1QILA

Inactive mutant toxic shock syndrome toxin-1 at 2.5 a
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
194
structure length
194
Chain Sequence
b'STNDNIKDLLDWYSSGSDTFTNSEVLDNSLGSMRIKNTDGSISLIIFPSPYYSPAFTKGEKVDLNTKRTKKSQHTSEGTYIHFQISGVTNTEKLPTPIELPLKVKVHGKDSPLKYWPKFDKKQLAISTLDFEIRAQLTQIHGLYRSSDKTGGYWKITMNDGSTYQSDLSKKFEYNTEKPPINIDEIKTIEAEIN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TOXIC SHOCK SYNDROME TOXIN-1
publication title Crystal structure of a biologically inactive mutant of toxic shock syndrome toxin-1 at 2.5 A resolution.
pubmed rcsb
source organism Staphylococcus aureus
molecule tags Toxin
total genus 59
structure length 194
sequence length 194
chains with identical sequence B, C
ec nomenclature
pdb deposition date 1997-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1qilA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1qilA01
1V1PB 3KLSX 1LT3D 1DYQA 1B44D 1CK1A 3W2DA 1CT1D 1PTOF 1SBBB 1S5FD 1I4GA 1LTAD 4RGOS 4Z9CB 1PRTD 1D5XC 2AQ2B 1SEBD 1FNVA 1S5BD 1STEA 1PRTC 1EFID 1L0YB 1PRTB 1BXTA 2G9HD 3R2TA 4K6LA 2NTTA 2IPKD 1T5XD 1FNWA 2O2LD 1I4QA 5I4DA 1AN8A 3R2IA 1EWCA 1SE2A 1KLUD 1FGBD 3MC0B 4RCOA 3OWEB 1RDPD 2XRSD 3EFXD 1SE4A 1FD7D 3EA6A 1JWMD 1LTTD 2RDHA 1F77A 1SXTA 1V1OA 1UUPA 2XN9C 5D3IB 1KLGD 1EEID 1EEFD 1TY0A 1I4XA 1FNUA 1D5ZC 1L0XB 2SEBD 2AQ1B 1PTOD 3GP7A 4RFBA 4O1NA 1ET9A 1HTLD 1PTOC 3V05A 1EU3A 1PTOB 1D6EC 3BZDB 1GOZA 3MFGA 1TS4A 2WV6D 1CQVA 1TS3A 5FK9C 1DJRD 5ELEA 3CHBD 1PZJD 4C56C 2QEJC 1ET6A 2XRQD 1KTKA 4RHSA 1LTID 1EU4A 1RD9D 3BVGA 2Z8LA 1RF2D 1JQYD 1V1PA 4DXGA 1YN4A 3O13A 3DWAA 1JCKB 1LTGD 3SEBA 2TSSA 4ZYSA 1B1ZA 1LO5D 1TS2A 3R8BA 5ELCA 4RH6A 1BCPF 5FKAC 1YN3A 3DWQA 2IJ0A 1LT5D 1AW7A 1HQRD 1BCPC 1BCPB 1S5DD 3URYA 1LLRD 1I4RA 1I4HA 1G8ZD 1PZID 3BVMA 5ELFA 1PZKD 1QILA 3BYYB 1XXGA 1LTRD 1LT4D 2RDGA 1PTOH 2AQ3B 1TY2A 5ELBA 4UDUC 1YN5A 1D5MC 2R61A 2CHBD 1S5CD 1PRTF 1I4PA 4TSSA 2NTSA 1ESFA 4OHJA 4RGMA 1UNSA 1JWSD 5D3DA 1JR0D 1CHQD 5ELDA 1XTCD 4L63B 1MD2D 5TSSA 1TS5A 1PYWD 1BCPD 3BVZA 1ENFA 1HA5A 4NZLB 1SJED 1RCVD 1S5ED 4RHRA 2QILA 2J4XA 3DWPA 3TSSA 1HXYD 1JWUD 1SJHD 1LTBD 4L6TB 1M4VA 4RGNA 4DXFA 1LTSD 1CHPD 2XNAC 2ICIA 4RGTA 3BYTB 1LT6D 1SE3A 4BWGB
chains in the Genus database with same CATH superfamily
1XQQA 4APVA 4JI5Q 1TWFB 3CCQA 1NBWA 5JEAG 3BJUA 2PZTA 5G3LF 3F2DA 1HZ9A 4IJHA 1N32L 1VQDA 4PS8A 4ZRZA 3WA0A 1TQOA 2M17A 5I9OA 3BDCA 3SFEB 1VMCA 4X66L 1EWCA 2X6LA 1I5FA 4RM8A 4OONA 3CMEA 2NUCA 2IGHA 4LFAL 2XWBB 3OWEB 1FRRA 4B0MA 3A33B 2VY3A 2JU6X 3H3VC 1CZPA 3L10B 4G7ZC 1WWTA 4YHHQ 1WR6E 4GN5A 4BOSC 3JAME 4WJOA 2KJXA 3BS1A 2IO1B 2DBYA 2DZJA 3PT2B 5FLXE 1QZGA 1H9RA 4BBSB 3U4EG 3V2TA 5M5YB 2MBEA 4BVUC 3OIPA 4BZAA 2GMIC 1FNUA 1N5XA 3QQ8B 2HUGA 2MBBB 1DCZA 3V05A 2LY7A 4RA8A 1O7IA 2XVSA 3BZDB 4ALPA 1EUJA 1WTHA 2YTXA 3R7RA 1C9OA 1CQVA 3MXPA 5EBDA 1Q0WB 1YHBA 4NY0A 5T8IA 5M3FG 3ZXVA 4M01A 3AQQA 4JOIA 4LWCA 2KWDA 3M4PA 3D6CA 3G6JB 4WJPA 4JPSA 1O78A 3GE8C 1V43A 1QOBA 4NB3A 4C2MB 3UF8A 4A3KB 3AECB 2L1BA 5IYCH 2E2DC 2B2WC 1ZDVA 1A2TA 1MGSA 2VZKD 1CSPA 2G4SA 4GN3B 2KWCA 1K8MA 3ZDTA 1Q3LA 3SR1A 1GNUA 3QA8A 1CKNB 3AXCA 2MP1A 4ZYSA 1XD3B 4EX5A 1T3QA 5FO8B 4JI4L 2KBNA 2R92H 4IPHA 3J81E 3VTVA 2WXLA 4CHKA 5EKIA 2FINB 2WINB 1R4NI 4ANWA 5C3EG 3LWUA 4BA1I 4DPGA 3M3YB 4KD3A 2DZKA 4GLSC 2CQAA 1TU2B 1TWGB 3BDOA 1I4RA 1WF9A 2KWUB 3W1SA 2ATWA 1I50H 5K5PA 4M8NA 1EQVA 3CCJA 1LT4D 2A8VA 1QOAA 4A75A 2KK8A 2B2VA 4PS3A 2F0PA 1MBYA 3NS8A 2SNSA 1VQBA 4A3IB 3Q8FA 5J22A 1H9KA 5IYBG 1NR2A 5CYUA 4IJLA 2HJ8A 2K5NA 2C7HA 3PIO3 4DR6Q 1FXAA 4HXDA 3D4RA 3NZ3A 5G2NA 3PUVA 4XT1B 1XMOL 2WXNA 2KZRA 3N6RA 3AE4B 3D0FA 4FF1A 1UBQA 4K1RB 2BB5A 3DOWA 4CKBA 2NVTB 1HXYD 2VZAA 3KQ4A 3PZ8A 4KZ0A 3HKZE 3M3JA 1O7YA 2IX1A 4OIJA 4I7AA 1WJ6A 1VQEA 3PREA 1SNPA 1S3SG 2M1MA 3OPOA 1E5WA 2NN6I 3B1LX 3D8GA 2DYMA 1STYA 3LB8C 4UPAA 3DBHI 4R3DA 3PO2G 5C4ZA 1R4MB 4NQLB 3ABVB 2PO4A 5LHY1 4S3SA 4DR7Q 2K14A 5COYA 2AYOB 5LMNL 1B3AA 1NMFA 3CCMA 4DQOC 2AWOA 3AE9B 3VAWA 1STEA 4BY1G 1PRTC 1PRTB 1EIHA 3TJPA 4A90A 3TEWA 4C7ZA 2XWJB 2XTIA 5HURA 4KD4A 4DUZL 1BT0A 1UBIA 2A4ZA 2NBWB 2JRHA 1VQ7A 5C23A 4FULA 2C7NB 1SE2A 1OEYJ 3DPDA 3SE0A 4HROA 1SYEA 5HI1A 4K5WA 3I8ZA 3S15B 2Y5PA 2KVMA 1YNND 2BT6A 2ZW1A 3EA6A 4JI0L 2R93G 2K8CA 5D3IB 2JA5H 4JI3Q 1SB3C 4B95A 4H0LC 4QUCA 2L0CA 2FCMA 3HOXG 4H7BA 2MHJA 3ZRFA 1TY0A 4UP7A 4HVBA 1AE2A 1Y1WB 4A6QA 4F87A 1L0XB 1OGWA 1ZOYB 4FNFA 3GTQB 2K6DB 4C1NI 2JA6H 3P4QB 3I4NB 1HTLD 1EYGA 1PTOC 1EU3A 1PTOB 2UUAQ 4EOYA 3GQBA 4K6DA 2KWVB 4KX6B 3I4MB 4GKKQ 4BKTA 4G57A 5FK9C 2R2OA 1SNCA 5GROA 2E5LQ 2QEJC 4ZRKA 1XCTL 2CH4W 1W6JA 2KCNA 4LF5Q 3B9JA 4RM9A 3WANA 5C4JB 2NMQA 4GLXA 3EQLC 4DUYQ 4PZ6A 1Q86C 3RI7C 1X3EA 5EKKA 2D3AA 3O13A 1E7ZA 2UXCL 3E56A 5HGTA 4HPLB 4LLGM 1F9SA 1Q1EA 2DN8A 4HCEA 2F0OA 1YJNA 3MXUA 1K73C 3HOYG 1SF0A 2C9WB 2N7JA 3AMZA 5CHWA 4EE2A 2NYZD 2A68D 3P4PB 3KW5B 3RNGC 2O5JC 5I9PA 3U9OA 1J7CA 5AUIA 1HQRD 2TMPA 1XCQL 2KN5A 3ZRCA 3R7QA 4KKJA 3W5UB 3URYA 1E7UA 2ZJPA 3NHEB 3A74A 2EYFA 1A6XA 3NBIA 4XDCA 1CKOA 4GNXC 4GNXB 1EF5A 3JSVA 4F1SA 1NAPA 2EYHA 1X55A 3RYTA 3I63C 5ELBA 3KLSA 2QIEB 1PMRA 