3LYYA

Crystal structure of the mucbp domain of the adhesion protein pepe_0118 from pediococcus pentosaceus. northeast structural genomics consortium target id ptr41a
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
102
structure length
102
Chain Sequence
THATSTETIHYVNEDGDQVFEDGGGKLDFTRTVTIDDVTNEVVEYGEWTPVTDDEFAAVTSPDKDGYTPDTSEVAAQKPDMTDGPDGTVKDVEVTVTYTANP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the MucBP domain of the adhesion protein PEPE_0118 from Pediococcus pentosaceus. Northeast Structural Genomics Consortium target id PtR41A
rcsb
source organism Pediococcus pentosaceus
molecule tags Cell adhesion
molecule keywords Adhesion exoprotein
total genus 17
structure length 102
sequence length 102
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17966 Mub_B2 Mub B2-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.460 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3lyyA00
3LYYA 3Q69A 4MT5A 3NZ3A 3I57A 2LFIA
chains in the Genus database with same CATH superfamily
5CX3A 1GJZA 2CJNA 4YWGG 3HM3A 1SE4A 4JWUC 2JYEA 4IW0A 1D5MC 1YJ1A 3ZUNA 2EMSA 2O2VA 2OJRA 3GP7A 4YSYB 1TZOA 5AZGA 4KGSA 4LNKA 4IOIE 5G55A 3H7PA 4H2AA 1L0YB 3WALA 2OOBB 2N9PC 4BKGA 1WF9A 1OQRA 2DBYA 2HJ8A 1SEBD 3LYYA 3ZTCA 2KX0A 1RAXA 4A3OA 2YEPB 2Y5BB 3GZNI 1WFYA 4MGIE 2AQ1B 2AYOB 1VCBA 1RFKA 3QC8B 4WJPA 4WJQA 1P3QU 4W9KA 4I6NB 1WX8A 2ZCCA 4YTNB 2N1VA 4MELA 4JWSC 2PPHA 2VH2A 3H6NA 3PLVA 2ZEQA 4FBJB 2WGSA 1XLPA 4B0EA 1J19A 1N6ZA 2LHEA 4CYEA 2ZNVC 4C4VB 1OGWA 2W9NA 4ITKA 1C9FA 1F0ZA 2V3NA 1HEZE 2N9KA 2ACZB 2L1AA 2MLBA 2EELA 1WZ3A 3KUZA 2INPE 4L1BA 2ZW1A 1TZ1A 3ZIMA 2KVRA 1X1MA 1ISNA 3VH3B 1Z2MA 4YT0B 2HDEA 3H7PB 1V97A 2DAJA 4GIVA 4NNJB 1KFYB 3I3TB 2QCZA 4ZHPA 4NJCA 1XLOA 2NBUA 4CHKA 3BIID 1IBXB 1S1QB 2N4FA 3P4SB 1YJJA 2IO2B 5LXIB 4FHKA 3TCAA 1K51A 1RRBA 1PGXA 4NAWB 1BMLC 2D3BA 3PO0A 3VUYA 2NR2A 4CO7A 1WJ4A 2Y5PA 2MWSB 3PRMB 2V3PA 2WX0A 2K9XA 2CS4A 2KC1A 3SDLC 4NJ7A 4BOZB 1VZ6A 3WAOA 2KLGA 3VRBB 4JQWC 2N7DA 1ZXHA 5IN7A 1B1ZA 3B9JA 1TBEA 4JGHB 1SE3A 2RGFA 1JALA 1GC6A 3AE8B 5AUIA 2L52A 1FFVA 1QT9A 4P1BC 2INNE 4C7ZA 3PZDA 2W82A 4GB9A 4BOSC 1IGDA 2R61A 1PGAA 5DCNA 1FXTB 1E9MA 3ZRCA 3Q3FA 1RFAA 2ICIA 1QOFA 3AEAB 1SF0A 1JWSD 5EDSA 5D94A 5D3DA 4DXGA 4FULA 3AMZA 3MHSD 2J0JA 3VRAB 3IT4B 1WXVA 1KOTA 1EF1A 3P2BA 3KQ4A 2JZZA 2JQRB 4K7SA 2DHZA 2WS3B 3AULA 1NYQA 2N0SB 4UDUC 2J42A 2LXAA 3CSFA 4WJNA 4LNOA 2DYMA 2PIAA 3N3KB 2DAFA 1MG4A 3GOEA 3KLSX 2G4SA 2GBJA 3L54A 3UINB 1WMHB 5JHBA 3ML8A 4RGNA 4MH0E 4ICVA 2WXGA 2WQYB 3DHHC 3T8MA 2J4XA 2HD5B 5HG2A 2IZVB 3VDZA 4XWTA 4C7YA 3E56A 2ZCBA 1XO3A 1AWDA 1WGHA 1HE8A 4GGQA 2K5PA 2H89B 2NCNA 2BWES 5J18A 4MSQB 4YTMB 1GOZA 1XLQA 3N1XC 5IOIA 4GLSC 1MI0A 4AOFA 2KTRB 3QQ8B 1WGDA 2LRUA 1Y56A 4KGRA 4B95A 3IVFA 1TIFA 5KHOA 1XT9B 2MJEA 1WX7A 1VZ8A 2M17A 4BZAA 4HDQA 2G1EA 2IYDB 1ACCA 3BK2A 1ZP0B 1G6JA 1TS4A 3QK0A 2VRRB 2AQ3B 2LUMA 1JW9D 3AEDB 5AZHA 1K8RB 3DQVA 4MEMA 4RF0A 3IT6B 1SXTA 5FKAC 4DHJD 2L00B 3NG0A 4LTUA 2BVCA 4IKGA 3FILA 4LNNA 4MSMB 1P7EA 3FAHA 3DOWA 3LXFA 2LVPA 3V62A 1NEKB 3DHGC 1FIQA 2BYFA 2PJHA 4AJYB 1BUIC 4DBGA 2IO0B 2KJHB 2XK5A 3ZQ4A 4IWQA 3UIPB 2KXJA 3N1ZC 3I57A 2DENB 3RMKC 1V9JA 2K8HA 3I9V1 4PK1A 1Z5SB 2KTFA 2WP9B 2K1FA 1CMXB 3IBEA 2JWZA 3TEXA 3T3NA 4ZRJA 2KTRA 1WR6E 2MSED 3L16A 4IC7B 2WXMA 1E0ZA 4C00A 1AW7A 2IGDA 4LDTB 1WSPA 3Q6BA 1ZE3D 4WJOA 3MC0B 2LJ5A 2CU1A 3SFEB 2C9WB 4M8MA 2GMIC 2ZPYA 2BYVE 2VZKB 4JE3B 4M0WA 2D5GA 3RNBC 3TL5A 2MA9B 4NQLB 3ZTDA 1F77A 2MX2A 2EKEC 3K9PB 1LO5D 2CHXA 3DWGC 1FO4A 3RN9C 2R2QA 2I1JA 3DVNU 2INCC 1JWMD 1WRIA 5TSSA 5H92C 3ZNHB 1YN4A 5HKHA 3DBRI 1HA5A 1M94A 1IBXA 3ZNZB 1RLFA 3DBLB 4TUUA 3AE6B 3IXSA 1L7YA 1WR1A 1QF6A 1V5TA 4I6LB 4NJ6A 3R66C 1V49A 1N63A 4L2YA 1XF5L 3X23A 1TKGA 1H8CA 1E8YA 1T0YA 4FJYA 1Q1OA 1E7VA 3TEWA 2KDFB 3OG5A 2NVUI 3P63A 4OHJA 3AEFB 3Q8CA 4EZKA 3M95A 1LM8B 2WXPA 3MTNB 2HE7A 4AP4C 1KM7A 3DVGY 1YX5B 1GB1A 3N20C 2OEDA 4GMVA 5JHAA 2TSSA 5G5GA 2KMMA 3VR9B 3DVGX 1WX9A 3CMMB 5BYSA 2BWFA 3AE1B 5CHFA 4DWFA 2KYWA 4JLCA 3P4RB 1FMAD 2PE6B 1ZUD2 2Y3AA 3OWEB 3A9KA 3NOBA 2KDMA 1WXAA 4IDIA 2WU2B 4KGTA 3W1SC 3U8ZA 4HEA1 3AEBB 4GU2A 4ANWA 4KX6B 5AEKB 1WJNA 5E6NA 2BS3B 1OEYA 4BAXA 3EC8A 1YMHE 2XEWA 4PT5A 4N58A 3VQIA 1U4AA 4ZRPA 3ZDTA 2FE8A 4XWWA 2L0FA 5HHDG 3KWLA 4WH4A 3OJ4B 4W9FA 1QOBA 1FCCC 2MRPA 4EZJA 3MJWA 3QJZA 1HZ6A 2RR9A 2DWQA 3EFUA 4IM3A 3Q3JA 3SEBA 1E8WA 3U52E 2B76B 2MHJA 4KKIA 3PT2B 1SGHA 4A20A 1ENFA 4ZRKA 2LGIA 4GN1A 4EZLA 3U7DA 4W9LA 2NTSA 3UGBB 4JPSA 2QSDA 3R7QA 3KH0A 4GDKA 2FCNA 2RPVA 2A4ZA 4M01A 2JYTA 1I42A 2L7RA 3AU4A 2ZNVB 3ZJVA 1FRRA 3W1YA 1CZPA 2BS4B 1AARA 1HQRD 1XQQA 4IUMB 3ZRFA 3WAMA 1TTNA 2BB6A 1HTQA 1RYJA 1I35A 1T0RC 1J7BA 2IY0B 4WWOA 2K8CA 2KJRA 5C3JB 4LNIA 4XGAB 4ZHOA 2KMCA 3JSVB 1WH3A 4DXAB 2KNBA 1YNTE 3KUDB 5LLIA 3ZW3A 1KLUD 3VVWB 2N9EB 2GLSA 3C8YA 4US8A 1C78A 5HI1A 1TY0A 1EWCA 1FPYA 1V6EA 2DZKA 4C80A 2E6XA 1PUTA 2M0XA 1R4MI 2DZIA 4II3B 2PE9A 3SD5A 1WYWB 1UGJA 3P4PB 1T0SC 2BB5A 3IHPC 3KUCB 1WJUA 1TYGB 2BS2B 2AWTA 3Q8FA 3W9CB 3RCZA 3NVYA 5EE0A 1BT0A 3GE3C 2QDFA 1I4RA 3PZ7A 1L0VB 2RMMA 