1R4MI

Appbp1-uba3-nedd8, an e1-ubiquitin-like protein complex
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
76
structure length
76
Chain Sequence
MLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVLHLVLALRGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The structure of the APPBP1-UBA3-NEDD8-ATP complex reveals the basis for selective ubiquitin-like protein activation by an E1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
molecule keywords amyloid beta precursor protein-binding protein 1
total genus 18
structure length 76
sequence length 76
chains with identical sequence J, K, L
ec nomenclature
pdb deposition date 2003-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1r4mI00
3PGEA 4M8NA 5CTRC 3PHWB 1M94A 2WX1A 2JRHA 2AL3A 2LRWA 3ZTCA 2DX5B 2CHZA 5GMVA 2C7MB 5JHBA 2MBBB 2A4ZA 2GOWA 2ZVOA 4DHJD 1V2YA 4HPLB 2GMIC 3APCA 4HDQA 2MBEA 3VH4B 4IM3A 1KOTA 2KWCA 3QIJA 2N4FA 1V6EA 2YLMA 3NZSA 3IG3A 1WY8A 2OJRA 4MGYE 3X0WA 5KHQA 2C60A 3RCZA 1V5TA 2GBMA 2JZ3B 4FA6A 2LI5A 2KK8A 1Z2MA 1J19A 2L7RA 1RAXA 1WH3A 3DBRI 1P1AA 3SHQA 4XX5A 3VVWB 4NJ7A 4ASWC 1WX7A 3PREA 1TBEA 3DCGA 2NPTB 4EZLA 4OVVA 4KSKC 4NJ6A 1V49A 3PHXB 3OJ4B 3PS6A 1WGDA 2KQSA 4WJNA 3AXCA 1WJ6A 4GDKB 3DVNV 3ALBA 5KHOA 2EMSA 2KXJA 2J7QB 1WR6E 1E7UA 4M0WB 3CMMB 4MGKE 3P2BA 2KNBA 4BVUC 3DVNU 2NR2A 2WDTB 1V86A 2GBJA 1WX8A 4G11A 3W1SA 4ZRJA 2KKCA 3VH3B 3UIPB 4LDTB 2J0KA 5D2MB 5C23A 1P0RA 3ZNZB 1XQQA 2WX0A 3KUCB 5CX3A 4GN1A 3VUXA 4MGZE 5G2NA 3WALA 1YD8U 4K1RB 2JF5A 4KV2A 4BOSC 1XD3B 4II3B 1CMXB 1I42A 2NPTA 1E90A 3QWZB 2LXAA 4MSQB 1R4NI 2LRUA 4GXBA 4NY0A 1WXAA 2KZRA 2MSED 3PSEB 3ZDTA 2ZPYA 4EZKA 4K7UA 1IP9A 3CSTA 5AZHA 4MSMB 2K39A 3ZNID 1T0YA 4ICVA 3SU8X 4FHJA 2REXA 3UQAA 1F9JA 3RYTA 2XK5A 2V1YA 2KD0A 3QQ8B 1Z5SB 2HTHA 2LVQA 3KVFB 4MM3A 2LZ6A 2J0JA 4WAAA 4DK5A 2BYFA 3N32A 3VTUA 3PPAA 4HDOA 3WAPA 3PTFC 2DZKA 2LD9A 1J0GA 4KDLB 2LGXA 3Q3JA 4NAWA 2ZJDA 3GZNI 1UELA 5CHWA 2LWPA 3A9JA 5D94A 1MG8A 4KZ0A 4RM8A 1XT9B 4W9CA 3X23A 2WWZA 4HPMB 2JRIB 5E6NA 1UGMA 2MCNB 4NQKE 2CR5A 2MX2A 2I1JA 4TQ0A 3H7PA 2W9NA 3HM6X 3ZRFA 2MQJA 3DBSA 4ZRKA 3M63B 4ZYNA 2JVCA 2PE6B 3C0RB 3TIXA 4HCPB 1LM8B 1YQBA 2D3GA 3EECA 1E8YA 4F7ZA 1G6JA 2JXXA 2ZNVC 4HK2A 2KFKB 4WWPA 2RD0A 3T9LA 3A4SC 4AP4C 4DHJB 2ZZPB 1WGGA 2JPHA 3NOBA 4IWPA 3U30A 2FCQA 3MHSD 3QA8A 4P7IA 2CS4A 3WAMA 4KIKB 1EUVB 2KQ7A 3RZFA 2ZCCA 4PYZA 2LGDA 2LASA 3NY5A 2DYBA 2K25A 4KSLC 2KFJA 3V6CB 5DPRA 2IO3B 2D11A 3DOWA 2IO1B 2JY6A 3KYDD 4CO7A 3QAQA 2K6DB 2HD5B 2D07B 2DZIA 5L95C 3RUIB 2ZEQA 4HVBA 5LLIA 3KH0A 3V60A 4G50A 1L7YA 3M62B 2MRPA 4JL9A 4K81A 3K9PB 5AZGA 1S3SG 3VDZA 2IBIB 2ZCBA 4AWJA 1KLVA 4ANWA 1FXTB 2HE7A 4EEWA 3ZRCA 4PS8A 3L13A 1V80A 4EZJA 4K7SA 1PQSA 1E8ZA 5IAAC 2KJHB 3BY4B 4ICUA 4JQWC 2MBHA 3DQVA 2N1VA 1OEYA 2M8SA 4BOZB 3OAWA 1WF9A 2ZPNA 1WI0A 4GDLA 3VUWA 4W9KA 1D3ZA 2ASQA 1OEYJ 3PRZA 2L76A 4GIVA 4B9KA 2KDBA 4EUTA 5DPWA 5BO4B 5AZFA 3V62A 5JH5C 3HIZA 2L05A 1J8CA 2Z0EB 2DZJA 3ENEA 1GC7A 2NBVB 2MP2B 2JZZA 4IUMB 1VD2A 2FIFA 2LXCA 4DXAB 4PS3A 2GBNA 4LDTD 4CHKA 3HK0A 1IPGA 1SGHA 1WR1A 2BF8B 3PLVA 2N7EA 4I6LB 1GUAB 3WIMA 2BGFA 4PYUA 1AARA 2EMTA 3PVLA 5DPTA 4IM2A 3NZUA 1Q5WB 1L2NA 2WYQA 3PT2B 3B08A 2NBUA 2R2OA 5J17A 1WGYA 3V61A 4DDGD 1P3QU 5TR5A 1OGWA 4AUQC 3KUDB 1WXVA 1JRUA 4HCNB 4AOFA 3CF6E 2DENB 2JT4B 3APFA 1WZ0A 1TZ1A 3A9KB 4LJPB 2KX0A 4PS7A 2M0XA 3A1QB 2BYEA 1P9DU 1GNUA 2XEWA 4X57B 3L17A 3ML8A 3R7QA 4DHZB 2LJ5A 2C5LC 4TQ1A 1NBFC 4BBNF 4FJVB 1UH6A 3UINB 1WE7A 1EF5A 4W9EA 3VQIA 2M1MA 2MW5A 4FULA 2DYMA 2XK5B 1WIAA 2G3QB 3JW0X 4KIKA 4FADA 4I6PA 3UQBA 2LGYA 2AL6A 1UBQA 3DBHI 3MTNB 4G3XB 2G45B 2DAJA 3VFKA 1WM3A 3MJWA 4W9IA 2PJHA 3ZNHB 4WWNA 4HLEA 1WGHA 2NCNA 4NQLB 4NAWB 1WE6A 3VTWA 5JHAA 2R2QA 2CU1A 4MDKE 1ZKHA 2FNJB 4NNJB 3QHTA 4K7WA 3M95A 3GOEA 3KYCD 2FIDA 4MJSA 3S2AA 3UF8A 2VRRB 3L0WB 3QC8B 2C7NB 1OTRB 2CHWA 1TGZB 3PRMB 4JIOU 1GJZA 3DBLI 2IYDB 3DPDA 3BINA 4MEMA 3PRPB 2PE9A 3W1SC 2O2VA 3U8ZA 3AU4A 3RT3B 3OLMD 2KDIA 2KTRB 2PPHA 4MH0E 4IW0A 1K8RB 4WWOA 2KVRA 2N9EB 2Z0DB 2MLBA 2D10A 4FJZA 2DAFA 3HHMA 1WJNA 4MGIE 3ZUNA 2DHZA 1RLFA 2J0MA 2KLGA 3EC8A 4YL8A 2I1KA 1VCBA 2N7DA 3A4RA 4ZRIA 5E6PA 4B95A 4BBNC 1IYFA 1EO6A 3DVGX 3HM3A 2HJ8A 3TCAA 5FR6A 1I35A 1YX6B 5D6JB 4TV3A 2DYOA 1WXSA 2RSUA 1UBIA 4ZDVA 3D32A 1E5WA 3DDCB 2YVCA 3KUZA 4ANUA 1WZ3A 2NBWB 2V3SA 4W9FA 2KMAA 4A3PA 4JLCA 4BKGA 4GMVA 5EDSA 1UD7A 3IBEA 4I6NB 2KJ6A 1H4RA 2MBOA 3PLUA 3H6NA 3R7RA 5CHVC 2L3ZA 4F8CB 2K8BA 4EFOA 3PV1A 4DBGA 3K9OB 3OJ3A 2M17A 4WJOA 1E8XA 1E8WA 3TMPB 2L0TA 1ISNA 2KOXA 1C3TA 3LDZE 1ZGUB 3ZNGC 3IVFA 3ZIMA 2N9PC 2Z59B 4IG7B 4AJWA 1YX5B 4G0NB 3ZVVA 4OVUA 2L8JA 4W9LA 3ECIA 4A3OA 1WJUA 4ANVA 4BKTA 2RPQA 2FCMA 4FLHA 3EHVA 4MELA 3SD5A 3I3TB 3WANA 4BFRA 5LXHA 1RRBA 2KTFA 1HE8A 1WJ4A 2KDFB 3N30A 1X1MA 2FCSA 1LXDA 3L16A 5L83A 2O2VB 4KZCA 4NPNA 4WJQA 2IO2B 3L54A 2PEAA 3JYUA 3A33B 2K8CA 4GGQA 2BWFA 1U4AA 4IC7B 4TKNA 2KLCA 3QCAA 3ZO5B 1WGRA 3R66C 1WMHB 2GBKA 3A9KA 3SDLC 1Y8RC 4E74A 3VTVA 2D2QA 4FBJB 2AWTA 2MA9B 4IWOA 1V81A 1S1QB 4XC2A 5J2RA 4E71A 1OQYA 3AI5A 2KC2A 1TTNA 2O6VA 2BWES 3A1QA 2L00B 3U7DA 3ZDMC 3EFUA 4IM0A 4MJSB 3WA0A 3PZDA 1NI2A 4GDKA 2JUOA 5CHFA 2BKFA 5J18A 3IFWB 3UIOB 2CKHB 3B1LX 2A5UA 4LJOB 5DCNA 1SIFA 1A5RA 3ZTDA 2IY1B 1WYWB 4HWIB 4ANXA 3H7SA 2IZVB 2BPSA 4W9GA 2K6QA 5JZEB 3ZKJC 4E3CA 2FAZA 3VUYA 1Q0WB 1KJTA 2KWVB 3N3KB 2KHWB 2B3AA 4A20A 2IO0B 3TJPA 3JSVB 4CYEA 4RM9A 4AJYB 2KWUB 2LVOA 4BKSD 1GG3A 2K1FA 3ONSA 3LJ3A 3UGBB 1WRDB 1LQBA 1ZW7A 5LXIB 2RGFA 4FN2A 4GSWA 2RR9A 1V9JA 3VXWA 1E7VA 2KC1A 4W9HA 4DHZE 2NS5A 3CSFA 3L10B 2MP2A 4TUUA 4XZ4A 4J6IA 3ZW3A 4KDIC 2KN5A 1Q1OA 3APDA 3H9DA 4WJPA 5D7GA 2KTRA 2MBQA 4II2B 2V4LA 4LCDE 2KDEB 4F1SA 1P98A 2Y5BB 4IWQA 2OOBB 1H8CA 5AEKB 3TBLD 3QJZA 2MWSB 1C1YB 3NS8A 2AEHA 1WMHA 3DVGY 2DZMA 1UZXB 5HKHA 4GDLB 4EOYA 1NDDA 3L08A 3ML9A 3NHEB 3O65B 2UWQA 5G55A 3T8MA 3RULA 2G4SA 3JSVA 4RMAA 4M8MA 2N1WA 3QX1A 1YJ1A 2KX3A 2BYVE 4N9F4 2LUEA 3IHPC 2BKRB 2AYOB 2KMCA 5DPSA 2NVUI 4W9DA 4DDID 2O6VB 3AULA 4EKUA 3H1UA 3M3JA 3A9JB 2N9XA 4HXDA 1QZEA 3KW5B 1RFAA 2IY0B 1V5OA 1WFYA 3B0AA 4WQOB 2KANA 1R4MI 4BKSA 1YIWA 2M4NA 5IA7A 4JGHB 4FJYA 3TL5A 3R3MA 2JWZA 1EF1A 3W1YA 2CHXA 1KM7A 3Q3FA 2FUHB 1BT0A 2FCNA 1LFDA 3RZWC 4DWFA 4B6WA 2GBRA 2KFKA 3QK0A 2KO3A 2G4DB 2L0FA 2LVPA 2XBBC 2C7HA 2K8HA 1SE9A 4W9JA 3WAOA 1WXMA 1WX9A 5E6OA 3RD2A 3QARA 4HJKA 2KJRA 4FHKA 1GC6A 4URKA 2QHOA 4GU2A 3VHTC 3ZLZA 2ZNVB 2ZVNA 2C9WB 2O6VD 4GOCA 4GB9A 3VAWA 2EKEC 1WM2A 3JVZX 3V6EB 4KVGB 5C1ZA 2UYZB 3AU5A 3H7PB
chains in the Genus database with same CATH superfamily
