1R4MI

Appbp1-uba3-nedd8, an e1-ubiquitin-like protein complex
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
76
structure length
76
Chain Sequence
MLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVLHLVLALRGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cell cycle
molecule keywords amyloid beta precursor protein-binding protein 1
publication title The structure of the APPBP1-UBA3-NEDD8-ATP complex reveals the basis for selective ubiquitin-like protein activation by an E1.
pubmed doi rcsb
source organism Homo sapiens
total genus 18
structure length 76
sequence length 76
chains with identical sequence J, K, L
ec nomenclature
pdb deposition date 2003-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1r4mI00
1OGWA 2REXA 3KUZA 1MG8A 4KSKC 5LLIA 3UIPB 2K6QA 2WX1A 4HK2A 2KD0A 2DX5B 2KWVB 2O6VA 3ZRFA 1JRUA 5C1ZA 4W9CA 3ZKJC 2MWSB 2XBBC 4DHZB 1WGRA 2EKEC 3KYDD 4W9FA 4A3PA 4NAWA 1TZ1A 4FJYA 1UGMA 3V61A 1WF9A 3JSVB 2M17A 3N30A 2MCNB 1V49A 2V1YA 2C7HA 2DAFA 4HPMB 1GUAB 1LXDA 2AL3A 2DZIA 4LDTD 4K1RB 4KVGB 2XK5A 2BKFA 3PHWB 3A1QA 1WYWB 3T8MA 1VCBA 4WJPA 3U30A 2FIFA 3EECA 4AUQC 3L16A 4WWNA 3W1SA 4HCPB 4PS7A 2A4ZA 2KDBA 1YX6B 2MLBA 3QJZA 2ASQA 3VVWB 2FCMA 2WX0A 4F7ZA 3M62B 2G4DB 3PRZA 1P1AA 2KMCA 4AWJA 4EOYA 1WX7A 2HTHA 2KC1A 4JIOU 2JT4B 4FBJB 2J7QB 2RGFA 1WGGA 1UD7A 1Z5SB 4K7UA 3KVFB 2CU1A 4GB9A 2LASA 5J18A 1V86A 1EF1A 4ANVA 2JWZA 1H8CA 1UELA 3AULA 2IO1B 2KLCA 4MJSA 1RRBA 3W1SC 2AYOB 4IM3A 4W9EA 1RAXA 2MP2B 3QARA 2L0TA 4B6WA 2GOWA 1NDDA 2IYDB 3PV1A 2JF5A 3VDZA 1P9DU 2C7MB 4BBNC 3EC8A 4NPNA 4RM8A 1SE9A 2EMTA 4M8MA 2O2VB 1LM8B 4EZJA 3MJWA 2CS4A 3PPAA 4CHKA 2C7NB 3ML8A 2JZZA 2LGDA 3PVLA 3H7PA 5DCNA 3R3MA 5E6PA 4PS3A 3QHTA 3OLMD 3A33B 1E7UA 4KIKB 3GZNI 4BKTA 2RPQA 4DK5A 3R7RA 3V60A 2JRHA 5D6JB 4M0WB 4XZ4A 3JYUA 3L10B 1S3SG 4P7IA 1Q5WB 4BOSC 3RZFA 2LGYA 3ZRCA 2OJRA 1CMXB 3VH3B 2Z0EB 2ZNVC 2ZVNA 3CSFA 4BOZB 1IYFA 3BINA 3TL5A 4W9JA 2HE7A 3ZUNA 4WWPA 2ZPNA 4WQOB 3DVGY 3QC8B 3AU5A 5HKHA 2KANA 3A9KA 1V80A 2M8SA 1WXAA 2CHWA 5CHWA 4II3B 3LDZE 5D94A 3RUIB 1WJ6A 3KUCB 3N3KB 5E6OA 2BWES 1WRDB 4MM3A 5GMVA 3UIOB 3VUXA 4I6NB 4FADA 2NS5A 2KX3A 3WA0A 3NY5A 2QHOA 5AEKB 4RMAA 1Y8RC 4PYUA 4IW0A 2L76A 2ZVOA 5IAAC 3JSVA 4HXDA 5AZFA 3QX1A 1WZ0A 2L7RA 2KKCA 1XQQA 3VAWA 2JPHA 3MTNB 4G0NB 3ML9A 3X0WA 1OQYA 4FN2A 2IZVB 2NPTB 3BY4B 4M8NA 5BO4B 1E8YA 5G55A 3ZIMA 3X23A 2FCNA 1WR1A 2KXJA 4X57B 3QCAA 4TKNA 2CHZA 3M63B 4FHKA 4EFOA 3KUDB 4B95A 4BVUC 4E3CA 3C0RB 3WALA 1IP9A 3B08A 3RT3B 2DYOA 5D7GA 1E7VA 4A3OA 2J0MA 3SU8X 1E5WA 2JXXA 3OJ3A 3S2AA 1IPGA 1UBIA 5G2NA 1R4NI 1GNUA 2BPSA 1WJUA 4LDTB 2G3QB 2L8JA 5CHFA 2IY0B 4II2B 5LXIB 2MP2A 2LD9A 1GJZA 2IY1B 2GMIC 3DVNU 3JW0X 2N9EB 4I6LB 4HLEA 3PS6A 3ZNGC 1ZGUB 3PREA 2O2VA 4HJKA 3NZUA 3QK0A 3U8ZA 3NHEB 4XC2A 3TIXA 1WM2A 4ICUA 4GN1A 2NBVB 3ZLZA 1V5OA 1WZ3A 2KHWB 3NS8A 3M95A 3OJ4B 4EUTA 4FLHA 1V2YA 2KOXA 2G4SA 4KIKA 1QZEA 3ENEA 4LJOB 2CHXA 1KM7A 1WXMA 2M4NA 2IO2B 3DBSA 3HIZA 3NZSA 1WY8A 1XD3B 4MGIE 4DBGA 3NOBA 3U7DA 4JL9A 2N7EA 5TR5A 2ZCBA 1P3QU 3OAWA 3QIJA 3PT2B 4G3XB 1U4AA 2XEWA 2N1WA 3QWZB 1ZW7A 2GBMA 3DQVA 3RYTA 3WANA 4EKUA 3ZNHB 1P98A 2BGFA 3DBRI 1GG3A 2N4FA 2LVQA 1TGZB 3RZWC 2LGXA 3O65B 3A4RA 2BYFA 4TQ0A 2FAZA 2PEAA 2M0XA 4ICVA 5JHBA 3ZW3A 5DPSA 4DHJD 1TTNA 4IM2A 3SD5A 3AXCA 4ASWC 2HD5B 2YLMA 3R7QA 1KLVA 3DBLI 4TV3A 4DWFA 4KV2A 2FCSA 3DVNV 2KFJA 2PJHA 2ZCCA 3RD2A 3MHSD 5AZGA 3WAOA 3UQBA 1NBFC 1D3ZA 3TCAA 4BKSA 1LFDA 2JVCA 4A20A 2KN5A 3PSEB 2UYZB 3APFA 3QAQA 3R66C 4K7WA 1V6EA 2KC2A 1T0YA 2GBNA 2NPTA 2FIDA 1C1YB 3IVFA 3A9JB 4HWIB 1M94A 2J0KA 2K8HA 3IBEA 2MW5A 3L0WB 1J0GA 1ISNA 2NBUA 4W9DA 2FCQA 5KHOA 2DZJA 1HE8A 1YJ1A 4GOCA 5L95C 1E8XA 2D2QA 3AU4A 4AP4C 2N1VA 4MEMA 1WXVA 4NY0A 1LQBA 2KJHB 3DPDA 3ZNZB 4LCDE 2MBBB 4MELA 2KK8A 3DCGA 3WAPA 5JH5C 1WXSA 1FXTB 1OEYA 4IWPA 5CTRC 4FJZA 4W9IA 1EUVB 3HK0A 4IWQA 2MSED 3ZNID 3P2BA 2Z59B 3QQ8B 3AI5A 1V9JA 3L17A 1L2NA 3VXWA 1GC7A 4GDLB 1OEYJ 2KQSA 4N9F4 2V4LA 3WIMA 2DHZA 3ZVVA 2J0JA 2C9WB 2KO3A 2M1MA 2IO0B 2KMAA 4ZRIA 2D3GA 4GIVA 4IWOA 1V81A 3EFUA 3IG3A 3VTUA 1P0RA 3KYCD 4F8CB 1EF5A 4FULA 1SGHA 2UWQA 2L05A 3VHTC 2NCNA 1WI0A 2CKHB 2C5LC 3CSTA 3PTFC 2KWUB 1WGDA 3VUWA 2BWFA 3H1UA 4TUUA 4ZDVA 4MSQB 2ZNVB 2LI5A 4JQWC 1J8CA 4ZRKA 1Q1OA 3ECIA 4KZCA 3H6NA 4W9KA 3APDA 1WGHA 2C60A 3PLUA 2KNBA 4BFRA 3H7PB 4ZRJA 2JRIB 3B0AA 5AZHA 4ZYNA 2LZ6A 1WJ4A 3ZO5B 5KHQA 4YL8A 3HHMA 2IBIB 2JY6A 2D11A 1UBQA 2LRWA 1S1QB 1WIAA 1YQBA 2GBKA 3K9PB 3H7SA 3M3JA 4KSLC 2K8CA 4NNJB 2LRUA 1WFYA 4XX5A 2LXAA 4B9KA 2DZKA 4J6IA 3APCA 4AOFA 4K81A 5JHAA 5FR6A 3VTVA 3LJ3A 4DHZE 2R2QA 3V6EB 2MA9B 3D32A 4ANXA 3V6CB 4HDOA 1I42A 4GXBA 2MQJA 4CYEA 4FA6A 4G11A 3HM6X 1WX9A 3PZDA 2JUOA 4AJWA 1X1MA 1Z2MA 1WM3A 1WMHB 5EDSA 2KTFA 4GDKB 5CHVC 3T9LA 2MBOA 4K7SA 1E8WA 2JZ3B 2N7DA 1WH3A 3TMPB 1K8RB 2D10A 2NBWB 3SDLC 2DYMA 2LUEA 2KJ6A 2PE9A 2KWCA 1NI2A 2BF8B 3A9JA 3A4SC 1PQSA 2K1FA 3K9OB 3ONSA 4MSMB 2CR5A 3RCZA 2L3ZA 1R4MI 2PE6B 2ZEQA 4AJYB 3GOEA 1YD8U 3SHQA 2ZJDA 3PRMB 4FHJA 5J2RA 5JZEB 4DHJB 3KW5B 5C23A 2HJ8A 3TJPA 4MGKE 2ZPYA 3UGBB 3UQAA 2D07B 1WJNA 2KFKB 2LVPA 3DDCB 4BKGA 2DAJA 3PRPB 2N9XA 4MGYE 1UZXB 2AEHA 2GBRA 1WR6E 4LJPB 4DDGD 2DENB 3JVZX 4BBNF 3CF6E 2BKRB 1VD2A 2KTRB 4FJVB 2EMSA 1GC6A 2RD0A 4WJOA 4IUMB 2GBJA 4HDQA 2DZMA 4GDLA 1E90A 1BT0A 2O6VB 2NVUI 1L7YA 1RLFA 4WJQA 4MGZE 4OVUA 2W9NA 3KH0A 1G6JA 2BYVE 4NQLB 2PPHA 3PGEA 3PLVA 3HM3A 3VFKA 4EZLA 2I1KA 4NAWB 4JGHB 2O6VD 3DVGX 5D2MB 2KDIA 3L13A 2WDTB 3W1YA 2RR9A 4EEWA 2FUHB 2LWPA 4KZ0A 4NQKE 1RFAA 1V5TA 2AL6A 2K39A 1F9JA 4G50A 2KJRA 2KQ7A 2XK5B 4DXAB 4IC7B 2LJ5A 2DYBA 2WYQA 4KDIC 4MDKE 4W9LA 1E8ZA 3A1QB 4WWOA 1Q0WB 2KDFB 2VRRB 2R2OA 3H9DA 3ZDTA 3DOWA 3TBLD 1SIFA 2L00B 3VH4B 3ZTDA 4RM9A 4W9GA 1ZKHA 1TBEA 3Q3FA 3L54A 2V3SA 4E74A 4HVBA 1WE7A 2KZRA 4IM0A 5E6NA 4MH0E 2BYEA 4E71A 3UINB 5DPWA 2WWZA 2OOBB 4GGQA 4ANWA 2L0FA 2IO3B 5DPRA 4EZKA 3ZDMC 1WGYA 3N32A 1EO6A 4PYZA 1J19A 4DDID 2AWTA 2MX2A 3UF8A 2RSUA 4MJSB 4HPLB 5LXHA 4GU2A 3I3TB 5J17A 4GMVA 1WMHA 4OVVA 2KLGA 5IA7A 2LXCA 2MBQA 4GDKA 1OTRB 4NJ6A 2LVOA 3ZTCA 3QA8A 4NJ7A 1UH6A 4ANUA 2Z0DB 2I1JA 3RULA 3B1LX 4W9HA 1AARA 4GSWA 3V62A 2K25A 3VUYA 2G45B 3ALBA 2NR2A 2FNJB 3WAMA 1WX8A 4KDLB 2MBHA 5DPTA 3L08A 2MBEA 2ZZPB 4PS8A 2N9PC 1I35A 1YX5B 3IHPC 4I6PA 3IFWB 2KVRA 1KOTA 2B3AA 4BKSD 1C3TA 1KJTA 3DBHI 4CO7A 3PHXB 4TQ1A 5CX3A 1YIWA 1WE6A 2KFKA 1H4RA 1XT9B 2K8BA 2Y5BB 3EHVA 3VQIA 4JLCA 3VTWA 4IG7B 4WAAA 4HCNB 1A5RA 4WJNA 2KX0A 5L83A 2KTRA 2K6DB 2A5UA 3Q3JA 2YVCA 3CMMB 4URKA 2MRPA 3A9KB 4F1SA 2KDEB
chains in the Genus database with same CATH superfamily
