1HZ5A

Crystal structures of the b1 domain of protein l from peptostreptococcus magnus, with a tyrosine to tryptophan substitution
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
72
structure length
72
Chain Sequence
b'MHHHHHHAMEEVTIKANLIFANGSTQTAEFKGTFEKATSEAYAYADTLKKDNGEWTVDVADKGYTLNIKFAG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN L
publication title Structures of the B1 domain of protein L from Peptostreptococcus magnus with a tyrosine to tryptophan substitution.
pubmed doi rcsb
source organism Finegoldia magna
molecule tags Protein binding
total genus 21
structure length 72
sequence length 72
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-01-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1hz5A00
1JMLA 1ZXHA 2JWUA 2JXTA 2PW9A 1XCTL 1IGCA 1EM7A 2KN4A 2ONQA 1KH0A 4HKZE 1GB4A 1C9FA 2N9LA 2ZW0A 2IGGA 2QMTA 4D2KA 2I38A 2JU6X 1Q10A 1PGXA 2IGHA 2N9KA 1IBXA 2ON8A 1MVKA 1QKZA 2LGIA 4MACA 4OZAA 2KWDA 5JXVA 2N7JA 1D4BA 4KGRA 1GB1A 2RPVA 2QSDA 2JZPA 2J53A 3UI3A 2IGDA 3V3XA 1P7FA 1IGDA 5HG2A 3FILB 2GI9A 3FILA 2EELA 2RMMA 1XCQL 1FCCC 1IBXB 4OZBA 2J52A 2K0PA 2JSVX 1MHXA 1HEZE 3MP9A 1YNTE 1HZ5A 1HZ6A 1F2RI 1PGAA 1F2RC 4KGTA 2KDMA 1K51A 2I2YA 2NMQA 4HJGE 1YMHE 2ZW1A 1K52A 1P7EA 5BMHA 1FCLA 4GLSC 1XF5L 2LUMA 2GB1A 2KQ4X 1MI0A 2PTLA 4WH4A 1UWXA 2LHEA 4IKGA 3GB1A 1K53A 4KGSA 1FD6A 2LHDA 1MHHE 4IOIE 5HFYA 2PLPA 5BMGA 2KACA 1K50A 5HHDG 1MPEA 4OZCA 1PGBA 5BMIA 5HI1A 2OEDA
chains in the Genus database with same CATH superfamily
1UH6A 3FKYA 4HCNB 3ZO5B 4WWNA 1N63A 2M19A 2H88B 2N9LA 1E7VA 1FPYA 4ZRPA 1Q1OA 4AJWA 4EKUA 1SE2A 2HTHA 2N4FA 5JH5C 4HCPB 3WAOA 3H9DA 5IP4D 2ON8A 4LNIA 5AZHA 2BYTA 4MJSA 1FXAA 4OZAA 4NNJB 2KWDA 3PZDA 2NPTB 4XDDA 1RM6C 2PE6B 4MGZE 2J53A 3AE2B 1L4ZB 2W55A 1SJED 2MLBA 3JSVB 4RFBA 2BS2B 1WE6A 1VZ7A 1E8ZA 2EELA 4DHZB 5I4DA 3Q8AA 4EEWA 2JSVX 4HRSA 3KUZA 2WHIA 2PPHA 2NTSA 1WWTA 2D3BA 2A5UA 4I6LB 3RZWC 2J0JA 1FIQA 1I42A 2DWQA 2D11A 2W9NA 1WR1A 2H89B 4XDCA 3K9OB 1C1YB 2KHWB 2WX0A 3IFWB 1I4HA 3DBHI 1KRHA 2GBRA 3VXWA 4IDIA 4GDLB 4ITKA 4W9FA 4K7SA 3RMKC 3U7DA 4C7ZA 4WWPA 3NVVA 4BBNF 3BK1A 3DBLB 4DBGA 2LXCA 3PTFC 3QK0A 1I4GA 1TZOA 1GAQB 2KQSA 2DAJA 1SGHA 1ET9A 1V1PA 2FCMA 3L17A 5D94A 3TSSA 4ZHOA 3AE7B 4RGTA 1E0ZA 2L83A 5G5HA 4F8CB 2NTTA 2GLSA 3KQ4A 1ISNA 2WDTB 4II2B 4CO7A 1A5RA 2BQQA 5C23A 4O1NA 4NJ7A 1IGCA 1T0YA 1VDVA 4B0EA 2V3NA 3H1UA 3ZJTA 4FJZA 2I38A 2LRUA 1V8CA 1V86A 2FE8A 2YLMA 2BB5A 2IPKD 4HPLB 2K1FA 1L5PA 4WJPA 2OOBB 2WNMA 3TJPA 4BOSC 1ESFA 2C7NB 1WX8A 4NJ6A 1C77A 2KDFB 2ZVNA 2D2QA 1PDXA 1B1ZA 1HTOA 1YQ3B 1LO5D 5HKHA 4OVUA 2SEBD 3ENEA 2FCNA 3OWEB 4JL9A 5E6PA 2ZNVC 1WM3A 3ONSA 5FK9C 4GDKB 3DHGC 3PRMB 2JZ3B 1YIWA 2ZNVB 1C76A 2EKEC 2RMMA 3RNCC 3W1SA 1JRUA 3ZDMC 1VJKA 3SR6A 2SAKA 1R4MB 3ZJUA 3B08A 3MJWA 1L7YA 3Q8FA 3VR8B 2Y5PA 4ZYSA 4MDKE 2D3AA 2BYEA 2QHOA 2M0AA 2QILA 2KDMA 3RCZA 2KX0A 4NAWB 4DXFA 2XNAC 3OLMD 3H7SA 1ZDXA 2KNBA 1VCBA 1P0RA 4XGAB 4FJYA 1AARA 4ASWC 4EUTA 2LUEA 3TL5A 4ICVA 1TTNA 3X23A 4NZLB 3L08A 3PHXB 4KKJA 4BAXA 1CQVA 1WFYA 1NYQA 4XX5A 4RM9A 3SDLC 2G1EA 1FD6A 1UUPA 3CF6E 4IG7B 4IM3A 1V1OA 4Q2JA 3VUXA 4X57B 3IBEA 3HHMA 2MQJA 4H2AA 1DOIA 4G50A 1WYWB 4WURA 3HM3A 2INNE 3K9PB 4EE2A 2NPTA 3U2SC 1WGKA 3I63C 3P42A 4J3OD 1P3QU 3TEYA 3M3JA 2HDEA 1SSNA 2EMSA 4YT0B 3KYDD 3R2IA 1V5OA 1E10A 3DBSA 2MCNB 2LRWA 1WXAA 5JXVA 3APCA 2L7RA 2O6VD 1SB3C 2KX3A 2JXXA 2DX5B 3V3XA 4GN1A 1IGDA 2LZ6A 4ANWA 1SE3A 1KLUD 1V2YA 4GDLA 2PEAA 3NZSA 2ZCBA 2D3GA 4HPPA 1HEZE 3A9KB 2KLCA 1VLBA 3AV8A 3BYYB 2ICIA 1XLQA 2WXIA 3VVWB 3VFKA 3Q8CA 3NG0A 3QA8A 3RT3B 2YEPF 4A8XC 4K3CA 3URYA 4GLSC 4LTUA 3DBLI 3PREA 5IN7A 2L0TA 1WX9A 3A4SC 1WR6E 3GB1A 3Q8BA 2FIDA 5AUIA 4US9A 1QT9A 3P4PB 1WRIA 2MWSB 1RWSA 5TSSA 4ANXA 3QARA 3IG3A 4P6VF 1DOXA 1JWAD 4F7ZA 1WRDB 2N1VA 5J18A 3HIZA 1WF9A 4TV3A 5C3JB 1C4CA 1P98A 2OEDA 1C9FA 1T3QA 1I35A 4GB9A 3MC9A 3VQIA 2JYTA 2ASQA 3X0WA 3NZUA 2QMTA 2WXOA 3M95A 3ZTDA 1JQ4A 4K1RB 1TS5A 1L0YB 2LVPA 1D3ZA 2M56B 2R2OA 3AM9A 4KZCA 2N0SB 1WXSA 5DPTA 1QKZA 4JLCA 4IWPA 3EFUA 2NBVB 5DPSA 4ANUA 1JRPA 1MG8A 2CU1A 2KN5A 4P1BC 3IXSA 4YSZB 2HJ1A 1E8YA 1R4MI 3PV1A 4GXBA 3B1LX 1UGMA 4K81A 5LXIB 2O6VB 4KV2A 3Q3MC 2K6QA 1K8RB 3TBLD 2MW5A 3EA6A 3UINB 4ZRIA 3WAMA 1DOYA 4RGNA 4YL8A 2WXHA 4NJCA 4FA6A 5TR5A 2L0FA 4C80A 3GP7A 3SFDB 1OQYA 3I3TB 1QQRA 2BBCA 3SHQA 1N5XA 1S3SG 2RD0A 3BVGA 5G55A 4DXGA 1RYJA 1ZUD2 1FCLA 1XXGA 2DZIA 2KMAA 3R7QA 1E8XA 4ZOHC 1BXTA 5IKCM 4LNKA 2G4DB 3GE3C 2B76B 4RM8A 4A9AA 4HEA1 3CMMB 3NJTA 1J19A 5HHDG 3T8MA 1MPEA 3T3NA 4YSYB 3DBRB 3RNFC 5AEKB 4LK0M 1YN4A 2PW9A 2KC1A 4W9IA 1TGZB 1EU3A 1Y56A 2WXPA 4FXCA 3V6CB 2KFJA 2KANA 3Q14C 4MELA 1WXMA 4P7IA 5JZEB 3MHSD 1N61A 4PK1A 4EZKA 3RYTA 4P1CC 3DWMA 3PRZA 1SE9A 2AYOB 3W9CB 1WJ4A 5BYSA 2HE7A 3NVZA 3M63B 3AI5A 3A9KA 1F0ZA 4JQWC 2PMVA 2LVOA 2O2VB 3O13A 5T8IA 4RH6A 1P9DU 1JROA 2FCQA 2BWES 4KKIA 3RFZB 2HJ8A 3KWLA 1TKGA 3TIXA 1LFDA 1GNUA 2D10A 3DQVA 4M02A 4OZBA 2KKCA 3AE6B 3EGRA 2WYQA 1NBFC 1MHXA 2BYFA 1MJDA 2UWQA 3AEAB 1E8WA 1AWDA 4F1SA 1GC7A 4R3DA 2PKOA 5E6JA 1Y8RC 2JZZA 1E9MA 3IVFA 2PIAA 4PS3A 3MC8A 2MRPA 3T9LA 1GOZA 1MI0A 2BT6A 4WH4A 1UWXA 4DDID 4L1BA 4NQKE 2LHDA 2LVQA 2JY6A 3ZLZA 3W5VB 1UWMA 5BMGA 1HTQA 2KACA 4KDIC 3AE1B 3KH0A 5H92C 4FULA 3UQAA 4WAAA 2CHZA 3NS1A 5AZGA 