3EC8A

The crystal structure of the ra domain of flj10324 (radil)
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
149
structure length
139
Chain Sequence
b'GTENLYFQSMDPAELSTQLSAPGVLKVFGDSTGTHYKSVLATGTSSARELVKEALERYALDPRQAGQYVLCDVVGWQARCFRVFGDSEKPLLIQELWKPREGLSRRFELRKRSDVEELAAKEVDTITAGINAQARRLQR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein FLJ10324
publication title The crystal structure of the RA domain of FLJ10324 (RADIL)
rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 41
structure length 139
sequence length 149
ec nomenclature
pdb deposition date 2008-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00788 RA Ras association (RalGDS/AF-6) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3ec8A00
2LD9A 2IO2B 2KTRA 3DBSA 3WAPA 2IO0B 3PZDA 4GMVA 1NBFC 4RMAA 2UWQA 1SGHA 4BKSD 2EMSA 4M8MA 2K6DB 3TIXA 2G4DB 1LXDA 4GB9A 2J7QB 1WE6A 3ZNZB 1SE9A 4FA6A 1WX8A 4DHJD 1YIWA 2KWUB 2BGFA 1GC7A 1RFAA 1UBIA 3AI5A 2ASQA 2LXAA 2AL6A 4FJVB 4I6PA 4NQKE 4ANXA 4DXAB 5C1ZA 5J18A 2ZCCA 2PJHA 1P9DU 4WAAA 2IO1B 3NS8A 4LJPB 4WWNA 5LXIB 1OTRB 1A5RA 2LWPA 1E5WA 2C5LC 1QZEA 3NHEB 3DBRI 4RM8A 3DQVA 3WALA 4K81A 1H4RA 1UD7A 1E8WA 3NOBA 4PYUA 3ZDTA 4FADA 2MA9B 2C60A 3NZUA 4MGKE 4KVGB 2R2QA 4MELA 5CHFA 3DVGX 3QAQA 2CHZA 3N30A 2ZCBA 2KLCA 1X1MA 4KIKB 3V61A 3CSTA 4PS8A 3L54A 1J19A 4GN1A 3RZFA 2KZRA 4IM2A 2KX3A 2CHXA 2BPSA 1YJ1A 2KQ7A 1ZKHA 3HHMA 4IG7B 2JT4B 2KTRB 5IA7A 3V60A 1LFDA 2D11A 2NPTA 2C9WB 2WX1A 3CSFA 3QJZA 3PHWB 4P7IA 1TBEA 4GU2A 1C1YB 3PLUA 4GDKA 1UH6A 3GOEA 4HWIB 4A3PA 2LJ5A 1V5OA 3JW0X 1WJUA 3W1SC 3ZVVA 4B9KA 1WXSA 4KZCA 2K1FA 4BFRA 5JZEB 2XK5A 4BOSC 1WE7A 3SU8X 2KFJA 3O65B 3VUXA 4DDID 3TL5A 3IVFA 2FUHB 2KMAA 3EECA 5KHQA 3X23A 3VAWA 3ZIMA 4HXDA 2PE9A 3DBLI 3L17A 3M3JA 4ICUA 3WAMA 2IZVB 2L3ZA 3APDA 1WM3A 5DCNA 4WJNA 2G45B 4URKA 3EC8A 4LDTB 2RSUA 3DDCB 2REXA 2PE6B 2A5UA 4KDIC 4ZYNA 2DZKA 1Q1OA 3DCGA 3WANA 2K8CA 4W9IA 4W9LA 3UIPB 4M0WB 4OVUA 4W9EA 3VXWA 1OQYA 1WIAA 2K25A 2KVRA 3M62B 2RD0A 3PSEB 1WI0A 2DZMA 3ZKJC 1YX5B 4YL8A 2KNBA 5E6OA 2KHWB 2LGDA 3PPAA 4W9JA 3AULA 2GBKA 2ZPYA 5DPWA 3M95A 1WGHA 4PS7A 2JF5A 2JWZA 2KC2A 2XBBC 3UIOB 4BKSA 3NZSA 4PS3A 4BOZB 2L7RA 1RRBA 4FHKA 1WYWB 4KSLC 2NPTB 1I35A 2CKHB 1T0YA 3PT2B 3RT3B 2G3QB 3LDZE 2N4FA 4OVVA 4GDKB 2K8BA 4FBJB 3KW5B 3QQ8B 3ZNID 3VTWA 2D3GA 1WXVA 1WGYA 4J6IA 3JSVA 4GDLA 2FCMA 2DYBA 1E8YA 2EKEC 3PVLA 2NVUI 3ZTCA 3L0WB 2XK5B 4XZ4A 2JY6A 2L8JA 4MJSA 3T8MA 3L10B 4ICVA 4JIOU 1WR1A 4HDQA 3VDZA 2FCQA 3VTVA 3IBEA 3ZO5B 1UZXB 3K9PB 4HDOA 2MBOA 4K7UA 2MQJA 3PRZA 4MGYE 3SHQA 3V62A 2D10A 2KTFA 2O6VD 4N9F4 5TR5A 4G0NB 2N9PC 3IFWB 3KH0A 1PQSA 2C7NB 4AUQC 4HPMB 2NBWB 2N9XA 1E7VA 4MGZE 5L95C 1S3SG 2JUOA 4II2B 2LGYA 2R2OA 2JVCA 4HCPB 4BBNF 2N9EB 2Y5BB 4ASWC 5CTRC 3RULA 2J0KA 3HK0A 4M8NA 1WMHA 2N1WA 3HIZA 2NCNA 4CO7A 2J0JA 1J0GA 2MSED 5AEKB 2BYFA 3UQAA 4XC2A 4E3CA 4WWOA 1BT0A 3HM3A 1E8ZA 3QCAA 4F1SA 2LI5A 4EZLA 4GXBA 1V81A 1IPGA 2UYZB 1NDDA 3PTFC 4WWPA 1P98A 4DHJB 3JSVB 1VD2A 4GDLB 4AWJA 3A1QA 3MJWA 1E8XA 1WJ6A 3SD5A 4FJYA 4A3OA 2BKFA 1M94A 3QA8A 2FCSA 1WFYA 3B1LX 4JL9A 4MJSB 3VUYA 2BYVE 3U7DA 1G6JA 1KLVA 4CHKA 2FCNA 4NJ7A 2DHZA 2DX5B 1WGRA 3KUDB 3Q3FA 2XEWA 4TQ1A 4WJQA 2D07B 2CHWA 4NAWA 3IG3A 2KK8A 1L7YA 4FN2A 3V6EB 2K6QA 3SDLC 3QC8B 3CMMB 4DHZE 1IP9A 1CMXB 4GIVA 5L83A 1R4MI 4GGQA 1GG3A 3L16A 3VH3B 4AP4C 4JGHB 3P2BA 4K7WA 4IUMB 4MEMA 2K39A 3BY4B 2MBEA 3KYCD 2M0XA 1WF9A 2HJ8A 2KC1A 2WDTB 5CHVC 3PLVA 5C23A 1GC6A 1FXTB 3A33B 1WMHB 1V5TA 1YQBA 3OJ4B 4IW0A 3VH4B 5D6JB 1V6EA 1WRDB 2PEAA 2M17A 3DPDA 3ECIA 3MHSD 5HKHA 1H8CA 2LVOA 3ENEA 5D94A 4B6WA 5AZFA 3MTNB 3JVZX 3N3KB 3QK0A 4LJOB 5LLIA 3W1YA 4TQ0A 2ZZPB 2KDFB 1AARA 1RAXA 1WJNA 4BKGA 3X0WA 4EUTA 5J2RA 3H1UA 3L08A 1ISNA 1KJTA 2CR5A 2IY1B 3DVNV 2RGFA 2MX2A 1WH3A 1WGGA 2JZ3B 3A1QB 1WZ0A 2C7MB 2YVCA 2GBRA 2JRHA 2O6VA 2DYOA 4W9KA 4PYZA 2V4LA 4DHZB 2O2VA 3RD2A 2DAJA 3R66C 3TBLD 3VVWB 2MBBB 2YLMA 3VQIA 1KOTA 2LVQA 3D32A 2L00B 2KFKA 2IYDB 4NAWB 4NPNA 1L2NA 4DWFA 1U4AA 1V2YA 2G4SA 5D2MB 3H7SA 1MG8A 3APCA 4I6NB 3C0RB 4HK2A 3RZWC 5JHBA 2AL3A 2L05A 4HPLB 2MW5A 4II3B 3RUIB 3ZUNA 3M63B 5AZGA 2ZVNA 2ZNVB 5JH5C 2VRRB 2MP2A 3QIJA 3U30A 2L0TA 2OOBB 4HLEA 3BINA 1D3ZA 1RLFA 1TGZB 3U8ZA 2LZ6A 1LQBA 2BWFA 3GZNI 3RCZA 5LXHA 3AU5A 2AYOB 2CU1A 3B08A 4BKTA 4BBNC 2BWES 4FHJA 2IO3B 4ZRJA 1HE8A 1V86A 2LGXA 3CF6E 2LRUA 3PS6A 4LCDE 4WQOB 2KX0A 2Z59B 1LM8B 4IM0A 2KDEB 2K8HA 4NJ6A 4FJZA 3ZNGC 2KWCA 4MDKE 3ALBA 4KZ0A 1KM7A 2NR2A 1TTNA 2B3AA 2O6VB 2MCNB 5DPSA 1SIFA 2O2VB 3UINB 4X57B 2LUEA 3DBHI 2KLGA 3H6NA 3AU4A 4HJKA 3UF8A 4G50A 1YD8U 1ZW7A 3A9JA 3R7RA 4ANWA 4ZRIA 2KFKB 4ANVA 4NQLB 3W1SA 2KN5A 1Y8RC 2J0MA 3HM6X 3ZW3A 2N1VA 4BVUC 1GJZA 2DYMA 3PRPB 3PV1A 2QHOA 4FULA 2ZEQA 3APFA 1S1QB 2KJ6A 3ONSA 3RYTA 2GBNA 3VHTC 1WGDA 4GSWA 2MP2B 3Q3JA 1IYFA 4DBGA 2NS5A 3A4SC 3QARA 1Z2MA 2RR9A 1F9JA 2KOXA 2Z0EB 2C7HA 3OJ3A 1EUVB 5D7GA 4EKUA 2HE7A 2V3SA 1C3TA 2V1YA 1XD3B 2MWSB 1E90A 4KSKC 3JYUA 4W9GA 2I1KA 5DPRA 3A4RA 4IC7B 1NI2A 2Z0DB 2WX0A 4JLCA 1VCBA 4AJYB 4I6LB 1UBQA 2GBMA 1YX6B 2A4ZA 3S2AA 3ZNHB 1GUAB 4W9CA 3EFUA 1Z5SB 4GOCA 3VTUA 1WXAA 3UQBA 2NBVB 4NNJB 2FIFA 1P0RA 3KUZA 2HTHA 2NBUA 3OAWA 2N7EA 5J17A 3KYDD 2LRWA 2JZZA 3A9JB 4MGIE 3ZRFA 1EF1A 2L0FA 3B0AA 2M1MA 1R4NI 3H7PA 1XT9B 1WX7A 2FNJB 3R3MA 3WA0A 2KD0A 4F8CB 5JHAA 3NY5A 1WZ3A 3QHTA 4IWQA 1OEYA 4WJPA 5FR6A 5EDSA 4W9HA 4IWOA 2KDBA 2LASA 3I3TB 4WJOA 2EMTA 2BYEA 5AZHA 2FIDA 2L76A 3LJ3A 4KV2A 2IY0B 1P3QU 2KJHB 3ZTDA 4G11A 1V9JA 3PRMB 5CHWA 1XQQA 2DZIA 2M8SA 4HVBA 5KHOA 2JRIB 3EHVA 4NY0A 2IBIB 4CYEA 2D2QA 4IWPA 2DZJA 1K8RB 4LDTD 4EEWA 1WY8A 3ML9A 4TUUA 3A9KA 3PHXB 1WM2A 4EZKA 3K9OB 3DOWA 3PGEA 3ZDMC 3ZRCA 2OJRA 3ZLZA 1WR6E 4TV3A 1V80A 3T9LA 4DK5A 5CX3A 2LXCA 2WYQA 2ZVOA 2ZJDA 2BF8B 5E6PA 2GOWA 4E74A 1EF5A 5G55A 1ZGUB 2KMCA 1EO6A 4K1RB 2WWZA 4MH0E 4EOYA 3R7QA 4RM9A 4DDGD 4AJWA 3KUCB 4FLHA 3OLMD 2GMIC 2BKRB 2GBJA 2HD5B 2JPHA 4HCNB 4TKNA 3H7PB 4IM3A 4ZDVA 1UELA 2KANA 4F7ZA 2I1JA 2FAZA 2LVPA 2N7DA 3N32A 4EZJA 3UGBB 4XX5A 3WAOA 4KDLB 4MSMB 2MBQA 2MBHA 5G2NA 2MRPA 1WX9A 2ZNVC 1GNUA 3TJPA 2DAFA 1TZ1A 1Q0WB 1OEYJ 4W9FA 5DPTA 2KXJA 5GMVA 2JXXA 3H9DA 2KDIA 2DENB 1WJ4A 3VFKA 4EFOA 2M4NA 2AWTA 1WXMA 2MLBA 3TMPB 3DVNU 3L13A 2CS4A 2KQSA 4K7SA 2W9NA 2KJRA 1P1AA 3V6CB 3VUWA 3ML8A 2KKCA 4B95A 1UGMA 4ANUA 1E7UA 3QWZB 5E6NA 3KVFB 3AXCA 2AEHA 1OGWA 3A9KB 1V49A 4A20A 2RPQA 4G3XB 4JQWC 3DVGY 3PREA 5BO4B 2KO3A 2PPHA 4KIKA 4ZRKA 4MM3A 4E71A 4MSQB 2ZPNA 4AOFA 3QX1A 1Q5WB 2KWVB 3IHPC 4W9DA 3WIMA 1J8CA 3TCAA 5IAAC 1I42A 1JRUA
chains in the Genus database with same CATH superfamily
