1WGGA

Solution structure of the n-terminal ubiquitin-like domain of mouse ubiquitin specific protease 14 (usp14)
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
96
structure length
96
Chain Sequence
GSSGSSGYSVTVKWGKEKFEGVELNTDEPPMVFKAQLFALTGVQPARQKVMVKGGTLKDDDWGNIKMKNGMTVLMMGSADALPEEPSAKTSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of the N-terminal Ubiquitin-like Domain of Mouse Ubiquitin Specific Protease 14 (USP14)
rcsb
source organism Mus musculus
molecule tags Hydrolase
molecule keywords Ubiquitin carboxyl-terminal hydrolase 14
total genus 10
structure length 96
sequence length 96
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2004-05-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1wggA01
3QA8A 4K1RB 4WJPA 4GXBA 2DYBA 2KX0A 2WYQA 4HWIB 3W1YA 2Z0EB 3TMPB 3ZDTA 4X57B 3S2AA 4EZKA 2D10A 3OLMD 2ZCBA 1S3SG 3ZUNA 4MGIE 3SHQA 2KDFB 3JYUA 3PRZA 3R7QA 1YIWA 1QZEA 5CTRC 4GDKB 2HJ8A 3GZNI 4EUTA 3SD5A 3HHMA 2JT4B 3QCAA 2N1VA 2XEWA 4G0NB 2MX2A 5E6OA 4ZDVA 3L16A 3UINB 2RD0A 1C1YB 3H6NA 2R2OA 2I1KA 4LCDE 2LXCA 3A4RA 2MWSB 3DBSA 3C0RB 1TGZB 1SGHA 1U4AA 1TTNA 2BWFA 4MSQB 3NZSA 1Z5SB 1F9JA 2BYEA 1UBIA 4AJWA 1H4RA 4RM9A 4JQWC 4XZ4A 1V2YA 2LGDA 5JZEB 3UGBB 1WE7A 3ZTDA 1OGWA 3H9DA 4J6IA 2JF5A 3B08A 2L7RA 2K1FA 4G11A 2KO3A 2L0TA 4W9GA 3VUXA 4IC7B 2DZJA 1YQBA 3X23A 4IM0A 2PPHA 3UF8A 2ASQA 4HDOA 4KSKC 5JH5C 2WX0A 4DBGA 2KWUB 2NBUA 2ZPNA 1LFDA 3CF6E 2KLGA 1E90A 2LWPA 4BKSA 3QK0A 4AOFA 2NPTB 3A4SC 1WMHA 2O6VD 4ANVA 1Q0WB 4CYEA 2V4LA 3K9OB 3UIOB 2C7NB 2D3GA 4FBJB 2KJRA 4KIKB 3IVFA 4E74A 2LI5A 3R7RA 3DPDA 1Z2MA 4GMVA 1WI0A 2WX1A 5GMVA 3ZW3A 3UQBA 1I42A 1KJTA 3WA0A 5E6PA 4DWFA 2M4NA 3NY5A 4IW0A 3L10B 3M63B 2GBNA 3PVLA 1V6EA 3APFA 4ZYNA 4EKUA 1OEYA 4F7ZA 2KVRA 3PRPB 1WFYA 5AEKB 3JW0X 1WF9A 2NS5A 1ISNA 1OEYJ 4PS3A 4NPNA 1E8WA 2IY1B 1LXDA 1ZGUB 2KOXA 3CSTA 3QX1A 2LRWA 2KDIA 1OQYA 4PYUA 3TIXA 4DHJB 2KKCA 3T9LA 4W9JA 3PPAA 2O2VA 3DVNV 2K6DB 3DQVA 2DZKA 5DPTA 2JXXA 3RZWC 2HE7A 1E8YA 2DHZA 2YLMA 2KQ7A 3V60A 2PE9A 1MG8A 1UGMA 2K8BA 2L8JA 4W9HA 4B6WA 1LM8B 4TQ1A 2N9XA 2NVUI 2K25A 4K7SA 1P1AA 2CU1A 5CHFA 4B95A 1IP9A 1J8CA 3W1SC 2BWES 3ZNZB 3UQAA 2CHXA 2JWZA 2LXAA 4IUMB 3EECA 4IWQA 4WWOA 2IYDB 4IM2A 3PZDA 2G3QB 4LJPB 4KDIC 2GMIC 3L54A 2LGXA 4WWNA 5FR6A 4KIKA 3ZLZA 2A5UA 2HD5B 3VTWA 3V6EB 2K6QA 2DAJA 1KM7A 3APCA 2K8HA 4YL8A 3ML9A 2GBMA 3PTFC 4WJNA 5CHVC 4XX5A 5HKHA 1P98A 3NOBA 3ZTCA 3Q3JA 3VH3B 5DCNA 1BT0A 3PS6A 3NZUA 4P7IA 2DYOA 1YJ1A 3BINA 3DVNU 1WJUA 2O2VB 2IBIB 2ZVOA 4BKSD 2JZZA 3QAQA 4K7UA 3EC8A 1E7UA 4LJOB 1YD8U 2LRUA 1AARA 2RGFA 4W9KA 2KANA 5JHAA 2D2QA 1UELA 3M3JA 3QJZA 3PHWB 2R2QA 2M0XA 4M8NA 3L08A 1RLFA 2KD0A 2KFJA 4GGQA 1NBFC 2NCNA 3LJ3A 4BKGA 1E5WA 3ZRFA 4PYZA 1Q1OA 2LVQA 5IA7A 2N7EA 3DCGA 3B0AA 3D32A 3OJ3A 2EMTA 4JLCA 4OVUA 2L76A 3WIMA 3HM3A 1GJZA 3ENEA 4BVUC 5DPWA 2JUOA 4DHZE 2PEAA 2C60A 1PQSA 5G2NA 2KTFA 2IO0B 1P9DU 4LDTB 3M62B 5DPRA 4NQKE 2KC2A 2L3ZA 1XQQA 2KFKA 2Z0DB 1YX5B 1V49A 2UYZB 3BY4B 2OJRA 4DHZB 5LXHA 4GDKA 2J7QB 2MP2B 2DZIA 2BGFA 1Q5WB 4MEMA 4I6NB 4FULA 4WQOB 2FNJB 1WXAA 3JSVA 3DOWA 1T0YA 2K39A 3TJPA 4W9FA 4DHJD 3VUYA 4II3B 3AI5A 2B3AA 2KFKB 3O65B 4IWOA 3KH0A 4W9LA 5D94A 2CKHB 1V86A 2V3SA 5TR5A 2YVCA 3H7SA 1HE8A 2MBHA 2W9NA 2K8CA 4TUUA 2N9PC 1GG3A 1WM2A 2GBKA 3ZDMC 3TL5A 1WJ4A 5BO4B 3HIZA 4EZLA 1VD2A 1WXSA 4XC2A 3P2BA 2DZMA 3R3MA 2MBOA 4HCPB 1WZ0A 2AYOB 3DBHI 3RULA 1WYWB 2ZEQA 2LVPA 4KSLC 2JRHA 4DXAB 2D07B 2REXA 1WGHA 2LJ5A 2GBJA 2KTRB 4HPLB 4WAAA 4JL9A 4GOCA 4EEWA 4F8CB 3A9JA 4II2B 4CO7A 3U7DA 2C5LC 1S1QB 4DDGD 3PV1A 3ML8A 4F1SA 4W9DA 2KNBA 1LQBA 1OTRB 4MJSA 3DVGY 1YX6B 4NY0A 1VCBA 4TQ0A 3M95A 2C7HA 2J0JA 2XBBC 1WGRA 2KX3A 3RD2A 3RYTA 2CHWA 3T8MA 2EMSA 2FIFA 4K7WA 4ZRIA 1WXMA 3L13A 3VTVA 3WANA 3VDZA 1WGDA 2MRPA 2LVOA 4GB9A 3GOEA 2M1MA 4E71A 3QQ8B 4G50A 2CHZA 3ZNHB 2L00B 4B9KA 1RRBA 2KTRA 2KJ6A 4RMAA 1EF1A 3KW5B 4A20A 4BOZB 2XK5A 3IG3A 3N3KB 3VQIA 4HCNB 3R66C 3CMMB 2IZVB 3OJ4B 3VH4B 3H1UA 4NJ7A 1E8ZA 4HLEA 3EFUA 4BKTA 3VUWA 2J0KA 1WJ6A 2L0FA 3KUDB 4FJZA 1GNUA 3IBEA 4HK2A 1IPGA 2FUHB 4ICVA 4NJ6A 2FIDA 5CX3A 1V5OA 4AUQC 1D3ZA 2MA9B 1NI2A 1NDDA 1G6JA 3ECIA 3NHEB 3A9KA 2KDBA 3PSEB 4GU2A 5CHWA 3V61A 1WIAA 3AULA 4GN1A 1I35A 4FN2A 2GBRA 5C23A 3ZKJC 4BBNF 4GDLB 4LDTD 2N1WA 4RM8A 3DBLI 2G4SA 5KHQA 4NAWB 4EFOA 5L83A 1FXTB 3NS8A 2GOWA 2JZ3B 2G45B 4N9F4 3PRMB 4MELA 4KV2A 2NR2A 3ZIMA 4HDQA 4BFRA 1L7YA 1WR6E 3UIPB 1UBQA 1TBEA 5J17A 2KZRA 2BPSA 5G55A 3CSFA 4JGHB 2KXJA 3W1SA 4MGKE 2ZCCA 3K9PB 2DX5B 1V80A 2JPHA 5D6JB 3ZO5B 2FCSA 4KVGB 2VRRB 2KWVB 4FLHA 3QHTA 1UZXB 3OAWA 4MGYE 2PE6B 3IFWB 3QARA 1WX7A 2JVCA 3VTUA 2BYFA 4W9CA 4GDLA 3PHXB 2MW5A 1XT9B 1WR1A 2UWQA 3U30A 4K81A 4MH0E 5J2RA 2LGYA 3AU4A 4WJOA 3KUCB 3VXWA 2NBWB 5C1ZA 2DENB 4A3PA 5D7GA 3ZRCA 4FHKA 3RUIB 2LD9A 2RSUA 3WALA 1EUVB 4TKNA 3I3TB 3A1QA 3KYDD 4FJYA 4WJQA 3RCZA 1WX9A 2DYMA 3MJWA 3QWZB 2N4FA 2IO2B 2NBVB 4W9IA 3WAPA 2DAFA 2Y5BB 2ZNVC 3HM6X 1J0GA 2AEHA 2BKFA 4M0WB 3AXCA 4I6LB 1ZW7A 2HTHA 2FCMA 5J18A 4PS7A 1WY8A 1WXVA 1KOTA 4IWPA 4HVBA 4CHKA 2ZPYA 4PS8A 3QIJA 1P3QU 1K8RB 2MSED 1JRUA 2CS4A 3DVGX 3ZNID 2WDTB 4TV3A 3TBLD 3WAOA 2CR5A 3RT3B 2C7MB 4A3OA 5AZGA 2KQSA 4FHJA 2IY0B 2BYVE 3A33B 3B1LX 3IHPC 1WMHB 2I1JA 3V6CB 1CMXB 2QHOA 3KVFB 2ZZPB 3DBRI 4NQLB 4M8MA 3L17A 1L2NA 2MBEA 3VVWB 1WRDB 2IO3B 5L95C 2RPQA 2FCNA 5KHOA 2N7DA 2NPTA 1ZKHA 2AL3A 3KUZA 2MLBA 4MSMB 4AP4C 1UD7A 2KN5A 3ONSA 4KZ0A 1P0RA 3PREA 1WM3A 4AWJA 4ASWC 1V81A 3HK0A 2PJHA 4GIVA 3KYCD 2MBQA 2FAZA 1X1MA 2IO1B 2Z59B 2LASA 3VHTC 2MCNB 2BF8B 2C9WB 1R4MI 3AU5A 5D2MB 3A1QB 2KDEB 1WGGA 5AZFA 2AL6A 3SU8X 3PLUA 4I6PA 4FADA 1UH6A 1WE6A 2V1YA 3LDZE 3PGEA 1H8CA 3H7PA 3A9KB 1EF5A 3QC8B 3ZVVA 3APDA 3EHVA 2WWZA 1V9JA 3VFKA 1WJNA 2ZNVB 3JSVB 5LLIA 2XK5B 1RAXA 4G3XB 4NAWA 3N30A 2KHWB 5IAAC 5AZHA 1WZ3A 2N9EB 4AJYB 4MJSB 2A4ZA 4IG7B 4GSWA 3PLVA 4HPMB 4MM3A 2LUEA 4NNJB 4HXDA 4ZRJA 1SIFA 1GUAB 1GC6A 4ANWA 2ZJDA 3PT2B 2FCQA 3DDCB 2KC1A 2KMCA 1KLVA 3MHSD 2MQJA 2L05A 2MBBB 2ZVNA 1Y8RC 4FJVB 3L0WB 4ICUA 2J0MA 3N32A 5EDSA 2LZ6A 2BKRB 1WGYA 3SDLC 2KJHB 1V5TA 1WX8A 2O6VB 4MGZE 4BBNC 2RR9A 3H7PB 1GC7A 5JHBA 3Q3FA 1C3TA 2G4DB 5DPSA 1M94A 1A5RA 4ANXA 2EKEC 4URKA 1E8XA 1IYFA 4FA6A 4JIOU 4IM3A 2KMAA 3U8ZA 4DK5A 1XD3B 5E6NA 3MTNB 4EOYA 1WH3A 4EZJA 2KLCA 4KDLB 2JRIB 4ANUA 1SE9A 4BOSC 2D11A 2KWCA 4MDKE 1R4NI 3X0WA 1RFAA 1TZ1A 2MP2A 1E7VA 2O6VA 4E3CA 4DDID 3ALBA 5LXIB 4W9EA 3ZNGC 2AWTA 1J19A 4WWPA 4HJKA 3VAWA 2OOBB 4OVVA 2KK8A 3TCAA 2JY6A 3V62A 3WAMA 3RZFA 4KZCA 1EO6A 4ZRKA 2M17A 2M8SA 3A9JB 3JVZX
chains in the Genus database with same CATH superfamily
