2O2VA

Crystal structure of the complex of human mitogen activated protein kinase kinase 5 phox domain (map2k5-phox) with human mitogen activated protein kinase kinase kinase 3 (map3k3b-phox)
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
93
structure length
92
Chain Sequence
VLVIRIKIPNSGAVDWTVHSPQLLFRDVLDVIGQVLPEATTTAFEYEDEDGDRITVRSDEEMKAMLSYYYSTVMEQQVNGQLIEPLQIFPRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dual specificity mitogen-activated protein kinase kinase 5
publication title Crystal Structure of the Complex of Human Mitogen Activated Protein Kinase Kinase 5 Phox Domain (MAP2K5-phox) with Human Mitogen Activated Protein Kinase Kinase Kinase 3 (MAP3K3B-phox)
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 21
structure length 92
sequence length 93
ec nomenclature ec 2.7.12.2: Mitogen-activated protein kinase kinase.
pdb deposition date 2006-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00564 PB1 PB1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2o2vA00
2MSED 3DDCB 2M8SA 2PPHA 1K8RB 2PJHA 4I6LB 2WWZA 4FLHA 2BGFA 2XEWA 3K9OB 4GB9A 1ZW7A 3JW0X 2MCNB 3VAWA 2KXJA 3APCA 3O65B 2EMSA 2NPTA 3WAPA 1Q0WB 3AI5A 5EDSA 3NZSA 3IHPC 5CX3A 3ZRFA 3R66C 3ZKJC 1GNUA 1WH3A 2M4NA 1M94A 2LVOA 3I3TB 3L0WB 1WMHA 3NY5A 4FHJA 2ZJDA 4W9IA 3UIOB 2BWFA 3BINA 5AEKB 1WM3A 4W9KA 2QHOA 4K7WA 3QJZA 1AARA 1V80A 4EZLA 1IPGA 3AULA 2BYFA 2G45B 2LRWA 3TBLD 4AOFA 3RZWC 1NBFC 2DAFA 2IO0B 4I6NB 4IWOA 4OVVA 4OVUA 1OEYJ 3ZVVA 1XQQA 1E7VA 2K8HA 4G11A 4GDKB 4F8CB 1LXDA 1XD3B 1IYFA 1L2NA 3U8ZA 2BYVE 3N32A 1ISNA 2O6VB 3Q3FA 5AZGA 5JHBA 3A9JA 3PHXB 3ZTDA 3PRZA 4IUMB 3TIXA 2PE6B 3H7PB 2KJHB 2YLMA 3W1SA 2LGYA 4NQKE 3RD2A 3JSVA 2KQ7A 2L7RA 3DBRI 3OLMD 1YQBA 1WM2A 2L3ZA 4MEMA 4NAWB 2DENB 2JRHA 3DBLI 1KOTA 3A9KB 3PT2B 2J0MA 3U7DA 3VH3B 1P0RA 1WY8A 2JRIB 1L7YA 1U4AA 3QX1A 1JRUA 4G50A 4FJZA 2LRUA 3ML9A 3IFWB 2ZEQA 1EUVB 3L08A 5CHVC 1T0YA 3QQ8B 4K81A 2XBBC 2JF5A 4WWOA 3A1QB 3M3JA 3VTUA 4GDLB 4MGZE 1J0GA 3L54A 3DBHI 5C1ZA 4AJYB 2G4SA 1WJNA 4DWFA 1KJTA 2NVUI 2HTHA 2UWQA 2XK5B 4MELA 5AZHA 4W9GA 4BFRA 2KTRA 4CO7A 2FNJB 2R2OA 1R4NI 2MBOA 2KKCA 3IG3A 4B95A 3CMMB 3KUZA 4B6WA 1CMXB 1WX7A 4BKSD 4DHZB 2ZPYA 2RR9A 3R7RA 4DK5A 1UBIA 2L00B 3DQVA 3WALA 2ZVNA 2O2VB 2KNBA 4P7IA 5J17A 5AZFA 2KN5A 3V6CB 1WZ3A 4YL8A 2KDBA 4KSKC 3ZTCA 4MJSA 3SU8X 5J2RA 2M0XA 1RAXA 4AWJA 2IBIB 3PSEB 2LUEA 3R3MA 2NBWB 3TCAA 3QIJA 2R2QA 2N1WA 2FIFA 3PLVA 1IP9A 3QAQA 2JZ3B 2LGXA 4HJKA 1S3SG 4II2B 3KW5B 5CHFA 4A3PA 4XC2A 4HVBA 4EZJA 2BF8B 1XT9B 2CHZA 4KZ0A 1P1AA 2AYOB 1P98A 4GGQA 1YJ1A 2RD0A 3APDA 2ZNVB 2NR2A 2IZVB 4WJNA 3RYTA 1UELA 1LQBA 1UGMA 2AL3A 4KV2A 4E3CA 2OOBB 2M17A 4DDID 2V4LA 4J6IA 2NCNA 1Q5WB 3V6EB 3DPDA 1WGHA 1J19A 2BYEA 1C1YB 1YD8U 2K6QA 3M95A 1I42A 2DAJA 3GZNI 2K25A 4G0NB 2LXCA 2RGFA 3HIZA 3QC8B 4AJWA 1V2YA 3CSTA 5HKHA 2LZ6A 3ZDMC 3VFKA 3HM3A 2D10A 2J7QB 1V5TA 2FCNA 3ECIA 2Y5BB 3RT3B 4HPMB 2KOXA 2GBJA 2NBVB 3SD5A 3HM6X 4K7UA 3KUDB 4NJ7A 3DVNV 2G4DB 1V5OA 4MH0E 4MSQB 3UGBB 1GUAB 1NI2A 3TL5A 1WXSA 2CHXA 1OQYA 4WWNA 4EEWA 1LFDA 1ZKHA 2MBBB 1S1QB 4A3OA 4HPLB 2K39A 3B1LX 3MHSD 4BBNC 4BVUC 2MBEA 3QHTA 3H7PA 3CF6E 2LVPA 2V3SA 3CSFA 3N30A 2UYZB 1V81A 4FHKA 5KHQA 3AU4A 3N3KB 4HCPB 1NDDA 2CR5A 4WJOA 4KIKB 1X1MA 2C9WB 2KMAA 3ML8A 1V49A 1Y8RC 1E8XA 1WI0A 2WDTB 1WFYA 1WX9A 5DPSA 3H1UA 3RUIB 3A9KA 1SIFA 1PQSA 2JZZA 2BPSA 3LJ3A 4FN2A 1WE6A 1C3TA 3DVGX 4W9FA 2I1JA 2LD9A 2DZJA 2HD5B 2KDIA 4LDTD 4DXAB 1WJ6A 2AWTA 2IO3B 2ZVOA 4BOZB 2DZMA 2IY0B 2L0FA 4W9DA 1RRBA 1V9JA 2V1YA 1E5WA 3WANA 2DYBA 2HE7A 3ZLZA 5DPWA 3A1QA 2DZKA 2MBQA 3ZO5B 3Q3JA 4GDLA 2NBUA 1QZEA 4NPNA 2JXXA 2A5UA 5FR6A 1H4RA 3UINB 4IC7B 3DVGY 4HK2A 2XK5A 2Z59B 2GBRA 3DCGA 5LLIA 2LASA 1WF9A 1V86A 4HXDA 3L16A 2KDEB 3KUCB 2LVQA 3VUYA 2KWUB 2BKRB 2KC1A 1YX5B 2NPTB 3PS6A 4KDLB 2FCMA 3DBSA 3H7SA 4A20A 1TGZB 3QK0A 4IM3A 4IG7B 2C7HA 2O2VA 2EKEC 1WMHB 2DX5B 3EFUA 3V62A 4I6PA 1WGDA 2YVCA 1LM8B 4WAAA 4ANVA 5G55A 2WX0A 4FA6A 3ONSA 2JUOA 1J8CA 2VRRB 4EOYA 4DHJD 5DPTA 2N9XA 3ZNZB 1WYWB 2KX3A 1WXVA 4NNJB 2EMTA 4ANWA 3WAMA 4DHZE 4LJPB 2JT4B 1E8WA 1OGWA 3VH4B 2KO3A 3MJWA 4K1RB 4NJ6A 3PREA 2PE9A 2NS5A 4HLEA 3A9JB 3NOBA 4KVGB 2KWVB 4IWQA 4JGHB 5BO4B 2KHWB 4CYEA 4M8NA 3TMPB 3W1SC 4N9F4 4HDOA 4BKGA 2D07B 4LJOB 4M8MA 2L76A 2DYOA 1UZXB 4W9LA 4F1SA 2D3GA 2G3QB 4TQ0A 2MX2A 3EC8A 3KH0A 2GOWA 2KQSA 3SDLC 3D32A 1ZGUB 4TKNA 4JLCA 5JZEB 2KFKB 3AU5A 3UQBA 1UBQA 4MGKE 3MTNB 4RM8A 2KJRA 4GSWA 3VDZA 3ZNID 4BOSC 1GG3A 4ZRIA 2FCSA 5D94A 3PRPB 5IAAC 2LWPA 2MP2B 3QCAA 4MGYE 2DYMA 3PVLA 2KX0A 4PS7A 2FIDA 4EFOA 4PYUA 2ASQA 3KYDD 2JY6A 1GC7A 4WWPA 3M62B 2O6VD 3NS8A 3PLUA 2J0KA 4KDIC 3OJ4B 4M0WB 4ZYNA 4CHKA 2KDFB 2N7DA 3X23A 3PHWB 2KC2A 2FUHB 2HJ8A 3QA8A 1WR1A 5JH5C 5L83A 2IO2B 2DHZA 4WJPA 2GBMA 2AEHA 1KLVA 2CS4A 2IYDB 5DCNA 2Z0EB 4GDKA 5C23A 4GIVA 2W9NA 4ZRJA 3P2BA 2C60A 3RULA 2O6VA 2Z0DB 3S2AA 2WX1A 3WA0A 3GOEA 4TV3A 1E90A 3JYUA 4PYZA 3H6NA 2FAZA 3L17A 1WRDB 2JPHA 4EKUA 2M1MA 3T8MA 1RLFA 2KD0A 2MLBA 3ZDTA 3A4RA 5CHWA 3DVNU 4ZDVA 2KANA 4FJVB 4MGIE 1WGRA 2L0TA 4NAWA 2N7EA 1OTRB 3W1YA 4KSLC 2MBHA 3PV1A 4HDQA 4HWIB 3X0WA 1G6JA 3ZW3A 3M63B 3VTVA 5DPRA 2IO1B 3RZFA 2L05A 3LDZE 3ZNGC 3ZUNA 2BKFA 1EF5A 1TZ1A 4K7SA 3R7QA 2D11A 2RSUA 4FULA 4HCNB 2C5LC 2GBKA 2ZZPB 5JHAA 2AL6A 4IWPA 5E6NA 2N9EB 4PS8A 4E74A 4FADA 1TTNA 1WZ0A 5TR5A 4IM0A 1MG8A 4W9HA 2PEAA 3AXCA 4GOCA 1A5RA 3APFA 3SHQA 1GC6A 4IM2A 3ZNHB 3DOWA 3VUXA 4IW0A 1WJ4A 2KK8A 2KWCA 4GN1A 3QWZB 2LI5A 3IBEA 1V6EA 4NQLB 5E6OA 3HK0A 3T9LA 2A4ZA 4ICUA 2MW5A 1WIAA 3ENEA 4MSMB 4BBNF 4E71A 3PZDA 4LCDE 5J18A 1WE7A 3L13A 4JIOU 2KVRA 1KM7A 1WR6E 1VCBA 3PRMB 2WYQA 3UQAA 2I1KA 5L95C 2N9PC 2ZPNA 1HE8A 1R4MI 3C0RB 3VTWA 4DDGD 5D2MB 2MA9B 3VHTC 2K1FA 2LXAA 2MRPA 1WGYA 2LGDA 2ZCCA 4F7ZA 2CKHB 4MDKE 2KFKA 3WAOA 1WXMA 2MWSB 3BY4B 4WJQA 4RMAA 1P9DU 1E8ZA 2GMIC 4G3XB 2C7MB 4JL9A 3ZRCA 3UIPB 4W9EA 2B3AA 2MP2A 2LJ5A 5D6JB 3ALBA 3U30A 3A4SC 1Q1OA 1EO6A 3A33B 5D7GA 1EF1A 2DZIA 3OJ3A 3HHMA 3NZUA 4PS3A 5CTRC 2FCQA 2MQJA 4DBGA 3JSVB 3EECA 3VXWA 1UH6A 4GMVA 1F9JA 1VD2A 4XZ4A 2N1VA 4ZRKA 2D2QA 3RCZA 4LDTB 2RPQA 1GJZA 4EZKA 4KZCA 3OAWA 2N4FA 1YX6B 4W9CA 2K8BA 3TJPA 2K6DB 4XX5A 3V61A 4TUUA 4RM9A 4GU2A 3ZIMA 3JVZX 1SE9A 2ZCBA 2KTFA 3IVFA 3K9PB 1Z5SB 2KJ6A 3B08A 4AUQC 2K8CA 4AP4C 3VUWA 2IY1B 3EHVA 1SGHA 2J0JA 2OJRA 1WXAA 2JVCA 3PTFC 4ANUA 4EUTA 1WX8A 4W9JA 3QARA 3B0AA 5LXHA 2C7NB 2CU1A 1TBEA 3PPAA 4MM3A 3V60A 4BKSA 1I35A 1H8CA 4KIKA 1WGGA 2KTRB 4X57B 5IA7A 1E7UA 4WQOB 5E6PA 2KLCA 3KYCD 2L8JA 2BWES 2REXA 4NY0A 2ZNVC 5LXIB 3H9DA 1P3QU 4ANXA 4II3B 4B9KA 2CHWA 2KZRA 1OEYA 3L10B 3VQIA 2KFJA 4ASWC 4ICVA 1BT0A 1E8YA 1RFAA 1Z2MA 3PGEA 5KHOA 4FJYA 4GXBA 4DHJB 4BKTA 1D3ZA 5GMVA 4MJSB 3KVFB 1UD7A 4JQWC 4URKA 1WJUA 3NHEB 2GBNA 2KLGA 4FBJB 2KMCA 3WIMA 2JWZA 3VVWB 1YIWA 3UF8A 1FXTB 4TQ1A 5G2NA
chains in the Genus database with same CATH superfamily
