1R4MI

Appbp1-uba3-nedd8, an e1-ubiquitin-like protein complex
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
76
structure length
76
Chain Sequence
MLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVLHLVLALRGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The structure of the APPBP1-UBA3-NEDD8-ATP complex reveals the basis for selective ubiquitin-like protein activation by an E1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
molecule keywords amyloid beta precursor protein-binding protein 1
total genus 18
structure length 76
sequence length 76
chains with identical sequence J, K, L
ec nomenclature
pdb deposition date 2003-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1r4mI00
4GN1A 2BWFA 2G4SA 4ANXA 2DAFA 2KTRB 4MSQB 3WALA 1V80A 1WI0A 1ZKHA 2KOXA 2L7RA 4NNJB 4ANUA 3CSFA 3L10B 2IY0B 2BGFA 4G50A 1G6JA 4HCNB 2KMCA 4M0WB 2C60A 1WGYA 2WWZA 3ZDMC 3TCAA 2GBKA 3TBLD 1LQBA 3IG3A 2MBHA 5G2NA 1E7UA 3EFUA 3SHQA 3KYCD 3TIXA 3A4RA 4AUQC 2J7QB 1YQBA 2EMTA 3ZO5B 2G3QB 3QWZB 1P3QU 4WJNA 3UGBB 4RMAA 3DVGX 2JZ3B 1Q5WB 2A4ZA 2LWPA 2BF8B 3M95A 4GGQA 4AJYB 1CMXB 4EZLA 1WIAA 2IZVB 4IM0A 2Z59B 3KUCB 3EHVA 2D10A 1UBIA 1V2YA 1C1YB 2N9PC 1YJ1A 2MSED 2DAJA 2KVRA 4W9GA 2LVPA 2LI5A 2MA9B 4MSMB 1WGDA 3U8ZA 1IPGA 2UWQA 3NHEB 4JGHB 3PT2B 1GJZA 4FULA 4PYUA 2G45B 3L13A 4I6LB 3UIOB 1XT9B 1RLFA 1SIFA 2KDFB 2RPQA 3AI5A 2KJRA 2KTRA 1OTRB 5EDSA 3PTFC 4NAWB 2N4FA 4FA6A 2LJ5A 3DBHI 5HKHA 5CHVC 5JHBA 3ZUNA 5JZEB 2DZJA 2FNJB 4MGIE 1EF1A 2N1WA 4AP4C 3ZNHB 2O2VB 5D7GA 2WX0A 3M62B 3QAQA 4I6NB 5GMVA 4M8MA 5FR6A 3A9KA 5AEKB 1E90A 1NBFC 4W9JA 1WJUA 2JY6A 2O6VB 3HIZA 3APFA 3QK0A 3VDZA 1LXDA 1WMHB 5CHWA 3ZW3A 3UQBA 3B0AA 2K6DB 4RM8A 3ZTDA 4ZYNA 2FIFA 2MBBB 3QCAA 1UBQA 1ZGUB 5AZFA 1QZEA 4IW0A 3NY5A 2LGDA 5BO4B 4B9KA 2KFJA 1WJ4A 1XD3B 2N1VA 1J0GA 5L83A 5E6OA 4PYZA 3UQAA 2WDTB 2MBQA 2KKCA 4ICVA 4WQOB 5DCNA 4DHZB 2B3AA 4KVGB 3SU8X 1E8XA 1SGHA 1TBEA 1ZW7A 3JSVB 3VVWB 2DZIA 3ZNZB 4AOFA 4K7UA 1WJNA 3PZDA 2KD0A 3H7PA 4ZRIA 1P1AA 2K25A 2KZRA 3RULA 3V61A 4E71A 2MBOA 2J0KA 3RCZA 4MEMA 4A3OA 1WE7A 2AL6A 1RFAA 4MGYE 3JYUA 4B95A 3ML9A 1YD8U 4II2B 1RRBA 2M4NA 3CSTA 1X1MA 2PE6B 3MTNB 3DVNV 3HM3A 2L8JA 2IO1B 3H9DA 3ENEA 4FLHA 3VH3B 2PEAA 5CHFA 1V9JA 4JIOU 3RYTA 3KH0A 4W9IA 2KWVB 1WF9A 2BWES 5IA7A 1LM8B 3OAWA 4ZDVA 2A5UA 2M17A 4EUTA 2K1FA 3DQVA 2ZPYA 2YVCA 3AU4A 1WGHA 2DENB 3DDCB 3PSEB 1F9JA 4MH0E 4MELA 5AZHA 1BT0A 2MRPA 3ZRCA 3VHTC 1WZ0A 2BYFA 2KQ7A 2ZVNA 4BKSA 3W1SC 3OJ4B 2KJHB 1FXTB 4KSKC 3QX1A 2DZKA 1KJTA 2I1KA 3NS8A 3ONSA 4TV3A 2ZCBA 5CTRC 5D2MB 2L00B 2FUHB 3ZVVA 3BINA 4HXDA 1WXVA 2LASA 2LRUA 3ECIA 1WX9A 3GZNI 4CYEA 2CR5A 4II3B 4E74A 4ICUA 2R2QA 4FADA 2MCNB 4GDLB 2KN5A 4TQ1A 2J0MA 3ZDTA 4NJ7A 3ALBA 3AXCA 3VAWA 1J19A 2LZ6A 4ZRKA 1P98A 1V5TA 3MJWA 4CO7A 3PLVA 5C1ZA 4IG7B 3WAMA 2KLGA 4HLEA 1WYWB 3DBRI 4IWPA 2HJ8A 2WX1A 4TQ0A 4IM3A 3ZKJC 1OQYA 3M3JA 2JT4B 3N3KB 1HE8A 3TMPB 4IWOA 2M1MA 2L0FA 3L08A 3V60A 1GC6A 1WZ3A 3ZNID 2LRWA 3KVFB 4HK2A 2KANA 4KSLC 3P2BA 4PS7A 4URKA 5AZGA 1WH3A 3RZFA 2RR9A 3AULA 1KOTA 4E3CA 5LXIB 2KWCA 5IAAC 2FCMA 1GC7A 2MX2A 3H1UA 2ZNVB 2FCSA 2V1YA 5J2RA 4PS3A 3A9JB 3L54A 2O6VD 2AEHA 2D2QA 4KZ0A 3U30A 3ZTCA 4FJVB 4K7WA 3V62A 3O65B 4FHKA 2HE7A 3CMMB 3VTUA 3U7DA 3NZSA 2M0XA 2W9NA 2NS5A 3A4SC 3K9PB 4MGZE 4WAAA 2CU1A 4DDGD 2RSUA 2CS4A 4GDKB 5J17A 3VUYA 2KK8A 3WAPA 2K6QA 3IFWB 2K39A 2EKEC 4W9DA 3A9JA 5J18A 1JRUA 4HDQA 1NI2A 4B6WA 4LJPB 2V4LA 3VH4B 2VRRB 4LDTD 2PE9A 1H4RA 2CHWA 3HM6X 4LDTB 3IHPC 1VD2A 2RGFA 4FJYA 3D32A 4DDID 2D11A 3OLMD 4HDOA 1M94A 4XZ4A 4X57B 1OGWA 1V49A 3JSVA 2KX0A 2I1JA 3H6NA 3H7PB 4W9HA 2BPSA 1V86A 2KJ6A 1WXMA 4MJSB 1UGMA 4GMVA 3LJ3A 5L95C 2KMAA 2L76A 2K8BA 4AWJA 1MG8A 1WX8A 2KC1A 4NAWA 4YL8A 3ZNGC 3B1LX 4BBNF 4DHZE 2PJHA 4OVVA 3DPDA 2HTHA 2KFKA 2MP2B 3M63B 1V6EA 3R66C 2J0JA 2REXA 3LDZE 4HCPB 5E6PA 3JW0X 4GXBA 3QHTA 1E8WA 2IO2B 5DPRA 4M8NA 3X0WA 5C23A 3PVLA 3APDA 4JLCA 3R7RA 1PQSA 1J8CA 3EECA 4BKTA 4EFOA 1LFDA 2D07B 2JF5A 2LXAA 4KIKA 3VXWA 3L17A 2K8HA 2G4DB 3QARA 1TTNA 1Q1OA 3ML8A 1Q0WB 3VUWA 4F7ZA 1Z5SB 2O2VA 2ZVOA 2XBBC 1V5OA 1S1QB 2GBNA 2NBUA 3DOWA 3PS6A 3B08A 2KQSA 1KLVA 1WR6E 3N30A 1AARA 4J6IA 4EKUA 3DCGA 1R4NI 3W1SA 4MGKE 4TUUA 3PRPB 4DHJD 1KM7A 1WXAA 2GBJA 2NBWB 2XEWA 4IC7B 4MM3A 3L0WB 4WJPA 3SDLC 4K1RB 4EEWA 2ZPNA 4HWIB 4NQLB 2DYMA 4ANVA 3QQ8B 3N32A 1RAXA 2FIDA 2GBRA 4DBGA 4G3XB 3WANA 3PRMB 1U4AA 1WY8A 5DPWA 3RUIB 2NBVB 3PREA 3DBLI 1WE6A 2MBEA 4HJKA 4BBNC 4KDLB 1YX6B 5JH5C 3KYDD 5D94A 4DXAB 4W9FA 1A5RA 1SE9A 3DVGY 1TGZB 2FCNA 2KLCA 1P9DU 1YX5B 2IO3B 4A3PA 3S2AA 2FAZA 2RD0A 1OEYJ 3UF8A 4TKNA 2DHZA 3K9OB 2DX5B 3TL5A 2XK5A 2D3GA 3VTVA 3WA0A 4EZKA 4K7SA 1UD7A 4ZRJA 5KHQA 1UH6A 4F1SA 3QJZA 3T8MA 4RM9A 1EUVB 4LCDE 3EC8A 4ANWA 4CHKA 3C0RB 4FHJA 4W9KA 5G55A 3PPAA 4GSWA 2GMIC 2JRHA 4GB9A 2EMSA 3VUXA 3V6CB 2IYDB 2N9EB 4DK5A 4FBJB 1V81A 1WJ6A 2IY1B 2L3ZA 1L7YA 2JXXA 2O6VA 3APCA 2DYBA 3PRZA 2BKFA 4N9F4 2XK5B 3IBEA 1ISNA 1Z2MA 4EOYA 3UIPB 2QHOA 3GOEA 3L16A 2AL3A 2LVOA 2N9XA 3Q3FA 3PHWB 2ASQA 2HD5B 1WRDB 4G11A 2LUEA 5DPTA 2R2OA 2KDEB 2UYZB 3KUZA 2LXCA 2DYOA 2BKRB 3A9KB 3PGEA 4ASWC 5JHAA 5LXHA 3MHSD 4W9LA 4BFRA 4IUMB 1NDDA 2JVCA 3A1QA 3JVZX 2KX3A 1GG3A 1WMHA 1TZ1A 2ZZPB 4WWNA 1T0YA 3VTWA 3R7QA 2KC2A 3RD2A 3PV1A 1UELA 3Q3JA 2NPTA 2Y5BB 2KNBA 4DWFA 1H8CA 1S3SG 4W9CA 2ZEQA 4OVUA 3PLUA 3RT3B 2WYQA 1I42A 3WIMA 4BOZB 2NPTB 3RZWC 2GBMA 2V3SA 3WAOA 2K8CA 1L2NA 4A20A 2N7EA 1EF5A 2IO0B 2ZNVC 2MWSB 5TR5A 3T9LA 3DVNU 3QC8B 4KV2A 5LLIA 4JQWC 1C3TA 2C7HA 2KTFA 2AYOB 1GUAB 4P7IA 1D3ZA 4NJ6A 3QIJA 2N7DA 2JWZA 2KDBA 5CX3A 2LGYA 3NZUA 4K81A 4KIKB 4W9EA 4BKGA 2C5LC 5DPSA 4I6PA 3PHXB 2KFKB 2IBIB 4DHJB 2ZJDA 4EZJA 2KXJA 1XQQA 2CHXA 1WM3A 3W1YA 3VFKA 4F8CB 4NY0A 2DZMA 1WGRA 1UZXB 3HK0A 2OJRA 5D6JB 2OOBB 2AWTA 4IM2A 3ZRFA 2NR2A 2NVUI 4FJZA 1P0RA 1E8ZA 3ZIMA 3SD5A 1WXSA 4XC2A 1OEYA 1R4MI 2L0TA 4GDLA 2ZCCA 4GIVA 3R3MA 3KUDB 2M8SA 4PS8A 5E6NA 2C7NB 3AU5A 4XX5A 3I3TB 3A33B 1K8RB 2PPHA 4BOSC 2CHZA 2BYEA 1Y8RC 3H7SA 4WJQA 3OJ3A 1EO6A 1E5WA 3HHMA 2KHWB 4KZCA 4BVUC 3X23A 2MP2A 4WWOA 2Z0DB 4FN2A 4LJOB 3BY4B 2GOWA 3IVFA 4MDKE 4GU2A 4AJWA 1WGGA 4HPLB 4BKSD 2LVQA 2KDIA 4HVBA 4G0NB 1WFYA 1I35A 4WJOA 2L05A 1WR1A 3VQIA 1IP9A 2NCNA 4JL9A 3TJPA 3UINB 1IYFA 2Z0EB 4HPMB 3NOBA 1WX7A 4NPNA 3CF6E 1E7VA 5KHOA 1YIWA 2KWUB 2FCQA 2JRIB 3KW5B 2LD9A 3DBSA 3ZLZA 2KO3A 1GNUA 4WWPA 2C7MB 1WM2A 3A1QB 2CKHB 2MW5A 2MQJA 4MJSA 3QA8A 4GDKA 4KDIC 2C9WB 1VCBA 2JPHA 4IWQA 3V6EB 2YLMA 2JUOA 2LGXA 4GOCA 2BYVE 2MLBA 2JZZA 4NQKE 1E8YA
chains in the Genus database with same CATH superfamily
