1BUIC

Structure of the ternary microplasmin-staphylokinase-microplasmin complex: a proteinase-cofactor-substrate complex in action
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
122
structure length
122
Chain Sequence
ASYFEPTGPYLMVNVTGVDSKGNELLSPHYVEFPIKPGTTLTKEKIEYYVEWALDATAYKEFRVVELDPSAKIEVTYYDKNKKKEETKSFPITEKGFVVPDLSEHIKNPGFNLITKVVIEKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Plasminogen
publication title The ternary microplasmin-staphylokinase-microplasmin complex is a proteinase-cofactor-substrate complex in action.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 15
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 1998-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02821 Staphylokinase Staphylokinase/Streptokinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.130 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1buiC00
1BUIC 1C76A 1C77A 1SSNA 2SAKA 1C78A 1C79A
chains in the Genus database with same CATH superfamily
1UWXA 2WQYB 3Q8CA 1YNTE 2LASA 3L08A 3NVYA 3Q8EA 1Z2MA 3QCAA 4BBNF 1SE3A 2BYTA 4IM3A 1WE6A 3DQVA 2BTEA 5FR6A 2R2OA 4N59A 3L13A 1L5PA 1FIQA 4BBNC 5AUIA 2LVPA 4MEMA 3AEDB 2LFIA 4RGMA 1T0YA 1V1PA 1FD6A 2NBWB 3VR8B 2V1YA 3ALBA 1WGRA 2WXKA 4C80A 5GXGB 4DHZE 1KLUD 4AP4C 3CSFA 1EM7A 1V80A 3A9JA 2KC1A 4W9EA 1WGYA 1C78A 3QJZA 5CHFA 1YD8U 2TSSA 2YEPB 2BGFA 1P3QU 1WXQA 4D2KA 2GBMA 4K7WA 1EWYC 2KN4A 4E3CA 2IY1B 2NTSA 3JVZX 1GOZA 2V4IB 2NR2A 2LXCA 2K8HA 2LMCA 2W9NA 4C7ZA 4NAMA 4BKGA 1WF9A 3ZRFA 4F1SA 1I4XA 1GG3A 3NG0A 3FAHA 4NQKE 3WCQA 3KYDD 2JZ3B 3VVWB 3CWIA 1FNUA 3Q2AC 3AE6B 3HVDA 2DAFA 1NYQA 1FNVA 2JWZA 3SR6A 3VTWA 3AEEB 3SD5A 1FNWA 1WJ6A 2K1FA 4IUMB 5JXVA 1Q5WB 1HQRD 3I3TB 5DPTA 1JMLA 1I4HA 4N9F4 5JHBA 5D7GA 2FUHB 2C7HA 2D5GA 3L54A 2INCC 5BO4B 4XYCA 2K6DB 1OQQA 2KJHB 4CO7A 3MC9A 4KSKC 1YN4A 2MA9B 3APCA 1VRAB 2D07B 2MJEA 1NVID 2KK8A 4GDLB 4X57B 3M95A 3OAWA 2KQ7A 1E7VA 1WX7A 4A9AA 2LHEA 4REZA 1KJTA 4ANUA 5LXIB 4P7IA 3DWMA 4KGSA 3AN1A 2OHFA 4HVBA 3MJ5A 1V86A 3T9LA 1WXAA 1ACCA 4W9FA 4ZOHC 4PS8A 3KYCD 2Z0EB 1HEZE 3U7ZA 3M63B 2DENB 1WZ0A 2XEWA 5FR3A 4KGRA 3R2IA 2LD9A 1N63A 1XT9B 2LJ5A 2V3SA 1IPGA 4RGTA 5IAAC 3PO0A 4LJPB 3LB8C 2VZKB 4KDLB 4WURA 1PUTA 4JE3B 1J8CA 4BOSC 4XDDA 3MHSD 4XE0A 2O6VB 1JWBD 2X8XX 3VR9B 2I1JA 4WAFA 2KKCA 2KAJA 3IFWB 1RM6C 3H7PB 4YXDB 4WWNA 1D5ZC 1SIFA 1FFUA 3N9YC 2BB5A 3E56A 2R61A 4B9KA 4B6WA 1FXTB 2KLCA 2KVRA 2JU6X 4K3CA 2IJ0A 5G2NA 3TEZA 2BB6A 2BPSA 1AWDA 3BVMA 2KDFB 3A33B 2DHZA 3PHWB 3Q3NC 5DPSA 1OQYA 5J17A 5GMVA 1C9FA 1XO3A 4AQ7A 3AE7B 1R4NB 3QAQA 1KM7A 1UGMA 4II2B 1MG8A 1AARA 4GU2A 1JRUA 1RWSA 2KDMA 2LEKA 1V49A 2LRWA 4RF0A 2MLBA 2HJ8A 4GB9A 2FNJB 2JYTA 2LUEA 1QT9A 4PS7A 5AUKA 1Z5SB 3RULA 2K5PA 4FJVB 4WH4A 4A90A 4ANWA 1LM8B 4KVGB 3AH7A 4NNJB 1VLBA 2DX5B 1RRBA 4L2YA 3HK0A 3ZQ4A 1IP9A 4LNNA 2N7DA 3AU5A 4OVZA 3ENEA 2M1MA 4KV2A 2JRIB 2MBQA 1IBXA 3ZDMC 3QIJA 3B08A 1B9RA 2W82A 4RMAA 2IGDA 3CMMB 5LLIA 2E3TA 2ZVOA 2NCNA 1QOGA 2LHDA 5IO9A 4NZLB 4CYEA 1KTKA 1FXIA 2EKEC 1D3ZA 3LJ3A 5C2TB 1GAQB 3FC4A 2IYDB 1H4RA 3QC8B 2XK5A 3O13A 3V6EB 2Z59B 2WXJA 4JWSC 4WWOA 3ZYYX 2JYEA 2V9HA 2CU3A 1OFFA 2SEBD 4K1RB 5E6OA 1C3TA 1NBFC 3JYUA 4ZRQA 2L8JA 4IDIA 3IAM1 3GE8C 2ON8A 3BYTB 2IPKD 2K8CA 4HJGE 2BQQA 4JLCA 1C4AA 4A6QA 4MM3B 2LJIA 1VJKA 2GBRA 4GGQA 2D10A 3TEYA 1YQBA 2L76A 4W9GA 3ZXRA 3IT4B 2KTFA 1DOIA 3ZW3A 1RYJA 1XLQA 5DPWA 1TJEA 4NJ6A 4BAXA 2AWTA 2YEPF 1R7SA 1KOTA 2BF8B 3N32A 5D3IB 2IDYA 2BT6A 3TBLD 3ZTCA 2BYEA 3KWLA 2NVUI 1WYWB 1PQSA 3ZDTA 3UQBA 4M0WA 4NPNA 2N0SB 1XLOA 2BWES 1F2RI 1C76A 4IKGA 1LO5D 2L32A 3ETRA 2G1EA 2DYMA 2G3QB 2WHIA 4DHJD 3NVVA 1WH3A 4GDKA 3WALA 4W9CA 3N1XC 4FLHA 2VRRB 4HROA 5JHAA 3APFA 2BVCA 2KFKA 3I63C 2WWZA 1YN3A 4A20A 2JY6A 5J2RA 1B1ZA 2E6XA 1N62A 3URYA 2UU7A 4IG7B 1SE9A 4II3B 5C3JB 1TS5A 4HJKA 3TJPA 1UF0A 4JGHB 2NBVB 1UBIA 2PVGC 2QHOA 3V62A 2LGXA 2KDIA 1SSNA 1L0XB 1HA5A 1ZGUB 2J0MA 4FJZA 4KDIC 1WIAA 1T0RC 2PIAA 3I9V1 4ZHOA 2BBCA 2PKOA 1C1YB 3W1SC 2AQ1B 4YSYB 1VZ8A 1G6JA 2OOBB 2Z0DB 4ARCA 4I6NB 2JZZA 2LUMA 3NZ3A 2BW2A 1S1QB 2GBNA 4EZLA 3PHXB 5I4DA 5H8YE 1H8CA 1J7AA 2PEAA 3P4RB 1JW9D 3GZNI 3GB1A 3SHQA 3QA8A 3D32A 1XXGA 3V3XA 4N6EB 2ZPNA 1RFAA 1WGDA 2KDEB 5FK9C 3AB5A 4RM9A 4LJOB 1MJDA 5CX3A 4LNOA 2WXFA 2KWCA 2KANA 3UQAA 4FJYA 1WMHB 5H92C 1QZEA 4JL9A 1ET6A 2RDBC 4W9DA 1RLFA 2ZPYA 3T8MA 2NPTA 3GOEA 4LTUA 3U30A 3JSVA 1E8WA 4GMVA 3RI7C 1TS2A 3ZJVA 2G4DB 2N9LA 2QIEB 2MP2A 1V97A 2IO0B 1HE8A 1YQ3B 2ZW0A 2WU5B 2QSDA 4TUUA 2VH1A 2RGFA 5C1ZA 1N61A 3MHZA 4FHJA 3O65B 2LGIA 3RYTA 4GSWA 1NDDA 4NAWB 4LNFA 1E8XA 1YOVB 4FULA 1WJNA 4WAAA 2FE8A 3ZNID 3DVNU 2RPQA 1FM0D 1I42A 1TYGB 2KMAA 1F0ZA 1QOBA 1E6EB 4J3OD 3ZNHB 2WX1A 2N1VA 1T6BX 4EKUA 1VZ6A 1SXTA 3PRPB 2K25A 3AEAB 3L4PA 2H89B 1T0SC 1UD7A 3UI3A 1YJJA 1UH6A 3HHMA 2KMMA 3TMPB 3ZNGC 1Q1OA 1N6ZA 4HPPA 1Y56A 3DVNV 1BUIC 2RMMA 4K7SA 1FPYA 3NS8A 2IO3B 1BMLC 3AU4A 3WAMA 3VFKA 4URKA 2WDTB 1GB4A 3KLSX 4C7YA 3K9OB 5L95C 2DYBA 1V8CA 2INDC 4GXBA 4GLSC 3DWGC 2VZKD 4B0EA 1V5TA 4IWOA 2N7JA 3BZDB 2MBBB 2O6VD 1HXYD 1QKZA 2J52A 3KVFB 3B2FA 2D11A 3R3MA 4IM2A 1YX6B 