1WX9A

Solution structure of the n-terminal ubiquitin-like domain in the human bat3 protein
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
86
structure length
86
Chain Sequence
GSSGSSGLEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYNVGGKVIHLVERAPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords HLA-B associated transcript-3 isoform b
publication title Solution Structure of the N-terminal Ubiquitin-like Domain in the Human BAT3 Protein
rcsb
source organism Homo sapiens
total genus 12
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2005-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1wx9A00
3M63B 1J19A 1WGDA 2AEHA 1GC7A 2C5LC 2LRUA 5J18A 1LM8B 2CHXA 2L05A 2KFJA 3ZTDA 3QA8A 2PE9A 5KHQA 3RYTA 2JRHA 3CF6E 4CO7A 3RUIB 4GIVA 2PEAA 4CYEA 5AZHA 4WJOA 2IY1B 1XT9B 4BBNC 2RR9A 2WX0A 1WGYA 4EFOA 2LZ6A 4ZDVA 3JSVB 2LASA 4IM3A 2L7RA 2DHZA 2J0JA 2C60A 4NJ6A 4AP4C 2KMAA 2FCQA 2KDFB 4IM2A 4EZJA 4FJVB 2FNJB 4JGHB 3WIMA 3R3MA 4GSWA 2ZZPB 4WJQA 2FCMA 2K8BA 2O2VB 2OOBB 1UBIA 3PLVA 4M0WB 3DCGA 3SU8X 2KDIA 2KC2A 2RD0A 4NPNA 2O6VB 1WMHB 4K81A 3W1YA 2JY6A 3HIZA 4IG7B 3OLMD 4LDTD 2YVCA 1YD8U 4NJ7A 3L13A 4KIKA 1WE6A 5DCNA 3WAPA 2KXJA 3ZNZB 4M8MA 1WGGA 1WXMA 3PREA 3AI5A 2GMIC 3A1QA 4E71A 2J0MA 4AWJA 1R4MI 2DZKA 1SIFA 2HTHA 3HM3A 5DPRA 3VDZA 1YQBA 2JF5A 3APCA 3KUCB 3MTNB 3NOBA 2LXCA 3KW5B 2M8SA 2LVQA 2WDTB 2ZVNA 2K1FA 3QARA 1YX5B 2DAFA 4A20A 2NR2A 2VRRB 2MQJA 2I1JA 4KVGB 1Z5SB 2KJRA 3ZDTA 3JSVA 1V80A 2LGDA 3ZNHB 2MBEA 1LXDA 3APFA 2PJHA 4MGIE 5E6OA 2OJRA 4RMAA 4M8NA 2KK8A 3D32A 2ZJDA 1P0RA 2KZRA 3DVGX 2CS4A 3V61A 5J17A 2KTRA 1OQYA 2KDEB 3DBLI 3IBEA 3DBSA 1E8YA 2LGXA 4TV3A 2IBIB 2NPTA 4EKUA 1GUAB 5L95C 1LQBA 3AU5A 2Z0DB 3PRPB 2LI5A 2KX3A 3PHXB 1MG8A 3KH0A 4J6IA 4WWNA 2PPHA 4E74A 2XK5B 4WWOA 2MP2B 3KUZA 4BKSA 2GBRA 4MJSA 1U4AA 4K1RB 2N9PC 1M94A 1T0YA 4RM9A 4WJPA 1J0GA 2BGFA 2GOWA 2BWFA 2JPHA 2KMCA 4FN2A 4W9CA 4CHKA 1GJZA 2KKCA 2BYVE 4BFRA 1WR6E 1WXSA 3VQIA 5E6PA 3N32A 2NS5A 5CHVC 2N1VA 1J8CA 4FHKA 2EKEC 3ZIMA 1VD2A 4X57B 1UBQA 5JZEB 3WAMA 1E8XA 2KJHB 1C1YB 3PZDA 4MELA 1TTNA 2KNBA 4HDOA 4W9JA 2DYMA 4KDIC 3LDZE 3TIXA 1CMXB 4G0NB 2ZNVB 5CHWA 2FCSA 3VXWA 3A4RA 1WR1A 3H7PB 2DZJA 2LXAA 4PYZA 5KHOA 2CHWA 3K9PB 3PPAA 4TUUA 1ZW7A 2B3AA 5J2RA 4W9FA 3QX1A 5HKHA 3M62B 1G6JA 5BO4B 2AL3A 3U8ZA 2G45B 4KIKB 4MGZE 3AU4A 2DYOA 3VFKA 4XC2A 3ML8A 5JH5C 3UIOB 4GMVA 2CR5A 4EOYA 1KM7A 2A4ZA 1TGZB 2KDBA 2MA9B 3JYUA 4GGQA 3U30A 2G4DB 5LXIB 1RRBA 1E90A 3A1QB 4I6PA 3TJPA 1WFYA 3P2BA 4W9GA 3V6EB 4P7IA 4DBGA 2XK5A 2KJ6A 2KTFA 1WJNA 1WIAA 2MP2A 3K9OB 2FCNA 3VAWA 1WY8A 2BPSA 1D3ZA 2LRWA 1V9JA 3PV1A 4FJZA 4FULA 4II2B 2ZCBA 1QZEA 2KOXA 3DOWA 2JVCA 3QIJA 2MRPA 3H6NA 3IFWB 2IZVB 3DVNU 4GB9A 4IWPA 5G2NA 3S2AA 4NAWA 3RZFA 4DWFA 3UQAA 2LWPA 1Q5WB 1F9JA 2KLCA 1HE8A 1E7VA 2A5UA 4KZ0A 3WA0A 4G11A 2KQSA 3W1SA 4NY0A 3R7RA 1WZ3A 2D2QA 1UH6A 2KTRB 2LVOA 4PS7A 4A3PA 4DXAB 3DDCB 4MSQB 5DPWA 3PLUA 2ZNVC 1ISNA 2FIFA 2NCNA 4DHJD 2NPTB 5E6NA 1LFDA 1X1MA 2G4SA 3H7PA 3UINB 1S1QB 4IW0A 3JW0X 4DHZB 3SDLC 2AL6A 2ZPNA 4GDKA 1YIWA 3ALBA 4MJSB 4PS3A 1SE9A 5D2MB 3RD2A 2MCNB 5G55A 4ICVA 4B9KA 4BOSC 4OVVA 1SGHA 2KC1A 4NQLB 1WM3A 5IA7A 2K6DB 2NBVB 4WWPA 1WRDB 2KVRA 2M4NA 3A9JA 2K25A 3DBRI 2PE6B 4ZRKA 4FADA 4FJYA 4LCDE 3L08A 2ASQA 2LGYA 4JLCA 2RPQA 4EUTA 3SD5A 4E3CA 2C9WB 4W9EA 1WF9A 4II3B 3X0WA 3EC8A 3IG3A 4EZKA 2BKFA 3ML9A 4DHZE 2MBQA 2NBUA 4WQOB 1V49A 4IWOA 2BF8B 2ZVOA 2DENB 3KYCD 2DYBA 4HCNB 3NZUA 2HJ8A 2DZIA 1GG3A 1WX7A 1JRUA 2MLBA 2EMTA 4IC7B 4ANXA 2JWZA 3VH3B 3WAOA 2GBKA 2JZZA 1IP9A 2KLGA 4PYUA 4BKGA 2KFKA 1WE7A 2O6VD 4A3OA 3TL5A 3ZKJC 3VHTC 3TCAA 4URKA 2M1MA 3PRMB 1FXTB 3H7SA 3VUXA 4F7ZA 4B95A 2K6QA 2Z59B 4MGYE 3A4SC 2N7EA 3GOEA 2N7DA 1A5RA 1WX9A 3KVFB 3ZW3A 3ZLZA 3CSFA 4HVBA 1L2NA 2JT4B 2MW5A 1BT0A 5JHAA 3UF8A 4AOFA 1P98A 2RSUA 1OEYJ 2G3QB 3OJ3A 3PGEA 4NAWB 3IHPC 3QQ8B 4AJYB 1P3QU 1OTRB 2R2OA 2JZ3B 4W9IA 3Q3JA 4KSLC 3B08A 2LVPA 4HPLB 3T9LA 5AZFA 4TQ0A 5AZGA 2KO3A 3QCAA 1E8WA 1E8ZA 1KJTA 3PSEB 3DVGY 4G3XB 4HDQA 3TBLD 1UGMA 3L10B 1I35A 1V6EA 1YJ1A 2L8JA 2ZPYA 4GXBA 4KZCA 3TMPB 1C3TA 2D07B 2L3ZA 4MH0E 4PS8A 3WANA 4I6LB 3ONSA 1P9DU 4LJOB 1GC6A 2K8HA 4BKTA 3EECA 2KQ7A 2M17A 2CKHB 1Y8RC 5CHFA 3PT2B 4ZYNA 2Z0EB 4MM3A 3V60A 4MDKE 4GDKB 3B1LX 3DPDA 1V2YA 4W9KA 4JQWC 4ZRIA 1UD7A 2W9NA 2BYEA 3VUYA 1YX6B 2HE7A 2GBNA 3H1UA 4HXDA 4IWQA 5TR5A 1EO6A 2IYDB 1UZXB 2Y5BB 3A9JB 3QHTA 4MEMA 4KSKC 3ZUNA 4IM0A 3M3JA 5EDSA 1IPGA 4B6WA 4ZRJA 1R4NI 2N9XA 2N1WA 3PVLA 5DPTA 1Z2MA 3KUDB 1S3SG 4MGKE 2D3GA 3EFUA 3I3TB 2KHWB 2MBBB 4NQKE 5DPSA 4LDTB 2N9EB 4OVUA 5C23A 2KX0A 1WJ4A 3UGBB 1KLVA 4DDID 4HJKA 3AXCA 3RT3B 3ZTCA 1PQSA 2UWQA 3QJZA 3W1SC 3UIPB 4TKNA 1P1AA 4YL8A 2FAZA 4K7UA 3A33B 3L17A 4ASWC 4MSMB 3KYDD 1OEYA 3DBHI 3EHVA 3A9KB 2KFKB 3RULA 2NVUI 2WX1A 1IYFA 2XEWA 4K7WA 3ZNGC 2CU1A 1XQQA 2HD5B 2NBWB 3JVZX 4HK2A 1WI0A 5AEKB 1I42A 1Q1OA 2REXA 3ECIA 2IO3B 3ENEA 3MJWA 5C1ZA 5L83A 4DK5A 1H8CA 3ZRFA 4G50A 4ANUA 3QC8B 2V1YA 1VCBA 2KD0A 4BOZB 4GN1A 1NDDA 1UELA 3NY5A 2C7NB 1WJUA 1V81A 1ZGUB 2L76A 1Q0WB 3NHEB 1GNUA 2ZEQA 3BINA 2IY0B 3ZRCA 3HHMA 3VTVA 1TZ1A 4F8CB 1RAXA 3QWZB 2I1KA 3RZWC 3DVNV 3BY4B 2UYZB 1WXVA 1NI2A 2ZCCA 3L54A 4GDLB 3ZNID 3PTFC 1WGRA 4I6NB 1WJ6A 1WM2A 2N4FA 3NZSA 2DAJA 4EEWA 4JL9A 4BBNF 4BVUC 4W9HA 2MX2A 3PHWB 5LXHA 2BYFA 5LLIA 5D7GA 3H9DA 2C7HA 1WX8A 4N9F4 3VH4B 2J0KA 5IAAC 4FHJA 1EF5A 1V5OA 2CHZA 2L0FA 3SHQA 3A9KA 2L0TA 2FUHB 1EUVB 2GBJA 3V6CB 3IVFA 3UQBA 3VTUA 2V4LA 4K7SA 4GOCA 4HPMB 4BKSD 3WALA 2R2QA 2AWTA 1WH3A 2EMSA 1V86A 2LD9A 3MHSD 2GBMA 2LJ5A 2K8CA 3VUWA 2KN5A 3V62A 1RFAA 4LJPB 2BKRB 3N30A 4W9LA 3ZVVA 2JXXA 3CSTA 3PRZA 1OGWA 4NNJB 1K8RB 4RM8A 3C0RB 3N3KB 1E7UA 2YLMA 2O2VA 4HWIB 5CTRC 3PS6A 3CMMB 4IUMB 5FR6A 4ANWA 2M0XA 2O6VA 1WMHA 3RCZA 4GDLA 2KANA 4DDGD 2KWVB 3NS8A 3HK0A 3Q3FA 1L7YA 3AULA 4GU2A 2MBHA 3QK0A 1NBFC 4TQ1A 1H4RA 4HCPB 3GZNI 1AARA 2K39A 3OAWA 1TBEA 3ZDMC 5D6JB 3M95A 3R7QA 4AUQC 2C7MB 3APDA 3L0WB 2WWZA 1ZKHA 2IO2B 3OJ4B 3B0AA 4KDLB 3QAQA 1E5WA 4HLEA 4ICUA 3T8MA 2JRIB 2AYOB 4WAAA 4F1SA 5JHBA 3O65B 1KOTA 4XX5A 1EF1A 1WXAA 2MSED 2FIDA 3X23A 3VVWB 4FBJB 4AJWA 2KWCA 2RGFA 3R66C 4KV2A 1WGHA 3VTWA 4WJNA 2LUEA 2IO1B 2IO0B 5CX3A 2MWSB 3L16A 4W9DA 3DQVA 1WYWB 2KWUB 1V5TA 2QHOA 1RLFA 4FLHA 4DHJB 2JUOA 3U7DA 3ZO5B 4XZ4A 3LJ3A 3HM6X 2DZMA 4ANVA 5D94A 2V3SA 4EZLA 1WZ0A 2D10A 4JIOU 2D11A 2MBOA 1XD3B 2BWES 2WYQA 2XBBC 2L00B 2J7QB 4FA6A 2DX5B 5GMVA
chains in the Genus database with same CATH superfamily