2DAFA 1WI0A 5IO9A 3AE4B 4NNJB 1NEKB 2IY0B 2BGFA 3FILA 4G50A 5G5HA 2C60A 4C56C 1LQBA 3AE3B 2MBHA 5G2NA 1RFKA 1E7UA 3EFUA 3SHQA 3N1XC 1TT5B 2J7QB 2KDMA 3ZO5B 2G3QB 3QWZB 1P3QU 1Q5WB 2A4ZA 1IGCA 1T5XD 3KWVA 2Z59B 3ABVB 2D10A 3BIID 4IOIE 3ZXVA 3RFZB 1GJZA 2G45B 3L13A 3U7ZA 1RLFA 1SIFA 2KJRA 2MH7A 5EDSA 4R3DA 3B2GA 1PDXA 4MT5A 2L52A 3DBHI 3NZ3A 4A90A 2M56B 4LTUA 2D3CA 3ZUNA 4AS1A 1DOIA 2DZJA 1QT9A 2N1WA 3ZNHB 4M8MA 3A9KA 1I4PA 3BYTB 1NBFC 4W9JA 2JY6A 2O6VB 4D2KA 1LXDA 1SF0A 1I4GA 4RM8A 2MBBB 5AZFA 5H8YE 5BO4B 4H2AA 2KFJA 1WJ4A 4PYZA 4MM3B 3UQAA 2E3TA 2LHDA 4ICVA 5DCNA 2BTEA 1E8XA 4YWGG 2Z8LA 1P1AA 3DBHB 4S17A 3RCZA 3N9YC 1L4DB 3JYUA 3NVVA 1SEBD 4B95A 3ML9A 5IP4D 3OWEB 1CZPA 4W9IA 2KWVB 3AU4A 1N5WA 1JWMD 4MH0E 4RGTA 1BT0A 2IPKD 1FD6A 1WZ0A 5FKAC 2KJHB 2QDFA 2DZKA 1KJTA 2V3PA 1QILA 2R2QA 2MCNB 4M00A 3AEBB 2K5PA 4RGMA 2J0MA 2BYTA 2ZW1A 3T3OA 3VAWA 3MC9A 3P1MA 1P98A 2J42A 1C4CA 2WXLA 2XN9C 1VDVA 2BT6A 4IWPA 2HJ8A 2L0FA 3L08A 3AEFB 2GRIA 3ZNID 2LRWA 3KVFB 4HK2A 2KANA 4KSLC 3P2BA 1HTQA 4PS7A 2OJWA 2W55A 4URKA 1WH3A 1AN8A 4B0EA 1MPEA 1EU4A 1DOYA 4E3CA 5LXIB 2KWCA 2K3UA 1GC7A 3SFDB 1V1PA 2V1YA 5J2RA 3U30A 2WXGA 3ZTCA 4K7WA 5AUKA 3O65B 2X8XX 3NZSA 2NS5A 4MGZE 4WAAA 2CU1A 1QOAA 1J7CA 3V3XA 2KMMA 1KFYB 2N7JA 2IGGA 4RFBA 2W3RA 3TEYA 1K53A 4HDQA 4B6WA 2V4LA 3EFCA 1WGKA 1CJEA 2CHWA 1DYQA 3HVZA 4LNFA 3B9JA 4XGAB 4C7YA 2CU3A 4X57B 1K51A 2INCC 2LMCA 1FFUA 1NYRA 3ZJVA 4ARIA 3AE1B 2K8BA 4YL8A 2ZW0A 3B1LX 4NJCA 3AH7A 1V6EA 1JQ4A 2J0JA 2REXA 2DWQA 5BYRA 3AEDB 2IGHA 3JW0X 4GXBA 1E8WA 2AX5A 5C23A 3R7RA 1PQSA 1VJKA 2PTLA 2I2YA 4BKTA 1LFDA 2LXAA 2K8HA 1TKYA 4P16A 3QARA 2V4IB 1Q1OA 2WU5B 3O13A 3VUWA 4WQMA 2O2VA 1V5OA 1S1QB 2GBNA 3DOWA 1IBXB 3B08A 5LNK1 4XDDA 1ET6A 2WXRA 1FMAD 3PRPB 1WXAA 2BB5A 4IC7B 1VZ6A 4NQLB 1F77A 2GB1A 4ANVA 2JX5A 5C2TB 1L0YB 2BBCA 4WWMA 3N32A 1QOBA 2FIDA 5BMHA 3RUIB 2NBVB 3DBLI 4KDLB 3I63C 5JH5C 1N62A 4A8XC 1SE9A 1TGZB 1XLOA 1YX5B 5E6JA 3S2AA 1OEYJ 1ZXIA 4TKNA 3K9OB 1JMLA 3VTVA 2CJOA 1UH6A 1EUVB 3RNEC 3T3NA 4LCDE 3C0RB 2JRHA 5JXVA 2EMSA 2IYDB 2N9EB 4FBJB 2L3ZA 2FE8A 1L7YA 2WXIA 2BKFA 3IBEA 1ISNA 1Z2MA 3GOEA 1EU3A 1VZ7A 2LVOA 4G11A 5DPTA 1WRDB 4ASWC 1ACCA 3BK2A 3Q3NC 2Y3AA 1WMHA 4C4VA 1E0ZA 1T0YA 2QIEB 3NVZA 2KQ4X 2NTSA 1ROEA 2Y5BB 3AM9A 1H8CA 1S3SG 2M0AA 4OVUA 3PLUA 2WYQA 3W2DA 3WIMA 1XXGA 4RGOS 4A20A 2N7EA 1EF5A 4YTMB 4LLGM 4REZA 1PGAA 1YN4A 3DVNU 1GUAB 1C76A 2KDBA 5CX3A 1FRDA 3NZUA 4W9EA 2J4XA 2RDBC 1J7AA 5BMIA 2WDVB 1UWMA 2WXMA 2KFKB 4DHJB 2ZJDA 2WQYB 1JCKB 1XQQA 4NY0A 2WDQB 2RPVA 2BS3B 2KT7A 3R2TA 2AWTA 4IM2A 2NVUI 4HRSA 4XC2A 1RYJA 4GDLA 2L0TA 2ZCCA 4WIPA 1FEHA 1BMLC 2TSSA 1TS4A 2PPHA 2CHZA 2BYEA 1J7BA 3OJ3A 4WJQA 2RMMA 1EO6A 3BK1A 1JROA 3BZDB 3BY4B 4MDKE 4GU2A 4HPLB 4BKSD 2KDIA 4RCOA 2NCNA 2Z0EB 1HTOA 1JWAD 1WX7A 3BVGA 3KWLA 4LNIA 1I4RA 3DBSA 4MACA 2C7MB 1UWXA 1FNVA 2JPHA 4GOCA 4WH4A 2QSDA 2MLBA 4W9FA 2N0SB 2BWFA 2JU6X 1V80A 3CSFA 1G6JA 4M0WB 1WGYA 2WWZA 1PFDA 3TBLD 2GBKA 4J3OD 3IG3A 2L83A 3R2IA 2LEKA 3DHIC 3TIXA 3A4RA 1YQBA 2EMTA 3UGBB 4GLSC 4GGQA 1CMXB 1WIAA 2LGSA 3KUCB 3EHVA 1UBIA 1GAQB 2LI5A 1ZOYB 4JGHB 4PYUA 4I6LB 1SE3A 3AI5A 2RPQA 3PTFC 2LJ5A 3AE8B 1WWTA 5JHBA 2FNJB 4MGIE 3P4PB 3QAQA 1ET9A 1L6VA 1E90A 3ZQ4A 3QK0A 3VDZA 4ZYNA 1C78A 3RNFC 4B9KA 2N1VA 2MBQA 2KKCA 4WQOB 1ZP0B 2B3AA 4KVGB 2QC8A 4KKJA 5AUIA 2DZIA 2KWDA 4K7UA 3PZDA 2KD0A 2VZKB 2KZRA 4E71A 2J0KA 5EE3A 4MEMA 1E7PB 2FBWB 3CSTA 3MTNB 1MHXA 3HM3A 2L8JA 1L6UA 3H9DA 3VH3B 2PEAA 2MEKA 1NI3A 2JZPA 1N63A 1WF9A 4L1BA 3VRBB 5IA7A 1LM8B 4XDCA 4EE2A 1OQRA 4ZDVA 2A5UA 4EUTA 4OW0A 1JRPA 3DBRB 3DQVA 3DDCB 1F9JA 3IT6B 1Y56A 4MELA 1OFFA 2KQ7A 2ZVNA 3IAS1 1FCCC 1FXTB 1YJJA 3QX1A 3NS8A 4TV3A 1R4MB 2ZCBA 2L00B 3BINA 1WXVA 2LRUA 4LNNA 1WX9A 3GZNI 5C3JB 2BW2A 4II3B 3LYYA 4FADA 1UNSA 1YNTE 3ZXRA 1FNUA 2WXFA 4YT0B 3ALBA 1YN5A 4K3BA 1FM0D 3C19A 1YQ4B 4IG7B 4HLEA 2K0PA 1LGRA 2IGDA 4BAXA 1QOFA 2BB6A 4MH8A 5AZGA 5IOIA 1MFWA 2FCMA 3W5UB 1IBXA 2ZNVB 5EE9A 4KGRA 2VZKD 1SSNA 1DOXA 3GE8C 2HE7A 3DHGC 5G5GA 1FXIA 3EUB2 2KK8A 3WAPA 1FCLA 4YTPB 2K6QA 2EKEC 5J18A 1JRUA 4M0WA 1NI2A 3PZ8A 4LJPB 3VH4B 2PE9A 3HM6X 4LDTB 1XLPA 3BYYB 1M94A 1V49A 2Q5WD 3H7PB 4W9HA 2BPSA 1V86A 2KJ6A 1ENFA 1PGXA 2KC1A 2PJHA 3DPDA 2KFKA 3AEGB 2MP2B 3R66C 3HVDA 2LGIA 3QHTA 2IO2B 3X0WA 3U4EG 1FNWA 2MJEA 2XNAC 1M4VA 1Q0WB 3RMKC 1QOGA 4O1NA 3UI3A 1UUPA 1KLVA 1WR6E 4J6IA 1R4NI 4MGKE 1KM7A 2KVZA 3L0WB 4MM3A 4K1RB 1E6EB 3W9CB 2MJ3A 2ZPNA 1KRHA 2DYMA 2VH2A 5DPWA 4BBNC 4HJGE 1UGJA 4OHJA 1TKEA 5D94A 1A5RA 3DVGY 1ESFA 2RD0A 2CJNA 3UF8A 1STEA 2PIAA 2DHZA 2DX5B 2XK5A 2D3GA 3WA0A 1UD7A 4ZRJA 1MG4A 1GB4A 1IUEA 3QJZA 3T8MA 1SBBB 2I38A 4CHKA 1XLNA 4XWWA 1TKGA 2GI9A 1WJ6A 3DWMA 3N20C 3VR9B 3PRZA 2LFIA 1SIJA 1T0QC 2AL3A 3PHWB 4P1BC 2KDEB 2UYZB 3KUZA 1D5XC 2BKRB 3A9KB 4W9LA 4IUMB 2JVCA 3A1QA 3JVZX 2KX3A 1TS2A 4WWNA 3RD2A 3V05A 1I4QA 3AE6B 3PV1A 2V0GA 5BYQA 2NPTA 4W9CA 1MI0A 4HROA 1D4BA 2QILA 2WLBA 2K8CA 1HXYD 2AQ2B 1TYGB 2MWSB 4HEA1 1L0VB 2C7HA 2KTFA 2AYOB 1D3ZA 1WSPA 3B2FA 3QIJA 4KIKB 3BWUD 2C5LC 5DPSA 2J52A 1TY2A 3IT4B 4EZJA 3Q14C 2JWUA 1PGBA 2CHXA 1WM3A 1XCQL 4XE0A 4F8CB 3HK0A 2WHIA 5HHDG 3SFEB 5D6JB 2OOBB 2BS2B 5TSSA 4FJZA 1P0RA 1WXSA 1R4MI 3KQ4A 2IDYA 1TZOA 4GIVA 3RI7C 3R3MA 4L23A 2M8SA 4PS8A 1MHHE 3CIRB 3AN1A 3AU5A 3A33B 4BOSC 1Y8RC 2JYEA 3HHMA 2ONQA 3RNCC 4BVUC 3IVFA 1ZXHA 1JALA 2PW9A 2LVQA 4G0NB 1PYWD 1WFYA 1T0RC 1I35A 2WU2B 2N9KA 2W82A 3VQIA 4HPMB 3CF6E 5KHOA 1YIWA 3ZLZA 2LD9A 1HEZE 2KO3A 1VZ8A 3AE2B 2MW5A 2MQJA 4KDIC 2C9WB 1L5PA 2JUOA 2BYVE 3RNAC 2JZZA 3WAOA 1E8YA 4GN1A 2KTRB 3WALA 4OZAA 2KOXA 3ZDMC 2LHEA 2AQ3B 3DVGX 2JZ3B 3HRDD 4M01A 3M95A 2FUG1 4EZLA 2IZVB 4IM0A 1D5MC 2M19A 1YJ1A 1EWCA 1WXQA 2LVPA 1WGDA 2UWQA 5H92C 3UIOB 1R7SA 1XT9B 2KDFB 4A9AA 4NAWB 2N4FA 1VRAB 1XEEA 3WCQA 2Y5CA 5JZEB 4N6EB 4AP4C 4RNAA 5D7GA 3M62B 1TJEA 1HZ5A 3Q2AC 3Q8FA 1D6EC 4KX6B 3NVWA 3APFA 1BUIC 2WXKA 4YTNB 1WMHB 2ICIA 1QKZA 1RM6C 3ZW3A 3B0AA 2W3SA 2K6DB 3ZTDA 2FIFA 3QCAA 1UBQA 1ZGUB 1QZEA 2LGDA 3P63A 1NVID 1XD3B 1F0ZA 5L83A 2Y5PA 1B9RA 2PVGC 1CQVA 4JX1C 3SU8X 1TBEA 1ZW7A 3ZNZB 2DLBA 3H7PA 2K25A 1F2RI 2MBOA 4A3OA 1WE7A 2AL6A 1GOZA 4MGYE 1L0XB 1RRBA 3EA6A 1X1MA 4YSYB 3DVNV 3OG5A 3ENEA 1V9JA 1IGDA 3KH0A 3RYTA 2VH1A 1C4AA 2BWES 1ZUD2 1LO5D 2JXTA 2M17A 2K1FA 2WS3B 2YVCA 2ZPYA 1WGHA 2YEPF 3HUIA 3PSEB 1UF0A 1FFVA 2MRPA 3ZRCA 2BYFA 3OJ4B 2I1KA 3ONSA 5CTRC 5D2MB 1T0SC 3FAHA 4QAYA 2FUHB 4RF1A 2LASA 4ZHPA 2CR5A 4E74A 3Q8AA 5D3IB 4GDLB 4KKIA 4US9A 3ZDTA 4NJ7A 2LZ6A 5T8IA 1V5TA 3MJWA 3Q8BA 5C1ZA 1VR9A 3WAMA 2KLGA 1F1HA 2WX1A 3ZKJC 1OQYA 3M3JA 2JT4B 3N3KB 3TMPB 3V60A 4IWOA 3MHZA 4LNOA 5EE0A 3I57A 4KGTA 1V1PB 2RR9A 3AULA 4ARCA 4ZRQA 4PS3A 3A9JB 3L54A 1C9FA 2O6VD 2AEHA 3P42A 4KZ0A 3ZJTA 3V62A 4FHKA 3VTUA 2AQ1B 2KYWA 3U7DA 2RDGA 3MC0B 2M0XA 2W9NA 3K9PB 3A4SC 4DDGD 2CS4A 5J17A 1WRIA 3Q3OC 3IFWB 1WYGA 1C77A 3Q8EA 1B1ZA 1I4HA 3GP7A 4LDTD 1TS3A 1H4RA 4K3CA 1VD2A 2RGFA 4FJYA 3W5VB 4DDID 1D5ZC 2D11A 4XZ4A 4HDOA 1OGWA 4XYCA 3JSVA 1FXAA 2KX0A 3TSSA 2I1JA 5FK9C 2WXQA 4MJSB 2WXNA 5L95C 2KMAA 1MG8A 1WX8A 4DHZE 4BBNF 2HTHA 3M63B 4S0RA 5E6PA 5DPRA 3PVLA 3APDA 1ZDXA 1J8CA 2JF5A 3Q6BA 4KIKA 3VXWA 2H88B 2G4DB 2OEDA 3KLSX 3P4SB 4F7ZA 1SXTA 4XWTA 2NBUA 3AV8A 1MJDA 3MP9A 2KQSA 1TY0A 1I7HA 4WURA 3N30A 3W1SA 4TUUA 4DHJD 2GBJA 2NBWB 2XEWA 1XLQA 4WJPA 3SDLC 2IJ0A 1RWSA 2JYTA 4P1CC 1T6BX 2ACZB 4P6VF 3P4QB 3TEWA 4BZAA 4DBGA 2KAJA 4G3XB 3PRMB 4NAMA 1WY8A 3J9CA 4HJKA 2WXHA 2D3AA 1YX6B 3KYDD 4UDUC 4US8A 2FCNA 2KLCA 1P9DU 2B76B 4PT5A 2FAZA 2INNE 3TL5A 5GXGB 3IXSA 4EZKA 5KHQA 4ACFA 3NRZA 4F1SA 1V8CA 4ZOHC 4RM9A 2WXJA 3EC8A 5D3DA 4ANWA 4FHJA 5G55A 4GSWA 2GMIC 3VUXA 3NG0A 4USAA 4AQ7A 2IY1B 5MPOA 2JXXA 2O6VA 3APCA 1CK1A 4N9F4 2XK5B 3GS2A 4EOYA 3UIPB 1QF6A 2LXCA 3N1YC 2HTME 3PGEA 5JHAA 4BFRA 1JW9D 4IKGA 1R4NB 1MVKA 1GG3A 2ZZPB 3SR6A 3VTWA 3R7QA 2KC2A 1UELA 3Q3JA 2KNBA 4DWFA 