4JX1C 4FLHA 2BGFA 3APCA 3I9V1 3O65B 3U52E 2NPTA 4AQ7A 3BYYB 1GNUA 1WH3A 1M94A 1B1ZA 3BINA 1K50A 4W9KA 3W2DA 4K7WA 1R4NB 1AW7A 2WNMA 4LLGM 1AARA 4EZLA 1VJKA 2XNAC 2BYFA 2G45B 3RZWC 3V3XA 3ZJUA 4OVUA 1XQQA 4F8CB 1L6VA 5JHBA 3A9JA 3ZTDA 3NJTA 3Q3NC 2BS3B 2PE6B 3W1SA 1TT5B 2LGYA 1TKGA 3JSVA 2N9KA 3AN1A 2WXPA 4K3CA 4MEMA 1EM7A 3RI7C 1P0RA 2JRIB 1L7YA 5HFYA 2LRUA 3GZNB 1YN3A 4WWOA 3M3JA 4GDLB 1E0ZA 5C1ZA 4AJYB 1WJNA 4OW0A 1KJTA 1IUEA 1T6BX 4BFRA 1FFUA 2FNJB 2R2OA 4B6WA 1KLGD 4JE3B 3R7RA 1V1PA 3DQVA 3NUHB 3H8HA 5J17A 3I5JC 4YTMB 1QT9A 4YL8A 5D3DA 1P7EA 2JSVX 5J2RA 2J52A 3DHHC 1B9RA 1RAXA 3IT6B 1FFVA 3LB8C 2R2QA 5FR3A 1STEA 3NVVA 2BQQA 2LGXA 1S3SG 2HTME 1NYQA 4HVBA 1JWSD 1YMHE 4WJNA 4KV2A 2M17A 3V6EB 1J19A 1YD8U 2G9HD 2DAJA 2K25A 1VZ7A 4G0NB 2V4IB 3HIZA 5FK9C 3CSTA 5HKHA 3ZDMC 3SFDB 2J7QB 1EU4A 3ECIA 3FAHA 4ARCA 4HPMB 2GBJA 4RH6A 3OG5A 1OFFA 3KUDB 1V5OA 1UNSA 4WWNA 1OQYA 1S1QB 1ZXIA 4A3OA 2K39A 2GB1A 3RFZB 2NTTA 4BVUC 5HG2A 3C8YA 3QHTA 3Q8CA 3BVMA 3CSFA 3Q8FA 3ZYYX 4FHKA 3N3KB 2CR5A 4WJOA 2C9WB 2KMAA 3MHZA 1E8XA 1PDXA 2QMTA 1WX9A 5DPSA 1HEZE 4RGNA 3ZJTA 1MHHE 4W9FA 2I1JA 2LHDA 2DZJA 2IO3B 4BOZB 1T3QA 1J7AA 3CWIA 2WQYB 4YWGG 1V9JA 2V1YA 5DPWA 2DZKA 3Q3JA 4GDLA 1QZEA 4NPNA 2JXXA 1XLQA 1FXIA 1H4RA 3NG0A 3DVGY 4HK2A 1KFYB 2Z59B 2GBRA 2KDEB 2KWUB 2BKRB 4A20A 3L4PA 3BVZA 2BYTA 2GRIA 2C7HA 4KGTA 2JZPA 2RDBC 4ZYSA 4ANVA 4WAAA 1KF6B 1E7PB 2JUOA 2VRRB 4DHJD 5DPTA 2WHIA 1HZ6A 1HQRD 3MJWA 3U2SC 2INNE 4NJ6A 4OVZA 2WXMA 1ZUD2 3VRBB 3W5VB 2E3TA 1OQQA 3P4PB 4N9F4 4LJOB 2KT7A 4W9LA 4N59A 4F1SA 1NYRA 2G3QB 2MX2A 2GOWA 2KQSA 1AN8A 4TKNA 3UQBA 1NI3A 5AUKA 4BOSC 3QCAA 3VR9B 2DYMA 4PS7A 2FIDA 2ASQA 2FUHB 5L83A 3RNCC 2KVZA 1Y56A 2CS4A 5IN7A 2HJ1A 4NAMA 1IBXB 1UWMA 3P2BA 3C19A 2Z0DB 3S2AA 3JYUA 2RDHA 3H6NA 4PYZA 2PVGC 1IGCA 1WWTA 4LNIA 4EKUA 2M1MA 1RLFA 2KD0A 3KQ4A 5I4DA 1WGRA 2N7EA 3W1YA 4HDQA 3X0WA 3M63B 3RZFA 3LDZE 3ZNGC 1UGJA 3ZUNA 4LNFA 3HVZA 2OJWA 1TZ1A 4K7SA 2JYTA 3AEEB 2ZZPB 5JHAA 4IWPA 5E6NA 2N9EB 1JWBD 1RM6C 3SR6A 1PFDA 3AXCA 3ZJVA 3DOWA 4IW0A 4GN1A 4NQLB 5E6JA 4BBNF 5J18A 4LNNA 3L13A 4JIOU 2KVRA 2WYQA 1I4GA 3UQAA 3LXFA 1R4MI 2D3AA 3VTWA 4DXFA 2MA9B 2LXAA 3LYYA 2MH7A 3BY4B 1N63A 1P9DU 1E8ZA 1N5XA 1HZ5A 4G3XB 4RCOA 3AB5A 4JL9A 2B3AA 2LJ5A 3A4SC 1Q1OA 4O1NA 3NZUA 5CTRC 2FCQA 3KWVA 2MQJA 1XCTL 4REZA 1UH6A 3Q8AA 4M02A 1VD2A 2WDVB 2D2QA 1GJZA 4EZKA 4KZCA 1VR9A 3OAWA 3TJPA 4XX5A 5IO9A 1XEEA 3JVZX 3B08A 4AUQC 4CQNA 1PGAA 1I4XA 4AP4C 2IY1B 2OJRA 4TSSA 3QARA 3B0AA 2N9LA 2J4XA 1QOBA 3PPAA 1K51A 2KTRB 1JALA 2PTLA 1PYWD 4X57B 4WQOB 1E9MA 2L8JA 2Y5PA 2M19A 4NY0A 3U4EG 4ICVA 3PGEA 4FJYA 3DBRB 2QJLA 4LK0M 5D3IB 2CU3A 4JQWC 3KVFB 3DHGC 3AE5B 2WXKA 4S0RA 1L0YB 3VVWB 1YIWA 2SAKA 1FXTB 2ONQA 5G2NA 1ZXHA 2MSED 1R7SA 2M8SA 2PPHA 2MHJA 4I6LB 3JW0X 1TKYA 5HHDG 2KXJA 1EWYC 2EMSA 1Q0WB 3AI5A 1ZP0B 5EDSA 3IHPC 3R66C 1I4HA 2M4NA 4FHJA 1WMHA 4W9IA 2BWFA 3ETRA 1WM3A 3DHIC 1WXQA 3QJZA 3RNEC 3IT4B 3NVYA 4C4VA 4IWOA 2DLBA 3ZVVA 1C9FA 4GDKB 2LUMA 1XD3B 1IYFA 1L2NA 1D4BA 2SEBD 2V3NA 1JWAD 3PRZA 4OZBA 1T0SC 3MJ5A 2K9XA 2X8XX 2KJHB 2YLMA 2W82A 4MACA 4NQKE 2KQ7A 2L7RA 1LGRA 3OLMD 1WM2A 3Q14C 2V9HA 4NAWB 2JRHA 4L1BA 3N1ZC 3R8BA 3PT2B 3VH3B 3ML9A 1D5ZC 2ZEQA 3L08A 1T0YA 2WXGA 2OEDA 2BB6A 3A1QB 4MGZE 3ZQ4A 3L54A 3DBHI 1WGKA 1YOVB 4XWTA 2NVUI 2UWQA 2XK5B 4MELA 4LNOA 5AZHA 4WH4A 2KTRA 1FPYA 2I38A 2MBOA 2KKCA 4A6QA 4XYCA 1CMXB 1WX7A 4BKSD 4DK5A 3AH7A 4N58A 1UBIA 3I57A 2ICIA 3WALA 4IDIA 1JRPA 5AZFA 4ZOHC 3V6CB 2PIAA 3SU8X 2M0XA 4AWJA 3TCAA 3PLVA 3NVZA 2JZ3B 3R2IA 2WXHA 3KW5B 5CHFA 4YSYB 3BIID 2JXTA 2BF8B 2CHZA 1N62A 1P1AA 4JWUC 1P98A 1YJ1A 3APDA 4C80A 3RYTA 1UGMA 1YN5A 4DDID 2NCNA 3RNBC 1UF0A 2LEKA 2LFIA 2LXCA 2RGFA 3QC8B 4AJWA 1PGXA 1V5TA 3SD5A 2ON8A 1XF5L 1XCQL 3HM6X 4K7UA 2YEPB 3DVNV 4MH0E 2VZKB 3HUIA 1WXSA 1VLBA 4M00A 3EUB2 3TL5A 4EEWA 4HPLB 2LMCA 5FKAC 1FRDA 1NDDA 4KIKB 3ML8A 1HXYD 3P4RB 1WI0A 2WDTB 5BYSA 1XXGA 3RUIB 2BPSA 3BYTB 4FN2A 2HD5B 4YSXB 4LDTD 1WJ6A 2AWTA 2XN9C 1RRBA 2J42A 1KH0A 2J53A 3A1QA 3ZO5B 1MVKA 2WXNA 1D5XC 4A55A 3UINB 4IC7B 2XK5A 5LLIA 1VZ8A 1P7FA 3UI3A 2KC1A 3AECB 3PS6A 4IM3A 4IG7B 2V0GA 1E6EB 1RWSA 3O13A 4FXCA 1L0VB 3ZNZB 2D5GA 3CIRB 1WYWB 2JWUA 1WXVA 2KX3A 4NNJB 3WAMA 4DHZE 2AQ3B 1OGWA 3GE8C 1FO4A 3PREA 2ZW0A 2NS5A 3TEWA 2KWVB 1L4ZB 2L1AA 4JGHB 4WIPA 2KHWB 4CYEA 3TMPB 1XO3A 1QQRA 2QIEB 4HDOA 5T8IA 3ZXVA 5EE9A 4WQMA 2WDQB 1UZXB 1C77A 2D3GA 4TQ0A 3RNGC 1C4PA 3SDLC 2BW2A 1ZGUB 1FNWA 3AU5A 3E9SA 4ZRIA 1A70A 5D94A 3PRPB 4ZHOA 2LWPA 2MP2B 2AX5A 4MGYE 3W5UB 4EFOA 3N9YC 4OZAA 2JY6A 1GC7A 4WWPA 1JMLA 3PLUA 4LNKA 2J0KA 4KDIC 3OJ4B 5C3JB 1YJJA 3AEAB 1YJIA 3PHWB 4KGRA 2KC2A 4P6VF 3QA8A 2IO2B 3AEBB 1DGJA 2DHZA 4WJPA 2GBMA 3GP7A 1FEHA 5C23A 4MH8A 4YTPB 2TSSA 2EKIA 3GOEA 1E90A 3TSSA 2WGSA 3L17A 2DBYA 2B76B 2W3SA 3T8MA 3ZDTA 1TKEA 4XGAB 3A4RA 2WU5B 1F1HA 1V97A 3DVNU 4P1CC 1QLBB 4RF1A 4ZHPA 2HDEA 4KX6B 1GB4A 1G6JA 3PV1A 2IO1B 5H92C 3RNFC 2BKFA 2BTEA 2MEKA 1EF5A 2D11A 3ABVB 2RSUA 4FULA 1MPEA 2K22A 5TR5A 4IM0A 1FNVA 4W9HA 1A5RA 3APFA 3HVDA 3DWGC 1WJ4A 5E6OA 1SBBB 3ENEA 4E71A 2DNFA 3PZDA 5HI1A 3AV8A 1KM7A 1SIJA 2FUG1 1WR6E 4ITKA 2N9PC 3GB1A 5D2MB 2K1FA 2MRPA 1WGYA 2ZCCA 4F7ZA 3AE3B 2MWSB 4J3OD 2BS2B 3ZRCA 1PGBA 1TYGB 2MP2A 5D6JB 2QC8A 3ALBA 3U30A 5EE0A 4PS3A 2NTSA 3PO0A 1DOYA 3AEDB 4GMVA 1HTQA 1F9JA 4XZ4A 2N1VA 4ZRKA 2WU2B 1F77A 2RPQA 4RGOS 4JWSC 1BMLC 3K9PB 2KJ6A 2K8CA 3MP9A 4HRSA 1WX8A 4W9JA 3AE4B 5LXHA 2KYWA 2C7NB 2QCZA 1TBEA 4L2YA 1H8CA 3GE3C 1I4RA 5E6PA 3P1MA 4YSZB 5IA7A 2KLCA 3KYCD 2REXA 3H9DA 1P3QU 2CHWA 3VQIA 2M0AA 1RFAA 1JWMD 1M4VA 1C4AA 4MJSB 1UD7A 2KLGA 3P4SB 2PMVA 4TQ1A 1FCCC 1SE4A 2PJHA 2WWZA 3K9OB 4P1BC 2MCNB 3VAWA 2CJNA 5IP4D 1HTOA 3WAPA 3NZSA 5CX3A 3ZRFA 3ZKJC 2LVOA 3UIOB 1PUTA 5AEKB 3EA6A 2KN4A 1T0QC 1V80A 2WXOA 4A8XC 3RN9C 3AULA 1VZ6A 4AOFA 1ROEA 1NBFC 4OVVA 4G11A 3SEBA 1LXDA 1CK1A 2LJIA 1FNUA 3U8ZA 1ISNA 2O6VB 5AZGA 3E56A 3Q2AC 3PHXB 2IDYA 4IUMB 3TIXA 1L4DB 3H7PB 2DENB 3DBLI 3ZXRA 3A9KB 3U7DA 1I4QA 1WY8A 1U4AA 2IGGA 3QX1A 4G50A 1JROA 4HKQA 1EUVB 1I4PA 3QQ8B 4K81A 2XBBC 1QOGA 3AEFB 4OZCA 3U7ZA 1TY2A 1ACCA 4DWFA 3I63C 3KLSX 2HTHA 1DOIA 1GOZA 1R4NI 3KUZA 1KLUD 4DHZB 4YXDB 2PKOA 2RR9A 2L00B 1MG4A 5BMIA 4B0EA 2KNBA 1IBXA 1QKZA 5BYRA 2KN5A 2I2YA 1SEBD 1DOXA 2KDBA 1F52A 4KSKC 4MJSA 2IBIB 3PSEB 3R3MA 2NBWB 3QIJA 2N1WA 2FIFA 1IP9A 3QAQA 3HRDD 4A3PA 4C00A 4XC2A 1WSPA 1KRHA 4KZ0A 3NZ3A 4HROA 2AYOB 2RD0A 2NR2A 2IZVB 1UELA 1LQBA 2AL3A 4E3CA 2V4LA 1Q5WB 1N5WA 1WGHA 2KQ4X 3M95A 4EE2A 1L6UA 3GZNI 5G5GA 1F0ZA 1TS4A 1V2YA 2LZ6A 3VFKA 4B0MA 3MC8A 1J7CA 2FCNA 1VRAB 2Y5BB 2KOXA 4IKGA 1VDVA 4NJ7A 2G4DB 4MSQB 1GUAB 1NI2A 1LFDA 4YTNB 2MBBB 1RFKA 2BBCA 3B1LX 4KKIA 2MBEA 2JQRB 3H7PA 1V81A 4ZRPA 2ZW1A 1WFYA 3H1UA 3A9KA 1SIFA 1PQSA 1ZOYB 2JZZA 3NRZA 1C3TA 1YNTE 3EFCA 2LD9A 1SE2A 2KDIA 4DXAB 2ZVOA 2L0FA 1FM0D 3WANA 2HE7A 3ZLZA 2MBQA 2NBUA 3ZGZA 4A9AA 2RDGA 2A5UA 1FRRA 5FR6A 5LNK1 2L52A 3DCGA 2LASA 4LTUA 1WF9A 2YEPF 1YN4A 1V86A 2ACZB 4HXDA 2W55A 3KWLA 3KUCB 2LVQA 3VUYA 3BZDB 2BVCA 4USAA 2NPTB 4XE0A 2FCMA 3DBSA 5AUIA 4DQOC 1TGZB 3QK0A 1WYGA 2EKEC 2CJOA 3EFUA 4M01A 1WGDA 1LM8B 1UUPA 5G55A 2WX0A 4FA6A 3ONSA 4RNAA 2N9XA 4DXGA 4ANWA 1GAQB 4LJPB 2JT4B 2M56B 2KO3A 4K1RB 2PE9A 3A9JB 1FIQA 4KVGB 3N20C 2D3BA 4BKGA 2D07B 4M8MA 5IOIA 4C7YA 3EC8A 3Q8EA 2Z8LA 3D32A 2INCC 3NS1A 5JZEB 2KFKB 3TEZA 1UBQA 4MGKE 3MTNB 3VRAB 4QAYA 2RMMA 2KJRA 4GSWA 3VDZA 2N7JA 1FXAA 1WRIA 5IAAC 2BS4B 1L0XB 1C4CA 2JYEA 3KYDD 2LGSA 2VH2A 4ZYNA 4DBGA 3NS8A 4M0WB 2N7DA 3X23A 1NVID 1WR1A 1KLVA 4GDKA 2WXRA 2C60A 3BVGA 2WX1A 3WA0A 4TV3A 1R4MB 1XLNA 2FAZA 1UWXA 1WRDB 2JPHA 5CHWA 4ZDVA 2KANA 