2GI9A 4G0NB 2CHZA 3AEFB 1C77A 1TZ1A 3X23A 1OTRB 1MHXA 1K52A 1STEA 1V1OA 3R8BA 2WDVB 1D6EC 1WI0A 2FAZA 1ZXHA 2H88B 3P42A 3IXSA 5T8IA 4GDLA 1CQVA 1CZPA 3Q8FA 4A3OA 4O1NA 2EKIA 5D3DA 4MSMB 3N20C 2A5UA 2Y5BB 3W1SA 4DDGD 2IZVB 3PGEA 3A4RA 1OEYJ 3UGBB 2LWPA 1TS3A 3RD2A 2IY0B 3IHPC 1J7CA 3DBLI 3DBRI 2EELA 4KZCA 4XGAB 2DZMA 3EGRA 3BVGA 3EUB2 3VH3B 4WQOB 2KC2A 1L0YB 3PRMB 4A3PA 3QQ8B 4TV3A 1TBEA 3M62B 4AJYB 1WM3A 4C4VB 1L4DB 1T5XD 4HKQA 2CS4A 2O6VA 4AOFA 2WDQB 1AYFA 4WWMA 4G3XB 2CU1A 2KNBA 1GNUA 2DWQA 1T0QC 4WJQA 4ACFA 3H7PA 2CHWA 2QEJC 3APDA 3VUXA 1T3QA 3A1QB 5KHQA 2CHXA 1K53A 3KWVA 5C23A 1UELA 1OGWA 3U8ZA 2KN5A 3Q3FA 3DVGX 2ZVNA 2B76B 4P6VF 3TEXA 3SEBA 3JW0X 4GN1A 2KDBA 3I57A 3Q8AA 3RUIB 1EWCA 2ASQA 3V05A 1TKEA 4W9HA 3IVFA 2XBBC 3AE5B 3PLUA 2Z8LA 4I6LB 2GOWA 2AL3A 2JT4B 2ICIA 3H7SA 2KQ4X 2MJ3A 1YJ1A 3BK1A 3KUZA 4H2AA 1WE7A 1ZKHA 3RT3B 1DOYA 1CMXB 2D2QA 1Y8RC 4TQ0A 4OW0A 3WANA 3PRZA 4DQOC 1EU4A 4MH8A 4FBJB 1QILA 3PZ7A 2ACZB 1FEHA 3Q3JA 2K22A 4LDTB 1F9JA 3BVZA 2QILA 1SE4A 4PT5A 3PS6A 2G45B 4HKZE 2WYQA 3V60A 5HG2A 1L2NA 1UUPA 1TZOA 3VRBB 2JWUA 2R2QA 1GB1A 4ANVA 1L4ZB 2L00B 4EZKA 1LXDA 1KLVA 5E6NA 3H9DA 3R66C 3V6CB 2YVCA 4TSSA 1KFYB 1TGZB 1N5XA 3DBLB 4YWGG 3ABVB 4PYUA 4KIKB 4MGZE 5LXHA 4WJNA 1XCTL 4EE2A 2WGSA 4ASWC 1QOFA 1SBBB 1CJEA 2RSUA 2JRHA 3H1UA 3SU8X 4F7ZA 2WLBA 5AZHA 1XF5L 1GUAB 2WXMA 2LGSA 2J4XA 3TUOA 1GC7A 3AI5A 4ZHPA 2KX3A 5HFYA 1ZOYB 1EU3A 4XWWA 1L6VA 4EUTA 1V9JA 1Q10A 3ECIA 2PW9A 3Q8BA 2MSED 1WX8A 3GS2A 5BYRA 4USAA 3B2GA 4MM3A 1V81A 2MH7A 2LVOA 1C4CA 4DXAB 1IBXB 4OVVA 3KH0A 1GC6A 2PLPA 3NHEB 2LRUA 1ESFA 1P7EA 1WGKA 3AV8A 3OJ3A 3EFUA 3ZIMA 2LGDA 4P16A 4ITKA 4S17A 3RPFC 2KXJA 2DNFA 4ANXA 4MJSA 2L1AA 2SAKA 4FXCA 3NJTA 2WXHA 3DCGA 4BKSD 4DHZB 3IAS1 1N60A 2ZW1A 1TIFA 3B1LX 4M00A 5EDSA 3NVZA 2G9HD 3VTVA 2KZRA 2MBHA 3U52E 2KOXA 3U7DA 5D94A 4M8NA 3P4PB 3AECB 2MQJA 1WXVA 1P1AA 2DYOA 2KVZA 2A4ZA 1WGHA 3AE3B 1DOXA 1JQ4A 1V2YA 4L1BA 5EE0A 4FA6A 4HCNB 1WR6E 1X1MA 2J0KA 2Y5CA 3HRDD 1HZ5A 5HKHA 2GLSA 2KJ6A 2IBIB 2KTRB 4OZAA 4ZRPA 4RF1A 1DYQA 1SB3C 3GE3C 4J6IA 3B9JA 1MHHE 2MBOA 3A9KB 3DVGY 1K50A 3HVZA 3TCAA 4LK0M 1ZUD2 1WXSA 3Q14C 1FO4A 4JQWC 2RPVA 1D5XC 2WXPA 2W54A 2UYZB 4FADA 1K51A 2HTME 2MX2A 4N58A 4L23A 4MSQB 2K6QA 1NI2A 1M94A 3Q69A 2K39A 5TR5A 1IGDA 1P98A 5EE9A 2DBYA 2FIFA 1SIJA 4WIPA 2FIDA 5AZGA 1JROA 2C9WB 5E6JA 1FCCC 3U2SC 2J42A 2HE7A 2M0XA 2BS2B 3C8YA 3K9PB 4HEA1 4RM8A 3W1YA 1E90A 3MJWA 1SGHA 2DZKA 4RNAA 1EUVB 1P7FA 2ZNVB 1ZE3D 3MP9A 1PGXA 4WJPA 5AEKB 1EF1A 3LDZE 3C19A 4AJWA 2AYOB 2AX5A 4IOIE 3ZJUA 1RFKA 1WMHA 2LXAA 4LCDE 4MGYE 2WXNA 1JWUD 2MEKA 1AW7A 3ZLZA 1S3SG 4OZBA 1YQ4B 2FUG1 3DHIC 1ROEA 2FCQA 3NS1A 4IC7B 3W2DA 2N9EB 2IO1B 4UDUC 4K7UA 4KGTA 2N9XA 3V61A 2C7MB 2O2VB 3QARA 1YN5A 3PVLA 3T3NA 4G50A 4B0MA 3H6NA 4TKNA 5G55A 4NAWA 2GMIC 4CQNA 2BYFA 1GJZA 4HXDA 3ZGZA 2L0TA 2VH2A 4R3DA 4BFRA 1D4BA 2MWSB 1UZXB 2MJDA 1UNSA 3ONSA 3PSEB 3VUYA 3PTFC 1UGJA 1XD3B 3BWUD 2L05A 2WXRA 3FILB 3C0RB 1ZDXA 2LVQA 1TS4A 4TMAB 4KKIA 4JIOU 3UF8A 3JSVB 1P0RA 1ZDVA 4KKJA 2LGYA 4HDOA 2MP2B 3Q6BA 2V4LA 3TL5A 3VH4B 1GPXA 4PYZA 2KX0A 3VAWA 1DGJA 1WR1A 2OJWA 4MDKE 4NJCA 1MI0A 2DAJA 2OEDA 3OWEB 2PE9A 1JWAD 1ZP0B 3P4SB 3RNFC 2PTLA 3WA0A 2BYVE 3L10B 4ZRIA 2KD0A 4YT0B 2RD0A 5DCNA 4LLGM 1YJIA 4RGNA 5JH5C 3ZRCA 2M4NA 3CF6E 4XC2A 3BYYB 4YTMB 4M02A 4EZJA 4E71A 2EMTA 3RNEC 2I2YA 3W5VB 2KHWB 3PZDA 4RCOA 3SFEB 3GZNB 2M17A 1YIWA 2I38A 3DPDA 2NBUA 3W9CB 1YMHE 4ZRKA 1V1PB 3IT6B 2K0PA 4FN2A 1SJHD 4B95A 2MW5A 2WP9B 1ENFA 2LI5A 1ZW7A 4P1CC 1XEEA 4PS3A 5DPRA 5MPOA 1FMAD 3A9JB 4IWQA 4C56C 3PT2B 4CHKA 2WXQA 4GIVA 3L0WB 2KLGA 2FCSA 1LGRA 4ICUA 3RNGC 2KYWA 2K3UA 1QQRA 3DBSA 1E5WA 1J0GA 2WX0A 3AM9A 2KJRA 3MFGA 2KACA 1E7PB 3AE2B 1C4PA 4ZYNA 1JCKB 4HRSA 1PGBA 4K81A 2FBWB 3R7RA 4DDID 4EEWA 4P1BC 3X0WA 1E9MA 1R4NI 3WAOA 1VD2A 4BOZB 2D3CA 4WWPA 1N5WA 1TY2A 3QX1A 2V0GA 2L52A 1OQRA 3E9SA 3AE4B 2KT7A 3DBHI 2FCMA 2INNE 2BKRB 5G5HA 5D6JB 4W9JA 2L3ZA 4LDTD 3TSSA 3R2TA 1E8ZA 1XLPA 4C4VA 3TIXA 5BYSA 3RMKC 4LNKA 2J7QB 1BT0A 3NZSA 4HCPB 2INPE 1WXMA 2JUOA 3OG5A 2UWQA 2JXTA 3MTNB 4ZDVA 3EFCA 2QJLA 5BMHA 3VUWA 2N9PC 3IBEA 1FCLA 2C5LC 1BXTA 4XX5A 4C00A 3A1QA 2LZ6A 1QOAA 2KMCA 1LQBA 4NY0A 2QCZA 3BK2A 1F1HA 2MCNB 3RZWC 3ZO5B 2WS3B 4IW0A 4AUQC 2XNAC 1AN8A 2ZJDA 4G11A 2CJOA 1E10A 1I4PA 3M3JA 4ARIA 4IM0A 1JWMD 3EC8A 3ML9A 1NI3A 3DHHC 5LNK1 3MC0B 3NOBA 5CHWA 1L7YA 1MVKA 2G4SA 4E74A 3NUHB 5BYQA 3KUCB 2V3NA 3Q3OC 3RZFA 2DLBA 1WGGA 3AE1B 2XN9C 4M01A 2KWVB 3DOWA 4MT5A 3AEGB 1WSPA 1WYGA 3R7QA 5JZEB 1L6UA 2AL6A 4AS1A 2WNMA 2L0FA 1WY8A 4BKTA 3VDZA 1L0VB 2KWDA 2HDEA 2RDGA 2PMVA 2PE6B 2Q5WD 2MRPA 4M8MA 4Q2JA 1QF6A 1A5RA 2D3AA 4MH0E 4MGKE 4W9KA 2W3RA 4DK5A 1J19A 1KF6B 3RCZA 3RN9C 2N4FA 2ZNVC 3AULA 3OLMD 2CKHB 2BWFA 1K8RB 2WXGA 4HLEA 3QWZB 4RFBA 1I35A 3RNBC 1LFDA 2ZCBA 1J7BA 4S0RA 4DWFA 4MGIE 1WJUA 3TEWA 3KQ4A 4YSXB 2PJHA 4KSLC 2D3BA 3ML8A 1YX5B 4KIKA 1TTNA 3T3OA 3DHGC 1WRIA 1D5MC 2REXA 3U4EG 3P1MA 1M4VA 1E7UA 3DBHB 2NS5A 5E6PA 1F2RC 3L16A 3ZUNA 3DBRB 3HIZA 5IKCM 3EA6A 4FHKA 2B3AA 3ZKJC 3VHTC 1XQQA 5CTRC 2AEHA 1I4RA 3WAPA 3WIMA 4KZ0A 4ZRJA 