2O2VA

Crystal structure of the complex of human mitogen activated protein kinase kinase 5 phox domain (map2k5-phox) with human mitogen activated protein kinase kinase kinase 3 (map3k3b-phox)
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
93
structure length
92
Chain Sequence
VLVIRIKIPNSGAVDWTVHSPQLLFRDVLDVIGQVLPEATTTAFEYEDEDGDRITVRSDEEMKAMLSYYYSTVMEQQVNGQLIEPLQIFPRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Dual specificity mitogen-activated protein kinase kinase 5
publication title Crystal Structure of the Complex of Human Mitogen Activated Protein Kinase Kinase 5 Phox Domain (MAP2K5-phox) with Human Mitogen Activated Protein Kinase Kinase Kinase 3 (MAP3K3B-phox)
rcsb
source organism Homo sapiens
total genus 21
structure length 92
sequence length 93
ec nomenclature ec 2.7.12.2: Mitogen-activated protein kinase kinase.
pdb deposition date 2006-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00564 PB1 PB1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2o2vA00
3RULA 1IP9A 2BYEA 4NPNA 2A4ZA 2K8CA 4NQLB 1WXAA 2C7HA 4W9JA 2NBVB 2MW5A 3VUYA 4DHJB 2D11A 2KJ6A 5D2MB 1V81A 2B3AA 2KX3A 2LGXA 3RUIB 2JUOA 4CO7A 3W1SA 3W1SC 2GOWA 2V4LA 3WAMA 4MEMA 2NPTA 3MTNB 4F7ZA 3C0RB 2XEWA 3VHTC 4AJYB 3QC8B 2RPQA 2NR2A 1KJTA 4II2B 3WIMA 1A5RA 3IVFA 2N1WA 3VTWA 4B9KA 3BY4B 3N30A 3IFWB 3N3KB 4JGHB 1WFYA 4ZRIA 3T8MA 5C1ZA 5L95C 2W9NA 2KTRB 3VFKA 2KO3A 2CR5A 2JWZA 3S2AA 3VUWA 3DCGA 4JL9A 4EZJA 4GSWA 2ZJDA 2O6VA 1WI0A 2PE9A 2DAJA 1T0YA 2K8BA 2L00B 4HCPB 3RD2A 4B6WA 3V6EB 4A20A 2ZZPB 3DBLI 5JH5C 2L05A 2JY6A 2IO1B 3B1LX 2KZRA 4LDTD 4DDID 4FA6A 1UBQA 1P1AA 3QAQA 2J0JA 4IM0A 4BKTA 2D3GA 4FJYA 1RAXA 4HCNB 3I3TB 2LXAA 4KSLC 3ZUNA 3L16A 4GGQA 4MDKE 3TL5A 3WAOA 4DXAB 2CU1A 2L76A 1EO6A 4HPMB 1D3ZA 2Z0EB 3ZNGC 2JRHA 2CHZA 4PYUA 3VAWA 1WYWB 3WA0A 4GDLA 1WXSA 1GUAB 5CHVC 4OVUA 2N1VA 5GMVA 3QA8A 1V80A 2N9PC 4MGYE 5E6PA 3OJ4B 4AJWA 2DHZA 4ICVA 1GJZA 2KDFB 4X57B 2IO3B 3WAPA 4K7UA 3V60A 2D10A 2KVRA 2WDTB 3PRPB 4PYZA 1WM2A 1SE9A 2IYDB 3DQVA 3K9PB 2MBHA 1YD8U 2PJHA 5KHQA 2V3SA 4TQ1A 1P0RA 1P9DU 1R4MI 4J6IA 4CYEA 2DZIA 4B95A 3VXWA 3H9DA 3APDA 1E8YA 2N9XA 1Y8RC 2KFJA 3IBEA 2NCNA 3PHXB 1X1MA 4WWPA 2KMAA 4IW0A 5J2RA 3KYDD 3O65B 2ASQA 2GBJA 3PZDA 4ANVA 3PRZA 2C60A 3VQIA 1E7VA 2K1FA 2LVQA 4HK2A 2KDIA 3JVZX 3H6NA 3KUDB 3KW5B 3M63B 1C1YB 4AP4C 3NZUA 4N9F4 2EKEC 3PS6A 1E8XA 2HTHA 3SU8X 2LASA 2KTRA 3JSVB 1MG8A 4EZKA 2Z59B 4HXDA 2M8SA 1WH3A 4ZDVA 2BPSA 1BT0A 4FADA 3QARA 2WX1A 2D07B 3VTUA 1WE7A 5D94A 1UELA 3A9KB 4HLEA 4A3OA 1PQSA 2BKFA 4RM8A 5CX3A 3QIJA 2LGYA 4DWFA 1OQYA 2C7MB 2M0XA 1OGWA 2KJHB 3M95A 1RFAA 2AWTA 4FHKA 4GB9A 5C23A 1Z5SB 2KKCA 2ZEQA 1JRUA 4XC2A 4WJQA 2M17A 2IBIB 3LJ3A 2KOXA 3GOEA 2XK5B 4K81A 2A5UA 4KIKB 1UGMA 2J0MA 1WXMA 1E5WA 3ECIA 1V2YA 4WWNA 4K7SA 3L54A 2N4FA 2CS4A 3QK0A 1WZ3A 1J19A 2FIFA 2JXXA 2K25A 3DVGX 4MJSB 1RRBA 4LCDE 3NY5A 3AU5A 2REXA 3UINB 2LJ5A 2ZCBA 3RYTA 3L0WB 4GDKB 5AEKB 4KDLB 4WJOA 3Q3JA 2M4NA 2JPHA 4W9GA 2KTFA 2GBKA 2N7DA 4G0NB 2RSUA 2KDBA 3DPDA 2MSED 4MELA 2LZ6A 4IM3A 2JZ3B 4MGIE 3ONSA 4WQOB 2Y5BB 4KZ0A 1XD3B 2LD9A 4IM2A 4BOSC 1V5OA 3VDZA 2K6DB 1ZKHA 1P3QU 2M1MA 3ZO5B 4FN2A 3PTFC 2GBRA 5DPTA 1KLVA 1WR1A 4TV3A 4PS3A 1WXVA 1Z2MA 2ZPNA 1RLFA 1V86A 2KN5A 2PE6B 2FCMA 3DBRI 3A4SC 4URKA 2FUHB 2KFKA 4DHZE 1M94A 5DPWA 3KUCB 1WX7A 1YIWA 4JLCA 4PS7A 5EDSA 1WGRA 3PPAA 3JYUA 4K1RB 4LDTB 4RM9A 2EMSA 3VH3B 5HKHA 3JSVA 2KWCA 3HHMA 3U7DA 4W9FA 2BWES 5J18A 1F9JA 2ZNVC 2PEAA 2HJ8A 4LJOB 5CTRC 1OEYJ 4BKSA 3R7RA 4BVUC 2DYBA 1YX5B 2QHOA 2ZPYA 3A9KA 4IC7B 1NDDA 2UYZB 4AWJA 1QZEA 1WJUA 1WR6E 2AYOB 4II3B 3VVWB 4FJVB 4E71A 3IHPC 4GXBA 4WAAA 1GC6A 4BFRA 3P2BA 4F1SA 1UBIA 2DZJA 1WGDA 4NY0A 3V6CB 1WJNA 4W9DA 3B0AA 3W1YA 3V62A 4KV2A 3EC8A 4WJNA 1WGYA 2KD0A 3R3MA 2DYMA 4M8MA 2XK5A 3PGEA 3HM6X 4KIKA 2K39A 4IWPA 5L83A 3H7PB 3BINA 3QHTA 1TGZB 1E8ZA 5G2NA 2KLCA 3ENEA 5TR5A 3R7QA 4ANXA 4MJSA 2KJRA 2RR9A 2LRWA 4ANWA 2MWSB 2OJRA 4E74A 2I1JA 5IA7A 3CSFA 2IY0B 4HJKA 3OLMD 1YQBA 1S3SG 2MP2B 4ICUA 4W9CA 1LFDA 2PPHA 4PS8A 4AOFA 4DDGD 4XZ4A 3SDLC 3DBHI 4G50A 2GBNA 4BOZB 2MBBB 4IUMB 3N32A 2N7EA 3NS8A 3X23A 3A9JB 1WMHB 4W9KA 1E90A 3WANA 1YX6B 3UF8A 3U8ZA 1E7UA 3AULA 1HE8A 3IG3A 4WJPA 2AEHA 3RZWC 3V61A 3SHQA 5JHAA 2Z0DB 1SIFA 1GNUA 2RGFA 4JQWC 2IO2B 2DZMA 3VTVA 1EF1A 5DCNA 1AARA 2V1YA 2GMIC 2L0FA 1J8CA 3NHEB 5D7GA 4ZRKA 3SD5A 4MH0E 3H1UA 3ZRFA 2G3QB 3DDCB 2O6VD 1UZXB 3L13A 1ZGUB 3OJ3A 3T9LA 2KC1A 2R2OA 3HM3A 3L17A 1WX8A 4G11A 4FBJB 2YLMA 3TIXA 1V6EA 3UGBB 3CF6E 5IAAC 3KYCD 2L0TA 2HD5B 4MSQB 4K7WA 3L10B 3PLUA 1ISNA 4F8CB 2LVOA 4AUQC 3MHSD 3Q3FA 3KUZA 4FULA 2MLBA 3L08A 4I6LB 4NAWB 4DK5A 2NBWB 4ANUA 2L7RA 4EFOA 4MSMB 3K9OB 1V5TA 4MGZE 3ZLZA 1WF9A 3APCA 3ZTDA 2LVPA 2HE7A 2OOBB 4GU2A 3TJPA 3ZVVA 1P98A 3MJWA 4IWQA 3PSEB 2KANA 5D6JB 4CHKA 4NJ7A 2CKHB 2L8JA 3ZDMC 2UWQA 3PREA 4EOYA 2C5LC 1KOTA 1WJ6A 2C7NB 3QX1A 2DX5B 4NNJB 4IG7B 2K6QA 2KQ7A 2BYFA 4FJZA 4ZRJA 4G3XB 4ZYNA 1WZ0A 3UIOB 1WGHA 2KDEB 2R2QA 3H7SA 5AZFA 2XBBC 3ZW3A 4BBNF 1OEYA 2GBMA 4MM3A 1WRDB 2MRPA 3U30A 4E3CA 4W9HA 5E6NA 4HVBA 3ZKJC 3QCAA 5LLIA 3QJZA 4I6PA 1YJ1A 3TMPB 4DHJD 2I1KA 3CSTA 2KLGA 3A1QB 1IPGA 2JZZA 2MP2A 4OVVA 3X0WA 3ZNID 3PVLA 1LM8B 5LXHA 2LRUA 2O2VB 4RMAA 2MBOA 2C9WB 4I6NB 3GZNI 1H8CA 1V9JA 3A9JA 1WMHA 3EHVA 1K8RB 3PHWB 1LQBA 2MBEA 2L3ZA 5G55A 1L2NA 3D32A 4GMVA 3ALBA 4LJPB 3ZIMA 4EEWA 3NOBA 4EKUA 5J17A 1C3TA 2J0KA 4HPLB 2JRIB 4TUUA 1FXTB 4YL8A 3ZTCA 1TBEA 1NBFC 1UH6A 3APFA 1WX9A 2KHWB 3PV1A 1UD7A 2BF8B 2ZVNA 2RD0A 3CMMB 1LXDA 3UQAA 3VH4B 2KK8A 4HWIB 2G4SA 5JHBA 5FR6A 2BGFA 2JF5A 3WALA 4KZCA 1WM3A 2DAFA 2MCNB 2FCSA 3HK0A 2FAZA 3B08A 3PT2B 2ZVOA 5JZEB 4M0WB 4NQKE 2BWFA 1WJ4A 3QWZB 4P7IA 2CHXA 2FCNA 2JVCA 4ASWC 3ZDTA 3DOWA 4NAWA 3TBLD 4HDQA 1Q5WB 2EMTA 3AXCA 2IZVB 2NBUA 2KWVB 1WY8A 2IO0B 3AU4A 4HDOA 1S1QB 2K8HA 3A33B 2MX2A 3TCAA 3NZSA 3ML8A 1SGHA 5CHFA 5LXIB 1E8WA 1TTNA 2LI5A 4BKGA 1OTRB 3UQBA 2VRRB 4GDKA 1I35A 1V49A 2NS5A 4JIOU 2NVUI 2WYQA 3KH0A 1U4AA 1R4NI 2DYOA 2AL3A 2D2QA 5DPRA 2KXJA 4EZLA 3PLVA 4FHJA 2FIDA 5AZGA 3LDZE 4XX5A 3ZNZB 2DZKA 2NPTB 3OAWA 3M62B 1WIAA 2WWZA 1Q1OA 3EECA 3EFUA 4DHZB 4M8NA 2WX0A 1EF5A 2MA9B 5E6OA 3ZRCA 2JT4B 3KVFB 1IYFA 2KX0A 1I42A 2BKRB 3JW0X 2MBQA 3ML9A 2J7QB 5DPSA 2KC2A 3A1QA 2BYVE 1CMXB 2N9EB 2CHWA 4KDIC 1WE6A 4GOCA 3VUXA 1XQQA 2G45B 3DVNU 4W9IA 3RT3B 2O2VA 1H4RA 1VD2A 2O6VB 3PRMB 4NJ6A 1J0GA 1NI2A 2KFKB 2KMCA 1GC7A 1ZW7A 3R66C 1WGGA 2G4DB 4KSKC 2AL6A 2KQSA 2MQJA 2YVCA 4KVGB 4A3PA 4FLHA 1TZ1A 1GG3A 4IWOA 2KWUB 4W9LA 5KHOA 3RCZA 3ZNHB 3DBSA 4WWOA 1XT9B 2ZNVB 4MGKE 1VCBA 5AZHA 3HIZA 2KNBA 3UIPB 4BKSD 2LXCA 5BO4B 5CHWA 4BBNC 4TQ0A 3DVNV 4GDLB 1Q0WB 4DBGA 2ZCCA 4GIVA 2IY1B 3AI5A 1L7YA 3QQ8B 3M3JA 2LWPA 3RZFA 4TKNA 2FNJB 1KM7A 4W9EA 3A4RA 2FCQA 3H7PA 1G6JA 2LGDA 2LUEA 3DVGY 1EUVB 2DENB 4GN1A 4EUTA
chains in the Genus database with same CATH superfamily