1JWBD 4OZAA 5E1FA 1VLBA 2MQHA 5IT9c 5JVG3 4UHVA 1AZQA 4XYCA 4N58A 4UAIA 1TR5A 4IOCA 4IFDG 2WHIA 2BS2B 3QC8B 1PFBA 3MZ5A 3J7ZC 2EYOA 2K05A 3CCLA 3K9OB 2B29A 3CW2C 2A73B 2NZOA 4X66Q 4C00A 3P2BA 2MNAA 2MP2A 2NPTB 1N63A 2KOXA 3T56B 5IODA 3C0RB 4IDIA 1PH5A 4RHRA 4P16A 1XNQL 1F2ZA 4IUTA 1LTBD 1TZ1A 3MXGA 4L6TB 3MJ5A 4HJ8A 2L7RA 1IYFA 2IW3A 4JC0A 2EXZA 2GI9A 3N32A 5ELNA 5CV5A 2EY6A 2NWGA 2JZ3B 2VXWA 1E10A 1YNJC 2ICIA 2KLGA 1KABA 4MHEA 1LT3D 1DOIA 1CT1D 4XYQA 1XLOA 3GTPH 2AQ2B 2IWHA 4R1JA 3SHQA 1I6VC 2P5ZX 2PNHA 5FJ8H 3PO3H 1WXSA 2K6QA 3WCQA 1L5PA 1QT9A 1TWCH 4K0KL 2W55A 1A3TA 2RHQB 1AN8A 2RA4A 3NQTA 4AYBB 5C4XH 4BBNC 1FD6A 3EFUA 2K03A 2KNBA 4GDLA 3HOUG 4HJAA 2ON8A 3NHHA 2WX0A 2R92B 5CMDA 3CSFA 3PGEA 4PYUA 3HM6X 4PMBA 5BR8L 4K2KA 5H8YE 2B2TA 3E5SA 1EYAA 3DEPA 2KDIA 2I1JA 1WGGA 3ULPA 3A8JE 4X6AH 4ZOHC 2K33A 1CZWA 1WJNA 1TT5B 3K80C 3L3OC 4BS9A 4FO2A 1I50B 2JYOA 4N8FA 5HGQA 4KIKA 1X65A 4BXXH 4M02A 4RCNA 4EQNA 1WTWA 5IYBH 1J8IA 4K7UA 2IHFA 4LNOA 3GTJH 4V0BA 3J7A5 3VR6A 2PIAA 2E75C 1VQFA 1KAWA 3VHTC 1WTXA 1HEZE 1KTKA 2ZEQA 2N1VA 3Q23A 2KQ7A 3WOEA 4HJGE 3CPWA 4DV2Q 5E7NA 3NY5A 4IKGA 4ODGA 4IWQA 3N3KB 2WLBA 5BN3A 5KIXA 2DUDA 3NBHB 3W3AA 2LUMA 4ZK9B 1XMOQ 1P98A 1IBXA 3PUWA 3PO2H 1G2TA 3I9V1 1YN3A 3ZGZA 1ESRA 4JI1Q 4YWLA 2L4NA 3S2HH 2N7DA 3KF6B 4LUZA 3J7YW 1HR0L 4KSLC 2H4OA 1S5DD 1WXQA 4YY3Q 4WJQA 1VQ6A 1KDCA 4HRSA 4XIGS 3A0JA 4BY7H 2LVQA 3AEVA 2UUBQ 3GTOH 3TS2A 3BZKA 3ONAB 2RDGA 2IY1B 3D4WA 3UE0A 4X62L 2M4NA 4UDUC 1FPYA 4QJFA 5FR3A 4DA2A 2WXPA 2KA7A 1YMHE 5LMNQ 2O6VB 2LS01 4OWXB 3PVLA 4EVOA 2BA0A 1EIFA 4B3ML 4QUFA 2INDC 5KYIA 1YZ6A 3S1RH 2KC2A 2KDFB 3DCGA 1J0GA 1AWDA 3HOXH 4A3IG 3M63B 2JA5B 4HSVA 5KEEA 1WCMG 3VR4A 4DUZQ 1AH9A 2INNE 4MGZE 1NE3A 4TV3A 3IFTA 1QVFA 2PLPA 4WIPA 2F52A 5BN5A 3HHMA 2OEOA 4GN4B 4JI0Q 2F0UA 4CBVA 5IP9H 1OXVA 1NEKB 2JA6B 3D6WA 4A3CH 2BW2A 2D2QA 4LF8Q 2YVCA 2CW0D 3VA7A 3UE1A 3Q3MC 4F7ZA 1DOKA 5L37A 2F03A 1B9RA 1UWXA 4JI6L 2RCFA 3KJPA 2GOWA 1PRTD 2D9UA 4A3EG 2B3GA 1A8VA 4B08A 4NNJB 4ZDVA 1Y56A 1B9MA 4C1NK 4DV0L 1ZE3D 4OX9L 3AN1A 1EY4A 1SLJA 4KMUC 5CC4A 4LF7Q 2N4FA 1T5XD 3A9KB 4I6LB 2W3RA 4LJOB 3HOZB 1Z7TA 2QCPX 4FJYA 3VDZA 5JOBA 3S1MH 3P1HA 3CCRA 2VQFL 3M4YA 4LFBL 3VR5A 3FRPB 1AZPA 2DAFA 2XRSD 1TTNA 4XX5A 2RF4A 4UY8C 3TREA 1IPGA 1N9WA 3SDLC 1MJCA 2XN9C 2WS3B 1PH9A 1EQQA 4KY6A 4GXBA 2RDBC 2MLBA 2FE8A 2DWQA 4J6HA 3P20A 2Z9HA 3NTIA 3L08A 3U7DA 1W6KA 1PTOD 2N1WA 3QWZB 4XGAB 4WH4A 1YEZA 1L0WA 3CXCA 3JYUA 1TS3A 4IZ8A 4IFDH 2LJ5A 4B3TL 2Z0SA 5C3WA 3G6EA 1GUOA 4TMAB 3OTOQ 3N1XC 1NMGA 2BTEA 3I4MG 4G7HC 4JG2A 3VR3A 2O4XA 1VS0A 3VXWA 4FDBA 3S1QH 1DGJA 4YWMA 3K58A 2NVXH 1LTID 2EELA 2MQJA 1L6VA 1YITA 4NKLA 3M85A 2BOSA 2MBQA 1C8CA 4HEDA 2D07B 5KYLA 2DNEA 3CMAA 1V5TA 2JVCA 5EJWA 3IBEA 3R66C 2HDLA 1EO6A 2ZTDA 2N78A 3DWQA 4WORA 4F8MA 3A9JB 5C3JB 5DLQE 2QEXA 2KQ4X 3TZDA 1XNQQ 5IKCM 1N33Q 3I72A 4BBRH 3RNBC 4KJNA 3RN2A 1LLRD 3GTPB 2IT1A 2F0QA 3EHVA 3OWFA 1EF1A 3BYYB 3PO3B 1F2RC 1J5EQ 1RL2A 2MJ3A 3VFKA 5HKHA 5DPTA 4G7OC 1EYCA 4LNFA 3HOUH 2N3SA 4HJ5A 5C4XB 1GUWA 1ML0D 5LLIA 4RGMA 2A74C 1VQKA 2DENB 3WALA 3Q3NC 3VUWA 2K50A 1B70B 3EBEA 1IBML 3C8YA 3DBLI 3DHGC 3A7LA 3M4QA 4KGTA 3T1YQ 1FIQA 2RSNA 1V97A 1MD2D 1K83H 1PYBA 1TS5A 5NUCA 2FBWB 4R8IA 1UAPA 4KV2A 3NOBA 2FUG1 2F0MA 2UYZB 3ND8A 2XIWA 1E22A 4X3SA 1MIUA 2PW5A 2KJHB 5C0XI 2D62A 2NS5A 1KL9A 4NAWB 5BR8Q 4JI7L 4IPDA 2BF8B 3OSOA 4OZBA 4YWGG 3AU7A 3E6ZX 3MVVA 2VRRB 5LXIB 3IHPC 2JYTA 5HY6A 2E8GA 1WGDA 3PMFA 1IBLQ 4POFA 3GTJB 4A9AA 1IGDA 4MDKE 4LF9L 4ZAIA 4CJ2C 1LTAD 4RGOS 1FFUA 2L0TA 1O80A 1D1IA 2M56B 5FLMH 2OJRA 1Y1VH 1GAQB 1S5BD 1CA6A 1WE7A 1GC7A 1L0YB 4G4KA 4O2DA 1N34L 2ONQA 4DR3Q 3K5LA 3F2CA 3Q8AA 3FMCA 2K4KA 5LMUL 1T0YA 1KFYB 2F0TA 1VZ8A 2D11A 4LF6Q 5I4DA 1D3ZA 2KDBA 5M3MG 1ENAA 4QCLA 5CR3A 5LNK1 3K5OA 3PO2B 3GDEA 2F0IA 2HD5B 2NZ1D 3S2HB 2BB6A 4W9JA 3LNNA 1B3QA 1E24A 4PV1C 1E90A 4DWFA 5JJIA 1MFWA 5EE0A 1TKGA 3Q8CA 4IUNA 1KM7A 1SAPA 1ZKOA 3Q24A 2MPMA 2OQ0A 1GC6A 1NCVA 4BY7B 2BPSA 2F0EA 2SEBD 1NSNS 3GTOB 1WRIA 1ET9A 3OW2A 2IX3A 2WXOA 2ZJRA 3GTMH 4YIJA 3ND9A 5C44H 3IRBA 2CJNA 1QUQB 4OL7A 2JQRB 1RKNA 2QC8A 1F0ZA 3M9BA 5D65A 3VRBB 2PMZE 4IURA 3RLOA 3S1RB 4B0EA 1PDQA 1QB5D 1RIPA 1WCMH 5E3FA 4MH0E 3Q2AC 1NR4A 1JMCA 3HOXB 1L0VB 5C0XJ 1OQQA 4GIVA 4EUTA 1TXYA 2KMMA 3UDIA 1WM2A 4D2KA 2K1BA 2EYPA 2FIFA 5CV7A 1OQRA 1YN4A 2L00B 4XWWA 2RVLA 1SR3A 3KFUA 2PNRC 4FJVB 1TGZB 4HJKA 1B1ZA 2MFIA 4RWSC 2M0XA 3I7FA 3R8BA 5ELCA 2ACZB 2CKZB 2F0WA 2O2VB 2EY5A 4KHPQ 1LYLA 3RUZA 2JYEA 1LABA 1F1HA 1HRJA 3L54A 3Q14C 1EY0A 2R2QA 3C19A 1QCBD 3Q6BA 3DBSA 1ZYRC 2C5CA 1II3A 1UE5A 4WWPA 2AKWB 2JZZA 2M00A 1WMHA 3CC2A 4PMWA 2XBBC 5HFYA 4LTUA 1B53A 2A6HC 2O6VD 1HPCA 1SMYC 1WM3A 2A1AA 4KHVA 1EFWA 4K8IA 4HWIB 3SD5A 4ASWC 1IHZA 3S1MB 1BR9A 2LGXA 3FILA 3ZJTA 2KQ3A 4ZLTF 4FVMA 3KLWA 5D3DA 1CHQD 4US9A 4AWJA 3NPPA 2HT1A 1LGRA 2JEAI 1SNQA 2LGYA 2WXIA 3MC8A 4JV5Q 4GN1A 2LHEA 4OGQC 1YJWA 2JA5G 3VR8B 3VH3B 3MHZA 4DR5L 1HFNA 3TL5A 3SU8X 1KNAA 4HCSA 2G45B 2EJMA 4GOCA 1XMQQ 2UU9Q 1WGYA 1MHHE 4HPMB 1BOSA 4N8X1 2GLSA 4AH6A 3PLVA 2B2UC 5H1SE 3RN9C 3N1YC 1ZPSA 3T1HL 4I7ZC 5BN4A 3CD6A 2JA6G 1G6ZA 