3P4QB

Crystal structure of menaquinol:oxidoreductase in complex with oxaloacetate
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
243
structure length
243
Chain Sequence
AEMKNLKIEVVRYNPEVDTAPHSAFYEVPYDATTSLLDALGYIKDNLAPDLSYRWSCRMAICGSCGMMVNNVPKLACKTFLRDYTDGMKVEALANFPIERDLVVDMTHFIESLEAIKPYIIGNSRTADQGTNIQTPAQMAKYHQFSGCINCGLCYAACPQFGLNPEFIGPAAITLAHRYNEDSRDHGKKERMAQLNSQNGVWSCTFVGYCSEVCPKHVDPAAAIQQGKVESSKDFLIATLKPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Fumarate reductase flavoprotein subunit
publication title Geometric restraint drives on- and off-pathway catalysis by the Escherichia coli menaquinol:fumarate reductase.
pubmed doi rcsb
source organism Escherichia coli 042
total genus 60
structure length 243
sequence length 243
chains with identical sequence N
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2010-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13183 Fer4_8 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 3p4qB02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3p4qB01
1WWTA 4US9A 3CIRB 3AE7B 1J7CA 3AEFB 1FRRA 3W5UB 1QOBA 1VLBA 3SFDB 2WU2B 1ZUD2 1NEKB 2QIEB 3BIID 3NVYA 3P1MA 3NVZA 4KX6B 3VR9B 1XLNA 1YJJA 1N62A 1QT9A 2KMMA 4YXDB 1GT8A 2W54A 2CJNA 3WCQA 3P63A 3HUIA 3AEAB 4YSYB 1IUEA 3VRAB 1A70A 2DWQA 2PVGC 1WXQA 4IDIA 2WDQB 5EE3A 2PIAA 2W3RA 1L0VB 2JQRB 3P4SB 1B9RA 4YTMB 1AWDA 1CJEA 4C7YA 3NS1A 3ETRA 1ROEA 2WS3B 1NVID 2H88B 1DOIA 2K5PA 4JX1C 4YTPB 1RM6C 5G5HA 1XLOA 2MJDA 1N61A 2DBYA 1GTHA 1OFFA 4US8A 1J7BA 1F0ZA 1H7XA 1TKGA 3RPFC 2BS4B 1N63A 2WQYB 1N5XA 1V8CA 3SR6A 2M19A 1GPXA 1PUTA 3AE8B 2Y5CA 1JW9D 2MJ3A 3P4PB 3NVWA 1WRIA 2B76B 1JWAD 2WP9B 3AE5B 1H7WA 1FMAD 1ZXIA 1VDVA 2QJLA 3FAHA 5C3JB 2OHFA 1I7HA 5C2TB 2MJEA 4JWUC 2JX5A 1WGKA 3B2FA 4YSZB 4ZOHC 1NYQA 2MH7A 1FFVA 4YT0B 4A9AA 1E6EB 1PDXA 3HVZA 1T3QA 1TKYA 2M56B 4N59A 2H89B 1QOAA 1DOYA 3AN1A 1KF6B 3ABVB 3FC4A 1E0ZA 3AH7A 1L5PA 3L4PA 1JALA 1KRHA 1TJEA 2G1EA 3NVVA 5EE0A 2L83A 2WLBA 5AUKA 1SF0A 1L6VA 2AX5A 3DWMA 1DOXA 3AM9A 1CZPA 5H92C 3AE2B 1JROA 3AE3B 3B9JA 5GXGB 1FO4A 5MPOA 4ZHPA 2EKIA 2BS3B 1NI3A 1N60A 3AV8A 1YQ4B 2CJOA 2CU3A 1YJIA 1V97A 1EWYC 4YSXB 2ACZB 3AEEB 2WDRB 3P4RB 2N0SB 2KAJA 1JWBD 1FM0D 3AE1B 2W55A 3B2GA 5AUIA 3AEGB 3AB5A 1QOGA 4JWSC 1PFDA 4ITKA 1OQRA 5H8YE 2BT6A 3AECB 4P6VF 3DWGC 3SFEB 4C7ZA 3VR8B 1E9MA 4ZHOA 1SB3C 3EUB2 3P4QB 3ZYYX 4HRSA 4WWMA 1FXAA 1UWMA 3AEBB 3AMZA 2FBWB 1XLPA 2PKOA 2BS2B 1ZP0B 1NYRA 1FIQA 3AE6B 3CF4A 1ZOYB 3HRDD 3AE9B 2WDVB 1TKEA 1TYGB 1FFUA 1XLQA 1JRPA 2K9XA 4N58A 1RFKA 4FXCA 4WQMA 1SIJA 1NENB 1J7AA 1XO3A 1OQQA 1RYJA 3KWLA 3W9CB 3VRBB 1E7PB 1KFYB 1YQ3B 2HTME 2W3SA 4HROA 1E10A 1R7SA 1L6UA 3CWIA 3PO0A 4C80A 1AYFA 1GTEA 4USAA 5EE9A 2K22A 5G5GA 1JQ4A 4LTUA 1N5WA 2E3TA 1DGJA 1WYGA 4YTNB 1RWSA 1QLBB 3AEDB 1FRDA 1QF6A 3LB8C 2WU5B 5EE1A 2Q5WD 2PVOD 1GAQB 3LXFA 3W5VB 1FXIA 1QOFA 2LEKA 4N6EB 3AE4B 1VJKA 3NRZA 2L52A
chains in the Genus database with same CATH superfamily
3HVDA 3X0WA 3CIRB 5IO9A 1IPGA 4J3OD 1QOBA 4F1SA 1HA5A 1LFDA 1RAXA 4B0EA 4AJWA 2AL3A 4ZRIA 3UI3A 1NDDA 2PIAA 2KC1A 4FJVB 2K5PA 2BW2A 5E6NA 5DCNA 1OEYA 2QILA 3H1UA 2XNAC 1WX8A 4B6WA 3NOBA 3FAHA 4WH4A 1KJTA 4KIKA 3B2FA 4WJPA 2N4FA 2N7EA 4AP4C 3U4EG 2K3UA 3I5JC 4W9IA 3C19A 4G0NB 4WWOA 3MHZA 1E0ZA 2G1EA 1FPYA 3JYUA 2WLBA 4EOYA 5DPSA 3HM6X 2K1FA 2IO3B 3HK0A 5IKCM 2SEBD 2L0FA 3PGEA 4YSXB 1EU4A 3P4RB 3NUHB 3AE1B 4JWSC 2LD9A 1JWUD 1AARA 1OEYJ 3UINB 2LGXA 2YLMA 1UWMA 1L4DB 2OEDA 3MJWA 1NYRA 2NCNA 1KH0A 3HRDD 1T0SC 3TBLD 4DK5A 1P7EA 3L17A 2ZPNA 1X1MA 1T0YA 3PPAA 1UH6A 1BUIC 3SDLC 2Y3AA 1E10A 4DDID 2ZW0A 2M8SA 2V4LA 4MGKE 1T6BX 1CK1A 4KDIC 2VH2A 3AEDB 1UD7A 2JF5A 4IWPA 2KDFB 2VRRB 1I4GA 2D10A 1GAQB 3H7PA 4WURA 4TUUA 5J18A 4Q2JA 1WWTA 2IZVB 1WY8A 3W1SA 3BK2A 1N62A 4EEWA 5BMIA 1C4PA 3OWEB 4MSMB 4GB9A 3U52E 2L7RA 2WXRA 4RF1A 1CJEA 4EKUA 1NVID 2KJRA 4YTPB 4XDDA 1D5XC 5G5HA 3TJPA 4C4VB 1FNUA 2BF8B 3ENEA 1H7XA 4XZ4A 2IO2B 1KLVA 4LNIA 4OVUA 2Y5CA 2MJ3A 2KMAA 3TEYA 4L23A 2JSVX 3NJTA 2D07B 3Q8BA 3O65B 5HKHA 3QHTA 1SE2A 5JHBA 4AJYB 2INCC 4C56C 5IN7A 5J17A 5AUKA 4H2AA 5LNK1 2KACA 2KN4A 1CMXB 1CQVA 1N60A 2CJOA 2C60A 4DBGA 4XWWA 2JUOA 2N7JA 4GLSC 2XK5B 1NBFC 2N0SB 3B2GA 1Q0WB 3RD2A 1PFDA 2G4DB 2Z59B 4MH8A 4HRSA 1GJZA 1WZ0A 3PZDA 4CO7A 1ZOYB 1V80A 2L76A 4YL8A 4HPPA 3R66C 1TS4A 4HJKA 1V49A 3BZDB 1E7PB 5KHQA 1YD8U 4C80A 4GSWA 3R2IA 4KDLB 1WIAA 1V1PB 2M1MA 4HK2A 3VH4B 4YTNB 2BKRB 2IGHA 4OHJA 1WMHA 4HDOA 5JXVA 2BYVE 1DYQA 5GMVA 2KNBA 4F7ZA 3H7SA 4TSSA 1WXAA 2V0GA 2BWFA 5LLIA 2REXA 2WXMA 2DZIA 2QIEB 4NQLB 1KLGD 2IO1B 4KX6B 3RI7C 2KANA 3DHGC 2KDEB 1H8CA 4MELA 2L00B 4BOSC 4MGIE 2LGSA 3L0WB 1LQBA 1KM7A 2VZKD 1LXDA 2KVRA 2C5LC 2VH1A 3E9SA 2UU7A 2MQJA 4EZJA 3I63C 1VDVA 5T8IA 5C2TB 4R3DA 4YSZB 2KQSA 1P0RA 4YT0B 2J4XA 4A9AA 2JWUA 3U30A 1E6EB 3WIMA 1MHHE 3AH7A 1L5PA 5AZGA 3PRZA 1KRHA 3JSVA 3CMMB 1VR9A 3GE8C 2BB5A 3N30A 4J6IA 1JROA 2MEKA 5BO4B 4A8XC 1P7FA 4E3CA 1V97A 2X8XX 4HKZE 1Y56A 3PV1A 3WANA 4ZHOA 3VR8B 3A4RA 1WJ4A 1JMLA 2MBBB 4II3B 1WJNA 2AYOB 3EFCA 1TKEA 3Q3JA 4ICVA 1TS2A 1F2RC 3RN9C 2AWTA 3NHEB 4G11A 3C0RB 2GB1A 1JQ4A 2RDGA 1QLBB 3LB8C 4BBNC 2PPHA 5JH5C 3DHHC 4RMAA 1YIWA 1UF0A 2N1WA 3I9V1 2M4NA 3NRZA 2L52A 3NG0A 3R8BA 3W5UB 1IP9A 3PSEB 3NVYA 2NPTA 2IYDB 2J0JA 1MI0A 3ZJUA 1F52A 3HM3A 4KIKB 4YSYB 3GE3C 2L8JA 3M95A 3ZJTA 2EMSA 5DPWA 1SE3A 1F9JA 1ROEA 2HD5B 1DOIA 4ZRQA 1WR6E 2XEWA 3GB1A 3VTUA 4IM2A 1N5XA 2AQ1B 3MC9A 2PJHA 2EELA 2JZPA 3NVWA 4BFRA 1I7HA 3Q69A 1R4NB 3VUYA 5E6PA 2CHZA 4ASWC 1GC6A 3ABVB 3FC4A 5BYSA 2KFKA 3R3MA 5TSSA 1XEEA 3AE2B 4RNAA 1WX9A 1OQYA 3Q3MC 3EECA 4RGNA 2LJIA 4ARIA 3JVZX 2W55A 2LUMA 1EF5A 3TSSA 2RMMA 1QOGA 3AECB 2KTFA 4PK1A 4ZRJA 3ZYYX 4XE0A 