4HKZE

Trastuzumab fab complexed with protein l and protein a fragments
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
63
structure length
63
Chain Sequence
SEVTIKVNLIFADGKIQTAEFKGTFEEATAEAYRYAALLAKVNGEYTADLEDGGNHMNIKFAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Trastuzumab light chain
publication title Identification and grafting of a unique peptide-binding site in the Fab framework of monoclonal antibodies.
pubmed doi rcsb
source organism Homo sapiens
total genus 18
structure length 63
sequence length 63
ec nomenclature
pdb deposition date 2012-10-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4hkzE00
2GI9A 4D2KA 1IBXA 2I2YA 1KH0A 2K0PA 4OZBA 2KQ4X 2JU6X 1C9FA 3FILB 1K51A 2ON8A 4GLSC 2RPVA 2PLPA 3FILA 1ZXHA 2QMTA 4KGSA 2KWDA 2KDMA 2JXTA 2LHDA 5HI1A 2IGHA 4IKGA 2IGGA 1PGBA 1HZ6A 1K53A 1UWXA 1XCQL 2JZPA 2PW9A 5HHDG 2I38A 2EELA 2N9LA 4KGRA 1GB1A 1PGXA 2ZW1A 2KN4A 1XCTL 1K52A 2N9KA 4WH4A 5BMIA 4HKZE 1EM7A 2IGDA 2PTLA 1PGAA 3UI3A 3V3XA 4KGTA 1P7EA 2JSVX 4OZCA 1MI0A 1HZ5A 1XF5L 5HFYA 1D4BA 3GB1A 2ZW0A 1P7FA 1HEZE 1MHHE 1FCCC 5BMHA 5BMGA 1F2RI 2LGIA 5HG2A 1Q10A 1GB4A 1MVKA 1K50A 2GB1A 2LHEA 1IGDA 5JXVA 2LUMA 1MHXA 2JWUA 4IOIE 1FCLA 2KACA 4OZAA 1JMLA 1F2RC 1MPEA 2J53A 1QKZA 2QSDA 1IBXB 1YMHE 1FD6A 2NMQA 2OEDA 1IGCA 1YNTE 2J52A 4HJGE 3MP9A 2ONQA 2RMMA 4MACA 2N7JA
chains in the Genus database with same CATH superfamily
3A33B 3DHIC 3UF8A 1D3ZA 1EUVB 2IY1B 2JXXA 2DAFA 2LI5A 2E6XA 2KX0A 3NUHB 2KJ6A 2QJLA 1WI0A 2ON8A 1IP9A 2LRUA 3HVZA 3B0AA 4XX5A 3UQBA 2KYWA 4PS8A 5D7GA 1N62A 2GBRA 2J0MA 2MWSB 1AARA 2JZ3B 1F77A 4FJVB 4HPMB 3ZLZA 3AE3B 1I4QA 1N5WA 2KMAA 1OFFA 1ZGUB 3QARA 2I1JA 1ZKHA 2PE9A 2Z8LA 1LXDA 2BF8B 4OHJA 4WJNA 1I4GA 1ZOYB 1V5OA 2CR5A 2N9EB 1UF0A 1XO3A 4GMVA 3CSFA 4ACFA 2WX0A 2INDC 3AU5A 1EF1A 4B0EA 2R2QA 3V60A 1SBBB 4BBNF 2WXFA 3C19A 1P7EA 3ETRA 4NAMA 2L3ZA 1WY8A 4CHKA 3DVNU 2GRIA 3T8MA 3AE7B 4IG7B 2PE6B 2DYOA 4L2YA 3V6EB 3VR8B 3VTWA 1OGWA 1WE7A 2LVQA 2KJHB 3ONSA 3GE8C 2LJ5A 4M02A 4MSQB 1SSNA 4NQLB 4W9EA 5CHVC 3WAOA 1J7AA 2W9NA 3L17A 1WXSA 4MM3B 1RAXA 1KFYB 5EE0A 1FFUA 2EMSA 3H8HA 1VD2A 2V3SA 2FIFA 3ENEA 4Q2JA 4D2KA 3RULA 1WWTA 5AZHA 2K0PA 4L1BA 2KANA 1C9FA 2Z59B 4A8XC 2MCNB 4HK2A 1L4ZB 1NYRA 3H7PA 2XNAC 1E8XA 3AEAB 2KLCA 2L76A 1WZ3A 2WGSA 1V1PA 2LVPA 2NPTA 1I4XA 3TJPA 3L16A 4KVGB 4NZLB 4RFBA 1JWAD 4GXBA 2L83A 2D2QA 1L0YB 2LGYA 4C56C 3HVDA 4LLGM 3ZDMC 1TIFA 2WWZA 4YXDB 3A4RA 4GB9A 4E74A 4BAXA 2FCQA 2ZNVC 1QQRA 2FAZA 1WXQA 2BS2B 3ZTDA 3U7ZA 1OQYA 4R3DA 2KWCA 1L0VB 4ANWA 4N58A 3NZUA 4W9FA 2J7QB 1F1HA 3UINB 1KOTA 2KKCA 3BVZA 2KFJA 2HD5B 3WAPA 5T8IA 2EMTA 3AMZA 3PTFC 1Q10A 1E7PB 2WXNA 4A3PA 1VR9A 3U2SC 5IP4D 1H8CA 2NCNA 4JX1C 3CMMB 2A5UA 3M3JA 2XBBC 4K7SA 1L2NA 3Q3MC 2KFKA 3SD5A 5H92C 5G55A 3WANA 4NQKE 2WXPA 1HA5A 1C79A 4BBNC 3TEWA 4IWPA 2NS5A 3ML8A 1JRUA 2N1WA 1WXMA 3P4SB 1H4RA 4LJPB 3Q8BA 1XXGA 3ML9A 2N9XA 5DPWA 2CKHB 2MBHA 3VTVA 1ZXHA 2WLBA 3ZNHB 1YQ4B 3Q14C 3H7PB 2DNFA 1TS2A 3APDA 5HI1A 3VRAB 2IGGA 3IAM1 1HZ6A 1JW9D 3PHXB 3RNAC 1ISNA 2ZCCA 2BYFA 2JT4B 1I4RA 3U52E 2KTRB 2NPTB 1FPYA 3EHVA 4GN1A 3RNGC 2Q5WD 4QAYA 1ZDVA 2LWPA 3A9KA 2JRHA 3KYCD 3EUB2 4ZHPA 1Z2MA 2AL6A 3PRMB 1C4AA 1WJNA 3I5JC 2M0XA 2G1EA 2BB6A 1R4NI 2CHXA 1TGZB 5DPSA 3M63B 2MJ3A 4TV3A 4JWUC 1E8ZA 2XEWA 1P98A 3AU4A 4K7UA 1VJKA 1YJ1A 1FXIA 1TJEA 2JUOA 4ZRKA 4NJ7A 3VFKA 1TZOA 2CS4A 3NHEB 3S2AA 1YMHE 3FC4A 2OOBB 3DCGA 1R7SA 1WM2A 2WDQB 1C76A 1IBXA 1WR6E 3WALA 3ZDTA 1KH0A 3E56A 4W9IA 2KFKB 1WX8A 2J42A 1ENFA 3M62B 2ACZB 3GZNI 4GLSC 3OG5A 1UELA 2B76B 2ZVOA 3ZNZB 2BB5A 1FIQA 4G0NB 3W2DA 4H2AA 3VXWA 2MEKA 4EZLA 1J8CA 1XEEA 3NVYA 3QA8A 4G3XB 3BVMA 4ZRJA 2LMCA 5JHAA 2UU7A 1NI2A 1FEHA 3DWGC 5KHOA 2WXHA 4YTMB 1YQ3B 3N9YC 5BMIA 3P63A 2VH2A 1TT5B 4P7IA 1YX5B 1L0XB 4EEWA 2LEKA 2K6QA 4MGIE 2MH7A 2CU3A 4HCPB 4EOYA 3A9KB 4F1SA 3A9JA 2FNJB 2Y5PA 2V4LA 1D4BA 1UNSA 2L1AA 2L05A 1MJDA 4IWQA 3ZJVA 1E90A 1RYJA 4K81A 1KLVA 2UWQA 1N6ZA 3PLUA 1QT9A 2ASQA 2X38A 4JWSC 3Q8EA 3B2FA 4PS3A 2V9HA 1F2RC 1J19A 3A4SC 1P9DU 1KRHA 3EFCA 2CHZA 5AZFA 2D3GA 4ARIA 1E6EB 5LXHA 1WM3A 1B1ZA 4MDKE 1T3QA 4S0RA 3ECIA 4KX6B 1XLNA 2KQ4X 4K7WA 4MELA 3QC8B 1EO6A 4YWGG 3Q6BA 4DHJB 2O2VA 1LFDA 3PV1A 4PS7A 1XLQA 3LYYA 1YJIA 1BT0A 1PQSA 1HE8A 5L95C 3QCAA 4G11A 4LNIA 4XDDA 4FHKA 3ZRFA 4FLHA 3QQ8B 1GUAB 1XCQL 3N30A 3ALBA 4ANUA 2IPKD 3LJ3A 1EU4A 1OEYA 2PW9A 2E3TA 3DVNV 1CMXB 1XCTL 2N9KA 2HTHA 3W1SC 3PSEB 2C9WB 3QHTA 2K3UA 1NENB 1TBEA 4AOFA 4A3OA 2CHWA 2JVCA 1EWYC 1T0YA 1PGAA 3UI3A 2ZZPB 5TSSA 4KZCA 3TSSA 1HZ5A 1WJUA 3IHPC 2IO2B 2V4IB 1SXTA 3R66C 3WA0A 2IDYA 4DHJD 3QIJA 2LGIA 5CHFA 4MGYE 3A9JB 1P1AA 5BYSA 2HE7A 4TMAB 5J17A 2W55A 4OZAA 1JMLA 2XK5A 1LM8B 1QKZA 3KLSX 2RD0A 4ZYNA 1NEKB 1I42A 1R4NB 1QILA 2PVOD 3ZNID 1YNTE 1KM7A 4WWOA 3KQ4A 4IDIA 2LFIA 3L54A 1UWMA 3VH4B 4A20A 3OWEB 5E6NA 3FILB 5C3JB 3R3MA 2IO3B 5D6JB 4A55A 2PLPA 1SB3C 3RNCC 3PZDA 1UBIA 2KVRA 5DPTA 2O2VB 3VAWA 4PT5A 1GC6A 5EE3A 3D32A 1J0GA 1K53A 2SAKA 3MJWA 2LXAA 3MHZA 1RM6C 4X57B 5C23A 4BOSC 1G6JA 3T9LA 1RRBA 3GZNB 2R2OA 1UD7A 1A5RA 1GC7A 3KW5B 1HTOA 4F8CB 1RFKA 2NBVB 4HWIB 4P6VF 4MH8A 3AM9A 2LGXA 2IO0B 1JCKB 2DLBA 3ZUNA 2AX5A 1IYFA 2MP2A 4YSXB 3GOEA 1L6UA 2JRIB 4RF0A 1XF5L 5HFYA 1XT9B 4KSKC 2KK8A 2D3BA 4KV2A 3MC9A 4YSYB 4FBJB 5GMVA 