1UD7A 3UI2A 1V5OA 1FVIA 4LF4Q 2KCCA 2JZPA 2LZ6A 1UE7A 1I4GA 1TZOA 2DHZA 2OJWA 4HLEA 2N8NA 2KHSA 4DR1L 3S1QB 2NVXB 3CKIB 2BE5C 4B3TQ 4GOPC 4GOPB 1T6BX 4LDTB 3PUXA 4DV7L 2K5QA 3R2IA 5T1GA 5C3XA 3IT4B 4FHKA 4W9EA 4OVZA 4AYBE 4GU2A 1IL8A 2JP1A 2VH1A 3ALBA 1XTDA 1FD7D 4IUVA 2LEKA 2Y5CA 1LTTD 2HD3A 4J1MA 1KAAA 2EMSA 2WU2B 1C79A 5G5GA 3V3XA 4DNIA 3J9CA 4KY7A 2UUCL 2KVRA 4PQXA 4BBRB 5BMGA 2GBRA 1F2MA 2OF1A 2FNJB 1DOMA 2F0DA 2EXDA 4K3BA 4O1NA 2KXJA 1H9JA 1G51A 1PFDA 4GZYC 4CDEC 3HOUB 3H91A 4K3CA 1QWYA 1VQPA 1N6ZA 4A93G 3GTLH 2FIDA 3UIOB 4TUUA 3I91A 2ASQA 2CFMA 1V1QA 1IXRA 2F0SA 2EDGA 2FHTA 4JI2L 3OJ4B 2K52A 1XLQA 1K83B 2VS1A 4HCPB 3H9DA 3MXNA 2Q5WD 4X65L 1D1KA 4TKOB 3BIID 3NS1A 2MRPA 4MJSB 3PTFC 3C1FA 1IBMQ 1Q8KA 4FN2A 4IM2A 1HNXQ 1LQBA 4HR7B 3S2DH 2X6GA 1TS2A 1L4ZB 2ZXRA 4RH6A 1H9SB 4P75A 5FKAC 5GAHC 5FR6A 2WAQB 4R4TA 3RN5A 2GB1A 2IBIB 3U4ZA 2LVOA 4LMQD 2GBJA 3L0WB 5TR5A 1VR9A 2C7MB 3HVDA 3IFDA 2BDOA 1SNOA 2EIFA 4MGKE 3FP9A 2KVZA 1JB3A 1CJEA 3VTUA 1VMPA 1X6OA 1NVID 3I73A 2B3AA 4I6NB 4J6IA 3ZKJC 3ZQ4A 1KD1C 1UZXB 4BKSA 3APDA 2WKDA 1LTRD 3I56A 1N5WA 4RG1A 4QQBX 1TY2A 4GB9A 2PE9A 1M94A 5M3MH 4KK7A 1A5RA 5J18A 1S5CD 3RMKC 3ER0A 1L1OC 4TSSA 1L1OB 4LW1A 5EE3A 1KF6B 3VR9B 5FJ8G 3PO3G 1UWVA 2CKHB 4ICUA 4C4VB 3T3OA 3RZFA 1V86A 1N62A 1K8OA 2WB1B 5EKLA 2DZIA 1M8AA 3CQZH 2NVQH 5C4XG 2K25A 4MSMB 4JQWC 3FHWA 5JHAA 1Y8PB 2PQAB 1X54A 4L2YA 2IO2B 4LJZC 2DNFA 2OXPA 4UP9A 3DVNU 3TSSA 1PLFA 2ENBA 3OLMD 2OTJA 3QARA 4DK1A 4KN7C 3CCUA 3PO0A 4HIOA 5HG2A 2HIXA 1XWEA 4AUQC 1WSPA 3T8MA 4DXFA 3GTMB 5C44B 1C4PA 2B2WA 3SXHA 1W2BA 1P1AA 1SE3A 1JROA 4P2CB 4BXXG 1I6HH 4MTNA 1GUNA 1WCMB 1CKNA 2K5VA 1QOHA 4RKBA 3C3LA 1FJGL 4FYDA 3CPFA 1JALA 2BKFA 4B6WA 2CHWA 4B3SL 1WRDB 4QAYA 1TKWB 4JGHB 5AZGA 2IGGA 3PSIA 5IP7H 5JHBA 5DM63 4IPGA 1C1YB 3H0GG 3MC9A 2NB0A 4WFN3 1C4AA 3ETRA 1VQHA 1QVCA 1VQJA 1S72A 1D7QA 2W54A 4W9LA 2DY8A 4HIDA 4FXDA 1ICFB 3VYRA 1DM0B 3T13A 4RCOA 2FCNA 5JH5C 3HGBA 2D5DA 3EFXD 3AEGB 1YOVB 3ENEA 4OVVA 2J52A 3U9SA 5KHOA 3AI5A 3I5JC 1A0IA 1KLGD 1MI2A 3IL8A 3SK4A 3APFA 1OXUA 3ULLA 3ZNID 4A3EB 1JRUA 2NN6H 1Y14B 3A4RA 2M2LA 1UEBA 2VNUD 3NRZA 4ILWA 3TEYA 3J7AF 1JE4A 2RKSA 1U9RA 4ZRJA 3SGIA 3DM1A 1U0LA 3A8IE 1SNDA 5CGKA 4Q2JA 1YBYA 2IL8A 1SNMA 1MPEA 1TVXA 3MFGA 2ZXOA 4K7SA 1ZGUB 2JA9A 2N9EB 4QMGA 5D6JB 4BY7G 1TBEA 4OO1I 3Q0AA 4I6PA 3L4PA 5IGBA 1K0SA 1NYQA 2LGIA 3QJZA 2PPHA 2MUYA 2D10A 1PFNA 3J80L 1B7YB 2KYWA 3RLNA 2Z8LA 2R7ZG 1V6EA 2KAJA 2OHFA 1KLVA 5J2RA 1JCKB 3I57A 1B2TA 3H94A 4W9KA 1KDBA 1E1TA 1BDOA 3AMUA 1XJVA 1FXIA 2FUHB 3RZDH 1S3OA 5IT9L 1Q82C 4DHZE 1WGHA 5M9OA 2A69C 1ZYRD 1MG8A 5IP9G 4DR4Q 1AP0A 1ROEA 4A3CG 5AZHA 4NJ6A 5IYDH 2KO3A 2EZVA 5BMHA 1XNRQ 3PUYA 1EY7A 2G1EA 3GV3A 4KY5A 3RCZA 1WYGA 1PZID 2BS4B 2WXGA 1RM6C 3X3MA 2A6HD 1P0RA 4YTMB 4OXPA 1SMYD 3PSEB 3J80i 1VRAB 3BG3A 3T1HQ 1JJGA 4HN7A 4ME5A 2VQEL 1V9JA 2I38A 2ZVNA 1KNEA 1PRTF 2KUMA 4J8QA 2INCC 4DAPA 5KNDA 1YQBA 2Z0DB 3TEXA 2L52A 2EKIA 3QAQA 3VUXA 4JCVE 2ZXPA 4PK1A 4Y52H 4C3JH 4CDDC 1MKHA 1E2WA 5GADC 3A1QB 4WJNA 4X3TA 1BCPD 4JYAL 1ENFA 4EEWA 4MM3B 1BUVT 1M90C 3PIPA 2JT4B 2MHVA 3NE5B 2BA1A 2LRWA 3J80c 2DNCA 3MTSA 4ZRIA 5LXHA 2WYQA 4A93H 1HA6A 2K04A 1E8XA 2K5WA 1TKYA 3SR6A 1V1PB 3KLSX 3GTLB 1B44D 1CK1A 4KI0A 1PTOF 3GS2A 1OXTA 1PXUA 4KJOA 4NXML 3HIZA 4ZHOA 1K9MC 3CCEA 4DAVA 3TMPB 2KTRB 1FNVA 2K7VA 4CKCA 1KJTA 1N32Q 4NP5A 3A56A 2ZCCA 3H09A 1UGMA 1CTMA 2RQXA 2A5UA 3TUOA 3HRDD 1PH7A 2BYFA 4LFAQ 4JI2Q 2V3NA 1BBUA 1L7YA 3DBRI 1F9PA 5KHQA 3AU5A 2JK8A 2L83A 2KDMA 2B8GA 2J0KA 4GNXA 4ICVA 1SE4A 1YJIA 5I6WA 2D3BA 3HG9A 2E76C 1V1OA 1QG7A 2WXHA 3KLRA 3E0JA 2MJEA 2H89B 1I7HA 4LAAA 2D5GA 2PI2E 2CVRA 5E4XA 3RT3B 3RPFC 1JB7A 2B63H 2XK5B 4DKAC 4WAAA 1T0SC 4RFBA 5EDSA 1E6EB 4BBRG 3G4SA 3RD4A 2BWFA 4GMVA 1HNZL 2B2YC 4N9TA 5M3MB 1C78A 2ZJQA 2NPTA 3VRAB 1ILQA 3K8AA 1Z2MA 4IN3A 1DJRD 1EOTA 5ELEA 2Q2IA 3NZUA 1NENB 1U4RA 1BMLC 1OXSC 1Q10A 1WTQA 1SGHA 2QJLA 4WWMA 4HCNB 3RUIB 4CGYB 4BKSD 4HDQA 4RKLA 3IG3A 2NVQB 3CQZB 1VQCA 3TZUA 4EQ5A 2NVYH 5FO7B 4AQYL 1MSGA 5E6PA 4WWNA 2UXDL 1CMXB 1J7BA 4CYEA 1R4NB 1YQ4B 5EBCA 4U68A 5JJKA 2H88B 2L76A 4CQNA 3AE3B 2HTHA 2K8BA 2V4IB 4JBWA 4JI4Q 1X3QA 2N55A 4IOAA 2KX3A 2Q2HA 2WWZA 2ZPYA 3APCA 1MSHA 2WXFA 2Z6KA 4NXNL 3MEHA 2ZM6L 1L4DB 2MX2A 3SK5A 5JEAJ 1A2UA 4HIKA 1SYFA 5C0XG 4NW2A 2MJDA 4CDFC 4YTNB 1I4HA 2WAQG 4MNOA 3CRKC 4QF4A 3H0GH 4CDCC 3JW0X 3UGBB 2KMCA 1PZKD 1VQ5A 4B3RL 1XXGA 4U673 2PW9A 3AEBB 3G7LA 5JPMC 5FLMG 1B8AA 1Y1VG 2BGFA 4A3JH 1GD7A 1RJTA 2ZZPB 1HH2P 4DFAA 4DV5L 3MHSD 3WAOA 1UNSA 2F3IA 1K3BC 4II2B 3DHQA 3PIP3 3RNCC 1Q81C 2EPBA 1AARA 1BF4A 3AFQA 1S4ZA 3WWVA 1HNWL 2E2IH 4FADA 4H13C 1JMLA 4YXDB 1HZ5A 4C3IG 2WB1G 3NZSA 3DBHB 2J4XA 2JQOA 3HP3A 5EPJA 4K2LA 3CSTA 1E8ZA 1KRHA 1RODA 4CKEA 2UU7A 2X38A 3P4RB 3VDYA 1PH4A 1STBA 2ZJDA 1LTSD 2UXBL 1RFKA 2GRIA 3RZOH 2UWQA 3S24A 3S9WA 1TYGB 3DVGY 4LK1C 1GB1A 2WQYB 1JOOA 4NDXA 3OMCA 3KVFB 4HTHA 5C44G 3NBHA 4RAUC 4PT5A 1I35A 3NEMA 2R7ZH 3AFPA 2KN4A 3CP0A 1LACA 4B9KA 2JJQA 4IUUA 1UEAB 1FNWA 2QA4A 2O2LD 3KF6A 5I2XA 4NQKE 4DV4L 2ZTCA 3W1YA 1FO4A 2KT7A 4MN3A 1VF5C 4GKJL 2YU9H 3EROA 4DR2L 3K0YA 3RZDB 1Y8NB 4MGIE 