4HKZE

Trastuzumab fab complexed with protein l and protein a fragments
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
63
structure length
63
Chain Sequence
b'SEVTIKVNLIFADGKIQTAEFKGTFEEATAEAYRYAALLAKVNGEYTADLEDGGNHMNIKFAG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Trastuzumab light chain
publication title Identification and grafting of a unique peptide-binding site in the Fab framework of monoclonal antibodies.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 18
structure length 63
sequence length 63
ec nomenclature
pdb deposition date 2012-10-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4hkzE00
4HKZE 2EELA 1KH0A 4IKGA 2JSVX 2ONQA 5JXVA 2N9LA 2RMMA 3GB1A 2N7JA 2JU6X 1D4BA 2IGDA 4OZAA 4OZBA 1HZ6A 1FCLA 1K53A 1MI0A 1MVKA 1IGCA 2OEDA 5BMGA 3UI3A 2LUMA 1XCQL 2JZPA 5HI1A 1UWXA 2JXTA 2LHEA 2RPVA 2QSDA 5HFYA 1HZ5A 2J53A 4MACA 1PGXA 1XF5L 1MHXA 2KN4A 2ZW1A 1Q10A 1K52A 1EM7A 5HHDG 1HEZE 1GB4A 5BMIA 2KACA 1IBXB 3FILB 2PTLA 1XCTL 4IOIE 2NMQA 1JMLA 2I38A 1YMHE 2N9KA 1QKZA 2ON8A 1F2RC 4HJGE 1IGDA 4KGSA 5HG2A 3MP9A 1GB1A 5BMHA 2JWUA 4KGRA 1ZXHA 1C9FA 1MHHE 2PLPA 1YNTE 2IGGA 4GLSC 1IBXA 4KGTA 2GB1A 1K50A 2KDMA 1P7EA 1MPEA 2K0PA 2KQ4X 2PW9A 2GI9A 4WH4A 2ZW0A 1P7FA 2J52A 2KWDA 2QMTA 2IGHA 1F2RI 2LGIA 2I2YA 4D2KA 1FD6A 1PGAA 4OZCA 1FCCC 1PGBA 2LHDA 1K51A 3FILA 3V3XA
chains in the Genus database with same CATH superfamily
4W9GA 2VH1A 2WXRA 3TBLD 3QAQA 1PQSA 4ACFA 4HK2A 1CJEA 2C5LC 1GC7A 2KQSA 2MRPA 1HA5A 4MELA 3ETRA 1MFWA 1HZ6A 1SJHD 1K53A 2ZZPB 4LCDE 2D5GA 2HJ1A 1XCQL 5TSSA 1OQRA 4A6QA 3APFA 3ZVVA 2M0AA 4AWJA 2CJNA 1R4MB 3MHSD 1ZKHA 2V3NA 2WDRB 5E6PA 2M8SA 3P4SB 3AEBB 1GB4A 1ENFA 2JY6A 2LFIA 1MJDA 3O13A 3ZLZA 5IKCM 3Q3JA 1NI2A 2PVOD 3PSEB 3RYTA 4KDLB 5D6JB 1ROEA 3WAPA 2JWUA 3GZNB 4K7UA 3R2TA 3AE3B 1AW7A 4AQ7A 3NS8A 4XC2A 1EU4A 1UGMA 2PLPA 1TS4A 5LLIA 3FKYA 4HPLB 3BYTB 3BK2A 2KKCA 4WAAA 2WS3B 2NR2A 2VH2A 3AE1B 2L1AA 3ZGZA 1WYGA 1ZW7A 2WXLA 5CHWA 3ZNGC 5GXGB 2G4SA 4B0EA 5CTRC 3VRAB 3IAS1 4II3B 2CHZA 4HWIB 3A9KA 2L52A 4IC7B 2LRWA 2GLSA 4HEA1 1V80A 2KHWB 5FK9C 1KLVA 3U2SC 1SE4A 2VZKB 4J6IA 2ONQA 1PUTA 2Y5BB 2PVGC 3RMKC 3MJWA 4EKUA 4H2AA 1WZ3A 4C56C 4WQMA 1F52A 3Q8CA 2K1FA 3LDZE 1WMHB 1WZ0A 4YXDB 2RPVA 4W9DA 5I4DA 4FJYA 5J17A 3AN1A 1D5ZC 4MGIE 4N58A 4K3CA 1TYGB 3AE2B 3NVWA 1BUIC 1EUVB 3GE8C 2KLCA 1WR6E 2BPSA 2KDBA 2WXGA 2LXCA 1Q10A 2WDTB 2V3PA 5GMVA 5HHDG 2WDQB 2N1WA 3H1UA 3DVNU 3R7QA 1JWSD 3DBRB 1TZ1A 1N6ZA 4ICVA 2KMAA 4P1BC 2ON8A 1OFFA 1J0GA 5H92C 2V3SA 4PK1A 2O2VB 4ZYNA 4ICUA 1WGKA 3QJZA 4W9LA 1HTQA 3VR9B 2FAZA 3A1QB 4AUQC 3V61A 1WRIA 4HROA 1Q1OA 1XLQA 4HRSA 1EF1A 1FXTB 1UWMA 3HUIA 1ESFA 1V1PB 2KJ6A 3C8YA 4YSYB 2RD0A 1UD7A 2LUEA 1YN3A 4W9EA 4ZRKA 2DYOA 4ASWC 1PGAA 2SAKA 4NPNA 1PGBA 4DK5A 2LZ6A 1NEKB 1QOBA 4HCPB 4HKZE 3T3NA 3ZDTA 1WY8A 3VAWA 4CHKA 1ZOYB 4EOYA 5BYRA 2AYOB 4OZBA 4DHZB 5KHOA 2MQJA 4W9FA 4NAWA 1VJKA 1JWUD 4IWOA 1TGZB 3L4PA 5BMGA 1WX8A 1M4VA 3C19A 1E5WA 2L05A 2N7DA 3MJ5A 4M8NA 2AQ2B 4C00A 3GP7A 2WXQA 1VCBA 1MHXA 1OGWA 3S2AA 1LFDA 2MEKA 4GDLB 3QWZB 2CJOA 2JYTA 1QOFA 5G5HA 1JALA 4JE3B 2A5UA 1R4NI 3W1YA 4NQKE 1V9JA 1RFAA 5FR3A 2KYWA 2KLGA 2D3CA 4RM8A 4BVUC 2JZ3B 5HKHA 4KGRA 3VFKA 1J19A 1BXTA 2ZPNA 3PVLA 1L7YA 2I1KA 1C9FA 4ZRQA 3ENEA 1C4CA 1WH3A 2DENB 2J0JA 3AU4A 4RNAA 2ZNVB 2INNE 2LGDA 3L16A 1KTKA 5FR6A 3J9CA 3ZNHB 2LVPA 3E56A 3RN9C 1UBQA 4CQNA 2KFKA 4IM3A 3DQVA 3JVZX 2ZW0A 4WJPA 3PZDA 4YTPB 1DOIA 4NJCA 3I57A 3AE7B 3RULA 2MSED 2XK5B 3DBSA 3NVZA 2CKHB 2ZEQA 1SSNA 4YTNB 1SIJA 4RF1A 2RDHA 4GGQA 1WJUA 1HE8A 4JX1C 3QC8B 4WJQA 4DBGA 3OLMD 4Q2JA 2L8JA 3ONSA 2FUG1 3RFZB 2BYVE 1C78A 1PYWD 4FADA 4IW0A 3ML8A 1NDDA 2IZVB 3TIXA 3WANA 1FCLA 1FM0D 3VUWA 1TT5B 4CYEA 4TMAB 4I6LB 3M62B 2ACZB 1J7BA 2ZCCA 2QSDA 2J0MA 3ABVB 2JYEA 3LJ3A 2N7EA 1F1HA 2JQRB 4RM9A 2Z59B 2BBCA 2WLBA 3AEEB 5AEKB 3HRDD 4G11A 3Q8AA 3VUXA 1FRDA 2LMCA 3PT2B 4NAMA 1MG4A 2K5PA 3BYYB 3I5JC 1UNSA 2DHZA 4LJPB 3RUIB 2NPTA 3VQIA 2UU7A 1QOAA 2DZMA 2MA9B 3QK0A 4DXAB 1GC6A 1Q5WB 3EA6A 1TS5A 1MHHE 2K6QA 4MH8A 2IGGA 2MP2A 4K1RB 3WAMA 5AUKA 2BYFA 3VH4B 3P2BA 4BZAA 3VTVA 4HLEA 2PIAA 3U4EG 5IA7A 5JZEB 1CQVA 2QILA 2M19A 2M4NA 3SD5A 2AQ3B 3E9SA 5AZHA 4ARCA 3R2IA 4D2KA 5TR5A 4PS7A 1XLPA 2LHDA 3NZ3A 4J3OD 3V3XA 2KD0A 4WWNA 3KUCB 2IO3B 1FRRA 5D2MB 1QOGA 3D32A 2IGDA 2MBQA 2OJWA 1SJED 2JRHA 1JWAD 1WM2A 3QCAA 1WGGA 2LVOA 3DBLI 3PHXB 4N9F4 5FKAC 2R61A 2X8XX 5EE3A 3UI3A 5HI1A 1IUEA 4TQ1A 2JXTA 2KJRA 1L4DB 1UBIA 2D3GA 2BQQA 4XGAB 4BBNF 1HZ5A 4MM3A 1TS3A 2WQYB 2ZJDA 3DHHC 1WM3A 2AWTA 3V05A 4W9KA 1D3ZA 1QILA 1GNUA 2ZVNA 3EC8A 1NVID 4XE0A 1JWMD 4W9JA 1K8RB 1FMAD 5JHAA 3RT3B 1FNWA 1S3SG 2KDIA 1WWTA 3W9CB 2KXJA 3TSSA 1R4NB 1F2RC 3A9JA 1GPXA 2IO2B 4GN1A 3H9DA 2YLMA 2WXOA 3Q3FA 1ZXHA 4RGOS 3EGRA 3CSFA 4GIVA 1QT9A 4RFBA 2KDMA 4BKSA 4IM2A 1AARA 1T6BX 1ZGUB 3HK0A 2AL3A 2GI9A 1L6UA 1F0ZA 2QMTA 1F2RI 1J7AA 5CX3A 1WI0A 1SE9A 5CHFA 3WA0A 2MWSB 4C80A 3EFCA 2XN9C 1CMXB 4IKGA 1KH0A 4ANUA 4DDID 2JSVX 4UDUC 1WGRA 4HXDA 2Y3AA 3GB1A 3NS1A 2L83A 5G5GA 4LNOA 1UUPA 1G6JA 3SFEB 2AX5A 2PMVA 3M63B 1WF9A 2FCQA 5E6OA 2OEDA 1NI3A 1WGDA 5EE9A 5BO4B 3ZQ4A 4EFOA 4XDDA 2G9HD 1V2YA 1DGJA 2J53A 4MH0E 1N5XA 4C4VA 2J7QB 4LDTD 1BMLC 4XDCA 2WU5B 1T0YA 2WYQA 1YQ4B 3VTWA 2LEKA 3A9KB 2B3AA 1IBXB 4WURA 2M17A 