1UBQA 2M0AA 3VXWA 1ZPSA 3CIRB 2CR5A 1CK1A 1XCQL 2HD5B 2JPHA 3UINB 4IWPA 5EE1A 1IYFA 2WXIA 3PZ8A 1WRDB 2GBJA 2JVCA 1SF0A 1IUEA 1V6EA 2YLMA 1I4QA 4MACA 3AE9B 4BZAA 3ZTDA 3PV1A 1EF5A 5FKAC 1FXAA 5IOIA 2FCNA 1FFVA 1SJED 4AWJA 1PDXA 4TQ1A 2K8BA 1A70A 4XZ4A 3OJ4B 3W5UB 1NEKB 2J53A 1U4AA 2CJNA 1EO6A 2JZPA 3HM3A 3BIID 2QC8A 4ICVA 3CSTA 4KX6B 1VR9A 3EECA 2JF5A 2ZEQA 4LNIA 5HHDG 2BS3B 2KQSA 3J9CA 3L17A 3PLVA 5TSSA 1HTQA 1V5OA 1WFYA 2XK5B 1RAXA 3HUIA 5BMIA 4RGOS 3NY5A 4I6PA 4OZCA 3GP7A 1WX9A 3ZVVA 2JX5A 3LYYA 3LXFA 1ET9A 4XDCA 1VCBA 2V3PA 2GRIA 3ZNZB 3RNCC 2KO3A 2ONQA 2K9XA 2WXOA 1TKGA 2C60A 3FKYA 3VQIA 1TKYA 2D3GA 2KTRA 3VTUA 5J18A 3PPAA 3N3KB 4JX1C 4A8XC 5AZFA 1OEYA 2X38A 1XLNA 3AEBB 4MJSB 1PGAA 3RFZB 4F8CB 2HJ1A 2RR9A 1TY0A 2BKFA 2JQRB 3DDCB 2IO2B 3B0AA 4HWIB 5HI1A 1F52A 4WQMA 1NENB 3A9KA 3KW5B 1WM2A 1ISNA 2PVOD 2EMSA 3VRAB 1R4MI 1SE2A 5D2MB 1JRPA 1I7HA 4HPMB 2M8SA 1I4GA 2JSVX 4M0WB 4OHJA 3AE8B 3AMZA 3A4SC 2BS4B 4XWTA 1WWTA 3PREA 4BVUC 1JALA 2N1WA 2HTHA 2NMQA 3NVWA 2GB1A 2Y3AA 1PFDA 2OJRA 2C7NB 2L83A 3KUDB 2WU2B 3SDLC 3NZUA 4BKSA 2N9KA 4GDKB 4YSZB 1MG4A 3MC8A 1WJ4A 4YL8A 2WXLA 3UIOB 4DXFA 3HM6X 4YTPB 1P9DU 2KFKB 5EE3A 1ZXIA 2J0JA 3IG3A 2KWUB 2L7RA 5IA7A 4GOCA 4ZYSA 5IN7A 3N1ZC 3UIPB 4WJOA 1IGCA 4EFOA 2ZZPB 3N30A 4K3BA 5L83A 3RNAC 4HDQA 4W9LA 1KLGD 3EHVA 4A55A 2M56B 1KRHA 3S2AA 3I5JC 4W9IA 4QAYA 2PPHA 4US8A 4DBGA 2O2VA 1QLBB 1SEBD 1MFWA 2JXXA 4PK1A 3P63A 1PYWD 1FRRA 2W55A 2N7EA 5IP4D 1TT5B 1FRDA 3AXCA 4DXGA 3BINA 1C79A 5BMGA 1HTOA 1E8YA 2RDHA 3ZJTA 2GBKA 3P4QB 2W3SA 1E0ZA 3H8HA 2IGGA 1NYRA 4DHJB 2DZIA 1VZ7A 2AQ3B 2NTTA 2WDRB 3FILA 1F77A 3QK0A 2IGHA 3QHTA 1HZ6A 1KH0A 4NJ7A 4JPSA 2QDFA 2QMTA 3ZXVA 4EOYA 2I1KA 4NQLB 3NRZA 4HPLB 2DZJA 2MBEA 5KHOA 2M19A 1MPEA 1VDVA 2ZCCA 5G5GA 1R4MB 5CHVC 2NPTB 1WZ3A 4RH6A 1UWMA 4MELA 2AQ2B 4JWUC 1Q0WB 2Y5PA 3BY4B 3SFDB 3N1YC 3P2BA 3Q3MC 4YTNB 1JWSD 2KFJA 4HK2A 4OVUA 2MHJA 4US9A
chains in the Genus database with same CATH topology
1UWXA 2INPE 2WQYB 3Q8CA 1YNTE 2JXTA 3NVYA 1QOFA 1SBBB 2QJLA 1CJEA 5BMHA 3Q8EA 5C3JB 1TS5A 1SE3A 2WLBA 1FCLA 2BYTA 1XF5L 2PVGC 2WXMA 1BXTA 2BTEA 4N59A 1SSNA 1L0XB 2J4XA 1L5PA 3TUOA 1HA5A 1FIQA 4ZHPA 1QOAA 5AUIA 2PIAA 5HFYA 3I9V1 3BK2A 2BBCA 4ZHOA 1ZOYB 1EU3A 2WS3B 3AEDB 2LFIA 4XWWA 1L6VA 4RGMA 2XNAC 1AN8A 2PKOA 1Q10A 3Q8BA 1V1PA 2PW9A 1FD6A 2CJOA 2AQ1B 1E10A 1I4PA 3GS2A 4YSYB 3VR8B 5BYRA 1VZ8A 4USAA 3B2GA 2WXKA 2MH7A 4ARIA 1JWMD 4C80A 4ARCA 5GXGB 1NI3A 1C4CA 5LNK1 3MC0B 1KLUD 2LUMA 3NZ3A 2BW2A 1IBXB 1MVKA 1EM7A 3NUHB 5BYQA 5I4DA 2V3NA 2PLPA 2DLBA 3AE1B 1ESFA 5H8YE 1J7AA 1P7EA 1WGKA 3AV8A 3P4RB 1JW9D 2XN9C 1C78A 4P16A 4MT5A 3GB1A 3AEGB 1WSPA 1WYGA 2TSSA 1L6UA 4ITKA 2YEPB 3RPFC 4AS1A 2WNMA 1WXQA 2L1AA 2SAKA 4D2KA 4FXCA 1L0VB 2KWDA 1XXGA 2WXHA 1EWYC 2HDEA 2KN4A 4N6EB 2RDGA 3V3XA 2PMVA 2NTSA 2Q5WD 5FK9C 1GOZA 3IAS1 2V4IB 3AB5A 1QF6A 4Q2JA 1N60A 2ZW1A 2WXFA 2W3RA 1KF6B 2LMCA 4C7ZA 4NAMA 1I4XA 3FAHA 3NVZA 2G9HD 3WCQA 3U52E 3CWIA 2WXGA 5H92C 1FNUA 3P4PB 1ET6A 3AECB 3AE6B 3HVDA 1NYQA 1FNVA 4RFBA 2DYOA 3SR6A 4LTUA 3AEEB 3AE3B 1DOXA 1JQ4A 1TS2A 3ZJVA 1FNWA 1J7BA 4L1BA 5EE0A 5JXVA 2N9LA 3TEWA 1HQRD 2QIEB 1V97A 3KQ4A 1YQ3B 2ZW0A 2WU5B 4YSXB 2QSDA 1JMLA 2Y5CA 1I4HA 1N61A 3HRDD 1HZ5A 3MHZA 2LGIA 5D7GA 3T3OA 2D5GA 4OZAA 4ZRPA 1WRIA 4RF1A 4NAWB 1D5MC 3U4EG 1OQQA 3P1MA 1DYQA 1M4VA 1SB3C 1YN4A 1F2RC 2FE8A 1VRAB 3B9JA 1MHHE 2MJEA 1NVID 1FM0D 4GDLB 3EA6A 1K50A 3HVZA 4A9AA 2LHEA 4REZA 1TYGB 1F0ZA 4LK0M 1ZUD2 1QOBA 1E6EB 4J3OD 1I4RA 3DWMA 1FO4A 4KGSA 3AN1A 2OHFA 2RPVA 1D5XC 3MJ5A 2WXPA 2W54A 1T6BX 1K51A 1VZ6A 2HTME 2M0AA 1ACCA 4N58A 4L23A 1SXTA 4ZOHC 3AEAB 1ZPSA 3CIRB 3L4PA 2H89B 1CK1A 1XCQL 1HEZE 3Q69A 3UI3A 3U7ZA 1IGDA 1YJJA 2KMMA 5EE1A 5EE9A 2DBYA 1SIJA 4WIPA 4KGRA 5FR3A 3R2IA 2WXIA 3PZ8A 1JROA 5E6JA 1N63A 1FCCC 3U2SC 1Y56A 1BUIC 2J42A 4RGTA 1SF0A 2RMMA 1IUEA 3PO0A 2BS2B 1I4QA 3C8YA 4MACA 3LB8C 2VZKB 3AE9B 1BMLC 4HEA1 4WURA 1PUTA 4JE3B 4RNAA 5FKAC 1FXAA 1FFVA 1P7FA 1SJED 4XDDA 4XE0A 1ZE3D 1PDXA 4TQ1A 3MP9A 1A70A 1JWBD 1PGXA 1GB4A 3VR9B 3KLSX 4C7YA 3W5UB 1NEKB 2J53A 2CJNA 4WAFA 2AX5A 4IOIE 3ZJUA 2JZPA 1RFKA 1V8CA 3BIID 4KX6B 4GLSC 1VR9A 2KAJA 2WXNA 1RM6C 3DWGC 1JWUD 2VZKD 4B0EA 5HHDG 2BS3B 2MEKA 3J9CA 1AW7A 2N7JA 5TSSA 4YXDB 4OZBA 3BZDB 2FUG1 1YQ4B 1D5ZC 3HUIA 5BMIA 4RGOS 1FFUA 4OZCA 3GP7A 1ROEA 3N9YC 2BB5A 3NS1A 3E56A 3W2DA 2R61A 2JX5A 3LYYA 3LXFA 4UDUC 1ET9A 4XDCA 1HXYD 1QKZA 4KGTA 2J52A 2V3PA 2GRIA 2JU6X 3B2FA 1YN5A 2IJ0A 3TEZA 2ONQA 3T3NA 2K9XA 2WXOA 1TKGA 2BB6A 3VQIA 4B0MA 1TKYA 2GI9A 3AEFB 4JX1C 4A8XC 1AWDA 1C77A 3BVMA 4CQNA 2X38A 1MHXA 1XLNA 3AEBB 1PGAA 3RFZB 3ZGZA 1K52A 1STEA 4R3DA 1V1OA 3R8BA 1C9FA 2WDVB 1D6EC 1XO3A 1ZXHA 1TY0A 2H88B 2JQRB 3IXSA 3P42A 5HI1A 5T8IA 4AQ7A 3AE7B 1D4BA 4WQMA 1CQVA 1CZPA 1NENB 3Q8FA 2MJDA 4O1NA 1UNSA 2EKIA 5D3DA 2PVOD 1UGJA 3VRAB 3W1SA 1RWSA 1SE2A 3BWUD 2KDMA 2LEKA 1JRPA 4RF0A 2WXRA 3FILB 1I7HA 1ZDXA 1I4GA 2JSVX 4OHJA 3AE8B 1TS4A 4TMAB 2JYTA 3AMZA 4KKIA 1QT9A 5AUKA 1TS3A 2K5PA 4WH4A 4A90A 2BS4B 1ZDVA 4KKJA 4XWTA 1WWTA 3AH7A 1J7CA 1VLBA 1JALA 4L2YA 3ZQ4A 2NMQA 3NVWA 2GB1A 2Y3AA 2EELA 