1WGGA

Solution structure of the n-terminal ubiquitin-like domain of mouse ubiquitin specific protease 14 (usp14)
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
96
structure length
96
Chain Sequence
GSSGSSGYSVTVKWGKEKFEGVELNTDEPPMVFKAQLFALTGVQPARQKVMVKGGTLKDDDWGNIKMKNGMTVLMMGSADALPEEPSAKTSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Ubiquitin carboxyl-terminal hydrolase 14
publication title Solution Structure of the N-terminal Ubiquitin-like Domain of Mouse Ubiquitin Specific Protease 14 (USP14)
rcsb
source organism Mus musculus
total genus 10
structure length 96
sequence length 96
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2004-05-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1wggA01
1Y8RC 1YQBA 3P2BA 2RD0A 4GGQA 2KWCA 2J0MA 2JF5A 4K7WA 4W9IA 2D11A 4NQLB 4CYEA 1WR1A 4A3OA 2KX0A 2BF8B 2KJHB 4GMVA 3NOBA 1IPGA 3DBLI 1C1YB 4HJKA 5EDSA 4HDOA 4HDQA 3R7QA 1E7UA 2XK5B 1T0YA 1TZ1A 3UIPB 2D10A 2KZRA 4CO7A 4HCPB 3A4SC 2XEWA 4HPMB 3QCAA 2GBNA 1WMHA 2IO0B 4GDLB 3A9JA 4WJQA 2WX0A 4X57B 4P7IA 3UGBB 1Q5WB 3EHVA 4EKUA 2MP2B 4W9CA 2NCNA 4AUQC 5CX3A 3RD2A 2MLBA 1V5TA 1YX5B 4F1SA 1WYWB 5FR6A 1RLFA 2J0JA 3V61A 1WE6A 3M95A 1P98A 2KK8A 2KFKA 2RR9A 4WJOA 2ZZPB 4ICUA 5DPSA 2K25A 1WRDB 3PVLA 4K1RB 3UF8A 3V62A 1A5RA 1WE7A 1P9DU 2IO3B 2N1WA 3APCA 4GB9A 4LJPB 1WJ4A 4AOFA 2JT4B 1V9JA 2GBMA 4TQ0A 3PGEA 5J17A 4EUTA 2JVCA 4FJYA 5DCNA 3ZTDA 1EF1A 3PLUA 3PSEB 4ZYNA 4AJYB 1ZW7A 4NPNA 2KJRA 3HIZA 5DPTA 1KOTA 5LLIA 2JXXA 3APFA 2ZPNA 4JL9A 2DYBA 3QQ8B 4RM8A 1V2YA 1V81A 5CHFA 4JQWC 2JZZA 4RMAA 4RM9A 1KJTA 4HLEA 5JZEB 2LJ5A 1OTRB 4E74A 2LXCA 2KFJA 1YIWA 2KN5A 2K6DB 1E8ZA 4ZRKA 1UBIA 4ANUA 1OGWA 5LXIB 3PV1A 4F7ZA 2FAZA 1P1AA 3VQIA 3WALA 2FNJB 4MGKE 1WXMA 5BO4B 1RFAA 2DAJA 3ZNHB 3KUCB 2KKCA 3WAMA 2L05A 4WJNA 4PS8A 2OJRA 3PLVA 4KIKB 5J18A 2FUHB 3GZNI 3KUZA 1V5OA 2JPHA 2MBQA 2Z0DB 1WJUA 3TL5A 4HK2A 1J19A 2KX3A 3S2AA 1UZXB 2PE6B 4BKGA 4MGYE 4URKA 1WJ6A 3L08A 2MX2A 2NBVB 2CS4A 2KTRA 4PYUA 2BGFA 3K9PB 1WXAA 4ICVA 1EUVB 2CHZA 2LXAA 2M17A 4ZRJA 1WIAA 1MG8A 2B3AA 4G0NB 2VRRB 4MGZE 1E8YA 4DWFA 5IA7A 4CHKA 2GBRA 2MQJA 2N9XA 1GUAB 2V1YA 4MEMA 1V6EA 2GMIC 2FCSA 2PE9A 3RZFA 1TBEA 3HM6X 3MTNB 1R4NI 2MP2A 2LI5A 4MSMB 2WX1A 2A4ZA 4W9EA 3VFKA 4BFRA 1GC6A 2KWUB 3VUWA 4DHZB 2NPTB 1EO6A 4IM2A 2C7HA 1EF5A 1BT0A 3KUDB 3ZVVA 1GNUA 4ANVA 1ZKHA 2G45B 3VH3B 4FBJB 2AYOB 1D3ZA 1NI2A 2N7DA 3A4RA 5D94A 2CKHB 4FHJA 2BWES 4MGIE 5AZGA 5L95C 4DDGD 5D2MB 2GOWA 4BKTA 4I6LB 2LVQA 3DBHI 2AL3A 4G11A 4NY0A 4BBNC 5DPRA 3I3TB 3JSVB 2BYVE 1S1QB 1X1MA 1K8RB 4W9KA 4XX5A 2N4FA 3ZIMA 2KOXA 3Q3FA 3PS6A 4HWIB 3ALBA 1WGRA 3RCZA 1ZGUB 5CTRC 3IVFA 1M94A 1XD3B 4II2B 3ONSA 3HHMA 2KQ7A 4FJVB 5IAAC 4GOCA 3SDLC 2BWFA 3DPDA 4XC2A 4NJ6A 1YJ1A 2KC2A 1WZ0A 4M0WB 3A33B 4IWPA 1UGMA 1WJNA 2KTRB 2CR5A 2FCQA 3VXWA 1WM3A 2KANA 2XBBC 1XQQA 4KDIC 4KZ0A 1OQYA 2LZ6A 3WAOA 4N9F4 2K6QA 3L54A 4PYZA 3RUIB 4MJSA 3RULA 3DVGX 4FLHA 1C3TA 1V49A 3N3KB 2YLMA 2UYZB 3L13A 4I6PA 4WJPA 5TR5A 2MSED 2V4LA 4KIKA 3VTUA 4AWJA 1FXTB 2M4NA 3QHTA 1WGDA 1ISNA 2IO1B 2KO3A 2ZVOA 1GC7A 2N9EB 2C7NB 4GSWA 3VH4B 2ZPYA 2JRHA 3NHEB 3ZRFA 2CHWA 3L17A 3N30A 4I6NB 4FN2A 1AARA 4GIVA 3AU5A 4WWOA 3VTWA 3NS8A 5LXHA 4A20A 1L2NA 2J0KA 3K9OB 4EZKA 2A5UA 2KWVB 1WF9A 1WM2A 1E8WA 4KVGB 1IP9A 4MDKE 2NBUA 3KYDD 3QJZA 1WXVA 4DK5A 3SD5A 3DVNV 1P0RA 1SE9A 3OLMD 2NBWB 1HE8A 2Z59B 3TCAA 2KJ6A 1SIFA 2WWZA 1WGGA 4GDKB 1Z5SB 3U30A 1V80A 3KW5B 3PRMB 5L83A 3WAPA 2RGFA 3R66C 2AWTA 2MBEA 4MELA 4OVVA 2NPTA 3EC8A 5D7GA 4IM0A 4NNJB 3ZNGC 2KC1A 3C0RB 2IO2B 2KLCA 1WI0A 3EECA 2LASA 3H6NA 4AJWA 3O65B 3QARA 1U4AA 2EKEC 2WYQA 2MRPA 1L7YA 3ZKJC 2L00B 3JSVA 4LDTD 4MJSB 2JRIB 4JLCA 2ZNVC 3JYUA 4HCNB 4TUUA 4KV2A 1YD8U 4GU2A 2NR2A 1YX6B 3ENEA 4W9DA 2JWZA 1PQSA 1WX8A 5GMVA 2LVPA 2K8HA 1OEYJ 1SGHA 4LJOB 4BBNF 2LVOA 2O6VD 3TIXA 3PT2B 3X23A 2I1KA 2LGYA 4M8NA 1GJZA 3ML9A 2N7EA 4FULA 2JZ3B 3VUXA 2OOBB 2UWQA 4XZ4A 3JW0X 3ZLZA 1E8XA 4JGHB 3OAWA 4YL8A 1H8CA 4EEWA 5DPWA 2KTFA 3GOEA 2FCNA 2WDTB 1RRBA 3H7PB 4WQOB 1KLVA 2AL6A 2LGXA 2O2VB 3A9KA 3ML8A 4OVUA 5G55A 3V6EB 4K81A 2J7QB 5E6OA 4WAAA 2NS5A 3VTVA 3ZRCA 2FIDA 1I42A 3OJ4B 5C23A 2L7RA 3EFUA 3VVWB 2GBJA 2DZIA 3MJWA 4JIOU 4G50A 2V3SA 3B1LX 3DQVA 1E5WA 1WR6E 2EMSA 3W1SA 3LDZE 3Q3JA 3QIJA 3X0WA 1UELA 4GDKA 4NJ7A 4IUMB 1E7VA 2JY6A 2DZKA 2ZEQA 3AU4A 3LJ3A 3MHSD 1S3SG 2O6VA 1XT9B 3N32A 3NY5A 3VUYA 1VD2A 4WWPA 3ZNZB 1I35A 2C5LC 4W9GA 2ZJDA 4KDLB 1WX9A 3M63B 3KH0A 3DVNU 1WGYA 4ASWC 2REXA 4BKSD 3DDCB 2KHWB 2M0XA 3L0WB 2G4DB 2PPHA 4B6WA 1J8CA 1Q1OA 4B95A 2JUOA 3OJ3A 1F9JA 1P3QU 4M8MA 5E6PA 2HD5B 3TJPA 1OEYA 5JHAA 2DHZA 3DVGY 3HK0A 4K7UA 4KSKC 3H1UA 3M62B 4IWQA 1G6JA 3PHWB 3WIMA 1WY8A 3ZDTA 1VCBA 2LWPA 1UBQA 3RT3B 2BKFA 2D3GA 1WH3A 3QA8A 4IM3A 5CHWA 3SU8X 4DDID 2ZVNA 4B9KA 2G3QB 4EZJA 1WFYA 2KMAA 2KVRA 3DBSA 1R4MI 4IG7B 3A9KB 2KDBA 2C9WB 3PZDA 1Q0WB 4TKNA 4LDTB 3U7DA 1NDDA 2MCNB 3ZUNA 3ZO5B 3H9DA 3M3JA 3TBLD 3T8MA 3UQBA 1KM7A 5HKHA 4GXBA 5KHOA 2IBIB 2MW5A 2R2OA 4W9JA 2R2QA 3DBRI 3PRZA 1IYFA 2KMCA 2HTHA 4BKSA 4E71A 4NAWB 2MBOA 2QHOA 2RPQA 3ECIA 4II3B 5CHVC 4HXDA 2O6VB 3H7PA 3W1SC 2AEHA 4DHJD 2K39A 2RSUA 3A1QA 2O2VA 3NZSA 3UQAA 2ZCBA 2IZVB 4MSQB 4A3PA 3NZUA 3ZNID 5JHBA 3U8ZA 3B0AA 4ANXA 1LQBA 2DYMA 3RZWC 5J2RA 2Y5BB 2K1FA 4J6IA 4MM3A 4AP4C 1H4RA 2KDIA 3H7SA 4NQKE 4EOYA 2D2QA 1JRUA 2PJHA 2DZMA 4DBGA 2C60A 1WGHA 2CU1A 2KDEB 2FIFA 3WA0A 5AZHA 4E3CA 5AZFA 3DCGA 4KZCA 1UH6A 3R7RA 3ZDMC 4BOZB 4EFOA 3QWZB 2MA9B 2ASQA 2HE7A 2D07B 2L76A 3DOWA 2W9NA 3PHXB 3AULA 2HJ8A 3VDZA 3T9LA 2M1MA 3BY4B 2N9PC 1QZEA 4TQ1A 1GG3A 2LRWA 2M8SA 3SHQA 2DYOA 3TMPB 4DHZE 4EZLA 3ZW3A 5KHQA 2BYFA 2KQSA 3CMMB 3UIOB 2ZNVB 3CSTA 4ANWA 4IW0A 1LM8B 4DXAB 2Z0EB 2GBKA 3KVFB 3QC8B 4F8CB 4FA6A 1LXDA 1WMHB 3IFWB 3A9JB 2KDFB 3IHPC 3QX1A 2KLGA 3HM3A 3CSFA 4MH0E 5AEKB 3CF6E 5JH5C 3VHTC 1Z2MA 4BOSC 2YVCA 2LGDA 3D32A 2BKRB 4IWOA 3RYTA 2KNBA 2N1VA 3ZTCA 2IY1B 3A1QB 3VAWA 3V60A 2NVUI 2ZCCA 3BINA 2KFKB 2FCMA 1TTNA 2L8JA 2BPSA 2XK5A 3V6CB 4HPLB 4W9FA 3W1YA 1J0GA 2LRUA 4IC7B 4LCDE 2EMTA 4FJZA 1V86A 2DAFA 2G4SA 4BVUC 2IY0B 2KD0A 3PRPB 5E6NA 2KXJA 4W9HA 3L16A 2CHXA 2K8BA 4W9LA 4GDLA 5G2NA 3AXCA 3QK0A 4GN1A 3APDA 2IYDB 2MBHA 1E90A 3B08A 2K8CA 1NBFC 4NAWA 5C1ZA 2DX5B 2PEAA 3PPAA 4PS7A 3AI5A 2L0FA 5D6JB 1RAXA 2L3ZA 4PS3A 2L0TA 2MBBB 1UD7A 4G3XB 4K7SA 2BYEA 2DZJA 3KYCD 2MWSB 3WANA 3JVZX 1WZ3A 3QAQA 3L10B 4FHKA 3PREA 3IBEA 1WX7A 4TV3A 4FADA 3UINB 1LFDA 3IG3A 4WWNA 1CMXB 2I1JA 2LUEA 2LD9A 4HVBA 3R3MA 4KSLC 4ZRIA 4DHJB 1TGZB 4ZDVA 2DENB 2C7MB 3PTFC 1WXSA
chains in the Genus database with same CATH superfamily