3P4QB 1IP9A 2BYEA 4NPNA 2WU2B 1L0VB 2WXFA 2JYEA 2D11A 3LYYA 5D2MB 1B9RA 1T0SC 4CO7A 1DYQA 2GOWA 3B2FA 2OJWA 2I38A 2NPTA 1SE3A 4F7ZA 3C0RB 3VHTC 2L83A 5BMIA 4RFBA 2CU3A 2JZPA 2KAJA 2RDBC 1A5RA 3VTWA 2N1WA 4B9KA 3BY4B 4JGHB 2W9NA 5FKAC 2KO3A 5T8IA 1R4MB 1NYQA 1WI0A 2L00B 1ROEA 2ZZPB 3DBLI 2JY6A 2IO1B 3B1LX 4DDID 3AECB 2K3UA 4FJYA 2LEKA 3I3TB 1DOIA 3TL5A 3WAOA 2N9LA 4DXAB 2QCZA 1XO3A 2L76A 2AX5A 3ZNGC 5EE1A 4O1NA 2N1VA 3QA8A 4XE0A 4MGYE 3TEZA 2DHZA 2D10A 1SE9A 3K9PB 3DQVA 2PJHA 1P9DU 3VR8B 4CYEA 5BMGA 4K3BA 4B95A 3VXWA 5G5HA 1AYFA 3Q8EA 1X1MA 1C77A 3O65B 1E7VA 2LVQA 4TMAB 3KUDB 1VZ7A 2LASA 3UI3A 3JSVB 1MG8A 4EZKA 2J52A 1BT0A 2WX1A 3W5VB 3VTUA 2WXHA 4A3OA 1PQSA 4ARCA 4RNAA 5CX3A 3QIJA 2LGYA 1JWMD 2LJIA 2QIEB 4K3CA 3N1ZC 1FRDA 3P4SB 4FHKA 4A55A 1DGJA 2ZEQA 1JRUA 1NYRA 1CK1A 1FO4A 3GOEA 4OW0A 2ZW1A 4K81A 2A5UA 4KIKB 3AN1A 1WXMA 1E5WA 3B2GA 1FCLA 4C7YA 3L54A 2N4FA 2DLBA 1XCTL 3UINB 2LJ5A 3L0WB 2WXQA 1SB3C 2M4NA 1QILA 2N7DA 4G0NB 1DOYA 1YNTE 2D5GA 4C80A 4IM2A 4BOSC 2HDEA 2K6DB 1ZKHA 4UDUC 2JQRB 3PTFC 2V3NA 5DPTA 1KLVA 4PS3A 1Z2MA 1RLFA 1V86A 3RNGC 4DQOC 2FCMA 4URKA 1FIQA 2KFKA 4DHZE 2PVOD 1YIWA 5EDSA 1WGRA 3PPAA 4K1RB 4LDTB 3IAS1 3U7DA 3MJ5A 2PEAA 2HJ8A 1OEYJ 1HEZE 3R7RA 1XLOA 2DYBA 1YX5B 2QHOA 3A9KA 1QZEA 3VVWB 1K51A 2BB6A 4BAXA 1F2RI 4NJCA 4NY0A 4W9DA 3B0AA 3W1YA 4KV2A 3EC8A 5C2TB 3R3MA 2DYMA 3PGEA 3HM6X 4RCOA 3QHTA 1TGZB 5G2NA 5TR5A 2BS2B 3BVGA 2MH7A 2MWSB 2OJRA 1OFFA 4E74A 3AM9A 2IY0B 2Y3AA 2WXJA 2K5PA 2MP2B 4L23A 4YSZB 3DBHI 3CIRB 2V0GA 2N7EA 3NS8A 3A9JB 2KWDA 1E90A 2PKOA 2PIAA 3R2TA 4B0MA 1HE8A 1V1PB 3N1YC 1EF1A 5DCNA 2MJEA 2V1YA 1GB4A 2QDFA 3NHEB 5D7GA 3ZRFA 3OJ3A 1L0YB 2R2OA 3HM3A 1KLGD 1UWMA 3GZNB 2RDHA 4AUQC 4FULA 3VRAB 3L08A 1IGDA 4NAWB 4EFOA 4MSMB 4LNIA 1TS4A 1FMAD 1ZXIA 3TJPA 4IWQA 1VZ8A 1GB1A 2DX5B 4IG7B 1SEBD 5EE3A 4G3XB 1WZ0A 2EKIA 1WGHA 1PGBA 2R2QA 4MM3A 1C76A 4I6PA 4ARIA 3A1QB 3ZXVA 5JXVA 4OVVA 3EUB2 1LM8B 1EU4A 1WMHA 3EHVA 3PHWB 1R4NB 2M56B 2N7JA 3R8BA 4GMVA 4EEWA 2WXKA 3E9SA 2JRIB 4HPLB 4ITKA 4TUUA 2HJ1A 2L52A 2BF8B 2RD0A 1DOXA 4HWIB 4WWMA 4KZCA 1WM3A 2FCSA 2FAZA 2IPKD 5IKCM 2B76B 1WJ4A 1KRHA 2FCNA 2JVCA 3GB1A 1ESFA 2KWVB 1WY8A 4HDOA 2K8HA 2K0PA 2MX2A 3NZSA 2PLPA 1SGHA 3HVZA 4BKGA 1OTRB 1ZXHA 1ET6A 3ABVB 1UNSA 2NVUI 5AZGA 3LDZE 4XX5A 2NPTB 2WQYB 2INPE 1T6BX 3OAWA 1YJJA 1IYFA 3JW0X 3RNEC 1C78A 2J7QB 2N9EB 2BQQA 3VUXA 4W9IA 1XF5L 2O2VA 2G9HD 1J0GA 1NI2A 3BK1A 2KYWA 4CQNA 1AWDA 3R66C 1WGGA 4NAMA 4IWOA 2KWUB 1HA5A 4W9LA 5KHOA 2KNBA 4WURA 2LXCA 5BO4B 1MI0A 4TQ0A 1D5ZC 2W82A 3VR9B 3U2SC 1T5XD 3Q8FA 4M0WA 3Q8BA 4LNOA 1TY2A 2MEKA 3IT6B 2WDQB 1EUVB 3U7ZA 4ZYSA 2W54A 3RULA 4NQLB 1WXAA 4W9JA 1JWAD 3W1SA 2V4LA 3GE8C 3WAMA 3IAM1 3TEWA 3QC8B 3TEYA 4II2B 1D5MC 3IVFA 3NG0A 3N3KB 4YT0B 4ZRIA 3FC4A 3T8MA 5C1ZA 2LUMA 2JWZA 3MFGA 1TS5A 1ENFA 1MPEA 1N5WA 2DAJA 2BW2A 3V6EB 4A20A 5JH5C 1P1AA 5BYQA 2YEPF 4EE2A 2IDYA 4PT5A 4IM0A 4BKTA 3Q3OC 2LXAA 2WXRA 4MDKE 1HTOA 2JX5A 2WDVB 1JROA 1D3ZA 2GB1A 1WXSA 5CHVC 1V80A 3OJ4B 4ICVA 3WAPA 2IO3B 1FNVA 2WXMA 2IJ0A 4K7UA 2KVRA 2J4XA 1YQ4B 2WDTB 1WM2A 4XDDA 3RNFC 1YD8U 5KHQA 4HKZE 4RGNA 1ZDVA 5TSSA 3APDA 4A9AA 1Y8RC 4N6EB 3CWIA 4IW0A 3RFZB 3KYDD 2ASQA 4ANVA 2V9HA 3PRZA 4HK2A 1VDVA 1FPYA 3M63B 4AP4C 1EM7A 3EA6A 2HTHA 1C79A 3SU8X 4HRSA 2KTRA 3ZJUA 1MG4A 1P7EA 2Z59B 1RWSA 1WH3A 3NZ3A 1MHHE 1SJHD 1F52A 2D07B 1UELA 3A9KB 1K53A 1QKZA 2KJHB 3M95A 1P7FA 1J7CA 5BYRA 1NEKB 1PFDA 4WH4A 2ZW0A 3DBRB 5H8YE 1PGXA 1WRIA 2X8XX 2M17A 4D2KA 2J0MA 3ECIA 2CJNA 3DVGX 2JXXA 2PMVA 4LNNA 4KDLB 3L4PA 5BMHA 4WJOA 2JPHA 2GBKA 4C56C 2RSUA 4L1BA 4IM3A 2WXLA 2MHJA 2BS3B 4KZ0A 1XD3B 2LD9A 3BK2A 1D4BA 1F0ZA 3BWUD 1K52A 2GBRA 1WR1A 4TV3A 3LXFA 1TT5B 2N9KA 2KN5A 4USAA 1M94A 3KUCB 2SEBD 2EMSA 4QAYA 4LNKA 4IDIA 4W9FA 5J18A 3MHZA 3AEEB 4IC7B 2UYZB 4AWJA 3IHPC 1GC6A 3P2BA 2DZJA 1WGDA 3V6CB 1C9FA 3BVZA 1JWUD 1C4PA 1TKGA 1MHXA 1WGYA 4IWPA 5L83A 3NVZA 4MM3B 4NZLB 2LRWA 4ANWA 2I1JA 1T0RC 3CSFA 3OLMD 1I4PA 1S3SG 4W9CA 4PS8A 4KKIA 4XZ4A 2ONQA 1PGAA 2GBNA 1N63A 3N32A 1J7BA 3AB5A 1WMHB 4W9KA 3WANA 1E7UA 3IG3A 3RZWC 2Z0DB 4JQWC 2IO2B 3NS1A 3VTVA 3RMKC 5C3JB 1JWBD 3ZYYX 4ZRKA 4MH0E 2O6VD 2KC1A 3GP7A 2QMTA 3L17A 1WX8A 2LHEA 4G11A 4ACFA 3UGBB 5IAAC 1KH0A 2INDC 3DHGC 2FUG1 4F8CB 1WSPA 3C19A 3MHSD 3P4PB 4BZAA 1RYJA 4GLSC 4MGZE 1V5TA 3ZQ4A 1D5XC 2INNE 1C4AA 3ZTDA 3MJWA 2KANA 3NJTA 2BTEA 3ZDMC 4EOYA 2KN4A 4NNJB 1JCKB 2KQ7A 4FJZA 3UIOB 2XBBC 3ZW3A 1OEYA 4E3CA 5E6NA 2OHFA 2WLBA 4OZAA 1YJ1A 3TMPB 4DHJD 3CSTA 3SEBA 2JZZA 2LRUA 2O2VB 3GS2A 4RMAA 4I6NB 1UWXA 3WCQA 2MBEA 1L2NA 3MP9A 3N1XC 4EKUA 5J17A 3NOBA 1VLBA 1C3TA 1NENB 4WAFA 2INCC 2FBWB 1TBEA 1WX9A 4IOIE 3PV1A 1UD7A 2RPVA 3AEFB 1QT9A 3VH4B 2KK8A 3EGRA 4TSSA 5FR6A 2BGFA 4WIPA 3PT2B 2ZVOA 5JZEB 4M0WB 1E7PB 2BWFA 3QWZB 4P7IA 3ZDTA 2LFIA 1Q5WB 2EMTA 1UUPA 2IZVB 2IO0B 3HVDA 2NMQA 3SFEB 1E8WA 3UQBA 2VRRB 1I35A 1V49A 4JIOU 3KH0A 1U4AA 2FIDA 1FNUA 2OEDA 2DZKA 2IGDA 3EFUA 3ETRA 2E6XA 3DHIC 1I42A 2BKRB 4H2AA 2MBQA 5BYSA 5G5GA 2BYVE 1CMXB 1M4VA 4KDIC 3R2IA 2G45B 3AE7B 3DVNU 3AMZA 1VD2A 3PRMB 5HI1A 1GC7A 1ZW7A 2G4DB 2AL6A 4KVGB 2MQJA 4KX6B 4FLHA 1TZ1A 1GG3A 1GAQB 1PUTA 2KACA 1XT9B 1TYGB 1V97A 4MGKE 4HKQA 1VCBA 2QC8A 3HIZA 4BKSD 3DVNV 1Q0WB 4DBGA 2ZCCA 2IY1B 3GE3C 5AUIA 4A6QA 4RH6A 5I4DA 3DBLB 4RF1A 3A4RA 5E6JA 2LGDA 2LUEA 3DVGY 3NVVA 1FFVA 2K8CA 1TY0A 1NI3A 3J9CA 2NBVB 2MW5A 3VUYA 2KJ6A 1TKYA 1V81A 1BMLC 2B3AA 2LGXA 4A8XC 1ZPSA 1XLNA 4AQ7A 4MEMA 2V4IB 3BIID 4AJYB 1HXYD 2RPQA 2NR2A 1KJTA 3RNCC 3I9V1 2J42A 3N30A 3IFWB 1WFYA 3DWMA 2KTRB 3AV8A 3FILB 3VFKA 2D3AA 3VUWA 4XDCA 3DCGA 4JL9A 4EZJA 4GSWA 2ZJDA 2O6VA 4ZRPA 3AE2B 2PE9A 1QOAA 2K8BA 1T0YA 4HCPB 4B6WA 1I4RA 1Y56A 2X38A 2L05A 2KZRA 3PZ8A 3QAQA 1ET9A 3Q8CA 2WP9B 1RFKA 4US8A 3ZUNA 1TS2A 3L16A 4GGQA 1UGJA 2CU1A 4HPMB 3TSSA 2JRHA 4JE3B 4PYUA 3VAWA 3WA0A 1GUAB 3BVMA 2TSSA 2N9PC 4AJWA 1AW7A 5E6PA 2KDMA 1SE2A 3V60A 1T3QA 3EFCA 2MBHA 4TQ1A 2ACZB 1P0RA 1R4MI 4J6IA 2DZIA 3H9DA 1E8YA 2N9XA 2KFJA 3IBEA 2NCNA 1VJKA 3RPFC 3KQ4A 4WWPA 2KMAA 1D6EC 3ZXRA 3AE5B 1L4ZB 5J2RA 2GBJA 2JXTA 2WXIA 2K1FA 3JVZX 2R61A 3NZUA 3PS6A 1E8XA 4WQMA 4YTNB 1L4DB 4HXDA 2M8SA 4ZDVA 2BPSA 4FADA 4N59A 1WE7A 4HLEA 1FXAA 2BKFA 3HUIA 4RM8A 2HTME 4ZHOA 1OQYA 2C7MB 1OGWA 4C4VA 3MC8A 2LGIA 3I57A 2DNFA 2IBIB 2VZKD 2KOXA 3LJ3A 4RGTA 1I4QA 5IO9A 2MJDA 1UGMA 4P1CC 3W9CB 4OVZA 2CS4A 2FIFA 1J19A 3AE8B 2K25A 3NY5A 5LNK1 2ZCBA 3RYTA 5AEKB 4GDKB 5HFYA 1CQVA 2L32A 3Q3JA 4W9GA 5D3DA 2KTFA 2MSED 1E6EB 2LZ6A 1L5PA 2JZ3B 1HZ5A 4LLGM 4MGIE 3ONSA 4WQOB 2KT7A 1V5OA 5MPOA 3DWGC 3P42A 4MH8A 3ZO5B 4FN2A 1PDXA 2BS4B 1WXVA 2ZPNA 1SSNA 1JALA 3A4SC 2FUHB 4ZOHC 3ZJVA 1MVKA 4YTMB 2WXNA 5DPWA 4JLCA 1WX7A 3BZDB 3JYUA 2Z8LA 1TS3A 4RM9A 3DBHB 5HKHA 2W3SA 3HHMA 4M01A 1F9JA 2ZNVC 3VRBB 4BKSA 2XNAC 2ZPYA 4E71A 4II3B 1WJUA 1WR6E 4WAAA 4RGOS 3NVYA 3N20C 4F1SA 1UBIA 4HJGE 4WJNA 3RI7C 1FM0D 4M8MA 2XK5A 4FXCA 3BINA 3PO0A 3R7QA 2UU7A 4MJSA 2KJRA 2VH2A 3FKYA 1QQRA 2PW9A 1VZ6A 3HRDD 1VR9A 1LFDA 2DWQA 4BOZB 4IUMB 1VRAB 3X23A 1YX6B 3UF8A 4US9A 3U8ZA 3AULA 2QJLA 4WJPA 3V61A 3SHQA 5JHAA 1SIFA 1GNUA 2RGFA 3FILA 4YXDB 1EWYC 2RMMA 3DHHC 1AARA 2GMIC 2L0FA 3AEBB 3SD5A 2JYTA 3ZJTA 3L13A 1ZGUB 4KGRA 4FBJB 2YLMA 1IBXB 3AE4B 4MSQB 3L10B 1JQ4A 4YWGG 1N62A 3KUZA 4C00A 4DXGA 2MLBA 4DK5A 2N0SB 3K9OB 3ZLZA 3APCA 2OOBB 3ZVVA 1P98A 3PSEB 2CKHB 2UWQA 3PREA 2C5LC 1OQQA 1F1HA 4ZYNA 2G1EA 2KDEB 3AE3B 3H7SA 5AZFA 1ZOYB 2GBMA 4W9HA 3Q6BA 4MT5A 4HVBA 3BYYB 3QCAA 5LLIA 3QJZA 2I1KA 2KLGA 3V05A 1QOGA 4HEA1 1YOVB 3ZNID 3PVLA 4YSYB 2MJ3A 5LXHA 2C9WB 3GZNI 1H8CA 1V9JA 4Q2JA 2WXGA 3Q69A 1JMLA 1LQBA 2IGHA 2LMCA 3ALBA 4LJPB 3ZIMA 3I5JC 2J0KA 1RM6C 