1QILA

Inactive mutant toxic shock syndrome toxin-1 at 2.5 a
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
194
structure length
194
Chain Sequence
STNDNIKDLLDWYSSGSDTFTNSEVLDNSLGSMRIKNTDGSISLIIFPSPYYSPAFTKGEKVDLNTKRTKKSQHTSEGTYIHFQISGVTNTEKLPTPIELPLKVKVHGKDSPLKYWPKFDKKQLAISTLDFEIRAQLTQIHGLYRSSDKTGGYWKITMNDGSTYQSDLSKKFEYNTEKPPINIDEIKTIEAEIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TOXIC SHOCK SYNDROME TOXIN-1
publication title Crystal structure of a biologically inactive mutant of toxic shock syndrome toxin-1 at 2.5 A resolution.
pubmed rcsb
source organism Staphylococcus aureus
molecule tags Toxin
total genus 59
structure length 194
sequence length 194
chains with identical sequence B, C
ec nomenclature
pdb deposition date 1997-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1qilA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1qilA01
1TY0A 2WV6D 4L63B 3R2IA 4Z9CB 1LT4D 1S5DD 1LTGD 1RCVD 3DWPA 1AW7A 1EU3A 1PTOF 2AQ2B 3DWAA 1HXYD 3MFGA 1HTLD 2IPKD 1ENFA 1S5BD 5D3IB 2XN9C 2NTTA 2ICIA 1RD9D 4ZYSA 3W2DA 4BWGB 1G8ZD 1LTTD 1JR0D 1CK1A 3MC0B 4NZLB 3KLSX 4RFBA 1BCPD 1TS4A 1AN8A 4RGOS 1S5FD 1PRTD 1LTRD 1LLRD 2QEJC 1YN4A 3BVZA 1I4XA 1ET6A 1FGBD 4RHSA 2O2LD 4UDUC 1YN5A 1QILA 1M4VA 1B44D 1I4PA 1RF2D 1EFID 2G9HD 3EFXD 1V1PA 1I4RA 2AQ1B 1HQRD 1LT3D 1UNSA 3BZDB 1PTOC 2J4XA 4RH6A 5ELEA 5FKAC 1D5XC 1YN3A 1EU4A 4K6LA 5ELBA 3GP7A 1L0XB 4RGNA 1PTOD 2TSSA 2Z8LA 4RGMA 1TS3A 5D3DA 2CHBD 1SE2A 1XTCD 1FD7D 1S5CD 1KLUD 3SEBA 1PYWD 1PZJD 1STEA 3CHBD 3BVMA 1CT1D 4O1NA 1DJRD 1SJED 5ELDA 1LTSD 1KTKA 4L6TB 2RDGA 2QILA 1UUPA 1FNVA 1SBBB 2SEBD 1D5MC 1MD2D 1BCPB 1PRTB 1RDPD 4C56C 2XNAC 3URYA 1CQVA 1D5ZC 1V1OA 3TSSA 1PTOH 1BXTA 3V05A 5FK9C 1SE3A 1CHPD 3EA6A 1S5ED 4DXFA 3R2TA 5TSSA 1JWMD 2NTSA 5ELFA 2XRQD 1JWSD 4OHJA 1I4QA 1V1PB 1FNWA 3BVGA 1LTID 1PTOB 1PZKD 4DXGA 1ESFA 1XXGA 1JCKB 5ELCA 4RHRA 1B1ZA 3BYTB 1DYQA 1BCPF 1L0YB 1TY2A 1SE4A 3O13A 4RCOA 1T5XD 4RGTA 1BCPC 5I4DA 1GOZA 1PRTF 4TSSA 3DWQA 3OWEB 1PRTC 1SEBD 1LO5D 1I4GA 1TS2A 1JQYD 3R8BA 1SXTA 1EWCA 1D6EC 2RDHA 2XRSD 1EEFD 1F77A 1EEID 1KLGD 1CHQD 1LT6D 1JWUD 1SJHD 1LTBD 2AQ3B 2IJ0A 1ET9A 1TS5A 1LTAD 1PZID 2R61A 3BYYB 1LT5D 1HA5A 1I4HA 1FNUA
chains in the Genus database with same CATH superfamily
1F9PA 2RBMA 2R3ZA 1VS0A 3VVWB 1WGKA 1SAPA 3CCLA 1O7YA 3RD2A 5C4HA 4CJ2C 4A3EB 1S72A 1X32A 4IURA 4R4TA 5C6AA 4XQNA 2IO2B 1SF0A 2Z4HA 2UXCQ 2IPKD 5BO4B 3I3TB 3NBIA 4F8MA 3RNBC 3Q69A 1M1KC 4HXDA 5AEKB 4CHKA 3HOYG 1SE9A 3X23A 4EFOA 1VQBA 5CC4A 4REZA 3RLOA 3HHMA 2HTHA 1N34Q 3LDZE 4FADA 4OIJA 1CK1A 1Q0WB 2K52A 2K3UA 4AUQC 1STYA 4ZRJA 1HRJA 3EUB2 1BNZA 5DM63 5EPKA 5E1FA 1VQFA 3ZJVA 1NVID 1YN4A 5KNBA 1VQKA 4HMJA 4R4IA 4PT5A 2HT1A 3SR6A 1J7CA 4UDUC 3HKZE 4CKEA 2RSOA 3CSFA 4YHHL 2C5CA 3KBXA 2G9HD 4OZAA 3EFXD 1I4RA 2PE6B 1HQRD 3DHQA 2I5HA 2KZRA 2BA0A 4AH6A 1L6VA 4X62L 1WI5A 4DAYA 4JI3Q 2BDOA 2RCFA 3KVFB 3WWVA 1K83H 1OXSC 3UQAA 3AE4B 1WJ4A 4DR4Q 3ZDTA 2HDMA 3GTKB 4QY7A 1N6ZA 2WXRA 4K3BA 2YV5A 2LXAA 3L0OA 4IALA 3PO2H 2E2HB 4JPSA 5J39A 2BT6A 4JI8Q 1K28A 4HCSA 5CYUA 1XEEA 4G11A 1P1AA 1SR3A 2E6XA 2MA9B 5IT9E 4V190 5FOBB 1BR9A 1MD2D 1A2UA 3L3OC 4S17A 2ALYB 4ODGA 1UD7A 1G6PA 4A3BB 1TIID 1MG4A 3WAMA 4BOZB 2F0EA 3MTSA 4F88A 1DZ1A 3ZJYC 2NVQH 3E56A 5IOIA 3U58A 5C5LA 3JAMc 2QIEB 2MGSA 1JROA 3M3YH 3MAQA 3CWIA 5CBEE 3ZYYX 1F2RI 1E7VA 4BVUC 1TWGB 5IE8A 3SD5A 4B0MA 5H8YE 1PH6A 1IBXA 2QC8A 1NSNS 4K7WA 4KJOA 3SR1A 3HOVH 3L7ZC 2XTIA 5BR8L 1HNWL 1FEHA 4XYCA 3A9KB 4A3IB 1PH1A 3MTNB 2R93B 2LASA 2DHZA 2DX5B 1MIUA 3VTWA 4BBSH 4GNXC 3HOWH 3UIPB 1CTMA 4X3SA 5FO8B 1GUGA 3NBHA 2X6LA 2BVCA 1ZP0B 1CKMA 2WDRB 3HK0A 4YWKA 4A3CH 2KN4A 4MT5A 3I4NG 2UXDQ 2A68C 2KHWB 2EMSA 2F0HA 3NZ3A 2VQFQ 2F0OA 4J3OD 2H89B 2F4VQ 4LDTD 1A0IA 4LF4L 2ZW1A 1SYEA 2XRSD 4K2LA 4MELA 3P42A 1U4PA 2O4XA 3WDNA 1CSQA 3VUWA 1CHQD 1ZE3D 4URKA 1L2NA 2FINB 1VQ8A 2IJ0A 1X6OA 5BN5A 3K0XA 1SYFA 1O78A 4JI4Q 3AEEB 4TKNA 3I4LA 2KDIA 3MEHA 1M90C 2GN5A 2K8CA 1RCVD 3KBGA 1PH9A 1L5PA 2JWZA 2PQAA 5C0XH 4ZAIA 1VQ7A 1WRIA 2KFKB 4GNXA 3PO0A 4HLEA 3GTMB 2Z1CA 3ZXRA 5CBAE 3AEVA 4R9WA 4MZ9A 2DGYA 4OWTB 3NSWA 2QDLA 2J0KA 3G7LA 2PVGC 2XN9C 4GU2A 2MBEA 3UF8A 5CV8A 2Q2HA 3WALA 2FCMA 3BZKA 4I65A 3J80E 2F03A 3I5JC 4WQMA 2UXBQ 2D62A 1FR3A 1I4XA 4CGYB 3I4MG 2WP9B 2Z0SA 3PO3G 2QA4A 3TBIB 2F0PA 3S24A 1A62A 1Z6HA 2C9WB 1KDAA 1SROA 1WD0A 3FILA 2JA9A 1E24A 2VXWA 3GV6A 3PTFC 3ZUNA 3CPFA 5AJ3Q 3BZDB 3IFWB 5GAEC 2JA5G 1I6VC 2Q5WD 1WX7A 1XQQA 1VQHA 1K0RA 2EJMA 2B8FA 3CW2C 3ITPA 2KTFA 3K80C 5J18A 1DM0B 1H9KA 4HCNB 1EYAA 1P9DU 2PMZB 1VMCA 1L1OB 1X3PA 4BA2I 3JSVB 3OPOA 4ZKBB 4EUTA 1VCBA 1L2FA 3E6ZX 1PH4A 4FBJB 2KANA 4KHZA 4DV6Q 4BY7H 1YIWA 3NWSA 4JI7Q 2XIWA 2V4LA 3HEJA 3A8JE 3ERQA 1Z5SB 3T16A 3U4EG 2CW0D 1LFDA 2FCQA 1GXDC 1JE4A 1WOCA 3D6WA 3J7AF 4XE0A 2K6AA 4F7ZA 2B63B 1C76A 3J81E 4CJ0B 1A3VA 1FFUA 1D5ZC 3UDGA 1IL2A 1J7BA 4MGZE 3TSSA 3M62B 4OX9Q 3GTLB 2VQEQ 1JRPA 1S5ED 2AHOB 5IOCA 4DR6L 4NQKE 1QVCA 3W5VB 1ZXTA 3U50C 3RZDH 4EX5A 1TTNA 3RNGC 2JPHA 2K6DB 5ELFA 1GO3E 1LACA 3S2DH 3TEYA 1HZCA 4WJOA 4HIOA 5IIFA 3BINA 1N33Q 3PF4A 2WX0A 4YXDB 4BY1B 4H0LC 