;  3GE3 C;  2QSD A;  3ECI A;  2L0F A;  4M8M A;  3A1Q B;  1WRD B;  2V0G A;  1TBE A;  2AQ1 B;  2FIF A;  1SB3 C;  2EKI A;  2IO3 B;  3UGB B;  3DVN V;  2K1F A;  2LRU A;  3JYU A;  3V60 A;  1SXT A;  1N63 A;  2BF8 B;  3A9K A;  2K8B A;  4EZL A;  2QMT A;  3K9P B;  3KYC D;  2QHO A;  3ABV B;  3CIR B;  2HJ1 A;  1N6Z A;  4BKS D;  2DNF A;  1UWX A;  1GB1 A;  3I9V 1;  2WXN A;  1HTO A;  1WGH A;  4F1S A;  5C23 A;  1I4P A;  2WXG A;  5AZH A;  4FA6 A;  1UGJ A;  4RF0 A;  4ZYS A;  2D5G A;  3KUZ A;  1M94 A;  2C7M B;  3PZ7 A;  3CWI A;  1V1P B;  1WY8 A;  3ZTD A;  2LGS A;  3O65 B;  4WQM A;  2PTL A;  1TGZ B;  3AEE B;  2YEP B;  3NY5 A;  2WWZ A;  1FCL A;  3C8Y A;  4NJ6 A;  2MA9 B;  4ZRQ A;  3UQA A;  2OJW A;  4HCN B;  4AP4 C;  1E5W A;  2DYO A;  5EE3 A;  2LZ6 A;  1RLF A;  2KMA A;  2PEA A;  2ZNV B;  4W9F A;  2LXC A;  1WX7 A;  2IJ0 A;  3UI3 A;  4AWJ A;  1ACC A;  3VR8 B;  1C76 A;  1ISN A;  2LJ5 A;  1Y56 A;  1DOY A;  1ZPS A;  4AS1 A;  4DK5 A;  1MHX A;  1BUI C;  4LDT B;  1I4X A;  3W1S C;  3DVN U;  3VVW B;  2EKE C;  3Q69 A;  1AN8 A;  1QOB A;  3KLS X;  1CK1 A;  3ETR A;  1WGD A;  4EE2 A;  3RCZ A;  3GP7 A;  1WM3 A;  2WXQ A;  2W55 A;  3PRP B;  2JVC A;  1PUT A;  5FR3 A;  2KJ6 A;  4OW0 A;  2ZZP B;  1KH0 A;  2MJ3 A;  3BK1 A;  3R3M A;  1XCT L;  3AUL A;  1H4R A;  4GDK A;  3AE6 B;  4FN2 A;  4F8C B;  4B9K A;  3N20 C;  4WAF A;  4F7Z A;  1NEK B;  2NBU A;  1RFK A;  3QC8 B;  3ZIM A;  3T3N A;  2LAS A;  2G4D B;  3L08 A;  4K3B A;  3TJP A;  4HWI B;  3L4P A;  2JWZ A;  1RWS A;  3V05 A;  1TYG B;  2WS3 B;  3B1L X;  3P42 A;  3ZTC A;  3BVM A;  2LVO A;  4C7Z A;  2G4S A;  4WQO B;  2M8S A;  4A9A A;  2FBW B;  2L05 A;  2O6V D;  2PLP A;  3N32 A;  4XWW A;  4G11 A;  4HDO A;  2N9L A;  3D32 A;  4DXG A;  2KFK B;  1WX9 A;  1JQ4 A;  2J7Q B;  2PKO A;  4KGT A;  3W9C B;  1T0Q C;  2EMT A;  2JY6 A;  1ZDV A;  2KNB A;  4L2Y A;  3ZUN A;  1XQQ A;  2RD0 A;  5LLI A;  3EUB 2;  4AQ7 A;  1WX8 A;  1QOA A;  1M4V A;  4PS7 A;  2D07 B;  1FXT B;  4TQ1 A;  2E3T A;  1EU3 A;  1WIA A;  3Q2A C;  