3EC8A

The crystal structure of the ra domain of flj10324 (radil)
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
149
structure length
139
Chain Sequence
GTENLYFQSMDPAELSTQLSAPGVLKVFGDSTGTHYKSVLATGTSSARELVKEALERYALDPRQAGQYVLCDVVGWQARCFRVFGDSEKPLLIQELWKPREGLSRRFELRKRSDVEELAAKEVDTITAGINAQARRLQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords Putative uncharacterized protein FLJ10324
publication title The crystal structure of the RA domain of FLJ10324 (RADIL)
rcsb
source organism Homo sapiens
total genus 41
structure length 139
sequence length 149
ec nomenclature
pdb deposition date 2008-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00788 RA Ras association (RalGDS/AF-6) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3ec8A00
3H7PA 1UBQA 4FADA 3DVGX 3SD5A 1XQQA 3RT3B 1WR6E 3A33B 1I35A 1XD3B 2RPQA 1E8ZA 2JUOA 1TTNA 2KDIA 2KXJA 2N4FA 3AI5A 3N3KB 3VFKA 3IHPC 3UIOB 4PS8A 3PTFC 4DDGD 2LRWA 3JSVA 3APCA 1WJNA 3V61A 2DZMA 2KWCA 3KH0A 4FLHA 2WYQA 4BVUC 3PV1A 1P9DU 3LJ3A 4GB9A 4WJQA 3OAWA 4P7IA 3PGEA 4ANXA 2KJ6A 2ZVOA 2BKRB 3RD2A 2BKFA 3SHQA 2KWUB 1UD7A 1WM3A 1WZ3A 2JZ3B 3PRMB 4IC7B 1ZGUB 2EKEC 4WJNA 5GMVA 3ZDTA 2W9NA 1YQBA 3I3TB 2D11A 4LDTD 3ZKJC 2MA9B 1IYFA 2KC1A 3ZLZA 2ZPNA 1WZ0A 2C7NB 1V5TA 2DZJA 3GOEA 5D94A 4ANVA 4ANWA 1YJ1A 3B0AA 3QK0A 1S1QB 1Y8RC 4GDLB 1P98A 1WGGA 1YIWA 2KLCA 2V3SA 4FHKA 2MBOA 1WH3A 2G3QB 2KD0A 2RSUA 1E90A 2LXCA 3A1QA 1IPGA 5CTRC 1RFAA 3WIMA 3DVNV 3ZDMC 2UYZB 2KTFA 5D2MB 1SGHA 2KWVB 4EZKA 1T0YA 3VVWB 2ZPYA 2EMSA 3ZNZB 2WX1A 2LRUA 2MP2A 4IM2A 4JQWC 4B95A 2KJRA 2N9XA 4DHZB 1GJZA 1RAXA 2KO3A 4E3CA 5G2NA 1TZ1A 2L3ZA 2OOBB 3M95A 3ML8A 3L17A 4EOYA 5C1ZA 2BYEA 2BYVE 4W9KA 5EDSA 5HKHA 1UZXB 3DPDA 4ANUA 3B08A 2B3AA 2LGDA 4KZ0A 4G50A 5BO4B 5DCNA 1E7UA 1JRUA 1ZW7A 2ZEQA 1L7YA 3DQVA 4ICUA 4EUTA 1WRDB 2D3GA 3SU8X 5J18A 3UQAA 3ALBA 2V4LA 2Z59B 3IG3A 2CHXA 2J0KA 4FA6A 3P2BA 4DDID 4WJPA 4KDLB 4ZRKA 3VUWA 1KM7A 4GN1A 2DENB 3ZRCA 1WX9A 5KHQA 2AWTA 2YVCA 1WY8A 2K1FA 2K6QA 5J2RA 1WM2A 4K81A 2O6VB 3A9JB 4TQ0A 2D07B 3PHWB 3H9DA 4HVBA 4I6LB 4OVUA 3V6EB 2DZKA 3A9KB 4FULA 3PPAA 2LI5A 3L08A 4W9CA 1M94A 2KDBA 1WGRA 1P0RA 2KK8A 4KSKC 2DYMA 2NBWB 3PRPB 1J19A 1J0GA 2N9PC 3ZO5B 1NDDA 3R7QA 3A4SC 4MSQB 2L05A 2KTRA 2NS5A 1WI0A 1E8XA 5C23A 2ZNVC 2ASQA 2LUEA 4KIKB 4XZ4A 3DBHI 3VTVA 2MLBA 2BPSA 4ZRJA 3T9LA 2REXA 3W1YA 2M4NA 4BKTA 3KUDB 4JLCA 3VTUA 1R4NI 2R2OA 3IFWB 4G11A 1SIFA 4AJWA 2JVCA 3N30A 5E6NA 1IP9A 4AOFA 3EC8A 1H4RA 2NPTB 1EO6A 2NBUA 2JXXA 3PZDA 2Z0DB 4KV2A 3TIXA 1SE9A 3M3JA 3HM6X 1WXMA 1RRBA 2KZRA 1WXAA 2MQJA 2M17A 3KUCB 3L16A 4OVVA 2KOXA 4URKA 4IWQA 2IY0B 1GG3A 2K39A 4BBNC 3QJZA 4GIVA 4HCPB 3JVZX 2N7DA 2CHWA 3EECA 4X57B 1I42A 3R3MA 3SDLC 2RD0A 3QIJA 2NCNA 4HWIB 4TV3A 4MJSB 2DAJA 1GUAB 1YX5B 1EF1A 2CHZA 4IWPA 2AYOB 5DPRA 3VUXA 1GNUA 2DYOA 4BBNF 3T8MA 1OEYJ 1YD8U 3QCAA 2K8HA 2DZIA 1E5WA 4E74A 2LGYA 3R7RA 4LCDE 4KSLC 4IM3A 4GDKA 2Z0EB 2DX5B 4W9FA 3H1UA 3X23A 2M1MA 2R2QA 2L7RA 1E8YA 3MJWA 1E8WA 5IA7A 4MDKE 1L2NA 2O2VB 1UBIA 3V62A 4FN2A 3ML9A 2ZCCA 3D32A 4DHJD 5D7GA 1WJ6A 1V80A 2KFKB 4ZDVA 4NQLB 1Z2MA 3ZW3A 4CYEA 3L0WB 2JWZA 1HE8A 3ZNHB 4GSWA 3H7PB 3IVFA 4G3XB 2C9WB 3PSEB 2I1KA 1R4MI 4JIOU 4DXAB 3VH3B 4G0NB 2LJ5A 5DPSA 3HHMA 1GC6A 5JHAA 2OJRA 2IY1B 3V60A 5DPWA 4IUMB 3QX1A 3DBRI 3QARA 2JZZA 3VAWA 1OQYA 1QZEA 3HM3A 3X0WA 3JSVB 3VTWA 1S3SG 3TL5A 2AL6A 2ZZPB 3K9OB 4XC2A 2KX3A 1KJTA 1NBFC 2BGFA 1BT0A 2WWZA 1EUVB 5KHOA 1V6EA 4DBGA 4MEMA 5G55A 3NOBA 2FAZA 3QAQA 5TR5A 3W1SA 1J8CA 2LD9A 3UQBA 1FXTB 1H8CA 1CMXB 2KX0A 3DDCB 3PRZA 1LQBA 4F8CB 3ZTDA 2KMCA 1Q5WB 2GBKA 4AP4C 3DBSA 2CU1A 4FJYA 5E6OA 2J7QB 4MGYE 2ZNVB 1WXVA 3DOWA 4B6WA 5JHBA 4E71A 3QQ8B 2LVQA 1WX7A 4AUQC 2JT4B 3R66C 3A9JA 4EEWA 2BWES 4NNJB 4KVGB 4EKUA 4F1SA 1OEYA 4FBJB 1Q0WB 3PHXB 3A1QB 3ZUNA 2XEWA 3ZIMA 2JPHA 3DVNU 1ZKHA 2GOWA 2N1VA 3ONSA 2ZVNA 3KYCD 1OGWA 1OTRB 1XT9B 2LXAA 3KYDD 4HJKA 4TKNA 4ICVA 4K7UA 4TQ1A 5AZFA 3S2AA 4FHJA 2MBQA 3PT2B 4EZLA 4FJVB 1RLFA 2LWPA 4AJYB 2FCMA 3B1LX 4KIKA 4MSMB 4WWPA 2IO0B 1WIAA 4I6PA 2CR5A 2FNJB 1UGMA 2MBHA 3RUIB 2G45B 3RYTA 1VCBA 3NZUA 3WALA 1A5RA 4IW0A 3QC8B 3WAMA 2FIFA 2NPTA 3L54A 1V9JA 4WWNA 4PYUA 3TMPB 2DYBA 2XK5B 3MTNB 1EF5A 1F9JA 2C7HA 2L0TA 4BKGA 2KANA 3UF8A 4DWFA 5LLIA 4NAWA 2QHOA 4FJZA 2XBBC 3JYUA 4A20A 4IG7B 2KDFB 2KKCA 3CMMB 4W9HA 1WGYA 2MBEA 1E7VA 3AULA 3UGBB 2C60A 2CS4A 2G4SA 3PREA 1VD2A 1WR1A 2LASA 2IZVB 3QWZB 5IAAC 4YL8A 3NHEB 4EFOA 3ECIA 4LDTB 2IO2B 4IM0A 2L76A 2AEHA 4KDIC 3W1SC 1MG8A 5AZGA 3WANA 4CO7A 5LXHA 4LJOB 2N1WA 2IO3B 4A3PA 3HK0A 1WMHB 5J17A 5JZEB 1WFYA 2J0MA 4M8NA 2V1YA 1WJUA 2VRRB 2KTRB 3L13A 1UH6A 2JRIB 2GBNA 4JGHB 3LDZE 3OJ3A 1GC7A 3TCAA 3VQIA 3VHTC 4M0WB 4HDOA 4BOSC 2FCNA 2KLGA 1D3ZA 2D2QA 3C0RB 1UELA 2JY6A 2O2VA 3KUZA 3RZWC 3DBLI 3UIPB 4BKSD 1V86A 1V2YA 3PVLA 2C7MB 4K7SA 2O6VD 3JW0X 3H7SA 2BYFA 2DHZA 2YLMA 4GMVA 1PQSA 5DPTA 1LXDA 3A4RA 2RGFA 4GXBA 1TGZB 3TBLD 1WGHA 2MCNB 4W9EA 3U8ZA 3UINB 5LXIB 2GBJA 4NJ6A 4BFRA 4GDLA 1V81A 4II2B 1KOTA 5AEKB 1V5OA 3QA8A 2MWSB 3K9PB 2D10A 4NY0A 2JRHA 4GU2A 2BWFA 3PS6A 2WX0A 2HTHA 2NR2A 2IO1B 3Q3FA 4IWOA 2A5UA 2IYDB 2L0FA 2LVPA 2PE9A 2A4ZA 2MBBB 4M8MA 4PYZA 4MM3A 1WGDA 3NS8A 3AXCA 2MX2A 3TJPA 2GBMA 4HDQA 4DK5A 2G4DB 1P1AA 3PLVA 2RR9A 3CSFA 4CHKA 3CF6E 4HXDA 4GDKB 2C5LC 2KN5A 2PEAA 4NQKE 4W9DA 4W9LA 2GMIC 5CX3A 4ZRIA 2MW5A 4MH0E 1WE7A 2M0XA 3GZNI 5FR6A 3U7DA 3VH4B 4WWOA 3RCZA 1C3TA 2FUHB 4GGQA 4RM8A 3EHVA 4WAAA 5JH5C 1LM8B 2KJHB 2NVUI 2PJHA 2JF5A 4RM9A 1WF9A 1WJ4A 3PLUA 4TUUA 3HIZA 3O65B 2K6DB 2ZCBA 4HCNB 2CKHB 3AU4A 2N9EB 3N32A 4BKSA 4F7ZA 2ZJDA 2KMAA 2O6VA 3M63B 4AWJA 4BOZB 2HJ8A 1AARA 3KW5B 4B9KA 3A9KA 3V6CB 4W9GA 3NZSA 3DCGA 4MGIE 2PPHA 3ZTCA 1WE6A 3NY5A 2J0JA 4MGKE 2LGXA 5CHFA 1NI2A 2DAFA 4DHZE 2MP2B 4KZCA 3APDA 3ZNGC 1Z5SB 2HD5B 3BINA 2NBVB 3U30A 4NJ7A 3DVGY 2XK5A 4WQOB 3ZNID 2BF8B 1Q1OA 2LZ6A 2KQ7A 3BY4B 3WAOA 1WYWB 3VXWA 1TBEA 2K25A 3RULA 5CHWA 2FCQA 2KDEB 3L10B 2KVRA 4PS3A 1WXSA 3OLMD 3ZRFA 2IBIB 3VDZA 3QHTA 4NPNA 1G6JA 2K8BA 4I6NB 4MELA 2FIDA 2FCSA 5CHVC 2L00B 1WX8A 2KC2A 4HPLB 3ZVVA 4W9IA 3AU5A 4GOCA 1WMHA 2I1JA 2KHWB 3RZFA 1U4AA 4K1RB 4II3B 4XX5A 2HE7A 5E6PA 3WAPA 1KLVA 4DHJB 2MSED 2AL3A 5L95C 4LJPB 2L8JA 4MJSA 4EZJA 1YX6B 5L83A 3ENEA 2EMTA 4HPMB 4WJOA 4N9F4 5AZHA 2KNBA 3VUYA 4HK2A 3WA0A 1LFDA 4J6IA 3OJ4B 2Y5BB 2M8SA 1C1YB 2MRPA 2KFJA 4ZYNA 2WDTB 3MHSD 1P3QU 2LVOA 1V49A 3EFUA 2KQSA 3IBEA 1X1MA 5D6JB 2N7EA 3Q3JA 1K8RB 4HLEA 4NAWB 3KVFB 4A3OA 4JL9A 3CSTA 4MGZE 3H6NA 4PS7A 3M62B 1ISNA 2KFKA 2UWQA 4K7WA 4W9JA 2GBRA 4ASWC 4RMAA 3APFA 2K8CA 2PE6B
chains in the Genus database with same CATH superfamily
