1R4MI

Appbp1-uba3-nedd8, an e1-ubiquitin-like protein complex
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
76
structure length
76
Chain Sequence
b'MLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVLHLVLALRGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords amyloid beta precursor protein-binding protein 1
publication title The structure of the APPBP1-UBA3-NEDD8-ATP complex reveals the basis for selective ubiquitin-like protein activation by an E1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 18
structure length 76
sequence length 76
chains with identical sequence J, K, L
ec nomenclature
pdb deposition date 2003-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1r4mI00
2IBIB 3VXWA 2LRUA 4KZCA 5D6JB 1T0YA 2KFKB 4K7WA 3APDA 2KVRA 4BKSD 2DAFA 2EMSA 1OQYA 3H7PA 2MRPA 2FIDA 1XD3B 5KHOA 4FJZA 2RR9A 1WGRA 3A9JA 3KUDB 3ZNHB 2FNJB 1WX7A 4ANXA 2J0KA 3QJZA 5DPTA 2DHZA 1E5WA 1WM3A 2N7EA 3BINA 4OVVA 2G4DB 2I1KA 3EFUA 3N3KB 4LDTB 4GDKA 3DQVA 4KSKC 4WWOA 1WGDA 1V80A 5LLIA 2AEHA 3Q3FA 5LXIB 1WYWB 3DVNV 4MJSA 2LVPA 4HXDA 2FIFA 3APFA 2L7RA 4EZJA 4AOFA 4MGZE 4F1SA 4FULA 2OJRA 1UBQA 1ZKHA 2OOBB 4MELA 4K1RB 4MM3A 1PQSA 4X57B 5C23A 3RD2A 2NPTA 2AWTA 2CHZA 3PSEB 3OLMD 3PREA 3WANA 3WA0A 4BBNC 1E7UA 2KX3A 1E7VA 4XC2A 2R2QA 3QX1A 1L2NA 2HTHA 2M8SA 3DVGY 3QHTA 2A5UA 2M1MA 3AXCA 2MLBA 2FAZA 4ZRJA 3VTWA 4B95A 1KJTA 3H9DA 1HE8A 2Z59B 3AU5A 1YD8U 3DBSA 2IO2B 2Z0EB 1UBIA 1R4NI 3RT3B 3ZW3A 4AWJA 2K1FA 3PLVA 4HDOA 2WDTB 2ZPNA 3VH4B 2V1YA 1WXMA 2MBQA 4DDID 2NR2A 3PZDA 1V81A 2KC1A 4I6LB 2MBBB 4NJ7A 5KHQA 3JYUA 2JUOA 2K6DB 5AZFA 3U8ZA 4IWOA 2KKCA 2V4LA 2ZPYA 5J17A 3UIOB 1WE7A 1H4RA 2EMTA 4BKTA 1L7YA 2IO0B 1F9JA 3UQBA 4AJWA 4BKSA 2LASA 3LJ3A 4GDLA 3KUCB 4NPNA 1K8RB 2M4NA 3CMMB 3QIJA 2AL3A 3NZSA 4MH0E 2C9WB 2KZRA 2N9EB 1I35A 3ZIMA 3H6NA 3EHVA 4M0WB 3RYTA 1WJUA 4WJNA 2KC2A 2UYZB 3VUXA 4II2B 4MGKE 2DZIA 3TIXA 2LI5A 1J0GA 2O6VB 3K9OB 5J2RA 1WMHA 1RLFA 2MBEA 3W1SC 2BYFA 3KVFB 3PRMB 2K6QA 1WXSA 1Z2MA 2XBBC 1P0RA 2LRWA 2J0MA 3VTUA 1UH6A 3R3MA 4GU2A 3IG3A 4HDQA 3ZNID 1GJZA 5D94A 1V9JA 4EKUA 1IP9A 2O2VA 4KV2A 5TR5A 1LXDA 2DYOA 1OEYA 3PLUA 4JGHB 3DOWA 5JH5C 4FHJA 2JRHA 4LJOB 3A4RA 2MP2A 2KMCA 4LDTD 4A20A 1FXTB 1Q1OA 1WZ3A 2EKEC 3KH0A 3B0AA 4FHKA 3KYDD 2N9PC 5E6OA 1WE6A 2KQSA 3WIMA 4PS7A 1KLVA 3NZUA 2LXCA 2N9XA 2K8CA 3L54A 2IY1B 4IWQA 5AEKB 3ZUNA 1TGZB 3L0WB 1LQBA 1RAXA 4B9KA 3VFKA 4FLHA 1TZ1A 5E6NA 1TTNA 2DZMA 2V3SA 4F7ZA 4A3PA 1YQBA 4GIVA 3H7PB 3A1QA 2RSUA 1SE9A 4WQOB 2FUHB 5L83A 1S3SG 2XK5A 4TQ0A 1KM7A 1WM2A 2C60A 2D07B 3PHXB 2GBKA 1U4AA 3P2BA 3SHQA 2KTRB 2NBWB 4DDGD 3DCGA 2FCQA 2LGXA 4HPMB 1YX6B 3HK0A 3PHWB 3R7QA 2KJHB 1GNUA 2KK8A 2WYQA 2MWSB 1VD2A 2L3ZA 3A9KB 3TCAA 3A33B 2LVQA 2DENB 1WXAA 2KWUB 3W1YA 2JWZA 1V86A 3WAMA 3SDLC 4AUQC 2KWCA 4DHZB 3AU4A 2C7HA 4MJSB 3WALA 4W9HA 3K9PB 2IZVB 3X0WA 4NJ6A 5IA7A 1WGYA 3HHMA 3Q3JA 4IM2A 4RMAA 2WX1A 4ZYNA 4HLEA 1GC7A 2FCSA 3X23A 2G3QB 2UWQA 4GOCA 3AI5A 3VQIA 1RFAA 4G0NB 3CF6E 2NPTB 1WIAA 2KFKA 3ZO5B 4DWFA 3V6CB 1UELA 2LUEA 2ZNVC 3QC8B 2GBJA 5HKHA 2ZCBA 4W9LA 2IY0B 2MSED 1V49A 2KJ6A 3UQAA 2KQ7A 3UINB 1Q5WB 3EC8A 1KOTA 4IW0A 4ICUA 4GSWA 2NCNA 3B08A 5DPWA 1RRBA 1NDDA 5E6PA 3DBHI 2DZKA 2GOWA 2GBMA 2O6VD 4WWNA 1WGHA 2BGFA 2MCNB 3RUIB 2MBOA 3JVZX 1H8CA 1IPGA 3BY4B 3PV1A 2CU1A 5DPRA 3O65B 2K8HA 3APCA 4A3OA 4M8MA 5CHFA 2KLCA 2MBHA 4E74A 3DDCB 2PE6B 4PS3A 3JW0X 4ASWC 3L10B 3W1SA 2JXXA 3UIPB 3U7DA 3ZRCA 2G45B 3PGEA 4BVUC 3TL5A 4CHKA 5DCNA 3N30A 1J19A 4WJQA 3VUWA 2NVUI 4K7SA 2L8JA 3MTNB 3IHPC 4NQKE 3CSTA 2B3AA 4IUMB 3H1UA 4NAWA 4I6NB 4KDLB 2KDEB 3WAOA 4HPLB 4HK2A 4E3CA 2N7DA 4NY0A 4XX5A 4KSLC 3S2AA 3ZNZB 4URKA 3N32A 1R4MI 2MW5A 3PTFC 2BWES 3T8MA 1WR1A 2D2QA 2NBUA 3ECIA 4IM0A 4ZRKA 3ZLZA 1WMHB 4BOSC 3ZVVA 2JVCA 3RCZA 2KO3A 2LD9A 1X1MA 2MX2A 2GMIC 2BKRB 4ANUA 4KIKA 5JHBA 2DZJA 3M62B 2N1VA 5J18A 1ISNA 4EOYA 1SIFA 2JRIB 4B6WA 2NS5A 4FN2A 2M17A 4NNJB 3R7RA 2CHXA 1E90A 5CHVC 3ZTCA 1Y8RC 3D32A 1IYFA 1J8CA 2WWZA 1V5OA 1VCBA 2BYEA 3NS8A 4W9JA 2MA9B 4BOZB 1P3QU 1LM8B 2JPHA 3OJ4B 4KDIC 3PRPB 4DHJB 4F8CB 2YLMA 2C5LC 4AP4C 4N9F4 3QCAA 4LJPB 5JZEB 4DXAB 2RGFA 4JL9A 2GBNA 3I3TB 3SU8X 2M0XA 1AARA 2JY6A 3VTVA 2O6VA 1P98A 3ZDMC 2KD0A 3VAWA 1I42A 3TBLD 5D7GA 2BKFA 2MQJA 2HE7A 3VH3B 1C1YB 3KYCD 4XZ4A 3M63B 1NBFC 2HD5B 2FCMA 4WAAA 4FJVB 3JSVA 2XEWA 2CKHB 4GN1A 4GB9A 3A9JB 4FADA 2J0JA 2D3GA 1WRDB 2JZZA 3NHEB 2KDIA 3KUZA 4JLCA 4OVUA 1OTRB 2IO3B 4EUTA 3ALBA 3M3JA 3EECA 2KXJA 1Z5SB 1OGWA 2FCNA 2RPQA 2ZVNA 3M95A 2KJRA 4TUUA 4W9EA 4GDKB 4GGQA 4WJOA 3IVFA 4WWPA 2BF8B 4E71A 1WX8A 4PYUA 5D2MB 2J7QB 2L0TA 2KX0A 1CMXB 3DVGX 4LCDE 2CHWA 5AZHA 1WJ4A 2KNBA 4P7IA 2KDBA 5IAAC 3ZKJC 1V5TA 3PS6A 5CTRC 4TV3A 2NBVB 1E8XA 4ZRIA 4AJYB 4I6PA 2LXAA 4MEMA 4IWPA 3QWZB 4EZLA 4ANVA 1EO6A 4GMVA 3HM6X 1TBEA 2JT4B 3DPDA 4HCNB 2KTRA 3CSFA 2PEAA 4W9KA 3V61A 2A4ZA 2KFJA 3A9KA 1BT0A 2DYMA 2LGYA 5LXHA 2L00B 4GXBA 3GOEA 3QK0A 2IYDB 3V6EB 2ZCCA 2K25A 2VRRB 3VDZA 2ASQA 3QQ8B 5FR6A 3ML9A 4ICVA 2PJHA 5CX3A 2W9NA 4FJYA 3ZRFA 2AYOB 3V62A 3NY5A 2QHOA 2ZZPB 2C7NB 1WGGA 3HM3A 2KANA 3DBLI 4IM3A 1EF1A 4MGYE 2DYBA 4RM9A 3C0RB 1WXVA 1GC6A 3GZNI 4K7UA 2KDFB 2HJ8A 4NQLB 1EF5A 3L08A 2RD0A 5JHAA 4MSMB 4MGIE 3B1LX 3RZWC 1MG8A 1WY8A 4EEWA 4NAWB 4DHJD 2BPSA 1QZEA 2G4SA 2KMAA 2IO1B 1WJNA 1Q0WB 4ZDVA 3ML8A 4GDLB 2GBRA 2CS4A 4JQWC 1JRUA 4BFRA 1WFYA 3IBEA 1ZW7A 3NOBA 1UGMA 3PRZA 4G50A 4HCPB 3KW5B 2JZ3B 2L76A 4G3XB 4IG7B 4W9GA 5GMVA 3ENEA 5EDSA 3H7SA 2CR5A 4FA6A 3MHSD 3VUYA 3OAWA 4DK5A 1OEYJ 4KIKB 4PYZA 1WZ0A 2REXA 3PPAA 3V60A 4BBNF 4ANWA 4EZKA 2AL6A 3UGBB 1GG3A 4TQ1A 1GUAB 2KOXA 3R66C 1WI0A 2Y5BB 1NI2A 2PE9A 4BKGA 2LZ6A 2K8BA 4II3B 3AULA 4W9DA 1WJ6A 2LJ5A 4CYEA 1V6EA 5DPSA 2O2VB 2BWFA 1E8YA 3L17A 4J6IA 1G6JA 3RZFA 2JF5A 2L05A 1M94A 4EFOA 1V2YA 4CO7A 3DBRI 2KWVB 2MP2B 1E8WA 3ZTDA 4FBJB 5L95C 3DVNU 5G2NA 3SD5A 1C3TA 3A4SC 1XQQA 1WR6E 2PPHA 2YVCA 1YX5B 2KLGA 3UF8A 2WX0A 1UD7A 1D3ZA 4KVGB 3HIZA 1SGHA 4MSQB 4IC7B 3IFWB 1P9DU 2DAJA 2N1WA 1A5RA 4KZ0A 4HJKA 4DHZE 3VVWB 3T9LA 5AZGA 4MDKE 4DBGA 2DX5B 3PT2B 2D10A 3A1QB 5CHWA 3U30A 2ZVOA 3JSVB 3PVLA 4TKNA 5G55A 2XK5B 1EUVB 3L13A 1WF9A 4HVBA 4M8NA 2ZNVB 3LDZE 4W9IA 5BO4B 1YJ1A 4JIOU 2K39A 3TMPB 3ONSA 1S1QB 2ZJDA 2LWPA 2D11A 3ZNGC 3WAPA 2L0FA 1UZXB 2KTFA 4W9FA 1WH3A 2R2OA 3ZDTA 1LFDA 1XT9B 2C7MB 3QARA 4PS8A 2BYVE 2Z0DB 1E8ZA 2LGDA 1WX9A 3QAQA 2KN5A 2N4FA 1ZGUB 4RM8A 1YIWA 2I1JA 3QA8A 3OJ3A 4HWIB 1P1AA 4YL8A 3L16A 3RULA 3VHTC 3MJWA 4G11A 2KHWB 4W9CA 4WJPA 5C1ZA 4K81A 2LVOA 2ZEQA 3TJPA
chains in the Genus database with same CATH superfamily
