1QILA

Inactive mutant toxic shock syndrome toxin-1 at 2.5 a
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
194
structure length
194
Chain Sequence
STNDNIKDLLDWYSSGSDTFTNSEVLDNSLGSMRIKNTDGSISLIIFPSPYYSPAFTKGEKVDLNTKRTKKSQHTSEGTYIHFQISGVTNTEKLPTPIELPLKVKVHGKDSPLKYWPKFDKKQLAISTLDFEIRAQLTQIHGLYRSSDKTGGYWKITMNDGSTYQSDLSKKFEYNTEKPPINIDEIKTIEAEIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a biologically inactive mutant of toxic shock syndrome toxin-1 at 2.5 A resolution.
pubmed rcsb
source organism Staphylococcus aureus
molecule tags Toxin
molecule keywords TOXIC SHOCK SYNDROME TOXIN-1
total genus 59
structure length 194
sequence length 194
chains with identical sequence B, C
ec nomenclature
pdb deposition date 1997-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1qilA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1qilA01
2RDGA 1AW7A 1BCPD 3BVZA 4OHJA 1YN3A 2WV6D 1XTCD 1RD9D 2O2LD 2XRSD 1PTOD 1CK1A 1MD2D 2XNAC 1ESFA 4RGNA 3W2DA 2G9HD 1D5ZC 3DWQA 1SJHD 1AN8A 1JCKB 1SEBD 4RHRA 4DXGA 2R61A 5TSSA 1LLRD 1HTLD 2TSSA 1EEID 1RDPD 3R2TA 1LT6D 1FNVA 1V1PA 5FK9C 1BCPB 2XRQD 1LTSD 2NTTA 1FNWA 1CHQD 2IJ0A 1LTAD 1PZKD 2J4XA 4Z9CB 1ET6A 1GOZA 1G8ZD 1RCVD 1PRTF 3DWPA 2IPKD 1SE3A 1I4PA 1M4VA 2AQ2B 1LO5D 4K6LA 1BCPF 1DYQA 1CT1D 4C56C 4RGMA 1PRTB 2SEBD 4RGOS 1T5XD 2XN9C 5D3IB 1EU3A 2NTSA 5ELFA 1FD7D 1ENFA 3SEBA 1S5DD 1PTOC 1TS5A 4L63B 4UDUC 5ELEA 5ELDA 5I4DA 1EFID 4RCOA 3GP7A 3BZDB 1ET9A 1D6EC 1I4HA 1PZJD 1SE2A 3KLSX 1JQYD 1KTKA 1EU4A 1TS2A 1PTOF 4ZYSA 1DJRD 1FGBD 3EFXD 1RF2D 1SXTA 5D3DA 1FNUA 1I4QA 1QILA 1JWUD 3MC0B 2AQ1B 1CHPD 1LTRD 3R8BA 3CHBD 1CQVA 4RHSA 2ICIA 1EEFD 1YN5A 1S5CD 3BVMA 4L6TB 1SBBB 1PYWD 3EA6A 4NZLB 1LT5D 1I4XA 1BCPC 1S5ED 4TSSA 1LTID 1V1PB 1JWMD 1TS3A 1I4RA 1PRTD 2QILA 1TY2A 1L0YB 5FKAC 1TY0A 1B44D 1L0XB 1S5FD 3OWEB 1B1ZA 1YN4A 4RH6A 3BYYB 1PTOB 1UNSA 1I4GA 1UUPA 3BYTB 4DXFA 1D5XC 2RDHA 2AQ3B 1PTOH 1LT3D 1TS4A 1JWSD 1KLGD 1XXGA 1PZID 1STEA 1KLUD 2QEJC 3V05A 4RFBA 2Z8LA 5ELBA 1HXYD 4BWGB 1SE4A 2CHBD 1SJED 1F77A 1S5BD 4RGTA 4O1NA 3R2IA 3DWAA 1JR0D 1LTGD 1HA5A 1LT4D 1V1OA 3BVGA 3TSSA 3URYA 1BXTA 3MFGA 5ELCA 1LTTD 1EWCA 1HQRD 1PRTC 1LTBD 3O13A 1D5MC
chains in the Genus database with same CATH superfamily
4HDOA 2RDGA 3NVZA 1BCPD 2ZEQA 2L55A 3S2HH 3PZ7A 5E3FA 2IO2B 3DXJC 5A2QL 3HOYH 1KOTA 1J19A 5M3MH 1E90A 4A3MB 3GTLB 3QJYA 1TVXA 5EJWA 1NY4A 2JA8H 4LNNA 1PFMA 4RMAA 4WJOA 3TL5A 2JEAI 1LXDA 3H3VI 4EE2A 3WALA 4B3SL 3NWTA 4N9TA 3P4QB 4NNJB 3DM1A 2JPHA 3CCLA 4DUZL 3CPWA 5C5LA 1WD0A 2BE5D 4NKLA 3CCSA 3C1EA 2B76B 2VY3A 2BH2A 3U8ZA 4MJSA 1V1PA 1UZXB 2LMCA 4E71A 4CBVA 3RZDH 1WTWA 3QG1A 4NAWA 1JE5A 1MVKA 4I7AA 2MRPA 2EXZA 5JH5C 3HVDA 4A3KB 2B2YA 3IKJA 1H8CA 2J4XA 1RCVD 2E2IB 2K1BA 1FCCC 2Q5WD 3X3NA 4TQ0A 4HRSA 2PO4A 1A8VA 5FOBB 1NE3A 3I73A 4QF4A 1NEKB 4DR3L 4C56C 4F87A 4RGMA 3PIP3 4W9EA 1KQSA 2INNE 1NSNS 2IHEA 5JPNC 1YNJD 3OJ3A 4R4QA 1FXTB 1BF4A 2L5TA 1PTOC 1SYFA 4L63B 4X3SA 5I4DA 2XWJB 1H4RA 3U9SA 5FO9B 4IJLA 4A3DG 1N34Q 2JYEA 2HJ8A 2KYWA 4IKGA 2JUOA 2QA4A 4IWOA 5IWAL 5BN5A 1QNKA 4NPNA 3K5LA 3I4LA 4DR3Q 4IZ8A 1VQNA 2FE8A 1FNUA 2K22A 2NR2A 4APVA 5IP9H 2DHZA 4K7SA 3ZNGC 3DLLA 1CHPD 1Z9FA 4NQLB 1KAWA 5J3BA 1WTPA 3A5UA 3P2BA 4AP4C 1YN5A 3EVQA 1C0AA 4ANVA 4G57A 1E24A 3PPAA 5L37A 3CW2C 3L4PA 3M62B 4BY7B 3EROA 2FCQA 2D10A 3QO2A 3OMGA 4KLKA 1V9JA 4KKTA 2CR5A 1PH7A 2EVBA 2BDOA 2YU9B 4F8MA 3Q3JA 2JRHA 1JOOA 4XWTA 3M4OH 1K9MC 1I4RA 2IGDA 3M7NA 1UGMA 3N1ZC 1SSOA 3RZWC 1S5FD 3OPOA 2IX0A 3NPPA 3KJOA 2GI9A 2M0AA 2MWSB 1BT0A 2NWGA 1YITA 1K53A 3GE3C 4J3OD 4HEDA 3RLFA 1ZXIA 2A73B 4JQWC 3L9AX 3AEVA 3RLOA 2KQSA 2WXLA 1X32A 4MGZE 5D2MB 4ZYNA 1C1YB 2KCNA 1GAQB 1F0ZA 1KLUD 1DGJA 3KYCD 1TT5B 1TWCH 4HTHA 1GM5A 2KXJA 4HIOA 3DM3A 1VR9A 3CMAA 3HOVH 5FR3A 1NCVA 2MBEA 4EZLA 2NVQB 3NOBA 3ZTDA 3NWSA 5C0XG 4AJWA 4FYDA 1WYDA 2B3GA 1V86A 1PYSB 3GTGB 3TSSA 2JF5A 3P1MA 3U2SC 5IGDA 1ZPSA 1XQQA 1STNA 1I7HA 3A33B 4BVUC 1GXDC 4DNRB 2GBJA 4DV0Q 4JI8Q 4YWGG 1ROEA 1B53A 1LQBA 3PGZA 3SXHA 3A8IE 1RD9D 4BOZB 1BR9A 3FMCA 1UELA 3PCOB 1Q86C 3BWUD 2KWCA 2XRSD 1Q10A 1S4ZA 2Z0EB 1TWGB 4DV6Q 3M95A 3OTOQ 1YD8U 4MGKE 5LMUL 4A3FG 4RAUC 4DV2Q 3GTJH 4M8NA 2AUKA 1HNZQ 2PE9A 3NENA 2SNMA 4HCSA 2O2VB 3NTKA 1EUJA 2OEDA 1SNQA 1TKGA 1X54A 3SDZA 2GBRA 3EBEA 4QIWB 2G3QB 1HNXL 1V2YA 4WWPA 4B0EA 3CCUA 4GLSC 1YX5B 2GBMA 5AJ3Q 2N49A 3RN2A 1LTSD 2UU9L 2LFIA 3ZNZB 4N8X1 2LZ6A 1I35A 4C3IG 1VQIA 4UHVA 4DK0A 5JEAH 4ASWC 2FCSA 1RKNA 3U52E 2K39A 2BTEA 1M1KC 3M3YB 2HIVA 4JPBW 1D7QA 1X6OA 3AE6B 1CFMA 3SHLA 3STBC 1HNWL 2E2DC 1XO3A 4QQBX 2JY6A 2VQFL 2Z59B 4DUYL 1D4BA 5D3IB 2VB2X 4N6EB 1CM9A 3TEYA 2WFWA 1TJEA 4X6AH 4KGRA 1Y1WG 2QCPX 2EZVA 3MXNB 2F0DA 3RZOH 3PF5A 3CP0A 1ONLA 1WJ4A 2E3TA 4NY0A 1JC7A 1UBIA 4DN4M 3S2DB 5DPTA 1K3BC 1PTOF 3A7LA 3X0WA 4EEWA 4K0KL 3TZUA 2KA7A 1L1OC 1Z6HA 1YI2A 5A35A 1MJCA 2Z6KC 2R3ZA 1JWUD 3MXNA 1RL2A 1QVCA 4YTNB 4NXNL 1CQVA 2MP2A 4Q2JA 1XEEA 4WURA 1V6EA 1A5RA 3BVMA 4L6TB 3TS0A 3JAML 4IO9A 3EA6A 3BDOA 4WIPA 1F9RA 2ZTEA 4F7XA 1RTOA 2BVCA 4GDLA 1BCPC 2VS1A 3KBGA 4DAVA 2W82A 3WA0A 4IUTA 3QWNA 4R3DA 5J2RA 3W9CB 2UXBL 2O5IC 