2O2VA

Crystal structure of the complex of human mitogen activated protein kinase kinase 5 phox domain (map2k5-phox) with human mitogen activated protein kinase kinase kinase 3 (map3k3b-phox)
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
93
structure length
92
Chain Sequence
b'VLVIRIKIPNSGAVDWTVHSPQLLFRDVLDVIGQVLPEATTTAFEYEDEDGDRITVRSDEEMKAMLSYYYSTVMEQQVNGQLIEPLQIFPRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dual specificity mitogen-activated protein kinase kinase 5
publication title Crystal Structure of the Complex of Human Mitogen Activated Protein Kinase Kinase 5 Phox Domain (MAP2K5-phox) with Human Mitogen Activated Protein Kinase Kinase Kinase 3 (MAP3K3B-phox)
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 21
structure length 92
sequence length 93
ec nomenclature ec 2.7.12.2: Mitogen-activated protein kinase kinase.
pdb deposition date 2006-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00564 PB1 PB1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2o2vA00
2ZPNA 4NAWB 3NY5A 4B95A 5JZEB 5CX3A 1ISNA 1WFYA 3NS8A 4MDKE 3L0WB 2L3ZA 3KUZA 1V49A 2KK8A 3HK0A 4CHKA 5KHQA 3ZO5B 2GOWA 2W9NA 2R2OA 4FBJB 2GBRA 2IBIB 3HM6X 3V62A 2FAZA 3ZLZA 2J0KA 1Y8RC 2M4NA 2DX5B 2IO1B 3SHQA 2J7QB 2OJRA 3JYUA 2ZJDA 2D2QA 3ZNZB 3L13A 3B08A 2CHZA 1MG8A 2D3GA 1WMHB 4LDTB 3L10B 2VRRB 2EMSA 4F1SA 1F9JA 3S2AA 2O2VB 4ZYNA 4HLEA 1OEYA 2FIFA 2O6VB 2K8CA 3DBSA 4BKSD 1WR1A 4LDTD 4WAAA 4WJOA 1P9DU 3LDZE 3ZDTA 2GBJA 2G4SA 1WH3A 4KVGB 5DPSA 3QA8A 4ANVA 2ZPYA 2KJHB 3TL5A 1WYWB 2BWFA 3UGBB 3W1SA 1KJTA 4GOCA 2KDIA 2LXCA 3CMMB 3HHMA 2K6QA 2KO3A 3UINB 2XK5A 1TZ1A 1GG3A 2KTRB 2JZZA 4W9GA 1U4AA 2L76A 5DPWA 1CMXB 4FLHA 2BKFA 3KUDB 1WXAA 4HK2A 4J6IA 2RSUA 2JF5A 3A9JA 3KYDD 2RPQA 4MGKE 4NNJB 3TMPB 2KDFB 3PHXB 4JLCA 4G50A 4PYZA 4M8NA 2DZIA 1H8CA 3DVNV 4DHJD 1OQYA 5E6PA 4HDQA 1E8ZA 2K1FA 4JGHB 3ECIA 3VAWA 2XBBC 4MGZE 1UGMA 2N9PC 2JXXA 3PLVA 1UBQA 1ZKHA 1UH6A 1OGWA 1KLVA 2LZ6A 1WGHA 1XT9B 2KFJA 2LXAA 1RLFA 2IZVB 1J8CA 3NOBA 2KLCA 2G45B 2ZCCA 4MJSB 1J19A 1LFDA 2LUEA 1R4NI 1H4RA 3QAQA 4IUMB 3HM3A 3VH4B 4I6NB 3CSFA 3PTFC 3QQ8B 5D94A 4KV2A 2N1WA 2J0MA 3ONSA 2KJ6A 4MSQB 1YX6B 3A1QA 1YQBA 3AXCA 2J0JA 2K6DB 3QK0A 4WWPA 4ANXA 2C7HA 1WI0A 1WX7A 1WXMA 3KW5B 3W1SC 1Q0WB 2DYBA 2MP2B 1RFAA 1I42A 1WGYA 4PS7A 4LJPB 3R7RA 4FJYA 3X23A 4K1RB 2JRHA 4AJYB 2L0FA 4DWFA 2DYMA 1ZGUB 1V5TA 4IW0A 3RYTA 2NPTA 2JT4B 2KDEB 3APCA 3GZNI 1FXTB 3AI5A 1C1YB 1OTRB 2BPSA 1E90A 2HE7A 4KSKC 4IM3A 2M8SA 4KIKB 4HVBA 4DDGD 5J18A 3VXWA 1WE6A 2AWTA 3GOEA 3DBRI 3A33B 2CHXA 3TJPA 3PT2B 4RM8A 3ZVVA 4EFOA 1GNUA 2MBOA 2MBHA 2DZMA 4RM9A 4WJQA 2KX0A 3A9KB 1EUVB 2AEHA 4MH0E 1IYFA 4FJZA 4DBGA 1E8YA 3M3JA 3K9PB 2OOBB 5CHWA 3PHWB 1V81A 4MELA 4EZKA 2L7RA 1C3TA 1UD7A 2ZNVC 4AOFA 2REXA 2LI5A 3OAWA 2HTHA 2KC1A 4JL9A 3RUIB 4EZJA 3P2BA 3IHPC 3N32A 5LLIA 5IA7A 1WJ6A 4IG7B 4TUUA 4ZRKA 4M0WB 1V86A 3APFA 1OEYJ 4FJVB 3QJZA 5HKHA 4II2B 2LVQA 4F8CB 5E6NA 3ML8A 1IP9A 3ZDMC 1L2NA 2BWES 4IWPA 3QARA 4ICUA 4EOYA 4W9FA 2HJ8A 1WIAA 3SD5A 3D32A 4HJKA 2ASQA 2KQ7A 4WJNA 4NJ7A 2ZEQA 3V6CB 3L54A 4AJWA 1SIFA 4ANUA 3X0WA 5CHFA 1WE7A 1EF1A 4EKUA 3HIZA 5E6OA 3QIJA 2KQSA 1SE9A 1EF5A 1SGHA 4G3XB 2FIDA 3DVGY 3JVZX 3MTNB 2ZVOA 3PS6A 4MEMA 1GUAB 3DVGX 4GDKB 1QZEA 2BYVE 4BBNF 3TBLD 1VCBA 2QHOA 4PYUA 2M0XA 3DQVA 4AWJA 2C60A 2MSED 2WYQA 1Q5WB 2N9EB 2WDTB 1P3QU 1WJUA 3VUWA 3NHEB 4FA6A 3ALBA 3WALA 2PJHA 3DOWA 4OVVA 1L7YA 4PS3A 4KZCA 3M62B 4W9DA 2C9WB 2GBKA 4BOSC 3UQBA 2HD5B 4HXDA 3SU8X 2MBBB 3R7QA 2GBMA 4DHJB 3K9OB 2NBWB 4EUTA 3PV1A 3APDA 3ZUNA 2BGFA 4W9HA 3R66C 4ICVA 3RZFA 5L95C 1V2YA 2PPHA 3RZWC 2KMCA 3H9DA 4N9F4 2LJ5A 4G0NB 4RMAA 2G3QB 4HCPB 5GMVA 2IO0B 2IO2B 5J2RA 3UF8A 2N7EA 2CS4A 2PEAA 4A20A 2FCSA 3AU4A 2FNJB 3IBEA 3RD2A 2BKRB 4YL8A 1E8WA 3M63B 2MCNB 2NVUI 3O65B 2KFKA 3PGEA 1UZXB 3VTWA 3WAPA 2KVRA 2DENB 3AULA 2KZRA 2DAFA 3IG3A 5KHOA 3RT3B 2KWCA 2M1MA 4CO7A 3PZDA 2LVOA 4GGQA 1J0GA 1K8RB 3PRPB 4NY0A 1WZ0A 3BINA 5EDSA 2FCQA 3VQIA 3EC8A 2LGDA 1PQSA 2A5UA 1A5RA 2C7MB 2PE6B 3KUCB 3WA0A 4HDOA 2XK5B 4E3CA 1WGRA 4GDLA 2MQJA 2L8JA 4NQLB 5G2NA 3V6EB 5J17A 3WAMA 4K7UA 1R4MI 3N3KB 4K7SA 1YIWA 3RULA 3DPDA 2EMTA 3ZTDA 3A9JB 5CTRC 3IVFA 1P98A 3KYCD 3VFKA 1UELA 1GJZA 1WXSA 3VUXA 1E7UA 1WX8A 3VTUA 4F7ZA 2DAJA 1TGZB 2K25A 3H7PA 1UBIA 2JVCA 3ZNID 3KH0A 1M94A 3C0RB 4G11A 4KDLB 4W9CA 2DZKA 3DBLI 3W1YA 3ML9A 2GMIC 1AARA 4MM3A 2MBQA 1V9JA 2D11A 2LGYA 3M95A 4BBNC 3VH3B 3JSVA 5DPTA 2LWPA 1XD3B 4FADA 1NI2A 4NAWA 2KC2A 2V4LA 3DDCB 4I6LB 4ANWA 5AZFA 4XC2A 2LASA 2JZ3B 4DDID 2ZNVB 3EFUA 3U30A 4EEWA 3A4RA 4NPNA 4DHZE 2AL6A 4HPMB 2KDBA 4B9KA 4EZLA 2AL3A 2RR9A 2GBNA 2JPHA 4WJPA 4CYEA 3Q3FA 1WJNA 2LVPA 3A1QB 1HE8A 2L0TA 3V60A 2R2QA 2BF8B 1NBFC 3MHSD 4GSWA 4KDIC 3PREA 2Z0EB 2K39A 3ZKJC 3UIPB 5C1ZA 3H7SA 5BO4B 1Z5SB 5JHBA 2WX0A 4BKSA 1WMHA 1YJ1A 4MGIE 2KMAA 4OVUA 2C7NB 1KOTA 2BYFA 4DK5A 1S3SG 2O2VA 3PSEB 4FHJA 2ZZPB 2O6VA 3R3MA 1ZW7A 3TIXA 2NPTB 2KKCA 3U8ZA 3KVFB 2A4ZA 5LXIB 4BOZB 3DBHI 3VVWB 3L08A 1WY8A 2N7DA 3I3TB 3U7DA 4PS8A 1V5OA 3L17A 1WZ3A 5CHVC 4HWIB 4JIOU 1XQQA 2I1JA 2L05A 2KTRA 2ZCBA 1E5WA 3L16A 3ZNHB 4A3PA 3WANA 5JHAA 5L83A 5G55A 2UWQA 1EO6A 3WAOA 3DVNU 4WWNA 2CKHB 4WQOB 2KANA 2KTFA 4GB9A 2LRWA 2NBUA 2JRIB 2WWZA 5DPRA 2N4FA 3V61A 1LXDA 1IPGA 3Q3JA 2FCNA 3BY4B 3T9LA 4W9JA 5JH5C 2MRPA 4ASWC 2LRUA 4TQ0A 4URKA 5LXHA 3NZUA 3CSTA 4KZ0A 3PVLA 3PPAA 2Z0DB 4FN2A 2MLBA 1WJ4A 3H1UA 2IO3B 4ZRIA 3ENEA 4W9KA 4A3OA 1WR6E 4FULA 3RCZA 2CR5A 4HPLB 3OJ4B 3OLMD 2Y5BB 2JUOA 3VUYA 2KN5A 3NZSA 2CHWA 2KJRA 2KWVB 3N30A 3WIMA 2D10A 1VD2A 2MW5A 2D07B 4ZDVA 3ZIMA 4MJSA 2WX1A 1LM8B 2O6VD 3A4SC 3JW0X 1WX9A 3PLUA 4MGYE 5D6JB 1S1QB 2MX2A 4TQ1A 4ZRJA 1T0YA 3T8MA 2B3AA 4KSLC 5AEKB 2FUHB 5D2MB 3ZTCA 4IM0A 1YD8U 2C5LC 3EECA 2JWZA 1WF9A 3QX1A 4DXAB 2MP2A 2Z59B 2K8HA 3QCAA 3TCAA 2KNBA 4XX5A 1RRBA 1V80A 4W9EA 2XEWA 3QWZB 2N9XA 2LD9A 4XZ4A 1JRUA 1I35A 2MWSB 4K7WA 5AZGA 1WGGA 4E74A 2MBEA 2KXJA 1RAXA 2UYZB 4BKTA 4HCNB 4TV3A 4E71A 4KIKA 4W9LA 4AP4C 5DCNA 2EKEC 4X57B 3CF6E 4II3B 2KWUB 4B6WA 4IWOA 3LJ3A 2DZJA 3ZRCA 1V6EA 2YLMA 4P7IA 4K81A 4AUQC 4M8MA 4I6PA 1P0RA 2L00B 5C23A 3B0AA 3A9KA 3AU5A 3PRZA 4GU2A 4JQWC 4BVUC 1WXVA 2AYOB 2RD0A 4DHZB 2K8BA 1Z2MA 1E8XA 2KOXA 4FHKA 5D7GA 3ZW3A 2CU1A 2FCMA 2LGXA 2KD0A 2MA9B 1GC6A 3B1LX 3MJWA 4NQKE 5FR6A 3VDZA 4LCDE 3ZRFA 2KFKB 4NJ6A 4IC7B 2ZVNA 3SDLC 4TKNA 4BKGA 3QHTA 4GXBA 2IYDB 4WWOA 4IM2A 2N1VA 2NR2A 2IY1B 3VTVA 2M17A 1WRDB 5AZHA 5TR5A 2KX3A 3OJ3A 3ZNGC 2NS5A 3UQAA 1LQBA 3EHVA 2KLGA 4GDLB 1E7VA 1GC7A 1TBEA 1WM3A 3PRMB 4GN1A 2NCNA 1WGDA 1WM2A 2V1YA 2KHWB 3QC8B 1P1AA 1NDDA 1G6JA 5IAAC 2YVCA 4GMVA 2PE9A 1X1MA 2JY6A 3DCGA 3H7PB 4MSMB 4GIVA 4BFRA 2V3SA 2DHZA 4LJOB 1BT0A 3H6NA 3VHTC 1TTNA 1D3ZA 1KM7A 2IY0B 3UIOB 4IWQA 4GDKA 2RGFA 2NBVB 2G4DB 2I1KA 3IFWB 2BYEA 2DYOA 3JSVB 1YX5B 4W9IA 1Q1OA
chains in the Genus database with same CATH superfamily