1F2ZA 1H4RA 2UUAQ 3DHIC 4DUYL 2E2DC 1NNXA 3BDOA 4XIGS 2I0QA 3AE9B 3QR8A 1ESFA 3NVYA 1FRRA 2VRRB 3H09A 4Y7NB 5COYA 4U68A 1G2SA 1K8MA 3E3XA 1HTOA 4K5WA 1NYQA 1VJKA 1X55A 1SE4A 2MJEA 2PPHA 2HCCA 4JCVE 3Q6SA 4CO7A 1SEBD 4BBNC 4QGUA 2GOWA 3A7AB 5IYBG 2IY5B 2V9HA 3IVFA 1EIFA 3K5LA 5EE3A 3PPAA 4HCPB 1SJHD 2F0VA 4NB3A 1V9PA 3TEXA 1G91A 4HPMB 1R9TB 2N78A 3SK8A 4HTHA 1FNUA 4L8JA 3MXPA 3VDZA 1I94L 1X3QA 1PFMA 2WACA 5FO9B 4K0KL 5C4XB 1EOVA 3PQIA 3PMFA 5CV6A 2FIFA 4OO1I 5G5HA 4LMQD 4LF8L 1QUQA 1XMOQ 4C00A 4LFCQ 4PZ8A 4IUUA 1ENFA 1RL2A 1WF9A 3DBRB 5M5WH 4WH4A 1X3EA 4L5QA 5CHFA 4ASWC 2WDTB 4IQZA 5LMUL 1XO3A 4FXKC 4AP4C 1Z7TA 5G3LD 2KCNA 2IDYA 2BGFA 4IPCA 1WRDB 3HUIA 4XGAB 1NBFC 3QAQA 4GB9A 4KSKC 5DAUA 2ZPYA 2KCCA 4I6NB 4RGOS 3VAWA 1W6KA 4W9HA 4M02A 3IRBA 3E5SA 3ONAB 5JEAG 1FGBD 3KUPA 2PW5A 1U4LA 2KK8A 1QQRA 2F0WA 5CV4A 3ND9A 1YN5A 3QIAA 3TMPB 4IUMB 1R4NI 4B0EA 2QDFA 1VQ6A 1F0ZA 3FKIG 4AQ7A 2ZTEA 2F0JA 3FRPB 1C9FA 4BXXG 2M56B 2PI2A 4K6LA 2ES2A 5DNFA 2ZNVC 2ACZB 3IFDA 1ZDVA 2KDMA 4K1RB 2MH7A 3UINB 4GLVB 1CZPA 1FJGQ 4OIKA 1KOTA 1N60A 1HNXL 1ACCA 4R4QA 2DN8A 3QJZA 2A69D 1K8AC 2NVUI 3SEBA 3H94A 3I4NH 3S1NB 1PYWD 3NTIA 4JI0L 4OGQC 3S2HH 4QIWE 1P7FA 1PQSA 3TREA 4IN3A 1UWXA 1TU2B 1VQIA 3DOWA 3ETRA 5IO9A 3VTVA 5JH5C 1QCBD 2DZJA 3NG0A 1V1QA 1VDZA 1EFWA 1NJIC 1P3QU 4P2CB 3M7NA 1AWDA 2RR9A 5DPTA 1EL0A 5G3LF 4R3DA 5JXVA 4BKSA 1UE1A 2WKCA 2KLGA 2DY7A 5EKKA 1MBYA 3URYA 1WCMG 2NVYH 2N7DA 4G3XB 1SMYD 1V1OA 4A3KH 2CHWA 3PLUA 3FC4A 5ISRA 1CUKA 2IGDA 2AMCB 3H8HA 1BDOA 3W1YA 3W5UB 1BQQT 4EEWA 2LMCA 2J0TD 3VH4B 2E5LL 2INPE 2NZHA 3OTOL 1XF5L 4XDCA 2HJ8A 3DWGC 1TGZB 1V1PB 1A70A 2BA1A 4IWPA 1P7EA 1E8ZA 1PTOB 3GTQH 3APCA 2L32A 2NZOA 3M4OB 3N3KB 3PV1A 2NPTB 3QOLA 2WU2B 3Q3JA 4UP9A 2GBKA 2E76C 1LABA 1WVLA 3MJWA 2YU9H 3VR2A 3RZFA 1X1MA 5J3BA 2KHJA 3I4MH 4II2B 3E9SA 2M0AA 1SYBA 1UELA 1VQLA 2YTVA 1PRTF 5FR6A 5IODA 2Q8IB 3DWQA 3GV3A 2ENBA 1PRTC 1ZEQX 2OJWA 1EIGA 3TUOA 3OSOA 2D07B 1DCZA 2M4NA 3N32A 2IY1B 4C3HG 1T0RC 3A1QB 3ZJTA 2JA5H 2AUJD 1E7UA 1LXDA 3PLVA 2GLSA 5C4ZA 2Y0SB 1KD1C 4US8A 1JMLA 2A19A 2K5WA 1LTAD 2KHIA 5CV7A 2KN5A 1KAWA 4UP8A 4LF9Q 2MBBB 5CHVC 4C80A 1Q46A 2RHQB 3EHVA 3TJPA 3J9CA 5MPOA 1NUCA 4ZRIA 3JAME 1J5EQ 3CD6A 4X64Q 4ZQ3A 1EU3A 4A3JB 5EPJA 1RLFA 2UYZB 2DNFA 5EJWA 4LF5L 3DXJC 1HTLD 2BQQA 3DBSA 1I3QH 4PG3A 1UBIA 1Q7YC 4WWNA 2F0TA 3NEMA 1VR9A 1ZPSA 4OZBA 5IP9G 2RCNA 1DOXA 1EF5A 3EROA 4P71A 3NVZA 3AU4A 5FJ8G 4DR1Q 2UUBL 2PTLA 4J6IA 1HUMA 3KQ4A 3PSIA 1RAXA 1BO0A 3A55A 2OEOA 1J6QA 4PNYA 3GS2A 3IG3A 2FHTA 1Y1WG 5BMIA 4H44C 2WAQG 3AE8B 4G7HC 4RHSA 3KW5B 1GKHA 4OWXB 3MHZA 1Z9FA 1V2YA 3SK5A 4F1SA 2EJFC 4OO1G 2MP1A 3QWNA 4GN3B 4AYBB 3ZJUA 5ELEA 1W2BA 1E3PA 2LKVA 1IGDA 5A2QL 3Q6BA 3CKIB 2NBUA 4A3DG 4K7SA 1XD3B 3MXUA 1PTOD 3BWUD 2F0MA 1QOFA 3BJUA 2Y5CA 2REXA 3AULA 2C60A 4ANUA 5D3DA 3S1QH 1U4MA 5FLXc 2F0GA 2NZ1D 2K75A 2HUGA 4XDXA 2JT4B 3LX0A 3PS6A 3PRZA 3SVMA 1YIJA 1WD1A 3W1SA 1SMXA 2IGGA 4BKGA 5IP7G 3T1YL 4MM3A 1JB3A 3FP9A 2KX3A 1SYDA 5KYIA 2JSOA 3IL8A 4OONA 5H1SE 5IYDH 2V1YA 2B39A 4DN4M 3VTUA 1KL9A 4JK1C 1NE3A 3NTHA 1PH3A 2LJ5A 1FNVA 4ZLTF 4X57B 1XPOA 4EQPA 1KH0A 1OTCA 1MG8A 2RSUA 3T1HL 1PMRA 1STNA 2CS4A 5GAHC 4DK1A 4ME5A 3NS1A 1VZ8A 4ID6A 3PRMB 2PEAA 4QUCA 1CKNB 4DV2L 4IFDJ 3H6MA 4PMCA 3U7DA 2LSSA 2N9PC 1HFGA 2LVQA 3BY4B 3PT2B 1HH2P 3VR6A 2GVAA 2LS01 3C1FA 3CP0A 4YHHQ 3J7AV 3PF5A 3LB8C 2K5PA 4A6QA 3KJPA 1C4AA 1F2LA 1B2TA 3J80i 3VRAB 1XPRA 1WJJA 1VQMA 5JEAH 2UWQA 4L5RC 2Y3AA 3GE8C 4DKAC 2VNUD 3PHWB 2E2IB 2F0LA 4BOSC 2K5HA 2KLCA 1G51A 3CCQA 3ZLZA 3AEAB 2CU3A 2M17A 3QCAA 3R8BA 3Q8AA 3WA0A 1XNRL 3FKIH 3AECB 2LWPA 2BPSA 1GB4A 4IC7B 4BXXH 4JI2L 1EEID 1FM0D 1RTOA 3HOZB 4PYUA 1EM7A 4LF6L 3QO2A 1L4ZB 1UZXB 1HA5A 3HOXG 2MP2B 2KAJA 5IGDA 3C2PA 2I5MX 1OQRA 3Q3FA 2G9DA 3S15H 3TZUA 3U2SC 1WTHA 3TRZA 3ML9A 4KV6A 2JSVX 4KI0A 1HPCA 3MFGA 1Q1EA 1G291 3CXCA 3U9SA 3Q3NC 4AOFA 5IYCG 3RD4A 5C2TB 3PCOB 1B50A 4WWOA 4YTPB 3S2AA 4DGZA 2HE7A 3AMUA 1T0QC 1G8ZD 2B29A 1N63A 2WXNA 5BYRA 1E1OA 1FYCA 2KCMA 4YY3L 2C7NB 2GBMA 3ZRCA 5BR8Q 1HNWQ 3BDCA 1TJEA 1Y1WB 1Y14B 1WCMH 2R2OA 3Q8BA 1QG7A 3M4QA 2K39A 3J81i 2VH1A 2KEEA 1DGJA 1YNTE 1AARA 2WNMA 2VUMG 1FXIA 3K58A 2JWUA 4G57A 1WYDA 3R3MA 1T9HA 3E9HA 2DAFA 5TR5A 4A3EG 4FP5D 1CZWA 1IYFA 1JOKA 2LGSA 2EY6A 4A3DB 1E0ZA 2WWZA 2FUG1 3VR4A 1IGCA 4MGKE 2HHHL 4LF4Q 4GOPC 1WXQA 3APFA 2LFIA 4GSWA 1I42A 4RCNA 2PZWA 2R7FA 1NMGA 2GBJA 3P20A 2L0TA 2EMTA 1KLUD 3I55A 1ASYA 1UE6A 2MFIA 4HCEA 1KFYB 3HM3A 5DEHA 2WDVB 3B1LX 1GVPA 2XWJB 1QZGA 1L4DB 1MHHE 1KTKA 4DAYB 1JB7A 2WHIA 4C4VA 1R4NB 4HWIB 4C3HH 1I6HH 2FJ2A 2ZXPA 1KHIA 3ERSX 4FF4A 3P1MA 4HJKA 3ZO5B 2SEBD 2QEXA 4MACA 5EKLA 3BK1A 4DK6C 4YCUA 1PVOA 3CCSA 2KTRB 2WU5B 1XLOA 1CFMA 2CH4A 3FMCA 3SFEB 4OELB 3V60A 4K2KA 3KJOA 3Q24A 4HK2A 1OEYJ 4RM8A 4JI5L 1OO9B 2ZVNA 4ARCA 3H3VI 1P98A 2KACA 1HR0L 4X66Q 1KNEA 2LGYA 5IY0A 4M0WA 4HDQA 1YJJA 4LF7L 4DAVA 5IP9H 2HD3A 2K50A 1UEAB 3S16H 1SGHA 4LW1A 1FNWA 1SLJA 1K3RA 3DEOA 3VXWA 1LTID 1NI3A 2LRWA 1YNNC 2BBCA 5FJ8H 4B3RL 1NR4A 4JQWC 1TWFH 1G6JA 1CMXB 2QSDA 1KNAA 5I9PA 4DNIA 2F0IA 2LGXA 3I3CA 1QZHA 1IYJB 1B70B 1STHA 1GUAB 2L83A 4DQOC 1ICWA 