1HZ5A

Crystal structures of the b1 domain of protein l from peptostreptococcus magnus, with a tyrosine to tryptophan substitution
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
72
structure length
72
Chain Sequence
MHHHHHHAMEEVTIKANLIFANGSTQTAEFKGTFEKATSEAYAYADTLKKDNGEWTVDVADKGYTLNIKFAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords PROTEIN L
publication title Structures of the B1 domain of protein L from Peptostreptococcus magnus with a tyrosine to tryptophan substitution.
pubmed doi rcsb
source organism Finegoldia magna
total genus 21
structure length 72
sequence length 72
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-01-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1hz5A00
2KQ4X 1PGBA 2LHEA 2KWDA 1PGXA 1XCTL 3GB1A 5HI1A 1Q10A 3V3XA 4GLSC 3FILB 1IGCA 1HEZE 1YNTE 2JU6X 3MP9A 1JMLA 2J52A 1C9FA 1UWXA 4WH4A 2K0PA 1F2RI 2ZW1A 2OEDA 4KGTA 1P7EA 2KN4A 1K51A 1D4BA 1QKZA 2EELA 2LUMA 2N9LA 1MI0A 4IKGA 4MACA 3UI3A 2JXTA 2N9KA 4OZBA 4OZCA 2KACA 1K52A 1F2RC 2QMTA 1MPEA 2RMMA 1MHXA 4KGRA 5HFYA 2ZW0A 5BMGA 1K53A 2J53A 2PLPA 1P7FA 2NMQA 2GB1A 1YMHE 1PGAA 2IGHA 2GI9A 5HG2A 1IBXA 2I2YA 2RPVA 1HZ6A 1FD6A 1FCCC 2ON8A 1ZXHA 2IGDA 4OZAA 4HKZE 1IGDA 1K50A 1XCQL 2LHDA 2QSDA 4D2KA 2IGGA 2KDMA 2N7JA 2JWUA 5BMIA 1GB4A 1IBXB 3FILA 4KGSA 1HZ5A 2ONQA 1EM7A 1MVKA 1XF5L 2LGIA 2PW9A 1KH0A 5BMHA 4IOIE 1GB1A 5HHDG 2I38A 1MHHE 5JXVA 2JSVX 1FCLA 2JZPA 4HJGE 2PTLA
chains in the Genus database with same CATH superfamily
2W82A 3ONSA 3B0AA 1WFYA 1YX5B 1I4GA 5H8YE 3R7RA 4KSKC 3HIZA 1FNVA 3RCZA 3KQ4A 5AZFA 2L76A 2VZKD 2DENB 1WRIA 2JYEA 4KGTA 4MM3B 2MRPA 2Z8LA 2HDEA 4YWGG 3PRZA 2MP2A 3KVFB 3N30A 4DWFA 2M1MA 4OZCA 1J7BA 3TEWA 3PO0A 1DOIA 2LWPA 3W2DA 4DQOC 2PE9A 2QJLA 2ZJDA 4IM3A 4ASWC 4BFRA 4P7IA 1NYRA 5FKAC 5J17A 3A9KB 1FM0D 4MGKE 2JUOA 1NBFC 3AE6B 1C4CA 3V6CB 4ICUA 1JRUA 2V3PA 2KKCA 2I2YA 3PHXB 2BB6A 3M95A 1VZ7A 2IGDA 4OVUA 3KWVA 5EDSA 2JWZA 1EU3A 1P3QU 2JRHA 2KANA 4RGOS 2O6VB 2ZCCA 3MC8A 4J6IA 2KMAA 4YTMB 4EEWA 3R66C 2R2OA 4KGSA 2KX3A 4IM0A 3Q3FA 3RULA 1TY0A 3PVLA 1YOVB 3ECIA 4IW0A 3PGEA 3RNBC 2KDBA 2I38A 3HRDD 4MT5A 3UQAA 3SU8X 4HWIB 2PVGC 1E9MA 1WM2A 2BW2A 2AL3A 1OQYA 1L2NA 2LJIA 3WA0A 2ZNVB 3OLMD 1Z2MA 2XK5B 2N9XA 1QT9A 3GZNB 4M8NA 4C7ZA 4JIOU 2RGFA 4W9LA 2B76B 1UWXA 1WXAA 3MJ5A 3QC8B 3W1YA 1F2RI 1WGYA 2BB5A 3EFCA 1CMXB 2AQ2B 1V5OA 2LUMA 2JZZA 2IO2B 2KT7A 2KMCA 3T8MA 2N0SB 1E7VA 1AWDA 1FPYA 1N61A 1NYQA 4FLHA 1N60A 2QMTA 3AEGB 3KUCB 2WU5B 3RN9C 2GBMA 3AV8A 4RM9A 1TBEA 1WE7A 4IWPA 4AJYB 2WXGA 3C8YA 2GLSA 2IGHA 2GI9A 2ICIA 3RNCC 1TZ1A 2RPVA 4RMAA 4JE3B 2M0AA 4X57B 5JH5C 2KZRA 1FXAA 2LHDA 2LGSA 3NS8A 2XBBC 1UELA 1TYGB 1OQQA 1F9JA 2BVCA 2MH7A 1HTQA 4WWOA 2AYOB 1TKGA 2E6XA 4RF0A 1PQSA 4Q2JA 1VRAB 1T5XD 2CHZA 4IC7B 3ZDMC 3AEFB 2N7DA 1RWSA 1Y56A 4AWJA 2BPSA 5LNK1 4GU2A 3KYCD 2K39A 3W1SA 2JYTA 1R4NI 3S2AA 1QOBA 2R61A 2KFKB 3U30A 1PGBA 2WDRB 1F77A 2ZVOA 2KWVB 1GUAB 1Q10A 1ZKHA 5JHBA 3VTWA 2D3GA 2JU6X 2JX5A 2J52A 3PRPB 4IDIA 1PUTA 4A6QA 2LFIA 3SDLC 4A9AA 3ZJTA 4URKA 4I6PA 5AZGA 1TKEA 2N9KA 4ANXA 2M4NA 4BKSA 1QOFA 4HKQA 2LD9A 2GBRA 1N62A 1YN3A 1WJUA 2JRIB 1WIAA 3IHPC 2SAKA 2FE8A 4E3CA 1VZ6A 3DHGC 2MP2B 2BQQA 4KSLC 4RGMA 1EF5A 2LUEA 2GB1A 4N58A 5G5GA 4LCDE 2BKRB 2GOWA 1P1AA 3A9JA 2D10A 3HK0A 5C3JB 3A4RA 1HA5A 2G4SA 2WLBA 1XCQL 1BT0A 2IJ0A 2IYDB 2QSDA 4ICVA 1JWAD 3EA6A 4NNJB 3SHQA 1WY8A 3KUDB 1E8ZA 1VZ8A 1I4QA 1GG3A 1YQ4B 3L16A 1RM6C 2MBBB 3L08A 2WX1A 1KLGD 2J0KA 2HJ8A 4BVUC 2KJHB 1MVKA 1R7SA 5HHDG 4FXCA 3FAHA 2KTRA 4A8XC 1RYJA 2DAJA 4M8MA 3VRAB 3TEYA 4K1RB 1GJZA 4FJVB 1B1ZA 2MX2A 1Z5SB 2LHEA 2MSED 4BBNF 1PGXA 4IWQA 5G5HA 3NVZA 4GLSC 1UGJA 3N3KB 2X38A 3V60A 1YNTE 2DZMA 2BYTA 4A3OA 2EMSA 3VTUA 3VUWA 5J2RA 2AQ3B 4K81A 2BTEA 2D3CA 2KYWA 3ALBA 2IY1B 2NBWB 1ZDXA 4OW0A 3AE3B 1QILA 4XGAB 4YSZB 2G3QB 2WXJA 2OHFA 3VRBB 2OEDA 3JW0X 3BWUD 1D4BA 1J7AA 2K1FA 3MC9A 3O65B 3RMKC 1E8XA 3AEEB 4DHJB 4EKUA 3TL5A 1OQRA 3L13A 4YT0B 2OOBB 3N32A 1JQ4A 4BKSD 1EUVB 1WJ4A 3IT4B 2Y3AA 4B0EA 4JWUC 4A55A 2N9EB 4GDLA 2K8CA 5IA7A 3DWMA 4HXDA 4WAFA 3V62A 1LXDA 2BS3B 4LNIA 2ZPYA 1WYWB 1YN5A 4HLEA 1IUEA 4PYZA 2LJ5A 3AE7B 2HE7A 1HZ6A 4BKTA 1BXTA 2WDQB 1KLUD 3BZDB 5BYRA 4PS8A 3KW5B 2WXFA 3KH0A 2WWZA 2KDMA 1XLOA 2MBQA 3AE5B 3ZNGC 4N59A 3FILA 2L3ZA 3PSEB 5LXIB 1K8RB 4MELA 2MW5A 5KHOA 5BYSA 2WDTB 3DBHB 1X1MA 3ZDTA 2MHJA 2TSSA 3PLUA 1D3ZA 3VH3B 2J4XA 5D3IB 3Q14C 4K7WA 3ML9A 4W9JA 4XDCA 1WXMA 2JVCA 5BO4B 5AEKB 2MWSB 1WX7A 4P1CC 1GOZA 3L17A 3R2IA 3PZ7A 4GMVA 4NZLB 3UIOB 2EELA 2N7EA 1F0ZA 3R3MA 2V3NA 3UGBB 1JCKB 1WGKA 5DPRA 4LJPB 1YJIA 4F8CB 2A5UA 2L0FA 2KACA 1C79A 5C23A 4W9IA 4EZKA 3DBRB 4RFBA 4HRSA 4O1NA 3U7DA 4AS1A 2D2QA 3U2SC 1YJJA 3RUIB 2KDFB 5JHAA 2L8JA 3BVMA 4I6LB 2NMQA 4FHJA 4YTPB 1L5PA 2LI5A 2Z0DB 4YL8A 2K6DB 3CSFA 4HPPA 1AYFA 3VH4B 2DYMA 3AECB 2M56B 2K9XA 3KYDD 4BKGA 2HTME 2N9PC 2N7JA 1SSNA 1T6BX 2DNFA 4TV3A 4AQ7A 4US9A 4DDGD 3A9JB 3VXWA 2V1YA 2XNAC 1H8CA 4EUTA 2W55A 4WJOA 2BWES 1NI3A 1STEA 4MGIE 4W9FA 2Q5WD 3EHVA 1JW9D 2KQ4X 1FNUA 3L54A 2D11A 4KZ0A 5T8IA 2CS4A 1JWMD 2PIAA 2BS2B 5D3DA 1N5WA 1M4VA 1M94A 3ZTCA 3PS6A 2IO1B 3VQIA 2K8BA 4JLCA 1VJKA 2KTRB 5AUKA 1P7EA 2DHZA 3AN1A 4TUUA 4FHKA 4RM8A 4PS3A 3LJ3A 3OWEB 3Q3MC 4FJZA 3GE8C 1E8YA 1XLNA 2WYQA 1WR6E 3DVGY 2HD5B 3PREA 