3C19 A;  1WH3 A;  3PS6 A;  2G3Q B;  4A3P A;  1BML C;  2Z0D B;  1MI0 A;  2KJR A;  2C5L C;  3DHI C;  1AWD A;  4KGS A;  3KYD D;  1JRU A;  3CMM B;  2O6V A;  3EHV A;  3B2G A;  4G50 A;  3JVZ X;  4TUU A;  2I1K A;  2Y3A A;  3UIN B;  3IXS A;  4S0R A;  3AEC B;  3K9O B;  1E8W A;  1YQB A;  3BWU D;  4E3C A;  3VH3 B;  3RNE C;  1A70 A;  1WZ0 A;  1MVK A;  2CHW A;  3C0R B;  2KWC A;  1VZ8 A;  4EZJ A;  3JSV B;  3DBS A;  5H8Y E;  4FJV B;  3GB1 A;  1OQR A;  1VDV A;  4LLG M;  2PW9 A;  1V8C A;  3J9C A;  2RDH A;  4IWQ A;  2MBB B;  2DZM A;  1R4M I;  3DBH I;  4GXB A;  4FAD A;  1CMX B;  1SIJ A;  4NJC A;  3CST A;  1QF6 A;  1I4R A;  3OWE B;  3AEB B;  5EE1 A;  2AL6 A;  5D2M B;  5FK9 C;  3SFD B;  1XEE A;  3ML8 A;  1P7F A;  2JU6 X;  4K3C A;  2JZZ A;  4FJY A;  4A6Q A;  1BT0 A;  2MBO A;  5FR6 A;  2BKF A;  1RAX A;  3Q14 C;  1WMH A;  1D5M C;  2O2V A;  3P63 A;  2B76 B;  2OOB B;  4RGT A;  5C3J B;  4NQK E;  4IC7 B;  1JRO A;  3BYY B;  2JZP A;  2CS4 A;  2OHF A;  2AQ3 B;  3VTV A;  5J17 A;  1IGD A;  3A4S C;  2K6D B;  2HTM E;  3URY A;  1NEN B;  1L7Y A;  1FO4 A;  2LRW A;  3Q3F A;  4LNN A;  4W9D A;  4DHJ B;  3APD A;  2XK5 A;  1U4A A;  4K7W A;  2XN9 C;  2LVQ A;  3T9L A;  1YJI A;  2LHD A;  3AH7 A;  3ZYY X;  2WDR B;  5D94 A;  2K39 A;  4YTP B;  5FKA C;  2KWU B;  1YN3 A;  1F2R I;  4HCP B;  3APC A;  4GLS C;  4BVU C;  2BKR B;  3LXF A;  4PT5 A;  4E74 A;  3RUI B;  3TCA A;  2KKC A;  3NZU A;  5BMH A;  1L0Y B;  3PZ8 A;  4DHZ B;  2CU3 A;  3HVD A;  2RGF A;  3PZD A;  3QK0 A;  2MCN B;  2INP E;  3W1S A;  2WXL A;  1EU4 A;  4HKZ E;  2WHI A;  5BMI A;  4RFB A;  3O13 A;  4RM8 A;  2BVC A;  3AE8 B;  2GB1 A;  1GB4 A;  2FAZ A;  4EEW A;  3EA6 A;  1AAR A;  2JPH A;  5AUI A;  3RI7 C;  1OQQ A;  2KLC A;  1JAL A;  3Q8B A;  2G1E A;  3P4R B;  2KVZ A;  2R2O A;  3ZGZ A;  1NI3 A;  3V62 A;  1YQ3 B;  3VXW A;  4XDC A;  4LJO B;  1GOZ A;  2LWP A;  4DHZ E;  3KUD B;  4MT5 A;  3A9J A;  4KGR A;  2VH2 A;  1WWT A;  3DWG C;  2WX0 A;  3VFK A;  1GJZ A;  3NZ3 A;  2JXT A;  4OVU A;  1TKE A;  4US8 