3P4QB

Crystal structure of menaquinol:oxidoreductase in complex with oxaloacetate
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
243
structure length
243
Chain Sequence
AEMKNLKIEVVRYNPEVDTAPHSAFYEVPYDATTSLLDALGYIKDNLAPDLSYRWSCRMAICGSCGMMVNNVPKLACKTFLRDYTDGMKVEALANFPIERDLVVDMTHFIESLEAIKPYIIGNSRTADQGTNIQTPAQMAKYHQFSGCINCGLCYAACPQFGLNPEFIGPAAITLAHRYNEDSRDHGKKERMAQLNSQNGVWSCTFVGYCSEVCPKHVDPAAAIQQGKVESSKDFLIATLKPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fumarate reductase flavoprotein subunit
publication title Geometric restraint drives on- and off-pathway catalysis by the Escherichia coli menaquinol:fumarate reductase.
pubmed doi rcsb
source organism Escherichia coli 042
molecule tags Oxidoreductase
total genus 60
structure length 243
sequence length 243
chains with identical sequence N
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2010-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13183 Fer4_8 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 3p4qB02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3p4qB01
1ZP0B 1FM0D 5EE3A 5C2TB 1TKGA 2DWQA 3B2GA 3AM9A 1I7HA 3FC4A 3HVZA 3AEEB 3AE2B 1ROEA 5AUIA 2H89B 1GTHA 5H92C 3HUIA 2M56B 2W54A 1J7BA 1YQ3B 3AECB 4YSYB 1RWSA 1PFDA 1TKEA 3EUB2 3AEGB 1E9MA 4FXCA 3NRZA 2CU3A 5EE9A 2K22A 3B9JA 2W55A 1N61A 3SFDB 2JX5A 3P4RB 1WGKA 1WRIA 1WWTA 1FMAD 3NVZA 4JWUC 2BS2B 2OHFA 4ZHPA 1DOYA 3VRBB 1FFVA 2L83A 1NYRA 3VR8B 1JALA 3ABVB 2M19A 1CZPA 1ZXIA 3SR6A 4JWSC 2B76B 1OQQA 4YTMB 2PVOD 3NVYA 3AE6B 1RFKA 1XLOA 3AEDB 4US8A 1L0VB 4YT0B 1AWDA 3LB8C 3NS1A 5EE0A 1WXQA 4C80A 3W5UB 2WU5B 1A70A 1E7PB 1NVID 1RM6C 2JQRB 2Q5WD 4N6EB 1R7SA 1RYJA 4YSZB 1N5WA 3ZYYX 1H7WA 2LEKA 3AEFB 1JWAD 1KFYB 1NEKB 1SB3C 1FXAA 1JWBD 4ZHOA 1E10A 2G1EA 4LTUA 3RPFC 3AEAB 2MJ3A 3P4QB 2W3RA 1V8CA 3NVVA 1TYGB 1QLBB 1QOGA 3CWIA 2DBYA 1NENB 1GTEA 1E6EB 1OFFA 2K5PA 1EWYC 5H8YE 2KAJA 1FXIA 4C7YA 3VRAB 3P1MA 3FAHA 1IUEA 2N0SB 2Y5CA 3AH7A 3AE5B 1KF6B 3SFEB 1NYQA 1QOAA 3AE1B 1JRPA 1OQRA 2EKIA 1KRHA 3DWMA 2WDVB 2MJEA 3AB5A 3HRDD 2AX5A 1J7CA 1FIQA 4IDIA 4N59A 1H7XA 1QT9A 1B9RA 3LXFA 4N58A 4HROA 1DGJA 1ZOYB 2PVGC 1UWMA 1GPXA 3P4SB 1FRRA 2BS4B 1JROA 1XLNA 2MJDA 3B2FA 2CJOA 3WCQA 4YTPB 4YTNB 3P63A 1NI3A 5AUKA 3W9CB 1YQ4B 2HTME 1E0ZA 3PO0A 2BS3B 4A9AA 4WWMA 1DOIA 3AE7B 2WLBA 2WP9B 1N60A 4P6VF 4USAA 3W5VB 5G5GA 4US9A 3AE8B 1TJEA 3AE4B 1SIJA 3L4PA 1T3QA 2K9XA 1QF6A 4YSXB 1N63A 1ZUD2 1QOFA 3AN1A 5EE1A 2FBWB 1WYGA 5MPOA 4YXDB 2KMMA 1VJKA 1QOBA 1V97A 2PIAA 3CF4A 1F0ZA 1GT8A 2W3SA 1L6VA 2WDQB 2WS3B 2WDRB 5C3JB 1JW9D 1FRDA 1L6UA 2QIEB 1N5XA 2PKOA 1AYFA 3ETRA 1VDVA 2H88B 2QJLA 3AMZA 4HRSA 1GAQB 4WQMA 3VR9B 1DOXA 1FFUA 4JX1C 4C7ZA 3DWGC 3AEBB 3CIRB 2WQYB 1N62A 4KX6B 1FO4A 1XLQA 2CJNA 1PUTA 1VLBA 3AV8A 2ACZB 2BT6A 3AE9B 1XLPA 3P4PB 2WU2B 1J7AA 1SF0A 3KWLA 3AE3B 1XO3A 1CJEA 2E3TA 4ITKA 3NVWA 4ZOHC 1TKYA 1PDXA 5G5HA 1YJJA 2L52A 2MH7A 3BIID 5GXGB 1L5PA 1YJIA 1JQ4A
chains in the Genus database with same CATH superfamily
1FM0D 2DYMA 3AM9A 3PLUA 1YMHE 2D3AA 2CHXA 3Q2AC 1VD2A 2MX2A 2K8CA 2BGFA 5D2MB 1TTNA 4WWPA 3DBHB 2MA9B 2LGIA 3QK0A 3H7PA 1HA5A 2RMMA 1WJUA 2MQJA 4HDOA 1V5OA 1C76A 2N9LA 1MHHE 2PMVA 4DDGD 3BYYB 3NZSA 4PYUA 3N1YC 1I42A 1JWBD 4ZHOA 1C4CA 2NBWB 1K52A 3PREA 5IOIA 1R4MB 4C7YA 2XNAC 3VRAB 1TY0A 4AOFA 1KLVA 2DYBA 1JRPA 4EOYA 2QMTA 1TZOA 4EKUA 4WAFA 2KDFB 2HD5B 3HRDD 1B9RA 2PVGC 2A4ZA 5C1ZA 3APFA 2IO1B 1WMHA 3PRZA 3RUIB 2HTME 1H4RA 4A9AA 4WWMA 4KSKC 3WAPA 1E8YA 4DBGA 3H1UA 4F7ZA 1OEYJ 5MPOA 2BYEA 2DNFA 3U2SC 1V2YA 1WM2A 1N5XA 2JYEA 4MT5A 1MG8A 3Q3JA 4KDIC 3CIRB 4BBNF 2KJ6A 1K50A 4TSSA 2ON8A 1EWCA 1TKGA 4NJ6A 2CR5A 3EA6A 3FC4A 3IT6B 2OOBB 3AECB 4YSYB 5D7GA 4JWUC 3BINA 1LGRA 3ABVB 3RNBC 1ZXIA 3MP9A 4AJYB 3I63C 3BK2A 4HDQA 4A3OA 5LXHA 4US8A 2D5GA 1RM6C 4JLCA 2A5UA 3VUXA 4NJ7A 1N5WA 2LEKA 3O13A 2RDBC 2BBCA 4MM3B 1MPEA 1R4NB 1SB3C 4C4VB 2KWDA 1P3QU 2ZNVB 2N1VA 1CMXB 2BYVE 2M1MA 3NVVA 2MP2B 3RN9C 2WXJA 1N6ZA 2L32A 1RRBA 2NR2A 1SE2A 2UWQA 5H8YE 1RLFA 3VDZA 4MJSB 1KRHA 4R3DA 2LMCA 3OWEB 1ZW7A 3WIMA 1XCTL 3FILA 4E74A 4PYZA 4FHKA 2KC1A 5L83A 1V86A 3ZRCA 3TEZA 3WANA 1ET6A 2ZEQA 1AARA 4II3B 1N60A 3AULA 3C8YA 3Q69A 4M8MA 4YWGG 3GE8C 2GLSA 4LNNA 3Q14C 2BB6A 1WYGA 2BWFA 2JRIB 4IC7B 1TBEA 3ETRA 2PKOA 1VDVA 1GNUA 3I57A 4KIKB 1E8WA 2C7MB 2LJ5A 1WXVA 3UQAA 2M8SA 3RZFA 2HTHA 2O2VB 1T6BX 1XLPA 2JT4B 2IO0B 4NQLB 4ITKA 4DWFA 2KDMA 2LJIA 1F0ZA 5EE3A 2MW5A 1E7VA 2Z0EB 5AUIA 2N9EB 4DHJB 3KUZA 1YQ3B 4AJWA 1WRIA 4GDLB 3LYYA 1CZPA 3TSSA 3U7ZA 3UQBA 1VR9A 1KLGD 1XLOA 2N9PC 3AEDB 1L0VB 3L10B 4PK1A 3A1QB 3ONSA 3K9PB 4G50A 4ICVA 2IJ0A 1HE8A 3ZDMC 2KTFA 3NHEB 2WWZA 3D32A 1LFDA 3TL5A 2DBYA 3NOBA 1GTEA 2J4XA 1ZDVA 3FAHA 1D5ZC 4XZ4A 3GP7A 4WJOA 2DYOA 1AW7A 1TGZB 5IA7A 3KWVA 4HJKA 3DHIC 3EFUA 4K1RB 4ANUA 1WR6E 4A3PA 2CJOA 1GUAB 3RNFC 2Z0DB 4P1CC 3W9CB 4MGIE 2YVCA 2DAJA 4HKZE 4DDID 1ZDXA 4M01A 2ZW1A 2M0AA 2NTSA 2RDHA 3IFWB 1C77A 1I4PA 1Z2MA 5HHDG 4MSQB 4P16A 5I4DA 4WAAA 1FCLA 2VH1A 2JRHA 1QQRA 1UD7A 4C4VA 3AU5A 4MGZE 1PUTA 1C4PA 3NZUA 2WU2B 4OVVA 2RSUA 1EO6A 3AE3B 3PZ8A 2OJRA 5E6NA 1TIFA 3VHTC 1YJIA 1MVKA 3QJZA 1ROEA 2JXTA 2LVQA 2AQ2B 2OHFA 5J2RA 3M3JA 3VRBB 2L83A 2N7DA 2ONQA 1J8CA 2FCQA 4KVGB 3W2DA 2N7JA 3Q3MC 4ZRIA 5D3IB 2WU5B 2IY0B 2Q5WD 2KTRA 4IWQA 3IHPC 1YN5A 4M8NA 2RD0A 2HJ8A 1KFYB 3DBRB 4KIKA 2KQ4X 1SE9A 1S3SG 3BY4B 4TV3A 1TS2A 3VTUA 1YN4A 2KAJA 2N0SB 3DBLI 3QCAA 1RFAA 4LNFA 4XWWA 5HI1A 4DHZE 1WGYA 4JPSA 2KYWA 3IXSA 2PEAA 4J3OD 4F8CB 2L8JA 3DQVA 3WCQA 3DBSA 4NNJB 1NI3A 4DXGA 1L0XB 1HZ5A 1SEBD 1FEHA 2X8XX 3NG0A 2RPQA 2LFIA 4W9HA 4QAYA 2MSED 3APCA 3VTVA 2FNJB 4GN1A 1QOFA 2WXGA 3H9DA 4PS7A 3N9YC 4WURA 4W9CA 2JUOA 2WYQA 2BTEA 2ZVNA 1L6VA 1ZPSA 4W9GA 