1R4MI

Appbp1-uba3-nedd8, an e1-ubiquitin-like protein complex
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
76
structure length
76
Chain Sequence
MLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVLHLVLALRGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords amyloid beta precursor protein-binding protein 1
publication title The structure of the APPBP1-UBA3-NEDD8-ATP complex reveals the basis for selective ubiquitin-like protein activation by an E1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 18
structure length 76
sequence length 76
chains with identical sequence J, K, L
ec nomenclature
pdb deposition date 2003-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1r4mI00
5J2RA 1YX6B 4X57B 5IA7A 4FULA 3ONSA 5D94A 1H8CA 4LDTD 2D2QA 2FUHB 2HTHA 4IWOA 2KX3A 2AL3A 4GB9A 2D11A 2M1MA 3L0WB 3ZTCA 2DZJA 3VHTC 2WX1A 3NOBA 4NQKE 2J0MA 1TBEA 4IC7B 1LM8B 2K25A 2PEAA 1WY8A 4WJNA 4KV2A 2BPSA 3RYTA 3S2AA 2AWTA 3RZWC 4B95A 3H6NA 2ZCBA 3UINB 3QK0A 2M0XA 3O65B 2UYZB 2WWZA 2KKCA 3IVFA 3ZW3A 4PS3A 4I6PA 4ICVA 2KLCA 2WX0A 4KZ0A 2GMIC 2LI5A 2XBBC 1WGHA 2ZVOA 3PSEB 4K7UA 3A33B 2JZ3B 2L0TA 4K81A 2KC1A 3AU5A 1KLVA 4CHKA 4FBJB 4BKTA 1HE8A 4FHKA 3T9LA 3TMPB 3L17A 5DPRA 3PHWB 4WQOB 4MJSB 3ZKJC 1LXDA 3GZNI 2JUOA 2OJRA 1Z2MA 3KVFB 2KJRA 1GC6A 1GG3A 4DHZE 3A9KA 4KDIC 2LXCA 3QCAA 3U8ZA 4XC2A 2K6QA 3JW0X 2KDIA 2LGDA 1Z5SB 1ZKHA 3H7SA 4HK2A 4TV3A 1OQYA 2J0KA 2K8BA 4DHZB 3H1UA 2L00B 4K7SA 2HJ8A 2EMTA 2N1WA 4W9GA 1XD3B 3MJWA 4DWFA 1V6EA 1YD8U 2K8CA 2GBJA 2LGYA 4M8MA 1WXAA 3Q3JA 4IG7B 2KWCA 1V5TA 1VD2A 3H9DA 1Q5WB 3ZLZA 3T8MA 3RZFA 3R66C 2KANA 5HKHA 5DPWA 4ZRIA 2IBIB 4K1RB 1UBQA 2BYVE 3VVWB 1WRDB 2NS5A 3K9OB 2KDEB 2FCQA 2Z0DB 2KWUB 4LCDE 2DZKA 4IWQA 1RLFA 2BGFA 3IBEA 4HPMB 1UGMA 2O2VB 4F8CB 2LGXA 2MBOA 1V86A 3ZTDA 1S1QB 2N9EB 2GBNA 4GDKB 5G2NA 1WZ0A 4EOYA 4HJKA 2V4LA 2JY6A 3M3JA 1PQSA 2YVCA 4RM8A 2N7DA 4GDKA 2PPHA 4HDOA 4DDID 3PV1A 1P1AA 2DX5B 5DCNA 1WGRA 1WE6A 1F9JA 4JLCA 3IFWB 5C1ZA 2IO1B 2ZZPB 1WJNA 1EF5A 1KM7A 4ZRJA 2A4ZA 4GGQA 1WFYA 2GOWA 2RD0A 2UWQA 3DVNV 2KFKB 2KVRA 1LFDA 2CHXA 2BWFA 2C7HA 1WMHA 5CX3A 1WM2A 4CO7A 3IG3A 3I3TB 2IY1B 3DVGY 3QIJA 2Z59B 4ANWA 2DHZA 2WYQA 4PS8A 2KXJA 4LJPB 1WXSA 2KFKA 1P0RA 4WWNA 1XT9B 3UQBA 1H4RA 4HDQA 2MSED 3ZO5B 1L2NA 3ML8A 3QA8A 5L83A 2DYOA 2KMAA 4KVGB 3W1YA 5G55A 4A20A 3RD2A 4AJYB 4WAAA 1C3TA 3B0AA 3WAOA 3U7DA 1WE7A 2CKHB 2KTRB 3PZDA 3SHQA 3NZSA 2LZ6A 4HWIB 4GOCA 4IM0A 4YL8A 2N9XA 2C9WB 3KH0A 2HD5B 2DAJA 3A4RA 3KW5B 2MP2A 3WA0A 3W1SC 2ZNVC 4MELA 2ZPYA 3R7RA 2G4SA 3DVNU 3QAQA 3VUXA 2NR2A 3TJPA 4AWJA 2LVOA 3V62A 4HCNB 4AJWA 1EF1A 3A1QB 3GOEA 1V5OA 3NZUA 2G4DB 4G11A 3HHMA 3ZUNA 5JZEB 2ZEQA 1J19A 3B08A 2EKEC 3PT2B 4TQ0A 1SE9A 1Y8RC 2R2OA 2KC2A 2GBRA 2LASA 3A1QA 3JVZX 3PREA 1EO6A 3OJ4B 4ANVA 1UH6A 5LLIA 4FLHA 2DZMA 1E7VA 4FJZA 4AOFA 2MBHA 4W9EA 2MLBA 2O6VA 3R7QA 4ANXA 4DHJD 3QQ8B 3BINA 3M62B 3ZDTA 2QHOA 3VXWA 4K7WA 1TZ1A 5AEKB 5IAAC 1WIAA 4DK5A 3ZIMA 2IZVB 2KMCA 4DHJB 3WALA 2BYFA 3W1SA 2LVPA 2CHZA 4P7IA 4ICUA 2NCNA 1FXTB 2JRIB 1V80A 4I6NB 4II2B 3HK0A 4JIOU 4NJ7A 5CHFA 3UIOB 1IP9A 2J0JA 4G50A 3A9KB 1OEYA 3PGEA 1U4AA 1ZGUB 4GDLB 2DYBA 4IWPA 2PE6B 3PRPB 3VTWA 5D7GA 3JYUA 2FIDA 3SD5A 4W9DA 1E7UA 4RM9A 2KQSA 1OEYJ 2C7NB 2JF5A 1E8WA 1QZEA 3KUCB 1E8ZA 3DBHI 4GDLA 3V6CB 4ZDVA 1I35A 3PPAA 2B3AA 3PRZA 4W9JA 4ANUA 1S3SG 1TTNA 4BKGA 5AZGA 3WANA 3UF8A 3RCZA 2N4FA 2HE7A 1WX7A 3Q3FA 4GN1A 1WJ4A 1WGDA 2MX2A 2NVUI 5GMVA 1RAXA 5AZHA 2MW5A 4JL9A 5J18A 2K1FA 2BYEA 1GUAB 3DPDA 5JH5C 4DDGD 4WJQA 2L05A 2JWZA 2KDFB 4ASWC 1D3ZA 2RPQA 5KHOA 2CU1A 2XK5B 4JGHB 4WJOA 4WWOA 2C60A 3BY4B 3L13A 1GC7A 5CHWA 4E71A 3A4SC 4B6WA 2FCNA 2FNJB 2JPHA 4MGKE 2IYDB 2M4NA 5TR5A 3LJ3A 4EZLA 5C23A 3VH4B 1Q1OA 2LRUA 2RR9A 3VUWA 2XK5A 4E3CA 2MWSB 5D2MB 2LD9A 2JZZA 1WF9A 1MG8A 4OVVA 4G0NB 4BVUC 1IPGA 2KZRA 1V9JA 2C7MB 2IO0B 2L7RA 3EFUA 3APCA 4NY0A 4KSKC 5KHQA 4WWPA 4MEMA 2JRHA 3HM3A 4EKUA 4MDKE 2JXXA 4W9FA 3ZDMC 3X0WA 2J7QB 2RGFA 2ZCCA 3VDZA 1V81A 2G3QB 3ZNID 3JSVA 2PJHA 5J17A 3N32A 1WMHB 2ZPNA 3ZRCA 2K6DB 2V1YA 4GXBA 3PRMB 3PVLA 1AARA 2EMSA 3ENEA 1UBIA 1UZXB 2ASQA 3MTNB 4EUTA 3KUDB 2IO2B 2ZVNA 4EEWA 4HLEA 2BKRB 2C5LC 5D6JB 3L10B 4HPLB 3UGBB 4HVBA 4DBGA 2L8JA 4PYZA 3ZVVA 3KYDD 2REXA 4WJPA 2V3SA 3KYCD 4BOZB 4LJOB 1WGYA 1J8CA 3SDLC 4KIKB 3RULA 4A3OA 5AZFA 4EFOA 3NHEB 4CYEA 4PYUA 2MP2B 2KHWB 1UELA 3N30A 4FADA 2CR5A 1V49A 1JRUA 3D32A 4TUUA 3QJZA 2DENB 4KIKA 2N1VA 2KTFA 2I1KA 3L16A 3TL5A 3CSFA 1RRBA 1X1MA 4PS7A 4TKNA 3X23A 1WM3A 1CMXB 1SIFA 1WI0A 3V61A 2MCNB 2BWES 2M8SA 2KN5A 3VQIA 1EUVB 1P9DU 1A5RA 4RMAA 2FIFA 2O6VD 2FCMA 3L08A 1G6JA 1WYWB 5LXIB 2M17A 1P3QU 2L3ZA 3N3KB 2KJ6A 4ZYNA 2K8HA 2XEWA 4NJ6A 4B9KA 2N7EA 2GBKA 2O6VB 3PLUA 3V6EB 4BKSA 5CTRC 3EC8A 3EHVA 3DQVA 1E8YA 2D10A 3QX1A 2DYMA 2FCSA 3DBSA 2L76A 2KQ7A 3ML9A 4JQWC 2GBMA 3ZRFA 4IM3A 4G3XB 2ZNVB 2D07B 4GSWA 3AI5A 2IY0B 3OAWA 1WGGA 4NAWB 2ZJDA 4XX5A 2KK8A 2KNBA 4IUMB 3VTVA 3WIMA 3TCAA 3DBRI 3KUZA 1WR6E 4NAWA 1WJUA 2W9NA 3ZNGC 1NBFC 2CS4A 4LDTB 4EZJA 3AU4A 2WDTB 3MHSD 3VFKA 3ZNZB 2D3GA 2LWPA 4MGYE 3P2BA 2MBQA 1WXVA 4MM3A 2A5UA 4E74A 2MA9B 3PHXB 4MSQB 4DXAB 2K39A 3PLVA 4IM2A 2KD0A 3M63B 1KOTA 4I6LB 3EECA 1OGWA 3H7PB 3OLMD 3VTUA 3ZNHB 4TQ1A 1ISNA 3TIXA 3APDA 4J6IA 5DPSA 4W9CA 4FJYA 4OVUA 1WR1A 3H7PA 2KFJA 4EZKA 4M8NA 3UQAA 1NI2A 1OTRB 3DOWA 3UIPB 1C1YB 4ZRKA 3VAWA 1GNUA 3PTFC 3A9JB 1KJTA 3CMMB 2N9PC 1K8RB 4W9IA 2KOXA 1VCBA 2MBEA 4MJSA 3A9JA 3TBLD 3DVGX 1NDDA 4NQLB 1M94A 3U30A 1T0YA 2Z0EB 4A3PA 4BBNC 2KJHB 4AP4C 5CHVC 1R4NI 2KO3A 3DCGA 3RT3B 2MBBB 3M95A 1R4MI 3CF6E 3HIZA 3QWZB 2AYOB 3IHPC 3QARA 1LQBA 2FAZA 2Y5BB 4N9F4 5DPTA 1WXMA 1WX9A 3CSTA 4II3B 1WH3A 2PE9A 3AXCA 2KX0A 4BOSC 2IO3B 3JSVB 4MGZE 4MH0E 5E6OA 3LDZE 5LXHA 4F7ZA 1ZW7A 2NBVB 3PS6A 4NPNA 3SU8X 2KLGA 2LXAA 4BBNF 2NPTB 4URKA 4AUQC 4FJVB 1SGHA 1L7YA 3DDCB 5FR6A 5L95C 3ALBA 1E5WA 2JVCA 3HM6X 2NPTA 2BF8B 3B1LX 4M0WB 4KZCA 1IYFA 4MGIE 3WAPA 1I42A 3C0RB 2KDBA 4GU2A 4XZ4A 1UD7A 5JHBA 4KDLB 2AEHA 1YX5B 2LVQA 2O2VA 4NNJB 1P98A 1WJ6A 4FA6A 2CHWA 1RFAA 3NS8A 2NBUA 1YIWA 5EDSA 1Q0WB 2MQJA 2I1JA 4W9LA 5E6NA 2RSUA 2L0FA 2LUEA 1E90A 1V2YA 3ECIA 2AL6A 3AULA 5JHAA 2DZIA 2YLMA 4MSMB 4HCPB 3NY5A 1E8XA 2OOBB 4BFRA 4BKSD 2NBWB 4IW0A 1YQBA 3VH3B 1J0GA 2BKFA 4FN2A 2LJ5A 2MRPA 3L54A 3R3MA 2R2QA 2VRRB 3VUYA 4F1SA 1TGZB 5BO4B 3WAMA 3APFA 3OJ3A 2JT4B 3RUIB 1WZ3A 3DBLI 4GMVA 4W9KA 2DAFA 4FHJA 2KTRA 2LRWA 4GIVA 4W9HA 1GJZA 1XQQA 2G45B 3QHTA 2KWVB 4KSLC 5E6PA 1WX8A 3K9PB 3QC8B 1YJ1A 4HXDA 3V60A 1BT0A
chains in the Genus database with same CATH superfamily