2J52A 2J7ZA 4FF1A 4IUNA 2K1FA 1C78A 3QA8A 5AZHA 3KDFA 3HKZE 1AFPA 5JJIA 3JAMi 2KWDA 3AMUA 2EYPA 2RVLA 1UE5A 2WS3B 3DBHB 1SMYC 3K6OA 3MEHA 1K73C 3QOJA 2INPE 3CF5A 1PTOH 2KJHB 4KX6B 2CHWA 3VDYA 2BW2A 2J0TD 2QC8A 2N3SA 4XT1B 1EQTA 3M4QA 4BY1B 2AYOB 2DZIA 2Z8LA 3EGRA 2PW5A 4BWGB 1WH3A 4K2LA 4M1UB 4NMZA 4B3SQ 1Q1BA 3K81C 1X3GA 2JQOA 3Q22A 3S1QB 2K8BA 1GB4A 3R2IA 2W55A 3EECA 1IBXB 2X8XX 3AE4B 5KHQA 2AUJD 3A9KA 2X6GA 4QL5A 4P72A 3QQ8B 3I4NB 1VQBA 2A68C 2K8CA 3UQBA 1TGZB 1I50B 3M4YA 4OEMB 2WGSA 2CCZA 2F0HA 2IO1B 3EIVA 4JI1L 2E6XA 2WV6D 1NMGA 1SROA 2HHHL 2G9DA 2M00A 1NBFC 2CFMA 3JVZX 2K25A 3NTHA 2QKIC 1UEAB 3QARA 1QJOA 1E8YA 1W6KA 2G45B 3DDCB 3WAMA 2IGHA 2UXCQ 1WTQA 1SJHD 2C7MB 3H94A 1AARA 4W9GA 1PQSA 4RHRA 2X38A 3HRZC 2VZKD 2TSSA 4F88A 3KWLA 4BBRG 4V0BA 4H7BA 4X3UA 4C3HH 1Y1VH 1TXYA 4XDDA 3NHHA 4DV1L 2AMCB 1UD7A 4GDKA 2K52A 3AQQA 2Z1CA 3GQBA 1FNWA 4UP8A 1XLQA 5EE0A 4ARIA 1Y8OB 5G2NA 1WRIA 1G8ZD 5IYCH 1M4VA 1WGYA 1LO5D 4U68A 4RM8A 1X65A 4XYCA 4ZK9B 5JJZA 1F9QA 3J81i 4DV0L 1JMLA 2JRIB 1FL0A 2L1BA 1L1OB 4H13C 1MGSA 4DF7A 3M3JA 3P4PB 3SK6A 3CQZH 3HKZB 4XT3B 5FJ8H 2HHHQ 1S5DD 1Z2MA 2KQ3A 4JI1Q 2PIAA 1QOGA 2DLBA 4H0LC 3EN2A 5DM73 1Y8PB 2G4SA 2ZPNA 3HOUB 4IPDA 1UE6A 4RM9A 1FVIA 1TQOA 1KXLA 1I4HA 1JW9D 2B2VA 4LUVA 3NY5A 4IPGA 4GKJQ 3AYHB 2MQJA 3CCMA 2PKOA 1KABA 4S3SA 1E2VA 3A56A 3IFTA 1TIFA 1L5PA 4GLVB 1K0SA 3QWZB 4JL9A 3OYYA 1FYCA 4NP5A 2PMZE 5IE8A 1PH8A 3KW5B 4XGAB 2FIFA 3MXUA 4BFRA 2R92H 1TIID 2D07B 3T4AC 2QEXA 1UH6A 5HG2A 3PUZA 1PHJA 2KDFB 2WXFA 4TSSA 4C3HG 4A3JH 1YQ3B 1U4MA 3FEWX 2D11A 4KHVA 2IZVB 4ODGA 1A0IA 4IOCA 4AYBB 2KK8A 5LL6X 2ZJQA 2K6DB 2K5QA 3SR1A 2VUMB 3FKIH 4CHTB 5NUCA 4L5RC 2UXBQ 5L95C 1Q82C 2C35B 3BDLA 3PSEB 3PREA 2RSOA 1D5XC 1J5EL 3T1HQ 3A9JB 3PT2B 3CF6E 1LT3D 2OTLA 2WACA 2GVBA 1HHVA 3F2DA 2A1AA 3JC66 1T9HA 4DK6C 1Q46A 3HOVG 2N9EB 4X64L 2WHIA 3N6RA 2OWOA 4NXNQ 3DBRI 2MJ8A 4ME5A 2E2HH 1N34L 1NI3A 1Y14B 3NS8A 1SJED 3P75A 4K3BA 1KDCA 1S5BD 2K7VA 4N59A 1ZDXA 1XWEA 4BBSB 4YXDB 1JT8A 3AEDB 5ELCA 3S14B 1LTTD 4MGIE 3SDLC 2OEOA 2A69D 4DR2Q 2AWNA 3BVZA 2FMMA 3R93A 5JJLA 1YN3A 5CV5A 1XTCD 1ZYRD 3S1NB 2MHVA 4JW0A 2GRIA 3OW7A 3KF8B 1T0YA 2E74C 3HG9A 2XVSA 2RBMA 3SFDB 3U4VA 2MQHA 3TCAA 5HURA 4XYQA 2UUBL 1VQCA 1ICWA 4AJYB 5GROA 3HZXA 2R7ZG 3W1SA 5C4HA 2OTJA 2FJ2A 2VNUD 4DXGA 3QC8B 1L6VA 3I4NH 2R61A 2RHSB 4PS7A 2CH4W 4HCEA 3GV6A 2IWHA 3S1RB 1MHWC 3R2TA 4GGQA 4C4VA 3ZJUA 4KY7A 1X56A 4IOAA 1YNNC 3A9KB 3W5VB 2K01A 4YSZB 4O42A 1R4QB 1EQRA 2EJMA 4OZCA 3SK5A 1EWIA 2QDLA 3F1ZA 3MHBA 1L6UA 4OXPA 4WWNA 3A55A 2K5PA 5E7NA 5C0XI 2G4DB 2FBWB 5C23A 4X65L 2AQ2B 1J7CA 4PS3A 4LJZC 4AOFA 5LMUQ 2AKWB 3OTOL 1S1QB 3I57A 4GLAC 1T5XD 4DR6L 2Y0SB 3RNUA 3RNCC 2KHSA 4IFDJ 4HCNB 4HIMA 1SMYD 1X3EA 2WXRA 4BAXA 1H9KA 5LMNQ 1EY7A 1ZDVA 3PF4A 1QLBB 2WQYB 3AN1A 3LX0A 2JSVX 3L08A 5KNCA 1WCMH 1DZ1A 1GHKA 1MI0A 1WYGA 2V9HA 1B50A 4PT5A 3L2PA 1PZJD 1SE2A 3U50C 4ZYSA 4K5XA 5J1ZA 3J9CA 1MIUA 2M56B 3T3NA 1E1OA 1P8LA 4EQOA 2E2JH 1Y8RC 1CJEA 2C5LC 3FP9A 1WVLA 3QCAA 1PH5A 4L23A 1PGBA 4UY8C 3IVFA 4ZOHC 4JLCA 3OHXC 2D3GA 1CSQA 1VF5C 3TQYA 1VMPA 2N9PC 3U7ZA 1XF5L 2YYZA 3P1HA 3F2UA 1YVCA 2YLMA 5IGEA 3ZUNA 4BKSD 1E7PB 4DHZE 2NZ1D 4GU2A 1PV4A 1HTQA 1XT9B 1SBBB 3L3OC 3DBLB 2WP9B 1I3QB 1LT5D 1QNUA 4A3MG 2LXCA 4JV5Q 5G55A 2KOLA 1OEYJ 1T0SC 3DEPA 3RFZB 4RKBA 2CS4A 4GOPB 1VQMA 1F9JA 1O7LA 4A3GH 2O6VD 3AXCA 1PRTD 4RWSC 2CU1A 1J6QA 4R4TA 2Q8TA 3JSVA 2MBHA 2EJFC 3BU2A 3PO3G 5LXHA 3ER0A 2NN6I 2DNCA 1DM0B 1E5WA 1QOAA 2EY1A 1HZBA 1YN4A 3AI5A 4HROA 4A3LH 1BMLC 1UGJA 2AL6A 3A1QA 2MCNB 3PIPA 1KLGD 4A55A 2KMCA 3KYHC 4MNOA 1A70A 3T3OA 2D0PA 3ND8A 4USAA 3B6YA 4JI7Q 1VQHA 1TWAH 1UWMA 1KM7A 3KUDB 2B2VC 2C60A 3Q8CA 4OIJA 2JZZA 2CHBD 3MA2B 4DWFA 1WXAA 1VQ7A 1JB3A 4DR2L 4KY5A 3DWAA 3OIQA 1Z5SB 2BOSA 1NJIC 3NSWA 1PH4A 1BXTA 2JXXA 4L5SA 2FIDA 2TMPA 2X69A 2KHIA 4KKSA 2KX0A 4FJVB 1A63A 3VR2A 3RN5A 3P4RB 4M8AA 1EZ8A 1N5XA 1CKOA 4KZ0A 1AW7A 2UXDQ 1ZUD2 3VXWA 3ZRCA 2Y5BB 2DAJA 1CI3M 2KLGA 3U9OA 1B4OA 3DBLI 2ZXRA 2O2LD 2JA5H 1C7YA 1E22A 3FPPA 1TWGH 3AH7A 3TEHB 2E2JB 2H88B 5AZGA 2RDBC 3T1HL 2CHZA 2G9HD 3G48A 1K0RA 3AE7B 3GZNI 4NJ7A 1KRSA 3UE0A 1EF5A 1FO4A 1WTXA 3EHVA 3VYSA 4C1NI 1NTGA 2I2YA 2EJGC 1I6HH 4K81A 1E6EB 1E8WA 1Q12A 4IALA 4UPAA 4OWTB 3AU5A 4JI3Q 1CTMA 1AH9A 4CDFC 2C9WB 1PUTA 1VQDA 4B3TL 3ZDTA 4P1BC 1SR3A 3WANA 2WXIA 4GOPA 4P16A 5FK9C 5M5WB 3TEXA 2WLBA 4NQKE 2K33A 5FO7B 4K5VA 3CMMB 1EYAA 4A3EG 1J7BA 1LTAD 1EM7A 4JC0A 1GOZA 4DUZQ 3VRAB 1E10A 2Q2HA 2M17A 1FIQA 4LFAQ 4WAFA 4DKAC 4PQXA 2ENBA 3IBEA 4LF5Q 2SAKA 3KUPA 3GDEA 1KNEA 2DAFA 1R4MB 1YJIA 3H09A 2NPTB 3SD5A 1Z47A 1YIWA 5BMIA 1JALA 1F2YA 3CC2A 5KRUA 2WDRB 2FMCA 1EYGA 3OW2A 1SE8A 1LM8B 3QK0A 3J81E 1ET9A 2IX3A 2C9OA 2NYZD 1IL2A 3MP9A 2M1MA 2RSUA 1KTKA 3H3VC 2LGXA 1FGUA 4H02A 4A8XC 2M4NA 3EFXD 3AEBB 1NENB 2FUHB 3TBIB 3CIRB 3QOLA 4OL7A 4QIWE 4DR7L 2I5MX 2RDFA 3I3CA 2F0VA 2M19A 1VQ6A 3J80E 2ICIA 2A8VA 3J81c 2K5NA 2ACZB 2JX5A 1H9JA 2F0NA 4LNIA 3N32A 2PZWA 5KNDA 2X6LA 1CUKA 2KBNA 2XTIA 3VH4B 1U0LA 4DV3L 1H9SA 4HJ5A 2XEWA 2KO3A 3UF8A 4YY3L 4BBSH 1GHJA 2H1EA 3S24A 1DOYA 3E6ZX 3BINA 4YCUA 3AE5B 4DV3Q 2N9LA 4A3OA 5IO9A 