1BUIC

Structure of the ternary microplasmin-staphylokinase-microplasmin complex: a proteinase-cofactor-substrate complex in action
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
122
structure length
122
Chain Sequence
b'ASYFEPTGPYLMVNVTGVDSKGNELLSPHYVEFPIKPGTTLTKEKIEYYVEWALDATAYKEFRVVELDPSAKIEVTYYDKNKKKEETKSFPITEKGFVVPDLSEHIKNPGFNLITKVVIEKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Plasminogen
publication title The ternary microplasmin-staphylokinase-microplasmin complex is a proteinase-cofactor-substrate complex in action.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 15
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 1998-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02821 Staphylokinase Staphylokinase/Streptokinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.130 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1buiC00
1SSNA 1C77A 1C79A 2SAKA 1C78A 1C76A 1BUIC
chains in the Genus database with same CATH superfamily
1WJNA 1YJIA 3C0RB 3W5VB 5C3JB 2KTRB 4WIPA 5GMVA 4BKTA 3AE2B 1D4BA 1E9MA 3V60A 3ZKJC 4ZHOA 1L4DB 4S0RA 1V49A 4NNJB 1F9JA 5HI1A 1SJHD 3RI7C 1I4XA 1WMHA 4US8A 3DBRI 4GXBA 1SGHA 3GZNB 3ZDTA 4GDKA 2LFIA 4E71A 2PEAA 4BKGA 1OQQA 2CU1A 2LWPA 4BKSD 1KLGD 3Q8BA 1TY2A 3UF8A 2JZZA 3H6NA 2V0GA 5IP4D 4ITKA 4L1BA 1P9DU 4B0EA 1G6JA 4LDTB 2KDIA 2WDRB 3TBLD 4M8NA 1KH0A 1E8WA 3U8ZA 4WWMA 3WA0A 4YXDB 1P0RA 1WXAA 4HK2A 2NPTB 3IG3A 4DHZB 3KH0A 4A20A 2W3RA 2J0MA 2RGFA 4XX5A 4IKGA 1DOYA 4RMAA 2PVGC 4MELA 2HD5B 1T3QA 4AJYB 3I63C 3AU4A 1NI2A 4KDIC 3NG0A 2IO1B 1T0RC 4ICUA 3GE3C 1UWMA 2FUHB 5DPTA 1SXTA 3R2IA 4BOZB 3AE7B 2WXPA 4OW0A 3ZXVA 3H7SA 4GU2A 2RD0A 1MPEA 4YTMB 3T9LA 1FFVA 1V1PB 3QCAA 2LRUA 1V6EA 1WGHA 3ZJUA 4WAFA 4HKZE 3LJ3A 4C4VB 4DHJB 2ZNVB 3KLSX 1Q10A 3ZNZB 3TIXA 4AS1A 4G50A 1WR6E 1WYGA 3BZDB 4MH0E 3VFKA 4JIOU 2IY1B 3AB5A 2BS3B 2LRWA 4JPSA 1V8CA 1P98A 1SF0A 4WAAA 2JX5A 1K8RB 2LZ6A 2K5PA 1FCCC 2WLBA 3ZNHB 3ZTCA 2VH2A 3QK0A 4AOFA 3CSTA 1H4RA 3L4PA 3IFWB 3N9YC 1UELA 2KXJA 1HTOA 3R66C 4P6VF 1WR1A 1WX8A 2WX0A 2W3SA 2BQQA 2JU6X 1NI3A 5TR5A 3RCZA 1UH6A 1ACCA 3ZJVA 1XLQA 2PJHA 3N1ZC 2O2VA 2JZPA 2KTFA 3Q3MC 1F0ZA 5EE3A 3HK0A 2A4ZA 3R8BA 3DQVA 2SEBD 4LNKA 2OJWA 5D3IB 2QEJC 2BS2B 3BYYB 3MC9A 3UQAA 2WXFA 1QZEA 3GP7A 1JALA 2FIFA 1LFDA 4XYCA 2N9EB 4WQMA 4A9AA 1HZ6A 3OJ4B 2IJ0A 3VHTC 1TS3A 5BYRA 3IHPC 2JXXA 1J7AA 1NBFC 3QAQA 2DX5B 3CWIA 5T8IA 2MCNB 2WS3B 3RULA 4I6LB 2K1FA 4XWTA 3E9SA 2C9WB 2N7EA 1QQRA 3AM9A 3PRZA 4XC2A 4KKIA 2WHIA 3TEZA 4FBJB 2K8BA 3V05A 3PVLA 2D5GA 1HEZE 2WXHA 1YX5B 4ICVA 2V3NA 3M63B 2R2QA 3V61A 3T8MA 2JSVX 1L7YA 2M0AA 1E8XA 1KOTA 3RD2A 1N5WA 4BOSC 1LO5D 3N1YC 4O1NA 3ZGZA 4BVUC 1D6EC 3RNEC 4YWGG 1XCQL 2KYWA 4II3B 4LNIA 2HE7A 1L6VA 2E6XA 4P1BC 1Y8RC 1HE8A 2Y3AA 2C60A 4HRSA 2INDC 2N4FA 4WJNA 1Y56A 1EF5A 4KGRA 2NTSA 2JQRB 4NZLB 5CHVC 3ML9A 4KZ0A 4NQKE 4CO7A 4XDCA 4JLCA 4M02A 3AEGB 2JYTA 5AUKA 2PIAA 3ML8A 2ZVNA 5C1ZA 3PO0A 1WE6A 1F2RC 4OZAA 2WXGA 2HTME 1TKYA 2MWSB 1L0XB 3P42A 4BFRA 1C3TA 3IVFA 2DLBA 2MHJA 4HKQA 3DVGY 2XBBC 4EOYA 1FD6A 3AULA 1K52A 1GB4A 3TEXA 5H8YE 2JVCA 2BGFA 1I4HA 2MBHA 3ECIA 1MJDA 2GRIA 1A70A 4GSWA 1DYQA 4IC7B 2LD9A 1ISNA 1J8CA 4GLSC 3UGBB 4YSZB 3U7DA 4HJKA 4W9HA 5JZEB 2XK5A 4RNAA 2LMCA 4P1CC 5IA7A 2D3GA 4ARIA 2FNJB 2QILA 4ZRJA 2RR9A 1WXSA 4CQNA 2C7MB 1BT0A 4W9KA 2KNBA 2B76B 1KM7A 2MQJA 1RFAA 5LLIA 2WXRA 2J0JA 1VZ8A 4OVUA 4ZYNA 3VR9B 4HVBA 4RF1A 3SU8X 5E6OA 4A55A 1ESFA 2JT4B 2OEDA 1WXQA 2O2VB 1WJ4A 3QWZB 3KUDB 4RGOS 1TKEA 5IOIA 2LHDA 4URKA 2RMMA 2WU2B 1F52A 2D3BA 1QLBB 1TYGB 1WXMA 2INPE 3SFEB 1P7EA 1ZDVA 1L0VB 3AXCA 2I1JA 1TS2A 5JXVA 3APDA 1E8YA 3C8YA 2Z0EB 5IO9A 4HPLB 4RCOA 4W9JA 1D5XC 1WYWB 2CJNA 2ASQA 2L76A 2ZVOA 1NVID 2IPKD 4RM9A 3B9JA 5HFYA 4MM3B 3L0WB 3E56A 4EE2A 3APFA 4ZOHC 3C19A 4KSLC 2L0FA 3WALA 3DVGX 2JWUA 3DBLB 3URYA 1CQVA 1KLUD 5IAAC 1SE4A 3EHVA 1Q5WB 3N30A 2NCNA 2KO3A 1FXAA 1WX7A 1GPXA 2Y5CA 2V3PA 3X0WA 2BYEA 3VH3B 2N9PC 2NMQA 1JROA 2IGGA 4PYZA 2R2OA 2PMVA 2O6VD 1C9FA 3CF6E 3LYYA 4ANVA 3DVNU 4K1RB 2CJOA 1C4AA 1E5WA 3KUZA 1I4GA 1UWXA 4RH6A 4TV3A 3ETRA 3VTVA 1WH3A 4N58A 2BS4B 4C56C 4AQ7A 2FCMA 1MHHE 2J4XA 3VXWA 3LDZE 4W9LA 3W1YA 2KC2A 3MHSD 4XE0A 3HM6X 2KFKA 2ZNVC 1KTKA 2CKHB 1V2YA 5J2RA 1C4PA 4F7ZA 1XT9B 2MEKA 3P4RB 2G3QB 4E3CA 2K39A 4KGSA 2A5UA 2ZPYA 3PSEB 4RGNA 3BY4B 3GB1A 1MG8A 3PRPB 1WJ6A 4DHZE 1SIJA 2WXQA 1UUPA 1JMLA 3JVZX 4ZRQA 3NZUA 2JY6A 4RF0A 2WXJA 4MGZE 3PV1A 2G4DB 3L10B 1WXVA 2WXOA 4NY0A 2L1AA 3H8HA 2PE9A 4OVZA 4N59A 1UF0A 5L95C 1CJEA 2RDGA 2KN5A 1RFKA 2WXKA 3FAHA 4EFOA 3AEAB 1E90A 1N62A 1OTRB 2ZEQA 3PTFC 1WF9A 3N20C 2N1VA 2D3CA 3IT6B 5KHQA 1IUEA 1V1OA 1FCLA 2KJRA 2M17A 5LXIB 3HVDA 1MI0A 1TS5A 3R2TA 1WY8A 2YEPB 3B0AA 1IGDA 2Y5BB 3NY5A 4E74A 4F1SA 3QQ8B 4MGIE 2ZZPB 3AE9B 2VRRB 3U30A 4W9FA 4D2KA 1YX6B 2JWZA 1P1AA 2JF5A 4MSQB 4IWOA 4A6QA 1JWMD 2KQSA 1ROEA 1VDVA 2ICIA 2DZKA 1GNUA 1T0YA 4FXCA 1HQRD 3NVYA 1C79A 5AZHA 2O6VA 2LGYA 2K3UA 1GOZA 2V1YA 5AEKB 4DDGD 4AUQC 4KV2A 5AZGA 2PKOA 2LJ5A 4JGHB 3DBRB 2RPQA 4C80A 5DPWA 3AE3B 3ZJTA 4XGAB 1BMLC 1WGYA 3N32A 5GXGB 2KX3A 4PS3A 