3RPFC 4NAWA 2PW9A 4HWIB 3AMZA 3VTVA 5DPRA 4Q2JA 2INDC 3AEGB 3AE7B 3BK1A 3R7QA 3B2FA 1ENFA 4R3DA 4E74A 4FADA 1TTNA 4ZRQA 2BB5A 3AE6B 1MG8A 2PEAA 2MJDA 3TUOA 1SJHD 2FE8A 4IM2A 3SHQA 3VUXA 2KK8A 2KWCA 3IBEA 1E10A 2PVOD 1F2RI 2LGIA 3FKYA 2L83A 4ICUA 3T9LA 3T3NA 3V05A 1MJDA 4LCDE 1WE7A 1ZDVA 3PRMB 1YQ4B 1HE8A 1SSNA 2G1EA 2CKHB 2KFKA 3WAOA 1N6ZA 4WJQA 4C56C 4K3BA 5G5HA 2UU7A 4YT0B 3A33B 1EO6A 5D7GA 2VZKD 4M0WA 1SF0A 1QOAA 3EECA 1SXTA 4TMAB 1QF6A 1ZE3D 2N4FA 2JX5A 4NZLB 4TUUA 2X38A 3EGRA 2VH1A 1NEKB 3ZIMA 1SE9A 3IVFA 1Z5SB 1XLOA 3AE2B 3PTFC 4ANUA 3MFGA 2CU1A 3V60A 4KIKA 1E7UA 5H8YE 2BWES 5LXIB 2ZNVC 4B9KA 3Q3MC 2KZRA 2KFJA 1BT0A 1Z2MA 3B9JA 4GXBA 4DHJB 4BKTA 2WDRB 3IAM1 1D3ZA 4HPPA 2AQ1B 3MC0B 1C78A 4HEA1 2JU6X 1V1OA 2KMCA 5C2TB 2JWZA 2QEJC 1F2RC 3UF8A 3FILB 2L32A 2NMQA 1I7HA 4US9A 5JXVA 3DDCB 1K8RB 3FC4A 2XEWA 4GB9A 1ZW7A 2R61A 3DBHB 3I3TB 3L0WB 3NY5A 4D2KA 2ZJDA 2BT6A 2QHOA 1GB1A 1IPGA 5BMHA 3TBLD 2LRWA 1T0RC 3Q6BA 2DAFA 2IO0B 4I6NB 4RGMA 1OEYJ 4BZAA 1K52A 1E7VA 2K8HA 1HA5A 2BYVE 3N32A 3Q3FA 4A90A 2AQ2B 4UDUC 3RD2A 1JQ4A 3DBRI 1YQBA 2L3ZA 2MJ3A 2H89B 1KOTA 1KTKA 3MC9A 2J0MA 2QSDA 1JRUA 4FJZA 2K5PA 3N1YC 1SE3A 3IFWB 3DWMA 2W54A 4GLSC 5CHVC 3RNAC 4KGSA 4RF0A 2JF5A 3VTUA 1J0GA 4L23A 4H2AA 2G4SA 1OQRA 1TS2A 4W9GA 3TEYA 4CO7A 1QILA 2IGHA 3IG3A 4B95A 3CMMB 1FCLA 3Q69A 2ZPYA 2ZVNA 1SB3C 1DYQA 2O2VB 4P7IA 2EELA 1WZ3A 2QILA 3ZTCA 1MI0A 3AE8B 2LUEA 2Y5CA 3PZ7A 4HJKA 3FILA 4II2B 3AE1B 2KMMA 4EZJA 1XT9B 1RYJA 4GGQA 1XLPA 4WAFA 1FD6A 2WS3B 2ZNVB 2OOBB 4J6IA 1LO5D 3DPDA 1V8CA 2BYEA 1C1YB 4HJGE 2K6QA 1I42A 2IPKD 4N6EB 3HM3A 3J9CA 2D10A 3RT3B 2NBVB 1TS3A 4MT5A 4C7ZA 2WLBA 3UGBB 1L5PA 2CHXA 1ZKHA 4BBNC 2K0PA 3MHSD 2KDMA 3CF6E 2LVPA 2V3SA 3N30A 2UYZB 2WXFA 1CQVA 5KHQA 3AU4A 4HCPB 1X1MA 1V49A 1Y8RC 1J7BA 4OHJA 3PZ8A 3OWEB 3LJ3A 1WE6A 3DVGX 4XDDA 2DZMA 2IY0B 4W9DA 1E5WA 2DYBA 1YQ3B 2WXIA 4US8A 4RFBA 4RGTA 1TIFA 1ZPSA 1TY0A 2IGDA 4WWMA 4BAXA 3L16A 1SJED 3P4QB 1YX5B 4KDLB 3H7SA 1TS5A 2O2VA 5MPOA 1WMHB 1BXTA 2DX5B 3V62A 4I6PA 2YVCA 1J8CA 1ET9A 1ET6A 2Q5WD 4EOYA 3IXSA 2K3UA 2D3CA 4C4VB 2EMTA 3TEXA 2MJEA 1E8WA 3VH4B 3AM9A 3IAS1 5EE3A 2GLSA 3NVWA 4WURA 4HLEA 1NENB 3NOBA 4IWQA 5BO4B 4M8NA 4S17A 3W1SC 1T5XD 2FBWB 2L76A 2DYOA 2LHEA 3KH0A 4JLCA 1IGDA 1QOFA 4RM8A 1EU3A 1JWUD 1MFWA 4IOIE 3ZNID 1GG3A 2FCSA 4ARIA 1CJEA 3PVLA 2KX0A 4PYUA 3M62B 2O6VD 1ESFA 4CHKA 1EWCA 2WP9B 2KDFB 2HJ8A 5JH5C 3AE9B 4P16A 5GXGB 2AEHA 2IYDB 5DCNA 3RMKC 2Z0EB 2QDFA 3WCQA 4GIVA 3SFEB 2W9NA 4ZRJA 1GPXA 4AS1A 3RULA 2O6VA 2OHFA 3URYA 1AWDA 2Y3AA 2MLBA 4PK1A 4MM3B 4FJVB 4MGIE 5IKCM 2L0TA 1OTRB 4KSLC 2MBHA 3ZW3A 3N1XC 4HKZE 2L05A 3BWUD 4HCNB 2C5LC 2GBKA 2W3RA 2AL6A 4PS8A 1WZ0A 1JCKB 3GS2A 1Q10A 1C79A 4GOCA 4PT5A 1GC6A 3ZNHB 1MHXA 5BMGA 3Q8BA 1ZDXA 1JW9D 4XWWA 3QWZB 2LI5A 4JPSA 1V6EA 3HK0A 2A4ZA 2MW5A 1WIAA 4MSMB 4XDCA 1N61A 1VCBA 1N60A 2N0SB 1TZOA 2I1KA 5L95C 4ACFA 3T3OA 2RPVA 2ZPNA 3C0RB 4DDGD 3VHTC 5BYQA 2LGDA 2WXLA 4MDKE 5EE1A 1WXMA 2IJ0A 3VR8B 4RMAA 1AYFA 2GMIC 2C7MB 3UIPB 4W9EA 2V3PA 1CZPA 2PLPA 1EF1A 2DZIA 5TSSA 3OJ3A 3HHMA 1FMAD 3JSVB 3VXWA 3RCZA 4LDTB 4NJCA 3BK2A 1K53A 1YX6B 4W9CA 2K8BA 3P42A 2H88B 2K6DB 3V61A 4RM9A 1C76A 4GU2A 3W9CB 2ZCBA 2KTFA 1BUIC 2KAJA 3VUWA 3EHVA 1SGHA 2J0JA 1WXAA 2JVCA 4EUTA 2GI9A 2WXQA 4BKSA 4MM3A 1I35A 1D6EC 3B2GA 1WGGA 2KWDA 2E6XA 2WXJA 2KACA 3R2TA 4ANXA 4II3B 2INPE 1V1PB 1OEYA 3L10B 1TJEA 4ASWC 1E8YA 5KHOA 3Q3OC 2DWQA 5GMVA 4URKA 1WJUA 3NHEB 2GBNA 4FBJB 3DBLB 3WIMA 4KKJA 1D5MC 3P63A
chains in the Genus database with same CATH topology
2MSED 3DDCB 2M8SA 2PPHA 1K8RB 2PJHA 4I6LB 2WWZA 4FLHA 2BGFA 2XEWA 3K9OB 4GB9A 1ZW7A 3JW0X 2MCNB 3VAWA 2KXJA 3APCA 3O65B 2EMSA 2NPTA 3WAPA 1Q0WB 3AI5A 5EDSA 3NZSA 3IHPC 5CX3A 3ZRFA 3R66C 3ZKJC 1GNUA 1WH3A 2M4NA 1M94A 2LVOA 3I3TB 3L0WB 1WMHA 3NY5A 4FHJA 2ZJDA 4W9IA 3UIOB 2BWFA 3BINA 5AEKB 1WM3A 4W9KA 2QHOA 4K7WA 3QJZA 1AARA 1V80A 4EZLA 1IPGA 3AULA 2BYFA 2G45B 2LRWA 3TBLD 4AOFA 3RZWC 1NBFC 2DAFA 2IO0B 4I6NB 4IWOA 4OVVA 4OVUA 1OEYJ 3ZVVA 1XQQA 1E7VA 2K8HA 4G11A 4GDKB 4F8CB 1LXDA 1XD3B 1IYFA 1L2NA 3U8ZA 2BYVE 3N32A 1ISNA 2O6VB 3Q3FA 5AZGA 5JHBA 3A9JA 3PHXB 3ZTDA 3PRZA 4IUMB 3TIXA 2PE6B 3H7PB 2KJHB 2YLMA 3W1SA 2LGYA 4NQKE 3RD2A 3JSVA 2KQ7A 2L7RA 3DBRI 3OLMD 1YQBA 1WM2A 2L3ZA 4MEMA 4NAWB 2DENB 2JRHA 3DBLI 1KOTA 3A9KB 3PT2B 2J0MA 3U7DA 3VH3B 1P0RA 1WY8A 2JRIB 1L7YA 1U4AA 3QX1A 1JRUA 4G50A 4FJZA 2LRUA 3ML9A 3IFWB 2ZEQA 1EUVB 3L08A 5CHVC 1T0YA 3QQ8B 4K81A 2XBBC 2JF5A 4WWOA 3A1QB 3M3JA 3VTUA 4GDLB 4MGZE 1J0GA 3L54A 3DBHI 5C1ZA 4AJYB 2G4SA 1WJNA 4DWFA 1KJTA 2NVUI 2HTHA 2UWQA 2XK5B 4MELA 5AZHA 4W9GA 4BFRA 2KTRA 4CO7A 2FNJB 2R2OA 1R4NI 2MBOA 2KKCA 3IG3A 4B95A 3CMMB 3KUZA 4B6WA 1CMXB 1WX7A 4BKSD 4DHZB 2ZPYA 2RR9A 3R7RA 4DK5A 1UBIA 2L00B 3DQVA 3WALA 2ZVNA 2O2VB 2KNBA 4P7IA 5J17A 5AZFA 2KN5A 3V6CB 1WZ3A 4YL8A 2KDBA 4KSKC 3ZTCA 4MJSA 3SU8X 5J2RA 2M0XA 1RAXA 4AWJA 2IBIB 3PSEB 2LUEA 3R3MA 2NBWB 3TCAA 3QIJA 2R2QA 2N1WA 2FIFA 3PLVA 1IP9A 3QAQA 2JZ3B 2LGXA 4HJKA 1S3SG 4II2B 3KW5B 5CHFA 4A3PA 4XC2A 4HVBA 4EZJA 2BF8B 1XT9B 2CHZA 4KZ0A 1P1AA 2AYOB 1P98A 4GGQA 1YJ1A 2RD0A 3APDA 2ZNVB 2NR2A 2IZVB 4WJNA 3RYTA 1UELA 1LQBA 1UGMA 2AL3A 4KV2A 4E3CA 2OOBB 2M17A 4DDID 2V4LA 4J6IA 2NCNA 1Q5WB 3V6EB 3DPDA 1WGHA 1J19A 2BYEA 1C1YB 1YD8U 2K6QA 3M95A 1I42A 2DAJA 3GZNI 2K25A 4G0NB 2LXCA 2RGFA 3HIZA 3QC8B 4AJWA 1V2YA 3CSTA 5HKHA 2LZ6A 3ZDMC 3VFKA 3HM3A 2D10A 2J7QB 1V5TA 2FCNA 3ECIA 2Y5BB 3RT3B 4HPMB 2KOXA 2GBJA 2NBVB 3SD5A 3HM6X 4K7UA 3KUDB 4NJ7A 3DVNV 2G4DB 1V5OA 4MH0E 4MSQB 3UGBB 1GUAB 1NI2A 3TL5A 1WXSA 2CHXA 1OQYA 4WWNA 4EEWA 1LFDA 1ZKHA 2MBBB 1S1QB 4A3OA 4HPLB 2K39A 3B1LX 3MHSD 4BBNC 4BVUC 2MBEA 3QHTA 3H7PA 3CF6E 2LVPA 2V3SA 3CSFA 3N30A 2UYZB 1V81A 4FHKA 5KHQA 3AU4A 3N3KB 4HCPB 1NDDA 2CR5A 4WJOA 4KIKB 1X1MA 2C9WB 2KMAA 3ML8A 1V49A 1Y8RC 1E8XA 1WI0A 2WDTB 1WFYA 1WX9A 5DPSA 3H1UA 3RUIB 3A9KA 1SIFA 1PQSA 2JZZA 2BPSA 3LJ3A 4FN2A 1WE6A 1C3TA 3DVGX 4W9FA 2I1JA 2LD9A 2DZJA 2HD5B 2KDIA 4LDTD 4DXAB 1WJ6A 2AWTA 2IO3B 2ZVOA 4BOZB 2DZMA 2IY0B 2L0FA 4W9DA 1RRBA 1V9JA 2V1YA 1E5WA 3WANA 2DYBA 2HE7A 3ZLZA 5DPWA 3A1QA 2DZKA 2MBQA 3ZO5B 3Q3JA 4GDLA 2NBUA 1QZEA 4NPNA 2JXXA 2A5UA 5FR6A 1H4RA 3UINB 4IC7B 3DVGY 4HK2A 2XK5A 2Z59B 2GBRA 3DCGA 5LLIA 2LASA 1WF9A 1V86A 4HXDA 3L16A 2KDEB 3KUCB 2LVQA 3VUYA 2KWUB 2BKRB 2KC1A 1YX5B 2NPTB 3PS6A 4KDLB 2FCMA 3DBSA 3H7SA 4A20A 1TGZB 3QK0A 4IM3A 4IG7B 2C7HA 2O2VA 2EKEC 1WMHB 2DX5B 3EFUA 3V62A 4I6PA 1WGDA 2YVCA 1LM8B 4WAAA 4ANVA 5G55A 2WX0A 4FA6A 3ONSA 2JUOA 1J8CA 2VRRB 4EOYA 4DHJD 5DPTA 2N9XA 3ZNZB 1WYWB 2KX3A 1WXVA 4NNJB 2EMTA 4ANWA 3WAMA 4DHZE 4LJPB 2JT4B 1E8WA 1OGWA 3VH4B 2KO3A 3MJWA 4K1RB 4NJ6A 3PREA 2PE9A 2NS5A 4HLEA 3A9JB 3NOBA 4KVGB 2KWVB 4IWQA 4JGHB 5BO4B 2KHWB 4CYEA 4M8NA 3TMPB 3W1SC 4N9F4 4HDOA 4BKGA 2D07B 4LJOB 4M8MA 2L76A 2DYOA 1UZXB 4W9LA 4F1SA 2D3GA 2G3QB 4TQ0A 2MX2A 3EC8A 3KH0A 2GOWA 2KQSA 3SDLC 3D32A 1ZGUB 4TKNA 4JLCA 5JZEB 2KFKB 3AU5A 3UQBA 1UBQA 4MGKE 3MTNB 4RM8A 2KJRA 4GSWA 3VDZA 3ZNID 4BOSC 1GG3A 4ZRIA 2FCSA 5D94A 3PRPB 5IAAC 2LWPA 2MP2B 3QCAA 4MGYE 2DYMA 3PVLA 2KX0A 4PS7A 2FIDA 4EFOA 4PYUA 2ASQA 3KYDD 2JY6A 1GC7A 4WWPA 3M62B 2O6VD 3NS8A 3PLUA 2J0KA 4KDIC 3OJ4B 4M0WB 4ZYNA 4CHKA 2KDFB 2N7DA 3X23A 3PHWB 2KC2A 2FUHB 2HJ8A 3QA8A 1WR1A 5JH5C 