3LYYA

Crystal structure of the mucbp domain of the adhesion protein pepe_0118 from pediococcus pentosaceus. northeast structural genomics consortium target id ptr41a
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
102
structure length
102
Chain Sequence
THATSTETIHYVNEDGDQVFEDGGGKLDFTRTVTIDDVTNEVVEYGEWTPVTDDEFAAVTSPDKDGYTPDTSEVAAQKPDMTDGPDGTVKDVEVTVTYTANP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adhesion exoprotein
publication title Crystal structure of the MucBP domain of the adhesion protein PEPE_0118 from Pediococcus pentosaceus. Northeast Structural Genomics Consortium target id PtR41A
rcsb
source organism Pediococcus pentosaceus
molecule tags Cell adhesion
total genus 17
structure length 102
sequence length 102
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17966 Mub_B2 Mub B2-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.460 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3lyyA00
3Q69A 3NZ3A 3I57A 3LYYA 4MT5A 2LFIA
chains in the Genus database with same CATH superfamily
2LVPA 1MFWA 2WXFA 2NMQA 2EMTA 1FNUA 1R7SA 3Q6BA 3LYYA 1VZ6A 4KIKB 4BKGA 2JZPA 4K81A 5HFYA 2DX5B 2MA9B 1GUAB 4Q2JA 4FLHA 1T6BX 3AE7B 5KHQA 3W1YA 3ZJTA 2KWDA 3ZDTA 1WMHA 3ETRA 3QX1A 1QF6A 4ITKA 1RRBA 2ZCCA 3Q3FA 2EMSA 2G45B 1WE6A 4N59A 1TIFA 3TEXA 2MRPA 2BWFA 4KVGB 2M56B 3CF6E 2OHFA 3PPAA 3R3MA 1UNSA 2JYEA 1V6EA 2ZJDA 3PVLA 4IC7B 3ABVB 3VUWA 2BPSA 1N62A 3AMZA 2W54A 2BYTA 2L83A 1JWUD 2WLBA 3HVDA 3ZGZA 2D5GA 1NI3A 2KJRA 1WH3A 2YVCA 3EUB2 3K9PB 2N9LA 1SF0A 4WAFA 2N9XA 2D11A 1XQQA 3AE6B 2KJHB 2ZNVB 1D3ZA 4XC2A 4AP4C 4B0MA 2KO3A 1ZW7A 3FILB 1RWSA 2VH2A 1ZE3D 3P1MA 4N58A 4MEMA 2ONQA 3VRAB 4C80A 2JRHA 3K9OB 4W9DA 2KTFA 2KDFB 3GZNI 5E6PA 3WIMA 3T8MA 2MW5A 4YSZB 4ANUA 5BYQA 1CK1A 1RFKA 4MJSB 2WXNA 4IWOA 3CSTA 4S17A 4HCNB 4FA6A 4XDCA 4NJCA 2EKIA 3NS8A 3KUDB 1YNTE 1PQSA 3BVMA 2JVCA 1RLFA 3Q2AC 4H2AA 1N60A 4WJOA 2LHEA 2QCZA 2INPE 1PGXA 4RNAA 2BYEA 3QIJA 4HWIB 2IBIB 4G3XB 5BYRA 3X23A 4YTNB 1OEYA 3E56A 1HTOA 2DZIA 3H8HA 1K51A 3W1SC 1XLQA 4MGYE 2IO0B 2E6XA 3AN1A 4HPLB 2KAJA 4P1BC 5D94A 2AQ1B 4KSLC 5GXGB 3AEGB 3VVWB 4BKTA 2KN5A 1YN5A 4RGMA 1J7CA 4RM8A 2SAKA 5G5HA 3A1QB 5TR5A 3AE4B 2K1FA 3RNEC 2KX0A 2B3AA 3V05A 2IO1B 2ZNVC 1AN8A 3IHPC 1WGKA 2KHWB 3URYA 4RF1A 4C56C 5BMGA 1A5RA 4JL9A 2Y5BB 4HDQA 1AYFA 2NBUA 2QMTA 4C4VA 3EECA 3C8YA 3U7ZA 2K9XA 5AZGA 1V81A 1Q5WB 4MM3A 4YTMB 2LASA 5CTRC 2J0MA 1WMHB 1KF6B 1UD7A 4KGTA 2DAFA 4ARIA 1FNVA 4KGRA 4ANVA 4DHJB 3HM3A 4BKSA 1R4MB 4RM9A 1TJEA 4B6WA 1LQBA 1IBXA 4HLEA 1WX8A 2K25A 2LRWA 1HEZE 5EDSA 2ZCBA 1P3QU 2Z0EB 3VR8B 2K5PA 3M95A 1J8CA 3RI7C 4UDUC 2M4NA 5EE3A 4IDIA 3AXCA 1TS2A 2J7QB 3DPDA 4OVUA 4C00A 4DHJD 3QA8A 4ACFA 2FCNA 1WFYA 2MJEA 2RPVA 1F52A 4BAXA 4XYCA 4XZ4A 3AE8B 4FJVB 2KXJA 2L7RA 3AU4A 3KWLA 5HKHA 2WXLA 4B9KA 1K53A 1BXTA 2GB1A 3VDZA 4B95A 3GS2A 1KOTA 1QQRA 3UGBB 2FUG1 3BYYB 2BB5A 3V3XA 1VZ8A 2HJ8A 4JWSC 2PPHA 4JLCA 5AEKB 1TKYA 1EUVB 2D3CA 2MQJA 1IGDA 3HM6X 1KLVA 3ZJUA 2ZVNA 1DGJA 3KH0A 2LZ6A 1HXYD 3DBLI 4TQ0A 1UBIA 1WSPA 1M94A 4HCPB 2FCSA 2G1EA 1F77A 4GMVA 2FAZA 1FRRA 1UGJA 1WY8A 3CWIA 5IO9A 3ZYYX 3H9DA 1L4DB 4IG7B 2NPTA 1I4XA 2MH7A 3NVWA 1RAXA 1LFDA 2V3PA 3RMKC 2N1VA 1RM6C 1XEEA 1KLUD 4HPMB 3W5UB 2G4DB 1JROA 2EKEC 4P7IA 2WDTB 2LGDA 2LJIA 3AEEB 4ANXA 4RH6A 2D3GA 4WWPA 3TJPA 3PSEB 1CJEA 4BZAA 1C1YB 3DDCB 4DXFA 4LCDE 4NY0A 1EWCA 2RD0A 3NVVA 4JIOU 3KW5B 1E7PB 2GMIC 1L6UA 1I42A 1RFAA 2N9PC 3V62A 4W9KA 3DBSA 2LHDA 4DDGD 1WJ6A 4C4VB 4JGHB 3WAOA 1FMAD 4WURA 4FXCA 2FIFA 3AV8A 2DZMA 4MM3B 1JRPA 1KH0A 2L1AA 5AZFA 3RNGC 1Y56A 1I4PA 4AJWA 3KUCB 4JX1C 5C1ZA 1XLPA 2INNE 4HPPA 1T0RC 4DHZB 4A9AA 2J53A 4RGNA 1UELA 3V61A 1JWSD 2GRIA 1IBXB 5IAAC 3KUZA 2XNAC 3L13A 1TGZB 3TMPB 2FBWB 2JRIB 2RDBC 4ARCA 4M01A 3ALBA 1R4NI 1UZXB 3NZ3A 2MJDA 4KDLB 1YX5B 2AX5A 1ZDXA 1V80A 4MSQB 4PS3A 2AEHA 3SHQA 2BKFA 3JW0X 2J0JA 2LGXA 3TBLD 5CHWA 2MBHA 4PYZA 4NNJB 1J7AA 3N20C 2LFIA 4S0RA 3B2FA 3JVZX 3BK2A 4XWWA 1P1AA 2ZZPB 1WZ0A 4PS8A 4GGQA 2OOBB 2REXA 4BBNF 2N7JA 1D4BA 2BVCA 2HJ1A 2JQRB 1GOZA 3BVGA 3WANA 1LGRA 2L0TA 1E5WA 1QLBB 4HVBA 3U8ZA 2K8BA 4W9FA 3VXWA 3VTUA 3NZUA 1SJED 1L0YB 3P4PB 2KMCA 2BS2B 2WXQA 2QDFA 1HZ6A 3NHEB 2FUHB 5FK9C 4EKUA 4ZYNA 1WM2A 4YSXB 2WXOA 2RDGA 2DENB 4GDKA 3Q14C 2KACA 4R3DA 2K8HA 4EUTA 2LUMA 2YLMA 3AB5A 1V86A 1WWTA 1V1PA 1D6EC 5L95C 3PREA 2NPTB 3KYDD 2GBKA 1GNUA 4ZOHC 1TBEA 2FNJB 3NY5A 3OJ3A 1KLGD 4MSMB 3N1ZC 1MHXA 4P6VF 2G4SA 2TSSA 3H7PA 4CHKA 3AE2B 5G55A 5G5GA 3L4PA 4LNIA 4WJQA 2HD5B 2NS5A 4CQNA 1S3SG 3H6NA 1QOAA 2K0PA 2C7NB 2IPKD 1T0QC 3Q8EA 5CHFA 3ZO5B 1WRDB 2JYTA 4F1SA 4FADA 3GP7A 5LLIA 3DBRI 2QILA 3NRZA 2ZW1A 2WGSA 2DHZA 2LEKA 4K7WA 3P4SB 4WWNA 1XXGA 4RGOS 4US9A 1TY2A 1WM3A 3AEDB 1I4RA 2WXKA 4I6NB 2WXJA 2Y5PA 2RR9A 2NVUI 4A8XC 1E8YA 4REZA 3BVZA 5AUIA 3A4SC 1QOGA 2K22A 1GB1A 2G3QB 2GI9A 2R2QA 2KFKA 5JH5C 2IDYA 4OVZA 2PLPA 3AI5A 1Q0WB 2CHXA 2KVRA 3S2AA 1QZEA 3TL5A 1MPEA 2MBOA 3GOEA 3AU5A 3QQ8B 1IGCA 1TKGA 1V8CA 4FBJB 2M1MA 4A90A 1ZPSA 3SEBA 3DCGA 4ZRPA 1FRDA 3U30A 1WJUA 4FJZA 1F9JA 1SB3C 3AE5B 1ZOYB 4J3OD 1I4QA 3I5JC 3ZUNA 2LGSA 3RN9C 