4DXAB 4G11A 3KVFB 3AULA 2KN4A 5JHAA 1BT0A 4LCDE 5DCNA 1UELA 2L76A 2GBMA 3DVGY 2L52A 2IY1B 2INDC 2O6VA 4GOCA 2IGHA 2N9KA 1CJEA 2KZRA 2Q5WD 2J4XA 1YQ4B 4GU2A 4HKQA 4OW0A 2WDRB 1FXIA 2LGIA 5D3DA 1L2NA 1YD8U 4BBNC 5J17A 3ABVB 2JZPA 1OQRA 3U8ZA 1WGGA 3BWUD 3Q2AC 3TUOA 4EFOA 1N62A 4JPSA 1XCQL 1HE8A 2WXGA 2B3AA 3AU4A 2N1WA 3AMZA 3DOWA 2KYWA 4KGTA 3DVNU 3VTWA 1YQBA 2IYDB 2WDQB 1ET6A 4HJGE 1NEKB 1K52A 2JX5A 3ZNZB 5BMHA 2KQ4X 2OHFA 1SJHD 4KGSA 2LJ5A 2VH1A 1KFYB 3DBRI 1C79A 5HFYA 4AUQC 3N3KB 1E6EB 2JRIB 2KTFA 1ZDVA 2NCNA 1KOTA 5L95C 3A4RA 3N9YC 2GBNA 4C56C 2K25A 3I9V1 1XLPA 1JMLA 2FNJB 1GJZA 1XQQA 1V6EA 5D7GA 3ZQ4A 2QCZA 1MFWA 4BKGA 2J42A 1IPGA 3U52E 2BB6A 2JU6X 3WALA 1WJNA 5KHOA 2QJLA 1SE4A 2WXMA 3BVZA 4US8A 3U30A 1JW9D 4AQ7A 4C00A 1XEEA 2MJ3A 5HG2A 3RN9C 4KVGB 3FILA 1T6BX 4KX6B 2ZPYA 3APFA 4BKSD 4M01A 3V6EB 2W54A 1HZ6A 3PO0A 2FBWB 2D3CA 2MP2B 5DPWA 5H8YE 4HJKA 3VDZA 1K51A 1JWUD 4JIOU 2ACZB 2Y5BB 3QWZB 4NPNA 4WJOA 1XF5L 2LUMA 2GB1A 2KVZA 3OJ3A 5LLIA 1HXYD 2LHEA 3EFCA 2MBOA 2E3TA 2WX1A 4RF1A 5FR6A 5LXHA 3LB8C 1EO6A 2WXNA 2KTRB 3ZW3A 2XK5B 2K39A 5FKAC 2RPQA 3NHEB 3T3OA 4IUMB 5HI1A 1JWMD 1GPXA 2MH7A 5GXGB 3RD2A 1XCTL 4PS8A 1UF0A 2KC2A 2KDEB 4HKZE 1YX5B 4N9F4 1UBIA 2AEHA 4KIKB 2YVCA 2A4ZA 2DZMA 2N9XA 2W3SA 3KYCD 1L6UA 2BWFA 3QQ8B 1C3TA 3W2DA 2DNFA 3TEWA 4L2YA 2RPVA 1WZ3A 3QAQA 3JSVA 2GI9A 1EU4A 1V97A 2ZJDA 2JVCA 2JT4B 4HK2A 2JUOA 1V9JA 4C4VB 3EC8A 3VTVA 3O65B 1FXTB 4YTNB 4YSXB 4XWTA 1P1AA 1RFAA 2LASA 3AEDB 1MG4A 1PQSA 4XE0A 1F2RC 3ZYYX 1VD2A 2N9PC 2EMTA 3E56A 2BTEA 4HLEA 1AW7A 1QOFA 1KLVA 3DVGX 4XWWA 2KQ7A 4A55A 4IKGA 1OEYJ 1M94A 1TS2A 2V0GA 4E3CA 4KSLC 1QOBA 2DENB 2FIFA 2LWPA 1E90A 3RNBC 3KUDB 3WA0A 5G2NA 4N59A 1YN3A 2VZKB 1J8CA 2GOWA 1IUEA 1S1QB 4WJQA 3A33B 1ZW7A 1L4DB 4S17A 2DHZA 3V60A 5E6OA 2V3SA 1GB4A 4L23A 4RCOA 3U4EG 4NAMA 1FMAD 1FNWA 1PGXA 2CHWA 1TIFA 1OQQA 1WH3A 3BYTB 5C1ZA 3DCGA 1TS3A 1A70A 1PFDA 2ZPNA 3VRBB 1RFKA 1PUTA 3ZNHB 5IO9A 2AQ3B 2RDGA 4ANVA 5CHFA 1XD3B 1GUAB 3RZFA 3N1ZC 1BMLC 4IC7B 4MGKE 2GRIA 1FEHA 3C0RB 2WQYB 3QJZA 4GDKA 4UDUC 2M4NA 2JQRB 2G3QB 3R66C 2HD5B 3CSFA 1L0VB 1WGHA 2MJEA 1FRDA 3RNEC 4M00A 3MP9A 4QAYA 2MSED 1WGDA 3SEBA 2K6DB 4FLHA 4PS7A 1YOVB 1F77A 3APDA 2FAZA 3BIID 1Z2MA 2X38A 1U4AA 3LDZE 4HDOA 4NAWA 1FFUA 2N9EB 4W9LA 2KTRA 2GBKA 4AS1A 2Z8LA 3AE9B 1ZP0B 4BKTA 1I7HA 2BGFA 4JE3B 2Z0DB 1FFVA 1XLOA 4ACFA 3ZUNA 5DPRA 1I4RA 2IZVB 4IWQA 4PT5A 4URKA 2AQ1B 3P1MA 3JYUA 3V05A 1I4XA 3CIRB 4A90A 3N1XC 1N6ZA 3H8HA 2RGFA 2KMCA 5E6NA 4MM3B 4CYEA 2L05A 2KFKB 3P2BA 2QIEB 3HVZA 3NY5A 2MBEA 1EM7A 3AEEB 2WXKA 2KVRA 4I6PA 1F52A 1QZEA 2PVGC 2IGGA 5GMVA 1HA5A 4B0MA 3UGBB 4DWFA 3GE8C 3ZXVA 1UBQA 3ML9A 2CS4A 4E71A 4MJSB 4C4VA 5BO4B 3HVDA 1D4BA 3ALBA 4KGRA 2RDHA 3ECIA 1HQRD 3NUHB 2N7DA 2Y3AA 4BKSA 2IO3B 3VUWA 1KLGD 4DK5A 1P7FA 3QIJA 4LDTB 5EDSA 1NDDA 4YTPB 4YXDB 2MBBB 2KD0A 2J52A 4GIVA 4DHJD 2C7HA 4FN2A 5BYQA 4DQOC 2KOXA 4II3B 4RMAA 1F2RI 1E5WA 1PGAA 3PSEB 3ZTCA 2CJNA 2KDIA 2CHXA 2X8XX 2ZW1A 2CJOA 2L3ZA 1J0GA 1SEBD 2PJHA 4M0WB 4ZHPA 3QHTA 2QC8A 2MJDA 2WXFA 4JX1C 2G9HD 2ZZPB 2WXLA 5CHWA 1V1PB 1VZ8A 1LGRA 4WWMA 4A20A 5J2RA 3MHZA 3KW5B 1UZXB 2DYOA 4BOZB 4BFRA 1T0QC 3VHTC 3TEXA 3PZ7A 2L8JA 2QEJC 3ZGZA 1WJUA 2L1AA 1PYWD 3QCAA 4BVUC 4MSMB 2ZVOA 4OVZA 1T0RC 2FUG1 4IW0A 4D2KA 3IAS1 2BKFA 3LJ3A 1RLFA 1YN5A 2MHJA 2HTME 2XEWA 4TKNA 3UIPB 3AB5A 4K7WA 2G45B 2XN9C 1TKEA 2K8BA 4M8MA 3JW0X 3R7RA 4AOFA 1QLBB 3GZNB 3L0WB 3AE4B 3W1SC 4AJYB 1VR9A 1JALA 1WXVA 3ZNID 3NOBA 1NVID 4XC2A 5D2MB 4USAA 4ARIA 1I4PA 1OTRB 2NBWB 1IYFA 3IT6B 1ZOYB 4FJVB 3ZRCA 2K0PA 2WGSA 4W9HA 2IY0B 4WQMA 2LD9A 2KJRA 4ZDVA 2NR2A 3B9JA 2W3RA 1R7SA 4DHJB 3UF8A 1ZGUB 2I2YA 4EZLA 2K3UA 2K8HA 2IJ0A 3ML8A 1WX7A 3Q3OC 4WQOB 2KFKA 2WXJA 3I57A 4TQ0A 3P63A 2V1YA 2UU7A 1WSPA 4N6EB 3LXFA 3DPDA 3Q3NC 1MHHE 2IBIB 2NS5A 1KF6B 2BS4B 4EZJA 1ZXIA 1UD7A 4ICUA 5D3IB 2BS3B 5CX3A 2KAJA 1R4NB 2D5GA 1LQBA 5MPOA 2KJHB 4FADA 3AE3B 3VAWA 4W9DA 4B9KA 3DDCB 2K22A 3B0AA 4MH8A 1OFFA 1ROEA 2V4LA 4FHJA 4XYCA 1RRBA 4WIPA 1G6JA 2L32A 3TEZA 4B6WA 4NQLB 2J7QB 1F1HA 5AUKA 1SF0A 2AX5A 1YJIA 2O2VA 2LJIA 5CTRC 2MEKA 1EWCA 4HVBA 5D6JB 3HRDD 4CQNA 3ZJVA 2K5PA 4AWJA 3MFGA 1C4PA 1D5MC 2V4IB 4M0WA 2BPSA 3OG5A 4GMVA 1NENB 2GBJA 3M62B 1JCKB 1J7CA 2FUHB 1YNTE 3V61A 2INCC 2BVCA 3P4RB 1QOAA 3PRPB 1IP9A 3RULA 3N1YC 2KLGA 3PLUA 4A6QA 1M4VA 3R2TA 3H7PB 3UQBA 4ARCA 3VTUA 4MGYE 3P4QB 4TSSA 2WDVB 2M17A 1WIAA 3PHWB 1KM7A 1K53A 2Y5CA 3N32A 2MA9B 2RDBC 3L16A 1WE7A 1NI2A 2IO2B 4K7UA 2XBBC 3KUCB 2IO0B 1FM0D 3WANA 3Q3JA 3VH4B 4ZYNA 4G3XB 3RPFC 1I4QA 1PGBA 5BMIA 4MSQB 3N20C 4PYUA 2KT7A 1ZXHA 2JXTA 3GS2A 1J7AA 2WWZA 2WXRA 2BYVE 2ONQA 2VZKD 3AXCA 2VH2A 1WGYA 4MGIE 1YX6B 1CK1A 1ZPSA 2MBHA 4ZRJA 5EE0A 3IT4B 1DGJA 3CWIA 3Q6BA 3C8YA 3GZNI 3Q69A 1TY2A 3EHVA 4YTMB 1KJTA 1QOGA 2DZJA 4C7YA 1XLNA 3ZNGC 1V80A 3ZKJC 1D6EC 2JRHA 4CHKA 2Z0EB 1EF1A 3TMPB 4IM0A 3VRAB 3VR9B 3L4PA 2YEPB 1WZ0A 3S2AA 4XZ4A 3J9CA 2VRRB 5IA7A 3WAPA 3NRZA 4EOYA 4AP4C 2ZEQA 4LJPB 2QDFA 4HXDA 4E74A 5CHVC 3PGEA 1N60A 1QF6A 2WU5B 2JWZA 3ZIMA 1ZKHA 4JWUC 4HWIB 3TCAA 1OGWA 2NBUA 3OJ4B 3B2GA 1LXDA 3PT2B 1WMHB 4YWGG 4RGMA 1LM8B 2DYBA 4FHKA 3GOEA 3MTNB 3CSTA 1TT5B 2AL6A 2BKRB 3FAHA 1R4NI 1L0XB 4OZCA 3SD5A 2OJWA 1WM2A 3RNAC 2LMCA 2L00B 2LGSA 3AEFB 2WP9B 4LLGM 1C78A 3AECB 4A3PA 3Q3FA 4WWOA 