1PFDA 2L83A 1GPXA 3EGRA 2WU2B 3BVGA 4OVZA 3EUB2 1DGJA 1IBXA 2N9KA 4GDKB 4NJCA 4YSZB 1MI0A 2OEDA 1L0YB 3OWEB 2WXLA 4DXFA 1JWAD 4YTPB 1ZP0B 3P4SB 1B9RA 2PTLA 5EE3A 1ZXIA 2W82A 4YT0B 2IGDA 1L4DB 1T5XD 2E3TA 4HKQA 4LLGM 1YJIA 4RGNA 4ZYSA 1QOGA 2WDQB 2LHDA 1AYFA 4NZLB 3BYYB 4WWMA 4YTMB 1KTKA 1FXIA 2DWQA 1IGCA 5C2TB 2I2YA 1KLGD 1GAQB 3W5VB 3FC4A 4A55A 4RCOA 2QEJC 1T3QA 3O13A 2M56B 3SFEB 2WXJA 4JWSC 1KRHA 3ZYYX 1K53A 2JYEA 2I38A 3KWVA 2CU3A 1OFFA 2SEBD 3W9CB 1YMHE 4ZRQA 4IDIA 1V1PB 4US8A 3IAM1 3IT6B 1QLBB 2K0PA 1SJHD 2ON8A 1SEBD 2B76B 2IPKD 3BYTB 4HJGE 2WP9B 4P6VF 3TEXA 1C4AA 4A6QA 3SEBA 4MM3B 2LJIA 1ENFA 1VJKA 3I57A 3Q8AA 1XEEA 1EWCA 1FRRA 1PYWD 2W55A 3P63A 3V05A 1TKEA 3TEYA 5MPOA 1FMAD 1FRDA 3AE5B 4C56C 2WXQA 2Z8LA 3IT4B 4DXGA 1C79A 5BMGA 1DOIA 2ICIA 1RYJA 2RDHA 1XLQA 2KQ4X 1TJEA 3ZJTA 2MJ3A 3BK1A 2YEPF 3P4QB 1R7SA 2K3UA 2W3SA 4H2AA 1QQRA 1E0ZA 3H8HA 5D3IB 1DOYA 2IGGA 1NYRA 2IDYA 2BT6A 4TQ0A 4OW0A 1VZ7A 2AQ3B 2NTTA 2WDRB 3FILA 3AM9A 1F77A 3KWLA 3MFGA 4DQOC 2KACA 2IGHA 1E7PB 1EU4A 1HZ6A 3AE2B 4MH8A 4M0WA 1QILA 2N0SB 1C4PA 1KH0A 1XLOA 3PZ7A 1JCKB 1F2RI 4HRSA 2ACZB 1FEHA 2K22A 1C76A 4JPSA 1PGBA 4IKGA 2FBWB 1LO5D 2QMTA 2L32A 3BVZA 3ETRA 3NRZA 2QILA 1E9MA 1SE4A 2G1EA 4PT5A 2M19A 1MPEA 1VDVA 2DYMA 4HKZE 5HG2A 4EE2A 1N5WA 1TY2A 5G5GA 2V0GA 2L52A 1OQRA 1UUPA 1TZOA 4RH6A 3VRBB 1UWMA 3NVVA 2JWUA 3E9SA 3AE4B 1GB1A 2AQ2B 1L4ZB 2INNE 5G5HA 4JWUC 4HROA 2Y5PA 3SFDB 4TSSA 1KFYB 3TSSA 3R2TA 1YN3A 1N5XA 1XLPA 1B1ZA 4YTNB 4YWGG 1JWSD 2E6XA 3ABVB 5BYSA 1N62A 3URYA 4US9A 1XCTL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BUI C;  1C76 A;  1C77 A;  1SSN A;  2SAK A;  1C78 A;  1C79 A; 
#chains in the Genus database with same CATH topology
 1UWX A;  2WQY B;  3Q8C A;  1YNT E;  2LAS A;  3L08 A;  3NVY A;  3Q8E A;  1Z2M A;  3QCA A;  4BBN F;  1SE3 A;  2BYT A;  4IM3 A;  1WE6 A;  3DQV A;  2BTE A;  5FR6 A;  2R2O A;  4N59 A;  3L13 A;  1L5P A;  1FIQ A;  4BBN C;  5AUI A;  2LVP A;  4MEM A;  3AED B;  2LFI A;  4RGM A;  1T0Y A;  1V1P A;  1FD6 A;  2NBW B;  3VR8 B;  2V1Y A;  3ALB A;  1WGR A;  2WXK A;  4C80 A;  5GXG B;  4DHZ E;  1KLU D;  4AP4 C;  3CSF A;  1EM7 A;  1V80 A;  3A9J A;  2KC1 A;  4W9E A;  1WGY A;  1C78 A;  3QJZ A;  5CHF A;  1YD8 U;  2TSS A;  2YEP B;  2BGF A;  1P3Q U;  1WXQ A;  4D2K A;  2GBM A;  4K7W A;  1EWY C;  2KN4 A;  4E3C A;  2IY1 B;  2NTS A;  3JVZ X;  1GOZ A;  2V4I B;  2NR2 A;  2LXC A;  2K8H A;  2LMC A;  2W9N A;  4C7Z A;  4NAM A;  4BKG A;  1WF9 A;  3ZRF A;  4F1S A;  1I4X A;  1GG3 A;  3NG0 A;  3FAH A;  4NQK E;  3WCQ A;  3KYD D;  2JZ3 B;  3VVW B;  3CWI A;  1FNU A;  3Q2A C;  3AE6 B;  3HVD A;  2DAF A;  1NYQ A;  1FNV A;  2JWZ A;  3SR6 A;  3VTW A;  3AEE B;  3SD5 A;  1FNW A;  1WJ6 A;  2K1F A;  4IUM B;  5JXV A;  1Q5W B;  1HQR D;  3I3T B;  5DPT A;  1JML A;  1I4H A;  4N9F 4;  5JHB A;  5D7G A;  2FUH B;  2C7H A;  2D5G A;  3L54 A;  2INC C;  5BO4 B;  4XYC A;  2K6D B;  1OQQ A;  2KJH B;  4CO7 A;  3MC9 A;  4KSK C;  1YN4 A;  2MA9 B;  3APC A;  1VRA B;  2D07 B;  2MJE A;  1NVI D;  2KK8 A;  4GDL B;  4X57 B;  3M95 A;  3OAW A;  2KQ7 A;  1E7V A;  1WX7 A;  4A9A A;  2LHE A;  4REZ A;  1KJT A;  4ANU A;  5LXI B;  4P7I A;  3DWM A;  4KGS A;  3AN1 A;  2OHF A;  4HVB A;  3MJ5 A;  1V86 A;  3T9L A;  1WXA A;  1ACC A;  4W9F A;  4ZOH C;  4PS8 A;  3KYC D;  2Z0E B;  1HEZ E;  3U7Z A;  3M63 B;  2DEN B;  1WZ0 A;  2XEW A;  5FR3 A;  4KGR A;  3R2I A;  2LD9 A;  1N63 A;  1XT9 B;  2LJ5 A;  2V3S A;  1IPG A;  4RGT A;  5IAA C;  3PO0 A;  4LJP B;  3LB8 C;  2VZK B;  4KDL B;  4WUR A;  1PUT A;  4JE3 B;  1J8C A;  4BOS C;  4XDD A;  3MHS D;  4XE0 A;  2O6V B;  1JWB D;  2X8X X;  3VR9 B;  2I1J A;  4WAF A;  2KKC A;  2KAJ A;  3IFW B;  1RM6 C;  3H7P B;  4YXD B;  4WWN A;  1D5Z C;  1SIF A;  1FFU A;  3N9Y C;  2BB5 A;  3E56 A;  2R61 A;  4B9K A;  4B6W A;  1FXT B;  2KLC A;  2KVR A;  2JU6 X;  4K3C A;  2IJ0 A;  5G2N A;  3TEZ A;  2BB6 A;  2BPS A;  1AWD A;  3BVM A;  2KDF B;  3A33 B;  2DHZ A;  3PHW B;  3Q3N C;  5DPS A;  1OQY A;  5J17 A;  5GMV A;  1C9F A;  1XO3 A;  4AQ7 A;  3AE7 B;  1R4N B;  3QAQ A;  1KM7 A;  1UGM A;  4II2 B;  1MG8 A;  1AAR A;  4GU2 A;  1JRU A;  1RWS A;  2KDM A;  2LEK A;  1V49 A;  2LRW A;  4RF0 A;  2MLB A;  2HJ8 A;  4GB9 A;  2FNJ B;  2JYT A;  2LUE A;  1QT9 A;  4PS7 A;  5AUK A;  1Z5S B;  3RUL A;  2K5P A;  4FJV B;  4WH4 A;  4A90 A;  4ANW A;  1LM8 B;  4KVG B;  3AH7 A;  4NNJ B;  1VLB A;  2DX5 B;  1RRB A;  4L2Y A;  3HK0 A;  3ZQ4 A;  1IP9 A;  4LNN A;  2N7D A;  3AU5 A;  4OVZ A;  3ENE A;  2M1M A;  4KV2 A;  2JRI B;  2MBQ A;  1IBX A;  3ZDM C;  3QIJ A;  3B08 A;  1B9R A;  2W82 A;  4RMA A;  2IGD A;  3CMM B;  5LLI A;  2E3T A;  2ZVO A;  2NCN A;  1QOG A;  2LHD A;  5IO9 A;  4NZL B;  4CYE A;  1KTK A;  1FXI A;  2EKE C;  1D3Z A;  3LJ3 A;  5C2T B;  1GAQ B;  3FC4 A;  2IYD B;  1H4R A;  3QC8 B;  2XK5 A;  3O13 A;  3V6E B;  2Z59 B;  2WXJ A;  4JWS C;  4WWO A;  3ZYY X;  2JYE A;  2V9H A;  2CU3 A;  1OFF A;  2SEB D;  4K1R B;  5E6O A;  1C3T A;  1NBF C;  3JYU A;  4ZRQ A;  2L8J A;  4IDI A;  3IAM 1;  3GE8 C;  2ON8 A;  3BYT B;  2IPK D;  2K8C A;  4HJG E;  2BQQ A;  4JLC