4A3BG 4NJ6A 1T5XD 4DV4L 3K7AB 1H9SA 4IO9A 3OWEB 4OO1H 3GE3C 4PZ7A 4JPBW 3WAOA 2WB1B 4WJQA 2YTYA 3AM9A 2HIVA 4KD4A 4MSQB 1KLGD 3CQZB 1ONLA 3J81j 3NBHB 1QJOA 1SNDA 3BIID 3EGRA 4A93B 1V6EA 3CRKC 1ZYRD 4JOIC 4NAWA 3S14H 4A3IG 1PDQA 3MFYA 2KO3A 1JORA 1TY0A 3DDCB 2R93G 1YX5B 1I50B 2FMMA 3DWPA 1LTGD 3K9PB 3K5OA 1T3QA 4YSZB 4AIMA 1QOBA 2WINB 1BF4A 1NCVA 3STBD 1EUJA 3AH7A 5IP7H 3PRPB 1K51A 3IAM1 3QB3A 1XWEA 2NTTA 2PZTA 2DJFC 1YI2A 3H7PB 3ND8A 2VH2A 1SYCA 4PYZA 4IW0A 4DR6Q 4EKUA 4A9AA 2PZUA 3WANA 2LI5A 1OXTA 3PUWA 4JI6L 3T4AC 3AEBB 2L8JA 3KFUA 2WQYB 3A54A 3RPFC 1S5FD 1Y56A 1TVXA 4FULA 2J7ZA 4DUYQ 2VUMB 2WFWA 1QF6A 1VDVA 2NCNA 2IHEA 1I5FA 1EIHA 2MBOA 2CJOA 2UUCL 1UNSA 2BE5C 4DV3L 2J4XA 2L52A 4HJ9A 1C8CA 1RKNA 4UAIA 4QB4A 3K81C 5HURA 1H95A 1L0XB 4XYOA 2B2UC 2TMPA 3H9DA 1XMQL 2ZPNA 3AE3B 1DGSA 3MWYW 1FIQA 4KV2A 2K5NA 4A76A 1IW7C 4NJCA 4GDLB 2MHVA 2RGFA 2IHFA 2H88B 1PA6A 1JQ4A 1Q86C 3ZNID 4B95A 3CHBD 2F52A 3NK9A 4M1UB 5M5XH 4A3GG 1DXMA 1SYGA 3AEGB 1SDFA 4K81A 4WWMA 2CHZA 4CJ1B 1I94Q 1K8RB 4K0KQ 3OMCA 4AQYL 4LNQA 3F2DA 4P16A 3SK6A 3ZDMC 4V0BA 4LF8Q 1D5MC 3SHQA 1HR0W 4PV1C 3A4SC 1RDPD 2AKWB 3HOXH 3OJ4B 4HPLB 5KHQA 1EY6A 3B0AA 5LMUQ 4LNKA 4Q2JA 2DBYA 3GTJB 2B2UA 3JAMi 4DXFA 1ILQA 1WJ6A 2WAQE 3U9OA 1Y8RC 1AZQA 4RWSC 2ZXRA 2NTSA 5L83A 1RODA 2HQEA 4DR3Q 2WXIA 3OJ3A 4OZCA 5JPNC 5IYCH 3DEPA 3RYTA 2A6HD 3N30A 2GRIA 2W9NA 3IAYA 3PZ7A 5JJZA 3KF6A 3RZOH 1AYFA 2DZIA 1B3QA 3HGBA 1EY0A 3NHEB 4ZUJA 5JAVA 2KECA 4DXGA 3JYUA 1O7ZA 2G3QB 3OG5A 1CZGA 2K32A 3SXHA 1V5TA 2KEDA 1WJUA 5FLXE 4ANVA 4M8MA 3TEHB 4DU9A 4G7ZC 1DYQA 1WY8A 1EQTA 2B63G 1HNXQ 4GLXA 4WURA 2ID0A 3M3JA 4N6EB 4A3EH 4FJVB 4MGYE 3ZTCA 1TR5A 3EQLC 1J8IA 1RFAA 4KKIA 3T3OA 4P72A 1KF6B 1NENB 2CWAA 3TP6A 3VA7A 2O5IC 5KIXA 4GDKB 1IBKL 1EYGA 5IGBA 2NUCA 3AE2B 3FPPA 2I38A 2BDNA 4BY1G 2R2QA 1OQYA 3J7YW 2Q2TA 4B3TL 1WGRA 1WTPA 2L3ZA 1D1KA 2IT1A 3KLSA 4EGVA 5JVH3 3CC7A 2BYFA 1HTPA 5GMVA 2A5UA 4IUQA 4QL5A 2H4OA 4W9JA 3ULPA 3QG1A 3TCAA 3KDFA 1GUTA 2J52A 1EF1A 2JU6X 2YEPB 4HIMA 4NAMA 2VB3X 4HAEA 5D94A 3VYTA 1R4PB 3HRDD 4HDOA 2OF1A 3EECA 4EZLA 4YWGG 2E5LQ 1C4PA 3I90A 1QOHA 3OTOQ 3G4SA 2DAJA 3D8GA 5CR3A 4MHEA 1LTRD 2Q8RE 3BU2A 1G2TA 2LUMA 3QQ8B 4YSYB 2QF7A 2ZTCA 2GA4B 1PLFA 3H0GB 4OL7A 1SFOB 3HIZA 4DHZE 3DLLA 2Y5PA 3KUDB 3ZQ4A 3SFDB 2ASBA 1B44D 5C4XG 1SRUA 3GTKH 3DBHB 2KWDA 5CHWA 4RH6A 4N9PA 4DFAA 1PGAA 2FAZA 2FCNA 2HTME 2GMIC 4M8NA 1EU4A 2ZM6L 5ELBA 2E2HH 1UE5A 4RGNA 3TEWA 1PFSA 3N1XC 3J7A5 2KMMA 1WXVA 2QHOA 4K5XA 5LMNL 2F3IA 4K6DA 1BBUA 2L4NA 3EC8A 4FVMA 3AMZA 3T51B 4RMAA 3DVGX 4EQ5A 5C3EG 4A3BH 4A3GB 5T1GA 1NR2A 4NPSA 1CT1D 4R8IA 2D2QA 2X6GA 2KVZA 3IBEA 3ER0A 4ZKCB 3L10B 3MP9A 3PVLA 4DHJB 1DD2A 2ZCCA 3P4PB 1FPYA 2RDGA 3ZTDA 4ZDVA 2NVTB 3DHHC 1HQMC 4KY7A 4LF5Q 1V80A 1GAQB 3A8IE 4YSXB 4Q0FA 1S40A 5E6JA 1WFQA 1BT0A 4YT0B 3RLNA 3RLFA 5JOBA 4C56C 4A3IH 2WDQB 5NUCA 1XYIA 3M63B 2KOXA 2R93H 3R93A 1VCIA 5J1ZA 3NQIA 2UUBQ 1K3BC 1IKMA 4XZ4A 1IBLL 3MZ5A 2EKEC 3C19A 3BS1A 1YEZA 2CCZA 2K04A 3TIXA 3AN1A 1Q10A 2PLPA 4IPHA 1CA6A 2XEWA 1D7QA 4BAXA 3ZNGC 5ELNA 5CX3A 4IUNA 4LNFA 2EYFA 1PZKD 3NHHA 5I6WA 2LXCA 3NVWA 5BYQA 3H6NA 3AB9A 1JMCA 4KD3A 3Q3OC 4QMGA 4DK3C 2UU9L 1U0LA 5AZHA 4RCOA 1U5KA 1BVSA 5C44G 1QKZA 2XBBC 3SDZA 2J42A 3CRLC 1I4GA 2ZJPA 1JQYD 5AFWA 3LXFA 1EWCA 1TWHB 3NPPA 1EEFD 3GTMH 2EKIA 3EFUA 1F77A 3EBEA 1E8WA 2OCEA 1JJ2A 1YHBA 3A0JA 3N20C 3T1YQ 1YZ6A 1QT9A 1FMAD 1LT5D 1RRBA 3CAMA 3HOYH 4H13C 3JVZX 3QOJA 3AXCA 3RCZA 1AW7A 1STGA 3DWAA 4RAUC 1HXYD 2DJGC 4JBWA 2EYHA 3HFZB 3GTOB 4DR2L 1TWCB 1JT8A 3T1HQ 4DHJD 3NOBA 1RD9D 2YEPF 4RA8A 3DM1A 4EQOA 3A9JA 4IPGA 4S3SA 4DV2Q 4FLHA 4WJWA 2PCFB 1TZOA 2FIDA 2PW9A 1TS4A 4AJWA 5M9OA 2F0QA 2DYBA 2CW0C 2DYOA 4WQOB 4JWSC 1X54A 2EOTA 2Z4IA 1S3SG 2Y0SG 3JC66 4NXML 4BA1I 5I2XA 3PIOA 2SOBA 3EN2A 5CV9A 5C0XJ 2JZPA 2KMAA 3A9KA 5LMNW 3KUCB 3K7UC 2JQOA 3P1HA 3APDA 4A3JG 1Y8OB 2F0DA 1F9RA 1T0SC 1YMHE 4IWQA 4DF7A 1WR6E 2PYKA 2WXJA 2BH8A 1XNRQ 3ECIA 5IGGA 1TS3A 5GADC 4JI2Q 1SE2A 1Q1BA 1OTRB 4H2AA 3V3XA 2V3NA 3A56A 1V8QA 4LF6Q 2ZT9C 5C3EB 1STEA 4L5TA 2E75C 3VYUA 1VD2A 4C3IB 2V4IB 4HPPA 4M00A 2B63H 2V0GA 1VQCA 1WYGA 3QC8B 4POFA 1MHXA 3B2GA 3H3VH 5L95C 5HKHA 3GTLH 4NQLB 4KHVA 3L4PA 2NVXB 2QGQA 2JA7G 2BYEA 2D0OA 3P7JA 2XVSA 2G45B 5HHDG 2K05A 1JICA 4AYBG 2D5GA 2CFMA 2PVOD 5DPRA 4BFRA 1PH2A 1CQVA 2N9XA 4BY1H 1TKGA 3R7RA 3RN2A 2RKSA 1YNJD 3KF8A 2WIIB 2IO3B 1J19A 2JZ3B 3VYRA 2K01A 4C7YA 2DLBA 4XWWA 4YY3Q 3R2TA 2Q2UA 4Y7NH 2L9HA 1HZ6A 2GI9A 4DAMA 1EYCA 2YTXA 1QVGA 4XQJA 1L1OC 1UGJA 4C1NI 3VQIA 2EXDA 4OHJA 4B9XA 1X56A 5KGUA 3N1ZC 1PH7A 3RR5A 3BVGA 3N52A 2DUDA 1XT9B 4JV5Q 1HE8A 1HZ9A 4ARIA 1JCKB 4OVUA 4BBRG 3C46A 3NJTA 2FCSA 4GN1A 4DV5L 2M1MA 2PIAA 5C44B 1R9TH 1B7YB 3TS0A 3CCMA 2HHHQ 1GOZA 1E9MA 1WTVA 2ON8A 3VUYA 5C4XH 2EPBA 1K53A 1UAPA 1LM8B 4CDCC 4AWJA 3M9BA 2JA8B 3KK7A 4IUPA 4JW0A 4ZRZA 4CHTB 4HJ7A 2GBRA 2O6VB 5KEEA 1PZID 2QKIC 1L6UA 1W6JA 1SNOA 5DPWA 4G0NB 3IAS1 4L63B 4YL8A 1A3TA 3I91A 1LYLA 2R7ZB 3UDFA 2L76A 5M5YB 4PS8A 2RVLA 2D9UA 2MPMA 2WP8J 1MI0A 3NUCA 4RF1A 3S1RB 3AEFB 3OIPA 3P63A 4JE3B 4KTAA 4DR7Q 2PE9A 2QDBA 2A69C 2UXDL 2PMZE 3DVNV 2IW3A 4JI5Q 