3LYYA

Crystal structure of the mucbp domain of the adhesion protein pepe_0118 from pediococcus pentosaceus. northeast structural genomics consortium target id ptr41a
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
102
structure length
102
Chain Sequence
THATSTETIHYVNEDGDQVFEDGGGKLDFTRTVTIDDVTNEVVEYGEWTPVTDDEFAAVTSPDKDGYTPDTSEVAAQKPDMTDGPDGTVKDVEVTVTYTANP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adhesion exoprotein
publication title Crystal structure of the MucBP domain of the adhesion protein PEPE_0118 from Pediococcus pentosaceus. Northeast Structural Genomics Consortium target id PtR41A
rcsb
source organism Pediococcus pentosaceus
molecule tags Cell adhesion
total genus 17
structure length 102
sequence length 102
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17966 Mub_B2 Mub B2-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.460 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3lyyA00
2LFIA 3Q69A 4MT5A 3LYYA 3NZ3A 3I57A
chains in the Genus database with same CATH superfamily
3MHZA 1QILA 4DHJB 4IWQA 1WH3A 2RPQA 1A5RA 2WQYB 3MHSD 4R3DA 4JWSC 4GDKA 3BVGA 4K7UA 1WE7A 5LXHA 5BYRA 2BS2B 3QJZA 1SJED 4A3PA 3JVZX 2J4XA 4C56C 2KQ7A 2ZW0A 3Q3FA 3ZIMA 4B6WA 3R7QA 2DZKA 2LZ6A 3N1YC 3NVYA 4GIVA 3AE4B 3H9DA 1YX6B 3VTWA 1TS5A 2CS4A 4IG7B 3ABVB 1JWBD 4BZAA 1FCLA 3OJ3A 2JYEA 2XN9C 3DCGA 2JRHA 3Q8BA 5IOIA 4GDKB 1OQYA 3BINA 2DAJA 2DWQA 4NPNA 1TIFA 4DXAB 1SE2A 4OVZA 2HJ1A 4PS7A 3KYDD 3RMKC 3RPFC 5BMGA 1JALA 4IM0A 1I7HA 4JPSA 1T0QC 5LXIB 4HLEA 3PS6A 5HG2A 2K5PA 2PPHA 3DVNU 1AWDA 2KMCA 3MP9A 1OGWA 2N4FA 2V3NA 2MQJA 4EKUA 3RI7C 4AUQC 2WDQB 3Q6BA 1P0RA 3VHTC 4BBNC 1PGAA 2Q5WD 3P4SB 2EELA 4NJ7A 2CJOA 2MJEA 1WR6E 3EFCA 2YEPF 2INNE 2FNJB 5BMHA 2BPSA 1C77A 1FPYA 2WDTB 1GJZA 4GMVA 3HIZA 5I4DA 4M02A 3E9SA 3UINB 3VRBB 2PIAA 3Q3JA 4HJGE 2QDFA 2XBBC 4BKSD 3PLVA 3P4PB 3AEDB 2V4LA 2BT6A 1L7YA 4KZCA 1WI0A 2JXTA 2LHEA 2NPTA 3RD2A 1ZKHA 3OLMD 5C23A 4GGQA 1VLBA 5D3DA 1RRBA 4EZKA 3ZDTA 4MEMA 2NS5A 2WWZA 4RM9A 4LDTD 2WP9B 3RNEC 1P3QU 1WE6A 5C1ZA 2KDEB 3J9CA 4HJKA 5J2RA 3NZ3A 1TY0A 3AH7A 4A55A 3NG0A 2LGXA 3KQ4A 4IW0A 2D3GA 4USAA 4WIPA 4ZYNA 2K39A 1TYGB 2IDYA 4EUTA 5AUKA 3Q3MC 2NPTB 2WNMA 3RULA 2HTME 4DHZE 2MHJA 3D32A 1I4PA 4PYUA 1QF6A 3PZ8A 3QQ8B 3RN9C 2ZPNA 2D10A 3VRAB 2BVCA 1C9FA 2LFIA 1UF0A 3ZDMC 1IBXA 3TIXA 4RNAA 3VR8B 1T0YA 4F1SA 2PJHA 3A9JB 2FBWB 2QHOA 2KKCA 2JZPA 2K25A 3EA6A 2WXLA 4JL9A 2O2VB 1ESFA 2EKEC 1K52A 1ISNA 4BFRA 2BBCA 1SGHA 2DHZA 3P42A 1J7BA 2M1MA 4NAMA 4NAWA 1R4NI 4E74A 2GBKA 3KW5B 1VZ7A 2CHXA 1E7PB 3RNAC 2WS3B 4N6EB 1YJIA 3EGRA 3MC0B 2KMMA 1IBXB 2WHIA 1PGXA 3UIPB 4LTUA 5FKAC 3KUZA 3AU4A 3AE1B 5D94A 4A3OA 2RD0A 5D2MB 4NY0A 1BUIC 1FRDA 3HM6X 1AYFA 3HUIA 1CQVA 2KANA 2QSDA 2MLBA 1MI0A 4EEWA 4P16A 2KTFA 1AN8A 4B9KA 3AN1A 3RUIB 5FR3A 2L32A 3L17A 3N1XC 1YMHE 1ZUD2 3V61A 2BTEA 1YNTE 2LVQA 1FNVA 1GB4A 3BYTB 3W5VB 3IFWB 3Q3NC 5FK9C 5C2TB 2Z0DB 5TSSA 4L23A 5D6JB 4WJOA 4XGAB 3QK0A 1LXDA 4HPMB 1L2NA 3DVNV 1YOVB 4TSSA 1V1PB 2WGSA 3R7RA 2A5UA 1V86A 2L7RA 1JWAD 5DPWA 1ZE3D 1A70A 3ZLZA 2FUG1 3T3NA 3DBSA 1NBFC 4KKIA 1I4HA 2IGDA 1N5XA 2R61A 4OHJA 3GOEA 2INPE 2DZJA 5TR5A 3ML8A 3FKYA 4E71A 2L0FA 4DK5A 3PHWB 2M4NA 4WJNA 3DHGC 4W9CA 2LWPA 3RFZB 1D6EC 1EF1A 4NQKE 3TMPB 1UWXA 2K6DB 1D5XC 3AEEB 4FBJB 2H88B 3APFA 2JYTA 4K1RB 4HVBA 2B76B 3LB8C 5E6OA 1L0YB 1F0ZA 1V5TA 3AM9A 5CHVC 3VVWB 4WWPA 3VFKA 2MCNB 2TSSA 3TCAA 4TQ0A 1I4XA 2IO2B 1GAQB 3JSVA 1SJHD 2W3SA 3Q8EA 1Z2MA 3TSSA 3I63C 1KLGD 5HKHA 2IO0B 3TEXA 1VCBA 4A8XC 3W1SA 5MPOA 4TKNA 1D5MC 1QOFA 1TGZB 3K9PB 4A6QA 3DVGY 1SSNA 1WSPA 4ZOHC 3VH3B 4F7ZA 4BKTA 1KLVA 3APCA 4EE2A 4FULA 3I57A 3JSVB 4YTPB 2KVZA 1IUEA 2ZPYA 2BYFA 3NZSA 4K7SA 3DOWA 1C76A 2W55A 5J18A 3U7DA 1EWYC 4N59A 4JX1C 3X23A 3AE6B 1RLFA 1R4NB 2OJWA 1YJ1A 2X8XX 3RNCC 1WX7A 4B0EA 4WJQA 4G0NB 1ROEA 2ZNVB 3PO0A 4FHJA 3CWIA 4GN1A 1GC6A 4BOSC 2AL3A 1FO4A 2INDC 3R8BA 4M8NA 2CR5A 2J7QB 3ZUNA 1PUTA 2I2YA 4FJVB 4RFBA 2Z59B 2KFKA 5IN7A 2Y5CA 1QKZA 2K8CA 1L4ZB 3RNBC 1UNSA 2N9PC 2LGSA 4YSXB 5D7GA 3PRZA 3BZDB 2K3UA 1C79A 1MJDA 3KLSX 1L4DB 1FFUA 5J17A 3Q8FA 1WX8A 2WXNA 4MACA 4CO7A 3H1UA 3U7ZA 1R4MI 1P7FA 4IM3A 3IG3A 3P2BA 5AZHA 3EECA 1XT9B 3PTFC 2AQ3B 4I6PA 2KFKB 2O6VA 1D3ZA 1WX9A 3PZ7A 2PVGC 3JYUA 3Q2AC 1Q5WB 1K51A 2QEJC 2KN4A 2PMVA 4LDTB 2LVPA 3IBEA 1NYRA 2FUHB 1CMXB 3MC9A 2KWUB 3R3MA 4S0RA 2MBEA 2MBBB 2WU5B 1N5WA 2ZW1A 3LDZE 4ANXA 3BVMA 2WLBA 2CHWA 2GBNA 3R66C 4J3OD 2AYOB 2XEWA 1HQRD 1NI3A 1WJNA 1GB1A 2L3ZA 3FC4A 1JMLA 4J6IA 2D5GA 3CSFA 2E6XA 4K81A 1EWCA 4W9JA 2PE9A 4DDID 3V6CB 2KQSA 1KLUD 1WJ6A 1OQQA 2BS4B 4BKGA 2K8HA 3PREA 2KX0A 4KGTA 4TUUA 3MC8A 4HPPA 1KH0A 3KUDB 3H6NA 4N58A 3TBLD 2GBJA 2FCSA 3V62A 3AU5A 4RGMA 1FNWA 5IA7A 3P4RB 3HVDA 2MJDA 1BMLC 2IY0B 2MRPA 2D11A 3NOBA 2QILA 2JWUA 3N30A 2JY6A 2ZCBA 1LO5D 3AE2B 4HWIB 3EFUA 3MFGA 3DWGC 1FMAD 2KZRA 4RMAA 4ITKA 4P1CC 4HPLB 2JPHA 2FAZA 2G4SA 4HKQA 3IAS1 4OVUA 3AEFB 4GXBA 2JZZA 3AE7B 2K8BA 3O13A 4OZCA 1OEYA 3VUWA 2RDGA 2C5LC 2BQQA 4IDIA 3IVFA 2RR9A 4GU2A 1T0SC 1EM7A 3T9LA 5KHOA 2HD5B 3CF6E 5G55A 2SEBD 4EFOA 3IT4B 1OTRB 2GI9A 