4AJWA 3OJ3A 4MSMB 3P2BA 4WWPA 3AI5A 1ET6A 4F1SA 3IBEA 5EE3A 5AUIA 4LNKA 1F52A 2N1VA 1P98A 3D32A 1ZW7A 2LXAA 2FAZA 3RD2A 5FR3A 3P4QB 2V0GA 2N1WA 4WJNA 2MLBA 3IG3A 1GAQB 4GXBA 2D5GA 4ZRIA 1LM8B 2NPTA 2MCNB 5C1ZA 4GDLB 3ZTDA 3ZXVA 1YQBA 2PJHA 5BMIA 2KQ7A 2WXLA 1OEYA 2KAJA 2BWFA 1JROA 2JF5A 4KZCA 3SD5A 1VCBA 2WGSA 1GB1A 4DDID 1C76A 2PE6B 3L4PA 1MJDA 2NR2A 1ZGUB 1WJNA 3H6NA 3RT3B 2Y5BB 4DXGA 1R4MB 3TIXA 3WAMA 1I7HA 3FILB 1IGCA 3ZUNA 2AL6A 2G9HD 5EE9A 1WF9A 4BOSC 1RAXA 4TSSA 2QEJC 3M63B 2BYEA 1C9FA 2C5LC 2KXJA 1WGRA 3DBSA 1WSPA 2MJ3A 4FA6A 1I4RA 3IT6B 1FRRA 2KFJA 1ET9A 1SGHA 1B9RA 3CMMB 3Q3OC 1TS4A 3U7ZA 3HVZA 2KJ6A 3A33B 5MPOA 1E7PB 2B3AA 1C77A 2DWQA 2L05A 3DHIC 2GBKA 1CJEA 4KGRA 3DWGC 4WJPA 3E9SA 2V9HA 1Q5WB 1XT9B 5IP4D 1P7FA 3TEZA 3RZFA 5EE0A 5LLIA 2VZKB 3BIID 2KO3A 2UU7A 2H88B 1L6UA 2KVRA 1QF6A 3APCA 1JWSD 3BYYB 1UWMA 3RNGC 3DDCB 4HCPB 3HHMA 5D94A 3B08A 1SIFA 2JWUA 3L10B 4GSWA 3VUYA 1GB4A 2FCMA 3NZ3A 2C7NB 3GZNI 4OVZA 2MJDA 4CYEA 1A5RA 5J18A 1ENFA 1MHHE 1V81A 2JSVX 2NS5A 3OG5A 4PS7A 3VFKA 1HXYD 4MGYE 5G2NA 3I3TB 1FMAD 4DHZE 1E6EB 2L7RA 4KVGB 3Q6BA 4W9HA 2FCQA 1FNWA 4M02A 1VR9A 3AEBB 5CX3A 1QOGA 1RLFA 1KFYB 4K7SA 1LQBA 3R8BA 3PHWB 2O2VA 1LO5D 2L1AA 3SFDB 2K0PA 5IKCM 4LNNA 1G6JA 1Q1OA 1K51A 3ENEA 4WWNA 2JZ3B 2N9LA 3DCGA 1SJHD 1SEBD 2JQRB 2KC1A 1HE8A 1KTKA 1GNUA 3ZW3A 2C7MB 2DZJA 4JL9A 3C19A 1TS3A 2K3UA 4P1BC 1WGHA 3Q2AC 4HDQA 3A1QA 2DLBA 4LNFA 3PLVA 2ZW0A 1ZUD2 1I42A 2IO0B 3Q8CA 3I5JC 3ABVB 1T3QA 2M8SA 1FXTB 5IAAC 3DBLB 1C3TA 2WNMA 3W5UB 1L4DB 1E0ZA 2WXMA 4FADA 2KJRA 3AE1B 3NZSA 3BY4B 3K9PB 3H7SA 4RNAA 1WXSA 2KN5A 3Q8AA 4XX5A 4EE2A 4CHKA 1TS5A 4EFOA 1HZ5A 1I35A 5DCNA 3PZDA 3UIPB 3P1MA 4IM2A 1KF6B 1FRDA 2KTFA 4HDOA 4B9KA 2NPTB 1L0VB 3NHEB 1C1YB 2CR5A 5JZEB 2RR9A 1JALA 1XO3A 4HCNB 5CHVC 1OTRB 3W1SC 4YSYB 1JRPA 3E56A 3ZLZA 4US8A 1E7UA 3R2TA 3IVFA 2V4LA 1CK1A 2J42A 3PPAA 1WMHA 1D6EC 3VVWB 3ZQ4A 2KK8A 4MSQB 2WXHA 3BK1A 3AXCA 3H1UA 2JXTA 1OEYJ 3GE3C 3KWLA 2NBVB 1SIJA 2KVZA 3Q3NC 4EOYA 4CO7A 2DYBA 3W9CB 3EECA 3NOBA 2KLCA 3B9JA 1PGAA 4REZA 4GB9A 4ACFA 3AEDB 1L6VA 1FD6A 2PKOA 5L95C 4WWMA 1FCCC 3BK2A 2IDYA 4LLGM 1PYWD 2C60A 3VR9B 3NG0A 2IO3B 5IN7A 4D2KA 1EO6A 2YEPB 3T3OA 3LDZE 1TGZB 2AEHA 3Q8BA 4HPLB 1P9DU 3V05A 4I6NB 4XDDA 3MC0B 2LZ6A 4HROA 4ANUA 4WAAA 5HKHA 2KWCA 2RDHA 3BVZA 1WZ3A 3T9LA 3TMPB 2JZPA 2LGYA 4HVBA 4YXDB 3MHSD 4A20A 4M01A 1KJTA 4G3XB 3GP7A 2FIFA 1V5TA 3FKYA 1ZOYB 1V1PA 2L0TA 3PZ8A 2VH1A 4XZ4A 4JQWC 3SEBA 3AB5A 5AZHA 1L0XB 2K5PA 2C9WB 4ARIA 2JXXA 2K25A 1TJEA 4C4VA 2N4FA 1I4PA 2EMTA 4DXFA 3ZRFA 1DOXA 2BT6A 1E10A 3QAQA 3B2FA 3IXSA 4DBGA 4II3B 3TBLD 2K6QA 1ZPSA 2ASQA 4HEA1 1VD2A 4FBJB 3Q3JA 2IZVB 2KNBA 2OJWA 2YEPF 2O2VB 1TY2A 1TIFA 4HPMB 3QX1A 4KDLB 2GRIA 3GOEA 1RFKA 1J8CA 1EWCA 3KUZA 1AARA 1S1QB 1QQRA 1ESFA 2PLPA 3ZIMA 3QARA 3VR8B 2KMMA 3CF6E 3NS1A 2YLMA 1NEKB 2ZZPB 1U4AA 3I63C 1UBQA 3A1QB 2PPHA 2I1JA 3VAWA 4R3DA 1ZP0B 2WQYB 3MTNB 1WGDA 3DBHI 1RFAA 2VRRB 3P4PB 1UF0A 3RZWC 2PEAA 2ONQA 3P42A 1WX9A 4OVVA 4WQOB 2INNE 4IOIE 4ZRKA 3HVDA 1NI2A 2GBJA 1ZE3D 1GC6A 2KQSA 1FEHA 2ACZB 2FUG1 5LXHA 1A70A 1V80A 2W3RA 1NDDA 5DPSA 1AW7A 1ZDVA 3AM9A 5EE1A 2KDEB 1XCTL 1WH3A 4M00A 3ZRCA 4ANWA 1JWUD 4KV2A 4ZYNA 3AE9B 4W9CA 5E6NA 4PK1A 1PFDA 2KDIA 2ZCBA 1ACCA 3DBRI 2NCNA 1CZPA 3H9DA 4II2B 1TS2A 1I4XA 2DAFA 2H89B 5IO9A 2ZNVC 2ZVNA 4WQMA 2O6VD 1HTOA 1RRBA 1MI0A 2LMCA 1V6EA 2PMVA 3JYUA 2WXQA 4W9DA 4F7ZA 1OGWA 1GPXA 3CSTA 1WR1A 1YD8U 2WXOA 3TUOA 3T3NA 2WX0A 5TSSA 2GBNA 2JT4B 2MBHA 3B2GA 4WIPA 3CWIA 4HK2A 3I57A 1WMHB 2DBYA 3AU5A 4A90A 4G50A 2J53A 3APFA 1D5ZC 4GOCA 4KIKA 5D7GA 1C4PA 3QK0A 2CKHB 4ITKA 4NAWA 2JY6A 3P4SB 4OZAA 4W9KA 3IAM1 2G4DB 4DXAB 4NQLB 3QWZB 2QILA 3LB8C 2EKEC 1NENB 3QJZA 2WXKA 1LFDA 3HM3A 4JWSC 4L2YA 1JWBD 1UH6A 3QHTA 4RGTA 1KH0A 2MA9B 3BVGA 1WZ0A 2NTTA 1NVID 3X0WA 1FCLA 2IY0B 3DOWA 3FC4A 3R7QA 4KKJA 4FN2A 5D6JB 4MGZE 1IP9A 2RDBC 3NZUA 3HUIA 4XYCA 3C0RB 1C78A 2CHWA 2IPKD 2KC2A 1E5WA 1ZXIA 4E71A 2D07B 2KLGA 2WHIA 3V3XA 4GDKA 2RD0A 4NPNA 1GC7A 3QA8A 3ZO5B 3ZJUA 3URYA 1F1HA 3DQVA 3JVZX 3H7PA 1OFFA 1YN4A 3KLSX 4IUMB 4NJ6A 2FCNA 2LXCA 2Z59B 2LGDA 1V1PB 1HQRD 1XQQA 4IKGA 4S17A 4NJCA 1E90A 3MHZA 2EKIA 2L32A 4M0WA 2BYVE 2DYOA 4B0MA 1H4RA 3LYYA 1UZXB 1K52A 4C4VB 1P0RA 1WGGA 2J0JA 1T0YA 1EWYC 4USAA 1V1OA 1YIWA 4KX6B 4K7UA 5KHQA 1S3SG 1D5MC 2MBEA 2L83A 5CTRC 5GXGB 4C56C 2BGFA 3EFUA 1XLPA 4BBNC 2D3AA 2BKFA 3ZKJC 3UF8A 2RSUA 1IGDA 3DHHC 1SBBB 2DX5B 1TKYA 5E6PA 1L7YA 1PDXA 2K22A 3PT2B 2IGGA 1UD7A 2LRUA 1R4MI 1N5XA 4J3OD 1DOYA 1WXQA 4W9EA 4YTNB 1FO4A 4RF1A 3ML8A 1WM3A 1V8CA 2NVUI 4N6EB 4MDKE 4XWTA 2PVOD 1YJ1A 3GB1A 5HI1A 3RNAC 3NJTA 2G45B 3JSVA 3VTVA 4B6WA 3UQBA 3Q8FA 4ARCA 1HEZE 2WU2B 1AN8A 3APDA 4W9GA 2WS3B 1R4NB 2VH2A 4FJYA 1ISNA 4FULA 4S0RA 1WE6A 2SEBD 2QIEB 2KN4A 2W54A 4MH8A 1SJED 2W3SA 4B95A 4RH6A 2HTHA 3NRZA 2BYFA 4DHZB 3LXFA 2LASA 3AEAB 2WXNA 3EGRA 2AQ1B 3L0WB 4EZJA 3BINA 4RCOA 2J0MA 1MPEA 1V9JA 2RMMA 2UYZB 4ZRQA 2QDFA 2Y5CA 3TSSA 3TEXA 1IBXA 3ETRA 2FNJB 1J0GA 3B1LX 4LK0M 2KD0A 1CQVA 3MFGA 1ZXHA 2Y5PA 1UGMA 2DZKA 4BOZB 4ZHPA 3WCQA 2XN9C 4LDTD 4NY0A 4ZRPA 5L83A 2A4ZA 4G0NB 3V6EB 2L52A 2G1EA 3I9V1 2BS4B 5DPTA 3TJPA 4KIKB 4MJSA 4NAWB 2J7QB 4DHJD 2UWQA 4PYUA 3QIJA 5JXVA 4K3CA 4HJGE 4TKNA 3HM6X 3NVWA 2PTLA 4KKIA 4AP4C 1TZOA 1WWTA 4AUQC 1ROEA 