1SE9A

Structure of at3g01050, a ubiquitin-fold protein from arabidopsis thaliana
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
101
structure length
101
Chain Sequence
EAEVHNQLEIKFRLTDGSDIGPKAFPDATTVSALKETVISEWPREKENGPKTVKEVKLISAGKVLENSKTVKDYRSPVSNLAGAVTTMHVIIQAPVTEKEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Plant protein
molecule keywords ubiquitin family
publication title Cell-free protein production and labeling protocol for NMR-based structural proteomics.
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 21
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2004-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13881 Rad60-SLD_2 Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1se9A00
2JY6A 2NBVB 1L7YA 2LI5A 2REXA 2DYOA 4AWJA 4TV3A 4B6WA 2BWFA 1OQYA 4CHKA 1EF5A 2DZMA 2KTFA 5DPTA 4HCNB 3DBLI 3H6NA 2KLCA 3TJPA 2FIDA 3DDCB 2FNJB 3PV1A 2OOBB 1WIAA 3AI5A 1YX5B 1OTRB 2KXJA 1UBIA 2UYZB 5DCNA 2MX2A 2L8JA 2MBOA 2R2OA 3NOBA 4CYEA 4KSKC 1WXAA 4HJKA 4JIOU 3Q3FA 4LCDE 3UQAA 1A5RA 2LRUA 4TUUA 4KZ0A 4DBGA 1TTNA 1XQQA 3A9JB 4HDQA 2KK8A 5D94A 1GNUA 2KX0A 3UGBB 2MP2A 4IWQA 4NJ6A 1P3QU 3PLVA 3X23A 3JW0X 2LASA 3Q3JA 2M0XA 2FUHB 4E3CA 5IA7A 4MELA 4TKNA 4FN2A 1U4AA 2C7NB 1SIFA 4DDID 3OAWA 2MCNB 2FCSA 2MW5A 1VCBA 4K1RB 3APDA 4HVBA 4GB9A 4W9GA 3V6EB 2FCQA 2MP2B 1F9JA 4XZ4A 1G6JA 1WI0A 3NY5A 2KOXA 4IWOA 1GC7A 4I6PA 2FCMA 1WJ6A 1IYFA 3WAPA 2M4NA 2G45B 3M63B 3DPDA 2NBUA 3RD2A 2LZ6A 4MGKE 2RGFA 3H7SA 1LFDA 3SU8X 4MSMB 3DVGX 1TZ1A 2JZZA 2MBBB 3DVGY 3T9LA 3CF6E 2KLGA 1V80A 3DVNV 4FJYA 2WWZA 4GDKA 4BOSC 2DYMA 5KHQA 4BKSA 2C5LC 1WX8A 2DZJA 3LDZE 2JRIB 2JVCA 2YVCA 3UIPB 3RULA 4JQWC 4MDKE 1YIWA 3QHTA 1KM7A 3R3MA 2YLMA 4KDLB 2RSUA 2WYQA 3PRPB 1IP9A 4DHJB 2OJRA 3B1LX 2ZJDA 4LDTD 1WX7A 4IUMB 3SHQA 2LUEA 2GBKA 2BWES 2NCNA 3NHEB 2O2VA 4GDKB 3QJZA 3WAOA 4MGIE 4WJOA 3ZO5B 4AJYB 2CHZA 5L83A 3ZNHB 1E8ZA 3RZWC 3IBEA 4P7IA 4EFOA 3BY4B 2K6DB 5JHAA 1ISNA 1LQBA 5CTRC 4DXAB 4K7WA 2D3GA 4G0NB 2EKEC 4DHZE 4NAWA 4ZRJA 4GGQA 4IW0A 2KX3A 1E7VA 3QC8B 2V1YA 1V86A 5AEKB 1RAXA 1D3ZA 5E6PA 4PS3A 3P2BA 4KIKA 4TQ1A 4CO7A 4X57B 4W9EA 2D07B 2V3SA 2LVPA 4IM0A 4WQOB 1V9JA 4F1SA 1LXDA 3TIXA 2NPTA 3RCZA 1RFAA 3VXWA 2MSED 1KOTA 3PRMB 2C9WB 4NAWB 3X0WA 2VRRB 1L2NA 3H9DA 1T0YA 3U30A 2IYDB 2L0FA 2PE9A 4FADA 1RRBA 2K6QA 4GN1A 4KIKB 2LD9A 2AEHA 4W9IA 2JRHA 1JRUA 2BKRB 1J8CA 2ZZPB 3KUZA 2EMSA 2KC1A 2ZEQA 1X1MA 3N32A 1E8WA 3ZDTA 2JPHA 4HDOA 4IM2A 4ZRIA 4LJPB 4EKUA 2NPTB 3BINA 3ONSA 2N4FA 2L0TA 2IO1B 1UZXB 2CU1A 3VUWA 1Q0WB 3QWZB 2N9XA 1S3SG 2KDFB 3EECA 3N3KB 2RPQA 1LM8B 1V2YA 2KWUB 2M17A 4W9DA 1XD3B 3V6CB 3A9JA 2N1VA 5C23A 3WIMA 2CS4A 5GMVA 2MBEA 5KHOA 3M95A 2UWQA 3V62A 2AYOB 3VVWB 1E90A 3L10B 2JT4B 4B9KA 1WXSA 1HE8A 2D10A 4PYZA 3UQBA 3HHMA 5E6OA 2N7DA 2KQSA 2BF8B 4EZJA 2KWVB 3TBLD 5EDSA 5L95C 3KH0A 3A33B 2LRWA 2GBNA 1WR1A 3QX1A 4ICVA 4JGHB 4RM9A 2DHZA 2K8HA 5D2MB 3U8ZA 3ZDMC 4BBNF 2GBJA 2AL6A 2ZPYA 4NJ7A 5D6JB 3QARA 4MEMA 3RYTA 1NBFC 1NDDA 3L54A 4AUQC 3V60A 3GOEA 2KJ6A 2KMAA 3L0WB 3PTFC 5IAAC 3VTVA 4E74A 2MA9B 2JXXA 5G55A 2FIFA 2NVUI 4FJVB 2DENB 2IO2B 5JH5C 3LJ3A 4XX5A 5C1ZA 2MLBA 1E8YA 2GBRA 5CHVC 2HTHA 2KFKA 3KW5B 1WX9A 3K9PB 4F8CB 2Z0DB 3DQVA 3ECIA 4KDIC 1WM3A 4BKGA 1RLFA 3I3TB 4W9FA 5FR6A 1UGMA 2PEAA 2JZ3B 3L13A 2DX5B 3KUCB 3DOWA 1WGHA 2KKCA 2M1MA 1H4RA 2V4LA 2JWZA 4IG7B 4GOCA 4M8MA 1R4NI 1Q1OA 3ZW3A 4ICUA 3VTUA 2KANA 1WE6A 3PRZA 3KYCD 2KFKB 2D2QA 4FJZA 2KO3A 4WJPA 3VUYA 3VDZA 2J7QB 1UELA 3IFWB 4IM3A 4WWNA 2KQ7A 2CHXA 1I35A 1XT9B 2K1FA 4FA6A 4EZKA 5J18A 2PE6B 4FHKA 5DPWA 1WXMA 3R7RA 3GZNI 4ZRKA 1V6EA 3K9OB 2KN5A 4HXDA 3QCAA 1Q5WB 2CR5A 2KDEB 2D11A 3ML9A 3UF8A 4W9JA 2KTRA 4LDTB 3ZVVA 2MBQA 4ANWA 2L76A 1EUVB 2EMTA 3EC8A 3ZTDA 3VQIA 1TBEA 1WXVA 4GDLA 2G4SA 4KZCA 2GMIC 2MRPA 3ZRFA 2KC2A 3IG3A 4HCPB 4MJSB 2PPHA 4FBJB 5HKHA 2Z0EB 1M94A 2NBWB 2O6VD 3RUIB 2GOWA 3ZLZA 1EO6A 4N9F4 3MTNB 2KTRB 4K81A 4IWPA 3PSEB 5LLIA 3VTWA 4HLEA 1C1YB 3A4SC 3U7DA 3AU5A 2B3AA 2LXCA 3PHWB 1QZEA 3IVFA 3MHSD 4GDLB 2M8SA 1WE7A 2K8BA 4A20A 3QA8A 2NR2A 2K25A 4ASWC 2L7RA 4EUTA 1WZ3A 1YX6B 4FLHA 3HM3A 2AWTA 3W1SC 4EZLA 4XC2A 3WALA 2I1JA 3DVNU 4I6NB 4K7SA 4W9CA 4AP4C 4DWFA 1GG3A 3H7PA 5J17A 1V49A 4DDGD 4WJQA 1J19A 3CMMB 1VD2A 2IY0B 4BKSD 3R7QA 2J0KA 2IY1B 4YL8A 4B95A 2HD5B 2BYFA 2I1KA 4G50A 2LGYA 2ZNVC 3PPAA 5D7GA 4WWOA 3HIZA 3L17A 3DCGA 3WAMA 3H7PB 2DZIA 2J0JA 3KUDB 2JUOA 3ZIMA 4AOFA 3PHXB 2BYVE 1UD7A 4W9HA 3QQ8B 4BBNC 2K39A 1WJ4A 1WMHA 4M0WB 3TCAA 1WYWB 3A1QA 2G4DB 4ZDVA 1C3TA 1P0RA 3R66C 5JZEB 3H1UA 2Z59B 1PQSA 3VH4B 3W1YA 2ZNVB 2LJ5A 2ZCBA 4BFRA 4NQLB 1Z5SB 1NI2A 3EHVA 4HPLB 4K7UA 2LWPA 2PJHA 1WMHB 2HE7A 3A1QB 1WGYA 2RD0A 4ANVA 3A9KB 5AZGA 2N7EA 4HWIB 3N30A 4LJOB 1GUAB 4AJWA 2L05A 4W9KA 5CHFA 3M62B 4KSLC 2KWCA 3ZRCA 1YJ1A 4PYUA 3QAQA 4ANUA 3PT2B 2XK5B 4GSWA 1S1QB 1TGZB 4ANXA 3PZDA 2BKFA 3B0AA 3NS8A 3WA0A 2LVOA 5DPRA 1V81A 2DAJA 3OJ4B 3C0RB 4G11A 1I42A 2C7HA 4NQKE 3T8MA 3APFA 3CSTA 1E8XA 4FULA 3IHPC 1IPGA 3MJWA 3OJ3A 1OGWA 2C60A 5DPSA 3ZTCA 2KDIA 2O6VA 2DAFA 4HK2A 3AU4A 3JYUA 2ZVNA 4KVGB 3SD5A 3AULA 1K8RB 1KJTA 2LGDA 4MJSA 2K8CA 2G3QB 4GXBA 1WGDA 2R2QA 2QHOA 5LXHA 2Y5BB 4OVVA 2IBIB 2FAZA 3M3JA 2NS5A 4DHZB 2N9PC 3PVLA 2BGFA 3RT3B 2O6VB 2A5UA 1ZW7A 2KVRA 3ZKJC 5CX3A 1Y8RC 3APCA 3PS6A 1YQBA 2KMCA 1ZKHA 2WX0A 2ZPNA 3ML8A 4JLCA 3EFUA 2IO3B 3OLMD 1WH3A 2A4ZA 2MWSB 1AARA 2XEWA 3PREA 4BOZB 4MM3A 1R4MI 1Z2MA 1V5OA 3AXCA 3PGEA 4II3B 4G3XB 4GMVA 4MGYE 3JVZX 2FCNA 2AL3A 4OVUA 4HPMB 1WJNA 2LGXA 2WX1A 4MH0E 1E7UA 2WDTB 4PS8A 4II2B 4KV2A 3KYDD 3NZUA 1UBQA 3UIOB 2GBMA 3JSVA 5E6NA 3VHTC 2J0MA 1OEYA 1EF1A 3B08A 4BKTA 3S2AA 2N9EB 1WR6E 1YD8U 4WJNA 3DBSA 2MQJA 3QIJA 4WAAA 2KNBA 1FXTB 3HK0A 3VUXA 3ZNZB 1P98A 2ZCCA 1WFYA 4MSQB 3W1SA 2KJRA 4W9LA 2BYEA 2MBHA 2CHWA 1H8CA 5G2NA 1V5TA 1SGHA 2RR9A 2ZVOA 2LXAA 3ENEA 4RMAA 3L16A 1WM2A 3JSVB 4DHJD 2KJHB 3V61A 2KZRA 2W9NA 1P1AA 2HJ8A 1P9DU 2L00B 4GU2A 4J6IA 4DK5A 2IO0B 2L3ZA 4ZYNA 2JF5A 1WJUA 3NZSA 2XBBC 4EEWA 1GC6A 4EOYA 5AZHA 1WZ0A 2IZVB 3D32A 2O2VB 5AZFA 4TQ0A 4NPNA 4I6LB 2KDBA 2DZKA 4MGZE 5J2RA 4M8NA 4A3OA 3SDLC 3A4RA 2KD0A 3VAWA 3VFKA 3O65B 3ZUNA 1UH6A 4JL9A 3ZNGC 5TR5A 2DYBA 4E71A 4WWPA 2KFJA 1SE9A 5CHWA 1GJZA 2KHWB 1MG8A 2BPSA 3TMPB 3WANA 4F7ZA 3DBHI 1BT0A 4URKA 5LXIB 3QK0A 3DBRI 3KVFB 3A9KA 3TL5A 4GIVA 1WGRA 3RZFA 2C7MB 1OEYJ 4NNJB 3HM6X 1WRDB 3ZNID 3PLUA 4FHJA 4RM8A 3VH3B 4A3PA 1J0GA 1KLVA 1WY8A 4PS7A 4NY0A 3CSFA 2XK5A 5JHBA 3L08A 1ZGUB 4BVUC 1CMXB 1E5WA 2CKHB 3UINB 2LVQA 4IC7B 3ALBA 2N1WA 5BO4B 1WGGA 1WF9A 2ASQA
chains in the Genus database with same CATH superfamily