4C4VA 3H7PB 3L13A 1E7VA 1TT5B 3PRMB 2HTHA 2L1AA 3DBSA 3CF6E 2L05A 4A3OA 1V9JA 1RYJA 1UGMA 2N9KA 2ZVOA 2GBMA 1QILA 2NS5A 4NQKE 2WXOA 4NZLB 4ICUA 2OJRA 2LVQA 2K39A 4N6EB 4OVZA 1YNTE 3AE4B 4X57B 2HE7A 4C00A 3IXSA 1D5ZC 3KWVA 3Q8FA 4JGHB 1AW7A 1T5XD 1UNSA 2K25A 2LASA 4DHZB 2LGIA 4BZAA 3IFWB 1F77A 4RCOA 4E71A 2ASQA 1RLFA 2LI5A 2V9HA 1D4BA 4WQOB 2V3SA 1F0ZA 2D2QA 2IDYA 4IM3A 4K7WA 4GGQA 3CSTA 1SEBD 4TQ0A 4K7UA 1WR1A 4XDCA 2MH7A 1V1PA 1MG8A 5CTRC 3TUOA 4RFBA 2RD0A 2QHOA 1ZPSA 3RNCC 2VZKB 1CZPA 4REZA 4W9JA 2INNE 3EGRA 2JY6A 3RUIB 3DQVA 2NTSA 3NZ3A 1JWBD 1D5MC 3AEGB 3ZNGC 2BT6A 3RULA 2J42A 2KWDA 3AMZA 4ZRPA 4NJ7A 4W9LA 1E5WA 2KWUB 4DHJD 1NENB 3QX1A 2R2OA 3WALA 1K51A 4WAAA 2R2QA 1L6UA 3VFKA 5BYQA 3HHMA 4KGTA 2BWES 1DGJA 1UUPA 5J2RA 1ZKHA 4M8NA 3KUDB 1P1AA 2K6DB 2KQ4X 1ZDXA 2GBKA 2L3ZA 3NVZA 1TS5A 1YJJA 4ZHPA 1GT8A 2CJNA 1KOTA 3AEAB 2KT7A 3K9OB 5TR5A 3L16A 3P4SB 2MP2A 2PMVA 2Z0EB 1NI2A 1R4MI 2MJDA 1TBEA 1FCCC 4L1BA 3RPFC 3JSVB 5I4DA 1HTOA 1GPXA 3A9KA 2G45B 1V6EA 1TZ1A 2I1KA 2OHFA 2MJEA 3T3OA 2GBNA 1LGRA 4GOCA 1T3QA 2D5GA 4HWIB 4PS7A 5HG2A 4RM9A 3VTVA 2MX2A 2QMTA 2Z8LA 3E56A 3AM9A 1HZ6A 4CQNA 1B1ZA 2HJ1A 2CHXA 4RF0A 3AEEB 2KO3A 4IG7B 4B9KA 3ZNZB 4W9GA 3QAQA 3DVNU 3EHVA 1E9MA 3FILB 3APFA 1FXAA 1T0QC 5C1ZA 2LFIA 3RNFC 4I6NB 1FFUA 2RPQA 3H6NA 5EDSA 1EU3A 2PW9A 2NPTB 3ZTDA 1KFYB 1VD2A 4OZCA 1S1QB 1GNUA 3GZNB 1QKZA 1C78A 2N1VA 2ONQA 1EM7A 4HJGE 2NVUI 1FXIA 1C4CA 1QOFA 4MT5A 3BY4B 3KW5B 5JHAA 2KC2A 3AEFB 1HEZE 4OVVA 3ECIA 3IG3A 1IUEA 2X38A 2ZNVC 2K8HA 3DVNV 1WXQA 2INPE 2KOXA 3QQ8B 1Z2MA 5EE3A 4M8MA 3NS1A 2NTTA 3RMKC 4GDKA 1PQSA 3WAOA 4DWFA 1GTHA 1OFFA 4HCNB 4WAFA 2DZKA 2ZEQA 1V8CA 2KFKB 1V5OA 1GOZA 3BYYB 1K53A 2Z0DB 1E7UA 2M0XA 1FMAD 3V62A 2J7QB 4KVGB 1N6ZA 2QDFA 3PRPB 4HPLB 2UYZB 1VCBA 2M56B 2H89B 2BVCA 3W1YA 2ON8A 2C7HA 2RSUA 2DAFA 3EC8A 3B9JA 4A55A 4AS1A 1C1YB 2BS3B 1BMLC 4BKSA 1MVKA 3ZRFA 1UELA 2ACZB 2GMIC 2CS4A 3ZXRA 4ARCA 1JCKB 2AQ3B 2MBEA 3R2TA 1I4XA 3RT3B 3CF4A 3UIOB 3VVWB 3X23A 3N1XC 2DLBA 4FXCA 3MHSD 1J7AA 1OQQA 3MFGA 2FCQA 2KJ6A 1GUAB 2WHIA 2N9PC 1GTEA 5EE9A 1Q10A 3LDZE 4PYZA 3AI5A 4MACA 1XCTL 3NY5A 2BYFA 4ANXA 3PTFC 3U7ZA 1C79A 4KSLC 1IYFA 4BKSD 4DHJB 3VR9B 2CKHB 4YXDB 2WGSA 3ZTCA 3Q3NC 2DWQA 1XQQA 4KSKC 1PGAA 2K8CA 1JWMD 2HDEA 2O6VA 2KXJA 1YQBA 4K3BA 3M62B 3EFUA 3AE8B 3BVGA 4FULA 3AE5B 2BYTA 1L2NA 3KYCD 3Q8CA 1MHXA 2B3AA 1TGZB 2Y5BB 1YMHE 3OLMD 1U4AA 2BQQA 4MEMA 1K8RB 3MTNB 2L83A 2RDBC 3ZLZA 2NMQA 1FO4A 4B0MA 4EUTA 1V1OA 4P1CC 3V6EB 1K50A 2GI9A 3AV8A 4ZRKA 1G6JA 2MRPA 1YJIA 2OJWA 1YX6B 3VH3B 1WJUA 1TY0A 1J19A 2CR5A 3APCA 3QA8A 3GZNI 3T9LA 2DAJA 5G55A 1IBXA 3V60A 4JIOU 2DENB 2O6VD 5AZHA 3RZWC 3TL5A 5LXHA 1JRPA 4JE3B 1FEHA 4WJOA 1PYWD 2KKCA 2W3SA 5D6JB 2L0TA 4OZBA 1WXSA 2R61A 1WYGA 2WNMA 2MP2B 1GB4A 3MC0B 4NAWA 1UWXA 3ZUNA 3KUCB 1C3TA 1KLUD 1ZUD2 1VZ6A 3P1MA 3A9KB 2WXGA 2DNFA 2QSDA 2JZ3B 1ZDVA 4KKJA 4A3PA 1AWDA 3FILA 1P98A 3DBRI 4C7YA 2W82A 2KWCA 1XLOA 3VQIA 2DBYA 2GBJA 4A6QA 2KDMA 3KQ4A 3VTWA 3ZIMA 5FKAC 3ZGZA 4LJOB 1WRIA 2D11A 5BMGA 2I38A 2JPHA 1XT9B 2LXAA 4W9FA 4HVBA 1SIFA 3SEBA 1I4RA 2DYOA 4BAXA 3IAM1 2FIDA 3AN1A 2J0MA 3Q14C 1ESFA 3SU8X 2XBBC 1DOXA 5GXGB 3MP9A 2UWQA 4WIPA 1YQ4B 2A5UA 3RZFA 3BINA 1L0YB 3M3JA 5CHFA 3UQAA 1STEA 4WJNA 2LUEA 4MSQB 1IGDA 1R4MB 1Y8RC 3R7QA 4AUQC 1FIQA 2QCZA 1ENFA 3KVFB 4LDTB 2I1JA 1MJDA 3R7RA 3W9CB 4FADA 1V86A 4HROA 3FKYA 1TZOA 4PS8A 3ZDTA 4OW0A 3B08A 3OAWA 2A4ZA 3DBHI 2FNJB 3W5VB 2WXHA 2N7DA 3J9CA 1GC7A 3PHWB 4GDKB 5D7GA 1SBBB 4RM8A 4D2KA 3W2DA 3P42A 5D94A 1HQRD 2N9XA 3U2SC 2O2VA 4IWQA 1PGXA 4XX5A 2PVGC 1GB1A 1WE6A 2K0PA 3RNBC 4II2B 2WXQA 3ETRA 3RCZA 3MJ5A 1SE9A 4GDLA 4JX1C 1RM6C 2ZZPB 4US8A 3B0AA 4CHKA 4DHZE 2M19A 1PUTA 3Q6BA 4YWGG 5C3JB 4JWUC 1ISNA 2JX5A 1WGKA 1J8CA 1NYQA 3DVGY 4JLCA 4E74A 3AU4A 4WJQA 1TKYA 1FXTB 4NJ6A 1XD3B 1F1HA 1WYWB 2SAKA 4WWPA 4K1RB 3NVVA 2QC8A 1ET6A 2G3QB 5CHWA 4BVUC 3PZ8A 2CU3A 2KLGA 3LYYA 2KDBA 3QC8B 4DQOC 4ZYSA 5L95C 3AB5A 1UBIA 1WF9A 4TKNA 3ZXVA 3DWGC 1SB3C 1D6EC 3ZW3A 2BS2B 3S2AA 3RNEC 4I6LB 4ZDVA 1ZW7A 4IWOA 5C23A 2FCSA 2WXNA 1WGRA 2FE8A 2MW5A 4LNKA 4TQ1A 2LWPA 3IT6B 1ZGUB 2KZRA 2J52A 1FRDA 2NBUA 4MM3A 5EE1A 4GXBA 4HPMB 1Z5SB 4AOFA 3KH0A 1P3QU 3BWUD 2O6VB 1YN4A 3V61A 2MHJA 4W9HA 2M17A 3BIID 4P7IA 4HCPB 4M0WA 2W9NA 3VDZA 1XLNA 4L2YA 2IGGA 2C9WB 3P63A 1JWSD 2V3PA 3H8HA 2JVCA 4YTMB 1UBQA 4ANWA 4HEA1 4M02A 1QQRA 2GRIA 2DZMA 4K7SA 1VZ7A 2WXIA 2RDHA 2BS4B 2KTRA 4RGOS 3P4PB 3ALBA 1AN8A 4LNNA 1S3SG 3ZQ4A 4IC7B 4MJSA 3ZVVA 3TEWA 1PDXA 3QIJA 1DOYA 3A1QA 1IBXB 1E8WA 3APDA 1TJEA 4W9DA 1V2YA 3C8YA 4CYEA 2FAZA 2C7MB 2INDC 4XYCA 1WGDA 2LRUA 3QWZB 2KAJA 4XGAB 3MC8A 2BPSA 3DBLI 4P6VF 1FD6A 2BYEA 1OGWA 3PT2B 3AEBB 4DDGD 3I57A 2KMCA 3OG5A 4NAWB 1E8XA 1XLQA 2BGFA 3A9JB 3O13A 1SIJA 3VXWA 1TY2A 4URKA 3VRBB 3QCAA 2MSED 2CU1A 2IY0B 2E3TA 5D3DA 3GOEA 5L83A 1RFAA 4EFOA 2JYTA 2WU5B 5D2MB 3LXFA 3BVZA 1D3ZA 1YJ1A 2LHEA 1T0RC 4O1NA 3IT4B 1VJKA 1WZ3A 1A5RA 4K81A 2JRIB 3BYTB 4P1BC 1J7CA 1FRRA 2WU2B 3ZDMC 1E8ZA 4M01A 4M00A 2BBCA 4BBNF 3N1YC 1A70A 4IDIA 1V5TA 1M4VA 2FUHB 3VUXA 2KLCA 3DOWA 2W3RA 4ACFA 3URYA 2JQRB 2LGDA 1MFWA 3RNGC 4FLHA 1TKGA 2D3GA 2TSSA 5DPTA 1TS3A 2B76B 2JXXA 5AEKB 2WP9B 1ACCA 5FR6A 1QZEA 2V3NA 2WXJA 3K9PB 2N9EB 4ZOHC 5FR3A 4HDQA 3HVZA 2HJ8A 4PYUA 1WM3A 4KV2A 4MGYE 2KDIA 2RPVA 2IBIB 3I3TB 2E6XA 2LMCA 3ZKJC 1FCLA 1I4PA 2M0AA 4WWNA 2K8BA 1EWYC 2D3AA 4NJCA 3A33B 4FHJA 1FM0D 2WYQA 3DBRB 3VAWA 2WDTB 3Q8AA 1EO6A 3ZNHB 2FBWB 1XLPA 2ZW1A 4UDUC 1TYGB 4LDTD 4WQMA 4XWTA 4JPSA 3IHPC 1F2RI 2O2VB 4AQ7A 4PS3A 2WX1A 1AYFA 4USAA 2K22A 1N5WA 5HHDG 5BYRA 2AEHA 1QF6A 5HI1A 2PE6B 4GDLB 2ZJDA 1YN3A 1WFYA 5BMHA 2FCMA 3AU5A 2LHDA 3OJ3A 2KWVB 4GN1A 3SFDB 3SR6A 1QT9A 2W54A 4AWJA 3WCQA 2EKEC 1EUVB 