2O2VA

Crystal structure of the complex of human mitogen activated protein kinase kinase 5 phox domain (map2k5-phox) with human mitogen activated protein kinase kinase kinase 3 (map3k3b-phox)
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
93
structure length
92
Chain Sequence
VLVIRIKIPNSGAVDWTVHSPQLLFRDVLDVIGQVLPEATTTAFEYEDEDGDRITVRSDEEMKAMLSYYYSTVMEQQVNGQLIEPLQIFPRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dual specificity mitogen-activated protein kinase kinase 5
publication title Crystal Structure of the Complex of Human Mitogen Activated Protein Kinase Kinase 5 Phox Domain (MAP2K5-phox) with Human Mitogen Activated Protein Kinase Kinase Kinase 3 (MAP3K3B-phox)
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 21
structure length 92
sequence length 93
ec nomenclature ec 2.7.12.2: Mitogen-activated protein kinase kinase.
pdb deposition date 2006-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00564 PB1 PB1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2o2vA00
1S1QB 1V5OA 2BGFA 3AXCA 3AULA 1GC7A 3C0RB 4W9KA 5C1ZA 2EKEC 2DZMA 3AI5A 3PVLA 4G3XB 3BINA 2NPTB 3M62B 4A20A 3ZKJC 1YJ1A 4W9LA 3UIOB 1C3TA 4WJPA 4XX5A 2J0MA 2K1FA 2EMSA 3CF6E 4AWJA 2LASA 3BY4B 2N9EB 4WWNA 3L08A 3QARA 2KDEB 1VCBA 2N1WA 3Q3JA 2KFJA 2KN5A 4BBNC 3ML8A 2KANA 2N4FA 2HTHA 3KUDB 2KJ6A 3VHTC 4EEWA 3WAOA 3CSFA 2L05A 5L95C 2KHWB 2NBVB 3QHTA 1Z2MA 3V61A 5J18A 1HE8A 1TGZB 4KV2A 2JUOA 2MSED 3JSVA 3VUWA 3QAQA 2MBQA 2DAFA 4TQ0A 3TJPA 1P9DU 1ZKHA 4ANWA 4OVUA 3DCGA 4NAWA 4PYZA 2CU1A 4GDLB 3APFA 2ZNVB 3RULA 2KX3A 1I35A 4LCDE 5G55A 1YX6B 3N30A 1C1YB 1XD3B 2WX1A 4PS8A 4XZ4A 5LXHA 2MA9B 3R3MA 2XBBC 4IM2A 4GXBA 1WX9A 4HCNB 3ZNZB 3HHMA 3L10B 5IA7A 5L83A 2JVCA 3WALA 1V6EA 4ICUA 5CHWA 1K8RB 3KVFB 3DVNV 1D3ZA 3KUCB 5DPTA 3W1SC 4EZKA 3SHQA 1MG8A 2BYVE 3VUYA 1CMXB 3KH0A 2MRPA 2XK5B 2LRWA 4W9IA 2LVOA 2GBMA 2MLBA 5CHFA 2BKRB 2JWZA 3DQVA 2BPSA 2Z59B 4FHKA 1R4MI 5JHAA 2DHZA 4LJOB 3NY5A 2AL6A 5J17A 3JW0X 2KC2A 4IWQA 1U4AA 2IY0B 2LGYA 2MX2A 2KQSA 1H4RA 4JLCA 3W1YA 2D10A 4FULA 3T9LA 2FCMA 4GSWA 4IM0A 3R7RA 3IBEA 5JZEB 1E90A 2NS5A 2BWES 1WX8A 1WMHA 4KDLB 3PHXB 1ZW7A 2AL3A 3N3KB 1Y8RC 4IWPA 3HM3A 2KWVB 2N1VA 2FAZA 2HJ8A 1IYFA 1WGGA 3EFUA 3RYTA 1VD2A 1UGMA 2IY1B 2K39A 4JGHB 5CX3A 2DENB 4B95A 2MW5A 1M94A 3PT2B 4F7ZA 3DVGY 1P98A 3PRMB 3RCZA 3HIZA 3ZIMA 1KLVA 2L76A 2KD0A 4WWPA 3A9JA 3APDA 3H7PA 4MSQB 4W9DA 4G50A 5D7GA 5TR5A 1TBEA 1LQBA 3K9PB 2J7QB 2HE7A 2ASQA 2FCNA 4URKA 2B3AA 3A1QA 1WXSA 3IFWB 4MJSB 2IO3B 3H1UA 2NCNA 1UBQA 3Q3FA 3T8MA 5E6PA 1GG3A 2N9PC 2MQJA 2UWQA 2AWTA 4IC7B 4KIKA 4NJ7A 3UQBA 2M1MA 2DAJA 3DVGX 2A5UA 2GBNA 2J0KA 4FJVB 4G0NB 3OLMD 2L0FA 4GN1A 1XT9B 4RM8A 5CTRC 3OJ4B 3PPAA 4W9HA 1FXTB 3LDZE 1WGDA 3DVNU 3ZTDA 4DWFA 1E7UA 3LJ3A 1E7VA 3D32A 4W9EA 2RGFA 3ZUNA 4CHKA 4I6LB 2LVQA 3SD5A 2DYBA 2BKFA 2GMIC 4TUUA 2ZPYA 4FJYA 3PRPB 4ICVA 1P1AA 3UQAA 2KO3A 1J8CA 2D07B 3X0WA 2D3GA 2KTFA 3VTWA 1WMHB 1WGRA 3RZWC 3ZNGC 3A4RA 4MGYE 2K6QA 3NOBA 2KTRB 4MGKE 4YL8A 5FR6A 1E8WA 2NBUA 2C5LC 1YQBA 4GDKA 4HLEA 3GZNI 4K7UA 4M8MA 1WR6E 2ZZPB 4ZRKA 4DDID 4AOFA 2KQ7A 3PHWB 2G3QB 2KNBA 4PS7A 2MCNB 3RT3B 2KZRA 2DZIA 3QA8A 1GC6A 4HDQA 1WFYA 4DK5A 1OEYJ 4EZJA 3N32A 2ZCCA 3H7PB 4GMVA 3TCAA 2CR5A 1WR1A 1V81A 1L7YA 5D2MB 3DPDA 4LDTB 1E8YA 2W9NA 4TKNA 2RD0A 2R2OA 3TBLD 2JRHA 2V4LA 3WAMA 2WDTB 3QCAA 3NZSA 3B08A 4K81A 3PREA 1WXVA 4JIOU 4W9GA 2KMAA 3R7QA 4NNJB 3DOWA 3PSEB 3NHEB 2M8SA 5DCNA 3NS8A 4A3PA 2IO1B 2O6VB 4TV3A 1TZ1A 2EMTA 1NBFC 1WX7A 1GJZA 3KUZA 2DZJA 3AU4A 2KFKB 1EO6A 4WJNA 4K7WA 4IW0A 2I1KA 4BOSC 4EZLA 4KSLC 1L2NA 1IPGA 2IZVB 1OQYA 2WX0A 3ZNHB 3ZVVA 5E6OA 1UZXB 4HPLB 2KWCA 1WJ6A 2MBBB 2PJHA 3PRZA 4GOCA 4JQWC 4DDGD 4E71A 2L00B 4II2B 3VAWA 2NR2A 1WM2A 2D2QA 2M0XA 5EDSA 4WJQA 4HVBA 3WIMA 2IYDB 1UELA 4KZ0A 3ENEA 4JL9A 1WH3A 3TMPB 3L0WB 2FCQA 2I1JA 1WZ0A 2FCSA 2L3ZA 2C7HA 2PE6B 4K1RB 5AZGA 1A5RA 1UD7A 3EC8A 2BF8B 2HD5B 2KWUB 1T0YA 3PZDA 3RUIB 4II3B 4B9KA 3DBHI 3MTNB 4BBNF 2GBRA 4DHJB 4I6PA 4BKGA 2VRRB 2O2VA 2NVUI 4HCPB 1GUAB 1RFAA 3QWZB 3VDZA 1P0RA 2Y5BB 4EOYA 2RR9A 4FADA 4BVUC 1EF5A 3KYDD 4FHJA 4W9JA 2K8HA 1OEYA 4MH0E 2REXA 2V1YA 3JSVB 5DPWA 4I6NB 3EECA 5J2RA 1E8ZA 2M17A 5D6JB 2FUHB 5AZHA 3APCA 3VQIA 4NAWB 2DX5B 3V6CB 1KJTA 1ZGUB 1WGYA 4EUTA 1J0GA 3QIJA 2LUEA 3A33B 2OOBB 3O65B 3VTVA 2DYOA 1WJUA 3ONSA 4HWIB 2G45B 2MBEA 3SDLC 2KC1A 4KSKC 5CHVC 4F1SA 3OAWA 1SGHA 1V5TA 5LXIB 2KDFB 4FBJB 1NI2A 4KDIC 3A4SC 2MBHA 4B6WA 1R4NI 4N9F4 2NPTA 2KMCA 4DXAB 1WXMA 1WI0A 1WIAA 3AU5A 2ZVNA 3PLUA 4BFRA 1IP9A 1V2YA 5KHOA 4FLHA 1TTNA 1X1MA 4NPNA 1Q5WB 2JZ3B 3QQ8B 1XQQA 5DPSA 3HM6X 4ANXA 2AEHA 1SE9A 1WJ4A 1F9JA 2Z0DB 4NQLB 2N7EA 2LVPA 1E8XA 2CHZA 2JPHA 2KK8A 1RRBA 4ZRIA 2O2VB 4W9CA 4M8NA 1V9JA 4HJKA 5AZFA 1QZEA 3B0AA 1WE6A 2C60A 4P7IA 3ZLZA 2RSUA 2JT4B 3ZDMC 4DHZE 4GDLA 2LXCA 4MELA 2KLCA 4BOZB 3DBSA 4WQOB 3H6NA 2LD9A 4AJYB 4ASWC 3ZNID 5D94A 3MHSD 2XEWA 3OJ3A 2K8CA 2IBIB 5G2NA 2UYZB 1Q1OA 1RLFA 1SIFA 4F8CB 2A4ZA 4DHZB 2ZPNA 2G4DB 2JF5A 2KX0A 5GMVA 3A9JB 3B1LX 1PQSA 2L7RA 3M63B 2GOWA 1LM8B 3KYCD 3A9KA 1P3QU 2XK5A 3A1QB 1KOTA 3HK0A 3UIPB 3QJZA 2KDIA 5C23A 4KIKB 3ZO5B 1WGHA 2MP2A 2G4SA 3X23A 4IUMB 4MM3A 3K9OB 4X57B 2IO0B 4A3OA 4FA6A 2KDBA 4LJPB 4K7SA 4IWOA 4ANUA 2ZEQA 4MDKE 4AP4C 4NQKE 3V6EB 2K25A 4MGZE 2LGXA 2N9XA 2QHOA 2JZZA 3KW5B 4NJ6A 3L54A 3ZRFA 1E5WA 4MGIE 3SU8X 5KHQA 1AARA 4FJZA 2PPHA 4GU2A 5JHBA 4HK2A 4EFOA 3U30A 1WE7A 4WJOA 3TIXA 3RD2A 2JRIB 2KXJA 3NZUA 5HKHA 1V86A 4GDKB 4G11A 1WJNA 4E74A 3U8ZA 2OJRA 4FN2A 3QX1A 3U7DA 2ZVOA 2DZKA 2C7MB 1LXDA 2JXXA 2LI5A 2KLGA 4GB9A 3JYUA 2FIFA 1YD8U 3DDCB 4NY0A 5IAAC 1J19A 3ZTCA 2BWFA 4MJSA 2GBKA 3IG3A 2M4NA 3EHVA 4RM9A 1WXAA 1Z5SB 3A9KB 3W1SA 2FNJB 2WWZA 3H7SA 1LFDA 1GNUA 4AUQC 3VTUA 3R66C 4OVVA 2JY6A 4LDTD 2LZ6A 2D11A 4EKUA 2LWPA 2NBWB 2MP2B 3H9DA 5E6NA 3VH4B 4BKSD 1KM7A 1BT0A 2KVRA 2PE9A 3IVFA 3QK0A 3IHPC 3WAPA 3DBRI 4AJWA 4BKTA 2K8BA 2CHWA 4HXDA 4MEMA 3QC8B 5DPRA 4DBGA 3TL5A 2O6VD 4CO7A 3M95A 3V62A 3VFKA 4E3CA 3V60A 3WANA 3PV1A 1WRDB 2DYMA 2KTRA 4GGQA 3CSTA 2KJHB 2C7NB 5JH5C 4WAAA 3PS6A 3GOEA 2KKCA 1ISNA 2L8JA 2ZCBA 3I3TB 5AEKB 2L0TA 1OGWA 1G6JA 2CHXA 3WA0A 3JVZX 2YLMA 2WYQA 3DBLI 3ZW3A 3VH3B 4CYEA 2V3SA 2C9WB 1WZ3A 1V80A 3P2BA 1YIWA 1YX5B 1JRUA 4IM3A 4ZYNA 1WYWB 1H8CA 3ECIA 2LJ5A 1NDDA 2CKHB 4IG7B 4GIVA 4PYUA 3ALBA 2MWSB 3L17A 2RPQA 1S3SG 4PS3A 1UBIA 1EUVB 3PGEA 2Z0EB 1UH6A 3UF8A 1Q0WB 2ZJDA 1V49A 4DHJD 2N7DA 4MSMB 2IO2B 5BO4B 3MJWA 3S2AA 3ZRCA 1I42A 2PEAA 4BKSA 5LLIA 2LGDA 2LXAA 4HDOA 3UINB 2MBOA 3L13A 3VVWB 3M3JA 3ML9A 4WWOA 2K6DB 3VXWA 1RAXA 2LRUA 4J6IA 4KZCA 2AYOB 2KOXA 2YVCA 2ZNVC 4ANVA 4XC2A 4HPMB 4KVGB 2BYEA 2R2QA 4M0WB 3PTFC 2O6VA 4W9FA 4ZRJA 4RMAA 1WF9A 3UGBB 3VUXA 4ZDVA 2J0JA 1EF1A 2BYFA 2CS4A 1WM3A 2KFKA 3CMMB 3L16A 3PLVA 2GBJA 3RZFA 1OTRB 3ZDTA 2FIDA 2KJRA 4TQ1A 1WY8A
chains in the Genus database with same CATH superfamily
