1QILA

Inactive mutant toxic shock syndrome toxin-1 at 2.5 a
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
194
structure length
194
Chain Sequence
STNDNIKDLLDWYSSGSDTFTNSEVLDNSLGSMRIKNTDGSISLIIFPSPYYSPAFTKGEKVDLNTKRTKKSQHTSEGTYIHFQISGVTNTEKLPTPIELPLKVKVHGKDSPLKYWPKFDKKQLAISTLDFEIRAQLTQIHGLYRSSDKTGGYWKITMNDGSTYQSDLSKKFEYNTEKPPINIDEIKTIEAEIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords TOXIC SHOCK SYNDROME TOXIN-1
publication title Crystal structure of a biologically inactive mutant of toxic shock syndrome toxin-1 at 2.5 A resolution.
pubmed rcsb
source organism Staphylococcus aureus
total genus 59
structure length 194
sequence length 194
chains with identical sequence B, C
ec nomenclature
pdb deposition date 1997-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1qilA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1qilA01
4O1NA 1DYQA 1LTGD 1SE3A 1KLUD 1M4VA 2XRQD 1LTID 1KTKA 1TS2A 2ICIA 5TSSA 1PZJD 4BWGB 1EFID 1PRTB 2QILA 1EEID 1S5FD 1I4GA 2IPKD 1RD9D 2WV6D 1CT1D 2R61A 1FD7D 3KLSX 3DWQA 3OWEB 1EWCA 1UNSA 1MD2D 2CHBD 5D3DA 1CK1A 3URYA 1PRTD 1FNWA 1AN8A 2Z8LA 4RGOS 1CHQD 1SXTA 5D3IB 1FNUA 1UUPA 1LT5D 3R8BA 1F77A 1LT4D 1I4XA 1HQRD 4OHJA 4RGMA 2XNAC 1PRTC 4DXGA 4RCOA 1LT3D 1LO5D 2G9HD 1EU3A 1JWSD 1L0YB 3V05A 1D6EC 1S5CD 1BXTA 3EFXD 3DWAA 1SBBB 1LTSD 2AQ2B 2XRSD 3BVMA 1FGBD 1RF2D 3BZDB 1YN4A 1PTOF 1CQVA 1SE2A 1EEFD 1FNVA 1LTRD 1JQYD 1L0XB 1I4HA 3DWPA 1PTOB 3BYYB 1STEA 1TY2A 4RFBA 2AQ3B 1CHPD 3SEBA 2NTTA 1JCKB 1TS4A 3MFGA 5ELCA 4C56C 2AQ1B 3BVZA 5ELEA 3MC0B 4DXFA 3BVGA 1QILA 3R2IA 1HXYD 1V1OA 1HA5A 1DJRD 1KLGD 1BCPF 5ELDA 3W2DA 4RH6A 2XN9C 1LT6D 1PTOC 1V1PB 2O2LD 1B44D 1JWMD 1S5DD 2QEJC 1BCPB 1SE4A 1JR0D 4RGTA 1LTAD 2TSSA 2NTSA 1SEBD 4TSSA 1LLRD 4L63B 2RDHA 3GP7A 2SEBD 5FKAC 1S5ED 1D5XC 1TY0A 1G8ZD 4RGNA 1PZID 5ELFA 1S5BD 1D5ZC 1PYWD 1YN5A 1ENFA 2J4XA 1PTOD 1BCPC 1ESFA 1D5MC 1PRTF 1TS5A 1SJHD 1RDPD 1B1ZA 4UDUC 5FK9C 4NZLB 1GOZA 4L6TB 1T5XD 2IJ0A 1HTLD 1ET6A 3BYTB 1PZKD 3O13A 1I4PA 3R2TA 3CHBD 1I4QA 4RHSA 1RCVD 4ZYSA 5ELBA 5I4DA 1SJED 1TS3A 1BCPD 1LTTD 1LTBD 2RDGA 4K6LA 4Z9CB 1YN3A 1AW7A 1PTOH 1JWUD 4RHRA 1V1PA 3TSSA 3EA6A 1XTCD 1XXGA 1ET9A 1EU4A 1I4RA
chains in the Genus database with same CATH superfamily
1C4CA 2F0FA 1NBWA 2A6ED 3KF6A 4ZLTF 1WXQA 3DVNV 2B2VA 4K8IA 3AN1A 5HGTA 2BB5A 4C3JB 2KDIA 3SR1A 3DEPA 4H0LC 4LJOB 3VR8B 1S5FD 2JN4A 1CT1D 3OWEB 5KIXA 5G3LF 4B3SQ 4C00A 1XLQA 1EWCA 3I3CA 2B63H 1MD2D 1MHHE 1WCMG 2KLCA 1X65A 1WGDA 4HJ5A 4R3DA 4RGOS 2XBBC 1SXTA 4DQOC 3P75A 1L2NA 1C3TA 5JJLA 4OHJA 1IBKQ 5C3EG 2PW7A 4DXGA 1TBEA 2Y0SB 4HJGE 4R1JA 1RM6C 4R4QA 1U4PA 2Z4HA 2ASQA 4WJNA 3FKYA 4TKOB 5L95C 5EPJA 3ZVVA 3V05A 4OWWB 2WDTB 4K7UA 3NP8A 4HAEA 4HCPB 3ZJTA 1JW9D 1IW7D 1SROA 1VJKA 2LGDA 4NKLA 3ZDMC 3VYUA 2K5HA 5GROA 4XWTA 4YSZB 2LHDA 1JQYD 1I94Q 1NR2A 1QZEA 4KIKB 5MPOA 2LMCA 2CHWA 3L7ZC 1WMHB 3N20C 1JRPA 1SYFA 4A3EB 3VH4B 3S17H 4XQNA 1V8QA 3B0AA 1CI3M 1D2BA 1WJJA 3TP8A 3GE8C 1QILA 2FCMA 1U0LA 3RN2A 3NG0A 1V1OA 2KHIA 1BCPF 4AYBG 2R93B 2N7JA 2IZVB 1WOCA 2VZKB 4Q0FA 2R92G 3A5UA 1SRUA 1QNUA 3OMGA 4JI4Q 3TJPA 2K5NA 1V2YA 4LFCQ 1FCLA 5COYA 1R9TH 3AE9B 3NPPA 2BWES 3L16A 4DAPA 3WOFA 1QUQA 1N5WA 3S15H 1E2VA 4DV3L 1F2RC 1PZID 5FLXE 2J0TD 2J42A 5I6WA 1HNWL 2F0IA 3KYCD 1HZCA 4LUVA 2JZ3B 2SAKA 4AUQC 5IT9L 1NBFC 4IWOA 3W1SA 1HHVA 4K7SA 1YVCA 2H5XA 2KEDA 1II3A 5E4WC 5K36H 2AX5A 1Q8IA 2OOBB 3I8ZA 4ID6A 4HR7B 4PMBA 2YTXA 1WTPA 4KI0A 2PCFB 4LF9Q 3AU7A 3ULLA 3LYYA 4OW0A 3HFZB 1JJ2A 4W9HA 1EQQA 3U7DA 5IP4D 4P7IA 3MC9A 4JOIC 2CHZA 3ZNZB 3OG5A 1XLNA 2D3GA 1KABA 3W3AA 4DKAC 1XO3A 2Q8RE 2NVYB 1JB3A 3MEFA 4GOPA 2R7ZH 3LX0A 2DZKA 1RCVD 2GMIC 4X66Q 1ASYA 4G0NB 5IOCA 2IX0A 1X1MA 3C46A 2CCZA 1T5EA 4KJNA 4NXNQ 4U68A 4RF1A 2EDGA 1Z5SB 4JCVE 3CKIB 3DHGC 2EXDA 3PLVA 2I1JA 3VTVA 3RMKC 2XRQD 2DBYA 2LVPA 4AQ7A 3ONAB 4P75A 1RLFA 1PZJD 2VH1A 1A3UA 4IALA 3PCOB 4GN3B 1JE5A 4LWCA 3J80E 3AEFB 1UD7A 3RR5A 2VY3A 3DWQA 1EY0A 4NXMQ 4JG2A 1VQLA 5C3EB 1CK1A 1C76A 2M00A 4JWUC 2BWFA 4YSYB 2K7VA 3PRPB 4J6HA 5D3IB 1E2WA 4NNJB 3QAQA 3R8BA 1K8OA 1LT4D 2YVCA 3MTNB 2XNAC 1SNPA 3PIPA 3I7FA 1HA6A 3VR5A 4APVA 4RCOA 2SOBA 1RFAA 1NAPA 2EMTA 2DYMA 1VMCA 5FLMG 4C3IH 2HE7A 1YJWA 4A3IG 2CWAA 2N3SA 3ULJA 4FDBA 3TEHB 2BCOA 3VR2A 1K53A 3I56A 1MPEA 1YMHE 5DPSA 2E2HB 1BQQT 2BA1A 1N5XA 2GLSA 3QJYA 5E1FA 1WGGA 2W82A 1FR3A 5E4XA 5BMIA 3FP9A 1PTOF 2KMCA 2WX0A 2BE5C 2WXMA 3V2TA 2KVRA 4EZLA 4HPLB 1ROEA 1SNMA 4OIKA 2IO1B 4A3FH 2AQ3B 3RNFC 4DNIA 3CC4A 3H3VC 2NN6H 2WKCA 2WDQB 3W5UB 4JK1C 1KL9A 2INNE 2EJMA 2IW3A 5ELEA 1P7FA 1LQBA 3CIRB 4FJZA 1YX6B 4OWTB 3T1HL 2NVXH 4ANVA 4HEA1 4IO9A 4IM2A 3PUZA 4B3ML 1PGAA 1FEHA 1V43A 2W55A 3LDZE 3CU7A 2F1MA 1HFNA 1T9HA 2VH2A 4KGTA 1ZW7A 1UBQA 4DK0A 4NY0A 3OW2A 3GTGB 3AI5A 1ZKHA 3AECB 1TWHB 1E0BA 2NPTB 2RDBC 3EUB2 4MGIE 5G2NA 3WWVA 4IM3A 4HPPA 3AFQA 3TP6A 1O78A 4A75A 3ZLZA 2MBOA 1QOHA 4C2MH 2IY0B 2KUMA 4BXXH 4D2KA 1GD7A 1Y8OB 1WFYA 5JOBA 1Q82C 1HFGA 4BY1H 2BB6A 2L9HA 2N9EB 5FJ8H 3IT4B 3NS1A 3A5ZB 4MT5A 1C48A 2PZWA 4B3RL 5BYRA 1JRUA 1WRDB 2MBEA 4IUPA 1X55A 3PUXA 2MBHA 2RA4A 4HIOA 2JA6B 2PNRC 4N9PA 