1BUIC

Structure of the ternary microplasmin-staphylokinase-microplasmin complex: a proteinase-cofactor-substrate complex in action
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
122
structure length
122
Chain Sequence
ASYFEPTGPYLMVNVTGVDSKGNELLSPHYVEFPIKPGTTLTKEKIEYYVEWALDATAYKEFRVVELDPSAKIEVTYYDKNKKKEETKSFPITEKGFVVPDLSEHIKNPGFNLITKVVIEKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Plasminogen
publication title The ternary microplasmin-staphylokinase-microplasmin complex is a proteinase-cofactor-substrate complex in action.
pubmed doi rcsb
source organism Homo sapiens
total genus 15
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 1998-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02821 Staphylokinase Staphylokinase/Streptokinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.130 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1buiC00
1C78A 1SSNA 1BUIC 1C79A 2SAKA 1C77A 1C76A
chains in the Genus database with same CATH superfamily
5DPSA 4HCPB 1ET9A 1WXVA 2LD9A 3AEDB 2MBQA 3ZNZB 1DOXA 2EMSA 4E74A 4KGSA 3P2BA 1LO5D 4EKUA 3UQBA 3S2AA 4ASWC 2IY0B 1SE9A 1FCLA 4FLHA 3RD2A 2BYFA 2MJDA 1QF6A 1SBBB 2ZNVC 1IUEA 2BVCA 5H92C 1WY8A 4OVZA 5D7GA 2V3NA 2WXLA 4HKQA 3ZIMA 2N9EB 1K52A 2KX3A 3AU5A 4W9LA 2MSED 3DVGY 3PO0A 3OAWA 4KDLB 2QSDA 1WXAA 2JU6X 3SR6A 2WGSA 3ZNID 2LVOA 5E6PA 1DGJA 4GMVA 4M01A 1STEA 2FE8A 1KRHA 2HJ8A 1WX7A 1XCTL 2FIDA 4L23A 1I4XA 1WX9A 1ET6A 2OJWA 3GE8C 4MH8A 1KOTA 2OHFA 2EELA 3PZ8A 1FMAD 1QOAA 3SEBA 3RNGC 3Q8FA 1C9FA 1EUVB 3TCAA 3VUXA 2AQ1B 5LXHA 2AQ2B 1MJDA 2E6XA 3V6CB 1OGWA 1JALA 4KSLC 4C4VB 1WGDA 4OZAA 4NAWA 1RFKA 3DBRI 4W9CA 2MP2B 3TBLD 5D94A 3MFGA 3IFWB 4C80A 1KJTA 1YN3A 3N1XC 2IGDA 3BYYB 4DQOC 2BS2B 4HXDA 3NS1A 4FN2A 2HJ1A 3B9JA 1OEYA 1XT9B 1GNUA 2N7EA 2C60A 3ENEA 1IGDA 3U8ZA 2D2QA 1V6EA 1V1OA 1CK1A 3LDZE 2L52A 4JGHB 1SGHA 4KZ0A 4JWSC 3GZNB 3R2TA 1AARA 1UBIA 1VZ8A 2WLBA 3P4SB 3P4PB 1PFDA 2D3GA 4MM3A 2WWZA 1V5TA 1ZW7A 1HZ6A 4RFBA 4GOCA 3KW5B 3I57A 3A9JB 4GDLA 2IGHA 3NJTA 2ZJDA 4TSSA 1TGZB 2R2QA 5D6JB 1ISNA 3DBSA 3RZWC 2DYBA 5G2NA 2G4DB 1C3TA 4YXDB 2Z0DB 2LGDA 2K6QA 2ZVNA 2IGGA 2JX5A 2NS5A 1RM6C 4YSXB 1TT5B 2BKRB 4E3CA 3AEEB 1I35A 4TQ0A 1E7VA 4FJVB 4BAXA 4KSKC 2G4SA 2GMIC 2JVCA 3M95A 2AYOB 3ZTCA 2LUEA 2M0XA 2D11A 4I6LB 4H2AA 2N9KA 1VJKA 5T8IA 4M00A 3V6EB 4HLEA 4X57B 1WM2A 1WGYA 5CHWA 3EC8A 3QQ8B 2LJIA 4HJKA 1IP9A 2KLCA 4YWGG 3URYA 1RLFA 3T9LA 3MJ5A 3ABVB 4WWNA 1TIFA 3APCA 3TL5A 2J7QB 3PS6A 2AEHA 1ZKHA 3GS2A 3P1MA 2RMMA 4AUQC 4GLSC 2V0GA 1ZGUB 2Y5CA 2UU7A 1C78A 1Q5WB 1UUPA 2QILA 3I9V1 4IOIE 3TEXA 2DYMA 4LNOA 1PUTA 2KWVB 5CX3A 3RNFC 1KTKA 3LXFA 2LRWA 3A33B 2WDRB 5FR3A 2XEWA 1F2RI 4IC7B 4AP4C 1WMHB 2KC1A 2KD0A 1AYFA 4NQKE 4C7YA 1YX6B 3VUWA 2N9XA 1MHHE 1LXDA 2J53A 1QOFA 4M0WA 2NTSA 1V9JA 3L4PA 2BPSA 2QMTA 1TBEA 4QAYA 3IVFA 1Q0WB 4OVVA 3D32A 2D10A 5HG2A 2SAKA 2FCMA 2QCZA 4TQ1A 4RGMA 1Y56A 2D07B 1VZ6A 3ECIA 3WAMA 1D5MC 3W1SC 2MCNB 2LVQA 4ZRJA 2BBCA 2LEKA 4WJOA 3KWVA 3L0WB 2KDEB 2JRHA 4ZRQA 3JW0X 4A6QA 4K3CA 2DAFA 4YTMB 3PPAA 3ML9A 1ZUD2 1UELA 1KLVA 2PTLA 3DCGA 3ZYYX 2MLBA 2W54A 5LNK1 1K8RB 3E9SA 4NPNA 3RT3B 1XEEA 1QZEA 2MBHA 4MSMB 1J8CA 1Q1OA 4G11A 1X1MA 3IBEA 4LJOB 1KF6B 1NYQA 1HE8A 2KFJA 2VH1A 3AEGB 1A70A 1LGRA 4K3BA 2WXPA 2Z8LA 1P98A 1WRDB 2KVRA 2LVPA 1SE4A 2FUHB 4FHKA 2A4ZA 2XBBC 2G1EA 3DHHC 5GMVA 1OEYJ 3UINB 3QHTA 4NNJB 1TTNA 3SFDB 2BYEA 5BYQA 4XX5A 1CZPA 1RFAA 2CU1A 3R2IA 3R66C 3I5JC 2DHZA 2PE9A 3DBHI 2D3CA 3BVMA 3OJ3A 4KGTA 2MA9B 2OEDA 2VZKD 3U7ZA 4W9KA 2RPVA 1WH3A 1T0QC 2LFIA 1P1AA 4DBGA 2WXQA 4ANUA 1JWMD 1GB4A 1SJED 2PVOD 4W9FA 2QDFA 2O6VD 4ZRIA 1L4ZB 2DZMA 4RMAA 2O6VB 3VFKA 4OZBA 1B9RA 1NBFC 1YQBA 1RAXA 3ZQ4A 4P16A 4NJCA 2INDC 4D2KA 2J4XA 3ZXRA 1XD3B 4EZKA 1T0SC 4DXGA 1RYJA 1FD6A 1L6UA 4DXAB 1TKYA 1WM3A 3CWIA 3AE1B 3RNCC 1UGJA 1FFUA 1Q10A 1PDXA 3EFCA 1H8CA 3TSSA 5DPTA 3DBLI 2X38A 3NS8A 2C7MB 1R7SA 3VRBB 1J0GA 2ON8A 1BUIC 2EMTA 4ANXA 3UIPB 4W9DA 1XLNA 3B2FA 3ZRFA 1KH0A 1MG8A 1IBXB 1YN5A 4CYEA 1K51A 3DBRB 3RULA 1IPGA 2AL3A 2RDBC 4MDKE 2LGSA 2LGIA 3K9OB 3MTNB 2KJRA 3IXSA 4KX6B 4GDLB 4WAFA 3UIOB 2GI9A 4XGAB 1E8YA 2Y5PA 3OG5A 1UWXA 2V3PA 4KIKA 3WCQA 2L8JA 2PEAA 4XDCA 2RGFA 1T3QA 2LMCA 4DWFA 1ESFA 2V9HA 1PGAA 1XO3A 1KLGD 5HHDG 1QOBA 4XYCA 3HUIA 2JZ3B 4IWQA 2IDYA 1WR6E 4LNNA 2WXOA 2KTFA 4FADA 2INCC 1TS5A 5G5GA 4WWOA 3IT6B 3Q8CA 2JQRB 3EECA 3VQIA 2KAJA 4AWJA 3H8HA 5L83A 1SF0A 2L1AA 2KWCA 4IM3A 3ZJVA 4NY0A 1C4AA 1JWBD 3NHEB 4HKZE 2ZW0A 3Q3MC 4GDKA 3LJ3A 4GIVA 1GUAB 4FHJA 3HM3A 2MJ3A 4IWPA 3JSVB 3SFEB 1GAQB 5BMHA 2K0PA 2L05A 4NQLB 4WURA 1WFYA 2FCSA 2WXNA 5BO4B 4ZRKA 3L08A 3AH7A 3PRPB 3E56A 4JWUC 4A8XC 3AV8A 1WJNA 2QC8A 1ZP0B 2YEPB 2LGYA 1TZOA 1WE7A 1HZ5A 5C2TB 1FNWA 2RDGA 4S17A 3U52E 5EDSA 1GG3A 4DHJD 2MRPA 4IDIA 3W1YA 1EWYC 2QJLA 1XCQL 4DHJB 1DYQA 2G45B 3KYDD 3Q2AC 2BS3B 4B0EA 2ZEQA 1WF9A 3UF8A 2KWDA 2KZRA 1ZDVA 2KHWB 2KX0A 1PQSA 3KYCD 1IYFA 1MHXA 3VH3B 1F1HA 3NZSA 2J0KA 2DZJA 3H7PB 2L00B 1F2RC 1IGCA 1NEKB 4GB9A 1SB3C 2JSVX 2IO1B 2CHWA 3TJPA 2N1WA 1C4CA 1KFYB 3PHWB 3NVWA 3RN9C 4BOSC 2LASA 3DVNU 1RWSA 2LHEA 4LTUA 