5IA7A 1H8CA 2D2QA 2FUHB 2AL3A 2QSDA 1TBEA 1ROEA 3RYTA 2AWTA 4B95A 3MC8A 3H6NA 2WDRB 4A55A 2AQ2B 4ICVA 4JWUC 3SFDB 2XBBC 2ZVOA 3PSEB 3J9CA 4K81A 2WLBA 3AU5A 1R4MB 2LUMA 1IBXA 2XNAC 5DPRA 4WQOB 5BYQA 1LXDA 1GOZA 3AV8A 1GG3A 4KGRA 4DHZE 2LXCA 3P4PB 1MHHE 1ZKHA 2BVCA 3H7SA 2RDBC 4DHZB 2HJ8A 2EMTA 3PO0A 3C8YA 4LNIA 1XD3B 3BK1A 2V9HA 1YD8U 2K8CA 1WXAA 4IG7B 2KWCA 2BS3B 3SEBA 1UUPA 3H9DA 4RF0A 1F52A 2ZW1A 2IBIB 2FCQA 2W54A 2K3UA 1UNSA 4IWQA 1YJIA 3IBEA 2GLSA 2X8XX 1ZUD2 2MBOA 3ZTDA 1S1QB 4HJKA 3Q8CA 2YVCA 1EM7A 3P1MA 2BYTA 3PV1A 2DX5B 3BK2A 1F1HA 1JCKB 4JLCA 2DBYA 3KQ4A 2ZZPB 1EF5A 3FC4A 4GGQA 2GOWA 2RD0A 2UWQA 1J7CA 1LFDA 2E6XA 4CO7A 4ZHOA 3R2IA 2Z59B 3DBLB 2KFKA 5EE9A 2DNFA 1XT9B 2G9HD 1T5XD 2MSED 3PZ7A 3ML8A 3FILA 3W1YA 5G55A 3RD2A 1SEBD 4AJYB 1C3TA 3WAOA 3U7DA 1WE7A 2CKHB 3HUIA 2KTRB 3PZDA 5C2TB 3NZSA 2LZ6A 4HWIB 4IM0A 3WA0A 3TUOA 2ZNVC 4MELA 2WNMA 3R7RA 1E7PB 2W3SA 3VUXA 3P4SB 4ITKA 4AJWA 3GOEA 4OZBA 3HHMA 3AE9B 2FUG1 2ZEQA 1J19A 3A1QA 4OW0A 5BMHA 1F2RI 3C19A 1WSPA 1EO6A 4KGSA 3OJ4B 4MH8A 3P4RB 2O6VA 3R7QA 4RFBA 3BVMA 3VXWA 1FXAA 5AEKB 4USAA 1TIFA 5IAAC 1WIAA 3Q3NC 4YXDB 1MI0A 3ZIMA 2IZVB 3U52E 1IUEA 3RPFC 4ICUA 2Y5PA 4I6NB 1T6BX 3HK0A 4JIOU 4G50A 3A9KB 1DYQA 3NVWA 3PGEA 3AE7B 2MJDA 1P7EA 2FIDA 1OEYJ 2JF5A 4XYCA 3KLSX 2YEPB 1I35A 3PPAA 2B3AA 3PRZA 4ANUA 3ZJVA 1TTNA 3RNCC 3RCZA 2HE7A 2MW5A 4JL9A 3MJ5A 1HXYD 2BYEA 1GUAB 3I5JC 4DDGD 3W2DA 2KDFB 4REZA 1VZ6A 2C60A 1XCQL 2Z8LA 1SB3C 4B6WA 2FNJB 2M4NA 5BMIA 1Q1OA 2V3PA 5D2MB 3NVYA 3DHGC 4BVUC 2AQ3B 3R2TA 4NY0A 2ZW0A 2GRIA 1EWYC 4MEMA 2JRHA 3HM3A 4MDKE 2JQRB 3ZDMC 2RGFA 2G3QB 5G5HA 1WMHB 2ZPNA 2AX5A 3ZRCA 4GXBA 3PRMB 1PGAA 4EUTA 4MACA 4LNNA 2QILA 4ZHPA 3UGBB 2L8JA 4PYZA 4BOZB 1WGYA 3B9JA 4A3OA 4CYEA 1TKYA 3N30A 1AW7A 1V49A 2CJNA 1JRUA 2INPE 2MJ3A 3QJZA 4KIKA 4TUUA 2I2YA 2N1VA 3TL5A 3CSFA 4PS7A 3AEDB 3N9YC 3AH7A 3GB1A 1N61A 4DQOC 3VQIA 1EUVB 2FIFA 1GAQB 1QKZA 1FXIA 1G6JA 1N62A 3Q14C 2K22A 1P3QU 3N3KB 4ZYNA 2QDFA 1FD6A 2GBKA 3V6EB 1E8YA 2D10A 5IO9A 2FCSA 2JX5A 4JQWC 3AEEB 3AI5A 1WGGA 4IUMB 2KNBA 1SBBB 4LTUA 1WJUA 2W9NA 2WDTB 3MHSD 3VFKA 2D3GA 2LWPA 1PDXA 4HKQA 4OZCA 4NAMA 2QEJC 3ZGZA 4MM3A 4KGTA 2A5UA 2KDMA 2KD0A 1N5XA 3M63B 1VRAB 2L83A 4I6LB 3EECA 3ZNHB 1XLQA 3APDA 1WR1A 4S17A 4EZKA 1OTRB 3UIPB 1GNUA 3A9JB 1K8RB 1FMAD 4W9IA 2KOXA 3AE8B 2WXLA 2MBEA 1JRPA 2IPKD 1M94A 4AP4C 1RFKA 2V3NA 3EA6A 1R4MI 3CF6E 3KWLA 2AQ1B 3QWZB 3QARA 1LQBA 5DPTA 3CSTA 4II3B 3AXCA 2IO3B 3IAM1 4FXCA 1L0VB 1C9FA 4XWTA 4F7ZA 2LXAA 1L7YA 4LK0M 1XEEA 2BF8B 4MGIE 1TS4A 3C0RB 1B9RA 4J3OD 2DWQA 4GU2A 4XZ4A 5JHBA 1BXTA 3U4EG 2W55A 4KDLB 2M0AA 1XCTL 3EUB2 1P98A 4FA6A 1QILA 3NJTA 1CQVA 3IT6B 2JYEA 1WWTA 3NZ3A 1QQRA 2L0FA 5IKCM 3FAHA 2JSVX 4HCPB 3NY5A 4BAXA 3DHIC 1YQBA 2ON8A 2LJ5A 3R3MA 2R2QA 4F1SA 2QMTA 1TGZB 2GI9A 2JZPA 1L0XB 2JT4B 3ZYYX 2NTSA 3RUIB 1N63A 3DBLI 4C4VB 2KVZA 1CZPA 2KTRA 1K51A 3PZ8A 3V3XA 1XQQA 1HQRD 1HTQA 3VRBB 4HXDA 3V60A 4X57B 4FULA 3ONSA 4LDTD 2HTHA 4IWOA 2LHEA 2M1MA 1AYFA 1UGJA 2DZJA 3VHTC 4CQNA 3HVDA 2OHFA 2BPSA 3RZWC 4JE3B 4YSZB 2M0XA 2UYZB 2M56B 2KKCA 3IVFA 3ZW3A 1WXQA 4PS3A 1N6ZA 5BYSA 2GMIC 1WGHA 1R4NB 2JZ3B 3A33B 1L4ZB 4N6EB 4TSSA 1E0ZA 2B76B 4BKTA 2D3CA 3L17A 4GLSC 3PHWB 4MJSB 2RDHA 1DOYA 1Z2MA 3A9KA 2TSSA 4XC2A 2K6QA 2LGDA 1OQYA 2BT6A 2K8BA 2L00B 2KWDA 3MJWA 4DWFA 3B2FA 3T3OA 1N60A 4LNFA 3T8MA 5HKHA 2DLBA 3WCQA 4K1RB 4ACFA 3K9OB 2KDEB 2Z0DB 2DZKA 1RLFA 2BGFA 4TMAB 1V1PB 4HPMB 5FR3A 3HRDD 2J42A 2LGXA 2GBNA 4GDKB 5G2NA 1WZ0A 3ZQ4A 1DGJA 2VZKD 5AUKA 5HHDG 4RM8A 4WURA 2K9XA 2N7DA 4HDOA 4DDID 1MHXA 1P1AA 5DCNA 2N0SB 1TKGA 1WGRA 1F9JA 2INDC 3IFWB 3I63C 2VZKB 1YN4A 1GB4A 4ARIA 2BWFA 1KLVA 1WMHA 4MT5A 3IG3A 3I3TB 3DVGY 1OQRA 3QIJA 2DHZA 2WYQA 4PS8A 1WXSA 4HDQA 3ZO5B 2D3AA 5L83A 4KVGB 4A20A 3W5VB 4JWSC 3B0AA 3ZJTA 3SHQA 1JMLA 3OWEB 2HD5B 2DAJA 3KW5B 4OHJA 1IGDA 1D4BA 3DVNU 2WXGA 3QAQA 4DXFA 2NR2A 4AWJA 2LVOA 4NZLB 1EF1A 3NZUA 3CWIA 3B08A 3PT2B 1TZOA 2R2OA 2GBRA 3PREA 1Q10A 3RN9C 3RNGC 1I4RA 4FLHA 2DZMA 2LEKA 1KRHA 1F0ZA 2MBHA 4W9EA 2MLBA 1OQQA 3QQ8B 3LYYA 3M62B 3ZDTA 3GZNB 3ABVB 2LVPA 2CHZA 2HDEA 4P7IA 1FXTB 2JRIB 4II2B 3R8BA 1OEYA 1PFDA 2DYBA 4ZRQA 2PE6B 2C7NB 3AE2B 3KUCB 4GDLA 1YQ3B 3ZJUA 1FM0D 1XLNA 3UF8A 1WX7A 1WGDA 1RAXA 2LJIA 2PMVA 1HA5A 1P7FA 5JH5C 4WJQA 1VZ7A 1D3ZA 5KHOA 2CU1A 3BY4B 2FCNA 2IYDB 2KQ4X 4EZLA 5C23A 2RR9A 3VUWA 1EWCA 2XK5A 2MWSB 4O1NA 5MPOA 4EE2A 2RPVA 4G0NB 1IPGA 2L7RA 4KSKC 4WWPA 1RYJA 2JXXA 4W9FA 2ZCCA 1V81A 4YSXB 1F2RC 2QCZA 3Q8EA 1AARA 3ETRA 3MTNB 2ZVNA 2LHDA 2BKRB 4HPLB 3KYDD 3I57A 4WJPA 4LJOB 1J8CA 3SDLC 3NHEB 2PVGC 2MP2B 1UELA 4FADA 3D32A 4LNKA 2KTFA 4TKNA 3X23A 1CMXB 1SIFA 1WI0A 2MCNB 1ZDXA 2LGIA 3IT4B 4L23A 1PYWD 4A90A 1WYWB 4NJ6A 4B9KA 2D5GA 2WU5B 3DQVA 1NYQA 4C4VA 2L76A 2KQ7A 3ZRFA 1FCLA 3OAWA 2ZJDA 1NEKB 2BS4B 3NG0A 2KK8A 1JW9D 3H8HA 3TCAA 1FNUA 4NAWA 4AS1A 4RGOS 3ZNGC 1NBFC 1SJED 4EZJA 5EE0A 1D5MC 4OVZA 4C7YA 3ZNZB 1YOVB 4M01A 3P2BA 1C76A 2MBQA 1PGXA 2K39A 4RGMA 1I4PA 1TS2A 1KOTA 3H7PB 1OGWA 3OLMD 3VTUA 1F77A 4K3CA 1TY0A 4J6IA 4FJYA 4OVUA 2H89B 3T3NA 1C1YB 3VAWA 2MH7A 1CK1A 3PTFC 2J4XA 3CMMB 2N9PC 1PGBA 1VCBA 3AN1A 3NRZA 4MJSA 4L1BA 3U30A 1T0YA 5IOIA 2Z0EB 4BBNC 4XE0A 5CHVC 1R4NI 2KO3A 3DCGA 1UWXA 5TSSA 4MGZE 3Q69A 5E6OA 5LXHA 2XN9C 2WXIA 3PS6A 2KLGA 2NPTB 2WXMA 4URKA 2MJEA 5L95C 2X38A 2KACA 3HM6X 3Q8BA 3B1LX 4KZCA 4RH6A 1IYFA 2KDBA 3BVGA 4ZYSA 4M0WA 1GPXA 1I4GA 3TEWA 4NNJB 2BTEA 1TY2A 1WJ6A 4YWGG 3NS8A 5BMGA 5EDSA 4KKIA 2MQJA 3MC9A 3IXSA 4L2YA 2RSUA 4ARCA 1V2YA 2AL6A 4RGNA 4YTNB 2H88B 2PVOD 4P16A 4BKSD 1FFUA 1XO3A 3BWUD 2WU2B 3L54A 4WWMA 1N5WA 1TS3A 5BO4B 3WAMA 1K53A 2WS3B 5HG2A 2LRWA 3QHTA 4KSLC 1WX8A 1I4QA 3K9PB 3QC8B 4QAYA 1QOAA 5J2RA 1FPYA 5GXGB 3SFEB 2KX3A 1JWMD 4XDDA 3ZTCA 2WX1A 3NOBA 2N9LA 4IC7B 2D3BA 3RFZB 1LM8B 2K25A 2PEAA 1MG4A 1T0QC 3AE6B 3S2AA 4HRSA 1L0YB 2ZCBA 3QK0A 1PUTA 1JWBD 3O65B 4I6PA 1XXGA 1J7AA 2OJWA 4KZ0A 1C77A 4IKGA 2LI5A 1YQ4B 2L0TA 2KC1A 1ACCA 1WYGA 5EE1A 3T9LA 1JALA 3TMPB 3GZNI 1QOFA 1VLBA 4JPSA 3KVFB 5IP4D 3U8ZA 4NJCA 1L6VA 2N1WA 4YTPB 1V6EA 4K3BA 1TT5B 2LGYA 3Q3JA 1FFVA 2PTLA 3ZLZA 4US8A 3RZFA 2KANA 4ZRIA 3VVWB 1UBQA 2BYVE 1WRDB 1SJHD 1SSNA 2KWUB 2EELA 1UGMA 3TEYA 4F8CB 1JQ4A 1YN5A 2N9EB 1DOXA 2WGSA 1PQSA 2JYTA 3NVZA 3FKYA 4LNOA 1WE6A 1TS5A 5C1ZA 2IO1B 1WJNA 4OZAA 4ZRJA 3BZDB 2KVRA 2KFKB 2CHXA 2ICIA 2C7HA 2MHJA 2IY1B 4R3DA 3Q8AA 4WWNA 5JXVA 3FILB 3QA8A 2WQYB 2DYOA 2KMAA 4JX1C 3Q3OC 2NTTA 5G5GA 1ESFA 1KTKA 3Q3MC 4YL8A 1NI3A 2MP2A 3W1SC 2ZPYA 3URYA 1RM6C 3TJPA 1ENFA 4KKJA 1LGRA 3V62A 3A1QB 2G4DB 3ZUNA 2EKEC 1SE9A 1Y8RC 2JWUA 2BBCA 4ANVA 1UH6A 1VJKA 4N58A 4FJZA 4AOFA 4C80A 2PIAA 5FK9C 1SF0A 4K7WA 1TZ1A 4DK5A 2KMCA 1AN8A 3O13A 1K52A 3W1SA 3BVZA 1BMLC 1TKEA 4NJ7A 5CHFA 3UIOB 2LMCA 1SE2A 1U4AA 1ZGUB 5D3IB 1FRRA 3RNAC 3VTWA 5D7GA 3JYUA 3SD5A 4W9DA 1E7UA 1UF0A 2KQSA 1QZEA 3W5UB 4W9JA 2JXTA 4ZOHC 1S3SG 2INCC 2Y3AA 4BKGA 5AZGA 3WANA 1C79A 1OFFA 2KN4A 1JWAD 2N4FA 3Q3FA 1WJ4A 2MX2A 2HTME 2WDVB 5AZHA 3VRAB 5J18A 1K50A 2I38A 2BQQA 3DPDA 3N1ZC 2IJ0A 1YNTE 4ASWC 2RPQA 4DXGA 4JGHB 4WWOA 5E6JA 4E71A 1GC7A 3A4SC 4MGKE 1QOBA 5TR5A 4ZRPA 2LRUA 2JZZA 1MG8A 1SIJA 3OG5A 2KZRA 1I4XA 2WDQB 3EFUA 2NMQA 3APCA 3X0WA 2J7QB 3VDZA 5I4DA 1ZE3D 1Y56A 3ZNID 5J17A 2K6DB 2V1YA 1C78A 3PVLA 1J7BA 1UBIA 1UZXB 4N59A 2SEBD 2IO2B 2C5LC 2HJ1A 4C00A 4HVBA 4DBGA 1FEHA 3EGRA 3ZVVA 1KFYB 2V3SA 2N9KA 3KYCD 1FNVA 4P1CC 3N20C 4KIKB 3GP7A 4PYUA 2W3RA 3E56A 2DENB 3P42A 2I1KA 1KH0A 4HPPA 1WM3A 3LXFA 1L6UA 2BWES 2M8SA 2WXKA 3L08A 2FCMA 2WXJA 1JWSD 5LXIB 2M17A 1BUIC 2KJ6A 3AEFB 2FBWB 2N7EA 4BKSA 3EC8A 3EHVA 3KWVA 1CJEA 2DYMA 4G3XB 4XX5A 3DBHB 4A6QA 4WH4A 3KUZA 1WR6E 2IDYA 3RNEC 2CS4A 2L32A 3AU4A 1VDVA 4MM3B 1E9MA 1WXVA 1DOIA 2J53A 3NVVA 4E74A 3PHXB 4MSQB 4HEA1 4IM2A 1ISNA 5IN7A 3TIXA 3UQAA 1VZ8A 3AEBB 3Q6BA 2LGSA 3AE4B 4HKZE 1WGKA 2VH1A 5AUIA 3A9JA 3TEXA 3DVGX 1NDDA 