5LNK1 4WJNA 2TSSA 2ZW0A 3A9JB 2WLBA 4J6IA 5BYRA 3HUIA 5EE9A 1Q10A 1Q0WB 3Q8EA 2IO1B 3A1QB 3AEBB 3L13A 2JYEA 3AE5B 1VRAB 2QSDA 1N5WA 5G5GA 3UI3A 2IGDA 1YJJA 2CKHB 3H7PA 2K9XA 4GSWA 3PS6A 1RAXA 3BINA 1E7UA 2NVUI 2D07B 1XT9B 4LNOA 1EUVB 3EECA 3MC0B 1L6VA 1IBXB 1YJ1A 1FRRA 1TS4A 1D5XC 3VUYA 5C2TB 1SXTA 4RGOS 3UIOB 3PZ8A 1UGJA 4LDTD 3ETRA 1DYQA 2MP2A 2KMMA 4MH0E 2NMQA 3U7ZA 2REXA 2BF8B 2KDBA 1Z5SB 3BY4B 3KLSX 1EF5A 2I1JA 3RNGC 2JF5A 3AN1A 4RNAA 1STEA 1BUIC 2CU3A 2N7EA 1WYGA 2UYZB 1Q5WB 3N30A 1CZPA 3AU5A 4IM2A 1B9RA 2V9HA 1FNVA 1V5TA 2XK5A 5FR3A 3RI7C 2LI5A 2R2QA 2LGXA 2M8SA 3W5UB 1EWYC 2JWUA 2PE9A 3HK0A 1KH0A 3OAWA 3R3MA 3QX1A 3D32A 3WCQA 1AYFA 5IAAC 2MX2A 1TYGB 3AH7A 3L54A 3C19A 4KIKA 4BZAA 3BK2A 2FCSA 1H8CA 1MVKA 2LGYA 1NYRA 4MACA 5EE1A 1TJEA 4REZA 1V49A 1GB1A 1F9JA 1J7BA 1WY8A 2LEKA 3ZXRA 3PVLA 3ZDTA 1E7PB 4JWSC 3DWGC 3NS8A 1FCCC 1V81A 3QC8B 2JPHA 5EE3A 1WMHA 1WXQA 2CR5A 2INPE 3NVYA 1SIFA 4GGQA 3B2FA 2KWUB 3DVNV 2AQ2B 1C4AA 4MT5A 4PYZA 3WIMA 1XO3A 4S0RA 3ZRFA 1ENFA 4KZ0A 1TY0A 3SFEB 1SBBB 3W1YA 3KWVA 4I6NB 2E6XA 2I1KA 2PTLA 2OJRA 3V62A 4WAFA 4K3BA 2R61A 1WI0A 2KO3A 3DBHB 2M1MA 3NVWA 3SU8X 1VZ6A 4OHJA 1TZ1A 1WGRA 1GC6A 3FC4A 1NI3A 2PLPA 3H6NA 3A9JA 2IDYA 1JWSD 2C5LC 2WU2B 1K50A 2M0XA 3A1QA 4W9JA 2AWTA 2EKIA 3ZVVA 2G4SA 3IAM1 4B95A 3JVZX 4W9GA 2DAFA 3LYYA 4W9KA 2DYMA 1SIJA 3DHIC 4OVVA 2WXQA 1QILA 4TMAB 3R8BA 3RUIB 2AL3A 3I5JC 4NY0A 4G0NB 1IBXA 3AEGB 4DHZE 2RSUA 4ZRKA 3L10B 3NZ3A 4M8NA 4IWOA 2KJ6A 4HDQA 2KXJA 2DZKA 2C9WB 3DHHC 2GMIC 1WJ6A 2N7JA 1T5XD 3BZDB 2DLBA 1FNUA 1T0SC 5IOIA 2J0KA 1FO4A 4HROA 1TKYA 2C60A 4HPMB 4LJOB 3FILB 2DBYA 1JWBD 1D5ZC 3AE8B 2BW2A 4KDLB 4FBJB 2KWVB 1HZ5A 3VH3B 1UNSA 1GG3A 1ACCA 2W82A 4TQ1A 2LFIA 2MBQA 2ZCCA 2LXAA 1TBEA 3PPAA 2KWCA 3E9SA 3P4SB 3IHPC 3MJ5A 1YMHE 2J0MA 1P7EA 2LGDA 3HM6X 3EUB2 4W9EA 4N58A 4RF0A 2C7MB 1ZE3D 4ZRQA 2RR9A 4KSKC 3BVMA 4DDGD 5KHQA 4P16A 1AN8A 1CMXB 2PVOD 4LNFA 2K8CA 1OEYA 4A3OA 4IOIE 5AZFA 2Z59B 4TUUA 1H4RA 1X1MA 4W9CA 4MEMA 4LNNA 5JHBA 2KK8A 5L83A 1KTKA 3PLVA 2WS3B 4MM3A 4JGHB 2V3PA
chains in the Genus database with same CATH topology
1ZXHA 2JXTA 2PW9A 3GS2A 1J7AA 1L4DB 2WXRA 1N63A 2ONQA 1EU3A 2VZKD 2M19A 1Y56A 1GB4A 2WXPA 4FXCA 2H88B 2N9LA 4L23A 4RCOA 4ZRPA 3U4EG 1N61A 1CK1A 1SE2A 1ZPSA 4NAMA 1FMAD 1FNWA 1PGXA 3DWMA 3W9CB 1OQQA 3BYTB 5EE0A 5BYSA 3IT4B 1TS3A 2ON8A 1A70A 3NVZA 1PFDA 1DGJA 2BYTA 3CWIA 3Q69A 3C8YA 3VRBB 1RFKA 1TY2A 1FXAA 4OZAA 1F0ZA 2KWDA 2PMVA 1PUTA 3O13A 5T8IA 2AQ3B 4RH6A 2RDGA 4XDDA 4YTMB 1RM6C 2J53A 1QOGA 4C7YA 1XLNA 1JROA 1BMLC 3AE2B 1L4ZB 2GRIA 1FEHA 4KKIA 3RFZB 2W55A 2WQYB 1SJED 1D6EC 4UDUC 4RFBA 2BS2B 3KWLA 1TKGA 2JQRB 1VZ7A 2EELA 5I4DA 3Q8AA 3VRAB 4OZBA 3AE6B 2JSVX 1L0VB 3EGRA 3VR9B 1MHXA 1FRDA 2MJEA 4HRSA 3L4PA 3MP9A 2YEPB 3AEAB 2NTSA 1WWTA 3J9CA 3SEBA 1F77A 1FIQA 3NRZA 1AWDA 3BIID 2DWQA 2X38A 2H89B 4R3DA 2PKOA 1FFUA 5E6JA 4XDCA 4AS1A 1N60A 1QF6A 2WU5B 1E9MA 4JWUC 2PIAA 1I4HA 2Z8LA 1KRHA 3B2GA 3AE9B 1ZP0B 4IDIA 4GDLB 4ITKA 1I7HA 1GOZA 1MI0A 2BT6A 4WH4A 4JE3B 1UWXA 4YWGG 4RGMA 4C7ZA 1FFVA 1XLOA 4L1BA 3NVVA 3BK1A 2LHDA 1I4RA 1I4GA 1TZOA 1GAQB 3FAHA 4PT5A 2AQ1B 3W5VB 3P1MA 1ET9A 1V1PA 1I4XA 3V05A 1UWMA 5BMGA 3CIRB 3TSSA 4A90A 4ZHOA 2KACA 3AE7B 4RGTA 3H8HA 1E0ZA 1L0XB 2L83A 5G5HA 3AE1B 4OZCA 2NTTA 5H92C 3KQ4A 4MM3B 2LMCA 3NS1A 2QIEB 3AEFB 3HVZA 2WP9B 4LLGM 1C78A 4O1NA 3AECB 1IGCA 1EM7A 3AEEB 2KN4A 1VDVA 2WXKA 5LNK1 4B0EA 2V3NA 2TSSA 2ZW0A 2PVGC 2IGGA 3ZJTA 2WLBA 5BYRA 2L52A 3HUIA 2I38A 5EE9A 1HA5A 1V8CA 2FE8A 1Q10A 4B0MA 2BB5A 2IPKD 2IGHA 2N9KA 3Q8EA 1CJEA 1L5PA 2Q5WD 2WNMA 2J4XA 1ESFA 1YQ4B 4HKQA 4OW0A 1C77A 2WDRB 1FXIA 3AEBB 2LGIA 2JYEA 3AE5B 5D3DA 3HVDA 1PDXA 1B1ZA 1VRAB 1YQ3B 1D4BA 1LO5D 4KGRA 2RDHA 2QSDA 3ABVB 2SEBD 1N5WA 2JZPA 1OQRA 1HQRD 3NUHB 5G5GA 2Y3AA 3OWEB 3UI3A 2IGDA 3BWUD 1YJJA 5FK9C 1KLGD 2K9XA 4GDKB 1P7FA 1C76A 3TUOA 4YTPB 1N62A 2RMMA 4JPSA 4YXDB 3W1SA 1XCQL 1IBXB 1VJKA 1L6VA 2J52A 2SAKA 3MC0B 3SR6A 2WXGA 1FRRA 1TS4A 3ZJUA 5BYQA 1D5XC 4DQOC 3Q8FA 5C2TB 1SXTA 1F2RI 3AMZA 4RGOS 3VR8B 3PZ8A 1UGJA 1PGAA 2Y5PA 3ETRA 4ZYSA 1DYQA 4KGTA 2M0AA 2QILA 2KDMA 2KMMA 4NAWB 2CJNA 2WDQB 4DXFA 1ET6A 2XNAC 2NMQA 4HJGE 3U7ZA 2ZW1A 2CJOA 1NEKB 1ZDXA 1SEBD 1K52A 2JX5A 5BMHA 3KLSX 4ZHPA 2KQ4X 2OHFA 3AN1A 4NZLB 4RNAA 1STEA 4KKJA 1CQVA 1BUIC 1SJHD 2MJDA 1NYQA 2WXFA 4KGSA 2CU3A 4JX1C 1FD6A 2G1EA 2G9HD 1UUPA 1WYGA 2WXLA 1CZPA 1KFYB 1V1PB 1C79A 5HFYA 1V1OA 4Q2JA 1VZ8A 4WWMA 1E6EB 1B9RA 1ZDVA 1FNVA 5FR3A 3MHZA 3N9YC 4C56C 3I9V1 2DYOA 4H2AA 3W5UB 1DOIA 1XLPA 1EWYC 4WURA 1JMLA 2JWUA 2INNE 3TEXA 4EE2A 3PZ7A 2QEJC 3U2SC 3ZGZA 2L1AA 1WGKA 1PYWD 3P42A 1KH0A 5D7GA 3ZQ4A 4J3OD 4OVZA 2FUG1 2J42A 3WCQA 3TEYA 4D2KA 3IAS1 1AYFA 2HDEA 3U52E 2BB6A 1SSNA 1TYGB 2JU6X 1YN5A 3AH7A 4YT0B 3R2IA 2HTME 3BK2A 2QJLA 1E10A 3AB5A 1MVKA 1SE4A 1NYRA 2XN9C 4MACA 2WXMA 5EE1A 3BVZA 4US8A 5JXVA 1TKEA 1TJEA 4REZA 1JW9D 1GB1A 4AQ7A 1J7BA 1QLBB 1SB3C 2LEKA 3AE4B 1XEEA 2MJ3A 3V3XA 1VR9A 1E7PB 1IGDA 1JALA 5HG2A 4JWSC 3DWGC 3FILA 1NVID 1T6BX 1SE3A 4USAA 4KX6B 1I4PA 1KLUD 4ARIA 1FCCC 3IT6B 1ZOYB 2K0PA 5EE3A 1WXQA 4WQMA 1HEZE 1VLBA 3AV8A 2W54A 1HZ6A 2INPE 3NVYA 3BYYB 3PO0A 3B9JA 2ICIA 1XLQA 2FBWB 2W3RA 2WXIA 3B2FA 1R7SA 2AQ2B 1C4AA 5H8YE 4MT5A 1K51A 1XO3A 3Q8CA 1JWUD 2I2YA 2ACZB 1ENFA 1TY0A 2K3UA 1SBBB 3SFEB 