2O2VA

Crystal structure of the complex of human mitogen activated protein kinase kinase 5 phox domain (map2k5-phox) with human mitogen activated protein kinase kinase kinase 3 (map3k3b-phox)
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
93
structure length
92
Chain Sequence
VLVIRIKIPNSGAVDWTVHSPQLLFRDVLDVIGQVLPEATTTAFEYEDEDGDRITVRSDEEMKAMLSYYYSTVMEQQVNGQLIEPLQIFPRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Complex of Human Mitogen Activated Protein Kinase Kinase 5 Phox Domain (MAP2K5-phox) with Human Mitogen Activated Protein Kinase Kinase Kinase 3 (MAP3K3B-phox)
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Dual specificity mitogen-activated protein kinase kinase 5
total genus 21
structure length 92
sequence length 93
ec nomenclature ec 2.7.12.2: Mitogen-activated protein kinase kinase.
pdb deposition date 2006-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00564 PB1 PB1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2o2vA00
3ZLZA 2MWSB 2DZKA 4IM2A 3DBSA 2JWZA 1WGYA 1RFAA 3WAMA 4EUTA 2IY0B 1OEYA 2PEAA 2XEWA 2ZCBA 4URKA 2BKFA 2DZIA 2JRHA 1GUAB 1LXDA 1WXMA 4BKTA 3NY5A 4PS3A 4GMVA 5CX3A 4HDQA 2K25A 2KWUB 2Y5BB 3QARA 1V9JA 5CHVC 2JZ3B 1SGHA 2EKEC 3Q3FA 2BYVE 1GG3A 1UBQA 1TBEA 2FCNA 2G3QB 1KOTA 3ONSA 2JF5A 5LXHA 4FN2A 1WGDA 3ML8A 4PYUA 2ZPNA 2KC2A 2M1MA 1H4RA 2RPQA 1XD3B 1WGHA 4BKGA 3K9PB 2N9PC 3A9JB 4M8NA 2VRRB 4FJYA 4LJPB 4K1RB 3A1QA 3OAWA 5D94A 2CHZA 3PLUA 2KFKA 4GIVA 2CKHB 3DVNU 4ZDVA 5JHBA 2LGDA 2D3GA 1KJTA 2R2QA 3RYTA 4X57B 1V86A 4WWNA 2NCNA 3WAOA 1YIWA 3VHTC 3VTWA 2MBEA 3A4RA 3PRMB 3RCZA 1OEYJ 2FIDA 3H7SA 2LWPA 1WMHA 3ENEA 4G11A 2DAFA 2MBOA 4W9JA 3KH0A 3HIZA 5AEKB 2CHXA 4II3B 4B95A 1V2YA 2JY6A 4BKSD 1YJ1A 5E6OA 1Z2MA 4F8CB 4FLHA 4BOSC 4BKSA 2L05A 2OJRA 5DPWA 2MQJA 3GZNI 1NDDA 4KZCA 2FAZA 3TL5A 4EZLA 4PS7A 4M0WB 1P3QU 4GDLB 4MEMA 4M8MA 3VVWB 2L0FA 3M62B 3SHQA 1E8XA 5TR5A 1S1QB 1MG8A 1WYWB 3UQAA 3VUWA 1I35A 4KSKC 3DQVA 4BBNC 5DPSA 1WJ6A 2MX2A 4GOCA 1KLVA 2KFJA 2KTFA 3L16A 1ZGUB 3JW0X 4G3XB 5E6PA 4WJOA 2KXJA 2WYQA 4AJWA 1EF5A 1GC7A 2MA9B 1UELA 1XQQA 4PS8A 4A3PA 2HJ8A 1UGMA 5IA7A 2NS5A 2NPTB 3DBRI 3GOEA 4TV3A 3ZVVA 3SDLC 1GJZA 3IG3A 2QHOA 4JQWC 2L3ZA 2MSED 5IAAC 2FCQA 2C5LC 3R66C 2LRUA 3ZDTA 3R7RA 3KYCD 3B0AA 3RD2A 3WALA 3L13A 4ASWC 2NBVB 2KTRA 2JVCA 3KW5B 3KYDD 4GN1A 1WMHB 3VDZA 4A3OA 4FHJA 4IG7B 2K8CA 4MGKE 2D07B 1C1YB 3QWZB 2ZJDA 2KDEB 3V6EB 2IY1B 2LD9A 4W9GA 3S2AA 5G55A 1P98A 1GC6A 2KLGA 5GMVA 4EKUA 3ZRFA 2KNBA 4NJ6A 2KN5A 5DCNA 2B3AA 2RSUA 2BYEA 3UGBB 5L95C 1UH6A 3ML9A 1S3SG 4GB9A 1WR1A 3PT2B 4FADA 4F7ZA 2KDBA 4ANXA 4F1SA 2BWFA 4K81A 3SD5A 3JSVB 4LJOB 3HK0A 3H1UA 2Z0DB 1UZXB 3H7PB 1IP9A 1WXAA 4B6WA 2AEHA 4HDOA 2FCMA 1YD8U 3OJ4B 1WJ4A 2KQ7A 3ZIMA 1C3TA 2LZ6A 4II2B 2DYBA 4ANWA 4XZ4A 3TCAA 1EUVB 2KOXA 2CR5A 2A5UA 3QK0A 3L10B 2L8JA 4YL8A 4NPNA 4LDTB 2YLMA 4J6IA 4DBGA 2PE6B 1LQBA 1T0YA 3JSVA 2NBUA 3IHPC 2RD0A 4MJSA 3DBHI 4FULA 1WJUA 2C7MB 2MBHA 3O65B 4EFOA 2ASQA 2LASA 4I6PA 2LGXA 2Z0EB 4MSMB 1ZKHA 2EMTA 2RGFA 1WX9A 4IM3A 4MDKE 4CYEA 3NS8A 1J0GA 1R4NI 3VH3B 4MH0E 4OVUA 2DZMA 2M17A 3HM3A 3L54A 3PSEB 4KVGB 2RR9A 4AOFA 2J0JA 2O6VD 2BF8B 3CMMB 3PPAA 1CMXB 1WI0A 2KWVB 5LLIA 3RZWC 2BYFA 1LM8B 1E5WA 3PTFC 4W9KA 3PRZA 4KSLC 3ZO5B 3M95A 3IVFA 3NOBA 4CO7A 2HTHA 2CHWA 3H6NA 2MCNB 3U30A 2KD0A 4EZJA 2MRPA 2MBQA 4K7SA 3WANA 1HE8A 2LXCA 3TIXA 3DOWA 3RULA 4WAAA 2LXAA 2Z59B 1A5RA 5AZHA 3V61A 4W9IA 4WJPA 3DDCB 2LVQA 3U7DA 3EHVA 2IBIB 3PVLA 1J8CA 3HM6X 4HJKA 3VH4B 2XK5B 2WWZA 4N9F4 4WWPA 2JT4B 3NZSA 3ALBA 4GGQA 2UWQA 1WIAA 4GXBA 4IM0A 3H9DA 3RZFA 1OQYA 4K7UA 4DHJB 1I42A 2KJ6A 3M63B 4W9FA 1Q0WB 4FBJB 1IYFA 1E7VA 4MGIE 4I6LB 1RAXA 4JL9A 4W9DA 4ANVA 1V5TA 1WM2A 4DDID 2MW5A 1PQSA 4DDGD 2I1KA 3MJWA 2K6QA 3QIJA 2N7DA 2DZJA 2PE9A 3T9LA 3X0WA 2K6DB 4LCDE 2CU1A 4WQOB 1WH3A 2C7NB 2N7EA 1TTNA 2XK5A 1XT9B 3LJ3A 4DWFA 1V5OA 4KDLB 4XX5A 3UINB 3M3JA 1WZ0A 1U4AA 1WM3A 4RMAA 4HVBA 4HWIB 2BKRB 3I3TB 2LVOA 1L7YA 5G2NA 3V60A 1E8WA 4NAWA 3ZNHB 4BOZB 5BO4B 1WX8A 2ZPYA 2JRIB 1L2NA 1WRDB 2GBNA 3CSTA 3ZTCA 2KVRA 1OGWA 1YQBA 3ZNZB 1H8CA 3C0RB 2G45B 3N30A 5CHFA 1RRBA 5J2RA 1WFYA 1WXVA 1E8ZA 4G0NB 2NBWB 4W9CA 1P1AA 2GMIC 4EEWA 3JVZX 5J17A 4NQKE 1P0RA 4IW0A 4NY0A 3VFKA 4KV2A 5DPTA 2AYOB 5D7GA 2G4SA 3DPDA 4XC2A 4DK5A 1SIFA 3KUDB 2MBBB 1EO6A 3QC8B 3A1QB 2KFKB 5E6NA 2WDTB 1Y8RC 2ZEQA 3ZW3A 2KX3A 1D3ZA 1EF1A 5CHWA 3V6CB 3PHXB 2V3SA 4PYZA 5L83A 4RM9A 2L00B 3BY4B 3U8ZA 3KUCB 4WJQA 2ZNVC 1Q1OA 3N3KB 1V80A 4NAWB 2J7QB 4TUUA 2DAJA 2WX0A 3T8MA 2IO3B 1V49A 2J0MA 2O2VB 3APCA 1WY8A 2XBBC 2KWCA 5JH5C 1WE7A 3QJZA 2N1VA 2KQSA 3QAQA 3IBEA 4FHKA 4ICUA 2N9EB 3ZNID 4AP4C 4MGZE 5HKHA 3DCGA 4TQ0A 2EMSA 3MHSD 4FJZA 3CSFA 5C23A 5LXIB 2AL3A 2C7HA 4ZRIA 2ZVNA 4LDTD 4W9HA 2IO0B 2IO1B 3PLVA 4GSWA 2PJHA 2DENB 3R7QA 3L08A 2DX5B 2IZVB 2I1JA 2ZVOA 3NHEB 2HE7A 3MTNB 3OLMD 3RT3B 4GU2A 4OVVA 3QA8A 4ZYNA 4E3CA 1Q5WB 4HLEA 2AWTA 2L76A 1FXTB 2K1FA 4WJNA 4MM3A 3PV1A 5DPRA 3TBLD 4KIKA 3W1SC 5JHAA 4HPLB 3ZRCA 1JRUA 2NPTA 1NI2A 5CTRC 3Q3JA 2FUHB 3EC8A 1X1MA 2YVCA 3A9KB 3N32A 1YX6B 1V6EA 3QHTA 2JXXA 4BFRA 3QQ8B 2M8SA 2KX0A 1J19A 1OTRB 4JIOU 3KUZA 1M94A 4MELA 2C60A 2O6VB 3WAPA 2MP2A 4B9KA 4BBNF 2D10A 5D6JB 2C9WB 2JPHA 1LFDA 2DYMA 5KHQA 4KDIC 4K7WA 1ISNA 4IC7B 1G6JA 2KKCA 2KJRA 3JYUA 4JGHB 3A4SC 3TJPA 3DVGY 4HK2A 2O2VA 2O6VA 3UF8A 2K8BA 3B1LX 1WF9A 1K8RB 2BPSA 2KLCA 2N9XA 4MGYE 2GBKA 4HCNB 2LUEA 3NZUA 4DHZB 3SU8X 4A20A 2DYOA 4ZRJA 3VQIA 3HHMA 4ZRKA 1UBIA 5EDSA 4CHKA 3AXCA 1WGRA 2LJ5A 3VUXA 3KVFB 3QX1A 2DHZA 1WZ3A 4ICVA 4DXAB 2FNJB 1WR6E 2J0KA 4DHZE 2REXA 2GBMA 2KDFB 3A9JA 1WE6A 3ZNGC 2N1WA 4DHJD 4ANUA 2K39A 4TKNA 2UYZB 3UIOB 2KHWB 3PS6A 1P9DU 2KANA 3ZTDA 2KJHB 3OJ3A 3AU4A 3ZUNA 1RLFA 2LVPA 3WA0A 5J18A 2IYDB 2BWES 1VD2A 5C1ZA 1Z5SB 4G50A 3V62A 2KDIA 5FR6A 3VTVA 2D11A 1NBFC 4IUMB 3D32A 3PRPB 2N4FA 4MJSB 2V1YA 3APDA 3PREA 1KM7A 4HXDA 2BGFA 4FA6A 1VCBA 2D2QA 1IPGA 2GOWA 2MLBA 1YX5B 4WWOA 2LRWA 3W1SA 1SE9A 3AU5A 4EZKA 3L0WB 3VAWA 2JZZA 2KC1A 3B08A 3ECIA 3AULA 4W9LA 3APFA 5KHOA 3VUYA 3VXWA 3CF6E 2G4DB 2ZZPB 2CS4A 2ZCCA 2K8HA 2AL6A 3QCAA 2M4NA 4P7IA 2KTRB 4EOYA 1WXSA 1WX7A 2JUOA 1AARA 2WX1A 3BINA 2KMAA 2GBRA 2HD5B 3K9OB 3RUIB 4IWQA 4KZ0A 1TGZB 1BT0A 4NNJB 4E71A 4AJYB 3PHWB 4AWJA 3ZKJC 3DVGX 1V81A 2V4LA 3DVNV 1ZW7A 4BVUC 4MSQB 3ZDMC 3AI5A 2NR2A 1E8YA 2GBJA 2IO2B 5AZGA 3PGEA 3LDZE 2L0TA 2FCSA 3A9KA 5AZFA 3A33B 2KK8A 2W9NA 3R3MA 3W1YA 4HCPB 4IWPA 3X23A 5D2MB 2PPHA 4E74A 1WJNA 1UD7A 4NJ7A 2L7RA 4TQ1A 3H7PA 4NQLB 4HPMB 2OOBB 1WGGA 2R2OA 4I6NB 3EECA 3UQBA 2LI5A 1GNUA 3IFWB 4IWOA 2FIFA 2M0XA 4GDLA 3EFUA 1F9JA 4FJVB 3PZDA 3UIPB 3L17A 4JLCA 2ZNVB 2LGYA 4KIKB 2KZRA 3P2BA 3DBLI 4GDKA 2A4ZA 2KMCA 2KO3A 1R4MI 1TZ1A 4AUQC 1QZEA 4W9EA 3TMPB 1E90A 3VTUA 2NVUI 3WIMA 4RM8A 5JZEB 1E7UA 2MP2B 4GDKB
chains in the Genus database with same CATH superfamily
