1SE9A

Structure of at3g01050, a ubiquitin-fold protein from arabidopsis thaliana
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
101
structure length
101
Chain Sequence
EAEVHNQLEIKFRLTDGSDIGPKAFPDATTVSALKETVISEWPREKENGPKTVKEVKLISAGKVLENSKTVKDYRSPVSNLAGAVTTMHVIIQAPVTEKEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ubiquitin family
publication title Cell-free protein production and labeling protocol for NMR-based structural proteomics.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Plant protein
total genus 21
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2004-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13881 Rad60-SLD_2 Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1se9A00
4EZJA 2MP2B 2KD0A 4LJOB 5BO4B 4ZDVA 2BKRB 4HK2A 4NAWB 5LLIA 1WXAA 2HTHA 4HDQA 3L0WB 2KDIA 2KO3A 4G3XB 5CX3A 3ZDTA 4W9FA 2C7HA 2V1YA 1IP9A 1WH3A 3VUXA 2KDFB 2CU1A 4OVUA 3TJPA 3L08A 4W9KA 1GJZA 4G50A 1X1MA 1E8WA 3B0AA 3VTVA 1OEYJ 2VRRB 3APCA 3PZDA 4II3B 2QHOA 4FLHA 2ZPNA 2B3AA 3ZRCA 2ZCBA 4EUTA 4FA6A 4NY0A 2PJHA 1KOTA 3NZUA 3B08A 3VFKA 3VHTC 3QIJA 3VUYA 1KM7A 3VH3B 4BBNF 5DPWA 2IO2B 2O6VD 2MBOA 1LM8B 3PRPB 5AZHA 4CYEA 3UQAA 2KOXA 3MJWA 4F7ZA 2FIFA 2M8SA 3PGEA 4W9JA 4IG7B 2NBUA 4W9DA 3ZUNA 1OQYA 2FIDA 2KQ7A 2R2QA 4YL8A 2CHWA 2NPTB 2BYFA 2FCQA 2KNBA 1KLVA 3WAPA 1BT0A 2FCSA 2WX0A 2MCNB 4A20A 4TV3A 1WMHB 1RRBA 2UYZB 2YVCA 2KFKA 2LD9A 3GOEA 2KKCA 5JHAA 2IBIB 1YJ1A 2MX2A 2C7NB 2LGDA 2O6VB 1WJUA 3KUCB 2KDEB 4ZRIA 1RLFA 4II2B 1AARA 2LI5A 4W9CA 4TQ0A 3RUIB 4J6IA 3PPAA 4FN2A 3R7RA 2FAZA 3WA0A 2D07B 3DBSA 4B9KA 3RZWC 4K7UA 1LFDA 2DYOA 5JH5C 2KJ6A 5LXHA 1WZ0A 4MGZE 1P9DU 1LXDA 4AJWA 1WYWB 2KLGA 3S2AA 2EMTA 2PE6B 2AL3A 4E3CA 3ZNID 3RCZA 3PHWB 3PHXB 4BKGA 2BYVE 1S3SG 2YLMA 4A3OA 1WXSA 2OOBB 4WJQA 4M0WB 1K8RB 2CHXA 3DDCB 3QC8B 2KTRB 4MELA 4MDKE 3HK0A 2CS4A 2GBKA 3DVGX 2JZZA 2ZPYA 3PVLA 2LVOA 1D3ZA 2K8HA 4KSKC 1WGHA 4GXBA 2HJ8A 1WX7A 3A1QB 4GGQA 1FXTB 4HPMB 4NJ7A 2V4LA 4ICUA 4DDGD 1C3TA 3LJ3A 3DQVA 4DHZE 2JZ3B 5IA7A 2J0KA 4IC7B 1V80A 1E8ZA 5E6NA 3RYTA 2KMCA 2MBBB 4GDKB 1Q5WB 1OTRB 1NBFC 2M1MA 2MA9B 3CF6E 3VH4B 1H4RA 2L76A 3L16A 2W9NA 4DHZB 3ZO5B 3PV1A 4PS8A 5D6JB 3APDA 3QQ8B 4BOZB 4HVBA 1A5RA 4ASWC 2D2QA 3MHSD 4AUQC 3IFWB 3KYCD 3KVFB 2BWFA 1TGZB 2ZZPB 4FULA 3ZKJC 2L0FA 3NZSA 1U4AA 4BFRA 2JXXA 2C7MB 4N9F4 3ONSA 1UD7A 2KN5A 3ZNGC 3ZRFA 2DZJA 3NS8A 3PREA 3QAQA 2JPHA 2FCNA 2DAFA 3EECA 4G11A 3V6EB 4ANXA 4WJNA 3MTNB 1SE9A 2BKFA 1ZGUB 2FNJB 4DWFA 1NDDA 4MH0E 3H7PB 5TR5A 1JRUA 1WX8A 2WDTB 3H6NA 3L10B 2JY6A 4MJSA 1HE8A 1WX9A 2KDBA 2M17A 3VTUA 1Q0WB 2N9XA 4I6PA 2DYMA 3ZW3A 1P3QU 4XC2A 3R3MA 2IO0B 1ZW7A 3KYDD 4XZ4A 3ZTDA 4BKSD 1WXMA 1WJ6A 3KW5B 2K39A 4TKNA 2WYQA 2RD0A 3UQBA 1P0RA 2O2VA 5E6PA 4EEWA 1QZEA 3UF8A 2M0XA 4BVUC 1XQQA 3PLVA 4JQWC 1WM3A 1MG8A 4KV2A 5KHQA 1IPGA 2JRHA 4HCNB 3SDLC 3TCAA 1ZKHA 1RAXA 1VD2A 4GN1A 4K7WA 2CHZA 3A9KB 3QK0A 4HCPB 3V6CB 3CSTA 2GBRA 3JSVB 4WWNA 1TTNA 2XK5A 1KJTA 2IO3B 2KQSA 3QARA 4HJKA 5JZEB 3EFUA 4K1RB 1I35A 3N30A 2N7EA 3EC8A 1WE7A 2D10A 4ANVA 3Q3JA 5L95C 2ZJDA 3WANA 5G2NA 3AI5A 3DBLI 3PT2B 4MGIE 5CTRC 3ZVVA 1EUVB 4BKTA 1EO6A 4KZCA 4F1SA 4KZ0A 3ZLZA 2J0MA 1V49A 4GDKA 3HIZA 4HLEA 2L8JA 5DPTA 3Q3FA 4IUMB 3M95A 4NAWA 2Y5BB 2JF5A 4W9LA 4ZRJA 1P1AA 2CKHB 4FHKA 2IY1B 4WWOA 2AWTA 4IW0A 3VVWB 2ZVOA 2PE9A 3CSFA 3B1LX 3PS6A 3U8ZA 3PTFC 4B95A 3TL5A 1GNUA 4PYZA 4DK5A 2V3SA 3ENEA 1E8XA 1WR1A 4GB9A 3M62B 2KX3A 5JHBA 3ZNHB 2MBEA 2KTFA 2L0TA 1WZ3A 2L3ZA 1LQBA 5KHOA 4AP4C 4DBGA 2G4SA 1VCBA 1YQBA 1V86A 3C0RB 4GSWA 4KIKB 4ANWA 2CR5A 4WQOB 3AXCA 2A4ZA 4HWIB 2BWES 3T8MA 2LZ6A 4FJYA 4IM2A 2LXCA 1PQSA 1WE6A 2JRIB 4NPNA 4RM8A 2DZIA 2J7QB 3PLUA 2JWZA 3PSEB 4GDLB 4GIVA 4I6NB 4FADA 3QWZB 3A9JB 3ECIA 2NPTA 4G0NB 4GMVA 2Z0EB 3UIPB 5J18A 2FCMA 2KANA 5DPSA 4WWPA 3VDZA 1L7YA 3SD5A 2GBMA 2A5UA 1R4NI 2LASA 2NR2A 2L00B 2O6VA 2KFJA 3VQIA 2KVRA 1GC6A 1WGDA 4I6LB 3ZTCA 1WFYA 4M8NA 2LXAA 4EZKA 1E90A 3QJZA 1E8YA 1YX5B 3OAWA 2ZEQA 4DXAB 3UINB 1E5WA 3IBEA 4K7SA 2KMAA 4W9HA 3K9OB 2GBNA 5D7GA 2XEWA 3NHEB 4JGHB 5CHVC 3W1SA 1UELA 3ML9A 5E6OA 5G55A 4MGKE 3U30A 1Z5SB 3SHQA 3H7SA 5J17A 2RGFA 2NBWB 3V61A 2LVQA 2KTRA 4HPLB 1WXVA 4KSLC 3N3KB 2L7RA 2MWSB 3L13A 1J8CA 2IYDB 2MBHA 3O65B 3QX1A 2G3QB 1OGWA 2KWCA 1M94A 1P98A 3DVGY 3L17A 1NI2A 2BYEA 3QA8A 3A1QA 2UWQA 2L05A 3D32A 2EKEC 2IY0B 3DBRI 1WJ4A 4MSQB 3RZFA 1GUAB 2REXA 3WAMA 2RPQA 4K81A 2K8BA 4W9IA 4PS3A 3X23A 3ALBA 4BOSC 5DCNA 4AJYB 5HKHA 4GOCA 4MM3A 4W9EA 2LRUA 3JVZX 4WAAA 2MBQA 5FR6A 2KC1A 1J19A 1WR6E 3DCGA 1S1QB 4PS7A 2ZNVC 3R7QA 2LGXA 4XX5A 3BY4B 3UIOB 1WF9A 2BGFA 3BINA 5D2MB 1IYFA 2Z0DB 4FBJB 4M8MA 2DZMA 2K8CA 2LRWA 3RD2A 3P2BA 2ZVNA 3IG3A 5L83A 3NOBA 1SIFA 2AEHA 3N32A 2D3GA 4MEMA 3UGBB 2N4FA 1TBEA 3H7PA 4IWQA 2NCNA 2LUEA 2NS5A 2N1VA 4JLCA 2KWUB 3KUDB 3OJ3A 3DVNV 4WJOA 3T9LA 3ZIMA 4NQLB 3X0WA 4B6WA 4X57B 3IVFA 3V62A 1L2NA 4EOYA 1YIWA 2MP2A 2N1WA 1WGGA 2KXJA 1C1YB 2JT4B 1Z2MA 2KFKB 3DBHI 4PYUA 5AZGA 1ISNA 1EF1A 3AULA 4ICVA 5IAAC 5LXIB 2BPSA 3U7DA 3M3JA 4E71A 4DDID 4URKA 3CMMB 2KZRA 3OLMD 2JVCA 2M4NA 2FUHB 1V5TA 2N9EB 3A9KA 2RR9A 4LDTD 5AZFA 4TUUA 2J0JA 4EKUA 5AEKB 2C5LC 3JSVA 2IZVB 3TBLD 3DVNU 4CHKA 2D11A 4TQ1A 1GG3A 4NJ6A 1WI0A 4NNJB 4BKSA 5C23A 3AU5A 2MW5A 5CHWA 2ASQA 4P7IA 1Q1OA 2DAJA 2DX5B 3KH0A 3RT3B 3EHVA 1SGHA 1UGMA 1Y8RC 4IWPA 3JW0X 2HD5B 2K6DB 3NY5A 4MSMB 4LJPB 4GU2A 2DYBA 4JIOU 1V5OA 4HXDA 4LDTB 5DPRA 4MGYE 2IO1B 1WRDB 3L54A 3VUWA 3ZDMC 2R2OA 1F9JA 3AU4A 3OJ4B 3VTWA 3DOWA 3H9DA 4LCDE 3HM6X 2K25A 1WJNA 1V2YA 2PEAA 2Z59B 4NQKE 2PPHA 3R66C 5EDSA 1T0YA 1WMHA 4RMAA 1E7VA 4OVVA 3GZNI 1V6EA 2G4DB 4IM0A 3PRMB 4A3PA 3I3TB 4IWOA 1UZXB 4RM9A 3TIXA 2MQJA 4FJZA 2I1JA 3V60A 3ZNZB 1J0GA 2KJHB 1GC7A 4BBNC 5D94A 2AYOB 2KC2A 1RFAA 1WGRA 2LVPA 2EMSA 2ZNVB 4KIKA 2DZKA 4W9GA 3VAWA 3WIMA 2N7DA 3H1UA 2C60A 5C1ZA 3KUZA 2LGYA 3W1YA 2MSED 2N9PC 3QHTA 1V9JA 3A4SC 4DHJD 4FHJA 1OEYA 3M63B 2K6QA 4GDLA 3IHPC 3A9JA 3ML8A 2KWVB 4AOFA 4CO7A 1H8CA 3TMPB 2NBVB 2DHZA 1UH6A 1E7UA 1V81A 4ANUA 4MJSB 3VXWA 2K1FA 4KDLB 1XT9B 4KDIC 3HM3A 1WGYA 1WIAA 2LWPA 4DHJB 2NVUI 4KVGB 3K9PB 1WM2A 4EZLA 4E74A 2O2VB 3JYUA 2WWZA 2OJRA 2MLBA 1EF5A 2GOWA 2MRPA 1WY8A 4AWJA 4ZRKA 1XD3B 3WALA 2KLCA 2XBBC 2JUOA 3LDZE 3PRZA 1CMXB 2DENB 3APFA 4EFOA 2AL6A 2WX1A 3SU8X 3A33B 4HDOA 2GBJA 2KJRA 2HE7A 2XK5B 5CHFA 2C9WB 2G45B 3RULA 4F8CB 1R4MI 4IM3A 3W1SC 3DPDA 2I1KA 4FJVB 2KHWB 3A4RA 5GMVA 3WAOA 2KX0A 4JL9A 1TZ1A 5J2RA 2BF8B 2LJ5A 4WJPA 2ZCCA 1UBQA 2RSUA 1UBIA 1YX6B 3QCAA 1I42A 4ZYNA 2KK8A 1G6JA 1YD8U 2GMIC 3HHMA
chains in the Genus database with same CATH superfamily
