3DWGC

Crystal structure of a sulfur carrier protein complex found in the cysteine biosynthetic pathway of mycobacterium tuberculosis
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
92
structure length
92
Chain Sequence
NVTVSIPTILRPHTGGQKSVSASGDTLGAVISDLEANYSGISERLMDPSSPGKLHRFVNIYVNDEDVRFSGGLATAIADGDSVTILPAVAGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cysteine synthase B
publication title Crystal structure of a sulfur carrier protein complex found in the cysteine biosynthetic pathway of Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 26
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2008-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02597 ThiS ThiS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3dwgC00
4YSXB 2WS3B 2CJOA 3AE9B 3AE6B 4LTUA 1KFYB 4YSZB 3P4SB 2FBWB 3AEAB 3W5VB 2JQRB 4KX6B 1PUTA 1R7SA 3AECB 3BIID 3VR8B 1QOAA 1VLBA 1QF6A 3SR6A 2CJNA 2KAJA 1JW9D 1L6UA 1FM0D 5AUKA 1JQ4A 3NVVA 1DOIA 5MPOA 1CZPA 1E10A 3AE7B 1WYGA 3AE3B 4YTNB 5EE1A 1F0ZA 2MJDA 4HRSA 1N5XA 2JX5A 2L52A 1N63A 1E9MA 1J7AA 3LB8C 1XLQA 2W54A 3P4PB 1ZOYB 1NENB 1JALA 3AE8B 3AE4B 3AEGB 3P4RB 4WQMA 4YTMB 1TKYA 2H89B 1QOGA 1XO3A 1ROEA 2DBYA 3AEFB 3AMZA 3ETRA 3HUIA 3PO0A 1E7PB 1YJJA 1SF0A 1RFKA 3P4QB 3VRAB 4C7ZA 2KMMA 4US9A 3KWLA 1E6EB 1ZP0B 4HROA 2MJ3A 1I7HA 1N61A 1SIJA 1FFVA 2W55A 2WLBA 2H88B 2WU5B 1VJKA 4US8A 3NS1A 3NVZA 2L83A 2PIAA 3ABVB 3AV8A 5GXGB 3SFEB 4ZHOA 2Q5WD 1IUEA 3AEDB 4ITKA 1YJIA 1FRDA 3VR9B 1RM6C 1NYRA 1L0VB 1SB3C 2QIEB 4FXCA 5H92C 3ZYYX 1KF6B 1N60A 1EWYC 1WGKA 3AE1B 3B9JA 4N6EB 1PFDA 2G1EA 2MJEA 4YT0B 5H8YE 4YXDB 1VDVA 1ZUD2 1A70A 2N0SB 3CWIA 4WWMA 3P1MA 1FRRA 1UWMA 1GAQB 1NYQA 2HTME 5G5GA 2LEKA 4JWSC 4ZHPA 3VRBB 2AX5A 1XLPA 4A9AA 2MH7A 1JRPA 4C80A 4YTPB 2WDQB 1QT9A 2WDVB 1OFFA 1N62A 1TJEA 2CU3A 1CJEA 1KRHA 1NI3A 1OQRA 1J7CA 3B2GA 2W3SA 1J7BA 1WXQA 1GPXA 2DWQA 1L6VA 3NVWA 1FMAD 2WU2B 1OQQA 1V8CA 2Y5CA 4JX1C 4JWUC 4N59A 4YSYB 3CIRB 1B9RA 5EE9A 1QOBA 1RWSA 1XLOA 4USAA 5EE3A 3W9CB 1JWAD 1RYJA 4N58A 3L4PA 1E0ZA 3DWGC 3HVZA 1DGJA 1NVID 1AYFA 3B2FA 1AWDA 2ACZB 3AH7A 4ZOHC 5G5HA 2WP9B 2WDRB 3LXFA 2QJLA 3FC4A 1N5WA 3RPFC 1XLNA 4C7YA 1ZXIA 2K5PA 2OHFA 2PKOA 3EUB2 3NRZA 3AEBB 1QLBB 3AN1A 2WQYB 3NVYA 2W3RA 3P63A 3WCQA 1QOFA 2BS2B 1V97A 3DWMA 1FFUA 1YQ3B 2B76B 3SFDB 3AE5B 1TYGB 1NEKB 3HRDD 1L5PA 1TKGA 5C2TB 2BT6A 5EE0A 4IDIA 1JWBD 2PVOD 1YQ4B 1FO4A 2PVGC 1DOXA 3AE2B 2K22A 1FXAA 1FIQA 1FXIA 2EKIA 1TKEA 2M19A 2K9XA 2M56B 2E3TA 4P6VF 1WWTA 3FAHA 5AUIA 2BS4B 1DOYA 1WRIA 2BS3B 3AB5A 3AEEB 5C3JB 3AM9A 1JROA 1PDXA 1T3QA 3W5UB
chains in the Genus database with same CATH superfamily
2DYMA 4KV2A 4YSZB 2DAFA 1MI0A 1XCQL 3PRZA 4YWGG 1FD6A 3DBLI 2V3NA 1JQ4A 2GBNA 3L17A 1GJZA 5D6JB 4YTNB 5DPTA 4E74A 2ZJDA 4RMAA 2JX5A 2WXMA 1QKZA 2WNMA 3RN9C 1ZXHA 3IT6B 2VZKD 1YJJA 1WIAA 2XK5A 3ZTCA 1KLVA 1N61A 2QILA 2EMTA 1FFVA 1IBXA 3HVDA 2IO2B 3SFEB 2JWUA 2LUMA 2Y3AA 2K3UA 4DXGA 4PS7A 5IA7A 3VR9B 3ZYYX 2V3PA 4ASWC 2K6QA 4M0WA 1BT0A 3CWIA 3V60A 3DHGC 4ZHPA 2L00B 4MACA 4IUMB 1P1AA 2UU7A 1LM8B 1TZOA 2FCMA 2L7RA 3KVFB 1UH6A 1GOZA 2BGFA 2WXLA 1B9RA 2KDEB 3UGBB 2IPKD 4BZAA 3NZ3A 1ZKHA 2XN9C 3QK0A 5GMVA 1AWDA 3DBLB 2ZW1A 3R2IA 1AARA 3IFWB 1WX7A 2WXHA 3ALBA 3HRDD 4GLSC 5CX3A 5AZGA 2ZVOA 4L23A 3KWVA 3M3JA 2W9NA 1ZE3D 3AE2B 2WGSA 1FXAA 1J0GA 4P6VF 5HFYA 1WRIA 2J0KA 2GBRA 2KDBA 3QX1A 3BZDB 3TSSA 5E6NA 3VUXA 4MT5A 3P4SB 2FBWB 4OW0A 2I38A 2C60A 1WGHA 3N30A 4AUQC 1UGJA 2HE7A 3J9CA 3VTVA 3A9KB 3AULA 2DZIA 3OAWA 1E10A 1BUIC 4CHKA 2JZ3B 2L32A 2E6XA 3M62B 2PJHA 2RPQA 5FR3A 4GIVA 4JGHB 2AL3A 3ETRA 1ROEA 2JU6X 1SF0A 2IY1B 1WZ3A 3MC0B 2FCNA 4P1CC 2KWDA 3PVLA 3ENEA 2O2VA 1OQYA 1IUEA 3CSTA 3ZXVA 3DBSA 4FBJB 1C76A 2X8XX 3CSFA 3MTNB 4MGYE 1Y8RC 4FXCA 2QEJC 3C0RB 1KF6B 5HHDG 3URYA 2KQ4X 3P1MA 4HPPA 3ECIA 2KTRB 4BAXA 4YTPB 2RSUA 1HA5A 3R7RA 1WXAA 1WRDB 1FNWA 3DQVA 4B6WA 1RWSA 2A5UA 4FHJA 5EE3A 2D3GA 4HVBA 1OGWA 4IKGA 3VH3B 1DGJA 4R3DA 1AYFA 4M8MA 4WURA 5BYQA 5IKCM 3ZO5B 2K5PA 1VZ6A 1RFAA 3DWMA 1YQ3B 1E90A 3AE5B 4HJGE 1TKGA 2BT6A 2GBKA 3WALA 2GMIC 2LASA 1YQ4B 3NUHB 2IYDB 1L2NA 4GN1A 2K22A 2Z0EB 3RNEC 3QWZB 5HKHA 3FAHA 2D3BA 2BS3B 3AM9A 3BK2A 4H2AA 3PRMB 1IP9A 4ACFA 2JYTA 1C4PA 2WS3B 1SSNA 3I3TB 3DHIC 1EWCA 1UF0A 2G9HD 1K51A 2MP2A 4MM3A 1MHXA 4EKUA 1Y56A 1L4ZB 1YJ1A 5LNK1 2LGSA 4O1NA 1EF1A 3TJPA 3AE3B 1WYGA 4LJPB 4MJSB 4M01A 2BB5A 2KKCA 2VH2A 3DVNU 4IM2A 3Q3MC 2FCSA 1XLQA 2DX5B 2MBHA 3P4PB 2J4XA 4J6IA 2MW5A 3R8BA 3RYTA 2KC1A 1UELA 3PO0A 1RFKA 3A4RA 5EDSA 4XE0A 2FE8A 1VJKA 4II2B 2LRUA 2D10A 3JW0X 4KSLC 2Q5WD 2WX1A 2N7EA 1FRDA 2C7HA 1UNSA 2AEHA 2ZW0A 4W9IA 1YX5B 2C9WB 2FNJB 4EZKA 3IXSA 2LVQA 1TJEA 1V86A 1F1HA 1WFYA 2WU2B 2SEBD 4GB9A 3KUCB 4YSYB 1R4NB 1XLOA 2NS5A 4WQOB 3ZJTA 3PV1A 2QMTA 1UUPA 1QZEA 2CR5A 3HVZA 4PK1A 2XBBC 1HEZE 3LXFA 4G11A 5LXIB 4A55A 4D2KA 2IGGA 3FILB 3NRZA 1TS5A 2BS2B 1PQSA 1NEKB 2GOWA 2LGXA 4HCNB 2M0AA 2HTHA 4ZYNA 2V4IB 4OZAA 1T5XD 4WJPA 2LI5A 1Z5SB 1V6EA 4F8CB 3DCGA 3PRPB 5JXVA 3V05A 4DWFA 1WI0A 3WAPA 4YSXB 2INCC 2RGFA 2BF8B 4LTUA 4IWQA 1SE2A 3GE8C 1TY2A 3Q8CA 1P7EA 3VR8B 5T8IA 1VLBA 4K7UA 1AW7A 1V5TA 2KWUB 2K8HA 1P98A 3JYUA 2WYQA 1N63A 1RLFA 3H1UA 2HDEA 2LVOA 4YTMB 2QHOA 2IZVB 2N1VA 1UZXB 2H89B 1E8WA 3N9YC 1E7PB 1RAXA 4L2YA 2Z59B 2EMSA 2MRPA 3AV8A 1HE8A 4RH6A 4IOIE 1YJIA 1EU3A 2N9LA 4PS8A 5KHOA 1EF5A 4GDKA 2ZNVC 1XT9B 1T0SC 2G1EA 2MSED 2IBIB 4XYCA 1NYQA 4JWSC 2MH7A 2IJ0A 5FK9C 2BKRB 3RI7C 5JHBA 2HJ8A 2YLMA 2YEPB 3RNGC 5JZEB 5C1ZA 3O65B 2PPHA 3PT2B 2A4ZA 4N59A 4KIKB 3KUDB 2K39A 2J52A 2WDTB 1F9JA 2KJ6A 2K0PA 2V1YA 4J3OD 3QCAA 1V80A 2NPTB 3HHMA 4B0MA 2OEDA 3AEBB 4LNKA 2W3RA 3LDZE 