5C2TB 1HZ5A 2BWES 1UZXB 3W1SA 1PQSA 2HJ8A 3OAWA 4LK0M 4MEMA 2KHWB 2WXNA 4ZYSA 3M3JA 4W9EA 1EWCA 2L52A 2J7QB 2AQ3B 1ZGUB 5DPRA 4IWQA 4JWSC 1YQBA 4FN2A 2KMCA 2GBKA 2MH7A 2V4LA 2K9XA 2VH1A 2PE6B 3QHTA 2DNFA 2NBUA 4J6IA 1FRRA 5JHAA 3PRMB 4II2B 3VUXA 4FJVB 2AYOB 4IG7B 2LHEA 1CK1A 2IGDA 4WJQA 1N6ZA 3A1QA 1E10A 2N9XA 1TTNA 2KLCA 4JQWC 4M0WA 3PHXB 3DCGA 1WFYA 3O13A 2RDBC 5DPSA 4DQOC 1I4PA 2LXAA 4MACA 1AWDA 4NJ6A 2K8CA 1WWTA 4HLEA 5AZFA 2NVUI 1WX9A 4M01A 1SSNA 4R3DA 3ZNID 2KAJA 4LNFA 2MA9B 3ZIMA 2QC8A 2N7DA 3IT4B 1D3ZA 1OFFA 2NBWB 4PS7A 2MP2B 1QKZA 3DPDA 3P4QB 1WSPA 3HRDD 4IOIE 2XN9C 3A9JA 1XXGA 4B0MA 4DDID 2LGXA 3VAWA 2IY0B 3OJ3A 4LCDE 4PS8A 4A90A 4NAWB 3Q6BA 1C4CA 2DYMA 2KN4A 4QAYA 2DWQA 3MC8A 3EGRA 1WZ0A 3B2GA 3BYTB 4OZCA 4IUMB 2WDVB 1WRIA 1TIFA 2DBYA 1TBEA 2EMSA 4AWJA 1GUAB 4OVVA 2DYBA 1EU3A 2ZW0A 3ABVB 1M4VA 1GAQB 2WXLA 4US9A 3ZDMC 4GIVA 1KFYB 2LGDA 1WMHB 3EFCA 2LEKA 1Z2MA 3NVZA 1ZXHA 4GDKB 2LVOA 2B3AA 2BKRB 2NTTA 2VZKD 3TUOA 3TEWA 1E8ZA 3EC8A 5FKAC 4TUUA 4XDDA 2H88B 4LJPB 4Q2JA 5HHDG 4ACFA 2KDBA 2QHOA 1ET9A 3HHMA 3FILA 4JL9A 3IXSA 4B95A 1PFDA 3SD5A 2NBVB 2O6VB 3T3OA 1UD7A 1ENFA 2DYOA 3K9OB 3BWUD 3NS1A 4HWIB 4KX6B 4ZDVA 3ZUNA 1VZ7A 4F8CB 2HTHA 2MSED 5KHOA 3PZDA 3RNFC 4ZRPA 3KW5B 1TS4A 1V81A 2MRPA 2KC1A 2KVRA 1JWUD 1QOGA 3U4EG 2UWQA 2XNAC 3WIMA 2QDFA 2AEHA 2WYQA 2BVCA 4YT0B 1A5RA 1F1HA 3RFZB 1PGBA 5EE1A 3HVZA 1C1YB 2X38A 3O65B 1V9JA 1RM6C 2SAKA 4EUTA 5E6NA 3NZSA 3U7ZA 4DWFA 4MGYE 1AW7A 3UI3A 2WXMA 3W5UB 2KDFB 3Q8AA 3SEBA 3A9KA 1NYQA 1XLOA 3DWMA 1WIAA 1IPGA 1PGAA 3R7RA 2MBQA 1V5OA 5DCNA 2GLSA 2EELA 2IYDB 3PT2B 4K3CA 3A1QB 2KMMA 2D10A 1VLBA 4M0WB 2UYZB 1QF6A 2BF8B 3CIRB 3JSVA 3APCA 1L2NA 3NRZA 2BTEA 1I35A 2IO0B 2LJIA 4MSMB 2OHFA 2INCC 3BVMA 5CX3A 5EE9A 1YN5A 3K9PB 1FNWA 3DHIC 3PHWB 5MPOA 2Z8LA 3FKYA 2K25A 3VVWB 1K53A 2DZJA 2LVQA 4MJSA 3X23A 3I9V1 2XEWA 1C78A 3TSSA 1ET6A 2GBRA 1VZ6A 3PLVA 2MW5A 2M8SA 2ZCCA 1TZOA 3LB8C 2CHXA 5C23A 2FCNA 1KF6B 1MG4A 1L0YB 1S1QB 3AEFB 5E6PA 3VTWA 4TKNA 1Q0WB 3P2BA 5D7GA 4TQ1A 2QSDA 3IBEA 1C77A 3RN9C 3QC8B 1YOVB 3OG5A 2CU3A 3KWVA 5EE0A 2JUOA 3RNCC 4I6NB 4ASWC 1PDXA 4ZHPA 1AYFA 4HEA1 2NR2A 4LLGM 3TEYA 4NJCA 5LXHA 1TKGA 1WGGA 2KFJA 1XD3B 2M4NA 3NVVA 3AE8B 3V62A 2AL6A 1RRBA 4HPPA 4FA6A 2AQ1B 3FC4A 2LUEA 3UIOB 4M00A 3RYTA 3UIPB 5G5GA 4ZRIA 4HXDA 1HXYD 1OQYA 3VQIA 2WDQB 2QCZA 4BZAA 3AV8A 2J42A 1SIFA 1EF1A 3T3NA 1C76A 4K7WA 4RM8A 1BUIC 3RUIB 1XCTL 3V6CB 4N6EB 3QIJA 1V5TA 4DXGA 2JZ3B 2PW9A 3ZNGC 4IM0A 3PPAA 2BYVE 5L83A 3SHQA 2RPVA 4GN1A 2KJHB 3RMKC 3AE1B 4ANWA 2FE8A 1UNSA 5I4DA 4J3OD 1N61A 4L23A 1R4NI 3OLMD 3EA6A 1V1PA 4NJ7A 3AN1A 2K6DB 3B08A 3KWLA 1XLPA 2X8XX 2WU5B 1E7VA 4DXFA 4UDUC 1EUVB 2WGSA 2JYEA 1V86A 2N9KA 1MHXA 1WGDA 3U52E 4BBNC 2K0PA 2GBMA 3GE8C 4FULA 1FIQA 1JRPA 2G45B 1WM2A 3W9CB 2FIDA 2WX1A 2JRHA 3JW0X 1AARA 4W9DA 4YTNB 4HROA 1J0GA 3DBHI 1OEYA 1ZDXA 2V9HA 1NYRA 1I4QA 1J7CA 4YL8A 1PUTA 5AUIA 2KWVB 3Q3JA 4XZ4A 2LI5A 2MBOA 1R4MI 4HPMB 3MJWA 3BVZA 2IDYA 4PK1A 4JX1C 4KIKA 1ZKHA 4KGTA 1TY0A 3P4SB 1T6BX 3QJZA 2XK5B 1FO4A 1YQ3B 1WGKA 1T0SC 2V4IB 1LXDA 3AECB 1YIWA 3TCAA 1YN4A 1YJJA 3H1UA 3PS6A 2KQ7A 3RNGC 1EM7A 4CHKA 2BB5A 3AE5B 3VH4B 5D6JB 3PZ8A 3R7QA 1ZW7A 4LJOB 2L7RA 2JRIB 3ZO5B 3VRBB 3D32A 1TT5B 2WWZA 2KD0A 1J19A 1ZP0B 1JWAD 3AE6B 2J53A 4JE3B 4MJSB 4G0NB 4IM2A 3UINB 1PYWD 2CR5A 3SDLC 4NPNA 1P7FA 1WM3A 1GC7A 3Q8FA 2W82A 4DXAB 2MBEA 2NS5A 2D07B 3MFGA 2PLPA 2KQ4X 2C7NB 1XF5L 1VRAB 4EZKA 1IP9A 1RAXA 4DBGA 2VZKB 3PLUA 2N9LA 3NOBA 4GDLA 1SJED 4WH4A 2YLMA 4GMVA 2R61A 4G11A 1YN3A 5D2MB 3J9CA 3I3TB 2C5LC 1NENB 2QJLA 2FUG1 2Y5PA 3VTUA 1JW9D 3UQBA 2BPSA 3I5JC 2CHWA 1QT9A 2KZRA 3KYDD 2ZJDA 3BIID 4X57B 3ZQ4A 4KSKC 1CMXB 2KVZA 1ZE3D 2ZPNA 3CMMB 2K8HA 1B1ZA 4L2YA 1F77A 3EFUA 4P7IA 5BYSA 2QMTA 1NDDA 3N3KB 2C7HA 4IWPA 3DWGC 3HM3A 2G1EA 4A8XC 3NS8A 2AX5A 4WWOA 2W54A 3VR8B 3BVGA 1RYJA 2WP9B 1YQ4B 3AEDB 4FLHA 4FJZA 4EEWA 3RNBC 1WE7A 1JCKB 3ONSA 1ZPSA 1E6EB 3QX1A 2DZMA 3H9DA 4C00A 2D3AA 2V3SA 2IO3B 1X1MA 4OHJA 1VCBA 5JH5C 2FBWB 1K50A 2J0KA 3W1SC 2KKCA 2PTLA 3L08A 2KWCA 2OOBB 3PZ7A 4IW0A 4WURA 2DZIA 5D94A 4GOCA 3VUYA 1P3QU 3RNAC 3CSFA 4TQ0A 4AJWA 2DAJA 1K51A 2N1WA 3ZW3A 4ANXA 4USAA 2AQ2B 4FHJA 1JWBD 1WZ3A 4B6WA 4EZJA 2KANA 3NVWA 3A33B 2MLBA 1V80A 2BBCA 1UGMA 2KFKB 1BXTA 3NJTA 3RZWC 1CZPA 3NHEB 1LGRA 3HIZA 4RGTA 1L4ZB 5CTRC 3WANA 2YEPF 5BMGA 2KLGA 1YNTE 2E3TA 2YVCA 3Q69A 1I4RA 4K81A 3TMPB 1TGZB 1B9RA 5J17A 2L00B 2FCQA 3M62B 2M1MA 1SE2A 4MH8A 1KJTA 1SE3A 4DK5A 3SR6A 5HG2A 1OEYJ 2MJDA 4K7SA 3RZFA 1KLVA 3S2AA 4K7UA 1ZXIA 1I7HA 5E6JA 4KIKB 4GGQA 1QOFA 2BW2A 2L8JA 4H2AA 3ZXRA 1HTQA 3VRAB 5IKCM 2I1KA 3A4RA 1JQ4A 4ZRKA 4BAXA 2KJ6A 1LQBA 4HJGE 4LNNA 3Q3OC 1WRDB 4WQOB 5J18A 1KRHA 3WAPA 1UBIA 4EZLA 1HA5A 2M0XA 3AEBB 4TMAB 3ZRCA 1FPYA 2KMAA 4BKSA 1YJ1A 1GC6A 3PGEA 2GMIC 3ENEA 1VD2A 5FR3A 4XWWA 3AMZA 2D11A 3GOEA 1FRDA 2PVOD 3MC0B 2GB1A 3IAS1 1RLFA 2WNMA 3A4SC 1QOAA 2EKIA 3Q3FA 1I42A 2L3ZA 1SE9A 2KDMA 4BBNF 3B1LX 4MM3A 2LGSA 4GDLB 5LNK1 3JYUA 3VDZA 2BWFA 2AL3A 3M95A 4ARCA 2K22A 3ZVVA 2AWTA 2FCSA 4MDKE 4ANUA 3AEEB 3LXFA 4HDQA 2N0SB 3R3MA 3EUB2 2MJ3A 1AN8A 2Q5WD 