2INCC 2EKEC 3PPAA 2N1VA 1ACCA 3X0WA 2BTEA 3VTUA 1JWMD 4RGOS 4HPLB 4C80A 5G5GA 2B3AA 4XYCA 3V6CB 1T5XD 1Q1OA 3PLVA 3ZGZA 1ZUD2 2C7MB 1NYQA 2XK5B 5CHWA 2N4FA 4NJCA 2MHJA 4LTUA 2ZPYA 5D3IB 1T6BX 3APFA 1LO5D 1WH3A 4B6WA 4ANXA 3HM6X 3VUWA 1YOVB 2N7EA 3OJ4B 4WWMA 4C7ZA 3VR9B 4I6PA 2BW2A 2LD9A 1E7UA 1AW7A 2M0AA 2REXA 3RNFC 4XZ4A 1E8YA 2FBWB 2QMTA 1XQQA 4KGSA 3L08A 1V8CA 1OEYJ 2IGHA 2KXJA 3JVZX 1WYWB 2J0KA 3N20C 4MT5A 3AECB 5D3DA 2KWVB 5EE9A 3VDZA 1D5ZC 1QOBA 4WH4A 3DHGC 1I4HA 4C7YA 1FNUA 1NDDA 4RGTA 1VRAB 4N6EB 2KTRA 5L83A 4GGQA 3DBLI 2IGDA 1I35A 1E9MA 4HEA1 2L0FA 5AUIA 2OHFA 3CIRB 4TSSA 4BKTA 4RM8A 1I7HA 4GOCA 4WJOA 2MP2B 2QIEB 1NI3A 1L4DB 1YD8U 2KTFA 1S3SG 2JZZA 2LUMA 2DWQA 1VZ8A 2V1YA 1FCLA 2KACA 3AI5A 2AQ2B 3TCAA 3ZXVA 4BKSA 2NBWB 4HXDA 2OEDA 2W82A 1YN3A 4HPPA 3W9CB 1QZEA 2KDIA 2K5PA 2K6DB 2M4NA 2K1FA 1K8RB 2QDFA 3TEXA 3DOWA 2VRRB 5DPRA 1TS3A 4M8NA 5FR3A 2WS3B 2DHZA 3AH7A 3NZ3A 1FO4A 2M17A 3V62A 4WWNA 1N61A 1WE6A 4AP4C 1L5PA 2KDMA 2K39A 2PMVA 1WMHA 2GOWA 2D5GA 2BT6A 2JZPA 2PKOA 1P0RA 4MH0E 4B0MA 4IW0A 1WX9A 2QHOA 3P4QB 4M00A 2N9LA 2QC8A 3OAWA 5C1ZA 4A90A 1TZ1A 3R7QA 1C3TA 3WIMA 1TY2A 2MJDA 1ZW7A 1Y8RC 3BK2A 1PUTA 3VQIA 3H7SA 1GOZA 3T3NA 1QOGA 3EGRA 3DQVA 3Q69A 1EWCA 4HROA 4KDLB 4NY0A 1WGGA 3DVGY 2V3PA 3Q2AC 2ZEQA 1FNVA 1FXAA 2BGFA 4RF1A 3I63C 3NS1A 1U4AA 4EE2A 1WRIA 3O65B 4JIOU 5JHBA 2KQ7A 4NJ6A 2RDHA 1TS5A 4B95A 4MEMA 4K3BA 2KO3A 2K8HA 2DZJA 3APCA 2M1MA 1WX7A 3H6NA 3TEYA 3MTNB 5KHQA 2WXOA 2Y3AA 3AE1B 2GI9A 3HRDD 4C00A 5LXIB 3ZJUA 4I6LB 3KUDB 4BFRA 2DBYA 3IBEA 4GDLA 4II2B 3LB8C 4EFOA 5TR5A 2DYMA 1VZ6A 4JQWC 4GSWA 2D07B 1CQVA 1HXYD 2AYOB 4W9GA 4DQOC 3NS8A 3SU8X 2V0GA 1FRDA 5IN7A 3AV8A 3PZ7A 3BINA 2MBBB 1WYGA 3V05A 1BUIC 1KLUD 1CZPA 2GMIC 2WXMA 1IPGA 2LXCA 1Q5WB 2MBQA 4P16A 2MBEA 2O6VA 1WMHB 3UQAA 4KSLC 1K52A 3M95A 3I9V1 3CSTA 1C4CA 3JSVA 2KC1A 5BYRA 2QILA 3V61A 4BKSD 2N9PC 3V3XA 3ZIMA 2WU2B 1C4PA 2WXQA 1IUEA 1N63A 4ZRPA 4BKGA 1KJTA 4RGMA 5IA7A 2L0TA 3ZXRA 1TTNA 2R61A 1AWDA 1FCCC 2N7DA 3AB5A 1F0ZA 3PT2B 4G50A 3ZW3A 1IGDA 2PVGC 3E9SA 4US8A 2RGFA 3DBLB 1E7VA 3N1ZC 1GG3A 4LCDE 2RDBC 3Q3FA 2DAJA 1ESFA 3MC8A 2J52A 3BK1A 1FNWA 1OTRB 1WJ6A 4S17A 2ZJDA 2RMMA 4LJOB 3R7RA 3AE2B 2UYZB 1SF0A 3K9PB 3SEBA 3QAQA 2G9HD 4NPNA 3IFWB 1HQRD 2AQ3B 3MHSD 1SIFA 1QOAA 4OZBA 4GU2A 1FXTB 2DYBA 5BYQA 3EECA 1T0RC 3FILA 3L13A 2YLMA 4HDOA 3UGBB 3PGEA 3Q8CA 2KWDA 4GDLB 3IAS1 1KF6B 4F7ZA 1GPXA 1WZ0A 1JWSD 1YJJA 3KWLA 1DOIA 3AE9B 2BS4B 2I38A 4KKJA 5HHDG 3UIOB 3KH0A 4P1BC 1GB1A 1PGXA 2INNE 1XD3B 3PVLA 1WGRA 2W3SA 1JRPA 4UDUC 5CTRC 2KWUB 4WJQA 2C60A 2O6VB 4CQNA 1Y56A 3ZVVA 1UBQA 1DGJA 4US9A 3TMPB 4II3B 3BYYB 2XN9C 3DDCB 3JSVB 3CWIA 1V86A 1LGRA 1RLFA 2KQSA 5FK9C 4JPSA 3GS2A 4RGNA 5BMHA 4DK5A 2FCNA 2WXRA 4ANVA 3PREA 5HG2A 1MVKA 1ZP0B 2GB1A 3C0RB 3LXFA 2YVCA 2K8CA 1Q0WB 3MFGA 2L8JA 1V80A 4DHZB 1YN4A 2K25A 4J6IA 1WGKA 1L7YA 4RNAA 3I3TB 4ICUA 3GP7A 2L52A 2FUHB 1SE4A 4HJGE 1OQRA 3BY4B 3MP9A 2NVUI 2WDTB 1QOFA 2W54A 3AN1A 1STEA 4PYUA 2KMMA 2KX3A 2Y5CA 3QWZB 2MRPA 2VZKB 1E8WA 1V81A 3KWVA 5MPOA 4DDGD 1KTKA 3BVGA 3NVWA 4RCOA 2M8SA 3VVWB 2KHWB 2IYDB 1D5XC 2RPVA 2O6VD 2DZKA 5AEKB 2N0SB 2AQ1B 3KYDD 1N60A 3AXCA 3PO0A 4W9JA 4AJYB 3Q8FA 5AUKA 3Q3OC 2VH1A 3NRZA 3RNBC 4ICVA 4YSZB 1J7BA 4IM2A 2MJEA 3NVZA 2G4DB 2WXLA 4DXFA 1L6VA 1PFDA 1XLOA 3VUYA 2WHIA 1VCBA 2HJ8A 2HTME 2WXJA 2WNMA 4JGHB 2ZW1A 2KN4A 4ZRIA 2KLGA 3BWUD 5JZEB 1WFYA 4MGZE 3URYA 2D3AA 4WIPA 3O13A 4A6QA 2PTLA 5E6PA 2LRWA 2VZKD 1TY0A 4KGTA 3RZWC 3SDLC 3P42A 3AEGB 1P7FA 3Q8AA 1WJ4A 3Q3JA 3U30A 3PRZA 4IUMB 1WRDB 1B9RA 2WDVB 3IT4B 2WYQA 2GBMA 4EKUA 2LHEA 2KJRA 2LJIA 2JF5A 2PJHA 4B9KA 4HRSA 2JYEA 3ZNGC 3SHQA 3H9DA 4KKIA 3IXSA 3AE4B 5EDSA 2LUEA 1RFAA 2BPSA 3ZKJC 2PPHA 4DHZE 3X23A 1MFWA 1SE3A 3IG3A 4ARCA 2D11A 3DBSA 4XGAB 3QK0A 4WAAA 2KT7A 3TL5A 3L0WB 3TUOA 1AN8A 3DBRI 2FE8A 3OJ3A 3BYTB 4IWOA 3DWMA 3K9OB 3RD2A 3RMKC 3A1QB 4A9AA 3P1MA 1D6EC 2DZMA 2HJ1A 2JPHA 4IC7B 4XWWA 3Q3NC 2X8XX 3P2BA 1E0ZA 4AUQC 3LDZE 3W5UB 3VH3B 4ZYSA 1UZXB 1SE9A 2WXGA 1TYGB 4IKGA 2RDGA 1PGBA 4HLEA 2Z0EB 3IT6B 5C2TB 3KVFB 2Z0DB 3EC8A 3RCZA 2PEAA 3AEEB 1NVID 2OJRA 4LK0M 4MJSA 4KIKA 2QEJC 1R4MB 4XWTA 2AL3A 2NTTA 1LQBA 1SGHA 1SJED 3ZJTA 1VDVA 1ZDXA 2SEBD 2JX5A 4RMAA 4HJKA 3B2GA 5IKCM 4W9DA 4W9KA 4C4VB 1BXTA 4FJYA 1J7CA 5J18A 1FRRA 3TBLD 1ZXIA 5IOIA 2EKIA 1T0QC 1D5MC 4W9LA 2M19A 2BWFA 3B1LX 2QSDA 4EZJA 4CYEA 1GJZA 4O1NA 4XE0A 3AULA 4DWFA 2MW5A 4TKNA 4MACA 1QF6A 2GBNA 2N7JA 1YIWA 4FADA 2QCZA 3N1YC 2BVCA 3JYUA 1DYQA 1SJHD 3EA6A 4WQOB 3RI7C 1P3QU 2G4SA 3VHTC 2L7RA 1JWUD 2J4XA 1T0SC 4XC2A 3L4PA 3PHWB 2NBUA 4TUUA 2DX5B 3FAHA 2K9XA 3GE3C 2C5LC 2WXKA 2DENB 1Z5SB 4J3OD 1WGYA 4EUTA 1ET9A 1DOXA 4DXAB 3RT3B 1EU3A 3SFEB 4LNFA 4BZAA 2JYTA 2JY6A 5J2RA 4TQ1A 1E10A 1QLBB 1WXAA 4HKZE 2RPQA 1EM7A 4MJSB 1UUPA 1TKEA 1OQQA 4PYZA 1JALA 1HTQA 4KIKB 2BQQA 1XLPA 1E5WA 5LNK1 2IO1B 4ZRQA 1V97A 4OVVA 2KN5A 1SIJA 4HDQA 5AZGA 2BYEA 3ZO5B 5BMGA 1GB4A 3QJZA 2MLBA 3RNEC 5JXVA 3HIZA 4IOIE 1MHXA 4AS1A 2BYVE 2FCMA 4L23A 4GIVA 1PYWD 3NJTA 3U8ZA 3DVGX 2LGSA 2KMCA 2YEPB 1I4PA 3RN9C 3N32A 2KDBA 4NAWA 1FM0D 1F52A 5BO4B 4ZOHC 1FFVA 3SR6A 5CX3A 2ZCBA 1ROEA 1UH6A 3CF6E 3HK0A 1V1PB 3W1YA 4ASWC 2ICIA 3RYTA 2IJ0A 2BYTA 1VLBA 2NTSA 4KDIC 3R8BA 1ET6A 3DBHI 2FCSA 4NNJB 1V2YA 4ZDVA 4FJZA 2G45B 