1OGWA 5MPOA 2KD0A 2DX5B 1TKEA 2WXRA 4MM3B 3ZKJC 2MWSB 2LUMA 1WGRA 1IBXA 4A3PA 1C77A 1T0QC 4NAWA 4YTPB 1NYQA 1WF9A 2XN9C 3N30A 2MCNB 1GUAB 3UI3A 2AL3A 2DZIA 4KVGB 3PHWB 1MVKA 3MC0B 3LXFA 3T8MA 3QJZA 2ASQA 2FBWB 3VVWB 1IGDA 2FCMA 3PO0A 2WDQB 1WX7A 2KC1A 4JIOU 4FBJB 2JT4B 3BYYB 1WGGA 3NUHB 4K7UA 5J18A 2X8XX 1EF1A 1TS3A 4MJSA 2L32A 4RGOS 2AYOB 4W9EA 1RAXA 1AW7A 4BZAA 3VDZA 4BBNC 3AE7B 1UNSA 4NPNA 1NVID 2JXTA 1IGCA 1LM8B 4EZJA 2CS4A 3R8BA 2WP9B 3ML8A 1HA5A 1EU4A 3A33B 2JRHA 4M0WB 5IO9A 1S3SG 2QEJC 1F2RC 3ZRCA 5EE3A 1CMXB 3VH3B 3AMZA 3CSFA 1IYFA 2ZPNA 5C3JB 3QC8B 3A9KA 1WXAA 1HTOA 1TY0A 1PUTA 4AS1A 1WJ6A 3N3KB 1C9FA 3VUXA 4XGAB 2KX3A 5FK9C 3WA0A 2SEBD 1KLGD 3U52E 2L76A 4GLSC 2RDHA 4HXDA 3TSSA 1PGBA 4KKJA 3I5JC 1XQQA 3R2TA 4OZAA 3ZQ4A 3ML9A 1I4GA 2W54A 3BY4B 5BO4B 4HKZE 1EWYC 1WR1A 2QJLA 4X57B 3BK1A 2CHZA 1QF6A 1VLBA 4PK1A 4B95A 4BVUC 4HJGE 2YEPF 2BS2B 1ZXHA 1N63A 2LJIA 1SE3A 2JXXA 1R4NI 3DHHC 4US9A 2BPSA 4US8A 2WGSA 2IY0B 2LD9A 2Z8LA 3AEAB 4A90A 1YJIA 1AN8A 2O2VA 4LNIA 3NZUA 2OJWA 3U8ZA 1XLQA 2IJ0A 3TIXA 1WM2A 1J7CA 3OJ4B 2KOXA 1BUIC 3IAS1 2DNFA 3GS2A 4KIKA 1HEZE 2CHXA 1WXMA 1L4DB 2IO2B 3HIZA 1WY8A 3BZDB 4MGIE 3U7DA 5TR5A 3PT2B 3QWZB 2XEWA 3N1YC 2GBMA 3DQVA 3RYTA 3WANA 4EKUA 3DBRB 4ZOHC 2LVQA 3RZWC 2N7JA 4P1CC 3A4RA 4ICVA 3N1ZC 1T0RC 4TV3A 3DBLB 4USAA 3HVZA 3DVNV 4LLGM 2KFJA 3RD2A 1SSNA 1I4QA 2UYZB 1T0YA 2NPTA 3IAM1 3AB5A 4YT0B 3IBEA 2MW5A 1J0GA 2NBUA 2FCQA 3BVGA 2LGSA 5L95C 4UDUC 4DXFA 3MJ5A 3SFEB 1WXVA 4MT5A 2KJHB 4NY0A 4LCDE 2MBBB 4MELA 2KK8A 3WAPA 3Q8EA 4P1BC 1WXSA 3P2BA 3B2FA 3MP9A 3VXWA 1GC7A 4GDLB 1OEYJ 3U2SC 2DHZA 2C9WB 2M1MA 4C80A 3BVZA 2KMAA 4GIVA 3RNGC 1P0RA 2L52A 4F8CB 4FULA 3J9CA 2L05A 3VHTC 2NCNA 1WI0A 4KGSA 3PTFC 2C5LC 1WGDA 3MC9A 3NVYA 4TUUA 4ZDVA 4MSQB 1KTKA 3B9JA 2NTSA 3APDA 3H7PB 4ZRJA 5AZHA 1SEBD 2LZ6A 4YL8A 4JE3B 2JY6A 2D11A 1UBQA 3H8HA 2K8CA 4NNJB 4B9KA 4K81A 2MEKA 1KLUD 2R2QA 2DWQA 3V6EB 2MA9B 3D32A 2MQJA 4CYEA 4FA6A 1OQRA 1WX9A 4AJWA 4KGRA 1WMHB 3P4RB 5CHVC 1K8RB 1WXQA 2D10A 2Y5CA 1PYWD 1R7SA 1A70A 2CR5A 2E3TA 1R4MI 2QMTA 4AJYB 1YD8U 1D5XC 1FXAA 3TJPA 1FRRA 2QCZA 3NRZA 1YJJA 2LVPA 1FEHA 2DAJA 1UZXB 2GBRA 4LJPB 4DDGD 3JVZX 2BKRB 4C00A 4FJVB 2EMSA 1GC6A 4WJOA 4WH4A 1LGRA 1QQRA 1B9RA 1E90A 2WDVB 1BT0A 4NAMA 2I38A 1FNVA 1SF0A 4MGZE 1G6JA 3KH0A 5D3DA 4NQLB 3PLVA 4EZLA 2O6VD 5D2MB 1RWSA 1E9MA 2IDYA 3W5UB 2FUHB 2LWPA 2W55A 1F9JA 2LMCA 2KJRA 4DXAB 4IC7B 2DYBA 1WWTA 4KDIC 4MDKE 3A1QB 1PGXA 4ITKA 1C79A 3ZDTA 1ZKHA 1TBEA 4H2AA 3L54A 2V3SA 1VZ7A 3NG0A 1WE7A 4E71A 2V0GA 1DGJA 5H8YE 5DPWA 5EE1A 4OZCA 2L0FA 2IO3B 3IT4B 4RGTA 2K0PA 2QC8A 1NI3A 3N32A 1EO6A 4PYZA 4DDID 2HTME 3FC4A 1AWDA 2RDGA 1NENB 1D5MC 5IA7A 4KGTA 2LXCA 1OTRB 4ARIA 3RULA 2JX5A 3RNEC 3VUYA 2NR2A 2ZZPB 4PS8A 3MC8A 1I35A 2JWUA 2B3AA 4TQ1A 1H4RA 1XT9B 2K8BA 2VH2A 1HZ5A 3VTWA 5C2TB 4IG7B 4WAAA 4HCNB 3CMMB 1MI0A 1T6BX 4F1SA 2KDEB 3UIPB 2K6QA 2O6VA 3ZRFA 4W9CA 2XBBC 2V4IB 3KYDD 1VJKA 4W9FA 2ICIA 4P6VF 3V61A 2M56B 4HPMB 3AEBB 1YN3A 4K1RB 1HXYD 1MFWA 2XK5A 2INCC 1UGJA 3EECA 4YXDB 1JROA 3M62B 1P1AA 2HTHA 4GB9A 3AECB 2LASA 4ANVA 1UELA 1F1HA 3AULA 2KLCA 1RRBA 3W1SC 1SJHD 2MP2B 2GOWA 2JF5A 1N62A 2QIEB 4RM8A 1SE9A 3PVLA 1RYJA 3R3MA 5E6PA 4PS3A 3QHTA 1GPXA 1E7UA 4L1BA 2RPQA 3JYUA 3E56A 2G1EA 3BINA 2HE7A 1XCQL 4WQOB 1UUPA 2WS3B 2KANA 1WRIA 2JYEA 2DBYA 5CHWA 4II3B 4DQOC 3RUIB 4YSXB 2BWES 3C8YA 4MM3A 4I6NB 4FADA 3NY5A 2ZVOA 4RNAA 1QKZA 5IAAC 1WZ0A 1IUEA 1MPEA 3I9V1 4M8NA 1C76A 3Q3NC 3M63B 4N59A 3P4QB 1IP9A 3GE3C 1TS2A 1ROEA 5HFYA 3OJ3A 1XLNA 1YQ3B 2ZW0A 5FR3A 1IPGA 1MJDA 2W3RA 2PVOD 2W82A 1V1OA 2ACZB 3LB8C 4HPPA 2G3QB 5CHFA 3SEBA 2IY1B 2GMIC 2VZKB 4I6LB 3KWLA 3AEFB 5HG2A 2MJEA 2H88B 1FFUA 3PREA 4XC2A 4GN1A 2NBVB 3ZLZA 3NS8A 4FLHA 4LJOB 2PTLA 2M4NA 3EGRA 1WYGA 4M0WA 3NZSA 1ACCA 1XD3B 3NVWA 2FUG1 3ZXVA 4JL9A 2ZCBA 1P3QU 3OAWA 3DHGC 4G3XB 2YEPB 1HZ6A 1B1ZA 1ZW7A 1P98A 3DBRI 3AE8B 1TGZB 1NEKB 3EA6A 2LGXA 2KWDA 2BYFA 2PEAA 5DPSA 2INDC 2YLMA 3R7QA 3DBLI 4KV2A 1JWUD 2ZCCA 3MHSD 3WAOA 3UQBA 2AQ2B 2WXNA 4BKSA 1LFDA 2JVCA 3P63A 3APFA 4TMAB 3QAQA 5AUIA 4ZRPA 1V6EA 1YQ4B 2KC2A 4QAYA 1UF0A 1C1YB 2EKIA 2IGHA 3Q8FA 1XLPA 2JU6X 3L0WB 2DZJA 4GOCA 1TKYA 1E8XA 3N20C 3HUIA 4AP4C 4MEMA 3RNAC 4K3CA 1LQBA 3DPDA 5G5GA 1XF5L 1F52A 3DCGA 5JH5C 1V1PB 5FKAC 1FXTB 1OEYA 4IWPA 4FJZA 4W9IA 3HK0A 4C56C 2MSED 1ZDXA 2Z59B 3AI5A 1TJEA 1DOIA 2D3BA 1L2NA 2BYTA 4N9F4 3NZ3A 2V4LA 3ZVVA 3RI7C 1VDVA 3HVDA 2KO3A 2K3UA 3EFUA 5I4DA 3IG3A 1EF5A 2UWQA 4JWSC 3H1UA 2ZNVB 4ZRKA 1P7EA 4W9KA 3PLUA 2KNBA 3Q8CA 4ZYNA 1N5WA 1QLBB 3SFDB 4A55A 1D4BA 1WIAA 1YQBA 4KSLC 1MHHE 2LXAA 2LHDA 1XO3A 4AOFA 3OWEB 4ANXA 4XYCA 4GXBA 4FXCA 4G11A 3HM6X 3PZDA 3N9YC 1Z2MA 1WM3A 5EDSA 1JALA 2WNMA 4K7SA 1E8WA 2JZ3B 2N7DA 1WH3A 3TMPB 2NBWB 2LFIA 2LUEA 1PQSA 3ONSA 4MSMB 2L3ZA 2PE6B 3Q8BA 5BYQA 3KW5B 4PT5A 3ZJUA 5C23A 2HJ8A 1I4XA 4MGKE 4JX1C 3UGBB 3UQAA 2D07B 1E6EB 1WJNA 4R3DA 4BKGA 3NJTA 3PRPB 3C19A 2AEHA 1WR6E 3EFCA 2KTRB 3BWUD 4OW0A 2RD0A 2GBJA 1GB1A 4GDLA 2NVUI 4WJQA 4OVUA 2W9NA 1PDXA 1F77A 3HM3A 3CIRB 2I1KA 3ZYYX 4JGHB 5AUKA 4LNKA 2KDIA 3L13A 2WDTB 3W1YA 1C78A 4EEWA 4M02A 1VRAB 4HKQA 4M01A 4RFBA 4W9LA 3H9DA 3TBLD 2KYWA 1SIFA 4S0RA 3ZTDA 1E10A 2G9HD 4RM9A 1JW9D 3Q3FA 2K22A 4E74A 4HVBA 2KAJA 2VH1A 4MH0E 2BYEA 1LO5D 2D3CA 2WWZA 4ANWA 4D2KA 2UU7A 1J19A 4YSYB 5JXVA 3UF8A 4YWGG 5LXHA 4GU2A 4GMVA 1WMHA 3AEEB 2MBQA 2LVOA 1F2RI 4NJ7A 1FNWA 1L0XB 4XWWA 3B1LX 1AARA 2WXJA 2K25A 3WAMA 1WX8A 1BMLC 4KDLB 2MBHA 3Q3OC 2WXLA 2K9XA 2N9PC 3IHPC 3PZ8A 2WLBA 3IFWB 2XNAC 3LYYA 1PFDA 2AQ1B 4RF0A 1KJTA 3DBHB 3PHXB 4JWUC 1WE6A 1AYFA 4JLCA 2INPE 3NVZA 2GLSA 1SIJA 3VR8B 1ZP0B 2K6DB 3TUOA 4URKA 1JWBD 5BYSA 4C4VB 1EM7A 2REXA 3KUZA 1MG8A 4KSKC 5LLIA 4HK2A 3AV8A 1JCKB 2OEDA 3W2DA 1R4NB 5BYRA 4DHZB 2EKEC 1MHXA 1XCTL 2SAKA 2B76B 4DXGA 1TZ1A 1UGMA 3JSVB 1V49A 2V1YA 2DAFA 3NVVA 2IGDA 2IPKD 1WGKA 1T3QA 5HI1A 4RF1A 1E0ZA 3A1QA 1WYWB 1VCBA 3U30A 1TS5A 4AUQC 3HRDD 4WIPA 2BQQA 4HCPB 1TIFA 2KDBA 1YX6B 3RMKC 2BBCA 2WX0A 3PRZA 4EOYA 1NYRA 2J7QB 3N1XC 1QILA 3B2GA 2D3AA 3KVFB 2CU1A 1V86A 4ARCA 3O13A 2JWZA 1ESFA 1YMHE 3TEZA 4IM3A 3IXSA 4B0MA 3QARA 3KLSX 4XWTA 2EMTA 4M8MA 2X38A 1QOFA 3TEXA 3MJWA 1DOXA 2D5GA 2C7NB 2LGDA 5DCNA 1FM0D 3OLMD 3GZNB 4DK5A 1JRPA 2J42A 2LGYA 1L5PA 2OJRA 2Z0EB 2WDRB 2ZNVC 2ZVNA 2BW2A 4BOZB 3Q8AA 5HKHA 3AU5A 1OQQA 2M8SA 2KN4A 3KUCB 1WRDB 4KKIA 2QHOA 1I4PA 4PYUA 4IW0A 1FRDA 2N9KA 3QX1A 2L7RA 3U4EG 2H89B 3VAWA 2JPHA 3MTNB 3X0WA 2CU3A 4FN2A 2IZVB 1E8YA 1TKGA 4IDIA 5G55A 2J4XA 3ZIMA 4O1NA 2JSVX 2KXJA 3QCAA 1L4ZB 1ZOYB 2WHIA 1GB4A 1VZ6A 3NS1A 5D7GA 1E7VA 1E5WA 1TYGB 1K53A 1UBIA 5G2NA 5HHDG 1J7AA 3AEDB 5BMHA 2CJNA 1WJUA 2WXIA 5BMIA 2L8JA 1L0VB 1KF6B 5LXIB 2MP2A 3Q3MC 1ZXIA 3JW0X 3BK2A 1GAQB 2N9EB 1FD6A 1K52A 4HLEA 3PS6A 3ZNGC 2MJ3A 2W3SA 3NHEB 2VZKD 4ICUA 4Q2JA 2KHWB 3M95A 2G4SA 1QZEA 3ENEA 1KM7A 3DBSA 3Q6BA 3NOBA 1L6VA 2LGIA 2N1WA 3ZNHB 2BGFA 2N4FA 2IGGA 4WAFA 3O65B 4LNOA 4B0EA 2FAZA 5G5HA 5JHBA 3ZW3A 4DHJD 1TTNA 4IM2A 3AXCA 4ASWC 1KLVA 4DWFA 1FO4A 1ZUD2 3FILB 2FCSA 5AZGA 2MHJA 1D5ZC 4A20A 2KN5A 2K5PA 2V3PA 2L1AA 4K7WA 2GBNA 2FIDA 3FKYA 3A9JB 1CZPA 4HWIB 3Q14C 3V05A 2J0KA 2K8HA 1BXTA 4WURA 2QSDA 4W9DA 1HE8A 1I4RA 1UWMA 4OZBA 2D2QA 2PMVA 5BMGA 3ZNZB 1YN5A 1TT5B 4YTNB 3W5VB 1QOBA 3QQ8B 5E6JA 1V9JA 3L17A 1L0YB 2KQSA 4HRSA 3RNFC 2J0JA 2Q5WD 1DYQA 1V81A 4IWOA 2FE8A 3CSTA 1I7HA 2KWUB 3VUWA 2BWFA 3P4PB 1J8CA 2GRIA 4KZCA 3H6NA 4XDCA 1WGHA 4HROA 3U7ZA 3ZO5B 1WJ4A 3AE4B 5KHQA 3HHMA 3CWIA 3M3JA 2LRUA 1WFYA 4XX5A 4IKGA 2DZKA 4J6IA 3APCA 5JHAA 2WXPA 3VR9B 4OHJA 3V6CB 4HDOA 1I4HA 1N5XA 4C7ZA 1X1MA 4XDDA 3BYTB 2WU5B 1SBBB 4GDKB 2WXQA 4KX6B 2MBOA 1JWAD 1N60A 1PGAA 3RNCC 2DYMA 2PE9A 2KWCA 2BF8B 3KQ4A 3A4SC 2K1FA 4J3OD 2ON8A 4ZYSA 2ZEQA 3SHQA 2ZJDA 4DHJB 1T0SC 1K51A 2AX5A 4MACA 2ZPYA 2KFKB 4MGYE 1V1PA 1VD2A 2LEKA 1V97A 2WXFA 3WCQA 4YSZB 2WU2B 