1SF0A 3ZXVA 2PKOA 4HVBA 3ZTCA 3MP9A 4ARIA 2HE7A 2YEPB 3ZUNA 2N9EB 2K6DB 3CWIA 3IHPC 1YOVB 2E3TA 4JPSA 2YVCA 1FNVA 1YJ1A 3PHWB 1MPEA 2REXA 4LNFA 1V8CA 2K0PA 3OJ4B 3PGEA 4LLGM 2KZRA 3AEAB 3R8BA 2BKRB 1RYJA 1TBEA 2MJEA 2GBJA 3H7PA 3KUZA 1A5RA 1K51A 5LXIB 4RGTA 4FHKA 3KW5B 3NJTA 1ISNA 2V4IB 1AYFA 4USAA 2ASQA 4WWMA 5J2RA 2PPHA 3H7SA 3NG0A 5DPRA 2V1YA 2IYDB 3W5VB 1SBBB 3HM6X 4ITKA 3NY5A 1SEBD 4PYZA 1YD8U 2C7NB 1I7HA 3OAWA 3TEZA 3DBLB 5HFYA 2BWFA 2A4ZA 3MC9A 4MACA 1PGXA 1XF5L 4ZRPA 3P4QB 2JXXA 3EECA 2LI5A 3HVDA 1D6EC 5L95C 3PLVA 4IWQA 1N62A 3UQBA 2FUHB 4JWSC 4DHZE 4US9A 2EKEC 1HEZE 2L0FA 2QDFA 4LNNA 1DOYA 4LNIA 1AWDA 4YSZB 1FFVA 2N9XA 4C7ZA 2NMQA 1JMLA 3KQ4A 4HPMB 2IY1B 3R7RA 2V9HA 5HG2A 3L13A 2CU1A 3KVFB 5BMHA 3CMMB 1I4RA 4NAWB 1FFUA 4B6WA 3RNEC 4G3XB 3PO0A 1P7EA 3B2FA 3N1ZC 4KSKC 1NENB 2WGSA 3MC8A 4JIOU 3X0WA 1ZUD2 3L54A 2TSSA 4MJSB 3SU8X 2M0XA 3BIID 3Q8EA 4FJZA 4KIKA 1OTRB 3UGBB 3MFGA 4A3PA 2XNAC 2HJ8A 5D94A 1ZDVA 2WX0A 3WALA 1ZDXA 2HTHA 3FILA 4HCNB 4AOFA 4HDQA 3T8MA 3UQAA 3B0AA 4US8A 4N6EB 4BFRA 2RPQA 2OJRA 2IPKD 2W55A 1C76A 2FE8A 1NBFC 3BZDB 1D5XC 4OZAA 3RNCC 3DDCB 2G45B 1RM6C 4KSLC 2ICIA 1FXAA 3SEBA 1C4PA 2KAJA 2KT7A 4KKIA 3V6EB 1OEYJ 3TUOA 1T0QC 1JCKB 3AEFB 1I4PA 4DDGD 3IBEA 2EMSA 2MH7A 4TQ0A 2WNMA 2IJ0A 1SIFA 4PT5A 2KFKB 4EUTA 4OVUA 3H6NA 2ZW1A 1EM7A 2LJIA 5E6JA 1WMHA 2MJ3A 2KACA 1VZ8A 3RNFC 5C3JB 4MDKE 2NBWB 4IOIE 2I38A 4ANVA 4LNKA 1RLFA 2KDFB 1CZPA 2FIFA 3OG5A 1PFDA 3PREA 3AU5A 3DVGX 4B9KA 2K25A 2LGYA 1K50A 4M0WA 5C1ZA 1PDXA 2LASA 2Y5PA 1KRHA 1T5XD 2PW9A 2O2VA 2KTFA 4MSMB 2L00B 2IGHA 3A1QA 4AS1A 3B1LX 5J18A 2RSUA 3WAOA 3R3MA 2G3QB 3FC4A 4JWUC 3RZFA 2NPTB 3ALBA 1V1PA 4RMAA 4YT0B 3P63A 4MT5A 1STEA 4P1CC 3P1MA 2N4FA 4OHJA 4IUMB 2ZVOA 2DX5B 2DZKA 3W1SA 3P4RB 4DXFA 2R2OA 4PYUA 3FAHA 2OOBB 2BKFA 2XBBC 4XWTA 4PS3A 2CHWA 3VUYA 2LHEA 2IDYA 4RH6A 1VR9A 3WIMA 3I63C 2KK8A 4ZHOA 1P9DU 2MBEA 1L2NA 1I4XA 3K9OB 1M94A 3RPFC 1XQQA 1UGJA 4P6VF 1EO6A 1SGHA 4C7YA 3TL5A 2LGXA 3JSVB 3CF6E 3Q8FA 3BY4B 3AECB 2DBYA 4MSQB 1LGRA 2SEBD 1GAQB 1TKYA 4GU2A 1YMHE 4HJGE 3NZSA 1TIFA 4GDLA 5DCNA 1C77A 1RAXA 2G1EA 1WX7A 1YNTE 3A4SC 3DHGC 2LGSA 4KVGB 1V81A 2INCC 1TKEA 2HD5B 3QHTA 1WXAA 3N1XC 1ZPSA 4MM3B 4E74A 1QZEA 1YJJA 2BGFA 2PE6B 4A8XC 1FD6A 2CS4A 1E90A 1EF5A 2R2QA 1Y8RC 2H89B 4FN2A 2V0GA 2CR5A 3U52E 4DQOC 2MX2A 2WXPA 1FIQA 2MHJA 2RMMA 3A9JB 4KV2A 1FO4A 3APDA 1WIAA 4P16A 1D4BA 3ZKJC 1ZXIA 1WSPA 2XK5A 1KLGD 2LD9A 4MGZE 3QARA 4WJNA 4EZLA 5JH5C 2X38A 4HPPA 3AXCA 2GBKA 2LRUA 1VDVA 1ZE3D 2D11A 4RGMA 3Q3OC 4WJOA 1WGYA 1WRDB 5IAAC 1EU3A 1LQBA 2KDEB 4K7SA 1NYQA 2KVRA 5IP4D 1KM7A 2NS5A 1CK1A 1WYWB 2KTRA 2O6VA 1YX5B 2LJ5A 2EKIA 2N9KA 1QKZA 3VR8B 4II2B 3TEYA 4KGSA 1WXSA 2L0TA 5D7GA 3Q6BA 1GG3A 3LYYA 3RCZA 2O6VD 4ANWA 1KFYB 1WXVA 4GLSC 1RFKA 4KX6B 3ZYYX 4LDTB 2IY0B 2MBHA 1I4QA 3AEDB 1V5TA 1VLBA 4E3CA 4BKGA 3SFDB 1SB3C 4FA6A 3PLUA 4WH4A 4C4VB 2Z8LA 2KFJA 1GJZA 3IAM1 1OEYA 1VD2A 3GOEA 3PRMB 4KZ0A 4OZCA 5DPWA 3NRZA 4GDKA 2KWUB 2PJHA 1VZ6A 2D3BA 4NY0A 2WXIA 4RF0A 4GXBA 2N7JA 1S1QB 3ZTDA 1E0ZA 4M01A 3APCA 2D2QA 2KWVB 4M8MA 5C2TB 1GUAB 4TSSA 1JROA 3DBRI 4N59A 4BKSD 3NOBA 4HDOA 4EE2A 3DWMA 1WXQA 3SDLC 3W1SC 2WXJA 1SE2A 1WFYA 4B95A 4URKA 4FLHA 3ECIA 1EWYC 2JT4B 1YJIA 2BS4B 2BB5A 3T9LA 4XX5A 3Q8BA 1P98A 2JPHA 4M02A 4EZKA 1ET6A 2MBOA 2XEWA 2KO3A 4HKQA 2JUOA 2QEJC 2BW2A 4MGKE 2K8HA 2UYZB 2LWPA 4DWFA 3EFUA 2KNBA 2WU2B 3UF8A 2PTLA 2EMTA 4ANXA 1XXGA 3W2DA 3EUB2 1YN4A 3ZO5B 4OVVA 2YEPF 1P0RA 3CIRB 5CHVC 1GB1A 4R3DA 4IDIA 3ZNID 1AN8A 1WGHA 5IN7A 2GMIC 2DYBA 4GSWA 4K3BA 1N5WA 1I4GA 3IXSA 4KGTA 4BAXA 3ZNZB 5LXHA 2BS2B 1ET9A 3VH3B 2GBRA 3AE4B 5BYSA 1BT0A 2HTME 4LTUA 2J0KA 2KQ7A 2KWDA 2JF5A 2RR9A 1Y56A 2DZJA 3CSTA 1EWCA 1HXYD 1FCCC 3RNGC 1L5PA 1I35A 2WXFA 2QJLA 1B9RA 3AE6B 3AEGB 4A9AA 4ZDVA 2L3ZA 2DAJA 2NTTA 2ZNVC 5IO9A 3ZJVA 3NVVA 2WXMA 3TMPB 4MEMA 5L83A 4JLCA 4L2YA 1IYFA 5T8IA 3N30A 4IG7B 3V60A 4TUUA 3PZ8A 2QHOA 1YIWA 2BF8B 4L1BA 2MLBA 1YN5A 2K9XA 5EE1A 4OW0A 1E8XA 4IM0A 2W3SA 3SR6A 4BOSC 1KOTA 1Q0WB 1E10A 3AI5A 1UWXA 1Z2MA 1JWBD 2BYEA 2UWQA 4DHJB 3L10B 2L32A 4AP4C 2CHXA 3K9PB 4KIKB 2KANA 1TKGA 1FPYA 4K81A 5MPOA 2JX5A 3NVYA 5DPSA 2IBIB 2FNJB 2MBBB 3FILB 1U4AA 2BT6A 3Q14C 3EHVA 4X57B 3WCQA 2LVQA 3N1YC 1C4AA 1C3TA 1E8WA 3I3TB 1SXTA 2JWZA 3RZWC 4JL9A 1A70A 4I6NB 1TTNA 2E6XA 3U7ZA 1IBXA 5BYQA 3QA8A 4YL8A 3NZUA 2C7MB 2NBUA 2QIEB 3RNBC 1NYRA 2W54A 3Q3NC 4FHJA 2NBVB 1UZXB 4LJOB 2LXAA 1N60A 2JZZA 2I2YA 1KLUD 3UIOB 2WHIA 2KC1A 3DBHI 2C7HA 3ZIMA 4NNJB 1YQBA 4XYCA 4FJVB 4I6PA 5JXVA 2RGFA 2DZIA 2JU6X 4JGHB 1XLNA 1TZOA 4O1NA 1XLOA 3RI7C 5D3DA 4W9IA 4DHJD 3MC0B 4AJWA 1JRPA 1KF6B 3UINB 3X23A 4M0WB 4OVZA 1YX6B 4S17A 3BVZA 2BB6A 5DPTA 1B1ZA 1F77A 2H88B 4RCOA 4GMVA 2KN4A 3AH7A 2KOXA 2D3AA 3MTNB 1E6EB 3OJ3A 3HM3A 3AB5A 4FXCA 4TV3A 3V6CB 4IWPA 3N32A 1WX9A 1E7VA 1HQRD 2QCZA 3BINA 1XCTL 1QF6A 4L23A 3PRZA 2Z0EB 1IGDA 2AL6A 3N20C 5G2NA 3ZJTA 3TEXA 2IO0B 4WIPA 1LXDA 4XZ4A 3H8HA 1X1MA 3PRPB 4G0NB 1VRAB 2VZKD 1XD3B 3TJPA 3MHZA 4BKTA 3VDZA 4PS8A 3DHIC 4W9HA 5EE0A 3A33B 4A3OA 1WJNA 2D07B 2M1MA 1VZ7A 4EEWA 1MG8A 1H4RA 3KH0A 3M95A 4G50A 5D3IB 1OQQA 3M3JA 2LGIA 2VRRB 4BBNC 1IP9A 3PS6A 3IG3A 1E9MA 3L08A 1D5MC 2Q5WD 2PEAA 4FBJB 2BYTA 3IVFA 4MJSA 1JQ4A 4REZA 2AEHA 4HJKA 3V62A 4P7IA 2RDGA 3PV1A 2B76B 