2VH1A 3WCQA 1YQBA 2RD0A 2QDFA 4NQLB 1WR1A 4A3OA 2BF8B 3AEDB 1CQVA 1UF0A 4HDOA 4HDQA 1JRPA 1E7UA 3Q14C 5MPOA 3EGRA 3A4SC 2XEWA 1YN4A 4GDLB 3A9JA 3P42A 1KLGD 3UGBB 5IP4D 1Q5WB 1WXQA 1AW7A 3ZYYX 2M19A 2EELA 4EKUA 2NCNA 3DWGC 3RD2A 2MLBA 2WHIA 1V5TA 3NVVA 4F1SA 5EE1A 1AWDA 4IOIE 3M95A 4WJOA 2KK8A 2RR9A 5T8IA 4ZRQA 5DPSA 2K25A 4K1RB 2BQQA 1P9DU 1VDVA 4LJPB 1WJ4A 4AOFA 2GBMA 1N61A 5DCNA 3ZTDA 3PLUA 3PSEB 4ZYNA 2KVZA 2JYTA 1FRDA 1V1OA 2ZPNA 4JL9A 4RM8A 1V81A 4HLEA 2JZZA 2X8XX 4LK0M 2K6DB 4ANUA 3B2FA 4F7ZA 3VQIA 3Q3MC 4MGKE 5BO4B 3DBHB 1N62A 1FPYA 3I57A 1IGCA 2PVOD 2OJRA 3GZNI 3KUZA 1FRRA 2JPHA 2MBQA 3U2SC 3AEBB 1FNVA 4MGYE 2X38A 2KTRA 3URYA 2BGFA 2BVCA 1WXAA 2KT7A 2CHZA 4ZRJA 1WIAA 4G0NB 2VRRB 1WYGA 2V1YA 1V6EA 2GMIC 4MEMA 3RZFA 2K5PA 3HM6X 1P7EA 2MP2A 2LI5A 1F0ZA 1TKGA 2WX1A 1GC6A 2JQRB 4IM2A 1YJJA 1JROA 1E6EB 1LO5D 1BT0A 1GNUA 4FBJB 2N7DA 3A4RA 5D94A 4USAA 3BK2A 5D2MB 2AL3A 4BBNC 3JSVB 3KWVA 4W9KA 4XX5A 1L0XB 3IVFA 1M94A 4FJVB 4C4VB 3BZDB 1NI3A 3DPDA 1J7AA 4XYCA 4D2KA 2KC2A 3O13A 4IWPA 2FCQA 3VXWA 4KDIC 2LZ6A 2N9LA 2K6QA 3L54A 4BAXA 3T3NA 3DVGX 3P63A 2V4LA 2M4NA 3NJTA 1WGDA 2ZVOA 2KO3A 2JSVX 4GSWA 2LEKA 3ZRFA 1Q10A 1ZPSA 3AU5A 5HHDG 4M00A 3NS8A 4RF0A 4A20A 3OWEB 4OZCA 1C77A 3MC9A 1E8WA 1C78A 1N60A 3KYDD 3QJZA 1HE8A 2Z59B 1SIFA 2RMMA 1R7SA 3KW5B 2OJWA 1FFVA 3PRMB 1RYJA 3GE8C 2NPTA 3PZ7A 3HUIA 1TS3A 2MEKA 3H6NA 2LJIA 1QOGA 2FE8A 2MRPA 3EA6A 3C19A 4LNOA 5EE9A 4HRSA 3NS1A 4HCNB 3B2GA 4KV2A 2NR2A 1YX6B 1JALA 3J9CA 2BS4B 1SE4A 2WXKA 2K8HA 1OEYJ 1I4RA 1SGHA 1FD6A 1EU4A 3AEFB 2W54A 4M8NA 3VR9B 1GJZA 1RM6C 3VUXA 4XZ4A 1QQRA 4YL8A 1YJIA 2KTFA 3GOEA 2FCNA 3H7PB 1RFKA 4WQOB 1JQ4A 1C4PA 1T0RC 3A9KA 4YTMB 3E9SA 3V6EB 2RDHA 2J7QB 5E6OA 2NS5A 1I4GA 1I42A 2RDBC 1XLNA 2WDQB 1D5ZC 2DZIA 4JIOU 2V3SA 3DBRB 1WR6E 2EMSA 3Q3JA 2WXQA 1E7VA 1SF0A 2DZKA 4AQ7A 1JCKB 4DXGA 1XT9B 3VUYA 3ZNZB 3T3OA 1D5XC 2C5LC 2QMTA 4KDLB 2REXA 4YSXB 2KHWB 4LLGM 2PPHA 1J8CA 2V9HA 1K51A 4B95A 3OJ3A 2JUOA 3C8YA 1F9JA 3GP7A 4HKQA 3DWMA 3ABVB 1MHXA 4KSKC 3H1UA 1XLQA 5D3DA 4XGAB 1UBQA 3RT3B 3AN1A 2BKFA 1WH3A 5CHWA 4ITKA 1ENFA 2ZVNA 2G3QB 4EZJA 1V97A 3MC0B 2WXNA 4BZAA 1R4MI 1FM0D 2RDGA 4LDTB 3U7DA 1NDDA 3ZUNA 3AM9A 4GXBA 5KHOA 2R2QA 1DOYA 1PFDA 3W1SC 1IUEA 3NZSA 2ZCBA 3RNCC 2IDYA 1CJEA 2WS3B 3U8ZA 1LQBA 5J2RA 2ONQA 3KLSX 4AP4C 1H4RA 1OQRA 3H7SA 3ZXRA 2PJHA 4YTNB 2M56B 1PYWD 2C60A 2HJ1A 1WGHA 4DBGA 3WA0A 4KZCA 3TSSA 3IAS1 2M0AA 2HE7A 2L76A 1SJHD 2W9NA 1TT5B 3VDZA 2INPE 2N9PC 4DHZE 2M8SA 2DYOA 2BYFA 4C80A 4IW0A 1XCTL 1N6ZA 1TY2A 3KQ4A 5EE0A 4DXAB 1C9FA 3KVFB 1I7HA 3IFWB 3A9JB 1XEEA 3SEBA 4M01A 5JH5C 2V3NA 4OVZA 1Z2MA 2IGDA 2YVCA 3B9JA 3H8HA 2BKRB 3ZTCA 2IY1B 3A1QB 3VAWA 2ZCCA 2WU5B 1XXGA 2L8JA 2BPSA 3IAM1 3W1YA 4HPLB 1J0GA 4YT0B 2DAFA 4MM3B 1LGRA 2KXJA 2MJDA 4W9LA 3FC4A 4GN1A 3ETRA 4NAWA 3NRZA 4EE2A 3AI5A 2L3ZA 3UI3A 1UD7A 2DZJA 2MWSB 3N1YC 1F2RC 2D3CA 5TSSA 4FADA 3LYYA 4IDIA 1N5XA 3QHTA 4L23A 2LXCA 3KH0A 5BYRA 5JXVA 1Y8RC 3P2BA 3HVZA 2KWCA 4K7WA 1PGBA 2JF5A 4W9IA 2D11A 4CYEA 2INCC 3AE8B 3U4EG 2KX0A 4YSYB 3NOBA 1C1YB 5EDSA 2XK5B 1KF6B 3UIPB 3QCAA 3PO0A 3RNAC 2IO0B 2Y5CA 2WX0A 1TYGB 4OHJA 4WQMA 3EHVA 2MP2B 5D3IB 4AUQC 5CX3A 4QAYA 1WYWB 2BB5A 2J0JA 2HDEA 1P98A 2IGGA 2K0PA 2KFKA 4ICUA 1A5RA 1WRDB 3UF8A 3Q8CA 4WAFA 3HVDA 3RFZB 2IO3B 2QILA 1V8CA 3GS2A 2JT4B 4TQ0A 4CQNA 3FILB 4FJYA 1EF1A 2QC8A 2LHDA 4ZOHC 5DPTA 1KOTA 4RGOS 2JXXA 1WWTA 2VH2A 4RMAA 4RM9A 1KJTA 1OTRB 2KFJA 2KN5A 2L1AA 1UBIA 4XDDA 5HFYA 5LXIB 1HQRD 1D5MC 1OFFA 2FAZA 2FNJB 2KKCA 2L05A 3IXSA 2Z0DB 2DNFA 4B0MA 2PE6B 4URKA 3MC8A 1WJ6A 3L08A 2MX2A 4RGMA 4DWFA 1OQQA 1GUAB 2FCSA 4P1BC 1TY0A 4MSMB 4W9EA 3VFKA 4BFRA 1IBXA 1T6BX 1MVKA 2NPTB 1EF5A 2G45B 2KQ4X 1NI2A 2E6XA 2BBCA 4FHJA 2GLSA 3W9CB 5L95C 4BKTA 2YEPF 2LVQA 3L4PA 4NY0A 3I3TB 2BYVE 3NZ3A 1S1QB 2KOXA 3Q3FA 3ZJTA 4GOCA 1UUPA 3A33B 5BMIA 2G9HD 1XQQA 1B9RA 3WAOA 3RUIB 4MJSA 3N20C 5TR5A 2UYZB 3VTUA 4AWJA 2MSED 4MT5A 5I4DA 4YWGG 1ISNA 1QF6A 1T0SC 2N9EB 2C7NB 2ZPYA 2LFIA 2CHWA 3L17A 3N30A 4P1CC 2AX5A 1L2NA 2J0KA 1WF9A 1C76A 2V3PA 3Q3NC 3SD5A 2JU6X 1P0RA 2NBWB 2KJ6A 1I4HA 2WWZA 1WGGA 3U30A 1V80A 4XDCA 2WU2B 1QLBB 1ZUD2 2LASA 3O65B 1U4AA 5FR3A 2J52A 2WYQA 4O1NA 3Q8BA 1ZXIA 2JRIB 3KWLA 4JLCA 1YD8U 5FKAC 4UDUC 4W9DA 1PQSA 2WNMA 4BBNF 2LVOA 4KKIA 4M0WA 3PT2B 3X23A 2I1KA 4RFBA 1YQ4B 2ZW1A 1TS2A 3JW0X 1E8XA 2BB6A 1CZPA 4R3DA 4C7ZA 2AL6A 1R4MB 1RWSA 2IJ0A 4WAAA 3OJ4B 5C23A 3EFUA 1MPEA 3SFDB 1BUIC 1E5WA 4HEA1 1FMAD 3SR6A 1UELA 4NJ7A 3I5JC 4IUMB 3LJ3A 3NY5A 1S3SG 2O6VA 3N32A 1VD2A 4WWPA 1L4DB 4ZRPA 1XLPA 3NVYA 2D5GA 4NJCA 3M63B 2OHFA 1J7BA 3DVNU 4LNIA 5AUKA 1F1HA 1ET6A 4WURA 3L0WB 1QT9A 2JXTA 4M8MA 3TJPA 2HD5B 1UWMA 2WXOA 1L6VA 2DHZA 3PHWB 3ZDTA 3SFEB 3ZXVA 2V0GA 2W55A 4MH8A 4JPSA 1L0YB 1ZOYB 1F52A 3TEYA 1KH0A 4IG7B 5EE3A 1Q0WB 2ZW0A 1T5XD 2MCNB 1ZE3D 3TBLD 3T8MA 3UQBA 5HKHA 1V1PA 3PZ8A 4W9JA 2MH7A 4BKSA 2PVGC 4NAWB 4II3B 1UNSA 4HXDA 4C56C 2O2VA 4HROA 4YTPB 3NZUA 1WRIA 5JHBA 2MJEA 2K1FA 4NQKE 2Y5PA 4EOYA 2LGSA 1JRUA 1FIQA 2DLBA 2INNE 2CU1A 2WXMA 1R4NB 5AZFA 2CJOA 3ZDMC 4BOZB 4JWUC 3QWZB 1FFUA 4P6VF 2HJ8A 2M1MA 4EZLA 3CMMB 3UIOB 2ZNVB 3CSTA 3RNBC 2J4XA 5HI1A 2BW2A 2Z0EB 1FNUA 3IHPC 2L83A 3HM3A 3CSFA 4MH0E 4S17A 1JWAD 2SAKA 2N1VA 1CK1A 4US9A 2KFKB 3V6CB 3BYYB 4IC7B 1V86A 3RNGC 3PRPB 4RGTA 3DHHC 4GDLA 5G2NA 3AXCA 3QK0A 3AE9B 4XWTA 1E90A 1ROEA 4B0EA 4WWMA 2DX5B 1NYRA 3PPAA 2L0FA 5D6JB 1RAXA 1SIJA 4PS3A 3AE2B 2BYEA 1PUTA 3KYCD 3QAQA 1BXTA 3L10B 1JWUD 2E3TA 1CMXB 3RI7C 3E56A 2I1JA 4HVBA 2AQ1B 4ZRIA 4ZDVA 2DENB 1WXSA 2NTSA 1STEA 4GGQA 1YQ3B 3W2DA 4N58A 1HA5A 2J0MA 2PKOA 4GMVA 1IPGA 1HTQA 1E7PB 1DGJA 5C3JB 3RNEC 1NVID 2IPKD 2KZRA 4HCPB 4HPMB 1MHHE 3ZGZA 1WMHA 4X57B 4WJQA 4Q2JA 4P7IA 3Q69A 2WGSA 4W9CA 1IBXB 2PLPA 3CIRB 1JW9D 1VZ6A 1SB3C 3VRAB 4FXCA 2MHJA 2ZZPB 3BYTB 2B76B 2QSDA 3V62A 3TEWA 1DOXA 4A6QA 1WE7A 1FO4A 2N1WA 3APCA 3FAHA 1HEZE 1V9JA 2V4IB 5IO9A 1QOAA 4AJYB 3ZJUA 3RN9C 4N6EB 5LLIA 3QQ8B 5JZEB 2INDC 4AS1A 2LJ5A 4E74A 1E8ZA 4JX1C 4ZRKA 1OGWA 2WP9B 3PV1A 2KMMA 1P1AA 3ZNHB 1I4XA 1D6EC 2WQYB 3WAMA 4LNKA 1SBBB 1TJEA 1ZDVA 2AQ3B 3PLVA 3Q3OC 5J18A 2FUHB 2ON8A 1V5OA 1FEHA 1WJUA 3TL5A 4HK2A 1J19A 4BKGA 3V05A 4XWWA 2CS4A 2ICIA 3K9PB 3MP9A 3AE4B 1EUVB 5FK9C 2LXAA 1MG8A 2B3AA 5IA7A 1VZ8A 1QILA 2GBRA 3P4QB 2MQJA 2N9XA 1FCCC 1TBEA 3U52E 3MTNB 1R4NI 2A4ZA 4DHZB 1EO6A 2KWDA 5LNK1 3KUDB 4ANVA 1D3ZA 1VR9A 2CKHB 3MHZA 2BWES 2GOWA 4I6LB 3NVWA 4G11A 1XF5L 4C7YA 2CJNA 1X1MA 1K8RB 2N9KA 4TSSA 1QOFA 2J53A 3ZIMA 4HWIB 3RCZA 1ZGUB 4P16A 3HHMA 5IAAC 3SDLC 4NJ6A 4M0WB 1UGMA 1WJNA 2KTRB 1VZ7A 2KANA 1NYQA 4KZ0A 1OQYA 1XCQL 4PYZA 2WXHA 1V49A 2YLMA 1UGJA 2AQ2B 4I6PA 2D3AA 4WJPA 3WIMA 4KIKA 4ZHPA 1MI0A 1K50A 1SEBD 2IO1B 2WXLA 3EUB2 3V3XA 3VH4B 3NHEB 4GIVA 1C79A 3K9OB 1KFYB 1IP9A 4RH6A 2NBUA 2W82A 1WXVA 4DK5A 1YMHE 3AV8A 2Z8LA 5L83A 3WAPA 2VZKB 4K3CA 4MELA 4OVVA 3ZNGC 3EC8A 3GE3C 3P4RB 3C0RB 2IO2B 2KLCA 1WI0A 1VLBA 4AJWA 2EKEC 1VRAB 3ZKJC 2L00B 1EU3A 2QIEB 4TUUA 2LGIA 2WLBA 1L5PA 4PK1A 2JWZA 5GMVA 5BYSA 4LJOB 2KDMA 2O6VD 1L0VB 2LGYA 1FNWA 4FULA 2H88B 4A55A 4LNNA 4JGHB 3OAWA 4EEWA 5DPWA 1QKZA 2WDTB 1RRBA 4RNAA 5H92C 2OEDA 1KLVA 2LMCA 2O2VB 2RPVA 1ESFA 4OVUA 1GPXA 5IN7A 5BMGA 2FIDA 4G50A 3B1LX 3DQVA 3VR8B 3ZJVA 3X0WA 4GDKA 4GLSC 3MHSD 2K3UA 4W9GA 2ZJDA 4KX6B 4REZA 4BKSD 4B6WA 4C00A 1P3QU 1UWXA 1XLOA 3MFGA 3HK0A 4K7UA 3M62B 4M02A 1WY8A 2LWPA 4JE3B 3R8BA 3R2TA 2D3GA 3SU8X 4IM3A 4B9KA 2WDVB 1Y56A 2KMAA 3RNFC 3A9KB 2KDBA 1I4QA 3H9DA 3M3JA 1KM7A 3N1XC 3DHIC 2IBIB 1ACCA 3PRZA 2MBOA 2QHOA 4H2AA 2RPQA 3ECIA 5CHVC 1C4AA 2I2YA 1I4PA 3NG0A 4DHJD 2K39A 3A1QA 3UQAA 1IGDA 3N1ZC 3Q8FA 4A3PA 3ZNID 2DYMA 3RZWC 4RF1A 1MFWA 4MM3A 4KGSA 2KDIA 1GB4A 2DZMA 2KDEB 2FIFA 3DHGC 5AZHA 3DCGA 3R7RA 2KYWA 2MA9B 2ASQA 2DWQA 2D07B 2QEJC 3DOWA 3PHXB 3AULA 3VRBB 3AE5B 3T9LA 3TIXA 3BY4B 4TQ1A 1QZEA 3TMPB 3LXFA 3AB5A 2KQSA 