2JXTA 2LHDA 2M56B 3DBRB 1JWBD 1KLGD 1UWXA 5I4DA 3VUXA 4W9CA 1GAQB 3PZ8A 3ZQ4A 1WGDA 3U4EG 2EELA 4HCNB 3HM3A 3WCQA 5H8YE 2MQJA 3NZSA 3R2TA 4LNKA 4DBGA 3L10B 4M0WA 3NY5A 1SE2A 2LZ6A 4HKQA 4LDTB 2AEHA 3C8YA 3ABVB 4IM3A 1YX6B 4W9HA 4OW0A 2CJOA 3BZDB 4LNNA 2ZNVB 2BBCA 2A4ZA 2HDEA 4LNOA 4WWPA 1CJEA 1WGHA 1F2RI 2K22A 4K3CA 2WX1A 1MG8A 1VZ7A 4JL9A 1V1OA 4YTNB 4GDKA 2KOXA 2JWUA 3PRPB 4N9F4 3P4PB 3U7DA 1MPEA 2J53A 2LGDA 4FULA 2H88B 4K1RB 4MGKE 5G2NA 3WAMA 1ZE3D 2DZIA 3TIXA 3HHMA 1M4VA 1A70A 1IGCA 1V6EA 2H89B 4YL8A 2ONQA 2PIAA 4XDCA 4MSMB 5DCNA 5LLIA 3AE8B 4JLCA 3ZRCA 5HKHA 3N3KB 4FHJA 4WAFA 2JU6X 3J9CA 2J0JA 4NAWB 2CJNA 1CK1A 3P4RB 2MSED 3N1XC 2C7HA 3B9JA 3RFZB 4LDTD 5D94A 2KDFB 3AEFB 5EE1A 1MG4A 2BKRB 4REZA 3QX1A 5IAAC 3ZYYX 5E6OA 2IZVB 3DPDA 3JW0X 4DDID 4KZ0A 2KAJA 2GLSA 3RPFC 4E71A 3NG0A 4PK1A 2C7NB 3NOBA 1TKYA 2MX2A 3DHHC 4EZKA 4FA6A 2IY0B 1ZPSA 2L00B 4WJPA 4CO7A 1WF9A 4FXCA 1R4MI 1C78A 4OVZA 3BIID 3T3OA 4IM0A 2WQYB 2L32A 2BWES 2NR2A 2G3QB 1MI0A 3KUCB 3I57A 1JROA 4M8MA 3GB1A 2ZW0A 5JH5C 1YQBA 3AEBB 1N5XA 4M0WB 1BMLC 2K8BA 2KVZA 4USAA 1K50A 2INPE 1UGJA 1PDXA 1GNUA 4N59A 1V49A 3AE6B 4I6NB 2IBIB 4WURA 2KNBA 1IBXB 2KD0A 2FIDA 2NMQA 4BVUC 3PS6A 4GDKB 1C77A 2OJWA 4M01A 3ZTCA 3H1UA 3VRBB 4OVUA 3KUZA 1FMAD 2I2YA 2LVOA 4AQ7A 1UGMA 2TSSA 1DOYA 3IVFA 1K51A 2ZPNA 3MJ5A 1SEBD 2JWZA 2WDRB 2BS3B 2JQRB 3OLMD 4P1CC 3W5VB 1WIAA 3A1QA 2MBOA 1S1QB 2LASA 1C1YB 1WR1A 3SFDB 2RR9A 2MA9B 2YEPF 4RM9A 2GBKA 3FKYA 2V3NA 1YN5A 2WP9B 4HVBA 4ZHOA 4JE3B 1WXVA 1JQ4A 3EFUA 4DXGA 5FR6A 1M94A 3AEDB 2WU5B 4KGRA 1WSPA 3R2IA 3B08A 3HUIA 4YTPB 3W1SA 3DBHB 2KC2A 5IO9A 1X1MA 1V9JA 1RWSA 4TQ0A 1AYFA 2GBJA 2I1KA 3UIPB 2JSVX 4OZCA 2Y5BB 2KDEB 4WQMA 3RZFA 1NBFC 2D10A 4YT0B 1F9JA 2D3CA 1HEZE 2W3RA 3TEZA 3RUIB 1MHHE 2ZVNA 3AE5B 4BOZB 3NVVA 2AWTA 2CU1A 4MM3A 5G5HA 2WXIA 4RH6A 5E6JA 1V5TA 4AWJA 5GXGB 4C4VA 4E3CA 5D2MB 1FD6A 1EF5A 4ITKA 4FN2A 2BKFA 2FUG1 1TKGA 2KZRA 3MC0B 4AJWA 2RSUA 1TS4A 4URKA 5FKAC
chains in the Genus database with same CATH topology
2GI9A 3HRDD 1T3QA 4KX6B 3ZJUA 1DYQA 2E6XA 1XLNA 3NUHB 1SJHD 3EA6A 2KQ4X 2QJLA 2DBYA 2ON8A 1JWUD 4YWGG 3LB8C 3HVZA 2J4XA 2DYMA 1VZ6A 3L4PA 1XLQA 3LYYA 5D7GA 1YJIA 1N62A 1CQVA 1HXYD 3FAHA 2K9XA 1F77A 4DQOC 2WXKA 3AE3B 1I4QA 4XDDA 1N5WA 4J3OD 1XCQL 2V0GA 1FRDA 1OFFA 2IPKD 1ET9A 3AV8A 3PZ7A 1DOXA 1EU4A 2PW9A 1WYGA 1EU3A 2E3TA 3SFEB 3V05A 1BUIC 1KLUD 1CZPA 2Z8LA 2WXMA 2JYTA 4OHJA 1I4GA 1ZOYB 4P16A 1XCTL 1K52A 4TQ1A 1XO3A 2N9KA 1E10A 1QLBB 3I9V1 1C4CA 4HKZE 2K3UA 1NENB 5BYRA 4B0EA 2QILA 1EM7A 1EWYC 1SBBB 1UUPA 1PGAA 3UI3A 3V3XA 1TKEA 5TSSA 2WXFA 1OQQA 1P7EA 2WU2B 1C4PA 2WXQA 3ETRA 1IUEA 1JALA 1N63A 3TSSA 1HZ5A 4NAMA 4ZRPA 1XLPA 5LNK1 4RGMA 4ZRQA 1V97A 2GRIA 1SXTA 2V4IB 1SIJA 2R61A 3AE7B 1AWDA 2IDYA 1FCCC 2DYOA 5BMGA 4L2YA 2LGIA 3AB5A 3VR8B 1F0ZA 1GB4A 1IGDA 5BYSA 4TMAB 2PVGC 3E9SA 5JXVA 4IOIE 1MHXA 4US8A 4AS1A 2W55A 4OZAA 4L23A 1JMLA 1PYWD 2N7JA 1QKZA 3KLSX 1SSNA 1NEKB 1QILA 2PVOD 1ESFA 1J7AA 1YNTE 2J52A 2YEPB 1FNWA 3BK1A 4MM3B 1I4PA 1KFYB 5EE0A 1FFUA 3H8HA 3KQ4A 2RMMA 2LFIA 4IDIA 3AE2B 1FM0D 1SF0A 3SEBA 4Q2JA 4D2KA 2G9HD 1UWMA 1WWTA 4ZOHC 1FFVA 3SR6A 2K0PA 1ROEA 4L1BA 1HQRD 2AQ3B 1QOAA 4OZBA 1C9FA 3OWEB 3FILB 4A8XC 5C3JB 1L4ZB 1NYRA 1V1PB 5BYQA 2ICIA 2XNAC 4A55A 2IJ0A 2BYTA 2PLPA 3AEAB 1SB3C 1VLBA 2NTSA 3R8BA 1ET6A 3FILA 1V1PA 3Q8CA 2KWDA 4GDLB 3IAS1 1I4XA 2JXTA 2LHDA 2M56B 4NZLB 4PT5A 1JWBD 5EE3A 1KF6B 1GPXA 1K53A 1KLGD 1UWXA 5I4DA 2SAKA 4RFBA 1JWSD 1YJJA 3MHZA 1GAQB 1JWAD 1DOIA 1RM6C 3AE9B 2BS4B 2I38A 3KWLA 3PZ8A 4KKJA 5HHDG 3U4EG 3ZQ4A 2EELA 2L83A 1L0YB 1GB1A 1PGXA 4C56C 3HVDA 4LLGM 2INNE 1RFKA 4YXDB 3WCQA 5H8YE 2W3SA 4P6VF 4MH8A 1JRPA 3AM9A 1QQRA 3R2TA 1WXQA 2BS2B 1JCKB 4UDUC 2DLBA 3U7ZA 2AX5A 4M0WA 4R3DA 1SE2A 1L0VB 4HKQA 4CQNA 1Y56A 3C8YA 4YSXB 4N58A 3ABVB 1DGJA 4US9A 1L6UA 3BYYB 4OW0A 2CJOA 2XN9C 4RF0A 1XF5L 5HFYA 3CWIA 3BZDB 3BVZA 5FK9C 2BBCA 3GS2A 4JPSA 4RGNA 2HDEA 4YSYB 5T8IA 5BMHA 1CJEA 1F2RI 2K22A 2WXRA 1VZ7A 3AMZA 5HG2A 1Q10A 1MVKA 1ZP0B 1E7PB 2GB1A 1V1OA 2WXNA 1ACCA 3LXFA 4YTNB 1VR9A 2JWUA 3U2SC 3MFGA 3P4PB 2BTEA 1JWMD 1YN4A 4RGOS 1MPEA 2J53A 1WGKA 2H88B 4RNAA 4JX1C 1ZE3D 4C80A 1M4VA 5G5GA 1A70A 1IGCA 3GP7A 2L52A 1SE4A 2H89B 4HJGE 1T5XD 1OQRA 3MP9A 2ONQA 5H92C 1QOFA 2PIAA 4XDCA 2W54A 3AN1A 1STEA 3ZGZA 1ZUD2 2KMMA 1NYQA 2Y5CA 3AE8B 2VZKB 4NJCA 2WXPA 4LTUA 5D3IB 1HA5A 1T6BX 1C79A 3KWVA 5MPOA 1LO5D 4WAFA 3TEWA 1KTKA 3BVGA 3NVWA 4RCOA 2JU6X 3J9CA 4NAWB 2CJNA 3P4SB 1CK1A 3P4RB 4WWMA 3B9JA 1D5XC 2RPVA 3VR9B 3Q8BA 4C7ZA 3RFZB 1XXGA 2BW2A 2N0SB 2AQ1B 1N60A 3PO0A 1AW7A 2M0AA 3AEFB 5EE1A 2FBWB 1ZXHA 2QMTA 2WLBA 3Q8FA 4KGSA 5AUKA 1YQ4B 3NRZA 4REZA 1V8CA 3ZYYX 4YSZB 1TS2A 1J7BA 2IGHA 2MJEA 5HI1A 3VRAB 2IGGA 3IAM1 3NVZA 1HZ6A 1JW9D 2KAJA 3RPFC 2WXLA 4DXFA 1L6VA 1PFDA 1XLOA 4MT5A 1TKYA 3AECB 1I4RA 5D3DA 3U52E 2HTME 2WXJA 2WNMA 2ZW1A 2KN4A 2Q5WD 5EE9A 1ZDVA 1D5ZC 1QOBA 4WH4A 1ZPSA 1I4HA 3BWUD 3EUB2 4ZHPA 4FXCA 4C7YA 1C78A 1FNUA 4OVZA 4RGTA 1VRAB 4N6EB 3BIID 3URYA 3T3OA 1C4AA 4WIPA 2IGDA 3O13A 4A6QA 2PTLA 1E9MA 2WQYB 2L32A 2VZKD 4HEA1 1TY0A 4KGTA 2G1EA 2BB6A 1MI0A 5AUIA 3I57A 2OHFA 3CIRB 1JROA 4TSSA 3P42A 3GB1A 2ZW0A 3AEGB 1I7HA 1P7FA 2MJ3A 3Q8AA 3AEBB 1N5XA 4JWUC 1BMLC 2QIEB 1NI3A 2WDVB 1L4DB 1VJKA 3IT4B 4USAA 1B9RA 