3GP7A

Staphylococcal enterotoxin b mutant n23yk97sk98s
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
237
structure length
226
Chain Sequence
SQPDPKPDELHKSSKFTGLMEYMKVLYDDNHVSAINVKSIDQFLYFDLIYSIKDTKLGNYDNVRVEFKNKDLADKYKDKYVDVFGANYYYQCYFSSKRKTCMYGGVTEHNGNQLDKYRSITVRVFEDGKNLLSFDVQTNKKKVTAQELDYLTRHYLVKNKKLYEFNNSPYETGYIKFIENENSFWYDMMPAPGDKFDQSKYLMMYNDNKMVDSKDVKIEVYLTTKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Enterotoxin type B
publication title Contribution of the flexible loop region to the function of staphylococcal enterotoxin B
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Toxin
total genus 67
structure length 226
sequence length 237
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3gp7A02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3gp7A01
2J4XA 4RGOS 1XTCD 5FK9C 3BZDB 1EEID 4RGTA 1KLUD 3DWAA 5ELCA 5TSSA 2ICIA 2QEJC 4K6LA 1B1ZA 1LTBD 1CHPD 2O2LD 4O1NA 5D3IB 1YN5A 1L0XB 1RD9D 2CHBD 5ELEA 1PRTB 2R61A 5I4DA 1HA5A 1SE2A 1F77A 1D5ZC 1TS5A 1PRTC 4BWGB 2IPKD 1ET9A 1ENFA 2WV6D 1I4QA 2XNAC 1PZID 2QILA 4RHRA 2SEBD 1PRTD 1AW7A 3SEBA 1EU3A 1LTID 5D3DA 1BCPB 1B44D 1TS3A 2XRQD 4Z9CB 1SXTA 1LT5D 1CHQD 1LTRD 4RCOA 1PYWD 1TY0A 1BCPD 4RHSA 1PZJD 4ZYSA 1QILA 1V1PB 4DXFA 1PTOB 1FNWA 1LLRD 1S5DD 1LT3D 1ET6A 1PTOC 1S5ED 2XN9C 3EFXD 3V05A 3BYTB 1SEBD 4OHJA 1EWCA 1PTOD 4NZLB 1DYQA 2G9HD 1YN4A 3TSSA 3BVZA 1LO5D 1FD7D 4UDUC 1HTLD 4C56C 3BYYB 1ESFA 1I4XA 3BVGA 1YN3A 1LTSD 3DWQA 4L6TB 3R2TA 1PRTF 1JWMD 1CT1D 1TS4A 1KTKA 1I4PA 2XRSD 1T5XD 2RDHA 1EFID 1HXYD 4RGNA 1D5XC 3R8BA 1JWSD 1HQRD 1SJHD 1SBBB 1M4VA 1G8ZD 5FKAC 2Z8LA 1BCPF 1FNVA 1JQYD 3GP7A 1LT4D 5ELBA 1JCKB 2IJ0A 3URYA 3EA6A 2AQ3B 2AQ1B 2RDGA 1SE4A 1GOZA 1D6EC 3KLSX 1JR0D 1BXTA 1D5MC 1TY2A 1LTGD 1RF2D 1KLGD 3BVMA 5ELDA 1LTAD 4RGMA 1LTTD 1S5FD 1RDPD 1S5BD 1UNSA 2TSSA 1SJED 1UUPA 1AN8A 3CHBD 1CK1A 3MC0B 5ELFA 1EEFD 3MFGA 3R2IA 1LT6D 1DJRD 1JWUD 4DXGA 4RFBA 4RH6A 3W2DA 1TS2A 3OWEB 1V1PA 2NTSA 1S5CD 2AQ2B 1CQVA 1MD2D 1FGBD 1FNUA 1PZKD 1STEA 3O13A 1SE3A 1I4GA 1L0YB 1XXGA 1EU4A 1RCVD 4L63B 1V1OA 4TSSA 2NTTA 1PTOF 1BCPC 1I4RA 1PTOH 3DWPA 1I4HA
chains in the Genus database with same CATH superfamily
3OW7A 4NJCA 2G4SA 3APDA 5EQ0A 1SLJA 1KLVA 2QHOA 2PW9A 3UI3A 5A2QL 1H9MA 3ZUNA 4WWOA 5DPWA 5CHFA 3M85A 4J3OD 1X3EA 4KHPL 3L08A 3Q3JA 4ZK9B 4ULLA 4DQOC 5I4DA 1JMCA 3V6CB 4EOYA 3M3YB 3A33B 3TZUA 1YEZA 4A93B 4JQWC 1JE5A 3BWUD 2QILA 3AU7A 2CS4A 1XMQQ 5IWAL 1KJTA 4JI4Q 4LFBL 2MJ8A 4ZYNA 4A3DG 4A3LH 1K83H 2FCMA 2MHJA 3HK0A 4AP4C 5C3EH 1KD1C 3DDCB 1U4RA 3N20C 5ISRA 4R1JA 3S1RB 4ZUJA 1TQOA 1SNMA 1BCPD 4BBRB 1V1PB 3VQIA 2PQAB 2JX5A 2LMCA 2F4IA 3HOUH 2IX0A 1ET6A 2XN9C 4WJNA 3RMKC 1F9JA 3ZDTA 1XPUA 2B63H 2FINB 1TIFA 2KECA 2KQ3A 3NRZA 4C3IH 4A3IB 1WD0A 5EKLA 3J80L 5LMNW 4IFDI 1J19A 4HIDA 2KUMA 3BVZA 3KF6A 3RYTA 2TMPA 3CKIB 3DHQA 1SMYC 4XC2A 1I7HA 2KD0A 2HCIA 2D9UA 2VL6A 3MXPA 3ZTDA 1UWVA 1HNZL 1GHKA 4MM3A 3HOZB 4NB3A 3RN5A 2JYEA 3H91A 4HCPB 4KIKA 5GAEC 2BB5A 1R4NI 4UAIA 1E7VA 1Q1OA 1G6ZA 2B2VA 1LV9A 5EKIA 2MFIA 1SJHD 3PGZA 4GOPB 1SBBB 2CWPA 4E71A 1GKHA 3V2TA 1B2TA 2LUEA 2NB0A 4FNFA 2EZVA 2Z8LA 1K52A 1TKYA 5D65A 1LT4D 1C4AA 1HTQA 4JG2A 4KGSA 4IFDH 3HM3A 5M5WB 2N88A 5CBEE 4M0WB 5KIXA 3TIXA 4LWCA 4A3BH 2VUMB 4KZCA 2I38A 2GBJA 1IBKL 4C00A 4W9CA 3ER0A 3PGEA 4BKGA 1CQFA 5IYCH 2ZTDA 1N60A 1NVID 1UD7A 2KX3A 5BO4B 3TEZA 3AYHB 3GE8C 4JPSA 3DUZA 1LTAD 5JPNC 1T0YA 3T13A 4JE3B 1X32A 1EY0A 1ZPSA 2A1AA 2F4VL 2D2QA 2KYWA 1TWCH 1NE3A 1RDPD 4K8IA 4KJOA 3SK6A 1AYFA 2TSSA 1XQQA 2G45B 2KQSA 2REXA 4ANWA 2MO0A 5IP9H 1EIHA 5BMIA 4YSZB 2JRIB 1GHJA 4JI3Q 3QIJA 3AEFB 4IURA 4DXGA 2A73B 3JAME 3HG9A 4RFBA 4CKBA 4DR1L 4ZHPA 2O6VD 4JI5Q 3BG3A 1MJCA 4IUTA 4R4IA 2EJFC 1H9JA 4EVOA 4QQBX 4PZ8A 3FKIB 4ARIA 4JC0A 1K8RB 3APFA 4XYCA 2WKDA 4QF4A 1QVCA 2BBCA 1XLQA 4KY5A 1UH6A 5JVG3 4LF7Q 4A3LG 1VMCA 3GTMB 2B2UC 3S2DB 2WAQB 5FLXE 5IY0A 1ISNA 5IT9E 5H92C 5C3EG 4DK0A 5KNCA 4K5VA 4DAMA 2ATWA 2NVTH 2EY5A 5JPMC 3P63A 4R3DA 3HKZB 4HSPA 2E2IB 1ML0D 1B8AA 5ELCA 1WGDA 4A3MH 1TWAB 2M2LA 3I90A 4DR7Q 1GUSA 1NBFC 1WSPA 3I4LA 1GUTA 4XQJA 2O2LD 2K1FA 4KVGB 4MH8A 3RD2A 4I6PA 3TEWA 2KCTA 5ELEA 1WGYA 5KHOA 4DAYB 3ZKJC 1VCIA 1ESRA 2F0IA 3TBIB 4GKKQ 2K5NA 1ET9A 5C3XA 5A2QE 2R6GA 1GVPA 3J7YW 2QA4A 2ZXRA 4LK0M 1Q12A 3EIVA 4PZ7A 4GNXA 4L23A 1GD7A 1BCPB 4A3PA 4DV5L 4A3GH 1MHXA 4F7ZA 4P74A 5T1GA 4XT3B 1SXTA 4NXML 2WU5B 2M0AA 1PYBA 1SFOB 3UF8A 1VQOA 5LL6X 1U5KA 3HOVH 3IAYA 3KLSA 3CPFA 3H7PA 1S5ED 5FR6A 1SIJA 3I57A 4IFDG 5D94A 1I50B 1UGJA 4A3BG 1VQCA 1J9OA 4A3FG 2WLBA 1EWCA 4WJOA 4A3CG 2LY7A 2A68C 3I8ZA 1Y1VH 5IYCG 5HFYA 3IFTA 1WXAA 4WJWA 3TSSA 4UDUC 1B4OA 1XNRQ 1Y8RC 4JL9A 1LTSD 3ENEA 2E74C 1X1MA 4KY7A 1HNXQ 2HE7A 3QG1A 4HJ7A 5I6YA 5IP9G 3I4MH 3W5VB 2J7ZA 1YVCA 4DAPA 4EX5A 3CCQA 5GXGB 4EZLA 1PLFA 3MXGA 4C4VA 1A5RA 1EF1A 3ONSA 2XWJB 1V8CA 4DXAB 1XNQL 3S17H 2N9KA 1WE7A 3CF6E 4AWJA 2BB6A 3URYA 4FHKA 1FCCC 1P7FA 1CUKA 3EA6A 1WWTA 2MQJA 4PS3A 2EYFA 2IX3A 1IGDA 4JOIA 1A2UA 1R4PB 1NI2A 2Y0SE 1SF0A 4G7ZC 3VRBB 4DV2L 3VH4B 4YSXB 3J9CA 3TRZA 1D5MC 2I1KA 3H15A 1XEEA 1F0ZA 4ZLTF 1E7ZA 2K4KA 5C4ZA 