1RLFA 2BYVE 1IBXB 2RPVA 1HQRD 1N61A 3VFKA 2PLPA 4NAWB 5EE0A 2RR9A 4NQKE 1RFAA 1V5TA 2K39A 1SB3C 1XXGA 2BB5A 2KQ7A 1HTQA 4ACFA 4LNFA 1E8ZA 4WWOA 1Q0WB 1SJED 2KDFB 2L83A 2VRRB 2R2OA 3DOWA 2L00B 2BTEA 3VH4B 3T3NA 5IOIA 2JYTA 5EE9A 2WXMA 1KFYB 4IM0A 3UINB 4LK0M 2KDMA 4EZKA 3ZDMC 2V9HA 3ETRA 1WGYA 3R2IA 2AWTA 2V3NA 4MJSB 4AQ7A 3I3TB 5J17A 2KLGA 1QOAA 4NJ6A 3W9CB 1UH6A 2PKOA 2Z0DB 2I1JA 3V62A 4YTMB 5DPTA 3RFZB 2KACA 4I6PA 3AN1A 1YN4A 2KVRA 1KOTA 1C3TA 1FCCC 3DBHI 4CO7A 1YIWA 4IOIE 3TEYA 1TY2A 1ENFA 5L83A 2KTRA 2A5UA 2YVCA 3A9KB 1KH0A 1T5XD 2WX1A 2KWVB 1JRUA 4TSSA 5C1ZA 3L4PA 1P7FA 1QOGA 4FJYA 4RH6A 2M17A 2JQRB 4OVZA 1FPYA 4EE2A 1E7PB 2C7HA 1LXDA 4LDTD 2BKFA 1DOYA 1CQVA 4WJPA 2FIFA 3DWMA 5TSSA 1TS4A 3L16A 4WWNA 3W1SA 4PS7A 4MH8A 2A4ZA 2MLBA 4S17A 1RFKA 4F7ZA 2G4DB 2KMCA 2PIAA 4RGMA 4AWJA 2RGFA 1UD7A 1Z5SB 3OG5A 1H8CA 2IO1B 4B6WA 2L0TA 3DWGC 1NDDA 2IYDB 3PV1A 4LTUA 1P9DU 2LHEA 4RCOA 2C7MB 3EC8A 2O2VB 3PPAA 3Q2AC 4CHKA 4REZA 2JZZA 3H7PA 3RNBC 2OHFA 4KIKB 3GZNI 1JWSD 3FAHA 4BKTA 1VZ8A 3R7RA 3V60A 5D6JB 4XZ4A 3AE5B 3L10B 2JZPA 4P7IA 1Q5WB 4BOSC 3RZFA 3AE6B 4M00A 3TL5A 4W9JA 3ZUNA 4WWPA 1C4PA 3DVGY 1V80A 4C4VA 3AM9A 2CHWA 3ZXRA 1YNTE 3LDZE 5D94A 5E6OA 3UIOB 5GMVA 2NS5A 5AEKB 3RN9C 4RMAA 1Y8RC 4A8XC 3JSVA 5AZFA 4NJCA 2KKCA 4G0NB 3AEGB 1C4AA 3ABVB 5GXGB 1OQYA 3SR6A 2NPTB 2KQ4X 3X23A 2FCNA 4XE0A 4TKNA 4FHKA 4EFOA 3KUDB 4N58A 1ET6A 3KWVA 2Y3AA 4E3CA 3C0RB 3WALA 3B08A 3RT3B 2DYOA 2WXKA 3I57A 3Q69A 4HEA1 4A3OA 2J0MA 3SU8X 1J7BA 3S2AA 1GNUA 1CJEA 3MFGA 4LDTB 4II2B 2N0SB 2I2YA 1GJZA 3DVNU 1KRHA 1EWCA 2NTTA 4P16A 1ZGUB 4HJKA 3P4SB 2R61A 3QK0A 3BVMA 1V5OA 1WZ3A 1OFFA 4EUTA 1V2YA 3RPFC 5H92C 3MHZA 4DBGA 2N7EA 3QIJA 1U4AA 4ZRQA 2INNE 1GG3A 2HJ1A 2WXHA 3VRBB 4TQ0A 3IT6B 2M0XA 1K50A 2N9LA 3SD5A 2HD5B 2DLBA 4WWMA 5T8IA 2AQ3B 1WSPA 3T3OA 2PJHA 5LNK1 2KVZA 5IN7A 1D3ZA 1NBFC 1FFVA 3TCAA 1QT9A 4L2YA 3PSEB 3PZ7A 3TEWA 3R66C 4ZHPA 3I63C 1TZOA 4A9AA 3IVFA 2NMQA 2BB6A 1M94A 1C4CA 3VRAB 2E6XA 1ISNA 5KHOA 1YJ1A 3ZGZA 3AU4A 2N1VA 1FNUA 1FMAD 1F0ZA 5CTRC 1EUVB 4IWQA 3ZNID 5IP4D 3ZJVA 2BT6A 2J52A 2WXGA 2TSSA 3BIID 3WIMA 3V3XA 3DHIC 3GB1A 2IO0B 4ZRIA 2D3GA 3VTUA 2BVCA 3KYCD 1SE2A 1SGHA 1L6UA 2CKHB 2GI9A 2PVGC 4A6QA 2LI5A 4JQWC 2Y5PA 1Q1OA 3GP7A 1FIQA 3ECIA 2C60A 4BFRA 2JRIB 1RM6C 3B0AA 2IBIB 1V8CA 1S1QB 2LRWA 3K9PB 2GBKA 3H7SA 4N6EB 1EU3A 1MG4A 1JMLA 4K3BA 5FR6A 3VTVA 3LJ3A 1CK1A 4DHZE 2ONQA 1ZE3D 2HDEA 1ET9A 3FILA 1I42A 4LNNA 2JUOA 1UWXA 2GB1A 5D3IB 2KTFA 2RDBC 3T9LA 3URYA 1STEA 3SDLC 2KJ6A 3A9JA 1NI2A 1GOZA 1XEEA 1N6ZA 3K9OB 3RCZA 2RMMA 2ZW1A 1VR9A 1R4MB 2M19A 3AE3B 3GOEA 3PRMB 5J2RA 4FHJA 5JZEB 1SE4A 3AE1B 4WQMA 4JPSA 3DDCB 2N9XA 3ZJTA 2DENB 4BBNF 3CF6E 1M4VA 5IKCM 3AH7A 4IUMB 4HDQA 2DZMA 2J53A 2O6VB 1L7YA 2PW9A 2M0AA 2PPHA 3PGEA 1FCLA 2BS3B 3DVGX 2KMMA 4KZ0A 1SXTA 2AL6A 3AE9B 3P1MA 1D6EC 4G50A 2XK5B 2LJ5A 2WYQA 1ZPSA 2WQYB 4NZLB 1Q10A 4W9GA 4ZHOA 2KZRA 5E6NA 2QDFA 3P42A 2EELA 2OOBB 4GGQA 5DPRA 2CJOA 4CQNA 1YOVB 2MX2A 4RGNA 3AE2B 2RSUA 2BS4B 4HPLB 4OVVA 4GDKA 3ZTCA 3QA8A 4ANUA 3EUB2 1ZDVA 4W9HA 4GSWA 2G45B 3ALBA 4C7YA 2FNJB 3L08A 2MBEA 4L23A 3E9SA 1Y56A 1YX5B 2WXOA 1JWMD 4BKSD 1JQ4A 1XLOA 4BAXA 3GE8C 5CX3A 2KFKA 2Y5BB 2KT7A 3EHVA 3VQIA 2QILA 2MH7A 1A5RA 4WJNA 2KX0A 2MJDA 3Q3JA 1FXIA 2MRPA
chains in the Genus database with same CATH topology
1OGWA 2REXA 3KUZA 1MG8A 4KSKC 5LLIA 3UIPB 2K6QA 2WX1A 4HK2A 2KD0A 2DX5B 2KWVB 2O6VA 3ZRFA 1JRUA 5C1ZA 4W9CA 3ZKJC 2MWSB 2XBBC 4DHZB 1WGRA 2EKEC 3KYDD 4W9FA 4A3PA 4NAWA 1TZ1A 4FJYA 1UGMA 3V61A 1WF9A 3JSVB 2M17A 3N30A 2MCNB 1V49A 2V1YA 2C7HA 2DAFA 4HPMB 1GUAB 1LXDA 2AL3A 2DZIA 4LDTD 4K1RB 4KVGB 2XK5A 2BKFA 3PHWB 3A1QA 1WYWB 3T8MA 1VCBA 4WJPA 3U30A 2FIFA 3EECA 4AUQC 3L16A 4WWNA 3W1SA 4HCPB 4PS7A 2A4ZA 2KDBA 1YX6B 2MLBA 3QJZA 2ASQA 3VVWB 2FCMA 2WX0A 4F7ZA 3M62B 2G4DB 3PRZA 1P1AA 2KMCA 4AWJA 4EOYA 1WX7A 2HTHA 2KC1A 4JIOU 2JT4B 4FBJB 2J7QB 2RGFA 1WGGA 1UD7A 1Z5SB 4K7UA 3KVFB 2CU1A 4GB9A 2LASA 5J18A 1V86A 1EF1A 4ANVA 2JWZA 1H8CA 1UELA 3AULA 2IO1B 2KLCA 4MJSA 1RRBA 3W1SC 2AYOB 4IM3A 4W9EA 1RAXA 2MP2B 3QARA 2L0TA 4B6WA 2GOWA 1NDDA 2IYDB 3PV1A 2JF5A 3VDZA 1P9DU 2C7MB 4BBNC 3EC8A 4NPNA 4RM8A 1SE9A 2EMTA 4M8MA 2O2VB 1LM8B 4EZJA 3MJWA 2CS4A 3PPAA 4CHKA 2C7NB 3ML8A 2JZZA 2LGDA 3PVLA 3H7PA 5DCNA 3R3MA 5E6PA 4PS3A 3QHTA 3OLMD 3A33B 1E7UA 4KIKB 3GZNI 4BKTA 2RPQA 4DK5A 3R7RA 3V60A 2JRHA 5D6JB 4M0WB 4XZ4A 3JYUA 3L10B 1S3SG 4P7IA 1Q5WB 4BOSC 3RZFA 2LGYA 3ZRCA 2OJRA 1CMXB 3VH3B 2Z0EB 2ZNVC 2ZVNA 3CSFA 4BOZB 1IYFA 3BINA 3TL5A 4W9JA 2HE7A 3ZUNA 4WWPA 2ZPNA 4WQOB 3DVGY 3QC8B 3AU5A 5HKHA 2KANA 3A9KA 1V80A 2M8SA 1WXAA 2CHWA 5CHWA 4II3B 3LDZE 5D94A 3RUIB 1WJ6A 3KUCB 3N3KB 5E6OA 2BWES 1WRDB 4MM3A 5GMVA 3UIOB 3VUXA 4I6NB 4FADA 2NS5A 2KX3A 3WA0A 3NY5A 2QHOA 5AEKB 4RMAA 1Y8RC 4PYUA 4IW0A 2L76A 2ZVOA 5IAAC 3JSVA 4HXDA 5AZFA 3QX1A 1WZ0A 2L7RA 2KKCA 1XQQA 3VAWA 2JPHA 3MTNB 4G0NB 3ML9A 3X0WA 1OQYA 4FN2A 2IZVB 2NPTB 3BY4B 4M8NA 5BO4B 1E8YA 5G55A 3ZIMA 3X23A 2FCNA 1WR1A 2KXJA 4X57B 3QCAA 4TKNA 2CHZA 3M63B 4FHKA 4EFOA 3KUDB 4B95A 4BVUC 4E3CA 3C0RB 3WALA 1IP9A 3B08A 3RT3B 2DYOA 5D7GA 1E7VA 4A3OA 2J0MA 3SU8X 1E5WA 2JXXA 3OJ3A 3S2AA 1IPGA 1UBIA 5G2NA 1R4NI 1GNUA 2BPSA 1WJUA 4LDTB 2G3QB 2L8JA 5CHFA 2IY0B 4II2B 5LXIB 2MP2A 2LD9A 1GJZA 2IY1B 2GMIC 3DVNU 3JW0X 2N9EB 4I6LB 4HLEA 3PS6A 3ZNGC 1ZGUB 3PREA 2O2VA 4HJKA 3NZUA 3QK0A 3U8ZA 3NHEB 4XC2A 3TIXA 1WM2A 4ICUA 4GN1A 2NBVB 3ZLZA 1V5OA 1WZ3A 2KHWB 3NS8A 3M95A 3OJ4B 4EUTA 4FLHA 1V2YA 2KOXA 2G4SA 4KIKA 1QZEA 3ENEA 4LJOB 2CHXA 1KM7A 1WXMA 2M4NA 2IO2B 3DBSA 3HIZA 3NZSA 1WY8A 1XD3B 4MGIE 4DBGA 3NOBA 3U7DA 4JL9A 2N7EA 5TR5A 2ZCBA 1P3QU 3OAWA 3QIJA 3PT2B 4G3XB 1U4AA 2XEWA 2N1WA 3QWZB 1ZW7A 2GBMA 3DQVA 3RYTA 3WANA 4EKUA 3ZNHB 1P98A 2BGFA 3DBRI 1GG3A 2N4FA 2LVQA 1TGZB 3RZWC 2LGXA 3O65B 3A4RA 2BYFA 4TQ0A 2FAZA 2PEAA 2M0XA 4ICVA 5JHBA 3ZW3A 5DPSA 4DHJD 1TTNA 4IM2A 3SD5A 3AXCA 4ASWC 2HD5B 2YLMA 3R7QA 1KLVA 3DBLI 4TV3A 4DWFA 4KV2A 2FCSA 3DVNV 2KFJA 2PJHA 2ZCCA 3RD2A 3MHSD 5AZGA 3WAOA 3UQBA 1NBFC 1D3ZA 3TCAA 4BKSA 1LFDA 2JVCA 4A20A 2KN5A 3PSEB 2UYZB 3APFA 3QAQA 3R66C 4K7WA 1V6EA 2KC2A 1T0YA 2GBNA 2NPTA 2FIDA 1C1YB 3IVFA 3A9JB 4HWIB 1M94A 2J0KA 2K8HA 3IBEA 2MW5A 3L0WB 1J0GA 1ISNA 2NBUA 4W9DA 2FCQA 5KHOA 2DZJA 1HE8A 1YJ1A 4GOCA 5L95C 1E8XA 2D2QA 3AU4A 4AP4C 2N1VA 4MEMA 1WXVA 4NY0A 1LQBA 2KJHB 3DPDA 3ZNZB 4LCDE 2MBBB 4MELA 2KK8A 3DCGA 3WAPA 5JH5C 1WXSA 1FXTB 1OEYA 4IWPA 5CTRC 4FJZA 4W9IA 1EUVB 3HK0A 4IWQA 2MSED 3ZNID 3P2BA 2Z59B 3QQ8B 3AI5A 1V9JA 3L17A 1L2NA 3VXWA 1GC7A 4GDLB 1OEYJ 2KQSA 4N9F4 2V4LA 3WIMA 2DHZA 3ZVVA 2J0JA 2C9WB 2KO3A 2M1MA 2IO0B 2KMAA 4ZRIA 2D3GA 4GIVA 4IWOA 1V81A 3EFUA 3IG3A 3VTUA 1P0RA 3KYCD 4F8CB 1EF5A 4FULA 1SGHA 2UWQA 2L05A 3VHTC 2NCNA 1WI0A 2CKHB 2C5LC 3CSTA 3PTFC 2KWUB 1WGDA 3VUWA 2BWFA 3H1UA 4TUUA 4ZDVA 4MSQB 2ZNVB 2LI5A 4JQWC 1J8CA 4ZRKA 1Q1OA 3ECIA 4KZCA 3H6NA 4W9KA 3APDA 1WGHA 2C60A 3PLUA 2KNBA 4BFRA 3H7PB 4ZRJA 2JRIB 3B0AA 5AZHA 4ZYNA 2LZ6A 1WJ4A 3ZO5B 5KHQA 4YL8A 3HHMA 2IBIB 2JY6A 2D11A 1UBQA 2LRWA 1S1QB 1WIAA 1YQBA 2GBKA 3K9PB 3H7SA 3M3JA 4KSLC 2K8CA 4NNJB 2LRUA 1WFYA 4XX5A 2LXAA 4B9KA 2DZKA 4J6IA 3APCA 4AOFA 4K81A 5JHAA 5FR6A 3VTVA 3LJ3A 4DHZE 2R2QA 3V6EB 2MA9B 3D32A 4ANXA 3V6CB 4HDOA 