4HKZE

Trastuzumab fab complexed with protein l and protein a fragments
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
63
structure length
63
Chain Sequence
SEVTIKVNLIFADGKIQTAEFKGTFEEATAEAYRYAALLAKVNGEYTADLEDGGNHMNIKFAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Trastuzumab light chain
publication title Identification and grafting of a unique peptide-binding site in the Fab framework of monoclonal antibodies.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 18
structure length 63
sequence length 63
ec nomenclature
pdb deposition date 2012-10-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4hkzE00
2ON8A 1IBXB 2IGGA 4OZAA 1C9FA 1Q10A 1JMLA 2J53A 2LUMA 2I38A 1FCCC 1MI0A 4KGSA 5HG2A 2ONQA 1KH0A 2ZW0A 4KGTA 2JWUA 2QMTA 1FCLA 2JSVX 4HKZE 2N7JA 2KDMA 1YMHE 2OEDA 1D4BA 2KWDA 3FILB 2JXTA 3V3XA 5JXVA 1K53A 1IGCA 1QKZA 1HEZE 1EM7A 2JZPA 2K0PA 2IGDA 1GB1A 1XCQL 4WH4A 4HJGE 1IBXA 1GB4A 2GB1A 2KQ4X 2PTLA 2IGHA 2RMMA 1P7EA 5HHDG 1MHXA 2JU6X 2GI9A 2LGIA 1P7FA 2N9KA 1HZ5A 1K51A 1FD6A 3GB1A 1MHHE 2QSDA 4D2KA 2N9LA 4IKGA 1MPEA 1K50A 1HZ6A 2KN4A 5BMIA 2I2YA 1YNTE 3FILA 1K52A 4IOIE 1MVKA 1F2RC 2RPVA 1PGBA 1XF5L 1ZXHA 1F2RI 1UWXA 2PLPA 1PGXA 1XCTL 5BMGA 5HI1A 2LHEA 4OZBA 2EELA 2J52A 2NMQA 2ZW1A 1IGDA 2LHDA 4GLSC 1PGAA 2PW9A 4KGRA 5HFYA 3UI3A 3MP9A 2KACA 5BMHA 4MACA 4OZCA
chains in the Genus database with same CATH superfamily
1TGZB 4K3CA 4AUQC 1TJEA 4IWPA 2OJRA 2LUMA 1XQQA 2GBNA 2LVQA 1FCCC 4EEWA 1J8CA 1FXAA 3PO0A 1H4RA 4KGSA 4DXFA 2MX2A 5EE1A 1P3QU 1ZXIA 3SDLC 4IUMB 4OVVA 1WYWB 3PZ7A 4RCOA 4GGQA 2NTTA 1HXYD 2PVOD 2JQRB 3NJTA 4IM0A 1MFWA 5JXVA 3GZNI 4BKGA 4HWIB 4WJPA 4BKSA 3MFGA 3NUHB 2JZPA 1ET6A 4XYCA 2NPTA 1E10A 4TMAB 2JWZA 5LXIB 2KC1A 1C78A 2IGHA 2RMMA 3RN9C 3KH0A 2QC8A 3P2BA 4EOYA 4C4VA 2AWTA 3ENEA 3MC9A 1MHHE 2PMVA 1V81A 2DZKA 4IKGA 2WP9B 4NNJB 1E6EB 1E7PB 4MGYE 5IN7A 2ZNVB 4FN2A 3L17A 5IOIA 2PEAA 4G50A 4FJZA 4XWWA 2HJ1A 2ZNVC 1P9DU 3DHHC 2RDGA 3B1LX 2V1YA 1UWMA 3KYDD 4M00A 3L10B 3H8HA 2C9WB 3ZXRA 1ZP0B 3NVZA 3GOEA 2JYEA 1FM0D 4ZYNA 2J52A 1SB3C 1QF6A 3QIJA 5E6NA 1DGJA 2LGDA 2DZJA 4F7ZA 1NENB 1QT9A 2BBCA 3KQ4A 3M62B 5E6PA 5AZGA 3PLUA 4B9KA 3N32A 1WY8A 1JMLA 2DBYA 3SFEB 4I6PA 2MP2A 2I38A 3ONSA 2MLBA 3K9PB 2QIEB 4WWPA 1V2YA 2MBHA 5HG2A 4EKUA 3TIXA 2WXNA 4US9A 3KUZA 2HDEA 1JCKB 1S3SG 3N30A 2LVPA 1T0SC 1C4AA 2ICIA 4HLEA 3RNFC 4C7ZA 2Z0DB 4K7SA 2OOBB 4FXCA 2WXJA 4MH0E 2KQ4X 3NZUA 2ZPNA 1WGKA 1V9JA 3RMKC 1N60A 2DYBA 1MHXA 1SE2A 3TCAA 4GB9A 1K51A 4RGTA 1XLQA 2KTFA 5D2MB 3ZDMC 1PDXA 2UYZB 4ANVA 4ITKA 4P1CC 1YD8U 2INDC 2BPSA 2LXCA 2OHFA 1WMHB 1MVKA 2MHJA 3UINB 4YL8A 1ZPSA 2EMTA 4IC7B 4LNIA 2KLGA 1CQVA 1XLNA 3DOWA 1E8YA 2FBWB 4ZRKA 4MSMB 4S17A 2DENB 4NQKE 3I3TB 4ZOHC 3SHQA 3B9JA 4RGNA 4JX1C 3T3NA 4Q2JA 1G6JA 1AW7A 4LLGM 3TUOA 4ARIA 1WSPA 3X0WA 2N1VA 1EWCA 3NG0A 4YSXB 2DHZA 5D3DA 2K5PA 4FHJA 1V86A 4RM8A 3AE8B 2M17A 2PIAA 1BMLC 1N5XA 3AE6B 1DOXA 4B0EA 3W1SC 4ICVA 3PT2B 5CHVC 4AP4C 3CSFA 3L16A 2KMAA 2JXTA 3R2TA 4A20A 3B2GA 1WXVA 5IA7A 2W55A 1XCQL 4W9KA 2J0JA 2N4FA 4BFRA 2KHWB 3ZVVA 4HXDA 2NVUI 2LGYA 1VZ6A 1Q5WB 1F1HA 1KJTA 3VUWA 2GBRA 3RNEC 2LASA 2N9LA 4HDOA 3Q2AC 3IT6B 1KLUD 1Q0WB 3BVZA 1TY2A 2VH2A 4NZLB 1L6VA 3DHIC 1F2RC 3HVDA 3AI5A 4GOCA 3Q8FA 1UWXA 2DAFA 3BY4B 3BK2A 4FA6A 1FFUA 4NJ6A 1D5MC 3HK0A 4W9LA 3APDA 1OQYA 1QLBB 1IGDA 1C3TA 2V3NA 1T0QC 1HA5A 2CJNA 2Y5BB 2N7EA 3VUXA 1T3QA 1SIJA 3UIPB 2K22A 4FADA 2BTEA 2GRIA 2ZVOA 4LK0M 3ABVB 2IGGA 2KOXA 1VRAB 1N6ZA 1SGHA 1Z5SB 1AWDA 2KQ7A 2FAZA 2IYDB 1MI0A 1F52A 4W9GA 2NBUA 2MQJA 2LVOA 3AMZA 1RYJA 3PTFC 1NEKB 3H9DA 5LNK1 4P6VF 1HQRD 5J17A 1QOBA 3ZNHB 4JIOU 3R7QA 2OEDA 2J0MA 3OG5A 1L5PA 3APFA 2L00B 2O2VB 1ISNA 5FR6A 4REZA 1OEYJ 3RNGC 3H7PB 5D3IB 3A4RA 3O65B 1N63A 2JF5A 4HKQA 4N59A 3BYTB 4W9HA 2N9KA 3VH4B 1SJHD 3GS2A 4BAXA 2B3AA 2BB6A 1P0RA 5KHOA 2WS3B 4G11A 2SAKA 2LMCA 2A4ZA 4HCNB 4IOIE 1FRRA 2M19A 1WR6E 4KV2A 3J9CA 4FHKA 3B0AA 2ACZB 3EA6A 5IO9A 1VR9A 4PK1A 2MW5A 1TBEA 2QCZA 2W9NA 2AQ2B 2LRWA 5G5HA 1BUIC 3R8BA 3Q3JA 4K7WA 4KDIC 3DQVA 3R3MA 2AQ1B 3ZQ4A 4MT5A 3GP7A 2KD0A 1RRBA 2ZZPB 3OJ4B 2C60A 3DWGC 4F8CB 4GMVA 3VDZA 4MGKE 1SJED 1WXQA 1WMHA 3IAM1 4DWFA 3N1XC 3TBLD 3HVZA 2K25A 3GE8C 2E6XA 2BS2B 5DPTA 4LNNA 1L0VB 4IM3A 1N62A 1OQRA 2CHWA 2KO3A 4MM3B 1IGCA 2L0TA 2INNE 4YTNB 1NYRA 2WU2B 2KMMA 2KVRA 5T8IA 2PE6B 4RF0A 2FE8A 4HCPB 3RZFA 3WAMA 4ACFA 4YTPB 3Q3MC 2KLCA 5TR5A 1V1PB 2GI9A 2AEHA 4M0WB 3AULA 1A70A 2X8XX 2FNJB 4KSKC 4XZ4A 2XEWA 4NJCA 5EE3A 2WDQB 2DLBA 2KN4A 5BMIA 4K81A 4TUUA 2Z8LA 4IG7B 4GN1A 2BW2A 2Z0EB 4M01A 5JZEB 5AEKB 3MJ5A 4MSQB 1VJKA 2FCSA 1TKYA 3ETRA 1WWTA 1NI3A 1TZ1A 3Q8BA 4UDUC 2JZ3B 4HEA1 4LDTB 4HPLB 1L4DB 4GLSC 3T9LA 1JRUA 3JVZX 4O1NA 4ZHPA 1ZW7A 2WHIA 2LXAA 3N1ZC 3BYYB 3MC8A 4OZCA 1E5WA 4BZAA 5EE0A 3QA8A 4MEMA 4OHJA 1WXMA 4W9CA 3PLVA 1YQ4B 2PJHA 4MJSB 1I4RA 4WQOB 2KJHB 2ZW0A 2RDBC 2VRRB 3AU4A 3IHPC 2DZMA 5CHWA 1VLBA 2CS4A 4K7UA 3DVNU 2V0GA 4MELA 1R4NB 5DCNA 3V6CB 2DAJA 3Q3NC 2EMSA 3FILB 1Z2MA 2WWZA 5AUKA 3BWUD 1FIQA 4OW0A 2WQYB 1D5XC 2EKIA 2REXA 4TQ1A 1NBFC 1V5OA 4H2AA 1WGRA 1P1AA 3ZNID 3EFUA 4LNOA 1ZOYB 4RGOS 4WQMA 3GB1A 1CJEA 3E56A 3EUB2 4JLCA 4XX5A 2BWFA 1Q1OA 4C00A 2KDFB 4R3DA 1T5XD 1KM7A 3MC0B 2O2VA 4PT5A 1AYFA 2L0FA 1JROA 4LCDE 3H7PA 1NI2A 3ZUNA 4WWNA 