1WXVA 4LK0M 2WDQB 2DHZA 4KGSA 4BOZB 1OTRB 1KTKA 1SJHD 4ANVA 2ZVNA 1WGYA 1XXGA 1YOVB 3LJ3A 4A90A 2PE9A 1WH3A 3PVLA 2XN9C 1H7WA 1WRDB 2G4SA 2GBRA 1SGHA 3VHTC 4FHKA 3DBHB 5IP4D 1RRBA 1L4ZB 4GIVA 2NR2A 1ZXHA 3UIPB 1WJ6A 2G9HD 1C9FA 2KYWA 1JRUA 1UGJA 5H92C 4KZCA 2JRHA 1C4AA 1J0GA 2ZCBA 3QARA 3W1SC 5LXIB 3DPDA 5JZEB 3DVGX 2C7NB 3UGBB 4RGMA 2BTEA 2KD0A 4S0RA 4TV3A 2PTLA 4C7ZA 1BT0A 1HXYD 4MM3B 4WWMA 2KX0A 2BB6A 3AE6B 2WDVB 1C76A 1MG4A 3NS8A 3ZRCA 2AQ2B 2D3BA 1VRAB 1VZ8A 1ET9A 4M0WB 1R7SA 2IY1B 3PREA 2WWZA 2LJ5A 4OZAA 3L54A 5D3IB 3DCGA 4HKQA 2JT4B 4XC2A 3KUZA 4KZ0A 3RYTA 4TMAB 4DXAB 5G2NA 2KTRB 4EZKA 4RH6A 1NEKB 5E6OA 3N9YC 3HUIA 2MA9B 3VRAB 4G3XB 4FN2A 4FJYA 4LCDE 1I42A 2AL6A 4NY0A 2V4IB 4MJSB 3GP7A 3U7DA 1HZ5A 2KVZA 2LRWA 2MBOA 3A1QB 3Q3OC 1I4HA 3SD5A 4MGZE 2NBWB 1WXMA 3A9JA 1JW9D 3UQBA 4HXDA 1UZXB 1ZXIA 2K6QA 4BKTA 2ZNVB 1TIFA 1QOAA 1WGGA 1XF5L 3L08A 2KFJA 5EE0A 2AX5A 2I2YA 1C77A 1WSPA 3AE3B 4I6PA 2GLSA 2EKIA 1NI3A 1Q5WB 3BVMA 2YVCA 2KK8A 4NPNA 1TTNA 2KN5A 1FNVA 3IBEA 1LM8B 4IKGA 4NNJB 1OQRA 5H8YE 1ZE3D 3TCAA 2Y5PA 4FBJB 3EUB2 4IW0A 2JWZA 2PKOA 3WAMA 1WI0A 2WX0A 3N32A 4EE2A 1RFKA 2YEPB 1PGBA 2ZPYA 2IPKD 1V81A 4N9F4 3PHXB 4G50A 2RR9A 2LXCA 1E90A 2MCNB 5DPRA 5KHOA 5IAAC 2FCNA 2WXFA 2WXKA 1I35A 4DXGA 3A4SC 1H4RA 3M63B 2IJ0A 1E8YA 2KMMA 2L32A 3DBLB 4GU2A 1L0VB 4DXFA 3HIZA 2DYMA 1BXTA 3RNAC 3ZO5B 4FA6A 2H88B 2CHWA 1HE8A 4S17A 1Q1OA 3UF8A 2MBHA 4GMVA 3V05A 1I4QA 3TMPB 1JWAD 2DX5B 4KGRA 3NZSA 1WX7A 1M94A 2MLBA 3CSFA 3PS6A 1FFVA 2DZJA 3DDCB 4HLEA 3Q8EA 2JZZA 1L7YA 1GG3A 3ML8A 1WM2A 3P2BA 3L4PA 4RGTA 1SF0A 1L6VA 1L0XB 2ICIA 3SHQA 3N3KB 2FUG1 3RFZB 1P9DU 1XCQL 4LLGM 4FJZA 3JW0X 4LNFA 1MPEA 5AUIA 2J53A 3T8MA 2KJHB 4ITKA 2JYEA 2LVOA 4IUMB 4BKGA 2YEPF 4MH0E 5E6JA 3PZ7A 2LGYA 3AE9B 3U8ZA 5IA7A 4N58A 3QK0A 2MWSB 2K9XA 2IGDA 2FIFA 5CX3A 1XO3A 3AULA 2XK5A 2HTME 4ZYNA 2V1YA 3TIXA 3CWIA 2PLPA 2N9LA 3IVFA 1SE4A 3DHIC 2WXLA 3ONSA 4LTUA 4IM0A 4LNOA 1HTQA 3VUWA 3Q3FA 2LEKA 2PEAA 4MDKE 3ML9A 4US9A 3AE7B 3ZJVA 1VLBA 3TEZA 1EF1A 4JQWC 5IOIA 3IAS1 2LZ6A 2NBVB 1B9RA 1FNWA 1K52A 1SXTA 2J0KA 2WS3B 3PLUA 4P16A 4IOIE 1N61A 3WAPA 1J7BA 1N63A 4KKIA 2WQYB 4W9KA 5HFYA 1WGHA 2KX3A 3N1ZC 4K3CA 2QJLA 3T3NA 3L10B 3D32A 3H9DA 2RGFA 3PLVA 4PT5A 4EZLA 2ZCCA 2DYBA 4W9CA 3KLSX 5AZFA 4N59A 4B95A 3Q2AC 1WMHB 1KF6B 2OOBB 1IGCA 3AXCA 2KHWB 4ANUA 1JALA 3DWMA 2BKFA 2LVPA 5CHVC 4JL9A 5MPOA 3N20C 3TEXA 4LJPB 4W9EA 2WDRB 3EA6A 3V6CB 3KYDD 3B1LX 1LO5D 3SFEB 2D3CA 3P4QB 2KQ7A 3ZNID 2MBQA 1ZP0B 1EWCA 3BK1A 5FK9C 1YX5B 3GS2A 4F8CB 3KWLA 3OJ4B 3NZUA 1YQ3B 4QAYA 3WA0A 2JU6X 4NAMA 3PO0A 1SSNA 4A20A 3V3XA 2WXPA 5G5GA 1YN5A 3QJZA 2IO0B 2GOWA 2QEJC 1RWSA 1R4NI 2EMTA 2Q5WD 2PVOD 2JXTA 1SJED 1WE7A
chains in the Genus database with same CATH topology
3HVDA 3IXSA 1D5ZC 3KWVA 3CIRB 2LHDA 3Q8FA 4J3OD 1AW7A 1KLUD 1QOBA 1T5XD 3SFDB 1ZUD2 1VZ6A 1UNSA 3P1MA 1HA5A 2WXGA 3SR6A 1QT9A 2W54A 2LGIA 3WCQA 4B0EA 4LK0M 2QSDA 3UI3A 2WDQB 1F77A 2PIAA 4RCOA 4KGSA 1ZDVA 4KKJA 1AWDA 3FILA 1SJHD 1KTKA 4C7YA 2W82A 2K5PA 1D4BA 1XLOA 3VQIA 2BW2A 2DBYA 1F0ZA 4A6QA 1XXGA 2KDMA 2QILA 3KQ4A 4A90A 3ZGZA 5FKAC 2IDYA 2XNAC 1WRIA 2XN9C 1H7WA 1SEBD 3FAHA 4WH4A 4TQ0A 5BMGA 2I38A 3B2FA 4XDCA 2MH7A 1V1PA 3U4EG 2K3UA 3TUOA 4RFBA 3SEBA 1I4RA 2DYOA 3IAM1 3AN1A 1ZPSA 1L4ZB 3MHZA 1ESFA 1E0ZA 1ZXHA 2G9HD 2G1EA 2VZKB 1C9FA 1DOXA 2WLBA 1CZPA 1UGJA 4REZA 2INNE 3EGRA 5H92C 5GXGB 3MP9A 1C4AA 2SEBD 4WIPA 1YQ4B 4YSXB 1L0YB 1EU4A 3P4RB 2NTSA 3NUHB 3NZ3A 1JWBD 3AE1B 1D5MC 3AEGB 4JWSC 4RGMA 1STEA 2BTEA 2BT6A 1JWUD 2PTLA 4C7ZA 1IGDA 1HXYD 2J42A 4MM3B 4WWMA 1UWMA 2KWDA 3AMZA 1L4DB 2OEDA 1NYRA 2BB6A 1FIQA 3AE6B 1KH0A 4ZRPA 3HRDD 2WDVB 1P7EA 1ENFA 1C76A 1NENB 2AQ2B 1VRAB 3W9CB 1VZ8A 1BUIC 1ET9A 1K51A 2Y3AA 4HROA 1R7SA 2ZW0A 1L6UA 1E10A 5BYQA 1TZOA 4KGTA 1T6BX 1CK1A 1DGJA 4OW0A 1UUPA 3AEDB 4OZAA 1I4GA 1GAQB 3W5VB 5D3IB 4WURA 2WXHA 3J9CA 4GDKB 5D7GA 1SBBB 4D2KA 2KQ4X 4HKQA 4Q2JA 1WWTA 1ZDXA 3P42A 3W2DA 4TMAB 4RH6A 1HQRD 3U2SC 1NEKB 3W1SA 3NVZA 1TS5A 1YJJA 4ZHPA 3BK2A 1N62A 1GT8A 1PGXA 2CJNA 3N9YC 5BMIA 3HUIA 3AEAB 2PVGC 1GB1A 3VRAB 1C4PA 3OWEB 2V4IB 3GP7A 3U52E 3P4SB 2K0PA 2WXRA 4RF1A 1HZ5A 1CJEA 2PMVA 2WXQA 3ETRA 3MJ5A 1NVID 4JX1C 4YTPB 1RM6C 1D5XC 4XDDA 5G5HA 1I4HA 2MJDA 1FCCC 4US8A 1FNUA 1H7XA 4L1BA 3RPFC 5I4DA 2M19A 1GPXA 1PUTA 2Y5CA 1JW9D 2MJ3A 3TEYA 4L23A 1ZXIA 4YWGG 2JSVX 5C3JB 2OHFA 3Q8BA 4JWUC 2MJEA 2JX5A 1WGKA 3T3OA 1NYQA 1SE2A 1T3QA 1TKYA 2D5GA 1QOAA 2SAKA 1XF5L 5HG2A 4C56C 3NVVA 2QMTA 2Z8LA 4H2AA 5AUKA 3E56A 5EE0A 1ET6A 2AX5A 3AM9A 5LNK1 1HZ6A 4CQNA 1B1ZA 2KACA 2KN4A 2I2YA 1C77A 1WSPA 3AE3B 3PZ8A 1CQVA 2EKIA 1NI3A 1N60A 4RF0A 2CJOA 2CU3A 4XWWA 3BVMA 2N7JA 3LYYA 3AEEB 4GLSC 4DQOC 2N0SB 4ZYSA 3B2GA 1FNVA 3AB5A 4IKGA 1PFDA 1OQRA 5H8YE 1ZE3D 2Y5PA 3DWGC 1E9MA 4MH8A 3FILB 1SB3C 3EUB2 4HRSA 1FXAA 1D6EC 2PKOA 2BS2B 2LFIA 1ZOYB 4EE2A 1FFUA 1RFKA 1TS4A 2YEPB 1PGBA 3BZDB 1EU3A 2PW9A 2IPKD 1E7PB 1KFYB 2WXNA 4OZCA 2FE8A 4TQ1A 4C80A 3R2IA 3IT6B 1QKZA 1V1PB 2J52A 4YTNB 1C78A 1FRDA 2ONQA 2IGHA 4OHJA 5EE1A 1EM7A 4HJGE 1FXIA 5JXVA 1C4CA 1QOFA 4MT5A 1DYQA 2WXFA 2WXKA 4TSSA 3BWUD 1YN4A 2V0GA 4DXGA 3AEFB 1HEZE 2WXMA 2QIEB 3BIID 1KLGD 2IJ0A 4M0WA 4KX6B 1XLNA 2KMMA 2L32A 2IGGA 4L2YA 3P63A 1JWSD 1IUEA 2X38A 1WXQA 2INPE 2V3PA 3H8HA 5EE3A 1L0VB 4DXFA 4YTMB 2DYMA 1BXTA 4HEA1 3NS1A 2NTTA 1QQRA 2GRIA 2H88B 2VZKD 1GTHA 1OFFA 1VZ7A 2WXIA 2RDHA 4WAFA 2BS4B 3E9SA 1V8CA 3V05A 4RGOS 1GOZA 1I4QA 3BYYB 3P4PB 1JWAD 1K53A 1FMAD 4KGRA 1VDVA 1AN8A 5T8IA 5C2TB 4R3DA 4YSZB 3ZQ4A 1FFVA 4YT0B 2J4XA 4A9AA 3TEWA 2JWUA 1E6EB 1PDXA 3Q8EA 2M56B 2H89B 1DOYA 1MHHE 1IBXB 2ON8A 3AH7A 1L5PA 3L4PA 1KRHA 1TJEA 4RGTA 1VR9A 1SF0A 1L6VA 1L0XB 2BB5A 2ICIA 2FUG1 1JROA 2MEKA 3B9JA 4A55A 