4NJCA 5C1ZA 4LNOA 1SE2A 3AI5A 2WGSA 3PVLA 2QDFA 4G3XB 2BS2B 4W9LA 3UIOB 1C3TA 1XF5L 4WJPA 2WXNA 3CF6E 4AWJA 2N9EB 4WWNA 3L08A 3IT4B 2KDEB 3Q3JA 1HTOA 4BBNC 2N4FA 4HRSA 1OQRA 1VR9A 1FFUA 2CU3A 2L05A 2NBVB 3VUWA 4TQ0A 1ZKHA 4M00A 4MH8A 3RULA 2DWQA 3I57A 4LCDE 1ZXHA 2XBBC 4GXBA 1FRDA 1WX9A 3FKYA 3HHMA 3WALA 3KVFB 2KVZA 1AW7A 2BYVE 3VUYA 1E10A 1CMXB 5TSSA 2GBMA 2JWZA 4FHKA 2V9HA 2W3RA 3NY5A 2AL6A 3EA6A 3JW0X 2KC2A 4C4VA 2L83A 2IY0B 2MX2A 1H4RA 4FULA 4GSWA 2D3CA 2TSSA 1E90A 1MFWA 3B2FA 1TS4A 1J7CA 2LFIA 2KQ4X 2KWVB 1TT5B 2Y3AA 3AE1B 2VH2A 2IY1B 4MT5A 4JGHB 1PDXA 1M94A 3U4EG 1HEZE 3DVGY 1T0SC 5D3DA 3HIZA 3ZJVA 2L76A 2KD0A 2V4IB 5E6JA 3R2IA 1C4AA 1WXSA 1HXYD 1I7HA 4BAXA 4W9HA 1FXTB 3ZTDA 4DWFA 1TS2A 1E7VA 3RN9C 3BVZA 2IDYA 2BKFA 3VR8B 3NG0A 4TUUA 1R4MB 4LNNA 4FJYA 4ICVA 2BT6A 2IGGA 1JCKB 3N9YC 1KF6B 1WMHB 1WGRA 3RZWC 2K6QA 5FR6A 3AEDB 1QQRA 1YQBA 4HLEA 4M8MA 3P1MA 4L1BA 2KQ7A 2KNBA 2KZRA 2DZIA 3QA8A 2BQQA 1CJEA 1K53A 1OEYJ 1WR1A 4YSYB 1XLQA 1L7YA 5EE1A 5HFYA 2E3TA 2BB6A 2RD0A 1WSPA 2V4LA 3V3XA 3J9CA 3RNGC 3B08A 1FNWA 4W9GA 3SFEB 1J7AA 3NS8A 2EKIA 4B0MA 3KUZA 3DHHC 2KFKB 1L2NA 1IPGA 2WX0A 3ZVVA 4HPLB 1T5XD 3Q8EA 2MBBB 3PRZA 4JQWC 2L00B 2D2QA 3NZ3A 4GLSC 3WIMA 4JL9A 3RI7C 1WH3A 3TMPB 2FCQA 2Q5WD 4K1RB 2C7HA 3EC8A 2BF8B 4OZBA 3PZDA 4B9KA 4BBNF 2WLBA 1IUEA 2O2VA 1E6EB 2GB1A 3QWZB 4HPPA 3BYTB 4ZRPA 3U52E 4W9JA 4MH0E 3JSVB 5J2RA 1E8ZA 2FUHB 5AZHA 1WGYA 2WXIA 1XXGA 5I4DA 3A33B 1JRPA 1FXIA 4HWIB 3SDLC 5LNK1 2KT7A 2KC1A 2ZW0A 4OZCA 3OAWA 2QEJC 2KDFB 5IOIA 4B6WA 1R4NI 1WXMA 1WIAA 4M01A 1L5PA 1FNVA 1DGJA 3C8YA 1K52A 1TTNA 1X1MA 2KDMA 3P4PB 5FKAC 3C19A 5DPSA 4ANXA 3T3OA 2YEPB 4YTNB 3BVGA 2WXMA 2CHZA 1AWDA 2JPHA 1I4PA 1RRBA 4W9CA 4M8NA 2C60A 2D5GA 3ZDMC 1QKZA 4BOZB 3DBSA 3AEEB 1K51A 2LD9A 4ASWC 1P7FA 1SJED 1F2RI 2IBIB 4WURA 4F8CB 2R61A 2G4DB 2JF5A 2KX0A 3SFDB 4JE3B 3ZXVA 1P7EA 4LNIA 1P3QU 3MFGA 3QJZA 2QCZA 1IGDA 1DOXA 3ZO5B 2G4SA 3P4SB 3EGRA 4LJPB 4ANUA 4MDKE 4KGSA 1I4HA 2LGXA 2QHOA 2JZZA 1E5WA 3RNFC 5KHQA 3B9JA 3RMKC 4HK2A 3W2DA 2Y5CA 4EFOA 1N63A 3N1ZC 1VZ6A 2JRIB 3Q14C 1EWCA 1C4PA 4US8A 4N59A 3KLSX 4GDKB 1GB4A 1WJNA 3U8ZA 1LGRA 3QX1A 2QIEB 2ZVOA 3GE8C 2C7MB 3CWIA 1XEEA 2JXXA 2LHEA 2INCC 3ZTCA 3IG3A 4RM9A 4N6EB 3A9KB 3W1SA 1YOVB 4AUQC 4OVVA 1FEHA 5BYQA 3TEYA 2NBWB 3H9DA 3IHPC 3WAPA 1GAQB 1V97A 5DPRA 1XCTL 3TL5A 2BS4B 2AQ3B 3WANA 4R3DA 4GGQA 2C7NB 1VZ7A 2KKCA 1ISNA 2L8JA 2ZCBA 3I3TB 3TEWA 1OGWA 1FM0D 3WA0A 3DBLI 3ZW3A 1V80A 1YX5B 4ZYNA 1H8CA 4GIVA 4PS3A 1S3SG 3PGEA 3AV8A 3NS1A 1Q0WB 1ZDVA 3PZ8A 3MJWA 2NTTA 4C56C 1XLPA 5LLIA 2LXAA 4KZCA 1YN4A 4J6IA 5IP4D 2YVCA 4XC2A 2WHIA 4RMAA 3VUXA 3L16A 2PW9A 4A90A 1RFKA 2FIDA 2KJRA 1QOFA 1V5OA 4S0RA 1V1OA 2RDHA 3AULA 1ACCA 2DZMA 1DYQA 4YSZB 3BINA 2NPTB 3BZDB 3M62B 4S17A 2K0PA 1YJ1A 2PKOA 3BY4B 1D5MC 2N1WA 4MACA 3NVYA 3ML8A 2HTHA 2KJ6A 1MG4A 1TYGB 3CSFA 3AB5A 2PMVA 3QHTA 3V61A 4WIPA 4C00A 4US9A 2BB5A 2WXOA 2MSED 1JWUD 1L0XB 3QAQA 2DAFA 3TJPA 3AE4B 1T0RC 3DCGA 4NAWA 1GOZA 4GDLB 3APFA 2ZNVB 2KX3A 3R8BA 1FIQA 2WX1A 1NYQA 2JX5A 3R3MA 4IM2A 4HCNB 5IA7A 3L10B 2JVCA 4OW0A 2K9XA 2E6XA 5DPTA 4EZKA 3SHQA 2WDVB 1NYRA 3KH0A 2MRPA 2XK5B 2LRWA 4W9IA 2LVOA 2MLBA 3Q8AA 2Z59B 1R4MI 5JHAA 3AEBB 1AYFA 2I2YA 1ZOYB 4KKIA 1U4AA 3IXSA 3W1YA 1IBXB 4IM0A 2BWES 2CJNA 3AE3B 2MHJA 3PHXB 2AL3A 4K3BA 3RYTA 4ZHOA 2LJIA 3DHIC 2K39A 2DENB 1MPEA 2JU6X 1JMLA 3PRMB 1E9MA 2INPE 1A70A 1YMHE 1KLVA 3OWEB 1JWSD 5D7GA 1HA5A 5TR5A 3K9PB 2J7QB 2ASQA 1PUTA 2B3AA 2IO3B 2DBYA 3H1UA 2NCNA 1PYWD 3Q3FA 1GG3A 4NJ7A 3Q8FA 2AWTA 4IC7B 3BIID 3UQBA 3DVGX 2WXLA 1ZPSA 5CTRC 3LDZE 5AUIA 1WGDA 3LB8C 2GLSA 1E7UA 3ZUNA 1F77A 4I6LB 1Q10A 4C4VB 2GMIC 2ZPYA 1D5ZC 2BYTA 3Q3NC 4RF1A 3X0WA 2D3GA 2PIAA 3ZNGC 3A4RA 2KTRB 4MGKE 3IT6B 4K3CA 1N61A 3GZNI 4DDID 3BK2A 3AECB 3PHWB 4PS7A 2MCNB 5MPOA 3NUHB 3RPFC 1BXTA 4HDQA 1F2RC 5D3IB 1SF0A 4EZJA 1NI3A 2W9NA 4OVZA 2R2OA 3RFZB 5IO9A 5BMHA 4K81A 3PREA 1WXVA 2LGIA 4JIOU 1FNUA 4NNJB 2Z8LA 3PSEB 3NHEB 5C2TB 5DCNA 2IO1B 2O6VB 1WX7A 4XWTA 2DZJA 4RGMA 1ENFA 4WJNA 4K7WA 3LXFA 4AQ7A 2IZVB 5E6OA 3GP7A 4II2B 2J42A 2NR2A 2HTME 2KWDA 1EU3A 3ENEA 1YN3A 2FCSA 2L3ZA 5AZGA 1A5RA 1UD7A 4KGRA 3KQ4A 4DHJB 4I6PA 2NVUI 1P0RA 4EOYA 4FADA 2QILA 4YTPB 3E56A 2N9KA 2WXFA 4FHJA 5DPWA 4ZRQA 2ZW1A 2G9HD 1FCLA 2M17A 1J0GA 3QIJA 1HTQA 2ICIA 2MEKA 2JQRB 5CHVC 4FBJB 4OZAA 3AEFB 4DXAB 5BYSA 1XO3A 4BFRA 1IP9A 1V2YA 3GB1A 1UUPA 1Q5WB 1OQQA 3ZGZA 2AEHA 4YSXB 3Q3MC 2ACZB 1E8XA 2FBWB 3BWUD 4ZRIA 2L32A 1AN8A 2O2VB 1QILA 3DBHB 3VRBB 2DLBA 1WE6A 4P7IA 2RSUA 2FUG1 2K5PA 1ROEA 1ZP0B 3KWVA 3ZNID 2XEWA 4RFBA 2K8CA 1GPXA 2UYZB 3MJ5A 2A4ZA 4DHZB 1BMLC 4FXCA 5GMVA 5AUKA 3A9JB 3B1LX 2L7RA 4LLGM 3M63B 1LM8B 3KYCD 4YTMB 3VR9B 5HHDG 3SEBA 2NMQA 3A1QB 3HK0A 3UIPB 1KOTA 1I4XA 4KIKB 1JWBD 2MP2A 4IUMB 4X57B 2IO0B 3I5JC 3FC4A 5EE3A 2RMMA 4PT5A 2AQ1B 4AP4C 4P16A 3AE9B 4NJ6A 3ZRFA 1AARA 4FJZA 3E9SA 4GU2A 2WQYB 4C7YA 1UWMA 4WJOA 1RM6C 2EELA 2K22A 1SBBB 3ZXRA 3LYYA 1V86A 3GS2A 3AN1A 2K3UA 1CQVA 2LI5A 4GB9A 1FFVA 1YD8U 3DDCB 1C77A 1MJDA 2BWFA 2WDRB 3AM9A 2RPVA 2OHFA 2GBKA 4JX1C 2M4NA 1GNUA 3Q2AC 4LDTD 2D11A 1UWXA 3BYYB 1KM7A 2PE9A 4LTUA 1MHXA 4DBGA 3QC8B 4CO7A 3M95A 1SIJA 3V62A 3VFKA 1WGKA 1K50A 3Q8BA 3ZQ4A 2KJHB 5JH5C 3O13A 1V1PA 3PS6A 4WAAA 1ET9A 2D3AA 3MC8A 3GE3C 3JVZX 3VH3B 2M56B 4UDUC 4IM3A 1TKEA 2CKHB 2MWSB 3L17A 2X8XX 2RPQA 3OG5A 4HJGE 2BVCA 2Z0EB 1V49A 4MSMB 2IJ0A 2WXHA 4XGAB 2PEAA 4BKSA 1B9RA 4O1NA 3L13A 3VVWB 3VXWA 2K6DB 4ANVA 4M0WB 4W9FA 5IN7A 2QMTA 1KLGD 3MHZA 2KFKA 3CMMB 3RZFA 2JWUA 1FO4A 1VCBA 1WY8A 1S1QB 3ETRA 2BGFA 3EUB2 1OFFA 1LO5D 1GC7A 4W9KA 1GB1A 2EKEC 4YXDB 1YJJA 1NENB 2DNFA 2OEDA 4D2KA 2K1FA 2LASA 3QARA 2KFJA 3AE2B 2KANA 3EFCA 3ABVB 3WAOA 5L95C 2KHWB 5J18A 1VRAB 1HE8A 5H92C 3DWMA 2JUOA 3JSVA 3L4PA 4ANWA 4REZA 4OVUA 1QF6A 5G55A 3N30A 5LXHA 4PS8A 4XZ4A 5GXGB 2MA9B 3DHGC 2I38A 3FAHA 4ICUA 1K8RB 3DVNV 2ON8A 1D3ZA 1NVID 3KUCB 3W1SC 1MG8A 4IOIE 5C3JB 3SR6A 2BKRB 3DQVA 1J7BA 4MM3B 5J17A 4IWQA 1E7PB 4JLCA 2D10A 2FCMA 3R7RA 3IBEA 2JYEA 2PLPA 3V05A 3HVZA 1ZW7A 3N3KB 4IWPA 3HM3A 2FAZA 2HJ8A 1IYFA 1WGGA 3EFUA 2BBCA 5CX3A 2MW5A 3PT2B 1P98A 3RCZA 2LMCA 3ZIMA 1YN5A 3H7PA 4W9DA 4XDCA 2FCNA 1D6EC 4MJSB 3NVWA 2N9PC 2UWQA 4OHJA 3AH7A 2M1MA 2DAJA 2A5UA 2GBNA 4FJVB 4G0NB 4GN1A 3OLMD 1XT9B 3AE6B 1KH0A 3LJ3A 4CHKA 3D32A 2RGFA 2FE8A 2DYBA 2J4XA 1SE3A 3UQAA 2KO3A 4WAFA 2D07B 1YQ3B 4XE0A 3VTWA 5IKCM 2BS3B 4MGYE 5G5HA 3NOBA 4YL8A 1E8WA 3IAS1 4GDKA 2W82A 3AMZA 2ZZPB 4ZRKA 4HROA 4AOFA 3PO0A 2G3QB 1GC6A 4DK5A 1PGBA 2CR5A 3DPDA 4TMAB 2ONQA 4C80A 1Y56A 2WS3B 2JRHA 1B1ZA 4ITKA 3WAMA 3NJTA 2WDTB 5T8IA 3ZYYX 3NZSA 3DOWA 2M8SA 4XDDA 1FRRA 4A3PA 1TKYA 1SSNA 3HVDA 2EMTA 3HUIA 1GJZA 3AU4A 1EO6A 2WP9B 2I1KA 4BOSC 1C79A 4KSLC 1ZDXA 2Y5PA 1UZXB 1WJ6A 4GOCA 4DDGD 4E71A 2JSVX 3TUOA 4HKQA 2M0XA 5EDSA 2IYDB 4KZ0A 2LEKA 5HI1A 2XNAC 4HKZE 1WZ0A 4L23A 1C78A 2PE6B 3Q3OC 4IDIA 2HD5B 2KWUB 1T0YA 1HQRD 3DBHI 3MTNB 2GBRA 2LHDA 2VRRB 2RDBC 2X38A 2Y5BB 4USAA 2RR9A 5BMGA 1EF5A 2K8HA 1OEYA 3FILA 2REXA 2V1YA 3Q69A 4DXGA 3AE8B 2DX5B 2OOBB 2G45B 1TIFA 2PVOD 5EE0A 3VRAB 5LXIB 1SGHA 4P6VF 4KDIC 2MBHA 2NPTA 5H8YE 2ZVNA 3Q6BA 3PLUA 5KHOA 4FLHA 1SEBD 4JWUC 4NPNA 2YEPF 3HM6X 2Z0DB 1WJ4A 1F9JA 3TEZA 1JWMD 2KK8A 4PK1A 1V9JA 4HJKA 1R7SA 1QZEA 4HEA1 1YQ4B 4GDLA 4C7ZA 2LXCA 4KX6B 2KLCA 1EM7A 1BUIC 4AJYB 2W3SA 3B2GA 3OJ3A 5G2NA 4EE2A 2MH7A 1Q1OA 1SIFA 2ZPNA 1N60A 2XK5A 2W55A 2KDIA 5C23A 1WGHA 4N58A 3K9OB 1C9FA 4RGNA 4K7SA 1IBXA 2UU7A 1L0VB 3DBLB 4QAYA 2VZKD 4XWWA 2V3PA 2N9XA 3KW5B 3AE7B 1KTKA 3HRDD 2G1EA 4IKGA 4MGIE 4ARCA 2V3NA 5JHBA 2PVGC 3U30A 1WE7A 3AEAB 1L4DB 3W5VB 1XCQL 1CZPA 4AS1A 4RNAA 3U7DA 