4FBJB 4H13C 2E2JH 5CGKA 2UU7A 4DNRB 2N55A 1LTTD 5DAUA 3HOYB 4W9HA 3T1YL 1P8LA 4O42A 5C0XI 2IO1B 2CHZA 2O6VB 1K50A 1L0VB 3MHBA 2PPHA 1KDCA 1N61A 1RRBA 1SIFA 4A93H 3PHWB 4C3HB 4NP5A 4YXDB 2BS4B 4DK6C 2Z1CA 3PUWA 1YX6B 2LI5A 3U4ZA 2ES2A 4BOZB 2FMMA 4MACA 3KLRA 4HPMB 1OXUA 1PZKD 2J52A 2FAZA 4GSWA 3S1RH 1WIAA 2MWSB 1RCVD 3AN1A 3UI2A 2DY8A 3WAMA 3A9JA 2ZTCA 4KKJA 4N9PA 4A3GG 5C0XH 2N9XA 1EY9A 4TMAB 4PK1A 3M4YA 2NS5A 3BS1A 4G57A 5G5HA 2KKCA 5FK9C 3ZQ4A 1VDVA 3L0OA 2OTLA 2D3CA 2OTJA 1LUZA 3WDNA 1A2TA 2A6ED 2Y5CA 4W9KA 4BY1B 3A56A 2UXDL 1JJGA 1WR1A 3L2PA 3B2FA 2C9OA 3UQBA 2X38A 3CF5A 1FJGL 2L3ZA 4DR5L 3I7FA 4HMJA 5JJIA 1C9OA 3D4RA 5DM63 4BKTA 3TREA 1Y69U 3MA2B 1Y1VG 3L3OC 4NY0A 4A20A 2HDEA 5J3BA 2KDFB 4OWTB 4BOSC 1EM7A 4UP9A 2WDTB 1HR0L 4J6HA 4EGVA 1G2TA 4JI2L 2JYTA 3SFDB 5BMHA 1X3GA 2RCNA 2CHWA 4GOCA 1YQ4B 4RKLA 2WDVB 4QIWB 2BDOA 2VNUD 3FHWA 3LYYA 5M5WH 4RHSA 4P71A 4G7HC 2NVXB 1RYJA 4JI7L 2BYVE 2F0EA 4B3SL 3IFDA 4Q0FA 3L4PA 2B2WA 1WGGA 1ILPA 1NEKB 2JZPA 1N8RC 3P4PB 2YV5A 3KUPA 5EPKA 4K7SA 4LNNA 4YL8A 4OWWB 4H0LC 1V9PA 3TJPA 2DZKA 4XWTA 3IBEA 1BF4A 4TQ0A 1T3QA 1LTLA 4IWOA 1VQEA 4EFOA 1OFFA 2JZ3B 3V60A 3CCJA 5KGUA 4LJPB 1C9FA 2K5DA 4IM3A 2A68D 3CQZH 3UE1A 3LJ3A 3NEMA 2HJ8A 2K8CA 3ETRA 3T16A 2GVBA 4L5SA 1Q81C 3NWSA 3FKYA 1MI0A 3OAWA 4RMAA 2ENBA 2RDHA 2EE1A 3GTLB 1WJ4A 4ANVA 3ONAB 3PIOA 4DNIA 4P1BC 3P75A 4XQNA 5JHAA 3X3MA 4YY3Q 2EY1A 2IJ0A 5M3MH 1R4QB 2FJ2A 3OMGA 3AQQA 4WORA 2XIWA 4I65A 1BBWA 3VUWA 1MJEA 1SE4A 2LSSA 2HT1A 2UUAL 1D6EC 3GTQH 1QLBB 1KM7A 1RWSA 2RSNA 4ID6A 2WB1G 1QZEA 3NTIA 1NNXA 4HJAA 2KJHB 2ZZPB 4QJFA 5M3FB 5C0XG 4DUYL 1TWAH 4ZRIA 1VQJA 1NENB 4A3EB 2R7ZB 2OQ0A 2M0XA 2LGDA 1S5FD 2DY7A 1K8AC 4WH4A 3TL5A 2D0PA 4GDLA 4Q2JA 3OWFA 4JWSC 1EOTA 1ZOYB 4IQZA 2N4FA 2F1MA 3VYTA 5LL6S 2R3ZA 4Q5VA 4USAA 2GBRA 2VZAA 4BFRA 3OWEB 1GO3E 1LYLA 2AWNA 4DV6L 1T5EA 3Q22A 3DWMA 4IW0A 2WYQA 1V5TA 5C4XG 2O4XA 1SE3A 3APCA 3NBHA 2UUBL 1R9TH 1SFOH 2GN5A 4TSSA 3ML9A 2B2YC 1RIPA 4DR6L 2W3SA 1I4HA 1GG3A 3H3VI 4K0KL 1XPRA 1I50H 3C2PA 4LF9Q 3ZJUA 4A3DB 4BS9A 4LCDE 3OJ3A 1JE4A 4K14A 1MI2A 1B1ZA 2B76B 4PS8A 3RUZA 3VR3A 2Q2TA 3C8YA 4B95A 4R4OA 2PEAA 2J0MA 2D2CC 2EQSA 2PNRC 4P75A 2Z0SA 3UDIA 1JB7A 3GS2A 4GKJL 2L00B 3NK9A 5EE1A 1ENFA 5F2DA 3DQVA 1D1IA 4CDDC 5LMNL 4A6QA 2MBBB 2IO3B 5H8YE 2G5DA 2SEBD 1S40A 1W6JA 1XX8A 3ULJA 2K22A 3CSTA 1ILQA 1TWFH 3P42A 4QCLA 2YU9B 3SDLC 2MQHA 1F2MA 1AE3A 1SNCA 3U58A 2K75A 5GQOA 1VQ6A 1B44D 2MBHA 1VZ7A 2QKIC 1QOHA 2KOLA 5DLQE 2OEDA 1VQ5A 5KNBA 1S3SG 1WM3A 1BNZA 4XX5A 2HIXA 4EEWA 3K6OA 3BDLA 2YLMA 5E4WC 3PSEB 4ARCA 5MPOA 1SYCA 5M3MG 4R4CA 3V05A 4HROA 3RR5A 1EFWA 1FXAA 3BYTB 3OMCA 4P2CB 1UEBA 2KT7A 3RNCC 3GD7A 3N6RA 4LF8L 1L4DB 4JV5L 3EROA 1HPCA 2BT6A 4YCWA 2KXJA 2RPQA 5LXHA 3QWNA 3BYYB 3NQIA 3K5LA 3A9KA 1UBQA 3AE7B 1UAPA 1UEAB 5C44H 3EECA 3PMFA 2QF7A 1CT1D 2VQFL 1WTQA 2F0SA 4FVMA 3KLWA 5IGFA 4C3HH 4LF6Q 1YNXA 2K03A 1PH7A 1PDXA 2LHDA 4I6NB 5AZHA 1A3VA 3AEDB 2EY6A 4YCUA 1K3BC 2ZTEA 1I94L 2EXDA 2LXKA 5E3FA 2Q8IB 1QCBD 3TMEA 3I3CA 2F3IA 1QB5D 1WGHA 2JQRB 3W5UB 4A4IA 1FFVA 4NQKE 3JAMc 1J8IA 1MBYA 4X64L 1ZP0B 1WR6E 4L2YA 1R7SA 1CSQA 1IBMQ 1TGZB 4PMBA 4MGZE 3ZRFA 1H9RA 2BOSA 1IKLA 2UU9Q 3N52A 4HKQA 2KEDA 4WIPA 2KWVB 2WU2B 1WTWA 1OO9B 2F52A 2F0LA 5FLXc 3HOXH 1DONA 4PT5A 2AUJD 2SDFA 2LMCB 4LFAQ 3F2DA 5E6OA 1O7IA 1S5BD 1UNSA 2WWZA 2JJQA 1UUPA 4ME3A 1LXDA 4B0EA 1KOTA 4X65Q 1AN8A 1SYGA 3MC0B 2YEPB 1K83B 4K6DA 4ACFA 4ZQ3A 2JQOA 2MEKA 5C3EB 3DHIC 3B6YA 5C3JB 4GN4B 3G6EA 2NN6I 1J0GA 2WIIB 3CW2C 4RH6A 4OGQC 4O0AA 3VR6A 3KF6B 2ZM6L 1EIFA 1WFQA 3E9IA 4NPSA 5C5MA 5IGBA 1P9DU 1TKEA 1D7QA 4MGYE 5CC4A 2X6GA 4JI1Q 4ZCKA 4K7UA 4G0NB 4R4TA 4MM3B 4IZ8A 4FN2A 1JOQA 4MJSB 1XMOQ 1HCZA 1STHA 1KL9A 2QGQA 3E9SA 2FHTA 3PO3H 3NELA 2KC1A 3V61A 2NVXH 1E8XA 3DVGX 2MBQA 3AU4A 2HDMA 4HJKA 1VQHA 5JEAH 5JHBA 1QZGA 3W1GA 3PRPB 2EYJA 4KKUA 3AE9B 5KYLA 2BDNA 1JJ2A 3NVYA 1SROA 1UE7A 4YHHL 2NN6H 2PIAA 4ZRQA 5CMDA 1WY8A 2AL3A 1F2LA 2JN4A 4AQYL 5AZGA 1OXTA 1N34Q 1JQ4A 5CV7A 3IXSA 4NJ7A 3HFZB 4DDID 1FFUA 4A3KG 2K33A 4RCNA 3RUIB 1KXLA 2NCNA 3AMZA 4JLCA 4KLKA 5G5GA 1LFDA 2KC2A 1ASYA 4TKOB 5C44G 2E2HH 5EGTA 1BMLC 4A3BB 4HPLB 4A3FB 1E8WA 1HZBA 4EQ5A 4FP5D 2CWAA 4X66L 3CC4A 1QOBA 3D3RA 5FOBB 3J80c 1QOAA 1F9RA 1YMHE 4RMFA 3AB5A 3PIPA 3DMUA 1IUEA 2KVZA 2PMZB 1L5PA 4L8JA 2MH7A 1FM0D 1S5DD 1R4NB 4S0RA 1WVLA 1WYGA 4KMUC 3L7ZC 2D10A 1Q46A 1JROA 4XYQA 1TWHB 4C2MB 1L7YA 1SEBD 4M8NA 4AH6A 2LGIA 4B9KA 1PV4A 1CM9A 4A3EH 1DYQA 3F2CA 3TN2A 2KAJA 2D3AA 3M63B 2C60A 3PPAA 4U68A 1KNEA 5HY6A 2Z4IA 1N33Q 4HKZE 3HOXG 3U7ZA 1PRTF 2OEOA 4RG1A 1C4CA 1TS4A 3S9WA 2MO1A 4E74A 4H2AA 3LNNA 5D14A 5IOCA 2R93G 1K73C 3LB8C 1D5XC 4DV0L 1HQRD 1H9KA 1PFBA 2VXWA 5J39A 1WTHA 3VDZA 4HJ5A 3I2ZA 1I6HH 1G2SA 2NVTB 1NI3A 1E9MA 1QNUA 3BU2A 3MTNB 1A0IA 1JQYD 3GP7A 4DKAC 3GTGH 1IYVA 4R9WA 1E24A 1Z6HA 4FXDA 2WP9B 2Z9HA 3AE5B 2RDGA 5LHY1 2JWZA 1PVOA 2K5WA 2F0JA 3PO3G 3BZKA 2RSUA 2OQKA 2EYHA 5AJ3Q 3L10B 1V49A 2RHQB 5JEAG 3S24A 4IM2A 1M8AA 4HCNB 3C19A 3NZUA 3ZLZA 2DX5B 3CHBD 4AJYB 2NN6G 4LF4L 1TWGH 4KHZA 3EGRA 3RNEC 5A35A 1DJRD 3RLNA 4A3GB 3PZ8A 4KJNA 4CGYB 2FCNA 3H3VC 