4WJPA 4LDTD 5CHWA 3I57A 3PREA 1YMHE 2CHZA 3BK1A 2ZW1A 2WDTB 4M8MA 4FADA 4S17A 3AH7A 2W9NA 1J7BA 1IBXA 3BINA 1GG3A 3HUIA 1YD8U 3AI5A 4A3OA 1Z5SB 3TL5A 3MTNB 3MHZA 1TJEA 1IGCA 1PGXA 3L16A 2L32A 2KACA 3DHGC 2L0TA 2IZVB 3QARA 1XEEA 3DHHC 3ZTDA 2GOWA 5G55A 3AU5A 1MFWA 1EO6A 2W55A 2LUMA 3KVFB 3RPFC 2ACZB 3NZ3A 3VUWA 4DHJD 2H89B 1LM8B 4B9KA 4CYEA 2ONQA 1M94A 1UBQA 4C7ZA 3GS2A 1OGWA 1N5XA 4LNOA 3ALBA 3DVNV 1U4AA 4AP4C 5HKHA 1JWSD 4GB9A 2DHZA 3P63A 1N60A 2DAFA 4RFBA 5BMIA 1N63A 3ZYYX 4YTPB 2FAZA 1NEKB 5JHBA 1FMAD 2Z0DB 3H7PA 3ZRFA 2OJRA 4HDOA 1S3SG 2G9HD 3U2SC 2KDEB 4WWPA 5H92C 4W9CA 4LTUA 5BYQA 2GBJA 1MVKA 3A9JB 2WXIA 2KTRA 2BT6A 2L05A 4FJYA 5EDSA 1L6UA 1SB3C 2ON8A 1TZ1A 1E0ZA 3OWEB 3SFDB 2IBIB 1GB1A 3N1XC 5TSSA 2BKFA 2RDHA 1FM0D 4YSYB 3B2FA 5G2NA 1DOXA 3DOWA 2WQYB 3P1MA 1JRUA 4MGKE 2LXCA 4NQLB 3KUCB 3DBLI 3ZLZA 1SBBB 2KWDA 1FNUA 4YSXB 3WCQA 1ZUD2 1EWYC 1VR9A 1XO3A 1WGRA 2D2QA 3NUHB 3Q3NC 5D3DA 4OZBA 4NAMA 2KX0A 4HCNB 3IAM1 1GJZA 1QOBA 1E7UA 3L54A 2EKEC 2RSUA 2G4SA 4TSSA 3EECA 3Q14C 2NPTA 1T0QC 2Z59B 2J52A 2REXA 4W9GA 2KK8A 1FNVA 3Q8CA 5IN7A 3FILB 2BB6A 2JXTA 2CS4A 5FK9C 1FEHA 1VJKA 2LVPA 1F2RI 5FR6A 4K3BA 2N7JA 2IO2B 3QA8A 4IM3A 1FFUA 2INNE 2IGHA 5G5HA 2HDEA 3Q8EA 4N9F4 1XQQA 2MJEA 1H8CA 4KDLB 2ZCBA 4JWUC 1OQRA 4G3XB 2M19A 3L17A 3V6EB 4C4VA 4KKJA 1IBXB 1V97A 4W9IA 5CHFA 2HJ1A 4P16A 2GBNA 1WJUA 2LGIA 1ZOYB 2BYTA 1DOIA 3Q2AC 2PPHA 2EMTA 3L13A 1FXIA 2K6QA 1DGJA 4PT5A 1IYFA 4WJOA 1R4NB 3A9KB 5BO4B 2KOXA 2BYFA 3W2DA 4WWNA 1WI0A 1STEA 3WAMA 1SEBD 3RT3B 2KT7A 4IDIA 2GI9A 2MBBB 4REZA 2KWUB 1EU4A 1D5ZC 1XLNA 3DDCB 3DBSA 3KYCD 3MP9A 1R7SA 1UGJA 3AE4B 3V3XA 2DENB 3JSVB 2I2YA 1T5XD 2I38A 2MX2A 3DBHB 2JPHA 4EKUA 2MP2A 4RGMA 1L5PA 5BMHA 4A3PA 2L83A 1R4MB 1QILA 4KVGB 1E7PB 4NAWA 1RWSA 1Q1OA 3GZNI 3H7PB 4PYUA 4KZCA 3BK2A 3P4PB 1FXTB 3TJPA 3MJ5A 4HCPB 4MT5A 2M56B 2UU7A 2QIEB 3KQ4A 2LASA 1D5MC 4FHKA 4C7YA 3WAOA 4I6PA 2TSSA
chains in the Genus database with same CATH topology
1SE2A 1YJIA 2JWUA 2X38A 3W5VB 5C3JB 3URYA 1CQVA 1KLUD 1RM6C 2SAKA 4MH8A 4WIPA 1SE4A 3AE2B 1D4BA 1E9MA 1SE3A 3SR6A 5HG2A 2MJDA 3U7ZA 1FXAA 4ZHOA 1L4DB 1GPXA 1AW7A 3UI3A 2Y5CA 1ZXIA 2V3PA 2WXMA 5HI1A 1I7HA 1SJHD 1I4XA 5E6JA 3W5UB 3Q8AA 3SEBA 4US8A 1NYQA 1QOFA 1XLOA 3DWMA 2NMQA 2BW2A 1JROA 2IGGA 4H2AA 2PMVA 2LFIA 3VRAB 1C9FA 3LYYA 1OQQA 1KLGD 3Q8BA 1TY2A 2CJOA 1JQ4A 1C4AA 1PGAA 1I4GA 1UWXA 4RH6A 2V0GA 4HJGE 4ITKA 2EELA 4L1BA 3ETRA 4B0EA 2KMMA 4N58A 2BS4B 4C56C 1VLBA 1KRHA 4AQ7A 1QF6A 2WDRB 1MHHE 1KH0A 1HA5A 2J4XA 3AEBB 3CIRB 4TMAB 3NRZA 2BTEA 4WWMA 2LJIA 4YXDB 2OHFA 4XE0A 3BVMA 5FR3A 5EE9A 1KTKA 4XWWA 1YN5A 3AMZA 1C4PA 1FNWA 2W3RA 1FRDA 5MPOA 2PVOD 2Z8LA 3MC0B 4IKGA 1DOYA 2GB1A 3IAS1 2MEKA 2PVGC 2WNMA 1T3QA 3P4RB 1QOAA 2EKIA 1K53A 3I9V1 2KDMA 1C78A 4KGSA 3TSSA 1ET6A 1UWMA 4RGNA 1VZ6A 4GDLB 1SXTA 5LNK1 3R2IA 1TZOA 3LB8C 3GB1A 3AE7B 4ARCA 1KF6B 2WXPA 1L0YB 3AEFB 4OW0A 2K22A 1SIJA 2WXQA 1UUPA 1JMLA 3AEEB 3LXFA 1MPEA 5D7GA 4ZRQA 4TQ1A 4YTMB 1FFVA 1V1PB 2QSDA 1C77A 3ZJUA 2N0SB 4RF0A 4WAFA 2WXJA 3EUB2 4HKZE 5EE0A 2CU3A 1AN8A 2MJ3A 2Q5WD 3KWVA 1PDXA 4ZHPA 3I57A 3KLSX 1Q10A 1YMHE 1AYFA 2WXOA 4HEA1 2L1AA 3BK1A 3H8HA 4LLGM 3TEYA 4NJCA 4OVZA 1TKGA 2ZW1A 4AS1A 4N59A 3NVVA 3AE8B 1WYGA 3BZDB 1CJEA 2RDGA 1RFKA 3AH7A 2WXKA 1J7BA 2AQ1B 1IBXA 3FC4A 3AB5A 3HUIA 2BS3B 4JPSA 3FAHA 3AEAB 1V8CA 1SF0A 1N62A 2JX5A 2K5PA 1FCCC 2WLBA 5G5GA 3MHZA 1TJEA 1IGCA 1PGXA 1HXYD 3VQIA 3IT6B 3L4PA 1IUEA 3N9YC 2WDQB 1V1OA 1FCLA 3AV8A 2L32A 2KACA 2J42A 4P6VF 3HVDA 1MI0A 2W3SA 2JU6X 3T3NA 1C76A 1TS5A 3R2TA 1NI3A 1XEEA 2YEPB 1IGDA 1BUIC 3AE9B 1XCTL 1ACCA 2W55A 4N6EB 3ZJVA 1XLQA 4D2KA 2LUMA 2JZPA 4DXGA 2PW9A 3RPFC 5EE3A 1F0ZA 3R8BA 2SEBD 2ACZB 3NZ3A 5D3IB 2QEJC 4A6QA 1JWMD 2RPVA 1ROEA 2H89B 2BS2B 1VDVA 2ICIA 3AE1B 3BYYB 2WXFA 4FXCA 1HQRD 2FE8A 3GP7A 2ONQA 3NVYA 1UNSA 5I4DA 1C79A 4J3OD 1N61A 4C7ZA 3GS2A 4L23A 1JALA 3EA6A 1N5XA 1V1PA 1GOZA 2K3UA 3AN1A 3KWLA 4WQMA 4A9AA 1HZ6A 1XLPA 2IJ0A 1TS3A 2WU5B 4DXFA 1JWSD 2PKOA 5BYRA 4UDUC 2JYEA 1J7AA 1MHXA 2N9KA 3U52E 3P63A 1N60A 3CWIA 2K0PA 5T8IA 4RFBA 2WS3B 1N63A 3ZYYX 5BMIA 4YTPB 1FIQA 4C80A 1NEKB 4XWTA 1JRPA 1FMAD 3AE3B 3W9CB 3E9SA 3ZJTA 1BMLC 1QQRA 3AM9A 4KKIA 3TEZA 4YTNB 4HROA 5GXGB 5C2TB 2G9HD 1HZ5A 1ZDXA 3U2SC 3V05A 1NYRA 3W1SA 1I4QA 1J7CA 2D5GA 1PUTA 5AUIA 4LK0M 5H92C 4LTUA 5BYQA 1HEZE 1MVKA 2WXHA 2WXNA 2WXIA 2BT6A 2V3NA 4ZYSA 1L6UA 1EWCA 1SB3C 2ON8A 2L52A 3BVZA 1E0ZA 2IDYA 3OWEB 2JSVX 3SFDB 1GB1A 2AQ3B 5TSSA 2M0AA 2RDHA 1FM0D 4JWSC 1N5WA 4JX1C 4YSYB 4KGTA 1LO5D 1TY0A 3B2FA 3P4SB 4O1NA 1DOXA 2MH7A 3ZGZA 1T6BX 2WQYB 1D6EC 3P1MA 2K9XA 4YWGG 1XCQL 1FO4A 1YQ3B 1WGKA 1L6VA 2E6XA 2Y3AA 1SBBB 2V4IB 2KWDA 1FNUA 3AECB 1FRRA 4HRSA 4YSXB 1YN4A 3WCQA 1YJJA 1ZUD2 1EWYC 2LHEA 1EM7A 1VR9A 1CK1A 2IGDA 1XO3A 2BB5A 1E10A 1Y56A 3AE5B 3NUHB 3PZ8A 4KGRA 4M0WA 4OZBA 2NTSA 5D3DA 2JQRB 4NZLB 4NAMA 4XDCA 3AEGB 3IAM1 3O13A 2JYTA 1QOBA 3VRBB 4TSSA 4DQOC 1ZP0B 1JWAD 3AE6B 2J53A 5AUKA 1I4PA 4JE3B 2PIAA 4MACA 1PYWD 1AWDA 1P7FA 2J52A 3PO0A 1WWTA 3Q8FA 2W82A 1FNVA 1F2RC 3Q8CA 4OZAA 2WXGA 1SSNA 3FILB 3MFGA 4R3DA 2HTME 2PLPA 2KQ4X 