4W9GA 3KLSX 4PYUA 1XCTL 2GRIA 5DPSA 2WX0A 2KANA 1EU4A 3DVNV 4I6NB 2D11A 1C4AA 1WF9A 4NJCA 3VUYA 4XC2A 2J42A 4XDCA 4HLEA 2X38A 5AZHA 2O6VA 3SEBA 4A3PA 4JE3B 4KX6B 5CHVC 1PUTA 5D2MB 3ZRFA 1JWUD 3ZLZA 1K52A 2NCNA 2J53A 2K8BA 1N6ZA 2JZPA 2L52A 4LNOA 1J7AA 1WY8A 3U2SC 3TUOA 1VR9A 4XWTA 3AE8B 3AEGB 2UYZB 1TKYA 1QQRA 2DBYA 3ZQ4A 4W9KA 2KMMA 3I57A 1ZP0B 2KT7A 2V9HA 2M8SA 1EUVB 1WJ6A 1I42A 4IM0A 3L54A 4MGZE 4FULA 5G55A 2KQ7A 3DBRI 3ZDTA 2NTTA 1JCKB 2XK5B 2EELA 1TS4A 2AQ2B 4GMVA 1F52A 1IBXB 2KC2A 3BWUD 4HEA1 5H8YE 5BO4B 4C00A 3M63B 4E71A 1ZW7A 2R2QA 2LEKA 4W9DA 4M0WB 1KRHA 2W3SA 1H4RA 3U7DA 1XEEA 3X0WA 3ZNGC 3BVZA 2ASQA 2KK8A 4AWJA 2WP9B 1C1YB 2QJLA 3FC4A 4LLGM 1ZXIA 1C9FA 1Q10A 2CKHB 4DK5A 4A8XC 1HZ5A 3GOEA 2BYVE 2KN5A 3MC9A 1L5PA 3WAMA 2WWZA 2J7QB 5C2TB 3WIMA 2PVGC 3VTWA 1Q1OA 3Q8AA 1UD7A 1MFWA 2BBCA 3DBRB 2JXTA 4HKQA 2SAKA 3L16A 4E3CA 5TSSA 3A4SC 3Q69A 4Q2JA 2CS4A 3UINB 3N1ZC 1TBEA 1YN4A 3PHWB 1E8XA 4BKSA 3NY5A 4JL9A 3L13A 3QARA 3T3OA 2KFKA 3QJZA 2C5LC 2GB1A 1T0RC 1TY0A 3RD2A 4EFOA 2JXXA 2KXJA 2D3AA 2L83A 4JQWC 4HCPB 1WYWB 2QDFA 4TSSA 2V4LA 3R3MA 4IG7B 3B9JA 1BXTA 2MJEA 2O2VB 5IAAC 4BOSC 4OHJA 3UF8A 4K7SA 3EGRA 2G3QB 4QAYA 3U7ZA 3DVGX 2RDGA 1WZ0A 4ZRQA 4RFBA 3L4PA 4BFRA 3VHTC 1Z2MA 4ZDVA 4LNFA 4W9EA 4WJQA 2RD0A 3B08A 1WR1A 4C7YA 2L3ZA 1ZDXA 1QLBB 3BYTB 3NVYA 1QOFA 1TYGB 1AN8A 2MLBA 3RZWC 2KYWA 1SE3A 2JY6A 2IO3B 3ZIMA 1M94A 5C23A 4TQ1A 4X57B 2KJRA 4LNNA 1WXSA 2KMAA 3T8MA 4GXBA 1S1QB 2HJ1A 4WJNA 3VH4B 3BIID 2AL6A 2ZVNA 3N3KB 1L6UA 4M8NA 1CZPA 2C7NB 4URKA 1PGAA 4MM3B 1XD3B 3PZ8A 3QC8B 4AJYB 3CMMB 3RNCC 1WE6A 4FJZA 3VVWB 5GXGB 1A5RA 3MHSD 2FUG1 4CO7A 4K81A 2DAJA 1IGDA 3NHEB 3TL5A 3I5JC 2MHJA 5BMHA 1B1ZA 5G5GA 4TV3A 1Q5WB 3B2GA 1CJEA 3AU5A 2BYEA 1KLUD 4RM9A 3WA0A 2PEAA 5L83A 1JWAD 1RYJA 4EZJA 2NBWB 1SGHA 2KDIA 3AH7A 5JHAA 4ZOHC 2WDRB 1I4GA 1TZ1A 4F7ZA 2PLPA 5D94A 4K3CA 4XDDA 3HM3A 1X1MA 5L95C 3A9JA 3MP9A 2I2YA 1F2RC 5DPWA 4XX5A 3NG0A 2BS4B 4ZRKA 4FADA 4FJVB 2LMCA 1DYQA 4WJOA 3Q3NC 3VDZA 2QCZA 1XQQA 3BYYB 5AZFA 2JQRB 3A1QA 3AECB 3QHTA 3ZXRA 2GBJA 1LQBA 1JW9D 3NVVA 3PLVA 1R4MI 2KFJA 4BBNF 2IY0B 1VZ8A 4CQNA 5FKAC 3ZW3A 4RM8A 3EFCA 3ZNHB 2ZPYA 4NAMA 3IG3A 4FA6A 1C79A 2KX0A 3JSVB 1I7HA 4WAAA 1WGRA 4XGAB 3ZGZA 3K9PB 1QILA 3N1XC 2EKEC 3P42A 1JWMD 2INDC 1EWYC 4KSKC 5IN7A 3EA6A 2WXNA 2LVPA 1ZUD2 2N0SB 2REXA 2LZ6A 2HTME 2LUEA 3E9SA 4GDKB 4NAWA 2AX5A 2ONQA 2M17A 3KUZA 1Q0WB 4WH4A 1FNVA 1SBBB 3M95A 1V2YA 2CU1A 2BWES 2N9XA 4GDLA 3OG5A 3ZJUA 2W82A 4JPSA 4BBNC 5JH5C 4DHZE 3A9KA 3Q14C 4HXDA 2C7MB 4UDUC 1R4MB 2JF5A 1GB4A 3AN1A 2MCNB 1FFUA 2GI9A 1VZ7A 2CHWA 3NZSA 1C4CA 1FO4A 1FIQA 3VQIA 2K9XA 4RGTA 3E56A 3IAM1 2N4FA 4TUUA 4MEMA 3N20C 1WH3A 4ZRJA 2FIFA 4EOYA 3AE9B 3QA8A 3AE6B 1KFYB 1YNTE 3W5VB 4NQKE 1QOAA 3SR6A 4HPLB 2N9EB 2M4NA 1DOIA 2O6VB 2WXGA 3NS8A 2KACA 5EE1A 4RGNA 2AQ1B 1TGZB 2WXRA 1WR6E 4MSMB 2KTRA 3LB8C 2ICIA 1ZOYB 1IYFA 3UIPB 4ZYSA 1EM7A 4HPMB 3W1YA 3C19A 4LNIA 3QAQA 2KWVB 3U8ZA 3KWLA 3TEXA 2H88B 2MWSB 4W9JA 3PHXB 3EECA 4RF0A 1K50A 3Q2AC 1TTNA 2QIEB 3L0WB 3V6CB 4BOZB 4N6EB 1PFDA 2DYOA 2RDBC 2ON8A 3B1LX 3SU8X 2RDHA 1P7FA 1WX9A 1E8ZA 3UI3A 2Y5BB 3CIRB 2JYEA 1UGMA 2LXAA 1NVID 1P9DU 2ZNVB 3OWEB 5HG2A 2NBUA 2KDMA 2V3SA 3ZDMC 1NDDA 4FN2A 1WMHB 1CMXB 3EUB2 4ANUA 1V9JA 4MJSA 1C78A 2LXCA 2WXOA 4A6QA 4RNAA 3DOWA 3O13A 4EE2A 2KD0A 3RNFC 1K53A 3DBHI 2E3TA 1UBIA 4W9CA 1WJNA 2QC8A 3TEWA 1J8CA 1WJ4A 2IDYA 4ZRIA 3RCZA 2ZZPB 3HIZA 2JPHA 4RCOA 4XZ4A 5MPOA 2I1KA 3BINA 2UWQA 1V1PB 4IWOA 3KW5B 2L05A 2LJ5A 1V49A 1CK1A 2J0MA 5I4DA 1SEBD 1NENB 4M00A 1WGDA 4WWPA 3AE4B 2DZKA 2V0GA 4BKGA 1ZPSA 1HZ6A 4C4VA 1GC6A 2YVCA 2JWZA 2KFKB 2W55A 1D6EC 5AEKB 4ZHOA 1ACCA 1J19A 5IO9A 4DQOC 1NYRA 3QQ8B 4MH8A 3APFA 3HM6X 5LLIA 4OVZA 2G4SA 4WWMA 3PREA 2KNBA 4A9AA 1LGRA 2WDVB 1E8YA 1OQRA 2ZPNA 2WXKA 4ZRPA 1ZGUB 1GB1A 1FCLA 4KGSA 2OJWA 1NI2A 5D3IB 1C77A 1I4HA 2KOXA 3S2AA 3UQBA 3QIJA 4JIOU 1D5ZC 3PZ7A 2WQYB 4LCDE 1YN3A 3I63C 4IW0A 2DHZA 3EC8A 5J18A 2AQ3B 4K7WA 4RGOS 4HDQA 1E7UA 2L0FA 2KJHB 2BW2A 3B0AA 2WXFA 1S3SG 2BYFA 1YIWA 4NJ7A 4P7IA 4I6LB 2HD5B 4NJ6A 1L7YA 3KQ4A 2DZJA 2N9PC 4YL8A 4W9HA 1T0YA 3ZJVA 2MJDA 2KVRA 4FJYA 2L1AA 2ZCCA 1KTKA 4FHKA 1T0QC 1HXYD 1XO3A 4US9A 4HROA 3U4EG 4KIKA 2NMQA 1HQRD 1I4RA 3PSEB 1I35A 1SIJA 2KVZA 3TBLD 4US8A 3AU4A 3NS1A 1YD8U 1VD2A 1STEA 1SXTA 3TEZA 1KH0A 2IO0B 2NPTA 4EUTA 2OOBB 4GOCA 1PGBA 4B0EA 1UWMA 2K6DB 2MBEA 2PE6B 4GU2A 5CHWA 1KOTA 2AYOB 2WDQB 3MJWA 4ANXA 2PE9A 3V62A 1L6VA 3NVWA 4HKZE 3Q8EA 2Y5CA 3ZRCA 4L1BA 4MDKE 1PYWD 2NVUI 1IGCA 2VZKB 2R61A 3H9DA 1GG3A 4KDLB 1SE4A 2L0TA 4NY0A 2JT4B 4WIPA 2VH1A 2MBQA 2DLBA 2Z8LA 4S17A 3WAOA 2LRWA 5E6JA 4KKIA 4KZCA 3RZFA 2MA9B 1JWBD 4BKTA 1FXIA 4NZLB 2EKIA 3APCA 2CHZA 4BVUC 3A9JB 2KQSA 2RR9A 3VFKA 3W5UB 3AEAB 2KX3A 5KHQA 1D4BA 1FPYA 2CJNA 5D3DA 4DDGD 2MQJA 4IWPA 3A1QB 4MSQB 1HTQA 1N5XA 2LWPA 2KMCA 3H7PA 2W54A 3IT4B 4OZCA 3AMZA 4C7ZA 4DHZB 2N7JA 2MJ3A 4NQLB 3H7SA 3I9V1 2WLBA 3ABVB 3KH0A 1C3TA 1P3QU 3Q3JA 4FLHA 4ITKA 2MP2B 1WE7A 3AE1B 3V61A 4JLCA 4YXDB 4P1BC 3GZNI 2WHIA 3TMPB 1WGYA 2KHWB 3AXCA 1F2RI 3W9CB 1OFFA 1NI3A 1D3ZA 1WXQA 3UIOB 4NAWB 3ML9A 4WAFA 1OQQA 3RT3B 2PTLA 1QOBA 4USAA 1E0ZA 2FAZA 1GC7A 5IOIA 5DCNA 3B2FA 4CYEA 4AQ7A 3KYCD 1RRBA 1XLNA 2NBVB 4P16A 2OHFA 4GDLB 1HTOA 3WCQA 4LDTB 2WXPA 4DDID 4KVGB 3SFDB 1SJED 5E6PA 2K8CA 1LFDA 4M02A 2LGIA 3DVGY 2DENB 5EE0A 3ZNID 1E5WA 2M19A 1ESFA 2OJRA 5D7GA 4KGTA 3DDCB 2MX2A 3ZNZB 1R7SA 4LDTD 3V6EB 4A3OA 1YX6B 3GZNB 4ANWA 1FNUA 1F0ZA 3WANA 3MFGA 1JALA 1FXTB 2Y5PA 4A20A 4NPNA 3R66C 3AEFB 1QOGA 1ET9A 3SHQA 3VRAB 4MELA 3OLMD 4LJOB 2WU5B 3Q8FA 2DNFA 3IAS1 1EO6A 3JVZX 3SDLC 3T9LA 4XWWA 1MJDA 1MPEA 1RM6C 