1SE9A

Structure of at3g01050, a ubiquitin-fold protein from arabidopsis thaliana
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
101
structure length
101
Chain Sequence
b'EAEVHNQLEIKFRLTDGSDIGPKAFPDATTVSALKETVISEWPREKENGPKTVKEVKLISAGKVLENSKTVKDYRSPVSNLAGAVTTMHVIIQAPVTEKEK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ubiquitin family
publication title Cell-free protein production and labeling protocol for NMR-based structural proteomics.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Plant protein
total genus 21
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2004-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13881 Rad60-SLD_2 Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1se9A00
2J0KA 3PHWB 1Q1OA 1XD3B 3PLUA 1HE8A 3BINA 4WWNA 3PGEA 1OEYA 4BKSA 2BYVE 3EHVA 4II2B 4NJ6A 2JZ3B 2LD9A 3KW5B 1JRUA 2O2VB 2BF8B 2KX0A 2HD5B 3H9DA 1UGMA 3NY5A 3ZNID 2N1VA 4E3CA 4B6WA 2MSED 3NHEB 3WAOA 2G4SA 3JSVB 4I6NB 3SU8X 2JXXA 3PSEB 2LI5A 2KANA 2DYBA 2BGFA 2CR5A 3W1SC 4ANWA 2AEHA 2ZEQA 2BPSA 2KQ7A 3QQ8B 2ZVNA 3KUZA 3UF8A 1WXVA 3PLVA 3ZDMC 3H6NA 2OJRA 5LXHA 3WIMA 2M1MA 4KDLB 1RAXA 3RZWC 3ZW3A 4DWFA 1IP9A 2PE9A 4M8MA 2K6DB 4NQKE 4AJWA 2DX5B 1GC6A 2KWVB 2CHXA 4ICVA 2KTRB 2D2QA 2LVPA 2NBUA 3SDLC 4BBNC 1IPGA 4AP4C 1S3SG 3JSVA 2JT4B 3VUYA 3EC8A 5HKHA 5JZEB 1E8XA 4FN2A 2KXJA 2KHWB 3AI5A 3R7QA 3UIPB 4CHKA 2A4ZA 1UH6A 3PTFC 5AZHA 1SIFA 4IW0A 2O6VB 2ZCCA 2JF5A 3HIZA 4IM3A 4N9F4 3M63B 2KN5A 1VD2A 2FCSA 1FXTB 3ZNHB 2M8SA 2NVUI 4MGIE 2IO2B 2L7RA 1WY8A 3DQVA 2J7QB 3TL5A 3KUDB 2K8HA 3KH0A 1I42A 3IHPC 5CHVC 1YJ1A 1WXMA 4LCDE 4BFRA 3H7SA 2DZJA 2MBBB 5G2NA 1ZGUB 2GMIC 2JRHA 4URKA 2MBHA 1WGYA 1OTRB 4GDKA 3VFKA 3ZUNA 5C23A 2NR2A 2YLMA 3QIJA 1WXSA 2AYOB 4GN1A 3OJ3A 4CYEA 1ISNA 3ZRCA 4KZ0A 1KLVA 3PPAA 1J0GA 4AUQC 3QWZB 4W9EA 2LGXA 1G6JA 3A9JA 4HDQA 1AARA 3DVGY 2KLCA 2EMTA 2RSUA 1WXAA 3MTNB 4HWIB 4DBGA 4JIOU 2N9XA 1TGZB 2KKCA 4M8NA 4W9DA 1WR6E 1V80A 1L2NA 4GU2A 3CMMB 2MW5A 4NAWB 3IBEA 2BYFA 5D94A 5E6OA 3X0WA 3LDZE 5J2RA 1Z5SB 4W9HA 1WYWB 2K8CA 3M95A 4K7UA 1P98A 1WGHA 4EUTA 3V60A 4FHKA 3TJPA 1P3QU 1SGHA 1WE7A 2L00B 3DPDA 3UQBA 2BYEA 1RRBA 2JPHA 3ZNGC 2I1KA 3PV1A 3RCZA 1WH3A 3V61A 2Z0EB 5CTRC 4A3PA 1WJUA 2KDEB 3L10B 3UQAA 1UZXB 2C7HA 1RLFA 2K8BA 1WFYA 4WJNA 2J0JA 4OVVA 5DPWA 4W9FA 3T8MA 4ZDVA 2IY0B 4LJPB 5DCNA 2FIDA 1UD7A 3UIOB 4E71A 3DBHI 1WM3A 2KC2A 4GB9A 2K25A 4DHJD 4F7ZA 2N1WA 2KJ6A 1TZ1A 5JHAA 2JY6A 3TMPB 2M0XA 4ZRIA 1Y8RC 1E8ZA 2CKHB 3C0RB 4DDGD 5J18A 4ZRKA 1KM7A 4HDOA 4BKSD 3P2BA 4HPMB 1V86A 4XX5A 4BOZB 4KZCA 2C9WB 3UGBB 1R4MI 2LRWA 1X1MA 4EKUA 3DCGA 2DZIA 3ZDTA 1E8YA 1LFDA 3CF6E 3ENEA 3A4SC 2HTHA 1C1YB 2LGYA 2WWZA 4IWPA 4PYUA 4XC2A 4GGQA 4ANXA 2A5UA 5IA7A 2KMCA 1WJ4A 4BOSC 3APFA 2IYDB 2LRUA 1Q0WB 3RZFA 1NI2A 2D10A 3HHMA 1M94A 2FAZA 2YVCA 3OAWA 3RYTA 3VXWA 1A5RA 2ASQA 2KJHB 4W9JA 2Z0DB 4FULA 1V6EA 3U8ZA 4B9KA 1E7UA 2JVCA 2ZZPB 3WA0A 1WGGA 2AL6A 4ASWC 1WMHB 4HK2A 2PEAA 2XK5B 2L3ZA 3HM6X 4DK5A 2O2VA 1H8CA 3GZNI 3NS8A 2DAFA 3VH3B 1EUVB 2ZVOA 4GXBA 3AU4A 2FIFA 4A3OA 4KVGB 4LJOB 1P0RA 4DHZB 4WAAA 4MJSB 3ZLZA 2BWFA 3KUCB 4WWPA 3VH4B 3CSFA 4BVUC 1I35A 2KFJA 4RM9A 3BY4B 4KDIC 1K8RB 2UWQA 2ZCBA 3DDCB 5D6JB 4A20A 4ANVA 3AULA 2IY1B 3DVNU 4GMVA 4WWOA 5AZFA 3VUXA 4K7SA 3IG3A 2QHOA 1NDDA 3M62B 3V62A 3VTUA 4E74A 3PRPB 5CX3A 3IFWB 3M3JA 4IM2A 1VCBA 4FLHA 2KFKB 2C7NB 2KLGA 2FCMA 5BO4B 3ZVVA 2LZ6A 1WZ3A 2FCQA 3UINB 3ZNZB 2IBIB 3VUWA 5J17A 3T9LA 2NCNA 2KTRA 2DAJA 3D32A 3TCAA 5TR5A 2AL3A 1QZEA 3W1SA 4ZRJA 2KX3A 2CHZA 1WX9A 3JVZX 4F8CB 5L83A 2MRPA 3DBLI 4HPLB 2I1JA 4BKGA 3OLMD 2O6VA 3SD5A 3PREA 1GJZA 2JRIB 3ZTCA 3A9KB 3L08A 2BKFA 3O65B 3NZSA 3R66C 2HE7A 4OVUA 2REXA 3V6CB 4GDLB 5KHQA 1XQQA 2PE6B 4GOCA 2VRRB 3VTVA 4EFOA 1UBIA 4GSWA 1YD8U 3OJ4B 4WQOB 4FJVB 1WGDA 2IO3B 2UYZB 3A1QB 3B0AA 4II3B 1V81A 4MELA 2R2QA 1GNUA 4MGKE 1LQBA 2D3GA 5C1ZA 2K39A 2L0TA 3QARA 5LLIA 4I6PA 2V4LA 2Y5BB 3QJZA 4JLCA 3PS6A 4FJYA 1KJTA 2JZZA 5CHWA 3QK0A 4W9GA 2G3QB 2M17A 4ICUA 4KIKB 4WJPA 4TQ1A 1E90A 3Q3JA 2KDBA 3JYUA 3DVNV 1WE6A 1UELA 2C5LC 1ZW7A 2N7EA 4GDLA 2KK8A 4PS3A 2BKRB 1TBEA 1V5TA 2RR9A 1WRDB 2LJ5A 2OOBB 2L0FA 4G0NB 3ZIMA 1T0YA 2GBRA 1MG8A 2LVQA 3ALBA 3AXCA 1Q5WB 2WYQA 3N30A 4NAWA 5E6PA 5KHOA 1D3ZA 3GOEA 2M4NA 2MBOA 4HVBA 3A33B 3VQIA 2GBJA 1OGWA 1OEYJ 2L8JA 2RD0A 4KV2A 3KYCD 2ZPNA 2D07B 1V9JA 3EECA 4NY0A 3W1YA 1Z2MA 2K1FA 3K9OB 4EZLA 2LVOA 1WX8A 1WIAA 2G45B 3L0WB 2CS4A 3JW0X 4FA6A 2CU1A 2KQSA 2MQJA 1E7VA 4LDTD 2V1YA 5E6NA 2J0MA 5DPTA 5AEKB 1XT9B 5L95C 3RUIB 2PJHA 1J8CA 2DYOA 3ONSA 2KC1A 2WX0A 1PQSA 4KSLC 2HJ8A 4MEMA 2DHZA 4TUUA 2R2OA 3H1UA 4FHJA 4AOFA 4B95A 4BBNF 3K9PB 5LXIB 5D2MB 3R7RA 5EDSA 5JH5C 2LASA 3QAQA 3WAPA 4WJQA 2CHWA 4HXDA 2D11A 1YX5B 2MBQA 3QC8B 4GIVA 2GBMA 4W9LA 3MJWA 5IAAC 3DVGX 4NJ7A 2L76A 1WGRA 3B08A 3R3MA 4HCNB 4X57B 4WJOA 2FNJB 4PS7A 1NBFC 2MBEA 4JL9A 1EF1A 4PYZA 1RFAA 4P7IA 2EKEC 2KJRA 1LM8B 4NQLB 1CMXB 1YQBA 4NNJB 2MLBA 2WX1A 2DYMA 3DBRI 4TV3A 5DPSA 3QCAA 1V2YA 3QHTA 3ZKJC 1ZKHA 1YIWA 3IVFA 2ZNVC 2G4DB 2LUEA 4IC7B 4DDID 2RPQA 3WANA 3SHQA 2GOWA 2ZJDA 3PT2B 4W9IA 2MP2B 1F9JA 1WF9A 3ECIA 4MH0E 4G11A 4MGYE 2KO3A 2NPTB 4RM8A 3MHSD 4JQWC 4GDKB 3LJ3A 2NBVB 3B1LX 2MWSB 4IG7B 2NBWB 1WMHA 2RGFA 4MSMB 2XK5A 3DBSA 3VAWA 1WI0A 4MM3A 1UBQA 1YX6B 3ZRFA 3APCA 1P1AA 4TQ0A 2DZMA 3L17A 2ZNVB 1R4NI 4EZKA 3V6EB 3L13A 1C3TA 2BWES 3A9JB 3PVLA 1OQYA 1WM2A 2C7MB 4MJSA 3PRZA 5CHFA 1H4RA 2KOXA 3ZTDA 2KMAA 4K81A 2AWTA 4DHZE 4W9CA 4ANUA 4J6IA 5D7GA 2L05A 4G50A 3WAMA 2O6VD 4BKTA 4PS8A 1P9DU 2K6QA 2MP2A 1TTNA 4I6LB 1EO6A 1V5OA 2WDTB 2MA9B 2NPTA 2KNBA 3PRMB 3TBLD 1E8WA 3H7PB 2KZRA 2W9NA 3HK0A 4M0WB 4XZ4A 2KFKA 2MCNB 1BT0A 1V49A 2B3AA 3A4RA 3X23A 3L16A 4MGZE 3RD2A 4EZJA 2XBBC 4HLEA 1LXDA 3DOWA 3KVFB 4K7WA 4EEWA 2KDFB 3NZUA 2KWCA 2DZKA 2LGDA 2EMSA 2Z59B 4IUMB 5GMVA 3PHXB 3VVWB 1WR1A 4RMAA 4HCPB 4TKNA 2IO1B 3TIXA 4MSQB 3Q3FA 3QX1A 2LXAA 4YL8A 1GC7A 4KSKC 4FJZA 2KVRA 3ML9A 1L7YA 2C60A 5G55A 4IM0A 3A9KA 1GUAB 2LWPA 2KD0A 2LXCA 2JWZA 1WX7A 4DHJB 4FADA 2KTFA 4FBJB 2N9PC 4IWOA 2XEWA 3H7PA 3QA8A 1WJNA 2N9EB 3A1QA 5AZGA 1J19A 1S1QB 2V3SA 4LDTB 3U30A 3WALA 4ZYNA 2FCNA 4W9KA 4MDKE 1KOTA 4K1RB 4AWJA 4HJKA 2PPHA 3U7DA 2N4FA 2N7DA 3PZDA 3KYDD 2KWUB 1U4AA 3I3TB 3CSTA 3ZO5B 4F1SA 4AJYB 2ZPYA 3NOBA 4CO7A 3RULA 2IZVB 4DXAB 2IO0B 3AU5A 2FUHB 4KIKA 3L54A 1WJ6A 2MX2A 1E5WA 3S2AA 2GBNA 3VTWA 5DPRA 1GG3A 5FR6A 5JHBA 1EF5A 3VHTC 2KDIA 2DENB 2GBKA 3EFUA 3HM3A 3ML8A 4IWQA 3N32A 4NPNA 4EOYA 1WZ0A 4G3XB 1SE9A 3VDZA 3N3KB 1IYFA 4JGHB 3APDA 3RT3B 2JUOA 2NS5A
chains in the Genus database with same CATH superfamily