4F7ZA 4YWGG 1MI0A 1UH6A 2W3RA 1IGCA 2DAFA 4B0MA 2LUMA 2JZPA 4F1SA 2GBNA 2L7RA 1N63A 3NHEB 1V1OA 3TCAA 3LB8C 3BVMA 1ZP0B 3R66C 2INDC 2K8CA 2W82A 3VXWA 1E8YA 3AE9B 1WE6A 1FEHA 2JRIB 3DPDA 1L4ZB 3P42A 1H8CA 2BWES 2G4DB 2MP2B 2OHFA 3QQ8B 2MJDA 2WXNA 1F9JA 1WJ4A 5KHQA 2DLBA 3AV8A 2BTEA 4A90A 1Z5SB 2ZPYA 4WWPA 5LNK1 2ZCBA 1P1AA 2WP9B 3RD2A 3OWEB 5AZGA 3JYUA 2KMMA 1WR1A 3L0WB 3DCGA 3KLSX 1GOZA 3RNAC 2WDVB 3IT4B 2N9PC 4GB9A 3VRBB 4WAFA 5G55A 3VVWB 1E7UA 1ACCA 4QAYA 2MW5A 3BVGA 3IFWB 2N1VA 1QQRA 5AUIA 3ML9A 3KYDD 3A4RA 2DWQA 2KQ4X 2N0SB 3ZW3A 1DOXA 3ZJUA 2KMCA 4AJYB 4CO7A 2RDBC 4NZLB 4GOCA 1L0VB 3AM9A 3IT6B 4WWOA 2W9NA 3KWVA 1C79A 2WXKA 2KTRB 2O6VB 4EZJA 3UIPB 2EELA 4FULA 4ZHPA 4MGYE 1R7SA 3DBHB 1UELA 2FCSA 1WJ6A 3U7DA 4ZYSA 4KZCA 2NVUI 1XO3A 5E6NA 2V4LA 4NQLB 3TEWA 2CU3A 1WE7A 2M56B 4A20A 4KDIC 1R4MI 3Q3MC 1LO5D 3DWGC 1SE3A 2L76A 2NTSA 4ZOHC 3Q2AC 4E71A 2QC8A 2INPE 3GS2A 5H8YE 1TY2A 3ZDMC 2GBMA 4LK0M 2WXHA 3GE3C 1JRUA 1FNUA 3KYCD 2K22A 4GDKB 2KX0A 3N9YC 3GZNI 3ZRCA 4K7WA 3T3OA 2Y5CA 1T0SC 1L0YB 3URYA 1DYQA 1V97A 1IPGA 3PZ7A 3QX1A 1KJTA 3JSVA 1J7CA 2I1JA 1T0RC 1RWSA 2FIDA 2GOWA 2GB1A 3ZXRA 3DVNV 1JW9D 2K8BA 3NUHB 5IOIA 2BVCA 1WXMA 1TS2A 2KVZA 1I4HA 2DNFA 2Z0DB 2IO1B 4TKNA 1HTOA 3VHTC 1N61A 2D10A 1OQYA 2KN5A 2KWCA 3DVGY 1V86A 2K3UA 1QLBB 2FCMA 2NCNA 4RGNA 4DXGA 2JVCA 4NJ6A 3N3KB 3HHMA 1E8ZA 3Q69A 4ZRIA 1E7PB 1L0XB 2C60A 2N9LA 4S0RA 3HIZA 3B2GA 3HVZA 2FBWB 5JHBA 1LM8B 1UF0A 4WQOB 2AQ1B 4M00A 3ZRFA 1MVKA 3SHQA 2WX1A 2DYMA 1YQ3B 3PTFC 1XEEA 2BS3B 1V5OA 2PE9A 2FCNA 3BWUD 2KX3A 4F8CB 5C23A 3DOWA 2J4XA 3C0RB 1K52A 4YSXB 2GRIA 3U30A 3PPAA 2KC2A 3AE8B 4YTMB 5BMIA 4W9CA 3P4PB 2HDEA 4BOZB 3VTUA 2KJHB 3AULA 4KKJA 3AMZA 1TJEA 3O65B 5EDSA 1I42A 3U8ZA 3B9JA 3LXFA 1T3QA 4XWWA 1J8CA 3KUDB 2C9WB 1V6EA 4A55A 1TY0A 3QIJA 3H7PB 1RRBA 2MCNB 3KWLA 1XT9B 2J42A 3AE5B 3JW0X 3W5UB 4ZRJA 4NJ7A 2K39A 3BK1A 1P7FA 1FXIA 2J52A 1L6VA 1C1YB 2WWZA 3B08A 5AZFA 3I9V1 1P3QU 3L17A 1V49A 4JQWC
chains in the Genus database with same CATH topology
4JWUC 3FC4A 2WXRA 1V1PA 1FRRA 5JXVA 4YT0B 3P63A 4MT5A 1STEA 1QOGA 2JU6X 1CJEA 2IGDA 3P1MA 4OHJA 1XLNA 3W1SA 1SJED 1TZOA 4O1NA 1HA5A 3P4RB 1JWAD 1XLOA 4DXFA 3ETRA 1HZ6A 5D3DA 1SJHD 1K53A 3MC0B 5FKAC 1JRPA 2R61A 3FAHA 1KF6B 5EE3A 2D5GA 3UI3A 1XCQL 4XWTA 5HI1A 1IUEA 5TSSA 4TQ1A 1OQRA 2JXTA 2LHEA 4OVZA 1L4DB 4A6QA 2IDYA 4RH6A 3BVZA 2BB6A 1B1ZA 1HZ5A 2M0AA 1F77A 1VR9A 2CJNA 1TS3A 2H88B 2WQYB 4ZHOA 4RCOA 3V05A 2KN4A 2V3NA 3AH7A 1I4XA 1QILA 3RPFC 2WDRB 1E6EB 1UGJA 1NVID 3AB5A 4FXCA 4P6VF 4XE0A 4C7YA 1JWMD 3P4SB 3Q8FA 3AEBB 1GB4A 1HQRD 1FMAD 1ENFA 3AECB 2DBYA 2LFIA 2SEBD 3O13A 1GAQB 1FNWA 1TKYA 1WWTA 1XCTL 3W9CB 1YMHE 1QF6A 3TSSA 1F2RC 1GPXA 2PVOD 4L23A 4HJGE 3ZJTA 1IGDA 3TEXA 1C77A 1ROEA 4WIPA 2JWUA 3R2TA 3AE3B 3H8HA 2G1EA 2WXOA 1AW7A 4AQ7A 1ZXHA 1VRAB 1EU4A 4RGOS 2PLPA 2VZKD 3EGRA 1YNTE 1TS4A 3MHZA 3BYTB 1QT9A 3BK2A 2KDMA 4RFBA 2WS3B 1TKEA 3AE1B 2L1AA 3ZGZA 1T6BX 1WYGA 1ZPSA 5EE0A 4MM3B 2GI9A 1VZ7A 2WXLA 1YJJA 1L6UA 5GXGB 5D3IB 1OQQA 4B0EA 2QMTA 1F0ZA 3VRAB 1F2RI 2LGIA 1J7AA 3IAS1 4A8XC 1FD6A 1E9MA 2H89B 2V0GA 2L52A 1D5MC 4C80A 4HEA1 5FK9C 3U52E 4DQOC 2Q5WD 2WXPA 3U2SC 1SE4A 2XN9C 2VZKB 4IKGA 1KH0A 2BYTA 1FIQA 2JSVX 2ONQA 4UDUC 1PUTA 2RMMA 1FO4A 2Y3AA 2PVGC 3GB1A 1JQ4A 3NS1A 2L83A 4REZA 4P16A 5G5GA 1D4BA 1UUPA 4H2AA 1ZXIA 1WSPA 3SFEB 4C56C 1KLGD 4WQMA 2RDGA 3Q8CA 2B76B 2AX5A 2PMVA 4YWGG 1MI0A 2W3RA 1IGCA 2OEDA 4YXDB 1NI3A 4B0MA 2X38A 2LUMA 5EE9A 2JZPA 3ZQ4A 4XDDA 2RPVA 2G9HD 5I4DA 1N63A 3AN1A 1V1OA 1D5ZC 1VDVA 1DGJA 4N58A 2J53A 1ZE3D 3LB8C 3BVMA 1ZP0B 1N5XA 1TYGB 3AE2B 3NVWA 4RGMA 2W82A 1BUIC 1BMLC 3AE9B 2WU5B 4XDCA 1FEHA 1EU3A 2WXGA 1Q10A 1L4ZB 3P42A 2V3PA 1NYQA 1YQ4B 5HHDG 2WDQB 2LEKA 2OHFA 2MJDA 2WXNA 1IBXB 1CK1A 4WURA 2DLBA 3AV8A 1JWSD 2BTEA 1SF0A 4A90A 2EKIA 2N9KA 1QKZA 2ON8A 3VR8B 5LNK1 1OFFA 3TEYA 2WP9B 2PKOA 3OWEB 4KGSA 5H92C 3MP9A 5D7GA 4ARIA 2KMMA 3LYYA 2YEPB 1WGKA 3CWIA 3VR9B 3KLSX 1KFYB 1GOZA 4GLSC 2E3TA 1RFKA 2WDVB 3IT4B 1WRIA 4HROA 4KX6B 1FNVA 4JPSA 3VRBB 3ZYYX 4WAFA 1ACCA 1XLQA 4HRSA 1I4QA 3BVGA 1MPEA 1UWMA 3HUIA 1QQRA 1ESFA 3AEDB 1VLBA 5AUIA 1V8CA 2K0PA 1V1PB 3SFDB 2DWQA 1SB3C 2KQ4X 2N0SB 3C8YA 4YSYB 4WH4A 1DOXA 2Z8LA 4LLGM 3ZJUA 3IAM1 1YN3A 3AEAB 2DYOA 3R8BA 1PGAA 2SAKA 4OZCA 4NZLB 3NRZA 1RYJA 1PGBA 2MJEA 1L0VB 3AM9A 1K51A 3IT6B 1VZ6A 3KWVA 4RGTA 1NEKB 1QOBA 1C79A 2WXKA 4HKZE 3T3NA 2WXIA 4RF0A 2EELA 4ZHPA 1R7SA 1ZOYB 2V4IB 1AYFA 5BYRA 4USAA 4WWMA 4ZYSA 2N7JA 1E0ZA 1XO3A 4OZBA 5C2TB 4TSSA 3W5VB 3TEWA 1SBBB 2CU3A 1JROA 4N59A 1VJKA 1JWUD 4ITKA 4EE2A 3DWMA 2M56B 1SEBD 3L4PA 1WXQA 2WXJA 1SE2A 5BMGA 1M4VA 1I7HA 1LO5D 3MJ5A 3DWGC 2AQ2B 3TEZA 1EWYC 1SE3A 5HFYA 1YJIA 2BS4B 2BB5A 2WXQA 3GP7A 4MACA 2NTSA 4ZOHC 1PGXA 1XF5L 4ZRPA 3Q8BA 2INPE 3P4QB 1MHXA 3GS2A 5H8YE 1TY2A 2MEKA 4GDLB 1ET6A 3HVDA 1D6EC 4LK0M 2WXHA 2CJOA 4HKQA 1N62A 2JYTA 2QEJC 1QOFA 2BW2A 1FNUA 4JWSC 5G5HA 4US9A 1JALA 4JE3B 1HEZE 1DOYA 2K22A 4GDKB 1AWDA 2WU2B 3N9YC 4YSZB 2PTLA 1FFVA 4C7ZA 2NMQA 1JMLA 3KQ4A 3T3OA 2Y5CA 1XXGA 1L0YB 3W2DA 3EUB2 5FR3A 3URYA 1YN4A 1DYQA 1V97A 2YEPF 5HG2A 1GB1A 3CIRB 5BMHA 4R3DA 4IDIA 4KGRA 3PZ7A 1AN8A 1BXTA 1J7CA 1I4RA 4NAWB 1FFUA 1C9FA 4ZRQA 1RWSA 1C4CA 1N5WA 1I4GA 3IXSA 4KGTA 4RNAA 2GB1A 2INNE 3PO0A 2BS2B 1P7EA 1ET9A 