1T0QC 2N7EA 4WWNA 2QKIC 5I2YA 1MG4A 4NDXA 4ZRQA 3VYRA 1K51A 1B3QA 5BYSA 1J0GA 3T51B 3KF6B 1YITA 4DV3Q 3HOVG 1EWYC 2N88A 1HNWQ 2JJQA 2F03A 2V4IB 4MH8A 3OTOL 1B70B 4RHSA 4F8MA 5T1GA 5I4DA 3U4EG 2HJ8A 2Z4IA 2KLGA 1Q86C 2C7NB 1BDOA 1CM9A 3PO3B 3C0RB 2EY5A 4KZCA 4DV4L 1J5EQ 1EU4A 2A8VA 1STHA 3JVZX 1VQMA 2BKRB 3K5OA 4KGRA 4YT0B 1F9RA 2HD3A 1ACCA 1H8CA 5TSSA 2DYBA 2B2VC 2WXIA 3M63B 3JC66 3LWEA 1V86A 2K5PA 1ISNA 5JVG3 1WCMH 1WYGA 2MJ3A 2JA7H 2NR2A 2F0MA 4IWQA 3ZDTA 2KTRA 4Y7NH 2PZUA 4ABNA 3GTLB 3H15A 2BS3B 3DBRI 2B2WA 2MQHA 4XYQA 1IYJB 4MZ9A 5LXHA 4Q2JA 1UUPA 4A3IB 2I2YA 4WFN3 3I4MH 4F8CB 3ULPA 5LNK1 3RCZA 2JEBI 4A3CG 5HGQA 3JAML 5C3WA 4DR4L 4BBNC 2LKVA 4QMGA 2LMCB 3S1QB 3E3XA 2IHEA 3CRKC 1JMCA 2CJNA 2CJOA 2LEKA 1JWSD 5EGTA 1VQJA 2G9DA 5C23A 4F1SA 4U673 2KTFA 5EE0A 1FGUA 2AQ2B 2ZM6L 1EIHA 2QDLA 2DZJA 4WQMA 1W6KA 3RLFA 1C79A 4YL8A 1JORA 1Z47A 3DVGY 1BBUA 2Z9HA 4BOSC 1PH6A 2HCIA 3D4WA 3OW7A 4L5TA 4H13C 4DN4M 4M8MA 3OIQA 3NY5A 3U50C 4OO1I 1R4NI 4JE3B 2JA5H 4S0RA 5JH5C 2ZTEA 3NUHB 3KLRA 2L00B 4A3BG 5L83A 2PEAA 4M1UB 4DXFA 3OJ3A 5HKHA 3AEBB 3T8MA 4KD3A 1PH5A 2CHXA 3DWMA 1R4PB 1QUQB 2C9WB 3Q8FA 2MBQA 2V3PA 3L13A 1B44D 3FRPB 5FO7B 2EELA 1S5DD 1GUOA 2H1EA 2BOSA 2NVTB 5HI1A 1SE4A 3N52A 5GADC 1LTAD 2IO3B 5G5GA 3I55A 1WGYA 1IYUA 5LLIA 1X9NA 4R8IA 3PSIA 3A9KA 5JEAJ 4K14A 3T1YL 2RHQB 4REZA 2R2QA 2IGHA 2JEAI 2KOLA 4K2LA 2PMZB 1EOTA 1STGA 3H0GB 3T1HQ 3ETRA 5D65A 1Q46A 4IJLA 2EMSA 3M4OB 4IM0A 2L52A 3M95A 1Y56A 4B3MQ 1HTQA 4KKIA 4RKBA 2NZ1D 4BFRA 1N8RC 3W1SC 1G2TA 4R4OA 1VQNA 3HOVB 2X6LA 2CQAA 4NJ7A 1SSOA 4JX1C 3NSWA 3KH0A 2Y3AA 3GV6A 4QIWE 2XGTA 3G48A 1KQSA 1ZXTA 4HRSA 2KDBA 4HVBA 1I4PA 3R2TA 5TR5A 3OYYA 2CQOA 1PGBA 2JT4B 4GB9A 4ANWA 2HQLA 2HQEA 2ZJDA 3ZRCA 1KD1C 1I3QH 4GU2A 2NVQB 1E10A 5EJWA 5C3XA 2PVGC 4B3RQ 2WX1A 1XX8A 4MGKE 2QF7A 1G6PA 2LWPA 2PPHA 4O1NA 3Q8AA 1QLBB 4P74A 1SE3A 2KAJA 4DR6L 4C3HG 2BGFA 1GNUA 1S3SG 3D3RA 3I2ZA 3AE7B 3S16H 3HKZE 5G5HA 5DPWA 3HOZG 1A8VA 3OTOQ 4CGYB 2G4SA 3MHSD 2OT2A 1EY7A 3JAMc 3GZNI 1BR9A 5JEAG 1K3BC 1LV9A 2GI9A 2N49A 3ZYYX 2A5UA 2PNHA 3I9V1 1FXIA 3L54A 1GXDC 4DV4Q 2K03A 1FNUA 4EUTA 3STBD 1Z2MA 1Q7YC 1GJXA 4DDID 4I6PA 2F0TA 4TKNA 3IAS1 3B9JA 2FIDA 3X23A 4PG3A 5JXVA 1ILPA 3V3XA 2FE8A 3BDLA 3H1UA 3P4RB 2DNFA 4OO1G 2A19A 4KTAA 2MJDA 2PLPA 2ZVNA 1X3PA 3NWTA 1KNEA 3A54A 4C1NK 2PJHA 3AE5B 2IY1B 1CQVA 3ERSX 4WJPA 1X54A 4H7BA 4OVZA 1WY8A 3VTUA 3SVMA 3HOWG 1YX5B 2UYZB 5AUKA 1IW7C 1X56A 1SYBA 3SGIA 2FINB 2KOXA 1N61A 1STEA 2O5JC 4QB4A 2N1VA 4F87A 2E8GA 1TWGH 3CCSA 1GUNA 5C44B 3PUYA 3GTOB 3ML9A 3SR6A 5CC4A 4B9KA 1T6BX 1MHXA 2BT6A 3VR9B 3BDOA 1F2ZA 3AULA 2QHOA 3E0JA 1LM0A 4JI2L 3R2IA 1Y1VG 2FMMA 4LFBL 1PUTA 1N9WA 2J0JA 4W9IA 5J39A 4KV6A 2B29A 1OQYA 2D0OA 2BE5D 4X65L 4XE0A 1MIUA 2MPMA 1M94A 3D6WA 2N9KA 2ZW1A 1OXTA 1IYFA 1CJEA 3TIXA 4W9EA 1E7UA 2X8XX 5JAVA 2F0KA 2KCMA 3EECA 1TZOA 1YJJA 3J9CA 3I5JC 4UPAA 4K81A 3MVVA 4JBKA 5LMUL 4C1NI 4DUYL 1WTQA 2A74C 3I4NG 1O7YA 1E22A 2OF1A 2L8JA 1F2LA 2BA0A 2DLBA 3T53B 3PSEB 4EKUA 5IYBG 3BWUD 1EWIA 4IQZA 2B2TA 3W1GA 4FXDA 1M90C 4CJ0B 1E8WA 1EQVA 2M2LA 4DHJD 2KCCA 1WR6E 5BN5A 1QOBA 3DLLA 3NWSA 4KIKA 3E9SA 3TZDA 1ZGUB 2ON8A 1SIFA 4ANUA 4UDUC 2KHWB 4EQPA 3M3JA 3I73A 1Y69U 4JL9A 1EIYB 2QJLA 3BIID 1H9KA 4EX5A 3IVFA 3MAQA 5JHAA 2Z6BA 2EZVA 1BKBA 3DXJC 3TRZA 2WP8J 4A3KB 1X3GA 4TRDA 1EYCA 4W9JA 1PH7A 2LJIA 4FXCA 3UI3A 3K0XA 4DK5A 3S9WA 1MJDA 4EOYA 3EQLC 5M5YH 4O0AA 4HIDA 2EVBA 1TVXA 1HR0L 4C3HB 4L5RC 3DBRB 3PUVA 5J17A 1FD6A 1MBYA 1Q12A 3CD6A 2MHJA 4IW0A 3PZ8A 1PLFA 2UUCQ 3VVWB 3R3MA 1XLOA 4MIUA 1F2RI 4BKSD 4NW2A 1XLPA 2PE6B 2Q2UA 1E3PA 4IUVA 5CV8A 1RWSA 1TZ1A 3H6MA 1BMLC 3GTKH 3BY4B 3ZIMA 2ZTCA 3VA5A 2KA7A 3IXSA 1G2SA 2KMMA 5EBDA 3SFEB 3PREA 3WAOA 4POFA 1V80A 4JOIA 3ZJUA 4LNQA 3U30A 3NOBA 4QY7A 3R93A 1G51A 3BDCA 2EYHA 5EQ0A 1X3QA 1VQCA 2JYEA 4HKZE 2B2WC 5A2QL 2NBVB 2NMQA 4A3DG 5HG2A 1DOLA 2LXAA 3P4SB 2K52A 1PMRA 3NVVA 5T8IA 5CHVC 3KUPA 3PRZA 1HCZA 1YHAA 1L0WA 5EE3A 1WZ3A 4ZRKA 3UI2A 4KY6A 5M3MB 1E9MA 4QUFA 3S14B 2VL6A 5IYDG 1NI2A 3AYHB 2EYOA 1SMXA 1SLJA 3DMUA 4B0MA 3TP5A 2UXDL 3UF8A 4IFDI 1G291 2JZZA 2LZ6A 4BBSB 1XF5L 1F0ZA 3UINB 2KN5A 2WAQE 1BVSA 1TT5B 3SK5A 4A20A 4C3JG 5CORA 1E6EB 1Q0WB 3NZ3A 4RFBA 1Y1VB 3WA0A 1A15A 3I3TB 1FPYA 3TMPB 3RZDH 3HVZA 4HMJA 1TIID 1GJZA 2JU6X 2M0AA 2AQ1B 1RKNA 1EY6A 1RL2A 2H4OA 2JF5A 3LWUA 4L5QA 1VQGA 1NI3A 3A9KB 4LLGM 1OGWA 1HXYD 4CKCA 2VNUD 3JSVB 3GTQH 2ALYB 2XN9C 1ZYRC 2RCNA 3PUWA 3TS0A 1WRIA 2KC2A 3ZW3A 3OHXC 1AARA 4UP8A 2Y0SG 3AB9A 4QIWB 1LABA 1LM8B 2HJ1A 3AB5A 4TQ1A 3VXWA 3VR6A 4CYEA 4X3SA 4IUNA 3VDZA 1I5FA 2NTSA 1QT9A 2M4NA 3S2DH 3R66C 2RDHA 2XTIA 4EQNA 1I6VC 2JYOA 3IL8A 4UP9A 2MJEA 1JJCB 3J81j 1A63A 4DK6C 5AZGA 2OTLA 2ZW0A 4JI2Q 1D7QA 4LFBQ 4TQ0A 1V5OA 1FFVA 2YLMA 2KDFB 4KSLC 1YN5A 4IZ8A 4X65Q 3HG9A 1KNAA 2VW9A 2W54A 1FM0D 3H3VI 3L3OC 4A3EG 4FJVB 1SJHD 2JE6I 5C6AA 3K5LA 3C3LA 5HHDG 3TEXA 4IFDJ 4AH6A 1YQ4B 3AE2B 4H2AA 2F0LA 4XYOA 2K04A 5LMUQ 4AP4C 4DUYQ 2EPBA 2Q5WD 2K3UA 1YJNA 2CR5A 1TGZB 4XT3B 4GOCA 3PGZA 3APDA 2CH4W 1J19A 1PQSA 3CMMB 1UF0A 1VCIA 4K0KL 1J7CA 1ZDXA 3KJOA 3S17B 3UQBA 4DV2L 2LJ5A 2NBUA 3ZRFA 2R93G 3GZNB 