1FXIA 1K50A 2LHEA 2INPE 1TJEA 2LJIA 1UGJA 1PDXA 2LUMA 2DWQA 4HRSA 1VZ8A 4N59A 1FCLA 2JYEA 2KACA 2AQ2B 4KKIA 3IXSA 3AE4B 3AE6B 1TZOA 4WURA 1IBXB 1YMHE 3FC4A 2NMQA 2OEDA 2W82A 1YN3A 3W9CB 4GDKB 1SE3A 1C77A 1R7SA 4ARCA 2K5PA 2WDQB 1C76A 3TUOA 1AN8A 3VRBB 1IBXA 3TEXA 1FMAD 2I2YA 1KH0A 2FE8A 3BYTB 3E56A 3DWMA 4AQ7A 4A9AA 2TSSA 3P1MA 1TS3A 1DOYA 5FR3A 2WS3B 1D6EC 2J42A 1K51A 3MJ5A 1SEBD 1ENFA 2WDRB 2ACZB 2BS3B 4GLSC 4XWWA 2JQRB 3AH7A 3NZ3A 2B76B 3W5VB 1E0ZA 1FO4A 2BB5A 1FIQA 3W2DA 1N61A 3SFDB 4H2AA 3W5UB 4ZYSA 2MEKA 1L5PA 2KDMA 2WXGA 1TYGB 2YEPF 2PMVA 1XEEA 4IKGA 2RDGA 1PGBA 3NVYA 2D5GA 2V3NA 2BT6A 3IT6B 5C2TB 1YN5A 2JZPA 2PKOA 2WP9B 4B0MA 4ZHOA 3BVMA 2LMCA 4JE3B 1JQ4A 3P4QB 4DXGA 3AEDB 2N9LA 2WU5B 1FEHA 1NVID 3AEEB 4KGRA 1WSPA 4LK0M 3R2IA 3DWGC 4A90A 3HUIA 4YTPB 2WXHA 4YTMB 1YQ3B 1TY2A 2MJDA 3N9YC 3W1SA 5BMIA 2QEJC 4XWTA 3BK2A 3P63A 2NTTA 1PUTA 3VQIA 1GOZA 1RWSA 4TQ0A 3T3NA 1L0XB 1AYFA 2LEKA 1SJED 2MH7A 2CU3A 3ZJTA 1QOGA 3EGRA 1VDVA 2JSVX 4OZCA 3Q69A 1ZDXA 1EWCA 2SEBD 2JX5A 2Y5PA 4HROA 4WQMA 1D4BA 2V3PA 4YT0B 3B2GA 1HEZE 1UNSA 2L1AA 2W3RA 3TEZA 1MHHE 1FNVA 3ZJVA 3AE5B 1FXAA 3AE1B 1RYJA 1BXTA 3NVVA 1J7CA 4RF1A 1FRRA 3NS1A 4EE2A 1WRIA 1ZXIA 2EKIA 5G5HA 1QT9A 2WXIA 1D5MC 2X38A 2M19A 4JWSC 4RH6A 3Q8EA 5E6JA 2RDHA 3B2FA 5GXGB 1F2RC 2QSDA 1TS5A 1FD6A 1KRHA 4ITKA 4O1NA 2FUG1 4XE0A 1TKGA 3TEYA 3MC0B 1TS4A 4MACA 1QF6A 2WXOA 4ARIA 1E6EB 2Y3AA 1B1ZA 5FKAC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GI9 A;  4D2K A;  1IBX A;  2I2Y A;  1KH0 A;  2K0P A;  4OZB A;  2KQ4 X;  2JU6 X;  1C9F A;  3FIL B;  1K51 A;  2ON8 A;  4GLS C;  2RPV A;  2PLP A;  3FIL A;  1ZXH A;  2QMT A;  4KGS A;  2KWD A;  2KDM A;  2JXT A;  2LHD A;  5HI1 A;  2IGH A;  4IKG A;  2IGG A;  1PGB A;  1HZ6 A;  1K53 A;  1UWX A;  1XCQ L;  2JZP A;  2PW9 A;  5HHD G;  2I38 A;  2EEL A;  2N9L A;  4KGR A;  1GB1 A;  1PGX A;  2ZW1 A;  2KN4 A;  1XCT L;  1K52 A;  2N9K A;  4WH4 A;  5BMI A;  4HKZ E;  1EM7 A;  2IGD A;  2PTL A;  1PGA A;  3UI3 A;  3V3X A;  4KGT A;  1P7E A;  2JSV X;  4OZC A;  1MI0 A;  1HZ5 A;  1XF5 L;  5HFY A;  1D4B A;  3GB1 A;  2ZW0 A;  1P7F A;  1HEZ E;  1MHH E;  1FCC C;  5BMH A;  5BMG A;  1F2R I;  2LGI A;  5HG2 A;  1Q10 A;  1GB4 A;  1MVK A;  1K50 A;  2GB1 A;  2LHE A;  1IGD A;  5JXV A;  2LUM A;  1MHX A;  2JWU A;  4IOI E;  1FCL A;  2KAC A;  4OZA A;  1JML A;  1F2R C;  1MPE A;  2J53 A;  1QKZ A;  2QSD A;  1IBX B;  1YMH E;  1FD6 A;  2NMQ A;  2OED A;  1IGC A;  1YNT E;  2J52 A;  4HJG E;  3MP9 A;  2ONQ A;  2RMM A;  4MAC A;  2N7J A; 
#chains in the Genus database with same CATH topology
 3A33 B;  3DHI C;  3UF8 A;  1D3Z A;  1EUV B;  2IY1 B;  2JXX A;  2DAF A;  2LI5 A;  2E6X A;  2KX0 A;  3NUH B;  2KJ6 A;  2QJL A;  1WI0 A;  2ON8 A;  1IP9 A;  2LRU A;  3HVZ A;  3B0A A;  4XX5 A;  3UQB A;  2KYW A;  4PS8 A;  5D7G A;  1N62 A;  2GBR A;  2J0M A;  2MWS B;  1AAR A;  2JZ3 B;  1F77 A;  4FJV B;  4HPM B;  3ZLZ A;  3AE3 B;  1I4Q A;  1N5W A;  2KMA A;  1OFF A;  1ZGU B;  3QAR A;  2I1J A;  1ZKH A;  2PE9 A;  2Z8L A;  1LXD A;  2BF8 B;  4OHJ A;  4WJN A;  1I4G A;  1ZOY B;  1V5O A;  2CR5 A;  2N9E B;  1UF0 A;  1XO3 A;  4GMV A;  3CSF A;  4ACF A;  2WX0 A;  2IND C;  3AU5 A;  1EF1 A;  4B0E A;  2R2Q A;  3V60 A;  1SBB B;  4BBN F;  2WXF A;  3C19 A;  1P7E A;  3ETR A;  4NAM A;  2L3Z A;  1WY8 A;  4CHK A;  3DVN U;  2GRI A;  3T8M A;  3AE7 B;  4IG7 B;  2PE6 B;  2DYO A;  4L2Y A;  3V6E B;  3VR8 B;  3VTW A;  1OGW A;  1WE7 A;  2LVQ A;  2KJH B;  3ONS A;  3GE8 C;  2LJ5 A;  4M02 A;  4MSQ B;  1SSN A;  4NQL B;  4W9E A;  5CHV C;  3WAO A;  1J7A A;  2W9N A;  3L17 A;  1WXS A;  4MM3 B;  1RAX A;  1KFY B;  5EE0 A;  1FFU A;  2EMS A;  3H8H A;  1VD2 A;  2V3S A;  2FIF A;  3ENE A;  4Q2J A;  4D2K A;  3RUL A;  1WWT A;  5AZH A;  2K0P A;  4L1B A;  2KAN A;  1C9F A;  2Z59 B;  4A8X C;  2MCN B;  4HK2 A;  1L4Z B;  1NYR A;  3H7P A;  2XNA C;  1E8X A;  3AEA B;  2KLC A;  2L76 A;  1WZ3 A;  2WGS A;  1V1P A;  2LVP A;  2NPT A;  1I4X A;  3TJP A;  3L16 A;  4KVG B;  4NZL B;  4RFB A;  1JWA D;  4GXB A;  2L83 A;  2D2Q A;  1L0Y B;  2LGY A;  4C56 C;  3HVD A;  4LLG M;  3ZDM C;  1TIF A;  2WWZ A;  4YXD B;  3A4R A;  4GB9 A;  4E74 A;  4BAX A;  2FCQ A;  2ZNV C;  1QQR A;  2FAZ A;  1WXQ A;  2BS2 B;  3ZTD A;  3U7Z A;  1OQY A;  4R3D A;  2KWC A;  1L0V B;  4ANW A;  4N58 A;  3NZU A;  4W9F A;  2J7Q B;  1F1H A;  3UIN B;  1KOT A;  2KKC A;  3BVZ A;  2KFJ A;  2HD5 B;  3WAP A;  5T8I A;  2EMT A;  3AMZ A;  3PTF C;  1Q10 A;  1E7P B;  2WXN A;  4A3P A;  1VR9 A;  3U2S C;  5IP4 D;  1H8C A;  2NCN A;  4JX1 C;  3CMM B;  2A5U A;  3M3J A;  2XBB C;  4K7S A;  1L2N A;  3Q3M C;  2KFK A;  3SD5 A;  5H92 C;  5G55 A;  3WAN A;  4NQK E;  2WXP A;  1HA5 A;  1C79 A;  4BBN C;  3TEW A;  4IWP A;  2NS5 A;  3ML8 A;  1JRU A;  2N1W A;  1WXM A;  3P4S B;  1H4R A;  4LJP B;  3Q8B A;  1XXG A;  3ML9 A;  2N9X A;  5DPW A;  2CKH B;  2MBH A;  3VTV A;  1ZXH A;  2WLB A;  3ZNH B;  1YQ4 B;  3Q14 C;  3H7P B;  2DNF A;  1TS2 A;  3APD A;  5HI1 A;  3VRA B;  2IGG A;  3IAM 1;  1HZ6 A;  1JW9 D;  3PHX B;  3RNA C;  1ISN A;  2ZCC A;  2BYF A;  2JT4 B;  1I4R A;  3U52 E;  2KTR B;  2NPT B;  1FPY A;  3EHV A;  4GN1 A;  3RNG C;  2Q5W D;  4QAY A;  1ZDV A;  2LWP A;  3A9K A;  2JRH A;  3KYC D;  3EUB 2;  4ZHP A;  1Z2M A;  2AL6 A;  3PRM B;  1C4A