3GP7A

Staphylococcal enterotoxin b mutant n23yk97sk98s
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
237
structure length
226
Chain Sequence
SQPDPKPDELHKSSKFTGLMEYMKVLYDDNHVSAINVKSIDQFLYFDLIYSIKDTKLGNYDNVRVEFKNKDLADKYKDKYVDVFGANYYYQCYFSSKRKTCMYGGVTEHNGNQLDKYRSITVRVFEDGKNLLSFDVQTNKKKVTAQELDYLTRHYLVKNKKLYEFNNSPYETGYIKFIENENSFWYDMMPAPGDKFDQSKYLMMYNDNKMVDSKDVKIEVYLTTKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords Enterotoxin type B
publication title Contribution of the flexible loop region to the function of staphylococcal enterotoxin B
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 67
structure length 226
sequence length 237
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3gp7A02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3gp7A01
1D5MC 4O1NA 1LT5D 1FD7D 4DXFA 2QEJC 3TSSA 1CQVA 1LO5D 2XRSD 4RCOA 3BZDB 3SEBA 1M4VA 1I4RA 1PRTF 4RGTA 1JWUD 2XRQD 1JQYD 1XTCD 4K6LA 2NTSA 4TSSA 3DWPA 1B1ZA 3MFGA 1TS4A 1DYQA 1L0XB 2AQ1B 1PTOD 3EFXD 3KLSX 4RHSA 4RHRA 3URYA 2J4XA 1ENFA 1G8ZD 1PZJD 1S5DD 1TS5A 3R2IA 1S5FD 4RH6A 5ELBA 1HTLD 4NZLB 1RDPD 1BCPD 4RGNA 2AQ3B 4BWGB 5FKAC 1YN5A 1ET6A 2ICIA 1LTAD 1AN8A 1D5ZC 2IPKD 1ET9A 4DXGA 1PZID 1I4QA 1LTID 1PYWD 4RGMA 1SBBB 1RCVD 5D3DA 1TS2A 1B44D 5ELEA 3BYTB 1JWMD 1JCKB 3OWEB 1QILA 1LT3D 1XXGA 4L6TB 1I4HA 2R61A 1UNSA 1CHPD 1BXTA 1PTOH 3O13A 3R2TA 1HXYD 1YN4A 2RDHA 1SJHD 2TSSA 1I4GA 2XNAC 1LLRD 1SE3A 1GOZA 1PTOC 1STEA 3W2DA 3DWAA 1FNVA 1MD2D 3EA6A 5ELFA 1LTGD 1SJED 4C56C 2O2LD 1ESFA 4ZYSA 1BCPC 1PRTD 1JWSD 1LT4D 1V1PA 1HA5A 3DWQA 1FGBD 1TS3A 3V05A 1CK1A 1RD9D 3CHBD 1AW7A 1LT6D 1TY2A 3BVGA 4RGOS 3GP7A 2RDGA 3BVZA 4RFBA 1EEID 1PTOF 5ELDA 1FNUA 1EU3A 1F77A 1JR0D 1LTSD 1DJRD 2NTTA 2AQ2B 4OHJA 2XN9C 1LTRD 3R8BA 1LTTD 4Z9CB 5FK9C 1CHQD 1BCPF 1V1PB 1SEBD 1TY0A 1D6EC 3MC0B 1PTOB 1EFID 1I4XA 4UDUC 2QILA 3BVMA 1SE4A 2WV6D 1KTKA 1L0YB 1YN3A 1BCPB 1SE2A 3BYYB 1CT1D 1I4PA 4L63B 1S5BD 2G9HD 1SXTA 1EU4A 1RF2D 2IJ0A 2SEBD 1S5ED 5I4DA 1PRTB 2CHBD 2Z8LA 1T5XD 1PRTC 5ELCA 5TSSA 1KLGD 5D3IB 1FNWA 1V1OA 1D5XC 1HQRD 1KLUD 1PZKD 1LTBD 1UUPA 1EEFD 1S5CD 1EWCA
chains in the Genus database with same CATH superfamily
4HCSA 2GMIC 4MGZE 2AWNA 1OXXK 1QOHA 2I5LX 4AYBB 4R4TA 1F9PA 3RMHA 1IHZA 3D32A 2H88B 1SIFA 3WALA 3IXSA 1B9MA 1VQ7A 2WXKA 3ZXVA 1A2UA 1JWUD 3CU7A 2IY5B 1SRUA 2MHJA 3QHTA 2IGDA 2BQQA 5HHDG 4N59A 2PVGC 1VQIA 1QG7A 3OOCA 3TL5A 2N7EA 1LYLA 3AFQA 2LWPA 4FN2A 4MH0E 4G3XB 4NXNL 4IFDJ 5IIFA 4AJWA 4AUQC 2EYOA 3PF5A 2EYHA 4FF3A 2W3RA 2EMTA 4C3HB 1Q90A 3ALBA 1JOKA 2A8VA 4MNOA 3H09A 4I7AA 3BWUD 1I50H 4GIVA 4NB3A 2VQFQ 1GVPA 2PVOD 2IL8A 3H7PB 3HP3A 4HTHA 1A3UA 1AN8A 5C23A 3WAOA 1ET9A 2X38A 5CHVC 5IKCM 4GKKL 3S2AA 2JYTA 4ASWC 1AH9A 2JQOA 2KN5A 2JQRB 1EO6A 5ELEA 3A4SC 2BS2B 1Y1VH 1ESRA 1WYDA 4FF1A 1JCKB 2F0JA 2CQOA 5IGFA 5AZFA 2KMAA 5I2XA 1GC6A 2D3GA 3VDZA 1SNQA 4C7YA 1PQSA 1E10A 5DM63 1PTOH 2KWDA 1B9NA 1K83H 4DWFA 2JA9A 4LDTB 3GTKH 1SB3C 3ZIMA 3ZJVA 4IN3A 4GLVB 1MHXA 3RT3B 3H15A 3OTOL 4KHZA 1N5XA 1LLRD 2DWQA 4R4IA 4HJ8A 2NMQA 2K4KA 1WI5A 4QGUA 2O2LD 1R4MB 1TZ1A 2XBBC 3QARA 2B39A 1WGDA 2CJNA 1I50B 4H02A 1QNKA 3VR2A 4ZYSA 3AXCA 2RPQA 2N9LA 4W9CA 3B1LX 1JWBD 3HZXA 3RUIB 1ZXTA 1RD9D 1HA6A 2I5HA 5T1IA 1PMRA 2EZVA 1VQLA 1GNUA 4KKSA 1YJJA 1TY2A 1BBXC 4L1BA 1C4AA 3PMFA 1EU3A 1PFBA 5DLQE 3ULPA 1Y1VB 5JPNC 3I56A 2D11A 4DUYQ 1WXMA 4XZ4A 5FK9C 3U50C 4NXML 4H7BA 2JEAI 1G6ZA 1D6EC 4W9EA 5C4ZA 5IA7A 1U4MA 1XTDA 1PTOB 5IE8A 1XMOL 1R7SA 1EFID 1K83B 4EGVA 4IFDI 4YTPB 4N8X1 3GTKB 1F2YA 3GZNB 3AE4B 1L0YB 4KY5A 1QOFA 2J53A 4LNIA 2GBNA 1G6PA 1XWEA 1XNQL 1J7CA 4ANUA 1TWHH 1SIJA 4K8IA 2V9HA 1D1KA 1EIFA 4DV2L 1YMHE 2CKZB 3I4LA 3HK0A 5BMGA 2CW0D 1MG4A 3DQVA 1VJKA 4U673 4HCPB 4NPNA 2C7NB 1E8ZA 1N61A 4LF8L 4EOYA 4XQNA 1R4NI 4AS1A 5JZEB 3D8GA 4HKQA 3E56A 4B3RL 1XF5L 2MP1A 4L5QA 1EWCA 1KDCA 4LF9Q 4GNXB 2DHZA 5LMUL 3TBIB 2MRPA 3PZ7A 2F0PA 3ZDMC 1VQHA 2CHWA 3KLRA 1KAWA 5JHAA 2JWZA 1IUEA 1FXIA 2B2YA 1T5EA 3HKZE 1L6UA 1VQGA 1HTQA 1JQYD 4M02A 3KW5B 2J0JA 3ZJYC 2B2WA 2A6HC 3MFGA 5MPOA 2C7HA 4JVZA 4RHSA 1TWHB 2PNRC 2IZVB 3QB3A 3NZUA 4FJZA 3C46A 2WB1B 3H9DA 5DEHA 3AEVA 1UELA 2J52A 2KQ4X 4GN4B 2PJHA 4YHHL 4X3UA 3M9BA 4JI6L 5HKHA 4YCWA 1WMHA 4DV0L 1TIFA 1VQ8A 1XCTL 3CMEA 3TZDA 5EE0A 2E5LQ 2Z0EB 1LTAD 3FEWX 3A74A 1Q1BA 3T13A 3DBRB 1HZAA 1WGKA 3GTLB 5IYCG 2E2IH 2FCNA 2ONQA 5H92C 1SBBB 3NP8A 2W55A 1WR6E 2C9OA 4CKBA 4AP4C 2ZVNA 2CR5A 2R7ZB 1PDQA 5DNFA 5D2MB 4ALPA 2KFKB 4C4VB 1V8CA 5FR3A 1A3VA 5C0XJ 2MBEA 1WX9A 3P1HA 4L2YA 1CA6A 1DCZA 4A3JH 4DR6L 2ZXPA 3MZ5A 4LFCL 4K7SA 2IX1A 3V62A 2LRWA 1E2ZA 4GDLB 2EELA 2B2TA 1IBLL 1PFMA 1BUVT 1RM6C 5M3MH 1C4PA 3L4PA 4KJOA 2ALYB 2ON8A 3ZRCA 4Y7NH 1L5PA 4UP8A 3KUCB 1EIGA 2KBNA 2YV5A 5HURA 3AEDB 5J17A 1BF4A 4LFBQ 3C19A 1GUTA 3HOZH 4DV5Q 3RNCC 1VR9A 1P1AA 5TR5A 1QF6A 4LK0M 3CHBD 1WTQA 1LABA 3A8JE 4DNIA 2E2IB 1JROA 3AEAB 2QDBA 3K8AA 1E8WA 1WZ3A 3K57A 3R93A 4BXXG 3Q69A 4JE3B 5JJZA 2JSOA 3E9HA 1IPGA 1Q3LA 3M95A 1LTRD 2KUMA 2Z6BA 2AX5A 4ZK9B 3GS2A 3BZKA 2JXTA 3P75A 2DYMA 3MHZA 1F52A 2CH4W 2ZNVC 5G55A 4HMIA 4F1SA 4KX6B 5DPWA 4UDUC 1XLQA 1YNJC 1F9JA 