2BF8B 4GU2A 2AWTA 3Q14C 1FO4A 3T3OA 2FCQA 2M0AA 2CHZA 1M4VA 2HD5B 3NZ3A 3AEAB 4NAMA 2HE7A 3A4SC 2C5LC 2W82A 1FPYA 3IHPC 4EZLA 5IA7A 3VTVA 4C7ZA 5TR5A 1WJ4A 1A5RA 2PMVA 5BMIA 1MG4A 2B76B 3WAPA 3OWEB 4K7WA 2KMAA 4K7SA 2WNMA 4URKA 1WYGA 2KDMA 3P42A 3PSEB 3VTWA 3NY5A 2KXJA 1R4NI 2RSUA 4TV3A 4LNFA 4EE2A 4M02A 3ZNGC 1TS2A 4YSZB 1KLUD 1K53A 1PGBA 1SE3A 1N63A 1QKZA 3B08A 3DOWA 1JRPA 1UWMA 1V1PB 1I4GA 4PS3A 5E6NA 4BBNC 2Z59B 2ZPNA 2BW2A 3RNBC 2WX1A 1P9DU 1XLQA 4K81A 2J52A 3DWGC 3L16A 4BVUC 2N7DA 4B0MA 5AZFA 4BKSA 2PIAA 3VVWB 1LQBA 1L2NA 1VZ7A 4N6EB 2R61A 4NJ6A 1C76A 4HPPA 1D5XC 1S3SG 4W9IA 2JY6A 1AW7A 2WQYB 2JPHA 3VAWA 3M62B 4GGQA 3Q3JA 4DDID 4CO7A 3DBHB 1YNTE 1ACCA 2XK5B 4XZ4A 3I3TB 1CJEA 1EWCA 4P1CC 2BKFA 2RPQA 3APFA 1U4AA 2LJ5A 2WXJA 2KQ4X 3BWUD 3FILA 2HTHA 3JVZX 4O1NA 1M94A 4XE0A 1T0RC 2GBRA 1SIFA 4WJNA 1WGRA 3AEFB 1FIQA 2V3SA 4ZDVA 1ZXIA 1P7FA 2IO0B 2BYVE 2BTEA 1YIWA 2AX5A 1TS3A 4A9AA 2LUMA 1JCKB 2ZCCA 3BIID 4HPMB 4OZCA 3H7SA 4C00A 1NENB 1GB1A 3VHTC 5D3IB 2MWSB 1E90A 3AN1A 4KIKB 2KFKB 4ZYNA 4W9GA 2KQSA 2DAJA 2KTRA 3AMZA 3DBLB 2ONQA 5BMGA 3Q3OC 5E6OA 1E7PB 3BYTB 1HEZE 2B3AA 2WU5B 2E3TA 2WYQA 5JHBA 4CHKA 1OFFA 3FC4A 3AE5B 4E71A 2HDEA 2DLBA 2D3AA 1AN8A 2NCNA 2K3UA 1YOVB 4NJ7A 3AXCA 3MHSD 2M1MA 4IG7B 3ZVVA 2H88B 3ZXVA 3RPFC 3K9PB 1HTOA 2GRIA 2O2VA 2MW5A 5BYSA 1NVID 3EGRA 4MJSA 2DWQA 2NVUI 3V05A 4I6PA 2WXFA 1VLBA 3AE2B 4L1BA 5IOIA 1JWUD 4C56C 4N59A 2ZW1A 4M8MA 4GDKB 3KUZA 1GC6A 3AECB 4WIPA 2IO3B 4P6VF 1J19A 3N1YC 2J0MA 1EM7A 2KOXA 1FXAA 4YTPB 3FAHA 1WJUA 1JWAD 5LXIB 2KANA 3KH0A 4PK1A 2WXIA 1L6VA 2KO3A 2FBWB 4KKIA 3RUIB 2N0SB 5EE1A 4WQOB 2N9PC 2IJ0A 3CMMB 3T8MA 2PPHA 1L5PA 4YL8A 3BVGA 1G6JA 2GBJA 3BK2A 3Q3FA 3RFZB 4XWWA 3ONSA 2LI5A 3PZDA 3MC8A 1E8XA 3AE8B 4GN1A 1VDVA 1QOGA 3UGBB 4XWTA 1WXSA 2FNJB 2IBIB 3MHZA 3N32A 3ZJTA 5CHVC 4RNAA 1F9JA 3DDCB 4K1RB 3EFUA 3NOBA 3NUHB 2I1KA 3RI7C 5J2RA 4LDTD 1R4MI 2DYOA 1MVKA 4LDTB 5FKAC 2M19A 2LWPA 2L3ZA 2EKIA 2QEJC 2J42A 1WIAA 3RNEC 3ZRCA 2OJRA 2GBNA 1WJ6A 4C4VA 1T0YA 1ROEA 3R7RA 2XNAC 3H6NA 2JRIB 1I4PA 1UGMA 3VRAB 2M4NA 2RDHA 5FK9C 3R8BA 2INNE 1YD8U 2BWES 4TUUA 2ICIA 5IP4D 3QA8A 3TMPB 4AOFA 1GC7A 3KVFB 3VUYA 1F52A 1GOZA 3QWZB 3UI3A 2JZZA 4CQNA 4J6IA 2BB6A 2KT7A 2GBKA 4WQMA 4NAWB 3H9DA 4MGYE 4FJYA 4RCOA 1VRAB 5EE9A 3V60A 4GXBA 4F8CB 2IZVB 3MJWA 2H89B 1BMLC 1WZ3A 4KZCA 1UD7A 3PTFC 3KQ4A 3A9KA 4A55A 2KLGA 3GB1A 3A9JA 4L2YA 3TEYA 1WR1A 2K9XA 2JYEA 1JQ4A 4MEMA 3PGEA 4F1SA 5G55A 4IKGA 1E0ZA 1WXMA 4MM3B 3WIMA 5CHFA 5HI1A 2ZZPB 3QARA 2KDBA 4AJYB 4JQWC 1FNUA 1WGHA 2AQ3B 3NZUA 5AEKB 1R4NB 1WGGA 2WDQB 2UWQA 4FA6A 4HDQA 2REXA 2LRUA 1L4DB 4BOZB 4AS1A 1L0VB 3L54A 1E8WA 4GSWA 2CHXA 3DPDA 3ZDTA 1L0XB 1D5ZC 1NI3A 3VR9B 1YJ1A 1P0RA 4MGZE 5GXGB 1LM8B 1V81A 1TY0A 2NMQA 2CJNA 5J18A 1C1YB 3AE3B 2L83A 5I4DA 3VTUA 2BS4B 3CSTA 2KC2A 2I1JA 2DX5B 1HTQA 1I4RA 1ZOYB 4ANWA 3PHXB 4ZYSA 5JZEB 3N9YC 5JHAA 3SDLC 2GB1A 4ZHPA 2C7HA 3C8YA 3N20C 2Y5BB 3KUDB 4HPLB 4MACA 3Q8AA 1XLPA 3I63C 1XLOA 2K8BA 1DOYA 2AL6A 1F0ZA 1FFVA 2DBYA 2KMMA 3IAS1 3TIXA 3AE9B 2MH7A 4W9JA 1E7UA 1RRBA 2I38A 4IUMB 1OQRA 2PJHA 3VDZA 5CTRC 1JROA 3AE4B 3AE7B 4AQ7A 1MI0A 4WJQA 4LK0M 1Z5SB 2ZVOA 4II2B 4BZAA 3BINA 3C0RB 3W5VB 1Y8RC 2BYTA 2Z0EB 3GOEA 3AULA 3B0AA 2N9LA 2ZPYA 2JXXA 1TYGB 4G0NB 3FKYA 3PZ7A 4HK2A 5D3DA 2CR5A 4MELA 3RCZA 4MJSB 3SHQA 2KVZA 4M0WB 1E9MA 1QLBB 2I2YA 5JH5C 1TKEA 3W1SA 2JF5A 5E6JA 1FM0D 5BYRA 4OHJA 2KQ7A 1K50A 2LXCA 5C3JB 2YLMA 4A3OA 3ZNHB 3AEBB 3NVVA 2W3SA 1JRUA 2KNBA 2PVGC 3P4RB 4JLCA 1WX8A 1UH6A 5LLIA 3L13A 3PLVA 1YN4A 3SU8X 4USAA 3BK1A 2BQQA 3GE3C 3DHGC 3J9CA 4OW0A 2ZNVB 2K39A 2SEBD 2K8HA 4DK5A 4ICUA 2K25A 3V61A 1HQRD 1H4RA 3LYYA 5EE3A 4KVGB 4P1BC 4ACFA 4F7ZA 2KDIA 2IYDB 4BKTA 2NTTA 3CIRB 4YT0B 1QILA 2FIFA 4HDOA 3SD5A 4IW0A 4LCDE 3DQVA 3C19A 3DVNV 4FXCA 2GBMA 1UBQA 3PT2B 2YVCA 5EE0A 4AJWA 3QAQA 1V8CA 3AI5A 5TSSA 1BT0A 3HRDD 1D3ZA 1WI0A 4OVUA 3H1UA 2RD0A 3PLUA 2L76A 1MFWA 1SJHD 2WXKA 3HHMA 4DHZB 3HVDA 3A1QA 1E5WA 1OTRB 1V97A 4RM8A 4B6WA 4IM2A 3UQAA 1J7BA 2KACA 3LB8C 3N3KB 3BVZA 2C9WB 1V80A 3IAM1 4PS8A 2O6VA 2VH2A 3PVLA 3KLSX 4ICVA 5AZGA 5C23A 1Z2MA 2KN4A 3WAOA 4I6NB 1YJJA 2FUG1 1NDDA 3R7QA 4US8A 2N7JA 2L0TA 4NZLB 2PLPA 4LJPB 1R4MB 2OOBB 1SEBD 2BT6A 4HRSA 1DOIA 4RGTA 2KWUB 3CF6E 1C4PA 4WAAA 1VCBA 2KJ6A 3ZGZA 3DWMA 3ZO5B 3O65B 4MSQB 1IBXA 3N1ZC 4LNKA 1V2YA 1TKGA 2K5PA 2JXTA 3QX1A 4EFOA 3A9KB 4EZJA 1ZXHA 3NG0A 2K8CA 5KHOA 1WYWB 3X0WA 1KM7A 3ZDMC 5IKCM 4MH0E 1B1ZA 2NPTA 2K1FA 1JWSD 1YJIA 3EUB2 2TSSA 2KKCA 1E6EB 1C79A 1L0YB 3ZLZA 2M17A 3M3JA 4JIOU 1I42A 4S0RA 2FAZA 3R3MA 1D4BA 3RMKC 2PE6B 1V5OA 1N5XA 3Q8EA 3KUCB 3EHVA 1TY2A 1SIJA 4BKGA 3CSFA 1ZPSA 3IT4B 4G50A 3V3XA 4DHZE 2C7NB 1V86A 2ASQA 3IG3A 2D3BA 2WS3B 4FJZA 3Q3NC 2N1VA 4EEWA 3WA0A 2MBOA 2MBBB 4FBJB 1EO6A 1I4QA 2WP9B 4XC2A 1EF1A 2WHIA 3U2SC 4N58A 1FRDA 2NBWB 2JZPA 1EU4A 5AUKA 1P7EA 2RR9A 3MC0B 2IPKD 2HTME 1I7HA 1YQ4B 4R3DA 5H8YE 1WXQA 5IO9A 1GJZA 1N5WA 3JSVA 2JWZA 2NBVB 3W9CB 2M56B 2XN9C 3QIJA 1MPEA 4ZHOA 3MP9A 3JYUA 1HXYD 2CU3A 1I4HA 3ZJUA 2DZIA 2EKEC 1FXTB 4MGIE 3QJZA 2MHJA 2J0JA 4EUTA 1WGKA 1PYWD 3MC9A 1CMXB 3AB5A 