4WJPA 4GXBA 1NYRA 4IDIA 3UI3A 3OLMD 2ZCBA 3AE9B 1HEZE 4EUTA 1Y56A 2D3BA 2N1VA 2XEWA 2RD0A 1C1YB 3H6NA 1N61A 3AB5A 2I1KA 1P7FA 2MWSB 3C0RB 2LFIA 1TGZB 1SGHA 1K52A 1TTNA 2QDFA 1F9JA 4LNIA 2RPVA 1VZ8A 5JZEB 3TEYA 1OGWA 2JF5A 2KO3A 1YQBA 5H8YE 1TYGB 2PPHA 3UF8A 5JH5C 3P4PB 4DBGA 5FK9C 2NBUA 3CF6E 5HI1A 3N9YC 3QK0A 2NPTB 3A4SC 3K9OB 1YQ3B 3UIOB 2D3GA 4FBJB 1NI3A 1TKYA 1XLPA 2KJRA 4E74A 3I5JC 3DPDA 1Z2MA 1WI0A 1I42A 4DWFA 3L10B 1AYFA 2GBNA 3PVLA 3U4EG 4EKUA 4F7ZA 4CQNA 3PRPB 1F52A 1MVKA 5AEKB 1FEHA 2NS5A 3R2IA 2KOXA 2KDIA 1BMLC 1OQYA 2BQQA 4Q2JA 1HTQA 3AM9A 2KKCA 1ZXHA 2LGIA 3GE8C 3PPAA 1PGAA 3DQVA 5DPTA 2JXXA 1NYQA 2DHZA 2PE9A 2K8BA 1DOYA 2H89B 2BS2B 3W2DA 2K25A 2BS4B 5CHFA 1IP9A 3W1SC 1E0ZA 4IUMB 4WWOA 4ARIA 3GS2A 3L54A 2W3SA 2LGXA 5FR6A 3I9V1 2HJ1A 2DAJA 2K8HA 3PTFC 1CJEA 3Q6BA 2WU5B 4KKIA 1L0XB 1P98A 2WNMA 3VH3B 4P7IA 4MACA 2WXIA 2Y5CA 3NS1A 2ZVOA 3U7ZA 1AARA 2DNFA 3NVVA 4W9KA 2BBCA 1V8CA 4M8NA 2WXQA 3I57A 1RLFA 3ZJTA 2KD0A 4GGQA 4QAYA 4PYZA 5IA7A 3DCGA 2EMTA 4JLCA 1D6EC 4DHZE 3AE8B 2C60A 2KTFA 2H88B 4N58A 3RN9C 4LDTB 2KC2A 1MHXA 2KFKA 1YX5B 1V49A 2UYZB 2OJRA 4XGAB 2J7QB 1Q5WB 4FULA 4B0MA 4WQOB 3B2FA 4R3DA 3V05A 4WURA 3VUYA 4II3B 2B3AA 3O65B 4IWOA 4L1BA 1R4MB 2PLPA 5TR5A 5BYSA 2MBHA 2MJ3A 3DWGC 4TUUA 2N9PC 1IGDA 3ZDMC 4XC2A 3P2BA 1T0SC 2MBOA 2AYOB 4K3BA 2LVPA 4DXAB 1FNWA 2LJ5A 1C76A 3C8YA 3DBRB 1A70A 2WXJA 2INCC 2DLBA 2C5LC 2JSVX 4RGTA 2L32A 3PV1A 1ET9A 4YWGG 4OHJA 4NY0A 3M95A 3AEEB 1WGRA 3RD2A 3T8MA 2FIFA 4ZRIA 3L13A 5AUIA 3GOEA 2M1MA 4E71A 2CHZA 4HEA1 4B9KA 3N3KB 2ONQA 3BZDB 2PMVA 4NJ7A 1IGCA 2OEDA 3EFUA 1TS5A 1T5XD 3IBEA 1IPGA 2FUHB 1TKEA 1FCCC 1JWSD 2EELA 3A9KA 3PSEB 1ZDXA 3RPFC 3V61A 5E6JA 4YTNB 5C23A 4XYCA 4BBNF 2PVOD 2SEBD 2G4SA 2WXNA 5KHQA 1FXTB 3NS8A 2GOWA 4N9F4 1EU3A 4NJCA 1UNSA 1L7YA 2N7JA 5J17A 1UBQA 3RMKC 1E7PB 4MGKE 1I4HA 2WXOA 1V80A 2JPHA 5D6JB 1HZ6A 2YEPF 1HTOA 4FLHA 4MGYE 2PE6B 3RNCC 2BYFA 3E9SA 1V1PA 2UWQA 5J2RA 2LGYA 3Q2AC 5D7GA 3ZRCA 4FHKA 2L83A 2IPKD 3A1QA 4FJYA 4REZA 3RNAC 3ZGZA 2WGSA 1PGXA 2DYMA 2NBVB 1OQQA 2KACA 2AEHA 4HROA 1T0QC 4CHKA 2ZPYA 3TUOA 2W3RA 1K8RB 1JRUA 2WDTB 1TZOA 5AZGA 4MH8A 2ON8A 3SR6A 4NQLB 2QIEB 4YSYB 2BW2A 2M19A 5KHOA 4N6EB 2N7DA 4MSMB 4AP4C 3ONSA 1P0RA 2MH7A 4AWJA 1QLBB 3KYCD 2LASA 3LXFA 1ZDVA 1I4RA 1WGGA 3Q8FA 3PLUA 4FADA 5TSSA 3KLSX 1SXTA 3VRBB 3APDA 3TEZA 1WJNA 2ZNVB 2XK5B 4JWSC 5I4DA 4G3XB 2WXLA 2LHDA 5IO9A 3RFZB 4AJYB 2V0GA 2A4ZA 4GSWA 2L1AA 1NEKB 1WXQA 4MM3A 2LUEA 2QILA 4ANWA 2KC1A 1KLVA 3MHSD 4FJVB 1KF6B 1Y8RC 1QOGA 5EDSA 2LZ6A 3SDLC 2AQ3B 2KJHB 1WX8A 4MGZE 1SSNA 1C3TA 2G4DB 1JQ4A 1A5RA 2EKEC 2WXHA 1I4PA 4FA6A 5E6NA 1NVID 1ZOYB 3N1XC 1SE9A 5EE0A 4MDKE 2PW9A 1KRHA 3AEBB 4E3CA 1VJKA 1CQVA 1J7CA 1VRAB 3ZJVA 1J19A 4WWPA 4OVVA 5HFYA 5BYRA 3JVZX 3QA8A 2DYBA 2KX0A 2WYQA 3W1YA 3CIRB 2Z0EB 1GB4A 4EZKA 2JZPA 2Z8LA 3ZUNA 3SHQA 4D2KA 4A9AA 3SD5A 4PK1A 3BK1A 4ZDVA 2LXCA 2KQ4X 1DOXA 4EE2A 1U4AA 2WDRB 1D4BA 3W5UB 3NZSA 3BVGA 2BYEA 3B2GA 1UBIA 4HRSA 4AJWA 1H4RA 4XDDA 4XZ4A 1UWMA 1WE7A 1JW9D 3N1ZC 2K1FA 3VUXA 2G1EA 4LK0M 4IC7B 4FXCA 1ZPSA 4HDOA 1XO3A 4OZAA 2WX0A 1K53A 2KWUB 2ZPNA 1E90A 4BAXA 2R61A 4BKSA 4AOFA 3O13A 2MJEA 4CYEA 1DYQA 2V4LA 1MG4A 3IVFA 1WGKA 4GMVA 2WX1A 2V9HA 2M4NA 4IW0A 3M63B 4HJGE 2HTME 4NAMA 1WFYA 1C78A 3JW0X 1ISNA 1ACCA 5D3DA 1JRPA 4NPNA 1E8WA 2IY1B 1LXDA 4PYUA 1CZPA 3QX1A 2LRWA 3T9LA 3ZJUA 4W9JA 2O2VA 2K6DB 1DGJA 2JYTA 3RZWC 2HE7A 1E8YA 2YLMA 2KQ7A 3V60A 4YSZB 4W9HA 2GI9A 1P1AA 3T3OA 1J8CA 1C4CA 1SJHD 2BWES 1UF0A 2LXAA 3NVZA 1FRRA 4IM2A 4LJPB 3NVWA 4WWNA 1KH0A 4KIKA 3V6EB 1TS2A 3MP9A 1FCLA 4YL8A 4WJNA 5CHVC 3NOBA 3ZTCA 3Q3JA 4K3CA 1BT0A 5DCNA 3NZUA 3H8HA 2DYOA 1YJ1A 2BTEA 3BINA 5LNK1 2IBIB 4K7UA 1L4DB 3EC8A 1IBXB 4LJOB 3QJZA 2RDHA 3PHWB 2R2QA 3L08A 2NCNA 3LJ3A 1R7SA 2N7EA 2BB5A 3OJ3A 1TY0A 4M00A 2INPE 1QQRA 1PQSA 1WWTA 1JWAD 5DPRA 2DBYA 1XQQA 4KGRA 3BY4B 4DXGA 4GDKA 4MEMA 1GB1A 4I6NB 1WXAA 4WQMA 1PDXA 3T3NA 5D94A 2KFKB 3Q69A 5G5HA 5HHDG 2CKHB 5IKCM 1WRIA 3H7SA 2W9NA 2K8CA 4YTMB 5T8IA 2DWQA 3TL5A 1WJ4A 5BO4B 5HG2A 1WXSA 1GOZA 1OQRA 2DZMA 3OWEB 3BVZA 3R3MA 2MJDA 3URYA 1WYWB 3PZ7A 1R4NB 2REXA 1WGHA 2GBJA 4EEWA 3A9JA 1TY2A 4II2B 1YJIA 3ML8A 1E6EB 3BYTB 2V3PA 3MC9A 4TQ0A 2C7HA 2KX3A 4TMAB 2CHWA 4K7WA 1WXMA 2IJ0A 4C56C 1WGDA 2KTRA 2KJ6A 4BOZB 4A20A 3IG3A 2IZVB 3OJ4B 1N5WA 2KT7A 1E8ZA 4BKTA 3VUWA 1GNUA 1L0YB 3OG5A 1WYGA 4NJ6A 4KKJA 4AUQC 1HXYD 1NI2A 4GU2A 4YTPB 1I35A 1AWDA 4OZCA 1TIFA 2N1WA 2JZ3B 1JROA 3PRMB 2X8XX 3ZIMA 1SJED 2KZRA 4A6QA 2BPSA 2KXJA 3P4RB 3HRDD 3W1SA 5EE1A 3K9PB 3AEGB 4KVGB 2VRRB 2KWVB 2W82A 3QHTA 3AE3B 3PHXB 1WR1A 3AU4A 4LNNA 3KUCB 1NENB 2DENB 2RSUA 3WALA 4C80A 1EUVB 4TKNA 3I3TB 3KYDD 4WJQA 2L52A 4XWTA 2N4FA 3NJTA 2WXMA 2DAFA 1XXGA 3MHZA 3AXCA 4I6LB 5J18A 2E3TA 4PS7A 1WY8A 2WP9B 1KOTA 1YQ4B 1Q10A 4O1NA 5FKAC 1L6VA 1P3QU 1T6BX 3TBLD 3WAOA 3R2TA 3AE7B 3U52E 4A3OA 4FHJA 3IHPC 3V6CB 3KVFB 2ZZPB 3VVWB 1EWYC 1WRDB 2RPQA 4BZAA 2Y5PA 2NPTA 1ZKHA 3KUZA 1OFFA 3E56A 2KN5A 4KZ0A 1WM3A 1V81A 4GIVA 2PJHA 2MBQA 2IO1B 2MCNB 2UU7A 4YT0B 3RNFC 2AL6A 4I6PA 1WE6A 3LDZE 3CWIA 3ETRA 1XLQA 1UUPA 3FC4A 1RAXA 1ZP0B 1XLNA 3GP7A 5AZHA 2BVCA 3PLVA 2N9KA 4HXDA 1SIFA 4DQOC 1GC6A 2ZJDA 3HVDA 2LMCA 2LHEA 2KMCA 1ZUD2 4US9A 5G5GA 2D3CA 3NRZA 3L0WB 2WU2B 3N32A 1SIJA 1WGYA 4KGTA 1ROEA 4ANXA 4URKA 1I4QA 1V97A 4IM3A 3ZXVA 4HPPA 4EZJA 2KLCA 2JRIB 3SFEB 4BOSC 2WDVB 2K0PA 3X0WA 1MPEA 2OHFA 2MP2A 3BVMA 3ALBA 2GLSA 4W9EA 4USAA 3VAWA 2KK8A 3TCAA 3J9CA 3V62A 3WAMA 3RZFA 3A9JB 1JCKB 3DBLB 4HWIB 2YEPB 1DOIA 3S2AA 2B76B 2D10A 1ESFA 1ZE3D 4HKQA 4MGIE 5BYQA 4ARCA 2KDFB 3JYUA 3PRZA 1YIWA 1QZEA 2HJ8A 4C7ZA 3FAHA 1VR9A 3HHMA 2JT4B 3QCAA 2IGHA 4G0NB 1F0ZA 3L16A 3UINB 2QSDA 3VR8B 1L0VB 2R2OA 4LCDE 3A4RA 3DBSA 3Q8EA 2BWFA 4MSQB 1Z5SB 2MEKA 5BMHA 1MJDA 2PTLA 4RM9A 4JQWC 1RYJA 3L4PA 4J6IA 3B08A 1SF0A 1VLBA 3NZ3A 2DZJA 4C7YA 1PFDA 4ZHPA 3PZ8A 4IM0A 4KSKC 1XCQL 2BYTA 1CK1A 1LFDA 2KLGA 1L5PA 3SFDB 4MM3B 4XDCA 3Q3NC 2O6VD 4ANVA 2C7NB 3GE3C 2W55A 3R7RA 1JWMD 4P6VF 4KX6B 3UQBA 3NY5A 3APFA 3LYYA 4ZYNA 4PS3A 3SEBA 1V1PB 3CSTA 3AEAB 1XF5L 3AE6B 1MI0A 2N9LA 2RDGA 3EGRA 1STEA 2DZKA 3LB8C 2KN4A 1FIQA 3KWLA 1TKGA 1C9FA 4WWMA 1LM8B 1XLOA 2WQYB 2N9XA 2CU1A 3RNGC 1UWXA 3ZNZB 3UQAA 2CHXA 1F2RC 2BT6A 4IWQA 1PUTA 3PZDA 1B1ZA 5MPOA 1SBBB 1TS4A 2LGSA 3Q8CA 3P1MA 4WAFA 3VTWA 2HD5B 2VZKD 1KM7A 3ML9A 1KLUD 4C4VB 1P7EA 3PS6A 2NMQA 2O2VB 1E9MA 2JZZA 3Q14C 3DHGC 1YD8U 2RGFA 2INDC 2D2QA 4P1CC 4ITKA 3VRAB 2KFJA 1FMAD 1E5WA 3ZRFA 2LVQA 3AECB 2WXGA 5BMGA 3D32A 3EA6A 5C2TB 2JU6X 3HM3A 2ICIA 5DPWA 2JUOA 2KDMA 2PEAA 2WXPA 2LUMA 1C79A 5G2NA 4RGNA 1YN3A 4JWUC 3M62B 2W54A 2FNJB 1C4PA 3JSVA 2J52A 2K39A 3TJPA 4DHJD 3AI5A 4W9LA 3KH0A 3BIID 2V3SA 1BXTA 2EKIA 2WHIA 3GB1A 1GG3A 2GBKA 1VD2A 2FE8A 5JXVA 3RULA 1QF6A 4KSLC 1HZ5A 3ZXRA 1L6UA 1QKZA 4F8CB 2RDBC 2Q5WD 5D3IB 3U7DA 4DDGD 1D5XC 1N5XA 4F1SA 2ZW1A 4W9DA 1HA5A 3DVGY 1YX6B 1VCBA 2N0SB 2KAJA 1PYWD 4IKGA 3RYTA 3VTVA 2BS3B 1FM0D 5AUKA 2LVOA 3QQ8B 4RMAA 3KW5B 3KWVA 3RNEC 3VQIA 3R66C 3VH4B 4KGSA 3Q3MC 1WJ6A 3KUDB 4FJZA 1FRDA 1V5OA 1G6JA 4NZLB 1NDDA 4A55A 3AH7A 3ECIA 4OZBA 2KDBA 3AULA 3PO0A 1F2RI 4FN2A 2GBRA 1SE4A 2G9HD 4RM8A 3DBLI 5L83A 4EFOA 4MELA 4BFRA 1WR6E 3EFCA 2XN9C 2V4IB 3CSFA 4JGHB 2DX5B 2FCSA 1UZXB 3OAWA 1BUIC 1LGRA 2LEKA 2IGGA 3VTUA 4GDLA 2MW5A 2VH2A 4K81A 4WJOA 1GPXA 1QOFA 1N60A 2NBWB 4A3PA 4LTUA 4TSSA 2LD9A 2D3AA 2IGDA 3RCZA 4H2AA 1WX9A 2QC8A 1FPYA 2WLBA 3MJWA 3QWZB 1RFKA 2JWUA 4W9IA 2Y5BB 1F1HA 2E6XA 1ZXIA 4M0WB 1ENFA 1ZW7A 2FCMA 3DHHC 1VDVA 1YN5A 1L4ZB 1FXIA 3QIJA 2MSED 2ZW0A 1FXAA 1AN8A 2CR5A 1QILA 4RGOS 3RT3B 1HQRD 3AE2B 1K51A 3A33B 2I1JA 1CMXB 4M8MA 3L17A 1TT5B 2MBEA 3NUHB 4UDUC 2AL3A 2MLBA 5BMIA 3Q8BA 1X1MA 2Z59B 2WXRA 2C9WB 1R4MI 2FUG1 3AU5A 3A1QB 4S17A 1I7HA 2KDEB 1UH6A 2V1YA 2KMMA 3PGEA 2MHJA 3V3XA 3ZVVA 3EHVA 1V9JA 3RNBC 1SB3C 4RF0A 2AX5A 5IAAC 