2VH1A 4IKGA 1XD3B 4ZOHC 4KX6B 4BKSA 2OJWA 2BYVE 2ZW1A 3FILA 3NVWA 2HD5B 2BS2B 1UGMA 3NY5A 4I6NB 1WRIA 4XDCA 2JXXA 2FBWB 2JWUA 2BGFA 3IT4B 2H89B 2BPSA 3PLVA 2BT6A 3AE8B 4OHJA 1ET6A 3WIMA 1RAXA 3VR8B 1IP9A 4M8MA 1EU4A 2D2QA 4S0RA 4BBNC 1KLUD 2WDQB 2SEBD 5HKHA 2KXJA 5D3IB 4EE2A 3UIPB 1QF6A 1FNWA 4HPPA 1UH6A 3AE1B 2ZCCA 4IM3A 2WXOA 2NVUI 4MGIE 3TL5A 2J7QB 2K8HA 5CHVC 1XLQA 1YJ1A 4LCDE 4BFRA 1TKEA 2BB5A 2MBBB 1ET9A 3VFKA 2NR2A 3IT6B 3Q3OC 1EU3A 2LJIA 2AYOB 4GN1A 1AWDA 1ISNA 4RFBA 1J0GA 1FNUA 4HDQA 3AE4B 3AEEB 1AARA 3CIRB 2N9XA 1ROEA 2KKCA 2INDC 2LHDA 3CMMB 3IBEA 3EUB2 1FM0D 1WYWB 1R4MB 1FPYA 1P3QU 3DPDA 3B2FA 2I1KA 2KVZA 1ZDXA 5CTRC 1VJKA 2KDEB 1RLFA 1C9FA 2D3AA 1PFDA 3AE7B 4YWGG 4YTMB 5DPWA 1TZOA 5IP4D 4ZDVA 2WXQA 3I5JC 5G5HA 2K3UA 5JHAA 4JX1C 4LLGM 4WH4A 3C0RB 4HDOA 4BKSD 1V86A 4BOZB 1R4MI 1NVID 1TY2A 2V3NA 3ZDTA 1G6JA 3A4SC 2HTHA 4PYUA 3UI3A 4ANXA 3Q14C 2KMCA 1WJ4A 5H92C 4BOSC 3APFA 2IYDB 2JYTA 1EM7A 2LRUA 2KT7A 3HHMA 2JXTA 1BMLC 3RYTA 2DWQA 4W9JA 1EWYC 2Z0DB 3R2IA 1V6EA 2JVCA 4ASWC 1WMHB 4K3BA 1KLGD 2O2VA 2L32A 1K50A 1KH0A 2DAFA 4LNKA 1I4GA 1EUVB 4GXBA 4A3OA 2X38A 3GE3C 1FRDA 2BWFA 3VH4B 4BVUC 3IXSA 2K22A 4KDIC 2E6XA 4A20A 3E56A 4ANVA 2KDMA 5EE9A 3DVNU 1C79A 1L4DB 5CX3A 4IM2A 1ZP0B 1VCBA 4FLHA 3ZVVA 2LZ6A 4PK1A 3UINB 2IBIB 2JSVX 3VUWA 5J17A 2IGGA 5FR3A 2KTRA 3D32A 2AL3A 1D5XC 1ENFA 3JVZX 5L83A 3DBLI 3OLMD 2O6VA 2D3BA 3B9JA 1I4RA 3SD5A 1GJZA 3DBHB 1CQVA 3V6CB 4GOCA 3VTVA 2QIEB 4EFOA 2QDFA 2WXFA 3RNBC 3TEWA 3AMZA 2N7JA 3CWIA 4II3B 1V81A 1PGBA 3H8HA 1LQBA 5I4DA 2K39A 3NVYA 5FK9C 4TSSA 4JPSA 4JLCA 3KQ4A 4FJYA 5BYRA 2JZZA 4LNOA 5CHWA 3QK0A 2AQ1B 1SE2A 4ICUA 4WJPA 3TEXA 1KFYB 1E90A 2C5LC 2KK8A 1V5TA 1WRDB 4NAWA 5KHOA 1B1ZA 1KF6B 1N60A 1FFUA 3KYCD 3W1YA 1T0QC 2K1FA 3DBRB 4TMAB 1L5PA 3L0WB 3Q8BA 4FA6A 2KQSA 2MQJA 1E7VA 5E6NA 3N20C 3ONSA 3L4PA 2KC1A 1C4PA 2WX0A 4C7YA 2DHZA 1SJHD 3H1UA 2H88B 4FHJA 3ZQ4A 4BBNF 3K9PB 3ZYYX 2GB1A 1I4HA 2M0AA 2D11A 2WU5B 2MBQA 3QC8B 4OZAA 4W9LA 4NJ7A 2L76A 1WGRA 3RFZB 2B76B 4WJOA 1QKZA 4B0EA 1EF1A 2OEDA 2KJRA 3GE8C 5C2TB 1IBXA 1ACCA 2PVGC 3DBRI 5DPSA 1V2YA 1ZKHA 1NYRA 4QAYA 2ZNVC 4A55A 2LUEA 1NEKB 3PT2B 2MP2B 3AEBB 4G11A 1F77A 1FCLA 3RNFC 4N58A 3LJ3A 2MWSB 4KGSA 4MSMB 2XK5A 2JU6X 1UBQA 3APCA 3BVMA 3PVLA 1KTKA 1WM2A 1MHHE 2KOXA 4K81A 1ZDVA 5IOIA 1YQ3B 4W9CA 4J6IA 1MFWA 1UGJA 2O6VD 1FXIA 1P9DU 2MP2A 2HDEA 4KKIA 1V5OA 2KNBA 3ABVB 1E8WA 2MCNB 2KFKA 3A4RA 3P4RB 3NZ3A 2D5GA 4OZCA 2KDFB 1HTOA 1D5MC 4LNFA 1TJEA 2QILA 1GC7A 1L7YA 4IM0A 1PDXA 2V3PA 1FO4A 2KTFA 1BUIC 2J42A 3BYTB 3AV8A 4HJKA 2N7DA 1NI3A 2LHEA 3BYYB 2KWUB 1QOFA 5EE0A 3ZO5B 2CJOA 1MVKA 1VR9A 1C4AA 3RULA 4YSZB 2IO0B 3L54A 1LO5D 3S2AA 3VHTC 4NPNA 1FXAA 3SFDB 3VDZA 3N3KB 5EE1A 3APDA 3RT3B 2JUOA 2CJNA 1E10A 1HE8A 3PGEA 4NJ6A 4II2B 2JZ3B 4HJGE 2LD9A 2KX0A 3RMKC 5IN7A 1HA5A 4B6WA 1T3QA 4DXFA 5T8IA 2G9HD 2KANA 2CR5A 2AEHA 2ZEQA 3MP9A 3UF8A 2OJRA 4KDLB 3RZWC 3ZW3A 2N9KA 4REZA 3EC8A 4CHKA 2A4ZA 3ZJUA 3PTFC 2JF5A 4L23A 2FCSA 1N63A 3DQVA 4KKJA 3KH0A 1AW7A 1TS3A 3VR9B 2DZJA 1FIQA 1L0XB 2DLBA 4GDKA 1OQQA 2YLMA 3Q3NC 1DOYA 4WWMA 3ZRCA 4KZ0A 1JWBD 1STEA 1KLVA 3QWZB 4YXDB 2LGXA 1JMLA 2RSUA 4DBGA 1WXAA 3NG0A 4HWIB 4JIOU 3Q3MC 4M8NA 4W9DA 1RWSA 4YSYB 5E6OA 2JX5A 4K7UA 3M95A 4FHKA 4M0WA 2WU2B 1WE7A 3UQBA 1NENB 1RRBA 2MJDA 2JPHA 3ZNGC 2BW2A 2QMTA 4XWWA 3RCZA 2Z0EB 4A3PA 4XWTA 1FD6A 3TUOA 3UQAA 2PTLA 4NZLB 2J0JA 4W9FA 2IY0B 1UWMA 2Q5WD 2V0GA 4GB9A 4F7ZA 2KJ6A 2J52A 2M0XA 4ZRIA 1Y8RC 1E8ZA 1UF0A 1ZUD2 4DDGD 2KYWA 1KM7A 4HPMB 4XX5A 4KZCA 2C9WB 3DCGA 2DZIA 3W2DA 1E8YA 3CF6E 3ENEA 4IWPA 3Q8EA 3FKYA 2A5UA 5IA7A 4C00A 3RZFA 1NI2A 2D10A 1ESFA 4ARIA 3VXWA 4AQ7A 2ASQA 3U8ZA 2VZKD 1E7UA 2ZZPB 3WA0A 1F1HA 1WGGA 2AL6A 2PEAA 2W55A 4ZRPA 4DK5A 3GZNI 5HFYA 3AU4A 2FIFA 4LJOB 4WAAA 3CSFA 4ARCA 5TSSA 1I35A 2KFJA 1K8RB 1FRRA 2UWQA 1HEZE 3AM9A 3I57A 4RF1A 3KWLA 5AZFA 2J4XA 2QHOA 1NDDA 3IG3A 3P63A 3IFWB 2C7NB 1XXGA 5BMHA 3ZNZB 1JWAD 3KLSX 3T9LA 3W1SA 4WAFA 4ZRJA 3AH7A 2IDYA 2IGDA 2M56B 2LUMA 4OVZA 1P7EA 3O13A 4BKGA 2J53A 3A9KB 3L08A 2BKFA 5KHQA 3MJ5A 1L6UA 1XQQA 2LFIA 2VRRB 4HKQA 1YD8U 4FJVB 4H2AA 4OZBA 4LNNA 3AEAB 1NYQA 2R2QA 3DHHC 3HVZA 5C1ZA 1RM6C 3P4SB 3QARA 3U7ZA 2V4LA 4ACFA 3PS6A 1KJTA 2EELA 3BVGA 3N9YC 3U4EG 4IOIE 5LNK1 3AE2B 2G3QB 3P1MA 4KIKB 4TQ1A 1UELA 2N7EA 4HRSA 3NJTA 3PO0A 2WGSA 2LJ5A 4K3CA 2L0FA 3ZIMA 2GBRA 2WYQA 4YTNB 4RH6A 1CJEA 2M4NA 5BYSA 2GBJA 1OEYJ 2ZPNA 1N62A 2D07B 1V9JA 1F2RC 4FXCA 3GB1A 1WX8A 1WIAA 3JW0X 5IKCM 4LDTD 4JE3B 1J8CA 5L95C 3RUIB 2PJHA 3ETRA 2DYOA 1PQSA 2HJ8A 2INPE 1DOXA 2V9HA 3SEBA 4C80A 1J7CA 2CHWA 4HXDA 3WCQA 3MJWA 1R4NB 1J7BA 2XN9C 3R3MA 2WNMA 3DBLB 1NBFC 1DOIA 3R8BA 2BTEA 4MH8A 2EKEC 1CMXB 2WX1A 2JQRB 1XCTL 2ZW0A 3QCAA 3QHTA 1FNVA 1VLBA 1YIWA 1K53A 4IC7B 2RPQA 3MFGA 1F9JA 2ON8A 2NPTB 2RDBC 2PMVA 2MJ3A 1V1PB 5AUIA 1QILA 1WMHA 3DBSA 1WI0A 4N6EB 1P1AA 4TQ0A 2ZNVB 1R4NI 3L13A 2BWES 3A9JB 1YNTE 3ZTDA 2KMAA 5HI1A 2AWTA 4DHZE 3WAMA 2K6QA 1TTNA 4I6LB 4C4VB 2NPTA 4XZ4A 2KZRA 2QCZA 2WQYB 1BT0A 1V49A 3X23A 3L16A 1V1PA 1TIFA 1LXDA 3DOWA 1IUEA 1E9MA 1QOBA 2EMSA 1DYQA 4RMAA 4HCPB 4P1CC 1BXTA 2NTTA 3Q3FA 3QX1A 4A90A 1SIJA 2XNAC 4KSKC 1D6EC 2KVRA 3ML9A 2LWPA 2KD0A 2LXCA 2QC8A 2JWZA 4MT5A 4FADA 3RNCC 4IWOA 2XEWA 2N9EB 3IAS1 5AZGA 1L0VB 1S1QB 3OWEB 3WALA 4ZYNA 1HTQA 2Z8LA 1KOTA 4K1RB 2PPHA 3KYDD 3NOBA 4CO7A 4DXAB 1SE4A 2FUHB 3DHIC 3U52E 2MEKA 1E5WA 3SFEB 1JWSD 4P1BC 2IPKD 2K0PA 2GBKA 3HM3A 3ML8A 2WXMA 1QQRA 1SE9A 4ZRQA 1IYFA 4JGHB 1MI0A 1TS5A 3BINA 4WWNA 1RYJA 3EHVA 3TEYA 2BBCA 4USAA 2PLPA 2N1VA 4E3CA 2MSED 3NHEB 4DXGA 3JSVB 1C78A 3SU8X 3PSEB 2DYBA 3GS2A 1E0ZA 1UWXA 3KUZA 1WXVA 2KACA 1MHXA 4PT5A 3H6NA 2M1MA 3I9V1 4DWFA 2PE9A 4NQKE 2W3RA 2NMQA 2KWVB 3ZJTA 3AB5A 2NBUA 3E9SA 1IPGA 4AP4C 3JSVA 3VUYA 1E8XA 1N61A 2WDVB 4XDDA 3BZDB 3AEFB 5AZHA 1SIFA 1T0RC 4D2KA 4N9F4 2KN5A 5HHDG 1VD2A 1FXTB 2M8SA 2IO2B 2WXNA 1MJDA 1T6BX 3IHPC 3T3NA 2QSDA 1WXMA 2AX5A 3V3XA 2JRHA 4URKA 2JZPA 1WGYA 3W9CB 1SJED 1WXSA 1TT5B 3OJ3A 1I4PA 4AUQC 2RDGA 1I4QA 3DVGY 2R61A 2KLCA 1RFKA 3B2GA 1GPXA 1JRPA 4AS1A 1TGZB 1WR6E 1L2NA 4GU2A 1JW9D 2BYFA 5D94A 3LDZE 1SBBB 1Z5SB 4W9HA 5GXGB 2K8CA 2LEKA 1WGHA 4EUTA 1SGHA 4ZYSA 4LK0M 5E6JA 3V61A 2AQ2B 1WJUA 2WXIA 2VH2A 1UNSA 4L1BA 1WFYA 1VRAB 2PKOA 4LJPB 4M00A 3LXFA 1UD7A 3UIOB 4E71A 3AN1A 2K25A 1SE3A 3W5VB 1LGRA 2JY6A 2CKHB 1HZ6A 5J18A 4ZRKA 5FKAC 4M01A 3UGBB 1X1MA 1GB1A 1LFDA 3NS1A 4XC2A 3RPFC 1Q0WB 2E3TA 1M94A 1A5RA 1UUPA 4YSXB 4B9KA 2WXLA 4HEA1 4HK2A 4MM3B 1H8CA 3NS8A 3VH3B 1P0RA 4DHZB 3ZLZA 4MJSB 1GB4A 5D3DA 3MHZA 2M19A 3C8YA 1JQ4A 3DDCB 5D6JB 1XF5L 2HJ1A 3AULA 2IY1B 4GMVA 3VUXA 4K7SA 3VTUA 3GP7A 3PRPB 3M3JA 2FCMA 2FCQA 2HTME 4JWUC 1SEBD 1QZEA 2KWDA 2KX3A 4RF0A 4F8CB 1P7FA 2RDHA 2I1JA 3RNEC 3FC4A 3PREA 3VRBB 3O65B 3NZSA 2RMMA 2HE7A 4OVUA 4GDLB 1TS2A 2WXRA 1UBIA 4GSWA 1JWMD 3TSSA 3OJ4B 4WQOB 2MHJA 2IO3B 2UYZB 3A1QB 3B0AA 1FEHA 4MGKE 1GNUA 3LB8C 2D3GA 3RNAC 1HZ5A 2L0TA 5LLIA 3QJZA 1ZXIA 1WXQA 2M17A 1YN4A 2KDBA 1ZW7A 4GDLA 2BKRB 2INNE 2RR9A 2OOBB 1MG8A 2LVQA 5E6PA 3AXCA 1Q5WB 1D3ZA 2WXKA 1OGWA 3GZNB 4YTPB 2RD0A 1FCCC 3DWMA 2SAKA 4NY0A 2FUG1 1XLPA 3FILB 3K9OB 4EZLA 5H8YE 2G45B 3VRAB 1VZ6A 1AYFA 1C77A 1C76A 2CU1A 1XT9B 4MEMA 2R2OA 4WQMA 4RCOA 4B95A 5LXIB 5D2MB 3R7RA 5EDSA 5JH5C 3WAPA 4WJQA 1MG4A 2JYEA 1YX5B 4ZHOA 2GBMA 1VZ7A 5IAAC 2NTSA 3AEGB 1XCQL 2WXGA 1PYWD 1QOAA 3B08A 2MBEA 2W3SA 2W82A 1F52A 2Y5CA 3Q6BA 4PYZA 4P7IA 3AEDB 1LM8B 4NQLB 1YQBA 4NNJB 2MLBA 4TV3A 2AQ3B 4KGTA 2LGSA 4RGTA 3IVFA 2G4DB 3WANA 2GOWA 2ZJDA 1FMAD 1HXYD 4W9IA 3ECIA 1WF9A 1AN8A 1CK1A 1D4BA 2KO3A 3RI7C 4JQWC 2WLBA 2NBVB 1F2RI 5AUKA 3Q2AC 3VAWA 2KMMA 3ZRFA 1L4ZB 2DZMA 3L17A 4NAMA 3V6EB 1C3TA 3PRZA 5CHFA 4C7ZA 4ZHPA 4LTUA 5MPOA 5D7GA 2L05A 3N1XC 4WURA 4BKTA 3TBLD 3HK0A 2ACZB 3ZXVA 1TKYA 2B3AA 2Y5PA 4MGZE 4EZJA 3T3OA 3NZUA 2KWCA 3HUIA 2Z59B 5GMVA 3PHXB 3VVWB 4TKNA 