1QT9A 2QCZA 2D3BA 2LXCA 4C00A 3ML9A 1K8RB 3A1QB 2A4ZA 3ZTCA 3TEYA 5H92C 2N7EA 1NI2A 4KGSA 2JUOA 4RH6A 1WXMA 3BWUD 1JRPA 4MDKE 4AJWA 1GNUA 1WJUA 5HHDG 3LJ3A 2HDEA 5L95C 2GLSA 1UBQA 1N62A 3H8HA 1WRIA 2N7DA 2MW5A 4JQWC 5HI1A 2ZVNA 3WALA 3W1SC 3I5JC 1Q1OA 1X1MA 2IY1B 3VUXA 3KWLA 1Q0WB 3M63B 3UGBB 2ZJDA 4MJSB 2Y3AA 2WXKA 2ZNVC 4PS8A 1TS4A 4KDIC 4AQ7A 4MSQB 2I1JA 3NY5A 2KC2A 2GMIC 4ARCA 4RCOA 5E6PA 1NVID 4RGNA 3ZKJC 4MGIE 2DNFA 3M3JA 4M0WB 4Q2JA 1F2RI 3A9JA 1R4MB 4S17A 4ANUA 2DYOA 4DHZB 2IPKD 1P9DU 2O2VA 3B9JA 2DBYA 1E7VA 1FXTB 2V0GA 2C7NB 4LNIA 1WYGA 3T8MA 2MJ3A 1Y56A 1L6UA 2BKFA 1H8CA 4WWMA 4DQOC 5T8IA 4N9F4 3V3XA 2QIEB 4YSZB 4EOYA 1WGRA 5E6JA 3TJPA 4X57B 4DHJD 2GBMA 3DWMA 4RF1A 1FEHA 1LQBA 3BY4B 1V1OA 2MP2B 3CMMB 4W9KA 2JQRB 2KFJA 2KX3A 1EO6A 3DQVA 4YSYB 3NHEB 2L76A 4MH0E 2BWFA 4ASWC 1LFDA 2ZVOA 1WGHA 2KLCA 1ZPSA 3VTUA 3BVZA 3VDZA 5KHQA 4US8A 2BS3B 1VRAB 2Z0EB 4XX5A 3P4QB 3NVWA 2W82A 2K22A 1YQ4B 4CQNA 3NS8A 3ZJVA 1TKGA 2BGFA 4C4VB 4IWOA 2JSVX 2J42A 5EDSA 3ZNGC 4M8MA 5AEKB 1LGRA 3AEAB 3APDA 1T6BX 1XLQA 3OG5A 2YLMA 2LUEA 1CZPA 4L2YA 1OQRA 4LCDE 3P63A 1PGBA 1WYWB 1V1PA 1C4CA 1YJJA 4TMAB 2MBQA 4EZLA 2CU3A 3IXSA 2J0KA 2NBWB 1ACCA 3V6EB 4G50A 3BK2A 1IP9A 1M94A 1WRDB 1NENB 2JVCA 4A90A 1PFDA 3AEBB 1V9JA 2INCC 2MX2A 5IAAC 4WQMA 3M62B 2CU1A 3SHQA 2WXHA 2JXXA 4E3CA 1PYWD 4HCNB 5BYQA 2I38A 2LRWA 1MHXA 1FNUA 2PTLA 3P1MA 2RSUA 3FAHA 3AE8B 1C78A 3IAM1 2Z8LA 4IC7B 4W9IA 2KXJA 3K9OB 1XLNA 1TBEA 3L10B 2MWSB 2ACZB 4PYZA 2KD0A 4XDCA 1YQ3B 3N20C 3WANA 1E8ZA 2D3AA 3N32A 2NR2A 3L0WB 4OZAA 2IGHA 4XWWA 2ZZPB 3AMZA 2KQ4X 3AXCA 1S3SG 4LK0M 1XLPA 1E8YA 1VZ6A 5CX3A 4REZA 4ZRQA 1NEKB 2KYWA 1P7EA 2LEKA 1RYJA 1I4GA 1KFYB 3CIRB 4JGHB 1FXIA 2WX0A 5BO4B 2ASQA 4GOCA 4WWNA 2H89B 2PW9A 4CYEA 1SXTA 3PT2B 4FHKA 4WAAA 2DZMA 2WXQA 1YX5B 3U2SC 1OEYJ 2VZKB 1SIJA 1ZDVA 1UD7A 1FCCC 3SEBA 3WAPA 1UUPA 2L83A 4L1BA 3U8ZA 1WWTA 3SFDB 1P98A 1VJKA 2N1VA 1I4RA 1L0VB 3EHVA 3VXWA 1DYQA 3VTVA 1TKYA 5G5GA 4C7YA 4XDDA 2KDMA 1XQQA 3ZGZA 4KKJA 1C4PA 1NYQA 4A20A 5G2NA 3PRMB 4TQ1A 4TV3A 3EUB2 3VH4B 3ZRCA 5E6NA 3A9KA 2KOXA 5AZGA 3ZJUA 1FRRA 3SFEB 4FXCA 1E8WA 4ZHPA 1MVKA 1JWUD 2MH7A 1VR9A 2HTHA 2V3SA 2PVOD 2AWTA 3UF8A 3I9V1 3ZVVA 1E90A 3L13A 3MJWA 4IWPA 1FXAA 1N6ZA 1MG8A 1IYFA 1K53A 2J0JA 4ARIA 2BB6A 2KT7A 3A9KB 4WWOA 2FE8A 3AE5B 1RFAA 3MJ5A 3NZUA 4ICVA 4NJCA 4I6NB 3B08A 1V80A 4KV2A 3B0AA 2LJIA 1WGDA 4BKSA 2EKIA 3VAWA 2N9LA 1ET9A 2DENB 2KDBA 2XNAC 5LNK1 3U52E 4A9AA 2M56B 3Q3OC 2MEKA 1ZDXA 1L6VA 3ZYYX 1V8CA 2SAKA 1F77A 3DHIC 1V49A 1SE4A 3NRZA 2WXPA 2JU6X 4II3B 2K9XA 4KSLC 4FADA 1EUVB 2UYZB 1G6JA 3URYA 2HJ8A 1D5ZC 1SE9A 4XZ4A 4HEA1 2VH1A 1PQSA 4WJPA 3ZXVA 4W9LA 2G1EA 3WAMA 1WGYA 2AQ2B 1TS3A 4GDLB 1RFKA 4ZDVA 1IGDA 2NBVB 4GB9A 4AOFA 1BXTA 3UIOB 3NUHB 4AS1A 2BWES 4PS3A 1L5PA 1UGMA 1XEEA 2JZ3B 4PT5A 4HK2A 1EF5A 4YL8A 2W9NA 4IM2A 1FM0D 3BK1A 1TTNA 1C4AA 3RYTA 3H7PA 1XF5L 1QZEA 3C19A 2FCQA 1E5WA 3ZQ4A 3DDCB 1GUAB 1WF9A 3WIMA 5IO9A 1ENFA 4FJYA 1UH6A 3QCAA 2BW2A 2MBHA 4DDGD 2R2OA 2BB5A 2RPVA 4RM8A 4K7WA 3TL5A 2LJ5A 4FLHA 1CK1A 1ET6A 1WXAA 1HZ6A 3WCQA 2NTTA 3U4EG 2KWVB 4CHKA 1MPEA 3H7PB 2JT4B 1UBIA 3KUCB 4MH8A 1WXSA 2QMTA 2D07B 3L4PA 4YTNB 3KYCD 3PRPB 1BT0A 2DYBA 2XK5B 3N3KB 2I1KA 3L08A 4ZRKA 4XC2A 1QLBB 4AP4C 2WXMA 3VUYA 1GC7A 1PDXA 1EU4A 3KVFB 3NVZA 4KDLB 4WQOB 5L83A 3V05A 2L8JA 2WU2B 3BIID 2GBRA 1GOZA 1UZXB 3PZDA 2N9EB 4ICUA 5CTRC 3RT3B 1KJTA 2KN5A 2MBOA 1WGKA 2C7HA 3Q69A 4MGYE 4HXDA 4ZRIA 4P1BC 2CKHB 3GE3C 3ZW3A 4K3CA 4NZLB 2PEAA 1XLOA 3A1QA 3E56A 2B3AA 5G5HA 1TS2A 2IO1B 1S1QB 1H4RA 1WM3A 3WA0A 1J7AA 3OJ4B 3TEWA 2C9WB 2R2QA 3GZNI 1F2RC 3SDLC 1XCTL 1WFYA 2K0PA 5BYSA 1VZ8A 4OW0A 3ZNZB 4ANVA 2ONQA 3UQAA 4BOZB 4YT0B 1T0RC 1JCKB 2WXJA 1HTOA 1FD6A 2AL6A 4MJSA 2MSED 3A4SC 2K6QA 4D2KA 1YQBA 1KM7A 1QOBA 3DBRI 2LMCA 2WDRB 2NVUI 4K3BA 1WZ3A 4KVGB 1J0GA 4OVVA 4EZJA 2VH2A 3PV1A 2WXFA 1F1HA 4ZYSA 4HROA 3KWVA 1HEZE 4M0WA 4WURA 3PHXB 2WDVB 2DX5B 1CJEA 1Z5SB 3QAQA 2RDBC 3DBLI 2GRIA 2N9XA 2GOWA 3NJTA 2AEHA 2W3RA 3ZJTA 3AI5A 2EMTA 5GXGB 1MG4A 1RWSA 1SE3A 2KMAA 3N1ZC 1YN4A 3AE3B 3QARA 3RZFA 2PLPA 1WXVA 3DBHI 2D3CA 2M8SA 4MT5A 1WMHA 3HK0A 1MHHE 3HRDD 3V60A 3ECIA 1TT5B 3IT6B 3HM3A 3DVGX 1WY8A 2IZVB 1SEBD 3ZXRA 4ZRJA 3O65B 5AUIA 1XXGA 2M19A 5JHAA 1V97A 1C1YB 3VR9B 2Y5PA 2KWCA 2G4DB 5EE0A 2MP2A 3TUOA 1KF6B 1FFVA 1DGJA 2LD9A 1WIAA 3PVLA 5EE9A 3QWZB 4DBGA 2KC1A 4LNNA 4KX6B 3GE8C 1E10A 2KNBA 3AULA 4M00A 2IO3B 3QA8A 1WMHB 1STEA 5H8YE 2LGDA 2KO3A 1DOXA 2O6VD 3W1YA 1JW9D 1QQRA 1T5XD 3QC8B 3MTNB 4FJZA 3FILA 4XE0A 4C4VA 3Q8CA 4IOIE 2CHZA 5DPTA 1DOYA 3HVZA 1KOTA 2EMSA 2KLGA 2WXGA 2LI5A 4LJOB 1P1AA 2QC8A 1I4QA 5AZFA 4I6LB 3Q14C 1D4BA 2LGYA 3PPAA 1TZOA 4LNKA 1B9RA 3ZTDA 1F52A 4W9EA 2D2QA 5JH5C 2NTSA 3FILB 2FIFA 3A4RA 2UU7A 3TEZA 2M0XA 3L54A 3SD5A 2JWZA 4KSKC 4B0MA 4XWTA 2REXA 4YXDB 1OFFA 1DOIA 1TKEA 3ALBA 1XD3B 4H2AA 5IKCM 4KIKA 2WXIA 3A33B 2ON8A 1ZW7A 2V1YA 1WGGA 3PLUA 4QAYA 3ZNID 3JW0X 3DPDA 4JIOU 3AV8A 1U4AA 2RGFA 3GB1A 2L00B 4P7IA 1Q10A 2IJ0A 4NAWB 4P6VF 3ZO5B 2L05A 2FCMA 4US9A 1I35A 2KTRA 3OAWA 4UDUC 5LLIA 2NCNA 3KH0A 3SR6A 3U30A 3GZNB 2RDHA 3B2GA 