1YOVB 2PLPA 2XBBC 1D5ZC 4HPMB 1TS4A 2LD9A 4OZBA 3VTUA 5J18A 3LXFA 1ESFA 5GMVA 2MBQA 2BVCA 2D3AA 4MH8A 1GPXA 3BINA 3RCZA 3DVNV 3Q8EA 2QILA 3DHGC 3ZXVA 1UF0A 4K1RB 2V4IB 3BVGA 2JYTA 1L0XB 4ICUA 4NQLB 2Z59B 3H1UA 3IT4B 1T0YA 3HUIA 1KOTA 3TL5A 1ZDXA 1YX6B 2Y3AA 3QAQA 5L95C 3AN1A 3KW5B 2GBKA 4HPPA 2D07B 2RPQA 2A5UA 2KANA 3ZRFA 2ZJDA 5FR3A 4PS3A 2BKRB 1A5RA 3A1QB 3NS8A 3LYYA 2JRHA 1EF1A 2DZIA 1H8CA 3W5UB 2MBBB 3IG3A 4ASWC 3O13A 3RULA 2PTLA 2L32A 2D3BA 2WXFA 2BWES 4A3OA 3KVFB 4EZLA 1T0RC 3TEXA 2LJIA 1OEYA 3VR9B 5D6JB 3TEYA 3I5JC 4FJYA 2K1FA 3AE2B 4MM3A 1XT9B 4IWQA 1QOAA 4EE2A 1WRDB 1UNSA 2MEKA 5CTRC 4RM9A 1F2RI 2DWQA 3V61A 2R2QA 2KWCA 3OAWA 3AE5B 3EECA 2LHEA 2ZVNA 1V1PA 2EELA 5TSSA 3R7RA 4M0WA 5DPWA 2WXRA 3ZJTA 4KKIA 3DBRB 2M56B 4C56C 5HFYA 1QOFA 4FBJB 1I4QA 3LB8C 2N9PC 1XXGA 1Y56A 3AE3B 4WURA 3VUYA 3ZYYX 3IFWB 1F77A 2J4XA 1JWBD 2VH1A 2KAJA 2CJOA 3VFKA 2RR9A 4NAMA 2WXIA 1STEA 1P98A 1EO6A 3AE9B 2ONQA 5IP4D 3VH3B 2KJRA 3UQAA 3AE7B 5E6OA 3PPAA 5DPSA 1L0YB 4KKJA 4AS1A 3EFCA 1FNWA 2IJ0A 1WXSA 2IY0B 1JQ4A 3DBSA 3AE1B 4ZYSA 3V3XA 3L4PA 1HTQA 3P4QB 4TSSA 2AL3A 2GLSA 1WM3A 1GC6A 1WJ6A 2GB1A 1TS2A 2MJDA 4RF1A 1SF0A 4MJSA 1NVID 4DHZE 1LQBA 1VD2A 3AEFB 3L13A 2QJLA 1IYFA 4MDKE 3V6EB 4KDLB 2N9EB 1UELA 1WM2A 3FILA 3QQ8B 2WYQA 3APCA 4P7IA 2V3PA 1KF6B 4XDDA 4RNAA 3WCQA 2KFKB 2WDVB 5G2NA 3V60A 2KYWA 3AEEB 4DXGA 3QHTA 3RYTA 4EZKA 2WX1A 4B0MA 1CMXB 4N9F4 2D5GA 3MP9A 1PQSA 3L54A 4PS8A 3JSVB 3DBHB 3NVVA 2UWQA 3DBLI 3U7DA 2L7RA 3WAOA 3ZO5B 3VRBB 1HTOA 3A9KB 1Q10A 5AZHA 1ZGUB 1VZ8A 1CZPA 2KNBA 2GBMA 2W3SA 3Q3OC 2C5LC 3MHZA 3OJ3A 5H8YE 3BK1A 2L05A 2MCNB 4S0RA 3V05A 3T8MA 3UIOB 2HJ8A 3Q14C 4HKZE 4JQWC 1SSNA 3RT3B 2GBJA 1RFKA 1EUVB 1FFVA 2KWDA 2FUG1 3P4PB 1I4PA 4W9EA 3VHTC 1M94A 1GUAB 5G55A 3PRMB 3L08A 4N6EB 3ZKJC 1XLOA 4DXAB 2N7DA 4KSLC 3RI7C 1JALA 3Q69A 2BYVE 1X1MA 3DCGA 1DYQA 4AQ7A 2K3UA 5E6JA 4HVBA 5G5GA 2KK8A 1C77A 3ML9A 4PS7A 4BKSD 2H89B 2LWPA 2WXPA 2KT7A 3FKYA 1GJZA 2WLBA 4G3XB 2WNMA 3QCAA 3D32A 1KRHA 1TZOA 5MPOA 3RNAC 1YNTE 2KWVB 1D3ZA 1WFYA 3EGRA 4LTUA 5FKAC 2INCC 1SE9A 2JT4B 3A1QA 2LZ6A 4B95A 1MJDA 1B1ZA 2PKOA 3PRPB 1V1OA 1XCTL 2KFJA 2KX3A 5HI1A 1VZ7A 1J7CA 2TSSA 3RZWC 4DHJB 2L52A 4ANXA 3CMMB 2O6VB 1I4GA 4C4VB 1YJJA 1IP9A 1FNUA 3UI3A 2KACA 4CHKA 1TIFA 3WIMA 3BIID 2ASQA 2ON8A 4A55A 1JWSD 2MBOA 1SIFA 4IWOA 3NZSA 4HJKA 1FPYA 2WXMA 4A9AA 1XD3B 3DBLB 2G4DB 4WJQA 2CHZA 3TEZA 3VR8B 3AB5A 3ZRCA 1WXAA 2KC2A 4J3OD 3N20C 1E7VA 1EU3A 2IZVB 1TKEA 1D4BA 4USAA 5C2TB 4YTMB 2KJ6A 1K53A 1R4NI 4M8NA 4M8MA 5FK9C 2V4LA 1GB1A 1YJ1A 1WGGA 2INPE 4HJGE 1D6EC 1OGWA 1GB4A 2W3RA 1NYQA 1WYGA 1SE3A 2IO1B 3CIRB 4HRSA 3U8ZA 4EFOA 3VTVA 4I6LB 1J19A 1XEEA 3ECIA 1N61A 3GE3C 2MA9B 3PHXB 4LJPB 3C8YA 2DYMA 3MHSD 1DOIA 1K50A 2FCMA 3NVYA 4AWJA 3EC8A 1KFYB 3KYCD 3HRDD 2EKEC 1I35A 2CR5A 4W9DA 3ZW3A 2AL6A 3H6NA 3P63A 3W1SA 2WXHA 2I1KA 2ZPYA 3VRAB 2KMCA 1SBBB 2CU3A 5BMGA 1GG3A 1ZE3D 3IXSA 3T3OA 4DK5A 2LFIA 3RFZB 2MBEA 4LNFA 3FAHA 1AARA 3M3JA 4AJWA 2B76B 2IO2B 5BMHA 2QEJC 2KTRB 1I7HA 3CSTA 4TQ0A 1WJUA 2LEKA 1KLGD 2WXGA 2DNFA 1RAXA 3ZDTA 3SEBA 3AEAB 3IBEA 2LI5A 1FNVA 2ZCBA 2QDFA 4ZRPA 2KFKA 2E3TA 3PZ8A 4KGTA 2JWUA 2QMTA 1TS5A 4TV3A 4XGAB 1R4MB 2RSUA 4ARCA 2WXLA 2BB5A 3JSVA 1V97A 4N58A 1TY0A 3R66C 1OTRB 1HEZE 1EM7A 4GU2A 2X38A 4BOZB 2LUEA 2JPHA 2VZKD 3AXCA 4US8A 3C19A 1ZUD2 3HM6X 5AZFA 3A9KA 2K6DB 2D2QA 3BVMA 3ZIMA 4X57B 1BXTA 1RM6C 1WE6A 3I63C 4ZRQA 3AEGB 4YSZB 4QAYA 4DQOC 3U4EG 1QZEA 3W9CB 1UBQA 1HE8A 4KIKB 4B6WA 2KWUB 4A3PA 4AOFA 3QC8B 2UU7A 1NDDA 4J6IA 1KLVA 2JY6A 2WDRB 4OVZA 3PREA 2K39A 2BS3B 1JWAD 1PGBA 4EZJA 2LGSA 2JZZA 2BYTA 2MJEA 3E9SA 1E90A 3X23A 3I57A 3QARA 2FUHB 1UD7A 1WGYA 1I4XA 3DWMA 1B9RA 2M1MA 1UBIA 1OQQA 2MJ3A 4IM2A 3FC4A 4KGRA 2LRUA 5JHAA 1RWSA 3KLSX 1I4HA 4AJYB 1QILA 4MACA 3NHEB 4P1BC 1PFDA 3DBRI 3VTWA 3OLMD 2G3QB 1WF9A 3AE4B 1L4ZB 3M63B 2KZRA 4HK2A 3AM9A 1EF5A 2K8HA 3AEBB 2I1JA 1C76A 4W9IA 2WXOA 1WX7A 2G4SA 4MGZE 2MH7A 5C23A 1Y8RC 2XK5B 3OWEB 4RH6A 3K9OB 1V80A 2KDIA 2JSVX 5CX3A 2XN9C 4L23A 1UGJA 2N7JA 1FRDA 3KUCB 3KWLA 2O6VA 3Q8CA 4M02A 3AH7A 2JXXA 3PZDA 3NS1A 1M4VA 1QKZA 5KHQA 2K0PA 3W5VB 1WX9A 1F0ZA 3ZTDA 3MTNB 4WH4A 3U7ZA 1WRIA 1LXDA 3JW0X 2G45B 2WX0A 2KQSA 3A33B 2DX5B 2OJWA 4HDQA 1VCBA 3Q6BA 3WANA 2LJ5A 4DBGA 1WJNA 3N1YC 4ANUA 2W82A 2BGFA 1L2NA 2SEBD 2ZCCA 3LDZE 2WGSA 4C80A 1YX5B 3WAPA 5LLIA 2K8BA 4JGHB 3UF8A 5C1ZA 4GDLB 4NAWB 4OVUA 1EWYC 1EU4A 4RMAA 3VXWA 1BT0A 5I4DA 3M95A 3W1YA 3ZNGC 2BT6A 1WZ3A 3Q3FA 4YSYB 1WR1A 4FJVB 2M8SA 3V62A 1C4CA 1WX8A 1C79A 1CK1A 2FCQA 1PGAA 2FCNA 4CQNA 1OFFA 1I42A 4RFBA 4WWMA 5IAAC 3L0WB 2Q5WD 3AECB 2ZEQA 3WA0A 1IBXB 3DBHI 5BO4B 4OZAA 4YWGG 2J53A 1V49A 3ZLZA 3HM3A 3S2AA 5IKCM 3NZ3A 5L83A 1FCLA 1SEBD 3GZNB 3H7SA 4G0NB 1QOGA 2L83A 3HIZA 2NCNA 2M0AA 4BOSC 2KTRA 1WH3A 3JYUA 4E74A 2M4NA 1XO3A 2MWSB 4LNKA 2G1EA 3ZTCA 2BYFA 3U52E 1WJ4A 1P7FA 1HZ5A 3HHMA 4NJ7A 4JWSC 3VQIA 4EUTA 3DVGY 4II3B 4WIPA 2BF8B 5AUIA 2L8JA 3UGBB 3RPFC 1TYGB 1N5WA 2GOWA 1PUTA 4FLHA 2NS5A 3CWIA 4WAFA 1LGRA 3DPDA 1L7YA 3VVWB 1J7AA 2CU1A 1ZXHA 1XF5L 1RFAA 2NTSA 1E8XA 2HTHA 1C1YB 1K8RB 1JRPA 2KN5A 2KX0A 4E3CA 5JH5C 3RD2A 2KDBA 4XE0A 4E71A 5CHFA 2LHDA 3AEDB 1V6EA 3KUDB 4NY0A 2K6QA 2PW9A 2L76A 4GIVA 3NRZA 3A9JB 1YIWA 3NVWA 3TMPB 4YXDB 2IO3B 3DVGX 1ZKHA 4IW0A 4KIKA 