1CZPA 4REZA 2WDRB 3ZTCA 1UH6A 3APFA 5IP4D 2KHWB 2K9XA 1V1OA 4J3OD 2ZVNA 3CMMB 4KGTA 3UQAA 4OZBA 3BYTB 2G4SA 5JHBA 2JF5A 3U4EG 2MCNB 3HK0A 3B08A 2W3RA 1AN8A 2CHXA 3DOWA 3TBLD 2KVZA 4HDQA 2NBUA 4ZRQA 3AU4A 4P6VF 3A33B 3RNBC 4B0EA 5CHFA 1GOZA 3RNAC 4GDKA 3P4RB 2BYTA 5DPRA 1R4NI 1N61A 2DYOA 3OG5A 4LK0M 3URYA 3ZNZB 1ZP0B 3M62B 1WIAA 1Q1OA 1JWSD 2AQ1B 4M8NA 3ZRCA 2JT4B 3KVFB 1SJED 4M02A 3ML9A 2M0AA 5DPSA 2KC2A 4YTPB 1UF0A 3MC9A 2CHWA 2RDGA 1XQQA 2FE8A 4KGSA 3N9YC 2WXOA 1STEA 1FNWA 2O6VB 4NJ6A 2KMCA 5D3IB 4C7ZA 2IGGA 4KSKC 4DXFA 2KQSA 2YVCA 4A3PA 3MC0B 2ICIA 4KKJA 1N6ZA 3ZNHB 3DBSA 3UIPB 1I4HA 3PZ7A 1YN3A 1LO5D 1QOFA 5CHWA 4BBNC 4LTUA 2KMMA 3AI5A 3NUHB 3M3JA 2V3PA 2LWPA 1XLPA 3U52E 1KM7A 2AQ3B 4W9EA 4LNFA 1G6JA 1E0ZA 2DENB 2AQ2B 2A4ZA 4P1BC 2C7HA 2QEJC 4DHJB 3RUIB 2KX3A 2JUOA 5IN7A 3W1SC 4JX1C 4S17A 3MTNB 2PTLA 2XEWA 2H88B 1MFWA 1L6UA 2Y5PA 1WYGA 3WIMA 4IKGA 5L95C 3KLSX 3AEGB 3P63A 2EELA 1I4XA 2CR5A 2E3TA 3S2AA 1TJEA 1YN5A 3RD2A 2D3BA 1LGRA 3Q3NC 1IBXA 4LDTD 4FA6A 1UBQA 4XWTA 4C4VB 2J0JA 2D3GA 1RAXA 4HCNB 4KSLC 1TIFA 5FK9C 4JPSA 1EO6A 1SF0A 2GRIA 2Z0EB 1KFYB 2CHZA 1ZUD2 1WYWB 4GDLA 5FR3A 5EE9A 1ZDXA 4OVUA 2JU6X 2NTTA 5GMVA 2NTSA 1GJZA 2KDFB 1YN4A 4X57B 4A90A 1PYWD 3PRPB 4PYZA 1JW9D 2IYDB 4MACA 2V3SA 2WNMA 3Q14C 4XYCA 3PHXB 2WHIA 2YEPB 3PZDA 2GLSA 2C60A 3VQIA 3KWLA 2KDIA 3H6NA 3KW5B 1TKEA 1C1YB 1FXIA 4N9F4 2EKEC 4PK1A 1BXTA 3T3OA 2BT6A 3Q3MC 3AEDB 3QARA 1N5XA 1YJIA 5D94A 2H89B 4DWFA 2M0XA 1RFAA 2AWTA 3W2DA 4GB9A 5C23A 1V8CA 3LB8C 1Z5SB 1KTKA 2KKCA 4XC2A 1XLQA 4WJQA 2XK5B 4S0RA 1V2YA 1EU3A 4K7SA 4WWNA 3KWVA 3QK0A 1WZ3A 4MJSB 1RRBA 2GI9A 4LCDE 3AU5A 2REXA 3NRZA 1SBBB 1IGCA 2LHDA 2QSDA 2KDBA 3DPDA 1FD6A 4MELA 4R3DA 5IOIA 2DBYA 1C4CA 2BBCA 2Y5BB 3VDZA 5HHDG 3RN9C 2BB5A 1P3QU 2VH1A 2M1MA 3AE1B 4RGMA 1WGKA 1YQ3B 4OHJA 2CJOA 1IUEA 2PE6B 3DBRI 1XXGA 3AEAB 3SFDB 4PS7A 1FEHA 3VH3B 3JSVA 1KLUD 2KWCA 2BWES 1JRPA 1XEEA 1L6VA 4LJOB 5CTRC 3AE9B 3H8HA 4BVUC 3I63C 1NDDA 2AYOB 4FJVB 4GXBA 4BFRA 4P16A 2JWUA 1WJNA 3V62A 1B1ZA 1ZE3D 1E10A 4ZHPA 2KD0A 1FFUA 4KIKA 2K39A 3H7PB 2SAKA 1E8ZA 2KLCA 1HZ6A 3ENEA 4ANXA 2RR9A 5EE0A 1TZOA 5IA7A 4HJKA 3B9JA 1YQBA 3T3NA 4ICUA 4AOFA 2PPHA 4DDGD 1WWTA 3SDLC 4G50A 2MBBB 1F2RC 3Q2AC 4M00A 2AEHA 2Y5CA 1XCQL 2DZMA 2PVGC 2ON8A 4XWWA 3IT4B 1J8CA 3H1UA 1BUIC 2G3QB 3DDCB 1UZXB 3T9LA 1I4GA 3TIXA 1V6EA 3IXSA 1HTQA 3CF6E 3KYCD 2L0TA 2HD5B 4K7WA 3PLUA 1ISNA 2VZKB 1SXTA 2LVOA 3Q3FA 1I7HA 1CJEA 4I6LB 2NBWB 4ANUA 2L7RA 2JSVX 2W55A 4YSXB 1WF9A 3TUOA 2LVPA 2HE7A 4GU2A 1K50A 2BVCA 4CHKA 5D6JB 4NJ7A 2L8JA 4JWSC 1KOTA 1WJ6A 2C7NB 3QX1A 2K6QA 2BYFA 4ZRJA 1QOBA 1R7SA 4BBNF 1WRDB 2QILA 2MRPA 3U30A 1SE4A 3ZKJC 3AH7A 1SIJA 3ZGZA 1ACCA 3Q8AA 1IPGA 2MP2A 3X0WA 4L2YA 2MBOA 3A9JA 1WXQA 4HPPA 1K8RB 1V1PA 1FRRA 1J7AA 2XN9C 2L3ZA 5G55A 3D32A 1FXTB 3OWEB 4YL8A 1NBFC 1QF6A 1GPXA 1LXDA 2WS3B 2LGSA 3O13A 3WALA 2DAFA 3P1MA 4JWUC 3FAHA 1FCCC 1F77A 4NQKE 2KQ4X 1OQRA 4ASWC 3E56A 4NAWA 3AXCA 5GXGB 1S1QB 3V3XA 3TCAA 3ML8A 5AUKA 2WU5B 5LXIB 1TTNA 2LI5A 2J53A 2NS5A 2WYQA 1Q10A 1T0QC 2AL3A 2D2QA 4EZLA 2KXJA 3PLVA 3SR6A 4AS1A 4FHJA 1YMHE 4HROA 1A70A 1KF6B 5H92C 2WWZA 3EECA 4DHZB 2WX0A 3C8YA 2WGSA 1EF5A 1EWCA 2MA9B 5E6OA 4RF0A 2KX0A 2WXPA 1L0XB 1HQRD 3A1QA 4N58A 2D3CA 1WE6A 4GOCA 1QLBB 3RT3B 1H4RA 2KFKB 5HG2A 1N60A 2K22A 2L1AA 3RCZA 4WWOA 2ZNVB 5AZHA 4OZCA 3W5UB 1E9MA 4GDLB 1MJDA 4GIVA 3AE6B 2I2YA 1L7YA 3QQ8B 4XGAB 3TEXA 3RZFA 3NVWA 4TKNA 2FNJB 3H7PA 2FCQA 4GN1A 1NVID 2Q5WD 2M19A 4EUTA
chains in the Genus database with same CATH topology
3RULA 1IP9A 2BYEA 4NPNA 2A4ZA 2K8CA 4NQLB 1WXAA 2C7HA 4W9JA 2NBVB 2MW5A 3VUYA 4DHJB 2D11A 2KJ6A 5D2MB 1V81A 2B3AA 2KX3A 2LGXA 3RUIB 2JUOA 4CO7A 3W1SA 3W1SC 2GOWA 2V4LA 3WAMA 4MEMA 2NPTA 3MTNB 4F7ZA 3C0RB 2XEWA 3VHTC 4AJYB 3QC8B 2RPQA 2NR2A 1KJTA 4II2B 3WIMA 1A5RA 3IVFA 2N1WA 3VTWA 4B9KA 3BY4B 3N30A 3IFWB 3N3KB 4JGHB 1WFYA 4ZRIA 3T8MA 5C1ZA 5L95C 2W9NA 2KTRB 3VFKA 2KO3A 2CR5A 2JWZA 3S2AA 3VUWA 3DCGA 4JL9A 4EZJA 4GSWA 2ZJDA 2O6VA 1WI0A 2PE9A 2DAJA 1T0YA 2K8BA 2L00B 4HCPB 3RD2A 4B6WA 3V6EB 4A20A 2ZZPB 3DBLI 5JH5C 2L05A 2JY6A 2IO1B 3B1LX 2KZRA 4LDTD 4DDID 4FA6A 1UBQA 1P1AA 3QAQA 2J0JA 4IM0A 4BKTA 2D3GA 4FJYA 1RAXA 4HCNB 3I3TB 2LXAA 4KSLC 3ZUNA 3L16A 4GGQA 4MDKE 3TL5A 3WAOA 4DXAB 2CU1A 2L76A 1EO6A 4HPMB 1D3ZA 2Z0EB 3ZNGC 2JRHA 2CHZA 4PYUA 3VAWA 1WYWB 3WA0A 4GDLA 1WXSA 1GUAB 5CHVC 4OVUA 2N1VA 5GMVA 3QA8A 1V80A 2N9PC 4MGYE 5E6PA 3OJ4B 4AJWA 2DHZA 4ICVA 1GJZA 2KDFB 4X57B 2IO3B 3WAPA 4K7UA 3V60A 2D10A 2KVRA 2WDTB 3PRPB 4PYZA 1WM2A 1SE9A 2IYDB 3DQVA 3K9PB 2MBHA 1YD8U 2PJHA 5KHQA 2V3SA 4TQ1A 1P0RA 1P9DU 1R4MI 4J6IA 4CYEA 2DZIA 4B95A 3VXWA 3H9DA 3APDA 1E8YA 2N9XA 1Y8RC 2KFJA 3IBEA 2NCNA 3PHXB 1X1MA 4WWPA 2KMAA 4IW0A 5J2RA 3KYDD 3O65B 2ASQA 2GBJA 3PZDA 4ANVA 3PRZA 2C60A 3VQIA 1E7VA 2K1FA 2LVQA 4HK2A 2KDIA 3JVZX 3H6NA 3KUDB 3KW5B 3M63B 1C1YB 4AP4C 3NZUA 4N9F4 2EKEC 3PS6A 1E8XA 2HTHA 3SU8X 2LASA 2KTRA 3JSVB 1MG8A 4EZKA 2Z59B 4HXDA 2M8SA 1WH3A 4ZDVA 2BPSA 1BT0A 4FADA 3QARA 2WX1A 2D07B 3VTUA 1WE7A 5D94A 1UELA 3A9KB 4HLEA 4A3OA 1PQSA 2BKFA 4RM8A 5CX3A 3QIJA 2LGYA 4DWFA 1OQYA 2C7MB 2M0XA 1OGWA 2KJHB 3M95A 1RFAA 2AWTA 4FHKA 4GB9A 5C23A 1Z5SB 2KKCA 2ZEQA 1JRUA 4XC2A 4WJQA 2M17A 2IBIB 3LJ3A 2KOXA 3GOEA 2XK5B 4K81A 2A5UA 4KIKB 1UGMA 2J0MA 1WXMA 1E5WA 3ECIA 1V2YA 4WWNA 4K7SA 3L54A 2N4FA 2CS4A 3QK0A 1WZ3A 1J19A 2FIFA 2JXXA 2K25A 3DVGX 4MJSB 1RRBA 4LCDE 3NY5A 3AU5A 2REXA 3UINB 2LJ5A 2ZCBA 3RYTA 3L0WB 4GDKB 5AEKB 4KDLB 4WJOA 3Q3JA 2M4NA 2JPHA 4W9GA 2KTFA 2GBKA 2N7DA 4G0NB 2RSUA 2KDBA 3DPDA 2MSED 4MELA 2LZ6A 4IM3A 2JZ3B 4MGIE 3ONSA 4WQOB 2Y5BB 4KZ0A 1XD3B 2LD9A 4IM2A 4BOSC 1V5OA 3VDZA 2K6DB 1ZKHA 1P3QU 2M1MA 3ZO5B 4FN2A 3PTFC 2GBRA 5DPTA 1KLVA 1WR1A 4TV3A 4PS3A 1WXVA 1Z2MA 2ZPNA 1RLFA 1V86A 2KN5A 2PE6B 2FCMA 3DBRI 3A4SC 4URKA 2FUHB 2KFKA 4DHZE 1M94A 5DPWA 3KUCB 1WX7A 1YIWA 4JLCA 4PS7A 5EDSA 1WGRA 3PPAA 3JYUA 4K1RB 4LDTB 4RM9A 2EMSA 3VH3B 5HKHA 3JSVA 2KWCA 3HHMA 3U7DA 4W9FA 2BWES 5J18A 1F9JA 2ZNVC 2PEAA 2HJ8A 4LJOB 5CTRC 1OEYJ 4BKSA 3R7RA 4BVUC 2DYBA 1YX5B 2QHOA 2ZPYA 3A9KA 4IC7B 1NDDA 2UYZB 4AWJA 1QZEA 1WJUA 1WR6E 2AYOB 4II3B 3VVWB 4FJVB 4E71A 3IHPC 4GXBA 4WAAA 1GC6A 4BFRA 3P2BA 4F1SA 1UBIA 2DZJA 1WGDA 4NY0A 3V6CB 1WJNA 4W9DA 3B0AA 3W1YA 3V62A 4KV2A 3EC8A 4WJNA 1WGYA 2KD0A 3R3MA 2DYMA 4M8MA 2XK5A 3PGEA 3HM6X 4KIKA 2K39A 4IWPA 5L83A 3H7PB 3BINA 3QHTA 1TGZB 1E8ZA 5G2NA 2KLCA 3ENEA 5TR5A 3R7QA 4ANXA 4MJSA 2KJRA 2RR9A 2LRWA 4ANWA 2MWSB 2OJRA 4E74A 2I1JA 5IA7A 3CSFA 2IY0B 4HJKA 3OLMD 1YQBA 1S3SG 2MP2B 4ICUA 4W9CA 1LFDA 2PPHA 4PS8A 4AOFA 4DDGD 4XZ4A 3SDLC 3DBHI 4G50A 2GBNA 4BOZB 2MBBB 4IUMB 3N32A 2N7EA 3NS8A 3X23A 3A9JB 1WMHB 4W9KA 1E90A 3WANA 1YX6B 3UF8A 3U8ZA 1E7UA 3AULA 1HE8A 3IG3A 4WJPA 2AEHA 3RZWC 3V61A 3SHQA 5JHAA 2Z0DB 1SIFA 1GNUA 2RGFA 4JQWC 2IO2B 2DZMA 3VTVA 1EF1A 5DCNA 1AARA 2V1YA 2GMIC 2L0FA 1J8CA 3NHEB 5D7GA 4ZRKA 3SD5A 4MH0E 3H1UA 3ZRFA 2G3QB 3DDCB 2O6VD 1UZXB 3L13A 1ZGUB 3OJ3A 3T9LA 2KC1A 2R2OA 3HM3A 3L17A 1WX8A 4G11A 4FBJB 2YLMA 3TIXA 1V6EA 3UGBB 3CF6E 5IAAC 3KYCD 2L0TA 2HD5B 4MSQB 4K7WA 3L10B 3PLUA 1ISNA 4F8CB 2LVOA 4AUQC 3MHSD 3Q3FA 3KUZA 4FULA 2MLBA 3L08A 4I6LB 4NAWB 4DK5A 2NBWB 4ANUA 2L7RA 4EFOA 4MSMB 3K9OB 1V5TA 4MGZE 3ZLZA 1WF9A 3APCA 3ZTDA 2LVPA 2HE7A 