1I42A 4GXBA 2MQJA 4CYEA 4FA6A 4G11A 3HM6X 1WX9A 3PZDA 2JUOA 4AJWA 1X1MA 1Z2MA 1WM3A 1WMHB 5EDSA 2KTFA 4GDKB 5CHVC 3T9LA 2MBOA 4K7SA 1E8WA 2JZ3B 2N7DA 1WH3A 3TMPB 1K8RB 2D10A 2NBWB 3SDLC 2DYMA 2LUEA 2KJ6A 2PE9A 2KWCA 1NI2A 2BF8B 3A9JA 3A4SC 1PQSA 2K1FA 3K9OB 3ONSA 4MSMB 2CR5A 3RCZA 2L3ZA 1R4MI 2PE6B 2ZEQA 4AJYB 3GOEA 1YD8U 3SHQA 2ZJDA 3PRMB 4FHJA 5J2RA 5JZEB 4DHJB 3KW5B 5C23A 2HJ8A 3TJPA 4MGKE 2ZPYA 3UGBB 3UQAA 2D07B 1WJNA 2KFKB 2LVPA 3DDCB 4BKGA 2DAJA 3PRPB 2N9XA 4MGYE 1UZXB 2AEHA 2GBRA 1WR6E 4LJPB 4DDGD 2DENB 3JVZX 4BBNF 3CF6E 2BKRB 1VD2A 2KTRB 4FJVB 2EMSA 1GC6A 2RD0A 4WJOA 4IUMB 2GBJA 4HDQA 2DZMA 4GDLA 1E90A 1BT0A 2O6VB 2NVUI 1L7YA 1RLFA 4WJQA 4MGZE 4OVUA 2W9NA 3KH0A 1G6JA 2BYVE 4NQLB 2PPHA 3PGEA 3PLVA 3HM3A 3VFKA 4EZLA 2I1KA 4NAWB 4JGHB 2O6VD 3DVGX 5D2MB 2KDIA 3L13A 2WDTB 3W1YA 2RR9A 4EEWA 2FUHB 2LWPA 4KZ0A 4NQKE 1RFAA 1V5TA 2AL6A 2K39A 1F9JA 4G50A 2KJRA 2KQ7A 2XK5B 4DXAB 4IC7B 2LJ5A 2DYBA 2WYQA 4KDIC 4MDKE 4W9LA 1E8ZA 3A1QB 4WWOA 1Q0WB 2KDFB 2VRRB 2R2OA 3H9DA 3ZDTA 3DOWA 3TBLD 1SIFA 2L00B 3VH4B 3ZTDA 4RM9A 4W9GA 1ZKHA 1TBEA 3Q3FA 3L54A 2V3SA 4E74A 4HVBA 1WE7A 2KZRA 4IM0A 5E6NA 4MH0E 2BYEA 4E71A 3UINB 5DPWA 2WWZA 2OOBB 4GGQA 4ANWA 2L0FA 2IO3B 5DPRA 4EZKA 3ZDMC 1WGYA 3N32A 1EO6A 4PYZA 1J19A 4DDID 2AWTA 2MX2A 3UF8A 2RSUA 4MJSB 4HPLB 5LXHA 4GU2A 3I3TB 5J17A 4GMVA 1WMHA 4OVVA 2KLGA 5IA7A 2LXCA 2MBQA 4GDKA 1OTRB 4NJ6A 2LVOA 3ZTCA 3QA8A 4NJ7A 1UH6A 4ANUA 2Z0DB 2I1JA 3RULA 3B1LX 4W9HA 1AARA 4GSWA 3V62A 2K25A 3VUYA 2G45B 3ALBA 2NR2A 2FNJB 3WAMA 1WX8A 4KDLB 2MBHA 5DPTA 3L08A 2MBEA 2ZZPB 4PS8A 2N9PC 1I35A 1YX5B 3IHPC 4I6PA 3IFWB 2KVRA 1KOTA 2B3AA 4BKSD 1C3TA 1KJTA 3DBHI 4CO7A 3PHXB 4TQ1A 5CX3A 1YIWA 1WE6A 2KFKA 1H4RA 1XT9B 2K8BA 2Y5BB 3EHVA 3VQIA 4JLCA 3VTWA 4IG7B 4WAAA 4HCNB 1A5RA 4WJNA 2KX0A 5L83A 2KTRA 2K6DB 2A5UA 3Q3JA 2YVCA 3CMMB 4URKA 2MRPA 3A9KB 4F1SA 2KDEB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OGW A;  2REX A;  3KUZ A;  1MG8 A;  4KSK C;  5LLI A;  3UIP B;  2K6Q A;  2WX1 A;  4HK2 A;  2KD0 A;  2DX5 B;  2KWV B;  2O6V A;  3ZRF A;  1JRU A;  5C1Z A;  4W9C A;  3ZKJ C;  2MWS B;  2XBB C;  4DHZ B;  1WGR A;  2EKE C;  3KYD D;  4W9F A;  4A3P A;  4NAW A;  1TZ1 A;  4FJY A;  1UGM A;  3V61 A;  1WF9 A;  3JSV B;  2M17 A;  3N30 A;  2MCN B;  1V49 A;  2V1Y A;  2C7H A;  2DAF A;  4HPM B;  1GUA B;  1LXD A;  2AL3 A;  2DZI A;  4LDT D;  4K1R B;  4KVG B;  2XK5 A;  2BKF A;  3PHW B;  3A1Q A;  1WYW B;  3T8M A;  1VCB A;  4WJP A;  3U30 A;  2FIF A;  3EEC A;  4AUQ C;  3L16 A;  4WWN A;  3W1S A;  4HCP B;  4PS7 A;  2A4Z A;  2KDB A;  1YX6 B;  2MLB A;  3QJZ A;  2ASQ A;  3VVW B;  2FCM A;  2WX0 A;  4F7Z A;  3M62 B;  2G4D B;  3PRZ A;  1P1A A;  2KMC A;  4AWJ A;  4EOY A;  1WX7 A;  2HTH A;  2KC1 A;  4JIO U;  2JT4 B;  4FBJ B;  2J7Q B;  2RGF A;  1WGG A;  1UD7 A;  1Z5S B;  4K7U A;  3KVF B;  2CU1 A;  4GB9 A;  2LAS A;  5J18 A;  1V86 A;  1EF1 A;  4ANV A;  2JWZ A;  1H8C A;  1UEL A;  3AUL A;  2IO1 B;  2KLC A;  4MJS A;  1RRB A;  3W1S C;  2AYO B;  4IM3 A;  4W9E A;  1RAX A;  2MP2 B;  3QAR A;  2L0T A;  4B6W A;  2GOW A;  1NDD A;  2IYD B;  3PV1 A;  2JF5 A;  3VDZ A;  1P9D U;  2C7M B;  4BBN C;  3EC8 A;  4NPN A;  4RM8 A;  1SE9 A;  2EMT A;  4M8M A;  2O2V B;  1LM8 B;  4EZJ A;  3MJW A;  2CS4 A;  3PPA A;  4CHK A;  2C7N B;  3ML8 A;  2JZZ A;  2LGD A;  3PVL A;  3H7P A;  5DCN A;  3R3M A;  5E6P A;  4PS3 A;  3QHT A;  3OLM D;  3A33 B;  1E7U A;  4KIK B;  3GZN I;  4BKT A;  2RPQ A;  4DK5 A;  3R7R A;  3V60 A;  2JRH A;  5D6J B;  4M0W B;  4XZ4 A;  3JYU A;  3L10 B;  1S3S G;  4P7I A;  1Q5W B;  4BOS C;  3RZF A;  2LGY A;  3ZRC A;  2OJR A;  1CMX B;  3VH3 B;  2Z0E B;  2ZNV C;  2ZVN A;  3CSF A;  4BOZ B;  1IYF A;  3BIN A;  3TL5 A;  4W9J A;  2HE7 A;  3ZUN A;  4WWP A;  2ZPN A;  4WQO B;  3DVG Y;  3QC8 B;  3AU5 A;  5HKH A;  2KAN A;  3A9K A;  1V80 A;  2M8S A;  1WXA A;  2CHW A;  5CHW A;  4II3 B;  3LDZ E;  5D94 A;  3RUI B;  1WJ6 A;  3KUC B;  3N3K B;  5E6O A;  2BWE S;  1WRD B;  4MM3 A;  5GMV A;  3UIO B;  3VUX A;  4I6N B;  4FAD A;  2NS5 A;  2KX3 A;  3WA0 A;  3NY5 A;  2QHO A;  5AEK B;  4RMA A;  1Y8R C;  4PYU A;  4IW0 A;  2L76 A;  2ZVO A;  5IAA C;  3JSV A;  4HXD A;  5AZF A;  3QX1 A;  1WZ0 A;  2L7R A;  2KKC A;  1XQQ A;  3VAW A;  2JPH A;  3MTN B;  4G0N B;  3ML9 A;  3X0W A;  1OQY A;  4FN2 A;  2IZV B;  2NPT B;  3BY4 B;  4M8N A;  5BO4 B;  1E8Y A;  5G55 A;  3ZIM A;  3X23 A;  2FCN A;  1WR1 A;  2KXJ A;  4X57 B;  3QCA A;  4TKN A;  2CHZ A;  3M63 B;  4FHK A;  4EFO A;  3KUD B;  4B95 A;  4BVU C;  4E3C A;  3C0R B;  3WAL A;  1IP9 A;  3B08 A;  3RT3 B;  2DYO A;  5D7G A;  1E7V A;  4A3O A;  2J0M A;  3SU8 X;  1E5W A;  2JXX A;  3OJ3 A;  3S2A A;  1IPG A;  1UBI A;  5G2N A;  1R4N I;  1GNU A;  2BPS A;  1WJU A;  4LDT B;  2G3Q B;  2L8J A;  5CHF A;  2IY0 B;  4II2 B;  5LXI B;  2MP2 A;  2LD9 A;  1GJZ A;  2IY1 B;  2GMI C;  3DVN U;  3JW0 X;  2N9E B;  4I6L B;  4HLE A;  3PS6 A;  3ZNG C;  1ZGU B;  3PRE A;  2O2V A;  4HJK A;  3NZU A;  3QK0 A;  3U8Z A;  3NHE B;  4XC2 A;  3TIX A;  1WM2 A;  4ICU A;  4GN1 A;  2NBV B;  3ZLZ A;  1V5O A;  1WZ3 A;  2KHW B;  3NS8 A;  3M95 A;  3OJ4 B;  4EUT A;  4FLH A;  1V2Y A;  2KOX A;  2G4S A;  4KIK A;  1QZE A;  3ENE A;  4LJO B;  2CHX A;  1KM7 A;  1WXM A;  2M4N A;  2IO2 B;  3DBS A;  3HIZ A;  3NZS A;  1WY8 A;  1XD3 B;  4MGI E;  4DBG A;  3NOB A;  3U7D A;  4JL9 A;  2N7E A;  5TR5 A;  2ZCB A;  1P3Q U;  3OAW A;  3QIJ A;  3PT2 B;  4G3X B;  1U4A A;  2XEW A;  2N1W A;  3QWZ B;  1ZW7 A;  2GBM A;  3DQV A;  3RYT A;  3WAN A;  4EKU A;  3ZNH B;  1P98 A;  2BGF A;  3DBR I;  1GG3 A;  2N4F A;  2LVQ A;  1TGZ B;  3RZW C;  2LGX A;  3O65 B;  3A4R A;  2BYF A;  4TQ0 A;  2FAZ A;  2PEA A;  2M0X A;  4ICV A;  5JHB A;  3ZW3 A;  5DPS A;  4DHJ D;  1TTN A;  4IM2 A;  3SD5 A;  3AXC A;  4ASW C;  2HD5 B;  2YLM A;  3R7Q A;  1KLV A;  3DBL I;  4TV3 A;  4DWF A;  4KV2 A;  2FCS A;  3DVN V;  2KFJ A;  2PJH A;  2ZCC A;  3RD2 A;  3MHS D;  5AZG A;  3WAO A;  3UQB A;  1NBF C;  1D3Z A;  3TCA A;  4BKS A;  1LFD A;  2JVC A;  4A20 A;  2KN5 A;  3PSE B;  2UYZ B;  3APF A;  3QAQ A;  3R66 C;  4K7W A;  1V6E A;  2KC2 A;  1T0Y A;  2GBN A;  2NPT A;  2FID A;  1C1Y B;  3IVF A;  3A9J B;  4HWI B;  1M94 A;  2J0K A;  2K8H A;  3IBE A;  2MW5 A;  3L0W B;  1J0G A;  1ISN A;  2NBU A;  4W9D A;  2FCQ A;  5KHO A;  2DZJ A;  1HE8 A;  1YJ1 A;  4GOC A;  5L95 C;  1E8X A;  2D2Q A;  3AU4 A;  4AP4 C;  2N1V A;  4MEM A;  1WXV A;  4NY0 A;  1LQB A;  2KJH B;  3DPD A;  3ZNZ B;  4LCD E;  2MBB B;  4MEL A;  2KK8 A;  3DCG A;  3WAP A;  5JH5 C;  1WXS A;  1FXT B;  1OEY A;  4IWP A;  5CTR C;  4FJZ A;  4W9I A;  1EUV B;  3HK0 A;  4IWQ A;  2MSE D;  3ZNI D;  3P2B A;  2Z59 B;  3QQ8 B;  3AI5 A;  1V9J A;  3L17 A;  1L2N A;  3VXW A;  1GC7 A;  4GDL B;  1OEY J;  2KQS A;  4N9F 4;  2V4L A;  3WIM A;  2DHZ A;  3ZVV A;  2J0J A;  2C9W B;  2KO3 A;  2M1M A;  2IO0 B;  2KMA A;  4ZRI A;  2D3G A;  4GIV A;  4IWO A;  1V81 A;  3EFU A;  3IG3 A;  3VTU A;  1P0R A;  3KYC D;  4F8C B;  1EF5 A;  4FUL A;  1SGH A;  2UWQ A;  2L05 A;  3VHT C;  2NCN A;  1WI0 A;  2CKH B;  2C5L C;  3CST A;  3PTF C;  2KWU B;  1WGD A;  3VUW A;  2BWF A;  3H1U A;  4TUU A;  4ZDV A;  4MSQ B;  2ZNV B;  2LI5 A;  4JQW C;  1J8C A;  4ZRK A;  1Q1O A;  3ECI A;  4KZC A;  