4B95A 4NAWB 4ZYSA 1ISNA 3NS8A 4YSXB 1TS2A 1IBXB 4LNIA 2KK8A 3DBHB 4IOIE 2W9NA 4FBJB 2R2OA 4P1BC 1I4PA 2FAZA 2AQ1B 4PK1A 1FRDA 2J7QB 2N9LA 2OJRA 3JYUA 1N6ZA 3L13A 3B08A 1HTOA 4N6EB 3L10B 1UGJA 2BS4B 1F9JA 5BMHA 3AE7B 2FIFA 4C7ZA 4WJOA 5HHDG 1P9DU 3LDZE 3QA8A 1FPYA 4GOCA 1MG4A 3CMMB 2K6QA 2XK5A 1GG3A 4W9GA 2BS3B 2JF5A 2PLPA 4MGKE 2RPQA 1NYQA 2PIAA 4PYZA 2DZIA 1N63A 4WQMA 2XBBC 2WXJA 1UGMA 2N9PC 4OZCA 2JXXA 3PLVA 3RMKC 1UBQA 1XT9B 4NJCA 5IN7A 1SB3C 1J19A 2LUEA 1H4RA 2LEKA 4IUMB 3HM3A 3Q14C 4RNAA 4KV2A 2N1WA 3ONSA 2HJ1A 1YX6B 3A1QA 1BUIC 3KQ4A 2W54A 2C7HA 1WX7A 1WXMA 2WXIA 3W9CB 2MP2B 4PS7A 2WXRA 4YWGG 2H88B 3W2DA 1L4DB 1TKGA 3SR6A 1WGKA 4DWFA 1RFKA 1V5TA 3RYTA 4L23A 3ZVVA 2KDEB 3AI5A 1OTRB 4KSKC 3Q8BA 5J18A 1T3QA 3VXWA 2AWTA 4RM9A 4WJQA 1Q10A 4DBGA 2KMMA 2QCZA 2J53A 2JWUA 2L7RA 4EZKA 1L0YB 1C3TA 2ZNVC 2QSDA 2HTHA 3IHPC 3N32A 1MPEA 4M0WB 3APFA 1OEYJ 2SAKA 4FJVB 5HKHA 1SEBD 2LVQA 3ZDMC 1F52A 4LNOA 2M56B 1XF5L 4ICUA 4S0RA 4N59A 4N58A 4WJNA 5BYQA 1NEKB 1XLNA 4ANUA 5TSSA 5CHFA 2SEBD 2WQYB 1KLUD 2BQQA 3QIJA 2KQSA 1FRRA 2FIDA 3DVGY 1GUAB 4GDKB 3DHHC 1UF0A 3ABVB 2EKIA 4PYUA 4AWJA 1FMAD 2WYQA 2Y5PA 3NHEB 5FR3A 2MJDA 1QQRA 4PS3A 3M62B 3T3OA 2J42A 3SU8X 4HXDA 2MBBB 3R7QA 3AE6B 4DHJB 2NBWB 1YJIA 2Z8LA 3PV1A 2JU6X 2GLSA 5EE0A 2M19A 3RZFA 1GPXA 3RZWC 4XE0A 2WXLA 3UF8A 2N7EA 2IGDA 4A20A 2FNJB 4K3BA 3O65B 3PGEA 3RT3B 4L1BA 3AECB 3PZDA 4GGQA 3AE9B 4NY0A 3VQIA 5G5GA 1YQ3B 2PE6B 3WA0A 4HDOA 3UI3A 3WAMA 1YN3A 1R4MI 3N3KB 1HXYD 2EMTA 3MC9A 1P98A 4Q2JA 1UELA 3AE1B 1WXSA 3T3NA 3VUXA 2DAJA 1UBIA 2JVCA 1JWUD 4W9CA 1WSPA 1AARA 1V9JA 4KKIA 1SSNA 5HG2A 5DPTA 4NAWA 1QF6A 1IBXA 2LASA 4DDID 1XLPA 4J3OD 4EEWA 3A4RA 4DHZE 2KDBA 4B9KA 4EZLA 4WJPA 3MC8A 2V0GA 3MHSD 4GSWA 2D3BA 4JE3B 2Z0EB 2K39A 5C1ZA 1Z5SB 2CJNA 1MHXA 3W5VB 1AN8A 1KOTA 4DK5A 1S3SG 1JW9D 2NPTB 3U8ZA 2A4ZA 1AW7A 3N9YC 1WY8A 2N7DA 3I3TB 3BVGA 1K52A 1QT9A 1V5OA 2RDGA 3Q8FA 1K51A 1N61A 3N1XC 1D5XC 5G55A 1EO6A 1D6EC 3DVNU 4WQOB 2WXHA 2N4FA 1LXDA 4RGOS 1IPGA 2FCNA 1ZXHA 3CSTA 3PVLA 1WJ4A 2RPVA 1C9FA 4A3OA 4YSYB 5JXVA 2KACA 2LJIA 2KN5A 3NZSA 2CHWA 3HRDD 2E3TA 2D10A 2MW5A 2D07B 1T0RC 3ZJVA 3ZIMA 1QLBB 2BVCA 1L5PA 1DGJA 1HZ5A 4MGYE 2TSSA 4TQ1A 4ZRJA 1T0YA 2FUHB 2C5LC 2OJWA 2MP2A 4LTUA 2K8HA 1F0ZA 1RRBA 4P16A 1T0SC 4DXFA 4K7WA 1WGGA 3NG0A 4E74A 2LHEA 1C4CA 4HCNB 3AEAB 1JCKB 1R4NB 5DCNA 4X57B 1TS3A 4B6WA 2LGIA 2M0AA 4QAYA 4P7IA 4AUQC 4I6PA 3PO0A 3B0AA 3PRZA 4BVUC 2RD0A 1Z2MA 4FHKA 1PGAA 5G5HA 4O1NA 3AEBB 3ZYYX 3B1LX 3ZRFA 4C80A 4IDIA 2KFKB 2MJEA 2OHFA 4IC7B 4M0WA 4GXBA 3P4QB 2NR2A 2M17A 5TR5A 1SE4A 1LQBA 3EHVA 1E7VA 1TKYA 3NJTA 5AUKA 1WM2A 1SJHD 2KHWB 1P1AA 1N60A 2NMQA 1C77A 2PVOD 2X8XX 4GIVA 2V3SA 3H6NA 4MM3B 4GDKA 2RGFA 2NBVB 3IFWB 2BYEA 1YX5B 5CX3A 4S17A 2L3ZA 3KUZA 2ZW0A 1VZ8A 1V49A 2W3RA 3P42A 1DOYA 2GBRA 2IBIB 3HM6X 3V62A 4JPSA 1PGBA 2IO1B 3SHQA 4YSZB 1EU3A 3ZJTA 1T0QC 2VZKB 2CHZA 2D3GA 4LDTB 2VRRB 2AX5A 5H92C 4KX6B 2K8CA 4BKSD 4LDTD 1WRIA 2DNFA 1HA5A 4KVGB 5DPSA 1KTKA 4ANVA 2KJHB 3TL5A 3W1SA 1KJTA 3URYA 4RCOA 2JZZA 4B0EA 4ACFA 3KUDB 3TMPB 2RSUA 3KYDD 2INPE 2KDFB 3PHXB 4JLCA 3ZGZA 3Q8EA 5E6PA 4WAFA 1E8ZA 1QOGA 3E56A 3ECIA 3VAWA 2AQ2B 3SFDB 1JWMD 1WGHA 2KFJA 2LXAA 2IZVB 1I4HA 1J8CA 2ZCCA 4UDUC 3AE3B 3BYYB 3VH4B 4KGSA 1EM7A 3PTFC 4RFBA 1YQBA 4REZA 2K6DB 3O13A 1LGRA 4ANXA 3DBLB 2DYBA 1ACCA 1I42A 1WGYA 4LJPB 3IXSA 1ZXIA 4K1RB 1OQRA 3NZ3A 4AJYB 1I7HA 4IW0A 1TS5A 2NPTA 1FFVA 3GZNI 2HE7A 2M8SA 3GOEA 3DBRI 5AUIA 2N7JA 3PT2B 2XNAC 3NVVA 4EFOA 1V8CA 4XWTA 2GRIA 1SF0A 3M3JA 2JZPA 1KH0A 1L0XB 5CHWA 3BWUD 5IP4D 2REXA 3OAWA 2KC1A 4JL9A 3P2BA 5BMGA 3QJZA 2WXFA 3P1MA 4II2B 1IP9A 1L2NA 2BWES 4EOYA 2LGSA 2HJ8A 1WIAA 3VR8B 3D32A 3KLSX 1I4QA 1SIFA 2NTTA 2KAJA 2HDEA 2K5PA 1WYGA 1SE9A 2QMTA 1EF5A 2ZVOA 1YNTE 3DVGX 5IOIA 2QHOA 3GE3C 3E9SA 1V1OA 2WDTB 3VUWA 3DOWA 4OVVA 1ZOYB 1XCTL 2K3UA 4CQNA 2HD5B 2JXTA 1ZP0B 2Q5WD 2N0SB 1FO4A 1XXGA 2WDQB 1PGXA 1FM0D 1FXAA 4EE2A 4HJGE 2LJ5A 4HCPB 2ICIA 5J2RA 2CS4A 1JQ4A 3AU4A 1SE2A 2J52A 2RDBC 3RD2A 4YL8A 2MCNB 2NVUI 2PTLA 2KFKA 3AH7A 1UZXB 3VTWA 2IPKD 2KZRA 5KHOA 3IG3A 2M1MA 2LVOA 1OQQA 1J0GA 2ON8A 1WZ0A 2FCQA 2ONQA 2LGDA 2MQJA 3V6EB 3DPDA 5CTRC 4YTPB 2QC8A 1E7UA 1WX8A 4K3CA 3VTUA 4F7ZA 4DXGA 1CK1A 2I38A 3HVDA 3B2FA 2K25A 4G11A 4D2KA 3W1YA 3ML9A 4MM3A 5C2TB 1FNVA 1VDVA 3IAM1 4ANWA 2L1AA 5AZFA 4XC2A 2GI9A 2ZNVB 3EFUA 2J4XA 2RR9A 2JPHA 4CYEA 2KYWA 3Q3FA 4YTNB 3V60A 2R2QA 4MACA 1DOXA 2BF8B 1NBFC 2V4IB 5HFYA 3LXFA 1EWCA 4USAA 1FCLA 1TIFA 1TJEA 5JHBA 4BKSA 1YJ1A 4MGIE 1ET6A 2C7NB 3AEGB 1J7BA 3PSEB 4FHJA 1N62A 1V97A 2WXNA 1KLGD 2MH7A 1QOBA 4DQOC 1ROEA 2I1JA 4ARIA 2UWQA 2CKHB 2KTFA 3IT6B 4GB9A 2LRWA 5DPRA 3TEWA 2WNMA 3BY4B 4LK0M 3T9LA 3NZUA 2W82A 1XLQA 4KZ0A 3AMZA 4FN2A 2KWDA 2MLBA 3H1UA 4W9KA 2KDMA 3RCZA 3PZ8A 1E6EB 2Y5BB 2MEKA 1NI3A 1ZPSA 1OFFA 3N30A 4ZDVA 3AEDB 4ITKA 2O6VD 3BIID 4L2YA 2WGSA 2ZW1A 1QOAA 5D6JB 1PFDA 1S1QB 2XN9C 5AEKB 2CU3A 4RH6A 4DXAB 3QCAA 3TCAA 4XX5A 4MH8A 3QWZB 3VR9B 2N9XA 2LD9A 4XZ4A 1GOZA 3RNGC 2MWSB 5AZGA 3AE4B 4M00A 2MBEA 4BKTA 1RAXA 2UYZB 2BB6A 4TV3A 4E71A 4W9LA 2QIEB 2WXGA 4IWOA 3ZRCA 1V6EA 1DOIA 2JQRB 3I57A 3R8BA 2L00B 5C23A 4JQWC 2LHDA 3AE8B 1E8XA 3AB5A 3ZW3A 2V3NA 1ZDXA 5LNK1 3SEBA 3EA6A 4NJ6A 2RMMA 3LB8C 3ETRA 3ZXVA 2ZVNA 1E0ZA 3RI7C 4TKNA 4BKGA 4B0MA 4IM2A 2EELA 3Q69A 4HKZE 2KX3A 4XGAB 2WXQA 1GB1A 4GDLB 1WM3A 3PRMB 3BVMA 1WGDA 1NDDA 4GMVA 4RGTA 3H7PB 2N9KA 1TKEA 4BFRA 3FILB 2DHZA 1F2RI 5BYSA 1D3ZA 1KM7A 2IY0B 4IWQA 4WH4A 1C4AA 3FKYA 3Q3NC 1C4PA 2I1KA 4KGTA 1JWSD 2ZPNA 3NY5A 4ZRQA 4C56C 5JZEB 4NAMA 1P7EA 4MDKE 1AWDA 1UUPA 3HK0A 3ZO5B 2GOWA 1JMLA 2VH2A 3I5JC 2DX5B 4ZHPA 1N5WA 1ET9A 3ZNZB 4AS1A 1MG8A 1WMHB 1TS4A 2O2VB 1OEYA 2YEPF 1YN4A 4A8XC 1WR1A 4WAAA 2BB5A 3RNBC 3MP9A 2G4SA 4OHJA 1UWXA 2K9XA 3GE8C 2BTEA 2BWFA 2LXCA 3HHMA 4M01A 2KO3A 3UINB 5DPWA 3NVWA 4OW0A 3I9V1 4NNJB 3HUIA 1MI0A 4G50A 3Q8CA 1SXTA 4M8NA 3DVNV 1OQYA 1XO3A 1E10A 3RNEC 1T6BX 2I2YA 3J9CA 1ZKHA 1UH6A 2LZ6A 1RLFA 2V9HA 2KLCA 1R4MB 2L83A 2KT7A 5D94A 2J0MA 4XDDA 1E9MA 3QK0A 1PYWD 1WI0A 3RNFC 1RFAA 2PKOA 3R7RA 4FJYA 1IGDA 5EE3A 3X23A 4RF1A 3AE5B 1ZGUB 2W55A 2JT4B 4N9F4 1C1YB 2WHIA 3P63A 2CHXA 3U52E 2QILA 3LYYA 2MBOA 2MBHA 1PDXA 3A9KB 1EUVB 3RPFC 3CWIA 1E8YA 2IJ0A 2OOBB 3PHWB 4MELA 2CJOA 4KKJA 2LI5A 3RUIB 5IA7A 4IG7B 4TUUA 1V86A 3DHGC 3ML8A 3RN9C 4ARCA 4IWPA 1F2RC 3QARA 4W9FA 1JWAD 4P1CC 2IGGA 2ASQA 4ZRPA 1BXTA 4NJ7A 3V6CB 3GS2A 3X0WA 1WE7A 4YTMB 3HIZA 5E6OA 2G9HD 1C76A 3PZ7A 1VZ6A 1SGHA 3MTNB 3ZXRA 1QZEA 2BYVE 3P4SB 3TBLD 4BBNF 1VCBA 2M0XA 3DQVA 4GLSC 2C60A 2N9EB 1WJUA 4FA6A 3ALBA 1I4RA 3WALA 2PJHA 1L7YA 4M02A 2GBKA 3MHZA 4A9AA 3K9OB 4EUTA 3ZUNA 3N1YC 2K0PA 4W9HA 5L95C 3KWLA 2KMCA 3H9DA 3BVZA 1CQVA 2JX5A 1RWSA 2G3QB 5GMVA 2IO0B 2PEAA 2FCSA 3IBEA 2BKRB 1E8WA 2BYTA 2KVRA 2DENB 2DAFA 3P4PB 2KWCA 2LUMA 4CO7A 2IGHA 3PRPB 3TEYA 3BINA 5EDSA 1VRAB 1K53A 1PQSA 2A5UA 3V3XA 3KUCB 3AN1A 4E3CA 1WGRA 4GDLA 5G2NA 4NQLB 5J17A 4K7UA 4K7SA 3A9JB 3NRZA 1RM6C 3VFKA 1TGZB 3H7PA 3ZNID 1ENFA 3FILA 1M94A 3KH0A 1WWTA 3H8HA 3EFCA 3TEXA 2GMIC 2D11A 5HI1A 3V05A 3M95A 4BBNC 1YJJA 1HEZE 2LWPA 4FADA 2V4LA 4I6LB 1JWBD 2BBCA 2FBWB 3U30A 4NPNA 2AL3A 4WIPA 2LVPA 1HE8A 2L0TA 1JRPA 1KF6B 5I4DA 4KDIC 3ZKJC 4LNKA 5BO4B 1WMHA 4YXDB 2KMAA 4YT0B 3AEEB 4OVUA 1V1PB 2O2VA 2ZZPB 3R3MA 1ZW7A 1AYFA 3KVFB 1UNSA 5GXGB 4BOZB 5LXIB 3R2TA 1IGCA 3L08A 3U7DA 4PS8A 4NZLB 1WZ3A 1KFYB 5CHVC 1XQQA 3BK1A 3ZNHB 1E5WA 1L6UA 4A3PA 3WANA 5L83A 3WAOA 1NYRA 4WWNA 2WWZA 5BYRA 5EE9A 2JYTA 3Q3JA 1ZDVA 2MRPA 4ASWC 2LRUA 1R7SA 2LMCA 2WP9B 3PPAA 3TUOA 3TEZA 2R61A 2IO3B 3ENEA 4FULA 2CR5A 4HPLB 3RFZB 3VUYA 1XCQL 2KJRA 4HPPA 