2OOBB 4GU2A 3TJPA 3ZVVA 1P98A 3MJWA 4IWQA 3PSEB 2KANA 5D6JB 4CHKA 4NJ7A 2CKHB 2L8JA 3ZDMC 2UWQA 3PREA 4EOYA 2C5LC 1KOTA 1WJ6A 2C7NB 3QX1A 2DX5B 4NNJB 4IG7B 2K6QA 2KQ7A 2BYFA 4FJZA 4ZRJA 4G3XB 4ZYNA 1WZ0A 3UIOB 1WGHA 2KDEB 2R2QA 3H7SA 5AZFA 2XBBC 3ZW3A 4BBNF 1OEYA 2GBMA 4MM3A 1WRDB 2MRPA 3U30A 4E3CA 4W9HA 5E6NA 4HVBA 3ZKJC 3QCAA 5LLIA 3QJZA 4I6PA 1YJ1A 3TMPB 4DHJD 2I1KA 3CSTA 2KLGA 3A1QB 1IPGA 2JZZA 2MP2A 4OVVA 3X0WA 3ZNID 3PVLA 1LM8B 5LXHA 2LRUA 2O2VB 4RMAA 2MBOA 2C9WB 4I6NB 3GZNI 1H8CA 1V9JA 3A9JA 1WMHA 3EHVA 1K8RB 3PHWB 1LQBA 2MBEA 2L3ZA 5G55A 1L2NA 3D32A 4GMVA 3ALBA 4LJPB 3ZIMA 4EEWA 3NOBA 4EKUA 5J17A 1C3TA 2J0KA 4HPLB 2JRIB 4TUUA 1FXTB 4YL8A 3ZTCA 1TBEA 1NBFC 1UH6A 3APFA 1WX9A 2KHWB 3PV1A 1UD7A 2BF8B 2ZVNA 2RD0A 3CMMB 1LXDA 3UQAA 3VH4B 2KK8A 4HWIB 2G4SA 5JHBA 5FR6A 2BGFA 2JF5A 3WALA 4KZCA 1WM3A 2DAFA 2MCNB 2FCSA 3HK0A 2FAZA 3B08A 3PT2B 2ZVOA 5JZEB 4M0WB 4NQKE 2BWFA 1WJ4A 3QWZB 4P7IA 2CHXA 2FCNA 2JVCA 4ASWC 3ZDTA 3DOWA 4NAWA 3TBLD 4HDQA 1Q5WB 2EMTA 3AXCA 2IZVB 2NBUA 2KWVB 1WY8A 2IO0B 3AU4A 4HDOA 1S1QB 2K8HA 3A33B 2MX2A 3TCAA 3NZSA 3ML8A 1SGHA 5CHFA 5LXIB 1E8WA 1TTNA 2LI5A 4BKGA 1OTRB 3UQBA 2VRRB 4GDKA 1I35A 1V49A 2NS5A 4JIOU 2NVUI 2WYQA 3KH0A 1U4AA 1R4NI 2DYOA 2AL3A 2D2QA 5DPRA 2KXJA 4EZLA 3PLVA 4FHJA 2FIDA 5AZGA 3LDZE 4XX5A 3ZNZB 2DZKA 2NPTB 3OAWA 3M62B 1WIAA 2WWZA 1Q1OA 3EECA 3EFUA 4DHZB 4M8NA 2WX0A 1EF5A 2MA9B 5E6OA 3ZRCA 2JT4B 3KVFB 1IYFA 2KX0A 1I42A 2BKRB 3JW0X 2MBQA 3ML9A 2J7QB 5DPSA 2KC2A 3A1QA 2BYVE 1CMXB 2N9EB 2CHWA 4KDIC 1WE6A 4GOCA 3VUXA 1XQQA 2G45B 3DVNU 4W9IA 3RT3B 2O2VA 1H4RA 1VD2A 2O6VB 3PRMB 4NJ6A 1J0GA 1NI2A 2KFKB 2KMCA 1GC7A 1ZW7A 3R66C 1WGGA 2G4DB 4KSKC 2AL6A 2KQSA 2MQJA 2YVCA 4KVGB 4A3PA 4FLHA 1TZ1A 1GG3A 4IWOA 2KWUB 4W9LA 5KHOA 3RCZA 3ZNHB 3DBSA 4WWOA 1XT9B 2ZNVB 4MGKE 1VCBA 5AZHA 3HIZA 2KNBA 3UIPB 4BKSD 2LXCA 5BO4B 5CHWA 4BBNC 4TQ0A 3DVNV 4GDLB 1Q0WB 4DBGA 2ZCCA 4GIVA 2IY1B 3AI5A 1L7YA 3QQ8B 3M3JA 2LWPA 3RZFA 4TKNA 2FNJB 1KM7A 4W9EA 3A4RA 2FCQA 3H7PA 1G6JA 2LGDA 2LUEA 3DVGY 1EUVB 2DENB 4GN1A 4EUTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RUL A;  1IP9 A;  2BYE A;  4NPN A;  2A4Z A;  2K8C A;  4NQL B;  1WXA A;  2C7H A;  4W9J A;  2NBV B;  2MW5 A;  3VUY A;  4DHJ B;  2D11 A;  2KJ6 A;  5D2M B;  1V81 A;  2B3A A;  2KX3 A;  2LGX A;  3RUI B;  2JUO A;  4CO7 A;  3W1S A;  3W1S C;  2GOW A;  2V4L A;  3WAM A;  4MEM A;  2NPT A;  3MTN B;  4F7Z A;  3C0R B;  2XEW A;  3VHT C;  4AJY B;  3QC8 B;  2RPQ A;  2NR2 A;  1KJT A;  4II2 B;  3WIM A;  1A5R A;  3IVF A;  2N1W A;  3VTW A;  4B9K A;  3BY4 B;  3N30 A;  3IFW B;  3N3K B;  4JGH B;  1WFY A;  4ZRI A;  3T8M A;  5C1Z A;  5L95 C;  2W9N A;  2KTR B;  3VFK A;  2KO3 A;  2CR5 A;  2JWZ A;  3S2A A;  3VUW A;  3DCG A;  4JL9 A;  4EZJ A;  4GSW A;  2ZJD A;  2O6V A;  1WI0 A;  2PE9 A;  2DAJ A;  1T0Y A;  2K8B A;  2L00 B;  4HCP B;  3RD2 A;  4B6W A;  3V6E B;  4A20 A;  2ZZP B;  3DBL I;  5JH5 C;  2L05 A;  2JY6 A;  2IO1 B;  3B1L X;  2KZR A;  4LDT D;  4DDI D;  4FA6 A;  1UBQ A;  1P1A A;  3QAQ A;  2J0J A;  4IM0 A;  4BKT A;  2D3G A;  4FJY A;  1RAX A;  4HCN B;  3I3T B;  2LXA A;  4KSL C;  3ZUN A;  3L16 A;  4GGQ A;  4MDK E;  3TL5 A;  3WAO A;  4DXA B;  2CU1 A;  2L76 A;  1EO6 A;  4HPM B;  1D3Z A;  2Z0E B;  3ZNG C;  2JRH A;  2CHZ A;  4PYU A;  3VAW A;  1WYW B;  3WA0 A;  4GDL A;  1WXS A;  1GUA B;  5CHV C;  4OVU A;  2N1V A;  5GMV A;  3QA8 A;  1V80 A;  2N9P C;  4MGY E;  5E6P A;  3OJ4 B;  4AJW A;  2DHZ A;  4ICV A;  1GJZ A;  2KDF B;  4X57 B;  2IO3 B;  3WAP A;  4K7U A;  3V60 A;  2D10 A;  2KVR A;  2WDT B;  3PRP B;  4PYZ A;  1WM2 A;  1SE9 A;  2IYD B;  3DQV A;  3K9P B;  2MBH A;  1YD8 U;  2PJH A;  5KHQ A;  2V3S A;  4TQ1 A;  1P0R A;  1P9D U;  1R4M I;  4J6I A;  4CYE A;  2DZI A;  4B95 A;  3VXW A;  3H9D A;  3APD A;  1E8Y A;  2N9X A;  1Y8R C;  2KFJ A;  3IBE A;  2NCN A;  3PHX B;  1X1M A;  4WWP A;  2KMA A;  4IW0 A;  5J2R A;  3KYD D;  3O65 B;  2ASQ A;  2GBJ A;  3PZD A;  4ANV A;  3PRZ A;  2C60 A;  3VQI A;  1E7V A;  2K1F A;  2LVQ A;  4HK2 A;  2KDI A;  3JVZ X;  3H6N A;  3KUD B;  3KW5 B;  3M63 B;  1C1Y B;  4AP4 C;  3NZU A;  4N9F 4;  2EKE C;  3PS6 A;  1E8X A;  2HTH A;  3SU8 X;  2LAS A;  2KTR A;  3JSV B;  1MG8 A;  4EZK A;  2Z59 B;  4HXD A;  2M8S A;  1WH3 A;  4ZDV A;  2BPS A;  1BT0 A;  4FAD A;  3QAR A;  2WX1 A;  2D07 B;  3VTU A;  1WE7 A;  5D94 A;  1UEL A;  3A9K B;  4HLE A;  4A3O A;  1PQS A;  2BKF A;  4RM8 A;  5CX3 A;  3QIJ A;  2LGY A;  4DWF A;  1OQY A;  2C7M B;  2M0X A;  1OGW A;  2KJH B;  3M95 A;  1RFA A;  2AWT A;  4FHK A;  4GB9 A;  5C23 A;  1Z5S B;  2KKC A;  2ZEQ A;  1JRU A;  4XC2 A;  4WJQ A;  2M17 A;  2IBI B;  3LJ3 A;  2KOX A;  3GOE A;  2XK5 B;  4K81 A;  2A5U A;  4KIK B;  1UGM A;  2J0M A;  1WXM A;  1E5W A;  3ECI A;  1V2Y A;  4WWN A;  4K7S A;  3L54 A;  2N4F A;  2CS4 A;  3QK0 A;  1WZ3 A;  1J19 A;  2FIF A;  2JXX A;  2K25 A;  3DVG X;  4MJS B;  1RRB A;  4LCD E;  3NY5 A;  3AU5 A;  2REX A;  3UIN B;  2LJ5 A;  2ZCB A;  3RYT A;  3L0W B;  4GDK B;  5AEK B;  4KDL B;  4WJO A;  3Q3J A;  2M4N A;  2JPH A;  4W9G A;  2KTF A;  2GBK A;  2N7D A;  4G0N B;  2RSU A;  2KDB A;  3DPD A;  2MSE D;  4MEL A;  2LZ6 A;  4IM3 A;  2JZ3 B;  4MGI E;  3ONS A;  4WQO B;  2Y5B B;  4KZ0 A;  1XD3 B;  2LD9 A;  4IM2 A;  4BOS C;  1V5O A;  3VDZ A;  2K6D B;  1ZKH A;  1P3Q U;  2M1M A;  3ZO5 B;  4FN2 A;  3PTF C;  2GBR A;  5DPT A;  1KLV A;  1WR1 A;  4TV3 A;  4PS3 A;  1WXV A;  1Z2M A;  2ZPN A;  1RLF A;  1V86 A;  2KN5 A;  2PE6 B;  2FCM A;  3DBR I;  3A4S C;  4URK A;  2FUH B;  2KFK A;  4DHZ E;  1M94 A;  5DPW A;  3KUC B;  1WX7 A;  1YIW A;  4JLC A;  4PS7 A;  5EDS A;  1WGR A;  3PPA A;  3JYU A;  4K1R B;  4LDT B;  4RM9 A;  2EMS A;  3VH3 B;  5HKH A;  3JSV A;  2KWC A;  3HHM A;  3U7D A;  4W9F A;  2BWE S;  5J18 A;  1F9J A;  2ZNV C;  2PEA A;  2HJ8 A;  4LJO B;  5CTR C;  1OEY J;  4BKS A;  3R7R A;  4BVU C;  2DYB A;  1YX5 B;  2QHO A;  2ZPY A;  3A9K A;  4IC7 B;  1NDD A;  2UYZ B;  4AWJ A;  1QZE A;  1WJU A;  1WR6 E;  2AYO B;  4II3 B;  3VVW B;  4FJV B;  4E71 A;  3IHP C;  4GXB A;  4WAA A;  1GC6 A;  4BFR A;  3P2B A;  4F1S A;  1UBI A;  2DZJ A;  1WGD A;  4NY0 A;  3V6C B;  1WJN A;  4W9D A;  3B0A A;  3W1Y A;  3V62 A;  4KV2 A;  3EC8 A;  4WJN A;  1WGY A;  2KD0 A;  3R3M A;  2DYM A;  4M8M A;  2XK5 A;  3PGE A;  3HM6 X;  4KIK A;  2K39 A;  4IWP A;  5L83 A;  3H7P B;  3BIN A;  3QHT A;  1TGZ B;  1E8Z A;  5G2N A;  2KLC A;  3ENE A;  5TR5 A;  3R7Q A;  4ANX A;  4MJS A;  2KJR A;  2RR9 A;  2LRW A;  4ANW A;  2MWS B;  2OJR A;  4E74 A;  2I1J A;  5IA7 A;  3CSF A;  2IY0 B;  4HJK A;  3OLM D;  1YQB A;  1S3S G;  2MP2 B;  4ICU A;  4W9C A;  1LFD A;  2PPH A;  4PS8 A;  4AOF A;  4DDG D;  4XZ4 A;  3SDL C;  3DBH I;  4G50 A;  2GBN A;  4BOZ B;  2MBB B;  4IUM B;  3N32 A;  2N7E A;  3NS8 A;  3X23 A;  3A9J B;  1WMH B;  4W9K A;  1E90 A;  3WAN A;  1YX6 B;  3UF8 A;  3U8Z A;  1E7U A;  3AUL A;  1HE8 A;  3IG3 A;  4WJP A;  2AEH A;  3RZW C;  3V61 A;  3SHQ A;  5JHA A;  2Z0D B;  1SIF A;  1GNU A;  2RGF A;  4JQW C;  2IO2 B;  2DZM A;  3VTV A;  1EF1 A;  5DCN A;  1AAR A;  2V1Y A;  2GMI C;  2L0F A;  1J8C A;  3NHE B;  5D7G A;  4ZRK A;  3SD5 A;  4MH0 E;  3H1U A;  3ZRF A;  2G3Q B;  3DDC B;  2O6V D;  1UZX B;  3L13 A;  1ZGU B;  3OJ3 A;  3T9L A;  2KC1 A;  2R2O A;  3HM3 A;  