3RFZB 4AS1A 3C8YA 1XCQL 2BS3B 1BMLC 4LLGM 1P7FA 1MVKA 4A8XC 1V97A 2ACZB 1MPEA 4HKZE 5AUIA 1Y56A 2KAJA 2J53A 4ARCA 1JCKB 2AQ3B 4ITKA 2JYEA 4P6VF 1FD6A 4ZHOA 3VR8B 1JMLA 3AEBB 2YEPF 3I57A 3R2TA 5E6JA 1I4XA 3PZ7A 4NAWB 3CF4A 3AE9B 1XLQA 1TKEA 4N58A 2K9XA 1TS2A 2DLBA 3O13A 2IGDA 4FXCA 1SIJA 1F2RC 1J7AA 1TY2A 1OQQA 1XO3A 3VRBB 2HTME 3MFGA 3CWIA 2GB1A 2PLPA 2N9LA 1GTEA 1SE4A 5EE9A 2WXLA 1JQ4A 1Q10A 4LTUA 2E3TA 5D3DA 2RDGA 1QLBB 4MACA 2JYTA 2WU5B 1XCTL 3LB8C 3LXFA 3BVZA 2LHEA 2LEKA 4O1NA 3IT4B 3I9V1 1VJKA 3NRZA 2L52A 3R8BA 3U7ZA 1C79A 3BYTB 4US9A 3AE7B 1J7CA 1FRRA 3W5UB 3ZJVA 1VLBA 3NVYA 2WU2B 3TEZA 3VR9B 1MI0A 4YXDB 2BBCA 3ZJUA 3IAS1 4YSYB 2DWQA 1A70A 4IDIA 3ZJTA 1M4VA 1PGAA 2W3RA 3URYA 2JQRB 1B9RA 1SE3A 1FNWA 1K52A 1ROEA 1SXTA 1JWMD 2WS3B 1DOIA 4ZRQA 4P16A 4IOIE 1N61A 1J7BA 2HDEA 3GB1A 1TKGA 2TSSA 1N63A 4KKIA 2WQYB 1N5XA 2AQ1B 1TS3A 5HFYA 3AE8B 2EELA 2JZPA 3NVWA 2B76B 3BVGA 2BYTA 2WP9B 3AE5B 1ACCA 2QJLA 3T3NA 2V3NA 1I7HA 2WXJA 3Q69A 4ZOHC 4PT5A 5FR3A 3Q8CA 1MHXA 3HVZA 3KLSX 4N59A 1YMHE 1KF6B 3ABVB 1IGCA 2RPVA 3FC4A 5BYSA 2E6XA 1JALA 2LMCA 2L83A 3DWMA 5TSSA 1XEEA 1FCLA 2NMQA 3AE2B 4RNAA 4B0MA 1FO4A 5MPOA 1I4PA 1V1OA 2M0AA 1K50A 2GI9A 3AV8A 3TEXA 1YJIA 1EWYC 4NJCA 2WDRB 4RGNA 2LJIA 4ARIA 2W55A 1FM0D 1TY0A 2LUMA 3EA6A 3TSSA 2RMMA 1QOGA 1LO5D 3AECB 3SFEB 1IBXA 3Q8AA 3ZYYX 3P4QB 4XE0A 2FBWB 1XLPA 1ZP0B 1EWCA 3BK1A 5FK9C 2ZW1A 2L1AA 4UDUC 3GS2A 1TYGB 4WQMA 4XWTA 1JRPA 4JE3B 1FEHA 1PYWD 4JPSA 1RYJA 3KWLA 2N9KA 1YQ3B 1F2RI 2W3SA 4AQ7A 2JU6X 4NAMA 1QILA 3PO0A 1SSNA 1AYFA 3V3XA 4OZBA 2WXPA 4USAA 5G5GA 2K22A 1YN5A 1N5WA 5HHDG 5BYRA 2QEJC 2R61A 1WYGA 1RWSA 2WXOA 1QF6A 4NZLB 5HI1A 2Q5WD 2PVOD 2WNMA 2JXTA 4OVZA 4N6EB 1GB4A 3MC0B 4GDLB 1YNTE 3AE4B 1UWXA 1YN3A 5BMHA 1SJED
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WWT A;  4US9 A;  3CIR B;  3AE7 B;  1J7C A;  3AEF B;  1FRR A;  3W5U B;  1QOB A;  1VLB A;  3SFD B;  2WU2 B;  1ZUD 2;  1NEK B;  2QIE B;  3BII D;  3NVY A;  3P1M A;  3NVZ A;  4KX6 B;  3VR9 B;  1XLN A;  1YJJ A;  1N62 A;  1QT9 A;  2KMM A;  4YXD B;  1GT8 A;  2W54 A;  2CJN A;  3WCQ A;  3P63 A;  3HUI A;  3AEA B;  4YSY B;  1IUE A;  3VRA B;  1A70 A;  2DWQ A;  2PVG C;  1WXQ A;  4IDI A;  2WDQ B;  5EE3 A;  2PIA A;  2W3R A;  1L0V B;  2JQR B;  3P4S B;  1B9R A;  4YTM B;  1AWD A;  1CJE A;  4C7Y A;  3NS1 A;  3ETR A;  1ROE A;  2WS3 B;  1NVI D;  2H88 B;  1DOI A;  2K5P A;  4JX1 C;  4YTP B;  1RM6 C;  5G5H A;  1XLO A;  2MJD A;  1N61 A;  2DBY A;  1GTH A;  1OFF A;  4US8 A;  1J7B A;  1F0Z A;  1H7X A;  1TKG A;  3RPF C;  2BS4 B;  1N63 A;  2WQY B;  1N5X A;  1V8C A;  3SR6 A;  2M19 A;  1GPX A;  1PUT A;  3AE8 B;  2Y5C A;  1JW9 D;  2MJ3 A;  3P4P B;  3NVW A;  1WRI A;  2B76 B;  1JWA D;  2WP9 B;  3AE5 B;  1H7W A;  1FMA D;  1ZXI A;  1VDV A;  2QJL A;  3FAH A;  5C3J B;  2OHF A;  1I7H A;  5C2T B;  2MJE A;  4JWU C;  2JX5 A;  1WGK A;  3B2F A;  4YSZ B;  4ZOH C;  1NYQ A;  2MH7 A;  1FFV A;  4YT0 B;  4A9A A;  1E6E B;  1PDX A;  3HVZ A;  1T3Q A;  1TKY A;  2M56 B;  4N59 A;  2H89 B;  1QOA A;  1DOY A;  3AN1 A;  1KF6 B;  3ABV B;  3FC4 A;  1E0Z A;  3AH7 A;  1L5P A;  3L4P A;  1JAL A;  1KRH A;  1TJE A;  2G1E A;  3NVV A;  5EE0 A;  2L83 A;  2WLB A;  5AUK A;  1SF0 A;  1L6V A;  2AX5 A;  3DWM A;  1DOX A;  3AM9 A;  1CZP A;  5H92 C;  3AE2 B;  1JRO A;  3AE3 B;  3B9J A;  5GXG B;  1FO4 A;  5MPO A;  4ZHP A;  2EKI A;  2BS3 B;  1NI3 A;  1N60 A;  3AV8 A;  1YQ4 B;  2CJO A;  2CU3 A;  1YJI A;  1V97 A;  1EWY C;  4YSX B;  2ACZ B;  3AEE B;  2WDR B;  3P4R B;  2N0S B;  2KAJ A;  1JWB D;  1FM0 D;  3AE1 B;  2W55 A;  3B2G A;  5AUI A;  3AEG B;  3AB5 A;  1QOG A;  4JWS C;  1PFD A;  4ITK A;  1OQR A;  5H8Y E;  2BT6 A;  3AEC B;  4P6V F;  3DWG C;  3SFE B;  4C7Z A;  3VR8 B;  1E9M A;  4ZHO A;  1SB3 C;  3EUB 2;  3P4Q B;  3ZYY X;  4HRS A;  4WWM A;  1FXA A;  1UWM A;  3AEB B;  3AMZ A;  2FBW B;  1XLP A;  2PKO A;  2BS2 B;  1ZP0 B;  1NYR A;  1FIQ A;  3AE6 B;  3CF4 A;  1ZOY B;  3HRD D;  3AE9 B;  2WDV B;  1TKE A;  1TYG B;  1FFU A;  1XLQ A;  1JRP A;  2K9X A;  4N58 A;  1RFK A;  4FXC A;  4WQM A;  1SIJ A;  1NEN B;  1J7A A;  1XO3 A;  1OQQ A;  1RYJ A;  3KWL A;  3W9C B;  3VRB B;  1E7P B;  1KFY B;  1YQ3 B;  2HTM E;  2W3S A;  4HRO A;  1E10 A;  1R7S A;  1L6U A;  3CWI A;  3PO0 A;  4C80 A;  1AYF A;  1GTE A;  4USA A;  5EE9 A;  2K22 A;  5G5G A;  1JQ4 A;  4LTU A;  1N5W A;  2E3T A;  1DGJ A;  1WYG A;  4YTN B;  1RWS A;  1QLB B;  3AED B;  1FRD A;  1QF6 A;  3LB8 C;  2WU5 B;  5EE1 A;  2Q5W D;  2PVO D;  1GAQ B;  3LXF A;  3W5V B;  1FXI A;  1QOF A;  2LEK A;  4N6E B;  3AE4 B;  1VJK A;  3NRZ A;  2L52 A; 
#chains in the Genus database with same CATH topology
 3HVD A;  3X0W A;  3CIR B;  5IO9 A;  1IPG A;  4J3O D;  1QOB A;  4F1S A;  1HA5 A;  1LFD A;  1RAX A;  4B0E A;  4AJW A;  2AL3 A;  4ZRI A;  3UI3 A;  1NDD A;  2PIA A;  2KC1 A;  4FJV B;  2K5P A;  2BW2 A;  5E6N A;  5DCN A;  1OEY A;  2QIL A;  3H1U A;  2XNA C;  1WX8 A;  4B6W A;  3NOB A;  3FAH A;  4WH4 A;  1KJT A;  4KIK A;  3B2F A;  4WJP A;  2N4F A;  2N7E A;  4AP4 C;  3U4E G;  2K3U A;  3I5J C;  4W9I A;  3C19 A;  4G0N B;  4WWO A;  3MHZ A;  1E0Z A;  2G1E A;  1FPY A;  3JYU A;  2WLB A;  4EOY A;  5DPS A;  3HM6 X;  2K1F A;  2IO3 B;  3HK0 A;  5IKC M;  2SEB D;  2L0F A;  3PGE A;  4YSX B;  1EU4 A;  3P4R B;  3NUH B;  3AE1 B;  4JWS C;  2LD9 A;  1JWU D;  1AAR A;  1OEY J;  3UIN B;  2LGX A;  2YLM A;  1UWM A;  1L4D B;  2OED A;  3MJW A;  1NYR A;  2NCN A;  1KH0 A;  3HRD D;  1T0S C;  3TBL D;  4DK5 A;  1P7E A;  3L17 A;  2ZPN A;  1X1M A;  1T0Y A;  3PPA A;  1UH6 A;  1BUI C;  3SDL C;  2Y3A A;  1E10 A;  4DDI D;  2ZW0 A;  2M8S A;  2V4L A;  4MGK E;  1T6B X;  1CK1 A;  4KDI C;  2VH2 A;  3AED B;  1UD7 A;  2JF5 A;  4IWP