4W9LA 3TBLD 1KH0A 5HG2A 4FULA 1L4ZB 3GZNI 2MRPA 2V3PA 2EKEC 1FO4A 3OG5A 2ACZB 4LJPB 3NY5A 5D3DA 2KWVB 2NPTB 3I5JC 4EUTA 4FN2A 2MH7A 2MLBA 2AL3A 4CQNA 1JQ4A 3T8MA 1WM3A 3CMMB 4HXDA 2GBRA 3HVZA 2V1YA 1VZ8A 3QHTA 3RI7C 4BVUC 4YL8A 2L0TA 3SD5A 3SFDB 2JX5A 2L0FA 3ML9A 3DBLB 3B0AA 2TSSA 1JMLA 2M0XA 4X57B 2CHWA 2KDBA 3MJ5A 1YQBA 2AQ3B 3AE6B 4P1BC 2J0JA 3I9V1 4WQOB 3Q8AA 3NJTA 3ZNID 3AEFB 3DVGX 1WMHB 4ZRPA 3AEAB 3IAS1 5BMGA 1UGMA 4W9JA 1QLBB 3NS8A 4AP4C 2D10A 3PHXB 1TS4A 3P1MA 3WALA 4EE2A 3AH7A 3LJ3A 3GZNB 5CX3A 4IM0A 1HTQA 2MBQA 1XT9B 3ZRFA 1ZOYB 1GPXA 2CHZA 4AQ7A 2GBKA 3RNEC 2WXMA 2JWZA 2KACA 2BS3B 4OHJA 4NPNA 4RH6A 3RYTA 2KQ7A 4US9A 3L54A 5FKAC 2V4LA 3DBHI 1VJKA 1QOBA 2JYTA 2EMTA 2KX3A 5LLIA 1Z5SB 3B1LX 1TS5A 2WDQB 2QILA 5JXVA 1L2NA 2R61A 3AMZA 3ZW3A 1P1AA 2BT6A 3M95A 4XDDA 4B0EA 3H6NA 2IGGA 1Q0WB 2ASQA 2UU7A 4G0NB 5TSSA 3BIID 3M63B 3QIJA 1D5XC 1R4MI 1NBFC 3RD2A 1D6EC 3IVFA 1EUVB 1UNSA 3SHQA 4P7IA 3RULA 1MHXA 3DPDA 4ZYNA 3NVZA 2L00B 4DXFA 4PT5A 2O6VB 1ZKHA 1WF9A 2V3NA 4OZAA 2KFKA 2JWUA 5IN7A 2WNMA 2L05A 2WXNA 3FILB 2RR9A 1VZ6A 1WH3A 2N9XA 2G1EA 3N1ZC 2JY6A 1OEYA 1V1PB 1WJ4A 2I1KA 3BZDB 2Y5CA 1LO5D 4A8XC 4IOIE 2QC8A 2NPTA 2MJEA 1EF1A 4HK2A 1SBBB 2KO3A 1G6JA 2WXFA 4PS8A 3RZWC 2MJDA 3R8BA 4YTNB 5E6OA 2C60A 1UBQA 3DDCB 2WLBA 4J6IA 2EELA 1QF6A 3RNAC 2B3AA 2GBJA 1K53A 2GMIC 1XQQA 2W3SA 3SU8X 2XN9C 2QJLA 2H88B 5BMHA 3PS6A 3KYDD 3A9JB 2C7NB 1VLBA 2R2QA 2RDGA 1V80A 1R4NI 1WGRA 5JZEB 1JCKB 5G5HA 2LASA 4DHJD 1SXTA 5KHQA 1SIFA 3MC8A 3I3TB 3MHZA 4C56C 2KWCA 3U52E 3ZJTA 4LLGM 3V3XA 3ZDTA 2W55A 1N61A 4G11A 2CU1A 1SJED 3V60A 1QKZA 3KLSX 3VR8B 2FUHB 2KMAA 4BKTA 3SR6A 1P7FA 1U4AA 2NTTA 2J52A 1S1QB 4JGHB 3LDZE 1H7WA 2IBIB 2KK8A 5CTRC 2KLGA 3A9KA 2LVOA 3PZDA 4MGYE 1CQVA 3DVNU 4ANXA 4BZAA 2KMCA 2WXHA 3HIZA 2QCZA 4K3CA 1EWYC 1GC6A 4MEMA 3AE1B 3JYUA 1FRRA 4MDKE 2N1WA 1XEEA 4YTPB 2K6QA 5T8IA 1YQ4B 1F2RC 2QHOA 1DOIA 5G5GA 1ENFA 2O6VA 2G4SA 3RFZB 5IP4D 2BKRB 3ZUNA 1C79A 2KLCA 3CF4A 5BYQA 3VFKA 2HJ1A 1K8RB 2WS3B 5AZFA 3V6CB 1HXYD 4JIOU 2YEPF 4LNIA 3N1XC 1EF5A 3PZ7A 3VTWA 4KX6B 3RCZA 3EGRA 2D2QA 3PVLA 2PPHA 2ZCCA 4K81A 3U4EG 3ZNZB 4WH4A 3NVWA 1PGXA 1V1PA 1TKYA 3PSEB 1I4RA 4KZCA 1L5PA 2KTRB 5DCNA 5GXGB 4FA6A 1MJDA 4WJPA 3AE2B 1KTKA 2H89B 1RWSA 2PW9A 4I6NB 1YX5B 1BXTA 2IO2B 2BS2B 4ZHPA 4TQ0A 1FFVA 1ISNA 5E6PA 2HDEA 3OAWA 1T0YA 1EU4A 2WDTB 2B76B 3ZNHB 3K9OB 3UGBB 2GRIA 2K3UA 3R7RA 4N6EB 1R7SA 1ET9A 2KOXA 2MBHA 1IPGA 3ZYYX 5EDSA 3DHHC 3VUWA 4ZRJA 1D3ZA 2K39A 2MJ3A 4FHJA 4RF1A 3WAMA 3A9JA 2K5PA 5J18A 5IAAC 4MACA 4XC2A 3PHWB 3DWMA 1SSNA 2GBMA 3R3MA 2WXRA 4DQOC 2WXLA 2JU6X 3VQIA 1TT5B 3UIOB 2LXAA 3B08A 1XLNA 2DENB 2KJRA 5G55A 1JRUA 3PT2B 4NAWA 1ZGUB 2FIFA 4RGNA 5BMIA 2KWUB 4OW0A 1YIWA 3N3KB 1F52A 2L1AA 1T0RC 2INPE 3ALBA 4S17A 3HHMA 2MBBB 1JW9D 2QIEB 1OGWA 4C7ZA 3AEBB 2LUEA 4NZLB 3DBRI 4B0MA 3APDA 4L2YA 3EC8A 4ICUA 2KC2A 1E8ZA 4HWIB 4IKGA 2D11A 3DHGC 3NRZA 3ZTCA 4NAMA 5LXIB 2DLBA 4KGRA 1XD3B 3V61A 1X1MA 4IM3A 2PVOD 1HZ6A 2JSVX 3ML8A 3NS1A 3TMPB 2IPKD 3EHVA 4IWPA 1ESFA 2JQRB 3TEWA 1KM7A 4HCPB 4MSMB 2VZKD 4MH0E 3DVNV 3Q3NC 1YX6B 1KLUD 4LTUA 3L0WB 3A4RA 3ZLZA 1QOGA 3AU4A 3CWIA 2INDC 3EFCA 3A33B 2FUG1 1FXIA 2QEJC 4MELA 4NJCA 1UELA 1PGBA 3AE5B 2EKIA 1TZ1A 4HVBA 2PE6B 3QA8A 2QSDA 4N59A 2IO3B 4TUUA 1Q1OA 3KQ4A 2C9WB 3P63A 3IT4B 1P0RA 4FJZA 2V0GA 3QX1A 1E7UA 4LNOA 2REXA 1T3QA 3P2BA 1ZUD2 3Q6BA 5EE1A 1WX8A 2W82A 1FRDA 2LVPA 1I4QA 2NVUI 5IO9A 1GAQB 1E90A 2VH2A 4RMAA 1C3TA 2LRWA 1V5TA 3GE3C 1YNTE 3R2TA 5DPWA 3TEXA 4D2KA 4LJOB 4S0RA 3U30A 2C5LC 4HLEA 2IYDB 2KFKB 1CJEA 4XGAB 1JWSD 3QC8B 4WWOA 1ZP0B 3MHSD 1WI0A 1J0GA 1BMLC 3HUIA 1V1OA 2W54A 1KOTA 1PFDA 3AEGB 2K22A 3N32A 1SJHD 2O6VD 1P9DU 1FMAD 5L95C 1WSPA 1NYRA 1UZXB 1BUIC 4N9F4 3N20C 3V6EB 2C7HA 1SE4A 1OQQA 3NVYA 3P42A 3EECA 1PQSA 4XDCA 3ZQ4A 4BKSA 1RYJA 2J53A 1A5RA 2JXXA 1FXTB 4HKQA 2WX0A 1P7EA 4L23A 2AL6A 2WXPA 3SEBA 1WJNA 2Z8LA 2ZPNA 1I4GA 1KJTA 4GGQA 1OFFA 1E6EB 2AQ1B 3Q8CA 4TMAB 4L1BA 1SGHA 4TKNA 3PPAA 1I4XA 4E3CA 4A20A 2VZKB 5LNK1 2W9NA 2DZJA 3BWUD 3W5VB 3C0RB 1N63A 3AN1A 2KMMA 1V97A 1T5XD 2AYOB 1WRDB 4HEA1 5C3JB 2IDYA 4W9DA 3TCAA 2KT7A 3P4PB 1J7AA 2KD0A 3QWZB 4M02A 2E3TA 4ZOHC 1WXAA 1WIAA 4GU2A 3HK0A 1YJ1A 2NBUA 1I7HA 2FAZA 3A9KB 1GTHA 5H92C 1V6EA 3B9JA 1WGKA 1V81A 4RGOS 3KW5B 2WX1A 1DOYA 2IGHA 3VUYA 2DX5B 4URKA 3A4SC 3BK1A 3MTNB 1F1HA 4M00A 4A6QA 1H8CA 1E7PB 1NVID 3MJWA 2K1FA 2KNBA 1WZ0A 2ZPYA 1NEKB 4KDLB 1ACCA 3ZXVA 3RPFC 2L7RA 3QAQA 3S2AA 1F2RI 1TYGB 3Q3FA 1NENB 3KYCD 2X38A 3GS2A 2SEBD 1L7YA 3RMKC 3QQ8B 2ZW0A 1J7CA 1FIQA 1WXSA 1H7XA 1DGJA 4GLSC 1WX9A 2BW2A 2BS4B 4AUQC 4BBNC 2D3BA 4WIPA 2L76A 4EEWA 1E0ZA 1JWUD 5BO4B 4USAA 1NDDA 3BVGA 2PTLA 4HCNB 3L4PA 5FR3A 4OVUA 2FBWB 4YXDB 1WFYA 2PIAA 1OQYA 1GT8A 3UIPB 2EMSA 2KZRA 4FBJB 1E5WA 2LGDA 2INNE 1Q5WB 4EZKA 4DHZB 4BAXA 1FPYA 1STEA 3E56A 1DOXA 3ZJVA 4GDKA 4E71A 3E9SA 2J42A 3OJ3A 2WQYB 3DCGA 2BF8B 3PRPB 2L3ZA 1SE3A 5AZGA 3KWLA 1SF0A 2HE7A 1M94A 2R2OA 3ZIMA 1PDXA 2DHZA 4BKGA 1LQBA 2JZZA 2LZ6A 4CO7A 3KUCB 3KUDB 1J7BA 1QZEA 1E9MA 2G3QB 2KXJA 2AEHA 2NCNA 4I6LB 2JPHA 2M17A 3LB8C 2Y5BB 5EE0A 4IUMB 2IZVB 2KJHB 3W5UB 4HJGE 2OJWA 3RT3B 2N4FA 1IBXA 3PGEA 1FXAA 4NAWB 4IG7B 3HM3A 3V05A 4FJYA 1V8CA 2LGSA 4TQ1A 4O1NA 1UUPA 5J17A 1LXDA 3VVWB 2MBOA 3W1YA 4XE0A 1OQRA 2BVCA 3QARA 3AB5A 3TEYA 3LXFA 5E6JA 4PS3A 5CHFA 4RGMA 3Q8FA 3WAOA 4EZLA 1GG3A 2WGSA 3AI5A 3Q8EA 3JW0X 1IP9A 4B9KA 1PGAA 3ZGZA 2UYZB 3AE8B 4BKSD 3AE4B 3JSVA 4LK0M 3ENEA 2KDIA 2MCNB 3ZTDA 3PV1A 2AWTA 4KSLC 1AN8A 1VRAB 2K25A 1MFWA 3WA0A 4RNAA 4B95A 1FCCC 1XCQL 2J7QB 1AYFA 4KGSA 4WJNA 2CKHB 3VR9B 5JHBA 3DOWA 4MGKE 4IM2A 1WGHA 2I38A 3AE9B 3URYA 2Z59B 4ANVA 1EU3A 4HPMB 1WZ3A 4FJVB 1IYFA 4AWJA 2DZIA 4OVZA 2K8HA 2LHDA 4RCOA 