3QCAA 3DVNU 4ZHOA 2NBUA 3OAWA 4C7YA 3PTFC 2QC8A 1WXVA 3W5VB 1LGRA 2WP9B 4NJ7A 4ZYSA 5I4DA 1MG4A 2OJRA 2K8HA 2V3SA 5CHFA 3N1ZC 3O13A 3M3JA 4H2AA 1N6ZA 1EU4A 1SE3A 3IFWB 4GDKB 1T0SC 2ZPNA 4MACA 3UI3A 1SB3C 4OZBA 4JX1C 2YVCA 1Y8RC 4LTUA 4XWWA 3TCAA 3DBLI 3P4RB 2DZIA 3A4SC 4N9F4 1FXIA 2LRWA 1VLBA 1BUIC 4GIVA 4C80A 3H7PB 1WI0A 1V97A 4ZDVA 3SR6A 3WIMA 3ZNZB 1BMLC 4XE0A 5HFYA 3DVGX 5BMGA 1K53A 2QCZA 4AOFA 1J19A 4KDIC 1XEEA 4RGNA 4P16A 1T0RC 4M0WB 3N9YC 5D2MB 4E74A 2I1KA 2E3TA 3WALA 2RPQA 2HJ1A 3PV1A 1MFWA 3X23A 2FBWB 1WJ6A 2MJEA 3UINB 4IWOA 2MQJA 3Q8EA 2IBIB 2CHXA 3ZJVA 1KLVA 1TT5B 3U4EG 1EM7A 1XF5L 2LGIA 3AE4B 1XLQA 3NUHB 4G11A 4LDTB 4ZRJA 1SF0A 2WDVB 2CU3A 4IG7B 5E6OA 4MM3A 1I4HA 5GMVA 4HJKA 3RI7C 1XXGA 1L0YB 4L1BA 5IOIA 2V4IB 3RFZB 5FK9C 1XD3B 4LNOA 2CJOA 3ZGZA 2KHWB 2INDC 3MP9A 3SFEB 2KX0A 2Z0EB 3RNFC 1SXTA 4JPSA 3ZVVA 3EC8A 2XEWA 2BF8B 1UBIA 2ZW1A 3OJ4B 1V86A 3A9KA 2QHOA 1QKZA 5BYQA 3JSVB 3AU4A 2WXRA 1SE9A 2WXIA 4MH0E 4DK5A 4TQ1A 1UNSA 1YX6B 3ZNHB 3BYTB 1DYQA 4JGHB 1C4AA 1WX8A 1QOAA 1QZEA 3NVYA 2W9NA 4PT5A 2O6VA 3GS2A 2AX5A 1YMHE 5HG2A 3CIRB 2LVPA 3J9CA 4WJQA 2ON8A 1D5XC 1SE2A 1K50A 2LVOA 2NTSA 1VDVA 5G55A 1TTNA 3RYTA 4OHJA 4TQ0A 1E8WA 4EZLA 2XK5A 1IBXB 2X8XX 1WYGA 2D3BA 4YSXB 2LEKA 3AE8B 2PW9A 3ZYYX 3WAPA 2WXPA 3DVNV 5TR5A 2ZEQA 4GGQA 4BZAA 3NVVA 4NAMA 2KWDA 4ZOHC 2LGXA 3ZXRA 1UUPA 4ANVA 3ZNID 1KM7A 1SE4A 4MJSB 1FFVA 1YQ3B 2CU1A 2FCSA 1JMLA 3M62B 2LVQA 3DPDA 2INCC 4WH4A 1MG8A 2CJNA 5DPWA 4CQNA 5CHWA 3NY5A 2C7HA 4TMAB 4BAXA 1IPGA 3PRMB 3RNEC 1EF1A 1FFUA 1N63A 2FIDA 3Q69A 3VDZA 1L4ZB 2FUHB 4P6VF 4NQKE 2GMIC 1F2RC 2KOXA 1IYFA 1KRHA 3QQ8B 4XC2A 2INPE 3N1YC 1MHXA 4UDUC 3MJWA 2BBCA 1FIQA 2M19A 1QLBB 2JPHA 5FR6A 2KWUB 3U52E 1J7CA 1KOTA 2R2QA 3P63A 4GN1A 3AMZA 3AE2B 3EUB2 5H92C 1V49A 2REXA 3VUXA 3H8HA 3N1XC 4HKZE 3AH7A 4C00A 3V61A 3RPFC 4MEMA 4LJOB 2RDGA 3WANA 3U8ZA 3IAS1 2M0XA 4L23A 2KFKA 2MBOA 5E6JA 1DGJA 1Q0WB 1T0QC 3N20C 2MEKA 3VHTC 4A3PA 4K3BA 5C2TB 3WAOA 3K9OB 1WRDB 5BMHA 3AULA 2M17A 2L00B 1V2YA 4QAYA 4WURA 2AWTA
chains in the Genus database with same CATH topology
2W82A 4XWTA 2PVOD 1I4GA 3GB1A 1L0VB 5H8YE 5HI1A 2TSSA 2J4XA 3Q8FA 5D3IB 4ARCA 1HEZE 1JALA 2WU2B 1XO3A 1FNVA 3KQ4A 1AN8A 2VZKD 4XDCA 2WS3B 4YSYB 1JRPA 3E56A 1GOZA 4US8A 2SEBD 1WRIA 2JYEA 2QIEB 3PZ7A 3R2IA 3R2TA 4KGTA 4MM3B 1CK1A 2Z8LA 2J42A 2KN4A 2HDEA 2W54A 4MH8A 4NZLB 1SJED 4YWGG 2W3SA 1D6EC 3ZQ4A 2EELA 1F0ZA 4RH6A 2WXHA 3BK1A 3NRZA 2V3NA 1JCKB 1WGKA 2JXTA 3LXFA 4OZCA 1J7BA 1YJIA 2KACA 1C79A 2WXNA 3AEAB 3TEWA 3PO0A 3EGRA 4RFBA 1DOIA 2AQ1B 4HRSA 3KWLA 3W2DA 4RCOA 4DQOC 2QJLA 1SIJA 4O1NA 1MPEA 4AS1A 2RMMA 3U2SC 4ZRQA 1NYRA 1YJJA 5FKAC 3W9CB 1FM0D 3BVMA 2Y5CA 3TSSA 3AE6B 2NMQA 1C4CA 3B9JA 1PGAA 4REZA 4YTPB 3TEXA 1L5PA 1IBXA 2V3PA 2I2YA 3AEDB 1L6VA 2BB6A 3ETRA 1FD6A 2PKOA 4WWMA 4LK0M 1FCCC 1CQVA 1AYFA 3BK2A 3MFGA 1ZXHA 1VZ7A 2DYMA 2IGDA 2Y5PA 2IDYA 3AECB 4LLGM 1PYWD 3KWVA 2M56B 2K9XA 3VR9B 3WCQA 2XN9C 4ZHPA 1EU3A 4D2KA 2HTME 2YEPB 4RGOS 3T3OA 4ZRPA 2N7JA 4YTMB 1SSNA 1T6BX 3Q8BA 2L52A 3V05A 4AQ7A 4US9A 4XDDA 3MC0B 2G1EA 3I9V1 2BS4B 4KGSA 4HROA 2XNAC 1TY0A 2RDHA 3BVZA 4NAWB 2W55A 3HRDD 2I38A 4MT5A 5JXVA 1NI3A 2PVGC 2JZPA 1E9MA 4HJGE 2BW2A 1STEA 3NVWA 2Q5WD 2PTLA 4KKIA 4YXDB 1JW9D 1TZOA 2LJIA 2KQ4X 1FNUA 1WWTA 1ROEA 3GP7A 5T8IA 1JWMD 2PIAA 1ZOYB 4ZHOA 1V1PA 2BS2B 5D3DA 1N5WA 3PZ8A 1M4VA 1QT9A 4C7YA 3SEBA 3AB5A 3VQIA 4C7ZA 3W5VB 1L0XB 2K5PA 2WP9B 2B76B 4ZYSA 1VJKA 4ARIA 1UWXA 3MJ5A 1TJEA 5I4DA 1F2RI 5AUKA 1I4PA 4DXFA 2BB5A 1DOXA 1P7EA 2BT6A 3AN1A 3O13A 4H2AA 1E10A 1EU4A 1SE3A 3B2FA 3IXSA 2AQ2B 4GDKB 2LUMA 3OWEB 1ZPSA 4MACA 4HEA1 2N0SB 3UI3A 1SB3C 4OZBA 1XLNA 4JX1C 4LTUA 4XWWA 1AWDA 3P4RB 1FXIA 2YEPF 1N61A 1VLBA 1NYQA 1BUIC 1N60A 1TY2A 4C80A 2QMTA 3AEGB 1V97A 1ET6A 2WU5B 3SR6A 2GRIA 1RFKA 1BMLC 4XE0A 5EE3A 5HFYA 5AUIA 3AV8A 1EWCA 5BMGA 1K53A 1QQRA 1ESFA 2PLPA 3VR8B 2KMMA 2WXGA 3C8YA 2IGHA 2GI9A 5FR3A 2ICIA 3P4QB 1XEEA 3NS1A 4RGNA 1NEKB 4P16A 2V0GA 2RPVA 3N9YC 4JE3B 2M0AA 1GAQB 2D5GA 2E3TA 1FXAA 2LHDA 4R3DA 4GDLB 1TYGB 1ZP0B 1OQQA 2WQYB 2FBWB 2MH7A 2MJEA 5BMIA 2WXLA 1TKGA 2KAJA 2E6XA 3P4PB 4RF0A 4Q2JA 1JROA 1VRAB 1T5XD 3Q8EA 3ZJVA 2ONQA 3AEFB 3P42A 1EM7A 1RWSA 1XF5L 1Y56A 2LGIA 3AE4B 3U4EG 5LNK1 1XLQA 2INNE 3NUHB 4IOIE 1GB1A 3HVDA 3W1SA 1C76A 1ZE3D 1SF0A 2JYTA 2WDVB 2CU3A 3L4PA 1QOBA 1FEHA 2ACZB 2FUG1 1I4HA 2R61A 1A70A 2W3RA 4DXGA 1AW7A 1PGBA 1ZDVA 1XXGA 2WDRB 1L0YB 3AM9A 4L1BA 5EE1A 1XCTL 2V4IB 3RFZB 1F77A 5FK9C 1I7HA 1Q10A 3FILB 1IGCA 1JWUD 2CJOA 3AE9B 3ZGZA 2JU6X 3MP9A 2G9HD 5EE9A 1PFDA 3SFEB 4TSSA 1SXTA 2QEJC 2JX5A 2J52A 1C9FA 1ACCA 4JPSA 4IDIA 1PUTA 1WSPA 2MJ3A 1I4RA 1CZPA 2ZW1A 1TS2A 3IT6B 1I4XA 4A6QA 2LFIA 1FRRA 2H89B 1ET9A 1B9RA 4WQMA 1QKZA 5BYQA 4A9AA 3ZJTA 1TS4A 3U7ZA 2LMCA 1MI0A 3HVZA 2PMVA 2WXQA 1TKEA 2WXRA 2WXIA 2N9KA 5MPOA 1GPXA 4TQ1A 1UNSA 1E7PB 1QOFA 4HKQA 1C77A 2DWQA 2WXOA 3TUOA 3BYTB 3T3NA 1DYQA 1N62A 1C4AA 1YN3A 4WIPA 5TSSA 3B2GA 3CWIA 1CJEA 2SAKA 3I57A 1QOAA 4KGRA 3DWGC 2FE8A 3NVYA 1VZ6A 4PT5A 3E9SA 2DBYA 4RGMA 4A90A 2J53A 3GS2A 2AX5A 1P7FA 1D5ZC 2GB1A 1YMHE 4N58A 5G5GA 3TEZA 5HG2A 5EE0A 3CIRB 2VZKB 3J9CA 5D7GA 1C4PA 3BIID 4ITKA 5C3JB 2H88B 2ON8A 1L6UA 3P4SB 4OZAA 1D5XC 1SE2A 1QF6A 1HA5A 3IAM1 1K50A 2WLBA 1XCQL 2IJ0A 1JWSD 3BYYB 2QSDA 2NTSA 1UWMA 