A;  2KDF B;  2VRR B;  1I4G A;  2D10 A;  1GAQ B;  3H7P A;  4WUR A;  4TUU A;  5J18 A;  4Q2J A;  1WWT A;  2IZV B;  1WY8 A;  3W1S A;  3BK2 A;  1N62 A;  4EEW A;  5BMI A;  1C4P A;  3OWE B;  4MSM B;  4GB9 A;  3U52 E;  2L7R A;  2WXR A;  4RF1 A;  1CJE A;  4EKU A;  1NVI D;  2KJR A;  4YTP B;  4XDD A;  1D5X C;  5G5H A;  3TJP A;  4C4V B;  1FNU A;  2BF8 B;  3ENE A;  1H7X A;  4XZ4 A;  2IO2 B;  1KLV A;  4LNI A;  4OVU A;  2Y5C A;  2MJ3 A;  2KMA A;  3TEY A;  4L23 A;  2JSV X;  3NJT A;  2D07 B;  3Q8B A;  3O65 B;  5HKH A;  3QHT A;  1SE2 A;  5JHB A;  4AJY B;  2INC C;  4C56 C;  5IN7 A;  5J17 A;  5AUK A;  4H2A A;  5LNK 1;  2KAC A;  2KN4 A;  1CMX B;  1CQV A;  1N60 A;  2CJO A;  2C60 A;  4DBG A;  4XWW A;  2JUO A;  2N7J A;  4GLS C;  2XK5 B;  1NBF C;  2N0S B;  3B2G A;  1Q0W B;  3RD2 A;  1PFD A;  2G4D B;  2Z59 B;  4MH8 A;  4HRS A;  1GJZ A;  1WZ0 A;  3PZD A;  4CO7 A;  1ZOY B;  1V80 A;  2L76 A;  4YL8 A;  4HPP A;  3R66 C;  1TS4 A;  4HJK A;  1V49 A;  3BZD B;  1E7P B;  5KHQ A;  1YD8 U;  4C80 A;  4GSW A;  3R2I A;  4KDL B;  1WIA A;  1V1P B;  2M1M A;  4HK2 A;  3VH4 B;  4YTN B;  2BKR B;  2IGH A;  4OHJ A;  1WMH A;  4HDO A;  5JXV A;  2BYV E;  1DYQ A;  5GMV A;  2KNB A;  4F7Z A;  3H7S A;  4TSS A;  1WXA A;  2V0G A;  2BWF A;  5LLI A;  2REX A;  2WXM A;  2DZI A;  2QIE B;  4NQL B;  1KLG D;  2IO1 B;  4KX6 B;  3RI7 C;  2KAN A;  3DHG C;  2KDE B;  1H8C A;  4MEL A;  2L00 B;  4BOS C;  4MGI E;  2LGS A;  3L0W B;  1LQB A;  1KM7 A;  2VZK D;  1LXD A;  2KVR A;  2C5L C;  2VH1 A;  3E9S A;  2UU7 A;  2MQJ A;  4EZJ A;  3I63 C;  1VDV A;  5T8I A;  5C2T B;  4R3D A;  4YSZ B;  2KQS A;  1P0R A;  4YT0 B;  2J4X A;  4A9A A;  2JWU A;  3U30 A;  1E6E B;  3WIM A;  1MHH E;  3AH7 A;  1L5P A;  5AZG A;  3PRZ A;  1KRH A;  3JSV A;  3CMM B;  1VR9 A;  3GE8 C;  2BB5 A;  3N30 A;  4J6I A;  1JRO A;  2MEK A;  5BO4 B;  4A8X C;  1P7F A;  4E3C A;  1V97 A;  2X8X X;  4HKZ E;  1Y56 A;  3PV1 A;  3WAN A;  4ZHO A;  3VR8 B;  3A4R A;  1WJ4 A;  1JML A;  2MBB B;  4II3 B;  1WJN A;  2AYO B;  3EFC A;  1TKE A;  3Q3J A;  4ICV A;  1TS2 A;  1F2R C;  3RN9 C;  2AWT A;  3NHE B;  4G11 A;  3C0R B;  2GB1 A;  1JQ4 A;  2RDG A;  1QLB B;  3LB8 C;  4BBN C;  2PPH A;  5JH5 C;  3DHH C;  4RMA A;  1YIW A;  1UF0 A;  2N1W A;  3I9V 1;  2M4N A;  3NRZ A;  2L52 A;  3NG0 A;  3R8B A;  3W5U B;  1IP9 A;  3PSE B;  3NVY A;  2NPT A;  2IYD B;  2J0J A;  1MI0 A;  3ZJU A;  1F52 A;  3HM3 A;  4KIK B;  4YSY B;  3GE3 C;  2L8J A;  3M95 A;  3ZJT A;  2EMS A;  5DPW A;  1SE3 A;  1F9J A;  1ROE A;  2HD5 B;  1DOI A;  4ZRQ A;  1WR6 E;  2XEW A;  3GB1 A;  3VTU A;  4IM2 A;  1N5X A;  2AQ1 B;  3MC9 A;  2PJH A;  2EEL A;  2JZP A;  3NVW A;  4BFR A;  1I7H A;  3Q69 A;  1R4N B;  3VUY A;  5E6P A;  2CHZ A;  4ASW C;  1GC6 A;  3ABV B;  3FC4 A;  5BYS A;  2KFK A;  3R3M A;  5TSS A;  1XEE A;  3AE2 B;  4RNA A;  1WX9 A;  1OQY A;  3Q3M C;  3EEC A;  4RGN A;  2LJI A;  4ARI A;  3JVZ X;  2W55 A;  2LUM A;  1EF5 A;  3TSS A;  2RMM A;  1QOG A;  3AEC B;  2KTF A;  4PK1 A;  4ZRJ A;  3ZYY X;  4XE0 A;  4C4V A;  3H7P B;  3L13 A;  1E7V A;  1TT5 B;  3PRM B;  2HTH A;  2L1A A;  3DBS A;  3CF6 E;  2L05 A;  4A3O A;  1V9J A;  1RYJ A;  1UGM A;  2N9K A;  2ZVO A;  2GBM A;  1QIL A;  2NS5 A;  4NQK E;  2WXO A;  4NZL B;  4ICU A;  2OJR A;  2LVQ A;  2K39 A;  4N6E B;  4OVZ A;  1YNT E;  3AE4 B;  4X57 B;  2HE7 A;  4C00 A;  3IXS A;  1D5Z C;  3KWV A;  3Q8F A;  4JGH B;  1AW7 A;  1T5X D;  1UNS A;  2K25 A;  2LAS A;  4DHZ B;  2LGI A;  4BZA A;  3IFW B;  1F77 A;  4RCO A;  4E71 A;  2ASQ A;  1RLF A;  2LI5 A;  2V9H A;  1D4B A;  4WQO B;  2V3S A;  1F0Z A;  2D2Q A;  2IDY A;  4IM3 A;  4K7W A;  4GGQ A;  3CST A;  1SEB D;  4TQ0 A;  4K7U A;  1WR1 A;  4XDC A;  2MH7 A;  1V1P A;  1MG8 A;  5CTR C;  3TUO A;  4RFB A;  2RD0 A;  2QHO A;  1ZPS A;  3RNC C;  2VZK B;  1CZP A;  4REZ A;  4W9J A;  2INN E;  3EGR A;  2JY6 A;  3RUI B;  3DQV A;  2NTS A;  3NZ3 A;  1JWB D;  1D5M C;  3AEG B;  3ZNG C;  2BT6 A;  3RUL A;  2J42 A;  2KWD A;  3AMZ A;  4ZRP A;  4NJ7 A;  4W9L A;  1E5W A;  2KWU B;  4DHJ D;  1NEN B;  3QX1 A;  2R2O A;  3WAL A;  1K51 A;  4WAA A;  2R2Q A;  1L6U A;  3VFK A;  5BYQ A;  3HHM A;  4KGT A;  2BWE S;  1DGJ A;  1UUP A;  5J2R A;  1ZKH A;  4M8N A;  3KUD B;  1P1A A;  2K6D B;  2KQ4 X;  1ZDX A;  2GBK A;  2L3Z A;  3NVZ A;  1TS5 A;  1YJJ A;  4ZHP A;  1GT8 A;  2CJN A;  1KOT A;  3AEA B;  2KT7 A;  3K9O B;  5TR5 A;  3L16 A;  3P4S B;  2MP2 A;  2PMV A;  2Z0E B;  1NI2 A;  1R4M I;  2MJD A;  1TBE A;  1FCC C;  4L1B A;  3RPF C;  3JSV B;  5I4D A;  1HTO A;  1GPX A;  3A9K A;  2G45 B;  1V6E A;  1TZ1 A;  2I1K A;  2OHF A;  2MJE A;  3T3O A;  2GBN A;  1LGR A;  4GOC A;  1T3Q A;  2D5G A;  4HWI B;  4PS7 A;  5HG2 A;  4RM9 A;  3VTV A;  2MX2 A;  2QMT A;  2Z8L A;  3E56 A;  3AM9 A;  1HZ6 A;  4CQN A;  1B1Z A;  2HJ1 A;  2CHX A;  4RF0 A;  3AEE B;  2KO3 A;  4IG7 B;  4B9K A;  3ZNZ B;  4W9G A;  3QAQ A;  3DVN U;  3EHV A;  1E9M A;  3FIL B;  3APF A;  1FXA A;  1T0Q C;  5C1Z A;  2LFI A;  3RNF C;  4I6N B;  1FFU A;  2RPQ A;  3H6N A;  5EDS A;  1EU3 A;  2PW9 A;  2NPT B;  3ZTD A;  1KFY B;  1VD2 A;  4OZC A;  1S1Q B;  1GNU A;  3GZN B;  1QKZ A;  1C78 A;  2N1V A;  2ONQ A;  1EM7 A;  4HJG E;  2NVU I;  1FXI A;  1C4C A;  1QOF A;  4MT5 A;  3BY4 B;  3KW5 B;  5JHA A;  2KC2 A;  3AEF B;  1HEZ E;  4OVV A;  3ECI A;  3IG3 A;  1IUE A;  2X38 A;  2ZNV C;  2K8H A;  3DVN V;  1WXQ A;  2INP E;  2KOX A;  3QQ8 B;  1Z2M A;  5EE3 A;  4M8M A;  3NS1 A;  2NTT A;  3RMK C;  4GDK A;  1PQS A;  3WAO A;  4DWF A;  1GTH A;  1OFF A;  4HCN B;  4WAF A;  2DZK A;  2ZEQ A;  1V8C A;  2KFK B;  1V5O A;  1GOZ A;  3BYY B;  1K53 A;  2Z0D B;  1E7U A;  2M0X A;  1FMA D;  3V62 A;  2J7Q B;  4KVG B;  1N6Z A;  2QDF A;  3PRP B;  4HPL B;  2UYZ B;  1VCB A;  