1FNUA 2L52A 2WX1A 1LM8B 3A4SC 3JW0X 3PLUA 1YQ4B 2MX2A 2INDC 2WDVB 2B3AA 5D2MB 2WU2B 4IM0A 3TSSA 2WDRB 3EECA 1FXIA 3Q3MC 3QX1A 1EU4A 4W9EA 2XEWA 3DHIC 1KRHA 3RNAC 1JRUA 1DYQA 1JROA 3AEFB 1I35A 2FE8A 4AP4C 1L6VA 3R2IA 2EKEC 4US8A 5IKCM 3CF6E 2KWUB 3LJ3A 2YLMA 4K81A 3HVZA 2Y3AA 3A9KA 4GU2A 1WXVA 4DHZB 2KOXA 5D7GA 4FXCA 2LGXA 2KD0A 3MJWA 4NQKE 3VDZA 4LCDE 2X38A 3GZNB 1GAQB 2WXKA 2IYDB 3QHTA 4WWOA 3SFEB 1XLOA 5AZHA 1SBBB 1I4GA 3AV8A 4A6QA 3DBRB 3ZNGC 2NS5A 2Y5CA 2KLGA 1TBEA 2DWQA 1FCCC 2MHJA 1VR9A 2NTSA 3QC8B 1G6JA 2YVCA 2PE9A 3W5UB 3DCGA 4MSMB 4LJOB 1BT0A 4PT5A 3VHTC 3IAS1 3P4RB 1STEA 2G4DB 2WU5B 2DYOA 3JSVB 1D5MC 2QDFA 4W9IA 1Q1OA 1WFYA 3L0WB 4CHKA 3KWVA 5KHQA 1F1HA 3ZLZA 2J0KA 1Y8RC 2M4NA 3B9JA 4HKQA 3Q2AC 2ZJDA 2D2QA 2EMSA 4F1SA 3S2AA 4OVZA 4ZYNA 4HLEA 2O6VB 3DBSA 2JYEA 2ACZB 3ZDTA 1QKZA 2GBJA 1WH3A 1HQRD 2QJLA 2ZPYA 3UGBB 1WYWB 2KDIA 2PMVA 1XEEA 2WXMA 1TZ1A 2KTRB 1U4AA 2L76A 3EUB2 2DLBA 1CMXB 4FLHA 2BKFA 1WXAA 4HK2A 4J6IA 2WS3B 3A9JA 3FAHA 1T5XD 3L4PA 1H8CA 4DHJD 4HDQA 2K1FA 3Q8AA 4JGHB 1SJED 1ZUD2 3NVZA 4MGZE 3MJ5A 1MJDA 2V3PA 3WCQA 1GB4A 1OGWA 1KLVA 2FUG1 1FEHA 5FK9C 3NOBA 2G45B 4MJSB 2RDHA 1LFDA 1R4NI 3QAQA 4I6NB 3CSFA 3QQ8B 1ESFA 3NUHB 2KJ6A 4MSQB 2BS2B 2KN4A 3AXCA 2J0JA 4RGNA 1A70A 1MFWA 4ZOHC 4WWPA 2H89B 2MJ3A 3W1SC 3KW5B 1Q0WB 4RGMA 1MHHE 2JRHA 2L0FA 2QEJC 1V1PA 2DYMA 3APCA 4AQ7A 1FXTB 2BPSA 1E90A 2KVZA 4IM3A 4KIKB 4HVBA 4DDGD 2PVGC 3OG5A 1WE6A 3A33B 3TJPA 4RM8A 4JWUC 1GNUA 3N20C 2DZMA 4C7YA 2KX0A 2AEHA 4MH0E 1IYFA 4FJZA 1EWYC 3ZQ4A 1F77A 3K9PB 3GB1A 1V81A 1L4ZB 1C78A 3DWGC 1UD7A 4AOFA 2GB1A 4EZJA 5LLIA 4A55A 1WJ6A 4ZRKA 1VZ7A 1FD6A 2W3SA 4F8CB 5E6NA 1N5XA 5BMIA 3SD5A 1VLBA 4HJKA 2KQ7A 4C4VB 2ZEQA 3L54A 4AJWA 1TY2A 4US9A 4P6VF 1EF1A 4EKUA 1NVID 2INCC 3VRAB 4G3XB 3JVZX 4MEMA 3PS6A 3C19A 4LLGM 2KQ4X 1QILA 5D3IB 5E6JA 1TZOA 2MSED 2B76B 1SE3A 1Q5WB 2E6XA 1P3QU 5H8YE 3B2GA 5EE1A 3NVYA 4KZCA 1FNWA 3RNCC 4W9DA 2C9WB 4ZHOA 4BOSC 3UQBA 2WLBA 3AE2B 4OZBA 3NS1A 2GBMA 4R3DA 2IDYA 1TT5B 2PW9A 3APDA 2BGFA 2WXPA 3R66C 4ICVA 1P7FA 1V2YA 2PPHA 1PUTA 4G0NB 1VJKA 2HTME 4RMAA 2IO2B 1YOVB 3M63B 3WAPA 1HZ6A 3AULA 1M4VA 1B9RA 1K8RB 1TYGB 3EC8A 1NENB 1A5RA 2C7MB 2L32A 2XK5B 2L8JA 4JX1C 1D4BA 4A90A 1YIWA 3RULA 3ZTDA 3IVFA 3KYCD 2YEPB 1GJZA 1K50A 3FC4A 4KDLB 3C0RB 2BW2A 2DZKA 3DBLI 4OZAA 3IT4B 2MBQA 2LGYA 4IKGA 3VH3B 3N1ZC 3JSVA 1XD3B 1NI2A 2AQ3B 2KC2A 3DDCB 3CIRB 2WXOA 3MFGA 2JZ3B 1C79A 2DBYA 1YN5A 1IUEA 2AL6A 4HPMB 5MPOA 2GBNA 3MC0B 1MVKA 3I63C 1WJNA 3A1QB 4LNNA 1HTQA 3PREA 3UIPB 3H7SA 2WX0A 4HRSA 2BYFA 4JWSC 2LFIA 4RF0A 2O6VA 3TIXA 2KKCA 3DBHI 2D5GA 3VVWB 2INNE 1J7CA 3L17A 4HWIB 4JIOU 5IO9A 2JSVX 4H2AA 2L05A 2KTRA 2ZCBA 5JHAA 3L16A 2K22A 4WWMA 1BMLC 2KANA 1L0VB 2NBUA 3V61A 2JRIB 4TMAB 1FFUA 4W9JA 5JH5C 4TQ0A 5LXHA 4URKA 5C3JB 2Z0DB 4ZRIA 1WR6E 3OJ4B 2UU7A 3OLMD 3Q6BA 2JUOA 3BK2A 2VZKD 2KWVB 3WIMA 1VD2A 4KGRA 1TY0A 4MJSA 3DWMA 1WX9A 3EGRA 3VRBB 3T8MA 1RYJA 4KSLC 3ZTCA 1YD8U 2JWZA 1WF9A 2Z59B 1B1ZA 2G1EA 3BYTB 2KNBA 1V80A 2VH1A 4HROA 3U2SC 4C00A 1YMHE 1D5ZC 4BZAA 2KXJA 1CJEA 1E7PB 3OWEB 4KIKA 4XWWA 4II3B 1LO5D 2DZJA 3U4EG 4M8MA 1P0RA 4LNFA 4XDCA 3AU5A 3BZDB 2D3CA 1QOFA 2AYOB 2K8BA 1ZE3D 2BT6A 2CU1A 2FCMA 2MA9B 1GC6A 1JALA 5FR6A 4MT5A 5D3DA 3C8YA 3SDLC 2N1VA 2IY1B 3AM9A 3VTVA 4XYCA 1WRDB 1UWMA 1CZPA 3OJ3A 4BAXA 3UQAA 2D3AA 4C4VA 1GC7A 1WXQA 4GN1A 2NCNA 4HEA1 2V1YA 4WURA 3Q3OC 5IAAC 3U7ZA 1X1MA 1J7AA 2JY6A 1TTNA 2OEDA 1Y56A 3UIOB 3ZJUA 3GP7A 5FKAC 1SIJA 4TSSA 5T8IA 1FIQA 1I4XA
chains in the Genus database with same CATH topology
2ZPNA 4NAWB 3NY5A 4B95A 5JZEB 5CX3A 1ISNA 1WFYA 3NS8A 4MDKE 3L0WB 2L3ZA 3KUZA 1V49A 2KK8A 3HK0A 4CHKA 5KHQA 3ZO5B 2GOWA 2W9NA 2R2OA 4FBJB 2GBRA 2IBIB 3HM6X 3V62A 2FAZA 3ZLZA 2J0KA 1Y8RC 2M4NA 2DX5B 2IO1B 3SHQA 2J7QB 2OJRA 3JYUA 2ZJDA 2D2QA 3ZNZB 3L13A 3B08A 2CHZA 1MG8A 2D3GA 1WMHB 4LDTB 3L10B 2VRRB 2EMSA 4F1SA 1F9JA 3S2AA 2O2VB 4ZYNA 4HLEA 1OEYA 2FIFA 2O6VB 2K8CA 3DBSA 4BKSD 1WR1A 4LDTD 4WAAA 4WJOA 1P9DU 3LDZE 3ZDTA 2GBJA 2G4SA 1WH3A 4KVGB 5DPSA 3QA8A 4ANVA 2ZPYA 2KJHB 3TL5A 1WYWB 2BWFA 3UGBB 3W1SA 1KJTA 4GOCA 2KDIA 2LXCA 3CMMB 3HHMA 2K6QA 2KO3A 3UINB 2XK5A 1TZ1A 1GG3A 2KTRB 2JZZA 4W9GA 1U4AA 2L76A 5DPWA 1CMXB 4FLHA 2BKFA 3KUDB 1WXAA 4HK2A 4J6IA 2RSUA 2JF5A 3A9JA 3KYDD 2RPQA 4MGKE 4NNJB 3TMPB 2KDFB 3PHXB 4JLCA 4G50A 4PYZA 4M8NA 2DZIA 1H8CA 3DVNV 4DHJD 1OQYA 5E6PA 4HDQA 1E8ZA 2K1FA 4JGHB 3ECIA 3VAWA 2XBBC 4MGZE 1UGMA 2N9PC 2JXXA 3PLVA 1UBQA 1ZKHA 1UH6A 1OGWA 1KLVA 2LZ6A 1WGHA 1XT9B 2KFJA 2LXAA 1RLFA 2IZVB 1J8CA 3NOBA 2KLCA 2G45B 2ZCCA 4MJSB 1J19A 1LFDA 2LUEA 1R4NI 1H4RA 3QAQA 4IUMB 3HM3A 3VH4B 4I6NB 3CSFA 3PTFC 3QQ8B 5D94A 4KV2A 2N1WA 2J0MA 3ONSA 2KJ6A 4MSQB 1YX6B 3A1QA 1YQBA 3AXCA 2J0JA 2K6DB 3QK0A 4WWPA 4ANXA 2C7HA 1WI0A 1WX7A 1WXMA 3KW5B 3W1SC 1Q0WB 2DYBA 2MP2B 1RFAA 1I42A 1WGYA 4PS7A 4LJPB 3R7RA 4FJYA 3X23A 4K1RB 2JRHA 4AJYB 2L0FA 4DWFA 2DYMA 1ZGUB 1V5TA 4IW0A 3RYTA 2NPTA 2JT4B 2KDEB 3APCA 3GZNI 1FXTB 3AI5A 1C1YB 1OTRB 2BPSA 1E90A 2HE7A 4KSKC 4IM3A 2M8SA 4KIKB 4HVBA 4DDGD 5J18A 3VXWA 1WE6A 2AWTA 3GOEA 3DBRI 3A33B 2CHXA 3TJPA 3PT2B 4RM8A 3ZVVA 4EFOA 1GNUA 2MBOA 2MBHA 2DZMA 4RM9A 4WJQA 2KX0A 3A9KB 1EUVB 2AEHA 4MH0E 1IYFA 4FJZA 4DBGA 1E8YA 3M3JA 3K9PB 2OOBB 5CHWA 3PHWB 1V81A 4MELA 4EZKA 2L7RA 1C3TA 1UD7A 2ZNVC 4AOFA 2REXA 2LI5A 3OAWA 2HTHA 2KC1A 4JL9A 3RUIB 4EZJA 3P2BA 3IHPC 3N32A 5LLIA 5IA7A 1WJ6A 4IG7B 4TUUA 4ZRKA 4M0WB 1V86A 3APFA 1OEYJ 4FJVB 3QJZA 5HKHA 4II2B 2LVQA 4F8CB 5E6NA 3ML8A 1IP9A 3ZDMC 1L2NA 2BWES 4IWPA 3QARA 4ICUA 4EOYA 4W9FA 2HJ8A 1WIAA 3SD5A 3D32A 4HJKA 2ASQA 2KQ7A 4WJNA 4NJ7A 2ZEQA 3V6CB 3L54A 4AJWA 1SIFA 4ANUA 3X0WA 5CHFA 1WE7A 1EF1A 4EKUA 3HIZA 5E6OA 3QIJA 2KQSA 1SE9A 1EF5A 1SGHA 4G3XB 2FIDA 3DVGY 3JVZX 3MTNB 2ZVOA 3PS6A 4MEMA 1GUAB 3DVGX 4GDKB 1QZEA 2BYVE 4BBNF 3TBLD 1VCBA 2QHOA 4PYUA 2M0XA 3DQVA 4AWJA 2C60A 2MSED 2WYQA 1Q5WB 2N9EB 2WDTB 1P3QU 1WJUA 3VUWA 3NHEB 4FA6A 3ALBA 3WALA 2PJHA 3DOWA 4OVVA 1L7YA 4PS3A 4KZCA 3M62B 4W9DA 2C9WB 2GBKA 4BOSC 3UQBA 2HD5B 4HXDA 3SU8X 2MBBB 3R7QA 2GBMA 4DHJB 3K9OB 2NBWB 4EUTA 3PV1A 3APDA 3ZUNA 2BGFA 4W9HA 3R66C 4ICVA 3RZFA 5L95C 1V2YA 2PPHA 3RZWC 2KMCA 3H9DA 4N9F4 2LJ5A 4G0NB 4RMAA 2G3QB 4HCPB 5GMVA 2IO0B 2IO2B 5J2RA 3UF8A 2N7EA 2CS4A 2PEAA 4A20A 2FCSA 3AU4A 2FNJB 3IBEA 3RD2A 2BKRB 4YL8A 1E8WA 3M63B 2MCNB 2NVUI 3O65B 2KFKA 3PGEA 1UZXB 3VTWA 3WAPA 2KVRA 2DENB 3AULA 2KZRA 2DAFA 3IG3A 5KHOA 3RT3B 2KWCA 2M1MA 4CO7A 3PZDA 2LVOA 4GGQA 1J0GA 1K8RB 3PRPB 4NY0A 1WZ0A 3BINA 5EDSA 2FCQA 3VQIA 3EC8A 2LGDA 1PQSA 2A5UA 1A5RA 2C7MB 2PE6B 3KUCB 3WA0A 4HDOA 2XK5B 4E3CA 1WGRA 4GDLA 2MQJA 2L8JA 4NQLB 5G2NA 3V6EB 5J17A 3WAMA 4K7UA 1R4MI 3N3KB 4K7SA 1YIWA 3RULA 3DPDA 2EMTA 3ZTDA 3A9JB 5CTRC 3IVFA 1P98A 3KYCD 3VFKA 1UELA 1GJZA 1WXSA 3VUXA 1E7UA 1WX8A 3VTUA 4F7ZA 2DAJA 1TGZB 2K25A 3H7PA 1UBIA 2JVCA 3ZNID 3KH0A 1M94A 3C0RB 4G11A 4KDLB 4W9CA 2DZKA 3DBLI 3W1YA 3ML9A 2GMIC 1AARA 4MM3A 2MBQA 1V9JA 2D11A 2LGYA 3M95A 4BBNC 3VH3B 3JSVA 5DPTA 2LWPA 1XD3B 4FADA 1NI2A 4NAWA 2KC2A 2V4LA 3DDCB 4I6LB 4ANWA 5AZFA 4XC2A 2LASA 2JZ3B 4DDID 2ZNVB 3EFUA 3U30A 4EEWA 3A4RA 4NPNA 4DHZE 2AL6A 4HPMB 2KDBA 4B9KA 4EZLA 2AL3A 2RR9A 2GBNA 2JPHA 4WJPA 4CYEA 3Q3FA 1WJNA 2LVPA 3A1QB 1HE8A 2L0TA 3V60A 2R2QA 2BF8B 1NBFC 3MHSD 4GSWA 4KDIC 