1JWAD 3EA6A 2QILA 1VZ8A 3LB8C 1I4QA 2JWUA 1YQ4B 1VDVA 1NENB 4TQ0A 4OHJA 1RM6C 2WXKA 1KLGD 4JWSC 1GB4A 1IBXB 4L2YA 1JWBD 1WYGA 3NZ3A 1MVKA 2LEKA 3AE8B 4YSXB 2PW9A 4OVZA 1KH0A 2MJDA 4RGTA 3ZYYX 3BVGA 2NTTA 1R7SA 5HHDG 1ENFA 1MHHE 1NVID 2WXPA 4FXCA 2JSVX 3FAHA 1FCLA 4A8XC 1HXYD 1RYJA 3VRAB 3FC4A 3TEYA 4KKJA 1FMAD 3NVVA 3HUIA 1B1ZA 4NAMA 1E6EB 1C78A 2IPKD 1ZXIA 2LHEA 2KWDA 1PGXA 5G5HA 3NVZA 4ZOHC 3V3XA 4GLSC 1FNWA 1UGJA 1UUPA 1VR9A 2X38A 3AEBB 1YNTE 1SE4A 1QOGA 2BYTA 1FFVA 1YQ3B 1JMLA 2AQ3B 1KFYB 2BTEA 4OW0A 3ZJUA 1ZDXA 3AE3B 1QILA 4YSZB 3R8BA 2WXJA 4WH4A 2OHFA 3URYA 1LO5D 2L1AA 3SFDB 2K0PA 3VRBB 2CJNA 1OFFA 2OEDA 1YN4A 3BWUD 4CQNA 3KLSX 4TMAB 1K51A 1D4BA 1J7AA 1V1PB 1HQRD 2N9LA 4IKGA 1SJHD 1SEBD 4NJCA 2JQRB 3MHZA 1KTKA 1FFUA 3AEEB 1OQRA 1N63A 2EKIA 2L32A 4YT0B 3Q69A 4M0WA 2DYOA 1TS3A 4B0MA 1L4ZB 2K3UA 3LYYA 4P6VF 1JQ4A 1K52A 1F2RC 1KRHA 3IT4B 2INPE 2DLBA 2Y3AA 4B0EA 1MHXA 4JWUC 1EWYC 4USAA 1V1OA 4A55A 4UDUC 2BBCA 1FIQA 2ZW0A 1ZUD2 4KX6B 2M19A 1QLBB 3DWMA 4WAFA 1D5MC 2L83A 3Q8CA 5GXGB 4C56C 2BS3B 3U52E 1J7CA 3ABVB 1T3QA 3P63A 1YN5A 1XLPA 3AMZA 1IUEA 3AE7B 3AE2B 3EUB2 5H92C 1HZ6A 3H8HA 1BXTA 2WNMA 2WDQB 3W5UB 4HKZE 3AH7A 1L4DB 1IGDA 3RPFC 1KLUD 1E0ZA 2RDGA 2WXMA 3BZDB 1SBBB 5BYRA 3IAS1 1TKYA 3AE1B 1PDXA 2WXFA 4L23A 2K22A 2IGGA 1XLOA 2KDMA 3AE5B 5E6JA 4RNAA 1DGJA 1N5XA 4J3OD 1DOYA 3Q8AA 2MEKA 1WXQA 4N59A 4EE2A 3FILA 1TS5A 1HZ5A 5C2TB 5BMHA 3P1MA 1KF6B 4YTNB 1FRDA 1FO4A 4WURA 4RF1A 5BYSA 4N6EB 1V8CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KQ4 X;  1PGB A;  2LHE A;  2KWD A;  1PGX A;  1XCT L;  3GB1 A;  5HI1 A;  1Q10 A;  3V3X A;  4GLS C;  3FIL B;  1IGC A;  1HEZ E;  1YNT E;  2JU6 X;  3MP9 A;  1JML A;  2J52 A;  1C9F A;  1UWX A;  4WH4 A;  2K0P A;  1F2R I;  2ZW1 A;  2OED A;  4KGT A;  1P7E A;  2KN4 A;  1K51 A;  1D4B A;  1QKZ A;  2EEL A;  2LUM A;  2N9L A;  1MI0 A;  4IKG A;  4MAC A;  3UI3 A;  2JXT A;  2N9K A;  4OZB A;  4OZC A;  2KAC A;  1K52 A;  1F2R C;  2QMT A;  1MPE A;  2RMM A;  1MHX A;  4KGR A;  5HFY A;  2ZW0 A;  5BMG A;  1K53 A;  2J53 A;  2PLP A;  1P7F A;  2NMQ A;  2GB1 A;  1YMH E;  1PGA A;  2IGH A;  2GI9 A;  5HG2 A;  1IBX A;  2I2Y A;  2RPV A;  1HZ6 A;  1FD6 A;  1FCC C;  2ON8 A;  1ZXH A;  2IGD A;  4OZA A;  4HKZ E;  1IGD A;  1K50 A;  1XCQ L;  2LHD A;  2QSD A;  4D2K A;  2IGG A;  2KDM A;  2N7J A;  2JWU A;  5BMI A;  1GB4 A;  1IBX B;  3FIL A;  4KGS A;  1HZ5 A;  2ONQ A;  1EM7 A;  1MVK A;  1XF5 L;  2LGI A;  2PW9 A;  1KH0 A;  5BMH A;  4IOI E;  1GB1 A;  5HHD G;  2I38 A;  1MHH E;  5JXV A;  2JSV X;  1FCL A;  2JZP A;  4HJG E;  2PTL A; 
#chains in the Genus database with same CATH topology
 2W82 A;  3ONS A;  3B0A A;  1WFY A;  1YX5 B;  1I4G A;  5H8Y E;  3R7R A;  4KSK C;  3HIZ A;  1FNV A;  3RCZ A;  3KQ4 A;  5AZF A;  2L76 A;  2VZK D;  2DEN B;  1WRI A;  2JYE A;  4KGT A;  4MM3 B;  2MRP A;  2Z8L A;  2HDE A;  4YWG G;  3PRZ A;  2MP2 A;  3KVF B;  3N30 A;  4DWF A;  2M1M A;  4OZC A;  1J7B A;  3TEW A;  3PO0 A;  1DOI A;  2LWP A;  3W2D A;  4DQO C;  2PE9 A;  2QJL A;  2ZJD A;  4IM3 A;  4ASW C;  4BFR A;  4P7I A;  1NYR A;  5FKA C;  5J17 A;  3A9K B;  1FM0 D;  4MGK E;  2JUO A;  1NBF C;  3AE6 B;  1C4C A;  3V6C B;  4ICU A;  1JRU A;  2V3P A;  2KKC A;  2I2Y A;  3PHX B;  2BB6 A;  3M95 A;  1VZ7 A;  2IGD A;  4OVU A;  3KWV A;  5EDS A;  2JWZ A;  1EU3 A;  1P3Q U;  2JRH A;  2KAN A;  4RGO S;  2O6V B;  2ZCC A;  3MC8 A;  4J6I A;  2KMA A;  4YTM B;  4EEW A;  3R66 C;  2R2O A;  4KGS A;  2KX3 A;  4IM0 A;  3Q3F A;  3RUL A;  1TY0 A;  3PVL A;  1YOV B;  3ECI A;  4IW0 A;  3PGE A;  3RNB C;  2KDB A;  2I38 A;  3HRD D;  4MT5 A;  3UQA A;  3SU8 X;  4HWI B;  2PVG C;  1E9M A;  1WM2 A;  2BW2 A;  2AL3 A;  1OQY A;  1L2N A;  2LJI A;  3WA0 A;  2ZNV B;  3OLM D;  1Z2M A;  2XK5 B;  2N9X A;  1QT9 A;  3GZN B;  4M8N A;  4C7Z A;  4JIO U;  2RGF A;  4W9L A;  2B76 B;  1UWX A;  1WXA A;  3MJ5 A;  3QC8 B;  3W1Y A;  1F2R I;  1WGY A;  2BB5 A;  3EFC A;  1CMX B;  2AQ2 B;  1V5O A;  2LUM A;  2JZZ A;  2IO2 B;  2KT7 A;  2KMC A;  3T8M A;  2N0S B;  1E7V A;  1AWD A;  1FPY A;  1N61 A;  1NYQ A;  4FLH A;  1N60 A;  2QMT A;  3AEG B;  3KUC B;  2WU5 B;  3RN9 C;  2GBM A;  3AV8 A;  4RM9 A;  1TBE A;  1WE7 A;  4IWP A;  4AJY B;  2WXG A;  3C8Y A;  2GLS A;  2IGH A;  2GI9 A;  2ICI A;  3RNC C;  1TZ1 A;  2RPV A;  4RMA A;  4JE3 B;  2M0A A;  4X57 B;  5JH5 C;  2KZR A;  1FXA A;  2LHD A;  2LGS A;  3NS8 A;  2XBB C;  1UEL A;  1TYG B;  1OQQ A;  1F9J A;  2BVC A;  2MH7 A;  1HTQ A;  4WWO A;  2AYO B;  1TKG A;  2E6X A;  4RF0 A;  1PQS A;  4Q2J A;  1VRA B;  1T5X D;  2CHZ A;  4IC7 B;  3ZDM C;  3AEF B;  2N7D A;  1RWS A;  1Y56 A;  4AWJ A;  2BPS A;  5LNK 1;  4GU2 A;  3KYC D;  2K39 A;  3W1S A;  2JYT A;  1R4N I;  3S2A A;  1QOB A;  2R61 A;  2KFK B;  3U30 A;  1PGB A;  2WDR B;  1F77 A;  2ZVO A;  2KWV B;  1GUA B;  1Q10 A;  1ZKH A;  5JHB A;  3VTW A;  2D3G A;  2JU6 X;  2JX5 A;  2J52 A;  3PRP B;  4IDI A;  1PUT A;  4A6Q A;  2LFI A;  3SDL C;  4A9A A;  3ZJT A;  4URK A;  4I6P A;  5AZG A;  1TKE A;  2N9K A;  4ANX A;  2M4N A;  4BKS A;  1QOF A;  4HKQ A;  2LD9 A;  2GBR A;  1N62 A;  1YN3 A;  1WJU A;  2JRI B;  1WIA A;  3IHP C;  2SAK A;  2FE8 A;  4E3C A;  1VZ6 A;  3DHG C;  2MP2 B;  2BQQ A;  4KSL C;  4RGM A;  1EF5 A;  2LUE A;  2GB1 A;  4N58 A;  5G5G A;  4LCD E;  2BKR B;  