3GB1A 4YXDB 3MC8A 4BOZB 3ZYYX 3RZWC 2GBMA 1YJIA 2V3SA 1L2NA 4OVZA 1L4ZB 3R8BA 1KLGD 2IO0B 3T9LA 5TR5A 3AE7B 3VR8B 4KV2A 3QC8B 1C3TA 4JQWC 4P7IA 3NUHB 4NJ6A 5BYSA 2N7DA 2JWZA 1I4XA 1N60A 4KGSA 2IBIB 4IDIA 1PUTA 3AEAB 3W1YA 3VFKA 2DZMA 3AB5A 1WGRA 1UZXB 3SEBA 4B0MA 2WDRB 2OJRA 2WP9B 3ZRFA 2NR2A 3ZGZA 1E8ZA 4NZLB 1TIFA 2DNFA 2INDC 1SB3C 5E6NA 2C7NB 4XX5A 1C4PA 3I3TB 1VLBA 1N61A 1F52A 3H7SA 4ZHOA 2KHWB 4KZCA 1GB1A 1XCTL 2MP2A 2NMQA 2Z0DB 4WWOA 4FN2A 4LJOB 2RDHA 1HA5A 4YSZB 4RF0A 4C00A 2JQRB 4WJOA 2L05A 1IYFA 3I5JC 4JL9A 1SE4A 3NOBA 2LJIA 2KWUB 2JRIB 4JE3B 1GNUA 4DXFA 1K50A 1WM2A 2CKHB 4MJSA 3QA8A 4GDKA 3IAM1 3DWGC 4IWQA 4JPSA 2LGXA 2EKIA 2MHJA 2PVOD 4AOFA 4K81A 1XO3A 4NQKE 3H8HA 2G4SA 4ANXA 4MSQB 1ZKHA 2L7RA 4ANUA 3L10B 2LUMA 4HCNB 2KMCA 3URYA 4Q2JA 5HFYA 1YQ3B 3TCAA 1AW7A 1T3QA 2QEJC 3CWIA 3KYCD 4AUQC 3NS1A 3RPFC 4WJNA 4RMAA 2GLSA 2LWPA 2BF8B 4AJYB 3RNGC 1V2YA 1C1YB 2N9PC 2MSED 2DAJA 2V9HA 1XF5L 2KVRA 4W9GA 4MSMB 2MA9B 3U8ZA 1IPGA 3NHEB 3AE9B 3PT2B 4FULA 4OZCA 2KTRA 1OTRB 1N5XA 4FA6A 1V1OA 5HKHA 5CHVC 3U52E 5IN7A 1SE2A 1EF1A 2O2VB 2N9LA 2WX0A 4I6NB 5GMVA 5FR6A 5AEKB 1EM7A 4TMAB 3EGRA 1WJUA 3HIZA 3VRAB 1HZ6A 4HPPA 5CHWA 3UQBA 1GPXA 4IW0A 3NY5A 1J0GA 2HDEA 5E6OA 3P4RB 2WDTB 2WXPA 4DHZB 3LXFA 4LK0M 1SGHA 3JSVB 3VVWB 2BVCA 1WJNA 3V61A 4ZRIA 3RULA 3RNBC 4JWSC 5HG2A 1N6ZA 5I4DA 1RFAA 1P7FA 1AWDA 1JWUD 2QJLA 1YD8U 4II2B 2M4NA 1EWYC 3ETRA 2PE6B 4FLHA 2IO1B 2L32A 2INPE 5CHFA 4JIOU 1P7EA 3Q3MC 5HI1A 3OAWA 3AMZA 1FRRA 2DENB 1K52A 3I9V1 4RH6A 5AZHA 3VHTC 4BKSA 3W1SC 4KSKC 3Q69A 3DBLB 3ZVVA 4HXDA 3ECIA 4CYEA 4ICUA 4CQNA 2BS4B 2KN5A 5IKCM 2V3NA 4TQ1A 3AXCA 3PZ7A 1J19A 1E10A 4ZRKA 5EE1A 4CO7A 3PLVA 3FILB 2BQQA 2G9HD 4ZYSA 1WYWB 3DBRI 4TQ0A 4IM3A 3NVYA 1HE8A 2M1MA 1GC6A 1FO4A 1WZ3A 3C8YA 4TSSA 1V97A 3MFGA 1YOVB 3RZFA 3MJ5A 1KH0A 1KOTA 3BVMA 4ZRPA 5IAAC 2MX2A 3H1UA 2FCSA 2D2QA 2D3BA 4WAFA 1E9MA 4FJVB 3CMMB 2SAKA 2H89B 2RSUA 4GDKB 4HKZE 3VUYA 4YSXB 2K39A 2WNMA 4W9DA 3A9JA 2HJ1A 1QQRA 2DBYA 2VRRB 3IHPC 4HKQA 2J53A 3D32A 4FXCA 4L2YA 3OLMD 2PLPA 3DHHC 4JWUC 4N59A 3H6NA 1WXMA 1QLBB 1UGMA 4GMVA 3LJ3A 2KACA 2L76A 4AWJA 1SJHD 4NAWA 3ZNGC 1NENB 4OVVA 2PKOA 4HCPB 3LDZE 4C7ZA 4M8NA 2YEPB 4JLCA 3EECA 4EFOA 1Q10A 2D07B 1NYQA 3AECB 3L17A 3U2SC 1TTNA 3ML8A 4C80A 1ZPSA 1Z5SB 2ZVOA 2XBBC 3PS6A 3TEXA 1HQRD 1ZE3D 1AARA 4EKUA 3DCGA 3AE5B 4RGNA 3L4PA 1YN3A 4EEWA 2ON8A 4HWIB 3QQ8B 1RAXA 1OQQA 2GBRA 3WANA 1U4AA 3PREA 1JWSD 1FIQA 1C79A 1WE6A 2MBEA 3LB8C 1DGJA 4DXAB 2IO3B 4A3PA 5BMGA 1KTKA 2JSVX 4K7SA 4W9KA 3NJTA 3PPAA 4A6QA 4GB9A 3V6CB 1F2RC 4DK5A 2NTTA 1V81A 3GZNB 4OZBA 2DYBA 2EELA 1FPYA 2WXOA 1KF6B 2E6XA 2QHOA 3L16A 4DXGA 2N9XA 3Q3FA 1TS5A 2ASQA 2HD5B 2LUEA 2R2OA 2DYOA 2D5GA 1A70A 2SEBD 5LXHA 3MHSD 2G1EA 1NDDA 2UU7A 1TZ1A 2QCZA 3N1ZC 2ZEQA 3E9SA 4PK1A 1BXTA 3RT3B 4M02A 4N58A 1I42A 2WGSA 2NPTB 1KLUD 3TUOA 2ZNVC 5LLIA 1YMHE 2LGYA 4BKGA 4I6PA 3PHXB 3RN9C 2KXJA 1ZDVA 4LNKA 1JWBD 1AYFA 2K9XA 3ZIMA 3SD5A 1OEYA 3GE3C 3KUDB 2QMTA 2R61A 2OHFA 3FC4A 1K8RB 2PMVA 1SJED 3FKYA 1E5WA 3X23A 3Q8CA 2GOWA 2W54A 3E56A 3PO0A 4AJWA 4C4VB 1WGGA 4HVBA 2KN4A 2K22A 1IP9A 1WR1A 3TJPA 3UINB 3BVZA 3ZJUA 4NPNA 1E7VA 4DQOC 2FCQA 3KW5B 2L1AA 2X38A 4WWPA 2MJDA 3A1QB 5FR3A 1VCBA 3V6EB 2YLMA 3AEEB 4ITKA 4A55A 3TEZA
chains in the Genus database with same CATH topology
4GN1A 2BWFA 2G4SA 4ANXA 2DAFA 2KTRB 4MSQB 3WALA 1V80A 1WI0A 1ZKHA 2KOXA 2L7RA 4NNJB 4ANUA 3CSFA 3L10B 2IY0B 2BGFA 4G50A 1G6JA 4HCNB 2KMCA 4M0WB 2C60A 1WGYA 2WWZA 3ZDMC 3TCAA 2GBKA 3TBLD 1LQBA 3IG3A 2MBHA 5G2NA 1E7UA 3EFUA 3SHQA 3KYCD 3TIXA 3A4RA 4AUQC 2J7QB 1YQBA 2EMTA 3ZO5B 2G3QB 3QWZB 1P3QU 4WJNA 3UGBB 4RMAA 3DVGX 2JZ3B 1Q5WB 2A4ZA 2LWPA 2BF8B 3M95A 4GGQA 4AJYB 1CMXB 4EZLA 1WIAA 2IZVB 4IM0A 2Z59B 3KUCB 3EHVA 2D10A 1UBIA 1V2YA 1C1YB 2N9PC 1YJ1A 2MSED 2DAJA 2KVRA 4W9GA 2LVPA 2LI5A 2MA9B 4MSMB 1WGDA 3U8ZA 1IPGA 2UWQA 3NHEB 4JGHB 3PT2B 1GJZA 4FULA 4PYUA 2G45B 3L13A 4I6LB 3UIOB 1XT9B 1RLFA 1SIFA 2KDFB 2RPQA 3AI5A 2KJRA 2KTRA 1OTRB 5EDSA 3PTFC 4NAWB 2N4FA 4FA6A 2LJ5A 3DBHI 5HKHA 5CHVC 5JHBA 3ZUNA 5JZEB 2DZJA 2FNJB 4MGIE 1EF1A 2N1WA 4AP4C 3ZNHB 2O2VB 5D7GA 2WX0A 3M62B 3QAQA 4I6NB 5GMVA 4M8MA 5FR6A 3A9KA 5AEKB 1E90A 1NBFC 4W9JA 1WJUA 2JY6A 2O6VB 3HIZA 3APFA 3QK0A 3VDZA 1LXDA 1WMHB 5CHWA 3ZW3A 3UQBA 3B0AA 2K6DB 4RM8A 3ZTDA 4ZYNA 2FIFA 2MBBB 3QCAA 1UBQA 1ZGUB 5AZFA 1QZEA 4IW0A 3NY5A 2LGDA 5BO4B 4B9KA 2KFJA 1WJ4A 1XD3B 2N1VA 1J0GA 5L83A 5E6OA 4PYZA 3UQAA 2WDTB 2MBQA 2KKCA 4ICVA 4WQOB 5DCNA 4DHZB 2B3AA 4KVGB 3SU8X 1E8XA 1SGHA 1TBEA 1ZW7A 3JSVB 3VVWB 2DZIA 3ZNZB 4AOFA 4K7UA 1WJNA 3PZDA 2KD0A 3H7PA 4ZRIA 1P1AA 2K25A 2KZRA 3RULA 3V61A 4E71A 2MBOA 2J0KA 3RCZA 4MEMA 4A3OA 1WE7A 2AL6A 1RFAA 4MGYE 3JYUA 4B95A 3ML9A 1YD8U 4II2B 1RRBA 2M4NA 3CSTA 1X1MA 2PE6B 3MTNB 3DVNV 3HM3A 2L8JA 2IO1B 3H9DA 3ENEA 4FLHA 3VH3B 2PEAA 5CHFA 1V9JA 4JIOU 3RYTA 3KH0A 4W9IA 2KWVB 1WF9A 2BWES 5IA7A 1LM8B 3OAWA 4ZDVA 2A5UA 2M17A 4EUTA 2K1FA 3DQVA 2ZPYA 2YVCA 3AU4A 1WGHA 2DENB 3DDCB 3PSEB 1F9JA 4MH0E 4MELA 5AZHA 1BT0A 2MRPA 3ZRCA 3VHTC 1WZ0A 2BYFA 2KQ7A 2ZVNA 4BKSA 3W1SC 3OJ4B 2KJHB 1FXTB 4KSKC 3QX1A 2DZKA 1KJTA 2I1KA 3NS8A 3ONSA 4TV3A 2ZCBA 5CTRC 5D2MB 2L00B 2FUHB 3ZVVA 3BINA 4HXDA 1WXVA 2LASA 2LRUA 3ECIA 1WX9A 3GZNI 4CYEA 2CR5A 4II3B 4E74A 4ICUA 2R2QA 4FADA 2MCNB 4GDLB 2KN5A 4TQ1A 2J0MA 3ZDTA 4NJ7A 3ALBA 3AXCA 3VAWA 1J19A 2LZ6A 4ZRKA 1P98A 1V5TA 3MJWA 4CO7A 3PLVA 5C1ZA 4IG7B 3WAMA 2KLGA 4HLEA 1WYWB 3DBRI 4IWPA 2HJ8A 2WX1A 4TQ0A 4IM3A 3ZKJC 1OQYA 3M3JA 2JT4B 3N3KB 1HE8A 3TMPB 4IWOA 2M1MA 2L0FA 3L08A 3V60A 1GC6A 1WZ3A 3ZNID 2LRWA 3KVFB 4HK2A 2KANA 4KSLC 3P2BA 4PS7A 4URKA 5AZGA 1WH3A 3RZFA 2RR9A 3AULA 1KOTA 4E3CA 5LXIB 2KWCA 5IAAC 2FCMA 1GC7A 2MX2A 3H1UA 2ZNVB 2FCSA 2V1YA 5J2RA 4PS3A 3A9JB 3L54A 2O6VD 2AEHA 2D2QA 4KZ0A 3U30A 3ZTCA 4FJVB 4K7WA 3V62A 3O65B 4FHKA 2HE7A 3CMMB 3VTUA 3U7DA 3NZSA 2M0XA 2W9NA 2NS5A 3A4SC 3K9PB 4MGZE 4WAAA 2CU1A 4DDGD 2RSUA 2CS4A 4GDKB 5J17A 3VUYA 2KK8A 3WAPA 2K6QA 3IFWB 2K39A 2EKEC 4W9DA 3A9JA 5J18A 1JRUA 4HDQA 1NI2A 4B6WA 4LJPB 2V4LA 3VH4B 2VRRB 4LDTD 2PE9A 1H4RA 2CHWA 3HM6X 4LDTB 3IHPC 1VD2A 2RGFA 4FJYA 3D32A 4DDID 2D11A 3OLMD 4HDOA 1M94A 4XZ4A 4X57B 1OGWA 1V49A 3JSVA 2KX0A 2I1JA 3H6NA 3H7PB 4W9HA 2BPSA 1V86A 2KJ6A 1WXMA 4MJSB 1UGMA 4GMVA 3LJ3A 5L95C 2KMAA 2L76A 2K8BA 4AWJA 1MG8A 1WX8A 2KC1A 4NAWA 4YL8A 3ZNGC 3B1LX 4BBNF 4DHZE 2PJHA 4OVVA 3DPDA 2HTHA 2KFKA 2MP2B 3M63B 1V6EA 3R66C 2J0JA 2REXA 3LDZE 4HCPB 5E6PA 3JW0X 4GXBA 3QHTA 1E8WA 2IO2B 5DPRA 4M8NA 3X0WA 5C23A 3PVLA 3APDA 4JLCA 3R7RA 1PQSA 1J8CA 3EECA 4BKTA 4EFOA 1LFDA 2D07B 2JF5A 2LXAA 4KIKA 3VXWA 3L17A 2K8HA 2G4DB 3QARA 1TTNA 1Q1OA 3ML8A 1Q0WB 3VUWA 4F7ZA 1Z5SB 2O2VA 2ZVOA 2XBBC 1V5OA 1S1QB 2GBNA 2NBUA 3DOWA 3PS6A 3B08A 2KQSA 1KLVA 1WR6E 3N30A 1AARA 4J6IA 4EKUA 3DCGA 1R4NI 3W1SA 4MGKE 4TUUA 3PRPB 4DHJD 1KM7A 1WXAA 2GBJA 2NBWB 2XEWA 4IC7B 4MM3A 3L0WB 4WJPA 3SDLC 4K1RB 4EEWA 2ZPNA 4HWIB 4NQLB 2DYMA 4ANVA 3QQ8B 3N32A 1RAXA 2FIDA 2GBRA 4DBGA 4G3XB 3WANA 3PRMB 1U4AA 1WY8A 5DPWA 3RUIB 2NBVB 3PREA 3DBLI 1WE6A 2MBEA 4HJKA 4BBNC 4KDLB 1YX6B 5JH5C 3KYDD 5D94A 4DXAB 4W9FA 1A5RA 1SE9A 3DVGY 1TGZB 2FCNA 2KLCA 1P9DU 1YX5B 2IO3B 4A3PA 3S2AA 2FAZA 2RD0A 1OEYJ 3UF8A 4TKNA 2DHZA 3K9OB 2DX5B 3TL5A 