3DWGC

Crystal structure of a sulfur carrier protein complex found in the cysteine biosynthetic pathway of mycobacterium tuberculosis
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
92
structure length
92
Chain Sequence
NVTVSIPTILRPHTGGQKSVSASGDTLGAVISDLEANYSGISERLMDPSSPGKLHRFVNIYVNDEDVRFSGGLATAIADGDSVTILPAVAGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Cysteine synthase B
publication title Crystal structure of a sulfur carrier protein complex found in the cysteine biosynthetic pathway of Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 26
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2008-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02597 ThiS ThiS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3dwgC00
1SF0A 2WQYB 2W3SA 1A70A 1ZP0B 2WP9B 1TJEA 2EKIA 5EE0A 5EE9A 2W3RA 3AEBB 4IDIA 1FXIA 1N5XA 3P4PB 4ZOHC 1TKGA 4YT0B 1XLOA 4LTUA 2K22A 1KF6B 1I7HA 1FRRA 1VJKA 2QJLA 1V97A 3VR9B 4ZHPA 1FIQA 1DOIA 1ROEA 3AE7B 2CJOA 2WU2B 1N5WA 4YSYB 1RFKA 1QF6A 1E0ZA 1TKEA 1N61A 4WQMA 2E3TA 3AECB 3AH7A 1VLBA 2KAJA 3BIID 3CIRB 1QOAA 3AE3B 1J7CA 3L4PA 1EWYC 1L0VB 1RM6C 2G1EA 2W55A 1ZOYB 3AEGB 2JX5A 3DWMA 3LB8C 3NVVA 1E10A 4C80A 3AMZA 1F0ZA 1JWAD 1PDXA 1B9RA 2CJNA 3SFEB 2LEKA 2H89B 3P4QB 4C7YA 1TYGB 4JWUC 1XLPA 1L6VA 1XO3A 2WLBA 1NI3A 3W5UB 2WU5B 1L5PA 5G5HA 2OHFA 5GXGB 1CZPA 2BS4B 3AEAB 1FM0D 3P4SB 2MJEA 1WRIA 3AN1A 3SFDB 2Q5WD 3AE4B 4N6EB 1E6EB 3W9CB 3NVZA 5AUIA 1WYGA 1V8CA 4ITKA 5G5GA 4P6VF 4ZHOA 1JQ4A 2B76B 5MPOA 3SR6A 3P4RB 1GPXA 1E7PB 1RYJA 2L83A 1AWDA 4US8A 4N58A 1VDVA 3NS1A 5H92C 2MJ3A 1TKYA 2WS3B 3FC4A 1R7SA 3VR8B 1FXAA 5H8YE 1NVID 1WXQA 4JX1C 2JQRB 2ACZB 2BS3B 5EE3A 4US9A 1DOXA 3AV8A 3VRBB 2H88B 3FAHA 3W5VB 1JWBD 3B2GA 1JW9D 1KFYB 2M19A 3AE6B 2QIEB 1FMAD 1N62A 1XLQA 1CJEA 1XLNA 2KMMA 3AB5A 4YTNB 1IUEA 1WWTA 3DWGC 4N59A 2BT6A 2DWQA 1JRPA 2FBWB 3AM9A 3HUIA 1OQQA 2WDRB 1J7AA 1JROA 2K9XA 1E9MA 4KX6B 5EE1A 2BS2B 3B2FA 3AEEB 2W54A 3ETRA 1FFVA 2AX5A 1NENB 3EUB2 2PVOD 3NVWA 4C7ZA 5AUKA 2M56B 3HVZA 2PIAA 2WDQB 3B9JA 4HROA 2HTME 1YJJA 1AYFA 1JALA 5C2TB 3PO0A 3AEFB 1WGKA 4YTMB 1DOYA 2K5PA 2Y5CA 3ABVB 3CWIA 3P1MA 4JWSC 2L52A 1NYQA 2MH7A 1QT9A 3ZYYX 1FRDA 4YTPB 4YSZB 1FFUA 1NEKB 3KWLA 1QLBB 1YJIA 3VRAB 3AEDB 3RPFC 1YQ4B 3AE8B 1QOGA 1L6UA 2N0SB 4A9AA 1KRHA 3AE5B 1GAQB 1T3QA 1QOBA 3AE2B 3WCQA 4YSXB 3LXFA 1DGJA 1PUTA 1UWMA 1ZXIA 1YQ3B 1QOFA 2WDVB 3AE1B 4WWMA 1PFDA 1RWSA 3HRDD 3NRZA 1OQRA 2PVGC 2CU3A 1N60A 1N63A 1SB3C 1J7BA 3NVYA 3P63A 1OFFA 3AE9B 4FXCA 4YXDB 5C3JB 1ZUD2 1FO4A 4HRSA 2MJDA 2DBYA 1SIJA 4USAA 2PKOA 1NYRA
chains in the Genus database with same CATH superfamily
1SF0A 2WP9B 3ZIMA 2KDFB 3EFUA 5D7GA 3FKYA 5EDSA 2MSED 4ZHPA 2ZPNA 3MJ5A 2WU2B 3Q14C 5FK9C 1EUVB 3X23A 2MHJA 4FHKA 3ENEA 3PLUA 2E3TA 4WQMA 1EU3A 2INPE 4F8CB 3CIRB 1F2RI 1EWYC 1PYWD 3O65B 2W55A 4LNFA 2DZKA 1OTRB 3IT4B 1PDXA 2OJRA 4QAYA 2IJ0A 2CJNA 2VZKB 2UU7A 5E6JA 1L6VA 4TSSA 1P1AA 4GOCA 2ZEQA 3V05A 1FM0D 1TBEA 4N6EB 4CO7A 4RMAA 4ZRKA 1SE9A 4ITKA 4A20A 4J6IA 4ZHOA 4WWOA 4KVGB 2D3BA 4US8A 1FD6A 2BYEA 2KX3A 2LD9A 1UGMA 4ZDVA 5CHVC 3TCAA 2JT4B 2KDBA 2KOXA 4ANXA 4MT5A 2LVPA 2X38A 4B6WA 1XLNA 2D07B 3AB5A 4FBJB 5AZHA 2ZJDA 3HUIA 2WDRB 3ZQ4A 5BYSA 3BK2A 1YJJA 1JALA 4FN2A 1MG4A 3Q3FA 2GOWA 1E8XA 1ZE3D 4OVVA 3U2SC 5DCNA 4IC7B 2N0SB 3RFZB 4GIVA 3AE5B 1QOBA 2XBBC 4BKSA 4FJYA 4KDIC 3L17A 2WDTB 4P1CC 1WF9A 1WXMA 4FXCA 3NVYA 2QCZA 3DCGA 3Q3OC 1FO4A 1N6ZA 2DX5B 4W9FA 4NPNA 4OZAA 1VZ6A 1FXIA 3R8BA 1KF6B 3IAM1 2KQ4X 4NNJB 3NUHB 1WGRA 4EOYA 3ZJUA 2LGXA 4Q2JA 2ZW0A 1SEBD 2EMSA 3DHIC 1WRDB 4HKZE 1ZOYB 3QIJA 5T8IA 3A9JA 2LVQA 3PZDA 3ZNID 1P9DU 2K1FA 3D32A 1GB1A 4O1NA 2KDEB 4W9DA 2D11A 4IM2A 2Q5WD 3C19A 1XEEA 5TSSA 1FNWA 2GBRA 4BKGA 3N9YC 4A90A 4KDLB 2JU6X 1ZGUB 1VDVA 1MI0A 1ZDXA 3VUYA 2BGFA 2BPSA 2N7DA 2WS3B 1TT5B 5E6PA 4CYEA 2HD5B 3TMPB 1TTNA 2G9HD 1J8CA 4DHJB 3QAQA 2BVCA 2AYOB 1EWCA 1ZXHA 1HQRD 1JRPA 1E9MA 1Z2MA 4K3CA 2WX0A 4GXBA 4E74A 1KJTA 2ZCCA 2ON8A 3DVNV 1WGHA 3AU4A 4OZBA 5G2NA 2JXXA 2K5PA 2Z8LA 1QT9A 2C7MB 4ZRJA 1EU4A 5FR3A 2NPTB 1G6JA 3A9JB 3NG0A 1QOFA 4GMVA 5D3DA 5AEKB 1RLFA 4ANUA 4HRSA 1V81A 2BYVE 3VAWA 2MA9B 1WX8A 2WXRA 3TUOA 2MWSB 1MVKA 1TKGA 3NJTA 2JWZA 2KTRA 1EM7A 1VJKA 1YN5A 4GU2A 4YL8A 4ZRIA 2CJOA 3DBRI 4I6NB 2NBUA 4XDDA 1QF6A 2N9XA 4XC2A 1YOVB 5CTRC 3APDA 4AJYB 4EUTA 3Q8BA 3DBLB 3U52E 2V3PA 5L83A 2LEKA 3AI5A 3P4QB 4BKTA 1TYGB 2QEJC 2M0XA 1EO6A 2KANA 4M02A 3IG3A 1WX9A 2IY1B 2JVCA 3SHQA 4HKQA 2N1WA 3RULA 4MGZE 1RYJA 2QHOA 1WYWB 2R2QA 2SEBD 4R3DA 4N58A 4DHZE 2CHXA 2KK8A 2D5GA 3VR8B 4JX1C 4FJZA 3H1UA 2GLSA 4IM0A 1I42A 2H88B 4WH4A 4KGSA 3B2GA 4YTNB 1R4NI 4N59A 2MEKA 5D2MB 2PPHA 2KTRB 5DPWA 2WXGA 1I4GA 3A9KB 3IXSA 5LLIA 5C2TB 2IGDA 1MPEA 3UINB 2QILA 4MM3A 3PVLA 1TZOA 3VUXA 3WALA 2L52A 2N4FA 1NEKB 2M8SA 1PGAA 2D2QA 1L0YB 1YQ3B 2C9WB 1YN3A 3LJ3A 4CHKA 1Z5SB 2G4DB 4G3XB 2J4XA 2FUG1 2WXIA 2NTTA 3AU5A 2EKIA 3IVFA 4RCOA 2FAZA 2IDYA 3R2IA 3VFKA 5D6JB 1SSNA 4WJOA 4DDGD 4E71A 2IY0B 3AH7A 3AE3B 1ACCA 1WFYA 3M95A 5JZEB 3R3MA 3H9DA 3AMZA 1D5MC 4WJPA 3FILA 2AL6A 3B0AA 4FADA 2MX2A 3GB1A 4EEWA 2YVCA 1V80A 3MFGA 4IWPA 1IBXA 2OHFA 4W9JA 3SDLC 4LNKA 1Y8RC 3TL5A 3SFDB 2IO2B 4MM3B 2V9HA 4UDUC 1YX6B 3BY4B 3KQ4A 3RT3B 3DBSA 1FCLA 2JZZA 1HA5A 1HZ5A 3RZFA 4PK1A 2EKEC 3QK0A 4ARCA 2IO3B 2A5UA 2DZJA 3N30A 3N3KB 1FPYA 3ZJTA 3I63C 1JWSD 3B2FA 3ETRA 4DDID 3NVWA 2KC1A 4PT5A 5AUKA 1SJED 2HTME 5BYQA 2C5LC 2L05A 4S0RA 4KIKA 1WJ6A 3BINA 1C76A 1UZXB 3AE8B 1C78A 2DLBA 3FILB 1UWMA 2GB1A 1IBXB 1ZUD2 1ZP0B 4OZCA 3DOWA 2NMQA 2KYWA 4GDKA 1I7HA 3WANA 4WQOB 3ZNGC 1FIQA 2L3ZA 4AJWA 2RSUA 3RNAC 3RN9C 1WGDA 1E0ZA 2LJIA 3L16A 