2JWUA 1YOVB 2NMQA 1HTOA 1QOBA 3RMKC 1WMHB 2KDFB 3QX1A 5AEKB 2LGDA 3D32A 3RYTA 3AECB 2KNBA 4A90A 3V60A 1N63A 2NVUI 4L2YA 3I63C 2FCMA 2XK5A 2LRUA 4LCDE 4ARCA 2EMTA 5H8YE 1KRHA 4BVUC 4W9HA 1FXAA 3Q6BA 3APDA 2IYDB 2K8CA 1NBFC 2PEAA 4J3OD 1XO3A 5BYQA 2CU3A 2MBBB 4K7SA 2Y3AA 1D4BA 1WZ3A 1T3QA 4S0RA 3IBEA 4TV3A 1LFDA 4WWNA 1DYQA 3TEXA 2LUEA 4DXFA 4KSLC 1SJED 1TGZB 2MJ3A 3FILA 3PS6A 2C7MB 1K52A 5G5GA 1F77A 1E0ZA 4ZHOA 2BTEA 2KJHB 3DBLI 1AN8A 2QJLA 3NUHB 4HJKA 3R7QA 1T0YA 1TZ1A 2JYEA 2D10A 4CO7A 5AUIA 2GBNA 2LHEA 1TKYA 4KGRA 2W3RA 1GB1A 1YX5B 4OW0A 5FR6A 1RLFA 1WE6A 3IT6B 3NVZA 1ZXHA 3PVLA 1GAQB 2ACZB 4GB9A 1JWSD 3PGEA 5J17A 4EUTA 2JVCA 4PT5A 4NAMA 1ZW7A 4NPNA 2KJRA 3HIZA 3APFA 2DYBA 4HJGE 1V2YA 5CHFA 1L6UA 4JQWC 2N7JA 1TKEA 2Q5WD 1YIWA 1SE2A 3WALA 1E10A 1WXMA 1RFAA 2DAJA 2KACA 3KUCB 2GRIA 2WXPA 4K3BA 4WJNA 1MG4A 3Q2AC 4PS8A 4KIKB 4A9AA 1K53A 1PDXA 2FUG1 2KX3A 2PMVA 2WDRB 1UZXB 3S2AA 2NBVB 4PYUA 2G1EA 4ICVA 1SXTA 2M17A 4IKGA 4MGZE 1E8YA 1J7CA 4CHKA 1P7FA 2PE9A 5GXGB 2KWUB 3RPFC 3VUWA 2C7HA 3TUOA 4ACFA 3ZVVA 1ZKHA 2N0SB 3VH3B 2WXIA 2AYOB 3P4SB 4MGIE 5AZGA 4DDGD 1EWYC 3DBHI 2I38A 4WH4A 5DPRA 3P1MA 2BYTA 1NEKB 2N4FA 2KN4A 4ARIA 3ALBA 2WXGA 1WGRA 5IKCM 5CTRC 1XD3B 4II2B 3ONSA 3U7ZA 3W5VB 2KQ7A 2BWFA 4XC2A 1YJ1A 1WZ0A 2JX5A 1HZ6A 2CR5A 2DBYA 2QCZA 1WM3A 2XBBC 4N9F4 4NZLB 1C3TA 1TIFA 3RULA 4FLHA 3N3KB 1E9MA 1ZP0B 3L13A 3V61A 1FXTB 1JWBD 1GC7A 4DQOC 1YN5A 2GI9A 1ET9A 1JWMD 2JRHA 4WIPA 4HKZE 5G5HA 2H89B 4I6NB 4FN2A 1AARA 4WWOA 3VTWA 2SEBD 5LXHA 4EZKA 2A5UA 2KWVB 1WM2A 4KVGB 4MDKE 2WXJA 3DVNV 1SE9A 1HZ5A 3OLMD 3TCAA 2D3BA 4GDKB 1Z5SB 2XN9C 1C4CA 3AEEB 5HG2A 2RGFA 3R66C 2AWTA 2MBEA 5D7GA 4IM0A 4NNJB 2KC1A 3EECA 1PGAA 3EFCA 3QARA 1L7YA 2EKIA 2J42A 4A8XC 3JSVA 4LDTD 2IGHA 4MJSB 2ZNVC 3JYUA 4GU2A 2KAJA 3ENEA 3Q8EA 2PIAA 1WX8A 3BVMA 4C4VA 2LVPA 1B1ZA 1DOIA 4XE0A 3ML9A 2N7EA 2JZ3B 2OOBB 1FXIA 2UWQA 2PW9A 4HPPA 3FKYA 4YXDB 4ZYSA 2UU7A 3ZLZA 1ZDXA 1H8CA 2HTME 2PTLA 2LGXA 3ML8A 1KTKA 5G55A 4K81A 1GOZA 3BVGA 3AMZA 3VTVA 4L1BA 3ZRCA 2L7RA 3VVWB 4MACA 2GBJA 3GB1A 3MJWA 2W3SA 2LUMA 1TS5A 2L32A 3W1SA 3LDZE 3QIJA 1MJDA 1TS4A 2JY6A 2ZEQA 3AU4A 1EWCA 1I35A 4KGTA 2K22A 1WX9A 4RGNA 1WGYA 3AE1B 4ASWC 3DDCB 2M0XA 1SE3A 2G4DB 2BS3B 1Q1OA 5E6PA 5JHAA 1OEYA 3DVGY 3AE3B 4IWQA 1G6JA 2GB1A 1VCBA 2TSSA 3AE6B 4OZBA 3QA8A 4DDID 5BMHA 1WFYA 3AEAB 5E6JA 2KVRA 3DBSA 3I9V1 1PGXA 2C9WB 3PZDA 4TKNA 1KLUD 3ZO5B 1EM7A 5IOIA 2JZPA 2R2OA 2MW5A 4N59A 2YEPB 3DBRI 3GZNB 1IYFA 1TZOA 2HTHA 2KMCA 1WGKA 3AE7B 4E71A 3CWIA 4KKJA 1A70A 2O6VB 1F2RI 2BS2B 3H7PA 2AEHA 2WXRA 2RSUA 3W5UB 4LTUA 2L52A 3R2IA 2IZVB 4MSQB 3B0AA 4ANXA 1WSPA 2Y5BB 4J6IA 1HXYD 2WXFA 3BIID 2D2QA 2FBWB 1VJKA 1BMLC 4E3CA 1UH6A 4LNFA 4EFOA 1AYFA 1NENB 4OZAA 3BWUD 4JWSC 3SHQA 1GG3A 2LRWA 3ZW3A 5KHQA 1M4VA 4ANWA 3HRDD 1LM8B 2K9XA 2GBKA 3IT4B 1V1PB 3QC8B 2XNAC 3AEGB 4F8CB 4FA6A 1FCLA 3ZQ4A 1LXDA 3TEZA 3P4PB 1JMLA 2KLGA 3BVZA 5C2TB 3CF6E 3VHTC 4BOSC 1SSNA 3DBLB 4IWOA 3BINA 3N9YC 1YNTE 3Q8AA 1TTNA 2VZKD 2BT6A 1L4ZB 2NTTA 4W9FA 4RCOA 4FJZA 1T0QC 2G4SA 2IY0B 2KD0A 5E6NA 3AH7A 3L16A 2CHXA 2K8BA 2MBHA 3MJ5A 3B08A 4TMAB 5C1ZA 4PS7A 3BK1A 2L0TA 4G3XB 1YN3A 3WANA 3JVZX 4FHKA 3PREA 2R61A 1WX7A 3UINB 4YSZB 3LB8C 3IG3A 1N5WA 2LD9A 3R3MA 4US8A 4DHJB 3OG5A 3PTFC
chains in the Genus database with same CATH topology
1Y8RC 1YQBA 3P2BA 2RD0A 4GGQA 2KWCA 2J0MA 2JF5A 4K7WA 4W9IA 2D11A 4NQLB 4CYEA 1WR1A 4A3OA 2KX0A 2BF8B 2KJHB 4GMVA 3NOBA 1IPGA 3DBLI 1C1YB 4HJKA 5EDSA 4HDOA 4HDQA 3R7QA 1E7UA 2XK5B 1T0YA 1TZ1A 3UIPB 2D10A 2KZRA 4CO7A 4HCPB 3A4SC 2XEWA 4HPMB 3QCAA 2GBNA 1WMHA 2IO0B 4GDLB 3A9JA 4WJQA 2WX0A 4X57B 4P7IA 3UGBB 1Q5WB 3EHVA 4EKUA 2MP2B 4W9CA 2NCNA 4AUQC 5CX3A 3RD2A 2MLBA 1V5TA 1YX5B 4F1SA 1WYWB 5FR6A 1RLFA 2J0JA 3V61A 1WE6A 3M95A 1P98A 2KK8A 2KFKA 2RR9A 4WJOA 2ZZPB 4ICUA 5DPSA 2K25A 1WRDB 3PVLA 4K1RB 3UF8A 3V62A 1A5RA 1WE7A 1P9DU 2IO3B 2N1WA 3APCA 4GB9A 4LJPB 1WJ4A 4AOFA 2JT4B 1V9JA 2GBMA 4TQ0A 3PGEA 5J17A 4EUTA 2JVCA 4FJYA 5DCNA 3ZTDA 1EF1A 3PLUA 3PSEB 4ZYNA 4AJYB 1ZW7A 4NPNA 2KJRA 3HIZA 5DPTA 1KOTA 5LLIA 2JXXA 3APFA 2ZPNA 4JL9A 2DYBA 3QQ8B 4RM8A 1V2YA 1V81A 5CHFA 4JQWC 2JZZA 4RMAA 4RM9A 1KJTA 4HLEA 5JZEB 2LJ5A 1OTRB 4E74A 2LXCA 2KFJA 1YIWA 2KN5A 2K6DB 1E8ZA 4ZRKA 1UBIA 4ANUA 1OGWA 5LXIB 3PV1A 4F7ZA 2FAZA 1P1AA 3VQIA 3WALA 2FNJB 4MGKE 1WXMA 5BO4B 1RFAA 2DAJA 3ZNHB 3KUCB 2KKCA 3WAMA 2L05A 4WJNA 4PS8A 2OJRA 3PLVA 4KIKB 5J18A 2FUHB 3GZNI 3KUZA 1V5OA 2JPHA 2MBQA 2Z0DB 1WJUA 3TL5A 4HK2A 1J19A 2KX3A 3S2AA 1UZXB 2PE6B 4BKGA 4MGYE 4URKA 1WJ6A 3L08A 2MX2A 2NBVB 2CS4A 2KTRA 4PYUA 2BGFA 3K9PB 1WXAA 4ICVA 1EUVB 2CHZA 2LXAA 2M17A 4ZRJA 1WIAA 1MG8A 2B3AA 4G0NB 2VRRB 4MGZE 1E8YA 4DWFA 5IA7A 4CHKA 2GBRA 2MQJA 2N9XA 1GUAB 2V1YA 4MEMA 1V6EA 2GMIC 2FCSA 2PE9A 3RZFA 1TBEA 3HM6X 3MTNB 1R4NI 2MP2A 2LI5A 4MSMB 2WX1A 2A4ZA 4W9EA 3VFKA 4BFRA 1GC6A 2KWUB 3VUWA 4DHZB 2NPTB 1EO6A 4IM2A 2C7HA 1EF5A 1BT0A 3KUDB 3ZVVA 1GNUA 4ANVA 1ZKHA 2G45B 3VH3B 4FBJB 2AYOB 1D3ZA 1NI2A 2N7DA 3A4RA 5D94A 2CKHB 4FHJA 2BWES 4MGIE 5AZGA 5L95C 4DDGD 5D2MB 2GOWA 4BKTA 4I6LB 2LVQA 3DBHI 2AL3A 4G11A 4NY0A 4BBNC 5DPRA 3I3TB 3JSVB 2BYVE 1S1QB 1X1MA 1K8RB 4W9KA 4XX5A 2N4FA 3ZIMA 2KOXA 3Q3FA 3PS6A 4HWIB 3ALBA 1WGRA 3RCZA 1ZGUB 5CTRC 3IVFA 1M94A 1XD3B 4II2B 3ONSA 3HHMA 2KQ7A 4FJVB 5IAAC 4GOCA 3SDLC 2BWFA 3DPDA 4XC2A 4NJ6A 1YJ1A 2KC2A 1WZ0A 4M0WB 3A33B 4IWPA 1UGMA 1WJNA 2KTRB 2CR5A 2FCQA 3VXWA 1WM3A 2KANA 2XBBC 1XQQA 4KDIC 4KZ0A 1OQYA 2LZ6A 3WAOA 4N9F4 2K6QA 3L54A 4PYZA 3RUIB 4MJSA 3RULA 3DVGX 4FLHA 1C3TA 1V49A 3N3KB 2YLMA 2UYZB 3L13A 4I6PA 4WJPA 5TR5A 2MSED 2V4LA 4KIKA 3VTUA 4AWJA 1FXTB 2M4NA 3QHTA 1WGDA 1ISNA 2IO1B 2KO3A 2ZVOA 1GC7A 2N9EB 2C7NB 4GSWA 3VH4B 2ZPYA 2JRHA 3NHEB 3ZRFA 2CHWA 3L17A 3N30A 4I6NB 4FN2A 1AARA 4GIVA 3AU5A 4WWOA 3VTWA 3NS8A 5LXHA 4A20A 1L2NA 2J0KA 3K9OB 4EZKA 2A5UA 2KWVB 1WF9A 1WM2A 1E8WA 4KVGB 1IP9A 4MDKE 2NBUA 3KYDD 3QJZA 1WXVA 4DK5A 3SD5A 3DVNV 1P0RA 1SE9A 3OLMD 2NBWB 1HE8A 2Z59B 3TCAA 2KJ6A 1SIFA 2WWZA 1WGGA 4GDKB 1Z5SB 3U30A 1V80A 3KW5B 3PRMB 5L83A 3WAPA 2RGFA 3R66C 2AWTA 2MBEA 4MELA 4OVVA 2NPTA 3EC8A 5D7GA 4IM0A 4NNJB 3ZNGC 2KC1A 3C0RB 2IO2B 2KLCA 1WI0A 3EECA 2LASA 3H6NA 4AJWA 3O65B 3QARA 1U4AA 2EKEC 2WYQA 2MRPA 1L7YA 3ZKJC 2L00B 3JSVA 4LDTD 4MJSB 2JRIB 4JLCA 2ZNVC 3JYUA 4HCNB 4TUUA 4KV2A 1YD8U 4GU2A 2NR2A 1YX6B 3ENEA 4W9DA 2JWZA 1PQSA 1WX8A 5GMVA 2LVPA 2K8HA 1OEYJ 1SGHA 4LJOB 4BBNF 2LVOA 2O6VD 3TIXA 3PT2B 3X23A 2I1KA 2LGYA 4M8NA 1GJZA 3ML9A 2N7EA 4FULA 2JZ3B 3VUXA 2OOBB 2UWQA 4XZ4A 3JW0X 3ZLZA 1E8XA 4JGHB 3OAWA 4YL8A 1H8CA 4EEWA 5DPWA 2KTFA 3GOEA 2FCNA 2WDTB 1RRBA 3H7PB 4WQOB 1KLVA 2AL6A 2LGXA 2O2VB 3A9KA 3ML8A 4OVUA 5G55A 3V6EB 4K81A 2J7QB 5E6OA 4WAAA 2NS5A 3VTVA 3ZRCA 2FIDA 1I42A 3OJ4B 5C23A 2L7RA 3EFUA 3VVWB 2GBJA 2DZIA 3MJWA 4JIOU 4G50A 2V3SA 3B1LX 3DQVA 1E5WA 1WR6E 2EMSA 3W1SA 3LDZE 3Q3JA 3QIJA 3X0WA 1UELA 4GDKA 4NJ7A 4IUMB 1E7VA 2JY6A 2DZKA 2ZEQA 3AU4A 3LJ3A 3MHSD 1S3SG 2O6VA 1XT9B 3N32A 3NY5A 3VUYA 1VD2A 4WWPA 3ZNZB 1I35A 2C5LC 4W9GA 2ZJDA 4KDLB 1WX9A 3M63B 3KH0A 3DVNU 1WGYA 4ASWC 2REXA 4BKSD 3DDCB 2KHWB 2M0XA 3L0WB 2G4DB 2PPHA 4B6WA 1J8CA 1Q1OA 4B95A 2JUOA 3OJ3A 1F9JA 1P3QU 4M8MA 5E6PA 2HD5B 3TJPA 1OEYA 5JHAA 2DHZA 3DVGY 3HK0A 4K7UA 4KSKC 