1HZ5A

Crystal structures of the b1 domain of protein l from peptostreptococcus magnus, with a tyrosine to tryptophan substitution
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
72
structure length
72
Chain Sequence
MHHHHHHAMEEVTIKANLIFANGSTQTAEFKGTFEKATSEAYAYADTLKKDNGEWTVDVADKGYTLNIKFAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN L
publication title Structures of the B1 domain of protein L from Peptostreptococcus magnus with a tyrosine to tryptophan substitution.
pubmed doi rcsb
source organism Finegoldia magna
molecule tags Protein binding
total genus 21
structure length 72
sequence length 72
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-01-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1hz5A00
2LUMA 1JMLA 1PGAA 2KACA 2JZPA 1XCQL 1IGDA 1KH0A 1PGXA 2ON8A 4WH4A 1C9FA 4HKZE 2J52A 4OZBA 2I38A 5BMGA 1P7FA 2ZW0A 2RMMA 1XF5L 1FCCC 2PW9A 5JXVA 2N9KA 4IOIE 2K0PA 2QMTA 1HZ6A 2J53A 2KWDA 4HJGE 2NMQA 1QKZA 2OEDA 1UWXA 1GB1A 1IBXB 1XCTL 2EELA 1PGBA 2IGDA 1HZ5A 2KQ4X 2JSVX 1K52A 5HHDG 2LHEA 2JXTA 1K50A 4OZAA 3FILB 2N7JA 4KGRA 1D4BA 2LHDA 2IGHA 2PLPA 2ZW1A 2GI9A 2I2YA 3GB1A 3UI3A 1IBXA 1MVKA 4GLSC 1YNTE 4IKGA 5HI1A 5BMHA 1FD6A 1MPEA 2QSDA 1YMHE 2KN4A 5HG2A 5HFYA 1IGCA 2ONQA 1HEZE 2JWUA 1K53A 1P7EA 4KGSA 1GB4A 4MACA 1K51A 2N9LA 1F2RC 3MP9A 4OZCA 2IGGA 4D2KA 4KGTA 2KDMA 2LGIA 5BMIA 1MI0A 2JU6X 1F2RI 2GB1A 1FCLA 1EM7A 2RPVA 1MHHE 1Q10A 3FILA 2PTLA 1MHXA 1ZXHA 3V3XA
chains in the Genus database with same CATH superfamily
3A1QA 3BK1A 3M3JA 1PGAA 2JZ3B 2MLBA 2JZPA 4W9HA 1WXAA 4TMAB 4ANVA 2J0JA 4HRSA 3U2SC 4IUMB 2WHIA 4C56C 1I4GA 3PREA 4DWFA 3ML9A 3I9V1 2BTEA 2MHJA 2BB6A 1JQ4A 2LFIA 4GMVA 2LEKA 4C7YA 4W9KA 4JL9A 2D07B 1KLVA 2MH7A 2K9XA 3KUDB 1R4MB 1PFDA 1C77A 2NBUA 1F77A 1WXVA 1ET9A 4OZAA 1YQBA 3DBHB 2AQ2B 2CHXA 5J2RA 4REZA 1UGJA 2GI9A 1FEHA 2NPTA 1I35A 5BMHA 2UU7A 5L83A 1ZXIA 4PS8A 4BKSD 3P2BA 1EWYC 2PE6B 3K9PB 2KWCA 4QAYA 3UINB 1YN3A 2JWUA 4GU2A 1WY8A 2MA9B 5DCNA 5EE3A 3UGBB 2E6XA 3BYTB 2R2QA 1QF6A 3DBLI 3AV8A 1FPYA 4F8CB 3RULA 5IKCM 3I57A 2MQJA 3H9DA 5CTRC 1Q10A 3ZNHB 1WM3A 4TSSA 1E7UA 4KX6B 4TQ1A 1YQ3B 4P1CC 4A55A 5BYQA 3DWGC 3Q8FA 5D94A 4HJKA 5IOIA 1G6JA 2KMMA 1WSPA 1J0GA 1J7BA 1UH6A 1XO3A 4FJVB 2I38A 4RGMA 4A90A 3EGRA 3EFCA 1E6EB 1JCKB 5LXHA 2VZKD 3VFKA 1QKZA 3AE2B 3AU5A 1JWMD 3RT3B 1VDVA 1WIAA 3OAWA 1D5ZC 2J7QB 1V6EA 2CKHB 4ZOHC 2CHWA 3Q8AA 2IZVB 2M56B 1B1ZA 4M0WA 2DZIA 2LHEA 3HRDD 3T3NA 3AM9A 4EEWA 5CHWA 4DXGA 3C19A 1P0RA 4LDTD 1N5XA 4A3OA 2WU5B 4W9JA 2XK5B 3ZKJC 4MJSA 4IKGA 4JGHB 2BS4B 1D3ZA 2RDHA 2QDFA 2FNJB 3SD5A 1YMHE 5HG2A 3W9CB 3TJPA 1EF5A 2KT7A 1WGDA 1SF0A 5AZHA 2JXXA 5C3JB 2KX3A 5L95C 4G0NB 2KTRB 2K5PA 1EO6A 3IFWB 4W9EA 1Q5WB 2IGGA 3N1YC 5C23A 3EHVA 1FNUA 1L6VA 2VZKB 1DOXA 3MHSD 4NJ7A 4RH6A 4NJCA 1J7AA 3V6CB 2JU6X 2L32A 1MHHE 5IA7A 3SFEB 2RPQA 1IYFA 1KOTA 3L4PA 1SBBB 4ZRPA 2FCMA 2BQQA 1TT5B 1Q0WB 1YJIA 3N1XC 3JVZX 2FCNA 3QIJA 3L16A 1I4QA 3N1ZC 1BUIC 2ZW0A 2WXOA 2WU2B 4IOIE 2IJ0A 2QMTA 1C4CA 1ZE3D 1XEEA 2LVQA 3IHPC 3WIMA 1QZEA 2MBEA 1HE8A 1L6UA 2IDYA 2ZNVC 3ENEA 1L2NA 2WXKA 1TS5A 3HVZA 3AEBB 1ZDXA 1LXDA 1EWCA 1K52A 1N60A 1JWSD 2PE9A 3RNEC 5BYRA 4HCNB 3ABVB 4IM0A 1YN5A 1SXTA 1D4BA 1DOYA 3PRMB 2DYOA 2MBHA 3MC8A 3UI3A 3MJ5A 4GGQA 2DWQA 1SB3C 4RGOS 2IYDB 2KZRA 3E9SA 2NBVB 1ESFA 2KXJA 2BYEA 1D5MC 2JYTA 4EUTA 2WDRB 4FADA 3HM3A 1T6BX 2N1WA 2HD5B 4JPSA 3IT6B 1P98A 2N9LA 4K7UA 2WYQA 2KLGA 2KFJA 3AU4A 3CF6E 1R7SA 1SIJA 1WGGA 4GIVA 2KDMA 3ZXRA 3PZ8A 2CU1A 3DBSA 2BYTA 4YWGG 3LXFA 1NI2A 2GBNA 1XLOA 1WJUA 1GPXA 1S1QB 2BB5A 3ZW3A 3WAPA 2WXGA 3R2IA 3VRBB 2DAFA 4II2B 2LUMA 3JW0X 3A9JA 2VH2A 2YVCA 2L0FA 1PGXA 4FJYA 4GDKB 4ZRIA 1E0ZA 4PT5A 1WGRA 1FIQA 1OEYJ 3JYUA 1QLBB 5KHQA 3WALA 1HZ6A 2TSSA 1IPGA 2LRWA 1TTNA 1EU3A 2D3BA 3VH3B 5AZGA 2B76B 4NZLB 1J8CA 1I4XA 4ZHPA 4I6PA 2JXTA 4HROA 3FILB 1D5XC 1FO4A 2AQ1B 3PSEB 1TJEA 2KDFB 1BMLC 2JQRB 4ANUA 3PZDA 2M8SA 2UYZB 3AE3B 4KSKC 1I4RA 3QCAA 4MM3A 1WXSA 2YLMA 4P7IA 2QSDA 2O6VD 2FE8A 4LLGM 1AYFA 3KUCB 4DQOC 4HLEA 4L2YA 3PTFC 2V4LA 1V5TA 3RNBC 2CJNA 2LMCA 1JWAD 1A70A 4S0RA 1K53A 3W1YA 1F0ZA 1UD7A 3P4PB 4G50A 3KH0A 2WXHA 4A8XC 3HVDA 3Q3FA 1YIWA 2DBYA 3B2GA 1RYJA 1WGYA 4DK5A 1EM7A 3DHIC 3ZVVA 2CJOA 1ZXHA 3VH4B 2Y5CA 4YTMB 1TGZB 1XQQA 1I42A 1WR6E 5T8IA 4IDIA 3AEEB 1OEYA 4DBGA 2K1FA 1C9FA 1P1AA 1WRIA 3TMPB 2WXLA 1XF5L 1VCBA 3GE3C 3HHMA 4WURA 2Z0DB 4KIKB 2MX2A 2J53A 3R7RA 5JH5C 4HVBA 3GZNI 4M8MA 1E7VA 5IAAC 3N20C 2KD0A 1TIFA 4GDLA 1H4RA 2NTTA 3AEFB 2QILA 5LNK1 2L7RA 2FAZA 2Y5PA 2QCZA 1BXTA 1C79A 2BS2B 2KK8A 1B9RA 1E8YA 3TSSA 2I2YA 3DVNV 2KDIA 3IAM1 3GOEA 2J0MA 4XWWA 1E8ZA 2V4IB 2KDEB 2JZZA 4RM8A 2KC2A 1OQQA 2CHZA 3O65B 3BIID 2PIAA 2DZJA 1GB4A 1ZP0B 3BZDB 5I4DA 4AJYB 2V3SA 1SJED 4MSMB 2IO2B 3NHEB 2IBIB 1NVID 2PJHA 4KZ0A 2GLSA 5BMIA 4ARIA 1BT0A 1C1YB 3MFGA 4DHZB 1F2RI 1FCLA 5H92C 3NVYA 4NAWA 3JSVA 1RM6C 1T0SC 3AB5A 4DDID 3H6NA 4AP4C 4KSLC 3RMKC 1GOZA 3IG3A 1JMLA 4ZHOA 3ZJUA 2KQSA 3FKYA 3NG0A 4E3CA 3QK0A 2J0KA 4FJZA 1KTKA 3M95A 2C60A 2M0AA 2AWTA 5JXVA 1XD3B 3KYDD 2K8BA 2NTSA 1N63A 1A5RA 5D2MB 1WMHB 2N9PC 3Q8EA 4XDDA 1UWXA 2LGYA 2FUHB 3Q6BA 2G3QB 2X8XX 4ANWA 3OG5A 5CX3A 1T5XD 2D2QA 5AEKB 3IBEA 4P1BC 3VAWA 2D3GA 2LZ6A 3ZNGC 4KV2A 1GC6A 3PGEA 3H7SA 3T3OA 2BF8B 5G55A 2LVOA 2C7HA 4EKUA 