4RF0A 3SK8A 3JVZX 4MGYE 3NVZA 2D3GA 1HZCA 4DF7A 2PTLA 1GVPA 4HEA1 3VR2A 2CCZA 1K50A 2EOTA 3FVQA 1QQRA 1EEFD 2FAZA 2O6VA 1Q8IA 4ZCKA 3E0EA 2L11A 3PGZA 2BS3B 1YX5B 3TIXA 4FBJB 4LFCL 3PLUA 5FLXL 2LFNA 3U8ZA 3DDCB 4JX1C 4ME3A 4YCVA 4L23A 3NENA 3DXJC 3JC66 3F2BA 4ARCA 2F0JA 1YJJA 4L1BA 2K1FA 3DWGC 3CHBD 4FXKC 5M5WH 1QLBB 1PH6A 4HDOA 1VQGA 4XC2A 3L13A 1ILPA 1WGRA 2V9HA 1PGXA 1C7YA 2LHDA 1O7ZA 3N52A 4C3JB 5AJ3L 1XPOA 1AE3A 1XPUA 3S16H 4HK2A 1S1QB 4DK5A 3RR5A 1FXTB 3NG0A 3P1MA 2UXCQ 2LI5A 3KH0A 3JAMi 2E2JH 1A3UA 2TSSA 4DAYA 1KXLA 5GXGB 1BVSA 2JX5A 4MACA 3PF5A 2RSOA 1TT2A 2OTLA 2A69D 3N30A 4A93B 1J8CA 4URKA 3PRZA 4OIKA 2I07B 1RTNA 2IJ0A 4HJ7A 2WAQE 3KDFB 2KTFA 1AW7A 2CR5A 2ZNVC 5J3BA 3A9KA 1NY4A 3J81L 3HKZB 4ZUIA 1WY8A 4KZCA 3EJIA 2MBOA 4BKGA 5M5XH 4YSXB 1JJCB 2QHOA 1HCZA 2JE6I 3B2FA 3WIMA 2GVBA 3W1GA 2JUOA 2W9NA 2AUJD 5IWAL 2Y0SG 1L2NA 2E74C 1D5MC 2L05A 3BINA 3CWIA 4P74A 3G48A 5LL6X 3KF8B 2A5HA 2F0VA 2NTSA 1HTOA 4MEMA 5FLXc 3GTGH 2WKCA 1EIGA 2DX5B 4BA2I 4KHZA 1IUEA 1O7LA 3E3XA 3D3RA 4A3GH 3C46A 3KWVA 1YX6B 1KOTA 1CFMA 4L63B 2F4VL 5EE9A 3B08A 1PYWD 3RLFA 3J81i 1V8QA 4POGA 3S14H 1J7AA 5D94A 4NZLB 3AE6B 1V2YA 5CV8A 3ZLZA 3KBGA 1AEXA 2R7FA 3K7AH 1E2VA 3WOFA 4X64L 2B63B 2WACA 4IW0A 1F2LA 4AOFA 3NP8A 1A63A 3CU7A 3M7GA 2L0FA 4MH8A 4REZA 4XWTA 1SIFA 1M4VA 4RGNA 4IUMB 2NBFA 1E7PB 4JLCA 1KRTA 5DM73 4EZKA 4L5TA 1TWCB 4P7IA 3FC4A 1KHIA 5A2QL 2IZVB 3PHXB 2LMCB 1WJUA 3W5VB 2K3UA 3GV6A 3TEHB 4C7YA 1R4QB 4IUQA 4JI5L 1R7SA 2RDFA 1SEBD 4WAFA 1PH3A 2NVYB 3FPPA 3TS0A 2L12A 2J0MA 1HJPA 4DV3L 3A9JA 3A8KE 3J81c 1EIYB 4K0KQ 2KD0A 2M8SA 3V61A 2Q2TA 2Z0EB 1BKBA 1SFOH 1R9TH 4K81A 2IGDA 2ES2A 2G4DB 5J39A 1EOVA 1OO9B 1NNXA 2G5DA 3GO5A 3J80E 1ZUD2 3IAS1 1QF6A 1WR1A 3CMMB 1F2YA 3QOLA 2WXQA 3ECIA 4ZHPA 4ULLA 2KFKB 2HQEA 5C0XH 2LGDA 2JA8H 1YNJD 1ZXHA 4YHHL 1VQNA 1STNA 3AEAB 5IT9E 2LJIA 3PS6A 1K53A 4M0WB 1CZGA 1TIFA 4NAMA 3H0GB 2ZM6Q 3H3VI 3FAHA 3X0WA 1OXXK 3GP7A 2BBCA 1UF0A 3MAQA 2Z1CA 1WH3A 1CQFA 2WU5B 2MGSA 4R4OA 2ASBA 1WJJA 4IFDJ 4WJWA 1MVKA 2RBMA 5DNFA 4A3JB 3ITPA 1DONA 5L95C 1MHWC 2OT2A 4A3FH 2BQQA 2E2HH 3IAYA 4NAWA 1STHA 2XRQD 4AP4C 2ALYB 2R3ZA 5C6AA 4XDXA 1PH8A 1IBKL 1EYDA 4CO7A 1V80A 1X56A 3HKSA 4C3IH 3TBLD 2E2IB 1H95A 2L8JA 1BO0A 2REXA 2RSUA 2QSDA 3I3TB 1GKHA 3H7SA 1NTGA 1QNUA 2BDNA 3GE3C 1UE6A 4H02A 3UDGA 3TBIB 1LV9A 3AV8A 2G3QB 2YLMA 1C4QA 3U2SC 2VW9A 1WYWB 3DHHC 3RZOB 1HR0Q 5JJLA 2I1KA 1NYRA 2LD9A 1ONLA 2LRUA 3CC7A 4V190 3TP8A 4TQUS 4ANVA 3IKJA 4A3LH 3T3NA 2PW7A 4TQ0A 4PYZA 3I4OA 1K28A 4NPNA 2HDMA 2UXBQ 3VA5A 2R7ZB 4E3CA 4X62Q 2KHWB 5T1IA 4YTPB 2GBKA 2HCIA 2NBUA 3H6NA 3TN2A 5IGFA 3LYYA 4GSWA 2K8HA 2PI2A 1UELA 1I4PA 2FMMA 1TWGH 3A54A 4B3MQ 3R3OA 4OHJA 4X3KA 5IP7G 1C0AA 1C77A 3H1UA 1K0RA 3ZYYX 3K57A 1UH6A 3H7PB 1SE9A 2YU9B 3TQYA 1BBWA 4E74A 4DR6L 5EPKA 3M95A 2K32A 2Z4HA 2SNMA 3UQBA 4DV4Q 2K01A 2EE1A 1QOFA 5IA7A 1QUQA 4HKQA 1IP9A 4GKJQ 4RMFA 4JBMA 2J7QB 1T5EA 4AS1A 4DR2Q 4RNAA 3EVQA 1VQ8A 2EJGC 1WXVA 4ANXA 2NN6G 5AUKA 1JRPA 1ZKHA 2B39A 2PZWA 3HM3A 5CV4A 4A76A 3CF6E 5DPRA 2KHJA 1E9MA 4IO9A 4JI6Q 1ENCA 3KYHC 4BWGB 2MO0A 2Z59B 3CF5A 3FKYA 4LFCQ 3N20C 1FR3A 4R9WA 5M5WB 4A3DG 2YEPB 3N9YC 4M00A 4GDKB 4WURA 1X1MA 4DR7L 5BO4B 1D5XC 4DV0Q 4JK1C 5LL6S 4EQOA 3T51B 3HOVH 2O2VA 3AE5B 4OX9Q 3S2AA 5CBAE 2N0SB 5L83A 3AYHB 4IQZA 1Q46A 5J1ZA 2G9HD 3R2TA 3S16B 5IOIA 1R4MI 2IPKD 4LCDE 1FM0D 3T53B 1WTOA 1RAXA 1E2ZA 3MHBA 4EKUA 2VQFQ 2AL6A 2JXTA 4LFBQ 1JORA 5C2TB 1FGBD 2NZHA 3KUPA 1E0ZA 1NI3A 2VB2X 3LX0A 2AWTA 2K22A 3PZDA 2IHEA 4WJ3M 5EE1A 1WYDA 3QR8A 3PPAA 3FDTA 3M4OH 2K5PA 1SXTA 1XEEA 3KBXA 2C5LC 2DJGC 4JI3L 1PV4A 2KHIA 2IYDB 1EEID 2L32A 5CORA 2PKOA 2LKVA 1OTRB 1EQRA 1XPRA 3QK0A 3BZCA 1GUSA 1D5ZC 1VQ4A 5M5XB 1N8RC 4DK3C 2KECA 2PE6B 3FPUB 2KENA 5IYDG 3Q3OC 3U58A 5EAYA 2EJFC 2MBHA 2NCNA 3ZNHB 3MFYA 2DYBA 2UUAL 2L5TA 3SDZA 1YHQA 4JWSC 4P73A 4DHJB 1HUNA 3GTGB 4Y7NH 1PZJD 1UE1A 2I5MX 3OOCA 4ZQ3A 4GKKL 2CU3A 4H44C 3KUZA 1PUTA 3AEDB 2E5LL 4A3GB 1XT9B 5IWAQ 4JE3B 4YWKA 1BNZA 1I3QH 4LF5L 1JJ2A 2ID0A 1VDVA 1T0QC 4GGQA 3L0OA 4DUYL 2B2UA 3F2UA 3S14B 2H5XA 1RF2D 1RTOA 4ZRQA 1C48A 3K7AB 3K5MA 4IC7B 4C3JG 2CHXA 3UDFA 5FOBB 3OMGA 1JW9D 2C35B 3RNEC 2ICEC 3IFWB 1WXAA 3SFDB 2K6AA 4A3MG 1BCPF 1BBXC 1EUVB 2C60A 1Y8RC 2WGSA 5JPNC 3PCOB 4IOIE 4GOPA 2F1MA 2B76B 1RHPA 4X64Q 1P16A 2DGYA 2LSSA 2D2CC 3PIOA 3TRZA 2RR9A 4RMAA 4C3HH 3PF4A 4G50A 2YTVA 4KTAA 3BVMA 1WX7A 2L1AA 5IGDA 3P4SB 4YL8A 2IDYA 3L16A 3HKZG 3DBLB 1DOLA 1QZHA 3K5NA 1U4MA 2WP8J 4K14A 1X3GA 2ZTEA 1IYUA 4XQQA 1R9TB 2QF7A 1SFOB 3HOWH 3OYYA 1ZW7A 1WX8A 4XE0A 5IO9A 3EFCA 3ZNGC 1STGA 2OWOA 2LGSA 2AMCB 4DV3Q 4DBGA 2CS4A 3UQAA 5JJZA 4BAXA 1YNXA 1PFSA 2R7DA 2JA8B 3V60A 1WOCA 3D31A 4PMCA 5TSSA 2M9VA 5J17A 1Y69U 1ZP0B 2IO0B 2A6EC 3BVZA 2JPHA 5D7GA 3QWNA 4JOIC 5AZFA 4LJPB 4FF4A 4QGUA 4JI7Q 3PHWB 1SROA 4DU9A 1C9FA 1SN8A 1Y1VB 3HRZC 4GS3A 1D8LA 5DPWA 1B50A 5CV9A 4DK0A 2F3VA 5KNCA 3WAPA 1X32A 2B63G 3K6OA 4FP5D 3I4LA 3ZJVA 1ICWA 4RGTA 3BYTB 2JA7G 1L6UA 1HTQA 4LF9Q 2W3SA 4MJSA 3STBC 3TEZA 4H2AA 2QW7A 1V9PA 4KDIC 1B4OA 5LMNW 4A3FB 2E2HB 3DQVA 4Q0FA 1SIJA 1HQMC 4N6EB 1N34Q 1WD1A 1DXMA 1H9SA 4C3IB 2J0JA 