1XLOA 3H7PA 3SD5A 1XD3B 2BB5A 2KXJA 4P16A 2V3NA 4C7YA 4LNOA 3PTFC 4YTNB 1JCKB 2DZMA 4FLHA 4NJCA 5HI1A 2QJLA 3PGEA 2BKFA 2KWUB 3PRMB 3AE4B 2PVGC 3RI7C 2EKEC 1C9FA 5GMVA 3ETRA 1XLNA 4HPPA 3C19A 2MA9B 4US9A 5C2TB 3NVVA 5IO9A 1VRAB 1Y8RC 1WGGA 2V3SA 2RSUA 1E90A 2VH2A 3A1QA 4J3OD 2D5GA 1GOZA 2KTFA 2KWVB 3VVWB 3ZYYX 2MP2A 3N9YC 4B95A 4MM3B 1GJZA 1FFUA 2KVZA 4HROA 1MI0A 3M95A 5C1ZA 1P7FA 3L17A 5EE9A 1UZXB 3B08A 4DXFA 5DCNA 2LGSA 1ZW7A 2LMCA 3I63C 3DQVA 3DHIC 1ET9A 2NTTA 4EUTA 3SU8X 3UQAA 3ALBA 4NZLB 3NZ3A 4P1CC 1UGJA 2J0KA 1QOFA 4B0MA 4ZRKA 1I4GA 3RNAC 1FNWA 1KM7A 1JROA 4YTPB 2YEPB 3Q6BA 2IJ0A 1P7EA 3GB1A 1WY8A 4HJGE 1F2RC 3A9JB 4HVBA 4I6LB 1ENFA 3V6EB 1SIJA 3V05A 1FCCC 1TYGB 1M94A 2OJWA 4HKZE 1WGRA 4OW0A 4KSKC 2DYMA 2N9PC 2Y3AA 3ZO5B 3R7QA 4JX1C 4XZ4A 2WDQB 2BPSA 3PZ8A 1K50A 4LNIA 3W1YA 4BKTA 1ZPSA 2JXTA 1TZOA 4AJWA 3RNEC 2EELA 4A90A 2L52A 2NPTB 2WXJA 1HQRD 2NBUA 3PZDA 3CWIA 3FILB 4KV2A 4AQ7A 1SE9A 1I4PA 2JYTA 3BWUD 2KZRA 3KUCB 4OVVA 4URKA 2K39A 4BBNC 2N7DA 4REZA 3MC8A 1SF0A 4HWIB 4DQOC 3VUXA 2LFIA 3FKYA 4BBNF 1NYRA 1YD8U 2K8HA 3PZ7A 2DZIA 1R4MB 2LGYA 1FMAD 1SJED 4IM3A 4WH4A 4GDKA 1T5XD 3TEYA 2R2QA 3DBRB 4NAMA 1E8YA 3MJWA 1E8WA 3HVZA 4YSXB 4MDKE 1L2NA 1YMHE 1V80A 3ZW3A 3L0WB 4MT5A 4GSWA 1J7CA 2I1KA 4G0NB 5DPSA 5IP4D 3HHMA 5DPWA 3QX1A 2VZKD 1OQYA 3VTWA 2AL6A 1C76A 1N6ZA 2D3AA 1QKZA 4ARCA 3QAQA 3ABVB 5T8IA 1J8CA 3MC0B 1FXTB 3P42A 2K5PA 1LQBA 4F8CB 4US8A 2KMCA 1MVKA 2CU1A 1B1ZA 4MGYE 2ZNVB 3DOWA 1GAQB 1F2RI 2ZW1A 3MHZA 1I4XA 1E0ZA 4NNJB 2QCZA 4KVGB 4EKUA 2FUG1 3ZUNA 2JPHA 3DVNU 1ZKHA 2GOWA 2N1VA 5E6OA 2KYWA 1VR9A 1XT9B 4K7UA 3S2AA 4FHJA 4EZLA 4FJVB 1RLFA 2LWPA 4AJYB 4MSMB 2HDEA 3DWGC 2BYTA 1UNSA 1DOXA 1N63A 1V9JA 3MP9A 3TMPB 1F9JA 2C7HA 5C3JB 2W3SA 3P4RB 2QHOA 1KLUD 1E9MA 2V4IB 1WGYA 4S0RA 3BVMA 3AULA 2D3CA 3DWMA 2G4SA 1QF6A 1SE3A 3C8YA 1WR1A 3Q2AC 3ZJUA 4L2YA 4YL8A 3N1ZC 3NHEB 4EE2A 2IO2B 5FKAC 3WANA 1KLGD 4A3PA 1WMHB 5JZEB 1WFYA 4M8NA 2VRRB 5FK9C 2KTRB 3L13A 1UH6A 1TS3A 2LGIA 3ZJTA 3GS2A 2ONQA 3P63A 4BOSC 3VHTC 2FCNA 1UELA 4B0EA 3RZWC 1V2YA 2L1AA 2O6VD 3EUB2 4FXCA 3Q8FA 5DPTA 3A4RA 4GXBA 1TGZB 1KH0A 2MCNB 3EFCA 4KGTA 4LNFA 1GB4A 4II2B 1Y56A 1V5OA 4ACFA 5BMHA 1OQQA 3PS6A 2KQ4X 4IWOA 2L0FA 2IYDB 2PE9A 4PYZA 4MM3A 1WGDA 2ZW0A 4XWWA 4RGNA 5H8YE 2V0GA 4D2KA 2BS3B 1FNVA 4CHKA 2WXNA 2VH1A 3BYTB 2IGDA 5CX3A 4ZRIA 4MH0E 1WE7A 2M0XA 1CJEA 1LGRA 3AE1B 2RPVA 1L0VB 4GGQA 1ACCA 2JF5A 4RM9A 1WF9A 3OG5A 1TKGA 3O65B 2ZCBA 3KQ4A 3SFDB 2WXOA 4F7ZA 4AWJA 3M63B 1B9RA 1AARA 4B9KA 2JSVX 1DOYA 4W9GA 4MGIE 3B2GA 2LGXA 1NI2A 2MP2B 1Z5SB 4RGMA 1JQ4A 2DBYA 3U30A 2XK5A 3ZNID 2BF8B 3AEBB 3BY4B 3WAOA 3VXWA 3RULA 2BQQA 5MPOA 3TSSA 3W5VB 3FILA 3OLMD 3QHTA 4MELA 3BIID 2FIDA 2FCSA 2QSDA 3ZQ4A 1WX8A 4HPLB 3ZVVA 3VR9B 3RZFA 1JWBD 1M4VA 2KHWB 3MJ5A 2AL3A 1EU3A 2RDGA 2L8JA 4HPMB 4WJOA 2JQRB 4N9F4 5AZHA 1D6EC 3SR6A 2DWQA 5G5HA 3AE9B 1UWMA 4OHJA 4LNKA 1C1YB 2KFJA 2VZKB 4KKJA 2WDTB 5IKCM 1SE2A 2LVOA 4XDCA 3EFUA 2D3BA 1X1MA 3AN1A 2H89B 5D6JB 4A3OA 2EKIA 3M62B 1ISNA 2YEPF 4RMAA 2K8CA 2PE6B 4UDUC 2HJ1A 4FADA 3DVGX 1XQQA 3RT3B 1WR6E 1TTNA 2ACZB 4KX6B 2KDIA 2N4FA 3AI5A 3N3KB 1PUTA 4KKIA 3KH0A 4RCOA 2WXLA 3PV1A 1P9DU 2GI9A 1QILA 1KFYB 1D4BA 1KTKA 4GLSC 1JWMD 1UD7A 1WM3A 4IC7B 1ZGUB 3AE5B 2J4XA 3KWVA 2D11A 1C79A 4LDTD 1WZ0A 1NEKB 2Y5PA 1YN5A 3TEXA 3B0AA 4ANWA 2PVOD 2JU6X 1S1QB 1T0QC 2I2YA 3AEAB 1P98A 1YIWA 2MBOA 2LXCA 2G1EA 2WXIA 2UYZB 5D2MB 4EZKA 1T0YA 3ZNZB 4IM2A 2KJRA 4ZHOA 4E3CA 5G2NA 4RF0A 1VZ6A 2L3ZA 1TT5B 2BYEA 5EDSA 4R3DA 2LGDA 4KZ0A 4ICUA 1K51A 2INCC 2RMMA 2WXHA 2V4LA 3IG3A 2CHXA 1IGDA 4GN1A 2DENB 3ZRCA 5KHQA 1PFDA 3LYYA 4PT5A 2O6VB 4TQ0A 2D07B 1R4NB 3H9DA 2DZKA 2SAKA 4HEA1 3A9KB 4FULA 1EWCA 3PPAA 2KDBA 1P0RA 3ZJVA 2NBWB 3PRPB 1J0GA 4MSQB 2KTRA 2NS5A 1E8XA 1JMLA 2ZNVC 2ASQA 3VTVA 1I4QA 2MLBA 3T9LA 2REXA 3VTUA 3BK2A 3Q69A 5BYQA 3RN9C 1IP9A 3EC8A 2INDC 3TUOA 2Z0DB 2I38A 3TIXA 5TSSA 3HM6X 1PGXA 1RRBA 3RNCC 1WXAA 4WURA 3L16A 1CQVA 2KOXA 4QAYA 2IY0B 1GG3A 1F52A 4HCPB 4X57B 1I42A 4RFBA 2NCNA 1QT9A 4TV3A 2DAJA 1HTOA 1GUAB 2KDMA 5DPRA 2CHZA 1GNUA 2DYOA 1BMLC 3IXSA 3QCAA 3GP7A 2PIAA 2R61A 2M1MA 5IA7A 2LHEA 2H88B 3V62A 4DHJD 5D7GA 1QQRA 1VDVA 2KFKB 1FPYA 1FD6A 2JWZA 1HE8A 3I9V1 3ZNHB 2IDYA 1XEEA 2CJOA 3IVFA 4G3XB 2C9WB 1R4MI 4JIOU 3T3OA 2PMVA 2OJRA 1YOVB 2WXGA 3QARA 3DBRI 3L4PA 3X0WA 1S3SG 3TL5A 2AQ1B 1QLBB 2ZZPB 3K9OB 1NBFC 1BT0A 5KHOA 1V6EA 2FAZA 5TR5A 2LD9A 1H8CA 3DDCB 5D3IB 3DBSA 4B6WA 5HG2A 4AUQC 1ZE3D 3R66C 4K3CA 3ZIMA 2NMQA 3ONSA 3KYCD 4PK1A 4ANUA 2LXAA 3VRAB 2L83A 3T3NA 4L1BA 3B1LX 1TS5A 2RDHA 3AV8A 4N59A 2MBHA 3RUIB 2WXFA 3NZUA 1ROEA 3AM9A 2W54A 1A5RA 2PTLA 3L54A 4WWNA 3URYA 2XK5B 1EF5A 1HTQA 4DWFA 5LLIA 3U7ZA 2XBBC 4IG7B 2KDFB 3RNFC 3CMMB 1E7VA 4ARIA 2C60A 2CS4A 1YNTE 1VD2A 2LASA 1T0RC 2IZVB 5IAAC 4EFOA 3ECIA 4LDTB 4IM0A 4KDIC 2LHDA 5LXHA 3R2IA 3HK0A 1WJUA 4KGRA 1R7SA 2GBNA 4JGHB 3LDZE 4RH6A 4M0WB 4HDOA 1V1PA 1D3ZA 2D2QA 4RNAA 1RM6C 2O2VA 3KUZA 4BKSD 4K7SA 3H7SA 2DHZA 4A6QA 1JRPA 3LB8C 4MACA 2QDFA 2GBJA 4NJ6A 5E6JA 5AEKB 2XN9C 3TEZA 2JRHA 2NR2A 2IO1B 2N0SB 3AMZA 1F0ZA 4M00A 1ZDXA 2WXMA 5HFYA 3AXCA 4IDIA 3TJPA 1L4ZB 1N62A 1P1AA 4IOIE 3PLVA 4C80A 3CSFA 3CF6E 3W2DA 2PEAA 1HZ5A 4C4VB 4W9LA 2GMIC 2MW5A 2LJIA 3VH4B 2SEBD 4WWOA 3RCZA 4N6EB 3EHVA 4WAAA 1AN8A 2KJHB 2NVUI 1WJ4A 2K6DB 2CKHB 2LUMA 2O6VA 2HJ8A 5BMGA 3A9KA 4IKGA 2PPHA 1WE6A 2W55A 4MGKE 2UU7A 5CHFA 5EE1A 2DAFA 3ZNGC 1J7BA 2HD5B 2NBVB 4WQOB 3BZDB 2KQ7A 3B2FA 1WYWB 1QOAA 2KDEB 2B76B 3AE3B 3V3XA 3VDZA 3N20C 4HRSA 1YN3A 2AX5A 4NPNA 1VJKA 4I6NB 1PYWD 1XCQL 4OZAA 2I1JA 1U4AA 4XX5A 4DHJB 5L95C 3O13A 4LJPB 1YX6B 3ENEA 2KNBA 4HK2A 1MJDA 1TY0A 4RGOS 4USAA 2IGHA 2MRPA 4ZYNA 3MHSD 1EU4A 2E6XA 3IBEA 2WU2B 1RYJA 2N7EA 3Q3JA 1K8RB 4JL9A 4P1BC 3H6NA 4PS7A 1ET6A 2KFKA 2WXQA 2V3PA 1I35A 2WXRA 1WWTA 3A33B 2RPQA 1E8ZA 2JUOA 1HEZE 1ESFA 3VFKA 1VZ7A 4PS8A 3APCA 2K9XA 1F1HA 3V61A 3PO0A 4YSZB 3ZGZA 1TIFA 3LJ3A 4GB9A 4WJQA 3OAWA 4DXGA 2BS4B 3RFZB 2KJ6A 3RD2A 4TMAB 3SHQA 2J53A 2QMTA 3ZDTA 2W9NA 1NI3A 3EA6A 1IYFA 2KC1A 1FRRA 4ANVA 2N9LA 1WSPA 1YJ1A 1EWYC 1DGJA 4GDLB 2K0PA 2KLCA 4FHKA 2KD0A 5CTRC 1YQ4B 3WIMA 3DVNV 3ZDMC 4M01A 1HA5A 1K53A 2EMSA 2ZPYA 3Q8EA 2IPKD 4DHZB 2N9XA 3DHHC 2KO3A 1WXQA 4C00A 2OEDA 2BYVE 4W9KA 1DYQA 5HKHA 4BAXA 2WS3B 4G50A 1JRUA 4N58A 3Q8BA 3BVZA 2D3GA 5HHDG 2INNE 3LXFA 4FA6A 3P2BA 3HVDA 4WJPA 1FEHA 3VUWA 2MHJA 1WX9A 3DBHB 3DHGC 4YT0B 1J7AA 5J2RA 5LNK1 2N7JA 2LI5A 4W9CA 3SEBA 1IBXB 3CIRB 1J19A 1NDDA 1ZDVA 3P4QB 3A4SC 1YJJA 2L05A 1WI0A 1DOIA 1C4PA 1GPXA 3IT6B 5C23A 2LUEA 4ZRJA 3NUHB 4M0WA 1R4NI 2R2OA 1LO5D 1NYQA 1SIFA 2DLBA 5E6NA 1H4RA 2JXXA 3M3JA 1WXMA 4A9AA 4IWQA 4JE3B 2K3UA 3N1YC 3QJZA 3JVZX 2CHWA 3R3MA 1V1OA 3SDLC 4RGTA 1FFVA 4XDDA 4XYCA 4MJSB 1YX5B 1EF1A 4IWPA 2J52A 1OEYJ 1YN4A 1E5WA 3N1XC 4LCDE 3E56A 2Z0EB 2DX5B 1JALA 3X23A 4C4VA 1V1PB 2K22A 3NJTA 2O2VB 1UBIA 4FN2A 3ML9A 5JXVA 1IGCA 1WJ6A 4NQLB 2L32A 3AE7B 3AECB 3PSEB 1TY2A 2LJ5A 4Q2JA 2IY1B 4YXDB 2QC8A 3VAWA 1NVID 3JSVB 1EM7A 4XC2A 1GB1A 1KJTA 1XO3A 2BGFA 2WWZA 4DBGA 3Q14C 3UQBA 2QEJC 1CMXB 1YJIA 5IN7A 3PRZA 1V8CA 1Q5WB 4AP4C 4FJYA 2J7QB 3AE8B 4ZHPA 4E71A 3QQ8B 3RMKC 4A8XC 2FE8A 2BWES 3VR8B 4FBJB 1Q0WB 3AEFB 2XEWA 3EGRA 1OTRB 5AZFA 4TQ1A 2GLSA 4ICVA 2MBQA 2FCMA 4KIKA 2OHFA 2IO0B 1WIAA 2FNJB 2WP9B 1K52A 2G45B 1WYGA 3RYTA 1VCBA 1KRHA 4IW0A 3QC8B 3WAMA 4HKQA 1SEBD 4PYUA 2JZPA 3MTNB 4OZCA 3RNGC 3UF8A 1L6UA 3BVGA 4FJZA 3UI3A 3JYUA 2KWDA 2MH7A 4ZOHC 2KKCA 2MBEA 3UGBB 3PREA 1L6VA 3VRBB 3QWZB 4A55A 3DBLB 2AEHA 1MG8A 4LJOB 3P1MA 2IO3B 5J17A 3Q8CA 4LLGM 4XWTA 2J0MA 2V1YA 1FCLA 1N5WA 2ON8A 3OJ3A 2NTSA 1MHXA 3IAS1 2JY6A 1RWSA 1V86A 3PVLA 2C7MB 1SBBB 4GMVA 5G5GA 1LXDA 2GRIA 4MH8A 5LXIB 2KACA 2WU5B 2BB6A 4GDLA 5FR3A 2MWSB 3K9PB 1I7HA 2BWFA 3R2TA 3P4SB 2HTHA 1CZPA 2A5UA 3GZNB 2LVPA 2A4ZA 2BVCA 2GBMA 4HDQA 5BMIA 2G4DB 