3H6N A;  4W9K A;  3APD A;  1WGH A;  2C60 A;  3PLU A;  2KNB A;  4BFR A;  3H7P B;  4ZRJ A;  2JRI B;  3B0A A;  5AZH A;  4ZYN A;  2LZ6 A;  1WJ4 A;  3ZO5 B;  5KHQ A;  4YL8 A;  3HHM A;  2IBI B;  2JY6 A;  2D11 A;  1UBQ A;  2LRW A;  1S1Q B;  1WIA A;  1YQB A;  2GBK A;  3K9P B;  3H7S A;  3M3J A;  4KSL C;  2K8C A;  4NNJ B;  2LRU A;  1WFY A;  4XX5 A;  2LXA A;  4B9K A;  2DZK A;  4J6I A;  3APC A;  4AOF A;  4K81 A;  5JHA A;  5FR6 A;  3VTV A;  3LJ3 A;  4DHZ E;  2R2Q A;  3V6E B;  2MA9 B;  3D32 A;  4ANX A;  3V6C B;  4HDO A;  1I42 A;  4GXB A;  2MQJ A;  4CYE A;  4FA6 A;  4G11 A;  3HM6 X;  1WX9 A;  3PZD A;  2JUO A;  4AJW A;  1X1M A;  1Z2M A;  1WM3 A;  1WMH B;  5EDS A;  2KTF A;  4GDK B;  5CHV C;  3T9L A;  2MBO A;  4K7S A;  1E8W A;  2JZ3 B;  2N7D A;  1WH3 A;  3TMP B;  1K8R B;  2D10 A;  2NBW B;  3SDL C;  2DYM A;  2LUE A;  2KJ6 A;  2PE9 A;  2KWC A;  1NI2 A;  2BF8 B;  3A9J A;  3A4S C;  1PQS A;  2K1F A;  3K9O B;  3ONS A;  4MSM B;  2CR5 A;  3RCZ A;  2L3Z A;  1R4M I;  2PE6 B;  2ZEQ A;  4AJY B;  3GOE A;  1YD8 U;  3SHQ A;  2ZJD A;  3PRM B;  4FHJ A;  5J2R A;  5JZE B;  4DHJ B;  3KW5 B;  5C23 A;  2HJ8 A;  3TJP A;  4MGK E;  2ZPY A;  3UGB B;  3UQA A;  2D07 B;  1WJN A;  2KFK B;  2LVP A;  3DDC B;  4BKG A;  2DAJ A;  3PRP B;  2N9X A;  4MGY E;  1UZX B;  2AEH A;  2GBR A;  1WR6 E;  4LJP B;  4DDG D;  2DEN B;  3JVZ X;  4BBN F;  3CF6 E;  2BKR B;  1VD2 A;  2KTR B;  4FJV B;  2EMS A;  1GC6 A;  2RD0 A;  4WJO A;  4IUM B;  2GBJ A;  4HDQ A;  2DZM A;  4GDL A;  1E90 A;  1BT0 A;  2O6V B;  2NVU I;  1L7Y A;  1RLF A;  4WJQ A;  4MGZ E;  4OVU A;  2W9N A;  3KH0 A;  1G6J A;  2BYV E;  4NQL B;  2PPH A;  3PGE A;  3PLV A;  3HM3 A;  3VFK A;  4EZL A;  2I1K A;  4NAW B;  4JGH B;  2O6V D;  3DVG X;  5D2M B;  2KDI A;  3L13 A;  2WDT B;  3W1Y A;  2RR9 A;  4EEW A;  2FUH B;  2LWP A;  4KZ0 A;  4NQK E;  1RFA A;  1V5T A;  2AL6 A;  2K39 A;  1F9J A;  4G50 A;  2KJR A;  2KQ7 A;  2XK5 B;  4DXA B;  4IC7 B;  2LJ5 A;  2DYB A;  2WYQ A;  4KDI C;  4MDK E;  4W9L A;  1E8Z A;  3A1Q B;  4WWO A;  1Q0W B;  2KDF B;  2VRR B;  2R2O A;  3H9D A;  3ZDT A;  3DOW A;  3TBL D;  1SIF A;  2L00 B;  3VH4 B;  3ZTD A;  4RM9 A;  4W9G A;  1ZKH A;  1TBE A;  3Q3F A;  3L54 A;  2V3S A;  4E74 A;  4HVB A;  1WE7 A;  2KZR A;  4IM0 A;  5E6N A;  4MH0 E;  2BYE A;  4E71 A;  3UIN B;  5DPW A;  2WWZ A;  2OOB B;  4GGQ A;  4ANW A;  2L0F A;  2IO3 B;  5DPR A;  4EZK A;  3ZDM C;  1WGY A;  3N32 A;  1EO6 A;  4PYZ A;  1J19 A;  4DDI D;  2AWT A;  2MX2 A;  3UF8 A;  2RSU A;  4MJS B;  4HPL B;  5LXH A;  4GU2 A;  3I3T B;  5J17 A;  4GMV A;  1WMH A;  4OVV A;  2KLG A;  5IA7 A;  2LXC A;  2MBQ A;  4GDK A;  1OTR B;  4NJ6 A;  2LVO A;  3ZTC A;  3QA8 A;  4NJ7 A;  1UH6 A;  4ANU A;  2Z0D B;  2I1J A;  3RUL A;  3B1L X;  4W9H A;  1AAR A;  4GSW A;  3V62 A;  2K25 A;  3VUY A;  2G45 B;  3ALB A;  2NR2 A;  2FNJ B;  3WAM A;  1WX8 A;  4KDL B;  2MBH A;  5DPT A;  3L08 A;  2MBE A;  2ZZP B;  4PS8 A;  2N9P C;  1I35 A;  1YX5 B;  3IHP C;  4I6P A;  3IFW B;  2KVR A;  1KOT A;  2B3A A;  4BKS D;  1C3T A;  1KJT A;  3DBH I;  4CO7 A;  3PHX B;  4TQ1 A;  5CX3 A;  1YIW A;  1WE6 A;  2KFK A;  1H4R A;  1XT9 B;  2K8B A;  2Y5B B;  3EHV A;  3VQI A;  4JLC A;  3VTW A;  4IG7 B;  4WAA A;  4HCN B;  1A5R A;  4WJN A;  2KX0 A;  5L83 A;  2KTR A;  2K6D B;  2A5U A;  3Q3J A;  2YVC A;  3CMM B;  4URK A;  2MRP A;  3A9K B;  4F1S A;  2KDE B; 
#chains in the Genus database with same CATH topology
 1OGW A;  5MPO A;  2KD0 A;  2DX5 B;  1TKE A;  2WXR A;  4MM3 B;  3ZKJ C;  2MWS B;  2LUM A;  1WGR A;  1IBX A;  4A3P A;  1C77 A;  1T0Q C;  4NAW A;  4YTP B;  1NYQ A;  1WF9 A;  2XN9 C;  3N30 A;  2MCN B;  1GUA B;  3UI3 A;  2AL3 A;  2DZI A;  4KVG B;  3PHW B;  1MVK A;  3MC0 B;  3LXF A;  3T8M A;  3QJZ A;  2ASQ A;  2FBW B;  3VVW B;  1IGD A;  2FCM A;  3PO0 A;  2WDQ B;  1WX7 A;  2KC1 A;  4JIO U;  4FBJ B;  2JT4 B;  3BYY B;  1WGG A;  3NUH B;  4K7U A;  5J18 A;  2X8X X;  1EF1 A;  1TS3 A;  4MJS A;  2L32 A;  4RGO S;  2AYO B;  4W9E A;  1RAX A;  1AW7 A;  4BZA A;  3VDZ A;  4BBN C;  3AE7 B;  1UNS A;  4NPN A;  1NVI D;  2JXT A;  1IGC A;  1LM8 B;  4EZJ A;  2CS4 A;  3R8B A;  2WP9 B;  3ML8 A;  1HA5 A;  1EU4 A;  3A33 B;  2JRH A;  4M0W B;  5IO9 A;  1S3S G;  2QEJ C;  1F2R C;  3ZRC A;  5EE3 A;  1CMX B;  3VH3 B;  3AMZ A;  3CSF A;  1IYF A;  2ZPN A;  5C3J B;  3QC8 B;  3A9K A;  1WXA A;  1HTO A;  1TY0 A;  1PUT A;  4AS1 A;  1WJ6 A;  3N3K B;  1C9F A;  3VUX A;  4XGA B;  2KX3 A;  5FK9 C;  3WA0 A;  2SEB D;  1KLG D;  3U52 E;  2L76 A;  4GLS C;  2RDH A;  4HXD A;  3TSS A;  1PGB A;  4KKJ A;  3I5J C;  1XQQ A;  3R2T A;  4OZA A;  3ZQ4 A;  3ML9 A;  1I4G A;  2W54 A;  3BY4 B;  5BO4 B;  4HKZ E;  1EWY C;  1WR1 A;  2QJL A;  4X57 B;  3BK1 A;  2CHZ A;  1QF6 A;  1VLB A;  4PK1 A;  4B95 A;  4BVU C;  4HJG E;  2YEP F;  2BS2 B;  1ZXH A;  1N63 A;  2LJI A;  1SE3 A;  2JXX A;  1R4N I;  3DHH C;  4US9 A;  2BPS A;  4US8 A;  2WGS A;  2IY0 B;  2LD9 A;  2Z8L A;  3AEA B;  4A90 A;  1YJI A;  1AN8 A;  2O2V A;  4LNI A;  3NZU A;  2OJW A;  3U8Z A;  1XLQ A;  2IJ0 A;  3TIX A;  1WM2 A;  1J7C A;  3OJ4 B;  2KOX A;  1BUI C;  3IAS 1;  2DNF A;  3GS2 A;  4KIK A;  1HEZ E;  2CHX A;  1WXM A;  1L4D B;  2IO2 B;  3HIZ A;  1WY8 A;  3BZD B;  4MGI E;  3U7D A;  5TR5 A;  3PT2 B;  3QWZ B;  2XEW A;  3N1Y C;  2GBM A;  3DQV A;  3RYT A;  3WAN A;  4EKU A;  3DBR B;  4ZOH C;  2LVQ A;  3RZW C;  2N7J A;  4P1C C;  3A4R A;  4ICV A;  3N1Z C;  1T0R C;  4TV3 A;  3DBL B;  4USA A;  3HVZ A;  3DVN V;  4LLG M;  2KFJ A;  3RD2 A;  1SSN A;  1I4Q A;  2UYZ B;  1T0Y A;  2NPT A;  3IAM 1;  3AB5 A;  4YT0 B;  3IBE A;  2MW5 A;  1J0G A;  2NBU A;  2FCQ A;  3BVG A;  2LGS A;  5L95 C;  4UDU C;  4DXF A;  3MJ5 A;  3SFE B;  1WXV A;  4MT5 A;  2KJH B;  4NY0 A;  4LCD E;  2MBB B;  4MEL A;  2KK8 A;  3WAP A;  3Q8E A;  4P1B C;  1WXS A;  3P2B A;  3B2F A;  3MP9 A;  3VXW A;  1GC7 A;  4GDL B;  1OEY J;  3U2S C;  2DHZ A;  2C9W B;  2M1M A;  4C80 A;  3BVZ A;  2KMA A;  4GIV A;  3RNG C;  1P0R A;  2L52 A;  4F8C B;  4FUL A;  3J9C A;  2L05 A;  3VHT C;  2NCN A;  1WI0 A;  4KGS A;  3PTF C;  2C5L C;  1WGD A;  3MC9 A;  3NVY A;  4TUU A;  4ZDV A;  4MSQ B;  1KTK A;  3B9J A;  2NTS A;  3APD A;  3H7P B;  4ZRJ A;  5AZH A;  1SEB D;  2LZ6 A;  4YL8 A;  4JE3 B;  2JY6 A;  2D11 A;  1UBQ A;  3H8H A;  2K8C A;  4NNJ B;  4B9K A;  4K81 A;  2MEK A;  1KLU D;  2R2Q A;  2DWQ A;  3V6E B;  2MA9 B;  3D32 A;  2MQJ A;  4CYE A;  4FA6 A;  1OQR A;  1WX9 A;  4AJW A;  4KGR A;  1WMH B;  3P4R B;  5CHV C;  1K8R B;  1WXQ A;  2D10 A;  2Y5C A;  1PYW D;  1R7S A;  1A70 A;  2CR5 A;  2E3T A;  1R4M I;  2QMT A;  4AJY B;  1YD8 U;  1D5X C;  1FXA A;  3TJP A;  1FRR A;  2QCZ A;  3NRZ A;  1YJJ A;  2LVP A;  1FEH A;  2DAJ A;  1UZX B;  2GBR A;  4LJP B;  4DDG D;  3JVZ X;  2BKR B;  4C00 A;  4FJV B;  2EMS A;  1GC6 A;  4WJO A;  4WH4 A;  1LGR A;  1QQR A;  1B9R A;  1E90 A;  2WDV B;  1BT0 A;  4NAM A;  2I38 A;  1FNV A;  1SF0 A;  4MGZ E;  1G6J A;  3KH0 A;  5D3D A;  4NQL B;  3PLV A;  4EZL A;  2O6V D;  5D2M B;  1RWS A;  1E9M A;  2IDY A;  3W5U B;  2FUH B;  2LWP A;  2W55 A;  1F9J A;  2LMC A;  2KJR A;  4DXA B;  4IC7 B;  2DYB A;  1WWT A;  4KDI C;  4MDK E;  3A1Q B;  1PGX A;  4ITK A;  1C79 A;  3ZDT A;  1ZKH A;  1TBE A;  4H2A A;  3L54 A;  2V3S A;  