1QQRA 1NYRA 4LNIA 2V1YA 4KGRA 3HM6X 4JX1C 4PYUA 4KKJA 1TZ1A 4A20A 4B95A 3ALBA 2NR2A 3O13A 3HK0A 3N30A 5AZHA 5IN7A 1VD2A 2WXMA 4DDGD 1AWDA 3ZUNA 5G5HA 1J7AA 3P4QB 3H7PA 5AUIA 1WSPA 5HKHA 3W5UB 3L10B 3U30A 2MEKA 1V49A 2PKOA 3TEZA 4ARIA 3ML8A 4FULA 2JYTA 5DPRA 4RF1A 4EOYA 3BY4B 5DCNA 4HEA1 2WXGA 2YEPF 3AE6B 4W9HA 4DXFA 1WWTA 4W9EA 4WWPA 2JUOA 2WDTB 4A90A 2W9NA 1ZE3D 2N4FA 3TEWA 2WDVB 3RZFA 1NI2A 1UZXB 2VRRB 2D5GA 2KDFB 5JXVA 1SSNA 2W3RA 3GZNI 2IY1B 1EF5A 2KMCA 5FR6A 4BFRA 2PW9A 1ENFA 1UNSA 4KV2A 1FRRA 4HWIB 4A3PA 1WE6A 4PT5A 2MP2A 3HIZA 2QIEB 3ETRA 1FNVA 2M8SA 1YX5B 3DHIC 3AU4A 3RNAC 5HFYA 4WJPA 2L0FA 2CS4A 4TMAB 1JW9D 2GLSA 2G3QB 3TUOA 2V4IB 2JWUA 2KK8A 2KJHB 2DNFA 4JE3B 4JL9A 4TKNA 2WU2B 3Q6BA 4LLGM 3B2GA 3QK0A 1N62A 1V1PA 4HVBA 1UF0A 2VZKB 2G9HD 3A1QB 3EA6A 5DPWA 2L7RA 3PREA 4RM9A 1WZ0A 2LXAA 2BWFA 3U4EG 3T3NA 3OLMD 3W2DA 2LGXA 3ZW3A 3DVGX 4KDIC 1OQQA 2UYZB 3PRZA 1L7YA 1N61A 3APDA 2WXHA 1N6ZA 2JT4B 2Q5WD 5KHQA 2KYWA 1TJEA 3V62A 4IM0A 2FCNA 2K22A 1C77A 5MPOA 3Q8BA 4IWOA 2QHOA 2XK5A 1FXIA 3NVZA 4B9KA 4BKSD 1E8ZA 4P7IA 2BB5A 2A5UA 2CJOA 1E10A 2MBEA 4REZA 1J7CA 4RGNA 3Q69A 2W55A 4UDUC 4Q2JA 5IAAC 5L95C 4RGOS 3WANA 3A4RA 1XF5L 3PRMB 3X23A 3VH4B 3RYTA 4BBNF 4M8NA 4ARCA 3U7DA 3QCAA 2DZKA 2NPTB 4WH4A 3FILB 2LZ6A 2BGFA 2KFKA 1CQVA 2V4LA 2INPE 3NRZA 4MGKE 3WALA 3NVYA 1S1QB 3PV1A 4K7UA 1VR9A 1T5XD 4XDDA 2NBUA 1T6BX 2R2OA 2WXRA 5J17A 3ZKJC 4YSYB 5C1ZA 3VXWA 1PGXA 1P3QU 2GOWA 4YTNB 4II3B 4ANVA 1HA5A 1EU3A 2LHDA 1FEHA 4PYZA 1SE2A 1OQYA 2ZCBA 1JMLA 1GPXA 4PS7A 1XXGA 1YQ3B 3B1LX 2WX0A 2IO2B 4G3XB 4RH6A 1BXTA 3HVZA 2KTRB 1WMHA 4JPSA 1XQQA 3AM9A 4MT5A 4J3OD 1LFDA 2MJEA 3KWLA 2DENB 4ZRPA 1WRIA 3QC8B 1TS4A 2K6DB 3ZTDA 4ZOHC 1D6EC 1SXTA 3L17A 1FCCC 4US9A 2ACZB 2KN5A 3VR8B 2MQJA 3M63B 4HJGE 1ZDXA 3OJ4B 4WWMA 2X8XX 3P63A 4ITKA 1QT9A 1YMHE 2O2VB 2Y3AA 5D2MB 1F77A 4N9F4 3GP7A 3BZDB 2L32A 2CKHB 4HCNB 4RF0A 1N60A 4HROA 2MX2A
chains in the Genus database with same CATH topology
4DXGA 1C4PA 1RYJA 1FD6A 1ET9A 1L6UA 3ZGZA 1TKYA 3CWIA 1EM7A 3DWMA 3AE1B 1UGJA 1FXAA 1FFUA 1Q10A 1PDXA 3AEDB 4YTPB 3FAHA 3TSSA 1DOXA 1JWAD 4KGSA 1IBXA 2WXIA 2X38A 1LO5D 1TKGA 1L6VA 2K5PA 2JXTA 2FBWB 1R7SA 4KKIA 3VRBB 2ON8A 1BUIC 2N0SB 1FCLA 5EE1A 1XLNA 1ZXHA 3B2FA 2MJDA 1QF6A 1KH0A 1SBBB 1IBXB 2IJ0A 1YN5A 1IUEA 1K51A 1L5PA 3BVGA 1B1ZA 2LGIA 5H92C 1JWSD 1YJIA 3BK2A 3RFZB 3EUB2 4OVZA 4XWWA 2TSSA 5D7GA 1E6EB 3AE8B 3IXSA 2V3NA 2WXLA 1C79A 1VDVA 4GDLB 4KX6B 4HKQA 1L0YB 4WAFA 1K52A 1QOGA 2GI9A 4XWTA 3MHZA 1D4BA 3PO0A 2QSDA 2Y5PA 1N5XA 3ZJTA 3Q8EA 2JU6X 1UWXA 2V3PA 3WCQA 4RNAA 3SR6A 4XDCA 1T3QA 2LMCA 1TY2A 1SIJA 1ESFA 3NUHB 1PGAA 1ZPSA 3IT4B 1DGJA 3V3XA 1XO3A 2DYOA 1MVKA 5FKAC 2M19A 1STEA 2FE8A 1KRHA 1KLGD 5HHDG 1XCTL 2EKIA 2QEJC 1QOBA 4L23A 2J42A 1I4XA 3HUIA 2WS3B 1ET6A 4MH8A 2IDYA 2OHFA 2EELA 3PZ8A 1FMAD 1QOAA 3SEBA 1I4QA 3Q8FA 2WP9B 1C9FA 3U2SC 2WXOA 1ROEA 4N58A 2XNAC 1FRDA 1TS5A 5G5GA 2AQ1B 2AQ2B 1I4PA 1EU4A 2JZPA 3IT6B 5AUKA 1P7EA 3MC0B 3VRAB 3Q8CA 2RDHA 5FK9C 2IPKD 2E6XA 2HTME 2JQRB 3R8BA 1I7HA 2INNE 1JALA 1YQ4B 3VQIA 2KAJA 3H8HA 4R3DA 5H8YE 1WXQA 2ICIA 1SF0A 2L1AA 4OZAA 1RFKA 3ZJVA 1N5WA 1GOZA 3UI3A 1C4AA 4CQNA 3MFGA 2BB6A 4C80A 1JWBD 1YN3A 4HKZE 4WQMA 2IGDA 2ZW0A 4NAWB 3BYYB 3W9CB 2M56B 4DQOC 2BS2B 2XN9C 1MPEA 4ZHOA 3NS1A 2MJ3A 3MP9A 4RCOA 1VRAB 1GAQB 1HXYD 3SFEB 5EE9A 5BMHA 2K0PA 2CU3A 1I4HA 3B9JA 4WURA 2WXNA 3ZJUA 3AH7A 1IGDA 1V1OA 2H89B 3E56A 1CK1A 1BMLC 4JWUC 2L52A 4A8XC 1WGKA 3AV8A 1PYWD 3AB5A 1QQRA 1ZP0B 4JWSC 2YEPB 1TZOA 3R2TA 1NYRA 1VZ8A 2WLBA 1HZ5A 3KQ4A 4A55A 5C2TB 1FNWA 2RDGA 3P4SB 4KGRA 4JX1C 3P4PB 1PFDA 3GB1A 4KKJA 4L2YA 3U52E 3TEYA 2K9XA 3O13A 4IDIA 1EWYC 1HZ6A 2JYEA 2QJLA 4RFBA 1XCQL 1JQ4A 2WXMA 1DYQA 3I57A 1AWDA 4IKGA 1E0ZA 4MM3B 2IGHA 5HI1A 5G5HA 1J7AA 2BS3B 3P4QB 4B0EA 5AUIA 1WSPA 2KWDA 1ZDVA 4TSSA 3W5UB 2MEKA 2PKOA 3TEZA 4ARIA 1FNUA 2AQ3B 1MHXA 2JYTA 2WDQB 4RF1A 4YXDB 1F2RC 1L4DB 1IGCA 2IGGA 2JX5A 1NEKB 4HEA1 4AS1A 2WXGA 1L0VB 1SB3C 2YEPF 3AE6B 1RM6C 2JSVX 4YSXB 4DXFA 1L0XB 1DOIA 1C4CA 3AEEB 4HRSA 1WWTA 4TQ0A 1KFYB 1D5ZC 1NI3A 3VR9B 4A90A 3NVWA 5GXGB 1ZE3D 1TY0A 2NMQA 1RWSA 2CJNA 2LHEA 2WDVB 4LTUA 3TEWA 4H2AA 2N9KA 1VJKA 5T8IA 2D5GA 2L83A 3AE3B 5JXVA 5I4DA 1SSNA 2W3RA 1FO4A 3T3OA 2M0AA 2BS4B 1M4VA 3NZ3A 3AEAB 2PW9A 1ENFA 4NAMA 1I4RA 1UNSA 1ZOYB 1FRRA 4ZYSA 3N9YC 4PT5A 2W82A 2GB1A 2QIEB 4ZHPA 2LJIA 3C8YA 4YWGG 3ETRA 1FNVA 3URYA 4MACA 4C7ZA 3Q8AA 1XLPA 3MJ5A 2PMVA 1XLOA 5BMIA 1DOYA 2B76B 5HFYA 3ABVB 1F0ZA 3OWEB 1FFVA 2DBYA 2KMMA 3IAS1 4TMAB 2WNMA 1WYGA 1JW9D 2KDMA 3GS2A 3TUOA 3P1MA 3P42A 2RMMA 2V4IB 3AE9B 2MH7A 4GLSC 2V0GA 2JWUA 2Y5CA 1C78A 2QILA 1UUPA 3I9V1 2I38A 4EE2A 4JE3B 4IOIE 1TS2A 2WU2B 3TEXA 2DYMA 4LLGM 1OQRA 3B2GA 4YSZB 1PUTA 1N62A 1JROA 1KTKA 3LXFA 2WDRB 3AE4B 1KLUD 1V1PA 3AE7B 4AQ7A 1MI0A 2VZKB 1K53A 5FR3A 1F2RI 2G9HD 1PGBA 3EA6A 4LK0M 1SE3A 1N63A 1QKZA 1AYFA 4C7YA 1MHHE 3W5VB 3U4EG 2J53A 3T3NA 2BYTA 1QOFA 3W2DA 4M0WA 1JRPA 2NTSA 1UWMA 1V1PB 1I4GA 1OQQA 2N9LA 3L4PA 1TYGB 3PZ7A 5D3DA 2BW2A 1N61A 2WXHA 2Q5WD 2QMTA 1XLQA 1TJEA 1E9MA 2J52A 3DWGC 4B0MA 1QLBB 2I2YA 1TKEA 5HG2A 