1KTKA 3B2FA 1JW9D 3NUHB 1NENB 3J9CA 3AE4B 5BYSA 3E56A 1TS2A 4CQNA 1ZUD2 2HTME 2TSSA 4LTUA 1I4HA 2ZW0A 3BIID 3Q8EA 4YTPB 1DOIA 2KWDA 4NJCA 3I57A 3AE7B 3MFGA 1N61A 1Y56A 1EWCA 2XNAC 1HXYD 1FCCC 3NVZA 1L5PA 2K3UA 1ZDVA 1ZDXA 2WXFA 1QLBB 2QJLA 1SSNA 1B9RA 4YTNB 3AE6B 3AEGB 1SIJA 3FILA 4RF1A 4RGNA 4A9AA 4DXGA 2RDHA 4JX1C 3Q69A 2NTTA 4Q2JA 1E7PB 3ZJVA 3NVVA 2WXMA 4US8A 4N6EB 1L0XB 2N9LA 4L2YA 2IPKD 2W55A 1C76A 2FE8A 2FUG1 3BZDB 1D5XC 5T8IA 3B2GA 3HVZA 3RFZB 2FBWB 4OZAA 3PZ8A 1C78A 1PYWD 1RM6C 2AQ1B 4L1BA 1YN5A 2ICIA 2K9XA 1FXAA 5EE1A 4OW0A 3SEBA 1FCLA 1C4PA 1FM0D 2KAJA 4KKIA 1MVKA 2W3SA 3SR6A 3TUOA 4TMAB 1JCKB 3AEFB 1E10A 2DYMA 1UWXA 1I4PA 2ACZB 1JWBD 1YQ3B 2MH7A 1J7BA 2QSDA 1XEEA 2BS3B 4TQ0A 3ABVB 2JYEA 2L32A 2WNMA 2IJ0A 3BWUD 2JQRB 4PT5A 2BBCA 2WLBA 3AEEB 3HRDD 2J4XA 3Q8AA 2ZW1A 1FRDA 2LMCA 1TKGA 1K52A 4YSXB 2GRIA 1EM7A 2LJIA 3AE8B 4NAMA 5E6JA 2K5PA 3BYYB 2MJ3A 4YTMB 5MPOA 5BMIA 2JX5A 1UNSA 1VZ8A 2KACA 3NVYA 3P4PB 2HDEA 5C3JB 3FILB 4KKJA 2BT6A 4IOIE 3AMZA 1TJEA 3VQIA 3WCQA 2I38A 1QOAA 1C4AA 1SXTA 3B9JA 1A70A 1CZPA 3LXFA 1PFDA 1T3QA 4XWWA 3EA6A 1TS5A 1MHHE 4A55A 4MH8A 1TY0A 2IGGA 2E6XA 3U7ZA 1IBXA 5BYQA 1K50A 2QIEB 4M0WA 5AUKA 1PDXA 3KWLA 1NYRA 2Y5PA 2W54A 1KRHA 2J42A 3AE5B 3W5UB 1T5XD 2PW9A 2PIAA 3BK1A 1P7FA 1FXIA 3U4EG 1CQVA 2J52A 2QILA 1N60A 1L6VA 2M19A 2AQ3B 2IGHA 3E9SA 2I2YA 4ARCA 4AS1A 3R2IA 4D2KA 1KLUD 1XLPA 3I9V1 2LHDA 3NZ3A 4J3OD 3V3XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HKZ E;  2EEL A;  1KH0 A;  4IKG A;  2JSV X;  2ONQ A;  5JXV A;  2N9L A;  2RMM A;  3GB1 A;  2N7J A;  2JU6 X;  1D4B A;  2IGD A;  4OZA A;  4OZB A;  1HZ6 A;  1FCL A;  1K53 A;  1MI0 A;  1MVK A;  1IGC A;  2OED A;  5BMG A;  3UI3 A;  2LUM A;  1XCQ L;  2JZP A;  5HI1 A;  1UWX A;  2JXT A;  2LHE A;  2RPV A;  2QSD A;  5HFY A;  1HZ5 A;  2J53 A;  4MAC A;  1PGX A;  1XF5 L;  1MHX A;  2KN4 A;  2ZW1 A;  1Q10 A;  1K52 A;  1EM7 A;  5HHD G;  1HEZ E;  1GB4 A;  5BMI A;  2KAC A;  1IBX B;  3FIL B;  2PTL A;  1XCT L;  4IOI E;  2NMQ A;  1JML A;  2I38 A;  1YMH E;  2N9K A;  1QKZ A;  2ON8 A;  1F2R C;  4HJG E;  1IGD A;  4KGS A;  5HG2 A;  3MP9 A;  1GB1 A;  5BMH A;  2JWU A;  4KGR A;  1ZXH A;  1C9F A;  1MHH E;  2PLP A;  1YNT E;  2IGG A;  4GLS C;  1IBX A;  4KGT A;  2GB1 A;  1K50 A;  2KDM A;  1P7E A;  1MPE A;  2K0P A;  2KQ4 X;  2PW9 A;  2GI9 A;  4WH4 A;  2ZW0 A;  1P7F A;  2J52 A;  2KWD A;  2QMT A;  2IGH A;  1F2R I;  2LGI A;  2I2Y A;  4D2K A;  1FD6 A;  1PGA A;  4OZC A;  1FCC C;  1PGB A;  2LHD A;  1K51 A;  3FIL A;  3V3X A; 
#chains in the Genus database with same CATH topology
 4W9G A;  2VH1 A;  2WXR A;  3TBL D;  3QAQ A;  1PQS A;  4ACF A;  4HK2 A;  1CJE A;  2C5L C;  1GC7 A;  2KQS A;  2MRP A;  1HA5 A;  4MEL A;  3ETR A;  1MFW A;  1HZ6 A;  1SJH D;  1K53 A;  2ZZP B;  4LCD E;  2D5G A;  2HJ1 A;  1XCQ L;  5TSS A;  1OQR A;  4A6Q A;  3APF A;  3ZVV A;  2M0A A;  4AWJ A;  2CJN A;  1R4M B;  3MHS D;  1ZKH A;  2V3N A;  2WDR B;  5E6P A;  2M8S A;  3P4S B;  3AEB B;  1GB4 A;  1ENF A;  2JY6 A;  2LFI A;  1MJD A;  3O13 A;  3ZLZ A;  5IKC M;  3Q3J A;  1NI2 A;  2PVO D;  3PSE B;  3RYT A;  4KDL B;  5D6J B;  1ROE A;  3WAP A;  2JWU A;  3GZN B;  4K7U A;  3R2T A;  3AE3 B;  1AW7 A;  4AQ7 A;  3NS8 A;  4XC2 A;  1EU4 A;  1UGM A;  2PLP A;  1TS4 A;  5LLI A;  3FKY A;  4HPL B;  3BYT B;  3BK2 A;  2KKC A;  4WAA A;  2WS3 B;  2NR2 A;  2VH2 A;  3AE1 B;  2L1A A;  3ZGZ A;  1WYG A;  1ZW7 A;  2WXL A;  5CHW A;  3ZNG C;  5GXG B;  2G4S A;  4B0E A;  5CTR C;  3VRA B;  3IAS 1;  4II3 B;  2CHZ A;  4HWI B;  3A9K A;  2L52 A;  4IC7 B;  2LRW A;  2GLS A;  4HEA 1;  1V80 A;  2KHW B;  5FK9 C;  1KLV A;  3U2S C;  1SE4 A;  2VZK B;  4J6I A;  2ONQ A;  1PUT A;  2Y5B B;  2PVG C;  3RMK C;  3MJW A;  4EKU A;  4H2A A;  1WZ3 A;  4C56 C;  4WQM A;  1F52 A;  3Q8C A;  2K1F A;  3LDZ E;  1WMH B;  1WZ0 A;  4YXD B;  2RPV A;  4W9D A;  5I4D A;  4FJY A;  5J17 A;  3AN1 A;  1D5Z C;  4MGI E;  4N58 A;  4K3C A;  1TYG B;  3AE2 B;  3NVW A;  1BUI C;  1EUV B;  3GE8 C;  2KLC A;  1WR6 E;  2BPS A;  2KDB A;  2WXG A;  2LXC A;  1Q10 A;  2WDT B;  2V3P A;  5GMV A;  5HHD G;  2WDQ B;  2N1W A;  3H1U A;  3DVN U;  3R7Q A;  1JWS D;  3DBR B;  1TZ1 A;  1N6Z A;  4ICV A;  2KMA A;  4P1B C;  2ON8 A;  1OFF A;  1J0G A;  5H92 C;  2V3S A;  4PK1 A;  2O2V B;  4ZYN A;  4ICU A;  1WGK A;  3QJZ A;  4W9L A;  1HTQ A;  3VR9 B;  2FAZ A;  3A1Q B;  4AUQ C;  3V61 A;  1WRI A;  4HRO A;  1Q1O A;  1XLQ A;  4HRS A;  1EF1 A;  1FXT B;  1UWM A;  3HUI A;  1ESF A;  1V1P B;  2KJ6 A;  3C8Y A;  4YSY B;  2RD0 A;  1UD7 A;  2LUE A;  1YN3 A;  4W9E A;  4ZRK A;  2DYO A;  4ASW C;  1PGA A;  2SAK A;  4NPN A;  1PGB A;  4DK5 A;  2LZ6 A;  1NEK B;  1QOB A;  4HCP B;  4HKZ E;  3T3N A;  3ZDT A;  1WY8 A;  3VAW A;  4CHK A;  1ZOY B;  4EOY A;  5BYR A;  2AYO B;  4OZB A;  4DHZ B;  5KHO A;  2MQJ A;  4W9F A;  4NAW A;  1VJK A;  1JWU D;  4IWO A;  1TGZ B;  3L4P A;  5BMG A;  1WX8 A;  1M4V A;  3C19 A;  1E5W A;  2L05 A;  2N7D A;  3MJ5 A;  4M8N A;  2AQ2 B;  4C00 A;  3GP7 A;  2WXQ A;  1VCB A;  1MHX A;  1OGW A;  3S2A A;  1LFD A;  2MEK A;  4GDL B;  3QWZ B;  2CJO A;  2JYT A;  1QOF A;  5G5H A;  1JAL A;  4JE3 B;  2A5U A;  1R4N I;  3W1Y A;  4NQK E;  1V9J A;  1RFA A;  5FR3 A;  2KYW A;  2KLG A;  2D3C A;  4RM8 A;  4BVU C;  2JZ3 B;  5HKH A;  4KGR