2KAJA 2BB6A 2JXTA 5FK9C 1XF5L 1FEHA 1TKYA 1VRAB 1L0XB 1VJKA 3IT4B 3P42A 1F2RI 1OFFA 2VZKB 2DLBA 2N9LA 2N7JA 1SJED 4WH4A 4HKQA 1QKZA 3P4QB 1WSPA 2R61A 3HRDD 4IOIE 1YN3A 2XN9C 3J9CA 1FD6A 1XXGA 4B0MA 1FFUA 1NENB 2QJLA 2INNE 2FUG1 2Y5PA 2IGHA 5G5HA 1K52A 2HDEA 3Q8EA 1GB4A 3TEXA 5H8YE 4A90A 4NAWB 1JW9D 2MJEA 1C4CA 2DYMA 2KN4A 4JWUC 1I4HA 2DWQA 1OQRA 1QT9A 3EGRA 3B2GA 2M19A 3BIID 3BYTB 2GRIA 1A70A 3ZQ4A 1DYQA 4KKJA 4OZCA 2WDVB 1WRIA 4GLSC 1ZE3D 2DBYA 4YSZB 1IBXB 1V97A 1B1ZA 4L2YA 1F77A 5BYSA 2QMTA 4P16A 4RNAA 2LMCA 2LGIA 1ZOYB 4ARIA 3DWGC 2BYTA 1DOIA 2G1EA 1EU3A 4A8XC 2ZW0A 3ABVB 1M4VA 2QILA 2AX5A 3VR8B 2W54A 3BVGA 1RYJA 4CQNA 1GAQB 2WP9B 1FXIA 2B76B 1DGJA 1YQ4B 2WXLA 3AEDB 4US9A 4PT5A 1KFYB 1JCKB 2WXRA 1ZPSA 1E6EB 2LEKA 3NVZA 3W2DA 1ZXHA 1VZ8A 4GDKB 3VR9B 4RF1A 1STEA 1SEBD 4A55A 2VZKD 2NTTA 4OHJA 4IDIA 3TUOA 1ESFA 2OEDA 3TEWA 1WXQA 2FBWB 5FKAC 1K50A 2GI9A 2PTLA 4XDDA 2H88B 4REZA 4RGOS 1TKEA 1EU4A 4Q2JA 1D5ZC 1XLNA 5HHDG 3PZ7A 4WURA 2LHDA 3MP9A 1R7SA 1ET9A 4TQ0A 3FILA 3IXSA 1UGJA 2RMMA 2WU2B 1PFDA 1QLBB 1K51A 3AE4B 3V3XA 4USAA 2AQ2B 3T3OA 1TYGB 2I2YA 2INPE 1ENFA 2I38A 1P7EA 1T5XD 2DYOA 1JWBD 3SFEB 1ZDVA 1L0VB 3NVWA 4RGMA 3BWUD 2BBCA 1TS2A 3NS1A 5JXVA 4KX6B 1L5PA 1VZ7A 3C8YA 5BMHA 1BXTA 2L83A 4RCOA 1QILA 1D5XC 2CJNA 1CZPA 4ZRPA 1E7PB 4RGTA 1TS4A 1RWSA 1L4ZB 2YEPF 1NVID 2IPKD 5BMGA 1JWUD 1QOGA 1YNTE 3BK2A 2E3TA 3B9JA 2XNAC 3U4EG 5HFYA 3P4PB 4YT0B 4MM3B 3Q69A 1I4RA 3E56A 3MJ5A 4MT5A 2M56B 4EE2A 3RFZB 1B9RA 2QIEB 3KQ4A 1PGBA 4ZOHC 5EE1A 1D5MC 3HVZA 4C7YA 2TSSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SSN A;  1C77 A;  1C79 A;  2SAK A;  1C78 A;  1C76 A;  1BUI C; 
#chains in the Genus database with same CATH topology
 1WJN A;  1YJI A;  3C0R B;  3W5V B;  5C3J B;  2KTR B;  4WIP A;  5GMV A;  4BKT A;  3AE2 B;  1D4B A;  1E9M A;  3V60 A;  3ZKJ C;  4ZHO A;  1L4D B;  4S0R A;  1V49 A;  4NNJ B;  1F9J A;  5HI1 A;  1SJH D;  3RI7 C;  1I4X A;  1WMH A;  4US8 A;  3DBR I;  4GXB A;  1SGH A;  3GZN B;  3ZDT A;  4GDK A;  2LFI A;  4E71 A;  2PEA A;  4BKG A;  1OQQ A;  2CU1 A;  2LWP A;  4BKS D;  1KLG D;  3Q8B A;  1TY2 A;  3UF8 A;  2JZZ A;  3H6N A;  2V0G A;  5IP4 D;  4ITK A;  4L1B A;  1P9D U;  4B0E A;  1G6J A;  4LDT B;  2KDI A;  2WDR B;  3TBL D;  4M8N A;  1KH0 A;  1E8W A;  3U8Z A;  4WWM A;  3WA0 A;  4YXD B;  1P0R A;  1WXA A;  4HK2 A;  2NPT B;  3IG3 A;  4DHZ B;  3KH0 A;  4A20 A;  2W3R A;  2J0M A;  2RGF A;  4XX5 A;  4IKG A;  1DOY A;  4RMA A;  2PVG C;  4MEL A;  2HD5 B;  1T3Q A;  4AJY B;  3I63 C;  3AU4 A;  1NI2 A;  4KDI C;  3NG0 A;  2IO1 B;  1T0R C;  4ICU A;  3GE3 C;  1UWM A;  2FUH B;  5DPT A;  1SXT A;  3R2I A;  4BOZ B;  3AE7 B;  2WXP A;  4OW0 A;  3ZXV A;  3H7S A;  4GU2 A;  2RD0 A;  1MPE A;  4YTM B;  3T9L A;  1FFV A;  1V1P B;  3QCA A;  2LRU A;  1V6E A;  1WGH A;  3ZJU A;  4WAF A;  4HKZ E;  3LJ3 A;  4C4V B;  4DHJ B;  2ZNV B;  3KLS X;  1Q10 A;  3ZNZ B;  3TIX A;  4AS1 A;  4G50 A;  1WR6 E;  1WYG A;  3BZD B;  4MH0 E;  3VFK A;  4JIO U;  2IY1 B;  3AB5 A;  2BS3 B;  2LRW A;  4JPS A;  1V8C A;  1P98 A;  1SF0 A;  4WAA A;  2JX5 A;  1K8R B;  2LZ6 A;  2K5P A;  1FCC C;  2WLB A;  3ZNH B;  3ZTC A;  2VH2 A;  3QK0 A;  4AOF A;  3CST A;  1H4R A;  3L4P A;  3IFW B;  3N9Y C;  1UEL A;  2KXJ A;  1HTO A;  3R66 C;  4P6V F;  1WR1 A;  1WX8 A;  2WX0 A;  2W3S A;  2BQQ A;  2JU6 X;  1NI3 A;  5TR5 A;  3RCZ A;  1UH6 A;  1ACC A;  3ZJV A;  1XLQ A;  2PJH A;  3N1Z C;  2O2V A;  2JZP A;  2KTF A;  3Q3M C;  1F0Z A;  5EE3 A;  3HK0 A;  2A4Z A;  3R8B A;  3DQV A;  2SEB D;  4LNK A;  2OJW A;  5D3I B;  2QEJ C;  2BS2 B;  3BYY B;  3MC9 A;  3UQA A;  2WXF A;  1QZE A;  3GP7 A;  1JAL A;  2FIF A;  1LFD A;  4XYC A;  2N9E B;  4WQM A;  4A9A A;  1HZ6 A;  3OJ4 B;  2IJ0 A;  3VHT C;  1TS3 A;  5BYR A;  3IHP C;  2JXX A;  1J7A A;  1NBF C;  3QAQ A;  2DX5 B;  3CWI A;  5T8I A;  2MCN B;  2WS3 B;  3RUL A;  4I6L B;  2K1F A;  4XWT A;  3E9S A;  2C9W B;  2N7E A;  1QQR A;  3AM9 A;  3PRZ A;  4XC2 A;  4KKI A;  2WHI A;  3TEZ A;  4FBJ B;  2K8B A;  3V05 A;  3PVL A;  2D5G A;  1HEZ E;  2WXH A;  1YX5 B;  4ICV A;  2V3N A;  3M63 B;  2R2Q A;  3V61 A;  3T8M A;  2JSV X;  1L7Y A;  2M0A A;  1E8X A;  1KOT A;  3RD2 A;  1N5W A;  4BOS C;  1LO5 D;  3N1Y C;  4O1N A;  3ZGZ A;  4BVU C;  1D6E C;  3RNE C;  4YWG G;  1XCQ L;  2KYW A;  4II3 B;  4LNI A;  2HE7 A;  1L6V A;  2E6X A;  4P1B C;  1Y8R C;  1HE8 A;  2Y3A A;  2C60 A;  4HRS A;  2IND C;  2N4F A;  4WJN A;  1Y56 A;  1EF5 A;  4KGR A;  2NTS A;  2JQR B;  4NZL B;  5CHV C;  3ML9 A;  4KZ0 A;  4NQK E;  4CO7 A;  4XDC A;  4JLC A;  4M02 A;  3AEG B;  2JYT A;  5AUK A;  2PIA A;  3ML8 A;  2ZVN A;  5C1Z A;  3PO0 A;  1WE6 A;  1F2R C;  4OZA A;  2WXG A;  2HTM E;  1TKY A;  2MWS B;  1L0X B;  3P42 A;  4BFR A;  1C3T A;  3IVF A;  2DLB A;  2MHJ A;  4HKQ A;  3DVG Y;  2XBB C;  4EOY A;  1FD6 A;  3AUL A;  1K52 A;  1GB4 A;  3TEX A;  5H8Y E;  2JVC A;  2BGF A;  1I4H A;  2MBH A;  3ECI A;  1MJD A;  2GRI A;  1A70 A;  4GSW A;  1DYQ A;  4IC7 B;  2LD9 A;  1ISN A;  1J8C A;  4GLS C;  3UGB B;  4YSZ B;  3U7D A;  4HJK A;  4W9H A;  5JZE B;  2XK5 A;  4RNA A;  2LMC A;  4P1C