3WAPA 2IO0B 2N0SB 4MH8A 2WU5B 4RMAA 1SGHA 3P4RB 2K6DB 2JZPA 5BMGA 4S17A 3AE3B 1WE6A 3RMKC 4P1BC 1ACCA 1WX8A 1FEHA 1GAQB 1IGCA 1VJKA 2BGFA 1XO3A 2W54A 1J7BA 4I6PA 2PLPA 5EE1A 2ZCCA 1P9DU 4HPPA 1C78A 4WWNA 1OTRB 2MH7A 2C5LC 1WRIA 4RM8A 1YN3A 2GB1A 3DQVA 2BTEA 5HFYA 4M0WA 4O1NA 4PYUA 1XEEA 2MA9B 2C60A 5IN7A 3QAQA 2CHZA 1D5ZC 4A90A 1TY0A 4RF0A 4PS8A 2E3TA 2CHXA 1F0ZA 3BK2A 2KQ7A 1MHHE 1ZKHA 2BS2B 4IG7B 1KH0A 3DBRB 1LFDA 2D11A 2WX1A 2C9WB 3MHZA 3QJZA 2KWDA 1TBEA 4GU2A 4A3PA 5JXVA 1D6EC 1UWXA 1ESFA 2J53A 4KZCA 4BFRA 3R8BA 1WE7A 3DHGC 3FC4A 4DXGA 2FUHB 5EE0A 1JW9D 3X23A 4A8XC 5FR3A 2PE9A 3L17A 3M3JA 3WAMA 2IZVB 1WM3A 2OEDA 2G45B 4WJNA 1YOVB 2JSVX 1Q1OA 1FM0D 2MJDA 3UIPB 1A70A 1OQYA 3PSEB 2GI9A 1NYRA 1L6VA 5E6OA 4OVZA 2GBKA 2ZPYA 2HTME 3M95A 3UIOB 4PS3A 2L7RA 3IAS1 4FHKA 4KSLC 2TSSA 1VRAB 3PT2B 3RT3B 3LDZE 4OVVA 2D3GA 5G5HA 1F2RC 2L8JA 1UUPA 3L10B 4ICVA 3DWGC 3VTVA 2KMMA 3K9PB 4HDOA 2MBOA 4K7UA 2MQJA 4MGYE 3V62A 3PZ7A 2VZKD 1PQSA 4RCOA 3AEFB 2C7NB 3NUHB 2N9XA 1E7VA 4MGZE 2JVCA 2Y5BB 1ZE3D 2K3UA 2J0KA 4CO7A 1J0GA 3AMZA 1K53A 4E3CA 3FILA 1QT9A 3V3XA 2QCZA 2L52A 4EZLA 4XWTA 4GXBA 3Q8BA 4M00A 1V81A 1IPGA 3PTFC 3JSVB 1VD2A 4GDLB 4AWJA 3A1QA 3SD5A 2LMCA 2CJNA 1JRPA 4MJSB 3VUYA 1V1PA 3U7DA 3NRZA 2DX5B 3ZJVA 4WJQA 2CHWA 2KK8A 3V6EB 2K6QA 3SDLC 2DLBA 3CMMB 1F52A 4GIVA 3VH3B 3L16A 4AP4C 1XLNA 4RGOS 2BBCA 1C4AA 3BY4B 2CU3A 3KYCD 1WF9A 3V05A 5C23A 5CHVC 4XWWA 5D6JB 4WIPA 3CWIA 4RH6A 5HKHA 4B6WA 1NVID 4ZRPA 2OHFA 2RPVA 4TQ0A 3N3KB 4LJOB 2ZZPB 2V9HA 4YTNB 3L08A 1KJTA 3DVNV 4ZYSA 2K9XA 2JZ3B 1C4PA 3W5UB 3PO0A 1I4HA 4DHZB 3R66C 1N62A 3TBLD 1SE4A 1T5XD 2LVQA 1SJED 2L00B 2IYDB 2AQ3B 2G4SA 4I6NB 3Q8CA 3ZUNA 1YMHE 3M63B 5AZGA 2ZVNA 2ZNVB 2R61A 2L0TA 1K51A 4HKQA 1RLFA 1TGZB 3U8ZA 2WQYB 3U52E 1LQBA 3RCZA 4H2AA 1XLQA 4KGRA 4ZRJA 2Q5WD 4KX6B 2ACZB 1HE8A 1V86A 1LM8B 3SFEB 4NJ6A 2D5GA 2K5PA 1MVKA 4P1CC 1GPXA 4FJZA 2KWCA 4MDKE 2NR2A 2B3AA 5DPSA 1GOZA 2KLGA 3H6NA 5G5GA 3A9JA 3MFGA 3R7RA 4ZRIA 4ANVA 4C7ZA 2CJOA 3Q3OC 2INPE 2J0MA 2DYMA 2ZEQA 3APFA 1S1QB 2KJ6A 3ONSA 2GBNA 1WGDA 3AE8B 1Z2MA 2KYWA 2Z0EB 2C7HA 3E9SA 1AWDA 2V1YA 2HJ1A 5D3IB 4YSXB 3Q8FA 4W9GA 5DPRA 3MC8A 1VCBA 2GBMA 3ZNHB 2DBYA 1GUAB 4W9CA 3EFUA 3UQBA 2NBVB 3UI3A 4LTUA 4M02A 4C4VB 2JWUA 3RNCC 2JZZA 3VRAB 4XDDA 1QLBB 1MI0A 2KD0A 4XDCA 1YQ4B 1R4MB 3T3OA 2EMTA 2FIDA 1ZDXA 2IY0B 1KTKA 3VR9B 2IBIB 2D2QA 4LDTD 4ARIA 2IDYA 3DOWA 2ZJDA 1CQVA 3B2GA 1EF5A 2NMQA 1C79A 1I4RA 1SXTA 4RF1A 4AJWA 4FLHA 2GMIC 2JPHA 2HD5B 4HCNB 1UELA 2LVPA 2N7DA 1XCQL 2MBHA 1WX9A 2M56B 3TJPA 3J9CA 1TZ1A 2WXHA 4W9FA 5DPTA 2JXXA 1RYJA 3H9DA 4USAA 4EFOA 2MLBA 2PVGC 1WSPA 2WXOA 2KQSA 2KJRA 1P1AA 2K22A 2D3AA 2Z8LA 3VRBB 1JWMD 1V49A 1YN5A 4JQWC 3DVGY 2G1EA 4OW0A 4ZRKA 1QOGA 3TCAA 1I42A 1I4XA 2LD9A 3DBSA 1FFUA 3PZDA 4YXDB 2EMSA 4M8MA 3TIXA 1L0YB 2G4DB 1PYWD 1GB4A 1MHXA 1SF0A 4NZLB 1SE9A 4FA6A 2WXNA 1PGAA 1HTQA 2KWUB 2V3NA 4KKJA 1GC7A 1SIJA 5J18A 3AEAB 3Q8EA 2IO1B 1J7CA 4LJPB 2RMMA 1VLBA 1H4RA 4IKGA 2KDMA 3VR8B 2LHDA 4FADA 2R2QA 5CHFA 5AUKA 3BVZA 2ZCBA 4GN1A 3RZFA 3I9V1 2KTRB 4P7IA 1C1YB 4GDKA 3GOEA 1KLGD 4HWIB 4WQMA 3EA6A 3W1SC 1XLOA 1WXSA 2XK5A 2KFJA 3VUXA 4DDID 4YT0B 3EECA 5KHQA 1T0QC 2MHJA 3ZIMA 1NENB 2D3BA 2WXLA 4HXDA 3DBLI 4ICUA 1T6BX 2RSUA 3DDCB 2REXA 2INNE 2WP9B 3KLSX 2A5UA 2K8CA 4W9LA 1FNUA 1EU4A 4JWSC 1HTOA 2KVRA 1WI0A 4C56C 1YX5B 4YL8A 2LGDA 4UDUC 4ZHPA 4PS7A 2XBBC 3AE1B 1ENFA 3NZSA 1FD6A 2NPTB 3N1YC 3ZGZA 1T0YA 2G3QB 2N4FA 3Q6BA 1SBBB 3KW5B 3ZNID 1WXVA 3Q14C 2FCMA 3PVLA 2X8XX 3L0WB 1DYQA 1TS5A 2RDBC 3ZO5B 2FCQA 1JWAD 3PRZA 3AE9B 5TR5A 3GE3C 4G0NB 5HI1A 1QOBA 5BYRA 3HUIA 2QJLA 1BXTA 2JUOA 2LGYA 3EUB2 4LNNA 2N9EB 3HK0A 2N1WA 3HIZA 1HQRD 2DWQA 2NCNA 3C8YA 2J0JA 5AEKB 2BYFA 3UQAA 1YJJA 3QCAA 3B2FA 3NVVA 3HVZA 1QQRA 3MJ5A 4JX1C 2LJIA 1NDDA 2UYZB 4DHJB 4XGAB 1E8XA 1TZOA 4A3OA 3QA8A 1WFYA 4JL9A 2BYVE 2N9KA 1KLVA 1DGJA 1FRRA 3KUDB 4TQ1A 2XEWA 3IG3A 1T0SC 4FN2A 1DOXA 2IGHA 1L6UA 1IP9A 2BB5A 4GGQA 1WXQA 3AE6B 3MC0B 3GS2A 1IUEA 5EE9A 4BAXA 2M0XA 2KC1A 2WDTB 2YEPF 1FXTB 2KN4A 1WMHB 1YQBA 1V6EA 1WRDB 2PEAA 3DPDA 3TUOA 3ECIA 5IOIA 5D94A 3I57A 2PW9A 3W1YA 2KDFB 3BIID 1RAXA 4EUTA 4BKGA 3X0WA 5J2RA 3WCQA 2IY1B 2MEKA 3H8HA 2MX2A 4YWGG 1HXYD 3R2IA 2C7MB 2GBRA 5MPOA 2DYOA 2V4LA 2O2VA 2MBBB 1KOTA 2EKIA 4NAWB 2KFKA 4DWFA 3APCA 3RZWC 4REZA 5JHBA 2MW5A 3RUIB 4KKIA 1NI3A 5JH5C 2VRRB 1NEKB 1FCCC 2BB6A 1KRHA 3GZNI 2AYOB 3LYYA 3B08A 2LFIA 2LGXA 4LCDE 1XF5L 2PVOD 3N1ZC 2WS3B 3ZNGC 1TTNA 2O6VB 2MCNB 3NZ3A 1SIFA 4X57B 2LUEA 4HJKA 4PK1A 3BZDB 4IOIE 4NQLB 3W1SA 2KN5A 4J3OD 2W55A 4BVUC 4OHJA 4FULA 2QHOA 3RYTA 2MP2B 3PZ8A 3AM9A 2LEKA 2NS5A 2V0GA 1F9JA 2KT7A 1GB1A 5D7GA 1C3TA 4C00A 3NVZA 2IGGA 1E90A 4KSKC 4NJCA 2M0AA 4IC7B 4JLCA 3Q8AA 1UBQA 3RNFC 2MJ3A 4P6VF 4GOCA 1JWSD 2FIFA 1P0RA 3KUZA 2LRWA 3ZRFA 2L0FA 3B0AA 3H7PA 1WX7A 3AE4B 3WA0A 3DWMA 1MPEA 1ZUD2 3N9YC 4K3CA 4F8CB 3QHTA 1NYQA 1OEYA 4WJPA 5FR6A 4W9HA 3I3TB 2LASA 3T3NA 3EGRA 2L76A 4KV2A 3ZTDA 4G11A 5CHWA 1XQQA 1VZ7A 1XXGA 2JRIB 4NY0A 1CZPA 4IWPA 1FCLA 2L1AA 3A9KA 3CIRB 3PHXB 1MFWA 1WM2A 5EE3A 3K9OB 3NVYA 2OJRA 3RI7C 3U7ZA 1F2RI 1WR6E 4LNOA 4TV3A 4OZAA 3T9LA 5CX3A 2WXRA 2WYQA 4E74A 2SEBD 3GE8C 3LXFA 4RNAA 1RWSA 4EOYA 3R7QA 5H8YE 3BVGA 4W9IA 4M01A 4B0MA 2H89B 4EZJA 3UGBB 3WAOA 4KDLB 2MRPA 1I4QA 2ZNVC 1VZ8A 3N20C 1Q0WB 1OEYJ 2KXJA 5GMVA 3VFKA 2M4NA 1WXMA 3AE5B 4L2YA 1HEZE 4K7SA 2W9NA 3VUWA 3ML8A 1HZ6A 3QWZB 3KVFB 1OGWA 1E9MA 4G3XB 1JQ4A 2KO3A 2PPHA 3P42A 3RFZB 5HG2A 2PKOA 2WDQB 2ZPNA 1ZP0B 1Q5WB 2KWVB 4W9DA 2LGSA 1JRUA 5FK9C 2UWQA 1TY2A 2B76B 4BKSD 2IGDA 1VDVA 4TSSA 1PUTA 1TT5B 2J7QB 4B0EA 1IBXB 1T0RC 1YIWA 4YTMB 4KGSA 1RFAA 2AL6A 1Y56A 4ANXA 3MP9A 4DXAB 5C1ZA 2N7JA 1FIQA 2WXIA 2PJHA 2YEPB 3NS8A 3W5VB 4AQ7A 5LXIB 1A5RA 2LWPA 1E5WA 4ZRQA 1V8CA 1QZEA 1JWBD 2BS3B 1MG4A 3NOBA 2QDFA 3E56A 3AE2B 4MELA 3N30A 2BYTA 4KIKB 2KLCA 1X1MA 3V61A 4MM3B 3L54A 1YJIA 4GLSC 2KZRA 2KX3A 2XNAC 2BPSA 1YJ1A 3P4PB 3HHMA 5IA7A 3CSFA 3PHWB 3Q3MC 4LNKA 4D2KA 3ZJTA 3PLUA 1UH6A 4K3BA 4N58A 1ZXHA 4RGTA 3P1MA 4B9KA 3ZXRA 2PMVA 1PGBA 3O65B 2INCC 3TL5A 3IVFA 4YTPB 3VAWA 3BK1A 3APDA 1VR9A 2XN9C 2PE6B 4KDIC 3TEWA 4ZYNA 3WANA 2WXPA 4M0WB 4W9EA 2K25A 2WXMA 4ZHOA 4US8A 3M62B 2RD0A 1YNTE 2JU6X 4N6EB 2KNBA 3FAHA 2KHWB 4LNFA 1PGXA 4W9JA 3AULA 3IAM1 5DPWA 1WGHA 2WXKA 2JF5A 2KC2A 4BKSA 2L32A 1XLPA 2QMTA 4A6QA 1D4BA 2WLBA 2K8BA 3TEYA 3QQ8B 1ROEA 5LNK1 1WGYA 4J6IA 1I7HA 3JSVA 1N63A 2WNMA 4GDLA 2WDVB 2DYBA 2EKEC 3ZTCA 3NVWA 2JY6A 1EWCA 4MJSA 3T8MA 4JIOU 1WR1A 3VDZA 3SHQA 1TS3A 4N9F4 3P63A 2N9PC 3OWEB 3KH0A 2FUG1 4HPMB 2NBWB 2QILA 3U2SC 5L95C 3HRDD 2R2OA 1T3QA 4ASWC 5CTRC 1CK1A 1N5XA 1L5PA 2MSED 2V3PA 5AUIA 2ONQA 4HRSA 2I2YA 4DQOC 2WU2B 1D5MC 4WWPA 1P98A 1TS4A 1QILA 2VH1A 4RFBA 4FJYA 2BKFA 1M94A 1L0VB 2FCNA 4NJ7A 2DHZA 2KACA 3NJTA 3Q3FA 4A55A 1L7YA 3QC8B 2BT6A 1HZ5A 1R4MI 1GG3A 2BVCA 3P2BA 4MEMA 2K39A 1K52A 1JWUD 1OQRA 1BMLC 2HJ8A 3PLVA 5T8IA 1GC6A 2W3SA 4IW0A 4OZCA 2M17A 1JROA 3MHSD 1H8CA 2LVOA 3ENEA 1E10A 3FILB 3ZXVA 2BS4B 1AW7A 2JX5A 2WHIA 5AZFA 3AEGB 3MTNB 4OZBA 3JVZX 1AARA 1K50A 2WDRB 1WJNA 3H1UA 2CR5A 2RGFA 1UWMA 4MT5A 3A1QB 1OQQA 2JRHA 1V1PB 4PYZA 2DAJA 3VVWB 1I4GA 2YLMA 3VQIA 1J7AA 2AQ2B 5I4DA 4ACFA 1V2YA 5D2MB 3H7SA 4A9AA 1MG8A 3C0RB 4HK2A 2L05A 3QIJA 2V4IB 2OOBB 4HLEA 3BINA 4PT5A 1C4CA 2LZ6A 2BWFA 5LXHA 3AU5A 1R7SA 4BKTA 4BBNC 2BWES 2IO3B 4L1BA 3CF6E 5BYSA 2KX0A 2Z59B 4IM0A 3Q69A 2K8HA 3ALBA 4KZ0A 