3L17 A;  1WX8 A;  4G11 A;  4FBJ B;  2YLM A;  3TIX A;  1V6E A;  3UGB B;  3CF6 E;  5IAA C;  3KYC D;  2L0T A;  2HD5 B;  4MSQ B;  4K7W A;  3L10 B;  3PLU A;  1ISN A;  4F8C B;  2LVO A;  4AUQ C;  3MHS D;  3Q3F A;  3KUZ A;  4FUL A;  2MLB A;  3L08 A;  4I6L B;  4NAW B;  4DK5 A;  2NBW B;  4ANU A;  2L7R A;  4EFO A;  4MSM B;  3K9O B;  1V5T A;  4MGZ E;  3ZLZ A;  1WF9 A;  3APC A;  3ZTD A;  2LVP A;  2HE7 A;  2OOB B;  4GU2 A;  3TJP A;  3ZVV A;  1P98 A;  3MJW A;  4IWQ A;  3PSE B;  2KAN A;  5D6J B;  4CHK A;  4NJ7 A;  2CKH B;  2L8J A;  3ZDM C;  2UWQ A;  3PRE A;  4EOY A;  2C5L C;  1KOT A;  1WJ6 A;  2C7N B;  3QX1 A;  2DX5 B;  4NNJ B;  4IG7 B;  2K6Q A;  2KQ7 A;  2BYF A;  4FJZ A;  4ZRJ A;  4G3X B;  4ZYN A;  1WZ0 A;  3UIO B;  1WGH A;  2KDE B;  2R2Q A;  3H7S A;  5AZF A;  2XBB C;  3ZW3 A;  4BBN F;  1OEY A;  2GBM A;  4MM3 A;  1WRD B;  2MRP A;  3U30 A;  4E3C A;  4W9H A;  5E6N A;  4HVB A;  3ZKJ C;  3QCA A;  5LLI A;  3QJZ A;  4I6P A;  1YJ1 A;  3TMP B;  4DHJ D;  2I1K A;  3CST A;  2KLG A;  3A1Q B;  1IPG A;  2JZZ A;  2MP2 A;  4OVV A;  3X0W A;  3ZNI D;  3PVL A;  1LM8 B;  5LXH A;  2LRU A;  2O2V B;  4RMA A;  2MBO A;  2C9W B;  4I6N B;  3GZN I;  1H8C A;  1V9J A;  3A9J A;  1WMH A;  3EHV A;  1K8R B;  3PHW B;  1LQB A;  2MBE A;  2L3Z A;  5G55 A;  1L2N A;  3D32 A;  4GMV A;  3ALB A;  4LJP B;  3ZIM A;  4EEW A;  3NOB A;  4EKU A;  5J17 A;  1C3T A;  2J0K A;  4HPL B;  2JRI B;  4TUU A;  1FXT B;  4YL8 A;  3ZTC A;  1TBE A;  1NBF C;  1UH6 A;  3APF A;  1WX9 A;  2KHW B;  3PV1 A;  1UD7 A;  2BF8 B;  2ZVN A;  2RD0 A;  3CMM B;  1LXD A;  3UQA A;  3VH4 B;  2KK8 A;  4HWI B;  2G4S A;  5JHB A;  5FR6 A;  2BGF A;  2JF5 A;  3WAL A;  4KZC A;  1WM3 A;  2DAF A;  2MCN B;  2FCS A;  3HK0 A;  2FAZ A;  3B08 A;  3PT2 B;  2ZVO A;  5JZE B;  4M0W B;  4NQK E;  2BWF A;  1WJ4 A;  3QWZ B;  4P7I A;  2CHX A;  2FCN A;  2JVC A;  4ASW C;  3ZDT A;  3DOW A;  4NAW A;  3TBL D;  4HDQ A;  1Q5W B;  2EMT A;  3AXC A;  2IZV B;  2NBU A;  2KWV B;  1WY8 A;  2IO0 B;  3AU4 A;  4HDO A;  1S1Q B;  2K8H A;  3A33 B;  2MX2 A;  3TCA A;  3NZS A;  3ML8 A;  1SGH A;  5CHF A;  5LXI B;  1E8W A;  1TTN A;  2LI5 A;  4BKG A;  1OTR B;  3UQB A;  2VRR B;  4GDK A;  1I35 A;  1V49 A;  2NS5 A;  4JIO U;  2NVU I;  2WYQ A;  3KH0 A;  1U4A A;  1R4N I;  2DYO A;  2AL3 A;  2D2Q A;  5DPR A;  2KXJ A;  4EZL A;  3PLV A;  4FHJ A;  2FID A;  5AZG A;  3LDZ E;  4XX5 A;  3ZNZ B;  2DZK A;  2NPT B;  3OAW A;  3M62 B;  1WIA A;  2WWZ A;  1Q1O A;  3EEC A;  3EFU A;  4DHZ B;  4M8N A;  2WX0 A;  1EF5 A;  2MA9 B;  5E6O A;  3ZRC A;  2JT4 B;  3KVF B;  1IYF A;  2KX0 A;  1I42 A;  2BKR B;  3JW0 X;  2MBQ A;  3ML9 A;  2J7Q B;  5DPS A;  2KC2 A;  3A1Q A;  2BYV E;  1CMX B;  2N9E B;  2CHW A;  4KDI C;  1WE6 A;  4GOC A;  3VUX A;  1XQQ A;  2G45 B;  3DVN U;  4W9I A;  3RT3 B;  2O2V A;  1H4R A;  1VD2 A;  2O6V B;  3PRM B;  4NJ6 A;  1J0G A;  1NI2 A;  2KFK B;  2KMC A;  1GC7 A;  1ZW7 A;  3R66 C;  1WGG A;  2G4D B;  4KSK C;  2AL6 A;  2KQS A;  2MQJ A;  2YVC A;  4KVG B;  4A3P A;  4FLH A;  1TZ1 A;  1GG3 A;  4IWO A;  2KWU B;  4W9L A;  5KHO A;  3RCZ A;  3ZNH B;  3DBS A;  4WWO A;  1XT9 B;  2ZNV B;  4MGK E;  1VCB A;  5AZH A;  3HIZ A;  2KNB A;  3UIP B;  4BKS D;  2LXC A;  5BO4 B;  5CHW A;  4BBN C;  4TQ0 A;  3DVN V;  4GDL B;  1Q0W B;  4DBG A;  2ZCC A;  4GIV A;  2IY1 B;  3AI5 A;  1L7Y A;  3QQ8 B;  3M3J A;  2LWP A;  3RZF A;  4TKN A;  2FNJ B;  1KM7 A;  4W9E A;  3A4R A;  2FCQ A;  3H7P A;  1G6J A;  2LGD A;  2LUE A;  3DVG Y;  1EUV B;  2DEN B;  4GN1 A;  4EUT A; 
#chains in the Genus database with same CATH topology
 3P4Q B;  1IP9 A;  2BYE A;  4NPN A;  2WU2 B;  1L0V B;  2WXF A;  2JYE A;  2D11 A;  3LYY A;  5D2M B;  1B9R A;  1T0S C;  4CO7 A;  1DYQ A;  2GOW A;  3B2F A;  2OJW A;  2I38 A;  2NPT A;  1SE3 A;  4F7Z A;  3C0R B;  3VHT C;  2L83 A;  5BMI A;  4RFB A;  2CU3 A;  2JZP A;  2KAJ A;  2RDB C;  1A5R A;  3VTW A;  2N1W A;  4B9K A;  3BY4 B;  4JGH B;  2W9N A;  5FKA C;  2KO3 A;  5T8I A;  1R4M B;  1NYQ A;  1WI0 A;  2L00 B;  1ROE A;  2ZZP B;  3DBL I;  2JY6 A;  2IO1 B;  3B1L X;  4DDI D;  3AEC B;  2K3U A;  4FJY A;  2LEK A;  3I3T B;  1DOI A;  3TL5 A;  3WAO A;  2N9L A;  4DXA B;  2QCZ A;  1XO3 A;  2L76 A;  2AX5 A;  3ZNG C;  5EE1 A;  4O1N A;  2N1V A;  3QA8 A;  4XE0 A;  4MGY E;  3TEZ A;  2DHZ A;  2D10 A;  1SE9 A;  3K9P B;  3DQV A;  2PJH A;  1P9D U;  3VR8 B;  4CYE A;  5BMG A;  4K3B A;  4B95 A;  3VXW A;  5G5H A;  1AYF A;  3Q8E A;  1X1M A;  1C77 A;  3O65 B;  1E7V A;  2LVQ A;  4TMA B;  3KUD B;  1VZ7 A;  2LAS A;  3UI3 A;  3JSV B;  1MG8 A;  4EZK A;  2J52 A;  1BT0 A;  2WX1 A;  3W5V B;  3VTU A;  2WXH A;  4A3O A;  1PQS A;  4ARC A;  4RNA A;  5CX3 A;  3QIJ A;  2LGY A;  1JWM D;  2LJI A;  2QIE B;  4K3C A;  3N1Z C;  1FRD A;  3P4S B;  4FHK A;  4A55 A;  1DGJ A;  2ZEQ A;  1JRU A;  1NYR A;  1CK1 A;  1FO4 A;  3GOE A;  4OW0 A;  2ZW1 A;  4K81 A;  2A5U A;  4KIK B;  3AN1 A;  1WXM A;  1E5W A;  3B2G A;  1FCL A;  4C7Y A;  3L54 A;  2N4F A;  2DLB A;  1XCT L;  3UIN B;  2LJ5 A;  3L0W B;  2WXQ A;  1SB3 C;  2M4N A;  1QIL A;  2N7D A;  4G0N B;  1DOY A;  1YNT E;  2D5G A;  4C80 A;  4IM2 A;  4BOS C;  2HDE A;  2K6D B;  1ZKH A;  4UDU C;  2JQR B;  3PTF C;  2V3N A;  5DPT A;  1KLV A;  4PS3 A;  1Z2M A;  1RLF A;  1V86 A;  3RNG C;  4DQO C;  2FCM A;  4URK A;  1FIQ A;  2KFK A;  4DHZ E;  2PVO D;  1YIW A;  5EDS A;  1WGR A;  3PPA A;  4K1R B;  4LDT B;  3IAS 1;  3U7D A;  3MJ5 A;  2PEA A;  2HJ8 A;  1OEY J;  1HEZ E;  3R7R A;  1XLO A;  2DYB A;  1YX5 B;  2QHO A;  3A9K A;  1QZE A;  3VVW B;  1K51 A;  2BB6 A;  4BAX A;  1F2R I;  4NJC A;  4NY0 A;  4W9D A;  3B0A A;  3W1Y A;  4KV2 A;  3EC8 A;  5C2T B;  3R3M A;  2DYM A;  3PGE A;  3HM6 X;  4RCO A;  3QHT A;  1TGZ B;  5G2N A;  5TR5 A;  2BS2 B;  3BVG A;  2MH7 A;  2MWS B;  2OJR A;  1OFF A;  4E74 A;  3AM9 A;  2IY0 B;  2Y3A A;  2WXJ A;  2K5P A;  2MP2 B;  4L23 A;  4YSZ B;  3DBH I;  3CIR B;  2V0G A;  2N7E A;  3NS8 A;  3A9J B;  2KWD A;  1E90 A;  2PKO A;  2PIA A;  3R2T A;  4B0M A;  1HE8 A;  1V1P B;  3N1Y C;  1EF1 A;  5DCN A;  2MJE A;  2V1Y A;  1GB4 A;  2QDF A;  3NHE B;  5D7G A;  3ZRF A;  3OJ3 A;  1L0Y B;  2R2O A;  3HM3 A;  1KLG D;  1UWM A;  3GZN B;  2RDH A;  4AUQ C;  4FUL A;  3VRA B;  3L08 A;  1IGD A;  4NAW B;  4EFO A;  4MSM B;  4LNI A;  1TS4 A;  1FMA D;  1ZXI A;  3TJP A;  4IWQ A;  1VZ8 A;  1GB1 A;  2DX5 B;  4IG7 B;  1SEB D;  5EE3 A;  4G3X B;  1WZ0 A;  2EKI A;  1WGH A;  1PGB A;  2R2Q A;  4MM3 A;  1C76 A;  4I6P A;  4ARI A;  3A1Q B;  3ZXV A;  5JXV A;  4OVV A;  3EUB 2;  1LM8 B;  1EU4 A;  1WMH A;  3EHV A;  3PHW B;  1R4N B;  2M56 B;  2N7J A;  3R8B A;  4GMV A;  4EEW A;  2WXK A;  3E9S A;  2JRI B;  4HPL B;  4ITK A;  4TUU A;  2HJ1 A;  2L52 A;  2BF8 B;  2RD0 A;  1DOX A;  4HWI B;  4WWM A;  4KZC A;  1WM3 A;  2FCS A;  2FAZ A;  2IPK D;  5IKC M;  2B76 B;  1WJ4 A;  1KRH A;  2FCN A;  2JVC A;  3GB1 A;  1ESF A;  2KWV B;  1WY8 A;  4HDO A;  2K8H A;  2K0P A;  2MX2 A;  3NZS A;  2PLP A;  1SGH A;  3HVZ A;  4BKG A;  1OTR B;  1ZXH A;  1ET6 A;  3ABV B;  1UNS A;  2NVU I;  5AZG A;  3LDZ E;  4XX5 A;  2NPT B;  2WQY B;  2INP E;  1T6B X;  3OAW A;  1YJJ A;  1IYF A;  3JW0 X;  3RNE C;  1C78 A;  2J7Q B;  2N9E B;  2BQQ A;  3VUX A;  4W9I A;  1XF5 L;  2O2V A;  2G9H D;  1J0G A;  1NI2 A;  3BK1 A;  2KYW A;  4CQN A;  