2INDC 3UI3A 3JYUA 5IAAC 2XN9C 1JROA 3EHVA 1Z5SB 2QC8A 4RH6A 1LFDA 1DOIA 3R66C 2V0GA 4EKUA 2LZ6A 4ARIA 2LWPA 4WQMA 2MP2B 5BYRA 1IGCA 5E6NA 3VH4B 4BKSD 3QK0A 4AJWA 2K8BA 2CHWA 4HXDA 4MEMA 2KMMA 3MP9A 5BMIA 1C4CA 4H2AA 4E3CA 1L4ZB 3PV1A 1WRDB 2DYMA 2KTRA 3GOEA 1ZE3D 3T3NA 4A8XC 4LNKA 1RYJA 1L6VA 1PGXA 1WWTA 1TY2A 4CYEA 2V3SA 1WZ3A 3P2BA 1YIWA 1JRUA 4NAMA 1WYWB 3ECIA 5FK9C 1JW9D 2LJ5A 1NDDA 2L1AA 3AE5B 1UBIA 1UH6A 4P1BC 5BO4B 2IO2B 1I42A 2LGDA 3UINB 4HDOA 2LGSA 3ML9A 4WWOA 1QT9A 1RAXA 2LRUA 2AYOB 2B76B 3PTFC 2O6VA 2VZKB 4ZRJA 2WDQB 1FD6A 1N62A 1WF9A 2RDGA 4ZDVA 1EF1A 4YT0B 3URYA 3ZDTA 3PLVA 3TEXA 3DBRB 3DWGC 1UF0A 2KYWA 2QSDA 3AXCA 2SAKA 2PTLA 3C0RB 1CK1A 1V1PB 1RWSA 1QLBB 1I4GA 4JWSC 4A20A 3ZKJC 1T6BX 2HJ1A 2WXQA 4XX5A 1ET6A 2J0MA 2EMSA 2GRIA 2SEBD 2N7JA 2KN5A 5FR3A 2L52A 2MJDA 3KUDB 3VHTC 4EEWA 1F0ZA 1Z2MA 3W5UB 1TGZB 1I4QA 4KV2A 1V8CA 3P63A 2MBQA 1P9DU 1ZUD2 2D3BA 2H88B 4PYZA 4LK0M 2CU1A 1I35A 2OJWA 4KGTA 1YX6B 1C1YB 1XD3B 1UNSA 3ZNZB 5L83A 3NVZA 1V6EA 5CHWA 2H89B 2LUMA 2AX5A 4XYCA 4WWMA 3WCQA 1QOBA 4LNFA 5CHFA 2BPSA 2DHZA 4KKJA 4LJOB 2LGYA 2KQSA 4CQNA 3T9LA 1C76A 5JZEB 1YJIA 3GZNB 5JXVA 2WXRA 2NS5A 2WXPA 1WX8A 1PGAA 1WMHA 4KDLB 1Y8RC 2N1VA 1D5XC 1VD2A 1UGMA 2WXKA 4B95A 3ZJTA 4F7ZA 3U2SC 4WWPA 3A9JA 1EU4A 1VDVA 3APDA 4MSQB 4A55A 4G50A 1TBEA 1LQBA 2HE7A 4URKA 3A1QA 3IFWB 2INNE 1TS3A 1UBQA 3T8MA 5E6PA 2MQJA 4KIKA 2J0KA 4RM8A 2L0FA 3OJ4B 3PPAA 4A9AA 3DVNU 4W9EA 2LVQA 3SD5A 3PRPB 1JWAD 1P1AA 3BVMA 1J8CA 2KTFA 4TSSA 2NBUA 2C5LC 3P42A 3W9CB 4K7UA 1WR6E 3RT3B 1KLUD 1WFYA 3TSSA 3N32A 2ZCCA 3H7PB 4GMVA 3TCAA 3P4QB 5G5GA 3U7ZA 3Q8CA 1V81A 4RGOS 1KFYB 2MJEA 5D2MB 2NTSA 4LDTB 1E8YA 4TKNA 4DQOC 3TBLD 1VLBA 1QOAA 3QCAA 2KMAA 1PFDA 3R7QA 1HZ6A 4TV3A 2HDEA 1TZ1A 1STEA 1N6ZA 1NBFC 2KACA 4BZAA 1MI0A 2IPKD 4IW0A 4EZLA 3R2TA 3ZNHB 1OQYA 2J52A 1ZXIA 2KWCA 2PJHA 1HZ5A 3VAWA 1WM2A 4WJQA 4HVBA 1UELA 1TY0A 3L0WB 2I1JA 3RNAC 2GI9A 4RF0A 1N5XA 3RUIB 4II3B 4BKGA 4M02A 1NEKB 4HCPB 4L2YA 1GUAB 1RFAA 5HG2A 3VDZA 1FPYA 2WXJA 4BVUC 1L6UA 3KYDD 4M0WA 4Q2JA 4I6NB 3EECA 2N0SB 5D6JB 3NRZA 3AEGB 3APCA 3VQIA 4NAWB 3V6CB 1KJTA 1ZGUB 4EUTA 2IGDA 2LUEA 3O65B 3VTVA 2DYOA 1WJUA 3ONSA 2MBEA 4J3OD 2WU5B 4KSKC 4F1SA 1TJEA 1V5TA 4B0EA 3MC9A 1NI2A 3IAM1 3A4SC 4ZHPA 4N9F4 1UGJA 3N1XC 2KMCA 1WI0A 2JZPA 1XLNA 3AU5A 3BK1A 1T3QA 1FMAD 3P4RB 4NZLB 4WH4A 2JZ3B 2WU2B 1F1HA 3QQ8B 1XQQA 1SE9A 4NQLB 2N7EA 2LVPA 2W54A 4RCOA 2AQ2B 2QJLA 1D4BA 5AZFA 3B0AA 3ZLZA 1DOYA 2JT4B 4DHZE 4MELA 3FILB 3H8HA 2KN4A 2M19A 4WQOB 3N20C 3RNBC 1MVKA 3H6NA 2KAJA 5D94A 3MHSD 1RLFA 1N5WA 3MC0B 1PQSA 2GOWA 3A9KA 1XLOA 1WRIA 1E0ZA 3X23A 4MM3A 4A3OA 4FA6A 2KDBA 2BTEA 1R4NB 4IWOA 2ZEQA 4NQKE 3V6EB 2K25A 4P1CC 4MGZE 3L54A 1FXAA 4YWGG 3SU8X 1I4RA 1TZOA 2PPHA 1F52A 1QOGA 3TIXA 3RD2A 2KXJA 3NZUA 5HKHA 4G11A 2BW2A 2MJ3A 4E74A 2OJRA 4FN2A 3I9V1 1EWYC 3N1YC 1TS5A 2DZKA 1LXDA 2KLGA 1VJKA 2FIFA 1SB3C 4NY0A 3KWLA 1J19A 4MJSA 3RNCC 1WXAA 2IGHA 2FNJB 2WWZA 3H7SA 4JPSA 1L0YB 3VTUA 3ZJUA 2JY6A 2N9LA 2WXGA 1VZ8A 1BT0A 2KVRA 3IVFA 3NVVA 2J53A 1T0QC 1SE4A 3DBRI 4BKTA 1TKGA 2O6VD 1SJHD 1ESFA 3CIRB 3V60A 1SXTA 3CSTA 4ACFA 5AEKB 2L0TA 1G6JA 2CHXA 4ZOHC 2YLMA 4ZYSA 2WYQA 3I63C 3PZ7A 2JYTA 1FCCC 2C9WB 4A6QA 4IG7B 4PYUA 1MHHE 3ALBA 1WXQA 1EUVB 1JALA 3UF8A 1M4VA 2ZJDA 4DHJD 2N7DA 1YNTE 3S2AA 3ZRCA 2CJOA 3RNEC 2M0AA 2MBOA 2WNMA 3M3JA 4RGTA 5EE9A 4DXFA 2JXTA 2KOXA 2ZNVC 4HPMB 4KVGB 2BYEA 2R2QA 3UGBB 2J0JA 2BYFA 2VH1A 2CS4A 1WM3A 1JQ4A 2GBJA 1OTRB 1KRHA 1WYGA 4TQ1A
chains in the Genus database with same CATH topology
1S1QB 1V5OA 2BGFA 3AXCA 3AULA 1GC7A 3C0RB 4W9KA 5C1ZA 2EKEC 2DZMA 3AI5A 3PVLA 4G3XB 3BINA 2NPTB 3M62B 4A20A 3ZKJC 1YJ1A 4W9LA 3UIOB 1C3TA 4WJPA 4XX5A 2J0MA 2K1FA 2EMSA 3CF6E 4AWJA 2LASA 3BY4B 2N9EB 4WWNA 3L08A 3QARA 2KDEB 1VCBA 2N1WA 3Q3JA 2KFJA 2KN5A 4BBNC 3ML8A 2KANA 2N4FA 2HTHA 3KUDB 2KJ6A 3VHTC 4EEWA 3WAOA 3CSFA 2L05A 5L95C 2KHWB 2NBVB 3QHTA 1Z2MA 3V61A 5J18A 1HE8A 1TGZB 4KV2A 2JUOA 2MSED 3JSVA 3VUWA 3QAQA 2MBQA 2DAFA 4TQ0A 3TJPA 1P9DU 1ZKHA 4ANWA 4OVUA 3DCGA 4NAWA 4PYZA 2CU1A 4GDLB 3APFA 2ZNVB 3RULA 2KX3A 1I35A 4LCDE 5G55A 1YX6B 3N30A 1C1YB 1XD3B 2WX1A 4PS8A 4XZ4A 5LXHA 2MA9B 3R3MA 2XBBC 4IM2A 4GXBA 1WX9A 4HCNB 3ZNZB 3HHMA 3L10B 5IA7A 5L83A 2JVCA 3WALA 1V6EA 4ICUA 5CHWA 1K8RB 3KVFB 3DVNV 1D3ZA 3KUCB 5DPTA 3W1SC 4EZKA 3SHQA 1MG8A 2BYVE 3VUYA 1CMXB 3KH0A 2MRPA 2XK5B 2LRWA 4W9IA 2LVOA 2GBMA 2MLBA 5CHFA 2BKRB 2JWZA 3DQVA 2BPSA 2Z59B 4FHKA 1R4MI 5JHAA 2DHZA 4LJOB 3NY5A 2AL6A 5J17A 3JW0X 2KC2A 4IWQA 1U4AA 2IY0B 2LGYA 2MX2A 2KQSA 1H4RA 4JLCA 3W1YA 2D10A 4FULA 3T9LA 2FCMA 4GSWA 4IM0A 3R7RA 3IBEA 5JZEB 1E90A 2NS5A 2BWES 1WX8A 1WMHA 4KDLB 3PHXB 1ZW7A 2AL3A 3N3KB 1Y8RC 4IWPA 3HM3A 2KWVB 2N1VA 2FAZA 2HJ8A 1IYFA 1WGGA 3EFUA 3RYTA 1VD2A 1UGMA 2IY1B 2K39A 4JGHB 5CX3A 2DENB 4B95A 2MW5A 1M94A 3PT2B 4F7ZA 3DVGY 1P98A 3PRMB 3RCZA 3HIZA 3ZIMA 1KLVA 2L76A 2KD0A 4WWPA 3A9JA 3APDA 3H7PA 4MSQB 4W9DA 4G50A 5D7GA 5TR5A 1TBEA 1LQBA 3K9PB 2J7QB 2HE7A 2ASQA 2FCNA 4URKA 2B3AA 3A1QA 1WXSA 3IFWB 4MJSB 2IO3B 3H1UA 2NCNA 1UBQA 3Q3FA 3T8MA 5E6PA 1GG3A 2N9PC 2MQJA 2UWQA 2AWTA 4IC7B 4KIKA 4NJ7A 3UQBA 2M1MA 2DAJA 3DVGX 2A5UA 2GBNA 2J0KA 4FJVB 4G0NB 3OLMD 2L0FA 4GN1A 1XT9B 4RM8A 5CTRC 3OJ4B 3PPAA 4W9HA 1FXTB 3LDZE 1WGDA 3DVNU 3ZTDA 4DWFA 1E7UA 3LJ3A 1E7VA 3D32A 4W9EA 2RGFA 3ZUNA 4CHKA 4I6LB 2LVQA 3SD5A 2DYBA 2BKFA 2GMIC 4TUUA 2ZPYA 4FJYA 3PRPB 4ICVA 1P1AA 3UQAA 2KO3A 1J8CA 2D07B 3X0WA 2D3GA 2KTFA 3VTWA 1WMHB 1WGRA 3RZWC 3ZNGC 3A4RA 4MGYE 2K6QA 3NOBA 2KTRB 4MGKE 4YL8A 5FR6A 1E8WA 2NBUA 2C5LC 1YQBA 4GDKA 4HLEA 3GZNI 4K7UA 4M8MA 1WR6E 2ZZPB 4ZRKA 4DDID 4AOFA 2KQ7A 3PHWB 2G3QB 2KNBA 4PS7A 2MCNB 3RT3B 2KZRA 2DZIA 3QA8A 1GC6A 4HDQA 1WFYA 4DK5A 1OEYJ 4EZJA 3N32A 2ZCCA 3H7PB 4GMVA 3TCAA 2CR5A 1WR1A 1V81A 1L7YA 5D2MB 3DPDA 4LDTB 1E8YA 2W9NA 4TKNA 2RD0A 2R2OA 3TBLD 2JRHA 2V4LA 3WAMA 2WDTB 3QCAA 3NZSA 3B08A 4K81A 3PREA 1WXVA 4JIOU 4W9GA 2KMAA 3R7QA 4NNJB 3DOWA 3PSEB 3NHEB 2M8SA 5DCNA 3NS8A 4A3PA 2IO1B 2O6VB 4TV3A 1TZ1A 2EMTA 1NBFC 1WX7A 1GJZA 3KUZA 2DZJA 3AU4A 2KFKB 1EO6A 4WJNA 4K7WA 4IW0A 2I1KA 4BOSC 4EZLA 4KSLC 1L2NA 1IPGA 2IZVB 1OQYA 2WX0A 3ZNHB 3ZVVA 5E6OA 1UZXB 4HPLB 2KWCA 1WJ6A 2MBBB 2PJHA 3PRZA 4GOCA 4JQWC 4DDGD 4E71A 2L00B 4II2B 3VAWA 2NR2A 1WM2A 2D2QA 2M0XA 5EDSA 4WJQA 4HVBA 3WIMA 2IYDB 1UELA 4KZ0A 3ENEA 4JL9A 1WH3A 3TMPB 3L0WB 2FCQA 2I1JA 1WZ0A 2FCSA 2L3ZA 2C7HA 2PE6B 4K1RB 5AZGA 1A5RA 1UD7A 3EC8A 2BF8B 2HD5B 2KWUB 1T0YA 3PZDA 3RUIB 4II3B 4B9KA 3DBHI 3MTNB 4BBNF 2GBRA 4DHJB 4I6PA 4BKGA 2VRRB 2O2VA 2NVUI 4HCPB 1GUAB 1RFAA 3QWZB 3VDZA 1P0RA 2Y5BB 4EOYA 2RR9A 4FADA 4BVUC 1EF5A 3KYDD 4FHJA 4W9JA 2K8HA 1OEYA 4MH0E 2REXA 2V1YA 3JSVB 5DPWA 4I6NB 3EECA 5J2RA 1E8ZA 2M17A 5D6JB 2FUHB 5AZHA 3APCA 3VQIA 4NAWB 2DX5B 3V6CB 1KJTA 1ZGUB 1WGYA 4EUTA 1J0GA 3QIJA 2LUEA 3A33B 2OOBB 3O65B 3VTVA 2DYOA 1WJUA 3ONSA 4HWIB 2G45B 2MBEA 3SDLC 2KC1A 4KSKC 5CHVC 4F1SA 3OAWA 1SGHA 1V5TA 5LXIB 2KDFB 4FBJB 1NI2A 4KDIC 3A4SC 2MBHA 4B6WA 1R4NI 4N9F4 2NPTA 2KMCA 4DXAB 1WXMA 1WI0A 1WIAA 3AU5A 2ZVNA 3PLUA 4BFRA 1IP9A 1V2YA 5KHOA 4FLHA 1TTNA 1X1MA 4NPNA 1Q5WB 2JZ3B 3QQ8B 1XQQA 5DPSA 3HM6X 4ANXA 2AEHA 1SE9A 1WJ4A 1F9JA 2Z0DB 4NQLB 2N7EA 2LVPA 1E8XA 2CHZA 2JPHA 2KK8A 1RRBA 4ZRIA 2O2VB 4W9CA 4M8NA 1V9JA 4HJKA 