2YEPF 3KWVA 2IJ0A 4A8XC 2E6XA 3URYA 4GLSC 4LTUA 1XF5L 2LUMA 2GB1A 2WXJA 2PTLA 3I57A 4TQ0A 1HXYD 4WAFA 2LHEA 3GB1A 3P63A 2R61A 2E3TA 3NVWA 3Q8BA 5AUIA 1WSPA 4N6EB 1QT9A 4US9A 3P4PB 3LXFA 1VZ6A 1WRIA 4OHJA 4RF1A 1RWSA 5TSSA 1MHHE 3FC4A 3LB8C 1NI3A 1KF6B 2BS4B 2PLPA 4P6VF 1ZXIA 1DOXA 1JWAD 2WXNA 2IDYA 1JWSD 5D3IB 2WU2B 1K50A 5FKAC 2BS3B 2KAJA 3T3OA 2D5GA 5HI1A 1C4CA 5C3JB 5MPOA 1JWMD 1GPXA 2MH7A 5GXGB 2EKIA 2OEDA 1C9FA 1XCTL 3IAM1 1T3QA 3AE3B 3LYYA 2DYMA 3VQIA 1SIJA 2JYTA 4HKZE 2QMTA 2K22A 2WXOA 2WXQA 4MH8A 1QILA 4TMAB 3R8BA 1JQ4A 1OFFA 1ROEA 1TS5A 1L0YB 4WIPA 2L32A 3TEZA 2W3SA 2M56B 3AM9A 3AEGB 1IBXA 2N0SB 3NZ3A 1L6UA 5AUKA 1QKZA 3W2DA 1SF0A 1JRPA 2AX5A 2N7JA 1T5XD 4L2YA 3TEWA 1YJIA 3BZDB 2RPVA 2DLBA 2LJIA 2MEKA 1EWCA 1FNUA 3IXSA 4YSZB 3HRDD 4CQNA 1FO4A 4HROA 1TKYA 3ZJVA 2K5PA 3FILB 2GI9A 3MFGA 2DBYA 1C4PA 1D5ZC 1EU4A 1JWBD 1V97A 1D5MC 2V4IB 3AE8B 4M0WA 3EA6A 2BW2A 1NENB 1DOYA 4RGNA 1JCKB 1J7CA 1YNTE 1HZ5A 4YTNB 1UNSA 4YSXB 2WXHA 4XWTA 1ACCA 3AEDB 3P4RB 1QOAA 2W82A 4NJCA 4TQ1A 2LFIA 1F2RC 4XE0A 3ZYYX 4A6QA 1M4VA 3R2TA 4C80A 3E9SA 3GP7A 3SFDB 4ARCA 3P4SB 3E56A 3MJ5A 1YMHE 2BTEA 1QQRA 2BBCA 1N5XA 1AW7A 1QOFA 1P7EA 3BVGA 4DXGA 4XWWA 3EUB2 1RYJA 1ZUD2 4N58A 4RF0A 3P4QB 1FCLA 1XXGA 4TSSA 1ZE3D 4ZRQA 2WDVB 4A55A 4IKGA 3BVMA 4ZOHC 1BXTA 1K53A 2Y5CA 1TS2A 4P16A 2V0GA 1AN8A 2PVOD 1QOBA 4IOIE 2B76B 4A9AA 1FM0D 4HEA1 4N59A 1YN3A 2VZKB 5HHDG 1KTKA 1MPEA 3T3NA 4YSYB 3RPFC 1I4QA 2WS3B 1IUEA 1PGBA 5BMIA 4LK0M 2V3PA 1YN4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JML A;  1ZXH A;  2JWU A;  2JXT A;  2PW9 A;  1XCT L;  1IGC A;  1EM7 A;  2KN4 A;  2ONQ A;  1KH0 A;  4HKZ E;  1GB4 A;  1C9F A;  2N9L A;  2ZW0 A;  2IGG A;  2QMT A;  4D2K A;  2I38 A;  2JU6 X;  1Q10 A;  1PGX A;  2IGH A;  2N9K A;  1IBX A;  2ON8 A;  1MVK A;  1QKZ A;  2LGI A;  4MAC A;  4OZA A;  2KWD A;  5JXV A;  2N7J A;  1D4B A;  4KGR A;  1GB1 A;  2RPV A;  2QSD A;  2JZP A;  2J53 A;  3UI3 A;  2IGD A;  3V3X A;  1P7F A;  1IGD A;  5HG2 A;  3FIL B;  2GI9 A;  3FIL A;  2EEL A;  2RMM A;  1XCQ L;  1FCC C;  1IBX B;  4OZB A;  2J52 A;  2K0P A;  2JSV X;  1MHX A;  1HEZ E;  3MP9 A;  1YNT E;  1HZ5 A;  1HZ6 A;  1F2R I;  1PGA A;  1F2R C;  4KGT A;  2KDM A;  1K51 A;  2I2Y A;  2NMQ A;  4HJG E;  1YMH E;  2ZW1 A;  1K52 A;  1P7E A;  5BMH A;  1FCL A;  4GLS C;  1XF5 L;  2LUM A;  2GB1 A;  2KQ4 X;  1MI0 A;  2PTL A;  4WH4 A;  1UWX A;  2LHE A;  4IKG A;  3GB1 A;  1K53 A;  4KGS A;  1FD6 A;  2LHD A;  1MHH E;  4IOI E;  5HFY A;  2PLP A;  5BMG A;  2KAC A;  1K50 A;  5HHD G;  1MPE A;  4OZC A;  1PGB A;  5BMI A;  5HI1 A;  2OED A; 
#chains in the Genus database with same CATH topology
 1UH6 A;  3FKY A;  4HCN B;  3ZO5 B;  4WWN A;  1N63 A;  2M19 A;  2H88 B;  2N9L A;  1E7V A;  1FPY A;  4ZRP A;  1Q1O A;  4AJW A;  4EKU A;  1SE2 A;  2HTH A;  2N4F A;  5JH5 C;  4HCP B;  3WAO A;  3H9D A;  5IP4 D;  2ON8 A;  4LNI A;  5AZH A;  2BYT A;  4MJS A;  1FXA A;  4OZA A;  4NNJ B;  2KWD A;  3PZD A;  2NPT B;  4XDD A;  1RM6 C;  2PE6 B;  4MGZ E;  2J53 A;  3AE2 B;  1L4Z B;  2W55 A;  1SJE D;  2MLB A;  3JSV B;  4RFB A;  2BS2 B;  1WE6 A;  1VZ7 A;  1E8Z A;  2EEL A;  4DHZ B;  5I4D A;  3Q8A A;  4EEW A;  2JSV X;  4HRS A;  3KUZ A;  2WHI A;  2PPH A;  2NTS A;  1WWT A;  2D3B A;  2A5U A;  4I6L B;  3RZW C;  2J0J A;  1FIQ A;  1I42 A;  2DWQ A;  2D11 A;  2W9N A;  1WR1 A;  2H89 B;  4XDC A;  3K9O B;  1C1Y B;  2KHW B;  2WX0 A;  3IFW B;  1I4H A;  3DBH I;  1KRH A;  2GBR A;  3VXW A;  4IDI A;  4GDL B;  4ITK A;  4W9F A;  4K7S A;  3RMK C;  3U7D A;  4C7Z A;  4WWP A;  3NVV A;  4BBN F;  3BK1 A;  3DBL B;  4DBG A;  2LXC A;  3PTF C;  3QK0 A;  1I4G A;  1TZO A;  1GAQ B;  2KQS A;  2DAJ A;  1SGH A;  1ET9 A;  1V1P A;  2FCM A;  3L17 A;  5D94 A;  3TSS A;  4ZHO A;  3AE7 B;  4RGT A;  1E0Z A;  2L83 A;  5G5H A;  4F8C B;  2NTT A;  2GLS A;  3KQ4 A;  1ISN A;  2WDT B;  4II2 B;  4CO7 A;  1A5R A;  2BQQ A;  5C23 A;  4O1N A;  4NJ7 A;  1IGC A;  1T0Y A;  1VDV A;  4B0E A;  2V3N A;  3H1U A;  3ZJT A;  4FJZ A;  2I38 A;  2LRU A;  1V8C A;  1V86 A;  2FE8 A;  2YLM A;  2BB5 A;  2IPK D;  4HPL B;  2K1F A;  1L5P A;  4WJP A;  2OOB B;  2WNM A;  3TJP A;  4BOS C;  1ESF A;  2C7N B;  1WX8 A;  4NJ6 A;  1C77 A;  2KDF B;  2ZVN A;  2D2Q A;  1PDX A;  1B1Z A;  1HTO A;  1YQ3 B;  1LO5 D;  5HKH A;  4OVU A;  2SEB D;  3ENE A;  2FCN A;  3OWE B;  4JL9 A;  5E6P A;  2ZNV C;  1WM3 A;  3ONS A;  5FK9 C;  4GDK B;  3DHG C;  3PRM B;  2JZ3 B;  1YIW A;  2ZNV B;  1C76 A;  2EKE C;  2RMM A;  3RNC C;  3W1S A;  1JRU A;  3ZDM C;  1VJK A;  3SR6 A;  2SAK A;  1R4M B;  3ZJU A;  3B08 A;  3MJW A;  1L7Y A;  3Q8F A;  3VR8 B;  2Y5P A;  4ZYS A;  4MDK E;  2D3A A;  2BYE A;  2QHO A;  2M0A A;  2QIL A;  2KDM A;  3RCZ A;  2KX0 A;  4NAW B;  4DXF A;  2XNA C;  3OLM D;  3H7S A;  1ZDX A;  2KNB A;  1VCB A;  1P0R A;  4XGA B;  4FJY A;  1AAR A;  4ASW C;  4EUT A;  2LUE A;  3TL5 A;  4ICV A;  1TTN A;  3X23 A;  4NZL B;  3L08 A;  3PHX B;  4KKJ A;  4BAX A;  1CQV A;  1WFY A;  1NYQ A;  4XX5 A;  4RM9 A;  3SDL C;  2G1E A;  1FD6 A;  1UUP A;  3CF6 E;  4IG7 B;  4IM3 A;  1V1O A;  4Q2J A;  3VUX A;  4X57 B;  3IBE A;  3HHM A;  2MQJ A;  4H2A A;  1DOI A;  4G50 A;  1WYW B;  4WUR A;  3HM3 A;  2INN E;  3K9P B;  4EE2 A;  2NPT A;  3U2S C;  1WGK A;  3I63 C;  3P42 A;  4J3O D;  1P3Q U;  3TEY