3AEEB 5BYRA 4II2B 1C4AA 1PYWD 3EUB2 5EE9A 2CU3A 1T0SC 2IGDA 3JVZX 3HM6X 3IBEA 2DZMA 4ANWA 2ZJDA 2M19A 3GB1A 2LHEA 2LXCA 5C23A 2V3SA 3UI3A 1RFKA 1VZ7A 1AWDA 4C80A 2MHJA 3TIXA 1A70A 3RNGC 3L17A 2G9HD 2XEWA 1EM7A 1F77A 2D07B 1WX7A 2J0KA 2WXOA 3CF6E 1LM8B 1E10A 4BFRA 1I35A 1GB1A 2PLPA 2MWSB 5DPRA 3P4QB 4W9KA 4CYEA 2BYFA 2ICIA 2XK5B 2WXQA 4BOSC 2FIDA 4H2AA 1IUEA 1WJ6A 3SFEB 5BYSA 5HFYA 3KVFB 1P98A 4NQKE 1JWMD 2K0PA 3DVGY 1UWMA 3L08A 3P4SB 1JROA 2MEKA 3IAM1 5AUKA 3ZNGC 1Y8RC 4ARCA 4W9IA 1TJEA 4ZRKA 1C1YB 4JE3B 2K9XA 5G2NA 4YSXB 3HVDA 3Q3OC 4GB9A 3ZKJC 3RNCC 2WDRB 3U8ZA 3Q8BA 3IG3A 2PJHA 2PE9A 4UDUC 4XX5A 1V49A 4K7UA 2G45B 1VCBA 1WGDA 1OTRB 2K6DB 4ACFA 3BVZA 2ZNVC 1E8XA 1YJJA 2GOWA 3ECIA 3SDLC 4IW0A 2NBVB 2M56B 1WY8A 1TKEA 4FXCA 4OZBA 2OEDA 4A55A 1B1ZA 3P4RB 2BPSA 3C19A 3T9LA 1XF5L 3N30A 3PRMB 1UGJA 2M4NA 4KV2A 4IWOA 1JALA 2FCMA 4JWSC 3ZXRA 1YN3A 4YT0B 2GI9A 4FADA 1MG4A 1WXQA 5FR6A 2KDEB 4YSZB 3MFGA 3M62B 1HEZE 1J19A 5CHVC 4I6PA 4DK5A 3X23A 2FCSA 1GOZA 2W3RA 1UH6A 2I1JA 1RAXA 3ZJUA 2JVCA 2KANA 3KH0A 1CK1A 5IKCM 2KN4A 4C00A 2BB5A 1MI0A 1UF0A 2D3CA 4CHKA 2AX5A 4M0WB 1QT9A 4K3BA 4HROA 1YOVB 4MM3A 3B2FA 2BWES 4GXBA 2LGYA 3R7QA 1HQRD 3T3OA 3CSTA 4K7WA 2WP9B 2MP2A 4RM9A 1C9FA 1SIJA 3J9CA 2LWPA 3L13A 2LD9A 4KKIA 5KHOA 4MJSA 4ASWC 3R2IA 1FNVA 1WE6A 1ZE3D 2ZVOA 3AXCA 4HRSA 4WQMA 2Y5PA 4JX1C 2ZCBA 2CJNA 3AV8A 2KKCA 2NMQA 2XK5A 1XO3A 4WWNA 2YLMA 2WHIA 2MBEA 5C2TB 3OLMD 3B2GA 5D94A 3V62A 3VAWA 3PLVA 1WE7A 2LGXA 5TR5A 2VRRB 4A90A 2KN5A 5DPSA 2O2VA 3ZVVA 4LDTD 1WGGA 1TY2A 1GJZA 4W9FA 4GOCA 2K8BA 3H7SA 1K51A 1BT0A 1D4BA 3L16A 2SAKA 1ZXHA 1UBIA 1IGCA 3MC9A 3NUHB 4DXAB 4RM8A 2WXKA 1WR1A 3BYTB 4GDLA 2IY1B 4KKJA 4F1SA 1Q10A 2D3GA 2KFJA 1KF6B 1FNUA 2WDVB 4Q2JA 3MC0B 4FLHA 3A1QA 2ZZPB 2LI5A 4N58A 1I4HA 3PTFC 4GDKB 2Y3AA 4ARIA 4HPLB 3U7DA 4KGTA 4XYCA 4REZA 1QILA 4LCDE 3H7PB 2G4DB 4AS1A 3VH3B 4WJQA 2N7EA 4RFBA 5CHWA 1M4VA 2J0MA 1UWXA 3UINB 2WXIA 3VXWA 1TS3A 4HPPA 3T3NA 3DWGC 1HTOA 2KHWB 2FCNA 1XLQA 3UF8A 2BYTA 5AZHA 2XBBC 3X0WA 3NZ3A 2E6XA 4B6WA 4BOZB 2L52A 4LNKA 4JL9A 3W1SC 2DWQA 1T0QC 4RF0A 3O65B 4GMVA 2LRUA 3BVMA 1L4DB 1IBXB 1V9JA 4M0WA 2RPVA 1YD8U 5JH5C 5GMVA 2JZPA 1WWTA 2KVZA 4JQWC 2QDFA 3VH4B 4NY0A 1XXGA 3TJPA 4W9EA 4ZDVA 3ZO5B 4YTMB 1WXMA 2LUMA 2NS5A 3R66C 3TUOA 5AEKB 1Y56A 1GC7A 4KZ0A 2FE8A 2GB1A 3GOEA 1L0YB 2V9HA 2JZ3B 2CS4A 4MH8A 1JWAD 4GSWA 2I2YA 2JF5A 4K7SA 3JSVB 5JHAA 1F9JA 1NYQA 1QOAA 4LDTB 3H8HA 1NI2A 4IDIA 2KQSA 4ZYSA 2GBNA 1GB4A 2RGFA 4XWTA 5D6JB 3PO0A 1D5MC 3AE7B 1WYWB 4P6VF 5FK9C 3W1SA 2YEPB 4RGTA 2BQQA 4ZRQA 4EFOA 4EZJA 1L6UA 1IGDA 1FD6A 4OZCA 1FFUA 1FNWA 2DAFA 3FKYA 1N62A 2KX0A 2KVRA 4G3XB 1DYQA 4GIVA 3OJ4B 3CSFA 2N9KA 5HKHA 2BKFA 2V4IB 1C78A 2INCC 2DZKA 5DPTA
chains in the Genus database with same CATH topology
1FM0D 4OVZA 2LHDA 2DYMA 3AM9A 4RCOA 3HVZA 3AEEB 1YMHE 5BYRA 1VZ8A 4IKGA 1C4AA 1PYWD 3EUB2 5EE9A 3NRZA 2CU3A 3SFDB 2JX5A 4NAMA 2IGDA 2DLBA 2TSSA 1JMLA 4KGRA 2LGIA 2M19A 3GB1A 2LHEA 3MJ5A 1HA5A 3UI3A 2PVOD 1HZ6A 2AQ3B 3AE6B 1RFKA 1VZ7A 2RMMA 2JSVX 3I9V1 1AWDA 3NS1A 4C80A 2IPKD 1C76A 1A70A 2N9LA 1ESFA 2JQRB 1MHHE 3TEWA 3Q8AA 2PMVA 2G9HD 1EM7A 1F77A 3BYYB 2WXOA 3AEFB 2VZKD 1JWBD 4ZRPA 4ZHOA 1E10A 1KLUD 4LTUA 1C4CA 1GB1A 3AEAB 2PLPA 3IAS1 5BMGA 3P4QB 1K52A 1QLBB 1QOGA 2ICIA 3CWIA 1TS4A 2FUG1 2WXQA 1FXIA 4C7YA 2QEJC 3VRAB 2XNAC 3P1MA 1TY0A 4H2AA 4NJCA 1IUEA 4EE2A 1PGBA 3AH7A 3AE5B 3SFEB 1JRPA 2EKIA 2QMTA 1TZOA 5BYSA 5HFYA 4WAFA 3HRDD 2QSDA 4N59A 1B9RA 1JWMD 2K0PA 1ZOYB 2PVGC 1UWMA 3KQ4A 3P4SB 1JROA 2MEKA 1GPXA 4AQ7A 3P63A 2WXMA 3IAM1 5AUKA 2HTME 2KACA 3IT4B 2BS3B 4OHJA 4A9AA 4WWMA 2V0GA 4ARCA 4RH6A 4US9A 1TJEA 1T3QA 4JE3B 5FKAC 2K9XA 4YSXB 1ZUD2 5EE1A 5MPOA 1VJKA 1QOBA 2JYTA 3HVDA 2W82A 3U2SC 1TS5A 2WDQB 2QILA 2WDRB 5JXVA 1FRDA 1I4QA 1N5XA 2JYEA 4MT5A 2R61A 3Q8BA 3AMZA 1GAQB 4UDUC 1YNTE 3R2TA 3CIRB 3TEXA 4D2KA 2BT6A 3BVZA 4XDDA 4B0EA 1CJEA 1K50A 2IGGA 4TSSA 5TSSA 1YJJA 2ON8A 1JWSD 3BIID 1ZP0B 1EWCA 1D5XC 1TKGA 3EA6A 3FC4A 1BMLC 3HUIA 3IT6B 1V1OA 2M56B 2W54A 1D6EC 3AECB 4YSYB 1TKEA 1PFDA 1UNSA 4FXCA 3AEGB 4OZBA 5D7GA 2K22A 2OEDA 1SJHD 4A55A 1MHXA 1B1ZA 3P4RB 1FMAD 1XF5L 3NVZA 4JWUC 1UGJA 1WSPA 4DXFA 1NYRA 1BUIC 4PT5A 1JALA 3ABVB 1ZXIA 3MP9A 3BK2A 2V3NA 1SE4A 1OQQA 3NVYA 3P42A 4JWSC 4OZAA 1YN3A 4US8A 4YT0B 2GI9A 2JWUA 2WNMA 2WXNA 1WXQA 2D5GA 4XDCA 1RM6C 3ZQ4A 3FILB 1RYJA 4YSZB 1N5WA 3MFGA 2LEKA 3O13A 2BBCA 1HEZE 2J53A 4MM3B 1MPEA 1VZ6A 4HKQA 1SB3C 2KWDA 1P7EA 4L23A 2WXPA 2G1EA 3SEBA 1GOZA 2W3RA 2Z8LA 3NVVA 2WXJA 1I4GA 2L32A 1SE2A 1OFFA 1E6EB 5H8YE 2AQ1B 3ZJUA 1V1PB 3BZDB 2Y5CA 3Q8CA 1LO5D 4TMAB 1CK1A 4A8XC 4IOIE 2KN4A 4L1BA 1KRHA 4R3DA 2LMCA 3OWEB 2MJEA 1XCTL 2BB5A 1MI0A 1SBBB 3FILA 2AX5A 1QT9A 4HROA 1I4XA 2WXFA 3B2FA 2MJDA 3R8BA 4YTNB 3TEZA 1ET6A 1HQRD 3T3OA 2VZKB 5LNK1 2WLBA 3BWUD 2WP9B 1N60A 3C8YA 3Q69A 4YWGG 3W5VB 2EELA 1C9FA 1SIJA 3J9CA 1QF6A 1N63A 3AN1A 2BB6A 1WYGA 1K53A 2KMMA 4KKIA 1V97A 1T5XD 2W3SA 3R2IA 4HEA1 5C3JB 3ETRA 1FNVA 1ZE3D 2PKOA 2XN9C 1VDVA 2H88B 2QJLA 4HRSA 5BMHA 3I57A 4WQMA 2IDYA 2Y5PA 4JX1C 2CJNA 3AV8A 1VLBA 1T6BX 1XLPA 3P4PB 2NMQA 2RDGA 1J7AA 1XO3A 2E3TA 4ITKA 4ZOHC 1JCKB 2KDMA 5G5HA 2LJIA 1SXTA 1F0ZA 5EE3A 5C2TB 3MHZA 3B2GA 5AUIA 1I7HA 4C56C 3U52E 3ZJTA 1GTHA 5H92C 1YQ3B 4LLGM 3V3XA 3B9JA 2W55A 1N61A 1WGKA 1WRIA 4RGOS 1SJED 4A90A 4GDLB 1DOYA 2IGHA 1QKZA 3KLSX 3VR8B 3LYYA 1CZPA 3SR6A 1P7FA 2NTTA 3BK1A 3TSSA 3U7ZA 1VR9A 1KLGD 4A6QA 1TY2A 1XLOA 3AEDB 2J52A 1L0VB 1K51A 1E7PB 1NVID 1D4BA 1H7WA 2SAKA 1NEKB 1ZXHA 2IJ0A 1ACCA 1CQVA 3RPFC 1IGCA 1F2RI 3NUHB 2WXKA 1TYGB 2WXHA 3BYTB 4KKJA 2DBYA 1NENB 1Q10A 1GTEA 1EWYC 2J4XA 1ZDVA 2X38A 3FAHA 1D5ZC 3GS2A 2SEBD 1KF6B 3GP7A 1FNUA 3AE1B 2DYOA 1AW7A 2WDVB 4Q2JA 3KWVA 