A;  1WJN A;  3I5J C;  2M0X A;  2G1E A;  2BB6 A;  1R4N I;  2CHX A;  1TGZ B;  5DPS A;  3M63 B;  2MJ3 A;  4TV3 A;  4JWU C;  1E8Z A;  2XEW A;  1P98 A;  3AU4 A;  4K7U A;  1VJK A;  1YJ1 A;  1FXI A;  1TJE A;  2JUO A;  4ZRK A;  4NJ7 A;  3VFK A;  1TZO A;  2CS4 A;  3NHE B;  3S2A A;  1YMH E;  3FC4 A;  2OOB B;  3DCG A;  1R7S A;  1WM2 A;  2WDQ B;  1C76 A;  1IBX A;  1WR6 E;  3WAL A;  3ZDT A;  1KH0 A;  3E56 A;  4W9I A;  2KFK B;  1WX8 A;  2J42 A;  1ENF A;  3M62 B;  2ACZ B;  3GZN I;  4GLS C;  3OG5 A;  1UEL A;  2B76 B;  2ZVO A;  3ZNZ B;  2BB5 A;  1FIQ A;  4G0N B;  3W2D A;  4H2A A;  3VXW A;  2MEK A;  4EZL A;  1J8C A;  1XEE A;  3NVY A;  3QA8 A;  4G3X B;  3BVM A;  4ZRJ A;  2LMC A;  5JHA A;  2UU7 A;  1NI2 A;  1FEH A;  3DWG C;  5KHO A;  2WXH A;  4YTM B;  1YQ3 B;  3N9Y C;  5BMI A;  3P63 A;  2VH2 A;  1TT5 B;  4P7I A;  1YX5 B;  1L0X B;  4EEW A;  2LEK A;  2K6Q A;  4MGI E;  2MH7 A;  2CU3 A;  4HCP B;  4EOY A;  3A9K B;  4F1S A;  3A9J A;  2FNJ B;  2Y5P A;  2V4L A;  1D4B A;  1UNS A;  2L1A A;  2L05 A;  1MJD A;  4IWQ A;  3ZJV A;  1E90 A;  1RYJ A;  4K81 A;  1KLV A;  2UWQ A;  1N6Z A;  3PLU A;  1QT9 A;  2ASQ A;  2X38 A;  4JWS C;  3Q8E A;  3B2F A;  4PS3 A;  2V9H A;  1F2R C;  1J19 A;  3A4S C;  1P9D U;  1KRH A;  3EFC A;  2CHZ A;  5AZF A;  2D3G A;  4ARI A;  1E6E B;  5LXH A;  1WM3 A;  1B1Z A;  4MDK E;  1T3Q A;  4S0R A;  3ECI A;  4KX6 B;  1XLN A;  2KQ4 X;  4K7W A;  4MEL A;  3QC8 B;  1EO6 A;  4YWG G;  3Q6B A;  4DHJ B;  2O2V A;  1LFD A;  3PV1 A;  4PS7 A;  1XLQ A;  3LYY A;  1YJI A;  1BT0 A;  1PQS A;  1HE8 A;  5L95 C;  3QCA A;  4G11 A;  4LNI A;  4XDD A;  4FHK A;  3ZRF A;  4FLH A;  3QQ8 B;  1GUA B;  1XCQ L;  3N30 A;  3ALB A;  4ANU A;  2IPK D;  3LJ3 A;  1EU4 A;  1OEY A;  2PW9 A;  2E3T A;  3DVN V;  1CMX B;  1XCT L;  2N9K A;  2HTH A;  3W1S C;  3PSE B;  2C9W B;  3QHT A;  2K3U A;  1NEN B;  1TBE A;  4AOF A;  4A3O A;  2CHW A;  2JVC A;  1EWY C;  1T0Y A;  1PGA A;  3UI3 A;  2ZZP B;  5TSS A;  4KZC A;  3TSS A;  1HZ5 A;  1WJU A;  3IHP C;  2IO2 B;  2V4I B;  1SXT A;  3R66 C;  3WA0 A;  2IDY A;  4DHJ D;  3QIJ A;  2LGI A;  5CHF A;  4MGY E;  3A9J B;  1P1A A;  5BYS A;  2HE7 A;  4TMA B;  5J17 A;  2W55 A;  4OZA A;  1JML A;  2XK5 A;  1LM8 B;  1QKZ A;  3KLS X;  2RD0 A;  4ZYN A;  1NEK B;  1I42 A;  1R4N B;  1QIL A;  2PVO D;  3ZNI D;  1YNT E;  1KM7 A;  4WWO A;  3KQ4 A;  4IDI A;  2LFI A;  3L54 A;  1UWM A;  3VH4 B;  4A20 A;  3OWE B;  5E6N A;  3FIL B;  5C3J B;  3R3M A;  2IO3 B;  5D6J B;  4A55 A;  2PLP A;  1SB3 C;  3RNC C;  3PZD A;  1UBI A;  2KVR A;  5DPT A;  2O2V B;  3VAW A;  4PT5 A;  1GC6 A;  5EE3 A;  3D32 A;  1J0G A;  1K53 A;  2SAK A;  3MJW A;  2LXA A;  3MHZ A;  1RM6 C;  4X57 B;  5C23 A;  4BOS C;  1G6J A;  3T9L A;  1RRB A;  3GZN B;  2R2O A;  1UD7 A;  1A5R A;  1GC7 A;  3KW5 B;  1HTO A;  4F8C B;  1RFK A;  2NBV B;  4HWI B;  4P6V F;  4MH8 A;  3AM9 A;  2LGX A;  2IO0 B;  1JCK B;  2DLB A;  3ZUN A;  2AX5 A;  1IYF A;  2MP2 A;  4YSX B;  3GOE A;  1L6U A;  2JRI B;  4RF0 A;  1XF5 L;  5HFY A;  1XT9 B;  4KSK C;  2KK8 A;  2D3B A;  4KV2 A;  3MC9 A;  4YSY B;  4FBJ B;  5GMV A;  2INC C;  2EKE C;  3PPA A;  2N1V A;  1ACC A;  3X0W A;  2BTE A;  3VTU A;  1JWM D;  4RGO S;  4HPL B;  4C80 A;  5G5G A;  2B3A A;  4XYC A;  3V6C B;  1T5X D;  1Q1O A;  3PLV A;  3ZGZ A;  1ZUD 2;  2C7M B;  1NYQ A;  2XK5 B;  5CHW A;  2N4F A;  4NJC A;  2MHJ A;  4LTU A;  2ZPY A;  5D3I B;  1T6B X;  3APF A;  1LO5 D;  1WH3 A;  4B6W A;  4ANX A;  3HM6 X;  3VUW A;  1YOV B;  2N7E A;  3OJ4 B;  4WWM A;  4C7Z A;  3VR9 B;  4I6P A;  2BW2 A;  2LD9 A;  1E7U A;  1AW7 A;  2M0A A;  2REX A;  3RNF C;  4XZ4 A;  1E8Y A;  2FBW B;  2QMT A;  1XQQ A;  4KGS A;  3L08 A;  1V8C A;  1OEY J;  2IGH A;  2KXJ A;  3JVZ X;  1WYW B;  2J0K A;  3N20 C;  4MT5 A;  3AEC B;  5D3D A;  2KWV B;  5EE9 A;  3VDZ A;  1D5Z C;  1QOB A;  4WH4 A;  3DHG C;  1I4H A;  4C7Y A;  1FNU A;  1NDD A;  4RGT A;  1VRA B;  4N6E B;  2KTR A;  5L83 A;  4GGQ A;  3DBL I;  2IGD A;  1I35 A;  1E9M A;  4HEA 1;  2L0F A;  5AUI A;  2OHF A;  3CIR B;  4TSS A;  4BKT A;  4RM8 A;  1I7H A;  4GOC A;  4WJO A;  2MP2 B;  2QIE B;  1NI3 A;  1L4D B;  1YD8 U;  2KTF A;  1S3S G;  2JZZ A;  2LUM A;  2DWQ A;  1VZ8 A;  2V1Y A;  1FCL A;  2KAC A;  3AI5 A;  2AQ2 B;  3TCA A;  3ZXV A;  4BKS A;  2NBW B;  4HXD A;  2OED A;  2W82 A;  1YN3 A;  4HPP A;  3W9C B;  1QZE A;  2KDI A;  2K5P A;  2K6D B;  2M4N A;  2K1F A;  1K8R B;  2QDF A;  3TEX A;  3DOW A;  2VRR B;  5DPR A;  1TS3 A;  4M8N A;  5FR3 A;  2WS3 B;  2DHZ A;  3AH7 A;  3NZ3 A;  1FO4 A;  2M17 A;  3V62 A;  4WWN A;  1N61 A;  1WE6 A;  4AP4 C;  1L5P A;  2KDM A;  2K39 A;  2PMV A;  1WMH A;  2GOW A;  2D5G A;  2BT6 A;  2JZP A;  2PKO A;  1P0R A;  4MH0 E;  4B0M A;  4IW0 A;  1WX9 A;  2QHO A;  3P4Q B;  4M00 A;  2N9L A;  2QC8 A;  3OAW A;  5C1Z A;  4A90 A;  1TZ1 A;  3R7Q A;  1C3T A;  3WIM A;  1TY2 A;  2MJD A;  1ZW7 A;  1Y8R C;  3BK2 A;  1PUT A;  3VQI A;  3H7S A;  1GOZ A;  3T3N A;  1QOG A;  3EGR A;  3DQV A;  3Q69 A;  1EWC A;  4HRO A;  4KDL B;  4NY0 A;  1WGG A;  3DVG Y;  2V3P A;  3Q2A C;  2ZEQ A;  1FNV A;  1FXA A;  2BGF A;  4RF1 A;  3I63 C;  3NS1 A;  1U4A A;  4EE2 A;  1WRI A;  3O65 B;  4JIO U;  5JHB A;  2KQ7 A;  4NJ6 A;  2RDH A;  1TS5 A;  4B95 A;  4MEM A;  4K3B A;  2KO3 A;  2K8H A;  2DZJ A;  3APC A;  2M1M A;  1WX7 