1NYRA 2FCMA 4MGKE 3HRDD 2V0GA 4IWPA 1I4GA 3HK0A 1VR9A 4DXAB 2NCNA 3AEAB 4DXGA 2HE7A 1V97A 2MP2A 3VRBB 5JXVA 5EE1A 4G50A 2A4ZA 2E3TA 4DWFA 2DLBA 2AQ2B 1EF5A 4K7SA 2IY1B 5I4DA 2CKHB 1WJNA 1WIAA 2KKCA 4KX6B 1ISNA 3M3JA 1STEA 3HVZA 4TV3A 3FKYA 3L10B 2O2VA 2KLGA 2WU2B 1SIFA 3IAS1 4TKNA 1T5XD 5IKCM 3RD2A 3KLSX 1FPYA 2MJ3A 4AJYB 2FIDA 3PRMB 4GDKB 4KGSA 1VJKA 3BK1A 2D07B 3R7RA 2N7DA 4A3PA 4DK5A 3ONSA 3DBHI 1F1HA 5TSSA 2FCQA 1V1PB 4EOYA 2WHIA 2KX3A 5D3DA 2N0SB 3DVNV 2JUOA 2LGYA 2KQSA 1FO4A 2KTRA 4A20A 4IKGA 2KN4A 3QAQA 3L54A 2QJLA 2W3SA 3ZIMA 1J19A 3H7PB 1FD6A 2WDRB 4GDLA 1OFFA 4J6IA 1MVKA 2JSVX 4JWUC 1B1ZA 1FCLA 4ZHPA 1OEYJ 1FXAA 3ZLZA 5J2RA 2WXPA 1WJ4A 3VUXA 2JT4B 3ZNZB 3LDZE 2KD0A 3AE3B 1WXSA 4N6EB 1YN3A 1F0ZA 3N32A 5GMVA 1V49A 4C7ZA 4EZKA 4I6PA 3NVYA 3PS6A 1IP9A 5FKAC 3RFZB 1M4VA 1Z2MA 1WXVA 1YJJA 1WI0A 1YX6B 1GAQB 2PW9A 4ZRKA 5D2MB 1YJIA 5IP4D 4K3CA 1EWYC 5HHDG 1NDDA 2PIAA 1P0RA 1FCCC 2XEWA 1OQYA 1E8WA 2CR5A 3J9CA 3PGEA 3A9KA 1FXTB 3Q8FA 2UWQA 1N5XA 2NTSA 2KFKB 2CJOA 5LXHA 1E90A 5E6JA 3RNBC 2PE9A 3WALA 1B9RA 1C79A 1UWXA 3DVGY 2PE6B 4DHZE 5BO4B 4ZDVA 3EFCA 1TZOA 3PHWB 3GE3C 4M8MA 3CMMB 4NJ7A 2Q5WD 1T3QA 3SDLC 3TSSA 3SU8X 3ZW3A 5H92C 2VZKB 3V6EB 2Y5CA 3R7QA 3QWZB 4BFRA 2QIEB 1YOVB 1L4ZB 3LXFA 4GU2A 4N9F4 3SFDB 1UUPA 2MP2B 3RNFC 2ZPYA 1C4AA 5T8IA 2C5LC 4HKZE 2NBVB 3R8BA 2WXGA 1QOFA 1C9FA 2BB6A 2GBNA 2XK5A 3IG3A 2AQ3B 2IGGA 2WQYB 5D6JB 1BMLC 1DYQA 3ZNID 2L0FA 2L8JA 3IBEA 3VH4B 2NBWB 2O2VB 3CSFA 5HI1A 4PYUA 1HZ5A 3QJZA 2DAJA 2CHWA 3OJ4B 3FAHA 3R2IA 4PK1A 3ZNHB 1EF1A 4GSWA 2ASQA 1XF5L 3TUOA 2QC8A 3RZWC 1KM7A 2ZVOA 3ZJVA 4BOZB 2K3UA 3U2SC 1WXMA 2KQ4X 3QC8B 2KTRB 1TS5A 2Z0DB 5J18A 2KANA 2IGDA 3SFEB 4FJYA 3P4RB 1SSNA 3PRZA 2L05A 2XN9C 1SXTA 2HDEA 4W9JA 5H8YE 2KK8A 5IN7A 4HKQA 1CMXB 3A33B 4GDLB 1SE3A 2L32A 1JALA 3UQBA 2J52A 1CQVA 1MG4A 4YWGG 5JZEB 3P42A 1K52A 4P1CC 4F8CB 2IJ0A 4ZRQA 1L7YA 1FNWA 1JCKB 2KDIA 3DHIC 2WX1A 3PRPB 2DWQA 4XDDA 1JMLA 3N9YC 3MC9A 1VD2A 3EHVA 1XCTL 3R2TA 1YD8U 1ZUD2 4A6QA 5DPTA 1UGMA 3QCAA 3GZNB 4BBNC 2GLSA 2WXRA 3P2BA 1I4HA 3U4EG 3HIZA 4KKJA 4FULA 1TY0A 2G9HD 4EZLA 2GBRA 4YXDB 1UBQA 4URKA 1OGWA 4FHJA 4K7UA 2I2YA 4WJNA 2VH1A 4MELA 3BY4B 2WP9B 3I63C 2OJRA 2I38A 2D2QA 3Q3NC 1SE9A 3A9KB 2JZZA 5G2NA 1ESFA 3L17A 3IT4B 3N30A 2KT7A 5J17A 5LNK1 3TEYA 4ICVA 4HROA 2DBYA 4BKSD 1TS4A 3PT2B 4HEA1 1F2RI 4FN2A 4GB9A 1C78A 2LVOA 3I3TB 1C77A 2KJ6A 4II3B 1E7UA 4QAYA 2EELA 3RZFA 2YEPF 4KZCA 3KYCD 1FEHA 2BT6A 1SGHA 3PV1A 5FR3A 1J7BA 2K6DB 2JZ3B 2CU3A 1MHHE 1L6VA 3O65B 1L0XB 3QARA 1T0SC 4BOSC 2I1JA 2WS3B 2NR2A 3IT6B 4G11A 2R61A 2D10A 3RYTA 1IPGA 4F7ZA 1WF9A 3MFGA 3W5VB 1WGYA 3OG5A 4WH4A 3ZVVA 2C7HA 3CIRB 1QT9A 2MBQA 3O13A 4XE0A 4NZLB 3AE1B 3ZTCA 2XK5B 2LJ5A 2QEJC 2DZJA 2M8SA 1V2YA 3Q8AA 2BS4B 2NTTA 1DOXA 3MHSD 4M00A 4ZHOA 3M62B 4GLSC 1R4MI 5E6NA 1QKZA 3KVFB 5CX3A 3WA0A 3DWMA 2B76B 2IGHA 4K1RB 1IYFA 2KMMA 4RFBA 1LM8B 2GBMA 1L2NA 2FE8A 3A9JA 3N1XC 2AL6A 2KFJA 1E10A 3MC8A 3B0AA 4TQ1A 2LXAA 2BW2A 2BQQA 3T9LA 1ZDVA 2M17A 1WGGA 1E7VA 3AEFB 3R66C 1WX9A 4IUMB 3E9SA 1YQ4B 4PS7A 1GC6A 1P7EA 2Z59B 4OZBA 3KQ4A 3JYUA 1FFVA 1KFYB 1JWMD 1HTQA 1FIQA 1YQBA 2AL3A 3A1QA 4NQLB 1OQQA 2PMVA 3NG0A 1KRHA 4GIVA 1XLOA 2BS3B 1NBFC 4BVUC 3RCZA 2WX0A 2V3SA 3T3OA 2RSUA 3M63B 4W9IA 4W9CA 1OQRA 1ACCA 1PYWD 4L2YA 2KWVB 2VRRB 3P63A 4EFOA 4MGIE 4II2B 1TT5B 4TMAB 3AEBB 3DBLB 5AZHA 2IZVB 4MH0E 4YSYB 4E71A 2LVQA 3TCAA 1Q1OA 1WGDA 4GN1A 2WU5B 3DWGC 2KDEB 1EM7A 2MBEA 3C19A 4WWOA 2MEKA 1HQRD 4OVVA 5JHAA 4HJKA 2D3AA 4LNKA 3PLVA 4NAWA 4W9EA 2JY6A 4WIPA 2RPQA 2INCC 1WZ3A 2W55A 1S1QB 2MX2A 1N63A 3L08A 3BWUD 1ET6A 4IM0A 2X38A 5C3JB 3HHMA 1GB4A 2BKRB 1E8XA 4K3BA 3VAWA 1I35A 4LDTB 3VTVA 3OWEB 2L52A 1C3TA 2WXHA 2W9NA 4YL8A 2JU6X 2WDVB 2BGFA 3Q3JA 5BMIA 3APFA 4EZJA 1DOYA 3MC0B 2BBCA 4MDKE 1N6ZA 3V6CB 4MGZE 4LJPB 1TZ1A 2MBBB 4E74A 1YN4A 2CHZA 2LUEA 4LDTD 3NS1A 4RMAA 3NVZA 5L83A 2N1WA 4D2KA 1V1OA 1SEBD 4C7YA 1MG8A 2D3BA 3PHXB 1EU3A 1ZXIA 2L00B 2UU7A 3Q3OC 3VQIA 3AE9B 4I6LB 3B9JA 1EU4A 3U52E 3UF8A 3AULA 3ZDMC 4RGTA 2N7EA 4IW0A 3W9CB 5E6OA 1SBBB 2KWUB 2V4IB 1MI0A 4LJOB 1D5ZC 2PVGC 5D3IB 2LXCA 3H7SA 4ICUA 5DPSA 5CHVC 5LXIB 3RNCC 4JPSA 4P16A 3B2GA 4A55A 2V4LA 3PZ7A 4HDOA 1PGAA 4L23A 2JF5A 4OZAA 4KV2A 4NJ6A 2C7MB 1Y8RC 2DYOA 4G0NB 3H1UA 1RYJA 4XGAB 1ENFA 1TS3A 2J42A 2JX5A 3ZTDA 5BMHA 4LNFA 4CYEA 2LGIA 3A9JB 1JW9D 1R4NB 2KZRA 1SE2A 3DVNU 4M02A 3ZRFA 1YIWA 1WXQA 2W3RA 5DCNA 2ACZB 1BUIC 2LRUA 3PO0A 4KKIA 1ZKHA 2WNMA 3Q69A 2BYFA 3MHZA 3ZKJC 2K39A 2WDQB 2ZPNA 1NENB 4TSSA 1SJHD 2MCNB 1VRAB 1ET9A 2AWTA 3DHGC 5HG2A 3TEZA 4GXBA 3JSVA 3PZ8A 3ENEA 3UQAA 4O1NA 1VDVA 2RGFA 2H88B 4IM2A 2OJWA 3AECB 4HRSA 2L3ZA 2X8XX 2KWCA 5C2TB 1JWAD 1PGBA 2IY0B 2WWZA 2KOXA 3IVFA 2K8CA 3VHTC 2J0KA 3X0WA 2KVZA 4LNNA 1VCBA 4DQOC 3VFKA 1U4AA 2KYWA 4AOFA 3B08A 2GOWA 3I9V1 5C23A 4ASWC 2JWZA 3B1LX 3VTWA 2GBJA 2ZEQA 4IWQA 3L0WB 3MJWA 4XWTA 3N1YC 4A3OA 3P4QB 2MHJA 4PT5A 4GOCA 4W9GA 4AWJA 1UH6A 4NAWB 1WR6E 4KDIC 1TYGB 3NUHB 3APDA 1ZGUB 3RULA 2LWPA 3APCA 3D32A 4NAMA 3TEWA 5IOIA 1F2RC 3ZRCA 2XBBC 5AUKA 1ZXHA 1Q10A 4ZRJA 3ZXVA 2BF8B 2JPHA 2W82A 1VZ7A 3RUIB 