2M56 B;  2H89 B;  2BVC A;  3W1Y A;  2ON8 A;  2C7H A;  2RSU A;  2DAF A;  3EC8 A;  3B9J A;  4A55 A;  4AS1 A;  1C1Y B;  2BS3 B;  1BML C;  4BKS A;  1MVK A;  3ZRF A;  1UEL A;  2ACZ B;  2GMI C;  2CS4 A;  3ZXR A;  4ARC A;  1JCK B;  2AQ3 B;  2MBE A;  3R2T A;  1I4X A;  3RT3 B;  3CF4 A;  3UIO B;  3VVW B;  3X23 A;  3N1X C;  2DLB A;  4FXC A;  3MHS D;  1J7A A;  1OQQ A;  3MFG A;  2FCQ A;  2KJ6 A;  1GUA B;  2WHI A;  2N9P C;  1GTE A;  5EE9 A;  1Q10 A;  3LDZ E;  4PYZ A;  3AI5 A;  4MAC A;  1XCT L;  3NY5 A;  2BYF A;  4ANX A;  3PTF C;  3U7Z A;  1C79 A;  4KSL C;  1IYF A;  4BKS D;  4DHJ B;  3VR9 B;  2CKH B;  4YXD B;  2WGS A;  3ZTC A;  3Q3N C;  2DWQ A;  1XQQ A;  4KSK C;  1PGA A;  2K8C A;  1JWM D;  2HDE A;  2O6V A;  2KXJ A;  1YQB A;  4K3B A;  3M62 B;  3EFU A;  3AE8 B;  3BVG A;  4FUL A;  3AE5 B;  2BYT A;  1L2N A;  3KYC D;  3Q8C A;  1MHX A;  2B3A A;  1TGZ B;  2Y5B B;  1YMH E;  3OLM D;  1U4A A;  2BQQ A;  4MEM A;  1K8R B;  3MTN B;  2L83 A;  2RDB C;  3ZLZ A;  2NMQ A;  1FO4 A;  4B0M A;  4EUT A;  1V1O A;  4P1C C;  3V6E B;  1K50 A;  2GI9 A;  3AV8 A;  4ZRK A;  1G6J A;  2MRP A;  1YJI A;  2OJW A;  1YX6 B;  3VH3 B;  1WJU A;  1TY0 A;  1J19 A;  2CR5 A;  3APC A;  3QA8 A;  3GZN I;  3T9L A;  2DAJ A;  5G55 A;  1IBX A;  3V60 A;  4JIO U;  2DEN B;  2O6V D;  5AZH A;  3RZW C;  3TL5 A;  5LXH A;  1JRP A;  4JE3 B;  1FEH A;  4WJO A;  1PYW D;  2KKC A;  2W3S A;  5D6J B;  2L0T A;  4OZB A;  1WXS A;  2R61 A;  1WYG A;  2WNM A;  2MP2 B;  1GB4 A;  3MC0 B;  4NAW A;  1UWX A;  3ZUN A;  3KUC B;  1C3T A;  1KLU D;  1ZUD 2;  1VZ6 A;  3P1M A;  3A9K B;  2WXG A;  2DNF A;  2QSD A;  2JZ3 B;  1ZDV A;  4KKJ A;  4A3P A;  1AWD A;  3FIL A;  1P98 A;  3DBR I;  4C7Y A;  2W82 A;  2KWC A;  1XLO A;  3VQI A;  2DBY A;  2GBJ A;  4A6Q A;  2KDM A;  3KQ4 A;  3VTW A;  3ZIM A;  5FKA C;  3ZGZ A;  4LJO B;  1WRI A;  2D11 A;  5BMG A;  2I38 A;  2JPH A;  1XT9 B;  2LXA A;  4W9F A;  4HVB A;  1SIF A;  3SEB A;  1I4R A;  2DYO A;  4BAX A;  3IAM 1;  2FID A;  3AN1 A;  2J0M A;  3Q14 C;  1ESF A;  3SU8 X;  2XBB C;  1DOX A;  5GXG B;  3MP9 A;  2UWQ A;  4WIP A;  1YQ4 B;  2A5U A;  3RZF A;  3BIN A;  1L0Y B;  3M3J A;  5CHF A;  3UQA A;  1STE A;  4WJN A;  2LUE A;  4MSQ B;  1IGD A;  1R4M B;  1Y8R C;  3R7Q A;  4AUQ C;  1FIQ A;  2QCZ A;  1ENF A;  3KVF B;  4LDT B;  2I1J A;  1MJD A;  3R7R A;  3W9C B;  4FAD A;  1V86 A;  4HRO A;  3FKY A;  1TZO A;  4PS8 A;  3ZDT A;  4OW0 A;  3B08 A;  3OAW A;  2A4Z A;  3DBH I;  2FNJ B;  3W5V B;  2WXH A;  2N7D A;  3J9C A;  1GC7 A;  3PHW B;  4GDK B;  5D7G A;  1SBB B;  4RM8 A;  4D2K A;  3W2D A;  3P42 A;  5D94 A;  1HQR D;  2N9X A;  3U2S C;  2O2V A;  4IWQ A;  1PGX A;  4XX5 A;  2PVG C;  1GB1 A;  1WE6 A;  2K0P A;  3RNB C;  4II2 B;  2WXQ A;  3ETR A;  3RCZ A;  3MJ5 A;  1SE9 A;  4GDL A;  4JX1 C;  1RM6 C;  2ZZP B;  4US8 A;  3B0A A;  4CHK A;  4DHZ E;  2M19 A;  1PUT A;  3Q6B A;  4YWG G;  5C3J B;  4JWU C;  1ISN A;  2JX5 A;  1WGK A;  1J8C A;  1NYQ A;  3DVG Y;  4JLC A;  4E74 A;  3AU4 A;  4WJQ A;  1TKY A;  1FXT B;  4NJ6 A;  1XD3 B;  1F1H A;  1WYW B;  2SAK A;  4WWP A;  4K1R B;  3NVV A;  2QC8 A;  1ET6 A;  2G3Q B;  5CHW A;  4BVU C;  3PZ8 A;  2CU3 A;  2KLG A;  3LYY A;  2KDB A;  3QC8 B;  4DQO C;  4ZYS A;  5L95 C;  3AB5 A;  1UBI A;  1WF9 A;  4TKN A;  3ZXV A;  3DWG C;  1SB3 C;  1D6E C;  3ZW3 A;  2BS2 B;  3S2A A;  3RNE C;  4I6L B;  4ZDV A;  1ZW7 A;  4IWO A;  5C23 A;  2FCS A;  2WXN A;  1WGR A;  2FE8 A;  2MW5 A;  4LNK A;  4TQ1 A;  2LWP A;  3IT6 B;  1ZGU B;  2KZR A;  2J52 A;  1FRD A;  2NBU A;  4MM3 A;  5EE1 A;  4GXB A;  4HPM B;  1Z5S B;  4AOF A;  3KH0 A;  1P3Q U;  3BWU D;  2O6V B;  1YN4 A;  3V61 A;  2MHJ A;  4W9H A;  2M17 A;  3BII D;  4P7I A;  4HCP B;  4M0W A;  2W9N A;  3VDZ A;  1XLN A;  4L2Y A;  2IGG A;  2C9W B;  3P63 A;  1JWS D;  2V3P A;  3H8H A;  2JVC A;  4YTM B;  1UBQ A;  4ANW A;  4HEA 1;  4M02 A;  1QQR A;  2GRI A;  2DZM A;  4K7S A;  1VZ7 A;  2WXI A;  2RDH A;  2BS4 B;  2KTR A;  4RGO S;  3P4P B;  3ALB A;  1AN8 A;  4LNN A;  1S3S G;  3ZQ4 A;  4IC7 B;  4MJS A;  3ZVV A;  3TEW A;  1PDX A;  3QIJ A;  1DOY A;  3A1Q A;  1IBX B;  1E8W A;  3APD A;  1TJE A;  4W9D A;  1V2Y A;  3C8Y A;  4CYE A;  2FAZ A;  2C7M B;  2IND C;  4XYC A;  1WGD A;  2LRU A;  3QWZ B;  2KAJ A;  4XGA B;  3MC8 A;  2BPS A;  3DBL I;  4P6V F;  1FD6 A;  2BYE A;  1OGW A;  3PT2 B;  3AEB B;  4DDG D;  3I57 A;  2KMC A;  3OG5 A;  4NAW B;  1E8X A;  1XLQ A;  2BGF A;  3A9J B;  3O13 A;  1SIJ A;  3VXW A;  1TY2 A;  4URK A;  3VRB B;  3QCA A;  2MSE D;  2CU1 A;  2IY0 B;  2E3T A;  5D3D A;  3GOE A;  5L83 A;  1RFA A;  4EFO A;  2JYT A;  2WU5 B;  5D2M B;  3LXF A;  3BVZ A;  1D3Z A;  1YJ1 A;  2LHE A;  1T0R C;  4O1N A;  3IT4 B;  1VJK A;  1WZ3 A;  1A5R A;  4K81 A;  2JRI B;  3BYT B;  4P1B C;  1J7C A;  1FRR A;  2WU2 B;  3ZDM C;  1E8Z A;  4M01 A;  4M00 A;  2BBC A;  4BBN F;  3N1Y C;  1A70 A;  4IDI A;  1V5T A;  1M4V A;  2FUH B;  3VUX A;  2KLC A;  3DOW A;  2W3R A;  4ACF A;  3URY A;  2JQR B;  2LGD A;  1MFW A;  3RNG C;  4FLH A;  1TKG A;  2D3G A;  2TSS A;  5DPT A;  1TS3 A;  2B76 B;  2JXX A;  5AEK B;  2WP9 B;  1ACC A;  5FR6 A;  1QZE A;  2V3N A;  2WXJ A;  3K9P B;  2N9E B;  4ZOH C;  5FR3 A;  4HDQ A;  3HVZ A;  2HJ8 A;  4PYU A;  1WM3 A;  4KV2 A;  4MGY E;  2KDI A;  2RPV A;  2IBI B;  3I3T B;  2E6X A;  2LMC A;  3ZKJ C;  1FCL A;  1I4P A;  2M0A A;  4WWN A;  2K8B A;  1EWY C;  2D3A A;  4NJC A;  3A33 B;  4FHJ A;  1FM0 D;  2WYQ A;  3DBR B;  3VAW A;  2WDT B;  3Q8A A;  1EO6 A;  3ZNH B;  2FBW B;  1XLP A;  2ZW1 A;  4UDU C;  1TYG B;  4LDT D;  4WQM A;  4XWT A;  4JPS A;  3IHP C;  1F2R I;  2O2V B;  4AQ7 A;  4PS3 A;  2WX1 A;  1AYF A;  4USA A;  2K22 A;  1N5W A;  5HHD G;  5BYR A;  2AEH A;  1QF6 A;  5HI1 A;  2PE6 B;  4GDL B;  2ZJD