2JK8A 3CCRA 1A70A 2INCC 1W3SA 3NXWA 1MSGA 3AH7A 3C8YA 5C4XH 2FUG1 4WWOA 4YTPB 3HRDD 1YZ6A 4OEMB 3NK9A 2MLBA 2WDRB 2L0FA 1VQKA 2KVZA 3RLOA 3D32A 1C9OA 2IX3A 1XCQL 3LB8C 2L7RA 3TBIB 4IPCA 3HOUG 3QK0A 1WTOA 4CDCC 1S40A 1XT9B 2XK5A 3H7SA 2ZTDA 5CV9A 1SMYD 3AEGB 3L10B 4A3JG 2D5DA 2RR9A 1VZ6A 3PZDA 4MHEA 1EFID 4OONA 4DV6L 4A3LH 2V3SA 3KLSX 5LXIB 5DPTA 5H92C 1TQOA 1HR0Q 1PFNA 3KF8A 3P1HA 1BBXC 5LHY1 1VQDA 1NEKB 3S15B 4CKBA 1FNWA 2M56B 4IDIA 1J7AA 4GNXB 5CV4A 4DR7L 3X3NA 1B7YB 3EIVA 5KNDA 4FP5D 2R7DA 4ME3A 1ZOYB 2LUMA 1EF1A 2QGQA 4IFDG 3BJUA 2LVOA 1RHPA 1C4QA 5J2RA 2XWBB 1F9SA 4ZUJA 1D6EC 2BBCA 1S5CD 2B76B 2ZCCA 5I6YA 2CU3A 2UWQA 2XEWA 4GSWA 4WORA 1DGSA 1U4LA 3K59A 2C9OA 1YNJC 4GNXC 1QG7A 3TREA 2R7ZB 2RMMA 2RD0A 4GMVA 4ZRIA 3CCQA 3NEMA 1WTWA 1YIJA 3KUDB 1SDFA 5T1IA 4X64L 3NJTA 1TY2A 4PK1A 3DVNU 2ZVOA 5IIFA 1P3QU 1NNXA 1VQ7A 4ZCKA 4I6NB 1TWCH 1NYQA 2BYFA 2IYDB 1N62A 3ZKJC 2IX1A 2FBWB 2HIXA 2IO0B 4OL7A 1XCTL 1HZBA 2KBNA 3QO2A 2UXDQ 2K0PA 2M1MA 2IY5B 1OTCA 2O2VA 2FXQA 4I65A 4JWSC 2SNMA 4MELA 4ZRJA 2JYTA 3ZO5B 2BDNA 3KOJA 1PHJA 4NMZA 2ATWA 1O7LA 1TWAH 2FFKB 3DUZA 4ME5A 3AV8A 1VQ6A 3J81L 1E5WA 4DUZL 3OPOA 1EUVB 2A5HA 3APFA 2XIWA 4L63B 1V6EA 4HK2A 2JA8H 1EQRA 3EGRA 1EY9A 4G7ZC 3OAWA 3PLUA 4US9A 3DOWA 5IGFA 4HWIB 5E6OA 3C2PA 3FPUB 1KOTA 1WZ0A 4AOFA 4C3IB 4FYDA 4RMAA 1YQBA 2KFKA 4XX5A 2B2TC 5DM63 4HCSA 4QUCA 3DQVA 3MEHA 1HNXL 2JSVX 5DAUA 2E2IH 1JJGA 1DOXA 1BOSA 1SYGA 2IGDA 2RGFA 1EYAA 2XVSA 3U52E 3KQ4A 5AEKB 1RDPD 3KYDD 4USAA 4NAWA 2DZIA 5BN4A 3KLWA 2SNSA 4N58A 1QCBD 5C3JB 4GS3A 4A3FB 5C4JB 4XGAB 4ZAIA 2X38A 1E8ZA 2E5LL 3RUIB 4WH4A 3SE0A 3F8TA 3HOUB 3J7ZC 2WU2B 1TS3A 5GAGC 1R4MB 2RDGA 2LFIA 3HEJA 2M0XA 4O42A 1I6HH 1GO3E 1A2UA 3P1MA 4A3JB 2NVXB 3EA6A 1NYRA 4XDXA 3QWZB 1BT0A 4EQOA 2WINB 4ALPA 5JJKA 4YCUA 3A8JE 4JPSA 4IOAA 1F2YA 3IT6B 1XTDA 1QZGA 3CQZB 4K0KQ 4NQLB 3PO2H 4MJSA 2UU9L 5IYCG 1ICWA 3PZ7A 4WWMA 3A4RA 2PKOA 3GTJH 3VA7A 1R4QB 4LMQD 5E7NA 2I5HA 2LHEA 4DV0L 2UUBL 2CHBD 3MTSA 3QC8B 2D3BA 2BTEA 3SK4A 2HDEA 4URKA 1SN8A 1CHQD 4EQ5A 2O5IC 2JA6G 2KX0A 3CAMA 4X3TA 1C7YA 3NELA 1I4XA 2JQRB 3PO0A 4PS7A 2PTLA 4DNTB 4IC7B 4ZDVA 3B2FA 2JRHA 3STBC 4DV5L 2F0SA 1V97A 2K5QA 5D14A 1E0ZA 1VR9A 4JI7Q 3VDYA 3CWIA 1KAWA 2E75C 3PO3G 5IGGA 1PXUA 4M0WA 1LTSD 1P8LA 2XRSD 2LXCA 4I6LB 4YCWA 3UDXA 2YU9H 4DR7Q 1HQMC 3PF4A 3S2AA 4KKUA 1C77A 1HR0W 1STBA 4HSVA 3J80i 3BYYB 1C0AA 1GAQB 2J7QB 4KN7C 2L05A 3P4QB 2F52A 1CHPD 2LRWA 4ULLA 3R7RA 5ELCA 2E2JH 2KKCA 1I50B 3KDFA 1FRDA 1QVFA 3NVYA 3J81c 2Z0DB 4KK7A 2RPQA 4H44C 4PYZA 4A3GH 4P1BC 4X3UA 1XQQA 1ZE3D 5AZFA 4B9XA 5IOIA 2JXMB 1OXXK 1VQ9A 4NQKE 1AYFA 3X3MA 1KLGD 1OXUA 2JA7B 3RNUA 4A3MH 1WTVA 1PYBA 5CV6A 2HHHL 4Y7NB 3FKIB 4RA8A 1KF6B 2QEJC 3X0WA 3BU2A 3SDZA 1HUNA 3VR4A 2JQOA 2ZXRA 3S2HH 1TXYA 2VUMH 2KQSA 4KKTA 3I4MB 4A8XC 1L4ZB 4KHPL 2J52A 1UWXA 2G5DA 1WYWB 3B08A 4DHJB 2WXLA 5IY0A 2L0CA 1S5BD 3NS8A 2F0HA 4IN3A 2L1AA 5EKLA 2QA4A 1SYCA 3BS1A 1ZYRD 4EE2A 1ESFA 4I7ZC 4CHTB 1L5PA 4DUZQ 2JXTA 2ZZPB 4XT1B 4MSMB 4R4CA 1C4PA 3RMHA 3K6OA 1Y1WG 2WGSA 4K3CA 4OVVA 3VH3B 3GTMB 2XK5B 1WYDA 5CV5A 3OSOA 3S1MH 5IT9c 5C0XI 2JA5B 1F9JA 2OWOA 1KJTA 1T0RC 2FIFA 5F2DA 4IG7B 2KXJA 2C7HA 1HNXQ 1SJED 4NAMA 2BYEA 4LFAL 2KK8A 5C5LA 1P1AA 1H9MA 3HOXH 1WX8A 4YXDB 3ABVB 5M3FG 3KF8B 4KN4C 2PMVA 1RIPA 2EY1A 2D07B 5GMVA 2GA4B 3MC8A 4BBNF 5EPLA 4DF7A 1KTKA 3H0GG 4PYUA 2MUYA 1F2MA 2ICEC 1U4RA 3GOEA 3L0OA 3CF5A 3ONSA 2E5LQ 2KT7A 1EEID 4HJKA 1GPXA 2JUOA 2O6VA 1JQ4A 4RNAA 5GAHC 4KMUC 5BN3A 4WURA 2QW7A 5D3DA 4IUMB 4WIPA 3URYA 1I42A 1CSQA 3E0EA 2L11A 2Z8LA 4QGUA 1C78A 4WAAA 4S3SA 1EF5A 3CCEA 5IO9A 2FHTA 5IGDA 2FNJB 2DNCA 4X6AH 4BBRG 2KJXA 1VQ8A 5KYLA 3U58A 1N34L 3S1RB 5JZEB 4N8FA 4E6IA 2UU9Q 2F0OA 3N3KB 1VQOA 2L83A 1WGRA 4US8A 3ITPA 4DV0Q 2UUBQ 4L5SA 5C0XJ 2ZJQA 1NDDA 1PFDA 2MBBB 3HGBA 2D0PA 2L55A 1FIQA 2GB1A 2HIVA 2X69A 2B3GA 5A35A 4ODGA 3CCUA 2KCTA 4LF4L 3IKJA 1FNVA 4DAVA 2K1FA 3ND9A 4II3B 5BR8L 2O2VB 2ONQA 1ILQA 1BO0A 2D3AA 5C3EH 2E74C 4HSPA 1K8MA 1HNZL 5CTRC 3VFKA 2JPHA 3Q24A 3RZOH 1RFKA 4MDKE 3SU8X 4DV5Q 2AUJD 2NTTA 4OX9L 1ML0D 2WXKA 1D1KA 3EHVA 2MQJA 2DJGC 1AEXA 3BVZA 2VQEL 4JBJA 2L32A 3CSTA 4ANXA 4YTNB 4AIMA 2RPVA 3F2DA 3S16B 5EDSA 4LF6L 1YNJD 1QJOA 2CFMA 2K5VA 1OQQA 2JRIB 3UDGA 5C2TB 4IUTA 4RWSC 5HY6A 3V96A 1IL2A 3I70A 5C4ZA 4FNFA 1KM7A 5IGBA 2GOWA 3M4QA 3N9YC 2KFKB 2MW5A 4LCDE 3C1FA 4WJ4A 3ENEA 1KRHA 5JJIA 1HTPA 4UY8C 2AWNA 4FLHA 1FYCA 4IOCA 4CO7A 2JXXA 1S5ED 1JT8A 1VQBA 2JWZA 4NAWB 1G8ZD 2NBWB 1WX7A 5EBCA 3RLNA 3M3YH 3U9OA 2LI5A 5EKIA 2GVAA 4NJ6A 3V6EB 1WD0A 2AWTA 5I2XA 1NY4A 2MO1A 2KX3A 5C0XG 1Y1WB 5GXGB 4IKGA 3DDCB 1XPOA 4FF2A 1CQFA 4JI0L 3K0YA 5G55A 3U2SC 4C4VA 2R92H 4KX6B 2V1YA 5C44G 3AE4B 4YY3L 1T0YA 3RD2A 5JHBA 5M9OA 2KNBA 3NZUA 4KHPQ 2WB1E 3OWFA 3KW5B 1QF6A 2F0VA 2PZTA 2DZMA 1TYGB 3TS2A 3BYTB 3KWVA 4X57B 3OJ4B 3PS6A 1TWGB 2MP2A 2LGYA 5M3FB 3KBGA 3H7PA 1NMGA 3QIAA 2VXWA 4MJSB 4MN3A 1LTTD 2J0KA 2WXNA 5EE9A 3JSVA 1GC6A 2ES2A 1MI0A 1AW7A 1PTOH 5LL6X 4JGHB 2D2CC 4BA1I 2D10A 4K1RB 1P16A 1VQ5A 3HOYB 2QIEB 3NUCA 4BY7G 3QHTA 1OEYA 2KVMA 4LW1A 2WHIA 1CTMA 1YNTE 2FCSA 1AZPA 2GBNA 2UU7A 1PVOA 1EY4A 4GZYC 