3H1UA 3M62B 4IWQA 1G6JA 3PHWB 3WIMA 1WY8A 3ZDTA 1VCBA 2LWPA 1UBQA 3RT3B 2BKFA 2D3GA 1WH3A 3QA8A 4IM3A 5CHWA 3SU8X 4DDID 2ZVNA 4B9KA 2G3QB 4EZJA 1WFYA 2KMAA 2KVRA 3DBSA 1R4MI 4IG7B 3A9KB 2KDBA 2C9WB 3PZDA 1Q0WB 4TKNA 4LDTB 3U7DA 1NDDA 2MCNB 3ZUNA 3ZO5B 3H9DA 3M3JA 3TBLD 3T8MA 3UQBA 1KM7A 5HKHA 4GXBA 5KHOA 2IBIB 2MW5A 2R2OA 4W9JA 2R2QA 3DBRI 3PRZA 1IYFA 2KMCA 2HTHA 4BKSA 4E71A 4NAWB 2MBOA 2QHOA 2RPQA 3ECIA 4II3B 5CHVC 4HXDA 2O6VB 3H7PA 3W1SC 2AEHA 4DHJD 2K39A 2RSUA 3A1QA 2O2VA 3NZSA 3UQAA 2ZCBA 2IZVB 4MSQB 4A3PA 3NZUA 3ZNID 5JHBA 3U8ZA 3B0AA 4ANXA 1LQBA 2DYMA 3RZWC 5J2RA 2Y5BB 2K1FA 4J6IA 4MM3A 4AP4C 1H4RA 2KDIA 3H7SA 4NQKE 4EOYA 2D2QA 1JRUA 2PJHA 2DZMA 4DBGA 2C60A 1WGHA 2CU1A 2KDEB 2FIFA 3WA0A 5AZHA 4E3CA 5AZFA 3DCGA 4KZCA 1UH6A 3R7RA 3ZDMC 4BOZB 4EFOA 3QWZB 2MA9B 2ASQA 2HE7A 2D07B 2L76A 3DOWA 2W9NA 3PHXB 3AULA 2HJ8A 3VDZA 3T9LA 2M1MA 3BY4B 2N9PC 1QZEA 4TQ1A 1GG3A 2LRWA 2M8SA 3SHQA 2DYOA 3TMPB 4DHZE 4EZLA 3ZW3A 5KHQA 2BYFA 2KQSA 3CMMB 3UIOB 2ZNVB 3CSTA 4ANWA 4IW0A 1LM8B 4DXAB 2Z0EB 2GBKA 3KVFB 3QC8B 4F8CB 4FA6A 1LXDA 1WMHB 3IFWB 3A9JB 2KDFB 3IHPC 3QX1A 2KLGA 3HM3A 3CSFA 4MH0E 5AEKB 3CF6E 5JH5C 3VHTC 1Z2MA 4BOSC 2YVCA 2LGDA 3D32A 2BKRB 4IWOA 3RYTA 2KNBA 2N1VA 3ZTCA 2IY1B 3A1QB 3VAWA 3V60A 2NVUI 2ZCCA 3BINA 2KFKB 2FCMA 1TTNA 2L8JA 2BPSA 2XK5A 3V6CB 4HPLB 4W9FA 3W1YA 1J0GA 2LRUA 4IC7B 4LCDE 2EMTA 4FJZA 1V86A 2DAFA 2G4SA 4BVUC 2IY0B 2KD0A 3PRPB 5E6NA 2KXJA 4W9HA 3L16A 2CHXA 2K8BA 4W9LA 4GDLA 5G2NA 3AXCA 3QK0A 4GN1A 3APDA 2IYDB 2MBHA 1E90A 3B08A 2K8CA 1NBFC 4NAWA 5C1ZA 2DX5B 2PEAA 3PPAA 4PS7A 3AI5A 2L0FA 5D6JB 1RAXA 2L3ZA 4PS3A 2L0TA 2MBBB 1UD7A 4G3XB 4K7SA 2BYEA 2DZJA 3KYCD 2MWSB 3WANA 3JVZX 1WZ3A 3QAQA 3L10B 4FHKA 3PREA 3IBEA 1WX7A 4TV3A 4FADA 3UINB 1LFDA 3IG3A 4WWNA 1CMXB 2I1JA 2LUEA 2LD9A 4HVBA 3R3MA 4KSLC 4ZRIA 4DHJB 1TGZB 4ZDVA 2DENB 2C7MB 3PTFC 1WXSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y8R C;  1YQB A;  3P2B A;  2RD0 A;  4GGQ A;  2KWC A;  2J0M A;  2JF5 A;  4K7W A;  4W9I A;  2D11 A;  4NQL B;  4CYE A;  1WR1 A;  4A3O A;  2KX0 A;  2BF8 B;  2KJH B;  4GMV A;  3NOB A;  1IPG A;  3DBL I;  1C1Y B;  4HJK A;  5EDS A;  4HDO A;  4HDQ A;  3R7Q A;  1E7U A;  2XK5 B;  1T0Y A;  1TZ1 A;  3UIP B;  2D10 A;  2KZR A;  4CO7 A;  4HCP B;  3A4S C;  2XEW A;  4HPM B;  3QCA A;  2GBN A;  1WMH A;  2IO0 B;  4GDL B;  3A9J A;  4WJQ A;  2WX0 A;  4X57 B;  4P7I A;  3UGB B;  1Q5W B;  3EHV A;  4EKU A;  2MP2 B;  4W9C A;  2NCN A;  4AUQ C;  5CX3 A;  3RD2 A;  2MLB A;  1V5T A;  1YX5 B;  4F1S A;  1WYW B;  5FR6 A;  1RLF A;  2J0J A;  3V61 A;  1WE6 A;  3M95 A;  1P98 A;  2KK8 A;  2KFK A;  2RR9 A;  4WJO A;  2ZZP B;  4ICU A;  5DPS A;  2K25 A;  1WRD B;  3PVL A;  4K1R B;  3UF8 A;  3V62 A;  1A5R A;  1WE7 A;  1P9D U;  2IO3 B;  2N1W A;  3APC A;  4GB9 A;  4LJP B;  1WJ4 A;  4AOF A;  2JT4 B;  1V9J A;  2GBM A;  4TQ0 A;  3PGE A;  5J17 A;  4EUT A;  2JVC A;  4FJY A;  5DCN A;  3ZTD A;  1EF1 A;  3PLU A;  3PSE B;  4ZYN A;  4AJY B;  1ZW7 A;  4NPN A;  2KJR A;  3HIZ A;  5DPT A;  1KOT A;  5LLI A;  2JXX A;  3APF A;  2ZPN A;  4JL9 A;  2DYB A;  3QQ8 B;  4RM8 A;  1V2Y A;  1V81 A;  5CHF A;  4JQW C;  2JZZ A;  4RMA A;  4RM9 A;  1KJT A;  4HLE A;  5JZE B;  2LJ5 A;  1OTR B;  4E74 A;  2LXC A;  2KFJ A;  1YIW A;  2KN5 A;  2K6D B;  1E8Z A;  4ZRK A;  1UBI A;  4ANU A;  1OGW A;  5LXI B;  3PV1 A;  4F7Z A;  2FAZ A;  1P1A A;  3VQI A;  3WAL A;  2FNJ B;  4MGK E;  1WXM A;  5BO4 B;  1RFA A;  2DAJ A;  3ZNH B;  3KUC B;  2KKC A;  3WAM A;  2L05 A;  4WJN A;  4PS8 A;  2OJR A;  3PLV A;  4KIK B;  5J18 A;  2FUH B;  3GZN I;  3KUZ A;  1V5O A;  2JPH A;  2MBQ A;  2Z0D B;  1WJU A;  3TL5 A;  4HK2 A;  1J19 A;  2KX3 A;  3S2A A;  1UZX B;  2PE6 B;  4BKG A;  4MGY E;  4URK A;  1WJ6 A;  3L08 A;  2MX2 A;  2NBV B;  2CS4 A;  2KTR A;  4PYU A;  2BGF A;  3K9P B;  1WXA A;  4ICV A;  1EUV B;  2CHZ A;  2LXA A;  2M17 A;  4ZRJ A;  1WIA A;  1MG8 A;  2B3A A;  4G0N B;  2VRR B;  4MGZ E;  1E8Y A;  4DWF A;  5IA7 A;  4CHK A;  2GBR A;  2MQJ A;  2N9X A;  1GUA B;  2V1Y A;  4MEM A;  1V6E A;  2GMI C;  2FCS A;  2PE9 A;  3RZF A;  1TBE A;  3HM6 X;  3MTN B;  1R4N I;  2MP2 A;  2LI5 A;  4MSM B;  2WX1 A;  2A4Z A;  4W9E A;  3VFK A;  4BFR A;  1GC6 A;  2KWU B;  3VUW A;  4DHZ B;  2NPT B;  1EO6 A;  4IM2 A;  2C7H A;  1EF5 A;  1BT0 A;  3KUD B;  3ZVV A;  1GNU A;  4ANV A;  1ZKH A;  2G45 B;  3VH3 B;  4FBJ B;  2AYO B;  1D3Z A;  1NI2 A;  2N7D A;  3A4R A;  5D94 A;  2CKH B;  4FHJ A;  2BWE S;  4MGI E;  5AZG A;  5L95 C;  4DDG D;  5D2M B;  2GOW A;  4BKT A;  4I6L B;  2LVQ A;  3DBH I;  2AL3 A;  4G11 A;  4NY0 A;  4BBN C;  5DPR A;  3I3T B;  3JSV B;  2BYV E;  1S1Q B;  1X1M A;  1K8R B;  4W9K A;  4XX5 A;  2N4F A;  3ZIM A;  2KOX A;  3Q3F A;  3PS6 A;  4HWI B;  3ALB A;  1WGR A;  3RCZ A;  1ZGU B;  5CTR C;  3IVF A;  1M94 A;  1XD3 B;  4II2 B;  3ONS A;  3HHM A;  2KQ7 A;  4FJV B;  5IAA C;  4GOC A;  3SDL C;  2BWF A;  3DPD A;  4XC2 A;  4NJ6 A;  1YJ1 A;  2KC2 A;  1WZ0 A;  4M0W B;  3A33 B;  4IWP A;  1UGM A;  1WJN A;  2KTR B;  2CR5 A;  2FCQ A;  3VXW A;  1WM3 A;  2KAN A;  2XBB C;  1XQQ A;  4KDI C;  4KZ0 A;  1OQY A;  2LZ6 A;  3WAO A;  4N9F 4;  2K6Q A;  3L54 A;  4PYZ A;  3RUI B;  4MJS A;  3RUL A;  3DVG X;  4FLH A;  1C3T A;  1V49 A;  3N3K B;  2YLM A;  2UYZ B;  3L13 A;  4I6P A;  4WJP A;  5TR5 A;  2MSE D;  2V4L A;  4KIK A;  3VTU A;  4AWJ A;  1FXT B;  2M4N A;  3QHT A;  1WGD A;  1ISN A;  2IO1 B;  2KO3 A;  2ZVO A;  1GC7 A;  2N9E B;  2C7N B;  4GSW A;  3VH4 B;  2ZPY A;  2JRH A;  3NHE B;  3ZRF A;  2CHW A;  3L17 A;  3N30 A;  4I6N B;  4FN2 A;  1AAR A;  4GIV A;  3AU5 A;  4WWO A;  3VTW A;  3NS8 A;  5LXH A;  4A20 A;  1L2N A;  2J0K A;  3K9O B;  4EZK A;  2A5U A;  2KWV B;  1WF9 A;  1WM2 A;  1E8W A;  4KVG B;  1IP9 A;  4MDK E;  2NBU A;  3KYD D;  3QJZ A;  1WXV A;  4DK5 A;  3SD5 A;  3DVN V;  1P0R A;  1SE9 A;  3OLM D;  2NBW B;  1HE8 A;  2Z59 B;  3TCA A;  2KJ6 A;  1SIF A;  2WWZ A;  1WGG A;  4GDK B;  1Z5S B;  3U30 A;  1V80 A;  3KW5 B;  3PRM B;  5L83 A;  3WAP A;  2RGF A;  3R66 C;  2AWT A;  2MBE A;  4MEL A;  4OVV A;  2NPT A;  3EC8 A;  5D7G A;  4IM0 A;  4NNJ B;  3ZNG C;  2KC1 A;  3C0R B;  2IO2 B;  2KLC A;  1WI0 A;  3EEC A;  2LAS A;  3H6N A;  4AJW A;  3O65 B;  3QAR A;  1U4A A;  2EKE C;  2WYQ A;  2MRP A;  1L7Y A;  3ZKJ C;  2L00 B;  3JSV A;  4LDT D;  4MJS B;  2JRI B;  4JLC A;  2ZNV C;  3JYU A;  4HCN B;  4TUU A;  4KV2 A;  1YD8 U;  4GU2 A;  2NR2 A;  1YX6 B;  3ENE A;  4W9D A;  2JWZ A;  1PQS A;  1WX8 A;  5GMV A;  2LVP A;  2K8H A;  1OEY J;  1SGH A;  4LJO B;  4BBN F;  2LVO A;  2O6V D;  3TIX A;  3PT2 B;  3X23 A;  2I1K A;  2LGY A;  4M8N A;  1GJZ A;  3ML9 A;  2N7E A;  4FUL A;  2JZ3 B;  3VUX A;  2OOB B;  2UWQ A;  4XZ4 A;  3JW0 X;  3ZLZ A;  1E8X A;  4JGH B;  3OAW A;  4YL8 A;  1H8C A;  4EEW A;  5DPW A;  2KTF A;  3GOE A;  2FCN A;  2WDT B;  1RRB A;  3H7P B;  4WQO B;  1KLV A;  2AL6 A;  2LGX A;  2O2V B;  3A9K A;  3ML8 A;  4OVU A;  5G55 A;  3V6E B;  4K81 A;  2J7Q B;  5E6O A;  4WAA A;  2NS5 A;  3VTV A;  3ZRC A;  2FID A;  1I42 A;  3OJ4 B;  5C23 A;  2L7R A;  3EFU A;  3VVW B;  2GBJ A;  2DZI A;  3MJW A;  4JIO U;  4G50 A;  2V3S A;  3B1L X;  3DQV A;  1E5W A;  1WR6 E;  2EMS A;  3W1S A;  3LDZ E;  3Q3J A;  3QIJ A;  3X0W A;  1UEL