3GB1A 1JRUA 2YEPB 1AWDA 1WX7A 3SD5A 4HK2A 3EGRA 3MP9A 1YJ1A 3BINA 3W2DA 2A5UA 5DPRA 2HTME 4MH8A 4LLGM 3C0RB 3ZNGC 2PJHA 3IXSA 3DBRB 2VZKD 3OAWA 2L76A 2N9EB 1FFUA 2V9HA 3A4RA 2KNBA 4KZ0A 3IAM1 1P98A 1XT9B 4YT0B 1FM0D 3LJ3A 1OTRB 5KHOA 4ZYSA 2WXIA 3Q8BA 2CJNA 1V5OA 1JQ4A 1L0VB 1P7FA 1FXIA 2O6VA 5JHBA 4MT5A 4AS1A 3N3KB 3L16A 1HE8A 3VUYA 1Z5SB 3RNAC 4AUQC 3ML8A 2KC1A 3V60A 2AYOB 4IOIE 4W9LA 2N4FA 3UIPB 1WR1A 2CU1A 1SE4A 1GJZA 4WAAA 1NI2A 4HXDA 1N5WA 3AH7A 4WQOB 4OZCA 1C4CA 4YTPB 1NYQA 4M0WA 4ZRIA 3ZQ4A 4LNOA 4ANWA 3UIOB 3DVGX 4NPNA 3UI3A 2ON8A 1TKEA 1H8CA 2M0XA 3AM9A 1L5PA 1SIJA 4LTUA 1BT0A 3SR6A 2UYZB 4EE2A 1EO6A 3DHHC 1YMHE 4DDID 4RCOA 2KDBA 3JSVB 3Q3MC 2HTHA 3EA6A 1X1MA 1K50A 4W9HA 1UF0A 4KIKA 2C60A 4HJGE 2IO3B 3U7DA 2KMAA 5IA7A 1AW7A 1GC7A 3EC8A 3WAPA 5MPOA 2IO2B 4FHKA 5BYSA 2PVOD 4LK0M 2Y3AA 1A70A 2PTLA 2MSED 4US8A 1XO3A 3TIXA 1XLNA 3OLMD 1J0GA 1QILA 1C76A 3MJ5A 1V9JA 1NEKB 2KC2A 4L1BA 1D5XC 1XCQL 3ECIA 3QHTA 3DBHB 1WRIA 2K6QA 1E8ZA 2V3NA 1V5TA 4EEWA 1CZPA 1PUTA 5DPWA 4OW0A 1WGRA 2DZKA 2WYQA 4OHJA 4CO7A 3BIID 3W1SA 1LO5D 1UWMA 1KTKA 2KLCA 1WE7A 3HUIA 4WQMA 3WCQA 3ML9A 4KSKC 2H89B 2JWUA 3RT3B 2R2OA 2PKOA 3PLUA 2JXTA 3KWVA 4DBGA 2MLBA 1IUEA 4RF0A 2LD9A 3RPFC 3DOWA 2RMMA 4X57B 1E6EB 1I7HA 2LI5A 2BWES 3FILA 3ZXRA 1P9DU 1XD3B 1WXAA 1PDXA 2ZW0A 4JQWC 3GE8C 2DNFA 2Z8LA 1T0YA 1WYGA 2BTEA 1D5MC 1NVID 1HA5A 3LB8C 2I1KA 3BZDB 3UINB 2PEAA 1C4PA 4MACA 1VLBA 4USAA 1YQ3B 3FC4A 4TUUA 2N9KA 2O6VB 1TTNA 4MJSA 4WJPA 2J4XA 2IYDB 1H4RA 2M0AA 2QHOA 1KJTA 1ROEA 1E0ZA 3NZSA 5FR6A 3QK0A 1WGHA 3PTFC 2KDMA 4IM3A 2OEDA 1ZP0B 3VH3B 1DOIA 2KQ7A 1QOBA 2C9WB 2LMCA 3PZDA 3T3NA 2BYVE 3BYTB 2JXXA 3MTNB 1PFDA 1WYWB 3I57A 1LXDA 2QSDA 2O6VD 1GPXA 2M19A 3IFWB 2INDC 5EE0A 1N61A 3VR9B 3WAMA 4AQ7A 2MWSB 1E9MA 2ICIA 4E3CA 4M8NA 5EE9A 1MJDA 4XX5A 4JE3B 4M0WB 5D7GA 4WWMA 2DYMA 3NJTA 4B0EA 2RDHA 3Q8CA 4NQKE 2DYBA 1G6JA 1GG3A 2CS4A 1AARA 1JWBD 3EFUA 1K8RB 2SEBD 2WXMA 2V1YA 3DQVA 3NOBA
chains in the Genus database with same CATH topology
1RYJA 2XNAC 3SFDB 1ENFA 1TS3A 2J42A 2JX5A 2WXFA 1UUPA 2NMQA 5BMHA 1FNUA 2FBWB 1R7SA 2LGIA 1C4AA 5T8IA 4ARCA 1JW9D 3LYYA 1VZ6A 4HKZE 3R8BA 2WXGA 1QOFA 1C9FA 1SE2A 3NZ3A 2MJDA 2JZPA 2BB6A 5HFYA 4Q2JA 2AX5A 1T6BX 2AQ3B 2IGGA 3AE7B 1ZDXA 2WQYB 3ZJTA 2KWDA 1WXQA 3ETRA 2W3RA 1BMLC 1DYQA 1QF6A 4ITKA 2ACZB 1BUIC 3PO0A 4KKIA 2WNMA 3Q69A 4N59A 3MHZA 3TEXA 2WDQB 1NENB 4TSSA 5HI1A 1SJHD 1J7AA 1HZ5A 1VRAB 1ET9A 2LFIA 5HG2A 3FAHA 3B2FA 3TEZA 2M56B 3BK2A 4XWWA 3R2IA 3PZ8A 2OHFA 1XF5L 4O1NA 1UNSA 1VDVA 3TUOA 2H88B 2N7JA 1D4BA 3AECB 4HRSA 2JYEA 3ZJVA 2JQRB 1GOZA 5C2TB 2K3UA 1JWAD 1PGBA 3BVGA 3ABVB 3U2SC 1QLBB 2KQ4X 1N62A 3AMZA 2W54A 1TS5A 2BYTA 4DQOC 2L83A 1SJED 2IGDA 1L0YB 3SFEB 3P4PB 3P4RB 1SSNA 1JWUD 2BS2B 2WLBA 2XN9C 3I9V1 2WXQA 1SXTA 1HZ6A 2HDEA 5H8YE 3HVDA 5FK9C 3ZGZA 4HKQA 4GDLB 4YSXB 2D5GA 1SE3A 1NI3A 1JALA 2L32A 2J52A 1CQVA 4XWTA 3EUB2 2WXOA 2N9LA 1SF0A 4YWGG 3P42A 3P4QB 4WAFA 1K52A 2RDGA 4PT5A 2IJ0A 3AE6B 4ZRQA 2KACA 4R3DA 4NAWB 1FNWA 1JCKB 2LUMA 3AB5A 4B0MA 1WWTA 3FILB 2DWQA 1RWSA 1TYGB 4XDDA 1JMLA 1ZE3D 3N9YC 1V1PA 1D6EC 3P1MA 3NUHB 4N58A 2ONQA 1XCTL 3R2TA 3VRAB 1ZUD2 4A6QA 4C80A 4ZOHC 1KLGD 2WXRA 4NAMA 3TEWA 1F2RC 1MHXA 4YSZB 5AUKA 1ZXHA 1I4HA 3U4EG 4KKJA 4P6VF 1Q10A 5BYQA 1CK1A 1RFKA 2W82A 1TY0A 1VZ7A 2G9HD 2WXNA 4YXDB 2TSSA 3AE2B 3GB1A 2YEPB 5G5GA 1AWDA 2I2YA 3L4PA 2WP9B 4XDCA 3EGRA 3MP9A 2I38A 4NJCA 2EKIA 3W2DA 1YNTE 2HTME 3BVMA 1ESFA 4MH8A 4CQNA 4H2AA 1N60A 4LLGM 1QOAA 2K0PA 3IT4B 5LNK1 2LHEA 3TEYA 3IXSA 2IPKD 2INPE 3Q8EA 4HROA 2DBYA 1PGXA 2JYTA 2VZKD 3GP7A 4RNAA 1FFUA 2QILA 1TS4A 4HEA1 3IAM1 1F2RI 5BYRA 3NRZA 2ZW1A 4YT0B 1FM0D 4YTNB 2LEKA 1C78A 3E56A 3P4SB 3H8HA 1C77A 1XXGA 4RGOS 2WXIA 3Q8BA 4US9A 4ZYSA 1TY2A 1K51A 2CJNA 1XLQA 1JQ4A 2EELA 2E6XA 1L0VB 1P7FA 1FXIA 3AN1A 2YEPF 3AEDB 1I4RA 2WXKA 4MT5A 4AS1A 2KAJA 1FEHA 2WXJA 2Y5PA 2BT6A 2AQ1B 5GXGB 5FR3A 1J7BA 3AEGB 4A8XC 4REZA 3BVZA 5AUIA 1QOGA 2CU3A 1MHHE 1L6VA 2K22A 1YN5A 4RGMA 1GB1A 1J7CA 1L0XB 2GI9A 2SAKA 5G5HA 2WS3B 3AE4B 3IT6B 4IOIE 2R61A 2IDYA 4OVZA 1SE4A 2PLPA 3V05A 3MFGA 3W5VB 1AN8A 1WGKA 3URYA 4RF1A 4C56C 4WH4A 1MPEA 5BMGA 3CIRB 1IGCA 1TKGA 1QT9A 1AYFA 2QMTA 3O13A 1V8CA 1N5WA 3C8YA 4XE0A 3U7ZA 4NZLB 3AE1B 3AH7A 4A90A 1ZPSA 2K9XA 3SEBA 4ZRPA 1FRDA 4OZCA 2QEJC 4YTMB 1C4CA 4YTPB 1NYQA 4M0WA 3ZQ4A 1SB3C 2BS4B 3AE5B 3Q8AA 1KF6B 3UI3A 1ZOYB 4J3OD 1I4QA 4KGTA 2NTTA 2ON8A 4ARIA 1DOXA 1NYRA 1TKEA 1FNVA 4KGRA 3AM9A 3HRDD 2V0GA 4ZHOA 1I4GA 4GLSC 1L5PA 1SIJA 1TJEA 4LTUA 3SR6A 1VR9A 1IBXA 1QKZA 4EE2A 1YMHE 1HEZE 4RCOA 3DWMA 3AEAB 2B76B 2IGHA 2KMMA 4RFBA 4DXGA 3VRBB 1V97A 5JXVA 5EE1A 2FE8A 2K5PA 3VR8B 3EA6A 1K50A 2E3TA 4UDUC 5EE3A 2DLBA 4IDIA 1E10A 1TS2A 2AQ2B 4TQ1A 4HJGE 5I4DA 2BW2A 1AW7A 2MJEA 1ZDVA 2RPVA 4KX6B 5MPOA 3AE8B 1STEA 5BYSA 2PVOD 4LK0M 3HVZA 3AEFB 2Y3AA 1A70A 2PTLA 3E9SA 2WU2B 1YQ4B 3KWLA 4US8A 2WXLA 1P7EA 4OZBA 1XO3A 3KQ4A 1XLNA 1K53A 3IAS1 1BXTA 1FFVA 1QILA 2GB1A 1C76A 1KFYB 3MJ5A 1JWMD 1T5XD 1FIQA 1NEKB 3GS2A 4L1BA 3KLSX 1QQRA 2MJ3A 4KGSA 4GDKB 1D5XC 1VJKA 1XCQL 3BK1A 2FUG1 1WRIA 2V3NA 3BYYB 2BB5A 3V3XA 