2LI5A 4YXDB 2PVGC 2REXA 3BVGA 4B6WA 1OQYA 3U7ZA 1AYFA 2KTFA 5DPTA 2KLCA 2FIDA 1EWYC 5BYSA 1WIAA 3AI5A 1YX5B 2MX2A 3UQAA 1WXAA 4JIOU 3Q3FA 4LCDE 2LMCA 4ARIA 4RNAA 1XF5L 1TTNA 3A9JB 4HDQA 1VJKA 4FXCA 4IWQA 3PLVA 5TSSA 2LASA 3RNGC 3Q3JA 4E3CA 3ZJVA 4FN2A 1U4AA 4ZYSA 2C7NB 3I9V1 3NVYA 1AN8A 5FK9C 3TEWA 4GB9A 2FCQA 2M0AA 4IWOA 1I4XA 2KOXA 3KWLA 2N7JA 4I6PA 2AX5A 3AH7A 3AE9B 2LUMA 1TZOA 3M63B 2KMMA 3VR9B 3RD2A 1T3QA 4B0EA 1QOFA 1F2RI 2MBBB 3CF6E 1V80A 4FJYA 4DXGA 4GDKA 1XXGA 4LNKA 2Q5WD 4BKSA 2JYTA 2AQ3B 2JRIB 3UIPB 1IGDA 1IGCA 1YIWA 1M4VA 2INNE 2WLBA 2RSUA 1N61A 1IP9A 3B1LX 1BMLC 2BS3B 2LUEA 3WAOA 4GDKB 4AJYB 4MGIE 4LNOA 2IPKD 2VZKD 4WURA 2K6DB 5JHAA 1LQBA 2EKEC 4C56C 4HPPA 3NUHB 1E7VA 1V86A 5E6PA 2UU7A 3P2BA 4PS3A 4X57B 1WWTA 2D07B 2V3SA 4NJCA 3RN9C 2DLBA 3N1ZC 1JRPA 4F1SA 2MSED 2C9WB 3N9YC 3U30A 1B1ZA 2PE9A 4FADA 2LD9A 1MFWA 4W9IA 1C77A 2JRHA 1J8CA 5FR3A 3KUZA 5HFYA 2ZEQA 4HDOA 4ZRIA 2H89B 4EKUA 1ROEA 2IO1B 2CU1A 3QWZB 1S3SG 2KDFB 4KX6B 2RPQA 1LM8B 2KWUB 4W9DA 1QLBB 5IOIA 2N1VA 5C23A 3WIMA 2CS4A 4C00A 3M95A 2UWQA 2AYOB 4JWSC 2WDQB 4EZJA 4JGHB 4ICVA 4URKA 5D2MB 4BBNF 3RYTA 4MEMA 5D3DA 3L54A 1C4PA 1HTOA 2KJ6A 3BWUD 2KMAA 4E74A 2V3NA 4FJVB 3I63C 2MLBA 5CHVC 2HTHA 1AWDA 1WX9A 4F8CB 1WM3A 1TKGA 4LK0M 1EU3A 2J52A 2WXLA 4OZAA 4W9FA 5FR6A 3P4PB 4NAMA 3AM9A 4P1BC 3B2GA 1QOBA 2V4LA 4M8MA 4GOCA 1C78A 3PRZA 4WJPA 2WXJA 2CHXA 1EM7A 2PE6B 3AE3B 1WXMA 4ZRKA 4HXDA 2CR5A 3V3XA 4UDUC 3ML9A 3UF8A 4C7YA 3ZVVA 2K9XA 2EMTA 1WXVA 3VRBB 4XWTA 3ZRFA 4HCPB 4MJSB 2SEBD 5HKHA 2LFIA 3ZLZA 1EO6A 1L0YB 3MTNB 2M56B 2WNMA 1C1YB 1VLBA 3AU5A 2B3AA 4ASWC 1YX6B 3DBRB 3N1XC 3HM3A 3DHIC 4MM3B 1ET9A 1MPEA 3NG0A 5EE0A 4N59A 1UWXA 1J19A 1VD2A 4A90A 4BKSD 2IY1B 2ZW0A 1LGRA 4YSXB 2HD5B 2LGYA 4US9A 5JXVA 3L17A 3WAMA 1D5XC 4AOFA 1TIFA 3QQ8B 1Q10A 3TCAA 1UWMA 2G4DB 4ZDVA 3B9JA 1P0RA 2Z59B 1LO5D 1Z5SB 1FIQA 3AE7B 4XGAB 3TEYA 2W3RA 4K7UA 2PJHA 1WSPA 2RD0A 3AE6B 2CU3A 5AZGA 3N30A 4W9KA 3M62B 3QAQA 3WCQA 2XK5B 3NRZA 3WA0A 2BBCA 3N20C 3ZQ4A 1V81A 2DAJA 2GB1A 2KAJA 4G11A 4C7ZA 2LHDA 3BYYB 1I42A 2C7HA 1I7HA 3APFA 3CSTA 1OQQA 4FULA 5DPSA 3ZTCA 1FRDA 2WDRB 3H8HA 3AU4A 4KVGB 1J7CA 3MC8A 1K8RB 1KJTA 2LGDA 4KGRA 1RFKA 2H88B 4GXBA 2WHIA 2R2QA 3HUIA 2Y5BB 4OVVA 2IBIB 2FAZA 1TY2A 4OHJA 4LTUA 3RMKC 3RT3B 2DBYA 2KVRA 3RNEC 3ZKJC 4XDDA 1YQ3B 4KGSA 1E0ZA 4JLCA 3EFUA 1JWSD 2EKIA 1WH3A 1AW7A 4JX1C 4G3XB 1PGXA 1FEHA 3C8YA 2AL3A 4OVUA 1Y56A 3NZUA 3B08A 2YEPB 1WR6E 1YD8U 4WJNA 2MHJA 3BVMA 4MSQB 2BYEA 2CHWA 1V5TA 1YQ4B 2PLPA 3IT6B 4RMAA 2INDC 3EFCA 4DHJD 3V61A 1T0QC 2L00B 1MVKA 2L3ZA 3B2FA 3NZSA 1WJUA 2RDHA 1GC6A 2I2YA 4AS1A 1EU4A 4I6LB 2TSSA 1FCCC 3ZUNA 2QIEB 4E71A 1DYQA 2KFJA 2NMQA 5CHWA 1GJZA 2KDMA 1MG8A 1EWCA 1YN4A 3Q6BA 1BT0A 2W54A 3DBRI 3TL5A 5T8IA 3ZNID 3R2IA 4FHJA 4REZA 4A3PA 4S17A 1XEEA 2WGSA 4NY0A 1ZGUB 4BVUC 1CMXB 2LVQA 1WGGA 3AEGB 2HTME 1IBXA 1N62A 4US8A 3TJPA 2NTTA 1YNTE 4KGTA 5AUIA 3RNAC 1GOZA 3PV1A 2ICIA 5DCNA 2J4XA 3W5VB 2R2OA 1P7EA 4HJKA 2LRUA 1QKZA 4TUUA 3VR8B 5D94A 2ONQA 4PT5A 4NJ6A 3X23A 1T0SC 2M0XA 1QQRA 1VZ8A 3TUOA 5IA7A 2FBWB 4MELA 1FXAA 1SIFA 3FAHA 2MCNB 3APDA 4W9GA 1JWUD 1CQVA 1XCQL 3NJTA 4XZ4A 2WU2B 1G6JA 1IYFA 3WAPA 2M4NA 2G45B 3RPFC 3DPDA 2PW9A 2MEKA 1SF0A 4BOSC 3O13A 2DZJA 1HEZE 2JVCA 2YVCA 3RULA 4JQWC 3QHTA 5AUKA 3R3MA 2YLMA 2WXNA 4LNNA 4LDTD 4OZCA 4M02A 2BWES 2JQRB 2O2VA 5L83A 2IGDA 3ZNHB 1E8ZA 3FILA 3IBEA 1ISNA 2BVCA 3AE4B 4NAWA 4IW0A 4IDIA 1SE3A 2KVZA 2J42A 3GB1A 1ZDXA 2QDFA 4WQOB 2FUG1 1V9JA 3TIXA 3IT4B 2NPTA 1F1HA 4NAWB 2VRRB 1L2NA 2GLSA 4GN1A 1L6UA 2KC1A 1X1MA 3N32A 4IM2A 3N1YC 2NPTB 3ONSA 2N4FA 1SE4A 3P63A 3EECA 2M17A 1XD3B 4Q2JA 3A9JA 1L5PA 3VVWB 2MBEA 1ZOYB 2L52A 2BB6A 3TBLD 2GBNA 3ZDMC 2K8HA 2W3SA 2AL6A 4BAXA 2WXFA 2MJEA 2ZPYA 3QARA 1NBFC 4AUQC 1V1OA 3L0WB 3PTFC 3VTVA 2NVUI 3LJ3A 5C1ZA 1E8YA 2L1AA 3KW5B 3ECIA 1WGKA 4KDIC 4BKGA 1RLFA 3I3TB 2PEAA 2JZ3B 2DX5B 1WGHA 2QCZA 4NZLB 2KKCA 2JWZA 1DOIA 3VUYA 2J7QB 1UELA 2GI9A 3IFWB 4IM3A 4WWNA 2K1FA 4LNIA 4FA6A 5J18A 4FHKA 5DPWA 3R7RA 1P7FA 3K9OB 1Q5WB 2KDEB 4W9JA 2KTRA 1EUVB 3ZTDA 1TY0A 1ZP0B 4GDLA 4KZCA 2V9HA 3EUB2 2PPHA 4C4VA 2O6VD 3U52E 2KTRB 1TS4A 4WWMA 4IWPA 1MI0A 5HHDG 3A4SC 3U7DA 4RH6A 1XLOA 4GDLB 3IVFA 2M8SA 1FRRA 2ZW1A 4YWGG 4A20A 2NR2A 4C4VB 1JWAD 1SBBB 2AQ2B 4FLHA 3WALA 2SAKA 4AP4C 4ACFA 1F77A 3NZ3A 1UNSA 3PZ7A 2IY0B 1WRIA 2J0KA 4KKJA 3KQ4A 2IGGA 4M0WA 1SIJA 1FMAD 1E10A 3DBLB 3PPAA 5D7GA 3LB8C 1TKYA 1UGJA 1ET6A 1ZE3D 3DCGA 2DZIA 2J0JA 3KUDB 2IDYA 3ZIMA 2BYVE 1UD7A 4C80A 2K39A 1WMHA 1SJED 4M0WB 1WYWB 3UI3A 3BIID 1R7SA 3VH4B 2V3PA 2LJ5A 4NQLB 1JQ4A 1WMHB 2W55A 2EELA 3A9KB 1XLQA 1DOXA 1R4NB 2MJDA 1C4CA 2WDVB 4AJWA 3AN1A 5CHFA 1HTQA 4KSLC 4WAFA 2KWCA 4WIPA 1FCLA 3PT2B 1RWSA 1S1QB 1TGZB 4ANXA 3PZDA 3B0AA 1FFVA 1ZDVA 5C2TB 1MG4A 1JCKB 2PTLA 2K0PA 3OJ4B 3C0RB 2VH1A 3AMZA 2LGSA 3T8MA 3MJWA 3OJ3A 1OGWA 3LYYA 2KDIA 3MC0B 3JYUA 3AULA 2JSVX 4MJSA 2K8CA 3NVZA 3AECB 2ACZB 2A5UA 4ZOHC 2Y5CA 5CX3A 1Y8RC 1MHHE 3APCA 4RGOS 4HKQA 1SSNA 1YQBA 2KMCA 1ZKHA 2WX0A 3HRDD 2IO3B 2X38A 2QEJC 2MWSB 3PREA 4MM3A 1Z2MA 4GMVA 4WH4A 2FCNA 2LGXA 2WX1A 4II2B 4KV2A 3KYDD 3JSVA 5E6NA 1CK1A 1OEYA 3S2AA 1K52A 2R61A 2BTEA 2MH7A 3BK1A 3HK0A 4XE0A 3ZNZB 1WFYA 5IKCM 4P16A 2RR9A 2Y3AA 3JSVB 3SFDB 2KZRA 1P1AA 1P9DU 4ZYNA 1C76A 1GPXA 2AQ1B 2D3AA 3IAS1 5J2RA 5BYRA 4M8NA 3SDLC 3VFKA 2DWQA 1JWMD 4HEA1 2KHWB 2JYEA 1BXTA 3WANA 3GP7A 1WGRA 3HM6X 1WRDB 3PLUA 1WY8A 4PS7A 5H92C 1E7PB 1WYGA 2XK5A 4ZRQA 5JHBA 3L08A 1E5WA 4IC7B 4YT0B 3MFGA 4GLSC 1I4RA 1I4PA 1A70A 3AB5A 1L7YA 1L0XB 2KYWA 2BWFA 4CHKA 1EF5A 1D5ZC 3DBLI 1FFUA 3H6NA 3DDCB 1D6EC 2OOBB 3MJ5A 1OTRB 2UYZB 2L8JA 3NOBA 4KSKC 1A5RA 4DBGA 1FD6A 1B9RA 2KK8A 2WXQA 3UGBB 2CJOA 2MP2A 3PZ8A 3JW0X 2FUHB 1PFDA 4TKNA 4L1BA 2DNFA 5LNK1 2FCSA 2MW5A 1QOGA 3FKYA 4K1RB 4HVBA 3MC9A 4HROA 1ZPSA 1WXQA 2MP2B 1WI0A 1GC7A 1FNUA 4OVZA 3Q3OC 4L2YA 5HI1A 1KH0A 4XDCA 2XN9C 2LZ6A 4MGKE 1L0VB 3H7SA 1LFDA 3SU8X 1SB3C 1KRHA 3DVGY 5EE1A 3T9LA 2KLGA 2WS3B 4OW0A 5KHQA 3LDZE 1J7AA 3LXFA 2QILA 1K50A 3SFEB 1KM7A 1JMLA 3NS1A 2K3UA 4KDLB 2WYQA 3PRPB 4XYCA 1HZ6A 1DOYA 2OJRA 4IUMB 1C79A 2GBKA 3QJZA 2RMMA 4WJOA 2N0SB 2CHZA 4TSSA 2YEPF 3RFZB 1NYRA 5CTRC 2D3GA 4G0NB 4DHZE 4ZRJA 4GGQA 1I4GA 2KX3A 1OQRA 2V1YA 5G5HA 3DBHB 1D3ZA 4KIKA 4CO7A 4W9EA 2LVPA 4IM0A 3AE8B 4YTMB 1LXDA 3PRMB 1T0YA 2IYDB 2L0FA 2K6QA 4KIKB 1JRUA 2ZZPB 3CIRB 1L4DB 2EMSA 1E8WA 1TS5A 2D3CA 3OWEB 3J9CA 2L0TA 3Q8CA 3P4QB 2G1EA 2WXHA 1T5XD 1Q0WB 4DQOC 1JROA 1PUTA 3N3KB 1QT9A 1V2YA 3W9CB 5GMVA 4B9KA 3V62A 2LHEA 1KF6B 5IO9A 1HE8A 2D10A 3HHMA 5E6OA 2N7DA 5EDSA 3A33B 4RM9A 2DHZA 4NJ7A 3RNBC 1NDDA 3V60A 3Q14C 4JE3B 5IAAC 3E9SA 3DWMA 1NYQA 2MA9B 3NVWA 3I57A 3VRAB 4RGTA 2OHFA 4RFBA 1YN3A 4XX5A 2GBRA 1C9FA 3DQVA 2WXKA 1UGMA 1R4MB 3DOWA 1QOAA 1TJEA 4LLGM 5BMHA 2M1MA 3PO0A 2GRIA 4IG7B 2V4IB 5EE9A 1Q1OA 4ICUA 3URYA 2KANA 1JWBD 1YOVB 2KQ7A 1I35A 4A6QA 1XLPA 3CWIA 2KN5A 2LJIA 2D11A 4XWWA 2MBQA 2L76A 3EC8A 4HJGE 1TBEA 2G4SA 2GMIC 1UF0A 4RF0A 2VZKB 2KC2A 4D2KA 2G9HD 1PGBA 2L32A 3BVZA 2KT7A 1N6ZA 2WXIA 4FBJB 2Z0EB 1M94A 2NBWB 2GOWA 3Q3NC 3PSEB 5LLIA 3VTWA 3EGRA 2LXCA 2JU6X 3MHSD 1E9MA 2L7RA 3R8BA 1WZ3A 1E6EB 3ZXRA 2BB5A 4EZLA 2JX5A 3Q2AC 3GE8C 4XC2A 3DVNU 4HRSA 4K7SA 4W9CA 4DWFA 2QJLA 3NVVA 1VRAB 4WJQA 3AE1B 1TYGB 2FE8A 3ZYYX 3Q8BA 1N5XA 3OG5A 1IUEA 1SEBD 4YL8A 5E6JA 4B95A 4H2AA 4USAA 3MP9A 4WWOA 3HIZA 2JUOA 3P42A 3ZXVA 1RM6C 4EE2A 3P1MA 3PHXB 4W9HA 3Q69A 4BBNC 1WJ4A 2CJNA 5IN7A 2W82A 1C3TA 1K51A 5JZEB 3H1UA 3MHZA 2ZNVB 3HVDA 2ZCBA 4BFRA 1NI2A 2JZPA 3EHVA 5G5GA 1N60A 5GXGB 1KTKA 3Q8FA 1HZ5A 2LEKA 4HWIB 3AEBB 2L05A 4LNFA 4PYUA 2BKFA 1MHXA 2LVOA 1VZ6A 4J3OD 1FM0D 4B0MA 2WP9B 4NQKE 1E8XA 2E6XA 2QSDA 1D5MC 3P4RB 5IP4D 2DAFA 4HK2A 1L6VA 3RI7C 3SD5A 3AEFB 2G3QB 1WGDA 1F0ZA 2QHOA 5LXHA 2K5PA 2NS5A 3PVLA 2BGFA 2KACA 1ZW7A 1SJHD 3PS6A 4TMAB 3ML8A 2WQYB 1CJEA 3KWVA 