3PREA 2Z0EB 2K39A 3ZKJC 3UIPB 5C1ZA 3H7SA 5BO4B 1Z5SB 5JHBA 2WX0A 4BKSA 1WMHA 1YJ1A 4MGIE 2KMAA 4OVUA 2C7NB 1KOTA 2BYFA 4DK5A 1S3SG 2O2VA 3PSEB 4FHJA 2ZZPB 2O6VA 3R3MA 1ZW7A 3TIXA 2NPTB 2KKCA 3U8ZA 3KVFB 2A4ZA 5LXIB 4BOZB 3DBHI 3VVWB 3L08A 1WY8A 2N7DA 3I3TB 3U7DA 4PS8A 1V5OA 3L17A 1WZ3A 5CHVC 4HWIB 4JIOU 1XQQA 2I1JA 2L05A 2KTRA 2ZCBA 1E5WA 3L16A 3ZNHB 4A3PA 3WANA 5JHAA 5L83A 5G55A 2UWQA 1EO6A 3WAOA 3DVNU 4WWNA 2CKHB 4WQOB 2KANA 2KTFA 4GB9A 2LRWA 2NBUA 2JRIB 2WWZA 5DPRA 2N4FA 3V61A 1LXDA 1IPGA 3Q3JA 2FCNA 3BY4B 3T9LA 4W9JA 5JH5C 2MRPA 4ASWC 2LRUA 4TQ0A 4URKA 5LXHA 3NZUA 3CSTA 4KZ0A 3PVLA 3PPAA 2Z0DB 4FN2A 2MLBA 1WJ4A 3H1UA 2IO3B 4ZRIA 3ENEA 4W9KA 4A3OA 1WR6E 4FULA 3RCZA 2CR5A 4HPLB 3OJ4B 3OLMD 2Y5BB 2JUOA 3VUYA 2KN5A 3NZSA 2CHWA 2KJRA 2KWVB 3N30A 3WIMA 2D10A 1VD2A 2MW5A 2D07B 4ZDVA 3ZIMA 4MJSA 2WX1A 1LM8B 2O6VD 3A4SC 3JW0X 1WX9A 3PLUA 4MGYE 5D6JB 1S1QB 2MX2A 4TQ1A 4ZRJA 1T0YA 3T8MA 2B3AA 4KSLC 5AEKB 2FUHB 5D2MB 3ZTCA 4IM0A 1YD8U 2C5LC 3EECA 2JWZA 1WF9A 3QX1A 4DXAB 2MP2A 2Z59B 2K8HA 3QCAA 3TCAA 2KNBA 4XX5A 1RRBA 1V80A 4W9EA 2XEWA 3QWZB 2N9XA 2LD9A 4XZ4A 1JRUA 1I35A 2MWSB 4K7WA 5AZGA 1WGGA 4E74A 2MBEA 2KXJA 1RAXA 2UYZB 4BKTA 4HCNB 4TV3A 4E71A 4KIKA 4W9LA 4AP4C 5DCNA 2EKEC 4X57B 3CF6E 4II3B 2KWUB 4B6WA 4IWOA 3LJ3A 2DZJA 3ZRCA 1V6EA 2YLMA 4P7IA 4K81A 4AUQC 4M8MA 4I6PA 1P0RA 2L00B 5C23A 3B0AA 3A9KA 3AU5A 3PRZA 4GU2A 4JQWC 4BVUC 1WXVA 2AYOB 2RD0A 4DHZB 2K8BA 1Z2MA 1E8XA 2KOXA 4FHKA 5D7GA 3ZW3A 2CU1A 2FCMA 2LGXA 2KD0A 2MA9B 1GC6A 3B1LX 3MJWA 4NQKE 5FR6A 3VDZA 4LCDE 3ZRFA 2KFKB 4NJ6A 4IC7B 2ZVNA 3SDLC 4TKNA 4BKGA 3QHTA 4GXBA 2IYDB 4WWOA 4IM2A 2N1VA 2NR2A 2IY1B 3VTVA 2M17A 1WRDB 5AZHA 5TR5A 2KX3A 3OJ3A 3ZNGC 2NS5A 3UQAA 1LQBA 3EHVA 2KLGA 4GDLB 1E7VA 1GC7A 1TBEA 1WM3A 3PRMB 4GN1A 2NCNA 1WGDA 1WM2A 2V1YA 2KHWB 3QC8B 1P1AA 1NDDA 1G6JA 5IAAC 2YVCA 4GMVA 2PE9A 1X1MA 2JY6A 3DCGA 3H7PB 4MSMB 4GIVA 4BFRA 2V3SA 2DHZA 4LJOB 1BT0A 3H6NA 3VHTC 1TTNA 1D3ZA 1KM7A 2IY0B 3UIOB 4IWQA 4GDKA 2RGFA 2NBVB 2G4DB 2I1KA 3IFWB 2BYEA 2DYOA 3JSVB 1YX5B 4W9IA 1Q1OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZPN A;  4NAW B;  3NY5 A;  4B95 A;  5JZE B;  5CX3 A;  1ISN A;  1WFY A;  3NS8 A;  4MDK E;  3L0W B;  2L3Z A;  3KUZ A;  1V49 A;  2KK8 A;  3HK0 A;  4CHK A;  5KHQ A;  3ZO5 B;  2GOW A;  2W9N A;  2R2O A;  4FBJ B;  2GBR A;  2IBI B;  3HM6 X;  3V62 A;  2FAZ A;  3ZLZ A;  2J0K A;  1Y8R C;  2M4N A;  2DX5 B;  2IO1 B;  3SHQ A;  2J7Q B;  2OJR A;  3JYU A;  2ZJD A;  2D2Q A;  3ZNZ B;  3L13 A;  3B08 A;  2CHZ A;  1MG8 A;  2D3G A;  1WMH B;  4LDT B;  3L10 B;  2VRR B;  2EMS A;  4F1S A;  1F9J A;  3S2A A;  2O2V B;  4ZYN A;  4HLE A;  1OEY A;  2FIF A;  2O6V B;  2K8C A;  3DBS A;  4BKS D;  1WR1 A;  4LDT D;  4WAA A;  4WJO A;  1P9D U;  3LDZ E;  3ZDT A;  2GBJ A;  2G4S A;  1WH3 A;  4KVG B;  5DPS A;  3QA8 A;  4ANV A;  2ZPY A;  2KJH B;  3TL5 A;  1WYW B;  2BWF A;  3UGB B;  3W1S A;  1KJT A;  4GOC A;  2KDI A;  2LXC A;  3CMM B;  3HHM A;  2K6Q A;  2KO3 A;  3UIN B;  2XK5 A;  1TZ1 A;  1GG3 A;  2KTR B;  2JZZ A;  4W9G A;  1U4A A;  2L76 A;  5DPW A;  1CMX B;  4FLH A;  2BKF A;  3KUD B;  1WXA A;  4HK2 A;  4J6I A;  2RSU A;  2JF5 A;  3A9J A;  3KYD D;  2RPQ A;  4MGK E;  4NNJ B;  3TMP B;  2KDF B;  3PHX B;  4JLC A;  4G50 A;  4PYZ A;  4M8N A;  2DZI A;  1H8C A;  3DVN V;  4DHJ D;  1OQY A;  5E6P A;  4HDQ A;  1E8Z A;  2K1F A;  4JGH B;  3ECI A;  3VAW A;  2XBB C;  4MGZ E;  1UGM A;  2N9P C;  2JXX A;  3PLV A;  1UBQ A;  1ZKH A;  1UH6 A;  1OGW A;  1KLV A;  2LZ6 A;  1WGH A;  1XT9 B;  2KFJ A;  2LXA A;  1RLF A;  2IZV B;  1J8C A;  3NOB A;  2KLC A;  2G45 B;  2ZCC A;  4MJS B;  1J19 A;  1LFD A;  2LUE A;  1R4N I;  1H4R A;  3QAQ A;  4IUM B;  3HM3 A;  3VH4 B;  4I6N B;  3CSF A;  3PTF C;  3QQ8 B;  5D94 A;  4KV2 A;  2N1W A;  2J0M A;  3ONS A;  2KJ6 A;  4MSQ B;  1YX6 B;  3A1Q A;  1YQB A;  3AXC A;  2J0J A;  2K6D B;  3QK0 A;  4WWP A;  4ANX A;  2C7H A;  1WI0 A;  1WX7 A;  1WXM A;  3KW5 B;  3W1S C;  1Q0W B;  2DYB A;  2MP2 B;  1RFA A;  1I42 A;  1WGY A;  4PS7 A;  4LJP B;  3R7R A;  4FJY A;  3X23 A;  4K1R B;  2JRH A;  4AJY B;  2L0F A;  4DWF A;  2DYM A;  1ZGU B;  1V5T A;  4IW0 A;  3RYT A;  2NPT A;  2JT4 B;  2KDE B;  3APC A;  3GZN I;  1FXT B;  3AI5 A;  1C1Y B;  1OTR B;  2BPS A;  1E90 A;  2HE7 A;  4KSK C;  4IM3 A;  2M8S A;  4KIK B;  4HVB A;  4DDG D;  5J18 A;  3VXW A;  1WE6 A;  2AWT A;  3GOE A;  3DBR I;  3A33 B;  2CHX A;  3TJP A;  3PT2 B;  4RM8 A;  3ZVV A;  4EFO A;  1GNU A;  2MBO A;  2MBH A;  2DZM A;  4RM9 A;  4WJQ A;  2KX0 A;  3A9K B;  1EUV B;  2AEH A;  4MH0 E;  1IYF A;  4FJZ A;  4DBG A;  1E8Y A;  3M3J A;  3K9P B;  2OOB B;  5CHW A;  3PHW B;  1V81 A;  4MEL A;  4EZK A;  2L7R A;  1C3T A;  1UD7 A;  2ZNV C;  4AOF A;  2REX A;  2LI5 A;  3OAW A;  2HTH A;  2KC1 A;  4JL9 A;  3RUI B;  4EZJ A;  3P2B A;  3IHP C;  3N32 A;  5LLI A;  5IA7 A;  1WJ6 A;  4IG7 B;  4TUU A;  4ZRK A;  4M0W B;  1V86 A;  3APF A;  1OEY J;  4FJV B;  3QJZ A;  5HKH A;  4II2 B;  2LVQ A;  4F8C B;  5E6N A;  3ML8 A;  1IP9 A;  3ZDM C;  1L2N A;  2BWE S;  4IWP A;  3QAR A;  4ICU A;  4EOY A;  4W9F A;  2HJ8 A;  1WIA A;  3SD5 A;  3D32 A;  4HJK A;  2ASQ A;  2KQ7 A;  4WJN A;  4NJ7 A;  2ZEQ A;  3V6C B;  3L54 A;  4AJW A;  1SIF A;  4ANU A;  3X0W A;  5CHF A;  1WE7 A;  1EF1 A;  4EKU A;  3HIZ A;  5E6O A;  3QIJ A;  2KQS A;  1SE9 A;  1EF5 A;  1SGH A;  4G3X B;  2FID A;  3DVG Y;  3JVZ X;  3MTN B;  2ZVO A;  3PS6 A;  4MEM A;  1GUA B;  3DVG X;  4GDK B;  1QZE A;  2BYV E;  4BBN F;  3TBL D;  1VCB A;  2QHO A;  4PYU A;  2M0X A;  3DQV A;  4AWJ A;  2C60 A;  2MSE D;  2WYQ A;  1Q5W B;  2N9E B;  2WDT B;  1P3Q U;  1WJU A;  3VUW A;  3NHE B;  4FA6 A;  3ALB A;  3WAL A;  2PJH A;  3DOW A;  4OVV A;  1L7Y A;  4PS3 A;  4KZC A;  3M62 B;  4W9D A;  2C9W B;  2GBK A;  4BOS C;  3UQB A;  2HD5 B;  4HXD A;  3SU8 X;  2MBB B;  3R7Q A;  2GBM A;  4DHJ B;  3K9O B;  2NBW B;  4EUT A;  3PV1 A;  3APD A;  3ZUN A;  2BGF A;  4W9H A;  3R66 C;  4ICV A;  3RZF A;  5L95 C;  1V2Y A;  2PPH A;  3RZW C;  2KMC A;  3H9D A;  4N9F 4;  2LJ5 A;  4G0N B;  4RMA A;  2G3Q B;  4HCP B;  5GMV A;  2IO0 B;  2IO2 B;  5J2R A;  3UF8 A;  2N7E A;  2CS4 A;  2PEA A;  4A20 A;  2FCS A;  3AU4 A;  2FNJ B;  3IBE A;  3RD2 A;  2BKR B;  4YL8 A;  1E8W A;  3M63 B;  2MCN B;  2NVU I;  3O65 B;  2KFK A;  3PGE A;  1UZX B;  3VTW A;  3WAP A;  2KVR A;  2DEN B;  3AUL A;  2KZR A;  2DAF A;  3IG3 A;  5KHO A;  3RT3 B;  2KWC A;  2M1M A;  4CO7 A;  3PZD A;  2LVO A;  4GGQ A;  1J0G A;  1K8R B;  3PRP B;  4NY0 A;  1WZ0 A;  3BIN A;  5EDS A;  2FCQ A;  3VQI A;  3EC8 A;  2LGD A;  1PQS A;  2A5U A;  1A5R A;  2C7M B;  2PE6 B;  3KUC B;  3WA0 A;  4HDO A;  2XK5 B;  4E3C A;  1WGR A;  4GDL A;  2MQJ A;  2L8J A;  4NQL B;  5G2N A;  3V6E B;  5J17 A;  3WAM A;  4K7U A;  1R4M I;  3N3K B;  4K7S A;  1YIW A;  3RUL A;  3DPD A;  2EMT A;  3ZTD A;  3A9J B;  5CTR C;  3IVF A;  1P98 A;  3KYC D;  3VFK A;  1UEL A;  1GJZ A;  1WXS A;  3VUX A;  1E7U A;  1WX8 A;  3VTU A;  4F7Z A;  2DAJ A;  1TGZ B;  2K25 A;  3H7P A;  1UBI A;  2JVC A;  3ZNI D;  3KH0 A;  1M94 A;  3C0R B;  4G11 A;  4KDL B;  4W9C A;  2DZK A;  3DBL I;  3W1Y A;  3ML9 A;  2GMI C;  1AAR A;  4MM3 A;  2MBQ A;  1V9J A;  2D11 A;  2LGY A;  3M95 A;  4BBN C;  3VH3 B;  3JSV A;  5DPT A;  2LWP A;  1XD3 B;  4FAD