2DZKA 4BZAA 2JWZA 2AQ3B 3AE5B 1OEYA 4LNKA 2SAKA 2XEWA 2BKFA 1WXMA 5CHVC 2B76B 2KWUB 2Y5BB 2JZ3B 4PK1A 1SGHA 2EKEC 3EFCA 2BYVE 1HTOA 3ONSA 4FXCA 1KOTA 5LXHA 4FN2A 4PYUA 2KC2A 3HRDD 2INNE 2RPVA 4A8XC 3K9PB 2N9PC 1WWTA 4LJPB 4K1RB 3A1QA 3OAWA 5D94A 5IO9A 3AE9B 4RF0A 4OW0A 4ZDVA 3DVNU 4WWNA 3WAOA 1F2RI 1YIWA 3VHTC 3VTWA 4C4VA 2QCZA 3HIZA 4II3B 1V2YA 4BKSD 2D5GA 4FLHA 3NS1A 4BOSC 3B2GA 2L05A 3BYYB 2WDVB 4PS7A 4M8MA 4DXGA 2L0FA 1XCQL 1XXGA 1MJDA 1JWBD 4KGSA 3PZ7A 2KFJA 2WYQA 4H2AA 1EF5A 1T5XD 4C80A 1XQQA 5HG2A 2K5PA 4TV3A 3ZVVA 1C77A 3AEFB 1GJZA 2QHOA 4JQWC 3OWEB 2FCQA 2C5LC 3IT4B 3Q8BA 3TEZA 3R7RA 3B0AA 3W5VB 1V1PB 3VDZA 4GN1A 2YEPB 4FHJA 4IG7B 4MGKE 1C1YB 3QWZB 3S2AA 1ACCA 2H89B 3RPFC 5L95C 1UH6A 2D3AA 1S3SG 4GB9A 4FADA 3AE8B 4F1SA 4K81A 3DWGC 4LJOB 1UZXB 3H7PB 1IP9A 4YL8A 1FXAA 2L8JA 4J6IA 1LQBA 1TS4A 2MEKA 2WXIA 2RD0A 1ZXIA 3DBHI 2LASA 1C76A 1TT5B 2RGFA 3VH3B 4YWGG 4ARCA 3L54A 3PSEB 4AOFA 3RZWC 2KWVB 5LLIA 3U7ZA 3AEDB 3IVFA 1STEA 2CHWA 3U30A 3VRAB 4WAAA 2LXAA 2Z59B 4QAYA 1A5RA 4W9IA 4USAA 3DDCB 3U7DA 2XNAC 2IBIB 3HM6X 3PO0A 4HJKA 2XK5B 4N9F4 1FCLA 4WWPA 3NZSA 3ALBA 2UWQA 1I42A 4K7UA 3M63B 3ZJVA 1TKEA 4FBJB 4DDID 2K9XA 4DDGD 3MJWA 1V97A 2WXRA 3FILB 2N7EA 4OZCA 1XT9B 1V5OA 2FBWB 2Y3AA 1J7AA 2MJEA 4HVBA 2KVZA 1XCTL 1E8WA 1UF0A 4A9AA 3ZXRA 3CSTA 1OGWA 1YQBA 1YJJA 2NTTA 1UWXA 1HQRD 3GZNB 2GRIA 2NTSA 2N0SB 2K3UA 2NBWB 1P1AA 2GMIC 3JVZX 5J17A 4NY0A 5DPTA 1MHXA 2EKIA 3KUDB 1MPEA 3RNCC 3A1QB 2CU3A 3B9JA 2OJWA 2KFKB 2ZEQA 3ZW3A 2KX3A 1D3ZA 5CHWA 3RNGC 2V3SA 2L00B 4LNIA 3U8ZA 5JXVA 1Q1OA 3N3KB 1V80A 3AE1B 2KAJA 3T8MA 2HJ1A 1SE4A 4XWWA 3R8BA 3P4PB 1SBBB 4FJZA 4W9HA 2IO1B 1N5XA 3R7QA 3MTNB 3OLMD 3RT3B 3CWIA 2W54A 4ZYNA 1DGJA 3DHHC 2JWUA 3W1SC 2QMTA 3ZRCA 3AB5A 2NPTA 3A9KB 1YX6B 3QHTA 4YTPB 4BFRA 2KACA 3QQ8B 1FIQA 2M8SA 2KX0A 4XE0A 3P42A 4JIOU 1M94A 2C60A 2O6VB 4B9KA 5D6JB 2C9WB 1FPYA 1LFDA 2DYMA 1YOVB 2KJRA 2RMMA 3A4SC 3P4SB 2BPSA 3I9V1 4MGYE 2LUEA 2BT6A 4DHZB 4WURA 2DYOA 2BBCA 4RGOS 1UBIA 3AXCA 1WGRA 1D5MC 2CJNA 2LJ5A 3QX1A 3AEEB 4KKJA 4DHZE 4JWSC 4LNFA 3CIRB 3ZNGC 2N1WA 2KHWB 1JWSD 1CK1A 3SEBA 1L4DB 3AE7B 3AEGB 2LVPA 3WA0A 1ESFA 2WXJA 3NJTA 1C4PA 1MHHE 2L1AA 5IKCM 1AN8A 1VCBA 1IPGA 2D2QA 1YX5B 1FNVA 3W1SA 1SE9A 3AU5A 2WXGA 2JZPA 1SB3C 2JZZA 3VUYA 2G4DB 2ZZPB 2ZCCA 3NVVA 3MHZA 3RNBC 2AL6A 2VH2A 2WP9B 3AN1A 2JUOA 1F2RC 3BINA 4AJYB 3PHWB 1BMLC 3DVGX 2V4LA 3KWLA 1FNWA 4ACFA 1E8YA 1FM0D 3KLSX 2KK8A 2W9NA 3FAHA 4IWPA 1DOYA 3Q2AC 2M19A 4NJ7A 4US9A 1I4HA 3UQBA 2PKOA 2X38A 5IOIA 3EFUA 3Q8AA 4ZHOA 3PZDA 1SE2A 3L17A 5FKAC 1L4ZB 4GDKA 1QF6A 1TZ1A 4P16A 3ZJUA 1PUTA 5EE9A 2NVUI 4P6VF 5JZEB 3LYYA 4IM2A 3ZGZA 1RFAA 4EUTA 2ZCBA 3AE4B 1AW7A 2DZIA 2ZW1A 4RNAA 1SJHD 1LXDA 1ZDXA 3Q3FA 1UBQA 1WGDA 3ML8A 2M1MA 1XD3B 2WGSA 2DBYA 1WGHA 2PMVA 3RNEC 5BMHA 2UU7A 2DLBA 3NVZA 2CHZA 3PLUA 2LGDA 3RYTA 1E7UA 1F1HA 3KWVA 3ZXVA 2FUG1 2LWPA 4G11A 3KH0A 1AYFA 2CHXA 5BYSA 3IXSA 1YJ1A 4BKSA 2XN9C 1TKYA 2FAZA 3TL5A 1KFYB 1P3QU 1IBXA 2W3RA 2BS4B 3VUWA 3L4PA 3L16A 1FO4A 1TYGB 3JW0X 4G3XB 4WJOA 2WXKA 1ENFA 2M56B 4PS8A 4LLGM 1PGXA 1UGMA 2WU2B 4OZBA 2NS5A 2NPTB 3DBRI 3IG3A 2L3ZA 1FRDA 3R66C 3AE2B 2LRUA 2DNFA 3KYCD 3L13A 4ASWC 2KTRA 3KW5B 4A3OA 1WMHB 1I4XA 3DHIC 2WDRB 3MP9A 4W9GA 3RN9C 5G55A 4NJ6A 1L0VB 2BYEA 3UGBB 3ML9A 2IPKD 4P1BC 3VR8B 2BWFA 3E56A 1IUEA 3SD5A 3HK0A 4WQMA 2Z0DB 2ON8A 2WQYB 2AEHA 3Q8FA 3IAS1 3OJ4B 1WJ4A 2KQ7A 3AH7A 3ZIMA 1C3TA 2LZ6A 2DWQA 3QK0A 2CR5A 5TSSA 2YLMA 1ROEA 3AECB 1P7EA 3N1ZC 1TJEA 2SEBD 4MJSA 1WJUA 1KLUD 5G5GA 4JX1C 5H8YE 1L6VA 1N5WA 1WX9A 4MDKE 2WDQB 1R4NI 4HPPA 2D3CA 4KVGB 1JMLA 2AQ1B 3PPAA 1CMXB 3PZ8A 4S0RA 2BYFA 1LM8B 3UI3A 1E5WA 1C79A 3PRZA 3W9CB 2HTHA 4EZJA 2MRPA 2MBQA 1HE8A 2LXCA 3DOWA 3RULA 4AQ7A 5AZHA 3V61A 2LVQA 1J8CA 3EHVA 1QOBA 3N9YC 2AQ2B 4GGQA 4IM0A 1WIAA 3RZFA 3H9DA 3BK2A 4I6LB 1R4NB 4ANVA 1L0YB 4LTUA 1V5TA 1E0ZA 2I1KA 3QIJA 2N7DA 1WGKA 4LCDE 4WQOB 2RDHA 2XK5A 3LJ3A 4DWFA 4KDLB 3UINB 4M02A 1F0ZA 1U4AA 1WM3A 2OHFA 4YSZB 4HWIB 2LVOA 3Q8CA 1B1ZA 4BOZB 4C56C 2ZPYA 4ZYSA 1L2NA 2GBNA 4A6QA 3ZTCA 4KKIA 5CHFA 2G45B 2M0AA 1RRBA 1WFYA 3GE8C 1WXVA 3V3XA 3GS2A 4EEWA 1T3QA 4NQKE 1FMAD 3H8HA 4KV2A 1V8CA 5D7GA 4XC2A 4DK5A 1WXQA 2MBBB 3QC8B 5E6NA 4LNNA 4N59A 1NENB 3V6CB 2QILA 4MACA 3BK1A 1C4CA 1K53A 4TUUA 2DAJA 1XF5L 2O2VB 3APCA 3Q14C 4NJCA 2KWCA 5JH5C 1WE7A 3I63C 4K3BA 3RNAC 2LGIA 1ZPSA 4AP4C 4MGZE 5HKHA 3DCGA 1JRPA 1N6ZA 3MHSD 4DQOC 3NVWA 2WXLA 3W5UB 5HHDG 2C7HA 3MJ5A 4ZRIA 1UGJA 1RYJA 2W55A 2PJHA 4KGRA 1VDVA 2DENB 3L08A 2DX5B 1R7SA 3URYA 4RGNA 2E3TA 4E3CA 1Q5WB 2RDGA 4WJNA 4MM3A 5DPRA 2WNMA 5JHAA 4HPLB 1JRUA 3Q3JA 5H92C 1X1MA 1KH0A 2JXXA 4YSYB 5GXGB 2JQRB 1J19A 4C00A 1OTRB 2JSVX 4K3CA 4MELA 2BYTA 2MP2A 1JWAD 4MT5A 3ZQ4A 1MG4A 3JYUA 3ABVB 2I38A 3FILA 3UF8A 2Y5PA 1T0QC 1NYQA 2GBKA 4HCNB 3NZUA 2E6XA 3SU8X 1K52A 1QILA 3VQIA 1PYWD 5EDSA 3DBHB 1D5XC 3VUXA 3KVFB 3EUB2 1WR6E 3RMKC 2JYTA 2UYZB 4IDIA 2KANA 3AU4A 3ZUNA 2IYDB 1Z5SB 2N9LA 3ZYYX 2KDIA 2D11A 4IUMB 1CQVA 2WXNA 3PREA 1KM7A 4JPSA 4YT0B 4ARIA 4EZKA 3VXWA 3BIID 3AULA 4W9LA 3CF6E 1XLNA 2CS4A 2NMQA 2K8HA 2M4NA 2KTRB 1WXSA 1WX7A 2WX1A 2KMAA 2GBRA 5D3DA 1AWDA 3K9OB 3RUIB 3Q3MC 1E7PB 5E6JA 1V81A 4BVUC 3ZDMC 3AI5A 5AZGA 3LDZE 3A33B 4HCPB 3X23A 5D2MB 2RDBC 1VZ7A 3GP7A 2PPHA 1UD7A 2L7RA 4TQ1A 4NQLB 2KWDA 3ZJTA 1GNUA 2WXMA 3UIPB 1FD6A 1J7BA 2IGHA 3KQ4A 3P2BA 2KO3A 4W9EA 3VTUA 2QEJC 3WIMA 2BQQA 2MP2B 3ZLZA 1ZXHA 2MWSB 3BYTB 3DBSA 5BYRA 3WAMA 2IY0B 3DBRB 3BVMA 4URKA 1I4GA 2JRHA 1GUAB 3NY5A 3R2TA 4PS3A 3T3NA 5CX3A 4C7YA 2W3SA 3DHGC 2HTME 2JF5A 1XLQA 4JE3B 3I5JC 4BKGA 3A9JB 4M8NA 4FJYA 1ZE3D 4XDCA 2KFKA 5JHBA 4X57B 2NCNA 2MBEA 3A4RA 3RCZA 1OEYJ 2FIDA 3H7SA 4B95A 2L32A 5BYQA 1MVKA 1F77A 1JW9D 5IN7A 2MQJA 4A55A 1ZDVA 1HA5A 4M00A 3VVWB 1SIJA 1E8XA 1TY0A 2LGSA 5TR5A 1MG8A 1WYWB 4KSKC 3DQVA 4BBNC 5DPSA 4GOCA 1KLVA 2KTFA 2WU5B 3E9SA 4WAFA 1TS5A 2KXJA 3TEWA 2HJ8A 3GB1A 5IA7A 3GOEA 1SF0A 3SDLC 1B9RA 4HROA 1T0RC 1GOZA 3ZDTA 3RD2A 1XO3A 1K51A 1L5PA 2JVCA 3KYDD 2KDMA 3IT6B 4R3DA 3V05A 2KDEB 3V6EB 2IY1B 2W82A 3SFEB 1P98A 5GMVA 3RI7C 2B3AA 4M0WA 1JALA 2RSUA 2WLBA 4AS1A 2Q5WD 2PIAA 3PT2B 2VZKB 1KTKA 2BW2A 3DBLB 3H1UA 1OQRA 2FCMA 1YD8U 1OFFA 4II2B 4ANWA 4CQNA 4XZ4A 2KOXA 4NPNA 4LDTB 1YMHE 2PE6B 1FEHA 2OEDA 3C8YA 3JSVA 3IHPC 1HEZE 2BS3B 4FULA 3FKYA 4EFOA 2ASQA 4I6PA 2LGXA 2Z0EB 4MSMB 1ZKHA 2EMTA 4IM3A 4CYEA 3NS8A 3U4EG 3BVZA 1XLPA 2EELA 4MH0E 2IGGA 2DZMA 2M17A 2RR9A 2J0JA 2BF8B 3CMMB 1JROA 3PTFC 4KSLC 3U52E 3NOBA 1OQQA 4CO7A 2V0GA 1F52A 4YXDB 2GB1A 4HKQA 3H6NA 2JXTA 1TZOA 3GE3C 2KD0A 2INPE 3WANA 3TIXA 5EE1A 1D4BA 5FR3A 4WJPA 2BB5A 3HVDA 3MC0B 4DHJB 1CJEA 2KJ6A 1EWCA 1E7VA 4W9DA 1RAXA 4JL9A 1EWYC 1WM2A 2MW5A 1PQSA 2ICIA 3Q8EA 2K6QA 1JWMD 2PE9A 2K6DB 1ET9A 2CU1A 1WH3A 1HZ5A 1N63A 4MM3B 3AM9A 4XX5A 2LEKA 3M3JA 2JX5A 2BKRB 3I3TB 3DWMA 3ZNHB 3SFDB 5BO4B 1WX8A 2JRIB 1WRDB 1NI3A 2KVRA 4XGAB 1H8CA 5C3JB 2LMCA 2MJDA 1XLOA 4D2KA 5J2RA 1YN5A 4HKZE 1FXIA 4G0NB 1R4MB 1HZ6A 4IW0A 3VFKA 2G4SA 1SIFA 1TY2A 1C4AA 1QOFA 2KN4A 2WDTB 1Y8RC 4WWMA 5HFYA 1GPXA 4PYZA 1L0XB 3BY4B 2ZNVC 1Q10A 2J7QB 2IO3B 1MI0A 3AMZA 1PFDA 5BMIA 4DXFA 2N1VA 3QAQA 3IBEA 4FHKA 4ICUA 3ZNID 1QKZA 4RF1A 3J9CA 4YTNB 2GLSA 2EMSA 2KMMA 4BAXA 3AE3B 3BWUD 3CSFA 5C23A 5LXIB 2AL3A 2ZVNA 4LDTD 4L23A 1IGCA 4RGMA 2IZVB 1D6EC 2I1JA 3NHEB 2HE7A 2R61A 4GU2A 4OVVA 1PGAA 2G9HD 4HLEA 2AWTA 2L76A 2K1FA 3PV1A 3TBLD 2KT7A 1NI2A 4ITKA 2FUHB 3EC8A 2V3NA 2YVCA 3N32A 3P4RB 4RGTA 1E6EB 2J52A 3KUZA 2D3BA 4KDIC 2JYEA 1ISNA 2PVGC 4IC7B 1G6JA 4JGHB 3TJPA 3DVGY 4HK2A 2O2VA 2WXFA 1EM7A 3B1LX 1WF9A 3Q6BA 2N9XA 1K50A 3WCQA 4A20A 4ZRJA 1FFUA 3HHMA 1NVID 2BTEA 4CHKA 4OZAA 3I57A 2DHZA 2WHIA 