A;  3P1M A;  3L54 A;  4LCD E;  1I4G A;  3V3X A;  4FUL A;  4C56 C;  4ARC A;  3VH4 B;  4TKN A;  2NS5 A;  4GMV A;  1J7A A;  2XBB C;  3N9Y C;  2MBQ A;  4WWN A;  1I4Q A;  1LXD A;  4P16 A;  2CHZ A;  2M1M A;  3PLV A;  2J42 A;  4WAA A;  3OJ3 A;  4BBN C;  4I6N B;  5CX3 A;  1FRD A;  1WGG A;  5CTR C;  2J53 A;  3FKY A;  1C77 A;  3Q8E A;  4PS3 A;  1MG4 A;  1L6U A;  3W2D A;  3AM9 A;  3AE3 B;  1OTR B;  1YIW A;  5I4D A;  2LHE A;  3NS1 A;  3TEX A;  2N1V A;  2N7E A;  3ONS A;  5BO4 B;  2YVC A;  1SE3 A;  5EE0 A;  4IDI A;  5IP4 D;  3H7S A;  4MEM A;  3RN9 C;  4RGM A;  1NVI D;  3TEZ A;  1FPY A;  1TS3 A;  1MG8 A;  1V9J A;  3H7P B;  1YQ4 B;  4JWU C;  2M56 B;  1N61 A;  2AEH A;  3DHH C;  1QKZ A;  1RYJ A;  2KD0 A;  2ACZ B;  2IZV B;  4G0N B;  1MHH E;  3AEG B;  2I2Y A;  1T0Y A;  3N30 A;  4JWS C;  2L1A A;  2NR2 A;  3A9K B;  4JL9 A;  2C7H A;  2MSE D;  1EM7 A;  4MAC A;  1XLQ A;  1F52 A;  3N1X C;  3DVG Y;  2FUH B;  1TTN A;  1WXA A;  5KHQ A;  3ZNI D;  1QIL A;  4REZ A;  3VR9 B;  2WU5 B;  3HM3 A; 
#chains in the Genus database with same CATH homology
 1JW9 D;  1Y56 A;  1DOY A;  1ZPS A;  2AQ2 B;  2MJE A;  4AS1 A;  1PGA A;  4LTU A;  5G5G A;  1FNV A;  1QT9 A;  1MHX A;  4WWM A;  1BUI C;  1I4X A;  4A8X C;  3IT4 B;  1PGX A;  1QQR A;  3P4P B;  2MH7 A;  3Q69 A;  1AN8 A;  1FFV A;  1FCC C;  1QOB A;  3KLS X;  1CK1 A;  3AV8 A;  3ETR A;  1ZE3 D;  2ZW0 A;  1KF6 B;  1TJE A;  4EE2 A;  3NVV A;  4Q2J A;  3GP7 A;  2J4X A;  2WXQ A;  3P4Q B;  2W55 A;  1PUT A;  4JPS A;  5FR3 A;  1KTK A;  2QEJ C;  4OW0 A;  4YTM B;  3Q8A A;  2MJD A;  3TEY A;  1KH0 A;  1VR9 A;  2MJ3 A;  3BK1 A;  1ENF A;  1EWY C;  3VRB B;  1QLB B;  1XCT L;  5D3I B;  3IAS 1;  2N7J A;  3KQ4 A;  3VRA B;  3AE6 B;  2L83 A;  1SE2 A;  4ZHO A;  4RH6 A;  2HDE A;  4CQN A;  4OZC A;  4HEA 1;  4WAF A;  4OVZ A;  1NYR A;  1L6V A;  1K53 A;  4YSZ B;  3KWL A;  1TY0 A;  1NEK B;  1JWS D;  1K51 A;  1RFK A;  2BW2 A;  1XLO A;  3T3N A;  3E56 A;  2V4I B;  3ZJT A;  1E0Z A;  1YN4 A;  3W5U B;  2WXH A;  4LK0 M;  3MC0 B;  