4RH6A 1I4GA 1WZ3A 2N9EB 4JPSA 1JWBD 1YNTE 4MJSB 4IG7B 3ABVB 3VR9B 4HPMB 4NNJB 1SEBD 3EUB2 4ZRJA 2NTTA 2MQJA 2L05A 2ZVNA 3BYYB 4P16A 1V5TA 2CJNA 2O6VB 1E10A 4BBNC 2RR9A 1C77A 1GC7A 5JHBA 2X38A 2K3UA 1E8XA 4JIOU 2KMAA 3U8ZA 1XD3B 3MC8A 4A8XC 4KDLB 3DBHB 1KTKA 4ANUA 2GB1A 1RFAA 1TZ1A 1E7VA 3P4QB 4B0EA 2D5GA 3MJ5A 4ZRPA 1SE2A 2JY6A 4HKZE 2M17A 2M8SA 4K1RB 1MHHE 4ZHOA 4ZOHC 4WH4A 3TMPB 4IOIE 3ZDTA 4X57B 3IT4B 1S3SG 1N63A 2M0AA 3AEFB 4JE3B 3R7QA 5CTRC 4GDKB 3GZNI 2K9XA 4N59A 4DXFA 2WS3B 2MX2A 5E6OA 4C00A 1QOBA 3IAS1 4ZYSA 2HDEA 4PT5A 2VZKB 4L2YA 1IBXA 4OVZA 4RNAA 4C4VA 2K22A 1V2YA 2LGDA 3UGBB 1K50A 4M0WA 3ZTDA 3H9DA 2L7RA 4G11A 2L0TA 4W9GA 5H92C 1PGBA 3HUIA 2K5PA 3P63A 5C3JB 1LO5D 2ASQA 4US8A 3IAM1 2LWPA 1D5ZC 1WMHA 2OJWA 1Q0WB 2IDYA 3P42A 4KIKB 2LI5A 5GMVA 3ZW3A 1ET6A 1FO4A 1KJTA 3WA0A 5E6PA 3DWMA 1J7AA 1M4VA 1V6EA 4RGMA 1OEYA 3W5VB 2KVRA 1WF9A 1FFUA 1OEYJ 1N6ZA 1YN4A 1YJJA 1ZGUB 3TIXA 4RFBA 3FILB 4DHJB 5EE9A 4LNKA 3RI7C 3TSSA 3DVNV 3AV8A 3ZQ4A 4B6WA 1MG8A 1UGMA 2L8JA 4TQ1A 1N62A 2NVUI 4YXDB 4K7SA 1YMHE 4B95A 1I4XA 1MFWA 1JWUD 2JWZA 2PVGC 3EECA 2IYDB 2G3QB 1YOVB 4KDIC 2GMIC 2WDQB 3R8BA 3ZLZA 2A5UA 2K6QA 3APCA 2M56B 2GBMA 4XX5A 5HKHA 4MT5A 3DVNU 1WJUA 4BKSD 3QAQA 1E7UA 4YSXB 2BB6A 2LRUA 1V1OA 2KANA 5JHAA 2NTSA 1UELA 3M3JA 2M0XA 1NBFC 3P4SB 3Q8AA 4BKGA 1Q1OA 2RMMA 3W9CB 3B0AA 1KLGD 1TJEA 4OVUA 2L76A 2XNAC 3WIMA 1GJZA 3ENEA 4BVUC 2CJOA 1RM6C 4WIPA 3KQ4A 2IO0B 1P9DU 1FNUA 2CU3A 1T3QA 2L3ZA 4NQKE 2Z0DB 4XWWA 1WSPA 4DHZB 5LXHA 2MP2B 2DZIA 2BGFA 3GZNB 3DOWA 1T0YA 3N20C 4W9FA 1T0RC 2QEJC 1V86A 2YVCA 1HE8A 3I63C 3BK2A 3BWUD 1WM2A 3HIZA 3TEXA 4EZLA 2FBWB 4HCPB 2I2YA 1WZ0A 3DBHI 2ZEQA 2VH1A 2JRHA 2D07B 2KTRB 4HPLB 4WAAA 4JL9A 3WCQA 2AQ1B 3MC0B 5GXGB 4GOCA 4CO7A 2I38A 4ACFA 1S1QB 1EM7A 2KNBA 1LQBA 1OTRB 4MJSA 4P1BC 1AW7A 2J0JA 2XBBC 2EMSA 3WANA 3VDZA 2MRPA 4GB9A 3AEDB 4G50A 3ZNHB 1RWSA 2J53A 2L00B 1RRBA 2J42A 1EF1A 1JMLA 2XK5A 4HCNB 5IN7A 3CMMB 1IUEA 3H1UA 4HLEA 2J0KA 2L0FA 2KVZA 1VZ6A 4HK2A 4ICVA 1KFYB 4LLGM 2FIDA 5CX3A 1D3ZA 2MA9B 3HVZA 2WXFA 4M02A 3NHEB 1QOAA 3AMZA 5CHWA 1WIAA 4GN1A 2KWDA 3ZKJC 4GDLB 4LDTD 1FFVA 4OW0A 1FD6A 3IXSA 4NAWB 5IP4D 4M01A 4S0RA 2G45B 4KV2A 2PIAA 2NR2A 4RF1A 4L23A 4HDQA 3UIPB 2TSSA 1TBEA 5G55A 2ZCCA 4RCOA 3ZO5B 2JYEA 3IFWB 3QARA 1WX7A 2JVCA 4W9CA 1XT9B 3U30A 2KYWA 4MH0E 4A90A 3VXWA 5C1ZA 3RUIB 4ZRQA 4AS1A 4LNOA 2IO2B 3WAPA 2ZNVC 2SAKA 3HM6X 1J0GA 2BKFA 2HTHA 3NG0A 2Y3AA 1WXVA 4IWPA 4HVBA 3AE5B 3AE4B 2JX5A 2J4XA 4PS8A 3DVGX 2CS4A 3ZNID 3B9JA 4TV3A 2WXKA 2C7MB 2INNE 2KQSA 1J7BA 2ACZB 2IY0B 2BYVE 3B1LX 1WMHB 3U2SC 2JXTA 2QHOA 3DBRI 2PKOA 1L2NA 1XCTL 4GLSC 1QT9A 2IO3B 2QMTA 5L95C 2FCNA 3AE1B 1D5MC 3IT6B 1UD7A 3PREA 2GRIA 4ASWC 3AN1A 3HK0A 2FAZA 3VHTC 2JQRB 2BF8B 1EWCA 1XEEA 5D2MB 1SE3A 3FILA 5AZFA 3SU8X 1C4AA 1H8CA 3H7PA 3A9KB 1EF5A 3QC8B 3NVYA 5IOIA 2WWZA 3VFKA 2V3NA 3FKYA 3JSVB 5LLIA 1TS3A 3C19A 4NAWA 3N30A 1UGJA 2KHWB 4AQ7A 3Q3OC 4J3OD 2AQ2B 1F77A 1GAQB 1GUAB 3PT2B 2FCQA 1EU4A 3DDCB 1JALA 4JX1C 2MBBB 4ICUA 1B9RA 2J0MA 4XE0A 2BKRB 2QCZA 3TEWA 1FNVA 3H7PB 3Q3FA 3MFGA 5DPSA 1M94A 4LNFA 1IYFA 4DK5A 3MTNB 4EOYA 1WH3A 3DHIC 2D11A 2KWCA 3ZYYX 1R4NI 2LJIA 2O6VA 5EE3A 4DDID 5LXIB 2QJLA 3ZNGC 2AWTA 4HJKA 2OOBB 5FR3A 4KZCA 3N1YC 1EO6A 4ZRKA 3X23A 1VZ7A
chains in the Genus database with same CATH topology
3QA8A 4K1RB 4WJPA 4GXBA 2DYBA 2KX0A 2WYQA 4HWIB 3W1YA 2Z0EB 3TMPB 3ZDTA 4X57B 3S2AA 4EZKA 2D10A 3OLMD 2ZCBA 1S3SG 3ZUNA 4MGIE 3SHQA 2KDFB 3JYUA 3PRZA 3R7QA 1YIWA 1QZEA 5CTRC 4GDKB 2HJ8A 3GZNI 4EUTA 3SD5A 3HHMA 2JT4B 3QCAA 2N1VA 2XEWA 4G0NB 2MX2A 5E6OA 4ZDVA 3L16A 3UINB 2RD0A 1C1YB 3H6NA 2R2OA 2I1KA 4LCDE 2LXCA 3A4RA 2MWSB 3DBSA 3C0RB 1TGZB 1SGHA 1U4AA 1TTNA 2BWFA 4MSQB 3NZSA 1Z5SB 1F9JA 2BYEA 1UBIA 4AJWA 1H4RA 4RM9A 4JQWC 4XZ4A 1V2YA 2LGDA 5JZEB 3UGBB 1WE7A 3ZTDA 1OGWA 3H9DA 4J6IA 2JF5A 3B08A 2L7RA 2K1FA 4G11A 2KO3A 2L0TA 4W9GA 3VUXA 4IC7B 2DZJA 1YQBA 3X23A 4IM0A 2PPHA 3UF8A 2ASQA 4HDOA 4KSKC 5JH5C 2WX0A 4DBGA 2KWUB 2NBUA 2ZPNA 1LFDA 3CF6E 2KLGA 1E90A 2LWPA 4BKSA 3QK0A 4AOFA 2NPTB 3A4SC 1WMHA 2O6VD 4ANVA 1Q0WB 4CYEA 2V4LA 3K9OB 3UIOB 2C7NB 2D3GA 4FBJB 2KJRA 4KIKB 3IVFA 4E74A 2LI5A 3R7RA 3DPDA 1Z2MA 4GMVA 1WI0A 2WX1A 5GMVA 3ZW3A 3UQBA 1I42A 1KJTA 3WA0A 5E6PA 4DWFA 2M4NA 3NY5A 4IW0A 3L10B 3M63B 2GBNA 3PVLA 1V6EA 3APFA 4ZYNA 4EKUA 1OEYA 4F7ZA 2KVRA 3PRPB 1WFYA 5AEKB 3JW0X 1WF9A 2NS5A 1ISNA 1OEYJ 4PS3A 4NPNA 1E8WA 2IY1B 1LXDA 1ZGUB 2KOXA 3CSTA 3QX1A 2LRWA 2KDIA 1OQYA 4PYUA 3TIXA 4DHJB 2KKCA 3T9LA 4W9JA 3PPAA 2O2VA 3DVNV 2K6DB 3DQVA 2DZKA 5DPTA 2JXXA 3RZWC 2HE7A 1E8YA 2DHZA 2YLMA 2KQ7A 3V60A 2PE9A 1MG8A 1UGMA 2K8BA 2L8JA 4W9HA 4B6WA 1LM8B 4TQ1A 2N9XA 2NVUI 2K25A 4K7SA 1P1AA 2CU1A 5CHFA 4B95A 1IP9A 1J8CA 3W1SC 2BWES 3ZNZB 3UQAA 2CHXA 2JWZA 2LXAA 4IUMB 3EECA 4IWQA 4WWOA 2IYDB 4IM2A 3PZDA 2G3QB 4LJPB 4KDIC 2GMIC 3L54A 2LGXA 4WWNA 5FR6A 4KIKA 3ZLZA 2A5UA 2HD5B 3VTWA 3V6EB 2K6QA 2DAJA 1KM7A 3APCA 2K8HA 4YL8A 3ML9A 2GBMA 3PTFC 4WJNA 5CHVC 4XX5A 5HKHA 1P98A 3NOBA 3ZTCA 3Q3JA 3VH3B 5DCNA 1BT0A 3PS6A 3NZUA 4P7IA 2DYOA 1YJ1A 3BINA 3DVNU 1WJUA 2O2VB 2IBIB 2ZVOA 4BKSD 2JZZA 3QAQA 4K7UA 3EC8A 1E7UA 4LJOB 1YD8U 2LRUA 1AARA 2RGFA 4W9KA 2KANA 5JHAA 2D2QA 1UELA 3M3JA 3QJZA 3PHWB 2R2QA 2M0XA 4M8NA 3L08A 1RLFA 2KD0A 2KFJA 4GGQA 1NBFC 2NCNA 3LJ3A 4BKGA 1E5WA 3ZRFA 4PYZA 1Q1OA 2LVQA 5IA7A 2N7EA 3DCGA 3B0AA 3D32A 3OJ3A 2EMTA 4JLCA 4OVUA 2L76A 3WIMA 3HM3A 1GJZA 3ENEA 4BVUC 5DPWA 2JUOA 4DHZE 2PEAA 2C60A 1PQSA 5G2NA 2KTFA 2IO0B 1P9DU 4LDTB 3M62B 5DPRA 4NQKE 2KC2A 2L3ZA 1XQQA 2KFKA 2Z0DB 1YX5B 1V49A 2UYZB 3BY4B 2OJRA 4DHZB 5LXHA 4GDKA 2J7QB 2MP2B 2DZIA 2BGFA 1Q5WB 4MEMA 4I6NB 4FULA 4WQOB 2FNJB 1WXAA 3JSVA 3DOWA 1T0YA 2K39A 3TJPA 4W9FA 4DHJD 3VUYA 4II3B 3AI5A 2B3AA 2KFKB 3O65B 4IWOA 3KH0A 4W9LA 5D94A 2CKHB 1V86A 2V3SA 5TR5A 2YVCA 3H7SA 1HE8A 2MBHA 2W9NA 2K8CA 4TUUA 2N9PC 1GG3A 1WM2A 2GBKA 3ZDMC 3TL5A 1WJ4A 5BO4B 3HIZA 4EZLA 1VD2A 1WXSA 4XC2A 3P2BA 2DZMA 3R3MA 2MBOA 4HCPB 1WZ0A 2AYOB 3DBHI 3RULA 1WYWB 2ZEQA 2LVPA 4KSLC 2JRHA 4DXAB 2D07B 2REXA 1WGHA 2LJ5A 2GBJA 2KTRB 4HPLB 4WAAA 4JL9A 4GOCA 4EEWA 4F8CB 3A9JA 4II2B 4CO7A 3U7DA 2C5LC 1S1QB 4DDGD 3PV1A 3ML8A 4F1SA 4W9DA 2KNBA 1LQBA 1OTRB 4MJSA 3DVGY 1YX6B 4NY0A 1VCBA 4TQ0A 3M95A 2C7HA 2J0JA 2XBBC 1WGRA 2KX3A 3RD2A 3RYTA 2CHWA 3T8MA 2EMSA 2FIFA 4K7WA 4ZRIA 1WXMA 3L13A 3VTVA 3WANA 3VDZA 1WGDA 2MRPA 2LVOA 4GB9A 3GOEA 2M1MA 4E71A 3QQ8B 4G50A 2CHZA 3ZNHB 2L00B 4B9KA 1RRBA 2KTRA 2KJ6A 4RMAA 1EF1A 3KW5B 4A20A 4BOZB 2XK5A 3IG3A 3N3KB 3VQIA 4HCNB 3R66C 3CMMB 2IZVB 3OJ4B 3VH4B 3H1UA 4NJ7A 1E8ZA 4HLEA 3EFUA 4BKTA 3VUWA 2J0KA 1WJ6A 2L0FA 3KUDB 4FJZA 1GNUA 3IBEA 4HK2A 1IPGA 2FUHB 4ICVA 4NJ6A 2FIDA 5CX3A 1V5OA 4AUQC 1D3ZA 2MA9B 1NI2A 1NDDA 1G6JA 3ECIA 3NHEB 3A9KA 2KDBA 3PSEB 4GU2A 5CHWA 3V61A 1WIAA 3AULA 4GN1A 1I35A 4FN2A 2GBRA 5C23A 3ZKJC 4BBNF 4GDLB 4LDTD 2N1WA 4RM8A 3DBLI 2G4SA 5KHQA 4NAWB 4EFOA 5L83A 1FXTB 3NS8A 2GOWA 2JZ3B 2G45B 4N9F4 3PRMB 4MELA 4KV2A 2NR2A 3ZIMA 4HDQA 4BFRA 1L7YA 1WR6E 3UIPB 1UBQA 1TBEA 5J17A 2KZRA 2BPSA 5G55A 3CSFA 4JGHB 2KXJA 3W1SA 4MGKE 2ZCCA 3K9PB 2DX5B 1V80A 2JPHA 5D6JB 3ZO5B 2FCSA 4KVGB 2VRRB 2KWVB 4FLHA 3QHTA 1UZXB 3OAWA 4MGYE 2PE6B 3IFWB 3QARA 1WX7A 2JVCA 3VTUA 2BYFA 4W9CA 