2XK5A 2D3GA 3VTVA 3WA0A 4EZKA 4K7SA 1UD7A 4ZRJA 5KHQA 1UH6A 4F1SA 3QJZA 3T8MA 4RM9A 1EUVB 4LCDE 3EC8A 4ANWA 4CHKA 3C0RB 4FHJA 4W9KA 5G55A 3PPAA 4GSWA 2GMIC 2JRHA 4GB9A 2EMSA 3VUXA 3V6CB 2IYDB 2N9EB 4DK5A 4FBJB 1V81A 1WJ6A 2IY1B 2L3ZA 1L7YA 2JXXA 2O6VA 3APCA 2DYBA 3PRZA 2BKFA 4N9F4 2XK5B 3IBEA 1ISNA 1Z2MA 4EOYA 3UIPB 2QHOA 3GOEA 3L16A 2AL3A 2LVOA 2N9XA 3Q3FA 3PHWB 2ASQA 2HD5B 1WRDB 4G11A 2LUEA 5DPTA 2R2OA 2KDEB 2UYZB 3KUZA 2LXCA 2DYOA 2BKRB 3A9KB 3PGEA 4ASWC 5JHAA 5LXHA 3MHSD 4W9LA 4BFRA 4IUMB 1NDDA 2JVCA 3A1QA 3JVZX 2KX3A 1GG3A 1WMHA 1TZ1A 2ZZPB 4WWNA 1T0YA 3VTWA 3R7QA 2KC2A 3RD2A 3PV1A 1UELA 3Q3JA 2NPTA 2Y5BB 2KNBA 4DWFA 1H8CA 1S3SG 4W9CA 2ZEQA 4OVUA 3PLUA 3RT3B 2WYQA 1I42A 3WIMA 4BOZB 2NPTB 3RZWC 2GBMA 2V3SA 3WAOA 2K8CA 1L2NA 4A20A 2N7EA 1EF5A 2IO0B 2ZNVC 2MWSB 5TR5A 3T9LA 3DVNU 3QC8B 4KV2A 5LLIA 4JQWC 1C3TA 2C7HA 2KTFA 2AYOB 1GUAB 4P7IA 1D3ZA 4NJ6A 3QIJA 2N7DA 2JWZA 2KDBA 5CX3A 2LGYA 3NZUA 4K81A 4KIKB 4W9EA 4BKGA 2C5LC 5DPSA 4I6PA 3PHXB 2KFKB 2IBIB 4DHJB 2ZJDA 4EZJA 2KXJA 1XQQA 2CHXA 1WM3A 3W1YA 3VFKA 4F8CB 4NY0A 2DZMA 1WGRA 1UZXB 3HK0A 2OJRA 5D6JB 2OOBB 2AWTA 4IM2A 3ZRFA 2NR2A 2NVUI 4FJZA 1P0RA 1E8ZA 3ZIMA 3SD5A 1WXSA 4XC2A 1OEYA 1R4MI 2L0TA 4GDLA 2ZCCA 4GIVA 3R3MA 3KUDB 2M8SA 4PS8A 5E6NA 2C7NB 3AU5A 4XX5A 3I3TB 3A33B 1K8RB 2PPHA 4BOSC 2CHZA 2BYEA 1Y8RC 3H7SA 4WJQA 3OJ3A 1EO6A 1E5WA 3HHMA 2KHWB 4KZCA 4BVUC 3X23A 2MP2A 4WWOA 2Z0DB 4FN2A 4LJOB 3BY4B 2GOWA 3IVFA 4MDKE 4GU2A 4AJWA 1WGGA 4HPLB 4BKSD 2LVQA 2KDIA 4HVBA 4G0NB 1WFYA 1I35A 4WJOA 2L05A 1WR1A 3VQIA 1IP9A 2NCNA 4JL9A 3TJPA 3UINB 1IYFA 2Z0EB 4HPMB 3NOBA 1WX7A 4NPNA 3CF6E 1E7VA 5KHOA 1YIWA 2KWUB 2FCQA 2JRIB 3KW5B 2LD9A 3DBSA 3ZLZA 2KO3A 1GNUA 4WWPA 2C7MB 1WM2A 3A1QB 2CKHB 2MW5A 2MQJA 4MJSA 3QA8A 4GDKA 4KDIC 2C9WB 1VCBA 2JPHA 4IWQA 3V6EB 2YLMA 2JUOA 2LGXA 4GOCA 2BYVE 2MLBA 2JZZA 4NQKE 1E8YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GN1 A;  2BWF A;  2G4S A;  4ANX A;  2DAF A;  2KTR B;  4MSQ B;  3WAL A;  1V80 A;  1WI0 A;  1ZKH A;  2KOX A;  2L7R A;  4NNJ B;  4ANU A;  3CSF A;  3L10 B;  2IY0 B;  2BGF A;  4G50 A;  1G6J A;  4HCN B;  2KMC A;  4M0W B;  2C60 A;  1WGY A;  2WWZ A;  3ZDM C;  3TCA A;  2GBK A;  3TBL D;  1LQB A;  3IG3 A;  2MBH A;  5G2N A;  1E7U A;  3EFU A;  3SHQ A;  3KYC D;  3TIX A;  3A4R A;  4AUQ C;  2J7Q B;  1YQB A;  2EMT A;  3ZO5 B;  2G3Q B;  3QWZ B;  1P3Q U;  4WJN A;  3UGB B;  4RMA A;  3DVG X;  2JZ3 B;  1Q5W B;  2A4Z A;  2LWP A;  2BF8 B;  3M95 A;  4GGQ A;  4AJY B;  1CMX B;  4EZL A;  1WIA A;  2IZV B;  4IM0 A;  2Z59 B;  3KUC B;  3EHV A;  2D10 A;  1UBI A;  1V2Y A;  1C1Y B;  2N9P C;  1YJ1 A;  2MSE D;  2DAJ A;  2KVR A;  4W9G A;  2LVP A;  2LI5 A;  2MA9 B;  4MSM B;  1WGD A;  3U8Z A;  1IPG A;  2UWQ A;  3NHE B;  4JGH B;  3PT2 B;  1GJZ A;  4FUL A;  4PYU A;  2G45 B;  3L13 A;  4I6L B;  3UIO B;  1XT9 B;  1RLF A;  1SIF A;  2KDF B;  2RPQ A;  3AI5 A;  2KJR A;  2KTR A;  1OTR B;  5EDS A;  3PTF C;  4NAW B;  2N4F A;  4FA6 A;  2LJ5 A;  3DBH I;  5HKH A;  5CHV C;  5JHB A;  3ZUN A;  5JZE B;  2DZJ A;  2FNJ B;  4MGI E;  1EF1 A;  2N1W A;  4AP4 C;  3ZNH B;  2O2V B;  5D7G A;  2WX0 A;  3M62 B;  3QAQ A;  4I6N B;  5GMV A;  4M8M A;  5FR6 A;  3A9K A;  5AEK B;  1E90 A;  1NBF C;  4W9J A;  1WJU A;  2JY6 A;  2O6V B;  3HIZ A;  3APF A;  3QK0 A;  3VDZ A;  1LXD A;  1WMH B;  5CHW A;  3ZW3 A;  3UQB A;  3B0A A;  2K6D B;  4RM8 A;  3ZTD A;  4ZYN A;  2FIF A;  2MBB B;  3QCA A;  1UBQ A;  1ZGU B;  5AZF A;  1QZE A;  4IW0 A;  3NY5 A;  2LGD A;  5BO4 B;  4B9K A;  2KFJ A;  1WJ4 A;  1XD3 B;  2N1V A;  1J0G A;  5L83 A;  5E6O A;  4PYZ A;  3UQA A;  2WDT B;  2MBQ A;  2KKC A;  4ICV A;  4WQO B;  5DCN A;  4DHZ B;  2B3A A;  4KVG B;  3SU8 X;  1E8X A;  1SGH A;  1TBE A;  1ZW7 A;  3JSV B;  3VVW B;  2DZI A;  3ZNZ B;  4AOF A;  4K7U A;  1WJN A;  3PZD A;  2KD0 A;  3H7P A;  4ZRI A;  1P1A A;  2K25 A;  2KZR A;  3RUL A;  3V61 A;  4E71 A;  2MBO A;  2J0K A;  3RCZ A;  4MEM A;  4A3O A;  1WE7 A;  2AL6 A;  1RFA A;  4MGY E;  3JYU A;  4B95 A;  3ML9 A;  1YD8 U;  4II2 B;  1RRB A;  2M4N A;  3CST A;  1X1M A;  2PE6 B;  3MTN B;  3DVN V;  3HM3 A;  2L8J A;  2IO1 B;  3H9D A;  3ENE A;  4FLH A;  3VH3 B;  2PEA A;  5CHF A;  1V9J A;  4JIO U;  3RYT A;  3KH0 A;  4W9I A;  2KWV B;  1WF9 A;  2BWE S;  5IA7 A;  1LM8 B;  3OAW A;  4ZDV A;  2A5U A;  2M17 A;  4EUT A;  2K1F A;  3DQV A;  2ZPY A;  2YVC A;  3AU4 A;  1WGH A;  2DEN B;  3DDC B;  3PSE B;  1F9J A;  4MH0 E;  4MEL A;  5AZH A;  1BT0 A;  2MRP A;  3ZRC A;  3VHT C;  1WZ0 A;  2BYF A;  2KQ7 A;  2ZVN A;  4BKS A;  3W1S C;  3OJ4 B;  2KJH B;  1FXT B;  4KSK C;  3QX1 A;  2DZK A;  1KJT A;  2I1K A;  3NS8 A;  3ONS A;  4TV3 A;  2ZCB A;  5CTR C;  5D2M B;  2L00 B;  2FUH B;  3ZVV A;  3BIN A;  4HXD A;  1WXV A;  2LAS A;  2LRU A;  3ECI A;  1WX9 A;  3GZN I;  4CYE A;  2CR5 A;  4II3 B;  4E74 A;  4ICU A;  2R2Q A;  4FAD A;  2MCN B;  4GDL B;  2KN5 A;  4TQ1 A;  2J0M A;  3ZDT A;  4NJ7 A;  3ALB A;  3AXC A;  3VAW A;  1J19 A;  2LZ6 A;  4ZRK A;  1P98 A;  1V5T A;  3MJW A;  4CO7 A;  3PLV A;  5C1Z A;  4IG7 B;  3WAM A;  2KLG A;  4HLE A;  1WYW B;  3DBR I;  4IWP A;  2HJ8 A;  2WX1 A;  4TQ0 A;  4IM3 A;  3ZKJ C;  1OQY A;  3M3J A;  2JT4 B;  3N3K B;  1HE8 A;  3TMP B;  4IWO A;  2M1M A;  2L0F A;  3L08 A;  3V60 A;  1GC6 A;  1WZ3 A;  3ZNI D;  2LRW A;  3KVF B;  4HK2 A;  2KAN A;  4KSL C;  3P2B A;  4PS7 A;  4URK A;  5AZG A;  1WH3 A;  3RZF A;  2RR9 A;  3AUL A;  1KOT A;  4E3C A;  5LXI B;  2KWC A;  5IAA C;  2FCM A;  1GC7 A;  2MX2 A;  3H1U A;  2ZNV B;  2FCS A;  2V1Y A;  5J2R A;  4PS3 A;  3A9J B;  3L54 A;  2O6V D;  2AEH A;  2D2Q A;  4KZ0 A;  3U30 A;  3ZTC A;  4FJV B;  4K7W A;  3V62 A;  3O65 B;  4FHK A;  2HE7 A;  3CMM B;  3VTU A;  3U7D A;  3NZS A;  2M0X A;  2W9N A;  2NS5 A;  3A4S C;  3K9P B;  4MGZ E;  4WAA A;  2CU1 A;  4DDG D;  2RSU A;  2CS4 A;  4GDK B;  5J17 A;  3VUY A;  2KK8 A;  3WAP A;  2K6Q A;  3IFW B;  2K39 A;  2EKE C;  4W9D A;  3A9J A;  5J18 A;  1JRU A;  4HDQ A;  1NI2 A;  4B6W A;  4LJP B;  2V4L A;  3VH4 B;  2VRR B;  4LDT D;  2PE9 A;  1H4R A;  2CHW A;  3HM6 X;  4LDT B;  3IHP C;  1VD2 A;  2RGF A;  4FJY A;  3D32 A;  4DDI D;  2D11 A;  3OLM D;  4HDO A;  1M94 A;  4XZ4 A;  4X57 B;  1OGW A;  1V49 A;  3JSV A;  2KX0 A;  2I1J A;  3H6N A;  3H7P B;  4W9H A;  2BPS A;  1V86 A;  2KJ6 A;  1WXM A;  4MJS B;  1UGM A;  4GMV A;  3LJ3 A;  5L95 C;  2KMA A;  2L76 A;  2K8B A;  4AWJ A;  1MG8 A;  1WX8 A;  2KC1 A;  4NAW A;  4YL8 A;  3ZNG C;  3B1L X;  4BBN F;  4DHZ E;  2PJH A;  4OVV A;  3DPD A;  2HTH A;  2KFK A;  2MP2 B;  3M63 B;  1V6E A;  3R66 C;  2J0J A;  2REX A;  3LDZ E;  4HCP B;  5E6P A;  3JW0 X;  4GXB A;  3QHT A;  1E8W A;  2IO2 B;  5DPR A;  4M8N A;  3X0W A;  5C23 A;  3PVL A;  3APD A;  4JLC A;  3R7R A;  1PQS A;  1J8C A;  3EEC A;  4BKT A;  4EFO A;  1LFD A;  2D07 B;  2JF5 A;  2LXA A;  4KIK A;  3VXW A;  3L17 A;  2K8H A;  2G4D B;  3QAR A;  1TTN A;  1Q1O A;  3ML8 A;  1Q0W B;  3VUW A;  4F7Z A;  1Z5S B;  2O2V A;  2ZVO A;  2XBB C;  1V5O A;  1S1Q B;  2GBN A;  2NBU A;  3DOW A;  3PS6 A;  3B08 A;  2KQS A;  1KLV A;  1WR6 E;  3N30 A;  1AAR A;  4J6I A;  4EKU A;  3DCG A;  1R4N I;  3W1S A;  4MGK E;  4TUU A;  3PRP B;  4DHJ D;  1KM7 A;  1WXA A;  2GBJ A;  2NBW B;  2XEW A;  4IC7 B;  