2IBIB 4KZCA 2KFKB 3P4QB 3MHZA 1OQYA 2DLBA 3RNBC 2OEDA 3AE4B 2RR9A 3KUDB 3AEEB 4ANXA 2WXRA 3EUB2 1QKZA 2K3UA 1K53A 2I1KA 3EFUA 2ZW0A 4LDTB 4GDKA 4LLGM 2AEHA 5LXIB 3DVNV 4US9A 3APFA 3ZGZA 3SEBA 1N5XA 5IP4D 4F1SA 4FULA 2OJRA 1ZKHA 2OOBB 2ONQA 4MELA 4OZBA 3OLMD 4MH8A 2A5UA 1FO4A 3VTWA 1KJTA 5C3JB 2VZKB 1CQVA 5D3DA 3RT3B 1ZXHA 3MJ5A 1WXMA 2KDMA 3AE1B 2K9XA 2SAKA 5AZFA 4IWOA 2KKCA 3BIID 2ZPYA 3EGRA 5BYRA 1N63A 2AQ1B 3GS2A 2IGDA 1F2RC 2BVCA 2IO0B 1F9JA 2LASA 1VR9A 1K8RB 1NENB 2Z8LA 3NZSA 2N9KA 4H2AA 1I35A 4M02A 4M0WB 3EHVA 2M0AA 2MHJA 2UYZB 2GLSA 4XDCA 2DZIA 3TIXA 3MC0B 2LI5A 3K9OB 5J2RA 1WMHA 3W1SC 3HUIA 3NVWA 1XLQA 1UH6A 3R3MA 2BW2A 4HDQA 3W5VB 5TR5A 1DOXA 1L4DB 3DOWA 5JH5C 4P16A 2KMCA 1TY0A 3TEZA 1FXTB 2LHEA 1MJDA 5AUIA 3KYDD 2N9PC 1WE6A 2KQSA 1KLVA 5AEKB 3ZUNA 3L0WB 1RAXA 2IPKD 3FKYA 3MFGA 5E6NA 4A3PA 4GIVA 3GE8C 2FUHB 5FKAC 4TQ0A 1D5ZC 2C60A 4KGTA 1C79A 3SHQA 2FCQA 2WXIA 3FAHA 3NZ3A 3R7QA 4YSZB 1P7EA 2L3ZA 2QCZA 1FNUA 2LFIA 1FXAA 2KWUB 2JWZA 2MJDA 4LNIA 1FCLA 3B2FA 3X0WA 5IA7A 1HA5A 2YEPB 3HHMA 1GC7A 3AI5A 4KKJA 1SE3A 4J3OD 4RCOA 4XE0A 1YN4A 3ZO5B 4DWFA 2BYTA 3V6CB 1ENFA 2ZNVC 1JW9D 4W9LA 2MSED 1MVKA 3AEDB 1V49A 3UQAA 3UINB 1KOTA 4ICUA 4GSWA 2JWUA 3B08A 2DZKA 2GOWA 2MBOA 1UF0A 4ARIA 5DPRA 4GLSC 2K8HA 4A3OA 2V3PA 4E74A 3DDCB 4RFBA 5BMIA 1D5XC 2V3NA 1RYJA 2FE8A 3W1SA 2JXXA 3UIPB 3U7DA 2G45B 4CHKA 5DCNA 1QILA 1J19A 3DHGC 2J52A 2B3AA 3H1UA 5JXVA 4I6NB 2JZPA 4HK2A 2JYTA 2N7DA 3PO0A 1GPXA 3ZNZB 2W55A 2WU2B 2B76B 2MW5A 3PTFC 2BQQA 1NYRA 4BOSC 1WMHB 2WXQA 4ANUA 5JHBA 2N1VA 1VRAB 3URYA 1SIFA 2JRIB 4KGSA 2NS5A 1Y8RC 4RGOS 1JMLA 3NS8A 1V5OA 4W9JA 4HKZE 1VJKA 2MA9B 4BOZB 1A70A 1P3QU 4F8CB 4KDIC 4WH4A 2YLMA 4AP4C 5JZEB 4DXAB 4JL9A 4RH6A 4M01A 3MC9A 1E6EB 1WWTA 2O6VA 3RNEC 1SXTA 3VAWA 1NEKB 5D7GA 4XGAB 2CU3A 1C1YB 4OZAA 2HD5B 4WAAA 4FJVB 2FUG1 3C19A 3JSVA 4GN1A 4FADA 4JX1C 2D3GA 2JZZA 2KDIA 1PYWD 4JLCA 4OVZA 1OTRB 2IO3B 3M3JA 3P4PB 3EECA 1J7BA 3IVFA 4E71A 2KX0A 4KGRA 3DVGX 1YJJA 1QOAA 3I9V1 1TZOA 1KF6B 2Y5PA 4TV3A 2NBVB 1E8XA 3B2GA 3P4RB 4ZRIA 2HJ1A 4IWPA 4EZLA 1T5XD 1EO6A 2V9HA 2JT4B 1CK1A 2KTRA 2PEAA 3NG0A 4JPSA 3A9KA 2DYMA 2L00B 5T8IA 3QK0A 3ML9A 1ROEA 4XWTA 5CX3A 3ZRFA 2ZZPB 2C7NB 2KANA 2KWDA 2H89B 1DOIA 3GZNI 3CIRB 2KDFB 4LTUA 3RZWC 1WY8A 1TYGB 3NJTA 2BPSA 4ZYSA 1FM0D 2KMAA 2IO1B 3GE3C 4ZDVA 3ML8A 1L6UA 2JZ3B 1I4PA 4W9GA 4FA6A 1GAQB 3MHSD 4KKIA 3VUYA 3OAWA 3Q8FA 4DK5A 2KOXA 3DWMA 1NI2A 4US8A 1WJ6A 1ACCA 1E8YA 5BMHA 1M94A 1FNWA 5IOIA 1C3TA 4NJCA 1D6EC 1E0ZA 2YVCA 1YX5B 2WX0A 1UD7A 2KYWA 1L0VB 5MPOA 2ICIA 2W82A 3IFWB 3SFDB 1P9DU 2M19A 2RMMA 1K51A 4HJKA 5AZGA 4Q2JA 4MDKE 4DBGA 2DX5B 4HRSA 3JSVB 2XK5B 3W5UB 5LNK1 1WF9A 4HVBA 2ZNVB 3ONSA 1S1QB 2QEJC 1EM7A 3ZNGC 3WAPA 4HROA 4FXCA 1WH3A 1XEEA 1LFDA 3QARA 2LGDA 2KN5A 1E9MA 2JX5A 4YT0B 1YIWA 2IJ0A 3OJ3A 3Q2AC 3AE8B 2RDGA 3VRBB 5C1ZA 3MC8A 3OG5A 4K81A 4JE3B 1JALA 2DAFA 2EMSA 3N1YC 2E3TA 2OHFA 4FJZA 1WGRA 3A9JA 2WXFA 3ZNHB 1NYQA 1WX7A 4YSYB 3QJZA 1C77A 5DPTA 4MACA 4OVVA 4KSKC 4WWOA 1WGDA 4REZA 2PTLA 1WYWB 1SB3C 5G5GA 2LVPA 4HXDA 2FIFA 4C4VA 2WQYB 1IGDA 1UBQA 2PW9A 2RPVA 5C23A 2CHZA 3Q8AA 1E7UA 2PLPA 1L2NA 2VH2A 3AXCA 1SJHD 4B95A 3NUHB 3H9DA 1HE8A 3AU5A 5BYSA 2IO2B 2NMQA 4AWJA 2K1FA 2L52A 3VH4B 2MBQA 4DDID 2QDFA 1RWSA 3GZNB 1V81A 2KC1A 1JROA 1FMAD 4YTPB 2K6DB 5HG2A 1WE7A 2XN9C 1MHHE 3UQBA 1FIQA 4AJWA 4GDLA 3KUCB 1MHXA 1XCTL 2D5GA 2M4NA 3CMMB 1HXYD 2C9WB 1LGRA 3ZIMA 3VUXA 4II2B 3FILA 1I4QA 1J0GA 4UDUC 3AH7A 2E6XA 2EELA 1M4VA 1T0SC 2K6QA 2WGSA 2Y5CA 4RGTA 1Z2MA 2XBBC 2LRWA 2J0MA 3P63A 3IG3A 3ZNID 1GJZA 1V9JA 4EKUA 2O2VA 4KV2A 1LXDA 1B1ZA 2DYOA 3PLUA 4FHJA 2MP2A 3AE9B 1Q1OA 1WZ3A 3B0AA 2WDRB 4LK0M 3ZXVA 1L5PA 2IY1B 1TKYA 1TGZB 1LQBA 1V8CA 4B9KA 4HKQA 4HJGE 1TTNA 5EE0A 3NS1A 1YQBA 3A1QA 4HPPA 2WNMA 4WAFA 3PHXB 3GB1A 1P7FA 2X8XX 4ITKA 3DCGA 2WXLA 2LGXA 3PHWB 2KK8A 1VD2A 3I57A 3NRZA 4A90A 3KQ4A 2DENB 3W1YA 2KWCA 1HZ5A 2C7HA 4W9HA 2IZVB 4P1CC 1WGYA 4RMAA 4ZYNA 4TMAB 3Q3OC 1QF6A 1RFAA 4R3DA 5FK9C 1WIAA 1N62A 1UELA 3Q6BA 1JRPA 2GBJA 3PZ8A 1YJIA 2IY0B 2K5PA 5HHDG 1KRHA 1PFDA 2Q5WD 4RF1A 3C8YA 2O6VD 2GBMA 2MCNB 3JVZX 1H8CA 1C78A 1FNVA 2CU1A 2N0SB 4M8MA 5CHFA 2JSVX 4ASWC 3L10B 3PGEA 3TL5A 2JYEA 3VUWA 2NVUI 3AM9A 4K7SA 1SF0A 4NAWA 2KT7A 4KDLB 2WXNA 1TKEA 3WAOA 3DBHB 4HPLB 4A55A 2AX5A 2UU7A 3RI7C 3S2AA 1WSPA 1HTOA 1R4MI 2D2QA 3ZLZA 2DWQA 3AEFB 2JVCA 3RCZA 3I63C 1X1MA 2MX2A 2G1EA 2BKRB 3M62B 3TUOA 4NNJB 1E90A 3ZTCA 1F0ZA 3D32A 2WWZA 1IBXB 1KLGD 3N20C 1FRDA 3QCAA 4LJPB 1PGAA 3AN1A 3VRAB 2WXKA 3I3TB 1C76A 2M0XA 3AE5B 1PGBA 3SU8X 2JY6A 3VTVA 1P98A 1QOGA 3TBLD 3R2IA 4C7ZA 3VH3B 4A8XC 1FFUA 2ON8A 2WP9B 3KYCD 4XZ4A 3M63B 2BT6A 2I2YA 3IAS1 2XEWA 3TSSA 2CKHB 2QIEB 1V1PA 1WRDB 3NHEB 1F2RI 3M95A 3W2DA 2ZVNA 4GDKB 2JU6X 2NTTA 1YQ4B 4WWPA 2BF8B 5D2MB 2L0TA 4L2YA 5IAAC 1V5TA 5CTRC 1QQRA 4ANVA 4GMVA 1TBEA 3DPDA 3CSFA 3RPFC 3V61A 4YTMB 2A4ZA 3Q3MC 4IOIE 1FRRA 2LGYA 1I7HA 3Q8CA 2VRRB 1XLOA 3VDZA 5FR6A 1STEA 2TSSA 2PVOD 1D4BA 2W9NA 3NY5A 1PDXA 3DBLI 4IM3A 2QJLA 4RM9A 1GC6A 4NQLB 2HJ8A 3ZXRA 1EF5A 2EKIA 1T0QC 4USAA 1MG8A 4NAWB 4DHJD 3Q8EA 1Q0WB 3E9SA 2CS4A 4JQWC 3IAM1 4BFRA 1WFYA 3IBEA 1ZW7A 3NOBA 3PRZA 4HCPB 4G3XB 3SFEB 2CR5A 1OEYJ 4PYZA 1UWXA 2REXA 3PPAA 4BBNF 4EZKA 2AL6A 1T0RC 2LZ6A 1V6EA 5IKCM 3V05A 5HI1A 1JWBD 4FBJB 5L95C 1SSNA 3SD5A 5G2NA 1WR6E 2PPHA 3Q3NC 1R4MB 2KLGA 1MG4A 2J53A 1D3ZA 4C56C 4MSQB 2N1WA 2KQ4X 4EE2A 4KZ0A 1N5WA 3VVWB 3BYTB 3T9LA 3PT2B 2PIAA 5CHWA 5D3IB 4S0RA 4TKNA 3DBRB 4K3BA 3AEGB 3PZ7A 2L83A 2L0FA 1UZXB 5IO9A 2XNAC 2INPE 4PS8A 2DNFA 1KLUD 3TEWA 2N4FA 1ZGUB 5BYQA 1FFVA 3QA8A 4HWIB 4YL8A 2LGSA 3RULA 3VHTC 3MJWA 2KHWB 2D3BA 5H92C 2IGGA 2LVOA 2ZEQA 2QC8A 1T0YA 4K7WA 3APDA 2KVRA 3H7PA 1I4GA 2PVGC 2Y3AA 2FIDA 1XD3B 2L1AA 2J0KA 2KAJA 3GP7A 2G4DB 3N3KB 3DQVA 1RM6C 1V80A 5LLIA 2WXGA 3Q3FA 1PGXA 4EZJA 4AOFA 4MGZE 4ZHPA 1FD6A 4MM3A 1PQSA 4X57B 3RD2A 2NPTA 3PSEB 3WANA 2SEBD 1CZPA 2WU5B 3WA0A 4BBNC 4XC2A 2R2QA 2M8SA 2MLBA 4ZRJA 1R7SA 4XDDA 2GRIA 2Z59B 3DBSA 2LMCA 1UBIA 2R61A 2CJOA 3DBLB 2BS3B 2NR2A 3AEBB 1RFKA 4I6LB 2MBBB 3JYUA 3HVZA 5J17A 3UIOB 4BKTA 1TKGA 4BKSA 1N60A 2BS4B 2QILA 3J9CA 3QIJA 1AWDA 1R4NB 4MH0E 3H6NA 4WJNA 3NVVA 2FBWB 2PKOA 2O6VB 1RLFA 2MBEA 1IGCA 1WXSA 3KWVA 5D94A 1IP9A 2ZW1A 4JGHB 2X38A 2JRHA 3RN9C 4PT5A 3ZYYX 2CJNA 5E6OA 2J4XA 1SE2A 3WIMA 4PS7A 3AECB 2K8CA 3L54A 1MI0A 2INDC 4IWQA 1WGKA 1TJEA 2D3CA 1QOFA 4RGNA 1OQQA 2HTME 3DWGC 4BAXA 2K0PA 4FLHA 2V3SA 4F7ZA 2RDBC 3H7PB 4C7YA 1SE9A 4WQOB 3N1ZC 1KM7A 3KWLA 1WM2A 2D07B 2GBKA 3P2BA 2KTRB 4DDGD 1YX6B 2BB5A 3HK0A 2QMTA 1GNUA 2MWSB 3A9KB 1XCQL 3T3OA 3TCAA 3A33B 2LVQA 1WXAA 3WAMA 4AUQC 1AYFA 3AU4A 3WALA 4N6EB 4NJ6A 4IM2A 2WX1A 4HLEA 4YWGG 2FCSA 1QT9A 3AV8A 2G3QB 3VQIA 5E6JA 4MM3B 1DYQA 3CF6E 2NPTB 2KFKA 1SIJA 2LUEA 2BBCA 2ZCBA 4N59A 3ZJVA 1I4HA 1TY2A 1YN5A 2N9LA 4LNNA 3EC8A 3OWEB 4IW0A 1TIFA 5E6PA 3DBHI 3BVZA 3RUIB 1F1HA 3O65B 3APCA 2KLCA 1V1OA 1IUEA 1T3QA 2PE6B 3JW0X 1BXTA 2PMVA 2WDQB 3IHPC 4NQKE 4M00A 3BZDB 3BYYB 2KDEB 4E3CA 4XX5A 1N6ZA 2WXPA 3N32A 3RMKC 1FPYA 4ZRKA 3N1XC 1ZOYB 2KO3A 2LD9A 1PUTA 2GMIC 1T6BX 5J18A 1SBBB 4RF0A 4XWWA 2M17A 3AE6B 3R7RA 2IGHA 2LHDA 1IYFA 1J8CA 3EFCA 2BYEA 2JPHA 3OJ4B 4DHJB 3KLSX 1ZE3D 2C5LC 1J7CA 3H8HA 3RNAC 2DBYA 2RGFA 1QLBB 4M0WA 4BZAA 1HQRD 2WXHA 3ZDMC 2BKFA 1NBFC 2FCMA 4A9AA 4WWMA 4LNKA 4GB9A 3A9JB 3DHHC 5EE1A 2KXJA 1OGWA 2KJRA 4WJOA 4W9EA 4GGQA 1SJED 4PYUA 4C4VB 2CHWA 1WJ4A 3BVMA 2KDBA 4LNOA 2V0GA 4AJYB 2LXAA 4XYCA 3QWZB 3AE2B 1ZP0B 3HM6X 1DOYA 1UWMA 2KFJA 5LXHA 4GXBA 2IYDB 3NVZA 3V6EB 2ZCCA 4ICVA 2PJHA 4KX6B 2AYOB 3V62A 2V4IB 1WGGA 1WXQA 1JWUD 2VH1A 4RNAA 3HM3A 1EF1A 4MGYE 2DYBA 3IXSA 1EWYC 3C0RB 1WXVA 1FCCC 3R8BA 1UNSA 2RD0A 3TEYA 4MSMB 3B1LX 4EEWA 3AMZA 4YTNB 1QZEA 1TS2A 4GDLB 3CWIA 3BVGA 3MP9A 3R2TA 4G50A 3Q8BA 2L76A 5GMVA 3ENEA 1AW7A 3FC4A 5EDSA 3H7SA 3FILB 3P4SB 1N61A 3O13A 1WZ0A 5AUKA 