3OIQA 2L3ZA 2RPVA 3N6RA 1Q1EA 1E1OA 1SE4A 4NP5A 2EJGC 1IYJB 4BY7H 2ZW0A 1Q46A 2JYOA 4LAAA 1EY4A 2LS01 5ELOA 2WAQG 4QL5A 5M3MB 3KVFB 1IYUA 4Y7NB 1U4PA 2B2UA 4UHVA 4UY8C 1G51A 1T0SC 3DEOA 2PW7A 1I6HH 2KJRA 2EQSA 1GUGA 5FJ8G 4C3IB 1PGXA 2LFIA 4HDOA 3HOZB 1WXSA 3WA0A 4W9KA 1I3QB 3HHMA 3T3OA 1BVSA 1PLFA 1KLGD 4K3BA 3NVVA 3P42A 4U68A 3Q8CA 1TYGB 5FR6A 3GDEA 3ZNGC 3CF5A 1RFKA 4YTMB 3IHPC 5C0XI 2RHQB 2K39A 2EPBA 2N8NA 1ZKOA 2L05A 2CQAA 4CQNA 3MWYW 1JQ4A 3ZDTA 2F3VA 2DN8A 2ZTDA 4UP9A 1HZBA 2RA4A 1K8MA 3KUPA 2M4NA 4FO2A 4MGIE 2M2LA 4YWKA 3RZOH 4BY7B 3AFPA 2HTHA 3A54A 2KTRA 1L1OA 1GAQB 4M0WA 1AWDA 3DWMA 2AEHA 3S2DH 1WYGA 3PO2H 3K9PB 2AKWB 1S5DD 5CORA 1STGA 4IM2A 5G5HA 1I6HB 1RKNA 3L17A 2NVQH 3E6ZX 3KBGA 2PLPA 1DD2A 5ISRA 2L5TA 4B3SQ 2DAFA 4HAEA 3WIMA 2L00B 4XGAB 5LXIB 3SDLC 3HKZB 3CRLC 3AYHB 3IFDA 1IL8A 5AJ3Q 4L5RC 1UGJA 3UQBA 4QUFA 3MXNA 4ZOHC 1E7ZA 3OSOA 2B3AA 1ILPA 1YQ3B 4XX5A 1QCBD 4ZUJA 3SK4A 2FMCA 1B4OA 3H3VC 4IUTA 1RRBA 2G45B 2WXNA 1NMFA 1VQDA 2DJFC 1IXRA 4AQYL 4C3JG 2VUMG 4JIOU 4CHKA 4KDLB 3EJIA 4GDKB 4IM3A 1ZXIA 3IT6B 1IKLA 2NN6I 1KQSA 3RZOB 3LNNA 1N33L 2PQAA 4DDID 4URKA 2EJFC 4LJOB 3G6EA 3CCLA 3ZNHB 1K9MC 1MPEA 5KNDA 3PUVA 3S2DB 3PO2B 2K8BA 2IHFA 3OAWA 1JOOA 2DNFA 5AZHA 5M5WH 1SYGA 3HRZC 4NKLA 2L15A 1CTMA 1E90A 2KYWA 2NVQB 1SNMA 4ODGA 4JBKA 2GBMA 2L0TA 2A6EC 4A3GG 1TT2A 2K5DA 2FCQA 2XEWA 1KDBA 2ZT9C 2HHHL 3A55A 5JEAG 2KDFB 4LTUA 1HA5A 3NELA 1PXUA 5IYBG 3F2DA 1CK1A 3NY5A 2A69D 1E7PB 1I94L 2VH2A 3CCEA 3MXGA 3RLOA 4OVUA 5IOIA 5IP4D 1RTNA 3P20A 3GP7A 4KI0A 1HNXL 1HNZL 3SR6A 2N78A 2R93G 1NBWA 2PW5A 1GPXA 1DGSA 3S1QH 4A3PA 2KX3A 4Z9CB 1ZPSA 4LF4L 5G3LD 3RPFC 1OQQA 2L9HA 2EKIA 1A5RA 4JX1C 2N9PC 1FMAD 2AL3A 1E6EB 3S17H 4LFAQ 1HFGA 5CGKA 2O5JC 2MPMA 4YY3Q 1PYBA 2M56B 1P8LA 3J7AV 5BR8Q 2KK8A 4WJWA 4KJNA 5M5WB 1S72A 1PHJA 1KJTA 2K75A 3AI5A 1QZEA 4ILWA 3FHWA 1SXTA 2IY1B 5IP9G 3LB8C 2BH8A 3VH4B 1PFNA 2PE9A 2KMMA 3ZNZB 1MBYA 3Q8FA 2L0CA 2WXIA 2EYLA 1MJCA 4DR1L 3AE5B 1KLUD 1XLOA 4A3OA 1WTXA 3CMMB 4A3MG 1C4CA 3ZJUA 1S5CD 3U7ZA 1M8AA 4DR4Q 2B2WC 2N1VA 3S1QB 3ND9A 3J9CA 4X57B 5CHWA 3VXWA 5M3FG 1YNNC 3I8ZA 2F0GA 3DHIC 2F0IA 1I4RA 1EZ8A 4K6LA 2IYDB 1B3AA 4GZYC 3S17B 3DWPA 3SD5A 4IALA 3W5UB 3H6MA 4ICVA 1CZPA 3ONSA 5LLIA 4IWPA 2LFNA 5C4HA 3I3TB 1ZDVA 2WS3B 1YX5B 2JP1A 3H7SA 2UUAL 4HLEA 4JK1C 3KF8B 3NBIA 4N8FA 1EF1A 4K5XA 4QIWE 3RCZA 4RGNA 4AJYB 2C35B 3I70A 4BWGB 3Q14C 4IUMB 4GMVA 4MSQB 2A69C 1SNPA 1JICA 1Q1OA 2MHVA 4X65L 4QQBX 3VR4A 2IPKD 5C3EG 3I73A 2IO3B 2LVPA 2WDQB 4EFOA 4I7ZC 2MJ3A 5C4JH 1RCVD 5M5XH 1I5FA 2IO2B 3A1QA 5D7GA 3RULA 3EFCA 4WH4A 1Y1WH 1GM5A 1STBA 1GG3A 4FJVB 1E7UA 3CWIA 4A9AA 1C77A 1LT3D 2QJLA 2WXHA 3CP0A 4UPAA 5E6NA 2JX5A 1UNSA 1EYCA 3H3VI 1E5WA 4HSVA 4II2B 1V86A 1C79A 2KANA 2HIXA 1NTGA 2KEEA 3I4MG 2B76B 4C80A 3UDGA 2RDHA 1SJHD 5FLXL 2UU9Q 1KRSA 2Z4IA 5C44H 2YEPB 3ABVB 4A20A 2L1BA 3R3MA 1HFNA 1SYEA 4GOPB 2N88A 5J22A 3OG5A 4NAWB 1MFWA 3VR8B 2M9VA 2VQFL 3TCAA 2CWAA 3A9JA 3H94A 4IPDA 2WXJA 3EC8A 3X3MA 1F9QA 4X62Q 1PH6A 1EY7A 1EY9A 4YTNB 4G7OC 2PI2E 4JW0A 2WXLA 1TS3A 3TS2A 3V60A 4A8XC 4ZHPA 1F2RC 1YJWA 4YT0B 1VQJA 4HPPA 1OXVA 4R8NA 3QIJA 1K52A 5C4JB 1C48A 3T51B 5M5XB 2YTVA 1EEID 4BBSH 4IDIA 1FNUA 4HJKA 1Y1WB 1MJEA 2MO1A 4DR5Q 1SGHA 1TGZB 1Q5WB 2LUMA 3LYYA 1J7BA 3KUZA 2B2UC 2WKDA 2K9XA 3W9CB 3DM1A 2KWUB 4AWJA 2K3UA 2ZCBA 1B3QA 2NPTB 3NHHA 4A93H 4HCEA 5C44B 4QUCA 4C00A 1YN3A 3SXHA 1STYA 2Y0SG 3FKIH 1Y69U 4DFAA 1DOIA 4L5TA 3I3CA 1JT8A 3R3OA 4IC7B 2N7JA 1EU4A 3V96A 3C3LA 1PV4A 4ZHOA 2MSED 1K51A 3L13A 1WTOA 2CHBD 4DBGA 3EGRA 1T5XD 2ZTEA 2KQSA 1NR2A 5IGGA 4M00A 5D3IB 3TUOA 1Y8PB 1LFDA 1IGCA 1L4DB 3LDZE 3CMAA 4JQWC 1X3FA 3EHVA 1EEFD 4EVOA 3HOYB 3QQ8B 4BBSB 4DUYL 1IBMQ 2BYTA 3RZFA 4BS9A 2FBWB 1RODA 3I5JC 3NK9A 2OJWA 4DR7Q 2LJ5A 3VYRA 4DHZE 2OQKA 2PKOA 2FNJB 2K28A 1N32Q 2F0HA 1SN8A 3H91A 4A93B 2RBMA 1KM7A 2A68D 3JAMi 4KKIA 1AEXA 2KCTA 2N7DA 3FKIB 1YI2A 1ZE3D 2INPE 1A2TA 2JA7B 3E3XA 3IFWB 1TS5A 3PO0A 2OTLA 1H9JA 4A6QA 3TEYA 1Z47A 4MJSA 1C9FA 4EZJA 3QO2A 2KCNA 3DXJC 3MTSA 1BR9A 3ZW3A 5G3LF 2JA8B 5JPMC 1ET6A 2BS4B 1ACCA 1J8CA 1WXQA 5IP7G 1IBXA 4LF9L 2L12A 2XSCA 4H2AA 3CCRA 2MP2B 1TZOA 5KYIA 4FF2A 2UXBQ 2KLGA 1XPUA 4KD4A 3ZQ4A 1O80A 4DV3L 1JB7A 1B44D 2TMPA 1PH4A 4S0RA 4P6VF 1RIPA 2A73B 1WGRA 3F2CA 3TEHB 4TRDA 1FFVA 3LWEA 1CZGA 4K2KA 3JSVB 1O7IA 3WOFA 4QIWB 4A76A 4LNKA 1FO4A 4JBMA 1JRPA 3HS0C 2RR9A 5CBEE 1Q10A 2KVRA 5C4XH 3H8HA 1DOYA 5IY0A 4KHPQ 3CXCA 1CJEA 3PIPA 2HE7A 1ZKHA 4ARCA 2JWUA 5FLXE 4FVMA 5EKLA 1V49A 1N62A 4B9XA 1XLNA 2XTIA 5AUKA 3WOEA 3H6NA 3H1UA 3ZXRA 4J1MA 1V80A 1WE6A 2LZ6A 2E5LL 3APDA 4DK5A 2V4DA 2VZAA 3HRDD 4WWNA 4O42A 3BK2A 1BCPC 4A3DH 2KJ6A 4WJ3M 3NS8A 5BMHA 2NYZD 5C0XH 4XT1B 2F0WA 5FLMH 4OELB 4NY0A 1HEZE 1NNXA 3EQLC 2V0GA 5JEAJ 1U4AA 4RM8A 3PPAA 1F9SA 4F88A 4V190 3A5ZB 4WJQA 1F2RI 4GN5A 1DJRD 1XJVA 4FF4A 1H8CA 4JI4Q 1OXSC 1YQ4B 3QIAA 1SYCA 2RCNA 4XQQA 1JC7A 1CHQD 2F0MA 2NVTH 2OOBB 4I6LB 3VYSA 1IYFA 1FGUA 3BS1A 3PV0A 3J81j 3DHQA 1D2BA 3A9KA 2K14A 5C4XB 1DXMA 4KK7A 2M8SA 2RCFA 2WX0A 3P4QB 2F0DA 4II3B 4KDIC 3BVMA 1QZGA 2VNUD 2G4SA 5EBCA 3BYYB 2JA6G 3GTJH 2W9NA 2CHZA 