3AE9B 2LXAA 1PGXA 3PZ8A 1ZE3D 4FJZA 2C60A 5G55A 2I38A 2QEJC 3A9KA 4DHJB 4FBJB 2N9PC 1ZXHA 3QA8A 1WJNA 1L6VA 3U30A 4B0MA 4W9KA 1CZPA 4AWJA 4RGOS 1D5ZC 3I3TB 4F1SA 2IZVB 1SB3C 2QJLA 4KIKA 3MC8A 2GBNA 1N5WA 5DPRA 2N0SB 3Q8AA 2DENB 2FE8A 4YT0B 4G3XB 4RGNA 3AE6B 2BVCA 1I4XA 2J0KA 3PHWB 1Q1OA 3PLUA 1OEYA 1E7PB 3NVZA 4P6VF 3KW5B 1JRUA 2O2VB 2BF8B 1N6ZA 3H9DA 3ZNID 3WAOA 2G4SA 4NJCA 2LI5A 3W1SC 4ANWA 2KQ7A 3QQ8B 2ZVNA 1V97A 3ZDMC 1N5XA 1HQRD 1QOGA 1TKGA 5LXHA 3N1YC 4S17A 1B9RA 4AJWA 2K6DB 2DX5B 1GC6A 1TS4A 4HKZE 2CHXA 4ICVA 2KTRB 2LVPA 3SDLC 1F0ZA 1S3SG 2JT4B 2TSSA 5JZEB 1XLNA 4FN2A 3U2SC 2KHWB 3AI5A 2KQ4X 3R7QA 4IW0A 2O6VB 3HIZA 3EGRA 3M63B 3ZNHB 2L7RA 3J9CA 1WY8A 2N9LA 3LYYA 3KUDB 1I42A 2K5PA 3H7SA 2DBYA 2L1AA 5G2NA 1ZGUB 2GMIC 1K51A 2WXHA 2KAJA 2MBHA 3IAM1 1IGDA 1OTRB 5JXVA 3ZUNA 5C23A 4XE0A 4UDUC 3QIJA 3C19A 1J7AA 4CYEA 5IO9A 3PPAA 4W9EA 3A9JA 5HG2A 2EMTA 3MTNB 3V05A 1SSNA 1GAQB 3TEZA 1V80A 2MW5A 3EA6A 4NAWB 2LMCA 3X0WA 5J2RA 1P98A 3V60A 4C4VA 3TJPA 2L00B 2BYEA 3PV1A 1WH3A 1YJIA 1DGJA 1WGKA 3MC0B 3L10B 4CQNA 1UZXB 2C7HA 2YEPF 1YN5A 2K8BA 1XEEA 3EFCA 3SR6A 4WJNA 1GOZA 4OVVA 3URYA 3T8MA 1T0SC 1QLBB 5DCNA 3NRZA 1JWUD 2FIDA 2MH7A 4A9AA 3FAHA 3DBHI 1WM3A 2KC2A 4DHJD 2N1WA 1TZ1A 4JWSC 3TMPB 3BVZA 1K52A 3HVDA 1M4VA 2WXPA 1YMHE 3P2BA 1IBXB 2LRWA 4EKUA 2WWZA 1C1YB 1SXTA 2LGYA 4GGQA 4BAXA 2BQQA 2KN4A 1XLOA 4US8A 2YVCA 2FAZA 3OAWA 1YOVB 2KJHB 4FULA 4RGMA 3HRDD 4HROA 2PVOD 2XK5B 2L3ZA 3HM6X 2L52A 4BZAA 2L83A 4RNAA 2ZVOA 2INCC 4KVGB 4WWPA 3BK1A 3KUCB 3NUHB 1JALA 4RM9A 3BY4B 2WS3B 2ZCBA 2UU7A 4WWOA 4E74A 3M62B 3V62A 1FFVA 2KFKB 5BO4B 2KLGA 1V1OA 1WZ3A 2W54A 5BMGA 4A6QA 1SF0A 2X8XX 2NCNA 2V4IB 4N59A 1JROA 2DAJA 2G1EA 5TR5A 3TCAA 1VDVA 2CHZA 2IGHA 1WX9A 2MRPA 4HPLB 2MJEA 2JRIB 1IGCA 3ZTCA 3R66C 1TY0A 2REXA 2PE6B 5G5GA 1PUTA 1WGDA 3N1ZC 3AE3B 4MELA 1YJJA 1OQRA 2OHFA 3NVVA 3P4QB 2BS3B 2EKIA 4C56C 4I6PA 2Y5BB 1WYGA 2CU3A 4J3OD 4W9GA 3Q3JA 3JYUA 3DVNV 1WE6A 4PS3A 1TBEA 2Y3AA 4L2YA 4G0NB 5C3JB 1T0YA 3ALBA 3N30A 1TYGB 1EWCA 3GOEA 2MBOA 4HVBA 3A33B 3VQIA 2K9XA 2L8JA 4KV2A 2D3CA 3EECA 1A70A 1Z2MA 4ITKA 4KGRA 2LVOA 3ZXRA 3Q69A 2CS4A 2V1YA 2J0MA 5DPTA 5AEKB 2LGIA 2I2YA 4KSLC 2GLSA 3OG5A 4TUUA 1YN3A 4AOFA 4A8XC 2DNFA 2VZKB 2LASA 3QAQA 4US9A 4GIVA 1ZOYB 3DVGX 1ZPSA 5BMIA 1V8CA 3BIID 4HCNB 4X57B 2FNJB 4PS7A 3I63C 3W5UB 3PZ7A 1Y56A 4JL9A 1RFAA 3AECB 1QT9A 2BB6A 4XYCA 3MC9A 2PIAA 1JCKB 2BS4B 1E6EB 2DYMA 2WDRB 4Q2JA 3ZKJC 1R7SA 1L0YB 2IJ0A 2YEPB 4GLSC 4XGAB 4DDID 2WXJA 3SHQA 4P16A 3P42A 3AE5B 4MH0E 2GRIA 2GI9A 4MGYE 4RM8A 3MHSD 4GDKB 3B1LX 4IG7B 2NBWB 2RGFA 4MM3A 3KWVA 1YX6B 3BWUD 3ZJVA 4EZKA 1I7HA 2PW9A 2BYTA 4DQOC 1OQYA 2C7MB 4MJSA 1H4RA 4WIPA 4ANUA 4G50A 3BK2A 4PS8A 3P4PB 4IDIA 1EO6A 2WHIA 2WDTB 3Q8CA 2MA9B 3PRMB 3H7PB 4M0WB 2W9NA 1C4CA 2RPVA 3RD2A 2XBBC 4HLEA 4K7WA 1Q10A 1VZ8A 3KVFB 4EEWA 4MACA 2DZKA 2LGDA 4IUMB 2WP9B 1WR1A 1WWTA 2IO1B 3TIXA 4MSQB 4YL8A 4OW0A 4R3DA 3DWGC 3ZGZA 1XO3A 1GUAB 3DHGC 3R2TA 4M02A 3RNGC 1WX7A 2ONQA 1WSPA 3RN9C 3H7PA 3Q8FA 1KRHA 1MPEA 3A1QA 1J19A 2V3SA 4LDTB 2FCNA 4MDKE 3U7DA 2N4FA 3PZDA 1T5XD 1U4AA 3CSTA 4LNIA 5BYQA 4AJYB 2ZPYA 3AU5A 5EE3A 1YQ4B 1PGAA 1WJ6A 2MX2A 3VTWA 1GG3A 5FR6A 5JHBA 1EF5A 2KDIA 4IWQA 3EFUA 4EOYA 3N32A 1WZ0A 1OFFA 2ICIA 4O1NA 2NS5A
chains in the Genus database with same CATH topology
2J0KA 3PHWB 1Q1OA 1XD3B 3PLUA 1HE8A 3BINA 4WWNA 3PGEA 1OEYA 4BKSA 2BYVE 3EHVA 4II2B 4NJ6A 2JZ3B 2LD9A 3KW5B 1JRUA 2O2VB 2BF8B 2KX0A 2HD5B 3H9DA 1UGMA 3NY5A 3ZNID 2N1VA 4E3CA 4B6WA 2MSED 3NHEB 3WAOA 2G4SA 3JSVB 4I6NB 3SU8X 2JXXA 3PSEB 2LI5A 2KANA 2DYBA 2BGFA 2CR5A 3W1SC 4ANWA 2AEHA 2ZEQA 2BPSA 2KQ7A 3QQ8B 2ZVNA 3KUZA 3UF8A 1WXVA 3PLVA 3ZDMC 3H6NA 2OJRA 5LXHA 3WIMA 2M1MA 4KDLB 1RAXA 3RZWC 3ZW3A 4DWFA 1IP9A 2PE9A 4M8MA 2K6DB 4NQKE 4AJWA 2DX5B 1GC6A 2KWVB 2CHXA 4ICVA 2KTRB 2D2QA 2LVPA 2NBUA 3SDLC 4BBNC 1IPGA 4AP4C 1S3SG 3JSVA 2JT4B 3VUYA 3EC8A 5HKHA 5JZEB 1E8XA 4FN2A 2KXJA 2KHWB 3AI5A 3R7QA 3UIPB 4CHKA 2A4ZA 1UH6A 3PTFC 5AZHA 1SIFA 4IW0A 2O6VB 2ZCCA 2JF5A 3HIZA 4IM3A 4N9F4 3M63B 2KN5A 1VD2A 2FCSA 1FXTB 3ZNHB 2M8SA 2NVUI 4MGIE 2IO2B 2L7RA 1WY8A 3DQVA 2J7QB 3TL5A 3KUDB 2K8HA 3KH0A 1I42A 3IHPC 5CHVC 1YJ1A 1WXMA 4LCDE 4BFRA 3H7SA 2DZJA 2MBBB 5G2NA 1ZGUB 2GMIC 2JRHA 4URKA 2MBHA 1WGYA 1OTRB 4GDKA 3VFKA 3ZUNA 5C23A 2NR2A 2YLMA 3QIJA 1WXSA 2AYOB 4GN1A 3OJ3A 4CYEA 1ISNA 3ZRCA 4KZ0A 1KLVA 3PPAA 1J0GA 4AUQC 3QWZB 4W9EA 2LGXA 1G6JA 3A9JA 4HDQA 1AARA 3DVGY 2KLCA 2EMTA 2RSUA 1WXAA 3MTNB 4HWIB 4DBGA 4JIOU 2N9XA 1TGZB 2KKCA 4M8NA 4W9DA 1WR6E 1V80A 1L2NA 4GU2A 3CMMB 2MW5A 4NAWB 3IBEA 2BYFA 5D94A 5E6OA 3X0WA 3LDZE 5J2RA 1Z5SB 4W9HA 1WYWB 2K8CA 3M95A 4K7UA 1P98A 1WGHA 4EUTA 3V60A 4FHKA 3TJPA 1P3QU 1SGHA 1WE7A 2L00B 3DPDA 3UQBA 2BYEA 1RRBA 2JPHA 3ZNGC 2I1KA 3PV1A 3RCZA 1WH3A 3V61A 2Z0EB 5CTRC 4A3PA 1WJUA 2KDEB 3L10B 3UQAA 1UZXB 2C7HA 1RLFA 2K8BA 1WFYA 4WJNA 2J0JA 4OVVA 5DPWA 4W9FA 3T8MA 4ZDVA 2IY0B 4LJPB 5DCNA 2FIDA 1UD7A 3UIOB 4E71A 3DBHI 1WM3A 2KC2A 4GB9A 2K25A 4DHJD 4F7ZA 2N1WA 2KJ6A 1TZ1A 5JHAA 2JY6A 3TMPB 2M0XA 4ZRIA 1Y8RC 1E8ZA 2CKHB 3C0RB 4DDGD 5J18A 4ZRKA 1KM7A 4HDOA 4BKSD 3P2BA 4HPMB 1V86A 4XX5A 4BOZB 4KZCA 2C9WB 3UGBB 1R4MI 2LRWA 1X1MA 4EKUA 3DCGA 2DZIA 3ZDTA 1E8YA 1LFDA 3CF6E 3ENEA 3A4SC 2HTHA 1C1YB 2LGYA 2WWZA 4IWPA 4PYUA 4XC2A 4GGQA 4ANXA 2A5UA 5IA7A 2KMCA 1WJ4A 4BOSC 3APFA 2IYDB 2LRUA 1Q0WB 3RZFA 1NI2A 2D10A 3HHMA 1M94A 2FAZA 2YVCA 3OAWA 3RYTA 3VXWA 1A5RA 2ASQA 2KJHB 4W9JA 2Z0DB 4FULA 1V6EA 3U8ZA 4B9KA 1E7UA 2JVCA 2ZZPB 3WA0A 1WGGA 2AL6A 4ASWC 1WMHB 4HK2A 2PEAA 2XK5B 2L3ZA 3HM6X 4DK5A 2O2VA 1H8CA 3GZNI 3NS8A 2DAFA 3VH3B 1EUVB 2ZVOA 4GXBA 3AU4A 2FIFA 4A3OA 4KVGB 4LJOB 1P0RA 4DHZB 4WAAA 4MJSB 3ZLZA 2BWFA 3KUCB 4WWPA 3VH4B 3CSFA 4BVUC 1I35A 2KFJA 4RM9A 3BY4B 4KDIC 1K8RB 2UWQA 2ZCBA 3DDCB 5D6JB 4A20A 4ANVA 3AULA 2IY1B 3DVNU 4GMVA 4WWOA 5AZFA 3VUXA 4K7SA 3IG3A 2QHOA 1NDDA 3M62B 3V62A 3VTUA 4E74A 3PRPB 5CX3A 3IFWB 3M3JA 4IM2A 1VCBA 4FLHA 2KFKB 2C7NB 2KLGA 2FCMA 5BO4B 3ZVVA 2LZ6A 1WZ3A 2FCQA 3UINB 3ZNZB 2IBIB 3VUWA 5J17A 3T9LA 2NCNA 2KTRA 2DAJA 3D32A 3TCAA 5TR5A 2AL3A 1QZEA 3W1SA 4ZRJA 2KX3A 2CHZA 1WX9A 3JVZX 4F8CB 5L83A 2MRPA 3DBLI 4HPLB 2I1JA 4BKGA 3OLMD 2O6VA 3SD5A 3PREA 1GJZA 2JRIB 3ZTCA 3A9KB 3L08A 2BKFA 3O65B 3NZSA 3R66C 2HE7A 4OVUA 2REXA 3V6CB 4GDLB 5KHQA 1XQQA 2PE6B 4GOCA 2VRRB 3VTVA 4EFOA 1UBIA 4GSWA 1YD8U 3OJ4B 4WQOB 4FJVB 1WGDA 2IO3B 2UYZB 3A1QB 3B0AA 4II3B 1V81A 4MELA 2R2QA 1GNUA 4MGKE 1LQBA 2D3GA 5C1ZA 2K39A 2L0TA 3QARA 5LLIA 4I6PA 2V4LA 2Y5BB 3QJZA 4JLCA 3PS6A 4FJYA 1KJTA 2JZZA 5CHWA 3QK0A 4W9GA 2G3QB 2M17A 4ICUA 4KIKB 4WJPA 4TQ1A 1E90A 3Q3JA 2KDBA 3JYUA 3DVNV 1WE6A 1UELA 2C5LC 1ZW7A 2N7EA 4GDLA 2KK8A 4PS3A 2BKRB 1TBEA 1V5TA 2RR9A 1WRDB 2LJ5A 2OOBB 2L0FA 4G0NB 3ZIMA 1T0YA 2GBRA 1MG8A 2LVQA 3ALBA 3AXCA 1Q5WB 2WYQA 3N30A 4NAWA 5E6PA 5KHOA 1D3ZA 3GOEA 2M4NA 2MBOA 4HVBA 3A33B 3VQIA 2GBJA 1OGWA 1OEYJ 2L8JA 2RD0A 4KV2A 3KYCD 2ZPNA 2D07B 1V9JA 3EECA 4NY0A 3W1YA 1Z2MA 2K1FA 3K9OB 4EZLA 2LVOA 1WX8A 1WIAA 2G45B 3L0WB 2CS4A 3JW0X 4FA6A 2CU1A 2KQSA 2MQJA 1E7VA 4LDTD 2V1YA 5E6NA 2J0MA 5DPTA 5AEKB 1XT9B 5L95C 3RUIB 2PJHA 1J8CA 2DYOA 3ONSA 2KC1A 2WX0A 1PQSA 4KSLC 2HJ8A 4MEMA 2DHZA 4TUUA 2R2OA 3H1UA 4FHJA 4AOFA 4B95A 4BBNF 3K9PB 