2JSVX 2J52A 1QOBA 2AL3A 3DBHB 1UGJA 4DHJD 1L6UA 4HPLB 3U7ZA 2L52A 1V1PA 1ENFA 2NMQA 4IM3A 2E3TA 3GE8C 3NZSA 2YLMA 1WSPA 3IG3A 4MGYE 1ZP0B 2C60A 3RCZA 2JZ3B 2KK8A 2L7RA 1RAXA 3URYA 3VVWB 4XX5A 2K3UA 1F1HA 3AE2B 1FPYA 4NJ6A 3OJ4B 4C7ZA 3PS6A 4GDKB 3RMKC 3W5UB 2IJ0A 4JWUC 4MGKE 3P2BA 4BAXA 2NR2A 2WDTB 2WXIA 2SAKA 1FFVA 2GBJA 4G11A 5IKCM 1I7HA 4LDTB 1BXTA 5D2MB 4M02A 2BS2B 3ZNZB 2WX0A 3DHHC 5CX3A 3VUXA 3NVYA 5AUKA 3BK2A 2JF5A 4C56C 1R4NI 2X38A 1T3QA 3NVVA 2WU2B 4FHJA 2LGIA 2XK5A 2V1YA 3QQ8B 1L0VB 4MM3A 1I4RA 1N5XA 3AE8B 4RCOA 2DZKA 1I4PA 3R2IA 4MH8A 3GZNI 4W9CA 4NQKE 4TQ0A 2WXOA 3DWGC 2W9NA 3HM6X 3ZRFA 4L23A 3DBSA 2JVCA 2PE6B 4HCPB 4F7ZA 2RD0A 3T9LA 4AP4C 4DHJB 3SFDB 2QDFA 2PKOA 3U30A 4AS1A 4OHJA 4KIKB 3RZFA 2ZCCA 4KSLC 1TKYA 4XDDA 2KVZA 2B76B 2V3NA 2JY6A 3AH7A 3J9CA 3N20C 3KH0A 4G50A 2N0SB 4JL9A 2D3AA 3K9PB 4K81A 3HVDA 3N1YC 1L0YB 4PS8A 2WP9B 3L13A 3U2SC 3P4PB 4K7SA 3IAM1 1SE4A 2W3RA 2KJHB 3BY4B 5IAAC 1LO5D 1ESFA 3VUWA 1YN4A 1WXQA 3V62A 2L05A 1J8CA 2NTSA 1CZPA 2Z0EB 2DZJA 3ENEA 1GC7A 2NBVB 2JQRB 1KFYB 2GBNA 5FK9C 3AV8A 1DOIA 4WURA 3PVLA 4IM2A 1L2NA 2WYQA 3PT2B 2NBUA 3NS1A 5J17A 3RNFC 4RGOS 2IGGA 1OGWA 1STEA 4AOFA 2JT4B 2RPVA 4WAFA 5EE1A 2KDMA 4LJPB 2BS3B 2WXQA 4PS7A 4S17A 2BYEA 1P9DU 2XEWA 5EE0A 5HG2A 2WDVB 2DBYA 1NBFC 3RN9C 3UINB 1SIJA 1IUEA 4OZBA 3AE9B 1SE2A 1ZDVA 3VQIA 1SJED 4US9A 1MG4A 1YJIA 4I6PA 1EM7A 3UQBA 1TS3A 1HZ6A 4G3XB 4BZAA 2WXMA 1SBBB 2PJHA 2L83A 4NAWB 3SFEB 4K7WA 3M95A 3GOEA 2K0PA 4IDIA 2VRRB 1GJZA 2WS3B 4JIOU 1AN8A 3DPDA 1HA5A 4MEMA 3BINA 3W1SC 3OLMD 2KTRB 4WWOA 2LHEA 2KVRA 2MLBA 4FJZA 3HHMA 1XF5L 1WJNA 2DHZA 1VCBA 1IYFA 3A4RA 4ZRIA 1JWUD 2BBCA 4BBNC 4PT5A 3TCAA 2GRIA 1I35A 1YX6B 1C79A 3D32A 2SEBD 3W9CB 3KUZA 1QKZA 4NAMA 4XYCA 2WU5B 4A3PA 2N7JA 4JLCA 3TEYA 1UD7A 3AE4B 2KACA 2MBOA 1D5ZC 5CHVC 1JRPA 2L3ZA 2K8BA 2AQ2B 3AN1A 2Y3AA 4WJOA 1KTKA 4ZHOA 2M19A 4IG7B 2VH1A 4MACA 4OVUA 3ZVVA 2L8JA 1SE3A 4KGTA 2RPQA 2FCMA 2K5PA 3ABVB 1FNUA 3RNGC 4WJQA 3Q8CA 1UWXA 1YQ4B 1ZUD2 2J4XA 1TY0A 5GXGB 3NVWA 1IBXA 3ZO5B 3SDLC 4Q2JA 1Y8RC 2WHIA 2D2QA 2E6XA 2MA9B 4IWOA 1S1QB 4WIPA 3ETRA 1OQYA 4IOIE 4C4VA 1TTNA 3A1QA 3GB1A 3ZDMC 4C7YA 3PZDA 1NI2A 2JUOA 4P1BC 2BKFA 5HFYA 3L4PA 3UIOB 5E6JA 3Q2AC 3ZTDA 2K6QA 1KH0A 3C19A 1UUPA 4H2AA 5LNK1 1E0ZA 2KWUB 1HTQA 1GG3A 2K1FA 3LJ3A 1F52A 4ARCA 2LEKA 4S0RA 3EGRA 1D5MC 2RR9A 1E7VA 4P1CC 4DHZE 3CSFA 3I9V1 2KN5A 4WJPA 1TY2A 4II2B 4TSSA 4IKGA 1IGCA 1P98A 2Y5BB 4IWQA 5AEKB 5HHDG 1TKEA 3NS8A 1WMHA 1UZXB 1QOFA 1NDDA 3L08A 3KQ4A 1D4BA 2BKRB 1NEKB 2KMCA 1E9MA 3AULA 4L2YA 2VZKD 1R4NB 4GLSC 1L4ZB 2IY0B 1AYFA 4JGHB 3PZ8A 2JWZA 2VH2A 1KM7A 3Q3FA 2FUHB 3AE7B 3RZWC 4M00A 2OEDA 3QK0A 1PDXA 2XBBC 2WXLA 1WXMA 3V3XA 2FE8A 1VJKA 3VHTC 3V6EB 1M94A 2WX1A 3GE3C 5I4DA 2DX5B 1XCQL 1SJHD 2ZVOA 4ARIA 2OJWA 3O13A 2MBEA 1KOTA 2KWCA 1VRAB 2OJRA 3X0WA 5KHQA 1K50A 2GBMA 4FA6A 3R2TA 1L6VA 2CU3A 1K53A 4ZYSA 2PTLA 2QILA 3DCGA 4YTNB 3DBRB 4HJGE 4KSKC 3P42A 3PHXB 4RGNA 1WGDA 2KQSA 3MP9A 3RPFC 2J7QB 1E7UA 2AQ1B 3AMZA 5BYRA 5IN7A 2WXNA 1WX8A 1C76A 3UIPB 1P0RA 1PGAA 3KUCB 2D3BA 4XGAB 2WXHA 1XD3B 1I42A 2NPTA 1E90A 3PSEB 2ZPYA 4HPPA 2K39A 1T0YA 1V1PB 1F9JA 1Z5SB 1FCCC 2J0JA 2L32A 2BYFA 3N32A 2V3PA 1T6BX 3PPAA 4HDOA 2LD9A 2ICIA 2LGXA 1UELA 5CHWA 3A9JA 5D94A 4RM8A 1UGMA 3I5JC 2I1JA 3UI3A 4LTUA 2MJDA 2D3GA 3ZYYX 1E8YA 2JXXA 2ZNVC 4HK2A 1WGGA 2JPHA 2WGSA 3WAMA 1LGRA 2KQ7A 4PYZA 2LGDA 2LASA 2DYBA 3RNCC 3DBLB 3I63C 3V05A 5DPRA 3DOWA 2IO1B 4CO7A 1WGKA 2D07B 2DZIA 4ZHPA 4HVBA 5LLIA 3W2DA 1L7YA 3M62B 5AZGA 1S3SG 3VDZA 1KLVA 4ANWA 2JZPA 3ZRCA 1OFFA 3DHIC 3RI7C 1QOGA 5EE9A 3TEWA 1PQSA 4JWSC 2JX5A 4ICUA 3PZ7A 1ROEA 4JQWC 5IO9A 2M8SA 4YTPB 3OAWA 1WI0A 3AM9A 3TUOA 3PRZA 2PLPA 2WXKA 3W5VB 5JH5C 1J7BA 3SEBA 1MFWA 4IUMB 4P16A 2LXCA 1IPGA 1SGHA 2N7EA 4I6LB 1GUAB 4PYUA 1QT9A 4HKZE 3V61A 4A9AA 1JRUA 1TZOA 3APFA 1WZ0A 3A9KB 2G9HD 1N60A 2HTME 3GZNB 2KX0A 3MC8A 3L17A 3T3OA 4DHZB 2LJ5A 1WYGA 1EF5A 2ONQA 1PYWD 2XNAC 4ITKA 2MW5A 3RNEC 3VR9B 1YQ3B 3MC0B 2LGYA 2AL6A 1NVID 3C8YA 3MJWA 3ZNHB 3ZXVA 1WGHA 5JHAA 4XWWA 4REZA 2R2QA 2YEPB 4NNJB 2DLBA 3QHTA 3UF8A 3KYCD 4EE2A 2I38A 3QC8B 1TGZB 3Q8FA 3DBLI 4YTMB 2IYDB 3Q3NC 2L1AA 3Q14C 2KDIA 3E9SA 5BYSA 1K8RB 2Z0DB 2D10A 1JCKB 2DAFA 4MGIE 5BMIA 2I1KA 1EO6A 3DVGX 2G1EA 1F2RI 5FR6A 3FKYA 1DGJA 1T0RC 2WNMA 5D6JB 3Q8AA 1I4XA 4KGRA 2RSUA 2AX5A 3DDCB 3B9JA 1FEHA 1WZ3A 3FC4A 2V3SA 2DNFA 3TSSA 1FD6A 4A55A 4GMVA 1FCLA 4I6NB 4DXFA 2KJ6A 1XEEA 1E6EB 2XN9C 3ZJTA 3PV1A 3K9OB 2M17A 1E8WA 3TMPB 2L0TA 1ISNA 2N9PC 2Z8LA 1PGXA 4G0NB 5T8IA 4A3OA 3HUIA 1GPXA 3AE3B 3EHVA 1N62A 2K22A 1RRBA 3N30A 1WJ4A 1K51A 3BIID 1LXDA 2ZW0A 3L16A 5L83A 4KZCA 1J7CA 1FXAA 1DOXA 1C77A 4TKNA 2GBKA 1SEBD 2INPE 3VRAB 5H92C 4JPSA 5C2TB 1NI3A 4MJSB 4GDKA 5CHFA 4JE3B 3IFWB 4RH6A 3ZQ4A 2I2YA 2GLSA 5DCNA 3AEGB 2IY1B 1SB3C 2IZVB 2J42A 4E3CA 3HRDD 3VUYA 2KWVB 3N3KB 1VZ7A 2KHWB 2KQ4X 3JSVB 3KWLA 3RNAC 1WRDB 4O1NA 1NYRA 4MT5A 2KYWA 3VXWA 4W9HA 2NS5A 2WXJA 2MP2A 4TUUA 4KDIC 1JWMD 1Q1OA 3AE5B 3H9DA 5D7GA 2MBQA 4LCDE 4F1SA 4LLGM 2OOBB 1H8CA 3TBLD 4YXDB 5HKHA 4EOYA 3NHEB 2UWQA 4RMAA 2BYVE 4N9F4 5HI1A 2AYOB 2NVUI 2KT7A 4W9DA 4PK1A 4DDID 2LJIA 3M3JA 4M01A 3KW5B 1V5OA 3B0AA 2MJ3A 1R4MI 1YIWA 2LFIA 3R3MA 1EF1A 2CHXA 1VR9A 2UU7A 2R61A 2L0FA 4NJCA 2K8HA 1SE9A 3WAOA 1WX9A 1R4MB 1A70A 4URKA 1M4VA 3NUHB 2ZNVB 1UF0A 4GOCA 2EKEC 1WM2A 1JWBD 4KVGB 1CJEA 3PGEA 4M8NA 2GI9A 2JU6X 3PHWB 2JRHA 2LRWA 2WDRB 2CHZA 5JHBA 2C7MB 3NZ3A 2JYTA 2LGSA 2MBBB 2A4ZA 2GMIC 3APCA 2V4IB 5D3IB 4HDQA 3VH4B 3QIJA 1WY8A 3SR6A 3LB8C 1Z2MA 1J19A 3VR8B 1WH3A 1P1AA 3BVGA 1DYQA 1SXTA 3PREA 4EZLA 1K52A 1KRHA 1V49A 1TS2A 1FM0D 1FRRA 1WJ6A 3AXCA 3BYYB 3DVNV 1UWMA 3ALBA 5KHOA 2EMSA 4M0WB 3CMMB 3Q6BA 4ZRJA 2KKCA 2ON8A 1FFUA 2J0KA 1FO4A 1N61A 4GN1A 3BZDB 4MGZE 3WALA 2WDQB 4XDCA 4KV2A 4BOSC 4II3B 1GOZA 2LXAA 2LRUA 1NYQA 4GXBA 4NY0A 4RF0A 2KZRA 2MSED 4EZKA 2Y5PA 5AZHA 4MSMB 3UQAA 2REXA 3RYTA 2LVQA 2LMCA 3KVFB 2LZ6A 4WAAA 1JQ4A 3VTUA 3WAPA 1ACCA 3PTFC 4B0EA 1J0GA 4KDLB 2FUG1 2LWPA 3X23A 4AJWA 2INCC 2WWZA 4HPMB 2JRIB 5E6NA 2MCNB 2MX2A 1ZE3D 3PO0A 1TJEA 3H7PA 1JWAD 2MQJA 4ZRKA 1MPEA 3C0RB 3TIXA 1LM8B 1L0XB 2K9XA 3KLSX 3ZGZA 2KFKB 4M0WA 2FCQA 3MHSD 2CS4A 1EUVB 3P4QB 3NY5A 2KFJA 2PW9A 2D11A 3KYDD 1FMAD 1L4DB 5G5HA 3RUIB 2QMTA 3BVZA 2MRPA 4LNKA 3B2GA 1YMHE 2IBIB 4AWJA 1FXTB 3BWUD 2HE7A 5TSSA 1XO3A 5IP4D 4EZJA 2WQYB 2MBHA 1WRIA 2N1VA 1OEYA 1XLQA 3WCQA 2ZPNA 4GDLA 1XLNA 1D3ZA 2ASQA 2VZKB 1YN3A 2L76A 4GIVA 2KDBA 4B9KA 4EUTA 5DPWA 2BYTA 2J53A 4A8XC 2MP2B 4OZCA 3HVZA 1VD2A 1I4GA 4PS3A 1E10A 4CHKA 2BF8B 1V1OA 3WIMA 2EMTA 1KLUD 2JYEA 5DPTA 1Q5WB 1IBXB 1IGDA 2R2OA 1WGYA 2KAJA 4DDGD 5TR5A 3KUDB 4WWMA 1BUIC 1TZ1A 3E56A 4YSZB 2BB5A 2M0XA 4LNFA 4LNOA 5AUIA 4X57B 3R7QA 2IPKD 2C5LC 4K3CA 3Q3OC 1UH6A 4FJVB 4MM3B 5G5GA 2M1MA 2NTTA 4ZRQA 2DYMA 2XK5B 1WIAA 3DWMA 1TYGB 2G3QB 3JW0X 4FADA 1L5PA 2G45B 2RDBC 2QCZA 4W9IA 4WWNA 4HLEA 2FBWB 4NQLB 4C80A 3Q3MC 2CU1A 1FNWA 2FNJB 3S2AA 4MJSA 2FIDA 4ACFA 2C7NB 3PRMB 4ZOHC 3AEFB 1PUTA 1CK1A 1QLBB 2O2VA 2IGDA 3RT3B 1EU4A 2MH7A 2INDC 2BB6A 4IW0A 1I4QA 2N9EB 2INNE 3ZUNA 1RLFA 2KLGA 3IXSA 4K3BA 4B95A 3T3NA 2HJ8A 1Y56A 2DYOA 2KWDA 1N5WA 2BQQA 1E5WA 2YVCA 2M0AA 1AWDA 3AE1B 2NBWB 4W9FA 4KGSA 4BKGA 5EDSA 2QJLA 1OQQA 3IBEA 4HEA1 3PLUA 3H6NA 4F8CB 4EFOA 4DBGA 3OJ3A 1E8XA 3LDZE 3IVFA 2WXGA 2QSDA 4W9LA 2QIEB 3N1XC 1Q10A 4FLHA 4A6QA 3I3TB 4WH4A 2KTFA 1HE8A 2KDFB 1X1MA 2V0GA 2FCSA 2IGHA 2O2VB 3L54A 2PEAA 3A33B 4IC7B 2BWFA 2KLCA 3QCAA 2PMVA 1WGRA 3R66C 4E74A 1MJDA 2GB1A 4QAYA 4E71A 3U7DA 3WA0A 1BMLC 3P4SB 3B1LX 2A5UA 1PFDA 1RFKA 1SIFA 1A5RA 2IDYA 4ANXA 1C4CA 2BPSA 4RF1A 1Q0WB 1KJTA 3CIRB 3OWEB 2IO0B 4CYEA 2LVOA 4BKSD 3ONSA 2HJ1A 3UGBB 2MJEA 1RYJA 2CJNA 1T5XD 5LXIB 2RGFA 4ZRPA 4GSWA 1P7EA 2KC1A 3L10B 4XZ4A 2KTRA 5FR3A 4OW0A 1FRDA 3LXFA 3RNBC 1QF6A 3QJZA 4KKIA 2AEHA 3DVGY 4GDLB 1HQRD 3O65B 5G55A 3T8MA 4YSYB 