1JORA 2GMIC 4N58A 5CR3A 1V97A 3K7UC 2EJGC 2GBNA 1A3TA 1VQMA 2QW7A 4LF5Q 1V86A 4N6EB 1OXVA 4JI4L 1QNKA 4FF1A 1FMAD 2OJRA 3HS0C 3MXUA 4CBVA 3D6CA 4GXBA 5AUKA 3TP8A 2DGYA 4PV1C 3PSIA 4QY7A 1ZYRC 3TUOA 2R2OA 1Y1VB 2KA7A 2DAJA 4EUTA 2MSED 2AWOA 2WAQE 4AUQC 4G3XB 4GLVB 2D0OA 3U50C 1MHWC 1PFNA 2BS3B 2BYTA 1IP9A 2VH2A 3HEJA 3HKZE 2G9DA 1L0XB 1PH9A 1HNWL 3I5JC 2EYLA 3A8JE 4J1MA 1F77A 3K58A 4UP8A 2VH1A 5IODA 4BWGB 2IPKD 2K5HA 4P72A 1YJWA 3RZOB 3SXHA 2A4ZA 2JF5A 4H02A 2H88B 4A9AA 4ASWC 4HCEA 2GLSA 4NAWA 4M1UB 3S17B 5J18A 3MVVA 1ONLA 3GV6A 2JVCA 1GB4A 1KRHA 2LWPA 4LNIA 1N32Q 1AZQA 4FHJA 3OIPA 1ACCA 1DOXA 2PZUA 2IZVB 1ZEQX 2N49A 2XWBB 2B8FA 3QQ8B 3PUZA 2E5LQ 2LVPA 4X3TA 2JA8H 1PYWD 1VQGA 2N0SB 1U4PA 5G55A 1QILA 4DXFA 2JPHA 2E2JB 4RNAA 3VR5A 3NY5A 1DOMA 1Y8PB 2F0DA 1LT3D 1CKNB 3KUDB 2K1BA 5GMVA 3I73A 3HKSA 2NYZD 3H0GG 1OXXK 4DUZQ 3A9JB 2NUCA 2H1EA 2XSCA 3RI7C 2GBKA 4P7IA 3KW5B 3IL8A 3NBIA 1JALA 2M8SA 4HEA1 1YN3A 3BVGA 1ZDXA 5G2NA 1QVFA 3F2UA 2BWFA 1SSOA 2LFIA 2Y0SG 4JI8Q 3PV1A 1MVKA 1IKMA 1B3QA 4L6TB 3D32A 3J7AV 4NQLB 2BF8B 2N9EB 2AYOB 5EE3A 2RD0A 2O2VA 2WB1B 4I7AA 4MELA 4DV1Q 1HJPA 4FA6A 5IP7G 3VYUA 1NMFA 1M4VA 5KRUA 4XYOA 4JI5L 3E0EA 3AE2B 3AXCA 1H8CA 4G7OC 1P3QU 2F0UA 2RQXA 4L5QA 3Q24A 4HK2A 4IWPA 2LVOA 4HRSA 1FXIA 1PHJA 4HTHA 2RDFA 2JY6A 4YTNB 1MSGA 1A6XA 1JR0D 3QIAA 2OWOA 3C3LA 2G3QB 4MTKA 2L4NA 1YJNA 1YI2A 1V2YA 3TP6A 3LXFA 2UXCQ 1YHQA 2E3TA 2W55A 4B9XA 1YJIA 5JAVA 3RZDB 1Z9FA 3CCEA 2RGFA 4GLAC 5C4XB 3D6WA 4MJSA 1WM2A 2V4LA 2E76C 4PMWA 4IUQA 1CK1A 4IG7B 4X3KA 4ZOHC 1HUMA 1X56A 4UP7A 1O78A 3T1HL 1R4MI 3U2SC 3NS1A 1TT2A 3AH7A 1BUIC 3CIRB 3QWZB 4GKKL 2KDMA 1HTOA 2D07B 2LGYA 4HIKA 2KTFA 4K3CA 4M01A 4MNOA 4AQ7A 3NZSA 2D3GA 1FNUA 4A3FH 3DBRI 5IOIA 3G71A 4A3CH 3N32A 4CYEA 4CQNA 3A7AB 5IYBG 4UY8C 2KZRA 3CMAA 3S1NH 1YIJA 5FO7B 3J81L 2L11A 1EYCA 4IKGA 4S3SA 5AUIA 2ZPNA 4TUUA 2JA8G 1WXVA 3HOWH 2BA0A 2LXJA 1TWHH 2PMVA 3KUZA 4K1RB 4C2MH 1FVIA 1VF7A 3CMEA 2LUMA 3CQZB 3HGBA 3B9JA 3VFKA 4FXCA 1PFSA 3PIO3 3Q3NC 4BZAA 4K6LA 2KTRB 4DR4L 1YOVB 5EE0A 4BA2I 3I70A 4B3RL 4X3UA 1STNA 1SE2A 3T8MA 4WJ3M 3FAHA 1WXSA 3Q14C 1F2ZA 4KV2A 4MSQB 5FR3A 1RJTA 1XNRL 3GZNI 4A90A 2EYMA 5M3MB 1UE6A 5E1FA 1WX9A 2MP2A 2KFKA 4GDLB 4EE2A 1A62A 3UINB 3VYRA 2B3GA 1HNXL 2KN5A 3MAQA 2VY3A 1FR3A 1STAA 2ACZB 3GTQB 3UQAA 3PF4A 3NPPA 4YSYB 2JP1A 1GPXA 2K14A 2M1MA 3RPFC 4IALA 3VHTC 3K7AB 4TKNA 2CQAA 2A19A 4XWWA 2K32A 4JI6Q 4MN3A 1SYFA 4V0BA 4GDKA 2C9WB 1OXSC 2JT4B 3M7GA 3P4RB 3NBHB 3ZXVA 2P5ZX 1YJ1A 1BO0A 4II2B 4MSMB 4A3OA 1GB1A 2G9HD 1J5EQ 3ZJTA 1LO5D 1VF5C 3ND9A 2VZKD 2O5JC 1JICA 2X6LA 4N59A 4YTMB 1NR4A 2NVYH 3TS0A 1C7YA 3VXWA 2J7QB 4GU2A 2EY2A 3QARA 2ONQA 3ZRCA 2DNFA 1KTKA 3U52E 3M7NA 4E3CA 3CCLA 2PQEA 1R9TB 1QQRA 3SU8X 1IL2A 2NBVB 3QX1A 1X3QA 2KANA 3KYCD 2L55A 4YWKA 2RSOA 2IWHA 2E75C 2F0PA 2AQ3B 3Q8EA 5ELOA 3NG0A 1IBKQ 2Z6KC 3ZJYC 1CA6A 3AV8A 1A70A 1PXUA 2ALYB 2JE6I 1K8OA 3GTKB 1PQSA 1WF9A 2HJ1A 1PH2A 2KNBA 3DBHI 1CKMA 4JBJA 1VD2A 3W1SC 1KLGD 1EY5A 1SDFA 5BN5A 2Y5BB 1Y8NB 1M94A 4IC7B 3FILA 4O2DA 1CZWA 3J80E 3HOWG 1SMYD 2B2YA 3IRBA 2IGDA 3VAWA 2M00A 1KDBA 2F3WA 2F0QA 2QCPX 4B3TL 2M9VA 1TWFB 3IKJA 1C77A 1P16A 1QOGA 3K9OB 1IPGA 3RZOH 3UGBB 4IDIA 5LLIA 1J7AA 1BT0A 3BK1A 3Q3OC 2WXGA 3BZCA 2ZW1A 3KFUA 3L0WB 3RN2A 4IPDA 1X6OA 4CDEC 4BXXH 1Q86C 3A9KB 2DNCA 1S5CD 2BPSA 3NVVA 1W3SA 1N62A 2J0TD 4DK3C 3BDCA 4DNTB 4WWNA 1XLOA 3Q8DA 1QF6A 1XXGA 1DCZA 4PNYA 5GROA 1OTRB 1S3OA 2YTXA 1MSHA 1I5FA 4ME5A 4B3MQ 5FLMH 4JBWA 2SNSA 4S17A 4A3KB 3OOCA 4WFN3 4DR2Q 1ICWA 2Q2UA 2H89B 3DHGC 4GGQA 2VW9A 2MA9B 1E5WA 1PYSB 1AFPA 3CSFA 3JYUA 3TMPB 2KBNA 3U4VA 3U9OA 5C44B 1GAQB 3NUHB 2PJHA 3STBC 1I35A 2RKSA 4YTPB 3A1QA 3N9YC 1X9NA 3K5MA 1PGAA 2IY1B 3F2BA 1JOOA 4L1BA 3CC2A 2WX1A 1Z47A 3KF8B 1Q10A 2JSVX 2WS3B 1K28A 4XTCS 1SYEA 1WGRA 3PHXB 4RF1A 1CKNA 2VQEQ 1N5WA 4XT1B 4US8A 1Y8OB 4XIGS 3SFEB 1SSNA 1VQDA 1UF0A 1SNPA 1HA6A 3HVDA 4E6IA 4DV5Q 1IHZA 2NZHA 3DEPA 1TU2B 5HGQA 4NXMQ 1VZ8A 1E0ZA 4DV4Q 4IUUA 1VQKA 5DM73 1V1QA 4HAEA 1ZXHA 4ZYSA 3OTOL 5L83A 3JAMi 1A15A 4A75A 2ZVNA 3WCQA 2KJXA 3OHXC 4CHTB 3M3JA 3KBXA 4YY3L 3AULA 1EQVA 3EUB2 3HOXB 2N7EA 1PTOC 2VZKB 3EFXD 3IVFA 4DR3Q 2PE9A 2LJ5A 1QZHA 1F2YA 2R93B 1S1QB 2QCZA 1AH9A 3RCZA 2PI2A 3U30A 2JA7G 4MGIE 1HUNA 5NUCA 3RZDH 3W3AA 1I6VC 2W9NA 5C4XH 1ESFA 1V43A 3CCVA 3MXNA 3R7RA 4AJWA 2AHOB 4DV3L 4KV6A 3M4OH 3HIZA 2L8JA 2JEAI 1XD3B 2WXKA 3HUIA 2KLCA 1I42A 3MEHA 4JPBW 4FADA 1RL2A 1GM5A 2IGHA 3QA8A 3G7LA 3I55A 4BKSD 1S4ZA 3Q23A 3PO3B 2HUGA 4DHZB 1VQIA 2H5XA 2MW5A 4FXGC 2KVRA 2PNHA 1BR9A 1XNQQ 3BK2A 1E3PA 1FO4A 2A69C 2AX5A 2EMSA 3H6MA 4BXXG 1KF6B 4G11A 3KYDD 2DZMA 4KKSA 3PS6A 1C76A 1FEHA 1GOZA 1NMGA 3EBEA 3LWUA 3BIID 3T56B 2WXHA 1H9SA 3A74A 3AE6B 5GAGC 3VR4A 3BVMA 3F8TA 4KKTA 2K3UA 4JGHB 5FLMG 1VQAA 3D0FA 1WYWB 4LLGM 5DNFA 5IAAC 3RULA 1LM0A 2C7MB 2L5TA 1VQFA 3Q6SA 4LF9L 4MEMA 2BH2A 3N1YC 2E2HB 1FGUA 4JBMA 3PIP3 5J1ZA 1JWUD 4JI0L 3GTPH 2PE6B 3HM6X 3A8KE 3RLFA 3W2DA 5J22A 2C7NB 1YBYA 4NNJB 2XVSA 2KTRA 5DPTA 1JC7A 1P98A 1WJJA 4CJ0B 1XCTL 2IHFA 3SR1A 2QSDA 3UIPB 1I4GA 3ZYYX 3NP8A 4DFAA 1GC7A 3FVQA 1L1OC 2QIEB 1EIGA 4L63B 