2K8CA 3RUIB 4A90A 1L6UA 1U4AA 1UUPA 1ZDVA 2IBIB 3ALBA 1E8ZA 4FULA 1ET9A 3MJWA 4ZRIA 2CKHB 1KH0A 2J42A 1RLFA 4KZCA 3QJZA 2GMIC 3LJ3A 3URYA 1MG8A 3VAWA 4NPNA 4BBNF 4KZ0A 1UZXB 2MRPA 5GXGB 4URKA 5EE9A 3A4SC 3PGEA 1YN4A 2G9HD 1GC7A 2KKCA 3QX1A 2HD5B 1V8CA 2JRIB 2BKFA 3PVLA 5BYQA 2IY1B 4XWTA 2L1AA 2V9HA 1LO5D 3PS6A 4GDKB 1TS3A 5D94A 3IAS1 3N3KB 1YN5A 1FD6A 3P4SB 4P16A 2BQQA 3W2DA 2XK5A 4HROA 3P4RB 2BS4B 3QK0A 2PPHA 1MPEA 3UQBA 2I2YA 3NOBA 2V3SA 4DHZB 1WGDA 4MGIE 2JVCA 2RPVA 3KWVA 2AQ3B 1FEHA 1IUEA 4WWOA 2D10A 5D7GA 1ROEA 2KDEB 2LGXA 4ZRJA 2NMQA 1FO4A 2Y5CA 4PYUA 1JWUD 2RD0A 2FIDA 1ENFA 1DOYA 2NPTB 3SD5A 4L1BA 3N9YC 2PE9A 1C9FA 4DDGD 1E8WA 4GDLA 1ACCA 2KVZA 4KVGB 4NAWA 3Q8AA 1C4PA 2C7MB 1PYWD 4L2YA 1SE4A 2YEPF 4DHJD 4YT0B 3C0RB 2QHOA 2O6VD 1QQRA 2KDMA 4WJOA 1YMHE 2W54A 4II2B 3PV1A 4DDID 2C7NB 2D11A 4BBNC 1WI0A 5C3JB 3BZDB 1WZ0A 3ZJUA 1R4MI 2NR2A 4WAAA 1IBXA 3TEWA 5HKHA 2N9XA 3U2SC 2IPKD 1LM8B 3P42A 1WIAA 5H92C 4W9FA 4JL9A 4ZHOA 5HHDG 1XLPA 2JU6X 2LGIA 2IDYA 2K9XA 4JWUC 1V5TA 3SFDB 2C7HA 2QSDA 4D2KA 2AYOB 4XDCA 3TJPA 1HZ6A 2JX5A 3ZNZB 3NY5A 1YJIA 2R61A 4ZDVA 3ZGZA 1K52A 1F9JA 2MP2B 5EDSA 4KX6B 2IO0B 1TTNA 1TT5B 4XC2A 4TKNA 4I6NB 1JW9D 1PGXA 3WALA 3CF6E 2R2OA 1JWMD 3PRZA 2J7QB 1J0GA 1MG4A 1FXIA 2ZW1A 2J0KA 4WJNA 3PSEB 3B2FA 2NBVB 2Y5PA 1YQ3B 4K3BA 3PHWB 2JUOA 2N1WA 1WGHA 1E0ZA 1LFDA 5JHBA 1T6BX 2N0SB 2L3ZA 4F1SA 2YEPB 3EHVA 5LXHA 2YLMA 2HE7A 2DYOA 4GSWA 1YQBA 1GOZA 1TKGA 1UH6A 4JPSA 2D3GA 3P1MA 4CO7A 4PYZA 3AU5A 3SU8X 4C7YA 4JE3B 2WU5B 1GAQB 3A9JA 4LJOB 1VDVA 2NBWB 2IGDA 2WXQA 2PVGC 3I9V1 3DDCB 3RNBC 1WE7A 2H88B 2WDTB 4LDTD 5BYSA 2D3CA 2RDHA 2CHXA 1UGMA 2WXKA 4BVUC 3B08A 1P7EA 2BYEA 1IPGA 1FXTB 3ZJVA 1AN8A 3U30A 1R7SA 1E9MA 3SR6A 2MSED 4A8XC 4A6QA 3QWZB 4BKTA 3AV8A 1J7BA 3ML8A 2RGFA 5J2RA 4IDIA 2YVCA 1YN3A 4W9JA 4GDKA 3RNCC 1KTKA 4ANWA 2VZKB 3TSSA 4GXBA 1FMAD 1S1QB 1GNUA 2M0XA 1SXTA 2XNAC 3IVFA 4RGMA 5DPRA 3R2IA 1E7UA 2FIFA 2AX5A 5BYRA 2HTME 4CYEA 2KXJA
chains in the Genus database with same CATH topology
1IBXB 3DWGC 3VRBB 1SJED 1WXQA 4OZAA 1TJEA 1Q10A 3IAM1 4YWGG 2J53A 1VZ8A 1CZPA 2LUMA 1FCCC 2W3SA 1FXAA 3PO0A 4KGSA 3MHZA 3HVZA 5H8YE 4DXFA 3NZ3A 3BK1A 5EE1A 3V05A 1ZXIA 2E6XA 1FCLA 1SEBD 2BS2B 4HKZE 3PZ7A 4RCOA 1SSNA 1L0VB 2NTTA 1HXYD 1N62A 1QOGA 1RFKA 2L83A 1OQRA 2PVOD 2JQRB 2KWDA 1FFVA 2FUG1 2M0AA 3P4PB 5JXVA 1I4PA 4MM3B 1IGCA 3MFGA 3NUHB 2INNE 4YTNB 2JZPA 1NYRA 2WU2B 1ET6A 2KMMA 5T8IA 4TMAB 1E10A 4RF0A 2FE8A 4N6EB 4YTPB 1XO3A 1XLOA 2G1EA 1JALA 3Q69A 1DYQA 1C78A 4AQ7A 2K3UA 2IGHA 5E6JA 2RMMA 3U52E 5G5GA 1V1PB 2GI9A 1P7FA 1C77A 1HZ5A 2H89B 4JWSC 1A70A 2WXPA 3VQIA 4WIPA 1MHHE 2PMVA 4NJCA 5EE3A 5AUIA 2WDQB 2WLBA 3RPFC 2DLBA 4IKGA 1TYGB 2WP9B 1E6EB 1E7PB 1N5WA 2WNMA 1KRHA 1PUTA 2KN4A 5BMIA 1TZOA 5MPOA 1YNTE 3CWIA 4WAFA 2Z8LA 4XWWA 3EGRA 4LTUA 5FKAC 1J7AA 2BW2A 1ZXHA 1XF5L 2RDGA 2NTSA 1UWMA 3MJ5A 1B1ZA 2PKOA 1VJKA 1JRPA 1TKYA 3ETRA 3H8HA 1V1OA 1WWTA 1XCTL 1ZP0B 1NI3A 3NVZA 5HI1A 2JYEA 1VZ7A 1FM0D 3Q8BA 4UDUC 1J7CA 2TSSA 4HEA1 4XE0A 2J52A 1SB3C 2L52A 1L4DB 2LHDA 3AEDB 4GLSC 1QF6A 2PW9A 1I4GA 4O1NA 1YJJA 1FNUA 1DGJA 3NRZA 3UI3A 4ZHPA 2KACA 3NVWA 4YXDB 3BYYB 1NENB 4OZCA 1QT9A 2BBCA 3BIID 3KQ4A 2ON8A 4A90A 4A55A 1L6UA 5EE0A 1JWSD 4OHJA 1UUPA 1ZDVA 1JMLA 2DBYA 3SFEB 1YQ4B 2I38A 2QIEB 2WXMA 1ET9A 4A9AA 5HG2A 1I4RA 1KH0A 2J42A 2ZW0A 2WXNA 4US9A 3TEZA 3VR8B 1VLBA 3AB5A 2HDEA 3URYA 1JCKB 4J3OD 2V0GA 1C4AA 1EU3A 2ICIA 1TKEA 5GXGB 1D4BA 4USAA 5EE9A 5C2TB 3FILB 5AUKA 4YTMB 3BWUD 1YN4A 2G9HD 1FIQA 1K53A 4OW0A 4C7ZA 2WQYB 1D5XC 2EKIA 1V8CA 4TQ1A 5FK9C 1GB1A 2INPE 4HJGE 4FXCA 5BYQA 4XWTA 1D6EC 1GB4A 2WXJA 2L1AA 2KQ4X 1LO5D 2W3RA 4GDKB 1NYQA 1WYGA 1SE3A 1WGKA 4H2AA 1TS3A 1N60A 3CIRB 4HRSA 1MHXA 1SE2A 3IAS1 1ZOYB 4RGOS 4WQMA 1YN5A 1K51A 1FD6A 4RGTA 1XLQA 3GB1A 1CJEA 1XEEA 3P4SB 3E56A 3EUB2 4P16A 3W2DA 4HROA 1N61A 3P4RB 3C8YA 2BS4B 2DYMA 1DOIA 1MPEA 1K50A 3NVYA 1PDXA 1KFYB 4ITKA 2I2YA 4R3DA 1T5XD 3HRDD 3MC0B 2OHFA 4PT5A 1AYFA 1MVKA 2RPVA 3KWVA 1JROA 1ZPSA 2AQ3B 1FEHA 3P63A 3W1SA 2WXHA 1IUEA 2PLPA 5D7GA 3VRAB 1SBBB 1CQVA 1XLNA 2CU3A 5BMGA 2FBWB 1ZE3D 1ROEA 1D5ZC 3IXSA 3T3OA 2LFIA 3RFZB 1TS4A 3FAHA 4OZBA 2NMQA 3LXFA 1ESFA 1FO4A 4ZOHC 3B9JA 2Y5CA 4RGNA 4MH8A 4JX1C 1GPXA 3T3NA 2B76B 4Q2JA 5BMHA 1AW7A 1JWUD 4LLGM 3TUOA 3Q8EA 1ENFA 2QEJC 2QILA 4ARIA 1DOYA 1I7HA 1WSPA 4TQ0A 4L1BA 2LEKA 3N9YC 1KLGD 1EWCA 4YSXB 2V4IB 1C9FA 3BVGA 5D3DA 2WXGA 2JYTA 1L0XB 2K5PA 1ACCA 3SEBA 3AEAB 3Q8AA 3AE8B 3IT4B 1C4PA 1FNVA 1PYWD 4L2YA 1SE4A 2PIAA 1BMLC 1N5XA 2YEPF 4ZRPA 3AE6B 3HUIA 1DOXA 4YT0B 4B0EA 2E3TA 3PZ8A 4KGTA 2JWUA 1ZDXA 2QMTA 1QQRA 2Y3AA 1TS5A 3AN1A 2KDMA 1YMHE 2W54A 4ARCA 2WXLA 2BB5A 2JXTA 3R2TA 1V97A 4N58A 5FR3A 5C3JB 3B2GA 3BZDB 1TY0A 3ZJUA 1HEZE 1EM7A 2X38A 2W55A 1XCQL 4US8A 2VZKD 1IBXA 3LYYA 3TEWA 1ZUD2 3U2SC 3W5UB 2IPKD 3BVMA 3O13A 2PTLA 3P42A 5H92C 1BXTA 4ZHOA 5HHDG 1VZ6A 1XLPA 2JU6X 2L32A 2LGIA 1RM6C 2WXFA 2IDYA 2K9XA 4JWUC 3SFDB 4ZRQA 3AEGB 2QSDA 4YSZB 3TEXA 4D2KA 2N9LA 2LJIA 3U4EG 4DQOC 4XDCA 3IT6B 1HZ6A 2JX5A 3VR9B 3TEYA 1KLUD 1YJIA 2R61A 3BVZA 3W9CB 3ZGZA 1TY2A 3AE2B 1K52A 2WDRB 1L6VA 4NZLB 1QOAA 4EE2A 1UNSA 4OVZA 1F2RC 2MEKA 2BS3B 3HVDA 1JWAD 1PGBA 1F2RI 4KX6B 3Q8FA 2DWQA 2BYTA 1UWXA 2MJEA 3E9SA 3BK2A 1FFUA 1JW9D 1PGXA 1D5MC 3I57A 1JWMD 3AE5B 