A;  3VFK A;  1J19 A;  1BXT A;  2ZPN A;  3PVL A;  1L7Y A;  2I1K A;  1C9F A;  4ZRQ A;  3ENE A;  1C4C A;  1WH3 A;  2DEN B;  2J0J A;  3AU4 A;  4RNA A;  2ZNV B;  2INN E;  2LGD A;  3L16 A;  1KTK A;  5FR6 A;  3J9C A;  3ZNH B;  2LVP A;  3E56 A;  3RN9 C;  1UBQ A;  4CQN A;  2KFK A;  4IM3 A;  3DQV A;  3JVZ X;  2ZW0 A;  4WJP A;  3PZD A;  4YTP B;  1DOI A;  4NJC A;  3I57 A;  3AE7 B;  3RUL A;  2MSE D;  2XK5 B;  3DBS A;  3NVZ A;  2CKH B;  2ZEQ A;  1SSN A;  4YTN B;  1SIJ A;  4RF1 A;  2RDH A;  4GGQ A;  1WJU A;  1HE8 A;  4JX1 C;  3QC8 B;  4WJQ A;  4DBG A;  3OLM D;  4Q2J A;  2L8J A;  3ONS A;  2FUG 1;  3RFZ B;  2BYV E;  1C78 A;  1PYW D;  4FAD A;  4IW0 A;  3ML8 A;  1NDD A;  2IZV B;  3TIX A;  3WAN A;  1FCL A;  1FM0 D;  3VUW A;  1TT5 B;  4CYE A;  4TMA B;  4I6L B;  3M62 B;  2ACZ B;  1J7B A;  2ZCC A;  2QSD A;  2J0M A;  3ABV B;  2JYE A;  3LJ3 A;  2N7E A;  1F1H A;  2JQR B;  4RM9 A;  2Z59 B;  2BBC A;  2WLB A;  3AEE B;  5AEK B;  3HRD D;  4G11 A;  3Q8A A;  3VUX A;  1FRD A;  2LMC A;  3PT2 B;  4NAM A;  1MG4 A;  2K5P A;  3BYY B;  3I5J C;  1UNS A;  2DHZ A;  4LJP B;  3RUI B;  2NPT A;  3VQI A;  2UU7 A;  1QOA A;  2DZM A;  2MA9 B;  3QK0 A;  4DXA B;  1GC6 A;  1Q5W B;  3EA6 A;  1TS5 A;  1MHH E;  2K6Q A;  4MH8 A;  2IGG A;  2MP2 A;  4K1R B;  3WAM A;  5AUK A;  2BYF A;  3VH4 B;  3P2B A;  4BZA A;  3VTV A;  4HLE A;  2PIA A;  3U4E G;  5IA7 A;  5JZE B;  1CQV A;  2QIL A;  2M19 A;  2M4N A;  3SD5 A;  2AQ3 B;  3E9S A;  5AZH A;  4ARC A;  3R2I A;  4D2K A;  5TR5 A;  4PS7 A;  1XLP A;  2LHD A;  3NZ3 A;  4J3O D;  3V3X A;  2KD0 A;  4WWN A;  3KUC B;  2IO3 B;  1FRR A;  5D2M B;  1QOG A;  3D32 A;  2IGD A;  2MBQ A;  2OJW A;  1SJE D;  2JRH A;  1JWA D;  1WM2 A;  3QCA A;  1WGG A;  2LVO A;  3DBL I;  3PHX B;  4N9F 4;  5FKA C;  2R61 A;  2X8X X;  5EE3 A;  3UI3 A;  5HI1 A;  1IUE A;  4TQ1 A;  2JXT A;  2KJR A;  1L4D B;  1UBI A;  2D3G A;  2BQQ A;  4XGA B;  4BBN F;  1HZ5 A;  4MM3 A;  1TS3 A;  2WQY B;  2ZJD A;  3DHH C;  1WM3 A;  2AWT A;  3V05 A;  4W9K A;  1D3Z A;  1QIL A;  1GNU A;  2ZVN A;  3EC8 A;  1NVI D;  4XE0 A;  1JWM D;  4W9J A;  1K8R B;  1FMA D;  5JHA A;  3RT3 B;  1FNW A;  1S3S G;  2KDI A;  1WWT A;  3W9C B;  2KXJ A;  3TSS A;  1R4N B;  1F2R C;  3A9J A;  1GPX A;  2IO2 B;  4GN1 A;  3H9D A;  2YLM A;  2WXO A;  3Q3F A;  1ZXH A;  4RGO S;  3EGR A;  3CSF A;  4GIV A;  1QT9 A;  4RFB A;  2KDM A;  4BKS A;  4IM2 A;  1AAR A;  1T6B X;  1ZGU B;  3HK0 A;  2AL3 A;  2GI9 A;  1L6U A;  1F0Z A;  2QMT A;  1F2R I;  1J7A A;  5CX3 A;  1WI0 A;  1SE9 A;  5CHF A;  3WA0 A;  2MWS B;  4C80 A;  3EFC A;  2XN9 C;  1CMX B;  4IKG A;  1KH0 A;  4ANU A;  4DDI D;  2JSV X;  4UDU C;  1WGR A;  4HXD A;  2Y3A A;  3GB1 A;  3NS1 A;  2L83 A;  5G5G A;  4LNO A;  1UUP A;  1G6J A;  3SFE B;  2AX5 A;  2PMV A;  3M63 B;  1WF9 A;  2FCQ A;  5E6O A;  2OED A;  1NI3 A;  1WGD A;  5EE9 A;  5BO4 B;  3ZQ4 A;  4EFO A;  4XDD A;  2G9H D;  1V2Y A;  1DGJ A;  2J53 A;  4MH0 E;  1N5X A;  4C4V A;  2J7Q B;  4LDT D;  1BML C;  4XDC A;  2WU5 B;  1T0Y A;  2WYQ A;  1YQ4 B;  3VTW A;  2LEK A;  3A9K B;  2B3A A;  1IBX B;  4WUR A;  2M17 A;  1SF0 A;  3ZXV A;  2PKO A;  4HVB A;  3ZTC A;  3MP9 A;  4ARI A;  2HE7 A;  2YEP B;  3ZUN A;  2N9E B;  2K6D B;  3CWI A;  3IHP C;  1YOV B;  2E3T A;  4JPS A;  2YVC A;  1FNV A;  1YJ1 A;  3PHW B;  1MPE A;  2REX A;  4LNF A;  1V8C A;  2K0P A;  3OJ4 B;  3PGE A;  4LLG M;  2KZR A;  3AEA B;  3R8B A;  2BKR B;  1RYJ A;  1TBE A;  2MJE A;  2GBJ A;  3H7P A;  3KUZ A;  1A5R A;  1K51 A;  5LXI B;  4RGT A;  4FHK A;  3KW5 B;  3NJT A;  1ISN A;  2V4I B;  1AYF A;  4USA A;  2ASQ A;  4WWM A;  5J2R A;  2PPH A;  3H7S A;  3NG0 A;  5DPR A;  2V1Y A;  2IYD B;  3W5V B;  1SBB B;  3HM6 X;  4ITK A;  3NY5 A;  1SEB D;  4PYZ A;  1YD8 U;  2C7N B;  1I7H A;  3OAW A;  3TEZ A;  3DBL B;  5HFY A;  2BWF A;  2A4Z A;  3MC9 A;  4MAC A;  1PGX A;  1XF5 L;  4ZRP A;  3P4Q B;  2JXX A;  3EEC A;  2LI5 A;  3HVD A;  1D6E C;  5L95 C;  3PLV A;  4IWQ A;  1N62 A;  3UQB A;  2FUH B;  4JWS C;  4DHZ E;  4US9 A;  2EKE C;  1HEZ E;  2L0F A;  2QDF A;  4LNN A;  1DOY A;  4LNI A;  1AWD A;  4YSZ B;  1FFV A;  2N9X A;  4C7Z A;  2NMQ A;  1JML A;  3KQ4 A;  4HPM B;  2IY1 B;  3R7R A;  2V9H A;  5HG2 A;  3L13 A;  2CU1 A;  3KVF B;  5BMH A;  3CMM B;  1I4R A;  4NAW B;  1FFU A;  4B6W A;  3RNE C;  4G3X B;  3PO0 A;  1P7E A;  3B2F A;  3N1Z C;  4KSK C;  1NEN B;  2WGS A;  3MC8 A;  4JIO U;  3X0W A;  1ZUD 2;  3L54 A;  2TSS A;  4MJS B;  3SU8 X;  2M0X A;  3BII D;  3Q8E A;  4FJZ A;  4KIK A;  1OTR B;  3UGB B;  3MFG A;  4A3P A;  2XNA C;  2HJ8 A;  5D94 A;  1ZDV A;  2WX0 A;  3WAL A;  1ZDX A;  2HTH A;  3FIL A;  4HCN B;  4AOF A;  4HDQ A;  3T8M A;  3UQA A;  3B0A A;  4US8 A;  4N6E B;  4BFR A;  2RPQ A;  2OJR A;  2IPK D;  2W55 A;  1C76 A;  2FE8 A;  1NBF C;  3BZD B;  1D5X C;  4OZA A;  3RNC C;  3DDC B;  2G45 B;  1RM6 C;  4KSL C;  2ICI A;  1FXA A;  3SEB A;  1C4P A;  2KAJ A;  2KT7 A;  4KKI A;  3V6E B;  1OEY J;  3TUO A;  1T0Q C;  1JCK B;  3AEF B;  1I4P A;  4DDG D;  3IBE A;  2EMS A;  2MH7 A;  4TQ0 A;  2WNM A;  2IJ0 A;  1SIF A;  4PT5 A;  2KFK B;  4EUT A;  4OVU A;  3H6N A;  2ZW1 A;  1EM7 A;  2LJI A;  5E6J A;  1WMH A;  2MJ3 A;  2KAC A;  1VZ8 A;  3RNF C;  5C3J B;  4MDK E;  2NBW B;  4IOI E;  2I38 A;  4ANV A;  4LNK A;  1RLF A;  2KDF B;  1CZP A;  