1I4QA 5AUKA 1A70A 2J0KA 4RCOA 2GBMA 2KDFB 3A9JA 4ANUA 3UIOB 3NVYA 3PS6A 2V4IB 1GB4A 3N1XC 3ZTDA 1ZP0B 2KJHB 3OJ3A 1EU4A 1RLFA 1ZUD2 5J18A 2BWES 5C1ZA 4G50A 3V62A 5FR6A 3VTVA 1NBFC 3D32A 2WXHA 4MJSB 3APDA 4HXDA 4FA6A 2BGFA 1FNUA 3HUIA 4WWOA 1WSPA 3VRBB 2IGDA 3AE6B 3L0WB 3R2IA 2KC1A 1NYRA 5KHOA 4OVZA 1IGDA 1MFWA 4P7IA 3Q3NC 1AARA 2LFIA 2HD5B 2JU6X 4IWQA 1JWUD 4NNJB 1VZ6A 4E71A 1TIFA 1ZW7A 2N7JA 2NR2A 2IO2B 2L0TA 5AZFA 3A9KA 1NEKB 1FRRA 4YSXB 3FC4A 4OHJA 1WJNA 4L2YA 3U2SC 4S17A 2PVOD 1WGGA 4LK0M 2LI5A 4IWOA 1TS3A 2WS3B 1F9JA 1TS2A 3Q3OC 4JLCA 4KIKB 2LGYA 2V9HA 3ETRA 1DOXA 1YQ4B 3DBLI 2A4ZA 2KMCA 2QSDA 5EE0A 4IKGA 1E90A 4RM8A 2L83A 1VZ8A 3B2FA 1SE3A 1WGYA 2INDC 2PEAA 1SJED 4ZHPA 2MHJA 1N62A 3Q69A 2N9KA 4BKTA 4GMVA 4HDQA 2AX5A 2K25A 2QJLA 3QARA 1V9JA 1GG3A 1TBEA 2FCNA 2G3QB 2ZPNA 1H4RA 2RPQA 2VRRB 1GAQB 2I2YA 5LNK1 4ZRPA 4GIVA 2CKHB 1RWSA 2R2QA 1BUIC 1KJTA 2D3GA 1V86A 2YEPF 3PRMB 2MH7A 3W2DA 3O13A 1FCCC 1UUPA 1WMHA 3ENEA 1VLBA 2DAFA 2MBOA 4W9JA 5AEKB 2H88B 3BVGA 4REZA 2LHEA 2K22A 1N60A 2JY6A 5E6OA 4F8CB 1Z2MA 2J4XA 2OJRA 5DPWA 3GZNI 1NDDA 5C2TB 1KF6B 4KZCA 4EZLA 4M0WB 3SR6A 4GDLB 4MEMA 4ZRQA 3P4QB 3M62B 3SHQA 1S1QB 3UQAA 2MJ3A 1I35A 3AV8A 1WJ6A 2MX2A 2WXQA 1ZGUB 5E6PA 4AJWA 1GC7A 1JCKB 2MA9B 1UELA 2K0PA 4A3PA 2LUMA 1YN4A 1YJIA 2X8XX 1DOIA 2L52A 2MSED 2IDYA 5IAAC 1QLBB 1UNSA 3T3OA 3WALA 2PW9A 2NBVB 5I4DA 1KLGD 2K8CA 2D07B 4XWTA 2ZJDA 4KGTA 4NAMA 1KRHA 2LD9A 4HJGE 3P63A 2KLGA 1GC6A 4EKUA 3ZRFA 4US8A 2KNBA 2KN5A 5DCNA 2LJIA 3OG5A 1YQ3B 3EGRA 1WR1A 4F7ZA 2KDBA 4ANXA 3RFZB 3JSVB 4WIPA 4M01A 4A90A 4B0MA 1GB1A 1WXAA 4B6WA 4HDOA 4O1NA 5MPOA 2DYBA 3TCAA 1EUVB 2A5UA 3L10B 1SXTA 1VJKA 4DBGA 1T0YA 2NBUA 4WH4A 1C9FA 2C7MB 3O65B 2MBHA 2BS2B 4RFBA 1HTQA 1J0GA 4OVUA 3HM3A 1J7CA 2O6VD 1HXYD 1WI0A 2Z8LA 2BVCA 1E10A 4W9KA 3MFGA 3ZO5B 3M95A 2CJOA 1PGBA 3NUHB 3MC8A 4N58A 2MCNB 4K7SA 4NZLB 1EU3A 2QIEB 1JQ4A 2ZW0A 3PVLA 3VH4B 2WWZA 2ACZB 2JT4B 4GXBA 1I4PA 1FFVA 1OQYA 2FE8A 1E9MA 1C78A 4W9FA 1Q0WB 1IYFA 4MGIE 4B0EA 3N1YC 2Y5CA 1QOGA 4XDDA 3IAM1 2VH1A 4XYCA 5D3IB 2DZJA 3T9LA 3X0WA 4P1CC 4KX6B 2C7NB 1TTNA 2TSSA 3NG0A 4PT5A 1DYQA 1WZ0A 2INCC 4N6EB 4RMAA 4C7ZA 1L7YA 5G2NA 1D5ZC 3V60A 4NAWA 3EA6A 5BMGA 1VRAB 1T0SC 3ZNZB 3N20C 3C0RB 3N30A 4L1BA 4TSSA 3C19A 4GLSC 1E8ZA 4W9CA 1P0RA 2IJ0A 2AYOB 3DPDA 1PDXA 1EO6A 1RFKA 2PLPA 1EF1A 1V1OA 4HEA1 1I4RA 1M4VA 3PHXB 5L83A 4RM9A 5G5HA 3KUCB 4WJQA 4C4VB 4NAWB 2WX0A 2J0MA 1V49A 1ZOYB 1WY8A 2XBBC 3QJZA 2KQSA 4YTMB 2N9EB 1YNTE 4TQ0A 3BZDB 1RM6C 2V3PA 2G1EA 4TMAB 1ET6A 1BXTA 1VR9A 4EE2A 3TUOA 2IO0B 3PLVA 4GSWA 4LNOA 2ZVOA 2WXOA 1V1PA 2J53A 2KYWA 5FK9C 4IOIE 3RNFC 3QA8A 1FXTB 1UWMA 3TEXA 4KIKA 4UDUC 1XEEA 5CTRC 1T6BX 3AEAB 4JWUC 1LGRA 1V6EA 2GI9A 2LHDA 2QDFA 2VZKD 1WYGA 4Q2JA 3WAPA 4BBNF 2D10A 5KHQA 2JPHA 4ZOHC 4K7WA 1QQRA 2KKCA 4MH8A 1Y56A 2O6VA 2K8BA 1K8RB 2KLCA 4RH6A 1QOAA 4ZRKA 5AUIA 1TKGA 3LB8C 1WZ3A 1LO5D 4ICVA 4DXAB 2FNJB 2REXA 3TSSA 1WE6A 3NRZA 4DHJD 2BB6A 2K39A 4TKNA 1P9DU 5T8IA 1IBXB 2QC8A 5HI1A 1VD2A 1I7HA 3PRPB 2N4FA 2V1YA 4HRSA 1P7FA 2GOWA 2MLBA 2LRWA 3TEYA 3VAWA 3B08A 3ECIA 3APFA 1SSNA 4EOYA 3QCAA 3P1MA 1CZPA 4KZ0A 1TGZB 1BT0A 4AWJA 1QT9A 3ZKJC 3DVNV 4MSQB 5EE3A 2GBJA 3PGEA 2FCSA 1YN3A 2J42A 3R3MA 2WXPA 3W1YA 1WRIA 1L6UA 4E74A 3H7PA 4HPMB 2OOBB 5IP4D 2R2OA 4I6NB 3EECA 3LXFA 2KQ4X 3IFWB 3HVZA 2FIFA 1N61A 2M0XA 4GDLA 4FJVB 2PTLA 2ZNVB 2KZRA 3AEBB 1SEBD 1R4MI 4AUQC 1QZEA 3TMPB 3VR9B 3NZ3A 2ONQA 2HDEA 4J3OD 3MC9A 4GDKB
chains in the Genus database with same CATH topology
3ZLZA 2MWSB 2DZKA 4IM2A 3DBSA 2JWZA 1WGYA 1RFAA 3WAMA 4EUTA 2IY0B 1OEYA 2PEAA 2XEWA 2ZCBA 4URKA 2BKFA 2DZIA 2JRHA 1GUAB 1LXDA 1WXMA 4BKTA 3NY5A 4PS3A 4GMVA 5CX3A 4HDQA 2K25A 2KWUB 2Y5BB 3QARA 1V9JA 5CHVC 2JZ3B 1SGHA 2EKEC 3Q3FA 2BYVE 1GG3A 1UBQA 1TBEA 2FCNA 2G3QB 1KOTA 3ONSA 2JF5A 5LXHA 4FN2A 1WGDA 3ML8A 4PYUA 2ZPNA 2KC2A 2M1MA 1H4RA 2RPQA 1XD3B 1WGHA 4BKGA 3K9PB 2N9PC 3A9JB 4M8NA 2VRRB 4FJYA 4LJPB 4K1RB 3A1QA 3OAWA 5D94A 2CHZA 3PLUA 2KFKA 4GIVA 2CKHB 3DVNU 4ZDVA 5JHBA 2LGDA 2D3GA 1KJTA 2R2QA 3RYTA 4X57B 1V86A 4WWNA 2NCNA 3WAOA 1YIWA 3VHTC 3VTWA 2MBEA 3A4RA 3PRMB 3RCZA 1OEYJ 2FIDA 3H7SA 2LWPA 1WMHA 3ENEA 4G11A 2DAFA 2MBOA 4W9JA 3KH0A 3HIZA 5AEKB 2CHXA 4II3B 4B95A 1V2YA 2JY6A 4BKSD 1YJ1A 5E6OA 1Z2MA 4F8CB 4FLHA 4BOSC 4BKSA 2L05A 2OJRA 5DPWA 2MQJA 3GZNI 1NDDA 4KZCA 2FAZA 3TL5A 4EZLA 4PS7A 4M0WB 1P3QU 4GDLB 4MEMA 4M8MA 3VVWB 2L0FA 3M62B 3SHQA 1E8XA 5TR5A 1S1QB 1MG8A 1WYWB 3UQAA 3VUWA 1I35A 4KSKC 3DQVA 4BBNC 5DPSA 1WJ6A 2MX2A 4GOCA 1KLVA 2KFJA 2KTFA 3L16A 1ZGUB 3JW0X 4G3XB 5E6PA 4WJOA 2KXJA 2WYQA 4AJWA 1EF5A 1GC7A 2MA9B 1UELA 1XQQA 4PS8A 4A3PA 2HJ8A 1UGMA 5IA7A 2NS5A 2NPTB 3DBRI 3GOEA 4TV3A 3ZVVA 3SDLC 1GJZA 3IG3A 2QHOA 4JQWC 2L3ZA 2MSED 5IAAC 2FCQA 2C5LC 3R66C 2LRUA 3ZDTA 3R7RA 3KYCD 3B0AA 3RD2A 3WALA 3L13A 4ASWC 2NBVB 2KTRA 2JVCA 3KW5B 3KYDD 4GN1A 1WMHB 3VDZA 4A3OA 4FHJA 4IG7B 2K8CA 4MGKE 2D07B 1C1YB 3QWZB 2ZJDA 2KDEB 3V6EB 2IY1B 2LD9A 4W9GA 3S2AA 5G55A 1P98A 1GC6A 2KLGA 5GMVA 4EKUA 3ZRFA 2KNBA 4NJ6A 2KN5A 5DCNA 2B3AA 2RSUA 2BYEA 3UGBB 5L95C 1UH6A 3ML9A 1S3SG 4GB9A 1WR1A 3PT2B 4FADA 4F7ZA 2KDBA 4ANXA 4F1SA 2BWFA 4K81A 3SD5A 3JSVB 4LJOB 3HK0A 3H1UA 2Z0DB 1UZXB 3H7PB 1IP9A 1WXAA 4B6WA 2AEHA 4HDOA 2FCMA 1YD8U 3OJ4B 1WJ4A 2KQ7A 3ZIMA 1C3TA 2LZ6A 4II2B 2DYBA 4ANWA 4XZ4A 3TCAA 1EUVB 2KOXA 2CR5A 2A5UA 3QK0A 3L10B 2L8JA 4YL8A 4NPNA 4LDTB 2YLMA 4J6IA 4DBGA 2PE6B 1LQBA 1T0YA 3JSVA 2NBUA 3IHPC 2RD0A 4MJSA 3DBHI 4FULA 1WJUA 2C7MB 2MBHA 3O65B 4EFOA 2ASQA 2LASA 4I6PA 2LGXA 2Z0EB 4MSMB 1ZKHA 2EMTA 2RGFA 1WX9A 4IM3A 4MDKE 4CYEA 3NS8A 1J0GA 1R4NI 3VH3B 4MH0E 4OVUA 2DZMA 2M17A 3HM3A 3L54A 3PSEB 4KVGB 2RR9A 4AOFA 2J0JA 2O6VD 2BF8B 3CMMB 3PPAA 1CMXB 1WI0A 2KWVB 5LLIA 3RZWC 2BYFA 1LM8B 1E5WA 3PTFC 4W9KA 3PRZA 4KSLC 3ZO5B 3M95A 3IVFA 3NOBA 4CO7A 2HTHA 2CHWA 3H6NA 2MCNB 3U30A 2KD0A 4EZJA 2MRPA 2MBQA 4K7SA 3WANA 1HE8A 2LXCA 3TIXA 3DOWA 3RULA 4WAAA 2LXAA 2Z59B 1A5RA 5AZHA 3V61A 4W9IA 4WJPA 3DDCB 2LVQA 3U7DA 3EHVA 2IBIB 3PVLA 1J8CA 3HM6X 4HJKA 3VH4B 2XK5B 2WWZA 4N9F4 4WWPA 2JT4B 3NZSA 3ALBA 4GGQA 2UWQA 1WIAA 4GXBA 4IM0A 3H9DA 3RZFA 1OQYA 4K7UA 4DHJB 1I42A 2KJ6A 3M63B 4W9FA 1Q0WB 4FBJB 1IYFA 1E7VA 4MGIE 4I6LB 1RAXA 4JL9A 4W9DA 4ANVA 1V5TA 1WM2A 4DDID 2MW5A 1PQSA 4DDGD 2I1KA 3MJWA 2K6QA 3QIJA 2N7DA 2DZJA 2PE9A 3T9LA 3X0WA 2K6DB 4LCDE 2CU1A 4WQOB 1WH3A 2C7NB 2N7EA 1TTNA 2XK5A 1XT9B 3LJ3A 4DWFA 1V5OA 4KDLB 4XX5A 3UINB 3M3JA 1WZ0A 1U4AA 1WM3A 4RMAA 4HVBA 4HWIB 2BKRB 3I3TB 2LVOA 1L7YA 5G2NA 3V60A 1E8WA 4NAWA 3ZNHB 4BOZB 5BO4B 1WX8A 2ZPYA 2JRIB 1L2NA 1WRDB 2GBNA 3CSTA 3ZTCA 2KVRA 1OGWA 1YQBA 3ZNZB 1H8CA 3C0RB 2G45B 3N30A 5CHFA 1RRBA 5J2RA 1WFYA 1WXVA 1E8ZA 4G0NB 2NBWB 4W9CA 1P1AA 2GMIC 4EEWA 3JVZX 5J17A 4NQKE 1P0RA 4IW0A 4NY0A 3VFKA 4KV2A 5DPTA 2AYOB 5D7GA 2G4SA 3DPDA 4XC2A 4DK5A 1SIFA 3KUDB 2MBBB 1EO6A 3QC8B 3A1QB 2KFKB 5E6NA 2WDTB 1Y8RC 2ZEQA 3ZW3A 2KX3A 1D3ZA 1EF1A 5CHWA 3V6CB 3PHXB 2V3SA 4PYZA 5L83A 4RM9A 2L00B 3BY4B 3U8ZA 3KUCB 4WJQA 2ZNVC 1Q1OA 3N3KB 1V80A 4NAWB 2J7QB 4TUUA 2DAJA 2WX0A 3T8MA 2IO3B 1V49A 2J0MA 2O2VB 3APCA 1WY8A 2XBBC 2KWCA 5JH5C 1WE7A 3QJZA 2N1VA 2KQSA 3QAQA 3IBEA 4FHKA 4ICUA 2N9EB 3ZNID 4AP4C 4MGZE 5HKHA 3DCGA 4TQ0A 2EMSA 3MHSD 4FJZA 3CSFA 5C23A 5LXIB 2AL3A 2C7HA 4ZRIA 