4GDLA 3PHXB 2MW5A 1XT9B 1WR1A 2UWQA 3U30A 4K81A 4MH0E 5J2RA 2LGYA 3AU4A 4WJOA 3KUCB 3VXWA 2NBWB 5C1ZA 2DENB 4A3PA 5D7GA 3ZRCA 4FHKA 3RUIB 2LD9A 2RSUA 3WALA 1EUVB 4TKNA 3I3TB 3A1QA 3KYDD 4FJYA 4WJQA 3RCZA 1WX9A 2DYMA 3MJWA 3QWZB 2N4FA 2IO2B 2NBVB 4W9IA 3WAPA 2DAFA 2Y5BB 2ZNVC 3HM6X 1J0GA 2AEHA 2BKFA 4M0WB 3AXCA 4I6LB 1ZW7A 2HTHA 2FCMA 5J18A 4PS7A 1WY8A 1WXVA 1KOTA 4IWPA 4HVBA 4CHKA 2ZPYA 4PS8A 3QIJA 1P3QU 1K8RB 2MSED 1JRUA 2CS4A 3DVGX 3ZNID 2WDTB 4TV3A 3TBLD 3WAOA 2CR5A 3RT3B 2C7MB 4A3OA 5AZGA 2KQSA 4FHJA 2IY0B 2BYVE 3A33B 3B1LX 3IHPC 1WMHB 2I1JA 3V6CB 1CMXB 2QHOA 3KVFB 2ZZPB 3DBRI 4NQLB 4M8MA 3L17A 1L2NA 2MBEA 3VVWB 1WRDB 2IO3B 5L95C 2RPQA 2FCNA 5KHOA 2N7DA 2NPTA 1ZKHA 2AL3A 3KUZA 2MLBA 4MSMB 4AP4C 1UD7A 2KN5A 3ONSA 4KZ0A 1P0RA 3PREA 1WM3A 4AWJA 4ASWC 1V81A 3HK0A 2PJHA 4GIVA 3KYCD 2MBQA 2FAZA 1X1MA 2IO1B 2Z59B 2LASA 3VHTC 2MCNB 2BF8B 2C9WB 1R4MI 3AU5A 5D2MB 3A1QB 2KDEB 1WGGA 5AZFA 2AL6A 3SU8X 3PLUA 4I6PA 4FADA 1UH6A 1WE6A 2V1YA 3LDZE 3PGEA 1H8CA 3H7PA 3A9KB 1EF5A 3QC8B 3ZVVA 3APDA 3EHVA 2WWZA 1V9JA 3VFKA 1WJNA 2ZNVB 3JSVB 5LLIA 2XK5B 1RAXA 4G3XB 4NAWA 3N30A 2KHWB 5IAAC 5AZHA 1WZ3A 2N9EB 4AJYB 4MJSB 2A4ZA 4IG7B 4GSWA 3PLVA 4HPMB 4MM3A 2LUEA 4NNJB 4HXDA 4ZRJA 1SIFA 1GUAB 1GC6A 4ANWA 2ZJDA 3PT2B 2FCQA 3DDCB 2KC1A 2KMCA 1KLVA 3MHSD 2MQJA 2L05A 2MBBB 2ZVNA 1Y8RC 4FJVB 3L0WB 4ICUA 2J0MA 3N32A 5EDSA 2LZ6A 2BKRB 1WGYA 3SDLC 2KJHB 1V5TA 1WX8A 2O6VB 4MGZE 4BBNC 2RR9A 3H7PB 1GC7A 5JHBA 3Q3FA 1C3TA 2G4DB 5DPSA 1M94A 1A5RA 4ANXA 2EKEC 4URKA 1E8XA 1IYFA 4FA6A 4JIOU 4IM3A 2KMAA 3U8ZA 4DK5A 1XD3B 5E6NA 3MTNB 4EOYA 1WH3A 4EZJA 2KLCA 4KDLB 2JRIB 4ANUA 1SE9A 4BOSC 2D11A 2KWCA 4MDKE 1R4NI 3X0WA 1RFAA 1TZ1A 2MP2A 1E7VA 2O6VA 4E3CA 4DDID 3ALBA 5LXIB 4W9EA 3ZNGC 2AWTA 1J19A 4WWPA 4HJKA 3VAWA 2OOBB 4OVVA 2KK8A 3TCAA 2JY6A 3V62A 3WAMA 3RZFA 4KZCA 1EO6A 4ZRKA 2M17A 2M8SA 3A9JB 3JVZX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QA8 A;  4K1R B;  4WJP A;  4GXB A;  2DYB A;  2KX0 A;  2WYQ A;  4HWI B;  3W1Y A;  2Z0E B;  3TMP B;  3ZDT A;  4X57 B;  3S2A A;  4EZK A;  2D10 A;  3OLM D;  2ZCB A;  1S3S G;  3ZUN A;  4MGI E;  3SHQ A;  2KDF B;  3JYU A;  3PRZ A;  3R7Q A;  1YIW A;  1QZE A;  5CTR C;  4GDK B;  2HJ8 A;  3GZN I;  4EUT A;  3SD5 A;  3HHM A;  2JT4 B;  3QCA A;  2N1V A;  2XEW A;  4G0N B;  2MX2 A;  5E6O A;  4ZDV A;  3L16 A;  3UIN B;  2RD0 A;  1C1Y B;  3H6N A;  2R2O A;  2I1K A;  4LCD E;  2LXC A;  3A4R A;  2MWS B;  3DBS A;  3C0R B;  1TGZ B;  1SGH A;  1U4A A;  1TTN A;  2BWF A;  4MSQ B;  3NZS A;  1Z5S B;  1F9J A;  2BYE A;  1UBI A;  4AJW A;  1H4R A;  4RM9 A;  4JQW C;  4XZ4 A;  1V2Y A;  2LGD A;  5JZE B;  3UGB B;  1WE7 A;  3ZTD A;  1OGW A;  3H9D A;  4J6I A;  2JF5 A;  3B08 A;  2L7R A;  2K1F A;  4G11 A;  2KO3 A;  2L0T A;  4W9G A;  3VUX A;  4IC7 B;  2DZJ A;  1YQB A;  3X23 A;  4IM0 A;  2PPH A;  3UF8 A;  2ASQ A;  4HDO A;  4KSK C;  5JH5 C;  2WX0 A;  4DBG A;  2KWU B;  2NBU A;  2ZPN A;  1LFD A;  3CF6 E;  2KLG A;  1E90 A;  2LWP A;  4BKS A;  3QK0 A;  4AOF A;  2NPT B;  3A4S C;  1WMH A;  2O6V D;  4ANV A;  1Q0W B;  4CYE A;  2V4L A;  3K9O B;  3UIO B;  2C7N B;  2D3G A;  4FBJ B;  2KJR A;  4KIK B;  3IVF A;  4E74 A;  2LI5 A;  3R7R A;  3DPD A;  1Z2M A;  4GMV A;  1WI0 A;  2WX1 A;  5GMV A;  3ZW3 A;  3UQB A;  1I42 A;  1KJT A;  3WA0 A;  5E6P A;  4DWF A;  2M4N A;  3NY5 A;  4IW0 A;  3L10 B;  3M63 B;  2GBN A;  3PVL A;  1V6E A;  3APF A;  4ZYN A;  4EKU A;  1OEY A;  4F7Z A;  2KVR A;  3PRP B;  1WFY A;  5AEK B;  3JW0 X;  1WF9 A;  2NS5 A;  1ISN A;  1OEY J;  4PS3 A;  4NPN A;  1E8W A;  2IY1 B;  1LXD A;  1ZGU B;  2KOX A;  3CST A;  3QX1 A;  2LRW A;  2KDI A;  1OQY A;  4PYU A;  3TIX A;  4DHJ B;  2KKC A;  3T9L A;  4W9J A;  3PPA A;  2O2V A;  3DVN V;  2K6D B;  3DQV A;  2DZK A;  5DPT A;  2JXX A;  3RZW C;  2HE7 A;  1E8Y A;  2DHZ A;  2YLM A;  2KQ7 A;  3V60 A;  2PE9 A;  1MG8 A;  1UGM A;  2K8B A;  2L8J A;  4W9H A;  4B6W A;  1LM8 B;  4TQ1 A;  2N9X A;  2NVU I;  2K25 A;  4K7S A;  1P1A A;  2CU1 A;  5CHF A;  4B95 A;  1IP9 A;  1J8C A;  3W1S C;  2BWE S;  3ZNZ B;  3UQA A;  2CHX A;  2JWZ A;  2LXA A;  4IUM B;  3EEC A;  4IWQ A;  4WWO A;  2IYD B;  4IM2 A;  3PZD A;  2G3Q B;  4LJP B;  4KDI C;  2GMI C;  3L54 A;  2LGX A;  4WWN A;  5FR6 A;  4KIK A;  3ZLZ A;  2A5U A;  2HD5 B;  3VTW A;  3V6E B;  2K6Q A;  2DAJ A;  1KM7 A;  3APC A;  2K8H A;  4YL8 A;  3ML9 A;  2GBM A;  3PTF C;  4WJN A;  5CHV C;  4XX5 A;  5HKH A;  1P98 A;  3NOB A;  3ZTC A;  3Q3J A;  3VH3 B;  5DCN A;  1BT0 A;  3PS6 A;  3NZU A;  4P7I A;  2DYO A;  1YJ1 A;  3BIN A;  3DVN U;  1WJU A;  2O2V B;  2IBI B;  2ZVO A;  4BKS D;  2JZZ A;  3QAQ A;  4K7U A;  3EC8 A;  1E7U A;  4LJO B;  1YD8 U;  2LRU A;  1AAR A;  2RGF A;  4W9K A;  2KAN A;  5JHA A;  2D2Q A;  1UEL A;  3M3J A;  3QJZ A;  3PHW B;  2R2Q A;  2M0X A;  4M8N A;  3L08 A;  1RLF A;  2KD0 A;  2KFJ A;  4GGQ A;  1NBF C;  2NCN A;  3LJ3 A;  4BKG A;  1E5W A;  3ZRF A;  4PYZ A;  1Q1O A;  2LVQ A;  5IA7 A;  2N7E A;  3DCG A;  3B0A A;  3D32 A;  3OJ3 A;  2EMT A;  4JLC A;  4OVU A;  2L76 A;  3WIM A;  3HM3 A;  1GJZ A;  3ENE A;  4BVU C;  5DPW A;  2JUO A;  4DHZ E;  2PEA A;  2C60 A;  1PQS A;  5G2N A;  2KTF A;  2IO0 B;  1P9D U;  4LDT B;  3M62 B;  5DPR A;  4NQK E;  2KC2 A;  2L3Z A;  1XQQ A;  2KFK A;  2Z0D B;  1YX5 B;  1V49 A;  2UYZ B;  3BY4 B;  2OJR A;  4DHZ B;  5LXH A;  4GDK A;  2J7Q B;  2MP2 B;  2DZI A;  2BGF A;  1Q5W B;  4MEM A;  4I6N B;  4FUL A;  4WQO B;  2FNJ B;  1WXA A;  3JSV A;  3DOW A;  1T0Y A;  2K39 A;  3TJP A;  4W9F A;  4DHJ D;  3VUY A;  4II3 B;  3AI5 A;  2B3A A;  2KFK B;  3O65 B;  4IWO A;  3KH0 A;  4W9L A;  5D94 A;  2CKH B;  1V86 A;  2V3S A;  5TR5 A;  2YVC A;  3H7S A;  1HE8 A;  2MBH A;  2W9N A;  2K8C A;  4TUU A;  2N9P C;  1GG3 A;  1WM2 A;  2GBK A;  3ZDM C;  3TL5 A;  1WJ4 A;  5BO4 B;  3HIZ A;  4EZL A;  1VD2 A;  1WXS A;  4XC2 A;  3P2B A;  2DZM A;  3R3M A;  2MBO A;  4HCP B;  1WZ0 A;  2AYO B;  3DBH I;  3RUL A;  1WYW B;  2ZEQ A;  2LVP A;  4KSL C;  2JRH A;  4DXA B;  2D07 B;  2REX A;  1WGH A;  2LJ5 A;  2GBJ A;  2KTR B;  4HPL B;  4WAA A;  4JL9 A;  4GOC A;  4EEW A;  4F8C B;  3A9J A;  4II2 B;  4CO7 A;  3U7D A;  2C5L C;  1S1Q B;  4DDG D;  3PV1 A;  3ML8 A;  4F1S A;  4W9D A;  2KNB A;  1LQB A;  1OTR B;  4MJS A;  3DVG Y;  1YX6 B;  4NY0 A;  1VCB A;  4TQ0 A;  3M95 A;  2C7H A;  2J0J A;  2XBB C;  1WGR A;  2KX3 A;  3RD2 A;  3RYT A;  2CHW A;  3T8M A;  2EMS A;  2FIF A;  4K7W A;  4ZRI A;  1WXM A;  3L13 A;  3VTV A;  3WAN A;  3VDZ A;  1WGD A;  2MRP A;  2LVO A;  4GB9 A;  3GOE A;  2M1M A;  4E71 A;  3QQ8 B;  4G50 A;  2CHZ A;  3ZNH B;  2L00 B;  4B9K A;  1RRB A;  2KTR A;  2KJ6 A;  4RMA A;  1EF1 A;  3KW5 B;  4A20 A;  4BOZ B;  2XK5 A;  3IG3 A;  3N3K B;  3VQI A;  4HCN B;  3R66 C;  3CMM B;  2IZV B;  3OJ4 B;  3VH4 B;  3H1U A;  4NJ7 A;  1E8Z A;  4HLE A;  3EFU A;  4BKT A;  3VUW A;  2J0K A;  1WJ6 A;  2L0F A;  3KUD B;  4FJZ A;  1GNU A;  3IBE A;  4HK2 A;  1IPG A;  2FUH B;  4ICV A;  4NJ6 A;  2FID A;  5CX3 A;  1V5O A;  4AUQ C;  1D3Z A;  2MA9 B;  1NI2 A;  1NDD A;  1G6J A;  3ECI A;  3NHE B;  3A9K A;  2KDB A;  3PSE B;  4GU2 A;  5CHW A;  3V61 A;  1WIA A;  3AUL A;  4GN1 A;  1I35 A;  4FN2 A;  2GBR A;  5C23 A;  3ZKJ C;  4BBN F;  4GDL B;  4LDT D;  2N1W A;  4RM8 A;  