A;  3M3J A;  2HDE A;  1SSN A;  2EMS A;  4YT0 B;  3KYD D;  3R2I A;  1V5O A;  1E10 A;  3DBS A;  2MCN B;  2LRW A;  1WXA A;  5JXV A;  3APC A;  2L7R A;  2O6V D;  1SB3 C;  2KX3 A;  2JXX A;  2DX5 B;  3V3X A;  4GN1 A;  1IGD A;  2LZ6 A;  4ANW A;  1SE3 A;  1KLU D;  1V2Y A;  4GDL A;  2PEA A;  3NZS A;  2ZCB A;  2D3G A;  4HPP A;  1HEZ E;  3A9K B;  2KLC A;  1VLB A;  3AV8 A;  3BYY B;  2ICI A;  1XLQ A;  2WXI A;  3VVW B;  3VFK A;  3Q8C A;  3NG0 A;  3QA8 A;  3RT3 B;  2YEP F;  4A8X C;  4K3C A;  3URY A;  4GLS C;  4LTU A;  3DBL I;  3PRE A;  5IN7 A;  2L0T A;  1WX9 A;  3A4S C;  1WR6 E;  3GB1 A;  3Q8B A;  2FID A;  5AUI A;  4US9 A;  1QT9 A;  3P4P B;  1WRI A;  2MWS B;  1RWS A;  5TSS A;  4ANX A;  3QAR A;  3IG3 A;  4P6V F;  1DOX A;  1JWA D;  4F7Z A;  1WRD B;  2N1V A;  5J18 A;  3HIZ A;  1WF9 A;  4TV3 A;  5C3J B;  1C4C A;  1P98 A;  2OED A;  1C9F A;  1T3Q A;  1I35 A;  4GB9 A;  3MC9 A;  3VQI A;  2JYT A;  2ASQ A;  3X0W A;  3NZU A;  2QMT A;  2WXO A;  3M95 A;  3ZTD A;  1JQ4 A;  4K1R B;  1TS5 A;  1L0Y B;  2LVP A;  1D3Z A;  2M56 B;  2R2O A;  3AM9 A;  4KZC A;  2N0S B;  1WXS A;  5DPT A;  1QKZ A;  4JLC A;  4IWP A;  3EFU A;  2NBV B;  5DPS A;  4ANU A;  1JRP A;  1MG8 A;  2CU1 A;  2KN5 A;  4P1B C;  3IXS A;  4YSZ B;  2HJ1 A;  1E8Y A;  1R4M I;  3PV1 A;  4GXB A;  3B1L X;  1UGM A;  4K81 A;  5LXI B;  2O6V B;  4KV2 A;  3Q3M C;  2K6Q A;  1K8R B;  3TBL D;  2MW5 A;  3EA6 A;  3UIN B;  4ZRI A;  3WAM A;  1DOY A;  4RGN A;  4YL8 A;  2WXH A;  4NJC A;  4FA6 A;  5TR5 A;  2L0F A;  4C80 A;  3GP7 A;  3SFD B;  1OQY A;  3I3T B;  1QQR A;  2BBC A;  3SHQ A;  1N5X A;  1S3S G;  2RD0 A;  3BVG A;  5G55 A;  4DXG A;  1RYJ A;  1ZUD 2;  1FCL A;  1XXG A;  2DZI A;  2KMA A;  3R7Q A;  1E8X A;  4ZOH C;  1BXT A;  5IKC M;  4LNK A;  2G4D B;  3GE3 C;  2B76 B;  4RM8 A;  4A9A A;  4HEA 1;  3CMM B;  3NJT A;  1J19 A;  5HHD G;  3T8M A;  1MPE A;  3T3N A;  4YSY B;  3DBR B;  3RNF C;  5AEK B;  4LK0 M;  1YN4 A;  2PW9 A;  2KC1 A;  4W9I A;  1TGZ B;  1EU3 A;  1Y56 A;  2WXP A;  4FXC A;  3V6C B;  2KFJ A;  2KAN A;  3Q14 C;  4MEL A;  1WXM A;  4P7I A;  5JZE B;  3MHS D;  1N61 A;  4PK1 A;  4EZK A;  3RYT A;  4P1C C;  3DWM A;  3PRZ A;  1SE9 A;  2AYO B;  3W9C B;  1WJ4 A;  5BYS A;  2HE7 A;  3NVZ A;  3M63 B;  3AI5 A;  3A9K A;  1F0Z A;  4JQW C;  2PMV A;  2LVO A;  2O2V B;  3O13 A;  5T8I A;  4RH6 A;  1P9D U;  1JRO A;  2FCQ A;  2BWE S;  4KKI A;  3RFZ B;  2HJ8 A;  3KWL A;  1TKG A;  3TIX A;  1LFD A;  1GNU A;  2D10 A;  3DQV A;  4M02 A;  4OZB A;  2KKC A;  3AE6 B;  3EGR A;  2WYQ A;  1NBF C;  1MHX A;  2BYF A;  1MJD A;  2UWQ A;  3AEA B;  1E8W A;  1AWD A;  4F1S A;  1GC7 A;  4R3D A;  2PKO A;  5E6J A;  1Y8R C;  2JZZ A;  1E9M A;  3IVF A;  2PIA A;  4PS3 A;  3MC8 A;  2MRP A;  3T9L A;  1GOZ A;  1MI0 A;  2BT6 A;  4WH4 A;  1UWX A;  4DDI D;  4L1B A;  4NQK E;  2LHD A;  2LVQ A;  2JY6 A;  3ZLZ A;  3W5V B;  1UWM A;  5BMG A;  1HTQ A;  2KAC A;  4KDI C;  3AE1 B;  3KH0 A;  5H92 C;  4FUL A;  3UQA A;  4WAA A;  2CHZ A;  3NS1 A;  5AZG A;  4DXA B;  4G11 A;  3KVF B;  3AUL A;  2KN4 A;  5JHA A;  1BT0 A;  4LCD E;  5DCN A;  1UEL A;  2L76 A;  2GBM A;  3DVG Y;  2L52 A;  2IY1 B;  2IND C;  2O6V A;  4GOC A;  2IGH A;  2N9K A;  1CJE A;  2KZR A;  2Q5W D;  2J4X A;  1YQ4 B;  4GU2 A;  4HKQ A;  4OW0 A;  2WDR B;  1FXI A;  2LGI A;  5D3D A;  1L2N A;  1YD8 U;  4BBN C;  5J17 A;  3ABV B;  2JZP A;  1OQR A;  3U8Z A;  1WGG A;  3BWU D;  3Q2A C;  3TUO A;  4EFO A;  1N62 A;  4JPS A;  1XCQ L;  1HE8 A;  2WXG A;  2B3A A;  3AU4 A;  2N1W A;  3AMZ A;  3DOW A;  2KYW A;  4KGT A;  3DVN U;  3VTW A;  1YQB A;  2IYD B;  2WDQ B;  1ET6 A;  4HJG E;  1NEK B;  1K52 A;  2JX5 A;  3ZNZ B;  5BMH A;  2KQ4 X;  2OHF A;  1SJH D;  4KGS A;  2LJ5 A;  2VH1 A;  1KFY B;  3DBR I;  1C79 A;  5HFY A;  4AUQ C;  3N3K B;  1E6E B;  2JRI B;  2KTF A;  1ZDV A;  2NCN A;  1KOT A;  5L95 C;  3A4R A;  3N9Y C;  2GBN A;  4C56 C;  2K25 A;  3I9V 1;  1XLP A;  1JML A;  2FNJ B;  1GJZ A;  1XQQ A;  1V6E A;  5D7G A;  3ZQ4 A;  2QCZ A;  1MFW A;  4BKG A;  2J42 A;  1IPG A;  3U52 E;  2BB6 A;  2JU6 X;  3WAL A;  1WJN A;  5KHO A;  2QJL A;  1SE4 A;  2WXM A;  3BVZ A;  4US8 A;  3U30 A;  1JW9 D;  4AQ7 A;  4C00 A;  1XEE A;  2MJ3 A;  5HG2 A;  3RN9 C;  4KVG B;  3FIL A;  1T6B X;  4KX6 B;  2ZPY A;  3APF A;  4BKS D;  4M01 A;  3V6E B;  2W54 A;  1HZ6 A;  3PO0 A;  2FBW B;  2D3C A;  2MP2 B;  5DPW A;  5H8Y E;  4HJK A;  3VDZ A;  1K51 A;  1JWU D;  4JIO U;  2ACZ B;  2Y5B B;  3QWZ B;  4NPN A;  4WJO A;  1XF5 L;  2LUM A;  2GB1 A;  2KVZ A;  3OJ3 A;  5LLI A;  1HXY D;  2LHE A;  3EFC A;  2MBO A;  2E3T A;  2WX1 A;  4RF1 A;  5FR6 A;  5LXH A;  3LB8 C;  1EO6 A;  2WXN A;  2KTR B;  3ZW3 A;  2XK5 B;  2K39 A;  5FKA C;  2RPQ A;  3NHE B;  3T3O A;  4IUM B;  5HI1 A;  1JWM D;  1GPX A;  2MH7 A;  5GXG B;  3RD2 A;  1XCT L;  4PS8 A;  1UF0 A;  2KC2 A;  2KDE B;  4HKZ E;  1YX5 B;  4N9F 4;  1UBI A;  2AEH A;  4KIK B;  2YVC A;  2A4Z A;  2DZM A;  2N9X A;  2W3S A;  3KYC D;  1L6U A;  2BWF A;  3QQ8 B;  1C3T A;  3W2D A;  2DNF A;  3TEW A;  4L2Y A;  2RPV A;  1WZ3 A;  3QAQ A;  3JSV A;  2GI9 A;  1EU4 A;  1V97 A;  2ZJD A;  2JVC A;  2JT4 B;  4HK2 A;  2JUO A;  1V9J A;  4C4V B;  3EC8 A;  3VTV A;  3O65 B;  1FXT B;  4YTN B;  4YSX B;  4XWT A;  1P1A A;  1RFA A;  2LAS A;  3AED B;  1MG4 A;  1PQS A;  4XE0 A;  1F2R C;  3ZYY