2WDVB 1TKEA 1LM8B 1QQRA 5KHQA 3RYTA 2L83A 4GIVA 4KX6B 5AZHA 4BBNC 1WGYA 4A6QA 2C60A 4LNKA 1I4XA 2FCQA 2KDFB 4LK0M 4FJVB 3R3MA 2OOBB 3Q69A 2LFIA 3DCGA 1JALA 2KC2A 4NPNA 3GE3C 3OLMD 2YVCA 1YD8U 3DWMA 1K50A 1WRIA 2D3BA 5AUIA 4M8MA 5HFYA 1WGGA 3PREA 3AI5A 3IT6B 2UU7A 1NYQA 2DZKA 2HTHA 1B9RA 1YQBA 1N63A 3Q3OC 3FILB 3AECB 3KUCB 3KW5B 5IO9A 2LVQA 2WDTB 2QC8A 4NJCA 4XWTA 4IKGA 2WU2B 1Z5SB 3JSVA 2MBEA 1V1PB 4RMAA 3D32A 2KTRA 3DBLI 1K53A 3PZ7A 4A8XC 4TV3A 3MP9A 2JU6X 1LQBA 3AU5A 2Z0DB 3PRPB 3KH0A 3AM9A 4RGNA 2PPHA 3IT4B 2XK5B 1TS3A 4MJSA 1TS4A 1M94A 1PGXA 4A55A 2BGFA 2V3PA 2JPHA 2BYVE 3Q3NC 4US9A 1E6EB 2NS5A 5CHVC 1N62A 1J8CA 1FCLA 1T0QC 4X57B 3N20C 1UBQA 5HG2A 1TJEA 1C76A 1QOAA 2KAJA 3ETRA 4KKIA 3PZDA 1EWYC 1ZXHA 5I4DA 4W9JA 5EE3A 2DYMA 1L0VB 4G0NB 2ZNVB 5CHWA 3RNCC 3A4RA 3H7PB 5KHOA 1LGRA 2CHWA 2IJ0A 1ET9A 2B3AA 2VH1A 4W9FA 5J2RA 1G6JA 1D5XC 4MT5A 4MGZE 2DYOA 4GMVA 2CR5A 4KGTA 2G4DB 4WIPA 3TJPA 1WFYA 4W9GA 3V6EB 3W5VB 3AE4B 2BPSA 3PV1A 4FULA 4II2B 3NVYA 1QZEA 2ACZB 1HZ6A 2IZVB 3UQAA 2E6XA 3NRZA 3SFEB 1HE8A 1SBBB 2A5UA 3WA0A 4G11A 3W1SA 4NY0A 2KTRB 4DXGA 3PLUA 1MJDA 1ISNA 1FFVA 2G4SA 3UINB 1S1QB 2XNAC 3W9CB 3JW0X 4DHZB 4YSXB 2M19A 1KLUD 2N7JA 2J53A 4MJSB 1SE9A 3RD2A 4ICVA 4JPSA 2IGGA 4WWPA 1WRDB 2KVRA 2M4NA 3A9JA 3DBRI 1C9FA 1C4AA 2PE6B 2WXQA 3P4SB 4FADA 2WXKA 2BVCA 3L08A 2ASQA 1MFWA 3AE8B 4YTMB 4ARIA 5T8IA 2INDC 5BYQA 4II3B 3EC8A 2WXPA 1XLPA 4HCNB 2DENB 3DHHC 1JRUA 2EMTA 4KGSA 4MM3B 3N9YC 1TS5A 3WAOA 2GBKA 1WE7A 2INCC 3ZKJC 2PKOA 4URKA 3PRMB 2N0SB 3H7SA 1V97A 1L6VA 3ZLZA 4HVBA 1BT0A 3ZYYX 1J7BA 1P98A 1OEYJ 3PGEA 1HEZE 2KMMA 2GI9A 4AJYB 3Q3JA 4HPLB 4HDQA 1I35A 4XDCA 1PYWD 1YJ1A 3TMPB 2AQ2B 4PS8A 2L3ZA 2AQ3B 5BMHA 3IAS1 4ZYNA 2Z0EB 3V60A 4MDKE 4HROA 3B1LX 3U52E 2W9NA 1AW7A 1QOGA 3Q6BA 2IYDB 1UZXB 3QHTA 3A9JB 3ZUNA 4MEMA 3M3JA 3GB1A 1R4NI 3PVLA 5DPTA 1TKGA 2OJWA 5DPSA 4LDTB 1N6ZA 3UGBB 2WXJA 4DDID 3ZTCA 1FO4A 4YL8A 2FAZA 2M56B 3RNFC 5IKCM 3DBHI 2ONQA 3RULA 3RNBC 4RF1A 1YN4A 2XEWA 2M0AA 3URYA 3AMZA 3GP7A 1I42A 5BMIA 1H8CA 4DK5A 2FBWB 3GZNB 2INPE 5G5GA 4ANUA 4GN1A 2C7NB 1UNSA 1ZGUB 1GNUA 2IY0B 3N1YC 1TZ1A 1MHHE 3QWZB 3DVNV 3BY4B 4GDLB 4AQ7A 1WM2A 1PGBA 3ZXRA 4EEWA 4BVUC 2MX2A 1IUEA 5LLIA 5D7GA 2JWUA 1WX8A 4Q2JA 5IAAC 3VRBB 2PVOD 2WXFA 2CU3A 4HPMB 4BKSD 3WALA 2AWTA 2EMSA 2ON8A 1B1ZA 2GBMA 3I57A 3VUWA 1RFAA 1GOZA 3ZVVA 3CSTA 3PRZA 1OGWA 3ZGZA 3C0RB 2WHIA 4M0WA 2M0XA 2O6VA 2KANA 2KWVB 1L7YA 1ZP0B 3BVMA 3QK0A 4TQ1A 3GZNI 3H8HA 2K39A 5EE0A 2BYTA 3ZDMC 1OQQA 3B2FA 4WH4A 3R7QA 4AUQC 1ZDXA 4KDLB 1MG4A 4HLEA 3P4QB 2JRIB 1WWTA 2AYOB 5JHBA 2FIDA 3X23A 1CZPA 2RGFA 2JXTA 3MC8A 1WGHA 4YTNB 3VTWA 2LUEA 2IO1B 2QIEB 2IO0B 1YQ3B 1TS2A 1STEA 2MWSB 3CIRB 3L16A 4XE0A 3DQVA 1WYWB 1V5TA 4FLHA 1RLFA 1VR9A 4A90A 3ZO5B 3RNGC 3RN9C 4P16A 3SR6A 2BTEA 3AE7B 2D11A 1XD3B 2WYQA 2I1KA 1XXGA 4FA6A 2PEAA 4YSYB 1GC7A 2C5LC 1LO5D 3ZTDA 1F52A 4OZCA 4CO7A 3AEDB 3RUIB 4CYEA 4WJOA 1XT9B 2WX0A 1XO3A 4OZAA 2V9HA 4OW0A 1VLBA 2QEJC 2L7RA 2LGSA 3AEAB 4EZJA 3AEFB 4D2KA 4GSWA 2ZZPB 2FCMA 2K8BA 3PLVA 4M0WB 1T0RC 2R61A 2O6VB 4K81A 4IG7B 3L13A 2PVGC 4KIKA 5DCNA 1MI0A 2GMIC 4E71A 4AWJA 3RNEC 1R4MI 1MHXA 4C56C 2JF5A 4MH8A 2LXCA 2ZVNA 2K1FA 2WGSA 1C79A 2DAFA 4A20A 4KVGB 2KJRA 1LXDA 4ZRQA 3U2SC 3GS2A 5E6OA 2OJRA 1JW9D 2KK8A 4RH6A 2ZJDA 1P0RA 1HXYD 3DVGX 1OQYA 2Y5CA 3DBSA 4QAYA 1E8YA 2LGXA 2IBIB 1GUAB 5L95C 3N1ZC 1JMLA 2J42A 4J6IA 3KUZA 2K3UA 2GBRA 3I9V1 4K1RB 2N9PC 4RM9A 1WXQA 4WJPA 1J0GA 5BYSA 4KGRA 2KMCA 4CHKA 2JYTA 1WR6E 5FK9C 2Y3AA 5E6PA 2K0PA 3HUIA 1I7HA 3ZIMA 5JZEB 2KYWA 1Y56A 4JX1C 1FXIA 3LDZE 1RWSA 3TIXA 2FCSA 3VXWA 1WR1A 2DZJA 1F1HA 1ZW7A 3M62B 2CJNA 2AL3A 3U8ZA 4KIKB 2VH2A 4K3CA 1C4PA 3UIOB 1AWDA 1KM7A 2KDBA 1EU4A 1RRBA 3P2BA 2RDBC 2XK5A 1WJNA 4C00A 4PT5A 3VAWA 1D3ZA 5C3JB 1ENFA 4ITKA 1V9JA 3NJTA 3DVNU 4DWFA 4HKQA 4YXDB 3AE1B 1WZ3A 1UH6A 3BWUD 2QCZA 2KN4A 3DDCB 4MSQB 2MJ3A 2WXNA 5DPWA 2ZNVC 5FKAC 4DHJD 5E6NA 5C2TB 3H7PA 2I38A 2ZPNA 1L0YB 4PS3A 1Q10A 5G55A 1SE2A 4B9KA 1SGHA 4NQLB 3PO0A 5IA7A 2K6DB 4FJYA 3SFDB 2RPQA 1YNTE 3SD5A 1NI3A 2C9WB 1WF9A 3X0WA 2DBYA 2MBQA 1V49A 4MACA 3KYCD 2DYBA 2HJ8A 2DZIA 3ABVB 1QOBA 2JWZA 1IP9A 3SEBA 1J7AA 3KWVA 3BVZA 1FXAA 4RGOS 4R3DA 1JWAD 1RYJA 2Z59B 3A4SC 1WX9A 3KVFB 4KKJA 3CSFA 4C7ZA 4N59A 3UF8A 2RSUA 3OJ3A 3U4EG 3IHPC 1PDXA 1OTRB 2R2OA 4JWSC 2W3SA 2JZ3B 3AE2B 4KSLC 1D5ZC 2SEBD 2WXOA 5AZFA 4TQ0A 1E7PB 3TBLD 1E8ZA 1KJTA 4J3OD 1UGMA 2IPKD 3L10B 2ZPYA 4I6LB 1P9DU 1GC6A 2K8HA 3Q3MC 2M17A 5CHFA 3PT2B 3R8BA 4MM3A 4S17A 3DPDA 4W9KA 1V2YA 1PUTA 1UD7A 4N58A 3H1UA 3N1XC 4P1CC 1EO6A 4KSKC 5EDSA 1IPGA 2N9XA 2N1WA 1S3SG 3Q8AA 2D3GA 4HRSA 3EFUA 3I3TB 1DOIA 2MBBB 4NQKE 2N9EB 4OVUA 1RM6C 3QJZA 3W1SC 4TKNA 1P1AA 4YTPB 1SSNA 4K7UA 3A33B 2H88B 3L17A 1VRAB 4ASWC 4DXFA 3KYDD 1OEYA 3FKYA 1IYFA 1TY0A 4YWGG 2HD5B 2NBWB 1WI0A 1ZOYB 2REXA 3MJWA 3Q8CA 3RMKC 2V1YA 2WU5B 2KD0A 1WJUA 1GB4A 1JQ4A 3NHEB 3BINA 1SIJA 3ZRCA 3VTVA 4ZHOA 1RAXA 2WQYB 1QKZA 3AH7A 3RZWC 2UYZB 2WS3B 3L54A 1WGRA 1I4GA 4C7YA 4L1BA 1WYGA 4BBNF 4W9HA 1SJED 1YJJA 3PHWB 3Q8FA 4PK1A 5LXHA 3H9DA 3P63A 5H92C 1M4VA 1OFFA 3V6CB 1TYGB 3IVFA 1D4BA 5HI1A 2R2QA 1WH3A 3L4PA 3AE6B 2K8CA 3V62A 4W9LA 2JXXA 1K8RB 4RM8A 3T3NA 2SAKA 3N3KB 1DGJA 4HWIB 3TSSA 3CMMB 2G9HD 3RCZA 1VZ7A 4GDLA 4WURA 3NS8A 3AV8A 2HJ1A 1H4RA 2BB6A 3OAWA 1YQ4B 2WXMA 2ICIA 1PGAA 5BMGA 1QLBB 3IXSA 4F1SA 3O65B 1EF1A 1WXAA 1XF5L 5CX3A 1I4RA 1ROEA 2V4IB 3TEYA 2QHOA 1KRHA 4DQOC 4ANVA 5D94A 3U7ZA 4JIOU 2XBBC 2BQQA 1E5WA 4BOSC 1N5XA 2RDGA 1WGKA 1J19A 1WGDA 2LRUA 2CHXA 2L05A 2VZKD 3NG0A 5IP4D 3QA8A 5AUKA 4USAA 2IY1B 1YN3A 2RR9A 2DNFA 4H2AA 4EFOA 2LZ6A 5IOIA 4ZDVA 2YEPB 1IBXB 1YN5A 2J0JA 4US8A 5D3IB 4NJ6A 2KMAA 3AE3B 4IM2A 3MC9A 2FNJB 4JGHB 3BIID 2KDMA 3DWGC 4M00A 4WJQA 3DHIC 2KDIA 3MJ5A 1QF6A 2JY6A 4NJ7A 2W82A 3WAPA 1I4HA 2NMQA 3ZNZB 3ZQ4A 4REZA 1AYFA 3A1QA 3DHGC 2IGDA 2EELA 2DLBA 3HM3A 2MH7A 3APCA 3MTNB 3NOBA 4UDUC 2WDQB 2MQJA 1E0ZA 1V80A 2LGDA 1SE3A 3ZNHB 1QILA 3APFA 1KTKA 1V8CA 2L1AA 2KZRA 1VZ8A 3V61A 2LJIA 3P1MA 5J17A 5MPOA 4ZRPA 5GXGB 3IBEA 1DOXA 1XLNA 4HEA1 2NPTA 4EKUA 1CK1A 1NVID 2LI5A 2Q5WD 3PHXB 1MG8A 4WWNA 1N60A 4E74A 4WWOA 2MP2B 1DOYA 4BKSA 2WXRA 2KWDA 2OHFA 3E9SA 2YEPF 3BK2A 2GOWA 2BWFA 4W9CA 1GJZA 4RCOA 2LMCA 1WXSA 4RGTA 3VQIA 1P7FA 4O1NA 3N32A 2N1VA 3NUHB 4FHKA 2EKEC 1VD2A 3WAMA 5FR3A 1L0XB 1GPXA 1C1YB 2EKIA 1TTNA 2KNBA 4HDOA 2AQ1B 4KDIC 2BW2A 1XLQA 1CMXB 1T6BX 1TT5B 3K9PB 2MHJA 2HDEA 2QMTA 5BO4B 2G45B 3AU4A 3VFKA 1QT9A 4XC2A 4EOYA 1TGZB 2Z8LA 3A1QB 4DBGA 4OVZA 1UWXA 2KTFA 3K9OB 2RPVA 3QIJA 5G5HA 1FIQA 3H6NA 3IFWB 4GB9A 5G2NA 4NAWA 3RZFA 4N6EB 2LWPA 1F9JA 2KT7A 4KZ0A 4M02A 1SE4A 3KWLA 4PS7A 2JQRB 4DXAB 2E3TA 2FIFA 2WXGA 5EE9A 2NPTB 1FPYA 1X1MA 3IAM1 2XN9C 4IW0A 3SDLC 2AL6A 4GDKA 2JZPA 2V0GA 3Q8BA 2MCNB 1NENB 2NBVB 3R2IA 1F2RI 2BT6A 4LCDE 1F0ZA 1VZ6A 2LGYA 3NZ3A 4HPPA 4E3CA 4W9EA 2NTSA 4EZKA 4B0MA 2V3NA 2LGIA 2NBUA 2BF8B 4TSSA 2ZVOA 2WNMA 3NZUA 4WWMA 3RI7C 4IC7B 3HRDD 3VH3B 1ACCA 4PYUA 4BKGA 2KFKA 4L2YA 3VHTC 2M1MA 1FXTB 2GRIA 4B95A 2K6QA 4LNFA 3BVGA 4LTUA 2INNE 4IDIA 3GOEA 1T3QA 1A5RA 3ZW3A 1I4PA 4WQMA 2D5GA 2G3QB 4NAWB 1SXTA 3QQ8B 3AN1A 1P3QU 2LVPA 3T9LA 1XCQL 2KO3A 1E8WA 4JE3B 1ESFA 3QCAA 3DVGY 2NTTA 1FNUA 1V6EA 2L8JA 4GXBA 3WANA 1FEHA 3TEWA 1FRRA 2KQ7A 3VR9B 2CKHB 4HKZE 1ZPSA 4GDKB 3EUB2 1KFYB 1YX6B 2GBNA 5TR5A 4XWWA 1I4QA 2Y5BB 4IM0A 2Y5PA 1J7CA 3AB5A 4ZRJA 2MEKA 3KUDB 3NVWA 4S0RA 2KX0A 1KLVA 3AXCA 1PQSA 2UWQA 3UIPB 1KF6B 3DBLB 2LEKA 3EHVA 3A9KB 2KFKB 2NVUI 2RMMA 2CU1A 4HK2A 5AEKB 1Q1OA 2IO3B 2N9KA 4ZOHC 3ZRFA 3QC8B 3Q14C 1JRPA 3VR8B 3TEXA 1VCBA 1F77A 4ZYSA 1YOVB 1V81A 2L76A 1Q0WB 5D3DA 3FC4A 3HHMA 2W55A 1L6UA 2ZCCA 1NEKB 3ZNID 4I6NB 1WJ6A 3NZSA 1JWUD 3Q2AC 3MHZA 3Q8EA 2IDYA 2CJOA 2C7HA 4RF0A 4N9F4 3VH4B 2J0KA 4FHJA 1IGCA 1EF5A 1V5OA 1MPEA 2L0FA 3SHQA 2L0TA 2PMVA 4CQNA 3VTUA 4K7SA 2LD9A 3MHSD 1JROA 2LJ5A 2KN5A 4LJPB 2AX5A 3P42A 4WAFA 3C19A 4GLSC 1TIFA 2G1EA 1FRDA 2O2VA 3PS6A 