1VZ7 A;  3NG0 A;  1WE7 A;  4E71 A;  2V0G A;  1DGJ A;  5H8Y E;  5DPW A;  5EE1 A;  4OZC A;  2L0F A;  2IO3 B;  3IT4 B;  4RGT A;  2K0P A;  2QC8 A;  1NI3 A;  3N32 A;  1EO6 A;  4PYZ A;  4DDI D;  2HTM E;  3FC4 A;  1AWD A;  2RDG A;  1NEN B;  1D5M C;  5IA7 A;  4KGT A;  2LXC A;  1OTR B;  4ARI A;  3RUL A;  2JX5 A;  3RNE C;  3VUY A;  2NR2 A;  2ZZP B;  4PS8 A;  3MC8 A;  1I35 A;  2JWU A;  2B3A A;  4TQ1 A;  1H4R A;  1XT9 B;  2K8B A;  2VH2 A;  1HZ5 A;  3VTW A;  5C2T B;  4IG7 B;  4WAA A;  4HCN B;  3CMM B;  1MI0 A;  1T6B X;  4F1S A;  2KDE B;  3UIP B;  2K6Q A;  2O6V A;  3ZRF A;  4W9C A;  2XBB C;  2V4I B;  3KYD D;  1VJK A;  4W9F A;  2ICI A;  4P6V F;  3V61 A;  2M56 B;  4HPM B;  3AEB B;  1YN3 A;  4K1R B;  1HXY D;  1MFW A;  2XK5 A;  2INC C;  1UGJ A;  3EEC A;  4YXD B;  1JRO A;  3M62 B;  1P1A A;  2HTH A;  4GB9 A;  3AEC B;  2LAS A;  4ANV A;  1UEL A;  1F1H A;  3AUL A;  2KLC A;  1RRB A;  3W1S C;  1SJH D;  2MP2 B;  2GOW A;  2JF5 A;  1N62 A;  2QIE B;  4RM8 A;  1SE9 A;  3PVL A;  1RYJ A;  3R3M A;  5E6P A;  4PS3 A;  3QHT A;  1GPX A;  1E7U A;  4L1B A;  2RPQ A;  3JYU A;  3E56 A;  2G1E A;  3BIN A;  2HE7 A;  1XCQ L;  4WQO B;  1UUP A;  2WS3 B;  2KAN A;  1WRI A;  2JYE A;  2DBY A;  5CHW A;  4II3 B;  4DQO C;  3RUI B;  4YSX B;  2BWE S;  3C8Y A;  4MM3 A;  4I6N B;  4FAD A;  3NY5 A;  2ZVO A;  4RNA A;  1QKZ A;  5IAA C;  1WZ0 A;  1IUE A;  1MPE A;  3I9V 1;  4M8N A;  1C76 A;  3Q3N C;  3M63 B;  4N59 A;  3P4Q B;  1IP9 A;  3GE3 C;  1TS2 A;  1ROE A;  5HFY A;  3OJ3 A;  1XLN A;  1YQ3 B;  2ZW0 A;  5FR3 A;  1IPG A;  1MJD A;  2W3R A;  2PVO D;  2W82 A;  1V1O A;  2ACZ B;  3LB8 C;  4HPP A;  2G3Q B;  5CHF A;  3SEB A;  2IY1 B;  2GMI C;  2VZK B;  4I6L B;  3KWL A;  3AEF B;  5HG2 A;  2MJE A;  2H88 B;  1FFU A;  3PRE A;  4XC2 A;  4GN1 A;  2NBV B;  3ZLZ A;  3NS8 A;  4FLH A;  4LJO B;  2PTL A;  2M4N A;  3EGR A;  1WYG A;  4M0W A;  3NZS A;  1ACC A;  1XD3 B;  3NVW A;  2FUG 1;  3ZXV A;  4JL9 A;  2ZCB A;  1P3Q U;  3OAW A;  3DHG C;  4G3X B;  2YEP B;  1HZ6 A;  1B1Z A;  1ZW7 A;  1P98 A;  3DBR I;  3AE8 B;  1TGZ B;  1NEK B;  3EA6 A;  2LGX A;  2KWD A;  2BYF A;  2PEA A;  5DPS A;  2IND C;  2YLM A;  3R7Q A;  3DBL I;  4KV2 A;  1JWU D;  2ZCC A;  3MHS D;  3WAO A;  3UQB A;  2AQ2 B;  2WXN A;  4BKS A;  1LFD A;  2JVC A;  3P63 A;  3APF A;  4TMA B;  3QAQ A;  5AUI A;  4ZRP A;  1V6E A;  1YQ4 B;  2KC2 A;  4QAY A;  1UF0 A;  1C1Y B;  2EKI A;  2IGH A;  3Q8F A;  1XLP A;  2JU6 X;  3L0W B;  2DZJ A;  4GOC A;  1TKY A;  1E8X A;  3N20 C;  3HUI A;  4AP4 C;  4MEM A;  3RNA C;  4K3C A;  1LQB A;  3DPD A;  5G5G A;  1XF5 L;  1F52 A;  3DCG A;  5JH5 C;  1V1P B;  5FKA C;  1FXT B;  1OEY A;  4IWP A;  4FJZ A;  4W9I A;  3HK0 A;  4C56 C;  2MSE D;  1ZDX A;  2Z59 B;  3AI5 A;  1TJE A;  1DOI A;  2D3B A;  1L2N A;  2BYT A;  4N9F 4;  3NZ3 A;  2V4L A;  3ZVV A;  3RI7 C;  1VDV A;  3HVD A;  2KO3 A;  2K3U A;  3EFU A;  5I4D A;  3IG3 A;  1EF5 A;  2UWQ A;  4JWS C;  3H1U A;  2ZNV B;  4ZRK A;  1P7E A;  4W9K A;  3PLU A;  2KNB A;  3Q8C A;  4ZYN A;  1N5W A;  1QLB B;  3SFD B;  4A55 A;  1D4B A;  1WIA A;  1YQB A;  4KSL C;  1MHH E;  2LXA A;  2LHD A;  1XO3 A;  4AOF A;  3OWE B;  4ANX A;  4XYC A;  4GXB A;  4FXC A;  4G11 A;  3HM6 X;  3PZD A;  3N9Y C;  1Z2M A;  1WM3 A;  5EDS A;  1JAL A;  2WNM A;  4K7S A;  1E8W A;  2JZ3 B;  2N7D A;  1WH3 A;  3TMP B;  2NBW B;  2LFI A;  2LUE A;  1PQS A;  3ONS A;  4MSM B;  2L3Z A;  2PE6 B;  3Q8B A;  5BYQ A;  3KW5 B;  4PT5 A;  3ZJU A;  5C23 A;  2HJ8 A;  1I4X A;  4MGK E;  4JX1 C;  3UGB B;  3UQA A;  2D07 B;  1E6E B;  1WJN A;  4R3D A;  4BKG A;  3NJT A;  3PRP B;  3C19 A;  2AEH A;  1WR6 E;  3EFC A;  2KTR B;  3BWU D;  4OW0 A;  2RD0 A;  2GBJ A;  1GB1 A;  4GDL A;  2NVU I;  4WJQ A;  4OVU A;  2W9N A;  1PDX A;  1F77 A;  3HM3 A;  3CIR B;  2I1K A;  3ZYY X;  4JGH B;  5AUK A;  4LNK A;  2KDI A;  3L13 A;  2WDT B;  3W1Y A;  1C78 A;  4EEW A;  4M02 A;  1VRA B;  4HKQ A;  4M01 A;  4RFB A;  4W9L A;  3H9D A;  3TBL D;  2KYW A;  1SIF A;  4S0R A;  3ZTD A;  1E10 A;  2G9H D;  4RM9 A;  1JW9 D;  3Q3F A;  2K22 A;  4E74 A;  4HVB A;  2KAJ A;  2VH1 A;  4MH0 E;  2BYE A;  1LO5 D;  2D3C A;  2WWZ A;  4ANW A;  4D2K A;  2UU7 A;  1J19 A;  4YSY B;  5JXV A;  3UF8 A;  4YWG G;  5LXH A;  4GU2 A;  4GMV A;  1WMH A;  3AEE B;  2MBQ A;  2LVO A;  1F2R I;  4NJ7 A;  1FNW A;  1L0X B;  4XWW A;  3B1L X;  1AAR A;  2WXJ A;  2K25 A;  3WAM A;  1WX8 A;  1BML C;  4KDL B;  2MBH A;  3Q3O C;  2WXL A;  2K9X A;  2N9P C;  3IHP C;  3PZ8 A;  2WLB A;  3IFW B;  2XNA C;  3LYY A;  1PFD A;  2AQ1 B;  4RF0 A;  1KJT A;  3DBH B;  3PHX B;  4JWU C;  1WE6 A;  1AYF A;  4JLC A;  2INP E;  3NVZ A;  2GLS A;  1SIJ A;  3VR8 B;  1ZP0 B;  2K6D B;  3TUO A;  4URK A;  1JWB D;  5BYS A;  4C4V B;  1EM7 A;  2REX A;  3KUZ A;  1MG8 A;  4KSK C;  5LLI A;  4HK2 A;  3AV8 A;  1JCK B;  2OED A;  3W2D A;  1R4N B;  5BYR A;  4DHZ B;  2EKE C;  1MHX A;  1XCT L;  2SAK A;  2B76 B;  4DXG A;  1TZ1 A;  1UGM A;  3JSV B;  1V49 A;  2V1Y A;  2DAF A;  3NVV A;  2IGD A;  2IPK D;  1WGK A;  1T3Q A;  5HI1 A;  4RF1 A;  1E0Z A;  3A1Q A;  1WYW B;  1VCB A;  3U30 A;  1TS5 A;  4AUQ C;  3HRD D;  4WIP A;  2BQQ A;  4HCP B;  1TIF A;  2KDB A;  1YX6 B;  3RMK C;  2BBC A;  2WX0 A;  3PRZ A;  4EOY A;  1NYR A;  2J7Q B;  3N1X C;  1QIL A;  3B2G A;  2D3A A;  3KVF B;  2CU1 A;  1V86 A;  4ARC A;  3O13 A;  2JWZ A;  1ESF A;  1YMH E;  3TEZ A;  4IM3 A;  3IXS A;  4B0M A;  3QAR A;  3KLS X;  4XWT A;  2EMT A;  4M8M A;  2X38 A;  1QOF A;  3TEX A;  3MJW A;  1DOX A;  2D5G A;  2C7N B;  2LGD A;  5DCN A;  1FM0 D;  3OLM D;  3GZN B;  4DK5 A;  1JRP A;  2J42 A;  2LGY A;  1L5P A;  2OJR A;  2Z0E B;  2WDR B;  2ZNV C;  2ZVN A;  2BW2 A;  4BOZ B;  3Q8A A;  5HKH A;  3AU5 A;  1OQQ A;  2M8S A;  2KN4 A;  3KUC B;  1WRD B;  4KKI A;  2QHO A;  1I4P A;  4PYU A;  4IW0 A;  1FRD A;  2N9K A;  3QX1 A;  2L7R A;  3U4E G;  2H89 B;  3VAW A;  2JPH A;  3MTN B;  3X0W A;  2CU3 A;  4FN2 A;  2IZV B;  1E8Y A;  1TKG A;  4IDI A;  5G55 A;  2J4X A;  3ZIM A;  4O1N A;  2JSV X;  2KXJ A;  3QCA A;  1L4Z B;  1ZOY B;  2WHI A;  1GB4 A;  1VZ6 A;  3NS1 A;  5D7G A;  1E7V A;  1E5W A;  1TYG B;  1K53 A;  1UBI A;  5G2N A;  5HHD G;  1J7A A;  3AED B;  5BMH A;  2CJN A;  1WJU A;  2WXI A;  5BMI A;  2L8J A;  1L0V B;  1KF6 B;  5LXI B;  2MP2 A;  3Q3M C;  1ZXI A;  3JW0 X;  3BK2 A;  1GAQ B;  2N9E B;  1FD6 A;  1K52 A;  4HLE A;  3PS6 A;  3ZNG C;  2MJ3 A;  2W3S A;  3NHE B;  2VZK D;  4ICU A;  4Q2J A;  2KHW B;  3M95 A;  2G4S A;  1QZE A;  3ENE A;  1KM7 A;  3DBS A;  3Q6B A;  3NOB A;  1L6V A;  2LGI A;  2N1W A;  3ZNH B;  2BGF A;  2N4F A;  2IGG A;  4WAF A;  3O65 B;  4LNO A;  4B0E A;  2FAZ A;  5G5H A;  5JHB A;  3ZW3 A;  4DHJ D;  1TTN A;  4IM2 A;  3AXC A;  4ASW C;  1KLV A;  4DWF A;  1FO4 A;  1ZUD 2;  3FIL B;  2FCS A;  5AZG A;  2MHJ A;  1D5Z C;  4A20 A;  2KN5 A;  2K5P A;  2V3P A;  2L1A A;  4K7W A;  2GBN A;  2FID A;  3FKY A;  3A9J B;  1CZP A;  4HWI B;  3Q14 C;  3V05 A;  2J0K A;  2K8H A;  1BXT A;  4WUR A;  2QSD A;  4W9D A;  1HE8 A;  1I4R A;  1UWM A;  4OZB A;  2D2Q A;  2PMV A;  5BMG A;  3ZNZ B;  1YN5 A;  1TT5 B;  4YTN B;  3W5V B;  1QOB A;  3QQ8 B;  5E6J A;  1V9J A;  3L17 A;  1L0Y B;  2KQS A;  4HRS A;  3RNF C;  2J0J A;  2Q5W D;  1DYQ A;  1V81 A;  4IWO A;  2FE8 A;  3CST