2NR2A 1L0VB 2DYBA 1N60A 1WGKA 4YT0B 3P2BA 4LK0M 4G0NB 3W2DA 3TIXA 1XLPA 1JRPA 3C8YA 1NBFC 1FCCC 4K1RB 1J7BA 2R2OA 1L0XB 2CHXA 2BTEA 4EEWA 5EE9A 2KLGA 2KZRA 4TQ0A 2N1WA 3PS6A 1WSPA 1MG4A 4DHJB 1WGGA 1R4NI 4ICVA 4RF1A 1XF5L 3P63A 2BB6A 1L4DB 3ONSA 2TSSA 3V3XA 4DXFA 2PVOD 4I6PA 1JWSD 1YN5A 1TT5B 3DPDA 1CQVA 1DOYA 3AEEB 2D07B 1L0YB 3BVGA 3A33B 3VXWA 4DHJD 1UBQA 2I1JA 1JMLA 4K3BA 3PGEA 5J2RA 1U4AA 1FM0D 2KDFB 3PZDA 3AE7B 4HRSA 4REZA 3IHPC 2QSDA 1E9MA 3ML8A 3Q6BA 1WJUA 3MC8A 4IC7B 4N9F4 1KLGD 1SIFA 3HUIA 1V5OA 2BKFA 2XNAC 4OZBA 4DXAB 2D3CA 2IGHA 2INNE 4HWIB 2PIAA 2ZEQA 1YMHE 1ZDVA 4C4VB 3VTUA 4IM3A 1D5XC 5H92C 2GBMA 3KYDD 1VDVA 1WM2A 4KDIC 4ARCA 5G2NA 2JZZA 1F77A 1XXGA 3VRBB 2IGDA 3N1YC 2FUHB 4KGRA 1FEHA 4WQMA 2JVCA 2CU3A 3AI5A 3RMKC 3TEYA 5DPRA 4G3XB 1GPXA 3K9OB 2DWQA 1FMAD 1I4PA 1V8CA 3RULA 2VRRB 2O6VD 1MVKA 5CTRC 4MGKE 3PLUA 2L76A 3GS2A 4HK2A 5BMGA 3HK0A 1TS2A 3RPFC 1YQBA 2YEPF 5BYRA 2PKOA 1IPGA 2FIDA 2PW9A 3H8HA 4B95A 2B3AA 4PS3A 1E7VA 3PTFC 1OTRB 1TKEA 2RMMA 5BMIA 3JSVA 4AOFA 3GE3C 4DBGA 3ZKJC 3LYYA 3ZVVA 2CJOA 4TMAB 3RNBC 5FR6A 2D2QA 1QF6A 2G45B 3L08A 4GGQA 4W9FA 2JRHA 1VRAB 4EZLA 2K1FA 3FKYA 3P4RB 4C56C 2IO1B 1ET6A 1KM7A 3P4QB 1T6BX 2LHDA 2K25A 3OJ3A 1MHHE 5CHFA 3VUWA 4NNJB 3ZTDA 2DZMA 3W1SC 4W9LA 2N7DA 4RGMA 2WXIA 2NTSA 2N9KA 3U30A 5HI1A 3OJ4B 1A70A 2L8JA 1FRRA 1GAQB 2BWFA 3Q3OC 2LGDA 1M4VA 3EFUA 4F1SA 4C80A 1WX8A 2RPVA 1J7CA 3APDA 3SD5A 2LJIA 2LGYA 4JX1C 1H8CA 3BVMA 1UWXA 2MBOA 3FILA 4N58A 3DWGC 4KKJA 3PPAA 1G6JA 4AS1A 3IVFA 2M0XA 1GUAB 2ACZB 1TS3A 5G5HA 1SE9A 5E6OA 1VCBA 2LHEA 4ICUA 4BKSD 3DBHB 1P0RA 2PMVA 1OEYJ 3VAWA 4AP4C 2KLCA 4IDIA 4B9KA 5J17A 2JSVX 2BYTA 2M56B 1T3QA 3TCAA 2MEKA 1OEYA 2BQQA 3CF6E 3X23A 4MH0E 5LXHA 2JRIB 3NJTA 3T3NA 1TIFA 3BY4B 2INPE 4GSWA 2KAJA 5AUKA 4KZ0A 4WWOA 2WXQA 3EHVA 2J0JA 3NZUA 4MGIE 4OVVA 1D5MC 1KJTA 3BK1A 2WXJA 2KN4A 2AWTA 3H7PB 1E6EB 1I4QA 3R7QA 3MHZA 2LFIA 2ZCBA 3R2TA 1LXDA 3RNAC 3UQAA 4TKNA 1BMLC 3NVZA 3Q8BA 4HJKA 4PT5A 1WXMA 1WMHA 2GLSA 3AEDB 1ISNA 1I4XA 1V81A 4WWNA 1ENFA 1SB3C 3NOBA 2MBBB 1YOVB 3IBEA 2KWCA 3GP7A 2FCQA 3U52E 2LD9A 2XEWA 2KTFA 3Q3FA 3W1SA 4S0RA 4PYZA 3H6NA 1QT9A 1N62A 2M1MA 5IP4D 4II3B 3LJ3A 4JWUC 2BVCA 2Z0DB 2D5GA 4A90A 1SJHD 1JRUA 3N32A 4AJWA 1WM3A 3ZUNA 1WXVA 4HDOA 1N5WA 3RUIB 1LO5D 1PGXA 1V1OA 1V97A 4ANVA 1V1PA 2B76B 2G4DB 3D32A 4ARIA 5TR5A 3DHHC 1K8RB 5BYSA 2JUOA 1DOXA 2KO3A 2BPSA 1GNUA 3L10B 5AUIA 1WWTA 3GB1A 3RFZB 3AB5A 5C3JB 4OVUA 1JROA 4G50A 1PDXA 1MG8A 3MJ5A
chains in the Genus database with same CATH topology
4KGTA 4XDCA 2J42A 2DYMA 2X38A 3AE9B 3AE6B 3SEBA 1KFYB 4YSZB 1YNTE 3W5VB 4JE3B 4KX6B 1PUTA 1R7SA 1QOAA 1MI0A 1XCQL 4YWGG 1JWUD 3SR6A 1FD6A 1JQ4A 2V3NA 1K52A 1DOIA 2WXGA 2KACA 5EE1A 1FNUA 2J53A 4RGNA 4YTNB 2AQ1B 1F0ZA 2WXRA 2JZPA 2L52A 2JX5A 2WXMA 3MFGA 1QKZA 2WNMA 3LB8C 1J7AA 2ICIA 3U2SC 1ZOYB 1ZXHA 3IT6B 3TUOA 1JALA 1VR9A 4XWTA 3AE8B 2Y5PA 1EM7A 3AEGB 4ZYSA 2VZKD 1TKYA 3AEFB 1QOGA 1QQRA 2DBYA 3ZQ4A 1YJJA 1ET9A 3VRAB 2KMMA 3I57A 3KWLA 1ZP0B 3TEXA 1N61A 2QILA 1FFVA 2WU5B 3Q8FA 2H88B 3HVDA 1IBXA 3SFEB 2JWUA 2LUMA 2NTTA 2K3UA 2Y3AA 1JCKB 4DXGA 3IAS1 4XWWA 2EELA 4RF0A 1K50A 1TS4A 1MPEA 2AQ2B 3VR9B 1RM6C 2QIEB 1L0VB 3ZYYX 2V3PA 1IBXB 1N60A 1WGKA 3BWUD 4HEA1 4N6EB 1PFDA 4YT0B 2DYOA 5H8YE 2ON8A 4M0WA 3CWIA 4LK0M 2LEKA 4ZHPA 3W2DA 4MACA 1XLPA 1JRPA 3C8YA 2RDHA 1TZOA 1KRHA 1FCCC 2W3SA 1J7BA 1P7FA 1L0XB 1XEEA 3UI3A 1GOZA 3BVZA 2BTEA 1B9RA 2WXLA 3CIRB 5EE9A 2JYEA 4TQ0A 2IPKD 1WSPA 1NVID 3NZ3A 3OWEB 5HG2A 2XN9C 2KDMA 1AWDA 2WP9B 2ZW1A 2QJLA 3FC4A 3R2IA 4LLGM 1ZXIA 4RF1A 1C9FA 1Q10A 3EUB2 1XF5L 2WXHA 3P63A 2BB6A 4A8XC 1HZ5A 1L4DB 3HRDD 1C78A 4GLSC 1L5PA 4L23A 3KWVA 2WXOA 2TSSA 5C2TB 3V3XA 4A6QA 4RNAA 3O13A 4DXFA 4EE2A 2PVOD 2PVGC 1ZE3D 3AE2B 1JWSD 1FXAA 1K53A 1YN5A 2E3TA 4P6VF 3Q8AA 1DOYA 5HFYA 1WRIA 3AEEB 1L0YB 3TEWA 3BVGA 3BZDB 2IDYA 2BBCA 3TSSA 2JXTA 4HKQA 4MT5A 2SAKA 1JMLA 3P4SB 2FBWB 4OW0A 2I38A 5TSSA 4RCOA 3Q69A 4Q2JA 1UGJA 3J9CA 1FM0D 1YN4A 5MPOA 1E10A 3AE7B 1BUIC 1V1PB 4HRSA 4REZA 2L32A 2E6XA 2QSDA 1E9MA 5FR3A 1CK1A 5I4DA 1SEBD 1NENB 3AE4B 3T3OA 3ETRA 1KLGD 1ROEA 3HUIA 2GB1A 2JU6X 1SF0A 2V0GA 2XNAC 1TY0A 1ZPSA 1HZ6A 3MC0B 4OZBA 2IGHA 2W55A 2INNE 1D6EC 2KWDA 2L83A 2PIAA 4ZHOA 1ACCA 1IUEA 1YMHE 1ZDVA 4DQOC 1C76A 1D5XC 4TSSA 1NYRA 4FXCA 2QEJC 4MH8A 5H92C 5HHDG 1KF6B 3B9JA 3URYA 1BXTA 2MJEA 2KQ4X 4OVZA 1VDVA 4WWMA 4ARCA 3P1MA 4OHJA 1F77A 1XXGA 3VRBB 2IGDA 4A9AA 4KGRA 1FEHA 4WQMA 3EGRA 2WDVB 4YTPB 2CU3A 1OQRA 3TEYA 1HA5A 3U7ZA 1GPXA 2DWQA 2RDGA 1FMAD 1FNWA 2WXKA 1I4PA 4ZRQA 1V8CA 4ZRPA 1RWSA 1MVKA 5EE3A 1GB1A 1FCLA 4RFBA 4IKGA 3L4PA 1DGJA 4KGSA 4R3DA 1AYFA 3GS2A 5D3IB 5BMGA 1C77A 4WURA 1I4HA 5BYQA 1TS2A 3RPFC 4C7YA 2YEPF 2K5PA 5BYRA 2PKOA 1VZ6A 1ZDXA 1QLBB 1D5ZC 2PW9A 2WQYB 3BYTB 3H8HA 3NVYA 1QOFA 3PZ7A 3DWMA 1YQ3B 3AE5B 1TYGB 4HJGE 1YN3A 1AN8A 1TKGA 1SE3A 2BT6A 2AQ3B 1YQ4B 3NUHB 2K22A 4RGOS 1TKEA 2RMMA 5BMIA 3FAHA 4TQ1A 2BS3B 3AM9A 3BK2A 2BW2A 4H2AA 2WXFA 2JYTA 1C4PA 3LYYA 2WS3B 2CJOA 1SSNA 4TMAB 3KQ4A 1EWCA 2G9HD 1K51A 3BIID 1MHXA 1Y56A 1QF6A 1L4ZB 1L6UA 5LNK1 4O1NA 3ZJVA 1CZPA 3AE3B 1WYGA 1PGAA 2MJDA 4MM3B 1VRAB 2BB5A 3PZ8A 2L1AA 1XLQA 3P4PB 2J4XA 1KTKA 3P4RB 4C56C 3R8BA 1HXYD 1XO3A 1ET6A 3PO0A 3P4QB 1T6BX 1RFKA 2LHDA 4US9A 4HROA 4XE0A 1MHHE 3U4EG 2NMQA 1HQRD 1I4RA 1SIJA 2FE8A 4US8A 1VJKA 3NS1A 5GXGB 2FUG1 2Q5WD 1STEA 1SXTA 4RGMA 2WXIA 3TEZA 1FRDA 1KH0A 1UNSA 1IGDA 2ZW0A 2NTSA 2N9KA 5HI1A 1PGBA 1A70A 5BMHA 4B0EA 1B1ZA 1FRRA 1UWMA 1GAQB 5G5GA 3IXSA 1M4VA 4C80A 2WDQB 1TJEA 3B2GA 2RPVA 1CJEA 1J7CA 1KLUD 1L6VA 3NVWA 2WU2B 4HKZE 2SEBD 3Q8EA 2LJIA 2Y5CA 4JX1C 4YSYB 3BVMA 1UWXA 4L1BA 1PYWD 