A;  1C4A A;  4A6Q A;  4MM3 B;  2LJI A;  1VJK A;  2GBR A;  4GGQ A;  2D10 A;  3TEY A;  1YQB A;  2L76 A;  4W9G A;  3ZXR A;  3IT4 B;  2KTF A;  1DOI A;  3ZW3 A;  1RYJ A;  1XLQ A;  5DPW A;  1TJE A;  4NJ6 A;  4BAX A;  2AWT A;  2YEP F;  1R7S A;  1KOT A;  2BF8 B;  3N32 A;  5D3I B;  2IDY A;  2BT6 A;  3TBL D;  3ZTC A;  2BYE A;  3KWL A;  2NVU I;  1WYW B;  1PQS A;  3ZDT A;  3UQB A;  4M0W A;  4NPN A;  2N0S B;  1XLO A;  2BWE S;  1F2R I;  1C76 A;  4IKG A;  1LO5 D;  2L32 A;  3ETR A;  2G1E A;  2DYM A;  2G3Q B;  2WHI A;  4DHJ D;  3NVV A;  1WH3 A;  4GDK A;  3WAL A;  4W9C A;  3N1X C;  4FLH A;  2VRR B;  4HRO A;  5JHA A;  3APF A;  2BVC A;  2KFK A;  3I63 C;  2WWZ A;  1YN3 A;  4A20 A;  2JY6 A;  5J2R A;  1B1Z A;  2E6X A;  1N62 A;  3URY A;  2UU7 A;  4IG7 B;  1SE9 A;  4II3 B;  5C3J B;  1TS5 A;  4HJK A;  3TJP A;  1UF0 A;  4JGH B;  2NBV B;  1UBI A;  2PVG C;  2QHO A;  3V62 A;  2LGX A;  2KDI A;  1SSN A;  1L0X B;  1HA5 A;  1ZGU B;  2J0M A;  4FJZ A;  4KDI C;  1WIA A;  1T0R C;  2PIA A;  3I9V 1;  4ZHO A;  2BBC A;  2PKO A;  1C1Y B;  3W1S C;  2AQ1 B;  4YSY B;  1VZ8 A;  1G6J A;  2OOB B;  2Z0D B;  4ARC A;  4I6N B;  2JZZ A;  2LUM A;  3NZ3 A;  2BW2 A;  1S1Q B;  2GBN A;  4EZL A;  3PHX B;  5I4D A;  5H8Y E;  1H8C A;  1J7A A;  2PEA A;  3P4R B;  1JW9 D;  3GZN I;  3GB1 A;  3SHQ A;  3QA8 A;  3D32 A;  1XXG A;  3V3X A;  4N6E B;  2ZPN A;  1RFA A;  1WGD A;  2KDE B;  5FK9 C;  3AB5 A;  4RM9 A;  4LJO B;  1MJD A;  5CX3 A;  4LNO A;  2WXF A;  2KWC A;  2KAN A;  3UQA A;  4FJY A;  1WMH B;  5H92 C;  1QZE A;  4JL9 A;  1ET6 A;  2RDB C;  4W9D A;  1RLF A;  2ZPY A;  3T8M A;  2NPT A;  3GOE A;  4LTU A;  3U30 A;  3JSV A;  1E8W A;  4GMV A;  3RI7 C;  1TS2 A;  3ZJV A;  2G4D B;  2N9L A;  2QIE B;  2MP2 A;  1V97 A;  2IO0 B;  1HE8 A;  1YQ3 B;  2ZW0 A;  2WU5 B;  2QSD A;  4TUU A;  2VH1 A;  2RGF A;  5C1Z A;  1N61 A;  3MHZ A;  4FHJ A;  3O65 B;  2LGI A;  3RYT A;  4GSW A;  1NDD A;  4NAW B;  4LNF A;  1E8X A;  1YOV B;  4FUL A;  1WJN A;  4WAA A;  2FE8 A;  3ZNI D;  3DVN U;  2RPQ A;  1FM0 D;  1I42 A;  1TYG B;  2KMA A;  1F0Z A;  1QOB A;  1E6E B;  4J3O D;  3ZNH B;  2WX1 A;  2N1V A;  1T6B X;  4EKU A;  1VZ6 A;  1SXT A;  3PRP B;  2K25 A;  3AEA B;  3L4P A;  2H89 B;  1T0S C;  1UD7 A;  3UI3 A;  1YJJ A;  1UH6 A;  3HHM A;  2KMM A;  3TMP B;  3ZNG C;  1Q1O A;  1N6Z A;  4HPP A;  1Y56 A;  3DVN V;  1BUI C;  2RMM A;  4K7S A;  1FPY A;  3NS8 A;  2IO3 B;  1BML C;  3AU4 A;  3WAM A;  3VFK A;  4URK A;  2WDT B;  1GB4 A;  3KLS X;  4C7Y A;  3K9O B;  5L95 C;  2DYB A;  1V8C A;  2IND C;  4GXB A;  4GLS C;  3DWG C;  2VZK D;  4B0E A;  1V5T A;  4IWO A;  2N7J A;  3BZD B;  2MBB B;  2O6V D;  1HXY D;  1QKZ A;  2J52 A;  3KVF B;  3B2F A;  2D11 A;  3R3M A;  4IM2 A;  1YX6 B;  2GI9 A;  4G0N B;  2CHZ A;  3AEF B;  1C77 A;  1TZ1 A;  3X23 A;  1OTR B;  1MHX A;  1K52 A;  1STE A;  1V1O A;  3R8B A;  2WDV B;  1D6E C;  1WI0 A;  2FAZ A;  1ZXH A;  2H88 B;  3P42 A;  3IXS A;  5T8I A;  4GDL A;  1CQV A;  1CZP A;  3Q8F A;  4A3O A;  4O1N A;  2EKI A;  5D3D A;  4MSM B;  3N20 C;  2A5U A;  2Y5B B;  3W1S A;  4DDG D;  2IZV B;  3PGE A;  3A4R A;  1OEY J;  3UGB B;  2LWP A;  1TS3 A;  3RD2 A;  2IY0 B;  3IHP C;  1J7C A;  3DBL I;  3DBR I;  2EEL A;  4KZC A;  4XGA B;  2DZM A;  3EGR A;  3BVG A;  3EUB 2;  3VH3 B;  4WQO B;  2KC2 A;  1L0Y B;  3PRM B;  4A3P A;  3QQ8 B;  4TV3 A;  1TBE A;  3M62 B;  4AJY B;  1WM3 A;  4C4V B;  1L4D B;  1T5X D;  4HKQ A;  2CS4 A;  2O6V A;  4AOF A;  2WDQ B;  1AYF A;  4WWM A;  4G3X B;  2CU1 A;  2KNB A;  1GNU A;  2DWQ A;  1T0Q C;  4WJQ A;  4ACF A;  3H7P A;  2CHW A;  2QEJ C;  3APD A;  3VUX A;  1T3Q A;  3A1Q B;  5KHQ A;  2CHX A;  1K53 A;  3KWV A;  5C23 A;  1UEL A;  1OGW A;  3U8Z A;  2KN5 A;  3Q3F A;  3DVG X;  2ZVN A;  2B76 B;  4P6V F;  3TEX A;  3SEB A;  3JW0 X;  4GN1 A;  2KDB A;  3I57 A;  3Q8A A;  3RUI B;  1EWC A;  2ASQ A;  3V05 A;  1TKE A;  4W9H A;  3IVF A;  2XBB C;  3AE5 B;  3PLU A;  2Z8L A;  4I6L B;  2GOW A;  2AL3 A;  2JT4 B;  2ICI A;  3H7S A;  2KQ4 X;  2MJ3 A;  1YJ1 A;  3BK1 A;  3KUZ A;  4H2A A;  1WE7 A;  1ZKH A;  3RT3 B;  1DOY A;  1CMX B;  2D2Q A;  1Y8R C;  4TQ0 A;  4OW0 A;  3WAN A;  3PRZ A;  4DQO C;  1EU4 A;  4MH8 A;  4FBJ B;  1QIL A;  3PZ7 A;  2ACZ B;  1FEH A;  3Q3J A;  2K22 A;  4LDT B;  1F9J A;  3BVZ A;  2QIL A;  1SE4 A;  4PT5 A;  3PS6 A;  2G45 B;  4HKZ E;  2WYQ A;  3V60 A;  5HG2 A;  1L2N A;  1UUP A;  1TZO A;  3VRB B;  2JWU A;  2R2Q A;  1GB1 A;  4ANV A;  1L4Z B;  2L00 B;  4EZK A;  1LXD A;  1KLV A;  5E6N A;  3H9D A;  3R66 C;  3V6C B;  2YVC A;  4TSS A;  1KFY B;  1TGZ B;  1N5X A;  3DBL B;  4YWG G;  3ABV B;  4PYU A;  4KIK B;  4MGZ E;  5LXH A;  4WJN A;  1XCT L;  4EE2 A;  2WGS A;  4ASW C;  1QOF A;  1SBB B;  1CJE A;  2RSU A;  2JRH A;  3H1U A;  3SU8 X;  4F7Z A;  2WLB A;  5AZH A;  1XF5 L;  1GUA B;  2WXM A;  2LGS A;  2J4X A;  3TUO A;  1GC7 A;  3AI5 A;  4ZHP A;  2KX3 A;  5HFY A;  1ZOY B;  1EU3 A;  4XWW A;  1L6V A;  4EUT A;  1V9J A;  1Q10 A;  3ECI A;  2PW9 A;  3Q8B A;  2MSE D;  1WX8 A;  3GS2 A;  5BYR A;  4USA A;  3B2G A;  4MM3 A;  1V81 A;  2MH7 A;  2LVO A;  1C4C A;  4DXA B;  1IBX B;  4OVV A;  