1MHXA 4B0MA 4I6PA 5HI1A 4EZLA 5IN7A 2X8XX 5E6NA 3NVVA 3PPAA 1X1MA 4AUQC 2XK5B 5HKHA 1F52A 2WLBA 4IWOA 4GLSC 2KQSA 2WXPA 4GDLA 3QJZA 3PRMB 3DBRB 1V49A 3U8ZA 2JY6A 3LDZE 3H7PB 3PSEB 5LXHA 1Q10A 2J0KA 1K53A 4KGTA 1R7SA 2LASA 2PEAA 3PREA 3RNFC 4KKJA 4JE3B 3VRBB 3RI7C 1SIFA 3BVGA 5KHOA 1S1QB 2BYTA 3W2DA 4LJPB 3MC0B 1NBFC 2JYTA 5EE1A 4FULA 5CHWA 3GS2A 1AW7A 4HPPA 3IAS1 3PGEA 1C4CA 2L76A 3OG5A 3QCAA 1V9JA 3MC8A 1R4MI 1C9FA 5D94A 4A9AA 3NZUA 1WM3A 4TQ0A 3AE2B 1FCCC 1P7FA 3U30A 1PUTA 1ZXIA 4AOFA 4EZJA 1L4DB 1YQBA 3KH0A 2GI9A 1R4NB 2MQJA 3I3TB 2ZZPB 1TS5A 4GDLB 1QKZA 4WWNA 3AEBB 2JZPA 3L08A 4GN1A 4YT0B 1P7EA 1WJUA 3Q8EA 3VTUA 5AZFA 3VR9B 1V86A 3W1YA 2QC8A 3VH4B 2KT7A 2CHZA 2VRRB 5FR6A 1T0SC 1IGDA 2IO1B 3DBLI 4KSLC 4OHJA 3PV1A 3AEGB 3I5JC 2BB5A 1WGYA 1JWAD 2GBJA 3R7QA 2HE7A 1FXTB 3HM6X 2CS4A 2RGFA 3ZKJC 4C4VA 2QMTA 2UYZB 1WRIA 2JZ3B 3KUCB 3ZTDA 3NVZA 2FCMA 2N1VA 2B76B 1F77A 2I38A 3KUDB 4I6LB 3ZDTA 2WXNA 2PJHA 2CKHB 5D3IB 1I4QA 2LXAA 2RDGA 4KSKC 1TGZB 2DHZA 3VTWA 3S2AA 1CJEA 2KWVB 4K7WA 1J7AA 3NHEB 1HXYD 3ZXVA 4MH0E 1C1YB 2AX5A 3K9PB 1Q0WB 4RGNA 2BF8B 2FCNA 1BUIC 3V6EB 1YIWA 1SJHD 3A4RA 3JSVA 4IW0A 2CR5A 3ZLZA 3P1MA 2INCC 4JWSC 2KC2A 4JQWC 3KWLA 1YJIA 4DXAB 3EFCA 2VZKD 5HHDG 4JLCA 4A6QA 2WXHA 3QC8B 4PS7A 3OAWA 4P16A 2L0TA 2LI5A 3C8YA 4B95A 3H6NA 1L7YA 4C4VB 2IGHA 4RM9A 3L0WB 3WA0A 1HE8A 5JH5C 2IZVB 4EKUA 2BYFA 2KZRA 1Y56A 1TKEA 4PYZA 3RCZA 2NTSA 4XYCA 1WH3A 4ASWC 2MBHA 2J0MA 2D10A 1UNSA 4NAWA 1IP9A 3N1ZC 3TEYA 2LRUA 2ZVNA 1XCQL 1TIFA 3ZVVA 2WXLA 2BS4B 3VDZA 3RNBC 3P4SB 1YJ1A 3JSVB 3PZ8A 4NJ7A 3VTVA 4BBNC 3UF8A 5CHFA 1JQ4A 1HTOA 3QX1A 2L32A 1FNUA 4HPMB 2WXMA 1WGGA 1I4RA 1E90A 5FKAC 2INDC 4W9GA 1TKYA 2NPTA 3H7SA 2KWUB 4MH8A 1NVID 2WGSA 2R61A 3TBLD 1M4VA 5G55A 4OW0A 2V3NA 2KQ7A 1JW9D 1KFYB 1VRAB 3UQAA 1QZEA 2KX0A 2HDEA 1D3ZA 4RF0A 1KLUD 1U4AA 3AEEB 4HXDA 2HJ8A 4MSMB 2PVOD 4PYUA 2B3AA 2J0JA 3DVGY 2KLCA 2WHIA 2NS5A 2KFKA 2K3UA 1P0RA 2MH7A 4YSZB 4KZ0A 1AARA 2K25A 2JPHA 1T3QA 2DZIA 4NAWB 2LGYA 2WDVB 1K50A 1OGWA 4MJSB 1N63A 3P63A 1OFFA 2MJDA 5HFYA 4K7UA 2REXA 2WQYB 1SBBB 2ZCBA 3ZUNA 4ZOHC 3P4PB 5AZGA 4DK5A 3IFWB 2G3QB 4BKSD 3PHXB 1J0GA 1WM2A 1R4MB 1PGBA 4JIOU 1LQBA 4DHJD 3E9SA 3M62B 3R7RA 4DXFA 3VQIA 1KLGD 5BMHA 1KM7A 1WMHA 3QA8A 3VVWB 3PRPB 2KTFA 2H89B 2LXCA 3PRZA 4JGHB 3W5UB 2BWES 1ENFA 4F1SA 3A9KA 1CMXB 3RNCC 4AS1A 2KFKB 5J18A 1WYGA 2HTHA 3BZDB 5MPOA 3DHGC 4MGIE 2V0GA 2LRWA 2ZNVC 4HCNB 1L4ZB 2KJ6A 3RNEC 3FC4A 1FXAA 2KJHB 2PLPA 4NAMA 5EE3A 3GZNI 2GRIA 1UGJA 4AP4C 2LWPA 1KLVA 1UUPA 1N62A 2D3CA 1STEA 4BOSC 4BFRA 4ICUA 4NJCA 4REZA 2D3AA 4HDOA 1V1OA 4LK0M 1K51A 4WJNA 1WGKA 3ABVB 1D5ZC 1NYQA 2N9EB 3AULA 1K8RB 4PS3A 1WMHB 1T5XD 4IKGA 3ZW3A 4K7SA 1DGJA 2LGIA 1SXTA 3NZ3A 4E3CA 1SB3C 1J7BA 1WY8A 2LVOA 5C3JB 4USAA 2BBCA 1WJ4A 2LHEA 4DQOC 5JHAA 5IP4D 1XLOA 2N9KA 2WX1A 4OVUA 2QJLA 1V97A 3T3NA 1A5RA 2JRIB 1P98A 4RM8A 1WIAA 2QSDA 2GBKA 2IGGA 1ISNA 1JMLA 1L0VB 2Z59B 2JX5A 4B9KA 1XCTL 1TS3A 1B9RA 3SFEB 4ICVA 2LFIA 2WYQA 4B0EA 2O6VA 2AL3A 5AUIA 4P6VF 4L23A 2K39A 1L0XB 2W82A 2KXJA 2KVRA 3HM3A 3I57A 4MEMA 1AWDA 3Q6BA 5J17A 1E8WA 1I4XA 5HG2A 3W5VB 3ONSA 3RYTA 1FMAD 1WWTA 4FHJA 3DWGC 1T0YA 3MP9A 2BS2B 3Q3NC 4RGTA 2PIAA 1WJNA 1AYFA 3HVDA 3PZ7A 4XZ4A 1HZ6A 1DOYA 4S17A 1M94A 1T0QC 1FFUA 1WZ0A 3ZRCA 3HIZA 1WE7A 2IO0B 3ML8A 1L2NA 4DHZB 1GAQB 4C00A 3R2TA 2UWQA 2BKFA 2BB6A 1GG3A 2LMCA 2PW9A 2XK5A 4TUUA 3AE9B 1CK1A 2KNBA 3HHMA 2O6VB 2LZ6A 4LCDE 2NVUI 1DYQA 3IT6B 4TQ1A 1CQVA 1N5XA 2C7NB 1KOTA 4BBNF 3T9LA 4LTUA 4BVUC 1T0RC 4GB9A 4D2KA 4A3OA 1ROEA 3H7PA 4K1RB 3OWEB 2FE8A 4KZCA 3ZJVA 1N61A 3Q8AA 3ZTCA 2MCNB 3UIOB 4ZYNA 2OEDA 4K81A 2XN9C 5BO4B 1VCBA 4NJ6A 3N1YC 3P42A 1Q1OA 2FIFA 3KUZA 2KN4A 2ASQA 3CMMB 3KLSX 1UBQA 2KJRA 3U4EG 5JHBA 2AEHA 4FA6A 3N1XC 2BWFA 3H8HA 1FEHA 2ICIA 4LDTB 1DOXA 3GE8C 2LGSA 3URYA 1ESFA 2WXQA 2LUMA 4EE2A 3AM9A 2FCQA 4W9EA 2KD0A 1EF5A 3DQVA 2Y5BB 3ZGZA 5E6OA 2M56B 3B9JA 2MP2A 3KVFB 2FUHB 1V2YA 2WWZA 1XQQA 2Y5CA 1FRDA 3EECA 4A3PA 4RGOS 3CSFA 4ARIA 2BKRB 3GZNB 3U7DA 1AN8A 1QQRA 1OQRA 2RDHA 3B08A 2MBQA 5GMVA 3HVZA 4IWQA 3ZRFA 3C0RB 3BK1A 2G45B 2V4IB 2DNFA 4IDIA 3QWZB 2K22A 2V4LA 5IAAC 4DWFA 2PE6B 4YSYB 3X0WA 1E7UA 2MW5A 4RH6A 4KV2A 3GOEA 3Q8CA 1UH6A 2MBBB 1VLBA 2QDFA 1IPGA 2K8BA 5C1ZA 2K6QA 4LLGM 3MHSD 1I4PA 4NZLB 4L2YA 2V3SA 1XO3A 2ZW1A 2MRPA 3RD2A 2M17A 3IHPC 2NCNA 3EHVA 4HVBA 2MP2B 3W1SA 4XE0A 2V1YA 3TEXA 4TV3A 2C60A 3OJ3A 2L8JA 1WXVA 3TJPA 5DPSA 1GB4A 3DVGX 4G50A 4RGMA 2RPVA 2VH2A 4M0WA 5H8YE 1UWXA 4US9A 4P1BC 3PHWB 1V1PA 1IYFA 2M19A 2FCSA 3DBHI 2Y5PA 1LM8B 2BT6A 4LNOA 1OQQA 2DAJA 4NQKE 2LJ5A 5KHQA 1NENB 3EUB2 1PQSA 1YD8U 2I1JA 2KACA 3ZNHB 1C3TA 3QQ8B 5IKCM 4A8XC 1EF1A 2ZNVB 3TEZA 1ZKHA 2KDIA 1YQ4B 4W9KA 3M3JA 3NRZA 4YXDB 3PTFC 1JWUD 2PMVA 2LGDA 1NYRA 4HJGE 2DENB 3JYUA 4ZRPA 2AQ2B 3LYYA 5EE0A 3AXCA 3MC9A 2W3RA 3V60A 4HLEA 2WXKA 3EA6A 3ZNZB 3A1QA 1DOIA 2JRHA 4GGQA 4LNNA 1XXGA 1V5TA 1N5WA 4II3B 3SU8X 4M0WB 5BYRA 3HK0A 1P3QU 2XEWA 2MBEA 2IBIB 4K3BA 2VH1A 4LJOB 2K6DB 1RM6C 2G1EA 1V1PB 2I2YA 2K8HA 3UIPB 3Q8FA 2KVZA 2A4ZA 1SE2A 3UQBA 1GC6A 2DYOA 4W9HA 2PTLA 1MG8A 4NQLB 5GXGB 1B1ZA 2C7HA 3QHTA 2BQQA 4HJKA 1RAXA 1E6EB 3E56A 4M8NA 2D3GA 1HEZE 2AQ1B 4NY0A 4JPSA 3KW5B 2K8CA 4F7ZA 1WXAA 2L83A 2DYBA 4ZYSA 4ANWA 1C79A 3MTNB 5H92C 3BWUD 3WIMA 3ECIA 2INNE 2ACZB 2BS3B 4LNIA 1WX7A 4MJSA 4XDCA 2L0FA 4IM3A 1XLQA 3ML9A 2KMMA 1IUEA 4HEA1 3EGRA 2E6XA 3NZSA 4CQNA 2DYMA 4IOIE 3A1QB 1FFVA 1YX5B 3DDCB 3P2BA 4MDKE 2DAFA 4WAFA 1S3SG 2MLBA 1H8CA 2RR9A 3ALBA 3V3XA 3NS8A 1QLBB 1D6EC 4KGRA 5C23A 4PS8A 2L00B 2EELA 2NBVB 3BYYB 2Z0EB 2N9LA 2JWUA 3VH3B 5EE9A 4HCPB 3OJ4B 4YWGG 1FRRA 2AQ3B 2KWDA 5DPTA 1YN4A 