1NEKB 3FC4A 1YNTE 3GP7A 1L4ZB 1WRDB 2D3AA 3UQBA 2AL6A 2ONQA 5JZEB 3Q14C 2Z8LA 2WGSA 3B9JA 4IW0A 2AL3A 1IUEA 3VTVA 3O13A 3T9LA 2KVRA 3BINA 2XNAC 2QIEB 2Y5BB 4C80A 5DPSA 1I4PA 2H88B 1QOAA 2BWFA 4WWNA 2WXPA 3SR6A 4X57B 4D2KA 4GXBA 1S3SG 3PPAA 2Y3AA 3BVMA 2DENB 1EU4A 1GJZA 3Q69A 2GB1A 3ZO5B 1SEBD 5CHFA 3VUWA 1FFVA 3J9CA 3UQAA 2UWQA 1ROEA 1L4DB 1V5OA 2ZNVB 2BKFA 2OJRA 1I7HA 4LJOB 5EE9A 1ZPSA 2YEPF 3A9KB 1GNUA 3PV1A 3ZTDA 2FIDA 4BKGA 3L08A 2MBBB 1M94A 3L0WB 4K81A 3QAQA 4H2AA 1Z5SB 1WYWB 4EOYA 1FM0D 4RGTA 2KAJA 4ZRKA 4HJGE 4YSYB 4O1NA 1JW9D 1YJJA 4JLCA 3I63C 4RF0A 3TEZA 2MJDA 4FHJA 2IGDA 3AE7B 5C1ZA 1E10A 2KLCA 1XXGA 2WP9B 1TKGA 2V3NA 3QC8B 3MC9A 2K39A 1WXQA 4BBNC 3VQIA 2IGHA 4W9CA 4N58A 4HKQA 3NY5A 4ZRJA 1EUVB 3NZUA 4GLSC 4HDQA 1I4HA 5E6PA 3H7PB 4YTPB 2MBQA 1UNSA 1FXTB 5HFYA 1IGCA 2MBOA 2BBCA 3W5UB 5G5HA 4YSZB 4LNNA 3B1LX 3KWVA 5EE1A 4IWPA 2LGXA 4AQ7A 3VVWB 3ETRA 3WAMA 2L0TA 3P63A 4HWIB 4FN2A 2L83A 3QA8A 4IG7B 1R4NI 2JWZA 3NS8A 4OVVA 3RPFC 3EFUA 4HPMB 3LJ3A 4ICUA 5GMVA 3ZRCA 2IY0B 1AN8A 3R8BA 1JALA 3HUIA 1CZPA 3AI5A 3BWUD 1T0RC 2BS3B 2KYWA 1MFWA 2ZPYA 2LUEA 3WCQA 2ACZB 3NZSA 3RCZA 4DXFA 4WH4A 5G5GA 3Q8BA 2LJ5A 1HQRD 4BBNF 3URYA 3VTUA 3H1UA 3DBRB 1WR1A 3NS1A 4BVUC 4RNAA 1WFYA 3BYYB 4N6EB 2NMQA 3TCAA 1OQRA 4LDTB 2WX0A 3B2FA 2KFKB 4NQKE 3TEYA 1F9JA 5G2NA 4I6NB 2Q5WD 3R66C 1VJKA 2K8HA 1WI0A 4XGAB 3VRAB 4BFRA 3TL5A 2PLPA 4RFBA 3R2TA 2D10A 4J6IA 4WQOB 1KLUD 3P4RB 3DQVA 2MSED 2QEJC 2JVCA 4WJOA 1DOIA 5HI1A 1MG4A 3AEGB 3ZGZA 2K8CA 1E5WA 2M17A 4DXAB 1RWSA 1N6ZA 4LK0M 1P3QU 2G1EA 5C2TB 2QJLA 1KF6B 4FULA 1VRAB 1UGMA 4B9KA 2XK5A 1YQ4B 1IP9A 3AE6B 3V6EB 2EMTA 4OZCA 1WM2A 4GSWA 3TIXA 4MGKE 4KGTA 4EE2A 3L54A 2M19A 2AYOB 3R7QA 1FXAA 2DNFA 4C7ZA 2BPSA 3U30A 1MHXA 2ASQA 4DHZE 2RDBC 2DX5B 3H8HA 3A4RA 4OHJA 1OGWA 1SE4A 3V60A 1QQRA 1SE3A 2H89B 3RNFC 1ZUD2 2PPHA 4MM3B 1IGDA 1KH0A 3AH7A 1C78A 4HDOA 1FMAD 2KO3A 2X38A 3U7DA 3W1SA 2N9EB 3P4QB 1P7FA 3DBHI 2DAJA 2M0XA 2PW9A 4HK2A 3B0AA 2WNMA 3SU8X 3SFDB 2K22A 1E8WA 3AMZA 4K1RB 2KTFA 3KWLA 4XX5A 2LJIA 1XLQA 2L76A 2N7EA 4TQ0A 2N7DA 1IBXB 1PGBA 3RN9C 3S2AA 2KC1A 1E90A 2WXFA 3DWMA 4ZDVA 2J4XA 2JPHA 2E3TA 2FCSA 1C3TA 5DPTA 4R3DA 5FR3A 2RR9A 1PYWD 2N7JA 3QQ8B 4KZCA 1ZKHA 3M63B 5E6OA 4ITKA 1WJNA 4Q2JA 3ZXVA 4B0MA 2MEKA 1F52A 2LI5A 2WDTB 2KX0A 2KMCA 2JF5A 2WS3B 4OVUA 3QWZB 1V1PB 4NAMA 1KRHA 2JYEA 2MP2A 5FKAC 4YL8A 1K51A 2W54A 3MP9A 3Q2AC 2ZVNA 1FRDA 3QARA 4JWUC 1Y56A 4G3XB 2IPKD 2N0SB 1ET6A 4GDLB 3BY4B 3KUZA 4IM3A 4US9A 2R2OA 1MG8A 1AARA 2GBMA 2KJ6A 4KKIA 1QILA 1AWDA 1CK1A 2L52A 4WJNA 5AUKA 2GOWA 2L3ZA 1XCQL 1ENFA 3DBLB 2KWVB 1LM8B 1WGKA 2G9HD 1VZ8A 3AE9B 3UIPB 5LXIB 4JWSC 2QC8A 4G11A 1F1HA 1VD2A 1M4VA 3EECA 3RNCC 4KKJA 3KLSX 4E74A 1JRUA 2OEDA 5JHBA 3AE1B 4L1BA 4II3B 4XWTA 1KM7A 4YXDB 2XBBC 2R61A 1WXMA 1K8RB 1YN4A 2WXMA 1HZ5A 2PMVA 3PVLA 3MC0B 4K7SA 1SE9A 3ECIA 2O6VB 2KQ7A 1QOBA 1UBIA 1ZW7A 1FNWA 2L1AA 2FCQA 3ZJVA 1J19A 3TUOA 4NY0A 2WDVB 2KWUB 4C4VA 2EMSA 3AECB 4RGNA 2INDC 1DGJA 4K3BA 4CQNA 2C7MB 4W9GA 4YTNB 2V3PA 3VHTC 3AEDB 4XYCA 1CQVA 4KVGB 1HEZE 1TKYA 3M62B 3OJ4B 1P7EA 4KGSA 4MACA 2JRIB 3LB8C 4DHJD 2XEWA 2AEHA 3A1QB 3Q3NC 1R4NB 5EE0A 4WWOA 2KANA 2CU3A 3P4SB 2I1KA 4E71A 2VH1A 2RPVA 1MJDA 2Z59B 2W3RA 4GB9A 2C9WB 1JWUD 3N32A 4BAXA 3V3XA 3RI7C 1YD8U 3VXWA 3A4SC 4C00A 3DOWA 4M01A 4XDCA 3RZWC 4BOZB 1NYRA 4K3CA 1FRRA 2DYBA 4PYZA 1V9JA 2C7NB 2ON8A 4W9IA 2D11A 2W3SA 2D5GA 2A5UA 1N61A 4W9LA 1JROA 2HTME 1CJEA 4FHKA 2DZMA 1YJ1A 1SGHA 2V9HA 2WXIA 3ZNID 1UWMA 2KWDA 2EKEC 3A33B 4IWQA 4LNOA 5EDSA 2NPTB 5AZFA 4DHJB 3UF8A 3NZ3A 2KKCA 1PQSA 2WDQB 1WF9A 5IO9A 5FR6A 2CS4A 5GXGB 4L23A 3Q3MC 3L17A 2KOXA 2OOBB 4KGRA 2INCC 4KIKA 4WJPA 2LASA 3GE8C 2ZJDA 5DPRA 2LXAA 3EA6A 4ANXA 4XE0A 3VDZA 3DDCB 2LGSA 1E9MA 2ZCCA 3KW5B 3KYCD 2AX5A 4B6WA 3ML8A 2EKIA 3EUB2 4JQWC 1T0QC 2K3UA 4N59A 1GUAB 3V05A 4KDIC 3OWEB 2O2VA 1ZDVA 3OLMD 4WAFA 4ASWC 2V1YA 3N3KB 1PDXA 4CO7A 3Q3JA 1V8CA 4J3OD 1LO5D 4US8A 2KJRA 1KJTA 2J42A 4TV3A 3V62A 4W9FA 2BYFA 4ZYNA 3MTNB 3X23A 2IO1B 3SHQA 3DCGA 4RMAA 4TUUA 2RGFA 3DPDA 1L0YB 4JE3B 4A9AA 2LRUA 4LNIA 2ZEQA 4P6VF 2LD9A 3W5VB 2REXA 3U7ZA 3VUXA 4HKZE 3ZNZB 2BW2A 2NR2A 3MJWA 1C76A 4M0WB 4WAAA 2INNE 4YSXB 1V49A 1AW7A 4MJSB 3P42A 4LNKA 3APDA 5DPWA 2LGDA 2KQ4X 3IAS1 2JSVX 3WA0A 5HHDG 1HTOA 2K25A 4MSQB 2K6QA 3DHHC 2VRRB 1WZ3A 4AWJA 2BYVE 3ZUNA 4EZJA 3E56A 1WMHA 4FBJB 2MWSB 2WXRA 1RFAA 1STEA 4GOCA 1MVKA 2ZCBA 2MJ3A 1RRBA 2W82A 1ISNA 3T8MA 3AE8B 2IO0B 2RDGA 3APFA 3DHGC 3V61A 2PVOD 3VUYA 4BOSC 1C4PA 3FAHA 4PS3A 1XLPA 2DHZA 2HTHA 1SJHD 4HPLB 4HCPB 1GC7A 2D3CA 3BVZA 4JX1C 3HIZA 3B08A 2MRPA 1RFKA 4GN1A 3N30A 2NCNA 4WQMA 1TS2A 1HA5A 3C8YA 1TYGB 1WX8A 2LXCA 4W9DA 5H8YE 4HXDA 2IY1B 4PYUA 1UF0A 4S17A 1TBEA 3DVGY 1UBQA 4ARCA 3PHXB 4PS7A 3U52E 2WX1A 5FK9C 4MGZE 1V1OA 1OFFA 2JY6A 2XN9C 1HXYD 2N9XA 2WXJA 2HJ8A 4DDGD 3AE4B 1ZGUB 3IXSA 3PO0A 2QHOA 1GB1A 1LQBA 2LVPA 2EELA 3A9KA 3DVNU 4ZYSA 3NUHB 3Q3OC 4RM9A 1WYGA 3RFZB 1PUTA 4M02A 5HKHA 3WANA 3CMMB 2N4FA 3RUIB 4MH8A 2W55A 3ZJTA 1LGRA 1QT9A 3N9YC 2ZZPB 1NDDA 2BKRB 4YT0B 1ZOYB 2IO3B 2Z0EB 1MPEA 1WGHA 3OJ3A 4URKA 2NS5A 3GZNB 4IM2A 1VZ6A 3PRPB 1Y8RC 2BGFA 3BK2A 1RLFA 1NBFC 4A3PA 1L5PA 2GMIC 2HDEA 4BKSA 1OQYA 5KHOA 1D6EC 1OTRB 1Z2MA 3TEWA 3KQ4A 4N9F4 4WIPA 3H7PA 2BT6A 4P16A 3A9JB 1L7YA 2BWES 3I3TB 4MGIE 