4EZJA 4ZDVA 5BO4B 1ET6A 3E56A 2QIEB 4C7ZA 1IP9A 2KYWA 1WH3A 2KDFB 2D3CA 3CWIA 2CU1A 2V0GA 2N9LA 1SJHD 1X1MA 2J4XA 4G50A 1ZDXA 2WP9B 3B0AA 5G5GA 1ROEA 3T3OA 4B0MA 4PT5A 2PJHA 3GE8C 1E9MA 3VHTC 1HA5A 1KM7A 1MHHE 4CYEA 4F7ZA 2M8SA 3PGEA 4GLSC 4YWGG 3OWEB 4YL8A 2ON8A 2CHWA 2NPTB 5C2TB 5EE9A 3WAPA 1B9RA 1PYWD 4HKZE 1JWUD 4WQMA 2UYZB 3W9CB 5H8YE 3MP9A 2LGDA 1E6EB 4W9CA 2E6XA 1EM7A 3PPAA 2FAZA 3BWUD 3WA0A 2D07B 3DBSA 1FNUA 1PFDA 3FILA 5JH5C 1T6BX 4MGZE 2VH2A 1LXDA 4FXCA 3VR8B 2EMTA 2PE6B 1C77A 2WXOA 3PHXB 3PHWB 1WYGA 4RCOA 2OOBB 4HPPA 2CHXA 3DDCB 3HK0A 2PVOD 3R2TA 1C4CA 2GBKA 2JZZA 4KSKC 1WGHA 3CIRB 4GXBA 1WX7A 4HPMB 1K53A 3HVDA 4RH6A 3Q69A 4DHZE 5IA7A 2EKIA 2J0KA 4IC7B 1KLGD 1E8ZA 4K3CA 4MM3B 3RYTA 4E3CA 1Q5WB 1OTRB 2MA9B 1N60A 4DHZB 1XLOA 1UWMA 2LFIA 1EWCA 2QMTA 3AE3B 4AUQC 2QILA 3KYCD 1TGZB 2ZZPB 4FULA 4LNOA 1U4AA 2WXHA 1V1PA 1GOZA 2KDMA 3NS8A 3QAQA 3TSSA 2DAFA 1ZGUB 1WX8A 1D5XC 1HE8A 2M17A 1P3QU 3R3MA 2IO0B 1VZ8A 3KYDD 4XZ4A 3ZTDA 1WJ6A 3UQBA 1P0RA 1RM6C 2SEBD 3HUIA 4EEWA 2B76B 2M0XA 5HHDG 4KV2A 5KHQA 4HCNB 2PLPA 2W55A 4GN1A 2CHZA 4HCPB 3QK0A 1QOFA 2BS3B 2IDYA 2KQSA 2OEDA 3QARA 3EC8A 1AYFA 2RDBC 4ANVA 1KF6B 5G2NA 3AI5A 4C56C 4MGIE 5CTRC 1EUVB 4KZCA 4GDKA 1AW7A 2L8JA 2J53A 1VRAB 2IY1B 3CSFA 3PS6A 3U8ZA 2BB6A 3PTFC 1MG4A 3ENEA 4RGNA 5D3DA 3M62B 2KX3A 5JHBA 2MBEA 1DOIA 2AQ2B 5KHOA 2G4SA 1V86A 4ANWA 1OQRA 1CQVA 4HWIB 1ZE3D 2M19A 4FJYA 1PQSA 2JWZA 3IAS1 3QWZB 2IPKD 2IJ0A 2NPTA 4WWPA 3NS1A 4OVZA 2NR2A 2K3UA 2H88B 2W54A 2KVRA 4I6LB 3AEBB 4NJCA 3Q2AC 3QJZA 4DXAB 3AE4B 1WSPA 3SFEB 4MH8A 1KFYB 4M00A 3ML9A 5E6OA 4MGKE 1Z5SB 3H7SA 5J17A 4HPLB 1QILA 1F1HA 4KSLC 2WQYB 3L13A 2G3QB 1WGKA 3L17A 3DVGY 1C9FA 1NI2A 1EU3A 2BYEA 2L05A 1ZXIA 1YMHE 2IY0B 3KWLA 4XDCA 4W9IA 4K81A 4REZA 5DCNA 3MC0B 4MM3A 2LRUA 2ZNVC 3ZYYX 3UIOB 1TS5A 3AEAB 1XLPA 3FC4A 1GB4A 2MJEA 1QOGA 4XYCA 1FFVA 2LUEA 1TY2A 3DVNV 3ZIMA 3Q14C 2V3NA 3AE7B 4X57B 2ZW1A 3IVFA 5JXVA 2AX5A 4LK0M 2IGHA 2JT4B 1Z2MA 4PYUA 2Y5PA 5IAAC 1NYQA 3SFDB 3AE1B 1NENB 2MJ3A 3NVVA 3DWGC 1MI0A 1C4AA 3DWMA 1MVKA 1V5TA 4LDTD 5HFYA 4NJ6A 4BKSA 1XEEA 5C23A 2DAJA 2DX5B 1SGHA 4IWPA 2WXKA 1XCQL 4LJPB 2QDFA 2GLSA 3V3XA 3L54A 1MHXA 2R2OA 1T0SC 1MPEA 3HM6X 4RF0A 2PEAA 2Z59B 4CQNA 1T0YA 2ICIA 1C79A 1V6EA 2G4DB 2LJIA 4IM0A 3PRMB 4A3PA 3I3TB 1NI3A 1XCTL 3IT6B 2G1EA 2I1JA 3V60A 2KJHB 2JU6X 3IXSA 2AYOB 3AV8A 1RFAA 2Y3AA 3WIMA 2N7DA 3N1YC 3W1YA 2MSED 3A4SC 3B2FA 2WXNA 4H2AA 2INDC 1OQQA 3ML8A 2L1AA 1H8CA 3RNCC 1V81A 3BYTB 5FKAC 4DXFA 2J52A 3HM3A 1WM2A 2O2VB 3Q8CA 2BYTA 2OJRA 1EF5A 2MRPA 1WY8A 1CMXB 1TS2A 4EFOA 4HDOA 2GBJA 2KJRA 2HE7A 2M0AA 2G45B 4ACFA 4F8CB 2KHWB 3A4RA 5GMVA 2KX0A 4HROA 2LJ5A 2BT6A 1ET9A 3QCAA 1I42A 3ZJTA 4KX6B 1G6JA 2MJDA 3C19A 5CHWA 3SR6A 3HHMA 2MP2B 4LJOB 2BKRB 2L52A 4HK2A 1JWMD 5CX3A 2KO3A 3AEGB 4G3XB 4HKQA 2VH1A 1L0YB 1XLNA 5HG2A 4XWTA 2WS3B 2V1YA 3VUXA 2SAKA 1TYGB 2VRRB 4DXGA 3PZDA 2QHOA 1TZOA 4C4VA 1E0ZA 1I4XA 2KVZA 4EUTA 3VFKA 3QIJA 2OJWA 2IO2B 2O6VD 1PDXA 3PRPB 3UQAA 2I38A 2PMVA 4W9DA 1R7SA 1JQ4A 2BQQA 4YSXB 1KLVA 2L32A 1FD6A 1WMHB 2LD9A 2RMMA 3GOEA 4L2YA 2KKCA 3RNBC 1YJ1A 1WJUA 2KDEB 4ZRIA 1RLFA 3LXFA 4TQ0A 1KTKA 3AE9B 4DQOC 4FN2A 3I57A 2NTSA 1GB1A 1LFDA 1P7EA 4JWUC 2KJ6A 2KLGA 5BYRA 1S3SG 2YLMA 1CK1A 4A3OA 1HZ6A 1K50A 2WU2B 3T3NA 2KTRB 1I4GA 1UGJA 2N7JA 4KGRA 2HJ8A 4GGQA 1FXTB 2V4LA 3LJ3A 3DQVA 2JZ3B 4AP4C 1NBFC 2M1MA 2WXRA 2L76A 3L16A 3PV1A 3APDA 3IFWB 2BWFA 3ZKJC 2L0FA 3H8HA 1DOYA 3ZRFA 3ZNGC 1TKGA 2CJOA 3V6EB 4WJNA 1SE9A 2BKFA 4MH0E 5TR5A 1JRUA 1NEKB 2DNFA 1WX9A 3VTUA 1DOXA 4P1BC 2PKOA 4US8A 1A70A 2I2YA 2BVCA 4LNIA 3I5JC 3KW5B 2K39A 2O2VA 3OG5A 4BVUC 3PLVA 2D5GA 1IPGA 2IGDA 2OHFA 3SDLC 1MFWA 1ZKHA 4US9A 1RAXA 4ZHOA 4K7WA 3A9KB 2IO3B 4HJKA 1IGDA 3EFUA 3N30A 2N7EA 2ZJDA 1RYJA 3PT2B 1EO6A 1CZPA 3HIZA 4HLEA 5DPTA 2WNMA 3M95A 2WLBA 1N61A 1P1AA 4B0EA 4YTPB 3LYYA 2PE9A 3B1LX 3TL5A 1GNUA 1FXAA 4BAXA 1E8XA 2TSSA 3P4RB 1WR1A 2K0PA 5AUIA 3BVZA 3P4QB 3ZNHB 3Q8AA 2L0TA 1WZ3A 2PIAA 4KIKB 4C00A 3AXCA 2AQ3B 1I7HA 4RM8A 2WXPA 2J7QB 3PLUA 4GIVA 1ZDVA 3A9JB 3ECIA 4ZRQA 2KANA 4YSZB 4IOIE 1YQ3B 4L23A 1R4NI 2LASA 3VQIA 4AS1A 1YN4A 3AM9A 1E90A 3W5VB 3DBRB 2ZEQA 3UINB 3IBEA 3K9OB 1IBXB 2GBNA 5D7GA 1V1OA 2XEWA 2HJ1A 2FBWB 3Q8FA 1WRIA 2XN9C 1UELA 5G55A 3U30A 3SHQA 4J3OD 5T8IA 1KLUD 2NBWB 2FE8A 2KTRA 3PZ8A 3N3KB 2L7RA 2KAJA 2IYDB 3O65B 2W82A 2PW9A 4RGMA 1OGWA 1M94A 1I4PA 1F2RC 3Q8BA 2UWQA 4JPSA 3RZFA 3WAMA 2RPQA 3RNEC 3IT4B 1XO3A 2ACZB 4W9EA 2R61A 2W3SA 2JXTA 5FR6A 1J19A 1QQRA 4PS7A 4LLGM 2LGXA 4YTNB 5AUKA 3AE6B 1WF9A 5D2MB 4O1NA 2LRWA 2K8CA 3RD2A 4UDUC 4ZRPA 3IG3A 3AMZA 3NOBA 3N32A 4MEMA 1FPYA 1FRRA 3KWVA 3RNGC 2MHJA 4IWQA 3UI3A 2NS5A 4JE3B 3KUDB 2CU3A 4NQLB 2WXQA 4M01A 4EOYA 2E3TA 2JZPA 5AZGA 2KWDA 1PGBA 1EF1A 3AULA 4ICVA 2FUG1 4URKA 4JX1C 2M4NA 2PTLA 4P16A 2N9EB 3A9KA 2RR9A 2KQ4X 2IZVB 3TBLD 1WI0A 1J7BA 3VRAB 2MW5A 1R4NB 3RT3B 1BMLC 3EHVA 2K6DB 3NY5A 4LNNA 4LDTB 2IO1B 1WRDB 1F9JA 3OJ4B 3VTWA 1WJNA 5EDSA 3ZJUA 1B1ZA 1SJED 4OVVA 1HEZE 3DHHC 3TIXA 4FJZA 1L4DB 1SIJA 4BBNC 5D94A 4KKJA 2ZNVB 2LVPA 1WGRA 4KIKA 2EMSA 3VAWA 2QC8A 4NAMA 4OZAA 2C60A 1AWDA 1D5ZC 3KUZA 1IGCA 2N9PC 2HDEA 4DHJD 4N6EB 4FHJA 3E9SA 4USAA 2K6QA 3A9JA 2MEKA 3GB1A 4K3BA 5EE3A 2DHZA 4ANUA 2QJLA 2WDRB 1I4QA 3P63A 2K1FA 3VXWA 2Y5CA 1VLBA 1JWAD 2JYTA 1N63A 1WGYA 2LGIA 3RFZB 1STEA 2WWZA 2MLBA 2GOWA 2D3AA 1IBXA 2AL6A 3A33B 1TY0A 3TEXA 5BYQA 1C78A 1R4MI 4IM3A 3W1SC 2WXFA 3MC9A 1F77A 2BF8B 4WJPA 2ZCCA 4WIPA 5G5HA 4TSSA 1UBQA 1FCCC 1UBIA 3ZJVA 4ZYNA 1SBBB 2KK8A 4ZHPA 2QEJC 3Q6BA 4WURA 2KD0A 4NAWB 5LLIA 1WXAA 2HTHA 2KDIA 3ZQ4A 2DWQA 4W9FA 2C7HA 3TJPA 3TEWA 3AECB 3O13A 1V8CA 2HTME 4JWSC 4II3B 2B3AA 4FA6A 4NY0A 3NZUA 1L0VB 3B08A 5DPWA 3VH3B 4BBNF 1KRHA 2K9XA 1RWSA 2MBOA 5AZHA 5MPOA 3MJWA 2FIFA 4W9JA 4IG7B 3ZUNA 1OQYA 2FIDA 2INCC 2KQ7A 2R2QA 3VR9B 2FCQA 1BT0A 3AE8B 1SE2A 1YD8U 1J7CA 1Q10A 2WX0A 3NG0A 1P7FA 4TV3A 2YVCA 1EWYC 3AEEB 2BW2A 5JHAA 2NMQA 2MX2A 2O6VB 2LI5A 2INPE 3R7RA 4B9KA 3RZWC 2G9HD 1P9DU 1JW9D 1JCKB 2AL3A 1K52A 3ZNID 1TIFA 1F0ZA 4BKGA 2Z8LA 3GS2A 1WXSA 3NRZA 4M0WB 3QC8B 4MELA 4MDKE 4S0RA 3ZGZA 2ZPYA 2LVOA 3DHIC 3A1QB 1YQ4B 4NJ7A 4DDGD 1UWXA 1FM0D 1R4MB 2KMMA 1V80A 2MBBB 2Q5WD 1T0QC 2W9NA 3ZO5B 3J9CA 1A5RA 5D6JB 3QQ8B 2D2QA 3MHSD 3KVFB 2L83A 2LHEA 3NZSA 3NJTA 1UD7A 2KN5A 2YEPB 2DZJA 3PREA 3U2SC 2LMCA 1VR9A 3EECA 5BMIA 4ANXA 2FNJB 1L5PA 2K5PA 2JY6A 1ZOYB 4HRSA 1Q0WB 2N9XA 4I6PA 1ZW7A 3BZDB 3AEFB 3AN1A 4BZAA 3NVYA 4TKNA 2WYQA 2RD0A 3U52E 5E6PA 1QZEA 5TSSA 2JRHA 2PVGC 1SE4A 3KLSX 1TTNA 4LTUA 3MC8A 4D2KA 2BS4B 5IOIA 1WE7A 2D10A 3WANA 3RNFC 4F1SA 2KN4A 4KZ0A 1SSNA 3ZLZA 1V49A 4YTMB 3Q3FA 2LUMA 4IUMB 4NAWA 2Y5BB 2JF5A 4FHKA 2AWTA 4IW0A 5I4DA 2ZVOA 3BK2A 5BMGA 2N0SB 2JQRB 5E6JA 4PYZA 4DK5A 4GB9A 1LO5D 4S17A 1SE3A 2KTFA 2AQ1B 1C4PA 1TS4A 2L3ZA 2GI9A 1HTQA 1L4ZB 1GPXA 1YQBA 4WQOB 4RFBA 2A4ZA 2BWES 3T8MA 1JALA 1WE6A 2JRIB 4NPNA 3PSEB 4FADA 5BYSA 1JWBD 5BMHA 4G0NB 4GMVA 2Z0EB 3UIPB 3RPFC 5DPSA 4XDDA 2WGSA 2RDHA 1VDVA 1TT5B 4C80A 2GBMA 1YN3A 3BVMA 1ESFA 2L00B 2O6VA 2KFJA 2LEKA 1WGDA 3DHGC 4M8NA 1YX5B 2KT7A 5GXGB 1UUPA 1F2RI 1XXGA 1V97A 3RMKC 4Q2JA 1SEBD 1VZ7A 3NHEB 4M0WA 1QOBA 2RGFA 2LVQA 3GP7A 2MWSB 2MBHA 2BBCA 2BS2B 2LHDA 1P98A 1AN8A 3A1QA 2YEPF 3FAHA 2EKEC 3GE3C 3DBRI 4MSQB 2K8BA 1VJKA 4PS3A 2MH7A 3X23A 5HKHA 1EU4A 2K22A 2KC1A 1FEHA 1WR6E 3DCGA 1S1QB 4XX5A 3BINA 2Z0DB 4FBJB 3P2BA 5L83A 1SIFA 2D3GA 2QCZA 3UGBB 2NCNA 5H92C 2N1VA 1CJEA 3OJ3A 1ZP0B 2GRIA 4B6WA 4L1BA 4RNAA 2V4IB 1L2NA 1YIWA 2MP2A 2KXJA 1YJIA 1C1YB 2WHIA 1YOVB 2KFKB 3DBHI 4QAYA 4TMAB 2BPSA 3M3JA 2H89B 4DDID 1SB3C 2KZRA 2JVCA 2FUHB 3B9JA 5AEKB 5AZFA 4EKUA 1NVID 2C5LC 4CHKA 2D11A 4TQ1A 1GG3A 4N59A 1SF0A 1L6UA 4NNJB 2RDGA 2QSDA 4NZLB 3KH0A 2ONQA 1N5XA 3AEDB 4MSMB 1BUIC 2DYBA 4JIOU 4MGYE 4R3DA 1M4VA 4P6VF 3AU4A 3P1MA 1ZXHA 4WAFA 3N1XC 2JSVX 4LCDE 3N9YC 4NQKE 2PPHA 3R66C 4RMAA 1WMHA 4IDIA 3GZNI 3W2DA 1UZXB 4RM9A 2MQJA 1D5MC 3ZNZB 1J0GA 3TUOA 1GC7A 2CJNA 1F52A 4W9GA 2DZKA 5C1ZA 2LGYA 1V9JA 2ZW0A 3M63B 3IHPC 4AOFA 2KWVB 4CO7A 1UH6A 1YJJA 4MJSB 4KDLB 1QOAA 1XT9B 1WIAA 2LWPA 4DHJB 4KVGB 2VZKD 3K9PB 1TKEA 3TEYA 3Q3OC 3JYUA 4OW0A 4AWJA 4ZRKA 2KLCA 1TS3A 3IAM1 2DENB 2WX1A 2JYEA 5CHFA 2XK5B 2C9WB 1E10A 3RULA 3DPDA 2I1KA 4FJVB 3DBHB 4PK1A 4M02A 2RSUA 1FFUA 1YX6B 2M56B 1VZ6A 1L0XB 1N62A 4HDQA 3L0WB 3ZDTA 2W3RA 1ZPSA 3B2GA 3NZ3A 4OVUA 3L08A 4W9KA 1GJZA 1E8WA 2JWUA 3VTVA 2V9HA 1OEYJ 1FO4A 1DGJA 4A8XC 3APCA 3HVZA 4FLHA 2ZPNA 3ZRCA 2ZCBA 1KOTA 3VUYA 1LM8B 2KOXA 3GZNB 3C8YA 2V3PA 2NBUA 1WWTA 4XE0A 2BYFA 4OZBA 2KNBA 3BVGA 3BYYB 1HXYD 2FCSA 2MCNB 4A20A 1C76A 1RRBA 2KFKA 2IBIB 2C7NB 1HQRD 3KUCB 4II2B 1AARA 3WCQA 3RUIB 4J6IA 3URYA 3Q3MC 5IKCM 1JRPA 4IKGA 1PUTA 4K7UA 2DYOA 3V05A 5LXHA 1WZ0A 4AJWA 1WYWB 3S2AA 1T5XD 1MJDA 3RCZA 5IO9A 2BYVE 4ZOHC 2X8XX 1L6VA 4WJQA 1K8RB 3ZXRA 2CS4A 3DVGX 3PVLA 2EELA 1D3ZA 2K8HA 2NTTA 4ICUA 1C3TA 2D3BA 4OZCA 5E6NA 2KMCA 3VH4B 3ZVVA 3CF6E 1H4RA 4PS8A 4BOZB 4HVBA 4ASWC 1QF6A 4A55A 4BFRA 2JXXA 2C7MB 1XF5L 4N9F4 3ONSA 1D4BA 2JPHA 2FCNA 3NUHB 3W5UB 4G11A 3MTNB 4A6QA 4A9AA 4DWFA 1HTOA 1NDDA 1J7AA 3H7PB 4RGTA 4ZYSA 2WDTB 3H6NA 4MJSA 3L10B 3EUB2 1T3QA 2DBYA 2KDBA 2X38A 1IUEA 2WXLA 3Q3NC 2DYMA 3ZW3A 4XC2A 2GB1A 1UF0A 4BKSD 1WXMA 2KACA 1WXQA 3UF8A 1XQQA 4JQWC 1WM3A 2J42A 4RF1A 5D3IB 1MG8A 4LNFA 3TCAA 4C4VB 1VD2A 3V6CB 3CSTA 2GBRA 1ZUD2 3JSVB 4WWNA 2XK5A 1KJTA 2WDVB 5JZEB 4K1RB 1I35A 4YSYB 1FCLA 3Q3JA 5L95C 1Y56A 3DBLI 3KQ4A 4BKTA 1YNTE 1E7PB 2J0MA 4WH4A 3RNAC 4W9LA 4ZRJA 2CKHB 3RI7C 4WWOA 3EA6A 3VVWB 1FNWA 2IGGA 3BIID 1FRDA 4B95A 2V3SA 4MACA 1JROA 2WXIA 3NVWA 2LGSA 1LQBA 4DBGA 4KGSA 1VCBA 3C0RB 4GSWA 2CR5A 4N58A 2LZ6A 1T0RC 4IM2A 2LXCA 5IN7A 2DZIA 1FIQA 4RGOS 4GDLB 4I6NB 3BK1A 3N20C 2N9KA 5J18A 2FCMA 5FK9C 1FXIA 3VDZA 1L7YA 3AH7A 3SD5A 1KH0A 2A5UA 5FR3A 2WXMA 1GC6A 3ZTCA 1WFYA 3MFGA 2LXAA 4EZKA 1QLBB 1FMAD 1E8YA 3OAWA 3VRBB 1E5WA 4K7SA 2KMAA 4W9HA 1FNVA 1PGAA 4OHJA 5LNK1 4JGHB 1TJEA 4KKIA 1XLQA 3ETRA 5CHVC 3W1SA 2WDQB 2WXJA 1N6ZA 3V61A 1WXVA 1J8CA 1I4RA 3QX1A 4A90A 2KWCA 5EE1A 4LNKA 3I9V1 3QA8A 3D32A 2JX5A 3NVZA 1WJ4A 4P1CC 1GUAB 2REXA 3PZ7A 3Q8EA 3P4SB 3HRDD 3ALBA 4BOSC 4AJYB 4GOCA 3JVZX 4MT5A 4AQ7A 4WAAA 1DYQA 2MBQA 1I4HA 3DBLB 2WU5B 4HEA1 5C3JB 1BXTA 3R7QA 3TEZA 3EFCA 3BY4B 1QKZA 2BGFA 1LGRA 1IYFA 4M8MA 5EE0A 2DZMA 2ZVNA 3ABVB 2AEHA 1OFFA 2N4FA 1TBEA 3H7PA 4JLCA 2KWUB 3U4EG 4WJOA 3T9LA 3X0WA 4WWMA 1NYRA 3V62A 2N1WA 1WGGA 1ISNA 5LXIB 1TKYA 3U7DA 4E71A 3CMMB 3OLMD 1D6EC 3U7ZA 1SXTA 4TUUA 2J0JA 3JSVA 1RFKA 3FILB 3SEBA 3DVNU 4YXDB 1GAQB 3R8BA 5IP4D 3AU5A 1JMLA 2ASQA 3I63C 4P7IA 1Q1OA 1UGMA 1Y8RC 3JW0X 2HD5B 4GU2A 1V5OA 4HJGE 4EE2A 4HXDA 4ARIA 3ZXVA 3AE2B 5DPRA 5HI1A 3VUWA 3MJ5A 3ZDMC 1HZ5A 3P42A 3DOWA 3H9DA 2K25A 4ITKA 2RPVA 1V2YA 2BB5A 3RN9C 3LB8C 1ACCA 1N5WA 1E7VA 1YN5A 1QT9A 2WXGA 4IWOA 3R2IA 2INNE 2KC2A 4C7YA 2UU7A 3H1UA 2DLBA 3AE5B 3QHTA 1V1PB 3PO0A 1OEYA 4GDLA 4ARCA 3TMPB 2NBVB 1E7UA 3N1ZC 2XNAC 3AB5A 1ENFA 4KDIC 4KGTA 2BTEA 2NVUI 1UNSA 4EZLA 4E74A 3FKYA 1JWSD 4XGAB 4YT0B 3EGRA 4XWWA 1XD3B 3WALA 3P4PB 2XBBC 2JUOA 3LDZE 3PRZA 3APFA 3MHZA 3SU8X 3L4PA 1K51A 3WAOA 2VZKB 4JL9A 1TZ1A 5J2RA 1PGXA 4GDKB 2GMIC
chains in the Genus database with same CATH topology
4EZJA 2MP2B 2KD0A 4LJOB 5BO4B 4ZDVA 2BKRB 4HK2A 4NAWB 5LLIA 1WXAA 2HTHA 4HDQA 3L0WB 2KDIA 2KO3A 4G3XB 5CX3A 3ZDTA 4W9FA 2C7HA 2V1YA 1IP9A 1WH3A 3VUXA 2KDFB 2CU1A 4OVUA 3TJPA 3L08A 4W9KA 1GJZA 4G50A 1X1MA 1E8WA 3B0AA 3VTVA 1OEYJ 2VRRB 3APCA 3PZDA 4II3B 2QHOA 4FLHA 2ZPNA 2B3AA 3ZRCA 2ZCBA 4EUTA 4FA6A 4NY0A 2PJHA 1KOTA 3NZUA 3B08A 3VFKA 3VHTC 3QIJA 3VUYA 1KM7A 3VH3B 4BBNF 5DPWA 2IO2B 2O6VD 2MBOA 1LM8B 3PRPB 5AZHA 4CYEA 3UQAA 2KOXA 3MJWA 4F7ZA 2FIFA 2M8SA 3PGEA 4W9JA 4IG7B 2NBUA 4W9DA 3ZUNA 1OQYA 2FIDA 2KQ7A 2R2QA 4YL8A 2CHWA 2NPTB 2BYFA 2FCQA 2KNBA 1KLVA 3WAPA 1BT0A 2FCSA 2WX0A 2MCNB 4A20A 4TV3A 1WMHB 1RRBA 2UYZB 2YVCA 2KFKA 2LD9A 3GOEA 2KKCA 5JHAA 2IBIB 1YJ1A 2MX2A 2C7NB 2LGDA 2O6VB 1WJUA 3KUCB 2KDEB 4ZRIA 1RLFA 4II2B 1AARA 2LI5A 4W9CA 4TQ0A 3RUIB 4J6IA 3PPAA 4FN2A 3R7RA 2FAZA 3WA0A 2D07B 3DBSA 4B9KA 3RZWC 4K7UA 1LFDA 2DYOA 5JH5C 2KJ6A 5LXHA 1WZ0A 4MGZE 1P9DU 1LXDA 4AJWA 1WYWB 2KLGA 3S2AA 2EMTA 2PE6B 2AL3A 4E3CA 3ZNID 3RCZA 3PHWB 3PHXB 4BKGA 2BYVE 1S3SG 2YLMA 4A3OA 1WXSA 2OOBB 4WJQA 4M0WB 1K8RB 2CHXA 3DDCB 3QC8B 2KTRB 4MELA 4MDKE 3HK0A 2CS4A 2GBKA 3DVGX 2JZZA 2ZPYA 3PVLA 2LVOA 1D3ZA 2K8HA 4KSKC 1WGHA 4GXBA 2HJ8A 1WX7A 3A1QB 4GGQA 1FXTB 4HPMB 4NJ7A 2V4LA 4ICUA 4DDGD 1C3TA 3LJ3A 3DQVA 4DHZE 2JZ3B 5IA7A 2J0KA 4IC7B 1V80A 1E8ZA 5E6NA 3RYTA 2KMCA 2MBBB 4GDKB 1Q5WB 1OTRB 1NBFC 2M1MA 2MA9B 3CF6E 3VH4B 1H4RA 2L76A 3L16A 2W9NA 4DHZB 3ZO5B 3PV1A 4PS8A 5D6JB 3APDA 3QQ8B 4BOZB 4HVBA 1A5RA 4ASWC 2D2QA 3MHSD 4AUQC 3IFWB 3KYCD 3KVFB 2BWFA 1TGZB 2ZZPB 4FULA 3ZKJC 2L0FA 3NZSA 1U4AA 4BFRA 2JXXA 2C7MB 4N9F4 3ONSA 1UD7A 2KN5A 3ZNGC 3ZRFA 2DZJA 3NS8A 3PREA 3QAQA 2JPHA 2FCNA 2DAFA 3EECA 4G11A 3V6EB 4ANXA 4WJNA 3MTNB 1SE9A 2BKFA 1ZGUB 2FNJB 4DWFA 1NDDA 4MH0E 3H7PB 5TR5A 1JRUA 1WX8A 2WDTB 3H6NA 3L10B 2JY6A 4MJSA 1HE8A 1WX9A 2KDBA 2M17A 3VTUA 1Q0WB 2N9XA 4I6PA 2DYMA 3ZW3A 1P3QU 4XC2A 3R3MA 2IO0B 1ZW7A 3KYDD 4XZ4A 3ZTDA 4BKSD 1WXMA 1WJ6A 3KW5B 2K39A 4TKNA 2WYQA 2RD0A 3UQBA 1P0RA 2O2VA 5E6PA 4EEWA 1QZEA 3UF8A 2M0XA 4BVUC 1XQQA 3PLVA 4JQWC 1WM3A 1MG8A 4KV2A 5KHQA 1IPGA 2JRHA 4HCNB 3SDLC 3TCAA 1ZKHA 1RAXA 1VD2A 4GN1A 4K7WA 2CHZA 3A9KB 3QK0A 4HCPB 3V6CB 3CSTA 2GBRA 3JSVB 4WWNA 1TTNA 2XK5A 1KJTA 2IO3B 2KQSA 3QARA 4HJKA 5JZEB 3EFUA 4K1RB 1I35A 3N30A 2N7EA 3EC8A 1WE7A 2D10A 4ANVA 3Q3JA 5L95C 2ZJDA 3WANA 5G2NA 3AI5A 3DBLI 3PT2B 4MGIE 5CTRC 3ZVVA 1EUVB 4BKTA 1EO6A 4KZCA 4F1SA 4KZ0A 3ZLZA 2J0MA 1V49A 4GDKA 3HIZA 4HLEA 2L8JA 5DPTA 3Q3FA 4IUMB 3M95A 4NAWA 2Y5BB 2JF5A 4W9LA 4ZRJA 1P1AA 2CKHB 4FHKA 2IY1B 4WWOA 2AWTA 4IW0A 3VVWB 2ZVOA 2PE9A 3CSFA 3B1LX 3PS6A 3U8ZA 3PTFC 4B95A 3TL5A 1GNUA 4PYZA 4DK5A 2V3SA 3ENEA 1E8XA 1WR1A 4GB9A 3M62B 2KX3A 5JHBA 3ZNHB 2MBEA 2KTFA 2L0TA 1WZ3A 2L3ZA 1LQBA 5KHOA 4AP4C 4DBGA 2G4SA 1VCBA 1YQBA 1V86A 3C0RB 4GSWA 4KIKB 4ANWA 2CR5A 4WQOB 3AXCA 2A4ZA 4HWIB 2BWES 3T8MA 2LZ6A 4FJYA 4IM2A 2LXCA 1PQSA 1WE6A 2JRIB 4NPNA 4RM8A 2DZIA 2J7QB 3PLUA 2JWZA 3PSEB 4GDLB 4GIVA 4I6NB 4FADA 3QWZB 3A9JB 3ECIA 2NPTA 4G0NB 4GMVA 2Z0EB 3UIPB 5J18A 2FCMA 2KANA 5DPSA 4WWPA 3VDZA 1L7YA 3SD5A 2GBMA 2A5UA 1R4NI 2LASA 2NR2A 2L00B 2O6VA 2KFJA 3VQIA 2KVRA 1GC6A 1WGDA 4I6LB 3ZTCA 1WFYA 4M8NA 2LXAA 4EZKA 1E90A 3QJZA 1E8YA 1YX5B 3OAWA 2ZEQA 4DXAB 3UINB 1E5WA 3IBEA 4K7SA 2KMAA 4W9HA 3K9OB 2GBNA 5D7GA 2XEWA 3NHEB 4JGHB 5CHVC 3W1SA 1UELA 3ML9A 5E6OA 5G55A 4MGKE 3U30A 1Z5SB 3SHQA 3H7SA 5J17A 2RGFA 2NBWB 3V61A 2LVQA 2KTRA 4HPLB 1WXVA 4KSLC 3N3KB 2L7RA 2MWSB 3L13A 1J8CA 2IYDB 2MBHA 3O65B 3QX1A 2G3QB 1OGWA 2KWCA 1M94A 1P98A 3DVGY 3L17A 1NI2A 2BYEA 3QA8A 3A1QA 2UWQA 2L05A 3D32A 2EKEC 2IY0B 3DBRI 1WJ4A 4MSQB 3RZFA 1GUAB 2REXA 3WAMA 2RPQA 4K81A 2K8BA 4W9IA 4PS3A 3X23A 3ALBA 4BOSC 5DCNA 4AJYB 5HKHA 4GOCA 4MM3A 4W9EA 2LRUA 3JVZX 4WAAA 2MBQA 5FR6A 2KC1A 1J19A 1WR6E 3DCGA 1S1QB 4PS7A 2ZNVC 3R7QA 2LGXA 4XX5A 3BY4B 3UIOB 1WF9A 2BGFA 3BINA 5D2MB 1IYFA 2Z0DB 4FBJB 4M8MA 2DZMA 