1UELA 2WQYB 1NR4A 2DJFC 2GVBA 2QILA 4X3KA 4ZUIA 2I38A 2KJRA 2MNAA 1VZ7A 3CMAA 4YSXB 2KJ6A 5BO4B 4ILWA 4LFAQ 1SMYC 1LFDA 4MSQB 4H02A 4B9WA 3CXCA 1YOVB 3AXCA 1B50A 1ICFB 1SYDA 4KDIC 3RD4A 4BBRB 1GM5A 1TTNA 2WXOA 2DHZA 2EOTA 2AKWB 2EJFC 4K8JA 4LJPB 4M0WB 4HEDA 3L08A 1F77A 4A3KG 5EKKA 3PHXB 4J6IA 1LT3D 3J7AV 2YEPB 2PI2E 3NBHA 1L0YB 4HDOA 2LXJA 1BXTA 1Q81C 4AJYB 5EE1A 4FBJB 4KKJA 3KDFB 3VHTC 4A93G 2RHSB 1A2TA 3ER0A 2DX5B 1FGBD 2A69C 2BPSA 1J8IA 1UGJA 2ID0A 5M5YB 3AFPA 1AZQA 3MJ5A 2IBIB 2V4DA 3DBLB 1EQTA 2QMTA 3L17A 5CHFA 3IFTA 3AEDB 3LGJA 1N34Q 3R3OA 3NRZA 5KHOA 1UWVA 5EPKA 5FLMH 1AP0A 2DAFA 1ZKOA 4LUOA 4XXEA 4A3IH 2RKSA 5D6JB 2L76A 3ZNHB 1IP9A 5IA7A 1RAXA 3K7AH 4FVMA 1V81A 1OEYJ 3GTKB 1YI2A 1EO6A 1P98A 1Q10A 4LF4Q 4J3OD 3S1QH 5IP9G 2HDMA 1PFSA 4TVAB 3D0FA 3BK1A 1K83B 1KFYB 4OZBA 2K01A 2B8FA 5BR8Q 5IT9E 4PS3A 1WE7A 3H91A 4GNXA 2P5ZX 1JR0D 4CQNA 2KENA 1HNZQ 3VRBB 1AWDA 4P73A 4N8X1 1GKHA 1QOFA 1LLRD 5M3MG 3PF5A 1MGSA 4OX9Q 5FKAC 2VQEQ 4DXAB 5C4HA 4DR4Q 3RT3B 1MJCA 3QB3A 4UHVA 3T4AC 5ELFA 4LF6Q 1P7EA 1ONLA 4BBSG 3A8KE 3DWGC 4DPGA 2LSSA 1TWFH 2IDYA 1VF5C 5CYUA 1TS5A 2RSOA 3CF6E 1PV4A 2V0GA 4JI1L 2ZM6Q 3RZWC 1V1QA 4KHVA 1J9OA 1PA6A 5JJZA 3JW0X 1JC7A 1U4MA 1AH9A 4MACA 2LUEA 3H8HA 5FLXL 1ZEQX 1CZGA 3QX1A 4ZK9B 4W9DA 1EYDA 3E9HA 3A9JA 1M8AA 3NHEB 1VQIA 3Q8BA 1NMFA 3LXFA 3TEYA 2B63G 4BY7B 1Y8RC 4Z9CB 4QL5A 3ZNID 1YN3A 3MXPA 2F0JA 5KRUA 2LXKA 1YHQA 3GTPB 1HTOA 4JI8L 2BS2B 2O6VB 4JI0Q 3Q8DA 4LNOA 4MGZE 2F0NA 4K5WA 3ERQA 4XQJA 2FMCA 2Q8IB 1XYIA 2D11A 4EEWA 4YY3Q 4E3CA 3GTQB 4DK1A 4JLCA 1K3RA 2YTVA 1N60A 1VZ8A 2K22A 1QB5D 2WXFA 3T9LA 3HM3A 3WALA 4IJHA 1EIFA 1UE7A 1JOOA 4PV1C 3K5MA 2FCNA 3Q22A 3HOVH 2LVQA 2KEEA 4M00A 4MGYE 3T1YQ 3CW2C 2M19A 1UNSA 1QVGA 3E56A 3KUCB 1CA5A 2BVCA 1PRTD 1DGJA 4GLXA 4MTKA 1E24A 1I7HA 2MFIA 1PH3A 3OMCA 4RGMA 4JI5L 2D5GA 1PH1A 2M8SA 3UGBB 1F52A 5CR3A 4B0EA 2G9HD 3D4RA 3J80L 4A93B 2GRIA 4NP5A 2GBJA 2E3TA 3AE3B 1KDAA 5ELNA 4N59A 3AE1B 1TT2A 2KDMA 3Q6SA 1WXMA 2LFNA 1IZ6A 3IAYA 3TN2A 2EXZA 2CS4A 2HCCA 4PQXA 2R2OA 2KQ4X 4KHZA 1DZ1A 1SBBB 2VZAA 3MXUA 1VQEA 2KZRA 1HH2P 3Q0AA 1RF2D 1CZPA 5HFYA 1H9JA 2NN6I 2RSUA 3AEEB 3QG1A 1V9PA 2EKIA 1R4MI 3HKSA 3UDIA 3DWPA 3PIP3 2DUDA 2MA9B 1E7VA 3GE3C 2GBRA 2IT1A 1L6UA 1K73C 4A3CH 1G6JA 2RSNA 4DAYA 2NB0A 4C56C 3HP3A 3RN5A 4DR6Q 1QE6A 3KK7A 3U9SA 1OTRB 1TKGA 4WQOB 3VUWA 3A8IE 4DR5L 2E76C 5I9PA 3AE6B 1Q5WB 1HA5A 1S3OA 4L2YA 3UQAA 1LT6D 4LUZA 2KC1A 4MEMA 2R6GA 4BA2I 2WB1B 5K36G 4DK3C 1H9SA 2I5MX 1IBLL 1MG8A 1QOAA 2Y5CA 2F3IA 2OJWA 4ARCA 3ECIA 4HROA 2N1WA 4TSSA 1WX9A 5M5XH 2D2QA 1B8AA 2F4VL 4NB3A 5DNFA 3WOEA 1UZXB 4C4VB 1Q1EA 2CW0C 1LXDA 1Q1BA 2ZPNA 2NBFA 1B53A 4A3BH 3A4SC 2PQAA 4DWFA 2W3SA 2RDFA 1PDQA 2R7ZG 4IOIE 3M9BA 4QAYA 3K8AA 3CPWA 1X3EA 3G7LA 5FLXc 3GTOH 3M7NA 3IG3A 3L0WB 3RNBC 3R7QA 2MP2B 1D5MC 1OXSC 1CUKA 3MHZA 2DN8A 2AL3A 4GLAC 1WFQA 3H7PB 3IBEA 1K9MC 1MHWC 2J7ZA 3I72A 3T56B 3A1QA 4RMFA 2QDFA 3H09A 2PYKA 2B63B 3RN9C 1XEEA 5C5MA 1A0IA 1HTLD 1YJIA 2MRPA 2OJRA 1Z7TA 3L2PA 2PO4A 1PH2A 5KYIA 3DEOA 4QCLA 3HHMA 4FF1A 5CBEE 1U5KA 5ELBA 1T3QA 2RQXA 2C5LC 1TWCB 4FJYA 1UE6A 4CJ2C 5M5WH 1SNOA 1YD8U 3GB1A 2KANA 3WAPA 3D4DA 4JI1Q 3ZXVA 4ZKBB 1XTCD 1Q3LA 3TQYA 2WXJA 3TBLD 1GUTA 4FF4A 1VD2A 2KO3A 1TWAB 4C3IG 3N6RA 3KFUA 2L15A 5CX3A 3JAME 3HKZB 4DAMA 3I63C 4YHHL 1YNND 3W9CB 3Q3JA 2WU5B 2LGSA 3ZUNA 4DHZE 3SK6A 5LL6S 2CH4A 1FD7D 4RAUC 3NBIA 2JA8B 3FILA 4KZ0A 2DNEA 4F7XA 3JAMi 4QF4A 1EYGA 3NBHB 4JI8Q 1K0SA 5D7GA 1CKOA 1Q1OA 1QKZA 1B2TA 1N63A 4G11A 4AJWA 2X6GA 3M7GA 3S1NH 4FN2A 5LMNL 4KY5A 4A4IA 3K81C 3A33B 3H6NA 2OCEA 2E2IB 4A3FG 4K6DA 3QA8A 1OO9B 4XYCA 2N9PC 4C3HH 2WIIB 3KJPA 4TUUA 1D8LA 2NN6G 2KQ3A 2YV5A 3VYSA 4LDTB 1SGHA 2R3ZA 4PZ6A 4JPBW 4IPGA 2K1BA 3T16A 4GDLA 1E1OA 3HOZH 3M4YA 2FCQA 3HUIA 2ZT9C 3DBSA 4ZHPA 3EVQA 4M02A 5JEAH 3DM1A 1R9TB 1XJVA 4HJ9A 1A3VA 4DA2A 1RTNA 2L3ZA 1LTRD 3NTKA 2Z6KC 4JI5Q 4W9GA 1I6HB 1E1TA 4JV5L 3MHBA 3RULA 1PYSB 3I91A 3DHIC 1RODA 3MFGA 3Q3NC 2B2YA 3PRMB 4GIVA 1NTGA 2WAQG 4AYBE 5ISRA 1LGRA 4C80A 4RM8A 1Y8NB 5CMDA 4OO1H 1A62A 1LACA 2IHFA 3PO2B 2G1EA 3HRZC 5FO8B 4BXXG 2MH7A 4K3BA 1CFMA 2DY7A 4A3OA 2A69D 4G7HC 4BZAA 2Z1CA 3H94A 4BY1G 4PZ7A 1NE3A 3GTJB 1V8CA 5FJ8G 1PDXA 4JI6L 3L4PA 1JWMD 2Q2IA 1Q8KA 3HOWH 1J6QA 4G57A 1X6OA 2TSSA 5E3FA 4XC2A 3NZSA 1RRBA 1B3AA 3SHLA 2AEHA 1FJGL 4CBVA 3QOJA 3I90A 2E2DC 1D5XC 4YIJA 1L7YA 4K5VA 3NE5B 4A3PA 1F9PA 1SFOH 1GHJA 4DR5Q 1BF4A 4DR1L 1Y1VH 4M01A 4TQUS 3AMZA 5IKCM 1CKNA 1IBLQ 3A9JB 4LNKA 1Z6HA 4POGA 2JA9A 1HZ6A 2WP9B 5DM73 4IWPA 2WXHA 1QOGA 2F4VQ 2YU9B 3ZJYC 4L6TB 4WJOA 1FXTB 3QJZA 2K5WA 1HPCA 1SYEA 1OQRA 3I4NH 3L9AX 1PH4A 2K75A 3CHBD 2JA7G 4DU9A 3NTIA 5IYBH 2E2JB 2EYJA 1IPGA 1WWTA 1XPRA 3Q6BA 3FKIG 4KSKC 3NENA 4GDKB 2V3NA 4KJOA 2GN5A 4A3GB 1LTLA 2KWDA 5D2MB 4P16A 2A6HD 5FOBB 4LNFA 1JROA 4GKKL 2SDFA 1ESRA 4MTNA 4KLKA 3I4MG 5NUCA 1I4RA 3V6CB 4A3MB 5CBAE 2UXBL 3V60A 1IKMA 1LTGD 1F9QA 1B4OA 3N1YC 3W5VB 2RVLA 1O80A 1UBIA 1JB7A 1VCBA 4KV2A 5IGEA 1X3FA 2WKDA 3S2HB 4RG1A 2VUMB 4CDDC 3ZJVA 2WV6D 2IPKD 2IWHA 3AU5A 4FHJA 1FL0A 1YNXA 1SSNA 1ENCA 2K14A 1AFPA 1H9RA 5KEEA 1AN8A 1JALA 4LK0M 1ZPSA 4A55A 