4RF1 A;  1PDX A;  4B0M A;  4P6V F;  3L4P A;  3RPF C;  1RWS A;  2KAJ A;  1TYG B;  2WS3 B;  4OZB A;  3V05 A;  3P42 A;  4C7Z A;  3BVM A;  1NYQ A;  2TSS A;  2PVO D;  1FXI A;  2M0A A;  2VZK B;  3R2T A;  5AUK A;  5E6J A;  4A9A A;  2FBW B;  2PLP A;  4XWW A;  1PFD A;  2BB5 A;  1C79 A;  3KWV A;  2G9H D;  1F0Z A;  2N9L A;  4DXG A;  2BYT A;  3FAH A;  4YSY B;  3ZJU A;  5C2T B;  4UDU C;  1JQ4 A;  1XXG A;  2PKO A;  1AYF A;  4KGT A;  3W9C B;  2ZW1 A;  3E9S A;  1UNS A;  1PYW D;  1UUP A;  2Y5P A;  2WXO A;  1YMH E;  1ZDV A;  2RDG A;  4HRS A;  4C7Y A;  3W5V B;  4L2Y A;  1BXT A;  1N5X A;  3SR6 A;  3EUB 2;  2KWD A;  3LB8 C;  4AQ7 A;  1KFY B;  1QOA A;  2WXP A;  3BYT B;  2IGD A;  1M4V A;  5BYQ A;  1UWM A;  1FNW A;  3NVW A;  5H92 C;  1XLN A;  1XO3 A;  5BMG A;  4TQ1 A;  3HRD D;  2N0S B;  2DBY A;  2E3T A;  1EU3 A;  1Q10 A;  2IPK D;  4M0W A;  5HG2 A;  1BML C;  4OHJ A;  2BS3 B;  1MI0 A;  2J52 A;  1PGB A;  1VJK A;  2K9X A;  4KKI A;  3NRZ A;  1AWD A;  3PO0 A;  1D5Z C;  1F2R C;  4KGS A;  1DOI A;  4ZOH C;  2KQ4 X;  5HHD G;  2LJI A;  3B2G A;  2WXK A;  2Y3A A;  1YNT E;  3IXS A;  2WDQ B;  3AEC B;  2EEL A;  4DXF A;  2K22 A;  1TS5 A;  3HUI A;  2N9K A;  1VZ7 A;  3R8B A;  3AB5 A;  1T5X D;  2OED A;  2W3R A;  4HJG E;  1N62 A;  2PMV A;  2WNM A;  3BWU D;  2JYE A;  2JQR B;  3FIL A;  3BK2 A;  4N6E B;  1P7E A;  3HVZ A;  2NTT A;  3SFE B;  1A70 A;  1FIQ A;  3I57 A;  3AE2 B;  1E10 A;  4US9 A;  1MVK A;  1HQR D;  1C78 A;  1HXY D;  1VZ8 A;  2WP9 B;  4L1B A;  3IT6 B;  2WU5 B;  1WXQ A;  5H8Y E;  4MM3 B;  2V3N A;  2H88 B;  3GB1 A;  1OFF A;  1OQR A;  1VDV A;  2PW9 A;  1KRH A;  4LLG M;  1V8C A;  1SSN A;  3J9C A;  2RDH A;  2BS2 B;  2L32 A;  3TSS A;  3BZD B;  1LO5 D;  1SIJ A;  4NJC A;  2BTE A;  1QF6 A;  5G5H A;  1QOF A;  2WLB A;  2BS4 B;  2ONQ A;  1I4R A;  2AX5 A;  2K0P A;  1C4C A;  1SF0 A;  1FD6 A;  3AE1 B;  3OWE B;  3AEB B;  5EE1 A;  1TS2 A;  5FK9 C;  3SFD B;  1XEE A;  1P7F A;  1RM6 C;  4DQO C;  2JU6 X;  1TKY A;  4O1N A;  3U52 E;  3VQI A;  5JXV A;  1D6E