1OQQA 5TSSA 1VZ8A 2PMVA 1CZPA 1PUTA 1KRHA 1XLOA 2BS3B 1V1PB 5D3DA 4JWSC 4OW0A 2N0SB 3T3OA 1TKYA 1OQRA 1ACCA 1PYWD 4OHJA 4L2YA 1FO4A 3BIID 1IGDA 3W1SA 4IKGA 1LO5D 2KN4A 3ZJUA 1UWMA 3P63A 1KTKA 3HUIA 4WQMA 1DGJA 4TMAB 3WCQA 3AEBB 2QJLA 2W3SA 1HXYD 4YSYB 4TQ0A 2H89B 2JWUA 1FD6A 2WDRB 1WSPA 1OFFA 2PKOA 2JXTA 3KWVA 2G1EA 1MVKA 2WU5B 2JSVX 3DWGC 1IUEA 1EM7A 4RF0A 4JWUC 1F77A 1B1ZA 1FCLA 4ZHPA 3RPFC 1FRRA 1FXAA 2RMMA 2WXPA 1E6EB 1HQRD 2MEKA 1I7HA 1UGJA 4WIPA 3AE3B 3FILA 3CWIA 2W55A 4N6EB 3ZYYX 1N63A 1YN3A 1F0ZA 1L4DB 1ET6A 3BWUD 1PDXA 2X38A 1I4XA 2MH7A 2ZW0A 3NVWA 4C7ZA 5C3JB 2Z8LA 1WYGA 2V3PA 3NVYA 2BTEA 1GB4A 1D5MC 1NVID 1RM6C 1HA5A 3LB8C 5FKAC 3RFZB 1XEEA 1KLUD 3BZDB 1M4VA 1C4PA 4MACA 3W5UB 1VLBA 3OWEB 1YJJA 4USAA 2L52A 1JROA 1GAQB 2WXHA 1YQ3B 3FC4A 2PW9A 2N9KA 1YJIA 2JU6X 2WDVB 2LJIA 3AEEB 4RH6A 1EWYC 2J4XA 5HHDG 5BMIA 2PIAA 2M0AA 1CJEA 1E0ZA 1ROEA 1DOYA 1FCCC 3MC0B 2BBCA 2KDMA 4DXFA 3J9CA 2OEDA 1ZP0B 1YN4A 1DOIA 2LMCA 1QOBA 3T3NA 1EWCA 3Q8FA 1N5XA 3BYTB 2NTSA 3NS1A 3NVVA 2CJOA 3NVZA 1E7PB 1PFDA 1L6UA 3I57A 2QSDA 5E6JA 4D2KA 1V1OA 1SEBD 4C7YA 1B9RA 1GPXA 1C79A 1UWXA 2M19A 1EU3A 2LHDA 1ZXIA 3VQIA 3AE9B 5EE0A 1N61A 3B9JA 3VR9B 1EU4A 3U52E 4AQ7A 4RGTA 1FMAD 4WURA 3W9CB 1E9MA 2ICIA 1TZOA 4FXCA 3AV8A 5EE9A 4MM3B 1SBBB 1JRPA 1KH0A 2L1AA 4JE3B 5D7GA 2V4IB 1MI0A 1Y56A 1D5ZC 1I4PA 4WWMA 2DYMA 2PVGC 5D3IB 4JX1C 4B0EA 2RDHA 3Q8CA 1XLPA 2Q5WD 1T3QA 2INNE 3TSSA 4A9AA 2J53A 5H92C 2VZKB 1JWBD 4JPSA 4P16A 3B2GA 2Y5CA 4RGNA 4A55A 3PZ7A 1PGAA 2SEBD 1JWSD 2GRIA 2QIEB 4L23A 2WXMA 1IBXB 1L4ZB 4OZAA 3LXFA 2DYOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q69 A;  3NZ3 A;  3I57 A;  3LYY A;  4MT5 A;  2LFI A; 
#chains in the Genus database with same CATH topology
 2LVP A;  1MFW A;  2WXF A;  2NMQ A;  2EMT A;  1FNU A;  1R7S A;  3Q6B A;  3LYY A;  1VZ6 A;  4KIK B;  4BKG A;  2JZP A;  4K81 A;  5HFY A;  2DX5 B;  2MA9 B;  1GUA B;  4Q2J A;  4FLH A;  1T6B X;  3AE7 B;  5KHQ A;  3W1Y A;  3ZJT A;  2KWD A;  3ZDT A;  1WMH A;  3ETR A;  3QX1 A;  1QF6 A;  4ITK A;  1RRB A;  2ZCC A;  3Q3F A;  2EMS A;  2G45 B;  1WE6 A;  4N59 A;  1TIF A;  3TEX A;  2MRP A;  2BWF A;  4KVG B;  2M56 B;  3CF6 E;  2OHF A;  3PPA A;  3R3M A;  1UNS A;  2JYE A;  1V6E A;  2ZJD A;  3PVL A;  4IC7 B;  3ABV B;  3VUW A;  2BPS A;  1N62 A;  3AMZ A;  2W54 A;  2BYT A;  2L83 A;  1JWU D;  2WLB A;  3HVD A;  3ZGZ A;  2D5G A;  1NI3 A;  2KJR A;  1WH3 A;  2YVC A;  3EUB 2;  3K9P B;  2N9L A;  1SF0 A;  4WAF A;  2N9X A;  2D11 A;  1XQQ A;  3AE6 B;  2KJH B;  2ZNV B;  1D3Z A;  4XC2 A;  4AP4 C;  4B0M A;  2KO3 A;  1ZW7 A;  3FIL B;  1RWS A;  2VH2 A;  1ZE3 D;  3P1M A;  4N58 A;  4MEM A;  2ONQ A;  3VRA B;  4C80 A;  2JRH A;  3K9O B;  4W9D A;  2KTF A;  2KDF B;  3GZN I;  5E6P A;  3WIM A;  3T8M A;  2MW5 A;  4YSZ B;  4ANU A;  5BYQ A;  1CK1 A;  1RFK A;  4MJS B;  2WXN A;  4IWO A;  3CST A;  4S17 A;  4HCN B;  4FA6 A;  4XDC A;  4NJC A;  2EKI A;  3NS8 A;  3KUD B;  1YNT E;  1PQS A;  3BVM A;  2JVC A;  1RLF A;  3Q2A C;  4H2A A;  1N60 A;  4WJO A;  2LHE A;  2QCZ A;  2INP E;  1PGX A;  4RNA A;  2BYE A;  3QIJ A;  4HWI B;  2IBI B;  4G3X B;  5BYR A;  3X23 A;  4YTN B;  1OEY A;  3E56 A;  1HTO A;  2DZI A;  3H8H A;  1K51 A;  3W1S C;  1XLQ A;  4MGY E;  2IO0 B;  2E6X A;  3AN1 A;  4HPL B;  2KAJ A;  4P1B C;  5D94 A;  2AQ1 B;  4KSL C;  5GXG B;  3AEG B;  3VVW B;  4BKT A;  2KN5 A;  1YN5 A;  4RGM A;  1J7C A;  4RM8 A;  2SAK A;  5G5H A;  3A1Q B;  5TR5 A;  3AE4 B;  2K1F A;  3RNE C;  2KX0 A;  2B3A A;  3V05 A;  2IO1 B;  2ZNV C;  1AN8 A;  3IHP C;  1WGK A;  2KHW B;  3URY A;  4RF1 A;  4C56 C;  5BMG A;  1A5R A;  4JL9 A;  2Y5B B;  4HDQ A;  1AYF A;  2NBU A;  2QMT A;  4C4V A;  3EEC A;  3C8Y A;  3U7Z A;  2K9X A;  5AZG A;  1V81 A;  1Q5W B;  4MM3 A;  4YTM B;  2LAS A;  5CTR C;  2J0M A;  1WMH B;  1KF6 B;  1UD7 A;  4KGT A;  2DAF A;  4ARI A;  1FNV A;  4KGR A;  4ANV A;  4DHJ B;  3HM3 A;  4BKS A;  1R4M B;  4RM9 A;  1TJE A;  4B6W A;  1LQB A;  1IBX A;  4HLE A;  1WX8 A;  2K25 A;  2LRW A;  1HEZ E;  5EDS A;  2ZCB A;  1P3Q U;  2Z0E B;  3VR8 B;  2K5P A;  3M95 A;  1J8C A;  3RI7 C;  4UDU C;  2M4N A;  5EE3 A;  4IDI A;  3AXC A;  1TS2 A;  2J7Q B;  3DPD A;  4OVU A;  4C00 A;  4DHJ D;  3QA8 A;  4ACF A;  2FCN A;  1WFY A;  2MJE A;  2RPV A;  1F52 A;  4BAX A;  4XYC A;  4XZ4 A;  3AE8 B;  4FJV B;  2KXJ A;  2L7R A;  3AU4 A;  3KWL A;  5HKH A;  2WXL A;  4B9K A;  1K53 A;  1BXT A;  2GB1 A;  3VDZ A;  4B95 A;  3GS2 A;  1KOT A;  1QQR A;  3UGB B;  2FUG 1;  3BYY B;  2BB5 A;  3V3X A;  1VZ8 A;  2HJ8 A;  4JWS C;  2PPH A;  4JLC A;  5AEK B;  1TKY A;  1EUV B;  2D3C A;  2MQJ A;  1IGD A;  3HM6 X;  1KLV A;  3ZJU A;  2ZVN A;  1DGJ A;  3KH0 A;  2LZ6 A;  1HXY D;  3DBL I;  4TQ0 A;  1UBI A;  1WSP A;  1M94 A;  4HCP B;  2FCS A;  2G1E A;  1F77 A;  4GMV A;  2FAZ A;  1FRR A;  1UGJ A;  1WY8 A;  3CWI A;  5IO9 A;  3ZYY X;  3H9D A;  1L4D B;  4IG7 B;  2NPT A;  1I4X A;  2MH7 A;  3NVW A;  1RAX A;  1LFD A;  2V3P A;  3RMK C;  2N1V A;  1RM6 C;  1XEE A;  1KLU D;  4HPM B;  3W5U B;  2G4D B;  1JRO A;  2EKE C;  4P7I A;  2WDT B;  2LGD A;  2LJI A;  3AEE B;  4ANX A;  4RH6 