1XLOA 3ZJTA 1JWAD 1RYJA 3FILA 4N58A 1IGCA 2QMTA 1UUPA 3DWGC 3HVZA 2VZKB 4KKJA 2R61A 4AS1A 2ACZB 3AH7A 1TS3A 4ZOHC 5G5HA 1HEZE 2WDRB 3LXFA 1SE4A 1I4GA 4A55A 4D2KA 2IGGA 3FILB 3NRZA 2LHEA 2PLPA 4WIPA 1TS5A 2BS2B 2DLBA 2Z8LA 2PMVA 4XDDA 1NEKB 5E6JA 4KKIA 2M0AA 2V4IB 4IDIA 1JWBD 2JSVX 1T5XD 4OZAA 3MP9A 1FXIA 4NZLB 2EKIA 1F2RC 2BYTA 2M56B 2I2YA 3MJ5A 2BS4B 5JXVA 2LMCA 3V05A 1DYQA 1T3QA 3W5UB 4YSXB 2MEKA 3BYYB 4LTUA 1SE2A 3AEAB 2JQRB 1TY2A 3Q8CA 1P7EA 3AECB 3VR8B 5T8IA 3T3NA 1VLBA 2INPE 1D4BA 2CJNA 2KAJA 1JW9D 5AUKA 5D3DA 1AW7A 3NVVA 2WXQA 1N5XA 1VZ8A 4CQNA 1D5MC 5FKAC 1N63A 3BK1A 2WXJA 2W54A 2HDEA 2KN4A 4YTMB 3IT4B 2H89B 4OZCA 3AMZA 3N9YC 4NAMA 1E7PB 1C79A 4C7ZA 1E6EB 1I4QA 2N7JA 4L2YA 2MJ3A 1I7HA 3MHZA 2LFIA 3I9V1 3R2TA 3ZGZA 2WLBA 1BMLC 3NVZA 3ABVB 3AV8A 3Q8BA 4RH6A 4PT5A 1QILA 4IOIE 3AEDB 4ITKA 1I4XA 1YJIA 3P42A 1EU3A 2N9LA 1JWMD 1ENFA 1SB3C 1EWYC 3AE1B 4YXDB 2G1EA 3EA6A 2WXNA 3GP7A 1ZUD2 2N0SB 1NYQA 2HTME 3U52E 4JWSC 3E9SA 4GDKB 3W1SA 2AX5A 2ONQA 1F2RI 2MH7A 1FNVA 2IJ0A 4WH4A 1QT9A 3W9CB 1OFFA 1N62A 5FK9C 1NI3A 1WXQA 1SBBB 2YEPB 4NAWB 4WAFA 1OQQA 4JWUC 4N59A 2PTLA 1QOBA 4USAA 2D5GA 4A90A 1SJHD 2J52A 1E0ZA 2K0PA 4J3OD 3ZJUA 3B2FA 2W82A 4JPSA 4AQ7A 1N5WA 1XLNA 4UDUC 4P16A 1LO5D 2OHFA 4B0MA 2OEDA 4GDLB 3AEBB 3AN1A 3WCQA 1GB4A 2WXPA 1PGXA 1V1OA 2W3RA 1V97A 1V1PA 1FFUA 2B76B 2GI9A 1SJED 3SFDB 1VZ7A 4ARIA 3KLSX 2LGIA 1XCTL 2GRIA 5EE0A 5BYSA 1C4CA 1FO4A 1DOXA 1EU4A 1FIQA 2M19A 3VQIA 2K9XA 5AUIA 4RGTA 1WWTA 3GB1A 3RFZB 3E56A 1ESFA 1C4AA 3AB5A 3IAM1 5C3JB 1JROA 1PDXA 4NJCA 1CQVA 5D7GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YSX B;  2WS3 B;  2CJO A;  3AE9 B;  3AE6 B;  4LTU A;  1KFY B;  4YSZ B;  3P4S B;  2FBW B;  3AEA B;  3W5V B;  2JQR B;  4KX6 B;  1PUT A;  1R7S A;  3AEC B;  3BII D;  3VR8 B;  1QOA A;  1VLB A;  1QF6 A;  3SR6 A;  2CJN A;  2KAJ A;  1JW9 D;  1L6U A;  1FM0 D;  5AUK A;  1JQ4 A;  3NVV A;  1DOI A;  5MPO A;  1CZP A;  1E10 A;  3AE7 B;  1WYG A;  3AE3 B;  4YTN B;  5EE1 A;  1F0Z A;  2MJD A;  4HRS A;  1N5X A;  2JX5 A;  2L52 A;  1N63 A;  1E9M A;  1J7A A;  3LB8 C;  1XLQ A;  2W54 A;  3P4P B;  1ZOY B;  1NEN B;  1JAL A;  3AE8 B;  3AE4 B;  3AEG B;  3P4R B;  4WQM A;  4YTM B;  1TKY A;  2H89 B;  1QOG A;  1XO3 A;  1ROE A;  2DBY A;  3AEF B;  3AMZ A;  3ETR A;  3HUI A;  3PO0 A;  1E7P B;  1YJJ A;  1SF0 A;  1RFK A;  3P4Q B;  3VRA B;  4C7Z A;  2KMM A;  4US9 A;  3KWL A;  1E6E B;  1ZP0 B;  4HRO A;  2MJ3 A;  1I7H A;  1N61 A;  1SIJ A;  1FFV A;  2W55 A;  2WLB A;  2H88 B;  2WU5 B;  1VJK A;  4US8 A;  3NS1 A;  3NVZ A;  2L83 A;  2PIA A;  3ABV B;  3AV8 A;  5GXG B;  3SFE B;  4ZHO A;  2Q5W D;  1IUE A;  3AED B;  4ITK A;  1YJI A;  1FRD A;  3VR9 B;  1RM6 C;  1NYR A;  1L0V B;  1SB3 C;  2QIE B;  4FXC A;  5H92 C;  3ZYY X;  1KF6 B;  1N60 A;  1EWY C;  1WGK A;  3AE1 B;  3B9J A;  4N6E B;  1PFD A;  2G1E A;  2MJE A;  4YT0 B;  5H8Y E;  4YXD B;  1VDV A;  1ZUD 2;  1A70 A;  2N0S B;  3CWI A;  4WWM A;  3P1M A;  1FRR A;  1UWM A;  1GAQ B;  1NYQ A;  2HTM E;  5G5G A;  2LEK A;  4JWS C;  4ZHP A;  3VRB B;  2AX5 A;  1XLP A;  4A9A A;  2MH7 A;  1JRP A;  4C80 A;  4YTP B;  2WDQ B;  1QT9 A;  2WDV B;  1OFF A;  1N62 A;  1TJE A;  2CU3 A;  1CJE A;  1KRH A;  1NI3 A;  1OQR A;  1J7C A;  3B2G A;  2W3S A;  1J7B A;  1WXQ A;  1GPX A;  2DWQ A;  1L6V A;  3NVW A;  1FMA D;  2WU2 B;  1OQQ A;  1V8C A;  2Y5C A;  4JX1 C;  4JWU C;  4N59 A;  4YSY B;  3CIR B;  1B9R A;  5EE9 A;  1QOB A;  1RWS A;  1XLO A;  4USA A;  5EE3 A;  3W9C B;  1JWA D;  1RYJ A;  4N58 A;  3L4P A;  1E0Z A;  3DWG C;  3HVZ A;  1DGJ A;  1NVI D;  1AYF A;  3B2F A;  1AWD A;  2ACZ B;  3AH7 A;  4ZOH C;  5G5H A;  2WP9 B;  2WDR B;  3LXF A;  2QJL A;  3FC4 A;  1N5W A;  3RPF C;  1XLN A;  4C7Y A;  1ZXI A;  2K5P A;  2OHF A;  2PKO A;  3EUB 2;  3NRZ A;  3AEB B;  1QLB B;  3AN1 A;  2WQY B;  3NVY A;  2W3R A;  3P63 A;  3WCQ A;  1QOF A;  2BS2 B;  1V97 A;  3DWM A;  1FFU A;  1YQ3 B;  2B76 B;  3SFD B;  3AE5 B;  1TYG B;  1NEK B;  3HRD D;  1L5P A;  1TKG A;  5C2T B;  2BT6 A;  5EE0 A;  4IDI A;  1JWB D;  2PVO D;  1YQ4 B;  1FO4 A;  2PVG C;  1DOX A;  3AE2 B;  2K22 A;  1FXA A;  1FIQ A;  1FXI A;  2EKI A;  1TKE A;  2M19 A;  2K9X A;  2M56 B;  2E3T A;  4P6V F;  1WWT A;  3FAH A;  5AUI A;  2BS4 B;  1DOY A;  1WRI A;  2BS3 B;  3AB5 A;  3AEE B;  5C3J B;  3AM9 A;  1JRO A;  1PDX A;  1T3Q A;  3W5U B; 
#chains in the Genus database with same CATH topology
 2DYM A;  4KV2 A;  4YSZ B;  2DAF A;  1MI0 A;  1XCQ L;  3PRZ A;  4YWG G;  1FD6 A;  3DBL I;  2V3N A;  1JQ4 A;  2GBN A;  3L17 A;  1GJZ A;  5D6J B;  4YTN B;  5DPT A;  4E74 A;  2ZJD A;  4RMA A;  2JX5 A;  2WXM A;  1QKZ A;  2WNM A;  3RN9 C;  1ZXH A;  3IT6 B;  2VZK D;  1YJJ A;  1WIA A;  2XK5 A;  3ZTC A;  1KLV A;  1N61 A;  2QIL A;  2EMT A;  1FFV A;  1IBX A;  3HVD A;  2IO2 B;  3SFE B;  2JWU A;  2LUM A;  2Y3A A;  2K3U A;  4DXG A;  4PS7 A;  5IA7 A;  3VR9 B;  3ZYY X;  2V3P A;  4ASW C;  2K6Q A;  4M0W A;  1BT0 A;  3CWI A;  3V60 A;  3DHG C;  4ZHP A;  2L00 B;  4MAC A;  4IUM B;  1P1A A;  2UU7 A;  1LM8 B;  1TZO A;  2FCM A;  2L7R A;  3KVF B;  1UH6 A;  1GOZ A;  2BGF A;  2WXL A;  1B9R A;  2KDE B;  3UGB B;  2IPK D;  4BZA A;  3NZ3 A;  1ZKH A;  2XN9 C;  3QK0 A;  5GMV A;  1AWD A;  3DBL B;  2ZW1 A;  3R2I A;  1AAR A;  3IFW B;  1WX7 A;  2WXH A;  3ALB A;  3HRD D;  4GLS C;  5CX3 A;  5AZG A;  2ZVO A;  4L23 A;  3KWV A;  3M3J A;  2W9N A;  1ZE3 D;  3AE2 B;  2WGS A;  1FXA A;  1J0G A;  4P6V F;  5HFY A;  1WRI A;  2J0K A;  2GBR A;  2KDB A;  3QX1 A;  3BZD B;  3TSS A;  5E6N A;  3VUX A;  4MT5 A;  3P4S B;  2FBW B;  4OW0 A;  2I38 A;  2C60 A;  1WGH A;  3N30 A;  4AUQ C;  1UGJ A;  2HE7 A;  