A;  4GDK A;  4NJ7 A;  4IUM B;  1E7V A;  2JY6 A;  2DZK A;  2ZEQ A;  3AU4 A;  3LJ3 A;  3MHS D;  1S3S G;  2O6V A;  1XT9 B;  3N32 A;  3NY5 A;  3VUY A;  1VD2 A;  4WWP A;  3ZNZ B;  1I35 A;  2C5L C;  4W9G A;  2ZJD A;  4KDL B;  1WX9 A;  3M63 B;  3KH0 A;  3DVN U;  1WGY A;  4ASW C;  2REX A;  4BKS D;  3DDC B;  2KHW B;  2M0X A;  3L0W B;  2G4D B;  2PPH A;  4B6W A;  1J8C A;  1Q1O A;  4B95 A;  2JUO A;  3OJ3 A;  1F9J A;  1P3Q U;  4M8M A;  5E6P A;  2HD5 B;  3TJP A;  1OEY A;  5JHA A;  2DHZ A;  3DVG Y;  3HK0 A;  4K7U A;  4KSK C;  3H1U A;  3M62 B;  4IWQ A;  1G6J A;  3PHW B;  3WIM A;  1WY8 A;  3ZDT A;  1VCB A;  2LWP A;  1UBQ A;  3RT3 B;  2BKF A;  2D3G A;  1WH3 A;  3QA8 A;  4IM3 A;  5CHW A;  3SU8 X;  4DDI D;  2ZVN A;  4B9K A;  2G3Q B;  4EZJ A;  1WFY A;  2KMA A;  2KVR A;  3DBS A;  1R4M I;  4IG7 B;  3A9K B;  2KDB A;  2C9W B;  3PZD A;  1Q0W B;  4TKN A;  4LDT B;  3U7D A;  1NDD A;  2MCN B;  3ZUN A;  3ZO5 B;  3H9D A;  3M3J A;  3TBL D;  3T8M A;  3UQB A;  1KM7 A;  5HKH A;  4GXB A;  5KHO A;  2IBI B;  2MW5 A;  2R2O A;  4W9J A;  2R2Q A;  3DBR I;  3PRZ A;  1IYF A;  2KMC A;  2HTH A;  4BKS A;  4E71 A;  4NAW B;  2MBO A;  2QHO A;  2RPQ A;  3ECI A;  4II3 B;  5CHV C;  4HXD A;  2O6V B;  3H7P A;  3W1S C;  2AEH A;  4DHJ D;  2K39 A;  2RSU A;  3A1Q A;  2O2V A;  3NZS A;  3UQA A;  2ZCB A;  2IZV B;  4MSQ B;  4A3P A;  3NZU A;  3ZNI D;  5JHB A;  3U8Z A;  3B0A A;  4ANX A;  1LQB A;  2DYM A;  3RZW C;  5J2R A;  2Y5B B;  2K1F A;  4J6I A;  4MM3 A;  4AP4 C;  1H4R A;  2KDI A;  3H7S A;  4NQK E;  4EOY A;  2D2Q A;  1JRU A;  2PJH A;  2DZM A;  4DBG A;  2C60 A;  1WGH A;  2CU1 A;  2KDE B;  2FIF A;  3WA0 A;  5AZH A;  4E3C A;  5AZF A;  3DCG A;  4KZC A;  1UH6 A;  3R7R A;  3ZDM C;  4BOZ B;  4EFO A;  3QWZ B;  2MA9 B;  2ASQ A;  2HE7 A;  2D07 B;  2L76 A;  3DOW A;  2W9N A;  3PHX B;  3AUL A;  2HJ8 A;  3VDZ A;  3T9L A;  2M1M A;  3BY4 B;  2N9P C;  1QZE A;  4TQ1 A;  1GG3 A;  2LRW A;  2M8S A;  3SHQ A;  2DYO A;  3TMP B;  4DHZ E;  4EZL A;  3ZW3 A;  5KHQ A;  2BYF A;  2KQS A;  3CMM B;  3UIO B;  2ZNV B;  3CST A;  4ANW A;  4IW0 A;  1LM8 B;  4DXA B;  2Z0E B;  2GBK A;  3KVF B;  3QC8 B;  4F8C B;  4FA6 A;  1LXD A;  1WMH B;  3IFW B;  3A9J B;  2KDF B;  3IHP C;  3QX1 A;  2KLG A;  3HM3 A;  3CSF A;  4MH0 E;  5AEK B;  3CF6 E;  5JH5 C;  3VHT C;  1Z2M A;  4BOS C;  2YVC A;  2LGD A;  3D32 A;  2BKR B;  4IWO A;  3RYT A;  2KNB A;  2N1V A;  3ZTC A;  2IY1 B;  3A1Q B;  3VAW A;  3V60 A;  2NVU I;  2ZCC A;  3BIN A;  2KFK B;  2FCM A;  1TTN A;  2L8J A;  2BPS A;  2XK5 A;  3V6C B;  4HPL B;  4W9F A;  3W1Y A;  1J0G A;  2LRU A;  4IC7 B;  4LCD E;  2EMT A;  4FJZ A;  1V86 A;  2DAF A;  2G4S A;  4BVU C;  2IY0 B;  2KD0 A;  3PRP B;  5E6N A;  2KXJ A;  4W9H A;  3L16 A;  2CHX A;  2K8B A;  4W9L A;  4GDL A;  5G2N A;  3AXC A;  3QK0 A;  4GN1 A;  3APD A;  2IYD B;  2MBH A;  1E90 A;  3B08 A;  2K8C A;  1NBF C;  4NAW A;  5C1Z A;  2DX5 B;  2PEA A;  3PPA A;  4PS7 A;  3AI5 A;  2L0F A;  5D6J B;  1RAX A;  2L3Z A;  4PS3 A;  2L0T A;  2MBB B;  1UD7 A;  4G3X B;  4K7S A;  2BYE A;  2DZJ A;  3KYC D;  2MWS B;  3WAN A;  3JVZ X;  1WZ3 A;  3QAQ A;  3L10 B;  4FHK A;  3PRE A;  3IBE A;  1WX7 A;  4TV3 A;  4FAD A;  3UIN B;  1LFD A;  3IG3 A;  4WWN A;  1CMX B;  2I1J A;  2LUE A;  2LD9 A;  4HVB A;  3R3M A;  4KSL C;  4ZRI A;  4DHJ B;  1TGZ B;  4ZDV A;  2DEN B;  2C7M B;  3PTF C;  1WXS A; 
#chains in the Genus database with same CATH topology
 2VH1 A;  3WCQ A;  1YQB A;  2RD0 A;  2QDF A;  4NQL B;  1WR1 A;  4A3O A;  2BF8 B;  3AED B;  1CQV A;  1UF0 A;  4HDO A;  4HDQ A;  1JRP A;  1E7U A;  3Q14 C;  5MPO A;  3EGR A;  3A4S C;  2XEW A;  1YN4 A;  4GDL B;  3A9J A;  3P42 A;  1KLG D;  3UGB B;  5IP4 D;  1Q5W B;  1WXQ A;  1AW7 A;  3ZYY X;  2M19 A;  2EEL A;  4EKU A;  2NCN A;  3DWG C;  3RD2 A;  2MLB A;  2WHI A;  1V5T A;  3NVV A;  4F1S A;  5EE1 A;  1AWD A;  4IOI E;  3M95 A;  4WJO A;  2KK8 A;  2RR9 A;  5T8I A;  4ZRQ A;  5DPS A;  2K25 A;  4K1R B;  2BQQ A;  1P9D U;  1VDV A;  4LJP B;  1WJ4 A;  4AOF A;  2GBM A;  1N61 A;  5DCN A;  3ZTD A;  3PLU A;  3PSE B;  4ZYN A;  2KVZ A;  2JYT A;  1FRD A;  1V1O A;  2ZPN A;  4JL9 A;  4RM8 A;  1V81 A;  4HLE A;  2JZZ A;  2X8X X;  4LK0 M;  2K6D B;  4ANU A;  3B2F A;  4F7Z A;  3VQI A;  3Q3M C;  4MGK E;  5BO4 B;  3DBH B;  1N62 A;  1FPY A;  3I57 A;  1IGC A;  2PVO D;  2OJR A;  3GZN I;  3KUZ A;  1FRR A;  2JPH A;  2MBQ A;  3U2S C;  3AEB B;  1FNV A;  4MGY E;  2X38 A;  2KTR A;  3URY A;  2BGF A;  2BVC A;  1WXA A;  2KT7 A;  2CHZ A;  4ZRJ A;  1WIA A;  4G0N B;  2VRR B;  1WYG A;  2V1Y A;  1V6E A;  2GMI C;  4MEM A;  3RZF A;  2K5P A;  3HM6 X;  1P7E A;  2MP2 A;  2LI5 A;  1F0Z A;  1TKG A;  2WX1 A;  1GC6 A;  2JQR B;  4IM2 A;  1YJJ A;  1JRO A;  1E6E B;  1LO5 D;  1BT0 A;  1GNU A;  4FBJ B;  2N7D A;  3A4R A;  5D94 A;  4USA A;  3BK2 A;  5D2M B;  2AL3 A;  4BBN C;  3JSV B;  3KWV A;  4W9K A;  4XX5 A;  1L0X B;  3IVF A;  1M94 A;  4FJV B;  4C4V B;  3BZD B;  1NI3 A;  3DPD A;  1J7A A;  4XYC A;  4D2K A;  2KC2 A;  3O13 A;  4IWP A;  2FCQ A;  3VXW A;  4KDI C;  2LZ6 A;  2N9L A;  2K6Q A;  3L54 A;  4BAX A;  3T3N A;  3DVG X;  3P63 A;  2V4L A;  2M4N A;  3NJT A;  1WGD A;  2ZVO A;  2KO3 A;  2JSV X;  4GSW A;  2LEK A;  3ZRF A;  1Q10 A;  1ZPS A;  3AU5 A;  5HHD G;  4M00 A;  3NS8 A;  4RF0 A;  4A20 A;  3OWE B;  4OZC A;  1C77 A;  3MC9 A;  1E8W A;  1C78 A;  1N60 A;  3KYD D;  3QJZ A;  1HE8 A;  2Z59 B;  1SIF A;  2RMM A;  1R7S A;  3KW5 B;  2OJW A;  1FFV A;  3PRM B;  1RYJ A;  3GE8 C;  2NPT A;  3PZ7 A;  3HUI A;  1TS3 A;  2MEK A;  3H6N A;  2LJI A;  1QOG A;  2FE8 A;  2MRP A;  3EA6 A;  3C19 A;  4LNO A;  5EE9 A;  4HRS A;  3NS1 A;  4HCN B;  3B2G A;  4KV2 A;  2NR2 A;  1YX6 B;  1JAL A;  3J9C A;  2BS4 B;  1SE4 A;  2WXK A;  2K8H A;  1OEY J;  1I4R A;  1SGH A;  1FD6 A;  1EU4 A;  3AEF B;  2W54 A;  4M8N A;  3VR9 B;  1GJZ A;  1RM6 C;  3VUX A;  4XZ4 A;  1QQR A;  4YL8 A;  1YJI A;  2KTF A;  3GOE A;  2FCN A;  3H7P B;  1RFK A;  4WQO B;  1JQ4 A;  1C4P A;  1T0R C;  3A9K A;  4YTM B;  3E9S A;  3V6E B;  2RDH A;  2J7Q B;  5E6O A;  2NS5 A;  1I4G A;  1I42 A;  2RDB C;  1XLN A;  2WDQ B;  1D5Z C;  2DZI A;  4JIO U;  2V3S A;  3DBR B;  1WR6 E;  2EMS A;  3Q3J A;  2WXQ A;  1E7V A;  1SF0 A;  2DZK A;  4AQ7 A;  1JCK B;  4DXG A;  1XT9 B;  3VUY A;  3ZNZ B;  3T3O A;  1D5X C;  2C5L C;  2QMT A;  4KDL B;  2REX A;  4YSX B;  2KHW B;  4LLG M;  2PPH A;  1J8C A;  2V9H A;  1K51 A;  4B95 A;  3OJ3 A;  2JUO A;  3C8Y A;  1F9J A;  3GP7 A;  4HKQ A;  3DWM A;  3ABV B;  1MHX A;  4KSK C;  3H1U A;  1XLQ A;  5D3D A;  4XGA B;  1UBQ A;  3RT3 B;  3AN1 A;  2BKF A;  1WH3 A;  5CHW A;  4ITK A;  1ENF A;  2ZVN A;  2G3Q B;  4EZJ A;  1V97 A;  3MC0 B;  2WXN A;  4BZA A;  1R4M I;  1FM0 D;  2RDG A;  4LDT B;  3U7D A;  1NDD A;  3ZUN A;  3AM9 A;  4GXB A;  5KHO A;  2R2Q A;  1DOY A;  1PFD A;  3W1S C;  1IUE A;  3NZS A;  2ZCB A;  3RNC C;  2IDY A;  1CJE A;  2WS3 B;  3U8Z A;  1LQB A;  5J2R A;  2ONQ A;  3KLS X;  4AP4 C;  1H4R A;  1OQR A;  3H7S A;  3ZXR A;  2PJH A;  4YTN B;  2M56 B;  1PYW D;  2C60 A;  2HJ1 A;  1WGH A;  4DBG A;  3WA0 A;  4KZC A;  3TSS A;  3IAS 1;  2M0A A;  2HE7 A;  2L76 A;  1SJH D;  2W9N A;  1TT5 B;  3VDZ A;  2INP E;  2N9P C;  4DHZ E;  2M8S A;  2DYO A;  2BYF A;  4C80 A;  4IW0 