5L83A 2IO2B 2DHZA 4WJPA 2GBMA 2AEHA 1KLVA 2CS4A 2IYDB 5DCNA 2Z0EB 4GDKA 5C23A 4GIVA 2W9NA 4ZRJA 3P2BA 2C60A 3RULA 2O6VA 2Z0DB 3S2AA 2WX1A 3WA0A 3GOEA 4TV3A 1E90A 3JYUA 4PYZA 3H6NA 2FAZA 3L17A 1WRDB 2JPHA 4EKUA 2M1MA 3T8MA 1RLFA 2KD0A 2MLBA 3ZDTA 3A4RA 5CHWA 3DVNU 4ZDVA 2KANA 4FJVB 4MGIE 1WGRA 2L0TA 4NAWA 2N7EA 1OTRB 3W1YA 4KSLC 2MBHA 3PV1A 4HDQA 4HWIB 3X0WA 1G6JA 3ZW3A 3M63B 3VTVA 5DPRA 2IO1B 3RZFA 2L05A 3LDZE 3ZNGC 3ZUNA 2BKFA 1EF5A 1TZ1A 4K7SA 3R7QA 2D11A 2RSUA 4FULA 4HCNB 2C5LC 2GBKA 2ZZPB 5JHAA 2AL6A 4IWPA 5E6NA 2N9EB 4PS8A 4E74A 4FADA 1TTNA 1WZ0A 5TR5A 4IM0A 1MG8A 4W9HA 2PEAA 3AXCA 4GOCA 1A5RA 3APFA 3SHQA 1GC6A 4IM2A 3ZNHB 3DOWA 3VUXA 4IW0A 1WJ4A 2KK8A 2KWCA 4GN1A 3QWZB 2LI5A 3IBEA 1V6EA 4NQLB 5E6OA 3HK0A 3T9LA 2A4ZA 4ICUA 2MW5A 1WIAA 3ENEA 4MSMB 4BBNF 4E71A 3PZDA 4LCDE 5J18A 1WE7A 3L13A 4JIOU 2KVRA 1KM7A 1WR6E 1VCBA 3PRMB 2WYQA 3UQAA 2I1KA 5L95C 2N9PC 2ZPNA 1HE8A 1R4MI 3C0RB 3VTWA 4DDGD 5D2MB 2MA9B 3VHTC 2K1FA 2LXAA 2MRPA 1WGYA 2LGDA 2ZCCA 4F7ZA 2CKHB 4MDKE 2KFKA 3WAOA 1WXMA 2MWSB 3BY4B 4WJQA 4RMAA 1P9DU 1E8ZA 2GMIC 4G3XB 2C7MB 4JL9A 3ZRCA 3UIPB 4W9EA 2B3AA 2MP2A 2LJ5A 5D6JB 3ALBA 3U30A 3A4SC 1Q1OA 1EO6A 3A33B 5D7GA 1EF1A 2DZIA 3OJ3A 3HHMA 3NZUA 4PS3A 5CTRC 2FCQA 2MQJA 4DBGA 3JSVB 3EECA 3VXWA 1UH6A 4GMVA 1F9JA 1VD2A 4XZ4A 2N1VA 4ZRKA 2D2QA 3RCZA 4LDTB 2RPQA 1GJZA 4EZKA 4KZCA 3OAWA 2N4FA 1YX6B 4W9CA 2K8BA 3TJPA 2K6DB 4XX5A 3V61A 4TUUA 4RM9A 4GU2A 3ZIMA 3JVZX 1SE9A 2ZCBA 2KTFA 3IVFA 3K9PB 1Z5SB 2KJ6A 3B08A 4AUQC 2K8CA 4AP4C 3VUWA 2IY1B 3EHVA 1SGHA 2J0JA 2OJRA 1WXAA 2JVCA 3PTFC 4ANUA 4EUTA 1WX8A 4W9JA 3QARA 3B0AA 5LXHA 2C7NB 2CU1A 1TBEA 3PPAA 4MM3A 3V60A 4BKSA 1I35A 1H8CA 4KIKA 1WGGA 2KTRB 4X57B 5IA7A 1E7UA 4WQOB 5E6PA 2KLCA 3KYCD 2L8JA 2BWES 2REXA 4NY0A 2ZNVC 5LXIB 3H9DA 1P3QU 4ANXA 4II3B 4B9KA 2CHWA 2KZRA 1OEYA 3L10B 3VQIA 2KFJA 4ASWC 4ICVA 1BT0A 1E8YA 1RFAA 1Z2MA 3PGEA 5KHOA 4FJYA 4GXBA 4DHJB 4BKTA 1D3ZA 5GMVA 4MJSB 3KVFB 1UD7A 4JQWC 4URKA 1WJUA 3NHEB 2GBNA 2KLGA 4FBJB 2KMCA 3WIMA 2JWZA 3VVWB 1YIWA 3UF8A 1FXTB 4TQ1A 5G2NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MSE D;  3DDC B;  2M8S A;  2PPH A;  1K8R B;  2PJH A;  4I6L B;  2WWZ A;  4FLH A;  2BGF A;  2XEW A;  3K9O B;  4GB9 A;  1ZW7 A;  3JW0 X;  2MCN B;  3VAW A;  2KXJ A;  3APC A;  3O65 B;  2EMS A;  2NPT A;  3WAP A;  1Q0W B;  3AI5 A;  5EDS A;  3NZS A;  3IHP C;  5CX3 A;  3ZRF A;  3R66 C;  3ZKJ C;  1GNU A;  1WH3 A;  2M4N A;  1M94 A;  2LVO A;  3I3T B;  3L0W B;  1WMH A;  3NY5 A;  4FHJ A;  2ZJD A;  4W9I A;  3UIO B;  2BWF A;  3BIN A;  5AEK B;  1WM3 A;  4W9K A;  2QHO A;  4K7W A;  3QJZ A;  1AAR A;  1V80 A;  4EZL A;  1IPG A;  3AUL A;  2BYF A;  2G45 B;  2LRW A;  3TBL D;  4AOF A;  3RZW C;  1NBF C;  2DAF A;  2IO0 B;  4I6N B;  4IWO A;  4OVV A;  4OVU A;  1OEY J;  3ZVV A;  1XQQ A;  1E7V A;  2K8H A;  4G11 A;  4GDK B;  4F8C B;  1LXD A;  1XD3 B;  1IYF A;  1L2N A;  3U8Z A;  2BYV E;  3N32 A;  1ISN A;  2O6V B;  3Q3F A;  5AZG A;  5JHB A;  3A9J A;  3PHX B;  3ZTD A;  3PRZ A;  4IUM B;  3TIX A;  2PE6 B;  3H7P B;  2KJH B;  2YLM A;  3W1S A;  2LGY A;  4NQK E;  3RD2 A;  3JSV A;  2KQ7 A;  2L7R A;  3DBR I;  3OLM D;  1YQB A;  1WM2 A;  2L3Z A;  4MEM A;  4NAW B;  2DEN B;  2JRH A;  3DBL I;  1KOT A;  3A9K B;  3PT2 B;  2J0M A;  3U7D A;  3VH3 B;  1P0R A;  1WY8 A;  2JRI B;  1L7Y A;  1U4A A;  3QX1 A;  1JRU A;  4G50 A;  4FJZ A;  2LRU A;  3ML9 A;  3IFW B;  2ZEQ A;  1EUV B;  3L08 A;  5CHV C;  1T0Y A;  3QQ8 B;  4K81 A;  2XBB C;  2JF5 A;  4WWO A;  3A1Q B;  3M3J A;  3VTU A;  4GDL B;  4MGZ E;  1J0G A;  3L54 A;  3DBH I;  5C1Z A;  4AJY B;  2G4S A;  1WJN A;  4DWF A;  1KJT A;  2NVU I;  2HTH A;  2UWQ A;  2XK5 B;  4MEL A;  5AZH A;  4W9G A;  4BFR A;  2KTR A;  4CO7 A;  2FNJ B;  2R2O A;  1R4N I;  2MBO A;  2KKC A;  3IG3 A;  4B95 A;  3CMM B;  3KUZ A;  4B6W A;  1CMX B;  1WX7 A;  4BKS D;  4DHZ B;  2ZPY A;  2RR9 A;  3R7R A;  4DK5 A;  1UBI A;  2L00 B;  3DQV A;  3WAL A;  2ZVN A;  2O2V B;  2KNB A;  4P7I A;  5J17 A;  5AZF A;  2KN5 A;  3V6C B;  1WZ3 A;  4YL8 A;  2KDB A;  4KSK C;  3ZTC A;  4MJS A;  3SU8 X;  5J2R A;  2M0X A;  1RAX A;  4AWJ A;  2IBI B;  3PSE B;  2LUE A;  3R3M A;  2NBW B;  3TCA A;  3QIJ A;  2R2Q A;  2N1W A;  2FIF A;  3PLV A;  1IP9 A;  3QAQ A;  2JZ3 B;  2LGX A;  4HJK A;  1S3S G;  4II2 B;  3KW5 B;  5CHF A;  4A3P A;  4XC2 A;  4HVB A;  4EZJ A;  2BF8 B;  1XT9 B;  2CHZ A;  4KZ0 A;  1P1A A;  2AYO B;  1P98 A;  4GGQ A;  1YJ1 A;  2RD0 A;  3APD A;  2ZNV B;  2NR2 A;  2IZV B;  4WJN A;  3RYT A;  1UEL A;  1LQB A;  1UGM A;  2AL3 A;  4KV2 A;  4E3C A;  2OOB B;  2M17 A;  4DDI D;  2V4L A;  4J6I A;  2NCN A;  1Q5W B;  3V6E B;  3DPD A;  1WGH A;  1J19 A;  2BYE A;  1C1Y B;  1YD8 U;  2K6Q A;  3M95 A;  1I42 A;  2DAJ A;  3GZN I;  2K25 A;  4G0N B;  2LXC A;  2RGF A;  3HIZ A;  3QC8 B;  4AJW A;  1V2Y A;  3CST A;  5HKH A;  2LZ6 A;  3ZDM C;  3VFK A;  3HM3 A;  2D10 A;  2J7Q B;  1V5T A;  2FCN A;  3ECI A;  2Y5B B;  3RT3 B;  4HPM B;  2KOX A;  2GBJ A;  2NBV B;  3SD5 A;  3HM6 X;  4K7U A;  3KUD B;  4NJ7 A;  3DVN V;  2G4D B;  1V5O A;  4MH0 E;  4MSQ B;  3UGB B;  1GUA B;  1NI2 A;  3TL5 A;  1WXS A;  2CHX A;  1OQY A;  4WWN A;  4EEW A;  1LFD A;  1ZKH A;  2MBB B;  1S1Q B;  4A3O A;  4HPL B;  2K39 A;  3B1L X;  3MHS D;  4BBN C;  4BVU C;  2MBE A;  3QHT A;  3H7P A;  3CF6 E;  2LVP A;  2V3S A;  3CSF A;  3N30 A;  2UYZ B;  1V81 A;  4FHK A;  5KHQ A;  3AU4 A;  3N3K B;  4HCP B;  1NDD A;  2CR5 A;  4WJO A;  4KIK B;  1X1M A;  2C9W B;  2KMA A;  3ML8 A;  1V49 A;  1Y8R C;  1E8X A;  1WI0 A;  2WDT B;  1WFY A;  1WX9 A;  5DPS A;  3H1U A;  3RUI B;  3A9K A;  1SIF A;  1PQS A;  2JZZ A;  2BPS A;  3LJ3 A;  4FN2 A;  1WE6 A;  1C3T A;  3DVG X;  4W9F A;  2I1J A;  2LD9 A;  2DZJ A;  2HD5 B;  2KDI A;  4LDT D;  4DXA B;  1WJ6 A;  2AWT A;  2IO3 B;  2ZVO A;  4BOZ B;  2DZM A;  2IY0 B;  2L0F A;  4W9D A;  1RRB A;  1V9J A;  2V1Y A;  1E5W A;  3WAN A;  2DYB A;  2HE7 A;  3ZLZ A;  5DPW A;  3A1Q A;  2DZK A;  2MBQ A;  3ZO5 B;  3Q3J A;  4GDL A;  2NBU A;  1QZE A;  4NPN A;  2JXX A;  2A5U A;  5FR6 A;  1H4R A;  3UIN B;  4IC7 B;  3DVG Y;  4HK2 A;  2XK5 A;  2Z59 B;  2GBR A;  3DCG A;  5LLI A;  2LAS A;  1WF9 A;  1V86 A;  4HXD A;  3L16 A;  2KDE B;  3KUC B;  2LVQ A;  3VUY A;  2KWU B;  2BKR B;  2KC1 A;  1YX5 B;  2NPT B;  3PS6 A;  4KDL B;  2FCM A;  3DBS A;  3H7S A;  4A20 A;  1TGZ B;  3QK0 A;  4IM3 A;  4IG7 B;  2C7H A;  2O2V A;  2EKE C;  1WMH B;  2DX5 B;  3EFU A;  3V62 A;  4I6P A;  1WGD A;  2YVC A;  1LM8 B;  4WAA A;  4ANV A;  5G55 A;  2WX0 A;  4FA6 A;  3ONS A;  2JUO A;  1J8C A;  2VRR B;  4EOY A;  4DHJ D;  5DPT A;  2N9X A;  3ZNZ B;  1WYW B;  2KX3 A;  1WXV A;  4NNJ B;  2EMT A;  4ANW A;  3WAM A;  4DHZ E;  4LJP B;  2JT4 B;  1E8W A;  1OGW A;  3VH4 B;  2KO3 A;  3MJW A;  4K1R B;  4NJ6 A;  3PRE A;  2PE9 A;  2NS5 A;  4HLE A;  3A9J B;  3NOB A;  4KVG B;  2KWV B;  4IWQ A;  4JGH B;  5BO4 B;  2KHW B;  4CYE A;  4M8N A;  3TMP B;  3W1S C;  4N9F 4;  4HDO A;  4BKG A;  2D07 B;  4LJO B;  4M8M A;  2L76 A;  2DYO A;  1UZX B;  4W9L A;  4F1S A;  2D3G A;  2G3Q B;  4TQ0 A;  2MX2 A;  3EC8 A;  3KH0 A;  2GOW A;  2KQS A;  3SDL C;  3D32 A;  1ZGU B;  4TKN A;  4JLC A;  5JZE B;  2KFK B;  3AU5 A;  3UQB A;  1UBQ A;  4MGK E;  3MTN B;  4RM8 A;  2KJR A;  4GSW A;  3VDZ A;  3ZNI