3J80i 4RA8A 1PTOF 5T1IA 4YWLA 3ITPA 1H95A 3HHMA 3AEBB 3K7AH 1PH1A 1GC6A 1WXMA 1BBXC 2CHXA 4MDKE 3QK0A 3RZWC 4KSKC 4X57B 3KDFA 1F9QA 2OT2A 3DWAA 4I6LB 1CTMA 2PPBC 1K0SA 3AE4B 4GN5A 1L6VA 5FO9B 1YNNC 1Y14B 4HIOA 1SYDA 1NYQA 2CVRA 4CHKA 4JYAQ 3RMHA 2V9HA 1RD9D 2CHBD 1CZGA 1F1HA 1FJGQ 1Y56A 2KWUB 1UWMA 3QHTA 3STBD 3GTOH 1TJEA 1SRUA 1UE1A 2ZJDA 3A8IE 3KOJA 4GN3B 2INNE 2LRUA 1I6HB 4MGKE 4IPCA 2BA1A 2B8GA 3IFWB 3TCAA 2F0NA 1EU3A 1G291 3GTGB 3H8HA 3Q3FA 4FYDA 1WCMG 3I56A 3H0GB 4ITKA 4FF4A 4JI2Q 1FRDA 2K50A 4CKEA 1MPEA 4EQPA 3ZW3A 3H94A 4HMIA 2JA6H 3HRZC 2ZJQA 1PZJD 4OZAA 4JI7Q 3R3OA 2Y0SB 1Q82C 1V9JA 4MHEA 2PYKA 3SK4A 3GTKH 2BYFA 2C5LC 4NXNQ 4HPPA 3A5UA 3R7QA 2PVOD 3ERSX 1IBML 3TBLD 1PTOD 4RM9A 1TWGB 2N3SA 3MTSA 2UU9L 4AYBG 4QL5A 1STBA 3AE3B 3SVMA 2MHVA 4PG3A 1U4MA 2MX2A 4NPNA 1YNJC 4TRDA 2BS2B 3DWQA 1HTPA 4KTAA 4LFAL 3PZ7A 3H3VH 3GOEA 5DCNA 5E6JA 2DYMA 3G48A 4A8XC 4WWMA 4KD3A 3ULLA 5I9PA 1E2ZA 1JRPA 1OEYA 3N1ZC 3Q8AA 4AIMA 2XRSD 4XGAB 1T5XD 2WFWA 2F0OA 4OELB 1CKOA 1JWSD 3W5OA 2K6DB 3L54A 4A3JH 4II3B 1FIQA 1E2VA 1KFYB 5L95C 3H1UA 2K01A 1XCQL 2KX0A 3CD6A 3A4RA 3VTWA 2OHFA 4NAWB 2GBMA 3D4WA 2E8GA 4IO9A 2JSOA 4JI1L 3H9DA 4MZ9A 5G3LF 1W2BA 1EUVB 2WNMA 3NTHA 2KJ6A 4CKCA 4A3KH 2L52A 1XJVA 2WGSA 2GA4B 2CU1A 1WTXA 3KBGA 2AEHA 1RLFA 3JSVB 3Q6BA 4H44C 1KH0A 1LGRA 4DUYQ 4JBKA 2BQQA 3P1HA 3C46A 1EOVA 2F0TA 5EKKA 4DV7Q 2K5PA 2MJEA 3PT2B 2L32A 1ZKOA 3OIQA 2RMMA 2KLGA 2XGTA 3DWGC 2ZCBA 3ZO5B 4IUPA 1EZ8A 5KYIA 2KO3A 2PO4A 4J6IA 2V3PA 3NJTA 2Z0EB 3E5SA 1LT6D 4WQOB 1QWYA 1N34L 3PLUA 4IM0A 1VQ9A 2YTVA 2JU6X 3I63C 1FRRA 2JA8B 2CQOA 2KQ4X 4DV6Q 1EZ6A 5GAHC 3DM3A 4OZBA 3MC9A 1GUAB 2L15A 3NVZA 3DBSA 2BWES 1RHPA 2HQEA 5IE8A 1YX5B 2PKOA 5CHWA 3KF8A 2HDLA 4NW2A 3SR6A 2O2VB 1FYCA 3AMUA 5FO8B 4DR6Q 3FDTA 5HI1A 1GJXA 2M19A 2UYZB 1HZAA 3QOJA 2V4IB 2K6AA 1XPOA 4ANXA 3T53B 2JA6G 4TVAB 3W1YA 1B3AA 2R93H 3VUYA 4LJZC 3EJIA 2R7FA 5G3LD 3VYSA 2R92G 1BKBA 3S14H 4BY7H 1CHPD 2WXFA 2PCFB 3S2AA 4AOFA 4ZHOA 4OX9Q 4PS7A 2FCQA 2DAFA 2R61A 4DBGA 2NBFA 1WI5A 1YJ9A 1PRTC 3DBLI 4GKJQ 2EOTA 4K81A 2V3SA 2DJGC 5LMNQ 3Q8CA 1JRUA 3ZIMA 3EQLC 4K7WA 5D3DA 2CFMA 1N33L 4KSLC 4DDGD 1E22A 3FPUB 1WTVA 1LQBA 1TS3A 2Q8RE 2N9LA 4K5XA 1KC8C 1IBLQ 4DK1A 2IBIB 2G1EA 4OONA 2IO0B 2XK5A 5BMGA 1Q0WB 4KHVA 1ICFB 3FP9A 1PTOB 4A3JG 1EYGA 1FNWA 1LLRD 1SR3A 4GOPC 4NDXA 2K28A 3EFUA 3HRDD 4KZ0A 2PW5A 2D62A 1KQSA 3SK8A 1MG4A 1SYBA 4XXEA 1EY4A 2DYBA 2SNMA 2FE8A 1J6QA 2UUCL 3PO0A 1WI0A 4JV5Q 4FJVB 1VS0A 1HTLD 2UXBL 1NJIC 3EHVA 1EQRA 1WE6A 2FBWB 1N36Q 3QR8A 1V5OA 1XTDA 1FD6A 1IYFA 3TP7A 4J15A 1PUTA 4IPHA 1YJJA 2DLBA 3MHSD 3Q0AA 4XQQA 5E6NA 1LABA 2KEEA 4XDCA 2V0GA 3J81j 1YNJD 3S1NB 3NQTA 2DN8A 1IW7C 3G4SA 3VDYA 1T9HA 2ID0A 3TZDA 4K2KA 1K51A 1FNVA 5CBAE 4OVVA 2HIVA 2WB1E 3HOWB 4P73A 1F52A 2NPTB 4LF5L 1R4MB 5BR8Q 2L83A 2AQ1B 1RKNA 2F0WA 2WQYB 4FJZA 2MP2B 3LX0A 3WWVA 2KFKB 2DBYA 4JW0A 2PLPA 4REZA 4BBNF 2VB3X 4R4QA 4R8IA 2B2TC 3QC8B 1JWAD 3DBRB 1KABA 2CCZA 4LMQD 4RGMA 1VRAB 2GVAA 1MHHE 4DA2A 2HHHQ 3Q2AC 2LHEA 2KENA 4GDKB 2K05A 3BINA 1BDOA 1KHIA 4LDTD 3MFGA 2N7DA 3WA0A 1ROEA 4BY7G 1YNTE 4PQXA 3J81c 3PVLA 4HIMA 3J7A5 2HTME 2K9XA 2N1WA 3D31A 4LUVA 3K9PB 3GO5A 5E6PA 1H4RA 4M00A 1N6ZA 1UZXB 1FGBD 4K3BA 3H0GH 2F0MA 1TZ1A 4C80A 4AS1A 4M8MA 2I5MX 4CO7A 3NUCA 1N32L 3OPOA 4KI0A 1BCPC 1CZPA 2DJFC 3GZNB 1ZKHA 5BN4A 3AEEB 1BVSA 5J17A 4P1CC 3I4NG 1L4ZB 4KGTA 3BZDB 2INDC 1EEID 1KLUD 5TSSA 3M9BA 4QMGA 2NVYB 2VB2X 2NBUA 3S1QH 1U4AA 3PRMB 3TP5A 2RF4A 2O5IC 5IP7H 2MUYA 4LNQA 2LJIA 1P1AA 4LNKA 4AQYQ 4NKLA 1DGJA 1HZ6A 5LMUQ 4DUZL 5HURA 4X62Q 1XMQL 4RHRA 4APVA 3FILB 1P0RA 1PRTD 4ICUA 4XDDA 4LFCQ 1E0BA 1E7PB 1NTGA 2F0KA 2IW3A 2XRQD 3RNUA 4FO2A 2KDBA 3CRLC 1QJOA 2JA7B 1TR5A 4BKSA 4WRDA 1DM0B 3U7DA 5BYQA 1O7LA 3WOFA 1TBEA 1SE9A 1I3QB 2WXNA 1NYRA 1TXYA 1G51A 4C7ZA 1KAWA 3AU5A 5C3WA 2CJOA 4UHVA 3ZNGC 1BQQT 3GB1A 3ZTCA 4B6WA 2ZVOA 1Q3LA 1MG8A 4NZLB 3DCGA 3PCOB 2F0GA 1YZ6A 5IYBH 2Z6KA 2UXCL 2JYOA 4ZAIA 2FIDA 1FCLA 4OXPA 2JK8A 4C3JH 3VVWB 3W1SA 1JWMD 3DBHB 5JOBA 1K0RA 3A1QB 3PREA 1II3A 3JSVA 1OQQA 1TZOA 2K8BA 3NTKA 1TIID 4ZRZA 3JC66 3TQYA 4DV0Q 4IOAA 3MJ5A 5FKAC 3AEAB 4B0MA 1BCPF 3UDXA 1WOCA 1ZUD2 3A54A 5IT9L 2OJWA 1HFNA 3CP0A 2NVQB 1XO3A 4WJQA 5JEAJ 4GIVA 4HR7B 2Z59B 2AMCB 1DOKA 2IO2B 1BXTA 1QUQB 2C5CA 1LTGD 1RF2D 1E8ZA 1EL0A 3ZVVA 3WOEA 5CORA 1VZ6A 2W82A 2R7DA 4LDTB 3T9LA 1MIUA 2J42A 3CPWA 4HDOA 1RM6C 4ZKCB 2K8HA 1RAXA 4C7YA 4R8NA 5ELFA 1EEFD 4JI3L 4LF4Q 2KMAA 3N3KB 1D3ZA 3DM1A 4DK5A 3D8GA 1OTCA 5C4JH 1VQPA 1VLBA 5H1SE 2I0QA 2KHSA 3DHHC 1AARA 2BH8A 3VRAB 1Z7TA 4YWMA 2KN4A 3I72A 1YHAA 2PW7A 1CQVA 1EO6A 1E8YA 5CX3A 3MXNB 5TR5A 2C7HA 1GXDC 1V8QA 3S16H 3O13A 1QOFA 1L0YB 4LF7L 1SB3C 4W9GA 2DUDA 3EFCA 4LTUA 4H7BA 1L2NA 2RVLA 3AI5A 2EKIA 5HG2A 3KJPA 4MTNA 4GLSC 4DWFA 3R66C 3S1MH 1PTOH 2JA5H 1U4LA 1KIXA 1TKWB 2D5GA 4QAYA 1EY6A 3H7SA 2BKRB 5C2TB 3VR2A 3PTFC 1WTOA 2N9PC 3V6EB 1EQTA 2JA9A 4RGTA 2KCCA 1PDQA 4RWSC 2D5DA 4DR7L 4JI6L 3M4OB 1WCMB 4DU9A 4EQNA 1B9MA 1RFAA 2B29A 4FJYA 4LJOB 3PUYA 4KD4A 4ZKBB 3VTVA 1HNWQ 2WDRB 1PRTB 4XE0A 3K0YA 1NCVA 1E6EB 4N8X1 1H9SB 1TS5A 2KHWB 1VQLA 1V6EA 2KDEB 