2G4SA 1YJ1A 1HTOA 2KX3A 3GS2A 2LUEA 5DPSA 2QEJC 4EKUA 5MPOA 3H1UA 1KF6B 3A9JB 2N9XA 1QZEA 1RFAA 1WFYA 2KANA 4FJYA 2HDEA 3TL5A 1T0SC 2Q5WD 1GAQB 2FCNA 3NJTA 1LFDA 1JWSD 1J7AA 5JXVA 4DWFA 2D5GA 1C4PA 2EKIA 2BT6A 2C7HA 2W55A 4W9JA 4DXGA 1F0ZA 2RDGA 2Y5CA 2KJRA 3NRZA 4US8A 2CJOA 2ZVNA 3DHGC 4L1BA 4GB9A 2O6VD 4YSXB 3JVZX 3FAHA 5C1ZA 3MFGA 3AU5A 3H7PB 5CTRC 3ZTCA 5GMVA 4KKJA 2QC8A 2TSSA 2GOWA 1DOYA 1V2YA 1V8CA 1JMLA 2YEPF 3LYYA 3BVMA 1CQVA 2N4FA 1V6EA 1TT5B 1V5TA 3AEBB 2LI5A 3IT6B 3DBRI 3SHQA 4NJ7A 4ASWC 4C4VB 1WX7A 1TBEA 2NPTB 4OVVA 2DWQA 1EWYC 2JWUA 3MC9A 1VLBA 3P63A 4WJNA 2W3SA 2RDHA 2KXJA 4HRSA 1WR6E 1NENB 2KNBA 4BVUC 3DVNU 1V86A 1TKGA 3W1SA 2PVGC 3VH3B 4RNAA 4XWTA 5C23A 1P7FA 1ZPSA 1RM6C 1XQQA 1C78A 5G2NA 1YD8U 4K1RB 2D3CA 1CMXB 1HZ5A 3QWZB 4MSQB 1WXAA 1HEZE 3ZDTA 4K7UA 1IP9A 3CSTA 3ZNID 4ICVA 3SU8X 2KN4A 4RGMA 4LK0M 2KD0A 2HTHA 1T0QC 4N59A 4DK5A 1V97A 2LUMA 4C00A 2W82A 3Q3JA 4NAWA 2ZJDA 4TMAB 1MG8A 4KZ0A 1XT9B 1EWCA 1RWSA 2X8XX 2CR5A 1JALA 3M63B 4ZYNA 1KLGD 1YQBA 3EECA 3GP7A 1G6JA 2BVCA 4WWPA 2RMMA 3AEDB 3A4SC 1ZOYB 2ZZPB 2PIAA 5H8YE 3NOBA 1XXGA 4IWPA 1FXIA 3QA8A 4P7IA 1VZ6A 3AEAB 3Q8BA 4AQ7A 4R3DA 2K25A 1GB4A 3V6CB 2IO3B 1XCTL 5L95C 3QAQA 2K6DB 2HD5B 2M56B 4P6VF 1JW9D 2ZEQA 3V60A 2W54A 2ZCBA 1YOVB 2N9LA 4B0MA 4EEWA 1TS4A 1V80A 3N1ZC 1E8ZA 3DQVA 4HROA 4BOZB 1WF9A 1MVKA 4W9KA 2WXPA 1OEYJ 3Q8EA 5BO4B 5AZFA 3HIZA 4OZAA 1YN5A 4JX1C 2ZW1A 4N6EB 2JZZA 2FIFA 4DXAB 3EUB2 4LDTD 5BMGA 1EU3A 3HK0A 1WR1A 3PLVA 2BGFA 1AARA 3NZUA 1MHHE 1SSNA 3B08A 1R7SA 2KMMA 1P3QU 4AUQC 1WXVA 4HCNB 3CF6E 2DENB 1F2RC 3ZXRA 3MJ5A 3A1QB 2BTEA 3EFCA 1GNUA 1FNVA 4LNIA 4RFBA 3ML8A 2WLBA 2EELA 3Q69A 4TQ1A 4BBNF 1AW7A 3AE6B 1FIQA 2MHJA 3NVZA 3ZJUA 1WE7A 3VRBB 4W9EA 3ZJVA 4FULA 4NZLB 4KIKA 4J3OD 1UBQA 1C9FA 3DBHI 1QILA 3MTNB 2DAJA 3VFKA 1WM3A 3AEEB 2NCNA 3VTWA 1WE6A 4MDKE 1ZKHA 4YWGG 4HKQA 3L0WB 1OTRB 2CHWA 1VZ8A 3BYTB 3BK1A 3PRPB 1ZDXA 2PE9A 3U8ZA 1F77A 3AU4A 2WXFA 2PPHA 4MH0E 1MHXA 4N58A 1B9RA 4A90A 2J0MA 1C4AA 3EC8A 4YL8A 5E6PA 2N7DA 3N9YC 3HM3A 1ZXHA 4TV3A 1WXSA 3FILB 1UBIA 4FXCA 4ZDVA 3CWIA 1OQRA 4ANUA 5BYQA 2KMAA 2BS4B 3EA6A 2OHFA 1H4RA 3R7RA 1HXYD 1TIFA 3R8BA 1WWTA 2KOXA 1C3TA 1ZGUB 3ZNGC 3ZIMA 2Z59B 2N9KA 1YX5B 1UNSA 3ECIA 1WJUA 4RGTA 4ANVA 4BKTA 3I57A 5C3JB 4MELA 3SD5A 3TEXA 3WANA 4BFRA 5LXHA 3IAS1 1QQRA 2WXRA 3MHZA 4NPNA 2IO2B 3JYUA 2K8CA 4GGQA 3U4EG 1U4AA 5BMHA 1WMHB 3NG0A 3A9KA 1D6EC 3VTVA 4USAA 4FBJB 2AWTA 3P1MA 1V81A 4XC2A 5J2RA 3AI5A 1N6ZA 2KC2A 2O6VA 3FILA 2BWES 2L00B 3EFUA 4IM0A 1N63A 2V9HA 5FKAC 4XE0A 5J18A 2CKHB 4LJOB 2MEKA 1WYWB 4HWIB 3H7SA 5JZEB 4W9GA 4D2KA 3U52E 3ZKJC 2FAZA 4OVZA 2B3AA 4A20A 3TJPA 4RM9A 4AJYB 1MI0A 5EE3A 5IOIA 3IT4B 1LQBA 1ZW7A 4FN2A 3RFZB 1I4HA 1XLOA 5D3DA 1V9JA 3TEZA 2LHDA 3AB5A 1JROA 1ET6A 4J6IA 3ZW3A 4DQOC 3APDA 1GB1A 1VDVA 1SF0A 1TS5A 1B1ZA 2V4LA 2KDEB 1YNTE 1XLPA 2BW2A 4KX6B 3P4RB 1E7PB 1ZXIA 1C1YB 2MWSB 3H8HA 2DZMA 2PVOD 4WQMA 4LNNA 3ML9A 1D5XC 3RULA 3JSVA 4M8MA 2N1WA 3QX1A 3IHPC 1ET9A 4YT0B 2JXTA 2O6VB 3OG5A 2AQ3B 4HXDA 4CQNA 4WQOB 1PGBA 4BKSA 2M4NA 5IA7A 3W1YA 1BT0A 3KWVA 4B6WA 2GBRA 2KFKA 1QOAA 2KO3A 2G4DB 4UDUC 2LVPA 2ACZB 2H88B 5E6OA 3RD2A 1YJJA 3QARA 4HJKA 4FHKA 1GC6A 2QHOA 3AECB 4GU2A 3ZLZA 3B2FA 2H89B 2C9WB 3VAWA 2UYZB
chains in the Genus database with same CATH topology
3PGEA 4M8NA 5CTRC 3PHWB 1M94A 2WX1A 2JRHA 2AL3A 2LRWA 3ZTCA 2DX5B 2CHZA 5GMVA 2C7MB 5JHBA 2MBBB 2A4ZA 2GOWA 2ZVOA 4DHJD 1V2YA 4HPLB 2GMIC 3APCA 4HDQA 2MBEA 3VH4B 4IM3A 1KOTA 2KWCA 3QIJA 2N4FA 1V6EA 2YLMA 3NZSA 3IG3A 1WY8A 2OJRA 4MGYE 3X0WA 5KHQA 2C60A 3RCZA 1V5TA 2GBMA 2JZ3B 4FA6A 2LI5A 2KK8A 1Z2MA 1J19A 2L7RA 1RAXA 1WH3A 3DBRI 1P1AA 3SHQA 4XX5A 3VVWB 4NJ7A 4ASWC 1WX7A 3PREA 1TBEA 3DCGA 2NPTB 4EZLA 4OVVA 4KSKC 4NJ6A 1V49A 3PHXB 3OJ4B 3PS6A 1WGDA 2KQSA 4WJNA 3AXCA 1WJ6A 4GDKB 3DVNV 3ALBA 5KHOA 2EMSA 2KXJA 2J7QB 1WR6E 1E7UA 4M0WB 3CMMB 4MGKE 3P2BA 2KNBA 4BVUC 3DVNU 2NR2A 2WDTB 1V86A 2GBJA 1WX8A 4G11A 3W1SA 4ZRJA 2KKCA 3VH3B 3UIPB 4LDTB 2J0KA 5D2MB 5C23A 1P0RA 3ZNZB 1XQQA 2WX0A 3KUCB 5CX3A 4GN1A 3VUXA 4MGZE 5G2NA 3WALA 1YD8U 4K1RB 2JF5A 4KV2A 4BOSC 1XD3B 4II3B 1CMXB 1I42A 2NPTA 1E90A 3QWZB 2LXAA 4MSQB 1R4NI 2LRUA 4GXBA 4NY0A 1WXAA 2KZRA 2MSED 3PSEB 3ZDTA 2ZPYA 4EZKA 4K7UA 1IP9A 3CSTA 5AZHA 4MSMB 2K39A 3ZNID 1T0YA 4ICVA 3SU8X 4FHJA 2REXA 3UQAA 1F9JA 3RYTA 2XK5A 2V1YA 2KD0A 3QQ8B 1Z5SB 2HTHA 2LVQA 3KVFB 4MM3A 2LZ6A 2J0JA 4WAAA 4DK5A 2BYFA 3N32A 3VTUA 3PPAA 4HDOA 3WAPA 3PTFC 2DZKA 2LD9A 1J0GA 4KDLB 2LGXA 3Q3JA 4NAWA 2ZJDA 3GZNI 1UELA 5CHWA 2LWPA 3A9JA 5D94A 1MG8A 4KZ0A 4RM8A 1XT9B 4W9CA 3X23A 2WWZA 4HPMB 2JRIB 5E6NA 1UGMA 2MCNB 4NQKE 2CR5A 2MX2A 2I1JA 4TQ0A 3H7PA 2W9NA 3HM6X 3ZRFA 2MQJA 3DBSA 4ZRKA 3M63B 4ZYNA 2JVCA 2PE6B 3C0RB 3TIXA 4HCPB 1LM8B 1YQBA 2D3GA 3EECA 1E8YA 4F7ZA 1G6JA 2JXXA 2ZNVC 4HK2A 2KFKB 4WWPA 2RD0A 3T9LA 3A4SC 4AP4C 4DHJB 2ZZPB 1WGGA 2JPHA 3NOBA 4IWPA 3U30A 2FCQA 3MHSD 3QA8A 4P7IA 2CS4A 3WAMA 4KIKB 1EUVB 2KQ7A 3RZFA 2ZCCA 4PYZA 2LGDA 2LASA 3NY5A 2DYBA 2K25A 4KSLC 2KFJA 3V6CB 5DPRA 2IO3B 2D11A 3DOWA 2IO1B 2JY6A 3KYDD 4CO7A 3QAQA 2K6DB 2HD5B 2D07B 2DZIA 5L95C 3RUIB 2ZEQA 4HVBA 5LLIA 3KH0A 3V60A 4G50A 1L7YA 3M62B 2MRPA 4JL9A 4K81A 3K9PB 5AZGA 1S3SG 3VDZA 2IBIB 2ZCBA 4AWJA 1KLVA 4ANWA 1FXTB 2HE7A 4EEWA 3ZRCA 4PS8A 3L13A 1V80A 4EZJA 4K7SA 1PQSA 1E8ZA 5IAAC 2KJHB 3BY4B 4ICUA 4JQWC 2MBHA 3DQVA 2N1VA 1OEYA 2M8SA 4BOZB 3OAWA 1WF9A 2ZPNA 1WI0A 4GDLA 3VUWA 4W9KA 1D3ZA 2ASQA 1OEYJ 3PRZA 2L76A 4GIVA 4B9KA 2KDBA 4EUTA 5DPWA 5BO4B 5AZFA 3V62A 5JH5C 3HIZA 2L05A 1J8CA 2Z0EB 2DZJA 3ENEA 1GC7A 2NBVB 2MP2B 2JZZA 4IUMB 1VD2A 2FIFA 2LXCA 4DXAB 4PS3A 2GBNA 4LDTD 4CHKA 3HK0A 1IPGA 1SGHA 1WR1A 2BF8B 3PLVA 2N7EA 4I6LB 1GUAB 3WIMA 2BGFA 4PYUA 1AARA 2EMTA 3PVLA 5DPTA 4IM2A 3NZUA 1Q5WB 1L2NA 2WYQA 3PT2B 3B08A 2NBUA 2R2OA 5J17A 1WGYA 3V61A 4DDGD 1P3QU 5TR5A 1OGWA 4AUQC 3KUDB 1WXVA 1JRUA 4HCNB 4AOFA 3CF6E 2DENB 2JT4B 3APFA 1WZ0A 1TZ1A 3A9KB 4LJPB 2KX0A 4PS7A 2M0XA 3A1QB 2BYEA 1P9DU 1GNUA 2XEWA 4X57B 3L17A 3ML8A 3R7QA 4DHZB 2LJ5A 2C5LC 4TQ1A 1NBFC 4BBNF 4FJVB 1UH6A 3UINB 1WE7A 1EF5A 4W9EA 3VQIA 2M1MA 2MW5A 4FULA 2DYMA 2XK5B 1WIAA 2G3QB 3JW0X 4KIKA 4FADA 4I6PA 3UQBA 2LGYA 2AL6A 1UBQA 3DBHI 3MTNB 4G3XB 2G45B 2DAJA 3VFKA 1WM3A 3MJWA 4W9IA 2PJHA 3ZNHB 4WWNA 4HLEA 1WGHA 2NCNA 4NQLB 4NAWB 1WE6A 3VTWA 5JHAA 2R2QA 2CU1A 4MDKE 1ZKHA 2FNJB 4NNJB 3QHTA 4K7WA 3M95A 3GOEA 3KYCD 2FIDA 4MJSA 3S2AA 3UF8A 2VRRB 3L0WB 3QC8B 2C7NB 1OTRB 2CHWA 1TGZB 3PRMB 4JIOU 1GJZA 3DBLI 2IYDB 3DPDA 3BINA 4MEMA 3PRPB 2PE9A 3W1SC 2O2VA 3U8ZA 3AU4A 3RT3B 3OLMD 2KDIA 2KTRB 2PPHA 4MH0E 4IW0A 1K8RB 4WWOA 2KVRA 2N9EB 2Z0DB 2MLBA 2D10A 4FJZA 2DAFA 3HHMA 1WJNA 4MGIE 3ZUNA 2DHZA 1RLFA 2J0MA 2KLGA 3EC8A 4YL8A 2I1KA 1VCBA 2N7DA 3A4RA 4ZRIA 5E6PA 4B95A 4BBNC 1IYFA 1EO6A 3DVGX 3HM3A 2HJ8A 3TCAA 5FR6A 1I35A 1YX6B 5D6JB 4TV3A 2DYOA 1WXSA 2RSUA 1UBIA 4ZDVA 3D32A 1E5WA 3DDCB 2YVCA 3KUZA 4ANUA 1WZ3A 2NBWB 2V3SA 4W9FA 2KMAA 4A3PA 4JLCA 4BKGA 4GMVA 5EDSA 1UD7A 3IBEA 4I6NB 2KJ6A 1H4RA 2MBOA 3PLUA 3H6NA 3R7RA 5CHVC 2L3ZA 4F8CB 2K8BA 4EFOA 3PV1A 4DBGA 3K9OB 3OJ3A 2M17A 4WJOA 1E8XA 1E8WA 3TMPB 2L0TA 1ISNA 2KOXA 1C3TA 3LDZE 1ZGUB 3ZNGC 3IVFA 3ZIMA 2N9PC 2Z59B 4IG7B 4AJWA 1YX5B 4G0NB 3ZVVA 4OVUA 