1T0RC 2XEWA 4BOZB 1R4MI 1V5OA 3AXCA 3PGEA 3DHGC 4YTNB 5MPOA 1HQRD 4HPMB 4MH0E 1E7UA 2HDEA 4PS8A 3DWGC 3KLSX 2J0MA 1EF1A 2N9EB 1UUPA 1L4ZB 3DBSA 3VUXA 1FXTB 4ZRPA 3W5UB 1P98A 2ZCCA 4S0RA 2KJRA 4W9LA 1SE2A 1ZXHA 2MBHA 1H8CA 1VR9A 3T3NA 2M19A 2LXAA 3ENEA 1WM2A 1BUIC 2IO0B 4DK5A 2JF5A 2L83A 2XBBC 4EEWA 2V0GA 1TS3A 3FC4A 3TSSA 4EOYA 1XCTL 2KDBA 2DZKA 4MGZE 4A3OA 2MJ3A 2KD0A 3VAWA 1NENB 4JL9A 5TR5A 3Q3MC 4PK1A 3ABVB 2BPSA 4HKZE 4F7ZA 5LXIB 2PKOA 5EE3A 3QK0A 4L23A 4RF1A 3A9KA 3E56A 4GIVA 2Y5PA 4NNJB 1GB1A 4RM8A 3VH3B 1KLVA 2I38A 4OZBA 2CKHB 3UINB 3IXSA 2N1WA 5BO4B 1WF9A 2JY6A 2NBVB 1ZUD2 4RCOA 1QF6A 1T6BX 2DYOA 1PDXA 4AWJA 1KLUD 4TV3A 4BZAA 2DZMA 4HCNB 2FNJB 2RDGA 4MT5A 1KLGD 2KXJA 1UBIA 5D3IB 2MBOA 4CYEA 3GZNB 1GAQB 4KZ0A 1XQQA 2INPE 1GNUA 2KX0A 3W2DA 1I4QA 1N5WA 1P3QU 5H8YE 3GE3C 5C3JB 3ZJUA 4RGMA 4DDID 3OAWA 2WXMA 1FPYA 1DGJA 1VCBA 3V6EB 1NEKB 1F9JA 1N63A 3NY5A 1D4BA 2QC8A 1FNWA 2FCMA 5FKAC 1WJ6A 2N9LA 2NBUA 2RGFA 4RGNA 4MSMB 3DVGX 1TZ1A 2JZZA 4A55A 3DVNV 1F52A 2WWZA 2JXTA 2DYMA 3U2SC 1V1PA 1HXYD 1NI3A 2C5LC 4KKIA 2NTSA 1WX8A 4N58A 4MDKE 1PGAA 2K22A 4DHJB 2ZJDA 1WX7A 2PVOD 3SHQA 4YTPB 2NCNA 3NHEB 3ZO5B 1V1PB 3RZWC 1VZ7A 4P7IA 3BY4B 1YJIA 4EFOA 3C19A 4DXAB 4K7WA 1CZPA 3AE2B 2B76B 3QC8B 5AEKB 1RAXA 4TQ1A 2WXRA 4AQ7A 3RCZA 1RFAA 2J53A 3VXWA 1KOTA 3X0WA 2OJWA 3ZJTA 3H9DA 2IGHA 1STEA 1RRBA 2AEHA 1JALA 2BKRB 4M00A 2BYTA 1SXTA 2XNAC 2N9KA 3ZDTA 2JPHA 4LJPB 3BINA 2BT6A 1UZXB 2BW2A 3VUWA 2N9XA 4DXFA 3V6CB 2WU5B 5L95C 3EA6A 5KHOA 1E90A 3L10B 2JT4B 5I4DA 1WXSA 4PYZA 3UQBA 3SR6A 2KQSA 2BF8B 2KWVB 1FO4A 1K53A 3KH0A 3QX1A 2LRWA 1WR1A 3U8ZA 2Z8LA 2D3BA 3RNFC 2GBJA 4P1CC 3ETRA 5D6JB 3AEAB 1F2RC 2KN4A 3GOEA 1V97A 1YMHE 2WXOA 3AEEB 2JXXA 1V8CA 5G55A 2FIFA 2DENB 2IO2B 5JH5C 2KFKA 3K9PB 2Z0DB 4R3DA 1KFYB 1TKEA 3L13A 4IOIE 3KUCB 1H4RA 4WQMA 1R4NI 1OFFA 3ZW3A 3VTUA 1C4AA 1WE6A 2D5GA 3KYCD 2KFKB 2D2QA 4FJZA 2KO3A 3VDZA 4A9AA 1XT9B 4EZKA 1MJDA 3GZNI 1V6EA 2WXGA 3QCAA 3R2TA 4LDTB 3T3OA 4ANWA 3VQIA 2MRPA 1RYJA 4JPSA 3IG3A 2ON8A 3RUIB 4N9F4 4ZHPA 4K81A 4HLEA 3PHWB 1QZEA 4JWUC 1WE7A 2K8BA 5BMGA 3L4PA 3QA8A 1XO3A 4O1NA 2K25A 4EUTA 1ENFA 2AWTA 3W1SC 2I1JA 5BMIA 4I6NB 4ZHOA 2X8XX 1GG3A 3H7PA 3DHHC 5J17A 1V49A 2KWDA 4DDGD 3BK2A 3CMMB 1TS2A 5BYQA 3R7QA 1TT5B 2BYFA 2I1KA 4G50A 2ZNVC 4P6VF 1GB4A 1FXIA 3H7PB 4QAYA 2PMVA 3A1QA 4K3CA 3R66C 1PQSA 4M01A 3W1YA 1ACCA 3HVZA 2WXPA 4HPLB 3U4EG 2LWPA 3RNCC 1ZXIA 2HE7A 3A1QB 1WGYA 4ANVA 2N7EA 1QILA 4LJOB 1GUAB 4CQNA 3ZRCA 1YJ1A 2E3TA 4ANUA 3ZGZA 3BZDB 4GSWA 3AV8A 3NS8A 2INCC 5DPRA 3I5JC 5HG2A 3AE5B 2RDBC 3IHPC 1IPGA 2IJ0A 2C60A 1IBXB 2O6VA 3Q8AA 2LGIA 3GS2A 2ZVNA 4A8XC 1FNVA 2KQ4X 1PYWD 3M3JA 4DHZB 2PIAA 2JWUA 2N9PC 2O6VB 4N6EB 2ZPNA 3BYTB 3IAM1 3OLMD 2A4ZA 1VDVA 1AARA 4II3B 1ESFA 4MGYE 3JVZX 2BS2B 1WJNA 2WDTB 4ITKA 1J7BA 1UBQA 3UIOB 2GBMA 1JW9D 3VHTC 4BKTA 2BS4B 4YSZB 3TEXA 2MQJA 3QIJA 1HA5A 4WAAA 2KNBA 1NVID 2QMTA 4K3BA 3W1SA 3TEZA 2RPVA 1I4HA 5G2NA 3Q8EA 1SGHA 2ZVOA 3L16A 2KJHB 2W9NA 2HJ8A 4J6IA 4GU2A 4IKGA 5AZHA 1WZ0A 3V05A 2IZVB 3D32A 2O2VB 5AZFA 4TQ0A 4NPNA 2OEDA 4MH8A 3A4RA 3FILB 3O65B 1UH6A 3ZNGC 2DYBA 3AEDB 4MACA 4WWPA 4YSYB 1SE9A 3TMPB 3DBHI 2BQQA 3SEBA 1YN5A 3KVFB 2HJ1A 3RZFA 2C7MB 1OEYJ 1XLNA 3P4SB 4ARCA 1J0GA 3CSFA 1YJJA 3ALBA 2VH2A 2ASQA
chains in the Genus database with same CATH topology
2JY6A 2NBVB 1L7YA 2LI5A 2REXA 2DYOA 4AWJA 4TV3A 4B6WA 2BWFA 1OQYA 4CHKA 1EF5A 2DZMA 2KTFA 5DPTA 4HCNB 3DBLI 3H6NA 2KLCA 3TJPA 2FIDA 3DDCB 2FNJB 3PV1A 2OOBB 1WIAA 3AI5A 1YX5B 1OTRB 2KXJA 1UBIA 2UYZB 5DCNA 2MX2A 2L8JA 2MBOA 2R2OA 3NOBA 4CYEA 4KSKC 1WXAA 4HJKA 4JIOU 3Q3FA 4LCDE 3UQAA 1A5RA 2LRUA 4TUUA 4KZ0A 4DBGA 1TTNA 1XQQA 3A9JB 4HDQA 2KK8A 5D94A 1GNUA 2KX0A 3UGBB 2MP2A 4IWQA 4NJ6A 1P3QU 3PLVA 3X23A 3JW0X 2LASA 3Q3JA 2M0XA 2FUHB 4E3CA 5IA7A 4MELA 4TKNA 4FN2A 1U4AA 2C7NB 1SIFA 4DDID 3OAWA 2MCNB 2FCSA 2MW5A 1VCBA 4K1RB 3APDA 4HVBA 4GB9A 4W9GA 3V6EB 2FCQA 2MP2B 1F9JA 4XZ4A 1G6JA 1WI0A 3NY5A 2KOXA 4IWOA 1GC7A 4I6PA 2FCMA 1WJ6A 1IYFA 3WAPA 2M4NA 2G45B 3M63B 3DPDA 2NBUA 3RD2A 2LZ6A 4MGKE 2RGFA 3H7SA 1LFDA 3SU8X 4MSMB 3DVGX 1TZ1A 2JZZA 2MBBB 3DVGY 3T9LA 3CF6E 2KLGA 1V80A 3DVNV 4FJYA 2WWZA 4GDKA 4BOSC 2DYMA 5KHQA 4BKSA 2C5LC 1WX8A 2DZJA 3LDZE 2JRIB 2JVCA 2YVCA 3UIPB 3RULA 4JQWC 4MDKE 1YIWA 3QHTA 1KM7A 3R3MA 2YLMA 4KDLB 2RSUA 2WYQA 3PRPB 1IP9A 4DHJB 2OJRA 3B1LX 2ZJDA 4LDTD 1WX7A 4IUMB 3SHQA 2LUEA 2GBKA 2BWES 2NCNA 3NHEB 2O2VA 4GDKB 3QJZA 3WAOA 4MGIE 4WJOA 3ZO5B 4AJYB 2CHZA 5L83A 3ZNHB 1E8ZA 3RZWC 3IBEA 4P7IA 4EFOA 3BY4B 2K6DB 5JHAA 1ISNA 1LQBA 5CTRC 4DXAB 4K7WA 2D3GA 4G0NB 2EKEC 4DHZE 4NAWA 4ZRJA 4GGQA 4IW0A 2KX3A 1E7VA 3QC8B 2V1YA 1V86A 5AEKB 1RAXA 1D3ZA 5E6PA 4PS3A 3P2BA 4KIKA 4TQ1A 4CO7A 4X57B 4W9EA 2D07B 2V3SA 2LVPA 4IM0A 4WQOB 1V9JA 4F1SA 1LXDA 3TIXA 2NPTA 3RCZA 1RFAA 3VXWA 2MSED 1KOTA 3PRMB 2C9WB 4NAWB 3X0WA 2VRRB 1L2NA 3H9DA 1T0YA 3U30A 2IYDB 2L0FA 2PE9A 4FADA 1RRBA 2K6QA 4GN1A 4KIKB 2LD9A 2AEHA 4W9IA 2JRHA 1JRUA 2BKRB 1J8CA 2ZZPB 3KUZA 2EMSA 2KC1A 2ZEQA 1X1MA 3N32A 1E8WA 3ZDTA 2JPHA 4HDOA 4IM2A 4ZRIA 4LJPB 4EKUA 2NPTB 3BINA 3ONSA 2N4FA 2L0TA 2IO1B 1UZXB 2CU1A 3VUWA 1Q0WB 3QWZB 2N9XA 1S3SG 2KDFB 3EECA 3N3KB 2RPQA 1LM8B 1V2YA 2KWUB 2M17A 4W9DA 1XD3B 3V6CB 3A9JA 2N1VA 5C23A 3WIMA 2CS4A 5GMVA 2MBEA 5KHOA 3M95A 2UWQA 3V62A 2AYOB 3VVWB 1E90A 3L10B 2JT4B 4B9KA 1WXSA 1HE8A 2D10A 4PYZA 3UQBA 3HHMA 5E6OA 2N7DA 2KQSA 2BF8B 4EZJA 2KWVB 3TBLD 5EDSA 5L95C 3KH0A 3A33B 2LRWA 2GBNA 1WR1A 3QX1A 4ICVA 4JGHB 4RM9A 2DHZA 2K8HA 5D2MB 3U8ZA 3ZDMC 4BBNF 2GBJA 2AL6A 2ZPYA 4NJ7A 5D6JB 3QARA 4MEMA 3RYTA 1NBFC 1NDDA 3L54A 4AUQC 3V60A 3GOEA 2KJ6A 2KMAA 3L0WB 3PTFC 5IAAC 3VTVA 4E74A 2MA9B 2JXXA 5G55A 2FIFA 2NVUI 4FJVB 2DENB 2IO2B 5JH5C 3LJ3A 4XX5A 5C1ZA 2MLBA 1E8YA 2GBRA 5CHVC 2HTHA 2KFKA 3KW5B 1WX9A 3K9PB 4F8CB 2Z0DB 3DQVA 3ECIA 4KDIC 1WM3A 4BKGA 1RLFA 3I3TB 4W9FA 5FR6A 1UGMA 2PEAA 2JZ3B 3L13A 2DX5B 3KUCB 3DOWA 1WGHA 2KKCA 2M1MA 1H4RA 2V4LA 2JWZA 4IG7B 4GOCA 4M8MA 1R4NI 1Q1OA 3ZW3A 4ICUA 3VTUA 2KANA 1WE6A 3PRZA 3KYCD 2KFKB 2D2QA 4FJZA 2KO3A 4WJPA 3VUYA 3VDZA 2J7QB 1UELA 3IFWB 4IM3A 4WWNA 2KQ7A 2CHXA 1I35A 1XT9B 2K1FA 4FA6A 4EZKA 5J18A 2PE6B 4FHKA 5DPWA 1WXMA 3R7RA 3GZNI 4ZRKA 1V6EA 3K9OB 2KN5A 4HXDA 3QCAA 1Q5WB 2CR5A 2KDEB 2D11A 3ML9A 3UF8A 4W9JA 2KTRA 4LDTB 3ZVVA 2MBQA 4ANWA 2L76A 1EUVB 2EMTA 3EC8A 3ZTDA 3VQIA 1TBEA 1WXVA 4GDLA 2G4SA 4KZCA 2GMIC 2MRPA 3ZRFA 2KC2A 3IG3A 4HCPB 4MJSB 2PPHA 4FBJB 5HKHA 2Z0EB 1M94A 2NBWB 2O6VD 3RUIB 2GOWA 3ZLZA 1EO6A 4N9F4 3MTNB 2KTRB 4K81A 4IWPA 3PSEB 5LLIA 3VTWA 4HLEA 1C1YB 3A4SC 3U7DA 3AU5A 2B3AA 2LXCA 3PHWB 1QZEA 3IVFA 3MHSD 4GDLB 2M8SA 1WE7A 2K8BA 4A20A 3QA8A 2NR2A 2K25A 4ASWC 2L7RA 4EUTA 1WZ3A 1YX6B 4FLHA 3HM3A 2AWTA 3W1SC 4EZLA 4XC2A 3WALA 2I1JA 3DVNU 4I6NB 4K7SA 4W9CA 4AP4C 4DWFA 1GG3A 3H7PA 5J17A 1V49A 4DDGD 4WJQA 1J19A 3CMMB 1VD2A 2IY0B 4BKSD 3R7QA 2J0KA 2IY1B 4YL8A 4B95A 2HD5B 2BYFA 2I1KA 4G50A 2LGYA 2ZNVC 3PPAA 5D7GA 4WWOA 3HIZA 3L17A 3DCGA 3WAMA 3H7PB 2DZIA 2J0JA 3KUDB 2JUOA 3ZIMA 4AOFA 3PHXB 2BYVE 1UD7A 4W9HA 3QQ8B 4BBNC 2K39A 1WJ4A 1WMHA 4M0WB 3TCAA 1WYWB 3A1QA 2G4DB 4ZDVA 1C3TA 1P0RA 3R66C 5JZEB 3H1UA 2Z59B 1PQSA 3VH4B 3W1YA 2ZNVB 2LJ5A 2ZCBA 4BFRA 4NQLB 1Z5SB 1NI2A 3EHVA 4HPLB 4K7UA 2LWPA 