5TSSA 4LTUA 2MCNB 5D3IB 3SDLC 3GS2A 3AEAB 3P1MA 3HM6X 3NJTA 4FA6A 2KMAA 4USAA 5TR5A 3CWIA 4EFOA 1P9DU 3Q8CA 3LYYA 1SSNA 1V2YA 2DZKA 1JRPA 5BO4B 1DYQA 1TY0A 2KNBA 2KDBA 4HPPA 1WE6A 3ZIMA 1T3QA 4NNJB 1GG3A 4OVZA 4MH0E 3I5JC 4MDKE 2M4NA 5BMGA 1V81A 2RMMA 4MEMA 1Q1OA 2N9KA 2K0PA 3ZTCA 1SE2A 2MP2B 1UUPA 4BZAA 1SIFA 4RF1A 3R3MA 3VR8B 2KTRA 3AN1A 3TEXA 2AQ3B 1R4MI 1XCTL 3QX1A 2RD0A 1LFDA 1GAQB 2SEBD 1E8XA 2GBJA 1U4AA 1YX6B 2NBWB 2N1VA 3QJZA 3L10B 3U4EG 3NOBA 1TKEA 4JIOU 5D6JB 2V0GA 2KFKA 1FD6A 1NYQA 5D7GA 3U8ZA 1JWBD 1WX7A 4CYEA 3CIRB 1XLNA 3PLVA 3LDZE 1WJ4A 4I6LB 1TY2A 3PT2B 3SEBA 3CSFA 3ALBA 1QOFA 3ONSA 2GBKA 4NJ6A 2INPE 2MW5A 1C4AA 1FFUA 3MHZA 2G4SA 1WJ6A 3HK0A 5MPOA 2WXNA 1TS4A 4F7ZA 2PVGC 4MELA 4A20A 1V86A 4TKNA 4ACFA 4K7WA 4C4VB 3ZDMC 4FLHA 2G4DB 4RCOA 1WZ0A 4ZRQA 1TS3A 3UIOB 2RSUA 4A6QA 1FCCC 2HE7A 3ZDTA 1EF1A 3AULA 2CR5A 5J17A 3W1SC 2ICIA 2ZPNA 5E6JA 3RZFA 4PK1A 4WJQA 2G45B 2NVUI 4EZLA 2W9NA 2HJ1A 3IVFA 3NRZA 1YOVB 2FUG1 1X1MA 4LJPB 4CHKA 2YEPB 4LCDE 5CHVC 2KHWB 3VTWA 1N5WA 1KFYB 2GBRA 4AJWA 2FBWB 1H8CA 3PRZA 3AE5B 2WXQA 2DYMA 3PS6A 4HEA1 1FXIA 1CMXB 4KDLB 4AS1A 2L8JA 4OW0A 3ZLZA 3GB1A 1IBXA 3BVGA 4M00A 2JX5A 4IWOA 4GDKA 5D3DA 2A4ZA 2WLBA 4AOFA 1L0VB 5AUIA 2I1JA 4ICVA 4IC7B 3PHWB 2C5LC 4NAWB 2KN5A 1XT9B 5J18A 2ZVOA 3JSVB 3ZYYX 2WWZA 1F2RC 4XZ4A 1YX5B 3AXCA 2LGIA 3DBRI 3D32A 3APCA 1WH3A 3K9OB 1V1PA 2L05A 3DVGX 3RD2A 3KVFB 3FILA 4UDUC 3WAOA 2WQYB 1RAXA 5JHAA 1VZ7A 2JT4B 2SAKA 1L0XB 1HTQA 4NPNA 2KJHB 1NI3A 3ZQ4A 2KACA 1KLGD 1FNVA 3RNGC 1J7CA 2J52A 4OZBA 5E6NA 4XC2A 4M8NA 1TZ1A 3QHTA 5BYSA 1WE7A 2DLBA 1N62A 2O2VB 3TBLD 3L13A 1VLBA 2K6DB 1V97A 2MJEA 4WWMA 2OHFA 3RYTA 1NENB 2PEAA 2FIFA 3RNAC 1K50A 4BKTA 1E7PB 1VR9A 2LHDA 5LLIA 2L00B 2ZW1A 3VR9B 4LNFA 1WX9A 2OJWA 4WWPA 4NQLB 4AUQC 1QOGA 2JRHA 3EC8A 2KN4A 3NVZA 3NVWA 4F1SA 2O6VA 1T0YA 4B0EA 1UELA 4B95A 4EZKA 3NVVA 2M1MA 2JUOA 2KVZA 3PZ7A 2GRIA 2PKOA 3CSTA 1V80A 2LWPA 4FXCA 1UZXB 1ACCA 3C0RB 3X0WA 2BVCA 3PLUA 1MI0A 4MT5A 4MGYE 2PTLA 1WWTA 3W2DA 5IN7A 2B3AA 1TZOA 3IT4B 5IP4D 3ZRFA
chains in the Genus database with same CATH topology
5T8IA 1SE4A 1QQRA 4IDIA 1SE3A 2H89B 3AEEB 1ZUD2 3BK1A 1PGAA 2JZPA 4MM3B 1IGDA 1KH0A 3AH7A 4ARCA 1C78A 1FMAD 1C9FA 4TMAB 1WRIA 2X38A 3W1SA 3P4QB 4HRSA 3U52E 2WXLA 1P7FA 3U2SC 5FK9C 1XF5L 2PW9A 4C56C 1I4GA 1V1OA 1OFFA 2WNMA 3I9V1 3SFDB 2K22A 2BTEA 2XN9C 4WURA 2BB6A 1HXYD 3AMZA 1JQ4A 2LFIA 2WXJA 2J53A 2LEKA 4C7YA 3KWLA 2LJIA 1XLQA 3AE4B 4TQ0A 2MH7A 3IXSA 3PO0A 2K9XA 1GB1A 1IBXB 2EELA 4ZYSA 1PFDA 1PGBA 3NUHB 1C77A 1WYGA 2WXFA 3DWMA 2J4XA 1F77A 2NTTA 3AEFB 2E3TA 2QILA 5LNK1 1ET9A 3RFZB 1PUTA 2Y5PA 4R3DA 4OZAA 5FR3A 1BXTA 1PYWD 2N7JA 2AQ2B 1C79A 4MH8A 4REZA 2BS2B 2W55A 3ZJTA 1UGJA 3TSSA 2GI9A 4ITKA 2I2YA 1B9RA 4Q2JA 1FEHA 4B0MA 1QT9A 3IAM1 3N9YC 4YT0B 1ZOYB 2MEKA 4XWWA 5BMHA 1MPEA 2V4IB 1ZXIA 1VZ6A 3BK2A 1EWYC 1L5PA 2WS3B 1OQQA 2HDEA 1V1PB 4NAMA 3BIID 1KRHA 1YN3A 2JWUA 1D6EC 2JYEA 2PIAA 5FKAC 1GB4A 1ZP0B 5EE3A 1K51A 2W54A 3BZDB 3TEWA 2E6XA 5I4DA 3BYTB 3KQ4A 3MP9A 1QF6A 1SJED 4WIPA 2BT6A 4P16A 3AV8A 1FRDA 5TSSA 4LTUA 4JWUC 1NVID 5D3IB 1Y56A 2IPKD 2N0SB 1ET6A 5BMIA 4ARIA 3I57A 4GDLB 3MFGA 3GS2A 1F2RI 1FCLA 3AEAB 3P1MA 4US9A 5H92C 1Q10A 3NVYA 4TSSA 1RM6C 3AB5A 4KX6B 4TQ1A 4USAA 4KKIA 1QILA 1YQ3B 3CWIA 1AWDA 1CK1A 3Q8CA 3LYYA 4A55A 1SSNA 1GOZA 1JMLA 2L52A 5BYQA 1JRPA 3DWGC 4ZHOA 1DYQA 1TY0A 3Q8FA 5AUKA 3ZJUA 1T3QA 1XCQL 1ENFA 2KMMA 1WSPA 4OVZA 1J7BA 1XO3A 1KTKA 2I38A 5BMGA 2M0AA 4RGMA 2RMMA 1WGKA 2G9HD 4A90A 5JXVA 2N9KA 3EGRA 1VZ8A 3AE9B 2K0PA 1SE2A 4JWSC 1UUPA 2NTSA 1E6EB 1N63A 4RF1A 1JCKB 3VR8B 2VZKD 1M4VA 3AN1A 3TEXA 1QKZA 2AQ3B 3AE2B 1JWMD 3KLSX 2OEDA 1UWXA 3Q8EA 4KKJA 4XDDA 1VDVA 3AE1B 1D5ZC 1XCTL 4L1BA 4XWTA 4YXDB 4ZOHC 3Q8AA 2R61A 2M56B 1YN4A 1B1ZA 4M0WA 2WXMA 1T5XD 1HZ5A 2PMVA 3MC0B 2LHEA 3HRDD 3T3NA 1GAQB 2SEBD 3AM9A 1QOBA 4DXGA 3T3OA 1N5XA 1FNWA 2L1AA 3U4EG 2WU5B 3ZJVA 3TUOA 2WDVB 1NEKB 1TKEA 3FC4A 1YNTE 3GP7A 1L4ZB 2V0GA 4IKGA 1FD6A 2BS4B 2RDHA 1NYQA 3AECB 4RGNA 1DGJA 4CQNA 1YMHE 5HG2A 5D7GA 2ONQA 4YTNB 3W9CB 1JWBD 2V3PA 3AEDB 1XLNA 3CIRB 1CQVA 1SF0A 1TY2A 1HEZE 3SEBA 1TKYA 2Z8LA 3B9JA 1IUEA 3O13A 1P7EA 4KGSA 5C3JB 4MACA 2XNAC 2QIEB 4C80A 1I4PA 2H88B 1QOAA 3LB8C 1QOFA 2K5PA 2IGGA 2WXPA 3SR6A 4D2KA 1FNUA 1L6VA 2VZKB 1DOXA 2Y3AA 3BVMA 4RH6A 1EU4A 2INPE 1J7AA 4NJCA 1C4AA 1FFUA 2CU3A 3P4SB 5EE0A 2JU6X 3Q69A 2GB1A 3MHZA 2RPVA 1SEBD 2L32A 1MHHE 2W3RA 3SFEB 5MPOA 1JWUD 1FFVA 3J9CA 2WXNA 1TS4A 3V3XA 1ROEA 1L4DB 3L4PA 2PVGC 1I7HA 1SBBB 4ZRPA 4XDCA 5EE9A 1NYRA 1FRRA 1ZPSA 2YEPF 1YJIA 1I4QA 2ON8A 4RCOA 4ZRQA 2W3SA 1BUIC 2D5GA 1TS3A 2ZW0A 2WXOA 4A6QA 1N61A 1FCCC 2WU2B 1JROA 2HTME 1CJEA 2IJ0A 4H2AA 4IOIE 1C4CA 1ZE3D 2QMTA 1XEEA 1FM0D 2ICIA 4RGTA 5E6JA 2WXIA 2KAJA 1L6UA 1UWMA 2KWDA 2IDYA 4HJGE 4YSYB 4O1NA 3NRZA 1JW9D 2FUG1 2WXKA 1YJJA 1TS5A 2YEPB 1N5WA 4RF0A 3TEZA 1KFYB 2MJDA 3HVZA 3NZ3A 2FBWB 2IGDA 3AE7B 3AE5B 1E10A 2WXQA 1ZDXA 2WDQB 1EWCA 2DYMA 3AEBB 1K52A 1N60A 1XXGA 2WP9B 1JWSD 4HEA1 1TKGA 1FXIA 2V3NA 5GXGB 4L23A 5BYRA 3ABVB 1YN5A 4AS1A 1SXTA 4KGRA 1D4BA 1WXQA 4OW0A 3VQIA 2IGHA 4N58A 1DOYA 4HKQA 3EA6A 2DYOA 3GB1A 3UI3A 3MJ5A 3BVGA 2DWQA 4XE0A 1IBXA 1SB3C 4GLSC 4RGOS 1I4HA 1E9MA 4YTPB 2JX5A 2AX5A 1UNSA 3E9SA 5D3DA 2WLBA 5HFYA 1ESFA 1IGCA 2EKIA 1L0VB 3EUB2 