5JXVA 2KAJA 3I63C 2JY6A 4HJGE 3M62B 3P42A 4OVUA 1C77A 4NPNA 3QA8A 4HKQA 2PTLA 1E7UA 3U2SC 2I1KA 1DOXA 2MCNB 3VTVA 2LASA 3AI5A 1JWAD 2J0KA 3RNEC 1YQBA 4A90A 1C3TA 1ZW7A 3NZUA 3UF8A 1FM0D 1EUVB 1YQ4B 1IP9A 2JVCA 3RULA 3M63B 4KZ0A 4IWOA 2KDEB 3O13A 2JPHA 2NPTB 2KHWB 2ZVNA 1WE7A 3NVZA 1XCTL 1ZDXA 4HPMB 4HXDA 2A5UA 1CJEA 1SJED 3V60A 3AXCA 4HWIB 2Q5WD 2PW9A 4XDDA 2LMCA 2KD0A 4GXBA 2KQ7A 5EE9A 4LK0M 5TR5A 1QKZA 4OZBA 2KLCA 3BZDB 2INDC 1R7SA 3EHVA 5BO4B 4AWJA 3SHQA 3OJ3A 2O2VB 4HRSA 3R8BA 5D2MB 4MJSB 1A70A 1E6EB 3ZNID 2I2YA 4DHJB 1P98A 5BMIA 4N6EB 1UWMA 4OVVA 3IFWB 3VFKA 2AQ2B 2ZJDA 2W3SA 2C5LC 2MBEA 1VZ7A 2CHWA 4KZCA 1KF6B 2WDQB 2QMTA 3AE3B 2K6QA 1V5OA 2MP2B 2V9HA 2WXIA 2CHZA 4LLGM 3AE9B 2D10A 3ZYYX 2C60A 2MBQA 2CU3A 5FK9C 2LJIA 5EE1A 2AEHA 2E3TA 2MP2A 1KJTA 4GDLA 2WWZA 1EU4A 3NY5A 2QILA 5AUKA 3HHMA 1GNUA 1OTRB 3LDZE 2J0MA 2FCQA 2FIDA 3L0WB 1BXTA 4TQ1A 4G3XB 2KK8A 1WGYA 3EA6A 5H8YE 4W9EA 3U30A 1V81A 2FAZA 1N5XA 2BKFA 3TJPA 4USAA 1YQ3B 1N62A 1ZPSA 4PYUA 3ML9A 1XXGA 2MJDA 4RGTA 2IO1B 2WXLA 4MH8A 1WXMA 4K81A 4G11A 4TSSA 4WAFA 1V8CA 3CF6E 2GBRA 1VR9A 1WGGA 3DBLI 2DYBA 3NUHB 4W9GA 2V0GA 4US9A 1N61A 3B08A 3AE7B 1PFDA 4J3OD 4OZAA 1XCQL 1LXDA 3MC9A 1DOIA 2JXXA 1EM7A 4EFOA 2BPSA 3R2IA 2JX5A 3L17A 4MM3B 3Q3NC 4Q2JA 1SE2A 2FUG1 2LI5A 2R2OA 3PGEA 3PLUA 1MFWA 1WXQA 1JMLA 1PDXA 5C1ZA 2N9XA 4YSXB 4KIKB 2KWCA 3URYA 2D2QA 5E6PA 4W9CA 4OZCA 5I4DA 4RM8A 2KJ6A 1VDVA 1V80A 2IBIB 4LJPB 4M0WB 3RFZB 1QOAA 3HUIA 1I7HA 3AEEB 2LFIA 2K6DB 4MGKE 2UU7A 2K3UA 1UWXA 1UH6A 3FC4A 1SJHD 3A1QA 2O6VB 5IAAC 1GAQB 4ZRIA 3DBSA 1NDDA 2KWVB 1I4HA 2BW2A 4JX1C 2VH1A 3IAS1 3HIZA 3ALBA 1MHHE 2KVZA 4B0MA 4FADA 1FXAA 3WCQA 3LB8C 4PS7A 1YN5A 2IGGA 3ZJTA 2M19A 2GBKA 3WA0A 3Q3OC 1WGRA 2DYOA 2BTEA 4DK5A 3AN1A 1F9JA 2KQSA 2BT6A 2MW5A 1VJKA 2DLBA 1OQQA 1WJ6A 4QAYA 2GB1A 4B6WA 2RPQA 1YD8U 1DGJA 2PKOA 3ETRA 1L6VA 1ET9A 1SE9A 1WI0A 3ABVB 4KIKA 3A4RA 1WXSA 1NI3A 2WDVB 2WXNA 4HPPA 4RF1A 2D3AA 2ZPNA 2MBBB 1WMHA 4O1NA 3RNGC 1OEYJ 2WXOA 4N9F4 1WYGA 3NZ3A 1MJDA 4NAMA 5BMHA 2D3CA 3AE2B 3O65B 1C1YB 2K8BA 3RNAC 2K25A 3L13A 1JWBD 4AUQC 1MVKA 3AECB 5JH5C 4ZDVA 3NS8A 4II2B 4BVUC 4JIOU 4WQMA 3ZKJC 4FN2A 3RNFC 2WU5B 4LCDE 1P9DU 2V4LA 2GI9A 4BKSA 2WXFA 3MC8A 3S2AA 3ZDMC 2M4NA 4DDID 4URKA 1QILA 4K7WA 4ANXA 2K39A 1CK1A 3PRPB 3HRDD 2LXCA 4TQ0A 3B2GA 3R3MA 2KFKA 5L83A 5CTRC 3L08A 2Z0EB 2FBWB 5FR6A 3J9CA 2MJ3A 4P7IA 4FJZA 2YVCA 1TS5A 1HZ5A 2JWUA 3AV8A 4ARIA 1F52A 4HVBA 3APFA 5J17A 2K0PA 1I4GA 2JRIB 1R4NI 4MJSA 3Q8EA 4OVZA 2G45B 2NTTA 1IGCA 3RZFA 4IM2A 2IDYA 2LGSA 3DBHB 4NAWA 2AL3A 2Z0DB 3AE4B 3BYTB 3N30A 1NBFC 2PVOD 1Q10A 2JT4B 2KWDA 2JXTA 1NYRA 1GUAB 2C7MB 1MG8A 3ENEA 1S3SG 2CR5A 3H7SA 1D3ZA 3KW5B 3R2TA 2J52A 1Y8RC 4G0NB 4J6IA 2FNJB 4CQNA 2EKIA 4ZYNA 3PSEB 3U7ZA 3QAQA 4IWPA 2RDGA 4TV3A 4TKNA 3W2DA 3A9KB 4ANVA 1FD6A 1I4QA 2L3ZA 1ZKHA 3C0RB 1PQSA 2JUOA 3MP9A 2QJLA 1KLGD 4W9HA 2AX5A 3QWZB 4MT5A 4AS1A 5LNK1 1YIWA 3Q69A 3KWVA 2RD0A 1WM3A 3QARA 1JQ4A 2X8XX 4XYCA 1J8CA 1ROEA 2FUHB 5EE3A 1TT5B 3D32A 3Q8AA 3TMPB 3H9DA 2QHOA 4EOYA 1MPEA 1AN8A 2WXJA 2CKHB 2IPKD 2LZ6A 3BY4B 5MPOA 4KDLB 1GB4A 3AM9A 2KT7A 1T6BX 3AB5A 4YSZB 1XEEA 1I4PA 4M8NA 4GDKB 4YXDB 1SB3C 3VAWA 5FR3A 3TIXA 3VUXA 3HVDA 2H88B 2NBWB 4HCNB 2LHDA 3PHWB 3W5VB 3CSTA 1ET6A 4HPLB 1JWUD 4FA6A 1HXYD 5E6JA 3A1QB 4C4VA 3A33B 1TGZB 4MM3A 1VRAB 4XDCA 2IY1B 2KN4A 2EMTA 3DPDA 4G50A 3KYDD 4M02A 3T9LA 3V05A 1WM2A 4JL9A 2BF8B 4XC2A 3Q14C 3T3OA 4ZYSA 4REZA 1F2RI 4PS8A 1SBBB 4RCOA 5D7GA 3NZSA 1L0XB 2KX3A 4TMAB 3RYTA 2OJWA 1FFUA 2VZKD 2M56B 4BKSD 3Q2AC 4RNAA 3NRZA 1YOVB 1C79A 4K1RB 3GS2A 1FNVA 1XD3B 4KVGB 2KKCA 4GDLB 1WIAA 3MFGA 2ZW0A 2V4IB 3UIOB 3ZXRA 1L2NA 4S0RA 3QX1A 4FLHA 4WQOB 3A4SC 2LGYA 1UF0A 3PPAA 2AL6A 2QIEB 3ZLZA 5DPRA 5BYRA 2PVGC 2FCMA 3DWMA 1EF5A 2OHFA 2W55A 3OAWA 3APDA 1UBIA 3DHIC 3L10B 2LVQA 1LFDA 4BKTA 3RD2A 3RPFC 3IAM1 4E71A 3C19A 3NHEB 1FRDA 2YEPF 5AZFA 4BBNF 1M4VA 2LGXA 3BWUD 1SSNA 4S17A 1YJIA 2NPTA 5C2TB 4AJWA 2KDBA 3N9YC 2WDRB 1TKYA 2BKRB 2PMVA 3RZWC 4NQKE 3I5JC 4P6VF 4XZ4A 2KFKB 2XNAC 4LNFA 3UQAA 1UZXB 4KDIC 3VTWA 3IG3A 1CQVA 1AYFA 4ZRQA 4IM0A 2KACA 1V1OA 3BINA 2WNMA 3DDCB 4EUTA 3H8HA 3B1LX 1T3QA 4HDOA 2LGDA 2JF5A 3VUWA 3JYUA 3VHTC 4K7UA 2WLBA 1KTKA 3WAPA 1ESFA 4A8XC 4LDTD 1NVID 1PGBA 4BFRA 3AEGB 5BMGA 3PHXB 4F7ZA 5JZEB 2G4DB 1JROA 3BYYB 4DHZB 2NBVB 2KQ4X 3QCAA 1N5WA 2JRHA 4W9IA 3P4QB 4GOCA 1KRHA 3WIMA 1UNSA 1QZEA 4WWPA 3L4PA 4HCPB 3DBHI 4YTPB 4KKJA 4MDKE 4F8CB 3A9JA 1D6EC 2JZPA 3VTUA 2W3RA 1ZOYB 5BYQA 3SU8X 5IA7A 2L0TA 1WGKA 1FEHA 3ZO5B 4ASWC 3EECA 2V3SA 3APCA 4A3PA 3FKYA 1V1PA 3CIRB 1J7AA 3VXWA 2XN9C 1R4MB 1F2RC 2N7JA 1SIFA 1C4CA 2WXKA 1GG3A 4W9JA 2GBMA 2ASQA 3MHZA 2GOWA 1JRUA 2MH7A 2ZZPB 2IGHA 4HKZE 5CHWA 1EU3A 1NI2A 4C56C 4MACA 3GZNB 1Q0WB 2IJ0A 3QHTA 5CHVC 1OQYA 2M8SA 4I6PA 2GRIA 1WE6A 4ACFA 1TS2A 1L4DB 2NS5A 1V86A 3N1YC 2L83A 2MBHA 2HJ1A 4WWMA 1RM6C 3SFDB 3PRZA 2RDBC 2KN5A 2O6VD 2LUEA 2PEAA 2D07B 2KO3A 1K53A 2MEKA 4HK2A 4GSWA 5IKCM 3NJTA 3BVMA 3X0WA 1P0RA 2M0AA 3ZNGC 1QLBB 2KC2A 2V1YA 2JSVX 1RWSA 5D3IB 1Q5WB 2WYQA 4LJOB 4HJKA 4FXCA 2Y5CA 2C7NB 3MJ5A 3OLMD 3BK1A 3KYCD 