2GOW A;  1P1A A;  3A9J A;  2D10 A;  3HK0 A;  5C3J B;  3A4R A;  1HA5 A;  2G4S A;  2WLB A;  1XCQ L;  1BT0 A;  2IJ0 A;  2IYD B;  2QSD A;  4ICV A;  1JWA D;  3EA6 A;  4NNJ B;  3SHQ A;  1WY8 A;  3KUD B;  1E8Z A;  1VZ8 A;  1I4Q A;  1GG3 A;  1YQ4 B;  3L16 A;  1RM6 C;  2MBB B;  3L08 A;  2WX1 A;  1KLG D;  2J0K A;  2HJ8 A;  4BVU C;  2KJH B;  1MVK A;  1R7S A;  5HHD G;  4FXC A;  3FAH A;  2KTR A;  4A8X C;  1RYJ A;  2DAJ A;  4M8M A;  3VRA B;  3TEY A;  4K1R B;  1GJZ A;  4FJV B;  1B1Z A;  2MX2 A;  1Z5S B;  2LHE A;  2MSE D;  4BBN F;  1PGX A;  4IWQ A;  5G5H A;  3NVZ A;  4GLS C;  1UGJ A;  3N3K B;  2X38 A;  3V60 A;  1YNT E;  2DZM A;  2BYT A;  4A3O A;  2EMS A;  3VTU A;  3VUW A;  5J2R A;  2AQ3 B;  4K81 A;  2BTE A;  2D3C A;  2KYW A;  3ALB A;  2IY1 B;  2NBW B;  1ZDX A;  4OW0 A;  3AE3 B;  1QIL A;  4XGA B;  4YSZ B;  2G3Q B;  2WXJ A;  2OHF A;  3VRB B;  2OED A;  3JW0 X;  3BWU D;  1D4B A;  1J7A A;  2K1F A;  3MC9 A;  3O65 B;  3RMK C;  1E8X A;  3AEE B;  4DHJ B;  4EKU A;  3TL5 A;  1OQR A;  3L13 A;  4YT0 B;  2OOB B;  3N32 A;  1JQ4 A;  4BKS D;  1EUV B;  1WJ4 A;  3IT4 B;  2Y3A A;  4B0E A;  4JWU C;  4A55 A;  2N9E B;  4GDL A;  2K8C A;  5IA7 A;  3DWM A;  4HXD A;  4WAF A;  3V62 A;  1LXD A;  2BS3 B;  4LNI A;  2ZPY A;  1WYW B;  1YN5 A;  4HLE A;  1IUE A;  4PYZ A;  2LJ5 A;  3AE7 B;  2HE7 A;  1HZ6 A;  4BKT A;  1BXT A;  2WDQ B;  1KLU D;  3BZD B;  5BYR A;  4PS8 A;  3KW5 B;  2WXF A;  3KH0 A;  2WWZ A;  2KDM A;  1XLO A;  2MBQ A;  3AE5 B;  3ZNG C;  4N59 A;  3FIL A;  2L3Z A;  3PSE B;  5LXI B;  1K8R B;  4MEL A;  2MW5 A;  5KHO A;  5BYS A;  2WDT B;  3DBH B;  1X1M A;  3ZDT A;  2MHJ A;  2TSS A;  3PLU A;  1D3Z A;  3VH3 B;  2J4X A;  5D3I B;  3Q14 C;  4K7W A;  3ML9 A;  4W9J A;  4XDC A;  1WXM A;  2JVC A;  5BO4 B;  5AEK B;  2MWS B;  1WX7 A;  4P1C C;  1GOZ A;  3L17 A;  3R2I A;  3PZ7 A;  4GMV A;  4NZL B;  3UIO B;  2EEL A;  2N7E A;  1F0Z A;  3R3M A;  2V3N A;  3UGB B;  1JCK B;  1WGK A;  5DPR A;  4LJP B;  1YJI A;  4F8C B;  2A5U A;  2L0F A;  2KAC A;  1C79 A;  5C23 A;  4W9I A;  4EZK A;  3DBR B;  4RFB A;  4HRS A;  4O1N A;  3U7D A;  4AS1 A;  2D2Q A;  3U2S C;  1YJJ A;  3RUI B;  2KDF B;  5JHA A;  2L8J A;  3BVM A;  4I6L B;  2NMQ A;  4FHJ A;  4YTP B;  1L5P A;  2LI5 A;  2Z0D B;  4YL8 A;  2K6D B;  3CSF A;  4HPP A;  1AYF A;  3VH4 B;  2DYM A;  3AEC B;  2M56 B;  2K9X A;  3KYD D;  4BKG A;  2HTM E;  2N9P C;  2N7J A;  1SSN A;  1T6B X;  2DNF A;  4TV3 A;  4AQ7 A;  4US9 A;  4DDG D;  3A9J B;  3VXW A;  2V1Y A;  2XNA C;  1H8C A;  4EUT A;  2W55 A;  4WJO A;  2BWE S;  1NI3 A;  1STE A;  4MGI E;  4W9F A;  2Q5W D;  3EHV A;  1JW9 D;  2KQ4 X;  1FNU A;  3L54 A;  2D11 A;  4KZ0 A;  5T8I A;  2CS4 A;  1JWM D;  2PIA A;  2BS2 B;  5D3D A;  1N5W A;  1M4V A;  1M94 A;  3ZTC A;  3PS6 A;  2IO1 B;  3VQI A;  2K8B A;  4JLC A;  1VJK A;  2KTR B;  5AUK A;  1P7E A;  2DHZ A;  3AN1 A;  4TUU A;  4FHK A;  4RM8 A;  4PS3 A;  3LJ3 A;  3OWE B;  3Q3M C;  4FJZ A;  3GE8 C;  1E8Y A;  1XLN A;  2WYQ A;  1WR6 E;  3DVG Y;  2HD5 B;  3PRE A;  4AJW A;  3OJ3 A;  4MSM B;  3P2B A;  4WWP A;  3AI5 A;  1ET6 A;  4F1S A;  3IBE A;  5EE3 A;  5AUI A;  4LNK A;  1F52 A;  2N1V A;  1P98 A;  3D32 A;  1ZW7 A;  2LXA A;  2FAZ A;  3RD2 A;  5FR3 A;  3P4Q B;  2V0G A;  2N1W A;  4WJN A;  2MLB A;  3IG3 A;  1GAQ B;  4GXB A;  2D5G A;  4ZRI A;  1LM8 B;  2NPT A;  2MCN B;  5C1Z A;  4GDL B;  3ZTD A;  3ZXV A;  1YQB A;  2PJH A;  5BMI A;  2KQ7 A;  2WXL A;  1OEY A;  2KAJ A;  2BWF A;  1JRO A;  2JF5 A;  4KZC A;  3SD5 A;  1VCB A;  2WGS A;  1GB1 A;  4DDI D;  1C76 A;  2PE6 B;  3L4P A;  1MJD A;  2NR2 A;  1ZGU B;  1WJN A;  3H6N A;  3RT3 B;  2Y5B B;  4DXG A;  1R4M B;  3TIX A;  3WAM A;  1I7H A;  3FIL B;  1IGC A;  3ZUN A;  2AL6 A;  2G9H D;  5EE9 A;  1WF9 A;  4BOS C;  1RAX A;  4TSS A;  2QEJ C;  3M63 B;  2BYE A;  1C9F A;  2C5L C;  2KXJ A;  1WGR A;  3DBS A;  1WSP A;  2MJ3 A;  4FA6 A;  1I4R A;  3IT6 B;  1FRR A;  2KFJ A;  1ET9 A;  1SGH A;  1B9R A;  3CMM B;  3Q3O C;  1TS4 A;  3U7Z A;  3HVZ A;  2KJ6 A;  3A33 B;  5MPO A;  1E7P B;  2B3A A;  1C77 A;  2DWQ A;  2L05 A;  3DHI C;  2GBK A;  1CJE A;  4KGR A;  3DWG C;  4WJP A;  3E9S A;  2V9H A;  1Q5W B;  1XT9 B;  5IP4 D;  1P7F A;  3TEZ A;  3RZF A;  5EE0 A;  5LLI A;  2VZK B;  3BII D;  2KO3 A;  2UU7 A;  2H88 B;  1L6U A;  2KVR A;  1QF6 A;  3APC A;  1JWS D;  3BYY B;  1UWM A;  3RNG C;  3DDC B;  4HCP B;  3HHM A;  5D94 A;  3B08 A;  1SIF A;  2JWU A;  3L10 B;  4GSW A;  3VUY A;  1GB4 A;  2FCM A;  3NZ3 A;  2C7N B;  3GZN I;  4OVZ A;  2MJD A;  4CYE A;  1A5R A;  5J18 A;  1ENF A;  1MHH E;  1V81 A;  2JSV X;  2NS5 A;  3OG5 A;  4PS7 A;  3VFK A;  1HXY D;  4MGY E;  5G2N A;  3I3T B;  1FMA D;  4DHZ E;  1E6E B;  2L7R A;  4KVG B;  3Q6B A;  4W9H A;  2FCQ A;  1FNW A;  4M02 A;  1VR9 A;  3AEB B;  5CX3 A;  1QOG A;  1RLF A;  1KFY B;  4K7S A;  1LQB A;  3R8B A;  3PHW B;  2O2V A;  1LO5 D;  2L1A A;  3SFD B;  2K0P A;  5IKC M;  4LNN A;  1G6J A;  1Q1O A;  1K51 A;  3ENE A;  4WWN A;  2JZ3 B;  2N9L A;  3DCG A;  1SJH D;  1SEB D;  2JQR B;  2KC1 A;  1HE8 A;  1KTK A;  1GNU A;  3ZW3 A;  2C7M B;  2DZJ A;  4JL9 A;  3C19 A;  1TS3 A;  2K3U A;  4P1B C;  1WGH A;  3Q2A C;  4HDQ A;  3A1Q A;  2DLB A;  4LNF A;  3PLV A;  2ZW0 A;  1ZUD 2;  1I42 A;  2IO0 B;  3Q8C A;  3I5J C;  3ABV B;  1T3Q A;  2M8S A;  1FXT B;  5IAA