2BBCA 3W5UB 1D5MC 2JYTA 5AUIA 2WDRB 2K3UA 4N59A 5G5HA 4YSZB 1T6BX 3KWVA 5EE1A 3V05A 4NAWB 4AQ7A 3OWEB 3ETRA 4JPSA 3ZYYX 3IT6B 1ZDVA 3P63A 4WAFA 2N9LA 2L83A 1F2RC 1PDXA 3RPFC 1R7SA 1SIJA 1V8CA 4J3OD 1LO5D 4US8A 2KDMA 2LGIA 3PZ8A 2J42A 2BYTA 4YWGG 3LXFA 1AN8A 1V1PA 3R8BA 1XLOA 3FILA 4UDUC 1JALA 2WQYB 3HUIA 1CZPA 1GPXA 3BWUD 1VZ7A 2BB5A 2BS3B 2SAKA 1L0XB 2WXGA 3R2IA 3VRBB 2LUMA 1NI3A 1L0YB 4JE3B 4A9AA 4P6VF 3WCQA 3ZQ4A 2KACA 1KLGD 1FNVA 3W5VB 2ACZB 3U7ZA 1J7CA 4DXFA 1PGXA 4WH4A 5G5GA 4GDKB 3Q8BA 4HKZE 1HQRD 1E0ZA 2BW2A 2J52A 4OZBA 4PT5A 3URYA 1C76A 1FIQA 1QLBB 3NS1A 1HZ6A 5BYSA 2TSSA 2DLBA 1N62A 2INNE 4RNAA 3BYYB 1EU3A 4N6EB 2NMQA 2B76B 4YSXB 1VLBA 2MJEA 1V97A 1OQRA 4NZLB 4WWMA 1AW7A 2OHFA 1I4XA 3B2FA 1NENB 3P42A 4ZHPA 3TEYA 2KQ4X 3IAS1 2JSVX 2Q5WD 5HHDG 2JXTA 4HROA 1VJKA 1K50A 3VRAB 3FILB 1D5XC 1FO4A 2AQ1B 1TJEA 1E7PB 1BMLC 1VR9A 2LHDA 2JQRB 3E56A 2PLPA 4RFBA 2ZW1A 3R2TA 3VR9B 1KLUD 3P4RB 2WXRA 3AE3B 1I4RA 1STEA 2QEJC 1MVKA 2MJ3A 1QOGA 1DOIA 5HI1A 2W82A 2QSDA 3AEGB 3ZGZA 2FE8A 4LLGM 2KN4A 1AYFA 4DQOC 4L2YA 3NVZA 3NVWA 3AE8B 1RWSA 4LK0M 5C2TB 2G1EA 2RDGA 4B0EA 2CJNA 2LMCA 2PVOD 1JWAD 1A70A 2QJLA 1F0ZA 1K53A 1KF6B 1C4PA 3NVVA 3PZ7A 1VRAB 3FAHA 2GRIA 2PKOA 1XLPA 1YQ4B 3AE6B 3P4PB 1SJHD 4OZCA 4FXCA 2WXHA 1ACCA 4KGTA 4EE2A 4A8XC 3HVDA 2M19A 2DBYA 3BVZA 3B2GA 1RYJA 4JX1C 1MI0A 4MT5A 1FXAA 1EM7A 1RFKA 4WQMA 1TS2A 1HA5A 3C8YA 2PTLA 1WWTA 1TYGB 4C7ZA 3W2DA 1MHXA 2CJOA 1ZXHA 5H8YE 2Y5CA 1TZOA 3H8HA 3IT4B 4YTMB 4OHJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LUM A;  1JML A;  1PGA A;  2KAC A;  2JZP A;  1XCQ L;  1IGD A;  1KH0 A;  1PGX A;  2ON8 A;  4WH4 A;  1C9F A;  4HKZ E;  2J52 A;  4OZB A;  2I38 A;  5BMG A;  1P7F A;  2ZW0 A;  2RMM A;  1XF5 L;  1FCC C;  2PW9 A;  5JXV A;  2N9K A;  4IOI E;  2K0P A;  2QMT A;  1HZ6 A;  2J53 A;  2KWD A;  4HJG E;  2NMQ A;  1QKZ A;  2OED A;  1UWX A;  1GB1 A;  1IBX B;  1XCT L;  2EEL A;  1PGB A;  2IGD A;  1HZ5 A;  2KQ4 X;  2JSV X;  1K52 A;  5HHD G;  2LHE A;  2JXT A;  1K50 A;  4OZA A;  3FIL B;  2N7J A;  4KGR A;  1D4B A;  2LHD A;  2IGH A;  2PLP A;  2ZW1 A;  2GI9 A;  2I2Y A;  3GB1 A;  3UI3 A;  1IBX A;  1MVK A;  4GLS C;  1YNT E;  4IKG A;  5HI1 A;  5BMH A;  1FD6 A;  1MPE A;  2QSD A;  1YMH E;  2KN4 A;  5HG2 A;  5HFY A;  1IGC A;  2ONQ A;  1HEZ E;  2JWU A;  1K53 A;  1P7E A;  4KGS A;  1GB4 A;  4MAC A;  1K51 A;  2N9L A;  1F2R C;  3MP9 A;  4OZC A;  2IGG A;  4D2K A;  4KGT A;  2KDM A;  2LGI A;  5BMI A;  1MI0 A;  2JU6 X;  1F2R I;  2GB1 A;  1FCL A;  1EM7 A;  2RPV A;  1MHH E;  1Q10 A;  3FIL A;  2PTL A;  1MHX A;  1ZXH A;  3V3X A; 
#chains in the Genus database with same CATH topology
 3A1Q A;  3BK1 A;  3M3J A;  1PGA A;  2JZ3 B;  2MLB A;  2JZP A;  4W9H A;  1WXA A;  4TMA B;  4ANV A;  2J0J A;  4HRS A;  3U2S C;  4IUM B;  2WHI A;  4C56 C;  1I4G A;  3PRE A;  4DWF A;  3ML9 A;  3I9V 1;  2BTE A;  2MHJ A;  2BB6 A;  1JQ4 A;  2LFI A;  4GMV A;  2LEK A;  4C7Y A;  4W9K A;  4JL9 A;  2D07 B;  1KLV A;  2MH7 A;  2K9X A;  3KUD B;  1R4M B;  1PFD A;  1C77 A;  2NBU A;  1F77 A;  1WXV A;  1ET9 A;  4OZA A;  1YQB A;  3DBH B;  2AQ2 B;  2CHX A;  5J2R A;  4REZ A;  1UGJ A;  2GI9 A;  1FEH A;  2NPT A;  1I35 A;  5BMH A;  2UU7 A;  5L83 A;  1ZXI A;  4PS8 A;  4BKS D;  3P2B A;  1EWY C;  2PE6 B;  3K9P B;  2KWC A;  4QAY A;  3UIN B;  1YN3 A;  2JWU A;  4GU2 A;  1WY8 A;  2MA9 B;  5DCN A;  5EE3 A;  3UGB B;  2E6X A;  3BYT B;  2R2Q A;  1QF6 A;  3DBL I;  3AV8 A;  1FPY A;  4F8C B;  3RUL A;  5IKC M;  3I57 A;  2MQJ A;  3H9D A;  5CTR C;  1Q10 A;  3ZNH B;  1WM3 A;  4TSS A;  1E7U A;  4KX6 B;  4TQ1 A;  1YQ3 B;  4P1C C;  4A55 A;  5BYQ A;  3DWG C;  3Q8F A;  5D94 A;  4HJK A;  5IOI A;  1G6J A;  2KMM A;  1WSP A;  1J0G A;  1J7B A;  1UH6 A;  1XO3 A;  4FJV B;  2I38 A;  4RGM A;  4A90 A;  3EGR A;  3EFC A;  1E6E B;  1JCK B;  5LXH A;  2VZK D;  3VFK A;  1QKZ A;  3AE2 B;  3AU5 A;  1JWM D;  3RT3 B;  1VDV A;  1WIA A;  3OAW A;  1D5Z C;  2J7Q B;  1V6E A;  2CKH B;  4ZOH C;  2CHW A;  3Q8A A;  2IZV B;  2M56 B;  1B1Z A;  4M0W A;  2DZI A;  2LHE A;  3HRD D;  3T3N A;  3AM9 A;  4EEW A;  5CHW A;  4DXG A;  3C19 A;  1P0R A;  4LDT D;  1N5X A;  4A3O A;  2WU5 B;  4W9J A;  2XK5 B;  3ZKJ C;  4MJS A;  4IKG A;  4JGH B;  2BS4 B;  1D3Z A;  2RDH A;  2QDF A;  2FNJ B;  3SD5 A;  1YMH E;  5HG2 A;  3W9C B;  3TJP A;  1EF5 A;  2KT7 A;  1WGD A;  1SF0 A;  5AZH A;  2JXX A;  5C3J B;  2KX3 A;  5L95 C;  4G0N B;  2KTR B;  2K5P A;  1EO6 A;  3IFW B;  4W9E A;  1Q5W B;  2IGG A;  3N1Y C;  5C23 A;  3EHV A;  1FNU A;  1L6V A;  2VZK B;  1DOX A;  3MHS D;  4NJ7 A;  4RH6 A;  4NJC A;  1J7A A;  3V6C B;  2JU6 X;  2L32 A;  1MHH E;  5IA7 A;  3SFE B;  2RPQ A;  1IYF A;  1KOT A;  3L4P A;  1SBB B;  4ZRP A;  2FCM A;  2BQQ A;  1TT5 B;  1Q0W B;  1YJI A;  3N1X C;  3JVZ X;  2FCN A;  3QIJ A;  3L16 A;  1I4Q A;  3N1Z C;  1BUI C;  2ZW0 A;  2WXO A;  2WU2 B;  4IOI E;  2IJ0 A;  2QMT A;  1C4C A;  1ZE3 D;  1XEE A;  2LVQ A;  3IHP C;  3WIM A;  1QZE A;  2MBE A;  1HE8 A;  1L6U A;  2IDY A;  2ZNV C;  3ENE A;  1L2N A;  2WXK A;  1TS5 A;  3HVZ A;  3AEB B;  1ZDX A;  1LXD A;  1EWC A;  1K52 A;  1N60 A;  1JWS D;  2PE9 A;  3RNE C;  5BYR A;  4HCN B;  3ABV B;  4IM0 A;  1YN5 A;  1SXT A;  1D4B A;  1DOY A;  3PRM B;  2DYO A;  2MBH A;  3MC8 A;  3UI3 A;  3MJ5 A;  4GGQ A;  2DWQ A;  