2ZEQA 3EVQA 4L63B 1VLBA 4LFBL 2K6DB 2PCFB 2JZZA 4KIKB 2G9HD 1YVCA 5EDSA 4DV5L 4P73A 2RMMA 1G2TA 4S17A 4X3SA 4A3DB 3J81E 2LRUA 2WXMA 3TZUA 4EKUA 1F1HA 1E8XA 1YD8U 1QUQB 2QDLA 5E4WC 5CMDA 2QCZA 1CZWA 4K81A 2AYOB 5D94A 4US8A 1WTHA 4FADA 4EZLA 1ZUD2 1D5MC 3Q3JA 5A2QL 3D6WA 4H44C 4F7XA 4B3MQ 2NN6H 2WXOA 4KGSA 3OPOA 1NBFC 3DBHI 5FOBB 5K36H 1DM0B 4M8MA 5C2TB 3V6CB 2NVTB 1V43A 3GO5A 2O4XA 2KC2A 2A74C 3OJ4B 2FIDA 4CKEA 2HT1A 5E4XA 4ZDVA 4B08A 4DV1Q 1QOAA 3MXUA 4DF7A 1G2SA 3NBHB 2KENA 1QE6A 1WGHA 1TS4A 4DAVA 3GTJB 2KD0A 2LVQA 3FILB 3Q8EA 3MC9A 1GUSA 2MUYA 4ZLTF 2OCEA 4KD3A 5IT9E 2ZXOA 1I6VC 4ANVA 2B8FA 3STBC 2EMSA 3GTMH 1QQRA 4G7HC 4YL8A 2I46A 1MHWC 1WVLA 4PMBA 4DAMA 2W82A 2DYBA 3IL8A 4FLHA 1PZID 4YCUA 3EROA 1YHBA 1JJGA 2Q8RE 1OEYJ 3AE9B 4TVAB 3LXFA 4OEMB 1C1YB 1L2FA 2NVYH 3ZJTA 3M4OH 4XXEA 3I4NG 3GTQH 2HDEA 4XYOA 4DAYB 1HZ5A 2VW9A 1QT9A 2VZKD 2C5LC 2MJDA 5KIXA 4ZRIA 5D14A 2DYOA 2JY6A 2F52A 2JK8A 1P3QU 4HXDA 4AOFA 1FRDA 3KJOA 4RF1A 4BAXA 4IPCA 1J19A 2K01A 2IX0A 4P71A 1VQEA 3J7A5 5J39A 4B3SL 4LF6Q 4RA8A 5ELFA 3L7ZC 1ICWA 3GTMB 1VMCA 3KYHC 3PSEB 4QAYA 2QKIC 2CH4A 4L23A 1TXYA 1EF5A 5AJ3L 1Z7TA 3QOLA 2D5GA 2BKFA 3KDFB 1FYCA 3V05A 3S1RH 2UUCQ 2VRRB 3QAQA 4BOZB 4MM3B 3ZO5B 2R2OA 2YEPF 2K05A 4ZQ3A 1PDXA 1EZ6A 3WDNA 2FMMA 4YWLA 2UXCQ 1D7QA 2WDRB 3NHEB 4C7ZA 2NVYB 2NR2A 3M4OB 2NTTA 5FO8B 4HVBA 1VCIA 1WR1A 2R3ZA 4PS8A 1V8QA 4ZRJA 3TDQA 1EY5A 4G4KA 1TWGH 2D07B 1V1PB 1TY0A 1JE4A 3OYYA 2ZNVB 1UGMA 2A6HD 2BW2A 2HDLA 3D4DA 4BKGA 4LW1A 1TJEA 4JC0A 5KGUA 4HEA1 2KHJA 2WV6D 1CI3M 1BT0A 1OTCA 1OGWA 2A5UA 3NS1A 1MG8A 3PUWA 3M3YH 1B2TA 2N1WA 3AEEB 1X56A 2EOTA 4P72A 1I4PA 3DLLA 3DBLI 1W6KA 3K81C 2SAKA 1BOSA 4GNXA 3NENA 1WTRA 3DDCB 5CHFA 2X6LA 4A90A 4J3OD 1C4QA 3P1MA 4PMWA 4MDKE 1A6XA 1JWAD 1JRUA 3VR6A 5KNBA 4EE2A 2DNCA 5TSSA 3S1RB 3VA5A 1HNWQ 1L6VA 1T6BX 2I2YA 4DUZQ 1S3OA 3ITPA 2XWBB 2RSUA 3A33B 4IUQA 1V1QA 4DXFA 2EYPA 3H3VH 2L83A 4JWSC 4QB4A 1SFOH 2Y3AA 1CQVA 4FHKA 3N20C 1KNAA 1TWGB 2FIFA 3DBSA 3SEBA 1M4VA 2MLBA 3AB9A 4LFAL 4IZ8A 5IGDA 4YY3L 2QIEB 3JW0X 4R1JA 4A75A 2F0FA 5T1GA 5BR8L 4TQ1A 1CFMA 2BT6A 2Q8IB 2LD9A 5GAHC 4DK1A 1DYQA 4DV7Q 5C3XA 3M3YB 1T0YA 3N9YC 2N3SA 3UDXA 5BN4A 2D62A 3K5MA 2J4XA 2JU6X 1ENFA 2LVOA 1PZJD 4DHJD 2WAQE 2H5XA 1S5FD 2H1EA 3BDOA 5T8IA 2BVCA 3M4PA 2AL6A 2MNAA 3ML8A 3RZWC 1WE7A 2FCSA 2HDMA 2JA5G 3P2BA 2K33A 1WJJA 3AU7A 3RD4A 4A3FH 3MTNB 4HK2A 3C0RB 4WAFA 2KOXA 2CU1A 4DR4L 1L0VB 3HOWH 1SYFA 3CIRB 5H8YE 3KYCD 2LXAA 3KOJA 3DCGA 4GDLA 4ME3A 1R4QB 1SFOB 1ZYRC 2NBFA 2M17A 3JVZX 4G57A 4RKLA 2HTME 3N1XC 1X3QA 2K7VA 2YYZA 1WJ4A 4B6WA 1X3GA 4TUUA 4X64Q 2DY8A 2JXXA 2RKSA 3OW2A 4CGYB 1YNJD 5IGEA 3AM9A 3V3XA 1NENB 1HXYD 2D5DA 1I4GA 4IO9A 1WX7A 2D0OA 4G50A 1SE3A 4FNFA 2KAJA 2NBUA 2XWJB 2MBHA 3EA6A 4OGQC 1SF0A 3WANA 3CKIB 3RI7C 5IYCH 1PH7A 3EN2A 1AYFA 3T53B 2R7ZG 1NYRA 3T56B 4OO1G 4A3FB 5KEEA 4HJGE 4HR7B 3F8TA 1EWHA 5I9OA 2L8JA 2NBVB 3Q3MC 1Y8OB 3HOWB 4JGHB 2N49A 5E3FA 2VQEQ 5FO7B 3BU2A 2PYKA 3BVZA 4RFBA 1Y8RC 2HCIA 4NDXA 2CKHB 1VQ6A 2AHOB 3VUWA 1WRIA 3GE8C 1SMYC 1TQOA 2DJGC 2K5PA 3J80L 1VQ9A 5COYA 1SLJA 2KN4A 2UU9L 5F2DA 1HHVA 4I65A 1VCBA 4DAPA 1YQBA 2WKCA 4LNFA 2O6VA 4IWOA 2XVSA 3HOVH 1N63A 2DUDA 1JALA 4IJLA 4YSYB 3ZYYX 4X62L 1WX8A 3HVZA 3W1SA 1ZOYB 1RF2D 2NUCA 2KWVB 2V3PA 5DPSA 4HEDA 2KNBA 2K8HA 4ZKBB 2Y5CA 5BYSA 4K1RB 3HG9A 4XWWA 3K59A 3N3KB 1H9SA 4WIPA 3DHHC 4A3BG 2ES2A 1A62A 3TS0A 4DR5L 3BDLA 4KZ0A 5M3MG 3AE1B 3MJWA 1V9PA 1UWVA 4WWMA 4CDDC 2BF8B 3AN1A 3ZNID 4A3JB 3RN9C 4JWUC 1YJNA 1L4ZB 2FINB 3EBEA 2N9XA 4ZAIA 1RFAA 2K22A 3RR5A 4LNNA 4C3IG 1KLVA 4MH8A 1UE6A 3UIOB 1O7LA 1WMHB 3ONAB 2WINB 2JN4A 1MJDA 1F2ZA 4OIKA 5FJ8H 4IQZA 3M63B 2HD3A 4BBNC 3UE0A 4FA6A 3L10B 3HOVB 1UWMA 3V61A 4RHRA 1V9JA 2WWZA 4A55A 2F4VQ 3R2IA 2MEKA 1Q8IA 4ANWA 4PV1C 2A6ED 3T1YQ 3RNAC 3Q22A 5J2RA 2AQ3B 4JI8Q 4ITKA 4R4CA 4BA1I 3RNEC 1B9RA 1I42A 2GBRA 2NBWB 2WFWA 3A5UA 4BKTA 2E75C 1D5ZC 3NVZA 4LK1C 4PG3A 4QMGA 1IBML 1FCLA 2WDVB 2LUEA 3N1YC 1PYWD 1P9DU 4HSPA 4HMJA 1JJCB 2VY3A 1K53A 3ML9A 4DR7L 4ZKCB 3NWSA 3PLUA 4CDFC 1FVIA 2B63G 1EQTA 1GUNA 1N32L 5BN5A 4JI1Q 2R2QA 3VYTA 4S3SA 3Q6SA 3KUDB 2LSSA 1PH9A 4PYZA 3ICEA 4W9DA 4RMAA 1Q7YC 1GJZA 1EIHA 4KV2A 4GLAC 1IW7C 5GMVA 4GXBA 3A8IE 3JAML 2OWOA 2GI9A 2WLBA 1PTOC 1QKZA 4R4QA 2F1MA 3MEFA 1Q12A 1QVGA 2CWPA 1W3SA 3L3OC 4K0KQ 2EY6A 4NJCA 2WDTB 1Y56A 3T8MA 3OHXC 1ONLA 3L9AX 3Q0AA 5IAAC 3SK8A 4M8NA 2L52A 1HR0Q 4JI0Q 2UXBL 2KTFA 2EY1A 5C3JB 5K5PA 3S14H 4C3JH 3UI3A 2PQEA 2OJRA 5HG2A 4RKBA 3P4RB 3T3NA 1TKEA 4DXAB 5EQ0A 1FCCC 2BTEA 2PPHA 3APFA 1JR0D 3PO2G 5LNK1 3QWNA 1HZ9A 2XN9C 1R4PB 1STHA 2EVBA 1YNND 1XO3A 2JT4B 4PZ8A 3R66C 1LUZA 1GB1A 2LGDA 2R6GA 3J80E 1RL2A 4KHPL 1HE8A 5I2YA 3HOUG 4GNXC 2N4FA 2WXQA 3NVYA 4PZ7A 3HOXH 1YNXA 3D3RA 1G91A 5KHQA 1E1TA 4JI5Q 4A3GH 4YIJA 2WYQA 3TEWA 2IY0B 5JEAH 3CPFA 4GLXA 1BO0A 5IYBH 1CT1D 1AE2A 1OTRB 2BYEA 4Y52H 3PIO3 3DHGC 1BNZA 3NOBA 3R7RA 2J42A 2OQ0A 4FXGC 1K0RA 3PRPB 1IGDA 3WAPA 1WOCA 4XYQA 2Q2UA 2ICEC 2XIWA 1PRTC 4PZ6A 3DBHB 4C3JB 1S4ZA 2HUGA 5J1ZA 1YJ1A 2BKRB 3L0OA 1DOMA 3PSIA 1C9OA 5CC4A 1QVFA 4HKZE 2RQXA 3B6YA 4HJ7A 4JI4L 3PF4A 2D0PA 1L1OB 