3J9C A;  3VTV A;  3A9K B;  3AUL A;  2DZI A;  3OAW A;  1E10 A;  1BUI C;  4CHK A;  2JZ3 B;  2L32 A;  2E6X A;  3M62 B;  2PJH A;  2RPQ A;  5FR3 A;  4GIV A;  4JGH B;  2AL3 A;  3ETR A;  1ROE A;  2JU6 X;  1SF0 A;  2IY1 B;  1WZ3 A;  3MC0 B;  2FCN A;  4P1C C;  2KWD A;  3PVL A;  3ENE A;  2O2V A;  1OQY A;  1IUE A;  3CST A;  3ZXV A;  3DBS A;  4FBJ B;  1C76 A;  2X8X X;  3CSF A;  3MTN B;  4MGY E;  1Y8R C;  4FXC A;  2QEJ C;  3C0R B;  1KF6 B;  5HHD G;  3URY A;  2KQ4 X;  3P1M A;  4HPP A;  3ECI A;  2KTR B;  4BAX A;  4YTP B;  2RSU A;  1HA5 A;  3R7R A;  1WXA A;  1WRD B;  1FNW A;  3DQV A;  4B6W A;  1RWS A;  2A5U A;  4FHJ A;  5EE3 A;  2D3G A;  4HVB A;  1OGW A;  4IKG A;  3VH3 B;  1DGJ A;  4R3D A;  1AYF A;  4M8M A;  4WUR A;  5BYQ A;  5IKC M;  3ZO5 B;  2K5P A;  1VZ6 A;  1RFA A;  3DWM A;  1YQ3 B;  1E90 A;  3AE5 B;  4HJG E;  1TKG A;  2BT6 A;  2GBK A;  3WAL A;  2GMI C;  2LAS A;  1YQ4 B;  3NUH B;  2IYD B;  1L2N A;  4GN1 A;  2K22 A;  2Z0E B;  3RNE C;  3QWZ B;  5HKH A;  3FAH A;  2D3B A;  2BS3 B;  3AM9 A;  3BK2 A;  4H2A A;  3PRM B;  1IP9 A;  4ACF A;  2JYT A;  1C4P A;  2WS3 B;  1SSN A;  3I3T B;  3DHI C;  1EWC A;  1UF0 A;  2G9H D;  1K51 A;  2MP2 A;  4MM3 A;  1MHX A;  4EKU A;  1Y56 A;  1L4Z B;  1YJ1 A;  5LNK 1;  2LGS A;  4O1N A;  1EF1 A;  3TJP A;  3AE3 B;  1WYG A;  4LJP B;  4MJS B;  4M01 A;  2BB5 A;  2KKC A;  2VH2 A;  3DVN U;  4IM2 A;  3Q3M C;  2FCS A;  1XLQ A;  2DX5 B;  2MBH A;  3P4P B;  2J4X A;  4J6I A;  2MW5 A;  3R8B A;  3RYT A;  2KC1 A;  1UEL A;  3PO0 A;  1RFK A;  3A4R A;  5EDS A;  4XE0 A;  2FE8 A;  1VJK A;  4II2 B;  2LRU A;  2D10 A;  3JW0 X;  4KSL C;  2Q5W D;  2WX1 A;  2N7E A;  1FRD A;  2C7H A;  1UNS A;  2AEH A;  2ZW0 A;  4W9I A;  1YX5 B;  2C9W B;  2FNJ B;  4EZK A;  3IXS A;  2LVQ A;  1TJE A;  1V86 A;  1F1H A;  1WFY A;  2WU2 B;  2SEB D;  4GB9 A;  3KUC B;  4YSY B;  1R4N B;  1XLO A;  2NS5 A;  4WQO B;  3ZJT A;  3PV1 A;  2QMT A;  1UUP A;  1QZE A;  2CR5 A;  3HVZ A;  4PK1 A;  2XBB C;  1HEZ E;  3LXF A;  4G11 A;  5LXI B;  4A55 A;  4D2K A;  2IGG A;  3FIL B;  3NRZ A;  1TS5 A;  2BS2 B;  1PQS A;  1NEK B;  2GOW A;  2LGX A;  4HCN B;  2M0A A;  2HTH A;  4ZYN A;  2V4I B;  4OZA A;  1T5X D;  4WJP A;  2LI5 A;  1Z5S B;  1V6E A;  4F8C B;  3DCG A;  3PRP B;  5JXV A;  3V05 A;  4DWF A;  1WI0 A;  3WAP A;  4YSX B;  2INC C;  2RGF A;  2BF8 B;  4LTU A;  4IWQ A;  1SE2 A;  3GE8 C;  1TY2 A;  3Q8C A;  1P7E A;  3VR8 B;  5T8I A;  1VLB A;  4K7U A;  1AW7 A;  1V5T A;  2KWU B;  2K8H A;  1P98 A;  3JYU A;  2WYQ A;  1N63 A;  1RLF A;  3H1U A;  2HDE A;  2LVO A;  4YTM B;  2QHO A;  2IZV B;  2N1V A;  1UZX B;  2H89 B;  1E8W A;  3N9Y C;  1E7P B;  1RAX A;  4L2Y A;  2Z59 B;  2EMS A;  2MRP A;  3AV8 A;  1HE8 A;  4RH6 A;  4IOI E;  1YJI A;  1EU3 A;  2N9L A;  4PS8 A;  5KHO A;  1EF5 A;  4GDK A;  2ZNV C;  1XT9 B;  1T0S C;  2G1E A;  2MSE D;  2IBI B;  4XYC A;  1NYQ A;  4JWS C;  2MH7 A;  2IJ0 A;  5FK9 C;  2BKR B;  3RI7 C;  5JHB A;  2HJ8 A;  2YLM A;  2YEP B;  3RNG C;  5JZE B;  5C1Z A;  3O65 B;  2PPH A;  3PT2 B;  2A4Z A;  4N59 A;  4KIK B;  3KUD B;  2K39 A;  2J52 A;  2WDT B;  1F9J A;  2KJ6 A;  2K0P A;  2V1Y A;  4J3O D;  3QCA A;  1V80 A;  2NPT B;  3HHM A;  4B0M A;  2OED A;  3AEB B;  4LNK A;  2W3R A;  3LDZ E;  4W9G A;  3KLS X;  4PYU A;  1XCT L;  2GRI A;  5DPS A;  2WX0 A;  2KAN A;  1EU4 A;  3DVN V;  4I6N B;  2D11 A;  1C4A A;  1WF9 A;  4NJC A;  3VUY A;  4XC2 A;  2J42 A;  4XDC A;  4HLE A;  2X38 A;  5AZH A;  2O6V A;  3SEB A;  4A3P A;  4JE3 B;  4KX6 B;  5CHV C;  1PUT A;  5D2M B;  3ZRF A;  1JWU D;  3ZLZ A;  1K52 A;  2NCN A;  2J53 A;  2K8B A;  1N6Z A;  2JZP A;  2L52 A;  4LNO A;  1J7A A;  1WY8 A;  3U2S C;  3TUO A;  1VR9 A;  4XWT A;  3AE8 B;  3AEG B;  2UYZ B;  1TKY A;  1QQR A;  2DBY A;  3ZQ4 A;  4W9K A;  2KMM A;  3I57 A;  1ZP0 B;  2KT7 A;  2V9H A;  2M8S A;  1EUV B;  1WJ6 A;  1I42 A;  4IM0 A;  3L54 A;  4MGZ E;  4FUL A;  5G55 A;  2KQ7 A;  3DBR I;  3ZDT A;  2NTT A;  1JCK B;  2XK5 B;  2EEL A;  1TS4 A;  2AQ2 B;  4GMV A;  1F52 A;  1IBX B;  2KC2 A;  3BWU D;  4HEA 1;  5H8Y E;  5BO4 B;  4C00 A;  3M63 B;  4E71 A;  1ZW7 A;  2R2Q A;  2LEK A;  4W9D A;  4M0W B;  1KRH A;  2W3S A;  1H4R A;  3U7D A;  1XEE A;  3X0W A;  3ZNG C;  3BVZ A;  2ASQ A;  2KK8 A;  4AWJ A;  2WP9 B;  1C1Y B;  2QJL A;  3FC4 A;  4LLG M;  1ZXI A;  1C9F A;  1Q10 A;  2CKH B;  4DK5 A;  4A8X C;  1HZ5 A;  3GOE A;  2BYV E;  2KN5 A;  3MC9 A;  1L5P A;  3WAM A;  2WWZ A;  2J7Q B;  5C2T B;  3WIM A;  2PVG C;  3VTW A;  1Q1O A;  3Q8A A;  1UD7 A;  1MFW A;  2BBC A;  3DBR B;  2JXT A;  4HKQ A;  2SAK A;  3L16 A;  4E3C A;  5TSS A;  3A4S C;  3Q69 A;  4Q2J A;  2CS4 A;  3UIN B;  3N1Z C;  1TBE A;  1YN4 A;  3PHW B;  1E8X A;  4BKS A;  3NY5 A;  4JL9 A;  3L13 A;  3QAR A;  3T3O A;  2KFK A;  3QJZ A;  2C5L C;  2GB1 A;  1T0R C;  1TY0 A;  3RD2 A;  4EFO A;  2JXX A;  2KXJ A;  2D3A A;  2L83 A;  4JQW C;  4HCP B;  1WYW B;  2QDF A;  4TSS A;  2V4L A;  3R3M A;  4IG7 B;  3B9J A;  1BXT A;  2MJE A;  2O2V B;  5IAA C;  4BOS C;  4OHJ A;  3UF8 A;  4K7S A;  3EGR A;  2G3Q B;  4QAY A;  3U7Z A;  3DVG X;  2RDG A;  1WZ0 A;  4ZRQ A;  4RFB A;  3L4P A;  4BFR A;  3VHT C;  1Z2M A;  4ZDV A;  4LNF A;  4W9E A;  4WJQ A;  2RD0 A;  3B08 A;  1WR1 A;  4C7Y A;  2L3Z A;  1ZDX A;  1QLB B;  3BYT B;  3NVY A;  1QOF A;  1TYG B;  1AN8 A;  2MLB A;  3RZW C;  2KYW A;  1SE3 A;  2JY6 A;  2IO3 B;  3ZIM A;  1M94 A;  5C23 A;  4TQ1 A;  4X57 B;  2KJR A;  4LNN A;  1WXS A;  2KMA A;  3T8M A;  4GXB A;  1S1Q B;  2HJ1 A;  4WJN A;  3VH4 B;  3BII D;  2AL6 A;  2ZVN A;  3N3K B;  1L6U A;  4M8N A;  1CZP A;  2C7N B;  4URK A;  1PGA A;  4MM3 B;  1XD3 B;  3PZ8 A;  3QC8 B;  4AJY B;  3CMM B;  3RNC C;  