1SB3 C;  4RGO S;  2IYD B;  2KZR A;  3E9S A;  2NBV B;  1ESF A;  2KXJ A;  2BYE A;  1D5M C;  2JYT A;  4EUT A;  2WDR B;  4FAD A;  3HM3 A;  1T6B X;  2N1W A;  2HD5 B;  4JPS A;  3IT6 B;  1P98 A;  2N9L A;  4K7U A;  2WYQ A;  2KLG A;  2KFJ A;  3AU4 A;  3CF6 E;  1R7S A;  1SIJ A;  1WGG A;  4GIV A;  2KDM A;  3ZXR A;  3PZ8 A;  2CU1 A;  3DBS A;  2BYT A;  4YWG G;  3LXF A;  1NI2 A;  2GBN A;  1XLO A;  1WJU A;  1GPX A;  1S1Q B;  2BB5 A;  3ZW3 A;  3WAP A;  2WXG A;  3R2I A;  3VRB B;  2DAF A;  4II2 B;  2LUM A;  3JW0 X;  3A9J A;  2VH2 A;  2YVC A;  2L0F A;  1PGX A;  4FJY A;  4GDK B;  4ZRI A;  1E0Z A;  4PT5 A;  1WGR A;  1FIQ A;  1OEY J;  3JYU A;  1QLB B;  5KHQ A;  3WAL A;  1HZ6 A;  2TSS A;  1IPG A;  2LRW A;  1TTN A;  1EU3 A;  2D3B A;  3VH3 B;  5AZG A;  2B76 B;  4NZL B;  1J8C A;  1I4X A;  4ZHP A;  4I6P A;  2JXT A;  4HRO A;  3FIL B;  1D5X C;  1FO4 A;  2AQ1 B;  3PSE B;  1TJE A;  2KDF B;  1BML C;  2JQR B;  4ANU A;  3PZD A;  2M8S A;  2UYZ B;  3AE3 B;  4KSK C;  1I4R A;  3QCA A;  4MM3 A;  1WXS A;  2YLM A;  4P7I A;  2QSD A;  2O6V D;  2FE8 A;  4LLG M;  1AYF A;  3KUC B;  4DQO C;  4HLE A;  4L2Y A;  3PTF C;  2V4L A;  1V5T A;  3RNB C;  2CJN A;  2LMC A;  1JWA D;  1A70 A;  4S0R A;  1K53 A;  3W1Y A;  1F0Z A;  1UD7 A;  3P4P B;  4G50 A;  3KH0 A;  2WXH A;  4A8X C;  3HVD A;  3Q3F A;  1YIW A;  2DBY A;  3B2G A;  1RYJ A;  1WGY A;  4DK5 A;  1EM7 A;  3DHI C;  3ZVV A;  2CJO A;  1ZXH A;  3VH4 B;  2Y5C A;  4YTM B;  1TGZ B;  1XQQ A;  1I42 A;  1WR6 E;  5T8I A;  4IDI A;  3AEE B;  1OEY A;  4DBG A;  2K1F A;  1C9F A;  1P1A A;  1WRI A;  3TMP B;  2WXL A;  1XF5 L;  1VCB A;  3GE3 C;  3HHM A;  4WUR A;  2Z0D B;  4KIK B;  2MX2 A;  2J53 A;  3R7R A;  5JH5 C;  4HVB A;  3GZN I;  4M8M A;  1E7V A;  5IAA C;  3N20 C;  2KD0 A;  1TIF A;  4GDL A;  1H4R A;  2NTT A;  3AEF B;  2QIL A;  5LNK 1;  2L7R A;  2FAZ A;  2Y5P A;  2QCZ A;  1BXT A;  1C79 A;  2BS2 B;  2KK8 A;  1B9R A;  1E8Y A;  3TSS A;  2I2Y A;  3DVN V;  2KDI A;  3IAM 1;  3GOE A;  2J0M A;  4XWW A;  1E8Z A;  2V4I B;  2KDE B;  2JZZ A;  4RM8 A;  2KC2 A;  1OQQ A;  2CHZ A;  3O65 B;  3BII D;  2PIA A;  2DZJ A;  1GB4 A;  1ZP0 B;  3BZD B;  5I4D A;  4AJY B;  2V3S A;  1SJE D;  4MSM B;  2IO2 B;  3NHE B;  2IBI B;  1NVI D;  2PJH A;  4KZ0 A;  2GLS A;  5BMI A;  4ARI A;  1BT0 A;  1C1Y B;  3MFG A;  4DHZ B;  1F2R I;  1FCL A;  5H92 C;  3NVY A;  4NAW A;  3JSV A;  1RM6 C;  1T0S C;  3AB5 A;  4DDI D;  3H6N A;  4AP4 C;  4KSL C;  3RMK C;  1GOZ A;  3IG3 A;  1JML A;  4ZHO A;  3ZJU A;  2KQS A;  3FKY A;  3NG0 A;  4E3C A;  3QK0 A;  2J0K A;  4FJZ A;  1KTK A;  3M95 A;  2C60 A;  2M0A A;  2AWT A;  5JXV A;  1XD3 B;  3KYD D;  2K8B A;  2NTS A;  1N63 A;  1A5R A;  5D2M B;  1WMH B;  2N9P C;  3Q8E A;  4XDD A;  1UWX A;  2LGY A;  2FUH B;  3Q6B A;  2G3Q B;  2X8X X;  4ANW A;  3OG5 A;  5CX3 A;  1T5X D;  2D2Q A;  5AEK B;  3IBE A;  4P1B C;  3VAW A;  2D3G A;  2LZ6 A;  3ZNG C;  4KV2 A;  1GC6 A;  3PGE A;  3H7S A;  3T3O A;  2BF8 B;  5G55 A;  2LVO A;  2C7H A;  4EKU A;  1NEK B;  3FC4 A;  1YNT E;  3GP7 A;  1L4Z B;  1WRD B;  2D3A A;  3UQB A;  2AL6 A;  2ONQ A;  5JZE B;  3Q14 C;  2Z8L A;  2WGS A;  3B9J A;  4IW0 A;  2AL3 A;  1IUE A;  3VTV A;  3O13 A;  3T9L A;  2KVR A;  3BIN A;  2XNA C;  2QIE B;  2Y5B B;  4C80 A;  5DPS A;  1I4P A;  2H88 B;  1QOA A;  2BWF A;  4WWN A;  2WXP A;  3SR6 A;  4X57 B;  4D2K A;  4GXB A;  1S3S G;  3PPA A;  2Y3A A;  3BVM A;  2DEN B;  1EU4 A;  1GJZ A;  3Q69 A;  2GB1 A;  3ZO5 B;  1SEB D;  5CHF A;  3VUW A;  1FFV A;  3J9C A;  3UQA A;  2UWQ A;  1ROE A;  1L4D B;  1V5O A;  2ZNV B;  2BKF A;  2OJR A;  1I7H A;  4LJO B;  5EE9 A;  1ZPS A;  2YEP F;  3A9K B;  1GNU A;  3PV1 A;  3ZTD A;  2FID A;  4BKG A;  3L08 A;  2MBB B;  1M94 A;  3L0W B;  4K81 A;  3QAQ A;  4H2A A;  1Z5S B;  1WYW B;  4EOY A;  1FM0 D;  4RGT A;  2KAJ A;  4ZRK A;  4HJG E;  4YSY B;  4O1N A;  1JW9 D;  1YJJ A;  4JLC A;  3I63 C;  4RF0 A;  3TEZ A;  2MJD A;  4FHJ A;  2IGD A;  3AE7 B;  5C1Z A;  1E10 A;  2KLC A;  1XXG A;  2WP9 B;  1TKG A;  2V3N A;  3QC8 B;  3MC9 A;  2K39 A;  1WXQ A;  4BBN C;  3VQI A;  2IGH A;  4W9C A;  4N58 A;  4HKQ A;  3NY5 A;  4ZRJ A;  1EUV B;  3NZU A;  4GLS C;  4HDQ A;  1I4H A;  5E6P A;  3H7P B;  4YTP B;  2MBQ A;  1UNS A;  1FXT B;  5HFY A;  1IGC A;  2MBO A;  2BBC A;  3W5U B;  5G5H A;  4YSZ B;  4LNN A;  3B1L X;  3KWV A;  5EE1 A;  4IWP A;  2LGX A;  4AQ7 A;  3VVW B;  3ETR A;  3WAM A;  2L0T A;  3P63 A;  4HWI B;  4FN2 A;  2L83 A;  3QA8 A;  4IG7 B;  1R4N I;  2JWZ A;  3NS8 A;  4OVV A;  3RPF C;  3EFU A;  4HPM B;  3LJ3 A;  4ICU A;  5GMV A;  3ZRC A;  2IY0 B;  1AN8 A;  3R8B A;  1JAL A;  3HUI A;  1CZP A;  3AI5 A;  3BWU D;  1T0R C;  2BS3 B;  2KYW A;  1MFW A;  2ZPY A;  2LUE A;  3WCQ A;  2ACZ B;  3NZS A;  3RCZ A;  4DXF A;  4WH4 A;  5G5G A;  3Q8B A;  2LJ5 A;  1HQR D;  4BBN F;  3URY A;  3VTU A;  3H1U A;  3DBR B;  1WR1 A;  3NS1 A;  4BVU C;  4RNA A;  1WFY A;  3BYY B;  4N6E B;  2NMQ A;  3TCA A;  1OQR A;  4LDT B;  2WX0 A;  3B2F A;  2KFK B;  4NQK E;  3TEY A;  1F9J A;  5G2N A;  4I6N B;  2Q5W D;  3R66 C;  1VJK A;  2K8H A;  1WI0 A;  4XGA B;  3VRA B;  4BFR A;  3TL5 A;  2PLP A;  4RFB A;  3R2T A;  2D10 A;  4J6I A;  4WQO B;  1KLU D;  3P4R B;  3DQV A;  2MSE D;  2QEJ C;  2JVC A;  4WJO A;  1DOI A;  5HI1 A;  1MG4 A;  3AEG B;  3ZGZ A;  2K8C A;  1E5W A;  