3EC8A 2PJHA 5LMUQ 3HUIA 2I46A 1ZEQX 2JXMB 3TP7A 4DNTB 1PVOA 2PEAA 2ZCBA 4YT0B 2JF5A 3EECA 1ZDXA 2DY7A 2FCSA 3BDLA 1YIWA 4R8NA 1C76A 1IGCA 5EQ0A 3R93A 1QE6A 3MJWA 1H9MA 1GUTA 1IBKQ 1RDPD 1Q12A 5JAVA 4XQJA 2MA9B 3DVNV 1K3RA 3W1SC 4ANUA 5C1ZA 5HHDG 3KYCD 2B2VC 2CWPA 3NVYA 2KCTA 1SYDA 3W9CB 1VZ6A 3NTKA 3OJ3A 1L1OA 1C3TA 1I4XA 4LNNA 2CJOA 4C4VA 3LXFA 1SDFA 4O0AA 1JT8A 2NR2A 2RGFA 1YJ9A 1HZ6A 1Z5SB 1XYIA 3UI3A 4KDLB 2PQAA 1YVCA 3C2PA 4M1UB 3RNAC 1YI2A 1Y8OB 2H1EA 5BYRA 3U7ZA 2HTME 1PH2A 2JSOA 2N88A 4A3JG 1K52A 3B0AA 2QCZA 3UDXA 1OFFA 1RD9D 3FEWX 3BVGA 4DV2L 2MH7A 1G91A 4TRDA 2PMVA 2PVGC 1LTGD 1Q7YC 1Q1OA 3Q8EA 3F8TA 1EWYC 2L3ZA 1LM0A 1YIJA 1WJ4A 1WTRA 4TVAB 4A3DH 3AE7B 4G11A 4II3B 4P1CC 4JI1L 2LXCA 1VF7A 1PFMA 3K81C 3NWSA 4EGVA 4N59A 1U5KA 3U52E 4OO1H 4YY3L 3RZWC 3NUHB 3VYTA 3HOVB 5A2QE 4KKSA 4KKUA 3CCSA 2UUBL 2N9KA 2QGQA 1UWMA 1YN5A 2CW0C 3A7AB 2HHHL 2D0PA 4YSYB 4A3BG 5FO9B 2KACA 1FCLA 2LASA 1V81A 1VQAA 4FF3A 3S17H 2L15A 4W9DA 4XTCS 5K36G 1WTVA 3E9IA 3M4OB 3I90A 1JWAD 1PQSA 3QCAA 2HE7A 3H8HA 3ZXRA 1YJ1A 3GZNI 4JBJA 2KEEA 1EM7A 2I0QA 4WRDA 1JOKA 4DR5Q 2HJ1A 1X9NA 4LUOA 3BY4B 3IAM1 1JWUD 3NUCA 1JC7A 1K8RB 2Y0SB 2MW5A 4JWUC 1DD2A 2A19A 1BQQT 1GUGA 2GBMA 2N9LA 2OOBB 2ZW0A 4PNYA 1HTPA 4LF8L 2X69A 1SYBA 2LXKA 1LT6D 1A62A 3K7UC 3W2DA 4EZLA 3VQIA 3X3NA 4Y7NB 4DR1Q 5BYQA 3C1EA 4Z9CB 4LK0M 2HCCA 2IX0A 2KJ6A 3RD2A 3X23A 1I3QB 5DEHA 4R4QA 3NQIA 4K6LA 2IO3B 1A3VA 3LGJA 4DV7Q 1WIAA 3AEFB 2PMZB 3GOEA 4LF7L 2VUMG 4QB4A 1RRBA 2WDTB 2BCOA 3QIJA 1LM8B 3UIPB 4A3MH 1ISNA 1KIXA 3ZDMC 2PZUA 2JWUA 3JSVB 1Q1BA 1Z9FA 2M0AA 1F77A 4EZJA 2UUCQ 3OAWA 3MA2B 1R4PB 2JN4A 1KQSA 2F0GA 3FKIG 1FEHA 1PDXA 4W9IA 4L8JA 1FL0A 3HOZH 1I42A 4C3HB 4LNQA 4S17A 5JVH3 4LNIA 4OEMB 5E6OA 2I2YA 1TIID 3KJOA 1VQ9A 5D2MB 4M8MA 4FXGC 2CQOA 4W9HA 1G2SA 2BE5D 3ICEA 4N9F4 4XZ4A 3EUB2 4LDTD 3L9AX 2F0HA 5G3LD 1VQMA 2MP2B 5JEAH 3SK6A 1EWIA 3HOWB 3A1QA 1WTPA 2MCNB 1PYSB 1RWSA 3ML8A 4MM3A 4K8JA 3HFZB 3J7AV 1N61A 4AQ7A 2XEWA 1ET6A 1GG3A 3S2DB 4JI8L 3OTOL 4RHSA 1PGAA 1N36L 2BYEA 4FXCA 1MJDA 4X65Q 3P75A 4ZRPA 2BYTA 4QIWB 2E6XA 2EY1A 3L7ZC 1HHVA 3NK9A 3ML9A 5DCNA 4DXGA 1V1PA 4A3GG 4FLHA 3I55A 2Y3AA 2PVOD 3A5UA 1X3FA 2DZMA 2K0PA 1STAA 5ISRA 1BUIC 2CHZA 2KTRA 4GLVB 3RNUA 2JA7H 1A70A 2RPVA 3L2PA 2J53A 3Q8BA 2CH4A 1S40A 1E1OA 4XYOA 3AEEB 4HIMA 4HPPA 3RFZB 4OWWB 4OW0A 1EY8A 1HR0W 2XSCA 2K28A 4DGZA 1N33L 2IY5B 2EYLA 2Q2UA 4GDLB 1G8ZD 2N9PC 3A4SC 2J7ZA 1K8AC 5M3FH 1SYGA 2K5DA 2EVBA 2VL6A 3MEFA 4KGSA 2HDEA 2B2TC 3DLLA 1J5EL 3NVVA 1Z6HA 2DLBA 5C5LA 3OG5A 2V0GA 2K9XA 4S0RA 3HZXA 3KWLA 3Q3FA 2EQSA 3DUZA 5A35A 2XK5A 4P72A 2LXJA 4P6VF 5ELOA 1F2RI 2Z6KC 4HMIA 4KIKB 4I65A 5BYSA 3W1BA 1XTCD 1ZXIA 2WNMA 1WFQA 1EY5A 1TWHH 4CJ0B 2A6ED 3T1YL 1HE8A 2WP9B 2B2YA 4W9CA 4P71A 5KRUA 5CHVC 5DPSA 4YSZB 3ZJYC 1PGBA 2LUEA 1P9DU 3G71A 3LDZE 3ZW3A 2WXJA 1JQ4A 1I6HB 2JA8G 2SAKA 1WZ3A 5C3EH 1DOXA 2F0FA 1V8CA 2IY0B 3GZNB 4JIOU 2D0OA 5I2YA 4K5XA 5GAGC 2RD0A 1CM9A 3DWMA 3E9SA 2EMTA 3STBD 1WGKA 1U4PA 4DN4M 3PRMB 3I3CA 1IBLL 1WI5A 1FJGQ 1FCCC 1OEYA 1IBXB 4B3SQ 4TKNA 3R3MA 3CCVA 1F9RA 4XT3B 5E6NA 4BBSG 4F8CB 5GMVA 5IAAC 4BBNF 2F3WA 3AH7A 2B8FA 4AJYB 1CKMA 4A3FG 1WD0A 4DR3L 1VZ7A 2PYKA 4A3OA 1I4QA 4CJ1B 1L2FA 2MO1A 4XXEA 4LF6L 2PQEA 3QO2A 3LJ3A 1VQOA 1KLUD 3HVZA 1IW7C 1GPXA 4ARIA 2F0NA 4E6IA 3NSWA 1GM5A 3AB5A 3Q8DA 1WX9A 3AE8B 2M19A 4A3DB 1CUKA 1UUPA 2F4IA 3NELA 3I2ZA 4OVUA 3LWEA 4JL9A 5G5HA 1VD2A 1CSQA 4A8XC 4A3KG 2RMMA 1JICA 3NVWA 4NMZA 1J19A 3OIQA 4DV6L 1WE6A 4IUPA 1GUAB 5CBEE 2JXXA 2KJRA 1VQLA 3Q69A 1IKLA 5CV6A 1J9OA 4A3BH 1LFDA 1G291 3EGRA 2QDBA 4A3LG 3VUYA 3K0XA 2WV6D 4NJCA 2BYVE 4M8AA 5MPOA 2AEHA 2AUKA 4BY1H 1WFYA 5K36H 2K39A 2RCNA 2WX1A 4PS7A 4K5VA 3S17B 2NBVB 2WDQB 3KUDB 5IOCA 4OWTB 3QG1A 4GLAC 1XF5L 1ACCA 2HHHQ 3AULA 2KQSA 1P7EA 1EU4A 1ASZA 4K7WA 1EZ8A 2QDFA 2Q8IB 1KH0A 1JQYD 3GTKH 2LVPA 2R93H 3DWAA 2JY6A 3SEBA 2YYZA 3N1ZC 3JAML 2YV5A 4HMJA 3Q22A 2F0KA 2KDEB 1WI0A 1EY6A 1M1KC 5C4HA 2V4DA 2L9HA 3DHIC 2N49A 3CRLC 2INPE 3A55A 1E7VA 4KHPL 4KKIA 3ZTDA 3GD7A 3PQIA 4QY7A 4HJ9A 3CIRB 4DHJD 3K59A 1NBFC 3CAMA 3QOJA 2Q8TA 3ZVVA 1Q90A 3ERSX 1VJKA 1NJIC 5IE8A 4BFRA 2VQEQ 2VUMH 1I94L 1RFAA 2V3SA 5EGTA 2KFJA 4DDGD 4KKTA 4PZ7A 3HOVG 4KGRA 3BK1A 3PUZA 4A3MB 1SMXA 1QNKA 4DAYB 2WDRB 3P63A 1JWSD 1EZ6A 2GA4B 1VCIA 2W82A 4JPBW 1MI0A 2V4LA 3TCAA 4FHJA 2JWZA 4BOZB 3FKIH 2ZVOA 4DAMA 1CA5A 4DV1L 2KCMA 4JYAQ 2FJ2A 4DXAB 3AU4A 2KX0A 3VYUA 2K75A 1F9JA 3HOYH 2ZNVB 3AE2B 1HA5A 3MP9A 1SJED 3KYDD 4L5RC 4JV5L 2EYMA 3EIVA 2DYOA 1T0RC 3PV0A 1VDZA 4QL5A 3TP6A 3DM3A 5KNBA 2J42A 3DEOA 1KC8C 1C4CA 3D4DA 4LUVA 5H92C 4IM0A 1CHPD 1XMQL 2UU9L 4A20A 2AHOB 1TWAH 4FJZA 2YTYA 1A15A 1SSNA 4NXMQ 2XGTA 2D3CA 2GBNA 1B9NA 4PZ8A 2QDLA 3JAMc 1SBBB 4Q5VA 1KDAA 2Z4IA 1S5FD 3NWTA 1QZEA 3HK0A 1FGUA 3T16A 4KVGB 1GJZA 4L5SA 3S1NH 4LF4L 4J3OD 3AB9A 3V96A 2KC1A 4ACFA 3ZO5B 3SHLA 2JRIB 3DBRB 4IFDI 1Y1WG 1J6QA 2WB1E 2NTTA 3KDFA 1PHJA 2ZT9C 3J81j 3ZJUA 1F52A 2KANA 3I4NG 1P8LA 1NDDA 3QJYA 4JI8Q 3DMUA 4ZUJA 4USAA 1N36Q 4LNKA 1SRUA 3QX1A 2BH8A 2JA7B 4MIUA 3IXSA 2KLCA 1JWMD 2WIIB 4ZKCB 3HS0C 4HKZE 4US8A 4CHTB 4F88A 2KOLA 3KF8A 5IP4D 1VCBA 4X3UA 