1WE6 A;  4FJZ A;  3VVW B;  5GXG B;  1A5R A;  3MHS D;  2FUG 1;  4CO7 A;  4K81 A;  2DAJ A;  1IGD A;  3NHE B;  3TL5 A;  3I5J C;  2MHJ A;  5BMH A;  1B1Z A;  5G5G A;  4TV3 A;  1Q5W B;  3B2G A;  1CJE A;  3AU5 A;  2BYE A;  1KLU D;  4RM9 A;  3WA0 A;  2PEA A;  5L83 A;  1JWA D;  1RYJ A;  4EZJ A;  2NBW B;  1SGH A;  2KDI A;  3AH7 A;  5JHA A;  4ZOH C;  2WDR B;  1I4G A;  1TZ1 A;  4F7Z A;  2PLP A;  5D94 A;  4K3C A;  4XDD A;  3HM3 A;  1X1M A;  5L95 C;  3A9J A;  3MP9 A;  2I2Y A;  1F2R C;  5DPW A;  4XX5 A;  3NG0 A;  2BS4 B;  4ZRK A;  4FAD A;  4FJV B;  2LMC A;  1DYQ A;  4WJO A;  3Q3N C;  3VDZ A;  2QCZ A;  1XQQ A;  3BYY B;  5AZF A;  2JQR B;  3A1Q A;  3AEC B;  3QHT A;  3ZXR A;  2GBJ A;  1LQB A;  1JW9 D;  3NVV A;  3PLV A;  1R4M I;  2KFJ A;  4BBN F;  2IY0 B;  1VZ8 A;  4CQN A;  5FKA C;  3ZW3 A;  4RM8 A;  3EFC A;  3ZNH B;  2ZPY A;  4NAM A;  3IG3 A;  4FA6 A;  1C79 A;  2KX0 A;  3JSV B;  1I7H A;  4WAA A;  1WGR A;  4XGA B;  3ZGZ A;  3K9P B;  1QIL A;  3N1X C;  2EKE C;  3P42 A;  1JWM D;  2IND C;  1EWY C;  4KSK C;  5IN7 A;  3EA6 A;  2WXN A;  2LVP A;  1ZUD 2;  2N0S B;  2REX A;  2LZ6 A;  2HTM E;  2LUE A;  3E9S A;  4GDK B;  4NAW A;  2AX5 A;  2ONQ A;  2M17 A;  3KUZ A;  1Q0W B;  4WH4 A;  1FNV A;  1SBB B;  3M95 A;  1V2Y A;  2CU1 A;  2BWE S;  2N9X A;  4GDL A;  3OG5 A;  3ZJU A;  2W82 A;  4JPS A;  4BBN C;  5JH5 C;  4DHZ E;  3A9K A;  3Q14 C;  4HXD A;  2C7M B;  4UDU C;  1R4M B;  2JF5 A;  1GB4 A;  3AN1 A;  2MCN B;  1FFU A;  2GI9 A;  1VZ7 A;  2CHW A;  3NZS A;  1C4C A;  1FO4 A;  1FIQ A;  3VQI A;  2K9X A;  4RGT A;  3E56 A;  3IAM 1;  2N4F A;  4TUU A;  4MEM A;  3N20 C;  1WH3 A;  4ZRJ A;  2FIF A;  4EOY A;  3AE9 B;  3QA8 A;  3AE6 B;  1KFY B;  1YNT E;  3W5V B;  4NQK E;  1QOA A;  3SR6 A;  4HPL B;  2N9E B;  2M4N A;  1DOI A;  2O6V B;  2WXG A;  3NS8 A;  2KAC A;  5EE1 A;  4RGN A;  2AQ1 B;  1TGZ B;  2WXR A;  1WR6 E;  4MSM B;  2KTR A;  3LB8 C;  2ICI A;  1ZOY B;  1IYF A;  3UIP B;  4ZYS A;  1EM7 A;  4HPM B;  3W1Y A;  3C19 A;  4LNI A;  3QAQ A;  2KWV B;  3U8Z A;  3KWL A;  3TEX A;  2H88 B;  2MWS B;  4W9J A;  3PHX B;  3EEC A;  4RF0 A;  1K50 A;  3Q2A C;  1TTN A;  2QIE B;  3L0W B;  3V6C B;  4BOZ B;  4N6E B;  1PFD A;  2DYO A;  2RDB C;  2ON8 A;  3B1L X;  3SU8 X;  2RDH A;  1P7F A;  1WX9 A;  1E8Z A;  3UI3 A;  2Y5B B;  3CIR B;  2JYE A;  1UGM A;  2LXA A;  1NVI D;  1P9D U;  2ZNV B;  3OWE B;  5HG2 A;  2NBU A;  2KDM A;  2V3S A;  3ZDM C;  1NDD A;  4FN2 A;  1WMH B;  1CMX B;  3EUB 2;  4ANU A;  1V9J A;  4MJS A;  1C78 A;  2LXC A;  2WXO A;  4A6Q A;  4RNA A;  3DOW A;  3O13 A;  4EE2 A;  2KD0 A;  3RNF C;  1K53 A;  3DBH I;  2E3T A;  1UBI A;  4W9C A;  1WJN A;  2QC8 A;  3TEW A;  1J8C A;  1WJ4 A;  2IDY A;  4ZRI A;  3RCZ A;  2ZZP B;  3HIZ A;  2JPH A;  4RCO A;  4XZ4 A;  5MPO A;  2I1K A;  3BIN A;  2UWQ A;  1V1P B;  4IWO A;  3KW5 B;  2L05 A;  2LJ5 A;  1V49 A;  1CK1 A;  2J0M A;  5I4D A;  1SEB D;  1NEN B;  4M00 A;  1WGD A;  4WWP A;  3AE4 B;  2DZK A;  2V0G A;  4BKG A;  1ZPS A;  1HZ6 A;  4C4V A;  1GC6 A;  2YVC A;  2JWZ A;  2KFK B;  2W55 A;  1D6E C;  5AEK B;  4ZHO A;  1ACC A;  1J19 A;  5IO9 A;  4DQO C;  1NYR A;  3QQ8 B;  4MH8 A;  3APF A;  3HM6 X;  5LLI A;  4OVZ A;  2G4S A;  4WWM A;  3PRE A;  2KNB A;  4A9A A;  1LGR A;  2WDV B;  1E8Y A;  1OQR A;  2ZPN A;  2WXK A;  4ZRP A;  1ZGU B;  1GB1 A;  1FCL A;  4KGS A;  2OJW A;  1NI2 A;  5D3I B;  1C77 A;  1I4H A;  2KOX A;  3S2A A;  3UQB A;  3QIJ A;  4JIO U;  1D5Z C;  3PZ7 A;  2WQY B;  4LCD E;  1YN3 A;  3I63 C;  4IW0 A;  2DHZ A;  3EC8 A;  5J18 A;  2AQ3 B;  4K7W A;  4RGO S;  4HDQ A;  1E7U A;  2L0F A;  2KJH B;  2BW2 A;  3B0A A;  2WXF A;  1S3S G;  2BYF A;  1YIW A;  4NJ7 A;  4P7I A;  4I6L B;  2HD5 B;  4NJ6 A;  1L7Y A;  3KQ4 A;  2DZJ A;  2N9P C;  4YL8 A;  4W9H A;  1T0Y A;  3ZJV A;  2MJD A;  2KVR A;  4FJY A;  2L1A A;  2ZCC A;  1KTK A;  4FHK A;  1T0Q C;  1HXY D;  1XO3 A;  4US9 A;  4HRO A;  3U4E G;  4KIK A;  2NMQ A;  1HQR D;  1I4R A;  3PSE B;  1I35 A;  1SIJ A;  2KVZ A;  3TBL D;  4US8 A;  3AU4 A;  3NS1 A;  1YD8 U;  1VD2 A;  1STE A;  1SXT A;  3TEZ A;  1KH0 A;  2IO0 B;  2NPT A;  4EUT A;  2OOB B;  4GOC A;  1PGB A;  4B0E A;  1UWM A;  2K6D B;  2MBE A;  2PE6 B;  4GU2 A;  5CHW A;  1KOT A;  2AYO B;  2WDQ B;  3MJW A;  4ANX A;  2PE9 A;  3V62 A;  1L6V A;  3NVW A;  4HKZ E;  3Q8E A;  2Y5C A;  3ZRC A;  4L1B A;  4MDK E;  1PYW D;  2NVU I;  1IGC A;  2VZK B;  2R61 A;  3H9D A;  1GG3 A;  4KDL B;  1SE4 A;  2L0T A;  4NY0 A;  2JT4 B;  4WIP A;  2VH1 A;  2MBQ A;  2DLB A;  2Z8L A;  4S17 A;  3WAO A;  2LRW A;  5E6J A;  4KKI A;  4KZC A;  3RZF A;  2MA9 B;  1JWB D;  4BKT A;  1FXI A;  4NZL B;  2EKI A;  3APC A;  2CHZ A;  4BVU C;  3A9J B;  2KQS A;  2RR9 A;  3VFK A;  3W5U B;  3AEA B;  2KX3 A;  5KHQ A;  1D4B A;  1FPY A;  2CJN A;  5D3D A;  4DDG D;  2MQJ A;  4IWP A;  3A1Q B;  4MSQ B;  1HTQ A;  1N5X A;  2LWP A;  2KMC A;  3H7P A;  2W54 A;  3IT4 B;  4OZC A;  3AMZ A;  4C7Z A;  4DHZ B;  2N7J A;  2MJ3 A;  4NQL B;  3H7S A;  3I9V 1;  2WLB A;  3ABV B;  3KH0 A;  1C3T A;  1P3Q U;  3Q3J A;  4FLH A;  4ITK A;  2MP2 B;  1WE7 A;  3AE1 B;  3V61 A;  4JLC A;  4YXD B;  4P1B C;  3GZN I;  2WHI A;  3TMP B;  1WGY A;  2KHW B;  3AXC A;  1F2R I;  3W9C B;  1OFF A;  1NI3 A;  1D3Z A;  1WXQ A;  3UIO B;  4NAW B;  3ML9 A;  4WAF A;  1OQQ A;  3RT3 B;  2PTL A;  1QOB A;  4USA A;  1E0Z A;  2FAZ A;  1GC7 A;  5IOI A;  5DCN A;  3B2F A;  4CYE A;  4AQ7 A;  3KYC D;  1RRB A;  1XLN A;  2NBV B;  4P16 A;  2OHF A;  4GDL B;  1HTO A;  3WCQ A;  4LDT B;  2WXP A;  4DDI D;  4KVG B;  3SFD B;  1SJE D;  5E6P A;  2K8C A;  1LFD A;  4M02 A;  2LGI A;  3DVG Y;  2DEN B;  5EE0 A;  3ZNI D;  1E5W A;  2M19 A;  1ESF