A;  2D3G A;  4WWP A;  3TJP A;  3PSE B;  1CJE A;  4BZA A;  1C1Y B;  3DDC B;  4DXF A;  4LCD E;  4NY0 A;  1EWC A;  2RD0 A;  3NVV A;  4JIO U;  3KW5 B;  1E7P B;  2GMI C;  1L6U A;  1I42 A;  1RFA A;  2N9P C;  3V62 A;  4W9K A;  3DBS A;  2LHD A;  4DDG D;  1WJ6 A;  4C4V B;  4JGH B;  3WAO A;  1FMA D;  4WUR A;  4FXC A;  2FIF A;  3AV8 A;  2DZM A;  4MM3 B;  1JRP A;  1KH0 A;  2L1A A;  5AZF A;  3RNG C;  1Y56 A;  1I4P A;  4AJW A;  3KUC B;  4JX1 C;  5C1Z A;  1XLP A;  2INN E;  4HPP A;  1T0R C;  4DHZ B;  4A9A A;  2J53 A;  4RGN A;  1UEL A;  3V61 A;  1JWS D;  2GRI A;  1IBX B;  5IAA C;  3KUZ A;  2XNA C;  3L13 A;  1TGZ B;  3TMP B;  2FBW B;  2JRI B;  2RDB C;  4ARC A;  4M01 A;  3ALB A;  1R4N I;  1UZX B;  3NZ3 A;  2MJD A;  4KDL B;  1YX5 B;  2AX5 A;  1ZDX A;  1V80 A;  4MSQ B;  4PS3 A;  2AEH A;  3SHQ A;  2BKF A;  3JW0 X;  2J0J A;  2LGX A;  3TBL D;  5CHW A;  2MBH A;  4PYZ A;  4NNJ B;  1J7A A;  3N20 C;  2LFI A;  4S0R A;  3B2F A;  3JVZ X;  3BK2 A;  4XWW A;  1P1A A;  2ZZP B;  1WZ0 A;  4PS8 A;  4GGQ A;  2OOB B;  2REX A;  4BBN F;  2N7J A;  1D4B A;  2BVC A;  2HJ1 A;  2JQR B;  1GOZ A;  3BVG A;  3WAN A;  1LGR A;  2L0T A;  1E5W A;  1QLB B;  4HVB A;  3U8Z A;  2K8B A;  4W9F A;  3VXW A;  3VTU A;  3NZU A;  1SJE D;  1L0Y B;  3P4P B;  2KMC A;  2BS2 B;  2WXQ A;  2QDF A;  1HZ6 A;  3NHE B;  2FUH B;  5FK9 C;  4EKU A;  4ZYN A;  1WM2 A;  4YSX B;  2WXO A;  2RDG A;  2DEN B;  4GDK A;  3Q14 C;  2KAC A;  4R3D A;  2K8H A;  4EUT A;  2LUM A;  2YLM A;  3AB5 A;  1V86 A;  1WWT A;  1V1P A;  1D6E C;  5L95 C;  3PRE A;  2NPT B;  3KYD D;  2GBK A;  1GNU A;  4ZOH C;  1TBE A;  2FNJ B;  3NY5 A;  3OJ3 A;  1KLG D;  4MSM B;  3N1Z C;  1MHX A;  4P6V F;  2G4S A;  2TSS A;  3H7P A;  4CHK A;  3AE2 B;  5G55 A;  5G5G A;  3L4P A;  4LNI A;  4WJQ A;  2HD5 B;  2NS5 A;  4CQN A;  1S3S G;  3H6N A;  1QOA A;  2K0P A;  2C7N B;  2IPK D;  1T0Q C;  3Q8E A;  5CHF A;  3ZO5 B;  1WRD B;  2JYT A;  4F1S A;  4FAD A;  3GP7 A;  5LLI A;  3DBR I;  2QIL A;  3NRZ A;  2ZW1 A;  2WGS A;  2DHZ A;  2LEK A;  4K7W A;  3P4S B;  4WWN A;  1XXG A;  4RGO S;  4US9 A;  1TY2 A;  1WM3 A;  3AED B;  1I4R A;  2WXK A;  4I6N B;  2WXJ A;  2Y5P A;  2RR9 A;  2NVU I;  4A8X C;  1E8Y A;  4REZ A;  3BVZ A;  5AUI A;  3A4S C;  1QOG A;  2K22 A;  1GB1 A;  2G3Q B;  2GI9 A;  2R2Q A;  2KFK A;  5JH5 C;  2IDY A;  4OVZ A;  2PLP A;  3AI5 A;  1Q0W B;  2CHX A;  2KVR A;  3S2A A;  1QZE A;  3TL5 A;  1MPE A;  2MBO A;  3GOE A;  3AU5 A;  3QQ8 B;  1IGC A;  1TKG A;  1V8C A;  4FBJ B;  2M1M A;  4A90 A;  1ZPS A;  3SEB A;  3DCG A;  4ZRP A;  1FRD A;  3U30 A;  1WJU A;  4FJZ A;  1F9J A;  1SB3 C;  3AE5 B;  1ZOY B;  4J3O D;  1I4Q A;  3I5J C;  3ZUN A;  2LGS A;  3RN9 C;  1NYR A;  2FCM A;  4MGK E;  3HRD D;  2V0G A;  4IWP A;  1I4G A;  3HK0 A;  1VR9 A;  4DXA B;  2NCN A;  3AEA B;  4DXG A;  2HE7 A;  1V97 A;  2MP2 A;  3VRB B;  5JXV A;  5EE1 A;  4G50 A;  2A4Z A;  2E3T A;  4DWF A;  2DLB A;  2AQ2 B;  1EF5 A;  4K7S A;  2IY1 B;  5I4D A;  2CKH B;  1WJN A;  1WIA A;  2KKC A;  4KX6 B;  1ISN A;  3M3J A;  1STE A;  3HVZ A;  4TV3 A;  3FKY A;  3L10 B;  2O2V A;  2KLG A;  2WU2 B;  1SIF A;  3IAS 1;  4TKN A;  1T5X D;  5IKC M;  3RD2 A;  3KLS X;  1FPY A;  2MJ3 A;  4AJY B;  2FID A;  3PRM B;  4GDK B;  4KGS A;  1VJK A;  3BK1 A;  2D07 B;  3R7R A;  2N7D A;  4A3P A;  4DK5 A;  3ONS A;  3DBH I;  1F1H A;  5TSS A;  2FCQ A;  1V1P B;  4EOY A;  2WHI A;  2KX3 A;  5D3D A;  2N0S B;  3DVN V;  2JUO A;  2LGY A;  2KQS A;  1FO4 A;  2KTR A;  4A20 A;  4IKG A;  2KN4 A;  3QAQ A;  3L54 A;  2QJL A;  2W3S A;  3ZIM A;  1J19 A;  3H7P B;  1FD6 A;  2WDR B;  4GDL A;  1OFF A;  4J6I A;  1MVK A;  2JSV X;  4JWU C;  1B1Z A;  1FCL A;  4ZHP A;  1OEY J;  1FXA A;  3ZLZ A;  5J2R A;  2WXP A;  1WJ4 A;  3VUX A;  2JT4 B;  3ZNZ B;  3LDZ E;  2KD0 A;  3AE3 B;  1WXS A;  4N6E B;  1YN3 A;  1F0Z A;  3N32 A;  5GMV A;  1V49 A;  4C7Z A;  4EZK A;  4I6P A;  3NVY A;  3PS6 A;  1IP9 A;  5FKA C;  3RFZ B;  1M4V A;  1Z2M A;  1WXV A;  1YJJ A;  1WI0 A;  1YX6 B;  1GAQ B;  2PW9 A;  4ZRK A;  5D2M B;  1YJI A;  5IP4 D;  4K3C A;  1EWY C;  5HHD G;  1NDD A;  2PIA A;  1P0R A;  1FCC C;  2XEW A;  1OQY A;  1E8W A;  2CR5 A;  3J9C A;  3PGE A;  3A9K A;  1FXT B;  3Q8F A;  2UWQ A;  1N5X A;  2NTS A;  2KFK B;  2CJO A;  5LXH A;  1E90 A;  5E6J A;  3RNB C;  2PE9 A;  3WAL A;  1B9R A;  1C79 A;  1UWX A;  3DVG Y;  2PE6 B;  4DHZ E;  5BO4 B;  4ZDV A;  3EFC A;  1TZO A;  3PHW B;  3GE3 C;  4M8M A;  3CMM B;  4NJ7 A;  2Q5W D;  1T3Q A;  3SDL C;  3TSS A;  3SU8 X;  3ZW3 A;  5H92 C;  2VZK B;  3V6E B;  2Y5C A;  3R7Q A;  3QWZ B;  4BFR A;  2QIE B;  1YOV B;  1L4Z B;  3LXF A;  4GU2 A;  4N9F 4;  3SFD B;  1UUP A;  2MP2 B;  3RNF C;  2ZPY A;  1C4A A;  5T8I A;  2C5L C;  4HKZ E;  2NBV B;  3R8B A;  2WXG A;  1QOF A;  1C9F A;  2BB6 A;  2GBN A;  2XK5 A;  3IG3 A;  2AQ3 B;  2IGG A;  2WQY B;  5D6J B;  1BML C;  1DYQ A;  3ZNI D;  2L0F A;  2L8J A;  3IBE A;  3VH4 B;  2NBW B;  2O2V B;  3CSF A;  5HI1 A;  4PYU A;  1HZ5 A;  3QJZ A;  2DAJ A;  2CHW A;  3OJ4 B;  3FAH A;  3R2I A;  4PK1 A;  3ZNH B;  1EF1 A;  4GSW A;  2ASQ A;  1XF5 L;  3TUO A;  2QC8 A;  3RZW C;  1KM7 A;  