2LHEA 1QLBB 1FXIA 1V1PA 1I4XA 2EELA 5TSSA 3DWMA 4M0WA 1B9RA 2ZW1A 1IGDA 2V3NA 1OQQA 2MJ3A 2Y5PA 2WXRA 3B2FA 3ZJTA 1YQ3B 3FC4A 4KKIA 1HA5A 2CJNA 2M56B 4C56C 4KGRA 5HFYA 1QOFA 1I4QA 3LB8C 1RWSA 1T3QA 1XXGA 1Y56A 3KLSX 3AE3B 1SIJA 1I4HA 1QILA 4MACA 4WURA 3ZYYX 2K22A 1PFDA 1F77A 2BTEA 3AE4B 1E0ZA 2J4XA 1L4ZB 2GRIA 4LK0M 3ABVB 1JWBD 2IGGA 3AM9A 1VRAB 2KAJA 2CJOA 3AEBB 1AWDA 1C76A 1T6BX 2N0SB 4NAMA 1MI0A 2WXIA 2WXOA 1STEA 2MH7A 2YEPB 3AE9B 2ONQA 3AMZA 1RYJA 3AE7B 2DYOA 1GOZA 3OWEB 4RH6A 1NEKB 1L0YB 2JSVX 4KKJA 4AS1A 5LNK1 2XN9C 4P6VF 1TKGA 1UGJA 2N7JA 4JPSA 1HQRD 1FRDA 3KWLA 3P1MA 1FNWA 4L23A 1QOBA 2IJ0A 1JQ4A 4C7YA 2OEDA 3Q8CA 4JE3B 2WU5B 1L5PA 3AE1B 1GAQB 3AH7A 4ZYSA 3V3XA 3L4PA 3NS1A 1M4VA 1QKZA 1VDVA 3P4QB 2K0PA 2IGDA 4TSSA 3W5VB 1F0ZA 4REZA 2WXQA 2PVGC 3I9V1 4WH4A 5D3IB 3U7ZA 1WRIA 2H88B 1N63A 5BYSA 2GB1A 2RDHA 2WXKA 1TS2A 2MJDA 4RF1A 4HKQA 1SF0A 4N59A 1P7EA 3BYTB 1NVID 2N9KA 3ZJVA 3AEFB 1AN8A 1SJHD 1R7SA 1E9MA 3SR6A 2QJLA 3GS2A 4A8XC 2BB6A 4A6QA 2W82A 3AV8A 2WS3B 2SEBD 3FILA 1J7BA 2SAKA 4C80A 2LMCA 4IOIE 2V3PA 1FRRA 4GDLB 2M19A 4NAWB 1EWYC 1EU4A 1KF6B 4IDIA 3J9CA 4XDDA 1YN3A 5I4DA 4RNAA 2ACZB 3WCQA 2WDVB 2BT6A 4YSYB 1KTKA 3EA6A 3AEEB 2VZKB 1VR9A 3TSSA 4DXGA 1FMAD 1C4CA 1C79A 1CK1A 2AQ2B 1SXTA 2XNAC 5G5HA 1PGAA 1BUIC 1OFFA 4CQNA 4B0MA 4RFBA 3R8BA 4RGMA 2D5GA 3R2IA 3MP9A 4WWMA 2AX5A 5BYRA 2Q5WD 2AQ1B 3ZQ4A 3NVVA 4MT5A 3GP7A 2HTME 3AECB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ON8 A;  1IBX B;  2IGG A;  4OZA A;  1C9F A;  1Q10 A;  1JML A;  2J53 A;  2LUM A;  2I38 A;  1FCC C;  1MI0 A;  4KGS A;  5HG2 A;  2ONQ A;  1KH0 A;  2ZW0 A;  4KGT A;  2JWU A;  2QMT A;  1FCL A;  2JSV X;  4HKZ E;  2N7J A;  2KDM A;  1YMH E;  2OED A;  1D4B A;  2KWD A;  3FIL B;  2JXT A;  3V3X A;  5JXV A;  1K53 A;  1IGC A;  1QKZ A;  1HEZ E;  1EM7 A;  2JZP A;  2K0P A;  2IGD A;  1GB1 A;  1XCQ L;  4WH4 A;  4HJG E;  1IBX A;  1GB4 A;  2GB1 A;  2KQ4 X;  2PTL A;  2IGH A;  2RMM A;  1P7E A;  5HHD G;  1MHX A;  2JU6 X;  2GI9 A;  2LGI A;  1P7F A;  2N9K A;  1HZ5 A;  1K51 A;  1FD6 A;  3GB1 A;  1MHH E;  2QSD A;  4D2K A;  2N9L A;  4IKG A;  1MPE A;  1K50 A;  1HZ6 A;  2KN4 A;  5BMI A;  2I2Y A;  1YNT E;  3FIL A;  1K52 A;  4IOI E;  1MVK A;  1F2R C;  2RPV A;  1PGB A;  1XF5 L;  1ZXH A;  1F2R I;  1UWX A;  2PLP A;  1PGX A;  1XCT L;  5BMG A;  5HI1 A;  2LHE A;  4OZB A;  2EEL A;  2J52 A;  2NMQ A;  2ZW1 A;  1IGD A;  2LHD A;  4GLS C;  1PGA A;  2PW9 A;  4KGR A;  5HFY A;  3UI3 A;  3MP9 A;  2KAC A;  5BMH A;  4MAC A;  4OZC A; 
#chains in the Genus database with same CATH topology
 1TGZ B;  4K3C A;  4AUQ C;  1TJE A;  4IWP A;  2OJR A;  2LUM A;  1XQQ A;  2GBN A;  2LVQ A;  1FCC C;  4EEW A;  1J8C A;  1FXA A;  3PO0 A;  1H4R A;  4KGS A;  4DXF A;  2MX2 A;  5EE1 A;  1P3Q U;  1ZXI A;  3SDL C;  4IUM B;  4OVV A;  1WYW B;  3PZ7 A;  4RCO A;  4GGQ A;  2NTT A;  1HXY D;  2PVO D;  2JQR B;  3NJT A;  4IM0 A;  1MFW A;  5JXV A;  3GZN I;  4BKG A;  4HWI B;  4WJP A;  4BKS A;  3MFG A;  3NUH B;  2JZP A;  1ET6 A;  4XYC A;  2NPT A;  1E10 A;  4TMA B;  2JWZ A;  5LXI B;  2KC1 A;  1C78 A;  2IGH A;  2RMM A;  3RN9 C;  3KH0 A;  2QC8 A;  3P2B A;  4EOY A;  4C4V A;  2AWT A;  3ENE A;  3MC9 A;  1MHH E;  2PMV A;  1V81 A;  2DZK A;  4IKG A;  2WP9 B;  4NNJ B;  1E6E B;  1E7P B;  4MGY E;  5IN7 A;  2ZNV B;  4FN2 A;  3L17 A;  5IOI A;  2PEA A;  4G50 A;  4FJZ A;  4XWW A;  2HJ1 A;  2ZNV C;  1P9D U;  3DHH C;  2RDG A;  3B1L X;  2V1Y A;  1UWM A;  3KYD D;  4M00 A;  3L10 B;  3H8H A;  2C9W B;  3ZXR A;  1ZP0 B;  3NVZ A;  3GOE A;  2JYE A;  1FM0 D;  4ZYN A;  2J52 A;  1SB3 C;  1QF6 A;  3QIJ A;  5E6N A;  1DGJ A;  2LGD A;  2DZJ A;  4F7Z A;  1NEN B;  1QT9 A;  2BBC A;  3KQ4 A;  3M62 B;  5E6P A;  5AZG A;  3PLU A;  4B9K A;  3N32 A;  1WY8 A;  1JML A;  2DBY A;  3SFE B;  4I6P A;  2MP2 A;  2I38 A;  3ONS A;  2MLB A;  3K9P B;  2QIE B;  4WWP A;  1V2Y A;  2MBH A;  5HG2 A;  4EKU A;  3TIX A;  2WXN A;  4US9 A;  3KUZ A;  2HDE A;  1JCK B;  1S3S G;  3N30 A;  2LVP A;  1T0S C;  1C4A A;  2ICI A;  4HLE A;  3RNF C;  4C7Z A;  2Z0D B;  4K7S A;  2OOB B;  4FXC A;  2WXJ A;  4MH0 E;  2KQ4 X;  3NZU A;  2ZPN A;  1WGK A;  1V9J A;  3RMK C;  1N60 A;  2DYB A;  1MHX A;  1SE2 A;  3TCA A;  4GB9 A;  1K51 A;  4RGT A;  1XLQ A;  2KTF A;  5D2M B;  3ZDM C;  1PDX A;  2UYZ B;  4ANV A;  4ITK A;  4P1C C;  1YD8 U;  2IND C;  2BPS A;  2LXC A;  2OHF A;  1WMH B;  1MVK A;  2MHJ A;  3UIN B;  4YL8 A;  1ZPS A;  2EMT A;  4IC7 B;  4LNI A;  2KLG A;  1CQV A;  1XLN A;  3DOW A;  1E8Y A;  2FBW B;  4ZRK A;  4MSM B;  4S17 A;  2DEN B;  4NQK E;  3I3T B;  4ZOH C;  3SHQ A;  3B9J A;  4RGN A;  4JX1 C;  3T3N A;  4Q2J A;  1G6J A;  1AW7 A;  4LLG M;  3TUO A;  4ARI A;  1WSP A;  3X0W A;  2N1V A;  1EWC A;  3NG0 A;  4YSX B;  2DHZ A;  5D3D A;  2K5P A;  4FHJ A;  1V86 A;  4RM8 A;  3AE8 B;  2M17 A;  2PIA A;  1BML C;  1N5X A;  3AE6 B;  1DOX A;  4B0E A;  3W1S C;  4ICV A;  3PT2 B;  5CHV C;  4AP4 C;  3CSF A;  3L16 A;  2KMA A;  2JXT A;  3R2T A;  4A20 A;  3B2G A;  1WXV A;  5IA7 A;  2W55 A;  1XCQ L;  4W9K A;  2J0J A;  2N4F A;  4BFR A;  2KHW B;  3ZVV A;  4HXD A;  2NVU I;  2LGY A;  1VZ6 A;  1Q5W B;  1F1H A;  1KJT A;  3VUW A;  2GBR A;  3RNE C;  2LAS A;  2N9L A;  4HDO A;  3Q2A C;  3IT6 B;  1KLU D;  1Q0W B;  3BVZ A;  1TY2 A;  