D;  4BOS C;  1GG3 A;  4ZRI A;  2FCS A;  5D94 A;  3PRP B;  5IAA C;  2LWP A;  2MP2 B;  3QCA A;  4MGY E;  2DYM A;  3PVL A;  2KX0 A;  4PS7 A;  2FID A;  4EFO A;  4PYU A;  2ASQ A;  3KYD D;  2JY6 A;  1GC7 A;  4WWP A;  3M62 B;  2O6V D;  3NS8 A;  3PLU A;  2J0K A;  4KDI C;  3OJ4 B;  4M0W B;  4ZYN A;  4CHK A;  2KDF B;  2N7D A;  3X23 A;  3PHW B;  2KC2 A;  2FUH B;  2HJ8 A;  3QA8 A;  1WR1 A;  5JH5 C;  5L83 A;  2IO2 B;  2DHZ A;  4WJP A;  2GBM A;  2AEH A;  1KLV A;  2CS4 A;  2IYD B;  5DCN A;  2Z0E B;  4GDK A;  5C23 A;  4GIV A;  2W9N A;  4ZRJ A;  3P2B A;  2C60 A;  3RUL A;  2O6V A;  2Z0D B;  3S2A A;  2WX1 A;  3WA0 A;  3GOE A;  4TV3 A;  1E90 A;  3JYU A;  4PYZ A;  3H6N A;  2FAZ A;  3L17 A;  1WRD B;  2JPH A;  4EKU A;  2M1M A;  3T8M A;  1RLF A;  2KD0 A;  2MLB A;  3ZDT A;  3A4R A;  5CHW A;  3DVN U;  4ZDV A;  2KAN A;  4FJV B;  4MGI E;  1WGR A;  2L0T A;  4NAW A;  2N7E A;  1OTR B;  3W1Y A;  4KSL C;  2MBH A;  3PV1 A;  4HDQ A;  4HWI B;  3X0W A;  1G6J A;  3ZW3 A;  3M63 B;  3VTV A;  5DPR A;  2IO1 B;  3RZF A;  2L05 A;  3LDZ E;  3ZNG C;  3ZUN A;  2BKF A;  1EF5 A;  1TZ1 A;  4K7S A;  3R7Q A;  2D11 A;  2RSU A;  4FUL A;  4HCN B;  2C5L C;  2GBK A;  2ZZP B;  5JHA A;  2AL6 A;  4IWP A;  5E6N A;  2N9E B;  4PS8 A;  4E74 A;  4FAD A;  1TTN A;  1WZ0 A;  5TR5 A;  4IM0 A;  1MG8 A;  4W9H A;  2PEA A;  3AXC A;  4GOC A;  1A5R A;  3APF A;  3SHQ A;  1GC6 A;  4IM2 A;  3ZNH B;  3DOW A;  3VUX A;  4IW0 A;  1WJ4 A;  2KK8 A;  2KWC A;  4GN1 A;  3QWZ B;  2LI5 A;  3IBE A;  1V6E A;  4NQL B;  5E6O A;  3HK0 A;  3T9L A;  2A4Z A;  4ICU A;  2MW5 A;  1WIA A;  3ENE A;  4MSM B;  4BBN F;  4E71 A;  3PZD A;  4LCD E;  5J18 A;  1WE7 A;  3L13 A;  4JIO U;  2KVR A;  1KM7 A;  1WR6 E;  1VCB A;  3PRM B;  2WYQ A;  3UQA A;  2I1K A;  5L95 C;  2N9P C;  2ZPN A;  1HE8 A;  1R4M I;  3C0R B;  3VTW A;  4DDG D;  5D2M B;  2MA9 B;  3VHT C;  2K1F A;  2LXA A;  2MRP A;  1WGY A;  2LGD A;  2ZCC A;  4F7Z A;  2CKH B;  4MDK E;  2KFK A;  3WAO A;  1WXM A;  2MWS B;  3BY4 B;  4WJQ A;  4RMA A;  1P9D U;  1E8Z A;  2GMI C;  4G3X B;  2C7M B;  4JL9 A;  3ZRC A;  3UIP B;  4W9E A;  2B3A A;  2MP2 A;  2LJ5 A;  5D6J B;  3ALB A;  3U30 A;  3A4S C;  1Q1O A;  1EO6 A;  3A33 B;  5D7G A;  1EF1 A;  2DZI A;  3OJ3 A;  3HHM A;  3NZU A;  4PS3 A;  5CTR C;  2FCQ A;  2MQJ A;  4DBG A;  3JSV B;  3EEC A;  3VXW A;  1UH6 A;  4GMV A;  1F9J A;  1VD2 A;  4XZ4 A;  2N1V A;  4ZRK A;  2D2Q A;  3RCZ A;  4LDT B;  2RPQ A;  1GJZ A;  4EZK A;  4KZC A;  3OAW A;  2N4F A;  1YX6 B;  4W9C A;  2K8B A;  3TJP A;  2K6D B;  4XX5 A;  3V61 A;  4TUU A;  4RM9 A;  4GU2 A;  3ZIM A;  3JVZ X;  1SE9 A;  2ZCB A;  2KTF A;  3IVF A;  3K9P B;  1Z5S B;  2KJ6 A;  3B08 A;  4AUQ C;  2K8C A;  4AP4 C;  3VUW A;  2IY1 B;  3EHV A;  1SGH A;  2J0J A;  2OJR A;  1WXA A;  2JVC A;  3PTF C;  4ANU A;  4EUT A;  1WX8 A;  4W9J A;  3QAR A;  3B0A A;  5LXH A;  2C7N B;  2CU1 A;  1TBE A;  3PPA A;  4MM3 A;  3V60 A;  4BKS A;  1I35 A;  1H8C A;  4KIK A;  1WGG A;  2KTR B;  4X57 B;  5IA7 A;  1E7U A;  4WQO B;  5E6P A;  2KLC A;  3KYC D;  2L8J A;  2BWE S;  2REX A;  4NY0 A;  2ZNV C;  5LXI B;  3H9D A;  1P3Q U;  4ANX A;  4II3 B;  4B9K A;  2CHW A;  2KZR A;  1OEY A;  3L10 B;  3VQI A;  2KFJ A;  4ASW C;  4ICV A;  1BT0 A;  1E8Y A;  1RFA A;  1Z2M A;  3PGE A;  5KHO A;  4FJY A;  4GXB A;  4DHJ B;  4BKT A;  1D3Z A;  5GMV A;  4MJS B;  3KVF B;  1UD7 A;  4JQW C;  4URK A;  1WJU A;  3NHE B;  2GBN A;  2KLG A;  4FBJ B;  2KMC A;  3WIM A;  2JWZ A;  3VVW B;  1YIW A;  3UF8 A;  1FXT B;  4TQ1 A;  5G2N A; 
#chains in the Genus database with same CATH topology
 4JX1 C;  4FLH A;  2BGF A;  3APC A;  3I9V 1;  3O65 B;  3U52 E;  2NPT A;  4AQ7 A;  3BYY B;  1GNU A;  1WH3 A;  1M94 A;  1B1Z A;  3BIN A;  1K50 A;  4W9K A;  3W2D A;  4K7W A;  1R4N B;  1AW7 A;  2WNM A;  4LLG M;  1AAR A;  4EZL A;  1VJK A;  2XNA C;  2BYF A;  2G45 B;  3RZW C;  3V3X A;  3ZJU A;  4OVU A;  1XQQ A;  4F8C B;  1L6V A;  5JHB A;  3A9J A;  3ZTD A;  3NJT A;  3Q3N C;  2BS3 B;  2PE6 B;  3W1S A;  1TT5 B;  2LGY A;  1TKG A;  3JSV A;  2N9K A;  3AN1 A;  2WXP A;  4K3C A;  4MEM A;  1EM7 A;  3RI7 C;  1P0R A;  2JRI B;  1L7Y A;  5HFY A;  2LRU A;  3GZN B;  1YN3 A;  4WWO A;  3M3J A;  4GDL B;  1E0Z A;  5C1Z A;  4AJY B;  1WJN A;  4OW0 A;  1KJT A;  1IUE A;  1T6B X;  4BFR A;  1FFU A;  2FNJ B;  2R2O A;  4B6W A;  1KLG D;  4JE3 B;  3R7R A;  1V1P A;  3DQV A;  3NUH B;  3H8H A;  5J17 A;  3I5J C;  4YTM B;  1QT9 A;  4YL8 A;  5D3D A;  1P7E A;  2JSV X;  5J2R A;  2J52 A;  3DHH C;  1B9R A;  1RAX A;  3IT6 B;  1FFV A;  3LB8 C;  2R2Q A;  5FR3 A;  1STE A;  3NVV A;  2BQQ A;  2LGX A;  1S3S G;  2HTM E;  1NYQ A;  4HVB A;  1JWS D;  1YMH E;  4WJN A;  4KV2 A;  2M17 A;  3V6E B;  1J19 A;  1YD8 U;  2G9H D;  2DAJ A;  2K25 A;  1VZ7 A;  4G0N B;  2V4I B;  3HIZ A;  5FK9 C;  3CST A;  5HKH A;  3ZDM C;  3SFD B;  2J7Q B;  1EU4 A;  3ECI A;  3FAH A;  4ARC A;  4HPM B;  2GBJ A;  4RH6 A;  3OG5 A;  1OFF A;  3KUD B;  1V5O A;  1UNS A;  4WWN A;  1OQY A;  1S1Q B;  1ZXI A;  4A3O A;  2K39 A;  2GB1 A;  3RFZ B;  2NTT A;  4BVU C;  5HG2 A;  3C8Y A;  3QHT A;  3Q8C A;  3BVM A;  3CSF A;  3Q8F A;  3ZYY X;  4FHK A;  3N3K B;  2CR5 A;  4WJO A;  2C9W B;  2KMA A;  3MHZ A;  1E8X A;  1PDX A;  2QMT A;  1WX9 A;  5DPS A;  1HEZ E;  4RGN A;  3ZJT A;  1MHH E;  4W9F A;  2I1J A;  2LHD A;  2DZJ A;  2IO3 B;  4BOZ B;  1T3Q A;  1J7A A;  3CWI A;  2WQY B;  4YWG G;  1V9J A;  2V1Y A;  5DPW A;  2DZK A;  3Q3J A;  4GDL A;  1QZE A;  4NPN A;  2JXX A;  1XLQ A;  1FXI A;  1H4R A;  3NG0 A;  3DVG Y;  4HK2 A;  1KFY B;  2Z59 B;  2GBR A;  2KDE B;  2KWU B;  2BKR B;  4A20 A;  3L4P A;  3BVZ A;  2BYT A;  2GRI A;  2C7H A;  4KGT A;  2JZP A;  2RDB C;  4ZYS A;  4ANV A;  4WAA A;  1KF6 B;  1E7P B;  2JUO A;  2VRR B;  4DHJ D;  5DPT A;  2WHI A;  1HZ6 A;  1HQR D;  3MJW A;  3U2S C;  2INN E;  4NJ6 A;  4OVZ A;  2WXM A;  1ZUD 2;  3VRB B;  3W5V B;  2E3T A;  1OQQ A;  3P4P B;  4N9F 4;  4LJO B;  2KT7 A;  4W9L A;  4N59 A;  4F1S A;  1NYR A;  2G3Q B;  2MX2 A;  2GOW A;  2KQS A;  1AN8 A;  4TKN A;  3UQB A;  1NI3 A;  5AUK A;  4BOS C;  3QCA A;  3VR9 B;  2DYM A;  4PS7 A;  2FID A;  2ASQ A;  2FUH B;  5L83 A;  3RNC C;  2KVZ A;  1Y56 A;  2CS4 A;  5IN7 A;  2HJ1 A;  4NAM A;  1IBX B;  1UWM A;  3P2B A;  3C19 A;  2Z0D B;  3S2A A;  3JYU A;  2RDH A;  3H6N A;  4PYZ A;  2PVG C;  1IGC A;  1WWT A;  4LNI A;  4EKU A;  2M1M A;  1RLF A;  2KD0 A;  3KQ4 A;  5I4D A;  1WGR A;  2N7E A;  3W1Y A;  4HDQ A;  3X0W A;  3M63 B;  3RZF A;  3LDZ E;  3ZNG C;  1UGJ A;  3ZUN A;  4LNF A;  3HVZ A;  2OJW A;  1TZ1 A;  4K7S A;  2JYT A;  3AEE B;  2ZZP B;  5JHA A;  4IWP A;  5E6N A;  2N9E B;  1JWB D;  1RM6 C;  3SR6 A;  1PFD A;  3AXC A;  3ZJV A;  3DOW A;  4IW0 A;  4GN1 A;  4NQL B;  5E6J A;  4BBN F;  5J18 A;  4LNN A;  3L13 A;  4JIO U;  2KVR A;  2WYQ A;  1I4G A;  3UQA A;  3LXF A;  1R4M I;  2D3A A;  3VTW A;  4DXF A;  2MA9 B;  2LXA A;  3LYY A;  2MH7 A;  3BY4 B;  1N63 A;  1P9D U;  1E8Z A;  1N5X A;  1HZ5 A;  4G3X B;  4RCO A;  3AB5 A;  4JL9 A;  2B3A A;  2LJ5 A;  3A4S C;  1Q1O A;  4O1N A;  3NZU A;  5CTR C;  2FCQ A;  3KWV A;  2MQJ A;  1XCT L;  4REZ A;  1UH6 A;  3Q8A A;  4M02 A;  1VD2 A;  2WDV B;  2D2Q A;  1GJZ A;  4EZK A;  4KZC A;  1VR9 A;  3OAW A;  3TJP A;  4XX5 A;  5IO9 A;  1XEE A;  3JVZ X;  3B08 A;  4AUQ C;  4CQN A;  1PGA A;  1I4X A;  4AP4 C;  2IY1 B;  2OJR A;  4TSS A;  3QAR A;  3B0A A;  2N9L A;  2J4X A;  1QOB A;  3PPA A;  1K51 A;  2KTR B;  1JAL A;  2PTL A;  1PYW D;  4X57 B;  4WQO B;  1E9M A;  2L8J A;  2Y5P A;  2M19 A;  4NY0 A;  3U4E G;  4ICV A;  3PGE A;  4FJY A;  3DBR B;  2QJL A;  4LK0 M;  5D3I B;  2CU3 A;  4JQW C;  3KVF B;  3DHG C;  3AE5 B;  2WXK A;  4S0R A;  1L0Y B;  3VVW B;  1YIW A;  2SAK A;  1FXT B;  2ONQ A;  5G2N A;  1ZXH A;  2MSE D;  1R7S A;  2M8S A;  2PPH A;  2MHJ A;  4I6L B;  3JW0 X;  1TKY A;  5HHD G;  2KXJ A;  1EWY C;  2EMS A;  1Q0W B;  3AI5 A;  1ZP0 B;  5EDS A;  3IHP C;  3R66 C;  1I4H A;  2M4N A;  4FHJ A;  1WMH A;  4W9I A;  2BWF A;  3ETR A;  1WM3 A;  3DHI C;  1WXQ A;  3QJZ A;  3RNE C;  3IT4 B;  3NVY A;  4C4V A;  4IWO A;  2DLB A;  3ZVV A;  1C9F A;  4GDK B;  2LUM A;  1XD3 B;  1IYF A;  1L2N A;  1D4B A;  2SEB D;  2V3N A;  1JWA D;  3PRZ A;  4OZB A;  1T0S C;  3MJ5 A;  2K9X A;  2X8X X;  2KJH B;  2YLM A;  2W82 A;  4MAC A;  4NQK E;  2KQ7 A;  2L7R A;  1LGR A;  3OLM D;  1WM2 A;  3Q14 C;  2V9H A;  4NAW B;  2JRH A;  4L1B A;  3N1Z C;  3R8B A;  3PT2 B;  3VH3 B;  3ML9 A;  1D5Z C;  2ZEQ A;  3L08 A;  1T0Y A;  2WXG A;  2OED A;  2BB6 A;  3A1Q B;  4MGZ E;  3ZQ4 A;  3L54 A;  3DBH I;  1WGK A;  1YOV B;  4XWT A;  2NVU I;  2UWQ A;  2XK5 B;  4MEL A;  4LNO A;  5AZH A;  4WH4 A;  2KTR A;  1FPY A;  2I38 A;  2MBO A;  2KKC A;  4A6Q A;  4XYC A;  1CMX B;  1WX7 A;  4BKS D;  4DK5 A;  3AH7 A;  4N58 A;  1UBI A;  3I57 A;  2ICI A;  3WAL A;  4IDI A;  1JRP A;  5AZF A;  4ZOH C;  3V6C B;  2PIA A;  3SU8 X;  2M0X A;  4AWJ A;  3TCA A;  3PLV A;  3NVZ A;  2JZ3 B;  3R2I A;  2WXH A;  3KW5 B;  5CHF A;  4YSY B;  3BII D;  2JXT A;  2BF8 B;  2CHZ A;  1N62 A;  1P1A A;  4JWU C;  1P98 A;  1YJ1 A;  3APD A;  4C80 A;  3RYT A;  1UGM A;  1YN5 A;  4DDI D;  2NCN A;  3RNB C;  1UF0 A;  2LEK A;  2LFI A;  2LXC A;  2RGF A;  3QC8 B;  4AJW A;  1PGX A;  1V5T A;  3SD5 A;  2ON8 A;  1XF5 L;  1XCQ L;  3HM6 X;  4K7U A;  2YEP B;  3DVN V;  4MH0 E;  2VZK B;  3HUI A;  1WXS A;  1VLB A;  4M00 A;  3EUB 2;  3TL5 A;  4EEW A;  4HPL B;  2LMC A;  5FKA C;  1FRD A;  1NDD A;  4KIK B;  3ML8 A;  1HXY D;  3P4R B;  1WI0 A;  2WDT B;  5BYS A;  1XXG A;  3RUI B;  2BPS A;  3BYT B;  4FN2 A;  2HD5 B;  4YSX B;  4LDT D;  1WJ6 A;  2AWT A;  2XN9 C;  1RRB A;  2J42 A;  1KH0 A;  2J53 A;  3A1Q A;  3ZO5 B;  1MVK A;  2WXN A;  1D5X C;  4A55 A;  3UIN B;  4IC7 B;  2XK5 A;  5LLI A;  1VZ8 A;  1P7F A;  3UI3 A;  2KC1 A;  3AEC B;  3PS6 A;  4IM3 A;  4IG7 B;  2V0G A;  1E6E B;  1RWS A;  3O13 A;  4FXC A;  1L0V B;  3ZNZ B;  2D5G A;  3CIR B;  1WYW B;  2JWU A;  1WXV A;  2KX3 A;  4NNJ B;  3WAM A;  4DHZ E;  2AQ3 B;  1OGW A;  3GE8 C;  1FO4 A;  3PRE A;  2ZW0 A;  2NS5 A;  3TEW A;  2KWV B;  1L4Z B;  2L1A A;  4JGH B;  4WIP A;  2KHW B;  4CYE A;  3TMP B;  1XO3 A;  1QQR A;  2QIE B;  4HDO A;  5T8I A;  3ZXV A;  5EE9 A;  4WQM A;  2WDQ B;  1UZX B;  1C77 A;  2D3G A;  4TQ0 A;  3RNG C;  1C4P A;  3SDL C;  2BW2 A;  1ZGU B;  1FNW A;  3AU5 A;  3E9S A;  4ZRI A;  1A70 A;  5D94 A;  3PRP B;  4ZHO A;  2LWP A;  2MP2 B;  2AX5 A;  4MGY E;  3W5U B;  4EFO A;  3N9Y C;  4OZA A;  2JY6 A;  1GC7 A;  4WWP A;  1JML A;  3PLU A;  4LNK A;  2J0K A;  4KDI C;  3OJ4 B;  5C3J B;  1YJJ A;  3AEA B;  1YJI A;  3PHW B;  4KGR A;  2KC2 A;  4P6V F;  3QA8 A;  2IO2 B;  3AEB B;  1DGJ A;  2DHZ A;  4WJP A;  2GBM A;  3GP7 A;  1FEH A;  5C23 A;  4MH8 A;  4YTP B;  2TSS A;  2EKI A;  3GOE A;  1E90 A;  3TSS A;  2WGS A;  3L17 A;  2DBY A;  2B76 B;  2W3S A;  3T8M A;  3ZDT A;  1TKE A;  4XGA B;  3A4R A;  2WU5 B;  1F1H A;  1V97 A;  3DVN U;  4P1C C;  1QLB B;  4RF1 A;  4ZHP A;  2HDE A;  4KX6 B;  1GB4 A;  1G6J A;  3PV1 A;  2IO1 B;  5H92 C;  3RNF C;  2BKF A;  2BTE A;  2MEK A;  1EF5 A;  2D11 A;  3ABV B;  2RSU A;  4FUL A;  1MPE A;  2K22 A;  5TR5 A;  4IM0 A;  1FNV A;  4W9H A;  1A5R A;  3APF A;  3HVD A;  3DWG C;  1WJ4 A;  5E6O A;  1SBB B;  3ENE A;  4E71 A;  2DNF A;  3PZD A;  5HI1 A;  3AV8 A;  1KM7 A;  1SIJ A;  2FUG 1;  1WR6 E;  4ITK A;  2N9P C;  3GB1 A;  5D2M B;  2K1F A;  2MRP A;  1WGY A;  2ZCC A;  4F7Z A;  3AE3 B;  2MWS B;  4J3O D;  2BS2 B;  3ZRC A;  1PGB A;  1TYG B;  2MP2 A;  5D6J B;  2QC8 A;  3ALB A;  3U30 A;  5EE0 A;  4PS3 A;  2NTS A;  3PO0 A;  1DOY A;  3AED B;  4GMV A;  1HTQ A;  1F9J A;  4XZ4 A;  2N1V A;  4ZRK A;  2WU2 B;  1F77 A;  2RPQ A;  4RGO S;  4JWS C;  1BML C;  3K9P B;  2KJ6 A;  2K8C A;  3MP9 A;  4HRS A;  1WX8 A;  4W9J A;  3AE4 B;  5LXH A;  2KYW A;  2C7N B;  2QCZ A;  1TBE A;  4L2Y A;  1H8C A;  3GE3 C;  1I4R A;  5E6P A;  3P1M A;  4YSZ B;  5IA7 A;  2KLC A;  3KYC D;  2REX A;  3H9D A;  1P3Q U;  2CHW A;  3VQI A;  2M0A A;  1RFA A;  1JWM D;  1M4V A;  1C4A A;  4MJS B;  1UD7 A;  2KLG A;  3P4S B;  2PMV A;  4TQ1 A;  1FCC C;  1SE4 A;  2PJH A;  2WWZ A;  3K9O B;  4P1B C;  2MCN B;  3VAW A;  2CJN A;  5IP4 D;  1HTO A;  3WAP A;  3NZS A;  5CX3 A;  3ZRF A;  3ZKJ C;  2LVO A;  3UIO B;  1PUT A;  5AEK B;  3EA6 A;  2KN4 A;  1T0Q C;  1V80 A;  2WXO A;  4A8X C;  3RN9 C;  3AUL A;  1VZ6 A;  4AOF A;  1ROE A;  1NBF C;  4OVV A;  4G11 A;  3SEB A;  1LXD A;  1CK1 A;  2LJI A;  1FNU A;  3U8Z A;  1ISN A;  2O6V B;  5AZG A;  3E56 A;  3Q2A C;  3PHX B;  2IDY A;  4IUM B;  3TIX A;  1L4D B;  3H7P B;  2DEN B;  3DBL I;  3ZXR A;  3A9K B;  3U7D A;  1I4Q A;  1WY8 A;  1U4A A;  2IGG A;  3QX1 A;  4G50 A;  1JRO A;  4HKQ A;  1EUV B;  1I4P A;  3QQ8 B;  4K81 A;  2XBB C;  1QOG A;  3AEF B;  4OZC A;  3U7Z A;  1TY2 A;  1ACC A;  4DWF A;  3I63 C;  3KLS X;  2HTH A;  1DOI A;  1GOZ A;  1R4N I;  3KUZ A;  1KLU D;  4DHZ B;  4YXD B;  2PKO A;  2RR9 A;  2L00 B;  1MG4 A;  5BMI A;  4B0E A;  2KNB A;  1IBX A;  1QKZ A;  5BYR A;  2KN5 A;  2I2Y A;  1SEB D;  1DOX A;  2KDB A;  1F52 A;  4KSK C;  4MJS A;  2IBI B;  3PSE B;  3R3M A;  2NBW B;  3QIJ A;  2N1W A;  2FIF A;  1IP9 A;  3QAQ A;  3HRD D;  4A3P A;  4C00 A;  4XC2 A;  1WSP A;  1KRH A;  4KZ0 A;  3NZ3 A;  4HRO A;  2AYO B;  2RD0 A;  2NR2 A;  2IZV B;  1UEL A;  1LQB A;  2AL3 A;  4E3C A;  2V4L A;  1Q5W B;  1N5W A;  1WGH A;  2KQ4 X;  3M95 A;  4EE2 A;  1L6U A;  3GZN I;  5G5G A;  1F0Z A;  1TS4 A;  1V2Y A;  2LZ6 A;  3VFK A;  4B0M A;  3MC8 A;  1J7C A;  2FCN A;  1VRA B;  2Y5B B;  2KOX A;  4IKG A;  1VDV A;  4NJ7 A;  2G4D B;  4MSQ B;  1GUA B;  1NI2 A;  1LFD A;  4YTN B;  2MBB B;  1RFK A;  2BBC A;  3B1L X;  4KKI A;  2MBE A;  2JQR B;  3H7P A;  1V81 A;  4ZRP A;  2ZW1 A;  1WFY A;  3H1U A;  3A9K A;  1SIF A;  1PQS A;  1ZOY B;  2JZZ A;  3NRZ A;  1C3T A;  1YNT E;  3EFC A;  2LD9 A;  1SE2 A;  2KDI A;  4DXA B;  2ZVO A;  2L0F A;  1FM0 D;  3WAN A;  2HE7 A;  3ZLZ A;  2MBQ A;  2NBU A;  3ZGZ A;  4A9A A;  2RDG A;  2A5U A;  1FRR A;  5FR6 A;  5LNK 1;  2L52 A;  3DCG A;  2LAS A;  4LTU A;  1WF9 A;  2YEP F;  1YN4 A;  1V86 A;  2ACZ B;  4HXD A;  2W55 A;  3KWL A;  3KUC B;  2LVQ A;  3VUY A;  3BZD B;  2BVC A;  4USA A;  2NPT B;  4XE0 A;  2FCM A;  3DBS A;  5AUI A;  4DQO C;  1TGZ B;  3QK0 A;  1WYG A;  2EKE C;  2CJO A;  3EFU A;  4M01 A;  1WGD A;  1LM8 B;  1UUP A;  5G55 A;  2WX0 A;  4FA6 A;  3ONS A;  4RNA A;  2N9X A;  4DXG A;  4ANW A;  1GAQ B;  4LJP B;  2JT4 B;  2M56 B;  2KO3 A;  4K1R B;  2PE9 A;  3A9J B;  1FIQ A;  4KVG B;  3N20 C;  2D3B A;  4BKG A;  2D07 B;  4M8M A;  5IOI A;  4C7Y A;  3EC8 A;  3Q8E