C;  5IA7 A;  2D3G A;  4ARI A;  2FNJ B;  2QIL A;  4ZRJ A;  2RR9 A;  1WXS A;  4CQN A;  2C7M B;  1BT0 A;  4W9K A;  2KNB A;  2B76 B;  1KM7 A;  2MQJ A;  1RFA A;  5LLI A;  2WXR A;  2J0J A;  1VZ8 A;  4OVU A;  4ZYN A;  3VR9 B;  4HVB A;  4RF1 A;  3SU8 X;  5E6O A;  4A55 A;  1ESF A;  2JT4 B;  2OED A;  1WXQ A;  2O2V B;  1WJ4 A;  3QWZ B;  3KUD B;  4RGO S;  1TKE A;  5IOI A;  2LHD A;  4URK A;  2RMM A;  2WU2 B;  1F52 A;  2D3B A;  1QLB B;  1TYG B;  1WXM A;  2INP E;  3SFE B;  1P7E A;  1ZDV A;  1L0V B;  3AXC A;  2I1J A;  1TS2 A;  5JXV A;  3APD A;  1E8Y A;  3C8Y A;  2Z0E B;  5IO9 A;  4HPL B;  4RCO A;  4W9J A;  1D5X C;  1WYW B;  2CJN A;  2ASQ A;  2L76 A;  2ZVO A;  1NVI D;  2IPK D;  4RM9 A;  3B9J A;  5HFY A;  4MM3 B;  3L0W B;  3E56 A;  4EE2 A;  3APF A;  4ZOH C;  3C19 A;  4KSL C;  2L0F A;  3WAL A;  3DVG X;  2JWU A;  3DBL B;  3URY A;  1CQV A;  1KLU D;  5IAA C;  1SE4 A;  3EHV A;  1Q5W B;  3N30 A;  2NCN A;  2KO3 A;  1FXA A;  1WX7 A;  1GPX A;  2Y5C A;  2V3P A;  3X0W A;  2BYE A;  3VH3 B;  2N9P C;  2NMQ A;  1JRO A;  2IGG A;  4PYZ A;  2R2O A;  2PMV A;  2O6V D;  1C9F A;  3CF6 E;  3LYY A;  4ANV A;  3DVN U;  4K1R B;  2CJO A;  1C4A A;  1E5W A;  3KUZ A;  1I4G A;  1UWX A;  4RH6 A;  4TV3 A;  3ETR A;  3VTV A;  1WH3 A;  4N58 A;  2BS4 B;  4C56 C;  4AQ7 A;  2FCM A;  1MHH E;  2J4X A;  3VXW A;  3LDZ E;  4W9L A;  3W1Y A;  2KC2 A;  3MHS D;  4XE0 A;  3HM6 X;  2KFK A;  2ZNV C;  1KTK A;  2CKH B;  1V2Y A;  5J2R A;  1C4P A;  4F7Z A;  1XT9 B;  2MEK A;  3P4R B;  2G3Q B;  4E3C A;  2K39 A;  4KGS A;  2A5U A;  2ZPY A;  3PSE B;  4RGN A;  3BY4 B;  3GB1 A;  1MG8 A;  3PRP B;  1WJ6 A;  4DHZ E;  1SIJ A;  2WXQ A;  1UUP A;  1JML A;  3JVZ X;  4ZRQ A;  3NZU A;  2JY6 A;  4RF0 A;  2WXJ A;  4MGZ E;  3PV1 A;  2G4D B;  3L10 B;  1WXV A;  2WXO A;  4NY0 A;  2L1A A;  3H8H A;  2PE9 A;  4OVZ A;  4N59 A;  1UF0 A;  5L95 C;  1CJE A;  2RDG A;  2KN5 A;  1RFK A;  2WXK A;  3FAH A;  4EFO A;  3AEA B;  1E90 A;  1N62 A;  1OTR B;  2ZEQ A;  3PTF C;  1WF9 A;  3N20 C;  2N1V A;  2D3C A;  3IT6 B;  5KHQ A;  1IUE A;  1V1O A;  1FCL A;  2KJR A;  2M17 A;  5LXI B;  3HVD A;  1MI0 A;  1TS5 A;  3R2T A;  1WY8 A;  2YEP B;  3B0A A;  1IGD A;  2Y5B B;  3NY5 A;  4E74 A;  4F1S A;  3QQ8 B;  4MGI E;  2ZZP B;  3AE9 B;  2VRR B;  3U30 A;  4W9F A;  4D2K A;  1YX6 B;  2JWZ A;  1P1A A;  2JF5 A;  4MSQ B;  4IWO A;  4A6Q A;  1JWM D;  2KQS A;  1ROE A;  1VDV A;  2ICI A;  2DZK A;  1GNU A;  1T0Y A;  4FXC A;  1HQR D;  3NVY A;  1C79 A;  5AZH A;  2O6V A;  2LGY A;  2K3U A;  1GOZ A;  2V1Y A;  5AEK B;  4DDG D;  4AUQ C;  4KV2 A;  5AZG A;  2PKO A;  2LJ5 A;  4JGH B;  3DBR B;  2RPQ A;  4C80 A;  5DPW A;  3AE3 B;  3ZJT A;  4XGA B;  1BML C;  1WGY A;  3N32 A;  5GXG B;  2KX3 A;  4PS3 A;  5C2T B;  1HZ5 A;  2BWE S;  1UZX B;  3W1S A;  1PQS A;  2HJ8 A;  3OAW A;  4LK0 M;  4MEM A;  2KHW B;  2WXN A;  4ZYS A;  3M3J A;  4W9E A;  1EWC A;  2L52 A;  2J7Q B;  2AQ3 B;  1ZGU B;  5DPR A;  4IWQ A;  4JWS C;  1YQB A;  4FN2 A;  2KMC A;  2GBK A;  2MH7 A;  2V4L A;  2K9X A;  2VH1 A;  2PE6 B;  3QHT A;  2DNF A;  2NBU A;  4J6I A;  1FRR A;  5JHA A;  3PRM B;  4II2 B;  3VUX A;  4FJV B;  2AYO B;  4IG7 B;  2LHE A;  1CK1 A;  2IGD A;  4WJQ A;  1N6Z A;  3A1Q A;  1E10 A;  2N9X A;  1TTN A;  2KLC A;  4JQW C;  4M0W A;  3PHX B;  3DCG A;  1WFY A;  3O13 A;  2RDB C;  5DPS A;  4DQO C;  1I4P A;  2LXA A;  4MAC A;  1AWD A;  4NJ6 A;  2K8C A;  1WWT A;  4HLE A;  5AZF A;  2NVU I;  1WX9 A;  4M01 A;  1SSN A;  4R3D A;  3ZNI D;  2KAJ A;  4LNF A;  2MA9 B;  3ZIM A;  2QC8 A;  2N7D A;  3IT4 B;  1D3Z A;  1OFF A;  2NBW B;  4PS7 A;  2MP2 B;  1QKZ A;  3DPD A;  3P4Q B;  1WSP A;  3HRD D;  4IOI E;  2XN9 C;  3A9J A;  1XXG A;  4B0M A;  4DDI D;  2LGX A;  3VAW A;  2IY0 B;  3OJ3 A;  4LCD E;  4PS8 A;  4A90 A;  4NAW B;  3Q6B A;  1C4C A;  2DYM A;  2KN4 A;  4QAY A;  2DWQ A;  3MC8 A;  3EGR A;  1WZ0 A;  3B2G A;  3BYT B;  4OZC A;  4IUM B;  2WDV B;  1WRI A;  1TIF A;  2DBY A;  1TBE A;  2EMS A;  4AWJ A;  1GUA B;  4OVV A;  2DYB A;  1EU3 A;  2ZW0 A;  3ABV B;  1M4V A;  1GAQ B;  2WXL A;  4US9 A;  3ZDM C;  4GIV A;  1KFY B;  2LGD A;  1WMH B;  3EFC A;  2LEK A;  1Z2M A;  3NVZ A;  1ZXH A;  4GDK B;  2LVO A;  2B3A A;  2BKR B;  2NTT A;  2VZK D;  3TUO A;  3TEW A;  1E8Z A;  3EC8 A;  5FKA C;  4TUU A;  4XDD A;  2H88 B;  4LJP B;  4Q2J A;  5HHD G;  4ACF A;  2KDB A;  2QHO A;  1ET9 A;  3HHM A;  3FIL A;  4JL9 A;  3IXS A;  4B95 A;  1PFD A;  3SD5 A;  2NBV B;  2O6V B;  3T3O A;  1UD7 A;  1ENF A;  2DYO A;  3K9O B;  3BWU D;  3NS1 A;  4HWI B;  4KX6 B;  4ZDV A;  3ZUN A;  1VZ7 A;  4F8C B;  2HTH A;  2MSE D;  5KHO A;  3PZD A;  3RNF C;  4ZRP A;  3KW5 B;  1TS4 A;  1V81 A;  2MRP A;  2KC1 A;  2KVR A;  1JWU D;  1QOG A;  3U4E G;  2UWQ A;  2XNA C;  3WIM A;  2QDF A;  2AEH A;  2WYQ A;  2BVC A;  4YT0 B;  1A5R A;  1F1H A;  3RFZ B;  1PGB A;  5EE1 A;  3HVZ A;  1C1Y B;  2X38 A;  3O65 B;  1V9J A;  1RM6 C;  2SAK A;  4EUT A;  5E6N A;  3NZS A;  3U7Z A;  4DWF A;  4MGY E;  1AW7 A;  3UI3 A;  2WXM A;  3W5U B;  2KDF B;  3Q8A A;  3SEB A;  3A9K A;  1NYQ A;  1XLO A;  3DWM A;  1WIA A;  1IPG A;  1PGA A;  3R7R A;  2MBQ A;  