3MWYW 1J5EL 1HEZE 4Y7NB 1A8VA 3KK7A 1VDZA 4CJ1B 1D1KA 2JUOA 3NXWA 2QC8A 2Y5PA 3NZ3A 3UIOB 4HJ8A 3SDZA 1MFWA 3IHPC 1DGSA 2AKWB 3T3NA 4MT5A 4V190 4C3JG 1Q1BA 3ICEA 4FXKC 2FNJB 3P4QB 4YWGG 4AYBB 4OL7A 4YIJA 3CCMA 4K2LA 3PLVA 4LAAA 5IGDA 4JK1C 3X3NA 3KVFB 1ZYRD 1KDAA 5IYDG 1XYIA 2BVCA 2WKCA 4MIUA 1L2FA 5M5XH 2K5QA 1KRSA 2HTHA 1WYDA 1X65A 2ON8A 1B53A 5DEHA 4KHPQ 1QT9A 1IGCA 2XTIA 3S2HB 2WDQB 4OW0A 2J0JA 1MKHA 5D6JB 3OSOA 4ZRJA 1FD7D 4C56C 3GTPB 1W6KA 2N7JA 2NPTA 2RDBC 1I4XA 5IWAQ 3MHZA 3KDFB 4LFBQ 1XLPA 4CDFC 1IBXB 3R2TA 5IP4D 3M4PA 1JOKA 1K53A 1ZXIA 1I4PA 2F03A 5CHVC 3FC4A 1TVXA 2LASA 4RGNA 2AL6A 5JJZA 5DPSA 2DZIA 2F3VA 2RPVA 2L9HA 1TYGB 1G8ZD 3NENA 2OXPA 4X3SA 2CU3A 1SGHA 2MNAA 2K04A 4WJ4A 1VR9A 5CTRC 3HZXA 1TTNA 2Q8TA 4POGA 4QIWE 1N9WA 1RODA 4DHZE 3E3XA 4K8JA 4PYUA 3B2GA 1YQ3B 2FCSA 4IPGA 2KFJA 4OEMB 1IYUA 2ZPYA 2KWCA 2KK8A 3C1FA 4C1NI 4B3ML 2ZXOA 2X8XX 2B39A 3GTOB 1WJNA 4US9A 2DYOA 4DR2L 2A6EC 3S15B 3MC8A 2JA5G 2GOWA 1L1OA 2A5HA 5JH5C 3IT6B 1HNZQ 2KHJA 5IA7A 2NWGA 1O7ZA 4U673 2KWDA 3IG3A 3WANA 5JXVA 1SJED 4POFA 2HCCA 3UDGA 4KX6B 2IHEA 3HOUG 1AZPA 2H4OA 2L1BA 3OG5A 3RNBC 3T1HQ 2B63G 2M56B 3E6ZX 4C3IG 4ICVA 4EZKA 2JA6B 2VQEL 2EJMA 3T4AC 5GADC 4BBSH 3J7ZC 1B50A 4F8MA 1HRJA 4WAAA 3TS2A 1EIYB 2R92B 3OW2A 1GJZA 1C8CA 3Q8FA 2JA7H 2LGXA 2NTTA 2DNEA 3W1BA 2LD9A 1I3QH 4RAUC 3ECIA 3DWPA 4OVUA 1FPYA 4DV4L 2J4XA 1HQMC 1EYAA 3RLOA 1SNOA 3T51B 2F4VQ 3L16A 1WD1A 3KYHC 5T8IA 4W9LA 2KJRA 1GUOA 1STYA 3NHHA 5K5PA 1Y1WH 4QB4A 3L13A 4J8QA 3MP9A 4YT0B 2W3RA 5IO9A 1EQQA 4DR4Q 1HE8A 1YN5A 3RFZB 1C3TA 4DR3L 1UGMA 1Q1EA 4B3RQ 4DR1Q 3MFYA 1B9RA 1K8MA 1D5ZC 5C5LA 1DOIA 1D2BA 5HGTA 1UELA 3BJUA 2HQLA 1C4QA 2WV6D 3GQBA 2N1VA 4OIKA 4A3JB 3PO2H 2IX1A 5AEKB 2KMMA 2EDGA 4ANUA 4N9F4 1SNQA 1AW7A 5IGCA 3FPPA 2I5HA 2WP8J 2LVQA 2JEBI 1PH8A 5JJLA 3NS8A 2N78A 1B7YB 2G4DB 1LT5D 5L37A 3IAS1 3CCSA 1NY4A 4N9TA 1WZ0A 4FLHA 2NVQH 2BCOA 2OCEA 2BYEA 3J81E 2ZW0A 3KJOA 1WGKA 1Z2MA 3AE1B 4KDLB 3V62A 4GS3A 2OOBB 5HKHA 2YYZA 4JX1C 2IYDB 4WAFA 3KWVA 3H6NA 4NMZA 1CSPA 2KVMA 4ALPA 1YN4A 5M5YB 5JVH3 5D2MB 5IGGA 3ZGZA 1PMRA 3I9V1 1Q8KA 5BYSA 4W9FA 2PZTA 4A55A 5EPLA 3VH3B 2I2YA 2CW0C 3CRKC 1QUQA 1K9MC 2JRHA 2K0PA 3E0JA 1N63A 4A3MG 3M3YH 1TKGA 3AECB 1EFID 1HXYD 2RBMA 4IFDJ 1CA5A 1XT9B 1JJCB 2LS01 2AUKA 4IUMB 1UE5A 4IWQA 2MBEA 2IT1A 3HVZA 3H09A 4F7XA 2K7VA 2WXQA 5KHQA 3RD4A 3VUXA 2FXQA 4QUFA 2Z6BA 4FF3A 3AB9A 2I46A 1YD8U 2FIFA 4BBSG 2KQ7A 4RM8A 3S14B 4BY7B 1Q5WB 4HN7A 4L5RC 1WJUA 2LZ6A 4BBRH 4M8AA 4OWXB 2BE5C 2L7RA 4EKUA 3TEYA 4B9WA 3UE0A 3ND8A 3QB3A 2XK5B 2INCC 2EKEC 1L0WA 1E7UA 1WCMH 2B2VC 3CCRA 4M02A 2K6QA 3KH0A 3WIMA 3DEOA 5EPJA 4WWPA 2KCNA 3M62B 4A3IH 3GDEA 2QDLA 1Y1WG 4B3TQ 3HOVG 1T6BX 4JYAL 3DXJC 3DPDA 4Y7NH 2ZEQA 4WQMA 4W9IA 1J7CA 1EYDA 3I4NB 1AEXA 1V1PA 4OVZA 2PQAA 4ABNA 1QVGA 2IY5B 3HOZH 2AQ2B 2JWUA 1DOYA 3RNAC 3ZNHB 3PO2G 4IUNA 1FXTB 3ABVB 3KQ4A 1EU4A 2QDFA 4DV2Q 2WX0A 2RCFA 1V1OA 3DBLB 1B9NA 1AE2A 2ZNVC 1I4RA 1WXQA 1VQBA 2R2QA 1ZW7A 2V1YA 4N8FA 5ELNA 2WXOA 1PH5A 3I4MG 4RGOS 1XTCD 2A74C 4KN7C 1J8CA 3NSWA 2MLBA 3T1YQ 3CWIA 2QEJC 5K36H 3NWTA 2VUMH 1X55A 4X6AH 3S2HH 2WXJA 1E2WA 3L17A 4EZJA 3DLLA 1LTBD 4DGZA 4URKA 5D3IB 1M90C 3NHEB 4NXNL 3MZ5A 4KGRA 1IL8A 4CJ2C 1AWDA 2GB1A 2XEWA 1HHVA 4GOPA 1GUWA 1E10A 1F2RI 2WXLA 4GMVA 1JWBD 4LNFA 1PA6A 3M4QA 4HJ9A 3CMMB 5C1ZA 2YEPF 1QG7A 4M0WA 1VQ8A 1LTID 3NE5B 2MJDA 2MJ3A 4QGUA 4HDQA 3K0XA 1NDDA 3VTUA 2LEKA 1E1TA 2IGGA 1CHQD 1G6JA 4FDBA 4JWUC 1PGBA 2NMQA 3N1XC 1UBIA 2PTLA 4A93G 3OTOQ 3P1MA 1IBXA 3AFQA 3FKIH 5KNDA 2XBBC 1AP0A 4WJPA 1ZGUB 2UXDQ 2SAKA 2JXMB 5C6AA 3S2DH 3GTMH 2RR9A 1BUVT 3U9SA 4UPAA 2EIFA 4DR5Q 3NVWA 5EBDA 2YTYA 1NBWA 5HHDG 4OHJA 3SK5A 4GNXC 3S15H 4QUCA 4HVBA 2ASBA 3AE8B 3MEFA 4RKBA 2E2IH 1XWEA 4GLXA 4BBRG 1VQ4A 3ML8A 4F8CB 5EAYA 3K57A 2WACA 1VQ7A 4Y52H 4BVUC 3PZDA 1HR0Q 3DOWA 1U9RA 1EWYC 1PFDA 4DV7L 1C4PA 4DV3Q 2WHIA 1ENAA 4LF6L 2B2TA 5I2XA 3K8AA 3J81i 2MP1A 3F1ZA 4A3IG 1WJ6A 3SHLA 4LNOA 2CW0D 2ZXPA 4B3SQ 4IOCA 3GE3C 2R92H 3Q8BA 2NZ1D 3K80C 3ZNID 1BOSA 3P20A 2IDYA 2INPE 3RNFC 5IKCM 3HOZG 1MGSA 5FJ8H 3S1QB 2PMZE 4IOIE 1WTPA 4DAYA 1YIWA 2CKZB 2LFNA 1NAPA 1KNAA 1Q8IA 1YQBA 2FUG1 2KDIA 3E56A 2DHZA 4KDIC 3OJ4B 4IN3A 1D8LA 3PQIA 3MJWA 2BE5D 2WXMA 4DHJD 5CV4A 4DAVA 1CI3M 4X65L 5K36G 2VUMG 1C78A 1JMLA 2BTEA 2EVBA 2N8NA 2Y3AA 2DENB 4LW1A 4OX9L 1MJDA 2X69A 2I5LX 3GTJB 4JI0Q 4ZDVA 2Q2IA 3ERQA 2A6HC 4JOIC 1TS2A 1VCBA 2NTSA 2EYOA 4IJLA 5C0XJ 2L1AA 2KHIA 2CH4W 3AEVA 4HLEA 2A69D 1OQYA 3P4SB 2DZJA 3SHQA 3CC7A 2UUAQ 5DPRA 1XMOL 3CAMA 3BDOA 1A3UA 4KN4C 1IXRA 4TV3A 4PYZA 3DVGY 1WMHB 3U8ZA 1K8GA 3SE0A 4F87A 1ZDVA 2M4NA 2OF1A 3OYYA 1JW9D 1IBLL 4GN1A 1DXMA 1DZ1A 2VRRB 2ICIA 3V96A 4PZ6A 3FKIG 3A5ZB 5CV9A 3E9HA 2Z4HA 4C3JB 3R93A 2F0FA 2NBWB 4W9EA 2L0TA 3I3TB 5M5YH 5I2YA 2WAQG 1EWIA 4K5WA 4LK1C 1C1YB 2FMCA 1SN8A 3QOLA 3HOYH 3HKZG 1ZXTA 2XNAC 3P7JA 1PZID 2VS1A 4XZ4A 4WURA 5LNK1 1N36L 1P7EA 4XDXA 3SEBA 1Q7YC 3GV3A 4OO1I 1C79A 1HZ9A 3PUVA 2D3BA 2UUBQ 2MPMA 4HSVA 1EF5A 5EBCA 1TT5B 2QMTA 4GZYC 1GNUA 2JXXA 2K39A 1ENCA 4Z9CB 3ZNZB 3PF5A 1K3RA 2BGFA 4K0KQ 1U0LA 1PH4A 3DVNV 3PV0A 4I7ZC 3T3OA 4BBNC 3PUXA 