5LXIB 5D2MB 3R7RA 5EDSA 5JH5C 2LASA 3QAQA 3WAPA 4WJQA 2CHWA 4HXDA 2D11A 1YX5B 2MBQA 3QC8B 4GIVA 2GBMA 4W9LA 3MJWA 5IAAC 3DVGX 4NJ7A 2L76A 1WGRA 3B08A 3R3MA 4HCNB 4X57B 4WJOA 2FNJB 4PS7A 1NBFC 2MBEA 4JL9A 1EF1A 4PYZA 1RFAA 4P7IA 2EKEC 2KJRA 1LM8B 4NQLB 1CMXB 1YQBA 4NNJB 2MLBA 2WX1A 2DYMA 3DBRI 4TV3A 5DPSA 3QCAA 1V2YA 3QHTA 3ZKJC 1ZKHA 1YIWA 3IVFA 2ZNVC 2G4DB 2LUEA 4IC7B 4DDID 2RPQA 3WANA 3SHQA 2GOWA 2ZJDA 3PT2B 4W9IA 2MP2B 1F9JA 1WF9A 3ECIA 4MH0E 4G11A 4MGYE 2KO3A 2NPTB 4RM8A 3MHSD 4JQWC 4GDKB 3LJ3A 2NBVB 3B1LX 2MWSB 4IG7B 2NBWB 1WMHA 2RGFA 4MSMB 2XK5A 3DBSA 3VAWA 1WI0A 4MM3A 1UBQA 1YX6B 3ZRFA 3APCA 1P1AA 4TQ0A 2DZMA 3L17A 2ZNVB 1R4NI 4EZKA 3V6EB 3L13A 1C3TA 2BWES 3A9JB 3PVLA 1OQYA 1WM2A 2C7MB 4MJSA 3PRZA 5CHFA 1H4RA 2KOXA 3ZTDA 2KMAA 4K81A 2AWTA 4DHZE 4W9CA 4ANUA 4J6IA 5D7GA 2L05A 4G50A 3WAMA 2O6VD 4BKTA 4PS8A 1P9DU 2K6QA 2MP2A 1TTNA 4I6LB 1EO6A 1V5OA 2WDTB 2MA9B 2NPTA 2KNBA 3PRMB 3TBLD 1E8WA 3H7PB 2KZRA 2W9NA 3HK0A 4M0WB 4XZ4A 2KFKA 2MCNB 1BT0A 1V49A 2B3AA 3A4RA 3X23A 3L16A 4MGZE 3RD2A 4EZJA 2XBBC 4HLEA 1LXDA 3DOWA 3KVFB 4K7WA 4EEWA 2KDFB 3NZUA 2KWCA 2DZKA 2LGDA 2EMSA 2Z59B 4IUMB 5GMVA 3PHXB 3VVWB 1WR1A 4RMAA 4HCPB 4TKNA 2IO1B 3TIXA 4MSQB 3Q3FA 3QX1A 2LXAA 4YL8A 1GC7A 4KSKC 4FJZA 2KVRA 3ML9A 1L7YA 2C60A 5G55A 4IM0A 3A9KA 1GUAB 2LWPA 2KD0A 2LXCA 2JWZA 1WX7A 4DHJB 4FADA 2KTFA 4FBJB 2N9PC 4IWOA 2XEWA 3H7PA 3QA8A 1WJNA 2N9EB 3A1QA 5AZGA 1J19A 1S1QB 2V3SA 4LDTB 3U30A 3WALA 4ZYNA 2FCNA 4W9KA 4MDKE 1KOTA 4K1RB 4AWJA 4HJKA 2PPHA 3U7DA 2N4FA 2N7DA 3PZDA 3KYDD 2KWUB 1U4AA 3I3TB 3CSTA 3ZO5B 4F1SA 4AJYB 2ZPYA 3NOBA 4CO7A 3RULA 2IZVB 4DXAB 2IO0B 3AU5A 2FUHB 4KIKA 3L54A 1WJ6A 2MX2A 1E5WA 3S2AA 2GBNA 3VTWA 5DPRA 1GG3A 5FR6A 5JHBA 1EF5A 3VHTC 2KDIA 2DENB 2GBKA 3EFUA 3HM3A 3ML8A 4IWQA 3N32A 4NPNA 4EOYA 1WZ0A 4G3XB 1SE9A 3VDZA 3N3KB 1IYFA 4JGHB 3APDA 3RT3B 2JUOA 2NS5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J0K A;  3PHW B;  1Q1O A;  1XD3 B;  3PLU A;  1HE8 A;  3BIN A;  4WWN A;  3PGE A;  1OEY A;  4BKS A;  2BYV E;  3EHV A;  4II2 B;  4NJ6 A;  2JZ3 B;  2LD9 A;  3KW5 B;  1JRU A;  2O2V B;  2BF8 B;  2KX0 A;  2HD5 B;  3H9D A;  1UGM A;  3NY5 A;  3ZNI D;  2N1V A;  4E3C A;  4B6W A;  2MSE D;  3NHE B;  3WAO A;  2G4S A;  3JSV B;  4I6N B;  3SU8 X;  2JXX A;  3PSE B;  2LI5 A;  2KAN A;  2DYB A;  2BGF A;  2CR5 A;  3W1S C;  4ANW A;  2AEH A;  2ZEQ A;  2BPS A;  2KQ7 A;  3QQ8 B;  2ZVN A;  3KUZ A;  3UF8 A;  1WXV A;  3PLV A;  3ZDM C;  3H6N A;  2OJR A;  5LXH A;  3WIM A;  2M1M A;  4KDL B;  1RAX A;  3RZW C;  3ZW3 A;  4DWF A;  1IP9 A;  2PE9 A;  4M8M A;  2K6D B;  4NQK E;  4AJW A;  2DX5 B;  1GC6 A;  2KWV B;  2CHX A;  4ICV A;  2KTR B;  2D2Q A;  2LVP A;  2NBU A;  3SDL C;  4BBN C;  1IPG A;  4AP4 C;  1S3S G;  3JSV A;  2JT4 B;  3VUY A;  3EC8 A;  5HKH A;  5JZE B;  1E8X A;  4FN2 A;  2KXJ A;  2KHW B;  3AI5 A;  3R7Q A;  3UIP B;  4CHK A;  2A4Z A;  1UH6 A;  3PTF C;  5AZH A;  1SIF A;  4IW0 A;  2O6V B;  2ZCC A;  2JF5 A;  3HIZ A;  4IM3 A;  4N9F 4;  3M63 B;  2KN5 A;  1VD2 A;  2FCS A;  1FXT B;  3ZNH B;  2M8S A;  2NVU I;  4MGI E;  2IO2 B;  2L7R A;  1WY8 A;  3DQV A;  2J7Q B;  3TL5 A;  3KUD B;  2K8H A;  3KH0 A;  1I42 A;  3IHP C;  5CHV C;  1YJ1 A;  1WXM A;  4LCD E;  4BFR A;  3H7S A;  2DZJ A;  2MBB B;  5G2N A;  1ZGU B;  2GMI C;  2JRH A;  4URK A;  2MBH A;  1WGY A;  1OTR B;  4GDK A;  3VFK A;  3ZUN A;  5C23 A;  2NR2 A;  2YLM A;  3QIJ A;  1WXS A;  2AYO B;  4GN1 A;  3OJ3 A;  4CYE A;  1ISN A;  3ZRC A;  4KZ0 A;  1KLV A;  3PPA A;  1J0G A;  4AUQ C;  3QWZ B;  4W9E A;  2LGX A;  1G6J A;  3A9J A;  4HDQ A;  1AAR A;  3DVG Y;  2KLC A;  2EMT A;  2RSU A;  1WXA A;  3MTN B;  4HWI B;  4DBG A;  4JIO U;  2N9X A;  1TGZ B;  2KKC A;  4M8N A;  4W9D A;  1WR6 E;  1V80 A;  1L2N A;  4GU2 A;  3CMM B;  2MW5 A;  4NAW B;  3IBE A;  2BYF A;  5D94 A;  5E6O A;  3X0W A;  3LDZ E;  5J2R A;  1Z5S B;  4W9H A;  1WYW B;  2K8C A;  3M95 A;  4K7U A;  1P98 A;  1WGH A;  4EUT A;  3V60 A;  4FHK A;  3TJP A;  1P3Q U;  1SGH A;  1WE7 A;  2L00 B;  3DPD A;  3UQB A;  2BYE A;  1RRB A;  2JPH A;  3ZNG C;  2I1K A;  3PV1 A;  3RCZ A;  1WH3 A;  3V61 A;  2Z0E B;  5CTR C;  4A3P A;  1WJU A;  2KDE B;  3L10 B;  3UQA A;  1UZX B;  2C7H A;  1RLF A;  2K8B A;  1WFY A;  4WJN A;  2J0J A;  4OVV A;  5DPW A;  4W9F A;  3T8M A;  4ZDV A;  2IY0 B;  4LJP B;  5DCN A;  2FID A;  1UD7 A;  3UIO B;  4E71 A;  3DBH I;  1WM3 A;  2KC2 A;  4GB9 A;  2K25 A;  4DHJ D;  4F7Z A;  2N1W A;  2KJ6 A;  1TZ1 A;  5JHA A;  2JY6 A;  3TMP B;  2M0X A;  4ZRI A;  1Y8R C;  1E8Z A;  2CKH B;  3C0R B;  4DDG D;  5J18 A;  4ZRK A;  1KM7 A;  4HDO A;  4BKS D;  3P2B A;  4HPM B;  1V86 A;  4XX5 A;  4BOZ B;  4KZC A;  2C9W B;  3UGB B;  1R4M I;  2LRW A;  1X1M A;  4EKU A;  3DCG A;  2DZI A;  3ZDT A;  1E8Y A;  1LFD A;  3CF6 E;  3ENE A;  3A4S C;  2HTH A;  1C1Y B;  2LGY A;  2WWZ A;  4IWP A;  4PYU A;  4XC2 A;  4GGQ A;  4ANX A;  2A5U A;  5IA7 A;  2KMC A;  1WJ4 A;  4BOS C;  3APF A;  2IYD B;  2LRU A;  1Q0W B;  3RZF A;  1NI2 A;  2D10 A;  3HHM A;  1M94 A;  2FAZ A;  2YVC A;  3OAW A;  3RYT A;  3VXW A;  1A5R A;  2ASQ A;  2KJH B;  4W9J A;  2Z0D B;  4FUL A;  1V6E A;  3U8Z A;  4B9K A;  1E7U A;  2JVC A;  2ZZP B;  3WA0 A;  1WGG A;  2AL6 A;  4ASW C;  1WMH B;  4HK2 A;  2PEA A;  2XK5 B;  2L3Z A;  3HM6 X;  4DK5 A;  2O2V A;  1H8C A;  3GZN I;  3NS8 A;  2DAF A;  3VH3 B;  1EUV B;  2ZVO A;  4GXB A;  3AU4 A;  2FIF A;  4A3O A;  4KVG B;  4LJO B;  1P0R A;  4DHZ B;  4WAA A;  4MJS B;  3ZLZ A;  2BWF A;  3KUC B;  4WWP A;  3VH4 B;  3CSF A;  4BVU C;  1I35 A;  2KFJ A;  4RM9 A;  3BY4 B;  4KDI C;  1K8R B;  2UWQ A;  2ZCB A;  3DDC B;  5D6J B;  4A20 A;  4ANV A;  3AUL A;  2IY1 B;  3DVN U;  4GMV A;  4WWO A;  5AZF A;  3VUX A;  4K7S A;  3IG3 A;  2QHO A;  1NDD A;  3M62 B;  3V62 A;  3VTU A;  4E74 A;  3PRP B;  5CX3 A;  3IFW B;  3M3J A;  4IM2 A;  1VCB A;  4FLH A;  2KFK B;  2C7N B;  2KLG A;  2FCM A;  5BO4 B;  3ZVV A;  2LZ6 A;  1WZ3 A;  2FCQ A;  3UIN B;  3ZNZ B;  2IBI B;  3VUW A;  5J17 A;  3T9L A;  2NCN A;  2KTR A;  2DAJ A;  3D32 A;  3TCA A;  5TR5 A;  2AL3 A;  1QZE A;  3W1S A;  4ZRJ A;  2KX3 A;  2CHZ A;  1WX9 A;  3JVZ X;  4F8C B;  5L83 A;  2MRP A;  3DBL I;  4HPL B;  2I1J A;  4BKG A;  3OLM D;  2O6V A;  3SD5 A;  3PRE A;  1GJZ A;  2JRI B;  3ZTC A;  3A9K B;  3L08 A;  2BKF A;  3O65 B;  3NZS A;  3R66 C;  2HE7 A;  4OVU A;  2REX A;  3V6C B;  4GDL B;  5KHQ A;  1XQQ A;  2PE6 B;  4GOC A;  2VRR B;  3VTV A;  4EFO A;  1UBI A;  4GSW A;  1YD8 U;  3OJ4 B;  4WQO B;  4FJV B;  1WGD A;  2IO3 B;  2UYZ B;  3A1Q B;  3B0A A;  4II3 B;  1V81 A;  4MEL A;  2R2Q A;  1GNU A;  4MGK E;  1LQB A;  2D3G A;  5C1Z A;  2K39 A;  2L0T A;  3QAR A;  5LLI A;  4I6P A;  2V4L A;  2Y5B B;  3QJZ A;  4JLC A;  3PS6 A;  4FJY A;  1KJT A;  2JZZ A;  5CHW A;  3QK0 A;  4W9G A;  2G3Q B;  2M17 A;  4ICU A;  4KIK B;  4WJP A;  4TQ1 A;  1E90 A;  3Q3J A;  2KDB A;  3JYU A;  3DVN V;  1WE6 A;  1UEL A;  2C5L C;  1ZW7 A;  2N7E A;  4GDL A;  2KK8 A;  4PS3 A;  2BKR B;  1TBE A;  1V5T A;  2RR9 A;  1WRD B;  2LJ5 A;  2OOB B;  2L0F A;  4G0N B;  3ZIM A;  1T0Y A;  2GBR A;  1MG8 A;  2LVQ A;  3ALB A;  3AXC A;  1Q5W B;  2WYQ A;  3N30 A;  4NAW A;  5E6P A;  5KHO A;  1D3Z A;  3GOE A;  2M4N A;  2MBO A;  4HVB A;  3A33 B;  3VQI