1KTKA 1ZDVA 2AWTA 1RFKA 2J42A 2JUOA 3AECB 3M63B 3U7ZA 3GE3C 1QOAA 1PGXA 1J7CA 1VZ7A 1F9JA 5IA7A 1FNVA 2NBWB 5TR5A 2RPQA 4L1BA 1UBIA 4C7YA 4DBGA 2JF5A 4HPLB 2TSSA 5LNK1 2WU5B 2YLMA 2RMMA 3OLMD 1UELA 3AE4B 5IO9A 1WE6A 3TEWA 2L7RA 3SR6A 3PLVA 4GSWA 4OVZA 3APFA 1XD3B 4TMAB 3TIXA 1JRUA 2O2VA 1XT9B 1E5WA 2J53A 3AV8A 2KMCA 1JCKB 1XF5L 2ZPYA 1J19A 3RUIB 3Q69A 3MHZA 1SE4A 2K9XA 4WAAA 1LXDA 1RFAA 1MHHE 3V6CB 4X57B 2OOBB 3KYCD 1WR6E 2RD0A 1HTQA 3T8MA 4BAXA 3CWIA 3J9CA 4YTPB 3AEDB 3RPFC 1QOGA 1KRHA 4M00A 3W1SC 3LXFA 3DHHC 2KWCA 4ACFA 3BVMA 3DBHB 4H2AA 1QILA 1SIJA 2DBYA 2PKOA 4FLHA 2IPKD 2OJWA 1YMHE 2J52A 1A70A 3JVZX 2WXFA 3AE7B 3B1LX 3K9OB 1BMLC 2GBNA 2O2VB 5BMIA 3ZO5B 4P7IA 4MACA 2KAJA 4XGAB 5BMGA 3L4PA 1ZPSA 5IOIA 1WZ3A 1GOZA 2LUEA 4KKIA 2M4NA 4JWUC 4IG7B 2I1KA 3A4SC 1L5PA 3WAPA 3I9V1 2MJEA 1E8YA 1ET6A 3RZWC 1WR1A 3P4RB 2WXOA 2CU1A 1GPXA 2KN5A 2G4SA 3A33B 2WNMA 3RNGC 1MFWA 2JQRB 3MJWA 1VR9A 1JWMD 1JWBD 3KWVA 3AE6B 4WJQA 4RF1A 2CHWA 5I4DA 2PE9A 2KKCA 1GUAB 4WURA 2R2OA 1OEYA 4KX6B 3N20C 1GC7A 3SD5A 4C7ZA 1NI2A 2WDQB 1KH0A 3AEFB 4HK2A 1TS4A 1TS2A 3O13A 1TY2A 4XWWA 3ZYYX 3NY5A 1VD2A 3L10B 4M8MA 3WCQA 1SE3A 2HJ1A 4MGKE 4WWMA 3WAOA 3HRDD 2PVGC 2CU3A 2LHDA 4XX5A 2JYEA 3GP7A 2W3SA 3CF6E 3L54A 1IGCA 4MGYE 2IYDB 1BXTA 1NDDA 4URKA 3QARA 1C4PA 2FNJB 2Z0DB 3WAMA 1YNTE 4TKNA 4HWIB 1MJDA 4RFBA 4BOZB 1VZ8A 4EFOA 5L95C 1ZW7A 3VXWA 3DWMA 3NOBA 1E10A 4C80A 1GJZA 1F0ZA 1I35A 1BT0A 5JXVA 1I4HA 2XNAC 4JL9A 4G11A 1XLPA 1NI3A 5G5HA 5J2RA 1CZPA 3AN1A 3UI3A 3PS6A 3UGBB 1V8CA 3Q2AC 4MELA 5G5GA 4MSQB 1C77A 4WWPA 1E7PB 2GBMA 1E7VA 3NS1A 2MJ3A 1TY0A 2O6VD 1V6EA 3FAHA 2N7JA 3DPDA 4II2B 4HDQA 3N32A 2WXJA 3JW0X 3ZXRA 1K52A 1JROA 2M1MA 3Q3JA 2W54A 1WXSA 2GMIC 3KYDD 2KLGA 1WI0A 3PO0A 1D4BA 1RRBA 4YTMB 1D5XC 3PT2B 4J3OD 1E8ZA 2ONQA 1UD7A 1L6UA 4DXGA 2YEPF 1SGHA 4W9LA 2BTEA 1RWSA 2L1AA 1N60A 2Y3AA 4C56C 3SEBA 4BZAA 1TJEA 2KFJA 4EZKA 5DPRA 4RNAA 4FJVB 4LDTD 2DZMA 4AQ7A 4IUMB 1UF0A 1Q5WB 4KIKB 1F2RC 2JSVX 3BIID 3R66C 3V61A 3CSTA 3LB8C 1T6BX 2KO3A 5CX3A 4G0NB 1GNUA 3EC8A 1C4AA 3RMKC 4M01A 4N9F4 3AEAB 4A55A 3W9CB 4ZRQA 4GDKB 2N7EA 3T3OA 2NR2A 1H4RA 2K0PA 3V62A 3BVZA 2J7QB 2FIDA 5LXIB 2BW2A 3Q3MC 1WSPA 1WXQA 1LFDA 3VUWA 3APCA 3L13A 2SAKA 2JXTA 2N9PC 2YEPB 4AWJA 2QIEB 2DWQA 2FBWB 4W9CA 2M0AA 2EMTA 4WIPA 2ZVOA 3DVNU 4HROA 1LO5D 2W9NA 1OEYJ 2MBOA 1OQYA 1V5OA 1LGRA 2KMAA 3IBEA 1ET9A 1F1HA 3ZDMC 3VRAB 4XWTA 1TZ1A 4ANVA 2RDBC 4YSXB 2KHWB 3AE1B 3BYTB 1PFDA 3TSSA 3VHTC 4W9IA 2KDMA
chains in the Genus database with same CATH topology
1SF0A 2LHEA 1ZP0B 2WP9B 5EE9A 4DQOC 4OZCA 1XLOA 2NMQA 5D7GA 4YWGG 1I7HA 2N9KA 1FRRA 2AQ3B 2KWDA 2QJLA 1YN4A 1V97A 4ZHPA 1FIQA 1KTKA 1ZDVA 3MJ5A 2WU2B 5FK9C 3T3NA 1RFKA 2J42A 1E0ZA 2LJIA 1MHXA 4B0MA 4WQMA 2E3TA 2QSDA 3AECB 5HI1A 1EU3A 2INPE 2IGGA 3U7ZA 1JMLA 3CIRB 1QOAA 1PGXA 1J7CA 1F2RI 1VZ7A 1EWYC 1PYWD 1L0VB 2W55A 2JX5A 3NVVA 1FNVA 1XCTL 1TS3A 3IT4B 1PDXA 1B9RA 4L1BA 2IJ0A 2CJNA 3SFEB 4C7YA 2VZKB 5E6JA 1L6VA 2WLBA 4TSSA 2TSSA 5LNK1 2WU5B 2RMMA 2LFIA 4B0EA 3V05A 4GLSC 1FM0D 2WXPA 3AE4B 4N6EB 5AUIA 4ITKA 3TEWA 4P6VF 4L23A 4ZHOA 3SR6A 1L0XB 2W82A 3I57A 1Q10A 1K53A 1AWDA 4US8A 1FD6A 4OVZA 4KGTA 1R7SA 4TMAB 4KKJA 1I4XA 2J53A 3AV8A 4JE3B 5HG2A 3VRBB 3W5VB 4MT5A 1JCKB 2X38A 1XF5L 1FMAD 3BVGA 1XLNA 3AB5A 2BYTA 1WWTA 3W2DA 3DWGC 3Q69A 3MHZA 3MC0B 1SE4A 3HUIA 3MP9A 2WDRB 2K9XA 2JYTA 5EE1A 2BS2B 3ZQ4A 5BYSA 3GS2A 1AW7A 1MHHE 2PIAA 3BK2A 3IAS1 4RGTA 1C4CA 1YJJA 3HVDA 1AYFA 3PZ7A 1JALA 1HZ6A 1DOYA 3CWIA 3J9CA 4YTPB 1C9FA 1FFUA 1ZE3D 4A9AA 3AEDB 3RPFC 3U2SC 1QOGA 2N0SB 3RFZB 1KRHA 3AE5B 1GAQB 4TQ0A 1QOBA 3AE2B 1FCCC 3R2TA 1P7FA 3LXFA 1PUTA 1ZXIA 2BB6A 1L4DB 2LMCA 2PW9A 4FXCA 3BVMA 3NVYA 4H2AA 2GI9A 1FO4A 3AE9B 1CK1A 2DBYA 1QILA 1SIJA 2PKOA 2IPKD 1YMHE 1TS5A 2J52A 1A70A 4GDLB 1DYQA 1QKZA 4OZAA 3IT6B 1VZ6A 3AEBB 4TQ1A 1CQVA 1FXIA 1N5XA 2JZPA 3R8BA 4YT0B 4LTUA 1KF6B 1P7EA 3IAM1 3Q8EA 2KQ4X 3NUHB 3VR9B 4D2KA 2WXFA 1ROEA 3AE7B 3ZJUA 4Q2JA 3OWEB 2ZW0A 1SEBD 1BMLC 2FE8A 3ZJVA 1N61A 5BMIA 3Q8AA 4MACA 2KAJA 5BMGA 1IGDA 3L4PA 1ZPSA 4HKZE 4OHJA 3AEGB 1ZOYB 1GOZA 2OEDA 5T8IA 2XN9C 2BB5A 1JWAD 4KKIA 3P42A 4JWUC 2KN4A 1L5PA 3KLSX 1GB1A 4O1NA 2QMTA 3I9V1 2MJEA 1WRIA 2Q5WD 3U4EG 1ET6A 1XEEA 5TSSA 1FNWA 3NVZA 3N9YC 2B76B 4A90A 3P4RB 2WXOA 1F77A 2I38A 1GPXA 2JU6X 1VDVA 2WXNA 1MI0A 1ZDXA 2WNMA 5D3IB 3H8HA 1I4QA 2WS3B 1FEHA 2ICIA 1DOXA 2RDGA 2JQRB 1VR9A 1JWMD 1JWBD 2G9HD 3URYA 1ESFA 3KWVA 2WXQA 3AE6B 4RF1A 5I4DA 1CJEA 2LUMA 4EE2A 1EWCA 1ZXHA 4WURA 1HQRD 1JRPA 3AM9A 1J7AA 1HXYD 1E9MA 4KX6B 3ZGZA 2AX5A 4C7ZA 2M56B 2ON8A 4RGNA 3B9JA 2WDQB 1BUIC 1SJHD 1KH0A 3AEFB 4OZBA 1TS4A 1TS2A 2K5PA 2Y5CA 3O13A 3P1MA 4JWSC 2Z8LA 1TY2A 1QT9A 3ZYYX 1FRDA 4XWWA 3KWLA 1YJIA 4RGOS 4ARIA 1EU4A 2VZKD 5FR3A 3WCQA 5HHDG 1SE3A 4WWMA 1QOFA 1AN8A 3HRDD 2WXHA 1QQRA 5D3DA 4A6QA 1OQRA 2RDHA 2PVGC 4P16A 2CU3A 2LHDA 3C8YA 4HRSA 2JYEA 2IGHA 3HVZA 3GP7A 3BK1A 2W3SA 2V4IB 2WXRA 3TUOA 1IGCA 4IDIA 1MVKA 1TKGA 1BXTA 2K22A 1EM7A 1C4PA 1VJKA 1YN5A 2CJOA 4XDDA 4YSYB 1QF6A 1Y56A 1YNTE 1TKEA 4RH6A 3Q8CA 4RFBA 2NTSA 1VLBA 1VZ8A 3DWMA 1E10A 3Q8BA 4C80A 4LLGM 1F0ZA 1I4PA 1UNSA 3U52E 2V3PA 4NZLB 5JXVA 1I4HA 2XNAC 4L2YA 2LEKA 3P4QB 1TYGB 2QEJC 1XLPA 1XO3A 2ZW1A 1NI3A 3TEYA 5G5HA 1XCQL 1CZPA 2WXLA 4XE0A 2BS4B 3W1SA 3P4SB 3TEXA 4HKQA 3AN1A 3UI3A 3PZ8A 1JQ4A 1V8CA 5G5GA 2L32A 1FNUA 1C77A 2WXMA 1E7PB 1RYJA 2SEBD 1I4RA 4R3DA 4N58A 1GB4A 5FKAC 3NS1A 4RGMA 2MJ3A 2D5GA 1TKYA 2RPVA 3VR8B 4M0WA 1TY0A 4MH8A 5H8YE 1NVID 2R61A 1UWXA 1M4VA 4JX1C 4US9A 4OW0A 2H88B 2V3NA 3FAHA 4WH4A 2N7JA 4KGSA 3B2GA 1JW9D 1KFYB 1V1PA 1VRAB 2M19A 4YTNB 2WXJA 4N59A 2Y5PA 2BT6A 2MEKA 2HDEA 