2ZVO A;  3ZJV A;  4BOZ B;  2K3U A;  3U2S C;  1WXM A;  2KQ4 X;  3QC8 B;  2KTR B;  1TS5 A;  2Z0D B;  5J18 A;  2KAN A;  2IGD A;  3SFE B;  4FJY A;  3P4R B;  1SSN A;  3PRZ A;  2L05 A;  2XN9 C;  1SXT A;  2HDE A;  4W9J A;  5H8Y E;  2KK8 A;  5IN7 A;  4HKQ A;  1CMX B;  3A33 B;  4GDL B;  1SE3 A;  2L32 A;  1JAL A;  3UQB A;  2J52 A;  1CQV A;  1MG4 A;  4YWG G;  5JZE B;  3P42 A;  1K52 A;  4P1C C;  4F8C B;  2IJ0 A;  4ZRQ A;  1L7Y A;  1FNW A;  1JCK B;  2KDI A;  3DHI C;  2WX1 A;  3PRP B;  2DWQ A;  4XDD A;  1JML A;  3N9Y C;  3MC9 A;  1VD2 A;  3EHV A;  1XCT L;  3R2T A;  1YD8 U;  1ZUD 2;  4A6Q A;  5DPT A;  1UGM A;  3QCA A;  3GZN B;  4BBN C;  2GLS A;  2WXR A;  3P2B A;  1I4H A;  3U4E G;  3HIZ A;  4KKJ A;  4FUL A;  1TY0 A;  2G9H D;  4EZL A;  2GBR A;  4YXD B;  1UBQ A;  4URK A;  1OGW A;  4FHJ A;  4K7U A;  2I2Y A;  4WJN A;  2VH1 A;  4MEL A;  3BY4 B;  2WP9 B;  3I63 C;  2OJR A;  2I38 A;  2D2Q A;  3Q3N C;  1SE9 A;  3A9K B;  2JZZ A;  5G2N A;  1ESF A;  3L17 A;  3IT4 B;  3N30 A;  2KT7 A;  5J17 A;  5LNK 1;  3TEY A;  4ICV A;  4HRO A;  2DBY A;  4BKS D;  1TS4 A;  3PT2 B;  4HEA 1;  1F2R I;  4FN2 A;  4GB9 A;  1C78 A;  2LVO A;  3I3T B;  1C77 A;  2KJ6 A;  4II3 B;  1E7U A;  4QAY A;  2EEL A;  3RZF A;  2YEP F;  4KZC A;  3KYC D;  1FEH A;  2BT6 A;  1SGH A;  3PV1 A;  5FR3 A;  1J7B A;  2K6D B;  2JZ3 B;  2CU3 A;  1MHH E;  1L6V A;  3O65 B;  1L0X B;  3QAR A;  1T0S C;  4BOS C;  2I1J A;  2WS3 B;  2NR2 A;  3IT6 B;  4G11 A;  2R61 A;  2D10 A;  3RYT A;  1IPG A;  4F7Z A;  1WF9 A;  3MFG A;  3W5V B;  1WGY A;  3OG5 A;  4WH4 A;  3ZVV A;  2C7H A;  3CIR B;  1QT9 A;  2MBQ A;  3O13 A;  4XE0 A;  4NZL B;  3AE1 B;  3ZTC A;  2XK5 B;  2LJ5 A;  2QEJ C;  2DZJ A;  2M8S A;  1V2Y A;  3Q8A A;  2BS4 B;  2NTT A;  1DOX A;  3MHS D;  4M00 A;  4ZHO A;  3M62 B;  4GLS C;  1R4M I;  5E6N A;  1QKZ A;  3KVF B;  5CX3 A;  3WA0 A;  3DWM A;  2B76 B;  2IGH A;  4K1R B;  1IYF A;  2KMM A;  4RFB A;  1LM8 B;  2GBM A;  1L2N A;  2FE8 A;  3A9J A;  3N1X C;  2AL6 A;  2KFJ A;  1E10 A;  3MC8 A;  3B0A A;  4TQ1 A;  2LXA A;  2BW2 A;  2BQQ A;  3T9L A;  1ZDV A;  2M17 A;  1WGG A;  1E7V A;  3AEF B;  3R66 C;  1WX9 A;  4IUM B;  3E9S A;  1YQ4 B;  4PS7 A;  1GC6 A;  1P7E A;  2Z59 B;  4OZB A;  3KQ4 A;  3JYU A;  1FFV A;  1KFY B;  1JWM D;  1HTQ A;  1FIQ A;  1YQB A;  2AL3 A;  3A1Q A;  4NQL B;  1OQQ A;  2PMV A;  3NG0 A;  1KRH A;  4GIV A;  1XLO A;  2BS3 B;  1NBF C;  4BVU C;  3RCZ A;  2WX0 A;  2V3S A;  3T3O A;  2RSU A;  3M63 B;  4W9I A;  4W9C A;  1OQR A;  1ACC A;  1PYW D;  4L2Y A;  2KWV B;  2VRR B;  3P63 A;  4EFO A;  4MGI E;  4II2 B;  1TT5 B;  4TMA B;  3AEB B;  3DBL B;  5AZH A;  2IZV B;  4MH0 E;  4YSY B;  4E71 A;  2LVQ A;  3TCA A;  1Q1O A;  1WGD A;  4GN1 A;  2WU5 B;  3DWG C;  2KDE B;  1EM7 A;  2MBE A;  3C19 A;  4WWO A;  2MEK A;  1HQR D;  4OVV A;  5JHA A;  4HJK A;  2D3A A;  4LNK A;  3PLV A;  4NAW A;  4W9E A;  2JY6 A;  4WIP A;  2RPQ A;  2INC C;  1WZ3 A;  2W55 A;  1S1Q B;  2MX2 A;  1N63 A;  3L08 A;  3BWU D;  1ET6 A;  4IM0 A;  2X38 A;  5C3J B;  3HHM A;  1GB4 A;  2BKR B;  1E8X A;  4K3B A;  3VAW A;  1I35 A;  4LDT B;  3VTV A;  3OWE B;  2L52 A;  1C3T A;  2WXH A;  2W9N A;  4YL8 A;  2JU6 X;  2WDV B;  2BGF A;  3Q3J A;  5BMI A;  3APF A;  4EZJ A;  1DOY A;  3MC0 B;  2BBC A;  4MDK E;  1N6Z A;  3V6C B;  4MGZ E;  4LJP B;  1TZ1 A;  2MBB B;  4E74 A;  1YN4 A;  2CHZ A;  2LUE A;  4LDT D;  3NS1 A;  4RMA A;  3NVZ A;  5L83 A;  2N1W A;  4D2K A;  1V1O A;  1SEB D;  4C7Y A;  1MG8 A;  2D3B A;  3PHX B;  1EU3 A;  1ZXI A;  2L00 B;  2UU7 A;  3Q3O C;  3VQI A;  3AE9 B;  4I6L B;  3B9J A;  1EU4 A;  3U52 E;  3UF8 A;  3AUL A;  3ZDM C;  4RGT A;  2N7E A;  4IW0 A;  3W9C B;  5E6O A;  1SBB B;  2KWU B;  2V4I B;  1MI0 A;  4LJO B;  1D5Z C;  2PVG C;  5D3I B;  2LXC A;  3H7S A;  4ICU A;  5DPS A;  5CHV C;  5LXI B;  3RNC C;  4JPS A;  4P16 A;  3B2G A;  4A55 A;  2V4L A;  3PZ7 A;  4HDO A;  1PGA A;  4L23 A;  2JF5 A;  4OZA A;  4KV2 A;  4NJ6 A;  2C7M B;  1Y8R C;  2DYO A;  4G0N B;  3H1U A;  1RYJ A;  4XGA B;  1ENF A;  1TS3 A;  2J42 A;  2JX5 A;  3ZTD A;  5BMH A;  4LNF A;  4CYE A;  2LGI A;  3A9J B;  1JW9 D;  1R4N B;  2KZR A;  1SE2 A;  3DVN U;  4M02 A;  3ZRF A;  1YIW A;  1WXQ A;  2W3R A;  5DCN A;  2ACZ B;  1BUI C;  2LRU A;  3PO0 A;  4KKI A;  1ZKH A;  2WNM A;  3Q69 A;  2BYF A;  3MHZ A;  3ZKJ C;  2K39 A;  2WDQ B;  2ZPN A;  1NEN B;  4TSS A;  1SJH D;  2MCN B;  1VRA B;  1ET9 A;  2AWT A;  3DHG C;  5HG2 A;  3TEZ A;  4GXB A;  3JSV A;  3PZ8 A;  3ENE A;  3UQA A;  4O1N A;  1VDV A;  2RGF A;  2H88 B;  4IM2 A;  2OJW A;  3AEC B;  4HRS A;  2L3Z A;  2X8X X;  2KWC A;  5C2T B;  1JWA D;  1PGB A;  2IY0 B;  2WWZ A;  2KOX A;  3IVF A;  2K8C A;  3VHT C;  2J0K A;  3X0W A;  2KVZ A;  4LNN A;  1VCB A;  4DQO C;  3VFK A;  1U4A A;  2KYW A;  4AOF A;  3B08 A;  2GOW A;  3I9V 1;  5C23 A;  4ASW C;  2JWZ A;  3B1L X;  3VTW A;  2GBJ A;  2ZEQ A;  4IWQ A;  3L0W B;  3MJW A;  4XWT A;  3N1Y C;  4A3O A;  3P4Q B;  2MHJ A;  4PT5 A;  4GOC A;  4W9G A;  4AWJ A;  1UH6 A;  4NAW B;  1WR6 E;  4KDI C;  1TYG B;  3NUH B;  3APD A;  1ZGU B;  3RUL A;  2LWP A;  3APC A;  3D32 A;  4NAM A;  3TEW A;  