4MM3 A;  3L0W B;  4WJP A;  3SDL C;  4K1R B;  4EEW A;  2ZPN A;  4HWI B;  4NQL B;  2DYM A;  4ANV A;  3QQ8 B;  3N32 A;  1RAX A;  2FID A;  2GBR A;  4DBG A;  4G3X B;  3WAN A;  3PRM B;  1U4A A;  1WY8 A;  5DPW A;  3RUI B;  2NBV B;  3PRE A;  3DBL I;  1WE6 A;  2MBE A;  4HJK A;  4BBN C;  4KDL B;  1YX6 B;  5JH5 C;  3KYD D;  5D94 A;  4DXA B;  4W9F A;  1A5R A;  1SE9 A;  3DVG Y;  1TGZ B;  2FCN A;  2KLC A;  1P9D U;  1YX5 B;  2IO3 B;  4A3P A;  3S2A A;  2FAZ A;  2RD0 A;  1OEY J;  3UF8 A;  4TKN A;  2DHZ A;  3K9O B;  2DX5 B;  3TL5 A;  2XK5 A;  2D3G A;  3VTV A;  3WA0 A;  4EZK A;  4K7S A;  1UD7 A;  4ZRJ A;  5KHQ A;  1UH6 A;  4F1S A;  3QJZ A;  3T8M A;  4RM9 A;  1EUV B;  4LCD E;  3EC8 A;  4ANW A;  4CHK A;  3C0R B;  4FHJ A;  4W9K A;  5G55 A;  3PPA A;  4GSW A;  2GMI C;  2JRH A;  4GB9 A;  2EMS A;  3VUX A;  3V6C B;  2IYD B;  2N9E B;  4DK5 A;  4FBJ B;  1V81 A;  1WJ6 A;  2IY1 B;  2L3Z A;  1L7Y A;  2JXX A;  2O6V A;  3APC A;  2DYB A;  3PRZ A;  2BKF A;  4N9F 4;  2XK5 B;  3IBE A;  1ISN A;  1Z2M A;  4EOY A;  3UIP B;  2QHO A;  3GOE A;  3L16 A;  2AL3 A;  2LVO A;  2N9X A;  3Q3F A;  3PHW B;  2ASQ A;  2HD5 B;  1WRD B;  4G11 A;  2LUE A;  5DPT A;  2R2O A;  2KDE B;  2UYZ B;  3KUZ A;  2LXC A;  2DYO A;  2BKR B;  3A9K B;  3PGE A;  4ASW C;  5JHA A;  5LXH A;  3MHS D;  4W9L A;  4BFR A;  4IUM B;  1NDD A;  2JVC A;  3A1Q A;  3JVZ X;  2KX3 A;  1GG3 A;  1WMH A;  1TZ1 A;  2ZZP B;  4WWN A;  1T0Y A;  3VTW A;  3R7Q A;  2KC2 A;  3RD2 A;  3PV1 A;  1UEL A;  3Q3J A;  2NPT A;  2Y5B B;  2KNB A;  4DWF A;  1H8C A;  1S3S G;  4W9C A;  2ZEQ A;  4OVU A;  3PLU A;  3RT3 B;  2WYQ A;  1I42 A;  3WIM A;  4BOZ B;  2NPT B;  3RZW C;  2GBM A;  2V3S A;  3WAO A;  2K8C A;  1L2N A;  4A20 A;  2N7E A;  1EF5 A;  2IO0 B;  2ZNV C;  2MWS B;  5TR5 A;  3T9L A;  3DVN U;  3QC8 B;  4KV2 A;  5LLI A;  4JQW C;  1C3T A;  2C7H A;  2KTF A;  2AYO B;  1GUA B;  4P7I A;  1D3Z A;  4NJ6 A;  3QIJ A;  2N7D A;  2JWZ A;  2KDB A;  5CX3 A;  2LGY A;  3NZU A;  4K81 A;  4KIK B;  4W9E A;  4BKG A;  2C5L C;  5DPS A;  4I6P A;  3PHX B;  2KFK B;  2IBI B;  4DHJ B;  2ZJD A;  4EZJ A;  2KXJ A;  1XQQ A;  2CHX A;  1WM3 A;  3W1Y A;  3VFK A;  4F8C B;  4NY0 A;  2DZM A;  1WGR A;  1UZX B;  3HK0 A;  2OJR A;  5D6J B;  2OOB B;  2AWT A;  4IM2 A;  3ZRF A;  2NR2 A;  2NVU I;  4FJZ A;  1P0R A;  1E8Z A;  3ZIM A;  3SD5 A;  1WXS A;  4XC2 A;  1OEY A;  1R4M I;  2L0T A;  4GDL A;  2ZCC A;  4GIV A;  3R3M A;  3KUD B;  2M8S A;  4PS8 A;  5E6N A;  2C7N B;  3AU5 A;  4XX5 A;  3I3T B;  3A33 B;  1K8R B;  2PPH A;  4BOS C;  2CHZ A;  2BYE A;  1Y8R C;  3H7S A;  4WJQ A;  3OJ3 A;  1EO6 A;  1E5W A;  3HHM A;  2KHW B;  4KZC A;  4BVU C;  3X23 A;  2MP2 A;  4WWO A;  2Z0D B;  4FN2 A;  4LJO B;  3BY4 B;  2GOW A;  3IVF A;  4MDK E;  4GU2 A;  4AJW A;  1WGG A;  4HPL B;  4BKS D;  2LVQ A;  2KDI A;  4HVB A;  4G0N B;  1WFY A;  1I35 A;  4WJO A;  2L05 A;  1WR1 A;  3VQI A;  1IP9 A;  2NCN A;  4JL9 A;  3TJP A;  3UIN B;  1IYF A;  2Z0E B;  4HPM B;  3NOB A;  1WX7 A;  4NPN A;  3CF6 E;  1E7V A;  5KHO A;  1YIW A;  2KWU B;  2FCQ A;  2JRI B;  3KW5 B;  2LD9 A;  3DBS A;  3ZLZ A;  2KO3 A;  1GNU A;  4WWP A;  2C7M B;  1WM2 A;  3A1Q B;  2CKH B;  2MW5 A;  2MQJ A;  4MJS A;  3QA8 A;  4GDK A;  4KDI C;  2C9W B;  1VCB A;  2JPH A;  4IWQ A;  3V6E B;  2YLM A;  2JUO A;  2LGX A;  4GOC A;  2BYV E;  2MLB A;  2JZZ A;  4NQK E;  1E8Y A; 
#chains in the Genus database with same CATH topology
 2DAF A;  1WI0 A;  5IO9 A;  3AE4 B;  4NNJ B;  1NEK B;  2IY0 B;  2BGF A;  3FIL A;  4G50 A;  5G5H A;  2C60 A;  4C56 C;  1LQB A;  3AE3 B;  2MBH A;  5G2N A;  1RFK A;  1E7U A;  3EFU A;  3SHQ A;  3N1X C;  1TT5 B;  2J7Q B;  2KDM A;  3ZO5 B;  2G3Q B;  3QWZ B;  1P3Q U;  1Q5W B;  2A4Z A;  1IGC A;  1T5X D;  3KWV A;  2Z59 B;  3ABV B;  2D10 A;  3BII D;  4IOI E;  3ZXV A;  3RFZ B;  1GJZ A;  2G45 B;  3L13 A;  3U7Z A;  1RLF A;  1SIF A;  2KJR A;  2MH7 A;  5EDS A;  4R3D A;  3B2G A;  1PDX A;  4MT5 A;  2L52 A;  3DBH I;  3NZ3 A;  4A90 A;  2M56 B;  4LTU A;  2D3C A;  3ZUN A;  4AS1 A;  1DOI A;  2DZJ A;  1QT9 A;  2N1W A;  3ZNH B;  4M8M A;  3A9K A;  1I4P A;  3BYT B;  1NBF C;  4W9J A;  2JY6 A;  2O6V B;  4D2K A;  1LXD A;  1SF0 A;  1I4G A;  4RM8 A;  2MBB B;  5AZF A;  5H8Y E;  5BO4 B;  4H2A A;  2KFJ A;  1WJ4 A;  4PYZ A;  4MM3 B;  3UQA A;  2E3T A;  2LHD A;  4ICV A;  5DCN A;  2BTE A;  1E8X A;  4YWG G;  2Z8L A;  1P1A A;  3DBH B;  4S17 A;  3RCZ A;  3N9Y C;  1L4D B;  3JYU A;  3NVV A;  1SEB D;  4B95 A;  3ML9 A;  5IP4 D;  3OWE B;  1CZP A;  4W9I A;  2KWV B;  3AU4 A;  1N5W A;  1JWM D;  4MH0 E;  4RGT A;  1BT0 A;  2IPK D;  1FD6 A;  1WZ0 A;  5FKA C;  2KJH B;  2QDF A;  2DZK A;  1KJT A;  2V3P A;  1QIL A;  2R2Q A;  2MCN B;  4M00 A;  3AEB B;  2K5P A;  4RGM A;  2J0M A;  2BYT A;  2ZW1 A;  3T3O A;  3VAW A;  3MC9 A;  3P1M A;  1P98 A;  2J42 A;  1C4C A;  2WXL A;  2XN9 C;  1VDV A;  2BT6 A;  4IWP A;  2HJ8 A;  2L0F A;  3L08 A;  3AEF B;  2GRI A;  3ZNI D;  2LRW A;  3KVF B;  4HK2 A;  2KAN A;  4KSL C;  3P2B A;  1HTQ A;  4PS7 A;  2OJW A;  2W55 A;  4URK A;  1WH3 A;  1AN8 A;  4B0E A;  1MPE A;  1EU4 A;  1DOY A;  4E3C A;  5LXI B;  2KWC A;  2K3U A;  1GC7 A;  3SFD B;  1V1P A;  2V1Y A;  5J2R A;  3U30 A;  2WXG A;  3ZTC A;  4K7W A;  5AUK A;  3O65 B;  2X8X X;  3NZS A;  2NS5 A;  4MGZ E;  4WAA A;  2CU1 A;  1QOA A;  1J7C A;  3V3X A;  2KMM A;  1KFY B;  2N7J A;  2IGG A;  4RFB A;  2W3R A;  3TEY A;  1K53 A;  4HDQ A;  4B6W A;  2V4L A;  3EFC A;  1WGK A;  1CJE A;  2CHW A;  1DYQ A;  3HVZ A;  4LNF A;  3B9J A;  4XGA B;  4C7Y A;  2CU3 A;  4X57 B;  1K51 A;  2INC C;  2LMC A;  1FFU A;  1NYR A;  3ZJV A;  4ARI A;  3AE1 B;  2K8B A;  4YL8 A;  2ZW0 A;  3B1L X;  4NJC A;  3AH7 A;  1V6E A;  1JQ4 A;  2J0J A;  2REX A;  2DWQ A;  5BYR A;  3AED B;  2IGH A;  3JW0 X;  4GXB A;  1E8W A;  2AX5 A;  5C23 A;  3R7R A;  1PQS A;  1VJK A;  2PTL A;  2I2Y A;  4BKT A;  1LFD A;  2LXA A;  2K8H A;  1TKY A;  4P16 A;  3QAR A;  2V4I B;  1Q1O A;  2WU5 B;  3O13 A;  3VUW A;  4WQM A;  2O2V A;  1V5O A;  1S1Q B;  2GBN A;  3DOW A;  1IBX B;  3B08 A;  5LNK 1;  4XDD A;  1ET6 A;  2WXR A;  1FMA D;  3PRP B;  1WXA A;  2BB5 A;  4IC7 B;  1VZ6 A;  4NQL B;  1F77 A;  2GB1 A;  4ANV A;  2JX5 A;  5C2T B;  1L0Y B;  2BBC A;  4WWM A;  3N32 A;  1QOB A;  2FID A;  5BMH A;  3RUI B;  2NBV B;  3DBL I;  4KDL B;  3I63 C;  5JH5 C;  1N62 A;  4A8X C;  1SE9 A;  1TGZ B;  1XLO A;  1YX5 B;  5E6J A;  3S2A A;  1OEY J;  1ZXI A;  4TKN A;  3K9O B;  1JML A;  3VTV A;  2CJO A;  1UH6 A;  1EUV B;  3RNE C;  3T3N A;  4LCD E;  3C0R B;  2JRH A;  5JXV A;  2EMS A;  2IYD B;  2N9E B;  4FBJ B;  2L3Z A;  2FE8 A;  1L7Y A;  2WXI A;  2BKF A;  3IBE A;  1ISN A;  1Z2M A;  3GOE A;  1EU3 A;  1VZ7 A;  2LVO A;  4G11 A;  5DPT A;  1WRD B;  4ASW C;  1ACC A;  3BK2 A;  3Q3N C;  2Y3A A;  1WMH A;  4C4V A;  1E0Z A;  1T0Y A;  2QIE B;  3NVZ A;  2KQ4 X;  2NTS A;  1ROE A;  2Y5B B;  3AM9 A;  1H8C A;  1S3S G;  2M0A A;  4OVU A;  3PLU A;  2WYQ A;  3W2D A;  3WIM A;  1XXG A;  4RGO S;  4A20 A;  2N7E A;  1EF5 A;  4YTM B;  4LLG M;  4REZ A;  1PGA A;  1YN4 A;  3DVN U;  1GUA B;  1C76 A;  2KDB A;  5CX3 A;  1FRD A;  3NZU A;  4W9E A;  2J4X A;  2RDB C;  1J7A A;  5BMI A;  2WDV B;  1UWM A;  2WXM A;  2KFK B;  4DHJ B;  2ZJD A;  2WQY B;  1JCK B;  