2K22A 2SAKA 3W1SA 4TQ1A 4RGMA 2PIAA 1C77A 1Y56A 5E6JA 5MPOA 1FM0D 5BYRA 3Q8BA 1VZ6A 4OHJA 1D5MC 1K50A 1VZ7A 4N6EB 1FXIA 2R61A 3NVZA 1C76A 5C3JB 1D5XC 3AEBB 3NVVA 1AW7A 2BBCA 2LEKA 2WQYB 2W3SA 3KWVA 2PVGC 4ZRQA 3P4RB 2BB5A 4A6QA 2CJOA 1E10A 1YNTE 4REZA 1J7CA 4RGNA 3Q69A 1ACCA 4YTMB 1YN4A 2W55A 4UDUC 4Q2JA 4USAA 1ZUD2 3BK1A 1CJEA 1EWCA 4RGOS 2PTLA 3ZYYX 2W54A 5LNK1 3J9CA 4OW0A 3E9SA 2SEBD 2WXJA 2KQ4X 1XEEA 3BWUD 3FILA 4O1NA 4XE0A 1XF5L 3AEFB 1FIQA 1KF6B 1ZXIA 1P7FA 1NYQA 4ARCA 1HQRD 3LYYA 5EE3A 2BTEA 4WH4A 3FILB 2AX5A 1TS3A 3AEGB 4A9AA 1A70A 2WXPA 2LUMA 1CQVA 1JCKB 2INPE 2NTTA 3CIRB 1QILA 3NRZA 3NVYA 4YT0B 2Z8LA 3BIID 4XDDA 1VR9A 1T5XD 4OZCA 1SE4A 1NENB 1GB1A 1T6BX 2WXRA 4FXCA 5D3IB 2G1EA 4YSYB 5EE0A 3AN1A 1PGXA 4YTNB 1V8CA 1HA5A 5TSSA 1EU3A 2LHDA 3AMZA 3HRDD 1FEHA 1SE2A 2ONQA 3SFDB 5BMGA 5BYQA 1E7PB 1SJHD 1JMLA 1GPXA 3BYTB 1CZPA 2WXKA 3R2IA 1XXGA 1YQ3B 1HEZE 2WU5B 3HVDA 2E3TA 4RH6A 1BXTA 3HVZA 1OFFA 3AE5B 3FC4A 3BVMA 1V97A 2HDEA 4JPSA 2DLBA 1AN8A 3AM9A 4KGTA 4MT5A 2MJEA 2K3UA 4J3OD 1J7BA 2KACA 3KWLA 3LB8C 2OEDA 2VZKD 4ZRPA 1WRIA 3U7ZA 2RPVA 3BVZA 1TS4A 2H88B 1D6EC 2LFIA 4ZOHC 3RPFC 1SXTA 1FCCC 3IAM1 4US9A 2ACZB 2WXQA 2GRIA 5BYSA 1JWMD 1GB4A 1SJED 3VR8B 2PVOD 1NVID 3EGRA 4HJGE 1ZDXA 3KLSX 4WWMA 2KN4A 2DWQA 3P63A 4ITKA 1YJJA 1L4ZB 2FUG1 3V05A 1QT9A 2WXFA 1VLBA 1YMHE 4OZBA 2Y3AA 1B9RA 4US8A 1F77A 3AE2B 2N7JA 4L1BA 4NZLB 1JWUD 3GP7A 4C56C 3BZDB 2L32A 3ZQ4A 2PLPA 4P16A 4N59A 2ZW1A 4GDKB 4NJCA 4RF0A 4D2KA 1N60A 2J4XA 4HROA 3AECB 4WIPA 1SEBD 2BT6A 4RGTA 4P6VF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1C78 A;  1SSN A;  1BUI C;  1C79 A;  2SAK A;  1C77 A;  1C76 A; 
#chains in the Genus database with same CATH topology
 5DPS A;  4HCP B;  1ET9 A;  1WXV A;  2LD9 A;  3AED B;  2MBQ A;  3ZNZ B;  1DOX A;  2EMS A;  4E74 A;  4KGS A;  3P2B A;  1LO5 D;  4EKU A;  3UQB A;  3S2A A;  4ASW C;  2IY0 B;  1SE9 A;  1FCL A;  4FLH A;  3RD2 A;  2BYF A;  2MJD A;  1QF6 A;  1SBB B;  2ZNV C;  1IUE A;  2BVC A;  5H92 C;  1WY8 A;  4OVZ A;  5D7G A;  2V3N A;  2WXL A;  4HKQ A;  3ZIM A;  2N9E B;  1K52 A;  2KX3 A;  3AU5 A;  4W9L A;  2MSE D;  3DVG Y;  3PO0 A;  3OAW A;  4KDL B;  2QSD A;  1WXA A;  2JU6 X;  3SR6 A;  2WGS A;  3ZNI D;  2LVO A;  5E6P A;  1DGJ A;  4GMV A;  4M01 A;  1STE A;  2FE8 A;  1KRH A;  2HJ8 A;  1WX7 A;  1XCT L;  2FID A;  4L23 A;  1I4X A;  1WX9 A;  1ET6 A;  2OJW A;  3GE8 C;  4MH8 A;  1KOT A;  2OHF A;  2EEL A;  3PZ8 A;  1FMA D;  1QOA A;  3SEB A;  3RNG C;  3Q8F A;  1C9F A;  1EUV B;  3TCA A;  3VUX A;  2AQ1 B;  5LXH A;  2AQ2 B;  1MJD A;  2E6X A;  3V6C B;  1OGW A;  1JAL A;  4KSL C;  4C4V B;  1WGD A;  4OZA A;  4NAW A;  1RFK A;  3DBR I;  4W9C A;  2MP2 B;  3TBL D;  5D94 A;  3MFG A;  3IFW B;  4C80 A;  1KJT A;  1YN3 A;  3N1X C;  2IGD A;  3BYY B;  4DQO C;  2BS2 B;  4HXD A;  3NS1 A;  4FN2 A;  2HJ1 A;  3B9J A;  1OEY A;  1XT9 B;  1GNU A;  2N7E A;  2C60 A;  3ENE A;  1IGD A;  3U8Z A;  2D2Q A;  1V6E A;  1V1O A;  1CK1 A;  3LDZ E;  2L52 A;  4JGH B;  1SGH A;  4KZ0 A;  4JWS C;  3GZN B;  3R2T A;  1AAR A;  1UBI A;  1VZ8 A;  2WLB A;  3P4S B;  3P4P B;  1PFD A;  2D3G A;  4MM3 A;  2WWZ A;  1V5T A;  1ZW7 A;  1HZ6 A;  4RFB A;  4GOC A;  3KW5 B;  3I57 A;  3A9J B;  4GDL A;  2IGH A;  3NJT A;  2ZJD A;  4TSS A;  1TGZ B;  2R2Q A;  5D6J B;  1ISN A;  3DBS A;  3RZW C;  2DYB A;  5G2N A;  2G4D B;  1C3T A;  4YXD B;  2Z0D B;  2LGD A;  2K6Q A;  2ZVN A;  2IGG A;  2JX5 A;  2NS5 A;  1RM6 C;  4YSX B;  1TT5 B;  2BKR B;  4E3C A;  3AEE B;  1I35 A;  4TQ0 A;  1E7V A;  4FJV B;  4BAX A;  4KSK C;  2G4S A;  2GMI C;  2JVC A;  3M95 A;  2AYO B;  3ZTC A;  2LUE A;  2M0X A;  2D11 A;  4I6L B;  4H2A A;  2N9K A;  1VJK A;  5T8I A;  4M00 A;  3V6E B;  4HLE A;  4X57 B;  1WM2 A;  1WGY A;  5CHW A;  3EC8 A;  3QQ8 B;  2LJI A;  4HJK A;  1IP9 A;  2KLC A;  4YWG G;  3URY A;  1RLF A;  3T9L A;  3MJ5 A;  3ABV B;  4WWN A;  1TIF A;  3APC A;  3TL5 A;  2J7Q B;  3PS6 A;  2AEH A;  1ZKH A;  3GS2 A;  3P1M A;  2RMM A;  4AUQ C;  4GLS C;  2V0G A;  1ZGU B;  2Y5C A;  2UU7 A;  1C78 A;  1Q5W B;  1UUP A;  2QIL A;  3I9V 1;  4IOI E;  3TEX A;  2DYM A;  4LNO A;  1PUT A;  2KWV B;  5CX3 A;  3RNF C;  1KTK A;  3LXF A;  2LRW A;  3A33 B;  2WDR B;  5FR3 A;  2XEW A;  1F2R I;  4IC7 B;  4AP4 C;  1WMH B;  2KC1 A;  2KD0 A;  1AYF A;  4NQK E;  4C7Y A;  1YX6 B;  3VUW A;  2N9X A;  1MHH E;  1LXD A;  2J53 A;  1QOF A;  4M0W A;  2NTS A;  1V9J A;  3L4P A;  2BPS A;  2QMT A;  1TBE A;  4QAY A;  3IVF A;  1Q0W B;  4OVV A;  3D32 A;  2D10 A;  5HG2 A;  2SAK A;  2FCM A;  2QCZ A;  4TQ1 A;  4RGM A;  1Y56 A;  2D07 B;  1VZ6 A;  3ECI A;  3WAM A;  1D5M C;  3W1S C;  2MCN B;  2LVQ A;  4ZRJ A;  2BBC A;  2LEK A;  4WJO A;  3KWV A;  3L0W B;  2KDE B;  2JRH A;  4ZRQ A;  3JW0 X;  4A6Q A;  4K3C A;  2DAF A;  4YTM B;  3PPA A;  3ML9 A;  1ZUD 2;  1UEL A;  1KLV A;  2PTL A;  3DCG A;  3ZYY X;  2MLB A;  2W54 A;  5LNK 1;  1K8R B;  3E9S A;  4NPN A;  3RT3 B;  1XEE A;  1QZE A;  2MBH A;  4MSM B;  1J8C A;  1Q1O A;  4G11 A;  1X1M A;  3IBE A;  4LJO B;  1KF6 B;  1NYQ A;  1HE8 A;  2KFJ A;  2VH1 A;  3AEG B;  1A70 A;  1LGR A;  4K3B