3GZNB 3UINB 3DBHI 1N6ZA 2OJWA 3AU4A 4C4VA 4ANWA 1ZW7A 2D3CA 1EWYC 1Y8RC 1GJZA 2JYEA 3PV1A 4FXCA 3VHTC 1OFFA 3A4SC 3QARA 1EUVB 1N5WA 3HVDA 4WURA 2MWSB 1CJEA 2I1KA 4YSZB 2Z0DB 2WX0A 2ZW0A 4TMAB 1ET6A 4I6LB 1YX6B 3NG0A 2A4ZA 3S2AA 3Q3NC 1Z5SB 1YN4A 1WXAA 1ET9A 4NNJB 2LHEA 3AEBB 2HTHA 2NTSA 2NBUA 3OAWA 5J17A 3KYDD 3A9JB 4MGIE 2M1MA 3KWLA 1R4NI 3I5JC 1TIFA 4RGMA 3NY5A 1FXAA 2M19A 1WZ3A 4IWQA 2IJ0A 3RNEC 2KDBA 2KAJA 2GLSA 4WJOA 1AYFA 5AZHA 1P3QU 2KJHB 5IKCM 3DHIC 3PRMB 2DZIA 1B1ZA 4HVBA 1FNWA 5KHOA 3EHVA 2QEJC 1QKZA 2DZJA 3SFDB 4EEWA 1WY8A 4JE3B 4TUUA 1IGDA 3PGEA 3ZDMC 2INDC 3C19A 3ZLZA 1V80A 2LXCA 2BF8B 2GOWA 5G55A 1EO6A 4K1RB 2WWZA 2BQQA 3L4PA 4DDGD 3KUCB 3OLMD 1P7EA 4ARCA 4IM3A 4ZDVA 2KANA 1ZPSA 4F7ZA 3N32A 2FAZA 4XX5A 4IDIA 4MSMB 2IPKD 3ETRA 2DAFA 4QAYA 2MJEA 1QF6A 1C77A 3DHHC 2DENB 1WJ4A 3TMPB 3L13A 3AEEB 2CS4A 3TSSA 1E7PB 3V6CB 4BOZB 4B95A 2KKCA 1UGMA 1E7UA 2AEHA 4A20A 1TS2A 3RNBC 4MACA 4E71A 2UU7A 4AOFA 2J4XA 1TKYA 3WIMA 5IAAC 2AQ1B 2IO2B 2KTRA 4GMVA 1NBFC 1TKGA 1FRDA 1LXDA 4NAMA 4GB9A 4WH4A 3ZNZB 2PIAA 4DHJD 2WXQA 3B9JA 1UBIA 3AI5A 2ASQA 2LXAA 4FJVB 4NQKE 4WAAA 1D5XC 4DXFA 4LK0M 3NHEB 2N9LA 3DBRI 3WALA 4K81A 1UD7A 1E8WA 2I38A 3ZDTA 4AS1A 4MGKE 3NZUA 4KVGB 3DVGX 3R2TA 3CSTA 5BMIA 5BYQA 1E0ZA 1V97A 1J19A 1EU3A 2WGSA 4IM2A 1SJHD 3I63C 2JT4B 5E6JA 3V60A 2NPTA 2J42A 1QOFA 2ON8A 1UNSA 2LJ5A 3ZYYX 1V5OA 3JW0X 1WJUA 1LO5D 3ZVVA 3BYTB 2WXJA 2K1FA 1FMAD 3U4EG 2JQRB 5JZEB 4BOSC 3SU8X 2EELA 2KMAA 4WWMA 4WAFA 1SE2A 2L3ZA 5DCNA 4URKA 2H88B 3EC8A 4LDTB 1FO4A 2DZKA 3DCGA 2GRIA 4R3DA 4OVUA 3VXWA 1WIAA 1L4ZB 3RPFC 3P4SB 2DZMA 3ZKJC 2QSDA 3PPAA 1WWTA 2WXFA 4US9A 3SR6A 2JWZA 1RRBA 1WYWB 4S0RA 1I35A 3MC9A 1EM7A 2CKHB 4GDKB 4FBJB 1QOAA 3VTWA 4CQNA 1UF0A 5D3DA 1I4PA 2KVZA 1E8YA 2NVUI 2XK5B 3KWVA 4XZ4A 1M4VA 1ZXIA 4HDQA 1FFVA 2BW2A 1JCKB 3IBEA 1UZXB 2D10A 2KTFA 2O6VD 3IFWB 4AUQC 1S3SG 4II2B 4HCPB 4BBNF 3RULA 1JMLA 4M8NA 1P7FA 1WMHA 1STEA 4HROA 1V1OA 4LLGM 3NS1A 4XC2A 4WWOA 1BT0A 3HM3A 4HEA1 1E8ZA 4F1SA 2LI5A 2HDEA 3TEXA 4RGNA 4C7YA 3AECB 3IXSA 3ZQ4A 2NTTA 3MJWA 1WJ6A 1TYGB 2FCSA 3B1LX 1G6JA 4CHKA 1WGRA 2D07B 3AV8A 4NAWA 4XYCA 5H92C 2JXTA 3FKYA 4DHZE 1CMXB 5L83A 1JALA 2PTLA 4JGHB 2K0PA 4K7WA 4IUMB 2MBEA 5GXGB 1DOIA 3P4QB 3AEDB 3A33B 1V5TA 3OJ4B 3VH4B 1SSNA 4C80A 2FBWB 5TSSA 3IT6B 1RM6C 2G9HD 2JYTA 5BMHA 2L83A 3SEBA 3RNAC 3QK0A 5LLIA 2QC8A 2J52A 2E6XA 1ISNA 4JPSA 1WH3A 1WGGA 1KF6B 1WZ0A 2YVCA 3KQ4A 2O6VA 4W9KA 2AX5A 4XE0A 5HHDG 3GB1A 3RD2A 5C3JB 2LGIA 3D32A 3BYYB 3AE7B 3O13A 4NPNA 3DBLB 1L2NA 1U4AA 3GP7A 3IT4B 2AL3A 4HPLB 4II3B 3RN9C 1FPYA 2MP2A 1TKEA 3U30A 1D3ZA 2QIEB 2CU1A 3AH7A 4FHJA 1Q10A 2LRUA 1RFKA 3PS6A 1YQ3B 4WQOB 1ZDVA 2KDEB 1AN8A 2ICIA 4Q2JA 1C76A 1KM7A 1UGJA 4EE2A 3AN1A 5IP4D 3RNGC 2O2VB 1F77A 5FKAC 3UF8A 4G50A 1YD8U 1SB3C 2KFKB 2WXGA 1BUIC 5C2TB 4ZOHC 3HM6X 3ZW3A 2N1VA 4KGTA 3PRPB 4HJGE 4LNIA 2RDHA 4GSWA 3Q3JA 1IYFA 4DBGA 3DBHB 5IO9A 2RR9A 3LB8C 2KOXA 3OJ3A 2KQ4X 1N60A 1ZOYB 4EKUA 3W2DA 2HE7A 2V3SA 1XD3B 3JYUA 1PDXA 3A4RA 1NI2A 3BWUD 4AJYB 2DNFA 1FXIA 1LGRA 3VTUA 2X38A 2N7EA 2Y5PA 1L0XB 1EF1A 1F1HA 1XT9B 2FNJB 3R3MA 5JHAA 3AB5A 1XCTL 5EDSA 4IWOA 1SE3A 3W9CB 2BYEA 1N61A 3LJ3A 1E6EB 1WYGA 1TJEA 4YSYB 1V9JA 3ABVB 2M8SA 4CYEA 1R4NB 1K8RB 3ML9A 2SAKA 3Q2AC 2LUMA 4EZKA 2FE8A 3URYA 3ZRCA 2VH2A 4N59A 3TEZA 4BZAA 2W82A 4DK5A 2RDGA 2ZVOA 5E6PA 3ZJUA 3OG5A 4L23A 1ZGUB 2KMCA 1SEBD 2ZW1A 4MH0E 2Y3AA 2Y5CA 4RM9A 3EFCA 2W3RA 2BKRB 2GBJA 1WGKA 4TKNA 3H7PB 4JWUC 2I1JA 1IBXA 2MBQA 5G2NA 1L4DB 1GNUA 3N1XC 4HKZE 2KDIA 1KLUD 1FNVA 2AWTA 1C9FA 1DOYA 3DVNU 4ANUA 5E6NA 3AXCA 1KFYB 2VZKB 3A9KB 1HA5A 2RPQA 3PREA 5BO4B 1PFDA 3BVMA 4KIKA 4MM3A 4P16A 4MSQB 1MJDA 1B9RA 1VZ6A 3QX1A 3IHPC 1J8CA 4ITKA
chains in the Genus database with same CATH topology
2LD9A 2IO2B 2KTRA 3DBSA 3WAPA 2IO0B 3PZDA 4GMVA 1NBFC 4RMAA 2UWQA 1SGHA 4BKSD 2EMSA 4M8MA 2K6DB 3TIXA 2G4DB 1LXDA 4GB9A 2J7QB 1WE6A 3ZNZB 1SE9A 4FA6A 1WX8A 4DHJD 1YIWA 2KWUB 2BGFA 1GC7A 1RFAA 1UBIA 3AI5A 2ASQA 2LXAA 2AL6A 4FJVB 4I6PA 4NQKE 4ANXA 4DXAB 5C1ZA 5J18A 2ZCCA 2PJHA 1P9DU 4WAAA 2IO1B 3NS8A 4LJPB 4WWNA 5LXIB 1OTRB 1A5RA 2LWPA 1E5WA 2C5LC 1QZEA 3NHEB 3DBRI 4RM8A 3DQVA 3WALA 4K81A 1H4RA 1UD7A 1E8WA 3NOBA 4PYUA 3ZDTA 4FADA 2MA9B 2C60A 3NZUA 4MGKE 4KVGB 2R2QA 4MELA 5CHFA 3DVGX 3QAQA 2CHZA 3N30A 2ZCBA 2KLCA 1X1MA 4KIKB 3V61A 3CSTA 4PS8A 3L54A 1J19A 4GN1A 3RZFA 2KZRA 4IM2A 2KX3A 2CHXA 2BPSA 1YJ1A 2KQ7A 1ZKHA 3HHMA 4IG7B 2JT4B 2KTRB 5IA7A 3V60A 1LFDA 2D11A 2NPTA 2C9WB 2WX1A 3CSFA 3QJZA 3PHWB 4P7IA 1TBEA 4GU2A 1C1YB 3PLUA 4GDKA 1UH6A 3GOEA 4HWIB 4A3PA 2LJ5A 1V5OA 3JW0X 1WJUA 3W1SC 3ZVVA 4B9KA 1WXSA 4KZCA 2K1FA 4BFRA 5JZEB 2XK5A 4BOSC 1WE7A 3SU8X 2KFJA 3O65B 3VUXA 4DDID 3TL5A 3IVFA 2FUHB 2KMAA 3EECA 5KHQA 3X23A 3VAWA 3ZIMA 4HXDA 2PE9A 3DBLI 3L17A 3M3JA 4ICUA 3WAMA 2IZVB 2L3ZA 3APDA 1WM3A 5DCNA 4WJNA 2G45B 4URKA 3EC8A 4LDTB 2RSUA 3DDCB 2REXA 2PE6B 2A5UA 4KDIC 4ZYNA 2DZKA 1Q1OA 3DCGA 3WANA 2K8CA 4W9IA 4W9LA 3UIPB 4M0WB 4OVUA 4W9EA 3VXWA 1OQYA 1WIAA 2K25A 2KVRA 3M62B 2RD0A 3PSEB 1WI0A 2DZMA 3ZKJC 1YX5B 4YL8A 2KNBA 5E6OA 2KHWB 2LGDA 3PPAA 4W9JA 3AULA 2GBKA 2ZPYA 5DPWA 3M95A 1WGHA 4PS7A 2JF5A 2JWZA 2KC2A 2XBBC 3UIOB 4BKSA 3NZSA 4PS3A 4BOZB 2L7RA 1RRBA 4FHKA 1WYWB 4KSLC 2NPTB 1I35A 2CKHB 1T0YA 3PT2B 3RT3B 2G3QB 3LDZE 2N4FA 4OVVA 4GDKB 2K8BA 4FBJB 3KW5B 3QQ8B 3ZNID 3VTWA 2D3GA 1WXVA 1WGYA 4J6IA 3JSVA 4GDLA 2FCMA 2DYBA 1E8YA 2EKEC 3PVLA 2NVUI 3ZTCA 3L0WB 2XK5B 4XZ4A 2JY6A 2L8JA 4MJSA 3T8MA 3L10B 4ICVA 4JIOU 1WR1A 4HDQA 3VDZA 2FCQA 3VTVA 3IBEA 3ZO5B 1UZXB 3K9PB 4HDOA 2MBOA 4K7UA 2MQJA 3PRZA 4MGYE 3SHQA 3V62A 2D10A 2KTFA 2O6VD 4N9F4 5TR5A 4G0NB 2N9PC 3IFWB 3KH0A 1PQSA 2C7NB 4AUQC 4HPMB 2NBWB 2N9XA 1E7VA 4MGZE 5L95C 1S3SG 2JUOA 4II2B 2LGYA 2R2OA 2JVCA 4HCPB 4BBNF 2N9EB 2Y5BB 4ASWC 5CTRC 3RULA 2J0KA 3HK0A 4M8NA 1WMHA 2N1WA 3HIZA 2NCNA 4CO7A 2J0JA 1J0GA 2MSED 5AEKB 2BYFA 3UQAA 4XC2A 4E3CA 4WWOA 1BT0A 3HM3A 1E8ZA 3QCAA 4F1SA 2LI5A 4EZLA 4GXBA 1V81A 1IPGA 2UYZB 1NDDA 3PTFC 4WWPA 1P98A 4DHJB 3JSVB 1VD2A 4GDLB 4AWJA 3A1QA 3MJWA 1E8XA 1WJ6A 3SD5A 4FJYA 4A3OA 2BKFA 1M94A 3QA8A 2FCSA 1WFYA 3B1LX 4JL9A 4MJSB 3VUYA 2BYVE 3U7DA 1G6JA 1KLVA 4CHKA 2FCNA 4NJ7A 2DHZA 2DX5B 1WGRA 3KUDB 3Q3FA 2XEWA 4TQ1A 4WJQA 2D07B 2CHWA 4NAWA 3IG3A 2KK8A 1L7YA 4FN2A 3V6EB 2K6QA 3SDLC 3QC8B 3CMMB 4DHZE 1IP9A 1CMXB 4GIVA 5L83A 1R4MI 4GGQA 1GG3A 3L16A 3VH3B 4AP4C 4JGHB 3P2BA 4K7WA 4IUMB 4MEMA 2K39A 3BY4B 2MBEA 3KYCD 2M0XA 1WF9A 2HJ8A 2KC1A 2WDTB 5CHVC 3PLVA 5C23A 1GC6A 1FXTB 3A33B 1WMHB 1V5TA 1YQBA 3OJ4B 4IW0A 3VH4B 5D6JB 1V6EA 1WRDB 2PEAA 2M17A 3DPDA 3ECIA 3MHSD 5HKHA 1H8CA 2LVOA 3ENEA 5D94A 4B6WA 5AZFA 3MTNB 3JVZX 3N3KB 3QK0A 4LJOB 5LLIA 3W1YA 4TQ0A 2ZZPB 2KDFB 1AARA 1RAXA 1WJNA 4BKGA 3X0WA 4EUTA 5J2RA 3H1UA 3L08A 1ISNA 1KJTA 2CR5A 2IY1B 3DVNV 2RGFA 2MX2A 1WH3A 1WGGA 2JZ3B 3A1QB 1WZ0A 2C7MB 2YVCA 2GBRA 2JRHA 2O6VA 2DYOA 4W9KA 4PYZA 2V4LA 4DHZB 2O2VA 3RD2A 2DAJA 3R66C 3TBLD 3VVWB 2MBBB 2YLMA 3VQIA 1KOTA 2LVQA 3D32A 2L00B 2KFKA 2IYDB 4NAWB 