1V5O A;  5DCN A;  2GLS A;  2EEL A;  2IYD B;  3PT2 B;  4K3C A;  3A1Q B;  2KMM A;  2D10 A;  1VLB A;  4M0W B;  2UYZ B;  1QF6 A;  2BF8 B;  3CIR B;  3JSV A;  3APC A;  1L2N A;  3NRZ A;  2BTE A;  1I35 A;  2IO0 B;  2LJI A;  4MSM B;  2OHF A;  2INC C;  3BVM A;  5CX3 A;  5EE9 A;  1YN5 A;  3K9P B;  1FNW A;  3DHI C;  3PHW B;  5MPO A;  2Z8L A;  3FKY A;  2K25 A;  3VVW B;  1K53 A;  2DZJ A;  2LVQ A;  4MJS A;  3X23 A;  3I9V 1;  2XEW A;  1C78 A;  3TSS A;  1ET6 A;  2GBR A;  1VZ6 A;  3PLV A;  2MW5 A;  2M8S A;  2ZCC A;  1TZO A;  3LB8 C;  2CHX A;  5C23 A;  2FCN A;  1KF6 B;  1MG4 A;  1L0Y B;  1S1Q B;  3AEF B;  5E6P A;  3VTW A;  4TKN A;  1Q0W B;  3P2B A;  5D7G A;  4TQ1 A;  2QSD A;  3IBE A;  1C77 A;  3RN9 C;  3QC8 B;  1YOV B;  3OG5 A;  2CU3 A;  3KWV A;  5EE0 A;  2JUO A;  3RNC C;  4I6N B;  4ASW C;  1PDX A;  4ZHP A;  1AYF A;  4HEA 1;  2NR2 A;  4LLG M;  3TEY A;  4NJC A;  5LXH A;  1TKG A;  1WGG A;  2KFJ A;  1XD3 B;  2M4N A;  3NVV A;  3AE8 B;  3V62 A;  2AL6 A;  1RRB A;  4HPP A;  4FA6 A;  2AQ1 B;  3FC4 A;  2LUE A;  3UIO B;  4M00 A;  3RYT A;  3UIP B;  5G5G A;  4ZRI A;  4HXD A;  1HXY D;  1OQY A;  3VQI A;  2WDQ B;  2QCZ A;  4BZA A;  3AV8 A;  2J42 A;  1SIF A;  1EF1 A;  3T3N A;  1C76 A;  4K7W A;  4RM8 A;  1BUI C;  3RUI B;  1XCT L;  3V6C B;  4N6E B;  3QIJ A;  1V5T A;  4DXG A;  2JZ3 B;  2PW9 A;  3ZNG C;  4IM0 A;  3PPA A;  2BYV E;  5L83 A;  3SHQ A;  2RPV A;  4GN1 A;  2KJH B;  3RMK C;  3AE1 B;  4ANW A;  2FE8 A;  1UNS A;  5I4D A;  4J3O D;  1N61 A;  4L23 A;  1R4N I;  3OLM D;  3EA6 A;  1V1P A;  4NJ7 A;  3AN1 A;  2K6D B;  3B08 A;  3KWL A;  1XLP A;  2X8X X;  2WU5 B;  1E7V A;  4DXF A;  4UDU C;  1EUV B;  2WGS A;  2JYE A;  1V86 A;  2N9K A;  1MHX A;  1WGD A;  3U52 E;  4BBN C;  2K0P A;  2GBM A;  3GE8 C;  4FUL A;  1FIQ A;  1JRP A;  2G45 B;  1WM2 A;  3W9C B;  2FID A;  2WX1 A;  2JRH A;  3JW0 X;  1AAR A;  4W9D A;  4YTN B;  4HRO A;  1J0G A;  3DBH I;  1OEY A;  1ZDX A;  2V9H A;  1NYR A;  1I4Q A;  1J7C A;  4YL8 A;  1PUT A;  5AUI A;  2KWV B;  3Q3J A;  4XZ4 A;  2LI5 A;  2MBO A;  1R4M I;  4HPM B;  3MJW A;  3BVZ A;  2IDY A;  4PK1 A;  4JX1 C;  4KIK A;  1ZKH A;  4KGT A;  1TY0 A;  3P4S B;  1T6B X;  3QJZ A;  2XK5 B;  1FO4 A;  1YQ3 B;  1WGK A;  1T0S C;  2V4I B;  1LXD A;  3AEC B;  1YIW A;  3TCA A;  1YN4 A;  1YJJ A;  3H1U A;  3PS6 A;  2KQ7 A;  3RNG C;  1EM7 A;  4CHK A;  2BB5 A;  3AE5 B;  3VH4 B;  5D6J B;  3PZ8 A;  3R7Q A;  1ZW7 A;  4LJO B;  2L7R A;  2JRI B;  3ZO5 B;  3VRB B;  3D32 A;  1TT5 B;  2WWZ A;  2KD0 A;  1J19 A;  1ZP0 B;  1JWA D;  3AE6 B;  2J53 A;  4JE3 B;  4MJS B;  4G0N B;  4IM2 A;  3UIN B;  1PYW D;  2CR5 A;  3SDL C;  4NPN A;  1P7F A;  1WM3 A;  1GC7 A;  3Q8F A;  2W82 A;  4DXA B;  2MBE A;  2NS5 A;  2D07 B;  3MFG A;  2PLP A;  2KQ4 X;  2C7N B;  1XF5 L;  1VRA B;  4EZK A;  1IP9 A;  1RAX A;  4DBG A;  2VZK B;  3PLU A;  2N9L A;  3NOB A;  4GDL A;  1SJE D;  4WH4 A;  2YLM A;  4GMV A;  2R61 A;  4G11 A;  1YN3 A;  5D2M B;  3J9C A;  3I3T B;  2C5L C;  1NEN B;  2QJL A;  2FUG 1;  2Y5P A;  3VTU A;  1JW9 D;  3UQB A;  2BPS A;  3I5J C;  2CHW A;  1QT9 A;  2KZR A;  3KYD D;  2ZJD A;  3BII D;  4X57 B;  3ZQ4 A;  4KSK C;  1CMX B;  2KVZ A;  1ZE3 D;  2ZPN A;  3CMM B;  2K8H A;  1B1Z A;  4L2Y A;  1F77 A;  3EFU A;  4P7I A;  5BYS A;  2QMT A;  1NDD A;  3N3K B;  2C7H A;  4IWP A;  3DWG C;  3HM3 A;  2G1E A;  4A8X C;  3NS8 A;  2AX5 A;  4WWO A;  2W54 A;  3VR8 B;  3BVG A;  1RYJ A;  2WP9 B;  1YQ4 B;  3AED B;  4FLH A;  4FJZ A;  4EEW A;  3RNB C;  1WE7 A;  1JCK B;  3ONS A;  1ZPS A;  1E6E B;  3QX1 A;  2DZM A;  3H9D A;  4C00 A;  2D3A A;  2V3S A;  2IO3 B;  1X1M A;  4OHJ A;  1VCB A;  5JH5 C;  2FBW B;  1K50 A;  2J0K A;  3W1S C;  2KKC A;  2PTL A;  3L08 A;  2KWC A;  2OOB B;  3PZ7 A;  4IW0 A;  4WUR A;  2DZI A;  5D94 A;  4GOC A;  3VUY A;  1P3Q U;  3RNA C;  3CSF A;  4TQ0 A;  4AJW A;  2DAJ A;  1K51 A;  2N1W A;  3ZW3 A;  4ANX A;  4USA A;  2AQ2 B;  4FHJ A;  1JWB D;  1WZ3 A;  4B6W A;  4EZJ A;  2KAN A;  3NVW A;  3A33 B;  2MLB A;  1V80 A;  2BBC A;  1UGM A;  2KFK B;  1BXT A;  3NJT A;  3RZW C;  1CZP A;  3NHE B;  1LGR A;  3HIZ A;  4RGT A;  1L4Z B;  5CTR C;  3WAN A;  2YEP F;  5BMG A;  2KLG A;  1YNT E;  2E3T A;  2YVC A;  3Q69 A;  1I4R A;  4K81 A;  3TMP B;  1TGZ B;  1B9R A;  5J17 A;  2L00 B;  2FCQ A;  3M62 B;  2M1M A;  1SE2 A;  4MH8 A;  1KJT A;  1SE3 A;  4DK5 A;  3SR6 A;  5HG2 A;  1OEY J;  2MJD A;  4K7S A;  3RZF A;  1KLV A;  3S2A A;  4K7U A;  1ZXI A;  1I7H A;  5E6J A;  4KIK B;  4GGQ A;  1QOF A;  2BW2 A;  2L8J A;  4H2A A;  3ZXR A;  1HTQ A;  3VRA B;  5IKC M;  2I1K A;  3A4R A;  1JQ4 A;  4ZRK A;  4BAX A;  2KJ6 A;  1LQB A;  4HJG E;  4LNN A;  3Q3O C;  1WRD B;  4WQO B;  5J18 A;  1KRH A;  3WAP A;  1UBI A;  4EZL A;  1HA5 A;  2M0X A;  3AEB B;  4TMA B;  3ZRC A;  1FPY A;  2KMA A;  4BKS A;  1YJ1 A;  1GC6 A;  3PGE A;  2GMI C;  3ENE A;  1VD2 A;  5FR3 A;  4XWW A;  3AMZ A;  2D11 A;  3GOE A;  1FRD A;  2PVO D;  3MC0 B;  2GB1 A;  3IAS 1;  1RLF A;  2WNM A;  3A4S C;  1QOA A;  2EKI A;  3Q3F A;  1I42 A;  2L3Z A;  1SE9 A;  2KDM A;  4BBN F;  3B1L X;  4MM3 A;  2LGS A;  4GDL B;  5LNK 1;  3JYU A;  