2PJHA 1WMHB 2HE7A 3A1QB 1WGYA 2RD0A 4ANVA 3A9KB 5AZGA 2N7EA 4HWIB 3N30A 4LJOB 1GUAB 4AJWA 2L05A 4W9KA 5CHFA 3M62B 4KSLC 2KWCA 3ZRCA 1YJ1A 4PYUA 3QAQA 4ANUA 3PT2B 2XK5B 4GSWA 1S1QB 1TGZB 4ANXA 3PZDA 2BKFA 3B0AA 3NS8A 3WA0A 2LVOA 5DPRA 1V81A 2DAJA 3OJ4B 3C0RB 4G11A 1I42A 2C7HA 4NQKE 3T8MA 3APFA 3CSTA 1E8XA 4FULA 3IHPC 1IPGA 3MJWA 3OJ3A 1OGWA 2C60A 5DPSA 3ZTCA 2KDIA 2O6VA 2DAFA 4HK2A 3AU4A 3JYUA 2ZVNA 4KVGB 3SD5A 3AULA 1K8RB 1KJTA 2LGDA 4MJSA 2K8CA 2G3QB 4GXBA 1WGDA 2R2QA 2QHOA 5LXHA 2Y5BB 4OVVA 2IBIB 2FAZA 3M3JA 2NS5A 4DHZB 2N9PC 3PVLA 2BGFA 3RT3B 2O6VB 2A5UA 1ZW7A 2KVRA 3ZKJC 5CX3A 1Y8RC 3APCA 3PS6A 1YQBA 2KMCA 1ZKHA 2WX0A 2ZPNA 3ML8A 4JLCA 3EFUA 2IO3B 3OLMD 1WH3A 2A4ZA 2MWSB 1AARA 2XEWA 3PREA 4BOZB 4MM3A 1R4MI 1Z2MA 1V5OA 3AXCA 3PGEA 4II3B 4G3XB 4GMVA 4MGYE 3JVZX 2FCNA 2AL3A 4OVUA 4HPMB 1WJNA 2LGXA 2WX1A 4MH0E 1E7UA 2WDTB 4PS8A 4II2B 4KV2A 3KYDD 3NZUA 1UBQA 3UIOB 2GBMA 3JSVA 5E6NA 3VHTC 2J0MA 1OEYA 1EF1A 3B08A 4BKTA 3S2AA 2N9EB 1WR6E 1YD8U 4WJNA 3DBSA 2MQJA 3QIJA 4WAAA 2KNBA 1FXTB 3HK0A 3VUXA 3ZNZB 1P98A 2ZCCA 1WFYA 4MSQB 3W1SA 2KJRA 4W9LA 2BYEA 2MBHA 2CHWA 1H8CA 5G2NA 1V5TA 1SGHA 2RR9A 2ZVOA 2LXAA 3ENEA 4RMAA 3L16A 1WM2A 3JSVB 4DHJD 2KJHB 3V61A 2KZRA 2W9NA 1P1AA 2HJ8A 1P9DU 2L00B 4GU2A 4J6IA 4DK5A 2IO0B 2L3ZA 4ZYNA 2JF5A 1WJUA 3NZSA 2XBBC 4EEWA 1GC6A 4EOYA 5AZHA 1WZ0A 2IZVB 3D32A 2O2VB 5AZFA 4TQ0A 4NPNA 4I6LB 2KDBA 2DZKA 4MGZE 5J2RA 4M8NA 4A3OA 3SDLC 3A4RA 2KD0A 3VAWA 3VFKA 3O65B 3ZUNA 1UH6A 4JL9A 3ZNGC 5TR5A 2DYBA 4E71A 4WWPA 2KFJA 1SE9A 5CHWA 1GJZA 2KHWB 1MG8A 2BPSA 3TMPB 3WANA 4F7ZA 3DBHI 1BT0A 4URKA 5LXIB 3QK0A 3DBRI 3KVFB 3A9KA 3TL5A 4GIVA 1WGRA 3RZFA 2C7MB 1OEYJ 4NNJB 3HM6X 1WRDB 3ZNID 3PLUA 4FHJA 4RM8A 3VH3B 4A3PA 1J0GA 1KLVA 1WY8A 4PS7A 4NY0A 3CSFA 2XK5A 5JHBA 3L08A 1ZGUB 4BVUC 1CMXB 1E5WA 2CKHB 3UINB 2LVQA 4IC7B 3ALBA 2N1WA 5BO4B 1WGGA 1WF9A 2ASQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JY6 A;  2NBV B;  1L7Y A;  2LI5 A;  2REX A;  2DYO A;  4AWJ A;  4TV3 A;  4B6W A;  2BWF A;  1OQY A;  4CHK A;  1EF5 A;  2DZM A;  2KTF A;  5DPT A;  4HCN B;  3DBL I;  3H6N A;  2KLC A;  3TJP A;  2FID A;  3DDC B;  2FNJ B;  3PV1 A;  2OOB B;  1WIA A;  3AI5 A;  1YX5 B;  1OTR B;  2KXJ A;  1UBI A;  2UYZ B;  5DCN A;  2MX2 A;  2L8J A;  2MBO A;  2R2O A;  3NOB A;  4CYE A;  4KSK C;  1WXA A;  4HJK A;  4JIO U;  3Q3F A;  4LCD E;  3UQA A;  1A5R A;  2LRU A;  4TUU A;  4KZ0 A;  4DBG A;  1TTN A;  1XQQ A;  3A9J B;  4HDQ A;  2KK8 A;  5D94 A;  1GNU A;  2KX0 A;  3UGB B;  2MP2 A;  4IWQ A;  4NJ6 A;  1P3Q U;  3PLV A;  3X23 A;  3JW0 X;  2LAS A;  3Q3J A;  2M0X A;  2FUH B;  4E3C A;  5IA7 A;  4MEL A;  4TKN A;  4FN2 A;  1U4A A;  2C7N B;  1SIF A;  4DDI D;  3OAW A;  2MCN B;  2FCS A;  2MW5 A;  1VCB A;  4K1R B;  3APD A;  4HVB A;  4GB9 A;  4W9G A;  3V6E B;  2FCQ A;  2MP2 B;  1F9J A;  4XZ4 A;  1G6J A;  1WI0 A;  3NY5 A;  2KOX A;  4IWO A;  1GC7 A;  4I6P A;  2FCM A;  1WJ6 A;  1IYF A;  3WAP A;  2M4N A;  2G45 B;  3M63 B;  3DPD A;  2NBU A;  3RD2 A;  2LZ6 A;  4MGK E;  2RGF A;  3H7S A;  1LFD A;  3SU8 X;  4MSM B;  3DVG X;  1TZ1 A;  2JZZ A;  2MBB B;  3DVG Y;  3T9L A;  3CF6 E;  2KLG A;  1V80 A;  3DVN V;  4FJY A;  2WWZ A;  4GDK A;  4BOS C;  2DYM A;  5KHQ A;  4BKS A;  2C5L C;  1WX8 A;  2DZJ A;  3LDZ E;  2JRI B;  2JVC A;  2YVC A;  3UIP B;  3RUL A;  4JQW C;  4MDK E;  1YIW A;  3QHT A;  1KM7 A;  3R3M A;  2YLM A;  4KDL B;  2RSU A;  2WYQ A;  3PRP B;  1IP9 A;  4DHJ B;  2OJR A;  3B1L X;  2ZJD A;  4LDT D;  1WX7 A;  4IUM B;  3SHQ A;  2LUE A;  2GBK A;  2BWE S;  2NCN A;  3NHE B;  2O2V A;  4GDK B;  3QJZ A;  3WAO A;  4MGI E;  4WJO A;  3ZO5 B;  4AJY B;  2CHZ A;  5L83 A;  3ZNH B;  1E8Z A;  3RZW C;  3IBE A;  4P7I A;  4EFO A;  3BY4 B;  2K6D B;  5JHA A;  1ISN A;  1LQB A;  5CTR C;  4DXA B;  4K7W A;  2D3G A;  4G0N B;  2EKE C;  4DHZ E;  4NAW A;  4ZRJ A;  4GGQ A;  4IW0 A;  2KX3 A;  1E7V A;  3QC8 B;  2V1Y A;  1V86 A;  5AEK B;  1RAX A;  1D3Z A;  5E6P A;  4PS3 A;  3P2B A;  4KIK A;  4TQ1 A;  4CO7 A;  4X57 B;  4W9E A;  2D07 B;  2V3S A;  2LVP A;  4IM0 A;  4WQO B;  1V9J A;  4F1S A;  1LXD A;  3TIX A;  2NPT A;  3RCZ A;  1RFA A;  3VXW A;  2MSE D;  1KOT A;  3PRM B;  2C9W B;  4NAW B;  3X0W A;  2VRR B;  1L2N A;  3H9D A;  1T0Y A;  3U30 A;  2IYD B;  2L0F A;  2PE9 A;  4FAD A;  1RRB A;  2K6Q A;  4GN1 A;  4KIK B;  2LD9 A;  2AEH A;  4W9I A;  2JRH A;  1JRU A;  2BKR B;  1J8C A;  2ZZP B;  3KUZ A;  2EMS A;  2KC1 A;  2ZEQ A;  1X1M A;  3N32 A;  1E8W A;  3ZDT A;  2JPH A;  4HDO A;  4IM2 A;  4ZRI A;  4LJP B;  4EKU A;  2NPT B;  3BIN A;  3ONS A;  2N4F A;  2L0T A;  2IO1 B;  1UZX B;  2CU1 A;  3VUW A;  1Q0W B;  3QWZ B;  2N9X A;  1S3S G;  2KDF B;  3EEC A;  3N3K B;  2RPQ A;  1LM8 B;  1V2Y A;  2KWU B;  2M17 A;  4W9D A;  1XD3 B;  3V6C B;  3A9J A;  2N1V A;  5C23 A;  3WIM A;  2CS4 A;  5GMV A;  2MBE A;  5KHO A;  3M95 A;  2UWQ A;  3V62 A;  2AYO B;  3VVW B;  1E90 A;  3L10 B;  2JT4 B;  4B9K A;  1WXS A;  1HE8 A;  2D10 A;  4PYZ A;  3UQB A;  3HHM A;  5E6O A;  2N7D A;  2KQS A;  2BF8 B;  4EZJ A;  2KWV B;  3TBL D;  5EDS A;  5L95 C;  3KH0 A;  3A33 B;  2LRW A;  2GBN A;  1WR1 A;  3QX1 A;  4ICV A;  4JGH B;  4RM9 A;  2DHZ A;  2K8H A;  5D2M B;  3U8Z A;  3ZDM C;  4BBN F;  2GBJ A;  2AL6 A;  2ZPY A;  4NJ7 A;  5D6J B;  3QAR A;  4MEM A;  3RYT A;  1NBF C;  1NDD A;  3L54 A;  4AUQ C;  3V60 A;  3GOE A;  2KJ6 A;  2KMA A;  3L0W B;  3PTF C;  5IAA C;  3VTV A;  4E74 A;  2MA9 B;  2JXX A;  5G55 A;  2FIF A;  2NVU I;  4FJV B;  2DEN B;  2IO2 B;  5JH5 C;  3LJ3 A;  4XX5 A;  5C1Z A;  2MLB A;  1E8Y A;  2GBR A;  5CHV C;  2HTH A;  2KFK A;  3KW5 B;  1WX9 A;  3K9P B;  4F8C B;  2Z0D B;  3DQV A;  3ECI A;  4KDI C;  1WM3 A;  4BKG A;  1RLF A;  3I3T B;  4W9F A;  5FR6 A;  1UGM A;  2PEA A;  2JZ3 B;  3L13 A;  2DX5 B;  3KUC B;  3DOW A;  1WGH A;  2KKC A;  2M1M A;  1H4R A;  2V4L A;  2JWZ A;  4IG7 B;  4GOC A;  4M8M A;  1R4N I;  1Q1O A;  3ZW3 A;  4ICU A;  3VTU A;  2KAN A;  1WE6 A;  3PRZ A;  3KYC D;  2KFK B;  2D2Q A;  4FJZ A;  2KO3 A;  4WJP A;  3VUY A;  3VDZ A;  2J7Q B;  1UEL A;  3IFW B;  4IM3 A;  4WWN A;  2KQ7 A;  2CHX A;  1I35 A;  1XT9 B;  2K1F A;  4FA6 A;  4EZK A;  5J18 A;  2PE6 B;  4FHK A;  5DPW A;  1WXM A;  3R7R A;  3GZN I;  4ZRK A;  1V6E A;  3K9O B;  2KN5 A;  4HXD A;  3QCA A;  1Q5W B;  2CR5 A;  2KDE B;  2D11 A;  3ML9 A;  3UF8 A;  4W9J A;  2KTR A;  4LDT B;  3ZVV A;  2MBQ A;  4ANW A;  2L76 A;  1EUV B;  2EMT A;  3EC8 A;  3ZTD A;  3VQI A;  1TBE A;  1WXV A;  4GDL A;  2G4S A;  4KZC A;  2GMI C;  2MRP A;  3ZRF A;  2KC2 A;  3IG3 A;  4HCP B;  4MJS B;  2PPH A;  4FBJ B;  5HKH A;  2Z0E B;  1M94 A;  2NBW B;  2O6V D;  3RUI B;  2GOW A;  3ZLZ A;  1EO6 A;  4N9F 4;  3MTN B;  2KTR B;  4K81 A;  4IWP A;  3PSE B;  5LLI A;  3VTW A;  4HLE A;  1C1Y B;  3A4S C;  3U7D A;  3AU5 A;  2B3A A;  2LXC A;  3PHW B;  1QZE A;  3IVF A;  3MHS D;  4GDL B;  2M8S A;  1WE7 A;  2K8B A;  4A20 A;  3QA8 A;  2NR2 A;  2K25 A;  4ASW C;  2L7R A;  4EUT A;  1WZ3 A;  1YX6 B;  4FLH A;  3HM3 A;  2AWT A;  3W1S C;  4EZL A;  4XC2 A;  3WAL A;  2I1J A;  3DVN U;  4I6N B;  4K7S A;  4W9C A;  4AP4 C;  4DWF A;  1GG3 A;  3H7P A;  5J17 A;  1V49 A;  4DDG D;  4WJQ A;  1J19 A;  3CMM B;  1VD2 A;  2IY0 B;  4BKS D;  3R7Q A;  2J0K A;  2IY1 B;  