C;  1XCQ L;  1ZXI A;  4WH4 A;  4A6Q A;  1FFU A;  1HZ5 A;  1ZDX A;  4USA A;  3FIL B;  1D5M C;  2E6X A;  5TSS A;  3P63 A;  4KKJ A;  4ITK A;  2B76 B;  1I4H A;  4RGT A;  4N59 A;  2JWU A;  2XNA C;  3MHZ A;  3U7Z A;  5C3J B;  1C4A A;  1AW7 A;  4L23 A;  2X38 A;  1TKG A;  1E7P B;  1JRO A;  2WU2 B;  2K5P A;  2JX5 A;  2DYM A;  4ARI A;  3BYY B;  1KLG D;  2JZP A;  2LGI A;  4C80 A;  4YWG G;  2OHF A;  1JRP A;  4A90 A;  1WRI A;  2AQ3 B;  4WIP A;  2WXM A;  1FEH A;  1IGD A;  3R2I A;  2W54 A;  2HTM E;  3URY A;  1NEN B;  1FO4 A;  2H89 B;  2WXR A;  1HA5 A;  2KDM A;  3NVZ A;  4NZL B;  2FUG 1;  1SBB B;  1R7S A;  1SJE D;  3B2F A;  4ZHP A;  2KMM A;  2R61 A;  2JYT A;  4GDK B;  5EE9 A;  2Y5C A;  2QIE B;  2M19 A;  2XN9 C;  1CZP A;  1IGC A;  3AEF B;  1JWA D;  1YJJ A;  1YJI A;  2DLB A;  2LHD A;  3AH7 A;  4NAM A;  4XE0 A;  3ZYY X;  2WDR B;  2IGH A;  3TUO A;  1VZ6 A;  1K50 A;  1L4Z B;  1T3Q A;  2NMQ A;  3GS2 A;  2KAC A;  4GDL B;  3TEW A;  4YTP B;  5FKA C;  2W82 A;  1STE A;  4IKG A;  2CJO A;  1WYG A;  1IUE A;  1E9M A;  1YN3 A;  1B1Z A;  1F2R I;  1TY2 A;  2RMM A;  2YEP F;  1L5P A;  4GLS C;  3BVG A;  3MJ5 A;  1V1O A;  4R3D A;  1SEB D;  5D3D A;  2WQY B;  3LXF A;  4PT5 A;  2LEK A;  4WUR A;  1TZO A;  2VZK D;  3AE5 B;  5BMH A;  1L0V B;  1L0Y B;  3BII D;  3PZ8 A;  2CU3 A;  1T6B X;  3HVD A;  2ON8 A;  1VLB A;  2INP E;  3W1S A;  2WXL A;  1EU4 A;  4HKZ E;  1B9R A;  1JWU D;  1WGK A;  3WCQ A;  1N5W A;  5BMI A;  4RFB A;  2Q5W D;  2MEK A;  1FRR A;  2BBC A;  3O13 A;  1J7B A;  1FM0 D;  3AN1 A;  1SJH D;  2BT6 A;  2ICI A;  4MH8 A;  2GRI A;  3U2S C;  2GI9 A;  4JX1 C;  1L4D B;  3AE7 B;  3AE8 B;  4NAW B;  2GB1 A;  1GB4 A;  4B0E A;  1J7C A;  3EA6 A;  1L0X B;  1XF5 L;  2WDV B;  5AUI A;  1ESF A;  1OQQ A;  2WXJ A;  2WXI A;  1JAL A;  2Z8L A;  3MFG A;  3Q8B A;  2G1E A;  2DWQ A;  2LUM A;  3T3O A;  3P4R B;  3ZQ4 A;  1WSP A;  1JWB D;  5LNK 1;  2K3U A;  3ZGZ A;  1NI3 A;  1DOX A;  1I7H A;  1YQ3 B;  4N58 A;  3MP9 A;  4XDC A;  1GOZ A;  1CQV A;  4YTN B;  1N60 A;  