3MC0B 2ZW0A 1J7CA 1FIQA 1H7XA 4N58A 1I4HA 1DGJA 4GLSC 2BW2A 1FRRA 2BS4B 1XEEA 4GDKB 2CJOA 2Y3AA 4ARIA 4YTPB 4WIPA 4KGTA 5T8IA 1YQ4B 1F2RC 3W9CB 1JWUD 1E0ZA 4REZA 1DOIA 4HKZE 1QILA 4USAA 1ZDXA 5G5GA 1ENFA 3BVGA 2PTLA 2ZW1A 3L4PA 5FR3A 4AS1A 2M0AA 2NTSA 3RFZB 2RDHA 2FBWB 1C77A 4YXDB 2PIAA 4RFBA 1C79A 1I4PA 1M4VA 3CF4A 5HHDG 1UWXA 1GT8A 4P16A 5BYQA 5I4DA 2WXIA 2WS3B 1FCLA 1TS3A 2INNE 1STEA 3E56A 1HXYD 2YEPF 1DOXA 3ZJVA 3T3NA 1QQRA 3DWGC 3E9SA 2J42A 2WQYB 3PZ7A 4KX6B 1XLQA 3EGRA 1PUTA 2BYTA 1C4PA 2WU2B 1SE3A 1SF0A 3KWLA 3AE3B 3U4EG 3PZ8A 4WH4A 3NVWA 1PGXA 3NZ3A 2E6XA 1V1PA 1TKYA 1PDXA 2L52A 1I4RA 5GXGB 1L5PA 1YJIA 1MVKA 2DWQA 4RF0A 3AE2B 1KTKA 1ROEA 2H89B 2JXTA 3BVMA 1J7BA 1L4DB 1IBXB 1RWSA 4M0WA 1E9MA 2RPVA 2PW9A 2JZPA 1WWTA 2AQ2B 1BXTA 2BS2B 2OHFA 4ZHPA 3VRBB 4TQ0A 1FFVA 2L83A 2ONQA 2HDEA 1XXGA 1EU4A 2B76B 3W2DA 4YTMB 2N7JA 2LUMA 3LB8C 5D3IB 5EE0A 2GRIA 2K3UA 3W5UB 2WU5B 3TUOA 2Q5WD 4N6EB 1R7SA 4HJGE 1Y56A 1ET9A 3ZYYX 1YN5A 2FE8A 2GB1A 1L0YB 4MH8A 1JWAD 1KFYB 1IBXA 2I2YA 1FXAA 4NAWB 3V05A 2MJ3A 2KQ4X 1V8CA 4RF1A 1TS2A 4TQ1A 4O1NA 1UUPA 2K5PA 1YN4A 2KAJA 2N0SB 4MACA 1NYQA 4XE0A 1QOAA 1OQRA 4XWWA 5HI1A 3DWMA 3H8HA 1SSNA 3AB5A 3TEYA 4IDIA 4JPSA 2WXRA 4DQOC 3LXFA 5E6JA 4ZYSA 2WXLA 2JU6X 3VQIA 3IXSA 4J3OD 1XLNA 4RGMA 3Q8FA 3WCQA 1GB4A 1NI3A 4XWTA 4DXGA 1L0XB 3Q8EA 1HZ5A 1SEBD 1D5MC 3PO0A 4RGNA 3AE7B 1FEHA 5BMIA 1PGAA 4P6VF 5FK9C 4OW0A 3ZGZA 3W1SA 2YEPB 3AE8B 2LFIA 3AE4B 4LK0M 4RGTA 1QOFA 2WXGA 3N9YC 4WURA 4ZRQA 2L1AA 1AN8A 1VRAB 2INPE 2BTEA 4RNAA 1ZPSA 1L6VA 1XCQL 1FCCC 1JW9D 1L6UA 1IGDA 2QIEB 1AYFA 4KGSA 1KH0A 5HG2A 1FD6A 1L4ZB 3VR9B 4OZCA 1FFUA 1FNWA 4C7ZA 2V3PA 3AEBB 1N62A 1FO4A 1DYQA 2I38A 4NZLB 2ACZB 5D3DA 3AE9B 3URYA 4B0MA 2N9KA 1EU3A 2V4IB 4L2YA 1C78A 2MH7A 4CQNA 1JQ4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZP0 B;  1FM0 D;  5EE3 A;  5C2T B;  1TKG A;  2DWQ A;  3B2G A;  3AM9 A;  1I7H A;  3FC4 A;  3HVZ A;  3AEE B;  3AE2 B;  1ROE A;  5AUI A;  2H89 B;  1GTH A;  5H92 C;  3HUI A;  2M56 B;  2W54 A;  1J7B A;  1YQ3 B;  3AEC B;  4YSY B;  1RWS A;  1PFD A;  1TKE A;  3EUB 2;  3AEG B;  1E9M A;  4FXC A;  3NRZ A;  2CU3 A;  5EE9 A;  2K22 A;  3B9J A;  2W55 A;  1N61 A;  3SFD B;  2JX5 A;  3P4R B;  1WGK A;  1WRI A;  1WWT A;  1FMA D;  3NVZ A;  4JWU C;  2BS2 B;  2OHF A;  4ZHP A;  1DOY A;  3VRB B;  1FFV A;  2L83 A;  1NYR A;  3VR8 B;  1JAL A;  3ABV B;  2M19 A;  1CZP A;  1ZXI A;  3SR6 A;  4JWS C;  2B76 B;  1OQQ A;  4YTM B;  2PVO D;  3NVY A;  3AE6 B;  1RFK A;  1XLO A;  3AED B;  4US8 A;  1L0V B;  4YT0 B;  1AWD A;  3LB8 C;  3NS1 A;  5EE0 A;  1WXQ A;  4C80 A;  3W5U B;  2WU5 B;  1A70 A;  1E7P B;  1NVI D;  1RM6 C;  2JQR B;  2Q5W D;  4N6E B;  1R7S A;  1RYJ A;  4YSZ B;  1N5W A;  3ZYY X;  1H7W A;  2LEK A;  3AEF B;  1JWA D;  1KFY B;  1NEK B;  1SB3 C;  1FXA A;  1JWB D;  4ZHO A;  1E10 A;  2G1E A;  4LTU A;  3RPF C;  3AEA B;  2MJ3 A;  3P4Q B;  2W3R A;  1V8C A;  3NVV A;  1TYG B;  1QLB B;  1QOG A;  3CWI A;  2DBY A;  1NEN B;  1GTE A;  1E6E B;  1OFF A;  2K5P A;  1EWY C;  5H8Y E;  2KAJ A;  1FXI A;  4C7Y A;  3VRA B;  3P1M A;  3FAH A;  1IUE A;  2N0S B;  2Y5C A;  3AH7 A;  3AE5 B;  1KF6 B;  3SFE B;  1NYQ A;  1QOA A;  3AE1 B;  1JRP A;  1OQR A;  2EKI A;  1KRH A;  3DWM A;  2WDV B;  2MJE A;  3AB5 A;  3HRD D;  2AX5 A;  1J7C A;  1FIQ A;  4IDI A;  4N59 A;  1H7X A;  1QT9 A;  1B9R A;  3LXF A;  4N58 A;  4HRO A;  1DGJ A;  1ZOY B;  2PVG C;  1UWM A;  1GPX A;  3P4S B;  1FRR A;  2BS4 B;  1JRO A;  1XLN A;  2MJD A;  3B2F A;  2CJO A;  3WCQ A;  4YTP B;  4YTN B;  3P63 A;  1NI3 A;  5AUK A;  3W9C B;  1YQ4 B;  2HTM E;  1E0Z A;  3PO0 A;  2BS3 B;  4A9A A;  4WWM A;  1DOI A;  3AE7 B;  2WLB A;  2WP9 B;  1N60 A;  4P6V F;  4USA A;  3W5V B;  5G5G A;  4US9 A;  3AE8 B;  1TJE A;  3AE4 B;  1SIJ A;  3L4P A;  1T3Q A;  2K9X A;  1QF6 A;  4YSX B;  1N63 A;  1ZUD 2;  1QOF A;  3AN1 A;  5EE1 A;  2FBW B;  1WYG A;  5MPO A;  4YXD B;  2KMM A;  1VJK A;  1QOB A;  1V97 A;  2PIA A;  3CF4 A;  1F0Z A;  1GT8 A;  2W3S A;  1L6V A;  2WDQ B;  2WS3 B;  2WDR B;  5C3J B;  1JW9 D;  1FRD A;  1L6U A;  2QIE B;  1N5X A;  2PKO A;  1AYF A;  3ETR A;  1VDV A;  2H88 B;  2QJL A;  3AMZ A;  4HRS A;  1GAQ B;  4WQM A;  3VR9 B;  1DOX A;  1FFU A;  4JX1 C;  4C7Z A;  3DWG C;  3AEB B;  3CIR B;  2WQY B;  1N62 A;  4KX6 B;  1FO4 A;  1XLQ A;  2CJN A;  1PUT A;  1VLB A;  3AV8 A;  2ACZ B;  2BT6 A;  3AE9 B;  1XLP A;  3P4P B;  2WU2 B;  1J7A A;  1SF0 A;  3KWL A;  3AE3 B;  1XO3 A;  1CJE A;  2E3T A;  4ITK A;  3NVW A;  4ZOH C;  1TKY A;  1PDX A;  5G5H A;  1YJJ A;  2L52 A;  2MH7 A;  3BII D;  5GXG B;  1L5P A;  1YJI A;  1JQ4 A; 
#chains in the Genus database with same CATH topology
 1FM0 D;  2DYM A;  3AM9 A;  3PLU A;  1YMH E;  2D3A A;  2CHX A;  3Q2A C;  1VD2 A;  2MX2 A;  2K8C A;  2BGF A;  5D2M B;  1TTN A;  4WWP A;  3DBH B;  2MA9 B;  2LGI A;  3QK0 A;  3H7P A;  1HA5 A;  2RMM A;  1WJU A;  2MQJ A;  4HDO A;  1V5O A;  1C76 A;  2N9L A;  1MHH E;  2PMV A;  4DDG D;  3BYY B;  3NZS A;  4PYU A;  3N1Y C;  1I42 A;  1JWB D;  4ZHO A;  1C4C A;  2NBW B;  1K52 A;  3PRE A;  5IOI A;  1R4M B;  4C7Y A;  2XNA C;  3VRA B;  1TY0 A;  4AOF A;  1KLV A;  2DYB A;  1JRP A;  4EOY A;  2QMT A;  1TZO A;  4EKU A;  4WAF A;  2KDF B;  2HD5 B;  3HRD D;  1B9R A;  2PVG C;  2A4Z A;  5C1Z A;  3APF A;  2IO1 B;  1WMH A;  3PRZ A;  3RUI B;  2HTM E;  1H4R A;  4A9A A;  4WWM A;  4KSK C;  3WAP A;  1E8Y A;  4DBG A;  3H1U A;  4F7Z A;  1OEY J;  5MPO A;  2BYE A;  2DNF A;  3U2S C;  1V2Y A;  1WM2 A;  1N5X A;  2JYE A;  4MT5 A;  1MG8 A;  3Q3J A;  4KDI C;  3CIR B;  4BBN F;  2KJ6 A;  1K50 A;  4TSS A;  2ON8 A;  1EWC A;  1TKG A;  4NJ6 A;  2CR5 A;  3EA6 A;  3FC4 A;  3IT6 B;  2OOB B;  3AEC B;  4YSY B;  5D7G A;  