A;  2Z8L A;  3D32 A;  2INC C;  3NS1 A;  5JZE B;  2KFK B;  3TEZ A;  1UBQ A;  4MGK E;  3MTN B;  3VRA B;  4QAY A;  2RMM A;  2KJR A;  4GSW A;  3VDZ A;  2N7J A;  1FXA A;  1WRI A;  5IAA C;  2BS4 B;  1L0X B;  1C4C A;  2JYE A;  3KYD D;  2LGS A;  2VH2 A;  4ZYN A;  4DBG A;  3NS8 A;  4M0W B;  2N7D A;  3X23 A;  1NVI D;  1WR1 A;  1KLV A;  4GDK A;  2WXR A;  2C60 A;  3BVG A;  2WX1 A;  3WA0 A;  4TV3 A;  1R4M B;  1XLN A;  2FAZ A;  1UWX A;  1WRD B;  2JPH A;  5CHW A;  4ZDV A;  2KAN A;  3RPF C;  4NAW A;  2PW9 A;  4HWI B;  3AMZ A;  3VTV A;  5DPR A;  4Q2J A;  2IND C;  3AEG B;  3AE7 B;  3BK1 A;  3R7Q A;  3B2F A;  1ENF A;  4R3D A;  4E74 A;  4FAD A;  1TTN A;  4ZRQ A;  2BB5 A;  3AE6 B;  1MG8 A;  2PEA A;  2MJD A;  3TUO A;  1SJH D;  2FE8 A;  4IM2 A;  3SHQ A;  3VUX A;  2KK8 A;  2KWC A;  3IBE A;  1E10 A;  2PVO D;  1F2R I;  2LGI A;  3FKY A;  2L83 A;  4ICU A;  3T9L A;  3T3N A;  3V05 A;  1MJD A;  4LCD E;  1WE7 A;  1ZDV A;  3PRM B;  1YQ4 B;  1HE8 A;  1SSN A;  2G1E A;  2CKH B;  2KFK A;  3WAO A;  1N6Z A;  4WJQ A;  4C56 C;  4K3B A;  5G5H A;  2UU7 A;  4YT0 B;  3A33 B;  1EO6 A;  5D7G A;  2VZK D;  4M0W A;  1SF0 A;  1QOA A;  3EEC A;  1SXT A;  4TMA B;  1QF6 A;  1ZE3 D;  2N4F A;  2JX5 A;  4NZL B;  4TUU A;  2X38 A;  3EGR A;  2VH1 A;  1NEK B;  3ZIM A;  1SE9 A;  3IVF A;  1Z5S B;  1XLO A;  3AE2 B;  3PTF C;  4ANU A;  3MFG A;  2CU1 A;  3V60 A;  4KIK A;  1E7U A;  5H8Y E;  2BWE S;  5LXI B;  2ZNV C;  4B9K A;  3Q3M C;  2KZR A;  2KFJ A;  1BT0 A;  1Z2M A;  3B9J A;  4GXB A;  4DHJ B;  4BKT A;  2WDR B;  3IAM 1;  1D3Z A;  4HPP A;  2AQ1 B;  3MC0 B;  1C78 A;  4HEA 1;  2JU6 X;  1V1O A;  2KMC A;  5C2T B;  2JWZ A;  2QEJ C;  1F2R C;  3UF8 A;  3FIL B;  2L32 A;  2NMQ A;  1I7H A;  4US9 A;  5JXV A;  3DDC B;  1K8R B;  3FC4 A;  2XEW A;  4GB9 A;  1ZW7 A;  2R61 A;  3DBH B;  3I3T B;  3L0W B;  3NY5 A;  4D2K A;  2ZJD A;  2BT6 A;  2QHO A;  1GB1 A;  1IPG A;  5BMH A;  3TBL D;  2LRW A;  1T0R C;  3Q6B A;  2DAF A;  2IO0 B;  4I6N B;  4RGM A;  1OEY J;  4BZA A;  1K52 A;  1E7V A;  2K8H A;  1HA5 A;  2BYV E;  3N32 A;  3Q3F A;  4A90 A;  2AQ2 B;  4UDU C;  3RD2 A;  1JQ4 A;  3DBR I;  1YQB A;  2L3Z A;  2MJ3 A;  2H89 B;  1KOT A;  1KTK A;  3MC9 A;  2J0M A;  2QSD A;  1JRU A;  4FJZ A;  2K5P A;  3N1Y C;  1SE3 A;  3IFW B;  3DWM A;  2W54 A;  4GLS C;  5CHV C;  3RNA C;  4KGS A;  4RF0 A;  2JF5 A;  3VTU A;  1J0G A;  4L23 A;  4H2A A;  2G4S A;  1OQR A;  1TS2 A;  4W9G A;  3TEY A;  4CO7 A;  1QIL A;  2IGH A;  3IG3 A;  4B95 A;  3CMM B;  1FCL A;  3Q69 A;  2ZPY A;  2ZVN A;  1SB3 C;  1DYQ A;  2O2V B;  4P7I A;  2EEL A;  1WZ3 A;  2QIL A;  3ZTC A;  1MI0 A;  3AE8 B;  2LUE A;  2Y5C A;  3PZ7 A;  4HJK A;  3FIL A;  4II2 B;  3AE1 B;  2KMM A;  4EZJ A;  1XT9 B;  1RYJ A;  4GGQ A;  1XLP A;  4WAF A;  1FD6 A;  2WS3 B;  2ZNV B;  2OOB B;  4J6I A;  1LO5 D;  3DPD A;  1V8C A;  2BYE A;  1C1Y B;  4HJG E;  2K6Q A;  1I42 A;  2IPK D;  4N6E B;  3HM3 A;  3J9C A;  2D10 A;  3RT3 B;  2NBV B;  1TS3 A;  4MT5 A;  4C7Z A;  2WLB A;  3UGB B;  1L5P A;  2CHX A;  1ZKH A;  4BBN C;  2K0P A;  3MHS D;  2KDM A;  3CF6 E;  2LVP A;  2V3S A;  3N30 A;  2UYZ B;  2WXF A;  1CQV A;  5KHQ A;  3AU4 A;  4HCP B;  1X1M A;  1V49 A;  1Y8R C;  1J7B A;  4OHJ A;  3PZ8 A;  3OWE B;  3LJ3 A;  1WE6 A;  3DVG X;  4XDD A;  2DZM A;  2IY0 B;  4W9D A;  1E5W A;  2DYB A;  1YQ3 B;  2WXI A;  4US8 A;  4RFB A;  4RGT A;  1TIF A;  1ZPS A;  1TY0 A;  2IGD A;  4WWM A;  4BAX A;  3L16 A;  1SJE D;  3P4Q B;  1YX5 B;  4KDL B;  3H7S A;  1TS5 A;  2O2V A;  5MPO A;  1WMH B;  1BXT A;  2DX5 B;  3V62 A;  4I6P A;  2YVC A;  1J8C A;  1ET9 A;  1ET6 A;  2Q5W D;  4EOY A;  3IXS A;  2K3U A;  2D3C A;  4C4V B;  2EMT A;  3TEX A;  2MJE A;  1E8W A;  3VH4 B;  3AM9 A;  3IAS 1;  5EE3 A;  2GLS A;  3NVW A;  4WUR A;  4HLE A;  1NEN B;  3NOB A;  4IWQ A;  5BO4 B;  4M8N A;  4S17 A;  3W1S C;  1T5X D;  2FBW B;  2L76 A;  2DYO A;  2LHE A;  3KH0 A;  4JLC A;  1IGD A;  1QOF A;  4RM8 A;  1EU3 A;  1JWU D;  1MFW A;  4IOI E;  3ZNI D;  1GG3 A;  2FCS A;  4ARI A;  1CJE A;  3PVL A;  2KX0 A;  4PYU A;  3M62 B;  2O6V D;  1ESF A;  4CHK A;  1EWC A;  2WP9 B;  2KDF B;  2HJ8 A;  5JH5 C;  3AE9 B;  4P16 A;  5GXG B;  2AEH A;  2IYD B;  5DCN A;  3RMK C;  2Z0E B;  2QDF A;  3WCQ A;  4GIV A;  3SFE B;  2W9N A;  4ZRJ A;  1GPX A;  4AS1 A;  3RUL A;  2O6V A;  2OHF A;  3URY A;  1AWD A;  2Y3A A;  2MLB A;  4PK1 A;  4MM3 B;  4FJV B;  4MGI E;  5IKC M;  2L0T A;  1OTR B;  4KSL C;  2MBH A;  3ZW3 A;  3N1X C;  4HKZ E;  2L05 A;  3BWU D;  4HCN B;  2C5L C;  2GBK A;  2W3R A;  2AL6 A;  4PS8 A;  1WZ0 A;  1JCK B;  3GS2 A;  1Q10 A;  1C79 A;  4GOC A;  4PT5 A;  1GC6 A;  3ZNH B;  1MHX A;  5BMG A;  3Q8B A;  1ZDX A;  1JW9 D;  4XWW A;  3QWZ B;  2LI5 A;  4JPS A;  1V6E A;  3HK0 A;  2A4Z A;  2MW5 A;  1WIA A;  4MSM B;  4XDC A;  1N61 A;  1VCB A;  1N60 A;  2N0S B;  1TZO A;  2I1K A;  5L95 C;  4ACF A;  3T3O A;  2RPV A;  2ZPN A;  3C0R B;  4DDG D;  3VHT C;  5BYQ A;  2LGD A;  2WXL A;  4MDK E;  5EE1 A;  1WXM A;  2IJ0 A;  3VR8 B;  4RMA A;  1AYF A;  2GMI C;  2C7M B;  3UIP B;  4W9E A;  2V3P A;  1CZP A;  2PLP A;  1EF1 A;  2DZI A;  5TSS A;  3OJ3 A;  3HHM A;  1FMA D;  3JSV B;  3VXW A;  3RCZ A;  4LDT B;  4NJC A;  3BK2 A;  1K53 A;  1YX6 B;  4W9C A;  2K8B A;  3P42 A;  2H88 B;  2K6D B;  3V61 A;  4RM9 A;  1C76 A;  4GU2 A;  3W9C B;  2ZCB A;  2KTF A;  1BUI C;  2KAJ A;  3VUW A;  3EHV A;  1SGH A;  2J0J A;  1WXA A;  2JVC A;  4EUT A;  2GI9 A;  2WXQ A;  4BKS A;  4MM3 A;  1I35 A;  1D6E C;  3B2G A;  1WGG A;  2KWD A;  2E6X A;  2WXJ A;  2KAC A;  3R2T A;  4ANX A;  4II3 B;  2INP E;  1V1P B;  1OEY A;  3L10 B;  1TJE A;  4ASW C;  1E8Y A;  5KHO A;  3Q3O C;  2DWQ A;  5GMV A;  4URK A;  1WJU A;  3NHE B;  2GBN A;  4FBJ B;  3DBL B;  3WIM A;  4KKJ A;  1D5M C;  3P63 A; 
#chains in the Genus database with same CATH homology
 2MSE D;  3DDC B;  2M8S A;  2PPH A;  1K8R B;  2PJH A;  4I6L B;  2WWZ A;  4FLH A;  2BGF A;  2XEW A;  3K9O B;  4GB9 A;  1ZW7 A;  3JW0 X;  2MCN B;  3VAW A;  2KXJ A;  3APC A;  3O65 B;  2EMS A;  2NPT A;  3WAP A;  1Q0W B;  3AI5 A;  5EDS A;  3NZS A;  3IHP C;  5CX3 A;  3ZRF A;  3R66 C;  3ZKJ C;  1GNU A;  1WH3 A;  2M4N A;  1M94 A;  2LVO A;  3I3T B;  3L0W B;  1WMH A;  3NY5 A;  4FHJ A;  2ZJD A;  4W9I A;  3UIO B;  2BWF A;  3BIN A;  5AEK B;  1WM3 A;  4W9K A;  2QHO A;  4K7W A;  3QJZ A;  1AAR A;  1V80 A;  4EZL A;  1IPG A;  3AUL A;  2BYF A;  2G45 B;  2LRW A;  3TBL D;  4AOF A;  3RZW C;  1NBF C;  2DAF A;  2IO0 B;  4I6N B;  4IWO A;  4OVV A;  4OVU A;  1OEY J;  3ZVV A;  1XQQ A;  1E7V A;  2K8H A;  4G11 A;  4GDK B;  4F8C B;  1LXD A;  1XD3 B;  1IYF A;  1L2N A;  3U8Z A;  2BYV E;  3N32 A;  1ISN A;  2O6V B;  3Q3F A;  5AZG A;  5JHB A;  3A9J A;  3PHX B;  3ZTD A;  3PRZ A;  4IUM B;  3TIX A;  2PE6 B;  3H7P B;  2KJH B;  2YLM A;  3W1S A;  2LGY A;  4NQK E;  3RD2 A;  3JSV A;  2KQ7 A;  2L7R A;  3DBR I;  3OLM D;  1YQB A;  1WM2 A;  2L3Z A;  4MEM A;  4NAW B;  2DEN B;  2JRH A;  3DBL I;  1KOT A;  3A9K B;  3PT2 B;  2J0M A;  3U7D A;  3VH3 B;  1P0R A;  1WY8 A;  2JRI B;  1L7Y A;  1U4A A;  3QX1 A;  1JRU A;  4G50 A;  4FJZ A;  2LRU A;  3ML9 A;  3IFW B;  2ZEQ A;  1EUV B;  3L08 A;  5CHV C;  1T0Y A;  3QQ8 B;  4K81 A;  2XBB C;  2JF5 A;  4WWO A;  3A1Q B;  3M3J A;  3VTU A;  4GDL B;  4MGZ E;  1J0G A;  3L54 