3BVZ A;  3EGR A;  4MT5 A;  3LYY A;  4ZRP A;  3AE4 B;  1ZOY B;  4KGR A;  1FMA D;  1WWT A;  2FE8 A;  1MPE A;  3AMZ A;  4JE3 B;  3ZJV A;  2CJN A;  1CJE A;  3DWG C;  5HI1 A;  1EWC A;  5BYR A;  2PVG C;  3NZ3 A;  4TQ0 A;  3NUH B;  1V97 A;  5MPO A;  2PIA A;  2L52 A;  2JXT A;  1DGJ A;  1TKE A;  4US8 A;  2NTS A;  3P1M A;  1E6E B;  1I4G A;  2SEB D;  4YT0 B;  5GXG B;  3V3X A;  4C56 C;  4ARC A;  3SEB A;  3P4S B;  3NVY A;  2IGG A;  1ZUD 2;  5D7G A;  1C9F A;  1J7A A;  1ROE A;  3N9Y C;  1QOG A;  1I4Q A;  1DYQ A;  4P16 A;  1ZXH A;  1D4B A;  2I38 A;  2W3S A;  2SAK A;  4TMA B;  4RCO A;  2QSD A;  2J42 A;  1VRA B;  1V1P A;  1K52 A;  2V0G A;  4OZA A;  1JCK B;  2AQ1 B;  1C4P A;  4RNA A;  3FC4 A;  2RPV A;  5T8I A;  1FRD A;  1SB3 C;  2EKI A;  2J53 A;  2QIL A;  1HZ6 A;  3RFZ B;  2LMC A;  5BYS A;  4YSX B;  4RGO S;  2LFI A;  1C77 A;  1SXT A;  3B9J A;  1N63 A;  3Q8E A;  4RGN A;  3IAM 1;  1L6U A;  1D5X C;  2QMT A;  4TSS A;  3W2D A;  4A55 A;  1ET9 A;  3AM9 A;  1IBX A;  3AE3 B;  3ABV B;  3CIR B;  5I4D A;  1UWX A;  1FXA A;  2LHE A;  1GB1 A;  3I9V 1;  3NS1 A;  3TEX A;  2INN E;  4D2K A;  2WXN A;  4YXD B;  1GPX A;  1SE3 A;  3H8H A;  5EE0 A;  1I4P A;  2WXG A;  3DWM A;  1UGJ A;  4RF0 A;  4ZYS A;  4IDI A;  4RGM A;  4IOI E;  2D5G A;  1NVI D;  3TEZ A;  1TS3 A;  1FNU A;  1SE4 A;  1XLP A;  2JSV X;  1HEZ E;  1ET6 A;  1YQ4 B;  3PZ7 A;  3CWI A;  4JWU C;  2M56 B;  4KX6 B;  1N61 A;  1V1P B;  2IDY A;  1JWM D;  1QKZ A;  1RYJ A;  4XDD A;  2V3P A;  4HRO A;  1KLU D;  3AE9 B;  4WQM A;  2PTL A;  2ACZ B;  2QJL A;  3AEE B;  4H2A A;  2YEP B;  3Q8F A;  2WXF A;  3Q8C A;  1MHH E;  3AEG B;  3U4E G;  2KN4 A;  2I2Y A;  1FCL A;  1JML A;  4JWS C;  3C8Y A;  2L1A A;  1GAQ B;  3AEA B;  4ZRQ A;  4HKQ A;  1YN5 A;  5HFY A;  1EM7 A;  4J3O D;  1XLQ A;  2DYO A;  4FXC A;  1ZP0 B;  4MAC A;  5EE3 A;  3AED B;  2BB6 A;  1IBX B;  1F77 A;  2IJ0 A;  3UI3 A;  1ACC A;  1QIL A;  4REZ A;  3VR8 B;  3VR9 B;  1C76 A;  1TS4 A;  4XWT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...