A;  3H6N A;  3TEY A;  3MTN B;  5KHQ A;  2WXO A;  2Y3A A;  3AE1 B;  2GI9 A;  3HRD D;  4C00 A;  5LXI B;  3ZJU A;  4I6L B;  3KUD B;  4BFR A;  2DBY A;  3IBE A;  4GDL A;  4II2 B;  3LB8 C;  4EFO A;  5TR5 A;  2DYM A;  1VZ6 A;  4JQW C;  4GSW A;  2D07 B;  1CQV A;  1HXY D;  2AYO B;  4W9G A;  4DQO C;  3NS8 A;  3SU8 X;  2V0G A;  1FRD A;  5IN7 A;  3AV8 A;  3PZ7 A;  3BIN A;  2MBB B;  1WYG A;  3V05 A;  1BUI C;  1KLU D;  1CZP A;  2GMI C;  2WXM A;  1IPG A;  2LXC A;  1Q5W B;  2MBQ A;  4P16 A;  2MBE A;  2O6V A;  1WMH B;  3UQA A;  4KSL C;  1K52 A;  3M95 A;  3I9V 1;  3CST A;  1C4C A;  3JSV A;  2KC1 A;  5BYR A;  2QIL A;  3V61 A;  4BKS D;  2N9P C;  3V3X A;  3ZIM A;  2WU2 B;  1C4P A;  2WXQ A;  1IUE A;  1N63 A;  4ZRP A;  4BKG A;  1KJT A;  4RGM A;  5IA7 A;  2L0T A;  3ZXR A;  1TTN A;  2R61 A;  1AWD A;  1FCC C;  2N7D A;  3AB5 A;  1F0Z A;  3PT2 B;  4G50 A;  3ZW3 A;  1IGD A;  2PVG C;  3E9S A;  4US8 A;  2RGF A;  3DBL B;  1E7V A;  3N1Z C;  1GG3 A;  4LCD E;  2RDB C;  3Q3F A;  2DAJ A;  1ESF A;  3MC8 A;  2J52 A;  3BK1 A;  1FNW A;  1OTR B;  1WJ6 A;  4S17 A;  2ZJD A;  2RMM A;  4LJO B;  3R7R A;  3AE2 B;  2UYZ B;  1SF0 A;  3K9P B;  3SEB A;  3QAQ A;  2G9H D;  4NPN A;  3IFW B;  1HQR D;  2AQ3 B;  3MHS D;  1SIF A;  1QOA A;  4OZB A;  4GU2 A;  1FXT B;  2DYB A;  5BYQ A;  3EEC A;  1T0R C;  3FIL A;  3L13 A;  2YLM A;  4HDO A;  3UGB B;  3PGE A;  3Q8C A;  2KWD A;  4GDL B;  3IAS 1;  1KF6 B;  4F7Z A;  1GPX A;  1WZ0 A;  1JWS D;  1YJJ A;  3KWL A;  1DOI A;  3AE9 B;  2BS4 B;  2I38 A;  4KKJ A;  5HHD G;  3UIO B;  3KH0 A;  4P1B C;  1GB1 A;  1PGX A;  2INN E;  1XD3 B;  3PVL A;  1WGR A;  2W3S A;  1JRP A;  4UDU C;  5CTR C;  2KWU B;  4WJQ A;  2C60 A;  2O6V B;  4CQN A;  1Y56 A;  3ZVV A;  1UBQ A;  1DGJ A;  4US9 A;  3TMP B;  4II3 B;  3BYY B;  2XN9 C;  3DDC B;  3JSV B;  3CWI A;  1V86 A;  1LGR A;  1RLF A;  2KQS A;  5FK9 C;  4JPS A;  3GS2 A;  4RGN A;  5BMH A;  4DK5 A;  2FCN A;  2WXR A;  4ANV A;  3PRE A;  5HG2 A;  1MVK A;  1ZP0 B;  2GB1 A;  3C0R B;  3LXF A;  2YVC A;  2K8C A;  1Q0W B;  3MFG A;  2L8J A;  1V80 A;  4DHZ B;  1YN4 A;  2K25 A;  4J6I A;  1WGK A;  1L7Y A;  4RNA A;  3I3T B;  4ICU A;  3GP7 A;  2L52 A;  2FUH B;  1SE4 A;  4HJG E;  1OQR A;  3BY4 B;  3MP9 A;  2NVU I;  2WDT B;  1QOF A;  2W54 A;  3AN1 A;  1STE A;  4PYU A;  2KMM A;  2KX3 A;  2Y5C A;  3QWZ B;  2MRP A;  2VZK B;  1E8W A;  1V81 A;  3KWV A;  5MPO A;  4DDG D;  1KTK A;  3BVG A;  3NVW A;  4RCO A;  2M8S A;  3VVW B;  2KHW B;  2IYD B;  1D5X C;  2RPV A;  2O6V D;  2DZK A;  5AEK B;  2N0S B;  2AQ1 B;  3KYD D;  1N60 A;  3AXC A;  3PO0 A;  4W9J A;  4AJY B;  3Q8F A;  5AUK A;  3Q3O C;  2VH1 A;  3NRZ A;  3RNB C;  4ICV A;  4YSZ B;  1J7B A;  4IM2 A;  2MJE A;  3NVZ A;  2G4D B;  2WXL A;  4DXF A;  1L6V A;  1PFD A;  1XLO A;  3VUY A;  2WHI A;  1VCB A;  2HJ8 A;  2HTM E;  2WXJ A;  2WNM A;  4JGH B;  2ZW1 A;  2KN4 A;  4ZRI A;  2KLG A;  3BWU D;  5JZE B;  1WFY A;  4MGZ E;  3URY A;  2D3A A;  4WIP A;  3O13 A;  4A6Q A;  2PTL A;  5E6P A;  2LRW A;  2VZK D;  1TY0 A;  4KGT A;  3RZW C;  3SDL C;  3P42 A;  3AEG B;  1P7F A;  3Q8A A;  1WJ4 A;  3Q3J A;  3U30 A;  3PRZ A;  4IUM B;  1WRD B;  1B9R A;  2WDV B;  3IT4 B;  2WYQ A;  2GBM A;  4EKU A;  2LHE A;  2KJR A;  2LJI A;  2JF5 A;  2PJH A;  4B9K A;  4HRS A;  2JYE A;  3ZNG C;  3SHQ A;  3H9D A;  4KKI A;  3IXS A;  3AE4 B;  5EDS A;  2LUE A;  1RFA A;  2BPS A;  3ZKJ C;  2PPH A;  4DHZ E;  3X23 A;  1MFW A;  1SE3 A;  3IG3 A;  4ARC A;  2D11 A;  3DBS A;  4XGA B;  3QK0 A;  4WAA A;  2KT7 A;  3TL5 A;  3L0W B;  3TUO A;  1AN8 A;  3DBR I;  2FE8 A;  3OJ3 A;  3BYT B;  4IWO A;  3DWM A;  3K9O B;  3RD2 A;  3RMK C;  3A1Q B;  4A9A A;  3P1M A;  1D6E C;  2DZM A;  2HJ1 A;  2JPH A;  4IC7 B;  4XWW A;  3Q3N C;  2X8X X;  3P2B A;  1E0Z A;  4AUQ C;  3LDZ E;  3W5U B;  3VH3 B;  4ZYS A;  1UZX B;  1SE9 A;  2WXG A;  1TYG B;  4IKG A;  2RDG A;  1PGB A;  4HLE A;  2Z0E B;  3IT6 B;  5C2T B;  3KVF B;  2Z0D B;  3EC8 A;  3RCZ A;  2PEA A;  3AEE B;  1NVI D;  2OJR A;  4LK0 M;  4MJS A;  4KIK A;  2QEJ C;  1R4M B;  4XWT A;  2AL3 A;  2NTT A;  1LQB A;  1SGH A;  1SJE D;  3ZJT A;  1VDV A;  1ZDX A;  2SEB D;  2JX5 A;  4RMA A;  4HJK A;  3B2G A;  5IKC M;  4W9D A;  4W9K A;  4C4V B;  1BXT A;  4FJY A;  1J7C A;  5J18 A;  1FRR A;  3TBL D;  1ZXI A;  5IOI A;  2EKI A;  1T0Q C;  1D5M C;  4W9L A;  2M19 A;  2BWF A;  3B1L X;  2QSD A;  4EZJ A;  4CYE A;  1GJZ A;  4O1N A;  4XE0 A;  3AUL A;  4DWF A;  2MW5 A;  4TKN A;  4MAC A;  1QF6 A;  2GBN A;  2N7J A;  1YIW A;  4FAD A;  2QCZ A;  3N1Y C;  2BVC A;  3JYU A;  1DYQ A;  1SJH D;  3EA6 A;  4WQO B;  3RI7 C;  1P3Q U;  2G4S A;  3VHT C;  2L7R A;  1JWU D;  2J4X A;  1T0S C;  4XC2 A;  3L4P A;  3PHW B;  2NBU A;  4TUU A;  2DX5 B;  3FAH A;  2K9X A;  3GE3 C;  2C5L C;  2WXK A;  2DEN B;  1Z5S B;  4J3O D;  1WGY A;  4EUT A;  1ET9 A;  1DOX A;  4DXA B;  3RT3 B;  1EU3 A;  3SFE B;  4LNF A;  4BZA A;  2JYT A;  2JY6 A;  5J2R A;  4TQ1 A;  1E10 A;  1QLB B;  1WXA A;  4HKZ E;  2RPQ A;  1EM7 A;  4MJS B;  1UUP A;  1TKE A;  1OQQ A;  4PYZ A;  1JAL A;  1HTQ A;  4KIK B;  2BQQ A;  1XLP A;  1E5W A;  5LNK 1;  2IO1 B;  4ZRQ A;  1V97 A;  4OVV A;  2KN5 A;  1SIJ A;  4HDQ A;  5AZG A;  2BYE A;  3ZO5 B;  5BMG A;  1GB4 A;  3QJZ A;  2MLB A;  3RNE C;  5JXV A;  3HIZ A;  4IOI E;  1MHX A;  