2LWPA 3V6EB 4YL8A 2UWQA 1FNUA 3WANA 1XLNA 3R7RA 2DX5B 5DPSA 1E8XA 3GB1A 2KWUB 1MHXA 2I38A 4A55A 3PTFC 1NENB 2LD9A 4K3CA 1V2YA 2SEBD 1A5RA 2JZ3B 3ZVVA 4W9DA 1K50A 3AU5A 4KSKC 3TEZA 2ON8A 2WXHA 4F1SA 3PVLA 4EEWA 3ZJUA 4P16A 5GMVA 1UBQA 4A9AA 4EKUA 3M3JA 2N9LA 4DDGD 3U4EG 2FIFA 3CWIA 4HROA 2X38A 2KOXA 2QEJC 2BQQA 4XE0A 2B3AA 2HTME 1C76A 1UUPA 1SIJA 2L05A 4WIPA 2UYZB 5KHQA 1KLVA 4RGMA 3SR6A 2JU6X 4OW0A 1JCKB 4L23A 5G5HA 1DYQA 1STEA 5C23A 4BBNC 3JSVA 3W5UB 1LGRA 1T5XD 2REXA 5G2NA 2NMQA 3HK0A 3Q3MC 3UQBA 2RDHA 4ICUA 2FCSA 4E74A 3QIJA 1JRPA 4MGZE 3AH7A 4NZLB 2IO3B 3UI3A 4DHZE 1E5WA 4MGYE 1H4RA 1WZ0A 2ONQA 5IO9A 4K3BA 3ZGZA 3NS1A 1P1AA 1L5PA 1FCLA 4AQ7A 2MQJA 1D5ZC 1WY8A 1TS3A 3RT3B 3TSSA 4B9KA 4WURA 1IPGA 1ZGUB 5L95C 4A6QA 1C4AA 3B0AA 3HVZA 4RMAA 1GPXA 3EUB2 3VR8B 4RM9A 2YLMA 4RH6A 1YN3A 1ZDVA 1I4XA 2HTHA 2WXQA 2L8JA 2D3GA 2KDIA 2CJOA 3N32A 2LEKA 2WHIA 1WRDB 1EWYC 1VLBA 1T0QC 2N1WA 5LXHA 2GBNA 1IYFA 3FILB 5DPTA 2K22A 2BBCA 4HLEA 4N59A 4DXFA 4RFBA 3DBRB 1FXIA 3H1UA 1QQRA 2D11A 2SAKA 1GC7A 3PV1A 2Z8LA 3JVZX 2QC8A 2DZJA 2WX1A 3RUIB 3PS6A 3E9SA 3ONSA 2J7QB 1L4ZB 1ZXIA 4D2KA 1KH0A 1EO6A 4M00A 3EGRA 3NVVA 4P1CC 1YX6B 2BGFA 1UGMA 1FNWA 1B9RA 1E7PB 2DNFA 4ANUA 1V1PB 2BYTA 1E90A 3AE5B 2M1MA 5IP4D 1PYWD 4FJVB 2DZMA 2G9HD 2Z59B 4XX5A 5T8IA 1LQBA 2L76A 4ARCA 3TBLD 1IUEA 2PLPA 2J53A 3EFCA 5J2RA 3V61A 4WWNA 1J0GA 5D6JB 4DQOC 3TUOA 2XBBC 2KANA 2KMAA 3A9JB 3Q8BA 2BYEA 4ZOHC 1C4PA 2LRWA 4R3DA 3BVGA 2WDTB 3NVWA 1D5XC 3B2FA 3V3XA 1E8ZA 3V6CB 4PYZA 2MBOA 1WWTA 2W54A 4X57B 3RI7C 2KZRA 2O6VA 4EE2A 3DVNV 1N60A 3JW0X 1J7CA 1HTOA 1UD7A 1F1HA 5HFYA 1R4NB 3ECIA 4KSLC 3P1MA 4RGOS 3GE8C 5GXGB 3K9OB 4FHJA 2LVOA 1TJEA 3RNCC 2KFJA 3ZXVA 4PS3A 4KV2A 1P7FA 2WXRA 1QOGA 2N7EA 3HM6X 2C7HA 2XK5B 1UELA 3TEYA 3VH4B 1TY2A 1VD2A 2L32A 1E10A 3DCGA 3KVFB 2G3QB 3BVZA 4WAAA 1D4BA 4E3CA 3PZ8A 5DPWA 3LJ3A 2ZVOA 1DOYA 3PREA 3W1SA 2RSUA 5E6OA 4NY0A 1TKEA 1OFFA 1L6UA 1K52A 4IG7B
chains in the Genus database with same CATH topology
3WCQA 4OHJA 2CJNA 1KRHA 3AEFB 3Q8CA 4YWGG 1SE4A 4JWUC 1UNSA 3LB8C 1YN5A 2JYEA 1D5MC 2WXPA 3L4PA 2IGGA 4YTPB 3ZJTA 2M19A 4KKJA 3GP7A 4YSYB 1TZOA 1GB1A 2DYOA 2OEDA 4KGSA 1D6EC 2JZPA 2BTEA 3AN1A 2W3RA 4IOIE 2BT6A 2TSSA 5G5GA 1VJKA 2DLBA 1OQQA 2KMMA 2GB1A 4H2AA 1ZOYB 5BYQA 3VR9B 1L0YB 5BYSA 3AE1B 1DGJA 1WGKA 2PKOA 3ETRA 1L6VA 1ET9A 3ABVB 1FEHA 3P4RB 1FMAD 2DBYA 1OQRA 1NI3A 2WDVB 2WXNA 1ZUD2 2Y3AA 1SEBD 3LYYA 3OWEB 4RF1A 1V1PA 2KDMA 3CIRB 1J7AA 4IDIA 2WU2B 4KGTA 4O1NA 4HEA1 2YEPB 2XN9C 3AEBB 2WXOA 4KX6B 1F2RC 1WYGA 3NZ3A 2BS3B 2AQ1B 1RFKA 1YMHE 4NAMA 5BMHA 4PT5A 2N7JA 4N58A 3VQIA 4ZRPA 3AE2B 1C4CA 2FE8A 2WXKA 4XWWA 5HHDG 3KWLA 4WH4A 1QOBA 1FCCC 1JWBD 3MHZA 2MH7A 1MVKA 4YTNB 3AECB 1HZ6A 2IGHA 4HKZE 4JWSC 1EU3A 4C56C 4MACA 2IJ0A 2DWQA 1XLPA 4WQMA 4B0EA 2GRIA 3SEBA 1TS2A 2WU5B 1L4DB 3U52E 2B76B 2GI9A 2LHEA 4KKIA 2L83A 4ITKA 2WXFA 1C9FA 1ENFA 2V3NA 1RM6C 2LGIA 4WWMA 1F0ZA 1HEZE 2N9KA 2ACZB 2NTSA 3SFDB 2L1AA 2QSDA 4JPSA 2EELA 2INPE 4L1BA 2ZW1A 1QILA 1CK1A 2RPVA 1K53A 2JYTA 2MEKA 3HRDD 4YT0B 2HDEA 1V97A 3BVMA 4TQ0A 3ZJVA 3B2GA 1KFYB 2M0AA 1QLBB 1FRRA 4ZHPA 1CZPA 2JSVX 2BS4B 4NJCA 1RWSA 1XLOA 5D3IB 1HQRD 2FBWB 3BIID 4FXCA 2Y5CA 1IBXB 3MJ5A 2BB6A 3BK1A 3J9CA 3P4SB 2MJ3A 1FNUA 1RYJA 1XLNA 1YJJA 1TS5A 1HZ5A 2JWUA 3AV8A 1J7BA 4ARIA 5C3JB 4ZHOA 3GB1A 1K51A 2K0PA 1I4GA 1PGXA 4NAWB 1BMLC 1YNTE 3PO0A 1MHXA 2I38A 1KLUD 3Q8EA 4A55A 4OVZA 3C8YA 2NTTA 4US8A 1IGCA 1NENB 1C78A 5HI1A 1TY0A 1EWCA 2Y5PA 2IDYA 4C80A 2E6XA 2SEBD 1K50A 1PUTA 2V3PA 3TEZA 3AE4B 2ON8A 3BYTB 2WXHA 2K9XA 1UGJA 3P4PB 2PVOD 2BB5A 1Q10A 3ZJUA 2KWDA 1TYGB 2BS2B 3Q8FA 3W9CB 4P16A 2JXTA 1NYRA 1VZ6A 3NVYA 5EE0A 4A9AA 3VRBB 2N9LA 1ZXHA 1B1ZA 3B9JA 1SE3A 1I4RA 1JALA 3U4EG 3PZ7A 3AE8B 3P63A 5AUIA 1L0VB 2L52A 1FFVA 2RMMA 5JXVA 2KAJA 3CWIA 3R2TA 4HROA 1QT9A 2X38A 2J52A 4HJGE 2QEJC 4CQNA 2INNE 2EKIA 3P42A 4C7ZA 3U7ZA 2W82A 1C77A 4XE0A 1IGDA 2HTME 1PGAA 2R61A 2RDGA 1C76A 4HKQA 1E9MA 2PTLA 1UUPA 2ICIA 1QOFA 3W2DA 1SIJA 3AEAB 1FD6A 3U2SC 1I4QA 1SF0A 4WIPA 1JWSD 1DOXA 5D3DA 4DXGA 4RGMA 3SR6A 2JU6X 3AMZA 3MP9A 1JWAD 4OW0A 3VRAB 1JCKB 3IT4B 4L23A 2QJLA 1KLGD 5G5HA 4A90A 1DYQA 1STEA 2AX5A 4MT5A 4AS1A 3KQ4A 5LNK1 2JQRB 1FM0D 1YQ4B 3Q69A 2WS3B 3KWVA 3W5UB 1T5XD 1NYQA 2N0SB 4UDUC 1JQ4A 2NMQA 2J42A 2RDHA 3O13A 1ROEA 5EE3A 2DYMA 2PIAA 3NVZA 1JRPA 3AH7A 1XCTL 4NZLB 1ZDXA 3Q8AA 3UI3A 3KLSX 1CJEA 1SJED 2ONQA 1MPEA 2Q5WD 3ZGZA 3NS1A 1AN8A 2PW9A 2LMCA 2WXJA 4XDDA 4RGNA 1L5PA 2IPKD 1FCLA 4AQ7A 5EE9A 5MPOA 2WXGA 2WQYB 1D5ZC 3AM9A 1GB4A 2J4XA 5HG2A 4LK0M 1T6BX 1TS3A 3AB5A 3TSSA 4YSZB 1QKZA 4OZBA 3BZDB 1XEEA 1I4PA 1R7SA 4GDKB 4YXDB 1SB3C 4WURA 4XWTA 4C7YA 5FR3A 3E56A 3HVDA 1XO3A 1AWDA 4HRSA 4A6QA 1C4AA 2H88B 2K5PA 3R8BA 2H89B 1A70A 1E6EB 4YTMB 1GOZA 1XLQA 3HVZA 1GPXA 4GLSC 2I2YA 3EUB2 3VR8B 1MI0A 2LHDA 5BMIA 3W5VB 4N6EB 1UWMA 1YN3A 4RH6A 1ZDVA 1ET6A 1Y56A 1I4XA 1JWUD 2AQ2B 4KGRA 2WXQA 2W3SA 1VZ7A 1HXYD 5E6JA 2MJEA 1VZ8A 1KF6B 2WDQB 2QMTA 2G1EA 3AE3B 2CJOA 1VRAB 4XDCA 1ACCA 2LEKA 1EWYC 1VLBA 3BK2A 2KN4A 1ZP0B 2WXIA 4LLGM 3AE9B 1TS4A 3FILB 2AQ3B 3V05A 2LUMA 3ZYYX 2K22A 