4M0WB 1VQ5A 2K0PA 2H89B 3L16A 3FPUB 3SK6A 2BDNA 3KF8A 4JLCA 1D3ZA 1IYVA 2O6VD 2JE6I 1O78A 3MXPA 1DOKA 2F0OA 5JAVA 1N8RC 3HOXB 4RMFA 3CSFA 3U30A 3S24A 1P7FA 4A3GB 1J7AA 1FD6A 5HFYA 3DWGC 4HIOA 2BH2A 3ECIA 1C8CA 1TT5B 2F0VA 2Y0SE 1SDFA 1QJOA 2OTJA 1G8ZD 4MEMA 3MXNB 3NXWA 4ZRZA 2PPBC 4JI7Q 3B2FA 3PHXB 3R7QA 1HUMA 4LMQD 3MHBA 1XNRQ 4NNJB 1OEYA 2OEOA 4OZAA 4LCDE 1QOGA 1QLBB 4OONA 2NCNA 4KY6A 1L2NA 3E9SA 5EJWA 1W6JA 5M3FH 3TREA 2KKCA 2ZPYA 4B3ML 4MT5A 3UINB 1GHKA 1I4QA 2JPHA 1NDDA 2PQAB 2RF4A 3F2BA 5D3DA 3KH0A 1TS2A 4ZYNA 1TU2B 1VMPA 2BE5C 4JBWA 5CV6A 2XK5B 4OVVA 4DQOC 2Q5WD 1NCVA 4DV1L 1CA5A 4NQLB 4XC2A 3KK7A 4L8JA 1KHIA 3AH7A 4RNAA 4BBRG 1I7HA 3BY4B 4AQ7A 1OQYA 2WP9B 5NUCA 4EQ5A 5C3EH 1KC8C 3HM3A 3JAME 4DDGD 1QOBA 1FFUA 2FJ2A 2H4OA 1ZW7A 1ESFA 3K0XA 5C5MA 3ZUNA 1U4LA 3L08A 5IWAQ 3I55A 4G7ZC 4E74A 5DCNA 2PZTA 4TKOB 2GVBA 3GZNI 1O7ZA 1CKNA 5M3FB 4IFDH 4ZUIA 1VQFA 4DR3Q 4FXCA 2INNE 1KOTA 1WGGA 1GHJA 2NZHA 2EY2A 2AUKA 4R9WA 1F77A 3I4MH 1EQRA 2AQ2B 1H95A 3HIZA 1HR0W 2LKVA 3QK0A 4XT3B 1TWCH 4YWMA 2UXDQ 3CW2C 4KN4C 4EQNA 4W9IA 3MC0B 4XE0A 1TKWB 1B50A 4OX9Q 4DKAC 3HFZB 4K14A 5IYDG 2Q2TA 4GSWA 3W1SC 1XPOA 2MH7A 2KWCA 3FKYA 3VVWB 3F2UA 3SVMA 1SE2A 3FRPB 2A19A 3NTKA 4LF6L 2MBQA 1C0AA 2KJXA 1M94A 4GLSC 4LJPB 4XTCS 1E0BA 2SOBA 3NQTA 1EUVB 3FP9A 5G2NA 4JI2Q 5JJLA 4UAIA 3UE1A 2W54A 1S5ED 1SMXA 2UUCL 4HDQA 2BCOA 2C5CA 2BPSA 1TTNA 1HCZA 4N58A 2GBKA 3L54A 1V1OA 2UXCL 1XD3B 1KF6B 4DNTB 5C44G 1TR5A 1VD2A 4DA2A 1H9MA 2VH1A 1NI3A 1FD7D 3I4MB 1CKOA 1NVID 2WX1A 3C1FA 3TSSA 2K5VA 4ARIA 3VRAB 1MGSA 1TWCB 3CD6A 1YX6B 3RYTA 2J7QB 3NUHB 3V2TA 4RGTA 1H9RA 3A56A 3SK5A 2HD5B 1RHPA 4F8MA 2NTSA 3MA2B 3Q8BA 2EYMA 2YTXA 1B8AA 5JVH3 3DPDA 1R4NB 4DGZA 5D6JB 3A7AB 3QC8B 2DX5B 2EY5A 5M5YH 1TKGA 2V4LA 3DMUA 4NJ6A 1JOQA 3HOYG 4KHVA 3PO3G 2Z59B 5ELBA 3IAS1 5CV5A 3DOWA 3T4AC 1KH0A 3A1QB 1WF9A 2B2VA 3MEHA 1BCPD 1ZXHA 2FHTA 4A3EG 1HNWL 1EOTA 4OO1I 5FKAC 1V97A 1T0RC 2YVCA 4DUZL 2REXA 1YN5A 1E0ZA 2F4IA 2SNSA 4WORA 4W9HA 2PZUA 1N5WA 4FULA 1WJUA 5M9OA 3CCJA 1EM7A 4A93G 3N52A 1KAAA 1NEKB 4MELA 2A4ZA 4RG1A 4OL7A 4RGMA 1EL0A 3FKIG 2WGSA 2I5MX 1SNOA 4PQXA 2JA7G 1LQBA 2GBJA 3BJUA 5GQOA 1Z6HA 3S9WA 2RDBC 3E0JA 3TP8A 4IUVA 3NE5B 3J7YW 3AMZA 2X6GA 3CRKC 5LMNQ 1KD1C 1UBQA 2FAZA 3A8KE 1EY6A 4XQJA 2K50A 2KVZA 3AULA 4MGKE 4DPGA 2I1JA 2JA8G 1PYSB 4LF5Q 1ASZA 4JOIA 4DV7L 2I07B 5EPJA 2BGFA 4REZA 5IO9A 3TEXA 2K6AA 1K3RA 2TSSA 2EJMA 4FHJA 2R7DA 4IPHA 3Q3OC 3PUYA 4QF4A 2R92G 4C56C 4A3IH 1LTGD 4HRSA 3DM3A 1BKBA 3CCMA 4A3CG 2GVAA 3AEFB 1VS0A 2D9UA 1YOVB 4EZKA 5IGBA 4A3LG 3DUZA 2F0NA 1HH2P 1LTLA 1ENCA 2LXKA 1DOLA 3G7LA 2ASQA 3KQ4A 3I72A 2LGIA 1LT6D 1CSQA 3KWVA 2E74C 4K8JA 4JG2A 5HGTA 3RN5A 1NR4A 4F87A 3FAHA 4X64L 2M1MA 2ZPNA 2VL6A 3K80C 2FUG1 1HTPA 1A15A 4B9KA 2K5QA 2KZRA 1TBEA 2GLSA 1WFQA 2E76C 3G4SA 4HWIB 2EE1A 4HPMB 1EIYB 1ILQA 3SE0A 3AMUA 1OFFA 4DV6Q 2MQJA 3K9OB 4IOCA 5EE3A 1KNEA 2KEDA 3HUIA 4JCVE 2ID0A 1WXVA 1ENAA 4MN3A 2E2JH 3STBD 4A3IB 3GD7A 3TN2A 2KT7A 5CYUA 5ELNA 4BY1G 1ASYA 1IP9A 2V1YA 2DY7A 2B29A 2Z8LA 2LHEA 4FBJB 2VQEL 4F8CB 1RWSA 2L11A 1KRTA 2K52A 3CQZH 4YCVA 1HZCA 5C4XG 4IURA 4M8AA 4QCLA 2BDOA 2D3BA 2E2DC 4MTNA 5LXHA 1UUPA 5J3BA 1C78A 2M0AA 3ZKJC 2VZKB 3I63C 4WQOB 2L32A 5IGCA 4E3CA 1WYWB 3FILA 1LO5D 2LMCA 1WCMG 2BBCA 2WHIA 2JA6H 4C1NK 1FEHA 3GV6A 3ZLZA 1UD7A 2MGSA 1MKHA 4MJSB 4W9GA 4LWCA 4P16A 3DVGY 4TSSA 1VF5C 2VB3X 1FIQA 3PV1A 3NTIA 3CC7A 4K2LA 4FJYA 1IBXB 1QNUA 3UI2A 1FJGQ 3VTVA 3AEGB 1OXTA 3E0EA 4LUVA 1CUKA 4PMCA 3URYA 2E2JB 2A5HA 5L83A 1STAA 5KYLA 1KDAA 1OO9B 2PEAA 4XYCA 2J0MA 2UUBQ 1RYJA 1WM3A 1X54A 1WD0A 1PFSA 2IW3A 2SDFA 5GROA 3Q24A 4GOPC 1VQNA 1KABA 1Z9FA 1WH3A 1PFDA 2HJ8A 1MI2A 4CYEA 4HIDA 2Y5BB 1WM2A 2QC8A 2PE6B 1E3PA 2FUHB 2XGTA 1LTID 5GXGB 4ID6A 1II3A 3GTGH 4JPBW 1RLFA 4P1BC 2JSVX 2ZJPA 1RAXA 1JWMD 5CV4A 3TQYA 3W5OA 2L4NA 4A3KG 2DAJA 1RTOA 1FXTB 3P4SB 3X0WA 2JA6B 3H7PA 3NRZA 4HPLB 3CCQA 4ACFA 4QY7A 4OZCA 3H0GG 3NQIA 3I2ZA 5H1SE 4LUOA 2Y5PA 4AYBG 1P98A 2F4VL 1T0QC 2JEBI 4KSLC 4PT5A 2ZTCA 5LMNW 3T1YL 2QEXA 3IAYA 3W2DA 4CO7A 1QVCA 4JI8L 5KRUA 1F2MA 5EE9A 2F0KA 2VXWA 5I6WA 5FLXc 1PGBA 3MJ5A 3NVWA 4DHZB 2E3TA 2CJOA 5EKKA 5JHBA 4F7ZA 2MO0A 1EWYC 1YHQA 3KLWA 1JWSD 1XCQL 1V1PA 2WQYB 3I4NH 4MIUA 3RNFC 1NMGA 3KF6B 1NJIC 2IDYA 3A9KB 4C3HG 2O2VB 3GTGB 3W1BA 2ZJQA 4JI1L 4OHJA 3WWVA 1LXDA 3R8BA 1LTTD 3RN2A 1VQAA 1LM8B 1BCPF 1X1MA 3CSTA 3VH3B 1Q8KA 5C1ZA 2IGHA 5EPLA 3ND8A 2MX2A 4B95A 5JJIA 4DHJB 1PA6A 2OEDA 1WFYA 5L95C 2V4IB 3QOJA 3MFYA 3VUXA 4K0KL 3PUXA 2X8XX 4G11A 2G3QB 3U52E 3JYUA 4MHEA 3Q8DA 4RM9A 3VA7A 1T9HA 3GTPH 4ME5A 1HR0L 4JI0L 1XLPA 2F0LA 3LX0A 4NMZA 2J0KA 5JH5C 4W9FA 5EKIA 4GGQA 2Z6KA 4B3TQ 2RVLA 1H4RA 3Q23A 3I4NB 4NJ7A 2DZKA 1NSNS 2UWQA 4ICUA 3J81c 1FNWA 1UEBA 4NW2A 3GTQB 1YBYA 1LTBD 2LXCA 4KY7A 3N1ZC 3PLVA 1S40A 2MQHA 1KXLA 1N36Q 4O1NA 4GB9A 2Q2HA 4TQUS 4V0BA 1J0GA 1ZYRD 4JV5Q 1G6JA 1P0RA 2QEJC 3TBLD 4K5VA 3UQAA 2BWFA 1VDZA 5GADC 2ZM6Q 2MFIA 4RCOA 4J15A 1J9OA 3DVNU 1N60A 4L5SA 2DNEA 2YLMA 2L76A 3BINA 3K5OA 1F9RA 2EYFA 4JI5L 3U9SA 2B2VC 2JUOA 3ULLA 4KN7C 2EDGA 4HN7A 4CDCC 2RSNA 1Y1VG 2PMZE 5EAYA 1HQMC 4X3TA 