2MEKA 1MVKA 2ACZB 3DWMA 2MBBB 3M95A 1WRIA 1KLUD 3IHPC 2FAZA 2Y5BB 1WXMA 2KX0A 4BOSC 3JSVB 4WIPA 2UU7A 4NPNA 3SU8X 1NVID 4YTMB 4FJVB 1SGHA 3DDCB 5FR6A 3ALBA 1ZPSA 4PK1A 3P4QB 1ZXIA 1YX5B 2LVQA 2WHIA 1T3QA 1KLGD 1D5XC 2NBUA 1YIWA 2WXNA 1Q0WB 2I1JA 4W9LA 5E6NA 2LUEA 3ECIA 3U2SC 5JHAA 3TSSA 1ZOYB 4KX6B 4M00A 4YSYB 3E9SA 2DZIA 2YLMA 4MSMB 2OOBB 2NBWB 3VH3B 2BKFA 4FN2A 2MRPA 3VUYA 3MHZA 1HZ5A 2IGDA 3APFA 1E6EB 1HZ6A 1TJEA 1ZXHA 3ZXVA 3DBRB 1WZ3A 3BYYB 2RMMA 4B0EA 3TEZA 3BYTB 4HROA 3MFGA 1BT0A 2KAJA 1YX6B 5D94A 1ET9A 4GB9A 2D11A 3AECB 2WXRA 3L0WB 1SXTA 1UWMA 4NQKE 2J0MA 1FCCC 4WJNA 1WY8A 4KV2A 2PKOA 2PLPA 3UINB 1FO4A 1YN3A 2WWZA 5H92C 2SAKA 5H8YE 2KLCA 2WX0A 1NENB 4RNAA 3N1YC 3VR9B 2YEPF 4K7UA 4CHKA 4FBJB 3IAS1 1HE8A 4FHKA 2WXFA 3UI3A 2V0GA 3ZKJC 2JUOA 2OJRA 1I4HA 2KJRA 1GC6A 3ZXRA 1C4CA 4KDIC 2L52A 3QCAA 3JW0X 3BIID 2KDIA 1Z5SB 4HK2A 4TV3A 2KYWA 2J0KA 3H1UA 1SE4A 4K7SA 4W9GA 2PW9A 2GBJA 4M8MA 1V5TA 1T0RC 1VD2A 1B1ZA 1Q5WB 3R66C 5DPWA 2QIEB 3Q8FA 2NS5A 1RWSA 3RMKC 4LCDE 3RI7C 2O2VB 1V86A 3AEGB 1V1PA 4EOYA 2V4LA 2JY6A 3M3JA 1L5PA 4GDKA 2PPHA 1KM7A 2A4ZA 1WFYA 3DVNV 5CX3A 1EU4A 1WM2A 4ANWA 2KXJA 4LJPB 1P0RA 2V4IB 3I9V1 1H4RA 1SE3A 3UQBA 1L2NA 2EKIA 3AE3B 4RF1A 4WAAA 3RNFC 4C56C 4GOCA 2N9XA 2C9WB 3KH0A 3A4RA 2G4SA 4M02A 4HCNB 2CJOA 4G11A 1V5OA 5JZEB 5EE3A 4TQ0A 1QOGA 2KC2A 2LASA 2KMMA 4UDUC 1M4VA 3JVZX 5HFYA 1T0SC 3HVZA 4XDCA 2IGHA 5LLIA 1E7VA 2KT7A 4H2AA 2W82A 1HTOA 4ANXA 4DHJD 3BINA 2QHOA 3AM9A 1I7HA 2J52A 3AMZA 4DHJB 3WALA 2BYFA 1NYRA 1IBXB 2NCNA 1V80A 1IP9A 1JROA 2J0JA 1MJDA 4GDLB 4IWPA 1E10A 3PRPB 4HLEA 4RM9A 1E8WA 3AEAB 1E8ZA 3DBHI 3V6CB 4ZDVA 1FIQA 4HJGE 3NS1A 4GN1A 5GMVA 2NVUI 4A8XC 2K1FA 2L05A 5LNK1 1L4DB 2JWZA 2XK5B 1V1OA 5CHWA 4WJOA 3L13A 3U7ZA 2JPHA 3LJ3A 2JU6X 3VH4B 4E3CA 3NUHB 2LD9A 1WF9A 4OVVA 1V9JA 2C7MB 2IO0B 1R7SA 5KHQA 3GS2A 1V97A 4EKUA 1D5ZC 2WP9B 4B0MA 3LB8C 3JSVA 1TYGB 2PJHA 4IDIA 2WXQA 3N32A 4P6VF 3MP9A 2GB1A 4Q2JA 1XLOA 2EMSA 3ENEA 1C4AA 2ASQA 5C3JB 1D6EC 3KUDB 4EEWA 2E3TA 5D6JB 3L10B 2REXA 2R61A 5T8IA 3RULA 5BYRA 2WXPA 5AZFA 4EFOA 2BB6A 2KHWB 2BB5A 2CR5A 2G1EA 3L16A 1RRBA 1YJJA 1X1MA 2ONQA 3V61A 2WXHA 2KN5A 1P9DU 1A5RA 4RMAA 1STEA 2O6VD 2K5PA 4RCOA 2OEDA 3V05A 2L3ZA 3VR8B 2K8HA 2XEWA 3CIRB 2O6VB 4WAFA 3PLUA 2BS2B 5CTRC 3AE1B 1AWDA 3QX1A 1GB1A 3DBSA 3P63A 3ML9A 4IOIE 2GBMA 2Y5CA 1QT9A 4IM3A 1VR9A 1XF5L 2ZNVB 2D07B 4GSWA 2IY0B 4NAWB 1HEZE 3WIMA 2QC8A 3B2GA 3VTVA 3DBRI 5D3DA 3L4PA 3AB5A 4LDTB 4MGYE 5HI1A 4BZAA 4P1BC 2MA9B 2INNE 2Q5WD 4DXAB 3PLVA 2LFIA 3RNBC 4TQ1A 1FNWA 4D2KA 5DPSA 4W9CA 4LLGM 3H7PA 2KFJA 4XWWA 4M8NA 1NI2A 3GE8C 3DOWA 1MFWA 4ZRKA 3AE5B 4S0RA 1KJTA 4AQ7A 1IGCA 3TBLD 4WQMA 4NQLB 4US9A 4A3PA 1QLBB 2KJHB 1FRDA 1QF6A 3RT3B 1LO5D 3HIZA 4RGTA 2AYOB 3Q2AC 4N9F4 1WX9A 2RDGA 1WH3A 2PE9A 2WXOA 1C4PA 4MH0E 4C7ZA 3LDZE 1EU3A 1ZW7A 2NBVB 3SR6A 2L1AA 4BBNF 4AUQC 3N1XC 2M19A 1E5WA 2JVCA 4M0WB 2NPTA 3WAPA 1I42A 2VH2A 1A70A 4YT0B 1UD7A 2K0PA 1XLPA 2AEHA 2O2VA 4XGAB 2CU3A 2CHWA 3EFCA 1RFAA 1JWUD 3GE3C 3W9CB 3DWGC 1E90A 3AULA 5FKAC 1ZDVA 3MC0B 1E8XA 2N7JA 2QJLA 4BFRA 4IW0A 1ZP0B 2BW2A 1J0GA 2VRRB 3DHHC 3OJ3A 2IGGA 1V8CA 2FE8A 1YMHE 4GMVA 4W9KA 2DAFA 4FHJA 4GIVA 4W9HA 1GJZA 2G45B 2KWVB 4PT5A 4A9AA 5E6PA 1ET6A 1MPEA 1KF6B 1YJ1A
chains in the Genus database with same CATH topology
5J2RA 1YX6B 4X57B 5IA7A 4FULA 3ONSA 5D94A 1H8CA 4LDTD 2D2QA 2FUHB 2HTHA 4IWOA 2KX3A 2AL3A 4GB9A 2D11A 2M1MA 3L0WB 3ZTCA 2DZJA 3VHTC 2WX1A 3NOBA 4NQKE 2J0MA 1TBEA 4IC7B 1LM8B 2K25A 2PEAA 1WY8A 4WJNA 4KV2A 2BPSA 3RYTA 3S2AA 2AWTA 3RZWC 4B95A 3H6NA 2ZCBA 3UINB 3QK0A 2M0XA 3O65B 2UYZB 2WWZA 2KKCA 3IVFA 3ZW3A 4PS3A 4I6PA 4ICVA 2KLCA 2WX0A 4KZ0A 2GMIC 2LI5A 2XBBC 1WGHA 2ZVOA 3PSEB 4K7UA 3A33B 2JZ3B 2L0TA 4K81A 2KC1A 3AU5A 1KLVA 4CHKA 4FBJB 4BKTA 1HE8A 4FHKA 3T9LA 3TMPB 3L17A 5DPRA 3PHWB 4WQOB 4MJSB 3ZKJC 1LXDA 3GZNI 2JUOA 2OJRA 1Z2MA 3KVFB 2KJRA 1GC6A 1GG3A 4DHZE 3A9KA 4KDIC 2LXCA 3QCAA 3U8ZA 4XC2A 2K6QA 3JW0X 2KDIA 2LGDA 1Z5SB 1ZKHA 3H7SA 4HK2A 4TV3A 1OQYA 2J0KA 2K8BA 4DHZB 3H1UA 2L00B 4K7SA 2HJ8A 2EMTA 2N1WA 4W9GA 1XD3B 3MJWA 4DWFA 1V6EA 1YD8U 2K8CA 2GBJA 2LGYA 4M8MA 1WXAA 3Q3JA 4IG7B 2KWCA 1V5TA 1VD2A 3H9DA 1Q5WB 3ZLZA 3T8MA 3RZFA 3R66C 2KANA 5HKHA 5DPWA 4ZRIA 2IBIB 4K1RB 1UBQA 2BYVE 3VVWB 1WRDB 2NS5A 3K9OB 2KDEB 2FCQA 2Z0DB 2KWUB 4LCDE 2DZKA 4IWQA 1RLFA 2BGFA 3IBEA 4HPMB 1UGMA 2O2VB 4F8CB 2LGXA 2MBOA 1V86A 3ZTDA 1S1QB 2N9EB 2GBNA 4GDKB 5G2NA 1WZ0A 4EOYA 4HJKA 2V4LA 2JY6A 3M3JA 1PQSA 2YVCA 4RM8A 2N7DA 4GDKA 2PPHA 4HDOA 4DDID 3PV1A 1P1AA 2DX5B 5DCNA 1WGRA 1WE6A 1F9JA 4JLCA 3IFWB 5C1ZA 2IO1B 2ZZPB 1WJNA 1EF5A 1KM7A 4ZRJA 2A4ZA 4GGQA 1WFYA 2GOWA 2RD0A 2UWQA 3DVNV 2KFKB 2KVRA 1LFDA 2CHXA 2BWFA 2C7HA 1WMHA 5CX3A 1WM2A 4CO7A 3IG3A 3I3TB 2IY1B 3DVGY 3QIJA 2Z59B 4ANWA 2DHZA 2WYQA 4PS8A 2KXJA 4LJPB 1WXSA 2KFKA 1P0RA 4WWNA 1XT9B 3UQBA 1H4RA 4HDQA 2MSED 3ZO5B 1L2NA 3ML8A 3QA8A 5L83A 2DYOA 2KMAA 4KVGB 3W1YA 5G55A 4A20A 3RD2A 4AJYB 4WAAA 1C3TA 3B0AA 3WAOA 3U7DA 1WE7A 2CKHB 2KTRB 3PZDA 3SHQA 3NZSA 2LZ6A 4HWIB 4GOCA 4IM0A 4YL8A 2N9XA 2C9WB 3KH0A 2HD5B 2DAJA 3A4RA 3KW5B 2MP2A 3WA0A 3W1SC 2ZNVC 4MELA 2ZPYA 3R7RA 2G4SA 3DVNU 3QAQA 3VUXA 2NR2A 3TJPA 4AWJA 2LVOA 3V62A 4HCNB 4AJWA 1EF1A 3A1QB 3GOEA 1V5OA 3NZUA 2G4DB 4G11A 3HHMA 3ZUNA 5JZEB 2ZEQA 1J19A 3B08A 2EKEC 3PT2B 4TQ0A 1SE9A 1Y8RC 2R2OA 2KC2A 2GBRA 2LASA 3A1QA 3JVZX 3PREA 1EO6A 3OJ4B 4ANVA 1UH6A 5LLIA 4FLHA 2DZMA 1E7VA 4FJZA 4AOFA 2MBHA 4W9EA 2MLBA 2O6VA 3R7QA 4ANXA 4DHJD 3QQ8B 3BINA 3M62B 3ZDTA 2QHOA 3VXWA 4K7WA 1TZ1A 5AEKB 5IAAC 1WIAA 4DK5A 3ZIMA 2IZVB 2KMCA 4DHJB 3WALA 2BYFA 3W1SA 2LVPA 2CHZA 4P7IA 4ICUA 2NCNA 1FXTB 2JRIB 1V80A 4I6NB 4II2B 3HK0A 4JIOU 4NJ7A 5CHFA 3UIOB 1IP9A 2J0JA 4G50A 3A9KB 1OEYA 3PGEA 1U4AA 1ZGUB 4GDLB 2DYBA 4IWPA 2PE6B 3PRPB 3VTWA 5D7GA 3JYUA 2FIDA 3SD5A 4W9DA 1E7UA 4RM9A 2KQSA 1OEYJ 2C7NB 2JF5A 1E8WA 1QZEA 3KUCB 1E8ZA 3DBHI 4GDLA 3V6CB 4ZDVA 1I35A 3PPAA 2B3AA 3PRZA 4W9JA 4ANUA 1S3SG 1TTNA 4BKGA 5AZGA 3WANA 3UF8A 3RCZA 2N4FA 2HE7A 1WX7A 3Q3FA 4GN1A 1WJ4A 1WGDA 2MX2A 2NVUI 5GMVA 1RAXA 5AZHA 2MW5A 4JL9A 5J18A 2K1FA 2BYEA 1GUAB 3DPDA 5JH5C 4DDGD 4WJQA 2L05A 2JWZA 2KDFB 4ASWC 1D3ZA 2RPQA 5KHOA 2CU1A 2XK5B 4JGHB 4WJOA 4WWOA 2C60A 3BY4B 3L13A 1GC7A 5CHWA 4E71A 3A4SC 4B6WA 2FCNA 2FNJB 2JPHA 4MGKE 2IYDB 2M4NA 5TR5A 3LJ3A 4EZLA 5C23A 3VH4B 1Q1OA 2LRUA 2RR9A 3VUWA 2XK5A 4E3CA 2MWSB 5D2MB 2LD9A 2JZZA 1WF9A 1MG8A 4OVVA 4G0NB 4BVUC 1IPGA 2KZRA 1V9JA 2C7MB 2IO0B 2L7RA 3EFUA 3APCA 4NY0A 4KSKC 5KHQA 4WWPA 4MEMA 2JRHA 3HM3A 4EKUA 4MDKE 2JXXA 4W9FA 3ZDMC 3X0WA 2J7QB 2RGFA 2ZCCA 3VDZA 1V81A 2G3QB 3ZNID 3JSVA 2PJHA 5J17A 3N32A 1WMHB 2ZPNA 3ZRCA 2K6DB 2V1YA 4GXBA 3PRMB 3PVLA 1AARA 2EMSA 3ENEA 1UBIA 1UZXB 2ASQA 3MTNB 4EUTA 3KUDB 2IO2B 2ZVNA 4EEWA 4HLEA 2BKRB 2C5LC 5D6JB 3L10B 4HPLB 3UGBB 4HVBA 4DBGA 2L8JA 4PYZA 3ZVVA 3KYDD 2REXA 4WJPA 2V3SA 3KYCD 4BOZB 4LJOB 1WGYA 1J8CA 3SDLC 4KIKB 3RULA 4A3OA 5AZFA 4EFOA 3NHEB 4CYEA 4PYUA 2MP2B 2KHWB 1UELA 3N30A 4FADA 2CR5A 1V49A 1JRUA 3D32A 4TUUA 3QJZA 2DENB 4KIKA 2N1VA 2KTFA 2I1KA 3L16A 3TL5A 3CSFA 1RRBA 1X1MA 4PS7A 4TKNA 3X23A 1WM3A 1CMXB 1SIFA 1WI0A 3V61A 2MCNB 2BWES 2M8SA 2KN5A 3VQIA 1EUVB 1P9DU 1A5RA 4RMAA 2FIFA 2O6VD 2FCMA 3L08A 1G6JA 1WYWB 5LXIB 