5IOI A;  1F2R C;  3ZRC A;  2XBB C;  5AUK A;  1ZXH A;  1Q10 A;  4ZRJ A;  3ZXV A;  2BF8 B;  2JPH A;  2W82 A;  1VZ7 A;  3RUI B;  3GB1 A;  1JRU A;  2YEP B;  1AWD A;  1WX7 A;  3SD5 A;  4HK2 A;  3EGR A;  3MP9 A;  1YJ1 A;  3BIN A;  3W2D A;  2A5U A;  5DPR A;  2HTM E;  4MH8 A;  4LLG M;  3C0R B;  3ZNG C;  2PJH A;  3IXS A;  3DBR B;  2VZK D;  3OAW A;  2L76 A;  2N9E B;  1FFU A;  2V9H A;  3A4R A;  2KNB A;  4KZ0 A;  3IAM 1;  1P98 A;  1XT9 B;  4YT0 B;  1FM0 D;  3LJ3 A;  1OTR B;  5KHO A;  4ZYS A;  2WXI A;  3Q8B A;  2CJN A;  1V5O A;  1JQ4 A;  1L0V B;  1P7F A;  1FXI A;  2O6V A;  5JHB A;  4MT5 A;  4AS1 A;  3N3K B;  3L16 A;  1HE8 A;  3VUY A;  1Z5S B;  3RNA C;  4AUQ C;  3ML8 A;  2KC1 A;  3V60 A;  2AYO B;  4IOI E;  4W9L A;  2N4F A;  3UIP B;  1WR1 A;  2CU1 A;  1SE4 A;  1GJZ A;  4WAA A;  1NI2 A;  4HXD A;  1N5W A;  3AH7 A;  4WQO B;  4OZC A;  1C4C A;  4YTP B;  1NYQ A;  4M0W A;  4ZRI A;  3ZQ4 A;  4LNO A;  4ANW A;  3UIO B;  3DVG X;  4NPN A;  3UI3 A;  2ON8 A;  1TKE A;  1H8C A;  2M0X A;  3AM9 A;  1L5P A;  1SIJ A;  4LTU A;  1BT0 A;  3SR6 A;  2UYZ B;  4EE2 A;  1EO6 A;  3DHH C;  1YMH E;  4DDI D;  4RCO A;  2KDB A;  3JSV B;  3Q3M C;  2HTH A;  3EA6 A;  1X1M A;  1K50 A;  4W9H A;  1UF0 A;  4KIK A;  2C60 A;  4HJG E;  2IO3 B;  3U7D A;  2KMA A;  5IA7 A;  1AW7 A;  1GC7 A;  3EC8 A;  3WAP A;  5MPO A;  2IO2 B;  4FHK A;  5BYS A;  2PVO D;  4LK0 M;  2Y3A A;  1A70 A;  2PTL A;  2MSE D;  4US8 A;  1XO3 A;  3TIX A;  1XLN A;  3OLM D;  1J0G A;  1QIL A;  1C76 A;  3MJ5 A;  1V9J A;  1NEK B;  2KC2 A;  4L1B A;  1D5X C;  1XCQ L;  3ECI A;  3QHT A;  3DBH B;  1WRI A;  2K6Q A;  1E8Z A;  2V3N A;  1V5T A;  4EEW A;  1CZP A;  1PUT A;  5DPW A;  4OW0 A;  1WGR A;  2DZK A;  2WYQ A;  4OHJ A;  4CO7 A;  3BII D;  3W1S A;  1LO5 D;  1UWM A;  1KTK A;  2KLC A;  1WE7 A;  3HUI A;  4WQM A;  3WCQ A;  3ML9 A;  4KSK C;  2H89 B;  2JWU A;  3RT3 B;  2R2O A;  2PKO A;  3PLU A;  2JXT A;  3KWV A;  4DBG A;  2MLB A;  1IUE A;  4RF0 A;  2LD9 A;  3RPF C;  3DOW A;  2RMM A;  4X57 B;  1E6E B;  1I7H A;  2LI5 A;  2BWE S;  3FIL A;  3ZXR A;  1P9D U;  1XD3 B;  1WXA A;  1PDX A;  2ZW0 A;  4JQW C;  3GE8 C;  2DNF A;  2Z8L A;  1T0Y A;  1WYG A;  2BTE A;  1D5M C;  1NVI D;  1HA5 A;  3LB8 C;  2I1K A;  3BZD B;  3UIN B;  2PEA A;  1C4P A;  4MAC A;  1VLB A;  4USA A;  1YQ3 B;  3FC4 A;  4TUU A;  2N9K A;  2O6V B;  1TTN A;  4MJS A;  4WJP A;  2J4X A;  2IYD B;  1H4R A;  2M0A A;  2QHO A;  1KJT A;  1ROE A;  1E0Z A;  3NZS A;  5FR6 A;  3QK0 A;  1WGH A;  3PTF C;  2KDM A;  4IM3 A;  2OED A;  1ZP0 B;  3VH3 B;  1DOI A;  2KQ7 A;  1QOB A;  2C9W B;  2LMC A;  3PZD A;  3T3N A;  2BYV E;  3BYT B;  2JXX A;  3MTN B;  1PFD A;  1WYW B;  3I57 A;  1LXD A;  2QSD A;  2O6V D;  1GPX A;  2M19 A;  3IFW B;  2IND C;  5EE0 A;  1N61 A;  3VR9 B;  3WAM A;  4AQ7 A;  2MWS B;  1E9M A;  2ICI A;  4E3C A;  4M8N A;  5EE9 A;  1MJD A;  4XX5 A;  4JE3 B;  4M0W B;  5D7G A;  4WWM A;  2DYM A;  3NJT A;  4B0E A;  2RDH A;  3Q8C A;  4NQK E;  2DYB A;  1G6J A;  1GG3 A;  2CS4 A;  1AAR A;  1JWB D;  3EFU A;  1K8R B;  2SEB D;  2WXM A;  2V1Y A;  3DQV A;  3NOB A; 
#chains in the Genus database with same CATH homology
 1RYJ A;  2XNA C;  3SFD B;  1ENF A;  1TS3 A;  2J42 A;  2JX5 A;  2WXF A;  1UUP A;  2NMQ A;  5BMH A;  1FNU A;  2FBW B;  1R7S A;  2LGI A;  1C4A A;  5T8I A;  4ARC A;  1JW9 D;  3LYY A;  1VZ6 A;  4HKZ E;  3R8B A;  2WXG A;  1QOF A;  1C9F A;  1SE2 A;  3NZ3 A;  2MJD A;  2JZP A;  2BB6 A;  5HFY A;  4Q2J A;  2AX5 A;  1T6B X;  2AQ3 B;  2IGG A;  3AE7 B;  1ZDX A;  2WQY B;  3ZJT A;  2KWD A;  1WXQ A;  3ETR A;  2W3R A;  1BML C;  1DYQ A;  1QF6 A;  4ITK A;  2ACZ B;  1BUI C;  3PO0 A;  4KKI A;  2WNM A;  3Q69 A;  4N59 A;  3MHZ A;  3TEX A;  2WDQ B;  1NEN B;  4TSS A;  5HI1 A;  1SJH D;  1J7A A;  1HZ5 A;  1VRA B;  1ET9 A;  2LFI A;  5HG2 A;  3FAH A;  3B2F A;  3TEZ A;  2M56 B;  3BK2 A;  4XWW A;  3R2I A;  3PZ8 A;  2OHF A;  1XF5 L;  4O1N A;  1UNS A;  1VDV A;  3TUO A;  2H88 B;  2N7J A;  1D4B A;  3AEC B;  4HRS A;  2JYE A;  3ZJV A;  2JQR B;  1GOZ A;  5C2T B;  2K3U A;  1JWA D;  1PGB A;  3BVG A;  3ABV B;  3U2S C;  1QLB B;  2KQ4 X;  1N62 A;  3AMZ A;  2W54 A;  1TS5 A;  2BYT A;  4DQO C;  2L83 A;  1SJE D;  2IGD A;  1L0Y B;  3SFE B;  3P4P B;  3P4R B;  1SSN A;  1JWU D;  2BS2 B;  2WLB A;  2XN9 C;  3I9V 1;  2WXQ A;  1SXT A;  1HZ6 A;  2HDE A;  5H8Y E;  3HVD A;  5FK9 C;  3ZGZ A;  4HKQ A;  4GDL B;  4YSX B;  2D5G A;  1SE3 A;  1NI3 A;  1JAL A;  2L32 A;  2J52 A;  1CQV A;  4XWT A;  3EUB 2;  2WXO A;  2N9L A;  1SF0 A;  4YWG G;  3P42 A;  3P4Q B;  4WAF A;  1K52 A;  2RDG A;  4PT5 A;  2IJ0 A;  3AE6 B;  4ZRQ A;  2KAC A;  4R3D A;  4NAW B;  1FNW A;  1JCK B;  2LUM A;  3AB5 A;  4B0M A;  1WWT A;  3FIL B;  2DWQ A;  1RWS A;  1TYG B;  4XDD A;  1JML A;  1ZE3 D;  3N9Y C;  1V1P A;  1D6E C;  3P1M A;  3NUH B;  4N58 A;  2ONQ A;  1XCT L;  3R2T A;  3VRA B;  1ZUD 2;  4A6Q A;  4C80 A;  4ZOH C;  1KLG D;  2WXR A;  4NAM A;  3TEW A;  1F2R C;  1MHX A;  4YSZ B;  5AUK A;  1ZXH A;  1I4H A;  3U4E G;  4KKJ A;  4P6V F;  1Q10 A;  5BYQ A;  1CK1 A;  1RFK A;  2W82 A;  1TY0 A;  1VZ7 A;  2G9H D;  2WXN A;  4YXD B;  