2BE5C 1L0YB 3KYDD 3KBXA 4OONA 1B44D 5CGKA 2MJEA 3K9PB 2B2WC 4HR7B 3NQIA 3EQLC 2ZCCA 3DBRB 1N33Q 3AULA 2OXPA 5KHOA 1OQRA 3STBD 2XIWA 5IGCA 1SFOB 1FEHA 2EMTA 1VQPA 4E3CA 1SMXA 5A2QE 2EDGA 2HQEA 3G6EA 3NXWA 1IP9A 2RHQB 2ZM6L 1D1KA 1UWVA 1P7EA 1XCTL 3H1UA 4GN3B 3WDNA 4OZBA 1HUMA 3HEJA 3IFDA 1IGCA 2ZNVC 2MBQA 2KMAA 1E8ZA 1U4AA 5F2DA 1CSPA 3T1YQ 4MH8A 3EJIA 2O6VB 4Y7NB 2SDFA 2YV5A 2RPVA 4A90A 4ACFA 4HMIA 4B9KA 3VTWA 2R93G 2HQLA 3KUZA 1QG7A 1EWCA 2LY7A 1HFNA 5AUKA 3PRZA 1I6HB 5DPRA 1K8OA 4ABNA 4LF5L 3FHWA 4X3KA 1MJDA 4LMQD 3T9LA 5I9PA 1Q8IA 2F0MA 2L1AA 2GA4B 4A3MH 2L00B 3ZTCA 3LDZE 1EYCA 1XCQL 3HOYB 1WI0A 3W5OA 1JB7A 3W1GA 4XDCA 1MKHA 1A15A 3I8ZA 5C3EG 3NEMA 4LUZA 5IY0A 2DWQA 1YEZA 2ZJDA 4JPSA 4S0RA 4DHJB 5J17A 1FCLA 4JI3L 4OWXB 4N58A 3ERQA 3VUYA 4XDXA 3HIZA 4ARCA 2WDVB 1ZYRC 2BKRB 4W9LA 1QT9A 1TZ1A 1SLJA 2BB5A 5ELOA 3CWIA 4HLEA 1IKLA 3CC7A 2I0QA 1J0GA 4DK3C 2BDNA 2NTTA 4RKLA 3TBLD 5C4XG 3S16H 2PI2A 1O80A 2DGYA 4GOPC 2VH2A 4HPLB 4B08A 3QIJA 1IXRA 1RRBA 5C44G 4JBMA 3FRPB 1XMQQ 2R7DA 2UUAQ 2MA9B 2XK5A 3HOWB 1EY6A 1Y56A 1STAA 2RMMA 1Y1VB 1WR1A 4A9AA 5FLXc 1PRTB 4F7ZA 2K8HA 2ZT9C 3LJ3A 2F0WA 1JROA 4I6LB 1GUOA 2J53A 3S15B 2VXWA 1LM0A 1BUVT 1TS5A 3SU8X 2HUGA 2BPSA 2N1WA 2O6VA 1J9OA 1VQJA 2K4KA 1WGHA 2I1KA 2INDC 4YIJA 4HJKA 4LK0M 1V5OA 1DGSA 4PG3A 3GTMH 1D6EC 1HJPA 1WZ0A 4K1RB 1SIJA 1I3QH 5CYUA 3DVGX 3AFPA 2PPHA 5M5WH 2L52A 4KGSA 1R9TB 3R7RA 4PZ8A 1BBXC 4IUPA 1RIPA 4KN7C 1WGRA 5JVG3 3NBHB 2WDTB 2FUG1 3H6MA 1SYGA 2F3IA 1BO0A 1I50H 3HP3A 4PV1C 1S72A 2BKFA 3F8TA 1B70B 2NVXB 3TEWA 1VQ9A 2NN6G 3Q14C 2NZOA 4A75A 2RKSA 5M5XH 1W3SA 3HOXB 3FKIG 5BYSA 5CBEE 4LTUA 2JA6G 1HNXQ 3RMHA 2IT1A 4TRDA 4L1BA 2JA5B 4MSQB 3SK4A 1GG3A 3TMPB 4EZJA 2N7JA 1SYEA 4A3JG 2WXMA 4B9WA 4W9DA 2R7ZH 3AE1B 2WXQA 2DY7A 1WF9A 2M8SA 4ICVA 3I63C 1TKWB 4TV3A 2JZPA 4D2KA 2DZKA 4E74A 3R3MA 4HSPA 4ALPA 4FLHA 2BBCA 5M3MG 1Y69U 4JI4L 1V80A 4L5QA 1C4QA 2NBUA 4QAYA 1GUNA 2JYOA 4A3IB 4XQNA 1Q0WB 3TMEA 2HTME 4G7ZC 4MTNA 1E0BA 4IWPA 2A74C 3IT6B 4W9FA 2V1YA 3BS1A 1WXVA 4HIKA 1WE7A 1RTNA 3G7LA 1PH6A 4O1NA 1PVOA 2N7EA 3VA5A 1JR0D 1K8GA 1JE4A 4QCLA 2K05A 4FO2A 5HGQA 4A3KG 5JJKA 1XLNA 1ZE3D 3DHHC 2PI2E 4GB9A 5L83A 3S1RH 2MPMA 3AEAB 4ZKBB 2KUMA 1VQ4A 3T8MA 4TVAB 5I2XA 1JJ2A 1D5MC 2KJ6A 2KQ7A 2KACA 1IBXA 3RR5A 2DN8A 5EKLA 4MSMB 1K52A 3DCGA 3SVMA 4KK7A 3I56A 4C3JB 3AEGB 5IT9E 2O5JC 1S3SG 2GOWA 2WXOA 2EOTA 4WJWA 1UWXA 4RGNA 1HFGA 3SK8A 2E75C 3GTMB 1GD7A 1TWHH 1SEBD 1C79A 2R2OA 4IPCA 1ASYA 1PXUA 1Q90A 4C3JH 1N5WA 1GJXA 2WIIB 3KF6B 5JVH3 2V4DA 4LF6L 3Q3MC 1SNCA 4BBRH 3C3LA 1ICFB 1LT6D 4LAAA 4PNYA 5JEAJ 1U5KA 3V60A 3DHGC 4LDTB 3F2BA 4XTCS 1JWBD 2O4XA 2E2HB 2WXNA 2PYKA 3V6EB 1L4ZB 1IYUA 3MAQA 2G5DA 1J7AA 1ZGUB 1WR6E 3HVZA 4M0WB 4C4VB 2EIFA 1WCMB 2JXTA 1B9RA 4FN2A 3S16B 4MELA 2UWQA 4JBWA 5COYA 1P98A 1B8AA 3UDXA 3TS2A 3GTKH 2ZW0A 3AU4A 3ML9A 4A3IH 3PUXA 4K7WA 2F4VL 1OFFA 1D8LA 3SEBA 4KHZA 1IW7C 1WMHB 1K8MA 3I9V1 2KEEA 2I5LX 2WAQE 3I4MH 2O2VA 3F2CA 2VZKB 2DJGC 2Z6BA 3MEFA 3J81j 4JWSC 4MTKA 5C6AA 4A3JB 3PRMB 3TP7A 3Q24A 2PW7A 4X64Q 3DVNV 3PLVA 1GKHA 2WXPA 1YNXA 2N8NA 3S1MH 1SXTA 3E9HA 3NELA 4LJPB 3VYTA 1V81A 3MC0B 4WFN3 5M5XB 2KX3A 1YZ6A 2K03A 4LF4Q 1V8QA 3V96A 1AE3A 1IW7D 1FJGL 2DYMA 2GVAA 5LL6S 2OOBB 3KFUA 1STGA 5LHY1 3P4SB 2NVXH 3T53B 3TREA 4TKOB 3SR6A 1DOXA 4HIDA 2KLCA 2ZXPA 1A2UA 2L83A 2DNEA 3GTPB 2D62A 4DR1Q 2DX5B 1FRDA 1R9TH 4Y7NH 2QCZA 2WX1A 3IL8A 2E5LL 5JZEB 4ICUA 1VLBA 1IBKL 5EDSA 1TS3A 1WX9A 3UQAA 3ALBA 5D6JB 1DONA 1P9DU 4ZRPA 3CQZB 1YOVB 1PFNA 1RFAA 1SFOH 3M63B 3PZ8A 1B1ZA 3OG5A 2JU6X 3S15H 1YIJA 1O7IA 1Z7TA 4K5WA 2JA6H 2CU3A 5IN7A 2OJRA 1JWSD 1WJ6A 1BOSA 1N61A 2QEJC 4HPPA 4KI0A 3V05A 2VW9A 2BS2B 3HOWH 4ZAIA 1WM2A 4H2AA 4ZUJA 2NMQA 4DK5A 4RGTA 2B2UC 5DM63 2HD3A 4J6IA 4JOIA 4BBNC 4EX5A 1VQKA 4HJ8A 4C00A 5CBAE 3A8KE 4IWQA 2HDMA 2ASBA 4X62Q 4DAPA 3L10B 4JE3B 1PRTC 5T1IA 1WXMA 4FHKA 3A4SC 1I5FA 1RJTA 4JK1C 4DA2A 5I9OA 4Q0FA 4XE0A 3L13A 3K58A 2KTRA 4KDLB 2LS01 5CV8A 3Q3FA 1VQOA 2MH7A 4IUMB 5IKCM 1XLPA 4GSWA 3H0GB 2UYZB 3KUCB 1FFUA 3OSOA 4YTMB 3PGEA 1ESFA 1ZKHA 4R4IA 1B9MA 4YT0B 2I38A 1E9MA 3RCZA 3CXCA 1R4MI 1P3QU 1OQYA 3TP8A 1NI2A 1D1IA 3EUB2 4X66L 1NR4A 4G3XB 4WWOA 2D5DA 4GDKB 3Q6BA 1U4LA 2IY0B 1MBYA 1LV9A 4EUTA 1RDPD 4IN3A 5IP4D 5FLXL 3CCRA 1EY0A 1FNVA 4RG1A 4GNXC 4J8QA 4FXGC 2FXQA 2F1MA 4FULA 4BBNF 4TQ1A 1Q5WB 2LGDA 3S9WA 2UXCL 3Q6SA 1B2TA 1Y1WH 1CHQD 1WIAA 5C4JH 5CORA 4US8A 4AH6A 3WOEA 1SE3A 4CDDC 3AV8A 4REZA 3I4MB 3VR8B 2RSNA 3KH0A 2RGFA 2YTXA 1WD1A 1DYQA 4KIKB 4M02A 4JOIC 2JJQA 5D65A 3C19A 4FHJA 1QUQA 1KRHA 2IYDB 3WOFA 5K36H 2HTHA 2F0TA 1GB1A 1VQGA 4C3JG 2F0JA 4EQ5A 3ONAB 2WAQB 1P0RA 2FCMA 3LGJA 4P2CB 1IBMQ 1DJRD 5IYBH 5C2TB 5J39A 2M2LA 3GTLH 3MTSA 3H7PA 2WXKA 2KCTA 1WI5A 3E0JA 4DR4L 4K7UA 1IL8A 4NW2A 1I4QA 4C3HB 4DHJD 2B3AA 2BF8B 4ZRQA 3HFZB 2ZTDA 4R9WA 3R8BA 4MN3A 3CHBD 2PZTA 5D14A 1QZGA 1PH2A 5EE1A 2WU5B 4DAMA 5H8YE 4DQOC 3PO2B 1TKEA 5H1SE 3ERSX 3W1YA 3RMKC 3N52A 1SE9A 4WQMA 1GUTA 3K7UC 2IX1A 2OQ0A 2LVPA 4FXCA 1LTID 3RZOB 3ETRA 4DR5Q 1V1PB 2LMCB 3KLRA 4GOCA 1YHBA 4ZKCB 3RULA 1X1MA 2DUDA 4GKKL 1ACCA 1F9PA 2CKHB 3PLUA 4OELB 3Q8FA 3D31A 