4NNJB 3ZNHB 4KIKB 5C3JB 2KAJA 1YN5A 5JXVA 2NMQA 5HFYA 2BYVE 4KGRA 4HKZE 2J53A 3WAOA 2L52A 5CHWA 1SIFA 2V9HA 1E0ZA 1B1ZA 3ENEA 3ETRA 2GB1A 3AB5A 4PK1A 3Q8AA 4DXGA 1WZ0A 4LLGM 3AE9B 2DZIA 2KDFB 2CJNA 1UELA 3DBRB 1N63A 2KTRB 1IPGA 1JWMD 3S2AA 3BYYB 2LGIA 1SBBB 2BF8B 2K1FA 1Y8RC 5GMVA 2M0AA 5FR6A 2N0SB 2LXAA 2OJRA 4MSMB 4JWUC 1VD2A 2DYMA 4HRSA 3RNFC 3I3TB 2KJHB 4RGTA 3C0RB 1VDVA 4LNFA 3B2FA 1K50A 3DBLB 3LXFA 1ZOYB 2WXOA 2BKRB 1NDDA 4W9GA 1TY2A 1LM8B 2NBUA 5JZEB 1YN3A 3PSEB 3DBHB 3AEGB 3NS1A 5EE1A 4ANWA 3X0WA 5BMIA 1N61A 1ZP0B 2G3QB 4W9HA 2KACA 2OHFA 1HXYD 4IKGA 4LJPB 1TZ1A 3VQIA 2KDIA 4URKA 4WAFA 2LHDA 2KWDA 1QOGA 1V2YA 1KTKA 4KZ0A 4MGZE 4NJ6A 2FIDA 3ZRFA 3IHPC 1JWSD 2WXRA 3AECB 2G9HD 1WJ4A 2HE7A 3C8YA 2AQ1B 2LASA 3W2DA 1JROA 4DWFA 4BAXA 3QX1A 2KJRA 2RMMA 4B95A 2IBIB 4F8CB 1I42A 3H7SA 2ICIA 1ZXHA 1E6EB 4GLSC 4MGKE 2IGGA 4O1NA 4RF0A 3L16A 2V3PA 2WYQA 1AARA 4AJYB 4YTMB 4FN2A 1J7CA 1N60A 1RM6C 2JRIB 3RNGC 2C60A 4HCPB 5CHFA 1C3TA 2L1AA 2IYDB 2ZEQA 4RGOS 1RAXA 4YWGG 2ZCCA 2PKOA 4MM3A 2V4IB 4GSWA 3SU8X 1WM2A 1WXQA 1HZ5A 1YIWA 4OZBA 2VRRB 2KVRA 3R2TA 4DXFA 2OEDA 4XYCA 4G3XB 1E8XA 2BYTA 1E9MA 4C7ZA 2G45B 1T3QA 2E3TA 2L0TA 4GDLA 2QJLA 4HDQA 4ZRPA 1GPXA 1UGJA 4FA6A 2C7MB 4JE3B 1J8CA 3CSTA 3M95A 4II2B 5D3IB 3W9CB 4ZHOA 1YD8U 2OOBB 1M4VA 4MM3B 2DLBA 3NVVA 5JHBA 1HA5A 1HTQA 1FIQA 2BYEA 2JX5A 1UWMA 3EC8A 4ACFA 1JQ4A 3N9YC 1V81A 4AWJA 3DHHC 1QOAA 3UQBA 3RCZA 1XO3A 5DPRA 1XCQL 2WX1A 3T3OA 2DAFA 2X38A 1MFWA 2KK8A 1ZGUB 2YVCA 3PGEA 2LVOA 3B1LX 2W54A 4NQLB 5EE3A 1E7UA 4G11A 1V6EA 1IGCA 2LUMA 3GS2A 1SB3C 5IP4D 2M17A 1J19A 1GG3A 1ZXIA 3RZWC 2XK5A 1WR1A 1R7SA 2J52A 1EU3A 4JLCA 2KJ6A 1HE8A 2J0MA 1JRUA 4LNOA 4C80A 2MA9B 3QHTA 5DPSA 3GP7A 3UI3A 4BBNF 1F9JA 2UWQA 1KRHA 3R2IA 4MELA 2N9KA 2N1WA 4WH4A 2N7JA 3ONSA 1V5OA 1TJEA 2LRUA 4W9FA 3LYYA 2YEPB 4IUMB 2PE6B 3OWEB 4W9DA 2VZKD 2FCNA 5DCNA 4BVUC 2Y5BB 4HDOA 3HHMA 3QIJA 1AW7A 2KHWB 1SF0A 2O6VB 1L0XB 2JF5A 2AX5A 4M01A 3W5UB
chains in the Genus database with same CATH topology
4YTPB 3MHZA 1IUEA 1QILA 1PYWD 1SEBD 1C76A 5BYQA 2W55A 5AUIA 2I38A 2WQYB 1XXGA 1MHXA 2M19A 1V97A 1FNUA 1EWYC 2PTLA 3P1MA 3VR9B 4N59A 3FAHA 4R3DA 4JWSC 2Y5PA 4JX1C 3AE8B 3AE6B 1C78A 3IAM1 2Z8LA 5EE0A 3BVGA 3TUOA 1KF6B 1FFVA 1XLNA 5BYRA 1DGJA 2BS2B 4B0EA 1SJED 5EE9A 2ACZB 4XDCA 1ROEA 2J4XA 4KX6B 1YQ3B 3PO0A 3CWIA 4C56C 1E10A 2ZW0A 4OZAA 1FO4A 3NVYA 1STEA 2IGHA 5H8YE 4XWWA 3AMZA 3AE4B 1DOXA 1JW9D 3R8BA 1QQRA 2KQ4X 1T5XD 1TS5A 4LK0M 3FILA 3ABVB 1PUTA 2I2YA 4XE0A 1JWBD 1XLPA 4RFBA 1VZ6A 3Q8CA 4REZA 4IOIE 1FCLA 4ZRQA 1NEKB 2JYEA 1P7EA 2XN9C 1DOYA 2LEKA 1RYJA 3Q8BA 2Y5CA 1I4GA 1KFYB 3HVZA 4GDKB 3CIRB 1QKZA 1L4ZB 2WXGA 1UNSA 2DWQA 1FXIA 4YSXB 1SE2A 4OVZA 5D7GA 3BZDB 2K3UA 2H89B 2PW9A 1C79A 3RPFC 1I4QA 5BMGA 1JALA 1I7HA 3KLSX 4JPSA 1L4DB 1FFUA 1SXTA 3Q8FA 1D4BA 2WXQA 2WXNA 4MACA 5HG2A 3U2SC 3U7ZA 1TZOA 2K5PA 1B9RA 2VZKB 1AWDA 1P7FA 3MP9A 2NTSA 1SIJA 1ZDVA 1FCCC 3FILB 3SEBA 2V3NA 3TEZA 2AQ3B 4B0MA 4XWTA 1UUPA 2L83A 4L1BA 4YXDB 1WWTA 3SFDB 1OFFA 1DOIA 1TKEA 2WDQB 3PZ7A 1VJKA 2PVGC 1I4RA 1PGAA 2Q5WD 1L0VB 3P4SB 4H2AA 1DYQA 1K51A 1TKYA 2EELA 2CJOA 2MJEA 2QEJC 2KN4A 5G5GA 2PMVA 4C7YA 4XDDA 2KDMA 2YEPF 2INNE 2WXIA 1NYRA 5BMHA 2ON8A 3ZGZA 1C77A 4KKJA 1C4PA 1NYQA 2WU5B 1N5WA 2ZW1A 5I4DA 4TQ1A 3BVMA 2WLBA 3E9SA 3EUB2 4J3OD 1HQRD 3VRBB 1NI3A 2PIAA 1GB1A 3AV8A 4HJGE 3ZJUA 1FRRA 1JMLA 3GB1A 3FC4A 2D5GA 1Q10A 3P4PB 2IJ0A 3AEDB 4NAWB 2E6XA 4P6VF 3SFEB 2BT6A 4FXCA 1EWCA 2JXTA 2LHEA 4ZHPA 1MVKA 4US9A 1JWUD 2MH7A 1VR9A 1VLBA 1KLUD 4UDUC 5D3DA 3SR6A 1OQQA 2BS4B 2PVOD 2RDHA 3B2GA 3I9V1 5C3JB 2KAJA 1YN5A 5JXVA 2NMQA 5HFYA 2WP9B 4KGRA 4HKZE 2J53A 3J9CA 2L52A 4KGTA 1FXAA 1E0ZA 1B1ZA 3NZ3A 1K53A 1TY0A 1KH0A 3AH7A 4A55A 3ETRA 4ARIA 2GB1A 2BB6A 3AB5A 3KQ4A 4N58A 3Q8AA 4DXGA 4USAA 2FE8A 4WIPA 4LLGM 1TYGB 3AE5B 4RGMA 2IDYA 1FNWA 3AE9B 3P4RB 5AUKA 2CJNA 3MJ5A 4NJCA 3HVDA 2MJDA 2WNMA 1BMLC 2LJIA 1N63A 1JWMD 2QILA 2JWUA 2HTME 3BYYB 2EKIA 2LGIA 1SBBB 1LO5D 2N9LA 3AE2B 2M0AA 2N0SB 1ET9A 2XNAC 1I4PA 5LNK1 3U52E 4A9AA 1QF6A 4JWUC 3PZ8A 3MFGA 2M56B 3DWGC 2MEKA 2DYMA 1FMAD 1ZDXA 1L6VA 3ZYYX 3VRAB 4HRSA 1V8CA 2SAKA 4ITKA 1F77A 4RGTA 1VDVA 1C9FA 1SE4A 2LFIA 3NRZA 3B2FA 1K50A 4HKQA 3IAS1 1IBXA 3IT6B 3LXFA 2WXPA 1ZOYB 2JU6X 2WXOA 4RNAA 3VR8B 2K9XA 2FBWB 3AEFB 1TY2A 2JZPA 3AE7B 3O13A 4OZCA 3EA6A 2WXLA 3URYA 1YN3A 1D5ZC 4HEA1 1ESFA 2RDGA 1K52A 4IDIA 2G1EA 3AEGB 2BBCA 3NS1A 2AQ2B 3P42A 1TS3A 1J7BA 4GDLB 5EE1A 1EM7A 1RFKA 1IGDA 4NAMA 2SEBD 3IT4B 1BXTA 2GI9A 3NUHB 4AS1A 1QT9A 5BMIA 1N61A 1VZ7A 1ZP0B 1L5PA 1E7PB 1XEEA 2KACA 2OHFA 2WS3B 4PT5A 4N6EB 1YJIA 1HXYD 3EGRA 3TEYA 1FM0D 4IKGA 3BK1A 3MC0B 3VQIA 2KMMA 1C4AA 5H92C 1IBXB 4WAFA 2LHDA 4KGSA 1PGXA 1XF5L 4LTUA 4RH6A 2KWDA 1QOGA 5FKAC 1KTKA 3BWUD 3ZQ4A 1JRPA 1ENFA 1JWSD 2WXRA 3AE1B 5HHDG 2HDEA 3AECB 2BW2A 2G9HD 1BUIC 3C8YA 2AQ1B 3W2DA 1JROA 1FRDA 1N62A 3H8HA 1AYFA 3HUIA 2RMMA 1WRIA 2BB5A 5HI1A 1CQVA 2RPVA 2ICIA 2QSDA 1ZXHA 1E6EB 4GLSC 1MI0A 2IGGA 4P16A 4O1NA 4RF0A 1AN8A 3KWLA 2V3PA 1CK1A 3AN1A 5FR3A 1ET6A 4YTMB 2L32A 1J7CA 1N60A 1YMHE 1ZUD2 1HZ6A 2Y3AA 2WXKA 1RM6C 2BTEA 