3V60A 3UGBB 1GG3A 1GUAB 3U2SC 4BKGA 4II3B 4ARCA 3LYYA 4JWSC 2O2VB 3L17A 4J6IA 1G6JA 3RZFA 2JF5A 4EFOA 2J42A 1V2YA 3IT6B 4CO7A 1L6VA 3DBRI 2MP2B 1E8WA 3ZTDA 1HTQA 3DVNU 1XQQA 3UF8A 4DXGA 1ET6A 4C00A 4AQ7A 1F77A 3T3NA 3I5JC 4IC7B 2I38A 4OZCA 4DHZE 2BTEA 3EA6A 1GB4A 2LGIA 3A1QB 2D3AA 5G55A 1EUVB 3L13A 3ZJTA 2WS3B 4M8NA 4W9IA 1YJ1A 2KN4A 2K39A 2KVZA 3TMPB 1E10A 1ET9A 2ZJDA 2LWPA 1K52A 2KTFA 3ZDTA 1XT9B 2BYVE 2MH7A 2L32A 3QAQA 1XXGA 4RM8A 2I1JA 5C2TB 5EE3A 4L1BA 3BK2A 4CQNA 1I4RA 4G11A 3TJPA 3VXWA 2LRUA 3NVYA 5D6JB 4BKSD 1EU4A 2MRPA 5KHOA 3U4EG 2FNJB 2DHZA 1E5WA 1WM3A 1UUPA 2N7EA 1JWMD 3BINA 4JWUC 3RNFC 2KACA 1L0YB 1MFWA 2KMMA 4MJSA 2LJIA 4ZHOA 2L7RA 1BUIC 2ACZB 2OJWA 1UGJA 3BWUD 3U7ZA 4K1RB 4TSSA 3ABVB 2AWTA 1K50A 3PREA 2KX3A 1E7VA 3QX1A 2HTHA 3DVGY 3QHTA 1VDVA 2M1MA 1E7PB 2FAZA 2M56B 1YD8U 4ZRQA 2Z0EB 1R4NI 3BK1A 3ZW3A 3U52E 3PLVA 4HDOA 1SE4A 4NZLB 4DQOC 2WDTB 1QOBA 2G9HD 1VZ7A 2ZPNA 3LXFA 2V1YA 1VZ8A 2WXOA 3PZDA 4C80A 3RFZB 4NJ7A 1XO3A 5KHQA 2JUOA 3U8ZA 2V4LA 3RNCC 1F52A 1H4RA 2EMTA 1L7YA 5H8YE 4WIPA 1C4CA 3LJ3A 4NPNA 2AL3A 2N9EB 2KZRA 3RYTA 1WJUA 2KC2A 3TEXA 4MGKE 2AQ2B 1EWCA 3N9YC 2W3SA 2BYFA 3KVFB 3PRMB 1FEHA 3VTUA 1P0RA 4GU2A 1TS3A 2HDEA 2BS2B 1DGJA 3IT4B 3SR6A 1OEYA 1V1PB 4LJOB 3A4RA 4LDTD 4A20A 2EKEC 1ESFA 3KH0A 2W54A 4FHKA 4QAYA 3NZUA 2LXCA 2N9XA 3UI3A 1XLNA 2LEKA 3VFKA 1TZ1A 3P1MA 2DZMA 1V97A 5G5HA 2RSUA 3AE3B 4YXDB 4PK1A 5L83A 1S3SG 2XK5A 1EU3A 1U4AA 2NBWB 1SEBD 4HPMB 2KJHB 2WYQA 2VZKD 4ZRPA 1C4PA 1V86A 3SDLC 4DHZB 2H88B 4MJSB 3K9PB 1KFYB 1MPEA 3Q3JA 1JWSD 1HZ6A 2MJ3A 3X23A 2UWQA 4GOCA 2INNE 3AB5A 4G0NB 1BMLC 1JQ4A 3QC8B 5HKHA 4MT5A 2MJEA 2KJ6A 2KQ7A 1Q5WB 1L4ZB 2NCNA 5DPWA 1RRBA 1NDDA 4ACFA 4WWNA 1WGHA 2BGFA 1IPGA 3BY4B 3PV1A 4HEA1 1XLPA 3RNGC 4P6VF 2MBHA 4RGMA 4PS3A 1HEZE 3Q69A 3ZRCA 3ZQ4A 4D2KA 4BVUC 3N30A 4WJQA 5GXGB 1OQRA 2L8JA 3MTNB 3CSTA 4WURA 4IUMB 4NY0A 1VLBA 1YQ3B 4KSLC 2WXMA 4URKA 1TT5B 5HFYA 2BWES 3T8MA 1WR1A 2NBUA 3ECIA 4IM0A 3ZVVA 2GB1A 2JXTA 4KIKA 2DZJA 1ISNA 1OFFA 4EOYA 4B6WA 4FN2A 1TS5A 2CHXA 5CHVC 2JQRB 1VCBA 2WDVB 2YEPF 1I4XA 1C9FA 1LM8B 4YSXB 3PRPB 4N9F4 4K3CA 4P1BC 2GBNA 1JCKB 1AARA 1YN3A 2KD0A 1I42A 2MQJA 2HE7A 1LO5D 4NAMA 2J0JA 5EE9A 4DXFA 1ZXIA 3KUZA 4OVUA 4EUTA 3ALBA 1D5MC 1Z5SB 2RPQA 2FCNA 3VR9B 2W3RA 4TUUA 2AQ3B 3L4PA 1XF5L 4IDIA 1AN8A 1WX8A 2N7JA 2J7QB 3W9CB 1CJEA 1YNTE 1CMXB 4N58A 1YMHE 4LCDE 5AZHA 2KNBA 4P7IA 3ZKJC 3PS6A 3AEAB 4I6PA 4MEMA 4HCNB 1B9RA 1GOZA 4OHJA 4W9KA 1KH0A 1BT0A 3GOEA 2NTSA 2K25A 2ASQA 3ETRA 3QQ8B 5FR3A 4FJYA 2IDYA 2QHOA 1NI3A 2WHIA 4IKGA 4A6QA 1WYGA 4K7UA 1YOVB 3HVDA 3ZJUA 3L08A 5JHAA 4MGIE 1JWAD 2G4SA 1WJNA 2GBRA 4L23A 1JRUA 1WRIA 1UGMA 4B0EA 3KW5B 3LB8C 4IG7B 2K22A 3AE7B 4S17A 3HRDD 4KIKB 4ANWA 4WQMA 4B0MA 3WCQA 4TQ1A 5I4DA 1GB1A 3R66C 1WI0A 2Y5BB 4AS1A 2PE9A 1FXIA 2K8BA 3AULA 1NVID 4W9DA 2LJ5A 4CYEA 5DPSA 2BWFA 3V3XA 2L05A 1KTKA 2KWVB 1TS4A 1C4AA 1J7AA 3A4SC 3P42A 3VR8B 2RDHA 4KVGB 3HIZA 1SGHA 4LNFA 2MEKA 1VZ6A 2DAJA 1A5RA 1Q10A 2D10A 3U30A 2ZVOA 2BB6A 3PVLA 1ZDXA 2GI9A 4ZOHC 3LDZE 5BO4B 2INCC 3B9JA 4JIOU 1Y56A 4OW0A 1IBXA 5IN7A 2D11A 1ZDVA 4W9FA 2LUMA 2R2OA 2C7MB 3E56A 2WLBA 5TSSA 2Z0DB 1E8ZA 1L0XB 1WX9A 3Q14C 1P1AA 3DHIC 1ZUD2 3L16A 1ZPSA 5BMGA 4W9CA 4WJPA 4O1NA 2WXJA 2QSDA
chains in the Genus database with same CATH topology
2IBIB 3VXWA 2LRUA 4KZCA 5D6JB 1T0YA 2KFKB 4K7WA 3APDA 2KVRA 4BKSD 2DAFA 2EMSA 1OQYA 3H7PA 2MRPA 2FIDA 1XD3B 5KHOA 4FJZA 2RR9A 1WGRA 3A9JA 3KUDB 3ZNHB 2FNJB 1WX7A 4ANXA 2J0KA 3QJZA 5DPTA 2DHZA 1E5WA 1WM3A 2N7EA 3BINA 4OVVA 2G4DB 2I1KA 3EFUA 3N3KB 4LDTB 4GDKA 3DQVA 4KSKC 4WWOA 1WGDA 1V80A 5LLIA 2AEHA 3Q3FA 5LXIB 1WYWB 3DVNV 4MJSA 2LVPA 4HXDA 2FIFA 3APFA 2L7RA 4EZJA 4AOFA 4MGZE 4F1SA 4FULA 2OJRA 1UBQA 1ZKHA 2OOBB 4MELA 4K1RB 4MM3A 1PQSA 4X57B 5C23A 3RD2A 2NPTA 2AWTA 2CHZA 3PSEB 3OLMD 3PREA 3WANA 3WA0A 4BBNC 1E7UA 2KX3A 1E7VA 4XC2A 2R2QA 3QX1A 1L2NA 2HTHA 2M8SA 3DVGY 3QHTA 2A5UA 2M1MA 3AXCA 2MLBA 2FAZA 4ZRJA 3VTWA 4B95A 1KJTA 3H9DA 1HE8A 2Z59B 3AU5A 1YD8U 3DBSA 2IO2B 2Z0EB 1UBIA 1R4NI 3RT3B 3ZW3A 4AWJA 2K1FA 3PLVA 4HDOA 2WDTB 2ZPNA 3VH4B 2V1YA 1WXMA 2MBQA 4DDID 2NR2A 3PZDA 1V81A 2KC1A 4I6LB 2MBBB 4NJ7A 5KHQA 3JYUA 2JUOA 2K6DB 5AZFA 3U8ZA 4IWOA 2KKCA 2V4LA 2ZPYA 5J17A 3UIOB 1WE7A 1H4RA 2EMTA 4BKTA 1L7YA 2IO0B 1F9JA 3UQBA 4AJWA 4BKSA 2LASA 3LJ3A 4GDLA 3KUCB 4NPNA 1K8RB 2M4NA 3CMMB 3QIJA 2AL3A 3NZSA 4MH0E 2C9WB 2KZRA 2N9EB 1I35A 3ZIMA 3H6NA 3EHVA 4M0WB 3RYTA 1WJUA 4WJNA 2KC2A 2UYZB 3VUXA 4II2B 4MGKE 2DZIA 3TIXA 2LI5A 1J0GA 2O6VB 3K9OB 5J2RA 1WMHA 1RLFA 2MBEA 3W1SC 2BYFA 3KVFB 3PRMB 2K6QA 1WXSA 1Z2MA 2XBBC 1P0RA 2LRWA 2J0MA 3VTUA 1UH6A 3R3MA 4GU2A 3IG3A 4HDQA 3ZNID 1GJZA 5D94A 1V9JA 4EKUA 1IP9A 2O2VA 4KV2A 5TR5A 1LXDA 2DYOA 1OEYA 3PLUA 4JGHB 3DOWA 5JH5C 4FHJA 2JRHA 4LJOB 3A4RA 2MP2A 2KMCA 4LDTD 4A20A 1FXTB 1Q1OA 1WZ3A 2EKEC 3KH0A 3B0AA 4FHKA 3KYDD 2N9PC 5E6OA 1WE6A 2KQSA 3WIMA 4PS7A 1KLVA 3NZUA 2LXCA 2N9XA 2K8CA 3L54A 2IY1B 4IWQA 5AEKB 3ZUNA 1TGZB 3L0WB 1LQBA 1RAXA 4B9KA 3VFKA 4FLHA 1TZ1A 5E6NA 1TTNA 2DZMA 2V3SA 4F7ZA 4A3PA 1YQBA 4GIVA 3H7PB 3A1QA 2RSUA 1SE9A 4WQOB 2FUHB 5L83A 1S3SG 2XK5A 4TQ0A 1KM7A 1WM2A 2C60A 2D07B 3PHXB 2GBKA 1U4AA 3P2BA 3SHQA 2KTRB 2NBWB 4DDGD 3DCGA 2FCQA 2LGXA 4HPMB 1YX6B 3HK0A 3PHWB 3R7QA 2KJHB 1GNUA 2KK8A 2WYQA 2MWSB 1VD2A 2L3ZA 3A9KB 3TCAA 3A33B 2LVQA 2DENB 1WXAA 2KWUB 3W1YA 2JWZA 1V86A 3WAMA 3SDLC 4AUQC 2KWCA 4DHZB 3AU4A 2C7HA 4MJSB 3WALA 4W9HA 3K9PB 2IZVB 3X0WA 4NJ6A 5IA7A 1WGYA 3HHMA 3Q3JA 4IM2A 4RMAA 2WX1A 4ZYNA 4HLEA 1GC7A 2FCSA 3X23A 2G3QB 2UWQA 4GOCA 3AI5A 3VQIA 1RFAA 4G0NB 3CF6E 2NPTB 1WIAA 2KFKA 3ZO5B 4DWFA 3V6CB 1UELA 2LUEA 2ZNVC 3QC8B 2GBJA 5HKHA 2ZCBA 4W9LA 2IY0B 2MSED 1V49A 2KJ6A 3UQAA 2KQ7A 3UINB 1Q5WB 3EC8A 1KOTA 4IW0A 4ICUA 4GSWA 2NCNA 3B08A 5DPWA 1RRBA 1NDDA 5E6PA 3DBHI 2DZKA 2GOWA 2GBMA 2O6VD 4WWNA 1WGHA 2BGFA 2MCNB 3RUIB 2MBOA 3JVZX 1H8CA 1IPGA 3BY4B 3PV1A 2CU1A 5DPRA 3O65B 2K8HA 3APCA 4A3OA 4M8MA 5CHFA 2KLCA 2MBHA 4E74A 3DDCB 2PE6B 4PS3A 3JW0X 4ASWC 3L10B 3W1SA 2JXXA 3UIPB 3U7DA 3ZRCA 2G45B 3PGEA 4BVUC 3TL5A 4CHKA 5DCNA 3N30A 1J19A 4WJQA 3VUWA 2NVUI 4K7SA 2L8JA 3MTNB 3IHPC 4NQKE 3CSTA 2B3AA 4IUMB 3H1UA 4NAWA 4I6NB 4KDLB 2KDEB 3WAOA 4HPLB 4HK2A 4E3CA 2N7DA 4NY0A 4XX5A 4KSLC 3S2AA 3ZNZB 4URKA 3N32A 1R4MI 2MW5A 3PTFC 2BWES 3T8MA 1WR1A 2D2QA 2NBUA 3ECIA 4IM0A 4ZRKA 3ZLZA 1WMHB 4BOSC 3ZVVA 2JVCA 3RCZA 2KO3A 2LD9A 1X1MA 2MX2A 2GMIC 2BKRB 4ANUA 4KIKA 5JHBA 2DZJA 3M62B 2N1VA 5J18A 1ISNA 4EOYA 1SIFA 2JRIB 4B6WA 2NS5A 4FN2A 2M17A 4NNJB 3R7RA 2CHXA 1E90A 5CHVC 3ZTCA 1Y8RC 3D32A 1IYFA 1J8CA 2WWZA 1V5OA 1VCBA 2BYEA 3NS8A 4W9JA 2MA9B 4BOZB 1P3QU 1LM8B 2JPHA 3OJ4B 4KDIC 3PRPB 4DHJB 4F8CB 2YLMA 2C5LC 4AP4C 4N9F4 3QCAA 4LJPB 5JZEB 4DXAB 2RGFA 4JL9A 2GBNA 3I3TB 3SU8X 2M0XA 1AARA 2JY6A 3VTVA 2O6VA 1P98A 3ZDMC 2KD0A 3VAWA 1I42A 3TBLD 5D7GA 2BKFA 2MQJA 2HE7A 3VH3B 1C1YB 3KYCD 4XZ4A 3M63B 1NBFC 2HD5B 2FCMA 4WAAA 4FJVB 3JSVA 2XEWA 2CKHB 4GN1A 4GB9A 3A9JB 4FADA 2J0JA 2D3GA 1WRDB 2JZZA 3NHEB 2KDIA 3KUZA 4JLCA 4OVUA 1OTRB 2IO3B 4EUTA 3ALBA 3M3JA 3EECA 2KXJA 1Z5SB 1OGWA 2FCNA 2RPQA 2ZVNA 3M95A 2KJRA 4TUUA 4W9EA 4GDKB 4GGQA 4WJOA 3IVFA 4WWPA 2BF8B 4E71A 1WX8A 4PYUA 5D2MB 2J7QB 2L0TA 2KX0A 1CMXB 3DVGX 4LCDE 2CHWA 