4JWU C;  3BIN A;  1LGR A;  3ABV B;  3RNB C;  1ZXI A;  3MP9 A;  4AJY B;  3I63 C;  3BK2 A;  4HDQ A;  4A3O A;  5LXH A;  4US8 A;  2D5G A;  1RM6 C;  4JLC A;  2A5U A;  3VUX A;  4NJ7 A;  1N5W A;  2LEK A;  3O13 A;  2RDB C;  2BBC A;  4MM3 B;  1MPE A;  1R4N B;  1SB3 C;  4C4V B;  2KWD A;  1P3Q U;  2ZNV B;  2N1V A;  1CMX B;  2BYV E;  2M1M A;  3NVV A;  2MP2 B;  3RN9 C;  2WXJ A;  1N6Z A;  2L32 A;  1RRB A;  2NR2 A;  1SE2 A;  2UWQ A;  5H8Y E;  1RLF A;  3VDZ A;  4MJS B;  1KRH A;  4R3D A;  2LMC A;  3OWE B;  1ZW7 A;  3WIM A;  1XCT L;  3FIL A;  4E74 A;  4PYZ A;  4FHK A;  2KC1 A;  5L83 A;  1V86 A;  3ZRC A;  3TEZ A;  3WAN A;  1ET6 A;  2ZEQ A;  1AAR A;  4II3 B;  1N60 A;  3AUL A;  3C8Y A;  3Q69 A;  4M8M A;  4YWG G;  3GE8 C;  2GLS A;  4LNN A;  3Q14 C;  2BB6 A;  1WYG A;  2BWF A;  2JRI B;  4IC7 B;  1TBE A;  3ETR A;  2PKO A;  1VDV A;  1GNU A;  3I57 A;  4KIK B;  1E8W A;  2C7M B;  2LJ5 A;  1WXV A;  3UQA A;  2M8S A;  3RZF A;  2HTH A;  2O2V B;  1T6B X;  1XLP A;  2JT4 B;  2IO0 B;  4NQL B;  4ITK A;  4DWF A;  2KDM A;  2LJI A;  1F0Z A;  5EE3 A;  2MW5 A;  1E7V A;  2Z0E B;  5AUI A;  2N9E B;  4DHJ B;  3KUZ A;  1YQ3 B;  4AJW A;  1WRI A;  4GDL B;  3LYY A;  1CZP A;  3TSS A;  3U7Z A;  3UQB A;  1VR9 A;  1KLG D;  1XLO A;  2N9P C;  3AED B;  1L0V B;  3L10 B;  4PK1 A;  3A1Q B;  3ONS A;  3K9P B;  4G50 A;  4ICV A;  2IJ0 A;  1HE8 A;  3ZDM C;  2KTF A;  3NHE B;  2WWZ A;  3D32 A;  1LFD A;  3TL5 A;  2DBY A;  3NOB A;  1GTE A;  2J4X A;  1ZDV A;  3FAH A;  1D5Z C;  4XZ4 A;  3GP7 A;  4WJO A;  2DYO A;  1AW7 A;  1TGZ B;  5IA7 A;  3KWV A;  4HJK A;  3DHI C;  3EFU A;  4K1R B;  4ANU A;  1WR6 E;  4A3P A;  2CJO A;  1GUA B;  3RNF C;  2Z0D B;  4P1C C;  3W9C B;  4MGI E;  2YVC A;  2DAJ A;  4HKZ E;  4DDI D;  1ZDX A;  4M01 A;  2ZW1 A;  2M0A A;  2NTS A;  2RDH A;  3IFW B;  1C77 A;  1I4P A;  1Z2M A;  5HHD G;  4MSQ B;  4P16 A;  5I4D A;  4WAA A;  1FCL A;  2VH1 A;  2JRH A;  1QQR A;  1UD7 A;  4C4V A;  3AU5 A;  4MGZ E;  1PUT A;  1C4P A;  3NZU A;  2WU2 B;  4OVV A;  2RSU A;  1EO6 A;  3AE3 B;  3PZ8 A;  2OJR A;  5E6N A;  1TIF A;  3VHT C;  1YJI A;  1MVK A;  3QJZ A;  1ROE A;  2JXT A;  2LVQ A;  2AQ2 B;  2OHF A;  5J2R A;  3M3J A;  3VRB B;  2L83 A;  2N7D A;  2ONQ A;  1J8C A;  2FCQ A;  4KVG B;  3W2D A;  2N7J A;  3Q3M C;  4ZRI A;  5D3I B;  2WU5 B;  2IY0 B;  2Q5W D;  2KTR A;  4IWQ A;  3IHP C;  1YN5 A;  4M8N A;  2RD0 A;  2HJ8 A;  1KFY B;  3DBR B;  4KIK A;  2KQ4 X;  1SE9 A;  1S3S G;  3BY4 B;  4TV3 A;  1TS2 A;  3VTU A;  1YN4 A;  2KAJ A;  2N0S B;  3DBL I;  3QCA A;  1RFA A;  4LNF A;  4XWW A;  5HI1 A;  4DHZ E;  1WGY A;  4JPS A;  2KYW A;  3IXS A;  2PEA A;  4J3O D;  4F8C B;  2L8J A;  3DQV A;  3WCQ A;  3DBS A;  4NNJ B;  1NI3 A;  4DXG A;  1L0X B;  1HZ5 A;  1SEB D;  1FEH A;  2X8X X;  3NG0 A;  2RPQ A;  2LFI A;  4W9H A;  4QAY A;  2MSE D;  3APC A;  3VTV A;  2FNJ B;  4GN1 A;  1QOF A;  2WXG A;  3H9D A;  4PS7 A;  3N9Y C;  4WUR A;  4W9C A;  2JUO A;  2WYQ A;  2BTE A;  2ZVN A;  1L6V A;  1ZPS A;  4W9G A;  4W9L A;  3TBL D;  1KH0 A;  5HG2 A;  4FUL A;  1L4Z B;  3GZN I;  2MRP A;  2V3P A;  2EKE C;  1FO4 A;  3OG5 A;  2ACZ B;  4LJP B;  3NY5 A;  5D3D A;  2KWV B;  2NPT B;  3I5J C;  4EUT A;  4FN2 A;  2MH7 A;  2MLB A;  2AL3 A;  4CQN A;  1JQ4 A;  3T8M A;  1WM3 A;  3CMM B;  4HXD A;  2GBR A;  3HVZ A;  2V1Y A;  1VZ8 A;  3QHT A;  3RI7 C;  4BVU C;  4YL8 A;  2L0T A;  3SD5 A;  3SFD B;  2JX5 A;  2L0F A;  3ML9 A;  3DBL B;  3B0A A;  2TSS A;  1JML A;  2M0X A;  4X57 B;  2CHW A;  2KDB A;  3MJ5 A;  1YQB A;  2AQ3 B;  3AE6 B;  4P1B C;  2J0J A;  3I9V 1;  4WQO B;  3Q8A A;  3NJT A;  3ZNI D;  3AEF B;  3DVG X;  1WMH B;  4ZRP A;  3AEA B;  3IAS 1;  5BMG A;  1UGM A;  4W9J A;  1QLB B;  3NS8 A;  4AP4 C;  2D10 A;  3PHX B;  1TS4 A;  3P1M A;  3WAL A;  4EE2 A;  3AH7 A;  3LJ3 A;  3GZN B;  5CX3 A;  4IM0 A;  1HTQ A;  2MBQ A;  1XT9 B;  3ZRF A;  1ZOY B;  1GPX A;  2CHZ A;  4AQ7 A;  2GBK A;  3RNE C;  2WXM A;  2JWZ A;  2KAC A;  2BS3 B;  4OHJ A;  4NPN A;  4RH6 A;  3RYT A;  2KQ7 A;  4US9 A;  3L54 A;  5FKA C;  2V4L A;  3DBH I;  1VJK A;  1QOB A;  2JYT A;  2EMT A;  2KX3 A;  5LLI A;  1Z5S B;  3B1L X;  1TS5 A;  2WDQ B;  2QIL A;  5JXV A;  1L2N A;  2R61 A;  3AMZ A;  3ZW3 A;  1P1A A;  2BT6 A;  3M95 A;  4XDD A;  4B0E A;  3H6N A;  2IGG A;  1Q0W B;  2ASQ A;  2UU7 A;  4G0N B;  5TSS A;  3BII D;  3M63 B;  3QIJ A;  1D5X C;  1R4M I;  1NBF C;  3RD2 A;  1D6E C;  3IVF A;  1EUV B;  1UNS A;  3SHQ A;  4P7I A;  3RUL A;  1MHX A;  3DPD A;  4ZYN A;  3NVZ A;  2L00 B;  4DXF A;  4PT5 A;  2O6V B;  1ZKH A;  1WF9 A;  2V3N A;  4OZA A;  2KFK A;  2JWU A;  5IN7 A;  2WNM A;  2L05 A;  2WXN A;  3FIL B;  2RR9 A;  1VZ6 A;  1WH3 A;  2N9X A;  2G1E A;  3N1Z C;  2JY6 A;  1OEY A;  1V1P B;  1WJ4 A;  2I1K A;  3BZD B;  2Y5C A;  1LO5 D;  4A8X C;  4IOI E;  2QC8 A;  2NPT A;  2MJE A;  1EF1 A;  4HK2 A;  1SBB B;  2KO3 A;  1G6J A;  2WXF A;  4PS8 A;  3RZW C;  2MJD A;  3R8B A;  4YTN B;  5E6O A;  2C60 A;  1UBQ A;  3DDC B;  2WLB A;  4J6I A;  2EEL A;  1QF6 A;  3RNA C;  2B3A A;  2GBJ A;  1K53 A;  2GMI C;  1XQQ A;  2W3S A;  3SU8 X;  2XN9 C;  2QJL A;  2H88 B;  5BMH A;  3PS6 A;  3KYD D;  3A9J B;  2C7N B;  1VLB A;  2R2Q A;  2RDG A;  1V80 A;  1R4N I;  1WGR A;  5JZE B;  1JCK B;  5G5H A;  2LAS A;  4DHJ D;  1SXT A;  5KHQ A;  1SIF A;  3MC8 A;  3I3T B;  3MHZ A;  4C56 C;  2KWC A;  3U52 E;  3ZJT A;  4LLG M;  3V3X A;  3ZDT A;  2W55 A;  1N61 A;  4G11 A;  2CU1 A;  1SJE D;  3V60 A;  1QKZ A;  3KLS X;  3VR8 B;  2FUH B;  2KMA A;  4BKT A;  3SR6 A;  1P7F A;  1U4A A;  2NTT A;  2J52 A;  1S1Q B;  4JGH B;  3LDZ E;  1H7W A;  2IBI B;  2KK8 A;  5CTR C;  2KLG A;  3A9K A;  2LVO A;  3PZD A;  4MGY E;  1CQV A;  3DVN U;  4ANX A;  4BZA A;  2KMC A;  2WXH A;  3HIZ A;  2QCZ A;  