4NP5A 1RIPA 2JA6G 3BDLA 3PO3H 2MBHA 4Y52H 1P0RA 4IWOA 4AS1A 2KVMA 1HR0Q 2NS5A 1QB5D 2V3PA 3UGBB 1EZ6A 3CMMB 4A8XC 4IJHA 4LF7Q 2K4KA 3RN9C 2N7EA 3CMEA 3HOZG 5EE1A 1RYJA 1ET6A 1UWVA 2O2LD 5IGCA 1E10A 4B3RQ 1JW9D 5J17A 3Q3MC 2MX2A 1K8OA 2HQLA 5AUKA 2KCTA 1VZ7A 1WX8A 3MHBA 1HCZA 2DNEA 4DV0L 1QOAA 1WGDA 2AL6A 4II3B 1EFID 1SMYC 5E4XA 1V97A 3PIP3 4DK5A 1C48A 3S1NH 2CKHB 4KHPL 1D5XC 3P4RB 2KQ3A 2NWGA 3CF5A 1IYVA 2G1EA 4DPGA 1Y1VB 2JXMB 1PFBA 2TSSA 4GKJL 4I7ZC 1SNMA 2JEBI 1YJ1A 3T8MA 2HJ1A 2CHXA 4N8FA 3C8YA 4N8X1 1B9NA 3DMUA 3RNAC 3ZRFA 4PS3A 1RJTA 4OXPA 1KIXA 3AE5B 4KGSA 1V9JA 2ONQA 4B9WA 1EY8A 3W5OA 2L1BA 2Z9HA 1D2BA 2EYPA 3IFTA 4RF0A 2JA7B 2GB1A 1JALA 4N58A 1UUPA 3FDTA 3HKZG 3PGZA 1LM0A 2BWES 1V5OA 2N9LA 3S1MB 3E0JA 1RWSA 2O6VD 5ELOA 3PUVA 3CCRA 1C78A 3UQBA 3S17B 5C3XA 1XLNA 4ITKA 4LJOB 5C4JB 1VQ4A 3CIRB 3AU7A 1PTOH 4HKQA 3M4OH 4QAYA 1J7AA 4IUTA 4JG2A 4C4VB 4JI6Q 3QIJA 3NUHB 2MLBA 3HOUB 4NW2A 4JI1L 2INCC 4Q5VA 1AZPA 3M4YA 1ESRA 2K1FA 1XCTL 2UU7A 3EFCA 1I4QA 1OXUA 4LK1C 3K5MA 1K8GA 3AFQA 3UIOB 4DXAB 3VA5A 2WS3B 2UUCQ 5IYBH 2O2VB 3M95A 1IXRA 2F4IA 2IX3A 1XXGA 3H1UA 4NJ7A 4BBRB 4DV3Q 2BB5A 4APVA 1CI3M 4KK7A 3D31A 1D4BA 3AFPA 2EQSA 4OVVA 2N9KA 1L0YB 5I4DA 1V43A 3GD7A 3JW0X 4L1BA 4O0AA 4M0WB 1OFFA 2MO0A 1XMQQ 2O5JC 1LO5D 1IP9A 2RDHA 1RHPA 2KD0A 3Q8CA 3D4DA 1B53A 4HSVA 2KX0A 2K5DA 5C0XI 1B9RA 3W1GA 3P4QB 3VR9B 4IM0A 5M3FB 4KMUC 4A3FB 3CMAA 2KA7A 4CDEC 1WGGA 3RZWC 2UUAL 4AQYQ 4DK0A 4XC2A 2HIXA 1FD6A 1PTOF 5EGTA 3KOJA 2XK5B 3BG3A 1JWBD 1VLBA 1O80A 3QJYA 3KYCD 1KJTA 2A6ED 4F7XA 4X62Q 2KENA 4K5VA 1TXYA 2K28A 1B3AA 2IO0B 2EY5A 4ZHPA 2JA6B 4DV1L 2EE1A 4UHVA 3GTGB 4C3JG 4NZLB 3EIVA 2WB1G 4C2MB 1F2RC 2W3RA 2L12A 3DBLI 5C3WA 3TL5A 1AN8A 3I9V1 5D14A 2BS3B 1WTXA 2JZZA 1I7HA 1A6XA 4KKUA 3MXGA 3QA8A 5A2QE 2IGHA 3DQVA 4A55A 4A93G 2EXZA 2K8HA 1RFKA 4A3MB 4L5SA 3LWEA 1YJIA 3CCEA 2F1MA 1GG3A 1UE7A 2DZMA 3B08A 3KWLA 4U673 4FN2A 2ZJRA 3MC8A 1V1PA 1QNUA 1DOLA 1WSPA 1STBA 5FKAC 3DBHI 4LFCL 5LLIA 2PKOA 4P7IA 4ANXA 1EWYC 2NPTA 3VFKA 4IM2A 1MSHA 3L2PA 1HA6A 3R3OA 2A74C 2KJXA 2N49A 5GXGB 2Z8LA 3PZ8A 4B08A 3MXNB 3T13A 5LL6S 4IJLA 1PZJD 4W9LA 3BVMA 3UDXA 2L15A 1YJ9A 2A5HA 1DJRD 1FO4A 1Q90A 1IBKQ 2B3GA 1I4HA 2GBNA 5ELDA 1EQRA 2R92B 1ENCA 3TEZA 1EQVA 2VL6A 4B3TQ 3DCGA 2IY0B 4ICVA 4WWPA 2QILA 2ZJDA 2FMCA 2KXJA 4ZYNA 2KDBA 3HKZB 2VW9A 3T3NA 1K0SA 1BCPB 4LWCA 3TS2A 5G2NA 4IOAA 5M3MB 3RN5A 3GTPH 2D3CA 1EY4A 4R4OA 1SB3C 5IA7A 2E2JB 2I1JA 3P75A 4C7ZA 2VY3A 2LGIA 1G6ZA 2K03A 3LJ3A 4JX1C 2C7HA 4K14A 2D0PA 2Y0SE 2KT7A 3ULLA 1JOOA 1B8AA 4FA6A 4X3TA 3RUZA 2M8SA 3HRZC 4EVOA 4MH0E 4MJSA 2E2IH 2KHSA 4P1CC 4QQBX 1EOTA 2C5LC 2KYWA 2B2YC 5D6JB 4NDXA 3MVVA 1KDCA 4KKJA 2R7DA 3OYYA 5ELCA 3SK4A 4N9F4 1MHWC 4PK1A 3AV8A 1GPXA 3G71A 1AFPA 3BK2A 3HOZH 3RUIB 2ZM6Q 1E6EB 2FNJB 3HOVG 2P5ZX 1NMFA 3BZCA 1IKLA 2PPBC 4DR5L 3M4PA 4JYAL 5LMNQ 1GC6A 2N1WA 1ZKHA 3DWMA 4BBSG 2V3SA 3NENA 2BYTA 4GOPA 1WXAA 2LEKA 3QARA 3NP8A 3K6OA 1E22A 1UGMA 4FXCA 3NZUA 2K7VA 3OW2A 4TV3A 4A3CG 1J0GA 1WTRA 2VB2X 1TS5A 5GROA 1K52A 4KZ0A 4DBGA 2RMMA 3ICEA 3UI3A 3M7GA 3NWTA 4AYBE 2NMQA 2RPVA 4Z9CB 3N9YC 1LT4D 2B2YA 3OOCA 2AQ2B 4FJZA 3PHXB 4HIDA 2V1CC 1AH9A 2I1KA 1QE6A 2INNE 3VH3B 5JEAJ 1Y1WH 1CA5A 1NDDA 3A4RA 2EYOA 2BKFA 5LNK1 4PMBA 1IBXB 1JWAD 3QK0A 2BCOA 2C9OA 1TWAB 4JC0A 4C3JB 3SU8X 1IBLQ 3RULA 5DPSA 2X8XX 3VHTC 2L55A 3RT3B 2JJQA 4LAAA 2BOSA 4GN5A 4A3LG 2CR5A 1JE5A 1BCPD 3Q14C 1XPUA 2EY1A 2VZKB 4A3DH 1E2ZA 1Z47A 4HN7A 1ROEA 2DY8A 1KC8C 4IUVA 1VF5C 2R6GA 4NKLA 2MBQA 2ZTDA 3L13A 2KDEB 1SSOA 1FRDA 2BH2A 4WJPA 4YTMB 1I4PA 1N5WA 3VDYA 2PJHA 1TKWB 5E6NA 5DCNA 1W3SA 1H9JA 4FNFA 1WGHA 1EZ8A 3L54A 3IT4B 1GJZA 5EPLA 2J53A 5IWAL 3NELA 2LXJA 2NBWB 3H7SA 4KX6B 4QCLA 2AL3A 1S5CD 5E6OA 1FCLA 2K5VA 3RNUA 2PQAB 2SNMA 1FCCC 5KYLA 2MW5A 4GNXB 3I56A 4O1NA 2HD5B 4ZOHC 1CQFA 1P8LA 1LTSD 1K83B 2L05A 1E1TA 4E71A 3H0GG 2I46A 4JOIA 4EE2A 1S3OA 4YWMA 3T9LA 1SBBB 3HG9A 2J7QB 2WYQA 5LL6X 1GNUA 2BW2A 1DOIA 4HSPA 3V2TA 1WX9A 4DUZL 1FXAA 2MP2A 1N62A 4DR2Q 2OJRA 5C23A 4TQ0A 1Q3LA 1N36L 2YLMA 2XNAC 3PO2B 5E6PA 4BY7G 1N9WA 3J7ZC 2N7JA 3MJ5A 4IFDI 2VZAA 4UP7A 3LGJA 1E2VA 1XNQL 1ZYRC 5IT9L 2MJDA 1A8VA 4A20A 2NB0A 2LRUA 3L16A 3B9JA 2EJGC 4W9DA 3Q0AA 1TKEA 2XRQD 2MQJA 4W9CA 4DV7L 4J1MA 4JBMA 1V8CA 3FILB 4NXMQ 4MGIE 2FBWB 4XDDA 4P74A 3K7AH 3STBC 2NVQB 1KXLA 1UH6A 2JUOA 1MJCA 3HZXA 2NN6I 1JJCB 4CKCA 3M3YB 2JYOA 2Z59B 3ALBA 3MHSD 4IDIA 5LXHA 5EAYA 2SNSA 1WXMA 3CQZH 1QNKA 2K14A 1EQQA 2ZCBA 1PXUA 3HOVB 3GZNB 3VYSA 1KRTA 4NXNL 4LFAL 4A93H 2VZKD 3H91A 1K73C 4W9IA 3O13A 1YD8U 3DPDA 1HHVA 2Q2IA 4BKTA 2MNAA 3DUZA 2KUMA 2LFNA 4TSSA 4GKKL 2ZXOA 1QOGA 1PFDA 4BBSB 4F8CB 3HOWB 1I50H 1PDXA 3D4RA 1WH3A 1RTNA 1Y69U 2INDC 3B6YA 3RFZB 3L0WB 1JC7A 4J15A 1X3FA 2ZVOA 1QZEA 1LT6D 1E2WA 2BS2B 3D32A 1RM6C 2N1VA 1P16A 2K0PA 3TMEA 4A3PA 3BYYB 4KJNA 2A1AA 2G5DA 2Z0EB 3E0EA 3EJIA 3KLRA 1VQPA 4LDTB 2JN4A 5CMDA 4IOCA 1H9RA 1WMHA 3FPUB 3QWZB 2EY2A 4X65L 2YVCA 4FJYA 1NTGA 3RNFC 4XXEA 4WIPA 3CU7A 2LGDA 1F9QA 1ICFB 1U4AA 4B9KA 1S5BD 1V49A 4GOCA 2VUMH 4HVBA 2RHSB 2CKZB 1WGYA 4KSLC 5BYSA 1PH8A 4GLSC 2KTRA 4GLAC 3E9IA 1JR0D 2EDGA 3MC0B 1T6BX 4EZJA 