2ZVNA 4LDTD 4W9HA 2IO0B 2IO1B 3PLVA 4GSWA 2PJHA 2DENB 3R7QA 3L08A 2DX5B 2IZVB 2I1JA 2ZVOA 3NHEB 2HE7A 3MTNB 3OLMD 3RT3B 4GU2A 4OVVA 3QA8A 4ZYNA 4E3CA 1Q5WB 4HLEA 2AWTA 2L76A 1FXTB 2K1FA 4WJNA 4MM3A 3PV1A 5DPRA 3TBLD 4KIKA 3W1SC 5JHAA 4HPLB 3ZRCA 1JRUA 2NPTA 1NI2A 5CTRC 3Q3JA 2FUHB 3EC8A 1X1MA 2YVCA 3A9KB 3N32A 1YX6B 1V6EA 3QHTA 2JXXA 4BFRA 3QQ8B 2M8SA 2KX0A 1J19A 1OTRB 4JIOU 3KUZA 1M94A 4MELA 2C60A 2O6VB 3WAPA 2MP2A 4B9KA 4BBNF 2D10A 5D6JB 2C9WB 2JPHA 1LFDA 2DYMA 5KHQA 4KDIC 4K7WA 1ISNA 4IC7B 1G6JA 2KKCA 2KJRA 3JYUA 4JGHB 3A4SC 3TJPA 3DVGY 4HK2A 2O2VA 2O6VA 3UF8A 2K8BA 3B1LX 1WF9A 1K8RB 2BPSA 2KLCA 2N9XA 4MGYE 2GBKA 4HCNB 2LUEA 3NZUA 4DHZB 3SU8X 4A20A 2DYOA 4ZRJA 3VQIA 3HHMA 4ZRKA 1UBIA 5EDSA 4CHKA 3AXCA 1WGRA 2LJ5A 3VUXA 3KVFB 3QX1A 2DHZA 1WZ3A 4ICVA 4DXAB 2FNJB 1WR6E 2J0KA 4DHZE 2REXA 2GBMA 2KDFB 3A9JA 1WE6A 3ZNGC 2N1WA 4DHJD 4ANUA 2K39A 4TKNA 2UYZB 3UIOB 2KHWB 3PS6A 1P9DU 2KANA 3ZTDA 2KJHB 3OJ3A 3AU4A 3ZUNA 1RLFA 2LVPA 3WA0A 5J18A 2IYDB 2BWES 1VD2A 5C1ZA 1Z5SB 4G50A 3V62A 2KDIA 5FR6A 3VTVA 2D11A 1NBFC 4IUMB 3D32A 3PRPB 2N4FA 4MJSB 2V1YA 3APDA 3PREA 1KM7A 4HXDA 2BGFA 4FA6A 1VCBA 2D2QA 1IPGA 2GOWA 2MLBA 1YX5B 4WWOA 2LRWA 3W1SA 1SE9A 3AU5A 4EZKA 3L0WB 3VAWA 2JZZA 2KC1A 3B08A 3ECIA 3AULA 4W9LA 3APFA 5KHOA 3VUYA 3VXWA 3CF6E 2G4DB 2ZZPB 2CS4A 2ZCCA 2K8HA 2AL6A 3QCAA 2M4NA 4P7IA 2KTRB 4EOYA 1WXSA 1WX7A 2JUOA 1AARA 2WX1A 3BINA 2KMAA 2GBRA 2HD5B 3K9OB 3RUIB 4IWQA 4KZ0A 1TGZB 1BT0A 4NNJB 4E71A 4AJYB 3PHWB 4AWJA 3ZKJC 3DVGX 1V81A 2V4LA 3DVNV 1ZW7A 4BVUC 4MSQB 3ZDMC 3AI5A 2NR2A 1E8YA 2GBJA 2IO2B 5AZGA 3PGEA 3LDZE 2L0TA 2FCSA 3A9KA 5AZFA 3A33B 2KK8A 2W9NA 3R3MA 3W1YA 4HCPB 4IWPA 3X23A 5D2MB 2PPHA 4E74A 1WJNA 1UD7A 4NJ7A 2L7RA 4TQ1A 3H7PA 4NQLB 4HPMB 2OOBB 1WGGA 2R2OA 4I6NB 3EECA 3UQBA 2LI5A 1GNUA 3IFWB 4IWOA 2FIFA 2M0XA 4GDLA 3EFUA 1F9JA 4FJVB 3PZDA 3UIPB 3L17A 4JLCA 2ZNVB 2LGYA 4KIKB 2KZRA 3P2BA 3DBLI 4GDKA 2A4ZA 2KMCA 2KO3A 1R4MI 1TZ1A 4AUQC 1QZEA 4W9EA 3TMPB 1E90A 3VTUA 2NVUI 3WIMA 4RM8A 5JZEB 1E7UA 2MP2B 4GDKB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZLZ A;  2MWS B;  2DZK A;  4IM2 A;  3DBS A;  2JWZ A;  1WGY A;  1RFA A;  3WAM A;  4EUT A;  2IY0 B;  1OEY A;  2PEA A;  2XEW A;  2ZCB A;  4URK A;  2BKF A;  2DZI A;  2JRH A;  1GUA B;  1LXD A;  1WXM A;  4BKT A;  3NY5 A;  4PS3 A;  4GMV A;  5CX3 A;  4HDQ A;  2K25 A;  2KWU B;  2Y5B B;  3QAR A;  1V9J A;  5CHV C;  2JZ3 B;  1SGH A;  2EKE C;  3Q3F A;  2BYV E;  1GG3 A;  1UBQ A;  1TBE A;  2FCN A;  2G3Q B;  1KOT A;  3ONS A;  2JF5 A;  5LXH A;  4FN2 A;  1WGD A;  3ML8 A;  4PYU A;  2ZPN A;  2KC2 A;  2M1M A;  1H4R A;  2RPQ A;  1XD3 B;  1WGH A;  4BKG A;  3K9P B;  2N9P C;  3A9J B;  4M8N A;  2VRR B;  4FJY A;  4LJP B;  4K1R B;  3A1Q A;  3OAW A;  5D94 A;  2CHZ A;  3PLU A;  2KFK A;  4GIV A;  2CKH B;  3DVN U;  4ZDV A;  5JHB A;  2LGD A;  2D3G A;  1KJT A;  2R2Q A;  3RYT A;  4X57 B;  1V86 A;  4WWN A;  2NCN A;  3WAO A;  1YIW A;  3VHT C;  3VTW A;  2MBE A;  3A4R A;  3PRM B;  3RCZ A;  1OEY J;  2FID A;  3H7S A;  2LWP A;  1WMH A;  3ENE A;  4G11 A;  2DAF A;  2MBO A;  4W9J A;  3KH0 A;  3HIZ A;  5AEK B;  2CHX A;  4II3 B;  4B95 A;  1V2Y A;  2JY6 A;  4BKS D;  1YJ1 A;  5E6O A;  1Z2M A;  4F8C B;  4FLH A;  4BOS C;  4BKS A;  2L05 A;  2OJR A;  5DPW A;  2MQJ A;  3GZN I;  1NDD A;  4KZC A;  2FAZ A;  3TL5 A;  4EZL A;  4PS7 A;  4M0W B;  1P3Q U;  4GDL B;  4MEM A;  4M8M A;  3VVW B;  2L0F A;  3M62 B;  3SHQ A;  1E8X A;  5TR5 A;  1S1Q B;  1MG8 A;  1WYW B;  3UQA A;  3VUW A;  1I35 A;  4KSK C;  3DQV A;  4BBN C;  5DPS A;  1WJ6 A;  2MX2 A;  4GOC A;  1KLV A;  2KFJ A;  2KTF A;  3L16 A;  1ZGU B;  3JW0 X;  4G3X B;  5E6P A;  4WJO A;  2KXJ A;  2WYQ A;  4AJW A;  1EF5 A;  1GC7 A;  2MA9 B;  1UEL A;  1XQQ A;  4PS8 A;  4A3P A;  2HJ8 A;  1UGM A;  5IA7 A;  2NS5 A;  2NPT B;  3DBR I;  3GOE A;  4TV3 A;  3ZVV A;  3SDL C;  1GJZ A;  3IG3 A;  2QHO A;  4JQW C;  2L3Z A;  2MSE D;  5IAA C;  2FCQ A;  2C5L C;  3R66 C;  2LRU A;  3ZDT A;  3R7R A;  3KYC D;  3B0A A;  3RD2 A;  3WAL A;  3L13 A;  4ASW C;  2NBV B;  2KTR A;  2JVC A;  3KW5 B;  3KYD D;  4GN1 A;  1WMH B;  3VDZ A;  4A3O A;  4FHJ A;  4IG7 B;  2K8C A;  4MGK E;  2D07 B;  1C1Y B;  3QWZ B;  2ZJD A;  2KDE B;  3V6E B;  2IY1 B;  2LD9 A;  4W9G A;  3S2A A;  5G55 A;  1P98 A;  1GC6 A;  2KLG A;  5GMV A;  4EKU A;  3ZRF A;  2KNB A;  4NJ6 A;  2KN5 A;  5DCN A;  2B3A A;  2RSU A;  2BYE A;  3UGB B;  5L95 C;  1UH6 A;  3ML9 A;  1S3S G;  4GB9 A;  1WR1 A;  3PT2 B;  4FAD A;  4F7Z A;  2KDB A;  4ANX A;  4F1S A;  2BWF A;  4K81 A;  3SD5 A;  3JSV B;  4LJO B;  3HK0 A;  3H1U A;  2Z0D B;  1UZX B;  3H7P B;  1IP9 A;  1WXA A;  4B6W A;  2AEH A;  4HDO A;  2FCM A;  1YD8 U;  3OJ4 B;  1WJ4 A;  2KQ7 A;  3ZIM A;  1C3T A;  2LZ6 A;  4II2 B;  2DYB A;  4ANW A;  4XZ4 A;  3TCA A;  1EUV B;  2KOX A;  2CR5 A;  2A5U A;  3QK0 A;  3L10 B;  2L8J A;  4YL8 A;  4NPN A;  4LDT B;  2YLM A;  4J6I A;  4DBG A;  2PE6 B;  1LQB A;  1T0Y A;  3JSV A;  2NBU A;  3IHP C;  2RD0 A;  4MJS A;  3DBH I;  4FUL A;  1WJU A;  2C7M B;  2MBH A;  3O65 B;  4EFO A;  2ASQ A;  2LAS A;  4I6P A;  2LGX A;  2Z0E B;  4MSM B;  1ZKH A;  2EMT A;  2RGF A;  1WX9 A;  4IM3 A;  4MDK E;  4CYE A;  3NS8 A;  1J0G A;  1R4N I;  3VH3 B;  4MH0 E;  4OVU A;  2DZM A;  2M17 A;  3HM3 A;  3L54 A;  3PSE B;  4KVG B;  2RR9 A;  4AOF A;  2J0J A;  2O6V D;  2BF8 B;  3CMM B;  3PPA A;  1CMX B;  1WI0 A;  2KWV B;  5LLI A;  3RZW C;  2BYF A;  1LM8 B;  1E5W A;  3PTF C;  4W9K A;  3PRZ A;  4KSL C;  3ZO5 B;  3M95 A;  3IVF A;  3NOB A;  4CO7 A;  2HTH A;  2CHW A;  3H6N A;  2MCN B;  3U30 A;  2KD0 A;  4EZJ A;  2MRP A;  2MBQ A;  4K7S A;  3WAN A;  1HE8 A;  2LXC A;  3TIX A;  3DOW A;  3RUL A;  4WAA A;  2LXA A;  2Z59 B;  1A5R A;  5AZH A;  3V61 A;  4W9I A;  4WJP A;  3DDC B;  2LVQ A;  3U7D A;  3EHV A;  2IBI B;  3PVL A;  1J8C A;  3HM6 X;  4HJK A;  3VH4 B;  2XK5 B;  2WWZ A;  4N9F 4;  4WWP A;  2JT4 B;  3NZS A;  3ALB A;  4GGQ A;  2UWQ A;  1WIA A;  4GXB A;  4IM0 A;  3H9D A;  3RZF A;  1OQY A;  4K7U A;  4DHJ B;  1I42 A;  2KJ6 A;  3M63 B;  4W9F A;  1Q0W B;  4FBJ B;  1IYF A;  1E7V A;  4MGI E;  4I6L B;  1RAX A;  4JL9 A;  4W9D A;  4ANV A;  1V5T A;  1WM2 A;  4DDI D;  2MW5 A;  1PQS A;  4DDG D;  2I1K A;  3MJW A;  2K6Q A;  3QIJ A;  2N7D A;  2DZJ A;  2PE9 A;  3T9L A;  3X0W A;  2K6D B;  4LCD E;  2CU1 A;  4WQO B;  1WH3 A;  2C7N B;  2N7E A;  1TTN A;  2XK5 A;  1XT9 B;  3LJ3 A;  4DWF A;  1V5O A;  4KDL B;  4XX5 A;  3UIN B;  3M3J A;  1WZ0 A;  1U4A A;  1WM3 A;  4RMA A;  4HVB A;  4HWI B;  2BKR B;  3I3T B;  2LVO A;  1L7Y A;  5G2N A;  3V60 A;  1E8W A;  4NAW A;  3ZNH B;  4BOZ B;  5BO4 B;  1WX8 A;  2ZPY A;  2JRI B;  1L2N A;  1WRD B;  2GBN A;  3CST A;  3ZTC A;  2KVR A;  1OGW A;  1YQB A;  3ZNZ B;  1H8C A;  3C0R B;  2G45 B;  3N30 A;  5CHF A;  1RRB A;  5J2R A;  1WFY A;  1WXV A;  1E8Z A;  4G0N B;  2NBW B;  4W9C A;  1P1A A;  2GMI C;  4EEW A;  3JVZ X;  5J17 A;  4NQK E;  1P0R A;  4IW0 A;  4NY0 A;  3VFK A;  4KV2 A;  5DPT A;  2AYO B;  5D7G A;  2G4S A;  3DPD A;  4XC2 A;  4DK5 A;  1SIF A;  3KUD B;  2MBB B;  1EO6 A;  3QC8 B;  3A1Q B;  2KFK B;  5E6N A;  2WDT B;  1Y8R C;  2ZEQ A;  3ZW3 A;  2KX3 A;  1D3Z A;  1EF1 A;  5CHW A;  3V6C B;  3PHX B;  2V3S A;  4PYZ A;  5L83 A;  4RM9 A;  2L00 B;  3BY4 B;  3U8Z