1V97A 1L4DB 4HXDA 1C78A 5EE0A 5GXGB 1XF5L 5AUKA 4NQKE 4W9DA 5I4DA 5FR6A 3U7DA 1C3TA 2M0AA 2FUHB 3IT4B 5JH5C 1LM8B 3BK1A 3W9CB 2WGSA 4BKSA 1D5XC 2KMAA 2BT6A 3KW5B 1JWSD 1L5PA 4C7ZA 1MFWA 3DCGA 2DNFA 1IBXA 4DHZE 4KZCA 3APDA 1AWDA 3BINA 3MFGA 4NJ7A 3Q3OC 1Q1OA 2LZ6A 1TBEA 2K25A 1ZOYB 1N60A 1D5ZC 4L23A 2WXKA 4PS3A 3ZRFA 3NVZA 1G6JA 2K8BA 5H92C 1SSNA 5CHVC 3Q8AA 3ZXVA 2FBWB 3AU5A 3WAPA 2WDVB 2MSED 4YTMB 3OWEB 4K3BA 4MJSA 4ITKA 1N61A 1FM0D 1LFDA 3FAHA 2WLBA 3OJ4B 2Y5BB 2M8SA 2BTEA 1P3QU 1QOGA 2KQSA 5BYRA 1E7PB 1T0SC 4HLEA 4NAWB 3KVFB 3CSTA 2G9HD 3AEDB 2UWQA 4K7WA 4W9JA 2GBRA 3APFA 3QA8A 1UBQA 1HXYD 1WGKA 1VZ8A 1D5MC 1L0XB 4JWSC 1OFFA 3NVWA 3IHPC 2KT7A 3UIOB 1SE4A 4DDGD 2LRWA 3JSVA 1WJNA 2KWCA 2WYQA 4BVUC 2CJNA 3AB5A 4P7IA 4ANXA 2ZVOA 2BKRB 2Y5CA 2JZ3B 1WZ3A 4WJNA 1JWAD 1YQBA 3I3TB 1FNUA 3ZKJC 3ZLZA 2ZPNA 2C7NB 1V5TA 2DZJA 3GOEA 1TS4A 5D94A 5IOIA 3QK0A 2JYEA 1FRDA 1WH3A 2G3QB 4LNNA 1IPGA 1RFAA 2WHIA 2MEKA 1SGHA 2WX1A 2LRUA 4JQWC 1PDXA 1RAXA 1OQRA 1TZ1A 2OOBB 3R8BA 3ML8A 4EOYA 1AYFA 4M02A 3DPDA 2AQ2B 3TEWA 2B3AA 5BO4B 1E7UA 2ZEQA 1L7YA 1WRDB 5J18A 2Z59B 2PKOA 2QIEB 2N9KA 4DDID 1FIQA 4KDLB 1L0YB 1STEA 1WRIA 4OZBA 2CU3A 4JWUC 3HRDD 3MC9A 2AWTA 2YVCA 2K1FA 2K6QA 2M19A 2MJDA 1WM2A 4K81A 3PHWB 4OVUA 3RNBC 4ZRPA 3L08A 1I4RA 2KK8A 1AW7A 3NVYA 1PGAA 4YWGG 4KIKB 3DBHI 5EE3A 2JWUA 3KWLA 4YSYB 3AE6B 2M4NA 3KUDB 4JLCA 1Q10A 3HUIA 1A70A 3IFWB 4G11A 2JVCA 3N30A 4AOFA 1EO6A 3I5JC 2QILA 2MQJA 2M17A 1FXIA 4ZRQA 4GIVA 2Q5WD 3EECA 2RD0A 3QIJA 4O1NA 1XXGA 2AYOB 3T8MA 3W5UB 3KLSX 1QOBA 2J42A 2X38A 5D3DA 4E74A 3R7RA 4KSLC 1JW9D 4W9FA 4OVZA 3H1UA 2KMMA 2L7RA 1XLPA 4H2AA 2ZCCA 3D32A 4LK0M 3NS1A 4ZDVA 1Z2MA 4CYEA 1HZ6A 4TSSA 3H7PB 1TKEA 4DXAB 3VH3B 3SFEB 1GC6A 5JHAA 3V60A 4IUMB 3U4EG 2JZZA 1QZEA 3HM3A 1UF0A 4P6VF 2KX3A 1EUVB 4MEMA 5G55A 3NOBA 3W1SA 2JX5A 2WQYB 2KX0A 2M56B 1C4AA 1MG4A 1KF6B 3ZTDA 4ZYSA 2GBKA 3GE3C 3NRZA 1WXVA 5AUIA 5JHBA 1UWXA 2LVQA 1WX7A 3E9SA 3AEEB 2JT4B 4EEWA 3A9JA 1IUEA 4F1SA 1OEYA 3PHXB 3A1QB 3AH7A 2ZVNA 1OGWA 3KYDD 4HJKA 2GB1A 4TKNA 3PT2B 2MJ3A 4WWPA 4I6PA 2CR5A 1UGMA 1MPEA 1RFKA 3WALA 3J9CA 4LTUA 1E10A 2FIFA 2NPTA 1VLBA 2DYBA 1T6BX 2L0TA 4BKGA 1XCTL 2KANA 2AQ3B 3I57A 4NAWA 3GE8C 2LEKA 4WQMA 1TKYA 4A20A 2IGGA 1E6EB 2RDBC 4W9HA 3AEGB 2Z8LA 1XLQA 1SB3C 2WDRB 2V9HA 2L76A 3W1SC 5AZGA 4CO7A 2N1WA 3U52E 2PW9A 3U2SC 2JRIB 2WXPA 3NG0A 2MJEA 1FO4A 1GC7A 3TCAA 3VQIA 2KLGA 4XE0A 3C0RB 1I4HA 3WCQA 4C56C 3DBLI 3UIPB 1UUPA 2PLPA 3JW0X 2BYFA 2YLMA 4WAFA 2E3TA 3IAM1 1PQSA 2ICIA 2RGFA 3TBLD 1WGHA 1MHHE 4W9EA 3U8ZA 3UINB 1NENB 4BFRA 3BYYB 1V81A 4WIPA 1KOTA 4BZAA 4RF1A 1BXTA 2XNAC 2D10A 4NY0A 4GU2A 1N5XA 2X8XX 2WX0A 3Q3FA 2MBBB 4M8MA 2TSSA 3NS8A 3ZXRA 2MX2A 3AE2B 1CK1A 2INPE 4DK5A 3FC4A 1T3QA 2KAJA 2RR9A 4JPSA 1FXAA 4GDKB 2C5LC 2KN5A 4KGSA 1BUIC 2BBCA 3GZNI 3H8HA 2BW2A 4RM8A 1ZP0B 2PJHA 3PLUA 4TUUA 3HIZA 4HCNB 3AU4A 3RPFC 2N9EB 1ZXIA 3N32A 2ZJDA 4AS1A 4BOZB 1TS2A 3V6CB 1F77A 3NZSA 3ZTCA 3NY5A 2J0JA 1ZXHA 3DVGY 4CQNA 3Q3MC 3B9JA 1YQ3B 5CHWA 2FCQA 3L10B 2W3RA 2BS2B 2KVRA 1C77A 1WXSA 2IBIB 2W82A 1PGBA 1SXTA 2L00B 2HTME 2KC2A 4W9IA 4GOCA 1WMHA 1JWUD 4K1RB 1TJEA 4II3B 5E6PA 2HE7A 1KLVA 1ZUD2 1SJHD 4XGAB 4EZJA 5L83A 2EMTA 3VUYA 3WA0A 4S17A 4J6IA 3P4PB 1V49A 2KN4A 3Q3NC 4WWMA 2WNMA 4MGZE 1C4CA 4ASWC 5BYSA
chains in the Genus database with same CATH topology
3H7PA 1UBQA 4FADA 3DVGX 3SD5A 1XQQA 3RT3B 1WR6E 3A33B 1I35A 1XD3B 2RPQA 1E8ZA 2JUOA 1TTNA 2KDIA 2KXJA 2N4FA 3AI5A 3N3KB 3VFKA 3IHPC 3UIOB 4PS8A 3PTFC 4DDGD 2LRWA 3JSVA 3APCA 1WJNA 3V61A 2DZMA 2KWCA 3KH0A 4FLHA 2WYQA 4BVUC 3PV1A 1P9DU 3LJ3A 4GB9A 4WJQA 3OAWA 4P7IA 3PGEA 4ANXA 2KJ6A 2ZVOA 2BKRB 3RD2A 2BKFA 3SHQA 2KWUB 1UD7A 1WM3A 1WZ3A 2JZ3B 3PRMB 4IC7B 1ZGUB 2EKEC 4WJNA 5GMVA 3ZDTA 2W9NA 1YQBA 3I3TB 2D11A 4LDTD 3ZKJC 2MA9B 1IYFA 2KC1A 3ZLZA 2ZPNA 1WZ0A 2C7NB 1V5TA 2DZJA 3GOEA 5D94A 4ANVA 4ANWA 1YJ1A 3B0AA 3QK0A 1S1QB 1Y8RC 4GDLB 1P98A 1WGGA 1YIWA 2KLCA 2V3SA 4FHKA 2MBOA 1WH3A 2G3QB 2KD0A 2RSUA 1E90A 2LXCA 3A1QA 1IPGA 5CTRC 1RFAA 3WIMA 3DVNV 3ZDMC 2UYZB 2KTFA 5D2MB 1SGHA 2KWVB 4EZKA 1T0YA 3VVWB 2ZPYA 2EMSA 3ZNZB 2WX1A 2LRUA 2MP2A 4IM2A 4JQWC 4B95A 2KJRA 2N9XA 4DHZB 1GJZA 1RAXA 2KO3A 4E3CA 5G2NA 1TZ1A 2L3ZA 2OOBB 3M95A 3ML8A 3L17A 4EOYA 5C1ZA 2BYEA 2BYVE 4W9KA 5EDSA 5HKHA 1UZXB 3DPDA 4ANUA 3B08A 2B3AA 2LGDA 4KZ0A 4G50A 5BO4B 5DCNA 1E7UA 1JRUA 1ZW7A 2ZEQA 1L7YA 3DQVA 4ICUA 4EUTA 1WRDB 2D3GA 3SU8X 5J18A 3UQAA 3ALBA 2V4LA 2Z59B 3IG3A 2CHXA 2J0KA 4FA6A 3P2BA 4DDID 4WJPA 4KDLB 4ZRKA 3VUWA 1KM7A 4GN1A 2DENB 3ZRCA 1WX9A 5KHQA 2AWTA 2YVCA 1WY8A 2K1FA 2K6QA 5J2RA 1WM2A 4K81A 2O6VB 3A9JB 4TQ0A 2D07B 3PHWB 3H9DA 4HVBA 4I6LB 4OVUA 3V6EB 2DZKA 3A9KB 4FULA 3PPAA 2LI5A 3L08A 4W9CA 1M94A 2KDBA 1WGRA 1P0RA 2KK8A 4KSKC 2DYMA 2NBWB 3PRPB 1J19A 1J0GA 2N9PC 3ZO5B 1NDDA 3R7QA 3A4SC 4MSQB 2L05A 2KTRA 2NS5A 1WI0A 1E8XA 5C23A 2ZNVC 2ASQA 2LUEA 4KIKB 4XZ4A 3DBHI 3VTVA 2MLBA 2BPSA 4ZRJA 3T9LA 2REXA 3W1YA 2M4NA 4BKTA 3KUDB 4JLCA 3VTUA 1R4NI 2R2OA 3IFWB 4G11A 1SIFA 4AJWA 2JVCA 3N30A 5E6NA 1IP9A 4AOFA 3EC8A 1H4RA 2NPTB 1EO6A 2NBUA 2JXXA 3PZDA 2Z0DB 4KV2A 3TIXA 1SE9A 3M3JA 3HM6X 1WXMA 1RRBA 2KZRA 1WXAA 2MQJA 2M17A 3KUCB 3L16A 4OVVA 2KOXA 4URKA 4IWQA 2IY0B 1GG3A 2K39A 4BBNC 3QJZA 4GIVA 4HCPB 3JVZX 2N7DA 2CHWA 3EECA 4X57B 1I42A 3R3MA 3SDLC 2RD0A 3QIJA 2NCNA 4HWIB 4TV3A 4MJSB 2DAJA 1GUAB 1YX5B 1EF1A 2CHZA 4IWPA 2AYOB 5DPRA 3VUXA 1GNUA 2DYOA 4BBNF 3T8MA 1OEYJ 1YD8U 3QCAA 2K8HA 2DZIA 1E5WA 4E74A 2LGYA 3R7RA 4LCDE 4KSLC 4IM3A 4GDKA 2Z0EB 2DX5B 4W9FA 3H1UA 3X23A 2M1MA 2R2QA 2L7RA 1E8YA 3MJWA 1E8WA 5IA7A 4MDKE 1L2NA 2O2VB 1UBIA 3V62A 4FN2A 3ML9A 2ZCCA 3D32A 4DHJD 5D7GA 1WJ6A 1V80A 2KFKB 4ZDVA 4NQLB 1Z2MA 3ZW3A 4CYEA 3L0WB 2JWZA 1HE8A 3ZNHB 4GSWA 3H7PB 3IVFA 4G3XB 2C9WB 3PSEB 2I1KA 1R4MI 4JIOU 4DXAB 3VH3B 4G0NB 2LJ5A 5DPSA 3HHMA 1GC6A 5JHAA 2OJRA 2IY1B 3V60A 5DPWA 4IUMB 3QX1A 3DBRI 3QARA 2JZZA 3VAWA 1OQYA 1QZEA 3HM3A 3X0WA 3JSVB 3VTWA 1S3SG 3TL5A 2AL6A 2ZZPB 3K9OB 4XC2A 2KX3A 1KJTA 1NBFC 2BGFA 1BT0A 2WWZA 1EUVB 5KHOA 1V6EA 4DBGA 4MEMA 5G55A 3NOBA 2FAZA 3QAQA 5TR5A 3W1SA 1J8CA 2LD9A 3UQBA 1FXTB 1H8CA 1CMXB 2KX0A 3DDCB 3PRZA 1LQBA 4F8CB 3ZTDA 2KMCA 1Q5WB 2GBKA 4AP4C 3DBSA 2CU1A 4FJYA 5E6OA 2J7QB 4MGYE 2ZNVB 1WXVA 3DOWA 4B6WA 5JHBA 4E71A 3QQ8B 2LVQA 1WX7A 4AUQC 2JT4B 3R66C 3A9JA 4EEWA 2BWES 4NNJB 4KVGB 4EKUA 4F1SA 1OEYA 4FBJB 1Q0WB 3PHXB 3A1QB 3ZUNA 2XEWA 3ZIMA 2JPHA 3DVNU 1ZKHA 2GOWA 2N1VA 3ONSA 2ZVNA 3KYCD 1OGWA 1OTRB 1XT9B 2LXAA 3KYDD 4HJKA 4TKNA 4ICVA 4K7UA 4TQ1A 5AZFA 3S2AA 4FHJA 2MBQA 3PT2B 4EZLA 4FJVB 1RLFA 2LWPA 4AJYB 2FCMA 3B1LX 4KIKA 4MSMB 4WWPA 2IO0B 1WIAA 4I6PA 2CR5A 2FNJB 1UGMA 2MBHA 3RUIB 2G45B 3RYTA 1VCBA 3NZUA 3WALA 1A5RA 4IW0A 3QC8B 3WAMA 2FIFA 2NPTA 3L54A 1V9JA 4WWNA 4PYUA 3TMPB 2DYBA 2XK5B 3MTNB 1EF5A 1F9JA 2C7HA 2L0TA 4BKGA 2KANA 3UF8A 4DWFA 5LLIA 4NAWA 2QHOA 4FJZA 2XBBC 3JYUA 4A20A 4IG7B 2KDFB 2KKCA 3CMMB 4W9HA 1WGYA 2MBEA 1E7VA 3AULA 3UGBB 2C60A 2CS4A 2G4SA 3PREA 1VD2A 1WR1A 2LASA 2IZVB 3QWZB 5IAAC 4YL8A 3NHEB 4EFOA 3ECIA 4LDTB 2IO2B 4IM0A 2L76A 2AEHA 4KDIC 3W1SC 1MG8A 5AZGA 3WANA 4CO7A 5LXHA 4LJOB 2N1WA 2IO3B 4A3PA 3HK0A 1WMHB 5J17A 5JZEB 1WFYA 2J0MA 4M8NA 2V1YA 1WJUA 2VRRB 2KTRB 3L13A 1UH6A 2JRIB 2GBNA 4JGHB 3LDZE 