2BBCA 1JW9D 3T3OA 2CU3A 3AEDB 5FK9C 4ZYSA 4N59A 4DXFA 2LJIA 4REZA 4RFBA 5EE1A 1FXIA 2E3TA 1F2RI 1QQRA 2SAKA 4RF0A 1SBBB 3IT6B 2Z8LA 1SXTA 5FKAC 1EU4A 4RCOA 5D7GA 3E9SA 4LTUA 2QILA 5AUKA 1L4ZB 1L0XB 1ZXIA 4TMAB 4IKGA 4D2KA 1KH0A 1FFUA 2VZKD 3FILA 2M56B 1P7EA 3FAHA 3EGRA 3NVVA 4RNAA 1BXTA 3LXFA 3NRZA 4TQ1A 1C79A 3EA6A 5H8YE 1FNWA 3GS2A 1B9RA 1FNVA 1E7PB 1NEKB 1V1PB 1FIQA 2BYTA 1N5XA 4GDLB 3AE5B 3MFGA 1YQ3B 4USAA 1BUIC 1N62A 1ZPSA 2ZW0A 3ZQ4A 2V4IB 1PYWD 1XXGA 2MJDA 4RGTA 2WXLA 4MH8A 2G9HD 3I57A 4TSSA 4WAFA 1V8CA 3I9V1 5T8IA 1VR9A 2WP9B 2QIEB 4ARCA 5BYRA 3NUHB 2PVGC 3DWMA 2V0GA 3TEXA 1IUEA 1N61A 2J53A 2OHFA 2PLPA 4US9A 3T3NA 2W55A 3AE7B 1PFDA 4J3OD 2WXMA 4DQOC 4OZAA 1XCQL 3TUOA 1DOIA 1E0ZA 1AW7A 3RPFC 3IAM1 1EM7A 3R2IA 2IGDA 2JX5A 1WSPA 4MM3B 1ZE3D 3MC0B 4Q2JA 3P4QB 1SE2A 2FUG1 3SFEB 1FRDA 3Q8BA 2VZKB 4JE3B 4M0WA 2YEPF 4ZOHC 1C4PA 4R3DA 2D5GA 1M4VA 1WXQA 1JMLA 1PDXA 1F77A 3BWUD 1SSNA 3BVGA 1YJIA 5C2TB 3NVWA 1D5XC 1LO5D 3B2FA 4YSXB 3V3XA 3DWGC 3N9YC 2WDRB 3URYA 1FO4A 1TKYA 4OZCA 5I4DA 2PMVA 1WWTA 2W54A 1JWMD 4P6VF 1VDVA 1WRIA 4EE2A 2XNAC 5TSSA 5H92C 1N60A 3RFZB 1YN4A 1QOAA 1HA5A 1I7HA 1J7CA 3AEEB 3HUIA 2LFIA 5HFYA 1CQVA 3P1MA 1IBXA 2K3UA 1UWXA 3FC4A 4RGOS 5GXGB 1AYFA 1SJHD 4ZRQA 2KACA 1TJEA 1V1OA 3AE6B 3IXSA 2WNMA 3H8HA 1P7FA 1QF6A 1T3QA 2WXRA 1QOGA 1GAQB 1N63A 4L2YA 1XF5L 3TEYA 1TKGA 2WLBA 1KTKA 1ESFA 1TY2A 1I4HA 2BW2A 2L32A 1E10A 4JX1C 4A8XC 1NVID 1PGBA 3AEGB 3IAS1 3BVZA 1D4BA 5BMGA 3PZ8A 3TEWA 3BYYB 1JROA 1DOYA 1MHHE 3W1SA 2KQ4X 4B0MA 1N5WA 1TKEA 1FXAA 1OFFA 1L6UA 1K52A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LYY A;  3Q69 A;  4MT5 A;  3NZ3 A;  3I57 A;  2LFI A; 
#chains in the Genus database with same CATH topology
 5CX3 A;  1GJZ A;  2CJN A;  4YWG G;  3HM3 A;  1SE4 A;  4JWU C;  2JYE A;  4IW0 A;  1D5M C;  1YJ1 A;  3ZUN A;  2EMS A;  2O2V A;  2OJR A;  3GP7 A;  4YSY B;  1TZO A;  5AZG A;  4KGS A;  4LNK A;  4IOI E;  5G55 A;  3H7P A;  4H2A A;  1L0Y B;  3WAL A;  2OOB B;  2N9P C;  4BKG A;  1WF9 A;  1OQR A;  2DBY A;  2HJ8 A;  1SEB D;  3LYY A;  3ZTC A;  2KX0 A;  1RAX A;  4A3O A;  2YEP B;  2Y5B B;  3GZN I;  1WFY A;  4MGI E;  2AQ1 B;  2AYO B;  1VCB A;  1RFK A;  3QC8 B;  4WJP A;  4WJQ A;  1P3Q U;  4W9K A;  4I6N B;  1WX8 A;  2ZCC A;  4YTN B;  2N1V A;  4MEL A;  4JWS C;  2PPH A;  2VH2 A;  3H6N A;  3PLV A;  2ZEQ A;  4FBJ B;  2WGS A;  1XLP A;  4B0E A;  1J19 A;  1N6Z A;  2LHE A;  4CYE A;  2ZNV C;  4C4V B;  1OGW A;  2W9N A;  4ITK A;  1C9F A;  1F0Z A;  2V3N A;  1HEZ E;  2N9K A;  2ACZ B;  2L1A A;  2MLB A;  2EEL A;  1WZ3 A;  3KUZ A;  2INP E;  4L1B A;  2ZW1 A;  1TZ1 A;  3ZIM A;  2KVR A;  1X1M A;  1ISN A;  3VH3 B;  1Z2M A;  4YT0 B;  2HDE A;  3H7P B;  1V97 A;  2DAJ A;  4GIV A;  4NNJ B;  1KFY B;  3I3T B;  2QCZ A;  4ZHP A;  4NJC A;  1XLO A;  2NBU A;  4CHK A;  3BII D;  1IBX B;  1S1Q B;  2N4F A;  3P4S B;  1YJJ A;  2IO2 B;  5LXI B;  4FHK A;  3TCA A;  1K51 A;  1RRB A;  1PGX A;  4NAW B;  1BML C;  2D3B A;  3PO0 A;  3VUY A;  2NR2 A;  4CO7 A;  1WJ4 A;  2Y5P A;  2MWS B;  3PRM B;  2V3P A;  2WX0 A;  2K9X A;  2CS4 A;  2KC1 A;  3SDL C;  4NJ7 A;  4BOZ B;  1VZ6 A;  3WAO A;  2KLG A;  3VRB B;  4JQW C;  2N7D A;  1ZXH A;  5IN7 A;  1B1Z A;  3B9J A;  1TBE A;  4JGH B;  1SE3 A;  2RGF A;  1JAL A;  1GC6 A;  3AE8 B;  5AUI A;  2L52 A;  1FFV A;  1QT9 A;  4P1B C;  2INN E;  4C7Z A;  3PZD A;  2W82 A;  4GB9 A;  4BOS C;  1IGD A;  2R61 A;  1PGA A;  5DCN A;  1FXT B;  1E9M A;  3ZRC A;  3Q3F A;  1RFA A;  2ICI A;  1QOF A;  3AEA B;  1SF0 A;  1JWS D;  5EDS A;  5D94 A;  5D3D A;  4DXG A;  4FUL A;  3AMZ A;  3MHS D;  2J0J A;  3VRA B;  3IT4 B;  1WXV A;  1KOT A;  1EF1 A;  3P2B A;  3KQ4 A;  2JZZ A;  2JQR B;  4K7S A;  2DHZ A;  2WS3 B;  3AUL A;  1NYQ A;  2N0S B;  4UDU C;  2J42 A;  2LXA A;  3CSF A;  4WJN A;  4LNO A;  2DYM A;  2PIA A;  3N3K B;  2DAF A;  1MG4 A;  3GOE A;  3KLS X;  2G4S A;  2GBJ A;  3L54 A;  3UIN B;  1WMH B;  5JHB A;  3ML8 A;  4RGN A;  4MH0 E;  4ICV A;  2WXG A;  2WQY B;  3DHH C;  3T8M A;  2J4X A;  2HD5 B;  5HG2 A;  2IZV B;  3VDZ A;  4XWT A;  4C7Y A;  3E56 A;  2ZCB A;  1XO3 A;  1AWD A;  1WGH A;  1HE8 A;  4GGQ A;  2K5P A;  2H89 B;  2NCN A;  2BWE S;  5J18 A;  4MSQ B;  4YTM B;  1GOZ A;  1XLQ A;  3N1X C;  5IOI A;  4GLS C;  1MI0 A;  4AOF A;  2KTR B;  3QQ8 B;  1WGD A;  2LRU A;  1Y56 A;  4KGR A;  4B95 A;  3IVF A;  1TIF A;  5KHO A;  1XT9 B;  2MJE A;  1WX7 A;  1VZ8 A;  2M17 A;  4BZA A;  4HDQ A;  2G1E A;  2IYD B;  1ACC A;  3BK2 A;  1ZP0 B;  1G6J A;  1TS4 A;  3QK0 A;  2VRR B;  2AQ3 B;  2LUM A;  1JW9 D;  3AED B;  5AZH A;  1K8R B;  3DQV A;  4MEM A;  4RF0 A;  3IT6 B;  1SXT A;  5FKA C;  4DHJ D;  2L00 B;  3NG0 A;  4LTU A;  2BVC A;  4IKG A;  3FIL A;  4LNN A;  4MSM B;  1P7E A;  3FAH A;  3DOW A;  3LXF A;  2LVP A;  3V62 A;  1NEK B;  3DHG C;  1FIQ A;  2BYF A;  2PJH A;  4AJY B;  1BUI C;  4DBG A;  2IO0 B;  2KJH B;  2XK5 A;  3ZQ4 A;  4IWQ A;  3UIP B;  2KXJ A;  3N1Z C;  3I57 A;  2DEN B;  3RMK C;  1V9J A;  2K8H A;  3I9V 1;  4PK1 A;  1Z5S B;  2KTF A;  2WP9 B;  2K1F A;  1CMX B;  3IBE A;  2JWZ A;  3TEX A;  3T3N A;  4ZRJ A;  2KTR