A;  2OJR A;  5D7G A;  4KGT A;  3DDC B;  2MX2 A;  3ZNZ B;  1R7S A;  4LDT D;  3V6E B;  4A3O A;  1YX6 B;  3GZN B;  4ANW A;  1FNU A;  1F0Z A;  3WAN A;  3MFG A;  1JAL A;  1FXT B;  2Y5P A;  4A20 A;  4NPN A;  3R66 C;  3AEF B;  1QOG A;  1ET9 A;  3SHQ A;  3VRA B;  4MEL A;  3OLM D;  4LJO B;  2WU5 B;  3Q8F A;  2DNF A;  3IAS 1;  1EO6 A;  3JVZ X;  3SDL C;  3T9L A;  4XWW A;  1MJD A;  1MPE A;  1RM6 C;  2NR2 A;  1L0V B;  2DYB A;  1N60 A;  1WGK A;  4YT0 B;  3P2B A;  4LK0 M;  4G0N B;  3W2D A;  3TIX A;  1XLP A;  1JRP A;  3C8Y A;  1NBF C;  1FCC C;  4K1R B;  1J7B A;  2R2O A;  1L0X B;  2CHX A;  2BTE A;  4EEW A;  5EE9 A;  2KLG A;  2KZR A;  4TQ0 A;  2N1W A;  3PS6 A;  1WSP A;  1MG4 A;  4DHJ B;  1WGG A;  1R4N I;  4ICV A;  4RF1 A;  1XF5 L;  3P63 A;  2BB6 A;  1L4D B;  3ONS A;  2TSS A;  3V3X A;  4DXF A;  2PVO D;  4I6P A;  1JWS D;  1YN5 A;  1TT5 B;  3DPD A;  1CQV A;  1DOY A;  3AEE B;  2D07 B;  1L0Y B;  3BVG A;  3A33 B;  3VXW A;  4DHJ D;  1UBQ A;  2I1J A;  1JML A;  4K3B A;  3PGE A;  5J2R A;  1U4A A;  1FM0 D;  2KDF B;  3PZD A;  3AE7 B;  4HRS A;  4REZ A;  3IHP C;  2QSD A;  1E9M A;  3ML8 A;  3Q6B A;  1WJU A;  3MC8 A;  4IC7 B;  4N9F 4;  1KLG D;  1SIF A;  3HUI A;  1V5O A;  2BKF A;  2XNA C;  4OZB A;  4DXA B;  2D3C A;  2IGH A;  2INN E;  4HWI B;  2PIA A;  2ZEQ A;  1YMH E;  1ZDV A;  4C4V B;  3VTU A;  4IM3 A;  1D5X C;  5H92 C;  2GBM A;  3KYD D;  1VDV A;  1WM2 A;  4KDI C;  4ARC A;  5G2N A;  2JZZ A;  1F77 A;  1XXG A;  3VRB B;  2IGD A;  3N1Y C;  2FUH B;  4KGR A;  1FEH A;  4WQM A;  2JVC A;  2CU3 A;  3AI5 A;  3RMK C;  3TEY A;  5DPR A;  4G3X B;  1GPX A;  3K9O B;  2DWQ A;  1FMA D;  1I4P A;  1V8C A;  3RUL A;  2VRR B;  2O6V D;  1MVK A;  5CTR C;  4MGK E;  3PLU A;  2L76 A;  3GS2 A;  4HK2 A;  5BMG A;  3HK0 A;  1TS2 A;  3RPF C;  1YQB A;  2YEP F;  5BYR A;  2PKO A;  1IPG A;  2FID A;  2PW9 A;  3H8H A;  4B95 A;  2B3A A;  4PS3 A;  1E7V A;  3PTF C;  1OTR B;  1TKE A;  2RMM A;  5BMI A;  3JSV A;  4AOF A;  3GE3 C;  4DBG A;  3ZKJ C;  3LYY A;  3ZVV A;  2CJO A;  4TMA B;  3RNB C;  5FR6 A;  2D2Q A;  1QF6 A;  2G45 B;  3L08 A;  4GGQ A;  4W9F A;  2JRH A;  1VRA B;  4EZL A;  2K1F A;  3FKY A;  3P4R B;  4C56 C;  2IO1 B;  1ET6 A;  1KM7 A;  3P4Q B;  1T6B X;  2LHD A;  2K25 A;  3OJ3 A;  1MHH E;  5CHF A;  3VUW A;  4NNJ B;  3ZTD A;  2DZM A;  3W1S C;  4W9L A;  2N7D A;  4RGM A;  2WXI A;  2NTS A;  2N9K A;  3U30 A;  5HI1 A;  3OJ4 B;  1A70 A;  2L8J A;  1FRR A;  1GAQ B;  2BWF A;  3Q3O C;  2LGD A;  1M4V A;  3EFU A;  4F1S A;  4C80 A;  1WX8 A;  2RPV A;  1J7C A;  3APD A;  3SD5 A;  2LJI A;  2LGY A;  4JX1 C;  1H8C A;  3BVM A;  1UWX A;  2MBO A;  3FIL A;  4N58 A;  3DWG C;  4KKJ A;  3PPA A;  1G6J A;  4AS1 A;  3IVF A;  2M0X A;  1GUA B;  2ACZ B;  1TS3 A;  5G5H A;  1SE9 A;  5E6O A;  1VCB A;  2LHE A;  4ICU A;  4BKS D;  3DBH B;  1P0R A;  2PMV A;  1OEY J;  3VAW A;  4AP4 C;  2KLC A;  4IDI A;  4B9K A;  5J17 A;  2JSV X;  2BYT A;  2M56 B;  1T3Q A;  3TCA A;  2MEK A;  1OEY A;  2BQQ A;  3CF6 E;  3X23 A;  4MH0 E;  5LXH A;  2JRI B;  3NJT A;  3T3N A;  1TIF A;  3BY4 B;  2INP E;  4GSW A;  2KAJ A;  5AUK A;  4KZ0 A;  4WWO A;  2WXQ A;  3EHV A;  2J0J A;  3NZU A;  4MGI E;  4OVV A;  1D5M C;  1KJT A;  3BK1 A;  2WXJ A;  2KN4 A;  2AWT A;  3H7P B;  1E6E B;  1I4Q A;  3R7Q A;  3MHZ A;  2LFI A;  2ZCB A;  3R2T A;  1LXD A;  3RNA C;  3UQA A;  4TKN A;  1BML C;  3NVZ A;  3Q8B A;  4HJK A;  4PT5 A;  1WXM A;  1WMH A;  2GLS A;  3AED B;  1ISN A;  1I4X A;  1V81 A;  4WWN A;  1ENF A;  1SB3 C;  3NOB A;  2MBB B;  1YOV B;  3IBE A;  2KWC A;  3GP7 A;  2FCQ A;  3U52 E;  2LD9 A;  2XEW A;  2KTF A;  3Q3F A;  3W1S A;  4S0R A;  4PYZ A;  3H6N A;  1QT9 A;  1N62 A;  2M1M A;  5IP4 D;  4II3 B;  3LJ3 A;  4JWU C;  2BVC A;  2Z0D B;  2D5G A;  4A90 A;  1SJH D;  1JRU A;  3N32 A;  4AJW A;  1WM3 A;  3ZUN A;  1WXV A;  4HDO A;  1N5W A;  3RUI B;  1LO5 D;  1PGX A;  1V1O A;  1V97 A;  4ANV A;  1V1P A;  2B76 B;  2G4D B;  3D32 A;  4ARI A;  5TR5 A;  3DHH C;  1K8R B;  5BYS A;  2JUO A;  1DOX A;  2KO3 A;  2BPS A;  1GNU A;  3L10 B;  5AUI A;  1WWT A;  3GB1 A;  3RFZ B;  3AB5 A;  5C3J B;  4OVU A;  1JRO A;  4G50 A;  1PDX A;  1MG8 A;  3MJ5 A; 
#chains in the Genus database with same CATH homology
 4KGT A;  4XDC A;  2J42 A;  2DYM A;  2X38 A;  3AE9 B;  3AE6 B;  3SEB A;  1KFY B;  4YSZ B;  1YNT E;  3W5V B;  4JE3 B;  4KX6 B;  1PUT A;  1R7S A;  1QOA A;  1MI0 A;  1XCQ L;  4YWG G;  1JWU D;  3SR6 A;  1FD6 A;  1JQ4 A;  2V3N A;  1K52 A;  1DOI A;  2WXG A;  2KAC A;  5EE1 A;  1FNU A;  2J53 A;  4RGN A;  4YTN B;  2AQ1 B;  1F0Z A;  2WXR A;  2JZP A;  2L52 A;  2JX5 A;  2WXM A;  3MFG A;  1QKZ A;  2WNM A;  3LB8 C;  1J7A A;  2ICI A;  3U2S C;  1ZOY B;  1ZXH A;  3IT6 B;  3TUO A;  1JAL A;  1VR9 A;  4XWT A;  3AE8 B;  2Y5P A;  1EM7 A;  3AEG B;  4ZYS A;  2VZK D;  1TKY A;  3AEF B;  1QOG A;  1QQR A;  2DBY A;  3ZQ4 A;  1YJJ A;  1ET9 A;  3VRA B;  2KMM A;  3I57 A;  3KWL A;  1ZP0 B;  3TEX A;  1N61 A;  2QIL A;  1FFV A;  2WU5 B;  3Q8F A;  2H88 B;  3HVD A;  1IBX A;  3SFE B;  2JWU A;  2LUM A;  2NTT A;  2K3U A;  2Y3A A;  1JCK B;  4DXG A;  3IAS 1;  4XWW A;  2EEL A;  4RF0 A;  1K50 A;  1TS4 A;  1MPE A;  2AQ2 B;  3VR9 B;  1RM6 C;  2QIE B;  1L0V B;  3ZYY X;  2V3P A;  1IBX B;  1N60 A;  1WGK A;  3BWU D;  4HEA 1;  4N6E B;  1PFD A;  4YT0 B;  2DYO A;  5H8Y E;  2ON8 A;  4M0W A;  3CWI A;  4LK0 M;  2LEK A;  4ZHP A;  3W2D A;  4MAC A;  1XLP A;  1JRP A;  3C8Y A;  2RDH A;  1TZO A;  1KRH A;  1FCC C;  2W3S A;  1J7B A;  1P7F A;  1L0X B;  1XEE A;  3UI3 A;  1GOZ A;  3BVZ A;  2BTE A;  1B9R A;  2WXL A;  3CIR B;  5EE9 A;  2JYE A;  4TQ0 A;  2IPK D;  1WSP A;  1NVI D;  3NZ3 A;  3OWE B;  