4AS1 A;  2BYV E;  2FCM A;  4L23 A;  4GIV A;  1PYW D;  3NJT A;  3U8Z A;  3DVG X;  2LGS A;  2KMC A;  2YEP B;  1I4P A;  3RN9 C;  3N32 A;  2KDB A;  4NAW A;  1FM0 D;  1F52 A;  5BO4 B;  4ZOH C;  1FFV A;  3SR6 A;  5CX3 A;  2ZCB A;  1ROE A;  1UH6 A;  3CF6 E;  3HK0 A;  1V1P B;  3W1Y A;  4ASW C;  2ICI A;  3RYT A;  2IJ0 A;  2BYT A;  1VLB A;  2NTS A;  4KDI C;  3R8B A;  1ET6 A;  3DBH I;  2FCS A;  4NNJ B;  1V2Y A;  4ZDV A;  4FJZ A;  2G45 B;  2JXT A;  2LHD A;  2M56 B;  3DBR B;  1JWB D;  1KLG D;  1UWX A;  5I4D A;  3VUX A;  4W9C A;  1GAQ B;  3PZ8 A;  3ZQ4 A;  1WGD A;  3U4E G;  2EEL A;  4HCN B;  3HM3 A;  3WCQ A;  5H8Y E;  2MQJ A;  3NZS A;  3R2T A;  4LNK A;  4DBG A;  3L10 B;  4M0W A;  3NY5 A;  1SE2 A;  2LZ6 A;  4HKQ A;  4LDT B;  2AEH A;  3C8Y A;  3ABV B;  4IM3 A;  1YX6 B;  4W9H A;  4OW0 A;  2CJO A;  3BZD B;  4LNN A;  2ZNV B;  2BBC A;  2A4Z A;  2HDE A;  4LNO A;  4WWP A;  1CJE A;  1WGH A;  1F2R I;  2K22 A;  4K3C A;  2WX1 A;  1MG8 A;  1VZ7 A;  4JL9 A;  1V1O A;  4YTN B;  4GDK A;  2KOX A;  2JWU A;  3PRP B;  4N9F 4;  3P4P B;  3U7D A;  1MPE A;  2J53 A;  2LGD A;  4FUL A;  2H88 B;  4K1R B;  4MGK E;  5G2N A;  3WAM A;  1ZE3 D;  2DZI A;  3TIX A;  3HHM A;  1M4V A;  1A70 A;  1IGC A;  1V6E A;  2H89 B;  4YL8 A;  2ONQ A;  2PIA A;  4XDC A;  4MSM B;  5DCN A;  5LLI A;  3AE8 B;  4JLC A;  3ZRC A;  5HKH A;  3N3K B;  4FHJ A;  4WAF A;  2JU6 X;  3J9C A;  2J0J A;  4NAW B;  2CJN A;  1CK1 A;  3P4R B;  2MSE D;  3N1X C;  2C7H A;  3B9J A;  3RFZ B;  4LDT D;  5D94 A;  2KDF B;  3AEF B;  5EE1 A;  1MG4 A;  2BKR B;  4REZ A;  3QX1 A;  5IAA C;  3ZYY X;  5E6O A;  2IZV B;  3DPD A;  3JW0 X;  4DDI D;  4KZ0 A;  2KAJ A;  2GLS A;  3RPF C;  4E71 A;  3NG0 A;  4PK1 A;  2C7N B;  3NOB A;  1TKY A;  2MX2 A;  3DHH C;  4EZK A;  4FA6 A;  2IY0 B;  1ZPS A;  2L00 B;  4WJP A;  4CO7 A;  1WF9 A;  4FXC A;  1R4M I;  1C78 A;  4OVZ A;  3BII D;  3T3O A;  4IM0 A;  2WQY B;  2L32 A;  2BWE S;  2NR2 A;  2G3Q B;  1MI0 A;  3KUC B;  3I57 A;  1JRO A;  4M8M A;  3GB1 A;  2ZW0 A;  5JH5 C;  1YQB A;  3AEB B;  1N5X A;  4M0W B;  1BML C;  2K8B A;  2KVZ A;  4USA A;  1K50 A;  2INP E;  1UGJ A;  1PDX A;  1GNU A;  4N59 A;  1V49 A;  3AE6 B;  4I6N B;  2IBI B;  4WUR A;  2KNB A;  1IBX B;  2KD0 A;  2FID A;  2NMQ A;  4BVU C;  3PS6 A;  4GDK B;  1C77 A;  2OJW A;  4M01 A;  3ZTC A;  3H1U A;  3VRB B;  4OVU A;  3KUZ A;  1FMA D;  2I2Y A;  2LVO A;  4AQ7 A;  1UGM A;  2TSS A;  1DOY A;  3IVF A;  1K51 A;  2ZPN A;  3MJ5 A;  1SEB D;  2JWZ A;  2WDR B;  2BS3 B;  2JQR B;  3OLM D;  4P1C C;  3W5V B;  1WIA A;  3A1Q A;  2MBO A;  1S1Q B;  2LAS A;  1C1Y B;  1WR1 A;  3SFD B;  2RR9 A;  2MA9 B;  2YEP F;  4RM9 A;  2GBK A;  3FKY A;  2V3N A;  1YN5 A;  2WP9 B;  4HVB A;  4ZHO A;  4JE3 B;  1WXV A;  1JQ4 A;  3EFU A;  4DXG A;  5FR6 A;  1M94 A;  3AED B;  2WU5 B;  4KGR A;  1WSP A;  3R2I A;  3B08 A;  3HUI A;  4YTP B;  3W1S A;  3DBH B;  2KC2 A;  5IO9 A;  1X1M A;  1V9J A;  1RWS A;  4TQ0 A;  1AYF A;  2GBJ A;  2I1K A;  3UIP B;  2JSV X;  4OZC A;  2Y5B B;  2KDE B;  4WQM A;  3RZF A;  1NBF C;  2D10 A;  4YT0 B;  1F9J A;  2D3C A;  1HEZ E;  2W3R A;  3TEZ A;  3RUI B;  1MHH E;  2ZVN A;  3AE5 B;  4BOZ B;  3NVV A;  2AWT A;  2CU1 A;  4MM3 A;  5G5H A;  2WXI A;  4RH6 A;  5E6J A;  1V5T A;  4AWJ A;  5GXG B;  4C4V A;  4E3C A;  5D2M B;  1FD6 A;  1EF5 A;  4ITK A;  4FN2 A;  2BKF A;  2FUG 1;  1TKG A;  2KZR A;  3MC0 B;  4AJW A;  2RSU A;  1TS4 A;  4URK A;  5FKA C; 
#chains in the Genus database with same CATH homology
 2GI9 A;  3HRD D;  1T3Q A;  4KX6 B;  3ZJU A;  1DYQ A;  2E6X A;  1XLN A;  3NUH B;  1SJH D;  3EA6 A;  2KQ4 X;  2QJL A;  2DBY A;  2ON8 A;  1JWU D;  4YWG G;  3LB8 C;  3HVZ A;  2J4X A;  2DYM A;  1VZ6 A;  3L4P A;  1XLQ A;  3LYY A;  5D7G A;  1YJI A;  1N62 A;  1CQV A;  1HXY D;  3FAH A;  2K9X A;  1F77 A;  4DQO C;  2WXK A;  3AE3 B;  1I4Q A;  4XDD A;  1N5W A;  4J3O D;  1XCQ L;  2V0G A;  1FRD A;  1OFF A;  2IPK D;  1ET9 A;  3AV8 A;  3PZ7 A;  1DOX A;  1EU4 A;  2PW9 A;  1WYG A;  1EU3 A;  2E3T A;  3SFE B;  3V05 A;  1BUI C;  1KLU D;  1CZP A;  2Z8L A;  2WXM A;  2JYT A;  4OHJ A;  1I4G A;  1ZOY B;  4P16 A;  1XCT L;  1K52 A;  4TQ1 A;  1XO3 A;  2N9K A;  1E10 A;  1QLB B;  3I9V 1;  1C4C A;  4HKZ E;  2K3U A;  1NEN B;  5BYR A;  4B0E A;  2QIL A;  1EM7 A;  1EWY C;  1SBB B;  1UUP A;  1PGA A;  3UI3 A;  3V3X A;  1TKE A;  5TSS A;  2WXF A;  1OQQ A;  1P7E A;  2WU2 B;  1C4P A;  2WXQ A;  3ETR A;  1IUE A;  1JAL A;  1N63 A;  3TSS A;  1HZ5 A;  4NAM A;  4ZRP A;  1XLP A;  5LNK 1;  4RGM A;  4ZRQ A;  1V97 A;  2GRI A;  1SXT A;  2V4I B;  1SIJ A;  2R61 A;  3AE7 B;  1AWD A;  2IDY A;  1FCC C;  2DYO A;  5BMG A;  4L2Y A;  2LGI A;  3AB5 A;  3VR8 B;  1F0Z A;  1GB4 A;  1IGD A;  5BYS A;  4TMA B;  2PVG C;  3E9S A;  5JXV A;  4IOI E;  1MHX A;  4US8 A;  4AS1 A;  2W55 A;  4OZA A;  4L23 A;  1JML A;  1PYW D;  2N7J A;  1QKZ A;  3KLS X;  1SSN A;  1NEK B;  1QIL A;  2PVO D;  1ESF A;  1J7A A;  1YNT E;  2J52 A;  2YEP B;  1FNW A;  3BK1 A;  4MM3 B;  1I4P A;  1KFY B;  5EE0 A;  1FFU A;  3H8H A;  3KQ4 A;  2RMM A;  2LFI A;  4IDI A;  3AE2 B;  1FM0 D;  1SF0 A;  3SEB A;  4Q2J A;  4D2K A;  2G9H D;  1UWM A;  1WWT A;  4ZOH C;  1FFV A;  3SR6 A;  2K0P A;  1ROE A;  4L1B A;  1HQR D;  2AQ3 B;  1QOA A;  4OZB A;  1C9F A;  3OWE B;  3FIL B;  4A8X C;  5C3J