3OJ3A 1GC7A 3TCAA 3VQIA 3VHTC 4M0WB 4HDOA 4BOSC 2FCNA 2KLGA 1D3ZA 2D2QA 3C0RB 1UELA 2JY6A 2O2VA 3KUZA 3RZWC 3DBLI 3UIPB 4BKSD 1V86A 1V2YA 3PVLA 2C7MB 4K7SA 2O6VD 3JW0X 3H7SA 2BYFA 2DHZA 2YLMA 4GMVA 1PQSA 5DPTA 1LXDA 3A4RA 2RGFA 4GXBA 1TGZB 3TBLD 1WGHA 2MCNB 4W9EA 3U8ZA 3UINB 5LXIB 2GBJA 4NJ6A 4BFRA 4GDLA 1V81A 4II2B 1KOTA 5AEKB 1V5OA 3QA8A 2MWSB 3K9PB 2D10A 4NY0A 2JRHA 4GU2A 2BWFA 3PS6A 2WX0A 2HTHA 2NR2A 2IO1B 3Q3FA 4IWOA 2A5UA 2IYDB 2L0FA 2LVPA 2PE9A 2A4ZA 2MBBB 4M8MA 4PYZA 4MM3A 1WGDA 3NS8A 3AXCA 2MX2A 3TJPA 2GBMA 4HDQA 4DK5A 2G4DB 1P1AA 3PLVA 2RR9A 3CSFA 4CHKA 3CF6E 4HXDA 4GDKB 2C5LC 2KN5A 2PEAA 4NQKE 4W9DA 4W9LA 2GMIC 5CX3A 4ZRIA 2MW5A 4MH0E 1WE7A 2M0XA 3GZNI 5FR6A 3U7DA 3VH4B 4WWOA 3RCZA 1C3TA 2FUHB 4GGQA 4RM8A 3EHVA 4WAAA 5JH5C 1LM8B 2KJHB 2NVUI 2PJHA 2JF5A 4RM9A 1WF9A 1WJ4A 3PLUA 4TUUA 3HIZA 3O65B 2K6DB 2ZCBA 4HCNB 2CKHB 3AU4A 2N9EB 3N32A 4BKSA 4F7ZA 2ZJDA 2KMAA 2O6VA 3M63B 4AWJA 4BOZB 2HJ8A 1AARA 3KW5B 4B9KA 3A9KA 3V6CB 4W9GA 3NZSA 3DCGA 4MGIE 2PPHA 3ZTCA 1WE6A 3NY5A 2J0JA 4MGKE 2LGXA 5CHFA 1NI2A 2DAFA 4DHZE 2MP2B 4KZCA 3APDA 3ZNGC 1Z5SB 2HD5B 3BINA 2NBVB 3U30A 4NJ7A 3DVGY 2XK5A 4WQOB 3ZNID 2BF8B 1Q1OA 2LZ6A 2KQ7A 3BY4B 3WAOA 1WYWB 3VXWA 1TBEA 2K25A 3RULA 5CHWA 2FCQA 2KDEB 3L10B 2KVRA 4PS3A 1WXSA 3OLMD 3ZRFA 2IBIB 3VDZA 3QHTA 4NPNA 1G6JA 2K8BA 4I6NB 4MELA 2FIDA 2FCSA 5CHVC 2L00B 1WX8A 2KC2A 4HPLB 3ZVVA 4W9IA 3AU5A 4GOCA 1WMHA 2I1JA 2KHWB 3RZFA 1U4AA 4K1RB 4II3B 4XX5A 2HE7A 5E6PA 3WAPA 1KLVA 4DHJB 2MSED 2AL3A 5L95C 4LJPB 2L8JA 4MJSA 4EZJA 1YX6B 5L83A 3ENEA 2EMTA 4HPMB 4WJOA 4N9F4 5AZHA 2KNBA 3VUYA 4HK2A 3WA0A 1LFDA 4J6IA 3OJ4B 2Y5BB 2M8SA 1C1YB 2MRPA 2KFJA 4ZYNA 2WDTB 3MHSD 1P3QU 2LVOA 1V49A 3EFUA 2KQSA 3IBEA 1X1MA 5D6JB 2N7EA 3Q3JA 1K8RB 4HLEA 4NAWB 3KVFB 4A3OA 4JL9A 3CSTA 4MGZE 3H6NA 4PS7A 3M62B 1ISNA 2KFKA 2UWQA 4K7WA 4W9JA 2GBRA 4ASWC 4RMAA 3APFA 2K8CA 2PE6B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H7P A;  1UBQ A;  4FAD A;  3DVG X;  3SD5 A;  1XQQ A;  3RT3 B;  1WR6 E;  3A33 B;  1I35 A;  1XD3 B;  2RPQ A;  1E8Z A;  2JUO A;  1TTN A;  2KDI A;  2KXJ A;  2N4F A;  3AI5 A;  3N3K B;  3VFK A;  3IHP C;  3UIO B;  4PS8 A;  3PTF C;  4DDG D;  2LRW A;  3JSV A;  3APC A;  1WJN A;  3V61 A;  2DZM A;  2KWC A;  3KH0 A;  4FLH A;  2WYQ A;  4BVU C;  3PV1 A;  1P9D U;  3LJ3 A;  4GB9 A;  4WJQ A;  3OAW A;  4P7I A;  3PGE A;  4ANX A;  2KJ6 A;  2ZVO A;  2BKR B;  3RD2 A;  2BKF A;  3SHQ A;  2KWU B;  1UD7 A;  1WM3 A;  1WZ3 A;  2JZ3 B;  3PRM B;  4IC7 B;  1ZGU B;  2EKE C;  4WJN A;  5GMV A;  3ZDT A;  2W9N A;  1YQB A;  3I3T B;  2D11 A;  4LDT D;  3ZKJ C;  2MA9 B;  1IYF A;  2KC1 A;  3ZLZ A;  2ZPN A;  1WZ0 A;  2C7N B;  1V5T A;  2DZJ A;  3GOE A;  5D94 A;  4ANV A;  4ANW A;  1YJ1 A;  3B0A A;  3QK0 A;  1S1Q B;  1Y8R C;  4GDL B;  1P98 A;  1WGG A;  1YIW A;  2KLC A;  2V3S A;  4FHK A;  2MBO A;  1WH3 A;  2G3Q B;  2KD0 A;  2RSU A;  1E90 A;  2LXC A;  3A1Q A;  1IPG A;  5CTR C;  1RFA A;  3WIM A;  3DVN V;  3ZDM C;  2UYZ B;  2KTF A;  5D2M B;  1SGH A;  2KWV B;  4EZK A;  1T0Y A;  3VVW B;  2ZPY A;  2EMS A;  3ZNZ B;  2WX1 A;  2LRU A;  2MP2 A;  4IM2 A;  4JQW C;  4B95 A;  2KJR A;  2N9X A;  4DHZ B;  1GJZ A;  1RAX A;  2KO3 A;  4E3C A;  5G2N A;  1TZ1 A;  2L3Z A;  2OOB B;  3M95 A;  3ML8 A;  3L17 A;  4EOY A;  5C1Z A;  2BYE A;  2BYV E;  4W9K A;  5EDS A;  5HKH A;  1UZX B;  3DPD A;  4ANU A;  3B08 A;  2B3A A;  2LGD A;  4KZ0 A;  4G50 A;  5BO4 B;  5DCN A;  1E7U A;  1JRU A;  1ZW7 A;  2ZEQ A;  1L7Y A;  3DQV A;  4ICU A;  4EUT A;  1WRD B;  2D3G A;  3SU8 X;  5J18 A;  3UQA A;  3ALB A;  2V4L A;  2Z59 B;  3IG3 A;  2CHX A;  2J0K A;  4FA6 A;  3P2B A;  4DDI D;  4WJP A;  4KDL B;  4ZRK A;  3VUW A;  1KM7 A;  4GN1 A;  2DEN B;  3ZRC A;  1WX9 A;  5KHQ A;  2AWT A;  2YVC A;  1WY8 A;  2K1F A;  2K6Q A;  5J2R A;  1WM2 A;  4K81 A;  2O6V B;  3A9J B;  4TQ0 A;  2D07 B;  3PHW B;  3H9D A;  4HVB A;  4I6L B;  4OVU A;  3V6E B;  2DZK A;  3A9K B;  4FUL A;  3PPA A;  2LI5 A;  3L08 A;  4W9C A;  1M94 A;  2KDB A;  1WGR A;  1P0R A;  2KK8 A;  4KSK C;  2DYM A;  2NBW B;  3PRP B;  1J19 A;  1J0G A;  2N9P C;  3ZO5 B;  1NDD A;  3R7Q A;  3A4S C;  4MSQ B;  2L05 A;  2KTR A;  2NS5 A;  1WI0 A;  1E8X A;  5C23 A;  2ZNV C;  2ASQ A;  2LUE A;  4KIK B;  4XZ4 A;  3DBH I;  3VTV A;  2MLB A;  2BPS A;  4ZRJ A;  3T9L A;  2REX A;  3W1Y A;  2M4N A;  4BKT A;  3KUD B;  4JLC A;  3VTU A;  1R4N I;  2R2O A;  3IFW B;  4G11 A;  1SIF A;  4AJW A;  2JVC A;  3N30 A;  5E6N A;  1IP9 A;  4AOF A;  3EC8 A;  1H4R A;  2NPT B;  1EO6 A;  2NBU A;  2JXX A;  3PZD A;  2Z0D B;  4KV2 A;  3TIX A;  1SE9 A;  3M3J A;  3HM6 X;  1WXM A;  1RRB A;  2KZR A;  1WXA A;  2MQJ A;  2M17 A;  3KUC B;  3L16 A;  4OVV A;  2KOX A;  4URK A;  4IWQ A;  2IY0 B;  1GG3 A;  2K39 A;  4BBN C;  3QJZ A;  4GIV A;  4HCP B;  3JVZ X;  2N7D A;  2CHW A;  3EEC A;  4X57 B;  1I42 A;  3R3M A;  3SDL C;  2RD0 A;  3QIJ A;  2NCN A;  4HWI B;  4TV3 A;  4MJS B;  2DAJ A;  1GUA B;  1YX5 B;  1EF1 A;  2CHZ A;  4IWP A;  2AYO B;  5DPR A;  3VUX A;  1GNU A;  2DYO A;  4BBN F;  3T8M A;  1OEY J;  1YD8 U;  3QCA A;  2K8H A;  2DZI A;  1E5W A;  4E74 A;  2LGY A;  3R7R A;  4LCD E;  4KSL C;  4IM3 A;  4GDK A;  2Z0E B;  2DX5 B;  4W9F A;  3H1U A;  3X23 A;  2M1M A;  2R2Q A;  2L7R A;  1E8Y A;  3MJW A;  1E8W A;  5IA7 A;  4MDK E;  1L2N A;  2O2V B;  1UBI A;  3V62 A;  4FN2 A;  3ML9 A;  2ZCC A;  3D32 A;  4DHJ D;  5D7G A;  1WJ6 A;  1V80 A;  2KFK B;  4ZDV A;  4NQL B;  1Z2M A;  3ZW3 A;  4CYE A;  3L0W B;  2JWZ A;  1HE8 A;  3ZNH B;  4GSW A;  3H7P B;  3IVF A;  4G3X B;  2C9W B;  3PSE B;  2I1K A;  1R4M I;  4JIO U;  4DXA B;  3VH3 B;  4G0N B;  2LJ5 A;  5DPS A;  3HHM A;  1GC6 A;  5JHA A;  2OJR A;  2IY1 B;  3V60 A;  5DPW A;  4IUM B;  3QX1 A;  3DBR I;  3QAR A;  2JZZ A;  3VAW A;  1OQY A;  1QZE A;  3HM3 A;  3X0W A;  3JSV B;  3VTW A;  1S3S G;  3TL5 A;  2AL6 A;  2ZZP B;  3K9O B;  4XC2 A;  2KX3 A;  1KJT A;  1NBF C;  2BGF A;  1BT0 A;  2WWZ A;  1EUV B;  5KHO A;  1V6E A;  4DBG A;  4MEM A;  5G55 A;  3NOB A;  2FAZ A;  3QAQ A;  5TR5 A;  3W1S A;  1J8C A;  2LD9 A;  3UQB A;  1FXT B;  1H8C A;  1CMX B;  2KX0 A;  3DDC B;  3PRZ A;  1LQB A;  4F8C B;  3ZTD A;  2KMC A;  1Q5W B;  2GBK A;  4AP4 C;  3DBS A;  2CU1 A;  4FJY A;  5E6O A;  2J7Q B;  4MGY E;  2ZNV B;  1WXV A;  3DOW A;  4B6W A;  5JHB A;  4E71 A;  3QQ8 B;  2LVQ A;  1WX7 A;  4AUQ C;  2JT4 B;  3R66 C;  3A9J A;  4EEW A;  2BWE S;  4NNJ B;  4KVG B;  4EKU A;  4F1S A;  1OEY A;  4FBJ B;  1Q0W B;  3PHX B;  3A1Q B;  3ZUN A;  2XEW A;  3ZIM A;  2JPH A;  3DVN U;  1ZKH A;  2GOW A;  2N1V A;  3ONS A;  2ZVN A;  3KYC D;  1OGW A;  1OTR B;  1XT9 B;  2LXA A;  3KYD D;  4HJK A;  4TKN A;  4ICV A;  4K7U A;  4TQ1 A;  5AZF A;  3S2A A;  4FHJ A;  2MBQ A;  3PT2 B;  4EZL A;  4FJV B;  1RLF A;  2LWP A;  4AJY B;  2FCM A;  3B1L X;  4KIK A;  4MSM B;  4WWP A;  2IO0 B;  1WIA A;  4I6P A;  2CR5 A;  2FNJ B;  1UGM A;  2MBH A;  3RUI B;  2G45 B;  3RYT A;  1VCB A;  3NZU A;  3WAL A;  1A5R A;  4IW0 A;  3QC8 B;  3WAM A;  2FIF A;  2NPT A;  3L54 A;  1V9J A;  4WWN A;  4PYU A;  3TMP B;  2DYB A;  2XK5 B;  3MTN B;  1EF5 A;  1F9J A;  2C7H A;  2L0T A;  4BKG A;  2KAN A;  3UF8 A;  4DWF A;  5LLI A;  4NAW A;  2QHO A;  4FJZ A;  2XBB C;  3JYU A;  4A20 A;  4IG7 