2M17 A;  4DXA B;  1RWS A;  1N6Z A;  4LK0 M;  1P3Q U;  2G1E A;  5C2T B;  2QJL A;  1KF6 B;  4FUL A;  1VRA B;  1UGM A;  4B9K A;  2XK5 A;  1YQ4 B;  1IP9 A;  3AE6 B;  3V6E B;  2EMT A;  4OZC A;  1WM2 A;  4GSW A;  3TIX A;  4MGK E;  4KGT A;  4EE2 A;  3L54 A;  2M19 A;  2AYO B;  3R7Q A;  1FXA A;  2DNF A;  4C7Z A;  2BPS A;  3U30 A;  1MHX A;  2ASQ A;  4DHZ E;  2RDB C;  2DX5 B;  3H8H A;  3A4R A;  4OHJ A;  1OGW A;  1SE4 A;  3V60 A;  1QQR A;  1SE3 A;  2H89 B;  3RNF C;  1ZUD 2;  2PPH A;  4MM3 B;  1IGD A;  1KH0 A;  3AH7 A;  1C78 A;  4HDO A;  1FMA D;  2KO3 A;  2X38 A;  3U7D A;  3W1S A;  2N9E B;  3P4Q B;  1P7F A;  3DBH I;  2DAJ A;  2M0X A;  2PW9 A;  4HK2 A;  3B0A A;  2WNM A;  3SU8 X;  3SFD B;  2K22 A;  1E8W A;  3AMZ A;  4K1R B;  2KTF A;  3KWL A;  4XX5 A;  2LJI A;  1XLQ A;  2L76 A;  2N7E A;  4TQ0 A;  2N7D A;  1IBX B;  1PGB A;  3RN9 C;  3S2A A;  2KC1 A;  1E90 A;  2WXF A;  3DWM A;  4ZDV A;  2J4X A;  2JPH A;  2E3T A;  2FCS A;  1C3T A;  5DPT A;  4R3D A;  5FR3 A;  2RR9 A;  1PYW D;  2N7J A;  3QQ8 B;  4KZC A;  1ZKH A;  3M63 B;  5E6O A;  4ITK A;  1WJN A;  4Q2J A;  3ZXV A;  4B0M A;  2MEK A;  1F52 A;  2LI5 A;  2WDT B;  2KX0 A;  2KMC A;  2JF5 A;  2WS3 B;  4OVU A;  3QWZ B;  1V1P B;  4NAM A;  1KRH A;  2JYE A;  2MP2 A;  5FKA C;  4YL8 A;  1K51 A;  2W54 A;  3MP9 A;  3Q2A C;  2ZVN A;  1FRD A;  3QAR A;  4JWU C;  1Y56 A;  4G3X B;  2IPK D;  2N0S B;  1ET6 A;  4GDL B;  3BY4 B;  3KUZ A;  4IM3 A;  4US9 A;  2R2O A;  1MG8 A;  1AAR A;  2GBM A;  2KJ6 A;  4KKI A;  1QIL A;  1AWD A;  1CK1 A;  2L52 A;  4WJN A;  5AUK A;  2GOW A;  2L3Z A;  1XCQ L;  1ENF A;  3DBL B;  2KWV B;  1LM8 B;  1WGK A;  2G9H D;  1VZ8 A;  3AE9 B;  3UIP B;  5LXI B;  4JWS C;  2QC8 A;  4G11 A;  1F1H A;  1VD2 A;  1M4V A;  3EEC A;  3RNC C;  4KKJ A;  3KLS X;  4E74 A;  1JRU A;  2OED A;  5JHB A;  3AE1 B;  4L1B A;  4II3 B;  4XWT A;  1KM7 A;  4YXD B;  2XBB C;  2R61 A;  1WXM A;  1K8R B;  1YN4 A;  2WXM A;  1HZ5 A;  2PMV A;  3PVL A;  3MC0 B;  4K7S A;  1SE9 A;  3ECI A;  2O6V B;  2KQ7 A;  1QOB A;  1UBI A;  1ZW7 A;  1FNW A;  2L1A A;  2FCQ A;  3ZJV A;  1J19 A;  3TUO A;  4NY0 A;  2WDV B;  2KWU B;  4C4V A;  2EMS A;  3AEC B;  4RGN A;  2IND C;  1DGJ A;  4K3B A;  4CQN A;  2C7M B;  4W9G A;  4YTN B;  2V3P A;  3VHT C;  3AED B;  4XYC A;  1CQV A;  4KVG B;  1HEZ E;  1TKY A;  3M62 B;  3OJ4 B;  1P7E A;  4KGS A;  4MAC A;  2JRI B;  3LB8 C;  4DHJ D;  2XEW A;  2AEH A;  3A1Q B;  3Q3N C;  1R4N B;  5EE0 A;  4WWO A;  2KAN A;  2CU3 A;  3P4S B;  2I1K A;  4E71 A;  2VH1 A;  2RPV A;  1MJD A;  2Z59 B;  2W3R A;  4GB9 A;  2C9W B;  1JWU D;  3N32 A;  4BAX A;  3V3X A;  3RI7 C;  1YD8 U;  3VXW A;  3A4S C;  4C00 A;  3DOW A;  4M01 A;  4XDC A;  3RZW C;  4BOZ B;  1NYR A;  4K3C A;  1FRR A;  2DYB A;  4PYZ A;  1V9J A;  2C7N B;  2ON8 A;  4W9I A;  2D11 A;  2W3S A;  2D5G A;  2A5U A;  1N61 A;  4W9L A;  1JRO A;  2HTM E;  1CJE A;  4FHK A;  2DZM A;  1YJ1 A;  1SGH A;  2V9H A;  2WXI A;  3ZNI D;  1UWM A;  2KWD A;  2EKE C;  3A33 B;  4IWQ A;  4LNO A;  5EDS A;  2NPT B;  5AZF A;  4DHJ B;  3UF8 A;  3NZ3 A;  2KKC A;  1PQS A;  2WDQ B;  1WF9 A;  5IO9 A;  5FR6 A;  2CS4 A;  5GXG B;  4L23 A;  3Q3M C;  3L17 A;  2KOX A;  2OOB B;  4KGR A;  2INC C;  4KIK A;  4WJP A;  2LAS A;  3GE8 C;  2ZJD A;  5DPR A;  2LXA A;  3EA6 A;  4ANX A;  4XE0 A;  3VDZ A;  3DDC B;  2LGS A;  1E9M A;  2ZCC A;  3KW5 B;  3KYC D;  2AX5 A;  4B6W A;  3ML8 A;  2EKI A;  3EUB 2;  4JQW C;  1T0Q C;  2K3U A;  4N59 A;  1GUA B;  3V05 A;  4KDI C;  3OWE B;  2O2V A;  1ZDV A;  3OLM D;  4WAF A;  4ASW C;  2V1Y A;  3N3K B;  1PDX A;  4CO7 A;  3Q3J A;  1V8C A;  4J3O D;  1LO5 D;  4US8 A;  2KJR A;  1KJT A;  2J42 A;  4TV3 A;  3V62 A;  4W9F A;  2BYF A;  4ZYN A;  3MTN B;  3X23 A;  2IO1 B;  3SHQ A;  3DCG A;  4RMA A;  4TUU A;  2RGF A;  3DPD A;  1L0Y B;  4JE3 B;  4A9A A;  2LRU A;  4LNI A;  2ZEQ A;  4P6V F;  2LD9 A;  3W5V B;  2REX A;  3U7Z A;  3VUX A;  4HKZ E;  3ZNZ B;  2BW2 A;  2NR2 A;  3MJW A;  1C76 A;  4M0W B;  4WAA A;  2INN E;  4YSX B;  1V49 A;  1AW7 A;  4MJS B;  3P42 A;  4LNK A;  3APD A;  5DPW A;  2LGD A;  2KQ4 X;  3IAS 1;  2JSV X;  3WA0 A;  5HHD G;  1HTO A;  2K25 A;  4MSQ B;  2K6Q A;  3DHH C;  2VRR B;  1WZ3 A;  4AWJ A;  2BYV E;  3ZUN A;  4EZJ A;  3E56 A;  1WMH A;  4FBJ B;  2MWS B;  2WXR A;  1RFA A;  1STE A;  4GOC A;  1MVK A;  2ZCB A;  2MJ3 A;  1RRB A;  2W82 A;  1ISN A;  3T8M A;  3AE8 B;  2IO0 B;  2RDG A;  3APF A;  3DHG C;  3V61 A;  2PVO D;  3VUY A;  4BOS C;  1C4P A;  3FAH A;  4PS3 A;  1XLP A;  2DHZ A;  2HTH A;  1SJH D;  4HPL B;  4HCP B;  1GC7 A;  2D3C A;  3BVZ A;  4JX1 C;  3HIZ A;  3B08 A;  2MRP A;  1RFK A;  4GN1 A;  3N30 A;  2NCN A;  4WQM A;  1TS2 A;  1HA5 A;  3C8Y A;  1TYG B;  1WX8 A;  2LXC A;  4W9D A;  5H8Y E;  4HXD A;  2IY1 B;  4PYU A;  1UF0 A;  4S17 A;  1TBE A;  3DVG Y;  1UBQ A;  4ARC A;  3PHX B;  4PS7 A;  3U52 E;  2WX1 A;  5FK9 C;  4MGZ E;  1V1O A;  1OFF A;  2JY6 A;  2XN9 C;  1HXY D;  2N9X A;  2WXJ A;  2HJ8 A;  4DDG D;  3AE4 B;  1ZGU B;  3IXS A;  3PO0 A;  2QHO A;  1GB1 A;  1LQB A;  2LVP A;  2EEL A;  3A9K A;  3DVN U;  4ZYS A;  3NUH B;  3Q3O C;  4RM9 A;  1WYG A;  3RFZ B;  1PUT A;  4M02 A;  5HKH A;  3WAN A;  3CMM B;  2N4F A;  3RUI B;  4MH8 A;  2W55 A;  3ZJT A;  1LGR A;  1QT9 A;  3N9Y C;  2ZZP B;  1NDD A;  2BKR B;  4YT0 B;  1ZOY B;  