A;  1I7H A;  2KWU B;  3VUW A;  2BWF A;  3P4P B;  1J8C A;  2GRI A;  4KZC A;  3H6N A;  4XDC A;  1WGH A;  4HRO A;  3U7Z A;  3ZO5 B;  1WJ4 A;  3AE4 B;  5KHQ A;  3HHM A;  3CWI A;  3M3J A;  2LRU A;  1WFY A;  4XX5 A;  4IKG A;  2DZK A;  4J6I A;  3APC A;  5JHA A;  2WXP A;  3VR9 B;  4OHJ A;  3V6C B;  4HDO A;  1I4H A;  1N5X A;  4C7Z A;  1X1M A;  4XDD A;  3BYT B;  2WU5 B;  1SBB B;  4GDK B;  2WXQ A;  4KX6 B;  2MBO A;  1JWA D;  1N60 A;  1PGA A;  3RNC C;  2DYM A;  2PE9 A;  2KWC A;  2BF8 B;  3KQ4 A;  3A4S C;  2K1F A;  4J3O D;  2ON8 A;  4ZYS A;  2ZEQ A;  3SHQ A;  2ZJD A;  4DHJ B;  1T0S C;  1K51 A;  2AX5 A;  4MAC A;  2ZPY A;  2KFK B;  4MGY E;  1V1P A;  1VD2 A;  2LEK A;  1V97 A;  2WXF A;  3WCQ A;  4YSZ B;  2WU2 B;  1RLF A;  2BYV E;  1IBX B;  2RPV A;  1HQR D;  1N61 A;  3VFK A;  2PLP A;  4NAW B;  5EE0 A;  2RR9 A;  4NQK E;  1RFA A;  1V5T A;  2K39 A;  1SB3 C;  1XXG A;  2BB5 A;  2KQ7 A;  1HTQ A;  4ACF A;  4LNF A;  1E8Z A;  4WWO A;  1Q0W B;  1SJE D;  2KDF B;  2L83 A;  2VRR B;  2R2O A;  3DOW A;  2L00 B;  2BTE A;  3VH4 B;  3T3N A;  5IOI A;  2JYT A;  5EE9 A;  2WXM A;  1KFY B;  4IM0 A;  3UIN B;  4LK0 M;  2KDM A;  4EZK A;  3ZDM C;  2V9H A;  3ETR A;  1WGY A;  3R2I A;  2AWT A;  2V3N A;  4MJS B;  4AQ7 A;  3I3T B;  5J17 A;  2KLG A;  1QOA A;  4NJ6 A;  3W9C B;  1UH6 A;  2PKO A;  2Z0D B;  2I1J A;  3V62 A;  4YTM B;  5DPT A;  3RFZ B;  2KAC A;  4I6P A;  3AN1 A;  1YN4 A;  2KVR A;  1KOT A;  1C3T A;  1FCC C;  3DBH I;  4CO7 A;  1YIW A;  4IOI E;  3TEY A;  1TY2 A;  1ENF A;  5L83 A;  2KTR A;  2A5U A;  2YVC A;  3A9K B;  1KH0 A;  1T5X D;  2WX1 A;  2KWV B;  1JRU A;  4TSS A;  5C1Z A;  3L4P A;  1P7F A;  1QOG A;  4FJY A;  4RH6 A;  2M17 A;  2JQR B;  4OVZ A;  1FPY A;  4EE2 A;  1E7P B;  2C7H A;  1LXD A;  4LDT D;  2BKF A;  1DOY A;  1CQV A;  4WJP A;  2FIF A;  3DWM A;  5TSS A;  1TS4 A;  3L16 A;  4WWN A;  3W1S A;  4PS7 A;  4MH8 A;  2A4Z A;  2MLB A;  4S17 A;  1RFK A;  4F7Z A;  2G4D B;  2KMC A;  2PIA A;  4RGM A;  4AWJ A;  2RGF A;  1UD7 A;  1Z5S B;  3OG5 A;  1H8C A;  2IO1 B;  4B6W A;  2L0T A;  3DWG C;  1NDD A;  2IYD B;  3PV1 A;  4LTU A;  1P9D U;  2LHE A;  4RCO A;  2C7M B;  3EC8 A;  2O2V B;  3PPA A;  3Q2A C;  4CHK A;  4REZ A;  2JZZ A;  3H7P A;  3RNB C;  2OHF A;  4KIK B;  3GZN I;  1JWS D;  3FAH A;  4BKT A;  1VZ8 A;  3R7R A;  3V60 A;  5D6J B;  4XZ4 A;  3AE5 B;  3L10 B;  2JZP A;  4P7I A;  1Q5W B;  4BOS C;  3RZF A;  3AE6 B;  4M00 A;  3TL5 A;  4W9J A;  3ZUN A;  4WWP A;  1C4P A;  3DVG Y;  1V80 A;  4C4V A;  3AM9 A;  2CHW A;  3ZXR A;  1YNT E;  3LDZ E;  5D94 A;  5E6O A;  3UIO B;  5GMV A;  2NS5 A;  5AEK B;  3RN9 C;  4RMA A;  1Y8R C;  4A8X C;  3JSV A;  5AZF A;  4NJC A;  2KKC A;  4G0N B;  3AEG B;  1C4A A;  3ABV B;  5GXG B;  1OQY A;  3SR6 A;  2NPT B;  2KQ4 X;  3X23 A;  2FCN A;  4XE0 A;  4TKN A;  4FHK A;  4EFO A;  3KUD B;  4N58 A;  1ET6 A;  3KWV A;  2Y3A A;  4E3C A;  3C0R B;  3WAL A;  3B08 A;  3RT3 B;  2DYO A;  2WXK A;  3I57 A;  3Q69 A;  4HEA 1;  4A3O A;  2J0M A;  3SU8 X;  1J7B A;  3S2A A;  1GNU A;  1CJE A;  3MFG A;  4LDT B;  4II2 B;  2N0S B;  2I2Y A;  1GJZ A;  3DVN U;  1KRH A;  1EWC A;  2NTT A;  4P16 A;  1ZGU B;  4HJK A;  3P4S B;  2R61 A;  3QK0 A;  3BVM A;  1V5O A;  1WZ3 A;  1OFF A;  4EUT A;  1V2Y A;  3RPF C;  5H92 C;  3MHZ A;  4DBG A;  2N7E A;  3QIJ A;  1U4A A;  4ZRQ A;  2INN E;  1GG3 A;  2HJ1 A;  2WXH A;  3VRB B;  4TQ0 A;  3IT6 B;  2M0X A;  1K50 A;  2N9L A;  3SD5 A;  2HD5 B;  2DLB A;  4WWM A;  5T8I A;  2AQ3 B;  1WSP A;  3T3O A;  2PJH A;  5LNK 1;  2KVZ A;  5IN7 A;  1D3Z A;  1NBF C;  1FFV A;  3TCA A;  1QT9 A;  4L2Y A;  3PSE B;  3PZ7 A;  3TEW A;  3R66 C;  4ZHP A;  3I63 C;  1TZO A;  4A9A A;  3IVF A;  2NMQ A;  2BB6 A;  1M94 A;  1C4C A;  3VRA B;  2E6X A;  1ISN A;  5KHO A;  1YJ1 A;  3ZGZ A;  3AU4 A;  2N1V A;  1FNU A;  1FMA D;  1F0Z A;  5CTR C;  1EUV B;  4IWQ A;  3ZNI D;  5IP4 D;  3ZJV A;  2BT6 A;  2J52 A;  2WXG A;  2TSS A;  3BII D;  3WIM A;  3V3X A;  3DHI C;  3GB1 A;  2IO0 B;  4ZRI A;  2D3G A;  3VTU A;  2BVC A;  3KYC D;  1SE2 A;  1SGH A;  1L6U A;  2CKH B;  2GI9 A;  2PVG C;  4A6Q A;  2LI5 A;  4JQW C;  2Y5P A;  1Q1O A;  3GP7 A;  1FIQ A;  3ECI A;  2C60 A;  4BFR A;  2JRI B;  1RM6 C;  3B0A A;  2IBI B;  1V8C A;  1S1Q B;  2LRW A;  3K9P B;  2GBK A;  3H7S A;  4N6E B;  1EU3 A;  1MG4 A;  1JML A;  4K3B A;  5FR6 A;  3VTV A;  3LJ3 A;  1CK1 A;  4DHZ E;  2ONQ A;  1ZE3 D;  2HDE A;  1ET9 A;  3FIL A;  1I42 A;  4LNN A;  2JUO A;  1UWX A;  2GB1 A;  5D3I B;  2KTF A;  2RDB C;  3T9L A;  3URY A;  1STE A;  3SDL C;  2KJ6 A;  3A9J A;  1NI2 A;  1GOZ A;  1XEE A;  1N6Z A;  3K9O B;  3RCZ A;  2RMM A;  2ZW1 A;  1VR9 A;  1R4M B;  2M19 A;  3AE3 B;  3GOE A;  3PRM B;  5J2R A;  4FHJ A;  5JZE B;  1SE4 A;  3AE1 B;  4WQM A;  4JPS A;  3DDC B;  2N9X A;  3ZJT A;  2DEN B;  4BBN F;  3CF6 E;  1M4V A;  5IKC M;  3AH7 A;  4IUM B;  4HDQ A;  2DZM A;  2J53 A;  2O6V B;  1L7Y A;  2PW9 A;  2M0A A;  2PPH A;  3PGE A;  1FCL A;  2BS3 B;  3DVG X;  2KMM A;  4KZ0 A;  1SXT A;  2AL6 A;  3AE9 B;  3P1M A;  1D6E C;  4G50 A;  2XK5 B;  2LJ5 A;  2WYQ A;  1ZPS A;  2WQY B;  4NZL B;  1Q10 A;  4W9G A;  4ZHO A;  2KZR A;  5E6N A;  2QDF A;  3P42 A;  2EEL A;  2OOB B;  4GGQ A;  5DPR A;  2CJO A;  4CQN A;  1YOV B;  2MX2 A;  4RGN A;  3AE2 B;  2RSU A;  2BS4 B;  4HPL B;  4OVV A;  4GDK A;  3ZTC A;  3QA8 A;  4ANU A;  3EUB 2;  1ZDV A;  4W9H A;  4GSW A;  2G45 B;  3ALB A;  4C7Y A;  2FNJ B;  3L08 A;  2MBE A;  4L23 A;  3E9S A;  1Y56 A;  1YX5 B;  2WXO A;  1JWM D;  4BKS D;  1JQ4 A;  1XLO A;  4BAX A;  3GE8 C;  5CX3 A;  2KFK A;  2Y5B B;  2KT7 A;  3EHV A;  3VQI A;  2QIL A;  2MH7 A;  1A5R A;  4WJN A;  2KX0 A;  2MJD A;  3Q3J A;  1FXI A;  2MRP A; 
#chains in the Genus database with same CATH homology
 1OGW A;  2REX A;  3KUZ A;  1MG8 A;  4KSK C;  5LLI A;  3UIP B;  2K6Q A;  2WX1 A;  4HK2 A;  2KD0 A;  2DX5 B;  2KWV B;  2O6V A;  3ZRF A;  1JRU A;  5C1Z A;  4W9C A;  3ZKJ C;  2MWS B;  2XBB C;  4DHZ B;  1WGR A;  2EKE C;  3KYD D;  4W9F A;  4A3P A;  4NAW A;  1TZ1 A;  4FJY A;  1UGM A;  3V61 A;  1WF9 A;  3JSV B;  2M17 A;  3N30 A;  2MCN B;  1V49 A;  2V1Y A;  2C7H A;  2DAF A;  4HPM B;  1GUA B;  1LXD A;  2AL3 A;  2DZI A;  4LDT D;  4K1R B;  4KVG B;  2XK5 A;  2BKF A;  3PHW B;  3A1Q A;  1WYW B;  3T8M A;  1VCB A;  4WJP A;  3U30 A;  2FIF A;  3EEC A;  4AUQ C;  3L16 A;  4WWN A;  3W1S A;  4HCP B;  4PS7 A;  2A4Z A;  2KDB A;  1YX6 B;  2MLB A;  3QJZ A;  2ASQ A;  3VVW B;  2FCM A;  2WX0 A;  4F7Z A;  3M62 B;  2G4D B;  3PRZ A;  1P1A A;  2KMC A;  4AWJ A;  4EOY A;  1WX7 A;  2HTH A;  2KC1 A;  4JIO U;  2JT4 B;  4FBJ B;  2J7Q B;  2RGF A;  1WGG A;  1UD7 A;  1Z5S B;  4K7U A;  3KVF B;  2CU1 A;  4GB9 A;  2LAS A;  5J18 A;  1V86 A;  1EF1 A;  4ANV A;  2JWZ A;  1H8C A;  1UEL A;  3AUL A;  2IO1 B;  2KLC A;  4MJS A;  1RRB A;  3W1S C;  2AYO B;  4IM3 A;  4W9E A;  1RAX A;  2MP2 B;  3QAR A;  2L0T A;  4B6W A;  2GOW A;  1NDD A;  2IYD B;  3PV1 A;  2JF5 A;  3VDZ A;  1P9D U;  2C7M B;  4BBN C;  3EC8 A;  4NPN A;  4RM8 A;  1SE9 A;  2EMT A;  4M8M A;  2O2V B;  1LM8 B;  4EZJ A;  3MJW A;  2CS4 A;  3PPA A;  4CHK A;  2C7N B;  3ML8 A;  2JZZ A;  2LGD A;  3PVL A;  3H7P A;  5DCN A;  3R3M A;  5E6P A;  4PS3 A;  3QHT A;  3OLM D;  3A33 B;  1E7U A;  4KIK