A;  3KUC B;  4WJQ A;  2ZNV C;  1Q1O A;  3N3K B;  1V80 A;  4NAW B;  2J7Q B;  4TUU A;  2DAJ A;  2WX0 A;  3T8M A;  2IO3 B;  1V49 A;  2J0M A;  2O2V B;  3APC A;  1WY8 A;  2XBB C;  2KWC A;  5JH5 C;  1WE7 A;  3QJZ A;  2N1V A;  2KQS A;  3QAQ A;  3IBE A;  4FHK A;  4ICU A;  2N9E B;  3ZNI D;  4AP4 C;  4MGZ E;  5HKH A;  3DCG A;  4TQ0 A;  2EMS A;  3MHS D;  4FJZ A;  3CSF A;  5C23 A;  5LXI B;  2AL3 A;  2C7H A;  4ZRI A;  2ZVN A;  4LDT D;  4W9H A;  2IO0 B;  2IO1 B;  3PLV A;  4GSW A;  2PJH A;  2DEN B;  3R7Q A;  3L08 A;  2DX5 B;  2IZV B;  2I1J A;  2ZVO A;  3NHE B;  2HE7 A;  3MTN B;  3OLM D;  3RT3 B;  4GU2 A;  4OVV A;  3QA8 A;  4ZYN A;  4E3C A;  1Q5W B;  4HLE A;  2AWT A;  2L76 A;  1FXT B;  2K1F A;  4WJN A;  4MM3 A;  3PV1 A;  5DPR A;  3TBL D;  4KIK A;  3W1S C;  5JHA A;  4HPL B;  3ZRC A;  1JRU A;  2NPT A;  1NI2 A;  5CTR C;  3Q3J A;  2FUH B;  3EC8 A;  1X1M A;  2YVC A;  3A9K B;  3N32 A;  1YX6 B;  1V6E A;  3QHT A;  2JXX A;  4BFR A;  3QQ8 B;  2M8S A;  2KX0 A;  1J19 A;  1OTR B;  4JIO U;  3KUZ A;  1M94 A;  4MEL A;  2C60 A;  2O6V B;  3WAP A;  2MP2 A;  4B9K A;  4BBN F;  2D10 A;  5D6J B;  2C9W B;  2JPH A;  1LFD A;  2DYM A;  5KHQ A;  4KDI C;  4K7W A;  1ISN A;  4IC7 B;  1G6J A;  2KKC A;  2KJR A;  3JYU A;  4JGH B;  3A4S C;  3TJP A;  3DVG Y;  4HK2 A;  2O2V A;  2O6V A;  3UF8 A;  2K8B A;  3B1L X;  1WF9 A;  1K8R B;  2BPS A;  2KLC A;  2N9X A;  4MGY E;  2GBK A;  4HCN B;  2LUE A;  3NZU A;  4DHZ B;  3SU8 X;  4A20 A;  2DYO A;  4ZRJ A;  3VQI A;  3HHM A;  4ZRK A;  1UBI A;  5EDS A;  4CHK A;  3AXC A;  1WGR A;  2LJ5 A;  3VUX A;  3KVF B;  3QX1 A;  2DHZ A;  1WZ3 A;  4ICV A;  4DXA B;  2FNJ B;  1WR6 E;  2J0K A;  4DHZ E;  2REX A;  2GBM A;  2KDF B;  3A9J A;  1WE6 A;  3ZNG C;  2N1W A;  4DHJ D;  4ANU A;  2K39 A;  4TKN A;  2UYZ B;  3UIO B;  2KHW B;  3PS6 A;  1P9D U;  2KAN A;  3ZTD A;  2KJH B;  3OJ3 A;  3AU4 A;  3ZUN A;  1RLF A;  2LVP A;  3WA0 A;  5J18 A;  2IYD B;  2BWE S;  1VD2 A;  5C1Z A;  1Z5S B;  4G50 A;  3V62 A;  2KDI A;  5FR6 A;  3VTV A;  2D11 A;  1NBF C;  4IUM B;  3D32 A;  3PRP B;  2N4F A;  4MJS B;  2V1Y A;  3APD A;  3PRE A;  1KM7 A;  4HXD A;  2BGF A;  4FA6 A;  1VCB A;  2D2Q A;  1IPG A;  2GOW A;  2MLB A;  1YX5 B;  4WWO A;  2LRW A;  3W1S A;  1SE9 A;  3AU5 A;  4EZK A;  3L0W B;  3VAW A;  2JZZ A;  2KC1 A;  3B08 A;  3ECI A;  3AUL A;  4W9L A;  3APF A;  5KHO A;  3VUY A;  3VXW A;  3CF6 E;  2G4D B;  2ZZP B;  2CS4 A;  2ZCC A;  2K8H A;  2AL6 A;  3QCA A;  2M4N A;  4P7I A;  2KTR B;  4EOY A;  1WXS A;  1WX7 A;  2JUO A;  1AAR A;  2WX1 A;  3BIN A;  2KMA A;  2GBR A;  2HD5 B;  3K9O B;  3RUI B;  4IWQ A;  4KZ0 A;  1TGZ B;  1BT0 A;  4NNJ B;  4E71 A;  4AJY B;  3PHW B;  4AWJ A;  3ZKJ C;  3DVG X;  1V81 A;  2V4L A;  3DVN V;  1ZW7 A;  4BVU C;  4MSQ B;  3ZDM C;  3AI5 A;  2NR2 A;  1E8Y A;  2GBJ A;  2IO2 B;  5AZG A;  3PGE A;  3LDZ E;  2L0T A;  2FCS A;  3A9K A;  5AZF A;  3A33 B;  2KK8 A;  2W9N A;  3R3M A;  3W1Y A;  4HCP B;  4IWP A;  3X23 A;  5D2M B;  2PPH A;  4E74 A;  1WJN A;  1UD7 A;  4NJ7 A;  2L7R A;  4TQ1 A;  3H7P A;  4NQL B;  4HPM B;  2OOB B;  1WGG A;  2R2O A;  4I6N B;  3EEC A;  3UQB A;  2LI5 A;  1GNU A;  3IFW B;  4IWO A;  2FIF A;  2M0X A;  4GDL A;  3EFU A;  1F9J A;  4FJV B;  3PZD A;  3UIP B;  3L17 A;  4JLC A;  2ZNV B;  2LGY A;  4KIK B;  2KZR A;  3P2B A;  3DBL I;  4GDK A;  2A4Z A;  2KMC A;  2KO3 A;  1R4M I;  1TZ1 A;  4AUQ C;  1QZE A;  4W9E A;  3TMP B;  1E90 A;  3VTU A;  2NVU I;  3WIM A;  4RM8 A;  5JZE B;  1E7U A;  2MP2 B;  4GDK B; 
#chains in the Genus database with same CATH topology
 2DZK A;  4BZA A;  2JWZ A;  2AQ3 B;  3AE5 B;  1OEY A;  4LNK A;  2SAK A;  2XEW A;  2BKF A;  1WXM A;  5CHV C;  2B76 B;  2KWU B;  2Y5B B;  2JZ3 B;  4PK1 A;  1SGH A;  2EKE C;  3EFC A;  2BYV E;  1HTO A;  3ONS A;  4FXC A;  1KOT A;  5LXH A;  4FN2 A;  4PYU A;  2KC2 A;  3HRD D;  2INN E;  2RPV A;  4A8X C;  3K9P B;  2N9P C;  1WWT A;  4LJP B;  4K1R B;  3A1Q A;  3OAW A;  5D94 A;  5IO9 A;  3AE9 B;  4RF0 A;  4OW0 A;  4ZDV A;  3DVN U;  4WWN A;  3WAO A;  1F2R I;  1YIW A;  3VHT C;  3VTW A;  4C4V A;  2QCZ A;  3HIZ A;  4II3 B;  1V2Y A;  4BKS D;  2D5G A;  4FLH A;  3NS1 A;  4BOS C;  3B2G A;  2L05 A;  3BYY B;  2WDV B;  4PS7 A;  4M8M A;  4DXG A;  2L0F A;  1XCQ L;  1XXG A;  1MJD A;  1JWB D;  4KGS A;  3PZ7 A;  2KFJ A;  2WYQ A;  4H2A A;  1EF5 A;  1T5X D;  4C80 A;  1XQQ A;  5HG2 A;  2K5P A;  4TV3 A;  3ZVV A;  1C77 A;  3AEF B;  1GJZ A;  2QHO A;  4JQW C;  3OWE B;  2FCQ A;  2C5L C;  3IT4 B;  3Q8B A;  3TEZ A;  3R7R A;  3B0A A;  3W5V B;  1V1P B;  3VDZ A;  4GN1 A;  2YEP B;  4FHJ A;  4IG7 B;  4MGK E;  1C1Y B;  3QWZ B;  3S2A A;  1ACC A;  2H89 B;  3RPF C;  5L95 C;  1UH6 A;  2D3A A;  1S3S G;  4GB9 A;  4FAD A;  3AE8 B;  4F1S A;  4K81 A;  3DWG C;  4LJO B;  1UZX B;  3H7P B;  1IP9 A;  4YL8 A;  1FXA A;  2L8J A;  4J6I A;  1LQB A;  1TS4 A;  2MEK A;  2WXI A;  2RD0 A;  1ZXI A;  3DBH I;  2LAS A;  1C76 A;  1TT5 B;  2RGF A;  3VH3 B;  4YWG G;  4ARC A;  3L54 A;  3PSE B;  4AOF A;  3RZW C;  2KWV B;  5LLI A;  3U7Z A;  3AED B;  3IVF A;  1STE A;  2CHW A;  3U30 A;  3VRA B;  4WAA A;  2LXA A;  2Z59 B;  4QAY A;  1A5R A;  4W9I A;  4USA A;  3DDC B;  3U7D A;  2XNA C;  2IBI B;  3HM6 X;  3PO0 A;  4HJK A;  2XK5 B;  4N9F 4;  1FCL A;  4WWP A;  3NZS A;  3ALB A;  2UWQ A;  1I42 A;  4K7U A;  3M63 B;  3ZJV A;  1TKE A;  4FBJ B;  4DDI D;  2K9X A;  4DDG D;  3MJW A;  1V97 A;  2WXR A;  3FIL B;  2N7E A;  4OZC A;  1XT9 B;  1V5O A;  2FBW B;  2Y3A A;  1J7A A;  2MJE A;  4HVB A;  2KVZ A;  1XCT L;  1E8W A;  1UF0 A;  4A9A A;  3ZXR A;  3CST A;  1OGW A;  1YQB A;  1YJJ A;  2NTT A;  1UWX A;  1HQR D;  3GZN B;  2GRI A;  2NTS A;  2N0S B;  2K3U A;  2NBW B;  1P1A A;  2GMI C;  3JVZ X;  5J17 A;  4NY0 A;  5DPT A;  1MHX A;  2EKI A;  3KUD B;  1MPE A;  3RNC C;  3A1Q B;  2CU3 A;  3B9J A;  2OJW A;  2KFK B;  2ZEQ A;  3ZW3 A;  2KX3 A;  1D3Z A;  5CHW A;  3RNG C;  2V3S A;  2L00 B;  4LNI A;  3U8Z A;  5JXV A;  1Q1O A;  3N3K B;  1V80 A;  3AE1 B;  2KAJ A;  3T8M A;  2HJ1 A;  1SE4 A;  4XWW A;  3R8B A;  3P4P B;  1SBB B;  4FJZ A;  4W9H A;  2IO1 B;  1N5X A;  3R7Q A;  3MTN B;  3OLM D;  3RT3 B;  3CWI A;  2W54 A;  4ZYN A;  1DGJ A;  3DHH C;  2JWU A;  3W1S C;  2QMT A;  3ZRC A;  3AB5 A;  2NPT A;  3A9K B;  1YX6 B;  3QHT A;  4YTP B;  4BFR A;  2KAC A;  3QQ8 B;  1FIQ A;  2M8S A;  2KX0 A;  4XE0 A;  3P42 A;  4JIO U;  1M94 A;  2C60 A;  2O6V B;  4B9K A;  5D6J B;  2C9W B;  1FPY A;  1LFD A;  2DYM A;  1YOV B;  2KJR A;  2RMM A;  3A4S C;  3P4S B;  2BPS A;  3I9V 1;  4MGY E;  2LUE A;  2BT6 A;  4DHZ B;  4WUR A;  2DYO A;  2BBC A;  4RGO S;  1UBI A;  3AXC A;  1WGR A;  1D5M C;  2CJN A;  2LJ5 A;  3QX1 A;  3AEE B;  4KKJ A;  4DHZ E;  4JWS C;  4LNF A;  3CIR B;  3ZNG C;  2N1W A;  2KHW B;  1JWS D;  1CK1 A;  3SEB A;  1L4D B;  3AE7 B;  3AEG B;  2LVP A;  3WA0 A;  1ESF A;  2WXJ A;  3NJT A;  1C4P A;  1MHH E;  2L1A A;  5IKC M;  1AN8 A;  1VCB A;  1IPG A;  2D2Q A;  1YX5 B;  1FNV A;  3W1S A;  1SE9 A;  3AU5 A;  2WXG A;  2JZP A;  1SB3 C;  2JZZ A;  3VUY A;  2G4D B;  2ZZP B;  2ZCC A;  3NVV A;  3MHZ A;  3RNB C;  2AL6 A;  2VH2 A;  2WP9 B;  3AN1 A;  2JUO A;  1F2R C;  3BIN A;  4AJY B;  3PHW B;  1BML C;  3DVG X;  2V4L A;  3KWL A;  1FNW A;  4ACF A;  1E8Y A;  1FM0 D;  3KLS X;  2KK8 A;  2W9N A;  