2K8CA 2LRWA 3RD2A 3P2BA 2ZVNA 3IG3A 5L83A 3NOBA 1SIFA 2AEHA 3N32A 2D3GA 4MEMA 3UGBB 2N4FA 1TBEA 3H7PA 4IWQA 2NCNA 2LUEA 2NS5A 2N1VA 4JLCA 2KWUB 3KUDB 3OJ3A 3DVNV 4WJOA 3T9LA 3ZIMA 4NQLB 3X0WA 4B6WA 4X57B 3IVFA 3V62A 1L2NA 4EOYA 1YIWA 2MP2A 2N1WA 1WGGA 2KXJA 1C1YB 2JT4B 1Z2MA 2KFKB 3DBHI 4PYUA 5AZGA 1ISNA 1EF1A 3AULA 4ICVA 5IAAC 5LXIB 2BPSA 3U7DA 3M3JA 4E71A 4DDID 4URKA 3CMMB 2KZRA 3OLMD 2JVCA 2M4NA 2FUHB 1V5TA 2N9EB 3A9KA 2RR9A 4LDTD 5AZFA 4TUUA 2J0JA 4EKUA 5AEKB 2C5LC 3JSVA 2IZVB 3TBLD 3DVNU 4CHKA 2D11A 4TQ1A 1GG3A 4NJ6A 1WI0A 4NNJB 4BKSA 5C23A 3AU5A 2MW5A 5CHWA 2ASQA 4P7IA 1Q1OA 2DAJA 2DX5B 3KH0A 3RT3B 3EHVA 1SGHA 1UGMA 1Y8RC 4IWPA 3JW0X 2HD5B 2K6DB 3NY5A 4MSMB 4LJPB 4GU2A 2DYBA 4JIOU 1V5OA 4HXDA 4LDTB 5DPRA 4MGYE 2IO1B 1WRDB 3L54A 3VUWA 3ZDMC 2R2OA 1F9JA 3AU4A 3OJ4B 3VTWA 3DOWA 3H9DA 4LCDE 3HM6X 2K25A 1WJNA 1V2YA 2PEAA 2Z59B 4NQKE 2PPHA 3R66C 5EDSA 1T0YA 1WMHA 4RMAA 1E7VA 4OVVA 3GZNI 1V6EA 2G4DB 4IM0A 3PRMB 4A3PA 3I3TB 4IWOA 1UZXB 4RM9A 3TIXA 2MQJA 4FJZA 2I1JA 3V60A 3ZNZB 1J0GA 2KJHB 1GC7A 4BBNC 5D94A 2AYOB 2KC2A 1RFAA 1WGRA 2LVPA 2EMSA 2ZNVB 4KIKA 2DZKA 4W9GA 3VAWA 3WIMA 2N7DA 3H1UA 2C60A 5C1ZA 3KUZA 2LGYA 3W1YA 2MSED 2N9PC 3QHTA 1V9JA 3A4SC 4DHJD 4FHJA 1OEYA 3M63B 2K6QA 4GDLA 3IHPC 3A9JA 3ML8A 2KWVB 4AOFA 4CO7A 1H8CA 3TMPB 2NBVB 2DHZA 1UH6A 1E7UA 1V81A 4ANUA 4MJSB 3VXWA 2K1FA 4KDLB 1XT9B 4KDIC 3HM3A 1WGYA 1WIAA 2LWPA 4DHJB 2NVUI 4KVGB 3K9PB 1WM2A 4EZLA 4E74A 2O2VB 3JYUA 2WWZA 2OJRA 2MLBA 1EF5A 2GOWA 2MRPA 1WY8A 4AWJA 4ZRKA 1XD3B 3WALA 2KLCA 2XBBC 2JUOA 3LDZE 3PRZA 1CMXB 2DENB 3APFA 4EFOA 2AL6A 2WX1A 3SU8X 3A33B 4HDOA 2GBJA 2KJRA 2HE7A 2XK5B 5CHFA 2C9WB 2G45B 3RULA 4F8CB 1R4MI 4IM3A 3W1SC 3DPDA 2I1KA 4FJVB 2KHWB 3A4RA 5GMVA 3WAOA 2KX0A 4JL9A 1TZ1A 5J2RA 2BF8B 2LJ5A 4WJPA 2ZCCA 1UBQA 2RSUA 1UBIA 1YX6B 3QCAA 1I42A 4ZYNA 2KK8A 1G6JA 1YD8U 2GMIC 3HHMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EZJ A;  2MP2 B;  2KD0 A;  4LJO B;  5BO4 B;  4ZDV A;  2BKR B;  4HK2 A;  4NAW B;  5LLI A;  1WXA A;  2HTH A;  4HDQ A;  3L0W B;  2KDI A;  2KO3 A;  4G3X B;  5CX3 A;  3ZDT A;  4W9F A;  2C7H A;  2V1Y A;  1IP9 A;  1WH3 A;  3VUX A;  2KDF B;  2CU1 A;  4OVU A;  3TJP A;  3L08 A;  4W9K A;  1GJZ A;  4G50 A;  1X1M A;  1E8W A;  3B0A A;  3VTV A;  1OEY J;  2VRR B;  3APC A;  3PZD A;  4II3 B;  2QHO A;  4FLH A;  2ZPN A;  2B3A A;  3ZRC A;  2ZCB A;  4EUT A;  4FA6 A;  4NY0 A;  2PJH A;  1KOT A;  3NZU A;  3B08 A;  3VFK A;  3VHT C;  3QIJ A;  3VUY A;  1KM7 A;  3VH3 B;  4BBN F;  5DPW A;  2IO2 B;  2O6V D;  2MBO A;  1LM8 B;  3PRP B;  5AZH A;  4CYE A;  3UQA A;  2KOX A;  3MJW A;  4F7Z A;  2FIF A;  2M8S A;  3PGE A;  4W9J A;  4IG7 B;  2NBU A;  4W9D A;  3ZUN A;  1OQY A;  2FID A;  2KQ7 A;  2R2Q A;  4YL8 A;  2CHW A;  2NPT B;  2BYF A;  2FCQ A;  2KNB A;  1KLV A;  3WAP A;  1BT0 A;  2FCS A;  2WX0 A;  2MCN B;  4A20 A;  4TV3 A;  1WMH B;  1RRB A;  2UYZ B;  2YVC A;  2KFK A;  2LD9 A;  3GOE A;  2KKC A;  5JHA A;  2IBI B;  1YJ1 A;  2MX2 A;  2C7N B;  2LGD A;  2O6V B;  1WJU A;  3KUC B;  2KDE B;  4ZRI A;  1RLF A;  4II2 B;  1AAR A;  2LI5 A;  4W9C A;  4TQ0 A;  3RUI B;  4J6I A;  3PPA A;  4FN2 A;  3R7R A;  2FAZ A;  3WA0 A;  2D07 B;  3DBS A;  4B9K A;  3RZW C;  4K7U A;  1LFD A;  2DYO A;  5JH5 C;  2KJ6 A;  5LXH A;  1WZ0 A;  4MGZ E;  1P9D U;  1LXD A;  4AJW A;  1WYW B;  2KLG A;  3S2A A;  2EMT A;  2PE6 B;  2AL3 A;  4E3C A;  3ZNI D;  3RCZ A;  3PHW B;  3PHX B;  4BKG A;  2BYV E;  1S3S G;  2YLM A;  4A3O A;  1WXS A;  2OOB B;  4WJQ A;  4M0W B;  1K8R B;  2CHX A;  3DDC B;  3QC8 B;  2KTR B;  4MEL A;  4MDK E;  3HK0 A;  2CS4 A;  2GBK A;  3DVG X;  2JZZ A;  2ZPY A;  3PVL A;  2LVO A;  1D3Z A;  2K8H A;  4KSK C;  1WGH A;  4GXB A;  2HJ8 A;  1WX7 A;  3A1Q B;  4GGQ A;  1FXT B;  4HPM B;  4NJ7 A;  2V4L A;  4ICU A;  4DDG D;  1C3T A;  3LJ3 A;  3DQV A;  4DHZ E;  2JZ3 B;  5IA7 A;  2J0K A;  4IC7 B;  1V80 A;  1E8Z A;  5E6N A;  3RYT A;  2KMC A;  2MBB B;  4GDK B;  1Q5W B;  1OTR B;  1NBF C;  2M1M A;  2MA9 B;  3CF6 E;  3VH4 B;  1H4R A;  2L76 A;  3L16 A;  2W9N A;  4DHZ B;  3ZO5 B;  3PV1 A;  4PS8 A;  5D6J B;  3APD A;  3QQ8 B;  4BOZ B;  4HVB A;  1A5R A;  4ASW C;  2D2Q A;  3MHS D;  4AUQ C;  3IFW B;  3KYC D;  3KVF B;  2BWF A;  1TGZ B;  2ZZP B;  4FUL A;  3ZKJ C;  2L0F A;  3NZS A;  1U4A A;  4BFR A;  2JXX A;  2C7M B;  4N9F 4;  3ONS A;  1UD7 A;  2KN5 A;  3ZNG C;  3ZRF A;  2DZJ A;  3NS8 A;  3PRE A;  3QAQ A;  2JPH A;  2FCN A;  2DAF A;  3EEC A;  4G11 A;  3V6E B;  4ANX A;  4WJN A;  3MTN B;  1SE9 A;  2BKF A;  1ZGU B;  2FNJ B;  4DWF A;  1NDD A;  4MH0 E;  3H7P B;  5TR5 A;  1JRU A;  1WX8 A;  2WDT B;  3H6N A;  3L10 B;  2JY6 A;  4MJS A;  1HE8 A;  1WX9 A;  2KDB A;  2M17 A;  3VTU A;  1Q0W B;  2N9X A;  4I6P A;  2DYM A;  3ZW3 A;  1P3Q U;  4XC2 A;  3R3M A;  2IO0 B;  1ZW7 A;  3KYD D;  4XZ4 A;  3ZTD A;  4BKS D;  1WXM A;  1WJ6 A;  3KW5 B;  2K39 A;  4TKN A;  2WYQ A;  2RD0 A;  3UQB A;  1P0R A;  2O2V A;  5E6P A;  4EEW A;  1QZE A;  3UF8 A;  2M0X A;  4BVU C;  1XQQ A;  3PLV A;  4JQW C;  1WM3 A;  1MG8 A;  4KV2 A;  5KHQ A;  1IPG A;  2JRH A;  4HCN B;  3SDL C;  3TCA A;  1ZKH A;  1RAX A;  1VD2 A;  4GN1 A;  4K7W A;  2CHZ A;  3A9K B;  3QK0 A;  4HCP B;  3V6C B;  3CST A;  2GBR A;  3JSV B;  4WWN A;  1TTN A;  2XK5 A;  1KJT A;  2IO3 B;  2KQS A;  3QAR A;  4HJK A;  5JZE B;  3EFU A;  4K1R B;  1I35 A;  3N30 A;  2N7E A;  3EC8 A;  1WE7 A;  2D10 A;  4ANV A;  3Q3J A;  5L95 C;  2ZJD A;  3WAN A;  5G2N A;  3AI5 A;  3DBL I;  3PT2 B;  4MGI E;  5CTR C;  3ZVV A;  1EUV B;  4BKT A;  1EO6 A;  4KZC A;  4F1S A;  4KZ0 A;  3ZLZ A;  2J0M A;  1V49 A;  4GDK A;  3HIZ A;  4HLE A;  2L8J A;  5DPT A;  3Q3F A;  4IUM B;  3M95 A;  4NAW A;  2Y5B B;  2JF5 A;  4W9L A;  4ZRJ A;  1P1A A;  2CKH B;  4FHK A;  2IY1 B;  4WWO A;  2AWT A;  4IW0 A;  3VVW B;  2ZVO A;  2PE9 A;  3CSF A;  3B1L X;  3PS6 A;  3U8Z A;  3PTF C;  4B95 A;  3TL5 A;  1GNU A;  4PYZ A;  4DK5 A;  2V3S A;  3ENE A;  1E8X A;  1WR1 A;  4GB9 A;  3M62 B;  2KX3 A;  5JHB A;  3ZNH B;  2MBE A;  2KTF A;  2L0T A;  1WZ3 A;  2L3Z A;  1LQB A;  5KHO A;  4AP4 C;  4DBG A;  2G4S A;  1VCB A;  1YQB A;  1V86 A;  3C0R B;  4GSW A;  4KIK B;  4ANW A;  2CR5 A;  4WQO B;  3AXC A;  2A4Z A;  4HWI B;  2BWE S;  3T8M A;  2LZ6 A;  4FJY A;  4IM2 A;  2LXC A;  1PQS A;  1WE6 A;  2JRI B;  4NPN A;  4RM8 A;  2DZI A;  2J7Q B;  3PLU A;  2JWZ A;  3PSE B;  4GDL B;  4GIV A;  4I6N B;  4FAD A;  3QWZ B;  3A9J B;  3ECI A;  2NPT A;  4G0N B;  4GMV A;  2Z0E B;  3UIP B;  5J18 A;  2FCM A;  2KAN A;  5DPS A;  4WWP A;  3VDZ A;  1L7Y A;  3SD5 A;  2GBM A;  2A5U A;  1R4N I;  2LAS A;  2NR2 A;  2L00 B;  2O6V A;  2KFJ A;  3VQI A;  2KVR A;  1GC6 A;  1WGD A;  4I6L B;  3ZTC A;  1WFY A;  4M8N A;  2LXA A;  4EZK A;  1E90 A;  3QJZ A;  1E8Y A;  1YX5 B;  3OAW A;  2ZEQ A;  4DXA B;  3UIN B;  1E5W A;  3IBE A;  4K7S A;  2KMA A;  4W9H A;  3K9O B;  2GBN A;  5D7G A;  2XEW A;  3NHE B;  4JGH B;  5CHV C;  3W1S A;  1UEL A;  3ML9 A;  5E6O A;  5G55 A;  4MGK E;  3U30 A;  1Z5S B;  3SHQ A;  3H7S A;  5J17 A;  2RGF A;  2NBW B;  3V61 A;  2LVQ A;  2KTR A;  4HPL B;  1WXV A;  4KSL C;  3N3K B;  2L7R A;  2MWS B;  3L13 A;  1J8C A;  2IYD B;  2MBH A;  3O65 B;  3QX1 A;  2G3Q B;  1OGW A;  2KWC A;  1M94 A;  1P98 A;  3DVG