2A68D 3U4ZA 2JRHA 2K1BA 4LFBL 1E8XA 4ZRPA 4JI0Q 5DLQE 5EDSA 2OTJA 2E3TA 2EVBA 2N88A 1WWTA 3BVZA 2K8BA 2OOBB 3IXSA 4WJ3M 4LUOA 1TZ1A 4TQ1A 1D3ZA 5BN4A 1EIYB 3Q8EA 3C0RB 3U52E 1ZKOA 3J80L 3A9JB 1F9SA 3KLWA 3S9WA 4DV5Q 1MJDA 3Q2AC 3GO5A 1WM2A 4FF3A 4HJ8A 3ENEA 1EY9A 3I72A 2PMVA 3V61A 2PW7A 2OTLA 3B2FA 2A6HC 3I73A 2K25A 2L1AA 2L5TA 3U4VA 3UE1A 4EQNA 2CHBD 1TBEA 2MEKA 3DBLB 1FD7D 1GD7A 5CTRC 5IKCM 4KIKA 4TKOB 2FE8A 2OQKA 1IHZA 4DDID 4K8JA 1QUQB 4ME3A 2B8GA 1IYUA 2N55A 1N32L 2RDFA 4TRDA 3GTJH 2AWNA 1WTOA 1AE2A 3PGEA 3SDLC 2N8NA 2QW7A 1Q81C 1VQ9A 3VR3A 4IOIE 1PYBA 4BY7B 4YTNB 2WB1E 4GMVA 2KBNA 2NYZD 4FF1A 2AUKA 3A8KE 1PHJA 2JP1A 4A4IA 1CJEA 5FK9C 2L0FA 3Q8FA 3ONSA 4HRSA 2WXLA 2AX5A 4N59A 4ZRQA 2MQHA 5TSSA 1PUTA 3H7PA 3AQQA 1C4QA 3AE7B 3L17A 1E5WA 1R4MI 2N4FA 1ISNA 2OXPA 3J81L 4ICUA 4G7OC 3KYHC 2KWCA 2M19A 4C3IG 1X9NA 2BKRB 1T5EA 4QIWB 1FVIA 2NBVB 4A3KG 3KUZA 5IGEA 3R7QA 4DV0Q 4A3LH 3AI5A 4LTUA 4NNJB 1AEXA 5D65A 2JEAI 4B3ML 1TWGH 3CCVA 3KF8B 4RHRA 3RZDB 4KHPQ 2B2TC 1Z2MA 2NR2A 4GN4B 3A7LA 4OW0A 1GJXA 1B1ZA 4QUFA 3V6CB 3S2DB 2JYEA 4WFN3 2WXHA 1GUSA 1GUOA 3HOYB 3D0FA 4IFDG 4MTKA 1HEZE 1WJNA 4KDIC 5K36G 2A4ZA 4GKJQ 4B3SL 5E7NA 2IO1B 3NE5B 1SXTA 4CDDC 4K8IA 2I07B 1YITA 4KVGB 4A90A 5JHBA 2I2YA 2H5XA 3I7FA 4X66L 2DNCA 3ZKJC 2AQ3B 2JK8A 2JE6I 4LJZC 1N5XA 2LVPA 3L08A 3WCQA 2EIFA 4IPDA 5C1ZA 3RMKC 2BF8B 5FLMG 3A74A 4GZYC 3KWVA 4GDLA 4G4KA 3I57A 2NN6G 1WR1A 1CSPA 1S5DD 4A3OA 4JWUC 1XX8A 2WXKA 2ZNVB 3NRZA 4B6WA 5HGTA 1VQ5A 4FXGC 2KKCA 2B2TA 2MUYA 1X65A 3W1BA 5D3IB 1EYDA 2HDLA 5I2YA 3D6CA 2CQAA 3H0GH 2F0SA 2LMCB 4US9A 1SFOH 2ZJQA 1NYRA 1N61A 1VQGA 1NEKB 4ALPA 3WAPA 1M8AA 3O65B 4JI1Q 2JA8G 4RFBA 1HNZL 1E7PB 3UE0A 5IP4D 1IBML 5F2DA 3TP5A 1MFWA 2K9XA 2NBFA 5M5WB 4W9KA 2ZEQA 5CV5A 3G6JB 3VR5A 1ZW7A 4WJNA 4BS9A 3SGIA 2KVRA 3MC9A 4P73A 1Q1OA 2XSCA 3OMGA 3NTKA 1RF2D 1ILPA 2R7ZG 4DWFA 3OWFA 2JYTA 2RD0A 1OQQA 1BUVT 2M2LA 4A3GH 1KQSA 4KDLB 4PMWA 3PZDA 2MWSB 3F2CA 4DAPA 2LUEA 4WJ4A 1XCQL 1VF7A 2L0CA 3KH0A 5KHOA 2NVTH 1Q5WB 1O7IA 2WLBA 4XWTA 4FHKA 4LLGM 1HZBA 1WZ3A 4ZCKA 3GDEA 2MJ3A 3IHPC 1CKOA 2C35B 2PQEA 3AB5A 3G6EA 3I70A 4XT3B 5DM73 2GVBA 2RPQA 2CVRA 2PNHA 3I4NB 4GDKA 1U9RA 3S2HB 1PRTB 2UXCL 2W55A 1ZUD2 4DV1Q 1DOMA 1IUEA 4BKSD 4BBNF 1EWHA 3F1ZA 4RKLA 1J9OA 1UWMA 1YHAA 5IYDG 3V05A 4HJAA 1CHPD 1Y1VG 1N34L 3UI2A 2KNBA 4R1JA 1JWMD 2DENB 5HI1A 2EZVA 1VQNA 1C1YB 3T53B 1JWSD 3TP8A 4X3UA 2JX5A 2BYVE 2B2VC 2BTEA 1SSNA 4IM3A 2NVYB 3F2BA 4A3KB 3FAHA 1NI2A 3MA2B 2CU1A 4L2YA 3DVGY 1TWHH 4ZUIA 1A63A 3T56B 1YOVB 2K22A 4ZHOA 3ZNHB 1XLPA 4LNNA 4PS7A 3LWUA 3N1YC 4CDFC 4JI3L 1JJGA 2KFKA 1SIJA 3GTQB 4R4CA 1WFYA 4MM3B 3W9CB 1S4ZA 4DR4L 1JOQA 3QX1A 4WRDA 2F0FA 3TZDA 4HJGE 4X6AH 4I6LB 2WX1A 4DR3L 2LHEA 2YU9B 2OHFA 3GTOH 2L11A 3Q8DA 3HOUG 3I4MB 1V86A 1TWCH 5AZFA 3PO3B 1KABA 4ABNA 2A8VA 5HY6A 1MVKA 1A5RA 2B2VA 4FYDA 4RM9A 2N9EB 4RGMA 4JIOU 3ZNZB 4MH8A 2M9VA 4XYQA 4JI8L 2KOLA 1TIFA 5EQ0A 3H15A 4HKZE 2JA5B 1EY5A 3PUYA 2LVOA 3NS8A 3X0WA 1TT2A 1PGBA 4MIUA 1ZDXA 2BB6A 2N0SB 1F2MA 5T1IA 3JAML 3W2DA 4KLKA 3FEWX 3KLSX 4JBKA 3H3VC 4KY5A 3DVNU 5T8IA 4ZK9B 2PI2E 4DDGD 1PRTD 1I3QB 1WE6A 3OIQA 5M3FG 1SNQA 2ASQA 4DNRB 5I9OA 4A3FG 1L1OA 3JSVA 2KWVB 1UEBA 3WOEA 4K3CA 5FR3A 3WOFA 3KYDD 3V62A 4NPNA 4WORA 2RDBC 2AQ1B 1LT3D 1TQOA 1YNJC 1BBWA 4MTNA 1YN3A 5C3EH 4HEA1 2YYZA 2XWBB 5BN3A 1ZOYB 4E3CA 4HMIA 4C3IH 4HEDA 2D10A 1PYSB 3GP7A 4DR5Q 4GGQA 1ENAA 3C1EA 4JYAQ 2IL8A 4FO2A 3I4OA 2VQFL 1WZ0A 2LJIA 1HUNA 4UPAA 2F4VL 3LNNA 2NVXH 4CYEA 3DHGC 5FO7B 2CJNA 2B3AA 2IX1A 4IZ8A 4IFDH 5JZEB 4CKBA 4XT1B 3CC4A 5K36H 1BBXC 4JI4L 2KDFB 3TQYA 4XX5A 4EOYA 1ZGUB 1PGXA 4ACFA 2WKDA 1K50A 1F52A 4A3MG 1YX6B 3TBLD 2EYMA 1N8RC 3S1QB 2M00A 4E74A 2JXXA 2SDFA 2Z0DB 5FLMH 5HGQA 2AWOA 2KC2A 2NN6H 4I6PA 2J0MA 4DV4Q 2N3SA 1VRAB 2WXMA 1C3TA 1I35A 1BUIC 1SE3A 3EA6A 2VS1A 1STAA 1L0VB 2IYDB 4N9TA 2MO1A 5KNDA 4UY8C 2JXTA 4JL9A 1L0WA 1H9MA 2EELA 3I63C 4E6IA 2WXGA 2MHJA 5C44H 2AWTA 1WI0A 2UXBL 3AE1B 2CWPA 5JJKA 1YQ3B 3D4WA 3A33B 4FHJA 3Q23A 4ANWA 5LXIB 2RSNA 1Q82C 2R92G 1QLBB 2JA8H 4LUVA 1YNXA 2E74C 3CF6E 1WYWB 3ULJA 5AJ3L 2MCNB 4WAAA 3RMHA 5IWAQ 5M3MG 5AZGA 3GZNI 4P75A 2JY6A 4MJSB 1NAPA 2JVCA 1TS2A 5GAGC 2R7ZH 2EYJA 4DA2A 5M5YH 1F9JA 4GIVA 4P1BC 1R4MB 3W1SC 4X3KA 3OAWA 1FGUA 1T0YA 3S1RH 2X69A 4FDBA 1ZXIA 1LTBD 5AUIA 5IN7A 4M01A 2R61A 3GOEA 2C7MB 4DV6L 3K59A 4FXDA 4JI7L 1KRSA 1KM7A 5JHAA 3FKIB 2F0NA 2KJHB 1E90A 1IL8A 4DUZQ 2QCPX 4W9GA 4JLCA 1N36Q 4LNIA 4JVZA 2Q8TA 1Q8IA 4GOPB 1J8CA 2PO4A 1CM9A 2ICIA 2AYOB 4K7UA 4MDKE 1XNQQ 1TKYA 4ZYSA 3UDIA 3S15B 2EYLA 3OW7A 5IT9c 4OX9L 2VQEL 4A3JH 4HROA 4DV7Q 3ZXVA 1DOYA 2F3VA 4KZCA 3U7ZA 4HR7B 5KRUA 3PSEB 1Q12A 3HVZA 4L23A 1YJWA 1WM3A 5I6YA 1MI2A 3EVQA 3PUXA 4M8AA 1N33L 1HZ5A 1Y1VH 1XLQA 2DZKA 2FUHB 2W3SA 4EZKA 2KQ4X 3AEDB 1M4VA 1FXTB 3IT6B 2LY7A 1H9SB 4OVZA 2G4DB 2D5DA 1PTOC 4LFAQ 4NXNQ 2XGTA 2IZVB 1C7YA 1WCMB 1E0BA 4ILWA 3HS0C 2KWUB 4KY6A 2L7RA 1ML0D 4GKKQ 3FVQA 4G50A 1PFNA 2MJ8A 5EE0A 2WGSA 2DWQA 2D2CC 4I7AA 1H8CA 2JA7H 4ULLA 1OGWA 1V81A 4MNOA 2G4SA 2KQ7A 2LD9A 4NAWB 1AE3A 1KRHA 3HVDA 2B76B 3K5NA 3FHWA 3GTPB 3S1MH 4FF2A 1WXSA 3CC2A 3CSTA 4WAFA 