2B2UA 3P63A 1J7BA 2ZJPA 2QC8A 2K4KA 4TV3A 3FDTA 5FR3A 2JA5G 4B95A 4RKLA 1MJEA 1SNCA 2BYTA 2ZEQA 4G3XB 1S72A 4R4IA 5AZHA 1KC8C 3PT2B 4DR3L 2ACZB 3GQBA 4YHHQ 2MX2A 3SDLC 1YEZA 1HZ9A 3A7AB 2KCNA 2XWJB 2JZPA 3T13A 2NVUI 4DAYB 2O6VD 3Q23A 2REXA 3GD7A 2AWOA 3S1MB 4W9CA 3J7A5 2VB2X 3F1ZA 4J1MA 2B3AA 4DV2Q 3FAHA 1KRSA 2CKZB 3KVFB 3A74A 5LMNQ 3FC4A 2HDLA 3P42A 2KHSA 4A3DH 3QOLA 2WAQB 3QWNA 2OEDA 3PV1A 4S17A 3VQIA 2EQSA 1WTRA 3HOXB 2YYZA 4C2MB 1JOKA 1H9SB 4OELB 1YQ3B 3E6ZX 2JP1A 1XMOL 1JCKB 1TS4A 4HXDA 5I9OA 2F3WA 4BY1B 2AMCB 2KYWA 4M8NA 2DGYA 4V0BA 1SNQA 3MC0B 3K9PB 3BZCA 4IPHA 4HCNB 4A6QA 1FFUA 5IE8A 5IYDH 5FO9B 1WE6A 2PQAB 4DV6Q 1J5EL 4RH6A 1V1PB 2K5DA 2O2LD 4ZQ3A 1GVPA 1PH8A 1XD3B 4RCNA 2L1BA 1CMXB 1BCPB 4JV5Q 4WAFA 4CDEC 2EYFA 1VDVA 2N0SB 2LS01 4C3JH 3RFZB 2EJGC 1GB4A 3GP7A 4IUUA 3Q3OC 4ZYNA 3K80C 2YTYA 2ZXPA 1IYVA 2F0UA 1UEAB 4OVUA 5CHWA 1KHIA 3VUXA 1TY0A 3DCGA 2N4FA 3A1QB 3KUZA 1WJ4A 4DBGA 1SE8A 2PMZE 4I7AA 4JIOU 1LUZA 1D5ZC 1HJPA 1PFMA 3FHWA 3G71A 2OTJA 1A6XA 1SE9A 2OXPA 4P2CB 2WXRA 4JI6Q 1BCPC 4L23A 3Q2AC 3CCJA 2MEKA 1PRTF 3IFWB 1SB3C 3D8GA 3UIPB 1KDCA 2F0PA 2G4DB 5L37A 1XNRL 5DPRA 1WCMB 1B1ZA 4JBWA 4DHZB 4E71A 4EZKA 1UE1A 3NTHA 4LNIA 4ACFA 1DM0B 2I0QA 1EZ6A 1GOZA 3C19A 1FJGQ 3P4PB 1T5XD 2CW0D 3Q3MC 1GUSA 3DBLI 3DM3A 4P6VF 2HTHA 4X64Q 4KVGB 1WI5A 1PZKD 3NQTA 4G7OC 4FHKA 2OQ0A 3RZOB 4FADA 2ZPYA 4PS8A 1I4QA 1VQAA 3A0JA 3EROA 3MFYA 4DR1Q 3EJIA 2KACA 4NPNA 4ASWC 4F88A 4OGQC 5IP7G 1LTBD 3QARA 3M85A 4HN7A 5H8YE 3FILB 3APCA 2VRRB 4A3EH 4JYAL 1ET9A 4DNRB 5A2QE 2KD0A 1E90A 5E6JA 4EGVA 1TKEA 1LTID 4BKTA 2GBKA 2INPE 2F4IA 4EVOA 4RM9A 1IL8A 4DFAA 1PRTB 4GLSC 3HZXA 4GLVB 3GDEA 1WI0A 2DENB 5KNCA 1VQFA 1LYLA 5KGUA 1L4DB 2R93H 3UE0A 3M4PA 3WCQA 3CCVA 4P1CC 2N7DA 4GDLB 3SFDB 3M3YB 1EY5A 5C4JH 3CMEA 4GKKQ 2B8GA 5FR6A 2W3RA 3OIPA 1T0SC 1UH6A 2H88B 2UXBQ 3TEZA 4XDDA 3HOUH 1ZXIA 1HQRD 4AYBB 2WLBA 4UP7A 2MGSA 1PRTC 2R92B 4HTHA 1EU3A 4A3JH 1X32A 3RNGC 3NVWA 4LTUA 3K58A 2MHVA 1K52A 2A73B 2K39A 4F7ZA 2EIFA 1B9NA 1E8YA 3RI7C 4OIJA 3PVLA 3P2BA 4CHKA 3FPPA 3HOYG 3CQZH 5IAAC 1WXSA 2K8HA 2LD9A 2A68C 2BH2A 1H95A 1ASZA 4YWLA 5E6PA 1PTOB 3CRLC 2N8NA 2K8CA 4DR3Q 3PPAA 2NVYH 3SEBA 3N30A 4IFDH 2K6DB 2HT1A 2KN4A 1K8AC 2B2YC 3D31A 3CP0A 1G91A 1STNA 3B6YA 1NENB 2IGGA 3GO5A 3ZTDA 4WJWA 1DJRD 1VLBA 3CPFA 2Q2TA 2F0EA 4FF3A 3J7AF 4DGZA 1BUIC 1PTOC 1N32L 2HD5B 1EY8A 1YIWA 5BMGA 3PQIA 3FVQA 4Y52H 4PMCA 1JICA 4LDTD 1K0RA 3AM9A 1CKNB 1DOYA 1I35A 2F0GA 2C5CA 3AU4A 2NCNA 3T3NA 1XMOQ 3MP9A 2WWZA 2JVCA 2G3QB 1I3QB 3I4LA 5LMNW 2JSOA 1G6ZA 4AQYL 1HE8A 2AUKA 3BK2A 2BQQA 1C4AA 4N6EB 1B9RA 3PIOA 2A4ZA 1PYWD 2K6QA 1PGXA 4CJ1B 4NJCA 1TJEA 1FMAD 1N33L 2L0TA 4MM3A 2PE9A 4YTMB 1KRTA 1I50H 1WTHA 2NYZD 3AE8B 4FXGC 4FXKC 4DV1L 2QSDA 5K5PA 4JC0A 3RNAC 4C7ZA 2KMAA 4NZLB 1EIGA 1W2BA 2BH8A 3H3VH 4JI3L 1RJTA 2H89B 3TDQA 3FKIH 2E2HH 3O13A 1QVCA 2AL6A 3V62A 2TMPA 4KD4A 3BG3A 4RF0A 5J18A 3DBHI 4GKJL 1S1QB 3K7AB 1VQ4A 1YBYA 1DOMA 1JWUD 2RCFA 3F2UA 4QQBX 1WGKA 4KKSA 2HUGA 3TP7A 1XNRQ 3UIOB 1XXGA 2I46A 3HIZA 2HHHQ 1WJUA 1DYQA 1RYJA 4R9WA 2ASBA 1DD2A 3PHWB 1BNZA 3ML8A 1O7ZA 2ICIA 2K05A 4BS9A 2BKFA 1VMPA 2WXGA 1U4AA 1NJIC 1SIJA 1E2ZA 1JE4A 1D1IA 1EOVA 3J7YW 1C1YB 4DV7L 1ZP0B 1RD9D 3GS2A 3ALBA 3VUYA 3WDNA 4LF8L 5BMHA 2EKEC 2FJ2A 4R4TA 5CGKA 3GTMH 2MP1A 1YNNC 3RNEC 4JYAQ 4Q5VA 3U8ZA 3EN2A 3N1XC 2B2UC 2DY8A 3GTGH 1TWFB 5IODA 1BUVT 1L1OA 3IAM1 1TWHH 2F0WA 4OXPA 2BW2A 2YEPF 3B1LX 3HK0A 4GGQA 2PW5A 1LO5D 1M1KC 2ZXOA 2IO2B 2K32A 2EY2A 1ENAA 1KH0A 4KY7A 5IYCH 3CC2A 2BS4B 3I57A 1YHBA 4WRDA 3G4SA 3QR8A 3EFXD 3EFCA 2E6XA 2DAJA 3RYTA 4PMWA 1H4RA 4AS1A 3CC7A 2W9NA 1XPUA 3DPDA 1YN4A 1PFBA 3MA2B 2MO0A 4HIKA 1WD1A 2JA6H 4B3TL 2DWQA 1KXLA 2PI2A 1SF0A 1UEBA 2NUCA 3W5OA 2K25A 1CA6A 3J81E 1N6ZA 4W9LA 1DCZA 4ZOHC 3MXGA 2FAZA 1TU2B 1WR1A 2WXPA 4J8QA 2ZJRA 1TKWB 5IN7A 5DEHA 2K50A 2F0QA 3G6JB 5G3LD 3C1EA 3J81i 4GOPB 3PO3H 1XMQL 4XIGS 3S1RH 1WTXA 2UUCL 4BVUC 4HPMB 1TKYA 3TL5A 4ITKA 4HMIA 4A76A 1L6VA 2MSED 1FO4A 4QJFA 3MXNA 4HJ7A 1OXVA 3EBEA 2KWVB 4K5XA 1JWAD 3SHQA 2WDVB 2Z6KA 2SEBD 4GOPC 2VZKD 1VDZA 1IGCA 4K2KA 1GG3A 4LNNA 3GTLH 3N32A 4RGNA 3PTFC 4TMAB 4MH0E 2MJ8A 1E7PB 2Y5BB 5C4XG 1EZ8A 2J4XA 1N32Q 3MJWA 3QCAA 4J15A 3Q8CA 4BAXA 3S24A 1HZ5A 1V9JA 4B6WA 4GXBA 1IBXA 3FEWX 2A1AA 5JPMC 2UXCL 2LY7A 3UDFA 5HURA 4XZ4A 1B9MA 1HUMA 4WWPA 1WVLA 3TUOA 2A6EC 4OZCA 4IURA 3TZUA 2V1CC 2VQFL 4AQYQ 3K5NA 2AYOB 2K9XA 1JWBD 1ET6A 2B39A 5IP7H 1MVKA 2WXQA 2EYMA 1KIXA 1Q90A 4A3LG 1K28A 1J8CA 4PT5A 1XNQL 3D6CA 3N1ZC 2KWCA 4W9KA 1N33Q 2WB1G 4A9AA 1IHZA 5JVH3 1BCPD 5DLQE 4ZRZA 2J53A 3VAWA 4RHRA 3IFDA 4JBMA 2M17A 4DV1Q 1WJNA 2NS5A 4LF5L 3LJ3A 1IUEA 1A5RA 1FVIA 4B08A 1WXVA 1KLUD 5IWAL 4JI3Q 1GUWA 2A6HC 4LF7L 3VRAB 1Y1WH 4BWGB 5M5XB 3KBXA 1I4GA 3E5SA 2R61A 4DR2L 4GKJQ 3KYHC 3CCLA 2PPBC 3HS0C 2GBMA 2KWUB 4A3BB 3QQ8B 1QZHA 1K8GA 2NVTH 2EYLA 1TR5A 2F3VA 1EL0A 4EFOA 1MSHA 1STAA 3RZDB 4YWGG 1S4ZA 4LK1C 3UE1A 1N36L 2ZNVB 1LT5D 4X62L 5M3FH 5E6NA 1NSNS 4ZKCB 3TMEA 5H1SE 1WF9A 2QCPX 1R7SA 3M62B 3U4VA 3K7UC 1MKHA 2D62A 2L5TA 2PW9A 2WFWA 2ENBA 3Q3FA 1FCCC 3H0GH 4LJZC 1VF7A 2QEXA 4WJ3M 1EM7A 3RPFC 3HOYH 3G6EA 