2L8JA 4W9LA 3ECIA 4A3OA 1WJUA 4ANVA 4BKTA 2RPQA 2FCMA 4FLHA 3EHVA 4MELA 3SD5A 3I3TB 3WANA 4BFRA 5LXHA 1RRBA 2KTFA 1HE8A 1WJ4A 2KDFB 3N30A 1X1MA 2FCSA 1LXDA 3L16A 5L83A 2O2VB 4KZCA 4NPNA 4WJQA 2IO2B 3L54A 2PEAA 3JYUA 3A33B 2K8CA 4GGQA 2BWFA 1U4AA 4IC7B 4TKNA 2KLCA 3QCAA 3ZO5B 1WGRA 3R66C 1WMHB 2GBKA 3A9KA 3SDLC 1Y8RC 4E74A 3VTVA 2D2QA 4FBJB 2AWTA 2MA9B 4IWOA 1V81A 1S1QB 4XC2A 5J2RA 4E71A 1OQYA 3AI5A 2KC2A 1TTNA 2O6VA 2BWES 3A1QA 2L00B 3U7DA 3ZDMC 3EFUA 4IM0A 4MJSB 3WA0A 3PZDA 1NI2A 4GDKA 2JUOA 5CHFA 2BKFA 5J18A 3IFWB 3UIOB 2CKHB 3B1LX 2A5UA 4LJOB 5DCNA 1SIFA 1A5RA 3ZTDA 2IY1B 1WYWB 4HWIB 4ANXA 3H7SA 2IZVB 2BPSA 4W9GA 2K6QA 5JZEB 3ZKJC 4E3CA 2FAZA 3VUYA 1Q0WB 1KJTA 2KWVB 3N3KB 2KHWB 2B3AA 4A20A 2IO0B 3TJPA 3JSVB 4CYEA 4RM9A 4AJYB 2KWUB 2LVOA 4BKSD 1GG3A 2K1FA 3ONSA 3LJ3A 3UGBB 1WRDB 1LQBA 1ZW7A 5LXIB 2RGFA 4FN2A 4GSWA 2RR9A 1V9JA 3VXWA 1E7VA 2KC1A 4W9HA 4DHZE 2NS5A 3CSFA 3L10B 2MP2A 4TUUA 4XZ4A 4J6IA 3ZW3A 4KDIC 2KN5A 1Q1OA 3APDA 3H9DA 4WJPA 5D7GA 2KTRA 2MBQA 4II2B 2V4LA 4LCDE 2KDEB 4F1SA 1P98A 2Y5BB 4IWQA 2OOBB 1H8CA 5AEKB 3TBLD 3QJZA 2MWSB 1C1YB 3NS8A 2AEHA 1WMHA 3DVGY 2DZMA 1UZXB 5HKHA 4GDLB 4EOYA 1NDDA 3L08A 3ML9A 3NHEB 3O65B 2UWQA 5G55A 3T8MA 3RULA 2G4SA 3JSVA 4RMAA 4M8MA 2N1WA 3QX1A 1YJ1A 2KX3A 2BYVE 4N9F4 2LUEA 3IHPC 2BKRB 2AYOB 2KMCA 5DPSA 2NVUI 4W9DA 4DDID 2O6VB 3AULA 4EKUA 3H1UA 3M3JA 3A9JB 2N9XA 4HXDA 1QZEA 3KW5B 1RFAA 2IY0B 1V5OA 1WFYA 3B0AA 4WQOB 2KANA 1R4MI 4BKSA 1YIWA 2M4NA 5IA7A 4JGHB 4FJYA 3TL5A 3R3MA 2JWZA 1EF1A 3W1YA 2CHXA 1KM7A 3Q3FA 2FUHB 1BT0A 2FCNA 1LFDA 3RZWC 4DWFA 4B6WA 2GBRA 2KFKA 3QK0A 2KO3A 2G4DB 2L0FA 2LVPA 2XBBC 2C7HA 2K8HA 1SE9A 4W9JA 3WAOA 1WXMA 1WX9A 5E6OA 3RD2A 3QARA 4HJKA 2KJRA 4FHKA 1GC6A 4URKA 2QHOA 4GU2A 3VHTC 3ZLZA 2ZNVB 2ZVNA 2C9WB 2O6VD 4GOCA 4GB9A 3VAWA 2EKEC 1WM2A 3JVZX 3V6EB 4KVGB 5C1ZA 2UYZB 3AU5A 3H7PB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PGE A;  4M8N A;  5CTR C;  3PHW B;  1M94 A;  2WX1 A;  2JRH A;  2AL3 A;  2LRW A;  3ZTC A;  2DX5 B;  2CHZ A;  5GMV A;  2C7M B;  5JHB A;  2MBB B;  2A4Z A;  2GOW A;  2ZVO A;  4DHJ D;  1V2Y A;  4HPL B;  2GMI C;  3APC A;  4HDQ A;  2MBE A;  3VH4 B;  4IM3 A;  1KOT A;  2KWC A;  3QIJ A;  2N4F A;  1V6E A;  2YLM A;  3NZS A;  3IG3 A;  1WY8 A;  2OJR A;  4MGY E;  3X0W A;  5KHQ A;  2C60 A;  3RCZ A;  1V5T A;  2GBM A;  2JZ3 B;  4FA6 A;  2LI5 A;  2KK8 A;  1Z2M A;  1J19 A;  2L7R A;  1RAX A;  1WH3 A;  3DBR I;  1P1A A;  3SHQ A;  4XX5 A;  3VVW B;  4NJ7 A;  4ASW C;  1WX7 A;  3PRE A;  1TBE A;  3DCG A;  2NPT B;  4EZL A;  4OVV A;  4KSK C;  4NJ6 A;  1V49 A;  3PHX B;  3OJ4 B;  3PS6 A;  1WGD A;  2KQS A;  4WJN A;  3AXC A;  1WJ6 A;  4GDK B;  3DVN V;  3ALB A;  5KHO A;  2EMS A;  2KXJ A;  2J7Q B;  1WR6 E;  1E7U A;  4M0W B;  3CMM B;  4MGK E;  3P2B A;  2KNB A;  4BVU C;  3DVN U;  2NR2 A;  2WDT B;  1V86 A;  2GBJ A;  1WX8 A;  4G11 A;  3W1S A;  4ZRJ A;  2KKC A;  3VH3 B;  3UIP B;  4LDT B;  2J0K A;  5D2M B;  5C23 A;  1P0R A;  3ZNZ B;  1XQQ A;  2WX0 A;  3KUC B;  5CX3 A;  4GN1 A;  3VUX A;  4MGZ E;  5G2N A;  3WAL A;  1YD8 U;  4K1R B;  2JF5 A;  4KV2 A;  4BOS C;  1XD3 B;  4II3 B;  1CMX B;  1I42 A;  2NPT A;  1E90 A;  3QWZ B;  2LXA A;  4MSQ B;  1R4N I;  2LRU A;  4GXB A;  4NY0 A;  1WXA A;  2KZR A;  2MSE D;  3PSE B;  3ZDT A;  2ZPY A;  4EZK A;  4K7U A;  1IP9 A;  3CST A;  5AZH A;  4MSM B;  2K39 A;  3ZNI D;  1T0Y A;  4ICV A;  3SU8 X;  4FHJ A;  2REX A;  3UQA A;  1F9J A;  3RYT A;  2XK5 A;  2V1Y A;  2KD0 A;  3QQ8 B;  1Z5S B;  2HTH A;  2LVQ A;  3KVF B;  4MM3 A;  2LZ6 A;  2J0J A;  4WAA A;  4DK5 A;  2BYF A;  3N32 A;  3VTU A;  3PPA A;  4HDO A;  3WAP A;  3PTF C;  2DZK A;  2LD9 A;  1J0G A;  4KDL B;  2LGX A;  3Q3J A;  4NAW A;  2ZJD A;  3GZN I;  1UEL A;  5CHW A;  2LWP A;  3A9J A;  5D94 A;  1MG8 A;  4KZ0 A;  4RM8 A;  1XT9 B;  4W9C A;  3X23 A;  2WWZ A;  4HPM B;  2JRI B;  5E6N A;  1UGM A;  2MCN B;  4NQK E;  2CR5 A;  2MX2 A;  2I1J A;  4TQ0 A;  3H7P A;  2W9N A;  3HM6 X;  3ZRF A;  2MQJ A;  3DBS A;  4ZRK A;  3M63 B;  4ZYN A;  2JVC A;  2PE6 B;  3C0R B;  3TIX A;  4HCP B;  1LM8 B;  1YQB A;  2D3G A;  3EEC A;  1E8Y A;  4F7Z A;  1G6J A;  2JXX A;  2ZNV C;  4HK2 A;  2KFK B;  4WWP A;  2RD0 A;  3T9L A;  3A4S C;  4AP4 C;  4DHJ B;  2ZZP B;  1WGG A;  2JPH A;  3NOB A;  4IWP A;  3U30 A;  2FCQ A;  3MHS D;  3QA8 A;  4P7I A;  2CS4 A;  3WAM A;  4KIK B;  1EUV B;  2KQ7 A;  3RZF A;  2ZCC A;  4PYZ A;  2LGD A;  2LAS A;  3NY5 A;  2DYB A;  2K25 A;  4KSL C;  2KFJ A;  3V6C B;  5DPR A;  2IO3 B;  2D11 A;  3DOW A;  2IO1 B;  2JY6 A;  3KYD D;  4CO7 A;  3QAQ A;  2K6D B;  2HD5 B;  2D07 B;  2DZI A;  5L95 C;  3RUI B;  2ZEQ A;  4HVB A;  5LLI A;  3KH0 A;  3V60 A;  4G50 A;  1L7Y A;  3M62 B;  2MRP A;  4JL9 A;  4K81 A;  3K9P B;  5AZG A;  1S3S G;  3VDZ A;  2IBI B;  2ZCB A;  4AWJ A;  1KLV A;  4ANW A;  1FXT B;  2HE7 A;  4EEW A;  3ZRC A;  4PS8 A;  3L13 A;  1V80 A;  4EZJ A;  4K7S A;  1PQS A;  1E8Z A;  5IAA C;  2KJH B;  3BY4 B;  4ICU A;  4JQW C;  2MBH A;  3DQV A;  2N1V A;  1OEY A;  2M8S A;  4BOZ B;  3OAW A;  1WF9 A;  2ZPN A;  1WI0 A;  4GDL A;  3VUW A;  4W9K A;  1D3Z A;  2ASQ A;  1OEY J;  3PRZ A;  2L76 A;  4GIV A;  4B9K A;  2KDB A;  4EUT A;  5DPW A;  5BO4 B;  5AZF A;  3V62 A;  5JH5 C;  3HIZ A;  2L05 A;  1J8C A;  2Z0E B;  2DZJ A;  3ENE A;  1GC7 A;  2NBV B;  2MP2 B;  2JZZ A;  4IUM B;  1VD2 A;  2FIF A;  2LXC A;  4DXA B;  4PS3 A;  2GBN A;  4LDT D;  4CHK A;  3HK0 A;  1IPG A;  1SGH A;  1WR1 A;  2BF8 B;  3PLV A;  2N7E A;  4I6L B;  1GUA B;  3WIM A;  2BGF A;  4PYU A;  1AAR A;  2EMT A;  3PVL A;  5DPT A;  4IM2 A;  3NZU A;  1Q5W B;  1L2N A;  2WYQ A;  3PT2 B;  3B08 A;  2NBU A;  2R2O A;  5J17 A;  1WGY A;  3V61 A;  4DDG D;  1P3Q U;  5TR5 A;  1OGW A;  4AUQ C;  3KUD B;  1WXV A;  1JRU A;  4HCN B;  4AOF A;  3CF6 E;  2DEN B;  2JT4 B;  3APF A;  1WZ0 A;  1TZ1 A;  3A9K B;  4LJP B;  2KX0 A;  4PS7 A;  2M0X A;  3A1Q B;  2BYE A;  1P9D U;  1GNU A;  2XEW A;  4X57 B;  3L17 A;  3ML8 A;  3R7Q A;  4DHZ B;  2LJ5 A;  2C5L C;  4TQ1 A;  1NBF C;  4BBN F;  4FJV B;  1UH6 A;  3UIN B;  1WE7 A;  1EF5 A;  4W9E A;  3VQI A;  2M1M A;  2MW5 A;  4FUL A;  2DYM A;  2XK5 B;  1WIA A;  2G3Q B;  3JW0 X;  4KIK A;  4FAD A;  4I6P A;  3UQB A;  2LGY A;  2AL6 A;  1UBQ A;  3DBH I;  3MTN B;  4G3X B;  2G45 B;  2DAJ A;  3VFK A;  1WM3 A;  3MJW A;  4W9I A;  2PJH A;  3ZNH B;  4WWN A;  4HLE A;  1WGH A;  2NCN A;  4NQL B;  4NAW B;  1WE6 A;  3VTW A;  5JHA A;  2R2Q A;  2CU1 A;  4MDK E;  1ZKH A;  2FNJ B;  4NNJ B;  3QHT A;  4K7W A;  3M95 A;  3GOE A;  3KYC D;  2FID A;  4MJS A;  3S2A A;  3UF8 A;  2VRR B;  3L0W B;  3QC8 B;  2C7N B;  1OTR B;  2CHW A;  1TGZ B;  3PRM B;  4JIO U;  1GJZ A;  3DBL I;  2IYD B;  3DPD A;  3BIN A;  4MEM A;  3PRP B;  2PE9 A;  3W1S C;  2O2V A;  3U8Z A;  3AU4 A;  3RT3 B;  3OLM D;  2KDI A;  2KTR B;  2PPH A;  4MH0 E;  4IW0 A;  1K8R B;  4WWO A;  2KVR A;  2N9E B;  2Z0D B;  2MLB A;  2D10 A;  4FJZ A;  2DAF A;  3HHM A;  1WJN A;  4MGI E;  3ZUN A;  2DHZ A;  1RLF A;  2J0M A;  2KLG A;  3EC8 A;  4YL8 A;  2I1K A;  1VCB A;  2N7D A;  3A4R A;  4ZRI A;  5E6P A;  4B95 A;  4BBN C;  1IYF A;  1EO6 A;  3DVG X;  3HM3 A;  2HJ8 A;  3TCA A;  5FR6 A;  1I35 A;  1YX6 B;  5D6J B;  4TV3 A;  2DYO A;  1WXS A;  2RSU A;  