3KH0 A;  1GC6 A;  2PLP A;  3NHE B;  2LRU A;  1ESF A;  1P7E A;  1WGK A;  3AV8 A;  3OJ3 A;  3EFU A;  3ZIM A;  2LGD A;  4P16 A;  4ITK A;  4S17 A;  3RPF C;  2KXJ A;  2DNF A;  4ANX A;  4MJS A;  2L1A A;  2SAK A;  4FXC A;  3NJT A;  2WXH A;  3DCG A;  4BKS D;  4DHZ B;  3IAS 1;  1N60 A;  2ZW1 A;  1TIF A;  3B1L X;  4M00 A;  5EDS A;  3NVZ A;  2G9H D;  3VTV A;  2KZR A;  2MBH A;  3U52 E;  2KOX A;  3U7D A;  5D94 A;  4M8N A;  3P4P B;  3AEC B;  2MQJ A;  1WXV A;  1P1A A;  2DYO A;  2KVZ A;  2A4Z A;  1WGH A;  3AE3 B;  1DOX A;  1JQ4 A;  1V2Y A;  4L1B A;  5EE0 A;  4FA6 A;  4HCN B;  1WR6 E;  1X1M A;  2J0K A;  2Y5C A;  3HRD D;  1HZ5 A;  5HKH A;  2GLS A;  2KJ6 A;  2IBI B;  2KTR B;  4OZA A;  4ZRP A;  4RF1 A;  1DYQ A;  1SB3 C;  3GE3 C;  4J6I A;  3B9J A;  1MHH E;  2MBO A;  3A9K B;  3DVG Y;  1K50 A;  3HVZ A;  3TCA A;  4LK0 M;  1ZUD 2;  1WXS A;  3Q14 C;  1FO4 A;  4JQW C;  2RPV A;  1D5X C;  2WXP A;  2W54 A;  2UYZ B;  4FAD A;  1K51 A;  2HTM E;  2MX2 A;  4N58 A;  4L23 A;  4MSQ B;  2K6Q A;  1NI2 A;  1M94 A;  3Q69 A;  2K39 A;  5TR5 A;  1IGD A;  1P98 A;  5EE9 A;  2DBY A;  2FIF A;  1SIJ A;  4WIP A;  2FID A;  5AZG A;  1JRO A;  2C9W B;  5E6J A;  1FCC C;  3U2S C;  2J42 A;  2HE7 A;  2M0X A;  2BS2 B;  3C8Y A;  3K9P B;  4HEA 1;  4RM8 A;  3W1Y A;  1E90 A;  3MJW A;  1SGH A;  2DZK A;  4RNA A;  1EUV B;  1P7F A;  2ZNV B;  1ZE3 D;  3MP9 A;  1PGX A;  4WJP A;  5AEK B;  1EF1 A;  3LDZ E;  3C19 A;  4AJW A;  2AYO B;  2AX5 A;  4IOI E;  3ZJU A;  1RFK A;  1WMH A;  2LXA A;  4LCD E;  4MGY E;  2WXN A;  1JWU D;  2MEK A;  1AW7 A;  3ZLZ A;  1S3S G;  4OZB A;  1YQ4 B;  2FUG 1;  3DHI C;  1ROE A;  2FCQ A;  3NS1 A;  4IC7 B;  3W2D A;  2N9E B;  2IO1 B;  4UDU C;  4K7U A;  4KGT A;  2N9X A;  3V61 A;  2C7M B;  2O2V B;  3QAR A;  1YN5 A;  3PVL A;  3T3N A;  4G50 A;  4B0M A;  3H6N A;  4TKN A;  5G55 A;  4NAW A;  2GMI C;  4CQN A;  2BYF A;  1GJZ A;  4HXD A;  3ZGZ A;  2L0T A;  2VH2 A;  4R3D A;  4BFR A;  1D4B A;  2MWS B;  1UZX B;  2MJD A;  1UNS A;  3ONS A;  3PSE B;  3VUY A;  3PTF C;  1UGJ A;  1XD3 B;  3BWU D;  2L05 A;  2WXR A;  3FIL B;  3C0R B;  1ZDX A;  2LVQ A;  1TS4 A;  4TMA B;  4KKI A;  4JIO U;  3UF8 A;  3JSV B;  1P0R A;  1ZDV A;  4KKJ A;  2LGY A;  4HDO A;  2MP2 B;  3Q6B A;  2V4L A;  3TL5 A;  3VH4 B;  1GPX A;  4PYZ A;  2KX0 A;  3VAW A;  1DGJ A;  1WR1 A;  2OJW A;  4MDK E;  4NJC A;  1MI0 A;  2DAJ A;  2OED A;  3OWE B;  2PE9 A;  1JWA D;  1ZP0 B;  3P4S B;  3RNF C;  2PTL A;  3WA0 A;  2BYV E;  3L10 B;  4ZRI A;  2KD0 A;  4YT0 B;  2RD0 A;  5DCN A;  4LLG M;  1YJI A;  4RGN A;  5JH5 C;  3ZRC A;  2M4N A;  3CF6 E;  4XC2 A;  3BYY B;  4YTM B;  4M02 A;  4EZJ A;  4E71 A;  2EMT A;  3RNE C;  2I2Y A;  3W5V B;  2KHW B;  3PZD A;  4RCO A;  3SFE B;  3GZN B;  2M17 A;  1YIW A;  2I38 A;  3DPD A;  2NBU A;  3W9C B;  1YMH E;  4ZRK A;  1V1P B;  3IT6 B;  2K0P A;  4FN2 A;  1SJH D;  4B95 A;  2MW5 A;  2WP9 B;  1ENF A;  2LI5 A;  1ZW7 A;  4P1C C;  1XEE A;  4PS3 A;  5DPR A;  5MPO A;  1FMA D;  3A9J B;  4IWQ A;  4C56 C;  3PT2 B;  4CHK A;  2WXQ A;  4GIV A;  3L0W B;  2KLG A;  2FCS A;  1LGR A;  4ICU A;  3RNG C;  2KYW A;  2K3U A;  1QQR A;  3DBS A;  1E5W A;  1J0G A;  2WX0 A;  3AM9 A;  2KJR A;  3MFG A;  2KAC A;  1E7P B;  3AE2 B;  1C4P A;  4ZYN A;  1JCK B;  4HRS A;  1PGB A;  4K81 A;  2FBW B;  3R7R A;  4DDI D;  4EEW A;  4P1B C;  3X0W A;  1E9M A;  1R4N I;  3WAO A;  1VD2 A;  4BOZ B;  2D3C A;  4WWP A;  1N5W A;  1TY2 A;  3QX1 A;  2V0G A;  2L52 A;  1OQR A;  3E9S A;  3AE4 B;  2KT7 A;  3DBH I;  2FCM A;  2INN E;  2BKR B;  5G5H A;  5D6J B;  4W9J A;  2L3Z A;  4LDT D;  3TSS A;  3R2T A;  1E8Z A;  1XLP A;  4C4V A;  3TIX A;  5BYS A;  3RMK C;  4LNK A;  2J7Q B;  1BT0 A;  3NZS A;  4HCP B;  2INP E;  1WXM A;  2JUO A;  3OG5 A;  2UWQ A;  2JXT A;  3MTN B;  4ZDV A;  3EFC A;  2QJL A;  5BMH A;  3VUW A;  2N9P C;  3IBE A;  1FCL A;  2C5L C;  1BXT A;  4XX5 A;  4C00 A;  3A1Q A;  2LZ6 A;  1QOA A;  2KMC A;  1LQB A;  4NY0 A;  2QCZ A;  3BK2 A;  1F1H A;  2MCN B;  3RZW C;  3ZO5 B;  2WS3 B;  4IW0 A;  4AUQ C;  2XNA C;  1AN8 A;  2ZJD A;  4G11 A;  2CJO A;  1E10 A;  1I4P A;  3M3J A;  4ARI A;  4IM0 A;  1JWM D;  3EC8 A;  3ML9 A;  1NI3 A;  3DHH C;  5LNK 1;  3MC0 B;  3NOB A;  5CHW A;  1L7Y A;  1MVK A;  2G4S A;  4E74 A;  3NUH B;  5BYQ A;  3KUC B;  2V3N A;  3Q3O C;  3RZF A;  2DLB A;  1WGG A;  3AE1 B;  2XN9 C;  4M01 A;  2KWV B;  3DOW A;  4MT5 A;  3AEG B;  1WSP A;  1WYG A;  3R7Q A;  5JZE B;  1L6U A;  2AL6 A;  4AS1 A;  2WNM A;  2L0F A;  1WY8 A;  4BKT A;  3VDZ A;  1L0V B;  2KWD A;  2HDE A;  2RDG A;  2PMV A;  2PE6 B;  2Q5W D;  2MRP A;  4M8M A;  4Q2J A;  1QF6 A;  1A5R A;  2D3A A;  4MH0 E;  4MGK E;  4W9K A;  2W3R A;  4DK5 A;  1J19 A;  1KF6 B;  3RCZ A;  3RN9 C;  2N4F A;  2ZNV C;  3AUL A;  3OLM D;  2CKH B;  2BWF A;  1K8R B;  2WXG A;  4HLE A;  3QWZ B;  4RFB A;  1I35 A;  3RNB C;  1LFD A;  2ZCB A;  1J7B A;  4S0R A;  4DWF A;  4MGI E;  1WJU A;  3TEW A;  3KQ4 A;  4YSX B;  2PJH A;  4KSL C;  2D3B A;  3ML8 A;  1YX5 B;  4KIK A;  1TTN A;  3T3O A;  3DHG C;  1WRI A;  1D5M C;  2REX A;  3U4E G;  3P1M A;  1M4V A;  1E7U A;  3DBH B;  2NS5 A;  5E6P