1WMHA 4DDGD 2GLSA 3Q3FA 1JWBD 3AULA 2JX5A 1NBFC 3W2DA 1HQRD 5D6JB 3EGRA 3L0WB 3APDA 4C80A 2WWZA 4NAMA 1T0SC 3OJ4B 3J9CA 2WXLA 4WAAA 1EWCA 3KQ4A 1YMHE 4OZBA 1XCTL 2MSED 3VVWB 3DBRB 4AJWA 3R66C 3AE5B 4WJNA 4NZLB 3EA6A 3UI3A 4W9DA 4DHJB 1FMAD 3HVZA 1MVKA 3LJ3A 4XGAB 3OWEB 2V3SA 3I5JC 2D10A 2JYEA 1FNVA 2L00B 5GMVA 3M63B 2QJLA 1FCCC 4L23A 2K22A 2AEHA 2W54A 1WSPA 5J18A 2KFJA 1UUPA 2PE9A 2JRHA 1JWMD 3LYYA 3CF6E 4XYCA 2BS4B 1RFKA 2BBCA 2OEDA 4ACFA 3T3OA 3JSVB 2LASA 4IM3A 2DHZA 4AP4C 3WIMA 3O13A 2O2VB 1ZXIA 1UBIA 1D5MC 3SU8X 2RD0A 1E10A 1GB1A 1WMHB 2BS2B 3W1YA 3HIZA 4LDTD 1PFDA 3ZJVA 1FD6A 1WE6A 4OHJA 5TSSA 2KXJA 1WXMA 2J0MA 1SIFA 5DPRA 3VDZA 1TKYA 2M8SA 2ZW1A 3BK1A 2PW9A 3QARA 1YX5B 2NR2A 2VRRB 2I1JA 3E56A 3ZDTA 3BYYB 5JXVA 1IBXA 3WCQA 1R4NB 2PJHA 4MGIE 3P4RB 4M8NA 1GAQB 2CS4A 4RNAA 1N61A 2KDEB 3TEZA 4ZHPA 3ZXVA 1TY2A 2KX3A 1JWSD 1IGDA 5H8YE 1EM7A 3DBHB 4B0EA 2I2YA 1U4AA 1T0YA 4AS1A 2L32A 4FN2A 2KKCA 1ZDVA 2LUMA 4BFRA 3RPFC 5BYRA 2QDFA 1E8XA 2KJHB 4MELA 3AE9B 3R2TA 1D6EC 4YT0B 4PYZA 2LXAA 3PPAA 4TUUA 3RNAC 1UWMA 2GB1A 3QX1A 5HKHA 2HTME 1K51A 3B9JA 3ML8A 3V05A 5JH5C 2IGHA 1L4DB 4FXCA 2A4ZA 3AEGB 2MA9B 3JYUA 4GGQA 5LXIB 3U30A 1E90A 4I6PA 4P7IA 2J4XA 2KJ6A 2MP2A 1WIAA 1HZ5A 2FCNA 1WY8A 3FAHA 2LRWA 4FJZA 2ZCBA 2KOXA 3DOWA 1E9MA 2JVCA 2MRPA 4IWPA 3S2AA 1Q5WB 2KLCA 1P7EA 1E7VA 3LXFA 1VDVA 1F2RC 2KQSA 3R7RA 2D2QA 2LVOA 4A3PA 5E6JA 2NCNA 3MFGA 4RGMA 1HTOA 1LFDA 3LB8C 2D3CA 1AN8A 1YIWA 3ALBA 4LNNA 2BB5A 5D2MB 5IN7A 1CJEA 4OVVA 2KC1A 1WM3A 1KLGD 2K25A 4ZRKA 2ZW0A 2QSDA 2JSVX 2L52A 1NYRA 3GE8C 4JLCA 4EUTA 3IG3A 1SB3C 2BKFA 3ML9A 4P1BC 4DHZE 2MJEA 1BMLC 4WQOB 4IWOA 4LLGM 1GG3A 1WX7A 2MLBA 1L4ZB 4K3BA 4C4VA 4ANXA 1VJKA 2JZZA 2KLGA 1XLOA 4A9AA 2O6VD 4A3OA 2RDHA 3TL5A 3TCAA 4EE2A 3VUXA 4F7ZA 5EE1A 3AEEB 2FUG1 4MGYE 4BAXA 2N7EA 5LNK1 2H89B 2N7DA 1YJIA 4YSZB 2PLPA 1EU3A 2W3RA 3TUOA 1L2NA 2JT4B 2MW5A 5JHAA 4AOFA 3KLSX 1ET6A 4W9IA 3B08A 2K5PA 2J52A 1XEEA 5AZGA 2TSSA 3PSEB 4G3XB 2WP9B 4P6VF 4TMAB 4KZCA 1C3TA 2D07B 4MH0E 3ONSA 4LJOB 4BKTA 2VZKB 3EECA 1Y8RC 3OG5A 1T5XD 3B2GA 2X38A 3RFZB 4JQWC 1BUIC 4ZRIA 1UF0A 2BYEA 3VUYA 2HE7A 1ZUD2 1CQVA 4HXDA 4IWQA 1A70A 2N9LA 1R4MB 3AEBB 4B6WA 1FFUA 1Z2MA 4ARCA 1QOFA 1R7SA 2PTLA 4MGKE 3BYTB 3NVZA 1SJHD 4JWUC 4M01A 2KHWB 4RFBA 5C23A 2KQ4X 1WJ4A 4HJKA 3HVDA 3RT3B 3PZ8A 4C4VB 3ZJTA 4MSMB 4IOIE 1OQRA 2WX1A 4K7WA 3ZNGC 1XQQA 3JVZX 2DWQA 3ECIA 5L83A 3ENEA 5C1ZA 4G50A 3EFCA 4XDDA 1DYQA 1C77A 3NVVA 4BOZB 3BZDB 1NDDA 1HTQA 1UELA 3NY5A 2WXHA 2ZEQA 1UGJA 4F8CB 3W5UB 1K52A 1WXVA 1NI2A 3MC0B 3PTFC 5HHDG 2WXIA 2N4FA 2DAJA 4JL9A 1KH0A 2BYFA 1C78A 1SF0A 2B76B 2CHZA 2LHDA 1ZE3D 3A9KA 2MJDA 2FUHB 1EUVB 1FM0D 4BZAA 2GBJA 3UQBA 2V4LA 4GOCA 2WDRB 2FE8A 2KACA 1V86A 3C8YA 4HJGE 2BKRB 2LHEA 3N30A 4NNJB 2WLBA 1E7UA 2BS3B 2YLMA 2PIAA 1V1OA 5CTRC 4IUMB 5FR6A 2X8XX 4ANWA 3VRAB 3HK0A 4GU2A 1TZOA 3V3XA 1JCKB 2MBHA 4HCPB 3ZJUA 1AARA 4LNIA 1TBEA 3M95A 2C7MB 1ZKHA 2IO2B 3CWIA 3B0AA 3QAQA 1FNWA 4ICUA 3T8MA 3NS1A 3FILA 1KOTA 4XX5A 4FBJB 2KWCA 4KV2A 1HA5A 1N5WA 1V1PA 4LNOA 2KWUB 2JUOA 2D3AA 3U7DA 1BXTA 3P4PB 2K9XA 4XZ4A 1C4CA 3HM6X 2DZMA 3I63C 2KVZA 4EZLA 2QILA 1WZ0A 1SEBD 2MBOA 1L5PA 2BWES 2J7QB 2DX5B
chains in the Genus database with same CATH topology
3M63B 1J19A 1WGDA 2AEHA 1GC7A 2C5LC 2LRUA 5J18A 1LM8B 2CHXA 2L05A 2KFJA 3ZTDA 3QA8A 2PE9A 5KHQA 3RYTA 2JRHA 3CF6E 4CO7A 3RUIB 4GIVA 2PEAA 4CYEA 5AZHA 4WJOA 2IY1B 1XT9B 4BBNC 2RR9A 2WX0A 1WGYA 4EFOA 2LZ6A 4ZDVA 3JSVB 2LASA 4IM3A 2L7RA 2DHZA 2J0JA 2C60A 4NJ6A 4AP4C 2KMAA 2FCQA 2KDFB 4IM2A 4EZJA 4FJVB 2FNJB 4JGHB 3WIMA 3R3MA 4GSWA 2ZZPB 4WJQA 2FCMA 2K8BA 2O2VB 2OOBB 1UBIA 3PLVA 4M0WB 3DCGA 3SU8X 2KDIA 2KC2A 2RD0A 4NPNA 2O6VB 1WMHB 4K81A 3W1YA 2JY6A 3HIZA 4IG7B 3OLMD 4LDTD 2YVCA 1YD8U 4NJ7A 3L13A 4KIKA 1WE6A 5DCNA 3WAPA 2KXJA 3ZNZB 4M8MA 1WGGA 1WXMA 3PREA 3AI5A 2GMIC 3A1QA 4E71A 2J0MA 4AWJA 1R4MI 2DZKA 1SIFA 2HTHA 3HM3A 5DPRA 3VDZA 1YQBA 2JF5A 3APCA 3KUCB 3MTNB 3NOBA 2LXCA 3KW5B 2M8SA 2LVQA 2WDTB 2ZVNA 2K1FA 3QARA 1YX5B 2DAFA 4A20A 2NR2A 2VRRB 2MQJA 2I1JA 4KVGB 1Z5SB 2KJRA 3ZDTA 3JSVA 1V80A 2LGDA 3ZNHB 2MBEA 1LXDA 3APFA 2PJHA 4MGIE 5E6OA 2OJRA 4RMAA 4M8NA 2KK8A 3D32A 2ZJDA 1P0RA 2KZRA 3DVGX 2CS4A 3V61A 5J17A 2KTRA 1OQYA 2KDEB 3DBLI 3IBEA 3DBSA 1E8YA 2LGXA 4TV3A 2IBIB 2NPTA 4EKUA 1GUAB 5L95C 1LQBA 3AU5A 2Z0DB 3PRPB 2LI5A 2KX3A 3PHXB 1MG8A 3KH0A 4J6IA 4WWNA 2PPHA 4E74A 2XK5B 4WWOA 2MP2B 3KUZA 4BKSA 2GBRA 4MJSA 1U4AA 4K1RB 2N9PC 1M94A 1T0YA 4RM9A 4WJPA 1J0GA 2BGFA 2GOWA 2BWFA 2JPHA 2KMCA 4FN2A 4W9CA 4CHKA 1GJZA 2KKCA 2BYVE 4BFRA 1WR6E 1WXSA 3VQIA 5E6PA 3N32A 2NS5A 5CHVC 2N1VA 1J8CA 4FHKA 2EKEC 3ZIMA 1VD2A 4X57B 1UBQA 5JZEB 3WAMA 1E8XA 2KJHB 1C1YB 3PZDA 4MELA 1TTNA 2KNBA 4HDOA 4W9JA 2DYMA 4KDIC 3LDZE 3TIXA 1CMXB 4G0NB 2ZNVB 5CHWA 2FCSA 3VXWA 3A4RA 1WR1A 3H7PB 2DZJA 2LXAA 4PYZA 5KHOA 2CHWA 3K9PB 3PPAA 4TUUA 1ZW7A 2B3AA 5J2RA 4W9FA 3QX1A 5HKHA 3M62B 1G6JA 5BO4B 2AL3A 3U8ZA 2G45B 4KIKB 4MGZE 3AU4A 2DYOA 3VFKA 4XC2A 3ML8A 5JH5C 3UIOB 4GMVA 2CR5A 4EOYA 1KM7A 2A4ZA 1TGZB 2KDBA 2MA9B 3JYUA 4GGQA 3U30A 2G4DB 5LXIB 1RRBA 1E90A 3A1QB 4I6PA 3TJPA 1WFYA 3P2BA 4W9GA 3V6EB 4P7IA 4DBGA 2XK5A 2KJ6A 2KTFA 1WJNA 1WIAA 2MP2A 3K9OB 2FCNA 3VAWA 1WY8A 2BPSA 1D3ZA 2LRWA 1V9JA 3PV1A 4FJZA 4FULA 4II2B 2ZCBA 1QZEA 2KOXA 3DOWA 2JVCA 3QIJA 2MRPA 3H6NA 3IFWB 2IZVB 3DVNU 4GB9A 4IWPA 5G2NA 3S2AA 4NAWA 3RZFA 4DWFA 3UQAA 2LWPA 1Q5WB 1F9JA 2KLCA 1HE8A 1E7VA 2A5UA 4KZ0A 3WA0A 4G11A 2KQSA 3W1SA 4NY0A 3R7RA 1WZ3A 2D2QA 1UH6A 2KTRB 2LVOA 4PS7A 4A3PA 4DXAB 3DDCB 4MSQB 5DPWA 3PLUA 2ZNVC 1ISNA 2FIFA 2NCNA 4DHJD 2NPTB 5E6NA 1LFDA 1X1MA 2G4SA 3H7PA 3UINB 1S1QB 4IW0A 3JW0X 4DHZB 3SDLC 2AL6A 2ZPNA 4GDKA 1YIWA 3ALBA 4MJSB 4PS3A 1SE9A 5D2MB 3RD2A 2MCNB 5G55A 4ICVA 4B9KA 4BOSC 4OVVA 1SGHA 2KC1A 4NQLB 1WM3A 5IA7A 2K6DB 2NBVB 4WWPA 1WRDB 2KVRA 2M4NA 3A9JA 2K25A 3DBRI 2PE6B 4ZRKA 4FADA 4FJYA 4LCDE 3L08A 2ASQA 2LGYA 4JLCA 2RPQA 4EUTA 3SD5A 4E3CA 2C9WB 4W9EA 1WF9A 4II3B 3X0WA 3EC8A 3IG3A 4EZKA 2BKFA 3ML9A 4DHZE 2MBQA 2NBUA 4WQOB 1V49A 4IWOA 2BF8B 2ZVOA 2DENB 3KYCD 2DYBA 4HCNB 3NZUA 2HJ8A 2DZIA 1GG3A 1WX7A 1JRUA 2MLBA 2EMTA 4IC7B 4ANXA 2JWZA 3VH3B 3WAOA 2GBKA 2JZZA 1IP9A 2KLGA 4PYUA 4BKGA 2KFKA 1WE7A 2O6VD 4A3OA 3TL5A 3ZKJC 3VHTC 3TCAA 4URKA 2M1MA 3PRMB 1FXTB 3H7SA 3VUXA 4F7ZA 4B95A 2K6QA 2Z59B 4MGYE 3A4SC 2N7EA 3GOEA 2N7DA 1A5RA 1WX9A 3KVFB 3ZW3A 3ZLZA 3CSFA 4HVBA 1L2NA 2JT4B 2MW5A 1BT0A 5JHAA 3UF8A 4AOFA 1P98A 2RSUA 1OEYJ 2G3QB 3OJ3A 3PGEA 4NAWB 3IHPC 3QQ8B 4AJYB 1P3QU 1OTRB 2R2OA 2JZ3B 4W9IA 3Q3JA 4KSLC 3B08A 2LVPA 4HPLB 3T9LA 5AZFA 4TQ0A 5AZGA 2KO3A 3QCAA 1E8WA 1E8ZA 1KJTA 3PSEB 3DVGY 4G3XB 4HDQA 3TBLD 1UGMA 3L10B 1I35A 1V6EA 1YJ1A 2L8JA 2ZPYA 4GXBA 4KZCA 3TMPB 1C3TA 2D07B 2L3ZA 4MH0E 4PS8A 3WANA 4I6LB 3ONSA 1P9DU 4LJOB 1GC6A 2K8HA 4BKTA 3EECA 2KQ7A 2M17A 2CKHB 1Y8RC 5CHFA 3PT2B 4ZYNA 2Z0EB 4MM3A 3V60A 4MDKE 4GDKB 3B1LX 3DPDA 1V2YA 4W9KA 4JQWC 4ZRIA 1UD7A 2W9NA 2BYEA 3VUYA 1YX6B 2HE7A 2GBNA 3H1UA 4HXDA 4IWQA 5TR5A 1EO6A 2IYDB 1UZXB 2Y5BB 3A9JB 3QHTA 4MEMA 4KSKC 3ZUNA 4IM0A 3M3JA 5EDSA 1IPGA 4B6WA 4ZRJA 1R4NI 2N9XA 2N1WA 3PVLA 5DPTA 1Z2MA 3KUDB 1S3SG 4MGKE 2D3GA 3EFUA 3I3TB 2KHWB 2MBBB 4NQKE 5DPSA 4LDTB 2N9EB 4OVUA 5C23A 2KX0A 