2TSS A;  3AE2 B;  3GB1 A;  2YEP B;  5G5G A;  1AWD A;  2I2Y A;  3L4P A;  2WP9 B;  4XDC A;  3EGR A;  3MP9 A;  2I38 A;  4NJC A;  2EKI A;  3W2D A;  1YNT E;  2HTM E;  3BVM A;  1ESF A;  4MH8 A;  4CQN A;  4H2A A;  1N60 A;  4LLG M;  1QOA A;  2K0P A;  3IT4 B;  5LNK 1;  2LHE A;  3TEY A;  3IXS A;  2IPK D;  2INP E;  3Q8E A;  4HRO A;  2DBY A;  1PGX A;  2JYT A;  2VZK D;  3GP7 A;  4RNA A;  1FFU A;  2QIL A;  1TS4 A;  4HEA 1;  3IAM 1;  1F2R I;  5BYR A;  3NRZ A;  2ZW1 A;  4YT0 B;  1FM0 D;  4YTN B;  2LEK A;  1C78 A;  3E56 A;  3P4S B;  3H8H A;  1C77 A;  1XXG A;  4RGO S;  2WXI A;  3Q8B A;  4US9 A;  4ZYS A;  1TY2 A;  1K51 A;  2CJN A;  1XLQ A;  1JQ4 A;  2EEL A;  2E6X A;  1L0V B;  1P7F A;  1FXI A;  3AN1 A;  2YEP F;  3AED B;  1I4R A;  2WXK A;  4MT5 A;  4AS1 A;  2KAJ A;  1FEH A;  2WXJ A;  2Y5P A;  2BT6 A;  2AQ1 B;  5GXG B;  5FR3 A;  1J7B A;  3AEG B;  4A8X C;  4REZ A;  3BVZ A;  5AUI A;  1QOG A;  2CU3 A;  1MHH E;  1L6V A;  2K22 A;  1YN5 A;  4RGM A;  1GB1 A;  1J7C A;  1L0X B;  2GI9 A;  2SAK A;  5G5H A;  2WS3 B;  3AE4 B;  3IT6 B;  4IOI E;  2R61 A;  2IDY A;  4OVZ A;  1SE4 A;  2PLP A;  3V05 A;  3MFG A;  3W5V B;  1AN8 A;  1WGK A;  3URY A;  4RF1 A;  4C56 C;  4WH4 A;  1MPE A;  5BMG A;  3CIR B;  1IGC A;  1TKG A;  1QT9 A;  1AYF A;  2QMT A;  3O13 A;  1V8C A;  1N5W A;  3C8Y A;  4XE0 A;  3U7Z A;  4NZL B;  3AE1 B;  3AH7 A;  4A90 A;  1ZPS A;  2K9X A;  3SEB A;  4ZRP A;  1FRD A;  4OZC A;  2QEJ C;  4YTM B;  1C4C A;  4YTP B;  1NYQ A;  4M0W A;  3ZQ4 A;  1SB3 C;  2BS4 B;  3AE5 B;  3Q8A A;  1KF6 B;  3UI3 A;  1ZOY B;  4J3O D;  1I4Q A;  4KGT A;  2NTT A;  2ON8 A;  4ARI A;  1DOX A;  1NYR A;  1TKE A;  1FNV A;  4KGR A;  3AM9 A;  3HRD D;  2V0G A;  4ZHO A;  1I4G A;  4GLS C;  1L5P A;  1SIJ A;  1TJE A;  4LTU A;  3SR6 A;  1VR9 A;  1IBX A;  1QKZ A;  4EE2 A;  1YMH E;  1HEZ E;  4RCO A;  3DWM A;  3AEA B;  2B76 B;  2IGH A;  2KMM A;  4RFB A;  4DXG A;  3VRB B;  1V97 A;  5JXV A;  5EE1 A;  2FE8 A;  2K5P A;  3VR8 B;  3EA6 A;  1K50 A;  2E3T A;  4UDU C;  5EE3 A;  2DLB A;  4IDI A;  1E10 A;  1TS2 A;  2AQ2 B;  4TQ1 A;  4HJG E;  5I4D A;  2BW2 A;  1AW7 A;  2MJE A;  1ZDV A;  2RPV A;  4KX6 B;  5MPO A;  3AE8 B;  1STE A;  5BYS A;  2PVO D;  4LK0 M;  3HVZ A;  3AEF B;  2Y3A A;  1A70 A;  2PTL A;  3E9S A;  2WU2 B;  1YQ4 B;  3KWL A;  4US8 A;  2WXL A;  1P7E A;  4OZB A;  1XO3 A;  3KQ4 A;  1XLN A;  1K53 A;  3IAS 1;  1BXT A;  1FFV A;  1QIL A;  2GB1 A;  1C76 A;  1KFY B;  3MJ5 A;  1JWM D;  1T5X D;  1FIQ A;  1NEK B;  3GS2 A;  4L1B A;  3KLS X;  1QQR A;  2MJ3 A;  4KGS A;  4GDK B;  1D5X C;  1VJK A;  1XCQ L;  3BK1 A;  2FUG 1;  1WRI A;  2V3N A;  3BYY B;  2BB5 A;  3V3X A;  1OQQ A;  5TSS A;  1VZ8 A;  2PMV A;  1CZP A;  1PUT A;  1KRH A;  1XLO A;  2BS3 B;  1V1P B;  5D3D A;  4JWS C;  4OW0 A;  2N0S B;  3T3O A;  1TKY A;  1OQR A;  1ACC A;  1PYW D;  4OHJ A;  4L2Y A;  1FO4 A;  3BII D;  1IGD A;  3W1S A;  4IKG A;  1LO5 D;  2KN4 A;  3ZJU A;  1UWM A;  3P63 A;  1KTK A;  3HUI A;  4WQM A;  1DGJ A;  4TMA B;  3WCQ A;  3AEB B;  2QJL A;  2W3S A;  1HXY D;  4YSY B;  4TQ0 A;  2H89 B;  2JWU A;  1FD6 A;  2WDR B;  1WSP A;  1OFF A;  2PKO A;  2JXT A;  3KWV A;  2G1E A;  1MVK A;  2WU5 B;  2JSV X;  3DWG C;  1IUE A;  1EM7 A;  4RF0 A;  4JWU C;  1F77 A;  1B1Z A;  1FCL A;  4ZHP A;  3RPF C;  1FRR A;  1FXA A;  2RMM A;  2WXP A;  1E6E B;  1HQR D;  2MEK A;  1I7H A;  1UGJ A;  4WIP A;  3AE3 B;  3FIL A;  3CWI A;  2W55 A;  4N6E B;  3ZYY X;  1N63 A;  1YN3 A;  1F0Z A;  1L4D B;  1ET6 A;  3BWU D;  1PDX A;  2X38 A;  1I4X A;  2MH7 A;  2ZW0 A;  3NVW A;  4C7Z A;  5C3J B;  2Z8L A;  1WYG A;  2V3P A;  3NVY A;  2BTE A;  1GB4 A;  1D5M C;  1NVI D;  1RM6 C;  1HA5 A;  3LB8 C;  5FKA C;  3RFZ B;  1XEE A;  1KLU D;  3BZD B;  1M4V A;  1C4P A;  4MAC A;  3W5U B;  1VLB A;  3OWE B;  1YJJ A;  4USA A;  2L52 A;  1JRO A;  1GAQ B;  2WXH A;  1YQ3 B;  3FC4 A;  2PW9 A;  2N9K A;  1YJI A;  2JU6 X;  2WDV B;  2LJI A;  3AEE B;  4RH6 A;  1EWY C;  2J4X A;  5HHD G;  5BMI A;  2PIA A;  2M0A A;  1CJE A;  1E0Z A;  1ROE A;  1DOY A;  1FCC C;  3MC0 B;  2BBC A;  2KDM A;  4DXF A;  3J9C A;  2OED A;  1ZP0 B;  1YN4 A;  1DOI A;  2LMC A;  1QOB A;  3T3N A;  1EWC A;  3Q8F A;  1N5X A;  3BYT B;  2NTS A;  3NS1 A;  3NVV A;  2CJO A;  3NVZ A;  1E7P B;  1PFD A;  1L6U A;  3I57 A;  2QSD A;  5E6J A;  4D2K A;  1V1O A;  1SEB D;  4C7Y A;  1B9R A;  1GPX A;  1C79 A;  1UWX A;  2M19 A;  1EU3 A;  2LHD A;  1ZXI A;  3VQI A;  3AE9 B;  5EE0 A;  1N61 A;  3B9J A;  3VR9 B;  1EU4 A;  3U52 E;  4AQ7 A;  4RGT A;  1FMA D;  4WUR A;  3W9C B;  1E9M A;  2ICI A;  1TZO A;  4FXC A;  3AV8 A;  5EE9 A;  4MM3 B;  1SBB B;  1JRP A;  1KH0 A;  2L1A A;  4JE3 B;  5D7G A;  2V4I B;  1MI0 A;  1Y56 A;  1D5Z C;  1I4P A;  4WWM A;  2DYM A;  2PVG C;  5D3I B;  4JX1 C;  4B0E A;  2RDH A;  3Q8C A;  1XLP A;  2Q5W D;  1T3Q A;  2INN E;  3TSS A;  4A9A A;  2J53 A;  5H92 C;  2VZK B;  1JWB D;  4JPS A;  4P16 A;  3B2G A;  2Y5C A;  4RGN A;  4A55 A;  3PZ7 A;  1PGA A;  2SEB D;  1JWS D;  2GRI A;  2QIE B;  4L23 A;  2WXM A;  1IBX B;  1L4Z B;  4OZA A;  3LXF A;  2DYO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...