5AZHA 1WJ4A 2KNBA 4P7IA 2KDBA 5IAAC 3ZKJC 1V5TA 3PS6A 5CTRC 4TV3A 2NBVB 1E8XA 4ZRIA 4AJYB 4I6PA 2LXAA 4MEMA 4IWPA 3QWZB 4EZLA 4ANVA 1EO6A 4GMVA 3HM6X 1TBEA 2JT4B 3DPDA 4HCNB 2KTRA 3CSFA 2PEAA 4W9KA 3V61A 2A4ZA 2KFJA 3A9KA 1BT0A 2DYMA 2LGYA 5LXHA 2L00B 4GXBA 3GOEA 3QK0A 2IYDB 3V6EB 2ZCCA 2K25A 2VRRB 3VDZA 2ASQA 3QQ8B 5FR6A 3ML9A 4ICVA 2PJHA 5CX3A 2W9NA 4FJYA 3ZRFA 2AYOB 3V62A 3NY5A 2QHOA 2ZZPB 2C7NB 1WGGA 3HM3A 2KANA 3DBLI 4IM3A 1EF1A 4MGYE 2DYBA 4RM9A 3C0RB 1WXVA 1GC6A 3GZNI 4K7UA 2KDFB 2HJ8A 4NQLB 1EF5A 3L08A 2RD0A 5JHAA 4MSMB 4MGIE 3B1LX 3RZWC 1MG8A 1WY8A 4EEWA 4NAWB 4DHJD 2BPSA 1QZEA 2G4SA 2KMAA 2IO1B 1WJNA 1Q0WB 4ZDVA 3ML8A 4GDLB 2GBRA 2CS4A 4JQWC 1JRUA 4BFRA 1WFYA 3IBEA 1ZW7A 3NOBA 1UGMA 3PRZA 4G50A 4HCPB 3KW5B 2JZ3B 2L76A 4G3XB 4IG7B 4W9GA 5GMVA 3ENEA 5EDSA 3H7SA 2CR5A 4FA6A 3MHSD 3VUYA 3OAWA 4DK5A 1OEYJ 4KIKB 4PYZA 1WZ0A 2REXA 3PPAA 3V60A 4BBNF 4ANWA 4EZKA 2AL6A 3UGBB 1GG3A 4TQ1A 1GUAB 2KOXA 3R66C 1WI0A 2Y5BB 1NI2A 2PE9A 4BKGA 2LZ6A 2K8BA 4II3B 3AULA 4W9DA 1WJ6A 2LJ5A 4CYEA 1V6EA 5DPSA 2O2VB 2BWFA 1E8YA 3L17A 4J6IA 1G6JA 3RZFA 2JF5A 2L05A 1M94A 4EFOA 1V2YA 4CO7A 3DBRI 2KWVB 2MP2B 1E8WA 3ZTDA 4FBJB 5L95C 3DVNU 5G2NA 3SD5A 1C3TA 3A4SC 1XQQA 1WR6E 2PPHA 2YVCA 1YX5B 2KLGA 3UF8A 2WX0A 1UD7A 1D3ZA 4KVGB 3HIZA 1SGHA 4MSQB 4IC7B 3IFWB 1P9DU 2DAJA 2N1WA 1A5RA 4KZ0A 4HJKA 4DHZE 3VVWB 3T9LA 5AZGA 4MDKE 4DBGA 2DX5B 3PT2B 2D10A 3A1QB 5CHWA 3U30A 2ZVOA 3JSVB 3PVLA 4TKNA 5G55A 2XK5B 1EUVB 3L13A 1WF9A 4HVBA 4M8NA 2ZNVB 3LDZE 4W9IA 5BO4B 1YJ1A 4JIOU 2K39A 3TMPB 3ONSA 1S1QB 2ZJDA 2LWPA 2D11A 3ZNGC 3WAPA 2L0FA 1UZXB 2KTFA 4W9FA 1WH3A 2R2OA 3ZDTA 1LFDA 1XT9B 2C7MB 3QARA 4PS8A 2BYVE 2Z0DB 1E8ZA 2LGDA 1WX9A 3QAQA 2KN5A 2N4FA 1ZGUB 4RM8A 1YIWA 2I1JA 3QA8A 3OJ3A 4HWIB 1P1AA 4YL8A 3L16A 3RULA 3VHTC 3MJWA 4G11A 2KHWB 4W9CA 4WJPA 5C1ZA 4K81A 2LVOA 2ZEQA 3TJPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IBI B;  3VXW A;  2LRU A;  4KZC A;  5D6J B;  1T0Y A;  2KFK B;  4K7W A;  3APD A;  2KVR A;  4BKS D;  2DAF A;  2EMS A;  1OQY A;  3H7P A;  2MRP A;  2FID A;  1XD3 B;  5KHO A;  4FJZ A;  2RR9 A;  1WGR A;  3A9J A;  3KUD B;  3ZNH B;  2FNJ B;  1WX7 A;  4ANX A;  2J0K A;  3QJZ A;  5DPT A;  2DHZ A;  1E5W A;  1WM3 A;  2N7E A;  3BIN A;  4OVV A;  2G4D B;  2I1K A;  3EFU A;  3N3K B;  4LDT B;  4GDK A;  3DQV A;  4KSK C;  4WWO A;  1WGD A;  1V80 A;  5LLI A;  2AEH A;  3Q3F A;  5LXI B;  1WYW B;  3DVN V;  4MJS A;  2LVP A;  4HXD A;  2FIF A;  3APF A;  2L7R A;  4EZJ A;  4AOF A;  4MGZ E;  4F1S A;  4FUL A;  2OJR A;  1UBQ A;  1ZKH A;  2OOB B;  4MEL A;  4K1R B;  4MM3 A;  1PQS A;  4X57 B;  5C23 A;  3RD2 A;  2NPT A;  2AWT A;  2CHZ A;  3PSE B;  3OLM D;  3PRE A;  3WAN A;  3WA0 A;  4BBN C;  1E7U A;  2KX3 A;  1E7V A;  4XC2 A;  2R2Q A;  3QX1 A;  1L2N A;  2HTH A;  2M8S A;  3DVG Y;  3QHT A;  2A5U A;  2M1M A;  3AXC A;  2MLB A;  2FAZ A;  4ZRJ A;  3VTW A;  4B95 A;  1KJT A;  3H9D A;  1HE8 A;  2Z59 B;  3AU5 A;  1YD8 U;  3DBS A;  2IO2 B;  2Z0E B;  1UBI A;  1R4N I;  3RT3 B;  3ZW3 A;  4AWJ A;  2K1F A;  3PLV A;  4HDO A;  2WDT B;  2ZPN A;  3VH4 B;  2V1Y A;  1WXM A;  2MBQ A;  4DDI D;  2NR2 A;  3PZD A;  1V81 A;  2KC1 A;  4I6L B;  2MBB B;  4NJ7 A;  5KHQ A;  3JYU A;  2JUO A;  2K6D B;  5AZF A;  3U8Z A;  4IWO A;  2KKC A;  2V4L A;  2ZPY A;  5J17 A;  3UIO B;  1WE7 A;  1H4R A;  2EMT A;  4BKT A;  1L7Y A;  2IO0 B;  1F9J A;  3UQB A;  4AJW A;  4BKS A;  2LAS A;  3LJ3 A;  4GDL A;  3KUC B;  4NPN A;  1K8R B;  2M4N A;  3CMM B;  3QIJ A;  2AL3 A;  3NZS A;  4MH0 E;  2C9W B;  2KZR A;  2N9E B;  1I35 A;  3ZIM A;  3H6N A;  3EHV A;  4M0W B;  3RYT A;  1WJU A;  4WJN A;  2KC2 A;  2UYZ B;  3VUX A;  4II2 B;  4MGK E;  2DZI A;  3TIX A;  2LI5 A;  1J0G A;  2O6V B;  3K9O B;  5J2R A;  1WMH A;  1RLF A;  2MBE A;  3W1S C;  2BYF A;  3KVF B;  3PRM B;  2K6Q A;  1WXS A;  1Z2M A;  2XBB C;  1P0R A;  2LRW A;  2J0M A;  3VTU A;  1UH6 A;  3R3M A;  4GU2 A;  3IG3 A;  4HDQ A;  3ZNI D;  1GJZ A;  5D94 A;  1V9J A;  4EKU A;  1IP9 A;  2O2V A;  4KV2 A;  5TR5 A;  1LXD A;  2DYO A;  1OEY A;  3PLU A;  4JGH B;  3DOW A;  5JH5 C;  4FHJ A;  2JRH A;  4LJO B;  3A4R A;  2MP2 A;  2KMC A;  4LDT D;  4A20 A;  1FXT B;  1Q1O A;  1WZ3 A;  2EKE C;  3KH0 A;  3B0A A;  4FHK A;  3KYD D;  2N9P C;  5E6O A;  1WE6 A;  2KQS A;  3WIM A;  4PS7 A;  1KLV A;  3NZU A;  2LXC A;  2N9X A;  2K8C A;  3L54 A;  2IY1 B;  4IWQ A;  5AEK B;  3ZUN A;  1TGZ B;  3L0W B;  1LQB A;  1RAX A;  4B9K A;  3VFK A;  4FLH A;  1TZ1 A;  5E6N A;  1TTN A;  2DZM A;  2V3S A;  4F7Z A;  4A3P A;  1YQB A;  4GIV A;  3H7P B;  3A1Q A;  2RSU A;  1SE9 A;  4WQO B;  2FUH B;  5L83 A;  1S3S G;  2XK5 A;  4TQ0 A;  1KM7 A;  1WM2 A;  2C60 A;  2D07 B;  3PHX B;  2GBK A;  1U4A A;  3P2B A;  3SHQ A;  2KTR B;  2NBW B;  4DDG D;  3DCG A;  2FCQ A;  2LGX A;  4HPM B;  1YX6 B;  3HK0 A;  3PHW B;  3R7Q A;  2KJH B;  1GNU A;  2KK8 A;  2WYQ A;  2MWS B;  1VD2 A;  2L3Z A;  3A9K B;  3TCA A;  3A33 B;  2LVQ A;  2DEN B;  1WXA A;  2KWU B;  3W1Y A;  2JWZ A;  1V86 A;  3WAM A;  3SDL C;  4AUQ C;  2KWC A;  4DHZ B;  3AU4 A;  2C7H A;  4MJS B;  3WAL A;  4W9H A;  3K9P B;  2IZV B;  3X0W A;  4NJ6 A;  5IA7 A;  1WGY A;  3HHM A;  3Q3J A;  4IM2 A;  4RMA A;  2WX1 A;  4ZYN A;  4HLE A;  1GC7 A;  2FCS A;  3X23 A;  2G3Q B;  2UWQ A;  4GOC A;  3AI5 A;  3VQI A;  1RFA A;  4G0N B;  3CF6 E;  2NPT B;  1WIA A;  2KFK A;  3ZO5 B;  4DWF A;  3V6C B;  1UEL A;  2LUE A;  2ZNV C;  3QC8 B;  2GBJ A;  5HKH A;  2ZCB A;  4W9L A;  2IY0 B;  2MSE D;  1V49 A;  2KJ6 A;  3UQA A;  2KQ7 A;  3UIN B;  1Q5W B;  3EC8 A;  1KOT A;  4IW0 A;  4ICU A;  4GSW A;  2NCN A;  3B08 A;  5DPW A;  1RRB A;  1NDD A;  5E6P A;  3DBH I;  2DZK A;  2GOW A;  2GBM A;  2O6V D;  4WWN A;  1WGH A;  2BGF A;  2MCN B;  3RUI B;  2MBO A;  3JVZ X;  1H8C A;  1IPG A;  3BY4 B;  3PV1 A;  2CU1 A;  5DPR A;  3O65 B;  2K8H A;  3APC A;  4A3O A;  4M8M A;  5CHF A;  2KLC A;  2MBH A;  4E74 A;  3DDC B;  2PE6 B;  4PS3 A;  3JW0 X;  4ASW C;  3L10 B;  3W1S A;  2JXX A;  3UIP B;  3U7D A;  3ZRC A;  2G45 B;  3PGE A;  4BVU C;  3TL5 A;  4CHK A;  5DCN A;  3N30 A;  1J19 A;  4WJQ A;  3VUW A;  2NVU I;  4K7S A;  2L8J A;  3MTN B;  3IHP C;  4NQK E;  3CST A;  2B3A A;  4IUM B;  3H1U A;  4NAW A;  4I6N B;  4KDL B;  2KDE B;  3WAO A;  4HPL B;  4HK2 A;  4E3C A;  2N7D A;  4NY0 A;  4XX5 A;  4KSL C;  3S2A A;  3ZNZ B;  4URK A;  3N32 A;  1R4M I;  2MW5 A;  3PTF C;  2BWE S;  3T8M A;  1WR1 A;  2D2Q A;  2NBU A;  3ECI A;  4IM0 A;  4ZRK A;  3ZLZ A;  1WMH B;  4BOS C;  3ZVV A;  2JVC A;  3RCZ A;  2KO3 A;  2LD9 A;  1X1M A;  2MX2 A;  2GMI C;  2BKR B;  4ANU A;  4KIK A;  5JHB A;  2DZJ A;  3M62 B;  2N1V A;  5J18 A;  1ISN A;  4EOY A;  1SIF A;  2JRI B;  4B6W A;  2NS5 A;  4FN2 A;  2M17 A;  4NNJ B;  3R7R A;  2CHX A;  1E90 A;  5CHV C;  3ZTC A;  1Y8R C;  3D32 A;  1IYF A;  1J8C A;  2WWZ A;  1V5O A;  1VCB A;  2BYE A;  3NS8 A;  4W9J A;  2MA9 B;  4BOZ B;  1P3Q U;  1LM8 B;  2JPH A;  3OJ4 B;  4KDI C;  3PRP B;  4DHJ B;  4F8C B;  2YLM A;  2C5L C;  4AP4 C;  4N9F 4;  3QCA A;  4LJP B;  5JZE B;  4DXA B;  2RGF A;  4JL9 A;  2GBN A;  3I3T B;  3SU8 X;  2M0X A;  1AAR A;  2JY6 A;  3VTV A;  2O6V A;  1P98 A;  3ZDM C;  2KD0 A;  3VAW A;  1I42 A;  3TBL D;  5D7G A;  2BKF A;  2MQJ A;  2HE7 A;  3VH3 