A;  1XCT L;  1N6Z A;  1TY2 A;  3KQ4 A;  5EE0 A;  4DXA B;  1C9F A;  3KVF B;  1I7H A;  3IFW B;  3A9J B;  1XEE A;  3SEB A;  4M01 A;  5JH5 C;  2V3N A;  4OVZ A;  1Z2M A;  2IGD A;  2YVC A;  3B9J A;  3H8H A;  2BKR B;  3ZTC A;  2IY1 B;  3A1Q B;  3VAW A;  2ZCC A;  2WU5 B;  1XXG A;  2L8J A;  2BPS A;  3IAM 1;  3W1Y A;  4HPL B;  1J0G A;  4YT0 B;  2DAF A;  4MM3 B;  1LGR A;  2KXJ A;  2MJD A;  4W9L A;  3FC4 A;  4GN1 A;  3ETR A;  4NAW A;  3NRZ A;  4EE2 A;  3AI5 A;  2L3Z A;  3UI3 A;  1UD7 A;  2DZJ A;  2MWS B;  3N1Y C;  1F2R C;  2D3C A;  5TSS A;  4FAD A;  3LYY A;  4IDI A;  1N5X A;  3QHT A;  4L23 A;  2LXC A;  3KH0 A;  5BYR A;  5JXV A;  1Y8R C;  3P2B A;  3HVZ A;  2KWC A;  4K7W A;  1PGB A;  2JF5 A;  4W9I A;  2D11 A;  4CYE A;  2INC C;  3AE8 B;  3U4E G;  2KX0 A;  4YSY B;  3NOB A;  1C1Y B;  5EDS A;  2XK5 B;  1KF6 B;  3UIP B;  3QCA A;  3PO0 A;  3RNA C;  2IO0 B;  2Y5C A;  2WX0 A;  1TYG B;  4OHJ A;  4WQM A;  3EHV A;  2MP2 B;  5D3I B;  4AUQ C;  5CX3 A;  4QAY A;  1WYW B;  2BB5 A;  2J0J A;  2HDE A;  1P98 A;  2IGG A;  2K0P A;  2KFK A;  4ICU A;  1A5R A;  1WRD B;  3UF8 A;  3Q8C A;  4WAF A;  3HVD A;  3RFZ B;  2IO3 B;  2QIL A;  1V8C A;  3GS2 A;  2JT4 B;  4TQ0 A;  4CQN A;  3FIL B;  4FJY A;  1EF1 A;  2QC8 A;  2LHD A;  4ZOH C;  5DPT A;  1KOT A;  4RGO S;  2JXX A;  1WWT A;  2VH2 A;  4RMA A;  4RM9 A;  1KJT A;  1OTR B;  2KFJ A;  2KN5 A;  2L1A A;  1UBI A;  4XDD A;  5HFY A;  5LXI B;  1HQR D;  1D5M C;  1OFF A;  2FAZ A;  2FNJ B;  2KKC A;  2L05 A;  3IXS A;  2Z0D B;  2DNF A;  4B0M A;  2PE6 B;  4URK A;  3MC8 A;  1WJ6 A;  3L08 A;  2MX2 A;  4RGM A;  4DWF A;  1OQQ A;  1GUA B;  2FCS A;  4P1B C;  1TY0 A;  4MSM B;  4W9E A;  3VFK A;  4BFR A;  1IBX A;  1T6B X;  1MVK A;  2NPT B;  1EF5 A;  2G45 B;  2KQ4 X;  1NI2 A;  2E6X A;  2BBC A;  4FHJ A;  2GLS A;  3W9C B;  5L95 C;  4BKT A;  2YEP F;  2LVQ A;  3L4P A;  4NY0 A;  3I3T B;  2BYV E;  3NZ3 A;  1S1Q B;  2KOX A;  3Q3F A;  3ZJT A;  4GOC A;  1UUP A;  3A33 B;  5BMI A;  2G9H D;  1XQQ A;  1B9R A;  3WAO A;  3RUI B;  4MJS A;  3N20 C;  5TR5 A;  2UYZ B;  3VTU A;  4AWJ A;  2MSE D;  4MT5 A;  5I4D A;  4YWG G;  1ISN A;  1QF6 A;  1T0S C;  2N9E B;  2C7N B;  2ZPY A;  2LFI A;  2CHW A;  3L17 A;  3N30 A;  4P1C C;  2AX5 A;  1L2N A;  2J0K A;  1WF9 A;  1C76 A;  2V3P A;  3Q3N C;  3SD5 A;  2JU6 X;  1P0R A;  2NBW B;  2KJ6 A;  1I4H A;  2WWZ A;  1WGG A;  3U30 A;  1V80 A;  4XDC A;  2WU2 B;  1QLB B;  1ZUD 2;  2LAS A;  3O65 B;  1U4A A;  5FR3 A;  2J52 A;  2WYQ A;  4O1N A;  3Q8B A;  1ZXI A;  2JRI B;  3KWL A;  4JLC A;  1YD8 U;  5FKA C;  4UDU C;  4W9D A;  1PQS A;  2WNM A;  4BBN F;  2LVO A;  4KKI A;  4M0W A;  3PT2 B;  3X23 A;  2I1K A;  4RFB A;  1YQ4 B;  2ZW1 A;  1TS2 A;  3JW0 X;  1E8X A;  2BB6 A;  1CZP A;  4R3D A;  4C7Z A;  2AL6 A;  1R4M B;  1RWS A;  2IJ0 A;  4WAA A;  3OJ4 B;  5C23 A;  3EFU A;  1MPE A;  3SFD B;  1BUI C;  1E5W A;  4HEA 1;  1FMA D;  3SR6 A;  1UEL A;  4NJ7 A;  3I5J C;  4IUM B;  3LJ3 A;  3NY5 A;  1S3S G;  2O6V A;  3N32 A;  1VD2 A;  4WWP A;  1L4D B;  4ZRP A;  1XLP A;  3NVY A;  2D5G A;  4NJC A;  3M63 B;  2OHF A;  1J7B A;  3DVN U;  4LNI A;  5AUK A;  1F1H A;  1ET6 A;  4WUR A;  3L0W B;  1QT9 A;  2JXT A;  4M8M A;  3TJP A;  2HD5 B;  1UWM A;  2WXO A;  1L6V A;  2DHZ A;  3PHW B;  3ZDT A;  3SFE B;  3ZXV A;  2V0G A;  2W55 A;  4MH8 A;  4JPS A;  1L0Y B;  1ZOY B;  1F52 A;  3TEY A;  1KH0 A;  4IG7 B;  5EE3 A;  1Q0W B;  2ZW0 A;  1T5X D;  2MCN B;  1ZE3 D;  3TBL D;  3T8M A;  3UQB A;  5HKH A;  1V1P A;  3PZ8 A;  4W9J A;  2MH7 A;  4BKS A;  2PVG C;  4NAW B;  4II3 B;  1UNS A;  4HXD A;  4C56 C;  2O2V A;  4HRO A;  4YTP B;  3NZU A;  1WRI A;  5JHB A;  2MJE A;  2K1F A;  4NQK E;  2Y5P A;  4EOY A;  2LGS A;  1JRU A;  1FIQ A;  2DLB A;  2INN E;  2CU1 A;  2WXM A;  1R4N B;  5AZF A;  2CJO A;  3ZDM C;  4BOZ B;  4JWU C;  3QWZ B;  1FFU A;  4P6V F;  2HJ8 A;  2M1M A;  4EZL A;  3CMM B;  3UIO B;  2ZNV B;  3CST A;  3RNB C;  2J4X A;  5HI1 A;  2BW2 A;  2Z0E B;  1FNU A;  3IHP C;  2L83 A;  3HM3 A;  3CSF A;  4MH0 E;  4S17 A;  1JWA D;  2SAK A;  2N1V A;  1CK1 A;  4US9 A;  2KFK B;  3V6C B;  3BYY B;  4IC7 B;  1V86 A;  3RNG C;  3PRP B;  4RGT A;  3DHH C;  4GDL A;  5G2N A;  3AXC A;  3QK0 A;  3AE9 B;  4XWT A;  1E90 A;  1ROE A;  4B0E A;  4WWM A;  2DX5 B;  1NYR A;  3PPA A;  2L0F A;  5D6J B;  1RAX A;  1SIJ A;  4PS3 A;  3AE2 B;  2BYE A;  1PUT A;  3KYC D;  3QAQ A;  1BXT A;  3L10 B;  1JWU D;  2E3T A;  1CMX B;  3RI7 C;  3E56 A;  2I1J A;  4HVB A;  2AQ1 B;  4ZRI A;  4ZDV A;  2DEN B;  1WXS A;  2NTS A;  1STE A;  4GGQ A;  1YQ3 B;  3W2D A;  4N58 A;  1HA5 A;  2J0M A;  2PKO A;  4GMV A;  1IPG A;  1HTQ A;  1E7P B;  1DGJ A;  5C3J B;  3RNE C;  1NVI D;  2IPK D;  2KZR A;  4HCP B;  4HPM B;  1MHH E;  3ZGZ A;  1WMH A;  4X57 B;  4WJQ A;  4Q2J A;  4P7I A;  3Q69 A;  2WGS A;  4W9C A;  1IBX B;  2PLP A;  3CIR B;  1JW9 D;  1VZ6 A;  1SB3 C;  3VRA B;  4FXC A;  2MHJ A;  2ZZP B;  3BYT B;  2B76 B;  2QSD A;  3V62 A;  3TEW A;  1DOX A;  4A6Q A;  1WE7 A;  1FO4 A;  2N1W A;  3APC A;  3FAH A;  1HEZ E;  1V9J A;  2V4I B;  5IO9 A;  1QOA A;  4AJY B;  3ZJU A;  3RN9 C;  4N6E B;  5LLI A;  3QQ8 B;  5JZE B;  2IND C;  4AS1 A;  2LJ5 A;  4E74 A;  1E8Z A;  4JX1 C;  4ZRK A;  1OGW A;  2WP9 B;  3PV1 A;  2KMM A;  1P1A A;  3ZNH B;  1I4X A;  1D6E C;  2WQY B;  3WAM A;  4LNK A;  1SBB B;  1TJE A;  1ZDV A;  2AQ3 B;  3PLV A;  3Q3O C;  5J18 A;  2FUH B;  2ON8 A;  1V5O A;  1FEH A;  1WJU A;  3TL5 A;  4HK2 A;  1J19 A;  4BKG A;  3V05 A;  4XWW A;  2CS4 A;  2ICI A;  3K9P B;  3MP9 A;  3AE4 B;  1EUV B;  5FK9 C;  2LXA A;  1MG8 A;  2B3A A;  5IA7 A;  1VZ8 A;  1QIL A;  2GBR A;  3P4Q B;  2MQJ A;  2N9X A;  1FCC C;  1TBE A;  3U52 E;  3MTN B;  1R4N I;  2A4Z A;  4DHZ B;  1EO6 A;  2KWD A;  5LNK 1;  3KUD B;  4ANV A;  1D3Z A;  1VR9 A;  2CKH B;  3MHZ A;  2BWE S;  2GOW A;  4I6L B;  3NVW A;  4G11 A;  1XF5 L;  4C7Y A;  2CJN A;  1X1M A;  1K8R B;  2N9K A;  4TSS A;  1QOF A;  2J53 A;  3ZIM A;  4HWI B;  3RCZ A;  1ZGU B;  4P16 A;  3HHM A;  5IAA C;  3SDL C;  4NJ6 A;  4M0W B;  1UGM A;  1WJN A;  2KTR B;  1VZ7 A;  2KAN A;  1NYQ A;  4KZ0 A;  1OQY A;  1XCQ L;  4PYZ A;  2WXH A;  1V49 A;  2YLM A;  1UGJ A;  2AQ2 B;  4I6P A;  2D3A A;  4WJP A;  3WIM A;  4KIK A;  4ZHP A;  1MI0 A;  1K50 A;  1SEB D;  2IO1 B;  2WXL A;  3EUB 2;  3V3X A;  3VH4 B;  3NHE B;  4GIV A;  1C79 A;  3K9O B;  1KFY B;  1IP9 A;  4RH6 A;  2NBU A;  2W82 A;  1WXV A;  4DK5 A;  1YMH E;  3AV8 A;  2Z8L A;  5L83 A;  3WAP A;  2VZK B;  4K3C A;  4MEL A;  4OVV A;  3ZNG C;  3EC8 A;  3GE3 C;  3P4R B;  3C0R B;  2IO2 B;  2KLC A;  1WI0 A;  1VLB A;  4AJW A;  2EKE C;  1VRA B;  3ZKJ C;  2L00 B;  1EU3 A;  2QIE B;  4TUU A;  2LGI A;  2WLB A;  1L5P A;  4PK1 A;  2JWZ A;  5GMV A;  5BYS A;  4LJO B;  2KDM A;  2O6V D;  1L0V B;  2LGY A;  1FNW A;  4FUL A;  2H88 B;  4A55 A;  4LNN A;  4JGH B;  3OAW A;  4EEW A;  5DPW A;  1QKZ A;  2WDT B;  1RRB A;  4RNA A;  5H92 C;  2OED A;  1KLV A;  2LMC A;  2O2V B;  2RPV A;  1ESF A;  4OVU A;  1GPX A;  5IN7 A;  5BMG A;  2FID A;  4G50 A;  3B1L X;  3DQV A;  3VR8 B;  3ZJV A;  3X0W A;  4GDK A;  4GLS C;  3MHS D;  2K3U A;  4W9G A;  2ZJD A;  4KX6 B;  4REZ A;  4BKS D;  4B6W A;  4C00 A;  1P3Q U;  1UWX A;  1XLO A;  3MFG A;  3HK0 A;  4K7U A;  3M62 