C;  3DBL B;  1C3T A;  2WNM A;  3W5U B;  1L4D B;  1E0Z A;  2WXM A;  4FAD A;  2KJR A;  3AE1 B;  3NZS A;  3BY4 B;  3K9P B;  3H7S A;  4RNA A;  1WXS A;  2KN5 A;  3Q8A A;  4XX5 A;  4EE2 A;  4CHK A;  1TS5 A;  4EFO A;  1HZ5 A;  1I35 A;  5DCN A;  3PZD A;  3UIP B;  3P1M A;  4IM2 A;  1KF6 B;  1FRD A;  2KTF A;  4HDO A;  4B9K A;  2NPT B;  1L0V B;  3NHE B;  1C1Y B;  2CR5 A;  5JZE B;  2RR9 A;  1JAL A;  1XO3 A;  4HCN B;  5CHV C;  1OTR B;  3W1S C;  4YSY B;  1JRP A;  3E56 A;  3ZLZ A;  4US8 A;  1E7U A;  3R2T A;  3IVF A;  2V4L A;  1CK1 A;  2J42 A;  3PPA A;  1WMH A;  1D6E C;  3VVW B;  3ZQ4 A;  2KK8 A;  4MSQ B;  2WXH A;  3BK1 A;  3AXC A;  3H1U A;  2JXT A;  1OEY J;  3GE3 C;  3KWL A;  2NBV B;  1SIJ A;  2KVZ A;  3Q3N C;  4EOY A;  4CO7 A;  2DYB A;  3W9C B;  3EEC A;  3NOB A;  2KLC A;  3B9J A;  1PGA A;  4REZ A;  4GB9 A;  4ACF A;  3AED B;  1L6V A;  1FD6 A;  2PKO A;  5L95 C;  4WWM A;  1FCC C;  3BK2 A;  2IDY A;  4LLG M;  1PYW D;  2C60 A;  3VR9 B;  3NG0 A;  2IO3 B;  5IN7 A;  4D2K A;  1EO6 A;  2YEP B;  3T3O A;  3LDZ E;  1TGZ B;  2AEH A;  3Q8B A;  4HPL B;  1P9D U;  3V05 A;  4I6N B;  4XDD A;  3MC0 B;  2LZ6 A;  4HRO A;  4ANU A;  4WAA A;  5HKH A;  2KWC A;  2RDH A;  3BVZ A;  1WZ3 A;  3T9L A;  3TMP B;  2JZP A;  2LGY A;  4HVB A;  4YXD B;  3MHS D;  4A20 A;  4M01 A;  1KJT A;  4G3X B;  3GP7 A;  2FIF A;  1V5T A;  3FKY A;  1ZOY B;  1V1P A;  2L0T A;  3PZ8 A;  2VH1 A;  4XZ4 A;  4JQW C;  3SEB A;  3AB5 A;  5AZH A;  1L0X B;  2K5P A;  2C9W B;  4ARI A;  2JXX A;  2K25 A;  1TJE A;  4C4V A;  2N4F A;  1I4P A;  2EMT A;  4DXF A;  3ZRF A;  1DOX A;  2BT6 A;  1E10 A;  3QAQ A;  3B2F A;  3IXS A;  4DBG A;  4II3 B;  3TBL D;  2K6Q A;  1ZPS A;  2ASQ A;  4HEA 1;  1VD2 A;  4FBJ B;  3Q3J A;  2IZV B;  2KNB A;  2OJW A;  2YEP F;  2O2V B;  1TY2 A;  1TIF A;  4HPM B;  3QX1 A;  4KDL B;  2GRI A;  3GOE A;  1RFK A;  1J8C A;  1EWC A;  3KUZ A;  1AAR A;  1S1Q B;  1QQR A;  1ESF A;  2PLP A;  3ZIM A;  3QAR A;  3VR8 B;  2KMM A;  3CF6 E;  3NS1 A;  2YLM A;  1NEK B;  2ZZP B;  1U4A A;  3I63 C;  1UBQ A;  3A1Q B;  2PPH A;  2I1J A;  3VAW A;  4R3D A;  1ZP0 B;  2WQY B;  3MTN B;  1WGD A;  3DBH I;  1RFA A;  2VRR B;  3P4P B;  1UF0 A;  3RZW C;  2PEA A;  2ONQ A;  3P42 A;  1WX9 A;  4OVV A;  4WQO B;  2INN E;  4IOI E;  4ZRK A;  3HVD A;  1NI2 A;  2GBJ A;  1ZE3 D;  1GC6 A;  2KQS A;  1FEH A;  2ACZ B;  2FUG 1;  5LXH A;  1A70 A;  1V80 A;  2W3R A;  1NDD A;  5DPS A;  1AW7 A;  1ZDV A;  3AM9 A;  5EE1 A;  2KDE B;  1XCT L;  1WH3 A;  4M00 A;  3ZRC A;  4ANW A;  1JWU D;  4KV2 A;  4ZYN A;  3AE9 B;  4W9C A;  5E6N A;  4PK1 A;  1PFD A;  2KDI A;  2ZCB A;  1ACC A;  3DBR I;  2NCN A;  1CZP A;  3H9D A;  4II2 B;  1TS2 A;  1I4X A;  2DAF A;  2H89 B;  5IO9 A;  2ZNV C;  2ZVN A;  4WQM A;  2O6V D;  1HTO A;  1RRB A;  1MI0 A;  2LMC A;  1V6E A;  2PMV A;  3JYU A;  2WXQ A;  4W9D A;  4F7Z A;  1OGW A;  1GPX A;  3CST A;  1WR1 A;  1YD8 U;  2WXO A;  3TUO A;  3T3N A;  2WX0 A;  5TSS A;  2GBN A;  2JT4 B;  2MBH A;  3B2G A;  4WIP A;  3CWI A;  4HK2 A;  3I57 A;  1WMH B;  2DBY A;  3AU5 A;  4A90 A;  4G50 A;  2J53 A;  3APF A;  1D5Z C;  4GOC A;  4KIK A;  5D7G A;  1C4P A;  3QK0 A;  2CKH B;  4ITK A;  4NAW A;  2JY6 A;  3P4S B;  4OZA A;  4W9K A;  3IAM 1;  2G4D B;  4DXA B;  4NQL B;  3QWZ B;  2QIL A;  3LB8 C;  2EKE C;  1NEN B;  3QJZ A;  2WXK A;  1LFD A;  3HM3 A;  4JWS C;  4L2Y A;  1JWB D;  1UH6 A;  3QHT A;  4RGT A;  1KH0 A;  2MA9 B;  3BVG A;  1WZ0 A;  2NTT A;  1NVI D;  3X0W A;  1FCL A;  2IY0 B;  3DOW A;  3FC4 A;  3R7Q A;  4KKJ A;  4FN2 A;  5D6J B;  4MGZ E;  1IP9 A;  2RDB C;  3NZU A;  3HUI A;  4XYC A;  3C0R B;  1C78 A;  2CHW A;  2IPK D;  2KC2 A;  1E5W A;  1ZXI A;  4E71 A;  2D07 B;  2KLG A;  2WHI A;  3V3X A;  4GDK A;  2RD0 A;  4NPN A;  1GC7 A;  3QA8 A;  3ZO5 B;  3ZJU A;  3URY A;  1F1H A;  3DQV A;  3JVZ X;  3H7P A;  1OFF A;  1YN4 A;  3KLS X;  4IUM B;  4NJ6 A;  2FCN A;  2LXC A;  2Z59 B;  2LGD A;  1V1P B;  1HQR D;  1XQQ A;  4IKG A;  4S17 A;  4NJC A;  1E90 A;  3MHZ A;  2EKI A;  2L32 A;  4M0W A;  2BYV E;  2DYO A;  4B0M A;  1H4R A;  3LYY A;  1UZX B;  1K52 A;  4C4V B;  1P0R A;  1WGG A;  2J0J A;  1T0Y A;  1EWY C;  4USA A;  1V1O A;  1YIW A;  4KX6 B;  4K7U A;  5KHQ A;  1S3S G;  1D5M C;  2MBE A;  2L83 A;  5CTR C;  5GXG B;  4C56 C;  2BGF A;  3EFU A;  1XLP A;  4BBN C;  2D3A A;  2BKF A;  3ZKJ C;  3UF8 A;  2RSU A;  1IGD A;  3DHH C;  1SBB B;  2DX5 B;  1TKY A;  5E6P A;  1L7Y A;  1PDX A;  2K22 A;  3PT2 B;  2IGG A;  1UD7 A;  2LRU A;  1R4M I;  1N5X A;  4J3O D;  1DOY A;  1WXQ A;  4W9E A;  4YTN B;  1FO4 A;  4RF1 A;  3ML8 A;  1WM3 A;  1V8C A;  2NVU I;  4N6E B;  4MDK E;  4XWT A;  2PVO D;  1YJ1 A;  3GB1 A;  5HI1 A;  3RNA C;  3NJT A;  2G45 B;  3JSV A;  3VTV A;  4B6W A;  3UQB A;  3Q8F A;  4ARC A;  1HEZ E;  2WU2 B;  1AN8 A;  3APD A;  4W9G A;  2WS3 B;  1R4N B;  2VH2 A;  4FJY A;  1ISN A;  4FUL A;  4S0R A;  1WE6 A;  2SEB D;  2QIE B;  2KN4 A;  2W54 A;  4MH8 A;  1SJE D;  2W3S A;  4B95 A;  4RH6 A;  2HTH A;  3NRZ A;  2BYF A;  4DHZ B;  3LXF A;  2LAS A;  3AEA B;  2WXN A;  3EGR A;  2AQ1 B;  3L0W B;  4EZJ A;  3BIN A;  4RCO A;  2J0M A;  1MPE A;  1V9J A;  2RMM A;  2UYZ B;  4ZRQ A;  2QDF A;  2Y5C A;  3TSS A;  3TEX A;  1IBX A;  3ETR A;  2FNJ B;  1J0G A;  3B1L X;  4LK0 M;  2KD0 A;  1CQV A;  3MFG A;  1ZXH A;  2Y5P A;  1UGM