2M17A 1P3QU 2L3ZA 3N3KB 2KJ6A 4ZYNA 2K8HA 2XEWA 4NJ6A 4B9KA 2N7EA 2GBKA 2O6VB 3PLUA 3V6EB 4BKSA 5CTRC 3EC8A 3EHVA 3DQVA 1E8YA 2D10A 3QX1A 2DYMA 2FCSA 3DBSA 2L76A 2KQ7A 3ML9A 4JQWC 2GBMA 3ZRFA 4IM3A 4G3XB 2ZNVB 2D07B 4GSWA 3AI5A 2IY0B 3OAWA 1WGGA 4NAWB 2ZJDA 4XX5A 2KK8A 2KNBA 4IUMB 3VTVA 3WIMA 3TCAA 3DBRI 3KUZA 1WR6E 4NAWA 1WJUA 2W9NA 3ZNGC 1NBFC 2CS4A 4LDTB 4EZJA 3AU4A 2WDTB 3MHSD 3VFKA 3ZNZB 2D3GA 2LWPA 4MGYE 3P2BA 2MBQA 1WXVA 4MM3A 2A5UA 4E74A 2MA9B 3PHXB 4MSQB 4DXAB 2K39A 3PLVA 4IM2A 2KD0A 3M63B 1KOTA 4I6LB 3EECA 1OGWA 3H7PB 3OLMD 3VTUA 3ZNHB 4TQ1A 1ISNA 3TIXA 3APDA 4J6IA 5DPSA 4W9CA 4FJYA 4OVUA 1WR1A 3H7PA 2KFJA 4EZKA 4M8NA 3UQAA 1NI2A 1OTRB 3DOWA 3UIPB 1C1YB 4ZRKA 3VAWA 1GNUA 3PTFC 3A9JB 1KJTA 3CMMB 2N9PC 1K8RB 4W9IA 2KOXA 1VCBA 2MBEA 4MJSA 3A9JA 3TBLD 3DVGX 1NDDA 4NQLB 1M94A 3U30A 1T0YA 2Z0EB 4A3PA 4BBNC 2KJHB 4AP4C 5CHVC 1R4NI 2KO3A 3DCGA 3RT3B 2MBBB 3M95A 1R4MI 3CF6E 3HIZA 3QWZB 2AYOB 3IHPC 3QARA 1LQBA 2FAZA 2Y5BB 4N9F4 5DPTA 1WXMA 1WX9A 3CSTA 4II3B 1WH3A 2PE9A 3AXCA 2KX0A 4BOSC 2IO3B 3JSVB 4MGZE 4MH0E 5E6OA 3LDZE 5LXHA 4F7ZA 1ZW7A 2NBVB 3PS6A 4NPNA 3SU8X 2KLGA 2LXAA 4BBNF 2NPTB 4URKA 4AUQC 4FJVB 1SGHA 1L7YA 3DDCB 5FR6A 5L95C 3ALBA 1E5WA 2JVCA 3HM6X 2NPTA 2BF8B 3B1LX 4M0WB 4KZCA 1IYFA 4MGIE 3WAPA 1I42A 3C0RB 2KDBA 4GU2A 4XZ4A 1UD7A 5JHBA 4KDLB 2AEHA 1YX5B 2LVQA 2O2VA 4NNJB 1P98A 1WJ6A 4FA6A 2CHWA 1RFAA 3NS8A 2NBUA 1YIWA 5EDSA 1Q0WB 2MQJA 2I1JA 4W9LA 5E6NA 2RSUA 2L0FA 2LUEA 1E90A 1V2YA 3ECIA 2AL6A 3AULA 5JHAA 2DZIA 2YLMA 4MSMB 4HCPB 3NY5A 1E8XA 2OOBB 4BFRA 4BKSD 2NBWB 4IW0A 1YQBA 3VH3B 1J0GA 2BKFA 4FN2A 2LJ5A 2MRPA 3L54A 3R3MA 2R2QA 2VRRB 3VUYA 4F1SA 1TGZB 5BO4B 3WAMA 3APFA 3OJ3A 2JT4B 3RUIB 1WZ3A 3DBLI 4GMVA 4W9KA 2DAFA 4FHJA 2KTRA 2LRWA 4GIVA 4W9HA 1GJZA 1XQQA 2G45B 3QHTA 2KWVB 4KSLC 5E6PA 1WX8A 3K9PB 3QC8B 1YJ1A 4HXDA 3V60A 1BT0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5J2R A;  1YX6 B;  4X57 B;  5IA7 A;  4FUL A;  3ONS A;  5D94 A;  1H8C A;  4LDT D;  2D2Q A;  2FUH B;  2HTH A;  4IWO A;  2KX3 A;  2AL3 A;  4GB9 A;  2D11 A;  2M1M A;  3L0W B;  3ZTC A;  2DZJ A;  3VHT C;  2WX1 A;  3NOB A;  4NQK E;  2J0M A;  1TBE A;  4IC7 B;  1LM8 B;  2K25 A;  2PEA A;  1WY8 A;  4WJN A;  4KV2 A;  2BPS A;  3RYT A;  3S2A A;  2AWT A;  3RZW C;  4B95 A;  3H6N A;  2ZCB A;  3UIN B;  3QK0 A;  2M0X A;  3O65 B;  2UYZ B;  2WWZ A;  2KKC A;  3IVF A;  3ZW3 A;  4PS3 A;  4I6P A;  4ICV A;  2KLC A;  2WX0 A;  4KZ0 A;  2GMI C;  2LI5 A;  2XBB C;  1WGH A;  2ZVO A;  3PSE B;  4K7U A;  3A33 B;  2JZ3 B;  2L0T A;  4K81 A;  2KC1 A;  3AU5 A;  1KLV A;  4CHK A;  4FBJ B;  4BKT A;  1HE8 A;  4FHK A;  3T9L A;  3TMP B;  3L17 A;  5DPR A;  3PHW B;  4WQO B;  4MJS B;  3ZKJ C;  1LXD A;  3GZN I;  2JUO A;  2OJR A;  1Z2M A;  3KVF B;  2KJR A;  1GC6 A;  1GG3 A;  4DHZ E;  3A9K A;  4KDI C;  2LXC A;  3QCA A;  3U8Z A;  4XC2 A;  2K6Q A;  3JW0 X;  2KDI A;  2LGD A;  1Z5S B;  1ZKH A;  3H7S A;  4HK2 A;  4TV3 A;  1OQY A;  2J0K A;  2K8B A;  4DHZ B;  3H1U A;  2L00 B;  4K7S A;  2HJ8 A;  2EMT A;  2N1W A;  4W9G A;  1XD3 B;  3MJW A;  4DWF A;  1V6E A;  1YD8 U;  2K8C A;  2GBJ A;  2LGY A;  4M8M A;  1WXA A;  3Q3J A;  4IG7 B;  2KWC A;  1V5T A;  1VD2 A;  3H9D A;  1Q5W B;  3ZLZ A;  3T8M A;  3RZF A;  3R66 C;  2KAN A;  5HKH A;  5DPW A;  4ZRI A;  2IBI B;  4K1R B;  1UBQ A;  2BYV E;  3VVW B;  1WRD B;  2NS5 A;  3K9O B;  2KDE B;  2FCQ A;  2Z0D B;  2KWU B;  4LCD E;  2DZK A;  4IWQ A;  1RLF A;  2BGF A;  3IBE A;  4HPM B;  1UGM A;  2O2V B;  4F8C B;  2LGX A;  2MBO A;  1V86 A;  3ZTD A;  1S1Q B;  2N9E B;  2GBN A;  4GDK B;  5G2N A;  1WZ0 A;  4EOY A;  4HJK A;  2V4L A;  2JY6 A;  3M3J A;  1PQS A;  2YVC A;  4RM8 A;  2N7D A;  4GDK A;  2PPH A;  4HDO A;  4DDI D;  3PV1 A;  1P1A A;  2DX5 B;  5DCN A;  1WGR A;  1WE6 A;  1F9J A;  4JLC A;  3IFW B;  5C1Z A;  2IO1 B;  2ZZP B;  1WJN A;  1EF5 A;  1KM7 A;  4ZRJ A;  2A4Z A;  4GGQ A;  1WFY A;  2GOW A;  2RD0 A;  2UWQ A;  3DVN V;  2KFK B;  2KVR A;  1LFD A;  2CHX A;  2BWF A;  2C7H A;  1WMH A;  5CX3 A;  1WM2 A;  4CO7 A;  3IG3 A;  3I3T B;  2IY1 B;  3DVG Y;  3QIJ A;  2Z59 B;  4ANW A;  2DHZ A;  2WYQ A;  4PS8 A;  2KXJ A;  4LJP B;  1WXS A;  2KFK A;  1P0R A;  4WWN A;  1XT9 B;  3UQB A;  1H4R A;  4HDQ A;  2MSE D;  3ZO5 B;  1L2N A;  3ML8 A;  3QA8 A;  5L83 A;  2DYO A;  2KMA A;  4KVG B;  3W1Y A;  5G55 A;  4A20 A;  3RD2 A;  4AJY B;  4WAA A;  1C3T A;  3B0A A;  3WAO A;  3U7D A;  1WE7 A;  2CKH B;  2KTR B;  3PZD A;  3SHQ A;  3NZS A;  2LZ6 A;  4HWI B;  4GOC A;  4IM0 A;  4YL8 A;  2N9X A;  2C9W B;  3KH0 A;  2HD5 B;  2DAJ A;  3A4R A;  3KW5 B;  2MP2 A;  3WA0 A;  3W1S C;  2ZNV C;  4MEL A;  2ZPY A;  3R7R A;  2G4S A;  3DVN U;  3QAQ A;  3VUX A;  2NR2 A;  3TJP A;  4AWJ A;  2LVO A;  3V62 A;  4HCN B;  4AJW A;  1EF1 A;  3A1Q B;  3GOE A;  1V5O A;  3NZU A;  2G4D B;  4G11 A;  3HHM A;  3ZUN A;  5JZE B;  2ZEQ A;  1J19 A;  3B08 A;  2EKE C;  3PT2 B;  4TQ0 A;  1SE9 A;  1Y8R C;  2R2O A;  2KC2 A;  2GBR A;  2LAS A;  3A1Q A;  3JVZ X;  3PRE A;  1EO6 A;  3OJ4 B;  4ANV A;  1UH6 A;  5LLI A;  4FLH A;  2DZM A;  1E7V A;  4FJZ A;  4AOF A;  2MBH A;  4W9E A;  2MLB A;  2O6V A;  3R7Q A;  4ANX A;  4DHJ D;  3QQ8 B;  3BIN A;  3M62 B;  3ZDT A;  2QHO A;  3VXW A;  4K7W A;  1TZ1 A;  5AEK B;  5IAA C;  1WIA A;  4DK5 A;  3ZIM A;  2IZV B;  2KMC A;  4DHJ B;  3WAL A;  2BYF A;  3W1S A;  2LVP A;  2CHZ A;  4P7I A;  4ICU A;  2NCN A;  1FXT B;  2JRI B;  1V80 A;  4I6N B;  4II2 B;  3HK0 A;  4JIO U;  4NJ7 A;  5CHF A;  3UIO B;  1IP9 A;  2J0J A;  4G50 A;  3A9K B;  1OEY A;  3PGE A;  1U4A A;  1ZGU B;  4GDL B;  2DYB A;  4IWP A;  2PE6 B;  3PRP B;  3VTW A;  5D7G A;  3JYU A;  2FID A;  3SD5 A;  4W9D A;  1E7U A;  4RM9 A;  2KQS A;  1OEY J;  2C7N B;  2JF5 A;  1E8W A;  1QZE A;  3KUC B;  1E8Z A;  3DBH I;  4GDL A;  3V6C B;  4ZDV A;  1I35 A;  3PPA A;  2B3A A;  3PRZ A;  4W9J A;  4ANU A;  1S3S G;  1TTN A;  4BKG A;  5AZG A;  3WAN A;  3UF8 A;  3RCZ A;  2N4F A;  2HE7 A;  1WX7 A;  3Q3F A;  4GN1 A;  1WJ4 A;  1WGD A;  2MX2 A;  2NVU I;  5GMV A;  1RAX A;  5AZH A;  2MW5 A;  4JL9 A;  5J18 A;  2K1F A;  2BYE A;  1GUA B;  3DPD A;  5JH5 C;  4DDG D;  4WJQ A;  2L05 A;  2JWZ A;  2KDF B;  4ASW C;  1D3Z A;  2RPQ A;  5KHO A;  2CU1 A;  2XK5 B;  4JGH B;  4WJO A;  4WWO A;  2C60 A;  3BY4 B;  3L13 A;  1GC7 A;  5CHW A;  4E71 A;  3A4S C;  4B6W A;  2FCN A;  2FNJ B;  2JPH A;  4MGK E;  2IYD B;  2M4N A;  5TR5 A;  3LJ3 A;  4EZL A;  5C23 A;  3VH4 B;  1Q1O A;  2LRU A;  2RR9 A;  3VUW A;  2XK5 A;  4E3C A;  2MWS B;  5D2M B;  2LD9 A;  2JZZ A;  1WF9 A;  1MG8 A;  4OVV A;  4G0N B;  4BVU C;  1IPG A;  2KZR A;  1V9J A;  2C7M B;  2IO0 B;  2L7R A;  3EFU A;  3APC A;  4NY0 A;  4KSK C;  5KHQ A;  4WWP A;  4MEM A;  2JRH A;  3HM3 A;  4EKU A;  4MDK E;  2JXX A;  4W9F A;  3ZDM C;  3X0W A;  2J7Q B;  2RGF A;  2ZCC A;  3VDZ A;  1V81 A;  2G3Q B;  3ZNI D;  3JSV A;  2PJH A;  5J17 A;  3N32 A;  1WMH B;  2ZPN A;  3ZRC A;  2K6D B;  2V1Y A;  4GXB A;  3PRM B;  3PVL A;  1AAR A;  2EMS A;  3ENE A;  1UBI A;  1UZX B;  2ASQ A;  3MTN B;  4EUT A;  3KUD B;  2IO2 B;  2ZVN A;  4EEW A;  4HLE A;  2BKR B;  2C5L C;  5D6J B;  3L10 B;  4HPL B;  3UGB B;  4HVB A;  4DBG A;  2L8J A;  4PYZ A;  3ZVV A;  3KYD D;  2REX A;  4WJP A;  2V3S A;  3KYC