3FAH A;  4IWP A;  1DOY A;  3Q2A C;  2M19 A;  4NJ7 A;  4US9 A;  1I4H A;  3UQB A;  2PKO A;  2X38 A;  5IOI A;  3EFU A;  3Q8A A;  4ZHO A;  3PZD A;  1SE2 A;  3L17 A;  5FKA C;  1L4Z B;  4GDK A;  1QF6 A;  1TZ1 A;  4P16 A;  3ZJU A;  1PUT A;  5EE9 A;  2NVU I;  4P6V F;  5JZE B;  3LYY A;  4IM2 A;  3ZGZ A;  1RFA A;  4EUT A;  2ZCB A;  3AE4 B;  1AW7 A;  2DZI A;  2ZW1 A;  4RNA A;  1SJH D;  1LXD A;  1ZDX A;  3Q3F A;  1UBQ A;  1WGD A;  3ML8 A;  2M1M A;  1XD3 B;  2WGS A;  2DBY A;  1WGH A;  2PMV A;  3RNE C;  5BMH A;  2UU7 A;  2DLB A;  3NVZ A;  2CHZ A;  3PLU A;  2LGD A;  3RYT A;  1E7U A;  1F1H A;  3KWV A;  3ZXV A;  2FUG 1;  2LWP A;  4G11 A;  3KH0 A;  1AYF A;  2CHX A;  5BYS A;  3IXS A;  1YJ1 A;  4BKS A;  2XN9 C;  1TKY A;  2FAZ A;  3TL5 A;  1KFY B;  1P3Q U;  1IBX A;  2W3R A;  2BS4 B;  3VUW A;  3L4P A;  3L16 A;  1FO4 A;  1TYG B;  3JW0 X;  4G3X B;  4WJO A;  2WXK A;  1ENF A;  2M56 B;  4PS8 A;  4LLG M;  1PGX A;  1UGM A;  2WU2 B;  4OZB A;  2NS5 A;  2NPT B;  3DBR I;  3IG3 A;  2L3Z A;  1FRD A;  3R66 C;  3AE2 B;  2LRU A;  2DNF A;  3KYC D;  3L13 A;  4ASW C;  2KTR A;  3KW5 B;  4A3O A;  1WMH B;  1I4X A;  3DHI C;  2WDR B;  3MP9 A;  4W9G A;  3RN9 C;  5G55 A;  4NJ6 A;  1L0V B;  2BYE A;  3UGB B;  3ML9 A;  2IPK D;  4P1B C;  3VR8 B;  2BWF A;  3E56 A;  1IUE A;  3SD5 A;  3HK0 A;  4WQM A;  2Z0D B;  2ON8 A;  2WQY B;  2AEH A;  3Q8F A;  3IAS 1;  3OJ4 B;  1WJ4 A;  2KQ7 A;  3AH7 A;  3ZIM A;  1C3T A;  2LZ6 A;  2DWQ A;  3QK0 A;  2CR5 A;  5TSS A;  2YLM A;  1ROE A;  3AEC B;  1P7E A;  3N1Z C;  1TJE A;  2SEB D;  4MJS A;  1WJU A;  1KLU D;  5G5G A;  4JX1 C;  5H8Y E;  1L6V A;  1N5W A;  1WX9 A;  4MDK E;  2WDQ B;  1R4N I;  4HPP A;  2D3C A;  4KVG B;  1JML A;  2AQ1 B;  3PPA A;  1CMX B;  3PZ8 A;  4S0R A;  2BYF A;  1LM8 B;  3UI3 A;  1E5W A;  1C79 A;  3PRZ A;  3W9C B;  2HTH A;  4EZJ A;  2MRP A;  2MBQ A;  1HE8 A;  2LXC A;  3DOW A;  3RUL A;  4AQ7 A;  5AZH A;  3V61 A;  2LVQ A;  1J8C A;  3EHV A;  1QOB A;  3N9Y C;  2AQ2 B;  4GGQ A;  4IM0 A;  1WIA A;  3RZF A;  3H9D A;  3BK2 A;  4I6L B;  1R4N B;  4ANV A;  1L0Y B;  4LTU A;  1V5T A;  1E0Z A;  2I1K A;  3QIJ A;  2N7D A;  1WGK A;  4LCD E;  4WQO B;  2RDH A;  2XK5 A;  3LJ3 A;  4DWF A;  4KDL B;  3UIN B;  4M02 A;  1F0Z A;  1U4A A;  1WM3 A;  2OHF A;  4YSZ B;  4HWI B;  2LVO A;  3Q8C A;  1B1Z A;  4BOZ B;  4C56 C;  2ZPY A;  4ZYS A;  1L2N A;  2GBN A;  4A6Q A;  3ZTC A;  4KKI A;  5CHF A;  2G45 B;  2M0A A;  1RRB A;  1WFY A;  3GE8 C;  1WXV A;  3V3X A;  3GS2 A;  4EEW A;  1T3Q A;  4NQK E;  1FMA D;  3H8H A;  4KV2 A;  1V8C A;  5D7G A;  4XC2 A;  4DK5 A;  1WXQ A;  2MBB B;  3QC8 B;  5E6N A;  4LNN A;  4N59 A;  1NEN B;  3V6C B;  2QIL A;  4MAC A;  3BK1 A;  1C4C A;  1K53 A;  4TUU A;  2DAJ A;  1XF5 L;  2O2V B;  3APC A;  3Q14 C;  4NJC A;  2KWC A;  5JH5 C;  1WE7 A;  3I63 C;  4K3B A;  3RNA C;  2LGI A;  1ZPS A;  4AP4 C;  4MGZ E;  5HKH A;  3DCG A;  1JRP A;  1N6Z A;  3MHS D;  4DQO C;  3NVW A;  2WXL A;  3W5U B;  5HHD G;  2C7H A;  3MJ5 A;  4ZRI A;  1UGJ A;  1RYJ A;  2W55 A;  2PJH A;  4KGR A;  1VDV A;  2DEN B;  3L08 A;  2DX5 B;  1R7S A;  3URY A;  4RGN A;  2E3T A;  4E3C A;  1Q5W B;  2RDG A;  4WJN A;  4MM3 A;  5DPR A;  2WNM A;  5JHA A;  4HPL B;  1JRU A;  3Q3J A;  5H92 C;  1X1M A;  1KH0 A;  2JXX A;  4YSY B;  5GXG B;  2JQR B;  1J19 A;  4C00 A;  1OTR B;  2JSV X;  4K3C A;  4MEL A;  2BYT A;  2MP2 A;  1JWA D;  4MT5 A;  3ZQ4 A;  1MG4 A;  3JYU A;  3ABV B;  2I38 A;  3FIL A;  3UF8 A;  2Y5P A;  1T0Q C;  1NYQ A;  2GBK A;  4HCN B;  3NZU A;  2E6X A;  3SU8 X;  1K52 A;  1QIL A;  3VQI A;  1PYW D;  5EDS A;  3DBH B;  1D5X C;  3VUX A;  3KVF B;  3EUB 2;  1WR6 E;  3RMK C;  2JYT A;  2UYZ B;  4IDI A;  2KAN A;  3AU4 A;  3ZUN A;  2IYD B;  1Z5S B;  2N9L A;  3ZYY X;  2KDI A;  2D11 A;  4IUM B;  1CQV A;  2WXN A;  3PRE A;  1KM7 A;  4JPS A;  4YT0 B;  4ARI A;  4EZK A;  3VXW A;  3BII D;  3AUL A;  4W9L A;  3CF6 E;  1XLN A;  2CS4 A;  2NMQ A;  2K8H A;  2M4N A;  2KTR B;  1WXS A;  1WX7 A;  2WX1 A;  2KMA A;  2GBR A;  5D3D A;  1AWD A;  3K9O B;  3RUI B;  3Q3M C;  1E7P B;  5E6J A;  1V81 A;  4BVU C;  3ZDM C;  3AI5 A;  5AZG A;  3LDZ E;  3A33 B;  4HCP B;  3X23 A;  5D2M B;  2RDB C;  1VZ7 A;  3GP7 A;  2PPH A;  1UD7 A;  2L7R A;  4TQ1 A;  4NQL B;  2KWD A;  3ZJT A;  1GNU A;  2WXM A;  3UIP B;  1FD6 A;  1J7B A;  2IGH A;  3KQ4 A;  3P2B A;  2KO3 A;  4W9E A;  3VTU A;  2QEJ C;  3WIM A;  2BQQ A;  2MP2 B;  3ZLZ A;  1ZXH A;  2MWS B;  3BYT B;  3DBS A;  5BYR A;  3WAM A;  2IY0 B;  3DBR B;  3BVM A;  4URK A;  1I4G A;  2JRH A;  1GUA B;  3NY5 A;  3R2T A;  4PS3 A;  3T3N A;  5CX3 A;  4C7Y A;  2W3S A;  3DHG C;  2HTM E;  2JF5 A;  1XLQ A;  4JE3 B;  3I5J C;  4BKG A;  3A9J B;  4M8N A;  4FJY A;  1ZE3 D;  4XDC A;  2KFK A;  5JHB A;  4X57 B;  2NCN A;  2MBE A;  3A4R A;  3RCZ A;  1OEY J;  2FID A;  3H7S A;  4B95 A;  2L32 A;  5BYQ A;  1MVK A;  1F77 A;  1JW9 D;  5IN7 A;  2MQJ A;  4A55 A;  1ZDV A;  1HA5 A;  4M00 A;  3VVW B;  1SIJ A;  1E8X A;  1TY0 A;  2LGS A;  5TR5 A;  1MG8 A;  1WYW B;  4KSK C;  3DQV A;  4BBN C;  5DPS A;  4GOC A;  1KLV A;  2KTF A;  2WU5 B;  3E9S A;  4WAF A;  1TS5 A;  2KXJ A;  3TEW A;  2HJ8 A;  3GB1 A;  5IA7 A;  3GOE A;  1SF0 A;  3SDL C;  1B9R A;  4HRO A;  1T0R C;  1GOZ A;  3ZDT A;  3RD2 A;  1XO3 A;  1K51 A;  1L5P A;  2JVC A;  3KYD D;  2KDM A;  3IT6 B;  4R3D A;  3V05 A;  2KDE B;  3V6E B;  2IY1 B;  2W82 A;  3SFE B;  1P98 A;  5GMV A;  3RI7 C;  2B3A A;  4M0W A;  1JAL A;  2RSU A;  2WLB A;  4AS1 A;  2Q5W D;  2PIA A;  3PT2 B;  2VZK B;  1KTK A;  2BW2 A;  3DBL B;  3H1U A;  1OQR A;  2FCM A;  1YD8 U;  1OFF A;  4II2 B;  4ANW A;  4CQN A;  4XZ4 A;  2KOX A;  4NPN A;  4LDT B;  1YMH E;  2PE6 B;  1FEH A;  2OED A;  3C8Y A;  3JSV A;  3IHP C;  1HEZ E;  2BS3 B;  4FUL A;  3FKY A;  4EFO A;  2ASQ A;  4I6P A;  2LGX A;  2Z0E B;  4MSM B;  1ZKH A;  2EMT A;  4IM3 A;  4CYE A;  3NS8 A;  3U4E G;  3BVZ A;  1XLP A;  2EEL A;  4MH0 E;  2IGG A;  2DZM A;  2M17 A;  2RR9 A;  2J0J A;  2BF8 B;  3CMM B;  1JRO A;  3PTF C;  4KSL C;  3U52 E;  3NOB A;  1OQQ A;  4CO7 A;  2V0G A;  1F52 A;  4YXD B;  2GB1 A;  4HKQ A;  3H6N A;  2JXT A;  1TZO A;  3GE3 C;  2KD0 A;  2INP E;  3WAN A;  3TIX A;  5EE1 A;  1D4B A;  5FR3 A;  4WJP A;  2BB5 A;  3HVD A;  3MC0 B;  4DHJ B;  1CJE A;  2KJ6 A;  1EWC A;  1E7V A;  4W9D A;  1RAX A;  4JL9 A;  1EWY C;  1WM2 A;  2MW5 A;  1PQS A;  2ICI A;  3Q8E A;  2K6Q A;  1JWM D;  2PE9 A;  2K6D B;  1ET9 A;  2CU1 A;  1WH3 A;  1HZ5 A;  1N63 A;  4MM3 B;  3AM9 A;  4XX5 A;  2LEK A;  3M3J A;  2JX5 A;  2BKR B;  3I3T B;  3DWM A;  3ZNH B;  3SFD B;  5BO4 B;  1WX8 A;  2JRI B;  1WRD B;  1NI3 A;  2KVR A;  4XGA B;  1H8C A;  5C3J B;  2LMC A;  2MJD A;  1XLO A;  4D2K A;  5J2R A;  1YN5 A;  4HKZ E;  1FXI A;  4G0N B;  1R4M B;  1HZ6 A;  4IW0 A;  3VFK A;  2G4S A;  1SIF A;  1TY2 A;  1C4A A;  1QOF A;  2KN4 A;  2WDT B;  1Y8R C;  4WWM A;  5HFY A;  1GPX A;  4PYZ A;  1L0X B;  3BY4 B;  2ZNV C;  1Q10 A;  2J7Q B;  2IO3 B;  1MI0 A;  3AMZ A;  1PFD A;  5BMI A;  4DXF A;  2N1V A;  3QAQ A;  3IBE A;  4FHK A;  4ICU A;  3ZNI D;  1QKZ A;  4RF1 A;  3J9C A;  4YTN B;  2GLS A;  2EMS A;  2KMM A;  4BAX A;  3AE3 B;  3BWU D;  3CSF A;  5C23 A;  5LXI B;  2AL3 A;  2ZVN A;  4LDT D;  4L23 A;  1IGC A;  4RGM A;  2IZV B;  1D6E C;  2I1J A;  3NHE B;  2HE7 