2VH2 A;  4NZL B;  1L6V A;  3DHI C;  1F2R C;  3HVD A;  3AI5 A;  4GOC A;  3Q8F A;  1UWX A;  2DAF A;  3BY4 B;  3BK2 A;  4FA6 A;  1FFU A;  4NJ6 A;  1D5M C;  3HK0 A;  4W9L A;  3APD A;  1OQY A;  1QLB B;  1IGD A;  1C3T A;  2V3N A;  1T0Q C;  1HA5 A;  2CJN A;  2Y5B B;  2N7E A;  3VUX A;  1T3Q A;  1SIJ A;  3UIP B;  2K22 A;  4FAD A;  2BTE A;  2GRI A;  2ZVO A;  4LK0 M;  3ABV B;  2IGG A;  2KOX A;  1VRA B;  1N6Z A;  1SGH A;  1Z5S B;  1AWD A;  2KQ7 A;  2FAZ A;  2IYD B;  1MI0 A;  1F52 A;  4W9G A;  2NBU A;  2MQJ A;  2LVO A;  3AMZ A;  1RYJ A;  3PTF C;  1NEK B;  3H9D A;  5LNK 1;  4P6V F;  1HQR D;  5J17 A;  1QOB A;  3ZNH B;  4JIO U;  3R7Q A;  2OED A;  2J0M A;  3OG5 A;  1L5P A;  3APF A;  2L00 B;  2O2V B;  1ISN A;  5FR6 A;  4REZ A;  1OEY J;  3RNG C;  3H7P B;  5D3I B;  3A4R A;  3O65 B;  1N63 A;  2JF5 A;  4HKQ A;  4N59 A;  3BYT B;  4W9H A;  2N9K A;  3VH4 B;  1SJH D;  3GS2 A;  4BAX A;  2B3A A;  2BB6 A;  1P0R A;  5KHO A;  2WS3 B;  4G11 A;  2SAK A;  2LMC A;  2A4Z A;  4HCN B;  4IOI E;  1FRR A;  2M19 A;  1WR6 E;  4KV2 A;  3J9C A;  4FHK A;  3B0A A;  2ACZ B;  3EA6 A;  5IO9 A;  1VR9 A;  4PK1 A;  2MW5 A;  1TBE A;  2QCZ A;  2W9N A;  2AQ2 B;  2LRW A;  5G5H A;  1BUI C;  3R8B A;  3Q3J A;  4K7W A;  4KDI C;  3DQV A;  3R3M A;  2AQ1 B;  3ZQ4 A;  4MT5 A;  3GP7 A;  2KD0 A;  1RRB A;  2ZZP B;  3OJ4 B;  2C60 A;  3DWG C;  4F8C B;  4GMV A;  3VDZ A;  4MGK E;  1SJE D;  1WXQ A;  1WMH A;  3IAM 1;  4DWF A;  3N1X C;  3TBL D;  3HVZ A;  2K25 A;  3GE8 C;  2E6X A;  2BS2 B;  5DPT A;  4LNN A;  1L0V B;  4IM3 A;  1N62 A;  1OQR A;  2CHW A;  2KO3 A;  4MM3 B;  1IGC A;  2L0T A;  2INN E;  4YTN B;  1NYR A;  2WU2 B;  2KMM A;  2KVR A;  5T8I A;  2PE6 B;  4RF0 A;  2FE8 A;  4HCP B;  3RZF A;  3WAM A;  4ACF A;  4YTP B;  3Q3M C;  2KLC A;  5TR5 A;  1V1P B;  2GI9 A;  2AEH A;  4M0W B;  3AUL A;  1A70 A;  2X8X X;  2FNJ B;  4KSK C;  4XZ4 A;  2XEW A;  4NJC A;  5EE3 A;  2WDQ B;  2DLB A;  2KN4 A;  5BMI A;  4K81 A;  4TUU A;  2Z8L A;  4IG7 B;  4GN1 A;  2BW2 A;  2Z0E B;  4M01 A;  5JZE B;  5AEK B;  3MJ5 A;  4MSQ B;  1VJK A;  2FCS A;  1TKY A;  3ETR A;  1WWT A;  1NI3 A;  1TZ1 A;  3Q8B A;  4UDU C;  2JZ3 B;  4HEA 1;  4LDT B;  4HPL B;  1L4D B;  4GLS C;  3T9L A;  1JRU A;  3JVZ X;  4O1N A;  4ZHP A;  1ZW7 A;  2WHI A;  2LXA A;  3N1Z C;  3BYY B;  3MC8 A;  4OZC A;  1E5W A;  4BZA A;  5EE0 A;  3QA8 A;  4MEM A;  4OHJ A;  1WXM A;  4W9C A;  3PLV A;  1YQ4 B;  2PJH A;  4MJS B;  1I4R A;  4WQO B;  2KJH B;  2ZW0 A;  2RDB C;  2VRR B;  3AU4 A;  3IHP C;  2DZM A;  5CHW A;  1VLB A;  2CS4 A;  4K7U A;  3DVN U;  2V0G A;  4MEL A;  1R4N B;  5DCN A;  3V6C B;  2DAJ A;  3Q3N C;  2EMS A;  3FIL B;  1Z2M A;  2WWZ A;  5AUK A;  3BWU D;  1FIQ A;  4OW0 A;  2WQY B;  1D5X C;  2EKI A;  2REX A;  4TQ1 A;  1NBF C;  1V5O A;  4H2A A;  1WGR A;  1P1A A;  3ZNI D;  3EFU A;  4LNO A;  1ZOY B;  4RGO S;  4WQM A;  3GB1 A;  1CJE A;  3E56 A;  3EUB 2;  4JLC A;  4XX5 A;  2BWF A;  1Q1O A;  4C00 A;  2KDF B;  4R3D A;  1T5X D;  1KM7 A;  3MC0 B;  2O2V A;  4PT5 A;  1AYF A;  2L0F A;  1JRO A;  4LCD E;  3H7P A;  1NI2 A;  3ZUN A;  4WWN A;  1YOV B;  2PLP A;  2XBB C;  1D5Z C;  4HPM B;  1TS4 A;  2LD9 A;  4OZB A;  3VTU A;  5J18 A;  3LXF A;  1ESF A;  5GMV A;  2MBQ A;  2BVC A;  2D3A A;  4MH8 A;  1GPX A;  3BIN A;  3RCZ A;  3DVN V;  3Q8E A;  2QIL A;  3DHG C;  3ZXV A;  1UF0 A;  4K1R B;  2V4I B;  3BVG A;  2JYT A;  1L0X B;  4ICU A;  4NQL B;  2Z59 B;  3H1U A;  3IT4 B;  1T0Y A;  3HUI A;  1KOT A;  3TL5 A;  1ZDX A;  1YX6 B;  2Y3A A;  3QAQ A;  5L95 C;  3AN1 A;  3KW5 B;  2GBK A;  4HPP A;  2D07 B;  2RPQ A;  2A5U A;  2KAN A;  3ZRF A;  2ZJD A;  5FR3 A;  4PS3 A;  2BKR B;  1A5R A;  3A1Q B;  3NS8 A;  3LYY A;  2JRH A;  1EF1 A;  2DZI A;  1H8C A;  3W5U B;  2MBB B;  3IG3 A;  4ASW C;  3O13 A;  3RUL A;  2PTL A;  2L32 A;  2D3B A;  2WXF A;  2BWE S;  4A3O A;  3KVF B;  4EZL A;  1T0R C;  3TEX A;  2LJI A;  1OEY A;  3VR9 B;  5D6J B;  3TEY A;  3I5J C;  4FJY A;  2K1F A;  3AE2 B;  4MM3 A;  1XT9 B;  4IWQ A;  1QOA A;  4EE2 A;  1WRD B;  1UNS A;  2MEK A;  5CTR C;  4RM9 A;  1F2R I;  2DWQ A;  3V61 A;  2R2Q A;  2KWC A;  3OAW A;  3AE5 B;  3EEC A;  2LHE A;  2ZVN A;  1V1P A;  2EEL A;  5TSS A;  3R7R A;  4M0W A;  5DPW A;  2WXR A;  3ZJT A;  4KKI A;  3DBR B;  2M56 B;  4C56 C;  5HFY A;  1QOF A;  4FBJ B;  1I4Q A;  3LB8 C;  2N9P C;  1XXG A;  1Y56 A;  3AE3 B;  4WUR A;  3VUY A;  3ZYY X;  3IFW B;  1F77 A;  2J4X A;  1JWB D;  2VH1 A;  2KAJ A;  2CJO A;  3VFK A;  2RR9 A;  4NAM A;  2WXI A;  1STE A;  1P98 A;  1EO6 A;  3AE9 B;  2ONQ A;  5IP4 D;  3VH3 B;  2KJR A;  3UQA A;  3AE7 B;  5E6O A;  3PPA A;  5DPS A;  1L0Y B;  4KKJ A;  4AS1 A;  3EFC A;  1FNW A;  2IJ0 A;  1WXS A;  2IY0 B;  1JQ4 A;  3DBS A;  3AE1 B;  4ZYS A;  3V3X A;  3L4P A;  1HTQ A;  3P4Q B;  4TSS A;  2AL3 A;  2GLS A;  1WM3 A;  1GC6 A;  1WJ6 A;  2GB1 A;  1TS2 A;  2MJD A;  4RF1 A;  1SF0 A;  4MJS A;  1NVI D;  4DHZ E;  1LQB A;  1VD2 A;  3AEF B;  3L13 A;  2QJL A;  1IYF A;  4MDK E;  3V6E B;  4KDL B;  2N9E B;  1UEL A;  1WM2 A;  3FIL A;  3QQ8 B;  2WYQ A;  3APC A;  4P7I A;  2V3P A;  1KF6 B;  4XDD A;  4RNA A;  3WCQ A;  2KFK B;  2WDV B;  5G2N A;  3V60 A;  2KYW A;  3AEE B;  4DXG A;  3QHT A;  3RYT A;  4EZK A;  2WX1 A;  4B0M A;  1CMX B;  4N9F 4;  2D5G A;  3MP9 A;  1PQS A;  3L54 A;  4PS8 