3DBL I;  2G4S A;  5KHQ A;  4NAW B;  4EFO A;  5L83 A;  1FXT B;  3NS8 A;  2GOW A;  2JZ3 B;  2G45 B;  4N9F 4;  3PRM B;  4MEL A;  4KV2 A;  2NR2 A;  3ZIM A;  4HDQ A;  4BFR A;  1L7Y A;  1WR6 E;  3UIP B;  1UBQ A;  1TBE A;  5J17 A;  2KZR A;  2BPS A;  5G55 A;  3CSF A;  4JGH B;  2KXJ A;  3W1S A;  4MGK E;  2ZCC A;  3K9P B;  2DX5 B;  1V80 A;  2JPH A;  5D6J B;  3ZO5 B;  2FCS A;  4KVG B;  2VRR B;  2KWV B;  4FLH A;  3QHT A;  1UZX B;  3OAW A;  4MGY E;  2PE6 B;  3IFW B;  3QAR A;  1WX7 A;  2JVC A;  3VTU A;  2BYF A;  4W9C A;  4GDL A;  3PHX B;  2MW5 A;  1XT9 B;  1WR1 A;  2UWQ A;  3U30 A;  4K81 A;  4MH0 E;  5J2R A;  2LGY A;  3AU4 A;  4WJO A;  3KUC B;  3VXW A;  2NBW B;  5C1Z A;  2DEN B;  4A3P A;  5D7G A;  3ZRC A;  4FHK A;  3RUI B;  2LD9 A;  2RSU A;  3WAL A;  1EUV B;  4TKN A;  3I3T B;  3A1Q A;  3KYD D;  4FJY A;  4WJQ A;  3RCZ A;  1WX9 A;  2DYM A;  3MJW A;  3QWZ B;  2N4F A;  2IO2 B;  2NBV B;  4W9I A;  3WAP A;  2DAF A;  2Y5B B;  2ZNV C;  3HM6 X;  1J0G A;  2AEH A;  2BKF A;  4M0W B;  3AXC A;  4I6L B;  1ZW7 A;  2HTH A;  2FCM A;  5J18 A;  4PS7 A;  1WY8 A;  1WXV A;  1KOT A;  4IWP A;  4HVB A;  4CHK A;  2ZPY A;  4PS8 A;  3QIJ A;  1P3Q U;  1K8R B;  2MSE D;  1JRU A;  2CS4 A;  3DVG X;  3ZNI D;  2WDT B;  4TV3 A;  3TBL D;  3WAO A;  2CR5 A;  3RT3 B;  2C7M B;  4A3O A;  5AZG A;  2KQS A;  4FHJ A;  2IY0 B;  2BYV E;  3A33 B;  3B1L X;  3IHP C;  1WMH B;  2I1J A;  3V6C B;  1CMX B;  2QHO A;  3KVF B;  2ZZP B;  3DBR I;  4NQL B;  4M8M A;  3L17 A;  1L2N A;  2MBE A;  3VVW B;  1WRD B;  2IO3 B;  5L95 C;  2RPQ A;  2FCN A;  5KHO A;  2N7D A;  2NPT A;  1ZKH A;  2AL3 A;  3KUZ A;  2MLB A;  4MSM B;  4AP4 C;  1UD7 A;  2KN5 A;  3ONS A;  4KZ0 A;  1P0R A;  3PRE A;  1WM3 A;  4AWJ A;  4ASW C;  1V81 A;  3HK0 A;  2PJH A;  4GIV A;  3KYC D;  2MBQ A;  2FAZ A;  1X1M A;  2IO1 B;  2Z59 B;  2LAS A;  3VHT C;  2MCN B;  2BF8 B;  2C9W B;  1R4M I;  3AU5 A;  5D2M B;  3A1Q B;  2KDE B;  1WGG A;  5AZF A;  2AL6 A;  3SU8 X;  3PLU A;  4I6P A;  4FAD A;  1UH6 A;  1WE6 A;  2V1Y A;  3LDZ E;  3PGE A;  1H8C A;  3H7P A;  3A9K B;  1EF5 A;  3QC8 B;  3ZVV A;  3APD A;  3EHV A;  2WWZ A;  1V9J A;  3VFK A;  1WJN A;  2ZNV B;  3JSV B;  5LLI A;  2XK5 B;  1RAX A;  4G3X B;  4NAW A;  3N30 A;  2KHW B;  5IAA C;  5AZH A;  1WZ3 A;  2N9E B;  4AJY B;  4MJS B;  2A4Z A;  4IG7 B;  4GSW A;  3PLV A;  4HPM B;  4MM3 A;  2LUE A;  4NNJ B;  4HXD A;  4ZRJ A;  1SIF A;  1GUA B;  1GC6 A;  4ANW A;  2ZJD A;  3PT2 B;  2FCQ A;  3DDC B;  2KC1 A;  2KMC A;  1KLV A;  3MHS D;  2MQJ A;  2L05 A;  2MBB B;  2ZVN A;  1Y8R C;  4FJV B;  3L0W B;  4ICU A;  2J0M A;  3N32 A;  5EDS A;  2LZ6 A;  2BKR B;  1WGY A;  3SDL C;  2KJH B;  1V5T A;  1WX8 A;  2O6V B;  4MGZ E;  4BBN C;  2RR9 A;  3H7P B;  1GC7 A;  5JHB A;  3Q3F A;  1C3T A;  2G4D B;  5DPS A;  1M94 A;  1A5R A;  4ANX A;  2EKE C;  4URK A;  1E8X A;  1IYF A;  4FA6 A;  4JIO U;  4IM3 A;  2KMA A;  3U8Z A;  4DK5 A;  1XD3 B;  5E6N A;  3MTN B;  4EOY A;  1WH3 A;  4EZJ A;  2KLC A;  4KDL B;  2JRI B;  4ANU A;  1SE9 A;  4BOS C;  2D11 A;  2KWC A;  4MDK E;  1R4N I;  3X0W A;  1RFA A;  1TZ1 A;  2MP2 A;  1E7V A;  2O6V A;  4E3C A;  4DDI D;  3ALB A;  5LXI B;  4W9E A;  3ZNG C;  2AWT A;  1J19 A;  4WWP A;  4HJK A;  3VAW A;  2OOB B;  4OVV A;  2KK8 A;  3TCA A;  2JY6 A;  3V62 A;  3WAM A;  3RZF A;  4KZC A;  1EO6 A;  4ZRK A;  2M17 A;  2M8S A;  3A9J B;  3JVZ X; 
#chains in the Genus database with same CATH topology
 4WJP A;  4GXB A;  1NYR A;  4IDI A;  3UI3 A;  3OLM D;  2ZCB A;  3AE9 B;  1HEZ E;  4EUT A;  1Y56 A;  2D3B A;  2N1V A;  2XEW A;  2RD0 A;  1C1Y B;  3H6N A;  1N61 A;  3AB5 A;  2I1K A;  1P7F A;  2MWS B;  3C0R B;  2LFI A;  1TGZ B;  1SGH A;  1K52 A;  1TTN A;  2QDF A;  1F9J A;  4LNI A;  2RPV A;  1VZ8 A;  5JZE B;  3TEY A;  1OGW A;  2JF5 A;  2KO3 A;  1YQB A;  5H8Y E;  1TYG B;  2PPH A;  3UF8 A;  5JH5 C;  3P4P B;  4DBG A;  5FK9 C;  2NBU A;  3CF6 E;  5HI1 A;  3N9Y C;  3QK0 A;  2NPT B;  3A4S C;  3K9O B;  1YQ3 B;  3UIO B;  2D3G A;  4FBJ B;  1NI3 A;  1TKY A;  1XLP A;  2KJR A;  4E74 A;  3I5J C;  3DPD A;  1Z2M A;  1WI0 A;  1I42 A;  4DWF A;  3L10 B;  1AYF A;  2GBN A;  3PVL A;  3U4E G;  4EKU A;  4F7Z A;  4CQN A;  3PRP B;  1F52 A;  1MVK A;  5AEK B;  1FEH A;  2NS5 A;  3R2I A;  2KOX A;  2KDI A;  1BML C;  1OQY A;  2BQQ A;  4Q2J A;  1HTQ A;  3AM9 A;  2KKC A;  1ZXH A;  2LGI A;  3GE8 C;  3PPA A;  1PGA A;  3DQV A;  5DPT A;  2JXX A;  1NYQ A;  2DHZ A;  2PE9 A;  2K8B A;  1DOY A;  2H89 B;  2BS2 B;  3W2D A;  2K25 A;  2BS4 B;  5CHF A;  1IP9 A;  3W1S C;  1E0Z A;  4IUM B;  4WWO A;  4ARI A;  3GS2 A;  3L54 A;  2W3S A;  2LGX A;  5FR6 A;  3I9V 1;  2HJ1 A;  2DAJ A;  2K8H A;  3PTF C;  1CJE A;  3Q6B A;  2WU5 B;  4KKI A;  1L0X B;  1P98 A;  2WNM A;  3VH3 B;  4P7I A;  4MAC A;  2WXI A;  2Y5C A;  3NS1 A;  2ZVO A;  3U7Z A;  1AAR A;  2DNF A;  3NVV A;  4W9K A;  2BBC A;  1V8C A;  4M8N A;  2WXQ A;  3I57 A;  1RLF A;  3ZJT A;  2KD0 A;  4GGQ A;  4QAY A;  4PYZ A;  5IA7 A;  3DCG A;  2EMT A;  4JLC A;  1D6E C;  4DHZ E;  3AE8 B;  2C60 A;  2KTF A;  2H88 B;  4N58 A;  3RN9 C;  4LDT B;  2KC2 A;  1MHX A;  2KFK A;  1YX5 B;  1V49 A;  2UYZ B;  2OJR A;  4XGA B;  2J7Q B;  1Q5W B;  4FUL A;  4B0M A;  4WQO B;  3B2F A;  4R3D A;  3V05 A;  4WUR A;  3VUY A;  4II3 B;  2B3A A;  3O65 B;  4IWO A;  4L1B A;  1R4M B;  2PLP A;  5TR5 A;  5BYS A;  2MBH A;  2MJ3 A;  3DWG C;  4TUU A;  2N9P C;  1IGD A;  3ZDM C;  4XC2 A;  3P2B A;  1T0S C;  2MBO A;  2AYO B;  4K3B A;  2LVP A;  4DXA B;  1FNW A;  2LJ5 A;  1C76 A;  3C8Y A;  3DBR B;  1A70 A;  2WXJ A;  2INC C;  2DLB A;  2C5L C;  2JSV X;  4RGT A;  2L32 A;  3PV1 A;  1ET9 A;  4YWG G;  4OHJ A;  4NY0 A;  3M95 A;  3AEE B;  1WGR A;  3RD2 A;  3T8M A;  2FIF A;  4ZRI A;  3L13 A;  5AUI A;  3GOE A;  2M1M A;  4E71 A;  2CHZ A;  4HEA 1;  4B9K A;  3N3K B;  2ONQ A;  3BZD B;  2PMV A;  4NJ7 A;  1IGC A;  2OED A;  3EFU A;  1TS5 A;  1T5X D;  3IBE A;  1IPG A;  2FUH B;  1TKE A;  1FCC C;  1JWS D;  2EEL A;  3A9K A;  3PSE B;  1ZDX A;  3RPF C;  3V61 A;  5E6J A;  4YTN B;  5C23 A;  4XYC A;  4BBN F;  2PVO D;  2SEB D;  2G4S A;  2WXN A;  5KHQ A;  1FXT B;  3NS8 A;  2GOW A;  4N9F 4;  1EU3 A;  4NJC A;  1UNS A;  1L7Y A;  2N7J A;  5J17 A;  1UBQ A;  3RMK C;  1E7P B;  4MGK E;  1I4H A;  2WXO A;  1V80 A;  2JPH A;  5D6J B;  1HZ6 A;  2YEP F;  1HTO A;  4FLH A;  4MGY E;  2PE6 B;  3RNC C;  2BYF A;  3E9S A;  1V1P A;  2UWQ A;  5J2R A;  2LGY A;  3Q2A C;  5D7G A;  3ZRC A;  4FHK A;  2L83 A;  2IPK D;  3A1Q A;  4FJY A;  4REZ A;  3RNA C;  3ZGZ A;  2WGS A;  1PGX A;  2DYM A;  2NBV B;  1OQQ A;  2KAC A;  2AEH A;  4HRO A;  1T0Q C;  4CHK A;  2ZPY A;  3TUO A;  2W3R A;  1K8R B;  1JRU A;  2WDT B;  1TZO A;  5AZG A;  4MH8 A;  2ON8 A;  3SR6 A;  4NQL B;  2QIE B;  4YSY B;  2BW2 A;  2M19 A;  5KHO A;  4N6E B;  2N7D A;  4MSM B;  4AP4 C;  3ONS A;  1P0R A;  2MH7 A;  4AWJ A;  1QLB B;  3KYC D;  2LAS A;  3LXF A;  1ZDV A;  1I4R A;  1WGG A;  3Q8F A;  3PLU A;  4FAD A;  5TSS A;  3KLS X;  1SXT A;  3VRB B;  3APD A;  3TEZ A;  1WJN A;  2ZNV B;  2XK5 B;  4JWS C;  5I4D A;  4G3X B;  2WXL A;  2LHD A;  5IO9 A;  3RFZ B;  4AJY B;  2V0G A;  2A4Z A;  4GSW A;  2L1A A;  1NEK B;  1WXQ A;  4MM3 A;  2LUE A;  2QIL A;  4ANW A;  2KC1 A;  1KLV A;  3MHS D;  4FJV B;  1KF6 