1UBI A;  4ZDV A;  3D32 A;  1E5W A;  3DDC B;  2YVC A;  3KUZ A;  4ANU A;  1WZ3 A;  2NBW B;  2V3S A;  4W9F A;  2KMA A;  4A3P A;  4JLC A;  4BKG A;  4GMV A;  5EDS A;  1UD7 A;  3IBE A;  4I6N B;  2KJ6 A;  1H4R A;  2MBO A;  3PLU A;  3H6N A;  3R7R A;  5CHV C;  2L3Z A;  4F8C B;  2K8B A;  4EFO A;  3PV1 A;  4DBG A;  3K9O B;  3OJ3 A;  2M17 A;  4WJO A;  1E8X A;  1E8W A;  3TMP B;  2L0T A;  1ISN A;  2KOX A;  1C3T A;  3LDZ E;  1ZGU B;  3ZNG C;  3IVF A;  3ZIM A;  2N9P C;  2Z59 B;  4IG7 B;  4AJW A;  1YX5 B;  4G0N B;  3ZVV A;  4OVU A;  2L8J A;  4W9L A;  3ECI A;  4A3O A;  1WJU A;  4ANV A;  4BKT A;  2RPQ A;  2FCM A;  4FLH A;  3EHV A;  4MEL A;  3SD5 A;  3I3T B;  3WAN A;  4BFR A;  5LXH A;  1RRB A;  2KTF A;  1HE8 A;  1WJ4 A;  2KDF B;  3N30 A;  1X1M A;  2FCS A;  1LXD A;  3L16 A;  5L83 A;  2O2V B;  4KZC A;  4NPN A;  4WJQ A;  2IO2 B;  3L54 A;  2PEA A;  3JYU A;  3A33 B;  2K8C A;  4GGQ A;  2BWF A;  1U4A A;  4IC7 B;  4TKN A;  2KLC A;  3QCA A;  3ZO5 B;  1WGR A;  3R66 C;  1WMH B;  2GBK A;  3A9K A;  3SDL C;  1Y8R C;  4E74 A;  3VTV A;  2D2Q A;  4FBJ B;  2AWT A;  2MA9 B;  4IWO A;  1V81 A;  1S1Q B;  4XC2 A;  5J2R A;  4E71 A;  1OQY A;  3AI5 A;  2KC2 A;  1TTN A;  2O6V A;  2BWE S;  3A1Q A;  2L00 B;  3U7D A;  3ZDM C;  3EFU A;  4IM0 A;  4MJS B;  3WA0 A;  3PZD A;  1NI2 A;  4GDK A;  2JUO A;  5CHF A;  2BKF A;  5J18 A;  3IFW B;  3UIO B;  2CKH B;  3B1L X;  2A5U A;  4LJO B;  5DCN A;  1SIF A;  1A5R A;  3ZTD A;  2IY1 B;  1WYW B;  4HWI B;  4ANX A;  3H7S A;  2IZV B;  2BPS A;  4W9G A;  2K6Q A;  5JZE B;  3ZKJ C;  4E3C A;  2FAZ A;  3VUY A;  1Q0W B;  1KJT A;  2KWV B;  3N3K B;  2KHW B;  2B3A A;  4A20 A;  2IO0 B;  3TJP A;  3JSV B;  4CYE A;  4RM9 A;  4AJY B;  2KWU B;  2LVO A;  4BKS D;  1GG3 A;  2K1F A;  3ONS A;  3LJ3 A;  3UGB B;  1WRD B;  1LQB A;  1ZW7 A;  5LXI B;  2RGF A;  4FN2 A;  4GSW A;  2RR9 A;  1V9J A;  3VXW A;  1E7V A;  2KC1 A;  4W9H A;  4DHZ E;  2NS5 A;  3CSF A;  3L10 B;  2MP2 A;  4TUU A;  4XZ4 A;  4J6I A;  3ZW3 A;  4KDI C;  2KN5 A;  1Q1O A;  3APD A;  3H9D A;  4WJP A;  5D7G A;  2KTR A;  2MBQ A;  4II2 B;  2V4L A;  4LCD E;  2KDE B;  4F1S A;  1P98 A;  2Y5B B;  4IWQ A;  2OOB B;  1H8C A;  5AEK B;  3TBL D;  3QJZ A;  2MWS B;  1C1Y B;  3NS8 A;  2AEH A;  1WMH A;  3DVG Y;  2DZM A;  1UZX B;  5HKH A;  4GDL B;  4EOY A;  1NDD A;  3L08 A;  3ML9 A;  3NHE B;  3O65 B;  2UWQ A;  5G55 A;  3T8M A;  3RUL A;  2G4S A;  3JSV A;  4RMA A;  4M8M A;  2N1W A;  3QX1 A;  1YJ1 A;  2KX3 A;  2BYV E;  4N9F 4;  2LUE A;  3IHP C;  2BKR B;  2AYO B;  2KMC A;  5DPS A;  2NVU I;  4W9D A;  4DDI D;  2O6V B;  3AUL A;  4EKU A;  3H1U A;  3M3J A;  3A9J B;  2N9X A;  4HXD A;  1QZE A;  3KW5 B;  1RFA A;  2IY0 B;  1V5O A;  1WFY A;  3B0A A;  4WQO B;  2KAN A;  1R4M I;  4BKS A;  1YIW A;  2M4N A;  5IA7 A;  4JGH B;  4FJY A;  3TL5 A;  3R3M A;  2JWZ A;  1EF1 A;  3W1Y A;  2CHX A;  1KM7 A;  3Q3F A;  2FUH B;  1BT0 A;  2FCN A;  1LFD A;  3RZW C;  4DWF A;  4B6W A;  2GBR A;  2KFK A;  3QK0 A;  2KO3 A;  2G4D B;  2L0F A;  2LVP A;  2XBB C;  2C7H A;  2K8H A;  1SE9 A;  4W9J A;  3WAO A;  1WXM A;  1WX9 A;  5E6O A;  3RD2 A;  3QAR A;  4HJK A;  2KJR A;  4FHK A;  1GC6 A;  4URK A;  2QHO A;  4GU2 A;  3VHT C;  3ZLZ A;  2ZNV B;  2ZVN A;  2C9W B;  2O6V D;  4GOC A;  4GB9 A;  3VAW A;  2EKE C;  1WM2 A;  3JVZ X;  3V6E B;  4KVG B;  5C1Z A;  2UYZ B;  3AU5 A;  3H7P B; 
#chains in the Genus database with same CATH topology
 2JSV X;  2J52 A;  1QOB A;  2AL3 A;  3DBH B;  1UGJ A;  4DHJ D;  1L6U A;  4HPL B;  3U7Z A;  2L52 A;  1V1P A;  1ENF A;  2NMQ A;  4IM3 A;  2E3T A;  3GE8 C;  3NZS A;  2YLM A;  1WSP A;  3IG3 A;  4MGY E;  1ZP0 B;  2C60 A;  3RCZ A;  2JZ3 B;  2KK8 A;  2L7R A;  1RAX A;  3URY A;  3VVW B;  4XX5 A;  2K3U A;  1F1H A;  3AE2 B;  1FPY A;  4NJ6 A;  3OJ4 B;  4C7Z A;  3PS6 A;  4GDK B;  3RMK C;  3W5U B;  2IJ0 A;  4JWU C;  4MGK E;  3P2B A;  4BAX A;  2NR2 A;  2WDT B;  2WXI A;  2SAK A;  1FFV A;  2GBJ A;  4G11 A;  5IKC M;  1I7H A;  4LDT B;  1BXT A;  5D2M B;  4M02 A;  2BS2 B;  3ZNZ B;  2WX0 A;  3DHH C;  5CX3 A;  3VUX A;  3NVY A;  5AUK A;  3BK2 A;  2JF5 A;  4C56 C;  1R4N I;  2X38 A;  1T3Q A;  3NVV A;  2WU2 B;  4FHJ A;  2LGI A;  2XK5 A;  2V1Y A;  3QQ8 B;  1L0V B;  4MM3 A;  1I4R A;  1N5X A;  3AE8 B;  4RCO A;  2DZK A;  1I4P A;  3R2I A;  4MH8 A;  3GZN I;  4W9C A;  4NQK E;  4TQ0 A;  2WXO A;  3DWG C;  2W9N A;  3HM6 X;  3ZRF A;  4L23 A;  3DBS A;  2JVC A;  2PE6 B;  4HCP B;  4F7Z A;  2RD0 A;  3T9L A;  4AP4 C;  4DHJ B;  3SFD B;  2QDF A;  2PKO A;  3U30 A;  4AS1 A;  4OHJ A;  4KIK B;  3RZF A;  2ZCC A;  4KSL C;  1TKY A;  4XDD A;  2KVZ A;  2B76 B;  2V3N A;  2JY6 A;  3AH7 A;  3J9C A;  3N20 C;  3KH0 A;  4G50 A;  2N0S B;  4JL9 A;  2D3A A;  3K9P B;  4K81 A;  3HVD A;  3N1Y C;  1L0Y B;  4PS8 A;  2WP9 B;  3L13 A;  3U2S C;  3P4P B;  4K7S A;  3IAM 1;  1SE4 A;  2W3R A;  2KJH B;  3BY4 B;  5IAA C;  1LO5 D;  1ESF A;  3VUW A;  1YN4 A;  1WXQ A;  3V62 A;  2L05 A;  1J8C A;  2NTS A;  1CZP A;  2Z0E B;  2DZJ A;  3ENE A;  1GC7 A;  2NBV B;  2JQR B;  1KFY B;  2GBN A;  5FK9 C;  3AV8 A;  1DOI A;  4WUR A;  3PVL A;  4IM2 A;  1L2N A;  2WYQ A;  3PT2 B;  2NBU A;  3NS1 A;  5J17 A;  3RNF C;  4RGO S;  2IGG A;  1OGW A;  1STE A;  4AOF A;  2JT4 B;  2RPV A;  4WAF A;  5EE1 A;  2KDM A;  4LJP B;  2BS3 B;  2WXQ A;  4PS7 A;  4S17 A;  2BYE A;  1P9D U;  2XEW A;  5EE0 A;  5HG2 A;  2WDV B;  2DBY A;  1NBF C;  3RN9 C;  3UIN B;  1SIJ A;  1IUE A;  4OZB A;  3AE9 B;  1SE2 A;  1ZDV A;  3VQI A;  1SJE D;  4US9 A;  1MG4 A;  1YJI A;  4I6P A;  1EM7 A;  3UQB A;  1TS3 A;  1HZ6 A;  4G3X B;  4BZA A;  2WXM A;  1SBB B;  2PJH A;  2L83 A;  4NAW B;  3SFE B;  4K7W A;  3M95 A;  3GOE A;  2K0P A;  4IDI A;  2VRR B;  1GJZ A;  2WS3 B;  4JIO U;  1AN8 A;  3DPD A;  1HA5 A;  4MEM A;  3BIN A;  3W1S C;  3OLM D;  2KTR B;  4WWO A;  2LHE A;  2KVR A;  2MLB A;  4FJZ A;  3HHM A;  1XF5 L;  1WJN A;  2DHZ A;  1VCB A;  1IYF A;  3A4R A;  4ZRI A;  1JWU D;  2BBC A;  4BBN C;  4PT5 A;  3TCA A;  2GRI A;  1I35 A;  1YX6 B;  1C79 A;  3D32 A;  2SEB D;  3W9C B;  3KUZ A;  1QKZ A;  4NAM A;  4XYC A;  2WU5 B;  4A3P A;  2N7J A;  4JLC A;  3TEY A;  1UD7 A;  3AE4 B;  2KAC A;  2MBO A;  1D5Z C;  5CHV C;  1JRP A;  2L3Z A;  2K8B A;  2AQ2 B;  3AN1 A;  2Y3A A;  4WJO A;  1KTK A;  4ZHO A;  2M19 A;  4IG7 B;  2VH1 A;  4MAC A;  4OVU A;  3ZVV A;  2L8J A;  1SE3 A;  4KGT A;  2RPQ A;  2FCM A;  2K5P A;  3ABV B;  1FNU A;  3RNG C;  4WJQ A;  3Q8C A;  1UWX A;  1YQ4 B;  1ZUD 2;  2J4X A;  1TY0 A;  5GXG B;  3NVW A;  1IBX A;  3ZO5 B;  3SDL C;  4Q2J A;  1Y8R C;  2WHI A;  2D2Q A;  2E6X A;  2MA9 B;  4IWO A;  1S1Q B;  4WIP A;  3ETR A;  1OQY A;  4IOI E;  4C4V A;  1TTN A;  3A1Q A;  3GB1 A;  3ZDM C;  4C7Y A;  3PZD A;  1NI2 A;  2JUO A;  4P1B C;  2BKF A;  5HFY A;  3L4P A;  3UIO B;  5E6J A;  3Q2A C;  3ZTD A;  2K6Q A;  1KH0 A;  3C19 A;  1UUP A;  4H2A A;  5LNK 1;  1E0Z A;  2KWU B;  1HTQ A;  1GG3 A;  2K1F A;  3LJ3 A;  1F52 A;  4ARC A;  2LEK A;  4S0R A;  3EGR A;  1D5M C;  2RR9 A;  1E7V A;  4P1C C;  4DHZ E;  3CSF A;  3I9V 1;  2KN5 A;  4WJP A;  1TY2 A;  4II2 B;  4TSS A;  4IKG A;  1IGC A;  1P98 A;  2Y5B B;  4IWQ A;  5AEK B;  5HHD G;  1TKE A;  3NS8 A;  1WMH A;  1UZX B;  1QOF A;  1NDD A;  3L08 A;  3KQ4 A;  1D4B A;  