1WJ4A 3UGBB 1KLVA 4DDID 4HJKA 3AXCA 3RT3B 3ZTCA 1PQSA 2UWQA 3QJZA 3W1SC 3UIPB 4TKNA 1P1AA 4YL8A 2FAZA 4K7UA 3A33B 3L17A 4ASWC 4MSMB 3KYDD 1OEYA 3DBHI 3EHVA 3A9KB 2KFKB 3RULA 2NVUI 2WX1A 1IYFA 2XEWA 4K7WA 3ZNGC 2CU1A 1XQQA 2HD5B 2NBWB 3JVZX 4HK2A 1WI0A 5AEKB 1I42A 1Q1OA 2REXA 3ECIA 2IO3B 3ENEA 3MJWA 5C1ZA 5L83A 4DK5A 1H8CA 3ZRFA 4G50A 4ANUA 3QC8B 2V1YA 1VCBA 2KD0A 4BOZB 4GN1A 1NDDA 1UELA 3NY5A 2C7NB 1WJUA 1V81A 1ZGUB 2L76A 1Q0WB 3NHEB 1GNUA 2ZEQA 3BINA 2IY0B 3ZRCA 3HHMA 3VTVA 1TZ1A 4F8CB 1RAXA 3QWZB 2I1KA 3RZWC 3DVNV 3BY4B 2UYZB 1WXVA 1NI2A 2ZCCA 3L54A 4GDLB 3ZNID 3PTFC 1WGRA 4I6NB 1WJ6A 1WM2A 2N4FA 3NZSA 2DAJA 4EEWA 4JL9A 4BBNF 4BVUC 4W9HA 2MX2A 3PHWB 5LXHA 2BYFA 5LLIA 5D7GA 3H9DA 2C7HA 1WX8A 4N9F4 3VH4B 2J0KA 5IAAC 4FHJA 1EF5A 1V5OA 2CHZA 2L0FA 3SHQA 3A9KA 2L0TA 2FUHB 1EUVB 2GBJA 3V6CB 3IVFA 3UQBA 3VTUA 2V4LA 4K7SA 4GOCA 4HPMB 4BKSD 3WALA 2R2QA 2AWTA 1WH3A 2EMSA 1V86A 2LD9A 3MHSD 2GBMA 2LJ5A 2K8CA 3VUWA 2KN5A 3V62A 1RFAA 4LJPB 2BKRB 3N30A 4W9LA 3ZVVA 2JXXA 3CSTA 3PRZA 1OGWA 4NNJB 1K8RB 4RM8A 3C0RB 3N3KB 1E7UA 2YLMA 2O2VA 4HWIB 5CTRC 3PS6A 3CMMB 4IUMB 5FR6A 4ANWA 2M0XA 2O6VA 1WMHA 3RCZA 4GDLA 2KANA 4DDGD 2KWVB 3NS8A 3HK0A 3Q3FA 1L7YA 3AULA 4GU2A 2MBHA 3QK0A 1NBFC 4TQ1A 1H4RA 4HCPB 3GZNI 1AARA 2K39A 3OAWA 1TBEA 3ZDMC 5D6JB 3M95A 3R7QA 4AUQC 2C7MB 3APDA 3L0WB 2WWZA 1ZKHA 2IO2B 3OJ4B 3B0AA 4KDLB 3QAQA 1E5WA 4HLEA 4ICUA 3T8MA 2JRIB 2AYOB 4WAAA 4F1SA 5JHBA 3O65B 1KOTA 4XX5A 1EF1A 1WXAA 2MSED 2FIDA 3X23A 3VVWB 4FBJB 4AJWA 2KWCA 2RGFA 3R66C 4KV2A 1WGHA 3VTWA 4WJNA 2LUEA 2IO1B 2IO0B 5CX3A 2MWSB 3L16A 4W9DA 3DQVA 1WYWB 2KWUB 1V5TA 2QHOA 1RLFA 4FLHA 4DHJB 2JUOA 3U7DA 3ZO5B 4XZ4A 3LJ3A 3HM6X 2DZMA 4ANVA 5D94A 2V3SA 4EZLA 1WZ0A 2D10A 4JIOU 2D11A 2MBOA 1XD3B 2BWES 2WYQA 2XBBC 2L00B 2J7QB 4FA6A 2DX5B 5GMVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M63 B;  1J19 A;  1WGD A;  2AEH A;  1GC7 A;  2C5L C;  2LRU A;  5J18 A;  1LM8 B;  2CHX A;  2L05 A;  2KFJ A;  3ZTD A;  3QA8 A;  2PE9 A;  5KHQ A;  3RYT A;  2JRH A;  3CF6 E;  4CO7 A;  3RUI B;  4GIV A;  2PEA A;  4CYE A;  5AZH A;  4WJO A;  2IY1 B;  1XT9 B;  4BBN C;  2RR9 A;  2WX0 A;  1WGY A;  4EFO A;  2LZ6 A;  4ZDV A;  3JSV B;  2LAS A;  4IM3 A;  2L7R A;  2DHZ A;  2J0J A;  2C60 A;  4NJ6 A;  4AP4 C;  2KMA A;  2FCQ A;  2KDF B;  4IM2 A;  4EZJ A;  4FJV B;  2FNJ B;  4JGH B;  3WIM A;  3R3M A;  4GSW A;  2ZZP B;  4WJQ A;  2FCM A;  2K8B A;  2O2V B;  2OOB B;  1UBI A;  3PLV A;  4M0W B;  3DCG A;  3SU8 X;  2KDI A;  2KC2 A;  2RD0 A;  4NPN A;  2O6V B;  1WMH B;  4K81 A;  3W1Y A;  2JY6 A;  3HIZ A;  4IG7 B;  3OLM D;  4LDT D;  2YVC A;  1YD8 U;  4NJ7 A;  3L13 A;  4KIK A;  1WE6 A;  5DCN A;  3WAP A;  2KXJ A;  3ZNZ B;  4M8M A;  1WGG A;  1WXM A;  3PRE A;  3AI5 A;  2GMI C;  3A1Q A;  4E71 A;  2J0M A;  4AWJ A;  1R4M I;  2DZK A;  1SIF A;  2HTH A;  3HM3 A;  5DPR A;  3VDZ A;  1YQB A;  2JF5 A;  3APC A;  3KUC B;  3MTN B;  3NOB A;  2LXC A;  3KW5 B;  2M8S A;  2LVQ A;  2WDT B;  2ZVN A;  2K1F A;  3QAR A;  1YX5 B;  2DAF A;  4A20 A;  2NR2 A;  2VRR B;  2MQJ A;  2I1J A;  4KVG B;  1Z5S B;  2KJR A;  3ZDT A;  3JSV A;  1V80 A;  2LGD A;  3ZNH B;  2MBE A;  1LXD A;  3APF A;  2PJH A;  4MGI E;  5E6O A;  2OJR A;  4RMA A;  4M8N A;  2KK8 A;  3D32 A;  2ZJD A;  1P0R A;  2KZR A;  3DVG X;  2CS4 A;  3V61 A;  5J17 A;  2KTR A;  1OQY A;  2KDE B;  3DBL I;  3IBE A;  3DBS A;  1E8Y A;  2LGX A;  4TV3 A;  2IBI B;  2NPT A;  4EKU A;  1GUA B;  5L95 C;  1LQB A;  3AU5 A;  2Z0D B;  3PRP B;  2LI5 A;  2KX3 A;  3PHX B;  1MG8 A;  3KH0 A;  4J6I A;  4WWN A;  2PPH A;  4E74 A;  2XK5 B;  4WWO A;  2MP2 B;  3KUZ A;  4BKS A;  2GBR A;  4MJS A;  1U4A A;  4K1R B;  2N9P C;  1M94 A;  1T0Y A;  4RM9 A;  4WJP A;  1J0G A;  2BGF A;  2GOW A;  2BWF A;  2JPH A;  2KMC A;  4FN2 A;  4W9C A;  4CHK A;  1GJZ A;  2KKC A;  2BYV E;  4BFR A;  1WR6 E;  1WXS A;  3VQI A;  5E6P A;  3N32 A;  2NS5 A;  5CHV C;  2N1V A;  1J8C A;  4FHK A;  2EKE C;  3ZIM A;  1VD2 A;  4X57 B;  1UBQ A;  5JZE B;  3WAM A;  1E8X A;  2KJH B;  1C1Y B;  3PZD A;  4MEL A;  1TTN A;  2KNB A;  4HDO A;  4W9J A;  2DYM A;  4KDI C;  3LDZ E;  3TIX A;  1CMX B;  4G0N B;  2ZNV B;  5CHW A;  2FCS A;  3VXW A;  3A4R A;  1WR1 A;  3H7P B;  2DZJ A;  2LXA A;  4PYZ A;  5KHO A;  2CHW A;  3K9P B;  3PPA A;  4TUU A;  1ZW7 A;  2B3A A;  5J2R A;  4W9F A;  3QX1 A;  5HKH A;  3M62 B;  1G6J A;  5BO4 B;  2AL3 A;  3U8Z A;  2G45 B;  4KIK B;  4MGZ E;  3AU4 A;  2DYO A;  3VFK A;  4XC2 A;  3ML8 A;  5JH5 C;  3UIO B;  4GMV A;  2CR5 A;  4EOY A;  1KM7 A;  2A4Z A;  1TGZ B;  2KDB A;  2MA9 B;  3JYU A;  4GGQ A;  3U30 A;  2G4D B;  5LXI B;  1RRB A;  1E90 A;  3A1Q B;  4I6P A;  3TJP A;  1WFY A;  3P2B A;  4W9G A;  3V6E B;  4P7I A;  4DBG A;  2XK5 A;  2KJ6 A;  2KTF A;  1WJN A;  1WIA A;  2MP2 A;  3K9O B;  2FCN A;  3VAW A;  1WY8 A;  2BPS A;  1D3Z A;  2LRW A;  1V9J A;  3PV1 A;  4FJZ A;  4FUL A;  4II2 B;  2ZCB A;  1QZE A;  2KOX A;  3DOW A;  2JVC A;  3QIJ A;  2MRP A;  3H6N A;  3IFW B;  2IZV B;  3DVN U;  4GB9 A;  4IWP A;  5G2N A;  3S2A A;  4NAW A;  3RZF A;  4DWF A;  3UQA A;  2LWP A;  1Q5W B;  1F9J A;  2KLC A;  1HE8 A;  1E7V A;  2A5U A;  4KZ0 A;  3WA0 A;  4G11 A;  2KQS A;  3W1S A;  4NY0 A;  3R7R A;  1WZ3 A;  2D2Q A;  1UH6 A;  2KTR B;  2LVO A;  4PS7 A;  4A3P A;  4DXA B;  3DDC B;  4MSQ B;  5DPW A;  3PLU A;  2ZNV C;  1ISN A;  2FIF A;  2NCN A;  4DHJ D;  2NPT B;  5E6N A;  1LFD A;  1X1M A;  2G4S A;  3H7P A;  3UIN B;  1S1Q B;  4IW0 A;  3JW0 X;  4DHZ B;  3SDL C;  2AL6 A;  2ZPN A;  4GDK A;  1YIW A;  3ALB A;  4MJS B;  4PS3 A;  1SE9 A;  5D2M B;  3RD2 A;  2MCN B;  5G55 A;  4ICV A;  4B9K A;  4BOS C;  4OVV A;  1SGH A;  2KC1 A;  4NQL B;  1WM3 A;  5IA7 A;  2K6D B;  2NBV B;  4WWP A;  1WRD B;  2KVR A;  2M4N A;  3A9J A;  2K25 A;  3DBR I;  2PE6 B;  4ZRK A;  4FAD A;  4FJY A;  4LCD E;  3L08 A;  2ASQ A;  2LGY A;  4JLC A;  2RPQ A;  4EUT A;  3SD5 A;  4E3C A;  2C9W B;  4W9E A;  1WF9 A;  4II3 B;  3X0W A;  3EC8 A;  3IG3 A;  4EZK A;  2BKF A;  3ML9 A;  4DHZ E;  2MBQ A;  2NBU A;  4WQO B;  1V49 A;  4IWO A;  2BF8 B;  2ZVO A;  2DEN B;  3KYC D;  2DYB A;  4HCN B;  3NZU A;  2HJ8 A;  2DZI A;  1GG3 A;  1WX7 A;  1JRU A;  2MLB A;  2EMT A;  4IC7 B;  4ANX A;  2JWZ A;  3VH3 B;  3WAO A;  2GBK A;  2JZZ A;  1IP9 A;  2KLG A;  4PYU A;  4BKG A;  2KFK A;  1WE7 A;  2O6V D;  4A3O A;  3TL5 A;  3ZKJ C;  3VHT C;  3TCA A;  4URK A;  2M1M A;  3PRM B;  1FXT B;  3H7S A;  3VUX A;  4F7Z A;  4B95 A;  2K6Q A;  2Z59 B;  4MGY E;  3A4S C;  2N7E A;  3GOE A;  2N7D A;  1A5R A;  1WX9 A;  3KVF B;  3ZW3 A;  3ZLZ A;  3CSF A;  4HVB A;  1L2N A;  2JT4 B;  2MW5 A;  1BT0 A;  5JHA A;  3UF8 A;  4AOF A;  1P98 A;  2RSU A;  1OEY J;  2G3Q B;  3OJ3 A;  3PGE A;  4NAW B;  3IHP C;  3QQ8 B;  4AJY B;  1P3Q U;  1OTR B;  2R2O A;  2JZ3 B;  4W9I A;  3Q3J A;  4KSL C;  3B08 A;  2LVP A;  4HPL B;  3T9L A;  5AZF A;  4TQ0 A;  5AZG A;  2KO3 A;  3QCA A;  1E8W A;  1E8Z A;  1KJT A;  3PSE B;  3DVG Y;  4G3X B;  4HDQ A;  3TBL D;  1UGM A;  3L10 B;  1I35 A;  1V6E A;  1YJ1 A;  2L8J A;  2ZPY A;  4GXB A;  4KZC A;  3TMP B;  1C3T A;  2D07 B;  2L3Z A;  4MH0 E;  4PS8 A;  3WAN A;  4I6L B;  3ONS A;  1P9D U;  4LJO B;  1GC6 A;  2K8H A;  4BKT A;  3EEC A;  2KQ7 A;  2M17 A;  2CKH