1K52A 1OQQA 4RF0A 1JROA 1KLUD 3AEEB 2W54A 2WXGA 1I4GA 1NENB 3EUB2 2PVOD 3IXSA 5C2TB 3PO0A 1D4BA 2IGDA 1MPEA 2KACA 4YTMB 1D5XC 4J3OD 2QILA 1TZOA 2K3UA 2L52A 2MH7A 4YSZB 4A8XC 2ONQA 1NEKB 3TEZA 1YQ4B 1L6UA 4DXGA 1T3QA 2YEPF 1PGAA 4NAWB 1L0YB 2WDVB 1YQ3B 2BTEA 1RWSA 1YN3A 3NRZA 2L1AA 1K50A 1N60A 1N63A 3P63A 4YXDB 1OFFA 1JWUD 2Y3AA 4C56C 2PMVA 2MJDA 2J4XA 3SEBA 2FUG1 5HFYA 1NYRA 4HJGE 2WXIA 2NTTA 2WQYB 4ZRPA 2AQ2B 1SBBB 3LYYA 5EE0A 1TJEA 2EKIA 2W3RA 4RCOA 4ZOHC 3P4PB 2WXKA 2IDYA 3EA6A 3R2IA 4RNAA 1DOIA 1SSNA 4AQ7A 1XXGA 1N5WA 1PGBA 1F2RC 5BYRA 3E9SA 3AH7A 2JSVX 3BIID 3AE3B 1ACCA 4DXFA 1RM6C 2G1EA 1V1PB 3VQIA 3LB8C 2I2YA 1T6BX 1KLGD 5BMHA 3AMZA 1D5MC 3FILA 3Q8FA 3GB1A 1C4AA 2H89B 1SE2A 3MFGA 3W5UB 1IBXA 2OHFA 2DYOA 2PTLA 5GXGB 1B1ZA 1ENFA 3AEAB 4A55A 3SFDB 4AS1A 4MM3B 1E6EB 3E56A 4ZRQA 3W9CB 4GDKB 1HEZE 2AQ1B 1WYGA 3BZDB 5MPOA 4JPSA 2V0GA 4UDUC 3T3OA 3KQ4A 2L83A 2K0PA 1L4ZB 4ZYSA 1C79A 1FCLA 3BVZA 3BWUD 5H92C 1HA5A 1HZ5A 3FC4A 2BW2A 1FXAA 2PLPA 4NAMA 2INNE 1WSPA 1WXQA 5EE3A 2ACZB 2BS3B 4ARCA 2GRIA 1UGJA 2JXTA 2SAKA 2YEPB 4XDCA 1UUPA 2QIEB 1N62A 1XLQA 1STEA 2KMMA 1IUEA 3ZJTA 4HEA1 2DWQA 4NJCA 2FBWB 3EGRA 2E6XA 4CQNA 2DYMA 4IOIE 1JWSD 2M0AA 3B2FA 3ETRA 4REZA 1V1OA 4LK0M 1FFVA 1K51A 3NVWA 4WIPA 4PT5A 5AUKA 1SJED 4HROA 1LO5D 2HTME 4WAFA 5BYQA 1WGKA 1ET9A 2N9LA 3ABVB 3V3XA 1D5ZC 1NYQA 1QLBB 3VRAB 4XWTA 1C76A 3AE8B 1C78A 1D6EC 2DLBA 3FILB 1T5XD 4IKGA 4YSXB 1DGJA 2LGIA 1UWMA 1SXTA 4KGRA 3AE1B 3BYTB 1PFDA 3NZ3A 2EELA 3TSSA 1SB3C 1J7BA 2GB1A 3BYYB 5C3JB 1IBXB 1ZUD2 4USAA 2JWUA 2BBCA 2KDMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SF0 A;  2WQY B;  2W3S A;  1A70 A;  1ZP0 B;  2WP9 B;  1TJE A;  2EKI A;  5EE0 A;  5EE9 A;  2W3R A;  3AEB B;  4IDI A;  1FXI A;  1N5X A;  3P4P B;  4ZOH C;  1TKG A;  4YT0 B;  1XLO A;  4LTU A;  2K22 A;  1KF6 B;  1I7H A;  1FRR A;  1VJK A;  2QJL A;  1V97 A;  3VR9 B;  4ZHP A;  1FIQ A;  1DOI A;  1ROE A;  3AE7 B;  2CJO A;  2WU2 B;  1N5W A;  4YSY B;  1RFK A;  1QF6 A;  1E0Z A;  1TKE A;  1N61 A;  4WQM A;  2E3T A;  3AEC B;  3AH7 A;  1VLB A;  2KAJ A;  3BII D;  3CIR B;  1QOA A;  3AE3 B;  1J7C A;  3L4P A;  1EWY C;  1L0V B;  1RM6 C;  2G1E A;  2W55 A;  1ZOY B;  3AEG B;  2JX5 A;  3DWM A;  3LB8 C;  3NVV A;  1E10 A;  4C80 A;  3AMZ A;  1F0Z A;  1JWA D;  1PDX A;  1B9R A;  2CJN A;  3SFE B;  2LEK A;  2H89 B;  3P4Q B;  4C7Y A;  1TYG B;  4JWU C;  1XLP A;  1L6V A;  1XO3 A;  2WLB A;  1NI3 A;  3W5U B;  2WU5 B;  1L5P A;  5G5H A;  2OHF A;  5GXG B;  1CZP A;  2BS4 B;  3AEA B;  1FM0 D;  3P4S B;  2MJE A;  1WRI A;  3AN1 A;  3SFD B;  2Q5W D;  3AE4 B;  4N6E B;  1E6E B;  3W9C B;  3NVZ A;  5AUI A;  1WYG A;  1V8C A;  4ITK A;  5G5G A;  4P6V F;  4ZHO A;  1JQ4 A;  2B76 B;  5MPO A;  3SR6 A;  3P4R B;  1GPX A;  1E7P B;  1RYJ A;  2L83 A;  1AWD A;  4US8 A;  4N58 A;  1VDV A;  3NS1 A;  5H92 C;  2MJ3 A;  1TKY A;  2WS3 B;  3FC4 A;  1R7S A;  3VR8 B;  1FXA A;  5H8Y E;  1NVI D;  1WXQ A;  4JX1 C;  2JQR B;  2ACZ B;  2BS3 B;  5EE3 A;  4US9 A;  1DOX A;  3AV8 A;  3VRB B;  2H88 B;  3FAH A;  3W5V B;  1JWB D;  3B2G A;  1JW9 D;  1KFY B;  2M19 A;  3AE6 B;  2QIE B;  1FMA D;  1N62 A;  1XLQ A;  1CJE A;  1XLN A;  2KMM A;  3AB5 A;  4YTN B;  1IUE A;  1WWT A;  3DWG C;  4N59 A;  2BT6 A;  2DWQ A;  1JRP A;  2FBW B;  3AM9 A;  3HUI A;  1OQQ A;  2WDR B;  1J7A A;  1JRO A;  2K9X A;  1E9M A;  4KX6 B;  5EE1 A;  2BS2 B;  3B2F A;  3AEE B;  2W54 A;  3ETR A;  1FFV A;  2AX5 A;  1NEN B;  3EUB 2;  2PVO D;  3NVW A;  4C7Z A;  5AUK A;  2M56 B;  3HVZ A;  2PIA A;  2WDQ B;  3B9J A;  4HRO A;  2HTM E;  1YJJ A;  1AYF A;  1JAL A;  5C2T B;  3PO0 A;  3AEF B;  1WGK A;  4YTM B;  1DOY A;  2K5P A;  2Y5C A;  3ABV B;  3CWI A;  3P1M A;  4JWS C;  2L52 A;  1NYQ A;  2MH7 A;  1QT9 A;  3ZYY X;  1FRD A;  4YTP B;  4YSZ B;  1FFU A;  1NEK B;  3KWL A;  1QLB B;  1YJI A;  3VRA B;  3AED B;  3RPF C;  1YQ4 B;  3AE8 B;  1QOG A;  1L6U A;  2N0S B;  4A9A A;  1KRH A;  3AE5 B;  1GAQ B;  1T3Q A;  1QOB A;  3AE2 B;  3WCQ A;  4YSX B;  3LXF A;  1DGJ A;  1PUT A;  1UWM A;  1ZXI A;  1YQ3 B;  1QOF A;  2WDV B;  3AE1 B;  4WWM A;  1PFD A;  1RWS A;  3HRD D;  3NRZ A;  1OQR A;  2PVG C;  2CU3 A;  1N60 A;  1N63 A;  1SB3 C;  1J7B A;  3NVY A;  3P63 A;  1OFF A;  3AE9 B;  4FXC A;  4YXD B;  5C3J B;  1ZUD 2;  1FO4 A;  4HRS A;  2MJD A;  2DBY A;  1SIJ A;  4USA A;  2PKO A;  1NYR A; 
#chains in the Genus database with same CATH topology
 1SF0 A;  2WP9 B;  3ZIM A;  2KDF B;  3EFU A;  5D7G A;  3FKY A;  5EDS A;  2MSE D;  4ZHP A;  2ZPN A;  3MJ5 A;  2WU2 B;  3Q14 C;  5FK9 C;  1EUV B;  3X23 A;  2MHJ A;  4FHK A;  3ENE A;  3PLU A;  2E3T A;  4WQM A;  1EU3 A;  2INP E;  4F8C B;  3CIR B;  1F2R I;  1EWY C;  1PYW D;  3O65 B;  2W55 A;  4LNF A;  2DZK A;  1OTR B;  3IT4 B;  1PDX A;  2OJR A;  4QAY A;  2IJ0 A;  2CJN A;  2VZK B;  2UU7 A;  5E6J A;  1L6V A;  4TSS A;  1P1A A;  4GOC A;  2ZEQ A;  3V05 A;  1FM0 D;  1TBE A;  4N6E B;  4CO7 A;  4RMA A;  4ZRK A;  1SE9 A;  4ITK A;  4A20 A;  4J6I A;  4ZHO A;  4WWO A;  4KVG B;  2D3B A;  4US8 A;  1FD6 A;  2BYE A;  2KX3 A;  2LD9 A;  1UGM A;  4ZDV A;  5CHV C;  3TCA A;  2JT4 B;  2KDB A;  2KOX A;  4ANX A;  4MT5 A;  2LVP A;  2X38 A;  4B6W A;  1XLN A;  2D07 B;  3AB5 A;  4FBJ B;  5AZH A;  2ZJD A;  3HUI A;  2WDR B;  3ZQ4 A;  5BYS A;  3BK2 A;  1YJJ A;  1JAL A;  4FN2 A;  1MG4 A;  3Q3F A;  2GOW A;  1E8X A;  1ZE3 D;  4OVV A;  3U2S C;  5DCN A;  4IC7 B;  2N0S B;  3RFZ B;  4GIV A;  3AE5 B;  1QOB A;  2XBB C;  4BKS A;  4FJY A;  4KDI C;  3L17 A;  2WDT B;  4P1C C;  1WF9 A;  1WXM A;  4FXC A;  3NVY A;  2QCZ A;  3DCG A;  3Q3O C;  1FO4 A;  1N6Z A;  2DX5 B;  4W9F A;  4NPN A;  4OZA A;  