1XQQ A;  4NY0 A;  2WDQ B;  2RPV A;  2BS3 B;  2KT7 A;  3R2T A;  2AWT A;  4IM2 A;  2NVU I;  4HRS A;  4XC2 A;  1RYJ A;  4GDL A;  2L0T A;  2ZCC A;  4WIP A;  1FEH A;  1BML C;  2TSS A;  1TS4 A;  2PPH A;  2CHZ A;  2BYE A;  1J7B A;  3OJ3 A;  4WJQ A;  2RMM A;  1EO6 A;  3BK1 A;  1JRO A;  3BZD B;  3BY4 B;  4MDK E;  4GU2 A;  4HPL B;  4BKS D;  2KDI A;  4RCO A;  2NCN A;  2Z0E B;  1HTO A;  1JWA D;  1WX7 A;  3BVG A;  3KWL A;  4LNI A;  1I4R A;  3DBS A;  4MAC A;  2C7M B;  1UWX A;  1FNV A;  2JPH A;  4GOC A;  4WH4 A;  2QSD A;  2MLB A;  4W9F A;  2N0S B;  2BWF A;  2JU6 X;  1V80 A;  3CSF A;  1G6J A;  4M0W B;  1WGY A;  2WWZ A;  1PFD A;  3TBL D;  2GBK A;  4J3O D;  3IG3 A;  2L83 A;  3R2I A;  2LEK A;  3DHI C;  3TIX A;  3A4R A;  1YQB A;  2EMT A;  3UGB B;  4GLS C;  4GGQ A;  1CMX B;  1WIA A;  2LGS A;  3KUC B;  3EHV A;  1UBI A;  1GAQ B;  2LI5 A;  1ZOY B;  4JGH B;  4PYU A;  4I6L B;  1SE3 A;  3AI5 A;  2RPQ A;  3PTF C;  2LJ5 A;  3AE8 B;  1WWT A;  5JHB A;  2FNJ B;  4MGI E;  3P4P B;  3QAQ A;  1ET9 A;  1L6V A;  1E90 A;  3ZQ4 A;  3QK0 A;  3VDZ A;  4ZYN A;  1C78 A;  3RNF C;  4B9K A;  2N1V A;  2MBQ A;  2KKC A;  4WQO B;  1ZP0 B;  2B3A A;  4KVG B;  2QC8 A;  4KKJ A;  5AUI A;  2DZI A;  2KWD A;  4K7U A;  3PZD A;  2KD0 A;  2VZK B;  2KZR A;  4E71 A;  2J0K A;  5EE3 A;  4MEM A;  1E7P B;  2FBW B;  3CST A;  3MTN B;  1MHX A;  3HM3 A;  2L8J A;  1L6U A;  3H9D A;  3VH3 B;  2PEA A;  2MEK A;  1NI3 A;  2JZP A;  1N63 A;  1WF9 A;  4L1B A;  3VRB B;  5IA7 A;  1LM8 B;  4XDC A;  4EE2 A;  1OQR A;  4ZDV A;  2A5U A;  4EUT A;  4OW0 A;  1JRP A;  3DBR B;  3DQV A;  3DDC B;  1F9J A;  3IT6 B;  1Y56 A;  4MEL A;  1OFF A;  2KQ7 A;  2ZVN A;  3IAS 1;  1FCC C;  1FXT B;  1YJJ A;  3QX1 A;  3NS8 A;  4TV3 A;  1R4M B;  2ZCB A;  2L00 B;  3BIN A;  1WXV A;  2LRU A;  4LNN A;  1WX9 A;  3GZN I;  5C3J B;  2BW2 A;  4II3 B;  3LYY A;  4FAD A;  1UNS A;  1YNT E;  3ZXR A;  1FNU A;  2WXF A;  4YT0 B;  3ALB A;  1YN5 A;  4K3B A;  1FM0 D;  3C19 A;  1YQ4 B;  4IG7 B;  4HLE A;  2K0P A;  1LGR A;  2IGD A;  4BAX A;  1QOF A;  2BB6 A;  4MH8 A;  5AZG A;  5IOI A;  1MFW A;  2FCM A;  3W5U B;  1IBX A;  2ZNV B;  5EE9 A;  4KGR A;  2VZK D;  1SSN A;  1DOX A;  3GE8 C;  2HE7 A;  3DHG C;  5G5G A;  1FXI A;  3EUB 2;  2KK8 A;  3WAP A;  1FCL A;  4YTP B;  2K6Q A;  2EKE C;  5J18 A;  1JRU A;  4M0W A;  1NI2 A;  3PZ8 A;  4LJP B;  3VH4 B;  2PE9 A;  3HM6 X;  4LDT B;  1XLP A;  3BYY B;  1M94 A;  1V49 A;  2Q5W D;  3H7P B;  4W9H A;  2BPS A;  1V86 A;  2KJ6 A;  1ENF A;  1PGX A;  2KC1 A;  2PJH A;  3DPD A;  2KFK A;  3AEG B;  2MP2 B;  3R66 C;  3HVD A;  2LGI A;  3QHT A;  2IO2 B;  3X0W A;  3U4E G;  1FNW A;  2MJE A;  2XNA C;  1M4V A;  1Q0W B;  3RMK C;  1QOG A;  4O1N A;  3UI3 A;  1UUP A;  1KLV A;  1WR6 E;  4J6I A;  1R4N I;  4MGK E;  1KM7 A;  2KVZ A;  3L0W B;  4MM3 A;  4K1R B;  1E6E B;  3W9C B;  2MJ3 A;  2ZPN A;  1KRH A;  2DYM A;  2VH2 A;  5DPW A;  4BBN C;  4HJG E;  1UGJ A;  4OHJ A;  1TKE A;  5D94 A;  1A5R A;  3DVG Y;  1ESF A;  2RD0 A;  2CJN A;  3UF8 A;  1STE A;  2PIA A;  2DHZ A;  2DX5 B;  2XK5 A;  2D3G A;  3WA0 A;  1UD7 A;  4ZRJ A;  1MG4 A;  1GB4 A;  1IUE A;  3QJZ A;  3T8M A;  1SBB B;  2I38 A;  4CHK A;  1XLN A;  4XWW A;  1TKG A;  2GI9 A;  1WJ6 A;  3DWM A;  3N20 C;  3VR9 B;  3PRZ A;  2LFI A;  1SIJ A;  1T0Q C;  2AL3 A;  3PHW B;  4P1B C;  2KDE B;  2UYZ B;  3KUZ A;  1D5X C;  2BKR B;  3A9K B;  4W9L A;  4IUM B;  2JVC A;  3A1Q A;  3JVZ X;  2KX3 A;  1TS2 A;  4WWN A;  3RD2 A;  3V05 A;  1I4Q A;  3AE6 B;  3PV1 A;  2V0G A;  5BYQ A;  2NPT A;  4W9C A;  1MI0 A;  4HRO A;  1D4B A;  2QIL A;  2WLB A;  2K8C A;  1HXY D;  2AQ2 B;  1TYG B;  2MWS B;  4HEA 1;  1L0V B;  2C7H A;  2KTF A;  2AYO B;  1D3Z A;  1WSP A;  3B2F A;  3QIJ A;  4KIK B;  3BWU D;  2C5L C;  5DPS A;  2J52 A;  1TY2 A;  3IT4 B;  4EZJ A;  3Q14 C;  2JWU A;  1PGB A;  2CHX A;  1WM3 A;  1XCQ L;  4XE0 A;  4F8C B;  3HK0 A;  2WHI A;  5HHD G;  3SFE B;  5D6J B;  2OOB B;  2BS2 B;  5TSS A;  4FJZ A;  1P0R A;  1WXS A;  1R4M I;  3KQ4 A;  2IDY A;  1TZO A;  4GIV A;  3RI7 C;  3R3M A;  4L23 A;  2M8S A;  4PS8 A;  1MHH E;  3CIR B;  3AN1 A;  3AU5 A;  3A33 B;  4BOS C;  1Y8R C;  2JYE A;  3HHM A;  2ONQ A;  3RNC C;  4BVU C;  3IVF A;  1ZXH A;  1JAL A;  2PW9 A;  2LVQ A;  4G0N B;  1PYW D;  1WFY A;  1T0R C;  1I35 A;  2WU2 B;  2N9K A;  2W82 A;  3VQI A;  4HPM B;  3CF6 E;  5KHO A;  1YIW A;  3ZLZ A;  2LD9 A;  1HEZ E;  2KO3 A;  1VZ8 A;  3AE2 B;  2MW5 A;  2MQJ A;  4KDI C;  2C9W B;  1L5P A;  2JUO A;  2BYV E;  3RNA C;  2JZZ A;  3WAO A;  1E8Y A;  4GN1 A;  2KTR B;  3WAL A;  4OZA A;  2KOX A;  3ZDM C;  2LHE A;  2AQ3 B;  3DVG X;  2JZ3 B;  3HRD D;  4M01 A;  3M95 A;  2FUG 1;  4EZL A;  2IZV B;  4IM0 A;  1D5M C;  2M19 A;  1YJ1 A;  1EWC A;  1WXQ A;  2LVP A;  1WGD A;  2UWQ A;  5H92 C;  3UIO B;  1R7S A;  1XT9 B;  2KDF B;  4A9A A;  4NAW B;  2N4F A;  1VRA B;  1XEE A;  3WCQ A;  2Y5C A;  5JZE B;  4N6E B;  4AP4 C;  4RNA A;  5D7G A;  3M62 B;  1TJE A;  1HZ5 A;  3Q2A C;  3Q8F A;  1D6E C;  4KX6 B;  3NVW A;  3APF A;  1BUI C;  2WXK A;  4YTN B;  1WMH B;  2ICI A;  1QKZ A;  1RM6 C;  3ZW3 A;  3B0A A;  2W3S A;  2K6D B;  3ZTD A;  2FIF A;  3QCA A;  1UBQ A;  1ZGU B;  1QZE A;  2LGD A;  3P63 A;  1NVI D;  1XD3 B;  1F0Z A;  5L83 A;  2Y5P A;  1B9R A;  2PVG C;  1CQV A;  4JX1 C;  3SU8 X;  1TBE A;  1ZW7 A;  3ZNZ B;  2DLB A;  3H7P A;  2K25 A;  1F2R I;  2MBO A;  4A3O A;  1WE7 A;  2AL6 A;  1GOZ A;  4MGY E;  1L0X B;  1RRB A;  3EA6 A;  1X1M A;  4YSY B;  3DVN V;  3OG5 A;  3ENE A;  1V9J A;  1IGD A;  3KH0 A;  3RYT A;  2VH1 A;  1C4A A;  2BWE S;  1ZUD 2;  1LO5 D;  2JXT A;  2M17 A;  2K1F A;  2WS3 B;  2YVC A;  2ZPY A;  1WGH A;  2YEP F;  3HUI A;  3PSE B;  1UF0 A;  1FFV A;  2MRP A;  3ZRC A;  2BYF A;  3OJ4 B;  2I1K A;  3ONS A;  5CTR C;  5D2M B;  1T0S C;  3FAH A;  4QAY A;  2FUH B;  4RF1 A;  2LAS A;  4ZHP A;  2CR5 A;  4E74 A;  3Q8A A;  5D3I B;  4GDL B;  4KKI A;  4US9 A;  3ZDT A;  4NJ7 A;  2LZ6 A;  5T8I A;  1V5T A;  3MJW A;  3Q8B A;  5C1Z A;  1VR9 A;  3WAM A;  2KLG A;  1F1H A;  2WX1 A;  3ZKJ C;  1OQY A;  3M3J A;  2JT4 B;  3N3K B;  3TMP B;  3V60 A;  4IWO A;  3MHZ A;  4LNO A;  5EE0 A;  3I57 A;  4KGT A;  1V1P B;  2RR9 A;  3AUL A;  4ARC A;  4ZRQ A;  4PS3 A;  3A9J B;  3L54 A;  1C9F A;  2O6V D;  2AEH A;  3P42 A;  4KZ0 A;  3ZJT A;  3V62 A;  4FHK A;  3VTU A;  2AQ1 B;  2KYW A;  3U7D A;  2RDG A;  3MC0 B;  2M0X A;  2W9N A;  3K9P B;  3A4S C;  4DDG D;  2CS4 A;  5J17 A;  1WRI A;  3Q3O C;  3IFW B;  1WYG A;  1C77 A;  3Q8E A;  1B1Z A;  1I4H A;  3GP7 A;  4LDT D;  1TS3 A;  1H4R A;  4K3C A;  1VD2 A;  2RGF A;  4FJY A;  3W5V B;  4DDI D;  1D5Z C;  2D11 A;  4XZ4 A;  4HDO A;  1OGW A;  4XYC A;  3JSV A;  1FXA A;  2KX0 A;  3TSS A;  2I1J A;  5FK9 C;  2WXQ A;  4MJS B;  2WXN A;  5L95 C;  2KMA A;  1MG8 A;  1WX8 A;  4DHZ E;  4BBN F;  2HTH A;  3M63 B;  4S0R A;  5E6P A;  5DPR A;  3PVL A;  3APD A;  1ZDX A;  1J8C A;  2JF5 A;  3Q6B A;  4KIK A;  3VXW A;  2H88 B;  2G4D B;  2OED A;  3KLS X;  3P4S B;  4F7Z A;  1SXT A;  4XWT A;  2NBU A;  3AV8 A;  1MJD A;  3MP9 A;  2KQS A;  1TY0 A;  1I7H A;  4WUR A;  3N30 A;  3W1S A;  4TUU A;  4DHJ D;  2GBJ A;  2NBW B;  2XEW A;  1XLQ A;  4WJP A;  3SDL C;  2IJ0 A;  1RWS A;  2JYT A;  4P1C C;  1T6B X;  2ACZ B;  