A;  2WXP A;  2Z8L A;  1P98 A;  1WRD B;  2KVR A;  2LVP A;  1SE4 A;  2FUH B;  4FHK A;  2A4Z A;  2XBB C;  2G1E A;  3DHH C;  5GMV A;  1OEY J;  3UIN B;  3QHT A;  4NNJ B;  1TTN A;  3SFD B;  2BYE A;  5BYQ A;  4XX5 A;  1CZP A;  1RFA A;  2CU1 A;  3R2I A;  3R66 C;  3I5J C;  2DHZ A;  2PE9 A;  3DBH I;  2D3C A;  3BVM A;  3OJ3 A;  4KGT A;  2MA9 B;  2OED A;  2VZK D;  3U7Z A;  4W9K A;  2RPV A;  1WH3 A;  1T0Q C;  2LFI A;  1P1A A;  4DBG A;  2WXQ A;  4ANU A;  1JWM D;  1GB4 A;  1SJE D;  2PVO D;  4W9F A;  2QDF A;  2O6V D;  4ZRI A;  1L4Z B;  2DZM A;  4RMA A;  2O6V B;  3VFK A;  4OZB A;  1B9R A;  1NBF C;  1YQB A;  1RAX A;  3ZQ4 A;  4P16 A;  4NJC A;  2IND C;  4D2K A;  2J4X A;  3ZXR A;  1XD3 B;  4EZK A;  1T0S C;  4DXG A;  1RYJ A;  1FD6 A;  1L6U A;  4DXA B;  1TKY A;  1WM3 A;  3CWI A;  3AE1 B;  3RNC C;  1UGJ A;  1FFU A;  1Q10 A;  1PDX A;  3EFC A;  1H8C A;  3TSS A;  5DPT A;  3DBL I;  2X38 A;  3NS8 A;  2C7M B;  1R7S A;  3VRB B;  1J0G A;  2ON8 A;  1BUI C;  2EMT A;  4ANX A;  3UIP B;  4W9D A;  1XLN A;  3B2F A;  3ZRF A;  1KH0 A;  1MG8 A;  1IBX B;  1YN5 A;  4CYE A;  1K51 A;  3DBR B;  3RUL A;  1IPG A;  2AL3 A;  2RDB C;  4MDK E;  2LGS A;  2LGI A;  3K9O B;  3MTN B;  2KJR A;  3IXS A;  4KX6 B;  4GDL B;  4WAF A;  3UIO B;  2GI9 A;  4XGA B;  1E8Y A;  2Y5P A;  3OG5 A;  1UWX A;  2V3P A;  4KIK A;  3WCQ A;  2L8J A;  2PEA A;  4XDC A;  2RGF A;  1T3Q A;  2LMC A;  4DWF A;  1ESF A;  2V9H A;  1PGA A;  1XO3 A;  1KLG D;  5HHD G;  1QOB A;  4XYC A;  3HUI A;  2JZ3 B;  4IWQ A;  2IDY A;  1WR6 E;  4LNN A;  2WXO A;  2KTF A;  4FAD A;  2INC C;  1TS5 A;  5G5G A;  4WWO A;  3IT6 B;  3Q8C A;  2JQR B;  3EEC A;  3VQI A;  2KAJ A;  4AWJ A;  3H8H A;  5L83 A;  1SF0 A;  2L1A A;  2KWC A;  4IM3 A;  3ZJV A;  4NY0 A;  1C4A A;  1JWB D;  3NHE B;  4HKZ E;  2ZW0 A;  3Q3M C;  4GDK A;  3LJ3 A;  4GIV A;  1GUA B;  4FHJ A;  3HM3 A;  2MJ3 A;  4IWP A;  3JSV B;  3SFE B;  1GAQ B;  5BMH A;  2K0P A;  2L05 A;  4NQL B;  4WUR A;  1WFY A;  2FCS A;  2WXN A;  5BO4 B;  4ZRK A;  3L08 A;  3AH7 A;  3PRP B;  3E56 A;  4JWU C;  4A8X C;  3AV8 A;  1WJN A;  2QC8 A;  1ZP0 B;  2YEP B;  2LGY A;  1TZO A;  1WE7 A;  1HZ5 A;  5C2T B;  1FNW A;  2RDG A;  4S17 A;  3U52 E;  5EDS A;  1GG3 A;  4DHJ D;  2MRP A;  4IDI A;  3W1Y A;  1EWY C;  2QJL A;  1XCQ L;  4DHJ B;  1DYQ A;  2G45 B;  3KYD D;  3Q2A C;  2BS3 B;  4B0E A;  2ZEQ A;  1WF9 A;  3UF8 A;  2KWD A;  2KZR A;  1ZDV A;  2KHW B;  2KX0 A;  1PQS A;  3KYC D;  1IYF A;  1MHX A;  3VH3 B;  1F1H A;  3NZS A;  2J0K A;  2DZJ A;  3H7P B;  2L00 B;  1F2R C;  1IGC A;  1NEK B;  4GB9 A;  1SB3 C;  2JSV X;  2IO1 B;  2CHW A;  3TJP A;  2N1W A;  1C4C A;  1KFY B;  3PHW B;  3NVW A;  3RN9 C;  4BOS C;  2LAS A;  3DVN U;  1RWS A;  2LHE A;  4LTU A;  2BF8 B;  4GU2 A;  2AWT A;  3Q14 C;  1FO4 A;  3T3O A;  2FCQ A;  2M0A A;  2CHZ A;  1M4V A;  2HD5 B;  3NZ3 A;  3AEA B;  4NAM A;  2HE7 A;  3A4S C;  2C5L C;  2W82 A;  1FPY A;  3IHP C;  4EZL A;  5IA7 A;  3VTV A;  4C7Z A;  5TR5 A;  1WJ4 A;  1A5R A;  2PMV A;  5BMI A;  1MG4 A;  2B76 B;  3WAP A;  3OWE B;  4K7W A;  2KMA A;  4K7S A;  2WNM A;  4URK A;  1WYG A;  2KDM A;  3P42 A;  3PSE B;  3VTW A;  3NY5 A;  2KXJ A;  1R4N I;  2RSU A;  4TV3 A;  4LNF A;  4EE2 A;  4M02 A;  3ZNG C;  1TS2 A;  4YSZ B;  1KLU D;  1K53 A;  1PGB A;  1SE3 A;  1N63 A;  1QKZ A;  3B08 A;  3DOW A;  1JRP A;  1UWM A;  1V1P B;  1I4G A;  4PS3 A;  5E6N A;  4BBN C;  2Z59 B;  2ZPN A;  2BW2 A;  3RNB C;  2WX1 A;  1P9D U;  1XLQ A;  4K81 A;  2J52 A;  3DWG C;  3L16 A;  4BVU C;  2N7D A;  4B0M A;  5AZF A;  4BKS A;  2PIA A;  3VVW B;  1LQB A;  1L2N A;  1VZ7 A;  4N6E B;  2R61 A;  4NJ6 A;  1C76 A;  4HPP A;  1D5X C;  1S3S G;  4W9I A;  2JY6 A;  1AW7 A;  2WQY B;  2JPH A;  3VAW A;  3M62 B;  4GGQ A;  3Q3J A;  4DDI D;  4CO7 A;  3DBH B;  1YNT E;  1ACC A;  2XK5 B;  4XZ4 A;  3I3T B;  1CJE A;  1EWC A;  4P1C C;  2BKF A;  2RPQ A;  3APF A;  1U4A A;  2LJ5 A;  2WXJ A;  2KQ4 X;  3BWU D;  3FIL A;  2HTH A;  3JVZ X;  4O1N A;  1M94 A;  4XE0 A;  1T0R C;  2GBR A;  1SIF A;  4WJN A;  1WGR A;  3AEF B;  1FIQ A;  2V3S A;  4ZDV A;  1ZXI A;  1P7F A;  2IO0 B;  2BYV E;  2BTE A;  1YIW A;  2AX5 A;  1TS3 A;  4A9A A;  2LUM A;  1JCK B;  2ZCC A;  3BII D;  4HPM B;  4OZC A;  3H7S A;  4C00 A;  1NEN B;  1GB1 A;  3VHT C;  5D3I B;  2MWS B;  1E90 A;  3AN1 A;  4KIK B;  2KFK B;  4ZYN A;  4W9G A;  2KQS A;  2DAJ A;  2KTR A;  3AMZ A;  3DBL B;  2ONQ A;  5BMG A;  3Q3O C;  5E6O A;  1E7P B;  3BYT B;  1HEZ E;  2B3A A;  2WU5 B;  2E3T A;  2WYQ A;  5JHB A;  4CHK A;  1OFF A;  3FC4 A;  3AE5 B;  4E71 A;  2HDE A;  2DLB A;  2D3A A;  1AN8 A;  2NCN A;  2K3U A;  1YOV B;  4NJ7 A;  3AXC A;  3MHS D;  2M1M A;  4IG7 B;  3ZVV A;  2H88 B;  3ZXV A;  3RPF C;  3K9P B;  1HTO A;  2GRI A;  2O2V A;  2MW5 A;  5BYS A;  1NVI D;  3EGR A;  4MJS A;  2DWQ A;  2NVU I;  3V05 A;  4I6P A;  2WXF A;  1VLB A;  3AE2 B;  4L1B A;  5IOI A;  1JWU D;  4C56 C;  4N59 A;  2ZW1 A;  4M8M A;  4GDK B;  3KUZ A;  1GC6 A;  3AEC B;  4WIP A;  2IO3 B;  4P6V F;  1J19 A;  3N1Y C;  2J0M A;  1EM7 A;  2KOX A;  1FXA A;  4YTP B;  3FAH A;  1WJU A;  1JWA D;  5LXI B;  2KAN A;  3KH0 A;  