A;  2R61 A;  4GU2 A;  4OVV A;  1PGA A;  2G9H D;  4HLE A;  2AWT A;  2L76 A;  2K1F A;  3PV1 A;  3TBL D;  2KT7 A;  1NI2 A;  4ITK A;  2FUH B;  3EC8 A;  2V3N A;  2YVC A;  3N32 A;  3P4R B;  4RGT A;  1E6E B;  2J52 A;  3KUZ A;  2D3B A;  4KDI C;  2JYE A;  1ISN A;  2PVG C;  4IC7 B;  1G6J A;  4JGH B;  3TJP A;  3DVG Y;  4HK2 A;  2O2V A;  2WXF A;  1EM7 A;  3B1L X;  1WF9 A;  3Q6B A;  2N9X A;  1K50 A;  3WCQ A;  4A20 A;  4ZRJ A;  1FFU A;  3HHM A;  1NVI D;  2BTE A;  4CHK A;  4OZA A;  3I57 A;  2DHZ A;  2WHI A;  1I4Q A;  5AUK A;  1A70 A;  2J0K A;  4RCO A;  2GBM A;  2KDF B;  3A9J A;  4ANU A;  3UIO B;  3NVY A;  3PS6 A;  2V4I B;  1GB4 A;  3N1X C;  3ZTD A;  1ZP0 B;  2KJH B;  3OJ3 A;  1EU4 A;  1RLF A;  1ZUD 2;  5J18 A;  2BWE S;  5C1Z A;  4G50 A;  3V62 A;  5FR6 A;  3VTV A;  1NBF C;  3D32 A;  2WXH A;  4MJS B;  3APD A;  4HXD A;  4FA6 A;  2BGF A;  1FNU A;  3HUI A;  4WWO A;  1WSP A;  3VRB B;  2IGD A;  3AE6 B;  3L0W B;  3R2I A;  2KC1 A;  1NYR A;  5KHO A;  4OVZ A;  1IGD A;  1MFW A;  4P7I A;  3Q3N C;  1AAR A;  2LFI A;  2HD5 B;  2JU6 X;  4IWQ A;  1JWU D;  4NNJ B;  1VZ6 A;  4E71 A;  1TIF A;  1ZW7 A;  2N7J A;  2NR2 A;  2IO2 B;  2L0T A;  5AZF A;  3A9K A;  1NEK B;  1FRR A;  4YSX B;  3FC4 A;  4OHJ A;  1WJN A;  4L2Y A;  3U2S C;  4S17 A;  2PVO D;  1WGG A;  4LK0 M;  2LI5 A;  4IWO A;  1TS3 A;  2WS3 B;  1F9J A;  1TS2 A;  3Q3O C;  4JLC A;  4KIK B;  2LGY A;  2V9H A;  3ETR A;  1DOX A;  1YQ4 B;  3DBL I;  2A4Z A;  2KMC A;  2QSD A;  5EE0 A;  4IKG A;  1E90 A;  4RM8 A;  2L83 A;  1VZ8 A;  3B2F A;  1SE3 A;  1WGY A;  2IND C;  2PEA A;  1SJE D;  4ZHP A;  2MHJ A;  1N62 A;  3Q69 A;  2N9K A;  4BKT A;  4GMV A;  4HDQ A;  2AX5 A;  2K25 A;  2QJL A;  3QAR A;  1V9J A;  1GG3 A;  1TBE A;  2FCN A;  2G3Q B;  2ZPN A;  1H4R A;  2RPQ A;  2VRR B;  1GAQ B;  2I2Y A;  5LNK 1;  4ZRP A;  4GIV A;  2CKH B;  1RWS A;  2R2Q A;  1BUI C;  1KJT A;  2D3G A;  1V86 A;  2YEP F;  3PRM B;  2MH7 A;  3W2D A;  3O13 A;  1FCC C;  1UUP A;  1WMH A;  3ENE A;  1VLB A;  2DAF A;  2MBO A;  4W9J A;  5AEK B;  2H88 B;  3BVG A;  4REZ A;  2LHE A;  2K22 A;  1N60 A;  2JY6 A;  5E6O A;  4F8C B;  1Z2M A;  2J4X A;  2OJR A;  5DPW A;  3GZN I;  1NDD A;  5C2T B;  1KF6 B;  4KZC A;  4EZL A;  4M0W B;  3SR6 A;  4GDL B;  4MEM A;  4ZRQ A;  3P4Q B;  3M62 B;  3SHQ A;  1S1Q B;  3UQA A;  2MJ3 A;  1I35 A;  3AV8 A;  1WJ6 A;  2MX2 A;  2WXQ A;  1ZGU B;  5E6P A;  4AJW A;  1GC7 A;  1JCK B;  2MA9 B;  1UEL A;  2K0P A;  4A3P A;  2LUM A;  1YN4 A;  1YJI A;  2X8X X;  1DOI A;  2L52 A;  2MSE D;  2IDY A;  5IAA C;  1QLB B;  1UNS A;  3T3O A;  3WAL A;  2PW9 A;  2NBV B;  5I4D A;  1KLG D;  2K8C A;  2D07 B;  4XWT A;  2ZJD A;  4KGT A;  4NAM A;  1KRH A;  2LD9 A;  4HJG E;  3P63 A;  2KLG A;  1GC6 A;  4EKU A;  3ZRF A;  4US8 A;  2KNB A;  2KN5 A;  5DCN A;  2LJI A;  3OG5 A;  1YQ3 B;  3EGR A;  1WR1 A;  4F7Z A;  2KDB A;  4ANX A;  3RFZ B;  3JSV B;  4WIP A;  4M01 A;  4A90 A;  4B0M A;  1GB1 A;  1WXA A;  4B6W A;  4HDO A;  4O1N A;  5MPO A;  2DYB A;  3TCA A;  1EUV B;  2A5U A;  3L10 B;  1SXT A;  1VJK A;  4DBG A;  1T0Y A;  2NBU A;  4WH4 A;  1C9F A;  2C7M B;  3O65 B;  2MBH A;  2BS2 B;  4RFB A;  1HTQ A;  1J0G A;  4OVU A;  3HM3 A;  1J7C A;  2O6V D;  1HXY D;  1WI0 A;  2Z8L A;  2BVC A;  1E10 A;  4W9K A;  3MFG A;  3ZO5 B;  3M95 A;  2CJO A;  1PGB A;  3NUH B;  3MC8 A;  4N58 A;  2MCN B;  4K7S A;  4NZL B;  1EU3 A;  2QIE B;  1JQ4 A;  2ZW0 A;  3PVL A;  3VH4 B;  2WWZ A;  2ACZ B;  2JT4 B;  4GXB A;  1I4P A;  1FFV A;  1OQY A;  2FE8 A;  1E9M A;  1C78 A;  4W9F A;  1Q0W B;  1IYF A;  4MGI E;  4B0E A;  3N1Y C;  2Y5C A;  1QOG A;  4XDD A;  3IAM 1;  2VH1 A;  4XYC A;  5D3I B;  2DZJ A;  3T9L A;  3X0W A;  4P1C C;  4KX6 B;  2C7N B;  1TTN A;  2TSS A;  3NG0 A;  4PT5 A;  1DYQ A;  1WZ0 A;  2INC C;  4N6E B;  4RMA A;  4C7Z A;  1L7Y A;  5G2N A;  1D5Z C;  3V60 A;  4NAW A;  3EA6 A;  5BMG A;  1VRA B;  1T0S C;  3ZNZ B;  3N20 C;  3C0R B;  3N30 A;  4L1B A;  4TSS A;  3C19 A;  4GLS C;  1E8Z A;  4W9C A;  1P0R A;  2IJ0 A;  2AYO B;  3DPD A;  1PDX A;  1EO6 A;  1RFK A;  2PLP A;  1EF1 A;  1V1O A;  4HEA 1;  1I4R A;  1M4V A;  3PHX B;  5L83 A;  4RM9 A;  5G5H A;  3KUC B;  4WJQ A;  4C4V B;  4NAW B;  2WX0 A;  2J0M A;  1V49 A;  1ZOY B;  1WY8 A;  2XBB C;  3QJZ A;  2KQS A;  4YTM B;  2N9E B;  1YNT E;  4TQ0 A;  3BZD B;  1RM6 C;  2V3P A;  2G1E A;  4TMA B;  1ET6 A;  1BXT A;  1VR9 A;  4EE2 A;  3TUO A;  2IO0 B;  3PLV A;  4GSW A;  4LNO A;  2ZVO A;  2WXO A;  1V1P A;  2J53 A;  2KYW A;  5FK9 C;  4IOI E;  3RNF C;  3QA8 A;  1FXT B;  1UWM A;  3TEX A;  4KIK A;  4UDU C;  1XEE A;  5CTR C;  1T6B X;  3AEA B;  4JWU C;  1LGR A;  1V6E A;  2GI9 A;  2LHD A;  2QDF A;  2VZK D;  1WYG A;  4Q2J A;  3WAP A;  4BBN F;  2D10 A;  5KHQ A;  2JPH A;  4ZOH C;  4K7W A;  1QQR A;  2KKC A;  4MH8 A;  1Y56 A;  2O6V A;  2K8B A;  1K8R B;  2KLC A;  4RH6 A;  1QOA A;  4ZRK A;  5AUI A;  1TKG A;  3LB8 C;  1WZ3 A;  1LO5 D;  4ICV A;  4DXA B;  2FNJ B;  2REX A;  3TSS A;  1WE6 A;  3NRZ A;  4DHJ D;  2BB6 A;  2K39 A;  4TKN A;  1P9D U;  5T8I A;  1IBX B;  2QC8 A;  5HI1 A;  1VD2 A;  1I7H A;  3PRP B;  2N4F A;  2V1Y A;  4HRS A;  1P7F A;  2GOW A;  2MLB A;  2LRW A;  3TEY A;  3VAW A;  3B08 A;  3ECI A;  3APF A;  1SSN A;  4EOY A;  3QCA A;  3P1M A;  1CZP A;  4KZ0 A;  1TGZ B;  1BT0 A;  4AWJ A;  1QT9 A;  3ZKJ C;  3DVN V;  4MSQ B;  5EE3 A;  2GBJ A;  3PGE A;  2FCS A;  1YN3 A;  2J42 A;  3R3M A;  2WXP A;  3W1Y A;  1WRI A;  1L6U A;  4E74 A;  3H7P A;  4HPM B;  2OOB B;  5IP4 D;  2R2O A;  4I6N B;  3EEC A;  3LXF A;  2KQ4 X;  3IFW B;  3HVZ A;  2FIF A;  1N61 A;  2M0X A;  4GDL A;  4FJV B;  2PTL A;  2ZNV B;  2KZR A;  3AEB B;  1SEB D;  1R4M I;  4AUQ C;  1QZE A;  3TMP B;  3VR9 B;  3NZ3 A;  2ONQ A;  2HDE A;  4J3O D;  3MC9 A;  4GDK B; 
#chains in the Genus database with same CATH homology
 3ZLZ A;  2MWS B;  2DZK A;  4IM2 A;  3DBS A;  2JWZ A;  1WGY A;  1RFA A;  3WAM A;  4EUT A;  2IY0 B;  1OEY A;  2PEA A;  2XEW A;  2ZCB A;  4URK A;  2BKF A;  2DZI A;  2JRH A;  1GUA B;  1LXD A;  1WXM A;  4BKT A;  3NY5 A;  4PS3 A;  4GMV A;  5CX3 A;  4HDQ A;  2K25 A;  2KWU B;  2Y5B B;  3QAR A;  1V9J A;  5CHV C;  2JZ3 B;  1SGH A;  2EKE C;  3Q3F A;  2BYV E;  1GG3 A;  1UBQ A;  1TBE A;  2FCN A;  2G3Q B;  1KOT A;  3ONS A;  2JF5 A;  5LXH A;  4FN2 A;  1WGD A;  3ML8 A;  4PYU A;  2ZPN A;  2KC2 A;  2M1M A;  1H4R A;  2RPQ A;  1XD3 B;  1WGH A;  4BKG A;  3K9P B;  2N9P C;  3A9J B;  4M8N A;  2VRR B;  4FJY A;  4LJP B;  4K1R B;  3A1Q A;  3OAW A;  5D94 A;  2CHZ A;  3PLU A;  2KFK A;  4GIV A;  2CKH B;  3DVN U;  4ZDV A;  5JHB A;  2LGD A;  2D3G A;  1KJT A;  2R2Q A;  3RYT A;  4X57 B;  1V86 A;  4WWN A;  2NCN A;  3WAO A;  1YIW A;  3VHT C;  3VTW A;  2MBE A;  3A4R A;  3PRM B;  3RCZ A;  1OEY J;  2FID A;  3H7S A;  2LWP A;  1WMH A;  3ENE A;  4G11 A;  2DAF A;  2MBO A;  4W9J A;  3KH0 A;  3HIZ A;  5AEK B;  2CHX A;  4II3 B;  4B95 A;  1V2Y A;  2JY6 A;  4BKS D;  1YJ1 A;  5E6O A;  1Z2M A;  4F8C B;  4FLH A;  4BOS C;  4BKS A;  2L05 A;  2OJR A;  5DPW A;  2MQJ A;  3GZN I;  1NDD A;  4KZC A;  2FAZ A;  3TL5 A;  4EZL A;  4PS7 A;  4M0W B;  1P3Q U;  4GDL B;  4MEM A;  4M8M A;  3VVW B;  2L0F A;  3M62 B;  3SHQ A;  1E8X A;  5TR5 A;  1S1Q B;  1MG8 A;  1WYW B;  3UQA A;  3VUW A;  1I35 A;  4KSK C;  3DQV A;  4BBN C;  