D;  4BOZ B;  4LJO B;  1WGY A;  1J8C A;  3SDL C;  4KIK B;  3RUL A;  4A3O A;  5AZF A;  4EFO A;  3NHE B;  4CYE A;  4PYU A;  2MP2 B;  2KHW B;  1UEL A;  3N30 A;  4FAD A;  2CR5 A;  1V49 A;  1JRU A;  3D32 A;  4TUU A;  3QJZ A;  2DEN B;  4KIK A;  2N1V A;  2KTF A;  2I1K A;  3L16 A;  3TL5 A;  3CSF A;  1RRB A;  1X1M A;  4PS7 A;  4TKN A;  3X23 A;  1WM3 A;  1CMX B;  1SIF A;  1WI0 A;  3V61 A;  2MCN B;  2BWE S;  2M8S A;  2KN5 A;  3VQI A;  1EUV B;  1P9D U;  1A5R A;  4RMA A;  2FIF A;  2O6V D;  2FCM A;  3L08 A;  1G6J A;  1WYW B;  5LXI B;  2M17 A;  1P3Q U;  2L3Z A;  3N3K B;  2KJ6 A;  4ZYN A;  2K8H A;  2XEW A;  4NJ6 A;  4B9K A;  2N7E A;  2GBK A;  2O6V B;  3PLU A;  3V6E B;  4BKS A;  5CTR C;  3EC8 A;  3EHV A;  3DQV A;  1E8Y A;  2D10 A;  3QX1 A;  2DYM A;  2FCS A;  3DBS A;  2L76 A;  2KQ7 A;  3ML9 A;  4JQW C;  2GBM A;  3ZRF A;  4IM3 A;  4G3X B;  2ZNV B;  2D07 B;  4GSW A;  3AI5 A;  2IY0 B;  3OAW A;  1WGG A;  4NAW B;  2ZJD A;  4XX5 A;  2KK8 A;  2KNB A;  4IUM B;  3VTV A;  3WIM A;  3TCA A;  3DBR I;  3KUZ A;  1WR6 E;  4NAW A;  1WJU A;  2W9N A;  3ZNG C;  1NBF C;  2CS4 A;  4LDT B;  4EZJ A;  3AU4 A;  2WDT B;  3MHS D;  3VFK A;  3ZNZ B;  2D3G A;  2LWP A;  4MGY E;  3P2B A;  2MBQ A;  1WXV A;  4MM3 A;  2A5U A;  4E74 A;  2MA9 B;  3PHX B;  4MSQ B;  4DXA B;  2K39 A;  3PLV A;  4IM2 A;  2KD0 A;  3M63 B;  1KOT A;  4I6L B;  3EEC A;  1OGW A;  3H7P B;  3OLM D;  3VTU A;  3ZNH B;  4TQ1 A;  1ISN A;  3TIX A;  3APD A;  4J6I A;  5DPS A;  4W9C A;  4FJY A;  4OVU A;  1WR1 A;  3H7P A;  2KFJ A;  4EZK A;  4M8N A;  3UQA A;  1NI2 A;  1OTR B;  3DOW A;  3UIP B;  1C1Y B;  4ZRK A;  3VAW A;  1GNU A;  3PTF C;  3A9J B;  1KJT A;  3CMM B;  2N9P C;  1K8R B;  4W9I A;  2KOX A;  1VCB A;  2MBE A;  4MJS A;  3A9J A;  3TBL D;  3DVG X;  1NDD A;  4NQL B;  1M94 A;  3U30 A;  1T0Y A;  2Z0E B;  4A3P A;  4BBN C;  2KJH B;  4AP4 C;  5CHV C;  1R4N I;  2KO3 A;  3DCG A;  3RT3 B;  2MBB B;  3M95 A;  1R4M I;  3CF6 E;  3HIZ A;  3QWZ B;  2AYO B;  3IHP C;  3QAR A;  1LQB A;  2FAZ A;  2Y5B B;  4N9F 4;  5DPT A;  1WXM A;  1WX9 A;  3CST A;  4II3 B;  1WH3 A;  2PE9 A;  3AXC A;  2KX0 A;  4BOS C;  2IO3 B;  3JSV B;  4MGZ E;  4MH0 E;  5E6O A;  3LDZ E;  5LXH A;  4F7Z A;  1ZW7 A;  2NBV B;  3PS6 A;  4NPN A;  3SU8 X;  2KLG A;  2LXA A;  4BBN F;  2NPT B;  4URK A;  4AUQ C;  4FJV B;  1SGH A;  1L7Y A;  3DDC B;  5FR6 A;  5L95 C;  3ALB A;  1E5W A;  2JVC A;  3HM6 X;  2NPT A;  2BF8 B;  3B1L X;  4M0W B;  4KZC A;  1IYF A;  4MGI E;  3WAP A;  1I42 A;  3C0R B;  2KDB A;  4GU2 A;  4XZ4 A;  1UD7 A;  5JHB A;  4KDL B;  2AEH A;  1YX5 B;  2LVQ A;  2O2V A;  4NNJ B;  1P98 A;  1WJ6 A;  4FA6 A;  2CHW A;  1RFA A;  3NS8 A;  2NBU A;  1YIW A;  5EDS A;  1Q0W B;  2MQJ A;  2I1J A;  4W9L A;  5E6N A;  2RSU A;  2L0F A;  2LUE A;  1E90 A;  1V2Y A;  3ECI A;  2AL6 A;  3AUL A;  5JHA A;  2DZI A;  2YLM A;  4MSM B;  4HCP B;  3NY5 A;  1E8X A;  2OOB B;  4BFR A;  4BKS D;  2NBW B;  4IW0 A;  1YQB A;  3VH3 B;  1J0G A;  2BKF A;  4FN2 A;  2LJ5 A;  2MRP A;  3L54 A;  3R3M A;  2R2Q A;  2VRR B;  3VUY A;  4F1S A;  1TGZ B;  5BO4 B;  3WAM A;  3APF A;  3OJ3 A;  2JT4 B;  3RUI B;  1WZ3 A;  3DBL I;  4GMV A;  4W9K A;  2DAF A;  4FHJ A;  2KTR A;  2LRW A;  4GIV A;  4W9H A;  1GJZ A;  1XQQ A;  2G45 B;  3QHT A;  2KWV B;  4KSL C;  5E6P A;  1WX8 A;  3K9P B;  3QC8 B;  1YJ1 A;  4HXD A;  3V60 A;  1BT0 A; 
#chains in the Genus database with same CATH topology
 5IA7 A;  1H8C A;  2D2Q A;  2FUH B;  2AL3 A;  2QSD A;  1TBE A;  1ROE A;  3RYT A;  2AWT A;  4B95 A;  3MC8 A;  3H6N A;  2WDR B;  4A55 A;  2AQ2 B;  4ICV A;  4JWU C;  3SFD B;  2XBB C;  2ZVO A;  3PSE B;  3J9C A;  4K81 A;  2WLB A;  3AU5 A;  1R4M B;  2LUM A;  1IBX A;  2XNA C;  5DPR A;  4WQO B;  5BYQ A;  1LXD A;  1GOZ A;  3AV8 A;  1GG3 A;  4KGR A;  4DHZ E;  2LXC A;  3P4P B;  1MHH E;  1ZKH A;  2BVC A;  3H7S A;  2RDB C;  4DHZ B;  2HJ8 A;  2EMT A;  3PO0 A;  3C8Y A;  4LNI A;  1XD3 B;  3BK1 A;  2V9H A;  1YD8 U;  2K8C A;  1WXA A;  4IG7 B;  2KWC A;  2BS3 B;  3SEB A;  1UUP A;  3H9D A;  4RF0 A;  1F52 A;  2ZW1 A;  2IBI B;  2FCQ A;  2W54 A;  2K3U A;  1UNS A;  4IWQ A;  1YJI A;  3IBE A;  2GLS A;  2X8X X;  1ZUD 2;  2MBO A;  3ZTD A;  1S1Q B;  4HJK A;  3Q8C A;  2YVC A;  1EM7 A;  3P1M A;  2BYT A;  3PV1 A;  2DX5 B;  3BK2 A;  1F1H A;  1JCK B;  4JLC A;  2DBY A;  3KQ4 A;  2ZZP B;  1EF5 A;  3FC4 A;  4GGQ A;  2GOW A;  2RD0 A;  2UWQ A;  1J7C A;  1LFD A;  2E6X A;  4CO7 A;  4ZHO A;  3R2I A;  2Z59 B;  3DBL B;  2KFK A;  5EE9 A;  2DNF A;  1XT9 B;  2G9H D;  1T5X D;  2MSE D;  3PZ7 A;  3ML8 A;  3FIL A;  3W1Y A;  5G55 A;  3RD2 A;  1SEB D;  4AJY B;  1C3T A;  3WAO A;  3U7D A;  1WE7 A;  2CKH B;  3HUI A;  2KTR B;  3PZD A;  5C2T B;  3NZS A;  2LZ6 A;  4HWI B;  4IM0 A;  3WA0 A;  3TUO A;  2ZNV C;  4MEL A;  2WNM A;  3R7R A;  1E7P B;  2W3S A;  3VUX A;  3P4S B;  4ITK A;  4AJW A;  3GOE A;  4OZB A;  3HHM A;  3AE9 B;  2FUG 1;  2ZEQ A;  1J19 A;  3A1Q A;  4OW0 A;  5BMH A;  1F2R I;  3C19 A;  1WSP A;  1EO6 A;  4KGS A;  3OJ4 B;  4MH8 A;  3P4R B;  2O6V A;  3R7Q A;  4RFB A;  3BVM A;  3VXW A;  1FXA A;  5AEK B;  4USA A;  1TIF A;  5IAA C;  1WIA A;  3Q3N C;  4YXD B;  1MI0 A;  3ZIM A;  2IZV B;  3U52 E;  1IUE A;  3RPF C;  4ICU A;  2Y5P A;  4I6N B;  1T6B X;  3HK0 A;  4JIO U;  4G50 A;  3A9K B;  1DYQ A;  3NVW A;  3PGE A;  3AE7 B;  2MJD A;  1P7E A;  2FID A;  1OEY J;  2JF5 A;  4XYC A;  3KLS X;  2YEP B;  1I35 A;  3PPA A;  2B3A A;  3PRZ A;  4ANU A;  3ZJV A;  1TTN A;  3RNC C;  3RCZ A;  2HE7 A;  2MW5 A;  4JL9 A;  3MJ5 A;  1HXY D;  2BYE A;  1GUA B;  3I5J C;  4DDG D;  3W2D A;  2KDF B;  4REZ A;  1VZ6 A;  2C60 A;  1XCQ L;  2Z8L A;  1SB3 C;  4B6W A;  2FNJ B;  2M4N A;  5BMI A;  1Q1O A;  2V3P A;  5D2M B;  3NVY A;  3DHG C;  4BVU C;  2AQ3 B;  3R2T A;  4NY0 A;  2ZW0 A;  2GRI A;  1EWY C;  4MEM A;  2JRH A;  3HM3 A;  4MDK E;  2JQR B;  3ZDM C;  2RGF A;  2G3Q B;  5G5H A;  1WMH B;  2ZPN A;  2AX5 A;  3ZRC A;  4GXB A;  3PRM B;  1PGA A;  4EUT A;  4MAC A;  4LNN A;  2QIL A;  4ZHP A;  3UGB B;  2L8J A;  4PYZ A;  4BOZ B;  1WGY A;  3B9J A;  4A3O A;  4CYE A;  1TKY A;  3N30 A;  1AW7 A;  1V49 A;  2CJN A;  1JRU A;  2INP E;  2MJ3 A;  3QJZ A;  4KIK A;  4TUU A;  2I2Y A;  2N1V A;  3TL5 A;  3CSF A;  4PS7 A;  3AED B;  3N9Y C;  3AH7 A;  3GB1 A;  1N61 A;  4DQO C;  3VQI A;  1EUV B;  2FIF A;  1GAQ B;  1QKZ A;  1FXI A;  1G6J A;  1N62 A;  3Q14 C;  2K22 A;  1P3Q U;  3N3K B;  4ZYN A;  2QDF A;  1FD6 A;  2GBK A;  3V6E B;  1E8Y A;  2D10 A;  5IO9 A;  2FCS A;  2JX5 A;  4JQW C;  3AEE B;  3AI5 A;  1WGG A;  4IUM B;  2KNB A;  1SBB B;  4LTU A;  1WJU A;  2W9N A;  2WDT B;  3MHS D;  3VFK A;  2D3G A;  2LWP A;  1PDX A;  4HKQ A;  4OZC A;  4NAM A;  2QEJ C;  3ZGZ A;  4MM3 A;  4KGT A;  2A5U A;  2KDM A;  2KD0 A;  1N5X A;  3M63 B;  1VRA B;  2L83 A;  4I6L B;  3EEC A;  3ZNH B;  1XLQ A;  3APD A;  1WR1 A;  4S17 A;  4EZK A;  1OTR B;  3UIP B;  1GNU A;  3A9J B;  1K8R B;  1FMA D;  4W9I A;  2KOX A;  3AE8 B;  2WXL A;  2MBE A;  1JRP A;  2IPK D;  1M94 A;  4AP4 C;  1RFK A;  2V3N A;  3EA6 A;  1R4M I;  3CF6 E;  3KWL A;  2AQ1 B;  3QWZ B;  3QAR A;  1LQB A;  5DPT A;  3CST A;  4II3 B;  3AXC A;  2IO3 B;  3IAM 1;  4FXC A;  1L0V B;  1C9F A;  4XWT A;  4F7Z A;  2LXA A;  1L7Y A;  4LK0 M;  