A;  2GBJ A;  1OGW A;  1OEY J;  2L8J A;  2RD0 A;  4KV2 A;  3KYC D;  2ZPN A;  2D07 B;  1V9J A;  3EEC A;  4NY0 A;  3W1Y A;  1Z2M A;  2K1F A;  3K9O B;  4EZL A;  2LVO A;  1WX8 A;  1WIA A;  2G45 B;  3L0W B;  2CS4 A;  3JW0 X;  4FA6 A;  2CU1 A;  2KQS A;  2MQJ A;  1E7V A;  4LDT D;  2V1Y A;  5E6N A;  2J0M A;  5DPT A;  5AEK B;  1XT9 B;  5L95 C;  3RUI B;  2PJH A;  1J8C A;  2DYO A;  3ONS A;  2KC1 A;  2WX0 A;  1PQS A;  4KSL C;  2HJ8 A;  4MEM A;  2DHZ A;  4TUU A;  2R2O A;  3H1U A;  4FHJ A;  4AOF A;  4B95 A;  4BBN F;  3K9P B;  5LXI B;  5D2M B;  3R7R A;  5EDS A;  5JH5 C;  2LAS A;  3QAQ A;  3WAP A;  4WJQ A;  2CHW A;  4HXD A;  2D11 A;  1YX5 B;  2MBQ A;  3QC8 B;  4GIV A;  2GBM A;  4W9L A;  3MJW A;  5IAA C;  3DVG X;  4NJ7 A;  2L76 A;  1WGR A;  3B08 A;  3R3M A;  4HCN B;  4X57 B;  4WJO A;  2FNJ B;  4PS7 A;  1NBF C;  2MBE A;  4JL9 A;  1EF1 A;  4PYZ A;  1RFA A;  4P7I A;  2EKE C;  2KJR A;  1LM8 B;  4NQL B;  1CMX B;  1YQB A;  4NNJ B;  2MLB A;  2WX1 A;  2DYM A;  3DBR I;  4TV3 A;  5DPS A;  3QCA A;  1V2Y A;  3QHT A;  3ZKJ C;  1ZKH A;  1YIW A;  3IVF A;  2ZNV C;  2G4D B;  2LUE A;  4IC7 B;  4DDI D;  2RPQ A;  3WAN A;  3SHQ A;  2GOW A;  2ZJD A;  3PT2 B;  4W9I A;  2MP2 B;  1F9J A;  1WF9 A;  3ECI A;  4MH0 E;  4G11 A;  4MGY E;  2KO3 A;  2NPT B;  4RM8 A;  3MHS D;  4JQW C;  4GDK B;  3LJ3 A;  2NBV B;  3B1L X;  2MWS B;  4IG7 B;  2NBW B;  1WMH A;  2RGF A;  4MSM B;  2XK5 A;  3DBS A;  3VAW A;  1WI0 A;  4MM3 A;  1UBQ A;  1YX6 B;  3ZRF A;  3APC A;  1P1A A;  4TQ0 A;  2DZM A;  3L17 A;  2ZNV B;  1R4N I;  4EZK A;  3V6E B;  3L13 A;  1C3T A;  2BWE S;  3A9J B;  3PVL A;  1OQY A;  1WM2 A;  2C7M B;  4MJS A;  3PRZ A;  5CHF A;  1H4R A;  2KOX A;  3ZTD A;  2KMA A;  4K81 A;  2AWT A;  4DHZ E;  4W9C A;  4ANU A;  4J6I A;  5D7G A;  2L05 A;  4G50 A;  3WAM A;  2O6V D;  4BKT A;  4PS8 A;  1P9D U;  2K6Q A;  2MP2 A;  1TTN A;  4I6L B;  1EO6 A;  1V5O A;  2WDT B;  2MA9 B;  2NPT A;  2KNB A;  3PRM B;  3TBL D;  1E8W A;  3H7P B;  2KZR A;  2W9N A;  3HK0 A;  4M0W B;  4XZ4 A;  2KFK A;  2MCN B;  1BT0 A;  1V49 A;  2B3A A;  3A4R A;  3X23 A;  3L16 A;  4MGZ E;  3RD2 A;  4EZJ A;  2XBB C;  4HLE A;  1LXD A;  3DOW A;  3KVF B;  4K7W A;  4EEW A;  2KDF B;  3NZU A;  2KWC A;  2DZK A;  2LGD A;  2EMS A;  2Z59 B;  4IUM B;  5GMV A;  3PHX B;  3VVW B;  1WR1 A;  4RMA A;  4HCP B;  4TKN A;  2IO1 B;  3TIX A;  4MSQ B;  3Q3F A;  3QX1 A;  2LXA A;  4YL8 A;  1GC7 A;  4KSK C;  4FJZ A;  2KVR A;  3ML9 A;  1L7Y A;  2C60 A;  5G55 A;  4IM0 A;  3A9K A;  1GUA B;  2LWP A;  2KD0 A;  2LXC A;  2JWZ A;  1WX7 A;  4DHJ B;  4FAD A;  2KTF A;  4FBJ B;  2N9P C;  4IWO A;  2XEW A;  3H7P A;  3QA8 A;  1WJN A;  2N9E B;  3A1Q A;  5AZG A;  1J19 A;  1S1Q B;  2V3S A;  4LDT B;  3U30 A;  3WAL A;  4ZYN A;  2FCN A;  4W9K A;  4MDK E;  1KOT A;  4K1R B;  4AWJ A;  4HJK A;  2PPH A;  3U7D A;  2N4F A;  2N7D A;  3PZD A;  3KYD D;  2KWU B;  1U4A A;  3I3T B;  3CST A;  3ZO5 B;  4F1S A;  4AJY B;  2ZPY A;  3NOB A;  4CO7 A;  3RUL A;  2IZV B;  4DXA B;  2IO0 B;  3AU5 A;  2FUH B;  4KIK A;  3L54 A;  1WJ6 A;  2MX2 A;  1E5W A;  3S2A A;  2GBN A;  3VTW A;  5DPR A;  1GG3 A;  5FR6 A;  5JHB A;  1EF5 A;  3VHT C;  2KDI A;  2DEN B;  2GBK A;  3EFU A;  3HM3 A;  3ML8 A;  4IWQ A;  3N32 A;  4NPN A;  4EOY A;  1WZ0 A;  4G3X B;  1SE9 A;  3VDZ A;  3N3K B;  1IYF A;  4JGH B;  3APD A;  3RT3 B;  2JUO A;  2NS5 A; 
#chains in the Genus database with same CATH topology
 2VH1 A;  4IKG A;  1XD3 B;  4ZOH C;  4KX6 B;  4BKS A;  2OJW A;  2BYV E;  2ZW1 A;  3FIL A;  3NVW A;  2HD5 B;  2BS2 B;  1UGM A;  3NY5 A;  4I6N B;  1WRI A;  4XDC A;  2JXX A;  2FBW B;  2JWU A;  2BGF A;  3IT4 B;  2H89 B;  2BPS A;  3PLV A;  2BT6 A;  3AE8 B;  4OHJ A;  1ET6 A;  3WIM A;  1RAX A;  3VR8 B;  1IP9 A;  4M8M A;  1EU4 A;  2D2Q A;  4S0R A;  4BBN C;  1KLU D;  2WDQ B;  2SEB D;  5HKH A;  2KXJ A;  5D3I B;  4EE2 A;  3UIP B;  1QF6 A;  1FNW A;  4HPP A;  1UH6 A;  3AE1 B;  2ZCC A;  4IM3 A;  2WXO A;  2NVU I;  4MGI E;  3TL5 A;  2J7Q B;  2K8H A;  5CHV C;  1XLQ A;  1YJ1 A;  4LCD E;  4BFR A;  1TKE A;  2BB5 A;  2MBB B;  1ET9 A;  3VFK A;  2NR2 A;  3IT6 B;  3Q3O C;  1EU3 A;  2LJI A;  2AYO B;  4GN1 A;  1AWD A;  1ISN A;  4RFB A;  1J0G A;  1FNU A;  4HDQ A;  3AE4 B;  3AEE B;  1AAR A;  3CIR B;  2N9X A;  1ROE A;  2KKC A;  2IND C;  2LHD A;  3CMM B;  3IBE A;  3EUB 2;  1FM0 D;  1WYW B;  1R4M B;  1FPY A;  1P3Q U;  3DPD A;  3B2F A;  2I1K A;  2KVZ A;  1ZDX A;  5CTR C;  1VJK A;  2KDE B;  1RLF A;  1C9F A;  2D3A A;  1PFD A;  3AE7 B;  4YWG G;  4YTM B;  5DPW A;  1TZO A;  5IP4 D;  4ZDV A;  2WXQ A;  3I5J C;  5G5H A;  2K3U A;  5JHA A;  4JX1 C;  4LLG M;  4WH4 A;  3C0R B;  4HDO A;  4BKS D;  1V86 A;  4BOZ B;  1R4M I;  1NVI D;  1TY2 A;  2V3N A;  3ZDT A;  1G6J A;  3A4S C;  2HTH A;  4PYU A;  3UI3 A;  4ANX A;  3Q14 C;  2KMC A;  1WJ4 A;  5H92 C;  4BOS C;  3APF A;  2IYD B;  2JYT A;  1EM7 A;  2LRU A;  2KT7 A;  3HHM A;  2JXT A;  1BML C;  3RYT A;  2DWQ A;  4W9J A;  1EWY C;  2Z0D B;  3R2I A;  1V6E A;  2JVC A;  4ASW C;  1WMH B;  4K3B A;  1KLG D;  2O2V A;  2L32 A;  1K50 A;  1KH0 A;  2DAF A;  4LNK A;  1I4G A;  1EUV B;  4GXB A;  4A3O A;  2X38 A;  3GE3 C;  1FRD A;  2BWF A;  3VH4 B;  4BVU C;  3IXS A;  2K22 A;  4KDI C;  2E6X A;  4A20 A;  3E56 A;  4ANV A;  2KDM A;  5EE9 A;  3DVN U;  1C79 A;  1L4D B;  5CX3 A;  4IM2 A;  1ZP0 B;  1VCB A;  4FLH A;  3ZVV A;  2LZ6 A;  4PK1 A;  3UIN B;  2IBI B;  2JSV X;  3VUW A;  5J17 A;  2IGG A;  5FR3 A;  2KTR A;  3D32 A;  2AL3 A;  1D5X C;  1ENF A;  3JVZ X;  5L83 A;  3DBL I;  3OLM D;  2O6V A;  2D3B A;  3B9J A;  1I4R A;  3SD5 A;  1GJZ A;  3DBH B;  1CQV A;  3V6C B;  4GOC A;  3VTV A;  2QIE B;  4EFO A;  2QDF A;  2WXF A;  3RNB C;  3TEW A;  3AMZ A;  2N7J A;  3CWI A;  4II3 B;  1V81 A;  1PGB A;  3H8H A;  1LQB A;  5I4D A;  2K39 A;  3NVY A;  5FK9 C;  4TSS A;  4JPS A;  4JLC A;  3KQ4 A;  4FJY A;  5BYR A;  2JZZ A;  4LNO A;  5CHW A;  3QK0 A;  2AQ1 B;  1SE2 A;  4ICU A;  4WJP A;  3TEX A;  1KFY B;  1E90 A;  2C5L C;  2KK8 A;  1V5T A;  1WRD B;  4NAW A;  5KHO A;  1B1Z A;  1KF6 B;  1N60 A;  1FFU A;  3KYC D;  3W1Y A;  1T0Q C;  2K1F A;  3DBR B;  4TMA B;  1L5P A;  3L0W B;  3Q8B A;  4FA6 A;  2KQS A;  2MQJ A;  1E7V A;  5E6N A;  3N20 C;  3ONS A;  3L4P A;  2KC1 A;  1C4P A;  2WX0 A;  4C7Y A;  2DHZ A;  1SJH D;  3H1U A;  2H88 B;  4FHJ A;  3ZQ4 A;  4BBN F;  3K9P B;  3ZYY X;  2GB1 A;  1I4H A;  2M0A A;  2D11 A;  2WU5 B;  2MBQ A;  3QC8 B;  4OZA A;  4W9L A;  4NJ7 A;  2L76 A;  1WGR A;  3RFZ B;  2B76 B;  4WJO A;  1QKZ A;  4B0E A;  1EF1 A;  2OED A;  2KJR A;  3GE8 C;  5C2T B;  1IBX A;  1ACC A;  2PVG C;  3DBR I;  5DPS A;  1V2Y A;  1ZKH A;  1NYR A;  4QAY A;  2ZNV C;  4A55 A;  2LUE A;  1NEK B;  3PT2 B;  2MP2 B;  3AEB B;  4G11 A;  1F77 A;  1FCL A;  3RNF C;  4N58 A;  3LJ3 A;  2MWS B;  4KGS A;  4MSM B;  2XK5 A;  2JU6 X;  1UBQ A;  3APC A;  3BVM A;  3PVL A;  1KTK A;  1WM2 A;  1MHH E;  2KOX A;  4K81 A;  1ZDV A;  5IOI A;  1YQ3 B;  4W9C A;  4J6I A;  1MFW A;  1UGJ A;  2O6V D;  1FXI A;  1P9D U;  2MP2 A;  2HDE A;  4KKI A;  1V5O A;  2KNB A;  3ABV B;  1E8W A;  2MCN B;  2KFK A;  3A4R A;  3P4R B;  3NZ3 A;  2D5G A;  4OZC A;  2KDF B;  1HTO A;  1D5M C;  4LNF A;  1TJE A;  2QIL A;  1GC7 A;  1L7Y A;  4IM0 A;  1PDX