A;  1WR6 E;  2MSE D;  3L16 A;  4IC7 B;  2WXM A;  1E0Z A;  4C00 A;  1AW7 A;  2IGD A;  4LDT B;  1WSP A;  3Q6B A;  1ZE3 D;  4WJO A;  3MC0 B;  2LJ5 A;  2CU1 A;  3SFE B;  2C9W B;  4M8M A;  2GMI C;  2ZPY A;  2BYV E;  2VZK B;  4JE3 B;  4M0W A;  2D5G A;  3RNB C;  3TL5 A;  2MA9 B;  4NQL B;  3ZTD A;  1F77 A;  2MX2 A;  2EKE C;  3K9P B;  1LO5 D;  2CHX A;  3DWG C;  1FO4 A;  3RN9 C;  2R2Q A;  2I1J A;  3DVN U;  2INC C;  1JWM D;  1WRI A;  5TSS A;  5H92 C;  3ZNH B;  1YN4 A;  5HKH A;  3DBR I;  1HA5 A;  1M94 A;  1IBX A;  3ZNZ B;  1RLF A;  3DBL B;  4TUU A;  3AE6 B;  3IXS A;  1L7Y A;  1WR1 A;  1QF6 A;  1V5T A;  4I6L B;  4NJ6 A;  3R66 C;  1V49 A;  1N63 A;  4L2Y A;  1XF5 L;  3X23 A;  1TKG A;  1H8C A;  1E8Y A;  1T0Y A;  4FJY A;  1Q1O A;  1E7V A;  3TEW A;  2KDF B;  3OG5 A;  2NVU I;  3P63 A;  4OHJ A;  3AEF B;  3Q8C A;  4EZK A;  3M95 A;  1LM8 B;  2WXP A;  3MTN B;  2HE7 A;  4AP4 C;  1KM7 A;  3DVG Y;  1YX5 B;  1GB1 A;  3N20 C;  2OED A;  4GMV A;  5JHA A;  2TSS A;  5G5G A;  2KMM A;  3VR9 B;  3DVG X;  1WX9 A;  3CMM B;  5BYS A;  2BWF A;  3AE1 B;  5CHF A;  4DWF A;  2KYW A;  4JLC A;  3P4R B;  1FMA D;  2PE6 B;  1ZUD 2;  2Y3A A;  3OWE B;  3A9K A;  3NOB A;  2KDM A;  1WXA A;  4IDI A;  2WU2 B;  4KGT A;  3W1S C;  3U8Z A;  4HEA 1;  3AEB B;  4GU2 A;  4ANW A;  4KX6 B;  5AEK B;  1WJN A;  5E6N A;  2BS3 B;  1OEY A;  4BAX A;  3EC8 A;  1YMH E;  2XEW A;  4PT5 A;  4N58 A;  3VQI A;  1U4A A;  4ZRP A;  3ZDT A;  2FE8 A;  4XWW A;  2L0F A;  5HHD G;  3KWL A;  4WH4 A;  3OJ4 B;  4W9F A;  1QOB A;  1FCC C;  2MRP A;  4EZJ A;  3MJW A;  3QJZ A;  1HZ6 A;  2RR9 A;  2DWQ A;  3EFU A;  4IM3 A;  3Q3J A;  3SEB A;  1E8W A;  3U52 E;  2B76 B;  2MHJ A;  4KKI A;  3PT2 B;  1SGH A;  4A20 A;  1ENF A;  4ZRK A;  2LGI A;  4GN1 A;  4EZL A;  3U7D A;  4W9L A;  2NTS A;  3UGB B;  4JPS A;  2QSD A;  3R7Q A;  3KH0 A;  4GDK A;  2FCN A;  2RPV A;  2A4Z A;  4M01 A;  2JYT A;  1I42 A;  2L7R A;  3AU4 A;  2ZNV B;  3ZJV A;  1FRR A;  3W1Y A;  1CZP A;  2BS4 B;  1AAR A;  1HQR D;  1XQQ A;  4IUM B;  3ZRF A;  3WAM A;  1TTN A;  2BB6 A;  1HTQ A;  1RYJ A;  1I35 A;  1T0R C;  1J7B A;  2IY0 B;  4WWO A;  2K8C A;  2KJR A;  5C3J B;  4LNI A;  4XGA B;  4ZHO A;  2KMC A;  3JSV B;  1WH3 A;  4DXA B;  2KNB A;  1YNT E;  3KUD B;  5LLI A;  3ZW3 A;  1KLU D;  3VVW B;  2N9E B;  2GLS A;  3C8Y A;  4US8 A;  1C78 A;  5HI1 A;  1TY0 A;  1EWC A;  1FPY A;  1V6E A;  2DZK A;  4C80 A;  2E6X A;  1PUT A;  2M0X A;  1R4M I;  2DZI A;  4II3 B;  2PE9 A;  3SD5 A;  1WYW B;  1UGJ A;  3P4P B;  1T0S C;  2BB5 A;  3IHP C;  3KUC B;  1WJU A;  1TYG B;  2BS2 B;  2AWT A;  3Q8F A;  3W9C B;  3RCZ A;  3NVY A;  5EE0 A;  1BT0 A;  3GE3 C;  2QDF A;  1I4R A;  3PZ7 A;  1L0V B;  2RMM A;  5JXV A;  2KAJ A;  3I63 C;  2JY6 A;  4HJG E;  3M62 B;  3P42 A;  4OVU A;  1C77 A;  4NPN A;  3QA8 A;  4HKQ A;  2PTL A;  1E7U A;  3U2S C;  2I1K A;  1DOX A;  2MCN B;  3VTV A;  2LAS A;  3AI5 A;  1JWA D;  2J0K A;  3RNE C;  1YQB A;  4A90 A;  1C3T A;  1ZW7 A;  3NZU A;  3UF8 A;  1FM0 D;  1EUV B;  1YQ4 B;  1IP9 A;  2JVC A;  3RUL A;  3M63 B;  4KZ0 A;  4IWO A;  2KDE B;  3O13 A;  2JPH A;  2NPT B;  2KHW B;  2ZVN A;  1WE7 A;  3NVZ A;  1XCT L;  1ZDX A;  4HPM B;  4HXD A;  2A5U A;  1CJE A;  1SJE D;  3V60 A;  3AXC A;  4HWI B;  2Q5W D;  2PW9 A;  4XDD A;  2LMC A;  2KD0 A;  4GXB A;  2KQ7 A;  5EE9 A;  4LK0 M;  5TR5 A;  1QKZ A;  4OZB A;  2KLC A;  3BZD B;  2IND C;  1R7S A;  3EHV A;  5BO4 B;  4AWJ A;  3SHQ A;  3OJ3 A;  2O2V B;  4HRS A;  3R8B A;  5D2M B;  4MJS B;  1A70 A;  1E6E B;  3ZNI D;  2I2Y A;  4DHJ B;  1P98 A;  5BMI A;  4N6E B;  1UWM A;  4OVV A;  3IFW B;  3VFK A;  2AQ2 B;  2ZJD A;  2W3S A;  2C5L C;  2MBE A;  1VZ7 A;  2CHW A;  4KZC A;  1KF6 B;  2WDQ B;  2QMT A;  3AE3 B;  2K6Q A;  1V5O A;  2MP2 B;  2V9H A;  2WXI A;  2CHZ A;  4LLG M;  3AE9 B;  2D10 A;  3ZYY X;  2C60 A;  2MBQ A;  2CU3 A;  5FK9 C;  2LJI A;  5EE1 A;  2AEH A;  2E3T A;  2MP2 A;  1KJT A;  4GDL A;  2WWZ A;  1EU4 A;  3NY5 A;  2QIL A;  5AUK A;  3HHM A;  1GNU A;  1OTR B;  3LDZ E;  2J0M A;  2FCQ A;  2FID A;  3L0W B;  1BXT A;  4TQ1 A;  4G3X B;  2KK8 A;  1WGY A;  3EA6 A;  5H8Y E;  4W9E A;  3U30 A;  1V81 A;  2FAZ A;  1N5X A;  2BKF A;  3TJP A;  4USA A;  1YQ3 B;  1N62 A;  1ZPS A;  4PYU A;  3ML9 A;  1XXG A;  2MJD A;  4RGT A;  2IO1 B;  2WXL A;  4MH8 A;  1WXM A;  4K81 A;  4G11 A;  4TSS A;  4WAF A;  1V8C A;  3CF6 E;  2GBR A;  1VR9 A;  1WGG A;  3DBL I;  2DYB A;  3NUH B;  4W9G A;  2V0G A;  4US9 A;  1N61 A;  3B08 A;  3AE7 B;  1PFD A;  4J3O D;  4OZA A;  1XCQ L;  1LXD A;  3MC9 A;  1DOI A;  2JXX A;  1EM7 A;  4EFO A;  2BPS A;  3R2I A;  2JX5 A;  3L17 A;  4MM3 B;  3Q3N C;  4Q2J A;  1SE2 A;  2FUG 1;  2LI5 A;  2R2O A;  3PGE A;  3PLU A;  1MFW A;  1WXQ A;  1JML A;  1PDX A;  5C1Z A;  2N9X A;  4YSX B;  4KIK B;  2KWC A;  3URY A;  2D2Q A;  5E6P A;  4W9C A;  4OZC A;  5I4D A;  4RM8 A;  2KJ6 A;  1VDV A;  1V80 A;  2IBI B;  4LJP B;  4M0W B;  3RFZ B;  1QOA A;  3HUI A;  1I7H A;  3AEE B;  2LFI A;  2K6D B;  4MGK E;  2UU7 A;  2K3U A;  1UWX A;  1UH6 A;  3FC4 A;  1SJH D;  3A1Q A;  2O6V B;  5IAA C;  1GAQ B;  4ZRI A;  3DBS A;  1NDD A;  