3WCQA 2NTTA 1YNTE 3U4EG 1FNVA 1TS4A 1MPEA 4MH8A 4AQ7A 1GB4A 3L4PA 2QMTA 2L1AA 3BYTB 3W5VB 4YTNB 4ARCA 5FK9C 4RCOA 4RGOS 4YWGG 5C2TB 1NVID 2PKOA 4RGNA 5TSSA 4L23A 2V4IB 1QLBB 1WXQA 2WXMA 1HZ5A 4Q2JA 1F2RI 1PDXA 1EU4A 4OZBA 4TSSA 3NVZA 1V1PB 2DYOA 1JWAD 3R2TA 4DXFA 2OEDA 2IPKD 1ZE3D 3V05A 1A70A 2WU2B 2FUG1 3BIID 3B9JA 2DBYA 2BYTA 1E9MA 4C7ZA 3T3NA 1T3QA 2E3TA 2V0GA 1GOZA 2QJLA 1WYGA 2MJ3A 4ZRPA 1GPXA 1Y56A 1L6UA 1UGJA 4JE3B 4WWMA 1WGKA 1I4HA 3Q69A 4KKIA 2IGDA 5T8IA 4DQOC 1N5XA 5D3IB 2R61A 4NZLB 4OHJA 3W9CB 4ZHOA 3V3XA 1XLOA 1M4VA 3E56A 4MM3B 2DLBA 2QIEB 3NVVA 4YSZB 5G5HA 1HA5A 1TS2A 2INPE 1FIQA 2JX5A 5E6JA 1UWMA 1J7AA 3TEWA 3DWMA 4RF1A 1JQ4A 1FEHA 3N9YC 1F2RC 1QOAA 1XCTL 1V1OA 2JQRB 5BYSA 2K0PA 3RFZB 1D6EC 1XO3A 1VZ8A 4OW0A 1XCQL 2ONQA 1UWXA 4YSYB 3T3OA 2X38A 4YT0B 1D5XC 3AEEB 1JCKB 2WXJA 2H88B 2W54A 5EE3A 1FD6A 2JYTA 1ZPSA 3BVZA 1IGCA 2LUMA 4US8A 3GS2A 2BS3B 1VRAB 1SB3C 2B76B 4D2KA 3LB8C 3P4QB 3NVWA 2K22A 2W82A 1QOBA 1YQ4B 4CQNA 1L0YB 2LMCA 1ZXIA 2WDRB 3ZJVA 1F0ZA 1TKGA 3AM9A 2JSVX 2TSSA 2J42A 4TQ0A 1R7SA 2J52A 2WXFA 1EU3A 1I4XA 4ZYSA 3AEAB 4HROA 1GAQB 4C80A 1SJHD 2W3SA 1T6BX 1XLQA 3Q8EA 3KWVA 1HEZE 3GP7A 4M0WA 4WURA 3TSSA 3UI3A 2WDVB 1CZPA 1CJEA 1KLGD 4L2YA 1OQRA 1KRHA 3TEXA 3P63A 1PGBA 1V1PA 1C4CA 1YJJA 3R2IA 4A8XC 3W1SA 5MPOA 1D5MC 2N9KA 1QOFA 4WH4A 2GRIA 2N7JA 1TJEA 2W3RA 4TMAB 4A6QA 2CU3A 3ZJTA 3LYYA 1SSNA 2YEPB 3IXSA 5GXGB 1WSPA 3OWEB 4ZOHC 1RWSA 1SE3A 1ACCA 2VZKD 1YN4A 3AE3B 3BK2A 2PLPA 4MT5A 4EE2A 1NENB 4A90A 1AW7A 1MHHE 3HRDD 1PFDA 3AEBB 1SF0A 1L0XB 4WQMA 3I57A 2AX5A 3W5UB 2WXHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LFI A;  3Q69 A;  4MT5 A;  3LYY A;  3NZ3 A;  3I57 A; 
#chains in the Genus database with same CATH topology
 3MHZ A;  1QIL A;  4DHJ B;  4IWQ A;  1WH3 A;  2RPQ A;  1A5R A;  2WQY B;  3MHS D;  4R3D A;  4JWS C;  4GDK A;  3BVG A;  4K7U A;  1WE7 A;  5LXH A;  5BYR A;  2BS2 B;  3QJZ A;  1SJE D;  4A3P A;  3JVZ X;  2J4X A;  4C56 C;  2KQ7 A;  2ZW0 A;  3Q3F A;  3ZIM A;  4B6W A;  3R7Q A;  2DZK A;  2LZ6 A;  3N1Y C;  3NVY A;  4GIV A;  3AE4 B;  3H9D A;  1YX6 B;  3VTW A;  1TS5 A;  2CS4 A;  4IG7 B;  3ABV B;  1JWB D;  4BZA A;  1FCL A;  3OJ3 A;  2JYE A;  2XN9 C;  3DCG A;  2JRH A;  3Q8B A;  5IOI A;  4GDK B;  1OQY A;  3BIN A;  2DAJ A;  2DWQ A;  4NPN A;  1TIF A;  4DXA B;  1SE2 A;  4OVZ A;  2HJ1 A;  4PS7 A;  3KYD D;  3RMK C;  3RPF C;  5BMG A;  1JAL A;  4IM0 A;  1I7H A;  4JPS A;  1T0Q C;  5LXI B;  4HLE A;  3PS6 A;  5HG2 A;  2K5P A;  2PPH A;  3DVN U;  1AWD A;  2KMC A;  3MP9 A;  1OGW A;  2N4F A;  2V3N A;  2MQJ A;  4EKU A;  3RI7 C;  4AUQ C;  2WDQ B;  3Q6B A;  1P0R A;  3VHT C;  4BBN C;  1PGA A;  2Q5W D;  3P4S B;  2EEL A;  4NJ7 A;  2CJO A;  2MJE A;  1WR6 E;  3EFC A;  2YEP F;  2INN E;  2FNJ B;  5BMH A;  2BPS A;  1C77 A;  1FPY A;  2WDT B;  1GJZ A;  4GMV A;  3HIZ A;  5I4D A;  4M02 A;  3E9S A;  3UIN B;  3VRB B;  2PIA A;  3Q3J A;  4HJG E;  2QDF A;  2XBB C;  4BKS D;  3PLV A;  3P4P B;  3AED B;  2V4L A;  2BT6 A;  1L7Y A;  4KZC A;  1WI0 A;  2JXT A;  2LHE A;  2NPT A;  3RD2 A;  1ZKH A;  3OLM D;  5C23 A;  4GGQ A;  1VLB A;  5D3D A;  1RRB A;  4EZK A;  3ZDT A;  4MEM A;  2NS5 A;  2WWZ A;  4RM9 A;  4LDT D;  2WP9 B;  3RNE C;  1P3Q U;  1WE6 A;  5C1Z A;  2KDE B;  3J9C A;  4HJK A;  5J2R A;  3NZ3 A;  1TY0 A;  3AH7 A;  4A55 A;  3NG0 A;  2LGX A;  3KQ4 A;  4IW0 A;  2D3G A;  4USA A;  4WIP A;  4ZYN A;  2K39 A;  1TYG B;  2IDY A;  4EUT A;  5AUK A;  3Q3M C;  2NPT B;  2WNM A;  3RUL A;  2HTM E;  4DHZ E;  2MHJ A;  3D32 A;  1I4P A;  4PYU A;  1QF6 A;  3PZ8 A;  3QQ8 B;  3RN9 C;  2ZPN A;  2D10 A;  3VRA B;  2BVC A;  1C9F A;  2LFI A;  1UF0 A;  3ZDM C;  1IBX A;  3TIX A;  4RNA A;  3VR8 B;  1T0Y A;  4F1S A;  2PJH A;  3A9J B;  2FBW B;  2QHO A;  2KKC A;  2JZP A;  2K25 A;  3EA6 A;  2WXL A;  4JL9 A;  2O2V B;  1ESF A;  2EKE C;  1K52 A;  1ISN A;  4BFR A;  2BBC A;  1SGH A;  2DHZ A;  3P42 A;  1J7B A;  2M1M A;  4NAM A;  4NAW A;  1R4N I;  4E74 A;  2GBK A;  3KW5 B;  1VZ7 A;  2CHX A;  1E7P B;  3RNA C;  2WS3 B;  4N6E B;  1YJI A;  3EGR A;  3MC0 B;  2KMM A;  1IBX B;  2WHI A;  1PGX A;  3UIP B;  4LTU A;  5FKA C;  3KUZ A;  3AU4 A;  3AE1 B;  5D94 A;  4A3O A;  2RD0 A;  5D2M B;  4NY0 A;  1BUI C;  1FRD A;  3HM6 X;  1AYF A;  3HUI A;  1CQV A;  2KAN A;  2QSD A;  2MLB A;  1MI0 A;  4EEW A;  4P16 A;  2KTF A;  1AN8 A;  4B9K A;  3AN1 A;  3RUI B;  5FR3 A;  2L32 A;  3L17 A;  3N1X C;  1YMH E;  1ZUD 2;  3V61 A;  2BTE A;  1YNT E;  2LVQ A;  1FNV A;  1GB4 A;  3BYT B;  3W5V B;  3IFW B;  3Q3N C;  5FK9 C;  5C2T B;  2Z0D B;  5TSS A;  4L23 A;  5D6J B;  4WJO A;  4XGA B;  3QK0 A;  1LXD A;  4HPM B;  1L2N A;  3DVN V;  1YOV B;  4TSS A;  1V1P B;  2WGS A;  3R7R A;  2A5U A;  1V86 A;  2L7R A;  1JWA D;  5DPW A;  1ZE3 D;  1A70 A;  3ZLZ A;  2FUG 1;  3T3N A;  3DBS A;  1NBF C;  4KKI A;  1I4H A;  2IGD A;  1N5X A;  2R61 A;  4OHJ A;  3GOE A;  2INP E;  2DZJ A;  5TR5 A;  3ML8 A;  3FKY A;  4E71 A;  2L0F A;  4DK5 A;  3PHW B;  2M4N A;  4WJN A;  3DHG C;  4W9C A;  2LWP A;  3RFZ B;  1D6E C;  1EF1 A;  4NQK E;  3TMP B;  1UWX A;  2K6D B;  1D5X C;  3AEE B;  4FBJ B;  2H88 B;  3APF A;  2JYT A;  4K1R B;  4HVB A;  2B76 B;  3LB8 C;  5E6O A;  1L0Y B;  1F0Z A;  1V5T A;  3AM9 A;  5CHV C;  3VVW B;  4WWP A;  3VFK A;  2MCN B;  2TSS A;  3TCA A;  4TQ0 A;  1I4X A;  2IO2 B;  1GAQ B;  3JSV A;  1SJH D;  2W3S A;  3Q8E A;  1Z2M A;  3TSS A;  3I63 C;  1KLG D;  5HKH A;  2IO0 B;  3TEX A;  1VCB A;  4A8X C;  3W1S A;  5MPO A;  4TKN A;  1D5M C;  1QOF A;  1TGZ B;  3K9P B;  4A6Q A;  3DVG Y;  1SSN A;  1WSP A;  4ZOH C;  3VH3 B;  4F7Z A;  4BKT A;  1KLV A;  3APC A;  4EE2 A;  4FUL A;  3I57 A;  3JSV B;  4YTP B;  2KVZ A;  1IUE A;  2ZPY A;  2BYF A;  3NZS A;  4K7S A;  3DOW A;  1C76 A;  2W55 A;  5J18 A;  3U7D A;  1EWY C;  4N59 A;  4JX1 C;  3X23 A;  3AE6 B;  1RLF A;  1R4N B;  2OJW A;  1YJ1 A;  2X8X X;  3RNC C;  1WX7 A;  4B0E A;  4WJQ A;  4G0N B;  1ROE A;  2ZNV B;  3PO0 A;  4FHJ A;  3CWI A;  4GN1 A;  1GC6 A;  4BOS C;  2AL3 A;  1FO4 A;  2IND C;  3R8B A;  4M8N A;  2CR5 A;  2J7Q B;  3ZUN A;  1PUT A;  2I2Y A;  4FJV B;  4RFB A;  2Z59 B;  2KFK A;  5IN7 A;  2Y5C A;  1QKZ A;  2K8C A;  1L4Z B;  3RNB C;  1UNS A;  2N9P C;  2LGS A;  4YSX B;  5D7G A;  3PRZ A;  3BZD B;  2K3U A;  1C79 A;  1MJD A;  3KLS X;  1L4D B;  1FFU A;  5J17 A;  3Q8F A;  1WX8 A;  2WXN A;  4MAC A;  4CO7 A;  3H1U A;  3U7Z A;  1R4M I;  1P7F A;  4IM3 A;  3IG3 A;  3P2B A;  5AZH A;  3EEC A;  1XT9 B;  3PTF C;  2AQ3 B;  4I6P A;  2KFK B;  2O6V A;  1D3Z A;  1WX9 A;  3PZ7 A;  2PVG C;  3JYU A;  3Q2A C;  1Q5W B;  1K51 A;  2QEJ C;  2KN4 A;  2PMV A;  4LDT B;  2LVP A;  3IBE A;  1NYR A;  2FUH B;  1CMX B;  3MC9 A;  2KWU B;  3R3M A;  4S0R A;  2MBE A;  2MBB B;  2WU5 B;  1N5W A;  2ZW1 A;  3LDZ E;  4ANX A;  3BVM A;  2WLB A;  2CHW A;  2GBN A;  3R66 C;  4J3O D;  2AYO B;  2XEW A;  1HQR D;  1NI3 A;  1WJN A;  1GB1 A;  2L3Z A;  3FC4 A;  1JML A;  4J6I A;  2D5G A;  3CSF A;  2E6X A;  4K81 A;  1EWC A;  4W9J A;  2PE9 A;  4DDI D;  3V6C B;  2KQS A;  1KLU D;  1WJ6 A;  1OQQ A;  2BS4 B;  4BKG A;  2K8H A;  3PRE A;  2KX0 A;  4KGT A;  4TUU A;  3MC8 A;  4HPP A;  1KH0 A;  3KUD B;  3H6N A;  4N58 A;  3TBL D;  2GBJ A;  2FCS A;  3V62 A;  3AU5 A;  4RGM A;  1FNW A;  5IA7 A;  3P4R B;  3HVD A;  2MJD A;  1BML C;  2IY0 B;  2MRP A;  2D11 A;  3NOB A;  2QIL A;  2JWU A;  3N30 A;  2JY6 A;  2ZCB A;  1LO5 D;  3AE2 B;  4HWI B;  3EFU A;  3MFG A;  3DWG C;  1FMA D;  2KZR A;  4RMA A;  4ITK A;  4P1C C;  4HPL B;  2JPH A;  2FAZ A;  2G4S A;  4HKQ A;  3IAS 1;  4OVU A;  3AEF B;  4GXB A;  2JZZ A;  3AE7 B;  2K8B A;  3O13 A;  4OZC A;  1OEY A;  3VUW A;  2RDG A;  2C5L C;  2BQQ A;  4IDI A;  3IVF A;  2RR9 A;  4GU2 A;  1T0S C;  1EM7 A;  3T9L A;  5KHO A;  2HD5 B;  3CF6 E;  5G55 A;  2SEB D;  4EFO A;  3IT4 B;  1OTR B;  2GI9 A;  1QT9 A;  2QCZ A;  2D3B A;  2LXC A;  4C00 A;  3ML9 A;  1K8R B;  3A1Q B;  2A4Z A;  3ZTC A;  3TEY A;  5H92 C;  2N7E A;  1NI2 A;  4KGS A;  2JUO A;  4RH6 A;  1WXM A;  3BWU D;  1JRP A;  4MDK E;  4AJW A;  1GNU A;  1WJU A;  5HHD G;  3LJ3 A;  2HDE A;  5L95 C;  2GLS A;  1UBQ A;  1N62 A;  3H8H A;  1WRI A;  2N7D A;  2MW5 A;  4JQW C;  5HI1 A;  2ZVN A;  3WAL A;  3W1S C;  3I5J C;  1Q1O A;  1X1M A;  2IY1 B;  3VUX A;  3KWL A;  1Q0W B;  3M63 B;  3UGB B;  2ZJD A;  4MJS B;  2Y3A A;  2WXK A;  2ZNV C;  4PS8 A;  1TS4 A;  4KDI C;  4AQ7 A;  4MSQ B;  2I1J A;  3NY5 A;  2KC2 A;  2GMI C;  4ARC A;  4RCO A;  5E6P A;  1NVI D;  4RGN A;  3ZKJ C;  4MGI E;  2DNF A;  3M3J A;  4M0W B;  4Q2J A;  1F2R I;  3A9J A;  1R4M B;  4S17 A;  4ANU A;  2DYO A;  4DHZ B;  2IPK D;  1P9D U;  2O2V A;  3B9J A;  2DBY A;  1E7V A;  1FXT B;  2V0G A;  2C7N B;  4LNI A;  1WYG A;  3T8M A;  2MJ3 A;  1Y56 A;  1L6U A;  2BKF A;  1H8C A;  4WWM A;  4DQO C;  5T8I A;  4N9F 4;  3V3X A;  2QIE B;  4YSZ B;  4EOY A;  1WGR A;  5E6J A;  3TJP A;  4X57 B;  4DHJ D;  2GBM A;  3DWM A;  4RF1 A;  1FEH A;  1LQB A;  3BY4 B;  1V1O A;  2MP2 B;  3CMM B;  4W9K A;  2JQR B;  2KFJ A;  2KX3 A;  1EO6 A;  3DQV A;  4YSY B;  3NHE B;  2L76 A;  4MH0 E;  2BWF A;  4ASW C;  1LFD A;  2ZVO A;  1WGH A;  2KLC A;  1ZPS A;  3VTU A;  3BVZ A;  3VDZ A;  5KHQ A;  4US8 A;  2BS3 B;  1VRA B;  2Z0E B;  4XX5 A;  3P4Q B;  3NVW A;  2W82 A;  2K22 A;  1YQ4 B;  4CQN A;  3NS8 A;  3ZJV A;  1TKG A;  2BGF A;  4C4V B;  4IWO A;  2JSV X;  2J42 A;  5EDS A;  3ZNG C;  4M8M A;  5AEK B;  1LGR A;  3AEA B;  3APD A;  1T6B X;  1XLQ A;  3OG5 A;  2YLM A;  2LUE A;  1CZP A;  4L2Y A;  1OQR A;  4LCD E;  3P63 A;  1PGB A;  1WYW B;  1V1P A;  1C4C A;  1YJJ A;  4TMA B;  2MBQ A;  4EZL A;  2CU3 A;  3IXS A;  2J0K A;  2NBW B;  1ACC A;  3V6E B;  4G50 A;  3BK2 A;  1IP9 A;  1M94 A;  1WRD B;  1NEN B;  2JVC A;  4A90 A;  1PFD A;  3AEB B;  1V9J A;  2INC C;  2MX2 A;  5IAA C;  4WQM A;  3M62 B;  2CU1 A;  3SHQ A;  2WXH A;  2JXX A;  4E3C A;  1PYW D;  4HCN B;  5BYQ A;  2I38 A;  2LRW A;  1MHX A;  1FNU A;  2PTL A;  3P1M A;  2RSU A;  3FAH A;  3AE8 B;  1C78 A;  3IAM 1;  2Z8L A;  4IC7 B;  4W9I A;  2KXJ A;  3K9O B;  1XLN A;  1TBE A;  3L10 B;  2MWS B;  2ACZ B;  4PYZ A;  2KD0 A;  4XDC A;  1YQ3 B;  3N20 C;  3WAN A;  1E8Z A;  2D3A A;  3N32 A;  2NR2 A;  3L0W B;  4OZA A;  2IGH A;  4XWW A;  2ZZP B;  3AMZ A;  2KQ4 X;  3AXC A;  