A;  2V3P A;  1FO4 A;  2KTF A;  1BUI C;  2J42 A;  3BYT B;  3AV8 A;  4HJK A;  2N7D A;  1NI3 A;  2LHE A;  3BYY B;  2KWU B;  1QOF A;  5EE0 A;  3ZO5 B;  2CJO A;  1MVK A;  1VR9 A;  1C4A A;  3RUL A;  4YSZ B;  2IO0 B;  3L54 A;  1LO5 D;  3S2A A;  3VHT C;  4NPN A;  1FXA A;  3SFD B;  3VDZ A;  3N3K B;  5EE1 A;  3APD A;  3RT3 B;  2JUO A;  2CJN A;  1E10 A;  1HE8 A;  3PGE A;  4NJ6 A;  4II2 B;  2JZ3 B;  4HJG E;  2LD9 A;  2KX0 A;  3RMK C;  5IN7 A;  1HA5 A;  4B6W A;  1T3Q A;  4DXF A;  5T8I A;  2G9H D;  2KAN A;  2CR5 A;  2AEH A;  2ZEQ A;  3MP9 A;  3UF8 A;  2OJR A;  4KDL B;  3RZW C;  3ZW3 A;  2N9K A;  4REZ A;  3EC8 A;  4CHK A;  2A4Z A;  3ZJU A;  3PTF C;  2JF5 A;  4L23 A;  2FCS A;  1N63 A;  3DQV A;  4KKJ A;  3KH0 A;  1AW7 A;  1TS3 A;  3VR9 B;  2DZJ A;  1FIQ A;  1L0X B;  2DLB A;  4GDK A;  1OQQ A;  2YLM A;  3Q3N C;  1DOY A;  4WWM A;  3ZRC A;  4KZ0 A;  1JWB D;  1STE A;  1KLV A;  3QWZ B;  4YXD B;  2LGX A;  1JML A;  2RSU A;  4DBG A;  1WXA A;  3NG0 A;  4HWI B;  4JIO U;  3Q3M C;  4M8N A;  4W9D A;  1RWS A;  4YSY B;  5E6O A;  2JX5 A;  4K7U A;  3M95 A;  4FHK A;  4M0W A;  2WU2 B;  1WE7 A;  3UQB A;  1NEN B;  1RRB A;  2MJD A;  2JPH A;  3ZNG C;  2BW2 A;  2QMT A;  4XWW A;  3RCZ A;  2Z0E B;  4A3P A;  4XWT A;  1FD6 A;  3TUO A;  3UQA A;  2PTL A;  4NZL B;  2J0J A;  4W9F A;  2IY0 B;  1UWM A;  2Q5W D;  2V0G A;  4GB9 A;  4F7Z A;  2KJ6 A;  2J52 A;  2M0X A;  4ZRI A;  1Y8R C;  1E8Z A;  1UF0 A;  1ZUD 2;  4DDG D;  2KYW A;  1KM7 A;  4HPM B;  4XX5 A;  4KZC A;  2C9W B;  3DCG A;  2DZI A;  3W2D A;  1E8Y A;  3CF6 E;  3ENE A;  4IWP A;  3Q8E A;  3FKY A;  2A5U A;  5IA7 A;  4C00 A;  3RZF A;  1NI2 A;  2D10 A;  1ESF A;  4ARI A;  3VXW A;  4AQ7 A;  2ASQ A;  3U8Z A;  2VZK D;  1E7U A;  2ZZP B;  3WA0 A;  1F1H A;  1WGG A;  2AL6 A;  2PEA A;  2W55 A;  4ZRP A;  4DK5 A;  3GZN I;  5HFY A;  3AU4 A;  2FIF A;  4LJO B;  4WAA A;  3CSF A;  4ARC A;  5TSS A;  1I35 A;  2KFJ A;  1K8R B;  1FRR A;  2UWQ A;  1HEZ E;  3AM9 A;  3I57 A;  4RF1 A;  3KWL A;  5AZF A;  2J4X A;  2QHO A;  1NDD A;  3IG3 A;  3P63 A;  3IFW B;  2C7N B;  1XXG A;  5BMH A;  3ZNZ B;  1JWA D;  3KLS X;  3T9L A;  3W1S A;  4WAF A;  4ZRJ A;  3AH7 A;  2IDY A;  2IGD A;  2M56 B;  2LUM A;  4OVZ A;  1P7E A;  3O13 A;  4BKG A;  2J53 A;  3A9K B;  3L08 A;  2BKF A;  5KHQ A;  3MJ5 A;  1L6U A;  1XQQ A;  2LFI A;  2VRR B;  4HKQ A;  1YD8 U;  4FJV B;  4H2A A;  4OZB A;  4LNN A;  3AEA B;  1NYQ A;  2R2Q A;  3DHH C;  3HVZ A;  5C1Z A;  1RM6 C;  3P4S B;  3QAR A;  3U7Z A;  2V4L A;  4ACF A;  3PS6 A;  1KJT A;  2EEL A;  3BVG A;  3N9Y C;  3U4E G;  4IOI E;  5LNK 1;  3AE2 B;  2G3Q B;  3P1M A;  4KIK B;  4TQ1 A;  1UEL A;  2N7E A;  4HRS A;  3NJT A;  3PO0 A;  2WGS A;  2LJ5 A;  4K3C A;  2L0F A;  3ZIM A;  2GBR A;  2WYQ A;  4YTN B;  4RH6 A;  1CJE A;  2M4N A;  5BYS A;  2GBJ A;  1OEY J;  2ZPN A;  1N62 A;  2D07 B;  1V9J A;  1F2R C;  4FXC A;  3GB1 A;  1WX8 A;  1WIA A;  3JW0 X;  5IKC M;  4LDT D;  4JE3 B;  1J8C A;  5L95 C;  3RUI B;  2PJH A;  3ETR A;  2DYO A;  1PQS A;  2HJ8 A;  2INP E;  1DOX A;  2V9H A;  3SEB A;  4C80 A;  1J7C A;  2CHW A;  4HXD A;  3WCQ A;  3MJW A;  1R4N B;  1J7B A;  2XN9 C;  3R3M A;  2WNM A;  3DBL B;  1NBF C;  1DOI A;  3R8B A;  2BTE A;  4MH8 A;  2EKE C;  1CMX B;  2WX1 A;  2JQR B;  1XCT L;  2ZW0 A;  3QCA A;  3QHT A;  1FNV A;  1VLB A;  1YIW A;  1K53 A;  4IC7 B;  2RPQ A;  3MFG A;  1F9J A;  2ON8 A;  2NPT B;  2RDB C;  2PMV A;  2MJ3 A;  1V1P B;  5AUI A;  1QIL A;  1WMH A;  3DBS A;  1WI0 A;  4N6E B;  1P1A A;  4TQ0 A;  2ZNV B;  1R4N I;  3L13 A;  2BWE S;  3A9J B;  1YNT E;  3ZTD A;  2KMA A;  5HI1 A;  2AWT A;  4DHZ E;  3WAM A;  2K6Q A;  1TTN A;  4I6L B;  4C4V B;  2NPT A;  4XZ4 A;  2KZR A;  2QCZ A;  2WQY B;  1BT0 A;  1V49 A;  3X23 A;  3L16 A;  1V1P A;  1TIF A;  1LXD A;  3DOW A;  1IUE A;  1E9M A;  1QOB A;  2EMS A;  1DYQ A;  4RMA A;  4HCP B;  4P1C C;  1BXT A;  2NTT A;  3Q3F A;  3QX1 A;  4A90 A;  1SIJ A;  2XNA C;  4KSK C;  1D6E C;  2KVR A;  3ML9 A;  2LWP A;  2KD0 A;  2LXC A;  2QC8 A;  2JWZ A;  4MT5 A;  4FAD A;  3RNC C;  4IWO A;  2XEW A;  2N9E B;  3IAS 1;  5AZG A;  1L0V B;  1S1Q B;  3OWE B;  3WAL A;  4ZYN A;  1HTQ A;  2Z8L A;  1KOT A;  4K1R B;  2PPH A;  3KYD D;  3NOB A;  4CO7 A;  4DXA B;  1SE4 A;  2FUH B;  3DHI C;  3U52 E;  2MEK A;  1E5W A;  3SFE B;  1JWS D;  4P1B C;  2IPK D;  2K0P A;  2GBK A;  3HM3 A;  3ML8 A;  2WXM A;  1QQR A;  1SE9 A;  4ZRQ A;  1IYF A;  4JGH B;  1MI0 A;  1TS5 A;  3BIN A;  4WWN A;  1RYJ A;  3EHV A;  3TEY A;  2BBC A;  4USA A;  2PLP A;  2N1V A;  4E3C A;  2MSE D;  3NHE B;  4DXG A;  3JSV B;  1C78 A;  3SU8 X;  3PSE B;  2DYB A;  3GS2 A;  1E0Z A;  1UWX A;  3KUZ A;  1WXV A;  2KAC A;  1MHX A;  4PT5 A;  3H6N A;  2M1M A;  3I9V 1;  4DWF A;  2PE9 A;  4NQK E;  2W3R A;  2NMQ A;  2KWV B;  3ZJT A;  3AB5 A;  2NBU A;  3E9S A;  1IPG A;  4AP4 C;  3JSV A;  3VUY A;  1E8X A;  1N61 A;  2WDV B;  4XDD A;  3BZD B;  3AEF B;  5AZH A;  1SIF A;  1T0R C;  4D2K A;  4N9F 4;  2KN5 A;  5HHD G;  1VD2 A;  1FXT B;  2M8S A;  2IO2 B;  2WXN A;  1MJD A;  1T6B X;  3IHP C;  3T3N A;  2QSD A;  1WXM A;  2AX5 A;  3V3X A;  2JRH A;  4URK A;  2JZP A;  1WGY A;  3W9C B;  1SJE D;  1WXS A;  1TT5 B;  3OJ3 A;  1I4P A;  4AUQ C;  2RDG A;  1I4Q A;  3DVG Y;  2R61 A;  2KLC A;  1RFK A;  3B2G A;  1GPX A;  1JRP A;  4AS1 A;  1TGZ B;  1WR6 E;  1L2N A;  4GU2 A;  1JW9 D;  2BYF A;  5D94 A;  3LDZ E;  1SBB B;  1Z5S B;  4W9H A;  5GXG B;  2K8C A;  2LEK A;  1WGH A;  4EUT A;  1SGH A;  4ZYS A;  4LK0 M;  5E6J A;  3V61 A;  2AQ2 B;  1WJU A;  2WXI A;  2VH2 A;  1UNS A;  4L1B A;  1WFY A;  1VRA B;  2PKO A;  4LJP B;  4M00 A;  3LXF A;  1UD7 A;  3UIO B;  4E71 A;  3AN1 A;  2K25 A;  1SE3 A;  3W5V B;  1LGR A;  2JY6 A;  2CKH B;  1HZ6 A;  5J18 A;  4ZRK A;  5FKA C;  4M01 A;  3UGB B;  1X1M A;  1GB1 A;  1LFD A;  3NS1 A;  4XC2 A;  3RPF C;  1Q0W B;  2E3T A;  1M94 A;  1A5R A;  1UUP A;  4YSX B;  4B9K A;  2WXL A;  4HEA 1;  4HK2 A;  4MM3 B;  1H8C A;  3NS8 A;  3VH3 B;  1P0R A;  4DHZ B;  3ZLZ A;  4MJS B;  1GB4 A;  5D3D A;  3MHZ A;  2M19 A;  3C8Y A;  1JQ4 A;  3DDC B;  5D6J B;  1XF5 L;  2HJ1 A;  3AUL A;  2IY1 B;  4GMV A;  3VUX A;  4K7S A;  3VTU A;  3GP7 A;  3PRP B;  3M3J A;  2FCM A;  2FCQ A;  2HTM E;  4JWU C;  1SEB D;  1QZE A;  2KWD A;  2KX3 A;  4RF0 A;  4F8C B;  1P7F A;  2RDH A;  2I1J A;  3RNE C;  3FC4 A;  3PRE A;  3VRB B;  3O65 B;  3NZS A;  2RMM A;  2HE7 A;  4OVU A;  4GDL B;  1TS2 A;  2WXR A;  1UBI A;  4GSW A;  1JWM D;  3TSS A;  3OJ4 B;  4WQO B;  2MHJ A;  2IO3 B;  2UYZ B;  3A1Q B;  3B0A A;  1FEH A;  4MGK E;  1GNU A;  3LB8 C;  2D3G A;  3RNA C;  1HZ5 A;  2L0T A;  5LLI A;  3QJZ A;  1ZXI A;  1WXQ A;  2M17 A;  1YN4 A;  2KDB A;  1ZW7 A;  4GDL A;  2BKR B;  2INN E;  2RR9 A;  2OOB B;  1MG8 A;  2LVQ A;  5E6P A;  3AXC A;  1Q5W B;  1D3Z A;  2WXK A;  1OGW A;  3GZN B;  4YTP B;  2RD0 A;  1FCC C;  3DWM A;  2SAK A;  4NY0 A;  2FUG 1;  1XLP A;  3FIL B;  3K9O B;  4EZL A;  5H8Y E;  2G45 B;  3VRA B;  1VZ6 A;  1AYF A;  1C77 A;  1C76 A;  2CU1 A;  1XT9 B;  4MEM A;  2R2O A;  4WQM A;  4RCO A;  4B95 A;  5LXI B;  5D2M B;  3R7R A;  5EDS A;  5JH5 C;  3WAP A;  4WJQ A;  1MG4 A;  2JYE A;  1YX5 B;  4ZHO A;  2GBM A;  1VZ7 A;  5IAA C;  2NTS A;  3AEG B;  1XCQ L;  2WXG A;  1PYW D;  1QOA