2ZPNA 4C80A 3VVWB 1Z47A 1RLFA 4DHZB 5M3FB 2AQ1B 2HIVA 1T9HA 1IZ6A 3B6YA 2EKEC 4W9GA 1HNZQ 3A5ZB 1X3PA 4C3HG 2LXAA 1D6EC 3SVMA 3U50C 1TS4A 3ZIMA 4IM3A 3T4AC 5I6YA 1JE5A 2Y5BB 4FF2A 2KMAA 4YCUA 3BWUD 1YD8U 4C56C 3RULA 2WDVB 1TWFH 3HOWG 1GXDC 4AQYQ 1K8GA 4A3PA 4IWPA 1MG4A 4R4IA 4UP8A 1TWHB 5CX3A 2UXDQ 2Q8RE 3NJTA 3PZ7A 2JEBI 1IYJB 2LMCA 2VZKB 1E3PA 2HQLA 4ID6A 4B9XA 4DDID 3EN2A 5C3EB 5CTRC 1DZ1A 4L5QA 1HNXL 4NXNQ 1XLPA 4MSQB 3H3VH 2WXKA 1RYJA 1YNTE 3MTNB 3E9HA 1EQTA 4IPCA 5GAEC 1EL0A 2AL3A 1WXMA 2R6GA 4ZKBB 1KRSA 4BBSH 1HZAA 5M5YH 1QKZA 3UINB 1AFPA 2V3PA 1SSOA 4PG3A 1U4AA 4B3RQ 1UGJA 5ELFA 2Z6BA 2KFKA 4JVZA 3H6MA 2EY2A 2AQ3B 1E8WA 1QOGA 4E71A 1VQIA 2GN5A 2QMTA 2R61A 4DV5Q 3DVGX 1ESFA 2C9OA 1PH1A 3M62B 4AJWA 1QVGA 4M0WA 4YCWA 1HFGA 1FRDA 3P7JA 5DAUA 3VYSA 1XO3A 1NUCA 4OELB 5ELDA 4DK6C 4DNRB 1G6JA 1HNWQ 2G9DA 4NPSA 4C2MH 4A3KH 3ZNZB 3OW7A 1N60A 3BK2A 5D14A 2BKRB 2N7EA 4FA6A 5IYCG 2N9XA 2X8XX 2QILA 3DWPA 4EFOA 3KOJA 3F1ZA 2QKIC 5GQOA 2Y0SE 4A3BB 4AYBG 3T9LA 3NTHA 1D2BA 3GB1A 3RNFC 3I70A 3ZUNA 2MSED 2R92G 4BY1B 5IGCA 3M3YH 4DV6Q 1DYQA 4MTKA 5F2DA 5AEKB 3HEJA 1K51A 2K5HA 1U4LA 5C5MA 3V6CB 4MT5A 2OEDA 2WXMA 3KK7A 1GJXA 1EFID 3D32A 1WZ0A 1IKMA 1BXTA 3B2GA 4WQMA 1WVLA 3GTKB 4A3IH 1IW7D 2R93B 1LUZA 1F9QA 3MC0B 2OQKA 1WMHB 2J0TD 3ULJA 3WAMA 1GHKA 1MJEA 1OTCA 2F0LA 4G0NB 2MWSB 3IVFA 2RDHA 1V49A 2FXQA 1YNNC 4JW0A 3QB3A 4J15A 2V1YA 3WDNA 1YQ3B 4NJ7A 3ZTCA 3Q6SA 2DAJA 4KN4C 2V1CC 1XLNA 2MEKA 2BH2A 2BVCA 3FILB 3ONSA 1FFVA 2AX5A 2NVTH 5IGGA 3H7PA 3TMEA 2KKCA 3MWYW 2EYJA 3H15A 4RF1A 5JZEB 2BWES 2VUMB 2GVAA 3IT6B 5IIFA 2CWAA 4ITKA 1GOZA 3TDQA 4X57B 5IN7A 4OO1G 1D4BA 5E6JA 1XX8A 2LFIA 4A3EH 3V62A 2I5LX 2FCQA 3VH4B 4XQNA 4MZ9A 2I5HA 3AM9A 2VB3X 2O5IC 1Q5WB 1P7FA 4G3XB 2E2JB 4TQ1A 3KUCB 3VTWA 1FYCA 1SE8A 5AJ3Q 1I94Q 4WWOA 3FKIB 1IYVA 2SDFA 4O42A 3W5OA 1E8YA 3PV1A 1W3SA 3QHTA 1HUMA 3HOYB 4QIWE 3U30A 1AYFA 4KSKC 5BMIA 2JSVX 1GHJA 5EPLA 4GDKA 3TP5A 2AWNA 4P1BC 4DV1Q 1CI3M 1LO5D 1TJEA 4KLKA 2RHSB 4IALA 3S15H 1GB4A 1ASYA 1OQYA 2E3TA 1GO3E 3BU2A 1DOYA 1TWAB 1P3QU 1H8CA 1LT5D 2A68C 5IGEA 3CC4A 3M7NA 1H4RA 1BCPC 2LWPA 1BCPB 2CU1A 3AE1B 4IWOA 4OZCA 4DR4L 5CHFA 1EY9A 4ABNA 3S1NB 1Y1WH 1XNRL 1LTLA 2VH2A 5IY0A 1HZBA 4R4CA 3GTQH 4WJ4A 1QILA 4HAEA 2YEPF 1E0BA 3I4NH 1JOQA 1PTOH 4W9FA 2FMCA 1FMAD 2PPBC 1PA6A 2CHBD 5E4WC 3I4MH 1NI2A 2NVUI 1IL2A 5G55A 3RMHA 4XDDA 4MELA 3NXWA 1SYCA 1JR0D 3QIAA 3V6EB 1TKEA 2RPQA 3Q3JA 2F4VQ 2L55A 2WXRA 1ZXTA 1LXDA 2WFWA 4ZYNA 5C4JH 3K9PB 5KGUA 4JBKA 4AIMA 1YHAA 2SOBA 3ERQA 5AFWA 2DJFC 1DGSA 1QJOA 2PCFB 1RCVD 1S5ED 2MJ8A 3O65B 3P42A 1MHXA 4IG7B 5JXVA 1SJHD 2OCEA 3OHXC 3PRPB 4WQOB 4B9WA 4F7XA 4EQPA 4A4IA 3HOZG 3L17A 3U4VA 2FFKB 4KV6A 4HSPA 4A55A 2KEDA 4N9PA 2XNAC 3MXNB 1EWHA 1G6PA
chains in the Genus database with same CATH topology
1TWFB 5JEAG 2PZTA 5G3LF 4ZRZA 1TQOA 5I9OA 3BDCA 3SFEB 1VMCA 1EWCA 2X6LA 2NUCA 2IGHA 2XWBB 3OWEB 1FRRA 4B0MA 2JU6X 3H3VC 1CZPA 4G7ZC 1WWTA 3JAME 2KJXA 3BS1A 2DBYA 5FLXE 1H9RA 4BBSB 3U4EG 3V2TA 5M5YB 3OIPA 1FNUA 1N5XA 2HUGA 1DCZA 3V05A 2LY7A 4RA8A 2XVSA 3BZDB 1CQVA 5T8IA 3MXPA 5EBDA 2KWDA 3D6CA 3G6JB 4JPSA 1O78A 1V43A 1QOBA 4C2MB 4A3KB 3AECB 2L1BA 2E2DC 2B2WC 1ZDVA 1A2TA 1MGSA 2VZKD 1K8MA 1Q3LA 3SR1A 2MP1A 4ZYSA 1T3QA 5FO8B 3J81E 2WXLA 5EKIA 2FINB 2WINB 3LWUA 4BA1I 3M3YB 4KD3A 4GLSC 2CQAA 1TU2B 1TWGB 3BDOA 1I4RA 3W1SA 5K5PA 1EQVA 1LT4D 1QOAA 2B2VA 2F0PA 1MBYA 2SNSA 4A3IB 3Q8FA 5J22A 1H9KA 1NR2A 5CYUA 3PIO3 1FXAA 3D4RA 3NZ3A 3PUVA 4XT1B 2WXNA 3N6RA 3AE4B 4FF1A 2BB5A 4CKBA 2NVTB 1HXYD 3KQ4A 3PZ8A 1O7YA 2IX1A 4OIJA 1SNPA 3OPOA 2NN6I 3D8GA 2DYMA 1STYA 3LB8C 4R3DA 5C4ZA 3ABVB 2PO4A 5LHY1 4S3SA 5COYA 1B3AA 4DQOC 2AWOA 3AE9B 1STEA 1PRTC 1PRTB 1EIHA 4A90A 3TEWA 4C7ZA 2XWJB 5HURA 4KD4A 1SE2A 3SE0A 4HROA 1SYEA 5HI1A 4K5WA 3I8ZA 3S15B 2Y5PA 2KVMA 1YNND 2BT6A 2ZW1A 3EA6A 5D3IB 1SB3C 4H0LC 4QUCA 2L0CA 4H7BA 1TY0A 1Y1WB 4A6QA 4F87A 1L0XB 1ZOYB 4FNFA 3GTQB 4C1NI 3P4QB 3I4NB 1HTLD 1PTOC 1EU3A 1PTOB 3GQBA 4K6DA 4KX6B 3I4MB 4G57A 5FK9C 1SNCA 2QEJC 1XCTL 1W6JA 2KCNA 3B9JA 5C4JB 2NMQA 3EQLC 5EKKA 3O13A 3E56A 5HGTA 4LLGM 1F9SA 1Q1EA 2DN8A 4HCEA 2F0OA 3MXUA 1SF0A 4EE2A 2N7JA 3AMZA 2NYZD 2A68D 3P4PB 2O5JC 5I9PA 3U9OA 1J7CA 5AUIA 1HQRD 2TMPA 1XCQL 4KKJA 3W5UB 3URYA 2EYFA 1A6XA 3NBIA 4XDCA 1NAPA 2EYHA 5ELBA 3KLSA 2QIEB 1PMRA 1JWBD 4OZAA 5E1FA 1VLBA 5JVG3 1AZQA 4N58A 4UAIA 1TR5A 4IFDG 2BS2B 1PFBA 3MZ5A 2EYOA 2K05A 2A73B 1N63A 3T56B 5IODA 4IDIA 4P16A 4RHRA 1F2ZA 4IUTA 1LTBD 3MXGA 4L6TB 3MJ5A 2IW3A 2EXZA 2GI9A 5CV5A 2EY6A 2NWGA 1E10A 2VXWA 1YNJC 2ICIA 1KABA 4MHEA 1LT3D 1DOIA 1CT1D 4XYQA 1XLOA 2AQ2B 2IWHA 1I6VC 3WCQA 1L5PA 1QT9A 2W55A 1A3TA 1AN8A 2RA4A 3NQTA 4AYBB 1FD6A 2K03A 2ON8A 3NHHA 2R92B 5CMDA 4PMBA 5H8YE 4K2KA 2B2TA 3E5SA 1EYAA 3DEPA 3A8JE 4ZOHC 2K33A 1CZWA 3L3OC 4BS9A 1I50B 2JYOA 4FO2A 4RCNA 4EQNA 1WTWA 1J8IA 4V0BA 2PIAA 3VR6A 2E75C 1WTXA 1HEZE 1KTKA 3Q23A 3WOEA 4HJGE 4IKGA 4ODGA 2WLBA 5BN3A 5KIXA 3W3AA 1IBXA 2LUMA 4ZK9B 3PUWA 1G2TA 3I9V1 1YN3A 3ZGZA 1ESRA 2L4NA 3J7YW 2H4OA 1S5DD 1WXQA 4HRSA 1KDCA 4XIGS 3ONAB 2RDGA 3D4WA 4UDUC 5FR3A 4DA2A 2WXPA 2KA7A 1YMHE 2LS01 4EVOA 2BA0A 4QUFA 