B;  4M02 A;  1WY8 A;  2LWP A;  4JE3 B;  3R8B A;  3R2T A;  2D3G A;  3SU8 X;  4IM3 A;  4B9K A;  2WDV B;  1Y56 A;  2KMA A;  3RNF C;  3A9K B;  2KDB A;  1I4Q A;  3H9D A;  3M3J A;  1KM7 A;  3N1X C;  3DHI C;  2IBI B;  1ACC A;  3PRZ A;  2MBO A;  2QHO A;  4H2A A;  2RPQ A;  3ECI A;  5CHV C;  1C4A A;  2I2Y A;  1I4P A;  3NG0 A;  4DHJ D;  2K39 A;  3A1Q A;  3UQA A;  1IGD A;  3N1Z C;  3Q8F A;  4A3P A;  3ZNI D;  2DYM A;  3RZW C;  4RF1 A;  1MFW A;  4MM3 A;  4KGS A;  2KDI A;  1GB4 A;  2DZM A;  2KDE B;  2FIF A;  3DHG C;  5AZH A;  3DCG A;  3R7R A;  2KYW A;  2MA9 B;  2ASQ A;  2DWQ A;  2D07 B;  2QEJ C;  3DOW A;  3PHX B;  3AUL A;  3VRB B;  3AE5 B;  3T9L A;  3TIX A;  3BY4 B;  4TQ1 A;  1QZE A;  3TMP B;  3LXF A;  3AB5 A;  2KQS A;  2JWU A;  1YOV B;  2NMQ A;  1HTO A;  1QOB A;  3RMK C;  1WMH B;  2KDF B;  3QX1 A;  5AEK B;  2LGD A;  3D32 A;  3RYT A;  3AEC B;  2KNB A;  4A90 A;  3V60 A;  1N63 A;  2NVU I;  4L2Y A;  3I63 C;  2FCM A;  2XK5 A;  2LRU A;  4LCD E;  4ARC A;  2EMT A;  5H8Y E;  1KRH A;  4BVU C;  4W9H A;  1FXA A;  3Q6B A;  3APD A;  2IYD B;  2K8C A;  1NBF C;  2PEA A;  4J3O D;  1XO3 A;  5BYQ A;  2CU3 A;  2MBB B;  4K7S A;  2Y3A A;  1D4B A;  1WZ3 A;  1T3Q A;  4S0R A;  3IBE A;  4TV3 A;  1LFD A;  4WWN A;  1DYQ A;  3TEX A;  2LUE A;  4DXF A;  4KSL C;  1SJE D;  1TGZ B;  2MJ3 A;  3FIL A;  3PS6 A;  2C7M B;  1K52 A;  5G5G A;  1F77 A;  1E0Z A;  4ZHO A;  2BTE A;  2KJH B;  3DBL I;  1AN8 A;  2QJL A;  3NUH B;  4HJK A;  3R7Q A;  1T0Y A;  1TZ1 A;  2JYE A;  2D10 A;  4CO7 A;  5AUI A;  2GBN A;  2LHE A;  1TKY A;  4KGR A;  2W3R A;  1GB1 A;  1YX5 B;  4OW0 A;  5FR6 A;  1RLF A;  1WE6 A;  3IT6 B;  3NVZ A;  1ZXH A;  3PVL A;  1GAQ B;  2ACZ B;  4GB9 A;  1JWS D;  3PGE A;  5J17 A;  4EUT A;  2JVC A;  4PT5 A;  4NAM A;  1ZW7 A;  4NPN A;  2KJR A;  3HIZ A;  3APF A;  2DYB A;  4HJG E;  1V2Y A;  5CHF A;  1L6U A;  4JQW C;  2N7J A;  1TKE A;  2Q5W D;  1YIW A;  1SE2 A;  3WAL A;  1E10 A;  1WXM A;  1RFA A;  2DAJ A;  2KAC A;  3KUC B;  2GRI A;  2WXP A;  4K3B A;  4WJN A;  1MG4 A;  3Q2A C;  4PS8 A;  4KIK B;  4A9A A;  1K53 A;  1PDX A;  2FUG 1;  2KX3 A;  2PMV A;  2WDR B;  1UZX B;  3S2A A;  2NBV B;  4PYU A;  2G1E A;  4ICV A;  1SXT A;  2M17 A;  4IKG A;  4MGZ E;  1E8Y A;  1J7C A;  4CHK A;  1P7F A;  2PE9 A;  5GXG B;  2KWU B;  3RPF C;  3VUW A;  2C7H A;  3TUO A;  4ACF A;  3ZVV A;  1ZKH A;  2N0S B;  3VH3 B;  2WXI A;  2AYO B;  3P4S B;  4MGI E;  5AZG A;  4DDG D;  1EWY C;  3DBH I;  2I38 A;  4WH4 A;  5DPR A;  3P1M A;  2BYT A;  1NEK B;  2N4F A;  2KN4 A;  4ARI A;  3ALB A;  2WXG A;  1WGR A;  5IKC M;  5CTR C;  1XD3 B;  4II2 B;  3ONS A;  3U7Z A;  3W5V B;  2KQ7 A;  2BWF A;  4XC2 A;  1YJ1 A;  1WZ0 A;  2JX5 A;  1HZ6 A;  2CR5 A;  2DBY A;  2QCZ A;  1WM3 A;  2XBB C;  4N9F 4;  4NZL B;  1C3T A;  1TIF A;  3RUL A;  4FLH A;  3N3K B;  1E9M A;  1ZP0 B;  3L13 A;  3V61 A;  1FXT B;  1JWB D;  1GC7 A;  4DQO C;  1YN5 A;  2GI9 A;  1ET9 A;  1JWM D;  2JRH A;  4WIP A;  4HKZ E;  5G5H A;  2H89 B;  4I6N B;  4FN2 A;  1AAR A;  4WWO A;  3VTW A;  2SEB D;  5LXH A;  4EZK A;  2A5U A;  2KWV B;  1WM2 A;  4KVG B;  4MDK E;  2WXJ A;  3DVN V;  1SE9 A;  1HZ5 A;  3OLM D;  3TCA A;  2D3B A;  4GDK B;  1Z5S B;  2XN9 C;  1C4C A;  3AEE B;  5HG2 A;  2RGF A;  3R66 C;  2AWT A;  2MBE A;  5D7G A;  4IM0 A;  4NNJ B;  2KC1 A;  3EEC A;  1PGA A;  3EFC A;  3QAR A;  1L7Y A;  2EKI A;  2J42 A;  4A8X C;  3JSV A;  4LDT D;  2IGH A;  4MJS B;  2ZNV C;  3JYU A;  4GU2 A;  2KAJ A;  3ENE A;  3Q8E A;  2PIA A;  1WX8 A;  3BVM A;  4C4V A;  2LVP A;  1B1Z A;  1DOI A;  4XE0 A;  3ML9 A;  2N7E A;  2JZ3 B;  2OOB B;  1FXI A;  2UWQ A;  2PW9 A;  4HPP A;  3FKY A;  4YXD B;  4ZYS A;  2UU7 A;  3ZLZ A;  1ZDX A;  1H8C A;  2HTM E;  2PTL A;  2LGX A;  3ML8 A;  1KTK A;  5G55 A;  4K81 A;  1GOZ A;  3BVG A;  3AMZ A;  3VTV A;  4L1B A;  3ZRC A;  2L7R A;  3VVW B;  4MAC A;  2GBJ A;  3GB1 A;  3MJW A;  2W3S A;  2LUM A;  1TS5 A;  2L32 A;  3W1S A;  3LDZ E;  3QIJ A;  1MJD A;  1TS4 A;  2JY6 A;  2ZEQ A;  3AU4 A;  1EWC A;  1I35 A;  4KGT A;  2K22 A;  1WX9 A;  4RGN A;  1WGY A;  3AE1 B;  4ASW C;  3DDC B;  2M0X A;  1SE3 A;  2G4D B;  2BS3 B;  1Q1O A;  5E6P A;  5JHA A;  1OEY A;  3DVG Y;  3AE3 B;  4IWQ A;  1G6J A;  2GB1 A;  1VCB A;  2TSS A;  3AE6 B;  4OZB A;  3QA8 A;  4DDI D;  5BMH A;  1WFY A;  3AEA B;  5E6J A;  2KVR A;  3DBS A;  3I9V 1;  1PGX A;  2C9W B;  3PZD A;  4TKN A;  1KLU D;  3ZO5 B;  1EM7 A;  5IOI A;  2JZP A;  2R2O A;  2MW5 A;  4N59 A;  2YEP B;  3DBR I;  3GZN B;  1IYF A;  1TZO A;  2HTH A;  2KMC A;  1WGK A;  3AE7 B;  4E71 A;  3CWI A;  4KKJ A;  1A70 A;  2O6V B;  1F2R I;  2BS2 B;  3H7P A;  2AEH A;  2WXR A;  2RSU A;  3W5U B;  4LTU A;  2L52 A;  3R2I A;  2IZV B;  4MSQ B;  3B0A A;  4ANX A;  1WSP A;  2Y5B B;  4J6I A;  1HXY D;  2WXF A;  3BII D;  2D2Q A;  2FBW B;  1VJK A;  1BML C;  4E3C A;  1UH6 A;  4LNF A;  4EFO A;  1AYF A;  1NEN B;  4OZA A;  3BWU D;  4JWS C;  3SHQ A;  1GG3 A;  2LRW A;  3ZW3 A;  5KHQ A;  1M4V A;  4ANW A;  3HRD D;  1LM8 B;  2K9X A;  2GBK A;  3IT4 B;  1V1P B;  3QC8 B;  2XNA C;  3AEG B;  4F8C B;  4FA6 A;  1FCL A;  3ZQ4 A;  1LXD A;  3TEZ A;  3P4P B;  1JML A;  2KLG A;  3BVZ A;  5C2T B;  3CF6 E;  3VHT C;  4BOS C;  1SSN A;  3DBL B;  4IWO A;  3BIN A;  3N9Y C;  1YNT E;  3Q8A A;  1TTN A;  2VZK D;  2BT6 A;  1L4Z B;  2NTT A;  4W9F A;  4RCO A;  4FJZ A;  1T0Q C;  2G4S A;  2IY0 B;  2KD0 A;  5E6N A;  3AH7 A;  3L16 A;  2CHX A;  2K8B A;  2MBH A;  3MJ5 A;  3B08 A;  4TMA B;  5C1Z A;  4PS7 A;  3BK1 A;  2L0T A;  4G3X B;  1YN3 A;  3WAN A;  3JVZ X;  4FHK A;  3PRE A;  2R61 A;  1WX7 A;  3UIN B;  4YSZ B;  3LB8 C;  3IG3 A;  1N5W A;  2LD9 A;  3R3M A;  4US8 A;  4DHJ B;  3OG5 A;  3PTF C; 
#chains in the Genus database with same CATH homology
 1Y8R C;  1YQB A;  3P2B A;  2RD0 A;  4GGQ A;  2KWC A;  2J0M A;  2JF5 A;  4K7W A;  4W9I A;  2D11 A;  4NQL B;  4CYE A;  1WR1 A;  4A3O A;  2KX0 A;  2BF8 B;  2KJH B;  4GMV A;  3NOB A;  1IPG A;  3DBL I;  1C1Y B;  4HJK A;  5EDS A;  4HDO A;  4HDQ A;  3R7Q A;  1E7U A;  2XK5 B;  1T0Y A;  1TZ1 A;  3UIP B;  2D10 A;  2KZR A;  4CO7 A;  4HCP B;  3A4S C;  2XEW A;  4HPM B;  3QCA A;  2GBN A;  1WMH A;  2IO0 B;  4GDL B;  3A9J A;  4WJQ A;  2WX0 A;  4X57 B;  4P7I A;  3UGB B;  1Q5W B;  3EHV A;  4EKU A;  2MP2 B;  4W9C A;  2NCN A;  4AUQ C;  5CX3 A;  3RD2 A;  2MLB A;  1V5T A;  1YX5 B;  4F1S A;  1WYW B;  5FR6 A;  1RLF A;  2J0J A;  3V61 A;  1WE6 A;  3M95 A;  1P98 A;  2KK8 A;  2KFK A;  2RR9 A;  4WJO A;  2ZZP B;  4ICU A;  5DPS A;  2K25 A;  1WRD B;  3PVL A;  4K1R B;  3UF8 A;  3V62 A;  1A5R A;  1WE7 A;  1P9D U;  2IO3 B;  2N1W A;  3APC A;  4GB9 A;  4LJP B;  1WJ4 A;  4AOF A;  2JT4 B;  1V9J A;  2GBM A;  4TQ0 A;  3PGE A;  5J17 A;  4EUT A;  2JVC A;  4FJY A;  5DCN A;  3ZTD A;  1EF1 A;  3PLU A;  3PSE B;  4ZYN A;  4AJY B;  1ZW7 A;  4NPN A;  2KJR A;  3HIZ A;  5DPT A;  1KOT A;  5LLI A;  2JXX A;  3APF A;  2ZPN A;  4JL9 A;  2DYB A;  3QQ8 B;  4RM8 A;  1V2Y A;  1V81 A;  5CHF A;  4JQW C;  2JZZ A;  4RMA A;  4RM9 A;  1KJT A;  4HLE A;  5JZE B;  2LJ5 A;  1OTR B;  4E74 A;  2LXC A;  2KFJ A;  1YIW A;  2KN5 A;  2K6D B;  1E8Z A;  4ZRK A;  1UBI A;  4ANU A;  1OGW A;  5LXI B;  3PV1 A;  4F7Z A;  2FAZ A;  1P1A A;  3VQI A;  3WAL A;  2FNJ B;  4MGK