A;  2DZK A;  4BOZ B;  4ZHP A;  3WCQ A;  2XN9 C;  4LDT D;  4NY0 A;  4ZRP A;  5L83 A;  2A4Z A;  4G0N B;  3V6E B;  2L52 A;  2G1E A;  3I9V 1;  2BS4 B;  5DPT A;  3TJP A;  4KIK B;  4MJS A;  4NAW B;  2J7Q B;  4DHJ D;  2UWQ A;  4PYU A;  3QIJ A;  5JXV A;  4K3C A;  4HJG E;  4TKN A;  3HM6 X;  3NVW A;  2PTL A;  4KKI A;  4AP4 C;  1TZO A;  1WWT A;  4AUQ C;  1ROE A;  3QCA A;  3DVN U;  4ZHO A;  2NBU A;  3OAW A;  4C7Y A;  3PTF C;  2QC8 A;  1WXV A;  3W5V B;  1LGR A;  2WP9 B;  4NJ7 A;  4ZYS A;  5I4D A;  1MG4 A;  2OJR A;  2K8H A;  2V3S A;  5CHF A;  3N1Z C;  3O13 A;  3M3J A;  4H2A A;  1N6Z A;  1EU4 A;  1SE3 A;  3IFW B;  4GDK B;  1T0S C;  2ZPN A;  4MAC A;  3UI3 A;  1SB3 C;  4OZB A;  4JX1 C;  2YVC A;  1Y8R C;  4LTU A;  4XWW A;  3TCA A;  3DBL I;  3P4R B;  2DZI A;  3A4S C;  4N9F 4;  1FXI A;  2LRW A;  1VLB A;  1BUI C;  4GIV A;  4C80 A;  3H7P B;  1WI0 A;  1V97 A;  4ZDV A;  3SR6 A;  3WIM A;  3ZNZ B;  1BML C;  4XE0 A;  5HFY A;  3DVG X;  5BMG A;  1K53 A;  2QCZ A;  4AOF A;  1J19 A;  4KDI C;  1XEE A;  4RGN A;  4P16 A;  1T0R C;  4M0W B;  3N9Y C;  5D2M B;  4E74 A;  2I1K A;  2E3T A;  3WAL A;  2RPQ A;  2HJ1 A;  3PV1 A;  1MFW A;  3X23 A;  2FBW B;  1WJ6 A;  2MJE A;  3UIN B;  4IWO A;  2MQJ A;  3Q8E A;  2IBI B;  2CHX A;  3ZJV A;  1KLV A;  1TT5 B;  3U4E G;  1EM7 A;  1XF5 L;  2LGI A;  3AE4 B;  1XLQ A;  3NUH B;  4G11 A;  4LDT B;  4ZRJ A;  1SF0 A;  2WDV B;  2CU3 A;  4IG7 B;  5E6O A;  4MM3 A;  1I4H A;  5GMV A;  4HJK A;  3RI7 C;  1XXG A;  1L0Y B;  4L1B A;  5IOI A;  2V4I B;  3RFZ B;  5FK9 C;  1XD3 B;  4LNO A;  2CJO A;  3ZGZ A;  2KHW B;  2IND C;  3MP9 A;  3SFE B;  2KX0 A;  2Z0E B;  3RNF C;  1SXT A;  4JPS A;  3ZVV A;  3EC8 A;  2XEW A;  2BF8 B;  1UBI A;  2ZW1 A;  3OJ4 B;  1V86 A;  3A9K A;  2QHO A;  1QKZ A;  5BYQ A;  3JSV B;  3AU4 A;  2WXR A;  1SE9 A;  2WXI A;  4MH0 E;  4DK5 A;  4TQ1 A;  1UNS A;  1YX6 B;  3ZNH B;  3BYT B;  1DYQ A;  4JGH B;  1C4A A;  1WX8 A;  1QOA A;  1QZE A;  3NVY A;  2W9N A;  4PT5 A;  2O6V A;  3GS2 A;  2AX5 A;  1YMH E;  5HG2 A;  3CIR B;  2LVP A;  3J9C A;  4WJQ A;  2ON8 A;  1D5X C;  1SE2 A;  1K50 A;  2LVO A;  2NTS A;  1VDV A;  5G55 A;  1TTN A;  3RYT A;  4OHJ A;  4TQ0 A;  1E8W A;  4EZL A;  2XK5 A;  1IBX B;  2X8X X;  1WYG A;  2D3B A;  4YSX B;  2LEK A;  3AE8 B;  2PW9 A;  3ZYY X;  3WAP A;  2WXP A;  3DVN V;  5TR5 A;  2ZEQ A;  4GGQ A;  4BZA A;  3NVV A;  4NAM A;  2KWD A;  4ZOH C;  2LGX A;  3ZXR A;  1UUP A;  4ANV A;  3ZNI D;  1KM7 A;  1SE4 A;  4MJS B;  1FFV A;  1YQ3 B;  2CU1 A;  2FCS A;  1JML A;  3M62 B;  2LVQ A;  3DPD A;  2INC C;  4WH4 A;  1MG8 A;  2CJN A;  5DPW A;  4CQN A;  5CHW A;  3NY5 A;  2C7H A;  4TMA B;  4BAX A;  1IPG A;  3PRM B;  3RNE C;  1EF1 A;  1FFU A;  1N63 A;  2FID A;  3Q69 A;  3VDZ A;  1L4Z B;  2FUH B;  4P6V F;  4NQK E;  2GMI C;  1F2R C;  2KOX A;  1IYF A;  1KRH A;  3QQ8 B;  4XC2 A;  2INP E;  3N1Y C;  1MHX A;  4UDU C;  3MJW A;  2BBC A;  1FIQ A;  2M19 A;  1QLB B;  2JPH A;  5FR6 A;  2KWU B;  3U52 E;  1J7C A;  1KOT A;  2R2Q A;  3P63 A;  4GN1 A;  3AMZ A;  3AE2 B;  3EUB 2;  5H92 C;  1V49 A;  2REX A;  3VUX A;  3H8H A;  3N1X C;  4HKZ E;  3AH7 A;  4C00 A;  3V61 A;  3RPF C;  4MEM A;  4LJO B;  2RDG A;  3WAN A;  3U8Z A;  3IAS 1;  2M0X A;  4L23 A;  2KFK A;  2MBO A;  5E6J A;  1DGJ A;  1Q0W B;  1T0Q C;  3N20 C;  2MEK A;  3VHT C;  4A3P A;  4K3B A;  5C2T B;  3WAO A;  3K9O B;  1WRD B;  5BMH A;  3AUL A;  2M17 A;  2L00 B;  1V2Y A;  4QAY A;  4WUR A;  2AWT A; 
#chains in the Genus database with same CATH homology
 2W82 A;  4XWT A;  2PVO D;  1I4G A;  3GB1 A;  1L0V B;  5H8Y E;  5HI1 A;  2TSS A;  2J4X A;  3Q8F A;  5D3I B;  4ARC A;  1HEZ E;  1JAL A;  2WU2 B;  1XO3 A;  1FNV A;  3KQ4 A;  1AN8 A;  2VZK D;  4XDC A;  2WS3 B;  4YSY B;  1JRP A;  3E56 A;  1GOZ A;  4US8 A;  2SEB D;  1WRI A;  2JYE A;  2QIE B;  3PZ7 A;  3R2I A;  3R2T A;  4KGT A;  4MM3 B;  1CK1 A;  2Z8L A;  2J42 A;  2KN4 A;  2HDE A;  2W54 A;  4MH8 A;  4NZL B;  1SJE D;  4YWG G;  2W3S A;  1D6E C;  3ZQ4 A;  2EEL A;  1F0Z A;  4RH6 A;  2WXH A;  3BK1 A;  3NRZ A;  2V3N A;  1JCK B;  1WGK A;  2JXT A;  3LXF A;  4OZC A;  1J7B A;  1YJI A;  2KAC A;  1C79 A;  2WXN A;  3AEA B;  3TEW A;  3PO0 A;  3EGR A;  4RFB A;  1DOI A;  2AQ1 B;  4HRS A;  3KWL A;  3W2D A;  4RCO A;  4DQO C;  2QJL A;  1SIJ A;  4O1N A;  1MPE A;  4AS1 A;  2RMM A;  3U2S C;  4ZRQ A;  1NYR A;  1YJJ A;  5FKA C;  3W9C B;  1FM0 D;  3BVM A;  2Y5C A;  3TSS A;  3AE6 B;  2NMQ A;  1C4C A;  3B9J A;  1PGA A;  4REZ A;  4YTP B;  3TEX A;  1L5P A;  1IBX A;  2V3P A;  2I2Y A;  3AED B;  1L6V A;  2BB6 A;  3ETR A;  1FD6 A;  2PKO A;  4WWM A;  4LK0 M;  1FCC C;  1CQV A;  1AYF A;  3BK2 A;  3MFG A;  1ZXH A;  1VZ7 A;  2DYM A;  2IGD A;  2Y5P A;  2IDY A;  3AEC B;  4LLG M;  1PYW D;  3KWV A;  2M56 B;  2K9X A;  3VR9 B;  3WCQ A;  2XN9 C;  4ZHP A;  1EU3 A;  4D2K A;  2HTM E;  2YEP B;  4RGO S;  3T3O A;  4ZRP A;  2N7J A;  4YTM B;  1SSN A;  1T6B X;  3Q8B A;  2L52 A;  3V05 A;  4AQ7 A;  4US9 A;  4XDD A;  3MC0 B;  2G1E A;  3I9V 1;  2BS4 B;  4KGS A;  4HRO A;  2XNA C;  1TY0 A;  2RDH A;  3BVZ A;  4NAW B;  2W55 A;  3HRD D;  2I38 A;  4MT5 A;  5JXV A;  1NI3 A;  2PVG C;  2JZP A;  1E9M A;  4HJG E;  2BW2 A;  1STE A;  3NVW A;  2Q5W D;  2PTL A;  4KKI A;  4YXD B;  1JW9 D;  1TZO A;  2LJI A;  2KQ4 X;  1FNU A;  1WWT A;  