4PK1 A;  2WXI A;  1L6V A;  2KO3 A;  2FBW B;  4KKI A;  3RUI B;  2N0S B;  5EE1 A;  4WQO B;  2N9P C;  2IJ0 A;  3CMM B;  3T8M A;  2PPH A;  1L5P A;  4YL8 A;  3BVG A;  1G6J A;  2GBJ A;  3BK2 A;  3Q3F A;  3RFZ B;  4XWW A;  3ONS A;  2LI5 A;  3PZD A;  3MC8 A;  1E8X A;  3AE8 B;  4GN1 A;  1VDV A;  1QOG A;  3UGB B;  4XWT A;  1WXS A;  2FNJ B;  2IBI B;  3MHZ A;  3N32 A;  3ZJT A;  5CHV C;  4RNA A;  1F9J A;  3DDC B;  4K1R B;  3EFU A;  3NOB A;  3NUH B;  2I1K A;  3RI7 C;  5J2R A;  4LDT D;  1R4M I;  2DYO A;  1MVK A;  4LDT B;  5FKA C;  2M19 A;  2LWP A;  2L3Z A;  2EKI A;  2QEJ C;  2J42 A;  1WIA A;  3RNE C;  3ZRC A;  2OJR A;  2GBN A;  1WJ6 A;  4C4V A;  1T0Y A;  1ROE A;  3R7R A;  2XNA C;  3H6N A;  2JRI B;  1I4P A;  1UGM A;  3VRA B;  2M4N A;  2RDH A;  5FK9 C;  3R8B A;  2INN E;  1YD8 U;  2BWE S;  4TUU A;  2ICI A;  5IP4 D;  3QA8 A;  3TMP B;  4AOF A;  1GC7 A;  3KVF B;  3VUY A;  1F52 A;  1GOZ A;  3QWZ B;  3UI3 A;  2JZZ A;  4CQN A;  4J6I A;  2BB6 A;  2KT7 A;  2GBK A;  4WQM A;  4NAW B;  3H9D A;  4MGY E;  4FJY A;  4RCO A;  1VRA B;  5EE9 A;  3V60 A;  4GXB A;  4F8C B;  2IZV B;  3MJW A;  2H89 B;  1BML C;  1WZ3 A;  4KZC A;  1UD7 A;  3PTF C;  3KQ4 A;  3A9K A;  4A55 A;  2KLG A;  3GB1 A;  3A9J A;  4L2Y A;  3TEY A;  1WR1 A;  2K9X A;  2JYE A;  1JQ4 A;  4MEM A;  3PGE A;  4F1S A;  5G55 A;  4IKG A;  1E0Z A;  1WXM A;  4MM3 B;  3WIM A;  5CHF A;  5HI1 A;  2ZZP B;  3QAR A;  2KDB A;  4AJY B;  4JQW C;  1FNU A;  1WGH A;  2AQ3 B;  3NZU A;  5AEK B;  1R4N B;  1WGG A;  2WDQ B;  2UWQ A;  4FA6 A;  4HDQ A;  2REX A;  2LRU A;  1L4D B;  4BOZ B;  4AS1 A;  1L0V B;  3L54 A;  1E8W A;  4GSW A;  2CHX A;  3DPD A;  3ZDT A;  1L0X B;  1D5Z C;  1NI3 A;  3VR9 B;  1YJ1 A;  1P0R A;  4MGZ E;  5GXG B;  1LM8 B;  1V81 A;  1TY0 A;  2NMQ A;  2CJN A;  5J18 A;  1C1Y B;  3AE3 B;  2L83 A;  5I4D A;  3VTU A;  2BS4 B;  3CST A;  2KC2 A;  2I1J A;  2DX5 B;  1HTQ A;  1I4R A;  1ZOY B;  4ANW A;  3PHX B;  4ZYS A;  5JZE B;  3N9Y C;  5JHA A;  3SDL C;  2GB1 A;  4ZHP A;  2C7H A;  3C8Y A;  3N20 C;  2Y5B B;  3KUD B;  4HPL B;  4MAC A;  3Q8A A;  1XLP A;  3I63 C;  1XLO A;  2K8B A;  1DOY A;  2AL6 A;  1F0Z A;  1FFV A;  2DBY A;  2KMM A;  3IAS 1;  3TIX A;  3AE9 B;  2MH7 A;  4W9J A;  1E7U A;  1RRB A;  2I38 A;  4IUM B;  1OQR A;  2PJH A;  3VDZ A;  5CTR C;  1JRO A;  3AE4 B;  3AE7 B;  4AQ7 A;  1MI0 A;  4WJQ A;  4LK0 M;  1Z5S B;  2ZVO A;  4II2 B;  4BZA A;  3BIN A;  3C0R B;  3W5V B;  1Y8R C;  2BYT A;  2Z0E B;  3GOE A;  3AUL A;  3B0A A;  2N9L A;  2ZPY A;  2JXX A;  1TYG B;  4G0N B;  3FKY A;  3PZ7 A;  4HK2 A;  5D3D A;  2CR5 A;  4MEL A;  3RCZ A;  4MJS B;  3SHQ A;  2KVZ A;  4M0W B;  1E9M A;  1QLB B;  2I2Y A;  5JH5 C;  1TKE A;  3W1S A;  2JF5 A;  5E6J A;  1FM0 D;  5BYR A;  4OHJ A;  2KQ7 A;  1K50 A;  2LXC A;  5C3J B;  2YLM A;  4A3O A;  3ZNH B;  3AEB B;  3NVV A;  2W3S A;  1JRU A;  2KNB A;  2PVG C;  3P4R B;  4JLC A;  1WX8 A;  1UH6 A;  5LLI A;  3L13 A;  3PLV A;  1YN4 A;  3SU8 X;  4USA A;  3BK1 A;  2BQQ A;  3GE3 C;  3DHG C;  3J9C A;  4OW0 A;  2ZNV B;  2K39 A;  2SEB D;  2K8H A;  4DK5 A;  4ICU A;  2K25 A;  3V61 A;  1HQR D;  1H4R A;  3LYY A;  5EE3 A;  4KVG B;  4P1B C;  4ACF A;  4F7Z A;  2KDI A;  2IYD B;  4BKT A;  2NTT A;  3CIR B;  4YT0 B;  1QIL A;  2FIF A;  4HDO A;  3SD5 A;  4IW0 A;  4LCD E;  3DQV A;  3C19 A;  3DVN V;  4FXC A;  2GBM A;  1UBQ A;  3PT2 B;  2YVC A;  5EE0 A;  4AJW A;  3QAQ A;  1V8C A;  3AI5 A;  5TSS A;  1BT0 A;  3HRD D;  1D3Z A;  1WI0 A;  4OVU A;  3H1U A;  2RD0 A;  3PLU A;  2L76 A;  1MFW A;  1SJH D;  2WXK A;  3HHM A;  4DHZ B;  3HVD A;  3A1Q A;  1E5W A;  1OTR B;  1V97 A;  4RM8 A;  4B6W A;  4IM2 A;  3UQA A;  1J7B A;  2KAC A;  3LB8 C;  3N3K B;  3BVZ A;  2C9W B;  1V80 A;  3IAM 1;  4PS8 A;  2O6V A;  2VH2 A;  3PVL A;  3KLS X;  4ICV A;  5AZG A;  5C23 A;  1Z2M A;  2KN4 A;  3WAO A;  4I6N B;  1YJJ A;  2FUG 1;  1NDD A;  3R7Q A;  4US8 A;  2N7J A;  2L0T A;  4NZL B;  2PLP A;  4LJP B;  1R4M B;  2OOB B;  1SEB D;  2BT6 A;  4HRS A;  1DOI A;  4RGT A;  2KWU B;  3CF6 E;  1C4P A;  4WAA A;  1VCB A;  2KJ6 A;  3ZGZ A;  3DWM A;  3ZO5 B;  3O65 B;  4MSQ B;  1IBX A;  3N1Z C;  4LNK A;  1V2Y A;  1TKG A;  2K5P A;  2JXT A;  3QX1 A;  4EFO A;  3A9K B;  4EZJ A;  1ZXH A;  3NG0 A;  2K8C A;  5KHO A;  1WYW B;  3X0W A;  1KM7 A;  3ZDM C;  5IKC M;  4MH0 E;  1B1Z A;  2NPT A;  2K1F A;  1JWS D;  1YJI A;  3EUB 2;  2TSS A;  2KKC A;  1E6E B;  1C79 A;  1L0Y B;  3ZLZ A;  2M17 A;  3M3J A;  4JIO U;  1I42 A;  4S0R A;  2FAZ A;  3R3M A;  1D4B A;  3RMK C;  2PE6 B;  1V5O A;  1N5X A;  3Q8E A;  3KUC B;  3EHV A;  1TY2 A;  1SIJ A;  4BKG A;  3CSF A;  1ZPS A;  3IT4 B;  4G50 A;  3V3X A;  4DHZ E;  2C7N B;  1V86 A;  2ASQ A;  3IG3 A;  2D3B A;  2WS3 B;  4FJZ A;  3Q3N C;  2N1V A;  4EEW A;  3WA0 A;  2MBO A;  2MBB B;  4FBJ B;  1EO6 A;  1I4Q A;  2WP9 B;  4XC2 A;  1EF1 A;  2WHI A;  3U2S C;  4N58 A;  1FRD A;  2NBW B;  2JZP A;  1EU4 A;  5AUK A;  1P7E A;  2RR9 A;  3MC0 B;  2IPK D;  2HTM E;  1I7H A;  1YQ4 B;  4R3D A;  5H8Y E;  1WXQ A;  5IO9 A;  1GJZ A;  1N5W A;  3JSV A;  2JWZ A;  2NBV B;  3W9C B;  2M56 B;  2XN9 C;  3QIJ A;  1MPE A;  