2RHSB 3K59A 3JW0X 1ASZA 4HEDA 2O6VA 4OZCA 1ZE3D 4D2KA 4LUZA 1NUCA 3WAPA 1SNDA 4EQOA 5BR8L 2CJNA 5JZEB 5IN7A 3G6JB 2JZZA 1YNND 5FJ8G 3Q3MC 1PH6A 2JXTA 1EY8A 4OO1H 1G6PA 1WTRA 1KRTA 5C4JB 1Q90A 1WRIA 2GRIA 5BYRA 2KOXA 4NAMA 4BAXA 1YITA 3QAQA 4TQ1A 4BY1H 1O7YA 5COYA 1T0QC 1B70B 5IT9c 2B3AA 2HHHL 2MRPA 4P16A 3K5NA 1FL0A 1QE6A 3S16B 2B2WC 1Z5SB 2IY0B 2WXPA 3I4NH 1C48A 3SD5A 2WINB 3R8BA 1V81A 3KWLA 4PMCA 3IT4B 3JVZX 4HWIB 3W9CB 4ODGA 5IGEA 3S1MB 2JA5B 5EDSA 5J2RA 1L6UA 3QJZA 1EY7A 3K81C 4FULA 1UWXA 1JCKB 3K5OA 2BW2A 3KUCB 3EC8A 3WAOA 4ZUIA 4CDCC 1IYJB 5M9OA 2EELA 2LRWA 2F0HA 5E4XA 4ILWA 5CV5A 3HOUB 2ZJRA 1WX7A 3O65B 2YVCA 4LF8Q 4DHJB 3Q69A 4KIKB 1TY2A 3I91A 3CU7A 4KK7A 2B63B 1HZCA 2ZCCA 1X3PA 5AJ3L 5ELDA 1DD2A 4C3IB 1E1OA 3EVQA 3QO2A 5LXIB 4DPGA 2M17A 4JVZA 3FMCA 3X23A 2VQFQ 3A7LA 5AFWA 3A4SC 3VA5A 3LDZE 1GUNA 1CMXB 3FRPB 2MCNB 2UWQA 1NSNS 5AZFA 3R2IA 2A5UA 1I94Q 1WRDB 4RF0A 3RNGC 5LMUL 1HZ5A 3A0JA 1PGXA 2Q2HA 1IZ6A 4X62L 3D4DA 4HXDA 3VR8B 2F0VA 3HOYG 1STGA 2A6HD 3RZFA 4X64Q 2PI2E 4KY6A 1SAPA 2E2DC 2GI9A 2NVUI 5M5XB 2ZNVB 2ZT9C 1CJEA 4LFCL 3GTLH 4KKIA 2V3NA 3TDQA 2L76A 1XF5L 1F2RC 4GB9A 4C3HG 3NOBA 3L9AX 3P2BA 1T0SC 4W9JA 1OEYJ 5E7NA 2FUHB 1JT8A 4JCVE 1HH2P 3PRZA 4G4KA 3A55A 1QKZA 4O1NA 1TWCB 3QJYA 2PZWA 5M3FH 5EJWA 1HA5A 3N30A 3V3XA 3WALA 2ZM6Q 2WXRA 1EWHA 2R7ZH 4OO1G 2AWTA 2FFKB 4W9DA 1I4QA 5CYUA 3ZXRA 1RTOA 1L1OB 2EPBA 1RFKA 1SMXA 5BN3A 5EE9A 4P6VF 1BBUA 2EMTA 1PFMA 4BY1G 4DF7A 1WZ3A 3OLMD 3RN9C 4C1NK 4B08A 2I07B 5C4HA 2I1JA 3DVNU 1VJKA 2E5LL 3LWEA 1LTRD 1XLNA 1LACA 4RCOA 1WFYA 2K25A 2QJLA 1E90A 1TY0A 3HP3A 2L0FA 3BY4B 1M1KC 2J53A 1F9SA 1F9PA 2EYPA 3LGJA 4YHHQ 2W54A 2HD3A 2D11A 3EN2A 4AYBE 4G50A 2V1CC 1WH3A 1DOLA 3B08A 4GNXB 1X54A 4OIJA 4F88A 3VA7A 4A3MB 1JB3A 2L12A 1S72A 1C0AA 1N5XA 3ZJVA 2ZJPA 3J7AF 5CV6A 2KACA 2SOBA 2UUCQ 1G91A 3I4OA 4HJGE 2A8VA 1A63A 1HR0W 2CR5A 2KMCA 2UXBQ 2LKVA 5KEEA 1OGWA 3UDFA 4A3DH 2K52A 4JI8L 4L5TA 2B2UA 4HCSA 2IL8A 3AM9A 4NJ6A 4BBSB 3GTJH 3H7PB 3X0WA 2CH4A 2CKHB 2NZOA 4X66Q 1KAAA 4DV1L 2DWQA 2K5VA 3ALBA 2HD5B 5D7GA 4ZRPA 5I6WA 3IAM1 1J7BA 1WX8A 2ICEC 3C0RB 3C1EA 2ASQA 3M95A 2LXCA 2RA4A 5ELBA 4MH0E 4ZRKA 2YU9H 4IJHA 3U4EG 3ZDMC 2BKFA 2QEXA 1Y1WB 3HOVB 3KLSX 1EUJA 3B1LX 1O80A 3R3MA 4IUVA 2L05A 1SE8A 1X3FA 3AFPA 2PVGC 5C23A 2C35B 4C4VB 3SGIA 5CV8A 1D4BA 3JAML 3TEXA 3VR9B 4YCVA 4TQUS 3PO2B 1YHBA 2L0CA 2V4DA 1LM8B 1WMHA 1GUGA 3AEGB 2QDBA 3ULPA 2NR2A 2LXAA 4LUOA 1PH3A 3CCUA 3TEHB 4FF2A 4BA1I 5M3FG 5IYDH 1T0RC 3I4MB 2MBOA 5FLXL 2Q5WD 3CXCA 1IW7D 2EXZA 4A3EG 1VQNA 3FEWX 2R7ZG 3RT3B 1MD2D 4A76A 5I9OA 1RTNA 1STEA 1CFMA 1VMPA 1OQRA 5IIFA 2E6XA 2Z0DB 2WXIA 4F1SA 5JJKA 4JIOU 1NR2A 2MGSA 3B0AA 2KCMA 2J0KA 4DN4M 3QCAA 1HFGA 1V80A 2LGSA
chains in the Genus database with same CATH topology
3OW7A 4NJCA 5EQ0A 2PW9A 3UI3A 5A2QL 1H9MA 3M85A 4J3OD 4ZK9B 4ULLA 4DQOC 5I4DA 3M3YB 3TZUA 4A93B 3BWUD 2QILA 3AU7A 2MJ8A 1U4RA 5ISRA 3S1RB 4ZUJA 1TQOA 1SNMA 1BCPD 4BBRB 1V1PB 3VQIA 2JX5A 2LMCA 2F4IA 2IX0A 1ET6A 2XN9C 2FINB 2KECA 2KQ3A 3NRZA 4A3IB 1WD0A 5EKLA 3J80L 4IFDI 2KUMA 3BVZA 2TMPA 3CKIB 3DHQA 1SMYC 1I7HA 2HCIA 2D9UA 3MXPA 1GHKA 3HOZB 2JYEA 3H91A 2BB5A 4UAIA 1G6ZA 2B2VA 1LV9A 5EKIA 1SJHD 1SBBB 3V2TA 1B2TA 2NB0A 4FNFA 2EZVA 2Z8LA 1K52A 1TKYA 5D65A 1LT4D 1C4AA 4KGSA 4IFDH 5M5WB 2N88A 5CBEE 5KIXA 2VUMB 2I38A 1CQFA 1N60A 3TEZA 1NVID 4JPSA 3DUZA 1LTAD 5JPNC 3T13A 4JE3B 1X32A 1EY0A 1ZPSA 3SK6A 1RDPD 4K8IA 4KJOA 4ARCA 1AYFA 2TSSA 1EIHA 5BMIA 4YSZB 1GHJA 3AEFB 4IURA 4DXGA 2A73B 3JAME 3HG9A 4RFBA 4CKBA 4ZHPA 3BG3A 4IUTA 2EJFC 1H9JA 4EVOA 3FKIB 4ARIA 2WKDA 4QF4A 2BBCA 1XLQA 4KY5A 5JVG3 1VMCA 3GTMB 2B2UC 3S2DB 2WAQB 5FLXE 5IT9E 5H92C 4DK0A 5KNCA 4K5VA 2EY5A 5JPMC 3P63A 4R3DA 3HKZB 4HSPA 2E2IB 1ML0D 5ELCA 1TWAB 2M2LA 3I90A 1GUSA 1WSPA 3I4LA 1GUTA 4XQJA 2O2LD 4MH8A 3TEWA 5ELEA 1VCIA 1ESRA 2F0IA 3TBIB 1ET9A 5C3XA 5A2QE 2R6GA 3J7YW 2ZXRA 4LK0M 1Q12A 4L23A 1BCPB 1MHXA 5T1GA 4XT3B 1SXTA 2WU5B 2M0AA 1SFOB 5LL6X 3IAYA 3KLSA 1S5ED 1SIJA 3I57A 4IFDG 1I50B 1UGJA 1J9OA 2WLBA 1EWCA 2LY7A 2A68C 3I8ZA 5HFYA 3IFTA 4WJWA 3TSSA 4UDUC 1B4OA 1LTSD 2E74C 4KY7A 3QG1A 5I6YA 3W5VB 2J7ZA 4DAPA 5GXGB 1PLFA 3MXGA 2XWJB 1V8CA 2N9KA 2BB6A 3URYA 1FCCC 1P7FA 3EA6A 1WWTA 2EYFA 2IX3A 1IGDA 1A2UA 1R4PB 1SF0A 4YSXB 4G7ZC 3VRBB 3J9CA 1D5MC 1XEEA 1F0ZA 4ZLTF 5C4ZA 4H13C 5CGKA 4DNRB 2N55A 1LTTD 5DAUA 3HOYB 4O42A 5C0XI 1K50A 1L0VB 3MHBA 1KDCA 1N61A 4C3HB 4NP5A 4YXDB 2BS4B 2Z1CA 3PUWA 2FMMA 4MACA 3KLRA 1OXUA 1PZKD 2J52A 1RCVD 3AN1A 3UI2A 2DY8A 4KKJA 4N9PA 4TMAB 5C0XH 1EY9A 3M4YA 3BS1A 4G57A 5G5HA 5FK9C 3ZQ4A 1VDVA 3WDNA 1A2TA 2A6ED 2Y5CA 4BY1B 3A56A 3B2FA 2C9OA 2X38A 4HMJA 3D4RA 5DM63 1Y69U 3MA2B 3L3OC 2HDEA 1EM7A 4J6HA 4EGVA 1G2TA 2JYTA 3SFDB 5BMHA 1YQ4B 4RKLA 2WDVB 4QIWB 2BDOA 2VNUD 3LYYA 4G7HC 4RHSA 1RYJA 2NVXB 2F0EA 3IFDA 4Q0FA 3L4PA 2B2WA 1ILPA 1NEKB 2JZPA 3P4PB 5EPKA 3KUPA 4H0LC 4TQ0A 4XWTA 1BF4A 1T3QA 1OFFA 5KGUA 1C9FA 2K5DA 2A68D 3ETRA 3T16A 3NWSA 1MI0A 2ENBA 2RDHA 2EE1A 3GTLB 3ONAB 3P75A 4XQNA 3X3MA 2EY1A 2IJ0A 1R4QB 2FJ2A 3OMGA 4WORA 2XIWA 4I65A 1SE4A 1QLBB 1D6EC 1RWSA 2RSNA 4ID6A 3NTIA 5M3FB 5C0XG 