2KWV B;  1I4H A;  2BW2 A;  4JX1 C;  2VH1 A;  3IAS 1;  3HIZ A;  3ALB A;  1MHH E;  2KVZ A;  4B0M A;  4FAD A;  1FXA A;  3WCQ A;  3LB8 C;  4PS7 A;  1YN5 A;  2IGG A;  3ZJT A;  2M19 A;  2GBK A;  3WA0 A;  3Q3O C;  1WGR A;  2DYO A;  2BTE A;  4DK5 A;  3AN1 A;  1F9J A;  2KQS A;  2BT6 A;  2MW5 A;  1VJK A;  2DLB A;  1OQQ A;  1WJ6 A;  4QAY A;  2GB1 A;  4B6W A;  2RPQ A;  1YD8 U;  1DGJ A;  2PKO A;  3ETR A;  1L6V A;  1ET9 A;  1SE9 A;  1WI0 A;  3ABV B;  4KIK A;  3A4R A;  1WXS A;  1NI3 A;  2WDV B;  2WXN A;  4HPP A;  4RF1 A;  2D3A A;  2ZPN A;  2MBB B;  1WMH A;  4O1N A;  3RNG C;  1OEY J;  2WXO A;  4N9F 4;  1WYG A;  3NZ3 A;  1MJD A;  4NAM A;  5BMH A;  2D3C A;  3AE2 B;  3O65 B;  1C1Y B;  2K8B A;  3RNA C;  2K25 A;  3L13 A;  1JWB D;  4AUQ C;  1MVK A;  3AEC B;  5JH5 C;  4ZDV A;  3NS8 A;  4II2 B;  4BVU C;  4JIO U;  4WQM A;  3ZKJ C;  4FN2 A;  3RNF C;  2WU5 B;  4LCD E;  1P9D U;  2V4L A;  2GI9 A;  4BKS A;  2WXF A;  3MC8 A;  3S2A A;  3ZDM C;  2M4N A;  4DDI D;  4URK A;  1QIL A;  4K7W A;  4ANX A;  2K39 A;  1CK1 A;  3PRP B;  3HRD D;  2LXC A;  4TQ0 A;  3B2G A;  3R3M A;  2KFK A;  5L83 A;  5CTR C;  3L08 A;  2Z0E B;  2FBW B;  5FR6 A;  3J9C A;  2MJ3 A;  4P7I A;  4FJZ A;  2YVC A;  1TS5 A;  1HZ5 A;  2JWU A;  3AV8 A;  4ARI A;  1F52 A;  4HVB A;  3APF A;  5J17 A;  2K0P A;  1I4G A;  2JRI B;  1R4N I;  4MJS A;  3Q8E A;  4OVZ A;  2G45 B;  2NTT A;  1IGC A;  3RZF A;  4IM2 A;  2IDY A;  2LGS A;  3DBH B;  4NAW A;  2AL3 A;  2Z0D B;  3AE4 B;  3BYT B;  3N30 A;  1NBF C;  2PVO D;  1Q10 A;  2JT4 B;  2KWD A;  2JXT A;  1NYR A;  1GUA B;  2C7M B;  1MG8 A;  3ENE A;  1S3S G;  2CR5 A;  3H7S A;  1D3Z A;  3KW5 B;  3R2T A;  2J52 A;  1Y8R C;  4G0N B;  4J6I A;  2FNJ B;  4CQN A;  2EKI A;  4ZYN A;  3PSE B;  3U7Z A;  3QAQ A;  4IWP A;  2RDG A;  4TV3 A;  4TKN A;  3W2D A;  3A9K B;  4ANV A;  1FD6 A;  1I4Q A;  2L3Z A;  1ZKH A;  3C0R B;  1PQS A;  2JUO A;  3MP9 A;  2QJL A;  1KLG D;  4W9H A;  2AX5 A;  3QWZ B;  4MT5 A;  4AS1 A;  5LNK 1;  1YIW A;  3Q69 A;  3KWV A;  2RD0 A;  1WM3 A;  3QAR A;  1JQ4 A;  2X8X X;  4XYC A;  1J8C A;  1ROE A;  2FUH B;  5EE3 A;  1TT5 B;  3D32 A;  3Q8A A;  3TMP B;  3H9D A;  2QHO A;  4EOY A;  1MPE A;  1AN8 A;  2WXJ A;  2CKH B;  2IPK D;  2LZ6 A;  3BY4 B;  5MPO A;  4KDL B;  1GB4 A;  3AM9 A;  2KT7 A;  1T6B X;  3AB5 A;  4YSZ B;  1XEE A;  1I4P A;  4M8N A;  4GDK B;  4YXD B;  1SB3 C;  3VAW A;  5FR3 A;  3TIX A;  3VUX A;  3HVD A;  2H88 B;  2NBW B;  4HCN B;  2LHD A;  3PHW B;  3W5V B;  3CST A;  1ET6 A;  4HPL B;  1JWU D;  4FA6 A;  1HXY D;  5E6J A;  3A1Q B;  4C4V A;  3A33 B;  1TGZ B;  4MM3 A;  1VRA B;  4XDC A;  2IY1 B;  2KN4 A;  2EMT A;  3DPD A;  4G50 A;  3KYD D;  4M02 A;  3T9L A;  3V05 A;  1WM2 A;  4JL9 A;  2BF8 B;  4XC2 A;  3Q14 C;  3T3O A;  4ZYS A;  4REZ A;  1F2R I;  4PS8 A;  1SBB B;  4RCO A;  5D7G A;  3NZS A;  1L0X B;  2KX3 A;  4TMA B;  3RYT A;  2OJW A;  1FFU A;  2VZK D;  2M56 B;  4BKS D;  3Q2A C;  4RNA A;  3NRZ A;  1YOV B;  1C79 A;  4K1R B;  3GS2 A;  1FNV A;  1XD3 B;  4KVG B;  2KKC A;  4GDL B;  1WIA A;  3MFG A;  2ZW0 A;  2V4I B;  3UIO B;  3ZXR A;  1L2N A;  4S0R A;  3QX1 A;  4FLH A;  4WQO B;  3A4S C;  2LGY A;  1UF0 A;  3PPA A;  2AL6 A;  2QIE B;  3ZLZ A;  5DPR A;  5BYR A;  2PVG C;  2FCM A;  3DWM A;  1EF5 A;  2OHF A;  2W55 A;  3OAW A;  3APD A;  1UBI A;  3DHI C;  3L10 B;  2LVQ A;  1LFD A;  4BKT A;  3RD2 A;  3RPF C;  3IAM 1;  4E71 A;  3C19 A;  3NHE B;  1FRD A;  2YEP F;  5AZF A;  4BBN F;  1M4V A;  2LGX A;  3BWU D;  1SSN A;  4S17 A;  1YJI A;  2NPT A;  5C2T B;  4AJW A;  2KDB A;  3N9Y C;  2WDR B;  1TKY A;  2BKR B;  2PMV A;  3RZW C;  4NQK E;  3I5J C;  4P6V F;  4XZ4 A;  2KFK B;  2XNA C;  4LNF A;  3UQA A;  1UZX B;  4KDI C;  3VTW A;  3IG3 A;  1CQV A;  1AYF A;  4ZRQ A;  4IM0 A;  2KAC A;  1V1O A;  3BIN A;  2WNM A;  3DDC B;  4EUT A;  3H8H A;  3B1L X;  1T3Q A;  4HDO A;  2LGD A;  2JF5 A;  3VUW A;  3JYU A;  3VHT C;  4K7U A;  2WLB A;  1KTK A;  3WAP A;  1ESF A;  4A8X C;  4LDT D;  1NVI D;  1PGB A;  4BFR A;  3AEG B;  5BMG A;  3PHX B;  4F7Z A;  5JZE B;  2G4D B;  1JRO A;  3BYY B;  4DHZ B;  2NBV B;  2KQ4 X;  3QCA A;  1N5W A;  2JRH A;  4W9I A;  3P4Q B;  4GOC A;  1KRH A;  3WIM A;  1UNS A;  1QZE A;  4WWP A;  3L4P A;  4HCP B;  3DBH I;  4YTP B;  4KKJ A;  4MDK E;  4F8C B;  3A9J A;  1D6E C;  2JZP A;  3VTU A;  2W3R A;  1ZOY B;  5BYQ A;  3SU8 X;  5IA7 A;  2L0T A;  1WGK A;  1FEH A;  3ZO5 B;  4ASW C;  3EEC A;  2V3S A;  3APC A;  4A3P A;  3FKY A;  1V1P A;  3CIR B;  1J7A A;  3VXW A;  2XN9 C;  1R4M B;  1F2R C;  2N7J A;  1SIF A;  1C4C A;  2WXK A;  1GG3 A;  4W9J A;  2GBM A;  2ASQ A;  3MHZ A;  2GOW A;  1JRU A;  2MH7 A;  2ZZP B;  2IGH A;  4HKZ E;  5CHW A;  1EU3 A;  1NI2 A;  4C56 C;  4MAC A;  3GZN B;  1Q0W B;  2IJ0 A;  3QHT A;  5CHV C;  1OQY A;  2M8S A;  4I6P A;  2GRI A;  1WE6 A;  4ACF A;  1TS2 A;  1L4D B;  2NS5 A;  1V86 A;  3N1Y C;  2L83 A;  2MBH A;  2HJ1 A;  4WWM A;  1RM6 C;  3SFD B;  3PRZ A;  2RDB C;  2KN5 A;  2O6V D;  2LUE A;  2PEA A;  2D07 B;  2KO3 A;  1K53 A;  2MEK A;  4HK2 A;  4GSW A;  5IKC M;  3NJT A;  3BVM A;  3X0W A;  1P0R A;  2M0A A;  3ZNG C;  1QLB