1VZ6 A;  1FXI A;  3R8B A;  1KF6 B;  3IAM 1;  2KQ4 X;  4NNJ B;  3NUH B;  1WGR A;  4EOY A;  3ZJU A;  2LGX A;  4Q2J A;  2ZW0 A;  1SEB D;  2EMS A;  3DHI C;  1WRD B;  4HKZ E;  1ZOY B;  3QIJ A;  5T8I A;  3A9J A;  2LVQ A;  3PZD A;  3ZNI D;  1P9D U;  2K1F A;  3D32 A;  1GB1 A;  4O1N A;  2KDE B;  4W9D A;  2D11 A;  4IM2 A;  2Q5W D;  3C19 A;  1XEE A;  5TSS A;  1FNW A;  2GBR A;  4BKG A;  3N9Y C;  4A90 A;  4KDL B;  2JU6 X;  1ZGU B;  1VDV A;  1MI0 A;  1ZDX A;  3VUY A;  2BGF A;  2BPS A;  2N7D A;  2WS3 B;  1TT5 B;  5E6P A;  4CYE A;  2HD5 B;  3TMP B;  1TTN A;  2G9H D;  1J8C A;  4DHJ B;  3QAQ A;  2BVC A;  2AYO B;  1EWC A;  1ZXH A;  1HQR D;  1JRP A;  1E9M A;  1Z2M A;  4K3C A;  2WX0 A;  4GXB A;  4E74 A;  1KJT A;  2ZCC A;  2ON8 A;  3DVN V;  1WGH A;  3AU4 A;  4OZB A;  5G2N A;  2JXX A;  2K5P A;  2Z8L A;  1QT9 A;  2C7M B;  4ZRJ A;  1EU4 A;  5FR3 A;  2NPT B;  1G6J A;  3A9J B;  3NG0 A;  1QOF A;  4GMV A;  5D3D A;  5AEK B;  1RLF A;  4ANU A;  4HRS A;  1V81 A;  2BYV E;  3VAW A;  2MA9 B;  1WX8 A;  2WXR A;  3TUO A;  2MWS B;  1MVK A;  1TKG A;  3NJT A;  2JWZ A;  2KTR A;  1EM7 A;  1VJK A;  1YN5 A;  4GU2 A;  4YL8 A;  4ZRI A;  2CJO A;  3DBR I;  4I6N B;  2NBU A;  4XDD A;  1QF6 A;  2N9X A;  4XC2 A;  1YOV B;  5CTR C;  3APD A;  4AJY B;  4EUT A;  3Q8B A;  3DBL B;  3U52 E;  2V3P A;  5L83 A;  2LEK A;  3AI5 A;  3P4Q B;  4BKT A;  1TYG B;  2QEJ C;  2M0X A;  1EO6 A;  2KAN A;  4M02 A;  3IG3 A;  1WX9 A;  2IY1 B;  2JVC A;  3SHQ A;  4HKQ A;  2N1W A;  3RUL A;  4MGZ E;  1RYJ A;  2QHO A;  1WYW B;  2R2Q A;  2SEB D;  4R3D A;  4N58 A;  4DHZ E;  2CHX A;  2KK8 A;  2D5G A;  3VR8 B;  4JX1 C;  4FJZ A;  3H1U A;  2GLS A;  4IM0 A;  1I42 A;  2H88 B;  4WH4 A;  4KGS A;  3B2G A;  4YTN B;  1R4N I;  4N59 A;  2MEK A;  5D2M B;  2PPH A;  2KTR B;  5DPW A;  2WXG A;  1I4G A;  3A9K B;  3IXS A;  5LLI A;  5C2T B;  2IGD A;  1MPE A;  3UIN B;  2QIL A;  4MM3 A;  3PVL A;  1TZO A;  3VUX A;  3WAL A;  2L52 A;  2N4F A;  1NEK B;  2M8S A;  1PGA A;  2D2Q A;  1L0Y B;  1YQ3 B;  2C9W B;  1YN3 A;  3LJ3 A;  4CHK A;  1Z5S B;  2G4D B;  4G3X B;  2J4X A;  2FUG 1;  2WXI A;  2NTT A;  3AU5 A;  2EKI A;  3IVF A;  4RCO A;  2FAZ A;  2IDY A;  3R2I A;  3VFK A;  5D6J B;  1SSN A;  4WJO A;  4DDG D;  4E71 A;  2IY0 B;  3AH7 A;  3AE3 B;  1ACC A;  1WFY A;  3M95 A;  5JZE B;  3R3M A;  3H9D A;  3AMZ A;  1D5M C;  4WJP A;  3FIL A;  2AL6 A;  3B0A A;  4FAD A;  2MX2 A;  3GB1 A;  4EEW A;  2YVC A;  1V80 A;  3MFG A;  4IWP A;  1IBX A;  2OHF A;  4W9J A;  3SDL C;  4LNK A;  1Y8R C;  3TL5 A;  3SFD B;  2IO2 B;  4MM3 B;  2V9H A;  4UDU C;  1YX6 B;  3BY4 B;  3KQ4 A;  3RT3 B;  3DBS A;  1FCL A;  2JZZ A;  1HA5 A;  1HZ5 A;  3RZF A;  4PK1 A;  2EKE C;  3QK0 A;  4ARC A;  2IO3 B;  2A5U A;  2DZJ A;  3N30 A;  3N3K B;  1FPY A;  3ZJT A;  3I63 C;  1JWS D;  3B2F A;  3ETR A;  4DDI D;  3NVW A;  2KC1 A;  4PT5 A;  5AUK A;  1SJE D;  2HTM E;  5BYQ A;  2C5L C;  2L05 A;  4S0R A;  4KIK A;  1WJ6 A;  3BIN A;  1C76 A;  1UZX B;  3AE8 B;  1C78 A;  2DLB A;  3FIL B;  1UWM A;  2GB1 A;  1IBX B;  1ZUD 2;  1ZP0 B;  4OZC A;  3DOW A;  2NMQ A;  2KYW A;  4GDK A;  1I7H A;  3WAN A;  4WQO B;  3ZNG C;  1FIQ A;  2L3Z A;  4AJW A;  2RSU A;  3RNA C;  3RN9 C;  1WGD A;  1E0Z A;  2LJI A;  3L16 A;  1MHX A;  4B0M A;  4I6P A;  5HI1 A;  4EZL A;  5IN7 A;  2X8X X;  5E6N A;  3NVV A;  3PPA A;  1X1M A;  4AUQ C;  2XK5 B;  5HKH A;  1F52 A;  2WLB A;  4IWO A;  4GLS C;  2KQS A;  2WXP A;  4GDL A;  3QJZ A;  3PRM B;  3DBR B;  1V49 A;  3U8Z A;  2JY6 A;  3LDZ E;  3H7P B;  3PSE B;  5LXH A;  1Q10 A;  2J0K A;  1K53 A;  4KGT A;  1R7S A;  2LAS A;  2PEA A;  3PRE A;  3RNF C;  4KKJ A;  4JE3 B;  3VRB B;  3RI7 C;  1SIF A;  3BVG A;  5KHO A;  1S1Q B;  2BYT A;  3W2D A;  4LJP B;  3MC0 B;  1NBF C;  2JYT A;  5EE1 A;  4FUL A;  5CHW A;  3GS2 A;  1AW7 A;  4HPP A;  3IAS 1;  3PGE A;  1C4C A;  2L76 A;  3OG5 A;  3QCA A;  1V9J A;  3MC8 A;  1R4M I;  1C9F A;  5D94 A;  4A9A A;  3NZU A;  1WM3 A;  4TQ0 A;  3AE2 B;  1FCC C;  1P7F A;  3U30 A;  1PUT A;  1ZXI A;  4AOF A;  4EZJ A;  1L4D B;  1YQB A;  3KH0 A;  2GI9 A;  1R4N B;  2MQJ A;  3I3T B;  2ZZP B;  1TS5 A;  4GDL B;  1QKZ A;  4WWN A;  3AEB B;  2JZP A;  3L08 A;  4GN1 A;  4YT0 B;  1P7E A;  1WJU A;  3Q8E A;  3VTU A;  5AZF A;  3VR9 B;  1V86 A;  3W1Y A;  2QC8 A;  3VH4 B;  2KT7 A;  2CHZ A;  2VRR B;  5FR6 A;  1T0S C;  1IGD A;  2IO1 B;  3DBL I;  4KSL C;  4OHJ A;  3PV1 A;  3AEG B;  3I5J C;  2BB5 A;  1WGY A;  1JWA D;  2GBJ A;  3R7Q A;  2HE7 A;  1FXT B;  3HM6 X;  2CS4 A;  2RGF A;  3ZKJ C;  4C4V A;  2QMT A;  2UYZ B;  1WRI A;  2JZ3 B;  3KUC B;  3ZTD A;  3NVZ A;  2FCM A;  2N1V A;  2B76 B;  1F77 A;  2I38 A;  3KUD B;  4I6L B;  3ZDT A;  2WXN A;  2PJH A;  2CKH B;  5D3I B;  1I4Q A;  2LXA A;  2RDG A;  4KSK C;  1TGZ B;  2DHZ A;  3VTW A;  3S2A A;  1CJE A;  2KWV B;  4K7W A;  1J7A A;  3NHE B;  1HXY D;  3ZXV A;  4MH0 E;  1C1Y B;  2AX5 A;  3K9P B;  1Q0W B;  4RGN A;  2BF8 B;  2FCN A;  1BUI C;  3V6E B;  1YIW A;  1SJH D;  3A4R A;  3JSV A;  4IW0 A;  2CR5 A;  3ZLZ A;  3P1M A;  2INC C;  4JWS C;  2KC2 A;  4JQW C;  3KWL A;  1YJI A;  4DXA B;  3EFC A;  2VZK D;  5HHD G;  4JLC A;  4A6Q A;  2WXH A;  3QC8 B;  4PS7 A;  3OAW A;  4P16 A;  2L0T A;  2LI5 A;  3C8Y A;  4B95 A;  3H6N A;  1L7Y A;  4C4V B;  2IGH A;  4RM9 A;  3L0W B;  3WA0 A;  1HE8 A;  5JH5 C;  2IZV B;  4EKU A;  2BYF A;  2KZR A;  1Y56 A;  1TKE A;  4PYZ A;  3RCZ A;  2NTS A;  4XYC A;  1WH3 A;  4ASW C;  2MBH A;  2J0M A;  2D10 A;  1UNS A;  4NAW A;  1IP9 A;  3N1Z C;  3TEY A;  2LRU A;  2ZVN A;  1XCQ L;  1TIF A;  3ZVV A;  2WXL A;  2BS4 B;  3VDZ A;  3RNB C;  3P4S B;  1YJ1 A;  3JSV B;  3PZ8 A;  4NJ7 A;  3VTV A;  4BBN C;  