4K3C A;  1EWY C;  1GC6 A;  4MEM A;  3AE1 B;  3JYU A;  1FRR A;  4MDK E;  2N1W A;  1XEE A;  4YTP B;  2K6Q A;  5T8I A;  1YQ4 B;  1F2R C;  2QHO A;  1DOI A;  5G5G A;  1ENF A;  2O6V A;  2G4S A;  3RFZ B;  5IP4 D;  2BKR B;  3ZUN A;  1C79 A;  2KLC A;  3CF4 A;  5BYQ A;  3VFK A;  2HJ1 A;  1K8R B;  2WS3 B;  5AZF A;  3V6C B;  1HXY D;  4JIO U;  2YEP F;  4LNI A;  3N1X C;  1EF5 A;  3PZ7 A;  3VTW A;  4KX6 B;  3RCZ A;  3EGR A;  2D2Q A;  3PVL A;  2PPH A;  2ZCC A;  4K81 A;  3U4E G;  3ZNZ B;  4WH4 A;  3NVW A;  1PGX A;  1V1P A;  1TKY A;  3PSE B;  1I4R A;  4KZC A;  1L5P A;  2KTR B;  5DCN A;  5GXG B;  4FA6 A;  1MJD A;  4WJP A;  3AE2 B;  1KTK A;  2H89 B;  1RWS A;  2PW9 A;  4I6N B;  1YX5 B;  1BXT A;  2IO2 B;  2BS2 B;  4ZHP A;  4TQ0 A;  1FFV A;  1ISN A;  5E6P A;  2HDE A;  3OAW A;  1T0Y A;  1EU4 A;  2WDT B;  2B76 B;  3ZNH B;  3K9O B;  3UGB B;  2GRI A;  2K3U A;  3R7R A;  4N6E B;  1R7S A;  1ET9 A;  2KOX A;  2MBH A;  1IPG A;  3ZYY X;  5EDS A;  3DHH C;  3VUW A;  4ZRJ A;  1D3Z A;  2K39 A;  2MJ3 A;  4FHJ A;  4RF1 A;  3WAM A;  3A9J A;  2K5P A;  5J18 A;  5IAA C;  4MAC A;  4XC2 A;  3PHW B;  3DWM A;  1SSN A;  2GBM A;  3R3M A;  2WXR A;  4DQO C;  2WXL A;  2JU6 X;  3VQI A;  1TT5 B;  3UIO B;  2LXA A;  3B08 A;  1XLN A;  2DEN B;  2KJR A;  5G55 A;  1JRU A;  3PT2 B;  4NAW A;  1ZGU B;  2FIF A;  4RGN A;  5BMI A;  2KWU B;  4OW0 A;  1YIW A;  3N3K B;  1F52 A;  2L1A A;  1T0R C;  2INP E;  3ALB A;  4S17 A;  3HHM A;  2MBB B;  1JW9 D;  2QIE B;  1OGW A;  4C7Z A;  3AEB B;  2LUE A;  4NZL B;  3DBR I;  4B0M A;  3APD A;  4L2Y A;  3EC8 A;  4ICU A;  2KC2 A;  1E8Z A;  4HWI B;  4IKG A;  2D11 A;  3DHG C;  3NRZ A;  3ZTC A;  4NAM A;  5LXI B;  2DLB A;  4KGR A;  1XD3 B;  3V61 A;  1X1M A;  4IM3 A;  2PVO D;  1HZ6 A;  2JSV X;  3ML8 A;  3NS1 A;  3TMP B;  2IPK D;  3EHV A;  4IWP A;  1ESF A;  2JQR B;  3TEW A;  1KM7 A;  4HCP B;  4MSM B;  2VZK D;  4MH0 E;  3DVN V;  3Q3N C;  1YX6 B;  1KLU D;  4LTU A;  3L0W B;  3A4R A;  3ZLZ A;  1QOG A;  3AU4 A;  3CWI A;  2IND C;  3EFC A;  3A33 B;  2FUG 1;  1FXI A;  2QEJ C;  4MEL A;  4NJC A;  1UEL A;  1PGB A;  3AE5 B;  2EKI A;  1TZ1 A;  4HVB A;  2PE6 B;  3QA8 A;  2QSD A;  4N59 A;  2IO3 B;  4TUU A;  1Q1O A;  3KQ4 A;  2C9W B;  3P63 A;  3IT4 B;  1P0R A;  4FJZ A;  2V0G A;  3QX1 A;  1E7U A;  4LNO A;  2REX A;  1T3Q A;  3P2B A;  1ZUD 2;  3Q6B A;  5EE1 A;  1WX8 A;  2W82 A;  1FRD A;  2LVP A;  1I4Q A;  2NVU I;  5IO9 A;  1GAQ B;  1E90 A;  2VH2 A;  4RMA A;  1C3T A;  2LRW A;  1V5T A;  3GE3 C;  1YNT E;  3R2T A;  5DPW A;  3TEX A;  4D2K A;  4LJO B;  4S0R A;  3U30 A;  2C5L C;  4HLE A;  2IYD B;  2KFK B;  1CJE A;  4XGA B;  1JWS D;  3QC8 B;  4WWO A;  1ZP0 B;  3MHS D;  1WI0 A;  1J0G A;  1BML C;  3HUI A;  1V1O A;  2W54 A;  1KOT A;  1PFD A;  3AEG B;  2K22 A;  3N32 A;  1SJH D;  2O6V D;  1P9D U;  1FMA D;  5L95 C;  1WSP A;  1NYR A;  1UZX B;  1BUI C;  4N9F 4;  3N20 C;  3V6E B;  2C7H A;  1SE4 A;  1OQQ A;  3NVY A;  3P42 A;  3EEC A;  1PQS A;  4XDC A;  3ZQ4 A;  4BKS A;  1RYJ A;  2J53 A;  1A5R A;  2JXX A;  1FXT B;  4HKQ A;  2WX0 A;  1P7E A;  4L23 A;  2AL6 A;  2WXP A;  3SEB A;  1WJN A;  2Z8L A;  2ZPN A;  1I4G A;  1KJT A;  4GGQ A;  1OFF A;  1E6E B;  2AQ1 B;  3Q8C A;  4TMA B;  4L1B A;  1SGH A;  4TKN A;  3PPA A;  1I4X A;  4E3C A;  4A20 A;  2VZK B;  5LNK 1;  2W9N A;  2DZJ A;  3BWU D;  3W5V B;  3C0R B;  1N63 A;  3AN1 A;  2KMM A;  1V97 A;  1T5X D;  2AYO B;  1WRD B;  4HEA 1;  5C3J B;  2IDY A;  4W9D A;  3TCA A;  2KT7 A;  3P4P B;  1J7A A;  2KD0 A;  3QWZ B;  4M02 A;  2E3T A;  4ZOH C;  1WXA A;  1WIA A;  4GU2 A;  3HK0 A;  1YJ1 A;  2NBU A;  1I7H A;  2FAZ A;  3A9K B;  1GTH A;  5H92 C;  1V6E A;  3B9J A;  1WGK A;  1V81 A;  4RGO S;  3KW5 B;  2WX1 A;  1DOY A;  2IGH A;  3VUY A;  2DX5 B;  4URK A;  3A4S C;  3BK1 A;  3MTN B;  1F1H A;  4M00 A;  4A6Q A;  1H8C A;  1E7P B;  1NVI D;  3MJW A;  2K1F A;  2KNB A;  1WZ0 A;  2ZPY A;  1NEK B;  4KDL B;  1ACC A;  3ZXV A;  3RPF C;  2L7R A;  3QAQ A;  3S2A A;  1F2R I;  1TYG B;  3Q3F A;  1NEN B;  3KYC D;  2X38 A;  3GS2 A;  2SEB D;  1L7Y A;  3RMK C;  3QQ8 B;  2ZW0 A;  1J7C A;  1FIQ A;  1WXS A;  1H7X A;  1DGJ A;  4GLS C;  1WX9 A;  2BW2 A;  2BS4 B;  4AUQ C;  4BBN C;  2D3B A;  4WIP A;  2L76 A;  4EEW A;  1E0Z A;  1JWU D;  5BO4 B;  4USA A;  1NDD A;  3BVG A;  2PTL A;  4HCN B;  3L4P A;  5FR3 A;  4OVU A;  2FBW B;  4YXD B;  1WFY A;  2PIA A;  1OQY A;  1GT8 A;  3UIP B;  2EMS A;  2KZR A;  4FBJ B;  1E5W A;  2LGD A;  2INN E;  1Q5W B;  4EZK A;  4DHZ B;  4BAX A;  1FPY A;  1STE A;  3E56 A;  1DOX A;  3ZJV A;  4GDK A;  4E71 A;  3E9S A;  2J42 A;  3OJ3 A;  2WQY B;  3DCG A;  2BF8 B;  3PRP B;  2L3Z A;  1SE3 A;  5AZG A;  3KWL A;  1SF0 A;  2HE7 A;  1M94 A;  2R2O A;  3ZIM A;  1PDX A;  2DHZ A;  4BKG A;  1LQB A;  2JZZ A;  2LZ6 A;  4CO7 A;  3KUC B;  3KUD B;  1J7B A;  1QZE A;  1E9M A;  2G3Q B;  2KXJ A;  2AEH A;  2NCN A;  4I6L B;  2JPH A;  2M17 A;  3LB8 C;  2Y5B B;  5EE0 A;  4IUM B;  2IZV B;  2KJH B;  3W5U B;  4HJG E;  2OJW A;  3RT3 B;  2N4F A;  1IBX A;  3PGE A;  1FXA A;  4NAW B;  4IG7 B;  3HM3 A;  3V05 A;  4FJY A;  1V8C A;  2LGS A;  4TQ1 A;  4O1N A;  1UUP A;  5J17 A;  1LXD A;  3VVW B;  2MBO A;  3W1Y A;  4XE0 A;  1OQR A;  2BVC A;  3QAR A;  3AB5 A;  3TEY A;  3LXF A;  5E6J A;  4PS3 A;  5CHF A;  4RGM A;  3Q8F A;  3WAO A;  4EZL A;  1GG3 A;  2WGS A;  3AI5 A;  3Q8E A;  3JW0 X;  1IP9 A;  4B9K A;  1PGA A;  3ZGZ A;  2UYZ B;  3AE8 B;  4BKS D;  3AE4 B;  3JSV A;  4LK0 M;  3ENE A;  2KDI A;  2MCN B;  3ZTD A;  3PV1 A;  2AWT A;  4KSL C;  1AN8 A;  1VRA B;  2K25 A;  1MFW A;  3WA0 A;  4RNA A;  4B95 A;  1FCC C;  1XCQ L;  2J7Q B;  1AYF A;  4KGS A;  4WJN A;  2CKH B;  3VR9 B;  5JHB A;  3DOW A;  4MGK E;  4IM2 A;  1WGH A;  2I38 A;  3AE9 