1NENB 4A3EB 2R7ZB 1S5FD 2DY7A 4WH4A 4Q2JA 3OWFA 4JWSC 1EOTA 1ZOYB 4IQZA 2F1MA 3VYTA 5LL6S 2R3ZA 4Q5VA 4USAA 3OWEB 2AWNA 1T5EA 3Q22A 3DWMA 2O4XA 1SE3A 3NBHA 4TSSA 2B2YC 2W3SA 1I4HA 3C2PA 3ZJUA 4A3DB 4BS9A 1JE4A 4K14A 1MI2A 1B1ZA 2B76B 3RUZA 3VR3A 3C8YA 2D2CC 2PNRC 3GS2A 5EE1A 3NK9A 1ENFA 5F2DA 1D1IA 4A6QA 5H8YE 2SEBD 1W6JA 1XX8A 3P42A 2K22A 1ILQA 4QCLA 2YU9B 1F2MA 1SNCA 1B44D 1VZ7A 2QKIC 1QOHA 2KOLA 2OEDA 5KNBA 1BNZA 3K6OA 3BDLA 5E4WC 5MPOA 1SYCA 3V05A 4HROA 1FXAA 3BYTB 3OMCA 4P2CB 3GD7A 3N6RA 1L4DB 3EROA 1HPCA 2BT6A 3QWNA 3BYYB 3NQIA 3K5LA 3AE7B 1UAPA 1UEAB 3PMFA 2QF7A 1CT1D 1WTQA 2BYTA 2F0SA 4FVMA 5IGFA 1PDXA 2K03A 2LHDA 1A3VA 3AEDB 2EY6A 2Q8IB 5E3FA 1QCBD 3TMEA 3I3CA 1QB5D 2JQRB 3W5UB 1FFVA 1J8IA 1MBYA 1ZP0B 4L2YA 1R7SA 4PMBA 1H9RA 2BOSA 1IKLA 3N52A 4HKQA 2KEDA 4WIPA 2WU2B 1WTWA 1OO9B 1DONA 2F0LA 4PT5A 2AUJD 2LMCB 2SDFA 1S5BD 1UNSA 4B0EA 1UUPA 1AN8A 1SYGA 3MC0B 2YEPB 1K83B 4K6DA 4ZQ3A 5C3JB 2MEKA 5C3EB 2NN6I 2WIIB 4RH6A 4OGQC 3VR6A 1TKEA 2GI9A 5IGBA 5C5MA 5CC4A 2X6GA 4MM3B 4IZ8A 1JOQA 1HCZA 1STHA 3E9SA 2FHTA 2HDMA 5JEAH 2EYJA 4KKUA 3AE9B 5KYLA 2BDNA 3NVYA 2NN6H 2PIAA 4ZRQA 5CMDA 1F2LA 1OXTA 1JQ4A 5CV7A 3IXSA 1FFUA 2K33A 4RCNA 3AMZA 5G5GA 4TKOB 5EGTA 1BMLC 4A3BB 4A3FB 1QOBA 4FP5D 3D3RA 5FOBB 1QOAA 1F9RA 1YMHE 3AB5A 3DMUA 1IUEA 2MH7A 2PMZB 1L5PA 4L8JA 1FM0D 1S5DD 1WVLA 1WYGA 4KMUC 3L7ZC 1JROA 4XYQA 1TWHB 4C2MB 1SEBD 2LGIA 1CM9A 1DYQA 3TN2A 2KAJA 4U68A 1KNEA 2Z4IA 4HKZE 3U7ZA 1PRTF 2OEOA 1C4CA 1TS4A 3S9WA 4H2AA 3LNNA 5D14A 5IOCA 3LB8C 1D5XC 1HQRD 1H9KA 1PFBA 2VXWA 5J39A 2NVTB 1G2SA 1NI3A 1E9MA 1QNUA 1JQYD 3GP7A 1IYVA 4R9WA 1Z6HA 4FXDA 2WP9B 3AE5B 2RDGA 5LHY1 2K5WA 2F0JA 2EYHA 5JEAG 1M8AA 3CHBD 2NN6G 4KHZA 3EGRA 5A35A 1DJRD 4A3GB 3PZ8A 4KJNA 4CGYB 4N58A 3H3VC 1JORA 5CR3A 1V97A 2EJGC 1A3TA 4N6EB 1OXVA 4FF1A 1QNKA 1FMAD 3HS0C 3MXUA 4CBVA 3D6CA 5AUKA 3TP8A 4PV1C 1ZYRC 3TUOA 1Y1VB 2KA7A 2AWOA 1PFNA 2BS3B 3HEJA 2G9DA 1L0XB 2EYLA 3A8JE 4J1MA 1F77A 3K58A 5IODA 4BWGB 2IPKD 3RZOB 4A9AA 3SXHA 2H88B 4HCEA 4M1UB 3S17B 3MVVA 1ONLA 3GV6A 1GB4A 1KRHA 1AZQA 3OIPA 1ACCA 1DOXA 2PZUA 1ZEQX 2XWBB 2B8FA 3PUZA 4X3TA 1PYWD 2N0SB 1U4PA 1QILA 4DXFA 2E2JB 4RNAA 3VR5A 1DOMA 1Y8PB 2F0DA 1LT3D 2K1BA 3I73A 2NYZD 1OXXK 2NUCA 2H1EA 2XSCA 3IL8A 3NBIA 1JALA 4HEA1 1YN3A 3BVGA 1ZDXA 3F2UA 1SSOA 2LFIA 1MVKA 1IKMA 4L6TB 3J7AV 5EE3A 2WB1B 3VYUA 1M4VA 5KRUA 4XYOA 3AE2B 4G7OC 2F0UA 2RQXA 3Q24A 4HRSA 1FXIA 4HTHA 2RDFA 4YTNB 1MSGA 1A6XA 1JR0D 3QIAA 3C3LA 2L4NA 3TP6A 3LXFA 2E3TA 2W55A 4B9XA 1YJIA 5JAVA 3RZDB 5C4XB 3D6WA 2E76C 4PMWA 4IUQA 1CK1A 4X3KA 4ZOHC 1HUMA 1O78A 3U2SC 3NS1A 1TT2A 3AH7A 1BUIC 3CIRB 2KDMA 4AQ7A 1FNUA 4CQNA 3A7AB 5FO7B 3J81L 2L11A 1EYCA 4IKGA 4S3SA 5AUIA 2BA0A 2PMVA 1VF7A 2LUMA 3B9JA 3CQZB 3HGBA 4FXCA 3PIO3 4K6LA 5EE0A 4BA2I 3I70A 4X3UA 1STNA 1SE2A 3FAHA 1F2ZA 5FR3A 1RJTA 4A90A 2EYMA 5M3MB 5E1FA 4GDLB 4EE2A 3VYRA 3MAQA 1FR3A 1STAA 2ACZB 3GTQB 3NPPA 4YSYB 2JP1A 1GPXA 3RPFC 4IALA 3K7AB 2CQAA 4XWWA 2K32A 4MN3A 1SYFA 4V0BA 1OXSC 3P4RB 3M7GA 1BO0A 1GB1A 2G9HD 3ZJTA 1LO5D 1VF5C 3ND9A 2VZKD 2O5JC 1JICA 2X6LA 4N59A 4YTMB 1NR4A 2EY2A 2ONQA 1KTKA 3U52E 3M7NA 2PQEA 1R9TB 1QQRA 1X3QA 2L55A 2RSOA 2IWHA 2E75C 2F0PA 2AQ3B 3Q8EA 1CA6A 3AV8A 1A70A 1PXUA 1K8OA 2JE6I 3GTKB 1KLGD 1EY5A 1SDFA 5BN5A 1Y8NB 3FILA 1CZWA 3J80E 1SMYD 2B2YA 2IGDA 2M00A 1KDBA 2F3WA 2F0QA 2QCPX 2M9VA 1TWFB 3IKJA 1C77A 1QOGA 4IDIA 1J7AA 3BK1A 2WXGA 2ZW1A 3NVVA 2DNCA 1S5CD 1N62A 2J0TD 4DNTB 3BDCA 1QF6A 1XLOA 1XXGA 1DCZA 4PNYA 1MSHA 4ME5A 4JBWA 2SNSA 4A3KB 3OOCA 4WFN3 2H89B 1ICWA 1AFPA 3U9OA 5C44B 1GAQB 3NUHB 2RKSA 4YTPB 3N9YC 3K5MA 1PGAA 1JOOA 4L1BA 1Z47A 1Q10A 2JSVX 2WS3B 4XTCS 1SYEA 4RF1A 1N5WA 4XT1B 4US8A 1Y8OB 4XIGS 3SFEB 1SSNA 1SNPA 1HA6A 3HVDA 4E6IA 1IHZA 3DEPA 1TU2B 1VZ8A 1E0ZA 4IUUA 5DM73 4HAEA 1ZXHA 4ZYSA 1A15A 3WCQA 2KJXA 3OHXC 4CHTB 3KBXA 1EQVA 3EUB2 3HOXB 1PTOC 2VZKB 3EFXD 2R93B 1F2YA 1HUNA 5NUCA 3W3AA 1I6VC 1ESFA 1V43A 3MXNA 4KV6A 2JEAI 2WXKA 3HUIA 3MEHA 2IGHA 3G7LA 1S4ZA 3Q23A 3PO3B 2HUGA 4FXGC 1BR9A 3BK2A 1FO4A 2A69C 2AX5A 3H6MA 1KF6B 4KKSA 1C76A 1FEHA 1GOZA 3LWUA 3BIID 3T56B 2WXHA 1H9SA 3AE6B 3VR4A 3BVMA 4KKTA 2K3UA 4LLGM 5DNFA 2L5TA 3Q6SA 2E2HB 3PIP3 5J1ZA 1JWUD 3A8KE 3RLFA 3W2DA 5J22A 2XVSA 1JC7A 2QSDA 4CJ0B 1XCTL 3SR1A 1I4GA 3ZYYX 3NP8A 4DFAA 3FVQA 2QIEB 1EIGA 4L63B 4RA8A 1PTOF 5T1IA 3ITPA 3AEBB 1BBXC 1F9QA 2OT2A 3DWAA 1CTMA 2PPBC 3AE4B 1L6VA 5FO9B 1YNNC 1SYDA 1NYQA 2CVRA 3RMHA 1RD9D 2CHBD 1CZGA 1Y56A 1UWMA 1TJEA 3A8IE 2INNE 1I6HB 2BA1A 2B8GA 2F0NA 1EU3A 1G291 3GTGB 3H8HA 4FYDA 3H0GB 4ITKA 4FF4A 1FRDA 4CKEA 1MPEA 4EQPA 3H94A 4HMIA 3HRZC 4OZAA 1PZJD 3R3OA 2Y0SB 4MHEA 2PYKA 3SK4A 2PVOD 1PTOD 1TWGB 3MTSA 1STBA 3AE3B 3SVMA 2MHVA 1U4MA 1YNJC 4TRDA 2BS2B 3DWQA 1HTPA 4KTAA 3PZ7A 5E6JA 2DYMA 4A8XC 4WWMA 4KD3A 5I9PA 1E2ZA 1JRPA 3Q8AA 2XRSD 1T5XD 2F0OA 1JWSD 1FIQA 1E2VA 1KFYB 2K01A 1XCQL 2OHFA 4NAWB 3D4WA 2JSOA 5G3LF 2WNMA 3NTHA 4CKCA 2L52A 2GA4B 1WTXA 3KBGA 4H44C 1KH0A 3P1HA 3C46A 2F0TA 5EKKA 2K5PA 2MJEA 2L32A 1ZKOA 3OIQA 2RMMA 3DWGC 4IUPA 1EZ8A 5KYIA 2PO4A 2V3PA 3E5SA 1LT6D 1QWYA 2JU6X 1FRRA 2JA8B 2KQ4X 1EZ6A 4OZBA 3NVZA 