A;  1YN3 A;  1WFY A;  5BMH A;  2FCM A;  3AU5 A;  2LHD A;  3OJ3 A;  2KWV B;  4GN1 A;  3SFD B;  3SR6 A;  1QT9 A;  2W54 A;  4AWJ A;  3WCQ A;  2EKE C;  1EUV B;  1WXV A;  4LK0 M;  2WDQ B;  2DHZ A;  4KGS A;  4BOZ B;  1OTR B;  1KTK A;  1SJH D;  4ANV A;  2ZVN A;  1WGY A;  1XXG A;  1YOV B;  3LJ3 A;  4A90 A;  2PE9 A;  1WH3 A;  3PVL A;  2XN9 C;  1H7W A;  1WRD B;  2G4S A;  2GBR A;  1SGH A;  3VHT C;  4FHK A;  3DBH B;  5IP4 D;  1RRB A;  1L4Z B;  4GIV A;  2NR2 A;  1ZXH A;  3UIP B;  1WJ6 A;  2G9H D;  1C9F A;  2KYW A;  1JRU A;  1UGJ A;  5H92 C;  4KZC A;  2JRH A;  1C4A A;  1J0G A;  2ZCB A;  3QAR A;  3W1S C;  5LXI B;  3DPD A;  5JZE B;  3DVG X;  2C7N B;  3UGB B;  4RGM A;  2BTE A;  2KD0 A;  4S0R A;  4TV3 A;  2PTL A;  4C7Z A;  1BT0 A;  1HXY D;  4MM3 B;  4WWM A;  2KX0 A;  2BB6 A;  3AE6 B;  2WDV B;  1C76 A;  1MG4 A;  3NS8 A;  3ZRC A;  2AQ2 B;  2D3B A;  1VRA B;  1VZ8 A;  1ET9 A;  4M0W B;  1R7S A;  2IY1 B;  3PRE A;  2WWZ A;  2LJ5 A;  4OZA A;  3L54 A;  5D3I B;  3DCG A;  4HKQ A;  2JT4 B;  4XC2 A;  3KUZ A;  4KZ0 A;  3RYT A;  4TMA B;  4DXA B;  5G2N A;  2KTR B;  4EZK A;  4RH6 A;  1NEK B;  5E6O A;  3N9Y C;  3HUI A;  2MA9 B;  3VRA B;  4G3X B;  4FN2 A;  4FJY A;  4LCD E;  1I42 A;  2AL6 A;  4NY0 A;  2V4I B;  4MJS B;  3GP7 A;  3U7D A;  1HZ5 A;  2KVZ A;  2LRW A;  2MBO A;  3A1Q B;  3Q3O C;  1I4H A;  3SD5 A;  4MGZ E;  2NBW B;  1WXM A;  3A9J A;  1JW9 D;  3UQB A;  4HXD A;  1UZX B;  1ZXI A;  2K6Q A;  4BKT A;  2ZNV B;  1TIF A;  1QOA A;  1WGG A;  1XF5 L;  3L08 A;  2KFJ A;  5EE0 A;  2AX5 A;  2I2Y A;  1C77 A;  1WSP A;  3AE3 B;  4I6P A;  2GLS A;  2EKI A;  1NI3 A;  1Q5W B;  3BVM A;  2YVC A;  2KK8 A;  4NPN A;  1TTN A;  2KN5 A;  1FNV A;  3IBE A;  1LM8 B;  4IKG A;  4NNJ B;  1OQR A;  5H8Y E;  1ZE3 D;  3TCA A;  2Y5P A;  4FBJ B;  3EUB 2;  4IW0 A;  2JWZ A;  2PKO A;  3WAM A;  1WI0 A;  2WX0 A;  3N32 A;  4EE2 A;  1RFK A;  2YEP B;  1PGB A;  2ZPY A;  2IPK D;  1V81 A;  4N9F 4;  3PHX B;  4G50 A;  2RR9 A;  2LXC A;  1E90 A;  2MCN B;  5DPR A;  5KHO A;  5IAA C;  2FCN A;  2WXF A;  2WXK A;  1I35 A;  4DXG A;  3A4S C;  1H4R A;  3M63 B;  2IJ0 A;  1E8Y A;  2KMM A;  2L32 A;  3DBL B;  4GU2 A;  1L0V B;  4DXF A;  3HIZ A;  2DYM A;  1BXT A;  3RNA C;  3ZO5 B;  4FA6 A;  2H88 B;  2CHW A;  1HE8 A;  4S17 A;  1Q1O A;  3UF8 A;  2MBH A;  4GMV A;  3V05 A;  1I4Q A;  3TMP B;  1JWA D;  2DX5 B;  4KGR A;  3NZS A;  1WX7 A;  1M94 A;  2MLB A;  3CSF A;  3PS6 A;  1FFV A;  2DZJ A;  3DDC B;  4HLE A;  3Q8E A;  2JZZ A;  1L7Y A;  1GG3 A;  3ML8 A;  1WM2 A;  3P2B A;  3L4P A;  4RGT A;  1SF0 A;  1L6V A;  1L0X B;  2ICI A;  3SHQ A;  3N3K B;  2FUG 1;  3RFZ B;  1P9D U;  1XCQ L;  4LLG M;  4FJZ A;  3JW0 X;  4LNF A;  1MPE A;  5AUI A;  2J53 A;  3T8M A;  2KJH B;  4ITK A;  2JYE A;  2LVO A;  4IUM B;  4BKG A;  2YEP F;  4MH0 E;  5E6J A;  3PZ7 A;  2LGY A;  3AE9 B;  3U8Z A;  5IA7 A;  4N58 A;  3QK0 A;  2MWS B;  2K9X A;  2IGD A;  2FIF A;  5CX3 A;  1XO3 A;  3AUL A;  2XK5 A;  2HTM E;  4ZYN A;  2V1Y A;  3TIX A;  3CWI A;  2PLP A;  2N9L A;  3IVF A;  1SE4 A;  3DHI C;  2WXL A;  3ONS A;  4LTU A;  4IM0 A;  4LNO A;  1HTQ A;  3VUW A;  3Q3F A;  2LEK A;  2PEA A;  4MDK E;  3ML9 A;  4US9 A;  3AE7 B;  3ZJV A;  1VLB A;  3TEZ A;  1EF1 A;  4JQW C;  5IOI A;  3IAS 1;  2LZ6 A;  2NBV B;  1B9R A;  1FNW A;  1K52 A;  1SXT A;  2J0K A;  2WS3 B;  3PLU A;  4P16 A;  4IOI E;  1N61 A;  3WAP A;  1J7B A;  1N63 A;  4KKI A;  2WQY B;  4W9K A;  5HFY A;  1WGH A;  2KX3 A;  3N1Z C;  4K3C A;  2QJL A;  3T3N A;  3L10 B;  3D32 A;  3H9D A;  2RGF A;  3PLV A;  4PT5 A;  4EZL A;  2ZCC A;  2DYB A;  4W9C A;  3KLS X;  5AZF A;  4N59 A;  4B95 A;  3Q2A C;  1WMH B;  1KF6 B;  2OOB B;  1IGC A;  3AXC A;  2KHW B;  4ANU A;  1JAL A;  3DWM A;  2BKF A;  2LVP A;  5CHV C;  4JL9 A;  5MPO A;  3N20 C;  3TEX A;  4LJP B;  4W9E A;  2WDR B;  3EA6 A;  3V6C B;  3KYD D;  3B1L X;  1LO5 D;  3SFE B;  2D3C A;  3P4Q B;  2KQ7 A;  3ZNI D;  2MBQ A;  1ZP0 B;  1EWC A;  3BK1 A;  5FK9 C;  1YX5 B;  3GS2 A;  4F8C B;  3KWL A;  3OJ4 B;  3NZU A;  1YQ3 B;  4QAY A;  3WA0 A;  2JU6 X;  4NAM A;  3PO0 A;  1SSN A;  4A20 A;  3V3X A;  2WXP A;  5G5G A;  1YN5 A;  3QJZ A;  2IO0 B;  2GOW A;  2QEJ C;  1RWS A;  1R4N I;  2EMT A;  2Q5W D;  2PVO D;  2JXT A;  1SJE D;  1WE7 A; 
#chains in the Genus database with same CATH homology
 3HVD A;  3IXS A;  1D5Z C;  3KWV A;  3CIR B;  2LHD A;  3Q8F A;  4J3O D;  1AW7 A;  1KLU D;  1QOB A;  1T5X D;  3SFD B;  1ZUD 2;  1VZ6 A;  1UNS A;  3P1M A;  1HA5 A;  2WXG A;  3SR6 A;  1QT9 A;  2W54 A;  2LGI A;  3WCQ A;  4B0E A;  4LK0 M;  2QSD A;  3UI3 A;  2WDQ B;  1F77 A;  2PIA A;  4RCO A;  4KGS A;  1ZDV A;  4KKJ A;  1AWD A;  3FIL A;  1SJH D;  1KTK A;  4C7Y A;  2W82 A;  2K5P A;  1D4B A;  1XLO A;  3VQI A;  2BW2 A;  2DBY A;  1F0Z A;  4A6Q A;  1XXG A;  2KDM A;  2QIL A;  3KQ4 A;  4A90 A;  3ZGZ A;  5FKA C;  2IDY A;  2XNA C;  1WRI A;  2XN9 C;  1H7W A;  1SEB D;  3FAH A;  4WH4 A;  4TQ0 A;  5BMG A;  2I38 A;  3B2F A;  4XDC A;  2MH7 A;  1V1P A;  3U4E G;  2K3U A;  3TUO A;  4RFB A;  3SEB A;  1I4R A;  2DYO A;  3IAM 1;  3AN1 A;  1ZPS A;  1L4Z B;  3MHZ A;  1ESF A;  1E0Z A;  1ZXH A;  2G9H D;  2G1E A;  2VZK B;  1C9F A;  1DOX A;  2WLB A;  1CZP A;  1UGJ A;  4REZ A;  2INN E;  3EGR A;  5H92 C;  5GXG B;  3MP9 A;  1C4A A;  2SEB D;  4WIP A;  1YQ4 B;  4YSX B;  1L0Y B;  1EU4 A;  3P4R B;  2NTS A;  3NUH B;  3NZ3 A;  1JWB D;  3AE1 B;  1D5M C;  3AEG B;  4JWS C;  4RGM A;  1STE A;  2BTE A;  2BT6 A;  1JWU D;  2PTL A;  4C7Z A;  1IGD A;  1HXY D;  2J42 A;  4MM3 B;  4WWM A;  1UWM A;  2KWD A;  3AMZ A;  1L4D B;  2OED A;  1NYR A;  2BB6 A;  1FIQ A;  3AE6 B;  1KH0 A;  4ZRP A;  3HRD D;  2WDV B;  1P7E A;  1ENF A;  1C76 A;  1NEN B;  2AQ2 B;  1VRA B;  3W9C B;  1VZ8 