Y;  3L17 A;  1NI2 A;  2BYE A;  3QA8 A;  3A1Q A;  2UWQ A;  2L05 A;  3D32 A;  2EKE C;  2IY0 B;  3DBR I;  1WJ4 A;  4MSQ B;  3RZF A;  1GUA B;  2REX A;  3WAM A;  2RPQ A;  4K81 A;  2K8B A;  4W9I A;  4PS3 A;  3X23 A;  3ALB A;  4BOS C;  5DCN A;  4AJY B;  5HKH A;  4GOC A;  4MM3 A;  4W9E A;  2LRU A;  3JVZ X;  4WAA A;  2MBQ A;  5FR6 A;  2KC1 A;  1J19 A;  1WR6 E;  3DCG A;  1S1Q B;  4PS7 A;  2ZNV C;  3R7Q A;  2LGX A;  4XX5 A;  3BY4 B;  3UIO B;  1WF9 A;  2BGF A;  3BIN A;  5D2M B;  1IYF A;  2Z0D B;  4FBJ B;  4M8M A;  2DZM A;  2K8C A;  2LRW A;  3RD2 A;  3P2B A;  2ZVN A;  3IG3 A;  5L83 A;  3NOB A;  1SIF A;  2AEH A;  3N32 A;  2D3G A;  4MEM A;  3UGB B;  2N4F A;  1TBE A;  3H7P A;  4IWQ A;  2NCN A;  2LUE A;  2NS5 A;  2N1V A;  4JLC A;  2KWU B;  3KUD B;  3OJ3 A;  3DVN V;  4WJO A;  3T9L A;  3ZIM A;  4NQL B;  3X0W A;  4B6W A;  4X57 B;  3IVF A;  3V62 A;  1L2N A;  4EOY A;  1YIW A;  2MP2 A;  2N1W A;  1WGG A;  2KXJ A;  1C1Y B;  2JT4 B;  1Z2M A;  2KFK B;  3DBH I;  4PYU A;  5AZG A;  1ISN A;  1EF1 A;  3AUL A;  4ICV A;  5IAA C;  5LXI B;  2BPS A;  3U7D A;  3M3J A;  4E71 A;  4DDI D;  4URK A;  3CMM B;  2KZR A;  3OLM D;  2JVC A;  2M4N A;  2FUH B;  1V5T A;  2N9E B;  3A9K A;  2RR9 A;  4LDT D;  5AZF A;  4TUU A;  2J0J A;  4EKU A;  5AEK B;  2C5L C;  3JSV A;  2IZV B;  3TBL D;  3DVN U;  4CHK A;  2D11 A;  4TQ1 A;  1GG3 A;  4NJ6 A;  1WI0 A;  4NNJ B;  4BKS A;  5C23 A;  3AU5 A;  2MW5 A;  5CHW A;  2ASQ A;  4P7I A;  1Q1O A;  2DAJ A;  2DX5 B;  3KH0 A;  3RT3 B;  3EHV A;  1SGH A;  1UGM A;  1Y8R C;  4IWP A;  3JW0 X;  2HD5 B;  2K6D B;  3NY5 A;  4MSM B;  4LJP B;  4GU2 A;  2DYB A;  4JIO U;  1V5O A;  4HXD A;  4LDT B;  5DPR A;  4MGY E;  2IO1 B;  1WRD B;  3L54 A;  3VUW A;  3ZDM C;  2R2O A;  1F9J A;  3AU4 A;  3OJ4 B;  3VTW A;  3DOW A;  3H9D A;  4LCD E;  3HM6 X;  2K25 A;  1WJN A;  1V2Y A;  2PEA A;  2Z59 B;  4NQK E;  2PPH A;  3R66 C;  5EDS A;  1T0Y A;  1WMH A;  4RMA A;  1E7V A;  4OVV A;  3GZN I;  1V6E A;  2G4D B;  4IM0 A;  3PRM B;  4A3P A;  3I3T B;  4IWO A;  1UZX B;  4RM9 A;  3TIX A;  2MQJ A;  4FJZ A;  2I1J A;  3V60 A;  3ZNZ B;  1J0G A;  2KJH B;  1GC7 A;  4BBN C;  5D94 A;  2AYO B;  2KC2 A;  1RFA A;  1WGR A;  2LVP A;  2EMS A;  2ZNV B;  4KIK A;  2DZK A;  4W9G A;  3VAW A;  3WIM A;  2N7D A;  3H1U A;  2C60 A;  5C1Z A;  3KUZ A;  2LGY A;  3W1Y A;  2MSE D;  2N9P C;  3QHT A;  1V9J A;  3A4S C;  4DHJ D;  4FHJ A;  1OEY A;  3M63 B;  2K6Q A;  4GDL A;  3IHP C;  3A9J A;  3ML8 A;  2KWV B;  4AOF A;  4CO7 A;  1H8C A;  3TMP B;  2NBV B;  2DHZ A;  1UH6 A;  1E7U A;  1V81 A;  4ANU A;  4MJS B;  3VXW A;  2K1F A;  4KDL B;  1XT9 B;  4KDI C;  3HM3 A;  1WGY A;  1WIA A;  2LWP A;  4DHJ B;  2NVU I;  4KVG B;  3K9P B;  1WM2 A;  4EZL A;  4E74 A;  2O2V B;  3JYU A;  2WWZ A;  2OJR A;  2MLB A;  1EF5 A;  2GOW A;  2MRP A;  1WY8 A;  4AWJ A;  4ZRK A;  1XD3 B;  3WAL A;  2KLC A;  2XBB C;  2JUO A;  3LDZ E;  3PRZ A;  1CMX B;  2DEN B;  3APF A;  4EFO A;  2AL6 A;  2WX1 A;  3SU8 X;  3A33 B;  4HDO A;  2GBJ A;  2KJR A;  2HE7 A;  2XK5 B;  5CHF A;  2C9W B;  2G45 B;  3RUL A;  4F8C B;  1R4M I;  4IM3 A;  3W1S C;  3DPD A;  2I1K A;  4FJV B;  2KHW B;  3A4R A;  5GMV A;  3WAO A;  2KX0 A;  4JL9 A;  1TZ1 A;  5J2R A;  2BF8 B;  2LJ5 A;  4WJP A;  2ZCC A;  1UBQ A;  2RSU A;  1UBI A;  1YX6 B;  3QCA A;  1I42 A;  4ZYN A;  2KK8 A;  1G6J A;  1YD8 U;  2GMI C;  3HHM A; 
#chains in the Genus database with same CATH topology
 4EZJ A;  4ZDV A;  5BO4 B;  1ET6 A;  3E56 A;  2QIE B;  4C7Z A;  1IP9 A;  2KYW A;  1WH3 A;  2KDF B;  2D3C A;  3CWI A;  2CU1 A;  2V0G A;  2N9L A;  1SJH D;  1X1M A;  2J4X A;  4G50 A;  1ZDX A;  2WP9 B;  3B0A A;  5G5G A;  1ROE A;  3T3O A;  4B0M A;  4PT5 A;  2PJH A;  3GE8 C;  1E9M A;  3VHT C;  1HA5 A;  1KM7 A;  1MHH E;  4CYE A;  4F7Z A;  2M8S A;  3PGE A;  4GLS C;  4YWG G;  3OWE B;  4YL8 A;  2ON8 A;  2CHW A;  2NPT B;  5C2T B;  5EE9 A;  3WAP A;  1B9R A;  1PYW D;  4HKZ E;  1JWU D;  4WQM A;  2UYZ B;  3W9C B;  5H8Y E;  3MP9 A;  2LGD A;  1E6E B;  4W9C A;  2E6X A;  1EM7 A;  3PPA A;  2FAZ A;  3BWU D;  3WA0 A;  2D07 B;  3DBS A;  1FNU A;  1PFD A;  3FIL A;  5JH5 C;  1T6B X;  4MGZ E;  2VH2 A;  1LXD A;  4FXC A;  3VR8 B;  2EMT A;  2PE6 B;  1C77 A;  2WXO A;  3PHX B;  3PHW B;  1WYG A;  4RCO A;  2OOB B;  4HPP A;  2CHX A;  3DDC B;  3HK0 A;  2PVO D;  3R2T A;  1C4C A;  2GBK A;  2JZZ A;  4KSK C;  1WGH A;  3CIR B;  4GXB A;  1WX7 A;  4HPM B;  1K53 A;  3HVD A;  4RH6 A;  3Q69 A;  4DHZ E;  5IA7 A;  2EKI A;  2J0K A;  4IC7 B;  1KLG D;  1E8Z A;  4K3C A;  4MM3 B;  3RYT A;  4E3C A;  1Q5W B;  1OTR B;  2MA9 B;  1N60 A;  4DHZ B;  1XLO A;  1UWM A;  2LFI A;  1EWC A;  2QMT A;  3AE3 B;  4AUQ C;  2QIL A;  3KYC D;  1TGZ B;  2ZZP B;  4FUL A;  4LNO A;  1U4A A;  2WXH A;  1V1P A;  1GOZ A;  2KDM A;  3NS8 A;  3QAQ A;  3TSS A;  2DAF A;  1ZGU B;  1WX8 A;  1D5X C;  1HE8 A;  2M17 A;  1P3Q U;  3R3M A;  2IO0 B;  1VZ8 A;  3KYD D;  4XZ4 A;  3ZTD A;  1WJ6 A;  3UQB A;  1P0R A;  1RM6 C;  2SEB D;  3HUI A;  4EEW A;  2B76 B;  2M0X A;  5HHD G;  4KV2 A;  5KHQ A;  4HCN B;  2PLP A;  2W55 A;  4GN1 A;  2CHZ A;  4HCP B;  3QK0 A;  1QOF A;  2BS3 B;  2IDY A;  2KQS A;  2OED A;  3QAR A;  3EC8 A;  1AYF A;  2RDB C;  4ANV A;  1KF6 B;  5G2N A;  3AI5 A;  4C56 C;  4MGI E;  5CTR C;  1EUV B;  4KZC A;  4GDK A;  1AW7 A;  2L8J A;  2J53 A;  1VRA B;  2IY1 B;  3CSF A;  3PS6 A;  3U8Z A;  2BB6 A;  3PTF C;  1MG4 A;  3ENE A;  4RGN A;  5D3D A;  3M62 B;  2KX3 A;  5JHB A;  2MBE A;  1DOI A;  2AQ2 B;  5KHO A;  2G4S A;  1V86 A;  4ANW A;  1OQR A;  1CQV A;  4HWI B;  1ZE3 D;  2M19 A;  4FJY A;  1PQS A;  2JWZ A;  3IAS 1;  3QWZ B;  2IPK D;  2IJ0 A;  2NPT A;  4WWP A;  3NS1 A;  4OVZ A;  2NR2 A;  2K3U A;  2H88 B;  2W54 A;  2KVR A;  4I6L B;  3AEB B;  4NJC A;  3Q2A C;  3QJZ A;  4DXA B;  3AE4 B;  1WSP A;  3SFE B;  4MH8 A;  1KFY B;  4M00 A;  3ML9 A;  5E6O A;  4MGK E;  1Z5S B;  3H7S A;  5J17 A;  4HPL B;  1QIL A;  1F1H A;  4KSL C;  2WQY B;  3L13 A;  2G3Q B;  1WGK A;  3L17 A;  3DVG Y;  1C9F A;  1NI2 A;  1EU3 A;  2BYE A;  2L05 A;  1ZXI A;  1YMH E;  2IY0 B;  3KWL A;  4XDC A;  4W9I A;  4K81 A;  4REZ A;  5DCN A;  3MC0 B;  4MM3 A;  2LRU A;  2ZNV C;  3ZYY X;  3UIO B;  1TS5 A;  3AEA B;  1XLP A;  3FC4 A;  1GB4 A;  2MJE A;  1QOG A;  4XYC A;  1FFV A;  2LUE A;  1TY2 A;  3DVN V;  3ZIM A;  3Q14 C;  2V3N A;  3AE7 B;  4X57 B;  2ZW1 A;  3IVF A;  5JXV A;  2AX5 A;  4LK0 M;  2IGH A;  2JT4 B;  1Z2M A;  4PYU A;  2Y5P A;  5IAA C;  1NYQ A;  3SFD B;  3AE1 B;  1NEN B;  2MJ3 A;  3NVV A;  3DWG C;  1MI0 A;  1C4A A;  3DWM A;  1MVK A;  1V5T A;  4LDT D;  5HFY A;  4NJ6 A;  4BKS A;  1XEE A;  5C23 A;  2DAJ A;  2DX5 B;  1SGH A;  4IWP A;  2WXK A;  1XCQ L;  4LJP B;  2QDF A;  2GLS A;  3V3X A;  3L54 A;  1MHX A;  2R2O A;  1T0S C;  1MPE A;  3HM6 X;  4RF0 A;  2PEA A;  2Z59 B;  4CQN A;  1T0Y A;  2ICI A;  1C79 A;  1V6E A;  2G4D B;  2LJI A;  4IM0 A;  3PRM B;  4A3P A;  3I3T B;  1NI3 A;  1XCT L;  3IT6 B;  2G1E A;  2I1J A;  3V60 A;  2KJH B;  2JU6 X;  3IXS A;  2AYO B;  3AV8 A;  1RFA A;  2Y3A A;  3WIM A;  2N7D A;  3N1Y C;  3W1Y A;  2MSE D;  3A4S C;  3B2F A;  2WXN A;  4H2A A;  2IND C;  1OQQ A;  3ML8 A;  2L1A A;  1H8C A;  3RNC C;  1V81 A;  3BYT B;  5FKA C;  4DXF A;  2J52 A;  3HM3 A;  1WM2 