4DV7Q 3M4OH 3NVZA 3AEAB 4PNYA 3O65B 2NZOA 4LF8Q 3NHHA 2AHOB 3DWAA 2MWSB 2KQ7A 5C1ZA 2ZNVC 4GDKA 3RUZA 3S2DB 2OHFA 2ZCBA 3BZDB 2KECA 4YWMA 3RZFA 1EEFD 2CU1A 3V61A 3Q8EA 1L0XB 2Z0EB 5M5WB 1HEZE 1I4HA 4P72A 4XQQA 4ARIA 3HKZG 5J3BA 4KDLB 1C8CA 4BBRH 4HJAA 4HIMA 3ZQ4A 2XSCA 4ZHOA 2JA8G 4II2B 2N78A 4XDCA 4HLEA 1F1HA 2NVQH 4YWKA 2Y0SE 1QNKA 4EZJA 5GQOA 2QDBA 4G50A 1WGHA 1IBML 2C35B 1GUAB 2A68D 2N55A 2D9UA 3W2DA 5KNBA 3AMUA 1EFWA 1TIFA 1WMHA 2VS1A 4B3TQ 2WS3B 1WSPA 3ZXRA 3PMFA 5GAEC 4GN4B 4R8NA 4RGTA 1DOIA 4MM3B 4AWJA 4BKGA 3S1NB 1V5TA 2JX5A 2CVRA 1E7ZA 3ZTCA 5C4XB 2UUAL 3I4OA 3K9OB 4JQWC 5AJ3L 4FULA 4OWXB 2J0MA 2F0DA 4UAIA 2KFJA 1XMQQ 1CKMA 1KAAA 2KTRB 3DBHB 2Q2HA 1GC7A 5EAYA 1ENFA 2I5LX 3HOZB 1PTOD 3EC8A 4HDQA 5DCNA 1HZAA 2VB3X 2EYPA 1UE5A 3P20A 1GUGA 2MCNB 1W6JA 2V9HA 3Q14C 1JOQA 4WJQA 1WIAA 1SAPA 5FK9C 3U7ZA 1C9FA 1YJ9A 4HCEA 1KDBA 1FXAA 3HVDA 1K83H 2K33A 2M9VA 1O7IA 2LGXA 2Z59B 3PO2G 4N9F4 3RNCC 2N9LA 4C7YA 1IGDA 1KLVA 1UWMA 1K8RB 1BBWA 1D4BA 1DXMA 2PVOD 4O2DA 4B3SL 5JPNC 4K6LA 5D94A 3WIMA 3ZGZA 1WM3A 3SD5A 5J22A 1R4NB 3TSSA 1V1PA 1EUJA 3WANA 5C0XH 1SNDA 5IGCA 4NPSA 2UXCQ 1VS0A 5C44H 2VQFQ 1M4VA 1IBKL 3HOWB 1TS2A 3SK8A 1VQPA 5J1ZA 4ZRPA 2I1KA 4LAAA 2KJHB 1L1OB 1A3TA 1QQRA 1XWEA 2V4LA 1IKLA 2WACA 1NUCA 1XNQQ 2LASA 3NQIA 5AFWA 2FUHB 2WNMA 2LRUA 2I07B 4W9FA 1GHKA 3BZKA 1SFOB 2EY6A 4MNOA 4LF5Q 4ICUA 1AE3A 2HTME 3KWLA 1I94L 4IUQA 3VR3A 2BDOA 5IWAQ 4BY7H 1L1OC 3A7LA 5ELOA 4LF7Q 3GTPH 3H9DA 2OEOA 2N9XA 2IL8A 3HM6X 1K50A 2KHJA 4K7WA 1Z9FA 2K6AA 3E9IA 2Z0SA 1L2FA 3FMCA 4DR2Q 4A3GG 3IHPC 4HJ8A 4OZAA 3MZ5A 3I4NB 3F2CA 4FA6A 1JMLA 3WAMA 2BF8B 1CZWA 2C7MB 3K57A 3BVMA 4A3MG 4ICVA 3PGEA 1SE2A 1N36Q 4X62Q 2L4NA 3AEVA 3J80c 3ZNGC 5CV7A 4FO2A 4XTCS 3LNNA 4A3KH 4JI4L 1WM2A 2BYVE 3P7JA 2VUMG 3DVGX 4LFCL 3MXNB 4JW0A 1MFWA 4G4KA 1CSPA 3PV0A 2NWGA 5BYQA 2R7FA 3BVGA 4V190 1HRJA 3DHHC 2L12A 2PQEA 3W1YA 3AQQA 1EWHA 3KLSA 4A93H 1WH3A 5ELDA 4HKQA 1RTOA 1VQHA 1UGMA 3SXHA 3VYTA 1FRRA 1MI2A 2EE1A 3W1BA 3PIO3 4L8JA 2Y5PA 3T3OA 4JVZA 2WYQA 4KGSA 1SEBD 1STYA 3GV3A 2KDEB 1GB1A 1IXRA 3A55A 1PH9A 2OQKA 1NVID 4LF9L 2DYOA 2G45B 2PIAA 2QCZA 3EFUA 3ICEA 3CSFA 5KHQA 1IBXB 1SR3A 3A56A 1DONA 2CWPA 3B2GA 1Y8PB 4A90A 3F2BA 4GN5A 4YCVA 1NCVA 2RF4A 1IBMQ 1WJ6A 3QIJA 1D3ZA 4L1BA 3ND8A 4P71A 4X66L 4IPDA 1YJ1A 2K28A 3OLMD 5IP9H 1E8XA 3Q69A 5AUIA 3VTWA 3HOXG 2RBMA 1OFFA 3DHQA 4NXNL 2NZHA 2K8BA 2NPTA 1VRAB 1ZUD2 4GN1A 4BKSA 4CDFC 1ZXHA 1L0VB 4DDGD 2O4XA 5M3MH 3U4ZA 4PZ8A 2UUAQ 4A3DB 1P0RA 2LGIA 1Y14B 2IJ0A 5AJ3Q 3S14H 3MWYW 3IRBA 4JI7L 2CKHB 2JWUA 3JYUA 3TEWA 1V49A 4E74A 1WXAA 2Q8TA 4BOZB 1QWYA 2JY6A 4CKEA 1ZDVA 4M8AA 3BINA 4ZYSA 2C60A 2D3CA 4N9TA 2INDC 4BBSH 1AE2A 4NXML 1P9DU 1UAPA 1U9RA 4XWWA 1DOKA 3OOCA 3TCAA 3CCMA
chains in the Genus database with same CATH topology
1C4CA 2F0FA 2A6ED 4ZLTF 1WXQA 2B2VA 4K8IA 3AN1A 5HGTA 2BB5A 4C3JB 3SR1A 3DEPA 4H0LC 3VR8B 1S5FD 1CT1D 3OWEB 5KIXA 5G3LF 1XLQA 1EWCA 3I3CA 1MD2D 1MHHE 4R3DA 4RGOS 1SXTA 4DQOC 3P75A 4OHJA 2PW7A 4DXGA 4HJGE 2Y0SB 1RM6C 1U4PA 2Z4HA 4TKOB 5EPJA 3V05A 3NP8A 4HAEA 3ZJTA 1JW9D 1IW7D 1VJKA 4NKLA 3VYUA 4XWTA 4YSZB 2LHDA 1JQYD 1NR2A 5MPOA 2LMCA 3L7ZC 1JRPA 1SYFA 4A3EB 4XQNA 1V8QA 1CI3M 1D2BA 3TP8A 1QILA 1V1OA 1BCPF 2R93B 2N7JA 2VZKB 4Q0FA 1QNUA 3OMGA 1FCLA 5COYA 3AE9B 3NPPA 4DAPA 3WOFA 1N5WA 1E2VA 1F2RC 1PZID 5FLXE 2J0TD 2J42A 5I6WA 2F0IA 2SAKA 5IT9L 3W1SA 1HHVA 2KEDA 5E4WC 5K36H 1II3A 2AX5A 1Q8IA 3I8ZA 4ID6A 4HR7B 4PMBA 1WTPA 4KI0A 2PCFB 3AU7A 3LYYA 4OW0A 1XLNA 1KABA 3W3AA 1XO3A 2Q8RE 2NVYB 1JB3A 3LX0A 1RCVD 5IOCA 2IX0A 3C46A 1T5EA 4KJNA 4U68A 4RF1A 2EDGA 3CKIB 2XRQD 2DBYA 4AQ7A 3ONAB 1PZJD 1A3UA 4IALA 3J80E 3AEFB 3DWQA 1EY0A 5C3EB 1CK1A 1C76A 2M00A 4JWUC 4YSYB 2K7VA 4J6HA 5D3IB 1E2WA 3R8BA 1K8OA 1LT4D 2XNAC 1SNPA 1HA6A 3VR5A 4RCOA 2SOBA 1NAPA 2DYMA 1VMCA 1MPEA 3VR2A 1K53A 2BCOA 1YMHE 2E2HB 1BQQT 2BA1A 1N5XA 3QJYA 5E1FA 2W82A 1FR3A 5E4XA 5BMIA 1PTOF 2BE5C 2WXMA 3V2TA 1ROEA 1SNMA 4OIKA 2AQ3B 3H3VC 3W5UB 2NN6H 2WKCA 2WDQB 4JK1C 2INNE 2EJMA 2IW3A 5ELEA 1P7FA 3CIRB 4HEA1 3PUZA 1PGAA 1FEHA 1V43A 2W55A 3CU7A 2F1MA 1HFNA 4KGTA 4DK0A 3GTGB 3AECB 1TWHB 1E0BA 3EUB2 3TP6A 1O78A 1QOHA 2KUMA 4D2KA 1Y8OB 5JOBA 3IT4B 1HFGA 2BB6A 2L9HA 3NS1A 4MT5A 1C48A 2PZWA 5BYRA 4IUPA 3PUXA 2RA4A 2JA6B 2PNRC 4N9PA 2QKIC 5I2YA 4NDXA 3VYRA 1K51A 5BYSA 3T51B 1EWYC 2N88A 4MH8A 2F03A 2V4IB 4RHSA 4F8MA 5T1GA 5I4DA 3U4EG 2Z4IA 1BDOA 1CM9A 3PO3B 2EY5A 1EU4A 1STHA 3K5OA 4KGRA 4YT0B 1F9RA 1ACCA 5TSSA 2B2VC 2WXIA 3LWEA 2K5PA 2MJ3A 5JVG3 1WYGA 2F0MA 2PZUA 4ABNA 3GTLB 2BS3B 2B2WA 4XYQA 4Q2JA 1UUPA 4A3IB 2I2YA 4WFN3 5LNK1 2JEBI 3JAML 5C3WA 2LKVA 4QMGA 2LMCB 3S1QB 2CJOA 2CJNA 3CRKC 2LEKA 1JWSD 5EGTA 2G9DA 4U673 5EE0A 2AQ2B 1EIHA 4WQMA 1W6KA 3RLFA 1C79A 1JORA 1Z47A 2HCIA 3D4WA 3OW7A 4H13C 4DN4M 3OIQA 4JE3B 4OO1I 3NUHB 3KLRA 4M1UB 4DXFA 3AEBB 4KD3A 3DWMA 1R4PB 3Q8FA 2V3PA 1B44D 3FRPB 5FO7B 2EELA 1S5DD 1GUOA 2H1EA 2BOSA 2NVTB 5HI1A 1SE4A 3N52A 1LTAD 5G5GA 1IYUA 4R8IA 5JEAJ 4K14A 4REZA 2IGHA 2JEAI 2KOLA 4K2LA 2PMZB 1EOTA 1STGA 3H0GB 3ETRA 3W5VB 5D65A 3M4OB 2L52A 1Y56A 4KKIA 4RKBA 2NZ1D 1G2TA 3HOVB 2X6LA 2CQAA 1SSOA 