B;  1Y8R C;  1QOG A;  5EDS A;  2LZ6 A;  3SDL C;  2AQ3 B;  2KJH B;  1WX8 A;  4MGZ E;  1SSN A;  1C3T A;  2G4D B;  1JQ4 A;  1A5R A;  2EKE C;  2WXH A;  1I4P A;  4FA6 A;  5E6N A;  1NVI D;  1ZOY B;  3N1X C;  1SE9 A;  5EE0 A;  4MDK E;  2PW9 A;  1KRH A;  3AEB B;  4E3C A;  1VJK A;  1CQV A;  1J7C A;  1VRA B;  3ZJV A;  1J19 A;  4WWP A;  4OVV A;  5HFY A;  5BYR A;  3JVZ X;  3QA8 A;  2DYB A;  2KX0 A;  2WYQ A;  3W1Y A;  3CIR B;  2Z0E B;  1GB4 A;  4EZK A;  2JZP A;  2Z8L A;  3ZUN A;  3SHQ A;  4D2K A;  4A9A A;  3SD5 A;  4PK1 A;  3BK1 A;  4ZDV A;  2LXC A;  2KQ4 X;  1DOX A;  4EE2 A;  1U4A A;  2WDR B;  1D4B A;  3W5U B;  3NZS A;  3BVG A;  2BYE A;  3B2G A;  1UBI A;  4HRS A;  4AJW A;  1H4R A;  4XDD A;  4XZ4 A;  1UWM A;  1WE7 A;  1JW9 D;  3N1Z C;  2K1F A;  3VUX A;  2G1E A;  4LK0 M;  4IC7 B;  4FXC A;  1ZPS A;  4HDO A;  1XO3 A;  4OZA A;  2WX0 A;  1K53 A;  2KWU B;  2ZPN A;  1E90 A;  4BAX A;  2R61 A;  4BKS A;  4AOF A;  3O13 A;  2MJE A;  4CYE A;  1DYQ A;  2V4L A;  1MG4 A;  3IVF A;  1WGK A;  4GMV A;  2WX1 A;  2V9H A;  2M4N A;  4IW0 A;  3M63 B;  4HJG E;  2HTM E;  4NAM A;  1WFY A;  1C78 A;  3JW0 X;  1ISN A;  1ACC A;  5D3D A;  1JRP A;  4NPN A;  1E8W A;  2IY1 B;  1LXD A;  4PYU A;  1CZP A;  3QX1 A;  2LRW A;  3T9L A;  3ZJU A;  4W9J A;  2O2V A;  2K6D B;  1DGJ A;  2JYT A;  3RZW C;  2HE7 A;  1E8Y A;  2YLM A;  2KQ7 A;  3V60 A;  4YSZ B;  4W9H A;  2GI9 A;  1P1A A;  3T3O A;  1J8C A;  1C4C A;  1SJH D;  2BWE S;  1UF0 A;  2LXA A;  3NVZ A;  1FRR A;  4IM2 A;  4LJP B;  3NVW A;  4WWN A;  1KH0 A;  4KIK A;  3V6E B;  1TS2 A;  3MP9 A;  1FCL A;  4YL8 A;  4WJN A;  5CHV C;  3NOB A;  3ZTC A;  3Q3J A;  4K3C A;  1BT0 A;  5DCN A;  3NZU A;  3H8H A;  2DYO A;  1YJ1 A;  2BTE A;  3BIN A;  5LNK 1;  2IBI B;  4K7U A;  1L4D B;  3EC8 A;  1IBX B;  4LJO B;  3QJZ A;  2RDH A;  3PHW B;  2R2Q A;  3L08 A;  2NCN A;  3LJ3 A;  1R7S A;  2N7E A;  2BB5 A;  3OJ3 A;  1TY0 A;  4M00 A;  2INP E;  1QQR A;  1PQS A;  1WWT A;  1JWA D;  5DPR A;  2DBY A;  1XQQ A;  4KGR A;  3BY4 B;  4DXG A;  4GDK A;  4MEM A;  1GB1 A;  4I6N B;  1WXA A;  4WQM A;  1PDX A;  3T3N A;  5D94 A;  2KFK B;  3Q69 A;  5G5H A;  5HHD G;  2CKH B;  5IKC M;  1WRI A;  3H7S A;  2W9N A;  2K8C A;  4YTM B;  5T8I A;  2DWQ A;  3TL5 A;  1WJ4 A;  5BO4 B;  5HG2 A;  1WXS A;  1GOZ A;  1OQR A;  2DZM A;  3OWE B;  3BVZ A;  3R3M A;  2MJD A;  3URY A;  1WYW B;  3PZ7 A;  1R4N B;  2REX A;  1WGH A;  2GBJ A;  4EEW A;  3A9J A;  1TY2 A;  4II2 B;  1YJI A;  3ML8 A;  1E6E B;  3BYT B;  2V3P A;  3MC9 A;  4TQ0 A;  2C7H A;  2KX3 A;  4TMA B;  2CHW A;  4K7W A;  1WXM A;  2IJ0 A;  4C56 C;  1WGD A;  2KTR A;  2KJ6 A;  4BOZ B;  4A20 A;  3IG3 A;  2IZV B;  3OJ4 B;  1N5W A;  2KT7 A;  1E8Z A;  4BKT A;  3VUW A;  1GNU A;  1L0Y B;  3OG5 A;  1WYG A;  4NJ6 A;  4KKJ A;  4AUQ C;  1HXY D;  1NI2 A;  4GU2 A;  4YTP B;  1I35 A;  1AWD A;  4OZC A;  1TIF A;  2N1W A;  2JZ3 B;  1JRO A;  3PRM B;  2X8X X;  3ZIM A;  1SJE D;  2KZR A;  4A6Q A;  2BPS A;  2KXJ A;  3P4R B;  3HRD D;  3W1S A;  5EE1 A;  3K9P B;  3AEG B;  4KVG B;  2VRR B;  2KWV B;  2W82 A;  3QHT A;  3AE3 B;  3PHX B;  1WR1 A;  3AU4 A;  4LNN A;  3KUC B;  1NEN B;  2DEN B;  2RSU A;  3WAL A;  4C80 A;  1EUV B;  4TKN A;  3I3T B;  3KYD D;  4WJQ A;  2L52 A;  4XWT A;  2N4F A;  3NJT A;  2WXM A;  2DAF A;  1XXG A;  3MHZ A;  3AXC A;  4I6L B;  5J18 A;  2E3T A;  4PS7 A;  1WY8 A;  2WP9 B;  1KOT A;  1YQ4 B;  1Q10 A;  4O1N A;  5FKA C;  1L6V A;  1P3Q U;  1T6B X;  3TBL D;  3WAO A;  3R2T A;  3AE7 B;  3U52 E;  4A3O A;  4FHJ A;  3IHP C;  3V6C B;  3KVF B;  2ZZP B;  3VVW B;  1EWY C;  1WRD B;  2RPQ A;  4BZA A;  2Y5P A;  2NPT A;  1ZKH A;  3KUZ A;  1OFF A;  3E56 A;  2KN5 A;  4KZ0 A;  1WM3 A;  1V81 A;  4GIV A;  2PJH A;  2MBQ A;  2IO1 B;  2MCN B;  2UU7 A;  4YT0 B;  3RNF C;  2AL6 A;  4I6P A;  1WE6 A;  3LDZ E;  3CWI A;  3ETR A;  1XLQ A;  1UUP A;  3FC4 A;  1RAX A;  1ZP0 B;  1XLN A;  3GP7 A;  5AZH A;  2BVC A;  3PLV A;  2N9K A;  4HXD A;  1SIF A;  4DQO C;  1GC6 A;  2ZJD A;  3HVD A;  2LMC A;  2LHE A;  2KMC A;  1ZUD 2;  4US9 A;  5G5G A;  2D3C A;  3NRZ A;  3L0W B;  2WU2 B;  3N32 A;  1SIJ A;  1WGY A;  4KGT A;  1ROE A;  4ANX A;  4URK A;  1I4Q A;  1V97 A;  4IM3 A;  3ZXV A;  4HPP A;  4EZJ A;  2KLC A;  2JRI B;  3SFE B;  4BOS C;  2WDV B;  2K0P A;  3X0W A;  1MPE A;  2OHF A;  2MP2 A;  3BVM A;  3ALB A;  2GLS A;  4W9E A;  4USA A;  3VAW A;  2KK8 A;  3TCA A;  3J9C A;  3V62 A;  3WAM A;  3RZF A;  3A9J B;  1JCK B;  3DBL B;  4HWI B;  2YEP B;  1DOI A;  3S2A A;  2B76 B;  2D10 A;  1ESF A;  1ZE3 D;  4HKQ A;  4MGI E;  5BYQ A;  4ARC A;  2KDF B;  3JYU A;  3PRZ A;  1YIW A;  1QZE A;  2HJ8 A;  4C7Z A;  3FAH A;  1VR9 A;  3HHM A;  2JT4 B;  3QCA A;  2IGH A;  4G0N B;  1F0Z A;  3L16 A;  3UIN B;  2QSD A;  3VR8 B;  1L0V B;  2R2O A;  4LCD E;  3A4R A;  3DBS A;  3Q8E A;  2BWF A;  4MSQ B;  1Z5S B;  2MEK A;  5BMH A;  1MJD A;  2PTL A;  4RM9 A;  4JQW C;  1RYJ A;  3L4P A;  4J6I A;  3B08 A;  1SF0 A;  1VLB A;  3NZ3 A;  2DZJ A;  4C7Y A;  1PFD A;  4ZHP A;  3PZ8 A;  4IM0 A;  4KSK C;  1XCQ L;  2BYT A;  1CK1 A;  1LFD A;  2KLG A;  1L5P A;  3SFD B;  4MM3 B;  4XDC A;  3Q3N C;  2O6V D;  4ANV A;  2C7N B;  3GE3 C;  2W55 A;  3R7R A;  1JWM D;  4P6V F;  4KX6 B;  3UQB A;  3NY5 A;  3APF A;  3LYY A;  4ZYN A;  4PS3 A;  3SEB A;  1V1P B;  3CST A;  3AEA B;  1XF5 L;  3AE6 B;  1MI0 A;  2N9L A;  2RDG A;  3EGR A;  1STE A;  2DZK A;  3LB8 C;  2KN4 A;  1FIQ A;  3KWL A;  1TKG A;  1C9F A;  4WWM A;  1LM8 B;  1XLO A;  2WQY B;  2N9X A;  2CU1 A;  3RNG C;  1UWX A;  3ZNZ B;  3UQA A;  2CHX A;  1F2R C;  2BT6 A;  4IWQ A;  1PUT A;  3PZD A;  1B1Z A;  5MPO A;  1SBB B;  1TS4 A;  2LGS A;  3Q8C A;  3P1M A;  4WAF A;  3VTW A;  2HD5 B;  2VZK D;  1KM7 A;  3ML9 A;  1KLU D;  4C4V B;  1P7E A;  3PS6 A;  2NMQ A;  2O2V B;  1E9M A;  2JZZ A;  3Q14 C;  3DHG C;  1YD8 U;  2RGF A;  2IND C;  2D2Q A;  4P1C C;  4ITK A;  3VRA B;  2KFJ A;  1FMA D;  1E5W A;  3ZRF A;  2LVQ A;  3AEC B;  2WXG A;  5BMG A;  3D32 A;  3EA6 A;  5C2T B;  2JU6 X;  3HM3 A;  2ICI A;  5DPW A;  2JUO A;  2KDM A;  2PEA A;  2WXP A;  2LUM A;  1C79 A;  5G2N A;  4RGN A;  1YN3 A;  4JWU C;  3M62 B;  2W54 A;  2FNJ B;  1C4P A;  3JSV A;  2J52 A;  2K39 A;  3TJP A;  4DHJ D;  3AI5 A;  4W9L A;  3KH0 A;  3BII D;  2V3S A;  1BXT A;  2EKI A;  2WHI A;  3GB1 A;  1GG3 A;  2GBK A;  1VD2 A;  2FE8 A;  5JXV A;  3RUL A;  1QF6 A;  4KSL C;  1HZ5 A;  3ZXR A;  1L6U A;  1QKZ A;  4F8C B;  2RDB C;  2Q5W D;  5D3I B;  3U7D A;  4DDG D;  1D5X C;  1N5X A;  4F1S A;  2ZW1 A;  4W9D A;  1HA5 A;  3DVG Y;  1YX6 B;  1VCB A;  2N0S B;  2KAJ A;  1PYW D;  4IKG A;  3RYT A;  3VTV A;  2BS3 B;  1FM0 D;  5AUK A;  2LVO A;  3QQ8 B;  4RMA A;  3KW5 B;  3KWV A;  3RNE C;  3VQI A;  3R66 C;  3VH4 B;  4KGS A;  3Q3M C;  1WJ6 A;  3KUD B;  4FJZ A;  1FRD A;  1V5O A;  1G6J A;  4NZL B;  1NDD A;  4A55 A;  3AH7 A;  3ECI A;  4OZB A;  2KDB A;  3AUL A;  3PO0 A;  1F2R I;  4FN2 A;  2GBR A;  1SE4 A;  2G9H D;  4RM8 A;  3DBL I;  5L83 A;  4EFO A;  4MEL A;  4BFR A;  1WR6 E;  3EFC A;  2XN9 C;  2V4I B;  3CSF A;  4JGH B;  2DX5 B;  2FCS A;  1UZX B;  3OAW A;  1BUI C;  1LGR A;  2LEK A;  2IGG A;  3VTU A;  4GDL A;  2MW5 A;  2VH2 A;  4K81 A;  4WJO A;  1GPX A;  1QOF A;  1N60 A;  2NBW B;  4A3P A;  4LTU