A;  2O2V B;  3Q8C A;  2BYT A;  2OJR A;  1EF5 A;  2MRP A;  1WY8 A;  1CMX B;  1TS2 A;  4EFO A;  4HDO A;  2GBJ A;  2KJR A;  2HE7 A;  2M0A A;  2G45 B;  4ACF A;  4F8C B;  2KHW B;  3A4R A;  5GMV A;  2KX0 A;  4HRO A;  2LJ5 A;  2BT6 A;  1ET9 A;  3QCA A;  1I42 A;  3ZJT A;  4KX6 B;  1G6J A;  2MJD A;  3C19 A;  5CHW A;  3SR6 A;  3HHM A;  2MP2 B;  4LJO B;  2BKR B;  2L52 A;  4HK2 A;  1JWM D;  5CX3 A;  2KO3 A;  3AEG B;  4G3X B;  4HKQ A;  2VH1 A;  1L0Y B;  1XLN A;  5HG2 A;  4XWT A;  2WS3 B;  2V1Y A;  3VUX A;  2SAK A;  1TYG B;  2VRR B;  4DXG A;  3PZD A;  2QHO A;  1TZO A;  4C4V A;  1E0Z A;  1I4X A;  2KVZ A;  4EUT A;  3VFK A;  3QIJ A;  2OJW A;  2IO2 B;  2O6V D;  1PDX A;  3PRP B;  3UQA A;  2I38 A;  2PMV A;  4W9D A;  1R7S A;  1JQ4 A;  2BQQ A;  4YSX B;  1KLV A;  2L32 A;  1FD6 A;  1WMH B;  2LD9 A;  2RMM A;  3GOE A;  4L2Y A;  2KKC A;  3RNB C;  1YJ1 A;  1WJU A;  2KDE B;  4ZRI A;  1RLF A;  3LXF A;  4TQ0 A;  1KTK A;  3AE9 B;  4DQO C;  4FN2 A;  3I57 A;  2NTS A;  1GB1 A;  1LFD A;  1P7E A;  4JWU C;  2KJ6 A;  2KLG A;  5BYR A;  1S3S G;  2YLM A;  1CK1 A;  4A3O A;  1HZ6 A;  1K50 A;  2WU2 B;  3T3N A;  2KTR B;  1I4G A;  1UGJ A;  2N7J A;  4KGR A;  2HJ8 A;  4GGQ A;  1FXT B;  2V4L A;  3LJ3 A;  3DQV A;  2JZ3 B;  4AP4 C;  1NBF C;  2M1M A;  2WXR A;  2L76 A;  3L16 A;  3PV1 A;  3APD A;  3IFW B;  2BWF A;  3ZKJ C;  2L0F A;  3H8H A;  1DOY A;  3ZRF A;  3ZNG C;  1TKG A;  2CJO A;  3V6E B;  4WJN A;  1SE9 A;  2BKF A;  4MH0 E;  5TR5 A;  1JRU A;  1NEK B;  2DNF A;  1WX9 A;  3VTU A;  1DOX A;  4P1B C;  2PKO A;  4US8 A;  1A70 A;  2I2Y A;  2BVC A;  4LNI A;  3I5J C;  3KW5 B;  2K39 A;  2O2V A;  3OG5 A;  4BVU C;  3PLV A;  2D5G A;  1IPG A;  2IGD A;  2OHF A;  3SDL C;  1MFW A;  1ZKH A;  4US9 A;  1RAX A;  4ZHO A;  4K7W A;  3A9K B;  2IO3 B;  4HJK A;  1IGD A;  3EFU A;  3N30 A;  2N7E A;  2ZJD A;  1RYJ A;  3PT2 B;  1EO6 A;  1CZP A;  3HIZ A;  4HLE A;  5DPT A;  2WNM A;  3M95 A;  2WLB A;  1N61 A;  1P1A A;  4B0E A;  4YTP B;  3LYY A;  2PE9 A;  3B1L X;  3TL5 A;  1GNU A;  1FXA A;  4BAX A;  1E8X A;  2TSS A;  3P4R B;  1WR1 A;  2K0P A;  5AUI A;  3BVZ A;  3P4Q B;  3ZNH B;  3Q8A A;  2L0T A;  1WZ3 A;  2PIA A;  4KIK B;  4C00 A;  3AXC A;  2AQ3 B;  1I7H A;  4RM8 A;  2WXP A;  2J7Q B;  3PLU A;  4GIV A;  1ZDV A;  3A9J B;  3ECI A;  4ZRQ A;  2KAN A;  4YSZ B;  4IOI E;  1YQ3 B;  4L23 A;  1R4N I;  2LAS A;  3VQI A;  4AS1 A;  1YN4 A;  3AM9 A;  1E90 A;  3W5V B;  3DBR B;  2ZEQ A;  3UIN B;  3IBE A;  3K9O B;  1IBX B;  2GBN A;  5D7G A;  1V1O A;  2XEW A;  2HJ1 A;  2FBW B;  3Q8F A;  1WRI A;  2XN9 C;  1UEL A;  5G55 A;  3U30 A;  3SHQ A;  4J3O D;  5T8I A;  1KLU D;  2NBW B;  2FE8 A;  2KTR A;  3PZ8 A;  3N3K B;  2L7R A;  2KAJ A;  2IYD B;  3O65 B;  2W82 A;  2PW9 A;  4RGM A;  1OGW A;  1M94 A;  1I4P A;  1F2R C;  3Q8B A;  2UWQ A;  4JPS A;  3RZF A;  3WAM A;  2RPQ A;  3RNE C;  3IT4 B;  1XO3 A;  2ACZ B;  4W9E A;  2R61 A;  2W3S A;  2JXT A;  5FR6 A;  1J19 A;  1QQR A;  4PS7 A;  4LLG M;  2LGX A;  4YTN B;  5AUK A;  3AE6 B;  1WF9 A;  5D2M B;  4O1N A;  2LRW A;  2K8C A;  3RD2 A;  4UDU C;  4ZRP A;  3IG3 A;  3AMZ A;  3NOB A;  3N32 A;  4MEM A;  1FPY A;  1FRR A;  3KWV A;  3RNG C;  2MHJ A;  4IWQ A;  3UI3 A;  2NS5 A;  4JE3 B;  3KUD B;  2CU3 A;  4NQL B;  2WXQ A;  4M01 A;  4EOY A;  2E3T A;  2JZP A;  5AZG A;  2KWD A;  1PGB A;  1EF1 A;  3AUL A;  4ICV A;  2FUG 1;  4URK A;  4JX1 C;  2M4N A;  2PTL A;  4P16 A;  2N9E B;  3A9K A;  2RR9 A;  2KQ4 X;  2IZV B;  3TBL D;  1WI0 A;  1J7B A;  3VRA B;  2MW5 A;  1R4N B;  3RT3 B;  1BML C;  3EHV A;  2K6D B;  3NY5 A;  4LNN A;  4LDT B;  2IO1 B;  1WRD B;  1F9J A;  3OJ4 B;  3VTW A;  1WJN A;  5EDS A;  3ZJU A;  1B1Z A;  1SJE D;  4OVV A;  1HEZ E;  3DHH C;  3TIX A;  4FJZ A;  1L4D B;  1SIJ A;  4BBN C;  5D94 A;  4KKJ A;  2ZNV B;  2LVP A;  1WGR A;  4KIK A;  2EMS A;  3VAW A;  2QC8 A;  4NAM A;  4OZA A;  2C60 A;  1AWD A;  1D5Z C;  3KUZ A;  1IGC A;  2N9P C;  2HDE A;  4DHJ D;  4N6E B;  4FHJ A;  3E9S A;  4USA A;  2K6Q A;  3A9J A;  2MEK A;  3GB1 A;  4K3B A;  5EE3 A;  2DHZ A;  4ANU A;  2QJL A;  2WDR B;  1I4Q A;  3P63 A;  2K1F A;  3VXW A;  2Y5C A;  1VLB A;  1JWA D;  2JYT A;  1N63 A;  1WGY A;  2LGI A;  3RFZ B;  1STE A;  2WWZ A;  2MLB A;  2GOW A;  2D3A A;  1IBX A;  2AL6 A;  3A33 B;  1TY0 A;  3TEX A;  5BYQ A;  1C78 A;  1R4M I;  4IM3 A;  3W1S C;  2WXF A;  3MC9 A;  1F77 A;  2BF8 B;  4WJP A;  2ZCC A;  4WIP A;  5G5H A;  4TSS A;  1UBQ A;  1FCC C;  1UBI A;  3ZJV A;  4ZYN A;  1SBB B;  2KK8 A;  4ZHP A;  2QEJ C;  3Q6B A;  4WUR A;  2KD0 A;  4NAW B;  5LLI A;  1WXA A;  2HTH A;  2KDI A;  3ZQ4 A;  2DWQ A;  4W9F A;  2C7H A;  3TJP A;  3TEW A;  3AEC B;  3O13 A;  1V8C A;  2HTM E;  4JWS C;  4II3 B;  2B3A A;  4FA6 A;  4NY0 A;  3NZU A;  1L0V B;  3B08 A;  5DPW A;  3VH3 B;  4BBN F;  1KRH A;  2K9X A;  1RWS A;  2MBO A;  5AZH A;  5MPO A;  3MJW A;  2FIF A;  4W9J A;  4IG7 B;  3ZUN A;  1OQY A;  2FID A;  2INC C;  2KQ7 A;  2R2Q A;  3VR9 B;  2FCQ A;  1BT0 A;  3AE8 B;  1SE2 A;  1YD8 U;  1J7C A;  1Q10 A;  2WX0 A;  3NG0 A;  1P7F A;  4TV3 A;  2YVC A;  1EWY C;  3AEE B;  2BW2 A;  5JHA A;  2NMQ A;  2MX2 A;  2O6V B;  2LI5 A;  2INP E;  3R7R A;  4B9K A;  3RZW C;  2G9H D;  1P9D U;  1JW9 D;  1JCK B;  2AL3 A;  1K52 A;  3ZNI D;  1TIF A;  1F0Z A;  4BKG A;  2Z8L A;  3GS2 A;  1WXS A;  3NRZ A;  4M0W B;  3QC8 B;  4MEL A;  4MDK E;  4S0R A;  3ZGZ A;  2ZPY A;  2LVO A;  3DHI C;  3A1Q B;  1YQ4 B;  4NJ7 A;  4DDG D;  1UWX A;  1FM0 D;  1R4M B;  2KMM A;  1V80 A;  2MBB B;  2Q5W D;  1T0Q C;  2W9N A;  3ZO5 B;  3J9C A;  1A5R A;  5D6J B;  3QQ8 B;  2D2Q A;  3MHS D;  3KVF B;  2L83 A;  2LHE A;  3NZS A;  3NJT A;  1UD7 A;  2KN5 A;  2YEP B;  2DZJ A;  3PRE A;  3U2S C;  2LMC A;  1VR9 A;  3EEC A;  5BMI A;  4ANX A;  2FNJ B;  1L5P A;  2K5P A;  2JY6 A;  1ZOY B;  4HRS A;  1Q0W B;  2N9X A;  4I6P A;  1ZW7 A;  3BZD B;  3AEF B;  3AN1 A;  4BZA A;  3NVY A;  4TKN A;  2WYQ A;  2RD0 A;  3U52 E;  5E6P A;  1QZE A;  5TSS A;  2JRH A;  2PVG C;  1SE4 A;  3KLS X;  1TTN A;  4LTU A;  3MC8 A;  4D2K A;  2BS4 B;  5IOI A;  1WE7 A;  2D10 A;  3WAN A;  3RNF C;  4F1S A;  2KN4 A;  4KZ0 A;  1SSN A;  3ZLZ A;  1V49 A;  4YTM B;  3Q3F A;  2LUM A;  4IUM B;  4NAW A;  2Y5B B;  2JF5 A;  4FHK A;  2AWT A;  4IW0 A;  5I4D A;  2ZVO A;  3BK2 A;  5BMG A;  2N0S B;  2JQR B;  5E6J A;  4PYZ A;  4DK5 A;  4GB9 A;  1LO5 D;  4S17 A;  1SE3 A;  2KTF A;  2AQ1 B;  1C4P A;  1TS4 A;  2L3Z A;  2GI9 A;  1HTQ A;  1L4Z B;  1GPX A;  1YQB A;  4WQO B;  4RFB A;  2A4Z A;  2BWE S;  3T8M A;  1JAL A;  1WE6 A;  2JRI B;  4NPN A;  3PSE B;  4FAD A;  5BYS A;  1JWB D;  5BMH A;  4G0N B;  4GMV A;  2Z0E B;  3UIP B;  3RPF C;  5DPS A;  4XDD A;  2WGS A;  2RDH A;  1VDV A;  1TT5 B;  4C80 A;  2GBM A;  1YN3 A;  3BVM A;  1ESF A;  2L00 B;  2O6V A;  2KFJ A;  2LEK A;  1WGD A;  3DHG C;  4M8N A;  1YX5 B;  2KT7 A;  5GXG B;  1UUP A;  1F2R I;  1XXG A;  1V97 A;  3RMK C;  4Q2J A;  1SEB D;  1VZ7 A;  3NHE B;  4M0W A;  1QOB A;  2RGF A;  2LVQ A;  3GP7 A;  2MWS B;  2MBH A;  2BBC A;  2BS2 B;  2LHD A;  1P98 A;  1AN8 A;  3A1Q A;  2YEP F;  3FAH A;  2EKE C;  3GE3 C;  3DBR I;  4MSQ B;  2K8B A;  1VJK A;  4PS3 A;  2MH7 A;  3X23 A;  5HKH A;  1EU4 A;  2K22 A;  2KC1 A;  1FEH A;  1WR6 E;  3DCG A;  1S1Q B;  4XX5 