2W3SA 4RF0A 3UDGA 1IBKQ 2B63G 2SNSA 5LLIA 3NZSA 2BYEA 4KSLC 5JHBA 3I91A 3BYTB 2AWOA 5G5HA 4B3TQ 2A6HC 4DNTB 2JP1A 4ZRIA 4Y52H 1XYIA 1C9OA 1PZID 4WJ4A 3EFCA 3OAWA 4N9PA 3M9BA 2YTYA 4P6VF 3SE0A 4K0KQ 3I7FA 1QVFA 2KHJA 2D3CA 2V1CC 3MHSD 5IYDH 4BY1H 3PO2G 3VQIA 3RNGC 1K83B 3NVYA 4O2DA 2JA7H 1TU2B 3K0XA 5IT9L 3CCVA 1PH3A 2LRWA 3IRBA 1KD1C 2DJFC 2C5CA 5TSSA 1XPRA 3O13A 2KJRA 3MHZA 1BBUA 4IC7B 2CQAA 4LF8L 3VDZA 5M3FB 3PZDA 1S3OA 2R7ZB 3MTNB 4UAIA 4QB4A 2WAQG 3K5MA 3NE5B 4J6HA 4BXXH 3M4PA 2F4VQ 3NZ3A 3RN9C 1PTOD 2RCFA 4NDXA 2KC2A 4OVVA 2FFKB 3HOXH 1C76A 1CZPA 1PDXA 3AECB 3RYTA 2LGYA 3RUZA 3LB8C 4WWMA 4OW0A 3U30A 4JI7L 3WAPA 2H89B 3VVWB 1V43A 2A6HD 2PNRC 4FVMA 2ZVOA 2NPTA 4X57B 5J22A 1RAXA 2ZJPA 4DK1A 2N9XA 2WXGA 4OX9L 1FXIA 1WWTA 4IM2A 4IUUA 1E3PA 2D2CC 4GMVA 4MEMA 2GB1A 3W1SC 4DHZB 2FNJB 1IGDA 1K28A 4A3DH 2PMVA 4HN7A 1HR0L 1CKMA 2JA7B 3NBIA 3HGBA 4DV6L 1YJ9A 3NUHB 3ONSA 4GNXA 3RPFC 1IZ6A 2QGQA 3AEFB 5IYCG 4IOIE 2KKCA 1IPGA 1WXQA 5E6NA 1LGRA 3KVFB 4OVUA 4QGUA 2Q2UA 2CVRA 1MSHA 2CQOA 2P5ZX 3V6CB 3ZYYX 4M0WA 2XN9C 4A76A 3CAMA 4IFDG 2QJLA 1R4PB 1SYDA 3AMZA 3EFUA 4PS8A 4DU9A 3M3YH 1II3A 1KL9A 2EQSA 1TWFH 2REXA 5IODA 3RNFC 1UAPA 1X3PA 3ZNID 3BZDB 4C7ZA 1A6XA 1BNZA 1VCBA 4M8MA 1OXTA 1PH1A 3APCA 2E76C 3PS6A 1FGBD 2KWUB 3D3RA 5LNK1 2N88A 5C44B 4I6NB 2YEPF 3L17A 2F03A 3MXPA 2BYFA 2PEAA 5M9OA 4G50A 5EE9A 4IUQA 1I94Q 5C4XB 1KH0A 3UI3A 4L8JA 2K32A 1LTRD 1PGXA 1RM6C 2MJDA 3PO2H 1EQVA 5D7GA 1S5CD 2I1JA 1OXVA 4C1NK 3ENEA 1XNQQ 3QX1A 3L7ZC 2DYOA 1IHZA 2F0OA 1VZ6A 3J7AV 3J7YW 2IDYA 2MP2B 3K80C 4X65Q 1KDAA 4OX9Q 1K8AC 1ZXHA 1JWMD 4POFA 2KVMA 4FXKC 3AB5A 2HE7A 2KDMA 5BO4B 2ID0A 2NS5A 1U9RA 1L0XB 2K6QA 3JW0X 3FILB 1XD3B 2UUCL 4JI2L 2JA8G 3G6JB 1I4GA 4FNFA 2RA4A 4IFDI 2YTVA 2VRRB 2F4IA 1N62A 2ZW1A 5ELNA 4WRDA 4MHEA 1QVGA 1R4NB 3GTQB 1K50A 1MPEA 3JYUA 3MVVA 2NVQH 4OWWB 4FF4A 1MI2A 2PVOD 3NZUA 4CGYB 3ULLA 3NUCA 3HOVB 1B9NA 3WCQA 1HXYD 3VR5A 3A54A 2VUMH 1FRRA 4YCWA 4B3MQ 4DGZA 1SYCA 4HJAA 1F77A 2N0SB 4JI5Q 2IGGA 3PV1A 4K6DA 2Z9HA 4CJ1B 2K04A 4P75A 3T16A 2MUYA 3PUYA 4LJOB 1LABA 4MGYE 1RHPA 3I4OA 4CHKA 1WCMG 1CMXB 1IBLL 1MHXA 3D0FA 2HDEA 1EY9A 4IM0A 3H6NA 2JA8B 2IBIB 3TJPA 3OMCA 2B2TA 2N9KA 4P74A 5AFWA 5HI1A 4HJGE 1L1OA 4WORA 2UU7A 2FINB 4YWKA 5BR8Q 4B3ML 4W9KA 2MBOA 3RNBC 1QWYA 2FAZA 3ND9A 2F0KA 1VQEA 1YJJA 2H4OA 2HDLA 3C8YA 4A3LG 3K9OB 1VCIA 3DWMA 3NVWA 3M85A 1DXMA 2QDBA 5AEKB 3W3AA 4BA1I 4JI6Q 4FP5D 4PMCA 4N8FA 3S14H 4HK2A 3KJPA 1F2RI 2I5HA 4Z9CB 4AIMA 2VZAA 5M5YH 1PRTF 4YCVA 5JPMC 1I4PA 1Q3LA 2JK8A 2WB1B 2F3WA 3I90A 3P20A 3HOZH 1UBQA 3LYYA 5JEAG 3KQ4A 1N8RC 3V2TA 1EUVB 3TRZA 4PYUA 2SEBD 3PO3B 1ENFA 4LF9L 2BA1A 4UDUC 5ELDA 1QZHA 4LF7L 2V4IB 4A3EB 5GADC 1I94L 1BQQT 3OOCA 2KECA 2BYVE 2XBBC 1J8IA 4KMUC 4DXAB 3WWVA 2WU2B 3B08A 5IA7A 5C1ZA 1YQ4B 2ATWA 2ZPYA 5IYDG 2ZXOA 1KIXA 5CHFA 2PQEA 1SNOA 5D3DA 1YBYA 1SNPA 2EKEC 4R4CA 5MPOA 3J7ZC 1QOHA 1H9SB 1MSGA 4HEA1 2OF1A 3TIXA 3SGIA 4GNXB 2MW5A 4B6WA 4RHSA 2KCMA 3GB1A 3H9DA 4PZ6A 3I5JC 2Q2IA 4BA2I 1G91A 1A3UA 3ZQ4A 4K8JA 4ZUIA 3ZRFA 4W9IA 1YJWA 1MG8A 2AX5A 1O78A 1JMCA 2WXJA 2ALYB 1O7ZA 3KK7A 2LRUA 2BS3B 1L0VB 2ON8A 3S2AA 1WTHA 3C0RB 3J80i 5LXIB 2KMMA 3ECIA 4CJ2C 3A7AB 1HR0Q 3BIID 4OO1H 3S2HB 2L12A 2WKDA 1CKNB 2I07B 1BUIC 2EYMA 4A3CH 2LD9A 2PE6B 4ME3A 4S17A 4AQ7A 2HCCA 4FF2A 1G2SA 4RH6A 4YY3Q 1PTOB 1UNSA 1GPXA 4WH4A 2CW0D 1WTOA 1NBWA 2IO0B 2AQ3B 2AEHA 4BXXG 2GMIC 5BN3A 4JYAQ 1XMOL 2KANA 3X3MA 2D5GA 1I6VC 1PGAA 1WGKA 2NN6H 4US9A 4DV7L 2KD0A 3TN2A 4CJ0B 2A5UA 1XPOA 2EXDA 4NXML 1TWAB 4XYOA 2KQ4X 3U7DA 2F0FA 4DR7Q 5T1GA 3VUXA 1V8CA 1FXAA 2ONQA 1V1OA 3MZ5A 3URYA 4F1SA 5K36G 4FBJB 1KNAA 1N36L 4HDQA 3J7AF 2HJ1A 2CW0C 2JA9A 1HQRD 4BY1G 3AM9A 3R66C 1EFWA 1TYGB 4OO1G 5EGTA 4OHJA 3LWEA 4BBRB 2R92G 3DVGY 3KDFB 5CV7A 1DOIA 3B9JA 3MJ5A 1ILQA 4HXDA 4TMAB 5C3JB 5GAHC 4HKQA 1SAPA 4I7ZC 3CD6A 4CQNA 4A3GB 4P7IA 1GUAB 1AEXA 1RWSA 3PVLA 3Q8EA 1TWHB 2XNAC 2LEKA 3C46A 5D94A 3KF6A 4B0MA 3UI2A 2K14A 1QQRA 1SN8A 4CKEA 2A6EC 4LFAL 3HS0C 2INCC 2JWUA 2B2TC 4AQYL 4KKIA 3ZDMC 5JAVA 4IUVA 1OTCA 3KLWA 1JOKA 1MHHE 2E8GA 1OEYA 2EKIA 2JE6I 3MC9A 4KKJA 1WX8A 5EBCA 4RNAA 5IT9c 3H7PB 4JCVE 5IAAC 5H92C 5BR8L 1EZ6A 4MH0E 1VZ8A 4I6PA 1Y1VG 3A8JE 4H44C 2JQRB 1HQMC 1ZXTA 4WJNA 5EKKA 4EQPA 4DR5L 2EYHA 4RMFA 3S1QH 4LFBQ 1JOQA 2DZMA 3GE8C 1IBLQ 2NVUI 2RR9A 2KVRA 4LF4L 1N63A 4OIKA 3E5SA 5CV6A 4LK1C 1CT1D 1YHAA 4F8CB 2EYOA 1HUNA 3HM3A 1IYFA 4BKSA 4RGOS 4NAMA 4A3BG 1B3QA 2NVYB 2JT4B 2LXAA 2F0QA 1JICA 1JORA 2KFJA 1VD2A 2B29A 4JVZA 2RPQA 3U58A 3VRBB 1ENCA 4KV2A 4HVBA 3ZJVA 2D2QA 3L16A 3X23A 4AWJA 1IKMA 1WOCA 4C80A 3GTJB 4L5TA 2EY6A 3PRPB 1IBML 3QB3A 4DAYB 1KRTA 3VTVA 1ML0D 2F52A 4YHHL 4MM3A 3I4MG 3BZKA 3CC4A 2MFIA 2WINB 5G5GA 5CR3A 3P7JA 1W2BA 4NXMQ 4POGA 1VMCA 5EQ0A 3DBSA 4DV7Q 2UUCQ 3DHQA 1TZOA 4FA6A 2EPBA 4DAYA 1WM3A 1EY5A 1U4RA 2VQFQ 5BYQA 1K3RA 2MGSA 4JYAL 4NZLB 2KWVB 3H0GG 1I4XA 1STHA 4HAEA 2IY5B 4W9CA 4IPHA 3QJZA 1RFKA 4K14A 2LI5A 3OIPA 3IAYA 2EY5A 4B95A 5KGUA 2PQAB 3ZO5B 5C0XJ 2Z0DB 1HTOA 5C3XA 3S1NH 5T8IA 4A3PA 2PMZB 4QUCA 1NYQA 3Q3NC 1DCZA 5E6PA 2UU9Q 2IY1B 2KZRA 3DHIC 2DNFA 3IHPC 1GNUA 3OWEB 2LASA 2YVCA 