1XEE A;  2BF8 B;  4MGI E;  1TS4 A;  3C0R B;  1B9R A;  4J3O D;  2DWQ A;  4GU2 A;  4XZ4 A;  5JHB A;  1BXT A;  3U4E G;  2W55 A;  4KDL B;  2M0A A;  1XCT L;  3EUB 2;  1P98 A;  4FA6 A;  1QIL A;  3NJT A;  1CQV A;  3IT6 B;  2JYE A;  1WWT A;  3NZ3 A;  1QQR A;  2L0F A;  5IKC M;  3FAH A;  2JSV X;  4HCP B;  3NY5 A;  4BAX A;  3DHI C;  1YQB A;  2ON8 A;  2LJ5 A;  3R3M A;  2R2Q A;  4F1S A;  2QMT A;  1TGZ B;  2GI9 A;  2JZP A;  1L0X B;  2JT4 B;  3ZYY X;  2NTS A;  3RUI B;  1N63 A;  3DBL I;  4C4V B;  2KVZ A;  1CZP A;  2KTR A;  1K51 A;  3PZ8 A;  3V3X A;  1XQQ A;  1HQR D;  1HTQ A;  3VRB B;  4HXD A;  3V60 A;  4X57 B;  4FUL A;  3ONS A;  4LDT D;  2HTH A;  4IWO A;  2LHE A;  2M1M A;  1AYF A;  1UGJ A;  2DZJ A;  3VHT C;  4CQN A;  3HVD A;  2OHF A;  2BPS A;  3RZW C;  4JE3 B;  4YSZ B;  2M0X A;  2UYZ B;  2M56 B;  2KKC A;  3IVF A;  3ZW3 A;  1WXQ A;  4PS3 A;  1N6Z A;  5BYS A;  2GMI C;  1WGH A;  1R4N B;  2JZ3 B;  3A33 B;  1L4Z B;  4N6E B;  4TSS A;  1E0Z A;  2B76 B;  4BKT A;  2D3C A;  3L17 A;  4GLS C;  3PHW B;  4MJS B;  2RDH A;  1DOY A;  1Z2M A;  3A9K A;  2TSS A;  4XC2 A;  2K6Q A;  2LGD A;  1OQY A;  2BT6 A;  2K8B A;  2L00 B;  2KWD A;  3MJW A;  4DWF A;  3B2F A;  3T3O A;  1N60 A;  4LNF A;  3T8M A;  5HKH A;  2DLB A;  3WCQ A;  4K1R B;  4ACF A;  3K9O B;  2KDE B;  2Z0D B;  2DZK A;  1RLF A;  2BGF A;  4TMA B;  1V1P B;  4HPM B;  5FR3 A;  3HRD D;  2J42 A;  2LGX A;  2GBN A;  4GDK B;  5G2N A;  1WZ0 A;  3ZQ4 A;  1DGJ A;  2VZK D;  5AUK A;  5HHD G;  4RM8 A;  4WUR A;  2K9X A;  2N7D A;  4HDO A;  4DDI D;  1MHX A;  1P1A A;  5DCN A;  2N0S B;  1TKG A;  1WGR A;  1F9J A;  2IND C;  3IFW B;  3I63 C;  2VZK B;  1YN4 A;  1GB4 A;  4ARI A;  2BWF A;  1KLV A;  1WMH A;  4MT5 A;  3IG3 A;  3I3T B;  3DVG Y;  1OQR A;  3QIJ A;  2DHZ A;  2WYQ A;  4PS8 A;  1WXS A;  4HDQ A;  3ZO5 B;  2D3A A;  5L83 A;  4KVG B;  4A20 A;  3W5V B;  4JWS C;  3B0A A;  3ZJT A;  3SHQ A;  1JML A;  3OWE B;  2HD5 B;  2DAJ A;  3KW5 B;  4OHJ A;  1IGD A;  1D4B A;  3DVN U;  2WXG A;  3QAQ A;  4DXF A;  2NR2 A;  4AWJ A;  2LVO A;  4NZL B;  1EF1 A;  3NZU A;  3CWI A;  3B08 A;  3PT2 B;  1TZO A;  2R2O A;  2GBR A;  3PRE A;  1Q10 A;  3RN9 C;  3RNG C;  1I4R A;  4FLH A;  2DZM A;  2LEK A;  1KRH A;  1F0Z A;  2MBH A;  4W9E A;  2MLB A;  1OQQ A;  3QQ8 B;  3LYY A;  3M62 B;  3ZDT A;  3GZN B;  3ABV B;  2LVP A;  2CHZ A;  2HDE A;  4P7I A;  1FXT B;  2JRI B;  4II2 B;  3R8B A;  1OEY A;  1PFD A;  2DYB A;  4ZRQ A;  2PE6 B;  2C7N B;  3AE2 B;  3KUC B;  4GDL A;  1YQ3 B;  3ZJU A;  1FM0 D;  1XLN A;  3UF8 A;  1WX7 A;  1WGD A;  1RAX A;  2LJI A;  2PMV A;  1HA5 A;  1P7F A;  5JH5 C;  4WJQ A;  1VZ7 A;  1D3Z A;  5KHO A;  2CU1 A;  3BY4 B;  2FCN A;  2IYD B;  2KQ4 X;  4EZL A;  5C23 A;  2RR9 A;  3VUW A;  1EWC A;  2XK5 A;  2MWS B;  4O1N A;  5MPO A;  4EE2 A;  2RPV A;  4G0N B;  1IPG A;  2L7R A;  4KSK C;  4WWP A;  1RYJ A;  2JXX A;  4W9F A;  2ZCC A;  1V81 A;  4YSX B;  1F2R C;  2QCZ A;  3Q8E A;  1AAR A;  3ETR A;  3MTN B;  2ZVN A;  2LHD A;  2BKR B;  4HPL B;  3KYD D;  3I57 A;  4WJP A;  4LJO B;  1J8C A;  3SDL C;  3NHE B;  2PVG C;  2MP2 B;  1UEL A;  4FAD A;  3D32 A;  4LNK A;  2KTF A;  4TKN A;  3X23 A;  1CMX B;  1SIF A;  1WI0 A;  2MCN B;  1ZDX A;  2LGI A;  3IT4 B;  4L23 A;  1PYW D;  4A90 A;  1WYW B;  4NJ6 A;  4B9K A;  2D5G A;  2WU5 B;  3DQV A;  1NYQ A;  4C4V A;  2L76 A;  2KQ7 A;  3ZRF A;  1FCL A;  3OAW A;  2ZJD A;  1NEK B;  2BS4 B;  3NG0 A;  2KK8 A;  1JW9 D;  3H8H A;  3TCA A;  1FNU A;  4NAW A;  4AS1 A;  4RGO S;  3ZNG C;  1NBF C;  1SJE D;  4EZJ A;  5EE0 A;  1D5M C;  4OVZ A;  4C7Y A;  3ZNZ B;  1YOV B;  4M01 A;  3P2B A;  1C76 A;  2MBQ A;  1PGX A;  2K39 A;  4RGM A;  1I4P A;  1TS2 A;  1KOT A;  3H7P B;  1OGW A;  3OLM D;  3VTU A;  1F77 A;  4K3C A;  1TY0 A;  4J6I A;  4FJY A;  4OVU A;  2H89 B;  3T3N A;  1C1Y B;  3VAW A;  2MH7 A;  1CK1 A;  3PTF C;  2J4X A;  3CMM B;  2N9P C;  1PGB A;  1VCB A;  3AN1 A;  3NRZ A;  4MJS A;  4L1B A;  3U30 A;  1T0Y A;  5IOI A;  2Z0E B;  4BBN C;  4XE0 A;  5CHV C;  1R4N I;  2KO3 A;  3DCG A;  1UWX A;  5TSS A;  4MGZ E;  3Q69 A;  5E6O A;  5LXH A;  2XN9 C;  2WXI A;  3PS6 A;  2KLG A;  2NPT B;  2WXM A;  4URK A;  2MJE A;  5L95 C;  2X38 A;  2KAC A;  3HM6 X;  3Q8B A;  3B1L X;  4KZC A;  4RH6 A;  1IYF A;  2KDB A;  3BVG A;  4ZYS A;  4M0W A;  1GPX A;  1I4G A;  3TEW A;  4NNJ B;  2BTE A;  1TY2 A;  1WJ6 A;  4YWG G;  3NS8 A;  5BMG A;  5EDS A;  4KKI A;  2MQJ A;  3MC9 A;  3IXS A;  4L2Y A;  2RSU A;  4ARC A;  1V2Y A;  2AL6 A;  4RGN A;  4YTN B;  2H88 B;  2PVO D;  4P16 A;  4BKS D;  1FFU A;  1XO3 A;  3BWU D;  2WU2 B;  3L54 A;  4WWM A;  1N5W A;  1TS3 A;  5BO4 B;  3WAM A;  1K53 A;  2WS3 B;  5HG2 A;  2LRW A;  3QHT A;  4KSL C;  1WX8 A;  1I4Q A;  3K9P B;  3QC8 B;  4QAY A;  1QOA A;  5J2R A;  1FPY A;  5GXG B;  3SFE B;  2KX3 A;  1JWM D;  4XDD A;  3ZTC A;  2WX1 A;  3NOB A;  2N9L A;  4IC7 B;  2D3B A;  3RFZ B;  1LM8 B;  2K25 A;  2PEA A;  1MG4 A;  1T0Q C;  3AE6 B;  3S2A A;  4HRS A;  1L0Y B;  2ZCB A;  3QK0 A;  1PUT A;  1JWB D;  3O65 B;  4I6P A;  1XXG A;  1J7A A;  2OJW A;  4KZ0 A;  1C77 A;  4IKG A;  2LI5 A;  1YQ4 B;  2L0T A;  2KC1 A;  1ACC A;  1WYG A;  5EE1 A;  3T9L A;  1JAL A;  3TMP B;  3GZN I;  1QOF A;  1VLB A;  4JPS A;  3KVF B;  5IP4 D;  3U8Z A;  4NJC A;  1L6V A;  2N1W A;  4YTP B;  1V6E A;  4K3B A;  1TT5 B;  2LGY A;  3Q3J A;  1FFV A;  2PTL A;  3ZLZ A;  4US8 A;  3RZF A;  2KAN A;  4ZRI A;  3VVW B;  1UBQ A;  2BYV E;  1WRD B;  1SJH D;  1SSN A;  2KWU B;  2EEL A;  1UGM A;  3TEY A;  4F8C B;  1JQ4 A;  1YN5 A;  2N9E B;  1DOX A;  2WGS A;  1PQS A;  2JYT A;  3NVZ A;  3FKY A;  4LNO A;  1WE6 A;  1TS5 A;  5C1Z A;  2IO1 B;  1WJN A;  4OZA A;  4ZRJ A;  3BZD B;  2KVR A;  2KFK B;  2CHX A;  2ICI A;  2C7H A;  2MHJ A;  2IY1 B;  4R3D A;  3Q8A A;  4WWN A;  5JXV A;  3FIL B;  3QA8 A;  2WQY B;  2DYO A;  2KMA A;  4JX1 C;  3Q3O C;  2NTT A;  5G5G A;  1ESF A;  1KTK A;  3Q3M C;  4YL8 A;  1NI3 A;  2MP2 A;  3W1S C;  2ZPY A;  3URY A;  1RM6 C;  3TJP A;  1ENF A;  4KKJ A;  1LGR A;  3V62 A;  3A1Q B;  2G4D B;  3ZUN A;  2EKE C;  1SE9 A;  1Y8R C;  2JWU A;  2BBC A;  4ANV A;  1UH6 A;  1VJK A;  4N58 A;  4FJZ A;  4AOF A;  4C80 A;  2PIA A;  5FK9 C;  1SF0 A;  4K7W A;  1TZ1 A;  4DK5 A;  2KMC A;  1AN8 A;  3O13 A;  1K52 A;  3W1S A;  3BVZ A;  1BML C;  1TKE A;  4NJ7 A;  5CHF A;  3UIO B;  2LMC A;  1SE2 A;  1U4A A;  1ZGU B;  5D3I B;  1FRR A;  3RNA C;  3VTW A;  5D7G A;  3JYU A;  3SD5 A;  4W9D A;  1E7U A;  1UF0 A;  2KQS A;  1QZE A;  3W5U B;  4W9J A;  2JXT A;  4ZOH C;  1S3S G;  2INC C;  2Y3A A;  4BKG A;  5AZG A;  3WAN A;  1C79 A;  1OFF A;  2KN4 A;  1JWA D;  2N4F A;  3Q3F A;  1WJ4 A;  2MX2 A;  2HTM E;  2WDV B;  5AZH A;  3VRA B;  5J18 A;  1K50 A;  2I38 A;  2BQQ A;  3DPD A;  3N1Z C;  2IJ0 A;  1YNT E;  4ASW C;  2RPQ A;  4DXG A;  4JGH B;  4WWO A;  5E6J A;  4E71 A;  1GC7 A;  3A4S C;  4MGK E;  1QOB A;  5TR5 A;  4ZRP A;  2LRU A;  2JZZ A;  1MG8 A;  1SIJ A;  3OG5 A;  2KZR A;  1I4X A;  2WDQ B;  3EFU A;  2NMQ A;  3APC A;  3X0W A;  2J7Q B;  3VDZ A;  5I4D A;  1ZE3 D;  1Y56 A;  3ZNI D;  5J17 A;  2K6D B;  2V1Y A;  1C78 A;  3PVL A;  1J7B A;  1UBI A;  1UZX B;  4N59 A;  2SEB D;  2IO2 B;  2C5L C;  2HJ1 A;  4C00 A;  4HVB A;  4DBG A;  1FEH A;  3EGR A;  3ZVV A;  