B;  2KDF B;  2KKC A;  3CMM B;  4W9H A;  1WGY A;  2MBE A;  1E7V A;  3AUL A;  3UGB B;  2C60 A;  2CS4 A;  2G4S A;  3PRE A;  1VD2 A;  1WR1 A;  2LAS A;  2IZV B;  3QWZ B;  5IAA C;  4YL8 A;  3NHE B;  4EFO A;  3ECI A;  4LDT B;  2IO2 B;  4IM0 A;  2L76 A;  2AEH A;  4KDI C;  3W1S C;  1MG8 A;  5AZG A;  3WAN A;  4CO7 A;  5LXH A;  4LJO B;  2N1W A;  2IO3 B;  4A3P A;  3HK0 A;  1WMH B;  5J17 A;  5JZE B;  1WFY A;  2J0M A;  4M8N A;  2V1Y A;  1WJU A;  2VRR B;  2KTR B;  3L13 A;  1UH6 A;  2JRI B;  2GBN A;  4JGH B;  3LDZ E;  3OJ3 A;  1GC7 A;  3TCA A;  3VQI A;  3VHT C;  4M0W B;  4HDO A;  4BOS C;  2FCN A;  2KLG A;  1D3Z A;  2D2Q A;  3C0R B;  1UEL A;  2JY6 A;  2O2V A;  3KUZ A;  3RZW C;  3DBL I;  3UIP B;  4BKS D;  1V86 A;  1V2Y A;  3PVL A;  2C7M B;  4K7S A;  2O6V D;  3JW0 X;  3H7S A;  2BYF A;  2DHZ A;  2YLM A;  4GMV A;  1PQS A;  5DPT A;  1LXD A;  3A4R A;  2RGF A;  4GXB A;  1TGZ B;  3TBL D;  1WGH A;  2MCN B;  4W9E A;  3U8Z A;  3UIN B;  5LXI B;  2GBJ A;  4NJ6 A;  4BFR A;  4GDL A;  1V81 A;  4II2 B;  1KOT A;  5AEK B;  1V5O A;  3QA8 A;  2MWS B;  3K9P B;  2D10 A;  4NY0 A;  2JRH A;  4GU2 A;  2BWF A;  3PS6 A;  2WX0 A;  2HTH A;  2NR2 A;  2IO1 B;  3Q3F A;  4IWO A;  2A5U A;  2IYD B;  2L0F A;  2LVP A;  2PE9 A;  2A4Z A;  2MBB B;  4M8M A;  4PYZ A;  4MM3 A;  1WGD A;  3NS8 A;  3AXC A;  2MX2 A;  3TJP A;  2GBM A;  4HDQ A;  4DK5 A;  2G4D B;  1P1A A;  3PLV A;  2RR9 A;  3CSF A;  4CHK A;  3CF6 E;  4HXD A;  4GDK B;  2C5L C;  2KN5 A;  2PEA A;  4NQK E;  4W9D A;  4W9L A;  2GMI C;  5CX3 A;  4ZRI A;  2MW5 A;  4MH0 E;  1WE7 A;  2M0X A;  3GZN I;  5FR6 A;  3U7D A;  3VH4 B;  4WWO A;  3RCZ A;  1C3T A;  2FUH B;  4GGQ A;  4RM8 A;  3EHV A;  4WAA A;  5JH5 C;  1LM8 B;  2KJH B;  2NVU I;  2PJH A;  2JF5 A;  4RM9 A;  1WF9 A;  1WJ4 A;  3PLU A;  4TUU A;  3HIZ A;  3O65 B;  2K6D B;  2ZCB A;  4HCN B;  2CKH B;  3AU4 A;  2N9E B;  3N32 A;  4BKS A;  4F7Z A;  2ZJD A;  2KMA A;  2O6V A;  3M63 B;  4AWJ A;  4BOZ B;  2HJ8 A;  1AAR A;  3KW5 B;  4B9K A;  3A9K A;  3V6C B;  4W9G A;  3NZS A;  3DCG A;  4MGI E;  2PPH A;  3ZTC A;  1WE6 A;  3NY5 A;  2J0J A;  4MGK E;  2LGX A;  5CHF A;  1NI2 A;  2DAF A;  4DHZ E;  2MP2 B;  4KZC A;  3APD A;  3ZNG C;  1Z5S B;  2HD5 B;  3BIN A;  2NBV B;  3U30 A;  4NJ7 A;  3DVG Y;  2XK5 A;  4WQO B;  3ZNI D;  2BF8 B;  1Q1O A;  2LZ6 A;  2KQ7 A;  3BY4 B;  3WAO A;  1WYW B;  3VXW A;  1TBE A;  2K25 A;  3RUL A;  5CHW A;  2FCQ A;  2KDE B;  3L10 B;  2KVR A;  4PS3 A;  1WXS A;  3OLM D;  3ZRF A;  2IBI B;  3VDZ A;  3QHT A;  4NPN A;  1G6J A;  2K8B A;  4I6N B;  4MEL A;  2FID A;  2FCS A;  5CHV C;  2L00 B;  1WX8 A;  2KC2 A;  4HPL B;  3ZVV A;  4W9I A;  3AU5 A;  4GOC A;  1WMH A;  2I1J A;  2KHW B;  3RZF A;  1U4A A;  4K1R B;  4II3 B;  4XX5 A;  2HE7 A;  5E6P A;  3WAP A;  1KLV A;  4DHJ B;  2MSE D;  2AL3 A;  5L95 C;  4LJP B;  2L8J A;  4MJS A;  4EZJ A;  1YX6 B;  5L83 A;  3ENE A;  2EMT A;  4HPM B;  4WJO A;  4N9F 4;  5AZH A;  2KNB A;  3VUY A;  4HK2 A;  3WA0 A;  1LFD A;  4J6I A;  3OJ4 B;  2Y5B B;  2M8S A;  1C1Y B;  2MRP A;  2KFJ A;  4ZYN A;  2WDT B;  3MHS D;  1P3Q U;  2LVO A;  1V49 A;  3EFU A;  2KQS A;  3IBE A;  1X1M A;  5D6J B;  2N7E A;  3Q3J A;  1K8R B;  4HLE A;  4NAW B;  3KVF B;  4A3O A;  4JL9 A;  3CST A;  4MGZ E;  3H6N A;  4PS7 A;  3M62 B;  1ISN A;  2KFK A;  2UWQ A;  4K7W A;  4W9J A;  2GBR A;  4ASW C;  4RMA A;  3APF A;  2K8C A;  2PE6 B; 
#chains in the Genus database with same CATH topology
 1XLO A;  3H7P A;  3SD5 A;  1XD3 B;  2BB5 A;  2KXJ A;  4P16 A;  2V3N A;  4C7Y A;  4LNO A;  3PTF C;  4YTN B;  1JCK B;  2DZM A;  4FLH A;  4NJC A;  5HI1 A;  2QJL A;  3PGE A;  2BKF A;  2KWU B;  3PRM B;  3AE4 B;  2PVG C;  3RI7 C;  2EKE C;  1C9F A;  5GMV A;  3ETR A;  1XLN A;  4HPP A;  3C19 A;  2MA9 B;  4US9 A;  5C2T B;  3NVV A;  5IO9 A;  1VRA B;  1Y8R C;  1WGG A;  2V3S A;  2RSU A;  1E90 A;  2VH2 A;  3A1Q A;  4J3O D;  2D5G A;  1GOZ A;  2KTF A;  2KWV B;  3VVW B;  3ZYY X;  2MP2 A;  3N9Y C;  4B95 A;  4MM3 B;  1GJZ A;  1FFU A;  2KVZ A;  4HRO A;  1MI0 A;  3M95 A;  5C1Z A;  1P7F A;  3L17 A;  5EE9 A;  1UZX B;  3B08 A;  4DXF A;  5DCN A;  2LGS A;  1ZW7 A;  2LMC A;  3I63 C;  3DQV A;  3DHI C;  1ET9 A;  2NTT A;  4EUT A;  3SU8 X;  3UQA A;  3ALB A;  4NZL B;  3NZ3 A;  4P1C C;  1UGJ A;  2J0K A;  1QOF A;  4B0M A;  4ZRK A;  1I4G A;  3RNA C;  1FNW A;  1KM7 A;  1JRO A;  4YTP B;  2YEP B;  3Q6B A;  2IJ0 A;  1P7E A;  3GB1 A;  1WY8 A;  4HJG E;  1F2R C;  3A9J B;  4HVB A;  4I6L B;  1ENF A;  3V6E B;  1SIJ A;  3V05 A;  1FCC C;  1TYG B;  1M94 A;  2OJW A;  4HKZ E;  1WGR A;  4OW0 A;  4KSK C;  2DYM A;  2N9P C;  2Y3A A;  3ZO5 B;  3R7Q A;  4JX1 C;  4XZ4 A;  2WDQ B;  2BPS A;  3PZ8 A;  1K50 A;  4LNI A;  3W1Y A;  4BKT A;  1ZPS A;  2JXT A;  1TZO A;  4AJW A;  3RNE C;  2EEL A;  4A90 A;  2L52 A;  2NPT B;  2WXJ A;  1HQR D;  2NBU A;  3PZD A;  3CWI A;  3FIL B;  4KV2 A;  4AQ7 A;  1SE9 A;  1I4P A;  2JYT A;  3BWU D;  2KZR A;  3KUC B;  4OVV A;  4URK A;  2K39 A;  4BBN C;  2N7D A;  4REZ A;  3MC8 A;  1SF0 A;  4HWI B;  4DQO C;  3VUX A;  2LFI A;  3FKY A;  4BBN F;  1NYR A;  1YD8 U;  2K8H A;  3PZ7 A;  2DZI A;  1R4M B;  2LGY A;  1FMA D;  1SJE D;  4IM3 A;  4WH4 A;  4GDK A;  1T5X D;  3TEY A;  2R2Q A;  3DBR B;  4NAM A;  1E8Y A;  3MJW A;  1E8W A;  3HVZ A;  4YSX B;  4MDK E;  1L2N A;  1YMH E;  1V80 A;  3ZW3 A;  3L0W B;  4MT5 A;  4GSW A;  1J7C A;  2I1K A;  4G0N B;  5DPS A;  5IP4 D;  3HHM A;  5DPW A;  3QX1 A;  2VZK D;  1OQY A;  3VTW A;  2AL6 A;  1C76 A;  1N6Z A;  2D3A A;  1QKZ A;  4ARC A;  3QAQ A;  3ABV B;  5T8I A;  1J8C A;  3MC0 B;  1FXT B;  3P42 A;  2K5P A;  1LQB A;  4F8C B;  4US8 A;  2KMC A;  1MVK A;  2CU1 A;  1B1Z A;  4MGY E;  2ZNV B;  3DOW A;  1GAQ B;  1F2R I;  2ZW1 A;  3MHZ A;  1I4X A;  1E0Z A;  4NNJ B;  2QCZ A;  4KVG B;  4EKU A;  2FUG 1;  3ZUN A;  2JPH A;  3DVN U;  1ZKH A;  2GOW A;  2N1V A;  5E6O A;  2KYW A;  1VR9 A;  1XT9 B;  4K7U A;  3S2A A;  4FHJ A;  4EZL A;  4FJV B;  1RLF A;  2LWP A;  4AJY B;  4MSM B;  2HDE A;  3DWG C;  2BYT A;  1UNS A;  1DOX A;  1N63 A;  1V9J A;  3MP9 A;  3TMP B;  1F9J A;  2C7H A;  5C3J B;  2W3S A;  3P4R B;  2QHO A;  1KLU D;  1E9M A;  2V4I B;  1WGY A;  4S0R A;  3BVM A;  3AUL A;  2D3C A;  3DWM A;  2G4S A;  1QF6 A;  1SE3 A;  3C8Y A;  1WR1 A;  3Q2A C;  3ZJU A;  4L2Y A;  4YL8 A;  3N1Z C;  3NHE B;  4EE2 A;  2IO2 B;  5FKA C;  3WAN A;  1KLG D;  4A3P A;  1WMH B;  5JZE B;  1WFY A;  4M8N A;  2VRR B;  5FK9 C;  2KTR B;  3L13 A;  1UH6 A;  1TS3 A;  2LGI A;  3ZJT A;  3GS2 A;  2ONQ A;  3P63 A;  4BOS C;  3VHT C;  2FCN A;  1UEL A;  4B0E A;  3RZW C;  1V2Y A;  2L1A A;  2O6V D;  3EUB 2;  4FXC A;  3Q8F A;  5DPT A;  3A4R A;  4GXB A;  1TGZ B;  1KH0 A;  2MCN B;  3EFC A;  4KGT A;  4LNF A;  1GB4 A;  4II2 B;  1Y56 A;  1V5O A;  4ACF A;  5BMH A;  1OQQ A;  3PS6 A;  2KQ4 X;  4IWO A;  2L0F A;  2IYD B;  2PE9 A;  4PYZ A;  4MM3 A;  1WGD A;  2ZW0 A;  4XWW A;  4RGN A;  5H8Y E;  2V0G A;  4D2K A;  2BS3 B;  1FNV A;  4CHK A;  2WXN A;  2VH1 A;  3BYT B;  2IGD A;  5CX3 A;  4ZRI A;  4MH0 E;  1WE7 A;  2M0X A;  1CJE A;  1LGR A;  3AE1 B;  2RPV A;  1L0V B;  4GGQ A;  1ACC A;  2JF5 A;  4RM9 A;  1WF9 A;  3OG5 A;  1TKG A;  3O65 B;  2ZCB A;  3KQ4 A;  3SFD B;  2WXO A;  4F7Z A;  4AWJ A;  3M63 B;  1B9R A;  