X;  1VD2 A;  2N9P C;  2EMT A;  3E56 A;  2BTE A;  4HLE A;  1AW7 A;  1QOF A;  1KLV A;  3DVG X;  4XWW A;  2KQ7 A;  4A55 A;  4IKG A;  1OEY J;  1M94 A;  1TS2 A;  2V0G A;  4E3C A;  4KSL C;  1QOB A;  2DEN B;  2FIF A;  2LWP A;  1E90 A;  3RNB C;  3KUD B;  3WA0 A;  5G2N A;  4N59 A;  1YN3 A;  2VZK B;  1J8C A;  2GOW A;  1IUE A;  1S1Q B;  4WJQ A;  3A33 B;  1ZW7 A;  1L4D B;  4S17 A;  2DHZ A;  3V60 A;  5E6O A;  2V3S A;  1GB4 A;  4L23 A;  4RCO A;  3U4E G;  4NAM A;  1FMA D;  1FNW A;  1PGX A;  2CHW A;  1TIF A;  1OQQ A;  1WH3 A;  3BYT B;  5C1Z A;  3DCG A;  1TS3 A;  1A70 A;  1PFD A;  2ZPN A;  3VRB B;  1RFK A;  1PUT A;  3ZNH B;  5IO9 A;  2AQ3 B;  2RDG A;  4ANV A;  5CHF A;  1XD3 B;  1GUA B;  3RZF A;  3N1Z C;  1BML C;  4IC7 B;  4MGK E;  2GRI A;  1FEH A;  3C0R B;  2WQY B;  3QJZ A;  4GDK A;  4UDU C;  2M4N A;  2JQR B;  2G3Q B;  3R66 C;  2HD5 B;  3CSF A;  1L0V B;  1WGH A;  2MJE A;  1FRD A;  3RNE C;  4M00 A;  3MP9 A;  4QAY A;  2MSE D;  1WGD A;  3SEB A;  2K6D B;  4FLH A;  4PS7 A;  1YOV B;  1F77 A;  3APD A;  2FAZ A;  3BII D;  1Z2M A;  2X38 A;  1U4A A;  3LDZ E;  4HDO A;  4NAW A;  1FFU A;  2N9E B;  4W9L A;  2KTR A;  2GBK A;  4AS1 A;  2Z8L A;  3AE9 B;  1ZP0 B;  4BKT A;  1I7H A;  2BGF A;  4JE3 B;  2Z0D B;  1FFV A;  1XLO A;  4ACF A;  3ZUN A;  5DPR A;  1I4R A;  2IZV B;  4IWQ A;  4PT5 A;  4URK A;  2AQ1 B;  3P1M A;  3JYU A;  3V05 A;  1I4X A;  3CIR B;  4A90 A;  3N1X C;  1N6Z A;  3H8H A;  2RGF A;  2KMC A;  5E6N A;  4MM3 B;  4CYE A;  2L05 A;  2KFK B;  3P2B A;  2QIE B;  3HVZ A;  3NY5 A;  2MBE A;  1EM7 A;  3AEE B;  2WXK A;  2KVR A;  4I6P A;  1F52 A;  1QZE A;  2PVG C;  2IGG A;  5GMV A;  1HA5 A;  4B0M A;  3UGB B;  4DWF A;  3GE8 C;  3ZXV A;  1UBQ A;  3ML9 A;  2CS4 A;  4E71 A;  4MJS B;  4C4V A;  5BO4 B;  3HVD A;  1D4B A;  3ALB A;  4KGR A;  2RDH A;  3ECI A;  1HQR D;  3NUH B;  2N7D A;  2Y3A A;  4BKS A;  2IO3 B;  3VUW A;  1KLG D;  4DK5 A;  1P7F A;  3QIJ A;  4LDT B;  5EDS A;  1NDD A;  4YTP B;  4YXD B;  2MBB B;  2KD0 A;  2J52 A;  4GIV A;  4DHJ D;  2C7H A;  4FN2 A;  5BYQ A;  4DQO C;  2KOX A;  4II3 B;  4RMA A;  1F2R I;  1E5W A;  1PGA A;  3PSE B;  3ZTC A;  2CJN A;  2KDI A;  2CHX A;  2X8X X;  2ZW1 A;  2CJO A;  2L3Z A;  1J0G A;  1SEB D;  2PJH A;  4M0W B;  4ZHP A;  3QHT A;  2QC8 A;  2MJD A;  2WXF A;  4JX1 C;  2G9H D;  2ZZP B;  2WXL A;  5CHW A;  1V1P B;  1VZ8 A;  1LGR A;  4WWM A;  4A20 A;  5J2R A;  3MHZ A;  3KW5 B;  1UZX B;  2DYO A;  4BOZ B;  4BFR A;  1T0Q C;  3VHT C;  3TEX A;  3PZ7 A;  2L8J A;  2QEJ C;  3ZGZ A;  1WJU A;  2L1A A;  1PYW D;  3QCA A;  4BVU C;  4MSM B;  2ZVO A;  4OVZ A;  1T0R C;  2FUG 1;  4IW0 A;  4D2K A;  3IAS 1;  2BKF A;  3LJ3 A;  1RLF A;  1YN5 A;  2MHJ A;  2HTM E;  2XEW A;  4TKN A;  3UIP B;  3AB5 A;  4K7W A;  2G45 B;  2XN9 C;  1TKE A;  2K8B A;  4M8M A;  3JW0 X;  3R7R A;  4AOF A;  1QLB B;  3GZN B;  3L0W B;  3AE4 B;  3W1S C;  4AJY B;  1VR9 A;  1JAL A;  1WXV A;  3ZNI D;  3NOB A;  1NVI D;  4XC2 A;  5D2M B;  4USA A;  4ARI A;  1I4P A;  1OTR B;  2NBW B;  1IYF A;  3IT6 B;  1ZOY B;  4FJV B;  3ZRC A;  2K0P A;  2WGS A;  4W9H A;  2IY0 B;  4WQM A;  2LD9 A;  2KJR A;  4ZDV A;  2NR2 A;  3B9J A;  2W3R A;  1R7S A;  4DHJ B;  3UF8 A;  1ZGU B;  2I2Y A;  4EZL A;  2K3U A;  2K8H A;  2IJ0 A;  3ML8 A;  1WX7 A;  3Q3O C;  4WQO B;  2KFK A;  2WXJ A;  3I57 A;  4TQ0 A;  3P63 A;  2V1Y A;  2UU7 A;  1WSP A;  4N6E B;  3LXF A;  3DPD A;  3Q3N C;  1MHH E;  2IBI B;  2NS5 A;  1KF6 B;  2BS4 B;  4EZJ A;  1ZXI A;  1UD7 A;  4ICU A;  5D3I B;  2BS3 B;  5CX3 A;  2KAJ A;  1R4N B;  2D5G A;  1LQB A;  5MPO A;  2KJH B;  4FAD A;  3AE3 B;  3VAW A;  4W9D A;  4B9K A;  3DDC B;  2K22 A;  3B0A A;  4MH8 A;  1OFF A;  1ROE A;  2V4L A;  4FHJ A;  4XYC A;  1RRB A;  4WIP A;  1G6J A;  2L32 A;  3TEZ A;  4B6W A;  4NQL B;  2J7Q B;  1F1H A;  5AUK A;  1SF0 A;  2AX5 A;  1YJI A;  2O2V A;  2LJI A;  5CTR C;  2MEK A;  1EWC A;  4HVB A;  5D6J B;  3HRD D;  4CQN A;  3ZJV A;  2K5P A;  4AWJ A;  3MFG A;  1C4P A;  1D5M C;  2V4I B;  4M0W A;  2BPS A;  3OG5 A;  4GMV A;  1NEN B;  2GBJ A;  3M62 B;  1JCK B;  1J7C A;  2FUH B;  1YNT E;  3V61 A;  2INC C;  2BVC A;  3P4R B;  1QOA A;  3PRP B;  1IP9 A;  3RUL A;  3N1Y C;  2KLG A;  3PLU A;  4A6Q A;  1M4V A;  3R2T A;  3H7P B;  3UQB A;  4ARC A;  3VTU A;  4MGY E;  3P4Q B;  4TSS A;  2WDV B;  2M17 A;  1WIA A;  3PHW B;  1KM7 A;  1K53 A;  2Y5C A;  3N32 A;  2MA9 B;  2RDB C;  3L16 A;  1WE7 A;  1NI2 A;  2IO2 B;  4K7U A;  2XBB C;  3KUC B;  2IO0 B;  1FM0 D;  3WAN A;  3Q3J A;  3VH4 B;  4ZYN A;  4G3X B;  3RPF C;  1I4Q A;  1PGB A;  5BMI A;  4MSQ B;  3N20 C;  4PYU A;  2KT7 A;  1ZXH A;  2JXT A;  3GS2 A;  1J7A A;  2WWZ A;  2WXR A;  2BYV E;  2ONQ A;  2VZK D;  3AXC A;  2VH2 A;  1WGY A;  4MGI E;  1YX6 B;  1CK1 A;  1ZPS A;  2MBH A;  4ZRJ A;  5EE0 A;  3IT4 B;  1DGJ A;  3CWI A;  3Q6B A;  3C8Y A;  3GZN I;  3Q69 A;  1TY2 A;  3EHV A;  4YTM B;  1KJT A;  1QOG A;  2DZJ A;  4C7Y A;  1XLN A;  3ZNG C;  1V80 A;  3ZKJ C;  1D6E C;  2JRH A;  4CHK A;  2Z0E B;  1EF1 A;  3TMP B;  4IM0 A;  3VRA B;  3VR9 B;  3L4P A;  2YEP B;  1WZ0 A;  3S2A A;  4XZ4 A;  3J9C A;  2VRR B;  5IA7 A;  3WAP A;  3NRZ A;  4EOY A;  4AP4 C;  2ZEQ A;  4LJP B;  2QDF A;  4HXD A;  4E74 A;  5CHV C;  3PGE A;  1N60 A;  1QF6 A;  2WU5 B;  2JWZ A;  3ZIM A;  1ZKH A;  4JWU C;  4HWI B;  3TCA