A;  1F2R C;  3L16 A;  3ZUN A;  3DBR B;  3HIZ A;  5IKC M;  3EA6 A;  4FHK A;  2B3A A;  3ZKJ C;  3VHT C;  1XQQ A;  5CTR C;  2AEH A;  1I4R A;  3WAP A;  3WIM A;  4KZ0 A;  4ZRJ A;  1UBQ A;  2M0A A;  3VXW A;  1ZPS A;  3CIR B;  2CR5 A;  1CK1 A;  1XCQ L;  2HD5 B;  2JPH A;  3UIN B;  4IWP A;  5EE1 A;  1IYF A;  2WXI A;  3PZ8 A;  1WRD B;  2GBJ A;  2JVC A;  1SF0 A;  1IUE A;  1V6E A;  2YLM A;  1I4Q A;  4MAC A;  3AE9 B;  4BZA A;  3ZTD A;  3PV1 A;  1EF5 A;  5FKA C;  1FXA A;  5IOI A;  2FCN A;  1FFV A;  1SJE D;  4AWJ A;  1PDX A;  4TQ1 A;  2K8B A;  1A70 A;  4XZ4 A;  3OJ4 B;  3W5U B;  1NEK B;  2J53 A;  1U4A A;  2CJN A;  1EO6 A;  2JZP A;  3HM3 A;  3BII D;  2QC8 A;  4ICV A;  3CST A;  4KX6 B;  1VR9 A;  3EEC A;  2JF5 A;  2ZEQ A;  4LNI A;  5HHD G;  2BS3 B;  2KQS A;  3J9C A;  3L17 A;  3PLV A;  5TSS A;  1HTQ A;  1V5O A;  1WFY A;  2XK5 B;  1RAX A;  3HUI A;  5BMI A;  4RGO S;  3NY5 A;  4I6P A;  4OZC A;  3GP7 A;  1WX9 A;  3ZVV A;  2JX5 A;  3LYY A;  3LXF A;  1ET9 A;  4XDC A;  1VCB A;  2V3P A;  2GRI A;  3ZNZ B;  3RNC C;  2KO3 A;  2ONQ A;  2K9X A;  2WXO A;  1TKG A;  2C60 A;  3FKY A;  3VQI A;  1TKY A;  2D3G A;  2KTR A;  3VTU A;  5J18 A;  3PPA A;  3N3K B;  4JX1 C;  4A8X C;  5AZF A;  1OEY A;  2X38 A;  1XLN A;  3AEB B;  4MJS B;  1PGA A;  3RFZ B;  4F8C B;  2HJ1 A;  2RR9 A;  1TY0 A;  2BKF A;  2JQR B;  3DDC B;  2IO2 B;  3B0A A;  4HWI B;  5HI1 A;  1F52 A;  4WQM A;  1NEN B;  3A9K A;  3KW5 B;  1WM2 A;  1ISN A;  2PVO D;  2EMS A;  3VRA B;  1R4M I;  1SE2 A;  5D2M B;  1JRP A;  1I7H A;  4HPM B;  2M8S A;  1I4G A;  2JSV X;  4M0W B;  4OHJ A;  3AE8 B;  3AMZ A;  3A4S C;  2BS4 B;  4XWT A;  1WWT A;  3PRE A;  4BVU C;  1JAL A;  2N1W A;  2HTH A;  2NMQ A;  3NVW A;  2GB1 A;  2Y3A A;  1PFD A;  2OJR A;  2C7N B;  2L83 A;  3KUD B;  2WU2 B;  3SDL C;  3NZU A;  4BKS A;  2N9K A;  4GDK B;  4YSZ B;  1MG4 A;  3MC8 A;  1WJ4 A;  4YL8 A;  2WXL A;  3UIO B;  4DXF A;  3HM6 X;  4YTP B;  1P9D U;  2KFK B;  5EE3 A;  1ZXI A;  2J0J A;  3IG3 A;  2KWU B;  2L7R A;  5IA7 A;  4GOC A;  4ZYS A;  5IN7 A;  3N1Z C;  3UIP B;  4WJO A;  1IGC A;  4EFO A;  2ZZP B;  3N30 A;  4K3B A;  5L83 A;  3RNA C;  4HDQ A;  4W9L A;  1KLG D;  3EHV A;  4A55 A;  2M56 B;  1KRH A;  3S2A A;  3I5J C;  4W9I A;  4QAY A;  2PPH A;  4US8 A;  4DBG A;  2O2V A;  1QLB B;  1SEB D;  1MFW A;  2JXX A;  4PK1 A;  3P63 A;  1PYW D;  1FRR A;  2W55 A;  2N7E A;  5IP4 D;  1TT5 B;  1FRD A;  3AXC A;  4DXG A;  3BIN A;  1C79 A;  5BMG A;  1HTO A;  1E8Y A;  2RDH A;  3ZJT A;  2GBK A;  3P4Q B;  2W3S A;  1E0Z A;  3H8H A;  2IGG A;  1NYR A;  4DHJ B;  2DZI A;  1VZ7 A;  2AQ3 B;  2NTT A;  2WDR B;  3FIL A;  1F77 A;  3QK0 A;  2IGH A;  3QHT A;  1HZ6 A;  1KH0 A;  4NJ7 A;  4JPS A;  2QDF A;  2QMT A;  3ZXV A;  4EOY A;  2I1K A;  4NQL B;  3NRZ A;  4HPL B;  2DZJ A;  2MBE A;  5KHO A;  2M19 A;  1MPE A;  1VDV A;  2ZCC A;  5G5G A;  1R4M B;  5CHV C;  2NPT B;  1WZ3 A;  4RH6 A;  1UWM A;  4MEL A;  2AQ2 B;  4JWU C;  1Q0W B;  2Y5P A;  3BY4 B;  3SFD B;  3N1Y C;  3P2B A;  3Q3M C;  4YTN B;  1JWS D;  2KFJ A;  4HK2 A;  4OVU A;  2MHJ A;  4US9 A; 
#chains in the Genus database with same CATH homology
 1UWX A;  2INP E;  2WQY B;  3Q8C A;  1YNT E;  2JXT A;  3NVY A;  1QOF A;  1SBB B;  2QJL A;  1CJE A;  5BMH A;  3Q8E A;  5C3J B;  1TS5 A;  1SE3 A;  2WLB A;  1FCL A;  2BYT A;  1XF5 L;  2PVG C;  2WXM A;  1BXT A;  2BTE A;  4N59 A;  1SSN A;  1L0X B;  2J4X A;  1L5P A;  3TUO A;  1HA5 A;  1FIQ A;  4ZHP A;  1QOA A;  5AUI A;  2PIA A;  5HFY A;  3I9V 1;  3BK2 A;  2BBC A;  4ZHO A;  1ZOY B;  1EU3 A;  2WS3 B;  3AED B;  2LFI A;  4XWW A;  1L6V A;  4RGM A;  2XNA C;  1AN8 A;  2PKO A;  1Q10 A;  3Q8B A;  1V1P A;  2PW9 A;  1FD6 A;  2CJO A;  2AQ1 B;  1E10 A;  1I4P A;  3GS2 A;  4YSY B;  3VR8 B;  5BYR A;  1VZ8 A;  4USA A;  3B2G A;  2WXK A;  2MH7 A;  4ARI A;  1JWM D;  4C80 A;  4ARC A;  5GXG B;  1NI3 A;  1C4C A;  5LNK 1;  3MC0 B;  1KLU D;  2LUM A;  3NZ3 A;  2BW2 A;  1IBX B;  1MVK A;  1EM7 A;  3NUH B;  5BYQ A;  5I4D A;  2V3N A;  2PLP A;  2DLB A;  3AE1 B;  1ESF A;  5H8Y E;  1J7A A;  1P7E A;  1WGK A;  3AV8 A;  3P4R B;  1JW9 D;  2XN9 C;  1C78 A;  4P16 A;  4MT5 A;  3GB1 A;  3AEG B;  1WSP A;  1WYG A;  2TSS A;  1L6U A;  4ITK A;  2YEP B;  3RPF C;  4AS1 A;  2WNM A;  1WXQ A;  2L1A A;  2SAK A;  4D2K A;  4FXC A;  1L0V B;  2KWD A;  1XXG A;  2WXH A;  1EWY C;  2HDE A;  2KN4 A;  4N6E B;  2RDG A;  3V3X A;  2PMV A;  2NTS A;  2Q5W D;  5FK9 C;  1GOZ A;  3IAS 1;  2V4I B;  3AB5 A;  1QF6 A;  4Q2J A;  1N60 A;  2ZW1 A;  2WXF A;  2W3R A;  1KF6 B;  2LMC A;  4C7Z A;  4NAM A;  1I4X A;  3FAH A;  3NVZ A;  2G9H D;  3WCQ A;  3U52 E;  3CWI A;  2WXG A;  5H92 C;  1FNU A;  3P4P B;  1ET6 A;  3AEC B;  3AE6 B;  3HVD A;  1NYQ A;  1FNV A;  4RFB A;  2DYO A;  3SR6 A;  4LTU A;  3AEE B;  3AE3 B;  1DOX A;  1JQ4 A;  1TS2 A;  3ZJV A;  1FNW A;  1J7B A;  4L1B A;  5EE0 A;  5JXV A;  2N9L A;  3TEW A;  1HQR D;  2QIE B;  1V97 A;  3KQ4 A;  1YQ3 B;  2ZW0 A;  2WU5 B;  4YSX B;  2QSD A;  1JML A;  2Y5C A;  1I4H A;  1N61 A;  3HRD D;  1HZ5 A;  3MHZ A;  2LGI A;  5D7G A;  3T3O A;  2D5G A;  4OZA A;  4ZRP A;  1WRI A;  4RF1 