3S17H 3CPWA 4IKGA 3QHTA 5C4JH 3NY5A 4R8NA 5JJIA 3NXWA 2KFJA 1JRUA 4NMZA 1EY7A 1R7SA 1X3GA 4X65Q 1NY4A 1WE7A 2IBIB 1VQOA 2E8GA 2O6VA 2WXFA 1LV9A 4LCDE 3AU5A 1MGSA 1GUNA 3VRBB 1VQAA 3HOUH 5BMGA 1D8LA 4OWWB 1XMOL 2AEHA 4QJFA 3PUZA 2D11A 2KJRA 4F87A 1EO6A 3RNEC 4HIKA 1WTWA 2MSED 3U30A 1HZAA 2WXPA 1BXTA 4TQUS 2ATWA 4LK0M 1DONA 3ZIMA 4KGRA 4C3HB 1I6HB 4TUUA 5D7GA 5EBDA 1BKBA 3D3RA 4BBRH 4LFBQ 5KNCA 2X38A 1SE8A 4YCWA 4LUZA 2K6QA 2ICEC 2HDEA 1VQEA 4TMAB 2KQSA 1SIFA 2A6EC 2H1EA 2HCIA 3N6RA 1GHKA 1YQBA 1Y8NB 3A1QA 3ZGZA 1HJPA 1WIAA 3J80c 3M85A 3RI7C 2FXQA 5JJLA 1ZXHA 1GB1A 1MPEA 1Q8KA 1VQJA 2Z6BA 5M3FH 2Z6KC 4A3FH 2KMCA 2BWFA 4RGTA 4CBVA 3S16B 2Y5BB 1VMPA 3PO2G 2LZ6A 4PQXA 3CCUA 3TDQA 2QJLA 1AP0A 1FL0A 1LQBA 4YIJA 2D3AA 1BOSA 1TWFB 2CQOA 1D6EC 1F2YA 4O42A 3SHLA 4YWLA 1FJGL 1GC7A 3ABVB 4LJPB 1HFNA 2OEDA 4W9FA 2V4DA 4KN7C 1U4RA 1MJEA 4RMFA 1YHQA 1II3A 2WAQB 1EUVB 1F1HA 2JF5A 1ET9A 3F2UA 2JA6H 1YJNA 3K8AA 3GTGH 1N32Q 2WV6D 4H02A 3R2IA 4JV5L 1R4QB 4USAA 2FFKB 4S0RA 3LYYA 5HFYA 4C2MH 2JQRB 1KLVA 5E3FA 1XJVA 1FFVA 2J0JA 1E8YA 3NZSA 4DNTB 1VQDA 1OEYA 5C5MA 1SNPA 4H7BA 1TT5B 1YNND 4KKSA 5K5PA 2IX0A 1PH5A 4HJ5A 1C77A 2Z6KA 4KKTA 5A35A 1SNCA 5JVG3 3S14B 2WXQA 5H92C 4A3MH 3WIMA 4AJYB 2IWHA 5JPMC 3G48A 4BWGB 1LTTD 2L00B 3ZW3A 3HOWG 3KF6B 4JBJA 4TVAB 2LHDA 3GB1A 1YVCA 2ZZPB 3OHXC 1WMHB 1C9OA 4MN3A 1OXXK 2K33A 1LLRD 5EKIA 3J81c 1B9MA 2QEJC 1C4CA 5HG2A 4YCVA 1EWIA 1GM5A 1O7LA 5EE9A 4P6VF 4B3MQ 1QILA 2W54A 2B2WC 1GUWA 3PV0A 2DYMA 1A15A 3ML8A 3K57A 2F0UA 5G5GA 2OT2A 2PNRC 1LUZA 2F0KA 4DR7L 2KJ6A 4RNAA 1XTDA 2QMTA 5CORA 2O2VA 1L7YA 5D2MB 2D3GA 3ZVVA 3TP7A 3A5ZB 4B3SQ 2R92H 1LGRA 4PZ6A 5LHY1 5CGKA 1C79A 2QCZA 3HP3A 4D2KA 3PREA 4A75A 3P4SB 1XTCD 4MEMA 5IAAC 5C0XG 2BS4B 2OQ0A 3AYHB 4XQQA 5G55A 3OLMD 5M3MH 4IG7B 3CCJA 1C0AA 3A5UA 3Q22A 2E2JH 3VR8B 1SJED 1Y8PB 5IGFA 2D3BA 4LNOA 4BZAA 2LXKA 4LF9L 4L6TB 5BMHA 3IKJA 1KDBA 3U8ZA 3KDFB 1CKNA 1IPGA 1K9MC 2JRIB 4CQNA 2RQXA 1J5EL 1IZ6A 4X64L 4DHZB 2M0XA 3PIPA 3P2BA 2B2WA 4W9EA 4GS3A 1WTQA 4J8QA 2UU9Q 5GQOA 2RA4A 4KIKB 4POGA 5M5XB 1A3UA 3I8ZA 2XK5A 5E4WC 1LTLA 5EBCA 2BE5D 4KGTA 4J6HA 1SN8A 1KAAA 1E7ZA 1HNZQ 4DR1L 2SAKA 3K0YA 1ASZA 4JGHB 2F3WA 1VZ6A 1BMLC 1IBMQ 3X3NA 2RF4A 1UF0A 1YBYA 3HOXB 2MRPA 1UBQA 4QF4A 2CH4W 3HM6X 4OEMB 1IW7D 2I5LX 3TN2A 3SE0A 3L9AX 5C3JB 1QVFA 3HKSA 4KN4C 2KC1A 1B4OA 3C3LA 4ZRKA 3VUXA 5J2RA 3F8TA 3FKYA 3DM3A 3RNCC 5J22A 1HTQA 1DOKA 1OXVA 4RG1A 2K5QA 3BYTB 1TY2A 1BCPF 1MKHA 3W3AA 3I2ZA 4XTCS 4O2DA 1BCPC 1GHJA 1QWYA 1S1QB 3V96A 3RZOB 1YQ4B 1NBWA 1TYGB 3DBRI 3NQTA 5L37A 3V6EB 3MEFA 4RKBA 3AE6B 2WXOA 3NVVA 2ZW0A 5FLXL 3GQBA 3X3MA 2W82A 1MSGA 1A2TA 2OWOA 1M94A 1JWUD 1PV4A 4GXBA 4MSMB 3R66C 4NY0A 4C1NK 3K9OB 2A73B 3PIO3 1D1IA 3MXNA 1TWAH 4C3JH
chains in the Genus database with same CATH topology
1F9PA 2RBMA 2R3ZA 1WGKA 1SAPA 1O7YA 5C4HA 4CJ2C 4A3EB 1X32A 4IURA 5C6AA 4XQNA 1SF0A 2Z4HA 2IPKD 3NBIA 4F8MA 3Q69A 5CC4A 4REZA 4OIJA 1CK1A 2K3UA 1STYA 1HRJA 3EUB2 1BNZA 5DM63 5EPKA 5E1FA 3ZJVA 1NVID 1YN4A 5KNBA 4HMJA 4PT5A 3SR6A 1J7CA 4UDUC 4CKEA 2RSOA 2C5CA 3KBXA 2G9HD 4OZAA 3EFXD 1I4RA 1HQRD 3DHQA 2BA0A 1L6VA 4DAYA 2BDOA 1OXSC 3AE4B 2HDMA 3GTKB 2WXRA 4IALA 2E2HB 4JPSA 5J39A 2BT6A 4HCSA 1XEEA 5CYUA 2E6XA 5IT9E 4V190 5FOBB 1BR9A 1MD2D 1A2UA 3L3OC 4ODGA 4A3BB 1TIID 2F0EA 3MTSA 4F88A 1DZ1A 3E56A 5C5LA 2QIEB 2MGSA 1JROA 3MAQA 3CWIA 5CBEE 3ZYYX 1F2RI 1TWGB 4B0MA 5H8YE 1IBXA 1NSNS 4KJOA 3SR1A 3L7ZC 1FEHA 4A3IB 2R93B 1CTMA 4X3SA 5FO8B 1GUGA 3NBHA 2X6LA 1ZP0B 2WDRB 2KN4A 4MT5A 2A68C 2F0HA 3NZ3A 2F0OA 4J3OD 2H89B 2ZW1A 1SYEA 2XRSD 4K2LA 3P42A 1U4PA 2O4XA 3WDNA 1CHQD 1ZE3D 2FINB 2IJ0A 3AEEB 5BN5A 1SYFA 1O78A 3I4LA 3MEHA 1RCVD 3KBGA 1L5PA 5C0XH 4ZAIA 3PO0A 1WRIA 3GTMB 2Z1CA 5CBAE 4R9WA 3NSWA 3G7LA 2PVGC 2XN9C 5CV8A 4I65A 3J80E 2F03A 4WQMA 2D62A 1FR3A 1I4XA 4CGYB 2WP9B 3TBIB 2F0PA 1Z6HA 3FILA 1KDAA 1WD0A 2VXWA 3GV6A 3BZDB 1I6VC 2Q5WD 2EJMA 2B8FA 3ITPA 1DM0B 1H9KA 1EYAA 2PMZB 1VMCA 1X3PA 4BA2I 3OPOA 4ZKBB 3E6ZX 4KHZA 3NWSA 2XIWA 3HEJA 3A8JE 3ERQA 3U4EG 3T16A 2CW0D 1GXDC 1JE4A 3D6WA 3J7AF 4XE0A 2K6AA 2B63B 1C76A 3J81E 4CJ0B 1A3VA 1FFUA 1D5ZC 1J7BA 3TSSA 3GTLB 1JRPA 1S5ED 5IOCA 3W5VB 1ZXTA 5ELFA 1LACA 3TEYA 5IIFA 4YXDB 4BY1B 4H0LC 1F2ZA 2E2DC 3BDOA 4XIGS 3AE9B 1ESFA 3NVYA 1FRRA 3H09A 4Y7NB 5COYA 4U68A 1G2SA 1K8MA 4K5WA 1NYQA 1VJKA 1SE4A 2HCCA 3Q6SA 1SEBD 3A7AB 3K5LA 5EE3A 1SJHD 2F0VA 3TEXA 1G91A 1R9TB 3SK8A 4HTHA 1FNUA 4L8JA 3MXPA 5C4XB 1X3QA 1PFMA 2WACA 5FO9B 3PMFA 5CV6A 4OO1I 5G5HA 4LMQD 4IUUA 1ENFA 4WH4A 4IQZA 1XO3A 4FXKC 1Z7TA 5G3LD 2KCNA 2IDYA 3HUIA 5DAUA 2KCCA 4RGOS 1W6KA 3ONAB 3E5SA 5JEAG 1FGBD 3KUPA 2PW5A 1U4LA 1QQRA 2F0WA 5CV4A 3ND9A 1YN5A 3QIAA 1F0ZA 4B0EA 4AQ7A 2F0JA 3FRPB 1C9FA 2M56B 4K6LA 5DNFA 2ACZB 3IFDA 1ZDVA 2KDMA 2MH7A 1CZPA 4OIKA 1N60A 1ACCA 2DN8A 2A69D 3SEBA 3H94A 3S1NB 1PYWD 3NTIA 4OGQC 1P7FA 3ETRA 4IN3A 1UWXA 1TU2B 1QCBD 1VDZA 4P2CB 3M7NA 1AWDA 1EL0A 5G3LF 4R3DA 5JXVA 2WKCA 2DY7A 5EKKA 1MBYA 3URYA 1SMYD 1V1OA 3FC4A 5ISRA 2IGDA 3H8HA 1BDOA 3W5UB 1BQQT 2LMCA 2J0TD 2INPE 4XDCA 1XF5L 3DWGC 1V1PB 1A70A 2BA1A 1P7EA 1PTOB 2L32A 3M4OB 3QOLA 2WU2B 2E76C 1LABA 