5AZFA 1QZEA 3B0AA 1WE6A 2C60A 4P7IA 3ZLZA 2RSUA 2JT4B 3ZDMC 4DHZE 4GDLA 2LXCA 4MELA 2KLCA 4BOZB 3DBSA 4WQOB 3H6NA 2LD9A 4AJYB 4ASWC 3ZNID 5D94A 3MHSD 2XEWA 3OJ3A 2K8CA 2IBIB 5G2NA 2UYZB 1Q1OA 1RLFA 1SIFA 4F8CB 2A4ZA 4DHZB 2ZPNA 2G4DB 2JF5A 2KX0A 5GMVA 3A9JB 3B1LX 1PQSA 2L7RA 3M63B 2GOWA 1LM8B 3KYCD 3A9KA 1P3QU 2XK5A 3A1QB 1KOTA 3HK0A 3UIPB 3QJZA 2KDIA 5C23A 4KIKB 3ZO5B 1WGHA 2MP2A 2G4SA 3X23A 4IUMB 4MM3A 3K9OB 4X57B 2IO0B 4A3OA 4FA6A 2KDBA 4LJPB 4K7SA 4IWOA 4ANUA 2ZEQA 4MDKE 4AP4C 4NQKE 3V6EB 2K25A 4MGZE 2LGXA 2N9XA 2QHOA 2JZZA 3KW5B 4NJ6A 3L54A 3ZRFA 1E5WA 4MGIE 3SU8X 5KHQA 1AARA 4FJZA 2PPHA 4GU2A 5JHBA 4HK2A 4EFOA 3U30A 1WE7A 4WJOA 3TIXA 3RD2A 2JRIB 2KXJA 3NZUA 5HKHA 1V86A 4GDKB 4G11A 1WJNA 4E74A 3U8ZA 2OJRA 4FN2A 3QX1A 3U7DA 2ZVOA 2DZKA 2C7MB 1LXDA 2JXXA 2LI5A 2KLGA 4GB9A 3JYUA 2FIFA 1YD8U 3DDCB 4NY0A 5IAAC 1J19A 3ZTCA 2BWFA 4MJSA 2GBKA 3IG3A 2M4NA 3EHVA 4RM9A 1WXAA 1Z5SB 3A9KB 3W1SA 2FNJB 2WWZA 3H7SA 1LFDA 1GNUA 4AUQC 3VTUA 3R66C 4OVVA 2JY6A 4LDTD 2LZ6A 2D11A 4EKUA 2LWPA 2NBWB 2MP2B 3H9DA 5E6NA 3VH4B 4BKSD 1KM7A 1BT0A 2KVRA 2PE9A 3IVFA 3QK0A 3IHPC 3WAPA 3DBRI 4AJWA 4BKTA 2K8BA 2CHWA 4HXDA 4MEMA 3QC8B 5DPRA 4DBGA 3TL5A 2O6VD 4CO7A 3M95A 3V62A 3VFKA 4E3CA 3V60A 3WANA 3PV1A 1WRDB 2DYMA 2KTRA 4GGQA 3CSTA 2KJHB 2C7NB 5JH5C 4WAAA 3PS6A 3GOEA 2KKCA 1ISNA 2L8JA 2ZCBA 3I3TB 5AEKB 2L0TA 1OGWA 1G6JA 2CHXA 3WA0A 3JVZX 2YLMA 2WYQA 3DBLI 3ZW3A 3VH3B 4CYEA 2V3SA 2C9WB 1WZ3A 1V80A 3P2BA 1YIWA 1YX5B 1JRUA 4IM3A 4ZYNA 1WYWB 1H8CA 3ECIA 2LJ5A 1NDDA 2CKHB 4IG7B 4GIVA 4PYUA 3ALBA 2MWSB 3L17A 2RPQA 1S3SG 4PS3A 1UBIA 1EUVB 3PGEA 2Z0EB 1UH6A 3UF8A 1Q0WB 2ZJDA 1V49A 4DHJD 2N7DA 4MSMB 2IO2B 5BO4B 3MJWA 3S2AA 3ZRCA 1I42A 2PEAA 4BKSA 5LLIA 2LGDA 2LXAA 4HDOA 3UINB 2MBOA 3L13A 3VVWB 3M3JA 3ML9A 4WWOA 2K6DB 3VXWA 1RAXA 2LRUA 4J6IA 4KZCA 2AYOB 2KOXA 2YVCA 2ZNVC 4ANVA 4XC2A 4HPMB 4KVGB 2BYEA 2R2QA 4M0WB 3PTFC 2O6VA 4W9FA 4ZRJA 4RMAA 1WF9A 3UGBB 3VUXA 4ZDVA 2J0JA 1EF1A 2BYFA 2CS4A 1WM3A 2KFKA 3CMMB 3L16A 3PLVA 2GBJA 3RZFA 1OTRB 3ZDTA 2FIDA 2KJRA 4TQ1A 1WY8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S1Q B;  1V5O A;  2BGF A;  3AXC A;  3AUL A;  1GC7 A;  3C0R B;  4W9K A;  5C1Z A;  2EKE C;  2DZM A;  3AI5 A;  3PVL A;  4G3X B;  3BIN A;  2NPT B;  3M62 B;  4A20 A;  3ZKJ C;  1YJ1 A;  4W9L A;  3UIO B;  1C3T A;  4WJP A;  4XX5 A;  2J0M A;  2K1F A;  2EMS A;  3CF6 E;  4AWJ A;  2LAS A;  3BY4 B;  2N9E B;  4WWN A;  3L08 A;  3QAR A;  2KDE B;  1VCB A;  2N1W A;  3Q3J A;  2KFJ A;  2KN5 A;  4BBN C;  3ML8 A;  2KAN A;  2N4F A;  2HTH A;  3KUD B;  2KJ6 A;  3VHT C;  4EEW A;  3WAO A;  3CSF A;  2L05 A;  5L95 C;  2KHW B;  2NBV B;  3QHT A;  1Z2M A;  3V61 A;  5J18 A;  1HE8 A;  1TGZ B;  4KV2 A;  2JUO A;  2MSE D;  3JSV A;  3VUW A;  3QAQ A;  2MBQ A;  2DAF A;  4TQ0 A;  3TJP A;  1P9D U;  1ZKH A;  4ANW A;  4OVU A;  3DCG A;  4NAW A;  4PYZ A;  2CU1 A;  4GDL B;  3APF A;  2ZNV B;  3RUL A;  2KX3 A;  1I35 A;  4LCD E;  5G55 A;  1YX6 B;  3N30 A;  1C1Y B;  1XD3 B;  2WX1 A;  4PS8 A;  4XZ4 A;  5LXH A;  2MA9 B;  3R3M A;  2XBB C;  4IM2 A;  4GXB A;  1WX9 A;  4HCN B;  3ZNZ B;  3HHM A;  3L10 B;  5IA7 A;  5L83 A;  2JVC A;  3WAL A;  1V6E A;  4ICU A;  5CHW A;  1K8R B;  3KVF B;  3DVN V;  1D3Z A;  3KUC B;  5DPT A;  3W1S C;  4EZK A;  3SHQ A;  1MG8 A;  2BYV E;  3VUY A;  1CMX B;  3KH0 A;  2MRP A;  2XK5 B;  2LRW A;  4W9I A;  2LVO A;  2GBM A;  2MLB A;  5CHF A;  2BKR B;  2JWZ A;  3DQV A;  2BPS A;  2Z59 B;  4FHK A;  1R4M I;  5JHA A;  2DHZ A;  4LJO B;  3NY5 A;  2AL6 A;  5J17 A;  3JW0 X;  2KC2 A;  4IWQ A;  1U4A A;  2IY0 B;  2LGY A;  2MX2 A;  2KQS A;  1H4R A;  4JLC A;  3W1Y A;  2D10 A;  4FUL A;  3T9L A;  2FCM A;  4GSW A;  4IM0 A;  3R7R A;  3IBE A;  5JZE B;  1E90 A;  2NS5 A;  2BWE S;  1WX8 A;  1WMH A;  4KDL B;  3PHX B;  1ZW7 A;  2AL3 A;  3N3K B;  1Y8R C;  4IWP A;  3HM3 A;  2KWV B;  2N1V A;  2FAZ A;  2HJ8 A;  1IYF A;  1WGG A;  3EFU A;  3RYT A;  1VD2 A;  1UGM A;  2IY1 B;  2K39 A;  4JGH B;  5CX3 A;  2DEN B;  4B95 A;  2MW5 A;  1M94 A;  3PT2 B;  4F7Z A;  3DVG Y;  1P98 A;  3PRM B;  3RCZ A;  3HIZ A;  3ZIM A;  1KLV A;  2L76 A;  2KD0 A;  4WWP A;  3A9J A;  3APD A;  3H7P A;  4MSQ B;  4W9D A;  4G50 A;  5D7G A;  5TR5 A;  1TBE A;  1LQB A;  3K9P B;  2J7Q B;  2HE7 A;  2ASQ A;  2FCN A;  4URK A;  2B3A A;  3A1Q A;  1WXS A;  3IFW B;  4MJS B;  2IO3 B;  3H1U A;  2NCN A;  1UBQ A;  3Q3F A;  3T8M A;  5E6P A;  1GG3 A;  2N9P C;  2MQJ A;  2UWQ A;  2AWT A;  4IC7 B;  4KIK A;  4NJ7 A;  3UQB A;  2M1M A;  2DAJ A;  3DVG X;  2A5U A;  2GBN A;  2J0K A;  4FJV B;  4G0N B;  3OLM D;  2L0F A;  4GN1 A;  1XT9 B;  4RM8 A;  5CTR C;  3OJ4 B;  3PPA A;  4W9H A;  1FXT B;  3LDZ E;  1WGD A;  3DVN U;  3ZTD A;  4DWF A;  1E7U A;  3LJ3 A;  1E7V A;  3D32 A;  4W9E A;  2RGF A;  3ZUN A;  4CHK A;  4I6L B;  2LVQ A;  3SD5 A;  2DYB A;  2BKF A;  2GMI C;  4TUU A;  2ZPY A;  4FJY A;  3PRP B;  4ICV A;  1P1A A;  3UQA A;  2KO3 A;  1J8C A;  2D07 B;  3X0W A;  2D3G A;  2KTF A;  3VTW A;  1WMH B;  1WGR A;  3RZW C;  3ZNG C;  3A4R A;  4MGY E;  2K6Q A;  3NOB A;  2KTR B;  4MGK E;  4YL8 A;  5FR6 A;  1E8W A;  2NBU A;  2C5L C;  1YQB A;  4GDK A;  4HLE A;  3GZN I;  4K7U A;  4M8M A;  1WR6 E;  2ZZP B;  4ZRK A;  4DDI D;  4AOF A;  2KQ7 A;  3PHW B;  2G3Q B;  2KNB A;  4PS7 A;  2MCN B;  3RT3 B;  2KZR A;  2DZI A;  3QA8 A;  1GC6 A;  4HDQ A;  1WFY A;  4DK5 A;  1OEY J;  4EZJ A;  3N32 A;  2ZCC A;  3H7P B;  4GMV A;  3TCA A;  2CR5 A;  1WR1 A;  1V81 A;  1L7Y A;  5D2M B;  3DPD A;  4LDT B;  1E8Y A;  2W9N A;  4TKN A;  2RD0 A;  2R2O A;  3TBL D;  2JRH A;  2V4L A;  3WAM A;  2WDT B;  3QCA A;  3NZS A;  3B08 A;  4K81 A;  3PRE A;  1WXV A;  4JIO U;  4W9G A;  2KMA A;  3R7Q A;  4NNJ B;  3DOW A;  3PSE B;  3NHE B;  2M8S A;  5DCN A;  3NS8 A;  4A3P A;  2IO1 B;  2O6V B;  4TV3 A;  1TZ1 A;  2EMT A;  1NBF C;  1WX7 A;  1GJZ A;  3KUZ A;  2DZJ A;  3AU4 A;  2KFK B;  1EO6 A;  4WJN A;  4K7W A;  4IW0 A;  2I1K A;  4BOS C;  4EZL A;  4KSL C;  1L2N A;  1IPG A;  2IZV B;  1OQY A;  2WX0 A;  3ZNH B;  3ZVV A;  5E6O A;  1UZX B;  4HPL B;  2KWC A;  1WJ6 A;  2MBB B;  2PJH A;  3PRZ A;  4GOC A;  4JQW C;  4DDG D;  4E71 A;  2L00 B;  4II2 B;  3VAW A;  2NR2 A;  1WM2 A;  2D2Q A;  2M0X A;  5EDS A;  4WJQ A;  4HVB A;  3WIM A;  2IYD B;  1UEL A;  4KZ0 A;  3ENE A;  4JL9 A;  1WH3 A;  3TMP B;  3L0W B;  2FCQ A;  2I1J A;  1WZ0 A;  2FCS A;  2L3Z A;  2C7H A;  2PE6 B;  4K1R B;  5AZG A;  1A5R A;  1UD7 A;  3EC8 A;  2BF8 B;  2HD5 B;  2KWU B;  1T0Y A;  3PZD A;  3RUI B;  4II3 B;  4B9K A;  3DBH I;  3MTN B;  4BBN F;  2GBR A;  4DHJ B;  4I6P A;  4BKG A;  2VRR B;  2O2V A;  2NVU I;  4HCP B;  1GUA B;  1RFA A;  3QWZ B;  3VDZ A;  1P0R A;  2Y5B B;  4EOY A;  2RR9 A;  4FAD A;  4BVU C;  1EF5 A;  3KYD D;  4FHJ A;  4W9J A;  2K8H A;  1OEY A;  4MH0 E;  2REX A;  2V1Y A;  3JSV B;  5DPW A;  4I6N B;  3EEC A;  5J2R A;  1E8Z A;  2M17 A;  5D6J B;  2FUH B;  5AZH A;  3APC A;  3VQI A;  4NAW B;  2DX5 B;  3V6C B;  1KJT A;  1ZGU B;  1WGY A;  4EUT A;  1J0G A;  3QIJ A;  2LUE A;  3A33 B;  2OOB B;  3O65 B;  3VTV A;  2DYO A;  1WJU A;  3ONS A;  4HWI B;  2G45 B;  2MBE A;  3SDL C;  2KC1 A;  4KSK C;  5CHV C;  4F1S A;  3OAW A;  1SGH A;  1V5T A;  5LXI B;  2KDF B;  4FBJ B;  1NI2 A;  4KDI C;  3A4S C;  2MBH A;  4B6W A;  1R4N I;  4N9F 