A;  4TSS A;  2LD9 A;  2D3A A;  2IGD A;  3RCZ A;  4H2A A;  1WX9 A;  2QC8 A;  1FPY A;  2WLB A;  3MJW A;  3QWZ B;  1RFK A;  2JWU A;  4W9I A;  2Y5B B;  1F1H A;  2E6X A;  1ZXI A;  4M0W B;  1ENF A;  1ZW7 A;  2FCM A;  3DHH C;  1VDV A;  1YN5 A;  1L4Z B;  1FXI A;  3QIJ A;  2MSE D;  2ZW0 A;  1FXA A;  1AN8 A;  2CR5 A;  1QIL A;  4RGO S;  3RT3 B;  1HQR D;  3AE2 B;  1K51 A;  3A33 B;  2I1J A;  1CMX B;  4M8M A;  3L17 A;  1TT5 B;  2MBE A;  3NUH B;  4UDU C;  2AL3 A;  2MLB A;  5BMI A;  3Q8B A;  1X1M A;  2Z59 B;  2WXR A;  2C9W B;  1R4M I;  2FUG 1;  3AU5 A;  3A1Q B;  4S17 A;  1I7H A;  2KDE B;  1UH6 A;  2V1Y A;  2KMM A;  3PGE A;  2MHJ A;  3V3X A;  3ZVV A;  3EHV A;  1V9J A;  3RNB C;  1SB3 C;  4RF0 A;  2AX5 A;  5IAA C;  4RH6 A;  1I4G A;  1WZ3 A;  2N9E B;  4JPS A;  1JWB D;  1YNT E;  4MJS B;  4IG7 B;  3ABV B;  3VR9 B;  4HPM B;  4NNJ B;  1SEB D;  3EUB 2;  4ZRJ A;  2NTT A;  2MQJ A;  2L05 A;  2ZVN A;  3BYY B;  4P16 A;  1V5T A;  2CJN A;  2O6V B;  1E10 A;  4BBN C;  2RR9 A;  1C77 A;  1GC7 A;  5JHB A;  2X38 A;  2K3U A;  1E8X A;  4JIO U;  2KMA A;  3U8Z A;  1XD3 B;  3MC8 A;  4A8X C;  4KDL B;  3DBH B;  1KTK A;  4ANU A;  2GB1 A;  1RFA A;  1TZ1 A;  1E7V A;  3P4Q B;  4B0E A;  2D5G A;  3MJ5 A;  4ZRP A;  1SE2 A;  2JY6 A;  4HKZ E;  2M17 A;  2M8S A;  4K1R B;  1MHH E;  4ZHO A;  4ZOH C;  4WH4 A;  3TMP B;  4IOI E;  3ZDT A;  4X57 B;  3IT4 B;  1S3S G;  1N63 A;  2M0A A;  3AEF B;  4JE3 B;  3R7Q A;  5CTR C;  4GDK B;  3GZN I;  2K9X A;  4N59 A;  4DXF A;  2WS3 B;  2MX2 A;  5E6O A;  4C00 A;  1QOB A;  3IAS 1;  4ZYS A;  2HDE A;  4PT5 A;  2VZK B;  4L2Y A;  1IBX A;  4OVZ A;  4RNA A;  4C4V A;  2K22 A;  1V2Y A;  2LGD A;  3UGB B;  1K50 A;  4M0W A;  3ZTD A;  3H9D A;  2L7R A;  4G11 A;  2L0T A;  4W9G A;  5H92 C;  1PGB A;  3HUI A;  2K5P A;  3P63 A;  5C3J B;  1LO5 D;  2ASQ A;  4US8 A;  3IAM 1;  2LWP A;  1D5Z C;  1WMH A;  2OJW A;  1Q0W B;  2IDY A;  3P42 A;  4KIK B;  2LI5 A;  5GMV A;  3ZW3 A;  1ET6 A;  1FO4 A;  1KJT A;  3WA0 A;  5E6P A;  3DWM A;  1J7A A;  1M4V A;  1V6E A;  4RGM A;  1OEY A;  3W5V B;  2KVR A;  1WF9 A;  1FFU A;  1OEY J;  1N6Z A;  1YN4 A;  1YJJ A;  1ZGU B;  3TIX A;  4RFB A;  3FIL B;  4DHJ B;  5EE9 A;  4LNK A;  3RI7 C;  3TSS A;  3DVN V;  3AV8 A;  3ZQ4 A;  4B6W A;  1MG8 A;  1UGM A;  2L8J A;  4TQ1 A;  1N62 A;  2NVU I;  4YXD B;  4K7S A;  1YMH E;  4B95 A;  1I4X A;  1MFW A;  1JWU D;  2JWZ A;  2PVG C;  3EEC A;  2IYD B;  2G3Q B;  1YOV B;  4KDI C;  2GMI C;  2WDQ B;  3R8B A;  3ZLZ A;  2A5U A;  2K6Q A;  3APC A;  2M56 B;  2GBM A;  4XX5 A;  5HKH A;  4MT5 A;  3DVN U;  1WJU A;  4BKS D;  3QAQ A;  1E7U A;  4YSX B;  2BB6 A;  2LRU A;  1V1O A;  2KAN A;  5JHA A;  2NTS A;  1UEL A;  3M3J A;  2M0X A;  1NBF C;  3P4S B;  3Q8A A;  4BKG A;  1Q1O A;  2RMM A;  3W9C B;  3B0A A;  1KLG D;  1TJE A;  4OVU A;  2L76 A;  2XNA C;  3WIM A;  1GJZ A;  3ENE A;  4BVU C;  2CJO A;  1RM6 C;  4WIP A;  3KQ4 A;  2IO0 B;  1P9D U;  1FNU A;  2CU3 A;  1T3Q A;  2L3Z A;  4NQK E;  2Z0D B;  4XWW A;  1WSP A;  4DHZ B;  5LXH A;  2MP2 B;  2DZI A;  2BGF A;  3GZN B;  3DOW A;  1T0Y A;  3N20 C;  4W9F A;  1T0R C;  2QEJ C;  1V86 A;  2YVC A;  1HE8 A;  3I63 C;  3BK2 A;  3BWU D;  1WM2 A;  3HIZ A;  3TEX A;  4EZL A;  2FBW B;  4HCP B;  2I2Y A;  1WZ0 A;  3DBH I;  2ZEQ A;  2VH1 A;  2JRH A;  2D07 B;  2KTR B;  4HPL B;  4WAA A;  4JL9 A;  3WCQ A;  2AQ1 B;  3MC0 B;  5GXG B;  4GOC A;  4CO7 A;  2I38 A;  4ACF A;  1S1Q B;  1EM7 A;  2KNB A;  1LQB A;  1OTR B;  4MJS A;  4P1B C;  1AW7 A;  2J0J A;  2XBB C;  2EMS A;  3WAN A;  3VDZ A;  2MRP A;  4GB9 A;  3AED B;  4G50 A;  3ZNH B;  1RWS A;  2J53 A;  2L00 B;  1RRB A;  2J42 A;  1EF1 A;  1JML A;  2XK5 A;  4HCN B;  5IN7 A;  3CMM B;  1IUE A;  3H1U A;  4HLE A;  2J0K A;  2L0F A;  2KVZ A;  1VZ6 A;  4HK2 A;  4ICV A;  1KFY B;  4LLG M;  2FID A;  5CX3 A;  1D3Z A;  2MA9 B;  3HVZ A;  2WXF A;  4M02 A;  3NHE B;  1QOA A;  3AMZ A;  5CHW A;  1WIA A;  4GN1 A;  2KWD A;  3ZKJ C;  4GDL B;  4LDT D;  1FFV A;  4OW0 A;  1FD6 A;  3IXS A;  4NAW B;  5IP4 D;  4M01 A;  4S0R A;  2G45 B;  4KV2 A;  2PIA A;  2NR2 A;  4RF1 A;  4L23 A;  4HDQ A;  3UIP B;  2TSS A;  1TBE A;  5G55 A;  2ZCC A;  4RCO A;  3ZO5 B;  2JYE A;  3IFW B;  3QAR A;  1WX7 A;  2JVC A;  4W9C A;  1XT9 B;  3U30 A;  2KYW A;  4MH0 E;  4A90 A;  3VXW A;  5C1Z A;  3RUI B;  4ZRQ A;  4AS1 A;  4LNO A;  2IO2 B;  3WAP A;  2ZNV C;  2SAK A;  3HM6 X;  1J0G A;  2BKF A;  2HTH A;  3NG0 A;  2Y3A A;  1WXV A;  4IWP A;  4HVB A;  3AE5 B;  3AE4 B;  2JX5 A;  2J4X A;  4PS8 A;  3DVG X;  2CS4 A;  3ZNI D;  3B9J A;  4TV3 A;  2WXK A;  2C7M B;  2INN E;  2KQS A;  1J7B A;  2ACZ B;  2IY0 B;  2BYV E;  3B1L X;  1WMH B;  3U2S C;  2JXT A;  2QHO A;  3DBR I;  2PKO A;  1L2N A;  1XCT L;  4GLS C;  1QT9 A;  2IO3 B;  2QMT A;  5L95 C;  2FCN A;  3AE1 B;  1D5M C;  3IT6 B;  1UD7 A;  3PRE A;  2GRI A;  4ASW C;  3AN1 A;  3HK0 A;  2FAZ A;  3VHT C;  2JQR B;  2BF8 B;  1EWC A;  1XEE A;  5D2M B;  1SE3 A;  3FIL A;  5AZF A;  3SU8 X;  1C4A A;  1H8C A;  3H7P A;  3A9K B;  1EF5 A;  3QC8 B;  3NVY A;  5IOI A;  2WWZ A;  3VFK A;  2V3N A;  3FKY A;  3JSV B;  5LLI A;  1TS3 A;  3C19 A;  4NAW A;  3N30 A;  1UGJ A;  2KHW B;  4AQ7 A;  3Q3O C;  4J3O D;  2AQ2 B;  1F77 A;  1GAQ B;  1GUA B;  3PT2 B;  2FCQ A;  1EU4 A;  3DDC B;  1JAL A;  4JX1 C;  2MBB B;  4ICU A;  1B9R A;  2J0M A;  4XE0 A;  2BKR B;  2QCZ A;  3TEW A;  1FNV A;  3H7P B;  3Q3F A;  3MFG A;  5DPS A;  1M94 A;  4LNF A;  1IYF A;  4DK5 A;  3MTN B;  4EOY A;  1WH3 A;  3DHI C;  2D11 A;  2KWC A;  3ZYY X;  1R4N I;  2LJI A;  2O6V A;  5EE3 A;  4DDI D;  5LXI B;  2QJL A;  3ZNG C;  2AWT A;  4HJK A;  2OOB B;  5FR3 A;  4KZC A;  3N1Y C;  1EO6 A;  4ZRK A;  3X23 A;  1VZ7 A; 
#chains in the Genus database with same CATH homology
 3QA8 A;  4K1R B;  4WJP A;  4GXB A;  2DYB A;  2KX0 A;  2WYQ A;  4HWI B;  3W1Y A;  2Z0E B;  3TMP B;  3ZDT A;  4X57 B;  3S2A A;  4EZK A;  2D10 A;  3OLM D;  2ZCB A;  1S3S G;  3ZUN A;  4MGI E;  3SHQ A;  2KDF B;  3JYU A;  3PRZ A;  3R7Q A;  1YIW A;  1QZE A;  5CTR C;  4GDK B;  2HJ8 A;  3GZN I;  4EUT A;  3SD5 A;  3HHM A;  2JT4 B;  3QCA A;  2N1V A;  2XEW A;  4G0N B;  2MX2 A;  5E6O A;  4ZDV A;  3L16 A;  3UIN B;  2RD0 A;  1C1Y B;  3H6N A;  2R2O A;  2I1K A;  4LCD E;  2LXC A;  3A4R A;  2MWS B;  3DBS A;  3C0R B;  1TGZ B;  1SGH A;  1U4A A;  1TTN A;  2BWF A;  4MSQ B;  3NZS A;  1Z5S B;  1F9J A;  2BYE A;  1UBI A;  4AJW A;  1H4R A;  4RM9 A;  4JQW C;  4XZ4 A;  1V2Y A;  2LGD A;  5JZE B;  3UGB B;  1WE7 A;  3ZTD A;  1OGW A;  3H9D A;  4J6I A;  2JF5 A;  3B08 A;  2L7R A;  2K1F A;  4G11 A;  2KO3 A;  2L0T A;  4W9G A;  3VUX A;  4IC7 B;  2DZJ A;  1YQB A;  3X23 A;  4IM0 A;  2PPH A;  3UF8 A;  2ASQ A;  4HDO A;  4KSK C;  5JH5 C;  2WX0 A;  4DBG A;  2KWU B;  2NBU A;  2ZPN A;  1LFD A;  3CF6 E;  2KLG A;  1E90 A;  2LWP A;  4BKS A;  3QK0 A;  4AOF A;  2NPT B;  3A4S C;  1WMH A;  2O6V D;  4ANV A;  1Q0W B;  4CYE A;  2V4L A;  3K9O B;  3UIO B;  2C7N B;  2D3G A;  4FBJ B;  2KJR A;  4KIK B;  3IVF A;  4E74 A;  2LI5 A;  3R7R A;  3DPD A;  1Z2M A;  4GMV A;  1WI0 A;  2WX1 A;  5GMV A;  3ZW3 A;  3UQB A;  1I42 A;  1KJT A;  3WA0 A;  5E6P A;  4DWF A;  2M4N A;  3NY5 A;  4IW0 A;  3L10 B;  3M63 B;  2GBN A;  3PVL A;  1V6E A;  3APF A;  4ZYN A;  4EKU