A;  3B08 A;  2MBE A;  2W3S A;  2W82 A;  1F52 A;  2Y5C A;  3Q6B A;  4PYZ A;  4P7I A;  3AED B;  1LM8 B;  4NQL B;  1YQB A;  4NNJ B;  2MLB A;  4TV3 A;  2AQ3 B;  4KGT A;  2LGS A;  4RGT A;  3IVF A;  2G4D B;  3WAN A;  2GOW A;  2ZJD A;  1FMA D;  1HXY D;  4W9I A;  3ECI A;  1WF9 A;  1AN8 A;  1CK1 A;  1D4B A;  2KO3 A;  3RI7 C;  4JQW C;  2WLB A;  2NBV B;  1F2R I;  5AUK A;  3Q2A C;  3VAW A;  2KMM A;  3ZRF A;  1L4Z B;  2DZM A;  3L17 A;  4NAM A;  3V6E B;  1C3T A;  3PRZ A;  5CHF A;  4C7Z A;  4ZHP A;  4LTU A;  5MPO A;  5D7G A;  2L05 A;  3N1X C;  4WUR A;  4BKT A;  3TBL D;  3HK0 A;  2ACZ B;  3ZXV A;  1TKY A;  2B3A A;  2Y5P A;  4MGZ E;  4EZJ A;  3T3O A;  3NZU A;  2KWC A;  3HUI A;  2Z59 B;  5GMV A;  3PHX B;  3VVW B;  4TKN A;  3AE9 B;  2LXA A;  1PGX A;  3PZ8 A;  1ZE3 D;  4FJZ A;  2C60 A;  5G55 A;  2I38 A;  2QEJ C;  3A9K A;  4DHJ B;  4FBJ B;  2N9P C;  1ZXH A;  3QA8 A;  1WJN A;  1L6V A;  3U30 A;  4B0M A;  4W9K A;  1CZP A;  4AWJ A;  4RGO S;  1D5Z C;  3I3T B;  4F1S A;  2IZV B;  1SB3 C;  2QJL A;  4KIK A;  3MC8 A;  2GBN A;  1N5W A;  5DPR A;  2N0S B;  3Q8A A;  2DEN B;  2FE8 A;  4YT0 B;  4G3X B;  4RGN A;  3AE6 B;  2BVC A;  1I4X A;  2J0K A;  3PHW B;  1Q1O A;  3PLU A;  1OEY A;  1E7P B;  3NVZ A;  4P6V F;  3KW5 B;  1JRU A;  2O2V B;  2BF8 B;  1N6Z A;  3H9D A;  3ZNI D;  3WAO A;  2G4S A;  4NJC A;  2LI5 A;  3W1S C;  4ANW A;  2KQ7 A;  3QQ8 B;  2ZVN A;  1V97 A;  3ZDM C;  1N5X A;  1HQR D;  1QOG A;  1TKG A;  5LXH A;  3N1Y C;  4S17 A;  1B9R A;  4AJW A;  2K6D B;  2DX5 B;  1GC6 A;  1TS4 A;  4HKZ E;  2CHX A;  4ICV A;  2KTR B;  2LVP A;  3SDL C;  1F0Z A;  1S3S G;  2JT4 B;  2TSS A;  5JZE B;  1XLN A;  4FN2 A;  3U2S C;  2KHW B;  3AI5 A;  2KQ4 X;  3R7Q A;  4IW0 A;  2O6V B;  3HIZ A;  3EGR A;  3M63 B;  3ZNH B;  2L7R A;  3J9C A;  1WY8 A;  2N9L A;  3LYY A;  3KUD B;  1I42 A;  2K5P A;  3H7S A;  2DBY A;  2L1A A;  5G2N A;  1ZGU B;  2GMI C;  1K51 A;  2WXH A;  2KAJ A;  2MBH A;  3IAM 1;  1IGD A;  1OTR B;  5JXV A;  3ZUN A;  5C23 A;  4XE0 A;  4UDU C;  3QIJ A;  3C19 A;  1J7A A;  4CYE A;  5IO9 A;  3PPA A;  4W9E A;  3A9J A;  5HG2 A;  2EMT A;  3MTN B;  3V05 A;  1SSN A;  1GAQ B;  3TEZ A;  1V80 A;  2MW5 A;  3EA6 A;  4NAW B;  2LMC A;  3X0W A;  5J2R A;  1P98 A;  3V60 A;  4C4V A;  3TJP A;  2L00 B;  2BYE A;  3PV1 A;  1WH3 A;  1YJI A;  1DGJ A;  1WGK A;  3MC0 B;  3L10 B;  4CQN A;  1UZX B;  2C7H A;  2YEP F;  1YN5 A;  2K8B A;  1XEE A;  3EFC A;  3SR6 A;  4WJN A;  1GOZ A;  4OVV A;  3URY A;  3T8M A;  1T0S C;  1QLB B;  5DCN A;  3NRZ A;  1JWU D;  2FID A;  2MH7 A;  4A9A A;  3FAH A;  3DBH I;  1WM3 A;  2KC2 A;  4DHJ D;  2N1W A;  1TZ1 A;  4JWS C;  3TMP B;  3BVZ A;  1K52 A;  3HVD A;  1M4V A;  2WXP A;  1YMH E;  3P2B A;  1IBX B;  2LRW A;  4EKU A;  2WWZ A;  1C1Y B;  1SXT A;  2LGY A;  4GGQ A;  4BAX A;  2BQQ A;  2KN4 A;  1XLO A;  4US8 A;  2YVC A;  2FAZ A;  3OAW A;  1YOV B;  2KJH B;  4FUL A;  4RGM A;  3HRD D;  4HRO A;  2PVO D;  2XK5 B;  2L3Z A;  3HM6 X;  2L52 A;  4BZA A;  2L83 A;  4RNA A;  2ZVO A;  2INC C;  4KVG B;  4WWP A;  3BK1 A;  3KUC B;  3NUH B;  1JAL A;  4RM9 A;  3BY4 B;  2WS3 B;  2ZCB A;  2UU7 A;  4WWO A;  4E74 A;  3M62 B;  3V62 A;  1FFV A;  2KFK B;  5BO4 B;  2KLG A;  1V1O A;  1WZ3 A;  2W54 A;  5BMG A;  4A6Q A;  1SF0 A;  2X8X X;  2NCN A;  2V4I B;  4N59 A;  1JRO A;  2DAJ A;  2G1E A;  5TR5 A;  3TCA A;  1VDV A;  2CHZ A;  2IGH A;  1WX9 A;  2MRP A;  4HPL B;  2MJE A;  2JRI B;  1IGC A;  3ZTC A;  3R66 C;  1TY0 A;  2REX A;  2PE6 B;  5G5G A;  1PUT A;  1WGD A;  3N1Z C;  3AE3 B;  4MEL A;  1YJJ A;  1OQR A;  2OHF A;  3NVV A;  3P4Q B;  2BS3 B;  2EKI A;  4C56 C;  4I6P A;  2Y5B B;  1WYG A;  2CU3 A;  4J3O D;  4W9G A;  3Q3J A;  3JYU A;  3DVN V;  1WE6 A;  4PS3 A;  1TBE A;  2Y3A A;  4L2Y A;  4G0N B;  5C3J B;  1T0Y A;  3ALB A;  3N30 A;  1TYG B;  1EWC A;  3GOE A;  2MBO A;  4HVB A;  3A33 B;  3VQI A;  2K9X A;  2L8J A;  4KV2 A;  2D3C A;  3EEC A;  1A70 A;  1Z2M A;  4ITK A;  4KGR A;  2LVO A;  3ZXR A;  3Q69 A;  2CS4 A;  2V1Y A;  2J0M A;  5DPT A;  5AEK B;  2LGI A;  2I2Y A;  4KSL C;  2GLS A;  3OG5 A;  4TUU A;  1YN3 A;  4AOF A;  4A8X C;  2DNF A;  2VZK B;  2LAS A;  3QAQ A;  4US9 A;  4GIV A;  1ZOY B;  3DVG X;  1ZPS A;  5BMI A;  1V8C A;  3BII D;  4HCN B;  4X57 B;  2FNJ B;  4PS7 A;  3I63 C;  3W5U B;  3PZ7 A;  1Y56 A;  4JL9 A;  1RFA A;  3AEC B;  1QT9 A;  2BB6 A;  4XYC A;  3MC9 A;  2PIA A;  1JCK B;  2BS4 B;  1E6E B;  2DYM A;  2WDR B;  4Q2J A;  3ZKJ C;  1R7S A;  1L0Y B;  2IJ0 A;  2YEP B;  4GLS C;  4XGA B;  4DDI D;  2WXJ A;  3SHQ A;  4P16 A;  3P42 A;  3AE5 B;  4MH0 E;  2GRI A;  2GI9 A;  4MGY E;  4RM8 A;  3MHS D;  4GDK B;  3B1L X;  4IG7 B;  2NBW B;  2RGF A;  4MM3 A;  3KWV A;  1YX6 B;  3BWU D;  3ZJV A;  4EZK A;  1I7H A;  2PW9 A;  2BYT A;  4DQO C;  1OQY A;  2C7M B;  4MJS A;  1H4R A;  4WIP A;  4ANU A;  4G50 A;  3BK2 A;  4PS8 A;  3P4P B;  4IDI A;  1EO6 A;  2WHI A;  2WDT B;  3Q8C A;  2MA9 B;  3PRM B;  3H7P B;  4M0W B;  2W9N A;  1C4C A;  2RPV A;  3RD2 A;  2XBB C;  4HLE A;  4K7W A;  1Q10 A;  1VZ8 A;  3KVF B;  4EEW A;  4MAC A;  2DZK A;  2LGD A;  4IUM B;  2WP9 B;  1WR1 A;  1WWT A;  2IO1 B;  3TIX A;  4MSQ B;  4YL8 A;  4OW0 A;  4R3D A;  3DWG C;  3ZGZ A;  1XO3 A;  1GUA B;  3DHG C;  3R2T A;  4M02 A;  3RNG C;  1WX7 A;  2ONQ A;  1WSP A;  3RN9 C;  3H7P A;  3Q8F A;  1KRH A;  1MPE A;  3A1Q A;  1J19 A;  2V3S A;  4LDT B;  2FCN A;  4MDK E;  3U7D A;  2N4F A;  3PZD A;  1T5X D;  1U4A A;  3CST A;  4LNI A;  5BYQ A;  4AJY B;  2ZPY A;  3AU5 A;  5EE3 A;  1YQ4 B;  1PGA A;  1WJ6 A;  2MX2 A;  3VTW A;  1GG3 A;  5FR6 A;  5JHB A;  1EF5 A;  2KDI A;  4IWQ A;  3EFU A;  4EOY A;  3N32 A;  1WZ0 A;  1OFF A;  2ICI A;  4O1N A;  2NS5 A; 
#chains in the Genus database with same CATH homology
 2J0K A;  3PHW B;  1Q1O A;  1XD3 B;  3PLU A;  1HE8 A;  3BIN A;  4WWN A;  3PGE A;  1OEY A;  4BKS A;  2BYV E;  3EHV A;  4II2 B;  4NJ6 A;  2JZ3 B;  2LD9 A;  3KW5 B;  1JRU A;  2O2V B;  2BF8 B;  2KX0 A;  2HD5 B;  3H9D A;  1UGM A;  3NY5 A;  3ZNI D;  2N1V A;  4E3C A;  4B6W A;  2MSE D;  3NHE B;  3WAO A;  2G4S A;  3JSV B;  4I6N B;  3SU8 X;  2JXX A;  3PSE B;  2LI5 A;  2KAN A;  2DYB A;  2BGF A;  2CR5 A;  3W1S C;  4ANW A;  2AEH A;  2ZEQ A;  2BPS A;  2KQ7 A;  3QQ8 B;  2ZVN A;  3KUZ A;  3UF8 A;  1WXV A;  3PLV A;  3ZDM C;  3H6N A;  2OJR A;  5LXH A;  3WIM A;  2M1M A;  4KDL B;  1RAX A;  3RZW C;  3ZW3 A;  4DWF A;  1IP9 A;  2PE9 A;  4M8M A;  2K6D B;  4NQK E;  4AJW A;  2DX5 B;  1GC6 A;  2KWV B;  2CHX A;  4ICV A;  2KTR B;  2D2Q A;  2LVP A;  2NBU A;  3SDL C;  4BBN C;  1IPG A;  4AP4 C;  1S3S G;  3JSV A;  2JT4 B;  3VUY A;  3EC8 A;  5HKH A;  5JZE B;  1E8X A;  4FN2 A;  2KXJ A;  2KHW B;  3AI5 A;  3R7Q A;  3UIP B;  4CHK A;  2A4Z A;  1UH6 A;  3PTF C;  5AZH A;  1SIF A;  4IW0 A;  2O6V B;  2ZCC A;  2JF5 A;  3HIZ A;  4IM3 A;  4N9F 4;  3M63 B;  2KN5 A;  1VD2 A;  2FCS A;  1FXT B;  3ZNH B;  2M8S A;  2NVU I;  4MGI E;  2IO2 B;  2L7R A;  1WY8 A;  3DQV A;  2J7Q B;  3TL5 A;  3KUD B;  2K8H A;  3KH0 A;  1I42 A;  3IHP C;  5CHV C;  1YJ1 A;  1WXM A;  4LCD E;  4BFR A;  3H7S A;  2DZJ A;  2MBB B;  5G2N A;  1ZGU B;  2GMI C;  2JRH A;  4URK A;  2MBH A;  1WGY A;  1OTR B;  4GDK A;  3VFK A;  3ZUN A;  5C23 A;  2NR2 A;  2YLM A;  3QIJ A;  1WXS