1WVLA 3VR2A 3E9SA 2M0AA 1SYBA 1PRTF 5IODA 2Q8IB 3DWQA 3GV3A 2ENBA 1PRTC 1ZEQX 3TUOA 1EIGA 3OSOA 1DCZA 4C3HG 3ZJTA 1D1IA 2AUJD 4US8A 5C4ZA 2Y0SB 1JMLA 2K5WA 1LTAD 5CV7A 4C80A 3J9CA 5MPOA 1NUCA 3JAME 4ZQ3A 1EU3A 4A3JB 5EPJA 5EJWA 3DXJC 1HTLD 2F0TA 1VR9A 1ZPSA 4OZBA 1DOXA 3EROA 3NVZA 2PTLA 1HUMA 3KQ4A 1BO0A 3A55A 2OEOA 3GS2A 4PNYA 2FHTA 5BMIA 4H44C 3AE8B 4G7HC 4RHSA 3MHZA 3SK5A 2EJFC 4OO1G 2MP1A 3QWNA 4AYBB 3ZJUA 5ELEA 2LKVA 1IGDA 5A2QL 3CKIB 3MXUA 1PTOD 3BWUD 2F0MA 1QOFA 2Y5CA 5D3DA 1U4MA 2F0GA 2NZ1D 2HUGA 4XDXA 3LX0A 3SVMA 1WD1A 3W1SA 2IGGA 1JB3A 1SYDA 5KYIA 2JSOA 3IL8A 2B39A 4DN4M 4JK1C 3NTHA 1FNVA 4ZLTF 4EQPA 1KH0A 1PMRA 1STNA 4DK1A 4ME5A 3NS1A 1VZ8A 4ID6A 4QUCA 4IFDJ 3H6MA 4PMCA 1HFGA 3VR6A 2LS01 3C1FA 3LB8C 3J7AV 2K5PA 4A6QA 1C4AA 1F2LA 1B2TA 3VRAB 5JEAH 2Y3AA 2VNUD 2E2IB 2F0LA 3AEAB 2CU3A 3R8BA 3Q8AA 3AECB 1GB4A 1EEID 1FM0D 1RTOA 3HOZB 1EM7A 3QO2A 1L4ZB 1HA5A 2KAJA 5IGDA 3C2PA 1OQRA 2G9DA 3TZUA 3U2SC 4KV6A 2JSVX 4KI0A 1HPCA 3MFGA 1Q1EA 1G291 3U9SA 3RD4A 5C2TB 1B50A 4YTPB 4DGZA 3AMUA 5BYRA 1G8ZD 1N63A 2WXNA 1FYCA 3BDCA 1TJEA 1Y1WB 3Q8BA 1QG7A 2KEEA 1DGJA 1YNTE 2WNMA 1FXIA 3K58A 2JWUA 4G57A 4FP5D 1CZWA 1JOKA 2EY6A 4A3DB 1E0ZA 2FUG1 3VR4A 1IGCA 1WXQA 2LFIA 4RCNA 2PZWA 3P20A 1KLUD 4HCEA 1KFYB 5DEHA 2WDVB 2XWJB 1MHHE 1L4DB 1KTKA 3P1MA 2FJ2A 2ZXPA 4FF4A 2SEBD 4MACA 5EKLA 3BK1A 2WU5B 1XLOA 1CFMA 3FMCA 3SFEB 4K2KA 3Q24A 1OO9B 4ARCA 2KACA 1KNEA 4M0WA 1YJJA 4DAVA 1UEAB 1FNWA 3DEOA 1LTID 1NI3A 1YNNC 2BBCA 1NR4A 2QSDA 1KNAA 5I9PA 2F0IA 3I3CA 1STHA 2L83A 4DQOC 1ICWA 1T5XD 3K7AB 1H9SA 3OWEB 4OO1H 2WB1B 3AM9A 4KD4A 1KLGD 3CQZB 1ONLA 1QJOA 1SNDA 3BIID 3EGRA 4A93B 3CRKC 1ZYRD 1PDQA 3MFYA 1JORA 1TY0A 1I50B 2FMMA 3DWPA 1LTGD 3K5OA 1T3QA 4YSZB 1QOBA 2WINB 1BF4A 1NCVA 3AH7A 1K51A 3IAM1 3QB3A 1XWEA 2NTTA 2PZTA 3ND8A 1SYCA 4A9AA 2PZUA 1OXTA 3PUWA 3T4AC 3AEBB 2WQYB 3A54A 3RPFC 1S5FD 1Y56A 1TVXA 2J7ZA 2VUMB 1QF6A 1VDVA 1EIHA 2CJOA 1UNSA 2BE5C 2L52A 2J4XA 1C8CA 1RKNA 4UAIA 4QB4A 5HURA 1L0XB 4XYOA 2B2UC 2TMPA 3AE3B 3MWYW 1FIQA 4NJCA 1IW7C 4GDLB 2MHVA 2H88B 1JQ4A 3CHBD 3NK9A 4M1UB 4WWMA 1DXMA 1SYGA 3AEGB 1SDFA 4CJ1B 3OMCA 4P16A 3SK6A 4V0BA 1D5MC 4PV1C 1RDPD 1EY6A 4Q2JA 2DBYA 3GTJB 2B2UA 4DXFA 1ILQA 3U9OA 1AZQA 4RWSC 2ZXRA 2NTSA 1RODA 2HQEA 2WXIA 4OZCA 5JPNC 3DEPA 2A6HD 2GRIA 3IAYA 3PZ7A 5JJZA 1AYFA 3HGBA 1EY0A 4ZUJA 5JAVA 2KECA 4DXGA 1O7ZA 1CZGA 2K32A 3SXHA 2KEDA 5FLXE 4DU9A 4G7ZC 1DYQA 1EQTA 4WURA 2ID0A 4N6EB 1TR5A 3EQLC 1J8IA 4KKIA 3T3OA 1KF6B 1NENB 3TP6A 3VA7A 2O5IC 5KIXA 4GDKB 5IGBA 2NUCA 3AE2B 3FPPA 2I38A 2BDNA 3J7YW 1WTPA 1D1KA 2IT1A 3KLSA 4EGVA 5JVH3 1HTPA 4IUQA 2H4OA 3QG1A 1GUTA 2J52A 2JU6X 2YEPB 4NAMA 2VB3X 4HAEA 3VYTA 1R4PB 3HRDD 2OF1A 4YWGG 1C4PA 3I90A 1QOHA 3D8GA 5CR3A 4MHEA 1LTRD 2Q8RE 1G2TA 2LUMA 4YSYB 2QF7A 2GA4B 1PLFA 3H0GB 4OL7A 1SFOB 3ZQ4A 2Y5PA 3SFDB 1B44D 2KWDA 4RH6A 4N9PA 4DFAA 1PGAA 2HTME 1EU4A 5ELBA 4RGNA 3TEWA 2KMMA 4K5XA 4K6DA 2L4NA 4FVMA 3AMZA 3T51B 4A3GB 5T1GA 1NR2A 4R8IA 1CT1D 3WCQA 2X6GA 4ZKCB 3MP9A 1DD2A 3P4PB 2RDGA 2NVTB 1HQMC 4KY7A 1GAQB 3A8IE 4YSXB 4Q0FA 5E6JA 4YT0B 3RLFA 5JOBA 4C56C 2WDQB 5NUCA 1XYIA 3R93A 1VCIA 5J1ZA 3NQIA 1IKMA 3MZ5A 3BS1A 2K04A 3AN1A 1Q10A 2PLPA 1CA6A 4IUNA 2EYFA 1PZKD 3NHHA 5I6WA 3NVWA 5BYQA 3AB9A 4KD3A 4QMGA 4RCOA 1QKZA 3SDZA 2J42A 3CRLC 1I4GA 1JQYD 5AFWA 3LXFA 1EWCA 1TWHB 3NPPA 1EEFD 2EKIA 1F77A 1QT9A 1FMAD 1LT5D 4H13C 3QOJA 1AW7A 1STGA 3DWAA 4RAUC 1HXYD 4JBWA 2EYHA 3GTOB 1TWCB 1RD9D 2YEPF 4RA8A 3DM1A 4EQOA 4S3SA 4WJWA 2PCFB 1TZOA 2PW9A 1TS4A 5M9OA 2F0QA 2CW0C 2DYOA 4JWSC 2Z4IA 2EOTA 4BA1I 5I2XA 2SOBA 5CV9A 5C0XJ 2JZPA 3P1HA 1Y8OB 2F0DA 1F9RA 1YMHE 4DF7A 2PYKA 2WXJA 5IGGA 1TS3A 1SE2A 1Q1BA 4H2AA 2V3NA 3A56A 1V8QA 2ZT9C 5C3EB 1STEA 3VYUA 2E75C 2V4IB 2V0GA 4C3IB 1WYGA 1MHXA 3B2GA 4KHVA 3L4PA 2NVXB 3P7JA 2XVSA 5HHDG 2K05A 1JICA 2D5GA 2PVOD 1CQVA 1TKGA 2RKSA 1YNJD 3KF8A 2WIIB 3VYRA 2K01A 4C7YA 2DLBA 4XWWA 3R2TA 2L9HA 1HZ6A 2GI9A 1EYCA 1UGJA 4XQJA 3VQIA 4C1NI 4OHJA 4B9XA 5KGUA 3BVGA 3N52A 4ARIA 1JCKB 3C46A 2PIAA 5C44B 1GOZA 1E9MA 1WTVA 2ON8A 2EPBA 1K53A 1UAPA 2JA8B 3KK7A 4IUPA 4CHTB 4ZRZA 5KEEA 1PZID 2QKIC 1L6UA 1W6JA 1SNOA 3IAS1 4L63B 1A3TA 3I91A 2R7ZB 5M5YB 2RVLA 2D9UA 2MPMA 2WP8J 1MI0A 3NUCA 4RF1A 3S1RB 3AEFB 3OIPA 3P63A 4JE3B 4KTAA 2QDBA 2A69C 2IW3A 4NP5A 3BDLA 4AS1A 2KVMA 2V3PA 1QB5D 4A8XC 1EZ6A 5EE1A 1RYJA 1ET6A 2O2LD 5IGCA 1E10A 1JW9D 1K8OA 5AUKA 1VZ7A 3MHBA 1HCZA 2DNEA 1QOAA 1EFID 1SMYC 5E4XA 1V97A 3PIP3 1C48A 1D5XC 3P4RB 2KQ3A 2NWGA 1IYVA 2G1EA 1Y1VB 2JXMB 1PFBA 2TSSA 4I7ZC 1SNMA 2JEBI 3C8YA 1B9NA 3DMUA 1RJTA 3AE5B 4KGSA 2ONQA 4B9WA 1EY8A 2L1BA 1D2BA 2EYPA 3IFTA 4RF0A 2JA7B 2GB1A 1JALA 4N58A 1UUPA 3FDTA 2N9LA 3S1MB 3E0JA 1RWSA 3PUVA 1C78A 3S17B 5C3XA 1XLNA 4ITKA 5C4JB 3CIRB 3AU7A 1PTOH 4HKQA 1J7AA 4IUTA 3NUHB 3HOUB 4NW2A 4Q5VA 1AZPA 3M4YA 1ESRA 1XCTL 1I4QA 1OXUA 4LK1C 3K5MA 3VA5A 2WS3B 2IX3A 2F4IA 1XXGA 4BBRB 2BB5A 1CI3M 4KK7A 3D31A 1D4BA 2N9KA 1L0YB 5I4DA 1V43A 3GD7A 4L1BA 1OFFA 2O5JC 1LO5D 2RDHA 1RHPA 3Q8CA 3D4DA 1B53A 4HSVA 2K5DA 5C0XI 1B9RA 3P4QB 3VR9B 5M3FB 4KMUC 4A3FB 2KA7A 4DK0A 1FD6A 1PTOF 5EGTA 3BG3A 1JWBD 1VLBA 1O80A 3QJYA 