5KYIA 1AWDA 2JA5B 4HSVA 5KEEA 3VR4A 2INNE 3IFTA 2PLPA 4WIPA 5BN5A 2OEOA 2F0UA 4CBVA 1OXVA 1NEKB 2JA6B 3D6WA 2BW2A 2CW0D 3VA7A 1DOKA 2F03A 1B9RA 1UWXA 1PRTD 2D9UA 4B08A 1Y56A 1B9MA 4C1NK 1ZE3D 3AN1A 1EY4A 4KMUC 5CC4A 1T5XD 2W3RA 3HOZB 1Z7TA 2QCPX 5JOBA 3P1HA 3M4YA 3VR5A 3FRPB 1AZPA 2XRSD 2XN9C 2WS3B 4KY6A 2FE8A 2DWQA 4J6HA 3P20A 3NTIA 1W6KA 1PTOD 4WH4A 1TS3A 4IZ8A 4IFDH 5C3WA 1GUOA 4TMAB 2BTEA 4G7HC 3VR3A 2O4XA 1DGJA 3K58A 1LTID 2EELA 1L6VA 4NKLA 3M85A 2BOSA 1C8CA 4HEDA 5KYLA 2DNEA 5EJWA 2HDLA 4F8MA 3DWQA 4WORA 5C3JB 2KQ4X 3TZDA 3I72A 4KJNA 1LLRD 3GTPB 2IT1A 2F0QA 3OWFA 3BYYB 3PO3B 1F2RC 2MJ3A 4G7OC 1EYCA 5C4XB 1GUWA 1ML0D 4RGMA 2A74C 3C8YA 3A7LA 4KGTA 1FIQA 2RSNA 1V97A 1MD2D 5NUCA 1TS5A 2FBWB 4R8IA 1UAPA 2FUG1 2F0MA 3ND8A 2XIWA 4X3SA 2PW5A 5C0XI 2D62A 4NAWB 4OZBA 4YWGG 3OSOA 3AU7A 3E6ZX 3MVVA 2JYTA 3PMFA 3GTJB 4A9AA 1IGDA 4ZAIA 4CJ2C 1LTAD 4RGOS 1FFUA 1O80A 1D1IA 2M56B 1GAQB 1S5BD 1CA6A 1L0YB 4G4KA 2ONQA 3K5LA 3Q8AA 3FMCA 1KFYB 2F0TA 1VZ8A 5I4DA 1ENAA 4QCLA 5CR3A 5LNK1 3K5OA 3PO2B 2F0IA 2NZ1D 3S2HB 2BB6A 3LNNA 4PV1C 5EE0A 1TKGA 3Q8CA 4IUNA 1SAPA 1ZKOA 3Q24A 2MPMA 1NCVA 4BY7B 2F0EA 2SEBD 1NSNS 3GTOB 1WRIA 1ET9A 2IX3A 2WXOA 4YIJA 3ND9A 2CJNA 4OL7A 2JQRB 1RKNA 1F0ZA 5D65A 3VRBB 4IURA 3S1RB 4B0EA 1PDQA 1QB5D 5E3FA 1NR4A 1L0VB 3HOXB 5C0XJ 1OQQA 2KMMA 4D2KA 2K1BA 2EYPA 5CV7A 1OQRA 1YN4A 4XWWA 2RVLA 2PNRC 1B1ZA 4RWSC 3R8BA 5ELCA 2ACZB 2F0WA 2EY5A 2JYEA 3RUZA 1LABA 1HRJA 1EY0A 1QCBD 1ZYRC 2C5CA 1II3A 2M00A 4PMWA 5HFYA 4LTUA 1B53A 2A6HC 1HPCA 1SMYC 4KHVA 4K8IA 1IHZA 3S1MB 1BR9A 3FILA 3ZJTA 2KQ3A 4ZLTF 4FVMA 5D3DA 1CHQD 4US9A 3NPPA 2JEAI 1SNQA 2WXIA 2LHEA 4OGQC 3VR8B 3MHZA 1HFNA 1KNAA 4HCSA 2EJMA 1MHHE 1BOSA 2B2UC 1ZPSA 4I7ZC 5BN4A 1G6ZA 3UI2A 2JZPA 2KCCA 1TZOA 1I4GA 2KHSA 3S1QB 2NVXB 3CKIB 2BE5C 1T6BX 3PUXA 2K5QA 3R2IA 5T1GA 5C3XA 3IT4B 4OVZA 1IL8A 2JP1A 1FD7D 4IUVA 2LEKA 2Y5CA 1LTTD 4J1MA 1KAAA 2WU2B 1C79A 5G5GA 3V3XA 3J9CA 4KY7A 4PQXA 4BBRB 5BMGA 1F2MA 2OF1A 1DOMA 2F0DA 4O1NA 1H9JA 1PFDA 4GZYC 3HOUB 3H91A 1QWYA 3I91A 2F0SA 2FHTA 2EDGA 1XLQA 1K83B 3MXNA 2Q5WD 1D1KA 4TKOB 3BIID 3NS1A 3C1FA 4HR7B 2X6GA 1TS2A 1L4ZB 2ZXRA 4RH6A 1H9SB 5FKAC 2WAQB 2GB1A 4LMQD 1VR9A 3HVDA 3IFDA 2BDOA 1SNOA 1JB3A 1CJEA 1VMPA 1NVID 3I73A 3ZQ4A 2WKDA 1LTRD 1N5WA 1TY2A 4KK7A 1S5CD 4TSSA 5EE3A 3VR9B 1KF6B 3T3OA 1N62A 1K8OA 2WB1B 5EKLA 1M8AA 1Y8PB 4L2YA 4LJZC 2OXPA 3TSSA 1PLFA 2ENBA 4DK1A 4KN7C 3PO0A 5HG2A 1XWEA 1WSPA 4DXFA 3GTMB 5C44B 1C4PA 2B2WA 3SXHA 1SE3A 1JROA 4P2CB 1GUNA 1WCMB 4RKBA 4FYDA 1QOHA 3C3LA 1JALA 1TKWB 2IGGA 5DM63 2NB0A 4WFN3 1C4AA 3ETRA 2W54A 2DY8A 4FXDA 3VYRA 1DM0B 3T13A 4RCOA 3HGBA 2D5DA 3EFXD 3AEGB 2J52A 3U9SA 1KLGD 1MI2A 3IL8A 3SK4A 1OXUA 4A3EB 2NN6H 2M2LA 3NRZA 2VNUD 3TEYA 4ILWA 3J7AF 1JE4A 2RKSA 1U9RA 3A8IE 3DM1A 1SNDA 5CGKA 4Q2JA 2IL8A 1SNMA 1MPEA 1TVXA 3MFGA 2ZXOA 4QMGA 4OO1I 3Q0AA 3L4PA 5IGBA 1NYQA 2LGIA 2MUYA 1PFNA 3J80L 2Z8LA 2OHFA 1JCKB 3I57A 1B2TA 3H94A 1KDBA 1BDOA 3AMUA 1FXIA 5IT9L 5M9OA 2A69C 1ZYRD 1AP0A 1ROEA 5BMHA 2EZVA 3PUYA 1EY7A 2G1EA 3GV3A 4KY5A 1WYGA 1PZID 2BS4B 2WXGA 1RM6C 3X3MA 2A6HD 4YTMB 1SMYD 1VRAB 3BG3A 4HN7A 4ME5A 2I38A 1KNEA 1PRTF 2KUMA 4J8QA 4DAPA 5KNDA 3TEXA 2L52A 2EKIA 2ZXPA 1E2WA 4X3TA 1BCPD 1ENFA 4MM3B 1BUVT 2MHVA 2BA1A 3NE5B 2DNCA 3MTSA 1HA6A 2K04A 2K5WA 1TKYA 3SR6A 1V1PB 3KLSX 3GTLB 1B44D 1CK1A 4KI0A 1PTOF 3GS2A 1OXTA 1PXUA 4KJOA 4ZHOA 4DAVA 1FNVA 2K7VA 4CKCA 4NP5A 3A56A 3H09A 1CTMA 2RQXA 3TUOA 3HRDD 2V3NA 1F9PA 2L83A 2KDMA 2B8GA 1SE4A 1YJIA 5I6WA 3HG9A 2E76C 1V1OA 1QG7A 2WXHA 3KLRA 3E0JA 2MJEA 2H89B 1I7HA 4LAAA 2D5GA 2CVRA 5E4XA 3RPFC 4RFBA 1E6EB 3RD4A 2B2YC 4N9TA 5M3MB 1C78A 3VRAB 1ILQA 4IN3A 1DJRD 1EOTA 5ELEA 1NENB 1U4RA 1BMLC 1OXSC 1Q10A 1WTQA 2QJLA 4WWMA 4CGYB 4RKLA 2NVQB 3CQZB 3TZUA 5FO7B 1MSGA 1J7BA 1YQ4B 2H88B 5EBCA 4U68A 4CQNA 3AE3B 2V4IB 4JBWA 1X3QA 2N55A 1MSHA 2WXFA 3MEHA 1L4DB 3SK5A 5JEAJ 1A2UA 1SYFA 5C0XG 4NW2A 2MJDA 4YTNB 1I4HA 4QF4A 3CRKC 1PZKD 1XXGA 4U673 2PW9A 3AEBB 3G7LA 5JPMC 1RJTA 4DFAA 1UNSA 3DHQA 3PIP3 2EPBA 1BF4A 1S4ZA 4H13C 1JMLA 4YXDB 1HZ5A 4C3IG 2J4XA 5EPJA 3HP3A 4K2LA 1KRHA 1RODA 4CKEA 2X38A 3P4RB 1STBA 1LTSD 1RFKA 2GRIA 3S9WA 1GB1A 1TYGB 4LK1C 2WQYB 1JOOA 4NDXA 3OMCA 4HTHA 3NBHA 4RAUC 4PT5A 2KN4A 1LACA 4IUUA 1UEAB 1FNWA 2O2LD 5I2XA 1FO4A 4MN3A 1VF5C 3EROA 3K0YA 3RZDB 1Y8NB 4RF0A 3SK8A 3NVZA 4DF7A 2PTLA 4HEA1 3VR2A 1K50A 2EOTA 3FVQA 1QQRA 1EEFD 1Q8IA 2L11A 2BS3B 5FLXL 2LFNA 4JX1C 4L23A 4ARCA 3DXJC 2F0JA 1YJJA 4L1BA 3DWGC 3CHBD 4FXKC 1QLBB 1ILPA 1PGXA 2LHDA 1O7ZA 3N52A 4C3JB 3P1MA 1A3UA 2TSSA 4DAYA 5GXGB 2JX5A 4MACA 2RSOA 1TT2A 2A69D 4A93B 4OIKA 2I07B 1RTNA 2IJ0A 1AW7A 3J81L 3HKZB 4ZUIA 3EJIA 4YSXB 3B2FA 1HCZA 2JE6I 2AUJD 2E74C 1D5MC 3CWIA 5LL6X 2A5HA 2F0VA 2NTSA 2WKCA 1EIGA 4BA2I 4KHZA 1IUEA 1O7LA 3D3RA 3C46A 3KWVA 1CFMA 4L63B 5EE9A 1PYWD 3RLFA 1V8QA 1J7AA 4NZLB 3AE6B 5CV8A 3KBGA 1AEXA 1E2VA 3WOFA 2B63B 2WACA 1F2LA 3NP8A 4REZA 3CU7A 3M7GA 4MH8A 4XWTA 1M4VA 4RGNA 2NBFA 1E7PB 5DM73 1TWCB 3FC4A 5A2QL 2LMCB 3W5VB 2K3UA 3GV6A 4C7YA 1R4QB 4IUQA 1R7SA 2RDFA 1SEBD 4WAFA 2NVYB 3FPPA 2L12A 3A8KE 2IGDA 5J39A 1OO9B 3GO5A 3IAS1 3J80E 1ZUD2 