4YL8 A;  4B95 A;  2HD5 B;  2BYF A;  2I1K A;  4G50 A;  2LGY A;  2ZNV C;  3PPA A;  5D7G A;  4WWO A;  3HIZ A;  3L17 A;  3DCG A;  3WAM A;  3H7P B;  2DZI A;  2J0J A;  3KUD B;  2JUO A;  3ZIM A;  4AOF A;  3PHX B;  2BYV E;  1UD7 A;  4W9H A;  3QQ8 B;  4BBN C;  2K39 A;  1WJ4 A;  1WMH A;  4M0W B;  3TCA A;  1WYW B;  3A1Q A;  2G4D B;  4ZDV A;  1C3T A;  1P0R A;  3R66 C;  5JZE B;  3H1U A;  2Z59 B;  1PQS A;  3VH4 B;  3W1Y A;  2ZNV B;  2LJ5 A;  2ZCB A;  4BFR A;  4NQL B;  1Z5S B;  1NI2 A;  3EHV A;  4HPL B;  4K7U A;  2LWP A;  2PJH A;  1WMH B;  2HE7 A;  3A1Q B;  1WGY A;  2RD0 A;  4ANV A;  3A9K B;  5AZG A;  2N7E A;  4HWI B;  3N30 A;  4LJO B;  1GUA B;  4AJW A;  2L05 A;  4W9K A;  5CHF A;  3M62 B;  4KSL C;  2KWC A;  3ZRC A;  1YJ1 A;  4PYU A;  3QAQ A;  4ANU A;  3PT2 B;  2XK5 B;  4GSW A;  1S1Q B;  1TGZ B;  4ANX A;  3PZD A;  2BKF A;  3B0A A;  3NS8 A;  3WA0 A;  2LVO A;  5DPR A;  1V81 A;  2DAJ A;  3OJ4 B;  3C0R B;  4G11 A;  1I42 A;  2C7H A;  4NQK E;  3T8M A;  3APF A;  3CST A;  1E8X A;  4FUL A;  3IHP C;  1IPG A;  3MJW A;  3OJ3 A;  1OGW A;  2C60 A;  5DPS A;  3ZTC A;  2KDI A;  2O6V A;  2DAF A;  4HK2 A;  3AU4 A;  3JYU A;  2ZVN A;  4KVG B;  3SD5 A;  3AUL A;  1K8R B;  1KJT A;  2LGD A;  4MJS A;  2K8C A;  2G3Q B;  4GXB A;  1WGD A;  2R2Q A;  2QHO A;  5LXH A;  2Y5B B;  4OVV A;  2IBI B;  2FAZ A;  3M3J A;  2NS5 A;  4DHZ B;  2N9P C;  3PVL A;  2BGF A;  3RT3 B;  2O6V B;  2A5U A;  1ZW7 A;  2KVR A;  3ZKJ C;  5CX3 A;  1Y8R C;  3APC A;  3PS6 A;  1YQB A;  2KMC A;  1ZKH A;  2WX0 A;  2ZPN A;  3ML8 A;  4JLC A;  3EFU A;  2IO3 B;  3OLM D;  1WH3 A;  2A4Z A;  2MWS B;  1AAR A;  2XEW A;  3PRE A;  4BOZ B;  4MM3 A;  1R4M I;  1Z2M A;  1V5O A;  3AXC A;  3PGE A;  4II3 B;  4G3X B;  4GMV A;  4MGY E;  3JVZ X;  2FCN A;  2AL3 A;  4OVU A;  4HPM B;  1WJN A;  2LGX A;  2WX1 A;  4MH0 E;  1E7U A;  2WDT B;  4PS8 A;  4II2 B;  4KV2 A;  3KYD D;  3NZU A;  1UBQ A;  3UIO B;  2GBM A;  3JSV A;  5E6N A;  3VHT C;  2J0M A;  1OEY A;  1EF1 A;  3B08 A;  4BKT A;  3S2A A;  2N9E B;  1WR6 E;  1YD8 U;  4WJN A;  3DBS A;  2MQJ A;  3QIJ A;  4WAA A;  2KNB A;  1FXT B;  3HK0 A;  3VUX A;  3ZNZ B;  1P98 A;  2ZCC A;  1WFY A;  4MSQ B;  3W1S A;  2KJR A;  4W9L A;  2BYE A;  2MBH A;  2CHW A;  1H8C A;  5G2N A;  1V5T A;  1SGH A;  2RR9 A;  2ZVO A;  2LXA A;  3ENE A;  4RMA A;  3L16 A;  1WM2 A;  3JSV B;  4DHJ D;  2KJH B;  3V61 A;  2KZR A;  2W9N A;  1P1A A;  2HJ8 A;  1P9D U;  2L00 B;  4GU2 A;  4J6I A;  4DK5 A;  2IO0 B;  2L3Z A;  4ZYN A;  2JF5 A;  1WJU A;  3NZS A;  2XBB C;  4EEW A;  1GC6 A;  4EOY A;  5AZH A;  1WZ0 A;  2IZV B;  3D32 A;  2O2V B;  5AZF A;  4TQ0 A;  4NPN A;  4I6L B;  2KDB A;  2DZK A;  4MGZ E;  5J2R A;  4M8N A;  4A3O A;  3SDL C;  3A4R A;  2KD0 A;  3VAW A;  3VFK A;  3O65 B;  3ZUN A;  1UH6 A;  4JL9 A;  3ZNG C;  5TR5 A;  2DYB A;  4E71 A;  4WWP A;  2KFJ A;  1SE9 A;  5CHW A;  1GJZ A;  2KHW B;  1MG8 A;  2BPS A;  3TMP B;  3WAN A;  4F7Z A;  3DBH I;  1BT0 A;  4URK A;  5LXI B;  3QK0 A;  3DBR I;  3KVF B;  3A9K A;  3TL5 A;  4GIV A;  1WGR A;  3RZF A;  2C7M B;  1OEY J;  4NNJ B;  3HM6 X;  1WRD B;  3ZNI D;  3PLU A;  4FHJ A;  4RM8 A;  3VH3 B;  4A3P A;  1J0G A;  1KLV A;  1WY8 A;  4PS7 A;  4NY0 A;  3CSF A;  2XK5 A;  5JHB A;  3L08 A;  1ZGU B;  4BVU C;  1CMX B;  1E5W A;  2CKH B;  3UIN B;  2LVQ A;  4IC7 B;  3ALB A;  2N1W A;  5BO4 B;  1WGG A;  1WF9 A;  2ASQ A; 
#chains in the Genus database with same CATH topology
 2LI5 A;  4YXD B;  2PVG C;  2REX A;  3BVG A;  4B6W A;  1OQY A;  3U7Z A;  1AYF A;  2KTF A;  5DPT A;  2KLC A;  2FID A;  1EWY C;  5BYS A;  1WIA A;  3AI5 A;  1YX5 B;  2MX2 A;  3UQA A;  1WXA A;  4JIO U;  3Q3F A;  4LCD E;  2LMC A;  4ARI A;  4RNA A;  1XF5 L;  1TTN A;  3A9J B;  4HDQ A;  1VJK A;  4FXC A;  4IWQ A;  3PLV A;  5TSS A;  2LAS A;  3RNG C;  3Q3J A;  4E3C A;  3ZJV A;  4FN2 A;  1U4A A;  4ZYS A;  2C7N B;  3I9V 1;  3NVY A;  1AN8 A;  5FK9 C;  3TEW A;  4GB9 A;  2FCQ A;  2M0A A;  4IWO A;  1I4X A;  2KOX A;  3KWL A;  2N7J A;  4I6P A;  2AX5 A;  3AH7 A;  3AE9 B;  2LUM A;  1TZO A;  3M63 B;  2KMM A;  3VR9 B;  3RD2 A;  1T3Q A;  4B0E A;  1QOF A;  1F2R I;  2MBB B;  3CF6 E;  1V80 A;  4FJY A;  4DXG A;  4GDK A;  1XXG A;  4LNK A;  2Q5W D;  4BKS A;  2JYT A;  2AQ3 B;  2JRI B;  3UIP B;  1IGD A;  1IGC A;  1YIW A;  1M4V A;  2INN E;  2WLB A;  2RSU A;  1N61 A;  1IP9 A;  3B1L X;  1BML C;  2BS3 B;  2LUE A;  3WAO A;  4GDK B;  4AJY B;  4MGI E;  4LNO A;  2IPK D;  2VZK D;  4WUR A;  2K6D B;  5JHA A;  1LQB A;  2EKE C;  4C56 C;  4HPP A;  3NUH B;  1E7V A;  1V86 A;  5E6P A;  2UU7 A;  3P2B A;  4PS3 A;  4X57 B;  1WWT A;  2D07 B;  2V3S A;  4NJC A;  3RN9 C;  2DLB A;  3N1Z C;  1JRP A;  4F1S A;  2MSE D;  2C9W B;  3N9Y C;  3U30 A;  1B1Z A;  2PE9 A;  4FAD A;  2LD9 A;  1MFW A;  4W9I A;  1C77 A;  2JRH A;  1J8C A;  5FR3 A;  3KUZ A;  5HFY A;  2ZEQ A;  4HDO A;  4ZRI A;  2H89 B;  4EKU A;  1ROE A;  2IO1 B;  2CU1 A;  3QWZ B;  1S3S G;  2KDF B;  4KX6 B;  2RPQ A;  1LM8 B;  2KWU B;  4W9D A;  1QLB B;  5IOI A;  2N1V A;  5C23 A;  3WIM A;  2CS4 A;  4C00 A;  3M95 A;  2UWQ A;  2AYO B;  4JWS C;  2WDQ B;  4EZJ A;  4JGH B;  4ICV A;  4URK A;  5D2M B;  4BBN F;  3RYT A;  4MEM A;  5D3D A;  3L54 A;  1C4P A;  1HTO A;  2KJ6 A;  3BWU D;  2KMA A;  4E74 A;  2V3N A;  4FJV B;  3I63 C;  2MLB A;  5CHV C;  2HTH A;  1AWD A;  1WX9 A;  4F8C B;  1WM3 A;  1TKG A;  4LK0 M;  1EU3 A;  2J52 A;  2WXL A;  4OZA A;  4W9F A;  5FR6 A;  3P4P B;  4NAM A;  3AM9 A;  4P1B C;  3B2G A;  1QOB A;  2V4L A;  4M8M A;  4GOC A;  1C78 A;  3PRZ A;  4WJP A;  2WXJ A;  2CHX A;  1EM7 A;  2PE6 B;  3AE3 B;  1WXM A;  4ZRK A;  4HXD A;  2CR5 A;  3V3X A;  4UDU C;  3ML9 A;  3UF8 A;  4C7Y A;  3ZVV A;  2K9X A;  2EMT A;  1WXV A;  3VRB B;  4XWT A;  3ZRF A;  4HCP B;  4MJS B;  2SEB D;  5HKH A;  2LFI A;  3ZLZ A;  1EO6 A;  1L0Y B;  3MTN B;  2M56 B;  2WNM A;  1C1Y B;  1VLB A;  3AU5 A;  2B3A A;  4ASW C;  1YX6 B;  3DBR B;  3N1X C;  3HM3 A;  3DHI C;  4MM3 B;  1ET9 A;  1MPE A;  3NG0 A;  5EE0 A;  4N59 A;  1UWX A;  1J19 A;  1VD2 A;  4A90 A;  4BKS D;  2IY1 B;  2ZW0 A;  1LGR A;  4YSX B;  2HD5 B;  2LGY A;  4US9 A;  5JXV A;  3L17 A;  3WAM A;  1D5X C;  4AOF A;  1TIF A;  3QQ8 B;  1Q10 A;  3TCA A;  1UWM A;  2G4D B;  4ZDV A;  3B9J A;  1P0R A;  2Z59 B;  1LO5 D;  1Z5S B;  1FIQ A;  3AE7 B;  4XGA B;  3TEY A;  2W3R A;  4K7U A;  2PJH A;  1WSP A;  2RD0 A;  3AE6 B;  2CU3 A;  5AZG A;  3N30 A;  4W9K A;  3M62 B;  3QAQ A;  3WCQ A;  2XK5 B;  3NRZ A;  3WA0 A;  2BBC A;  3N20 C;  3ZQ4 A;  1V81 A;  2DAJ A;  2GB1 A;  2KAJ A;  4G11 A;  4C7Z A;  2LHD A;  3BYY B;  1I42 A;  2C7H A;  1I7H A;  3APF A;  3CST A;  1OQQ A;  4FUL A;  5DPS A;  3ZTC A;  1FRD A;  2WDR B;  3H8H A;  3AU4 A;  4KVG B;  1J7C A;  3MC8 A;  1K8R B;  1KJT A;  2LGD A;  4KGR A;  1RFK A;  2H88 B;  4GXB A;  2WHI A;  2R2Q A;  3HUI A;  2Y5B B;  4OVV A;  2IBI B;  2FAZ A;  1TY2 A;  4OHJ A;  4LTU A;  3RMK C;  3RT3 B;  2DBY A;  2KVR A;  3RNE C;  3ZKJ C;  4XDD A;  1YQ3 B;  4KGS A;  1E0Z A;  4JLC A;  3EFU A;  1JWS D;  2EKI A;  1WH3 A;  1AW7 A;  4JX1 C;  4G3X B;  1PGX A;  1FEH A;  3C8Y A;  2AL3 A;  4OVU A;  1Y56 A;  3NZU A;  3B08 A;  2YEP B;  1WR6 E;  1YD8 U;  4WJN A;  2MHJ A;  3BVM A;  4MSQ B;  2BYE A;  2CHW A;  1V5T A;  1YQ4 B;  