B;  3GZN I;  4BKT A;  2RPQ A;  4DK5 A;  3R7R A;  3V60 A;  2JRH A;  5D6J B;  4M0W B;  4XZ4 A;  3JYU A;  3L10 B;  1S3S G;  4P7I A;  1Q5W B;  4BOS C;  3RZF A;  2LGY A;  3ZRC A;  2OJR A;  1CMX B;  3VH3 B;  2Z0E B;  2ZNV C;  2ZVN A;  3CSF A;  4BOZ B;  1IYF A;  3BIN A;  3TL5 A;  4W9J A;  2HE7 A;  3ZUN A;  4WWP A;  2ZPN A;  4WQO B;  3DVG Y;  3QC8 B;  3AU5 A;  5HKH A;  2KAN A;  3A9K A;  1V80 A;  2M8S A;  1WXA A;  2CHW A;  5CHW A;  4II3 B;  3LDZ E;  5D94 A;  3RUI B;  1WJ6 A;  3KUC B;  3N3K B;  5E6O A;  2BWE S;  1WRD B;  4MM3 A;  5GMV A;  3UIO B;  3VUX A;  4I6N B;  4FAD A;  2NS5 A;  2KX3 A;  3WA0 A;  3NY5 A;  2QHO A;  5AEK B;  4RMA A;  1Y8R C;  4PYU A;  4IW0 A;  2L76 A;  2ZVO A;  5IAA C;  3JSV A;  4HXD A;  5AZF A;  3QX1 A;  1WZ0 A;  2L7R A;  2KKC A;  1XQQ A;  3VAW A;  2JPH A;  3MTN B;  4G0N B;  3ML9 A;  3X0W A;  1OQY A;  4FN2 A;  2IZV B;  2NPT B;  3BY4 B;  4M8N A;  5BO4 B;  1E8Y A;  5G55 A;  3ZIM A;  3X23 A;  2FCN A;  1WR1 A;  2KXJ A;  4X57 B;  3QCA A;  4TKN A;  2CHZ A;  3M63 B;  4FHK A;  4EFO A;  3KUD B;  4B95 A;  4BVU C;  4E3C A;  3C0R B;  3WAL A;  1IP9 A;  3B08 A;  3RT3 B;  2DYO A;  5D7G A;  1E7V A;  4A3O A;  2J0M A;  3SU8 X;  1E5W A;  2JXX A;  3OJ3 A;  3S2A A;  1IPG A;  1UBI A;  5G2N A;  1R4N I;  1GNU A;  2BPS A;  1WJU A;  4LDT B;  2G3Q B;  2L8J A;  5CHF A;  2IY0 B;  4II2 B;  5LXI B;  2MP2 A;  2LD9 A;  1GJZ A;  2IY1 B;  2GMI C;  3DVN U;  3JW0 X;  2N9E B;  4I6L B;  4HLE A;  3PS6 A;  3ZNG C;  1ZGU B;  3PRE A;  2O2V A;  4HJK A;  3NZU A;  3QK0 A;  3U8Z A;  3NHE B;  4XC2 A;  3TIX A;  1WM2 A;  4ICU A;  4GN1 A;  2NBV B;  3ZLZ A;  1V5O A;  1WZ3 A;  2KHW B;  3NS8 A;  3M95 A;  3OJ4 B;  4EUT A;  4FLH A;  1V2Y A;  2KOX A;  2G4S A;  4KIK A;  1QZE A;  3ENE A;  4LJO B;  2CHX A;  1KM7 A;  1WXM A;  2M4N A;  2IO2 B;  3DBS A;  3HIZ A;  3NZS A;  1WY8 A;  1XD3 B;  4MGI E;  4DBG A;  3NOB A;  3U7D A;  4JL9 A;  2N7E A;  5TR5 A;  2ZCB A;  1P3Q U;  3OAW A;  3QIJ A;  3PT2 B;  4G3X B;  1U4A A;  2XEW A;  2N1W A;  3QWZ B;  1ZW7 A;  2GBM A;  3DQV A;  3RYT A;  3WAN A;  4EKU A;  3ZNH B;  1P98 A;  2BGF A;  3DBR I;  1GG3 A;  2N4F A;  2LVQ A;  1TGZ B;  3RZW C;  2LGX A;  3O65 B;  3A4R A;  2BYF A;  4TQ0 A;  2FAZ A;  2PEA A;  2M0X A;  4ICV A;  5JHB A;  3ZW3 A;  5DPS A;  4DHJ D;  1TTN A;  4IM2 A;  3SD5 A;  3AXC A;  4ASW C;  2HD5 B;  2YLM A;  3R7Q A;  1KLV A;  3DBL I;  4TV3 A;  4DWF A;  4KV2 A;  2FCS A;  3DVN V;  2KFJ A;  2PJH A;  2ZCC A;  3RD2 A;  3MHS D;  5AZG A;  3WAO A;  3UQB A;  1NBF C;  1D3Z A;  3TCA A;  4BKS A;  1LFD A;  2JVC A;  4A20 A;  2KN5 A;  3PSE B;  2UYZ B;  3APF A;  3QAQ A;  3R66 C;  4K7W A;  1V6E A;  2KC2 A;  1T0Y A;  2GBN A;  2NPT A;  2FID A;  1C1Y B;  3IVF A;  3A9J B;  4HWI B;  1M94 A;  2J0K A;  2K8H A;  3IBE A;  2MW5 A;  3L0W B;  1J0G A;  1ISN A;  2NBU A;  4W9D A;  2FCQ A;  5KHO A;  2DZJ A;  1HE8 A;  1YJ1 A;  4GOC A;  5L95 C;  1E8X A;  2D2Q A;  3AU4 A;  4AP4 C;  2N1V A;  4MEM A;  1WXV A;  4NY0 A;  1LQB A;  2KJH B;  3DPD A;  3ZNZ B;  4LCD E;  2MBB B;  4MEL A;  2KK8 A;  3DCG A;  3WAP A;  5JH5 C;  1WXS A;  1FXT B;  1OEY A;  4IWP A;  5CTR C;  4FJZ A;  4W9I A;  1EUV B;  3HK0 A;  4IWQ A;  2MSE D;  3ZNI D;  3P2B A;  2Z59 B;  3QQ8 B;  3AI5 A;  1V9J A;  3L17 A;  1L2N A;  3VXW A;  1GC7 A;  4GDL B;  1OEY J;  2KQS A;  4N9F 4;  2V4L A;  3WIM A;  2DHZ A;  3ZVV A;  2J0J A;  2C9W B;  2KO3 A;  2M1M A;  2IO0 B;  2KMA A;  4ZRI A;  2D3G A;  4GIV A;  4IWO A;  1V81 A;  3EFU A;  3IG3 A;  3VTU A;  1P0R A;  3KYC D;  4F8C B;  1EF5 A;  4FUL A;  1SGH A;  2UWQ A;  2L05 A;  3VHT C;  2NCN A;  1WI0 A;  2CKH B;  2C5L C;  3CST A;  3PTF C;  2KWU B;  1WGD A;  3VUW A;  2BWF A;  3H1U A;  4TUU A;  4ZDV A;  4MSQ B;  2ZNV B;  2LI5 A;  4JQW C;  1J8C A;  4ZRK A;  1Q1O A;  3ECI A;  4KZC A;  3H6N A;  4W9K A;  3APD A;  1WGH A;  2C60 A;  3PLU A;  2KNB A;  4BFR A;  3H7P B;  4ZRJ A;  2JRI B;  3B0A A;  5AZH A;  4ZYN A;  2LZ6 A;  1WJ4 A;  3ZO5 B;  5KHQ A;  4YL8 A;  3HHM A;  2IBI B;  2JY6 A;  2D11 A;  1UBQ A;  2LRW A;  1S1Q B;  1WIA A;  1YQB A;  2GBK A;  3K9P B;  3H7S A;  3M3J A;  4KSL C;  2K8C A;  4NNJ B;  2LRU A;  1WFY A;  4XX5 A;  2LXA A;  4B9K A;  2DZK A;  4J6I A;  3APC A;  4AOF A;  4K81 A;  5JHA A;  5FR6 A;  3VTV A;  3LJ3 A;  4DHZ E;  2R2Q A;  3V6E B;  2MA9 B;  3D32 A;  4ANX A;  3V6C B;  4HDO A;  1I42 A;  4GXB A;  2MQJ A;  4CYE A;  4FA6 A;  4G11 A;  3HM6 X;  1WX9 A;  3PZD A;  2JUO A;  4AJW A;  1X1M A;  1Z2M A;  1WM3 A;  1WMH B;  5EDS A;  2KTF A;  4GDK B;  5CHV C;  3T9L A;  2MBO A;  4K7S A;  1E8W A;  2JZ3 B;  2N7D A;  1WH3 A;  3TMP B;  1K8R B;  2D10 A;  2NBW B;  3SDL C;  2DYM A;  2LUE A;  2KJ6 A;  2PE9 A;  2KWC A;  1NI2 A;  2BF8 B;  3A9J A;  3A4S C;  1PQS A;  2K1F A;  3K9O B;  3ONS A;  4MSM B;  2CR5 A;  3RCZ A;  2L3Z A;  1R4M I;  2PE6 B;  2ZEQ A;  4AJY B;  3GOE A;  1YD8 U;  3SHQ A;  2ZJD A;  3PRM B;  4FHJ A;  5J2R A;  5JZE B;  4DHJ B;  3KW5 B;  5C23 A;  2HJ8 A;  3TJP A;  4MGK E;  2ZPY A;  3UGB B;  3UQA A;  2D07 B;  1WJN A;  2KFK B;  2LVP A;  3DDC B;  4BKG A;  2DAJ A;  3PRP B;  2N9X A;  4MGY E;  1UZX B;  2AEH A;  2GBR A;  1WR6 E;  4LJP B;  4DDG D;  2DEN B;  3JVZ X;  4BBN F;  3CF6 E;  2BKR B;  1VD2 A;  2KTR B;  4FJV B;  2EMS A;  1GC6 A;  2RD0 A;  4WJO A;  4IUM B;  2GBJ A;  4HDQ A;  2DZM A;  4GDL A;  1E90 A;  1BT0 A;  2O6V B;  2NVU I;  1L7Y A;  1RLF A;  4WJQ A;  4MGZ E;  4OVU A;  2W9N A;  3KH0 A;  1G6J A;  2BYV E;  4NQL B;  2PPH A;  3PGE A;  3PLV A;  3HM3 A;  3VFK A;  4EZL A;  2I1K A;  4NAW B;  4JGH B;  2O6V D;  3DVG X;  5D2M B;  2KDI A;  3L13 A;  2WDT B;  3W1Y A;  2RR9 A;  4EEW A;  2FUH B;  2LWP A;  4KZ0 A;  4NQK E;  1RFA A;  1V5T A;  2AL6 A;  2K39 A;  1F9J A;  4G50 A;  2KJR A;  2KQ7 A;  2XK5 B;  4DXA B;  4IC7 B;  2LJ5 A;  2DYB A;  2WYQ A;  4KDI C;  4MDK E;  4W9L A;  1E8Z A;  3A1Q B;  4WWO A;  1Q0W B;  2KDF B;  2VRR B;  2R2O A;  3H9D A;  3ZDT A;  3DOW A;  3TBL D;  1SIF A;  2L00 B;  3VH4 B;  3ZTD A;  4RM9 A;  4W9G A;  1ZKH A;  1TBE A;  3Q3F A;  3L54 A;  2V3S A;  4E74 A;  4HVB A;  1WE7 A;  2KZR A;  4IM0 A;  5E6N A;  4MH0 E;  2BYE A;  4E71 A;  3UIN B;  5DPW A;  2WWZ A;  2OOB B;  4GGQ A;  4ANW A;  2L0F A;  2IO3 B;  5DPR A;  4EZK A;  3ZDM C;  1WGY A;  3N32 A;  1EO6 A;  4PYZ A;  1J19 A;  4DDI D;  2AWT A;  2MX2 A;  3UF8 A;  2RSU A;  4MJS B;  4HPL B;  5LXH A;  4GU2 A;  3I3T B;  5J17 A;  4GMV A;  1WMH A;  4OVV A;  2KLG A;  5IA7 A;  2LXC A;  2MBQ A;  4GDK A;  1OTR B;  4NJ6 A;  2LVO A;  3ZTC A;  3QA8 A;  4NJ7 A;  1UH6 A;  4ANU A;  2Z0D B;  2I1J A;  3RUL A;  3B1L X;  4W9H A;  1AAR A;  4GSW A;  3V62 A;  2K25 A;  3VUY A;  2G45 B;  3ALB A;  2NR2 A;  2FNJ B;  3WAM A;  1WX8 A;  4KDL B;  2MBH A;  5DPT A;  3L08 A;  2MBE A;  2ZZP B;  4PS8 A;  2N9P C;  1I35 A;  1YX5 B;  3IHP C;  4I6P A;  3IFW B;  2KVR A;  1KOT A;  2B3A A;  4BKS D;  1C3T A;  1KJT A;  3DBH I;  4CO7 A;  3PHX B;  4TQ1 A;  5CX3 A;  1YIW A;  1WE6 A;  2KFK A;  1H4R A;  1XT9 B;  2K8B A;  2Y5B B;  3EHV A;  3VQI A;  4JLC A;  3VTW A;  4IG7 B;  4WAA A;  4HCN B;  1A5R A;  4WJN A;  2KX0 A;  5L83 A;  2KTR A;  2K6D B;  2A5U A;  3Q3J A;  2YVC A;  3CMM B;  4URK A;  2MRP A;  3A9K B;  4F1S A;  2KDE B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...