A;  3BIN A;  2Z0D B;  4FBJ B;  3P2B A;  5L83 A;  1SIF A;  2D3G A;  2QCZ A;  3UGB B;  2NCN A;  5H92 C;  2N1V A;  1CJE A;  3OJ3 A;  1ZP0 B;  2GRI A;  4B6W A;  4L1B A;  4RNA A;  2V4I B;  1L2N A;  1YIW A;  2MP2 A;  2KXJ A;  1YJI A;  1C1Y B;  2WHI A;  1YOV B;  2KFK B;  3DBH I;  4QAY A;  4TMA B;  2BPS A;  3M3J A;  2H89 B;  4DDI D;  1SB3 C;  2KZR A;  2JVC A;  2FUH B;  3B9J A;  5AEK B;  5AZF A;  4EKU A;  1NVI D;  2C5L C;  4CHK A;  2D11 A;  4TQ1 A;  1GG3 A;  4N59 A;  1SF0 A;  1L6U A;  4NNJ B;  2RDG A;  2QSD A;  4NZL B;  3KH0 A;  2ONQ A;  1N5X A;  3AED B;  4MSM B;  1BUI C;  2DYB A;  4JIO U;  4MGY E;  4R3D A;  1M4V A;  4P6V F;  3AU4 A;  3P1M A;  1ZXH A;  4WAF A;  3N1X C;  2JSV X;  4LCD E;  3N9Y C;  4NQK E;  2PPH A;  3R66 C;  4RMA A;  1WMH A;  4IDI A;  3GZN I;  3W2D A;  1UZX B;  4RM9 A;  2MQJ A;  1D5M C;  3ZNZ B;  1J0G A;  3TUO A;  1GC7 A;  2CJN A;  1F52 A;  4W9G A;  2DZK A;  5C1Z A;  2LGY A;  1V9J A;  2ZW0 A;  3M63 B;  3IHP C;  4AOF A;  2KWV B;  4CO7 A;  1UH6 A;  1YJJ A;  4MJS B;  4KDL B;  1QOA A;  1XT9 B;  1WIA A;  2LWP A;  4DHJ B;  4KVG B;  2VZK D;  3K9P B;  1TKE A;  3TEY A;  3Q3O C;  3JYU A;  4OW0 A;  4AWJ A;  4ZRK A;  2KLC A;  1TS3 A;  3IAM 1;  2DEN B;  2WX1 A;  2JYE A;  5CHF A;  2XK5 B;  2C9W B;  1E10 A;  3RUL A;  3DPD A;  2I1K A;  4FJV B;  3DBH B;  4PK1 A;  4M02 A;  2RSU A;  1FFU A;  1YX6 B;  2M56 B;  1VZ6 A;  1L0X B;  1N62 A;  4HDQ A;  3L0W B;  3ZDT A;  2W3R A;  1ZPS A;  3B2G A;  3NZ3 A;  4OVU A;  3L08 A;  4W9K A;  1GJZ A;  1E8W A;  2JWU A;  3VTV A;  2V9H A;  1OEY J;  1FO4 A;  1DGJ A;  4A8X C;  3APC A;  3HVZ A;  4FLH A;  2ZPN A;  3ZRC A;  2ZCB A;  1KOT A;  3VUY A;  1LM8 B;  2KOX A;  3GZN B;  3C8Y A;  2V3P A;  2NBU A;  1WWT A;  4XE0 A;  2BYF A;  4OZB A;  2KNB A;  3BVG A;  3BYY B;  1HXY D;  2FCS A;  2MCN B;  4A20 A;  1C76 A;  1RRB A;  2KFK A;  2IBI B;  2C7N B;  1HQR D;  3KUC B;  4II2 B;  1AAR A;  3WCQ A;  3RUI B;  4J6I A;  3URY A;  3Q3M C;  5IKC M;  1JRP A;  4IKG A;  1PUT A;  4K7U A;  2DYO A;  3V05 A;  5LXH A;  1WZ0 A;  4AJW A;  1WYW B;  3S2A A;  1T5X D;  1MJD A;  3RCZ A;  5IO9 A;  2BYV E;  4ZOH C;  2X8X X;  1L6V A;  4WJQ A;  1K8R B;  3ZXR A;  2CS4 A;  3DVG X;  3PVL A;  2EEL A;  1D3Z A;  2K8H A;  2NTT A;  4ICU A;  1C3T A;  2D3B A;  4OZC A;  5E6N A;  2KMC A;  3VH4 B;  3ZVV A;  3CF6 E;  1H4R A;  4PS8 A;  4BOZ B;  4HVB A;  4ASW C;  1QF6 A;  4A55 A;  4BFR A;  2JXX A;  2C7M B;  1XF5 L;  4N9F 4;  3ONS A;  1D4B A;  2JPH A;  2FCN A;  3NUH B;  3W5U B;  4G11 A;  3MTN B;  4A6Q A;  4A9A A;  4DWF A;  1HTO A;  1NDD A;  1J7A A;  3H7P B;  4RGT A;  4ZYS A;  2WDT B;  3H6N A;  4MJS A;  3L10 B;  3EUB 2;  1T3Q A;  2DBY A;  2KDB A;  2X38 A;  1IUE A;  2WXL A;  3Q3N C;  2DYM A;  3ZW3 A;  4XC2 A;  2GB1 A;  1UF0 A;  4BKS D;  1WXM A;  2KAC A;  1WXQ A;  3UF8 A;  1XQQ A;  4JQW C;  1WM3 A;  2J42 A;  4RF1 A;  5D3I B;  1MG8 A;  4LNF A;  3TCA A;  4C4V B;  1VD2 A;  3V6C B;  3CST A;  2GBR A;  1ZUD 2;  3JSV B;  4WWN A;  2XK5 A;  1KJT A;  2WDV B;  5JZE B;  4K1R B;  1I35 A;  4YSY B;  1FCL A;  3Q3J A;  5L95 C;  1Y56 A;  3DBL I;  3KQ4 A;  4BKT A;  1YNT E;  1E7P B;  2J0M A;  4WH4 A;  3RNA C;  4W9L A;  4ZRJ A;  2CKH B;  3RI7 C;  4WWO A;  3EA6 A;  3VVW B;  1FNW A;  2IGG A;  3BII D;  1FRD A;  4B95 A;  2V3S A;  4MAC A;  1JRO A;  2WXI A;  3NVW A;  2LGS A;  1LQB A;  4DBG A;  4KGS A;  1VCB A;  3C0R B;  4GSW A;  2CR5 A;  4N58 A;  2LZ6 A;  1T0R C;  4IM2 A;  2LXC A;  5IN7 A;  2DZI A;  1FIQ A;  4RGO S;  4GDL B;  4I6N B;  3BK1 A;  3N20 C;  2N9K A;  5J18 A;  2FCM A;  5FK9 C;  1FXI A;  3VDZ A;  1L7Y A;  3AH7 A;  3SD5 A;  1KH0 A;  2A5U A;  5FR3 A;  2WXM A;  1GC6 A;  3ZTC A;  1WFY A;  3MFG A;  2LXA A;  4EZK A;  1QLB B;  1FMA D;  1E8Y A;  3OAW A;  3VRB B;  1E5W A;  4K7S A;  2KMA A;  4W9H A;  1FNV A;  1PGA A;  4OHJ A;  5LNK 1;  4JGH B;  1TJE A;  4KKI A;  1XLQ A;  3ETR A;  5CHV C;  3W1S A;  2WDQ B;  2WXJ A;  1N6Z A;  3V61 A;  1WXV A;  1J8C A;  1I4R A;  3QX1 A;  4A90 A;  2KWC A;  5EE1 A;  4LNK A;  3I9V 1;  3QA8 A;  3D32 A;  2JX5 A;  3NVZ A;  1WJ4 A;  4P1C C;  1GUA B;  2REX A;  3PZ7 A;  3Q8E A;  3P4S B;  3HRD D;  3ALB A;  4BOS C;  4AJY B;  4GOC A;  3JVZ X;  4MT5 A;  4AQ7 A;  4WAA A;  1DYQ A;  2MBQ A;  1I4H A;  3DBL B;  2WU5 B;  4HEA 1;  5C3J B;  1BXT A;  3R7Q A;  3TEZ A;  3EFC A;  3BY4 B;  1QKZ A;  2BGF A;  1LGR A;  1IYF A;  4M8M A;  5EE0 A;  2DZM A;  2ZVN A;  3ABV B;  2AEH A;  1OFF A;  2N4F A;  1TBE A;  3H7P A;  4JLC A;  2KWU B;  3U4E G;  4WJO A;  3T9L A;  3X0W A;  4WWM A;  1NYR A;  3V62 A;  2N1W A;  1WGG A;  1ISN A;  5LXI B;  1TKY A;  3U7D A;  4E71 A;  3CMM B;  3OLM D;  1D6E C;  3U7Z A;  1SXT A;  4TUU A;  2J0J A;  3JSV A;  1RFK A;  3FIL B;  3SEB A;  3DVN U;  4YXD B;  1GAQ B;  3R8B A;  5IP4 D;  3AU5 A;  1JML A;  2ASQ A;  3I63 C;  4P7I A;  1Q1O A;  1UGM A;  1Y8R C;  3JW0 X;  2HD5 B;  4GU2 A;  1V5O A;  4HJG E;  4EE2 A;  4HXD A;  4ARI A;  3ZXV A;  3AE2 B;  5DPR A;  5HI1 A;  3VUW A;  3MJ5 A;  3ZDM C;  1HZ5 A;  3P42 A;  3DOW A;  3H9D A;  2K25 A;  4ITK A;  2RPV A;  1V2Y A;  2BB5 A;  3RN9 C;  3LB8 C;  1ACC A;  1N5W A;  1E7V A;  1YN5 A;  1QT9 A;  2WXG A;  4IWO A;  3R2I A;  2INN E;  2KC2 A;  4C7Y A;  2UU7 A;  3H1U A;  2DLB A;  3AE5 B;  3QHT A;  1V1P B;  3PO0 A;  1OEY A;  4GDL A;  4ARC A;  3TMP B;  2NBV B;  1E7U A;  3N1Z C;  2XNA C;  3AB5 A;  1ENF A;  4KDI C;  4KGT A;  2BTE A;  2NVU I;  1UNS A;  4EZL A;  4E74 A;  3FKY A;  1JWS D;  4XGA B;  4YT0 B;  3EGR A;  4XWW A;  1XD3 B;  3WAL A;  3P4P B;  2XBB C;  2JUO A;  3LDZ E;  3PRZ A;  3APF A;  3MHZ A;  3SU8 X;  3L4P A;  1K51 A;  3WAO A;  2VZK B;  4JL9 A;  1TZ1 A;  5J2R A;  1PGX A;  4GDK B;  2GMI C; 
#chains in the Genus database with same CATH homology
 4EZJ A;  2MP2 B;  2KD0 A;  4LJO B;  5BO4 B;  4ZDV A;  2BKR B;  4HK2 A;  4NAW B;  5LLI A;  1WXA A;  2HTH A;  4HDQ A;  3L0W B;  2KDI A;  2KO3 A;  4G3X B;  5CX3 A;  3ZDT A;  4W9F A;  2C7H A;  2V1Y A;  1IP9 A;  1WH3 A;  3VUX A;  2KDF B;  2CU1 A;  4OVU A;  3TJP A;  3L08 A;  4W9K A;  1GJZ A;  4G50 A;  1X1M A;  1E8W A;  3B0A A;  3VTV A;  1OEY J;  2VRR B;  3APC A;  3PZD A;  4II3 B;  2QHO A;  4FLH A;  2ZPN A;  2B3A A;  3ZRC A;  2ZCB A;  4EUT A;  4FA6 A;  4NY0 A;  2PJH A;  1KOT A;  3NZU A;  3B08 A;  3VFK A;  3VHT C;  3QIJ A;  3VUY A;  1KM7 A;  3VH3 B;  4BBN F;  5DPW A;  2IO2 B;  2O6V D;  2MBO A;  1LM8 B;  3PRP B;  5AZH A;  4CYE A;  3UQA A;  2KOX A;  3MJW A;  4F7Z A;  2FIF A;  2M8S A;  3PGE A;  4W9J A;  4IG7 B;  2NBU A;  4W9D A;  3ZUN A;  1OQY A;  2FID A;  2KQ7 A;  2R2Q A;  4YL8 A;  2CHW A;  2NPT B;  2BYF A;  2FCQ A;  2KNB A;  1KLV A;  3WAP A;  1BT0 A;  2FCS A;  2WX0 A;  2MCN B;  4A20 A;  4TV3 A;  1WMH B;  1RRB A;  2UYZ B;  2YVC A;  2KFK A;  2LD9 A;  3GOE A;  2KKC A;  5JHA A;  2IBI B;  1YJ1 A;  2MX2 A;  2C7N B;  2LGD A;  2O6V B;  1WJU A;  3KUC B;  2KDE B;  4ZRI A;  1RLF A;  4II2 B;  1AAR A;  2LI5 A;  4W9C A;  4TQ0 A;  3RUI B;  4J6I A;  3PPA A;  4FN2 A;  3R7R A;  2FAZ A;  3WA0 A;  2D07 B;  3DBS A;  4B9K A;  3RZW C;  4K7U A;  1LFD A;  2DYO A;  5JH5 C;  2KJ6 A;  5LXH A;  1WZ0 A;  4MGZ E;  1P9D U;  1LXD A;  4AJW A;  1WYW B;  2KLG A;  3S2A A;  2EMT A;  2PE6 B;  2AL3 A;  4E3C A;  3ZNI D;  3RCZ A;  3PHW