2IO3 B;  2Z0E B;  1MPE A;  1WGH A;  3OJ3 A;  4URK A;  2NS5 A;  3GZN B;  4IM2 A;  1VZ6 A;  3PRP B;  1Y8R C;  2BGF A;  3BK2 A;  1RLF A;  1NBF C;  4A3P A;  1L5P A;  2GMI C;  2HDE A;  4BKS A;  1OQY A;  5KHO A;  1D6E C;  1OTR B;  1Z2M A;  3TEW A;  3KQ4 A;  4N9F 4;  4WIP A;  3H7P A;  2BT6 A;  4P16 A;  3A9J B;  1L7Y A;  2BWE S;  3I3T B;  4MGI E;  5TSS A;  4LTU A;  2MCN B;  5D3I B;  3SDL C;  3GS2 A;  3AEA B;  3P1M A;  3HM6 X;  3NJT A;  4FA6 A;  2KMA A;  4USA A;  5TR5 A;  3CWI A;  4EFO A;  1P9D U;  3Q8C A;  3LYY A;  1SSN A;  1V2Y A;  2DZK A;  1JRP A;  5BO4 B;  1DYQ A;  1TY0 A;  2KNB A;  2KDB A;  4HPP A;  1WE6 A;  3ZIM A;  1T3Q A;  4NNJ B;  1GG3 A;  4OVZ A;  4MH0 E;  3I5J C;  4MDK E;  2M4N A;  5BMG A;  1V81 A;  2RMM A;  4MEM A;  1Q1O A;  2N9K A;  2K0P A;  3ZTC A;  1SE2 A;  2MP2 B;  1UUP A;  4BZA A;  1SIF A;  4RF1 A;  3R3M A;  3VR8 B;  2KTR A;  3AN1 A;  3TEX A;  2AQ3 B;  1R4M I;  1XCT L;  3QX1 A;  2RD0 A;  1LFD A;  1GAQ B;  2SEB D;  1E8X A;  2GBJ A;  1U4A A;  1YX6 B;  2NBW B;  2N1V A;  3QJZ A;  3L10 B;  3U4E G;  3NOB A;  1TKE A;  4JIO U;  5D6J B;  2V0G A;  2KFK A;  1FD6 A;  1NYQ A;  5D7G A;  3U8Z A;  1JWB D;  1WX7 A;  4CYE A;  3CIR B;  1XLN A;  3PLV A;  3LDZ E;  1WJ4 A;  4I6L B;  1TY2 A;  3PT2 B;  3SEB A;  3CSF A;  3ALB A;  1QOF A;  3ONS A;  2GBK A;  4NJ6 A;  2INP E;  2MW5 A;  1C4A A;  1FFU A;  3MHZ A;  2G4S A;  1WJ6 A;  3HK0 A;  5MPO A;  2WXN A;  1TS4 A;  4F7Z A;  2PVG C;  4MEL A;  4A20 A;  1V86 A;  4TKN A;  4ACF A;  4K7W A;  4C4V B;  3ZDM C;  4FLH A;  2G4D B;  4RCO A;  1WZ0 A;  4ZRQ A;  1TS3 A;  3UIO B;  2RSU A;  4A6Q A;  1FCC C;  2HE7 A;  3ZDT A;  1EF1 A;  3AUL A;  2CR5 A;  5J17 A;  3W1S C;  2ICI A;  2ZPN A;  5E6J A;  3RZF A;  4PK1 A;  4WJQ A;  2G45 B;  2NVU I;  4EZL A;  2W9N A;  2HJ1 A;  3IVF A;  3NRZ A;  1YOV B;  2FUG 1;  1X1M A;  4LJP B;  4CHK A;  2YEP B;  4LCD E;  5CHV C;  2KHW B;  3VTW A;  1N5W A;  1KFY B;  2GBR A;  4AJW A;  2FBW B;  1H8C A;  3PRZ A;  3AE5 B;  2WXQ A;  2DYM A;  3PS6 A;  4HEA 1;  1FXI A;  1CMX B;  4KDL B;  4AS1 A;  2L8J A;  4OW0 A;  3ZLZ A;  3GB1 A;  1IBX A;  3BVG A;  4M00 A;  2JX5 A;  4IWO A;  4GDK A;  5D3D A;  2A4Z A;  2WLB A;  4AOF A;  1L0V B;  5AUI A;  2I1J A;  4ICV A;  4IC7 B;  3PHW B;  2C5L C;  4NAW B;  2KN5 A;  1XT9 B;  5J18 A;  2ZVO A;  3JSV B;  3ZYY X;  2WWZ A;  1F2R C;  4XZ4 A;  1YX5 B;  3AXC A;  2LGI A;  3DBR I;  3D32 A;  3APC A;  1WH3 A;  3K9O B;  1V1P A;  2L05 A;  3DVG X;  3RD2 A;  3KVF B;  3FIL A;  4UDU C;  3WAO A;  2WQY B;  1RAX A;  5JHA A;  1VZ7 A;  2JT4 B;  2SAK A;  1L0X B;  1HTQ A;  4NPN A;  2KJH B;  1NI3 A;  3ZQ4 A;  2KAC A;  1KLG D;  1FNV A;  3RNG C;  1J7C A;  2J52 A;  4OZB A;  5E6N A;  4XC2 A;  4M8N A;  1TZ1 A;  3QHT A;  5BYS A;  1WE7 A;  2DLB A;  1N62 A;  2O2V B;  3TBL D;  3L13 A;  1VLB A;  2K6D B;  1V97 A;  2MJE A;  4WWM A;  2OHF A;  3RYT A;  1NEN B;  2PEA A;  2FIF A;  3RNA C;  1K50 A;  4BKT A;  1E7P B;  1VR9 A;  2LHD A;  5LLI A;  2L00 B;  2ZW1 A;  3VR9 B;  4LNF A;  1WX9 A;  2OJW A;  4WWP A;  4NQL B;  4AUQ C;  1QOG A;  2JRH A;  3EC8 A;  2KN4 A;  3NVZ A;  3NVW A;  4F1S A;  2O6V A;  1T0Y A;  4B0E A;  1UEL A;  4B95 A;  4EZK A;  3NVV A;  2M1M A;  2JUO A;  2KVZ A;  3PZ7 A;  2GRI A;  2PKO A;  3CST A;  1V80 A;  2LWP A;  4FXC A;  1UZX B;  1ACC A;  3C0R B;  3X0W A;  2BVC A;  3PLU A;  1MI0 A;  4MT5 A;  4MGY E;  2PTL A;  1WWT A;  3W2D A;  5IN7 A;  2B3A A;  1TZO A;  3IT4 B;  5IP4 D;  3ZRF A; 
#chains in the Genus database with same CATH homology
 5T8I A;  1SE4 A;  1QQR A;  4IDI A;  1SE3 A;  2H89 B;  3AEE B;  1ZUD 2;  3BK1 A;  1PGA A;  2JZP A;  4MM3 B;  1IGD A;  1KH0 A;  3AH7 A;  4ARC A;  1C78 A;  1FMA D;  1C9F A;  4TMA B;  1WRI A;  2X38 A;  3W1S A;  3P4Q B;  4HRS A;  3U52 E;  2WXL A;  1P7F A;  3U2S C;  5FK9 C;  1XF5 L;  2PW9 A;  4C56 C;  1I4G A;  1V1O A;  1OFF A;  2WNM A;  3I9V 1;  3SFD B;  2K22 A;  2BTE A;  2XN9 C;  4WUR A;  2BB6 A;  1HXY D;  3AMZ A;  1JQ4 A;  2LFI A;  2WXJ A;  2J53 A;  2LEK A;  4C7Y A;  3KWL A;  2LJI A;  1XLQ A;  3AE4 B;  4TQ0 A;  2MH7 A;  3IXS A;  3PO0 A;  2K9X A;  1GB1 A;  1IBX B;  2EEL A;  4ZYS A;  1PFD A;  1PGB A;  3NUH B;  1C77 A;  1WYG A;  2WXF A;  3DWM A;  2J4X A;  1F77 A;  2NTT A;  3AEF B;  2E3T A;  2QIL A;  5LNK 1;  1ET9 A;  3RFZ B;  1PUT A;  2Y5P A;  4R3D A;  4OZA A;  5FR3 A;  1BXT A;  1PYW D;  2N7J A;  2AQ2 B;  1C79 A;  4MH8 A;  4REZ A;  2BS2 B;  2W55 A;  3ZJT A;  1UGJ A;  3TSS A;  2GI9 A;  4ITK A;  2I2Y A;  1B9R A;  4Q2J A;  1FEH A;  4B0M A;  1QT9 A;  3IAM 1;  3N9Y C;  4YT0 B;  1ZOY B;  2MEK A;  4XWW A;  5BMH A;  1MPE A;  2V4I B;  1ZXI A;  1VZ6 A;  3BK2 A;  1EWY C;  1L5P A;  2WS3 B;  1OQQ A;  2HDE A;  1V1P B;  4NAM A;  3BII D;  1KRH A;  1YN3 A;  2JWU A;  1D6E C;  2JYE A;  2PIA A;  5FKA C;  1GB4 A;  1ZP0 B;  5EE3 A;  1K51 A;  2W54 A;  3BZD B;  3TEW A;  2E6X A;  5I4D A;  3BYT B;  3KQ4 A;  3MP9 A;  1QF6 A;  1SJE D;  4WIP A;  2BT6 A;  4P16 A;  3AV8 A;  1FRD A;  5TSS A;  4LTU A;  4JWU C;  1NVI D;  5D3I B;  1Y56 A;  2IPK D;  2N0S B;  1ET6 A;  5BMI A;  4ARI A;  3I57 A;  4GDL B;  3MFG A;  3GS2 A;  1F2R I;  1FCL A;  3AEA B;  3P1M A;  4US9 A;  5H92 C;  1Q10 A;  3NVY A;  4TSS A;  1RM6 C;  3AB5 A;  4KX6 B;  4TQ1 A;  4USA A;  4KKI A;  1QIL A;  1YQ3 B;  3CWI A;  1AWD A;  1CK1 