2BKR B;  1NEK B;  2KMC A;  1E9M A;  3AUL A;  4L2Y A;  2VZK D;  1R4N B;  4GLS C;  1L4Z B;  2IY0 B;  1AYF A;  4JGH B;  3PZ8 A;  2JWZ A;  2VH2 A;  1KM7 A;  3Q3F A;  2FUH B;  3AE7 B;  3RZW C;  4M00 A;  2OED A;  3QK0 A;  1PDX A;  2XBB C;  2WXL A;  1WXM A;  3V3X A;  2FE8 A;  1VJK A;  3VHT C;  3V6E B;  1M94 A;  2WX1 A;  3GE3 C;  5I4D A;  2DX5 B;  1XCQ L;  1SJH D;  2ZVO A;  4ARI A;  2OJW A;  3O13 A;  2MBE A;  1KOT A;  2KWC A;  1VRA B;  2OJR A;  3X0W A;  5KHQ A;  1K50 A;  2GBM A;  4FA6 A;  3R2T A;  1L6V A;  2CU3 A;  1K53 A;  4ZYS A;  2PTL A;  2QIL A;  3DCG A;  4YTN B;  3DBR B;  4HJG E;  4KSK C;  3P42 A;  3PHX B;  4RGN A;  1WGD A;  2KQS A;  3MP9 A;  3RPF C;  2J7Q B;  1E7U A;  2AQ1 B;  3AMZ A;  5BYR A;  5IN7 A;  2WXN A;  1WX8 A;  1C76 A;  3UIP B;  1P0R A;  1PGA A;  3KUC B;  2D3B A;  4XGA B;  2WXH A;  1XD3 B;  1I42 A;  2NPT A;  1E90 A;  3PSE B;  2ZPY A;  4HPP A;  2K39 A;  1T0Y A;  1V1P B;  1F9J A;  1Z5S B;  1FCC C;  2J0J A;  2L32 A;  2BYF A;  3N32 A;  2V3P A;  1T6B X;  3PPA A;  4HDO A;  2LD9 A;  2ICI A;  2LGX A;  1UEL A;  5CHW A;  3A9J A;  5D94 A;  4RM8 A;  1UGM A;  3I5J C;  2I1J A;  3UI3 A;  4LTU A;  2MJD A;  2D3G A;  3ZYY X;  1E8Y A;  2JXX A;  2ZNV C;  4HK2 A;  1WGG A;  2JPH A;  2WGS A;  3WAM A;  1LGR A;  2KQ7 A;  4PYZ A;  2LGD A;  2LAS A;  2DYB A;  3RNC C;  3DBL B;  3I63 C;  3V05 A;  5DPR A;  3DOW A;  2IO1 B;  4CO7 A;  1WGK A;  2D07 B;  2DZI A;  4ZHP A;  4HVB A;  5LLI A;  3W2D A;  1L7Y A;  3M62 B;  5AZG A;  1S3S G;  3VDZ A;  1KLV A;  4ANW A;  2JZP A;  3ZRC A;  1OFF A;  3DHI C;  3RI7 C;  1QOG A;  5EE9 A;  3TEW A;  1PQS A;  4JWS C;  2JX5 A;  4ICU A;  3PZ7 A;  1ROE A;  4JQW C;  5IO9 A;  2M8S A;  4YTP B;  3OAW A;  1WI0 A;  3AM9 A;  3TUO A;  3PRZ A;  2PLP A;  2WXK A;  3W5V B;  5JH5 C;  1J7B A;  3SEB A;  1MFW A;  4IUM B;  4P16 A;  2LXC A;  1IPG A;  1SGH A;  2N7E A;  4I6L B;  1GUA B;  4PYU A;  1QT9 A;  4HKZ E;  3V61 A;  4A9A A;  1JRU A;  1TZO A;  3APF A;  1WZ0 A;  3A9K B;  2G9H D;  1N60 A;  2HTM E;  3GZN B;  2KX0 A;  3MC8 A;  3L17 A;  3T3O A;  4DHZ B;  2LJ5 A;  1WYG A;  1EF5 A;  2ONQ A;  1PYW D;  2XNA C;  4ITK A;  2MW5 A;  3RNE C;  3VR9 B;  1YQ3 B;  3MC0 B;  2LGY A;  2AL6 A;  1NVI D;  3C8Y A;  3MJW A;  3ZNH B;  3ZXV A;  1WGH A;  5JHA A;  4XWW A;  4REZ A;  2R2Q A;  2YEP B;  4NNJ B;  2DLB A;  3QHT A;  3UF8 A;  3KYC D;  4EE2 A;  2I38 A;  3QC8 B;  1TGZ B;  3Q8F A;  3DBL I;  4YTM B;  2IYD B;  3Q3N C;  2L1A A;  3Q14 C;  2KDI A;  3E9S A;  5BYS A;  1K8R B;  2Z0D B;  2D10 A;  1JCK B;  2DAF A;  4MGI E;  5BMI A;  2I1K A;  1EO6 A;  3DVG X;  2G1E A;  1F2R I;  5FR6 A;  3FKY A;  1DGJ A;  1T0R C;  2WNM A;  5D6J B;  3Q8A A;  1I4X A;  4KGR A;  2RSU A;  2AX5 A;  3DDC B;  3B9J A;  1FEH A;  1WZ3 A;  3FC4 A;  2V3S A;  2DNF A;  3TSS A;  1FD6 A;  4A55 A;  4GMV A;  1FCL A;  4I6N B;  4DXF A;  2KJ6 A;  1XEE A;  1E6E B;  2XN9 C;  3ZJT A;  3PV1 A;  3K9O B;  2M17 A;  1E8W A;  3TMP B;  2L0T A;  1ISN A;  2N9P C;  2Z8L A;  1PGX A;  4G0N B;  5T8I A;  4A3O A;  3HUI A;  1GPX A;  3AE3 B;  3EHV A;  1N62 A;  2K22 A;  1RRB A;  3N30 A;  1WJ4 A;  1K51 A;  3BII D;  1LXD A;  2ZW0 A;  3L16 A;  5L83 A;  4KZC A;  1J7C A;  1FXA A;  1DOX A;  1C77 A;  4TKN A;  2GBK A;  1SEB D;  2INP E;  3VRA B;  5H92 C;  4JPS A;  5C2T B;  1NI3 A;  4MJS B;  4GDK A;  5CHF A;  4JE3 B;  3IFW B;  4RH6 A;  3ZQ4 A;  2I2Y A;  2GLS A;  5DCN A;  3AEG B;  2IY1 B;  1SB3 C;  2IZV B;  2J42 A;  4E3C A;  3HRD D;  3VUY A;  2KWV B;  3N3K B;  1VZ7 A;  2KHW B;  2KQ4 X;  3JSV B;  3KWL A;  3RNA C;  1WRD B;  4O1N A;  1NYR A;  4MT5 A;  2KYW A;  3VXW A;  4W9H A;  2NS5 A;  2WXJ A;  2MP2 A;  4TUU A;  4KDI C;  1JWM D;  1Q1O A;  3AE5 B;  3H9D A;  5D7G A;  2MBQ A;  4LCD E;  4F1S A;  4LLG M;  2OOB B;  1H8C A;  3TBL D;  4YXD B;  5HKH A;  4EOY A;  3NHE B;  2UWQ A;  4RMA A;  2BYV E;  4N9F 4;  5HI1 A;  2AYO B;  2NVU I;  2KT7 A;  4W9D A;  4PK1 A;  4DDI D;  2LJI A;  3M3J A;  4M01 A;  3KW5 B;  1V5O A;  3B0A A;  2MJ3 A;  1R4M I;  1YIW A;  2LFI A;  3R3M A;  1EF1 A;  2CHX A;  1VR9 A;  2UU7 A;  2R61 A;  2L0F A;  4NJC A;  2K8H A;  1SE9 A;  3WAO A;  1WX9 A;  1R4M B;  1A70 A;  4URK A;  1M4V A;  3NUH B;  2ZNV B;  1UF0 A;  4GOC A;  2EKE C;  1WM2 A;  1JWB D;  4KVG B;  1CJE A;  3PGE A;  4M8N A;  2GI9 A;  2JU6 X;  3PHW B;  2JRH A;  2LRW A;  2WDR B;  2CHZ A;  5JHB A;  2C7M B;  3NZ3 A;  2JYT A;  2LGS A;  2MBB B;  2A4Z A;  2GMI C;  3APC A;  2V4I B;  5D3I B;  4HDQ A;  3VH4 B;  3QIJ A;  1WY8 A;  3SR6 A;  3LB8 C;  1Z2M A;  1J19 A;  3VR8 B;  1WH3 A;  1P1A A;  3BVG A;  1DYQ A;  1SXT A;  3PRE A;  4EZL A;  1K52 A;  1KRH A;  1V49 A;  1TS2 A;  1FM0 D;  1FRR A;  1WJ6 A;  3AXC A;  3BYY B;  3DVN V;  1UWM A;  3ALB A;  5KHO A;  2EMS A;  4M0W B;  3CMM B;  3Q6B A;  4ZRJ A;  2KKC A;  2ON8 A;  1FFU A;  2J0K A;  1FO4 A;  1N61 A;  4GN1 A;  3BZD B;  4MGZ E;  3WAL A;  2WDQ B;  4XDC A;  4KV2 A;  4BOS C;  4II3 B;  1GOZ A;  2LXA A;  2LRU A;  1NYQ A;  4GXB A;  4NY0 A;  4RF0 A;  2KZR A;  2MSE D;  4EZK A;  2Y5P A;  5AZH A;  4MSM B;  3UQA A;  2REX A;  3RYT A;  2LVQ A;  2LMC A;  3KVF B;  2LZ6 A;  4WAA A;  1JQ4 A;  3VTU A;  3WAP A;  1ACC A;  3PTF C;  4B0E A;  1J0G A;  4KDL B;  2FUG 1;  2LWP A;  3X23 A;  4AJW A;  2INC C;  2WWZ A;  4HPM B;  2JRI B;  5E6N A;  2MCN B;  2MX2 A;  1ZE3 D;  3PO0 A;  1TJE A;  3H7P A;  1JWA D;  2MQJ A;  4ZRK A;  1MPE A;  3C0R B;  3TIX A;  1LM8 B;  1L0X B;  2K9X A;  3KLS X;  3ZGZ A;  2KFK B;  4M0W A;  2FCQ A;  3MHS D;  2CS4 A;  1EUV B;  3P4Q B;  3NY5 A;  2KFJ A;  2PW9 A;  2D11 A;  3KYD D;  1FMA D;  1L4D B;  5G5H A;  3RUI B;  2QMT A;  3BVZ A;  2MRP A;  4LNK A;  3B2G A;  1YMH E;  2IBI B;  4AWJ A;  1FXT B;  3BWU D;  2HE7 A;  5TSS A;  1XO3 A;  5IP4 D;  4EZJ A;  2WQY B;  2MBH A;  1WRI A;  2N1V A;  1OEY A;  1XLQ A;  3WCQ A;  2ZPN A;  4GDL A;  1XLN A;  1D3Z A;  2ASQ A;  2VZK B;  1YN3 A;  2L76 A;  4GIV A;  2KDB A;  4B9K A;  4EUT A;  5DPW A;  2BYT A;  2J53 A;  4A8X C;  2MP2 B;  4OZC A;  3HVZ A;  1VD2 A;  1I4G A;  4PS3 A;  1E10 A;  4CHK A;  2BF8 B;  1V1O A;  3WIM A;  2EMT A;  1KLU D;  2JYE A;  5DPT A;  1Q5W B;  1IBX B;  1IGD A;  2R2O A;  1WGY A;  2KAJ A;  4DDG D;  5TR5 A;  3KUD B;  4WWM A;  1BUI C;  1TZ1 A;  3E56 A;  4YSZ B;  2BB5 A;  2M0X A;  4LNF A;  4LNO A;  5AUI A;  4X57 B;  3R7Q A;  2IPK D;  2C5L C;  4K3C A;  3Q3O C;  1UH6 A;  4FJV B;  4MM3 B;  5G5G A;  2M1M A;  2NTT A;  4ZRQ A;  2DYM A;  2XK5 B;  1WIA A;  3DWM A;  1TYG B;  2G3Q B;  3JW0 X;  4FAD A;  1L5P A;  2G45 B;  2RDB C;  2QCZ A;  4W9I A;  4WWN A;  4HLE A;  2FBW B;  4NQL B;  4C80 A;  3Q3M C;  2CU1 A;  1FNW A;  2FNJ B;  3S2A A;  4MJS A;  2FID A;  4ACF A;  2C7N B;  3PRM B;  4ZOH C;  3AEF B;  1PUT A;  1CK1 A;  1QLB B;  2O2V A;  2IGD A;  3RT3 B;  1EU4 A;  2MH7 A;  2IND C;  2BB6 A;  4IW0 A;  1I4Q A;  2N9E B;  2INN E;  3ZUN A;  1RLF A;  2KLG A;  3IXS A;  4K3B A;  4B95 A;  3T3N A;  2HJ8 A;  1Y56 A;  2DYO A;  2KWD A;  1N5W A;  2BQQ A;  1E5W A;  2YVC A;  2M0A A;  1AWD A;  3AE1 B;  2NBW B;  4W9F A;  4KGS A;  4BKG A;  5EDS A;  2QJL A;  1OQQ A;  3IBE A;  4HEA 1;  3PLU A;  3H6N A;  4F8C B;  4EFO A;  4DBG A;  3OJ3 A;  1E8X A;  3LDZ E;  3IVF A;  2WXG A;  2QSD A;  4W9L A;  2QIE B;  3N1X C;  1Q10 A;  4FLH A;  