A;  3DBH I;  5C1Z A;  4AJY B;  2G4S A;  1WJN A;  4DWF A;  1KJT A;  2NVU I;  2HTH A;  2UWQ A;  2XK5 B;  4MEL A;  5AZH A;  4W9G A;  4BFR A;  2KTR A;  4CO7 A;  2FNJ B;  2R2O A;  1R4N I;  2MBO A;  2KKC A;  3IG3 A;  4B95 A;  3CMM B;  3KUZ A;  4B6W A;  1CMX B;  1WX7 A;  4BKS D;  4DHZ B;  2ZPY A;  2RR9 A;  3R7R A;  4DK5 A;  1UBI A;  2L00 B;  3DQV A;  3WAL A;  2ZVN A;  2O2V B;  2KNB A;  4P7I A;  5J17 A;  5AZF A;  2KN5 A;  3V6C B;  1WZ3 A;  4YL8 A;  2KDB A;  4KSK C;  3ZTC A;  4MJS A;  3SU8 X;  5J2R A;  2M0X A;  1RAX A;  4AWJ A;  2IBI B;  3PSE B;  2LUE A;  3R3M A;  2NBW B;  3TCA A;  3QIJ A;  2R2Q A;  2N1W A;  2FIF A;  3PLV A;  1IP9 A;  3QAQ A;  2JZ3 B;  2LGX A;  4HJK A;  1S3S G;  4II2 B;  3KW5 B;  5CHF A;  4A3P A;  4XC2 A;  4HVB A;  4EZJ A;  2BF8 B;  1XT9 B;  2CHZ A;  4KZ0 A;  1P1A A;  2AYO B;  1P98 A;  4GGQ A;  1YJ1 A;  2RD0 A;  3APD A;  2ZNV B;  2NR2 A;  2IZV B;  4WJN A;  3RYT A;  1UEL A;  1LQB A;  1UGM A;  2AL3 A;  4KV2 A;  4E3C A;  2OOB B;  2M17 A;  4DDI D;  2V4L A;  4J6I A;  2NCN A;  1Q5W B;  3V6E B;  3DPD A;  1WGH A;  1J19 A;  2BYE A;  1C1Y B;  1YD8 U;  2K6Q A;  3M95 A;  1I42 A;  2DAJ A;  3GZN I;  2K25 A;  4G0N B;  2LXC A;  2RGF A;  3HIZ A;  3QC8 B;  4AJW A;  1V2Y A;  3CST A;  5HKH A;  2LZ6 A;  3ZDM C;  3VFK A;  3HM3 A;  2D10 A;  2J7Q B;  1V5T A;  2FCN A;  3ECI A;  2Y5B B;  3RT3 B;  4HPM B;  2KOX A;  2GBJ A;  2NBV B;  3SD5 A;  3HM6 X;  4K7U A;  3KUD B;  4NJ7 A;  3DVN V;  2G4D B;  1V5O A;  4MH0 E;  4MSQ B;  3UGB B;  1GUA B;  1NI2 A;  3TL5 A;  1WXS A;  2CHX A;  1OQY A;  4WWN A;  4EEW A;  1LFD A;  1ZKH A;  2MBB B;  1S1Q B;  4A3O A;  4HPL B;  2K39 A;  3B1L X;  3MHS D;  4BBN C;  4BVU C;  2MBE A;  3QHT A;  3H7P A;  3CF6 E;  2LVP A;  2V3S A;  3CSF A;  3N30 A;  2UYZ B;  1V81 A;  4FHK A;  5KHQ A;  3AU4 A;  3N3K B;  4HCP B;  1NDD A;  2CR5 A;  4WJO A;  4KIK B;  1X1M A;  2C9W B;  2KMA A;  3ML8 A;  1V49 A;  1Y8R C;  1E8X A;  1WI0 A;  2WDT B;  1WFY A;  1WX9 A;  5DPS A;  3H1U A;  3RUI B;  3A9K A;  1SIF A;  1PQS A;  2JZZ A;  2BPS A;  3LJ3 A;  4FN2 A;  1WE6 A;  1C3T A;  3DVG X;  4W9F A;  2I1J A;  2LD9 A;  2DZJ A;  2HD5 B;  2KDI A;  4LDT D;  4DXA B;  1WJ6 A;  2AWT A;  2IO3 B;  2ZVO A;  4BOZ B;  2DZM A;  2IY0 B;  2L0F A;  4W9D A;  1RRB A;  1V9J A;  2V1Y A;  1E5W A;  3WAN A;  2DYB A;  2HE7 A;  3ZLZ A;  5DPW A;  3A1Q A;  2DZK A;  2MBQ A;  3ZO5 B;  3Q3J A;  4GDL A;  2NBU A;  1QZE A;  4NPN A;  2JXX A;  2A5U A;  5FR6 A;  1H4R A;  3UIN B;  4IC7 B;  3DVG Y;  4HK2 A;  2XK5 A;  2Z59 B;  2GBR A;  3DCG A;  5LLI A;  2LAS A;  1WF9 A;  1V86 A;  4HXD A;  3L16 A;  2KDE B;  3KUC B;  2LVQ A;  3VUY A;  2KWU B;  2BKR B;  2KC1 A;  1YX5 B;  2NPT B;  3PS6 A;  4KDL B;  2FCM A;  3DBS A;  3H7S A;  4A20 A;  1TGZ B;  3QK0 A;  4IM3 A;  4IG7 B;  2C7H A;  2O2V A;  2EKE C;  1WMH B;  2DX5 B;  3EFU A;  3V62 A;  4I6P A;  1WGD A;  2YVC A;  1LM8 B;  4WAA A;  4ANV A;  5G55 A;  2WX0 A;  4FA6 A;  3ONS A;  2JUO A;  1J8C A;  2VRR B;  4EOY A;  4DHJ D;  5DPT A;  2N9X A;  3ZNZ B;  1WYW B;  2KX3 A;  1WXV A;  4NNJ B;  2EMT A;  4ANW A;  3WAM A;  4DHZ E;  4LJP B;  2JT4 B;  1E8W A;  1OGW A;  3VH4 B;  2KO3 A;  3MJW A;  4K1R B;  4NJ6 A;  3PRE A;  2PE9 A;  2NS5 A;  4HLE A;  3A9J B;  3NOB A;  4KVG B;  2KWV B;  4IWQ A;  4JGH B;  5BO4 B;  2KHW B;  4CYE A;  4M8N A;  3TMP B;  3W1S C;  4N9F 4;  4HDO A;  4BKG A;  2D07 B;  4LJO B;  4M8M A;  2L76 A;  2DYO A;  1UZX B;  4W9L A;  4F1S A;  2D3G A;  2G3Q B;  4TQ0 A;  2MX2 A;  3EC8 A;  3KH0 A;  2GOW A;  2KQS A;  3SDL C;  3D32 A;  1ZGU B;  4TKN A;  4JLC A;  5JZE B;  2KFK B;  3AU5 A;  3UQB A;  1UBQ A;  4MGK E;  3MTN B;  4RM8 A;  2KJR A;  4GSW A;  3VDZ A;  3ZNI D;  4BOS C;  1GG3 A;  4ZRI A;  2FCS A;  5D94 A;  3PRP B;  5IAA C;  2LWP A;  2MP2 B;  3QCA A;  4MGY E;  2DYM A;  3PVL A;  2KX0 A;  4PS7 A;  2FID A;  4EFO A;  4PYU A;  2ASQ A;  3KYD D;  2JY6 A;  1GC7 A;  4WWP A;  3M62 B;  2O6V D;  3NS8 A;  3PLU A;  2J0K A;  4KDI C;  3OJ4 B;  4M0W B;  4ZYN A;  4CHK A;  2KDF B;  2N7D A;  3X23 A;  3PHW B;  2KC2 A;  2FUH B;  2HJ8 A;  3QA8 A;  1WR1 A;  5JH5 C;  5L83 A;  2IO2 B;  2DHZ A;  4WJP A;  2GBM A;  2AEH A;  1KLV A;  2CS4 A;  2IYD B;  5DCN A;  2Z0E B;  4GDK A;  5C23 A;  4GIV A;  2W9N A;  4ZRJ A;  3P2B A;  2C60 A;  3RUL A;  2O6V A;  2Z0D B;  3S2A A;  2WX1 A;  3WA0 A;  3GOE A;  4TV3 A;  1E90 A;  3JYU A;  4PYZ A;  3H6N A;  2FAZ A;  3L17 A;  1WRD B;  2JPH A;  4EKU A;  2M1M A;  3T8M A;  1RLF A;  2KD0 A;  2MLB A;  3ZDT A;  3A4R A;  5CHW A;  3DVN U;  4ZDV A;  2KAN A;  4FJV B;  4MGI E;  1WGR A;  2L0T A;  4NAW A;  2N7E A;  1OTR B;  3W1Y A;  4KSL C;  2MBH A;  3PV1 A;  4HDQ A;  4HWI B;  3X0W A;  1G6J A;  3ZW3 A;  3M63 B;  3VTV A;  5DPR A;  2IO1 B;  3RZF A;  2L05 A;  3LDZ E;  3ZNG C;  3ZUN A;  2BKF A;  1EF5 A;  1TZ1 A;  4K7S A;  3R7Q A;  2D11 A;  2RSU A;  4FUL A;  4HCN B;  2C5L C;  2GBK A;  2ZZP B;  5JHA A;  2AL6 A;  4IWP A;  5E6N A;  2N9E B;  4PS8 A;  4E74 A;  4FAD A;  1TTN A;  1WZ0 A;  5TR5 A;  4IM0 A;  1MG8 A;  4W9H A;  2PEA A;  3AXC A;  4GOC A;  1A5R A;  3APF A;  3SHQ A;  1GC6 A;  4IM2 A;  3ZNH B;  3DOW A;  3VUX A;  4IW0 A;  1WJ4 A;  2KK8 A;  2KWC A;  4GN1 A;  3QWZ B;  2LI5 A;  3IBE A;  1V6E A;  4NQL B;  5E6O A;  3HK0 A;  3T9L A;  2A4Z A;  4ICU A;  2MW5 A;  1WIA A;  3ENE A;  4MSM B;  4BBN F;  4E71 A;  3PZD A;  4LCD E;  5J18 A;  1WE7 A;  3L13 A;  4JIO U;  2KVR A;  1KM7 A;  1WR6 E;  1VCB A;  3PRM B;  2WYQ A;  3UQA A;  2I1K A;  5L95 C;  2N9P C;  2ZPN A;  1HE8 A;  1R4M I;  3C0R B;  3VTW A;  4DDG D;  5D2M B;  2MA9 B;  3VHT C;  2K1F A;  2LXA A;  2MRP A;  1WGY A;  2LGD A;  2ZCC A;  4F7Z A;  2CKH B;  4MDK E;  2KFK A;  3WAO A;  1WXM A;  2MWS B;  3BY4 B;  4WJQ A;  4RMA A;  1P9D U;  1E8Z A;  2GMI C;  4G3X B;  2C7M B;  4JL9 A;  3ZRC A;  3UIP B;  4W9E A;  2B3A A;  2MP2 A;  2LJ5 A;  5D6J B;  3ALB A;  3U30 A;  3A4S C;  1Q1O A;  1EO6 A;  3A33 B;  5D7G A;  1EF1 A;  2DZI A;  3OJ3 A;  3HHM A;  3NZU A;  4PS3 A;  5CTR C;  2FCQ A;  2MQJ A;  4DBG A;  3JSV B;  3EEC A;  3VXW A;  1UH6 A;  4GMV A;  1F9J A;  1VD2 A;  4XZ4 A;  2N1V A;  4ZRK A;  2D2Q A;  3RCZ A;  4LDT B;  2RPQ A;  1GJZ A;  4EZK A;  4KZC A;  3OAW A;  2N4F A;  1YX6 B;  4W9C A;  2K8B A;  3TJP A;  2K6D B;  4XX5 A;  3V61 A;  4TUU A;  4RM9 A;  4GU2 A;  3ZIM A;  3JVZ X;  1SE9 A;  2ZCB A;  2KTF A;  3IVF A;  3K9P B;  1Z5S B;  2KJ6 A;  3B08 A;  4AUQ C;  2K8C A;  4AP4 C;  3VUW A;  2IY1 B;  3EHV A;  1SGH A;  2J0J A;  2OJR A;  1WXA A;  2JVC A;  3PTF C;  4ANU A;  4EUT A;  1WX8 A;  4W9J A;  3QAR A;  3B0A A;  5LXH A;  2C7N B;  2CU1 A;  1TBE A;  3PPA A;  4MM3 A;  3V60 A;  4BKS A;  1I35 A;  1H8C A;  4KIK A;  1WGG A;  2KTR B;  4X57 B;  5IA7 A;  1E7U A;  4WQO B;  5E6P A;  2KLC A;  3KYC D;  2L8J A;  2BWE S;  2REX A;  4NY0 A;  2ZNV C;  5LXI B;  3H9D A;  1P3Q U;  4ANX A;  4II3 B;  4B9K A;  2CHW A;  2KZR A;  1OEY A;  3L10 B;  3VQI A;  2KFJ A;  4ASW C;  4ICV A;  1BT0 A;  1E8Y A;  1RFA A;  1Z2M A;  3PGE A;  5KHO A;  4FJY A;  4GXB A;  4DHJ B;  4BKT A;  1D3Z A;  5GMV A;  4MJS B;  3KVF B;  1UD7 A;  4JQW C;  4URK A;  1WJU A;  3NHE B;  2GBN A;  2KLG A;  4FBJ B;  2KMC A;  3WIM A;  2JWZ A;  3VVW B;  1YIW A;  3UF8 A;  1FXT B;  4TQ1 A;  5G2N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...