1FPYA 3KLSX 2KC1A 4XDXA 3VYUA 4RAUC 1HTOA 1M1KC 2AUJD 1YIWA 2K25A 2CHXA 2WXGA 3ENEA 3KFUA 3AECB 4E71A 3GTPB 1HTLD 1HUNA 1WSPA 4OXPA 4WJPA 2WP8J 2IO0B 1N34Q 2EXDA 5IT9c 4OW0A 3PTFC 5HY6A 3Q3NC 3J81i 3U4VA 2FCMA 2D2CC 2Z1CA 3P7JA 3IBEA 3APCA 1XPRA 5A2QE 3VR9B 3M4QA 1TWFH 3KLSA 5D65A 3GE3C 4IWQA 1YIJA 4JOIC 1SMYD 3BYTB 1CQFA 3A4RA 4EUTA 1Q0WB 5E6PA 4AIMA 2ENBA 1DGJA 3R2TA 3K5NA 2NWGA 4R3DA 2JA5H 4FP5D 3M7GA 2KDBA 3Q3FA 4JI7L 4LF7Q 3NPPA 3IT4B 1XNRL 2LEKA 2KFKA 4B0MA 4C4VA 3C2PA 1KL9A 3OMCA 2CS4A 3RZDH 3IVFA 3BG3A 1K8AC 1GO3E 5CBAE 1SAPA 5LL6X 1QZHA 2DZIA 1A63A 5L37A 5LL6S 1E8YA 4ZRKA 2HQEA 3L0WB 1K3BC 3W1YA 2WB1G 1TWFB 1CSPA 5EBDA 1M90C 1BUIC 3ETRA 2RDGA 3K7UC 3GB1A 4PK1A 1MIUA 1SE8A 3UIPB 3SHLA 1LTSD 4OWXB 1T3QA 1K50A 2HQLA 2ZW1A 2LGYA 3GTLH 1VQBA 4HCNB 3TMEA 2Z9HA 3TJPA 4DV4Q 2PMVA 2DZMA 3M62B 3OLMD 3PZ8A 4A3FG 1NUCA 3RLFA 2IX3A 1C76A 2F0QA 4FYDA 2QILA 2P5ZX 4X66Q 2R7ZH 4DV3Q 3HOWG 2JA5B 4OO1H 2UYZB 3PREA 4LDTD 3X23A 3AE2B 3T16A 3BZCA 3ZVVA 3AQQA 3K7AH 1Q82C 3IFTA 5IWAL 3RZDB 2E2HH 2GN5A 2IJ0A 1X6OA 4E6IA 3U2SC 3I57A 4R4OA 2PNHA 4KZCA 2SEBD 1V5OA 4KKUA 1Z2MA 1PRTB 1Y8NB 4DR3L 5AUIA 5ELCA 1UWXA 1HJPA 4GOCA 2F3IA 1PH3A 4IUPA 1MI0A 3VHTC 2M19A 3J7ZC 3VQIA 1HQRD 3C1EA 3PS6A 2BYVE 1LT5D 1Y14B 2KCMA 3G48A 4KVGB 2LGSA 4CJ0B 1E2WA 2UXDL 2NS5A 3B08A 5C5LA 4NQKE 4OX9L 5IODA 2D3CA 5DM73 3DVGX 3W1GA 1WD1A 1KFYB 1TKYA 1XTCD 2C7MB 1PH5A 1K0SA 2G4DB 3DVNV 1AE3A 3AEBB 2KOLA 4IOIE 4K3CA 1IW7D 3VTUA 5JXVA 3MC8A 3U9OA 4GU2A 1NYQA 4GKJQ 1LGRA 1VZ6A 3PRMB 3KYDD 1PTOD 1HRJA 2D10A 3DEPA 1J5EQ 4JI2L 3FPPA 4BXXH 2RSOA 5DPTA 3K7AB 4N9PA 4NZLB 2E2HB 1SSOA 1XMQQ 1X3EA 1JW9D 2F03A 4EX5A 1U4RA 1UE5A 4A3JG 4A3BH 3HVDA 5CX3A 3S1NH 5A35A 3U58A 4BA2I 2MA9B 2CW0C 3IKJA 3NZSA 2WU5B 5KNCA 2ICIA 4DK0A 2EYJA 3W5VB 2N55A 4DNRB 3I91A 1LM0A 1UE7A 4DXGA 4CHTB 4C3IH 4IKGA 4OVZA 3HOVG 4KGTA 3T1HQ 1SE9A 2A1AA 1MVKA 1I3QH 2PMZB 3ZRFA 3HOZG 4ANXA 1GXDC 3TEZA 4C1NI 1WZ0A 4ZCKA 1XXGA 2Z4HA 3B2GA 4IPGA 1BXTA 4ABNA 4JI3Q 1STNA 3WAMA 2D3AA 3AE3B 4HJ5A 3TP6A 4USAA 1K8RB 4BOSC 1KIXA 3PZDA 2EXZA 4KKJA 3M85A 1PH1A 3UF8A 3EECA 1GOZA 3CC4A 1STEA 3DWAA 1FNVA 1SYBA 1EFWA 4GDKA 4K7UA 4A3BB 1V2YA 3AU4A 3UDFA 3S1NB 3ZTDA 1XEEA 4BY7G 1PRTD 3GV3A 2KO3A 3IAM1 1JORA 1WTWA 2ZXRA 2B63H 1K28A 4JYAQ 2NZOA 4MACA 1D1IA 2L1AA 3BVGA 1IBKQ 3SFEB 2AWOA 4PS7A 2WAQB 3GTOH 4DK3C 5ELDA 4DR2Q 1SYDA 1HPCA 1EWIA 2LY7A 2SNMA 3OIPA 5LMNL 3S15H 2O6VB 5IN7A 4US9A 2MJEA 3QX1A 2G5DA 1B7YB 5DPRA 4LF5L 2GRIA 2DZJA 1D4BA 3HKZG 1X65A 1VDVA 4JBJA 1JJ2A 4PS3A 3D6CA 5IOCA 2MCNB 2F3WA 1Z5SB 1I4XA 3D4WA 1VQPA 3MVVA 4M01A 3M3JA 2KA7A 4LUZA 2Z6KC 4H0LC 3BIID 2N0SB 1H9SB 1LACA 1VRAB 5EPKA 1S1QB 4YSZB 1CM9A 4MZ9A 1JE5A 2O5IC 3ER0A 3SHQA 1ZDXA 2VUMH 4NXNQ 2K32A 1VQ4A 3QA8A 1GUOA 5EE1A 1ROEA 3PHWB 2B63B 4K6DA 4P7IA 2QGQA 2KHIA 1H9KA 3BK1A 3HKSA 1C7YA 4CJ2C 1J6QA 1WJ6A 4POGA 3HOUH 3GTOB 2G9DA 2KVMA 1WJNA 3S15B 1NAPA 5JOBA 2CU3A 2BE5D 4NPSA 5AEKB 3ERQA 4HJAA 4GKKQ 2XRSD 3I4OA 4WQMA 2WACA 1F0ZA 3NG0A 1MHHE 2YTYA 4WWOA 3S1MH 4DV6L 3RNGC 4ZRPA 4WFN3 2BOSA 2N9EB 1A70A 2BYFA 2M0XA 5HI1A 4OWWB 1PH2A 3BDCA 4Q5VA 2K1FA 4PYUA 2RGFA 4XIGS 3EIVA 3Q6BA 4W9JA 2R93H 1IL2A 2FE8A 1J8IA 4BVUC 4JPSA 5BYRA 2MWSB 5CTRC 3OTOQ 2MBBB 3S14B 1RDPD 1FM0D 2VUMB 4WJNA 1OXUA 3M4YA 1E7VA 2K03A 3U4EG 4PNYA 3QJZA 1YJIA 1YEZA 3C8YA 2EIFA 2XK5A 1B70B 5BYQA 1WIAA 2KTRB 3U7DA 3HOXG 5I6YA 1UE1A 3K6OA 4BBNF 3SFDB 3HOUB 3F1ZA 1PH8A 3PUZA 1VF7A 2KJHB 1FL0A 3NZ3A 1RJTA 4WJ4A 3OJ3A 1UAPA 1EQQA 1ZP0B 2LJIA 5IP9H 2QHOA 4TKNA 3S1MB 4L6TB 3VFKA 1I4HA 3PIOA 2F0UA 5GAGC 4KV6A 1AFPA 1FJGL 2ZCCA 4NXMQ 1YHAA 1GC7A 4IM0A 3HM6X 1XMOQ 4A3MH 3N30A 2DENB 1EYAA 2FFKB 2R93B 3PRZA 2XNAC 2UUBL 3RFZB 2RDFA 4POFA 1VZ7A 4OWTB 2JZPA 3G6JB 1XNQQ 4TQ0A 1C3TA 2KDMA 1K8GA 5AZGA 3LGJA 5JJKA 4HROA 1YZ6A 3VDYA 3OMGA 3MHSD 4DV2Q 2PTLA 3DWQA 3PT2B 4KKTA 1YITA 3ULJA 1UH6A 4LLGM 2QW7A 1BQQT 4KGRA 3CCVA 3ZTCA 1R4MI 1AW7A 3SGIA 4GOPA 1HZ6A 4MTKA 4LF8Q 1BBUA 4NAWA 2FXQA 2G1EA 4TV3A 1PTOF 2HJ1A 4B3RQ 3P4PB 4BBRH 2X69A 2B2YC 4NAMA 1GUWA 3UGBB 5LMUQ 1CKMA 1MSHA 4R8IA 3K58A 1WI0A 2KQ3A 1Q86C 1AARA 1SR3A 1ZEQX 3OW7A 3RD2A 1V81A 2B8GA 2QCPX 3J80c 1QB5D 1XX8A 2QA4A 2N9KA 5GAEC 2BA1A 4A3MB 5C6AA 2KECA 1BCPB 3FMCA 4H13C 4P2CB 2EKEC 3O65B 5KHOA 1U0LA 3RMKC 3TMPB 1XYIA 3A0JA 3U4ZA 3TP7A 1S5BD 4ULLA 2KDIA 3SDZA 3KBXA 1UF0A 1EQVA 2MW5A 5DAUA 1XT9B 2JRHA 1G291 4ZRQA 5BO4B 2B3GA 2NPTA 2C60A 4YHHQ 1VQMA 2LXJA 4JI6Q 1UEAB 2BB6A 4HJ9A 1S3SG 4DV0Q 3JC66 1NE3A 1ML0D 1WGYA 2DGYA 1FR3A 3LWUA 2YU9H 2INDC 4FXDA 1A8VA 1WWTA 1N9WA 3QR8A 5IYDH 1L7YA 2F0EA 1X9NA 4BBRB 2CVRA 2KACA 3DBLB 2V1CC 2C9WB 2KQ7A 1X3PA 4G0NB 1EYDA 1P16A 3NEMA 3ERSX 2LASA 3B0AA 3VTWA 3J80i 4P75A 1PRTF 4O0AA 3WCQA 1IZ6A 5C3EB 4CJ1B 2B2TC 1B1ZA 4IFDG 3QCAA 1Y1WG 3FC4A 4LNOA 2F0TA 1L0XB 2QF7A 4GS3A 5BN3A 4HIMA 4LFCQ 4DR6Q 2D2QA 2OHFA 1EUJA 2MBOA 1Q81C 4B3TL 1NI2A 1IBLQ 3KWLA 3CCUA 3ZGZA 3FVQA 1UBIA 3TRZA 2DLBA 3AU5A 2K5WA 4RF0A 2W3SA 4DU9A 4MSMB 4OIJA 3TIXA 1VZ8A 1MSGA 1N36L 2YU9B 1JMCA 3CPWA 4JV5L 4X3KA 5E1FA 2LI5A 4YSXB 4AH6A 5LHY1 2J7ZA 1DZ1A 2L55A 3RNBC 2ZM6L 3G71A 4N6EB 3RLNA 1V5TA 1JMLA 1X55A 