4A6Q A;  3I3T B;  4WH4 A;  2KTF A;  1HE8 A;  2KDF B;  1X1M A;  2V0G A;  2FCS A;  2IGH A;  2O2V B;  3L54 A;  2PEA A;  3A33 B;  4IC7 B;  2BWF A;  2KLC A;  3QCA A;  2PMV A;  1WGR A;  3R66 C;  4E74 A;  1MJD A;  2GB1 A;  4QAY A;  4E71 A;  3U7D A;  3WA0 A;  1BML C;  3P4S B;  3B1L X;  2A5U A;  1PFD A;  1RFK A;  1SIF A;  1A5R A;  2IDY A;  4ANX A;  1C4C A;  2BPS A;  4RF1 A;  1Q0W B;  1KJT A;  3CIR B;  3OWE B;  2IO0 B;  4CYE A;  2LVO A;  4BKS D;  3ONS A;  2HJ1 A;  3UGB B;  2MJE A;  1RYJ A;  2CJN A;  1T5X D;  5LXI B;  2RGF A;  4ZRP A;  4GSW A;  1P7E A;  2KC1 A;  3L10 B;  4XZ4 A;  2KTR A;  5FR3 A;  4OW0 A;  1FRD A;  3LXF A;  3RNB C;  1QF6 A;  3QJZ A;  4KKI A;  2AEH A;  3DVG Y;  4GDL B;  1HQR D;  3O65 B;  5G55 A;  3T8M A;  4YSY B;  2G4S A;  1YJ1 A;  1HTO A;  2KX3 A;  3GS2 A;  2LUE A;  5DPS A;  2QEJ C;  4EKU A;  5MPO A;  3H1U A;  1KF6 B;  3A9J B;  2N9X A;  1QZE A;  1RFA A;  1WFY A;  2KAN A;  4FJY A;  2HDE A;  3TL5 A;  1T0S C;  2Q5W D;  1GAQ B;  2FCN A;  3NJT A;  1LFD A;  1JWS D;  1J7A A;  5JXV A;  4DWF A;  2D5G A;  1C4P A;  2EKI A;  2BT6 A;  2C7H A;  2W55 A;  4W9J A;  4DXG A;  1F0Z A;  2RDG A;  2Y5C A;  2KJR A;  3NRZ A;  4US8 A;  2CJO A;  2ZVN A;  3DHG C;  4L1B A;  4GB9 A;  2O6V D;  4YSX B;  3JVZ X;  3FAH A;  5C1Z A;  3MFG A;  3AU5 A;  3H7P B;  5CTR C;  3ZTC A;  5GMV A;  4KKJ A;  2QC8 A;  2TSS A;  2GOW A;  1DOY A;  1V2Y A;  1V8C A;  1JML A;  2YEP F;  3LYY A;  3BVM A;  1CQV A;  2N4F A;  1V6E A;  1TT5 B;  1V5T A;  3AEB B;  2LI5 A;  3IT6 B;  3DBR I;  3SHQ A;  4NJ7 A;  4ASW C;  4C4V B;  1WX7 A;  1TBE A;  2NPT B;  4OVV A;  2DWQ A;  1EWY C;  2JWU A;  3MC9 A;  1VLB A;  3P63 A;  4WJN A;  2W3S A;  2RDH A;  2KXJ A;  4HRS A;  1WR6 E;  1NEN B;  2KNB A;  4BVU C;  3DVN U;  1V86 A;  1TKG A;  3W1S A;  2PVG C;  3VH3 B;  4RNA A;  4XWT A;  5C23 A;  1P7F A;  1ZPS A;  1RM6 C;  1XQQ A;  1C78 A;  5G2N A;  1YD8 U;  4K1R B;  2D3C A;  1CMX B;  1HZ5 A;  3QWZ B;  4MSQ B;  1WXA A;  1HEZ E;  3ZDT A;  4K7U A;  1IP9 A;  3CST A;  3ZNI D;  4ICV A;  3SU8 X;  2KN4 A;  4RGM A;  4LK0 M;  2KD0 A;  2HTH A;  1T0Q C;  4N59 A;  4DK5 A;  1V97 A;  2LUM A;  4C00 A;  2W82 A;  3Q3J A;  4NAW A;  2ZJD A;  4TMA B;  1MG8 A;  4KZ0 A;  1XT9 B;  1EWC A;  1RWS A;  2X8X X;  2CR5 A;  1JAL A;  3M63 B;  4ZYN A;  1KLG D;  1YQB A;  3EEC A;  3GP7 A;  1G6J A;  2BVC A;  4WWP A;  2RMM A;  3AED B;  3A4S C;  1ZOY B;  2ZZP B;  2PIA A;  5H8Y E;  3NOB A;  1XXG A;  4IWP A;  1FXI A;  3QA8 A;  4P7I A;  1VZ6 A;  3AEA B;  3Q8B A;  4AQ7 A;  4R3D A;  2K25 A;  1GB4 A;  3V6C B;  2IO3 B;  1XCT L;  5L95 C;  3QAQ A;  2K6D B;  2HD5 B;  2M56 B;  4P6V F;  1JW9 D;  2ZEQ A;  3V60 A;  2W54 A;  2ZCB A;  1YOV B;  2N9L A;  4B0M A;  4EEW A;  1TS4 A;  1V80 A;  3N1Z C;  1E8Z A;  3DQV A;  4HRO A;  4BOZ B;  1WF9 A;  1MVK A;  4W9K A;  2WXP A;  1OEY J;  3Q8E A;  5BO4 B;  5AZF A;  3HIZ A;  4OZA A;  1YN5 A;  4JX1 C;  2ZW1 A;  4N6E B;  2JZZ A;  2FIF A;  4DXA B;  3EUB 2;  4LDT D;  5BMG A;  1EU3 A;  3HK0 A;  1WR1 A;  3PLV A;  2BGF A;  1AAR A;  3NZU A;  1MHH E;  1SSN A;  3B08 A;  1R7S A;  2KMM A;  1P3Q U;  4AUQ C;  1WXV A;  4HCN B;  3CF6 E;  2DEN B;  1F2R C;  3ZXR A;  3MJ5 A;  3A1Q B;  2BTE A;  3EFC A;  1GNU A;  1FNV A;  4LNI A;  4RFB A;  3ML8 A;  2WLB A;  2EEL A;  3Q69 A;  4TQ1 A;  4BBN F;  1AW7 A;  3AE6 B;  1FIQ A;  2MHJ A;  3NVZ A;  3ZJU A;  1WE7 A;  3VRB B;  4W9E A;  3ZJV A;  4FUL A;  4NZL B;  4KIK A;  4J3O D;  1UBQ A;  1C9F A;  3DBH I;  1QIL A;  3MTN B;  2DAJ A;  3VFK A;  1WM3 A;  3AEE B;  2NCN A;  3VTW A;  1WE6 A;  4MDK E;  1ZKH A;  4YWG G;  4HKQ A;  3L0W B;  1OTR B;  2CHW A;  1VZ8 A;  3BYT B;  3BK1 A;  3PRP B;  1ZDX A;  2PE9 A;  3U8Z A;  1F77 A;  3AU4 A;  2WXF A;  2PPH A;  4MH0 E;  1MHX A;  4N58 A;  1B9R A;  4A90 A;  2J0M A;  1C4A A;  3EC8 A;  4YL8 A;  5E6P A;  2N7D A;  3N9Y C;  3HM3 A;  1ZXH A;  4TV3 A;  1WXS A;  3FIL B;  1UBI A;  4FXC A;  4ZDV A;  3CWI A;  1OQR A;  4ANU A;  5BYQ A;  2KMA A;  2BS4 B;  3EA6 A;  2OHF A;  1H4R A;  3R7R A;  1HXY D;  1TIF A;  3R8B A;  1WWT A;  2KOX A;  1C3T A;  1ZGU B;  3ZNG C;  3ZIM A;  2Z59 B;  2N9K A;  1YX5 B;  1UNS A;  3ECI A;  1WJU A;  4RGT A;  4ANV A;  4BKT A;  3I57 A;  5C3J B;  4MEL A;  3SD5 A;  3TEX A;  3WAN A;  4BFR A;  5LXH A;  3IAS 1;  1QQR A;  2WXR A;  3MHZ A;  4NPN A;  2IO2 B;  3JYU A;  2K8C A;  4GGQ A;  3U4E G;  1U4A A;  5BMH A;  1WMH B;  3NG0 A;  3A9K A;  1D6E C;  3VTV A;  4USA A;  4FBJ B;  2AWT A;  3P1M A;  1V81 A;  4XC2 A;  5J2R A;  3AI5 A;  1N6Z A;  2KC2 A;  2O6V A;  3FIL A;  2BWE S;  2L00 B;  3EFU A;  4IM0 A;  1N63 A;  2V9H A;  5FKA C;  4XE0 A;  5J18 A;  2CKH B;  4LJO B;  2MEK A;  1WYW B;  4HWI B;  3H7S A;  5JZE B;  4W9G A;  4D2K A;  3U52 E;  3ZKJ C;  2FAZ A;  4OVZ A;  2B3A A;  4A20 A;  3TJP A;  4RM9 A;  4AJY B;  1MI0 A;  5EE3 A;  5IOI A;  3IT4 B;  1LQB A;  1ZW7 A;  4FN2 A;  3RFZ B;  1I4H A;  1XLO A;  5D3D A;  1V9J A;  3TEZ A;  2LHD A;  3AB5 A;  1JRO A;  1ET6 A;  4J6I A;  3ZW3 A;  4DQO C;  3APD A;  1GB1 A;  1VDV A;  1SF0 A;  1TS5 A;  1B1Z A;  2V4L A;  2KDE B;  1YNT E;  1XLP A;  2BW2 A;  4KX6 B;  3P4R B;  1E7P B;  1ZXI A;  1C1Y B;  2MWS B;  3H8H A;  2DZM A;  2PVO D;  4WQM A;  4LNN A;  3ML9 A;  1D5X C;  3RUL A;  3JSV A;  4M8M A;  2N1W A;  3QX1 A;  3IHP C;  1ET9 A;  4YT0 B;  2JXT A;  2O6V B;  3OG5 A;  2AQ3 B;  4HXD A;  4CQN A;  4WQO B;  1PGB A;  4BKS A;  2M4N A;  5IA7 A;  3W1Y A;  1BT0 A;  3KWV A;  4B6W A;  2GBR A;  2KFK A;  1QOA A;  2KO3 A;  2G4D B;  4UDU C;  2LVP A;  2ACZ B;  2H88 B;  5E6O A;  3RD2 A;  1YJJ A;  3QAR A;  4HJK A;  4FHK A;  1GC6 A;  2QHO A;  3AEC B;  4GU2 A;  3ZLZ A;  3B2F A;  2H89 B;  2C9W B;  3VAW A;  2UYZ B; 
#chains in the Genus database with same CATH homology
 3PGE A;  4M8N A;  5CTR C;  3PHW B;  1M94 A;  2WX1 A;  2JRH A;  2AL3 A;  2LRW A;  3ZTC A;  2DX5 B;  2CHZ A;  5GMV A;  2C7M B;  5JHB A;  2MBB B;  2A4Z A;  2GOW A;  2ZVO A;  4DHJ D;  1V2Y A;  4HPL B;  2GMI C;  3APC A;  4HDQ A;  2MBE A;  3VH4 B;  4IM3 A;  1KOT A;  2KWC A;  3QIJ A;  2N4F A;  1V6E A;  2YLM A;  3NZS A;  3IG3 A;  1WY8 A;  2OJR A;  4MGY E;  3X0W A;  5KHQ A;  2C60 A;  3RCZ A;  1V5T A;  2GBM A;  2JZ3 B;  4FA6 A;  2LI5 A;  2KK8 A;  1Z2M A;  1J19 A;  2L7R A;  1RAX A;  1WH3 A;  3DBR I;  1P1A A;  3SHQ A;  4XX5 A;  3VVW B;  4NJ7 A;  4ASW C;  1WX7 A;  3PRE A;  1TBE A;  3DCG A;  2NPT B;  4EZL A;  4OVV A;  4KSK C;  4NJ6 A;  1V49 A;  3PHX B;  3OJ4 B;  3PS6 A;  1WGD A;  2KQS A;  4WJN A;  3AXC A;  1WJ6 A;  4GDK B;  3DVN V;  3ALB A;  5KHO A;  2EMS A;  2KXJ A;  2J7Q B;  1WR6 E;  1E7U A;  4M0W B;  3CMM B;  4MGK E;  3P2B A;  2KNB A;  4BVU C;  3DVN U;  2NR2 A;  2WDT B;  1V86 A;  2GBJ A;  1WX8 A;  4G11 A;  3W1S A;  4ZRJ A;  2KKC A;  3VH3 B;  3UIP B;  4LDT B;  2J0K A;  5D2M B;  5C23 A;  1P0R A;  3ZNZ B;  1XQQ A;  2WX0 A;  3KUC B;  5CX3 A;  4GN1 A;  3VUX A;  4MGZ E;  5G2N A;  3WAL A;  1YD8 U;  4K1R B;  2JF5 A;  4KV2 A;  4BOS C;  1XD3 B;  4II3 B;  1CMX B;  1I42 A;  2NPT A;  1E90 A;  3QWZ B;  2LXA A;  4MSQ B;  1R4N I;  2LRU A;  4GXB A;  4NY0 A;  1WXA A;  2KZR A;  2MSE D;  3PSE B;  3ZDT A;  2ZPY A;  4EZK A;  4K7U A;  1IP9 A;  3CST A;  5AZH A;  4MSM B;  2K39 A;  3ZNI D;  1T0Y A;  4ICV A;  3SU8 X;  4FHJ A;  