3UF8 A;  5CHF A;  1JQ4 A;  1HTO A;  3QX1 A;  2L32 A;  1FNU A;  4HPM B;  2WXM A;  1WGG A;  1I4R A;  1E90 A;  5FKA C;  2IND C;  4W9G A;  1TKY A;  2NPT A;  3H7S A;  2KWU B;  4MH8 A;  1NVI D;  2WGS A;  2R61 A;  3TBL D;  1M4V A;  5G55 A;  4OW0 A;  2V3N A;  2KQ7 A;  1JW9 D;  1KFY B;  1VRA B;  3UQA A;  1QZE A;  2KX0 A;  2HDE A;  1D3Z A;  4RF0 A;  1KLU D;  1U4A A;  3AEE B;  4HXD A;  2HJ8 A;  4MSM B;  2PVO D;  4PYU A;  2B3A A;  2J0J A;  3DVG Y;  2KLC A;  2WHI A;  2NS5 A;  2KFK A;  2K3U A;  1P0R A;  2MH7 A;  4YSZ B;  4KZ0 A;  1AAR A;  2K25 A;  2JPH A;  1T3Q A;  2DZI A;  4NAW B;  2LGY A;  2WDV B;  1K50 A;  1OGW A;  4MJS B;  1N63 A;  3P63 A;  1OFF A;  2MJD A;  5HFY A;  4K7U A;  2REX A;  2WQY B;  1SBB B;  2ZCB A;  3ZUN A;  4ZOH C;  3P4P B;  5AZG A;  4DK5 A;  3IFW B;  2G3Q B;  4BKS D;  3PHX B;  1J0G A;  1WM2 A;  1R4M B;  1PGB A;  4JIO U;  1LQB A;  4DHJ D;  3E9S A;  3M62 B;  3R7R A;  4DXF A;  3VQI A;  1KLG D;  5BMH A;  1KM7 A;  1WMH A;  3QA8 A;  3VVW B;  3PRP B;  2KTF A;  2H89 B;  2LXC A;  3PRZ A;  4JGH B;  3W5U B;  2BWE S;  1ENF A;  4F1S A;  3A9K A;  1CMX B;  3RNC C;  4AS1 A;  2KFK B;  5J18 A;  1WYG A;  2HTH A;  3BZD B;  5MPO A;  3DHG C;  4MGI E;  2V0G A;  2LRW A;  2ZNV C;  4HCN B;  1L4Z B;  2KJ6 A;  3RNE C;  3FC4 A;  1FXA A;  2KJH B;  2PLP A;  4NAM A;  5EE3 A;  3GZN I;  2GRI A;  1UGJ A;  4AP4 C;  2LWP A;  1KLV A;  1UUP A;  1N62 A;  2D3C A;  1STE A;  4BOS C;  4BFR A;  4ICU A;  4NJC A;  4REZ A;  2D3A A;  4HDO A;  1V1O A;  4LK0 M;  1K51 A;  4WJN A;  1WGK A;  3ABV B;  1D5Z C;  1NYQ A;  2N9E B;  3AUL A;  1K8R B;  4PS3 A;  1WMH B;  1T5X D;  4IKG A;  3ZW3 A;  4K7S A;  1DGJ A;  2LGI A;  1SXT A;  3NZ3 A;  4E3C A;  1SB3 C;  1J7B A;  1WY8 A;  2LVO A;  5C3J B;  4USA A;  2BBC A;  1WJ4 A;  2LHE A;  4DQO C;  5JHA A;  5IP4 D;  1XLO A;  2N9K A;  2WX1 A;  4OVU A;  2QJL A;  1V97 A;  3T3N A;  1A5R A;  2JRI B;  1P98 A;  4RM8 A;  1WIA A;  2QSD A;  2GBK A;  2IGG A;  1ISN A;  1JML A;  1L0V B;  2Z59 B;  2JX5 A;  4B9K A;  1XCT L;  1TS3 A;  1B9R A;  3SFE B;  4ICV A;  2LFI A;  2WYQ A;  4B0E A;  2O6V A;  2AL3 A;  5AUI A;  4P6V F;  4L23 A;  2K39 A;  1L0X B;  2W82 A;  2KXJ A;  2KVR A;  3HM3 A;  3I57 A;  4MEM A;  1AWD A;  3Q6B A;  5J17 A;  1E8W A;  1I4X A;  5HG2 A;  3W5V B;  3ONS A;  3RYT A;  1FMA D;  1WWT A;  4FHJ A;  3DWG C;  1T0Y A;  3MP9 A;  2BS2 B;  3Q3N C;  4RGT A;  2PIA A;  1WJN A;  1AYF A;  3HVD A;  3PZ7 A;  4XZ4 A;  1HZ6 A;  1DOY A;  4S17 A;  1M94 A;  1T0Q C;  1FFU A;  1WZ0 A;  3ZRC A;  3HIZ A;  1WE7 A;  2IO0 B;  3ML8 A;  1L2N A;  4DHZ B;  1GAQ B;  4C00 A;  3R2T A;  2UWQ A;  2BKF A;  2BB6 A;  1GG3 A;  2LMC A;  2PW9 A;  2XK5 A;  4TUU A;  3AE9 B;  1CK1 A;  2KNB A;  3HHM A;  2O6V B;  2LZ6 A;  4LCD E;  2NVU I;  1DYQ A;  3IT6 B;  4TQ1 A;  1CQV A;  1N5X A;  2C7N B;  1KOT A;  4BBN F;  3T9L A;  4LTU A;  4BVU C;  1T0R C;  4GB9 A;  4D2K A;  4A3O A;  1ROE A;  3H7P A;  4K1R B;  3OWE B;  2FE8 A;  4KZC A;  3ZJV A;  1N61 A;  3Q8A A;  3ZTC A;  2MCN B;  3UIO B;  4ZYN A;  2OED A;  4K81 A;  2XN9 C;  5BO4 B;  1VCB A;  4NJ6 A;  3N1Y C;  3P42 A;  1Q1O A;  2FIF A;  3KUZ A;  2KN4 A;  2ASQ A;  3CMM B;  3KLS X;  1UBQ A;  2KJR A;  3U4E G;  5JHB A;  2AEH A;  4FA6 A;  3N1X C;  2BWF A;  3H8H A;  1FEH A;  2ICI A;  4LDT B;  1DOX A;  3GE8 C;  2LGS A;  3URY A;  1ESF A;  2WXQ A;  2LUM A;  4EE2 A;  3AM9 A;  2FCQ A;  4W9E A;  2KD0 A;  1EF5 A;  3DQV A;  2Y5B B;  3ZGZ A;  5E6O A;  2M56 B;  3B9J A;  2MP2 A;  3KVF B;  2FUH B;  1V2Y A;  2WWZ A;  1XQQ A;  2Y5C A;  1FRD A;  3EEC A;  4A3P A;  4RGO S;  3CSF A;  4ARI A;  2BKR B;  3GZN B;  3U7D A;  1AN8 A;  1QQR A;  1OQR A;  2RDH A;  3B08 A;  2MBQ A;  5GMV A;  3HVZ A;  4IWQ A;  3ZRF A;  3C0R B;  3BK1 A;  2G45 B;  2V4I B;  2DNF A;  4IDI A;  3QWZ B;  2K22 A;  2V4L A;  5IAA C;  4DWF A;  2PE6 B;  4YSY B;  3X0W A;  1E7U A;  2MW5 A;  4RH6 A;  4KV2 A;  3GOE A;  3Q8C A;  1UH6 A;  2MBB B;  1VLB A;  2QDF A;  1IPG A;  2K8B A;  5C1Z A;  2K6Q A;  4LLG M;  3MHS D;  1I4P A;  4NZL B;  4L2Y A;  2V3S A;  1XO3 A;  2ZW1 A;  2MRP A;  3RD2 A;  2M17 A;  3IHP C;  2NCN A;  3EHV A;  4HVB A;  2MP2 B;  3W1S A;  4XE0 A;  2V1Y A;  3TEX A;  4TV3 A;  2C60 A;  3OJ3 A;  2L8J A;  1WXV A;  3TJP A;  5DPS A;  1GB4 A;  3DVG X;  4G50 A;  4RGM A;  2RPV A;  2VH2 A;  4M0W A;  5H8Y E;  1UWX A;  4US9 A;  4P1B C;  3PHW B;  1V1P A;  1IYF A;  2M19 A;  2FCS A;  3DBH I;  2Y5P A;  1LM8 B;  2BT6 A;  4LNO A;  1OQQ A;  2DAJ A;  4NQK E;  2LJ5 A;  5KHQ A;  1NEN B;  3EUB 2;  1PQS A;  1YD8 U;  2I1J A;  2KAC A;  3ZNH B;  1C3T A;  3QQ8 B;  5IKC M;  4A8X C;  1EF1 A;  2ZNV B;  3TEZ A;  1ZKH A;  2KDI A;  1YQ4 B;  4W9K A;  3M3J A;  3NRZ A;  4YXD B;  3PTF C;  1JWU D;  2PMV A;  2LGD A;  1NYR A;  4HJG E;  2DEN B;  3JYU A;  4ZRP A;  2AQ2 B;  3LYY A;  5EE0 A;  3AXC A;  3MC9 A;  2W3R A;  3V60 A;  4HLE A;  2WXK A;  3EA6 A;  3ZNZ B;  3A1Q A;  1DOI A;  2JRH A;  4GGQ A;  4LNN A;  1XXG A;  1V5T A;  1N5W A;  4II3 B;  3SU8 X;  4M0W B;  5BYR A;  3HK0 A;  1P3Q U;  2XEW A;  2MBE A;  2IBI B;  4K3B A;  2VH1 A;  4LJO B;  2K6D B;  1RM6 C;  2G1E A;  1V1P B;  2I2Y A;  2K8H A;  3UIP B;  3Q8F A;  2KVZ A;  2A4Z A;  1SE2 A;  3UQB A;  1GC6 A;  2DYO A;  4W9H A;  2PTL A;  1MG8 A;  4NQL B;  5GXG B;  1B1Z A;  2C7H A;  3QHT A;  2BQQ A;  4HJK A;  1RAX A;  1E6E B;  3E56 A;  4M8N A;  2D3G A;  1HEZ E;  2AQ1 B;  4NY0 A;  4JPS A;  3KW5 B;  2K8C A;  4F7Z A;  1WXA A;  2L83 A;  2DYB A;  4ZYS A;  4ANW A;  1C79 A;  3MTN B;  5H92 C;  3BWU D;  3WIM A;  3ECI A;  2INN E;  2ACZ B;  2BS3 B;  4LNI A;  1WX7 A;  4MJS A;  4XDC A;  2L0F A;  4IM3 A;  1XLQ A;  3ML9 A;  2KMM A;  1IUE A;  4HEA 