1KFY B;  2V3S A;  2N9K A;  3KYC D;  1FNV A;  4P1C C;  3N20 C;  4KIK B;  3GP7 A;  4PYU A;  2W3R A;  3E56 A;  2DEN B;  3P42 A;  2I1K A;  1KH0 A;  4HPP A;  1WM3 A;  3LXF A;  1L6U A;  2BWE S;  2M8S A;  2WXK A;  3L08 A;  2FCM A;  2WXJ A;  1JWS D;  5LXI B;  2M17 A;  1BUI C;  2KJ6 A;  3AEF B;  2FBW B;  2N7E A;  4BKS A;  3EC8 A;  3EHV A;  3KWV A;  1CJE A;  2DYM A;  4G3X B;  4XX5 A;  3DBH B;  4A6Q A;  4WH4 A;  3KUZ A;  1WR6 E;  2IDY A;  3RNE C;  2CS4 A;  2L32 A;  3AU4 A;  1VDV A;  4MM3 B;  1E9M A;  1WXV A;  1DOI A;  2J53 A;  3NVV A;  4E74 A;  3PHX B;  4MSQ B;  4HEA 1;  4IM2 A;  1ISN A;  5IN7 A;  3TIX A;  3UQA A;  1VZ8 A;  3AEB B;  3Q6B A;  2LGS A;  3AE4 B;  4HKZ E;  1WGK A;  2VH1 A;  5AUI A;  3A9J A;  3TEX A;  3DVG X;  1NDD A;  2MEK A;  1MVK A;  2ACZ B;  3DWM A;  2MBB B;  3M95 A;  1WRI A;  1KLU D;  3IHP C;  2FAZ A;  2Y5B B;  1WXM A;  2KX0 A;  4BOS C;  3JSV B;  4WIP A;  2UU7 A;  4NPN A;  3SU8 X;  1NVI D;  4YTM B;  4FJV B;  1SGH A;  3DDC B;  5FR6 A;  3ALB A;  1ZPS A;  4PK1 A;  3P4Q B;  1ZXI A;  1YX5 B;  2LVQ A;  2WHI A;  1T3Q A;  1KLG D;  1D5X C;  2NBU A;  1YIW A;  2WXN A;  1Q0W B;  2I1J A;  4W9L A;  5E6N A;  2LUE A;  3ECI A;  3U2S C;  5JHA A;  3TSS A;  1ZOY B;  4KX6 B;  4M00 A;  4YSY B;  3E9S A;  2DZI A;  2YLM A;  4MSM B;  2OOB B;  2NBW B;  3VH3 B;  2BKF A;  4FN2 A;  2MRP A;  3VUY A;  3MHZ A;  1HZ5 A;  2IGD A;  3APF A;  1E6E B;  1HZ6 A;  1TJE A;  1ZXH A;  3ZXV A;  3DBR B;  1WZ3 A;  3BYY B;  2RMM A;  4B0E A;  3TEZ A;  3BYT B;  4HRO A;  3MFG A;  1BT0 A;  2KAJ A;  1YX6 B;  5D94 A;  1ET9 A;  4GB9 A;  2D11 A;  3AEC B;  2WXR A;  3L0W B;  1SXT A;  1UWM A;  4NQK E;  2J0M A;  1FCC C;  4WJN A;  1WY8 A;  4KV2 A;  2PKO A;  2PLP A;  3UIN B;  1FO4 A;  1YN3 A;  2WWZ A;  5H92 C;  2SAK A;  5H8Y E;  2KLC A;  2WX0 A;  1NEN B;  4RNA A;  3N1Y C;  3VR9 B;  2YEP F;  4K7U A;  4CHK A;  4FBJ B;  3IAS 1;  1HE8 A;  4FHK A;  2WXF A;  3UI3 A;  2V0G A;  3ZKJ C;  2JUO A;  2OJR A;  1I4H A;  2KJR A;  1GC6 A;  3ZXR A;  1C4C A;  4KDI C;  2L52 A;  3QCA A;  3JW0 X;  3BII D;  2KDI A;  1Z5S B;  4HK2 A;  4TV3 A;  2KYW A;  2J0K A;  3H1U A;  1SE4 A;  4K7S A;  4W9G A;  2PW9 A;  2GBJ A;  4M8M A;  1V5T A;  1T0R C;  1VD2 A;  1B1Z A;  1Q5W B;  3R66 C;  5DPW A;  2QIE B;  3Q8F A;  2NS5 A;  1RWS A;  3RMK C;  4LCD E;  3RI7 C;  2O2V B;  1V86 A;  3AEG B;  1V1P A;  4EOY A;  2V4L A;  2JY6 A;  3M3J A;  1L5P A;  4GDK A;  2PPH A;  1KM7 A;  2A4Z A;  1WFY A;  3DVN V;  5CX3 A;  1EU4 A;  1WM2 A;  4ANW A;  2KXJ A;  4LJP B;  1P0R A;  2V4I B;  3I9V 1;  1H4R A;  1SE3 A;  3UQB A;  1L2N A;  2EKI A;  3AE3 B;  4RF1 A;  4WAA A;  3RNF C;  4C56 C;  4GOC A;  2N9X A;  2C9W B;  3KH0 A;  3A4R A;  2G4S A;  4M02 A;  4HCN B;  2CJO A;  4G11 A;  1V5O A;  5JZE B;  5EE3 A;  4TQ0 A;  1QOG A;  2KC2 A;  2LAS A;  2KMM A;  4UDU C;  1M4V A;  3JVZ X;  5HFY A;  1T0S C;  3HVZ A;  4XDC A;  2IGH A;  5LLI A;  1E7V A;  2KT7 A;  4H2A A;  2W82 A;  1HTO A;  4ANX A;  4DHJ D;  3BIN A;  2QHO A;  3AM9 A;  1I7H A;  2J52 A;  3AMZ A;  4DHJ B;  3WAL A;  2BYF A;  1NYR A;  1IBX B;  2NCN A;  1V80 A;  1IP9 A;  1JRO A;  2J0J A;  1MJD A;  4GDL B;  4IWP A;  1E10 A;  3PRP B;  4HLE A;  4RM9 A;  1E8W A;  3AEA B;  1E8Z A;  3DBH I;  3V6C B;  4ZDV A;  1FIQ A;  4HJG E;  3NS1 A;  4GN1 A;  5GMV A;  2NVU I;  4A8X C;  2K1F A;  2L05 A;  5LNK 1;  1L4D B;  2JWZ A;  2XK5 B;  1V1O A;  5CHW A;  4WJO A;  3L13 A;  3U7Z A;  2JPH A;  3LJ3 A;  2JU6 X;  3VH4 B;  4E3C A;  3NUH B;  2LD9 A;  1WF9 A;  4OVV A;  1V9J A;  2C7M B;  2IO0 B;  1R7S A;  5KHQ A;  3GS2 A;  1V97 A;  4EKU A;  1D5Z C;  2WP9 B;  4B0M A;  3LB8 C;  3JSV A;  1TYG B;  2PJH A;  4IDI A;  2WXQ A;  3N32 A;  4P6V F;  3MP9 A;  2GB1 A;  4Q2J A;  1XLO A;  2EMS A;  3ENE A;  1C4A A;  2ASQ A;  5C3J B;  1D6E C;  3KUD B;  4EEW A;  2E3T A;  5D6J B;  3L10 B;  2REX A;  2R61 A;  5T8I A;  3RUL A;  5BYR A;  2WXP A;  5AZF A;  4EFO A;  2BB6 A;  2KHW B;  2BB5 A;  2CR5 A;  2G1E A;  3L16 A;  1RRB A;  1YJJ A;  1X1M A;  2ONQ A;  3V61 A;  2WXH A;  2KN5 A;  1P9D U;  1A5R A;  4RMA A;  1STE A;  2O6V D;  2K5P A;  4RCO A;  2OED A;  3V05 A;  2L3Z A;  3VR8 B;  2K8H A;  2XEW A;  3CIR B;  2O6V B;  4WAF A;  3PLU A;  2BS2 B;  5CTR C;  3AE1 B;  1AWD A;  3QX1 A;  1GB1 A;  3DBS A;  3P63 A;  3ML9 A;  4IOI E;  2GBM A;  2Y5C A;  1QT9 A;  4IM3 A;  1VR9 A;  1XF5 L;  2ZNV B;  2D07 B;  4GSW A;  2IY0 B;  4NAW B;  1HEZ E;  3WIM A;  2QC8 A;  3B2G A;  3VTV A;  3DBR I;  5D3D A;  3L4P A;  3AB5 A;  4LDT B;  4MGY E;  5HI1 A;  4BZA A;  4P1B C;  2MA9 B;  2INN E;  2Q5W D;  4DXA B;  3PLV A;  2LFI A;  3RNB C;  4TQ1 A;  1FNW A;  4D2K A;  5DPS A;  4W9C A;  4LLG M;  3H7P A;  2KFJ A;  4XWW A;  4M8N A;  1NI2 A;  3GE8 C;  3DOW A;  1MFW A;  4ZRK A;  3AE5 B;  4S0R A;  1KJT A;  4AQ7 A;  1IGC A;  3TBL D;  4WQM A;  4NQL B;  4US9 A;  4A3P A;  1QLB B;  2KJH B;  1FRD A;  1QF6 A;  3RT3 B;  1LO5 D;  3HIZ A;  4RGT A;  2AYO B;  3Q2A C;  4N9F 4;  1WX9 A;  2RDG A;  1WH3 A;  2PE9 A;  2WXO A;  1C4P A;  4MH0 E;  4C7Z A;  3LDZ E;  1EU3 A;  1ZW7 A;  2NBV B;  3SR6 A;  2L1A A;  4BBN F;  4AUQ C;  3N1X C;  2M19 A;  1E5W A;  2JVC A;  4M0W B;  2NPT A;  3WAP A;  1I42 A;  2VH2 A;  1A70 A;  4YT0 B;  1UD7 A;  2K0P A;  1XLP A;  2AEH A;  2O2V A;  4XGA B;  2CU3 A;  2CHW A;  3EFC A;  1RFA A;  1JWU D;  3GE3 C;  3W9C B;  3DWG C;  1E90 A;  3AUL A;  5FKA C;  1ZDV A;  3MC0 B;  1E8X A;  2N7J A;  2QJL A;  4BFR A;  4IW0 A;  1ZP0 B;  2BW2 A;  1J0G A;  2VRR B;  3DHH C;  3OJ3 A;  2IGG A;  1V8C A;  2FE8 A;  1YMH E;  4GMV A;  4W9K A;  2DAF A;  4FHJ A;  4GIV A;  4W9H A;  1GJZ A;  2G45 B;  2KWV B;  4PT5 A;  4A9A A;  5E6P A;  1ET6 A;  1MPE A;  1KF6 B;  1YJ1 A; 
#chains in the Genus database with same CATH homology
 5J2R A;  1YX6 B;  4X57 B;  5IA7 A;  4FUL A;  3ONS A;  5D94 A;  1H8C A;  4LDT D;  2D2Q A;  2FUH B;  2HTH A;  4IWO A;  2KX3 A;  2AL3 A;  4GB9 A;  2D11 A;  2M1M A;  3L0W B;  3ZTC A;  2DZJ A;  3VHT C;  2WX1 A;  3NOB A;  4NQK E;  2J0M A;  1TBE A;  4IC7 B;  1LM8 B;  2K25 A;  2PEA A;  1WY8 A;  4WJN A;  4KV2 A;  2BPS A;  3RYT A;  3S2A A;  2AWT A;  3RZW C;  4B95 A;  3H6N A;  2ZCB A;  3UIN B;  3QK0 A;  2M0X A;  3O65 B;  2UYZ B;  2WWZ A;  2KKC A;  3IVF A;  3ZW3 A;  4PS3 A;  4I6P A;  4ICV A;  2KLC A;  2WX0 A;  4KZ0 A;  2GMI C;  2LI5 A;  2XBB C;  1WGH A;  2ZVO A;  3PSE B;  4K7U A;  3A33 B;  2JZ3 B;  2L0T A;  4K81 A;  2KC1 A;  3AU5 A;  1KLV A;  4CHK A;  4FBJ B;  4BKT A;  1HE8 A;  4FHK A;  3T9L A;  3TMP B;  3L17 A;  5DPR A;  3PHW B;  4WQO B;  4MJS B;  3ZKJ C;  1LXD A;  3GZN I;  2JUO A;  2OJR A;  1Z2M A;  3KVF B;  2KJR A;  1GC6 A;  1GG3 A;  4DHZ E;  3A9K A;  4KDI C;  2LXC A;  3QCA A;  3U8Z A;  4XC2 A;  2K6Q A;  3JW0 X;  2KDI A;  2LGD A;  1Z5S B;  1ZKH A;  3H7S A;  4HK2 A;  4TV3 A;  1OQY A;  2J0K A;  2K8B A;  4DHZ B;  3H1U A;  2L00 B;  4K7S A;  2HJ8 A;  2EMT A;  2N1W A;  4W9G A;  1XD3 B;  3MJW A;  4DWF A;  1V6E A;  1YD8 U;  2K8C A;  2GBJ A;  2LGY A;  4M8M A;  1WXA A;  3Q3J A;  4IG7 B;  2KWC A;  1V5T A;  1VD2 A;  3H9D A;  1Q5W B;  3ZLZ A;  3T8M A;  3RZF A;  3R66 C;  2KAN A;  5HKH A;  5DPW A;  4ZRI A;  2IBI B;  4K1R B;  1UBQ A;  2BYV E;  3VVW B;  1WRD B;  2NS5 A;  3K9O B;  2KDE B;  2FCQ A;  2Z0D B;  2KWU B;  