A;  1OEY A;  4F7Z A;  2KVR A;  3PRP B;  1WFY A;  5AEK B;  3JW0 X;  1WF9 A;  2NS5 A;  1ISN A;  1OEY J;  4PS3 A;  4NPN A;  1E8W A;  2IY1 B;  1LXD A;  1ZGU B;  2KOX A;  3CST A;  3QX1 A;  2LRW A;  2KDI A;  1OQY A;  4PYU A;  3TIX A;  4DHJ B;  2KKC A;  3T9L A;  4W9J A;  3PPA A;  2O2V A;  3DVN V;  2K6D B;  3DQV A;  2DZK A;  5DPT A;  2JXX A;  3RZW C;  2HE7 A;  1E8Y A;  2DHZ A;  2YLM A;  2KQ7 A;  3V60 A;  2PE9 A;  1MG8 A;  1UGM A;  2K8B A;  2L8J A;  4W9H A;  4B6W A;  1LM8 B;  4TQ1 A;  2N9X A;  2NVU I;  2K25 A;  4K7S A;  1P1A A;  2CU1 A;  5CHF A;  4B95 A;  1IP9 A;  1J8C A;  3W1S C;  2BWE S;  3ZNZ B;  3UQA A;  2CHX A;  2JWZ A;  2LXA A;  4IUM B;  3EEC A;  4IWQ A;  4WWO A;  2IYD B;  4IM2 A;  3PZD A;  2G3Q B;  4LJP B;  4KDI C;  2GMI C;  3L54 A;  2LGX A;  4WWN A;  5FR6 A;  4KIK A;  3ZLZ A;  2A5U A;  2HD5 B;  3VTW A;  3V6E B;  2K6Q A;  2DAJ A;  1KM7 A;  3APC A;  2K8H A;  4YL8 A;  3ML9 A;  2GBM A;  3PTF C;  4WJN A;  5CHV C;  4XX5 A;  5HKH A;  1P98 A;  3NOB A;  3ZTC A;  3Q3J A;  3VH3 B;  5DCN A;  1BT0 A;  3PS6 A;  3NZU A;  4P7I A;  2DYO A;  1YJ1 A;  3BIN A;  3DVN U;  1WJU A;  2O2V B;  2IBI B;  2ZVO A;  4BKS D;  2JZZ A;  3QAQ A;  4K7U A;  3EC8 A;  1E7U A;  4LJO B;  1YD8 U;  2LRU A;  1AAR A;  2RGF A;  4W9K A;  2KAN A;  5JHA A;  2D2Q A;  1UEL A;  3M3J A;  3QJZ A;  3PHW B;  2R2Q A;  2M0X A;  4M8N A;  3L08 A;  1RLF A;  2KD0 A;  2KFJ A;  4GGQ A;  1NBF C;  2NCN A;  3LJ3 A;  4BKG A;  1E5W A;  3ZRF A;  4PYZ A;  1Q1O A;  2LVQ A;  5IA7 A;  2N7E A;  3DCG A;  3B0A A;  3D32 A;  3OJ3 A;  2EMT A;  4JLC A;  4OVU A;  2L76 A;  3WIM A;  3HM3 A;  1GJZ A;  3ENE A;  4BVU C;  5DPW A;  2JUO A;  4DHZ E;  2PEA A;  2C60 A;  1PQS A;  5G2N A;  2KTF A;  2IO0 B;  1P9D U;  4LDT B;  3M62 B;  5DPR A;  4NQK E;  2KC2 A;  2L3Z A;  1XQQ A;  2KFK A;  2Z0D B;  1YX5 B;  1V49 A;  2UYZ B;  3BY4 B;  2OJR A;  4DHZ B;  5LXH A;  4GDK A;  2J7Q B;  2MP2 B;  2DZI A;  2BGF A;  1Q5W B;  4MEM A;  4I6N B;  4FUL A;  4WQO B;  2FNJ B;  1WXA A;  3JSV A;  3DOW A;  1T0Y A;  2K39 A;  3TJP A;  4W9F A;  4DHJ D;  3VUY A;  4II3 B;  3AI5 A;  2B3A A;  2KFK B;  3O65 B;  4IWO A;  3KH0 A;  4W9L A;  5D94 A;  2CKH B;  1V86 A;  2V3S A;  5TR5 A;  2YVC A;  3H7S A;  1HE8 A;  2MBH A;  2W9N A;  2K8C A;  4TUU A;  2N9P C;  1GG3 A;  1WM2 A;  2GBK A;  3ZDM C;  3TL5 A;  1WJ4 A;  5BO4 B;  3HIZ A;  4EZL A;  1VD2 A;  1WXS A;  4XC2 A;  3P2B A;  2DZM A;  3R3M A;  2MBO A;  4HCP B;  1WZ0 A;  2AYO B;  3DBH I;  3RUL A;  1WYW B;  2ZEQ A;  2LVP A;  4KSL C;  2JRH A;  4DXA B;  2D07 B;  2REX A;  1WGH A;  2LJ5 A;  2GBJ A;  2KTR B;  4HPL B;  4WAA A;  4JL9 A;  4GOC A;  4EEW A;  4F8C B;  3A9J A;  4II2 B;  4CO7 A;  3U7D A;  2C5L C;  1S1Q B;  4DDG D;  3PV1 A;  3ML8 A;  4F1S A;  4W9D A;  2KNB A;  1LQB A;  1OTR B;  4MJS A;  3DVG Y;  1YX6 B;  4NY0 A;  1VCB A;  4TQ0 A;  3M95 A;  2C7H A;  2J0J A;  2XBB C;  1WGR A;  2KX3 A;  3RD2 A;  3RYT A;  2CHW A;  3T8M A;  2EMS A;  2FIF A;  4K7W A;  4ZRI A;  1WXM A;  3L13 A;  3VTV A;  3WAN A;  3VDZ A;  1WGD A;  2MRP A;  2LVO A;  4GB9 A;  3GOE A;  2M1M A;  4E71 A;  3QQ8 B;  4G50 A;  2CHZ A;  3ZNH B;  2L00 B;  4B9K A;  1RRB A;  2KTR A;  2KJ6 A;  4RMA A;  1EF1 A;  3KW5 B;  4A20 A;  4BOZ B;  2XK5 A;  3IG3 A;  3N3K B;  3VQI A;  4HCN B;  3R66 C;  3CMM B;  2IZV B;  3OJ4 B;  3VH4 B;  3H1U A;  4NJ7 A;  1E8Z A;  4HLE A;  3EFU A;  4BKT A;  3VUW A;  2J0K A;  1WJ6 A;  2L0F A;  3KUD B;  4FJZ A;  1GNU A;  3IBE A;  4HK2 A;  1IPG A;  2FUH B;  4ICV A;  4NJ6 A;  2FID A;  5CX3 A;  1V5O A;  4AUQ C;  1D3Z A;  2MA9 B;  1NI2 A;  1NDD A;  1G6J A;  3ECI A;  3NHE B;  3A9K A;  2KDB A;  3PSE B;  4GU2 A;  5CHW A;  3V61 A;  1WIA A;  3AUL A;  4GN1 A;  1I35 A;  4FN2 A;  2GBR A;  5C23 A;  3ZKJ C;  4BBN F;  4GDL B;  4LDT D;  2N1W A;  4RM8 A;  3DBL I;  2G4S A;  5KHQ A;  4NAW B;  4EFO A;  5L83 A;  1FXT B;  3NS8 A;  2GOW A;  2JZ3 B;  2G45 B;  4N9F 4;  3PRM B;  4MEL A;  4KV2 A;  2NR2 A;  3ZIM A;  4HDQ A;  4BFR A;  1L7Y A;  1WR6 E;  3UIP B;  1UBQ A;  1TBE A;  5J17 A;  2KZR A;  2BPS A;  5G55 A;  3CSF A;  4JGH B;  2KXJ A;  3W1S A;  4MGK E;  2ZCC A;  3K9P B;  2DX5 B;  1V80 A;  2JPH A;  5D6J B;  3ZO5 B;  2FCS A;  4KVG B;  2VRR B;  2KWV B;  4FLH A;  3QHT A;  1UZX B;  3OAW A;  4MGY E;  2PE6 B;  3IFW B;  3QAR A;  1WX7 A;  2JVC A;  3VTU A;  2BYF A;  4W9C A;  4GDL A;  3PHX B;  2MW5 A;  1XT9 B;  1WR1 A;  2UWQ A;  3U30 A;  4K81 A;  4MH0 E;  5J2R A;  2LGY A;  3AU4 A;  4WJO A;  3KUC B;  3VXW A;  2NBW B;  5C1Z A;  2DEN B;  4A3P A;  5D7G A;  3ZRC A;  4FHK A;  3RUI B;  2LD9 A;  2RSU A;  3WAL A;  1EUV B;  4TKN A;  3I3T B;  3A1Q A;  3KYD D;  4FJY A;  4WJQ A;  3RCZ A;  1WX9 A;  2DYM A;  3MJW A;  3QWZ B;  2N4F A;  2IO2 B;  2NBV B;  4W9I A;  3WAP A;  2DAF A;  2Y5B B;  2ZNV C;  3HM6 X;  1J0G A;  2AEH A;  2BKF A;  4M0W B;  3AXC A;  4I6L B;  1ZW7 A;  2HTH A;  2FCM A;  5J18 A;  4PS7 A;  1WY8 A;  1WXV A;  1KOT A;  4IWP A;  4HVB A;  4CHK A;  2ZPY A;  4PS8 A;  3QIJ A;  1P3Q U;  1K8R B;  2MSE D;  1JRU A;  2CS4 A;  3DVG X;  3ZNI D;  2WDT B;  4TV3 A;  3TBL D;  3WAO A;  2CR5 A;  3RT3 B;  2C7M B;  4A3O A;  5AZG A;  2KQS A;  4FHJ A;  2IY0 B;  2BYV E;  3A33 B;  3B1L X;  3IHP C;  1WMH B;  2I1J A;  3V6C B;  1CMX B;  2QHO A;  3KVF B;  2ZZP B;  3DBR I;  4NQL B;  4M8M A;  3L17 A;  1L2N A;  2MBE A;  3VVW B;  1WRD B;  2IO3 B;  5L95 C;  2RPQ A;  2FCN A;  5KHO A;  2N7D A;  2NPT A;  1ZKH A;  2AL3 A;  3KUZ A;  2MLB A;  4MSM B;  4AP4 C;  1UD7 A;  2KN5 A;  3ONS A;  4KZ0 A;  1P0R A;  3PRE A;  1WM3 A;  4AWJ A;  4ASW C;  1V81 A;  3HK0 A;  2PJH A;  4GIV A;  3KYC D;  2MBQ A;  2FAZ A;  1X1M A;  2IO1 B;  2Z59 B;  2LAS A;  3VHT C;  2MCN B;  2BF8 B;  2C9W B;  1R4M I;  3AU5 A;  5D2M B;  3A1Q B;  2KDE B;  1WGG A;  5AZF A;  2AL6 A;  3SU8 X;  3PLU A;  4I6P A;  4FAD A;  1UH6 A;  1WE6 A;  2V1Y A;  3LDZ E;  3PGE A;  1H8C A;  3H7P A;  3A9K B;  1EF5 A;  3QC8 B;  3ZVV A;  3APD A;  3EHV A;  2WWZ A;  1V9J A;  3VFK A;  1WJN A;  2ZNV B;  3JSV B;  5LLI A;  2XK5 B;  1RAX A;  4G3X B;  4NAW A;  3N30 A;  2KHW B;  5IAA C;  5AZH A;  1WZ3 A;  2N9E B;  4AJY B;  4MJS B;  2A4Z A;  4IG7 B;  4GSW A;  3PLV A;  4HPM B;  4MM3 A;  2LUE A;  4NNJ B;  4HXD A;  4ZRJ A;  1SIF A;  1GUA B;  1GC6 A;  4ANW A;  2ZJD A;  3PT2 B;  2FCQ A;  3DDC B;  2KC1 A;  2KMC A;  1KLV A;  3MHS D;  2MQJ A;  2L05 A;  2MBB B;  2ZVN A;  1Y8R C;  4FJV B;  3L0W B;  4ICU A;  2J0M A;  3N32 A;  5EDS A;  2LZ6 A;  2BKR B;  1WGY A;  3SDL C;  2KJH B;  1V5T A;  1WX8 A;  2O6V B;  4MGZ E;  4BBN C;  2RR9 A;  3H7P B;  1GC7 A;  5JHB A;  3Q3F A;  1C3T A;  2G4D B;  5DPS A;  1M94 A;  1A5R A;  4ANX A;  2EKE C;  4URK A;  1E8X A;  1IYF A;  4FA6 A;  4JIO U;  4IM3 A;  2KMA A;  3U8Z A;  4DK5 A;  1XD3 B;  5E6N A;  3MTN B;  4EOY A;  1WH3 A;  4EZJ A;  2KLC A;  4KDL B;  2JRI B;  4ANU A;  1SE9 A;  4BOS C;  2D11 A;  2KWC A;  4MDK E;  1R4N I;  3X0W A;  1RFA A;  1TZ1 A;  2MP2 A;  1E7V A;  2O6V A;  4E3C A;  4DDI D;  3ALB A;  5LXI B;  4W9E A;  3ZNG C;  2AWT A;  1J19 A;  4WWP A;  4HJK A;  3VAW A;  2OOB B;  4OVV A;  2KK8 A;  3TCA A;  2JY6 A;  3V62 A;  3WAM A;  3RZF A;  4KZC A;  1EO6 A;  4ZRK A;  2M17 A;  2M8S A;  3A9J B;  3JVZ X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...