B;  1C1Y B;  3KYC D;  4XZ4 A;  3M63 B;  1NBF C;  2HD5 B;  2FCM A;  4WAA A;  4FJV B;  3JSV A;  2XEW A;  2CKH B;  4GN1 A;  4GB9 A;  3A9J B;  4FAD A;  2J0J A;  2D3G A;  1WRD B;  2JZZ A;  3NHE B;  2KDI A;  3KUZ A;  4JLC A;  4OVU A;  1OTR B;  2IO3 B;  4EUT A;  3ALB A;  3M3J A;  3EEC A;  2KXJ A;  1Z5S B;  1OGW A;  2FCN A;  2RPQ A;  2ZVN A;  3M95 A;  2KJR A;  4TUU A;  4W9E A;  4GDK B;  4GGQ A;  4WJO A;  3IVF A;  4WWP A;  2BF8 B;  4E71 A;  1WX8 A;  4PYU A;  5D2M B;  2J7Q B;  2L0T A;  2KX0 A;  1CMX B;  3DVG X;  4LCD E;  2CHW A;  5AZH A;  1WJ4 A;  2KNB A;  4P7I A;  2KDB A;  5IAA C;  3ZKJ C;  1V5T A;  3PS6 A;  5CTR C;  4TV3 A;  2NBV B;  1E8X A;  4ZRI A;  4AJY B;  4I6P A;  2LXA A;  4MEM A;  4IWP A;  3QWZ B;  4EZL A;  4ANV A;  1EO6 A;  4GMV A;  3HM6 X;  1TBE A;  2JT4 B;  3DPD A;  4HCN B;  2KTR A;  3CSF A;  2PEA A;  4W9K A;  3V61 A;  2A4Z A;  2KFJ A;  3A9K A;  1BT0 A;  2DYM A;  2LGY A;  5LXH A;  2L00 B;  4GXB A;  3GOE A;  3QK0 A;  2IYD B;  3V6E B;  2ZCC A;  2K25 A;  2VRR B;  3VDZ A;  2ASQ A;  3QQ8 B;  5FR6 A;  3ML9 A;  4ICV A;  2PJH A;  5CX3 A;  2W9N A;  4FJY A;  3ZRF A;  2AYO B;  3V62 A;  3NY5 A;  2QHO A;  2ZZP B;  2C7N B;  1WGG A;  3HM3 A;  2KAN A;  3DBL I;  4IM3 A;  1EF1 A;  4MGY E;  2DYB A;  4RM9 A;  3C0R B;  1WXV A;  1GC6 A;  3GZN I;  4K7U A;  2KDF B;  2HJ8 A;  4NQL B;  1EF5 A;  3L08 A;  2RD0 A;  5JHA A;  4MSM B;  4MGI E;  3B1L X;  3RZW C;  1MG8 A;  1WY8 A;  4EEW A;  4NAW B;  4DHJ D;  2BPS A;  1QZE A;  2G4S A;  2KMA A;  2IO1 B;  1WJN A;  1Q0W B;  4ZDV A;  3ML8 A;  4GDL B;  2GBR A;  2CS4 A;  4JQW C;  1JRU A;  4BFR A;  1WFY A;  3IBE A;  1ZW7 A;  3NOB A;  1UGM A;  3PRZ A;  4G50 A;  4HCP B;  3KW5 B;  2JZ3 B;  2L76 A;  4G3X B;  4IG7 B;  4W9G A;  5GMV A;  3ENE A;  5EDS A;  3H7S A;  2CR5 A;  4FA6 A;  3MHS D;  3VUY A;  3OAW A;  4DK5 A;  1OEY J;  4KIK B;  4PYZ A;  1WZ0 A;  2REX A;  3PPA A;  3V60 A;  4BBN F;  4ANW A;  4EZK A;  2AL6 A;  3UGB B;  1GG3 A;  4TQ1 A;  1GUA B;  2KOX A;  3R66 C;  1WI0 A;  2Y5B B;  1NI2 A;  2PE9 A;  4BKG A;  2LZ6 A;  2K8B A;  4II3 B;  3AUL A;  4W9D A;  1WJ6 A;  2LJ5 A;  4CYE A;  1V6E A;  5DPS A;  2O2V B;  2BWF A;  1E8Y A;  3L17 A;  4J6I A;  1G6J A;  3RZF A;  2JF5 A;  2L05 A;  1M94 A;  4EFO A;  1V2Y A;  4CO7 A;  3DBR I;  2KWV B;  2MP2 B;  1E8W A;  3ZTD A;  4FBJ B;  5L95 C;  3DVN U;  5G2N A;  3SD5 A;  1C3T A;  3A4S C;  1XQQ A;  1WR6 E;  2PPH A;  2YVC A;  1YX5 B;  2KLG A;  3UF8 A;  2WX0 A;  1UD7 A;  1D3Z A;  4KVG B;  3HIZ A;  1SGH A;  4MSQ B;  4IC7 B;  3IFW B;  1P9D U;  2DAJ A;  2N1W A;  1A5R A;  4KZ0 A;  4HJK A;  4DHZ E;  3VVW B;  3T9L A;  5AZG A;  4MDK E;  4DBG A;  2DX5 B;  3PT2 B;  2D10 A;  3A1Q B;  5CHW A;  3U30 A;  2ZVO A;  3JSV B;  3PVL A;  4TKN A;  5G55 A;  2XK5 B;  1EUV B;  3L13 A;  1WF9 A;  4HVB A;  4M8N A;  2ZNV B;  3LDZ E;  4W9I A;  5BO4 B;  1YJ1 A;  4JIO U;  2K39 A;  3TMP B;  3ONS A;  1S1Q B;  2ZJD A;  2LWP A;  2D11 A;  3ZNG C;  3WAP A;  2L0F A;  1UZX B;  2KTF A;  4W9F A;  1WH3 A;  2R2O A;  3ZDT A;  1LFD A;  1XT9 B;  2C7M B;  3QAR A;  4PS8 A;  2BYV E;  2Z0D B;  1E8Z A;  2LGD A;  1WX9 A;  3QAQ A;  2KN5 A;  2N4F A;  1ZGU B;  4RM8 A;  1YIW A;  2I1J A;  3QA8 A;  3OJ3 A;  4HWI B;  1P1A A;  4YL8 A;  3L16 A;  3RUL A;  3VHT C;  3MJW A;  4G11 A;  2KHW B;  4W9C A;  4WJP A;  5C1Z A;  4K81 A;  2LVO A;  2ZEQ A;  3TJP A; 
#chains in the Genus database with same CATH topology
 2IBI B;  4KZC A;  2KFK B;  3P4Q B;  3MHZ A;  1OQY A;  2DLB A;  3RNB C;  2OED A;  3AE4 B;  2RR9 A;  3KUD B;  3AEE B;  4ANX A;  2WXR A;  3EUB 2;  1QKZ A;  2K3U A;  1K53 A;  2I1K A;  3EFU A;  2ZW0 A;  4LDT B;  4GDK A;  4LLG M;  2AEH A;  5LXI B;  3DVN V;  4US9 A;  3APF A;  3ZGZ A;  3SEB A;  1N5X A;  5IP4 D;  4F1S A;  4FUL A;  2OJR A;  1ZKH A;  2OOB B;  2ONQ A;  4MEL A;  4OZB A;  3OLM D;  4MH8 A;  2A5U A;  1FO4 A;  3VTW A;  1KJT A;  5C3J B;  2VZK B;  1CQV A;  5D3D A;  3RT3 B;  1ZXH A;  3MJ5 A;  1WXM A;  2KDM A;  3AE1 B;  2K9X A;  2SAK A;  5AZF A;  4IWO A;  2KKC A;  3BII D;  2ZPY A;  3EGR A;  5BYR A;  1N63 A;  2AQ1 B;  3GS2 A;  2IGD A;  1F2R C;  2BVC A;  2IO0 B;  1F9J A;  2LAS A;  1VR9 A;  1K8R B;  1NEN B;  2Z8L A;  3NZS A;  2N9K A;  4H2A A;  1I35 A;  4M02 A;  4M0W B;  3EHV A;  2M0A A;  2MHJ A;  2UYZ B;  2GLS A;  4XDC A;  2DZI A;  3TIX A;  3MC0 B;  2LI5 A;  3K9O B;  5J2R A;  1WMH A;  3W1S C;  3HUI A;  3NVW A;  1XLQ A;  1UH6 A;  3R3M A;  2BW2 A;  4HDQ A;  3W5V B;  5TR5 A;  1DOX A;  1L4D B;  3DOW A;  5JH5 C;  4P16 A;  2KMC A;  1TY0 A;  3TEZ A;  1FXT B;  2LHE A;  1MJD A;  5AUI A;  3KYD D;  2N9P C;  1WE6 A;  2KQS A;  1KLV A;  5AEK B;  3ZUN A;  3L0W B;  1RAX A;  2IPK D;  3FKY A;  3MFG A;  5E6N A;  4A3P A;  4GIV A;  3GE8 C;  2FUH B;  5FKA C;  4TQ0 A;  1D5Z C;  2C60 A;  4KGT A;  1C79 A;  3SHQ A;  2FCQ A;  2WXI A;  3FAH A;  3NZ3 A;  3R7Q A;  4YSZ B;  1P7E A;  2L3Z A;  2QCZ A;  1FNU A;  2LFI A;  1FXA A;  2KWU B;  2JWZ A;  2MJD A;  4LNI A;  1FCL A;  3B2F A;  3X0W A;  5IA7 A;  1HA5 A;  2YEP B;  3HHM A;  1GC7 A;  3AI5 A;  4KKJ A;  1SE3 A;  4J3O D;  4RCO A;  4XE0 A;  1YN4 A;  3ZO5 B;  4DWF A;  2BYT A;  3V6C B;  1ENF A;  2ZNV C;  1JW9 D;  4W9L A;  2MSE D;  1MVK A;  3AED B;  1V49 A;  3UQA A;  3UIN B;  1KOT A;  4ICU A;  4GSW A;  2JWU A;  3B08 A;  2DZK A;  2GOW A;  2MBO A;  1UF0 A;  4ARI A;  5DPR A;  4GLS C;  2K8H A;  4A3O A;  2V3P A;  4E74 A;  3DDC B;  4RFB A;  5BMI A;  1D5X C;  2V3N A;  1RYJ A;  2FE8 A;  3W1S A;  2JXX A;  3UIP B;  3U7D A;  2G45 B;  4CHK A;  5DCN A;  1QIL A;  1J19 A;  3DHG C;  2J52 A;  2B3A A;  3H1U A;  5JXV A;  4I6N B;  2JZP A;  4HK2 A;  2JYT A;  2N7D A;  3PO0 A;  1GPX A;  3ZNZ B;  2W55 A;  2WU2 B;  2B76 B;  2MW5 A;  3PTF C;  2BQQ A;  1NYR A;  4BOS C;  1WMH B;  2WXQ A;  4ANU A;  5JHB A;  2N1V A;  1VRA B;  3URY A;  1SIF A;  2JRI B;  4KGS A;  2NS5 A;  1Y8R C;  4RGO S;  1JML A;  3NS8 A;  1V5O A;  4W9J A;  4HKZ E;  1VJK A;  2MA9 B;  4BOZ B;  1A70 A;  1P3Q U;  4F8C B;  4KDI C;  4WH4 A;  2YLM A;  4AP4 C;  5JZE B;  4DXA B;  4JL9 A;  4RH6 A;  4M01 A;  3MC9 A;  1E6E B;  1WWT A;  2O6V A;  3RNE C;  1SXT A;  3VAW A;  1NEK B;  5D7G A;  4XGA B;  2CU3 A;  1C1Y B;  4OZA A;  2HD5 B;  4WAA A;  4FJV B;  2FUG 1;  3C19 A;  3JSV A;  4GN1 A;  4FAD A;  4JX1 C;  2D3G A;  2JZZ A;  2KDI A;  1PYW D;  4JLC A;  4OVZ A;  1OTR B;  2IO3 B;  3M3J A;  3P4P B;  3EEC A;  1J7B A;  3IVF A;  4E71 A;  2KX0 A;  4KGR A;  3DVG X;  1YJJ A;  1QOA A;  3I9V 1;  1TZO A;  1KF6 B;  2Y5P A;  4TV3 A;  2NBV B;  1E8X A;  3B2G A;  3P4R B;  4ZRI A;  2HJ1 A;  4IWP A;  4EZL A;  1T5X D;  1EO6 A;  2V9H A;  2JT4 B;  1CK1 A;  2KTR A;  2PEA A;  3NG0 A;  4JPS A;  3A9K A;  2DYM A;  2L00 B;  5T8I A;  3QK0 A;  3ML9 A;  1ROE A;  4XWT A;  5CX3 A;  3ZRF A;  2ZZP B;  2C7N B;  2KAN A;  2KWD A;  2H89 B;  1DOI A;  3GZN I;  3CIR B;  2KDF B;  4LTU A;  3RZW C;  1WY8 A;  1TYG B;  3NJT A;  2BPS A;  4ZYS A;  1FM0 D;  2KMA A;  2IO1 B;  3GE3 C;  4ZDV A;  3ML8 A;  1L6U A;  2JZ3 B;  1I4P A;  4W9G A;  4FA6 A;  1GAQ B;  3MHS D;  4KKI A;  3VUY A;  3OAW A;  3Q8F A;  4DK5 A;  2KOX A;  3DWM A;  1NI2 A;  4US8 A;  1WJ6 A;  1ACC A;  1E8Y A;  5BMH A;  1M94 A;  1FNW A;  5IOI A;  1C3T A;  4NJC A;  1D6E C;  1E0Z A;  2YVC A;  1YX5 B;  2WX0 A;  1UD7 A;  2KYW A;  1L0V B;  5MPO A;  2ICI A;  2W82 A;  3IFW B;  3SFD B;  1P9D U;  2M19 A;  2RMM A;  1K51 A;  4HJK A;  5AZG A;  4Q2J A;  4MDK E;  4DBG A;  2DX5 B;  4HRS A;  3JSV B;  2XK5 B;  3W5U B;  5LNK 1;  1WF9 A;  4HVB A;  2ZNV B;  3ONS A;  1S1Q B;  2QEJ C;  1EM7 A;  3ZNG C;  3WAP A;  4HRO A;  4FXC A;  1WH3 A;  1XEE A;  1LFD A;  3QAR A;  2LGD A;  2KN5 A;  1E9M A;  2JX5 A;  4YT0 B;  1YIW A;  2IJ0 A;  3OJ3 A;  3Q2A C;  3AE8 B;  2RDG A;  3VRB B;  5C1Z A;  3MC8 A;  3OG5 A;  4K81 A;  4JE3 B;  1JAL A;  2DAF A;  2EMS A;  3N1Y C;  2E3T A;  2OHF A;  4FJZ A;  1WGR A;  3A9J A;  2WXF A;  3ZNH B;  1NYQ A;  1WX7 A;  4YSY B;  3QJZ A;  1C77 A;  5DPT A;  4MAC A;  4OVV A;  4KSK C;  4WWO A;  1WGD A;  4REZ A;  2PTL A;  1WYW B;  1SB3 C;  5G5G A;  2LVP A;  4HXD A;  2FIF A;  4C4V A;  2WQY B;  1IGD A;  1UBQ A;  2PW9 A;  2RPV A;  5C23 A;  2CHZ A;  3Q8A A;  1E7U A;  2PLP A;  1L2N A;  2VH2 A;  3AXC A;  1SJH D;  4B95 A;  3NUH B;  3H9D A;  1HE8 A;  3AU5 A;  5BYS A;  2IO2 B;  2NMQ A;  4AWJ A;  2K1F A;  2L52 A;  3VH4 B;  2MBQ A;  4DDI D;  2QDF A;  1RWS A;  3GZN B;  1V81 A;  2KC1 A;  1JRO A;  1FMA D;  4YTP B;  2K6D B;  5HG2 A;  1WE7 A;  2XN9 C;  1MHH E;  3UQB A;  1FIQ A;  4AJW A;  4GDL A;  3KUC B;  1MHX A;  1XCT L;  2D5G A;  2M4N A;  3CMM B;  1HXY D;  2C9W B;  1LGR A;  3ZIM A;  3VUX A;  4II2 B;  3FIL A;  1I4Q A;  1J0G A;  4UDU C;  3AH7 A;  2E6X A;  2EEL A;  1M4V A;  1T0S C;  2K6Q A;  2WGS A;  2Y5C A;  4RGT A;  1Z2M A;  2XBB C;  2LRW A;  2J0M A;  3P63 A;  3IG3 A;  3ZNI D;  1GJZ A;  1V9J A;  4EKU A;  2O2V A;  4KV2 A;  1LXD A;  1B1Z A;  2DYO A;  3PLU A;  4FHJ A;  2MP2 A;  3AE9 B;  1Q1O A;  1WZ3 A;  3B0A A;  2WDR B;  4LK0 M;  3ZXV A;  1L5P A;  2IY1 B;  1TKY A;  1TGZ B;  1LQB A;  1V8C A;  4B9K A;  4HKQ A;  4HJG E;  1TTN A;  5EE0 A;  3NS1 A;  1YQB A;  3A1Q A;  4HPP A;  2WNM A;  4WAF A;  3PHX B;  3GB1 A;  1P7F A;  2X8X X;  4ITK A;  3DCG A;  2WXL A;  2LGX A;  3PHW B;  2KK8 A;  1VD2 A;  3I57 A;  3NRZ A;  4A90 A;  3KQ4 A;  2DEN B;  3W1Y A;  2KWC A;  1HZ5 A;  2C7H A;  4W9H A;  2IZV B;  4P1C C;  1WGY A;  4RMA A;  4ZYN A;  4TMA B;  3Q3O C;  1QF6 A;  1RFA A;  4R3D A;  5FK9 C;  1WIA A;  1N62 A;  1UEL A;  3Q6B A;  1JRP A;  2GBJ A;  3PZ8 A;  1YJI A;  2IY0 B;  2K5P A;  5HHD G;  1KRH A;  1PFD A;  2Q5W D;  4RF1 A;  3C8Y A;  2O6V D;  2GBM A;  2MCN B;  3JVZ X;  1H8C A;  1C78 A;  1FNV A;  2CU1 A;  2N0S B;  4M8M A;  5CHF A;  2JSV X;  4ASW C;  3L10 B;  3PGE A;  3TL5 A;  2JYE A;  3VUW A;  2NVU I;  3AM9 A;  4K7S A;  1SF0 A;  4NAW A;  2KT7 A;  4KDL B;  2WXN A;  1TKE A;  3WAO A;  3DBH B;  4HPL B;  4A55 A;  2AX5 A;  2UU7 A;  3RI7 C;  3S2A A;  1WSP A;  1HTO A;  1R4M I;  2D2Q A;  3ZLZ A;  2DWQ A;  3AEF B;  2JVC A;  3RCZ A;  3I63 C;  1X1M A;  2MX2 A;  2G1E A;  2BKR B;  3M62 B;  3TUO A;  4NNJ B;  1E90 A;  3ZTC A;  1F0Z A;  3D32 A;  2WWZ A;  1IBX B;  1KLG D;  3N20 C;  1FRD A;  3QCA A;  4LJP B;  1PGA A;  3AN1 A;  3VRA B;  2WXK A;  3I3T B;  1C76 A;  2M0X A;  3AE5 B;  1PGB A;  3SU8 X;  2JY6 A;  3VTV A;  1P98 A;  1QOG A;  3TBL D;  3R2I A;  4C7Z A;  3VH3 B;  4A8X C;  1FFU A;  2ON8 A;  2WP9 B;  3KYC D;  4XZ4 A;  3M63 B;  2BT6 A;  2I2Y A;  3IAS 1;  2XEW A;  3TSS A;  2CKH B;  2QIE B;  1V1P A;  1WRD B;  3NHE B;  1F2R I;  3M95 A;  3W2D A;  2ZVN A;  4GDK B;  2JU6 X;  2NTT A;  1YQ4 B;  4WWP A;  2BF8 B;  5D2M B;  2L0T A;  4L2Y A;  5IAA C;  1V5T A;  5CTR C;  1QQR A;  4ANV A;  4GMV A;  1TBE A;  3DPD A;  3CSF A;  3RPF C;  3V61 A;  4YTM B;  2A4Z A;  3Q3M C;  4IOI E;  1FRR A;  2LGY A;  1I7H A;  3Q8C A;  2VRR B;  1XLO A;  3VDZ A;  5FR6 A;  1STE A;  2TSS A;  2PVO D;  1D4B A;  2W9N A;  3NY5 A;  1PDX A;  3DBL I;  4IM3 A;  2QJL A;  4RM9 A;  1GC6 A;  4NQL B;  2HJ8 A;  3ZXR A;  1EF5 A;  2EKI A;  1T0Q C;  4USA A;  1MG8 A;  4NAW B;  4DHJ D;  3Q8E A;  1Q0W B;  3E9S A;  2CS4 A;  4JQW C;  3IAM 1;  4BFR A;  1WFY A;  3IBE A;  1ZW7 A;  3NOB A;  3PRZ A;  4HCP B;  4G3X B;  3SFE B;  2CR5 A;  1OEY J;  4PYZ A;  1UWX A;  2REX A;  3PPA A;  4BBN F;  4EZK A;  2AL6 A;  1T0R C;  2LZ6 A;  1V6E A;  5IKC M;  3V05 A;  5HI1 A;  1JWB D;  4FBJ B;  5L95 C;  1SSN A;  3SD5 A;  5G2N A;  1WR6 E;  2PPH A;  3Q3N C;  1R4M B;  2KLG A;  1MG4 A;  2J53 A;  1D3Z A;  4C56 C;  4MSQ B;  2N1W A;  2KQ4 X;  4EE2 A;  4KZ0 A;  1N5W A;  3VVW B;  3BYT B;  3T9L A;  3PT2 B;  2PIA A;  5CHW A;  5D3I B;  4S0R A;  4TKN A;  3DBR B;  4K3B A;  3AEG B;  3PZ7 A;  2L83 A;  2L0F A;  1UZX B;  5IO9 A;  2XNA C;  2INP E;  4PS8 A;  2DNF A;  1KLU D;  3TEW A;  2N4F A;  1ZGU B;  5BYQ A;  1FFV A;  3QA8 A;  4HWI B;  4YL8 A;  2LGS A;  3RUL A;  3VHT C;  3MJW A;  2KHW B;  2D3B A;  5H92 C;  2IGG A;  2LVO A;  2ZEQ A;  2QC8 A;  1T0Y A;  4K7W A;  3APD A;  2KVR A;  3H7P A;  1I4G A;  2PVG C;  2Y3A A;  2FID A;  1XD3 B;  2L1A A;  2J0K A;  2KAJ A;  3GP7 A;  2G4D B;  3N3K B;  3DQV A;  1RM6 C;  1V80 A;  5LLI A;  2WXG A;  3Q3F A;  1PGX A;  4EZJ A;  4AOF A;  4MGZ E;  4ZHP A;  1FD6 A;  4MM3 A;  1PQS A;  4X57 B;  3RD2 A;  2NPT A;  3PSE B;  3WAN A;  2SEB D;  1CZP A;  2WU5 B;  3WA0 A;  4BBN C;  4XC2 A;  2R2Q A;  2M8S A;  2MLB A;  4ZRJ A;  1R7S A;  4XDD A;  2GRI A;  2Z59 B;  3DBS A;  2LMC A;  1UBI A;  2R61 A;  2CJO A;  3DBL B;  2BS3 B;  2NR2 A;  3AEB B;  1RFK A;  4I6L B;  2MBB B;  3JYU A;  3HVZ A;  5J17 A;  3UIO B;  4BKT A;  1TKG A;  4BKS A;  1N60 A;  2BS4 B;  2QIL A;  3J9C A;  3QIJ A;  1AWD A;  1R4N B;  4MH0 E;  3H6N A;  4WJN A;  3NVV A;  2FBW B;  2PKO A;  2O6V B;  1RLF A;  2MBE A;  1IGC A;  1WXS A;  3KWV A;  5D94 A;  1IP9 A;  2ZW1 A;  4JGH B;  2X38 A;  2JRH A;  3RN9 C;  4PT5 A;  3ZYY X;  2CJN A;  5E6O A;  2J4X A;  1SE2 A;  3WIM A;  4PS7 A;  3AEC B;  2K8C A;  3L54 A;  1MI0 A;  2IND C;  4IWQ A;  1WGK A;  1TJE A;  2D3C A;  1QOF A;  4RGN A;  1OQQ A;  2HTM E;  3DWG C;  4BAX A;  2K0P A;  4FLH A;  2V3S A;  4F7Z A;  2RDB C;  3H7P B;  4C7Y A;  1SE9 A;  4WQO B;  3N1Z C;  1KM7 A;  3KWL A;  1WM2 A;  2D07 B;  2GBK A;  3P2B A;  2KTR B;  4DDG D;  1YX6 B;  2BB5 A;  3HK0 A;  2QMT A;  1GNU A;  2MWS B;  3A9K B;  1XCQ L;  3T3O A;  3TCA A;  3A33 B;  2LVQ A;  1WXA A;  3WAM A;  4AUQ C;  1AYF A;  3AU4 A;  3WAL A;  4N6E B;  4NJ6 A;  4IM2 A;  2WX1 A;  4HLE A;  4YWG G;  2FCS A;  1QT9 A;  3AV8 A;  2G3Q B;  3VQI A;  5E6J A;  4MM3 B;  1DYQ A;  3CF6 E;  2NPT B;  2KFK A;  1SIJ A;  2LUE A;  2BBC A;  2ZCB A;  4N59 A;  3ZJV A;  1I4H A;  1TY2 A;  1YN5 A;  2N9L A;  4LNN A;  3EC8 A;  3OWE B;  4IW0 A;  1TIF A;  5E6P A;  3DBH I;  3BVZ A;  3RUI B;  1F1H A;  3O65 B;  3APC A;  2KLC A;  1V1O A;  1IUE A;  1T3Q A;  2PE6 B;  3JW0 X;  1BXT A;  2PMV A;  2WDQ B;  3IHP C;  4NQK E;  4M00 A;  3BZD B;  3BYY B;  2KDE B;  4E3C A;  4XX5 A;  1N6Z A;  2WXP A;  3N32 A;  3RMK C;  1FPY A;  4ZRK A;  3N1X C;  1ZOY B;  2KO3 A;  2LD9 A;  1PUT A;  2GMI C;  1T6B X;  5J18 A;  1SBB B;  4RF0 A;  4XWW A;  2M17 A;  3AE6 B;  3R7R A;  2IGH A;  2LHD A;  1IYF A;  1J8C A;  3EFC A;  2BYE A;  2JPH A;  3OJ4 B;  4DHJ B;  3KLS X;  1ZE3 D;  2C5L C;  1J7C A;  3H8H A;  3RNA C;  2DBY A;  2RGF A;  1QLB B;  4M0W A;  4BZA A;  1HQR D;  2WXH A;  3ZDM C;  2BKF A;  1NBF C;  2FCM A;  4A9A A;  4WWM A;  4LNK A;  4GB9 A;  3A9J B;  3DHH C;  5EE1 A;  2KXJ A;  