E;  1WXM A;  5BO4 B;  1RFA A;  2DAJ A;  3ZNH B;  3KUC B;  2KKC A;  3WAM A;  2L05 A;  4WJN A;  4PS8 A;  2OJR A;  3PLV A;  4KIK B;  5J18 A;  2FUH B;  3GZN I;  3KUZ A;  1V5O A;  2JPH A;  2MBQ A;  2Z0D B;  1WJU A;  3TL5 A;  4HK2 A;  1J19 A;  2KX3 A;  3S2A A;  1UZX B;  2PE6 B;  4BKG A;  4MGY E;  4URK A;  1WJ6 A;  3L08 A;  2MX2 A;  2NBV B;  2CS4 A;  2KTR A;  4PYU A;  2BGF A;  3K9P B;  1WXA A;  4ICV A;  1EUV B;  2CHZ A;  2LXA A;  2M17 A;  4ZRJ A;  1WIA A;  1MG8 A;  2B3A A;  4G0N B;  2VRR B;  4MGZ E;  1E8Y A;  4DWF A;  5IA7 A;  4CHK A;  2GBR A;  2MQJ A;  2N9X A;  1GUA B;  2V1Y A;  4MEM A;  1V6E A;  2GMI C;  2FCS A;  2PE9 A;  3RZF A;  1TBE A;  3HM6 X;  3MTN B;  1R4N I;  2MP2 A;  2LI5 A;  4MSM B;  2WX1 A;  2A4Z A;  4W9E A;  3VFK A;  4BFR A;  1GC6 A;  2KWU B;  3VUW A;  4DHZ B;  2NPT B;  1EO6 A;  4IM2 A;  2C7H A;  1EF5 A;  1BT0 A;  3KUD B;  3ZVV A;  1GNU A;  4ANV A;  1ZKH A;  2G45 B;  3VH3 B;  4FBJ B;  2AYO B;  1D3Z A;  1NI2 A;  2N7D A;  3A4R A;  5D94 A;  2CKH B;  4FHJ A;  2BWE S;  4MGI E;  5AZG A;  5L95 C;  4DDG D;  5D2M B;  2GOW A;  4BKT A;  4I6L B;  2LVQ A;  3DBH I;  2AL3 A;  4G11 A;  4NY0 A;  4BBN C;  5DPR A;  3I3T B;  3JSV B;  2BYV E;  1S1Q B;  1X1M A;  1K8R B;  4W9K A;  4XX5 A;  2N4F A;  3ZIM A;  2KOX A;  3Q3F A;  3PS6 A;  4HWI B;  3ALB A;  1WGR A;  3RCZ A;  1ZGU B;  5CTR C;  3IVF A;  1M94 A;  1XD3 B;  4II2 B;  3ONS A;  3HHM A;  2KQ7 A;  4FJV B;  5IAA C;  4GOC A;  3SDL C;  2BWF A;  3DPD A;  4XC2 A;  4NJ6 A;  1YJ1 A;  2KC2 A;  1WZ0 A;  4M0W B;  3A33 B;  4IWP A;  1UGM A;  1WJN A;  2KTR B;  2CR5 A;  2FCQ A;  3VXW A;  1WM3 A;  2KAN A;  2XBB C;  1XQQ A;  4KDI C;  4KZ0 A;  1OQY A;  2LZ6 A;  3WAO A;  4N9F 4;  2K6Q A;  3L54 A;  4PYZ A;  3RUI B;  4MJS A;  3RUL A;  3DVG X;  4FLH A;  1C3T A;  1V49 A;  3N3K B;  2YLM A;  2UYZ B;  3L13 A;  4I6P A;  4WJP A;  5TR5 A;  2MSE D;  2V4L A;  4KIK A;  3VTU A;  4AWJ A;  1FXT B;  2M4N A;  3QHT A;  1WGD A;  1ISN A;  2IO1 B;  2KO3 A;  2ZVO A;  1GC7 A;  2N9E B;  2C7N B;  4GSW A;  3VH4 B;  2ZPY A;  2JRH A;  3NHE B;  3ZRF A;  2CHW A;  3L17 A;  3N30 A;  4I6N B;  4FN2 A;  1AAR A;  4GIV A;  3AU5 A;  4WWO A;  3VTW A;  3NS8 A;  5LXH A;  4A20 A;  1L2N A;  2J0K A;  3K9O B;  4EZK A;  2A5U A;  2KWV B;  1WF9 A;  1WM2 A;  1E8W A;  4KVG B;  1IP9 A;  4MDK E;  2NBU A;  3KYD D;  3QJZ A;  1WXV A;  4DK5 A;  3SD5 A;  3DVN V;  1P0R A;  1SE9 A;  3OLM D;  2NBW B;  1HE8 A;  2Z59 B;  3TCA A;  2KJ6 A;  1SIF A;  2WWZ A;  1WGG A;  4GDK B;  1Z5S B;  3U30 A;  1V80 A;  3KW5 B;  3PRM B;  5L83 A;  3WAP A;  2RGF A;  3R66 C;  2AWT A;  2MBE A;  4MEL A;  4OVV A;  2NPT A;  3EC8 A;  5D7G A;  4IM0 A;  4NNJ B;  3ZNG C;  2KC1 A;  3C0R B;  2IO2 B;  2KLC A;  1WI0 A;  3EEC A;  2LAS A;  3H6N A;  4AJW A;  3O65 B;  3QAR A;  1U4A A;  2EKE C;  2WYQ A;  2MRP A;  1L7Y A;  3ZKJ C;  2L00 B;  3JSV A;  4LDT D;  4MJS B;  2JRI B;  4JLC A;  2ZNV C;  3JYU A;  4HCN B;  4TUU A;  4KV2 A;  1YD8 U;  4GU2 A;  2NR2 A;  1YX6 B;  3ENE A;  4W9D A;  2JWZ A;  1PQS A;  1WX8 A;  5GMV A;  2LVP A;  2K8H A;  1OEY J;  1SGH A;  4LJO B;  4BBN F;  2LVO A;  2O6V D;  3TIX A;  3PT2 B;  3X23 A;  2I1K A;  2LGY A;  4M8N A;  1GJZ A;  3ML9 A;  2N7E A;  4FUL A;  2JZ3 B;  3VUX A;  2OOB B;  2UWQ A;  4XZ4 A;  3JW0 X;  3ZLZ A;  1E8X A;  4JGH B;  3OAW A;  4YL8 A;  1H8C A;  4EEW A;  5DPW A;  2KTF A;  3GOE A;  2FCN A;  2WDT B;  1RRB A;  3H7P B;  4WQO B;  1KLV A;  2AL6 A;  2LGX A;  2O2V B;  3A9K A;  3ML8 A;  4OVU A;  5G55 A;  3V6E B;  4K81 A;  2J7Q B;  5E6O A;  4WAA A;  2NS5 A;  3VTV A;  3ZRC A;  2FID A;  1I42 A;  3OJ4 B;  5C23 A;  2L7R A;  3EFU A;  3VVW B;  2GBJ A;  2DZI A;  3MJW A;  4JIO U;  4G50 A;  2V3S A;  3B1L X;  3DQV A;  1E5W A;  1WR6 E;  2EMS A;  3W1S A;  3LDZ E;  3Q3J A;  3QIJ A;  3X0W A;  1UEL A;  4GDK A;  4NJ7 A;  4IUM B;  1E7V A;  2JY6 A;  2DZK A;  2ZEQ A;  3AU4 A;  3LJ3 A;  3MHS D;  1S3S G;  2O6V A;  1XT9 B;  3N32 A;  3NY5 A;  3VUY A;  1VD2 A;  4WWP A;  3ZNZ B;  1I35 A;  2C5L C;  4W9G A;  2ZJD A;  4KDL B;  1WX9 A;  3M63 B;  3KH0 A;  3DVN U;  1WGY A;  4ASW C;  2REX A;  4BKS D;  3DDC B;  2KHW B;  2M0X A;  3L0W B;  2G4D B;  2PPH A;  4B6W A;  1J8C A;  1Q1O A;  4B95 A;  2JUO A;  3OJ3 A;  1F9J A;  1P3Q U;  4M8M A;  5E6P A;  2HD5 B;  3TJP A;  1OEY A;  5JHA A;  2DHZ A;  3DVG Y;  3HK0 A;  4K7U A;  4KSK C;  3H1U A;  3M62 B;  4IWQ A;  1G6J A;  3PHW B;  3WIM A;  1WY8 A;  3ZDT A;  1VCB A;  2LWP A;  1UBQ A;  3RT3 B;  2BKF A;  2D3G A;  1WH3 A;  3QA8 A;  4IM3 A;  5CHW A;  3SU8 X;  4DDI D;  2ZVN A;  4B9K A;  2G3Q B;  4EZJ A;  1WFY A;  2KMA A;  2KVR A;  3DBS A;  1R4M I;  4IG7 B;  3A9K B;  2KDB A;  2C9W B;  3PZD A;  1Q0W B;  4TKN A;  4LDT B;  3U7D A;  1NDD A;  2MCN B;  3ZUN A;  3ZO5 B;  3H9D A;  3M3J A;  3TBL D;  3T8M A;  3UQB A;  1KM7 A;  5HKH A;  4GXB A;  5KHO A;  2IBI B;  2MW5 A;  2R2O A;  4W9J A;  2R2Q A;  3DBR I;  3PRZ A;  1IYF A;  2KMC A;  2HTH A;  4BKS A;  4E71 A;  4NAW B;  2MBO A;  2QHO A;  2RPQ A;  3ECI A;  4II3 B;  5CHV C;  4HXD A;  2O6V B;  3H7P A;  3W1S C;  2AEH A;  4DHJ D;  2K39 A;  2RSU A;  3A1Q A;  2O2V A;  3NZS A;  3UQA A;  2ZCB A;  2IZV B;  4MSQ B;  4A3P A;  3NZU A;  3ZNI D;  5JHB A;  3U8Z A;  3B0A A;  4ANX A;  1LQB A;  2DYM A;  3RZW C;  5J2R A;  2Y5B B;  2K1F A;  4J6I A;  4MM3 A;  4AP4 C;  1H4R A;  2KDI A;  3H7S A;  4NQK E;  4EOY A;  2D2Q A;  1JRU A;  2PJH A;  2DZM A;  4DBG A;  2C60 A;  1WGH A;  2CU1 A;  2KDE B;  2FIF A;  3WA0 A;  5AZH A;  4E3C A;  5AZF A;  3DCG A;  4KZC A;  1UH6 A;  3R7R A;  3ZDM C;  4BOZ B;  4EFO A;  3QWZ B;  2MA9 B;  2ASQ A;  2HE7 A;  2D07 B;  2L76 A;  3DOW A;  2W9N A;  3PHX B;  3AUL A;  2HJ8 A;  3VDZ A;  3T9L A;  2M1M A;  3BY4 B;  2N9P C;  1QZE A;  4TQ1 A;  1GG3 A;  2LRW A;  2M8S A;  3SHQ A;  2DYO A;  3TMP B;  4DHZ E;  4EZL A;  3ZW3 A;  5KHQ A;  2BYF A;  2KQS A;  3CMM B;  3UIO B;  2ZNV B;  3CST A;  4ANW A;  4IW0 A;  1LM8 B;  4DXA B;  2Z0E B;  2GBK A;  3KVF B;  3QC8 B;  4F8C B;  4FA6 A;  1LXD A;  1WMH B;  3IFW B;  3A9J B;  2KDF B;  3IHP C;  3QX1 A;  2KLG A;  3HM3 A;  3CSF A;  4MH0 E;  5AEK B;  3CF6 E;  5JH5 C;  3VHT C;  1Z2M A;  4BOS C;  2YVC A;  2LGD A;  3D32 A;  2BKR B;  4IWO A;  3RYT A;  2KNB A;  2N1V A;  3ZTC A;  2IY1 B;  3A1Q B;  3VAW A;  3V60 A;  2NVU I;  2ZCC A;  3BIN A;  2KFK B;  2FCM A;  1TTN A;  2L8J A;  2BPS A;  2XK5 A;  3V6C B;  4HPL B;  4W9F A;  3W1Y A;  1J0G A;  2LRU A;  4IC7 B;  4LCD E;  2EMT A;  4FJZ A;  1V86 A;  2DAF A;  2G4S A;  4BVU C;  2IY0 B;  2KD0 A;  3PRP B;  5E6N A;  2KXJ A;  4W9H A;  3L16 A;  2CHX A;  2K8B A;  4W9L A;  4GDL A;  5G2N A;  3AXC A;  3QK0 A;  4GN1 A;  3APD A;  2IYD B;  2MBH A;  1E90 A;  3B08 A;  2K8C A;  1NBF C;  4NAW A;  5C1Z A;  2DX5 B;  2PEA A;  3PPA A;  4PS7 A;  3AI5 A;  2L0F A;  5D6J B;  1RAX A;  2L3Z A;  4PS3 A;  2L0T A;  2MBB B;  1UD7 A;  4G3X B;  4K7S A;  2BYE A;  2DZJ A;  3KYC D;  2MWS B;  3WAN A;  3JVZ X;  1WZ3 A;  3QAQ A;  3L10 B;  4FHK A;  3PRE A;  3IBE A;  1WX7 A;  4TV3 A;  4FAD A;  3UIN B;  1LFD A;  3IG3 A;  4WWN A;  1CMX B;  2I1J A;  2LUE A;  2LD9 A;  4HVB A;  3R3M A;  4KSL C;  4ZRI A;  4DHJ B;  1TGZ B;  4ZDV A;  2DEN B;  2C7M B;  3PTF C;  1WXS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...