B;  2KC2 A;  2V1Y A;  2JSV X;  1RWS A;  5D3I B;  1Q5W B;  2WYQ A;  4LJO B;  4HJK A;  4FXC A;  2Y5C A;  2C7N B;  3MJ5 A;  3OLM D;  3BK1 A;  3KYC D;  2LWP A;  3V6E B;  4YL8 A;  2UWQ A;  1FNU A;  3WAN A;  1XLN A;  3R7R A;  2DX5 B;  5DPS A;  1E8X A;  3GB1 A;  2KWU B;  1MHX A;  2I38 A;  4A55 A;  3PTF C;  1NEN B;  2LD9 A;  4K3C A;  1V2Y A;  2SEB D;  1A5R A;  2JZ3 B;  3ZVV A;  4W9D A;  1K50 A;  3AU5 A;  4KSK C;  3TEZ A;  2ON8 A;  2WXH A;  4F1S A;  3PVL A;  4EEW A;  3ZJU A;  4P16 A;  5GMV A;  1UBQ A;  4A9A A;  4EKU A;  3M3J A;  2N9L A;  4DDG D;  3U4E G;  2FIF A;  3CWI A;  4HRO A;  2X38 A;  2KOX A;  2QEJ C;  2BQQ A;  4XE0 A;  2B3A A;  2HTM E;  1C76 A;  1UUP A;  1SIJ A;  2L05 A;  4WIP A;  2UYZ B;  5KHQ A;  1KLV A;  4RGM A;  3SR6 A;  2JU6 X;  4OW0 A;  1JCK B;  4L23 A;  5G5H A;  1DYQ A;  1STE A;  5C23 A;  4BBN C;  3JSV A;  3W5U B;  1LGR A;  1T5X D;  2REX A;  5G2N A;  2NMQ A;  3HK0 A;  3Q3M C;  3UQB A;  2RDH A;  4ICU A;  2FCS A;  4E74 A;  3QIJ A;  1JRP A;  4MGZ E;  3AH7 A;  4NZL B;  2IO3 B;  3UI3 A;  4DHZ E;  1E5W A;  4MGY E;  1H4R A;  1WZ0 A;  2ONQ A;  5IO9 A;  4K3B A;  3ZGZ A;  3NS1 A;  1P1A A;  1L5P A;  1FCL A;  4AQ7 A;  2MQJ A;  1D5Z C;  1WY8 A;  1TS3 A;  3RT3 B;  3TSS A;  4B9K A;  4WUR A;  1IPG A;  1ZGU B;  5L95 C;  4A6Q A;  1C4A A;  3B0A A;  3HVZ A;  4RMA A;  1GPX A;  3EUB 2;  3VR8 B;  4RM9 A;  2YLM A;  4RH6 A;  1YN3 A;  1ZDV A;  1I4X A;  2HTH A;  2WXQ A;  2L8J A;  2D3G A;  2KDI A;  2CJO A;  3N32 A;  2LEK A;  2WHI A;  1WRD B;  1EWY C;  1VLB A;  1T0Q C;  2N1W A;  5LXH A;  2GBN A;  1IYF A;  3FIL B;  5DPT A;  2K22 A;  2BBC A;  4HLE A;  4N59 A;  4DXF A;  4RFB A;  3DBR B;  1FXI A;  3H1U A;  1QQR A;  2D11 A;  2SAK A;  1GC7 A;  3PV1 A;  2Z8L A;  3JVZ X;  2QC8 A;  2DZJ A;  2WX1 A;  3RUI B;  3PS6 A;  3E9S A;  3ONS A;  2J7Q B;  1L4Z B;  1ZXI A;  4D2K A;  1KH0 A;  1EO6 A;  4M00 A;  3EGR A;  3NVV A;  4P1C C;  1YX6 B;  2BGF A;  1UGM A;  1FNW A;  1B9R A;  1E7P B;  2DNF A;  4ANU A;  1V1P B;  2BYT A;  1E90 A;  3AE5 B;  2M1M A;  5IP4 D;  1PYW D;  4FJV B;  2DZM A;  2G9H D;  2Z59 B;  4XX5 A;  5T8I A;  1LQB A;  2L76 A;  4ARC A;  3TBL D;  1IUE A;  2PLP A;  2J53 A;  3EFC A;  5J2R A;  3V61 A;  4WWN A;  1J0G A;  5D6J B;  4DQO C;  3TUO A;  2XBB C;  2KAN A;  2KMA A;  3A9J B;  3Q8B A;  2BYE A;  4ZOH C;  1C4P A;  2LRW A;  4R3D A;  3BVG A;  2WDT B;  3NVW A;  1D5X C;  3B2F A;  3V3X A;  1E8Z A;  3V6C B;  4PYZ A;  2MBO A;  1WWT A;  2W54 A;  4X57 B;  3RI7 C;  2KZR A;  2O6V A;  4EE2 A;  3DVN V;  1N60 A;  3JW0 X;  1J7C A;  1HTO A;  1UD7 A;  1F1H A;  5HFY A;  1R4N B;  3ECI A;  4KSL C;  3P1M A;  4RGO S;  3GE8 C;  5GXG B;  3K9O B;  4FHJ A;  2LVO A;  1TJE A;  3RNC C;  2KFJ A;  3ZXV A;  4PS3 A;  4KV2 A;  1P7F A;  2WXR A;  1QOG A;  2N7E A;  3HM6 X;  2C7H A;  2XK5 B;  1UEL A;  3TEY A;  3VH4 B;  1TY2 A;  1VD2 A;  2L32 A;  1E10 A;  3DCG A;  3KVF B;  2G3Q B;  3BVZ A;  4WAA A;  1D4B A;  4E3C A;  3PZ8 A;  5DPW A;  3LJ3 A;  2ZVO A;  1DOY A;  3PRE A;  3W1S A;  2RSU A;  5E6O A;  4NY0 A;  1TKE A;  1OFF A;  1L6U A;  1K52 A;  4IG7 B; 
#chains in the Genus database with same CATH homology
 3WCQ A;  4OHJ A;  2CJN A;  1KRH A;  3AEF B;  3Q8C A;  4YWG G;  1SE4 A;  4JWU C;  1UNS A;  3LB8 C;  1YN5 A;  2JYE A;  1D5M C;  2WXP A;  3L4P A;  2IGG A;  4YTP B;  3ZJT A;  2M19 A;  4KKJ A;  3GP7 A;  4YSY B;  1TZO A;  1GB1 A;  2DYO A;  2OED A;  4KGS A;  1D6E C;  2JZP A;  2BTE A;  3AN1 A;  2W3R A;  4IOI E;  2BT6 A;  2TSS A;  5G5G A;  1VJK A;  2DLB A;  1OQQ A;  2KMM A;  2GB1 A;  4H2A A;  1ZOY B;  5BYQ A;  3VR9 B;  1L0Y B;  5BYS A;  3AE1 B;  1DGJ A;  1WGK A;  2PKO A;  3ETR A;  1L6V A;  1ET9 A;  3ABV B;  1FEH A;  3P4R B;  1FMA D;  2DBY A;  1OQR A;  1NI3 A;  2WDV B;  2WXN A;  1ZUD 2;  2Y3A A;  1SEB D;  3LYY A;  3OWE B;  4RF1 A;  1V1P A;  2KDM A;  3CIR B;  1J7A A;  4IDI A;  2WU2 B;  4KGT A;  4O1N A;  4HEA 1;  2YEP B;  2XN9 C;  3AEB B;  2WXO A;  4KX6 B;  1F2R C;  1WYG A;  3NZ3 A;  2BS3 B;  2AQ1 B;  1RFK A;  1YMH E;  4NAM A;  5BMH A;  4PT5 A;  2N7J A;  4N58 A;  3VQI A;  4ZRP A;  3AE2 B;  1C4C A;  2FE8 A;  2WXK A;  4XWW A;  5HHD G;  3KWL A;  4WH4 A;  1QOB A;  1FCC C;  1JWB D;  3MHZ A;  2MH7 A;  1MVK A;  4YTN B;  3AEC B;  1HZ6 A;  2IGH A;  4HKZ E;  4JWS C;  1EU3 A;  4C56 C;  4MAC A;  2IJ0 A;  2DWQ A;  1XLP A;  4WQM A;  4B0E A;  2GRI A;  3SEB A;  1TS2 A;  2WU5 B;  1L4D B;  3U52 E;  2B76 B;  2GI9 A;  2LHE A;  4KKI A;  2L83 A;  4ITK A;  2WXF A;  1C9F A;  1ENF A;  2V3N A;  1RM6 C;  2LGI A;  4WWM A;  1F0Z A;  1HEZ E;  2N9K A;  2ACZ B;  2NTS A;  3SFD B;  2L1A A;  2QSD A;  4JPS A;  2EEL A;  2INP E;  4L1B A;  2ZW1 A;  1QIL A;  1CK1 A;  2RPV A;  1K53 A;  2JYT A;  2MEK A;  3HRD D;  4YT0 B;  2HDE A;  1V97 A;  3BVM A;  4TQ0 A;  3ZJV A;  3B2G A;  1KFY B;  2M0A A;  1QLB B;  1FRR A;  4ZHP A;  1CZP A;  2JSV X;  2BS4 B;  4NJC A;  1RWS A;  1XLO A;  5D3I B;  1HQR D;  2FBW B;  3BII D;  4FXC A;  2Y5C A;  1IBX B;  3MJ5 A;  2BB6 A;  3BK1 A;  3J9C A;  3P4S B;  2MJ3 A;  1FNU A;  1RYJ A;  1XLN A;  1YJJ A;  1TS5 A;  1HZ5 A;  2JWU A;  3AV8 A;  1J7B A;  4ARI A;  