A;  1BUI C;  1ET9 A;  1K51 A;  2Y3A A;  4HRO A;  1R7S A;  2ZW0 A;  1L6U A;  1E10 A;  5BYQ A;  1TZO A;  4KGT A;  1T6B X;  1CK1 A;  1DGJ A;  4OW0 A;  1UUP A;  3AED B;  4OZA A;  1I4G A;  1GAQ B;  3W5V B;  5D3I B;  4WUR A;  2WXH A;  3J9C A;  4GDK B;  5D7G A;  1SBB B;  4D2K A;  2KQ4 X;  4HKQ A;  4Q2J A;  1WWT A;  1ZDX A;  3P42 A;  3W2D A;  4TMA B;  4RH6 A;  1HQR D;  3U2S C;  1NEK B;  3W1S A;  3NVZ A;  1TS5 A;  1YJJ A;  4ZHP A;  3BK2 A;  1N62 A;  1GT8 A;  1PGX A;  2CJN A;  3N9Y C;  5BMI A;  3HUI A;  3AEA B;  2PVG C;  1GB1 A;  3VRA B;  1C4P A;  3OWE B;  2V4I B;  3GP7 A;  3U52 E;  3P4S B;  2K0P A;  2WXR A;  4RF1 A;  1HZ5 A;  1CJE A;  2PMV A;  2WXQ A;  3ETR A;  3MJ5 A;  1NVI D;  4JX1 C;  4YTP B;  1RM6 C;  1D5X C;  4XDD A;  5G5H A;  1I4H A;  2MJD A;  1FCC C;  4US8 A;  1FNU A;  1H7X A;  4L1B A;  3RPF C;  5I4D A;  2M19 A;  1GPX A;  1PUT A;  2Y5C A;  1JW9 D;  2MJ3 A;  3TEY A;  4L23 A;  1ZXI A;  4YWG G;  2JSV X;  5C3J B;  2OHF A;  3Q8B A;  4JWU C;  2MJE A;  2JX5 A;  1WGK A;  3T3O A;  1NYQ A;  1SE2 A;  1T3Q A;  1TKY A;  2D5G A;  1QOA A;  2SAK A;  1XF5 L;  5HG2 A;  4C56 C;  3NVV A;  2QMT A;  2Z8L A;  4H2A A;  5AUK A;  3E56 A;  5EE0 A;  1ET6 A;  2AX5 A;  3AM9 A;  5LNK 1;  1HZ6 A;  4CQN A;  1B1Z A;  2KAC A;  2KN4 A;  2I2Y A;  1C77 A;  1WSP A;  3AE3 B;  3PZ8 A;  1CQV A;  2EKI A;  1NI3 A;  1N60 A;  4RF0 A;  2CJO A;  2CU3 A;  4XWW A;  3BVM A;  2N7J A;  3LYY A;  3AEE B;  4GLS C;  4DQO C;  2N0S B;  4ZYS A;  3B2G A;  1FNV A;  3AB5 A;  4IKG A;  1PFD A;  1OQR A;  5H8Y E;  1ZE3 D;  2Y5P A;  3DWG C;  1E9M A;  4MH8 A;  3FIL B;  1SB3 C;  3EUB 2;  4HRS A;  1FXA A;  1D6E C;  2PKO A;  2BS2 B;  2LFI A;  1ZOY B;  4EE2 A;  1FFU A;  1RFK A;  1TS4 A;  2YEP B;  1PGB A;  3BZD B;  1EU3 A;  2PW9 A;  2IPK D;  1E7P B;  1KFY B;  2WXN A;  4OZC A;  2FE8 A;  4TQ1 A;  4C80 A;  3R2I A;  3IT6 B;  1QKZ A;  1V1P B;  2J52 A;  4YTN B;  1C78 A;  1FRD A;  2ONQ A;  2IGH A;  4OHJ A;  5EE1 A;  1EM7 A;  4HJG E;  1FXI A;  5JXV A;  1C4C A;  1QOF A;  4MT5 A;  1DYQ A;  2WXF A;  2WXK A;  4TSS A;  3BWU D;  1YN4 A;  2V0G A;  4DXG A;  3AEF B;  1HEZ E;  2WXM A;  2QIE B;  3BII D;  1KLG D;  2IJ0 A;  4M0W A;  4KX6 B;  1XLN A;  2KMM A;  2L32 A;  2IGG A;  4L2Y A;  3P63 A;  1JWS D;  1IUE A;  2X38 A;  1WXQ A;  2INP E;  2V3P A;  3H8H A;  5EE3 A;  1L0V B;  4DXF A;  4YTM B;  2DYM A;  1BXT A;  4HEA 1;  3NS1 A;  2NTT A;  1QQR A;  2GRI A;  2H88 B;  2VZK D;  1GTH A;  1OFF A;  1VZ7 A;  2WXI A;  2RDH A;  4WAF A;  2BS4 B;  3E9S A;  1V8C A;  3V05 A;  4RGO S;  1GOZ A;  1I4Q A;  3BYY B;  3P4P B;  1JWA D;  1K53 A;  1FMA D;  4KGR A;  1VDV A;  1AN8 A;  5T8I A;  5C2T B;  4R3D A;  4YSZ B;  3ZQ4 A;  1FFV A;  4YT0 B;  2J4X A;  4A9A A;  3TEW A;  2JWU A;  1E6E B;  1PDX A;  3Q8E A;  2M56 B;  2H89 B;  1DOY A;  1MHH E;  1IBX B;  2ON8 A;  3AH7 A;  1L5P A;  3L4P A;  1KRH A;  1TJE A;  4RGT A;  1VR9 A;  1SF0 A;  1L6V A;  1L0X B;  2BB5 A;  2ICI A;  2FUG 1;  1JRO A;  2MEK A;  3B9J A;  4A55 A;  3RFZ B;  4AS1 A;  3C8Y A;  1XCQ L;  2BS3 B;  1BML C;  4LLG M;  1P7F A;  1MVK A;  4A8X C;  1V97 A;  2ACZ B;  1MPE A;  4HKZ E;  5AUI A;  1Y56 A;  2KAJ A;  2J53 A;  4ARC A;  1JCK B;  2AQ3 B;  4ITK A;  2JYE A;  4P6V F;  1FD6 A;  4ZHO A;  3VR8 B;  1JML A;  3AEB B;  2YEP F;  3I57 A;  3R2T A;  5E6J A;  1I4X A;  3PZ7 A;  4NAW B;  3CF4 A;  3AE9 B;  1XLQ A;  1TKE A;  4N58 A;  2K9X A;  1TS2 A;  2DLB A;  3O13 A;  2IGD A;  4FXC A;  1SIJ A;  1F2R C;  1J7A A;  1TY2 A;  1OQQ A;  1XO3 A;  3VRB B;  2HTM E;  3MFG A;  3CWI A;  2GB1 A;  2PLP A;  2N9L A;  1GTE A;  1SE4 A;  5EE9 A;  2WXL A;  1JQ4 A;  1Q10 A;  4LTU A;  2E3T A;  5D3D A;  2RDG A;  1QLB B;  4MAC A;  2JYT A;  2WU5 B;  1XCT L;  3LB8 C;  3LXF A;  3BVZ A;  2LHE A;  2LEK A;  4O1N A;  3IT4 B;  3I9V 1;  1VJK A;  3NRZ A;  2L52 A;  3R8B A;  3U7Z A;  1C79 A;  3BYT B;  4US9 A;  3AE7 B;  1J7C A;  1FRR A;  3W5U B;  3ZJV A;  1VLB A;  3NVY A;  2WU2 B;  3TEZ A;  3VR9 B;  1MI0 A;  4YXD B;  2BBC A;  3ZJU A;  3IAS 1;  4YSY B;  2DWQ A;  1A70 A;  4IDI A;  3ZJT A;  1M4V A;  1PGA A;  2W3R A;  3URY A;  2JQR B;  1B9R A;  1SE3 A;  1FNW A;  1K52 A;  1ROE A;  1SXT A;  1JWM D;  2WS3 B;  1DOI A;  4ZRQ A;  4P16 A;  4IOI E;  1N61 A;  1J7B A;  2HDE A;  3GB1 A;  1TKG A;  2TSS A;  1N63 A;  4KKI A;  2WQY B;  1N5X A;  2AQ1 B;  1TS3 A;  5HFY A;  3AE8 B;  2EEL A;  2JZP A;  3NVW A;  2B76 B;  3BVG A;  2BYT A;  2WP9 B;  3AE5 B;  1ACC A;  2QJL A;  3T3N A;  2V3N A;  1I7H A;  2WXJ A;  3Q69 A;  4ZOH C;  4PT5 A;  5FR3 A;  3Q8C A;  1MHX A;  3HVZ A;  3KLS X;  4N59 A;  1YMH E;  1KF6 B;  3ABV B;  1IGC A;  2RPV A;  3FC4 A;  5BYS A;  2E6X A;  1JAL A;  2LMC A;  2L83 A;  3DWM A;  5TSS A;  1XEE A;  1FCL A;  2NMQ A;  3AE2 B;  4RNA A;  4B0M A;  1FO4 A;  5MPO A;  1I4P A;  1V1O A;  2M0A A;  1K50 A;  2GI9 A;  3AV8 A;  3TEX A;  1YJI A;  1EWY C;  4NJC A;  2WDR B;  4RGN A;  2LJI A;  4ARI A;  2W55 A;  1FM0 D;  1TY0 A;  2LUM A;  3EA6 A;  3TSS A;  2RMM A;  1QOG A;  1LO5 D;  3AEC B;  3SFE B;  1IBX A;  3Q8A A;  3ZYY X;  3P4Q B;  4XE0 A;  2FBW B;  1XLP A;  1ZP0 B;  1EWC A;  3BK1 A;  5FK9 C;  2ZW1 A;  2L1A A;  4UDU C;  3GS2 A;  1TYG B;  4WQM A;  4XWT A;  1JRP A;  4JE3 B;  1FEH A;  1PYW D;  4JPS A;  1RYJ A;  3KWL A;  2N9K A;  1YQ3 B;  1F2R I;  2W3S A;  4AQ7 A;  2JU6 X;  4NAM A;  1QIL A;  3PO0 A;  1SSN A;  1AYF A;  3V3X A;  4OZB A;  2WXP A;  4USA A;  5G5G A;  2K22 A;  1YN5 A;  1N5W A;  5HHD G;  5BYR A;  2QEJ C;  2R61 A;  1WYG A;  1RWS A;  2WXO A;  1QF6 A;  4NZL B;  5HI1 A;  2Q5W D;  2PVO D;  2WNM A;  2JXT A;  4OVZ A;  4N6E B;  1GB4 A;  3MC0 B;  4GDL B;  1YNT E;  3AE4 B;  1UWX A;  1YN3 A;  5BMH A;  1SJE D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...