1AAR A;  4B9K A;  2JSV X;  1DOY A;  4W9G A;  4MGI E;  3B2G A;  2LGX A;  1NI2 A;  2MP2 B;  1Z5S B;  4RGM A;  1JQ4 A;  2DBY A;  3U30 A;  2XK5 A;  3ZNI D;  2BF8 B;  3AEB B;  3BY4 B;  3WAO A;  3VXW A;  3RUL A;  2BQQ A;  5MPO A;  3TSS A;  3W5V B;  3FIL A;  3OLM D;  3QHT A;  4MEL A;  3BII D;  2FID A;  2FCS A;  2QSD A;  3ZQ4 A;  1WX8 A;  4HPL B;  3ZVV A;  3VR9 B;  3RZF A;  1JWB D;  1M4V A;  2KHW B;  3MJ5 A;  2AL3 A;  1EU3 A;  2RDG A;  2L8J A;  4HPM B;  4WJO A;  2JQR B;  4N9F 4;  5AZH A;  1D6E C;  3SR6 A;  2DWQ A;  5G5H A;  3AE9 B;  1UWM A;  4OHJ A;  4LNK A;  1C1Y B;  2KFJ A;  2VZK B;  4KKJ A;  2WDT B;  5IKC M;  1SE2 A;  2LVO A;  4XDC A;  3EFU A;  2D3B A;  1X1M A;  3AN1 A;  2H89 B;  5D6J B;  4A3O A;  2EKI A;  3M62 B;  1ISN A;  2YEP F;  4RMA A;  2K8C A;  2PE6 B;  4UDU C;  2HJ1 A;  4FAD A;  3DVG X;  1XQQ A;  3RT3 B;  1WR6 E;  1TTN A;  2ACZ B;  4KX6 B;  2KDI A;  2N4F A;  3AI5 A;  3N3K B;  1PUT A;  4KKI A;  3KH0 A;  4RCO A;  2WXL A;  3PV1 A;  1P9D U;  2GI9 A;  1QIL A;  1KFY B;  1D4B A;  1KTK A;  4GLS C;  1JWM D;  1UD7 A;  1WM3 A;  4IC7 B;  1ZGU B;  3AE5 B;  2J4X A;  3KWV A;  2D11 A;  1C79 A;  4LDT D;  1WZ0 A;  1NEK B;  2Y5P A;  1YN5 A;  3TEX A;  3B0A A;  4ANW A;  2PVO D;  2JU6 X;  1S1Q B;  1T0Q C;  2I2Y A;  3AEA B;  1P98 A;  1YIW A;  2MBO A;  2LXC A;  2G1E A;  2WXI A;  2UYZ B;  5D2M B;  4EZK A;  1T0Y A;  3ZNZ B;  4IM2 A;  2KJR A;  4ZHO A;  4E3C A;  5G2N A;  4RF0 A;  1VZ6 A;  2L3Z A;  1TT5 B;  2BYE A;  5EDS A;  4R3D A;  2LGD A;  4KZ0 A;  4ICU A;  1K51 A;  2INC C;  2RMM A;  2WXH A;  2V4L A;  3IG3 A;  2CHX A;  1IGD A;  4GN1 A;  2DEN B;  3ZRC A;  5KHQ A;  1PFD A;  3LYY A;  4PT5 A;  2O6V B;  4TQ0 A;  2D07 B;  1R4N B;  3H9D A;  2DZK A;  2SAK A;  4HEA 1;  3A9K B;  4FUL A;  1EWC A;  3PPA A;  2KDB A;  1P0R A;  3ZJV A;  2NBW B;  3PRP B;  1J0G A;  4MSQ B;  2KTR A;  2NS5 A;  1E8X A;  1JML A;  2ZNV C;  2ASQ A;  3VTV A;  1I4Q A;  2MLB A;  3T9L A;  2REX A;  3VTU A;  3BK2 A;  3Q69 A;  5BYQ A;  3RN9 C;  1IP9 A;  3EC8 A;  2IND C;  3TUO A;  2Z0D B;  2I38 A;  3TIX A;  5TSS A;  3HM6 X;  1PGX A;  1RRB A;  3RNC C;  1WXA A;  4WUR A;  3L16 A;  1CQV A;  2KOX A;  4QAY A;  2IY0 B;  1GG3 A;  1F52 A;  4HCP B;  4X57 B;  1I42 A;  4RFB A;  2NCN A;  1QT9 A;  4TV3 A;  2DAJ A;  1HTO A;  1GUA B;  2KDM A;  5DPR A;  2CHZ A;  1GNU A;  2DYO A;  1BML C;  3IXS A;  3QCA A;  3GP7 A;  2PIA A;  2R61 A;  2M1M A;  5IA7 A;  2LHE A;  2H88 B;  3V62 A;  4DHJ D;  5D7G A;  1QQR A;  1VDV A;  2KFK B;  1FPY A;  1FD6 A;  2JWZ A;  1HE8 A;  3I9V 1;  3ZNH B;  2IDY A;  1XEE A;  2CJO A;  3IVF A;  4G3X B;  2C9W B;  1R4M I;  4JIO U;  3T3O A;  2PMV A;  2OJR A;  1YOV B;  2WXG A;  3QAR A;  3DBR I;  3L4P A;  3X0W A;  1S3S G;  3TL5 A;  2AQ1 B;  1QLB B;  2ZZP B;  3K9O B;  1NBF C;  1BT0 A;  5KHO A;  1V6E A;  2FAZ A;  5TR5 A;  2LD9 A;  1H8C A;  3DDC B;  5D3I B;  3DBS A;  4B6W A;  5HG2 A;  4AUQ C;  1ZE3 D;  3R66 C;  4K3C A;  3ZIM A;  2NMQ A;  3ONS A;  3KYC D;  4PK1 A;  4ANU A;  2LXA A;  3VRA B;  2L83 A;  3T3N A;  4L1B A;  3B1L X;  1TS5 A;  2RDH A;  3AV8 A;  4N59 A;  2MBH A;  3RUI B;  2WXF A;  3NZU A;  1ROE A;  3AM9 A;  2W54 A;  1A5R A;  2PTL A;  3L54 A;  4WWN A;  3URY A;  2XK5 B;  1EF5 A;  1HTQ A;  4DWF A;  5LLI A;  3U7Z A;  2XBB C;  4IG7 B;  2KDF B;  3RNF C;  3CMM B;  1E7V A;  4ARI A;  2C60 A;  2CS4 A;  1YNT E;  1VD2 A;  2LAS A;  1T0R C;  2IZV B;  5IAA C;  4EFO A;  3ECI A;  4LDT B;  4IM0 A;  4KDI C;  2LHD A;  5LXH A;  3R2I A;  3HK0 A;  1WJU A;  4KGR A;  1R7S A;  2GBN A;  4JGH B;  3LDZ E;  4RH6 A;  4M0W B;  4HDO A;  1V1P A;  1D3Z A;  2D2Q A;  4RNA A;  1RM6 C;  2O2V A;  3KUZ A;  4BKS D;  4K7S A;  3H7S A;  2DHZ A;  4A6Q A;  1JRP A;  3LB8 C;  4MAC A;  2QDF A;  2GBJ A;  4NJ6 A;  5E6J A;  5AEK B;  2XN9 C;  3TEZ A;  2JRH A;  2NR2 A;  2IO1 B;  2N0S B;  3AMZ A;  1F0Z A;  4M00 A;  1ZDX A;  2WXM A;  5HFY A;  3AXC A;  4IDI A;  3TJP A;  1L4Z B;  1N62 A;  1P1A A;  4IOI E;  3PLV A;  4C80 A;  3CSF A;  3CF6 E;  3W2D A;  2PEA A;  1HZ5 A;  4C4V B;  4W9L A;  2GMI C;  2MW5 A;  2LJI A;  3VH4 B;  2SEB D;  4WWO A;  3RCZ A;  4N6E B;  3EHV A;  4WAA A;  1AN8 A;  2KJH B;  2NVU I;  1WJ4 A;  2K6D B;  2CKH B;  2LUM A;  2O6V A;  2HJ8 A;  5BMG A;  3A9K A;  4IKG A;  2PPH A;  1WE6 A;  2W55 A;  4MGK E;  2UU7 A;  5CHF A;  5EE1 A;  2DAF A;  3ZNG C;  1J7B A;  2HD5 B;  2NBV B;  4WQO B;  3BZD B;  2KQ7 A;  3B2F A;  1WYW B;  1QOA A;  2KDE B;  2B76 B;  3AE3 B;  3V3X A;  3VDZ A;  3N20 C;  4HRS A;  1YN3 A;  2AX5 A;  4NPN A;  1VJK A;  4I6N B;  1PYW D;  1XCQ L;  4OZA A;  2I1J A;  1U4A A;  4XX5 A;  4DHJ B;  5L95 C;  3O13 A;  4LJP B;  1YX6 B;  3ENE A;  2KNB A;  4HK2 A;  1MJD A;  1TY0 A;  4RGO S;  4USA A;  2IGH A;  2MRP A;  4ZYN A;  3MHS D;  1EU4 A;  2E6X A;  3IBE A;  2WU2 B;  1RYJ A;  2N7E A;  3Q3J A;  1K8R B;  4JL9 A;  4P1B C;  3H6N A;  4PS7 A;  1ET6 A;  2KFK A;  2WXQ A;  2V3P A;  1I35 A;  2WXR A;  1WWT A;  3A33 B;  2RPQ A;  1E8Z A;  2JUO A;  1HEZ E;  1ESF A;  3VFK A;  1VZ7 A;  4PS8 A;  3APC A;  2K9X A;  1F1H A;  3V61 A;  3PO0 A;  4YSZ B;  3ZGZ A;  1TIF A;  3LJ3 A;  4GB9 A;  4WJQ A;  3OAW A;  4DXG A;  2BS4 B;  3RFZ B;  2KJ6 A;  3RD2 A;  4TMA B;  3SHQ A;  2J53 A;  2QMT A;  3ZDT A;  2W9N A;  1NI3 A;  3EA6 A;  1IYF A;  2KC1 A;  1FRR A;  4ANV A;  2N9L A;  1WSP A;  1YJ1 A;  1EWY C;  1DGJ A;  4GDL B;  2K0P A;  2KLC A;  4FHK A;  2KD0 A;  5CTR C;  1YQ4 B;  3WIM A;  3DVN V;  3ZDM C;  4M01 A;  1HA5 A;  1K53 A;  2EMS A;  2ZPY A;  3Q8E A;  2IPK D;  4DHZ B;  2N9X A;  3DHH C;  2KO3 A;  1WXQ A;  4C00 A;  2OED A;  2BYV E;  4W9K A;  1DYQ A;  5HKH A;  4BAX A;  2WS3 B;  4G50 A;  1JRU A;  4N58 A;  3Q8B A;  3BVZ A;  2D3G A;  5HHD G;  2INN E;  3LXF A;  4FA6 A;  3P2B A;  3HVD A;  4WJP A;  1FEH A;  3VUW A;  2MHJ A;  1WX9 A;  3DBH B;  3DHG C;  4YT0 B;  1J7A A;  5J2R A;  5LNK 1;  2N7J A;  2LI5 A;  4W9C A;  3SEB A;  1IBX B;  3CIR B;  1J19 A;  1NDD A;  1ZDV A;  3P4Q B;  3A4S C;  1YJJ A;  2L05 A;  1WI0 A;  1DOI A;  1C4P A;  1GPX A;  3IT6 B;  5C23 A;  2LUE A;  4ZRJ A;  3NUH B;  4M0W A;  1R4N I;  2R2O A;  1LO5 D;  1NYQ A;  1SIF A;  2DLB A;  5E6N A;  1H4R A;  2JXX A;  3M3J A;  1WXM A;  4A9A A;  4IWQ A;  4JE3 B;  2K3U A;  3N1Y C;  3QJZ A;  3JVZ X;  2CHW A;  3R3M A;  1V1O A;  3SDL C;  4RGT A;  1FFV A;  4XDD A;  4XYC A;  4MJS B;  1YX5 B;  1EF1 A;  4IWP A;  2J52 A;  1OEY J;  1YN4 A;  1E5W A;  3N1X C;  4LCD E;  3E56 A;  2Z0E B;  2DX5 B;  1JAL A;  3X23 A;  4C4V A;  1V1P B;  2K22 A;  3NJT A;  2O2V B;  1UBI A;  4FN2 A;  3ML9 A;  5JXV A;  1IGC A;  1WJ6 A;  4NQL B;  2L32 A;  3AE7 B;  3AEC B;  3PSE B;  1TY2 A;  2LJ5 A;  4Q2J A;  2IY1 B;  4YXD B;  2QC8 A;  3VAW A;  1NVI D;  3JSV B;  1EM7 A;  4XC2 A;  1GB1 A;  1KJT A;  1XO3 A;  2BGF A;  2WWZ A;  4DBG A;  3Q14 C;  3UQB A;  2QEJ C;  1CMX B;  1YJI A;  5IN7 A;  3PRZ A;  1V8C A;  1Q5W B;  4AP4 C;  4FJY A;  2J7Q B;  3AE8 B;  4ZHP A;  4E71 A;  3QQ8 B;  3RMK C;  4A8X C;  2FE8 A;  2BWE S;  3VR8 B;  4FBJ B;  1Q0W B;  3AEF B;  2XEW A;  3EGR A;  1OTR B;  5AZF A;  4TQ1 A;  2GLS A;  4ICV A;  2MBQ A;  2FCM A;  4KIK A;  2OHF A;  2IO0 B;  1WIA A;  2FNJ B;  2WP9 B;  1K52 A;  2G45 B;  1WYG A;  3RYT A;  1VCB A;  1KRH A;  4IW0 A;  3QC8 B;  3WAM A;  4HKQ A;  1SEB D;  4PYU A;  2JZP A;  3MTN B;  4OZC A;  3RNG C;  3UF8 A;  1L6U A;  3BVG A;  4FJZ A;  3UI3 A;  3JYU A;  2KWD A;  2MH7 A;  4ZOH C;  2KKC A;  2MBE A;  3UGB B;  3PRE A;  1L6V A;  3VRB B;  3QWZ B;  4A55 A;  3DBL B;  2AEH A;  1MG8 A;  4LJO B;  3P1M A;  2IO3 B;  5J17 A;  3Q8C A;  4LLG M;  4XWT A;  2J0M A;  2V1Y A;  1FCL A;  1N5W A;  2ON8 A;  3OJ3 A;  2NTS A;  1MHX A;  3IAS 1;  2JY6 A;  1RWS A;  1V86 A;  3PVL A;  2C7M B;  1SBB B;  4GMV A;  5G5G A;  1LXD A;  2GRI A;  4MH8 A;  5LXI B;  2KAC A;  2WU5 B;  2BB6 A;  4GDL A;  5FR3 A;  2MWS B;  3K9P B;  1I7H A;  2BWF A;  3R2T A;  3P4S B;  2HTH A;  1CZP A;  2A5U A;  3GZN B;  2LVP A;  2A4Z A;  2BVC A;  2GBM A;  4HDQ A;  5BMI A;  2G4D B;  1V97 A;  1L4D B;  4HXD A;  1C78 A;  5EE0 A;  5GXG B;  1XF5 L;  5AUK A;  4NQK E;  4W9D A;  5I4D A;  5FR6 A;  3U7D A;  1C3T A;  2M0A A;  2FUH B;  3IT4 B;  5JH5 C;  1LM8 B;  3BK1 A;  3W9C B;  2WGS A;  4BKS A;  1D5X C;  2KMA A;  2BT6 A;  3KW5 B;  1JWS D;  1L5P A;  4C7Z A;  1MFW A;  3DCG A;  2DNF A;  1IBX A;  4DHZ E;  4KZC A;  3APD A;  1AWD A;  3BIN A;  3MFG A;  4NJ7 A;  3Q3O C;  1Q1O A;  2LZ6 A;  1TBE A;  2K25 A;  1ZOY B;  1N60 A;  1D5Z C;  4L23 A;  2WXK A;  4PS3 A;  3ZRF A;  3NVZ A;  1G6J A;  2K8B A;  5H92 C;  1SSN A;  5CHV C;  3Q8A A;  3ZXV A;  2FBW B;  3AU5 A;  3WAP A;  2WDV B;  2MSE D;  4YTM B;  3OWE B;  4K3B A;  4MJS A;  4ITK A;  1N61 A;  1FM0 D;  1LFD A;  3FAH A;  2WLB A;  3OJ4 B;  2Y5B B;  2M8S A;  2BTE A;  1P3Q U;  1QOG A;  2KQS A;  5BYR A;  1E7P B;  1T0S C;  4HLE A;  4NAW B;  3KVF B;  3CST A;  2G9H D;  3AED B;  2UWQ A;  4K7W A;  4W9J A;  2GBR A;  3APF A;  3QA8 A;  1UBQ A;  1HXY D;  1WGK A;  1VZ8 A;  1D5M C;  1L0X B;  4JWS C;  1OFF A;  3NVW A;  3IHP C;  2KT7 A;  3UIO B;  1SE4 A;  4DDG D;  2LRW A;  3JSV A;  1WJN A;  2KWC A;  2WYQ A;  4BVU C;  2CJN A;  3AB5 A;  4P7I A;  4ANX A;  2ZVO A;  2BKR B;  2Y5C A;  2JZ3 B;  1WZ3 A;  4WJN A;  1JWA D;  1YQB A;  3I3T B;  1FNU A;  3ZKJ C;  3ZLZ A;  2ZPN A;  2C7N B;  1V5T A;  2DZJ A;  3GOE A;  1TS4 A;  5D94 A;  5IOI A;  3QK0 A;  2JYE A;  1FRD A;  1WH3 A;  2G3Q B;  4LNN A;  1IPG A;  1RFA A;  2WHI A;  2MEK A;  1SGH A;  2WX1 A;  2LRU A;  4JQW C;  1PDX A;  1RAX A;  1OQR A;  1TZ1 A;  2OOB B;  3R8B A;  3ML8 A;  4EOY A;  1AYF A;  4M02 A;  3DPD A;  2AQ2 B;  3TEW A;  2B3A A;  5BO4 B;  1E7U A;  2ZEQ A;  1L7Y A;  1WRD B;  5J18 A;  2Z59 B;  2PKO A;  2QIE B;  2N9K A;  4DDI D;  1FIQ A;  4KDL B;  1L0Y B;  1STE A;  1WRI A;  4OZB A;  2CU3 A;  4JWU C;  3HRD D;  3MC9 A;  2AWT A;  2YVC A;  2K1F A;  2K6Q A;  2M19 A;  2MJD A;  1WM2 A;  4K81 A;  3PHW B;  4OVU A;  3RNB C;  4ZRP A;  3L08 A;  1I4R A;  2KK8 A;  1AW7 A;  3NVY A;  1PGA A;  4YWG G;  4KIK B;  3DBH I;  5EE3 A;  2JWU A;  3KWL A;  4YSY B;  3AE6 B;  2M4N A;  3KUD B;  4JLC A;  1Q10 A;  3HUI A;  1A70 A;  3IFW B;  4G11 A;  2JVC A;  3N30 A;  4AOF A;  1EO6 A;  3I5J C;  2QIL A;  2MQJ A;  2M17 A;  1FXI A;  4ZRQ A;  4GIV A;  2Q5W D;  3EEC A;  2RD0 A;  3QIJ A;  4O1N A;  1XXG A;  2AYO B;  3T8M A;  3W5U B;  3KLS X;  1QOB A;  2J42 A;  2X38 A;  5D3D A;  4E74 A;  3R7R A;  4KSL C;  1JW9 D;  4W9F A;  4OVZ A;  3H1U A;  2KMM A;  2L7R A;  1XLP A;  4H2A A;  2ZCC A;  3D32 A;  4LK0 M;  3NS1 A;  4ZDV A;  1Z2M A;  4CYE A;  1HZ6 A;  4TSS A;  3H7P B;  1TKE A;  4DXA B;  3VH3 B;  3SFE B;  1GC6 A;  5JHA A;  3V60 A;  4IUM B;  3U4E G;  2JZZ A;  1QZE A;  3HM3 A;  1UF0 A;  4P6V F;  2KX3 A;  1EUV B;  4MEM A;  5G55 A;  3NOB A;  3W1S A;  2JX5 A;  2WQY B;  2KX0 A;  2M56 B;  1C4A A;  1MG4 A;  1KF6 B;  3ZTD A;  4ZYS A;  2GBK A;  3GE3 C;  3NRZ A;  1WXV A;  5AUI A;  5JHB A;  1UWX A;  2LVQ A;  1WX7 A;  3E9S A;  3AEE B;  2JT4 B;  4EEW A;  3A9J A;  1IUE A;  4F1S A;  1OEY A;  3PHX B;  3A1Q B;  3AH7 A;  2ZVN A;  1OGW A;  3KYD D;  4HJK A;  2GB1 A;  4TKN A;  3PT2 B;  2MJ3 A;  4WWP A;  4I6P A;  2CR5 A;  1UGM A;  1MPE A;  1RFK A;  3WAL A;  3J9C A;  4LTU A;  1E10 A;  2FIF A;  2NPT A;  1VLB A;  2DYB A;  1T6B X;  2L0T A;  4BKG A;  1XCT L;  2KAN A;  2AQ3 B;  3I57 A;  4NAW A;  3GE8 C;  2LEK A;  4WQM A;  1TKY A;  4A20 A;  2IGG A;  1E6E B;  2RDB C;  4W9H A;  3AEG B;  2Z8L A;  1XLQ A;  1SB3 C;  2WDR B;  2V9H A;  2L76 A;  3W1S C;  5AZG A;  4CO7 A;  2N1W A;  3U52 E;  2PW9 A;  3U2S C;  2JRI B;  2WXP A;  3NG0 A;  2MJE A;  1FO4 A;  1GC7 A;  3TCA A;  3VQI A;  2KLG A;  4XE0 A;  3C0R B;  1I4H A;  3WCQ A;  4C56 C;  3DBL I;  3UIP B;  1UUP A;  2PLP A;  3JW0 X;  2BYF A;  2YLM A;  4WAF A;  2E3T A;  3IAM 1;  1PQS A;  2ICI A;  2RGF A;  3TBL D;  1WGH A;  1MHH E;  4W9E A;  3U8Z A;  3UIN B;  1NEN B;  4BFR A;  3BYY B;  1V81 A;  4WIP A;  1KOT A;  4BZA A;  4RF1 A;  1BXT A;  2XNA C;  2D10 A;  4NY0 A;  4GU2 A;  1N5X A;  2X8X X;  2WX0 A;  3Q3F A;  2MBB B;  4M8M A;  2TSS A;  3NS8 A;  3ZXR A;  2MX2 A;  3AE2 B;  1CK1 A;  2INP E;  4DK5 A;  3FC4 A;  1T3Q A;  2KAJ A;  2RR9 A;  4JPS A;  1FXA A;  4GDK B;  2C5L C;  2KN5 A;  4KGS A;  1BUI C;  2BBC A;  3GZN I;  3H8H A;  2BW2 A;  4RM8 A;  1ZP0 B;  2PJH A;  3PLU A;  4TUU A;  3HIZ A;  4HCN B;  3AU4 A;  3RPF C;  2N9E B;  1ZXI A;  3N32 A;  2ZJD A;  4AS1 A;  4BOZ B;  1TS2 A;  3V6C B;  1F77 A;  3NZS A;  3ZTC A;  3NY5 A;  2J0J A;  1ZXH A;  3DVG Y;  4CQN A;  3Q3M C;  3B9J A;  1YQ3 B;  5CHW A;  2FCQ A;  3L10 B;  2W3R A;  2BS2 B;  2KVR A;  1C77 A;  1WXS A;  2IBI B;  2W82 A;  1PGB A;  1SXT A;  2L00 B;  2HTM E;  2KC2 A;  4W9I A;  4GOC A;  1WMH A;  1JWU D;  4K1R B;  1TJE A;  4II3 B;  5E6P A;  2HE7 A;  1KLV A;  1ZUD 2;  1SJH D;  4XGA B;  4EZJ A;  5L83 A;  2EMT A;  3VUY A;  3WA0 A;  4S17 A;  4J6I A;  3P4P B;  1V49 A;  2KN4 A;  3Q3N C;  4WWM A;  2WNM A;  4MGZ E;  1C4C A;  4ASW C;  5BYS A; 
#chains in the Genus database with same CATH homology
 3H7P A;  1UBQ A;  4FAD A;  3DVG X;  3SD5 A;  1XQQ A;  3RT3 B;  1WR6 E;  3A33 B;  1I35 A;  1XD3 B;  2RPQ A;  1E8Z A;  2JUO A;  1TTN A;  2KDI A;  2KXJ A;  2N4F A;  3AI5 A;  3N3K B;  3VFK A;  3IHP C;  3UIO B;  4PS8 A;  3PTF C;  4DDG D;  2LRW A;  3JSV A;  3APC A;  1WJN A;  3V61 A;  2DZM A;  2KWC A;  3KH0 A;  4FLH A;  2WYQ A;  4BVU C;  3PV1 A;  1P9D U;  3LJ3 A;  4GB9 A;  4WJQ A;  3OAW A;  4P7I A;  3PGE A;  4ANX A;  2KJ6 A;  2ZVO A;  2BKR B;  3RD2 A;  2BKF A;  3SHQ A;  2KWU B;  1UD7 A;  1WM3 A;  1WZ3 A;  2JZ3 B;  3PRM B;  4IC7 B;  1ZGU B;  2EKE C;  4WJN A;  5GMV A;  3ZDT A;  2W9N A;  1YQB A;  3I3T B;  2D11 A;  4LDT D;  3ZKJ C;  2MA9 B;  1IYF A;  2KC1 A;  3ZLZ A;  2ZPN A;  1WZ0 A;  2C7N B;  1V5T A;  2DZJ A;  3GOE A;  5D94 A;  4ANV A;  4ANW A;  1YJ1 A;  3B0A A;  3QK0 A;  1S1Q B;  1Y8R C;  4GDL B;  1P98 A;  1WGG A;  1YIW A;  2KLC A;  2V3S A;  4FHK A;  2MBO A;  1WH3 A;  2G3Q B;  2KD0 A;  2RSU A;  1E90 A;  2LXC A;  3A1Q A;  1IPG A;  5CTR C;  1RFA A;  3WIM A;  3DVN V;  3ZDM C;  2UYZ B;  2KTF A;  5D2M B;  1SGH A;  2KWV B;  4EZK A;  1T0Y A;  3VVW B;  2ZPY A;  2EMS A;  3ZNZ B;  2WX1 A;  2LRU A;  2MP2 A;  4IM2 A;  4JQW C;  4B95 A;  2KJR A;  2N9X A;  4DHZ B;  1GJZ A;  1RAX A;  2KO3 A;  4E3C A;  5G2N A;  1TZ1 A;  2L3Z A;  2OOB B;  3M95 A;  3ML8 A;  3L17 A;  4EOY A;  5C1Z A;  2BYE A;  2BYV E;  4W9K A;  5EDS A;  5HKH A;  1UZX B;  3DPD A;  4ANU A;  3B08 A;  2B3A A;  2LGD A;  4KZ0 A;  4G50 A;  5BO4 B;  