A;  3Q8C A;  3LYY A;  4A55 A;  1SSN A;  1GOZ A;  1JML A;  2L52 A;  5BYQ A;  1JRP A;  3DWG C;  4ZHO A;  1DYQ A;  1TY0 A;  3Q8F A;  5AUK A;  3ZJU A;  1T3Q A;  1XCQ L;  1ENF A;  2KMM A;  1WSP A;  4OVZ A;  1J7B A;  1XO3 A;  1KTK A;  2I38 A;  5BMG A;  2M0A A;  4RGM A;  2RMM A;  1WGK A;  2G9H D;  4A90 A;  5JXV A;  2N9K A;  3EGR A;  1VZ8 A;  3AE9 B;  2K0P A;  1SE2 A;  4JWS C;  1UUP A;  2NTS A;  1E6E B;  1N63 A;  4RF1 A;  1JCK B;  3VR8 B;  2VZK D;  1M4V A;  3AN1 A;  3TEX A;  1QKZ A;  2AQ3 B;  3AE2 B;  1JWM D;  3KLS X;  2OED A;  1UWX A;  3Q8E A;  4KKJ A;  4XDD A;  1VDV A;  3AE1 B;  1D5Z C;  1XCT L;  4L1B A;  4XWT A;  4YXD B;  4ZOH C;  3Q8A A;  2R61 A;  2M56 B;  1YN4 A;  1B1Z A;  4M0W A;  2WXM A;  1T5X D;  1HZ5 A;  2PMV A;  3MC0 B;  2LHE A;  3HRD D;  3T3N A;  1GAQ B;  2SEB D;  3AM9 A;  1QOB A;  4DXG A;  3T3O A;  1N5X A;  1FNW A;  2L1A A;  3U4E G;  2WU5 B;  3ZJV A;  3TUO A;  2WDV B;  1NEK B;  1TKE A;  3FC4 A;  1YNT E;  3GP7 A;  1L4Z B;  2V0G A;  4IKG A;  1FD6 A;  2BS4 B;  2RDH A;  1NYQ A;  3AEC B;  4RGN A;  1DGJ A;  4CQN A;  1YMH E;  5HG2 A;  5D7G A;  2ONQ A;  4YTN B;  3W9C B;  1JWB D;  2V3P A;  3AED B;  1XLN A;  3CIR B;  1CQV A;  1SF0 A;  1TY2 A;  1HEZ E;  3SEB A;  1TKY A;  2Z8L A;  3B9J A;  1IUE A;  3O13 A;  1P7E A;  4KGS A;  5C3J B;  4MAC A;  2XNA C;  2QIE B;  4C80 A;  1I4P A;  2H88 B;  1QOA A;  3LB8 C;  1QOF A;  2K5P A;  2IGG A;  2WXP A;  3SR6 A;  4D2K A;  1FNU A;  1L6V A;  2VZK B;  1DOX A;  2Y3A A;  3BVM A;  4RH6 A;  1EU4 A;  2INP E;  1J7A A;  4NJC A;  1C4A A;  1FFU A;  2CU3 A;  3P4S B;  5EE0 A;  2JU6 X;  3Q69 A;  2GB1 A;  3MHZ A;  2RPV A;  1SEB D;  2L32 A;  1MHH E;  2W3R A;  3SFE B;  5MPO A;  1JWU D;  1FFV A;  3J9C A;  2WXN A;  1TS4 A;  3V3X A;  1ROE A;  1L4D B;  3L4P A;  2PVG C;  1I7H A;  1SBB B;  4ZRP A;  4XDC A;  5EE9 A;  1NYR A;  1FRR A;  1ZPS A;  2YEP F;  1YJI A;  1I4Q A;  2ON8 A;  4RCO A;  4ZRQ A;  2W3S A;  1BUI C;  2D5G A;  1TS3 A;  2ZW0 A;  2WXO A;  4A6Q A;  1N61 A;  1FCC C;  2WU2 B;  1JRO A;  2HTM E;  1CJE A;  2IJ0 A;  4H2A A;  4IOI E;  1C4C A;  1ZE3 D;  2QMT A;  1XEE A;  1FM0 D;  2ICI A;  4RGT A;  5E6J A;  2WXI A;  2KAJ A;  1L6U A;  1UWM A;  2KWD A;  2IDY A;  4HJG E;  4YSY B;  4O1N A;  3NRZ A;  1JW9 D;  2FUG 1;  2WXK A;  1YJJ A;  1TS5 A;  2YEP B;  1N5W A;  4RF0 A;  3TEZ A;  1KFY B;  2MJD A;  3HVZ A;  3NZ3 A;  2FBW B;  2IGD A;  3AE7 B;  3AE5 B;  1E10 A;  2WXQ A;  1ZDX A;  2WDQ B;  1EWC A;  2DYM A;  3AEB B;  1K52 A;  1N60 A;  1XXG A;  2WP9 B;  1JWS D;  4HEA 1;  1TKG A;  1FXI A;  2V3N A;  5GXG B;  4L23 A;  5BYR A;  3ABV B;  1YN5 A;  4AS1 A;  1SXT A;  4KGR A;  1D4B A;  1WXQ A;  4OW0 A;  3VQI A;  2IGH A;  4N58 A;  1DOY A;  4HKQ A;  3EA6 A;  2DYO A;  3GB1 A;  3UI3 A;  3MJ5 A;  3BVG A;  2DWQ A;  4XE0 A;  1IBX A;  1SB3 C;  4GLS C;  4RGO S;  1I4H A;  1E9M A;  4YTP B;  2JX5 A;  2AX5 A;  1UNS A;  3E9S A;  5D3D A;  2WLB A;  5HFY A;  1ESF A;  1IGC A;  2EKI A;  1L0V B;  3EUB 2;  2BBC A;  3W5U B;  1D5M C;  2JYT A;  5AUI A;  2WDR B;  2K3U A;  4N59 A;  5G5H A;  4YSZ B;  1T6B X;  3KWV A;  5EE1 A;  3V05 A;  4NAW B;  4AQ7 A;  3OWE B;  3ETR A;  4JPS A;  3ZYY X;  3IT6 B;  1ZDV A;  3P63 A;  4WAF A;  2N9L A;  2L83 A;  1F2R C;  1PDX A;  3RPF C;  1R7S A;  1SIJ A;  1V8C A;  4J3O D;  1LO5 D;  4US8 A;  2KDM A;  2LGI A;  3PZ8 A;  2J42 A;  2BYT A;  4YWG G;  3LXF A;  1AN8 A;  1V1P A;  3R8B A;  1XLO A;  3FIL A;  4UDU C;  1JAL A;  2WQY B;  3HUI A;  1CZP A;  1GPX A;  3BWU D;  1VZ7 A;  2BB5 A;  2BS3 B;  2SAK A;  1L0X B;  2WXG A;  3R2I A;  3VRB B;  2LUM A;  1NI3 A;  1L0Y B;  4JE3 B;  4A9A A;  4P6V F;  3WCQ A;  3ZQ4 A;  2KAC A;  1KLG D;  1FNV A;  3W5V B;  2ACZ B;  3U7Z A;  1J7C A;  4DXF A;  1PGX A;  4WH4 A;  5G5G A;  4GDK B;  3Q8B A;  4HKZ E;  1HQR D;  1E0Z A;  2BW2 A;  2J52 A;  4OZB A;  4PT5 A;  3URY A;  1C76 A;  1FIQ A;  1QLB B;  3NS1 A;  1HZ6 A;  5BYS A;  2TSS A;  2DLB A;  1N62 A;  2INN E;  4RNA A;  3BYY B;  1EU3 A;  4N6E B;  2NMQ A;  2B76 B;  4YSX B;  1VLB A;  2MJE A;  1V97 A;  1OQR A;  4NZL B;  4WWM A;  1AW7 A;  2OHF A;  1I4X A;  3B2F A;  1NEN B;  3P42 A;  4ZHP A;  3TEY A;  2KQ4 X;  3IAS 1;  2JSV X;  2Q5W D;  5HHD G;  2JXT A;  4HRO A;  1VJK A;  1K50 A;  3VRA B;  3FIL B;  1D5X C;  1FO4 A;  2AQ1 B;  1TJE A;  1E7P B;  1BML C;  1VR9 A;  2LHD A;  2JQR B;  3E56 A;  2PLP A;  4RFB A;  2ZW1 A;  3R2T A;  3VR9 B;  1KLU D;  3P4R B;  2WXR A;  3AE3 B;  1I4R A;  1STE A;  2QEJ C;  1MVK A;  2MJ3 A;  1QOG A;  1DOI A;  5HI1 A;  2W82 A;  2QSD A;  3AEG B;  3ZGZ A;  2FE8 A;  4LLG M;  2KN4 A;  1AYF A;  4DQO C;  4L2Y A;  3NVZ A;  3NVW A;  3AE8 B;  1RWS A;  4LK0 M;  5C2T B;  2G1E A;  2RDG A;  4B0E A;  2CJN A;  2LMC A;  2PVO D;  1JWA D;  1A70 A;  2QJL A;  1F0Z A;  1K53 A;  1KF6 B;  1C4P A;  3NVV A;  3PZ7 A;  1VRA B;  3FAH A;  2GRI A;  2PKO A;  1XLP A;  1YQ4 B;  3AE6 B;  3P4P B;  1SJH D;  4OZC A;  4FXC A;  2WXH A;  1ACC A;  4KGT A;  4EE2 A;  4A8X C;  3HVD A;  2M19 A;  2DBY A;  3BVZ A;  3B2G A;  1RYJ A;  4JX1 C;  1MI0 A;  4MT5 A;  1FXA A;  1EM7 A;  1RFK A;  4WQM A;  1TS2 A;  1HA5 A;  3C8Y A;  2PTL A;  1WWT A;  1TYG B;  4C7Z A;  3W2D A;  1MHX A;  2CJO A;  1ZXH A;  5H8Y E;  2Y5C A;  1TZO A;  3H8H A;  3IT4 B;  4YTM B;  4OHJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...