4NPNA 1L2NA 4DWFA 1U4AA 1V2YA 2G4SA 5D2MB 3H7SA 1MG8A 3APCA 4I6NB 3C0RB 4HK2A 3RZWC 5JHBA 2AL3A 2L05A 4HPLB 2MW5A 4II3B 3RUIB 3ZUNA 3M63B 5AZGA 2ZVNA 2ZNVB 5JH5C 2VRRB 2MP2A 3QIJA 3U30A 2L0TA 2OOBB 4HLEA 3BINA 1D3ZA 1RLFA 1TGZB 3U8ZA 2LZ6A 1LQBA 2BWFA 3GZNI 3RCZA 5LXHA 3AU5A 2AYOB 2CU1A 3B08A 4BKTA 4BBNC 2BWES 4FHJA 2IO3B 4ZRJA 1HE8A 1V86A 2LGXA 3CF6E 2LRUA 3PS6A 4LCDE 4WQOB 2KX0A 2Z59B 1LM8B 4IM0A 2KDEB 2K8HA 4NJ6A 4FJZA 3ZNGC 2KWCA 4MDKE 3ALBA 4KZ0A 1KM7A 2NR2A 1TTNA 2B3AA 2O6VB 2MCNB 5DPSA 1SIFA 2O2VB 3UINB 4X57B 2LUEA 3DBHI 2KLGA 3H6NA 3AU4A 4HJKA 3UF8A 4G50A 1YD8U 1ZW7A 3A9JA 3R7RA 4ANWA 4ZRIA 2KFKB 4ANVA 4NQLB 3W1SA 2KN5A 1Y8RC 2J0MA 3HM6X 3ZW3A 2N1VA 4BVUC 1GJZA 2DYMA 3PRPB 3PV1A 2QHOA 4FULA 2ZEQA 3APFA 1S1QB 2KJ6A 3ONSA 3RYTA 2GBNA 3VHTC 1WGDA 4GSWA 2MP2B 3Q3JA 1IYFA 4DBGA 2NS5A 3A4SC 3QARA 1Z2MA 2RR9A 1F9JA 2KOXA 2Z0EB 2C7HA 3OJ3A 1EUVB 5D7GA 4EKUA 2HE7A 2V3SA 1C3TA 2V1YA 1XD3B 2MWSB 1E90A 4KSKC 3JYUA 4W9GA 2I1KA 5DPRA 3A4RA 4IC7B 1NI2A 2Z0DB 2WX0A 4JLCA 1VCBA 4AJYB 4I6LB 1UBQA 2GBMA 1YX6B 2A4ZA 3S2AA 3ZNHB 1GUAB 4W9CA 3EFUA 1Z5SB 4GOCA 3VTUA 1WXAA 3UQBA 2NBVB 4NNJB 2FIFA 1P0RA 3KUZA 2HTHA 2NBUA 3OAWA 2N7EA 5J17A 3KYDD 2LRWA 2JZZA 3A9JB 4MGIE 3ZRFA 1EF1A 2L0FA 3B0AA 2M1MA 1R4NI 3H7PA 1XT9B 1WX7A 2FNJB 3R3MA 3WA0A 2KD0A 4F8CB 5JHAA 3NY5A 1WZ3A 3QHTA 4IWQA 1OEYA 4WJPA 5FR6A 5EDSA 4W9HA 4IWOA 2KDBA 2LASA 3I3TB 4WJOA 2EMTA 2BYEA 5AZHA 2FIDA 2L76A 3LJ3A 4KV2A 2IY0B 1P3QU 2KJHB 3ZTDA 4G11A 1V9JA 3PRMB 5CHWA 1XQQA 2DZIA 2M8SA 4HVBA 5KHOA 2JRIB 3EHVA 4NY0A 2IBIB 4CYEA 2D2QA 4IWPA 2DZJA 1K8RB 4LDTD 4EEWA 1WY8A 3ML9A 4TUUA 3A9KA 3PHXB 1WM2A 4EZKA 3K9OB 3DOWA 3PGEA 3ZDMC 3ZRCA 2OJRA 3ZLZA 1WR6E 4TV3A 1V80A 3T9LA 4DK5A 5CX3A 2LXCA 2WYQA 2ZVOA 2ZJDA 2BF8B 5E6PA 2GOWA 4E74A 1EF5A 5G55A 1ZGUB 2KMCA 1EO6A 4K1RB 2WWZA 4MH0E 4EOYA 3R7QA 4RM9A 4DDGD 4AJWA 3KUCB 4FLHA 3OLMD 2GMIC 2BKRB 2GBJA 2HD5B 2JPHA 4HCNB 4TKNA 3H7PB 4IM3A 4ZDVA 1UELA 2KANA 4F7ZA 2I1JA 2FAZA 2LVPA 2N7DA 3N32A 4EZJA 3UGBB 4XX5A 3WAOA 4KDLB 4MSMB 2MBQA 2MBHA 5G2NA 2MRPA 1WX9A 2ZNVC 1GNUA 3TJPA 2DAFA 1TZ1A 1Q0WB 1OEYJ 4W9FA 5DPTA 2KXJA 5GMVA 2JXXA 3H9DA 2KDIA 2DENB 1WJ4A 3VFKA 4EFOA 2M4NA 2AWTA 1WXMA 2MLBA 3TMPB 3DVNU 3L13A 2CS4A 2KQSA 4K7SA 2W9NA 2KJRA 1P1AA 3V6CB 3VUWA 3ML8A 2KKCA 4B95A 1UGMA 4ANUA 1E7UA 3QWZB 5E6NA 3KVFB 3AXCA 2AEHA 1OGWA 3A9KB 1V49A 4A20A 2RPQA 4G3XB 4JQWC 3DVGY 3PREA 5BO4B 2KO3A 2PPHA 4KIKA 4ZRKA 4MM3A 4E71A 4MSQB 2ZPNA 4AOFA 3QX1A 1Q5WB 2KWVB 3IHPC 4W9DA 3WIMA 1J8CA 3TCAA 5IAAC 1I42A 1JRUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LD9 A;  2IO2 B;  2KTR A;  3DBS A;  3WAP A;  2IO0 B;  3PZD A;  4GMV A;  1NBF C;  4RMA A;  2UWQ A;  1SGH A;  4BKS D;  2EMS A;  4M8M A;  2K6D B;  3TIX A;  2G4D B;  1LXD A;  4GB9 A;  2J7Q B;  1WE6 A;  3ZNZ B;  1SE9 A;  4FA6 A;  1WX8 A;  4DHJ D;  1YIW A;  2KWU B;  2BGF A;  1GC7 A;  1RFA A;  1UBI A;  3AI5 A;  2ASQ A;  2LXA A;  2AL6 A;  4FJV B;  4I6P A;  4NQK E;  4ANX A;  4DXA B;  5C1Z A;  5J18 A;  2ZCC A;  2PJH A;  1P9D U;  4WAA A;  2IO1 B;  3NS8 A;  4LJP B;  4WWN A;  5LXI B;  1OTR B;  1A5R A;  2LWP A;  1E5W A;  2C5L C;  1QZE A;  3NHE B;  3DBR I;  4RM8 A;  3DQV A;  3WAL A;  4K81 A;  1H4R A;  1UD7 A;  1E8W A;  3NOB A;  4PYU A;  3ZDT A;  4FAD A;  2MA9 B;  2C60 A;  3NZU A;  4MGK E;  4KVG B;  2R2Q A;  4MEL A;  5CHF A;  3DVG X;  3QAQ A;  2CHZ A;  3N30 A;  2ZCB A;  2KLC A;  1X1M A;  4KIK B;  3V61 A;  3CST A;  4PS8 A;  3L54 A;  1J19 A;  4GN1 A;  3RZF A;  2KZR A;  4IM2 A;  2KX3 A;  2CHX A;  2BPS A;  1YJ1 A;  2KQ7 A;  1ZKH A;  3HHM A;  4IG7 B;  2JT4 B;  2KTR B;  5IA7 A;  3V60 A;  1LFD A;  2D11 A;  2NPT A;  2C9W B;  2WX1 A;  3CSF A;  3QJZ A;  3PHW B;  4P7I A;  1TBE A;  4GU2 A;  1C1Y B;  3PLU A;  4GDK A;  1UH6 A;  3GOE A;  4HWI B;  4A3P A;  2LJ5 A;  1V5O A;  3JW0 X;  1WJU A;  3W1S C;  3ZVV A;  4B9K A;  1WXS A;  4KZC A;  2K1F A;  4BFR A;  5JZE B;  2XK5 A;  4BOS C;  1WE7 A;  3SU8 X;  2KFJ A;  3O65 B;  3VUX A;  4DDI D;  3TL5 A;  3IVF A;  2FUH B;  2KMA A;  3EEC A;  5KHQ A;  3X23 A;  3VAW A;  3ZIM A;  4HXD A;  2PE9 A;  3DBL I;  3L17 A;  3M3J A;  4ICU A;  3WAM A;  2IZV B;  2L3Z A;  3APD A;  1WM3 A;  5DCN A;  4WJN A;  2G45 B;  4URK A;  3EC8 A;  4LDT B;  2RSU A;  3DDC B;  2REX A;  2PE6 B;  2A5U A;  4KDI C;  4ZYN A;  2DZK A;  1Q1O A;  3DCG A;  3WAN A;  2K8C A;  4W9I A;  4W9L A;  3UIP B;  4M0W B;  4OVU A;  4W9E A;  3VXW A;  1OQY A;  1WIA A;  2K25 A;  2KVR A;  3M62 B;  2RD0 A;  3PSE B;  1WI0 A;  2DZM A;  3ZKJ C;  1YX5 B;  4YL8 A;  2KNB A;  5E6O A;  2KHW B;  2LGD A;  3PPA A;  4W9J A;  3AUL A;  2GBK A;  2ZPY A;  5DPW A;  3M95 A;  1WGH A;  4PS7 A;  2JF5 A;  2JWZ A;  2KC2 A;  2XBB C;  3UIO B;  4BKS A;  3NZS A;  4PS3 A;  4BOZ B;  2L7R A;  1RRB A;  4FHK A;  1WYW B;  4KSL C;  2NPT B;  1I35 A;  2CKH B;  1T0Y A;  3PT2 B;  3RT3 B;  2G3Q B;  3LDZ E;  2N4F A;  4OVV A;  4GDK B;  2K8B A;  4FBJ B;  3KW5 B;  3QQ8 B;  3ZNI D;  3VTW A;  2D3G A;  1WXV A;  1WGY A;  4J6I A;  3JSV A;  4GDL A;  2FCM A;  2DYB A;  1E8Y A;  2EKE C;  3PVL A;  2NVU I;  3ZTC A;  3L0W B;  2XK5 B;  4XZ4 A;  2JY6 A;  2L8J A;  4MJS A;  3T8M A;  3L10 B;  4ICV A;  4JIO U;  1WR1 A;  4HDQ A;  3VDZ A;  2FCQ A;  3VTV A;  3IBE A;  3ZO5 B;  1UZX B;  3K9P B;  4HDO A;  2MBO A;  4K7U A;  2MQJ A;  3PRZ A;  4MGY E;  3SHQ A;  3V62 A;  2D10 A;  2KTF A;  2O6V D;  4N9F 4;  5TR5 A;  4G0N B;  2N9P C;  3IFW B;  3KH0 A;  1PQS A;  2C7N B;  4AUQ C;  4HPM B;  2NBW B;  2N9X A;  1E7V A;  4MGZ E;  5L95 C;  1S3S G;  2JUO A;  4II2 B;  2LGY A;  2R2O A;  2JVC A;  4HCP B;  4BBN F;  2N9E B;  2Y5B B;  4ASW C;  5CTR C;  3RUL A;  2J0K A;  3HK0 A;  4M8N A;  1WMH A;  2N1W A;  3HIZ A;  2NCN A;  4CO7 A;  2J0J A;  1J0G A;  2MSE D;  5AEK B;  2BYF A;  3UQA A;  4XC2 A;  4E3C A;  4WWO A;  1BT0 A;  3HM3 A;  1E8Z A;  3QCA A;  4F1S A;  2LI5 A;  4EZL A;  4GXB A;  1V81 A;  1IPG A;  2UYZ B;  1NDD A;  3PTF C;  4WWP A;  1P98 A;  4DHJ B;  3JSV B;  1VD2 A;  4GDL B;  4AWJ A;  3A1Q A;  3MJW A;  1E8X A;  1WJ6 A;  3SD5 A;  4FJY A;  4A3O A;  2BKF A;  1M94 A;  3QA8 A;  2FCS A;  1WFY A;  3B1L X;  4JL9 A;  4MJS B;  3VUY A;  2BYV E;  3U7D A;  1G6J A;  1KLV A;  4CHK A;  2FCN A;  4NJ7 A;  2DHZ A;  2DX5 B;  1WGR A;  3KUD B;  3Q3F A;  2XEW A;  4TQ1 A;  4WJQ A;  2D07 B;  2CHW A;  4NAW A;  3IG3 A;  2KK8 A;  1L7Y A;  4FN2 A;  3V6E B;  2K6Q A;  3SDL C;  3QC8 B;  3CMM B;  4DHZ E;  1IP9 A;  1CMX B;  4GIV A;  5L83 A;  1R4M I;  4GGQ A;  1GG3 A;  3L16 A;  3VH3 B;  4AP4 C;  4JGH B;  3P2B A;  4K7W A;  4IUM B;  4MEM A;  2K39 A;  3BY4 B;  2MBE A;  3KYC D;  2M0X A;  1WF9 A;  2HJ8 A;  2KC1 A;  2WDT B;  5CHV C;  3PLV A;  5C23 A;  1GC6 A;  1FXT B;  3A33 B;  1WMH B;  1V5T A;  1YQB A;  3OJ4 B;  4IW0 A;  3VH4 B;  5D6J B;  1V6E A;  1WRD B;  2PEA A;  2M17 A;  3DPD A;  3ECI A;  3MHS D;  5HKH A;  1H8C A;  2LVO A;  3ENE A;  5D94 A;  4B6W A;  5AZF A;  3MTN B;  3JVZ X;  3N3K B;  3QK0 A;  4LJO B;  5LLI A;  3W1Y A;  4TQ0 A;  2ZZP B;  2KDF B;  1AAR A;  1RAX A;  