4BZAA 3D4RA 3QAQA 3V3XA 3N20C 2NBVB 3CU7A 5K5PA 2GN5A 1VQAA 4KSKC 3VTUA 1NYRA 3H91A 4R8IA 1F1HA 4EFOA 1HA6A 4M01A 5DAUA 5GXGB 3W1BA 3RNAC 4DBGA 4DV2L 1F2RC 1FPYA 3M4OB 4DV5L 3L54A 2KDIA 4A3FB 2JN4A 1ZW7A 1LTGD 3NJTA 2Z6KA 2CWAA 3IG3A 1N32L 1NUCA 1E2ZA 1LT4D 1LFDA 1C48A 1SSNA 3PQIA 5DPSA 2MEKA 1GJZA 1D2BA 3IT4B 1VQFA 3N30A 1H9MA 2DENB 2LJIA 3WAOA 2R93H 4R4OA 4LF7Q 5IP7G 5E6OA 4XXEA 4FJZA 4I65A 4JI0Q 3HM6X 4FF3A 2YEPB 1MD2D 2KN5A 3I70A 4GLXA 4GZYC 1C8CA 2WX0A 5BMHA 2K50A 2KCCA 1L0WA 1XX8A 1X55A 3G71A 5BN4A 2KVZA 3VUWA 4QMGA 1X9NA 2R92B 4NJCA 2LFNA 2BA0A 3PV0A 4IQZA 4EQNA 1SYBA 2ZTCA 2DBYA 4CDEC 1MG4A 1QKZA 2FCNA 2F0UA 2HIXA 1AZQA 1WGGA 3T51B 4JI6L 4KHPQ 1WSPA 4II2B 1N60A 1E8XA 3VH3B 1X3FA 2C7HA 3WIMA 4A93B 4ZDVA 1WRDB 4AUQC 1PZKD 2LSSA 1NNXA 2PW9A 2ZVNA 1ENAA 3HOUH 2IPKD 3ITPA 4QUFA 1QUQB 4IFDH 2UUBQ 1AE2A 3K7AH 4CKCA 5KYLA 4LUOA 1YX6B 1EL0A 2L05A 5G3LD 2KDBA 4G7OC 1K51A 4II3B 2OQKA 3V61A 2NBWB 2NTSA 2WNMA 1FJGQ 3K57A 3AB9A 4MM3B 4ANWA 4HSVA 2JA5G 1EIYB 4RCOA 3DWGC 3GP7A 3PUVA 1VDZA 3FC4A 4R8NA 4KY6A 2LUMA 2IO3B 3RI7C 2OCEA 2KHWB 1Y8NB 3J7A5 5M3FG 2LHDA 3L0WB 3RD2A 3GS2A 2V0GA 3RUIB 5E4WC 2YU9H 2R6GA 5M3MB 2Y0SE 5C4ZA 1KAAA 3RZFA 4JI5L 1B3AA 3Q8DA 3MXGA 1F2ZA 1SDFA 4NPSA 1ISNA 2BT6A 4G0NB 2J0MA 2R7FA 3KF8A 4HJ9A 2R2QA 4LDTD 3B2FA 1JJCB 3PIOA 1PYWD 2Y3AA 5I6YA 1LYLA 1STBA 2D0OA 3NHEB 4PK1A 4JI2Q 1EOVA 2B39A 4KHPL 1BKBA 4YSXB 1AZPA 4LLGM 5IP7H 3Q0AA 2QILA 1TY2A 3NVVA 1F9SA 3H15A 4PZ7A 3H7SA 1ESRA 1SB3C 4FJYA 4E6IA 2VH1A 3BK1A 1C4AA 4CYEA 4P73A 3CKIB 2L32A 2XK5B 2N4FA 5JHAA 5I6WA 1ZEQX 1W6JA 2MJ3A 1STEA 3T56B 4B3RL 1AWDA 4XWWA 1G6JA 2ZCBA 3HOXG 4RFBA 2MNAA 4JI0L 3P42A 4WJPA 1EQQA 1V5TA 3A0JA 2JVCA 4J1MA 2J42A 2ZNVB 3ZJTA 1CA6A 4ITKA 3VFKA 1AYFA 2K5VA 1WMHA 3BVGA 4GKJL 1LUZA 2BWES 1N32Q 2DZJA 2NCNA 3RZDB 1F52A 1UE7A 2B63H 5C5MA 3J81L 3IAM1 4DV5Q 1DOKA 1FR3A 1DOLA 3TEZA 3GV3A 4L2YA 3AU7A 5C0XH 1G6ZA 4LNKA 1ZKOA 2Q8IB 2K28A 2D3AA 2GLSA 5AZFA 3ZGZA 1KFYB 4EOYA 3CPFA 1RYJA 3A5ZB 4KGTA 3VR3A 2N78A 4JWUC 1T0QC 3G4SA 5E4XA 2JWZA 2QSDA 1OXUA 4KV6A 3VR9B 3N1YC 4EKUA 3GD7A 4KD4A 3S17H 1LTLA 2QW7A 3FAHA 1R7SA 1ASZA 1PLFA 5IGBA 1BVSA 3B1LX 1WJUA 2HCIA 2L11A 1WXSA 4PYZA 3ZJYC 1BCPB 1WY8A 1Q1EA 2LGSA 2K5DA 3S2DH 1VJKA 1FD6A 1WFQA 3AE8B 1EYDA 2EYLA 3DWPA 2N55A 1L4DB 5CTRC 2IHFA 3KWVA 3NG0A 2PPBC 1A3VA 1C3TA 1JRPA 2V3NA 2K75A 1FFVA 2Q8RE 1OTRB 3QIAA 1Q7YC 4YWLA 4OO1I 3C2PA 5ELEA 4ZCKA 5IOIA 4BS9A 4A20A 2VQEL 5IYBG 2ZZPB 3NP8A 4HPMB 4EZKA 5C3EH 3TP5A 4K2KA 1EIFA 3KLSX 2LHEA 1F2LA 3TDQA 3V62A 1KDBA 2BQQA 1RF2D 1HZ5A 3OWFA 1M90C 5EPLA 2XWBB 1SNMA 4CDCC 1Q81C 4KJNA 3CMEA 5C4XH 4LFBL 2PNHA 1EEFD 2LUEA 4JX1C 2RQXA 4WQOB 4RCNA 3E9SA 1CQFA 1P1AA 3JSVB 2A69C 3TZDA 2BS4B 3B2GA 3JAMc 3K59A 3GTOH 3NBHA 3L0OA 1Q8KA 2UUAL 3J80L 5C3EB 5CMDA 2RCNA 4DR1L 1TWFB 4TQUS 2EELA 3E56A 3Q3OC 2LXJA 2PJHA 1D3ZA 4OGQC 3UDFA 4BBSG 2F0LA 4UP9A 4GKKQ 5DNFA 1T5EA 1J8CA 2D9UA 3HKZG 4MJSB 3NRZA 4RF1A 1MFWA 1QOFA 1NMFA 1PFBA 2B8FA 2KT7A 1OQQA 1E7ZA 4KKUA 4IDIA 1HPCA 3PSIA 1ILPA 1DOMA 2MP1A 5DEHA 5C3WA 2L7RA 2IW3A 3IXSA 2M0XA 3CSTA 4IW0A 4LFCQ 3HOWG 1UEBA 2L8JA 1LACA 3MFYA 4A3DB 1EF1A 3A4RA 3PTFC 3HRDD 2VQEQ 1HZAA 5DPWA 1KC8C 3HOYG 2PZUA 4DR4Q 3PHWB 2VL6A 1PA6A 1N36Q 3AEEB 5DCNA 4KN4C 4DPGA 3K8AA 3APFA 3NQTA 1XLOA 2CKZB 3NK9A 2VUMG 2C7NB 3QR8A 1T3QA 2L4NA 1GVPA 1V9PA 4ZLTF 1E7UA 3AE3B 4YL8A 5GAEC 1WGDA 3FVQA 5E1FA 5HGTA 1XMOQ 1HNWQ 2V3PA 4G11A 3UIPB 4NB3A 4WJ3M 3VR6A 2BGFA 2JYTA 2BYTA 1HEZE 1QB5D 1WTRA 4A3BB 4BOSC 2NB0A 5M3FH 1JCKB 4LWCA 1TR5A 1A62A 4ZRKA 5HY6A 1T0RC 2N1VA 1HTLD 3LNNA 5AJ3L 3BJUA 3D8GA 4MACA 5AUIA 4HWIB 1CKNA 2JZ3B 2ES2A 1K83H 2KN4A 3DVNU 5FR6A 2LKVA 3I55A 1A3TA 3D6WA 4UP7A 4G4KA 1ET6A 3ULJA 5CC4A 1STYA 2ICEC 3K5NA 1VQLA 3VR4A 5EAYA 3A1QB 1GUGA 4C3IH 1G6PA 3Q23A 4GN4B 4TUUA 5CV4A 1KF6B 1PFSA 4R1JA 1VZ7A 3NS1A 1V49A 3A74A 4IJHA 2LXKA 1FD7D 2GBNA 4W9JA 2L15A 3HOZG 4LCDE 2PVGC 5GMVA 3VAWA 1BDOA 3GOEA 4JI8L 4A6QA 2E2IH 2MO0A 2WKCA 5LMNL 3RD4A 3FKIB 2F0IA 1TS2A 4LF9Q 3FDTA 4FXDA 4HKZE 2ASQA 2XGTA 4B3RQ 3AE2B 1G2TA 1QILA 1QF6A 4O0AA 2KNBA 3HOUG 4GN1A 4ANXA 4FDBA 2A6ED 3UDIA 1VDVA 1QE6A 3ABVB 3BY4B 4KVGB 1C9FA 5EPKA 1MJEA 3PHXB 3B0AA 4TKNA 1E1TA 1H9RA 3CRKC 2JXMB 1KHIA 4XIGS 1A2TA 3MWYW 4KTAA 2KTFA 2F0SA 4C2MH 2LVOA 2F3VA 5FLXE 5BMGA 3BG3A 1OO9B 2SOBA 5ISRA 3I3TB 3LXFA 4DDGD 3K0YA 1G291 3TP6A 4Q5VA 1TKYA 1SF0A 4OZAA 2A19A 1SRUA 5FKAC 4MT5A 3H3VH 1IYJB 3E9IA 3CCJA 2RF4A 2PCFB 5IGFA 3ULPA 5HHDG 2E5LQ 2B63B 3RT3B 3BYYB 3PUWA 3SFEB 2KC1A 1JRUA 1EY4A 3K7AB 4JG2A 4KIKA 2WB1E 1HZ9A 3HUIA 2B2WA 2J7QB 2JSOA 2PLPA 4K3CA 5C4JB 4IURA 1SE4A 1Y1WB 3K5OA 3MC8A 3DEOA 1NVID 4W9HA 3N1XC 2Y0SG 2D3BA 2JA7G 2CJNA 5IWAQ 4MZ9A 2MO1A 1C4CA 5DLQE 4AS1A 4LNFA 3OLMD 4PMBA 4A3CG 2EMSA 1UF0A 3Q8BA 5JOBA 1OGWA 4A3IG 3IAS1 2NVTB 1XTDA 3ZIMA 2F0PA 4KDIC 2EY2A 3CSFA 3H0GH 3VHTC 1HRJA 3W2DA 4DFAA 3N9YC 1PFDA 4P71A 4XQQA 3U4ZA 1V97A 2KTRB 2HD5B 3E0EA 1HZ6A 1PMRA 5FLMG 2EYFA 1P7FA 1Q1OA 4FADA 4WJQA 2WDQB 3SHQA 2L0FA 1P16A 2KEDA 1LLRD 5CV9A 4M00A 4ZQ3A 3HHMA 3ZXVA 4LW1A 2WB1G 3R3OA 4XQJA 2F0EA 1NR2A 2BB6A 4GIVA 4LNOA 3I4NG 3KOJA 3QHTA 4C3IB 2XRQD 3VYUA 