A;  3JSV B;  3DBH B;  3NVV A;  2UWQ A;  3DBL I;  3U7D A;  2L7R A;  3WAO A;  3ZO5 B;  3VRB B;  1HTO A;  3A9K B;  1Q10 A;  5AZH A;  1ZGU B;  1VZ8 A;  1CZP A;  2KNB A;  2GBM A;  2W3S A;  3Q3O C;  2C5L C;  3MHZ A;  3OJ3 A;  5H8Y E;  3BK1 A;  2L05 A;  2MCN B;  4S0R A;  3V05 A;  3T8M A;  3UIO B;  2HJ8 A;  3Q14 C;  4HKZ E;  4JQW C;  1SSN A;  3RT3 B;  2GBJ A;  1RFK A;  1EUV B;  1FFV A;  2KWD A;  2FUG 1;  3P4P B;  1I4P A;  4W9E A;  3VHT C;  1M94 A;  1GUA B;  5G55 A;  3PRM B;  3L08 A;  4N6E B;  3ZKJ C;  1XLO A;  4DXA B;  2N7D A;  4KSL C;  3RI7 C;  1JAL A;  3Q69 A;  2BYV E;  1X1M A;  3DCG A;  1DYQ A;  4AQ7 A;  2K3U A;  5E6J A;  4HVB A;  5G5G A;  2KK8 A;  1C77 A;  3ML9 A;  4PS7 A;  4BKS D;  2H89 B;  2LWP A;  2WXP A;  2KT7 A;  3FKY A;  1GJZ A;  2WLB A;  4G3X B;  2WNM A;  3QCA A;  3D32 A;  1KRH A;  1TZO A;  5MPO A;  3RNA C;  1YNT E;  2KWV B;  1D3Z A;  1WFY A;  3EGR A;  4LTU A;  5FKA C;  2INC C;  1SE9 A;  2JT4 B;  3A1Q A;  2LZ6 A;  4B95 A;  1MJD A;  1B1Z A;  2PKO A;  3PRP B;  1V1O A;  1XCT L;  2KFJ A;  2KX3 A;  5HI1 A;  1VZ7 A;  1J7C A;  2TSS A;  3RZW C;  4DHJ B;  2L52 A;  4ANX A;  3CMM B;  2O6V B;  1I4G A;  4C4V B;  1YJJ A;  1IP9 A;  1FNU A;  3UI3 A;  2KAC A;  4CHK A;  1TIF A;  3WIM A;  3BII D;  2ASQ A;  2ON8 A;  4A55 A;  1JWS D;  2MBO A;  1SIF A;  4IWO A;  3NZS A;  4HJK A;  1FPY A;  2WXM A;  4A9A A;  1XD3 B;  3DBL B;  2G4D B;  4WJQ A;  2CHZ A;  3TEZ A;  3VR8 B;  3AB5 A;  3ZRC A;  1WXA A;  2KC2 A;  4J3O D;  3N20 C;  1E7V A;  1EU3 A;  2IZV B;  1TKE A;  1D4B A;  4USA A;  5C2T B;  4YTM B;  2KJ6 A;  1K53 A;  1R4N I;  4M8N A;  4M8M A;  5FK9 C;  2V4L A;  1GB1 A;  1YJ1 A;  1WGG A;  2INP E;  4HJG E;  1D6E C;  1OGW A;  1GB4 A;  2W3R A;  1NYQ A;  1WYG A;  1SE3 A;  2IO1 B;  3CIR B;  4HRS A;  3U8Z A;  4EFO A;  3VTV A;  4I6L B;  1J19 A;  1XEE A;  3ECI A;  1N61 A;  3GE3 C;  2MA9 B;  3PHX B;  4LJP B;  3C8Y A;  2DYM A;  3MHS D;  1DOI A;  1K50 A;  2FCM A;  3NVY A;  4AWJ A;  3EC8 A;  1KFY B;  3KYC D;  3HRD D;  2EKE C;  1I35 A;  2CR5 A;  4W9D A;  3ZW3 A;  2AL6 A;  3H6N A;  3P63 A;  3W1S A;  2WXH A;  2I1K A;  2ZPY A;  3VRA B;  2KMC A;  1SBB B;  2CU3 A;  5BMG A;  1GG3 A;  1ZE3 D;  3IXS A;  3T3O A;  4DK5 A;  2LFI A;  3RFZ B;  2MBE A;  4LNF A;  3FAH A;  1AAR A;  3M3J A;  4AJW A;  2B76 B;  2IO2 B;  5BMH A;  2QEJ C;  2KTR B;  1I7H A;  3CST A;  4TQ0 A;  1WJU A;  2LEK A;  1KLG D;  2WXG A;  2DNF A;  1RAX A;  3ZDT A;  3SEB A;  3AEA B;  3IBE A;  2LI5 A;  1FNV A;  2ZCB A;  2QDF A;  4ZRP A;  2KFK A;  2E3T A;  3PZ8 A;  4KGT A;  2JWU A;  2QMT A;  1TS5 A;  4TV3 A;  4XGA B;  1R4M B;  2RSU A;  4ARC A;  2WXL A;  2BB5 A;  3JSV A;  1V97 A;  4N58 A;  1TY0 A;  3R66 C;  1OTR B;  1HEZ E;  1EM7 A;  4GU2 A;  2X38 A;  4BOZ B;  2LUE A;  2JPH A;  2VZK D;  3AXC A;  4US8 A;  3C19 A;  1ZUD 2;  3HM6 X;  5AZF A;  3A9K A;  2K6D B;  2D2Q A;  3BVM A;  3ZIM A;  4X57 B;  1BXT A;  1RM6 C;  1WE6 A;  3I63 C;  4ZRQ A;  3AEG B;  4YSZ B;  4QAY A;  4DQO C;  3U4E G;  1QZE A;  3W9C B;  1UBQ A;  1HE8 A;  4KIK B;  4B6W A;  2KWU B;  4A3P A;  4AOF A;  3QC8 B;  2UU7 A;  1NDD A;  4J6I A;  1KLV A;  2JY6 A;  2WDR B;  4OVZ A;  3PRE A;  2K39 A;  2BS3 B;  1JWA D;  1PGB A;  4EZJ A;  2LGS A;  2JZZ A;  2BYT A;  2MJE A;  3E9S A;  1E90 A;  3X23 A;  3I57 A;  3QAR A;  2FUH B;  1UD7 A;  1WGY A;  1I4X A;  3DWM A;  1B9R A;  2M1M A;  1UBI A;  1OQQ A;  2MJ3 A;  4IM2 A;  3FC4 A;  4KGR A;  2LRU A;  5JHA A;  1RWS A;  3KLS X;  1I4H A;  4AJY B;  1QIL A;  4MAC A;  3NHE B;  4P1B C;  1PFD A;  3DBR I;  3VTW A;  3OLM D;  2G3Q B;  1WF9 A;  3AE4 B;  1L4Z B;  3M63 B;  2KZR A;  4HK2 A;  3AM9 A;  1EF5 A;  2K8H A;  3AEB B;  2I1J A;  1C76 A;  4W9I A;  2WXO A;  1WX7 A;  2G4S A;  4MGZ E;  2MH7 A;  5C23 A;  1Y8R C;  2XK5 B;  3OWE B;  4RH6 A;  3K9O B;  1V80 A;  2KDI A;  2JSV X;  5CX3 A;  2XN9 C;  4L23 A;  1UGJ A;  2N7J A;  1FRD A;  3KUC B;  3KWL A;  2O6V A;  3Q8C A;  4M02 A;  3AH7 A;  2JXX A;  3PZD A;  3NS1 A;  1M4V A;  1QKZ A;  5KHQ A;  2K0P A;  3W5V B;  1WX9 A;  1F0Z A;  3ZTD A;  3MTN B;  4WH4 A;  3U7Z A;  1WRI A;  1LXD A;  3JW0 X;  2G45 B;  2WX0 A;  2KQS A;  3A33 B;  2DX5 B;  2OJW A;  4HDQ A;  1VCB A;  3Q6B A;  3WAN A;  2LJ5 A;  4DBG A;  1WJN A;  3N1Y C;  4ANU A;  2W82 A;  2BGF A;  1L2N A;  2SEB D;  2ZCC A;  3LDZ E;  2WGS A;  4C80 A;  1YX5 B;  3WAP A;  5LLI A;  2K8B A;  4JGH B;  3UF8 A;  5C1Z A;  4GDL B;  4NAW B;  4OVU A;  1EWY C;  1EU4 A;  4RMA A;  3VXW A;  1BT0 A;  5I4D A;  3M95 A;  3W1Y A;  3ZNG C;  2BT6 A;  1WZ3 A;  3Q3F A;  4YSY B;  1WR1 A;  4FJV B;  2M8S A;  3V62 A;  1C4C A;  1WX8 A;  1C79 A;  1CK1 A;  2FCQ A;  1PGA A;  2FCN A;  4CQN A;  1OFF A;  1I42 A;  4RFB A;  4WWM A;  5IAA C;  3L0W B;  2Q5W D;  3AEC B;  2ZEQ A;  3WA0 A;  1IBX B;  3DBH I;  5BO4 B;  4OZA A;  4YWG G;  2J53 A;  1V49 A;  3ZLZ A;  3HM3 A;  3S2A A;  5IKC M;  3NZ3 A;  5L83 A;  1FCL A;  1SEB D;  3GZN B;  3H7S A;  4G0N B;  1QOG A;  2L83 A;  3HIZ A;  2NCN A;  2M0A A;  4BOS C;  2KTR A;  1WH3 A;  3JYU A;  4E74 A;  2M4N A;  1XO3 A;  2MWS B;  4LNK A;  2G1E A;  3ZTC A;  2BYF A;  3U52 E;  1WJ4 A;  1P7F A;  1HZ5 A;  3HHM A;  4NJ7 A;  4JWS C;  3VQI A;  4EUT A;  3DVG Y;  4II3 B;  4WIP A;  2BF8 B;  5AUI A;  2L8J A;  3UGB B;  3RPF C;  1TYG B;  1N5W A;  2GOW A;  1PUT A;  