1WJN A;  4BKG A;  3X0W A;  4EUT A;  5J2R A;  3H1U A;  3L08 A;  1ISN A;  1KJT A;  2CR5 A;  2IY1 B;  3DVN V;  2RGF A;  2MX2 A;  1WH3 A;  1WGG A;  2JZ3 B;  3A1Q B;  1WZ0 A;  2C7M B;  2YVC A;  2GBR A;  2JRH A;  2O6V A;  2DYO A;  4W9K A;  4PYZ A;  2V4L A;  4DHZ B;  2O2V A;  3RD2 A;  2DAJ A;  3R66 C;  3TBL D;  3VVW B;  2MBB B;  2YLM A;  3VQI A;  1KOT A;  2LVQ A;  3D32 A;  2L00 B;  2KFK A;  2IYD B;  4NAW B;  4NPN A;  1L2N A;  4DWF A;  1U4A A;  1V2Y A;  2G4S A;  5D2M B;  3H7S A;  1MG8 A;  3APC A;  4I6N B;  3C0R B;  4HK2 A;  3RZW C;  5JHB A;  2AL3 A;  2L05 A;  4HPL B;  2MW5 A;  4II3 B;  3RUI B;  3ZUN A;  3M63 B;  5AZG A;  2ZVN A;  2ZNV B;  5JH5 C;  2VRR B;  2MP2 A;  3QIJ A;  3U30 A;  2L0T A;  2OOB B;  4HLE A;  3BIN A;  1D3Z A;  1RLF A;  1TGZ B;  3U8Z A;  2LZ6 A;  1LQB A;  2BWF A;  3GZN I;  3RCZ A;  5LXH A;  3AU5 A;  2AYO B;  2CU1 A;  3B08 A;  4BKT A;  4BBN C;  2BWE S;  4FHJ A;  2IO3 B;  4ZRJ A;  1HE8 A;  1V86 A;  2LGX A;  3CF6 E;  2LRU A;  3PS6 A;  4LCD E;  4WQO B;  2KX0 A;  2Z59 B;  1LM8 B;  4IM0 A;  2KDE B;  2K8H A;  4NJ6 A;  4FJZ A;  3ZNG C;  2KWC A;  4MDK E;  3ALB A;  4KZ0 A;  1KM7 A;  2NR2 A;  1TTN A;  2B3A A;  2O6V B;  2MCN B;  5DPS A;  1SIF A;  2O2V B;  3UIN B;  4X57 B;  2LUE A;  3DBH I;  2KLG A;  3H6N A;  3AU4 A;  4HJK A;  3UF8 A;  4G50 A;  1YD8 U;  1ZW7 A;  3A9J A;  3R7R A;  4ANW A;  4ZRI A;  2KFK B;  4ANV A;  4NQL B;  3W1S A;  2KN5 A;  1Y8R C;  2J0M A;  3HM6 X;  3ZW3 A;  2N1V A;  4BVU C;  1GJZ A;  2DYM A;  3PRP B;  3PV1 A;  2QHO A;  4FUL A;  2ZEQ A;  3APF A;  1S1Q B;  2KJ6 A;  3ONS A;  3RYT A;  2GBN A;  3VHT C;  1WGD A;  4GSW A;  2MP2 B;  3Q3J A;  1IYF A;  4DBG A;  2NS5 A;  3A4S C;  3QAR A;  1Z2M A;  2RR9 A;  1F9J A;  2KOX A;  2Z0E B;  2C7H A;  3OJ3 A;  1EUV B;  5D7G A;  4EKU A;  2HE7 A;  2V3S A;  1C3T A;  2V1Y A;  1XD3 B;  2MWS B;  1E90 A;  4KSK C;  3JYU A;  4W9G A;  2I1K A;  5DPR A;  3A4R A;  4IC7 B;  1NI2 A;  2Z0D B;  2WX0 A;  4JLC A;  1VCB A;  4AJY B;  4I6L B;  1UBQ A;  2GBM A;  1YX6 B;  2A4Z A;  3S2A A;  3ZNH B;  1GUA B;  4W9C A;  3EFU A;  1Z5S B;  4GOC A;  3VTU A;  1WXA A;  3UQB A;  2NBV B;  4NNJ B;  2FIF A;  1P0R A;  3KUZ A;  2HTH A;  2NBU A;  3OAW A;  2N7E A;  5J17 A;  3KYD D;  2LRW A;  2JZZ A;  3A9J B;  4MGI E;  3ZRF A;  1EF1 A;  2L0F A;  3B0A A;  2M1M A;  1R4N I;  3H7P A;  1XT9 B;  1WX7 A;  2FNJ B;  3R3M A;  3WA0 A;  2KD0 A;  4F8C B;  5JHA A;  3NY5 A;  1WZ3 A;  3QHT A;  4IWQ A;  1OEY A;  4WJP A;  5FR6 A;  5EDS A;  4W9H A;  4IWO A;  2KDB A;  2LAS A;  3I3T B;  4WJO A;  2EMT A;  2BYE A;  5AZH A;  2FID A;  2L76 A;  3LJ3 A;  4KV2 A;  2IY0 B;  1P3Q U;  2KJH B;  3ZTD A;  4G11 A;  1V9J A;  3PRM B;  5CHW A;  1XQQ A;  2DZI A;  2M8S A;  4HVB A;  5KHO A;  2JRI B;  3EHV A;  4NY0 A;  2IBI B;  4CYE A;  2D2Q A;  4IWP A;  2DZJ A;  1K8R B;  4LDT D;  4EEW A;  1WY8 A;  3ML9 A;  4TUU A;  3A9K A;  3PHX B;  1WM2 A;  4EZK A;  3K9O B;  3DOW A;  3PGE A;  3ZDM C;  3ZRC A;  2OJR A;  3ZLZ A;  1WR6 E;  4TV3 A;  1V80 A;  3T9L A;  4DK5 A;  5CX3 A;  2LXC A;  2WYQ A;  2ZVO A;  2ZJD A;  2BF8 B;  5E6P A;  2GOW A;  4E74 A;  1EF5 A;  5G55 A;  1ZGU B;  2KMC A;  1EO6 A;  4K1R B;  2WWZ A;  4MH0 E;  4EOY A;  3R7Q A;  4RM9 A;  4DDG D;  4AJW A;  3KUC B;  4FLH A;  3OLM D;  2GMI C;  2BKR B;  2GBJ A;  2HD5 B;  2JPH A;  4HCN B;  4TKN A;  3H7P B;  4IM3 A;  4ZDV A;  1UEL A;  2KAN A;  4F7Z A;  2I1J A;  2FAZ A;  2LVP A;  2N7D A;  3N32 A;  4EZJ A;  3UGB B;  4XX5 A;  3WAO A;  4KDL B;  4MSM B;  2MBQ A;  2MBH A;  5G2N A;  2MRP A;  1WX9 A;  2ZNV C;  1GNU A;  3TJP A;  2DAF A;  1TZ1 A;  1Q0W B;  1OEY J;  4W9F A;  5DPT A;  2KXJ A;  5GMV A;  2JXX A;  3H9D A;  2KDI A;  2DEN B;  1WJ4 A;  3VFK A;  4EFO A;  2M4N A;  2AWT A;  1WXM A;  2MLB A;  3TMP B;  3DVN U;  3L13 A;  2CS4 A;  2KQS A;  4K7S A;  2W9N A;  2KJR A;  1P1A A;  3V6C B;  3VUW A;  3ML8 A;  2KKC A;  4B95 A;  1UGM A;  4ANU A;  1E7U A;  3QWZ B;  5E6N A;  3KVF B;  3AXC A;  2AEH A;  1OGW A;  3A9K B;  1V49 A;  4A20 A;  2RPQ A;  4G3X B;  4JQW C;  3DVG Y;  3PRE A;  5BO4 B;  2KO3 A;  2PPH A;  4KIK A;  4ZRK A;  4MM3 A;  4E71 A;  4MSQ B;  2ZPN A;  4AOF A;  3QX1 A;  1Q5W B;  2KWV B;  3IHP C;  4W9D A;  3WIM A;  1J8C A;  3TCA A;  5IAA C;  1I42 A;  1JRU A; 
#chains in the Genus database with same CATH topology
 3WAP A;  2IO0 B;  2N0S B;  4MH8 A;  2WU5 B;  4RMA A;  1SGH A;  3P4R B;  2K6D B;  2JZP A;  5BMG A;  4S17 A;  3AE3 B;  1WE6 A;  3RMK C;  4P1B C;  1ACC A;  1WX8 A;  1FEH A;  1GAQ B;  1IGC A;  1VJK A;  2BGF A;  1XO3 A;  2W54 A;  1J7B A;  4I6P A;  2PLP A;  5EE1 A;  2ZCC A;  1P9D U;  4HPP A;  1C78 A;  4WWN A;  1OTR B;  2MH7 A;  2C5L C;  1WRI A;  4RM8 A;  1YN3 A;  2GB1 A;  3DQV A;  2BTE A;  5HFY A;  4M0W A;  4O1N A;  4PYU A;  1XEE A;  2MA9 B;  2C60 A;  5IN7 A;  3QAQ A;  2CHZ A;  1D5Z C;  4A90 A;  1TY0 A;  4RF0 A;  4PS8 A;  2E3T A;  2CHX A;  1F0Z A;  3BK2 A;  2KQ7 A;  1MHH E;  1ZKH A;  2BS2 B;  4IG7 B;  1KH0 A;  3DBR B;  1LFD A;  2D11 A;  2WX1 A;  2C9W B;  3MHZ A;  3QJZ A;  2KWD A;  1TBE A;  4GU2 A;  4A3P A;  5JXV A;  1D6E C;  1UWX A;  1ESF A;  2J53 A;  4KZC A;  4BFR A;  3R8B A;  1WE7 A;  3DHG C;  3FC4 A;  4DXG A;  2FUH B;  5EE0 A;  1JW9 D;  3X23 A;  4A8X C;  5FR3 A;  2PE9 A;  3L17 A;  3M3J A;  3WAM A;  2IZV B;  1WM3 A;  2OED A;  2G45 B;  4WJN A;  1YOV B;  2JSV X;  1Q1O A;  1FM0 D;  2MJD A;  3UIP B;  1A70 A;  1OQY A;  3PSE B;  2GI9 A;  1NYR A;  1L6V A;  5E6O A;  4OVZ A;  2GBK A;  2ZPY A;  2HTM E;  3M95 A;  3UIO B;  4PS3 A;  2L7R A;  3IAS 1;  4FHK A;  4KSL C;  2TSS A;  1VRA B;  3PT2 B;  3RT3 B;  3LDZ E;  4OVV A;  2D3G A;  5G5H A;  1F2R C;  2L8J A;  1UUP A;  3L10 B;  4ICV A;  3DWG C;  3VTV A;  2KMM A;  3K9P B;  4HDO A;  2MBO A;  4K7U A;  2MQJ A;  4MGY E;  3V62 A;  3PZ7 A;  2VZK D;  1PQS A;  4RCO A;  3AEF B;  2C7N B;  3NUH B;  2N9X A;  1E7V A;  4MGZ E;  2JVC A;  2Y5B B;  1ZE3 D;  2K3U A;  2J0K A;  4CO7 A;  1J0G A;  3AMZ A;  1K53 A;  4E3C A;  3FIL A;  1QT9 A;  3V3X A;  2QCZ A;  2L52 A;  4EZL A;  4XWT A;  4GXB A;  3Q8B A;  4M00 A;  1V81 A;  1IPG A;  3PTF C;  3JSV B;  1VD2 A;  4GDL B;  4AWJ A;  3A1Q A;  3SD5 A;  2LMC A;  2CJN A;  1JRP A;  4MJS B;  3VUY A;  1V1P A;  3U7D A;  3NRZ A;  2DX5 B;  3ZJV A;  4WJQ A;  2CHW A;  2KK8 A;  3V6E B;  2K6Q A;  3SDL C;  2DLB A;  3CMM B;  1F52 A;  4GIV A;  3VH3 B;  3L16 A;  4AP4 C;  1XLN A;  4RGO S;  2BBC A;  1C4A A;  3BY4 B;  2CU3 A;  3KYC D;  1WF9 A;  3V05 A;  5C23 A;  5CHV C;  4XWW A;  5D6J B;  4WIP A;  3CWI A;  4RH6 A;  5HKH A;  4B6W A;  1NVI D;  4ZRP A;  2OHF A;  2RPV A;  4TQ0 A;  3N3K B;  4LJO B;  2ZZP B;  2V9H A;  4YTN B;  3L08 A;  1KJT A;  3DVN V;  4ZYS A;  2K9X A;  2JZ3 B;  1C4P A;  3W5U B;  3PO0 A;  1I4H A;  4DHZ B;  3R66 C;  1N62 A;  3TBL D;  1SE4 A;  1T5X D;  2LVQ A;  1SJE D;  2L00 B;  2IYD B;  2AQ3 B;  2G4S A;  4I6N B;  3Q8C A;  3ZUN A;  1YMH E;  3M63 B;  5AZG A;  2ZVN A;  2ZNV B;  2R61 A;  2L0T A;  1K51 A;  4HKQ A;  1RLF A;  1TGZ B;  3U8Z A;  2WQY B;  3U52 E;  1LQB A;  