2FIF A;  3OG5 A;  1PFD A;  3PRE A;  3AU5 A;  3DVG X;  4B9K A;  2K25 A;  2LGY A;  1K50 A;  4M0W A;  5C1Z A;  1PDX A;  2LAS A;  2Y5P A;  1KRH A;  1T5X D;  2PW9 A;  2O2V A;  2KTF A;  4MSM B;  2L00 B;  2IGH A;  3A1Q A;  4AS1 A;  3B1L X;  5J18 A;  2RSU A;  3WAO A;  3R3M A;  2G3Q B;  3FC4 A;  4JWU C;  3RZF A;  2NPT B;  3ALB A;  1V1P A;  4RMA A;  4YT0 B;  3P63 A;  4MT5 A;  1STE A;  4P1C C;  3P1M A;  2N4F A;  4OHJ A;  4IUM B;  2ZVO A;  2DX5 B;  2DZK A;  3W1S A;  3P4R B;  4DXF A;  2R2O A;  4PYU A;  3FAH A;  2OOB B;  2BKF A;  2XBB C;  4XWT A;  4PS3 A;  2CHW A;  3VUY A;  2LHE A;  2IDY A;  4RH6 A;  1VR9 A;  3WIM A;  3I63 C;  2KK8 A;  4ZHO A;  1P9D U;  2MBE A;  1L2N A;  1I4X A;  3K9O B;  1M94 A;  3RPF C;  1XQQ A;  1UGJ A;  4P6V F;  1EO6 A;  1SGH A;  4C7Y A;  3TL5 A;  2LGX A;  3JSV B;  3CF6 E;  3Q8F A;  3BY4 B;  3AEC B;  2DBY A;  4MSQ B;  1LGR A;  2SEB D;  1GAQ B;  1TKY A;  4GU2 A;  1YMH E;  4HJG E;  3NZS A;  1TIF A;  4GDL A;  5DCN A;  1C77 A;  1RAX A;  2G1E A;  1WX7 A;  1YNT E;  3A4S C;  3DHG C;  2LGS A;  4KVG B;  1V81 A;  2INC C;  1TKE A;  2HD5 B;  3QHT A;  1WXA A;  3N1X C;  1ZPS A;  4MM3 B;  4E74 A;  1QZE A;  1YJJ A;  2BGF A;  2PE6 B;  4A8X C;  1FD6 A;  2CS4 A;  1E90 A;  1EF5 A;  2R2Q A;  1Y8R C;  2H89 B;  4FN2 A;  2V0G A;  2CR5 A;  3U52 E;  4DQO C;  2MX2 A;  2WXP A;  1FIQ A;  2MHJ A;  2RMM A;  3A9J B;  4KV2 A;  1FO4 A;  3APD A;  1WIA A;  4P16 A;  1D4B A;  3ZKJ C;  1ZXI A;  1WSP A;  2XK5 A;  1KLG D;  2LD9 A;  4MGZ E;  3QAR A;  4WJN A;  4EZL A;  5JH5 C;  2X38 A;  4HPP A;  3AXC A;  2GBK A;  2LRU A;  1VDV A;  1ZE3 D;  2D11 A;  4RGM A;  3Q3O C;  4WJO A;  1WGY A;  1WRD B;  5IAA C;  1EU3 A;  1LQB A;  2KDE B;  4K7S A;  1NYQ A;  2KVR A;  5IP4 D;  1KM7 A;  2NS5 A;  1CK1 A;  1WYW B;  2KTR A;  2O6V A;  1YX5 B;  2LJ5 A;  2EKI A;  2N9K A;  1QKZ A;  3VR8 B;  4II2 B;  3TEY A;  4KGS A;  1WXS A;  2L0T A;  5D7G A;  3Q6B A;  1GG3 A;  3LYY A;  3RCZ A;  2O6V D;  4ANW A;  1KFY B;  1WXV A;  4GLS C;  1RFK A;  4KX6 B;  3ZYY X;  4LDT B;  2IY0 B;  2MBH A;  1I4Q A;  3AED B;  1V5T A;  1VLB A;  4E3C A;  4BKG A;  3SFD B;  1SB3 C;  4FA6 A;  3PLU A;  4WH4 A;  4C4V B;  2Z8L A;  2KFJ A;  1GJZ A;  3IAM 1;  1OEY A;  1VD2 A;  3GOE A;  3PRM B;  4KZ0 A;  4OZC A;  5DPW A;  3NRZ A;  4GDK A;  2KWU B;  2PJH A;  1VZ6 A;  2D3B A;  4NY0 A;  2WXI A;  4RF0 A;  4GXB A;  2N7J A;  1S1Q B;  3ZTD A;  1E0Z A;  4M01 A;  3APC A;  2D2Q A;  2KWV B;  4M8M A;  5C2T B;  1GUA B;  4TSS A;  1JRO A;  3DBR I;  4N59 A;  4BKS D;  3NOB A;  4HDO A;  4EE2 A;  3DWM A;  1WXQ A;  3SDL C;  3W1S C;  2WXJ A;  1SE2 A;  1WFY A;  4B95 A;  4URK A;  4FLH A;  3ECI A;  1EWY C;  2JT4 B;  1YJI A;  2BS4 B;  2BB5 A;  3T9L A;  4XX5 A;  3Q8B A;  1P98 A;  2JPH A;  4M02 A;  4EZK A;  1ET6 A;  2MBO A;  2XEW A;  2KO3 A;  4HKQ A;  2JUO A;  2QEJ C;  2BW2 A;  4MGK E;  2K8H A;  2UYZ B;  2LWP A;  4DWF A;  3EFU A;  2KNB A;  2WU2 B;  3UF8 A;  2PTL A;  2EMT A;  4ANX A;  1XXG A;  3W2D A;  3EUB 2;  1YN4 A;  3ZO5 B;  4OVV A;  2YEP F;  1P0R A;  3CIR B;  5CHV C;  1GB1 A;  4R3D A;  4IDI A;  3ZNI D;  1AN8 A;  1WGH A;  5IN7 A;  2GMI C;  2DYB A;  4GSW A;  4K3B A;  1N5W A;  1I4G A;  3IXS A;  4KGT A;  4BAX A;  3ZNZ B;  5LXH A;  2BS2 B;  1ET9 A;  3VH3 B;  2GBR A;  3AE4 B;  5BYS A;  1BT0 A;  2HTM E;  4LTU A;  2J0K A;  2KQ7 A;  2KWD A;  2JF5 A;  2RR9 A;  1Y56 A;  2DZJ A;  3CST A;  1EWC A;  1HXY D;  1FCC C;  3RNG C;  1L5P A;  1I35 A;  2WXF A;  2QJL A;  1B9R A;  3AE6 B;  3AEG B;  4A9A A;  4ZDV A;  2L3Z A;  2DAJ A;  2NTT A;  2ZNV C;  5IO9 A;  3ZJV A;  3NVV A;  2WXM A;  3TMP B;  4MEM A;  5L83 A;  4JLC A;  4L2Y A;  1IYF A;  5T8I A;  3N30 A;  4IG7 B;  3V60 A;  4TUU A;  3PZ8 A;  2QHO A;  1YIW A;  2BF8 B;  4L1B A;  2MLB A;  1YN5 A;  2K9X A;  5EE1 A;  4OW0 A;  1E8X A;  4IM0 A;  2W3S A;  3SR6 A;  4BOS C;  1KOT A;  1Q0W B;  1E10 A;  3AI5 A;  1UWX A;  1Z2M A;  1JWB D;  2BYE A;  2UWQ A;  4DHJ B;  3L10 B;  2L32 A;  4AP4 C;  2CHX A;  3K9P B;  4KIK B;  2KAN A;  1TKG A;  1FPY A;  4K81 A;  5MPO A;  2JX5 A;  3NVY A;  5DPS A;  2IBI B;  2FNJ B;  2MBB B;  3FIL B;  1U4A A;  2BT6 A;  3Q14 C;  3EHV A;  4X57 B;  3WCQ A;  2LVQ A;  3N1Y C;  1C4A A;  1C3T A;  1E8W A;  3I3T B;  1SXT A;  2JWZ A;  3RZW C;  4JL9 A;  1A70 A;  4I6N B;  1TTN A;  2E6X A;  3U7Z A;  1IBX A;  5BYQ A;  3QA8 A;  4YL8 A;  3NZU A;  2C7M B;  2NBU A;  2QIE B;  3RNB C;  1NYR A;  2W54 A;  3Q3N C;  4FHJ A;  2NBV B;  1UZX B;  4LJO B;  2LXA A;  1N60 A;  2JZZ A;  2I2Y A;  1KLU D;  3UIO B;  2WHI A;  2KC1 A;  3DBH I;  2C7H A;  3ZIM A;  4NNJ B;  1YQB A;  4XYC A;  4FJV B;  4I6P A;  5JXV A;  2RGF A;  2DZI A;  2JU6 X;  4JGH B;  1XLN A;  1TZO A;  4O1N A;  1XLO A;  3RI7 C;  5D3D A;  4W9I A;  4DHJ D;  3MC0 B;  4AJW A;  1JRP A;  1KF6 B;  3UIN B;  3X23 A;  4M0W B;  4OVZ A;  1YX6 B;  4S17 A;  3BVZ A;  2BB6 A;  5DPT A;  1B1Z A;  1F77 A;  2H88 B;  4RCO A;  4GMV A;  2KN4 A;  3AH7 A;  2KOX A;  2D3A A;  3MTN B;  1E6E B;  3OJ3 A;  3HM3 A;  3AB5 A;  4FXC A;  4TV3 A;  3V6C B;  4IWP A;  3N32 A;  1WX9 A;  1E7V A;  1HQR D;  2QCZ A;  3BIN A;  1XCT L;  1QF6 A;  4L23 A;  3PRZ A;  2Z0E B;  1IGD A;  2AL6 A;  3N20 C;  5G2N A;  3ZJT A;  3TEX A;  2IO0 B;  4WIP A;  1LXD A;  4XZ4 A;  3H8H A;  1X1M A;  3PRP B;  4G0N B;  1VRA B;  2VZK