2M00A 2KMCA 2Z0SA 5I9PA 3OWEB 2F0SA 1VQOA 3L2PA 3KJPA 3DBRI 3VRBB 4BKSA 1EY0A 3HOYH 4GN1A 3PO3H 1BBWA 2WNMA 3U8ZA 3AE7B 1B53A 4YXDB 3D31A 1KRHA 2MP2A 4BBSG 2BS3B 1JB3A 4B9WA 5E6JA 2E6XA 1U9RA 2K5NA 4A3EH 5G5GA 3NWTA 1K8OA 1I35A 2V3NA 2NB0A 1CKNB 2BA0A 1SROA 2CCZA 1A0IA 1SSNA 1N34L 2IGGA 2UU7A 3MAQA 2JVCA 1MD2D 3NUCA 4IUNA 3JSVA 2KDEB 2JXMB 2KHSA 2MJ8A 3M7NA 1TIID 4RCNA 2JA7H 3JAMc 2KXJA 4EEWA 5CV8A 4KTAA 1U5KA 2HCCA 2ZJRA 4IOAA 3J81L 2OF1A 1TVXA 1O7YA 2Y0SB 4RGOS 2JA8H 2RD0A 1OQRA 1AZQA 4WJOA 3D0FA 3A9JB 3VR5A 2GA4B 3VR3A 5CR3A 1WTVA 2L0FA 3Q8AA 5M5YB 3PO3B 1W2BA 3K0YA 2I0QA 3NTHA 4EQPA 1SNCA 3LJ3A 2R92H 2IHEA 1ZGUB 4IG7B 3NJTA 5IP7H 4LF7L 1L1OC 4XWTA 3UDIA 3SU8X 4B0EA 3E9IA 3SR1A 4CBVA 4A3EB 1VQCA 2PO4A 4Q0FA 3S2HH 4A3CH 4A3LH 2I38A 3AE8B 4AYBE 3AV8A 4P1CC 3NSWA 1DONA 1EY8A 3N32A 2KLCA 5BMIA 2K5HA 3FDTA 4WRDA 2QSDA 2QMTA 2PW9A 3X3NA 5J18A 1V6EA 3PQIA 2PIAA 2KCCA 5IT9L 3PVLA 4O2DA 3PIP3 1ISNA 4GN3B 1UZXB 2PI2A 3CAMA 3CCSA 2HIVA 4BFRA 5EGTA 3IRBA 2PZWA 1PVOA 5AFWA 4CKCA 3P63A 4D2KA 5E6OA 3A7LA 4KIKA 2JZ3B 4X6AH 2Q2IA 2JRIB 4RWSC 1AZPA 3EFUA 4DV4L 4A3IG 1QWYA 4N9TA 2V3SA 3PCOB 2K04A 1X32A 3IG3A 1QUQA 3BZDB 1R9TH 4X66L 2R92B 1WTPA 4AQYQ 2XRQD 1GKHA 3E5SA 1GB4A 3CF6E 1TWAH 3S2HB 2JF5A 1GJXA 4BY1H 3D4RA 2IBIB 3TP5A 1EOVA 2BB5A 2GB1A 2LGXA 3Q2AC 2AQ1B 3EFXD 1N33Q 3AB5A 2ASBA 2R7FA 4RH6A 2I1KA 4FXKC 2K6QA 3T9LA 1P7EA 4WAAA 4DK6C 3I7FA 1PGAA 2L7RA 2ZVOA 3VUYA 4N9F4 4I6NB 1WXAA 1L0WA 3QG1A 2J0TD 2OT2A 3NBHA 4C2MH 1WY8A 3QWZB 1WCMH 1VQKA 4I6PA 2RHSB 3B9JA 2Q8TA 2HHHQ 4MGYE 3CC2A 3PGZA 1ICFB 2OXPA 2VS1A 1I94Q 4A3DG 1FXAA 4BZAA 2VB2X 2AWTA 2K1BA 5C0XG 5CV9A 1K73C 4KLKA 1HNXQ 2E8GA 2WIIB 1QILA 5FLMG 1HNZQ 4LNQA 4JL9A 2IWHA 1R9TB 2KX0A 1YJ9A 2R61A 2AMCB 2ATWA 2ACZB 2ZZPB 3VAWA 1CHPD 1DOXA 1SNDA 3O13A 3J7AF 1TWAB 4LF4Q 4GKJL 1XQQA 1BDOA 4QJFA 4BY1B 3K5LA 5E7NA 2LHDA 1J5EL 2WXPA 4M1UB 4J6HA 4CDEC 5C3WA 2KFJA 1GUAB 4XDDA 3KF6A 3W3AA 5FO9B 1XMQL 2A68C 1PUTA 2Z0DB 4KSKC 3RNUA 4KMUC 3PGEA 4DAYA 3V6EB 2O2VA 1GD7A 3CQZB 1AP0A 1BMLC 2JYEA 1SJED 4K5WA 2WXFA 4OZBA 2BWES 2INCC 4UP7A 2NVXH 1LT4D 4C2MB 4YWGG 2CFMA 1FGBD 4A3KH 1WCMB 1IKMA 1CMXB 3T1HL 5CV7A 3S16H 1EYGA 1E9MA 2IO1B 4IUUA 4HIKA 1NY4A 3H0GH 4DR1Q 4BKSD 3AE6B 3QJYA 3HEJA 1E2VA 4XDCA 4WWPA 1E22A 1F2LA 2JJQA 2NVUI 4Q2JA 4JI3L 3I9V1 1A3TA 1SEBD 3KDFA 4J8QA 4J6IA 1E24A 4P74A 3HGBA 4EQOA 4MM3A 3I90A 2NN6G 2KHWB 5K36G 4A4IA 1WRDB 1KTKA 2QDFA 3MP9A 4WURA 2IT1A 1FRRA 4IJHA 2NZ1D 3OWFA 4C3HH 2WXRA 4LJZC 4K7WA 2UUAQ 1YNTE 1N6ZA 5I4DA 4JYAL 2NVXB 4APVA 2ZJDA 3RUZA 2LMCB 5HGQA 4FDBA 3EUB2 4A3KB 3GQBA 1IBKL 4TMAB 4IW0A 2DBYA 3S16B 3GOEA 2GOWA 2WU2B 1D5XC 4DR2L 4W9LA 1PZKD 4DN4M 1LV9A 2WB1E 4X65Q 3H0GB 1YN4A 5JVG3 2K8CA 1D8LA
chains in the Genus database with same CATH topology
4HCSA 2AWNA 1OXXK 1QOHA 4AYBB 1F9PA 3RMHA 1IHZA 2H88B 3IXSA 1B9MA 2WXKA 1A2UA 1JWUD 3CU7A 2IGDA 5HHDG 4N59A 2PVGC 1QG7A 3OOCA 4IFDJ 5IIFA 2EYOA 2W3RA 2EYHA 4FF3A 4C3HB 1Q90A 1JOKA 3H09A 3BWUD 2PVOD 2IL8A 3HP3A 4HTHA 1A3UA 1AN8A 1ET9A 2X38A 2JYTA 2JQRB 5ELEA 2BS2B 1ESRA 4FF1A 1JCKB 2F0JA 5IGFA 5I2XA 1SNQA 4C7YA 1E10A 5DM63 1PTOH 2KWDA 1B9NA 1SB3C 3ZJVA 4IN3A 1MHXA 4KHZA 1N5XA 1LLRD 2DWQA 2NMQA 2O2LD 2B39A 2CJNA 1I50B 4ZYSA 1QNKA 3VR2A 2N9LA 1JWBD 3HZXA 1ZXTA 1RD9D 1HA6A 5T1IA 2EZVA 1PMRA 4KKSA 1YJJA 1TY2A 1BBXC 4L1BA 1C4AA 3PMFA 1EU3A 1PFBA 1Y1VB 5JPNC 5FK9C 2JEAI 1G6ZA 4H7BA 1D6EC 5C4ZA 1U4MA 1PTOB 1R7SA 1EFID 1K83B 4EGVA 4IFDI 4YTPB 3GTKB 1F2YA 3AE4B 1L0YB 4KY5A 1QOFA 2J53A 1XWEA 1J7CA 1SIJA 4K8IA 1D1KA 1YMHE 3I4LA 5BMGA 2CW0D 1VJKA 4U673 1N61A 4XQNA 4AS1A 3D8GA 3E56A 1XF5L 2MP1A 1KDCA 1EWCA 3TBIB 3PZ7A 2F0PA 3KLRA 1IUEA 1FXIA 2B2YA 1T5EA 1L6UA 1JQYD 2B2WA 2A6HC 3MFGA 5MPOA 4RHSA 1TWHB 2PNRC 3QB3A 3C46A 2WB1B 5DEHA 2J52A 2KQ4X 4X3UA 1XCTL 3TZDA 5EE0A 1LTAD 3FEWX 1Q1BA 3T13A 1WGKA 3GTLB 2ONQA 5H92C 1SBBB 3NP8A 2W55A 2C9OA 4CKBA 2R7ZB 1PDQA 5DNFA 1V8CA 5FR3A 1A3VA 5C0XJ 3P1HA 4L2YA 1CA6A 1DCZA 2ZXPA 3MZ5A 2IX1A 1E2ZA 4GDLB 2EELA 2B2TA 1RM6C 1PFMA 1BUVT 1C4PA 3L4PA 4KJOA 2ON8A 1L5PA 1EIGA 5HURA 3AEDB 1BF4A 1GUTA 1VR9A 1QF6A 4LK0M 3CHBD 1WTQA 1LABA 3A8JE 2E2IB 1JROA 3AEAB 2QDBA 3K57A 3R93A 3Q69A 4JE3B 5JJZA 2JSOA 1Q3LA 1LTRD 2KUMA 2AX5A 4ZK9B 3GS2A 2JXTA 3P75A 2DYMA 3MHZA 4HMIA 4KX6B 4UDUC 1XLQA 1YNJC 3OIQA 2RPVA 3N6RA 1Q1EA 4NP5A 1SE4A 2EJGC 2ZW0A 2JYOA 4LAAA 1EY4A 2LS01 5M3MB 1IYUA 4Y7NB 1U4PA 2B2UA 3DEOA 2PW7A 1PGXA 1GUGA 2LFIA 4C3IB 3HOZB 1I3QB 3T3OA 1PLFA 1KLGD 3NVVA 3P42A 4U68A 3Q8CA 1TYGB 1RFKA 4YTMB 5C0XI 2EPBA 1ZKOA 2CQAA 4CQNA 3MWYW 1JQ4A 2F3VA 2DN8A 2RA4A 1K8MA 3KUPA 4FO2A 2M2LA 4BY7B 3A54A 1GAQB 4M0WA 1AWDA 3DWMA 1WYGA 1S5DD 5CORA 1STGA 5G5HA 1I6HB 1RKNA 3E6ZX 3KBGA 2PLPA 1DD2A 5ISRA 2L5TA 4HAEA 3HKZB 3CRLC 3IFDA 1IL8A 1UGJA 4QUFA 3MXNA 4ZOHC 3OSOA 1ILPA 1YQ3B 1QCBD 4ZUJA 3SK4A 2FMCA 1B4OA 3H3VC 4IUTA 2WXNA 4C3JG 3EJIA 4GDKB 1ZXIA 3IT6B 1IKLA 2NN6I 3RZOB 3LNNA 2EJFC 1MPEA 5KNDA 3PUVA 3S2DB 3PO2B 1JOOA 1SYGA 3HRZC 4NKLA 1CTMA 2NVQB 1SNMA 4ODGA 2A6EC 1TT2A 2K5DA 1KDBA 2ZT9C 3A55A 5JEAG 4LTUA 1HA5A 1PXUA 1CK1A 2A69D 1E7PB 3MXGA 1RTNA 3P20A 3GP7A 4KI0A 3SR6A 2PW5A 