B;  1Y8R C;  5CHF A;  3PT2 B;  4ZYN A;  2Z0E B;  4MM3 A;  3V60 A;  4MDK E;  4GDK B;  3B1L X;  3DPD A;  1V2Y A;  4W9K A;  4JQW C;  4ZRI A;  1UD7 A;  2W9N A;  2BYE A;  3VUY A;  1YX6 B;  2HE7 A;  2GBN A;  3H1U A;  4HXD A;  4IWQ A;  5TR5 A;  1EO6 A;  2IYD B;  1UZX B;  2Y5B B;  3A9J B;  3QHT A;  4MEM A;  4KSK C;  3ZUN A;  4IM0 A;  3M3J A;  5EDS A;  1IPG A;  4B6W A;  4ZRJ A;  1R4N I;  2N9X A;  2N1W A;  3PVL A;  5DPT A;  1Z2M A;  3KUD B;  1S3S G;  4MGK E;  2D3G A;  3EFU A;  3I3T B;  2KHW B;  2MBB B;  4NQK E;  5DPS A;  4LDT B;  2N9E B;  4OVU A;  5C23 A;  2KX0 A;  1WJ4 A;  3UGB B;  1KLV A;  4DDI D;  4HJK A;  3AXC A;  3RT3 B;  3ZTC A;  1PQS A;  2UWQ A;  3QJZ A;  3W1S C;  3UIP B;  4TKN A;  1P1A A;  4YL8 A;  2FAZ A;  4K7U A;  3A33 B;  3L17 A;  4ASW C;  4MSM B;  3KYD D;  1OEY A;  3DBH I;  3EHV A;  3A9K B;  2KFK B;  3RUL A;  2NVU I;  2WX1 A;  1IYF A;  2XEW A;  4K7W A;  3ZNG C;  2CU1 A;  1XQQ A;  2HD5 B;  2NBW B;  3JVZ X;  4HK2 A;  1WI0 A;  5AEK B;  1I42 A;  1Q1O A;  2REX A;  3ECI A;  2IO3 B;  3ENE A;  3MJW A;  5C1Z A;  5L83 A;  4DK5 A;  1H8C A;  3ZRF A;  4G50 A;  4ANU A;  3QC8 B;  2V1Y A;  1VCB A;  2KD0 A;  4BOZ B;  4GN1 A;  1NDD A;  1UEL A;  3NY5 A;  2C7N B;  1WJU A;  1V81 A;  1ZGU B;  2L76 A;  1Q0W B;  3NHE B;  1GNU A;  2ZEQ A;  3BIN A;  2IY0 B;  3ZRC A;  3HHM A;  3VTV A;  1TZ1 A;  4F8C B;  1RAX A;  3QWZ B;  2I1K A;  3RZW C;  3DVN V;  3BY4 B;  2UYZ B;  1WXV A;  1NI2 A;  2ZCC A;  3L54 A;  4GDL B;  3ZNI D;  3PTF C;  1WGR A;  4I6N B;  1WJ6 A;  1WM2 A;  2N4F A;  3NZS A;  2DAJ A;  4EEW A;  4JL9 A;  4BBN F;  4BVU C;  4W9H A;  2MX2 A;  3PHW B;  5LXH A;  2BYF A;  5LLI A;  5D7G A;  3H9D A;  2C7H A;  1WX8 A;  4N9F 4;  3VH4 B;  2J0K A;  5IAA C;  4FHJ A;  1EF5 A;  1V5O A;  2CHZ A;  2L0F A;  3SHQ A;  3A9K A;  2L0T A;  2FUH B;  1EUV B;  2GBJ A;  3V6C B;  3IVF A;  3UQB A;  3VTU A;  2V4L A;  4K7S A;  4GOC A;  4HPM B;  4BKS D;  3WAL A;  2R2Q A;  2AWT A;  1WH3 A;  2EMS A;  1V86 A;  2LD9 A;  3MHS D;  2GBM A;  2LJ5 A;  2K8C A;  3VUW A;  2KN5 A;  3V62 A;  1RFA A;  4LJP B;  2BKR B;  3N30 A;  4W9L A;  3ZVV A;  2JXX A;  3CST A;  3PRZ A;  1OGW A;  4NNJ B;  1K8R B;  4RM8 A;  3C0R B;  3N3K B;  1E7U A;  2YLM A;  2O2V A;  4HWI B;  5CTR C;  3PS6 A;  3CMM B;  4IUM B;  5FR6 A;  4ANW A;  2M0X A;  2O6V A;  1WMH A;  3RCZ A;  4GDL A;  2KAN A;  4DDG D;  2KWV B;  3NS8 A;  3HK0 A;  3Q3F A;  1L7Y A;  3AUL A;  4GU2 A;  2MBH A;  3QK0 A;  1NBF C;  4TQ1 A;  1H4R A;  4HCP B;  3GZN I;  1AAR A;  2K39 A;  3OAW A;  1TBE A;  3ZDM C;  5D6J B;  3M95 A;  3R7Q A;  4AUQ C;  2C7M B;  3APD A;  3L0W B;  2WWZ A;  1ZKH A;  2IO2 B;  3OJ4 B;  3B0A A;  4KDL B;  3QAQ A;  1E5W A;  4HLE A;  4ICU A;  3T8M A;  2JRI B;  2AYO B;  4WAA A;  4F1S A;  5JHB A;  3O65 B;  1KOT A;  4XX5 A;  1EF1 A;  1WXA A;  2MSE D;  2FID A;  3X23 A;  3VVW B;  4FBJ B;  4AJW A;  2KWC A;  2RGF A;  3R66 C;  4KV2 A;  1WGH A;  3VTW A;  4WJN A;  2LUE A;  2IO1 B;  2IO0 B;  5CX3 A;  2MWS B;  3L16 A;  4W9D A;  3DQV A;  1WYW B;  2KWU B;  1V5T A;  2QHO A;  1RLF A;  4FLH A;  4DHJ B;  2JUO A;  3U7D A;  3ZO5 B;  4XZ4 A;  3LJ3 A;  3HM6 X;  2DZM A;  4ANV A;  5D94 A;  2V3S A;  4EZL A;  1WZ0 A;  2D10 A;  4JIO U;  2D11 A;  2MBO A;  1XD3 B;  2BWE S;  2WYQ A;  2XBB C;  2L00 B;  2J7Q B;  4FA6 A;  2DX5 B;  5GMV A; 
#chains in the Genus database with same CATH topology
 2WDV B;  1TKE A;  1LM8 B;  1QQR A;  5KHQ A;  3RYT A;  2L83 A;  4GIV A;  4KX6 B;  5AZH A;  4BBN C;  1WGY A;  4A6Q A;  2C60 A;  4LNK A;  1I4X A;  2FCQ A;  2KDF B;  4LK0 M;  4FJV B;  3R3M A;  2OOB B;  3Q69 A;  2LFI A;  3DCG A;  1JAL A;  2KC2 A;  4NPN A;  3GE3 C;  3OLM D;  2YVC A;  1YD8 U;  3DWM A;  1K50 A;  1WRI A;  2D3B A;  5AUI A;  4M8M A;  5HFY A;  1WGG A;  3PRE A;  3AI5 A;  3IT6 B;  2UU7 A;  1NYQ A;  2DZK A;  2HTH A;  1B9R A;  1YQB A;  1N63 A;  3Q3O C;  3FIL B;  3AEC B;  3KUC B;  3KW5 B;  5IO9 A;  2LVQ A;  2WDT B;  2QC8 A;  4NJC A;  4XWT A;  4IKG A;  2WU2 B;  1Z5S B;  3JSV A;  2MBE A;  1V1P B;  4RMA A;  3D32 A;  2KTR A;  3DBL I;  1K53 A;  3PZ7 A;  4A8X C;  4TV3 A;  3MP9 A;  2JU6 X;  1LQB A;  3AU5 A;  2Z0D B;  3PRP B;  3KH0 A;  3AM9 A;  4RGN A;  2PPH A;  3IT4 B;  2XK5 B;  1TS3 A;  4MJS A;  1TS4 A;  1M94 A;  1PGX A;  4A55 A;  2BGF A;  2V3P A;  2JPH A;  2BYV E;  3Q3N C;  4US9 A;  1E6E B;  2NS5 A;  5CHV C;  1N62 A;  1J8C A;  1FCL A;  1T0Q C;  4X57 B;  3N20 C;  1UBQ A;  5HG2 A;  1TJE A;  1C76 A;  1QOA A;  2KAJ A;  3ETR A;  4KKI A;  3PZD A;  1EWY C;  1ZXH A;  5I4D A;  4W9J A;  5EE3 A;  2DYM A;  1L0V B;  4G0N B;  2ZNV B;  5CHW A;  3RNC C;  3A4R A;  3H7P B;  5KHO A;  1LGR A;  2CHW A;  2IJ0 A;  1ET9 A;  2B3A A;  2VH1 A;  4W9F A;  5J2R A;  1G6J A;  1D5X C;  4MT5 A;  4MGZ E;  2DYO A;  4GMV A;  2CR5 A;  4KGT A;  2G4D B;  4WIP A;  3TJP A;  1WFY A;  4W9G A;  3V6E B;  3W5V B;  3AE4 B;  2BPS A;  3PV1 A;  4FUL A;  4II2 B;  3NVY A;  1QZE A;  2ACZ B;  1HZ6 A;  2IZV B;  3UQA A;  2E6X A;  3NRZ A;  3SFE B;  1HE8 A;  1SBB B;  2A5U A;  3WA0 A;  4G11 A;  3W1S A;  4NY0 A;  2KTR B;  4DXG A;  3PLU A;  1MJD A;  1ISN A;  1FFV A;  2G4S A;  3UIN B;  1S1Q B;  2XNA C;  3W9C B;  3JW0 X;  4DHZ B;  4YSX B;  2M19 A;  1KLU D;  2N7J A;  2J53 A;  4MJS B;  1SE9 A;  3RD2 A;  4ICV A;  4JPS A;  2IGG A;  4WWP A;  1WRD B;  2KVR A;  2M4N A;  3A9J A;  3DBR I;  1C9F A;  1C4A A;  2PE6 B;  2WXQ A;  3P4S B;  4FAD A;  2WXK A;  2BVC A;  3L08 A;  2ASQ A;  1MFW A;  3AE8 B;  4YTM B;  4ARI A;  5T8I A;  2IND C;  5BYQ A;  4II3 B;  3EC8 A;  2WXP A;  1XLP A;  4HCN B;  2DEN B;  3DHH C;  1JRU A;  2EMT A;  4KGS A;  4MM3 B;  3N9Y C;  1TS5 A;  3WAO A;  2GBK A;  1WE7 A;  2INC C;  3ZKJ C;  2PKO A;  4URK A;  3PRM B;  2N0S B;  3H7S A;  1V97 A;  1L6V A;  3ZLZ A;  4HVB A;  1BT0 A;  3ZYY X;  1J7B A;  1P98 A;  1OEY J;  3PGE A;  1HEZ E;  2KMM A;  2GI9 A;  4AJY B;  3Q3J A;  4HPL B;  4HDQ A;  1I35 A;  4XDC A;  1PYW D;  1YJ1 A;  3TMP B;  2AQ2 B;  4PS8 A;  2L3Z A;  2AQ3 B;  5BMH A;  3IAS 1;  4ZYN A;  2Z0E B;  3V60 A;  4MDK E;  4HRO A;  3B1L X;  3U52 E;  2W9N A;  1AW7 A;  1QOG A;  3Q6B A;  2IYD B;  1UZX B;  3QHT A;  3A9J B;  3ZUN A;  4MEM A;  3M3J A;  3GB1 A;  1R4N I;  3PVL A;  5DPT A;  1TKG A;  2OJW A;  5DPS A;  4LDT B;  1N6Z A;  3UGB B;  2WXJ A;  4DDI D;  3ZTC A;  1FO4 A;  4YL8 A;  2FAZ A;  2M56 B;  3RNF C;  5IKC M;  3DBH I;  2ONQ A;  3RUL A;  3RNB C;  4RF1 A;  1YN4 A;  2XEW A;  2M0A A;  3URY A;  3AMZ A;  3GP7 A;  1I42 A;  5BMI A;  1H8C A;  4DK5 A;  2FBW B;  3GZN B;  2INP E;  5G5G A;  4ANU A;  4GN1 A;  2C7N B;  1UNS A;  1ZGU B;  1GNU A;  2IY0 B;  3N1Y C;  1TZ1 A;  1MHH E;  3QWZ B;  3DVN V;  3BY4 B;  4GDL B;  4AQ7 A;  1WM2 A;  1PGB A;  3ZXR A;  4EEW A;  4BVU C;  2MX2 A;  1IUE A;  5LLI A;  5D7G A;  2JWU A;  1WX8 A;  4Q2J A;  5IAA C;  3VRB B;  2PVO D;  2WXF A;  2CU3 A;  4HPM B;  4BKS D;  3WAL A;  2AWT A;  2EMS A;  2ON8 A;  1B1Z A;  2GBM A;  3I57 A;  3VUW A;  1RFA A;  1GOZ A;  3ZVV A;  3CST A;  3PRZ A;  1OGW A;  3ZGZ A;  3C0R B;  2WHI A;  4M0W A;  2M0X A;  2O6V A;  2KAN A;  2KWV B;  1L7Y A;  1ZP0 B;  3BVM A;  3QK0 A;  4TQ1 A;  3GZN I;  3H8H A;  2K39 A;  5EE0 A;  2BYT A;  3ZDM C;  1OQQ A;  3B2F A;  4WH4 A;  3R7Q A;  4AUQ C;  1ZDX A;  4KDL