4;  2NPT A;  2KMC A;  4DXA B;  1WXM A;  1WI0 A;  1WIA A;  3AU5 A;  2ZVN A;  3PLU A;  4BFR A;  1IP9 A;  1V2Y A;  5KHO A;  4FLH A;  1TTN A;  1X1M A;  4NPN A;  1Q5W B;  2JZ3 B;  3QQ8 B;  1XQQ A;  5DPS A;  3HM6 X;  4ANX A;  2AEH A;  1SE9 A;  1WJ4 A;  1F9J A;  2Z0D B;  4NQL B;  2N7E A;  2LVP A;  1E8X A;  2CHZ A;  2JPH A;  2KK8 A;  1RRB A;  4ZRI A;  2O2V B;  4W9C A;  4M8N A;  1V9J A;  4HJK A;  5AZF A;  1QZE A;  3B0A A;  1WE6 A;  2C60 A;  4P7I A;  3ZLZ A;  2RSU A;  2JT4 B;  3ZDM C;  4DHZ E;  4GDL A;  2LXC A;  4MEL A;  2KLC A;  4BOZ B;  3DBS A;  4WQO B;  3H6N A;  2LD9 A;  4AJY B;  4ASW C;  3ZNI D;  5D94 A;  3MHS D;  2XEW A;  3OJ3 A;  2K8C A;  2IBI B;  5G2N A;  2UYZ B;  1Q1O A;  1RLF A;  1SIF A;  4F8C B;  2A4Z A;  4DHZ B;  2ZPN A;  2G4D B;  2JF5 A;  2KX0 A;  5GMV A;  3A9J B;  3B1L X;  1PQS A;  2L7R A;  3M63 B;  2GOW A;  1LM8 B;  3KYC D;  3A9K A;  1P3Q U;  2XK5 A;  3A1Q B;  1KOT A;  3HK0 A;  3UIP B;  3QJZ A;  2KDI A;  5C23 A;  4KIK B;  3ZO5 B;  1WGH A;  2MP2 A;  2G4S A;  3X23 A;  4IUM B;  4MM3 A;  3K9O B;  4X57 B;  2IO0 B;  4A3O A;  4FA6 A;  2KDB A;  4LJP B;  4K7S A;  4IWO A;  4ANU A;  2ZEQ A;  4MDK E;  4AP4 C;  4NQK E;  3V6E B;  2K25 A;  4MGZ E;  2LGX A;  2N9X A;  2QHO A;  2JZZ A;  3KW5 B;  4NJ6 A;  3L54 A;  3ZRF A;  1E5W A;  4MGI E;  3SU8 X;  5KHQ A;  1AAR A;  4FJZ A;  2PPH A;  4GU2 A;  5JHB A;  4HK2 A;  4EFO A;  3U30 A;  1WE7 A;  4WJO A;  3TIX A;  3RD2 A;  2JRI B;  2KXJ A;  3NZU A;  5HKH A;  1V86 A;  4GDK B;  4G11 A;  1WJN A;  4E74 A;  3U8Z A;  2OJR A;  4FN2 A;  3QX1 A;  3U7D A;  2ZVO A;  2DZK A;  2C7M B;  1LXD A;  2JXX A;  2LI5 A;  2KLG A;  4GB9 A;  3JYU A;  2FIF A;  1YD8 U;  3DDC B;  4NY0 A;  5IAA C;  1J19 A;  3ZTC A;  2BWF A;  4MJS A;  2GBK A;  3IG3 A;  2M4N A;  3EHV A;  4RM9 A;  1WXA A;  1Z5S B;  3A9K B;  3W1S A;  2FNJ B;  2WWZ A;  3H7S A;  1LFD A;  1GNU A;  4AUQ C;  3VTU A;  3R66 C;  4OVV A;  2JY6 A;  4LDT D;  2LZ6 A;  2D11 A;  4EKU A;  2LWP A;  2NBW B;  2MP2 B;  3H9D A;  5E6N A;  3VH4 B;  4BKS D;  1KM7 A;  1BT0 A;  2KVR A;  2PE9 A;  3IVF A;  3QK0 A;  3IHP C;  3WAP A;  3DBR I;  4AJW A;  4BKT A;  2K8B A;  2CHW A;  4HXD A;  4MEM A;  3QC8 B;  5DPR A;  4DBG A;  3TL5 A;  2O6V D;  4CO7 A;  3M95 A;  3V62 A;  3VFK A;  4E3C A;  3V60 A;  3WAN A;  3PV1 A;  1WRD B;  2DYM A;  2KTR A;  4GGQ A;  3CST A;  2KJH B;  2C7N B;  5JH5 C;  4WAA A;  3PS6 A;  3GOE A;  2KKC A;  1ISN A;  2L8J A;  2ZCB A;  3I3T B;  5AEK B;  2L0T A;  1OGW A;  1G6J A;  2CHX A;  3WA0 A;  3JVZ X;  2YLM A;  2WYQ A;  3DBL I;  3ZW3 A;  3VH3 B;  4CYE A;  2V3S A;  2C9W B;  1WZ3 A;  1V80 A;  3P2B A;  1YIW A;  1YX5 B;  1JRU A;  4IM3 A;  4ZYN A;  1WYW B;  1H8C A;  3ECI A;  2LJ5 A;  1NDD A;  2CKH B;  4IG7 B;  4GIV A;  4PYU A;  3ALB A;  2MWS B;  3L17 A;  2RPQ A;  1S3S G;  4PS3 A;  1UBI A;  1EUV B;  3PGE A;  2Z0E B;  1UH6 A;  3UF8 A;  1Q0W B;  2ZJD A;  1V49 A;  4DHJ D;  2N7D A;  4MSM B;  2IO2 B;  5BO4 B;  3MJW A;  3S2A A;  3ZRC A;  1I42 A;  2PEA A;  4BKS A;  5LLI A;  2LGD A;  2LXA A;  4HDO A;  3UIN B;  2MBO A;  3L13 A;  3VVW B;  3M3J A;  3ML9 A;  4WWO A;  2K6D B;  3VXW A;  1RAX A;  2LRU A;  4J6I A;  4KZC A;  2AYO B;  2KOX A;  2YVC A;  2ZNV C;  4ANV A;  4XC2 A;  4HPM B;  4KVG B;  2BYE A;  2R2Q A;  4M0W B;  3PTF C;  2O6V A;  4W9F A;  4ZRJ A;  4RMA A;  1WF9 A;  3UGB B;  3VUX A;  4ZDV A;  2J0J A;  1EF1 A;  2BYF A;  2CS4 A;  1WM3 A;  2KFK A;  3CMM B;  3L16 A;  3PLV A;  2GBJ A;  3RZF A;  1OTR B;  3ZDT A;  2FID A;  2KJR A;  4TQ1 A;  1WY8 A; 
#chains in the Genus database with same CATH topology
 4NJC A;  5C1Z A;  4LNO A;  1SE2 A;  3AI5 A;  2WGS A;  3PVL A;  2QDF A;  4G3X B;  2BS2 B;  4W9L A;  3UIO B;  1C3T A;  1XF5 L;  4WJP A;  2WXN A;  3CF6 E;  4AWJ A;  2N9E B;  4WWN A;  3L08 A;  3IT4 B;  2KDE B;  3Q3J A;  1HTO A;  4BBN C;  2N4F A;  4HRS A;  1OQR A;  1VR9 A;  1FFU A;  2CU3 A;  2L05 A;  2NBV B;  3VUW A;  4TQ0 A;  1ZKH A;  4M00 A;  4MH8 A;  3RUL A;  2DWQ A;  3I57 A;  4LCD E;  1ZXH A;  2XBB C;  4GXB A;  1FRD A;  1WX9 A;  3FKY A;  3HHM A;  3WAL A;  3KVF B;  2KVZ A;  1AW7 A;  2BYV E;  3VUY A;  1E10 A;  1CMX B;  5TSS A;  2GBM A;  2JWZ A;  4FHK A;  2V9H A;  2W3R A;  3NY5 A;  2AL6 A;  3EA6 A;  3JW0 X;  2KC2 A;  4C4V A;  2L83 A;  2IY0 B;  2MX2 A;  1H4R A;  4FUL A;  4GSW A;  2D3C A;  2TSS A;  1E90 A;  1MFW A;  3B2F A;  1TS4 A;  1J7C A;  2LFI A;  2KQ4 X;  2KWV B;  1TT5 B;  2Y3A A;  3AE1 B;  2VH2 A;  2IY1 B;  4MT5 A;  4JGH B;  1PDX A;  1M94 A;  3U4E G;  1HEZ E;  3DVG Y;  1T0S C;  5D3D A;  3HIZ A;  3ZJV A;  2L76 A;  2KD0 A;  2V4I B;  5E6J A;  3R2I A;  1C4A A;  1WXS A;  1HXY D;  1I7H A;  4BAX A;  4W9H A;  1FXT B;  3ZTD A;  4DWF A;  1TS2 A;  1E7V A;  3RN9 C;  3BVZ A;  2IDY A;  2BKF A;  3VR8 B;  3NG0 A;  4TUU A;  1R4M B;  4LNN A;  4FJY A;  4ICV A;  2BT6 A;  2IGG A;  1JCK B;  3N9Y C;  1KF6 B;  1WMH B;  1WGR A;  3RZW C;  2K6Q A;  5FR6 A;  3AED B;  1QQR A;  1YQB A;  4HLE A;  4M8M A;  3P1M A;  4L1B A;  2KQ7 A;  2KNB A;  2KZR A;  2DZI A;  3QA8 A;  2BQQ A;  1CJE A;  1K53 A;  1OEY J;  1WR1 A;  4YSY B;  1XLQ A;  1L7Y A;  5EE1 A;  5HFY A;  2E3T A;  2BB6 A;  2RD0 A;  1WSP A;  2V4L A;  3V3X A;  3J9C A;  3RNG C;  3B08 A;  1FNW A;  4W9G A;  3SFE B;  1J7A A;  3NS8 A;  2EKI A;  4B0M A;  3KUZ A;  3DHH C;  2KFK B;  1L2N A;  1IPG A;  2WX0 A;  3ZVV A;  4HPL B;  1T5X D;  3Q8E A;  2MBB B;  3PRZ A;  4JQW C;  2L00 B;  2D2Q A;  3NZ3 A;  4GLS C;  3WIM A;  4JL9 A;  3RI7 C;  1WH3 A;  3TMP B;  2FCQ A;  2Q5W D;  4K1R B;  2C7H A;  3EC8 A;  2BF8 B;  4OZB A;  3PZD A;  4B9K A;  4BBN F;  2WLB A;  1IUE A;  2O2V A;  1E6E B;  2GB1 A;  3QWZ B;  4HPP A;  3BYT B;  4ZRP A;  3U52 E;  4W9J A;  4MH0 E;  3JSV B;  5J2R A;  1E8Z A;  2FUH B;  5AZH A;  1WGY A;  2WXI A;  1XXG A;  5I4D A;  3A33 B;  1JRP A;  1FXI A;  4HWI B;  3SDL C;  5LNK 1;  2KT7 A;  2KC1 A;  2ZW0 A;  4OZC A;  3OAW A;  2QEJ C;  2KDF B;  5IOI A;  4B6W A;  1R4N I;  1WXM A;  1WIA A;  4M01 A;  1L5P A;  1FNV A;  1DGJ A;  3C8Y A;  1K52 A;  1TTN A;  1X1M A;  2KDM A;  3P4P B;  5FKA C;  3C19 A;  5DPS A;  4ANX A;  3T3O A;  2YEP B;  4YTN B;  3BVG A;  2WXM A;  2CHZ A;  1AWD A;  2JPH A;  1I4P A;  1RRB A;  4W9C A;  4M8N A;  2C60 A;  2D5G A;  3ZDM C;  1QKZ A;  4BOZ B;  3DBS A;  3AEE B;  1K51 A;  2LD9 A;  4ASW C;  1P7F A;  1SJE D;  1F2R I;  2IBI B;  4WUR A;  4F8C B;  2R61 A;  2G4D B;  2JF5 A;  2KX0 A;  3SFD B;  4JE3 B;  3ZXV A;  1P7E A;  4LNI A;  1P3Q U;  3MFG A;  3QJZ A;  2QCZ A;  1IGD A;  1DOX A;  3ZO5 B;  2G4S A;  3P4S B;  3EGR A;  4LJP B;  4ANU A;  4MDK E;  4KGS A;  1I4H A;  2LGX A;  2QHO A;  2JZZ A;  1E5W A;  3RNF C;  5KHQ A;  3B9J A;  3RMK C;  4HK2 A;  3W2D A;  2Y5C A;  4EFO A;  1N63 A;  3N1Z C;  1VZ6 A;  2JRI B;  3Q14 C;  1EWC A;  1C4P A;  4US8 A;  4N59 A;  3KLS X;  4GDK B;  1GB4 A;  1WJN A;  3U8Z A;  1LGR A;  3QX1 A;  2QIE B;  2ZVO A;  3GE8 C;  2C7M B;  3CWI A;  1XEE A;  2JXX A;  2LHE A;  2INC C;  3ZTC A;  3IG3 A;  4RM9 A;  4N6E B;  3A9K B;  3W1S A;  1YOV B;  4AUQ C;  4OVV A;  1FEH A;  5BYQ A;  3TEY A;  2NBW B;  3H9D A;  3IHP C;  3WAP A;  1GAQ B;  1V97 A;  5DPR A;  1XCT L;  3TL5 A;  2BS4 B;  2AQ3 B;  3WAN A;  4R3D A;  4GGQ A;  2C7N B;  1VZ7 A;  2KKC A;  1ISN A;  2L8J A;  2ZCB A;  3I3T B;  3TEW A;  1OGW A;  1FM0 