3RCZ A;  4H2A A;  1XLQ A;  4KGR A;  4ZRJ A;  2Q5W D;  4KX6 B;  2ACZ B;  1HE8 A;  1V86 A;  1LM8 B;  3SFE B;  4NJ6 A;  2D5G A;  2K5P A;  1MVK A;  4P1C C;  1GPX A;  4FJZ A;  2KWC A;  4MDK E;  2NR2 A;  2B3A A;  5DPS A;  1GOZ A;  2KLG A;  3H6N A;  5G5G A;  3A9J A;  3MFG A;  3R7R A;  4ZRI A;  4ANV A;  4C7Z A;  2CJO A;  3Q3O C;  2INP E;  2J0M A;  2DYM A;  2ZEQ A;  3APF A;  1S1Q B;  2KJ6 A;  3ONS A;  2GBN A;  1WGD A;  3AE8 B;  1Z2M A;  2KYW A;  2Z0E B;  2C7H A;  3E9S A;  1AWD A;  2V1Y A;  2HJ1 A;  5D3I B;  4YSX B;  3Q8F A;  4W9G A;  5DPR A;  3MC8 A;  1VCB A;  2GBM A;  3ZNH B;  2DBY A;  1GUA B;  4W9C A;  3EFU A;  3UQB A;  2NBV B;  3UI3 A;  4LTU A;  4M02 A;  4C4V B;  2JWU A;  3RNC C;  2JZZ A;  3VRA B;  4XDD A;  1QLB B;  1MI0 A;  2KD0 A;  4XDC A;  1YQ4 B;  1R4M B;  3T3O A;  2EMT A;  2FID A;  1ZDX A;  2IY0 B;  1KTK A;  3VR9 B;  2IBI B;  2D2Q A;  4LDT D;  4ARI A;  2IDY A;  3DOW A;  2ZJD A;  1CQV A;  3B2G A;  1EF5 A;  2NMQ A;  1C79 A;  1I4R A;  1SXT A;  4RF1 A;  4AJW A;  4FLH A;  2GMI C;  2JPH A;  2HD5 B;  4HCN B;  1UEL A;  2LVP A;  2N7D A;  1XCQ L;  2MBH A;  1WX9 A;  2M56 B;  3TJP A;  3J9C A;  1TZ1 A;  2WXH A;  4W9F A;  5DPT A;  2JXX A;  1RYJ A;  3H9D A;  4USA A;  4EFO A;  2MLB A;  2PVG C;  1WSP A;  2WXO A;  2KQS A;  2KJR A;  1P1A A;  2K22 A;  2D3A A;  2Z8L A;  3VRB B;  1JWM D;  1V49 A;  1YN5 A;  4JQW C;  3DVG Y;  2G1E A;  4OW0 A;  4ZRK A;  1QOG A;  3TCA A;  1I42 A;  1I4X A;  2LD9 A;  3DBS A;  1FFU A;  3PZD A;  4YXD B;  2EMS A;  4M8M A;  3TIX A;  1L0Y B;  2G4D B;  1PYW D;  1GB4 A;  1MHX A;  1SF0 A;  4NZL B;  1SE9 A;  4FA6 A;  2WXN A;  1PGA A;  1HTQ A;  2KWU B;  2V3N A;  4KKJ A;  1GC7 A;  1SIJ A;  5J18 A;  3AEA B;  3Q8E A;  2IO1 B;  1J7C A;  4LJP B;  2RMM A;  1VLB A;  1H4R A;  4IKG A;  2KDM A;  3VR8 B;  2LHD A;  4FAD A;  2R2Q A;  5CHF A;  5AUK A;  3BVZ A;  2ZCB A;  4GN1 A;  3RZF A;  3I9V 1;  2KTR B;  4P7I A;  1C1Y B;  4GDK A;  3GOE A;  1KLG D;  4HWI B;  4WQM A;  3EA6 A;  3W1S C;  1XLO A;  1WXS A;  2XK5 A;  2KFJ A;  3VUX A;  4DDI D;  4YT0 B;  3EEC A;  5KHQ A;  1T0Q C;  2MHJ A;  3ZIM A;  1NEN B;  2D3B A;  2WXL A;  4HXD A;  3DBL I;  4ICU A;  1T6B X;  2RSU A;  3DDC B;  2REX A;  2INN E;  2WP9 B;  3KLS X;  2A5U A;  2K8C A;  4W9L A;  1FNU A;  1EU4 A;  4JWS C;  1HTO A;  2KVR A;  1WI0 A;  4C56 C;  1YX5 B;  4YL8 A;  2LGD A;  4UDU C;  4ZHP A;  4PS7 A;  2XBB C;  3AE1 B;  1ENF A;  3NZS A;  1FD6 A;  2NPT B;  3N1Y C;  3ZGZ A;  1T0Y A;  2G3Q B;  2N4F A;  3Q6B A;  1SBB B;  3KW5 B;  3ZNI D;  1WXV A;  3Q14 C;  2FCM A;  3PVL A;  2X8X X;  3L0W B;  1DYQ A;  1TS5 A;  2RDB C;  3ZO5 B;  2FCQ A;  1JWA D;  3PRZ A;  3AE9 B;  5TR5 A;  3GE3 C;  4G0N B;  5HI1 A;  1QOB A;  5BYR A;  3HUI A;  2QJL A;  1BXT A;  2JUO A;  2LGY A;  3EUB 2;  4LNN A;  2N9E B;  3HK0 A;  2N1W A;  3HIZ A;  1HQR D;  2DWQ A;  2NCN A;  3C8Y A;  2J0J A;  5AEK B;  2BYF A;  3UQA A;  1YJJ A;  3QCA A;  3B2F A;  3NVV A;  3HVZ A;  1QQR A;  3MJ5 A;  4JX1 C;  2LJI A;  1NDD A;  2UYZ B;  4DHJ B;  4XGA B;  1E8X A;  1TZO A;  4A3O A;  3QA8 A;  1WFY A;  4JL9 A;  2BYV E;  2N9K A;  1KLV A;  1DGJ A;  1FRR A;  3KUD B;  4TQ1 A;  2XEW A;  3IG3 A;  1T0S C;  4FN2 A;  1DOX A;  2IGH A;  1L6U A;  1IP9 A;  2BB5 A;  4GGQ A;  1WXQ A;  3AE6 B;  3MC0 B;  3GS2 A;  1IUE A;  5EE9 A;  4BAX A;  2M0X A;  2KC1 A;  2WDT B;  2YEP F;  1FXT B;  2KN4 A;  1WMH B;  1YQB A;  1V6E A;  1WRD B;  2PEA A;  3DPD A;  3TUO A;  3ECI A;  5IOI A;  5D94 A;  3I57 A;  2PW9 A;  3W1Y A;  2KDF B;  3BII D;  1RAX A;  4EUT A;  4BKG A;  3X0W A;  5J2R A;  3WCQ A;  2IY1 B;  2MEK A;  3H8H A;  2MX2 A;  4YWG G;  1HXY D;  3R2I A;  2C7M B;  2GBR A;  5MPO A;  2DYO A;  2V4L A;  2O2V A;  2MBB B;  1KOT A;  2EKI A;  4NAW B;  2KFK A;  4DWF A;  3APC A;  3RZW C;  4REZ A;  5JHB A;  2MW5 A;  3RUI B;  4KKI A;  1NI3 A;  5JH5 C;  2VRR B;  1NEK B;  1FCC C;  2BB6 A;  1KRH A;  3GZN I;  2AYO B;  3LYY A;  3B08 A;  2LFI A;  2LGX A;  4LCD E;  1XF5 L;  2PVO D;  3N1Z C;  2WS3 B;  3ZNG C;  1TTN A;  2O6V B;  2MCN B;  3NZ3 A;  1SIF A;  4X57 B;  2LUE A;  4HJK A;  4PK1 A;  3BZD B;  4IOI E;  4NQL B;  3W1S A;  2KN5 A;  4J3O D;  2W55 A;  4BVU C;  4OHJ A;  4FUL A;  2QHO A;  3RYT A;  2MP2 B;  3PZ8 A;  3AM9 A;  2LEK A;  2NS5 A;  2V0G A;  1F9J A;  2KT7 A;  1GB1 A;  5D7G A;  1C3T A;  4C00 A;  3NVZ A;  2IGG A;  1E90 A;  4KSK C;  4NJC A;  2M0A A;  4IC7 B;  4JLC A;  3Q8A A;  1UBQ A;  3RNF C;  2MJ3 A;  4P6V F;  4GOC A;  1JWS D;  2FIF A;  1P0R A;  3KUZ A;  2LRW A;  3ZRF A;  2L0F A;  3B0A A;  3H7P A;  1WX7 A;  3AE4 B;  3WA0 A;  3DWM A;  1MPE A;  1ZUD 2;  3N9Y C;  4K3C A;  4F8C B;  3QHT A;  1NYQ A;  1OEY A;  4WJP A;  5FR6 A;  4W9H A;  3I3T B;  2LAS A;  3T3N A;  3EGR A;  2L76 A;  4KV2 A;  3ZTD A;  4G11 A;  5CHW A;  1XQQ A;  1VZ7 A;  1XXG A;  2JRI B;  4NY0 A;  1CZP A;  4IWP A;  1FCL A;  2L1A A;  3A9K A;  3CIR B;  3PHX B;  1MFW A;  1WM2 A;  5EE3 A;  3K9O B;  3NVY A;  2OJR A;  3RI7 C;  3U7Z A;  1F2R I;  1WR6 E;  4LNO A;  4TV3 A;  4OZA A;  3T9L A;  5CX3 A;  2WXR A;  2WYQ A;  4E74 A;  2SEB D;  3GE8 C;  3LXF A;  4RNA A;  1RWS A;  4EOY A;  3R7Q A;  5H8Y E;  3BVG A;  4W9I A;  4M01 A;  4B0M A;  2H89 B;  4EZJ A;  3UGB B;  3WAO A;  4KDL B;  2MRP A;  1I4Q A;  2ZNV C;  1VZ8 A;  3N20 C;  1Q0W B;  1OEY J;  2KXJ A;  5GMV A;  3VFK A;  2M4N A;  1WXM A;  3AE5 B;  4L2Y A;  1HEZ E;  4K7S A;  2W9N A;  3VUW A;  3ML8 A;  1HZ6 A;  3QWZ B;  3KVF B;  1OGW A;  1E9M A;  4G3X B;  1JQ4 A;  2KO3 A;  2PPH A;  3P42 A;  3RFZ B;  5HG2 A;  2PKO A;  2WDQ B;  2ZPN A;  1ZP0 B;  1Q5W B;  2KWV B;  4W9D A;  2LGS A;  1JRU A;  5FK9 C;  2UWQ A;  1TY2 A;  2B76 B;  4BKS D;  2IGD A;  1VDV A;  4TSS A;  1PUT A;  1TT5 B;  2J7Q B;  4B0E A;  1IBX B;  1T0R C;  1YIW A;  4YTM B;  4KGS A;  1RFA A;  2AL6 A;  1Y56 A;  4ANX A;  3MP9 A;  4DXA B;  5C1Z A;  2N7J A;  1FIQ A;  2WXI A;  2PJH A;  2YEP B;  3NS8 A;  3W5V B;  4AQ7 A;  5LXI B;  1A5R A;  2LWP A;  1E5W A;  4ZRQ A;  1V8C A;  1QZE A;  1JWB D;  2BS3 B;  1MG4 A;  3NOB A;  2QDF A;  3E56 A;  3AE2 B;  4MEL A;  3N30 A;  2BYT A;  4KIK B;  2KLC A;  1X1M A;  3V61 A;  4MM3 B;  3L54 A;  1YJI A;  4GLS C;  2KZR A;  2KX3 A;  2XNA C;  2BPS A;  1YJ1 A;  3P4P B;  3HHM A;  5IA7 A;  3CSF A;  3PHW B;  3Q3M C;  4LNK A;  4D2K A;  3ZJT A;  3PLU A;  1UH6 A;  4K3B A;  4N58 A;  1ZXH A;  4RGT A;  3P1M A;  4B9K A;  3ZXR A;  2PMV A;  1PGB A;  3O65 B;  2INC C;  3TL5 A;  3IVF A;  4YTP B;  3VAW A;  3BK1 A;  3APD A;  1VR9 A;  2XN9 C;  2PE6 B;  4KDI C;  3TEW A;  4ZYN A;  3WAN A;  2WXP A;  4M0W B;  4W9E A;  2K25 A;  2WXM A;  4ZHO A;  4US8 A;  3M62 B;  2RD0 A;  1YNT E;  2JU6 X;  4N6E B;  2KNB A;  3FAH A;  2KHW B;  4LNF A;  1PGX A;  4W9J A;  3AUL A;  3IAM 1;  5DPW A;  1WGH A;  2WXK A;  2JF5 A;  2KC2 A;  4BKS A;  2L32 A;  1XLP A;  2QMT A;  4A6Q A;  1D4B A;  2WLB A;  2K8B A;  3TEY A;  3QQ8 B;  1ROE A;  5LNK 1;  1WGY A;  4J6I A;  1I7H A;  3JSV A;  1N63 A;  2WNM A;  4GDL A;  2WDV B;  2DYB A;  2EKE C;  3ZTC A;  3NVW A;  2JY6 A;  1EWC A;  4MJS