1GPXA 4Z9CB 1ZPSA 5G3LD 3RPFC 1OQQA 2L9HA 2EKIA 4JX1C 1FMAD 1E6EB 1HFGA 5CGKA 2O5JC 2MPMA 2M56B 3J7AV 4WJWA 4KJNA 5M5WB 4ILWA 1SXTA 3LB8C 1PFNA 2KMMA 1MBYA 3Q8FA 2L0CA 2WXIA 2EYLA 3AE5B 1KLUD 1XLOA 1WTXA 1C4CA 3ZJUA 1S5CD 3U7ZA 1M8AA 2B2WC 3S1QB 3ND9A 3J9CA 1YNNC 3I8ZA 2F0GA 2F0IA 1I4RA 1EZ8A 4K6LA 1B3AA 4GZYC 3S17B 3DWPA 4IALA 3W5UB 3H6MA 1CZPA 2LFNA 5C4HA 1ZDVA 2WS3B 2JP1A 4JK1C 3NBIA 4K5XA 4RGNA 3I70A 4BWGB 2A69C 1SNPA 1JICA 2MHVA 3VR4A 2IPKD 3I73A 2WDQB 4I7ZC 2MJ3A 1RCVD 5D7GA 4WH4A 1STBA 4A9AA 3CWIA 1C77A 1LT3D 2QJLA 2WXHA 2JX5A 1UNSA 1EYCA 4HSVA 1C79A 4C80A 2KEEA 2B76B 2RDHA 1SJHD 5FLXL 2Z4IA 2YEPB 3ABVB 2L1BA 1HFNA 1SYEA 2N88A 5J22A 4NAWB 3VR8B 2M9VA 3H94A 2WXJA 3X3MA 1F9QA 1EY7A 1EY9A 4YTNB 4G7OC 2WXLA 1TS3A 4ZHPA 4A8XC 1F2RC 4YT0B 1OXVA 4R8NA 1K52A 5C4JB 1C48A 3T51B 5M5XB 4IDIA 1EEID 1FNUA 1Y1WB 2LUMA 3LYYA 1J7BA 2B2UC 2WKDA 2K9XA 3W9CB 3DM1A 2K3UA 3NHHA 4HCEA 5C44B 4QUCA 1YN3A 3SXHA 1STYA 1Y69U 4DFAA 1DOIA 3I3CA 3R3OA 2N7JA 1EU4A 3V96A 3C3LA 4ZHOA 1K51A 1WTOA 2CHBD 3EGRA 1T5XD 1NR2A 5IGGA 5D3IB 3TUOA 1Y8PB 1IGCA 1L4DB 1EEFD 4EVOA 3HOYB 4BBSB 2BYTA 4BS9A 2FBWB 1RODA 3NK9A 3VYRA 2PKOA 2K28A 2F0HA 3H91A 4A93B 2RBMA 2A68D 4KKIA 1AEXA 3FKIB 1ZE3D 2INPE 1A2TA 2JA7B 1TS5A 3PO0A 1H9JA 4A6QA 3TEYA 1Z47A 1C9FA 3QO2A 2KCNA 3DXJC 3MTSA 1BR9A 5G3LF 2JA8B 5JPMC 1ET6A 2BS4B 1ACCA 1WXQA 1IBXA 2L12A 2XSCA 4H2AA 1TZOA 5KYIA 4FF2A 4KD4A 3ZQ4A 1O80A 1B44D 2TMPA 4P6VF 2A73B 4TRDA 1FFVA 3LWEA 1CZGA 4K2KA 3WOFA 4QIWB 1FO4A 1JRPA 3HS0C 5CBEE 1Q10A 3H8HA 1DOYA 1CJEA 4ARCA 2JWUA 5FLXE 4FVMA 5EKLA 1N62A 4B9XA 1XLNA 5AUKA 3WOEA 4J1MA 2V4DA 3HRDD 4O42A 3BK2A 1BCPC 5BMHA 2NYZD 5C0XH 4XT1B 2F0WA 1HEZE 3EQLC 2V0GA 5JEAJ 1F9SA 4F88A 4V190 1F2RI 1DJRD 4FF4A 1OXSC 1YQ4B 3QIAA 1SYCA 4XQQA 1JC7A 1CHQD 2F0MA 3VYSA 3BS1A 3PV0A 1D2BA 3DHQA 5C4XB 1DXMA 4KK7A 3P4QB 2F0DA 3BVMA 2VNUD 5EBCA 3BYYB 3EVQA 4L63B 1VLBA 2PCFB 2G9HD 2RMMA 1G2TA 4X3SA 4A3DB 3J81E 2WXMA 3TZUA 5E4WC 4US8A 5CMDA 1CZWA 1ZUD2 1D5MC 5A2QL 3D6WA 4H44C 4F7XA 4KGSA 2NN6H 2WXOA 3OPOA 5C2TB 5FOBB 5K36H 1DM0B 2NVTB 1V43A 3GO5A 2O4XA 2A74C 4CKEA 5E4XA 4B08A 1QOAA 3MXUA 4DF7A 1G2SA 1QE6A 1TS4A 4DAVA 3GTJB 3FILB 3Q8EA 1GUSA 2MUYA 4ZLTF 5IT9E 4KD3A 2ZXOA 1I6VC 2B8FA 1QQRA 4G7HC 2I46A 1WVLA 4PMBA 2W82A 3IL8A 1PZID 3EROA 3LXFA 2Q8RE 3AE9B 3ZJTA 4XXEA 2HDEA 4XYOA 1HZ5A 1QT9A 2VZKD 2MJDA 5KIXA 5D14A 2DYOA 1FRDA 4RF1A 2K01A 2IX0A 5J39A 4RA8A 5ELFA 3L7ZC 1ICWA 3GTMB 1VMCA 2QKIC 4L23A 1Z7TA 3QOLA 2D5GA 1FYCA 3V05A 4MM3B 2YEPF 2K05A 4ZQ3A 1PDXA 1EZ6A 3WDNA 2FMMA 2WDRB 4C7ZA 2NVYB 3M4OB 2NTTA 5FO8B 1VCIA 2R3ZA 1V8QA 3TDQA 1EY5A 4G4KA 1V1PB 1TY0A 1JE4A 2A6HD 2BW2A 2HDLA 3D4DA 1TJEA 5KGUA 4HEA1 2WV6D 1CI3M 3NS1A 3PUWA 1B2TA 3AEEB 2EOTA 1I4PA 1W6KA 2SAKA 1BOSA 1WTRA 2X6LA 4A90A 4J3OD 1C4QA 3P1MA 4PMWA 1A6XA 1JWAD 3VR6A 5KNBA 4EE2A 2DNCA 5TSSA 3S1RB 3VA5A 1L6VA 1T6BX 2I2YA 3ITPA 2XWBB 4IUQA 4DXFA 2EYPA 2L83A 4JWSC 4QB4A 2Y3AA 1CQVA 1KNAA 1TWGB 3SEBA 1M4VA 3AB9A 4IZ8A 5IGDA 2QIEB 2F0FA 5T1GA 4TQ1A 1CFMA 2BT6A 2Q8IB 4DK1A 1DYQA 3M3YB 5C3XA 3N9YC 5BN4A 2D62A 3K5MA 2J4XA 2JU6X 1ENFA 1PZJD 3BDOA 1S5FD 2H1EA 5T8IA 2HDMA 2K33A 3AU7A 3RD4A 4WAFA 1L0VB 1SYFA 3CIRB 5H8YE 1R4QB 1SFOB 1ZYRC 2NBFA 4G57A 4RKLA 2HTME 1X3QA 2K7VA 2YYZA 2DY8A 2RKSA 4CGYB 1YNJD 5IGEA 3AM9A 3V3XA 1NENB 1HXYD 2D5DA 1I4GA 1SE3A 4FNFA 2KAJA 2XWJB 3EA6A 4OGQC 1SF0A 3CKIB 1AYFA 3T53B 1NYRA 3T56B 4OO1G 4A3FB 5KEEA 4HJGE 4HR7B 1EWHA 5I9OA 1Y8OB 3HOWB 5E3FA 5FO7B 2PYKA 3BVZA 4RFBA 2HCIA 4NDXA 1WRIA 1SMYC 1TQOA 2K5PA 3J80L 5COYA 2KN4A 5F2DA 1HHVA 4I65A 4DAPA 2WKCA 2XVSA 1N63A 1JALA 4YSYB 3ZYYX 3HVZA 3W1SA 1ZOYB 1RF2D 2NUCA 2V3PA 4HEDA 4ZKBB 2Y5CA 5BYSA 3HG9A 4XWWA 3K59A 1H9SA 4WIPA 3BDLA 4WWMA 3AE1B 3AN1A 4A3JB 4JWUC 1L4ZB 2FINB 4ZAIA 2K22A 4C3IG 4MH8A 1O7LA 3ONAB 2WINB 1F2ZA 4OIKA 4IQZA 3HOVB 1UWMA 4RHRA 4A55A 3R2IA 2MEKA 1Q8IA 4PV1C 2A6ED 3Q22A 2AQ3B 4ITKA 4BA1I 1B9RA 2E75C 1D5ZC 3NVZA 4LK1C 4QMGA 1FCLA 2WDVB 1PYWD 4HSPA 4HMJA 1K53A 4ZKCB 3NWSA 1EQTA 1GUNA 5BN5A 3VYTA 4S3SA 3Q6SA 1EIHA 1IW7C 3A8IE 3JAML 2GI9A 2WLBA 1PTOC 1QKZA 2F1MA 1Q12A 3L3OC 2EY6A 4NJCA 1Y56A 3OHXC 1ONLA 3L9AX 3Q0AA 3SK8A 2L52A 2EY1A 5C3JB 5K5PA 3UI3A 2PQEA 5HG2A 4RKBA 3P4RB 3T3NA 1TKEA 5EQ0A 1FCCC 2BTEA 1JR0D 5LNK1 3QWNA 2EVBA 2XN9C 1R4PB 1STHA 1XO3A 1YNND 1GB1A 2R6GA 3J80E 5I2YA 2WXQA 3NVYA 3D3RA 1G91A 4YIJA 3TEWA 5JEAH 1BO0A 1CT1D 3PIO3 1BNZA 2J42A 4FXGC 1IGDA 4XYQA 2ICEC 2XIWA 1PRTC 4C3JB 1S4ZA 2HUGA 5J1ZA 1DOMA 5CC4A 4HKZE 2RQXA 2K0PA 2H89B 3FPUB 3SK6A 2BDNA 3KF8A 1IYVA 2JE6I 1O78A 3MXPA 1DOKA 2F0OA 5JAVA 3HOXB 1P7FA 4A3GB 1J7AA 1FD6A 5HFYA 3DWGC 1C8CA 2F0VA 1SDFA 1QJOA 1G8ZD 4ZRZA 3NXWA 2PPBC 3B2FA 1HUMA 4LMQD 3MHBA 2OEOA 4OZAA 1QOGA 1QLBB 4KY6A 3E9SA 5EJWA 1W6JA 4MT5A 1GHKA 1I4QA 5D3DA 1TS2A 1TU2B 1VMPA 2BE5C 4JBWA 5CV6A 4DQOC 2Q5WD 1NCVA 1CA5A 3KK7A 4L8JA 3AH7A 4RNAA 1I7HA 4AQ7A 2WP9B 5NUCA 3JAME 1QOBA 1FFUA 2FJ2A 2H4OA 1ESFA 5C5MA 1U4LA 4G7ZC 2PZTA 4TKOB 1O7ZA 5M3FB 4IFDH 4FXCA 4ZUIA 2INNE 1GHJA 2EY2A 2AUKA 4R9WA 1F77A 2AQ2B 2LKVA 4XT3B 4XE0A 4KN4C 4EQNA 3MC0B 1TKWB 1B50A 4K14A 2MH7A 3F2UA 3SVMA 1SE2A 3FRPB 