2PLP A;  3IT6 B;  4RMA A;  2IND C;  3EFC A;  4DHJ D;  3V61 A;  1T0Q C;  2L00 B;  1MVK A;  2L3Z A;  3B2F A;  3NZS A;  1WJU A;  2RDH A;  1GC6 A;  2I2Y A;  4AS1 A;  1EU4 A;  4I6L B;  2TSS A;  1FCC C;  3ZUN A;  2QIE B;  4E71 A;  1DYQ A;  2KFJ A;  2NMQ A;  5CHW A;  1GJZ A;  2KDM A;  1MG8 A;  1EWC A;  1YN4 A;  3Q6B A;  1BT0 A;  2W54 A;  3DBR I;  3TL5 A;  5T8I A;  3ZNI D;  3R2I A;  4FHJ A;  4REZ A;  4A3P A;  4S17 A;  1XEE A;  2WGS A;  4NY0 A;  1ZGU B;  4BVU C;  1CMX B;  2LVQ A;  1WGG A;  3AEG B;  2HTM E;  1IBX A;  1N62 A;  4US8 A;  3TJP A;  2NTT A;  1YNT E;  4KGT A;  5AUI A;  3RNA C;  1GOZ A;  3PV1 A;  2ICI A;  5DCN A;  2J4X A;  3W5V B;  2R2O A;  1P7E A;  4HJK A;  2LRU A;  1QKZ A;  4TUU A;  3VR8 B;  5D94 A;  2ONQ A;  4PT5 A;  4NJ6 A;  3X23 A;  1T0S C;  2M0X A;  1QQR A;  1VZ8 A;  3TUO A;  5IA7 A;  2FBW B;  4MEL A;  1FXA A;  1SIF A;  3FAH A;  2MCN B;  3APD A;  4W9G A;  1JWU D;  1CQV A;  1XCQ L;  3NJT A;  4XZ4 A;  2WU2 B;  1G6J A;  1IYF A;  3WAP A;  2M4N A;  2G45 B;  3RPF C;  3DPD A;  2PW9 A;  2MEK A;  1SF0 A;  4BOS C;  3O13 A;  2DZJ A;  1HEZ E;  2JVC A;  2YVC A;  3RUL A;  4JQW C;  3QHT A;  5AUK A;  3R3M A;  2YLM A;  2WXN A;  4LNN A;  4LDT D;  4OZC A;  4M02 A;  2BWE S;  2JQR B;  2O2V A;  5L83 A;  2IGD A;  3ZNH B;  1E8Z A;  3FIL A;  3IBE A;  1ISN A;  2BVC A;  3AE4 B;  4NAW A;  4IW0 A;  4IDI A;  1SE3 A;  2KVZ A;  2J42 A;  3GB1 A;  1ZDX A;  2QDF A;  4WQO B;  2FUG 1;  1V9J A;  3TIX A;  3IT4 B;  2NPT A;  1F1H A;  4NAW B;  2VRR B;  1L2N A;  2GLS A;  4GN1 A;  1L6U A;  2KC1 A;  1X1M A;  3N32 A;  4IM2 A;  3N1Y C;  2NPT B;  3ONS A;  2N4F A;  1SE4 A;  3P63 A;  3EEC A;  2M17 A;  1XD3 B;  4Q2J A;  3A9J A;  1L5P A;  3VVW B;  2MBE A;  1ZOY B;  2L52 A;  2BB6 A;  3TBL D;  2GBN A;  3ZDM C;  2K8H A;  2W3S A;  2AL6 A;  4BAX A;  2WXF A;  2MJE A;  2ZPY A;  3QAR A;  1NBF C;  4AUQ C;  1V1O A;  3L0W B;  3PTF C;  3VTV A;  2NVU I;  3LJ3 A;  5C1Z A;  1E8Y A;  2L1A A;  3KW5 B;  3ECI A;  1WGK A;  4KDI C;  4BKG A;  1RLF A;  3I3T B;  2PEA A;  2JZ3 B;  2DX5 B;  1WGH A;  2QCZ A;  4NZL B;  2KKC A;  2JWZ A;  1DOI A;  3VUY A;  2J7Q B;  1UEL A;  2GI9 A;  3IFW B;  4IM3 A;  4WWN A;  2K1F A;  4LNI A;  4FA6 A;  5J18 A;  4FHK A;  5DPW A;  3R7R A;  1P7F A;  3K9O B;  1Q5W B;  2KDE B;  4W9J A;  2KTR A;  1EUV B;  3ZTD A;  1TY0 A;  1ZP0 B;  4GDL A;  4KZC A;  2V9H A;  3EUB 2;  2PPH A;  4C4V A;  2O6V D;  3U52 E;  2KTR B;  1TS4 A;  4WWM A;  4IWP A;  1MI0 A;  5HHD G;  3A4S C;  3U7D A;  4RH6 A;  1XLO A;  4GDL B;  3IVF A;  2M8S A;  1FRR A;  2ZW1 A;  4YWG G;  4A20 A;  2NR2 A;  4C4V B;  1JWA D;  1SBB B;  2AQ2 B;  4FLH A;  3WAL A;  2SAK A;  4AP4 C;  4ACF A;  1F77 A;  3NZ3 A;  1UNS A;  3PZ7 A;  2IY0 B;  1WRI A;  2J0K A;  4KKJ A;  3KQ4 A;  2IGG A;  4M0W A;  1SIJ A;  1FMA D;  1E10 A;  3DBL B;  3PPA A;  5D7G A;  3LB8 C;  1TKY A;  1UGJ A;  1ET6 A;  1ZE3 D;  3DCG A;  2DZI A;  2J0J A;  3KUD B;  2IDY A;  3ZIM A;  2BYV E;  1UD7 A;  4C80 A;  2K39 A;  1WMH A;  1SJE D;  4M0W B;  1WYW B;  3UI3 A;  3BII D;  1R7S A;  3VH4 B;  2V3P A;  2LJ5 A;  4NQL B;  1JQ4 A;  1WMH B;  2W55 A;  2EEL A;  3A9K B;  1XLQ A;  1DOX A;  1R4N B;  2MJD A;  1C4C A;  2WDV B;  4AJW A;  3AN1 A;  5CHF A;  1HTQ A;  4KSL C;  4WAF A;  2KWC A;  4WIP A;  1FCL A;  3PT2 B;  1RWS A;  1S1Q B;  1TGZ B;  4ANX A;  3PZD A;  3B0A A;  1FFV A;  1ZDV A;  5C2T B;  1MG4 A;  1JCK B;  2PTL A;  2K0P A;  3OJ4 B;  3C0R B;  2VH1 A;  3AMZ A;  2LGS A;  3T8M A;  3MJW A;  3OJ3 A;  1OGW A;  3LYY A;  2KDI A;  3MC0 B;  3JYU A;  3AUL A;  2JSV X;  4MJS A;  2K8C A;  3NVZ A;  3AEC B;  2ACZ B;  2A5U A;  4ZOH C;  2Y5C A;  5CX3 A;  1Y8R C;  1MHH E;  3APC A;  4RGO S;  4HKQ A;  1SSN A;  1YQB A;  2KMC A;  1ZKH A;  2WX0 A;  3HRD D;  2IO3 B;  2X38 A;  2QEJ C;  2MWS B;  3PRE A;  4MM3 A;  1Z2M A;  4GMV A;  4WH4 A;  2FCN A;  2LGX A;  2WX1 A;  4II2 B;  4KV2 A;  3KYD D;  3JSV A;  5E6N A;  1CK1 A;  1OEY A;  3S2A A;  1K52 A;  2R61 A;  2BTE A;  2MH7 A;  3BK1 A;  3HK0 A;  4XE0 A;  3ZNZ B;  1WFY A;  5IKC M;  4P16 A;  2RR9 A;  2Y3A A;  3JSV B;  3SFD B;  2KZR A;  1P1A A;  1P9D U;  4ZYN A;  1C76 A;  1GPX A;  2AQ1 B;  2D3A A;  3IAS 1;  5J2R A;  5BYR A;  4M8N A;  3SDL C;  3VFK A;  2DWQ A;  1JWM D;  4HEA 1;  2KHW B;  2JYE A;  1BXT A;  3WAN A;  3GP7 A;  1WGR A;  3HM6 X;  1WRD B;  3PLU A;  1WY8 A;  4PS7 A;  5H92 C;  1E7P B;  1WYG A;  2XK5 A;  4ZRQ A;  5JHB A;  3L08 A;  1E5W A;  4IC7 B;  4YT0 B;  3MFG A;  4GLS C;  1I4R A;  1I4P A;  1A70 A;  3AB5 A;  1L7Y A;  1L0X B;  2KYW A;  2BWF A;  4CHK A;  1EF5 A;  1D5Z C;  3DBL I;  1FFU A;  3H6N A;  3DDC B;  1D6E C;  2OOB B;  3MJ5 A;  1OTR B;  2UYZ B;  2L8J A;  3NOB A;  4KSK C;  1A5R A;  4DBG A;  1FD6 A;  1B9R A;  2KK8 A;  2WXQ A;  3UGB B;  2CJO A;  2MP2 A;  3PZ8 A;  3JW0 X;  2FUH B;  1PFD A;  4TKN A;  4L1B A;  2DNF A;  5LNK 1;  2FCS A;  2MW5 A;  1QOG A;  3FKY A;  4K1R B;  4HVB A;  3MC9 A;  4HRO A;  1ZPS A;  1WXQ A;  2MP2 B;  1WI0 A;  1GC7 A;  1FNU A;  4OVZ A;  3Q3O C;  4L2Y A;  5HI1 A;  1KH0 A;  4XDC A;  2XN9 C;  2LZ6 A;  4MGK E;  1L0V B;  3H7S A;  1LFD A;  3SU8 X;  1SB3 C;  1KRH A;  3DVG Y;  5EE1 A;  3T9L A;  2KLG A;  2WS3 B;  4OW0 A;  5KHQ A;  3LDZ E;  1J7A A;  3LXF A;  2QIL A;  1K50 A;  3SFE B;  1KM7 A;  1JML A;  3NS1 A;  2K3U A;  4KDL B;  2WYQ A;  3PRP B;  4XYC A;  1HZ6 A;  1DOY A;  2OJR A;  4IUM B;  1C79 A;  2GBK A;  3QJZ A;  2RMM A;  4WJO A;  2N0S B;  2CHZ A;  4TSS A;  2YEP F;  3RFZ B;  1NYR A;  5CTR C;  2D3G A;  4G0N B;  4DHZ E;  4ZRJ A;  4GGQ A;  1I4G A;  2KX3 A;  1OQR A;  2V1Y A;  5G5H A;  3DBH B;  1D3Z A;  4KIK A;  4CO7 A;  4W9E A;  2LVP A;  4IM0 A;  3AE8 B;  4YTM B;  1LXD A;  3PRM B;  1T0Y A;  2IYD B;  2L0F A;  2K6Q A;  4KIK B;  1JRU A;  2ZZP B;  3CIR B;  1L4D B;  2EMS A;  1E8W A;  1TS5 A;  2D3C A;  3OWE B;  3J9C A;  2L0T A;  3Q8C A;  3P4Q B;  2G1E A;  2WXH A;  1T5X D;  1Q0W B;  4DQO C;  1JRO A;  1PUT A;  3N3K B;  1QT9 A;  1V2Y A;  3W9C B;  5GMV A;  4B9K A;  3V62 A;  2LHE A;  1KF6 B;  5IO9 A;  1HE8 A;  2D10 A;  3HHM A;  5E6O A;  2N7D A;  5EDS A;  3A33 B;  4RM9 A;  2DHZ A;  4NJ7 A;  3RNB C;  1NDD A;  3V60 A;  3Q14 C;  4JE3 B;  5IAA C;  3E9S A;  3DWM A;  1NYQ A;  2MA9 B;  3NVW A;  3I57 A;  3VRA B;  4RGT A;  2OHF A;  4RFB A;  1YN3 A;  4XX5 A;  2GBR A;  1C9F A;  3DQV A;  2WXK A;  1UGM A;  1R4M B;  3DOW A;  1QOA A;  1TJE A;  4LLG M;  5BMH A;  2M1M A;  3PO0 A;  2GRI A;  4IG7 B;  2V4I B;  5EE9 A;  1Q1O A;  4ICU A;  3URY A;  2KAN A;  1JWB D;  1YOV B;  2KQ7 A;  1I35 A;  4A6Q A;  1XLP A;  3CWI A;  2KN5 A;  2LJI A;  2D11 A;  4XWW A;  2MBQ A;  2L76 A;  3EC8 A;  4HJG E;  1TBE A;  2G4S A;  2GMI C;  1UF0 A;  4RF0 A;  2VZK B;  2KC2 A;  4D2K A;  2G9H D;  1PGB A;  2L32 A;  3BVZ A;  2KT7 A;  1N6Z A;  2WXI A;  4FBJ B;  2Z0E B;  1M94 A;  2NBW B;  2GOW A;  3Q3N C;  3PSE B;  5LLI A;  3VTW A;  3EGR A;  2LXC A;  2JU6 X;  3MHS D;  1E9M A;  2L7R A;  3R8B A;  1WZ3 A;  1E6E B;  3ZXR A;  2BB5 A;  4EZL A;  2JX5 A;  3Q2A C;  3GE8 C;  4XC2 A;  3DVN U;  4HRS A;  4K7S A;  4W9C A;  4DWF A;  2QJL A;  3NVV A;  1VRA B;  4WJQ A;  3AE1 B;  1TYG B;  2FE8 A;  3ZYY X;  3Q8B A;  1N5X A;  3OG5 A;  1IUE A;  1SEB D;  4YL8 A;  5E6J A;  4B95 A;  4H2A A;  4USA A;  3MP9 A;  4WWO