D;  1XD3 B;  3TJP A;  3MHZ A;  4BKT A;  3VDZ A;  4PS8 A;  3DHI C;  4W9H A;  5EE0 A;  3A33 B;  4A3O A;  1WJN A;  2D07 B;  2M1M A;  1VZ7 A;  4EEW A;  1MG8 A;  1H4R A;  3KH0 A;  3M95 A;  4G50 A;  5D3I B;  1OQQ A;  3M3J A;  2LGI A;  2VRR B;  4BBN C;  1IP9 A;  3PS6 A;  3IG3 A;  1E9M A;  3L08 A;  1D5M C;  2Q5W D;  2PEA A;  4FBJ B;  2BYT A;  3IVF A;  4MJS A;  1JQ4 A;  4REZ A;  2AEH A;  4HJK A;  3V62 A;  4P7I A;  2RDG A;  3PV1 A;  2B76 B;  4F7Z A;  4YWG G;  1MI0 A;  1UH6 A;  2W3R A;  1IGC A;  2DAF A;  4B0M A;  2LUM A;  2JZP A;  4F1S A;  2GBN A;  2L7R A;  1N63 A;  3NHE B;  1V1O A;  3TCA A;  3LB8 C;  3BVM A;  1ZP0 B;  3R66 C;  2IND C;  2K8C A;  2W82 A;  3VXW A;  1E8Y A;  3AE9 B;  1WE6 A;  1FEH A;  2JRI B;  3DPD A;  1L4Z B;  3P42 A;  1H8C A;  2BWE S;  2G4D B;  2MP2 B;  2OHF A;  3QQ8 B;  2MJD A;  2WXN A;  1F9J A;  1WJ4 A;  5KHQ A;  2DLB A;  3AV8 A;  2BTE A;  4A90 A;  1Z5S B;  2ZPY A;  4WWP A;  5LNK 1;  2ZCB A;  1P1A A;  2WP9 B;  3RD2 A;  3OWE B;  5AZG A;  3JYU A;  2KMM A;  1WR1 A;  3L0W B;  3DCG A;  3KLS X;  1GOZ A;  3RNA C;  2WDV B;  3IT4 B;  2N9P C;  4GB9 A;  3VRB B;  4WAF A;  5G55 A;  3VVW B;  1E7U A;  1ACC A;  4QAY A;  2MW5 A;  3BVG A;  3IFW B;  2N1V A;  1QQR A;  5AUI A;  3ML9 A;  3KYD D;  3A4R A;  2DWQ A;  2KQ4 X;  2N0S B;  3ZW3 A;  1DOX A;  3ZJU A;  2KMC A;  4AJY B;  4CO7 A;  2RDB C;  4NZL B;  4GOC A;  1L0V B;  3AM9 A;  3IT6 B;  4WWO A;  2W9N A;  3KWV A;  1C79 A;  2WXK A;  2KTR B;  2O6V B;  4EZJ A;  3UIP B;  2EEL A;  4FUL A;  4ZHP A;  4MGY E;  1R7S A;  3DBH B;  1UEL A;  2FCS A;  1WJ6 A;  3U7D A;  4ZYS A;  4KZC A;  2NVU I;  1XO3 A;  5E6N A;  2V4L A;  4NQL B;  3TEW A;  2CU3 A;  1WE7 A;  2M56 B;  4A20 A;  4KDI C;  1R4M I;  3Q3M C;  1LO5 D;  3DWG C;  1SE3 A;  2L76 A;  2NTS A;  4ZOH C;  3Q2A C;  4E71 A;  2QC8 A;  2INP E;  3GS2 A;  5H8Y E;  1TY2 A;  3ZDM C;  2GBM A;  4LK0 M;  2WXH A;  3GE3 C;  1JRU A;  1FNU A;  3KYC D;  2K22 A;  4GDK B;  2KX0 A;  3N9Y C;  3GZN I;  3ZRC A;  4K7W A;  3T3O A;  2Y5C A;  1T0S C;  1L0Y B;  3URY A;  1DYQ A;  1V97 A;  1IPG A;  3PZ7 A;  3QX1 A;  1KJT A;  3JSV A;  1J7C A;  2I1J A;  1T0R C;  1RWS A;  2FID A;  2GOW A;  2GB1 A;  3ZXR A;  3DVN V;  1JW9 D;  2K8B A;  3NUH B;  5IOI A;  2BVC A;  1WXM A;  1TS2 A;  2KVZ A;  1I4H A;  2DNF A;  2Z0D B;  2IO1 B;  4TKN A;  1HTO A;  3VHT C;  1N61 A;  2D10 A;  1OQY A;  2KN5 A;  2KWC A;  3DVG Y;  1V86 A;  2K3U A;  1QLB B;  2FCM A;  2NCN A;  4RGN A;  4DXG A;  2JVC A;  4NJ6 A;  3N3K B;  3HHM A;  1E8Z A;  3Q69 A;  4ZRI A;  1E7P B;  1L0X B;  2C60 A;  2N9L A;  4S0R A;  3HIZ A;  3B2G A;  3HVZ A;  2FBW B;  5JHB A;  1LM8 B;  1UF0 A;  4WQO B;  2AQ1 B;  4M00 A;  3ZRF A;  1MVK A;  3SHQ A;  2WX1 A;  2DYM A;  1YQ3 B;  3PTF C;  1XEE A;  2BS3 B;  1V5O A;  2PE9 A;  2FCN A;  3BWU D;  2KX3 A;  4F8C B;  5C23 A;  3DOW A;  2J4X A;  3C0R B;  1K52 A;  4YSX B;  2GRI A;  3U30 A;  3PPA A;  2KC2 A;  3AE8 B;  4YTM B;  5BMI A;  4W9C A;  3P4P B;  2HDE A;  4BOZ B;  3VTU A;  2KJH B;  3AUL A;  4KKJ A;  3AMZ A;  1TJE A;  3O65 B;  5EDS A;  1I42 A;  3U8Z A;  3B9J A;  3LXF A;  1T3Q A;  4XWW A;  1J8C A;  3KUD B;  2C9W B;  1V6E A;  4A55 A;  1TY0 A;  3QIJ A;  3H7P B;  1RRB A;  2MCN B;  3KWL A;  1XT9 B;  2J42 A;  3AE5 B;  3JW0 X;  3W5U B;  4ZRJ A;  4NJ7 A;  2K39 A;  3BK1 A;  1P7F A;  1FXI A;  2J52 A;  1L6V A;  1C1Y B;  2WWZ A;  3B08 A;  5AZF A;  3I9V 1;  1P3Q U;  3L17 A;  1V49 A;  4JQW C; 
#chains in the Genus database with same CATH homology
 4JWU C;  3FC4 A;  2WXR A;  1V1P A;  1FRR A;  5JXV A;  4YT0 B;  3P63 A;  4MT5 A;  1STE A;  1QOG A;  2JU6 X;  1CJE A;  2IGD A;  3P1M A;  4OHJ A;  1XLN A;  3W1S A;  1SJE D;  1TZO A;  4O1N A;  1HA5 A;  3P4R B;  1JWA D;  1XLO A;  4DXF A;  3ETR A;  1HZ6 A;  5D3D A;  1SJH D;  1K53 A;  3MC0 B;  5FKA C;  1JRP A;  2R61 A;  3FAH A;  1KF6 B;  5EE3 A;  2D5G A;  3UI3 A;  1XCQ L;  4XWT A;  5HI1 A;  1IUE A;  5TSS A;  4TQ1 A;  1OQR A;  2JXT A;  2LHE A;  4OVZ A;  1L4D B;  4A6Q A;  2IDY A;  4RH6 A;  3BVZ A;  2BB6 A;  1B1Z A;  1HZ5 A;  2M0A A;  1F77 A;  1VR9 A;  2CJN A;  1TS3 A;  2H88 B;  2WQY B;  4ZHO A;  4RCO A;  3V05 A;  2KN4 A;  2V3N A;  3AH7 A;  1I4X A;  1QIL A;  3RPF C;  2WDR B;  1E6E B;  1UGJ A;  1NVI D;  3AB5 A;  4FXC A;  4P6V F;  4XE0 A;  4C7Y A;  1JWM D;  3P4S B;  3Q8F A;  3AEB B;  1GB4 A;  1HQR D;  1FMA D;  1ENF A;  3AEC B;  2DBY A;  2LFI A;  2SEB D;  3O13 A;  1GAQ B;  1FNW A;  1TKY A;  1WWT A;  1XCT L;  3W9C B;  1YMH E;  1QF6 A;  3TSS A;  1F2R C;  1GPX A;  2PVO D;  4L23 A;  4HJG E;  3ZJT A;  1IGD A;  3TEX A;  1C77 A;  1ROE A;  4WIP A;  2JWU A;  3R2T A;  3AE3 B;  3H8H A;  2G1E A;  2WXO A;  1AW7 A;  4AQ7 A;  1ZXH A;  1VRA B;  1EU4 A;  4RGO S;  2PLP A;  2VZK D;  3EGR A;  1YNT E;  1TS4 A;  3MHZ A;  3BYT B;  1QT9 A;  3BK2 A;  2KDM A;  4RFB A;  2WS3 B;  1TKE A;  3AE1 B;  2L1A A;  3ZGZ A;  1T6B X;  1WYG A;  1ZPS A;  5EE0 A;  4MM3 B;  2GI9 A;  1VZ7 A;  2WXL A;  1YJJ A;  1L6U A;  5GXG B;  5D3I B;  1OQQ A;  4B0E A;  2QMT A;  1F0Z A;  3VRA B;  1F2R I;  2LGI A;  1J7A A;  3IAS 1;  4A8X C;  1FD6 A;  1E9M A;  2H89 B;  2V0G A;  2L52 A;  1D5M C;  4C80 A;  4HEA 1;  5FK9 C;  3U52 E;  4DQO C;  2Q5W D;  2WXP A;  3U2S C;  1SE4 A;  2XN9 C;  2VZK B;  4IKG A;  1KH0 A;  2BYT A;  1FIQ A;  2JSV X;  