1QF6A 1F2YA 3QOLA 2WXQA 4ZHPA 4ULLA 2HQEA 5C0XH 1YNJD 1ZXHA 1STNA 3AEAB 5IT9E 2LJIA 1K53A 1CZGA 4NAMA 3H0GB 3FAHA 1OXXK 3GP7A 2BBCA 3MAQA 2Z1CA 1CQFA 2WU5B 2MGSA 4IFDJ 4WJWA 1MVKA 2RBMA 5DNFA 4A3JB 3ITPA 1DONA 2OT2A 3IAYA 1STHA 2XRQD 2R3ZA 5C6AA 4XDXA 1EYDA 2E2IB 1BO0A 2QSDA 1QNUA 2BDNA 3TBIB 1LV9A 3AV8A 1C4QA 3U2SC 3RZOB 1NYRA 1ONLA 4V190 3TP8A 4TQUS 3IKJA 3T3NA 2PW7A 4TQ0A 2HDMA 3VA5A 2R7ZB 4YTPB 5T1IA 2HCIA 3TN2A 5IGFA 3LYYA 1I4PA 2FMMA 3A54A 3R3OA 4OHJA 4X3KA 1C77A 3ZYYX 3K57A 2YU9B 5EPKA 2K32A 2Z4HA 2SNMA 2K01A 2EE1A 1QOFA 4HKQA 1T5EA 4AS1A 4RNAA 3EVQA 2EJGC 2NN6G 5AUKA 1JRPA 2B39A 2PZWA 5CV4A 1E9MA 1ENCA 4BWGB 3N9YC 1FR3A 4R9WA 5M5WB 2YEPB 4WURA 4GDKB 1D5XC 4JK1C 5LL6S 4EQOA 3T51B 3AE5B 5CBAE 2N0SB 3S16B 4IQZA 5J1ZA 2G9HD 3R2TA 2IPKD 1FM0D 3T53B 1WTOA 1E2ZA 3MHBA 2JXTA 1JORA 5C2TB 1FGBD 3KUPA 1E0ZA 1NI3A 2VB2X 3LX0A 2K22A 5EE1A 3FDTA 2K5PA 1SXTA 1XEEA 3KBXA 1EEID 2L32A 5CORA 2PKOA 2LKVA 1GUSA 1D5ZC 5M5XB 2KECA 3FPUB 2EJFC 3MFYA 2L5TA 3SDZA 4JWSC 1HUNA 3GTGB 1PZJD 3OOCA 4ZQ3A 2CU3A 4H44C 1PUTA 3AEDB 4A3GB 4JE3B 1BNZA 2ID0A 1VDVA 2B2UA 3F2UA 3S14B 1RF2D 1RTOA 4ZRQA 1C48A 3K7AB 3K5MA 4C3JG 5FOBB 3OMGA 1JW9D 2ICEC 3SFDB 2K6AA 1BCPF 1BBXC 5JPNC 4IOIE 2F1MA 2B76B 1RHPA 2D2CC 4KTAA 3BVMA 2L1AA 5IGDA 3P4SB 2IDYA 1DOLA 3K5NA 1U4MA 2WP8J 4K14A 1SFOB 4XQQA 1IYUA 1R9TB 2KAJA 2QF7A 4XE0A 1STGA 5JJZA 2JA8B 4PMCA 3D31A 5TSSA 2M9VA 1Y69U 1ZP0B 5D7GA 2A6EC 3BVZA 3QWNA 4FF4A 4DU9A 1C9FA 1Y1VB 3HRZC 1B50A 5CV9A 4DK0A 2F3VA 5KNCA 1X32A 3K6OA 4FP5D 3I4LA 3ZJVA 1ICWA 4RGTA 3BYTB 1L6UA 2W3SA 3TEZA 4H2AA 1B4OA 4A3FB 2E2HB 4Q0FA 1SIJA 1HQMC 4N6EB 1WD1A 1DXMA 1H9SA 4C3IB 3HUIA 2I46A 1ZEQX 2JXMB 3TP7A 4DNTB 4YT0B 1ZDXA 2DY7A 3BDLA 4R8NA 1C76A 1IGCA 5EQ0A 3R93A 1QE6A 1H9MA 1GUTA 1RDPD 1Q12A 5JAVA 4XQJA 5HHDG 2B2VC 3NVYA 1SYDA 3W9CB 1VZ6A 3NTKA 1I4XA 2CJOA 3LXFA 1SDFA 1HZ6A 1XYIA 3UI3A 3C2PA 4M1UB 1Y8OB 2H1EA 5BYRA 3U7ZA 2HTME 2JSOA 2N88A 1K52A 1OFFA 1RD9D 3FEWX 3BVGA 2MH7A 1G91A 4TRDA 2PMVA 2PVGC 1LTGD 3Q8EA 1EWYC 1WTRA 3AE7B 1VF7A 1PFMA 3NWSA 4EGVA 4N59A 3U52E 4OO1H 3NUHB 3VYTA 3HOVB 5A2QE 4KKSA 4KKUA 2N9KA 1UWMA 1YN5A 2CW0C 3A7AB 4YSYB 2KACA 5FO9B 1FCLA 4FF3A 4XTCS 5K36G 1WTVA 3M4OB 3I90A 1JWAD 3H8HA 2KEEA 1EM7A 4WRDA 1JOKA 3IAM1 1JWUD 3NUCA 1JC7A 2Y0SB 4JWUC 1DD2A 1BQQT 1GUGA 2N9LA 2ZW0A 4PNYA 1HTPA 2X69A 1SYBA 1LT6D 3W2DA 3VQIA 3X3NA 4Y7NB 5BYQA 3C1EA 4Z9CB 4LK0M 2HCCA 2IX0A 1I3QB 5DEHA 3NQIA 4K6LA 1A3VA 3AEFB 2PMZB 4QB4A 2BCOA 2PZUA 2JWUA 1Q1BA 2M0AA 1F77A 3MA2B 1R4PB 2F0GA 1FEHA 1PDXA 4L8JA 4C3HB 5JVH3 2I2YA 1TIID 4FXGC 1G2SA 2BE5D 3EUB2 3L9AX 2F0HA 5G3LD 5JEAH 3SK6A 3HOWB 1WTPA 1RWSA 4K8JA 3J7AV 1N61A 4AQ7A 1ET6A 3S2DB 4RHSA 1PGAA 4FXCA 2BYTA 3P75A 4ZRPA 4QIWB 2E6XA 2EY1A 3L7ZC 1HHVA 3NK9A 4DXGA 1V1PA 2Y3AA 2PVOD 2K0PA 1STAA 5ISRA 1BUIC 1A70A 2RPVA 2J53A 3Q8BA 4XYOA 3AEEB 3RFZB 4OW0A 1EY8A 2XSCA 2K28A 4DGZA 2EYLA 4GDLB 1G8ZD 2J7ZA 1SYGA 2K5DA 2EVBA 4KGSA 2HDEA 2B2TC 3NVVA 1Z6HA 2DLBA 5C5LA 2V0GA 2K9XA 3HZXA 3KWLA 3DUZA 5A35A 4P6VF 1F2RI 4HMIA 4I65A 5BYSA 1XTCD 1ZXIA 2WNMA 1EY5A 4CJ0B 2A6ED 2WP9B 2B2YA 5KRUA 4YSZB 1JQ4A 1PGBA 2WXJA 1I6HB 2SAKA 1DOXA 2F0FA 1V8CA 5I2YA 4K5XA 1CM9A 3DWMA 3E9SA 1WGKA 1U4PA 4DN4M 3I3CA 1FCCC 1IBXB 1F9RA 4XT3B 2F3WA 3AH7A 2B8FA 1WD0A 1VZ7A 2PYKA 1I4QA 4CJ1B 4XXEA 2PQEA 3QO2A 1KLUD 3HVZA 1IW7C 1GPXA 4ARIA 2F0NA 4E6IA 3NSWA 3AB5A 3AE8B 2M19A 4A3DB 1UUPA 2F4IA 3LWEA 5G5HA 4A8XC 2RMMA 1JICA 3NVWA 4NMZA 3OIQA 4IUPA 5CBEE 3Q69A 1IKLA 5CV6A 1J9OA 1G291 3EGRA 2QDBA 4NJCA 2WV6D 5MPOA 4M8AA 2AUKA 5K36H 4K5VA 3S17B 2WDQB 5IOCA 3QG1A 1XF5L 1ACCA 1P7EA 1EU4A 1EZ8A 2Q8IB 1KH0A 1JQYD 3DWAA 3SEBA 2YYZA 3JAML 4HMJA 3Q22A 2F0KA 1EY6A 5C4HA 2V4DA 2L9HA 3CRLC 2INPE 3A55A 4KKIA 3GD7A 3CIRB 3K59A 3QOJA 2Q8TA 1Q90A 1VJKA 5EGTA 4KKTA 4KGRA 3BK1A 3PUZA 4A3MB 1QNKA 2WDRB 3P63A 1JWSD 1EZ6A 2GA4B 1VCIA 2W82A 1MI0A 1CA5A 2FJ2A 3VYUA 3AE2B 1HA5A 3MP9A 1SJED 2EYMA 2DYOA 3PV0A 1VDZA 3TP6A 5KNBA 2J42A 3DEOA 1C4CA 3D4DA 5H92C 1CHPD 1A15A 1SSNA 1B9NA 4Q5VA 1SBBB 1KDAA 2Z4IA 1S5FD 3NWTA 3T16A 4J3OD 3AB9A 3V96A 3SHLA 4IFDI 2NTTA 2ZT9C 3ZJUA 3QJYA 3DMUA 4ZUJA 4USAA 2JA7B 4MIUA 3IXSA 1JWMD 2WIIB 4ZKCB 3HS0C 4HKZE 4US8A 4CHTB 4F88A 2KOLA 3KF8A 4X3UA 4C80A 1Z47A 5M3FB 2AQ1B 1X3PA 4C3HG 1D6EC 3SVMA 1TS4A 3T4AC 5I6YA 3BWUD 4FF2A 4C56C 2WDVB 1GXDC 1TWHB 2Q8RE 3PZ7A 2JEBI 2LMCA 2VZKB 4ID6A 4B9XA 5C3EB 1DZ1A 1XLPA 2WXKA 1RYJA 1YNTE 1EQTA 1EL0A 2R6GA 4ZKBB 1QKZA 1AFPA 2V3PA 1SSOA 1UGJA 5ELFA 3H6MA 2EY2A 2AQ3B 1QOGA 2QMTA 2R61A 1ESFA 2C9OA 4M0WA 1FRDA 1HFGA 1XO3A 3P7JA 5DAUA 3VYSA 1NUCA 4DNRB 5ELDA 2G9DA 3OW7A 1N60A 3BK2A 5D14A 2QILA 3DWPA 2QKIC 4A3BB 3NTHA 1D2BA 3GB1A 3I70A 4BY1B 5IGCA 1DYQA 5F2DA 3HEJA 1K51A 1U4LA 5C5MA 4MT5A 2OEDA 2WXMA 3KK7A 1GJXA 1EFID 1IKMA 1BXTA 3B2GA 4WQMA 1WVLA 3GTKB 1IW7D 2R93B 1F9QA 3MC0B 2J0TD 1GHKA 2F0LA 2RDHA 1YNNC 3QB3A 3WDNA 1YQ3B 3Q6SA 4KN4C 1XLNA 2MEKA 3FILB 1FFVA 2AX5A 5IGGA 3TMEA 3MWYW 2EYJA 4RF1A 2VUMB 3IT6B 5IIFA 4ITKA 1GOZA 3TDQA 1D4BA 4OO1G 5E6JA 1XX8A 2LFIA 4XQNA 3AM9A 4TQ1A 2VB3X 2O5IC 1P7FA 2E2JB 1FYCA 3FKIB 1IYVA 2SDFA 4O42A 1HUMA 3HOYB 1AYFA 5BMIA 2JSVX 1GHJA 5EPLA