1S3S G;  4LK0 M;  1XLP A;  1E8Y A;  1VZ6 A;  5CX3 A;  4REZ A;  4ZRQ A;  1NEK B;  2KYW A;  1P7E A;  2LEK A;  1RYJ A;  1I4G A;  1KFY B;  3CIR B;  4JGH B;  1FXI A;  2WX0 A;  5BO4 B;  2ASQ A;  4GOC A;  4WWN A;  2H89 B;  2PW9 A;  4CYE A;  1SXT A;  3PT2 B;  4FHK A;  4WAA A;  2DZM A;  2WXQ A;  1YX5 B;  3U2S C;  1OEY J;  2VZK B;  1SIJ A;  1ZDV A;  1UD7 A;  1FCC C;  3SEB A;  3WAP A;  1UUP A;  2L83 A;  4L1B A;  3U8Z A;  1WWT A;  3SFD B;  1P98 A;  1VJK A;  2N1V A;  1I4R A;  1L0V B;  3EHV A;  3VXW A;  1DYQ A;  3VTV A;  1TKY A;  5G5G A;  4C7Y A;  4XDD A;  2KDM A;  1XQQ A;  3ZGZ A;  4KKJ A;  1C4P A;  1NYQ A;  4A20 A;  5G2N A;  3PRM B;  4TQ1 A;  4TV3 A;  3EUB 2;  3VH4 B;  3ZRC A;  5E6N A;  3A9K A;  2KOX A;  5AZG A;  3ZJU A;  1FRR A;  3SFE B;  4FXC A;  1E8W A;  4ZHP A;  1MVK A;  1JWU D;  2MH7 A;  1VR9 A;  2HTH A;  2V3S A;  2PVO D;  2AWT A;  3UF8 A;  3I9V 1;  3ZVV A;  1E90 A;  3L13 A;  3MJW A;  4IWP A;  1FXA A;  1N6Z A;  1MG8 A;  1IYF A;  1K53 A;  2J0J A;  4ARI A;  2BB6 A;  2KT7 A;  3A9K B;  4WWO A;  2FE8 A;  3AE5 B;  1RFA A;  3MJ5 A;  3NZU A;  4ICV A;  4NJC A;  4I6N B;  3B08 A;  1V80 A;  4KV2 A;  3B0A A;  2LJI A;  1WGD A;  4BKS A;  2EKI A;  3VAW A;  2N9L A;  1ET9 A;  2DEN B;  2KDB A;  2XNA C;  5LNK 1;  3U52 E;  4A9A A;  2M56 B;  3Q3O C;  2MEK A;  1ZDX A;  1L6V A;  3ZYY X;  1V8C A;  2SAK A;  1F77 A;  3DHI C;  1V49 A;  1SE4 A;  3NRZ A;  2WXP A;  2JU6 X;  4II3 B;  2K9X A;  4KSL C;  4FAD A;  1EUV B;  2UYZ B;  1G6J A;  3URY A;  2HJ8 A;  1D5Z C;  1SE9 A;  4XZ4 A;  4HEA 1;  2VH1 A;  1PQS A;  4WJP A;  3ZXV A;  4W9L A;  2G1E A;  3WAM A;  1WGY A;  2AQ2 B;  1TS3 A;  4GDL B;  1RFK A;  4ZDV A;  1IGD A;  2NBV B;  4GB9 A;  4AOF A;  1BXT A;  3UIO B;  3NUH B;  4AS1 A;  2BWE S;  4PS3 A;  1L5P A;  1UGM A;  1XEE A;  2JZ3 B;  4PT5 A;  4HK2 A;  1EF5 A;  4YL8 A;  2W9N A;  4IM2 A;  1FM0 D;  3BK1 A;  1TTN A;  1C4A A;  3RYT A;  3H7P A;  1XF5 L;  1QZE A;  3C19 A;  2FCQ A;  1E5W A;  3ZQ4 A;  3DDC B;  1GUA B;  1WF9 A;  3WIM A;  5IO9 A;  1ENF A;  4FJY A;  1UH6 A;  3QCA A;  2BW2 A;  2MBH A;  4DDG D;  2R2O A;  2BB5 A;  2RPV A;  4RM8 A;  4K7W A;  3TL5 A;  2LJ5 A;  4FLH A;  1CK1 A;  1ET6 A;  1WXA A;  1HZ6 A;  3WCQ A;  2NTT A;  3U4E G;  2KWV B;  4CHK A;  1MPE A;  3H7P B;  2JT4 B;  1UBI A;  3KUC B;  4MH8 A;  1WXS A;  2QMT A;  2D07 B;  3L4P A;  4YTN B;  3KYC D;  3PRP B;  1BT0 A;  2DYB A;  2XK5 B;  3N3K B;  2I1K A;  3L08 A;  4ZRK A;  4XC2 A;  1QLB B;  4AP4 C;  2WXM A;  3VUY A;  1GC7 A;  1PDX A;  1EU4 A;  3KVF B;  3NVZ A;  4KDL B;  4WQO B;  5L83 A;  3V05 A;  2L8J A;  2WU2 B;  3BII D;  2GBR A;  1GOZ A;  1UZX B;  3PZD A;  2N9E B;  4ICU A;  5CTR C;  3RT3 B;  1KJT A;  2KN5 A;  2MBO A;  1WGK A;  2C7H A;  3Q69 A;  4MGY E;  4HXD A;  4ZRI A;  4P1B C;  2CKH B;  3GE3 C;  3ZW3 A;  4K3C A;  4NZL B;  2PEA A;  1XLO A;  3A1Q A;  3E56 A;  2B3A A;  5G5H A;  1TS2 A;  2IO1 B;  1S1Q B;  1H4R A;  1WM3 A;  3WA0 A;  1J7A A;  3OJ4 B;  3TEW A;  2C9W B;  2R2Q A;  3GZN I;  1F2R C;  3SDL C;  1XCT L;  1WFY A;  2K0P A;  5BYS A;  1VZ8 A;  4OW0 A;  3ZNZ B;  4ANV A;  2ONQ A;  3UQA A;  4BOZ B;  4YT0 B;  1T0R C;  1JCK B;  2WXJ A;  1HTO A;  1FD6 A;  2AL6 A;  4MJS A;  2MSE D;  3A4S C;  2K6Q A;  4D2K A;  1YQB A;  1KM7 A;  1QOB A;  3DBR I;  2LMC A;  2WDR B;  2NVU I;  4K3B A;  1WZ3 A;  4KVG B;  1J0G A;  4OVV A;  4EZJ A;  2VH2 A;  3PV1 A;  2WXF A;  1F1H A;  4ZYS A;  4HRO A;  3KWV A;  1HEZ E;  4M0W A;  4WUR A;  3PHX B;  2WDV B;  2DX5 B;  1CJE A;  1Z5S B;  3QAQ A;  2RDB C;  3DBL I;  2GRI A;  2N9X A;  2GOW A;  3NJT A;  2AEH A;  2W3R A;  3ZJT A;  3AI5 A;  2EMT A;  5GXG B;  1MG4 A;  1RWS A;  1SE3 A;  2KMA A;  3N1Z C;  1YN4 A;  3AE3 B;  3QAR A;  3RZF A;  2PLP A;  1WXV A;  3DBH I;  2D3C A;  2M8S A;  4MT5 A;  1WMH A;  3HK0 A;  1MHH E;  3HRD D;  3V60 A;  3ECI A;  1TT5 B;  3IT6 B;  3HM3 A;  3DVG X;  1WY8 A;  2IZV B;  1SEB D;  3ZXR A;  4ZRJ A;  3O65 B;  5AUI A;  1XXG A;  2M19 A;  5JHA A;  1V97 A;  1C1Y B;  3VR9 B;  2Y5P A;  2KWC A;  2G4D B;  5EE0 A;  2MP2 A;  3TUO A;  1KF6 B;  1FFV A;  1DGJ A;  2LD9 A;  1WIA A;  3PVL A;  5EE9 A;  3QWZ B;  4DBG A;  2KC1 A;  4LNN A;  4KX6 B;  3GE8 C;  1E10 A;  2KNB A;  3AUL A;  4M00 A;  2IO3 B;  3QA8 A;  1WMH B;  1STE A;  5H8Y E;  2LGD A;  2KO3 A;  1DOX A;  2O6V D;  3W1Y A;  1JW9 D;  1QQR A;  1T5X D;  3QC8 B;  3MTN B;  4FJZ A;  3FIL A;  4XE0 A;  4C4V A;  3Q8C A;  4IOI E;  2CHZ A;  5DPT A;  1DOY A;  3HVZ A;  1KOT A;  2EMS A;  2KLG A;  2WXG A;  2LI5 A;  4LJO B;  1P1A A;  2QC8 A;  1I4Q A;  5AZF A;  4I6L B;  3Q14 C;  1D4B A;  2LGY A;  3PPA A;  1TZO A;  4LNK A;  1B9R A;  3ZTD A;  1F52 A;  4W9E A;  2D2Q A;  5JH5 C;  2NTS A;  3FIL B;  2FIF A;  3A4R A;  2UU7 A;  3TEZ A;  2M0X A;  3L54 A;  3SD5 A;  2JWZ A;  4KSK C;  4B0M A;  4XWT A;  2REX A;  4YXD B;  1OFF A;  1DOI A;  1TKE A;  3ALB A;  1XD3 B;  4H2A A;  5IKC M;  4KIK A;  2WXI A;  3A33 B;  2ON8 A;  1ZW7 A;  2V1Y A;  1WGG A;  3PLU A;  4QAY A;  3ZNI D;  3JW0 X;  3DPD A;  4JIO U;  3AV8 A;  1U4A A;  2RGF A;  3GB1 A;  2L00 B;  4P7I A;  1Q10 A;  2IJ0 A;  4NAW B;  4P6V F;  3ZO5 B;  2L05 A;  