A;  3T8M A;  4JIO U;  1WR1 A;  3VDZ A;  3SHQ A;  1TS3 A;  4N9F 4;  3P63 A;  2N9P C;  3OWE B;  3KH0 A;  2FUG 1;  4HPM B;  2NBW B;  2QIL A;  3U2S C;  5L95 C;  3HRD D;  2R2O A;  1T3Q A;  4ASW C;  5CTR C;  1CK1 A;  1N5X A;  1L5P A;  2MSE D;  2V3P A;  5AUI A;  2ONQ A;  4HRS A;  2I2Y A;  4DQO C;  2WU2 B;  1D5M C;  4WWP A;  1P98 A;  1TS4 A;  1QIL A;  2VH1 A;  4RFB A;  4FJY A;  2BKF A;  1M94 A;  1L0V B;  2FCN A;  4NJ7 A;  2DHZ A;  2KAC A;  3NJT A;  3Q3F A;  4A55 A;  1L7Y A;  3QC8 B;  2BT6 A;  1HZ5 A;  1R4M I;  1GG3 A;  2BVC A;  3P2B A;  4MEM A;  2K39 A;  1K52 A;  1JWU D;  1OQR A;  1BML C;  2HJ8 A;  3PLV A;  5T8I A;  1GC6 A;  2W3S A;  4IW0 A;  4OZC A;  2M17 A;  1JRO A;  3MHS D;  1H8C A;  2LVO A;  3ENE A;  1E10 A;  3FIL B;  3ZXV A;  2BS4 B;  1AW7 A;  2JX5 A;  2WHI A;  5AZF A;  3AEG B;  3MTN B;  4OZB A;  3JVZ X;  1AAR A;  1K50 A;  2WDR B;  1WJN A;  3H1U A;  2CR5 A;  2RGF A;  1UWM A;  4MT5 A;  3A1Q B;  1OQQ A;  2JRH A;  1V1P B;  4PYZ A;  2DAJ A;  3VVW B;  1I4G A;  2YLM A;  3VQI A;  1J7A A;  2AQ2 B;  5I4D A;  4ACF A;  1V2Y A;  5D2M B;  3H7S A;  4A9A A;  1MG8 A;  3C0R B;  4HK2 A;  2L05 A;  3QIJ A;  2V4I B;  2OOB B;  4HLE A;  3BIN A;  4PT5 A;  1C4C A;  2LZ6 A;  2BWF A;  5LXH A;  3AU5 A;  1R7S A;  4BKT A;  4BBN C;  2BWE S;  2IO3 B;  4L1B A;  3CF6 E;  5BYS A;  2KX0 A;  2Z59 B;  4IM0 A;  3Q69 A;  2K8H A;  3ALB A;  4KZ0 A;  3GZN B;  3UIN B;  3DBH I;  1N6Z A;  2OJW A;  3AU4 A;  4C4V A;  4ANW A;  1ZW7 A;  2D3C A;  1EWY C;  1Y8R C;  1GJZ A;  2JYE A;  3PV1 A;  4FXC A;  3VHT C;  1OFF A;  3A4S C;  3QAR A;  1EUV B;  1N5W A;  3HVD A;  4WUR A;  2MWS B;  1CJE A;  2I1K A;  4YSZ B;  2Z0D B;  2WX0 A;  2ZW0 A;  4TMA B;  1ET6 A;  4I6L B;  1YX6 B;  3NG0 A;  2A4Z A;  3S2A A;  3Q3N C;  1Z5S B;  1YN4 A;  1WXA A;  1ET9 A;  4NNJ B;  2LHE A;  3AEB B;  2HTH A;  2NTS A;  2NBU A;  3OAW A;  5J17 A;  3KYD D;  3A9J B;  4MGI E;  2M1M A;  3KWL A;  1R4N I;  3I5J C;  1TIF A;  4RGM A;  3NY5 A;  1FXA A;  2M19 A;  1WZ3 A;  4IWQ A;  2IJ0 A;  3RNE C;  2KDB A;  2KAJ A;  2GLS A;  4WJO A;  1AYF A;  5AZH A;  1P3Q U;  2KJH B;  5IKC M;  3DHI C;  3PRM B;  2DZI A;  1B1Z A;  4HVB A;  1FNW A;  5KHO A;  3EHV A;  2QEJ C;  1QKZ A;  2DZJ A;  3SFD B;  4EEW A;  1WY8 A;  4JE3 B;  4TUU A;  1IGD A;  3PGE A;  3ZDM C;  2IND C;  3C19 A;  3ZLZ A;  1V80 A;  2LXC A;  2BF8 B;  2GOW A;  5G55 A;  1EO6 A;  4K1R B;  2WWZ A;  2BQQ A;  3L4P A;  4DDG D;  3KUC B;  3OLM D;  1P7E A;  4ARC A;  4IM3 A;  4ZDV A;  2KAN A;  1ZPS A;  4F7Z A;  3N32 A;  2FAZ A;  4XX5 A;  4IDI A;  4MSM B;  2IPK D;  3ETR A;  2DAF A;  4QAY A;  2MJE A;  1QF6 A;  1C77 A;  3DHH C;  2DEN B;  1WJ4 A;  3TMP B;  3L13 A;  3AEE B;  2CS4 A;  3TSS A;  1E7P B;  3V6C B;  4BOZ B;  4B95 A;  2KKC A;  1UGM A;  1E7U A;  2AEH A;  4A20 A;  1TS2 A;  3RNB C;  4MAC A;  4E71 A;  2UU7 A;  4AOF A;  2J4X A;  1TKY A;  3WIM A;  5IAA C;  2AQ1 B;  2IO2 B;  2KTR A;  4GMV A;  1NBF C;  1TKG A;  1FRD A;  1LXD A;  4NAM A;  4GB9 A;  4WH4 A;  3ZNZ B;  2PIA A;  4DHJ D;  2WXQ A;  3B9J A;  1UBI A;  3AI5 A;  2ASQ A;  2LXA A;  4FJV B;  4NQK E;  4WAA A;  1D5X C;  4DXF A;  4LK0 M;  3NHE B;  2N9L A;  3DBR I;  3WAL A;  4K81 A;  1UD7 A;  1E8W A;  2I38 A;  3ZDT A;  4AS1 A;  4MGK E;  3NZU A;  4KVG B;  3DVG X;  3R2T A;  3CST A;  5BMI A;  5BYQ A;  1E0Z A;  1V97 A;  1J19 A;  1EU3 A;  2WGS A;  4IM2 A;  1SJH D;  3I63 C;  2JT4 B;  5E6J A;  3V60 A;  2NPT A;  2J42 A;  1QOF A;  2ON8 A;  1UNS A;  2LJ5 A;  3ZYY X;  1V5O A;  3JW0 X;  1WJU A;  1LO5 D;  3ZVV A;  3BYT B;  2WXJ A;  2K1F A;  1FMA D;  3U4E G;  2JQR B;  5JZE B;  4BOS C;  3SU8 X;  2EEL A;  2KMA A;  4WWM A;  4WAF A;  1SE2 A;  2L3Z A;  5DCN A;  4URK A;  2H88 B;  3EC8 A;  4LDT B;  1FO4 A;  2DZK A;  3DCG A;  2GRI A;  4R3D A;  4OVU A;  3VXW A;  1WIA A;  1L4Z B;  3RPF C;  3P4S B;  2DZM A;  3ZKJ C;  2QSD A;  3PPA A;  1WWT A;  2WXF A;  4US9 A;  3SR6 A;  2JWZ A;  1RRB A;  1WYW B;  4S0R A;  1I35 A;  3MC9 A;  1EM7 A;  2CKH B;  4GDK B;  4FBJ B;  1QOA A;  3VTW A;  4CQN A;  1UF0 A;  5D3D A;  1I4P A;  2KVZ A;  1E8Y A;  2NVU I;  2XK5 B;  3KWV A;  4XZ4 A;  1M4V A;  1ZXI A;  4HDQ A;  1FFV A;  2BW2 A;  1JCK B;  3IBE A;  1UZX B;  2D10 A;  2KTF A;  2O6V D;  3IFW B;  4AUQ C;  1S3S G;  4II2 B;  4HCP B;  4BBN F;  3RUL A;  1JML A;  4M8N A;  1P7F A;  1WMH A;  1STE A;  4HRO A;  1V1O A;  4LLG M;  3NS1 A;  4XC2 A;  4WWO A;  1BT0 A;  3HM3 A;  4HEA 1;  1E8Z A;  4F1S A;  2LI5 A;  2HDE A;  3TEX A;  4RGN A;  4C7Y A;  3AEC B;  3IXS A;  3ZQ4 A;  2NTT A;  3MJW A;  1WJ6 A;  1TYG B;  2FCS A;  3B1L X;  1G6J A;  4CHK A;  1WGR A;  2D07 B;  3AV8 A;  4NAW A;  4XYC A;  5H92 C;  2JXT A;  3FKY A;  4DHZ E;  1CMX B;  5L83 A;  1JAL A;  2PTL A;  4JGH B;  2K0P A;  4K7W A;  4IUM B;  2MBE A;  5GXG B;  1DOI A;  3P4Q B;  3AED B;  3A33 B;  1V5T A;  3OJ4 B;  3VH4 B;  1SSN A;  4C80 A;  2FBW B;  5TSS A;  3IT6 B;  1RM6 C;  2G9H D;  2JYT A;  5BMH A;  2L83 A;  3SEB A;  3RNA C;  3QK0 A;  5LLI A;  2QC8 A;  2J52 A;  2E6X A;  1ISN A;  4JPS A;  1WH3 A;  1WGG A;  1KF6 B;  1WZ0 A;  2YVC A;  3KQ4 A;  2O6V A;  4W9K A;  2AX5 A;  4XE0 A;  5HHD G;  3GB1 A;  3RD2 A;  5C3J B;  2LGI A;  3D32 A;  3BYY B;  3AE7 B;  3O13 A;  4NPN A;  3DBL B;  1L2N A;  1U4A A;  3GP7 A;  3IT4 B;  2AL3 A;  4HPL B;  4II3 B;  3RN9 C;  1FPY A;  2MP2 A;  1TKE A;  3U30 A;  1D3Z A;  2QIE B;  2CU1 A;  3AH7 A;  4FHJ A;  1Q10 A;  2LRU A;  1RFK A;  3PS6 A;  1YQ3 B;  4WQO B;  1ZDV A;  2KDE B;  1AN8 A;  2ICI A;  4Q2J A;  1C76 A;  1KM7 A;  1UGJ A;  4EE2 A;  3AN1 A;  5IP4 D;  3RNG C;  2O2V B;  1F77 A;  5FKA C;  3UF8 A;  4G50 A;  1YD8 U;  1SB3 C;  2KFK B;  2WXG A;  1BUI C;  5C2T B;  4ZOH C;  3HM6 X;  3ZW3 A;  2N1V A;  4KGT A;  3PRP B;  4HJG E;  4LNI A;  2RDH A;  4GSW A;  3Q3J A;  1IYF A;  4DBG A;  3DBH B;  5IO9 A;  2RR9 A;  3LB8 C;  2KOX A;  3OJ3 A;  2KQ4 X;  1N60 A;  1ZOY B;  4EKU A;  3W2D A;  2HE7 A;  2V3S A;  1XD3 B;  3JYU A;  1PDX A;  3A4R A;  1NI2 A;  3BWU D;  4AJY B;  2DNF A;  1FXI A;  1LGR A;  3VTU A;  2X38 A;  2N7E A;  2Y5P A;  1L0X B;  1EF1 A;  1F1H A;  1XT9 B;  2FNJ B;  3R3M A;  5JHA A;  3AB5 A;  1XCT L;  5EDS A;  4IWO A;  1SE3 A;  3W9C B;  2BYE A;  1N61 A;  3LJ3 A;  1E6E B;  1WYG A;  1TJE A;  4YSY B;  1V9J A;  3ABV B;  2M8S A;  4CYE A;  1R4N B;  1K8R B;  3ML9 A;  2SAK A;  3Q2A C;  2LUM A;  4EZK A;  2FE8 A;  3URY A;  3ZRC A;  2VH2 A;  4N59 A;  3TEZ A;  4BZA A;  2W82 A;  4DK5 A;  2RDG A;  2ZVO A;  5E6P A;  3ZJU A;  3OG5 A;  4L23 A;  1ZGU B;  2KMC A;  1SEB D;  2ZW1 A;  4MH0 E;  2Y3A A;  2Y5C A;  4RM9 A;  3EFC A;  2W3R A;  2BKR B;  2GBJ A;  1WGK A;  4TKN A;  3H7P B;  4JWU C;  2I1J A;  1IBX A;  2MBQ A;  5G2N A;  1L4D B;  1GNU A;  3N1X C;  4HKZ E;  2KDI A;  1KLU D;  1FNV A;  2AWT A;  1C9F A;  1DOY A;  3DVN U;  4ANU A;  5E6N A;  3AXC A;  1KFY B;  2VZK B;  3A9K B;  1HA5 A;  2RPQ A;  3PRE A;  5BO4 B;  1PFD A;  3BVM A;  4KIK A;  4MM3 A;  4P16 A;  4MSQ B;  1MJD A;  1B9R A;  1VZ6 A;  3QX1 A;  3IHP C;  1J8C A;  4ITK A; 