B;  1MG4 A;  4HLE A;  3P4Q B;  2JRI B;  1WWT A;  2AYO B;  5JHB A;  2FID A;  3X23 A;  1CZP A;  2RGF A;  2JXT A;  3MC8 A;  1WGH A;  4YTN B;  3VTW A;  2LUE A;  2IO1 B;  2QIE B;  2IO0 B;  1YQ3 B;  1TS2 A;  1STE A;  2MWS B;  3CIR B;  3L16 A;  4XE0 A;  3DQV A;  1WYW B;  1V5T A;  4FLH A;  1RLF A;  1VR9 A;  4A90 A;  3ZO5 B;  3RNG C;  3RN9 C;  4P16 A;  3SR6 A;  2BTE A;  3AE7 B;  2D11 A;  1XD3 B;  2WYQ A;  2I1K A;  1XXG A;  4FA6 A;  2PEA A;  4YSY B;  1GC7 A;  2C5L C;  1LO5 D;  3ZTD A;  1F52 A;  4OZC A;  4CO7 A;  3AED B;  3RUI B;  4CYE A;  4WJO A;  1XT9 B;  2WX0 A;  1XO3 A;  4OZA A;  2V9H A;  4OW0 A;  1VLB A;  2QEJ C;  2L7R A;  2LGS A;  3AEA B;  4EZJ A;  3AEF B;  4D2K A;  4GSW A;  2ZZP B;  2FCM A;  2K8B A;  3PLV A;  4M0W B;  1T0R C;  2R61 A;  2O6V B;  4K81 A;  4IG7 B;  3L13 A;  2PVG C;  4KIK A;  5DCN A;  1MI0 A;  2GMI C;  4E71 A;  4AWJ A;  3RNE C;  1R4M I;  1MHX A;  4C56 C;  2JF5 A;  4MH8 A;  2LXC A;  2ZVN A;  2K1F A;  2WGS A;  1C79 A;  2DAF A;  4A20 A;  4KVG B;  2KJR A;  1LXD A;  4ZRQ A;  3U2S C;  3GS2 A;  5E6O A;  2OJR A;  1JW9 D;  2KK8 A;  4RH6 A;  2ZJD A;  1P0R A;  1HXY D;  3DVG X;  1OQY A;  2Y5C A;  3DBS A;  4QAY A;  1E8Y A;  2LGX A;  2IBI B;  1GUA B;  5L95 C;  3N1Z C;  1JML A;  2J42 A;  4J6I A;  3KUZ A;  2K3U A;  2GBR A;  3I9V 1;  4K1R B;  2N9P C;  4RM9 A;  1WXQ A;  4WJP A;  1J0G A;  5BYS A;  4KGR A;  2KMC A;  4CHK A;  2JYT A;  1WR6 E;  5FK9 C;  2Y3A A;  5E6P A;  2K0P A;  3HUI A;  1I7H A;  3ZIM A;  5JZE B;  2KYW A;  1Y56 A;  4JX1 C;  1FXI A;  3LDZ E;  1RWS A;  3TIX A;  2FCS A;  3VXW A;  1WR1 A;  2DZJ A;  1F1H A;  1ZW7 A;  3M62 B;  2CJN A;  2AL3 A;  3U8Z A;  4KIK B;  2VH2 A;  4K3C A;  1C4P A;  3UIO B;  1AWD A;  1KM7 A;  2KDB A;  1EU4 A;  1RRB A;  3P2B A;  2RDB C;  2XK5 A;  1WJN A;  4C00 A;  4PT5 A;  3VAW A;  1D3Z A;  5C3J B;  1ENF A;  4ITK A;  1V9J A;  3NJT A;  3DVN U;  4DWF A;  4HKQ A;  4YXD B;  3AE1 B;  1WZ3 A;  1UH6 A;  3BWU D;  2QCZ A;  2KN4 A;  3DDC B;  4MSQ B;  2MJ3 A;  2WXN A;  5DPW A;  2ZNV C;  5FKA C;  4DHJ D;  5E6N A;  5C2T B;  3H7P A;  2I38 A;  2ZPN A;  1L0Y B;  4PS3 A;  1Q10 A;  5G55 A;  1SE2 A;  4B9K A;  1SGH A;  4NQL B;  3PO0 A;  5IA7 A;  2K6D B;  4FJY A;  3SFD B;  2RPQ A;  1YNT E;  3SD5 A;  1NI3 A;  2C9W B;  1WF9 A;  3X0W A;  2DBY A;  2MBQ A;  1V49 A;  4MAC A;  3KYC D;  2DYB A;  2HJ8 A;  2DZI A;  3ABV B;  1QOB A;  2JWZ A;  1IP9 A;  3SEB A;  1J7A A;  3KWV A;  3BVZ A;  1FXA A;  4RGO S;  4R3D A;  1JWA D;  1RYJ A;  2Z59 B;  3A4S C;  1WX9 A;  3KVF B;  4KKJ A;  3CSF A;  4C7Z A;  4N59 A;  3UF8 A;  2RSU A;  3OJ3 A;  3U4E G;  3IHP C;  1PDX A;  1OTR B;  2R2O A;  4JWS C;  2W3S A;  2JZ3 B;  3AE2 B;  4KSL C;  1D5Z C;  2SEB D;  2WXO A;  5AZF A;  4TQ0 A;  1E7P B;  3TBL D;  1E8Z A;  1KJT A;  4J3O D;  1UGM A;  2IPK D;  3L10 B;  2ZPY A;  4I6L B;  1P9D U;  1GC6 A;  2K8H A;  3Q3M C;  2M17 A;  5CHF A;  3PT2 B;  3R8B A;  4MM3 A;  4S17 A;  3DPD A;  4W9K A;  1V2Y A;  1PUT A;  1UD7 A;  4N58 A;  3H1U A;  3N1X C;  4P1C C;  1EO6 A;  4KSK C;  5EDS A;  1IPG A;  2N9X A;  2N1W A;  1S3S G;  3Q8A A;  2D3G A;  4HRS A;  3EFU A;  3I3T B;  1DOI A;  2MBB B;  4NQK E;  2N9E B;  4OVU A;  1RM6 C;  3QJZ A;  3W1S C;  4TKN A;  1P1A A;  4YTP B;  1SSN A;  4K7U A;  3A33 B;  2H88 B;  3L17 A;  1VRA B;  4ASW C;  4DXF A;  3KYD D;  1OEY A;  3FKY A;  1IYF A;  1TY0 A;  4YWG G;  2HD5 B;  2NBW B;  1WI0 A;  1ZOY B;  2REX A;  3MJW A;  3Q8C A;  3RMK C;  2V1Y A;  2WU5 B;  2KD0 A;  1WJU A;  1GB4 A;  1JQ4 A;  3NHE B;  3BIN A;  1SIJ A;  3ZRC A;  3VTV A;  4ZHO A;  1RAX A;  2WQY B;  1QKZ A;  3AH7 A;  3RZW C;  2UYZ B;  2WS3 B;  3L54 A;  1WGR A;  1I4G A;  4C7Y A;  4L1B A;  1WYG A;  4BBN F;  4W9H A;  1SJE D;  1YJJ A;  3PHW B;  3Q8F A;  4PK1 A;  5LXH A;  3H9D A;  3P63 A;  5H92 C;  1M4V A;  1OFF A;  3V6C B;  1TYG B;  3IVF A;  1D4B A;  5HI1 A;  2R2Q A;  1WH3 A;  3L4P A;  3AE6 B;  2K8C A;  3V62 A;  4W9L A;  2JXX A;  1K8R B;  4RM8 A;  3T3N A;  2SAK A;  3N3K B;  1DGJ A;  4HWI B;  3TSS A;  3CMM B;  2G9H D;  3RCZ A;  1VZ7 A;  4GDL A;  4WUR A;  3NS8 A;  3AV8 A;  2HJ1 A;  1H4R A;  2BB6 A;  3OAW A;  1YQ4 B;  2WXM A;  2ICI A;  1PGA A;  5BMG A;  1QLB B;  3IXS A;  4F1S A;  3O65 B;  1EF1 A;  1WXA A;  1XF5 L;  5CX3 A;  1I4R A;  1ROE A;  2V4I B;  3TEY A;  2QHO A;  1KRH A;  4DQO C;  4ANV A;  5D94 A;  3U7Z A;  4JIO U;  2XBB C;  2BQQ A;  1E5W A;  4BOS C;  1N5X A;  2RDG A;  1WGK A;  1J19 A;  1WGD A;  2LRU A;  2CHX A;  2L05 A;  2VZK D;  3NG0 A;  5IP4 D;  3QA8 A;  5AUK A;  4USA A;  2IY1 B;  1YN3 A;  2RR9 A;  2DNF A;  4H2A A;  4EFO A;  2LZ6 A;  5IOI A;  4ZDV A;  2YEP B;  1IBX B;  1YN5 A;  2J0J A;  4US8 A;  5D3I B;  4NJ6 A;  2KMA A;  3AE3 B;  4IM2 A;  3MC9 A;  2FNJ B;  4JGH B;  3BII D;  2KDM A;  3DWG C;  4M00 A;  4WJQ A;  3DHI C;  2KDI A;  3MJ5 A;  1QF6 A;  2JY6 A;  4NJ7 A;  2W82 A;  3WAP A;  1I4H A;  2NMQ A;  3ZNZ B;  3ZQ4 A;  4REZ A;  1AYF A;  3A1Q A;  3DHG C;  2IGD A;  2EEL A;  2DLB A;  3HM3 A;  2MH7 A;  3APC A;  3MTN B;  3NOB A;  4UDU C;  2WDQ B;  2MQJ A;  1E0Z A;  1V80 A;  2LGD A;  1SE3 A;  3ZNH B;  1QIL A;  3APF A;  1KTK A;  1V8C A;  2L1A A;  2KZR A;  1VZ8 A;  3V61 A;  2LJI A;  3P1M A;  5J17 A;  5MPO A;  4ZRP A;  5GXG B;  3IBE A;  1DOX A;  1XLN A;  4HEA 1;  2NPT A;  4EKU A;  1CK1 A;  1NVI D;  2LI5 A;  2Q5W D;  3PHX B;  1MG8 A;  4WWN A;  1N60 A;  4E74 A;  4WWO A;  2MP2 B;  1DOY A;  4BKS A;  2WXR A;  2KWD A;  2OHF A;  3E9S A;  2YEP F;  3BK2 A;  2GOW A;  2BWF A;  4W9C A;  1GJZ A;  4RCO A;  2LMC A;  1WXS A;  4RGT A;  3VQI A;  1P7F A;  4O1N A;  3N32 A;  2N1V A;  3NUH B;  4FHK A;  2EKE C;  1VD2 A;  3WAM A;  5FR3 A;  1L0X B;  1GPX A;  1C1Y B;  2EKI A;  1TTN A;  2KNB A;  4HDO A;  2AQ1 B;  4KDI C;  2BW2 A;  1XLQ A;  1CMX B;  1T6B X;  1TT5 B;  3K9P B;  2MHJ A;  2HDE A;  2QMT A;  5BO4 B;  2G45 B;  3AU4 A;  3VFK A;  1QT9 A;  4XC2 A;  4EOY A;  1TGZ B;  2Z8L A;  3A1Q B;  4DBG A;  4OVZ A;  1UWX A;  2KTF A;  3K9O B;  2RPV A;  3QIJ A;  5G5H A;  1FIQ A;  3H6N A;  3IFW B;  4GB9 A;  5G2N A;  4NAW A;  3RZF A;  4N6E B;  2LWP A;  1F9J A;  2KT7 A;  4KZ0 A;  4M02 A;  1SE4 A;  3KWL A;  4PS7 A;  2JQR B;  4DXA B;  2E3T A;  2FIF A;  2WXG A;  5EE9 A;  2NPT B;  1FPY A;  1X1M A;  3IAM 1;  2XN9 C;  4IW0 A;  3SDL C;  2AL6 A;  4GDK A;  2JZP A;  2V0G A;  3Q8B A;  2MCN B;  1NEN B;  2NBV B;  3R2I A;  1F2R I;  2BT6 A;  4LCD E;  1F0Z A;  1VZ6 A;  2LGY A;  3NZ3 A;  4HPP A;  4E3C A;  4W9E A;  2NTS A;  4EZK A;  4B0M A;  2V3N A;  2LGI A;  2NBU A;  2BF8 B;  4TSS A;  2ZVO A;  2WNM A;  3NZU A;  4WWM A;  3RI7 C;  4IC7 B;  3HRD D;  3VH3 B;  1ACC A;  4PYU A;  4BKG A;  2KFK A;  4L2Y A;  3VHT C;  2M1M A;  1FXT B;  2GRI A;  4B95 A;  2K6Q A;  4LNF A;  3BVG A;  4LTU A;  2INN E;  4IDI A;  3GOE A;  1T3Q A;  1A5R A;  3ZW3 A;  1I4P A;  4WQM A;  2D5G A;  2G3Q B;  4NAW B;  1SXT A;  3QQ8 B;  3AN1 A;  1P3Q U;  2LVP A;  3T9L A;  1XCQ L;  2KO3 A;  1E8W A;  4JE3 B;  1ESF A;  3QCA A;  3DVG Y;  2NTT A;  1FNU A;  1V6E A;  2L8J A;  4GXB A;  3WAN A;  1FEH A;  3TEW A;  1FRR A;  2KQ7 A;  3VR9 B;  2CKH B;  4HKZ E;  1ZPS A;  4GDK B;  3EUB 2;  1KFY B;  1YX6 B;  2GBN A;  5TR5 A;  4XWW A;  1I4Q A;  2Y5B B;  4IM0 A;  2Y5P A;  1J7C A;  3AB5 A;  