1ROE A;  3GP7 A;  5T8I A;  1JWM D;  2PIA A;  1ZOY B;  4ZHO A;  1V1P A;  2BS2 B;  5D3D A;  1N5W A;  3PZ8 A;  1M4V A;  1QT9 A;  4C7Y A;  3SEB A;  3AB5 A;  3VQI A;  4C7Z A;  3W5V B;  1L0X B;  2K5P A;  2WP9 B;  2B76 B;  4ZYS A;  1VJK A;  4ARI A;  1UWX A;  3MJ5 A;  1TJE A;  5I4D A;  1F2R I;  5AUK A;  1I4P A;  4DXF A;  2BB5 A;  1DOX A;  1P7E A;  2BT6 A;  3AN1 A;  3O13 A;  4H2A A;  1E10 A;  1EU4 A;  1SE3 A;  3B2F A;  3IXS A;  2AQ2 B;  4GDK B;  2LUM A;  3OWE B;  1ZPS A;  4MAC A;  4HEA 1;  2N0S B;  3UI3 A;  1SB3 C;  4OZB A;  1XLN A;  4JX1 C;  4LTU A;  4XWW A;  1AWD A;  3P4R B;  1FXI A;  2YEP F;  1N61 A;  1VLB A;  1NYQ A;  1BUI C;  1N60 A;  1TY2 A;  4C80 A;  2QMT A;  3AEG B;  1V97 A;  1ET6 A;  2WU5 B;  3SR6 A;  2GRI A;  1RFK A;  1BML C;  4XE0 A;  5EE3 A;  5HFY A;  5AUI A;  3AV8 A;  1EWC A;  5BMG A;  1K53 A;  1QQR A;  1ESF A;  2PLP A;  3VR8 B;  2KMM A;  2WXG A;  3C8Y A;  2IGH A;  2GI9 A;  5FR3 A;  2ICI A;  3P4Q B;  1XEE A;  3NS1 A;  4RGN A;  1NEK B;  4P16 A;  2V0G A;  2RPV A;  3N9Y C;  4JE3 B;  2M0A A;  1GAQ B;  2D5G A;  2E3T A;  1FXA A;  2LHD A;  4R3D A;  4GDL B;  1TYG B;  1ZP0 B;  1OQQ A;  2WQY B;  2FBW B;  2MH7 A;  2MJE A;  5BMI A;  2WXL A;  1TKG A;  2KAJ A;  2E6X A;  3P4P B;  4RF0 A;  4Q2J A;  1JRO A;  1VRA B;  1T5X D;  3Q8E A;  3ZJV A;  2ONQ A;  3AEF B;  3P42 A;  1EM7 A;  1RWS A;  1XF5 L;  1Y56 A;  2LGI A;  3AE4 B;  3U4E G;  5LNK 1;  1XLQ A;  2INN E;  3NUH B;  4IOI E;  1GB1 A;  3HVD A;  3W1S A;  1C76 A;  1ZE3 D;  1SF0 A;  2JYT A;  2WDV B;  2CU3 A;  3L4P A;  1QOB A;  1FEH A;  2ACZ B;  2FUG 1;  1I4H A;  2R61 A;  1A70 A;  2W3R A;  4DXG A;  1AW7 A;  1PGB A;  1ZDV A;  1XXG A;  2WDR B;  1L0Y B;  3AM9 A;  4L1B A;  5EE1 A;  1XCT L;  2V4I B;  3RFZ B;  1F77 A;  5FK9 C;  1I7H A;  1Q10 A;  3FIL B;  1IGC A;  1JWU D;  2CJO A;  3AE9 B;  3ZGZ A;  2JU6 X;  3MP9 A;  2G9H D;  5EE9 A;  1PFD A;  3SFE B;  4TSS A;  1SXT A;  2QEJ C;  2JX5 A;  2J52 A;  1C9F A;  1ACC A;  4JPS A;  4IDI A;  1PUT A;  1WSP A;  2MJ3 A;  1I4R A;  1CZP A;  2ZW1 A;  1TS2 A;  3IT6 B;  1I4X A;  4A6Q A;  2LFI A;  1FRR A;  2H89 B;  1ET9 A;  1B9R A;  4WQM A;  1QKZ A;  5BYQ A;  4A9A A;  3ZJT A;  1TS4 A;  3U7Z A;  2LMC A;  1MI0 A;  3HVZ A;  2PMV A;  2WXQ A;  1TKE A;  2WXR A;  2WXI A;  2N9K A;  5MPO A;  1GPX A;  4TQ1 A;  1UNS A;  1E7P B;  1QOF A;  4HKQ A;  1C77 A;  2DWQ A;  2WXO A;  3TUO A;  3BYT B;  3T3N A;  1DYQ A;  1N62 A;  1C4A A;  1YN3 A;  4WIP A;  5TSS A;  3B2G A;  3CWI A;  1CJE A;  2SAK A;  3I57 A;  1QOA A;  4KGR A;  3DWG C;  2FE8 A;  3NVY A;  1VZ6 A;  4PT5 A;  3E9S A;  2DBY A;  4RGM A;  4A90 A;  2J53 A;  3GS2 A;  2AX5 A;  1P7F A;  1D5Z C;  2GB1 A;  1YMH E;  4N58 A;  5G5G A;  3TEZ A;  5HG2 A;  5EE0 A;  3CIR B;  2VZK B;  3J9C A;  5D7G A;  1C4P A;  3BII D;  4ITK A;  5C3J B;  2H88 B;  2ON8 A;  1L6U A;  3P4S B;  4OZA A;  1D5X C;  1SE2 A;  1QF6 A;  1HA5 A;  3IAM 1;  1K50 A;  2WLB A;  1XCQ L;  2IJ0 A;  1JWS D;  3BYY B;  2QSD A;  2NTS A;  1UWM A;  1JWA D;  3EA6 A;  2QIL A;  1VZ8 A;  3LB8 C;  1I4Q A;  2JWU A;  1YQ4 B;  1VDV A;  1NEN B;  4TQ0 A;  4OHJ A;  1RM6 C;  2WXK A;  1KLG D;  4JWS C;  1GB4 A;  1IBX B;  4L2Y A;  1JWB D;  1WYG A;  3NZ3 A;  1MVK A;  2LEK A;  3AE8 B;  4YSX B;  2PW9 A;  4OVZ A;  1KH0 A;  2MJD A;  4RGT A;  3ZYY X;  3BVG A;  2NTT A;  1R7S A;  5HHD G;  1ENF A;  1MHH E;  1NVI D;  2WXP A;  4FXC A;  2JSV X;  3FAH A;  1FCL A;  4A8X C;  1HXY D;  1RYJ A;  3VRA B;  3FC4 A;  3TEY A;  4KKJ A;  1FMA D;  3NVV A;  3HUI A;  1B1Z A;  4NAM A;  1E6E B;  1C78 A;  2IPK D;  1ZXI A;  2LHE A;  2KWD A;  1PGX A;  5G5H A;  3NVZ A;  4ZOH C;  3V3X A;  4GLS C;  1FNW A;  1UGJ A;  1UUP A;  1VR9 A;  2X38 A;  3AEB B;  1YNT E;  1SE4 A;  1QOG A;  2BYT A;  1FFV A;  1YQ3 B;  1JML A;  2AQ3 B;  1KFY B;  2BTE A;  4OW0 A;  3ZJU A;  1ZDX A;  3AE3 B;  1QIL A;  4YSZ B;  3R8B A;  2WXJ A;  4WH4 A;  2OHF A;  3URY A;  1LO5 D;  2L1A A;  3SFD B;  2K0P A;  3VRB B;  2CJN A;  1OFF A;  2OED A;  1YN4 A;  3BWU D;  4CQN A;  3KLS X;  4TMA B;  1K51 A;  1D4B A;  1J7A A;  1V1P B;  1HQR D;  2N9L A;  4IKG A;  1SJH D;  1SEB D;  4NJC A;  2JQR B;  3MHZ A;  1KTK A;  1FFU A;  3AEE B;  1OQR A;  1N63 A;  2EKI A;  2L32 A;  4YT0 B;  3Q69 A;  4M0W A;  2DYO A;  1TS3 A;  4B0M A;  1L4Z B;  2K3U A;  3LYY A;  4P6V F;  1JQ4 A;  1K52 A;  1F2R C;  1KRH A;  3IT4 B;  2INP E;  2DLB A;  2Y3A A;  4B0E A;  1MHX A;  4JWU C;  1EWY C;  4USA A;  1V1O A;  4A55 A;  4UDU C;  2BBC A;  1FIQ A;  2ZW0 A;  1ZUD 2;  4KX6 B;  2M19 A;  1QLB B;  3DWM A;  4WAF A;  1D5M C;  2L83 A;  3Q8C A;  5GXG B;  4C56 C;  2BS3 B;  3U52 E;  1J7C A;  3ABV B;  1T3Q A;  3P63 A;  1YN5 A;  1XLP A;  3AMZ A;  1IUE A;  3AE7 B;  3AE2 B;  3EUB 2;  5H92 C;  1HZ6 A;  3H8H A;  1BXT A;  2WNM A;  2WDQ B;  3W5U B;  4HKZ E;  3AH7 A;  1L4D B;  1IGD A;  3RPF C;  1KLU D;  1E0Z A;  2RDG A;  2WXM A;  3BZD B;  1SBB B;  5BYR A;  3IAS 1;  1TKY A;  3AE1 B;  1PDX A;  2WXF A;  4L23 A;  2K22 A;  2IGG A;  1XLO A;  2KDM A;  3AE5 B;  5E6J A;  4RNA A;  1DGJ A;  1N5X A;  4J3O D;  1DOY A;  3Q8A A;  2MEK A;  1WXQ A;  4N59 A;  4EE2 A;  3FIL A;  1TS5 A;  1HZ5 A;  5C2T B;  5BMH A;  3P1M A;  1KF6 B;  4YTN B;  1FRD A;  1FO4 A;  4WUR A;  4RF1 A;  5BYS A;  4N6E B;  1V8C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...