A;  3HIZ A;  2JUO A;  3P42 A;  3ZXV A;  1RM6 C;  4EE2 A;  3P1M A;  3PHX B;  4W9H A;  3Q69 A;  4BBN C;  1WJ4 A;  2CJN A;  5IN7 A;  2W82 A;  1C3T A;  1K51 A;  5JZE B;  3H1U A;  3MHZ A;  2ZNV B;  3HVD A;  2ZCB A;  4BFR A;  1NI2 A;  2JZP A;  3EHV A;  5G5G A;  1N60 A;  5GXG B;  1KTK A;  3Q8F A;  1HZ5 A;  2LEK A;  4HWI B;  3AEB B;  2L05 A;  4LNF A;  4PYU A;  2BKF A;  1MHX A;  2LVO A;  1VZ6 A;  4J3O D;  1FM0 D;  4B0M A;  2WP9 B;  4NQK E;  1E8X A;  2E6X A;  2QSD A;  1D5M C;  3P4R B;  5IP4 D;  2DAF A;  4HK2 A;  1L6V A;  3RI7 C;  3SD5 A;  3AEF B;  2G3Q B;  1WGD A;  1F0Z A;  2QHO A;  5LXH A;  2K5P A;  2NS5 A;  3PVL A;  2BGF A;  2KAC A;  1ZW7 A;  1SJH D;  3PS6 A;  4TMA B;  3ML8 A;  2WQY B;  1CJE A;  3KWV A;  1T0R C;  2XEW A;  4BOZ B;  1R4M I;  1V5O A;  3AXC A;  3PGE A;  3DHG C;  4YTN B;  5MPO A;  1HQR D;  4HPM B;  4MH0 E;  1E7U A;  2HDE A;  4PS8 A;  3DWG C;  3KLS X;  2J0M A;  1EF1 A;  2N9E B;  1UUP A;  1L4Z B;  3DBS A;  3VUX A;  1FXT B;  4ZRP A;  3W5U B;  1P98 A;  2ZCC A;  4S0R A;  2KJR A;  4W9L A;  1SE2 A;  1ZXH A;  2MBH A;  1H8C A;  1VR9 A;  3T3N A;  2M19 A;  2LXA A;  3ENE A;  1WM2 A;  1BUI C;  2IO0 B;  4DK5 A;  2JF5 A;  2L83 A;  2XBB C;  4EEW A;  2V0G A;  1TS3 A;  3FC4 A;  3TSS A;  4EOY A;  1XCT L;  2KDB A;  2DZK A;  4MGZ E;  4A3O A;  2MJ3 A;  2KD0 A;  3VAW A;  1NEN B;  4JL9 A;  5TR5 A;  3Q3M C;  4PK1 A;  3ABV B;  2BPS A;  4HKZ E;  4F7Z A;  5LXI B;  2PKO A;  5EE3 A;  3QK0 A;  4L23 A;  4RF1 A;  3A9K A;  3E56 A;  4GIV A;  2Y5P A;  4NNJ B;  1GB1 A;  4RM8 A;  3VH3 B;  1KLV A;  2I38 A;  4OZB A;  2CKH B;  3UIN B;  3IXS A;  2N1W A;  5BO4 B;  1WF9 A;  2JY6 A;  2NBV B;  1ZUD 2;  4RCO A;  1QF6 A;  1T6B X;  2DYO A;  1PDX A;  4AWJ A;  1KLU D;  4TV3 A;  4BZA A;  2DZM A;  4HCN B;  2FNJ B;  2RDG A;  4MT5 A;  1KLG D;  2KXJ A;  1UBI A;  5D3I B;  2MBO A;  4CYE A;  3GZN B;  1GAQ B;  4KZ0 A;  1XQQ A;  2INP E;  1GNU A;  2KX0 A;  3W2D A;  1I4Q A;  1N5W A;  1P3Q U;  5H8Y E;  3GE3 C;  5C3J B;  3ZJU A;  4RGM A;  4DDI D;  3OAW A;  2WXM A;  1FPY A;  1DGJ A;  1VCB A;  3V6E B;  1NEK B;  1F9J A;  1N63 A;  3NY5 A;  1D4B A;  2QC8 A;  1FNW A;  2FCM A;  5FKA C;  1WJ6 A;  2N9L A;  2NBU A;  2RGF A;  4RGN A;  4MSM B;  3DVG X;  1TZ1 A;  2JZZ A;  4A55 A;  3DVN V;  1F52 A;  2WWZ A;  2JXT A;  2DYM A;  3U2S C;  1V1P A;  1HXY D;  1NI3 A;  2C5L C;  4KKI A;  2NTS A;  1WX8 A;  4N58 A;  4MDK E;  1PGA A;  2K22 A;  4DHJ B;  2ZJD A;  1WX7 A;  2PVO D;  3SHQ A;  4YTP B;  2NCN A;  3NHE B;  3ZO5 B;  1V1P B;  3RZW C;  1VZ7 A;  4P7I A;  3BY4 B;  1YJI A;  4EFO A;  3C19 A;  4DXA B;  4K7W A;  1CZP A;  3AE2 B;  2B76 B;  3QC8 B;  5AEK B;  1RAX A;  4TQ1 A;  2WXR A;  4AQ7 A;  3RCZ A;  1RFA A;  2J53 A;  3VXW A;  1KOT A;  3X0W A;  2OJW A;  3ZJT A;  3H9D A;  2IGH A;  1STE A;  1RRB A;  2AEH A;  1JAL A;  2BKR B;  4M00 A;  2BYT A;  1SXT A;  2XNA C;  2N9K A;  3ZDT A;  2JPH A;  4LJP B;  3BIN A;  2BT6 A;  1UZX B;  2BW2 A;  3VUW A;  2N9X A;  4DXF A;  3V6C B;  2WU5 B;  5L95 C;  3EA6 A;  5KHO A;  1E90 A;  3L10 B;  2JT4 B;  5I4D A;  1WXS A;  4PYZ A;  3UQB A;  3SR6 A;  2KQS A;  2BF8 B;  2KWV B;  1FO4 A;  1K53 A;  3KH0 A;  3QX1 A;  2LRW A;  1WR1 A;  3U8Z A;  2Z8L A;  2D3B A;  3RNF C;  2GBJ A;  4P1C C;  3ETR A;  5D6J B;  3AEA B;  1F2R C;  2KN4 A;  3GOE A;  1V97 A;  1YMH E;  2WXO A;  3AEE B;  2JXX A;  1V8C A;  5G55 A;  2FIF A;  2DEN B;  2IO2 B;  5JH5 C;  2KFK A;  3K9P B;  2Z0D B;  4R3D A;  1KFY B;  1TKE A;  3L13 A;  4IOI E;  3KUC B;  1H4R A;  4WQM A;  1R4N I;  1OFF A;  3ZW3 A;  3VTU A;  1C4A A;  1WE6 A;  2D5G A;  3KYC D;  2KFK B;  2D2Q A;  4FJZ A;  2KO3 A;  3VDZ A;  4A9A A;  1XT9 B;  4EZK A;  1MJD A;  3GZN I;  1V6E A;  2WXG A;  3QCA A;  3R2T A;  4LDT B;  3T3O A;  4ANW A;  3VQI A;  2MRP A;  1RYJ A;  4JPS A;  3IG3 A;  2ON8 A;  3RUI B;  4N9F 4;  4ZHP A;  4K81 A;  4HLE A;  3PHW B;  1QZE A;  4JWU C;  1WE7 A;  2K8B A;  5BMG A;  3L4P A;  3QA8 A;  1XO3 A;  4O1N A;  2K25 A;  4EUT A;  1ENF A;  2AWT A;  3W1S C;  2I1J A;  5BMI A;  4I6N B;  4ZHO A;  2X8X X;  1GG3 A;  3H7P A;  3DHH C;  5J17 A;  1V49 A;  2KWD A;  4DDG D;  3BK2 A;  3CMM B;  1TS2 A;  5BYQ A;  3R7Q A;  1TT5 B;  2BYF A;  2I1K A;  4G50 A;  2ZNV C;  4P6V F;  1GB4 A;  1FXI A;  3H7P B;  4QAY A;  2PMV A;  3A1Q A;  4K3C A;  3R66 C;  1PQS A;  4M01 A;  3W1Y A;  1ACC A;  3HVZ A;  2WXP A;  4HPL B;  3U4E G;  2LWP A;  3RNC C;  1ZXI A;  2HE7 A;  3A1Q B;  1WGY A;  4ANV A;  2N7E A;  1QIL A;  4LJO B;  1GUA B;  4CQN A;  3ZRC A;  1YJ1 A;  2E3T A;  4ANU A;  3ZGZ A;  3BZD B;  4GSW A;  3AV8 A;  3NS8 A;  2INC C;  5DPR A;  3I5J C;  5HG2 A;  3AE5 B;  2RDB C;  3IHP C;  1IPG A;  2IJ0 A;  2C60 A;  1IBX B;  2O6V A;  3Q8A A;  2LGI A;  3GS2 A;  2ZVN A;  4A8X C;  1FNV A;  2KQ4 X;  1PYW D;  3M3J A;  4DHZ B;  2PIA A;  2JWU A;  2N9P C;  2O6V B;  4N6E B;  2ZPN A;  3BYT B;  3IAM 1;  3OLM D;  2A4Z A;  1VDV A;  1AAR A;  4II3 B;  1ESF A;  4MGY E;  3JVZ X;  2BS2 B;  1WJN A;  2WDT B;  4ITK A;  1J7B A;  1UBQ A;  3UIO B;  2GBM A;  1JW9 D;  3VHT C;  4BKT A;  2BS4 B;  4YSZ B;  3TEX A;  2MQJ A;  3QIJ A;  1HA5 A;  4WAA A;  2KNB A;  1NVI D;  2QMT A;  4K3B A;  3W1S A;  3TEZ A;  2RPV A;  1I4H A;  5G2N A;  3Q8E A;  1SGH A;  2ZVO A;  3L16 A;  2KJH B;  2W9N A;  2HJ8 A;  4J6I A;  4GU2 A;  4IKG A;  5AZH A;  1WZ0 A;  3V05 A;  2IZV B;  3D32 A;  2O2V B;  5AZF A;  4TQ0 A;  4NPN A;  2OED A;  4MH8 A;  3A4R A;  3FIL B;  3O65 B;  1UH6 A;  3ZNG C;  2DYB A;  3AED B;  4MAC A;  4WWP A;  4YSY B;  1SE9 A;  3TMP B;  3DBH I;  2BQQ A;  3SEB A;  1YN5 A;  3KVF B;  2HJ1 A;  3RZF A;  2C7M B;  1OEY J;  1XLN A;  3P4S B;  4ARC A;  1J0G A;  3CSF A;  1YJJ A;  3ALB A;  2VH2 A;  2ASQ A; 
#chains in the Genus database with same CATH homology
 2JY6 A;  2NBV B;  1L7Y A;  2LI5 A;  2REX A;  2DYO A;  4AWJ A;  4TV3 A;  4B6W A;  2BWF A;  1OQY A;  4CHK A;  1EF5 A;  2DZM A;  2KTF A;  5DPT A;  4HCN B;  3DBL I;  3H6N A;  2KLC A;  3TJP A;  2FID A;  3DDC B;  2FNJ B;  3PV1 A;  2OOB B;  1WIA A;  3AI5 A;  1YX5 B;  1OTR B;  2KXJ A;  1UBI A;  2UYZ B;  5DCN A;  2MX2 A;  2L8J A;  2MBO A;  2R2O A;  3NOB A;  4CYE A;  4KSK C;  1WXA A;  4HJK A;  4JIO U;  3Q3F A;  4LCD E;  3UQA A;  1A5R A;  2LRU A;  4TUU A;  4KZ0 A;  4DBG A;  1TTN A;  1XQQ A;  3A9J B;  4HDQ A;  2KK8 A;  5D94 A;  1GNU A;  2KX0 A;  3UGB B;  2MP2 A;  4IWQ A;  4NJ6 A;  1P3Q U;  3PLV A;  3X23 A;  3JW0 X;  2LAS A;  3Q3J A;  2M0X A;  2FUH B;  4E3C A;  5IA7 A;  4MEL A;  4TKN A;  4FN2 A;  1U4A A;  2C7N B;  1SIF A;  4DDI D;  3OAW A;  2MCN B;  2FCS A;  2MW5 A;  1VCB A;  4K1R B;  3APD A;  4HVB A;  4GB9 A;  4W9G A;  3V6E B;  2FCQ A;  2MP2 B;  1F9J A;  4XZ4 A;  1G6J A;  1WI0 A;  3NY5 A;  2KOX A;  4IWO A;  1GC7 A;  4I6P A;  2FCM A;  1WJ6 A;  1IYF A;  3WAP A;  2M4N A;  2G45 B;  3M63 B;  3DPD A;  2NBU A;  3RD2 A;  2LZ6 A;  4MGK E;  2RGF A;  3H7S A;  1LFD A;  3SU8 X;  4MSM B;  3DVG X;  1TZ1 A;  2JZZ A;  2MBB B;  3DVG Y;  3T9L A;  3CF6 E;  2KLG A;  1V80 A;  3DVN V;  4FJY A;  2WWZ A;  4GDK A;  4BOS C;  2DYM A;  5KHQ A;  4BKS A;  2C5L C;  1WX8 A;  2DZJ A;  3LDZ E;  2JRI B;  2JVC A;  2YVC A;  3UIP B;  3RUL A;  4JQW C;  4MDK E;  1YIW A;  3QHT A;  1KM7 A;  3R3M A;  2YLM A;  4KDL B;  2RSU A;  2WYQ A;  3PRP