4ZRJ A;  2MEK A;  3KUD B;  3NVW A;  4S0R A;  2KX0 A;  1KLV A;  3AXC A;  1PQS A;  2UWQ A;  3UIP B;  1KF6 B;  3DBL B;  2LEK A;  3EHV A;  3A9K B;  2KFK B;  2NVU I;  2RMM A;  2CU1 A;  4HK2 A;  5AEK B;  1Q1O A;  2IO3 B;  2N9K A;  4ZOH C;  3ZRF A;  3QC8 B;  3Q14 C;  1JRP A;  3VR8 B;  3TEX A;  1VCB A;  1F77 A;  4ZYS A;  1YOV B;  1V81 A;  2L76 A;  1Q0W B;  5D3D A;  3FC4 A;  3HHM A;  2W55 A;  1L6U A;  2ZCC A;  1NEK B;  3ZNI D;  4I6N B;  1WJ6 A;  3NZS A;  1JWU D;  3Q2A C;  3MHZ A;  3Q8E A;  2IDY A;  2CJO A;  2C7H A;  4RF0 A;  4N9F 4;  3VH4 B;  2J0K A;  4FHJ A;  1IGC A;  1EF5 A;  1V5O A;  1MPE A;  2L0F A;  3SHQ A;  2L0T A;  2PMV A;  4CQN A;  3VTU A;  4K7S A;  2LD9 A;  3MHS D;  1JRO A;  2LJ5 A;  2KN5 A;  4LJP B;  2AX5 A;  3P42 A;  4WAF A;  3C19 A;  4GLS C;  1TIF A;  2G1E A;  1FRD A;  2O2V A;  3PS6 A;  1WMH A;  4DDG D;  2GLS A;  3Q3F A;  1JWB D;  3AUL A;  2JX5 A;  1NBF C;  3W2D A;  1HQR D;  5D6J B;  3EGR A;  3L0W B;  3APD A;  4C80 A;  2WWZ A;  4NAM A;  1T0S C;  3OJ4 B;  3J9C A;  2WXL A;  4WAA A;  1EWC A;  3KQ4 A;  1YMH E;  4OZB A;  1XCT L;  2MSE D;  3VVW B;  3DBR B;  4AJW A;  3R66 C;  3AE5 B;  4WJN A;  4NZL B;  3EA6 A;  3UI3 A;  4W9D A;  4DHJ B;  1FMA D;  3HVZ A;  1MVK A;  3LJ3 A;  4XGA B;  3OWE B;  2V3S A;  3I5J C;  2D10 A;  2JYE A;  1FNV A;  2L00 B;  5GMV A;  3M63 B;  2QJL A;  1FCC C;  4L23 A;  2K22 A;  2AEH A;  2W54 A;  1WSP A;  5J18 A;  2KFJ A;  1UUP A;  2PE9 A;  2JRH A;  1JWM D;  3LYY A;  3CF6 E;  4XYC A;  2BS4 B;  1RFK A;  2BBC A;  2OED A;  4ACF A;  3T3O A;  3JSV B;  2LAS A;  4IM3 A;  2DHZ A;  4AP4 C;  3WIM A;  3O13 A;  2O2V B;  1ZXI A;  1UBI A;  1D5M C;  3SU8 X;  2RD0 A;  1E10 A;  1GB1 A;  1WMH B;  2BS2 B;  3W1Y A;  3HIZ A;  4LDT D;  1PFD A;  3ZJV A;  1FD6 A;  1WE6 A;  4OHJ A;  5TSS A;  2KXJ A;  1WXM A;  2J0M A;  1SIF A;  5DPR A;  3VDZ A;  1TKY A;  2M8S A;  2ZW1 A;  3BK1 A;  2PW9 A;  3QAR A;  1YX5 B;  2NR2 A;  2VRR B;  2I1J A;  3E56 A;  3ZDT A;  3BYY B;  5JXV A;  1IBX A;  3WCQ A;  1R4N B;  2PJH A;  4MGI E;  3P4R B;  4M8N A;  1GAQ B;  2CS4 A;  4RNA A;  1N61 A;  2KDE B;  3TEZ A;  4ZHP A;  3ZXV A;  1TY2 A;  2KX3 A;  1JWS D;  1IGD A;  5H8Y E;  1EM7 A;  3DBH B;  4B0E A;  2I2Y A;  1U4A A;  1T0Y A;  4AS1 A;  2L32 A;  4FN2 A;  2KKC A;  1ZDV A;  2LUM A;  4BFR A;  3RPF C;  5BYR A;  2QDF A;  1E8X A;  2KJH B;  4MEL A;  3AE9 B;  3R2T A;  1D6E C;  4YT0 B;  4PYZ A;  2LXA A;  3PPA A;  4TUU A;  3RNA C;  1UWM A;  2GB1 A;  3QX1 A;  5HKH A;  2HTM E;  1K51 A;  3B9J A;  3ML8 A;  3V05 A;  5JH5 C;  2IGH A;  1L4D B;  4FXC A;  2A4Z A;  3AEG B;  2MA9 B;  3JYU A;  4GGQ A;  5LXI B;  3U30 A;  1E90 A;  4I6P A;  4P7I A;  2J4X A;  2KJ6 A;  2MP2 A;  1WIA A;  1HZ5 A;  2FCN A;  1WY8 A;  3FAH A;  2LRW A;  4FJZ A;  2ZCB A;  2KOX A;  3DOW A;  1E9M A;  2JVC A;  2MRP A;  4IWP A;  3S2A A;  1Q5W B;  2KLC A;  1P7E A;  1E7V A;  3LXF A;  1VDV A;  1F2R C;  2KQS A;  3R7R A;  2D2Q A;  2LVO A;  4A3P A;  5E6J A;  2NCN A;  3MFG A;  4RGM A;  1HTO A;  1LFD A;  3LB8 C;  2D3C A;  1AN8 A;  1YIW A;  3ALB A;  4LNN A;  2BB5 A;  5D2M B;  5IN7 A;  1CJE A;  4OVV A;  2KC1 A;  1WM3 A;  1KLG D;  2K25 A;  4ZRK A;  2ZW0 A;  2QSD A;  2JSV X;  2L52 A;  1NYR A;  3GE8 C;  4JLC A;  4EUT A;  3IG3 A;  1SB3 C;  2BKF A;  3ML9 A;  4P1B C;  4DHZ E;  2MJE A;  1BML C;  4WQO B;  4IWO A;  4LLG M;  1GG3 A;  1WX7 A;  2MLB A;  1L4Z B;  4K3B A;  4C4V A;  4ANX A;  1VJK A;  2JZZ A;  2KLG A;  1XLO A;  4A9A A;  2O6V D;  4A3O A;  2RDH A;  3TL5 A;  3TCA A;  4EE2 A;  3VUX A;  4F7Z A;  5EE1 A;  3AEE B;  2FUG 1;  4MGY E;  4BAX A;  2N7E A;  5LNK 1;  2H89 B;  2N7D A;  1YJI A;  4YSZ B;  2PLP A;  1EU3 A;  2W3R A;  3TUO A;  1L2N A;  2JT4 B;  2MW5 A;  5JHA A;  4AOF A;  3KLS X;  1ET6 A;  4W9I A;  3B08 A;  2K5P A;  2J52 A;  1XEE A;  5AZG A;  2TSS A;  3PSE B;  4G3X B;  2WP9 B;  4P6V F;  4TMA B;  4KZC A;  1C3T A;  2D07 B;  4MH0 E;  3ONS A;  4LJO B;  4BKT A;  2VZK B;  3EEC A;  1Y8R C;  3OG5 A;  1T5X D;  3B2G A;  2X38 A;  3RFZ B;  4JQW C;  1BUI C;  4ZRI A;  1UF0 A;  2BYE A;  3VUY A;  2HE7 A;  1ZUD 2;  1CQV A;  4HXD A;  4IWQ A;  1A70 A;  2N9L A;  1R4M B;  3AEB B;  4B6W A;  1FFU A;  1Z2M A;  4ARC A;  1QOF A;  1R7S A;  2PTL A;  4MGK E;  3BYT B;  3NVZ A;  1SJH D;  4JWU C;  4M01 A;  2KHW B;  4RFB A;  5C23 A;  2KQ4 X;  1WJ4 A;  4HJK A;  3HVD A;  3RT3 B;  3PZ8 A;  4C4V B;  3ZJT A;  4MSM B;  4IOI E;  1OQR A;  2WX1 A;  4K7W A;  3ZNG C;  1XQQ A;  3JVZ X;  2DWQ A;  3ECI A;  5L83 A;  3ENE A;  5C1Z A;  4G50 A;  3EFC A;  4XDD A;  1DYQ A;  1C77 A;  3NVV A;  4BOZ B;  3BZD B;  1NDD A;  1HTQ A;  1UEL A;  3NY5 A;  2WXH A;  2ZEQ A;  1UGJ A;  4F8C B;  3W5U B;  1K52 A;  1WXV A;  1NI2 A;  3MC0 B;  3PTF C;  5HHD G;  2WXI A;  2N4F A;  2DAJ A;  4JL9 A;  1KH0 A;  2BYF A;  1C78 A;  1SF0 A;  2B76 B;  2CHZ A;  2LHD A;  1ZE3 D;  3A9K A;  2MJD A;  2FUH B;  1EUV B;  1FM0 D;  4BZA A;  2GBJ A;  3UQB A;  2V4L A;  4GOC A;  2WDR B;  2FE8 A;  2KAC A;  1V86 A;  3C8Y A;  4HJG E;  2BKR B;  2LHE A;  3N30 A;  4NNJ B;  2WLB A;  1E7U A;  2BS3 B;  2YLM A;  2PIA A;  1V1O A;  5CTR C;  4IUM B;  5FR6 A;  2X8X X;  4ANW A;  3VRA B;  3HK0 A;  4GU2 A;  1TZO A;  3V3X A;  1JCK B;  2MBH A;  4HCP B;  3ZJU A;  1AAR A;  4LNI A;  1TBE A;  3M95 A;  2C7M B;  1ZKH A;  2IO2 B;  3CWI A;  3B0A A;  3QAQ A;  1FNW A;  4ICU A;  3T8M A;  3NS1 A;  3FIL A;  1KOT A;  4XX5 A;  4FBJ B;  2KWC A;  4KV2 A;  1HA5 A;  1N5W A;  1V1P A;  4LNO A;  2KWU B;  2JUO A;  2D3A A;  3U7D A;  1BXT A;  3P4P B;  2K9X A;  4XZ4 A;  1C4C A;  3HM6 X;  2DZM A;  3I63 C;  2KVZ A;  4EZL A;  2QIL A;  1WZ0 A;  1SEB D;  2MBO A;  1L5P A;  2BWE S;  2J7Q B;  2DX5 B; 
#chains in the Genus database with same CATH homology
 3M63 B;  1J19 A;  1WGD A;  2AEH A;  1GC7 A;  2C5L C;  2LRU A;  5J18 A;  1LM8 B;  2CHX A;  2L05 A;  2KFJ A;  3ZTD A;  3QA8 A;  2PE9 A;  5KHQ A;  3RYT A;  2JRH A;  3CF6 E;  4CO7 A;  3RUI B;  4GIV A;  2PEA A;  4CYE A;  5AZH A;  4WJO A;  2IY1 B;  1XT9 B;  4BBN C;  2RR9 A;  2WX0 A;  1WGY A;  4EFO A;  2LZ6 A;  4ZDV A;  3JSV B;  2LAS A;  4IM3 A;  2L7R A;  2DHZ A;  2J0J A;  2C60 A;  4NJ6 A;  4AP4 C;  2KMA A;  2FCQ A;  2KDF B;  4IM2 A;  4EZJ A;  4FJV B;  2FNJ B;  4JGH B;  3WIM A;  3R3M A;  4GSW A;  2ZZP B;  4WJQ A;  2FCM A;  2K8B A;  2O2V B;  2OOB B;  1UBI A;  3PLV A;  4M0W B;  3DCG A;  3SU8 X;  2KDI A;  2KC2 A;  2RD0 A;  4NPN A;  2O6V B;  1WMH B;  4K81 A;  3W1Y A;  2JY6 A;  3HIZ A;  4IG7 B;  3OLM D;  4LDT D;  2YVC A;  1YD8 U;  4NJ7 A;  3L13 A;  4KIK A;  1WE6 A;  5DCN A;  3WAP A;  2KXJ A;  3ZNZ B;  4M8M A;  1WGG A;  1WXM A;  3PRE A;  3AI5 A;  2GMI C;  3A1Q A;  4E71 A;  2J0M A;  4AWJ A;  1R4M I;  2DZK A;  1SIF A;  2HTH A;  3HM3 A;  5DPR A;  3VDZ A;  1YQB A;  2JF5 A;  3APC A;  3KUC B;  3MTN B;  3NOB A;  2LXC A;  3KW5 B;  2M8S A;  2LVQ A;  2WDT B;  2ZVN A;  2K1F A;  3QAR A;  1YX5 B;  2DAF A;  4A20 A;  2NR2 A;  2VRR B;  2MQJ A;  2I1J A;  4KVG B;  1Z5S B;  2KJR A;  3ZDT A;  3JSV A;  1V80 A;  2LGD A;  3ZNH B;  2MBE A;  1LXD A;  3APF A;  2PJH A;  4MGI E;  5E6O A;  2OJR A;  4RMA A;  4M8N A;  2KK8 A;  3D32 A;  2ZJD A;  1P0R A;  2KZR A;  3DVG X;  2CS4 A;  3V61 A;  5J17 A;  2KTR A;  1OQY A;  2KDE B;  3DBL I;  3IBE A;  