1;  3EGR A;  2E6X A;  3NZS A;  4CQN A;  2DYM A;  4IOI E;  3A1Q B;  1FFV A;  1YX5 B;  3DDC B;  3P2B A;  4MDK E;  2DAF A;  4WAF A;  1S3S G;  2MLB A;  1H8C A;  2RR9 A;  3ALB A;  3V3X A;  3NS8 A;  1QLB B;  1D6E C;  4KGR A;  5C23 A;  4PS8 A;  2L00 B;  2EEL A;  2NBV B;  3BYY B;  2Z0E B;  2N9L A;  2JWU A;  3VH3 B;  5EE9 A;  4HCP B;  3OJ4 B;  4YWG G;  1FRR A;  2AQ3 B;  2KWD A;  5DPT A;  1YN4 A;  1KTK A;  1ZDV A;  2AWT A;  1RFK A;  2J42 A;  2JUO A;  3AEC B;  3M63 B;  3U7Z A;  3GE3 C;  1QOA A;  1PGX A;  1J7C A;  1VZ7 A;  1F9J A;  5IA7 A;  1FNV A;  2NBW B;  5TR5 A;  2RPQ A;  4L1B A;  1UBI A;  4C7Y A;  4DBG A;  2JF5 A;  4HPL B;  2TSS A;  5LNK 1;  2WU5 B;  2YLM A;  2RMM A;  3OLM D;  1UEL A;  3AE4 B;  5IO9 A;  1WE6 A;  3TEW A;  2L7R A;  3SR6 A;  3PLV A;  4GSW A;  4OVZ A;  3APF A;  1XD3 B;  4TMA B;  3TIX A;  1JRU A;  2O2V A;  1XT9 B;  1E5W A;  2J53 A;  3AV8 A;  2KMC A;  1JCK B;  1XF5 L;  2ZPY A;  1J19 A;  3RUI B;  3Q69 A;  3MHZ A;  1SE4 A;  2K9X A;  4WAA A;  1LXD A;  1RFA A;  1MHH E;  3V6C B;  4X57 B;  2OOB B;  3KYC D;  1WR6 E;  2RD0 A;  1HTQ A;  3T8M A;  4BAX A;  3CWI A;  3J9C A;  4YTP B;  3AED B;  3RPF C;  1QOG A;  1KRH A;  4M00 A;  3W1S C;  3LXF A;  3DHH C;  2KWC A;  4ACF A;  3BVM A;  3DBH B;  4H2A A;  1QIL A;  1SIJ A;  2DBY A;  2PKO A;  4FLH A;  2IPK D;  2OJW A;  1YMH E;  2J52 A;  1A70 A;  3JVZ X;  2WXF A;  3AE7 B;  3B1L X;  3K9O B;  1BML C;  2GBN A;  2O2V B;  5BMI A;  3ZO5 B;  4P7I A;  4MAC A;  2KAJ A;  4XGA B;  5BMG A;  3L4P A;  1ZPS A;  5IOI A;  1WZ3 A;  1GOZ A;  2LUE A;  4KKI A;  2M4N A;  4JWU C;  4IG7 B;  2I1K A;  3A4S C;  1L5P A;  3WAP A;  3I9V 1;  2MJE A;  1E8Y A;  1ET6 A;  3RZW C;  1WR1 A;  3P4R B;  2WXO A;  2CU1 A;  1GPX A;  2KN5 A;  2G4S A;  3A33 B;  2WNM A;  3RNG C;  1MFW A;  2JQR B;  3MJW A;  1VR9 A;  1JWM D;  1JWB D;  3KWV A;  3AE6 B;  4WJQ A;  4RF1 A;  2CHW A;  5I4D A;  2PE9 A;  2KKC A;  1GUA B;  4WUR A;  2R2O A;  1OEY A;  4KX6 B;  3N20 C;  1GC7 A;  3SD5 A;  4C7Z A;  1NI2 A;  2WDQ B;  1KH0 A;  3AEF B;  4HK2 A;  1TS4 A;  1TS2 A;  3O13 A;  1TY2 A;  4XWW A;  3ZYY X;  3NY5 A;  1VD2 A;  3L10 B;  4M8M A;  3WCQ A;  1SE3 A;  2HJ1 A;  4MGK E;  4WWM A;  3WAO A;  3HRD D;  2PVG C;  2CU3 A;  2LHD A;  4XX5 A;  2JYE A;  3GP7 A;  2W3S A;  3CF6 E;  3L54 A;  1IGC A;  4MGY E;  2IYD B;  1BXT A;  1NDD A;  4URK A;  3QAR A;  1C4P A;  2FNJ B;  2Z0D B;  3WAM A;  1YNT E;  4TKN A;  4HWI B;  1MJD A;  4RFB A;  4BOZ B;  1VZ8 A;  4EFO A;  5L95 C;  1ZW7 A;  3VXW A;  3DWM A;  3NOB A;  1E10 A;  4C80 A;  1GJZ A;  1F0Z A;  1I35 A;  1BT0 A;  5JXV A;  1I4H A;  2XNA C;  4JL9 A;  4G11 A;  1XLP A;  1NI3 A;  5G5H A;  5J2R A;  1CZP A;  3AN1 A;  3UI3 A;  3PS6 A;  3UGB B;  1V8C A;  3Q2A C;  4MEL A;  5G5G A;  4MSQ B;  1C77 A;  4WWP A;  1E7P B;  2GBM A;  1E7V A;  3NS1 A;  2MJ3 A;  1TY0 A;  2O6V D;  1V6E A;  3FAH A;  2N7J A;  3DPD A;  4II2 B;  4HDQ A;  3N32 A;  2WXJ A;  3JW0 X;  3ZXR A;  1K52 A;  1JRO A;  2M1M A;  3Q3J A;  2W54 A;  1WXS A;  2GMI C;  3KYD D;  2KLG A;  1WI0 A;  3PO0 A;  1D4B A;  1RRB A;  4YTM B;  1D5X C;  3PT2 B;  4J3O D;  1E8Z A;  2ONQ A;  1UD7 A;  1L6U A;  4DXG A;  2YEP F;  1SGH A;  4W9L A;  2BTE A;  1RWS A;  2L1A A;  1N60 A;  2Y3A A;  4C56 C;  3SEB A;  4BZA A;  1TJE A;  2KFJ A;  4EZK A;  5DPR A;  4RNA A;  4FJV B;  4LDT D;  2DZM A;  4AQ7 A;  4IUM B;  1UF0 A;  1Q5W B;  4KIK B;  1F2R C;  2JSV X;  3BII D;  3R66 C;  3V61 A;  3CST A;  3LB8 C;  1T6B X;  2KO3 A;  5CX3 A;  4G0N B;  1GNU A;  3EC8 A;  1C4A A;  3RMK C;  4M01 A;  4N9F 4;  3AEA B;  4A55 A;  3W9C B;  4ZRQ A;  4GDK B;  2N7E A;  3T3O A;  2NR2 A;  1H4R A;  2K0P A;  3V62 A;  3BVZ A;  2J7Q B;  2FID A;  5LXI B;  2BW2 A;  3Q3M C;  1WSP A;  1WXQ A;  1LFD A;  3VUW A;  3APC A;  3L13 A;  2SAK A;  2JXT A;  2N9P C;  2YEP B;  4AWJ A;  2QIE B;  2DWQ A;  2FBW B;  4W9C A;  2M0A A;  2EMT A;  4WIP A;  2ZVO A;  3DVN U;  4HRO A;  1LO5 D;  2W9N A;  1OEY J;  2MBO A;  1OQY A;  1V5O A;  1LGR A;  2KMA A;  3IBE A;  1ET9 A;  1F1H A;  3ZDM C;  3VRA B;  4XWT A;  1TZ1 A;  4ANV A;  2RDB C;  4YSX B;  2KHW B;  3AE1 B;  3BYT B;  1PFD A;  3TSS A;  3VHT C;  4W9I A;  2KDM A; 
#chains in the Genus database with same CATH homology
 1SF0 A;  2LHE A;  1ZP0 B;  2WP9 B;  5EE9 A;  4DQO C;  4OZC A;  1XLO A;  2NMQ A;  5D7G A;  4YWG G;  1I7H A;  2N9K A;  1FRR A;  2AQ3 B;  2KWD A;  2QJL A;  1YN4 A;  1V97 A;  4ZHP A;  1FIQ A;  1KTK A;  1ZDV A;  3MJ5 A;  2WU2 B;  5FK9 C;  3T3N A;  1RFK A;  2J42 A;  1E0Z A;  2LJI A;  1MHX A;  4B0M A;  4WQM A;  2E3T A;  2QSD A;  3AEC B;  5HI1 A;  1EU3 A;  2INP E;  2IGG A;  3U7Z A;  1JML A;  3CIR B;  1QOA A;  1PGX A;  1J7C A;  1F2R I;  1VZ7 A;  1EWY C;  1PYW D;  1L0V B;  2W55 A;  2JX5 A;  3NVV A;  1FNV A;  1XCT L;  1TS3 A;  3IT4 B;  1PDX A;  1B9R A;  4L1B A;  2IJ0 A;  2CJN A;  3SFE B;  4C7Y A;  2VZK B;  5E6J A;  1L6V A;  2WLB A;  4TSS A;  2TSS A;  5LNK 1;  2WU5 B;  2RMM A;  2LFI A;  4B0E A;  3V05 A;  4GLS C;  1FM0 D;  2WXP A;  3AE4 B;  4N6E B;  5AUI A;  4ITK A;  3TEW A;  4P6V F;  4L23 A;  4ZHO A;  3SR6 A;  1L0X B;  2W82 A;  3I57 A;  1Q10 A;  1K53 A;  1AWD A;  4US8 A;  1FD6 A;  4OVZ A;  4KGT A;  1R7S A;  4TMA B;  4KKJ A;  1I4X A;  2J53 A;  3AV8 A;  4JE3 B;  5HG2 A;  3VRB B;  3W5V B;  4MT5 A;  1JCK B;  2X38 A;  1XF5 L;  1FMA D;  3BVG A;  1XLN A;  3AB5 A;  2BYT A;  1WWT A;  3W2D A;  3DWG C;  3Q69 A;  3MHZ A;  3MC0 B;  1SE4 A;  3HUI A;  3MP9 A;  2WDR B;  2K9X A;  2JYT A;  5EE1 A;  2BS2 B;  3ZQ4 A;  5BYS A;  3GS2 A;  1AW7 A;  1MHH E;  2PIA A;  3BK2 A;  3IAS 1;  4RGT A;  1C4C A;  1YJJ A;  3HVD A;  1AYF A;  3PZ7 A;  1JAL A;  1HZ6 A;  1DOY A;  