4ZHO A;  3MP9 A;  3JYU A;  1HXY D;  2CU3 A;  1I4H A;  3ZJU A;  2DZI A;  2EKE C;  1FXT B;  4MGI E;  3QJZ A;  2MHJ A;  2J0J A;  4EUT A;  1WGK A;  1PYW D;  3MC9 A;  1CMX B;  3AB5 A;  1QQR A;  1NYR A;  4LNI A;  2V1Y A;  4KGR A;  3HM6 X;  4JX1 C;  4PYU A;  4KKJ A;  1TZ1 A;  4A20 A;  4B95 A;  3ALB A;  2NR2 A;  3O13 A;  3HK0 A;  3N30 A;  5AZH A;  5IN7 A;  1VD2 A;  2WXM A;  4DDG D;  1AWD A;  3ZUN A;  5G5H A;  1J7A A;  3P4Q B;  3H7P A;  5AUI A;  1WSP A;  5HKH A;  3W5U B;  3L10 B;  3U30 A;  2MEK A;  1V49 A;  2PKO A;  3TEZ A;  4ARI A;  3ML8 A;  4FUL A;  2JYT A;  5DPR A;  4RF1 A;  4EOY A;  3BY4 B;  5DCN A;  4HEA 1;  2WXG A;  2YEP F;  3AE6 B;  4W9H A;  4DXF A;  1WWT A;  4W9E A;  4WWP A;  2JUO A;  2WDT B;  4A90 A;  2W9N A;  1ZE3 D;  2N4F A;  3TEW A;  2WDV B;  3RZF A;  1NI2 A;  1UZX B;  2VRR B;  2D5G A;  2KDF B;  5JXV A;  1SSN A;  2W3R A;  3GZN I;  2IY1 B;  1EF5 A;  2KMC A;  5FR6 A;  4BFR A;  2PW9 A;  1ENF A;  1UNS A;  4KV2 A;  1FRR A;  4HWI B;  4A3P A;  1WE6 A;  4PT5 A;  2MP2 A;  3HIZ A;  2QIE B;  3ETR A;  1FNV A;  2M8S A;  1YX5 B;  3DHI C;  3AU4 A;  3RNA C;  5HFY A;  4WJP A;  2L0F A;  2CS4 A;  4TMA B;  1JW9 D;  2GLS A;  2G3Q B;  3TUO A;  2V4I B;  2JWU A;  2KK8 A;  2KJH B;  2DNF A;  4JE3 B;  4JL9 A;  4TKN A;  2WU2 B;  3Q6B A;  4LLG M;  3B2G A;  3QK0 A;  1N62 A;  1V1P A;  4HVB A;  1UF0 A;  2VZK B;  2G9H D;  3A1Q B;  3EA6 A;  5DPW A;  2L7R A;  3PRE A;  4RM9 A;  1WZ0 A;  2LXA A;  2BWF A;  3U4E G;  3T3N A;  3OLM D;  3W2D A;  2LGX A;  3ZW3 A;  3DVG X;  4KDI C;  1OQQ A;  2UYZ B;  3PRZ A;  1L7Y A;  1N61 A;  3APD A;  2WXH A;  1N6Z A;  2JT4 B;  2Q5W D;  5KHQ A;  2KYW A;  1TJE A;  3V62 A;  4IM0 A;  2FCN A;  2K22 A;  1C77 A;  5MPO A;  3Q8B A;  4IWO A;  2QHO A;  2XK5 A;  1FXI A;  3NVZ A;  4B9K A;  4BKS D;  1E8Z A;  4P7I A;  2BB5 A;  2A5U A;  2CJO A;  1E10 A;  2MBE A;  4REZ A;  1J7C A;  4RGN A;  3Q69 A;  2W55 A;  4UDU C;  4Q2J A;  5IAA C;  5L95 C;  4RGO S;  3WAN A;  3A4R A;  1XF5 L;  3PRM B;  3X23 A;  3VH4 B;  3RYT A;  4BBN F;  4M8N A;  4ARC A;  3U7D A;  3QCA A;  2DZK A;  2NPT B;  4WH4 A;  3FIL B;  2LZ6 A;  2BGF A;  2KFK A;  1CQV A;  2V4L A;  2INP E;  3NRZ A;  4MGK E;  3WAL A;  3NVY A;  1S1Q B;  3PV1 A;  4K7U A;  1VR9 A;  1T5X D;  4XDD A;  2NBU A;  1T6B X;  2R2O A;  2WXR A;  5J17 A;  3ZKJ C;  4YSY B;  5C1Z A;  3VXW A;  1PGX A;  1P3Q U;  2GOW A;  4YTN B;  4II3 B;  4ANV A;  1HA5 A;  1EU3 A;  2LHD A;  1FEH A;  4PYZ A;  1SE2 A;  1OQY A;  2ZCB A;  1JML A;  1GPX A;  4PS7 A;  1XXG A;  1YQ3 B;  3B1L X;  2WX0 A;  2IO2 B;  4G3X B;  4RH6 A;  1BXT A;  3HVZ A;  2KTR B;  1WMH A;  4JPS A;  1XQQ A;  3AM9 A;  4MT5 A;  4J3O D;  1LFD A;  2MJE A;  3KWL A;  2DEN B;  4ZRP A;  1WRI A;  3QC8 B;  1TS4 A;  2K6D B;  3ZTD A;  4ZOH C;  1D6E C;  1SXT A;  3L17 A;  1FCC C;  4US9 A;  2ACZ B;  2KN5 A;  3VR8 B;  2MQJ A;  3M63 B;  4HJG E;  1ZDX A;  3OJ4 B;  4WWM A;  2X8X X;  3P63 A;  4ITK A;  1QT9 A;  1YMH E;  2O2V B;  2Y3A A;  5D2M B;  1F77 A;  4N9F 4;  3GP7 A;  3BZD B;  2L32 A;  2CKH B;  4HCN B;  4RF0 A;  1N60 A;  4HRO A;  2MX2 A; 
#chains in the Genus database with same CATH homology
 4DXG A;  1C4P A;  1RYJ A;  1FD6 A;  1ET9 A;  1L6U A;  3ZGZ A;  1TKY A;  3CWI A;  1EM7 A;  3DWM A;  3AE1 B;  1UGJ A;  1FXA A;  1FFU A;  1Q10 A;  1PDX A;  3AED B;  4YTP B;  3FAH A;  3TSS A;  1DOX A;  1JWA D;  4KGS A;  1IBX A;  2WXI A;  2X38 A;  1LO5 D;  1TKG A;  1L6V A;  2K5P A;  2JXT A;  2FBW B;  1R7S A;  4KKI A;  3VRB B;  2ON8 A;  1BUI C;  2N0S B;  1FCL A;  5EE1 A;  1XLN A;  1ZXH A;  3B2F A;  2MJD A;  1QF6 A;  1KH0 A;  1SBB B;  1IBX B;  2IJ0 A;  1YN5 A;  1IUE A;  1K51 A;  1L5P A;  3BVG A;  1B1Z A;  2LGI A;  5H92 C;  1JWS D;  1YJI A;  3BK2 A;  3RFZ B;  3EUB 2;  4OVZ A;  4XWW A;  2TSS A;  5D7G A;  1E6E B;  3AE8 B;  3IXS A;  2V3N A;  2WXL A;  1C79 A;  1VDV A;  4GDL B;  4KX6 B;  4HKQ A;  1L0Y B;  4WAF A;  1K52 A;  1QOG A;  2GI9 A;  4XWT A;  3MHZ A;  1D4B A;  3PO0 A;  2QSD A;  2Y5P A;  1N5X A;  3ZJT A;  3Q8E A;  2JU6 X;  1UWX A;  2V3P A;  3WCQ A;  4RNA A;  3SR6 A;  4XDC A;  1T3Q A;  2LMC A;  1TY2 A;  1SIJ A;  1ESF A;  3NUH B;  1PGA A;  1ZPS A;  3IT4 B;  1DGJ A;  3V3X A;  1XO3 A;  2DYO A;  1MVK A;  5FKA C;  2M19 A;  1STE A;  2FE8 A;  1KRH A;  1KLG D;  5HHD G;  1XCT L;  2EKI A;  2QEJ C;  1QOB A;  4L23 A;  2J42 A;  1I4X A;  3HUI A;  2WS3 B;  1ET6 A;  4MH8 A;  2IDY A;  2OHF A;  2EEL A;  3PZ8 A;  1FMA D;  1QOA A;  3SEB A;  1I4Q A;  3Q8F A;  2WP9 B;  1C9F A;  3U2S C;  2WXO A;  1ROE A;  4N58 A;  2XNA C;  1FRD A;  1TS5 A;  5G5G A;  2AQ1 B;  2AQ2 B;  1I4P A;  1EU4 A;  2JZP A;  3IT6 B;  5AUK A;  1P7E A;  3MC0 B;  3VRA B;  3Q8C A;  2RDH A;  5FK9 C;  2IPK D;  2E6X A;  2HTM E;  2JQR B;  3R8B A;  1I7H A;  2INN E;  1JAL A;  1YQ4 B;  3VQI A;  2KAJ A;  3H8H A;  4R3D A;  5H8Y E;  1WXQ A;  2ICI A;  1SF0 A;  2L1A A;  4OZA A;  1RFK A;  3ZJV A;  1N5W A;  1GOZ A;  3UI3 A;  1C4A A;  4CQN A;  3MFG A;  2BB6 A;  4C80 A;  1JWB D;  1YN3 A;  4HKZ E;  4WQM A;  2IGD A;  2ZW0 A;  4NAW B;  3BYY B;  3W9C B;  2M56 B;  4DQO C;  2BS2 B;  2XN9 C;  1MPE A;  4ZHO A;  3NS1 