1AWD A;  3R66 C;  1WGG A;  4NAM A;  4IWO A;  2KWU B;  1HA5 A;  4W9L A;  5KHO A;  2KNB A;  4WUR A;  2LXC A;  5BO4 B;  1MI0 A;  4TQ0 A;  1D5Z C;  2W82 A;  3VR9 B;  3U2S C;  1T5X D;  3Q8F A;  4M0W A;  3Q8B A;  4LNO A;  1TY2 A;  2MEK A;  3IT6 B;  2WDQ B;  1EUV B;  3U7Z A;  4ZYS A;  2W54 A;  3RUL A;  4NQL B;  1WXA A;  4W9J A;  1JWA D;  3W1S A;  2V4L A;  3GE8 C;  3WAM A;  3IAM 1;  3TEW A;  3QC8 B;  3TEY A;  4II2 B;  1D5M C;  3IVF A;  3NG0 A;  3N3K B;  4YT0 B;  4ZRI A;  3FC4 A;  3T8M A;  5C1Z A;  2LUM A;  2JWZ A;  3MFG A;  1TS5 A;  1ENF A;  1MPE A;  1N5W A;  2DAJ A;  2BW2 A;  3V6E B;  4A20 A;  5JH5 C;  1P1A A;  5BYQ A;  2YEP F;  4EE2 A;  2IDY A;  4PT5 A;  4IM0 A;  4BKT A;  3Q3O C;  2LXA A;  2WXR A;  4MDK E;  1HTO A;  2JX5 A;  2WDV B;  1JRO A;  1D3Z A;  2GB1 A;  1WXS A;  5CHV C;  1V80 A;  3OJ4 B;  4ICV A;  3WAP A;  2IO3 B;  1FNV A;  2WXM A;  2IJ0 A;  4K7U A;  2KVR A;  2J4X A;  1YQ4 B;  2WDT B;  1WM2 A;  4XDD A;  3RNF C;  1YD8 U;  5KHQ A;  4HKZ E;  4RGN A;  1ZDV A;  5TSS A;  3APD A;  4A9A A;  1Y8R C;  4N6E B;  3CWI A;  4IW0 A;  3RFZ B;  3KYD D;  2ASQ A;  4ANV A;  2V9H A;  3PRZ A;  4HK2 A;  1VDV A;  1FPY A;  3M63 B;  4AP4 C;  1EM7 A;  3EA6 A;  2HTH A;  1C79 A;  3SU8 X;  4HRS A;  2KTR A;  3ZJU A;  1MG4 A;  1P7E A;  2Z59 B;  1RWS A;  1WH3 A;  3NZ3 A;  1MHH E;  1SJH D;  1F52 A;  2D07 B;  1UEL A;  3A9K B;  1K53 A;  1QKZ A;  2KJH B;  3M95 A;  1P7F A;  1J7C A;  5BYR A;  1NEK B;  1PFD A;  4WH4 A;  2ZW0 A;  3DBR B;  5H8Y E;  1PGX A;  1WRI A;  2X8X X;  2M17 A;  4D2K A;  2J0M A;  3ECI A;  2CJN A;  3DVG X;  2JXX A;  2PMV A;  4LNN A;  4KDL B;  3L4P A;  5BMH A;  4WJO A;  2JPH A;  2GBK A;  4C56 C;  2RSU A;  4L1B A;  4IM3 A;  2WXL A;  2MHJ A;  2BS3 B;  4KZ0 A;  1XD3 B;  2LD9 A;  3BK2 A;  1D4B A;  1F0Z A;  3BWU D;  1K52 A;  2GBR A;  1WR1 A;  4TV3 A;  3LXF A;  1TT5 B;  2N9K A;  2KN5 A;  4USA A;  1M94 A;  3KUC B;  2SEB D;  2EMS A;  4QAY A;  4LNK A;  4IDI A;  4W9F A;  5J18 A;  3MHZ A;  3AEE B;  4IC7 B;  2UYZ B;  4AWJ A;  3IHP C;  1GC6 A;  3P2B A;  2DZJ A;  1WGD A;  3V6C B;  1C9F A;  3BVZ A;  1JWU D;  1C4P A;  1TKG A;  1MHX A;  1WGY A;  4IWP A;  5L83 A;  3NVZ A;  4MM3 B;  4NZL B;  2LRW A;  4ANW A;  2I1J A;  1T0R C;  3CSF A;  3OLM D;  1I4P A;  1S3S G;  4W9C A;  4PS8 A;  4KKI A;  4XZ4 A;  2ONQ A;  1PGA A;  2GBN A;  1N63 A;  3N32 A;  1J7B A;  3AB5 A;  1WMH B;  4W9K A;  3WAN A;  1E7U A;  3IG3 A;  3RZW C;  2Z0D B;  4JQW C;  2IO2 B;  3NS1 A;  3VTV A;  3RMK C;  5C3J B;  1JWB D;  3ZYY X;  4ZRK A;  4MH0 E;  2O6V D;  2KC1 A;  3GP7 A;  2QMT A;  3L17 A;  1WX8 A;  2LHE A;  4G11 A;  4ACF A;  3UGB B;  5IAA C;  1KH0 A;  2IND C;  3DHG C;  2FUG 1;  4F8C B;  1WSP A;  3C19 A;  3MHS D;  3P4P B;  4BZA A;  1RYJ A;  4GLS C;  4MGZ E;  1V5T A;  3ZQ4 A;  1D5X C;  2INN E;  1C4A A;  3ZTD A;  3MJW A;  2KAN A;  3NJT A;  2BTE A;  3ZDM C;  4EOY A;  2KN4 A;  4NNJ B;  1JCK B;  2KQ7 A;  4FJZ A;  3UIO B;  2XBB C;  3ZW3 A;  1OEY A;  4E3C A;  5E6N A;  2OHF A;  2WLB A;  4OZA A;  1YJ1 A;  3TMP B;  4DHJ D;  3CST A;  3SEB A;  2JZZ A;  2LRU A;  2O2V B;  3GS2 A;  4RMA A;  4I6N B;  1UWX A;  3WCQ A;  2MBE A;  1L2N A;  3MP9 A;  3N1X C;  4EKU A;  5J17 A;  3NOB A;  1VLB A;  1C3T A;  1NEN B;  4WAF A;  2INC C;  2FBW B;  1TBE A;  1WX9 A;  4IOI E;  3PV1 A;  1UD7 A;  2RPV A;  3AEF B;  1QT9 A;  3VH4 B;  2KK8 A;  3EGR A;  4TSS A;  5FR6 A;  2BGF A;  4WIP A;  3PT2 B;  2ZVO A;  5JZE B;  4M0W B;  1E7P B;  2BWF A;  3QWZ B;  4P7I A;  3ZDT A;  2LFI A;  1Q5W B;  2EMT A;  1UUP A;  2IZV B;  2IO0 B;  3HVD A;  2NMQ A;  3SFE B;  1E8W A;  3UQB A;  2VRR B;  1I35 A;  1V49 A;  4JIO U;  3KH0 A;  1U4A A;  2FID A;  1FNU A;  2OED A;  2DZK A;  2IGD A;  3EFU A;  3ETR A;  2E6X A;  3DHI C;  1I42 A;  2BKR B;  4H2A A;  2MBQ A;  5BYS A;  5G5G A;  2BYV E;  1CMX B;  1M4V A;  4KDI C;  3R2I A;  2G45 B;  3AE7 B;  3DVN U;  3AMZ A;  1VD2 A;  3PRM B;  5HI1 A;  1GC7 A;  1ZW7 A;  2G4D B;  2AL6 A;  4KVG B;  2MQJ A;  4KX6 B;  4FLH A;  1TZ1 A;  1GG3 A;  1GAQ B;  1PUT A;  2KAC A;  1XT9 B;  1TYG B;  1V97 A;  4MGK E;  4HKQ A;  1VCB A;  2QC8 A;  3HIZ A;  4BKS D;  3DVN V;  1Q0W B;  4DBG A;  2ZCC A;  2IY1 B;  3GE3 C;  5AUI A;  4A6Q A;  4RH6 A;  5I4D A;  3DBL B;  4RF1 A;  3A4R A;  5E6J A;  2LGD A;  2LUE A;  3DVG Y;  3NVV A;  1FFV A;  2K8C A;  1TY0 A;  1NI3 A;  3J9C A;  2NBV B;  2MW5 A;  3VUY A;  2KJ6 A;  1TKY A;  1V81 A;  1BML C;  2B3A A;  2LGX A;  4A8X C;  1ZPS A;  1XLN A;  4AQ7 A;  4MEM A;  2V4I B;  3BII D;  4AJY B;  1HXY D;  2RPQ A;  2NR2 A;  1KJT A;  3RNC C;  3I9V 1;  2J42 A;  3N30 A;  3IFW B;  1WFY A;  3DWM A;  2KTR B;  3AV8 A;  3FIL B;  3VFK A;  2D3A A;  3VUW A;  4XDC A;  3DCG A;  4JL9 A;  4EZJ A;  4GSW A;  2ZJD A;  2O6V A;  4ZRP A;  3AE2 B;  2PE9 A;  1QOA A;  2K8B A;  1T0Y A;  4HCP B;  4B6W A;  1I4R A;  1Y56 A;  2X38 A;  2L05 A;  2KZR A;  3PZ8 A;  3QAQ A;  1ET9 A;  3Q8C A;  2WP9 B;  1RFK A;  4US8 A;  3ZUN A;  1TS2 A;  3L16 A;  4GGQ A;  1UGJ A;  2CU1 A;  4HPM B;  3TSS A;  2JRH A;  4JE3 B;  4PYU A;  3VAW A;  3WA0 A;  1GUA B;  3BVM A;  2TSS A;  2N9P C;  4AJW A;  1AW7 A;  5E6P A;  2KDM A;  1SE2 A;  3V60 A;  1T3Q A;  3EFC A;  2MBH A;  4TQ1 A;  2ACZ B;  1P0R A;  1R4M I;  4J6I A;  2DZI A;  3H9D A;  1E8Y A;  2N9X A;  2KFJ A;  3IBE A;  2NCN A;  1VJK A;  3RPF C;  3KQ4 A;  4WWP A;  2KMA A;  1D6E C;  3ZXR A;  3AE5 B;  1L4Z B;  5J2R A;  2GBJ A;  2JXT A;  2WXI A;  2K1F A;  3JVZ X;  2R61 A;  3NZU A;  3PS6 A;  1E8X A;  4WQM A;  4YTN B;  1L4D B;  4HXD A;  2M8S A;  4ZDV A;  2BPS A;  4FAD A;  4N59 A;  1WE7 A;  4HLE A;  1FXA A;  2BKF A;  3HUI A;  4RM8 A;  2HTM E;  4ZHO A;  1OQY A;  2C7M B;  1OGW A;  4C4V A;  3MC8 A;  2LGI A;  3I57 A;  2DNF A;  2IBI B;  2VZK D;  2KOX A;  3LJ3 A;  4RGT A;  1I4Q A;  5IO9 A;  2MJD A;  1UGM A;  4P1C C;  3W9C B;  4OVZ A;  2CS4 A;  2FIF A;  1J19 A;  3AE8 B;  2K25 A;  3NY5 A;  5LNK 1;  2ZCB A;  3RYT A;  5AEK B;  4GDK B;  5HFY A;  1CQV A;  2L32 A;  3Q3J A;  4W9G A;  5D3D A;  2KTF A;  2MSE D;  1E6E B;  2LZ6 A;  1L5P A;  2JZ3 B;  1HZ5 A;  4LLG M;  4MGI E;  3ONS A;  4WQO B;  2KT7 A;  1V5O A;  5MPO A;  3DWG C;  3P42 A;  4MH8 A;  3ZO5 B;  4FN2 A;  1PDX A;  2BS4 B;  1WXV A;  2ZPN A;  1SSN A;  1JAL A;  3A4S C;  2FUH B;  4ZOH C;  3ZJV A;  1MVK A;  4YTM B;  2WXN A;  5DPW A;  4JLC A;  1WX7 A;  3BZD B;  3JYU A;  2Z8L A;  1TS3 A;  4RM9 A;  3DBH B;  5HKH A;  2W3S A;  3HHM A;  4M01 A;  1F9J A;  2ZNV C;  3VRB B;  4BKS A;  2XNA C;  2ZPY A;  4E71 A;  4II3 B;  1WJU A;  1WR6 E;  4WAA A;  4RGO S;  3NVY A;  3N20 C;  4F1S A;  1UBI A;  4HJG E;  4WJN A;  3RI7 C;  1FM0 D;  4M8M A;  2XK5 A;  4FXC A;  3BIN A;  3PO0 A;  3R7Q A;  2UU7 A;  4MJS A;  2KJR A;  2VH2 A;  3FKY A;  1QQR A;  2PW9 A;  1VZ6 A;  3HRD D;  1VR9 A;  1LFD A;  2DWQ A;  4BOZ B;  4IUM B;  1VRA B;  3X23 A;  1YX6 B;  3UF8 A;  4US9 A;  3U8Z A;  3AUL A;  2QJL A;  4WJP A;  3V61 A;  3SHQ A;  5JHA A;  1SIF A;  1GNU A;  2RGF A;  3FIL A;  4YXD B;  1EWY C;  2RMM A;  3DHH C;  1AAR A;  2GMI C;  2L0F A;  3AEB B;  3SD5 A;  2JYT A;  3ZJT A;  3L13 A;  1ZGU B;  4KGR A;  4FBJ B;  2YLM A;  1IBX B;  3AE4 B;  4MSQ B;  3L10 B;  1JQ4 A;  4YWG G;  1N62 A;  3KUZ A;  4C00 A;  4DXG A;  2MLB A;  4DK5 A;  2N0S B;  3K9O B;  3ZLZ A;  3APC A;  2OOB B;  