1OGW A;  2KJR A;  4WJO A;  4W9E A;  4GGQ A;  1SJE D;  4PYU A;  4C4V B;  2CHW A;  1WJ4 A;  3BVM A;  2KDB A;  4LNO A;  2V0G A;  4AJY B;  2LXA A;  4XYC A;  3QWZ B;  3AE2 B;  1ZP0 B;  3HM6 X;  1DOY A;  1UWM A;  2KFJ A;  5LXH A;  4GXB A;  2IYD B;  3NVZ A;  3V6E B;  2ZCC A;  4ICV A;  2PJH A;  4KX6 B;  2AYO B;  3V62 A;  2V4I B;  1WGG A;  1WXQ A;  1JWU D;  2VH1 A;  4RNA A;  3HM3 A;  1EF1 A;  4MGY E;  2DYB A;  3IXS A;  1EWY C;  3C0R B;  1WXV A;  1FCC C;  3R8B A;  1UNS A;  2RD0 A;  3TEY A;  4MSM B;  3B1L X;  4EEW A;  3AMZ A;  4YTN B;  1QZE A;  1TS2 A;  4GDL B;  3CWI A;  3BVG A;  3MP9 A;  3R2T A;  4G50 A;  3Q8B A;  2L76 A;  5GMV A;  3ENE A;  1AW7 A;  3FC4 A;  5EDS A;  3H7S A;  3FIL B;  3P4S B;  1N61 A;  3O13 A;  1WZ0 A;  5AUK A;  3V60 A;  3UGB B;  1GG3 A;  1GUA B;  3U2S C;  4BKG A;  4II3 B;  4ARC A;  3LYY A;  4JWS C;  2O2V B;  3L17 A;  4J6I A;  1G6J A;  3RZF A;  2JF5 A;  4EFO A;  2J42 A;  1V2Y A;  3IT6 B;  4CO7 A;  1L6V A;  3DBR I;  2MP2 B;  1E8W A;  3ZTD A;  1HTQ A;  3DVN U;  1XQQ A;  3UF8 A;  4DXG A;  1ET6 A;  4C00 A;  4AQ7 A;  1F77 A;  3T3N A;  3I5J C;  4IC7 B;  2I38 A;  4OZC A;  4DHZ E;  2BTE A;  3EA6 A;  1GB4 A;  2LGI A;  3A1Q B;  2D3A A;  5G55 A;  1EUV B;  3L13 A;  3ZJT A;  2WS3 B;  4M8N A;  4W9I A;  1YJ1 A;  2KN4 A;  2K39 A;  2KVZ A;  3TMP B;  1E10 A;  1ET9 A;  2ZJD A;  2LWP A;  1K52 A;  2KTF A;  3ZDT A;  1XT9 B;  2BYV E;  2MH7 A;  2L32 A;  3QAQ A;  1XXG A;  4RM8 A;  2I1J A;  5C2T B;  5EE3 A;  4L1B A;  3BK2 A;  4CQN A;  1I4R A;  4G11 A;  3TJP A;  3VXW A;  2LRU A;  3NVY A;  5D6J B;  4BKS D;  1EU4 A;  2MRP A;  5KHO A;  3U4E G;  2FNJ B;  2DHZ A;  1E5W A;  1WM3 A;  1UUP A;  2N7E A;  1JWM D;  3BIN A;  4JWU C;  3RNF C;  2KAC A;  1L0Y B;  1MFW A;  2KMM A;  4MJS A;  2LJI A;  4ZHO A;  2L7R A;  1BUI C;  2ACZ B;  2OJW A;  1UGJ A;  3BWU D;  3U7Z A;  4K1R B;  4TSS A;  3ABV B;  2AWT A;  1K50 A;  3PRE A;  2KX3 A;  1E7V A;  3QX1 A;  2HTH A;  3DVG Y;  3QHT A;  1VDV A;  2M1M A;  1E7P B;  2FAZ A;  2M56 B;  1YD8 U;  4ZRQ A;  2Z0E B;  1R4N I;  3BK1 A;  3ZW3 A;  3U52 E;  3PLV A;  4HDO A;  1SE4 A;  4NZL B;  4DQO C;  2WDT B;  1QOB A;  2G9H D;  1VZ7 A;  2ZPN A;  3LXF A;  2V1Y A;  1VZ8 A;  2WXO A;  3PZD A;  4C80 A;  3RFZ B;  4NJ7 A;  1XO3 A;  5KHQ A;  2JUO A;  3U8Z A;  2V4L A;  3RNC C;  1F52 A;  1H4R A;  2EMT A;  1L7Y A;  5H8Y E;  4WIP A;  1C4C A;  3LJ3 A;  4NPN A;  2AL3 A;  2N9E B;  2KZR A;  3RYT A;  1WJU A;  2KC2 A;  3TEX A;  4MGK E;  2AQ2 B;  1EWC A;  3N9Y C;  2W3S A;  2BYF A;  3KVF B;  3PRM B;  1FEH A;  3VTU A;  1P0R A;  4GU2 A;  1TS3 A;  2HDE A;  2BS2 B;  1DGJ A;  3IT4 B;  3SR6 A;  1OEY A;  1V1P B;  4LJO B;  3A4R A;  4LDT D;  4A20 A;  2EKE C;  1ESF A;  3KH0 A;  2W54 A;  4FHK A;  4QAY A;  3NZU A;  2LXC A;  2N9X A;  3UI3 A;  1XLN A;  2LEK A;  3VFK A;  1TZ1 A;  3P1M A;  2DZM A;  1V97 A;  5G5H A;  2RSU A;  3AE3 B;  4YXD B;  4PK1 A;  5L83 A;  1S3S G;  2XK5 A;  1EU3 A;  1U4A A;  2NBW B;  1SEB D;  4HPM B;  2KJH B;  2WYQ A;  2VZK D;  4ZRP A;  1C4P A;  1V86 A;  3SDL C;  4DHZ B;  2H88 B;  4MJS B;  3K9P B;  1KFY B;  1MPE A;  3Q3J A;  1JWS D;  1HZ6 A;  2MJ3 A;  3X23 A;  2UWQ A;  4GOC A;  2INN E;  3AB5 A;  4G0N B;  1BML C;  1JQ4 A;  3QC8 B;  5HKH A;  4MT5 A;  2MJE A;  2KJ6 A;  2KQ7 A;  1Q5W B;  1L4Z B;  2NCN A;  5DPW A;  1RRB A;  1NDD A;  4ACF A;  4WWN A;  1WGH A;  2BGF A;  1IPG A;  3BY4 B;  3PV1 A;  4HEA 1;  1XLP A;  3RNG C;  4P6V F;  2MBH A;  4RGM A;  4PS3 A;  1HEZ E;  3Q69 A;  3ZRC A;  3ZQ4 A;  4D2K A;  4BVU C;  3N30 A;  4WJQ A;  5GXG B;  1OQR A;  2L8J A;  3MTN B;  3CST A;  4WUR A;  4IUM B;  4NY0 A;  1VLB A;  1YQ3 B;  4KSL C;  2WXM A;  4URK A;  1TT5 B;  5HFY A;  2BWE S;  3T8M A;  1WR1 A;  2NBU A;  3ECI A;  4IM0 A;  3ZVV A;  2GB1 A;  2JXT A;  4KIK A;  2DZJ A;  1ISN A;  1OFF A;  4EOY A;  4B6W A;  4FN2 A;  1TS5 A;  2CHX A;  5CHV C;  2JQR B;  1VCB A;  2WDV B;  2YEP F;  1I4X A;  1C9F A;  1LM8 B;  4YSX B;  3PRP B;  4N9F 4;  4K3C A;  4P1B C;  2GBN A;  1JCK B;  1AAR A;  1YN3 A;  2KD0 A;  1I42 A;  2MQJ A;  2HE7 A;  1LO5 D;  4NAM A;  2J0J A;  5EE9 A;  4DXF A;  1ZXI A;  3KUZ A;  4OVU A;  4EUT A;  3ALB A;  1D5M C;  1Z5S B;  2RPQ A;  2FCN A;  3VR9 B;  2W3R A;  4TUU A;  2AQ3 B;  3L4P A;  1XF5 L;  4IDI A;  1AN8 A;  1WX8 A;  2N7J A;  2J7Q B;  3W9C B;  1CJE A;  1YNT E;  1CMX B;  4N58 A;  1YMH E;  4LCD E;  5AZH A;  2KNB A;  4P7I A;  3ZKJ C;  3PS6 A;  3AEA B;  4I6P A;  4MEM A;  4HCN B;  1B9R A;  1GOZ A;  4OHJ A;  4W9K A;  1KH0 A;  1BT0 A;  3GOE A;  2NTS A;  2K25 A;  2ASQ A;  3ETR A;  3QQ8 B;  5FR3 A;  4FJY A;  2IDY A;  2QHO A;  1NI3 A;  2WHI A;  4IKG A;  4A6Q A;  1WYG A;  4K7U A;  1YOV B;  3HVD A;  3ZJU A;  3L08 A;  5JHA A;  4MGI E;  1JWA D;  2G4S A;  1WJN A;  2GBR A;  4L23 A;  1JRU A;  1WRI A;  1UGM A;  4B0E A;  3KW5 B;  3LB8 C;  4IG7 B;  2K22 A;  3AE7 B;  4S17 A;  3HRD D;  4KIK B;  4ANW A;  4WQM A;  4B0M A;  3WCQ A;  4TQ1 A;  5I4D A;  1GB1 A;  3R66 C;  1WI0 A;  2Y5B B;  4AS1 A;  2PE9 A;  1FXI A;  2K8B A;  3AUL A;  1NVI D;  4W9D A;  2LJ5 A;  4CYE A;  5DPS A;  2BWF A;  3V3X A;  2L05 A;  1KTK A;  2KWV B;  1TS4 A;  1C4A A;  1J7A A;  3A4S C;  3P42 A;  3VR8 B;  2RDH A;  4KVG B;  3HIZ A;  1SGH A;  4LNF A;  2MEK A;  1VZ6 A;  2DAJ A;  1A5R A;  1Q10 A;  2D10 A;  3U30 A;  2ZVO A;  2BB6 A;  3PVL A;  1ZDX A;  2GI9 A;  4ZOH C;  3LDZ E;  5BO4 B;  2INC C;  3B9J A;  4JIO U;  1Y56 A;  4OW0 A;  1IBX A;  5IN7 A;  2D11 A;  1ZDV A;  4W9F A;  2LUM A;  2R2O A;  2C7M B;  3E56 A;  2WLB A;  5TSS A;  2Z0D B;  1E8Z A;  1L0X B;  1WX9 A;  3Q14 C;  1P1A A;  3DHI C;  1ZUD 2;  3L16 A;  1ZPS A;  5BMG A;  4W9C A;  4WJP A;  4O1N A;  2WXJ A;  2QSD A; 
#chains in the Genus database with same CATH homology
 2IBI B;  3VXW A;  2LRU A;  4KZC A;  5D6J B;  1T0Y A;  2KFK B;  4K7W A;  3APD A;  2KVR A;  4BKS D;  2DAF A;  2EMS A;  1OQY A;  3H7P A;  2MRP A;  2FID A;  1XD3 B;  5KHO A;  4FJZ A;  2RR9 A;  1WGR A;  3A9J A;  3KUD B;  3ZNH B;  2FNJ B;  1WX7 A;  4ANX A;  2J0K A;  3QJZ A;  5DPT A;  2DHZ A;  1E5W A;  1WM3 A;  2N7E A;  3BIN A;  4OVV A;  2G4D B;  2I1K A;  3EFU A;  3N3K B;  4LDT B;  4GDK A;  3DQV A;  4KSK C;  4WWO A;  1WGD A;  1V80 A;  5LLI A;  2AEH A;  3Q3F A;  5LXI B;  1WYW B;  3DVN V;  4MJS A;  2LVP A;  4HXD A;  2FIF A;  3APF A;  2L7R A;  4EZJ A;  4AOF A;  4MGZ E;  4F1S A;  4FUL A;  2OJR A;  1UBQ A;  1ZKH A;  2OOB B;  4MEL A;  4K1R B;  4MM3 A;  1PQS A;  4X57 B;  5C23 A;  3RD2 A;  2NPT A;  2AWT A;  2CHZ A;  3PSE B;  3OLM D;  3PRE A;  3WAN A;  3WA0 A;  4BBN C;  1E7U A;  2KX3 A;  1E7V A;  4XC2 A;  2R2Q A;  3QX1 A;  1L2N A;  2HTH A;  2M8S A;  3DVG Y;  3QHT A;  2A5U A;  2M1M A;  3AXC A;  2MLB A;  2FAZ A;  4ZRJ A;  3VTW A;  4B95 A;  1KJT A;  3H9D A;  1HE8 A;  2Z59 B;  3AU5 A;  1YD8 U;  3DBS A;  2IO2 B;  2Z0E B;  1UBI A;  1R4N I;  3RT3 B;  3ZW3 A;  4AWJ A;  2K1F A;  3PLV A;  4HDO A;  2WDT B;  2ZPN A;  3VH4 B;  2V1Y A;  1WXM A;  2MBQ A;  4DDI D;  2NR2 A;  3PZD A;  1V81 A;  2KC1 A;  4I6L B;  2MBB B;  4NJ7 A;  5KHQ A;  3JYU A;  2JUO A;  2K6D B;  5AZF A;  3U8Z A;  4IWO A;  2KKC A;  2V4L A;  2ZPY A;  5J17 A;  3UIO B;  1WE7 A;  1H4R A;  2EMT A;  4BKT A;  1L7Y A;  2IO0 B;  1F9J A;  3UQB A;  4AJW A;  4BKS A;  