A;  2MJ3 A;  3MP9 A;  4RCO A;  1VRA B;  1GAQ B;  1HXY D;  3SFE B;  5EE9 A;  5BMH A;  2K0P A;  2CU3 A;  1I4H A;  3B9J A;  4WUR A;  2WXN A;  3ZJU A;  3AH7 A;  1IGD A;  1V1O A;  2H89 B;  3E56 A;  1CK1 A;  1BML C;  4JWU C;  2L52 A;  4A8X C;  1WGK A;  3AV8 A;  1PYW D;  3AB5 A;  1QQR A;  1ZP0 B;  4JWS C;  2YEP B;  1TZO A;  3R2T A;  1NYR A;  1VZ8 A;  2WLB A;  1HZ5 A;  3KQ4 A;  4A55 A;  5C2T B;  1FNW A;  2RDG A;  3P4S B;  4KGR A;  4JX1 C;  3P4P B;  1PFD A;  3GB1 A;  4KKJ A;  4L2Y A;  3U52 E;  3TEY A;  2K9X A;  3O13 A;  4IDI A;  1EWY C;  1HZ6 A;  2JYE A;  2QJL A;  4RFB A;  1XCQ L;  1JQ4 A;  2WXM A;  1DYQ A;  3I57 A;  1AWD A;  4IKG A;  1E0Z A;  4MM3 B;  2IGH A;  5HI1 A;  5G5H A;  1J7A A;  2BS3 B;  3P4Q B;  4B0E A;  5AUI A;  1WSP A;  2KWD A;  1ZDV A;  4TSS A;  3W5U B;  2MEK A;  2PKO A;  3TEZ A;  4ARI A;  1FNU A;  2AQ3 B;  1MHX A;  2JYT A;  2WDQ B;  4RF1 A;  4YXD B;  1F2R C;  1L4D B;  1IGC A;  2IGG A;  2JX5 A;  1NEK B;  4HEA 1;  4AS1 A;  2WXG A;  1L0V B;  1SB3 C;  2YEP F;  3AE6 B;  1RM6 C;  2JSV X;  4YSX B;  4DXF A;  1L0X B;  1DOI A;  1C4C A;  3AEE B;  4HRS A;  1WWT A;  4TQ0 A;  1KFY B;  1D5Z C;  1NI3 A;  3VR9 B;  4A90 A;  3NVW A;  5GXG B;  1ZE3 D;  1TY0 A;  2NMQ A;  1RWS A;  2CJN A;  2LHE A;  2WDV B;  4LTU A;  3TEW A;  4H2A A;  2N9K A;  1VJK A;  5T8I A;  2D5G A;  2L83 A;  3AE3 B;  5JXV A;  5I4D A;  1SSN A;  2W3R A;  1FO4 A;  3T3O A;  2M0A A;  2BS4 B;  1M4V A;  3NZ3 A;  3AEA B;  2PW9 A;  1ENF A;  4NAM A;  1I4R A;  1UNS A;  1ZOY B;  1FRR A;  4ZYS A;  3N9Y C;  4PT5 A;  2W82 A;  2GB1 A;  2QIE B;  4ZHP A;  2LJI A;  3C8Y A;  4YWG G;  3ETR A;  1FNV A;  3URY A;  4MAC A;  4C7Z A;  3Q8A A;  1XLP A;  3MJ5 A;  2PMV A;  1XLO A;  5BMI A;  1DOY A;  2B76 B;  5HFY A;  3ABV B;  1F0Z A;  3OWE B;  1FFV A;  2DBY A;  2KMM A;  3IAS 1;  4TMA B;  2WNM A;  1WYG A;  1JW9 D;  2KDM A;  3GS2 A;  3TUO A;  3P1M A;  3P42 A;  2RMM A;  2V4I B;  3AE9 B;  2MH7 A;  4GLS C;  2V0G A;  2JWU A;  2Y5C A;  1C78 A;  2QIL A;  1UUP A;  3I9V 1;  2I38 A;  4EE2 A;  4JE3 B;  4IOI E;  1TS2 A;  2WU2 B;  3TEX A;  2DYM A;  4LLG M;  1OQR A;  3B2G A;  4YSZ B;  1PUT A;  1N62 A;  1JRO A;  1KTK A;  3LXF A;  2WDR B;  3AE4 B;  1KLU D;  1V1P A;  3AE7 B;  4AQ7 A;  1MI0 A;  2VZK B;  1K53 A;  5FR3 A;  1F2R I;  2G9H D;  1PGB A;  3EA6 A;  4LK0 M;  1SE3 A;  1N63 A;  1QKZ A;  1AYF A;  4C7Y A;  1MHH E;  3W5V B;  3U4E G;  2J53 A;  3T3N A;  2BYT A;  1QOF A;  3W2D A;  4M0W A;  1JRP A;  2NTS A;  1UWM A;  1V1P B;  1I4G A;  1OQQ A;  2N9L A;  3L4P A;  1TYG B;  3PZ7 A;  5D3D A;  2BW2 A;  1N61 A;  2WXH A;  2Q5W D;  2QMT A;  1XLQ A;  1TJE A;  1E9M A;  2J52 A;  3DWG C;  4B0M A;  1QLB B;  2I2Y A;  1TKE A;  5HG2 A;  2K22 A;  2SAK A;  3W1S A;  4TQ1 A;  4RGM A;  2PIA A;  1C77 A;  1Y56 A;  5E6J A;  5MPO A;  1FM0 D;  5BYR A;  3Q8B A;  1VZ6 A;  4OHJ A;  1D5M C;  1K50 A;  1VZ7 A;  4N6E B;  1FXI A;  2R61 A;  3NVZ A;  1C76 A;  5C3J B;  1D5X C;  3AEB B;  3NVV A;  1AW7 A;  2BBC A;  2LEK A;  2WQY B;  2W3S A;  3KWV A;  2PVG C;  4ZRQ A;  3P4R B;  2BB5 A;  4A6Q A;  2CJO A;  1E10 A;  1YNT E;  4REZ A;  1J7C A;  4RGN A;  3Q69 A;  1ACC A;  4YTM B;  1YN4 A;  2W55 A;  4UDU C;  4Q2J A;  4USA A;  1ZUD 2;  3BK1 A;  1CJE A;  1EWC A;  4RGO S;  2PTL A;  3ZYY X;  2W54 A;  5LNK 1;  3J9C A;  4OW0 A;  3E9S A;  2SEB D;  2WXJ A;  2KQ4 X;  1XEE A;  3BWU D;  3FIL A;  4O1N A;  4XE0 A;  1XF5 L;  3AEF B;  1FIQ A;  1KF6 B;  1ZXI A;  1P7F A;  1NYQ A;  4ARC A;  1HQR D;  3LYY A;  5EE3 A;  2BTE A;  4WH4 A;  3FIL B;  2AX5 A;  1TS3 A;  3AEG B;  4A9A A;  1A70 A;  2WXP A;  2LUM A;  1CQV A;  1JCK B;  2INP E;  2NTT A;  3CIR B;  1QIL A;  3NRZ A;  3NVY A;  4YT0 B;  2Z8L A;  3BII D;  4XDD A;  1VR9 A;  1T5X D;  4OZC A;  1SE4 A;  1NEN B;  1GB1 A;  1T6B X;  2WXR A;  4FXC A;  5D3I B;  2G1E A;  4YSY B;  5EE0 A;  3AN1 A;  1PGX A;  4YTN B;  1V8C A;  1HA5 A;  5TSS A;  1EU3 A;  2LHD A;  3AMZ A;  3HRD D;  1FEH A;  1SE2 A;  2ONQ A;  3SFD B;  5BMG A;  5BYQ A;  1E7P B;  1SJH D;  1JML A;  1GPX A;  3BYT B;  1CZP A;  2WXK A;  3R2I A;  1XXG A;  1YQ3 B;  1HEZ E;  2WU5 B;  3HVD A;  2E3T A;  4RH6 A;  1BXT A;  3HVZ A;  1OFF A;  3AE5 B;  3FC4 A;  3BVM A;  1V97 A;  2HDE A;  4JPS A;  2DLB A;  1AN8 A;  3AM9 A;  4KGT A;  4MT5 A;  2MJE A;  2K3U A;  4J3O D;  1J7B A;  2KAC A;  3KWL A;  3LB8 C;  2OED A;  2VZK D;  4ZRP A;  1WRI A;  3U7Z A;  2RPV A;  3BVZ A;  1TS4 A;  2H88 B;  1D6E C;  2LFI A;  4ZOH C;  3RPF C;  1SXT A;  1FCC C;  3IAM 1;  4US9 A;  2ACZ B;  2WXQ A;  2GRI A;  5BYS A;  1JWM D;  1GB4 A;  1SJE D;  3VR8 B;  2PVO D;  1NVI D;  3EGR A;  4HJG E;  1ZDX A;  3KLS X;  4WWM A;  2KN4 A;  2DWQ A;  3P63 A;  4ITK A;  1YJJ A;  1L4Z B;  2FUG 1;  3V05 A;  1QT9 A;  2WXF A;  1VLB A;  1YMH E;  4OZB A;  2Y3A A;  1B9R A;  4US8 A;  1F77 A;  3AE2 B;  2N7J A;  4L1B A;  4NZL B;  1JWU D;  3GP7 A;  4C56 C;  3BZD B;  2L32 A;  3ZQ4 A;  2PLP A;  4P16 A;  4N59 A;  2ZW1 A;  4GDK B;  4NJC A;  4RF0 A;  4D2K A;  1N60 A;  2J4X A;  4HRO A;  3AEC B;  4WIP A;  1SEB D;  2BT6 A;  4RGT A;  4P6V F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...