5DCN A;  1E7U A;  1JRU A;  1ZW7 A;  2ZEQ A;  1L7Y A;  3DQV A;  4ICU A;  4EUT A;  1WRD B;  2D3G A;  3SU8 X;  5J18 A;  3UQA A;  3ALB A;  2V4L A;  2Z59 B;  3IG3 A;  2CHX A;  2J0K A;  4FA6 A;  3P2B A;  4DDI D;  4WJP A;  4KDL B;  4ZRK A;  3VUW A;  1KM7 A;  4GN1 A;  2DEN B;  3ZRC A;  1WX9 A;  5KHQ A;  2AWT A;  2YVC A;  1WY8 A;  2K1F A;  2K6Q A;  5J2R A;  1WM2 A;  4K81 A;  2O6V B;  3A9J B;  4TQ0 A;  2D07 B;  3PHW B;  3H9D A;  4HVB A;  4I6L B;  4OVU A;  3V6E B;  2DZK A;  3A9K B;  4FUL A;  3PPA A;  2LI5 A;  3L08 A;  4W9C A;  1M94 A;  2KDB A;  1WGR A;  1P0R A;  2KK8 A;  4KSK C;  2DYM A;  2NBW B;  3PRP B;  1J19 A;  1J0G A;  2N9P C;  3ZO5 B;  1NDD A;  3R7Q A;  3A4S C;  4MSQ B;  2L05 A;  2KTR A;  2NS5 A;  1WI0 A;  1E8X A;  5C23 A;  2ZNV C;  2ASQ A;  2LUE A;  4KIK B;  4XZ4 A;  3DBH I;  3VTV A;  2MLB A;  2BPS A;  4ZRJ A;  3T9L A;  2REX A;  3W1Y A;  2M4N A;  4BKT A;  3KUD B;  4JLC A;  3VTU A;  1R4N I;  2R2O A;  3IFW B;  4G11 A;  1SIF A;  4AJW A;  2JVC A;  3N30 A;  5E6N A;  1IP9 A;  4AOF A;  3EC8 A;  1H4R A;  2NPT B;  1EO6 A;  2NBU A;  2JXX A;  3PZD A;  2Z0D B;  4KV2 A;  3TIX A;  1SE9 A;  3M3J A;  3HM6 X;  1WXM A;  1RRB A;  2KZR A;  1WXA A;  2MQJ A;  2M17 A;  3KUC B;  3L16 A;  4OVV A;  2KOX A;  4URK A;  4IWQ A;  2IY0 B;  1GG3 A;  2K39 A;  4BBN C;  3QJZ A;  4GIV A;  4HCP B;  3JVZ X;  2N7D A;  2CHW A;  3EEC A;  4X57 B;  1I42 A;  3R3M A;  3SDL C;  2RD0 A;  3QIJ A;  2NCN A;  4HWI B;  4TV3 A;  4MJS B;  2DAJ A;  1GUA B;  1YX5 B;  1EF1 A;  2CHZ A;  4IWP A;  2AYO B;  5DPR A;  3VUX A;  1GNU A;  2DYO A;  4BBN F;  3T8M A;  1OEY J;  1YD8 U;  3QCA A;  2K8H A;  2DZI A;  1E5W A;  4E74 A;  2LGY A;  3R7R A;  4LCD E;  4KSL C;  4IM3 A;  4GDK A;  2Z0E B;  2DX5 B;  4W9F A;  3H1U A;  3X23 A;  2M1M A;  2R2Q A;  2L7R A;  1E8Y A;  3MJW A;  1E8W A;  5IA7 A;  4MDK E;  1L2N A;  2O2V B;  1UBI A;  3V62 A;  4FN2 A;  3ML9 A;  2ZCC A;  3D32 A;  4DHJ D;  5D7G A;  1WJ6 A;  1V80 A;  2KFK B;  4ZDV A;  4NQL B;  1Z2M A;  3ZW3 A;  4CYE A;  3L0W B;  2JWZ A;  1HE8 A;  3ZNH B;  4GSW A;  3H7P B;  3IVF A;  4G3X B;  2C9W B;  3PSE B;  2I1K A;  1R4M I;  4JIO U;  4DXA B;  3VH3 B;  4G0N B;  2LJ5 A;  5DPS A;  3HHM A;  1GC6 A;  5JHA A;  2OJR A;  2IY1 B;  3V60 A;  5DPW A;  4IUM B;  3QX1 A;  3DBR I;  3QAR A;  2JZZ A;  3VAW A;  1OQY A;  1QZE A;  3HM3 A;  3X0W A;  3JSV B;  3VTW A;  1S3S G;  3TL5 A;  2AL6 A;  2ZZP B;  3K9O B;  4XC2 A;  2KX3 A;  1KJT A;  1NBF C;  2BGF A;  1BT0 A;  2WWZ A;  1EUV B;  5KHO A;  1V6E A;  4DBG A;  4MEM A;  5G55 A;  3NOB A;  2FAZ A;  3QAQ A;  5TR5 A;  3W1S A;  1J8C A;  2LD9 A;  3UQB A;  1FXT B;  1H8C A;  1CMX B;  2KX0 A;  3DDC B;  3PRZ A;  1LQB A;  4F8C B;  3ZTD A;  2KMC A;  1Q5W B;  2GBK A;  4AP4 C;  3DBS A;  2CU1 A;  4FJY A;  5E6O A;  2J7Q B;  4MGY E;  2ZNV B;  1WXV A;  3DOW A;  4B6W A;  5JHB A;  4E71 A;  3QQ8 B;  2LVQ A;  1WX7 A;  4AUQ C;  2JT4 B;  3R66 C;  3A9J A;  4EEW A;  2BWE S;  4NNJ B;  4KVG B;  4EKU A;  4F1S A;  1OEY A;  4FBJ B;  1Q0W B;  3PHX B;  3A1Q B;  3ZUN A;  2XEW A;  3ZIM A;  2JPH A;  3DVN U;  1ZKH A;  2GOW A;  2N1V A;  3ONS A;  2ZVN A;  3KYC D;  1OGW A;  1OTR B;  1XT9 B;  2LXA A;  3KYD D;  4HJK A;  4TKN A;  4ICV A;  4K7U A;  4TQ1 A;  5AZF A;  3S2A A;  4FHJ A;  2MBQ A;  3PT2 B;  4EZL A;  4FJV B;  1RLF A;  2LWP A;  4AJY B;  2FCM A;  3B1L X;  4KIK A;  4MSM B;  4WWP A;  2IO0 B;  1WIA A;  4I6P A;  2CR5 A;  2FNJ B;  1UGM A;  2MBH A;  3RUI B;  2G45 B;  3RYT A;  1VCB A;  3NZU A;  3WAL A;  1A5R A;  4IW0 A;  3QC8 B;  3WAM A;  2FIF A;  2NPT A;  3L54 A;  1V9J A;  4WWN A;  4PYU A;  3TMP B;  2DYB A;  2XK5 B;  3MTN B;  1EF5 A;  1F9J A;  2C7H A;  2L0T A;  4BKG A;  2KAN A;  3UF8 A;  4DWF A;  5LLI A;  4NAW A;  2QHO A;  4FJZ A;  2XBB C;  3JYU A;  4A20 A;  4IG7 B;  2KDF B;  2KKC A;  3CMM B;  4W9H A;  1WGY A;  2MBE A;  1E7V A;  3AUL A;  3UGB B;  2C60 A;  2CS4 A;  2G4S A;  3PRE A;  1VD2 A;  1WR1 A;  2LAS A;  2IZV B;  3QWZ B;  5IAA C;  4YL8 A;  3NHE B;  4EFO A;  3ECI A;  4LDT B;  2IO2 B;  4IM0 A;  2L76 A;  2AEH A;  4KDI C;  3W1S C;  1MG8 A;  5AZG A;  3WAN A;  4CO7 A;  5LXH A;  4LJO B;  2N1W A;  2IO3 B;  4A3P A;  3HK0 A;  1WMH B;  5J17 A;  5JZE B;  1WFY A;  2J0M A;  4M8N A;  2V1Y A;  1WJU A;  2VRR B;  2KTR B;  3L13 A;  1UH6 A;  2JRI B;  2GBN A;  4JGH B;  3LDZ E;  3OJ3 A;  1GC7 A;  3TCA A;  3VQI A;  3VHT C;  4M0W B;  4HDO A;  4BOS C;  2FCN A;  2KLG A;  1D3Z A;  2D2Q A;  3C0R B;  1UEL A;  2JY6 A;  2O2V A;  3KUZ A;  3RZW C;  3DBL I;  3UIP B;  4BKS D;  1V86 A;  1V2Y A;  3PVL A;  2C7M B;  4K7S A;  2O6V D;  3JW0 X;  3H7S A;  2BYF A;  2DHZ A;  2YLM A;  4GMV A;  1PQS A;  5DPT A;  1LXD A;  3A4R A;  2RGF A;  4GXB A;  1TGZ B;  3TBL D;  1WGH A;  2MCN B;  4W9E A;  3U8Z A;  3UIN B;  5LXI B;  2GBJ A;  4NJ6 A;  4BFR A;  4GDL A;  1V81 A;  4II2 B;  1KOT A;  5AEK B;  1V5O A;  3QA8 A;  2MWS B;  3K9P B;  2D10 A;  4NY0 A;  2JRH A;  4GU2 A;  2BWF A;  3PS6 A;  2WX0 A;  2HTH A;  2NR2 A;  2IO1 B;  3Q3F A;  4IWO A;  2A5U A;  2IYD B;  2L0F A;  2LVP A;  2PE9 A;  2A4Z A;  2MBB B;  4M8M A;  4PYZ A;  4MM3 A;  1WGD A;  3NS8 A;  3AXC A;  2MX2 A;  3TJP A;  2GBM A;  4HDQ A;  4DK5 A;  2G4D B;  1P1A A;  3PLV A;  2RR9 A;  3CSF A;  4CHK A;  3CF6 E;  4HXD A;  4GDK B;  2C5L C;  2KN5 A;  2PEA A;  4NQK E;  4W9D A;  4W9L A;  2GMI C;  5CX3 A;  4ZRI A;  2MW5 A;  4MH0 E;  1WE7 A;  2M0X A;  3GZN I;  5FR6 A;  3U7D A;  3VH4 B;  4WWO A;  3RCZ A;  1C3T A;  2FUH B;  4GGQ A;  4RM8 A;  3EHV A;  4WAA A;  5JH5 C;  1LM8 B;  2KJH B;  2NVU I;  2PJH A;  2JF5 A;  4RM9 A;  1WF9 A;  1WJ4 A;  3PLU A;  4TUU A;  3HIZ A;  3O65 B;  2K6D B;  2ZCB A;  4HCN B;  2CKH B;  3AU4 A;  2N9E B;  3N32 A;  4BKS A;  4F7Z A;  2ZJD A;  2KMA A;  2O6V A;  3M63 B;  4AWJ A;  4BOZ B;  2HJ8 A;  1AAR A;  3KW5 B;  4B9K A;  3A9K A;  3V6C B;  4W9G A;  3NZS A;  3DCG A;  4MGI E;  2PPH A;  3ZTC A;  1WE6 A;  3NY5 A;  2J0J A;  4MGK E;  2LGX A;  5CHF A;  1NI2 A;  2DAF A;  4DHZ E;  2MP2 B;  4KZC A;  3APD A;  3ZNG C;  1Z5S B;  2HD5 B;  3BIN A;  2NBV B;  3U30 A;  4NJ7 A;  3DVG Y;  2XK5 A;  4WQO B;  3ZNI D;  2BF8 B;  1Q1O A;  2LZ6 A;  2KQ7 A;  3BY4 B;  3WAO A;  1WYW B;  3VXW A;  1TBE A;  2K25 A;  3RUL A;  5CHW A;  2FCQ A;  2KDE B;  3L10 B;  2KVR A;  4PS3 A;  1WXS A;  3OLM D;  3ZRF A;  2IBI B;  3VDZ A;  3QHT A;  4NPN A;  1G6J A;  2K8B A;  4I6N B;  4MEL A;  2FID A;  2FCS A;  5CHV C;  2L00 B;  1WX8 A;  2KC2 A;  4HPL B;  3ZVV A;  4W9I A;  3AU5 A;  4GOC A;  1WMH A;  2I1J A;  2KHW B;  3RZF A;  1U4A A;  4K1R B;  4II3 B;  4XX5 A;  2HE7 A;  5E6P A;  3WAP A;  1KLV A;  4DHJ B;  2MSE D;  2AL3 A;  5L95 C;  4LJP B;  2L8J A;  4MJS A;  4EZJ A;  1YX6 B;  5L83 A;  3ENE A;  2EMT A;  4HPM B;  4WJO A;  4N9F 4;  5AZH A;  2KNB A;  3VUY A;  4HK2 A;  3WA0 A;  1LFD A;  4J6I A;  3OJ4 B;  2Y5B B;  2M8S A;  1C1Y B;  2MRP A;  2KFJ A;  4ZYN A;  2WDT B;  3MHS D;  1P3Q U;  2LVO A;  1V49 A;  3EFU A;  2KQS A;  3IBE A;  1X1M A;  5D6J B;  2N7E A;  3Q3J A;  1K8R B;  4HLE A;  4NAW B;  3KVF B;  4A3O A;  4JL9 A;  3CST A;  4MGZ E;  3H6N A;  4PS7 A;  3M62 B;  1ISN A;  2KFK A;  2UWQ A;  4K7W A;  4W9J A;  2GBR A;  4ASW C;  4RMA A;  3APF A;  2K8C A;  2PE6 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...