1C77A 2A4ZA 4LF6Q 3VA7A 4A4IA 4DNIA 3VYRA 1XNQL 3HOZB 3I72A 1UE1A 5M5YB 1EO6A 1E7VA 3ML8A 2QF7A 4C7YA 4K6LA 1FM0D 1SIFA 3A9JA 3O65B 5FLMH 2JA6B 2Z4HA 4XZ4A 3RLNA 3BZCA 1GC7A 1E0ZA 4JV5L 3DUZA 2Y5PA 2OHFA 1EIGA 1BBWA 4YWMA 5KIXA 4IG7B 4XX5A 3MJWA 2L76A 1EU3A 2W54A 5LMNW 3LWUA 2KFKB 5IGGA 2QHOA 2I46A 2W9NA 2MLBA 1EFID 3T1YL 4ILWA 4ZRZA 4QJFA 1CZGA 4AYBE 2K9XA 4A93G 2L0TA 3W5UB 4A3BH 3Q8AA 2QIEB 3GZNB 1JQYD 1EU4A 1YNND 3GTPH 2Y5CA 2BH8A 5GQOA 1B7YB 1VF7A 4A93H 1QOBA 1WE6A 3APDA 3ZLZA 1XJVA 1SNDA 3D32A 4C2MB 4GDLB 1HTPA 2AQ1B 1VQ8A 1L7YA 3OJ4B 2CH4A 2EE1A 1I42A 1OXXK 4J15A 1G51A 1GUWA 2LGIA 1T6BX 3Q69A 4DR6Q 4EGVA 1L2FA 2M9VA 3U4EG 3S1MB 5G3LF 1N9WA 3T13A 3DBHI 4JI4Q 1KLVA 4DV1Q 2L3ZA 5CHVC 3FILA 1WJJA 1EWYC 1EY8A 4N9F4 4YSYB 4BKGA 3CRLC 1RODA 2NUCA 2XSCA 1AP0A 2DY8A 2MSED 2QDFA 1TY0A 2NBFA 2NVYH 2NZHA 2AHOB 1HR0W 2R93B 1YNJC 2A5HA 1U4PA 5EKIA 1SGHA 3I2ZA 3GTQH 3D4WA 1YJ1A 2V4LA 3GTKB 1L2NA 2H5XA 2PQAA 3ZXRA 1UUPA 4DXFA 2ZJRA 2RDHA 1WZ3A 4ZRJA 4YTPB 1TS4A 2F0GA 1XXGA 2K5HA 4AYBG 1GC6A 4WAAA 1R4NI 4YHHQ 3UE1A 4A3FH 3DMUA 2LJ5A 2DYBA 5TR5A 4JBJA 1JQ4A 1JWAD 4LF8Q 3IFWB 1TTNA 3DPDA 3Q2AC 2HT1A 1HH2P 2L9HA 5IP9G 3GTOB 2WP8J 1IUEA 1WFYA 4GXBA 4K8IA 3HK0A 4HCPB 3CCQA 1HZCA 5E6JA 2KDEB 2EYJA 1PDQA 1KJTA 2W3RA 3H8HA 4EVOA 1H95A 1VS0A 1O7YA 5HKHA 1WX7A 3PIO3 3BDCA 4BY7G 1M8AA 3AE9B 4BKTA 1CK1A 1XNRQ 5C44H 2LWPA 4MIUA 1WTVA 1EIHA 4OVZA 2BWFA 1F2MA 1ZOYB 1D5ZC 3DWQA 4RA8A 4XC2A 1XMQL 1HE8A 1AN8A 4LFCL 1PYBA 3DQVA 5J18A 5GAGC 4KD3A 4G7HC 2GBKA 1QZEA 4NJ6A 3UGBB 4P1CC 1EEID 3AFQA 4DV4Q 1J5EQ 4KZCA 3PMFA 4JIOU 4AQYQ 1CA5A 1NAPA 1ZP0B 1WYWB 4CO7A 1CZWA 4ULLA 3EC8A 2A68D 4DV4L 4JGHB 2IJ0A 3GTGH 4GN5A 2Q2TA 2K6AA 3D6CA 4ZHPA 2Z0SA 4U673 2IL8A 3NTIA 2KJXA 2KFKA 2N7DA 1BCPF 2K0PA 1EWHA 2LVQA 5CHWA 1TWCB 2OT2A 3M7GA 2UXDL 4MDKE 1RLFA 1XNRL 4JBKA 2KOXA 4HJ7A 4HMJA 5ELFA 1PH9A 5IIFA 2MX2A 5EBDA 3S17B 5KNBA 2G1EA 5I2YA 3UIOB 2WXHA 5FJ8G 5JXVA 1N6ZA 3CCEA 2Z4IA 3ICEA 1DD2A 1FMAD 1E2WA 1EOTA 3DOWA 4DUYQ 5KEEA 2CWPA 4ID6A 3R7QA 4X3TA 1K8RB 4B9XA 2RD0A 3HKSA 3FPUB 1V1QA 3PO0A 5CX3A 4BY7H 2MHJA 2KAJA 2ZM6Q 1JJGA 4DDID 2JEBI 3N3KB 2CHXA 3P63A 3C1FA 5EPJA 3D4DA 3JAME 5FO8B 3ZKJC 1S40A 2AL3A 1XPUA 1S5ED 1N33L 2J0KA 1M94A 1YQBA 2WYQA 3ZNHB 2L0CA 2V3SA 1WJNA 5KYIA 5IOCA 1QCBD 4A3EH 3J80c 1VQ5A 1NDDA 2CJOA 5BYRA 2VB3X 2BCOA 2NVTH 1GUSA 1TT2A 3PO3H 1IYVA 2K3UA 4LNQA 4X66Q 4ZHOA 4ANUA 3KLSA 1HNZL 4KJOA 2AWTA 4A3GG 1YNTE 2WWZA 3ZW3A 3E3XA 1GO3E 1YJNA 4QY7A 1YHQA 3BK2A 3TUOA 3ZVVA 2KENA 1YMHE 2PTLA 2J0JA 2B2YC 3RNEC 5HFYA 1C4PA 4CKBA 2B8GA 3GO5A 5ELBA 2OJWA 1X3QA 4IM3A 1TBEA 1HCZA 2MBBB 3UINB 1VRAB 4V190 1OXSC 5EE3A 4URKA 4PMWA 1HA5A 3FKYA 4A3KH 2QMTA 4X62L 2K5WA 2FHTA 3MFGA 4NAWB 4GS3A 2B2UA 1LTBD
chains in the Genus database with same CATH topology
2RDGA 3NVZA 1BCPD 2L55A 3PZ7A 5E3FA 3DXJC 5A2QL 4A3MB 3GTLB 3QJYA 1TVXA 5EJWA 1PFMA 2JEAI 4EE2A 3NWTA 4N9TA 3P4QB 3DM1A 5C5LA 1WD0A 2BE5D 4NKLA 3C1EA 2B76B 1V1PA 2LMCA 4CBVA 1WTWA 3QG1A 1MVKA 2EXZA 3HVDA 4A3KB 2B2YA 3IKJA 2J4XA 1RCVD 2E2IB 2K1BA 1FCCC 2Q5WD 3X3NA 4TQ0A 4HRSA 2PO4A 5FOBB 4QF4A 3I73A 1NEKB 4C56C 4F87A 4RGMA 3PIP3 2INNE 1NSNS 5JPNC 1YNJD 1BF4A 2L5TA 1PTOC 1SYFA 4L63B 4X3SA 5I4DA 2XWJB 3U9SA 5FO9B 2JYEA 4IKGA 5BN5A 1QNKA 3K5LA 3I4LA 4IZ8A 2FE8A 1FNUA 2K22A 1CHPD 1WTPA 1YN5A 3EVQA 4G57A 3L4PA 4BY7B 3EROA 3QO2A 3OMGA 4KKTA 2EVBA 2BDOA 2YU9B 4F8MA 1JOOA 4XWTA 1I4RA 2IGDA 3M7NA 1SSOA 1S5FD 3OPOA 2IX0A 3NPPA 2GI9A 2M0AA 2NWGA 1K53A 4J3OD 4HEDA 3RLFA 1ZXIA 2A73B 3L9AX 2WXLA 1X32A 1GAQB 2KCNA 1KLUD 1DGJA 4HTHA 1VR9A 5FR3A 1NCVA 2NVQB 3NWSA 5C0XG 4FYDA 3GTGB 3TSSA 3P1MA 3U2SC 5IGDA 1ZPSA 1STNA 1I7HA 1GXDC 4DNRB 1ROEA 1B53A 3SXHA 3A8IE 1RD9D 1BR9A 3FMCA 3BWUD 2XRSD 1Q10A 1S4ZA 1TWGB 4RAUC 2AUKA 2SNMA 4HCSA 3NTKA 2OEDA 1SNQA 1TKGA 3SDZA 4QIWB 4B0EA 4GLSC 1LTSD 2LFIA 4C3IG 4DK0A 5JEAH 1RKNA 3U52E 2BTEA 3M3YB 3AE6B 1CFMA 3SHLA 1XO3A 2E2DC 1D4BA 5D3IB 2VB2X 4N6EB 1CM9A 3TEYA 1TJEA 4KGRA 2QCPX 2EZVA 2F0DA 1ONLA 2E3TA 1JC7A 4DN4M 3S2DB 3A7LA 1PTOF 3TZUA 2KA7A 1Z6HA 5A35A 2R3ZA 1JWUD 3MXNA 4YTNB 1CQVA 4Q2JA 1XEEA 4WURA 3BVMA 4L6TB 3JAML 4WIPA 3EA6A 3BDOA 1F9RA 4F7XA 1RTOA 1BCPC 2W82A 3KBGA 4DAVA 4IUTA 3QWNA 4R3DA 3W9CB 2O5IC 2J52A 2J7ZA 4FF1A 4IUNA 1C78A 1AFPA 2KWDA 3AMUA 2EYPA 2RVLA 2WS3B 1SMYC 3K6OA 3MEHA 3QOJA 2INPE 1PTOH 4KX6B 2BW2A 2J0TD 4XT1B 1EQTA 4BY1B 3EGRA 2Z8LA 2PW5A 4BWGB 1F0ZA 4K2LA 4M1UB 4NMZA 1Q1BA 3Q22A 3S1QB 1GB4A 3R2IA 2W55A 1IBXB 3AE4B 2AUJD 2X6GA 3I4NB 2A68C 1I50B 3M4YA 2F0HA 2E6XA 2WV6D 2G9DA 2M00A 3NTHA 2QKIC 1UEAB 1QJOA 1W6KA 2IGHA 1WTQA 1SJHD 3H94A 4RHRA 2X38A 3HRZC 2VZKD 2TSSA 4F88A 3KWLA 4V0BA 4H7BA 4X3UA 4XDDA 3NHHA 1XLQA 5EE0A 2Z1CA 3GQBA 1FNWA 4ARIA 1Y8OB 1WRIA 1G8ZD 1M4VA 1LO5D 4U68A 4ZK9B 5JJZA 1F9QA 1JMLA 2L1BA 4H13C 4DF7A 1MGSA 3P4PB 3SK6A 3HKZB 4XT3B 1S5DD 2KQ3A 2PIAA 1QOGA 2DLBA 4H0LC 5DM73 1Y8PB 3HOUB 1TQOA 1I4HA 1JW9D 2B2VA 2PKOA 1KABA 4S3SA 1E2VA 3A56A 3IFTA 1L5PA 4NP5A 1FYCA 3MXUA 1TIID 3T4AC 5HG2A 3PUZA 2WXFA 4TSSA 4C3HG 1YQ3B 1U4MA 3FEWX 4KHVA 4ODGA 4AYBB 5LL6X 2K5QA 3SR1A 2VUMB 4CHTB 5NUCA 3BDLA 2RSOA 1D5XC 1LT3D 2WACA 1HHVA 