B;  1L4Z B;  1NYR A;  1V1P B;  5BYQ A;  2ICI A;  2XNA C;  4A55 A;  2IJ0 A;  2BYT A;  2PLP A;  3AEA B;  1SB3 C;  1VLB A;  2NTS A;  3R8B A;  1ET6 A;  3FIL A;  1V1P A;  3Q8C A;  2KWD A;  4GDL B;  3IAS 1;  1I4X A;  2JXT A;  2LHD A;  2M56 B;  4NZL B;  4PT5 A;  1JWB D;  5EE3 A;  1KF6 B;  1GPX A;  1K53 A;  1KLG D;  1UWX A;  5I4D A;  2SAK A;  4RFB A;  1JWS D;  1YJJ A;  3MHZ A;  1GAQ B;  1JWA D;  1DOI A;  1RM6 C;  3AE9 B;  2BS4 B;  2I38 A;  3KWL A;  3PZ8 A;  4KKJ A;  5HHD G;  3U4E G;  3ZQ4 A;  2EEL A;  2L83 A;  1L0Y B;  1GB1 A;  1PGX A;  4C56 C;  3HVD A;  4LLG M;  2INN E;  1RFK A;  4YXD B;  3WCQ A;  5H8Y E;  2W3S A;  4P6V F;  4MH8 A;  1JRP A;  3AM9 A;  1QQR A;  3R2T A;  1WXQ A;  2BS2 B;  1JCK B;  4UDU C;  2DLB A;  3U7Z A;  2AX5 A;  4M0W A;  4R3D A;  1SE2 A;  1L0V B;  4HKQ A;  4CQN A;  1Y56 A;  3C8Y A;  4YSX B;  4N58 A;  3ABV B;  1DGJ A;  4US9 A;  1L6U A;  3BYY B;  4OW0 A;  2CJO A;  2XN9 C;  4RF0 A;  1XF5 L;  5HFY A;  3CWI A;  3BZD B;  3BVZ A;  5FK9 C;  2BBC A;  3GS2 A;  4JPS A;  4RGN A;  2HDE A;  4YSY B;  5T8I A;  5BMH A;  1CJE A;  1F2R I;  2K22 A;  2WXR A;  1VZ7 A;  3AMZ A;  5HG2 A;  1Q10 A;  1MVK A;  1ZP0 B;  1E7P B;  2GB1 A;  1V1O A;  2WXN A;  1ACC A;  3LXF A;  4YTN B;  1VR9 A;  2JWU A;  3U2S C;  3MFG A;  3P4P B;  2BTE A;  1JWM D;  1YN4 A;  4RGO S;  1MPE A;  2J53 A;  1WGK A;  2H88 B;  4RNA A;  4JX1 C;  1ZE3 D;  4C80 A;  1M4V A;  5G5G A;  1A70 A;  1IGC A;  3GP7 A;  2L52 A;  1SE4 A;  2H89 B;  4HJG E;  1T5X D;  1OQR A;  3MP9 A;  2ONQ A;  5H92 C;  1QOF A;  2PIA A;  4XDC A;  2W54 A;  3AN1 A;  1STE A;  3ZGZ A;  1ZUD 2;  2KMM A;  1NYQ A;  2Y5C A;  3AE8 B;  2VZK B;  4NJC A;  2WXP A;  4LTU A;  5D3I B;  1HA5 A;  1T6B X;  1C79 A;  3KWV A;  5MPO A;  1LO5 D;  4WAF A;  3TEW A;  1KTK A;  3BVG A;  3NVW A;  4RCO A;  2JU6 X;  3J9C A;  4NAW B;  2CJN A;  3P4S B;  1CK1 A;  3P4R B;  4WWM A;  3B9J A;  1D5X C;  2RPV A;  3VR9 B;  3Q8B A;  4C7Z A;  3RFZ B;  1XXG A;  2BW2 A;  2N0S B;  2AQ1 B;  1N60 A;  3PO0 A;  1AW7 A;  2M0A A;  3AEF B;  5EE1 A;  2FBW B;  1ZXH A;  2QMT A;  2WLB A;  3Q8F A;  4KGS A;  5AUK A;  1YQ4 B;  3NRZ A;  4REZ A;  1V8C A;  3ZYY X;  4YSZ B;  1TS2 A;  1J7B A;  2IGH A;  2MJE A;  5HI1 A;  3VRA B;  2IGG A;  3IAM 1;  3NVZ A;  1HZ6 A;  1JW9 D;  2KAJ A;  3RPF C;  2WXL A;  4DXF A;  1L6V A;  1PFD A;  1XLO A;  4MT5 A;  1TKY A;  3AEC B;  1I4R A;  5D3D A;  3U52 E;  2HTM E;  2WXJ A;  2WNM A;  2ZW1 A;  2KN4 A;  2Q5W D;  5EE9 A;  1ZDV A;  1D5Z C;  1QOB A;  4WH4 A;  1ZPS A;  1I4H A;  3BWU D;  3EUB 2;  4ZHP A;  4FXC A;  4C7Y A;  1C78 A;  1FNU A;  4OVZ A;  4RGT A;  1VRA B;  4N6E B;  3BII D;  3URY A;  3T3O A;  1C4A A;  4WIP A;  2IGD A;  3O13 A;  4A6Q A;  2PTL A;  1E9M A;  2WQY B;  2L32 A;  2VZK D;  4HEA 1;  1TY0 A;  4KGT A;  2G1E A;  2BB6 A;  1MI0 A;  5AUI A;  3I57 A;  2OHF A;  3CIR B;  1JRO A;  4TSS A;  3P42 A;  3GB1 A;  2ZW0 A;  3AEG B;  1I7H A;  1P7F A;  2MJ3 A;  3Q8A A;  3AEB B;  1N5X A;  4JWU C;  1BML C;  2QIE B;  1NI3 A;  2WDV B;  1L4D B;  1VJK A;  3IT4 B;  4USA A;  1B9R A;  1FXI A;  1K50 A;  2LHE A;  2INP E;  1TJE A;  2LJI A;  1UGJ A;  1PDX A;  2LUM A;  2DWQ A;  4HRS A;  1VZ8 A;  4N59 A;  1FCL A;  2JYE A;  2KAC A;  2AQ2 B;  4KKI A;  3IXS A;  3AE4 B;  3AE6 B;  1TZO A;  4WUR A;  1IBX B;  1YMH E;  3FC4 A;  2NMQ A;  2OED A;  2W82 A;  1YN3 A;  3W9C B;  4GDK B;  1SE3 A;  1C77 A;  1R7S A;  4ARC A;  2K5P A;  2WDQ B;  1C76 A;  3TUO A;  1AN8 A;  3VRB B;  1IBX A;  3TEX A;  1FMA D;  2I2Y A;  1KH0 A;  2FE8 A;  3BYT B;  3E56 A;  3DWM A;  4AQ7 A;  4A9A A;  2TSS A;  3P1M A;  1TS3 A;  1DOY A;  5FR3 A;  2WS3 B;  1D6E C;  2J42 A;  1K51 A;  3MJ5 A;  1SEB D;  1ENF A;  2WDR B;  2ACZ B;  2BS3 B;  4GLS C;  4XWW A;  2JQR B;  3AH7 A;  3NZ3 A;  2B76 B;  3W5V B;  1E0Z A;  1FO4 A;  2BB5 A;  1FIQ A;  3W2D A;  1N61 A;  3SFD B;  4H2A A;  3W5U B;  4ZYS A;  2MEK A;  1L5P A;  2KDM A;  2WXG A;  1TYG B;  2YEP F;  2PMV A;  1XEE A;  4IKG A;  2RDG A;  1PGB A;  3NVY A;  2D5G A;  2V3N A;  2BT6 A;  3IT6 B;  5C2T B;  1YN5 A;  2JZP A;  2PKO A;  2WP9 B;  4B0M A;  4ZHO A;  3BVM A;  2LMC A;  4JE3 B;  1JQ4 A;  3P4Q B;  4DXG A;  3AED B;  2N9L A;  2WU5 B;  1FEH A;  1NVI D;  3AEE B;  4KGR A;  1WSP A;  4LK0 M;  3R2I A;  3DWG C;  4A90 A;  3HUI A;  4YTP B;  2WXH A;  4YTM B;  1YQ3 B;  1TY2 A;  2MJD A;  3N9Y C;  3W1S A;  5BMI A;  2QEJ C;  4XWT A;  3BK2 A;  3P63 A;  2NTT A;  1PUT A;  3VQI A;  1GOZ A;  1RWS A;  4TQ0 A;  3T3N A;  1L0X B;  1AYF A;  2LEK A;  1SJE D;  2MH7 A;  2CU3 A;  3ZJT A;  1QOG A;  3EGR A;  1VDV A;  2JSV X;  4OZC A;  3Q69 A;  1ZDX A;  1EWC A;  2SEB D;  2JX5 A;  2Y5P A;  4HRO A;  4WQM A;  1D4B A;  2V3P A;  4YT0 B;  3B2G A;  1HEZ E;  1UNS A;  2L1A A;  2W3R A;  3TEZ A;  1MHH E;  1FNV A;  3ZJV A;  3AE5 B;  1FXA A;  3AE1 B;  1RYJ A;  1BXT A;  3NVV A;  1J7C A;  4RF1 A;  1FRR A;  3NS1 A;  4EE2 A;  1WRI A;  1ZXI A;  2EKI A;  5G5H A;  1QT9 A;  2WXI A;  1D5M C;  2X38 A;  2M19 A;  4JWS C;  4RH6 A;  3Q8E A;  5E6J A;  2RDH A;  3B2F A;  5GXG B;  1F2R C;  2QSD A;  1TS5 A;  1FD6 A;  1KRH A;  4ITK A;  4O1N A;  2FUG 1;  4XE0 A;  1TKG A;  3TEY A;  3MC0 B;  1TS4 A;  4MAC A;  1QF6 A;  2WXO A;  4ARI A;  1E6E B;  2Y3A A;  1B1Z A;  5FKA C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...