3DBS A;  1E8Y A;  2LGX A;  4TV3 A;  2IBI B;  2NPT A;  4EKU A;  1GUA B;  5L95 C;  1LQB A;  3AU5 A;  2Z0D B;  3PRP B;  2LI5 A;  2KX3 A;  3PHX B;  1MG8 A;  3KH0 A;  4J6I A;  4WWN A;  2PPH A;  4E74 A;  2XK5 B;  4WWO A;  2MP2 B;  3KUZ A;  4BKS A;  2GBR A;  4MJS A;  1U4A A;  4K1R B;  2N9P C;  1M94 A;  1T0Y A;  4RM9 A;  4WJP A;  1J0G A;  2BGF A;  2GOW A;  2BWF A;  2JPH A;  2KMC A;  4FN2 A;  4W9C A;  4CHK A;  1GJZ A;  2KKC A;  2BYV E;  4BFR A;  1WR6 E;  1WXS A;  3VQI A;  5E6P A;  3N32 A;  2NS5 A;  5CHV C;  2N1V A;  1J8C A;  4FHK A;  2EKE C;  3ZIM A;  1VD2 A;  4X57 B;  1UBQ A;  5JZE B;  3WAM A;  1E8X A;  2KJH B;  1C1Y B;  3PZD A;  4MEL A;  1TTN A;  2KNB A;  4HDO A;  4W9J A;  2DYM A;  4KDI C;  3LDZ E;  3TIX A;  1CMX B;  4G0N B;  2ZNV B;  5CHW A;  2FCS A;  3VXW A;  3A4R A;  1WR1 A;  3H7P B;  2DZJ A;  2LXA A;  4PYZ A;  5KHO A;  2CHW A;  3K9P B;  3PPA A;  4TUU A;  1ZW7 A;  2B3A A;  5J2R A;  4W9F A;  3QX1 A;  5HKH A;  3M62 B;  1G6J A;  5BO4 B;  2AL3 A;  3U8Z A;  2G45 B;  4KIK B;  4MGZ E;  3AU4 A;  2DYO A;  3VFK A;  4XC2 A;  3ML8 A;  5JH5 C;  3UIO B;  4GMV A;  2CR5 A;  4EOY A;  1KM7 A;  2A4Z A;  1TGZ B;  2KDB A;  2MA9 B;  3JYU A;  4GGQ A;  3U30 A;  2G4D B;  5LXI B;  1RRB A;  1E90 A;  3A1Q B;  4I6P A;  3TJP A;  1WFY A;  3P2B A;  4W9G A;  3V6E B;  4P7I A;  4DBG A;  2XK5 A;  2KJ6 A;  2KTF A;  1WJN A;  1WIA A;  2MP2 A;  3K9O B;  2FCN A;  3VAW A;  1WY8 A;  2BPS A;  1D3Z A;  2LRW A;  1V9J A;  3PV1 A;  4FJZ A;  4FUL A;  4II2 B;  2ZCB A;  1QZE A;  2KOX A;  3DOW A;  2JVC A;  3QIJ A;  2MRP A;  3H6N A;  3IFW B;  2IZV B;  3DVN U;  4GB9 A;  4IWP A;  5G2N A;  3S2A A;  4NAW A;  3RZF A;  4DWF A;  3UQA A;  2LWP A;  1Q5W B;  1F9J A;  2KLC A;  1HE8 A;  1E7V A;  2A5U A;  4KZ0 A;  3WA0 A;  4G11 A;  2KQS A;  3W1S A;  4NY0 A;  3R7R A;  1WZ3 A;  2D2Q A;  1UH6 A;  2KTR B;  2LVO A;  4PS7 A;  4A3P A;  4DXA B;  3DDC B;  4MSQ B;  5DPW A;  3PLU A;  2ZNV C;  1ISN A;  2FIF A;  2NCN A;  4DHJ D;  2NPT B;  5E6N A;  1LFD A;  1X1M A;  2G4S A;  3H7P A;  3UIN B;  1S1Q B;  4IW0 A;  3JW0 X;  4DHZ B;  3SDL C;  2AL6 A;  2ZPN A;  4GDK A;  1YIW A;  3ALB A;  4MJS B;  4PS3 A;  1SE9 A;  5D2M B;  3RD2 A;  2MCN B;  5G55 A;  4ICV A;  4B9K A;  4BOS C;  4OVV A;  1SGH A;  2KC1 A;  4NQL B;  1WM3 A;  5IA7 A;  2K6D B;  2NBV B;  4WWP A;  1WRD B;  2KVR A;  2M4N A;  3A9J A;  2K25 A;  3DBR I;  2PE6 B;  4ZRK A;  4FAD A;  4FJY A;  4LCD E;  3L08 A;  2ASQ A;  2LGY A;  4JLC A;  2RPQ A;  4EUT A;  3SD5 A;  4E3C A;  2C9W B;  4W9E A;  1WF9 A;  4II3 B;  3X0W A;  3EC8 A;  3IG3 A;  4EZK A;  2BKF A;  3ML9 A;  4DHZ E;  2MBQ A;  2NBU A;  4WQO B;  1V49 A;  4IWO A;  2BF8 B;  2ZVO A;  2DEN B;  3KYC D;  2DYB A;  4HCN B;  3NZU A;  2HJ8 A;  2DZI A;  1GG3 A;  1WX7 A;  1JRU A;  2MLB A;  2EMT A;  4IC7 B;  4ANX A;  2JWZ A;  3VH3 B;  3WAO A;  2GBK A;  2JZZ A;  1IP9 A;  2KLG A;  4PYU A;  4BKG A;  2KFK A;  1WE7 A;  2O6V D;  4A3O A;  3TL5 A;  3ZKJ C;  3VHT C;  3TCA A;  4URK A;  2M1M A;  3PRM B;  1FXT B;  3H7S A;  3VUX A;  4F7Z A;  4B95 A;  2K6Q A;  2Z59 B;  4MGY E;  3A4S C;  2N7E A;  3GOE A;  2N7D A;  1A5R A;  1WX9 A;  3KVF B;  3ZW3 A;  3ZLZ A;  3CSF A;  4HVB A;  1L2N A;  2JT4 B;  2MW5 A;  1BT0 A;  5JHA A;  3UF8 A;  4AOF A;  1P98 A;  2RSU A;  1OEY J;  2G3Q B;  3OJ3 A;  3PGE A;  4NAW B;  3IHP C;  3QQ8 B;  4AJY B;  1P3Q U;  1OTR B;  2R2O A;  2JZ3 B;  4W9I A;  3Q3J A;  4KSL C;  3B08 A;  2LVP A;  4HPL B;  3T9L A;  5AZF A;  4TQ0 A;  5AZG A;  2KO3 A;  3QCA A;  1E8W A;  1E8Z A;  1KJT A;  3PSE B;  3DVG Y;  4G3X B;  4HDQ A;  3TBL D;  1UGM A;  3L10 B;  1I35 A;  1V6E A;  1YJ1 A;  2L8J A;  2ZPY A;  4GXB A;  4KZC A;  3TMP B;  1C3T A;  2D07 B;  2L3Z A;  4MH0 E;  4PS8 A;  3WAN A;  4I6L B;  3ONS A;  1P9D U;  4LJO B;  1GC6 A;  2K8H A;  4BKT A;  3EEC A;  2KQ7 A;  2M17 A;  2CKH B;  1Y8R C;  5CHF A;  3PT2 B;  4ZYN A;  2Z0E B;  4MM3 A;  3V60 A;  4MDK E;  4GDK B;  3B1L X;  3DPD A;  1V2Y A;  4W9K A;  4JQW C;  4ZRI A;  1UD7 A;  2W9N A;  2BYE A;  3VUY A;  1YX6 B;  2HE7 A;  2GBN A;  3H1U A;  4HXD A;  4IWQ A;  5TR5 A;  1EO6 A;  2IYD B;  1UZX B;  2Y5B B;  3A9J B;  3QHT A;  4MEM A;  4KSK C;  3ZUN A;  4IM0 A;  3M3J A;  5EDS A;  1IPG A;  4B6W A;  4ZRJ A;  1R4N I;  2N9X A;  2N1W A;  3PVL A;  5DPT A;  1Z2M A;  3KUD B;  1S3S G;  4MGK E;  2D3G A;  3EFU A;  3I3T B;  2KHW B;  2MBB B;  4NQK E;  5DPS A;  4LDT B;  2N9E B;  4OVU A;  5C23 A;  2KX0 A;  1WJ4 A;  3UGB B;  1KLV A;  4DDI D;  4HJK A;  3AXC A;  3RT3 B;  3ZTC A;  1PQS A;  2UWQ A;  3QJZ A;  3W1S C;  3UIP B;  4TKN A;  1P1A A;  4YL8 A;  2FAZ A;  4K7U A;  3A33 B;  3L17 A;  4ASW C;  4MSM B;  3KYD D;  1OEY A;  3DBH I;  3EHV A;  3A9K B;  2KFK B;  3RUL A;  2NVU I;  2WX1 A;  1IYF A;  2XEW A;  4K7W A;  3ZNG C;  2CU1 A;  1XQQ A;  2HD5 B;  2NBW B;  3JVZ X;  4HK2 A;  1WI0 A;  5AEK B;  1I42 A;  1Q1O A;  2REX A;  3ECI A;  2IO3 B;  3ENE A;  3MJW A;  5C1Z A;  5L83 A;  4DK5 A;  1H8C A;  3ZRF A;  4G50 A;  4ANU A;  3QC8 B;  2V1Y A;  1VCB A;  2KD0 A;  4BOZ B;  4GN1 A;  1NDD A;  1UEL A;  3NY5 A;  2C7N B;  1WJU A;  1V81 A;  1ZGU B;  2L76 A;  1Q0W B;  3NHE B;  1GNU A;  2ZEQ A;  3BIN A;  2IY0 B;  3ZRC A;  3HHM A;  3VTV A;  1TZ1 A;  4F8C B;  1RAX A;  3QWZ B;  2I1K A;  3RZW C;  3DVN V;  3BY4 B;  2UYZ B;  1WXV A;  1NI2 A;  2ZCC A;  3L54 A;  4GDL B;  3ZNI D;  3PTF C;  1WGR A;  4I6N B;  1WJ6 A;  1WM2 A;  2N4F A;  3NZS A;  2DAJ A;  4EEW A;  4JL9 A;  4BBN F;  4BVU C;  4W9H A;  2MX2 A;  3PHW B;  5LXH A;  2BYF A;  5LLI A;  5D7G A;  3H9D A;  2C7H A;  1WX8 A;  4N9F 4;  3VH4 B;  2J0K A;  5IAA C;  4FHJ A;  1EF5 A;  1V5O A;  2CHZ A;  2L0F A;  3SHQ A;  3A9K A;  2L0T A;  2FUH B;  1EUV B;  2GBJ A;  3V6C B;  3IVF A;  3UQB A;  3VTU A;  2V4L A;  4K7S A;  4GOC A;  4HPM B;  4BKS D;  3WAL A;  2R2Q A;  2AWT A;  1WH3 A;  2EMS A;  1V86 A;  2LD9 A;  3MHS D;  2GBM A;  2LJ5 A;  2K8C A;  3VUW A;  2KN5 A;  3V62 A;  1RFA A;  4LJP B;  2BKR B;  3N30 A;  4W9L A;  3ZVV A;  2JXX A;  3CST A;  3PRZ A;  1OGW A;  4NNJ B;  1K8R B;  4RM8 A;  3C0R B;  3N3K B;  1E7U A;  2YLM A;  2O2V A;  4HWI B;  5CTR C;  3PS6 A;  3CMM B;  4IUM B;  5FR6 A;  4ANW A;  2M0X A;  2O6V A;  1WMH A;  3RCZ A;  4GDL A;  2KAN A;  4DDG D;  2KWV B;  3NS8 A;  3HK0 A;  3Q3F A;  1L7Y A;  3AUL A;  4GU2 A;  2MBH A;  3QK0 A;  1NBF C;  4TQ1 A;  1H4R A;  4HCP B;  3GZN I;  1AAR A;  2K39 A;  3OAW A;  1TBE A;  3ZDM C;  5D6J B;  3M95 A;  3R7Q A;  4AUQ C;  2C7M B;  3APD A;  3L0W B;  2WWZ A;  1ZKH A;  2IO2 B;  3OJ4 B;  3B0A A;  4KDL B;  3QAQ A;  1E5W A;  4HLE A;  4ICU A;  3T8M A;  2JRI B;  2AYO B;  4WAA A;  4F1S A;  5JHB A;  3O65 B;  1KOT A;  4XX5 A;  1EF1 A;  1WXA A;  2MSE D;  2FID A;  3X23 A;  3VVW B;  4FBJ B;  4AJW A;  2KWC A;  2RGF A;  3R66 C;  4KV2 A;  1WGH A;  3VTW A;  4WJN A;  2LUE A;  2IO1 B;  2IO0 B;  5CX3 A;  2MWS B;  3L16 A;  4W9D A;  3DQV A;  1WYW B;  2KWU B;  1V5T A;  2QHO A;  1RLF A;  4FLH A;  4DHJ B;  2JUO A;  3U7D A;  3ZO5 B;  4XZ4 A;  3LJ3 A;  3HM6 X;  2DZM A;  4ANV A;  5D94 A;  2V3S A;  4EZL A;  1WZ0 A;  2D10 A;  4JIO U;  2D11 A;  2MBO A;  1XD3 B;  2BWE S;  2WYQ A;  2XBB C;  2L00 B;  2J7Q B;  4FA6 A;  2DX5 B;  5GMV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...