3VDZ A;  2BWF A;  2AL3 A;  3M95 A;  4ARC A;  2K22 A;  3ZVV A;  2AWT A;  2FCS A;  4MDK E;  4ANU A;  3AEE B;  3LXF A;  4HDQ A;  2N0S B;  3R3M A;  3EUB 2;  2MJ3 A;  1AN8 A;  2Q5W D;  4WJP A;  4LDT D;  5CHW A;  3I57 A;  3PRE A;  1YMH E;  2CHZ A;  3BK1 A;  2ZW1 A;  2WDT B;  4M8M A;  4FAD A;  4S17 A;  3AH7 A;  2W9N A;  1J7B A;  1IBX A;  3BIN A;  1GG3 A;  3HUI A;  1YD8 U;  3AI5 A;  4A3O A;  1Z5S B;  3TL5 A;  3MTN B;  3MHZ A;  1TJE A;  1IGC A;  1PGX A;  3L16 A;  2L32 A;  2KAC A;  3DHG C;  2L0T A;  2IZV B;  3QAR A;  1XEE A;  3DHH C;  3ZTD A;  2GOW A;  5G55 A;  3AU5 A;  1MFW A;  1EO6 A;  2W55 A;  2LUM A;  3KVF B;  3RPF C;  2ACZ B;  3NZ3 A;  3VUW A;  4DHJ D;  2H89 B;  1LM8 B;  4B9K A;  4CYE A;  2ONQ A;  1M94 A;  1UBQ A;  4C7Z A;  3GS2 A;  1OGW A;  1N5X A;  4LNO A;  3ALB A;  3DVN V;  1U4A A;  4AP4 C;  5HKH A;  1JWS D;  4GB9 A;  2DHZ A;  3P63 A;  1N60 A;  2DAF A;  4RFB A;  5BMI A;  1N63 A;  3ZYY X;  4YTP B;  2FAZ A;  1NEK B;  5JHB A;  1FMA D;  2Z0D B;  3H7P A;  3ZRF A;  2OJR A;  4HDO A;  1S3S G;  2G9H D;  3U2S C;  2KDE B;  4WWP A;  5H92 C;  4W9C A;  4LTU A;  5BYQ A;  2GBJ A;  1MVK A;  3A9J B;  2WXI A;  2KTR A;  2BT6 A;  2L05 A;  4FJY A;  5EDS A;  1L6U A;  1SB3 C;  2ON8 A;  1TZ1 A;  1E0Z A;  3OWE B;  3SFD B;  2IBI B;  1GB1 A;  3N1X C;  5TSS A;  2BKF A;  2RDH A;  1FM0 D;  4YSY B;  3B2F A;  5G2N A;  1DOX A;  3DOW A;  2WQY B;  3P1M A;  1JRU A;  4MGK E;  2LXC A;  4NQL B;  3KUC B;  3DBL I;  3ZLZ A;  1SBB B;  2KWD A;  1FNU A;  4YSX B;  3WCQ A;  1ZUD 2;  1EWY C;  1VR9 A;  1XO3 A;  1WGR A;  2D2Q A;  3NUH B;  3Q3N C;  5D3D A;  4OZB A;  4NAM A;  2KX0 A;  4HCN B;  3IAM 1;  1GJZ A;  1QOB A;  1E7U A;  3L54 A;  2EKE C;  2RSU A;  2G4S A;  4TSS A;  3EEC A;  3Q14 C;  2NPT A;  1T0Q C;  2Z59 B;  2J52 A;  2REX A;  4W9G A;  2KK8 A;  1FNV A;  3Q8C A;  5IN7 A;  3FIL B;  2BB6 A;  2JXT A;  2CS4 A;  5FK9 C;  1FEH A;  1VJK A;  2LVP A;  1F2R I;  5FR6 A;  4K3B A;  2N7J A;  2IO2 B;  3QA8 A;  4IM3 A;  1FFU A;  2INN E;  2IGH A;  5G5H A;  2HDE A;  3Q8E A;  4N9F 4;  1XQQ A;  2MJE A;  1H8C A;  4KDL B;  2ZCB A;  4JWU C;  1OQR A;  4G3X B;  2M19 A;  3L17 A;  3V6E B;  4C4V A;  4KKJ A;  1IBX B;  1V97 A;  4W9I A;  5CHF A;  2HJ1 A;  4P16 A;  2GBN A;  1WJU A;  2LGI A;  1ZOY B;  2BYT A;  1DOI A;  3Q2A C;  2PPH A;  2EMT A;  3L13 A;  1FXI A;  2K6Q A;  1DGJ A;  4PT5 A;  1IYF A;  4WJO A;  1R4N B;  3A9K B;  5BO4 B;  2KOX A;  2BYF A;  3W2D A;  4WWN A;  1WI0 A;  1STE A;  3WAM A;  1SEB D;  3RT3 B;  2KT7 A;  4IDI A;  2GI9 A;  2MBB B;  4REZ A;  2KWU B;  1EU4 A;  1D5Z C;  1XLN A;  3DDC B;  3DBS A;  3KYC D;  3MP9 A;  1R7S A;  1UGJ A;  3AE4 B;  3V3X A;  2DEN B;  3JSV B;  2I2Y A;  1T5X D;  2I38 A;  2MX2 A;  3DBH B;  2JPH A;  4EKU A;  2MP2 A;  4RGM A;  1L5P A;  5BMH A;  4A3P A;  2L83 A;  1R4M B;  1QIL A;  4KVG B;  1E7P B;  4NAW A;  1RWS A;  1Q1O A;  3GZN I;  3H7P B;  4PYU A;  4KZC A;  3BK2 A;  3P4P B;  1FXT B;  3TJP A;  3MJ5 A;  4HCP B;  4MT5 A;  2M56 B;  2UU7 A;  2QIE B;  3KQ4 A;  2LAS A;  1D5M C;  4FHK A;  4C7Y A;  3WAO A;  4I6P A;  2TSS A; 
#chains in the Genus database with same CATH homology
 1SE2 A;  1YJI A;  2JWU A;  2X38 A;  3W5V B;  5C3J B;  3URY A;  1CQV A;  1KLU D;  1RM6 C;  2SAK A;  4MH8 A;  4WIP A;  1SE4 A;  3AE2 B;  1D4B A;  1E9M A;  1SE3 A;  3SR6 A;  5HG2 A;  2MJD A;  3U7Z A;  1FXA A;  4ZHO A;  1L4D B;  1GPX A;  1AW7 A;  3UI3 A;  2Y5C A;  1ZXI A;  2V3P A;  2WXM A;  5HI1 A;  1I7H A;  1SJH D;  1I4X A;  5E6J A;  3W5U B;  3Q8A A;  3SEB A;  4US8 A;  1NYQ A;  1QOF A;  1XLO A;  3DWM A;  2NMQ A;  2BW2 A;  1JRO A;  2IGG A;  4H2A A;  2PMV A;  2LFI A;  3VRA B;  1C9F A;  3LYY A;  1OQQ A;  1KLG D;  3Q8B A;  1TY2 A;  2CJO A;  1JQ4 A;  1C4A A;  1PGA A;  1I4G A;  1UWX A;  4RH6 A;  2V0G A;  4HJG E;  4ITK A;  2EEL A;  4L1B A;  3ETR A;  4B0E A;  2KMM A;  4N58 A;  2BS4 B;  4C56 C;  1VLB A;  1KRH A;  4AQ7 A;  1QF6 A;  2WDR B;  1MHH E;  1KH0 A;  1HA5 A;  2J4X A;  3AEB B;  3CIR B;  4TMA B;  3NRZ A;  2BTE A;  4WWM A;  2LJI A;  4YXD B;  2OHF A;  4XE0 A;  3BVM A;  5FR3 A;  5EE9 A;  1KTK A;  4XWW A;  1YN5 A;  3AMZ A;  1C4P A;  1FNW A;  2W3R A;  1FRD A;  5MPO A;  2PVO D;  2Z8L A;  3MC0 B;  4IKG A;  1DOY A;  2GB1 A;  3IAS 1;  2MEK A;  2PVG C;  2WNM A;  1T3Q A;  3P4R B;  1QOA A;  2EKI A;  1K53 A;  3I9V 1;  2KDM A;  1C78 A;  4KGS A;  3TSS A;  1ET6 A;  1UWM A;  4RGN A;  1VZ6 A;  4GDL B;  1SXT A;  5LNK 1;  3R2I A;  1TZO A;  3LB8 C;  3GB1 A;  3AE7 B;  4ARC A;  1KF6 B;  2WXP A;  1L0Y B;  3AEF B;  4OW0 A;  2K22 A;  1SIJ A;  2WXQ A;  1UUP A;  1JML A;  3AEE B;  3LXF A;  1MPE A;  5D7G A;  4ZRQ A;  4TQ1 A;  4YTM B;  1FFV A;  1V1P B;  2QSD A;  1C77 A;  3ZJU A;  2N0S B;  4RF0 A;  4WAF A;  2WXJ A;  3EUB 2;  4HKZ E;  5EE0 A;  2CU3 A;  1AN8 A;  2MJ3 A;  2Q5W D;  3KWV A;  1PDX A;  4ZHP A;  3I57 A;  3KLS X;  1Q10 A;  1YMH E;  1AYF A;  2WXO A;  4HEA 1;  2L1A A;  3BK1 A;  3H8H A;  4LLG M;  3TEY A;  4NJC A;  4OVZ A;  1TKG A;  2ZW1 A;  4AS1 A;  4N59 A;  3NVV A;  3AE8 B;  1WYG A;  3BZD B;  1CJE A;  2RDG A;  1RFK A;  3AH7 A;  2WXK A;  1J7B A;  2AQ1 B;  1IBX