B;  1IP9 A;  4DHJ B;  2OJR A;  3B1L X;  2ZJD A;  4LDT D;  1WX7 A;  4IUM B;  3SHQ A;  2LUE A;  2GBK A;  2BWE S;  2NCN A;  3NHE B;  2O2V A;  4GDK B;  3QJZ A;  3WAO A;  4MGI E;  4WJO A;  3ZO5 B;  4AJY B;  2CHZ A;  5L83 A;  3ZNH B;  1E8Z A;  3RZW C;  3IBE A;  4P7I A;  4EFO A;  3BY4 B;  2K6D B;  5JHA A;  1ISN A;  1LQB A;  5CTR C;  4DXA B;  4K7W A;  2D3G A;  4G0N B;  2EKE C;  4DHZ E;  4NAW A;  4ZRJ A;  4GGQ A;  4IW0 A;  2KX3 A;  1E7V A;  3QC8 B;  2V1Y A;  1V86 A;  5AEK B;  1RAX A;  1D3Z A;  5E6P A;  4PS3 A;  3P2B A;  4KIK A;  4TQ1 A;  4CO7 A;  4X57 B;  4W9E A;  2D07 B;  2V3S A;  2LVP A;  4IM0 A;  4WQO B;  1V9J A;  4F1S A;  1LXD A;  3TIX A;  2NPT A;  3RCZ A;  1RFA A;  3VXW A;  2MSE D;  1KOT A;  3PRM B;  2C9W B;  4NAW B;  3X0W A;  2VRR B;  1L2N A;  3H9D A;  1T0Y A;  3U30 A;  2IYD B;  2L0F A;  2PE9 A;  4FAD A;  1RRB A;  2K6Q A;  4GN1 A;  4KIK B;  2LD9 A;  2AEH A;  4W9I A;  2JRH A;  1JRU A;  2BKR B;  1J8C A;  2ZZP B;  3KUZ A;  2EMS A;  2KC1 A;  2ZEQ A;  1X1M A;  3N32 A;  1E8W A;  3ZDT A;  2JPH A;  4HDO A;  4IM2 A;  4ZRI A;  4LJP B;  4EKU A;  2NPT B;  3BIN A;  3ONS A;  2N4F A;  2L0T A;  2IO1 B;  1UZX B;  2CU1 A;  3VUW A;  1Q0W B;  3QWZ B;  2N9X A;  1S3S G;  2KDF B;  3EEC A;  3N3K B;  2RPQ A;  1LM8 B;  1V2Y A;  2KWU B;  2M17 A;  4W9D A;  1XD3 B;  3V6C B;  3A9J A;  2N1V A;  5C23 A;  3WIM A;  2CS4 A;  5GMV A;  2MBE A;  5KHO A;  3M95 A;  2UWQ A;  3V62 A;  2AYO B;  3VVW B;  1E90 A;  3L10 B;  2JT4 B;  4B9K A;  1WXS A;  1HE8 A;  2D10 A;  4PYZ A;  3UQB A;  3HHM A;  5E6O A;  2N7D A;  2KQS A;  2BF8 B;  4EZJ A;  2KWV B;  3TBL D;  5EDS A;  5L95 C;  3KH0 A;  3A33 B;  2LRW A;  2GBN A;  1WR1 A;  3QX1 A;  4ICV A;  4JGH B;  4RM9 A;  2DHZ A;  2K8H A;  5D2M B;  3U8Z A;  3ZDM C;  4BBN F;  2GBJ A;  2AL6 A;  2ZPY A;  4NJ7 A;  5D6J B;  3QAR A;  4MEM A;  3RYT A;  1NBF C;  1NDD A;  3L54 A;  4AUQ C;  3V60 A;  3GOE A;  2KJ6 A;  2KMA A;  3L0W B;  3PTF C;  5IAA C;  3VTV A;  4E74 A;  2MA9 B;  2JXX A;  5G55 A;  2FIF A;  2NVU I;  4FJV B;  2DEN B;  2IO2 B;  5JH5 C;  3LJ3 A;  4XX5 A;  5C1Z A;  2MLB A;  1E8Y A;  2GBR A;  5CHV C;  2HTH A;  2KFK A;  3KW5 B;  1WX9 A;  3K9P B;  4F8C B;  2Z0D B;  3DQV A;  3ECI A;  4KDI C;  1WM3 A;  4BKG A;  1RLF A;  3I3T B;  4W9F A;  5FR6 A;  1UGM A;  2PEA A;  2JZ3 B;  3L13 A;  2DX5 B;  3KUC B;  3DOW A;  1WGH A;  2KKC A;  2M1M A;  1H4R A;  2V4L A;  2JWZ A;  4IG7 B;  4GOC A;  4M8M A;  1R4N I;  1Q1O A;  3ZW3 A;  4ICU A;  3VTU A;  2KAN A;  1WE6 A;  3PRZ A;  3KYC D;  2KFK B;  2D2Q A;  4FJZ A;  2KO3 A;  4WJP A;  3VUY A;  3VDZ A;  2J7Q B;  1UEL A;  3IFW B;  4IM3 A;  4WWN A;  2KQ7 A;  2CHX A;  1I35 A;  1XT9 B;  2K1F A;  4FA6 A;  4EZK A;  5J18 A;  2PE6 B;  4FHK A;  5DPW A;  1WXM A;  3R7R A;  3GZN I;  4ZRK A;  1V6E A;  3K9O B;  2KN5 A;  4HXD A;  3QCA A;  1Q5W B;  2CR5 A;  2KDE B;  2D11 A;  3ML9 A;  3UF8 A;  4W9J A;  2KTR A;  4LDT B;  3ZVV A;  2MBQ A;  4ANW A;  2L76 A;  1EUV B;  2EMT A;  3EC8 A;  3ZTD A;  3VQI A;  1TBE A;  1WXV A;  4GDL A;  2G4S A;  4KZC A;  2GMI C;  2MRP A;  3ZRF A;  2KC2 A;  3IG3 A;  4HCP B;  4MJS B;  2PPH A;  4FBJ B;  5HKH A;  2Z0E B;  1M94 A;  2NBW B;  2O6V D;  3RUI B;  2GOW A;  3ZLZ A;  1EO6 A;  4N9F 4;  3MTN B;  2KTR B;  4K81 A;  4IWP A;  3PSE B;  5LLI A;  3VTW A;  4HLE A;  1C1Y B;  3A4S C;  3U7D A;  3AU5 A;  2B3A A;  2LXC A;  3PHW B;  1QZE A;  3IVF A;  3MHS D;  4GDL B;  2M8S A;  1WE7 A;  2K8B A;  4A20 A;  3QA8 A;  2NR2 A;  2K25 A;  4ASW C;  2L7R A;  4EUT A;  1WZ3 A;  1YX6 B;  4FLH A;  3HM3 A;  2AWT A;  3W1S C;  4EZL A;  4XC2 A;  3WAL A;  2I1J A;  3DVN U;  4I6N B;  4K7S A;  4W9C A;  4AP4 C;  4DWF A;  1GG3 A;  3H7P A;  5J17 A;  1V49 A;  4DDG D;  4WJQ A;  1J19 A;  3CMM B;  1VD2 A;  2IY0 B;  4BKS D;  3R7Q A;  2J0K A;  2IY1 B;  4YL8 A;  4B95 A;  2HD5 B;  2BYF A;  2I1K A;  4G50 A;  2LGY A;  2ZNV C;  3PPA A;  5D7G A;  4WWO A;  3HIZ A;  3L17 A;  3DCG A;  3WAM A;  3H7P B;  2DZI A;  2J0J A;  3KUD B;  2JUO A;  3ZIM A;  4AOF A;  3PHX B;  2BYV E;  1UD7 A;  4W9H A;  3QQ8 B;  4BBN C;  2K39 A;  1WJ4 A;  1WMH A;  4M0W B;  3TCA A;  1WYW B;  3A1Q A;  2G4D B;  4ZDV A;  1C3T A;  1P0R A;  3R66 C;  5JZE B;  3H1U A;  2Z59 B;  1PQS A;  3VH4 B;  3W1Y A;  2ZNV B;  2LJ5 A;  2ZCB A;  4BFR A;  4NQL B;  1Z5S B;  1NI2 A;  3EHV A;  4HPL B;  4K7U A;  2LWP A;  2PJH A;  1WMH B;  2HE7 A;  3A1Q B;  1WGY A;  2RD0 A;  4ANV A;  3A9K B;  5AZG A;  2N7E A;  4HWI B;  3N30 A;  4LJO B;  1GUA B;  4AJW A;  2L05 A;  4W9K A;  5CHF A;  3M62 B;  4KSL C;  2KWC A;  3ZRC A;  1YJ1 A;  4PYU A;  3QAQ A;  4ANU A;  3PT2 B;  2XK5 B;  4GSW A;  1S1Q B;  1TGZ B;  4ANX A;  3PZD A;  2BKF A;  3B0A A;  3NS8 A;  3WA0 A;  2LVO A;  5DPR A;  1V81 A;  2DAJ A;  3OJ4 B;  3C0R B;  4G11 A;  1I42 A;  2C7H A;  4NQK E;  3T8M A;  3APF A;  3CST A;  1E8X A;  4FUL A;  3IHP C;  1IPG A;  3MJW A;  3OJ3 A;  1OGW A;  2C60 A;  5DPS A;  3ZTC A;  2KDI A;  2O6V A;  2DAF A;  4HK2 A;  3AU4 A;  3JYU A;  2ZVN A;  4KVG B;  3SD5 A;  3AUL A;  1K8R B;  1KJT A;  2LGD A;  4MJS A;  2K8C A;  2G3Q B;  4GXB A;  1WGD A;  2R2Q A;  2QHO A;  5LXH A;  2Y5B B;  4OVV A;  2IBI B;  2FAZ A;  3M3J A;  2NS5 A;  4DHZ B;  2N9P C;  3PVL A;  2BGF A;  3RT3 B;  2O6V B;  2A5U A;  1ZW7 A;  2KVR A;  3ZKJ C;  5CX3 A;  1Y8R C;  3APC A;  3PS6 A;  1YQB A;  2KMC A;  1ZKH A;  2WX0 A;  2ZPN A;  3ML8 A;  4JLC A;  3EFU A;  2IO3 B;  3OLM D;  1WH3 A;  2A4Z A;  2MWS B;  1AAR A;  2XEW A;  3PRE A;  4BOZ B;  4MM3 A;  1R4M I;  1Z2M A;  1V5O A;  3AXC A;  3PGE A;  4II3 B;  4G3X B;  4GMV A;  4MGY E;  3JVZ X;  2FCN A;  2AL3 A;  4OVU A;  4HPM B;  1WJN A;  2LGX A;  2WX1 A;  4MH0 E;  1E7U A;  2WDT B;  4PS8 A;  4II2 B;  4KV2 A;  3KYD D;  3NZU A;  1UBQ A;  3UIO B;  2GBM A;  3JSV A;  5E6N A;  3VHT C;  2J0M A;  1OEY A;  1EF1 A;  3B08 A;  4BKT A;  3S2A A;  2N9E B;  1WR6 E;  1YD8 U;  4WJN A;  3DBS A;  2MQJ A;  3QIJ A;  4WAA A;  2KNB A;  1FXT B;  3HK0 A;  3VUX A;  3ZNZ B;  1P98 A;  2ZCC A;  1WFY A;  4MSQ B;  3W1S A;  2KJR A;  4W9L A;  2BYE A;  2MBH A;  2CHW A;  1H8C A;  5G2N A;  1V5T A;  1SGH A;  2RR9 A;  2ZVO A;  2LXA A;  3ENE A;  4RMA A;  3L16 A;  1WM2 A;  3JSV B;  4DHJ D;  2KJH B;  3V61 A;  2KZR A;  2W9N A;  1P1A A;  2HJ8 A;  1P9D U;  2L00 B;  4GU2 A;  4J6I A;  4DK5 A;  2IO0 B;  2L3Z A;  4ZYN A;  2JF5 A;  1WJU A;  3NZS A;  2XBB C;  4EEW A;  1GC6 A;  4EOY A;  5AZH A;  1WZ0 A;  2IZV B;  3D32 A;  2O2V B;  5AZF A;  4TQ0 A;  4NPN A;  4I6L B;  2KDB A;  2DZK A;  4MGZ E;  5J2R A;  4M8N A;  4A3O A;  3SDL C;  3A4R A;  2KD0 A;  3VAW A;  3VFK A;  3O65 B;  3ZUN A;  1UH6 A;  4JL9 A;  3ZNG C;  5TR5 A;  2DYB A;  4E71 A;  4WWP A;  2KFJ A;  1SE9 A;  5CHW A;  1GJZ A;  2KHW B;  1MG8 A;  2BPS A;  3TMP B;  3WAN A;  4F7Z A;  3DBH I;  1BT0 A;  4URK A;  5LXI B;  3QK0 A;  3DBR I;  3KVF B;  3A9K A;  3TL5 A;  4GIV A;  1WGR A;  3RZF A;  2C7M B;  1OEY J;  4NNJ B;  3HM6 X;  1WRD B;  3ZNI D;  3PLU A;  4FHJ A;  4RM8 A;  3VH3 B;  4A3P A;  1J0G A;  1KLV A;  1WY8 A;  4PS7 A;  4NY0 A;  3CSF A;  2XK5 A;  5JHB A;  3L08 A;  1ZGU B;  4BVU C;  1CMX B;  1E5W A;  2CKH B;  3UIN B;  2LVQ A;  4IC7 B;  3ALB A;  2N1W A;  5BO4 B;  1WGG A;  1WF9 A;  2ASQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...