2REX A;  3UQA A;  1F9J A;  3RYT A;  2XK5 A;  2V1Y A;  2KD0 A;  3QQ8 B;  1Z5S B;  2HTH A;  2LVQ A;  3KVF B;  4MM3 A;  2LZ6 A;  2J0J A;  4WAA A;  4DK5 A;  2BYF A;  3N32 A;  3VTU A;  3PPA A;  4HDO A;  3WAP A;  3PTF C;  2DZK A;  2LD9 A;  1J0G A;  4KDL B;  2LGX A;  3Q3J A;  4NAW A;  2ZJD A;  3GZN I;  1UEL A;  5CHW A;  2LWP A;  3A9J A;  5D94 A;  1MG8 A;  4KZ0 A;  4RM8 A;  1XT9 B;  4W9C A;  3X23 A;  2WWZ A;  4HPM B;  2JRI B;  5E6N A;  1UGM A;  2MCN B;  4NQK E;  2CR5 A;  2MX2 A;  2I1J A;  4TQ0 A;  3H7P A;  2W9N A;  3HM6 X;  3ZRF A;  2MQJ A;  3DBS A;  4ZRK A;  3M63 B;  4ZYN A;  2JVC A;  2PE6 B;  3C0R B;  3TIX A;  4HCP B;  1LM8 B;  1YQB A;  2D3G A;  3EEC A;  1E8Y A;  4F7Z A;  1G6J A;  2JXX A;  2ZNV C;  4HK2 A;  2KFK B;  4WWP A;  2RD0 A;  3T9L A;  3A4S C;  4AP4 C;  4DHJ B;  2ZZP B;  1WGG A;  2JPH A;  3NOB A;  4IWP A;  3U30 A;  2FCQ A;  3MHS D;  3QA8 A;  4P7I A;  2CS4 A;  3WAM A;  4KIK B;  1EUV B;  2KQ7 A;  3RZF A;  2ZCC A;  4PYZ A;  2LGD A;  2LAS A;  3NY5 A;  2DYB A;  2K25 A;  4KSL C;  2KFJ A;  3V6C B;  5DPR A;  2IO3 B;  2D11 A;  3DOW A;  2IO1 B;  2JY6 A;  3KYD D;  4CO7 A;  3QAQ A;  2K6D B;  2HD5 B;  2D07 B;  2DZI A;  5L95 C;  3RUI B;  2ZEQ A;  4HVB A;  5LLI A;  3KH0 A;  3V60 A;  4G50 A;  1L7Y A;  3M62 B;  2MRP A;  4JL9 A;  4K81 A;  3K9P B;  5AZG A;  1S3S G;  3VDZ A;  2IBI B;  2ZCB A;  4AWJ A;  1KLV A;  4ANW A;  1FXT B;  2HE7 A;  4EEW A;  3ZRC A;  4PS8 A;  3L13 A;  1V80 A;  4EZJ A;  4K7S A;  1PQS A;  1E8Z A;  5IAA C;  2KJH B;  3BY4 B;  4ICU A;  4JQW C;  2MBH A;  3DQV A;  2N1V A;  1OEY A;  2M8S A;  4BOZ B;  3OAW A;  1WF9 A;  2ZPN A;  1WI0 A;  4GDL A;  3VUW A;  4W9K A;  1D3Z A;  2ASQ A;  1OEY J;  3PRZ A;  2L76 A;  4GIV A;  4B9K A;  2KDB A;  4EUT A;  5DPW A;  5BO4 B;  5AZF A;  3V62 A;  5JH5 C;  3HIZ A;  2L05 A;  1J8C A;  2Z0E B;  2DZJ A;  3ENE A;  1GC7 A;  2NBV B;  2MP2 B;  2JZZ A;  4IUM B;  1VD2 A;  2FIF A;  2LXC A;  4DXA B;  4PS3 A;  2GBN A;  4LDT D;  4CHK A;  3HK0 A;  1IPG A;  1SGH A;  1WR1 A;  2BF8 B;  3PLV A;  2N7E A;  4I6L B;  1GUA B;  3WIM A;  2BGF A;  4PYU A;  1AAR A;  2EMT A;  3PVL A;  5DPT A;  4IM2 A;  3NZU A;  1Q5W B;  1L2N A;  2WYQ A;  3PT2 B;  3B08 A;  2NBU A;  2R2O A;  5J17 A;  1WGY A;  3V61 A;  4DDG D;  1P3Q U;  5TR5 A;  1OGW A;  4AUQ C;  3KUD B;  1WXV A;  1JRU A;  4HCN B;  4AOF A;  3CF6 E;  2DEN B;  2JT4 B;  3APF A;  1WZ0 A;  1TZ1 A;  3A9K B;  4LJP B;  2KX0 A;  4PS7 A;  2M0X A;  3A1Q B;  2BYE A;  1P9D U;  1GNU A;  2XEW A;  4X57 B;  3L17 A;  3ML8 A;  3R7Q A;  4DHZ B;  2LJ5 A;  2C5L C;  4TQ1 A;  1NBF C;  4BBN F;  4FJV B;  1UH6 A;  3UIN B;  1WE7 A;  1EF5 A;  4W9E A;  3VQI A;  2M1M A;  2MW5 A;  4FUL A;  2DYM A;  2XK5 B;  1WIA A;  2G3Q B;  3JW0 X;  4KIK A;  4FAD A;  4I6P A;  3UQB A;  2LGY A;  2AL6 A;  1UBQ A;  3DBH I;  3MTN B;  4G3X B;  2G45 B;  2DAJ A;  3VFK A;  1WM3 A;  3MJW A;  4W9I A;  2PJH A;  3ZNH B;  4WWN A;  4HLE A;  1WGH A;  2NCN A;  4NQL B;  4NAW B;  1WE6 A;  3VTW A;  5JHA A;  2R2Q A;  2CU1 A;  4MDK E;  1ZKH A;  2FNJ B;  4NNJ B;  3QHT A;  4K7W A;  3M95 A;  3GOE A;  3KYC D;  2FID A;  4MJS A;  3S2A A;  3UF8 A;  2VRR B;  3L0W B;  3QC8 B;  2C7N B;  1OTR B;  2CHW A;  1TGZ B;  3PRM B;  4JIO U;  1GJZ A;  3DBL I;  2IYD B;  3DPD A;  3BIN A;  4MEM A;  3PRP B;  2PE9 A;  3W1S C;  2O2V A;  3U8Z A;  3AU4 A;  3RT3 B;  3OLM D;  2KDI A;  2KTR B;  2PPH A;  4MH0 E;  4IW0 A;  1K8R B;  4WWO A;  2KVR A;  2N9E B;  2Z0D B;  2MLB A;  2D10 A;  4FJZ A;  2DAF A;  3HHM A;  1WJN A;  4MGI E;  3ZUN A;  2DHZ A;  1RLF A;  2J0M A;  2KLG A;  3EC8 A;  4YL8 A;  2I1K A;  1VCB A;  2N7D A;  3A4R A;  4ZRI A;  5E6P A;  4B95 A;  4BBN C;  1IYF A;  1EO6 A;  3DVG X;  3HM3 A;  2HJ8 A;  3TCA A;  5FR6 A;  1I35 A;  1YX6 B;  5D6J B;  4TV3 A;  2DYO A;  1WXS A;  2RSU A;  1UBI A;  4ZDV A;  3D32 A;  1E5W A;  3DDC B;  2YVC A;  3KUZ A;  4ANU A;  1WZ3 A;  2NBW B;  2V3S A;  4W9F A;  2KMA A;  4A3P A;  4JLC A;  4BKG A;  4GMV A;  5EDS A;  1UD7 A;  3IBE A;  4I6N B;  2KJ6 A;  1H4R A;  2MBO A;  3PLU A;  3H6N A;  3R7R A;  5CHV C;  2L3Z A;  4F8C B;  2K8B A;  4EFO A;  3PV1 A;  4DBG A;  3K9O B;  3OJ3 A;  2M17 A;  4WJO A;  1E8X A;  1E8W A;  3TMP B;  2L0T A;  1ISN A;  2KOX A;  1C3T A;  3LDZ E;  1ZGU B;  3ZNG C;  3IVF A;  3ZIM A;  2N9P C;  2Z59 B;  4IG7 B;  4AJW A;  1YX5 B;  4G0N B;  3ZVV A;  4OVU A;  2L8J A;  4W9L A;  3ECI A;  4A3O A;  1WJU A;  4ANV A;  4BKT A;  2RPQ A;  2FCM A;  4FLH A;  3EHV A;  4MEL A;  3SD5 A;  3I3T B;  3WAN A;  4BFR A;  5LXH A;  1RRB A;  2KTF A;  1HE8 A;  1WJ4 A;  2KDF B;  3N30 A;  1X1M A;  2FCS A;  1LXD A;  3L16 A;  5L83 A;  2O2V B;  4KZC A;  4NPN A;  4WJQ A;  2IO2 B;  3L54 A;  2PEA A;  3JYU A;  3A33 B;  2K8C A;  4GGQ A;  2BWF A;  1U4A A;  4IC7 B;  4TKN A;  2KLC A;  3QCA A;  3ZO5 B;  1WGR A;  3R66 C;  1WMH B;  2GBK A;  3A9K A;  3SDL C;  1Y8R C;  4E74 A;  3VTV A;  2D2Q A;  4FBJ B;  2AWT A;  2MA9 B;  4IWO A;  1V81 A;  1S1Q B;  4XC2 A;  5J2R A;  4E71 A;  1OQY A;  3AI5 A;  2KC2 A;  1TTN A;  2O6V A;  2BWE S;  3A1Q A;  2L00 B;  3U7D A;  3ZDM C;  3EFU A;  4IM0 A;  4MJS B;  3WA0 A;  3PZD A;  1NI2 A;  4GDK A;  2JUO A;  5CHF A;  2BKF A;  5J18 A;  3IFW B;  3UIO B;  2CKH B;  3B1L X;  2A5U A;  4LJO B;  5DCN A;  1SIF A;  1A5R A;  3ZTD A;  2IY1 B;  1WYW B;  4HWI B;  4ANX A;  3H7S A;  2IZV B;  2BPS A;  4W9G A;  2K6Q A;  5JZE B;  3ZKJ C;  4E3C A;  2FAZ A;  3VUY A;  1Q0W B;  1KJT A;  2KWV B;  3N3K B;  2KHW B;  2B3A A;  4A20 A;  2IO0 B;  3TJP A;  3JSV B;  4CYE A;  4RM9 A;  4AJY B;  2KWU B;  2LVO A;  4BKS D;  1GG3 A;  2K1F A;  3ONS A;  3LJ3 A;  3UGB B;  1WRD B;  1LQB A;  1ZW7 A;  5LXI B;  2RGF A;  4FN2 A;  4GSW A;  2RR9 A;  1V9J A;  3VXW A;  1E7V A;  2KC1 A;  4W9H A;  4DHZ E;  2NS5 A;  3CSF A;  3L10 B;  2MP2 A;  4TUU A;  4XZ4 A;  4J6I A;  3ZW3 A;  4KDI C;  2KN5 A;  1Q1O A;  3APD A;  3H9D A;  4WJP A;  5D7G A;  2KTR A;  2MBQ A;  4II2 B;  2V4L A;  4LCD E;  2KDE B;  4F1S A;  1P98 A;  2Y5B B;  4IWQ A;  2OOB B;  1H8C A;  5AEK B;  3TBL D;  3QJZ A;  2MWS B;  1C1Y B;  3NS8 A;  2AEH A;  1WMH A;  3DVG Y;  2DZM A;  1UZX B;  5HKH A;  4GDL B;  4EOY A;  1NDD A;  3L08 A;  3ML9 A;  3NHE B;  3O65 B;  2UWQ A;  5G55 A;  3T8M A;  3RUL A;  2G4S A;  3JSV A;  4RMA A;  4M8M A;  2N1W A;  3QX1 A;  1YJ1 A;  2KX3 A;  2BYV E;  4N9F 4;  2LUE A;  3IHP C;  2BKR B;  2AYO B;  2KMC A;  5DPS A;  2NVU I;  4W9D A;  4DDI D;  2O6V B;  3AUL A;  4EKU A;  3H1U A;  3M3J A;  3A9J B;  2N9X A;  4HXD A;  1QZE A;  3KW5 B;  1RFA A;  2IY0 B;  1V5O A;  1WFY A;  3B0A A;  4WQO B;  2KAN A;  1R4M I;  4BKS A;  1YIW A;  2M4N A;  5IA7 A;  4JGH B;  4FJY A;  3TL5 A;  3R3M A;  2JWZ A;  1EF1 A;  3W1Y A;  2CHX A;  1KM7 A;  3Q3F A;  2FUH B;  1BT0 A;  2FCN A;  1LFD A;  3RZW C;  4DWF A;  4B6W A;  2GBR A;  2KFK A;  3QK0 A;  2KO3 A;  2G4D B;  2L0F A;  2LVP A;  2XBB C;  2C7H A;  2K8H A;  1SE9 A;  4W9J A;  3WAO A;  1WXM A;  1WX9 A;  5E6O A;  3RD2 A;  3QAR A;  4HJK A;  2KJR A;  4FHK A;  1GC6 A;  4URK A;  2QHO A;  4GU2 A;  3VHT C;  3ZLZ A;  2ZNV B;  2ZVN A;  2C9W B;  2O6V D;  4GOC A;  4GB9 A;  3VAW A;  2EKE C;  1WM2 A;  3JVZ X;  3V6E B;  4KVG B;  5C1Z A;  2UYZ B;  3AU5 A;  3H7P B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...