D;  3WA0 A;  3DBL I;  3ZW3 A;  1V80 A;  1YX5 B;  4ZYN A;  1H8C A;  4GIV A;  4PS3 A;  1S3S G;  3PGE A;  3AV8 A;  3NS1 A;  1Q0W B;  1ZDV A;  3PZ8 A;  3MJW A;  2NTT A;  4C56 C;  1XLP A;  5LLI A;  2LXA A;  4KZC A;  1YN4 A;  4J6I A;  5IP4 D;  2YVC A;  4XC2 A;  2WHI A;  4RMA A;  3VUX A;  3L16 A;  2PW9 A;  4A90 A;  1RFK A;  2FID A;  2KJR A;  1QOF A;  1V5O A;  4S0R A;  1V1O A;  2RDH A;  3AUL A;  1ACC A;  2DZM A;  1DYQ A;  4YSZ B;  3BIN A;  2NPT B;  3BZD B;  3M62 B;  4S17 A;  2K0P A;  1YJ1 A;  2PKO A;  3BY4 B;  1D5M C;  2N1W A;  4MAC A;  3NVY A;  3ML8 A;  2HTH A;  2KJ6 A;  1MG4 A;  1TYG B;  3CSF A;  3AB5 A;  2PMV A;  3QHT A;  3V61 A;  4WIP A;  4C00 A;  4US9 A;  2BB5 A;  2WXO A;  2MSE D;  1JWU D;  1L0X B;  3QAQ A;  2DAF A;  3TJP A;  3AE4 B;  1T0R C;  3DCG A;  4NAW A;  1GOZ A;  4GDL B;  3APF A;  2ZNV B;  2KX3 A;  3R8B A;  1FIQ A;  2WX1 A;  1NYQ A;  2JX5 A;  3R3M A;  4IM2 A;  4HCN B;  5IA7 A;  3L10 B;  2JVC A;  4OW0 A;  2K9X A;  2E6X A;  5DPT A;  4EZK A;  3SHQ A;  2WDV B;  1NYR A;  3KH0 A;  2MRP A;  2XK5 B;  2LRW A;  4W9I A;  2LVO A;  2MLB A;  3Q8A A;  2Z59 B;  1R4M I;  5JHA A;  3AEB B;  1AYF A;  2I2Y A;  1ZOY B;  4KKI A;  1U4A A;  3IXS A;  3W1Y A;  1IBX B;  4IM0 A;  2BWE S;  2CJN A;  3AE3 B;  2MHJ A;  3PHX B;  2AL3 A;  4K3B A;  3RYT A;  4ZHO A;  2LJI A;  3DHI C;  2K39 A;  2DEN B;  1MPE A;  2JU6 X;  1JML A;  3PRM B;  1E9M A;  2INP E;  1A70 A;  1YMH E;  1KLV A;  3OWE B;  1JWS D;  5D7G A;  1HA5 A;  5TR5 A;  3K9P B;  2J7Q B;  2ASQ A;  1PUT A;  2B3A A;  2IO3 B;  2DBY A;  3H1U A;  2NCN A;  1PYW D;  3Q3F A;  1GG3 A;  4NJ7 A;  3Q8F A;  2AWT A;  4IC7 B;  3BII D;  3UQB A;  3DVG X;  2WXL A;  1ZPS A;  5CTR C;  3LDZ E;  5AUI A;  1WGD A;  3LB8 C;  2GLS A;  1E7U A;  3ZUN A;  1F77 A;  4I6L B;  1Q10 A;  4C4V B;  2GMI C;  2ZPY A;  1D5Z C;  2BYT A;  3Q3N C;  4RF1 A;  3X0W A;  2D3G A;  2PIA A;  3ZNG C;  3A4R A;  2KTR B;  4MGK E;  3IT6 B;  4K3C A;  1N61 A;  3GZN I;  4DDI D;  3BK2 A;  3AEC B;  3PHW B;  4PS7 A;  2MCN B;  5MPO A;  3NUH B;  3RPF C;  1BXT A;  4HDQ A;  1F2R C;  5D3I B;  1SF0 A;  4EZJ A;  1NI3 A;  2W9N A;  4OVZ A;  2R2O A;  3RFZ B;  5IO9 A;  5BMH A;  4K81 A;  3PRE A;  1WXV A;  2LGI A;  4JIO U;  1FNU A;  4NNJ B;  2Z8L A;  3PSE B;  3NHE B;  5C2T B;  5DCN A;  2IO1 B;  2O6V B;  1WX7 A;  4XWT A;  2DZJ A;  4RGM A;  1ENF A;  4WJN A;  4K7W A;  3LXF A;  4AQ7 A;  2IZV B;  5E6O A;  3GP7 A;  4II2 B;  2J42 A;  2NR2 A;  2HTM E;  2KWD A;  1EU3 A;  3ENE A;  1YN3 A;  2FCS A;  2L3Z A;  5AZG A;  1A5R A;  1UD7 A;  4KGR A;  3KQ4 A;  4DHJ B;  4I6P A;  2NVU I;  1P0R A;  4EOY A;  4FAD A;  2QIL A;  4YTP B;  3E56 A;  2N9K A;  2WXF A;  4FHJ A;  5DPW A;  4ZRQ A;  2ZW1 A;  2G9H D;  1FCL A;  2M17 A;  1J0G A;  3QIJ A;  1HTQ A;  2ICI A;  2MEK A;  2JQR B;  5CHV C;  4FBJ B;  4OZA A;  3AEF B;  4DXA B;  5BYS A;  1XO3 A;  4BFR A;  1IP9 A;  1V2Y A;  3GB1 A;  1UUP A;  1Q5W B;  1OQQ A;  3ZGZ A;  2AEH A;  4YSX B;  3Q3M C;  2ACZ B;  1E8X A;  2FBW B;  3BWU D;  4ZRI A;  2L32 A;  1AN8 A;  2O2V B;  1QIL A;  3DBH B;  3VRB B;  2DLB A;  1WE6 A;  4P7I A;  2RSU A;  2FUG 1;  2K5P A;  1ROE A;  1ZP0 B;  3KWV A;  3ZNI D;  2XEW A;  4RFB A;  2K8C A;  1GPX A;  2UYZ B;  3MJ5 A;  2A4Z A;  4DHZ B;  1BML C;  4FXC A;  5GMV A;  5AUK A;  3A9J B;  3B1L X;  2L7R A;  4LLG M;  3M63 B;  1LM8 B;  3KYC D;  4YTM B;  3VR9 B;  5HHD G;  3SEB A;  2NMQ A;  3A1Q B;  3HK0 A;  3UIP B;  1KOT A;  1I4X A;  4KIK B;  1JWB D;  2MP2 A;  4IUM B;  4X57 B;  2IO0 B;  3I5J C;  3FC4 A;  5EE3 A;  2RMM A;  4PT5 A;  2AQ1 B;  4AP4 C;  4P16 A;  3AE9 B;  4NJ6 A;  3ZRF A;  1AAR A;  4FJZ A;  3E9S A;  4GU2 A;  2WQY B;  4C7Y A;  1UWM A;  4WJO A;  1RM6 C;  2EEL A;  2K22 A;  1SBB B;  3ZXR A;  3LYY A;  1V86 A;  3GS2 A;  3AN1 A;  2K3U A;  1CQV A;  2LI5 A;  4GB9 A;  1FFV A;  1YD8 U;  3DDC B;  1C77 A;  1MJD A;  2BWF A;  2WDR B;  3AM9 A;  2RPV A;  2OHF A;  2GBK A;  4JX1 C;  2M4N A;  1GNU A;  3Q2A C;  4LDT D;  2D11 A;  1UWX A;  3BYY B;  1KM7 A;  2PE9 A;  4LTU A;  1MHX A;  4DBG A;  3QC8 B;  4CO7 A;  3M95 A;  1SIJ A;  3V62 A;  3VFK A;  1WGK A;  1K50 A;  3Q8B A;  3ZQ4 A;  2KJH B;  5JH5 C;  3O13 A;  1V1P A;  3PS6 A;  4WAA A;  1ET9 A;  2D3A A;  3MC8 A;  3GE3 C;  3JVZ X;  3VH3 B;  2M56 B;  4UDU C;  4IM3 A;  1TKE A;  2CKH B;  2MWS B;  3L17 A;  2X8X X;  2RPQ A;  3OG5 A;  4HJG E;  2BVC A;  2Z0E B;  1V49 A;  4MSM B;  2IJ0 A;  2WXH A;  4XGA B;  2PEA A;  4BKS A;  1B9R A;  4O1N A;  3L13 A;  3VVW B;  3VXW A;  2K6D B;  4ANV A;  4M0W B;  4W9F A;  5IN7 A;  2QMT A;  1KLG D;  3MHZ A;  2KFK A;  3CMM B;  3RZF A;  2JWU A;  1FO4 A;  1VCB A;  1WY8 A;  1S1Q B;  3ETR A;  2BGF A;  3EUB 2;  1OFF A;  1LO5 D;  1GC7 A;  4W9K A;  1GB1 A;  2EKE C;  4YXD B;  1YJJ A;  1NEN B;  2DNF A;  2OED A;  4D2K A;  2K1F A;  2LAS A;  3QAR A;  2KFJ A;  3AE2 B;  2KAN A;  3EFC A;  3ABV B;  3WAO A;  5L95 C;  2KHW B;  5J18 A;  1VRA B;  1HE8 A;  5H92 C;  3DWM A;  2JUO A;  3JSV A;  3L4P A;  4ANW A;  4REZ A;  4OVU A;  1QF6 A;  5G55 A;  3N30 A;  5LXH A;  4PS8 A;  4XZ4 A;  5GXG B;  2MA9 B;  3DHG C;  2I38 A;  3FAH A;  4ICU A;  1K8R B;  3DVN V;  2ON8 A;  1D3Z A;  1NVI D;  3KUC B;  3W1S C;  1MG8 A;  4IOI E;  5C3J B;  3SR6 A;  2BKR B;  3DQV A;  1J7B A;  4MM3 B;  5J17 A;  4IWQ A;  1E7P B;  4JLC A;  2D10 A;  2FCM A;  3R7R A;  3IBE A;  2JYE A;  2PLP A;  3V05 A;  3HVZ A;  1ZW7 A;  3N3K B;  4IWP A;  3HM3 A;  2FAZ A;  2HJ8 A;  1IYF A;  1WGG A;  3EFU A;  2BBC A;  5CX3 A;  2MW5 A;  3PT2 B;  1P98 A;  3RCZ A;  2LMC A;  3ZIM A;  1YN5 A;  3H7P A;  4W9D A;  4XDC A;  2FCN A;  1D6E C;  4MJS B;  3NVW A;  2N9P C;  2UWQ A;  4OHJ A;  3AH7 A;  2M1M A;  2DAJ A;  2A5U A;  2GBN A;  4FJV B;  4G0N B;  4GN1 A;  3OLM D;  1XT9 B;  3AE6 B;  1KH0 A;  3LJ3 A;  4CHK A;  3D32 A;  2RGF A;  2FE8 A;  2DYB A;  2J4X A;  1SE3 A;  3UQA A;  2KO3 A;  4WAF A;  2D07 B;  1YQ3 B;  4XE0 A;  3VTW A;  5IKC M;  2BS3 B;  4MGY E;  5G5H A;  3NOB A;  4YL8 A;  1E8W A;  3IAS 1;  4GDK A;  2W82 A;  3AMZ A;  2ZZP B;  4ZRK A;  4HRO A;  4AOF A;  3PO0 A;  2G3Q B;  1GC6 A;  4DK5 A;  1PGB A;  2CR5 A;  3DPD A;  4TMA B;  2ONQ A;  4C80 A;  1Y56 A;  2WS3 B;  2JRH A;  1B1Z A;  4ITK A;  3WAM A;  3NJT A;  2WDT B;  5T8I A;  3ZYY X;  3NZS A;  3DOW A;  2M8S A;  4XDD A;  1FRR A;  4A3P A;  1TKY A;  1SSN A;  3HVD A;  2EMT A;  3HUI A;  1GJZ A;  3AU4 A;  1EO6 A;  2WP9 B;  2I1K A;  4BOS C;  1C79 A;  4KSL C;  1ZDX A;  2Y5P A;  1UZX B;  1WJ6 A;  4GOC A;  4DDG D;  4E71 A;  2JSV X;  3TUO A;  4HKQ A;  2M0X A;  5EDS A;  2IYD B;  4KZ0 A;  2LEK A;  5HI1 A;  2XNA C;  4HKZ E;  1WZ0 A;  4L23 A;  1C78 A;  2PE6 B;  3Q3O C;  4IDI A;  2HD5 B;  2KWU B;  1T0Y A;  1HQR D;  3DBH I;  3MTN B;  2GBR A;  2LHD A;  2VRR B;  2RDB C;  2X38 A;  2Y5B B;  4USA A;  2RR9 A;  5BMG A;  1EF5 A;  2K8H A;  1OEY A;  3FIL A;  2REX A;  2V1Y A;  3Q69 A;  4DXG A;  3AE8 B;  2DX5 B;  2OOB B;  2G45 B;  1TIF A;  2PVO D;  5EE0 A;  3VRA B;  5LXI B;  1SGH A;  4P6V F;  4KDI C;  2MBH A;  2NPT A;  5H8Y E;  2ZVN A;  3Q6B A;  3PLU A;  5KHO A;  4FLH A;  1SEB D;  4JWU C;  4NPN A;  2YEP F;  3HM6 X;  2Z0D B;  1WJ4 A;  1F9J A;  3TEZ A;  1JWM D;  2KK8 A;  4PK1 A;  1V9J A;  4HJK A;  1R7S A;  1QZE A;  4HEA 1;  1YQ4 B;  4GDL A;  4C7Z A;  2LXC A;  4KX6 B;  2KLC A;  1EM7 