3ZVV A;  1P98 A;  3PSE B;  2CKH B;  2UWQ A;  3PRE A;  2C5L C;  1OQQ A;  1F1H A;  4ZYN A;  2G1E A;  2KDE B;  3AE3 B;  3H7S A;  5AZF A;  1ZOY B;  2GBM A;  4W9H A;  3Q6B A;  4MT5 A;  4HVB A;  3BYY B;  3QCA A;  5LLI A;  3QJZ A;  2I1K A;  2KLG A;  3V05 A;  1QOG A;  4HEA 1;  1YOV B;  3ZNI D;  3PVL A;  4YSY B;  2MJ3 A;  5LXH A;  2C9W B;  3GZN I;  1H8C A;  1V9J A;  4Q2J A;  2WXG A;  3Q69 A;  1JML A;  1LQB A;  2IGH A;  2LMC A;  3ALB A;  4LJP B;  3ZIM A;  3I5J C;  2J0K A;  1RM6 C;  1CZP A;  4REZ A;  2WDR B;  3ZTC A;  1UH6 A;  3APF A;  5IP4 D;  2KHW B;  2K9X A;  1V1O A;  4J3O D;  2ZVN A;  3CMM B;  4KGT A;  3UQA A;  4OZB A;  3BYT B;  2G4S A;  5JHB A;  2JF5 A;  3U4E G;  2MCN B;  3HK0 A;  3B08 A;  2W3R A;  1AN8 A;  2CHX A;  3DOW A;  3TBL D;  2KVZ A;  4HDQ A;  2NBU A;  4ZRQ A;  3AU4 A;  4P6V F;  3A33 B;  3RNB C;  4B0E A;  5CHF A;  1GOZ A;  3RNA C;  4GDK A;  3P4R B;  2BYT A;  5DPR A;  1R4N I;  1N61 A;  2DYO A;  3OG5 A;  4LK0 M;  3URY A;  3ZNZ B;  1ZP0 B;  3M62 B;  1WIA A;  1Q1O A;  1JWS D;  2AQ1 B;  4M8N A;  3ZRC A;  2JT4 B;  3KVF B;  1SJE D;  4M02 A;  3ML9 A;  2M0A A;  5DPS A;  2KC2 A;  4YTP B;  1UF0 A;  3MC9 A;  2CHW A;  2RDG A;  1XQQ A;  2FE8 A;  4KGS A;  3N9Y C;  2WXO A;  1STE A;  1FNW A;  2O6V B;  4NJ6 A;  2KMC A;  5D3I B;  4C7Z A;  2IGG A;  4KSK C;  4DXF A;  2KQS A;  2YVC A;  4A3P A;  3MC0 B;  2ICI A;  4KKJ A;  1N6Z A;  3ZNH B;  3DBS A;  3UIP B;  1I4H A;  3PZ7 A;  1YN3 A;  1LO5 D;  1QOF A;  5CHW A;  4BBN C;  4LTU A;  2KMM A;  3AI5 A;  3NUH B;  3M3J A;  2V3P A;  2LWP A;  1XLP A;  3U52 E;  1KM7 A;  2AQ3 B;  4W9E A;  4LNF A;  1G6J A;  1E0Z A;  2DEN B;  2AQ2 B;  2A4Z A;  4P1B C;  2C7H A;  2QEJ C;  4DHJ B;  3RUI B;  2KX3 A;  2JUO A;  5IN7 A;  3W1S C;  4JX1 C;  4S17 A;  3MTN B;  2PTL A;  2XEW A;  2H88 B;  1MFW A;  1L6U A;  2Y5P A;  1WYG A;  3WIM A;  4IKG A;  5L95 C;  3KLS X;  3AEG B;  3P63 A;  2EEL A;  1I4X A;  2CR5 A;  2E3T A;  3S2A A;  1TJE A;  1YN5 A;  3RD2 A;  2D3B A;  1LGR A;  3Q3N C;  1IBX A;  4LDT D;  4FA6 A;  1UBQ A;  4XWT A;  4C4V B;  2J0J A;  2D3G A;  1RAX A;  4HCN B;  4KSL C;  1TIF A;  5FK9 C;  4JPS A;  1EO6 A;  1SF0 A;  2GRI A;  2Z0E B;  1KFY B;  2CHZ A;  1ZUD 2;  1WYW B;  4GDL A;  5FR3 A;  5EE9 A;  1ZDX A;  4OVU A;  2JU6 X;  2NTT A;  5GMV A;  2NTS A;  1GJZ A;  2KDF B;  1YN4 A;  4X57 B;  4A90 A;  1PYW D;  3PRP B;  4PYZ A;  1JW9 D;  2IYD B;  4MAC A;  2V3S A;  2WNM A;  3Q14 C;  4XYC A;  3PHX B;  2WHI A;  2YEP B;  3PZD A;  2GLS A;  2C60 A;  3VQI A;  3KWL A;  2KDI A;  3H6N A;  3KW5 B;  1TKE A;  1C1Y B;  1FXI A;  4N9F 4;  2EKE C;  4PK1 A;  1BXT A;  3T3O A;  2BT6 A;  3Q3M C;  3AED B;  3QAR A;  1N5X A;  1YJI A;  5D94 A;  2H89 B;  4DWF A;  2M0X A;  1RFA A;  2AWT A;  3W2D A;  4GB9 A;  5C23 A;  1V8C A;  3LB8 C;  1Z5S B;  1KTK A;  2KKC A;  4XC2 A;  1XLQ A;  4WJQ A;  2XK5 B;  4S0R A;  1V2Y A;  1EU3 A;  4K7S A;  4WWN A;  3KWV A;  3QK0 A;  1WZ3 A;  4MJS B;  1RRB A;  2GI9 A;  4LCD E;  3AU5 A;  2REX A;  3NRZ A;  1SBB B;  1IGC A;  2LHD A;  2QSD A;  2KDB A;  3DPD A;  1FD6 A;  4MEL A;  4R3D A;  5IOI A;  2DBY A;  1C4C A;  2BBC A;  2Y5B B;  3VDZ A;  5HHD G;  3RN9 C;  2BB5 A;  1P3Q U;  2VH1 A;  2M1M A;  3AE1 B;  4RGM A;  1WGK A;  1YQ3 B;  4OHJ A;  2CJO A;  1IUE A;  2PE6 B;  3DBR I;  1XXG A;  3AEA B;  3SFD B;  4PS7 A;  1FEH A;  3VH3 B;  3JSV A;  1KLU D;  2KWC A;  2BWE S;  1JRP A;  1XEE A;  1L6V A;  4LJO B;  5CTR C;  3AE9 B;  3H8H A;  4BVU C;  3I63 C;  1NDD A;  2AYO B;  4FJV B;  4GXB A;  4BFR A;  4P16 A;  2JWU A;  1WJN A;  3V62 A;  1B1Z A;  1ZE3 D;  1E10 A;  4ZHP A;  2KD0 A;  1FFU A;  4KIK A;  2K39 A;  3H7P B;  2SAK A;  1E8Z A;  2KLC A;  1HZ6 A;  3ENE A;  4ANX A;  2RR9 A;  5EE0 A;  1TZO A;  5IA7 A;  4HJK A;  3B9J A;  1YQB A;  3T3N A;  4ICU A;  4AOF A;  2PPH A;  4DDG D;  1WWT A;  3SDL C;  4G50 A;  2MBB B;  1F2R C;  3Q2A C;  4M00 A;  2AEH A;  2Y5C A;  1XCQ L;  2DZM A;  2PVG C;  2ON8 A;  4XWW A;  3IT4 B;  1J8C A;  3H1U A;  1BUI C;  2G3Q B;  3DDC B;  1UZX B;  3T9L A;  1I4G A;  3TIX A;  1V6E A;  3IXS A;  1HTQ A;  3CF6 E;  3KYC D;  2L0T A;  2HD5 B;  4K7W A;  3PLU A;  1ISN A;  2VZK B;  1SXT A;  2LVO A;  3Q3F A;  1I7H A;  1CJE A;  4I6L B;  2NBW B;  4ANU A;  2L7R A;  2JSV X;  2W55 A;  4YSX B;  1WF9 A;  3TUO A;  2LVP A;  2HE7 A;  4GU2 A;  1K50 A;  2BVC A;  4CHK A;  5D6J B;  4NJ7 A;  2L8J A;  4JWS C;  1KOT A;  1WJ6 A;  2C7N B;  3QX1 A;  2K6Q A;  2BYF A;  4ZRJ A;  1QOB A;  1R7S A;  4BBN F;  1WRD B;  2QIL A;  2MRP A;  3U30 A;  1SE4 A;  3ZKJ C;  3AH7 A;  1SIJ A;  3ZGZ A;  1ACC A;  3Q8A A;  1IPG A;  2MP2 A;  3X0W A;  4L2Y A;  2MBO A;  3A9J A;  1WXQ A;  4HPP A;  1K8R B;  1V1P A;  1FRR A;  1J7A A;  2XN9 C;  2L3Z A;  5G55 A;  3D32 A;  1FXT B;  3OWE B;  4YL8 A;  1NBF C;  1QF6 A;  1GPX A;  1LXD A;  2WS3 B;  2LGS A;  3O13 A;  3WAL A;  2DAF A;  3P1M A;  4JWU C;  3FAH A;  1FCC C;  1F77 A;  4NQK E;  2KQ4 X;  1OQR A;  4ASW C;  3E56 A;  4NAW A;  3AXC A;  5GXG B;  1S1Q B;  3V3X A;  3TCA A;  3ML8 A;  5AUK A;  2WU5 B;  5LXI B;  1TTN A;  2LI5 A;  2J53 A;  2NS5 A;  2WYQ A;  1Q10 A;  1T0Q C;  2AL3 A;  2D2Q A;  4EZL A;  2KXJ A;  3PLV A;  3SR6 A;  4AS1 A;  4FHJ A;  1YMH E;  4HRO A;  1A70 A;  1KF6 B;  5H92 C;  2WWZ A;  3EEC A;  4DHZ B;  2WX0 A;  3C8Y A;  2WGS A;  1EF5 A;  1EWC A;  2MA9 B;  5E6O A;  4RF0 A;  2KX0 A;  2WXP A;  1L0X B;  1HQR D;  3A1Q A;  4N58 A;  2D3C A;  1WE6 A;  4GOC A;  1QLB B;  3RT3 B;  1H4R A;  2KFK B;  5HG2 A;  1N60 A;  2K22 A;  2L1A A;  3RCZ A;  4WWO A;  2ZNV B;  5AZH A;  4OZC A;  3W5U B;  1E9M A;  4GDL B;  1MJD A;  4GIV A;  3AE6 B;  2I2Y A;  1L7Y A;  3QQ8 B;  4XGA B;  3TEX A;  3RZF A;  3NVW A;  4TKN A;  2FNJ B;  3H7P A;  2FCQ A;  4GN1 A;  1NVI D;  2Q5W D;  2M19 A;  4EUT A; 
#chains in the Genus database with same CATH homology
 3RUL A;  1IP9 A;  2BYE A;  4NPN A;  2A4Z A;  2K8C A;  4NQL B;  1WXA A;  2C7H A;  4W9J A;  2NBV B;  2MW5 A;  3VUY A;  4DHJ B;  2D11 A;  2KJ6 A;  5D2M B;  1V81 A;  2B3A A;  2KX3 A;  2LGX A;  3RUI B;  2JUO A;  4CO7 A;  3W1S A;  3W1S C;  2GOW A;  2V4L A;  3WAM A;  4MEM A;  2NPT A;  3MTN B;  4F7Z A;  3C0R B;  2XEW A;  3VHT C;  4AJY B;  3QC8 B;  2RPQ A;  2NR2 A;  1KJT A;  4II2 B;  3WIM A;  1A5R A;  3IVF A;  2N1W A;  3VTW A;  4B9K A;  3BY4 B;  3N30 A;  3IFW B;  3N3K B;  4JGH B;  1WFY A;  4ZRI A;  3T8M A;  5C1Z A;  5L95 C;  2W9N A;  2KTR B;  3VFK A;  2KO3 A;  2CR5 A;  2JWZ A;  3S2A A;  3VUW A;  3DCG A;  4JL9 A;  4EZJ A;  4GSW A;  2ZJD A;  2O6V A;  1WI0 A;  2PE9 A;  2DAJ A;  1T0Y A;  2K8B A;  2L00 B;  4HCP B;  3RD2 A;  4B6W A;  3V6E B;  4A20 A;  2ZZP B;  3DBL I;  5JH5 C;  2L05 A;  2JY6 A;  2IO1 B;  3B1L X;  2KZR A;  4LDT D;  4DDI D;  4FA6 A;  1UBQ A;  1P1A A;  3QAQ A;  2J0J A;  4IM0 A;  4BKT A;  2D3G A;  4FJY A;  1RAX A;  4HCN B;  3I3T B;  2LXA A;  4KSL C;  3ZUN A;  3L16 A;  4GGQ A;  4MDK E;  3TL5 A;  3WAO A;  4DXA B;  2CU1 A;  2L76 A;  1EO6 A;  4HPM B;  1D3Z A;  2Z0E B;  3ZNG C;  2JRH A;  2CHZ A;  4PYU A;  3VAW A;  1WYW B;  3WA0 A;  4GDL A;  1WXS A;  1GUA B;  5CHV C;  4OVU A;  2N1V A;  5GMV A;  3QA8 A;  1V80 A;  2N9P C;  4MGY E;  5E6P A;  3OJ4 B;  4AJW A;  2DHZ A;  4ICV A;  1GJZ A;  2KDF B;  4X57 B;  2IO3 B;  3WAP A;  4K7U A;  3V60 A;  2D10 A;  2KVR A;  2WDT