3N6RA 2MJ8A 4ME5A 1NI3A 4YWGG 1SJED 3P75A 1KDCA 1S5BD 2K7VA 4N59A 1ZDXA 1XWEA 4BBSB 4YXDB 3AEDB 5ELCA 3S14B 1LTTD 2OEOA 2A69D 2AWNA 3BVZA 2FMMA 3R93A 1YN3A 5CV5A 1XTCD 1ZYRD 3S1NB 2MHVA 2GRIA 3OW7A 2E74C 3HG9A 2XVSA 2RBMA 3SFDB 5HURA 4XYQA 1ICWA 3W1SA 3HZXA 5C4HA 2FJ2A 2VNUD 4DXGA 1L6VA 2R61A 4HCEA 3GV6A 2IWHA 3S1RB 3R2TA 3ZJUA 4KY7A 1YNNC 3W5VB 2K01A 4YSZB 4O42A 1R4QB 2EJMA 4OZCA 3SK5A 3MHBA 1L6UA 3A55A 2K5PA 5C0XI 2FBWB 2AQ2B 1J7CA 4LJZC 3I57A 1T5XD 2Y0SB 2KHSA 4IFDJ 1SMYD 2WXRA 1H9KA 1ZDVA 1EY7A 4HROA 1QLBB 2WQYB 3AN1A 3LX0A 2JSVX 5KNCA 1GHKA 1DZ1A 1MI0A 1WYGA 1B50A 4PT5A 1PZJD 1SE2A 4ZYSA 4K5XA 5J1ZA 3J9CA 2M56B 3T3NA 4EQOA 1CJEA 1WVLA 4L23A 1PGBA 4ZOHC 3OHXC 3U7ZA 1VF5C 1VMPA 1XF5L 2YYZA 3P1HA 3F2UA 5IGEA 1E7PB 2NZ1D 1SBBB 3L3OC 2WP9B 1I3QB 1LT5D 1QNUA 2KOLA 3DEPA 3RFZB 4RKBA 1O7LA 1PRTD 4RWSC 2Q8TA 2EJFC 2NN6I 2DNCA 1DM0B 1QOAA 2EY1A 1YN4A 1BMLC 1UGJA 1KLGD 4A55A 1A70A 3T3OA 3ND8A 4USAA 1UWMA 2B2VC 3Q8CA 4OIJA 2CHBD 3MA2B 1JB3A 4KY5A 3DWAA 3OIQA 2BOSA 3NSWA 1BXTA 2TMPA 2X69A 4KKSA 3VR2A 3P4RB 4M8AA 1EZ8A 1N5XA 1AW7A 1ZUD2 1CI3M 3U9OA 1B4OA 2ZXRA 2O2LD 3FPPA 3AH7A 2E2JB 2H88B 2G9HD 3AE7B 1FO4A 1WTXA 3VYSA 4C1NI 2I2YA 2EJGC 1E6EB 1Q12A 4IALA 1CTMA 1PUTA 2WXIA 4P16A 3TEXA 5FK9C 5M5WB 2WLBA 2K33A 5FO7B 4K5VA 1EYAA 1J7BA 1LTAD 1EM7A 1GOZA 3VRAB 1E10A 1FIQA 4WAFA 4PQXA 2ENBA 2SAKA 3KUPA 1KNEA 1YJIA 3H09A 1Z47A 5BMIA 1JALA 1F2YA 2WDRB 2FMCA 3J81E 1ET9A 2IX3A 2C9OA 2NYZD 3MP9A 1KTKA 3H3VC 4A8XC 3EFXD 3AEBB 1NENB 3TBIB 3CIRB 3QOLA 4OL7A 2RDFA 3I3CA 2F0VA 2M19A 3J80E 2ICIA 2ACZB 2JX5A 1H9JA 2F0NA 2PZWA 5KNDA 2X6LA 1H9SA 1DOYA 1GHJA 2H1EA 3E6ZX 3AE5B 2N9LA 2BE5C 1L0YB 3KBXA 1B44D 5CGKA 2MJEA 2B2WC 4HR7B 3NQIA 3EQLC 2OXPA 1OQRA 2XIWA 5IGCA 1SFOB 1FEHA 5A2QE 2EDGA 2HQEA 3NXWA 1XCTL 1D1KA 1P7EA 3WDNA 4OZBA 1HUMA 3HEJA 3IFDA 1IGCA 5F2DA 4MH8A 3EJIA 4Y7NB 2SDFA 2RPVA 4A90A 4HMIA 1QG7A 1EWCA 2LY7A 1HFNA 5AUKA 1I6HB 1K8OA 4ABNA 4X3KA 4LMQD 5I9PA 1Q8IA 2F0MA 2L1AA 2GA4B 1EYCA 1XCQL 3HOYB 4XDCA 1A15A 3I8ZA 2DWQA 4JPSA 1FCLA 4N58A 3ERQA 4XDXA 4ARCA 2WDVB 1ZYRC 1QT9A 3CWIA 1IKLA 2BDNA 2NTTA 4RKLA 1O80A 4B08A 3FRPB 3HOWB 1EY6A 1Y56A 1STAA 2RMMA 1Y1VB 4A9AA 1PRTB 2ZT9C 2F0WA 1JROA 1GUOA 2J53A 3S15B 2VXWA 1BUVT 1TS5A 2HUGA 1J9OA 4YIJA 4LK0M 1D6EC 1SIJA 5CYUA 2L52A 4KGSA 1R9TB 1BBXC 4IUPA 4KN7C 5JVG3 2FUG1 3H6MA 1SYGA 1BO0A 3HP3A 4PV1C 2NVXB 3TEWA 2NN6G 2RKSA 3HOXB 5BYSA 5CBEE 4LTUA 3RMHA 2IT1A 4TRDA 4L1BA 2JA5B 3SK4A 2N7JA 1SYEA 2WXMA 4B9WA 3AE1B 2WXQA 2DY7A 1TKWB 2JZPA 4D2KA 4HSPA 2BBCA 1Y69U 1C4QA 1GUNA 2JYOA 4A3IB 4XQNA 2HTME 3TMEA 4G7ZC 1E0BA 2A74C 3IT6B 3BS1A 1RTNA 3G7LA 4O1NA 3VA5A 1JR0D 4QCLA 1JE4A 2K05A 4FO2A 1XLNA 1ZE3D 3AEAB 2MPMA 4ZKBB 2KUMA 5I2XA 1D5MC 1IBXA 2KACA 2DN8A 5EKLA 1K52A 3SVMA 4KK7A 4C3JB 3AEGB 5IT9E 2O5JC 2WXOA 2EOTA 4WJWA 1UWXA 4RGNA 1HFGA 3SK8A 2E75C 3GTMB 1SEBD 1C79A 1N5WA 1PXUA 1Q90A 1GJXA 2WIIB 5JVH3 2V4DA 1SNCA 3C3LA 4PNYA 1LT6D 4LAAA 5JEAJ 4XTCS 1JWBD 2O4XA 2E2HB 2WXNA 2PYKA 1L4ZB 1IYUA 3MAQA 1J7AA 3HVZA 1B9RA 1WCMB 2JXTA 3S16B 4JBWA 5COYA 2ZW0A 3PUXA 1OFFA 3SEBA 4KHZA 1IW7C 1K8MA 3I9V1 2KEEA 2VZKB 4JWSC 5C6AA 4A3JB 3TP7A 3Q24A 2PW7A 2WXPA 1SXTA 3VYTA 3MC0B 4WFN3 5M5XB 2K03A 1V8QA 3V96A 2DYMA 1IW7D 3P4SB 5LL6S 1STGA 5LHY1 3T53B 1DOXA 4TKOB 3SR6A 2ZXPA 1A2UA 2L83A 2DNEA 3GTPB 2D62A 1FRDA 3IL8A 1VLBA 1TS3A 1DONA 4ZRPA 3CQZB 1PFNA 3PZ8A 1B1ZA 2JU6X 2CU3A 1Z7TA 4K5WA 1JWSD 1BOSA 1N61A 2QEJC 4KI0A 3V05A 2BS2B 4ZAIA 4H2AA 4ZUJA 2NMQA 4RGTA 2B2UC 5DM63 5CBAE 3A8KE 2HDMA 4DAPA 4JE3B 1PRTC 5T1IA 1RJTA 4JK1C 4DA2A 5I9OA 4Q0FA 4XE0A 3K58A 2LS01 5CV8A 2MH7A 1XLPA 3H0GB 1FFUA 3OSOA 4YTMB 1ESFA 1B9MA 4YT0B 2I38A 1E9MA 3TP8A 1D1IA 3EUB2 1NR4A 2D5DA 4GDKB 1U4LA 1MBYA 1LV9A 1RDPD 4IN3A 5FLXL 1EY0A 1FNVA 4J8QA 4FXGC 2F1MA 4TQ1A 3S9WA 3Q6SA 1B2TA 1CHQD 5CORA 4US8A 3WOEA 1SE3A 3AV8A 4REZA 3VR8B 3I4MB 2RSNA 1WD1A 1DYQA 5D65A 1KRHA 3WOFA 5K36H 2F0TA 1GB1A 4C3JG 2F0JA 3ONAB 2WAQB 4P2CB 1DJRD 5C2TB 5J39A 2M2LA 3MTSA 2WXKA 3E0JA 1IL8A 4NW2A 1I4QA 4C3HB 4ZRQA 4R9WA 3R8BA 4MN3A 3CHBD 2PZTA 5D14A 5EE1A 2WU5B 5H8YE 4DQOC 3PO2B 1TKEA 3N52A 4WQMA 1GUTA 2IX1A 4FXCA 1LTID 3RZOB 3ETRA 1V1PB 2LMCB 3KLRA 4ZKCB 1ACCA 1F9PA 3Q8FA 4RF0A 3D31A 2W3SA 2SNSA 3I91A 3BYTB 2AWOA 5G5HA 2A6HC 4DNTB 2JP1A 1XYIA 1PZID 4N9PA 4P6VF 3SE0A 3VQIA 1K83B 3NVYA 1TU2B 5IT9L 2C5CA 5TSSA 3O13A 3MHZA 2CQAA 5M3FB 2R7ZB 4UAIA 4QB4A 3K5MA 3NE5B 4J6HA 3NZ3A 1PTOD 4NDXA 2FFKB 1CZPA 1C76A 1PDXA 3AECB 3RUZA 3LB8C 4WWMA 4OW0A 2H89B 1V43A 2A6HD 2PNRC 4FVMA 5J22A 4DK1A 2WXGA 1FXIA 1WWTA 4IUUA 2D2CC 2GB1A 1IGDA 2PMVA 4HN7A 3NUHB 2JA7B 3NBIA 3HGBA 3RPFC 3AEFB 4IOIE 1WXQA 2CVRA 1MSHA 3ZYYX 4M0WA 2XN9C 4IFDG 2QJLA 3AMZA 1R4PB 1SYDA 4DU9A 1II3A 4C7ZA 5IODA 1UAPA 1X3PA 3BZDB 1A6XA 1BNZA 1OXTA 2E76C 1FGBD 3D3RA 5LNK1 2N88A 5C44B 2YEPF 2F03A 3MXPA 5EE9A 5M9OA 4IUQA 5C4XB 1KH0A 3UI3A 4L8JA 2K32A 1LTRD 1PGXA 1RM6C 2MJDA 1EQVA 5D7GA 1S5CD 1OXVA 4C1NK 3L7ZC 2DYOA 1IHZA 2F0OA 1VZ6A 3J7AV 3J7YW 2IDYA 1KDAA 1ZXHA 1JWMD 2KVMA 4FXKC 3AB5A 2KDMA 2ID0A 1U9RA 1L0XB 3FILB 3G6JB 1I4GA 4FNFA 2RA4A 4IFDI 2F4IA 1N62A 2ZW1A 4WRDA 4MHEA 3GTQB 1K50A 1MPEA 3MVVA 