B;  3URY A;  2Z59 B;  4ANV A;  1EU3 A;  4HPM B;  1WZ3 A;  4FJV B;  1IYF A;  4AWJ A;  2DZI A;  4OVZ A;  2K8H A;  2LHD A;  4RCO A;  3AEE B;  5BYR A;  4II2 B;  1C4A A;  1PYW D;  3EUB 2;  5EE9 A;  2CU3 A;  1T0S C;  2IGD A;  3JVZ X;  3HM6 X;  3IBE A;  2DZM A;  4ANW A;  2ZJD A;  2M19 A;  3GB1 A;  2LHE A;  2LXC A;  5C23 A;  2V3S A;  3UI3 A;  1RFK A;  1VZ7 A;  1AWD A;  4C80 A;  2MHJ A;  3TIX A;  1A70 A;  3RNG C;  3L17 A;  2G9H D;  2XEW A;  1EM7 A;  1F77 A;  2D07 B;  1WX7 A;  2J0K A;  2WXO A;  3CF6 E;  1LM8 B;  1E10 A;  4BFR A;  1I35 A;  1GB1 A;  2PLP A;  2MWS B;  5DPR A;  3P4Q B;  4W9K A;  4CYE A;  2BYF A;  2ICI A;  2XK5 B;  2WXQ A;  4BOS C;  2FID A;  4H2A A;  1IUE A;  1WJ6 A;  3SFE B;  5BYS A;  5HFY A;  3KVF B;  1P98 A;  4NQK E;  1JWM D;  2K0P A;  3DVG Y;  1UWM A;  3L08 A;  3P4S B;  1JRO A;  2MEK A;  3IAM 1;  5AUK A;  3ZNG C;  1Y8R C;  4ARC A;  4W9I A;  1TJE A;  4ZRK A;  1C1Y B;  4JE3 B;  2K9X A;  5G2N A;  4YSX B;  3HVD A;  3Q3O C;  4GB9 A;  3ZKJ C;  3RNC C;  2WDR B;  3U8Z A;  3Q8B A;  3IG3 A;  2PJH A;  2PE9 A;  4UDU C;  4XX5 A;  1V49 A;  4K7U A;  2G45 B;  1VCB A;  1WGD A;  1OTR B;  2K6D B;  4ACF A;  3BVZ A;  2ZNV C;  1E8X A;  1YJJ A;  2GOW A;  3ECI A;  3SDL C;  4IW0 A;  2NBV B;  2M56 B;  1WY8 A;  1TKE A;  4FXC A;  4OZB A;  2OED A;  4A55 A;  1B1Z A;  3P4R B;  2BPS A;  3C19 A;  3T9L A;  1XF5 L;  3N30 A;  3PRM B;  1UGJ A;  2M4N A;  4KV2 A;  4IWO A;  1JAL A;  2FCM A;  4JWS C;  3ZXR A;  1YN3 A;  4YT0 B;  2GI9 A;  4FAD A;  1MG4 A;  1WXQ A;  5FR6 A;  2KDE B;  4YSZ B;  3MFG A;  3M62 B;  1HEZ E;  1J19 A;  5CHV C;  4I6P A;  4DK5 A;  3X23 A;  2FCS A;  1GOZ A;  2W3R A;  1UH6 A;  2I1J A;  1RAX A;  3ZJU A;  2JVC A;  2KAN A;  3KH0 A;  1CK1 A;  5IKC M;  2KN4 A;  4C00 A;  2BB5 A;  1MI0 A;  1UF0 A;  2D3C A;  4CHK A;  2AX5 A;  4M0W B;  1QT9 A;  4K3B A;  4HRO A;  1YOV B;  4MM3 A;  3B2F A;  2BWE S;  4GXB A;  2LGY A;  3R7Q A;  1HQR D;  3T3O A;  3CST A;  4K7W A;  2WP9 B;  2MP2 A;  4RM9 A;  1C9F A;  1SIJ A;  3J9C A;  2LWP A;  3L13 A;  2LD9 A;  4KKI A;  5KHO A;  4MJS A;  4ASW C;  3R2I A;  1FNV A;  1WE6 A;  1ZE3 D;  2ZVO A;  3AXC A;  4HRS A;  4WQM A;  2Y5P A;  4JX1 C;  2ZCB A;  2CJN A;  3AV8 A;  2KKC A;  2NMQ A;  2XK5 A;  1XO3 A;  4WWN A;  2YLM A;  2WHI A;  2MBE A;  5C2T B;  3OLM D;  3B2G A;  5D94 A;  3V62 A;  3VAW A;  3PLV A;  1WE7 A;  2LGX A;  5TR5 A;  2VRR B;  4A90 A;  2KN5 A;  5DPS A;  2O2V A;  3ZVV A;  4LDT D;  1WGG A;  1TY2 A;  1GJZ A;  4W9F A;  4GOC A;  2K8B A;  3H7S A;  1K51 A;  1BT0 A;  1D4B A;  3L16 A;  2SAK A;  1ZXH A;  1UBI A;  1IGC A;  3MC9 A;  3NUH B;  4DXA B;  4RM8 A;  2WXK A;  1WR1 A;  3BYT B;  4GDL A;  2IY1 B;  4KKJ A;  4F1S A;  1Q10 A;  2D3G A;  2KFJ A;  1KF6 B;  1FNU A;  2WDV B;  4Q2J A;  3MC0 B;  4FLH A;  3A1Q A;  2ZZP B;  2LI5 A;  4N58 A;  1I4H A;  3PTF C;  4GDK B;  2Y3A A;  4ARI A;  4HPL B;  3U7D A;  4KGT A;  4XYC A;  4REZ A;  1QIL A;  4LCD E;  3H7P B;  2G4D B;  4AS1 A;  3VH3 B;  4WJQ A;  2N7E A;  4RFB A;  5CHW A;  1M4V A;  2J0M A;  1UWX A;  3UIN B;  2WXI A;  3VXW A;  1TS3 A;  4HPP A;  3T3N A;  3DWG C;  1HTO A;  2KHW B;  2FCN A;  1XLQ A;  3UF8 A;  2BYT A;  5AZH A;  2XBB C;  3X0W A;  3NZ3 A;  2E6X A;  4B6W A;  4BOZ B;  2L52 A;  4LNK A;  4JL9 A;  3W1S C;  2DWQ A;  1T0Q C;  4RF0 A;  3O65 B;  4GMV A;  2LRU A;  3BVM A;  1L4D B;  1IBX B;  1V9J A;  4M0W A;  2RPV A;  1YD8 U;  5JH5 C;  5GMV A;  2JZP A;  1WWT A;  2KVZ A;  4JQW C;  2QDF A;  3VH4 B;  4NY0 A;  1XXG A;  3TJP A;  4W9E A;  4ZDV A;  3ZO5 B;  4YTM B;  1WXM A;  2LUM A;  2NS5 A;  3R66 C;  3TUO A;  5AEK B;  1Y56 A;  1GC7 A;  4KZ0 A;  2FE8 A;  2GB1 A;  3GOE A;  1L0Y B;  2V9H A;  2JZ3 B;  2CS4 A;  4MH8 A;  1JWA D;  4GSW A;  2I2Y A;  2JF5 A;  4K7S A;  3JSV B;  5JHA A;  1F9J A;  1NYQ A;  1QOA A;  4LDT B;  3H8H A;  1NI2 A;  4IDI A;  2KQS A;  4ZYS A;  2GBN A;  1GB4 A;  2RGF A;  4XWT A;  5D6J B;  3PO0 A;  1D5M C;  3AE7 B;  1WYW B;  4P6V F;  5FK9 C;  3W1S A;  2YEP B;  4RGT A;  2BQQ A;  4ZRQ A;  4EFO A;  4EZJ A;  1L6U A;  1IGD A;  1FD6 A;  4OZC A;  1FFU A;  1FNW A;  2DAF A;  3FKY A;  1N62 A;  2KX0 A;  2KVR A;  4G3X B;  1DYQ A;  4GIV A;  3OJ4 B;  3CSF A;  2N9K A;  5HKH A;  2BKF A;  2V4I B;  1C78 A;  2INC C;  2DZK A;  5DPT A; 
#chains in the Genus database with same CATH homology
 1FM0 D;  4OVZ A;  2LHD A;  2DYM A;  3AM9 A;  4RCO A;  3HVZ A;  3AEE B;  1YMH E;  5BYR A;  1VZ8 A;  4IKG A;  1C4A A;  1PYW D;  3EUB 2;  5EE9 A;  3NRZ A;  2CU3 A;  3SFD B;  2JX5 A;  4NAM A;  2IGD A;  2DLB A;  2TSS A;  1JML A;  4KGR A;  2LGI A;  2M19 A;  3GB1 A;  2LHE A;  3MJ5 A;  1HA5 A;  3UI3 A;  2PVO D;  1HZ6 A;  2AQ3 B;  3AE6 B;  1RFK A;  1VZ7 A;  2RMM A;  2JSV X;  3I9V 1;  1AWD A;  3NS1 A;  4C80 A;  2IPK D;  1C76 A;  1A70 A;  2N9L A;  1ESF A;  2JQR B;  1MHH E;  3TEW A;  3Q8A A;  2PMV A;  2G9H D;  1EM7 A;  1F77 A;  3BYY B;  2WXO A;  3AEF B;  2VZK D;  1JWB D;  4ZRP A;  4ZHO A;  1E10 A;  1KLU D;  4LTU A;  1C4C A;  1GB1 A;  3AEA B;  2PLP A;  3IAS 1;  5BMG A;  3P4Q B;  1K52 A;  1QLB B;  1QOG A;  2ICI A;  3CWI A;  1TS4 A;  2FUG 1;  2WXQ A;  1FXI A;  4C7Y A;  2QEJ C;  3VRA B;  2XNA C;  3P1M A;  1TY0 A;  4H2A A;  4NJC A;  1IUE A;  4EE2 A;  1PGB A;  3AH7 A;  3AE5 B;  3SFE B;  1JRP A;  2EKI A;  2QMT A;  1TZO A;  5BYS A;  5HFY A;  4WAF A;  3HRD D;  2QSD A;  4N59 A;  1B9R A;  1JWM D;  2K0P A;  1ZOY B;  2PVG C;  1UWM A;  3KQ4 A;  3P4S B;  1JRO A;  2MEK A;  1GPX A;  4AQ7 A;  3P63 A;  2WXM A;  3IAM 1;  5AUK A;  2HTM E;  2KAC A;  3IT4 B;  2BS3 B;  4OHJ A;  4A9A A;  4WWM A;  2V0G A;  4ARC A;  4RH6 A;  4US9 A;  1TJE A;  1T3Q A;  4JE3 B;  5FKA C;  2K9X A;  4YSX B;  1ZUD 2;  5EE1 A;  5MPO A;  1VJK A;  1QOB A;  2JYT A;  3HVD A;  