A;  1BUI C;  4AJY B;  2W3S A;  3B2G A;  3OJ3 A;  5G2N A;  4EE2 A;  2MH7 A;  1Q1O A;  1SIF A;  2ZPN A;  1N60 A;  2XK5 A;  2W55 A;  2KDI A;  5C23 A;  1WGH A;  4N58 A;  3K9O B;  1C9F A;  4RGN A;  4K7S A;  1IBX A;  2UU7 A;  1L0V B;  3DBL B;  4QAY A;  2VZK D;  4XWW A;  2V3P A;  2N9X A;  3KW5 B;  3AE7 B;  1KTK A;  3HRD D;  2G1E A;  4IKG A;  4MGI E;  4ARC A;  2V3N A;  5JHB A;  2PVG C;  3U30 A;  1WE7 A;  3AEA B;  1L4D B;  3W5V B;  1XCQ L;  1CZP A;  4AS1 A;  4RNA A;  3U7D A;  2IND C;  3UI3 A;  3JYU A;  5IAA C;  2XN9 C;  1JRO A;  3EHV A;  1Z5S B;  2QC8 A;  4RH6 A;  1LFD A;  1DOI A;  3R66 C;  2V0G A;  4EKU A;  2LZ6 A;  4ARI A;  2LWP A;  4WQM A;  2MP2 B;  5BYR A;  1IGC A;  5E6N A;  3VH4 B;  4BKS D;  3QK0 A;  4AJW A;  2K8B A;  2CHW A;  4HXD A;  4MEM A;  2KMM A;  3MP9 A;  5BMI A;  1C4C A;  4H2A A;  4E3C A;  1L4Z B;  3PV1 A;  1WRD B;  2DYM A;  2KTR A;  3GOE A;  1ZE3 D;  3T3N A;  4A8X C;  4LNK A;  1RYJ A;  1L6V A;  1PGX A;  1WWT A;  1TY2 A;  4CYE A;  2V3S A;  1WZ3 A;  3P2B A;  1YIW A;  1JRU A;  4NAM A;  1WYW B;  3ECI A;  5FK9 C;  1JW9 D;  2LJ5 A;  1NDD A;  2L1A A;  3AE5 B;  1UBI A;  1UH6 A;  4P1B C;  5BO4 B;  2IO2 B;  1I42 A;  2LGD A;  3UIN B;  4HDO A;  2LGS A;  3ML9 A;  4WWO A;  1QT9 A;  1RAX A;  2LRU A;  2AYO B;  2B76 B;  3PTF C;  2O6V A;  2VZK B;  4ZRJ A;  2WDQ B;  1FD6 A;  1N62 A;  1WF9 A;  2RDG A;  4ZDV A;  1EF1 A;  4YT0 B;  3URY A;  3ZDT A;  3PLV A;  3TEX A;  3DBR B;  3DWG C;  1UF0 A;  2KYW A;  2QSD A;  3AXC A;  2SAK A;  2PTL A;  3C0R B;  1CK1 A;  1V1P B;  1RWS A;  1QLB B;  1I4G A;  4JWS C;  4A20 A;  3ZKJ C;  1T6B X;  2HJ1 A;  2WXQ A;  4XX5 A;  1ET6 A;  2J0M A;  2EMS A;  2GRI A;  2SEB D;  2N7J A;  2KN5 A;  5FR3 A;  2L52 A;  2MJD A;  3KUD B;  3VHT C;  4EEW A;  1F0Z A;  1Z2M A;  3W5U B;  1TGZ B;  1I4Q A;  4KV2 A;  1V8C A;  3P63 A;  2MBQ A;  1P9D U;  1ZUD 2;  2D3B A;  2H88 B;  4PYZ A;  4LK0 M;  2CU1 A;  1I35 A;  2OJW A;  4KGT A;  1YX6 B;  1C1Y B;  1XD3 B;  1UNS A;  3ZNZ B;  5L83 A;  3NVZ A;  1V6E A;  5CHW A;  2H89 B;  2LUM A;  2AX5 A;  4XYC A;  4WWM A;  3WCQ A;  1QOB A;  4LNF A;  5CHF A;  2BPS A;  2DHZ A;  4KKJ A;  4LJO B;  2LGY A;  2KQS A;  4CQN A;  3T9L A;  1C76 A;  5JZE B;  1YJI A;  3GZN B;  5JXV A;  2WXR A;  2NS5 A;  2WXP A;  1WX8 A;  1PGA A;  1WMH A;  4KDL B;  1Y8R C;  2N1V A;  1D5X C;  1VD2 A;  1UGM A;  2WXK A;  4B95 A;  3ZJT A;  4F7Z A;  3U2S C;  4WWP A;  3A9J A;  1EU4 A;  1VDV A;  3APD A;  4MSQ B;  4A55 A;  4G50 A;  1TBE A;  1LQB A;  2HE7 A;  4URK A;  3A1Q A;  3IFW B;  2INN E;  1TS3 A;  1UBQ A;  3T8M A;  5E6P A;  2MQJ A;  4KIK A;  2J0K A;  4RM8 A;  2L0F A;  3OJ4 B;  3PPA A;  4A9A A;  3DVN U;  4W9E A;  2LVQ A;  3SD5 A;  3PRP B;  1JWA D;  1P1A A;  3BVM A;  1J8C A;  2KTF A;  4TSS A;  2NBU A;  2C5L C;  3P42 A;  3W9C B;  4K7U A;  1WR6 E;  3RT3 B;  1KLU D;  1WFY A;  3TSS A;  3N32 A;  2ZCC A;  3H7P B;  4GMV A;  3TCA A;  3P4Q B;  5G5G A;  3U7Z A;  3Q8C A;  1V81 A;  4RGO S;  1KFY B;  2MJE A;  5D2M B;  2NTS A;  4LDT B;  1E8Y A;  4TKN A;  4DQO C;  3TBL D;  1VLB A;  1QOA A;  3QCA A;  2KMA A;  1PFD A;  3R7Q A;  1HZ6 A;  4TV3 A;  2HDE A;  1TZ1 A;  1STE A;  1N6Z A;  1NBF C;  2KAC A;  4BZA A;  1MI0 A;  2IPK D;  4IW0 A;  4EZL A;  3R2T A;  3ZNH B;  1OQY A;  2J52 A;  1ZXI A;  2KWC A;  2PJH A;  1HZ5 A;  3VAW A;  1WM2 A;  4WJQ A;  4HVB A;  1UEL A;  1TY0 A;  3L0W B;  2I1J A;  3RNA C;  2GI9 A;  4RF0 A;  1N5X A;  3RUI B;  4II3 B;  4BKG A;  4M02 A;  1NEK B;  4HCP B;  4L2Y A;  1GUA B;  1RFA A;  5HG2 A;  3VDZ A;  1FPY A;  2WXJ A;  4BVU C;  1L6U A;  3KYD D;  4M0W A;  4Q2J A;  4I6N B;  3EEC A;  2N0S B;  5D6J B;  3NRZ A;  3AEG B;  3APC A;  3VQI A;  4NAW B;  3V6C B;  1KJT A;  1ZGU B;  4EUT A;  2IGD A;  2LUE A;  3O65 B;  3VTV A;  2DYO A;  1WJU A;  3ONS A;  2MBE A;  4J3O D;  2WU5 B;  4KSK C;  4F1S A;  1TJE A;  1V5T A;  4B0E A;  3MC9 A;  1NI2 A;  3IAM 1;  3A4S C;  4ZHP A;  4N9F 4;  1UGJ A;  3N1X C;  2KMC A;  1WI0 A;  2JZP A;  1XLN A;  3AU5 A;  3BK1 A;  1T3Q A;  1FMA D;  3P4R B;  4NZL B;  4WH4 A;  2JZ3 B;  2WU2 B;  1F1H A;  3QQ8 B;  1XQQ A;  1SE9 A;  4NQL B;  2N7E A;  2LVP A;  2W54 A;  4RCO A;  2AQ2 B;  2QJL A;  1D4B A;  5AZF A;  3B0A A;  3ZLZ A;  1DOY A;  2JT4 B;  4DHZ E;  4MEL A;  3FIL B;  3H8H A;  2KN4 A;  2M19 A;  4WQO B;  3N20 C;  3RNB C;  1MVK A;  3H6N A;  2KAJ A;  5D94 A;  3MHS D;  1RLF A;  1N5W A;  3MC0 B;  1PQS A;  2GOW A;  3A9K A;  1XLO A;  1WRI A;  1E0Z A;  3X23 A;  4MM3 A;  4A3O A;  4FA6 A;  2KDB A;  2BTE A;  1R4N B;  4IWO A;  2ZEQ A;  4NQK E;  3V6E B;  2K25 A;  4P1C C;  4MGZ E;  3L54 A;  1FXA A;  4YWG G;  3SU8 X;  1I4R A;  1TZO A;  2PPH A;  1F52 A;  1QOG A;  3TIX A;  3RD2 A;  2KXJ A;  3NZU A;  5HKH A;  4G11 A;  2BW2 A;  2MJ3 A;  4E74 A;  2OJR A;  4FN2 A;  3I9V 1;  1EWY C;  3N1Y C;  1TS5 A;  2DZK A;  1LXD A;  2KLG A;  1VJK A;  2FIF A;  1SB3 C;  4NY0 A;  3KWL A;  1J19 A;  4MJS A;  3RNC C;  1WXA A;  2IGH A;  2FNJ B;  2WWZ A;  3H7S A;  4JPS A;  1L0Y B;  3VTU A;  3ZJU A;  2JY6 A;  2N9L A;  2WXG A;  1VZ8 A;  1BT0 A;  2KVR A;  3IVF A;  3NVV A;  2J53 A;  1T0Q C;  1SE4 A;  3DBR I;  4BKT A;  1TKG A;  2O6V D;  1SJH D;  1ESF A;  3CIR B;  3V60 A;  1SXT A;  3CST A;  4ACF A;  5AEK B;  2L0T A;  1G6J A;  2CHX A;  4ZOH C;  2YLM A;  4ZYS A;  2WYQ A;  3I63 C;  3PZ7 A;  2JYT A;  1FCC C;  2C9W B;  4A6Q A;  4IG7 B;  4PYU A;  1MHH E;  3ALB A;  1WXQ A;  1EUV B;  1JAL A;  3UF8 A;  1M4V A;  2ZJD A;  4DHJ D;  2N7D A;  1YNT E;  3S2A A;  3ZRC A;  2CJO A;  3RNE C;  2M0A A;  2MBO A;  2WNM A;  3M3J A;  4RGT A;  5EE9 A;  4DXF A;  2JXT A;  2KOX A;  2ZNV C;  4HPM B;  4KVG B;  2BYE A;  2R2Q A;  3UGB B;  2J0J A;  2BYF A;  2VH1 A;  2CS4 A;  1WM3 A;  1JQ4 A;  2GBJ A;  1OTR B;  1KRH A;  1WYG A;  4TQ1 A; 
#chains in the Genus database with same CATH homology
 1S1Q B;  1V5O A;  2BGF A;  3AXC A;  3AUL A;  1GC7 A;  3C0R B;  4W9K A;  5C1Z A;  2EKE C;  2DZM A;  3AI5 A;  3PVL A;  4G3X B;  3BIN A;  2NPT B;  3M62 B;  4A20 A;  3ZKJ C;  1YJ1 A;  4W9L A;  3UIO B;  1C3T A;  4WJP A;  4XX5 A;  2J0M A;  2K1F A;  2EMS A;  3CF6 E;  4AWJ A;  2LAS A;  3BY4 B;  2N9E B;  4WWN A;  3L08 A;  3QAR A;  2KDE B;  1VCB A;  2N1W A;  3Q3J A;  2KFJ A;  2KN5 A;  4BBN C;  3ML8 A;  2KAN A;  2N4F A;  2HTH A;  3KUD B;  2KJ6 A;  3VHT C;  4EEW A;  3WAO A;  3CSF A;  2L05 A;  5L95 C;  2KHW B;  2NBV B;  3QHT A;  1Z2M A;  3V61 A;  5J18 A;  1HE8 A;  1TGZ B;  4KV2 A;  2JUO A;  2MSE D;  3JSV A;  3VUW A;  3QAQ A;  2MBQ A;  2DAF A;  4TQ0 A;  3TJP A;  1P9D U;  1ZKH A;  4ANW A;  4OVU A;  3DCG A;  4NAW A;  4PYZ A;  2CU1 A;  4GDL B;  3APF A;  2ZNV B;  3RUL A;  2KX3 A;  1I35 A;  4LCD E;  5G55 A;  1YX6 B;  3N30 A;  1C1Y B;  1XD3 B;  2WX1 A;  4PS8 A;  4XZ4 A;  5LXH A;  2MA9 B;  3R3M A;  2XBB C;  4IM2 A;  4GXB A;  1WX9 A;  4HCN B;  3ZNZ B;  3HHM A;  3L10 B;  5IA7 A;  5L83 A;  2JVC A;  3WAL A;  1V6E A;  4ICU A;  5CHW A;  1K8R B;  3KVF B;  3DVN V;  1D3Z A;  3KUC B;  5DPT A;  3W1S C;  4EZK A;  3SHQ A;  1MG8 A;  2BYV E;  3VUY A;  1CMX B;  3KH0 A;  2MRP A;  2XK5 B;  2LRW A;  4W9I A;  2LVO A;  2GBM A;  2MLB A;  5CHF A;  2BKR B;  2JWZ A;  3DQV A;  2BPS A;  2Z59 B;  4FHK A;  1R4M I;  5JHA A;  2DHZ A;  4LJO B;  3NY5 A;  2AL6 A;  5J17 A;  3JW0 X;  2KC2 A;  4IWQ A;  1U4A