2FCM A;  4US9 A;  1I35 A;  2KTR A;  3OAW A;  4UDU C;  5LLI A;  2NCN A;  3KH0 A;  3SR6 A;  3U30 A;  3GZN B;  2RDH A;  3B2G A;  4NNJ B;  3ZNH B;  4KIK B;  5C3J B;  2KAJ A;  1YN5 A;  5JXV A;  2NMQ A;  5HFY A;  2BYV E;  4KGR A;  4HKZ E;  2J53 A;  3WAO A;  2L52 A;  5CHW A;  1SIF A;  2V9H A;  1E0Z A;  1B1Z A;  3ENE A;  3ETR A;  2GB1 A;  3AB5 A;  4PK1 A;  3Q8A A;  4DXG A;  1WZ0 A;  4LLG M;  3AE9 B;  2DZI A;  2KDF B;  2CJN A;  1UEL A;  3DBR B;  1N63 A;  2KTR B;  1IPG A;  1JWM D;  3S2A A;  3BYY B;  2LGI A;  1SBB B;  2BF8 B;  2K1F A;  1Y8R C;  5GMV A;  2M0A A;  5FR6 A;  2N0S B;  2LXA A;  2OJR A;  4MSM B;  4JWU C;  1VD2 A;  2DYM A;  4HRS A;  3RNF C;  3I3T B;  2KJH B;  4RGT A;  3C0R B;  1VDV A;  4LNF A;  3B2F A;  1K50 A;  3DBL B;  3LXF A;  1ZOY B;  2WXO A;  2BKR B;  1NDD A;  4W9G A;  1TY2 A;  1LM8 B;  2NBU A;  5JZE B;  1YN3 A;  3PSE B;  3DBH B;  3AEG B;  3NS1 A;  5EE1 A;  4ANW A;  3X0W A;  5BMI A;  1N61 A;  1ZP0 B;  2G3Q B;  4W9H A;  2KAC A;  2OHF A;  1HXY D;  4IKG A;  4LJP B;  1TZ1 A;  3VQI A;  2KDI A;  4URK A;  4WAF A;  2LHD A;  2KWD A;  1QOG A;  1V2Y A;  1KTK A;  4KZ0 A;  4MGZ E;  4NJ6 A;  2FID A;  3ZRF A;  3IHP C;  1JWS D;  2WXR A;  3AEC B;  2G9H D;  1WJ4 A;  2HE7 A;  3C8Y A;  2AQ1 B;  2LAS A;  3W2D A;  1JRO A;  4DWF A;  4BAX A;  3QX1 A;  2KJR A;  2RMM A;  4B95 A;  2IBI B;  4F8C B;  1I42 A;  3H7S A;  2ICI A;  1ZXH A;  1E6E B;  4GLS C;  4MGK E;  2IGG A;  4O1N A;  4RF0 A;  3L16 A;  2V3P A;  2WYQ A;  1AAR A;  4AJY B;  4YTM B;  4FN2 A;  1J7C A;  1N60 A;  1RM6 C;  2JRI B;  3RNG C;  2C60 A;  4HCP B;  5CHF A;  1C3T A;  2L1A A;  2IYD B;  2ZEQ A;  4RGO S;  1RAX A;  4YWG G;  2ZCC A;  2PKO A;  4MM3 A;  2V4I B;  4GSW A;  3SU8 X;  1WM2 A;  1WXQ A;  1HZ5 A;  1YIW A;  4OZB A;  2VRR B;  2KVR A;  3R2T A;  4DXF A;  2OED A;  4XYC A;  4G3X B;  1E8X A;  2BYT A;  1E9M A;  4C7Z A;  2G45 B;  1T3Q A;  2E3T A;  2L0T A;  4GDL A;  2QJL A;  4HDQ A;  4ZRP A;  1GPX A;  1UGJ A;  4FA6 A;  2C7M B;  4JE3 B;  1J8C A;  3CST A;  3M95 A;  4II2 B;  5D3I B;  3W9C B;  4ZHO A;  1YD8 U;  2OOB B;  1M4V A;  4MM3 B;  2DLB A;  3NVV A;  5JHB A;  1HA5 A;  1HTQ A;  1FIQ A;  2BYE A;  2JX5 A;  1UWM A;  3EC8 A;  4ACF A;  1JQ4 A;  3N9Y C;  1V81 A;  4AWJ A;  3DHH C;  1QOA A;  3UQB A;  3RCZ A;  1XO3 A;  5DPR A;  1XCQ L;  2WX1 A;  3T3O A;  2DAF A;  2X38 A;  1MFW A;  2KK8 A;  1ZGU B;  2YVC A;  3PGE A;  2LVO A;  3B1L X;  2W54 A;  4NQL B;  5EE3 A;  1E7U A;  4G11 A;  1V6E A;  1IGC A;  2LUM A;  3GS2 A;  1SB3 C;  5IP4 D;  2M17 A;  1J19 A;  1GG3 A;  1ZXI A;  3RZW C;  2XK5 A;  1WR1 A;  1R7S A;  2J52 A;  1EU3 A;  4JLC A;  2KJ6 A;  1HE8 A;  2J0M A;  1JRU A;  4LNO A;  4C80 A;  2MA9 B;  3QHT A;  5DPS A;  3GP7 A;  3UI3 A;  4BBN F;  1F9J A;  2UWQ A;  1KRH A;  3R2I A;  4MEL A;  2N9K A;  2N1W A;  4WH4 A;  2N7J A;  3ONS A;  1V5O A;  1TJE A;  2LRU A;  4W9F A;  3LYY A;  2YEP B;  4IUM B;  2PE6 B;  3OWE B;  4W9D A;  2VZK D;  2FCN A;  5DCN A;  4BVU C;  2Y5B B;  4HDO A;  3HHM A;  3QIJ A;  1AW7 A;  2KHW B;  1SF0 A;  2O6V B;  1L0X B;  2JF5 A;  2AX5 A;  4M01 A;  3W5U B; 
#chains in the Genus database with same CATH homology
 4YTP B;  3MHZ A;  1IUE A;  1QIL A;  1PYW D;  1SEB D;  1C76 A;  5BYQ A;  2W55 A;  5AUI A;  2I38 A;  2WQY B;  1XXG A;  1MHX A;  2M19 A;  1V97 A;  1FNU A;  1EWY C;  2PTL A;  3P1M A;  3VR9 B;  4N59 A;  3FAH A;  4R3D A;  4JWS C;  2Y5P A;  4JX1 C;  3AE8 B;  3AE6 B;  1C78 A;  3IAM 1;  2Z8L A;  5EE0 A;  3BVG A;  3TUO A;  1KF6 B;  1FFV A;  1XLN A;  5BYR A;  1DGJ A;  2BS2 B;  4B0E A;  1SJE D;  5EE9 A;  2ACZ B;  4XDC A;  1ROE A;  2J4X A;  4KX6 B;  1YQ3 B;  3PO0 A;  3CWI A;  4C56 C;  1E10 A;  2ZW0 A;  4OZA A;  1FO4 A;  3NVY A;  1STE A;  2IGH A;  5H8Y E;  4XWW A;  3AMZ A;  3AE4 B;  1DOX A;  1JW9 D;  3R8B A;  1QQR A;  2KQ4 X;  1T5X D;  1TS5 A;  4LK0 M;  3FIL A;  3ABV B;  1PUT A;  2I2Y A;  4XE0 A;  1JWB D;  1XLP A;  4RFB A;  1VZ6 A;  3Q8C A;  4REZ A;  4IOI E;  1FCL A;  4ZRQ A;  1NEK B;  2JYE A;  1P7E A;  2XN9 C;  1DOY A;  2LEK A;  1RYJ A;  3Q8B A;  2Y5C A;  1I4G A;  1KFY B;  3HVZ A;  4GDK B;  3CIR B;  1QKZ A;  1L4Z B;  2WXG A;  1UNS A;  2DWQ A;  1FXI A;  4YSX B;  1SE2 A;  4OVZ A;  5D7G A;  3BZD B;  2K3U A;  2H89 B;  2PW9 A;  1C79 A;  3RPF C;  1I4Q A;  5BMG A;  1JAL A;  1I7H A;  3KLS X;  4JPS A;  1L4D B;  1FFU A;  1SXT A;  3Q8F A;  1D4B A;  2WXQ A;  2WXN A;  4MAC A;  5HG2 A;  3U2S C;  3U7Z A;  1TZO A;  2K5P A;  1B9R A;  2VZK B;  1AWD A;  1P7F A;  3MP9 A;  2NTS A;  1SIJ A;  1ZDV A;  1FCC C;  3FIL B;  3SEB A;  2V3N A;  3TEZ A;  2AQ3 B;  4B0M A;  4XWT A;  1UUP A;  2L83 A;  4L1B A;  4YXD B;  1WWT A;  3SFD B;  1OFF A;  1DOI A;  1TKE A;  2WDQ B;  3PZ7 A;  1VJK A;  2PVG C;  1I4R A;  1PGA A;  2Q5W D;  1L0V B;  3P4S B;  4H2A A;  1DYQ A;  1K51 A;  1TKY A;  2EEL A;  2CJO A;  2MJE A;  2QEJ C;  2KN4 A;  5G5G A;  2PMV A;  4C7Y A;  4XDD A;  2KDM A;  2YEP F;  2INN E;  2WXI A;  1NYR A;  5BMH A;  2ON8 A;  3ZGZ A;  1C77 A;  4KKJ A;  1C4P A;  1NYQ A;  2WU5 B;  1N5W A;  2ZW1 A;  5I4D A;  4TQ1 A;  3BVM A;  2WLB A;  3E9S A;  3EUB 2;  4J3O D;  1HQR D;  3VRB B;  