A;  3FC4 A;  3AB5 A;  3HUI A;  2BS3 B;  4JPS A;  3FAH A;  3AEA B;  1V8C A;  1SF0 A;  1N62 A;  2JX5 A;  2K5P A;  1FCC C;  2WLB A;  5G5G A;  3MHZ A;  1TJE A;  1IGC A;  1PGX A;  1HXY D;  3VQI A;  3IT6 B;  3L4P A;  1IUE A;  3N9Y C;  2WDQ B;  1V1O A;  1FCL A;  3AV8 A;  2L32 A;  2KAC A;  2J42 A;  4P6V F;  3HVD A;  1MI0 A;  2W3S A;  2JU6 X;  3T3N A;  1C76 A;  1TS5 A;  3R2T A;  1NI3 A;  1XEE A;  2YEP B;  1IGD A;  1BUI C;  3AE9 B;  1XCT L;  1ACC A;  2W55 A;  4N6E B;  3ZJV A;  1XLQ A;  4D2K A;  2LUM A;  2JZP A;  4DXG A;  2PW9 A;  3RPF C;  5EE3 A;  1F0Z A;  3R8B A;  2SEB D;  2ACZ B;  3NZ3 A;  5D3I B;  2QEJ C;  4A6Q A;  1JWM D;  2RPV A;  1ROE A;  2H89 B;  2BS2 B;  1VDV A;  2ICI A;  3AE1 B;  3BYY B;  2WXF A;  4FXC A;  1HQR D;  2FE8 A;  3GP7 A;  2ONQ A;  3NVY A;  1UNS A;  5I4D A;  1C79 A;  4J3O D;  1N61 A;  4C7Z A;  3GS2 A;  4L23 A;  1JAL A;  3EA6 A;  1N5X A;  1V1P A;  1GOZ A;  2K3U A;  3AN1 A;  3KWL A;  4WQM A;  4A9A A;  1HZ6 A;  1XLP A;  2IJ0 A;  1TS3 A;  2WU5 B;  4DXF A;  1JWS D;  2PKO A;  5BYR A;  4UDU C;  2JYE A;  1J7A A;  1MHX A;  2N9K A;  3U52 E;  3P63 A;  1N60 A;  3CWI A;  2K0P A;  5T8I A;  4RFB A;  2WS3 B;  1N63 A;  3ZYY X;  5BMI A;  4YTP B;  1FIQ A;  4C80 A;  1NEK B;  4XWT A;  1JRP A;  1FMA D;  3AE3 B;  3W9C B;  3E9S A;  3ZJT A;  1BML C;  1QQR A;  3AM9 A;  4KKI A;  3TEZ A;  4YTN B;  4HRO A;  5GXG B;  5C2T B;  2G9H D;  1HZ5 A;  1ZDX A;  3U2S C;  3V05 A;  1NYR A;  3W1S A;  1I4Q A;  1J7C A;  2D5G A;  1PUT A;  5AUI A;  4LK0 M;  5H92 C;  4LTU A;  5BYQ A;  1HEZ E;  1MVK A;  2WXH A;  2WXN A;  2WXI A;  2BT6 A;  2V3N A;  4ZYS A;  1L6U A;  1EWC A;  1SB3 C;  2ON8 A;  2L52 A;  3BVZ A;  1E0Z A;  2IDY A;  3OWE B;  2JSV X;  3SFD B;  1GB1 A;  2AQ3 B;  5TSS A;  2M0A A;  2RDH A;  1FM0 D;  4JWS C;  1N5W A;  4JX1 C;  4YSY B;  4KGT A;  1LO5 D;  1TY0 A;  3B2F A;  3P4S B;  4O1N A;  1DOX A;  2MH7 A;  3ZGZ A;  1T6B X;  2WQY B;  1D6E C;  3P1M A;  2K9X A;  4YWG G;  1XCQ L;  1FO4 A;  1YQ3 B;  1WGK A;  1L6V A;  2E6X A;  2Y3A A;  1SBB B;  2V4I B;  2KWD A;  1FNU A;  3AEC B;  1FRR A;  4HRS A;  4YSX B;  1YN4 A;  3WCQ A;  1YJJ A;  1ZUD 2;  1EWY C;  2LHE A;  1EM7 A;  1VR9 A;  1CK1 A;  2IGD A;  1XO3 A;  2BB5 A;  1E10 A;  1Y56 A;  3AE5 B;  3NUH B;  3PZ8 A;  4KGR A;  4M0W A;  4OZB A;  2NTS A;  5D3D A;  2JQR B;  4NZL B;  4NAM A;  4XDC A;  3AEG B;  3IAM 1;  3O13 A;  2JYT A;  1QOB A;  3VRB B;  4TSS A;  4DQO C;  1ZP0 B;  1JWA D;  3AE6 B;  2J53 A;  5AUK A;  1I4P A;  4JE3 B;  2PIA A;  4MAC A;  1PYW D;  1AWD A;  1P7F A;  2J52 A;  3PO0 A;  1WWT A;  3Q8F A;  2W82 A;  1FNV A;  1F2R C;  3Q8C A;  4OZA A;  2WXG A;  1SSN A;  3FIL B;  3MFG A;  4R3D A;  2HTM E;  2PLP A;  2KQ4 X;  2KAJ A;  2BB6 A;  2JXT A;  5FK9 C;  1XF5 L;  1FEH A;  1TKY A;  1VRA B;  1L0X B;  1VJK A;  3IT4 B;  3P42 A;  1F2R I;  1OFF A;  2VZK B;  2DLB A;  2N9L A;  2N7J A;  1SJE D;  4WH4 A;  4HKQ A;  1QKZ A;  3P4Q B;  1WSP A;  2R61 A;  3HRD D;  4IOI E;  1YN3 A;  2XN9 C;  3J9C A;  1FD6 A;  1XXG A;  4B0M A;  1FFU A;  1NEN B;  2QJL A;  2INN E;  2FUG 1;  2Y5P A;  2IGH A;  5G5H A;  1K52 A;  2HDE A;  3Q8E A;  1GB4 A;  3TEX A;  5H8Y E;  4A90 A;  4NAW B;  1JW9 D;  2MJE A;  1C4C A;  2DYM A;  2KN4 A;  4JWU C;  1I4H A;  2DWQ A;  1OQR A;  1QT9 A;  3EGR A;  3B2G A;  2M19 A;  3BII D;  3BYT B;  2GRI A;  1A70 A;  3ZQ4 A;  1DYQ A;  4KKJ A;  4OZC A;  2WDV B;  1WRI A;  4GLS C;  1ZE3 D;  2DBY A;  4YSZ B;  1IBX B;  1V97 A;  1B1Z A;  4L2Y A;  1F77 A;  5BYS A;  2QMT A;  4P16 A;  4RNA A;  2LMC A;  2LGI A;  1ZOY B;  4ARI A;  3DWG C;  2BYT A;  1DOI A;  2G1E A;  1EU3 A;  4A8X C;  2ZW0 A;  3ABV B;  1M4V A;  2QIL A;  2AX5 A;  3VR8 B;  2W54 A;  3BVG A;  1RYJ A;  4CQN A;  1GAQ B;  2WP9 B;  1FXI A;  2B76 B;  1DGJ A;  1YQ4 B;  2WXL A;  3AED B;  4US9 A;  4PT5 A;  1KFY B;  1JCK B;  2WXR A;  1ZPS A;  1E6E B;  2LEK A;  3NVZ A;  3W2D A;  1ZXH A;  1VZ8 A;  4GDK B;  3VR9 B;  4RF1 A;  1STE A;  1SEB D;  4A55 A;  2VZK D;  2NTT A;  4OHJ A;  4IDI A;  3TUO A;  1ESF A;  2OED A;  3TEW A;  1WXQ A;  2FBW B;  5FKA C;  1K50 A;  2GI9 A;  2PTL A;  4XDD A;  2H88 B;  4REZ A;  4RGO S;  1TKE A;  1EU4 A;  4Q2J A;  1D5Z C;  1XLN A;  5HHD G;  3PZ7 A;  4WUR A;  2LHD A;  3MP9 A;  1R7S A;  1ET9 A;  4TQ0 A;  3FIL A;  3IXS A;  1UGJ A;  2RMM A;  2WU2 B;  1PFD A;  1QLB B;  1K51 A;  3AE4 B;  3V3X A;  4USA A;  2AQ2 B;  3T3O A;  1TYG B;  2I2Y A;  2INP E;  1ENF A;  2I38 A;  1P7E A;  1T5X D;  2DYO A;  1JWB D;  3SFE B;  1ZDV A;  1L0V B;  3NVW A;  4RGM A;  3BWU D;  2BBC A;  1TS2 A;  3NS1 A;  5JXV A;  4KX6 B;  1L5P A;  1VZ7 A;  3C8Y A;  5BMH A;  1BXT A;  2L83 A;  4RCO A;  1QIL A;  1D5X C;  2CJN A;  1CZP A;  4ZRP A;  1E7P B;  4RGT A;  1TS4 A;  1RWS A;  1L4Z B;  2YEP F;  1NVI D;  2IPK D;  5BMG A;  1JWU D;  1QOG A;  1YNT E;  3BK2 A;  2E3T A;  3B9J A;  2XNA C;  3U4E G;  5HFY A;  3P4P B;  4YT0 B;  4MM3 B;  3Q69 A;  1I4R A;  3E56 A;  3MJ5 A;  4MT5 A;  2M56 B;  4EE2 A;  3RFZ B;  1B9R A;  2QIE B;  3KQ4 A;  1PGB A;  4ZOH C;  5EE1 A;  1D5M C;  3HVZ A;  4C7Y A;  2TSS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...