B;  3PRP B;  4PYZ A;  1WM2 A;  1SE9 A;  2IYD B;  3DQV A;  3K9P B;  2MBH A;  1YD8 U;  2PJH A;  5KHQ A;  2V3S A;  4TQ1 A;  1P0R A;  1P9D U;  1R4M I;  4J6I A;  4CYE A;  2DZI A;  4B95 A;  3VXW A;  3H9D A;  3APD A;  1E8Y A;  2N9X A;  1Y8R C;  2KFJ A;  3IBE A;  2NCN A;  3PHX B;  1X1M A;  4WWP A;  2KMA A;  4IW0 A;  5J2R A;  3KYD D;  3O65 B;  2ASQ A;  2GBJ A;  3PZD A;  4ANV A;  3PRZ A;  2C60 A;  3VQI A;  1E7V A;  2K1F A;  2LVQ A;  4HK2 A;  2KDI A;  3JVZ X;  3H6N A;  3KUD B;  3KW5 B;  3M63 B;  1C1Y B;  4AP4 C;  3NZU A;  4N9F 4;  2EKE C;  3PS6 A;  1E8X A;  2HTH A;  3SU8 X;  2LAS A;  2KTR A;  3JSV B;  1MG8 A;  4EZK A;  2Z59 B;  4HXD A;  2M8S A;  1WH3 A;  4ZDV A;  2BPS A;  1BT0 A;  4FAD A;  3QAR A;  2WX1 A;  2D07 B;  3VTU A;  1WE7 A;  5D94 A;  1UEL A;  3A9K B;  4HLE A;  4A3O A;  1PQS A;  2BKF A;  4RM8 A;  5CX3 A;  3QIJ A;  2LGY A;  4DWF A;  1OQY A;  2C7M B;  2M0X A;  1OGW A;  2KJH B;  3M95 A;  1RFA A;  2AWT A;  4FHK A;  4GB9 A;  5C23 A;  1Z5S B;  2KKC A;  2ZEQ A;  1JRU A;  4XC2 A;  4WJQ A;  2M17 A;  2IBI B;  3LJ3 A;  2KOX A;  3GOE A;  2XK5 B;  4K81 A;  2A5U A;  4KIK B;  1UGM A;  2J0M A;  1WXM A;  1E5W A;  3ECI A;  1V2Y A;  4WWN A;  4K7S A;  3L54 A;  2N4F A;  2CS4 A;  3QK0 A;  1WZ3 A;  1J19 A;  2FIF A;  2JXX A;  2K25 A;  3DVG X;  4MJS B;  1RRB A;  4LCD E;  3NY5 A;  3AU5 A;  2REX A;  3UIN B;  2LJ5 A;  2ZCB A;  3RYT A;  3L0W B;  4GDK B;  5AEK B;  4KDL B;  4WJO A;  3Q3J A;  2M4N A;  2JPH A;  4W9G A;  2KTF A;  2GBK A;  2N7D A;  4G0N B;  2RSU A;  2KDB A;  3DPD A;  2MSE D;  4MEL A;  2LZ6 A;  4IM3 A;  2JZ3 B;  4MGI E;  3ONS A;  4WQO B;  2Y5B B;  4KZ0 A;  1XD3 B;  2LD9 A;  4IM2 A;  4BOS C;  1V5O A;  3VDZ A;  2K6D B;  1ZKH A;  1P3Q U;  2M1M A;  3ZO5 B;  4FN2 A;  3PTF C;  2GBR A;  5DPT A;  1KLV A;  1WR1 A;  4TV3 A;  4PS3 A;  1WXV A;  1Z2M A;  2ZPN A;  1RLF A;  1V86 A;  2KN5 A;  2PE6 B;  2FCM A;  3DBR I;  3A4S C;  4URK A;  2FUH B;  2KFK A;  4DHZ E;  1M94 A;  5DPW A;  3KUC B;  1WX7 A;  1YIW A;  4JLC A;  4PS7 A;  5EDS A;  1WGR A;  3PPA A;  3JYU A;  4K1R B;  4LDT B;  4RM9 A;  2EMS A;  3VH3 B;  5HKH A;  3JSV A;  2KWC A;  3HHM A;  3U7D A;  4W9F A;  2BWE S;  5J18 A;  1F9J A;  2ZNV C;  2PEA A;  2HJ8 A;  4LJO B;  5CTR C;  1OEY J;  4BKS A;  3R7R A;  4BVU C;  2DYB A;  1YX5 B;  2QHO A;  2ZPY A;  3A9K A;  4IC7 B;  1NDD A;  2UYZ B;  4AWJ A;  1QZE A;  1WJU A;  1WR6 E;  2AYO B;  4II3 B;  3VVW B;  4FJV B;  4E71 A;  3IHP C;  4GXB A;  4WAA A;  1GC6 A;  4BFR A;  3P2B A;  4F1S A;  1UBI A;  2DZJ A;  1WGD A;  4NY0 A;  3V6C B;  1WJN A;  4W9D A;  3B0A A;  3W1Y A;  3V62 A;  4KV2 A;  3EC8 A;  4WJN A;  1WGY A;  2KD0 A;  3R3M A;  2DYM A;  4M8M A;  2XK5 A;  3PGE A;  3HM6 X;  4KIK A;  2K39 A;  4IWP A;  5L83 A;  3H7P B;  3BIN A;  3QHT A;  1TGZ B;  1E8Z A;  5G2N A;  2KLC A;  3ENE A;  5TR5 A;  3R7Q A;  4ANX A;  4MJS A;  2KJR A;  2RR9 A;  2LRW A;  4ANW A;  2MWS B;  2OJR A;  4E74 A;  2I1J A;  5IA7 A;  3CSF A;  2IY0 B;  4HJK A;  3OLM D;  1YQB A;  1S3S G;  2MP2 B;  4ICU A;  4W9C A;  1LFD A;  2PPH A;  4PS8 A;  4AOF A;  4DDG D;  4XZ4 A;  3SDL C;  3DBH I;  4G50 A;  2GBN A;  4BOZ B;  2MBB B;  4IUM B;  3N32 A;  2N7E A;  3NS8 A;  3X23 A;  3A9J B;  1WMH B;  4W9K A;  1E90 A;  3WAN A;  1YX6 B;  3UF8 A;  3U8Z A;  1E7U A;  3AUL A;  1HE8 A;  3IG3 A;  4WJP A;  2AEH A;  3RZW C;  3V61 A;  3SHQ A;  5JHA A;  2Z0D B;  1SIF A;  1GNU A;  2RGF A;  4JQW C;  2IO2 B;  2DZM A;  3VTV A;  1EF1 A;  5DCN A;  1AAR A;  2V1Y A;  2GMI C;  2L0F A;  1J8C A;  3NHE B;  5D7G A;  4ZRK A;  3SD5 A;  4MH0 E;  3H1U A;  3ZRF A;  2G3Q B;  3DDC B;  2O6V D;  1UZX B;  3L13 A;  1ZGU B;  3OJ3 A;  3T9L A;  2KC1 A;  2R2O A;  3HM3 A;  3L17 A;  1WX8 A;  4G11 A;  4FBJ B;  2YLM A;  3TIX A;  1V6E A;  3UGB B;  3CF6 E;  5IAA C;  3KYC D;  2L0T A;  2HD5 B;  4MSQ B;  4K7W A;  3L10 B;  3PLU A;  1ISN A;  4F8C B;  2LVO A;  4AUQ C;  3MHS D;  3Q3F A;  3KUZ A;  4FUL A;  2MLB A;  3L08 A;  4I6L B;  4NAW B;  4DK5 A;  2NBW B;  4ANU A;  2L7R A;  4EFO A;  4MSM B;  3K9O B;  1V5T A;  4MGZ E;  3ZLZ A;  1WF9 A;  3APC A;  3ZTD A;  2LVP A;  2HE7 A;  2OOB B;  4GU2 A;  3TJP A;  3ZVV A;  1P98 A;  3MJW A;  4IWQ A;  3PSE B;  2KAN A;  5D6J B;  4CHK A;  4NJ7 A;  2CKH B;  2L8J A;  3ZDM C;  2UWQ A;  3PRE A;  4EOY A;  2C5L C;  1KOT A;  1WJ6 A;  2C7N B;  3QX1 A;  2DX5 B;  4NNJ B;  4IG7 B;  2K6Q A;  2KQ7 A;  2BYF A;  4FJZ A;  4ZRJ A;  4G3X B;  4ZYN A;  1WZ0 A;  3UIO B;  1WGH A;  2KDE B;  2R2Q A;  3H7S A;  5AZF A;  2XBB C;  3ZW3 A;  4BBN F;  1OEY A;  2GBM A;  4MM3 A;  1WRD B;  2MRP A;  3U30 A;  4E3C A;  4W9H A;  5E6N A;  4HVB A;  3ZKJ C;  3QCA A;  5LLI A;  3QJZ A;  4I6P A;  1YJ1 A;  3TMP B;  4DHJ D;  2I1K A;  3CST A;  2KLG A;  3A1Q B;  1IPG A;  2JZZ A;  2MP2 A;  4OVV A;  3X0W A;  3ZNI D;  3PVL A;  1LM8 B;  5LXH A;  2LRU A;  2O2V B;  4RMA A;  2MBO A;  2C9W B;  4I6N B;  3GZN I;  1H8C A;  1V9J A;  3A9J A;  1WMH A;  3EHV A;  1K8R B;  3PHW B;  1LQB A;  2MBE A;  2L3Z A;  5G55 A;  1L2N A;  3D32 A;  4GMV A;  3ALB A;  4LJP B;  3ZIM A;  4EEW A;  3NOB A;  4EKU A;  5J17 A;  1C3T A;  2J0K A;  4HPL B;  2JRI B;  4TUU A;  1FXT B;  4YL8 A;  3ZTC A;  1TBE A;  1NBF C;  1UH6 A;  3APF A;  1WX9 A;  2KHW B;  3PV1 A;  1UD7 A;  2BF8 B;  2ZVN A;  2RD0 A;  3CMM B;  1LXD A;  3UQA A;  3VH4 B;  2KK8 A;  4HWI B;  2G4S A;  5JHB A;  5FR6 A;  2BGF A;  2JF5 A;  3WAL A;  4KZC A;  1WM3 A;  2DAF A;  2MCN B;  2FCS A;  3HK0 A;  2FAZ A;  3B08 A;  3PT2 B;  2ZVO A;  5JZE B;  4M0W B;  4NQK E;  2BWF A;  1WJ4 A;  3QWZ B;  4P7I A;  2CHX A;  2FCN A;  2JVC A;  4ASW C;  3ZDT A;  3DOW A;  4NAW A;  3TBL D;  4HDQ A;  1Q5W B;  2EMT A;  3AXC A;  2IZV B;  2NBU A;  2KWV B;  1WY8 A;  2IO0 B;  3AU4 A;  4HDO A;  1S1Q B;  2K8H A;  3A33 B;  2MX2 A;  3TCA A;  3NZS A;  3ML8 A;  1SGH A;  5CHF A;  5LXI B;  1E8W A;  1TTN A;  2LI5 A;  4BKG A;  1OTR B;  3UQB A;  2VRR B;  4GDK A;  1I35 A;  1V49 A;  2NS5 A;  4JIO U;  2NVU I;  2WYQ A;  3KH0 A;  1U4A A;  1R4N I;  2DYO A;  2AL3 A;  2D2Q A;  5DPR A;  2KXJ A;  4EZL A;  3PLV A;  4FHJ A;  2FID A;  5AZG A;  3LDZ E;  4XX5 A;  3ZNZ B;  2DZK A;  2NPT B;  3OAW A;  3M62 B;  1WIA A;  2WWZ A;  1Q1O A;  3EEC A;  3EFU A;  4DHZ B;  4M8N A;  2WX0 A;  1EF5 A;  2MA9 B;  5E6O A;  3ZRC A;  2JT4 B;  3KVF B;  1IYF A;  2KX0 A;  1I42 A;  2BKR B;  3JW0 X;  2MBQ A;  3ML9 A;  2J7Q B;  5DPS A;  2KC2 A;  3A1Q A;  2BYV E;  1CMX B;  2N9E B;  2CHW A;  4KDI C;  1WE6 A;  4GOC A;  3VUX A;  1XQQ A;  2G45 B;  3DVN U;  4W9I A;  3RT3 B;  2O2V A;  1H4R A;  1VD2 A;  2O6V B;  3PRM B;  4NJ6 A;  1J0G A;  1NI2 A;  2KFK B;  2KMC A;  1GC7 A;  1ZW7 A;  3R66 C;  1WGG A;  2G4D B;  4KSK C;  2AL6 A;  2KQS A;  2MQJ A;  2YVC A;  4KVG B;  4A3P A;  4FLH A;  1TZ1 A;  1GG3 A;  4IWO A;  2KWU B;  4W9L A;  5KHO A;  3RCZ A;  3ZNH B;  3DBS A;  4WWO A;  1XT9 B;  2ZNV B;  4MGK E;  1VCB A;  5AZH A;  3HIZ A;  2KNB A;  3UIP B;  4BKS D;  2LXC A;  5BO4 B;  5CHW A;  4BBN C;  4TQ0 A;  3DVN V;  4GDL B;  1Q0W B;  4DBG A;  2ZCC A;  4GIV A;  2IY1 B;  3AI5 A;  1L7Y A;  3QQ8 B;  3M3J A;  2LWP A;  3RZF A;  4TKN A;  2FNJ B;  1KM7 A;  4W9E A;  3A4R A;  2FCQ A;  3H7P A;  1G6J A;  2LGD A;  2LUE A;  3DVG Y;  1EUV B;  2DEN B;  4GN1 A;  4EUT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...