1NI3 A;  2PIA A;  1GB1 A;  3AV8 A;  4HJG E;  3ZJU A;  1FRR A;  1JML A;  3GB1 A;  3FC4 A;  2D5G A;  1Q10 A;  3P4P B;  2IJ0 A;  3AED B;  4NAW B;  2E6X A;  4P6V F;  3SFE B;  2BT6 A;  4FXC A;  1EWC A;  2JXT A;  2LHE A;  4ZHP A;  1MVK A;  4US9 A;  1JWU D;  2MH7 A;  1VR9 A;  1VLB A;  1KLU D;  4UDU C;  5D3D A;  3SR6 A;  1OQQ A;  2BS4 B;  2PVO D;  2RDH A;  3B2G A;  3I9V 1;  5C3J B;  2KAJ A;  1YN5 A;  5JXV A;  2NMQ A;  5HFY A;  2WP9 B;  4KGR A;  4HKZ E;  2J53 A;  3J9C A;  2L52 A;  4KGT A;  1FXA A;  1E0Z A;  1B1Z A;  3NZ3 A;  1K53 A;  1TY0 A;  1KH0 A;  3AH7 A;  4A55 A;  3ETR A;  4ARI A;  2GB1 A;  2BB6 A;  3AB5 A;  3KQ4 A;  4N58 A;  3Q8A A;  4DXG A;  4USA A;  2FE8 A;  4WIP A;  4LLG M;  1TYG B;  3AE5 B;  4RGM A;  2IDY A;  1FNW A;  3AE9 B;  3P4R B;  5AUK A;  2CJN A;  3MJ5 A;  4NJC A;  3HVD A;  2MJD A;  2WNM A;  1BML C;  2LJI A;  1N63 A;  1JWM D;  2QIL A;  2JWU A;  2HTM E;  3BYY B;  2EKI A;  2LGI A;  1SBB B;  1LO5 D;  2N9L A;  3AE2 B;  2M0A A;  2N0S B;  1ET9 A;  2XNA C;  1I4P A;  5LNK 1;  3U52 E;  4A9A A;  1QF6 A;  4JWU C;  3PZ8 A;  3MFG A;  2M56 B;  3DWG C;  2MEK A;  2DYM A;  1FMA D;  1ZDX A;  1L6V A;  3ZYY X;  3VRA B;  4HRS A;  1V8C A;  2SAK A;  4ITK A;  1F77 A;  4RGT A;  1VDV A;  1C9F A;  1SE4 A;  2LFI A;  3NRZ A;  3B2F A;  1K50 A;  4HKQ A;  3IAS 1;  1IBX A;  3IT6 B;  3LXF A;  2WXP A;  1ZOY B;  2JU6 X;  2WXO A;  4RNA A;  3VR8 B;  2K9X A;  2FBW B;  3AEF B;  1TY2 A;  2JZP A;  3AE7 B;  3O13 A;  4OZC A;  3EA6 A;  2WXL A;  3URY A;  1YN3 A;  1D5Z C;  4HEA 1;  1ESF A;  2RDG A;  1K52 A;  4IDI A;  2G1E A;  3AEG B;  2BBC A;  3NS1 A;  2AQ2 B;  3P42 A;  1TS3 A;  1J7B A;  4GDL B;  5EE1 A;  1EM7 A;  1RFK A;  1IGD A;  4NAM A;  2SEB D;  3IT4 B;  1BXT A;  2GI9 A;  3NUH B;  4AS1 A;  1QT9 A;  5BMI A;  1N61 A;  1VZ7 A;  1ZP0 B;  1L5P A;  1E7P B;  1XEE A;  2KAC A;  2OHF A;  2WS3 B;  4PT5 A;  4N6E B;  1YJI A;  1HXY D;  3EGR A;  3TEY A;  1FM0 D;  4IKG A;  3BK1 A;  3MC0 B;  3VQI A;  2KMM A;  1C4A A;  5H92 C;  1IBX B;  4WAF A;  2LHD A;  4KGS A;  1PGX A;  1XF5 L;  4LTU A;  4RH6 A;  2KWD A;  1QOG A;  5FKA C;  1KTK A;  3BWU D;  3ZQ4 A;  1JRP A;  1ENF A;  1JWS D;  2WXR A;  3AE1 B;  5HHD G;  2HDE A;  3AEC B;  2BW2 A;  2G9H D;  1BUI C;  3C8Y A;  2AQ1 B;  3W2D A;  1JRO A;  1FRD A;  1N62 A;  3H8H A;  1AYF A;  3HUI A;  2RMM A;  1WRI A;  2BB5 A;  5HI1 A;  1CQV A;  2RPV A;  2ICI A;  2QSD A;  1ZXH A;  1E6E B;  4GLS C;  1MI0 A;  2IGG A;  4P16 A;  4O1N A;  4RF0 A;  1AN8 A;  3KWL A;  2V3P A;  1CK1 A;  3AN1 A;  5FR3 A;  1ET6 A;  4YTM B;  2L32 A;  1J7C A;  1N60 A;  1YMH E;  1ZUD 2;  1HZ6 A;  2Y3A A;  2WXK A;  1RM6 C;  2BTE A;  3WCQ A;  2NTT A;  1YNT E;  3U4E G;  1FNV A;  1TS4 A;  1MPE A;  4MH8 A;  4AQ7 A;  1GB4 A;  3L4P A;  2QMT A;  2L1A A;  3BYT B;  3W5V B;  4YTN B;  4ARC A;  5FK9 C;  4RCO A;  4RGO S;  4YWG G;  5C2T B;  1NVI D;  2PKO A;  4RGN A;  5TSS A;  4L23 A;  2V4I B;  1QLB B;  1WXQ A;  2WXM A;  1HZ5 A;  4Q2J A;  1F2R I;  1PDX A;  1EU4 A;  4OZB A;  4TSS A;  3NVZ A;  1V1P B;  2DYO A;  1JWA D;  3R2T A;  4DXF A;  2OED A;  2IPK D;  1ZE3 D;  3V05 A;  1A70 A;  2WU2 B;  2FUG 1;  3BII D;  3B9J A;  2DBY A;  2BYT A;  1E9M A;  4C7Z A;  3T3N A;  1T3Q A;  2E3T A;  2V0G A;  1GOZ A;  2QJL A;  1WYG A;  2MJ3 A;  4ZRP A;  1GPX A;  1Y56 A;  1L6U A;  1UGJ A;  4JE3 B;  4WWM A;  1WGK A;  1I4H A;  3Q69 A;  4KKI A;  2IGD A;  5T8I A;  4DQO C;  1N5X A;  5D3I B;  2R61 A;  4NZL B;  4OHJ A;  3W9C B;  4ZHO A;  3V3X A;  1XLO A;  1M4V A;  3E56 A;  4MM3 B;  2DLB A;  2QIE B;  3NVV A;  4YSZ B;  5G5H A;  1HA5 A;  1TS2 A;  2INP E;  1FIQ A;  2JX5 A;  5E6J A;  1UWM A;  1J7A A;  3TEW A;  3DWM A;  4RF1 A;  1JQ4 A;  1FEH A;  3N9Y C;  1F2R C;  1QOA A;  1XCT L;  1V1O A;  2JQR B;  5BYS A;  2K0P A;  3RFZ B;  1D6E C;  1XO3 A;  1VZ8 A;  4OW0 A;  1XCQ L;  2ONQ A;  1UWX A;  4YSY B;  3T3O A;  2X38 A;  4YT0 B;  1D5X C;  3AEE B;  1JCK B;  2WXJ A;  2H88 B;  2W54 A;  5EE3 A;  1FD6 A;  2JYT A;  1ZPS A;  3BVZ A;  1IGC A;  2LUM A;  4US8 A;  3GS2 A;  2BS3 B;  1VRA B;  1SB3 C;  2B76 B;  4D2K A;  3LB8 C;  3P4Q B;  3NVW A;  2K22 A;  2W82 A;  1QOB A;  1YQ4 B;  4CQN A;  1L0Y B;  2LMC A;  1ZXI A;  2WDR B;  3ZJV A;  1F0Z A;  1TKG A;  3AM9 A;  2JSV X;  2TSS A;  2J42 A;  4TQ0 A;  1R7S A;  2J52 A;  2WXF A;  1EU3 A;  1I4X A;  4ZYS A;  3AEA B;  4HRO A;  1GAQ B;  4C80 A;  1SJH D;  2W3S A;  1T6B X;  1XLQ A;  3Q8E A;  3KWV A;  1HEZ E;  3GP7 A;  4M0W A;  4WUR A;  3TSS A;  3UI3 A;  2WDV B;  1CZP A;  1CJE A;  1KLG D;  4L2Y A;  1OQR A;  1KRH A;  3TEX A;  3P63 A;  1PGB A;  1V1P A;  1C4C A;  1YJJ A;  3R2I A;  4A8X C;  3W1S A;  5MPO A;  1D5M C;  2N9K A;  1QOF A;  4WH4 A;  2GRI A;  2N7J A;  1TJE A;  2W3R A;  4TMA B;  4A6Q A;  2CU3 A;  3ZJT A;  3LYY A;  1SSN A;  2YEP B;  3IXS A;  5GXG B;  1WSP A;  3OWE B;  4ZOH C;  1RWS A;  1SE3 A;  1ACC A;  2VZK D;  1YN4 A;  3AE3 B;  3BK2 A;  2PLP A;  4MT5 A;  4EE2 A;  1NEN B;  4A90 A;  1AW7 A;  1MHH E;  3HRD D;  1PFD A;  3AEB B;  1SF0 A;  1L0X B;  4WQM A;  3I57 A;  2AX5 A;  3W5U B;  2WXH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...