2ONQ A;  4UDU C;  1PUT A;  2RMM A;  1FO4 A;  2Y3A A;  2PVG C;  3GB1 A;  1JQ4 A;  3NS1 A;  2L83 A;  4REZ A;  4P16 A;  5G5G A;  1D4B A;  1UUP A;  4H2A A;  1ZXI A;  1WSP A;  3SFE B;  4C56 C;  1KLG D;  4WQM A;  2RDG A;  3Q8C A;  2B76 B;  2AX5 A;  2PMV A;  4YWG G;  1MI0 A;  2W3R A;  1IGC A;  2OED A;  4YXD B;  1NI3 A;  4B0M A;  2X38 A;  2LUM A;  5EE9 A;  2JZP A;  3ZQ4 A;  4XDD A;  2RPV A;  2G9H D;  5I4D A;  1N63 A;  3AN1 A;  1V1O A;  1D5Z C;  1VDV A;  1DGJ A;  4N58 A;  2J53 A;  1ZE3 D;  3LB8 C;  3BVM A;  1ZP0 B;  1N5X A;  1TYG B;  3AE2 B;  3NVW A;  4RGM A;  2W82 A;  1BUI C;  1BML C;  3AE9 B;  2WU5 B;  4XDC A;  1FEH A;  1EU3 A;  2WXG A;  1Q10 A;  1L4Z B;  3P42 A;  2V3P A;  1NYQ A;  1YQ4 B;  5HHD G;  2WDQ B;  2LEK A;  2OHF A;  2MJD A;  2WXN A;  1IBX B;  1CK1 A;  4WUR A;  2DLB A;  3AV8 A;  1JWS D;  2BTE A;  1SF0 A;  4A90 A;  2EKI A;  2N9K A;  1QKZ A;  2ON8 A;  3VR8 B;  5LNK 1;  1OFF A;  3TEY A;  2WP9 B;  2PKO A;  3OWE B;  4KGS A;  5H92 C;  3MP9 A;  5D7G A;  4ARI A;  2KMM A;  3LYY A;  2YEP B;  1WGK A;  3CWI A;  3VR9 B;  3KLS X;  1KFY B;  1GOZ A;  4GLS C;  2E3T A;  1RFK A;  2WDV B;  3IT4 B;  1WRI A;  4HRO A;  4KX6 B;  1FNV A;  4JPS A;  3VRB B;  3ZYY X;  4WAF A;  1ACC A;  1XLQ A;  4HRS A;  1I4Q A;  3BVG A;  1MPE A;  1UWM A;  3HUI A;  1QQR A;  1ESF A;  3AED B;  1VLB A;  5AUI A;  1V8C A;  2K0P A;  1V1P B;  3SFD B;  2DWQ A;  1SB3 C;  2KQ4 X;  2N0S B;  3C8Y A;  4YSY B;  4WH4 A;  1DOX A;  2Z8L A;  4LLG M;  3ZJU A;  3IAM 1;  1YN3 A;  3AEA B;  2DYO A;  3R8B A;  1PGA A;  2SAK A;  4OZC A;  4NZL B;  3NRZ A;  1RYJ A;  1PGB A;  2MJE A;  1L0V B;  3AM9 A;  1K51 A;  3IT6 B;  1VZ6 A;  3KWV A;  4RGT A;  1NEK B;  1QOB A;  1C79 A;  2WXK A;  4HKZ E;  3T3N A;  2WXI A;  4RF0 A;  2EEL A;  4ZHP A;  1R7S A;  1ZOY B;  2V4I B;  1AYF A;  5BYR A;  4USA A;  4WWM A;  4ZYS A;  2N7J A;  1E0Z A;  1XO3 A;  4OZB A;  5C2T B;  4TSS A;  3W5V B;  3TEW A;  1SBB B;  2CU3 A;  1JRO A;  4N59 A;  1VJK A;  1JWU D;  4ITK A;  4EE2 A;  3DWM A;  2M56 B;  1SEB D;  3L4P A;  1WXQ A;  2WXJ A;  1SE2 A;  5BMG A;  1M4V A;  1I7H A;  1LO5 D;  3MJ5 A;  3DWG C;  2AQ2 B;  3TEZ A;  1EWY C;  1SE3 A;  5HFY A;  1YJI A;  2BS4 B;  2BB5 A;  2WXQ A;  3GP7 A;  4MAC A;  2NTS A;  4ZOH C;  1PGX A;  1XF5 L;  4ZRP A;  3Q8B A;  2INP E;  3P4Q B;  1MHX A;  3GS2 A;  5H8Y E;  1TY2 A;  2MEK A;  4GDL B;  1ET6 A;  3HVD A;  1D6E C;  4LK0 M;  2WXH A;  2CJO A;  4HKQ A;  1N62 A;  2JYT A;  2QEJ C;  1QOF A;  2BW2 A;  1FNU A;  4JWS C;  5G5H A;  4US9 A;  1JAL A;  4JE3 B;  1HEZ E;  1DOY A;  2K22 A;  4GDK B;  1AWD A;  2WU2 B;  3N9Y C;  4YSZ B;  2PTL A;  1FFV A;  4C7Z A;  2NMQ A;  1JML A;  3KQ4 A;  3T3O A;  2Y5C A;  1XXG A;  1L0Y B;  3W2D A;  3EUB 2;  5FR3 A;  3URY A;  1YN4 A;  1DYQ A;  1V97 A;  2YEP F;  5HG2 A;  1GB1 A;  3CIR B;  5BMH A;  4R3D A;  4IDI A;  4KGR A;  3PZ7 A;  1AN8 A;  1BXT A;  1J7C A;  1I4R A;  4NAW B;  1FFU A;  1C9F A;  4ZRQ A;  1RWS A;  1C4C A;  1N5W A;  1I4G A;  3IXS A;  4KGT A;  4RNA A;  2GB1 A;  2INN E;  3PO0 A;  2BS2 B;  1P7E A;  1ET9 A;  1KTK A;  3B2F A;  1JW9 D;  3NUH B;  1NEN B;  3J9C A;  3AE4 B;  5BYS A;  3E56 A;  1TS2 A;  4CQN A;  1ZUD 2;  2HTM E;  2TSS A;  4LTU A;  1I4H A;  2ZW0 A;  3BII D;  3Q8E A;  4YTP B;  1DOI A;  2KWD A;  4NJC A;  3I57 A;  3AE7 B;  3MFG A;  1N61 A;  1Y56 A;  1EWC A;  2XNA C;  1HXY D;  1FCC C;  3NVZ A;  1L5P A;  2K3U A;  1ZDV A;  1ZDX A;  2WXF A;  1QLB B;  2QJL A;  1SSN A;  1B9R A;  4YTN B;  3AE6 B;  3AEG B;  1SIJ A;  3FIL A;  4RF1 A;  4RGN A;  4A9A A;  4DXG A;  2RDH A;  4JX1 C;  3Q69 A;  2NTT A;  4Q2J A;  1E7P B;  3ZJV A;  3NVV A;  2WXM A;  4US8 A;  4N6E B;  1L0X B;  2N9L A;  4L2Y A;  2IPK D;  2W55 A;  1C76 A;  2FE8 A;  2FUG 1;  3BZD B;  1D5X C;  5T8I A;  3B2G A;  3HVZ A;  3RFZ B;  2FBW B;  4OZA A;  3PZ8 A;  1C78 A;  1PYW D;  1RM6 C;  2AQ1 B;  4L1B A;  1YN5 A;  2ICI A;  2K9X A;  1FXA A;  5EE1 A;  4OW0 A;  3SEB A;  1FCL A;  1C4P A;  1FM0 D;  2KAJ A;  4KKI A;  1MVK A;  2W3S A;  3SR6 A;  3TUO A;  4TMA B;  1JCK B;  3AEF B;  1E10 A;  2DYM A;  1UWX A;  1I4P A;  2ACZ B;  1JWB D;  1YQ3 B;  2MH7 A;  1J7B A;  2QSD A;  1XEE A;  2BS3 B;  4TQ0 A;  3ABV B;  2JYE A;  2L32 A;  2WNM A;  2IJ0 A;  3BWU D;  2JQR B;  4PT5 A;  2BBC A;  2WLB A;  3AEE B;  3HRD D;  2J4X A;  3Q8A A;  2ZW1 A;  1FRD A;  2LMC A;  1TKG A;  1K52 A;  4YSX B;  2GRI A;  1EM7 A;  2LJI A;  3AE8 B;  4NAM A;  5E6J A;  2K5P A;  3BYY B;  2MJ3 A;  4YTM B;  5MPO A;  5BMI A;  2JX5 A;  1UNS A;  1VZ8 A;  2KAC A;  3NVY A;  3P4P B;  2HDE A;  5C3J B;  3FIL B;  4KKJ A;  2BT6 A;  4IOI E;  3AMZ A;  1TJE A;  3VQI A;  3WCQ A;  2I38 A;  1QOA A;  1C4A A;  1SXT A;  3B9J A;  1A70 A;  1CZP A;  3LXF A;  1PFD A;  1T3Q A;  4XWW A;  3EA6 A;  1TS5 A;  1MHH E;  4A55 A;  4MH8 A;  1TY0 A;  2IGG A;  2E6X A;  3U7Z A;  1IBX A;  5BYQ A;  1K50 A;  2QIE B;  4M0W A;  5AUK A;  1PDX A;  3KWL A;  1NYR A;  2Y5P A;  2W54 A;  1KRH A;  2J42 A;  3AE5 B;  3W5U B;  1T5X D;  2PW9 A;  2PIA A;  3BK1 A;  1P7F A;  1FXI A;  3U4E G;  1CQV A;  2J52 A;  2QIL A;  1N60 A;  1L6V A;  2M19 A;  2AQ3 B;  2IGH A;  3E9S A;  2I2Y A;  4ARC A;  4AS1 A;  3R2I A;  4D2K A;  1KLU D;  1XLP A;  3I9V 1;  2LHD A;  3NZ3 A;  4J3O D;  3V3X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...