4FF4A 2PVOD 1MI2A 3WCQA 4CGYB 3NUCA 3HOVB 1B9NA 1HXYD 3VR5A 3A54A 1FRRA 4DGZA 1SYCA 2N0SB 1F77A 2IGGA 4K6DA 4CJ1B 2K04A 3T16A 2MUYA 3PUYA 1LABA 1RHPA 2HDEA 1MHXA 1EY9A 2JA8B 3OMCA 2B2TA 2N9KA 5AFWA 5HI1A 4HJGE 4WORA 2FINB 1QWYA 3ND9A 2F0KA 1YJJA 2H4OA 2HDLA 3C8YA 1VCIA 3DWMA 3NVWA 3M85A 1DXMA 2QDBA 3W3AA 4BA1I 4FP5D 4PMCA 1F2RI 4Z9CB 1PRTF 5JPMC 1I4PA 1Q3LA 3LYYA 2WB1B 2F3WA 3I90A 3P20A 5JEAG 3KQ4A 3V2TA 2SEBD 3PO3B 1ENFA 2BA1A 4UDUC 5ELDA 2V4IB 4A3EB 1BQQT 3OOCA 2KECA 1J8IA 4KMUC 2WU2B 1YQ4B 2ZXOA 2PQEA 1SNOA 5D3DA 1SNPA 5MPOA 1QOHA 1H9SB 1MSGA 4HEA1 2OF1A 4RHSA 3GB1A 4BA2I 1G91A 1A3UA 3ZQ4A 4K8JA 4ZUIA 2AX5A 1O78A 2WXJA 1O7ZA 3KK7A 2BS3B 1L0VB 2KMMA 4CJ2C 3A7AB 3BIID 4OO1H 3S2HB 2L12A 2WKDA 2I07B 1BUIC 2EYMA 4AQ7A 2HCCA 4FF2A 1G2SA 4RH6A 1GPXA 1PTOB 1UNSA 4WH4A 2CW0D 1WTOA 2AQ3B 5BN3A 3X3MA 2D5GA 1I6VC 1PGAA 1WGKA 2NN6H 4US9A 3TN2A 4CJ0B 1TWAB 4XYOA 2KQ4X 2F0FA 5T1GA 1V8CA 1FXAA 2ONQA 1V1OA 3MZ5A 3URYA 5K36G 1KNAA 3J7AF 2CW0C 1HQRD 3AM9A 1TYGB 4OO1G 5EGTA 4OHJA 3LWEA 4BBRB 3MJ5A 5CV7A 1DOIA 5C3JB 3B9JA 4TMAB 1ILQA 4HKQA 1SAPA 4I7ZC 4CQNA 4A3GB 1AEXA 1RWSA 3Q8EA 1TWHB 2XNAC 2LEKA 3C46A 4B0MA 3UI2A 1QQRA 4CKEA 2A6EC 3HS0C 2JWUA 2B2TC 4KKIA 5JAVA 4IUVA 1MHHE 1JOKA 2EKIA 2JE6I 4KKJA 4RNAA 5EBCA 5H92C 1EZ6A 1VZ8A 3A8JE 4H44C 2JQRB 1HQMC 1ZXTA 5EKKA 4EQPA 2EYHA 1JOQA 1N63A 4OIKA 3E5SA 5CV6A 4LK1C 1CT1D 2EYOA 1HUNA 4RGOS 4NAMA 2NVYB 2F0QA 1JICA 1JORA 3VRBB 1ENCA 3ZJVA 1IKMA 4C80A 3GTJB 2EY6A 3QB3A 1ML0D 2WINB 5G5GA 5CR3A 3P7JA 1VMCA 5EQ0A 1TZOA 3DHQA 2EPBA 4DAYA 1EY5A 1U4RA 5BYQA 2MGSA 4NZLB 1I4XA 1STHA 4HAEA 1RFKA 4K14A 3OIPA 3IAYA 2EY5A 5KGUA 5C0XJ 5C3XA 5T8IA 2PMZB 4QUCA 1NYQA 1DCZA 3OWEB 3D4RA 3V3XA 3CU7A 5K5PA 1NYRA 3H91A 4R8IA 1HA6A 5DAUA 5GXGB 1F2RC 3M4OB 4A3FB 1LTGD 1NUCA 1E2ZA 1LT4D 1C48A 1SSNA 2MEKA 1D2BA 3IT4B 1H9MA 2LJIA 4XXEA 4I65A 4FF3A 2YEPB 1MD2D 3I70A 4GZYC 1C8CA 5BMHA 2KCCA 1XX8A 5BN4A 4QMGA 2R92B 4NJCA 2LFNA 2BA0A 3PV0A 4IQZA 4EQNA 1SYBA 2DBYA 1QKZA 2F0UA 1AZQA 3T51B 1WSPA 1N60A 4A93B 1PZKD 2PW9A 1ENAA 2IPKD 3ITPA 4QUFA 4IFDH 4CKCA 5KYLA 1EL0A 5G3LD 4G7OC 1K51A 2NTSA 2WNMA 3K57A 3AB9A 4MM3B 4HSVA 4RCOA 3DWGC 3GP7A 3PUVA 1VDZA 3FC4A 4R8NA 4KY6A 2LUMA 1Y8NB 2LHDA 3GS2A 2V0GA 5E4WC 2R6GA 5M3MB 5C4ZA 1KAAA 1B3AA 3MXGA 1F2ZA 1SDFA 2BT6A 3KF8A 3B2FA 1PYWD 2Y3AA 5I6YA 1STBA 2B39A 4YSXB 1AZPA 4LLGM 3Q0AA 2QILA 1TY2A 1F9SA 1ESRA 1SB3C 4E6IA 3BK1A 1C4AA 3CKIB 2L32A 5I6WA 1ZEQX 1W6JA 2MJ3A 1STEA 3T56B 1AWDA 4XWWA 4RFBA 3P42A 4J1MA 2J42A 3ZJTA 1CA6A 4ITKA 1AYFA 3BVGA 3RZDB 3J81L 5C5MA 3IAM1 1DOKA 1FR3A 1DOLA 3TEZA 3GV3A 4L2YA 3AU7A 5C0XH 1G6ZA 1ZKOA 2Q8IB 2K28A 3ZGZA 1KFYB 1RYJA 4KGTA 3VR3A 4JWUC 5E4XA 2QSDA 1OXUA 4KV6A 3VR9B 3GD7A 4KD4A 3FAHA 1R7SA 1PLFA 5IGBA 2HCIA 2L11A 1BCPB 1Q1EA 2K5DA 1VJKA 1FD6A 3AE8B 1EYDA 2EYLA 3DWPA 2N55A 1L4DB 3KWVA 2PPBC 1A3VA 1JRPA 2V3NA 1FFVA 2Q8RE 3QIAA 4OO1I 3C2PA 5ELEA 4BS9A 3NP8A 3TP5A 4K2KA 3KLSX 2LHEA 1F2LA 3TDQA 1KDBA 1RF2D 1HZ5A 3OWFA 5EPLA 2XWBB 1SNMA 4KJNA 4JX1C 1EEFD 2RQXA 4RCNA 3E9SA 1CQFA 2A69C 3TZDA 2BS4B 3B2GA 3K59A 3NBHA 3J80L 5C3EB 5CMDA 1TWFB 4TQUS 2EELA 3E56A 4OGQC 2F0LA 5DNFA 1T5EA 2D9UA 3NRZA 4RF1A 1QOFA 1PFBA 2B8FA 1OQQA 4KKUA 4IDIA 1HPCA 1ILPA 1DOMA 2MP1A 5DEHA 5C3WA 2IW3A 3IXSA 1LACA 3MFYA 4A3DB 3HRDD 2PZUA 3AEEB 4KN4C 3NQTA 1XLOA 3NK9A 1T3QA 2L4NA 4ZLTF 3AE3B 3FVQA 5E1FA 5HGTA 2V3PA 3VR6A 2JYTA 2BYTA 1HEZE 1QB5D 1WTRA 4A3BB 2NB0A 1JCKB 1TR5A 1HTLD 3LNNA 3D8GA 4MACA 5AUIA 2KN4A 2LKVA 1A3TA 3D6WA 4G4KA 1ET6A 5CC4A 1STYA 2ICEC 3K5NA 3VR4A 1GUGA 3Q23A 5CV4A 1KF6B 1VZ7A 3NS1A 1FD7D 2B2UA 2PVGC 1BDOA 4A6QA 2WKCA 3RD4A 3FKIB 2F0IA 1TS2A 4HKZE 3FDTA 4FXDA 3AE2B 1G2TA 1QILA 1QF6A 2A6ED 1VDVA 3ABVB 1QE6A 1C9FA 5EPKA 1H9RA 2JXMB 3CRKC 4XIGS 1A2TA 3MWYW 4KTAA 2F0SA 2F3VA 5FLXE 5BMGA 3BG3A 1OO9B 2SOBA 5ISRA 3LXFA 3K0YA 1G291 3TP6A 4Q5VA 1TKYA 1SF0A 4OZAA 5FKAC 4MT5A 2PCFB 5IGFA 5HHDG 2B63B 3BYYB 3PUWA 3SFEB 1EY4A 3K7AB 3HUIA 2B2WA 2JSOA 2PLPA 5C4JB 4IURA 1SE4A 1Y1WB 3K5OA 3DEOA 1NVID 2CJNA 1C4CA 4AS1A 4PMBA 3Q8BA 5JOBA 3IAS1 2NVTB 2F0PA 2EY2A 1HRJA 3W2DA 4DFAA 3N9YC 1PFDA 4XQQA 1V97A 1HZ6A 1PMRA 2EYFA 1P7FA 2WDQB 2KEDA 1LLRD 5CV9A 4ZQ3A 3R3OA 4XQJA 2F0EA 1NR2A 2BB6A 4C3IB 2XRQD 3VYUA 1C77A 3VA7A 3VYRA 3HOZB 3I72A 5M5YB 2QF7A 4C7YA 4K6LA 1FM0D 2JA6B 2Z4HA 1E0ZA 3DUZA 2Y5PA 2OHFA 1EIGA 5KIXA 1EU3A 2W54A 3LWUA 5IGGA 2I46A 1EFID 2K9XA 4ILWA 4ZRZA 1CZGA 3W5UB 3Q8AA 2QIEB 1JQYD 1EU4A 1YNND 2Y5CA 1VF7A 1QOBA 1SNDA 4C2MB 4GDLB 1HTPA 2AQ1B 2EE1A 1OXXK 2LGIA 3Q69A 1GUWA 1T6BX 4EGVA 2M9VA 3U4EG 3S1MB 5G3LF 3T13A 3FILA 1EWYC 1EY8A 4YSYB 3CRLC 1RODA 2NUCA 2XSCA 1AP0A 2DY8A 1TY0A 2NBFA 2ON8A 2R93B 2BB5A 3NVVA 1YNJC 2A5HA 1U4PA 5EKIA 3D4WA 3GTKB 1UUPA 4DXFA 2RDHA 4YTPB 1TS4A 2F0GA 1XXGA 3DMUA 1JQ4A 1JWAD 1IUEA 2L9HA 3GTOB 2WP8J 4K8IA 5E6JA 2EYJA 1PDQA 2W3RA 3H8HA 4EVOA 1O7YA 3PIO3 3BDCA 1M8AA 3AE9B 1CK1A 4MIUA 1WTVA 1EIHA 4OVZA 1F2MA 1ZOYB 1D5ZC 3DWQA 4RA8A 1AN8A 4KD3A 4G7HC 1EEID 3PMFA 1CA5A 1NAPA 1ZP0B 1CZWA 4ULLA 2A68D 2IJ0A 2K6AA 3D6CA 4ZHPA 4U673 2IL8A 3NTIA 2KJXA 1BCPF 2K0PA 1EWHA 1TWCB 2OT2A 3M7GA 4HMJA 5ELFA 5IIFA 5EBDA 3S17B 5KNBA