3NTKA 4GLSC 2KJXA 4XTCS 1E0BA 2SOBA 3NQTA 4UAIA 2W54A 1S5ED 2BCOA 2C5CA 1HCZA 4N58A 1V1OA 1KF6B 4DNTB 1TR5A 4DA2A 1H9MA 1NI3A 1FD7D 3I4MB 1NVID 3C1FA 3TSSA 4ARIA 3VRAB 1MGSA 1TWCB 3NUHB 3V2TA 4RGTA 1H9RA 3A56A 3SK5A 1RHPA 4F8MA 2NTSA 3MA2B 3Q8BA 2EYMA 5JVH3 4DGZA 3A7AB 2EY5A 1TKGA 3DMUA 1JOQA 4KHVA 5ELBA 3IAS1 5CV5A 3T4AC 1KH0A 2B2VA 3MEHA 1BCPD 1ZXHA 2FHTA 4HKQA 1EOTA 4OO1I 5FKAC 1V97A 1E0ZA 1YN5A 2F4IA 2SNSA 4WORA 2PZUA 1N5WA 5M9OA 1EM7A 3N52A 1KAAA 1NEKB 4OL7A 4RGMA 1EL0A 4PQXA 1SNOA 1Z6HA 3S9WA 3E0JA 3TP8A 4IUVA 3NE5B 3J7YW 3AMZA 2X6GA 3CRKC 3A8KE 1EY6A 4XQJA 2I07B 5EPJA 4REZA 3TEXA 2K6AA 2TSSA 2EJMA 3PUYA 4QF4A 4C56C 4HRSA 1LTGD 3AEFB 2D9UA 5IGBA 3DUZA 2F0NA 1ENCA 1DOLA 3G7LA 3KQ4A 3I72A 2LGIA 1LT6D 3KWVA 2E74C 4K8JA 5HGTA 1NR4A 4F87A 3FAHA 2FUG1 1HTPA 1A15A 2K5QA 2E76C 2EE1A 1ILQA 3SE0A 3AMUA 1OFFA 5EE3A 1KNEA 2KEDA 3HUIA 2ID0A 1ENAA 4MN3A 4A3IB 3GD7A 3TN2A 5CYUA 2DY7A 2LHEA 2Z8LA 1RWSA 2L11A 4IURA 4M8AA 4QCLA 2BDOA 2E2DC 1UUPA 1C78A 2M0AA 2VZKB 2L32A 5IGCA 3FILA 1LO5D 2LMCA 2BBCA 4C1NK 1FEHA 3GV6A 2MGSA 4P16A 4TSSA 1VF5C 2VB3X 1FIQA 3NTIA 4K2LA 1IBXB 1QNUA 3UI2A 3AEGB 1OXTA 4PMCA 3URYA 2E2JB 2A5HA 1STAA 5KYLA 1KDAA 1OO9B 1RYJA 1WD0A 2IW3A 2SDFA 3Q24A 1KABA 1PFDA 1MI2A 5GXGB 1LTID 4ID6A 1II3A 2JSVX 1JWMD 5CV4A 2L4NA 3P4SB 1RTOA 2JA6B 3NRZA 4OZCA 3NQIA 2Y5PA 2JEBI 4PT5A 3IAYA 3W2DA 5KRUA 1F2MA 5EE9A 2F0KA 2VXWA 5I6WA 1PGBA 3MJ5A 3NVWA 2E3TA 2CJOA 5EKKA 1EWYC 1XCQL 1JWSD 1V1PA 2WQYB 4MIUA 2IDYA 4C3HG 3GTGB 4OHJA 3R8BA 1LTTD 1BCPF 2IGHA 5EPLA 3ND8A 2OEDA 2V4IB 3QOJA 3MFYA 3PUXA 3U52E 4MHEA 3VA7A 4ME5A 1XLPA 2F0LA 3LX0A 4NMZA 5EKIA 2RVLA 3Q23A 3I4NB 1NSNS 1FNWA 4NW2A 3GTQB 1LTBD 4KY7A 4O1NA 4TQUS 4V0BA 1ZYRD 2QEJC 4K5VA 1VDZA 4RCOA 1J9OA 1N60A 2DNEA 3K5OA 1F9RA 2EYFA 3U9SA 2B2VC 4KN7C 2EDGA 4HN7A 2RSNA 1HQMC 4X3TA 3KLSX 4XDXA 3VYUA 4RAUC 2AUJD 2WXGA 3AECB 3GTPB 1HTLD 1HUNA 1WSPA 2WP8J 4OW0A 2D2CC 2Z1CA 3P7JA 5A2QE 3VR9B 3KLSA 5D65A 1SMYD 3BYTB 1CQFA 2ENBA 1DGJA 3R2TA 3K5NA 2NWGA 4R3DA 4FP5D 3M7GA 3NPPA 3IT4B 2LEKA 4B0MA 3C2PA 3OMCA 3BG3A 5CBAE 1SAPA 5LL6X 5LL6S 2HQEA 5EBDA 1TWFB 1BUIC 3ETRA 2RDGA 3GB1A 3SHLA 1LTSD 1T3QA 1K50A 2ZW1A 3TMEA 2PMVA 3PZ8A 1NUCA 3RLFA 2IX3A 1C76A 2F0QA 4FYDA 2QILA 2JA5B 4OO1H 3AE2B 3T16A 3IFTA 3RZDB 2IJ0A 4E6IA 3U2SC 3I57A 2SEBD 4KKUA 1PRTB 1Y8NB 5AUIA 5ELCA 1UWXA 4IUPA 1MI0A 3VQIA 2M19A 1HQRD 3C1EA 1LT5D 4CJ0B 1E2WA 5C5LA 5IODA 5DM73 1KFYB 1WD1A 1TKYA 1XTCD 3AEBB 2KOLA 4IOIE 5JXVA 1IW7D 3U9OA 1NYQA 1VZ6A 1PTOD 1HRJA 3DEPA 3FPPA 2RSOA 3K7AB 4N9PA 4NZLB 2E2HB 1SSOA 1JW9D 2F03A 1U4RA 3HVDA 5A35A 4BA2I 2CW0C 3IKJA 2WU5B 5KNCA 2ICIA 4DK0A 2EYJA 3W5VB 2N55A 4DNRB 3I91A 4DXGA 4CHTB 4IKGA 4OVZA 4KGTA 1MVKA 2PMZB 1GXDC 3TEZA 4C1NI 1XXGA 2Z4HA 3B2GA 1BXTA 4ABNA 1STNA 3AE3B 3TP6A 4USAA 2EXZA 4KKJA 3M85A 1GOZA 1STEA 3DWAA 1FNVA 1SYBA 4A3BB 3S1NB 1XEEA 1PRTD 3GV3A 3IAM1 1JORA 1WTWA 2ZXRA 4MACA 1D1IA 2L1AA 3BVGA 3SFEB 2AWOA 2WAQB 5ELDA 1SYDA 1HPCA 2LY7A 2SNMA 3OIPA 4US9A 2MJEA 2GRIA 1D4BA 1VDVA 3D6CA 5IOCA 2F3WA 1I4XA 3D4WA 3MVVA 2KA7A 4H0LC 3BIID 2N0SB 1H9SB 1LACA 1VRAB 5EPKA 4YSZB 1CM9A 2O5IC 1ZDXA 2K32A 1GUOA 5EE1A 1ROEA 2B63B 4K6DA 1H9KA 3BK1A 4CJ2C 3GTOB 2G9DA 2KVMA 3S15B 1NAPA 5JOBA 2CU3A 2BE5D 3ERQA 2XRSD 4WQMA 1F0ZA 2WACA 1MHHE 4ZRPA 4WFN3 2BOSA 1A70A 5HI1A 3BDCA 4Q5VA 4XIGS 2FE8A 1J8IA 4JPSA 5BYRA 3S14B 1RDPD 1FM0D 2VUMB 1OXUA 3M4YA 2K03A 3U4EG 4PNYA 1YJIA 3C8YA 5BYQA 5I6YA 3K6OA 3SFDB 3HOUB 3PUZA 1VF7A 3NZ3A 1RJTA 1UAPA 1ZP0B 2LJIA 3S1MB 4L6TB 1I4HA 2F0UA 4KV6A 1AFPA 1EYAA 2FFKB 2R93B 2XNAC 3RFZB 2RDFA 1VZ7A 2JZPA 3G6JB 4TQ0A 2KDMA 4HROA 3OMGA 2PTLA 3DWQA 4KKTA 4LLGM 1BQQT 4KGRA 1AW7A 1HZ6A 2G1EA 1PTOF 3P4PB 2X69A 2B2YC 4NAMA 1GUWA 1MSHA 4R8IA 3K58A 2KQ3A 3OW7A 1ZEQX 2B8GA 2QCPX 1QB5D 1XX8A 2N9KA 2BA1A 4A3MB 5C6AA 2KECA 1BCPB 3FMCA 4H13C 4P2CB 1XYIA 3TP7A 1S5BD 4ULLA 3SDZA 3KBXA 1EQVA 5DAUA 1G291 4ZRQA 2BB6A 1UEAB 1ML0D 1FR3A 3LWUA 4FXDA 1WWTA 2F0EA 4BBRB 2CVRA 2KACA 1X3PA 1EYDA 1PRTF 3WCQA 5C3EB 4CJ1B 2B2TC 1B1ZA 4IFDG 3FC4A 2F0TA 1L0XB 2QF7A 5BN3A 2OHFA 3KWLA 3ZGZA 3FVQA 2DLBA 4RF0A 2K5WA 2W3SA 4DU9A 4OIJA 1VZ8A 1MSGA 2YU9B 4X3KA 5E1FA 4YSXB 5LHY1 2J7ZA 1DZ1A 2L55A 4N6EB 1JMLA 2M00A 5I9PA 3OWEB 2F0SA 3VRBB 1EY0A 2WNMA 3AE7B 1B53A 4YXDB 3D31A 1KRHA 2BS3B 1JB3A 4B9WA 5E6JA 2E6XA 1U9RA 5G5GA 3NWTA 1K8OA 2V3NA 2NB0A 2BA0A 1SSNA 2IGGA 3MAQA 1MD2D 3NUCA 4IUNA 2JXMB 2KHSA 2MJ8A 3M7NA 1TIID 4RCNA 5CV8A 4KTAA 2HCCA 3J81L 2OF1A 1TVXA 1O7YA 2Y0SB 4RGOS 1OQRA 1AZQA 3VR5A 2GA4B 3VR3A 5CR3A 1WTVA 3Q8AA 5M5YB 3PO3B 3K0YA 3NTHA 4EQPA 1SNCA 4B0EA 4XWTA 3SR1A 4CBVA 4A3EB 2PO4A 4Q0FA 2I38A 3AE8B 3AV8A 3NSWA 1DONA 1EY8A 5BMIA 3FDTA 4WRDA 2QSDA 2QMTA 2PW9A 3X3NA 2PIAA 2KCCA 5IT9L 3PIP3 5EGTA 2PZWA 3P63A 5AFWA 4CKCA 4D2KA 3A7LA 4RWSC 1AZPA 1QWYA 4N9TA 2K04A 1X32A 3BZDB 2R92B 1WTPA 2XRQD 3E5SA 1GB4A 3S2HB 1GJXA 3D4RA 3TP5A 2BB5A 2GB1A 2AQ1B 3EFXD 3AB5A 4RH6A 4FXKC 1P7EA 1PGAA 3QG1A 2J0TD 2OT2A 3NBHA 3B9JA 2Q8TA 2OXPA 1FXAA 2VB2X 2K1BA 5C0XG 5CV9A 2WIIB 1QILA 2IWHA 1R9TB 2ACZB 2R61A 1CHPD 1DOXA 1SNDA 3O13A 3J7AF 1TWAB 1BDOA 4BY1B 3K5LA 2LHDA 2WXPA 4M1UB