2A6ED 4F7XA 4K5VA 2K28A 1B3AA 2EY5A 4ZHPA 2JA6B 2EE1A 3GTGB 4C3JG 4NZLB 1F2RC 4C2MB 2W3RA 2L12A 5C3WA 1AN8A 3I9V1 5D14A 2BS3B 1WTXA 1I7HA 1A6XA 4KKUA 3MXGA 4A55A 5A2QE 2IGHA 2EXZA 1RFKA 4A3MB 3LWEA 1YJIA 2F1MA 3KWLA 4U673 1V1PA 1QNUA 1DOLA 1WSPA 1STBA 5FKAC 2PKOA 1EWYC 1MSHA 1HA6A 3R3OA 2A74C 2KJXA 5GXGB 2Z8LA 3PZ8A 4B08A 3T13A 5LL6S 1PZJD 3BVMA 2A5HA 1DJRD 1FO4A 1Q90A 5ELDA 2R92B 1ENCA 3TEZA 1EQVA 2QILA 2FMCA 3HKZB 3T3NA 1BCPB 5M3MB 1EY4A 1SB3C 2E2JB 4C7ZA 3P75A 2LGIA 1G6ZA 2K03A 4JX1C 4K14A 1JOOA 4X3TA 3RUZA 3HRZC 4EVOA 2KHSA 1EOTA 2B2YC 4NDXA 3MVVA 1KDCA 4KKJA 5ELCA 3SK4A 3AV8A 1GPXA 1AFPA 3BK2A 1E6EB 1IKLA 2PPBC 3DWMA 2BYTA 2LEKA 3NP8A 3K6OA 4FXCA 2K7VA 1WTRA 2VB2X 1TS5A 1K52A 2RMMA 3UI3A 3M7GA 3NWTA 2NMQA 2RPVA 4Z9CB 3N9YC 1LT4D 2B2YA 3OOCA 2AQ2B 2INNE 1QE6A 5JEAJ 1CA5A 2EYOA 5LNK1 4PMBA 1IBXB 1JWAD 2BCOA 2C9OA 1TWAB 4C3JB 2L55A 4LAAA 2BOSA 1BCPD 2EY1A 2VZKB 1E2ZA 1Z47A 4HN7A 1ROEA 2DY8A 4IUVA 1VF5C 2R6GA 4NKLA 4YTMB 1SSOA 1FRDA 1I4PA 1N5WA 1TKWB 1H9JA 4FNFA 1EZ8A 3IT4B 5EPLA 2J53A 4KX6B 4QCLA 1S5CD 1FCLA 2SNMA 1FCCC 5KYLA 4O1NA 4ZOHC 1CQFA 1LTSD 1K83B 2I46A 4EE2A 1SBBB 3HG9A 5LL6X 2BW2A 1DOIA 4HSPA 3V2TA 5H92C 1FXAA 4TQ0A 1N62A 1Q3LA 2XNAC 3PO2B 2N7JA 3MJ5A 4IFDI 1E2VA 1ZYRC 5IT9L 2MJDA 2NB0A 3B9JA 2EJGC 3Q0AA 1TKEA 2XRQD 4J1MA 3FILB 1V8CA 2FBWB 4XDDA 2NVQB 3HZXA 3M3YB 2NN6I 4CKCA 2JYOA 4IDIA 2SNSA 1QNKA 1PXUA 3HOVB 3VYSA 2VZKD 3H91A 3O13A 1HHVA 3DUZA 2KUMA 2LFNA 4TSSA 2ZXOA 1QOGA 1PFDA 4BBSB 3HOWB 1PDXA 3D4RA 1RTNA 1Y69U 3RFZB 1JC7A 1LT6D 1E2WA 2BS2B 1RM6C 2K0PA 3TMEA 3BYYB 4KJNA 3EJIA 3KLRA 5CMDA 1H9RA 3FPUB 2EY2A 4XXEA 4WIPA 3CU7A 1F9QA 1S5BD 5BYSA 4GLSC 3MC0B 1JR0D 2EDGA 1T6BX 2A68D 2K1BA 4ZRPA 2E3TA 2EVBA 2N88A 1WWTA 3BVZA 3IXSA 4TQ1A 5BN4A 3Q8EA 3U52E 1ZKOA 3J80L 1F9SA 3S9WA 3GO5A 4FF3A 1EY9A 3I72A 2PMVA 2PW7A 3B2FA 2A6HC 3I73A 2L1AA 2L5TA 2MEKA 4EQNA 2CHBD 1FD7D 4TKOB 2FE8A 1IHZA 4K8JA 2B8GA 1IYUA 2N55A 2RDFA 4TRDA 2AWNA 1WTOA 3VR3A 4IOIE 4BY7B 4YTNB 2NYZD 4FF1A 2AUKA 3A8KE 2JP1A 1CJEA 5FK9C 3Q8FA 4HRSA 2WXLA 2AX5A 4N59A 4ZRQA 5TSSA 1PUTA 1C4QA 3AE7B 2OXPA 3J81L 4G7OC 2M19A 4C3IG 1T5EA 4QIWB 5IGEA 1AEXA 5D65A 2JEAI 3RZDB 4RHRA 2B2TC 3A7LA 4OW0A 1GJXA 1B1ZA 4QUFA 3S2DB 2JYEA 4WFN3 2WXHA 1GUSA 1GUOA 3HOYB 4IFDG 1HEZE 5K36G 3NE5B 1SXTA 4K8IA 2I07B 4A90A 2I2YA 2DNCA 2AQ3B 2JE6I 4LJZC 1N5XA 4GZYC 3KWVA 4G4KA 3I57A 2NN6G 1S5DD 4JWUC 1XX8A 2WXKA 3NRZA 5HGTA 4FXGC 2B2TA 2MUYA 5D3IB 1EYDA 2HDLA 5I2YA 3D6CA 2CQAA 2F0SA 2LMCB 4US9A 1NYRA 1N61A 1NEKB 1M8AA 4RFBA 1E7PB 5F2DA 3TP5A 2K9XA 2NBFA 5M5WB 5CV5A 3G6JB 3VR5A 4BS9A 2XSCA 3OMGA 3NTKA 1RF2D 1ILPA 3OWFA 2JYTA 1OQQA 1BUVT 2M2LA 4PMWA 4DAPA 1XCQL 1VF7A 2L0CA 2WLBA 4XWTA 4LLGM 2MJ3A 2PQEA 3AB5A 3I70A 4XT3B 5DM73 2CVRA 3I4NB 1U9RA 3S2HB 1PRTB 2W55A 1ZUD2 1DOMA 1IUEA 1EWHA 1UWMA 4RKLA 1J9OA 3V05A 1CHPD 3UI2A 1JWMD 5HI1A 2EZVA 3T53B 1JWSD 3TP8A 4X3UA 2JX5A 2BTEA 2B2VC 1SSNA 2NVYB 4A3KB 3FAHA 3MA2B 4L2YA 4ZUIA 3T56B 2K22A 4ZHOA 1XLPA 3LWUA 1SIJA 3GTQB 4MM3B 3W9CB 1S4ZA 1JOQA 4WRDA 2F0FA 3TZDA 4HJGE 2LHEA 2YU9B 2OHFA 2L11A 3I4MB 3PO3B 1KABA 4ABNA 1MVKA 2B2VA 4FYDA 4RGMA 4MH8A 2M9VA 4XYQA 2KOLA 5EQ0A 4HKZE 2JA5B 1EY5A 3PUYA 1TT2A 1PGBA 4MIUA 1ZDXA 2BB6A 2N0SB 1F2MA 5T1IA 3JAML 3W2DA 3FEWX 3KLSX 3H3VC 4KY5A 5T8IA 4ZK9B 1PRTD 1I3QB 3OIQA 1SNQA 4DNRB 5I9OA 3WOEA 5FR3A 3WOFA 4WORA 2AQ1B 1LT3D 1TQOA 1YNJC 4HEA1 1YN3A 3V3XA 2YYZA 2XWBB 5BN3A 1ZOYB 4HMIA 4HEDA 3GP7A 1ENAA 3C1EA 2IL8A 4FO2A 2LJIA 1HUNA 3LNNA 5FO7B 2CJNA 2IX1A 4IZ8A 4IFDH 4CKBA 4XT1B 5K36H 1BBXC 1PGXA 2WKDA 1K50A 2EYMA 3S1QB 2M00A 2SDFA 2AWOA 2NN6H 1VRAB 2WXMA 1BUIC 1SE3A 3EA6A 1STAA 1L0VB 4N9TA 5KNDA 2JXTA 1H9MA 2EELA 4E6IA 2WXGA 3AE1B 1YQ3B 3D4WA 3Q23A 2RSNA 1QLBB 2E74C 3RMHA 1NAPA 1TS2A 2EYJA 4DA2A 4X3KA 2X69A 1ZXIA 1LTBD 5AUIA 2R61A 3K59A 4FXDA 3FKIB 2F0NA 1IL8A 2QCPX 2Q8TA 1Q8IA 2PO4A 1CM9A 2ICIA 1TKYA 4ZYSA 3S15B 2EYLA 3OW7A 4HROA 1DOYA 2F3VA 3U7ZA 4HR7B 5KRUA 1Q12A 3HVZA 4L23A 1XLQA 5I6YA 1MI2A 3EVQA 3PUXA 4M8AA 1HZ5A 2W3SA 2KQ4X 3AEDB 1M4VA 3IT6B 2LY7A 1H9SB 4OVZA 2D5DA 1PTOC 1WCMB 1E0BA 4ILWA 3HS0C 4KY6A 1ML0D 3FVQA 1PFNA 2MJ8A 5EE0A 2DWQA 2D2CC 4ULLA 4NAWB 1KRHA 3HVDA 2B76B 3K5NA 3GTPB 4FF2A 4WAFA 4IKGA 4R8NA 3NXWA 4NMZA 1EY7A 1R7SA 2WXFA 1LV9A 1MGSA 1GUNA 3VRBB 5BMGA 2MJEA 3PUZA 4F87A 1WTWA 2WXPA 1BXTA 4TQUS 4LK0M 1DONA 4KGRA 4C3HB 1I6HB 5D7GA 5EBDA 3D3RA 5KNCA 2X38A 2ICEC 2HDEA 4TMAB 2A6EC 2H1EA 2HCIA 3N6RA 1GHKA 3ZGZA 1Y8NB 3M85A 1ZXHA 1GB1A 1MPEA 4RGTA 4CBVA 3S16B 1VMPA 4PQXA 3TDQA 2QJLA 1AP0A 4YIJA 4O42A 1BOSA 1TWFB 1D6EC 1F2YA 3SHLA 3ABVB 1HFNA 2OEDA 2V4DA 4KN7C 1U4RA 1II3A 2WAQB 1ET9A 3F2UA 2WV6D 3R2IA 1R4QB 4USAA 2FFKB 3LYYA 5HFYA 2JQRB 5E3FA 1FFVA 4DNTB 5C5MA 1SNPA 4H7BA 1YNND 4KKSA 5K5PA 2IX0A 1C77A 3VR8B 5A35A 4KKTA 5JVG3 1SNCA 3S14B 2WXQA 2IWHA 5JPMC 4BWGB 1LTTD 2LHDA 3GB1A 3OHXC 4MN3A 1OXXK 2K33A 1LLRD 5EKIA 1C4CA 1B9MA 2QEJC 5HG2A 1O7LA 5EE9A 4P6VF 1QILA 2W54A 2B2WC 1GUWA 3PV0A 2DYMA 1A15A 3K57A 2F0UA 5G5GA 2OT2A 2PNRC 2F0KA 4RNAA 2QMTA 5CORA 3TP7A 5LHY1 5CGKA 1C79A 4D2KA 3HP3A 3P4SB 1XTCD 5C0XG 2BS4B 4XQQA 3Q22A 1SJED 1Y8PB 5IGFA 4L6TB 5BMHA 3IKJA