5HG2 A;  2XN9 C;  2KDM A;  1AWD A;  2WP9 B;  2ZW1 A;  2QJL A;  3FC4 A;  3R2I A;  4LLG M;  1ZXI A;  4RF1 A;  1C9F A;  1Q10 A;  3EUB 2;  1XF5 L;  2WXH A;  3P63 A;  2BB6 A;  4A8X C;  1HZ5 A;  1L4D B;  3HRD D;  1C78 A;  4GLS C;  1L5P A;  4L23 A;  3KWV A;  2WXO A;  2TSS A;  5C2T B;  3V3X A;  4A6Q A;  4RNA A;  3O13 A;  4DXF A;  4EE2 A;  2PVO D;  2PVG C;  1ZE3 D;  3AE2 B;  1JWS D;  1FXA A;  1K53 A;  1YN5 A;  2E3T A;  4P6V F;  3Q8A A;  1DOY A;  5HFY A;  1WRI A;  3AEE B;  1L0Y B;  3TEW A;  3BVG A;  3BZD B;  2IDY A;  2BBC A;  3TSS A;  2JXT A;  4HKQ A;  4MT5 A;  2SAK A;  1JML A;  3P4S B;  2FBW B;  4OW0 A;  2I38 A;  5TSS A;  4RCO A;  3Q69 A;  4Q2J A;  1UGJ A;  3J9C A;  1FM0 D;  1YN4 A;  5MPO A;  1E10 A;  3AE7 B;  1BUI C;  1V1P B;  4HRS A;  4REZ A;  2L32 A;  2E6X A;  2QSD A;  1E9M A;  5FR3 A;  1CK1 A;  5I4D A;  1SEB D;  1NEN B;  3AE4 B;  3T3O A;  3ETR A;  1KLG D;  1ROE A;  3HUI A;  2GB1 A;  2JU6 X;  1SF0 A;  2V0G A;  2XNA C;  1TY0 A;  1ZPS A;  1HZ6 A;  3MC0 B;  4OZB A;  2IGH A;  2W55 A;  2INN E;  1D6E C;  2KWD A;  2L83 A;  2PIA A;  4ZHO A;  1ACC A;  1IUE A;  1YMH E;  1ZDV A;  4DQO C;  1C76 A;  1D5X C;  4TSS A;  1NYR A;  4FXC A;  2QEJ C;  4MH8 A;  5H92 C;  5HHD G;  1KF6 B;  3B9J A;  3URY A;  1BXT A;  2MJE A;  2KQ4 X;  4OVZ A;  1VDV A;  4WWM A;  4ARC A;  3P1M A;  4OHJ A;  1F77 A;  1XXG A;  3VRB B;  2IGD A;  4A9A A;  4KGR A;  1FEH A;  4WQM A;  3EGR A;  2WDV B;  4YTP B;  2CU3 A;  1OQR A;  3TEY A;  1HA5 A;  3U7Z A;  1GPX A;  2DWQ A;  2RDG A;  1FMA D;  1FNW A;  2WXK A;  1I4P A;  4ZRQ A;  1V8C A;  4ZRP A;  1RWS A;  1MVK A;  5EE3 A;  1GB1 A;  1FCL A;  4RFB A;  4IKG A;  3L4P A;  1DGJ A;  4KGS A;  4R3D A;  1AYF A;  3GS2 A;  5D3I B;  5BMG A;  1C77 A;  4WUR A;  1I4H A;  5BYQ A;  1TS2 A;  3RPF C;  4C7Y A;  2YEP F;  2K5P A;  5BYR A;  2PKO A;  1VZ6 A;  1ZDX A;  1QLB B;  1D5Z C;  2PW9 A;  2WQY B;  3BYT B;  3H8H A;  3NVY A;  1QOF A;  3PZ7 A;  3DWM A;  1YQ3 B;  3AE5 B;  1TYG B;  4HJG E;  1YN3 A;  1AN8 A;  1TKG A;  1SE3 A;  2BT6 A;  2AQ3 B;  1YQ4 B;  3NUH B;  2K22 A;  4RGO S;  1TKE A;  2RMM A;  5BMI A;  3FAH A;  4TQ1 A;  2BS3 B;  3AM9 A;  3BK2 A;  2BW2 A;  4H2A A;  2WXF A;  2JYT A;  1C4P A;  3LYY A;  2WS3 B;  2CJO A;  1SSN A;  4TMA B;  3KQ4 A;  1EWC A;  2G9H D;  1K51 A;  3BII D;  1MHX A;  1Y56 A;  1QF6 A;  1L4Z B;  1L6U A;  5LNK 1;  4O1N A;  3ZJV A;  1CZP A;  3AE3 B;  1WYG A;  1PGA A;  2MJD A;  4MM3 B;  1VRA B;  2BB5 A;  3PZ8 A;  2L1A A;  1XLQ A;  3P4P B;  2J4X A;  1KTK A;  3P4R B;  4C56 C;  3R8B A;  1HXY D;  1XO3 A;  1ET6 A;  3PO0 A;  3P4Q B;  1T6B X;  1RFK A;  2LHD A;  4US9 A;  4HRO A;  4XE0 A;  1MHH E;  3U4E G;  2NMQ A;  1HQR D;  1I4R A;  1SIJ A;  2FE8 A;  4US8 A;  1VJK A;  3NS1 A;  5GXG B;  2FUG 1;  2Q5W D;  1STE A;  1SXT A;  4RGM A;  2WXI A;  3TEZ A;  1FRD A;  1KH0 A;  1UNS A;  1IGD A;  2ZW0 A;  2NTS A;  2N9K A;  5HI1 A;  1PGB A;  1A70 A;  5BMH A;  4B0E A;  1B1Z A;  1FRR A;  1UWM A;  1GAQ B;  5G5G A;  3IXS A;  1M4V A;  4C80 A;  2WDQ B;  1TJE A;  3B2G A;  2RPV A;  1CJE A;  1J7C A;  1KLU D;  1L6V A;  3NVW A;  2WU2 B;  4HKZ E;  2SEB D;  3Q8E A;  2LJI A;  2Y5C A;  4JX1 C;  4YSY B;  3BVM A;  1UWX A;  4L1B A;  1PYW D;  1XLO A;  3ZJT A;  1JWA D;  1RYJ A;  3FIL A;  4N58 A;  1IGC A;  2QMT A;  1UUP A;  3DWG C;  3HVZ A;  2VZK B;  4KKJ A;  2R61 A;  4AS1 A;  2ACZ B;  3AH7 A;  1TS3 A;  4ZOH C;  5G5H A;  1HEZ E;  2WDR B;  3LXF A;  1SE4 A;  1I4G A;  4A55 A;  4D2K A;  2IGG A;  3FIL B;  3NRZ A;  2LHE A;  2PLP A;  4WIP A;  1TS5 A;  2BS2 B;  2DLB A;  2Z8L A;  2PMV A;  4XDD A;  1NEK B;  5E6J A;  4KKI A;  2M0A A;  2V4I B;  4IDI A;  1JWB D;  2JSV X;  1T5X D;  4OZA A;  3MP9 A;  1FXI A;  4NZL B;  2EKI A;  1F2R C;  2BYT A;  2M56 B;  2I2Y A;  3MJ5 A;  2BS4 B;  5JXV A;  2LMC A;  3V05 A;  1DYQ A;  1T3Q A;  3W5U B;  4YSX B;  2MEK A;  3BYY B;  4LTU A;  1SE2 A;  3AEA B;  2JQR B;  1TY2 A;  3Q8C A;  1P7E A;  3AEC B;  3VR8 B;  5T8I A;  3T3N A;  1VLB A;  2INP E;  1D4B A;  2CJN A;  2KAJ A;  1JW9 D;  5AUK A;  5D3D A;  1AW7 A;  3NVV A;  2WXQ A;  1N5X A;  1VZ8 A;  4CQN A;  1D5M C;  5FKA C;  1N63 A;  3BK1 A;  2WXJ A;  2W54 A;  2HDE A;  2KN4 A;  4YTM B;  3IT4 B;  2H89 B;  4OZC A;  3AMZ A;  3N9Y C;  4NAM A;  1E7P B;  1C79 A;  4C7Z A;  1E6E B;  1I4Q A;  2N7J A;  4L2Y A;  2MJ3 A;  1I7H A;  3MHZ A;  2LFI A;  3I9V 1;  3R2T A;  3ZGZ A;  2WLB A;  1BML C;  3NVZ A;  3ABV B;  3AV8 A;  3Q8B A;  4RH6 A;  4PT5 A;  1QIL A;  4IOI E;  3AED B;  4ITK A;  1I4X A;  1YJI A;  3P42 A;  1EU3 A;  2N9L A;  1JWM D;  1ENF A;  1SB3 C;  1EWY C;  3AE1 B;  4YXD B;  2G1E A;  3EA6 A;  2WXN A;  3GP7 A;  1ZUD 2;  2N0S B;  1NYQ A;  2HTM E;  3U52 E;  4JWS C;  3E9S A;  4GDK B;  3W1S A;  2AX5 A;  2ONQ A;  1F2R I;  2MH7 A;  1FNV A;  2IJ0 A;  4WH4 A;  1QT9 A;  3W9C B;  1OFF A;  1N62 A;  5FK9 C;  1NI3 A;  1WXQ A;  1SBB B;  2YEP B;  4NAW B;  4WAF A;  1OQQ A;  4JWU C;  4N59 A;  2PTL A;  1QOB A;  4USA A;  2D5G A;  4A90 A;  1SJH D;  2J52 A;  1E0Z A;  2K0P A;  4J3O D;  3ZJU A;  3B2F A;  2W82 A;  4JPS A;  4AQ7 A;  1N5W A;  1XLN A;  4UDU C;  4P16 A;  1LO5 D;  2OHF A;  4B0M A;  2OED A;  4GDL B;  3AEB B;  3AN1 A;  3WCQ A;  1GB4 A;  2WXP A;  1PGX A;  1V1O A;  2W3R A;  1V97 A;  1V1P A;  1FFU A;  2B76 B;  2GI9 A;  1SJE D;  3SFD B;  1VZ7 A;  4ARI A;  3KLS X;  2LGI A;  1XCT L;  2GRI A;  5EE0 A;  5BYS A;  1C4C A;  1FO4 A;  1DOX A;  1EU4 A;  1FIQ A;  2M19 A;  3VQI A;  2K9X A;  5AUI A;  4RGT A;  1WWT A;  3GB1 A;  3RFZ B;  3E56 A;  1ESF A;  1C4A A;  3AB5 A;  3IAM 1;  5C3J B;  1JRO A;  1PDX A;  4NJC A;  1CQV A;  5D7G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...