A;  4NAW B;  1D5M C;  3U4E G;  1OQQ A;  3P1M A;  1DYQ A;  1M4V A;  1SB3 C;  1YN4 A;  1F2R C;  2FE8 A;  1VRA B;  3B9J A;  1MHH E;  2MJE A;  1NVI D;  1FM0 D;  4GDL B;  3EA6 A;  1K50 A;  3HVZ A;  4A9A A;  2LHE A;  4REZ A;  1TYG B;  1F0Z A;  4LK0 M;  1ZUD 2;  1QOB A;  1E6E B;  4J3O D;  1I4R A;  3DWM A;  1FO4 A;  4KGS A;  3AN1 A;  2OHF A;  2RPV A;  1D5X C;  3MJ5 A;  2WXP A;  2W54 A;  1T6B X;  1K51 A;  1VZ6 A;  2HTM E;  2M0A A;  1ACC A;  4N58 A;  4L23 A;  1SXT A;  4ZOH C;  3AEA B;  1ZPS A;  3CIR B;  3L4P A;  2H89 B;  1CK1 A;  1XCQ L;  1HEZ E;  3Q69 A;  3UI3 A;  3U7Z A;  1IGD A;  1YJJ A;  2KMM A;  5EE1 A;  5EE9 A;  2DBY A;  1SIJ A;  4WIP A;  4KGR A;  5FR3 A;  3R2I A;  2WXI A;  3PZ8 A;  1JRO A;  5E6J A;  1N63 A;  1FCC C;  3U2S C;  1Y56 A;  1BUI C;  2J42 A;  4RGT A;  1SF0 A;  2RMM A;  1IUE A;  3PO0 A;  2BS2 B;  1I4Q A;  3C8Y A;  4MAC A;  3LB8 C;  2VZK B;  3AE9 B;  1BML C;  4HEA 1;  4WUR A;  1PUT A;  4JE3 B;  4RNA A;  5FKA C;  1FXA A;  1FFV A;  1P7F A;  1SJE D;  4XDD A;  4XE0 A;  1ZE3 D;  1PDX A;  4TQ1 A;  3MP9 A;  1A70 A;  1JWB D;  1PGX A;  1GB4 A;  3VR9 B;  3KLS X;  4C7Y A;  3W5U B;  1NEK B;  2J53 A;  2CJN A;  4WAF A;  2AX5 A;  4IOI E;  3ZJU A;  2JZP A;  1RFK A;  1V8C A;  3BII D;  4KX6 B;  4GLS C;  1VR9 A;  2KAJ A;  2WXN A;  1RM6 C;  3DWG C;  1JWU D;  2VZK D;  4B0E A;  5HHD G;  2BS3 B;  2MEK A;  3J9C A;  1AW7 A;  2N7J A;  5TSS A;  4YXD B;  4OZB A;  3BZD B;  2FUG 1;  1YQ4 B;  1D5Z C;  3HUI A;  5BMI A;  4RGO S;  1FFU A;  4OZC A;  3GP7 A;  1ROE A;  3N9Y C;  2BB5 A;  3NS1 A;  3E56 A;  3W2D A;  2R61 A;  2JX5 A;  3LYY A;  3LXF A;  4UDU C;  1ET9 A;  4XDC A;  1HXY D;  1QKZ A;  4KGT A;  2J52 A;  2V3P A;  2GRI A;  2JU6 X;  3B2F A;  1YN5 A;  2IJ0 A;  3TEZ A;  2ONQ A;  3T3N A;  2K9X A;  2WXO A;  1TKG A;  2BB6 A;  3VQI A;  4B0M A;  1TKY A;  2GI9 A;  3AEF B;  4JX1 C;  4A8X C;  1AWD A;  1C77 A;  3BVM A;  4CQN A;  2X38 A;  1MHX A;  1XLN A;  3AEB B;  1PGA A;  3RFZ B;  3ZGZ A;  1K52 A;  1STE A;  4R3D A;  1V1O A;  3R8B A;  1C9F A;  2WDV B;  1D6E C;  1XO3 A;  1ZXH A;  1TY0 A;  2H88 B;  2JQR B;  3IXS A;  3P42 A;  5HI1 A;  5T8I A;  4AQ7 A;  3AE7 B;  1D4B A;  4WQM A;  1CQV A;  1CZP A;  1NEN B;  3Q8F A;  2MJD A;  4O1N A;  1UNS A;  2EKI A;  5D3D A;  2PVO D;  1UGJ A;  3VRA B;  3W1S A;  1RWS A;  1SE2 A;  3BWU D;  2KDM A;  2LEK A;  1JRP A;  4RF0 A;  2WXR A;  3FIL B;  1I7H A;  1ZDX A;  1I4G A;  2JSV X;  4OHJ A;  3AE8 B;  1TS4 A;  4TMA B;  2JYT A;  3AMZ A;  4KKI A;  1QT9 A;  5AUK A;  1TS3 A;  2K5P A;  4WH4 A;  4A90 A;  2BS4 B;  1ZDV A;  4KKJ A;  4XWT A;  1WWT A;  3AH7 A;  1J7C A;  1VLB A;  1JAL A;  4L2Y A;  3ZQ4 A;  2NMQ A;  3NVW A;  2GB1 A;  2Y3A A;  2EEL A;  1PFD A;  2L83 A;  1GPX A;  3EGR A;  2WU2 B;  3BVG A;  4OVZ A;  3EUB 2;  1DGJ A;  1IBX A;  2N9K A;  4GDK B;  4NJC A;  4YSZ B;  1MI0 A;  2OED A;  1L0Y B;  3OWE B;  2WXL A;  4DXF A;  1JWA D;  4YTP B;  1ZP0 B;  3P4S B;  1B9R A;  2PTL A;  5EE3 A;  1ZXI A;  2W82 A;  4YT0 B;  2IGD A;  1L4D B;  1T5X D;  2E3T A;  4HKQ A;  4LLG M;  1YJI A;  4RGN A;  4ZYS A;  1QOG A;  2WDQ B;  2LHD A;  1AYF A;  4NZL B;  3BYY B;  4WWM A;  4YTM B;  1KTK A;  1FXI A;  2DWQ A;  1IGC A;  5C2T B;  2I2Y A;  1KLG D;  1GAQ B;  3W5V B;  3FC4 A;  4A55 A;  4RCO A;  2QEJ C;  1T3Q A;  3O13 A;  2M56 B;  3SFE B;  2WXJ A;  4JWS C;  1KRH A;  3ZYY X;  1K53 A;  2JYE A;  2I38 A;  3KWV A;  2CU3 A;  1OFF A;  2SEB D;  3W9C B;  1YMH E;  4ZRQ A;  4IDI A;  1V1P B;  4US8 A;  3IAM 1;  3IT6 B;  1QLB B;  2K0P A;  1SJH D;  2ON8 A;  1SEB D;  2B76 B;  2IPK D;  3BYT B;  4HJG E;  2WP9 B;  4P6V F;  3TEX A;  1C4A A;  4A6Q A;  3SEB A;  4MM3 B;  2LJI A;  1ENF A;  1VJK A;  3I57 A;  3Q8A A;  1XEE A;  1EWC A;  1FRR A;  1PYW D;  2W55 A;  3P63 A;  3V05 A;  1TKE A;  3TEY A;  5MPO A;  1FMA D;  1FRD A;  3AE5 B;  4C56 C;  2WXQ A;  2Z8L A;  3IT4 B;  4DXG A;  1C79 A;  5BMG A;  1DOI A;  2ICI A;  1RYJ A;  2RDH A;  1XLQ A;  2KQ4 X;  1TJE A;  3ZJT A;  2MJ3 A;  3BK1 A;  2YEP F;  3P4Q B;  1R7S A;  2K3U A;  2W3S A;  4H2A A;  1QQR A;  1E0Z A;  3H8H A;  5D3I B;  1DOY A;  2IGG A;  1NYR A;  2IDY A;  2BT6 A;  4TQ0 A;  4OW0 A;  1VZ7 A;  2AQ3 B;  2NTT A;  2WDR B;  3FIL A;  3AM9 A;  1F77 A;  3KWL A;  3MFG A;  4DQO C;  2KAC A;  2IGH A;  1E7P B;  1EU4 A;  1HZ6 A;  3AE2 B;  4MH8 A;  4M0W A;  1QIL A;  2N0S B;  1C4P A;  1KH0 A;  1XLO A;  3PZ7 A;  1JCK B;  1F2R I;  4HRS A;  2ACZ B;  1FEH A;  2K22 A;  1C76 A;  4JPS A;  1PGB A;  4IKG A;  2FBW B;  1LO5 D;  2QMT A;  2L32 A;  3BVZ A;  3ETR A;  3NRZ A;  2QIL A;  1E9M A;  1SE4 A;  2G1E A;  4PT5 A;  2M19 A;  1MPE A;  1VDV A;  2DYM A;  4HKZ E;  5HG2 A;  4EE2 A;  1N5W A;  1TY2 A;  5G5G A;  2V0G A;  2L52 A;  1OQR A;  1UUP A;  1TZO A;  4RH6 A;  3VRB B;  1UWM A;  3NVV A;  2JWU A;  3E9S A;  3AE4 B;  1GB1 A;  2AQ2 B;  1L4Z B;  2INN E;  5G5H A;  4JWU C;  4HRO A;  2Y5P A;  3SFD B;  4TSS A;  1KFY B;  3TSS A;  3R2T A;  1YN3 A;  1N5X A;  1XLP A;  1B1Z A;  4YTN B;  4YWG G;  1JWS D;  2E6X A;  3ABV B;  5BYS A;  1N62 A;  3URY A;  4US9 A;  1XCT L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...