A;  1OGW A;  2NBU A;  3OJ4 B;  3B2G A;  1LXD A;  3PT2 B;  1WMH B;  4YWG G;  4RGM A;  1LM8 B;  2DYB A;  4FHK A;  3GOE A;  3MTN B;  3CST A;  1TT5 B;  2AL6 A;  2BKR B;  3FAH A;  1R4N I;  1L0X B;  4OZC A;  3SD5 A;  2OJW A;  1WM2 A;  3RNA C;  2LMC A;  2L00 B;  2LGS A;  3AEF B;  2WP9 B;  4LLG M;  1C78 A;  3AEC B;  4A3P A;  3Q3F A;  4WWO A;  5LNK 1;  4WJN A;  2TSS A;  2ZW0 A;  3A9J B;  2WLB A;  4J6I A;  5BYR A;  3HUI A;  5EE9 A;  1Q10 A;  1Q0W B;  3Q8E A;  2IO1 B;  3A1Q B;  3AEB B;  3L13 A;  2JYE A;  3AE5 B;  1VRA B;  2QSD A;  1N5W A;  5G5G A;  3UI3 A;  2IGD A;  1YJJ A;  2CKH B;  3H7P A;  2K9X A;  4GSW A;  3PS6 A;  1RAX A;  3BIN A;  1E7U A;  2NVU I;  2D07 B;  1XT9 B;  4LNO A;  1EUV B;  3EEC A;  3MC0 B;  1L6V A;  1IBX B;  1YJ1 A;  1FRR A;  1TS4 A;  1D5X C;  3VUY A;  5C2T B;  1SXT A;  4RGO S;  3UIO B;  3PZ8 A;  1UGJ A;  4LDT D;  3ETR A;  1DYQ A;  2MP2 A;  2KMM A;  4MH0 E;  2NMQ A;  3U7Z A;  2REX A;  2BF8 B;  2KDB A;  1Z5S B;  3BY4 B;  3KLS X;  1EF5 A;  2I1J A;  3RNG C;  2JF5 A;  3AN1 A;  4RNA A;  1STE A;  1BUI C;  2CU3 A;  2N7E A;  1WYG A;  2UYZ B;  1Q5W B;  3N30 A;  1CZP A;  3AU5 A;  4IM2 A;  1B9R A;  2V9H A;  1FNV A;  1V5T A;  2XK5 A;  5FR3 A;  3RI7 C;  2LI5 A;  2R2Q A;  2LGX A;  2M8S A;  3W5U B;  1EWY C;  2JWU A;  2PE9 A;  3HK0 A;  1KH0 A;  3OAW A;  3R3M A;  3QX1 A;  3D32 A;  3WCQ A;  1AYF A;  5IAA C;  2MX2 A;  1TYG B;  3AH7 A;  3L54 A;  3C19 A;  4KIK A;  4BZA A;  3BK2 A;  2FCS A;  1H8C A;  1MVK A;  2LGY A;  1NYR A;  4MAC A;  5EE1 A;  1TJE A;  4REZ A;  1V49 A;  1GB1 A;  1F9J A;  1J7B A;  1WY8 A;  2LEK A;  3ZXR A;  3PVL A;  3ZDT A;  1E7P B;  4JWS C;  3DWG C;  3NS8 A;  1FCC C;  1V81 A;  3QC8 B;  2JPH A;  5EE3 A;  1WMH A;  1WXQ A;  2CR5 A;  2INP E;  3NVY A;  1SIF A;  4GGQ A;  3B2F A;  2KWU B;  3DVN V;  2AQ2 B;  1C4A A;  4MT5 A;  4PYZ A;  3WIM A;  1XO3 A;  4S0R A;  3ZRF A;  1ENF A;  4KZ0 A;  1TY0 A;  3SFE B;  1SBB B;  3W1Y A;  3KWV A;  4I6N B;  2E6X A;  2I1K A;  2PTL A;  2OJR A;  3V62 A;  4WAF A;  4K3B A;  2R61 A;  1WI0 A;  2KO3 A;  3DBH B;  2M1M A;  3NVW A;  3SU8 X;  1VZ6 A;  4OHJ A;  1TZ1 A;  1WGR A;  1GC6 A;  3FC4 A;  1NI3 A;  2PLP A;  3H6N A;  3A9J A;  2IDY A;  1JWS D;  2C5L C;  2WU2 B;  1K50 A;  2M0X A;  3A1Q A;  4W9J A;  2AWT A;  2EKI A;  3ZVV A;  2G4S A;  3IAM 1;  4B95 A;  3JVZ X;  4W9G A;  2DAF A;  3LYY A;  4W9K A;  2DYM A;  1SIJ A;  3DHI C;  4OVV A;  2WXQ A;  1QIL A;  4TMA B;  3R8B A;  3RUI B;  2AL3 A;  3I5J C;  4NY0 A;  4G0N B;  1IBX A;  3AEG B;  4DHZ E;  2RSU A;  4ZRK A;  3L10 B;  3NZ3 A;  4M8N A;  4IWO A;  2KJ6 A;  4HDQ A;  2KXJ A;  2DZK A;  2C9W B;  3DHH C;  2GMI C;  1WJ6 A;  2N7J A;  1T5X D;  3BZD B;  2DLB A;  1FNU A;  1T0S C;  5IOI A;  2J0K A;  1FO4 A;  4HRO A;  1TKY A;  2C60 A;  4HPM B;  4LJO B;  3FIL B;  2DBY A;  1JWB D;  1D5Z C;  3AE8 B;  2BW2 A;  4KDL B;  4FBJ B;  2KWV B;  1HZ5 A;  3VH3 B;  1UNS A;  1GG3 A;  1ACC A;  2W82 A;  4TQ1 A;  2LFI A;  2MBQ A;  2ZCC A;  2LXA A;  1TBE A;  3PPA A;  2KWC A;  3E9S A;  3P4S B;  3IHP C;  3MJ5 A;  1YMH E;  2J0M A;  1P7E A;  2LGD A;  3HM6 X;  3EUB 2;  4W9E A;  4N58 A;  4RF0 A;  2C7M B;  1ZE3 D;  4ZRQ A;  2RR9 A;  4KSK C;  3BVM A;  4DDG D;  5KHQ A;  4P16 A;  1AN8 A;  1CMX B;  2PVO D;  4LNF A;  2K8C A;  1OEY A;  4A3O A;  4IOI E;  5AZF A;  2Z59 B;  4TUU A;  1H4R A;  1X1M A;  4W9C A;  4MEM A;  4LNN A;  5JHB A;  2KK8 A;  5L83 A;  1KTK A;  3PLV A;  2WS3 B;  4MM3 A;  4JGH B;  2V3P A; 
#chains in the Genus database with same CATH homology
 1ZXH A;  2JXT A;  2PW9 A;  3GS2 A;  1J7A A;  1L4D B;  2WXR A;  1N63 A;  2ONQ A;  1EU3 A;  2VZK D;  2M19 A;  1Y56 A;  1GB4 A;  2WXP A;  4FXC A;  2H88 B;  2N9L A;  4L23 A;  4RCO A;  4ZRP A;  3U4E G;  1N61 A;  1CK1 A;  1SE2 A;  1ZPS A;  4NAM A;  1FMA D;  1FNW A;  1PGX A;  3DWM A;  3W9C B;  1OQQ A;  3BYT B;  5EE0 A;  5BYS A;  3IT4 B;  1TS3 A;  2ON8 A;  1A70 A;  3NVZ A;  1PFD A;  1DGJ A;  2BYT A;  3CWI A;  3Q69 A;  3C8Y A;  3VRB B;  1RFK A;  1TY2 A;  1FXA A;  4OZA A;  1F0Z A;  2KWD A;  2PMV A;  1PUT A;  3O13 A;  5T8I A;  2AQ3 B;  4RH6 A;  2RDG A;  4XDD A;  4YTM B;  1RM6 C;  2J53 A;  1QOG A;  4C7Y A;  1XLN A;  1JRO A;  1BML C;  3AE2 B;  1L4Z B;  2GRI A;  1FEH A;  4KKI A;  3RFZ B;  2W55 A;  2WQY B;  1SJE D;  1D6E C;  4UDU C;  4RFB A;  2BS2 B;  3KWL A;  1TKG A;  2JQR B;  1VZ7 A;  2EEL A;  5I4D A;  3Q8A A;  3VRA B;  4OZB A;  3AE6 B;  2JSV X;  1L0V B;  3EGR A;  3VR9 B;  1MHX A;  1FRD A;  2MJE A;  4HRS A;  3L4P A;  3MP9 A;  2YEP B;  3AEA B;  2NTS A;  1WWT A;  3J9C A;  3SEB A;  1F77 A;  1FIQ A;  3NRZ A;  1AWD A;  3BII D;  2DWQ A;  2X38 A;  2H89 B;  4R3D A;  2PKO A;  1FFU A;  5E6J A;  4XDC A;  4AS1 A;  1N60 A;  1QF6 A;  2WU5 B;  1E9M A;  4JWU C;  2PIA A;  1I4H A;  2Z8L A;  1KRH A;  3B2G A;  3AE9 B;  1ZP0 B;  4IDI A;  4GDL B;  4ITK A;  1I7H A;  1GOZ A;  1MI0 A;  2BT6 A;  4WH4 A;  4JE3 B;  1UWX A;  4YWG G;  4RGM A;  4C7Z A;  1FFV A;  1XLO A;  4L1B A;  3NVV A;  3BK1 A;  2LHD A;  1I4R A;  1I4G A;  1TZO A;  1GAQ B;  3FAH A;  4PT5 A;  2AQ1 B;  3W5V B;  3P1M A;  1ET9 A;  1V1P A;  1I4X A;  3V05 A;  1UWM A;  5BMG A;  3CIR B;  3TSS A;  4A90 A;  4ZHO A;  2KAC A;  3AE7 B;  4RGT A;  3H8H A;  1E0Z A;  1L0X B;  2L83 A;  5G5H A;  3AE1 B;  4OZC A;  2NTT A;  5H92 C;  3KQ4 A;  4MM3 