A;  1NI2 A;  4NAW A;  2KC2 A;  2V4L A;  3DDC B;  4I6L B;  4ANW A;  5AZF A;  4XC2 A;  2LAS A;  2JZ3 B;  4DDI D;  2ZNV B;  3EFU A;  3U30 A;  4EEW A;  3A4R A;  4NPN A;  4DHZ E;  2AL6 A;  4HPM B;  2KDB A;  4B9K A;  4EZL A;  2AL3 A;  2RR9 A;  2GBN A;  2JPH A;  4WJP A;  4CYE A;  3Q3F A;  1WJN A;  2LVP A;  3A1Q B;  1HE8 A;  2L0T A;  3V60 A;  2R2Q A;  2BF8 B;  1NBF C;  3MHS D;  4GSW A;  4KDI C;  3PRE A;  2Z0E B;  2K39 A;  3ZKJ C;  3UIP B;  5C1Z A;  3H7S A;  5BO4 B;  1Z5S B;  5JHB A;  2WX0 A;  4BKS A;  1WMH A;  1YJ1 A;  4MGI E;  2KMA A;  4OVU A;  2C7N B;  1KOT A;  2BYF A;  4DK5 A;  1S3S G;  2O2V A;  3PSE B;  4FHJ A;  2ZZP B;  2O6V A;  3R3M A;  1ZW7 A;  3TIX A;  2NPT B;  2KKC A;  3U8Z A;  3KVF B;  2A4Z A;  5LXI B;  4BOZ B;  3DBH I;  3VVW B;  3L08 A;  1WY8 A;  2N7D A;  3I3T B;  3U7D A;  4PS8 A;  1V5O A;  3L17 A;  1WZ3 A;  5CHV C;  4HWI B;  4JIO U;  1XQQ A;  2I1J A;  2L05 A;  2KTR A;  2ZCB A;  1E5W A;  3L16 A;  3ZNH B;  4A3P A;  3WAN A;  5JHA A;  5L83 A;  5G55 A;  2UWQ A;  1EO6 A;  3WAO A;  3DVN U;  4WWN A;  2CKH B;  4WQO B;  2KAN A;  2KTF A;  4GB9 A;  2LRW A;  2NBU A;  2JRI B;  2WWZ A;  5DPR A;  2N4F A;  3V61 A;  1LXD A;  1IPG A;  3Q3J A;  2FCN A;  3BY4 B;  3T9L A;  4W9J A;  5JH5 C;  2MRP A;  4ASW C;  2LRU A;  4TQ0 A;  4URK A;  5LXH A;  3NZU A;  3CST A;  4KZ0 A;  3PVL A;  3PPA A;  2Z0D B;  4FN2 A;  2MLB A;  1WJ4 A;  3H1U A;  2IO3 B;  4ZRI A;  3ENE A;  4W9K A;  4A3O A;  1WR6 E;  4FUL A;  3RCZ A;  2CR5 A;  4HPL B;  3OJ4 B;  3OLM D;  2Y5B B;  2JUO A;  3VUY A;  2KN5 A;  3NZS A;  2CHW A;  2KJR A;  2KWV B;  3N30 A;  3WIM A;  2D10 A;  1VD2 A;  2MW5 A;  2D07 B;  4ZDV A;  3ZIM A;  4MJS A;  2WX1 A;  1LM8 B;  2O6V D;  3A4S C;  3JW0 X;  1WX9 A;  3PLU A;  4MGY E;  5D6J B;  1S1Q B;  2MX2 A;  4TQ1 A;  4ZRJ A;  1T0Y A;  3T8M A;  2B3A A;  4KSL C;  5AEK B;  2FUH B;  5D2M B;  3ZTC A;  4IM0 A;  1YD8 U;  2C5L C;  3EEC A;  2JWZ A;  1WF9 A;  3QX1 A;  4DXA B;  2MP2 A;  2Z59 B;  2K8H A;  3QCA A;  3TCA A;  2KNB A;  4XX5 A;  1RRB A;  1V80 A;  4W9E A;  2XEW A;  3QWZ B;  2N9X A;  2LD9 A;  4XZ4 A;  1JRU A;  1I35 A;  2MWS B;  4K7W A;  5AZG A;  1WGG A;  4E74 A;  2MBE A;  2KXJ A;  1RAX A;  2UYZ B;  4BKT A;  4HCN B;  4TV3 A;  4E71 A;  4KIK A;  4W9L A;  4AP4 C;  5DCN A;  2EKE C;  4X57 B;  3CF6 E;  4II3 B;  2KWU B;  4B6W A;  4IWO A;  3LJ3 A;  2DZJ A;  3ZRC A;  1V6E A;  2YLM A;  4P7I A;  4K81 A;  4AUQ C;  4M8M A;  4I6P A;  1P0R A;  2L00 B;  5C23 A;  3B0A A;  3A9K A;  3AU5 A;  3PRZ A;  4GU2 A;  4JQW C;  4BVU C;  1WXV A;  2AYO B;  2RD0 A;  4DHZ B;  2K8B A;  1Z2M A;  1E8X A;  2KOX A;  4FHK A;  5D7G A;  3ZW3 A;  2CU1 A;  2FCM A;  2LGX A;  2KD0 A;  2MA9 B;  1GC6 A;  3B1L X;  3MJW A;  4NQK E;  5FR6 A;  3VDZ A;  4LCD E;  3ZRF A;  2KFK B;  4NJ6 A;  4IC7 B;  2ZVN A;  3SDL C;  4TKN A;  4BKG A;  3QHT A;  4GXB A;  2IYD B;  4WWO A;  4IM2 A;  2N1V A;  2NR2 A;  2IY1 B;  3VTV A;  2M17 A;  1WRD B;  5AZH A;  5TR5 A;  2KX3 A;  3OJ3 A;  3ZNG C;  2NS5 A;  3UQA A;  1LQB A;  3EHV A;  2KLG A;  4GDL B;  1E7V A;  1GC7 A;  1TBE A;  1WM3 A;  3PRM B;  4GN1 A;  2NCN A;  1WGD A;  1WM2 A;  2V1Y A;  2KHW B;  3QC8 B;  1P1A A;  1NDD A;  1G6J A;  5IAA C;  2YVC A;  4GMV A;  2PE9 A;  1X1M A;  2JY6 A;  3DCG A;  3H7P B;  4MSM B;  4GIV A;  4BFR A;  2V3S A;  2DHZ A;  4LJO B;  1BT0 A;  3H6N A;  3VHT C;  1TTN A;  1D3Z A;  1KM7 A;  2IY0 B;  3UIO B;  4IWQ A;  4GDK A;  2RGF A;  2NBV B;  2G4D B;  2I1K A;  3IFW B;  2BYE A;  2DYO A;  3JSV B;  1YX5 B;  4W9I A;  1Q1O A; 
#chains in the Genus database with same CATH topology
 4B95 A;  4NAW B;  4ZYS A;  1ISN A;  3NS8 A;  4YSX B;  1TS2 A;  1IBX B;  4LNI A;  2KK8 A;  3DBH B;  4IOI E;  2W9N A;  4FBJ B;  2R2O A;  4P1B C;  1I4P A;  2FAZ A;  2AQ1 B;  4PK1 A;  1FRD A;  2J7Q B;  2N9L A;  2OJR A;  3JYU A;  1N6Z A;  3L13 A;  3B08 A;  1HTO A;  4N6E B;  3L10 B;  1UGJ A;  2BS4 B;  1F9J A;  5BMH A;  3AE7 B;  2FIF A;  4C7Z A;  4WJO A;  5HHD G;  1P9D U;  3LDZ E;  3QA8 A;  1FPY A;  4GOC A;  1MG4 A;  3CMM B;  2K6Q A;  2XK5 A;  1GG3 A;  4W9G A;  2BS3 B;  2JF5 A;  2PLP A;  4MGK E;  2RPQ A;  1NYQ A;  2PIA A;  4PYZ A;  2DZI A;  1N63 A;  4WQM A;  2XBB C;  2WXJ A;  1UGM A;  2N9P C;  4OZC A;  2JXX A;  3PLV A;  3RMK C;  1UBQ A;  1XT9 B;  4NJC A;  5IN7 A;  1SB3 C;  1J19 A;  2LUE A;  1H4R A;  2LEK A;  4IUM B;  3HM3 A;  3Q14 C;  4RNA A;  4KV2 A;  2N1W A;  3ONS A;  2HJ1 A;  1YX6 B;  3A1Q A;  1BUI C;  3KQ4 A;  2W54 A;  2C7H A;  1WX7 A;  1WXM A;  2WXI A;  3W9C B;  2MP2 B;  4PS7 A;  2WXR A;  4YWG G;  2H88 B;  3W2D A;  1L4D B;  1TKG A;  3SR6 A;  1WGK A;  4DWF A;  1RFK A;  1V5T A;  3RYT A;  4L23 A;  3ZVV A;  2KDE B;  3AI5 A;  1OTR B;  4KSK C;  3Q8B A;  5J18 A;  1T3Q A;  3VXW A;  2AWT A;  4RM9 A;  4WJQ A;  1Q10 A;  4DBG A;  2KMM A;  2QCZ A;  2J53 A;  2JWU A;  2L7R A;  4EZK A;  1L0Y B;  1C3T A;  2ZNV C;  2QSD A;  2HTH A;  3IHP C;  3N32 A;  1MPE A;  4M0W B;  3APF A;  1OEY J;  2SAK A;  4FJV B;  5HKH A;  1SEB D;  2LVQ A;  3ZDM C;  1F52 A;  4LNO A;  2M56 B;  1XF5 L;  4ICU A;  4S0R A;  4N59 A;  4N58 A;  4WJN A;  5BYQ A;  1NEK B;  1XLN A;  4ANU A;  5TSS A;  5CHF A;  2SEB D;  2WQY B;  1KLU D;  2BQQ A;  3QIJ A;  2KQS A;  1FRR A;  2FID A;  3DVG Y;  1GUA B;  4GDK B;  3DHH C;  1UF0 A;  3ABV B;  2EKI A;  4PYU A;  4AWJ A;  1FMA D;  2WYQ A;  2Y5P A;  3NHE B;  5FR3 A;  2MJD A;  1QQR A;  4PS3 A;  3M62 B;  3T3O A;  2J42 A;  3SU8 X;  4HXD A;  2MBB B;  3R7Q A;  3AE6 B;  4DHJ B;  2NBW B;  1YJI A;  2Z8L A;  3PV1 A;  2JU6 X;  2GLS A;  5EE0 A;  2M19 A;  3RZF A;  1GPX A;  3RZW C;  4XE0 A;  2WXL A;  3UF8 A;  2N7E A;  2IGD A;  4A20 A;  2FNJ B;  4K3B A;  3O65 B;  3PGE A;  3RT3 B;  4L1B A;  3AEC B;  3PZD A;  4GGQ A;  3AE9 B;  4NY0 A;  3VQI A;  5G5G A;  1YQ3 B;  2PE6 B;  3WA0 A;  4HDO A;  3UI3 A;  3WAM A;  1YN3 A;  1R4M I;  3N3K B;  1HXY D;  2EMT A;  3MC9 A;  1P98 A;  4Q2J A;  1UEL A;  3AE1 B;  1WXS A;  3T3N A;  3VUX A;  2DAJ A;  1UBI A;  2JVC A;  1JWU D;  4W9C A;  1WSP A;  1AAR A;  1V9J A;  4KKI A;  1SSN A;  5HG2 A;  5DPT A;  4NAW A;  1QF6 A;  1IBX A;  2LAS A;  4DDI D;  1XLP A;  4J3O D;  4EEW A;  3A4R A;  4DHZ E;  2KDB A;  4B9K A;  4EZL A;  4WJP A;  3MC8 A;  2V0G A;  3MHS D;  4GSW A;  2D3B A;  4JE3 B;  2Z0E B;  2K39 A;  5C1Z A;  1Z5S B;  2CJN A;  1MHX A;  3W5V B;  1AN8 A;  1KOT A;  4DK5 A;  1S3S G;  1JW9 D;  2NPT B;  3U8Z A;  2A4Z A;  1AW7 A;  3N9Y C;  1WY8 A;  2N7D A;  3I3T B;  3BVG A;  1K52 A;  1QT9 A;  1V5O A;  2RDG A;  3Q8F A;  1K51 A;  1N61 A;  3N1X C;  1D5X C;  5G55 A;  1EO6 A;  1D6E C;  3DVN U;  4WQO B;  2WXH A;  2N4F A;  1LXD A;  4RGO S;  1IPG A;  2FCN A;  1ZXH A;  3CST A;  3PVL A;  1WJ4 A;  2RPV A;  1C9F A;  4A3O A;  4YSY B;  5JXV A;  2KAC A;  2LJI A;  2KN5 A;  3NZS A;  2CHW A;  3HRD D;  2E3T A;  2D10 A;  2MW5 A;  2D07 B;  1T0R C;  3ZJV A;  3ZIM A;  1QLB B;  2BVC A;  1L5P A;  1DGJ A;  1HZ5 A;  4MGY E;  2TSS A;  4TQ1 A;  4ZRJ A;  1T0Y A;  2FUH B;  2C5L C;  2OJW A;  2MP2 A;  4LTU A;  2K8H A;  1F0Z A;  1RRB A;  4P16 A;  1T0S C;  4DXF A;  4K7W A;  1WGG A;  3NG0 A;  4E74 A;  2LHE A;  1C4C A;  4HCN B;  3AEA B;  1JCK B;  1R4N B;  5DCN A;  4X57 B;  1TS3 A;  4B6W A;  2LGI A;  2M0A A;  4QAY A;  4P7I A;  4AUQ C;  4I6P A;  3PO0 A;  3B0A A;  3PRZ A;  4BVU C;  2RD0 A;  1Z2M A;  4FHK A;  1PGA A;  5G5H A;  4O1N A;  3AEB B;  3ZYY X;  3B1L X;  3ZRF A;  4C80 A;  4IDI A;  2KFK B;  2MJE A;  2OHF A;  4IC7 B;  4M0W A;  4GXB A;  3P4Q B;  2NR2 A;  2M17 A;  5TR5 A;  1SE4 A;  1LQB A;  3EHV A;  1E7V A;  1TKY A;  3NJT A;  5AUK A;  1WM2 A;  1SJH D;  2KHW B;  1P1A A;  1N60 A;  2NMQ A;  1C77 A;  2PVO D;  2X8X X;  4GIV A;  2V3S A;  3H6N A;  4MM3 B;  4GDK A;  2RGF A;  2NBV B;  3IFW B;  2BYE A;  1YX5 B;  5CX3 A;  4S17 A;  2L3Z A;  3KUZ A;  2ZW0 A;  1VZ8 A;  1V49 A;  2W3R A;  3P42 A;  1DOY A;  2GBR A;  2IBI B;  3HM6 X;  3V62 A;  4JPS A;  1PGB A;  2IO1 B;  3SHQ A;  4YSZ B;  1EU3 A;  3ZJT A;  1T0Q C;  2VZK B;  2CHZ A;  2D3G A;  4LDT B;  2VRR B;  2AX5 A;  5H92 C;  4KX6 B;  2K8C A;  4BKS D;  4LDT D;  1WRI A;  2DNF A;  1HA5 A;  4KVG B;  5DPS A;  1KTK A;  4ANV A;  2KJH B;  3TL5 A;  3W1S A;  1KJT A;  3URY A;  4RCO A;  2JZZ A;  4B0E A;  4ACF A;  3KUD B;  3TMP B;  2RSU A;  3KYD D;  2INP E;  2KDF B;  3PHX B;  4JLC A;  3ZGZ A;  3Q8E A;  5E6P A;  4WAF A;  1E8Z A;  1QOG A;  3E56 A;  3ECI A;  3VAW A;  2AQ2 B;  3SFD B;  1JWM D;  1WGH A;  2KFJ A;  2LXA A;  2IZV B;  1I4H A;  1J8C A;  2ZCC A;  4UDU C;  3AE3 B;  3BYY B;  3VH4 B;  4KGS A;  1EM7 A;  3PTF C;  4RFB A;  1YQB A;  4REZ A;  2K6D B;  3O13 A;  1LGR A;  4ANX A;  3DBL B;  2DYB A;  1ACC A;  1I42 A;  1WGY A;  4LJP B;  3IXS A;  1ZXI A;  4K1R B;  1OQR A;  3NZ3 A;  4AJY B;  1I7H A;  4IW0 A;  1TS5 A;  2NPT A;  1FFV A;  3GZN I;  2HE7 A;  2M8S A;  3GOE A;  3DBR I;  5AUI A;  2N7J A;  3PT2 B;  2XNA C;  3NVV A;  4EFO A;  1V8C A;  4XWT A;  2GRI A;  1SF0 A;  3M3J A;  2JZP A;  1KH0 A;  1L0X B;  5CHW A;  3BWU D;  5IP4 D;  2REX A;  3OAW A;  2KC1 A;  4JL9 A;  3P2B A;  5BMG A;  3QJZ A;  2WXF A;  3P1M A;  4II2 B;  1IP9 A;  1L2N A;  2BWE S;  4EOY A;  2LGS A;  2HJ8 A;  1WIA A;  3VR8 B;  3D32 A;  3KLS X;  1I4Q A;  1SIF A;  2NTT A;  2KAJ A;  2HDE A;  2K5P A;  1WYG A;  1SE9 A;  2QMT A;  1EF5 A;  2ZVO A;  1YNT E;  3DVG X;  5IOI A;  2QHO A;  3GE3 C;  3E9S A;  1V1O A;  2WDT B;  3VUW A;  3DOW A;  4OVV A;  1ZOY B;  1XCT L;  2K3U A;  4CQN A;  2HD5 B;  2JXT A;  1ZP0 B;  2Q5W D;  2N0S B;  1FO4 A;  1XXG A;  2WDQ B;  1PGX A;  1FM0 D;  1FXA A;  4EE2 A;  4HJG E;  2LJ5 A;  4HCP B;  2ICI A;  5J2R A;  2CS4 A;  1JQ4 A;  3AU4 A;  1SE2 A;  2J52 A;  2RDB C;  3RD2 A;  4YL8 A;  2MCN B;  2NVU I;  2PTL A;  2KFK A;  3AH7 A;  1UZX B;  3VTW A;  2IPK D;  2KZR A;  5KHO A;  3IG3 A;  2M1M A;  2LVO A;  1OQQ A;  1J0G A;  2ON8 A;  1WZ0 A;  2FCQ A;  2ONQ A;  2LGD A;  2MQJ A;  3V6E B;  3DPD A;  5CTR C;  4YTP B;  2QC8 A;  1E7U A;  1WX8 A;  4K3C A;  3VTU A;  4F7Z A;  4DXG A;  1CK1 A;  2I38 A;  3HVD A;  3B2F A;  2K25 A;  4G11 A;  4D2K A;  3W1Y A;  3ML9 A;  4MM3 A;  5C2T B;  1FNV A;  1VDV A;  3IAM 1;  4ANW A;  2L1A A;  5AZF A;  4XC2 A;  2GI9 A;  2ZNV B;  3EFU A;  2J4X A;  2RR9 A;  2JPH A;  4CYE A;  2KYW A;  3Q3F A;  4YTN B;  3V60 A;  2R2Q A;  4MAC A;  1DOX A;  2BF8 B;  1NBF C;  2V4I B;  5HFY A;  3LXF A;  1EWC A;  4USA A;  1FCL A;  1TIF A;  1TJE A;  5JHB A;  4BKS A;  1YJ1 A;  4MGI E;  1ET6 A;  2C7N B;  3AEG B;  1J7B A;  3PSE B;  4FHJ A;  1N62 A;  1V97 A;  2WXN A;  1KLG D;  2MH7 A;  1QOB A;  4DQO C;  1ROE A;  2I1J A;  4ARI A;  2UWQ A;  2CKH B;  2KTF A;  3IT6 B;  4GB9 A;  2LRW A;  5DPR A;  3TEW A;  2WNM A;  3BY4 B;  4LK0 M;  3T9L A;  3NZU A;  2W82 A;  1XLQ A;  4KZ0 A;  3AMZ A;  4FN2 A;  2KWD A;  2MLB A;  3H1U A;  4W9K A;  2KDM A;  3RCZ A;  3PZ8 A;  1E6E B;  2Y5B B;  2MEK A;  1NI3 A;  1ZPS A;  1OFF A;  3N30 A;  4ZDV A;  3AED B;  4ITK A;  2O6V D;  3BII D;  4L2Y A;  2WGS A;  2ZW1 A;  1QOA A;  5D6J B;  1PFD A;  1S1Q B;  2XN9 C;  5AEK B;  2CU3 A;  4RH6 A;  4DXA B;  3QCA A;  3TCA A;  4XX5 A;  4MH8 A;  3QWZ B;  3VR9 B;  2N9X A;  2LD9 A;  4XZ4 A;  1GOZ A;  3RNG C;  2MWS B;  5AZG A;  3AE4 B;  4M00 A;  2MBE A;  4BKT A;  1RAX A;  2UYZ B;  2BB6 A;  4TV3 A;  4E71 A;  4W9L A;  2QIE B;  2WXG A;  4IWO A;  3ZRC A;  1V6E A;  1DOI A;  2JQR B;  3I57 A;  3R8B A;  2L00 B;  5C23 A;  4JQW C;  2LHD A;  3AE8 B;  1E8X A;  3AB5 A;  3ZW3 A;  2V3N A;  1ZDX A;  5LNK 1;  3SEB A;  3EA6 A;  4NJ6 A;  2RMM A;  3LB8 C;  3ETR A;  3ZXV A;  2ZVN A;  1E0Z A;  3RI7 C;  4TKN A;  4BKG A;  4B0M A;  4IM2 A;  2EEL A;  3Q69 A;  4HKZ E;  2KX3 A;  4XGA B;  2WXQ A;  1GB1 A;  4GDL B;  1WM3 A;  3PRM B;  3BVM A;  1WGD A;  1NDD A;  4GMV A;  4RGT A;  3H7P B;  2N9K A;  1TKE A;  4BFR A;  3FIL B;  2DHZ A;  1F2R I;  5BYS A;  1D3Z A;  1KM7 A;  2IY0 B;  4IWQ A;  4WH4 A;  1C4A A;  3FKY A;  3Q3N C;  1C4P A;  2I1K A;  4KGT A;  1JWS D;  2ZPN A;  3NY5 A;  4ZRQ A;  4C56 C;  5JZE B;  4NAM A;  1P7E A;  4MDK E;  1AWD A;  1UUP A;  3HK0 A;  3ZO5 B;  2GOW A;  1JML A;  2VH2 A;  3I5J C;  2DX5 B;  4ZHP A;  1N5W A;  1ET9 A;  3ZNZ B;  4AS1 A;  1MG8 A;  1WMH B;  1TS4 A;  2O2V B;  1OEY A;  2YEP F;  1YN4 A;  4A8X C;  1WR1 A;  4WAA A;  2BB5 A;  3RNB C;  3MP9 A;  2G4S A;  4OHJ A;  1UWX A;  2K9X A;  3GE8 C;  2BTE A;  2BWF A;  2LXC A;  3HHM A;  4M01 A;  2KO3 A;  3UIN B;  5DPW A;  3NVW A;  4OW0 A;  3I9V 1;  4NNJ B;  3HUI A;  1MI0 A;  4G50 A;  3Q8C A;  1SXT A;  4M8N A;  3DVN V;  1OQY A;  1XO3 A;  1E10 A;  3RNE C;  1T6B X;  2I2Y A;  3J9C A;  1ZKH A;  1UH6 A;  2LZ6 A;  1RLF A;  2V9H A;  2KLC A;  1R4M B;  2L83 A;  2KT7 A;  5D94 A;  2J0M A;  4XDD A;  1E9M A;  3QK0 A;  1PYW D;  1WI0 A;  3RNF C;  1RFA A;  2PKO A;  3R7R A;  4FJY A;  1IGD A;  5EE3 A;  3X23 A;  4RF1 A;  3AE5 B;  1ZGU B;  2W55 A;  2JT4 B;  4N9F 4;  1C1Y B;  2WHI A;  3P63 A;  2CHX A;  3U52 E;  2QIL A;  3LYY A;  2MBO A;  2MBH A;  1PDX A;  3A9K B;  1EUV B;  3RPF C;  3CWI A;  1E8Y A;  2IJ0 A;  2OOB B;  3PHW B;  4MEL A;  2CJO A;  4KKJ A;  2LI5 A;  3RUI B;  5IA7 A;  4IG7 B;  4TUU A;  1V86 A;  3DHG C;  3ML8 A;  3RN9 C;  4ARC A;  4IWP A;  1F2R C;  3QAR A;  4W9F A;  1JWA D;  4P1C C;  2IGG A;  2ASQ A;  4ZRP A;  1BXT A;  4NJ7 A;  3V6C B;  3GS2 A;  3X0W A;  1WE7 A;  4YTM B;  3HIZ A;  5E6O A;  2G9H D;  1C76 A;  3PZ7 A;  1VZ6 A;  1SGH A;  3MTN B;  3ZXR A;  1QZE A;  2BYV E;  3P4S B;  3TBL D;  4BBN F;  1VCB A;  2M0X A;  3DQV A;  4GLS C;  2C60 A;  2N9E B;  1WJU A;  4FA6 A;  3ALB A;  1I4R A;  3WAL A;  2PJH A;  1L7Y A;  4M02 A;  2GBK A;  3MHZ A;  4A9A A;  3K9O B;  4EUT A;  3ZUN A;  3N1Y C;  2K0P A;  4W9H A;  5L95 C;  3KWL A;  2KMC A;  3H9D A;  3BVZ A;  1CQV A;  2JX5 A;  1RWS A;  2G3Q B;  5GMV A;  2IO0 B;  2PEA A;  2FCS A;  3IBE A;  2BKR B;  1E8W A;  2BYT A;  2KVR A;  2DEN B;  2DAF A;  3P4P B;  2KWC A;  2LUM A;  4CO7 A;  2IGH A;  3PRP B;  3TEY A;  3BIN A;  5EDS A;  1VRA B;  1K53 A;  1PQS A;  2A5U A;  3V3X A;  3KUC B;  3AN1 A;  4E3C A;  1WGR A;  4GDL A;  5G2N A;  4NQL B;  5J17 A;  4K7U A;  4K7S A;  3A9J B;  3NRZ A;  1RM6 C;  3VFK A;  1TGZ B;  3H7P A;  3ZNI D;  1ENF A;  3FIL A;  1M94 A;  3KH0 A;  1WWT A;  3H8H A;  3EFC A;  3TEX A;  2GMI C;  2D11 A;  5HI1 A;  3V05 A;  3M95 A;  4BBN C;  1YJJ A;  1HEZ E;  2LWP A;  4FAD A;  2V4L A;  4I6L B;  1JWB D;  2BBC A;  2FBW B;  3U30 A;  4NPN A;  2AL3 A;  4WIP A;  2LVP A;  1HE8 A;  2L0T A;  1JRP A;  1KF6 B;  5I4D A;  4KDI C;  3ZKJ C;  4LNK A;  5BO4 B;  1WMH A;  4YXD B;  2KMA A;  4YT0 B;  3AEE B;  4OVU A;  1V1P B;  2O2V A;  2ZZP B;  3R3M A;  1ZW7 A;  1AYF