3CWI A;  3J9C A;  4YTP B;  1C9F A;  1FFU A;  1ZE3 D;  4A9A A;  3AED B;  3RPF C;  3U2S C;  1QOG A;  2N0S B;  3RFZ B;  1KRH A;  3AE5 B;  1GAQ B;  4TQ0 A;  1QOB A;  3AE2 B;  1FCC C;  3R2T A;  1P7F A;  3LXF A;  1PUT A;  1ZXI A;  2BB6 A;  1L4D B;  2LMC A;  2PW9 A;  4FXC A;  3BVM A;  3NVY A;  4H2A A;  2GI9 A;  1FO4 A;  3AE9 B;  1CK1 A;  2DBY A;  1QIL A;  1SIJ A;  2PKO A;  2IPK D;  1YMH E;  1TS5 A;  2J52 A;  1A70 A;  4GDL B;  1DYQ A;  1QKZ A;  4OZA A;  3IT6 B;  1VZ6 A;  3AEB B;  4TQ1 A;  1CQV A;  1FXI A;  1N5X A;  2JZP A;  3R8B A;  4YT0 B;  4LTU A;  1KF6 B;  1P7E A;  3IAM 1;  3Q8E A;  2KQ4 X;  3NUH B;  3VR9 B;  4D2K A;  2WXF A;  1ROE A;  3AE7 B;  3ZJU A;  4Q2J A;  3OWE B;  2ZW0 A;  1SEB D;  1BML C;  2FE8 A;  3ZJV A;  1N61 A;  5BMI A;  3Q8A A;  4MAC A;  2KAJ A;  5BMG A;  1IGD A;  3L4P A;  1ZPS A;  4HKZ E;  4OHJ A;  3AEG B;  1ZOY B;  1GOZ A;  2OED A;  5T8I A;  2XN9 C;  2BB5 A;  1JWA D;  4KKI A;  3P42 A;  4JWU C;  2KN4 A;  1L5P A;  3KLS X;  1GB1 A;  4O1N A;  2QMT A;  3I9V 1;  2MJE A;  1WRI A;  2Q5W D;  3U4E G;  1ET6 A;  1XEE A;  5TSS A;  1FNW A;  3NVZ A;  3N9Y C;  2B76 B;  4A90 A;  3P4R B;  2WXO A;  1F77 A;  2I38 A;  1GPX A;  2JU6 X;  1VDV A;  2WXN A;  1MI0 A;  1ZDX A;  2WNM A;  5D3I B;  3H8H A;  1I4Q A;  2WS3 B;  1FEH A;  2ICI A;  1DOX A;  2RDG A;  2JQR B;  1VR9 A;  1JWM D;  1JWB D;  2G9H D;  3URY A;  1ESF A;  3KWV A;  2WXQ A;  3AE6 B;  4RF1 A;  5I4D A;  1CJE A;  2LUM A;  4EE2 A;  1EWC A;  1ZXH A;  4WUR A;  1HQR D;  1JRP A;  3AM9 A;  1J7A A;  1HXY D;  1E9M A;  4KX6 B;  3ZGZ A;  2AX5 A;  4C7Z A;  2M56 B;  2ON8 A;  4RGN A;  3B9J A;  2WDQ B;  1BUI C;  1SJH D;  1KH0 A;  3AEF B;  4OZB A;  1TS4 A;  1TS2 A;  2K5P A;  2Y5C A;  3O13 A;  3P1M A;  4JWS C;  2Z8L A;  1TY2 A;  1QT9 A;  3ZYY X;  1FRD A;  4XWW A;  3KWL A;  1YJI A;  4RGO S;  4ARI A;  1EU4 A;  2VZK D;  5FR3 A;  3WCQ A;  5HHD G;  1SE3 A;  4WWM A;  1QOF A;  1AN8 A;  3HRD D;  2WXH A;  1QQR A;  5D3D A;  4A6Q A;  1OQR A;  2RDH A;  2PVG C;  4P16 A;  2CU3 A;  2LHD A;  3C8Y A;  4HRS A;  2JYE A;  2IGH A;  3HVZ A;  3GP7 A;  3BK1 A;  2W3S A;  2V4I B;  2WXR A;  3TUO A;  1IGC A;  4IDI A;  1MVK A;  1TKG A;  1BXT A;  2K22 A;  1EM7 A;  1C4P A;  1VJK A;  1YN5 A;  2CJO A;  4XDD A;  4YSY B;  1QF6 A;  1Y56 A;  1YNT E;  1TKE A;  4RH6 A;  3Q8C A;  4RFB A;  2NTS A;  1VLB A;  1VZ8 A;  3DWM A;  1E10 A;  3Q8B A;  4C80 A;  4LLG M;  1F0Z A;  1I4P A;  1UNS A;  3U52 E;  2V3P A;  4NZL B;  5JXV A;  1I4H A;  2XNA C;  4L2Y A;  2LEK A;  3P4Q B;  1TYG B;  2QEJ C;  1XLP A;  1XO3 A;  2ZW1 A;  1NI3 A;  3TEY A;  5G5H A;  1XCQ L;  1CZP A;  2WXL A;  4XE0 A;  2BS4 B;  3W1S A;  3P4S B;  3TEX A;  4HKQ A;  3AN1 A;  3UI3 A;  3PZ8 A;  1JQ4 A;  1V8C A;  5G5G A;  2L32 A;  1FNU A;  1C77 A;  2WXM A;  1E7P B;  1RYJ A;  2SEB D;  1I4R A;  4R3D A;  4N58 A;  1GB4 A;  5FKA C;  3NS1 A;  4RGM A;  2MJ3 A;  2D5G A;  1TKY A;  2RPV A;  3VR8 B;  4M0W A;  1TY0 A;  4MH8 A;  5H8Y E;  1NVI D;  2R61 A;  1UWX A;  1M4V A;  4JX1 C;  4US9 A;  4OW0 A;  2H88 B;  2V3N A;  3FAH A;  4WH4 A;  2N7J A;  4KGS A;  3B2G A;  1JW9 D;  1KFY B;  1V1P A;  1VRA B;  2M19 A;  4YTN B;  2WXJ A;  4N59 A;  2Y5P A;  2BT6 A;  2MEK A;  2HDE A;  1K52 A;  1OQQ A;  4RF0 A;  1JRO A;  1KLU D;  3AEE B;  2W54 A;  2WXG A;  1I4G A;  1NEN B;  3EUB 2;  2PVO D;  3IXS A;  5C2T B;  3PO0 A;  1D4B A;  2IGD A;  1MPE A;  2KAC A;  4YTM B;  1D5X C;  4J3O D;  2QIL A;  1TZO A;  2K3U A;  2L52 A;  2MH7 A;  4YSZ B;  4A8X C;  2ONQ A;  1NEK B;  3TEZ A;  1YQ4 B;  1L6U A;  4DXG A;  1T3Q A;  2YEP F;  1PGA A;  4NAW B;  1L0Y B;  2WDV B;  1YQ3 B;  2BTE A;  1RWS A;  1YN3 A;  3NRZ A;  2L1A A;  1K50 A;  1N60 A;  1N63 A;  3P63 A;  4YXD B;  1OFF A;  1JWU D;  2Y3A A;  4C56 C;  2PMV A;  2MJD A;  2J4X A;  3SEB A;  2FUG 1;  5HFY A;  1NYR A;  4HJG E;  2WXI A;  2NTT A;  2WQY B;  4ZRP A;  2AQ2 B;  1SBB B;  3LYY A;  5EE0 A;  1TJE A;  2EKI A;  2W3R A;  4RCO A;  4ZOH C;  3P4P B;  2WXK A;  2IDY A;  3EA6 A;  3R2I A;  4RNA A;  1DOI A;  1SSN A;  4AQ7 A;  1XXG A;  1N5W A;  1PGB A;  1F2R C;  5BYR A;  3E9S A;  3AH7 A;  2JSV X;  3BII D;  3AE3 B;  1ACC A;  4DXF A;  1RM6 C;  2G1E A;  1V1P B;  3VQI A;  3LB8 C;  2I2Y A;  1T6B X;  1KLG D;  5BMH A;  3AMZ A;  1D5M C;  3FIL A;  3Q8F A;  3GB1 A;  1C4A A;  2H89 B;  1SE2 A;  3MFG A;  3W5U B;  1IBX A;  2OHF A;  2DYO A;  2PTL A;  5GXG B;  1B1Z A;  1ENF A;  3AEA B;  4A55 A;  3SFD B;  4AS1 A;  4MM3 B;  1E6E B;  3E56 A;  4ZRQ A;  3W9C B;  4GDK B;  1HEZ E;  2AQ1 B;  1WYG A;  3BZD B;  5MPO A;  4JPS A;  2V0G A;  4UDU C;  3T3O A;  3KQ4 A;  2L83 A;  2K0P A;  1L4Z B;  4ZYS A;  1C79 A;  1FCL A;  3BVZ A;  3BWU D;  5H92 C;  1HA5 A;  1HZ5 A;  3FC4 A;  2BW2 A;  1FXA A;  2PLP A;  4NAM A;  2INN E;  1WSP A;  1WXQ A;  5EE3 A;  2ACZ B;  2BS3 B;  4ARC A;  2GRI A;  1UGJ A;  2JXT A;  2SAK A;  2YEP B;  4XDC A;  1UUP A;  2QIE B;  1N62 A;  1XLQ A;  1STE A;  2KMM A;  1IUE A;  3ZJT A;  4HEA 1;  2DWQ A;  4NJC A;  2FBW B;  3EGR A;  2E6X A;  4CQN A;  2DYM A;  4IOI E;  1JWS D;  2M0A A;  3B2F A;  3ETR A;  4REZ A;  1V1O A;  4LK0 M;  1FFV A;  1K51 A;  3NVW A;  4WIP A;  4PT5 A;  5AUK A;  1SJE D;  4HRO A;  1LO5 D;  2HTM E;  4WAF A;  5BYQ A;  1WGK A;  1ET9 A;  2N9L A;  3ABV B;  3V3X A;  1D5Z C;  1NYQ A;  1QLB B;  3VRA B;  4XWT A;  1C76 A;  3AE8 B;  1C78 A;  1D6E C;  2DLB A;  3FIL B;  1T5X D;  4IKG A;  4YSX B;  1DGJ A;  2LGI A;  1UWM A;  1SXT A;  4KGR A;  3AE1 B;  3BYT B;  1PFD A;  3NZ3 A;  2EEL A;  3TSS A;  1SB3 C;  1J7B A;  2GB1 A;  3BYY B;  5C3J B;  1IBX B;  1ZUD 2;  4USA A;  2JWU A;  2BBC A;  2KDM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...