1RHPA 2HQEA 2PKOA 3SR6A 3KF8A 2HDLA 4NW2A 1FYCA 3AMUA 5FO8B 3FDTA 5HI1A 1GJXA 2M19A 3QOJA 2V4IB 2K6AA 3T53B 1B3AA 4LJZC 3EJIA 5G3LD 3VYSA 1CHPD 2WXFA 2PCFB 4ZHOA 2R61A 2NBFA 1PRTC 2EOTA 3Q8CA 3EQLC 5D3DA 3FPUB 1WTVA 2N9LA 1TS3A 2Q8RE 4K5XA 4DK1A 2G1EA 5BMGA 4KHVA 1PTOB 1FNWA 1LLRD 3HRDD 4NDXA 2K28A 2PW5A 2D62A 3SK8A 1SYBA 4XXEA 1EY4A 2SNMA 2FE8A 3PO0A 1HTLD 2FBWB 1FD6A 3TP7A 1PUTA 1YJJA 2DLBA 3Q0AA 4XQQA 1LABA 2KEEA 4XDCA 2V0GA 1YNJD 3S1NB 3NQTA 2DN8A 1IW7C 2ID0A 3TZDA 4K2KA 1K51A 1FNVA 5CBAE 3HOWB 2L83A 2AQ1B 1RKNA 2F0WA 2WQYB 3LX0A 2DBYA 2PLPA 4REZA 2VB3X 4R8IA 2B2TC 1JWAD 1KABA 4LMQD 4RGMA 1VRAB 1MHHE 4DA2A 2LHEA 4GDKB 2K05A 1BDOA 3MFGA 1ROEA 1YNTE 4PQXA 2HTME 2K9XA 3D31A 3GO5A 1FGBD 2F0MA 4C80A 4AS1A 3NUCA 3OPOA 4KI0A 1BCPC 1CZPA 3AEEB 5BN4A 1L4ZB 4KGTA 3BZDB 1EEID 1KLUD 5TSSA 4QMGA 2NVYB 2VB2X 3TP5A 2O5IC 2MUYA 2LJIA 4NKLA 1DGJA 1HZ6A 5HURA 4RHRA 3FILB 1PRTD 4XDDA 1E0BA 1E7PB 2F0KA 2IW3A 2XRQD 4FO2A 3CRLC 1QJOA 2JA7B 1TR5A 4WRDA 1DM0B 5BYQA 1O7LA 3WOFA 2WXNA 1I3QB 1NYRA 4C7ZA 5C3WA 2CJOA 1BQQT 3GB1A 4NZLB 1Q3LA 2F0GA 2JYOA 4ZAIA 1FCLA 3W1SA 1JWMD 5JOBA 1II3A 1OQQA 1TZOA 3NTKA 1TIID 4ZRZA 3MJ5A 5FKAC 3AEAB 4B0MA 1BCPF 1ZUD2 5IT9L 3A54A 1HFNA 2NVQB 1XO3A 5JEAJ 4HR7B 1DOKA 1BXTA 2C5CA 1LTGD 1RF2D 1EL0A 3WOEA 5CORA 1VZ6A 2W82A 2J42A 1RM6C 4ZKCB 4C7YA 4R8NA 5ELFA 1EEFD 3DM1A 3D8GA 1VLBA 2KHSA 3VRAB 1Z7TA 2KN4A 3I72A 2PW7A 1CQVA 1GXDC 1V8QA 3O13A 1QOFA 1L0YB 1SB3C 4LTUA 4H7BA 2RVLA 2EKIA 5HG2A 4GLSC 1PTOH 1U4LA 1TKWB 2D5GA 1EY6A 5C2TB 3VR2A 1WTOA 1EQTA 4RGTA 2KCCA 1PDQA 4RWSC 2D5DA 3M4OB 1WCMB 4DU9A 4EQNA 1B9MA 3PUYA 4KD4A 4ZKBB 2WDRB 1PRTB 4XE0A 3K0YA 1NCVA 1E6EB 1H9SB 1TS5A 3MWYW 1HEZE 4Y7NB 3KK7A 1VDZA 4CJ1B 1D1KA 2Y5PA 3NXWA 3NZ3A 3SDZA 3T3NA 4MT5A 4V190 4C3JG 1Q1BA 4FXKC 3P4QB 4YWGG 4AYBB 4OL7A 4YIJA 4K2LA 4LAAA 5IGDA 4JK1C 3X3NA 1ZYRD 1KDAA 1XYIA 2WKCA 4MIUA 2K5QA 2ON8A 1B53A 5DEHA 1QT9A 1IGCA 3S2HB 2WDQB 4OW0A 3OSOA 1FD7D 4C56C 3GTPB 1W6KA 2N7JA 3MHZA 1I4XA 1XLPA 1IBXB 3R2TA 1JOKA 1K53A 1ZXIA 1I4PA 2F03A 3FC4A 1TVXA 4RGNA 5JJZA 2F3VA 2RPVA 2L9HA 1TYGB 1G8ZD 4X3SA 2OXPA 2CU3A 2K04A 1VR9A 3HZXA 2Q8TA 1RODA 4K8JA 3B2GA 1YQ3B 1IYUA 3C1FA 4C1NI 2ZXOA 2B39A 3GTOB 4US9A 2DYOA 2A6EC 3S15B 2A5HA 3IT6B 2NWGA 1O7ZA 4U673 2KWDA 5JXVA 1SJED 2HCCA 4KX6B 1AZPA 2H4OA 2L1BA 2M56B 3E6ZX 4C3IG 2JA6B 2EJMA 3T4AC 1B50A 4F8MA 1HRJA 2R92B 1C8CA 3Q8FA 2NTTA 2DNEA 4RAUC 3DWPA 2J4XA 1HQMC 1EYAA 1SNOA 3T51B 1WD1A 5T8IA 1GUOA 1STYA 3NHHA 5K5PA 4QB4A 4J8QA 3MP9A 4YT0B 2W3RA 1YN5A 3RFZB 1Q1EA 3MFYA 1B9RA 1K8MA 1D5ZC 5C5LA 1DOIA 1D2BA 5HGTA 2WV6D 1C4QA 3GQBA 4OIKA 4A3JB 2IX1A 2KMMA 2EDGA 1SNQA 1AW7A 5IGCA 3FPPA 2WP8J 2JEBI 1LT5D 3IAS1 4N9TA 2BCOA 2ZW0A 3J81E 1WGKA 3AE1B 2YYZA 4JX1C 4WAFA 3KWVA 4NMZA 2KVMA 1YN4A 5M5YB 5JVH3 5IGGA 3ZGZA 1PMRA 3I9V1 5BYSA 2PZTA 4A55A 5EPLA 2I2YA 2CW0C 3CRKC 2K0PA 3E0JA 1N63A 1TKGA 3AECB 1EFID 1HXYD 2RBMA 4IFDJ 1CA5A 2AUKA 2LS01 2IT1A 3HVZA 3H09A 4F7XA 2K7VA 2WXQA 3RD4A 4QUFA 4FF3A 3AB9A 2I46A 3S14B 4BY7B 4HN7A 4M8AA 2BE5C 3TEYA 4B9WA 3ND8A 3QB3A 2B2VC 3DEOA 5EPJA 2KCNA 1T6BX 3DXJC 4WQMA 1J7CA 1EYDA 3I4NB 1AEXA 1V1PA 4OVZA 4ABNA 2AQ2B 2JWUA 1DOYA 4IUNA 3ABVB 3KQ4A 1EU4A 1V1OA 1B9NA 1I4RA 1WXQA 2WXOA 4RGOS 1XTCD 2A74C 4KN7C 3NSWA 3CWIA 2QEJC 5K36H 3NWTA 2WXJA 1E2WA 1LTBD 4DGZA 5D3IB 3MZ5A 4KGRA 1IL8A 4CJ2C 1AWDA 2GB1A 1HHVA 1GUWA 1E10A 1F2RI 2WXLA 1JWBD 2YEPF 1QG7A 4M0WA 1LTID 3NE5B 2MJDA 2MJ3A 2LEKA 2IGGA 1CHQD 4JWUC 1PGBA 2NMQA 2PTLA 3P1MA 1IBXA 5KNDA 1AP0A 2SAKA 2JXMB 5C6AA 1BUVT 3U9SA 3NVWA 5EBDA 5HHDG 4OHJA 3SK5A 4QUCA 3AE8B 4RKBA 1XWEA 3K57A 2WACA 1U9RA 1EWYC 1PFDA 1C4PA 1ENAA 2B2TA 5I2XA 2MP1A 3SHLA 2CW0D 2ZXPA 3Q8BA 2NZ1D 1BOSA 3P20A 2IDYA 2INPE 1MGSA 3S1QB 4IOIE 1WTPA 4DAYA 2LFNA 1NAPA 1KNAA 1Q8IA 2FUG1 3E56A 4IN3A 2BE5D 2WXMA 5CV4A 4DAVA 1CI3M 5K36G 1C78A 1JMLA 2BTEA 2EVBA 2Y3AA 2X69A 3GTJB 3ERQA 2A6HC 1TS2A 2NTSA 2EYOA 5C0XJ 2L1AA 2A69D 3P4SB 4KN4C 3BDOA 1A3UA 3SE0A 4F87A 1ZDVA 2OF1A 1JW9D 1DXMA 1DZ1A 2ICIA 3V96A 5CV9A 4C3JB 2Z4HA 3R93A 2F0FA 5I2YA 4K5WA 4LK1C 2FMCA 3QOLA 3P7JA 1ZXTA 2XNAC 1PZID 4WURA 5LNK1 1P7EA 4XDXA 3SEBA 4OO1I 3GV3A 1C79A 3PUVA 2MPMA 4HSVA 5EBCA 2QMTA 4GZYC 1ENCA 4Z9CB 3PV0A 4I7ZC 3T3OA 3PUXA 3K59A 4OZCA 4D2KA 4HEDA 1ZE3D 1NUCA 1SNDA 4EQOA 2CJNA 3G6JB 1YNND 2JXTA 1EY8A 4OO1H 1WTRA 5C4JB 1Q90A 1WRIA 2GRIA 5BYRA 4NAMA 4TQ1A 1O7YA 5COYA 4P16A 3K5NA 1QE6A 3S16B 2B2WC 2WXPA 1C48A 2WINB 3R8BA 3KWLA 4PMCA 3IT4B 3W9CB 4ODGA 5IGEA 3S1MB 2JA5B 1L6UA 1EY7A 1UWXA 1JCKB 3K5OA 2BW2A 4ZUIA 2EELA 5M9OA 2F0HA 5E4XA 4ILWA 5CV5A 3HOUB 3Q69A 1TY2A 3I91A 3CU7A 4KK7A 2B63B 1X3PA 5ELDA 1DD2A 4C3IB 3EVQA 3QO2A 3FMCA 3A7LA 5AFWA 3VA5A 1GUNA 3FRPB 1NSNS 3R2IA 4RF0A 1HZ5A 1PGXA 3D4DA 3VR8B 2F0VA 1STGA 2A6HD 4KY6A 1SAPA 2E2DC 5M5XB 2ZT9C 1CJEA 4KKIA 2V3NA 3TDQA 1XF5L 1F2RC 4C3HG 3L9AX 4G4KA 3A55A 1QKZA 4O1NA 1TWCB 3QJYA 2PZWA 3V3XA 5EJWA 1HA5A 2WXRA 1EWHA 4OO1G 2FFKB 1I4QA 5CYUA 1RTOA 2EPBA 1RFKA 5BN3A 5EE9A 4P6VF 1PFMA 4DF7A 4C1NK 4B08A 2I07B 5C4HA 1VJKA 3LWEA 1LTRD 1XLNA 1LACA 4RCOA 2QJLA 1TY0A 3HP3A 2J53A 1F9SA 1F9PA 2EYPA 2W54A 1DOLA 3VA7A 4OIJA 4F88A