4JX1C 3NSWA 2Y3AA 3GV6A 1ZXTA 4HRSA 1I4PA 3R2TA 1PGBA 2HQEA 2NVQB 1E10A 5EJWA 5C3XA 2PVGC 1XX8A 2QF7A 3Q8AA 4O1NA 1QLBB 1SE3A 2KAJA 4C3HG 3D3RA 3AE7B 5G5HA 4CGYB 2OT2A 1EY7A 1BR9A 5JEAG 1LV9A 2GI9A 3ZYYX 3I9V1 1FXIA 1GXDC 2K03A 1FNUA 1GJXA 2F0TA 3IAS1 3B9JA 5JXVA 1ILPA 3V3XA 2FE8A 3BDLA 3P4RB 4OO1G 4KTAA 2MJDA 2PLPA 1X3PA 1KNEA 3A54A 3NWTA 4C1NK 3AE5B 1CQVA 4H7BA 4OVZA 3SVMA 5AUKA 1IW7C 1SYBA 2FINB 1N61A 1STEA 2O5JC 4QB4A 4F87A 1GUNA 5C44B 3PUYA 3GTOB 3SR6A 5CC4A 1T6BX 1MHXA 2BT6A 3VR9B 3BDOA 1F2ZA 3E0JA 3R2IA 2FMMA 1PUTA 5J39A 4KV6A 2BE5D 4XE0A 2MPMA 2ZW1A 3D6WA 2N9KA 1OXTA 1CJEA 5JAVA 2F0KA 1TZOA 1YJJA 3J9CA 3MVVA 4C1NI 1WTQA 2A74C 1O7YA 2OF1A 1F2LA 2BA0A 2DLBA 3T53B 3BWUD 4IQZA 2B2TA 4FXDA 4CJ0B 1EQVA 2M2LA 2KCCA 5BN5A 1QOBA 3NWSA 3E9SA 3TZDA 2ON8A 4UDUC 4EQPA 3I73A 1Y69U 2QJLA 3BIID 1H9KA 3MAQA 2EZVA 3DXJC 2WP8J 4A3KB 3UI3A 4TRDA 1EYCA 2LJIA 4FXCA 3S9WA 3EQLC 2EVBA 1TVXA 4C3HB 1FD6A 3PUVA 1MBYA 1Q12A 3PZ8A 1PLFA 1XLOA 4MIUA 1F2RI 4NW2A 1XLPA 4IUVA 5CV8A 1RWSA 3H6MA 1BMLC 3VA5A 2KA7A 3IXSA 1G2SA 2KMMA 5EBDA 3SFEB 3ZJUA 3R93A 3BDCA 2EYHA 5EQ0A 1X3QA 2JYEA 4HKZE 2B2WC 5A2QL 2NMQA 5HG2A 1DOLA 3P4SB 1PMRA 3NVVA 5T8IA 3KUPA 1HCZA 5EE3A 3UI2A 4KY6A 5M3MB 1E9MA 4QUFA 3S14B 2EYOA 4B0MA 3DMUA 3TP5A 4IFDI 1G291 4BBSB 1XF5L 1F0ZA 3SK5A 4C3JG 5CORA 1E6EB 3NZ3A 4RFBA 1Y1VB 1A15A 3HVZA 4HMJA 1TIID 2JU6X 2M0AA 2AQ1B 1RKNA 1EY6A 2H4OA 3LWUA 1NI3A 4LLGM 1HXYD 4CKCA 2VNUD 2XN9C 1ZYRC 3PUWA 1WRIA 3OHXC 3AB5A 3AB9A 4QIWB 1LABA 4TQ1A 3VR6A 4X3SA 4IUNA 2NTSA 1QT9A 2RDHA 4EQNA 1I6VC 2JYOA 3IL8A 2MJEA 2ZW0A 4TQ0A 1FFVA 1YN5A 4IZ8A 3HG9A 1KNAA 2W54A 1FM0D 3L3OC 1SJHD 2JE6I 5C6AA 3K5LA 3C3LA 5HHDG 3TEXA 4IFDJ 1YQ4B 4H2AA 2F0LA 4XYOA 2K04A 2EPBA 2Q5WD 2K3UA 4XT3B 1VCIA 1J7CA 1ZDXA 3S17B 1A70A 3NXWA 1MSGA 3AH7A 3C8YA 2FUG1 4YTPB 3HRDD 3NK9A 2WDRB 2IX3A 1XCQL 3LB8C 3TBIB 1WTOA 5CV9A 1SMYD 3AEGB 2D5DA 1VZ6A 4MHEA 1EFID 3KLSX 5H92C 1TQOA 1PFNA 3KF8A 3P1HA 1BBXC 5LHY1 1NEKB 3S15B 4CKBA 1FNWA 2M56B 4IDIA 1J7AA 5CV4A 3X3NA 5KNDA 4FP5D 1ZOYB 2LUMA 4IFDG 1RHPA 1C4QA 2XWBB 1F9SA 4ZUJA 1D6EC 2BBCA 1S5CD 2B76B 5I6YA 2CU3A 4WORA 1U4LA 3K59A 2C9OA 1YNJC 1QG7A 2R7ZB 2RMMA 1WTWA 1SDFA 5T1IA 1TY2A 5IIFA 1NYQA 1N62A 2IX1A 2FBWB 4OL7A 1XCTL 3QO2A 2K0PA 4I65A 4JWSC 2SNMA 2JYTA 2BDNA 4NMZA 1O7LA 3DUZA 2FFKB 4ME5A 3AV8A 3J81L 3OPOA 2A5HA 2XIWA 4L63B 3EGRA 1EY9A 4G7ZC 4US9A 5IGFA 3C2PA 3FPUB 4C3IB 4FYDA 2B2TC 5DM63 4HCSA 4QUCA 3MEHA 2JSVX 5DAUA 1DOXA 1BOSA 1SYGA 2IGDA 3U52E 1EYAA 2XVSA 3KQ4A 1RDPD 4USAA 5BN4A 4N58A 2SNSA 1QCBD 5C3JB 4A3FB 5C4JB 4ZAIA 2X38A 4WH4A 3SE0A 3HOUB 2WU2B 1TS3A 2RDGA 2LFIA 3HEJA 4O42A 1A2UA 3P1MA 4A3JB 2NVXB 3EA6A 1NYRA 4XDXA 4EQOA 2WINB 3A8JE 4JPSA 1F2YA 3IT6B 3CQZB 1ICWA 3PZ7A 4WWMA 2PKOA 3VA7A 1R4QB 4LMQD 2LHEA 2CHBD 3MTSA 2BTEA 3SK4A 2HDEA 1CHQD 2O5IC 4X3TA 2JQRB 1I4XA 3PO0A 2PTLA 4DNTB 3B2FA 2F0SA 1V97A 2K5QA 5D14A 1E0ZA 1VR9A 3CWIA 2E75C 5IGGA 1PXUA 4M0WA 1LTSD 2XRSD 1HQMC 4KKUA 1C77A 1STBA 4HSVA 3BYYB 1GAQB 4KN7C 3P4QB 1CHPD 4ULLA 5ELCA 1I50B 1FRDA 3NVYA 4KK7A 4H44C 4X3UA 1ZE3D 4B9XA 2JXMB 1OXXK 1AYFA 3X3MA 1KLGD 1OXUA 2JA7B 1WTVA 5CV6A 4Y7NB 3FKIB 4RA8A 1KF6B 2QEJC 3SDZA 1HUNA 3VR4A 2ZXRA 4KKTA 3I4MB 4A8XC 1L4ZB 2J52A 1UWXA 2WXLA 2L0CA 1S5BD 2F0HA 4IN3A 2L1AA 5EKLA 1SYCA 3BS1A 1ZYRD 4EE2A 1ESFA 4I7ZC 4CHTB 1L5PA 2JXTA 4XT1B 1C4PA 3RMHA 3K6OA 3GTMB 2JA5B 5CV5A 3OSOA 5C0XI 5F2DA 1SJED 4NAMA 5C5LA 1H9MA 4YXDB 3ABVB 4KN4C 2PMVA 2EY1A 2GA4B 5EPLA 4DF7A 1KTKA 2MUYA 1F2MA 2ICEC 1U4RA 1EEID 1GPXA 1JQ4A 4RNAA 4KMUC 5BN3A 4WURA 5D3DA 4WIPA 3URYA 2L11A 2Z8LA 1C78A 4S3SA 2FHTA 5IGDA 2DNCA 2KJXA 5KYLA 3S1RB 4E6IA 2F0OA 2L83A 4US8A 3ITPA 5C0XJ 1PFDA 3HGBA 2L55A 1FIQA 2GB1A 2X69A 5A35A 4ODGA 3IKJA 1FNVA 4DAVA 3ND9A 2ONQA 1ILQA 1BO0A 2E74C 4HSPA 1K8MA 3Q24A 1RFKA 2AUJD 2NTTA 1ML0D 2WXKA 1D1KA 1AEXA 3BVZA 2L32A 4YTNB 2RPVA 3S16B 1YNJD 1QJOA 1OQQA 5C2TB 4IUTA 4RWSC 3V96A 3N9YC 3I70A 5C4ZA 4FNFA 5IGBA 3C1FA 1KRHA 1HTPA 2AWNA 1FYCA 1S5ED 4NAWB 1G8ZD 5EBCA 3U9OA 5EKIA 1WD0A 5I2XA 5C0XG 1Y1WB 5GXGB 4IKGA 4FF2A 1CQFA 3U2SC 3K0YA 4KX6B 3AE4B 5M9OA 3OWFA 1QF6A 2F0VA 2PZTA 1TYGB 3BYTB 3KWVA 1TWGB 5M3FB 3KBGA 3QIAA 2VXWA 4MN3A 1LTTD 2WXNA 5EE9A 1MI0A 1AW7A 1PTOH 5LL6X 2D2CC 4BA1I 3HOYB 2QIEB 3NUCA 2KVMA 1CTMA 1YNTE 1AZPA 1EY4A 4GZYC 2WQYB 1NR4A 2QILA 4X3KA 4ZUIA 2I38A 1VZ7A 4YSXB 4ILWA 1SMYC 4B9WA 1B50A 1SYDA 3RD4A 4BBRB 2WXOA 2EOTA 2EJFC 4K8JA 4HEDA 1F77A 5EKKA 1LT3D 3J7AV 2YEPB 3NBHA 1L0YB 1BXTA 5EE1A 4KKJA 1A2TA 1FGBD 2A69C 1J8IA 1UGJA 2ID0A 5M5YB 3MJ5A 1AZQA 2V4DA 1EQTA 2QMTA 3IFTA 3AEDB 3R3OA 3NRZA 5EPKA 1AP0A 1ZKOA 4XXEA 2RKSA 4FVMA 3GTKB 1Q10A 4J3OD 2HDMA 3BK1A 1K83B 1KFYB 4OZBA 2K01A 2B8FA 5IT9E 3H91A 1JR0D 3VRBB 1AWDA 1QOFA 1LLRD 1MGSA 5FKAC 5C4HA 3T4AC 3QB3A 5ELFA 1P7EA 1ONLA 3A8KE 3DWGC 2IDYA 1VF5C 5CYUA 1TS5A 2RSOA 2V0GA 4KHVA 1J9OA 5JJZA 1JC7A 1U4MA 4MACA 3H8HA 5FLXL 1ZEQX 1CZGA 4ZK9B 1EYDA 3Q8BA 1M8AA 3TEYA 3LXFA 4BY7B 4Z9CB 1YN3A 3MXPA 2F0JA 5KRUA 2BS2B 3GTPB 4CQNA 2F0NA 4K5WA 3ERQA 4XQJA 2FMCA 2Q8IB 1XYIA 3GTQB 4DK1A 1N60A 1VZ8A 2K22A 1QB5D 2WXFA 4PV1C 1JOOA 3K5MA 3Q22A 2KEEA 2M19A 1UNSA 3E56A 1CA5A 