5DPS A;  1WJ6 A;  2MX2 A;  4GOC A;  1KLV A;  2KFJ A;  2KTF A;  3L16 A;  1ZGU B;  3JW0 X;  4G3X B;  5E6P A;  4WJO A;  2KXJ A;  2WYQ A;  4AJW A;  1EF5 A;  1GC7 A;  2MA9 B;  1UEL A;  1XQQ A;  4PS8 A;  4A3P A;  2HJ8 A;  1UGM A;  5IA7 A;  2NS5 A;  2NPT B;  3DBR I;  3GOE A;  4TV3 A;  3ZVV A;  3SDL C;  1GJZ A;  3IG3 A;  2QHO A;  4JQW C;  2L3Z A;  2MSE D;  5IAA C;  2FCQ A;  2C5L C;  3R66 C;  2LRU A;  3ZDT A;  3R7R A;  3KYC D;  3B0A A;  3RD2 A;  3WAL A;  3L13 A;  4ASW C;  2NBV B;  2KTR A;  2JVC A;  3KW5 B;  3KYD D;  4GN1 A;  1WMH B;  3VDZ A;  4A3O A;  4FHJ A;  4IG7 B;  2K8C A;  4MGK E;  2D07 B;  1C1Y B;  3QWZ B;  2ZJD A;  2KDE B;  3V6E B;  2IY1 B;  2LD9 A;  4W9G A;  3S2A A;  5G55 A;  1P98 A;  1GC6 A;  2KLG A;  5GMV A;  4EKU A;  3ZRF A;  2KNB A;  4NJ6 A;  2KN5 A;  5DCN A;  2B3A A;  2RSU A;  2BYE A;  3UGB B;  5L95 C;  1UH6 A;  3ML9 A;  1S3S G;  4GB9 A;  1WR1 A;  3PT2 B;  4FAD A;  4F7Z A;  2KDB A;  4ANX A;  4F1S A;  2BWF A;  4K81 A;  3SD5 A;  3JSV B;  4LJO B;  3HK0 A;  3H1U A;  2Z0D B;  1UZX B;  3H7P B;  1IP9 A;  1WXA A;  4B6W A;  2AEH A;  4HDO A;  2FCM A;  1YD8 U;  3OJ4 B;  1WJ4 A;  2KQ7 A;  3ZIM A;  1C3T A;  2LZ6 A;  4II2 B;  2DYB A;  4ANW A;  4XZ4 A;  3TCA A;  1EUV B;  2KOX A;  2CR5 A;  2A5U A;  3QK0 A;  3L10 B;  2L8J A;  4YL8 A;  4NPN A;  4LDT B;  2YLM A;  4J6I A;  4DBG A;  2PE6 B;  1LQB A;  1T0Y A;  3JSV A;  2NBU A;  3IHP C;  2RD0 A;  4MJS A;  3DBH I;  4FUL A;  1WJU A;  2C7M B;  2MBH A;  3O65 B;  4EFO A;  2ASQ A;  2LAS A;  4I6P A;  2LGX A;  2Z0E B;  4MSM B;  1ZKH A;  2EMT A;  2RGF A;  1WX9 A;  4IM3 A;  4MDK E;  4CYE A;  3NS8 A;  1J0G A;  1R4N I;  3VH3 B;  4MH0 E;  4OVU A;  2DZM A;  2M17 A;  3HM3 A;  3L54 A;  3PSE B;  4KVG B;  2RR9 A;  4AOF A;  2J0J A;  2O6V D;  2BF8 B;  3CMM B;  3PPA A;  1CMX B;  1WI0 A;  2KWV B;  5LLI A;  3RZW C;  2BYF A;  1LM8 B;  1E5W A;  3PTF C;  4W9K A;  3PRZ A;  4KSL C;  3ZO5 B;  3M95 A;  3IVF A;  3NOB A;  4CO7 A;  2HTH A;  2CHW A;  3H6N A;  2MCN B;  3U30 A;  2KD0 A;  4EZJ A;  2MRP A;  2MBQ A;  4K7S A;  3WAN A;  1HE8 A;  2LXC A;  3TIX A;  3DOW A;  3RUL A;  4WAA A;  2LXA A;  2Z59 B;  1A5R A;  5AZH A;  3V61 A;  4W9I A;  4WJP A;  3DDC B;  2LVQ A;  3U7D A;  3EHV A;  2IBI B;  3PVL A;  1J8C A;  3HM6 X;  4HJK A;  3VH4 B;  2XK5 B;  2WWZ A;  4N9F 4;  4WWP A;  2JT4 B;  3NZS A;  3ALB A;  4GGQ A;  2UWQ A;  1WIA A;  4GXB A;  4IM0 A;  3H9D A;  3RZF A;  1OQY A;  4K7U A;  4DHJ B;  1I42 A;  2KJ6 A;  3M63 B;  4W9F A;  1Q0W B;  4FBJ B;  1IYF A;  1E7V A;  4MGI E;  4I6L B;  1RAX A;  4JL9 A;  4W9D A;  4ANV A;  1V5T A;  1WM2 A;  4DDI D;  2MW5 A;  1PQS A;  4DDG D;  2I1K A;  3MJW A;  2K6Q A;  3QIJ A;  2N7D A;  2DZJ A;  2PE9 A;  3T9L A;  3X0W A;  2K6D B;  4LCD E;  2CU1 A;  4WQO B;  1WH3 A;  2C7N B;  2N7E A;  1TTN A;  2XK5 A;  1XT9 B;  3LJ3 A;  4DWF A;  1V5O A;  4KDL B;  4XX5 A;  3UIN B;  3M3J A;  1WZ0 A;  1U4A A;  1WM3 A;  4RMA A;  4HVB A;  4HWI B;  2BKR B;  3I3T B;  2LVO A;  1L7Y A;  5G2N A;  3V60 A;  1E8W A;  4NAW A;  3ZNH B;  4BOZ B;  5BO4 B;  1WX8 A;  2ZPY A;  2JRI B;  1L2N A;  1WRD B;  2GBN A;  3CST A;  3ZTC A;  2KVR A;  1OGW A;  1YQB A;  3ZNZ B;  1H8C A;  3C0R B;  2G45 B;  3N30 A;  5CHF A;  1RRB A;  5J2R A;  1WFY A;  1WXV A;  1E8Z A;  4G0N B;  2NBW B;  4W9C A;  1P1A A;  2GMI C;  4EEW A;  3JVZ X;  5J17 A;  4NQK E;  1P0R A;  4IW0 A;  4NY0 A;  3VFK A;  4KV2 A;  5DPT A;  2AYO B;  5D7G A;  2G4S A;  3DPD A;  4XC2 A;  4DK5 A;  1SIF A;  3KUD B;  2MBB B;  1EO6 A;  3QC8 B;  3A1Q B;  2KFK B;  5E6N A;  2WDT B;  1Y8R C;  2ZEQ A;  3ZW3 A;  2KX3 A;  1D3Z A;  1EF1 A;  5CHW A;  3V6C B;  3PHX B;  2V3S A;  4PYZ A;  5L83 A;  4RM9 A;  2L00 B;  3BY4 B;  3U8Z A;  3KUC B;  4WJQ A;  2ZNV C;  1Q1O A;  3N3K B;  1V80 A;  4NAW B;  2J7Q B;  4TUU A;  2DAJ A;  2WX0 A;  3T8M A;  2IO3 B;  1V49 A;  2J0M A;  2O2V B;  3APC A;  1WY8 A;  2XBB C;  2KWC A;  5JH5 C;  1WE7 A;  3QJZ A;  2N1V A;  2KQS A;  3QAQ A;  3IBE A;  4FHK A;  4ICU A;  2N9E B;  3ZNI D;  4AP4 C;  4MGZ E;  5HKH A;  3DCG A;  4TQ0 A;  2EMS A;  3MHS D;  4FJZ A;  3CSF A;  5C23 A;  5LXI B;  2AL3 A;  2C7H A;  4ZRI A;  2ZVN A;  4LDT D;  4W9H A;  2IO0 B;  2IO1 B;  3PLV A;  4GSW A;  2PJH A;  2DEN B;  3R7Q A;  3L08 A;  2DX5 B;  2IZV B;  2I1J A;  2ZVO A;  3NHE B;  2HE7 A;  3MTN B;  3OLM D;  3RT3 B;  4GU2 A;  4OVV A;  3QA8 A;  4ZYN A;  4E3C A;  1Q5W B;  4HLE A;  2AWT A;  2L76 A;  1FXT B;  2K1F A;  4WJN A;  4MM3 A;  3PV1 A;  5DPR A;  3TBL D;  4KIK A;  3W1S C;  5JHA A;  4HPL B;  3ZRC A;  1JRU A;  2NPT A;  1NI2 A;  5CTR C;  3Q3J A;  2FUH B;  3EC8 A;  1X1M A;  2YVC A;  3A9K B;  3N32 A;  1YX6 B;  1V6E A;  3QHT A;  2JXX A;  4BFR A;  3QQ8 B;  2M8S A;  2KX0 A;  1J19 A;  1OTR B;  4JIO U;  3KUZ A;  1M94 A;  4MEL A;  2C60 A;  2O6V B;  3WAP A;  2MP2 A;  4B9K A;  4BBN F;  2D10 A;  5D6J B;  2C9W B;  2JPH A;  1LFD A;  2DYM A;  5KHQ A;  4KDI C;  4K7W A;  1ISN A;  4IC7 B;  1G6J A;  2KKC A;  2KJR A;  3JYU A;  4JGH B;  3A4S C;  3TJP A;  3DVG Y;  4HK2 A;  2O2V A;  2O6V A;  3UF8 A;  2K8B A;  3B1L X;  1WF9 A;  1K8R B;  2BPS A;  2KLC A;  2N9X A;  4MGY E;  2GBK A;  4HCN B;  2LUE A;  3NZU A;  4DHZ B;  3SU8 X;  4A20 A;  2DYO A;  4ZRJ A;  3VQI A;  3HHM A;  4ZRK A;  1UBI A;  5EDS A;  4CHK A;  3AXC A;  1WGR A;  2LJ5 A;  3VUX A;  3KVF B;  3QX1 A;  2DHZ A;  1WZ3 A;  4ICV A;  4DXA B;  2FNJ B;  1WR6 E;  2J0K A;  4DHZ E;  2REX A;  2GBM A;  2KDF B;  3A9J A;  1WE6 A;  3ZNG C;  2N1W A;  4DHJ D;  4ANU A;  2K39 A;  4TKN A;  2UYZ B;  3UIO B;  2KHW B;  3PS6 A;  1P9D U;  2KAN A;  3ZTD A;  2KJH B;  3OJ3 A;  3AU4 A;  3ZUN A;  1RLF A;  2LVP A;  3WA0 A;  5J18 A;  2IYD B;  2BWE S;  1VD2 A;  5C1Z A;  1Z5S B;  4G50 A;  3V62 A;  2KDI A;  5FR6 A;  3VTV A;  2D11 A;  1NBF C;  4IUM B;  3D32 A;  3PRP B;  2N4F A;  4MJS B;  2V1Y A;  3APD A;  3PRE A;  1KM7 A;  4HXD A;  2BGF A;  4FA6 A;  1VCB A;  2D2Q A;  1IPG A;  2GOW A;  2MLB A;  1YX5 B;  4WWO A;  2LRW A;  3W1S A;  1SE9 A;  3AU5 A;  4EZK A;  3L0W B;  3VAW A;  2JZZ A;  2KC1 A;  3B08 A;  3ECI A;  3AUL A;  4W9L A;  3APF A;  5KHO A;  3VUY A;  3VXW A;  3CF6 E;  2G4D B;  2ZZP B;  2CS4 A;  2ZCC A;  2K8H A;  2AL6 A;  3QCA A;  2M4N A;  4P7I A;  2KTR B;  4EOY A;  1WXS A;  1WX7 A;  2JUO A;  1AAR A;  2WX1 A;  3BIN A;  2KMA A;  2GBR A;  2HD5 B;  3K9O B;  3RUI B;  4IWQ A;  4KZ0 A;  1TGZ B;  1BT0 A;  4NNJ B;  4E71 A;  4AJY B;  3PHW B;  4AWJ A;  3ZKJ C;  3DVG X;  1V81 A;  2V4L A;  3DVN V;  1ZW7 A;  4BVU C;  4MSQ B;  3ZDM C;  3AI5 A;  2NR2 A;  1E8Y A;  2GBJ A;  2IO2 B;  5AZG A;  3PGE A;  3LDZ E;  2L0T A;  2FCS A;  3A9K A;  5AZF A;  3A33 B;  2KK8 A;  2W9N A;  3R3M A;  3W1Y A;  4HCP B;  4IWP A;  3X23 A;  5D2M B;  2PPH A;  4E74 A;  1WJN A;  1UD7 A;  4NJ7 A;  2L7R A;  4TQ1 A;  3H7P A;  4NQL B;  4HPM B;  2OOB B;  1WGG A;  2R2O A;  4I6N B;  3EEC A;  3UQB A;  2LI5 A;  1GNU A;  3IFW B;  4IWO A;  2FIF A;  2M0X A;  4GDL A;  3EFU A;  1F9J A;  4FJV B;  3PZD A;  3UIP B;  3L17 A;  4JLC A;  2ZNV B;  2LGY A;  4KIK B;  2KZR A;  3P2B A;  3DBL I;  4GDK A;  2A4Z A;  2KMC A;  2KO3 A;  1R4M I;  1TZ1 A;  4AUQ C;  1QZE A;  4W9E A;  3TMP B;  1E90 A;  3VTU A;  2NVU I;  3WIM A;  4RM8 A;  5JZE B;  1E7U A;  2MP2 B;  4GDK B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...