B;  2LMC A;  3NS1 A;  2QIE B;  3AEF B;  3HVZ A;  2WP9 B;  4LLG M;  1C78 A;  4O1N A;  3AEC B;  1IGC A;  1EM7 A;  3AEE B;  2KN4 A;  1VDV A;  2WXK A;  5LNK 1;  4B0E A;  2V3N A;  2TSS A;  2ZW0 A;  2PVG C;  2IGG A;  3ZJT A;  2WLB A;  5BYR A;  2L52 A;  3HUI A;  2I38 A;  5EE9 A;  1HA5 A;  1V8C A;  2FE8 A;  1Q10 A;  4B0M A;  2BB5 A;  2IPK D;  2IGH A;  2N9K A;  3Q8E A;  1CJE A;  1L5P A;  2Q5W D;  2WNM A;  2J4X A;  1ESF A;  1YQ4 B;  4HKQ A;  4OW0 A;  1C77 A;  2WDR B;  1FXI A;  3AEB B;  2LGI A;  2JYE A;  3AE5 B;  5D3D A;  3HVD A;  1PDX A;  1B1Z A;  1VRA B;  1YQ3 B;  1D4B A;  1LO5 D;  4KGR A;  2RDH A;  2QSD A;  3ABV B;  2SEB D;  1N5W A;  2JZP A;  1OQR A;  1HQR D;  3NUH B;  5G5G A;  2Y3A A;  3OWE B;  3UI3 A;  2IGD A;  3BWU D;  1YJJ A;  5FK9 C;  1KLG D;  2K9X A;  4GDK B;  1P7F A;  1C76 A;  3TUO A;  4YTP B;  1N62 A;  2RMM A;  4JPS A;  4YXD B;  3W1S A;  1XCQ L;  1IBX B;  1VJK A;  1L6V A;  2J52 A;  2SAK A;  3MC0 B;  3SR6 A;  2WXG A;  1FRR A;  1TS4 A;  3ZJU A;  5BYQ A;  1D5X C;  4DQO C;  3Q8F A;  5C2T B;  1SXT A;  1F2R I;  3AMZ A;  4RGO S;  3VR8 B;  3PZ8 A;  1UGJ A;  1PGA A;  2Y5P A;  3ETR A;  4ZYS A;  1DYQ A;  4KGT A;  2M0A A;  2QIL A;  2KDM A;  2KMM A;  4NAW B;  2CJN A;  2WDQ B;  4DXF A;  1ET6 A;  2XNA C;  2NMQ A;  4HJG E;  3U7Z A;  2ZW1 A;  2CJO A;  1NEK B;  1ZDX A;  1SEB D;  1K52 A;  2JX5 A;  5BMH A;  3KLS X;  4ZHP A;  2KQ4 X;  2OHF A;  3AN1 A;  4NZL B;  4RNA A;  1STE A;  4KKJ A;  1CQV A;  1BUI C;  1SJH D;  2MJD A;  1NYQ A;  2WXF A;  4KGS A;  2CU3 A;  4JX1 C;  1FD6 A;  2G1E A;  2G9H D;  1UUP A;  1WYG A;  2WXL A;  1CZP A;  1KFY B;  1V1P B;  1C79 A;  5HFY A;  1V1O A;  4Q2J A;  1VZ8 A;  4WWM A;  1E6E B;  1B9R A;  1ZDV A;  1FNV A;  5FR3 A;  3MHZ A;  3N9Y C;  4C56 C;  3I9V 1;  2DYO A;  4H2A A;  3W5U B;  1DOI A;  1XLP A;  1EWY C;  4WUR A;  1JML A;  2JWU A;  2INN E;  3TEX A;  4EE2 A;  3PZ7 A;  2QEJ C;  3U2S C;  3ZGZ A;  2L1A A;  1WGK A;  1PYW D;  3P42 A;  1KH0 A;  5D7G A;  3ZQ4 A;  4J3O D;  4OVZ A;  2FUG 1;  2J42 A;  3WCQ A;  3TEY A;  4D2K A;  3IAS 1;  1AYF A;  2HDE A;  3U52 E;  2BB6 A;  1SSN A;  1TYG B;  2JU6 X;  1YN5 A;  3AH7 A;  4YT0 B;  3R2I A;  2HTM E;  3BK2 A;  2QJL A;  1E10 A;  3AB5 A;  1MVK A;  1SE4 A;  1NYR A;  2XN9 C;  4MAC A;  2WXM A;  5EE1 A;  3BVZ A;  4US8 A;  5JXV A;  1TKE A;  1TJE A;  4REZ A;  1JW9 D;  1GB1 A;  4AQ7 A;  1J7B A;  1QLB B;  1SB3 C;  2LEK A;  3AE4 B;  1XEE A;  2MJ3 A;  3V3X A;  1VR9 A;  1E7P B;  1IGD A;  1JAL A;  5HG2 A;  4JWS C;  3DWG C;  3FIL A;  1NVI D;  1T6B X;  1SE3 A;  4USA A;  4KX6 B;  1I4P A;  1KLU D;  4ARI A;  1FCC C;  3IT6 B;  1ZOY B;  2K0P A;  5EE3 A;  1WXQ A;  4WQM A;  1HEZ E;  1VLB A;  3AV8 A;  2W54 A;  1HZ6 A;  2INP E;  3NVY A;  3BYY B;  3PO0 A;  3B9J A;  2ICI A;  1XLQ A;  2FBW B;  2W3R A;  2WXI A;  3B2F A;  1R7S A;  2AQ2 B;  1C4A A;  5H8Y E;  4MT5 A;  1K51 A;  1XO3 A;  3Q8C A;  1JWU D;  2I2Y A;  2ACZ B;  1ENF A;  1TY0 A;  2K3U A;  1SBB B;  3SFE B;  2YEP F;  3KWV A;  2IJ0 A;  4A8X C;  2E6X A;  3URY A;  4GLS C;  4LTU A;  1XF5 L;  2LUM A;  2GB1 A;  2WXJ A;  2PTL A;  3I57 A;  4TQ0 A;  1HXY D;  4WAF A;  2LHE A;  3GB1 A;  3P63 A;  2R61 A;  2E3T A;  3NVW A;  3Q8B A;  5AUI A;  1WSP A;  4N6E B;  1QT9 A;  4US9 A;  3P4P B;  3LXF A;  1VZ6 A;  1WRI A;  4OHJ A;  4RF1 A;  1RWS A;  5TSS A;  1MHH E;  3FC4 A;  3LB8 C;  1NI3 A;  1KF6 B;  2BS4 B;  2PLP A;  4P6V F;  1ZXI A;  1DOX A;  1JWA D;  2WXN A;  2IDY A;  1JWS D;  5D3I B;  2WU2 B;  1K50 A;  5FKA C;  2BS3 B;  2KAJ A;  3T3O A;  2D5G A;  5HI1 A;  1C4C A;  5C3J B;  5MPO A;  1JWM D;  1GPX A;  2MH7 A;  5GXG B;  2EKI A;  2OED A;  1C9F A;  1XCT L;  3IAM 1;  1T3Q A;  3AE3 B;  3LYY A;  2DYM A;  3VQI A;  1SIJ A;  2JYT A;  4HKZ E;  2QMT A;  2K22 A;  2WXO A;  2WXQ A;  4MH8 A;  1QIL A;  4TMA B;  3R8B A;  1JQ4 A;  1OFF A;  1ROE A;  1TS5 A;  1L0Y B;  4WIP A;  2L32 A;  3TEZ A;  2W3S A;  2M56 B;  3AM9 A;  3AEG B;  1IBX A;  2N0S B;  3NZ3 A;  1L6U A;  5AUK A;  1QKZ A;  3W2D A;  1SF0 A;  1JRP A;  2AX5 A;  2N7J A;  1T5X D;  4L2Y A;  3TEW A;  1YJI A;  3BZD B;  2RPV A;  2DLB A;  2LJI A;  2MEK A;  1EWC A;  1FNU A;  3IXS A;  4YSZ B;  3HRD D;  4CQN A;  1FO4 A;  4HRO A;  1TKY A;  3ZJV A;  2K5P A;  3FIL B;  2GI9 A;  3MFG A;  2DBY A;  1C4P A;  1D5Z C;  1EU4 A;  1JWB D;  1V97 A;  1D5M C;  2V4I B;  3AE8 B;  4M0W A;  3EA6 A;  2BW2 A;  1NEN B;  1DOY A;  4RGN A;  1JCK B;  1J7C A;  1YNT E;  1HZ5 A;  4YTN B;  1UNS A;  4YSX B;  2WXH A;  4XWT A;  1ACC A;  3AED B;  3P4R B;  1QOA A;  2W82 A;  4NJC A;  4TQ1 A;  2LFI A;  1F2R C;  4XE0 A;  3ZYY X;  4A6Q A;  1M4V A;  3R2T A;  4C80 A;  3E9S A;  3GP7 A;  3SFD B;  4ARC A;  3P4S B;  3E56 A;  3MJ5 A;  1YMH E;  2BTE A;  1QQR A;  2BBC A;  1N5X A;  1AW7 A;  1QOF A;  1P7E A;  3BVG A;  4DXG A;  4XWW A;  3EUB 2;  1RYJ A;  1ZUD 2;  4N58 A;  4RF0 A;  3P4Q B;  1FCL A;  1XXG A;  4TSS A;  1ZE3 D;  4ZRQ A;  2WDV B;  4A55 A;  4IKG A;  3BVM A;  4ZOH C;  1BXT A;  1K53 A;  2Y5C A;  1TS2 A;  4P16 A;  2V0G A;  1AN8 A;  2PVO D;  1QOB A;  4IOI E;  2B76 B;  4A9A A;  1FM0 D;  4HEA 1;  4N59 A;  1YN3 A;  2VZK B;  5HHD G;  1KTK A;  1MPE A;  3T3N A;  4YSY B;  3RPF C;  1I4Q A;  2WS3 B;  1IUE A;  1PGB A;  5BMI A;  4LK0 M;  2V3P A;  1YN4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...