2W82 A;  3U2S C;  1TS5 A;  2WDQ B;  2QIL A;  2WDR B;  5JXV A;  1FRD A;  1I4Q A;  1N5X A;  2JYE A;  4MT5 A;  2R61 A;  3Q8B A;  3AMZ A;  1GAQ B;  4UDU C;  1YNT E;  3R2T A;  3CIR B;  3TEX A;  4D2K A;  2BT6 A;  3BVZ A;  4XDD A;  4B0E A;  1CJE A;  1K50 A;  2IGG A;  4TSS A;  5TSS A;  1YJJ A;  2ON8 A;  1JWS D;  3BII D;  1ZP0 B;  1EWC A;  1D5X C;  1TKG A;  3EA6 A;  3FC4 A;  1BML C;  3HUI A;  3IT6 B;  1V1O A;  2M56 B;  2W54 A;  1D6E C;  3AEC B;  4YSY B;  1TKE A;  1PFD A;  1UNS A;  4FXC A;  3AEG B;  4OZB A;  5D7G A;  2K22 A;  2OED A;  1SJH D;  4A55 A;  1MHX A;  1B1Z A;  3P4R B;  1FMA D;  1XF5 L;  3NVZ A;  4JWU C;  1UGJ A;  1WSP A;  4DXF A;  1NYR A;  1BUI C;  4PT5 A;  1JAL A;  3ABV B;  1ZXI A;  3MP9 A;  3BK2 A;  2V3N A;  1SE4 A;  1OQQ A;  3NVY A;  3P42 A;  4JWS C;  4OZA A;  1YN3 A;  4US8 A;  4YT0 B;  2GI9 A;  2JWU A;  2WNM A;  2WXN A;  1WXQ A;  2D5G A;  4XDC A;  1RM6 C;  3ZQ4 A;  3FIL B;  1RYJ A;  4YSZ B;  1N5W A;  3MFG A;  2LEK A;  3O13 A;  2BBC A;  1HEZ E;  2J53 A;  4MM3 B;  1MPE A;  1VZ6 A;  4HKQ A;  1SB3 C;  2KWD A;  1P7E A;  4L23 A;  2WXP A;  2G1E A;  3SEB A;  1GOZ A;  2W3R A;  2Z8L A;  3NVV A;  2WXJ A;  1I4G A;  2L32 A;  1SE2 A;  1OFF A;  1E6E B;  5H8Y E;  2AQ1 B;  3ZJU A;  1V1P B;  3BZD B;  2Y5C A;  3Q8C A;  1LO5 D;  4TMA B;  1CK1 A;  4A8X C;  4IOI E;  2KN4 A;  4L1B A;  1KRH A;  4R3D A;  2LMC A;  3OWE B;  2MJE A;  1XCT L;  2BB5 A;  1MI0 A;  1SBB B;  3FIL A;  2AX5 A;  1QT9 A;  4HRO A;  1I4X A;  2WXF A;  3B2F A;  2MJD A;  3R8B A;  4YTN B;  3TEZ A;  1ET6 A;  1HQR D;  3T3O A;  2VZK B;  5LNK 1;  2WLB A;  3BWU D;  2WP9 B;  1N60 A;  3C8Y A;  3Q69 A;  4YWG G;  3W5V B;  2EEL A;  1C9F A;  1SIJ A;  3J9C A;  1QF6 A;  1N63 A;  3AN1 A;  2BB6 A;  1WYG A;  1K53 A;  2KMM A;  4KKI A;  1V97 A;  1T5X D;  2W3S A;  3R2I A;  4HEA 1;  5C3J B;  3ETR A;  1FNV A;  1ZE3 D;  2PKO A;  2XN9 C;  1VDV A;  2H88 B;  2QJL A;  4HRS A;  5BMH A;  3I57 A;  4WQM A;  2IDY A;  2Y5P A;  4JX1 C;  2CJN A;  3AV8 A;  1VLB A;  1T6B X;  1XLP A;  3P4P B;  2NMQ A;  2RDG A;  1J7A A;  1XO3 A;  2E3T A;  4ITK A;  4ZOH C;  1JCK B;  2KDM A;  5G5H A;  2LJI A;  1SXT A;  1F0Z A;  5EE3 A;  5C2T B;  3MHZ A;  3B2G A;  5AUI A;  1I7H A;  4C56 C;  3U52 E;  3ZJT A;  1GTH A;  5H92 C;  1YQ3 B;  4LLG M;  3V3X A;  3B9J A;  2W55 A;  1N61 A;  1WGK A;  1WRI A;  4RGO S;  1SJE D;  4A90 A;  4GDL B;  1DOY A;  2IGH A;  1QKZ A;  3KLS X;  3VR8 B;  3LYY A;  1CZP A;  3SR6 A;  1P7F A;  2NTT A;  3BK1 A;  3TSS A;  3U7Z A;  1VR9 A;  1KLG D;  4A6Q A;  1TY2 A;  1XLO A;  3AED B;  2J52 A;  1L0V B;  1K51 A;  1E7P B;  1NVI D;  1D4B A;  1H7W A;  2SAK A;  1NEK B;  1ZXH A;  2IJ0 A;  1ACC A;  1CQV A;  3RPF C;  1IGC A;  1F2R I;  3NUH B;  2WXK A;  1TYG B;  2WXH A;  3BYT B;  4KKJ A;  2DBY A;  1NEN B;  1Q10 A;  1GTE A;  1EWY C;  2J4X A;  1ZDV A;  2X38 A;  3FAH A;  1D5Z C;  3GS2 A;  2SEB D;  1KF6 B;  3GP7 A;  1FNU A;  3AE1 B;  2DYO A;  1AW7 A;  2WDV B;  4Q2J A;  3KWV A;  3MC0 B;  2ZW0 A;  1J7C A;  1FIQ A;  1H7X A;  4N58 A;  1I4H A;  1DGJ A;  4GLS C;  2BW2 A;  1FRR A;  2BS4 B;  1XEE A;  4GDK B;  2CJO A;  2Y3A A;  4ARI A;  4YTP B;  4WIP A;  4KGT A;  5T8I A;  1YQ4 B;  1F2R C;  3W9C B;  1JWU D;  1E0Z A;  4REZ A;  1DOI A;  4HKZ E;  1QIL A;  4USA A;  1ZDX A;  5G5G A;  1ENF A;  3BVG A;  2PTL A;  2ZW1 A;  3L4P A;  5FR3 A;  4AS1 A;  2M0A A;  2NTS A;  3RFZ B;  2RDH A;  2FBW B;  1C77 A;  4YXD B;  2PIA A;  4RFB A;  1C79 A;  1I4P A;  1M4V A;  3CF4 A;  5HHD G;  1UWX A;  1GT8 A;  4P16 A;  5BYQ A;  5I4D A;  2WXI A;  2WS3 B;  1FCL A;  1TS3 A;  2INN E;  1STE A;  3E56 A;  1HXY D;  2YEP F;  1DOX A;  3ZJV A;  3T3N A;  1QQR A;  3DWG C;  3E9S A;  2J42 A;  2WQY B;  3PZ7 A;  4KX6 B;  1XLQ A;  3EGR A;  1PUT A;  2BYT A;  1C4P A;  2WU2 B;  1SE3 A;  1SF0 A;  3KWL A;  3AE3 B;  3U4E G;  3PZ8 A;  4WH4 A;  3NVW A;  1PGX A;  3NZ3 A;  2E6X A;  1V1P A;  1TKY A;  1PDX A;  2L52 A;  1I4R A;  5GXG B;  1L5P A;  1YJI A;  1MVK A;  2DWQ A;  4RF0 A;  3AE2 B;  1KTK A;  1ROE A;  2H89 B;  2JXT A;  3BVM A;  1J7B A;  1L4D B;  1IBX B;  1RWS A;  4M0W A;  1E9M A;  2RPV A;  2PW9 A;  2JZP A;  1WWT A;  2AQ2 B;  1BXT A;  2BS2 B;  2OHF A;  4ZHP A;  3VRB B;  4TQ0 A;  1FFV A;  2L83 A;  2ONQ A;  2HDE A;  1XXG A;  1EU4 A;  2B76 B;  3W2D A;  4YTM B;  2N7J A;  2LUM A;  3LB8 C;  5D3I B;  5EE0 A;  2GRI A;  2K3U A;  3W5U B;  2WU5 B;  3TUO A;  2Q5W D;  4N6E B;  1R7S A;  4HJG E;  1Y56 A;  1ET9 A;  3ZYY X;  1YN5 A;  2FE8 A;  2GB1 A;  1L0Y B;  4MH8 A;  1JWA D;  1KFY B;  1IBX A;  2I2Y A;  1FXA A;  4NAW B;  3V05 A;  2MJ3 A;  2KQ4 X;  1V8C A;  4RF1 A;  1TS2 A;  4TQ1 A;  4O1N A;  1UUP A;  2K5P A;  1YN4 A;  2KAJ A;  2N0S B;  4MAC A;  1NYQ A;  4XE0 A;  1QOA A;  1OQR A;  4XWW A;  5HI1 A;  3DWM A;  3H8H A;  1SSN A;  3AB5 A;  3TEY A;  4IDI A;  4JPS A;  2WXR A;  4DQO C;  3LXF A;  5E6J A;  4ZYS A;  2WXL A;  2JU6 X;  3VQI A;  3IXS A;  4J3O D;  1XLN A;  4RGM A;  3Q8F A;  3WCQ A;  1GB4 A;  1NI3 A;  4XWT A;  4DXG A;  1L0X B;  3Q8E A;  1HZ5 A;  1SEB D;  1D5M C;  3PO0 A;  4RGN A;  3AE7 B;  1FEH A;  5BMI A;  1PGA A;  4P6V F;  5FK9 C;  4OW0 A;  3ZGZ A;  3W1S A;  2YEP B;  3AE8 B;  2LFI A;  3AE4 B;  4LK0 M;  4RGT A;  1QOF A;  2WXG A;  3N9Y C;  4WUR A;  4ZRQ A;  2L1A A;  1AN8 A;  1VRA B;  2INP E;  2BTE A;  4RNA A;  1ZPS A;  1L6V A;  1XCQ L;  1FCC C;  1JW9 D;  1L6U A;  1IGD A;  2QIE B;  1AYF A;  4KGS A;  1KH0 A;  5HG2 A;  1FD6 A;  1L4Z B;  3VR9 B;  4OZC A;  1FFU A;  1FNW A;  4C7Z A;  2V3P A;  3AEB B;  1N62 A;  1FO4 A;  1DYQ A;  2I38 A;  4NZL B;  2ACZ B;  5D3D A;  3AE9 B;  3URY A;  4B0M A;  2N9K A;  1EU3 A;  2V4I B;  4L2Y A;  1C78 A;  2MH7 A;  4CQN A;  1JQ4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...