4FLH A;  2NS5 A;  3CWI A;  4WAF A;  1LGR A;  3DPD A;  1L7Y A;  3VVW B;  1J7A A;  2CU1 A;  1ZXH A;  1XF5 L;  1RFA A;  2NTS A;  1E8X A;  2HTH A;  1C1Y B;  1K8R B;  1JRP A;  2KN5 A;  2KX0 A;  4E3C A;  5JH5 C;  3RD2 A;  2KDB A;  4XE0 A;  4E71 A;  5CHF A;  2LHD A;  3AED B;  1V6E A;  3KUD B;  4NY0 A;  2K6Q A;  2PW9 A;  2L76 A;  4GIV A;  3NRZ A;  3A9J B;  1YIW A;  3NVW A;  3TMP B;  4YXD B;  2IO3 B;  3DVG X;  1ZKH A;  4IW0 A;  4KIK A;  2K8C A;  3RUI B;  4A90 A;  1L6U A;  1U4A A;  1UUP A;  1ZDV A;  2IBI B;  3ALB A;  1E8Z A;  4FUL A;  1ET9 A;  3MJW A;  4ZRI A;  2CKH B;  1KH0 A;  2J42 A;  1RLF A;  4KZC A;  3QJZ A;  2GMI C;  3LJ3 A;  3URY A;  1MG8 A;  3VAW A;  4NPN A;  4BBN F;  4KZ0 A;  1UZX B;  2MRP A;  5GXG B;  4URK A;  5EE9 A;  3A4S C;  3PGE A;  1YN4 A;  2G9H D;  1GC7 A;  2KKC A;  3QX1 A;  2HD5 B;  1V8C A;  2JRI B;  2BKF A;  3PVL A;  5BYQ A;  2IY1 B;  4XWT A;  2L1A A;  2V9H A;  1LO5 D;  3PS6 A;  4GDK B;  1TS3 A;  5D94 A;  3IAS 1;  3N3K B;  1YN5 A;  1FD6 A;  3P4S B;  4P16 A;  2BQQ A;  3W2D A;  2XK5 A;  4HRO A;  3P4R B;  2BS4 B;  3QK0 A;  2PPH A;  1MPE A;  3UQB A;  2I2Y A;  3NOB A;  2V3S A;  4DHZ B;  1WGD A;  4MGI E;  2JVC A;  2RPV A;  3KWV A;  2AQ3 B;  1FEH A;  1IUE A;  4WWO A;  2D10 A;  5D7G A;  1ROE A;  2KDE B;  2LGX A;  4ZRJ A;  2NMQ A;  1FO4 A;  2Y5C A;  4PYU A;  1JWU D;  2RD0 A;  2FID A;  1ENF A;  1DOY A;  2NPT B;  3SD5 A;  4L1B A;  3N9Y C;  2PE9 A;  1C9F A;  4DDG D;  1E8W A;  4GDL A;  1ACC A;  2KVZ A;  4KVG B;  4NAW A;  3Q8A A;  1C4P A;  2C7M B;  1PYW D;  4L2Y A;  1SE4 A;  2YEP F;  4DHJ D;  4YT0 B;  3C0R B;  2QHO A;  2O6V D;  1QQR A;  2KDM A;  4WJO A;  1YMH E;  2W54 A;  4II2 B;  3PV1 A;  4DDI D;  2C7N B;  2D11 A;  4BBN C;  1WI0 A;  5C3J B;  3BZD B;  1WZ0 A;  3ZJU A;  1R4M I;  2NR2 A;  4WAA A;  1IBX A;  3TEW A;  5HKH A;  2N9X A;  3U2S C;  2IPK D;  1LM8 B;  3P42 A;  1WIA A;  5H92 C;  4W9F A;  4JL9 A;  4ZHO A;  5HHD G;  1XLP A;  2JU6 X;  2LGI A;  2IDY A;  2K9X A;  4JWU C;  1V5T A;  3SFD B;  2C7H A;  2QSD A;  4D2K A;  2AYO B;  4XDC A;  3TJP A;  1HZ6 A;  2JX5 A;  3ZNZ B;  3NY5 A;  1YJI A;  2R61 A;  4ZDV A;  3ZGZ A;  1K52 A;  1F9J A;  2MP2 B;  5EDS A;  4KX6 B;  2IO0 B;  1TTN A;  1TT5 B;  4XC2 A;  4TKN A;  4I6N B;  1JW9 D;  1PGX A;  3WAL A;  3CF6 E;  2R2O A;  1JWM D;  3PRZ A;  2J7Q B;  1J0G A;  1MG4 A;  1FXI A;  2ZW1 A;  2J0K A;  4WJN A;  3PSE B;  3B2F A;  2NBV B;  2Y5P A;  1YQ3 B;  4K3B A;  3PHW B;  2JUO A;  2N1W A;  1WGH A;  1E0Z A;  1LFD A;  5JHB A;  1T6B X;  2N0S B;  2L3Z A;  4F1S A;  2YEP B;  3EHV A;  5LXH A;  2YLM A;  2HE7 A;  2DYO A;  4GSW A;  1YQB A;  1GOZ A;  1TKG A;  1UH6 A;  4JPS A;  2D3G A;  3P1M A;  4CO7 A;  4PYZ A;  3AU5 A;  3SU8 X;  4C7Y A;  4JE3 B;  2WU5 B;  1GAQ B;  3A9J A;  4LJO B;  1VDV A;  2NBW B;  2IGD A;  2WXQ A;  2PVG C;  3I9V 1;  3DDC B;  3RNB C;  1WE7 A;  2H88 B;  2WDT B;  4LDT D;  5BYS A;  2D3C A;  2RDH A;  2CHX A;  1UGM A;  2WXK A;  4BVU C;  3B08 A;  1P7E A;  2BYE A;  1IPG A;  1FXT B;  3ZJV A;  1AN8 A;  3U30 A;  1R7S A;  1E9M A;  3SR6 A;  2MSE D;  4A8X C;  4A6Q A;  3QWZ B;  4BKT A;  3AV8 A;  1J7B A;  3ML8 A;  2RGF A;  5J2R A;  4IDI A;  2YVC A;  1YN3 A;  4W9J A;  4GDK A;  3RNC C;  1KTK A;  4ANW A;  2VZK B;  3TSS A;  4GXB A;  1FMA D;  1S1Q B;  1GNU A;  2M0X A;  1SXT A;  2XNA C;  3IVF A;  4RGM A;  5DPR A;  3R2I A;  1E7U A;  2FIF A;  2AX5 A;  5BYR A;  2HTM E;  4CYE A;  2KXJ A; 
#chains in the Genus database with same CATH homology
 1IBX B;  3DWG C;  3VRB B;  1SJE D;  1WXQ A;  4OZA A;  1TJE A;  1Q10 A;  3IAM 1;  4YWG G;  2J53 A;  1VZ8 A;  1CZP A;  2LUM A;  1FCC C;  2W3S A;  1FXA A;  3PO0 A;  4KGS A;  3MHZ A;  3HVZ A;  5H8Y E;  4DXF A;  3NZ3 A;  3BK1 A;  5EE1 A;  3V05 A;  1ZXI A;  2E6X A;  1FCL A;  1SEB D;  2BS2 B;  4HKZ E;  3PZ7 A;  4RCO A;  1SSN A;  1L0V B;  2NTT A;  1HXY D;  1N62 A;  1QOG A;  1RFK A;  2L83 A;  1OQR A;  2PVO D;  2JQR B;  2KWD A;  1FFV A;  2FUG 1;  2M0A A;  3P4P B;  5JXV A;  1I4P A;  4MM3 B;  1IGC A;  3MFG A;  3NUH B;  2INN E;  4YTN B;  2JZP A;  1NYR A;  2WU2 B;  1ET6 A;  2KMM A;  5T8I A;  4TMA B;  1E10 A;  4RF0 A;  2FE8 A;  4N6E B;  4YTP B;  1XO3 A;  1XLO A;  2G1E A;  1JAL A;  3Q69 A;  1DYQ A;  1C78 A;  4AQ7 A;  2K3U A;  2IGH A;  5E6J A;  2RMM A;  3U52 E;  5G5G A;  1V1P B;  2GI9 A;  1P7F A;  1C77 A;  1HZ5 A;  2H89 B;  4JWS C;  1A70 A;  2WXP A;  3VQI A;  4WIP A;  1MHH E;  2PMV A;  4NJC A;  5EE3 A;  5AUI A;  2WDQ B;  2WLB A;  3RPF C;  2DLB A;  4IKG A;  1TYG B;  2WP9 B;  1E6E B;  1E7P B;  1N5W A;  2WNM A;  1KRH A;  1PUT A;  2KN4 A;  5BMI A;  1TZO A;  5MPO A;  1YNT E;  3CWI A;  4WAF A;  2Z8L A;  4XWW A;  3EGR A;  4LTU A;  5FKA C;  1J7A A;  2BW2 A;  1ZXH A;  1XF5 L;  2RDG A;  2NTS A;  1UWM A;  3MJ5 A;  1B1Z A;  2PKO A;  1VJK A;  1JRP A;  1TKY A;  3ETR A;  3H8H A;  1V1O A;  1WWT A;  1XCT L;  1ZP0 B;  1NI3 A;  3NVZ A;  5HI1 A;  2JYE A;  1VZ7 A;  1FM0 D;  3Q8B A;  4UDU C;  1J7C A;  2TSS A;  4HEA 1;  4XE0 A;  2J52 A;  1SB3 C;  2L52 A;  1L4D B;  2LHD A;  3AED B;  4GLS C;  1QF6 A;  2PW9 A;  1I4G A;  4O1N A;  1YJJ A;  1FNU A;  1DGJ A;  3NRZ A;  3UI3 A;  4ZHP A;  2KAC A;  3NVW A;  4YXD B;  3BYY B;  1NEN B;  4OZC A;  1QT9 A;  2BBC A;  3BII D;  3KQ4 A;  2ON8 A;  4A90 A;  4A55 A;  1L6U A;  5EE0 