1PRTD 1DGJA 1I7HA 3OMCA 4RGMA 2D5GA 4B0EA 5CR3A 2G9HD 3D4RA 3J80L 4A93B 2GRIA 4NP5A 2E3TA 3AE3B 1KDAA 4N59A 3AE1B 1TT2A 2KDMA 3Q6SA 2LFNA 3IAYA 3TN2A 2EXZA 3AE2B 2HCCA 4PQXA 2KQ4X 4KHZA 1DZ1A 1SBBB 3MXUA 3Q0AA 1RF2D 1CZPA 5HFYA 1H9JA 2NN6I 3AEEB 3QG1A 2EKIA 3DWPA 3PIP3 2IT1A 1L6UA 2RSNA 4DAYA 2NB0A 4C56C 3HP3A 1QE6A 3KK7A 3U9SA 1TKGA 3A8IE 2E76C 5I9PA 3AE6B 1HA5A 4L2YA 1LT6D 2R6GA 4BA2I 2WB1B 5K36G 1QOAA 1H9SA 4ARCA 2Y5CA 4HROA 4TSSA 5DNFA 3WOEA 1Q1EA 2CW0C 1Q1BA 2NBFA 1B53A 2W3SA 2RDFA 1PDQA 4IOIE 3M7NA 3G7LA 1D5MC 1OXSC 3MHZA 2DN8A 2J7ZA 3I72A 3T56B 3H09A 2PYKA 2B63B 1XEEA 5C5MA 1HTLD 1YJIA 1Z7TA 2PO4A 5KYIA 3DEOA 4QCLA 4FF1A 5CBEE 5ELBA 1T3QA 2RQXA 1TWCB 4CJ2C 3GB1A 1SNOA 3D4DA 4ZKBB 1XTCD 1Q3LA 2WXJA 1GUTA 4FF4A 1TWAB 4C3IG 3N6RA 3JAME 3HKZB 3W9CB 1YNND 2WU5B 3SK6A 5LL6S 1FD7D 4RAUC 3NBIA 2JA8B 3FILA 2DNEA 4F7XA 4QF4A 5D7GA 1QKZA 1B2TA 1N63A 2X6GA 3M7GA 4KY5A 2E2IB 4K6DA 1OO9B 2WIIB 2NN6G 2KQ3A 3VYSA 2R3ZA 3T16A 2K1BA 3M4YA 3HUIA 2ZT9C 4ZHPA 3EVQA 5JEAH 3DM1A 1R9TB 1A3VA 4DA2A 1RTNA 1LTRD 3NTKA 1I6HB 3MHBA 3I91A 1RODA 3MFGA 2B2YA 5ISRA 4C80A 1Y8NB 5CMDA 4OO1H 2G1EA 1LACA 3PO2B 2MH7A 4ZRQA 3HRZC 5FO8B 1CFMA 2DY7A 2A69D 4G7HC 2Z1CA 3H94A 3GTJB 1V8CA 3L4PA 1PDXA 1JWMD 4G57A 2TSSA 5E3FA 1B3AA 3SHLA 4CBVA 3QOJA 3I90A 2E2DC 1D5XC 4YIJA 4K5VA 3NE5B 1F9PA 1GHJA 1BF4A 4TQUS 3AMZA 1Z6HA 1HZ6A 2WP9B 5DM73 2WXHA 1QOGA 2YU9B 4L6TB 2K5WA 1HPCA 1SYEA 1OQRA 3L9AX 3CHBD 4DU9A 3NTIA 2E2JB 1WWTA 2EYJA 4GDKB 2V3NA 4KJOA 4A3GB 2KWDA 4P16A 2A6HD 5FOBB 1JROA 2SDFA 1ESRA 5NUCA 1I4RA 4A3MB 5CBAE 1IKMA 1LTGD 1F9QA 1B4OA 2RVLA 1O80A 5IGEA 2WKDA 3S2HB 2VUMB 3ZJVA 2WV6D 2IPKD 2IWHA 1SSNA 1ENCA 1AFPA 1H9RA 5KEEA 1AN8A 1JALA 1ZPSA 4A55A 2B2UA 3P63A 1J7BA 3FDTA 5FR3A 4RKLA 1SNCA 2BYTA 2ACZB 3GQBA 3A7AB 2KCNA 2XWJB 2JZPA 3T13A 3Q23A 3GD7A 2AWOA 3S1MB 2VB2X 4J1MA 3FAHA 3FC4A 2HDLA 3P42A 2KHSA 3QOLA 2WAQB 3QWNA 2OEDA 3VQIA 1WTRA 3HOXB 2YYZA 4C2MB 1JOKA 1H9SB 1YQ3B 3E6ZX 2JP1A 1JCKB 1TS4A 5I9OA 2F3WA 4BY1B 4V0BA 1SNQA 3MC0B 4A6QA 1FFUA 5FO9B 4RH6A 1V1PB 2K5DA 2O2LD 4ZQ3A 4RCNA 2L1BA 1BCPB 4WAFA 2EYFA 1VDVA 2N0SB 2LS01 3RFZB 2EJGC 1GB4A 3GP7A 4IUUA 2ZXPA 1IYVA 2F0UA 1UEAB 1TY0A 1D5ZC 1PFMA 1A6XA 2WXRA 2OXPA 4P2CB 1BCPC 4L23A 2MEKA 1PRTF 1SB3C 3D8GA 1KDCA 2F0PA 1WCMB 1B1ZA 4JBWA 3NTHA 1DM0B 3P4PB 1EZ6A 1GOZA 1T5XD 2CW0D 1GUSA 4P6VF 1PZKD 3NQTA 4G7OC 3RZOB 1I4QA 3EROA 3MFYA 3EJIA 2KACA 4F88A 4OGQC 1LTBD 3M85A 4HN7A 5H8YE 3FILB 1ET9A 4DNRB 5A2QE 5E6JA 4EGVA 1TKEA 1LTID 2INPE 2F4IA 4EVOA 1IL8A 4DFAA 1PRTB 4GLSC 3HZXA 5KNCA 1L4DB 5KGUA 3WCQA 4GDLB 3SFDB 3M3YB 1EY5A 2B8GA 2W3RA 3OIPA 2H88B 3TEZA 4XDDA 1ZXIA 1HQRD 4AYBB 2WLBA 2MGSA 1PRTC 2R92B 4HTHA 1EU3A 1X32A 3NVWA 4LTUA 3K58A 2MHVA 1K52A 2A73B 1B9NA 4OIJA 3FPPA 2A68C 1PTOB 3CRLC 3SEBA 4IFDH 2KN4A 2B2YC 3D31A 1G91A 1STNA 1NENB 2IGGA 3GO5A 4WJWA 1DJRD 1VLBA 3J7AF 2F0EA 4FF3A 4DGZA 1BUIC 1PTOC 1EY8A 5BMGA 3FVQA 4PMCA 1JICA 3AM9A 1DOYA 2F0GA 2C5CA 3T3NA 3MP9A 1I3QB 3I4LA 2JSOA 1G6ZA 3BK2A 1B9RA 2AUKA 1C4AA 4N6EB 1PYWD 1PGXA 4CJ1B 4NJCA 1TJEA 1FMAD 4YTMB 2NYZD 3AE8B 4FXGC 4FXKC 2QSDA 5K5PA 4C7ZA 4NZLB 1EIGA 1RJTA 2H89B 3TDQA 3O13A 2TMPA 4KD4A 3BG3A 4RF0A 3K7AB 1DOMA 1JWUD 3F2UA 1WGKA 4KKSA 2HUGA 3TP7A 1XXGA 2I46A 1DYQA 1RYJA 4R9WA 1DD2A 1BNZA 1O7ZA 2ICIA 2K05A 4BS9A 2WXGA 1VMPA 1SIJA 1E2ZA 1JE4A 1D1IA 3J7YW 1ZP0B 1RD9D 3GS2A 3WDNA 5BMHA 2FJ2A 5CGKA 2MP1A 1YNNC 4Q5VA 2B2UC 2DY8A 1TWFB 5IODA 1BUVT 3IAM1 2BW2A 2F0WA 2YEPF 2PW5A 1LO5D 2ZXOA 2K32A 2EY2A 1ENAA 1KH0A 4KY7A 2BS4B 3I57A 4WRDA 3EFXD 2E6XA 4PMWA 4AS1A 1YN4A 1PFBA 3MA2B 1WD1A 2DWQA 1SF0A 2NUCA 1CA6A 3J81E 1DCZA 4ZOHC 3MXGA 1TU2B 2WXPA 4J8QA 1TKWB 5DEHA 2F0QA 3G6JB 5G3LD 3C1EA 4XIGS 1WTXA 1TKYA 4ITKA 4HMIA 1L6VA 1FO4A 3MXNA 1OXVA 4K5XA 1JWAD 2WDVB 2SEBD 2VZKD 1VDZA 1IGCA 4K2KA 4RGNA 4TMAB 2MJ8A 1E7PB 1EZ8A 2J4XA 3Q8CA 1HZ5A 1IBXA 3FEWX 5JPMC 2LY7A 5HURA 1B9MA 1HUMA 1WVLA 3TUOA 2A6EC 4OZCA 4IURA 3TZUA 2K9XA 3K5NA 1JWBD 1ET6A 2B39A 2WXQA 1MVKA 2EYMA 1Q90A 4PT5A 3D6CA 4A9AA 1IHZA 5JVH3 1BCPD 4ZRZA 2J53A 4RHRA 3IFDA 1IUEA 4B08A 1KLUD 1GUWA 2A6HC 3VRAB 4BWGB 5M5XB 3KBXA 1I4GA 3E5SA 2R61A 2PPBC 3HS0C 4A3BB 2EYLA 1TR5A 2F3VA 1EL0A 1MSHA 1STAA 3RZDB 4YWGG 1S4ZA 4LK1C 1LT5D 1NSNS 4ZKCB 3TMEA 2QCPX 1R7SA 2D62A 2L5TA 2PW9A 2ENBA 1FCCC 1EM7A 4LJZC 1VF7A 3RPFC 3NVZA 3AEAB 4PNYA 3NHHA 3DWAA 3RUZA 3S2DB 2OHFA 3BZDB 2KECA 1EEFD 3Q8EA 1L0XB 5M5WB 1HEZE 1I4HA 4XQQA 4ARIA 1C8CA 3ZQ4A 2XSCA 4ZHOA 4XDCA 1QNKA 2QDBA 2A68D 2N55A 2D9UA 3W2DA 5KNBA 3AMUA 2WS3B 1WSPA 3PMFA 1DOIA 4R8NA 4RGTA 4MM3B 3S1NB 2JX5A 2CVRA 5C4XB 2F0DA 4UAIA 1KAAA 1ENFA 3HOZB 1PTOD 2VB3X 2EYPA 3P20A 1GUGA 1W6JA 1JOQA 1SAPA 5FK9C 3U7ZA 1C9FA 4HCEA 1KDBA 1FXAA 3HVDA 2K33A 2M9VA 2N9LA 4C7YA 1IGDA 1UWMA 1D4BA 1DXMA 2PVOD 3ZGZA 5JPNC 4K6LA 5J22A 3TSSA 1V1PA 5C0XH 1SNDA 5IGCA 1M4VA 3HOWB 1TS2A 3SK8A 5J1ZA 4ZRPA 4LAAA 1QQRA 1A3TA 1XWEA 1IKLA 2WACA 1NUCA 3NQIA 5AFWA 2WNMA 2I07B 1GHKA 1SFOB 2EY6A 2HTME 3KWLA 4IUQA 3VR3A 2BDOA 3A7LA 2OEOA 2IL8A 1K50A 2K6AA 3FMCA 4OZAA 3MZ5A 3I4NB 1JMLA 1CZWA 3K57A 3BVMA 1SE2A 2L4NA 5CV7A 4FO2A 4XTCS 3LNNA 3P7JA 4G4KA 2NWGA 3PV0A 5BYQA