A;  3KVF B;  1UNS A;  5GXG B;  4BOZ B;  5LXI B;  3R2T A;  1IGC A;  3L08 A;  3U7D A;  4PS8 A;  4NZL B;  1WZ3 A;  1KFY B;  5CHV C;  1XQQ A;  3BK1 A;  3ZNH B;  1E5W A;  1L6U A;  4A3P A;  3WAN A;  5L83 A;  3WAO A;  1NYR A;  4WWN A;  2WWZ A;  5BYR A;  5EE9 A;  2JYT A;  3Q3J A;  1ZDV A;  2MRP A;  4ASW C;  2LRU A;  1R7S A;  2LMC A;  2WP9 B;  3PPA A;  3TUO A;  3TEZ A;  2R61 A;  2IO3 B;  3ENE A;  4FUL A;  2CR5 A;  4HPL B;  3RFZ B;  3VUY A;  1XCQ L;  2KJR A;  4HPP A;  1FNU A;  2L52 A;  2WX1 A;  1LM8 B;  3A4S C;  3JW0 X;  3PLU A;  1YQ4 B;  2MX2 A;  2IND C;  2WDV B;  2B3A A;  5D2M B;  2WU2 B;  4IM0 A;  3TSS A;  2WDR B;  3EEC A;  1FXI A;  3Q3M C;  3QX1 A;  1EU4 A;  4W9E A;  2XEW A;  3DHI C;  1KRH A;  3RNA C;  1JRU A;  1DYQ A;  1JRO A;  3AEF B;  1I35 A;  2FE8 A;  4AP4 C;  1L6V A;  3R2I A;  2EKE C;  4US8 A;  5IKC M;  3CF6 E;  2KWU B;  3LJ3 A;  2YLM A;  4K81 A;  3HVZ A;  2Y3A A;  3A9K A;  4GU2 A;  1WXV A;  4DHZ B;  2KOX A;  5D7G A;  4FXC A;  2LGX A;  2KD0 A;  3MJW A;  4NQK E;  3VDZ A;  4LCD E;  2X38 A;  3GZN B;  1GAQ B;  2WXK A;  2IYD B;  3QHT A;  4WWO A;  3SFE B;  1XLO A;  5AZH A;  1SBB B;  1I4G A;  3AV8 A;  4A6Q A;  3DBR B;  3ZNG C;  2NS5 A;  2Y5C A;  2KLG A;  1TBE A;  2DWQ A;  1FCC C;  2MHJ A;  1VR9 A;  2NTS A;  3QC8 B;  1G6J A;  2YVC A;  2PE9 A;  3W5U B;  3DCG A;  4MSM B;  4LJO B;  1BT0 A;  4PT5 A;  3VHT C;  3IAS 1;  3P4R B;  1STE A;  2G4D B;  2WU5 B;  2DYO A;  3JSV B;  1D5M C;  2QDF A;  4W9I A;  1Q1O A;  1WFY A;  3L0W B;  4CHK A;  3KWV A;  5KHQ A;  1F1H A;  3ZLZ A;  2J0K A;  1Y8R C;  2M4N A;  3B9J A;  4HKQ A;  3Q2A C;  2ZJD A;  2D2Q A;  2EMS A;  4F1S A;  3S2A A;  4OVZ A;  4ZYN A;  4HLE A;  2O6V B;  3DBS A;  2JYE A;  2ACZ B;  3ZDT A;  1QKZ A;  2GBJ A;  1WH3 A;  1HQR D;  2QJL A;  2ZPY A;  3UGB B;  1WYW B;  2KDI A;  2PMV A;  1XEE A;  2WXM A;  1TZ1 A;  2KTR B;  1U4A A;  2L76 A;  3EUB 2;  2DLB A;  1CMX B;  4FLH A;  2BKF A;  1WXA A;  4HK2 A;  4J6I A;  2WS3 B;  3A9J A;  3FAH A;  1T5X D;  3L4P A;  1H8C A;  4DHJ D;  4HDQ A;  2K1F A;  3Q8A A;  4JGH B;  1SJE D;  1ZUD 2;  3NVZ A;  4MGZ E;  3MJ5 A;  1MJD A;  2V3P A;  3WCQ A;  1GB4 A;  1OGW A;  1KLV A;  2FUG 1;  1FEH A;  5FK9 C;  3NOB A;  2G45 B;  4MJS B;  2RDH A;  1LFD A;  1R4N I;  3QAQ A;  4I6N B;  3CSF A;  3QQ8 B;  1ESF A;  3NUH B;  2KJ6 A;  4MSQ B;  2BS2 B;  2KN4 A;  3AXC A;  2J0J A;  4RGN A;  1A70 A;  1MFW A;  4ZOH C;  4WWP A;  2H89 B;  2MJ3 A;  3W1S C;  3KW5 B;  1Q0W B;  4RGM A;  1MHH E;  2JRH A;  2L0F A;  2QEJ C;  1V1P A;  2DYM A;  3APC A;  4AQ7 A;  1FXT B;  2BPS A;  1E90 A;  2KVZ A;  4IM3 A;  4KIK B;  4HVB A;  4DDG D;  2PVG C;  3OG5 A;  1WE6 A;  3A33 B;  3TJP A;  4RM8 A;  4JWU C;  1GNU A;  3N20 C;  2DZM A;  4C7Y A;  2KX0 A;  2AEH A;  4MH0 E;  1IYF A;  4FJZ A;  1EWY C;  3ZQ4 A;  1F77 A;  3K9P B;  3GB1 A;  1V81 A;  1L4Z B;  1C78 A;  3DWG C;  1UD7 A;  4AOF A;  2GB1 A;  4EZJ A;  5LLI A;  4A55 A;  1WJ6 A;  4ZRK A;  1VZ7 A;  1FD6 A;  2W3S A;  4F8C B;  5E6N A;  1N5X A;  5BMI A;  3SD5 A;  1VLB A;  4HJK A;  2KQ7 A;  4C4V B;  2ZEQ A;  3L54 A;  4AJW A;  1TY2 A;  4US9 A;  4P6V F;  1EF1 A;  4EKU A;  1NVI D;  2INC C;  3VRA B;  4G3X B;  3JVZ X;  4MEM A;  3PS6 A;  3C19 A;  4LLG M;  2KQ4 X;  1QIL A;  5D3I B;  5E6J A;  1TZO A;  2MSE D;  2B76 B;  1SE3 A;  1Q5W B;  2E6X A;  1P3Q U;  5H8Y E;  3B2G A;  5EE1 A;  3NVY A;  4KZC A;  1FNW A;  3RNC C;  4W9D A;  2C9W B;  4ZHO A;  4BOS C;  3UQB A;  2WLB A;  3AE2 B;  4OZB A;  3NS1 A;  2GBM A;  4R3D A;  2IDY A;  1TT5 B;  2PW9 A;  3APD A;  2BGF A;  2WXP A;  3R66 C;  4ICV A;  1P7F A;  1V2Y A;  2PPH A;  1PUT A;  4G0N B;  1VJK A;  2HTM E;  4RMA A;  2IO2 B;  1YOV B;  3M63 B;  3WAP A;  1HZ6 A;  3AUL A;  1M4V A;  1B9R A;  1K8R B;  1TYG B;  3EC8 A;  1NEN B;  1A5R A;  2C7M B;  2L32 A;  2XK5 B;  2L8J A;  4JX1 C;  1D4B A;  4A90 A;  1YIW A;  3RUL A;  3ZTD A;  3IVF A;  3KYC D;  2YEP B;  1GJZ A;  1K50 A;  3FC4 A;  4KDL B;  3C0R B;  2BW2 A;  2DZK A;  3DBL I;  4OZA A;  3IT4 B;  2MBQ A;  2LGY A;  4IKG A;  3VH3 B;  3N1Z C;  3JSV A;  1XD3 B;  1NI2 A;  2AQ3 B;  2KC2 A;  3DDC B;  3CIR B;  2WXO A;  3MFG A;  2JZ3 B;  1C79 A;  2DBY A;  1YN5 A;  1IUE A;  2AL6 A;  4HPM B;  5MPO A;  2GBN A;  3MC0 B;  1MVK A;  3I63 C;  1WJN A;  3A1Q B;  4LNN A;  1HTQ A;  3PRE A;  3UIP B;  3H7S A;  2WX0 A;  4HRS A;  2BYF A;  4JWS C;  2LFI A;  4RF0 A;  2O6V A;  3TIX A;  2KKC A;  3DBH I;  2D5G A;  3VVW B;  2INN E;  1J7C A;  3L17 A;  4HWI B;  4JIO U;  5IO9 A;  2JSV X;  4H2A A;  2L05 A;  2KTR A;  2ZCB A;  5JHA A;  3L16 A;  2K22 A;  4WWM A;  1BML C;  2KAN A;  1L0V B;  2NBU A;  3V61 A;  2JRI B;  4TMA B;  1FFU A;  4W9J A;  5JH5 C;  4TQ0 A;  5LXH A;  4URK A;  5C3J B;  2Z0D B;  4ZRI A;  1WR6 E;  3OJ4 B;  2UU7 A;  3OLM D;  3Q6B A;  2JUO A;  3BK2 A;  2VZK D;  2KWV B;  3WIM A;  1VD2 A;  4KGR A;  1TY0 A;  4MJS A;  3DWM A;  1WX9 A;  3EGR A;  3VRB B;  3T8M A;  1RYJ A;  4KSL C;  3ZTC A;  1YD8 U;  2JWZ A;  1WF9 A;  2Z59 B;  1B1Z A;  2G1E A;  3BYT B;  2KNB A;  1V80 A;  2VH1 A;  4HRO A;  3U2S C;  4C00 A;  1YMH E;  1D5Z C;  4BZA A;  2KXJ A;  1CJE A;  1E7P B;  3OWE B;  4KIK A;  4XWW A;  4II3 B;  1LO5 D;  2DZJ A;  3U4E G;  4M8M A;  1P0R A;  4LNF A;  4XDC A;  3AU5 A;  3BZD B;  2D3C A;  1QOF A;  2AYO B;  2K8B A;  1ZE3 D;  2BT6 A;  2CU1 A;  2FCM A;  2MA9 B;  1GC6 A;  1JAL A;  5FR6 A;  4MT5 A;  5D3D A;  3C8Y A;  3SDL C;  2N1V A;  2IY1 B;  3AM9 A;  3VTV A;  4XYC A;  1WRD B;  1UWM A;  1CZP A;  3OJ3 A;  4BAX A;  3UQA A;  2D3A A;  4C4V A;  1GC7 A;  1WXQ A;  4GN1 A;  2NCN A;  4HEA 1;  2V1Y A;  4WUR A;  3Q3O C;  5IAA C;  3U7Z A;  1X1M A;  1J7A A;  2JY6 A;  1TTN A;  2OED A;  1Y56 A;  3UIO B;  3ZJU A;  3GP7 A;  5FKA C;  1SIJ A;  4TSS A;  5T8I A;  1FIQ A;  1I4X A; 
#chains in the Genus database with same CATH homology
 2ZPN A;  4NAW B;  3NY5 A;  4B95 A;  5JZE B;  5CX3 A;  1ISN A;  1WFY A;  3NS8 A;  4MDK E;  3L0W B;  2L3Z A;  3KUZ A;  1V49 A;  2KK8 A;  3HK0 A;  4CHK A;  5KHQ A;  3ZO5 B;  2GOW A;  2W9N A;  2R2O A;  4FBJ B;  2GBR A;  2IBI B;  3HM6 X;  3V62 A;  2FAZ A;  3ZLZ A;  2J0K A;  1Y8R C;  2M4N A;  2DX5 B;  2IO1 B;  3SHQ A;  2J7Q B;  2OJR A;  3JYU A;  2ZJD A;  2D2Q A;  3ZNZ B;  3L13 A;  3B08 A;  2CHZ A;  1MG8 A;  2D3G A;  1WMH B;  4LDT B;  3L10 B;  2VRR B;  2EMS A;  4F1S A;  1F9J A;  3S2A A;  2O2V B;  4ZYN A;  4HLE A;  1OEY A;  2FIF A;  2O6V B;  2K8C A;  3DBS A;  4BKS D;  1WR1 A;  4LDT D;  4WAA A;  4WJO A;  1P9D U;  3LDZ E;  3ZDT A;  2GBJ A;  2G4S A;  1WH3 A;  4KVG B;  5DPS A;  3QA8 A;  4ANV A;  2ZPY A;  2KJH B;  3TL5 A;  1WYW B;  2BWF A;  3UGB B;  3W1S A;  1KJT A;  4GOC A;  2KDI A;  2LXC A;  3CMM B;  3HHM A;  2K6Q A;  2KO3 A;  3UIN B;  2XK5 A;  1TZ1 A;  1GG3 A;  2KTR B;  2JZZ A;  4W9G A;  1U4A A;  2L76 A;  5DPW A;  1CMX B;  4FLH A;  2BKF A;  3KUD B;  1WXA A;  4HK2 A;  4J6I A;  2RSU A;  2JF5 A;  3A9J A;  3KYD D;  2RPQ A;  4MGK E;  4NNJ B;  3TMP B;  2KDF B;  3PHX B;  4JLC A;  4G50 A;  4PYZ A;  4M8N A;  2DZI A;  1H8C A;  3DVN V;  4DHJ D;  1OQY A;  5E6P A;  4HDQ A;  1E8Z A;  2K1F A;  4JGH B;  3ECI A;  3VAW A;  2XBB C;  4MGZ E;  1UGM A;  2N9P C;  2JXX A;  3PLV A;  1UBQ A;  1ZKH A;  1UH6 A;  1OGW A;  1KLV A;  2LZ6 A;  1WGH A;  1XT9 B;  2KFJ A;  2LXA A;  1RLF A;  2IZV