B;  3PHX B;  4BKG A;  2BYV E;  1S3S G;  2YLM A;  4A3O A;  1WXS A;  2OOB B;  4WJQ A;  4M0W B;  1K8R B;  2CHX A;  3DDC B;  3QC8 B;  2KTR B;  4MEL A;  4MDK E;  3HK0 A;  2CS4 A;  2GBK A;  3DVG X;  2JZZ A;  2ZPY A;  3PVL A;  2LVO A;  1D3Z A;  2K8H A;  4KSK C;  1WGH A;  4GXB A;  2HJ8 A;  1WX7 A;  3A1Q B;  4GGQ A;  1FXT B;  4HPM B;  4NJ7 A;  2V4L A;  4ICU A;  4DDG D;  1C3T A;  3LJ3 A;  3DQV A;  4DHZ E;  2JZ3 B;  5IA7 A;  2J0K A;  4IC7 B;  1V80 A;  1E8Z A;  5E6N A;  3RYT A;  2KMC A;  2MBB B;  4GDK B;  1Q5W B;  1OTR B;  1NBF C;  2M1M A;  2MA9 B;  3CF6 E;  3VH4 B;  1H4R A;  2L76 A;  3L16 A;  2W9N A;  4DHZ B;  3ZO5 B;  3PV1 A;  4PS8 A;  5D6J B;  3APD A;  3QQ8 B;  4BOZ B;  4HVB A;  1A5R A;  4ASW C;  2D2Q A;  3MHS D;  4AUQ C;  3IFW B;  3KYC D;  3KVF B;  2BWF A;  1TGZ B;  2ZZP B;  4FUL A;  3ZKJ C;  2L0F A;  3NZS A;  1U4A A;  4BFR A;  2JXX A;  2C7M B;  4N9F 4;  3ONS A;  1UD7 A;  2KN5 A;  3ZNG C;  3ZRF A;  2DZJ A;  3NS8 A;  3PRE A;  3QAQ A;  2JPH A;  2FCN A;  2DAF A;  3EEC A;  4G11 A;  3V6E B;  4ANX A;  4WJN A;  3MTN B;  1SE9 A;  2BKF A;  1ZGU B;  2FNJ B;  4DWF A;  1NDD A;  4MH0 E;  3H7P B;  5TR5 A;  1JRU A;  1WX8 A;  2WDT B;  3H6N A;  3L10 B;  2JY6 A;  4MJS A;  1HE8 A;  1WX9 A;  2KDB A;  2M17 A;  3VTU A;  1Q0W B;  2N9X A;  4I6P A;  2DYM A;  3ZW3 A;  1P3Q U;  4XC2 A;  3R3M A;  2IO0 B;  1ZW7 A;  3KYD D;  4XZ4 A;  3ZTD A;  4BKS D;  1WXM A;  1WJ6 A;  3KW5 B;  2K39 A;  4TKN A;  2WYQ A;  2RD0 A;  3UQB A;  1P0R A;  2O2V A;  5E6P A;  4EEW A;  1QZE A;  3UF8 A;  2M0X A;  4BVU C;  1XQQ A;  3PLV A;  4JQW C;  1WM3 A;  1MG8 A;  4KV2 A;  5KHQ A;  1IPG A;  2JRH A;  4HCN B;  3SDL C;  3TCA A;  1ZKH A;  1RAX A;  1VD2 A;  4GN1 A;  4K7W A;  2CHZ A;  3A9K B;  3QK0 A;  4HCP B;  3V6C B;  3CST A;  2GBR A;  3JSV B;  4WWN A;  1TTN A;  2XK5 A;  1KJT A;  2IO3 B;  2KQS A;  3QAR A;  4HJK A;  5JZE B;  3EFU A;  4K1R B;  1I35 A;  3N30 A;  2N7E A;  3EC8 A;  1WE7 A;  2D10 A;  4ANV A;  3Q3J A;  5L95 C;  2ZJD A;  3WAN A;  5G2N A;  3AI5 A;  3DBL I;  3PT2 B;  4MGI E;  5CTR C;  3ZVV A;  1EUV B;  4BKT A;  1EO6 A;  4KZC A;  4F1S A;  4KZ0 A;  3ZLZ A;  2J0M A;  1V49 A;  4GDK A;  3HIZ A;  4HLE A;  2L8J A;  5DPT A;  3Q3F A;  4IUM B;  3M95 A;  4NAW A;  2Y5B B;  2JF5 A;  4W9L A;  4ZRJ A;  1P1A A;  2CKH B;  4FHK A;  2IY1 B;  4WWO A;  2AWT A;  4IW0 A;  3VVW B;  2ZVO A;  2PE9 A;  3CSF A;  3B1L X;  3PS6 A;  3U8Z A;  3PTF C;  4B95 A;  3TL5 A;  1GNU A;  4PYZ A;  4DK5 A;  2V3S A;  3ENE A;  1E8X A;  1WR1 A;  4GB9 A;  3M62 B;  2KX3 A;  5JHB A;  3ZNH B;  2MBE A;  2KTF A;  2L0T A;  1WZ3 A;  2L3Z A;  1LQB A;  5KHO A;  4AP4 C;  4DBG A;  2G4S A;  1VCB A;  1YQB A;  1V86 A;  3C0R B;  4GSW A;  4KIK B;  4ANW A;  2CR5 A;  4WQO B;  3AXC A;  2A4Z A;  4HWI B;  2BWE S;  3T8M A;  2LZ6 A;  4FJY A;  4IM2 A;  2LXC A;  1PQS A;  1WE6 A;  2JRI B;  4NPN A;  4RM8 A;  2DZI A;  2J7Q B;  3PLU A;  2JWZ A;  3PSE B;  4GDL B;  4GIV A;  4I6N B;  4FAD A;  3QWZ B;  3A9J B;  3ECI A;  2NPT A;  4G0N B;  4GMV A;  2Z0E B;  3UIP B;  5J18 A;  2FCM A;  2KAN A;  5DPS A;  4WWP A;  3VDZ A;  1L7Y A;  3SD5 A;  2GBM A;  2A5U A;  1R4N I;  2LAS A;  2NR2 A;  2L00 B;  2O6V A;  2KFJ A;  3VQI A;  2KVR A;  1GC6 A;  1WGD A;  4I6L B;  3ZTC A;  1WFY A;  4M8N A;  2LXA A;  4EZK A;  1E90 A;  3QJZ A;  1E8Y A;  1YX5 B;  3OAW A;  2ZEQ A;  4DXA B;  3UIN B;  1E5W A;  3IBE A;  4K7S A;  2KMA A;  4W9H A;  3K9O B;  2GBN A;  5D7G A;  2XEW A;  3NHE B;  4JGH B;  5CHV C;  3W1S A;  1UEL A;  3ML9 A;  5E6O A;  5G55 A;  4MGK E;  3U30 A;  1Z5S B;  3SHQ A;  3H7S A;  5J17 A;  2RGF A;  2NBW B;  3V61 A;  2LVQ A;  2KTR A;  4HPL B;  1WXV A;  4KSL C;  3N3K B;  2L7R A;  2MWS B;  3L13 A;  1J8C A;  2IYD B;  2MBH A;  3O65 B;  3QX1 A;  2G3Q B;  1OGW A;  2KWC A;  1M94 A;  1P98 A;  3DVG Y;  3L17 A;  1NI2 A;  2BYE A;  3QA8 A;  3A1Q A;  2UWQ A;  2L05 A;  3D32 A;  2EKE C;  2IY0 B;  3DBR I;  1WJ4 A;  4MSQ B;  3RZF A;  1GUA B;  2REX A;  3WAM A;  2RPQ A;  4K81 A;  2K8B A;  4W9I A;  4PS3 A;  3X23 A;  3ALB A;  4BOS C;  5DCN A;  4AJY B;  5HKH A;  4GOC A;  4MM3 A;  4W9E A;  2LRU A;  3JVZ X;  4WAA A;  2MBQ A;  5FR6 A;  2KC1 A;  1J19 A;  1WR6 E;  3DCG A;  1S1Q B;  4PS7 A;  2ZNV C;  3R7Q A;  2LGX A;  4XX5 A;  3BY4 B;  3UIO B;  1WF9 A;  2BGF A;  3BIN A;  5D2M B;  1IYF A;  2Z0D B;  4FBJ B;  4M8M A;  2DZM A;  2K8C A;  2LRW A;  3RD2 A;  3P2B A;  2ZVN A;  3IG3 A;  5L83 A;  3NOB A;  1SIF A;  2AEH A;  3N32 A;  2D3G A;  4MEM A;  3UGB B;  2N4F A;  1TBE A;  3H7P A;  4IWQ A;  2NCN A;  2LUE A;  2NS5 A;  2N1V A;  4JLC A;  2KWU B;  3KUD B;  3OJ3 A;  3DVN V;  4WJO A;  3T9L A;  3ZIM A;  4NQL B;  3X0W A;  4B6W A;  4X57 B;  3IVF A;  3V62 A;  1L2N A;  4EOY A;  1YIW A;  2MP2 A;  2N1W A;  1WGG A;  2KXJ A;  1C1Y B;  2JT4 B;  1Z2M A;  2KFK B;  3DBH I;  4PYU A;  5AZG A;  1ISN A;  1EF1 A;  3AUL A;  4ICV A;  5IAA C;  5LXI B;  2BPS A;  3U7D A;  3M3J A;  4E71 A;  4DDI D;  4URK A;  3CMM B;  2KZR A;  3OLM D;  2JVC A;  2M4N A;  2FUH B;  1V5T A;  2N9E B;  3A9K A;  2RR9 A;  4LDT D;  5AZF A;  4TUU A;  2J0J A;  4EKU A;  5AEK B;  2C5L C;  3JSV A;  2IZV B;  3TBL D;  3DVN U;  4CHK A;  2D11 A;  4TQ1 A;  1GG3 A;  4NJ6 A;  1WI0 A;  4NNJ B;  4BKS A;  5C23 A;  3AU5 A;  2MW5 A;  5CHW A;  2ASQ A;  4P7I A;  1Q1O A;  2DAJ A;  2DX5 B;  3KH0 A;  3RT3 B;  3EHV A;  1SGH A;  1UGM A;  1Y8R C;  4IWP A;  3JW0 X;  2HD5 B;  2K6D B;  3NY5 A;  4MSM B;  4LJP B;  4GU2 A;  2DYB A;  4JIO U;  1V5O A;  4HXD A;  4LDT B;  5DPR A;  4MGY E;  2IO1 B;  1WRD B;  3L54 A;  3VUW A;  3ZDM C;  2R2O A;  1F9J A;  3AU4 A;  3OJ4 B;  3VTW A;  3DOW A;  3H9D A;  4LCD E;  3HM6 X;  2K25 A;  1WJN A;  1V2Y A;  2PEA A;  2Z59 B;  4NQK E;  2PPH A;  3R66 C;  5EDS A;  1T0Y A;  1WMH A;  4RMA A;  1E7V A;  4OVV A;  3GZN I;  1V6E A;  2G4D B;  4IM0 A;  3PRM B;  4A3P A;  3I3T B;  4IWO A;  1UZX B;  4RM9 A;  3TIX A;  2MQJ A;  4FJZ A;  2I1J A;  3V60 A;  3ZNZ B;  1J0G A;  2KJH B;  1GC7 A;  4BBN C;  5D94 A;  2AYO B;  2KC2 A;  1RFA A;  1WGR A;  2LVP A;  2EMS A;  2ZNV B;  4KIK A;  2DZK A;  4W9G A;  3VAW A;  3WIM A;  2N7D A;  3H1U A;  2C60 A;  5C1Z A;  3KUZ A;  2LGY A;  3W1Y A;  2MSE D;  2N9P C;  3QHT A;  1V9J A;  3A4S C;  4DHJ D;  4FHJ A;  1OEY A;  3M63 B;  2K6Q A;  4GDL A;  3IHP C;  3A9J A;  3ML8 A;  2KWV B;  4AOF A;  4CO7 A;  1H8C A;  3TMP B;  2NBV B;  2DHZ A;  1UH6 A;  1E7U A;  1V81 A;  4ANU A;  4MJS B;  3VXW A;  2K1F A;  4KDL B;  1XT9 B;  4KDI C;  3HM3 A;  1WGY A;  1WIA A;  2LWP A;  4DHJ B;  2NVU I;  4KVG B;  3K9P B;  1WM2 A;  4EZL A;  4E74 A;  2O2V B;  3JYU A;  2WWZ A;  2OJR A;  2MLB A;  1EF5 A;  2GOW A;  2MRP A;  1WY8 A;  4AWJ A;  4ZRK A;  1XD3 B;  3WAL A;  2KLC A;  2XBB C;  2JUO A;  3LDZ E;  3PRZ A;  1CMX B;  2DEN B;  3APF A;  4EFO A;  2AL6 A;  2WX1 A;  3SU8 X;  3A33 B;  4HDO A;  2GBJ A;  2KJR A;  2HE7 A;  2XK5 B;  5CHF A;  2C9W B;  2G45 B;  3RUL A;  4F8C B;  1R4M I;  4IM3 A;  3W1S C;  3DPD A;  2I1K A;  4FJV B;  2KHW B;  3A4R A;  5GMV A;  3WAO A;  2KX0 A;  4JL9 A;  1TZ1 A;  5J2R A;  2BF8 B;  2LJ5 A;  4WJP A;  2ZCC A;  1UBQ A;  2RSU A;  1UBI A;  1YX6 B;  3QCA A;  1I42 A;  4ZYN A;  2KK8 A;  1G6J A;  1YD8 U;  2GMI C;  3HHM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...