A;  2AYO B;  4GN1 A;  3OJ3 A;  4CYE A;  1ISN A;  3ZRC A;  4KZ0 A;  1KLV A;  3PPA A;  1J0G A;  4AUQ C;  3QWZ B;  4W9E A;  2LGX A;  1G6J A;  3A9J A;  4HDQ A;  1AAR A;  3DVG Y;  2KLC A;  2EMT A;  2RSU A;  1WXA A;  3MTN B;  4HWI B;  4DBG A;  4JIO U;  2N9X A;  1TGZ B;  2KKC A;  4M8N A;  4W9D A;  1WR6 E;  1V80 A;  1L2N A;  4GU2 A;  3CMM B;  2MW5 A;  4NAW B;  3IBE A;  2BYF A;  5D94 A;  5E6O A;  3X0W A;  3LDZ E;  5J2R A;  1Z5S B;  4W9H A;  1WYW B;  2K8C A;  3M95 A;  4K7U A;  1P98 A;  1WGH A;  4EUT A;  3V60 A;  4FHK A;  3TJP A;  1P3Q U;  1SGH A;  1WE7 A;  2L00 B;  3DPD A;  3UQB A;  2BYE A;  1RRB A;  2JPH A;  3ZNG C;  2I1K A;  3PV1 A;  3RCZ A;  1WH3 A;  3V61 A;  2Z0E B;  5CTR C;  4A3P A;  1WJU A;  2KDE B;  3L10 B;  3UQA A;  1UZX B;  2C7H A;  1RLF A;  2K8B A;  1WFY A;  4WJN A;  2J0J A;  4OVV A;  5DPW A;  4W9F A;  3T8M A;  4ZDV A;  2IY0 B;  4LJP B;  5DCN A;  2FID A;  1UD7 A;  3UIO B;  4E71 A;  3DBH I;  1WM3 A;  2KC2 A;  4GB9 A;  2K25 A;  4DHJ D;  4F7Z A;  2N1W A;  2KJ6 A;  1TZ1 A;  5JHA A;  2JY6 A;  3TMP B;  2M0X A;  4ZRI A;  1Y8R C;  1E8Z A;  2CKH B;  3C0R B;  4DDG D;  5J18 A;  4ZRK A;  1KM7 A;  4HDO A;  4BKS D;  3P2B A;  4HPM B;  1V86 A;  4XX5 A;  4BOZ B;  4KZC A;  2C9W B;  3UGB B;  1R4M I;  2LRW A;  1X1M A;  4EKU A;  3DCG A;  2DZI A;  3ZDT A;  1E8Y A;  1LFD A;  3CF6 E;  3ENE A;  3A4S C;  2HTH A;  1C1Y B;  2LGY A;  2WWZ A;  4IWP A;  4PYU A;  4XC2 A;  4GGQ A;  4ANX A;  2A5U A;  5IA7 A;  2KMC A;  1WJ4 A;  4BOS C;  3APF A;  2IYD B;  2LRU A;  1Q0W B;  3RZF A;  1NI2 A;  2D10 A;  3HHM A;  1M94 A;  2FAZ A;  2YVC A;  3OAW A;  3RYT A;  3VXW A;  1A5R A;  2ASQ A;  2KJH B;  4W9J A;  2Z0D B;  4FUL A;  1V6E A;  3U8Z A;  4B9K A;  1E7U A;  2JVC A;  2ZZP B;  3WA0 A;  1WGG A;  2AL6 A;  4ASW C;  1WMH B;  4HK2 A;  2PEA A;  2XK5 B;  2L3Z A;  3HM6 X;  4DK5 A;  2O2V A;  1H8C A;  3GZN I;  3NS8 A;  2DAF A;  3VH3 B;  1EUV B;  2ZVO A;  4GXB A;  3AU4 A;  2FIF A;  4A3O A;  4KVG B;  4LJO B;  1P0R A;  4DHZ B;  4WAA A;  4MJS B;  3ZLZ A;  2BWF A;  3KUC B;  4WWP A;  3VH4 B;  3CSF A;  4BVU C;  1I35 A;  2KFJ A;  4RM9 A;  3BY4 B;  4KDI C;  1K8R B;  2UWQ A;  2ZCB A;  3DDC B;  5D6J B;  4A20 A;  4ANV A;  3AUL A;  2IY1 B;  3DVN U;  4GMV A;  4WWO A;  5AZF A;  3VUX A;  4K7S A;  3IG3 A;  2QHO A;  1NDD A;  3M62 B;  3V62 A;  3VTU A;  4E74 A;  3PRP B;  5CX3 A;  3IFW B;  3M3J A;  4IM2 A;  1VCB A;  4FLH A;  2KFK B;  2C7N B;  2KLG A;  2FCM A;  5BO4 B;  3ZVV A;  2LZ6 A;  1WZ3 A;  2FCQ A;  3UIN B;  3ZNZ B;  2IBI B;  3VUW A;  5J17 A;  3T9L A;  2NCN A;  2KTR A;  2DAJ A;  3D32 A;  3TCA A;  5TR5 A;  2AL3 A;  1QZE A;  3W1S A;  4ZRJ A;  2KX3 A;  2CHZ A;  1WX9 A;  3JVZ X;  4F8C B;  5L83 A;  2MRP A;  3DBL I;  4HPL B;  2I1J A;  4BKG A;  3OLM D;  2O6V A;  3SD5 A;  3PRE A;  1GJZ A;  2JRI B;  3ZTC A;  3A9K B;  3L08 A;  2BKF A;  3O65 B;  3NZS A;  3R66 C;  2HE7 A;  4OVU A;  2REX A;  3V6C B;  4GDL B;  5KHQ A;  1XQQ A;  2PE6 B;  4GOC A;  2VRR B;  3VTV A;  4EFO A;  1UBI A;  4GSW A;  1YD8 U;  3OJ4 B;  4WQO B;  4FJV B;  1WGD A;  2IO3 B;  2UYZ B;  3A1Q B;  3B0A A;  4II3 B;  1V81 A;  4MEL A;  2R2Q A;  1GNU A;  4MGK E;  1LQB A;  2D3G A;  5C1Z A;  2K39 A;  2L0T A;  3QAR A;  5LLI A;  4I6P A;  2V4L A;  2Y5B B;  3QJZ A;  4JLC A;  3PS6 A;  4FJY A;  1KJT A;  2JZZ A;  5CHW A;  3QK0 A;  4W9G A;  2G3Q B;  2M17 A;  4ICU A;  4KIK B;  4WJP A;  4TQ1 A;  1E90 A;  3Q3J A;  2KDB A;  3JYU A;  3DVN V;  1WE6 A;  1UEL A;  2C5L C;  1ZW7 A;  2N7E A;  4GDL A;  2KK8 A;  4PS3 A;  2BKR B;  1TBE A;  1V5T A;  2RR9 A;  1WRD B;  2LJ5 A;  2OOB B;  2L0F A;  4G0N B;  3ZIM A;  1T0Y A;  2GBR A;  1MG8 A;  2LVQ A;  3ALB A;  3AXC A;  1Q5W B;  2WYQ A;  3N30 A;  4NAW A;  5E6P A;  5KHO A;  1D3Z A;  3GOE A;  2M4N A;  2MBO A;  4HVB A;  3A33 B;  3VQI A;  2GBJ A;  1OGW A;  1OEY J;  2L8J A;  2RD0 A;  4KV2 A;  3KYC D;  2ZPN A;  2D07 B;  1V9J A;  3EEC A;  4NY0 A;  3W1Y A;  1Z2M A;  2K1F A;  3K9O B;  4EZL A;  2LVO A;  1WX8 A;  1WIA A;  2G45 B;  3L0W B;  2CS4 A;  3JW0 X;  4FA6 A;  2CU1 A;  2KQS A;  2MQJ A;  1E7V A;  4LDT D;  2V1Y A;  5E6N A;  2J0M A;  5DPT A;  5AEK B;  1XT9 B;  5L95 C;  3RUI B;  2PJH A;  1J8C A;  2DYO A;  3ONS A;  2KC1 A;  2WX0 A;  1PQS A;  4KSL C;  2HJ8 A;  4MEM A;  2DHZ A;  4TUU A;  2R2O A;  3H1U A;  4FHJ A;  4AOF A;  4B95 A;  4BBN F;  3K9P B;  5LXI B;  5D2M B;  3R7R A;  5EDS A;  5JH5 C;  2LAS A;  3QAQ A;  3WAP A;  4WJQ A;  2CHW A;  4HXD A;  2D11 A;  1YX5 B;  2MBQ A;  3QC8 B;  4GIV A;  2GBM A;  4W9L A;  3MJW A;  5IAA C;  3DVG X;  4NJ7 A;  2L76 A;  1WGR A;  3B08 A;  3R3M A;  4HCN B;  4X57 B;  4WJO A;  2FNJ B;  4PS7 A;  1NBF C;  2MBE A;  4JL9 A;  1EF1 A;  4PYZ A;  1RFA A;  4P7I A;  2EKE C;  2KJR A;  1LM8 B;  4NQL B;  1CMX B;  1YQB A;  4NNJ B;  2MLB A;  2WX1 A;  2DYM A;  3DBR I;  4TV3 A;  5DPS A;  3QCA A;  1V2Y A;  3QHT A;  3ZKJ C;  1ZKH A;  1YIW A;  3IVF A;  2ZNV C;  2G4D B;  2LUE A;  4IC7 B;  4DDI D;  2RPQ A;  3WAN A;  3SHQ A;  2GOW A;  2ZJD A;  3PT2 B;  4W9I A;  2MP2 B;  1F9J A;  1WF9 A;  3ECI A;  4MH0 E;  4G11 A;  4MGY E;  2KO3 A;  2NPT B;  4RM8 A;  3MHS D;  4JQW C;  4GDK B;  3LJ3 A;  2NBV B;  3B1L X;  2MWS B;  4IG7 B;  2NBW B;  1WMH A;  2RGF A;  4MSM B;  2XK5 A;  3DBS A;  3VAW A;  1WI0 A;  4MM3 A;  1UBQ A;  1YX6 B;  3ZRF A;  3APC A;  1P1A A;  4TQ0 A;  2DZM A;  3L17 A;  2ZNV B;  1R4N I;  4EZK A;  3V6E B;  3L13 A;  1C3T A;  2BWE S;  3A9J B;  3PVL A;  1OQY A;  1WM2 A;  2C7M B;  4MJS A;  3PRZ A;  5CHF A;  1H4R A;  2KOX A;  3ZTD A;  2KMA A;  4K81 A;  2AWT A;  4DHZ E;  4W9C A;  4ANU A;  4J6I A;  5D7G A;  2L05 A;  4G50 A;  3WAM A;  2O6V D;  4BKT A;  4PS8 A;  1P9D U;  2K6Q A;  2MP2 A;  1TTN A;  4I6L B;  1EO6 A;  1V5O A;  2WDT B;  2MA9 B;  2NPT A;  2KNB A;  3PRM B;  3TBL D;  1E8W A;  3H7P B;  2KZR A;  2W9N A;  3HK0 A;  4M0W B;  4XZ4 A;  2KFK A;  2MCN B;  1BT0 A;  1V49 A;  2B3A A;  3A4R A;  3X23 A;  3L16 A;  4MGZ E;  3RD2 A;  4EZJ A;  2XBB C;  4HLE A;  1LXD A;  3DOW A;  3KVF B;  4K7W A;  4EEW A;  2KDF B;  3NZU A;  2KWC A;  2DZK A;  2LGD A;  2EMS A;  2Z59 B;  4IUM B;  5GMV A;  3PHX B;  3VVW B;  1WR1 A;  4RMA A;  4HCP B;  4TKN A;  2IO1 B;  3TIX A;  4MSQ B;  3Q3F A;  3QX1 A;  2LXA A;  4YL8 A;  1GC7 A;  4KSK C;  4FJZ A;  2KVR A;  3ML9 A;  1L7Y A;  2C60 A;  5G55 A;  4IM0 A;  3A9K A;  1GUA B;  2LWP A;  2KD0 A;  2LXC A;  2JWZ A;  1WX7 A;  4DHJ B;  4FAD A;  2KTF A;  4FBJ B;  2N9P C;  4IWO A;  2XEW A;  3H7P A;  3QA8 A;  1WJN A;  2N9E B;  3A1Q A;  5AZG A;  1J19 A;  1S1Q B;  2V3S A;  4LDT B;  3U30 A;  3WAL A;  4ZYN A;  2FCN A;  4W9K A;  4MDK E;  1KOT A;  4K1R B;  4AWJ A;  4HJK A;  2PPH A;  3U7D A;  2N4F A;  2N7D A;  3PZD A;  3KYD D;  2KWU B;  1U4A A;  3I3T B;  3CST A;  3ZO5 B;  4F1S A;  4AJY B;  2ZPY A;  3NOB A;  4CO7 A;  3RUL A;  2IZV B;  4DXA B;  2IO0 B;  3AU5 A;  2FUH B;  4KIK A;  3L54 A;  1WJ6 A;  2MX2 A;  1E5W A;  3S2A A;  2GBN A;  3VTW A;  5DPR A;  1GG3 A;  5FR6 A;  5JHB A;  1EF5 A;  3VHT C;  2KDI A;  2DEN B;  2GBK A;  3EFU A;  3HM3 A;  3ML8 A;  4IWQ A;  3N32 A;  4NPN A;  4EOY A;  1WZ0 A;  4G3X B;  1SE9 A;  3VDZ A;  3N3K B;  1IYF A;  4JGH B;  3APD A;  3RT3 B;  2JUO A;  2NS5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...