4P6V F;  3P4Q B;  3TEW A;  4BZA A;  4DBG A;  2KAJ A;  4G3X B;  3PRM B;  4NAM A;  1WY8 A;  3J9C A;  4HJK A;  2WXH A;  2D3A A;  1YX6 B;  3KYD D;  4UDU C;  4US8 A;  2FCN A;  2KLC A;  1P9D U;  2B76 B;  4PT5 A;  2FAZ A;  2INN E;  3TL5 A;  5GXG B;  3IXS A;  4EZK A;  5KHQ A;  4ACF A;  3NRZ A;  4F1S A;  1V8C A;  4ZOH C;  4RM9 A;  2WXJ A;  3EC8 A;  5D3D A;  4ANW A;  4FHJ A;  5G55 A;  4GSW A;  2GMI C;  3VUX A;  3NG0 A;  4USA A;  4AQ7 A;  2IY1 B;  5MPO A;  2JXX A;  2O6V A;  3APC A;  1CK1 A;  4N9F 4;  2XK5 B;  3GS2 A;  4EOY A;  3UIP B;  1QF6 A;  2LXC A;  3N1Y C;  2HTM E;  3PGE A;  5JHA A;  4BFR A;  1JW9 D;  4IKG A;  1R4N B;  1MVK A;  1GG3 A;  2ZZP B;  3SR6 A;  3VTW A;  3R7Q A;  2KC2 A;  1UEL A;  3Q3J A;  2KNB A;  4DWF A;  3GB1 A;  4YXD B;  3MC8 A;  4BOZ B;  3ZYY X;  3RZW C;  2GBM A;  1YJI A;  2V3S A;  1L2N A;  4OVZ A;  1L4Z B;  3R8B A;  1KLG D;  2IO0 B;  3T9L A;  5TR5 A;  3AE7 B;  3VR8 B;  4KV2 A;  3QC8 B;  1C3T A;  4JQW C;  4P7I A;  3NUH B;  4NJ6 A;  5BYS A;  2N7D A;  2JWZ A;  1I4X A;  1N60 A;  4KGS A;  2IBI B;  4IDI A;  1PUT A;  3AEA B;  3W1Y A;  3VFK A;  2DZM A;  3AB5 A;  1WGR A;  1UZX B;  3SEB A;  4B0M A;  2WDR B;  2OJR A;  2WP9 B;  3ZRF A;  2NR2 A;  3ZGZ A;  1E8Z A;  4NZL B;  1TIF A;  2DNF A;  2IND C;  1SB3 C;  5E6N A;  2C7N B;  4XX5 A;  1C4P A;  3I3T B;  1VLB A;  1N61 A;  1F52 A;  3H7S A;  4ZHO A;  2KHW B;  4KZC A;  1GB1 A;  1XCT L;  2MP2 A;  2NMQ A;  2Z0D B;  4WWO A;  4FN2 A;  4LJO B;  2RDH A;  1HA5 A;  4YSZ B;  4RF0 A;  4C00 A;  2JQR B;  4WJO A;  2L05 A;  1IYF A;  3I5J C;  4JL9 A;  1SE4 A;  3NOB A;  2LJI A;  2KWU B;  2JRI B;  4JE3 B;  1GNU A;  4DXF A;  1K50 A;  1WM2 A;  2CKH B;  4MJS A;  3QA8 A;  4GDK A;  3IAM 1;  3DWG C;  4IWQ A;  4JPS A;  2LGX A;  2EKI A;  2MHJ A;  2PVO D;  4AOF A;  4K81 A;  1XO3 A;  4NQK E;  3H8H A;  2G4S A;  4ANX A;  4MSQ B;  1ZKH A;  2L7R A;  4ANU A;  3L10 B;  2LUM A;  4HCN B;  2KMC A;  3URY A;  4Q2J A;  5HFY A;  1YQ3 B;  3TCA A;  1AW7 A;  1T3Q A;  2QEJ C;  3CWI A;  3KYC D;  4AUQ C;  3NS1 A;  3RPF C;  4WJN A;  4RMA A;  2GLS A;  2LWP A;  2BF8 B;  4AJY B;  3RNG C;  1V2Y A;  1C1Y B;  2N9P C;  2MSE D;  2DAJ A;  2V9H A;  1XF5 L;  2KVR A;  4W9G A;  4MSM B;  2MA9 B;  3U8Z A;  1IPG A;  3NHE B;  3AE9 B;  3PT2 B;  4FUL A;  4OZC A;  2KTR A;  1OTR B;  1N5X A;  4FA6 A;  1V1O A;  5HKH A;  5CHV C;  3U52 E;  5IN7 A;  1SE2 A;  1EF1 A;  2O2V B;  2N9L A;  2WX0 A;  4I6N B;  5GMV A;  5FR6 A;  5AEK B;  1EM7 A;  4TMA B;  3EGR A;  1WJU A;  3HIZ A;  3VRA B;  1HZ6 A;  4HPP A;  5CHW A;  3UQB A;  1GPX A;  4IW0 A;  3NY5 A;  1J0G A;  2HDE A;  5E6O A;  3P4R B;  2WDT B;  2WXP A;  4DHZ B;  3LXF A;  4LK0 M;  1SGH A;  3JSV B;  3VVW B;  2BVC A;  1WJN A;  3V61 A;  4ZRI A;  3RUL A;  3RNB C;  4JWS C;  5HG2 A;  1N6Z A;  5I4D A;  1RFA A;  1P7F A;  1AWD A;  1JWU D;  2QJL A;  1YD8 U;  4II2 B;  2M4N A;  1EWY C;  3ETR A;  2PE6 B;  4FLH A;  2IO1 B;  2L32 A;  2INP E;  5CHF A;  4JIO U;  1P7E A;  3Q3M C;  5HI1 A;  3OAW A;  3AMZ A;  1FRR A;  2DEN B;  1K52 A;  3I9V 1;  4RH6 A;  5AZH A;  3VHT C;  4BKS A;  3W1S C;  4KSK C;  3Q69 A;  3DBL B;  3ZVV A;  4HXD A;  3ECI A;  4CYE A;  4ICU A;  4CQN A;  2BS4 B;  2KN5 A;  5IKC M;  2V3N A;  4TQ1 A;  3AXC A;  3PZ7 A;  1J19 A;  1E10 A;  4ZRK A;  5EE1 A;  4CO7 A;  3PLV A;  3FIL B;  2BQQ A;  2G9H D;  4ZYS A;  1WYW B;  3DBR I;  4TQ0 A;  4IM3 A;  3NVY A;  1HE8 A;  2M1M A;  1GC6 A;  1FO4 A;  1WZ3 A;  3C8Y A;  4TSS A;  1V97 A;  3MFG A;  1YOV B;  3RZF A;  3MJ5 A;  1KH0 A;  1KOT A;  3BVM A;  4ZRP A;  5IAA C;  2MX2 A;  3H1U A;  2FCS A;  2D2Q A;  2D3B A;  4WAF A;  1E9M A;  4FJV B;  3CMM B;  2SAK A;  2H89 B;  2RSU A;  4GDK B;  4HKZ E;  3VUY A;  4YSX B;  2K39 A;  2WNM A;  4W9D A;  3A9J A;  2HJ1 A;  1QQR A;  2DBY A;  2VRR B;  3IHP C;  4HKQ A;  2J53 A;  3D32 A;  4FXC A;  4L2Y A;  3OLM D;  2PLP A;  3DHH C;  4JWU C;  4N59 A;  3H6N A;  1WXM A;  1QLB B;  1UGM A;  4GMV A;  3LJ3 A;  2KAC A;  2L76 A;  4AWJ A;  1SJH D;  4NAW A;  3ZNG C;  1NEN B;  4OVV A;  2PKO A;  4HCP B;  3LDZ E;  4C7Z A;  4M8N A;  2YEP B;  4JLC A;  3EEC A;  4EFO A;  1Q10 A;  2D07 B;  1NYQ A;  3AEC B;  3L17 A;  3U2S C;  1TTN A;  3ML8 A;  4C80 A;  1ZPS A;  1Z5S B;  2ZVO A;  2XBB C;  3PS6 A;  3TEX A;  1HQR D;  1ZE3 D;  1AAR A;  4EKU A;  3DCG A;  3AE5 B;  4RGN A;  3L4P A;  1YN3 A;  4EEW A;  2ON8 A;  4HWI B;  3QQ8 B;  1RAX A;  1OQQ A;  2GBR A;  3WAN A;  1U4A A;  3PRE A;  1JWS D;  1FIQ A;  1C79 A;  1WE6 A;  2MBE A;  3LB8 C;  1DGJ A;  4DXA B;  2IO3 B;  4A3P A;  5BMG A;  1KTK A;  2JSV X;  4K7S A;  4W9K A;  3NJT A;  3PPA A;  4A6Q A;  4GB9 A;  3V6C B;  1F2R C;  4DK5 A;  2NTT A;  1V81 A;  3GZN B;  4OZB A;  2DYB A;  2EEL A;  1FPY A;  2WXO A;  1KF6 B;  2E6X A;  2QHO A;  3L16 A;  4DXG A;  2N9X A;  3Q3F A;  1TS5 A;  2ASQ A;  2HD5 B;  2LUE A;  2R2O A;  2DYO A;  2D5G A;  1A70 A;  2SEB D;  5LXH A;  3MHS D;  2G1E A;  1NDD A;  2UU7 A;  1TZ1 A;  2QCZ A;  3N1Z C;  2ZEQ A;  3E9S A;  4PK1 A;  1BXT A;  3RT3 B;  4M02 A;  4N58 A;  1I42 A;  2WGS A;  2NPT B;  1KLU D;  3TUO A;  2ZNV C;  5LLI A;  1YMH E;  2LGY A;  4BKG A;  4I6P A;  3PHX B;  3RN9 C;  2KXJ A;  1ZDV A;  4LNK A;  1JWB D;  1AYF A;  2K9X A;  3ZIM A;  3SD5 A;  1OEY A;  3GE3 C;  3KUD B;  2QMT A;  2R61 A;  2OHF A;  3FC4 A;  1K8R B;  2PMV A;  1SJE D;  3FKY A;  1E5W A;  3X23 A;  3Q8C A;  2GOW A;  2W54 A;  3E56 A;  3PO0 A;  4AJW A;  4C4V B;  1WGG A;  4HVB A;  2KN4 A;  2K22 A;  1IP9 A;  1WR1 A;  3TJP A;  3UIN B;  3BVZ A;  3ZJU A;  4NPN A;  1E7V A;  4DQO C;  2FCQ A;  3KW5 B;  2L1A A;  2X38 A;  4WWP A;  2MJD A;  3A1Q B;  5FR3 A;  1VCB A;  3V6E B;  2YLM A;  3AEE B;  4ITK A;  4A55 A;  3TEZ A; 
#chains in the Genus database with same CATH homology
 4GN1 A;  2BWF A;  2G4S A;  4ANX A;  2DAF A;  2KTR B;  4MSQ B;  3WAL A;  1V80 A;  1WI0 A;  1ZKH A;  2KOX A;  2L7R A;  4NNJ B;  4ANU A;  3CSF A;  3L10 B;  2IY0 B;  2BGF A;  4G50 A;  1G6J A;  4HCN B;  2KMC A;  4M0W B;  2C60 A;  1WGY A;  2WWZ A;  3ZDM C;  3TCA A;  2GBK A;  3TBL D;  1LQB A;  3IG3 A;  2MBH A;  5G2N A;  1E7U A;  3EFU A;  3SHQ A;  3KYC D;  3TIX A;  3A4R A;  4AUQ C;  2J7Q B;  1YQB A;  2EMT A;  3ZO5 B;  2G3Q B;  3QWZ B;  1P3Q U;  4WJN A;  3UGB B;  4RMA A;  3DVG X;  2JZ3 B;  1Q5W B;  2A4Z A;  2LWP A;  2BF8 B;  3M95 A;  4GGQ A;  4AJY B;  1CMX B;  4EZL A;  1WIA A;  2IZV B;  4IM0 A;  2Z59 B;  3KUC B;  3EHV A;  2D10 A;  1UBI A;  1V2Y A;  1C1Y B;  2N9P C;  1YJ1 A;  2MSE D;  2DAJ A;  2KVR A;  4W9G A;  2LVP A;  2LI5 A;  2MA9 B;  4MSM B;  1WGD A;  3U8Z A;  1IPG A;  2UWQ A;  3NHE B;  4JGH B;  3PT2 B;  1GJZ A;  4FUL A;  4PYU A;  2G45 B;  3L13 A;  4I6L B;  3UIO B;  1XT9 B;  1RLF A;  1SIF A;  2KDF B;  2RPQ A;  3AI5 A;  2KJR A;  2KTR A;  1OTR B;  5EDS A;  3PTF C;  4NAW B;  2N4F A;  4FA6 A;  2LJ5 A;  3DBH I;  5HKH A;  5CHV C;  5JHB A;  3ZUN A;  5JZE B;  2DZJ A;  2FNJ B;  4MGI E;  1EF1 A;  2N1W A;  4AP4 C;  3ZNH B;  2O2V B;  5D7G A;  2WX0 A;  3M62 B;  3QAQ A;  4I6N B;  5GMV A;  4M8M A;  5FR6 A;  3A9K A;  5AEK B;  1E90 A;  1NBF C;  4W9J A;  1WJU A;  2JY6 A;  2O6V B;  3HIZ A;  3APF A;  3QK0 A;  3VDZ A;  1LXD A;  1WMH B;  5CHW A;  3ZW3 A;  3UQB A;  3B0A A;  2K6D B;  4RM8 A;  3ZTD A;  4ZYN A;  2FIF