4LCD E;  2DZK A;  4IWQ A;  1RLF A;  2BGF A;  3IBE A;  4HPM B;  1UGM A;  2O2V B;  4F8C B;  2LGX A;  2MBO A;  1V86 A;  3ZTD A;  1S1Q B;  2N9E B;  2GBN A;  4GDK B;  5G2N A;  1WZ0 A;  4EOY A;  4HJK A;  2V4L A;  2JY6 A;  3M3J A;  1PQS A;  2YVC A;  4RM8 A;  2N7D A;  4GDK A;  2PPH A;  4HDO A;  4DDI D;  3PV1 A;  1P1A A;  2DX5 B;  5DCN A;  1WGR A;  1WE6 A;  1F9J A;  4JLC A;  3IFW B;  5C1Z A;  2IO1 B;  2ZZP B;  1WJN A;  1EF5 A;  1KM7 A;  4ZRJ A;  2A4Z A;  4GGQ A;  1WFY A;  2GOW A;  2RD0 A;  2UWQ A;  3DVN V;  2KFK B;  2KVR A;  1LFD A;  2CHX A;  2BWF A;  2C7H A;  1WMH A;  5CX3 A;  1WM2 A;  4CO7 A;  3IG3 A;  3I3T B;  2IY1 B;  3DVG Y;  3QIJ A;  2Z59 B;  4ANW A;  2DHZ A;  2WYQ A;  4PS8 A;  2KXJ A;  4LJP B;  1WXS A;  2KFK A;  1P0R A;  4WWN A;  1XT9 B;  3UQB A;  1H4R A;  4HDQ A;  2MSE D;  3ZO5 B;  1L2N A;  3ML8 A;  3QA8 A;  5L83 A;  2DYO A;  2KMA A;  4KVG B;  3W1Y A;  5G55 A;  4A20 A;  3RD2 A;  4AJY B;  4WAA A;  1C3T A;  3B0A A;  3WAO A;  3U7D A;  1WE7 A;  2CKH B;  2KTR B;  3PZD A;  3SHQ A;  3NZS A;  2LZ6 A;  4HWI B;  4GOC A;  4IM0 A;  4YL8 A;  2N9X A;  2C9W B;  3KH0 A;  2HD5 B;  2DAJ A;  3A4R A;  3KW5 B;  2MP2 A;  3WA0 A;  3W1S C;  2ZNV C;  4MEL A;  2ZPY A;  3R7R A;  2G4S A;  3DVN U;  3QAQ A;  3VUX A;  2NR2 A;  3TJP A;  4AWJ A;  2LVO A;  3V62 A;  4HCN B;  4AJW A;  1EF1 A;  3A1Q B;  3GOE A;  1V5O A;  3NZU A;  2G4D B;  4G11 A;  3HHM A;  3ZUN A;  5JZE B;  2ZEQ A;  1J19 A;  3B08 A;  2EKE C;  3PT2 B;  4TQ0 A;  1SE9 A;  1Y8R C;  2R2O A;  2KC2 A;  2GBR A;  2LAS A;  3A1Q A;  3JVZ X;  3PRE A;  1EO6 A;  3OJ4 B;  4ANV A;  1UH6 A;  5LLI A;  4FLH A;  2DZM A;  1E7V A;  4FJZ A;  4AOF A;  2MBH A;  4W9E A;  2MLB A;  2O6V A;  3R7Q A;  4ANX A;  4DHJ D;  3QQ8 B;  3BIN A;  3M62 B;  3ZDT A;  2QHO A;  3VXW A;  4K7W A;  1TZ1 A;  5AEK B;  5IAA C;  1WIA A;  4DK5 A;  3ZIM A;  2IZV B;  2KMC A;  4DHJ B;  3WAL A;  2BYF A;  3W1S A;  2LVP A;  2CHZ A;  4P7I A;  4ICU A;  2NCN A;  1FXT B;  2JRI B;  1V80 A;  4I6N B;  4II2 B;  3HK0 A;  4JIO U;  4NJ7 A;  5CHF A;  3UIO B;  1IP9 A;  2J0J A;  4G50 A;  3A9K B;  1OEY A;  3PGE A;  1U4A A;  1ZGU B;  4GDL B;  2DYB A;  4IWP A;  2PE6 B;  3PRP B;  3VTW A;  5D7G A;  3JYU A;  2FID A;  3SD5 A;  4W9D A;  1E7U A;  4RM9 A;  2KQS A;  1OEY J;  2C7N B;  2JF5 A;  1E8W A;  1QZE A;  3KUC B;  1E8Z A;  3DBH I;  4GDL A;  3V6C B;  4ZDV A;  1I35 A;  3PPA A;  2B3A A;  3PRZ A;  4W9J A;  4ANU A;  1S3S G;  1TTN A;  4BKG A;  5AZG A;  3WAN A;  3UF8 A;  3RCZ A;  2N4F A;  2HE7 A;  1WX7 A;  3Q3F A;  4GN1 A;  1WJ4 A;  1WGD A;  2MX2 A;  2NVU I;  5GMV A;  1RAX A;  5AZH A;  2MW5 A;  4JL9 A;  5J18 A;  2K1F A;  2BYE A;  1GUA B;  3DPD A;  5JH5 C;  4DDG D;  4WJQ A;  2L05 A;  2JWZ A;  2KDF B;  4ASW C;  1D3Z A;  2RPQ A;  5KHO A;  2CU1 A;  2XK5 B;  4JGH B;  4WJO A;  4WWO A;  2C60 A;  3BY4 B;  3L13 A;  1GC7 A;  5CHW A;  4E71 A;  3A4S C;  4B6W A;  2FCN A;  2FNJ B;  2JPH A;  4MGK E;  2IYD B;  2M4N A;  5TR5 A;  3LJ3 A;  4EZL A;  5C23 A;  3VH4 B;  1Q1O A;  2LRU A;  2RR9 A;  3VUW A;  2XK5 A;  4E3C A;  2MWS B;  5D2M B;  2LD9 A;  2JZZ A;  1WF9 A;  1MG8 A;  4OVV A;  4G0N B;  4BVU C;  1IPG A;  2KZR A;  1V9J A;  2C7M B;  2IO0 B;  2L7R A;  3EFU A;  3APC A;  4NY0 A;  4KSK C;  5KHQ A;  4WWP A;  4MEM A;  2JRH A;  3HM3 A;  4EKU A;  4MDK E;  2JXX A;  4W9F A;  3ZDM C;  3X0W A;  2J7Q B;  2RGF A;  2ZCC A;  3VDZ A;  1V81 A;  2G3Q B;  3ZNI D;  3JSV A;  2PJH A;  5J17 A;  3N32 A;  1WMH B;  2ZPN A;  3ZRC A;  2K6D B;  2V1Y A;  4GXB A;  3PRM B;  3PVL A;  1AAR A;  2EMS A;  3ENE A;  1UBI A;  1UZX B;  2ASQ A;  3MTN B;  4EUT A;  3KUD B;  2IO2 B;  2ZVN A;  4EEW A;  4HLE A;  2BKR B;  2C5L C;  5D6J B;  3L10 B;  4HPL B;  3UGB B;  4HVB A;  4DBG A;  2L8J A;  4PYZ A;  3ZVV A;  3KYD D;  2REX A;  4WJP A;  2V3S A;  3KYC D;  4BOZ B;  4LJO B;  1WGY A;  1J8C A;  3SDL C;  4KIK B;  3RUL A;  4A3O A;  5AZF A;  4EFO A;  3NHE B;  4CYE A;  4PYU A;  2MP2 B;  2KHW B;  1UEL A;  3N30 A;  4FAD A;  2CR5 A;  1V49 A;  1JRU A;  3D32 A;  4TUU A;  3QJZ A;  2DEN B;  4KIK A;  2N1V A;  2KTF A;  2I1K A;  3L16 A;  3TL5 A;  3CSF A;  1RRB A;  1X1M A;  4PS7 A;  4TKN A;  3X23 A;  1WM3 A;  1CMX B;  1SIF A;  1WI0 A;  3V61 A;  2MCN B;  2BWE S;  2M8S A;  2KN5 A;  3VQI A;  1EUV B;  1P9D U;  1A5R A;  4RMA A;  2FIF A;  2O6V D;  2FCM A;  3L08 A;  1G6J A;  1WYW B;  5LXI B;  2M17 A;  1P3Q U;  2L3Z A;  3N3K B;  2KJ6 A;  4ZYN A;  2K8H A;  2XEW A;  4NJ6 A;  4B9K A;  2N7E A;  2GBK A;  2O6V B;  3PLU A;  3V6E B;  4BKS A;  5CTR C;  3EC8 A;  3EHV A;  3DQV A;  1E8Y A;  2D10 A;  3QX1 A;  2DYM A;  2FCS A;  3DBS A;  2L76 A;  2KQ7 A;  3ML9 A;  4JQW C;  2GBM A;  3ZRF A;  4IM3 A;  4G3X B;  2ZNV B;  2D07 B;  4GSW A;  3AI5 A;  2IY0 B;  3OAW A;  1WGG A;  4NAW B;  2ZJD A;  4XX5 A;  2KK8 A;  2KNB A;  4IUM B;  3VTV A;  3WIM A;  3TCA A;  3DBR I;  3KUZ A;  1WR6 E;  4NAW A;  1WJU A;  2W9N A;  3ZNG C;  1NBF C;  2CS4 A;  4LDT B;  4EZJ A;  3AU4 A;  2WDT B;  3MHS D;  3VFK A;  3ZNZ B;  2D3G A;  2LWP A;  4MGY E;  3P2B A;  2MBQ A;  1WXV A;  4MM3 A;  2A5U A;  4E74 A;  2MA9 B;  3PHX B;  4MSQ B;  4DXA B;  2K39 A;  3PLV A;  4IM2 A;  2KD0 A;  3M63 B;  1KOT A;  4I6L B;  3EEC A;  1OGW A;  3H7P B;  3OLM D;  3VTU A;  3ZNH B;  4TQ1 A;  1ISN A;  3TIX A;  3APD A;  4J6I A;  5DPS A;  4W9C A;  4FJY A;  4OVU A;  1WR1 A;  3H7P A;  2KFJ A;  4EZK A;  4M8N A;  3UQA A;  1NI2 A;  1OTR B;  3DOW A;  3UIP B;  1C1Y B;  4ZRK A;  3VAW A;  1GNU A;  3PTF C;  3A9J B;  1KJT A;  3CMM B;  2N9P C;  1K8R B;  4W9I A;  2KOX A;  1VCB A;  2MBE A;  4MJS A;  3A9J A;  3TBL D;  3DVG X;  1NDD A;  4NQL B;  1M94 A;  3U30 A;  1T0Y A;  2Z0E B;  4A3P A;  4BBN C;  2KJH B;  4AP4 C;  5CHV C;  1R4N I;  2KO3 A;  3DCG A;  3RT3 B;  2MBB B;  3M95 A;  1R4M I;  3CF6 E;  3HIZ A;  3QWZ B;  2AYO B;  3IHP C;  3QAR A;  1LQB A;  2FAZ A;  2Y5B B;  4N9F 4;  5DPT A;  1WXM A;  1WX9 A;  3CST A;  4II3 B;  1WH3 A;  2PE9 A;  3AXC A;  2KX0 A;  4BOS C;  2IO3 B;  3JSV B;  4MGZ E;  4MH0 E;  5E6O A;  3LDZ E;  5LXH A;  4F7Z A;  1ZW7 A;  2NBV B;  3PS6 A;  4NPN A;  3SU8 X;  2KLG A;  2LXA A;  4BBN F;  2NPT B;  4URK A;  4AUQ C;  4FJV B;  1SGH A;  1L7Y A;  3DDC B;  5FR6 A;  5L95 C;  3ALB A;  1E5W A;  2JVC A;  3HM6 X;  2NPT A;  2BF8 B;  3B1L X;  4M0W B;  4KZC A;  1IYF A;  4MGI E;  3WAP A;  1I42 A;  3C0R B;  2KDB A;  4GU2 A;  4XZ4 A;  1UD7 A;  5JHB A;  4KDL B;  2AEH A;  1YX5 B;  2LVQ A;  2O2V A;  4NNJ B;  1P98 A;  1WJ6 A;  4FA6 A;  2CHW A;  1RFA A;  3NS8 A;  2NBU A;  1YIW A;  5EDS A;  1Q0W B;  2MQJ A;  2I1J A;  4W9L A;  5E6N A;  2RSU A;  2L0F A;  2LUE A;  1E90 A;  1V2Y A;  3ECI A;  2AL6 A;  3AUL A;  5JHA A;  2DZI A;  2YLM A;  4MSM B;  4HCP B;  3NY5 A;  1E8X A;  2OOB B;  4BFR A;  4BKS D;  2NBW B;  4IW0 A;  1YQB A;  3VH3 B;  1J0G A;  2BKF A;  4FN2 A;  2LJ5 A;  2MRP A;  3L54 A;  3R3M A;  2R2Q A;  2VRR B;  3VUY A;  4F1S A;  1TGZ B;  5BO4 B;  3WAM A;  3APF A;  3OJ3 A;  2JT4 B;  3RUI B;  1WZ3 A;  3DBL I;  4GMV A;  4W9K A;  2DAF A;  4FHJ A;  2KTR A;  2LRW A;  4GIV A;  4W9H A;  1GJZ A;  1XQQ A;  2G45 B;  3QHT A;  2KWV B;  4KSL C;  5E6P A;  1WX8 A;  3K9P B;  3QC8 B;  1YJ1 A;  4HXD A;  3V60 A;  1BT0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...