2LAS A;  3LJ3 A;  4GDL A;  3KUC B;  4NPN A;  1K8R B;  2M4N A;  3CMM B;  3QIJ A;  2AL3 A;  3NZS A;  4MH0 E;  2C9W B;  2KZR A;  2N9E B;  1I35 A;  3ZIM A;  3H6N A;  3EHV A;  4M0W B;  3RYT A;  1WJU A;  4WJN A;  2KC2 A;  2UYZ B;  3VUX A;  4II2 B;  4MGK E;  2DZI A;  3TIX A;  2LI5 A;  1J0G A;  2O6V B;  3K9O B;  5J2R A;  1WMH A;  1RLF A;  2MBE A;  3W1S C;  2BYF A;  3KVF B;  3PRM B;  2K6Q A;  1WXS A;  1Z2M A;  2XBB C;  1P0R A;  2LRW A;  2J0M A;  3VTU A;  1UH6 A;  3R3M A;  4GU2 A;  3IG3 A;  4HDQ A;  3ZNI D;  1GJZ A;  5D94 A;  1V9J A;  4EKU A;  1IP9 A;  2O2V A;  4KV2 A;  5TR5 A;  1LXD A;  2DYO A;  1OEY A;  3PLU A;  4JGH B;  3DOW A;  5JH5 C;  4FHJ A;  2JRH A;  4LJO B;  3A4R A;  2MP2 A;  2KMC A;  4LDT D;  4A20 A;  1FXT B;  1Q1O A;  1WZ3 A;  2EKE C;  3KH0 A;  3B0A A;  4FHK A;  3KYD D;  2N9P C;  5E6O A;  1WE6 A;  2KQS A;  3WIM A;  4PS7 A;  1KLV A;  3NZU A;  2LXC A;  2N9X A;  2K8C A;  3L54 A;  2IY1 B;  4IWQ A;  5AEK B;  3ZUN A;  1TGZ B;  3L0W B;  1LQB A;  1RAX A;  4B9K A;  3VFK A;  4FLH A;  1TZ1 A;  5E6N A;  1TTN A;  2DZM A;  2V3S A;  4F7Z A;  4A3P A;  1YQB A;  4GIV A;  3H7P B;  3A1Q A;  2RSU A;  1SE9 A;  4WQO B;  2FUH B;  5L83 A;  1S3S G;  2XK5 A;  4TQ0 A;  1KM7 A;  1WM2 A;  2C60 A;  2D07 B;  3PHX B;  2GBK A;  1U4A A;  3P2B A;  3SHQ A;  2KTR B;  2NBW B;  4DDG D;  3DCG A;  2FCQ A;  2LGX A;  4HPM B;  1YX6 B;  3HK0 A;  3PHW B;  3R7Q A;  2KJH B;  1GNU A;  2KK8 A;  2WYQ A;  2MWS B;  1VD2 A;  2L3Z A;  3A9K B;  3TCA A;  3A33 B;  2LVQ A;  2DEN B;  1WXA A;  2KWU B;  3W1Y A;  2JWZ A;  1V86 A;  3WAM A;  3SDL C;  4AUQ C;  2KWC A;  4DHZ B;  3AU4 A;  2C7H A;  4MJS B;  3WAL A;  4W9H A;  3K9P B;  2IZV B;  3X0W A;  4NJ6 A;  5IA7 A;  1WGY A;  3HHM A;  3Q3J A;  4IM2 A;  4RMA A;  2WX1 A;  4ZYN A;  4HLE A;  1GC7 A;  2FCS A;  3X23 A;  2G3Q B;  2UWQ A;  4GOC A;  3AI5 A;  3VQI A;  1RFA A;  4G0N B;  3CF6 E;  2NPT B;  1WIA A;  2KFK A;  3ZO5 B;  4DWF A;  3V6C B;  1UEL A;  2LUE A;  2ZNV C;  3QC8 B;  2GBJ A;  5HKH A;  2ZCB A;  4W9L A;  2IY0 B;  2MSE D;  1V49 A;  2KJ6 A;  3UQA A;  2KQ7 A;  3UIN B;  1Q5W B;  3EC8 A;  1KOT A;  4IW0 A;  4ICU A;  4GSW A;  2NCN A;  3B08 A;  5DPW A;  1RRB A;  1NDD A;  5E6P A;  3DBH I;  2DZK A;  2GOW A;  2GBM A;  2O6V D;  4WWN A;  1WGH A;  2BGF A;  2MCN B;  3RUI B;  2MBO A;  3JVZ X;  1H8C A;  1IPG A;  3BY4 B;  3PV1 A;  2CU1 A;  5DPR A;  3O65 B;  2K8H A;  3APC A;  4A3O A;  4M8M A;  5CHF A;  2KLC A;  2MBH A;  4E74 A;  3DDC B;  2PE6 B;  4PS3 A;  3JW0 X;  4ASW C;  3L10 B;  3W1S A;  2JXX A;  3UIP B;  3U7D A;  3ZRC A;  2G45 B;  3PGE A;  4BVU C;  3TL5 A;  4CHK A;  5DCN A;  3N30 A;  1J19 A;  4WJQ A;  3VUW A;  2NVU I;  4K7S A;  2L8J A;  3MTN B;  3IHP C;  4NQK E;  3CST A;  2B3A A;  4IUM B;  3H1U A;  4NAW A;  4I6N B;  4KDL B;  2KDE B;  3WAO A;  4HPL B;  4HK2 A;  4E3C A;  2N7D A;  4NY0 A;  4XX5 A;  4KSL C;  3S2A A;  3ZNZ B;  4URK A;  3N32 A;  1R4M I;  2MW5 A;  3PTF C;  2BWE S;  3T8M A;  1WR1 A;  2D2Q A;  2NBU A;  3ECI A;  4IM0 A;  4ZRK A;  3ZLZ A;  1WMH B;  4BOS C;  3ZVV A;  2JVC A;  3RCZ A;  2KO3 A;  2LD9 A;  1X1M A;  2MX2 A;  2GMI C;  2BKR B;  4ANU A;  4KIK A;  5JHB A;  2DZJ A;  3M62 B;  2N1V A;  5J18 A;  1ISN A;  4EOY A;  1SIF A;  2JRI B;  4B6W A;  2NS5 A;  4FN2 A;  2M17 A;  4NNJ B;  3R7R A;  2CHX A;  1E90 A;  5CHV C;  3ZTC A;  1Y8R C;  3D32 A;  1IYF A;  1J8C A;  2WWZ A;  1V5O A;  1VCB A;  2BYE A;  3NS8 A;  4W9J A;  2MA9 B;  4BOZ B;  1P3Q U;  1LM8 B;  2JPH A;  3OJ4 B;  4KDI C;  3PRP B;  4DHJ B;  4F8C B;  2YLM A;  2C5L C;  4AP4 C;  4N9F 4;  3QCA A;  4LJP B;  5JZE B;  4DXA B;  2RGF A;  4JL9 A;  2GBN A;  3I3T B;  3SU8 X;  2M0X A;  1AAR A;  2JY6 A;  3VTV A;  2O6V A;  1P98 A;  3ZDM C;  2KD0 A;  3VAW A;  1I42 A;  3TBL D;  5D7G A;  2BKF A;  2MQJ A;  2HE7 A;  3VH3 B;  1C1Y B;  3KYC D;  4XZ4 A;  3M63 B;  1NBF C;  2HD5 B;  2FCM A;  4WAA A;  4FJV B;  3JSV A;  2XEW A;  2CKH B;  4GN1 A;  4GB9 A;  3A9J B;  4FAD A;  2J0J A;  2D3G A;  1WRD B;  2JZZ A;  3NHE B;  2KDI A;  3KUZ A;  4JLC A;  4OVU A;  1OTR B;  2IO3 B;  4EUT A;  3ALB A;  3M3J A;  3EEC A;  2KXJ A;  1Z5S B;  1OGW A;  2FCN A;  2RPQ A;  2ZVN A;  3M95 A;  2KJR A;  4TUU A;  4W9E A;  4GDK B;  4GGQ A;  4WJO A;  3IVF A;  4WWP A;  2BF8 B;  4E71 A;  1WX8 A;  4PYU A;  5D2M B;  2J7Q B;  2L0T A;  2KX0 A;  1CMX B;  3DVG X;  4LCD E;  2CHW A;  5AZH A;  1WJ4 A;  2KNB A;  4P7I A;  2KDB A;  5IAA C;  3ZKJ C;  1V5T A;  3PS6 A;  5CTR C;  4TV3 A;  2NBV B;  1E8X A;  4ZRI A;  4AJY B;  4I6P A;  2LXA A;  4MEM A;  4IWP A;  3QWZ B;  4EZL A;  4ANV A;  1EO6 A;  4GMV A;  3HM6 X;  1TBE A;  2JT4 B;  3DPD A;  4HCN B;  2KTR A;  3CSF A;  2PEA A;  4W9K A;  3V61 A;  2A4Z A;  2KFJ A;  3A9K A;  1BT0 A;  2DYM A;  2LGY A;  5LXH A;  2L00 B;  4GXB A;  3GOE A;  3QK0 A;  2IYD B;  3V6E B;  2ZCC A;  2K25 A;  2VRR B;  3VDZ A;  2ASQ A;  3QQ8 B;  5FR6 A;  3ML9 A;  4ICV A;  2PJH A;  5CX3 A;  2W9N A;  4FJY A;  3ZRF A;  2AYO B;  3V62 A;  3NY5 A;  2QHO A;  2ZZP B;  2C7N B;  1WGG A;  3HM3 A;  2KAN A;  3DBL I;  4IM3 A;  1EF1 A;  4MGY E;  2DYB A;  4RM9 A;  3C0R B;  1WXV A;  1GC6 A;  3GZN I;  4K7U A;  2KDF B;  2HJ8 A;  4NQL B;  1EF5 A;  3L08 A;  2RD0 A;  5JHA A;  4MSM B;  4MGI E;  3B1L X;  3RZW C;  1MG8 A;  1WY8 A;  4EEW A;  4NAW B;  4DHJ D;  2BPS A;  1QZE A;  2G4S A;  2KMA A;  2IO1 B;  1WJN A;  1Q0W B;  4ZDV A;  3ML8 A;  4GDL B;  2GBR A;  2CS4 A;  4JQW C;  1JRU A;  4BFR A;  1WFY A;  3IBE A;  1ZW7 A;  3NOB A;  1UGM A;  3PRZ A;  4G50 A;  4HCP B;  3KW5 B;  2JZ3 B;  2L76 A;  4G3X B;  4IG7 B;  4W9G A;  5GMV A;  3ENE A;  5EDS A;  3H7S A;  2CR5 A;  4FA6 A;  3MHS D;  3VUY A;  3OAW A;  4DK5 A;  1OEY J;  4KIK B;  4PYZ A;  1WZ0 A;  2REX A;  3PPA A;  3V60 A;  4BBN F;  4ANW A;  4EZK A;  2AL6 A;  3UGB B;  1GG3 A;  4TQ1 A;  1GUA B;  2KOX A;  3R66 C;  1WI0 A;  2Y5B B;  1NI2 A;  2PE9 A;  4BKG A;  2LZ6 A;  2K8B A;  4II3 B;  3AUL A;  4W9D A;  1WJ6 A;  2LJ5 A;  4CYE A;  1V6E A;  5DPS A;  2O2V B;  2BWF A;  1E8Y A;  3L17 A;  4J6I A;  1G6J A;  3RZF A;  2JF5 A;  2L05 A;  1M94 A;  4EFO A;  1V2Y A;  4CO7 A;  3DBR I;  2KWV B;  2MP2 B;  1E8W A;  3ZTD A;  4FBJ B;  5L95 C;  3DVN U;  5G2N A;  3SD5 A;  1C3T A;  3A4S C;  1XQQ A;  1WR6 E;  2PPH A;  2YVC A;  1YX5 B;  2KLG A;  3UF8 A;  2WX0 A;  1UD7 A;  1D3Z A;  4KVG B;  3HIZ A;  1SGH A;  4MSQ B;  4IC7 B;  3IFW B;  1P9D U;  2DAJ A;  2N1W A;  1A5R A;  4KZ0 A;  4HJK A;  4DHZ E;  3VVW B;  3T9L A;  5AZG A;  4MDK E;  4DBG A;  2DX5 B;  3PT2 B;  2D10 A;  3A1Q B;  5CHW A;  3U30 A;  2ZVO A;  3JSV B;  3PVL A;  4TKN A;  5G55 A;  2XK5 B;  1EUV B;  3L13 A;  1WF9 A;  4HVB A;  4M8N A;  2ZNV B;  3LDZ E;  4W9I A;  5BO4 B;  1YJ1 A;  4JIO U;  2K39 A;  3TMP B;  3ONS A;  1S1Q B;  2ZJD A;  2LWP A;  2D11 A;  3ZNG C;  3WAP A;  2L0F A;  1UZX B;  2KTF A;  4W9F A;  1WH3 A;  2R2O A;  3ZDT A;  1LFD A;  1XT9 B;  2C7M B;  3QAR A;  4PS8 A;  2BYV E;  2Z0D B;  1E8Z A;  2LGD A;  1WX9 A;  3QAQ A;  2KN5 A;  2N4F A;  1ZGU B;  4RM8 A;  1YIW A;  2I1J A;  3QA8 A;  3OJ3 A;  4HWI B;  1P1A A;  4YL8 A;  3L16 A;  3RUL A;  3VHT C;  3MJW A;  4G11 A;  2KHW B;  4W9C A;  4WJP A;  5C1Z A;  4K81 A;  2LVO A;  2ZEQ A;  3TJP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...