A;  2MBB B;  3QCA A;  1UBQ A;  1ZGU B;  5AZF A;  1QZE A;  4IW0 A;  3NY5 A;  2LGD A;  5BO4 B;  4B9K A;  2KFJ A;  1WJ4 A;  1XD3 B;  2N1V A;  1J0G A;  5L83 A;  5E6O A;  4PYZ A;  3UQA A;  2WDT B;  2MBQ A;  2KKC A;  4ICV A;  4WQO B;  5DCN A;  4DHZ B;  2B3A A;  4KVG B;  3SU8 X;  1E8X A;  1SGH A;  1TBE A;  1ZW7 A;  3JSV B;  3VVW B;  2DZI A;  3ZNZ B;  4AOF A;  4K7U A;  1WJN A;  3PZD A;  2KD0 A;  3H7P A;  4ZRI A;  1P1A A;  2K25 A;  2KZR A;  3RUL A;  3V61 A;  4E71 A;  2MBO A;  2J0K A;  3RCZ A;  4MEM A;  4A3O A;  1WE7 A;  2AL6 A;  1RFA A;  4MGY E;  3JYU A;  4B95 A;  3ML9 A;  1YD8 U;  4II2 B;  1RRB A;  2M4N A;  3CST A;  1X1M A;  2PE6 B;  3MTN B;  3DVN V;  3HM3 A;  2L8J A;  2IO1 B;  3H9D A;  3ENE A;  4FLH A;  3VH3 B;  2PEA A;  5CHF A;  1V9J A;  4JIO U;  3RYT A;  3KH0 A;  4W9I A;  2KWV B;  1WF9 A;  2BWE S;  5IA7 A;  1LM8 B;  3OAW A;  4ZDV A;  2A5U A;  2M17 A;  4EUT A;  2K1F A;  3DQV A;  2ZPY A;  2YVC A;  3AU4 A;  1WGH A;  2DEN B;  3DDC B;  3PSE B;  1F9J A;  4MH0 E;  4MEL A;  5AZH A;  1BT0 A;  2MRP A;  3ZRC A;  3VHT C;  1WZ0 A;  2BYF A;  2KQ7 A;  2ZVN A;  4BKS A;  3W1S C;  3OJ4 B;  2KJH B;  1FXT B;  4KSK C;  3QX1 A;  2DZK A;  1KJT A;  2I1K A;  3NS8 A;  3ONS A;  4TV3 A;  2ZCB A;  5CTR C;  5D2M B;  2L00 B;  2FUH B;  3ZVV A;  3BIN A;  4HXD A;  1WXV A;  2LAS A;  2LRU A;  3ECI A;  1WX9 A;  3GZN I;  4CYE A;  2CR5 A;  4II3 B;  4E74 A;  4ICU A;  2R2Q A;  4FAD A;  2MCN B;  4GDL B;  2KN5 A;  4TQ1 A;  2J0M A;  3ZDT A;  4NJ7 A;  3ALB A;  3AXC A;  3VAW A;  1J19 A;  2LZ6 A;  4ZRK A;  1P98 A;  1V5T A;  3MJW A;  4CO7 A;  3PLV A;  5C1Z A;  4IG7 B;  3WAM A;  2KLG A;  4HLE A;  1WYW B;  3DBR I;  4IWP A;  2HJ8 A;  2WX1 A;  4TQ0 A;  4IM3 A;  3ZKJ C;  1OQY A;  3M3J A;  2JT4 B;  3N3K B;  1HE8 A;  3TMP B;  4IWO A;  2M1M A;  2L0F A;  3L08 A;  3V60 A;  1GC6 A;  1WZ3 A;  3ZNI D;  2LRW A;  3KVF B;  4HK2 A;  2KAN A;  4KSL C;  3P2B A;  4PS7 A;  4URK A;  5AZG A;  1WH3 A;  3RZF A;  2RR9 A;  3AUL A;  1KOT A;  4E3C A;  5LXI B;  2KWC A;  5IAA C;  2FCM A;  1GC7 A;  2MX2 A;  3H1U A;  2ZNV B;  2FCS A;  2V1Y A;  5J2R A;  4PS3 A;  3A9J B;  3L54 A;  2O6V D;  2AEH A;  2D2Q A;  4KZ0 A;  3U30 A;  3ZTC A;  4FJV B;  4K7W A;  3V62 A;  3O65 B;  4FHK A;  2HE7 A;  3CMM B;  3VTU A;  3U7D A;  3NZS A;  2M0X A;  2W9N A;  2NS5 A;  3A4S C;  3K9P B;  4MGZ E;  4WAA A;  2CU1 A;  4DDG D;  2RSU A;  2CS4 A;  4GDK B;  5J17 A;  3VUY A;  2KK8 A;  3WAP A;  2K6Q A;  3IFW B;  2K39 A;  2EKE C;  4W9D A;  3A9J A;  5J18 A;  1JRU A;  4HDQ A;  1NI2 A;  4B6W A;  4LJP B;  2V4L A;  3VH4 B;  2VRR B;  4LDT D;  2PE9 A;  1H4R A;  2CHW A;  3HM6 X;  4LDT B;  3IHP C;  1VD2 A;  2RGF A;  4FJY A;  3D32 A;  4DDI D;  2D11 A;  3OLM D;  4HDO A;  1M94 A;  4XZ4 A;  4X57 B;  1OGW A;  1V49 A;  3JSV A;  2KX0 A;  2I1J A;  3H6N A;  3H7P B;  4W9H A;  2BPS A;  1V86 A;  2KJ6 A;  1WXM A;  4MJS B;  1UGM A;  4GMV A;  3LJ3 A;  5L95 C;  2KMA A;  2L76 A;  2K8B A;  4AWJ A;  1MG8 A;  1WX8 A;  2KC1 A;  4NAW A;  4YL8 A;  3ZNG C;  3B1L X;  4BBN F;  4DHZ E;  2PJH A;  4OVV A;  3DPD A;  2HTH A;  2KFK A;  2MP2 B;  3M63 B;  1V6E A;  3R66 C;  2J0J A;  2REX A;  3LDZ E;  4HCP B;  5E6P A;  3JW0 X;  4GXB A;  3QHT A;  1E8W A;  2IO2 B;  5DPR A;  4M8N A;  3X0W A;  5C23 A;  3PVL A;  3APD A;  4JLC A;  3R7R A;  1PQS A;  1J8C A;  3EEC A;  4BKT A;  4EFO A;  1LFD A;  2D07 B;  2JF5 A;  2LXA A;  4KIK A;  3VXW A;  3L17 A;  2K8H A;  2G4D B;  3QAR A;  1TTN A;  1Q1O A;  3ML8 A;  1Q0W B;  3VUW A;  4F7Z A;  1Z5S B;  2O2V A;  2ZVO A;  2XBB C;  1V5O A;  1S1Q B;  2GBN A;  2NBU A;  3DOW A;  3PS6 A;  3B08 A;  2KQS A;  1KLV A;  1WR6 E;  3N30 A;  1AAR A;  4J6I A;  4EKU A;  3DCG A;  1R4N I;  3W1S A;  4MGK E;  4TUU A;  3PRP B;  4DHJ D;  1KM7 A;  1WXA A;  2GBJ A;  2NBW B;  2XEW A;  4IC7 B;  4MM3 A;  3L0W B;  4WJP A;  3SDL C;  4K1R B;  4EEW A;  2ZPN A;  4HWI B;  4NQL B;  2DYM A;  4ANV A;  3QQ8 B;  3N32 A;  1RAX A;  2FID A;  2GBR A;  4DBG A;  4G3X B;  3WAN A;  3PRM B;  1U4A A;  1WY8 A;  5DPW A;  3RUI B;  2NBV B;  3PRE A;  3DBL I;  1WE6 A;  2MBE A;  4HJK A;  4BBN C;  4KDL B;  1YX6 B;  5JH5 C;  3KYD D;  5D94 A;  4DXA B;  4W9F A;  1A5R A;  1SE9 A;  3DVG Y;  1TGZ B;  2FCN A;  2KLC A;  1P9D U;  1YX5 B;  2IO3 B;  4A3P A;  3S2A A;  2FAZ A;  2RD0 A;  1OEY J;  3UF8 A;  4TKN A;  2DHZ A;  3K9O B;  2DX5 B;  3TL5 A;  2XK5 A;  2D3G A;  3VTV A;  3WA0 A;  4EZK A;  4K7S A;  1UD7 A;  4ZRJ A;  5KHQ A;  1UH6 A;  4F1S A;  3QJZ A;  3T8M A;  4RM9 A;  1EUV B;  4LCD E;  3EC8 A;  4ANW A;  4CHK A;  3C0R B;  4FHJ A;  4W9K A;  5G55 A;  3PPA A;  4GSW A;  2GMI C;  2JRH A;  4GB9 A;  2EMS A;  3VUX A;  3V6C B;  2IYD B;  2N9E B;  4DK5 A;  4FBJ B;  1V81 A;  1WJ6 A;  2IY1 B;  2L3Z A;  1L7Y A;  2JXX A;  2O6V A;  3APC A;  2DYB A;  3PRZ A;  2BKF A;  4N9F 4;  2XK5 B;  3IBE A;  1ISN A;  1Z2M A;  4EOY A;  3UIP B;  2QHO A;  3GOE A;  3L16 A;  2AL3 A;  2LVO A;  2N9X A;  3Q3F A;  3PHW B;  2ASQ A;  2HD5 B;  1WRD B;  4G11 A;  2LUE A;  5DPT A;  2R2O A;  2KDE B;  2UYZ B;  3KUZ A;  2LXC A;  2DYO A;  2BKR B;  3A9K B;  3PGE A;  4ASW C;  5JHA A;  5LXH A;  3MHS D;  4W9L A;  4BFR A;  4IUM B;  1NDD A;  2JVC A;  3A1Q A;  3JVZ X;  2KX3 A;  1GG3 A;  1WMH A;  1TZ1 A;  2ZZP B;  4WWN A;  1T0Y A;  3VTW A;  3R7Q A;  2KC2 A;  3RD2 A;  3PV1 A;  1UEL A;  3Q3J A;  2NPT A;  2Y5B B;  2KNB A;  4DWF A;  1H8C A;  1S3S G;  4W9C A;  2ZEQ A;  4OVU A;  3PLU A;  3RT3 B;  2WYQ A;  1I42 A;  3WIM A;  4BOZ B;  2NPT B;  3RZW C;  2GBM A;  2V3S A;  3WAO A;  2K8C A;  1L2N A;  4A20 A;  2N7E A;  1EF5 A;  2IO0 B;  2ZNV C;  2MWS B;  5TR5 A;  3T9L A;  3DVN U;  3QC8 B;  4KV2 A;  5LLI A;  4JQW C;  1C3T A;  2C7H A;  2KTF A;  2AYO B;  1GUA B;  4P7I A;  1D3Z A;  4NJ6 A;  3QIJ A;  2N7D A;  2JWZ A;  2KDB A;  5CX3 A;  2LGY A;  3NZU A;  4K81 A;  4KIK B;  4W9E A;  4BKG A;  2C5L C;  5DPS A;  4I6P A;  3PHX B;  2KFK B;  2IBI B;  4DHJ B;  2ZJD A;  4EZJ A;  2KXJ A;  1XQQ A;  2CHX A;  1WM3 A;  3W1Y A;  3VFK A;  4F8C B;  4NY0 A;  2DZM A;  1WGR A;  1UZX B;  3HK0 A;  2OJR A;  5D6J B;  2OOB B;  2AWT A;  4IM2 A;  3ZRF A;  2NR2 A;  2NVU I;  4FJZ A;  1P0R A;  1E8Z A;  3ZIM A;  3SD5 A;  1WXS A;  4XC2 A;  1OEY A;  1R4M I;  2L0T A;  4GDL A;  2ZCC A;  4GIV A;  3R3M A;  3KUD B;  2M8S A;  4PS8 A;  5E6N A;  2C7N B;  3AU5 A;  4XX5 A;  3I3T B;  3A33 B;  1K8R B;  2PPH A;  4BOS C;  2CHZ A;  2BYE A;  1Y8R C;  3H7S A;  4WJQ A;  3OJ3 A;  1EO6 A;  1E5W A;  3HHM A;  2KHW B;  4KZC A;  4BVU C;  3X23 A;  2MP2 A;  4WWO A;  2Z0D B;  4FN2 A;  4LJO B;  3BY4 B;  2GOW A;  3IVF A;  4MDK E;  4GU2 A;  4AJW A;  1WGG A;  4HPL B;  4BKS D;  2LVQ A;  2KDI A;  4HVB A;  4G0N B;  1WFY A;  1I35 A;  4WJO A;  2L05 A;  1WR1 A;  3VQI A;  1IP9 A;  2NCN A;  4JL9 A;  3TJP A;  3UIN B;  1IYF A;  2Z0E B;  4HPM B;  3NOB A;  1WX7 A;  4NPN A;  3CF6 E;  1E7V A;  5KHO A;  1YIW A;  2KWU B;  2FCQ A;  2JRI B;  3KW5 B;  2LD9 A;  3DBS A;  3ZLZ A;  2KO3 A;  1GNU A;  4WWP A;  2C7M B;  1WM2 A;  3A1Q B;  2CKH B;  2MW5 A;  2MQJ A;  4MJS A;  3QA8 A;  4GDK A;  4KDI C;  2C9W B;  1VCB A;  2JPH A;  4IWQ A;  3V6E B;  2YLM A;  2JUO A;  2LGX A;  4GOC A;  2BYV E;  2MLB A;  2JZZ A;  4NQK E;  1E8Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...