B;  1J8C A;  3NOB A;  2KLC A;  2G45 B;  2ZCC A;  4MJS B;  1J19 A;  1LFD A;  2LUE A;  1R4N I;  1H4R A;  3QAQ A;  4IUM B;  3HM3 A;  3VH4 B;  4I6N B;  3CSF A;  3PTF C;  3QQ8 B;  5D94 A;  4KV2 A;  2N1W A;  2J0M A;  3ONS A;  2KJ6 A;  4MSQ B;  1YX6 B;  3A1Q A;  1YQB A;  3AXC A;  2J0J A;  2K6D B;  3QK0 A;  4WWP A;  4ANX A;  2C7H A;  1WI0 A;  1WX7 A;  1WXM A;  3KW5 B;  3W1S C;  1Q0W B;  2DYB A;  2MP2 B;  1RFA A;  1I42 A;  1WGY A;  4PS7 A;  4LJP B;  3R7R A;  4FJY A;  3X23 A;  4K1R B;  2JRH A;  4AJY B;  2L0F A;  4DWF A;  2DYM A;  1ZGU B;  1V5T A;  4IW0 A;  3RYT A;  2NPT A;  2JT4 B;  2KDE B;  3APC A;  3GZN I;  1FXT B;  3AI5 A;  1C1Y B;  1OTR B;  2BPS A;  1E90 A;  2HE7 A;  4KSK C;  4IM3 A;  2M8S A;  4KIK B;  4HVB A;  4DDG D;  5J18 A;  3VXW A;  1WE6 A;  2AWT A;  3GOE A;  3DBR I;  3A33 B;  2CHX A;  3TJP A;  3PT2 B;  4RM8 A;  3ZVV A;  4EFO A;  1GNU A;  2MBO A;  2MBH A;  2DZM A;  4RM9 A;  4WJQ A;  2KX0 A;  3A9K B;  1EUV B;  2AEH A;  4MH0 E;  1IYF A;  4FJZ A;  4DBG A;  1E8Y A;  3M3J A;  3K9P B;  2OOB B;  5CHW A;  3PHW B;  1V81 A;  4MEL A;  4EZK A;  2L7R A;  1C3T A;  1UD7 A;  2ZNV C;  4AOF A;  2REX A;  2LI5 A;  3OAW A;  2HTH A;  2KC1 A;  4JL9 A;  3RUI B;  4EZJ A;  3P2B A;  3IHP C;  3N32 A;  5LLI A;  5IA7 A;  1WJ6 A;  4IG7 B;  4TUU A;  4ZRK A;  4M0W B;  1V86 A;  3APF A;  1OEY J;  4FJV B;  3QJZ A;  5HKH A;  4II2 B;  2LVQ A;  4F8C B;  5E6N A;  3ML8 A;  1IP9 A;  3ZDM C;  1L2N A;  2BWE S;  4IWP A;  3QAR A;  4ICU A;  4EOY A;  4W9F A;  2HJ8 A;  1WIA A;  3SD5 A;  3D32 A;  4HJK A;  2ASQ A;  2KQ7 A;  4WJN A;  4NJ7 A;  2ZEQ A;  3V6C B;  3L54 A;  4AJW A;  1SIF A;  4ANU A;  3X0W A;  5CHF A;  1WE7 A;  1EF1 A;  4EKU A;  3HIZ A;  5E6O A;  3QIJ A;  2KQS A;  1SE9 A;  1EF5 A;  1SGH A;  4G3X B;  2FID A;  3DVG Y;  3JVZ X;  3MTN B;  2ZVO A;  3PS6 A;  4MEM A;  1GUA B;  3DVG X;  4GDK B;  1QZE A;  2BYV E;  4BBN F;  3TBL D;  1VCB A;  2QHO A;  4PYU A;  2M0X A;  3DQV A;  4AWJ A;  2C60 A;  2MSE D;  2WYQ A;  1Q5W B;  2N9E B;  2WDT B;  1P3Q U;  1WJU A;  3VUW A;  3NHE B;  4FA6 A;  3ALB A;  3WAL A;  2PJH A;  3DOW A;  4OVV A;  1L7Y A;  4PS3 A;  4KZC A;  3M62 B;  4W9D A;  2C9W B;  2GBK A;  4BOS C;  3UQB A;  2HD5 B;  4HXD A;  3SU8 X;  2MBB B;  3R7Q A;  2GBM A;  4DHJ B;  3K9O B;  2NBW B;  4EUT A;  3PV1 A;  3APD A;  3ZUN A;  2BGF A;  4W9H A;  3R66 C;  4ICV A;  3RZF A;  5L95 C;  1V2Y A;  2PPH A;  3RZW C;  2KMC A;  3H9D A;  4N9F 4;  2LJ5 A;  4G0N B;  4RMA A;  2G3Q B;  4HCP B;  5GMV A;  2IO0 B;  2IO2 B;  5J2R A;  3UF8 A;  2N7E A;  2CS4 A;  2PEA A;  4A20 A;  2FCS A;  3AU4 A;  2FNJ B;  3IBE A;  3RD2 A;  2BKR B;  4YL8 A;  1E8W A;  3M63 B;  2MCN B;  2NVU I;  3O65 B;  2KFK A;  3PGE A;  1UZX B;  3VTW A;  3WAP A;  2KVR A;  2DEN B;  3AUL A;  2KZR A;  2DAF A;  3IG3 A;  5KHO A;  3RT3 B;  2KWC A;  2M1M A;  4CO7 A;  3PZD A;  2LVO A;  4GGQ A;  1J0G A;  1K8R B;  3PRP B;  4NY0 A;  1WZ0 A;  3BIN A;  5EDS A;  2FCQ A;  3VQI A;  3EC8 A;  2LGD A;  1PQS A;  2A5U A;  1A5R A;  2C7M B;  2PE6 B;  3KUC B;  3WA0 A;  4HDO A;  2XK5 B;  4E3C A;  1WGR A;  4GDL A;  2MQJ A;  2L8J A;  4NQL B;  5G2N A;  3V6E B;  5J17 A;  3WAM A;  4K7U A;  1R4M I;  3N3K B;  4K7S A;  1YIW A;  3RUL A;  3DPD A;  2EMT A;  3ZTD A;  3A9J B;  5CTR C;  3IVF A;  1P98 A;  3KYC D;  3VFK A;  1UEL A;  1GJZ A;  1WXS A;  3VUX A;  1E7U A;  1WX8 A;  3VTU A;  4F7Z A;  2DAJ A;  1TGZ B;  2K25 A;  3H7P A;  1UBI A;  2JVC A;  3ZNI D;  3KH0 A;  1M94 A;  3C0R B;  4G11 A;  4KDL B;  4W9C A;  2DZK A;  3DBL I;  3W1Y A;  3ML9 A;  2GMI C;  1AAR A;  4MM3 A;  2MBQ A;  1V9J A;  2D11 A;  2LGY A;  3M95 A;  4BBN C;  3VH3 B;  3JSV A;  5DPT A;  2LWP A;  1XD3 B;  4FAD A;  1NI2 A;  4NAW A;  2KC2 A;  2V4L A;  3DDC B;  4I6L B;  4ANW A;  5AZF A;  4XC2 A;  2LAS A;  2JZ3 B;  4DDI D;  2ZNV B;  3EFU A;  3U30 A;  4EEW A;  3A4R A;  4NPN A;  4DHZ E;  2AL6 A;  4HPM B;  2KDB A;  4B9K A;  4EZL A;  2AL3 A;  2RR9 A;  2GBN A;  2JPH A;  4WJP A;  4CYE A;  3Q3F A;  1WJN A;  2LVP A;  3A1Q B;  1HE8 A;  2L0T A;  3V60 A;  2R2Q A;  2BF8 B;  1NBF C;  3MHS D;  4GSW A;  4KDI C;  3PRE A;  2Z0E B;  2K39 A;  3ZKJ C;  3UIP B;  5C1Z A;  3H7S A;  5BO4 B;  1Z5S B;  5JHB A;  2WX0 A;  4BKS A;  1WMH A;  1YJ1 A;  4MGI E;  2KMA A;  4OVU A;  2C7N B;  1KOT A;  2BYF A;  4DK5 A;  1S3S G;  2O2V A;  3PSE B;  4FHJ A;  2ZZP B;  2O6V A;  3R3M A;  1ZW7 A;  3TIX A;  2NPT B;  2KKC A;  3U8Z A;  3KVF B;  2A4Z A;  5LXI B;  4BOZ B;  3DBH I;  3VVW B;  3L08 A;  1WY8 A;  2N7D A;  3I3T B;  3U7D A;  4PS8 A;  1V5O A;  3L17 A;  1WZ3 A;  5CHV C;  4HWI B;  4JIO U;  1XQQ A;  2I1J A;  2L05 A;  2KTR A;  2ZCB A;  1E5W A;  3L16 A;  3ZNH B;  4A3P A;  3WAN A;  5JHA A;  5L83 A;  5G55 A;  2UWQ A;  1EO6 A;  3WAO A;  3DVN U;  4WWN A;  2CKH B;  4WQO B;  2KAN A;  2KTF A;  4GB9 A;  2LRW A;  2NBU A;  2JRI B;  2WWZ A;  5DPR A;  2N4F A;  3V61 A;  1LXD A;  1IPG A;  3Q3J A;  2FCN A;  3BY4 B;  3T9L A;  4W9J A;  5JH5 C;  2MRP A;  4ASW C;  2LRU A;  4TQ0 A;  4URK A;  5LXH A;  3NZU A;  3CST A;  4KZ0 A;  3PVL A;  3PPA A;  2Z0D B;  4FN2 A;  2MLB A;  1WJ4 A;  3H1U A;  2IO3 B;  4ZRI A;  3ENE A;  4W9K A;  4A3O A;  1WR6 E;  4FUL A;  3RCZ A;  2CR5 A;  4HPL B;  3OJ4 B;  3OLM D;  2Y5B B;  2JUO A;  3VUY A;  2KN5 A;  3NZS A;  2CHW A;  2KJR A;  2KWV B;  3N30 A;  3WIM A;  2D10 A;  1VD2 A;  2MW5 A;  2D07 B;  4ZDV A;  3ZIM A;  4MJS A;  2WX1 A;  1LM8 B;  2O6V D;  3A4S C;  3JW0 X;  1WX9 A;  3PLU A;  4MGY E;  5D6J B;  1S1Q B;  2MX2 A;  4TQ1 A;  4ZRJ A;  1T0Y A;  3T8M A;  2B3A A;  4KSL C;  5AEK B;  2FUH B;  5D2M B;  3ZTC A;  4IM0 A;  1YD8 U;  2C5L C;  3EEC A;  2JWZ A;  1WF9 A;  3QX1 A;  4DXA B;  2MP2 A;  2Z59 B;  2K8H A;  3QCA A;  3TCA A;  2KNB A;  4XX5 A;  1RRB A;  1V80 A;  4W9E A;  2XEW A;  3QWZ B;  2N9X A;  2LD9 A;  4XZ4 A;  1JRU A;  1I35 A;  2MWS B;  4K7W A;  5AZG A;  1WGG A;  4E74 A;  2MBE A;  2KXJ A;  1RAX A;  2UYZ B;  4BKT A;  4HCN B;  4TV3 A;  4E71 A;  4KIK A;  4W9L A;  4AP4 C;  5DCN A;  2EKE C;  4X57 B;  3CF6 E;  4II3 B;  2KWU B;  4B6W A;  4IWO A;  3LJ3 A;  2DZJ A;  3ZRC A;  1V6E A;  2YLM A;  4P7I A;  4K81 A;  4AUQ C;  4M8M A;  4I6P A;  1P0R A;  2L00 B;  5C23 A;  3B0A A;  3A9K A;  3AU5 A;  3PRZ A;  4GU2 A;  4JQW C;  4BVU C;  1WXV A;  2AYO B;  2RD0 A;  4DHZ B;  2K8B A;  1Z2M A;  1E8X A;  2KOX A;  4FHK A;  5D7G A;  3ZW3 A;  2CU1 A;  2FCM A;  2LGX A;  2KD0 A;  2MA9 B;  1GC6 A;  3B1L X;  3MJW A;  4NQK E;  5FR6 A;  3VDZ A;  4LCD E;  3ZRF A;  2KFK B;  4NJ6 A;  4IC7 B;  2ZVN A;  3SDL C;  4TKN A;  4BKG A;  3QHT A;  4GXB A;  2IYD B;  4WWO A;  4IM2 A;  2N1V A;  2NR2 A;  2IY1 B;  3VTV A;  2M17 A;  1WRD B;  5AZH A;  5TR5 A;  2KX3 A;  3OJ3 A;  3ZNG C;  2NS5 A;  3UQA A;  1LQB A;  3EHV A;  2KLG A;  4GDL B;  1E7V A;  1GC7 A;  1TBE A;  1WM3 A;  3PRM B;  4GN1 A;  2NCN A;  1WGD A;  1WM2 A;  2V1Y A;  2KHW B;  3QC8 B;  1P1A A;  1NDD A;  1G6J A;  5IAA C;  2YVC A;  4GMV A;  2PE9 A;  1X1M A;  2JY6 A;  3DCG A;  3H7P B;  4MSM B;  4GIV A;  4BFR A;  2V3S A;  2DHZ A;  4LJO B;  1BT0 A;  3H6N A;  3VHT C;  1TTN A;  1D3Z A;  1KM7 A;  2IY0 B;  3UIO B;  4IWQ A;  4GDK A;  2RGF A;  2NBV B;  2G4D B;  2I1K A;  3IFW B;  2BYE A;  2DYO A;  3JSV B;  1YX5 B;  4W9I A;  1Q1O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...