5C3J B;  4ZHO A;  3GB1 A;  1K51 A;  2K0P A;  1I4G A;  1PGX A;  4NAW B;  1BML C;  1YNT E;  3PO0 A;  1MHX A;  2I38 A;  1KLU D;  3Q8E A;  4A55 A;  4OVZ A;  3C8Y A;  2NTT A;  4US8 A;  1IGC A;  1NEN B;  1C78 A;  5HI1 A;  1TY0 A;  1EWC A;  2Y5P A;  2IDY A;  4C80 A;  2E6X A;  2SEB D;  1K50 A;  1PUT A;  2V3P A;  3TEZ A;  3AE4 B;  2ON8 A;  3BYT B;  2WXH A;  2K9X A;  1UGJ A;  3P4P B;  2PVO D;  2BB5 A;  1Q10 A;  3ZJU A;  2KWD A;  1TYG B;  2BS2 B;  3Q8F A;  3W9C B;  4P16 A;  2JXT A;  1NYR A;  1VZ6 A;  3NVY A;  5EE0 A;  4A9A A;  3VRB B;  2N9L A;  1ZXH A;  1B1Z A;  3B9J A;  1SE3 A;  1I4R A;  1JAL A;  3U4E G;  3PZ7 A;  3AE8 B;  3P63 A;  5AUI A;  1L0V B;  2L52 A;  1FFV A;  2RMM A;  5JXV A;  2KAJ A;  3CWI A;  3R2T A;  4HRO A;  1QT9 A;  2X38 A;  2J52 A;  4HJG E;  2QEJ C;  4CQN A;  2INN E;  2EKI A;  3P42 A;  4C7Z A;  3U7Z A;  2W82 A;  1C77 A;  4XE0 A;  1IGD A;  2HTM E;  1PGA A;  2R61 A;  2RDG A;  1C76 A;  4HKQ A;  1E9M A;  2PTL A;  1UUP A;  2ICI A;  1QOF A;  3W2D A;  1SIJ A;  3AEA B;  1FD6 A;  3U2S C;  1I4Q A;  1SF0 A;  4WIP A;  1JWS D;  1DOX A;  5D3D A;  4DXG A;  4RGM A;  3SR6 A;  2JU6 X;  3AMZ A;  3MP9 A;  1JWA D;  4OW0 A;  3VRA B;  1JCK B;  3IT4 B;  4L23 A;  2QJL A;  1KLG D;  5G5H A;  4A90 A;  1DYQ A;  1STE A;  2AX5 A;  4MT5 A;  4AS1 A;  3KQ4 A;  5LNK 1;  2JQR B;  1FM0 D;  1YQ4 B;  3Q69 A;  2WS3 B;  3KWV A;  3W5U B;  1T5X D;  1NYQ A;  2N0S B;  4UDU C;  1JQ4 A;  2NMQ A;  2J42 A;  2RDH A;  3O13 A;  1ROE A;  5EE3 A;  2DYM A;  2PIA A;  3NVZ A;  1JRP A;  3AH7 A;  1XCT L;  4NZL B;  1ZDX A;  3Q8A A;  3UI3 A;  3KLS X;  1CJE A;  1SJE D;  2ONQ A;  1MPE A;  2Q5W D;  3ZGZ A;  3NS1 A;  1AN8 A;  2PW9 A;  2LMC A;  2WXJ A;  4XDD A;  4RGN A;  1L5P A;  2IPK D;  1FCL A;  4AQ7 A;  5EE9 A;  5MPO A;  2WXG A;  2WQY B;  1D5Z C;  3AM9 A;  1GB4 A;  2J4X A;  5HG2 A;  4LK0 M;  1T6B X;  1TS3 A;  3AB5 A;  3TSS A;  4YSZ B;  1QKZ A;  4OZB A;  3BZD B;  1XEE A;  1I4P A;  1R7S A;  4GDK B;  4YXD B;  1SB3 C;  4WUR A;  4XWT A;  4C7Y A;  5FR3 A;  3E56 A;  3HVD A;  1XO3 A;  1AWD A;  4HRS A;  4A6Q A;  1C4A A;  2H88 B;  2K5P A;  3R8B A;  2H89 B;  1A70 A;  1E6E B;  4YTM B;  1GOZ A;  1XLQ A;  3HVZ A;  1GPX A;  4GLS C;  2I2Y A;  3EUB 2;  3VR8 B;  1MI0 A;  2LHD A;  5BMI A;  3W5V B;  4N6E B;  1UWM A;  1YN3 A;  4RH6 A;  1ZDV A;  1ET6 A;  1Y56 A;  1I4X A;  1JWU D;  2AQ2 B;  4KGR A;  2WXQ A;  2W3S A;  1VZ7 A;  1HXY D;  5E6J A;  2MJE A;  1VZ8 A;  1KF6 B;  2WDQ B;  2QMT A;  2G1E A;  3AE3 B;  2CJO A;  1VRA B;  4XDC A;  1ACC A;  2LEK A;  1EWY C;  1VLB A;  3BK2 A;  2KN4 A;  1ZP0 B;  2WXI A;  4LLG M;  3AE9 B;  1TS4 A;  3FIL B;  2AQ3 B;  3V05 A;  2LUM A;  3ZYY X;  2K22 A;  2BBC A;  1JW9 D;  3T3O A;  2CU3 A;  3AED B;  5FK9 C;  4ZYS A;  4N59 A;  4DXF A;  2LJI A;  4REZ A;  4RFB A;  5EE1 A;  1FXI A;  2E3T A;  1F2R I;  1QQR A;  2SAK A;  4RF0 A;  1SBB B;  3IT6 B;  2Z8L A;  1SXT A;  5FKA C;  1EU4 A;  4RCO A;  5D7G A;  3E9S A;  4LTU A;  2QIL A;  5AUK A;  1L4Z B;  1L0X B;  1ZXI A;  4TMA B;  4IKG A;  4D2K A;  1KH0 A;  1FFU A;  2VZK D;  3FIL A;  2M56 B;  1P7E A;  3FAH A;  3EGR A;  3NVV A;  4RNA A;  1BXT A;  3LXF A;  3NRZ A;  4TQ1 A;  1C79 A;  3EA6 A;  5H8Y E;  1FNW A;  3GS2 A;  1B9R A;  1FNV A;  1E7P B;  1NEK B;  1V1P B;  1FIQ A;  2BYT A;  1N5X A;  4GDL B;  3AE5 B;  3MFG A;  1YQ3 B;  4USA A;  1BUI C;  1N62 A;  1ZPS A;  2ZW0 A;  3ZQ4 A;  2V4I B;  1PYW D;  1XXG A;  2MJD A;  4RGT A;  2WXL A;  4MH8 A;  2G9H D;  3I57 A;  4TSS A;  4WAF A;  1V8C A;  3I9V 1;  5T8I A;  1VR9 A;  2WP9 B;  2QIE B;  4ARC A;  5BYR A;  3NUH B;  2PVG C;  3DWM A;  2V0G A;  3TEX A;  1IUE A;  1N61 A;  2J53 A;  2OHF A;  2PLP A;  4US9 A;  3T3N A;  2W55 A;  3AE7 B;  1PFD A;  4J3O D;  2WXM A;  4DQO C;  4OZA A;  1XCQ L;  3TUO A;  1DOI A;  1E0Z A;  1AW7 A;  3RPF C;  3IAM 1;  1EM7 A;  3R2I A;  2IGD A;  2JX5 A;  1WSP A;  4MM3 B;  1ZE3 D;  3MC0 B;  4Q2J A;  3P4Q B;  1SE2 A;  2FUG 1;  3SFE B;  1FRD A;  3Q8B A;  2VZK B;  4JE3 B;  4M0W A;  2YEP F;  4ZOH C;  1C4P A;  4R3D A;  2D5G A;  1M4V A;  1WXQ A;  1JML A;  1PDX A;  1F77 A;  3BWU D;  1SSN A;  3BVG A;  1YJI A;  5C2T B;  3NVW A;  1D5X C;  1LO5 D;  3B2F A;  4YSX B;  3V3X A;  3DWG C;  3N9Y C;  2WDR B;  3URY A;  1FO4 A;  1TKY A;  4OZC A;  5I4D A;  2PMV A;  1WWT A;  2W54 A;  1JWM D;  4P6V F;  1VDV A;  1WRI A;  4EE2 A;  2XNA C;  5TSS A;  5H92 C;  1N60 A;  3RFZ B;  1YN4 A;  1QOA A;  1HA5 A;  1I7H A;  1J7C A;  3AEE B;  3HUI A;  2LFI A;  5HFY A;  1CQV A;  3P1M A;  1IBX A;  2K3U A;  1UWX A;  3FC4 A;  4RGO S;  5GXG B;  1AYF A;  1SJH D;  4ZRQ A;  2KAC A;  1TJE A;  1V1O A;  3AE6 B;  3IXS A;  2WNM A;  3H8H A;  1P7F A;  1QF6 A;  1T3Q A;  2WXR A;  1QOG A;  1GAQ B;  1N63 A;  4L2Y A;  1XF5 L;  3TEY A;  1TKG A;  2WLB A;  1KTK A;  1ESF A;  1TY2 A;  1I4H A;  2BW2 A;  2L32 A;  1E10 A;  4JX1 C;  4A8X C;  1NVI D;  1PGB A;  3AEG B;  3IAS 1;  3BVZ A;  1D4B A;  5BMG A;  3PZ8 A;  3TEW A;  3BYY B;  1JRO A;  1DOY A;  1MHH E;  3W1S A;  2KQ4 X;  4B0M A;  1N5W A;  1TKE A;  1FXA A;  1OFF A;  1L6U A;  1K52 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...