A;  2IY0 B;  2LGY A;  2MX2 A;  2KQS A;  1H4R A;  4JLC A;  3W1Y A;  2D10 A;  4FUL A;  3T9L A;  2FCM A;  4GSW A;  4IM0 A;  3R7R A;  3IBE A;  5JZE B;  1E90 A;  2NS5 A;  2BWE S;  1WX8 A;  1WMH A;  4KDL B;  3PHX B;  1ZW7 A;  2AL3 A;  3N3K B;  1Y8R C;  4IWP A;  3HM3 A;  2KWV B;  2N1V A;  2FAZ A;  2HJ8 A;  1IYF A;  1WGG A;  3EFU A;  3RYT A;  1VD2 A;  1UGM A;  2IY1 B;  2K39 A;  4JGH B;  5CX3 A;  2DEN B;  4B95 A;  2MW5 A;  1M94 A;  3PT2 B;  4F7Z A;  3DVG Y;  1P98 A;  3PRM B;  3RCZ A;  3HIZ A;  3ZIM A;  1KLV A;  2L76 A;  2KD0 A;  4WWP A;  3A9J A;  3APD A;  3H7P A;  4MSQ B;  4W9D A;  4G50 A;  5D7G A;  5TR5 A;  1TBE A;  1LQB A;  3K9P B;  2J7Q B;  2HE7 A;  2ASQ A;  2FCN A;  4URK A;  2B3A A;  3A1Q A;  1WXS A;  3IFW B;  4MJS B;  2IO3 B;  3H1U A;  2NCN A;  1UBQ A;  3Q3F A;  3T8M A;  5E6P A;  1GG3 A;  2N9P C;  2MQJ A;  2UWQ A;  2AWT A;  4IC7 B;  4KIK A;  4NJ7 A;  3UQB A;  2M1M A;  2DAJ A;  3DVG X;  2A5U A;  2GBN A;  2J0K A;  4FJV B;  4G0N B;  3OLM D;  2L0F A;  4GN1 A;  1XT9 B;  4RM8 A;  5CTR C;  3OJ4 B;  3PPA A;  4W9H A;  1FXT B;  3LDZ E;  1WGD A;  3DVN U;  3ZTD A;  4DWF A;  1E7U A;  3LJ3 A;  1E7V A;  3D32 A;  4W9E A;  2RGF A;  3ZUN A;  4CHK A;  4I6L B;  2LVQ A;  3SD5 A;  2DYB A;  2BKF A;  2GMI C;  4TUU A;  2ZPY A;  4FJY A;  3PRP B;  4ICV A;  1P1A A;  3UQA A;  2KO3 A;  1J8C A;  2D07 B;  3X0W A;  2D3G A;  2KTF A;  3VTW A;  1WMH B;  1WGR A;  3RZW C;  3ZNG C;  3A4R A;  4MGY E;  2K6Q A;  3NOB A;  2KTR B;  4MGK E;  4YL8 A;  5FR6 A;  1E8W A;  2NBU A;  2C5L C;  1YQB A;  4GDK A;  4HLE A;  3GZN I;  4K7U A;  4M8M A;  1WR6 E;  2ZZP B;  4ZRK A;  4DDI D;  4AOF A;  2KQ7 A;  3PHW B;  2G3Q B;  2KNB A;  4PS7 A;  2MCN B;  3RT3 B;  2KZR A;  2DZI A;  3QA8 A;  1GC6 A;  4HDQ A;  1WFY A;  4DK5 A;  1OEY J;  4EZJ A;  3N32 A;  2ZCC A;  3H7P B;  4GMV A;  3TCA A;  2CR5 A;  1WR1 A;  1V81 A;  1L7Y A;  5D2M B;  3DPD A;  4LDT B;  1E8Y A;  2W9N A;  4TKN A;  2RD0 A;  2R2O A;  3TBL D;  2JRH A;  2V4L A;  3WAM A;  2WDT B;  3QCA A;  3NZS A;  3B08 A;  4K81 A;  3PRE A;  1WXV A;  4JIO U;  4W9G A;  2KMA A;  3R7Q A;  4NNJ B;  3DOW A;  3PSE B;  3NHE B;  2M8S A;  5DCN A;  3NS8 A;  4A3P A;  2IO1 B;  2O6V B;  4TV3 A;  1TZ1 A;  2EMT A;  1NBF C;  1WX7 A;  1GJZ A;  3KUZ A;  2DZJ A;  3AU4 A;  2KFK B;  1EO6 A;  4WJN A;  4K7W A;  4IW0 A;  2I1K A;  4BOS C;  4EZL A;  4KSL C;  1L2N A;  1IPG A;  2IZV B;  1OQY A;  2WX0 A;  3ZNH B;  3ZVV A;  5E6O A;  1UZX B;  4HPL B;  2KWC A;  1WJ6 A;  2MBB B;  2PJH A;  3PRZ A;  4GOC A;  4JQW C;  4DDG D;  4E71 A;  2L00 B;  4II2 B;  3VAW A;  2NR2 A;  1WM2 A;  2D2Q A;  2M0X A;  5EDS A;  4WJQ A;  4HVB A;  3WIM A;  2IYD B;  1UEL A;  4KZ0 A;  3ENE A;  4JL9 A;  1WH3 A;  3TMP B;  3L0W B;  2FCQ A;  2I1J A;  1WZ0 A;  2FCS A;  2L3Z A;  2C7H A;  2PE6 B;  4K1R B;  5AZG A;  1A5R A;  1UD7 A;  3EC8 A;  2BF8 B;  2HD5 B;  2KWU B;  1T0Y A;  3PZD A;  3RUI B;  4II3 B;  4B9K A;  3DBH I;  3MTN B;  4BBN F;  2GBR A;  4DHJ B;  4I6P A;  4BKG A;  2VRR B;  2O2V A;  2NVU I;  4HCP B;  1GUA B;  1RFA A;  3QWZ B;  3VDZ A;  1P0R A;  2Y5B B;  4EOY A;  2RR9 A;  4FAD A;  4BVU C;  1EF5 A;  3KYD D;  4FHJ A;  4W9J A;  2K8H A;  1OEY A;  4MH0 E;  2REX A;  2V1Y A;  3JSV B;  5DPW A;  4I6N B;  3EEC A;  5J2R A;  1E8Z A;  2M17 A;  5D6J B;  2FUH B;  5AZH A;  3APC A;  3VQI A;  4NAW B;  2DX5 B;  3V6C B;  1KJT A;  1ZGU B;  1WGY A;  4EUT A;  1J0G A;  3QIJ A;  2LUE A;  3A33 B;  2OOB B;  3O65 B;  3VTV A;  2DYO A;  1WJU A;  3ONS A;  4HWI B;  2G45 B;  2MBE A;  3SDL C;  2KC1 A;  4KSK C;  5CHV C;  4F1S A;  3OAW A;  1SGH A;  1V5T A;  5LXI B;  2KDF B;  4FBJ B;  1NI2 A;  4KDI C;  3A4S C;  2MBH A;  4B6W A;  1R4N I;  4N9F 4;  2NPT A;  2KMC A;  4DXA B;  1WXM A;  1WI0 A;  1WIA A;  3AU5 A;  2ZVN A;  3PLU A;  4BFR A;  1IP9 A;  1V2Y A;  5KHO A;  4FLH A;  1TTN A;  1X1M A;  4NPN A;  1Q5W B;  2JZ3 B;  3QQ8 B;  1XQQ A;  5DPS A;  3HM6 X;  4ANX A;  2AEH A;  1SE9 A;  1WJ4 A;  1F9J A;  2Z0D B;  4NQL B;  2N7E A;  2LVP A;  1E8X A;  2CHZ A;  2JPH A;  2KK8 A;  1RRB A;  4ZRI A;  2O2V B;  4W9C A;  4M8N A;  1V9J A;  4HJK A;  5AZF A;  1QZE A;  3B0A A;  1WE6 A;  2C60 A;  4P7I A;  3ZLZ A;  2RSU A;  2JT4 B;  3ZDM C;  4DHZ E;  4GDL A;  2LXC A;  4MEL A;  2KLC A;  4BOZ B;  3DBS A;  4WQO B;  3H6N A;  2LD9 A;  4AJY B;  4ASW C;  3ZNI D;  5D94 A;  3MHS D;  2XEW A;  3OJ3 A;  2K8C A;  2IBI B;  5G2N A;  2UYZ B;  1Q1O A;  1RLF A;  1SIF A;  4F8C B;  2A4Z A;  4DHZ B;  2ZPN A;  2G4D B;  2JF5 A;  2KX0 A;  5GMV A;  3A9J B;  3B1L X;  1PQS A;  2L7R A;  3M63 B;  2GOW A;  1LM8 B;  3KYC D;  3A9K A;  1P3Q U;  2XK5 A;  3A1Q B;  1KOT A;  3HK0 A;  3UIP B;  3QJZ A;  2KDI A;  5C23 A;  4KIK B;  3ZO5 B;  1WGH A;  2MP2 A;  2G4S A;  3X23 A;  4IUM B;  4MM3 A;  3K9O B;  4X57 B;  2IO0 B;  4A3O A;  4FA6 A;  2KDB A;  4LJP B;  4K7S A;  4IWO A;  4ANU A;  2ZEQ A;  4MDK E;  4AP4 C;  4NQK E;  3V6E B;  2K25 A;  4MGZ E;  2LGX A;  2N9X A;  2QHO A;  2JZZ A;  3KW5 B;  4NJ6 A;  3L54 A;  3ZRF A;  1E5W A;  4MGI E;  3SU8 X;  5KHQ A;  1AAR A;  4FJZ A;  2PPH A;  4GU2 A;  5JHB A;  4HK2 A;  4EFO A;  3U30 A;  1WE7 A;  4WJO A;  3TIX A;  3RD2 A;  2JRI B;  2KXJ A;  3NZU A;  5HKH A;  1V86 A;  4GDK B;  4G11 A;  1WJN A;  4E74 A;  3U8Z A;  2OJR A;  4FN2 A;  3QX1 A;  3U7D A;  2ZVO A;  2DZK A;  2C7M B;  1LXD A;  2JXX A;  2LI5 A;  2KLG A;  4GB9 A;  3JYU A;  2FIF A;  1YD8 U;  3DDC B;  4NY0 A;  5IAA C;  1J19 A;  3ZTC A;  2BWF A;  4MJS A;  2GBK A;  3IG3 A;  2M4N A;  3EHV A;  4RM9 A;  1WXA A;  1Z5S B;  3A9K B;  3W1S A;  2FNJ B;  2WWZ A;  3H7S A;  1LFD A;  1GNU A;  4AUQ C;  3VTU A;  3R66 C;  4OVV A;  2JY6 A;  4LDT D;  2LZ6 A;  2D11 A;  4EKU A;  2LWP A;  2NBW B;  2MP2 B;  3H9D A;  5E6N A;  3VH4 B;  4BKS D;  1KM7 A;  1BT0 A;  2KVR A;  2PE9 A;  3IVF A;  3QK0 A;  3IHP C;  3WAP A;  3DBR I;  4AJW A;  4BKT A;  2K8B A;  2CHW A;  4HXD A;  4MEM A;  3QC8 B;  5DPR A;  4DBG A;  3TL5 A;  2O6V D;  4CO7 A;  3M95 A;  3V62 A;  3VFK A;  4E3C A;  3V60 A;  3WAN A;  3PV1 A;  1WRD B;  2DYM A;  2KTR A;  4GGQ A;  3CST A;  2KJH B;  2C7N B;  5JH5 C;  4WAA A;  3PS6 A;  3GOE A;  2KKC A;  1ISN A;  2L8J A;  2ZCB A;  3I3T B;  5AEK B;  2L0T A;  1OGW A;  1G6J A;  2CHX A;  3WA0 A;  3JVZ X;  2YLM A;  2WYQ A;  3DBL I;  3ZW3 A;  3VH3 B;  4CYE A;  2V3S A;  2C9W B;  1WZ3 A;  1V80 A;  3P2B A;  1YIW A;  1YX5 B;  1JRU A;  4IM3 A;  4ZYN A;  1WYW B;  1H8C A;  3ECI A;  2LJ5 A;  1NDD A;  2CKH B;  4IG7 B;  4GIV A;  4PYU A;  3ALB A;  2MWS B;  3L17 A;  2RPQ A;  1S3S G;  4PS3 A;  1UBI A;  1EUV B;  3PGE A;  2Z0E B;  1UH6 A;  3UF8 A;  1Q0W B;  2ZJD A;  1V49 A;  4DHJ D;  2N7D A;  4MSM B;  2IO2 B;  5BO4 B;  3MJW A;  3S2A A;  3ZRC A;  1I42 A;  2PEA A;  4BKS A;  5LLI A;  2LGD A;  2LXA A;  4HDO A;  3UIN B;  2MBO A;  3L13 A;  3VVW B;  3M3J A;  3ML9 A;  4WWO A;  2K6D B;  3VXW A;  1RAX A;  2LRU A;  4J6I A;  4KZC A;  2AYO B;  2KOX A;  2YVC A;  2ZNV C;  4ANV A;  4XC2 A;  4HPM B;  4KVG B;  2BYE A;  2R2Q A;  4M0W B;  3PTF C;  2O6V A;  4W9F A;  4ZRJ A;  4RMA A;  1WF9 A;  3UGB B;  3VUX A;  4ZDV A;  2J0J A;  1EF1 A;  2BYF A;  2CS4 A;  1WM3 A;  2KFK A;  3CMM B;  3L16 A;  3PLV A;  2GBJ A;  3RZF A;  1OTR B;  3ZDT A;  2FID A;  2KJR A;  4TQ1 A;  1WY8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...