A;  1JWS D;  4OHJ A;  1UUP A;  1ZDV A;  1JML A;  2DBY A;  3SFE B;  1YQ4 B;  2I38 A;  2QIE B;  2WXM A;  1ET9 A;  4A9A A;  5HG2 A;  1I4R A;  1KH0 A;  2J42 A;  2ZW0 A;  2WXN A;  4US9 A;  3TEZ A;  3VR8 B;  1VLB A;  3AB5 A;  2HDE A;  3URY A;  1JCK B;  4J3O D;  2V0G A;  1C4A A;  1EU3 A;  2ICI A;  1TKE A;  5GXG B;  1D4B A;  4USA A;  5EE9 A;  5C2T B;  3FIL B;  5AUK A;  4YTM B;  3BWU D;  1YN4 A;  2G9H D;  1FIQ A;  1K53 A;  4OW0 A;  4C7Z A;  2WQY B;  1D5X C;  2EKI A;  1V8C A;  4TQ1 A;  5FK9 C;  1GB1 A;  2INP E;  4HJG E;  4FXC A;  5BYQ A;  4XWT A;  1D6E C;  1GB4 A;  2WXJ A;  2L1A A;  2KQ4 X;  1LO5 D;  2W3R A;  4GDK B;  1NYQ A;  1WYG A;  1SE3 A;  1WGK A;  4H2A A;  1TS3 A;  1N60 A;  3CIR B;  4HRS A;  1MHX A;  1SE2 A;  3IAS 1;  1ZOY B;  4RGO S;  4WQM A;  1YN5 A;  1K51 A;  1FD6 A;  4RGT A;  1XLQ A;  3GB1 A;  1CJE A;  1XEE A;  3P4S B;  3E56 A;  3EUB 2;  4P16 A;  3W2D A;  4HRO A;  1N61 A;  3P4R B;  3C8Y A;  2BS4 B;  2DYM A;  1DOI A;  1MPE A;  1K50 A;  3NVY A;  1PDX A;  1KFY B;  4ITK A;  2I2Y A;  4R3D A;  1T5X D;  3HRD D;  3MC0 B;  2OHF A;  4PT5 A;  1AYF A;  1MVK A;  2RPV A;  3KWV A;  1JRO A;  1ZPS A;  2AQ3 B;  1FEH A;  3P63 A;  3W1S A;  2WXH A;  1IUE A;  2PLP A;  5D7G A;  3VRA B;  1SBB B;  1CQV A;  1XLN A;  2CU3 A;  5BMG A;  2FBW B;  1ZE3 D;  1ROE A;  1D5Z C;  3IXS A;  3T3O A;  2LFI A;  3RFZ B;  1TS4 A;  3FAH A;  4OZB A;  2NMQ A;  3LXF A;  1ESF A;  1FO4 A;  4ZOH C;  3B9J A;  2Y5C A;  4RGN A;  4MH8 A;  4JX1 C;  1GPX A;  3T3N A;  2B76 B;  4Q2J A;  5BMH A;  1AW7 A;  1JWU D;  4LLG M;  3TUO A;  3Q8E A;  1ENF A;  2QEJ C;  2QIL A;  4ARI A;  1DOY A;  1I7H A;  1WSP A;  4TQ0 A;  4L1B A;  2LEK A;  3N9Y C;  1KLG D;  1EWC A;  4YSX B;  2V4I B;  1C9F A;  3BVG A;  5D3D A;  2WXG A;  2JYT A;  1L0X B;  2K5P A;  1ACC A;  3SEB A;  3AEA B;  3Q8A A;  3AE8 B;  3IT4 B;  1C4P A;  1FNV A;  1PYW D;  4L2Y A;  1SE4 A;  2PIA A;  1BML C;  1N5X A;  2YEP F;  4ZRP A;  3AE6 B;  3HUI A;  1DOX A;  4YT0 B;  4B0E A;  2E3T A;  3PZ8 A;  4KGT A;  2JWU A;  1ZDX A;  2QMT A;  1QQR A;  2Y3A A;  1TS5 A;  3AN1 A;  2KDM A;  1YMH E;  2W54 A;  4ARC A;  2WXL A;  2BB5 A;  2JXT A;  3R2T A;  1V97 A;  4N58 A;  5FR3 A;  5C3J B;  3B2G A;  3BZD B;  1TY0 A;  3ZJU A;  1HEZ E;  1EM7 A;  2X38 A;  2W55 A;  1XCQ L;  4US8 A;  2VZK D;  1IBX A;  3LYY A;  3TEW A;  1ZUD 2;  3U2S C;  3W5U B;  2IPK D;  3BVM A;  3O13 A;  2PTL A;  3P42 A;  5H92 C;  1BXT A;  4ZHO A;  5HHD G;  1VZ6 A;  1XLP A;  2JU6 X;  2L32 A;  2LGI A;  1RM6 C;  2WXF A;  2IDY A;  2K9X A;  4JWU C;  3SFD B;  4ZRQ A;  3AEG B;  2QSD A;  4YSZ B;  3TEX A;  4D2K A;  2N9L A;  2LJI A;  3U4E G;  4DQO C;  4XDC A;  3IT6 B;  1HZ6 A;  2JX5 A;  3VR9 B;  3TEY A;  1KLU D;  1YJI A;  2R61 A;  3BVZ A;  3W9C B;  3ZGZ A;  1TY2 A;  3AE2 B;  1K52 A;  2WDR B;  1L6V A;  4NZL B;  1QOA A;  4EE2 A;  1UNS A;  4OVZ A;  1F2R C;  2MEK A;  2BS3 B;  3HVD A;  1JWA D;  1PGB A;  1F2R I;  4KX6 B;  3Q8F A;  2DWQ A;  2BYT A;  1UWX A;  2MJE A;  3E9S A;  3BK2 A;  1FFU A;  1JW9 D;  1PGX A;  1D5M C;  3I57 A;  1JWM D;  3AE5 B;  2LHE A;  1QLB B;  1FXI A;  1V1P A;  1I4X A;  2EEL A;  5TSS A;  3DWM A;  4M0W A;  1B9R A;  2ZW1 A;  1IGD A;  2V3N A;  1OQQ A;  2MJ3 A;  2Y5P A;  2WXR A;  3B2F A;  3ZJT A;  1YQ3 B;  3FC4 A;  4KKI A;  1HA5 A;  2CJN A;  2M56 B;  4C56 C;  4KGR A;  5HFY A;  1QOF A;  1I4Q A;  3LB8 C;  1RWS A;  1T3Q A;  1XXG A;  1Y56 A;  3KLS X;  3AE3 B;  1SIJ A;  1I4H A;  1QIL A;  4MAC A;  4WUR A;  3ZYY X;  2K22 A;  1PFD A;  1F77 A;  2BTE A;  3AE4 B;  1E0Z A;  2J4X A;  1L4Z B;  2GRI A;  4LK0 M;  3ABV B;  1JWB D;  2IGG A;  3AM9 A;  1VRA B;  2KAJ A;  2CJO A;  3AEB B;  1AWD A;  1C76 A;  1T6B X;  2N0S B;  4NAM A;  1MI0 A;  2WXI A;  2WXO A;  1STE A;  2MH7 A;  2YEP B;  3AE9 B;  2ONQ A;  3AMZ A;  1RYJ A;  3AE7 B;  2DYO A;  1GOZ A;  3OWE B;  4RH6 A;  1NEK B;  1L0Y B;  2JSV X;  4KKJ A;  4AS1 A;  5LNK 1;  2XN9 C;  4P6V F;  1TKG A;  1UGJ A;  2N7J A;  4JPS A;  1HQR D;  1FRD A;  3KWL A;  3P1M A;  1FNW A;  4L23 A;  1QOB A;  2IJ0 A;  1JQ4 A;  4C7Y A;  2OED A;  3Q8C A;  4JE3 B;  2WU5 B;  1L5P A;  3AE1 B;  1GAQ B;  3AH7 A;  4ZYS A;  3V3X A;  3L4P A;  3NS1 A;  1M4V A;  1QKZ A;  1VDV A;  3P4Q B;  2K0P A;  2IGD A;  4TSS A;  3W5V B;  1F0Z A;  4REZ A;  2WXQ A;  2PVG C;  3I9V 1;  4WH4 A;  5D3I B;  3U7Z A;  1WRI A;  2H88 B;  1N63 A;  5BYS A;  2GB1 A;  2RDH A;  2WXK A;  1TS2 A;  2MJD A;  4RF1 A;  4HKQ A;  1SF0 A;  4N59 A;  1P7E A;  3BYT B;  1NVI D;  2N9K A;  3ZJV A;  3AEF B;  1AN8 A;  1SJH D;  1R7S A;  1E9M A;  3SR6 A;  2QJL A;  3GS2 A;  4A8X C;  2BB6 A;  4A6Q A;  2W82 A;  3AV8 A;  2WS3 B;  2SEB D;  3FIL A;  1J7B A;  2SAK A;  4C80 A;  2LMC A;  4IOI E;  2V3P A;  1FRR A;  4GDL B;  2M19 A;  4NAW B;  1EWY C;  1EU4 A;  1KF6 B;  4IDI A;  3J9C A;  4XDD A;  1YN3 A;  5I4D A;  4RNA A;  2ACZ B;  3WCQ A;  2WDV B;  2BT6 A;  4YSY B;  1KTK A;  3EA6 A;  3AEE B;  2VZK B;  1VR9 A;  3TSS A;  4DXG A;  1FMA D;  1C4C A;  1C79 A;  1CK1 A;  2AQ2 B;  1SXT A;  2XNA C;  5G5H A;  1PGA A;  1BUI C;  1OFF A;  4CQN A;  4B0M A;  4RFB A;  3R8B A;  4RGM A;  2D5G A;  3R2I A;  3MP9 A;  4WWM A;  2AX5 A;  5BYR A;  2Q5W D;  2AQ1 B;  3ZQ4 A;  3NVV A;  4MT5 A;  3GP7 A;  2HTM E;  3AEC B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...