#chains in the Genus database with same CATH homology
 2LD9 A;  2IO2 B;  2KTR A;  3DBS A;  3WAP A;  2IO0 B;  3PZD A;  4GMV A;  1NBF C;  4RMA A;  2UWQ A;  1SGH A;  4BKS D;  2EMS A;  4M8M A;  2K6D B;  3TIX A;  2G4D B;  1LXD A;  4GB9 A;  2J7Q B;  1WE6 A;  3ZNZ B;  1SE9 A;  4FA6 A;  1WX8 A;  4DHJ D;  1YIW A;  2KWU B;  2BGF A;  1GC7 A;  1RFA A;  1UBI A;  3AI5 A;  2ASQ A;  2LXA A;  2AL6 A;  4FJV B;  4I6P A;  4NQK E;  4ANX A;  4DXA B;  5C1Z A;  5J18 A;  2ZCC A;  2PJH A;  1P9D U;  4WAA A;  2IO1 B;  3NS8 A;  4LJP B;  4WWN A;  5LXI B;  1OTR B;  1A5R A;  2LWP A;  1E5W A;  2C5L C;  1QZE A;  3NHE B;  3DBR I;  4RM8 A;  3DQV A;  3WAL A;  4K81 A;  1H4R A;  1UD7 A;  1E8W A;  3NOB A;  4PYU A;  3ZDT A;  4FAD A;  2MA9 B;  2C60 A;  3NZU A;  4MGK E;  4KVG B;  2R2Q A;  4MEL A;  5CHF A;  3DVG X;  3QAQ A;  2CHZ A;  3N30 A;  2ZCB A;  2KLC A;  1X1M A;  4KIK B;  3V61 A;  3CST A;  4PS8 A;  3L54 A;  1J19 A;  4GN1 A;  3RZF A;  2KZR A;  4IM2 A;  2KX3 A;  2CHX A;  2BPS A;  1YJ1 A;  2KQ7 A;  1ZKH A;  3HHM A;  4IG7 B;  2JT4 B;  2KTR B;  5IA7 A;  3V60 A;  1LFD A;  2D11 A;  2NPT A;  2C9W B;  2WX1 A;  3CSF A;  3QJZ A;  3PHW B;  4P7I A;  1TBE A;  4GU2 A;  1C1Y B;  3PLU A;  4GDK A;  1UH6 A;  3GOE A;  4HWI B;  4A3P A;  2LJ5 A;  1V5O A;  3JW0 X;  1WJU A;  3W1S C;  3ZVV A;  4B9K A;  1WXS A;  4KZC A;  2K1F A;  4BFR A;  5JZE B;  2XK5 A;  4BOS C;  1WE7 A;  3SU8 X;  2KFJ A;  3O65 B;  3VUX A;  4DDI D;  3TL5 A;  3IVF A;  2FUH B;  2KMA A;  3EEC A;  5KHQ A;  3X23 A;  3VAW A;  3ZIM A;  4HXD A;  2PE9 A;  3DBL I;  3L17 A;  3M3J A;  4ICU A;  3WAM A;  2IZV B;  2L3Z A;  3APD A;  1WM3 A;  5DCN A;  4WJN A;  2G45 B;  4URK A;  3EC8 A;  4LDT B;  2RSU A;  3DDC B;  2REX A;  2PE6 B;  2A5U A;  4KDI C;  4ZYN A;  2DZK A;  1Q1O A;  3DCG A;  3WAN A;  2K8C A;  4W9I A;  4W9L A;  3UIP B;  4M0W B;  4OVU A;  4W9E A;  3VXW A;  1OQY A;  1WIA A;  2K25 A;  2KVR A;  3M62 B;  2RD0 A;  3PSE B;  1WI0 A;  2DZM A;  3ZKJ C;  1YX5 B;  4YL8 A;  2KNB A;  5E6O A;  2KHW B;  2LGD A;  3PPA A;  4W9J A;  3AUL A;  2GBK A;  2ZPY A;  5DPW A;  3M95 A;  1WGH A;  4PS7 A;  2JF5 A;  2JWZ A;  2KC2 A;  2XBB C;  3UIO B;  4BKS A;  3NZS A;  4PS3 A;  4BOZ B;  2L7R A;  1RRB A;  4FHK A;  1WYW B;  4KSL C;  2NPT B;  1I35 A;  2CKH B;  1T0Y A;  3PT2 B;  3RT3 B;  2G3Q B;  3LDZ E;  2N4F A;  4OVV A;  4GDK B;  2K8B A;  4FBJ B;  3KW5 B;  3QQ8 B;  3ZNI D;  3VTW A;  2D3G A;  1WXV A;  1WGY A;  4J6I A;  3JSV A;  4GDL A;  2FCM A;  2DYB A;  1E8Y A;  2EKE C;  3PVL A;  2NVU I;  3ZTC A;  3L0W B;  2XK5 B;  4XZ4 A;  2JY6 A;  2L8J A;  4MJS A;  3T8M A;  3L10 B;  4ICV A;  4JIO U;  1WR1 A;  4HDQ A;  3VDZ A;  2FCQ A;  3VTV A;  3IBE A;  3ZO5 B;  1UZX B;  3K9P B;  4HDO A;  2MBO A;  4K7U A;  2MQJ A;  3PRZ A;  4MGY E;  3SHQ A;  3V62 A;  2D10 A;  2KTF A;  2O6V D;  4N9F 4;  5TR5 A;  4G0N B;  2N9P C;  3IFW B;  3KH0 A;  1PQS A;  2C7N B;  4AUQ C;  4HPM B;  2NBW B;  2N9X A;  1E7V A;  4MGZ E;  5L95 C;  1S3S G;  2JUO A;  4II2 B;  2LGY A;  2R2O A;  2JVC A;  4HCP B;  4BBN F;  2N9E B;  2Y5B B;  4ASW C;  5CTR C;  3RUL A;  2J0K A;  3HK0 A;  4M8N A;  1WMH A;  2N1W A;  3HIZ A;  2NCN A;  4CO7 A;  2J0J A;  1J0G A;  2MSE D;  5AEK B;  2BYF A;  3UQA A;  4XC2 A;  4E3C A;  4WWO A;  1BT0 A;  3HM3 A;  1E8Z A;  3QCA A;  4F1S A;  2LI5 A;  4EZL A;  4GXB A;  1V81 A;  1IPG A;  2UYZ B;  1NDD A;  3PTF C;  4WWP A;  1P98 A;  4DHJ B;  3JSV B;  1VD2 A;  4GDL B;  4AWJ A;  3A1Q A;  3MJW A;  1E8X A;  1WJ6 A;  3SD5 A;  4FJY A;  4A3O A;  2BKF A;  1M94 A;  3QA8 A;  2FCS A;  1WFY A;  3B1L X;  4JL9 A;  4MJS B;  3VUY A;  2BYV E;  3U7D A;  1G6J A;  1KLV A;  4CHK A;  2FCN A;  4NJ7 A;  2DHZ A;  2DX5 B;  1WGR A;  3KUD B;  3Q3F A;  2XEW A;  4TQ1 A;  4WJQ A;  2D07 B;  2CHW A;  4NAW A;  3IG3 A;  2KK8 A;  1L7Y A;  4FN2 A;  3V6E B;  2K6Q A;  3SDL C;  3QC8 B;  3CMM B;  4DHZ E;  1IP9 A;  1CMX B;  4GIV A;  5L83 A;  1R4M I;  4GGQ A;  1GG3 A;  3L16 A;  3VH3 B;  4AP4 C;  4JGH B;  3P2B A;  4K7W A;  4IUM B;  4MEM A;  2K39 A;  3BY4 B;  2MBE A;  3KYC D;  2M0X A;  1WF9 A;  2HJ8 A;  2KC1 A;  2WDT B;  5CHV C;  3PLV A;  5C23 A;  1GC6 A;  1FXT B;  3A33 B;  1WMH B;  1V5T A;  1YQB A;  3OJ4 B;  4IW0 A;  3VH4 B;  5D6J B;  1V6E A;  1WRD B;  2PEA A;  2M17 A;  3DPD A;  3ECI A;  3MHS D;  5HKH A;  1H8C A;  2LVO A;  3ENE A;  5D94 A;  4B6W A;  5AZF A;  3MTN B;  3JVZ X;  3N3K B;  3QK0 A;  4LJO B;  5LLI A;  3W1Y A;  4TQ0 A;  2ZZP B;  2KDF B;  1AAR A;  1RAX A;  1WJN A;  4BKG A;  3X0W A;  4EUT A;  5J2R A;  3H1U A;  3L08 A;  1ISN A;  1KJT A;  2CR5 A;  2IY1 B;  3DVN V;  2RGF A;  2MX2 A;  1WH3 A;  1WGG A;  2JZ3 B;  3A1Q B;  1WZ0 A;  2C7M B;  2YVC A;  2GBR A;  2JRH A;  2O6V A;  2DYO A;  4W9K A;  4PYZ A;  2V4L A;  4DHZ B;  2O2V A;  3RD2 A;  2DAJ A;  3R66 C;  3TBL D;  3VVW B;  2MBB B;  2YLM A;  3VQI A;  1KOT A;  2LVQ A;  3D32 A;  2L00 B;  2KFK A;  2IYD B;  4NAW B;  4NPN A;  1L2N A;  4DWF A;  1U4A A;  1V2Y A;  2G4S A;  5D2M B;  3H7S A;  1MG8 A;  3APC A;  4I6N B;  3C0R B;  4HK2 A;  3RZW C;  5JHB A;  2AL3 A;  2L05 A;  4HPL B;  2MW5 A;  4II3 B;  3RUI B;  3ZUN A;  3M63 B;  5AZG A;  2ZVN A;  2ZNV B;  5JH5 C;  2VRR B;  2MP2 A;  3QIJ A;  3U30 A;  2L0T A;  2OOB B;  4HLE A;  3BIN A;  1D3Z A;  1RLF A;  1TGZ B;  3U8Z A;  2LZ6 A;  1LQB A;  2BWF A;  3GZN I;  3RCZ A;  5LXH A;  3AU5 A;  2AYO B;  2CU1 A;  3B08 A;  4BKT A;  4BBN C;  2BWE S;  4FHJ A;  2IO3 B;  4ZRJ A;  1HE8 A;  1V86 A;  2LGX A;  3CF6 E;  2LRU A;  3PS6 A;  4LCD E;  4WQO B;  2KX0 A;  2Z59 B;  1LM8 B;  4IM0 A;  2KDE B;  2K8H A;  4NJ6 A;  4FJZ A;  3ZNG C;  2KWC A;  4MDK E;  3ALB A;  4KZ0 A;  1KM7 A;  2NR2 A;  1TTN A;  2B3A A;  2O6V B;  2MCN B;  5DPS A;  1SIF A;  2O2V B;  3UIN B;  4X57 B;  2LUE A;  3DBH I;  2KLG A;  3H6N A;  3AU4 A;  4HJK A;  3UF8 A;  4G50 A;  1YD8 U;  1ZW7 A;  3A9J A;  3R7R A;  4ANW A;  4ZRI A;  2KFK B;  4ANV A;  4NQL B;  3W1S A;  2KN5 A;  1Y8R C;  2J0M A;  3HM6 X;  3ZW3 A;  2N1V A;  4BVU C;  1GJZ A;  2DYM A;  3PRP B;  3PV1 A;  2QHO A;  4FUL A;  2ZEQ A;  3APF A;  1S1Q B;  2KJ6 A;  3ONS A;  3RYT A;  2GBN A;  3VHT C;  1WGD A;  4GSW A;  2MP2 B;  3Q3J A;  1IYF A;  4DBG A;  2NS5 A;  3A4S C;  3QAR A;  1Z2M A;  2RR9 A;  1F9J A;  2KOX A;  2Z0E B;  2C7H A;  3OJ3 A;  1EUV B;  5D7G A;  4EKU A;  2HE7 A;  2V3S A;  1C3T A;  2V1Y A;  1XD3 B;  2MWS B;  1E90 A;  4KSK C;  3JYU A;  4W9G A;  2I1K A;  5DPR A;  3A4R A;  4IC7 B;  1NI2 A;  2Z0D B;  2WX0 A;  4JLC A;  1VCB A;  4AJY B;  4I6L B;  1UBQ A;  2GBM A;  1YX6 B;  2A4Z A;  3S2A A;  3ZNH B;  1GUA B;  4W9C A;  3EFU A;  1Z5S B;  4GOC A;  3VTU A;  1WXA A;  3UQB A;  2NBV B;  4NNJ B;  2FIF A;  1P0R A;  3KUZ A;  2HTH A;  2NBU A;  3OAW A;  2N7E A;  5J17 A;  3KYD D;  2LRW A;  2JZZ A;  3A9J B;  4MGI E;  3ZRF A;  1EF1 A;  2L0F A;  3B0A A;  2M1M A;  1R4N I;  3H7P A;  1XT9 B;  1WX7 A;  2FNJ B;  3R3M A;  3WA0 A;  2KD0 A;  4F8C B;  5JHA A;  3NY5 A;  1WZ3 A;  3QHT A;  4IWQ A;  1OEY A;  4WJP A;  5FR6 A;  5EDS A;  4W9H A;  4IWO A;  2KDB A;  2LAS A;  3I3T B;  4WJO A;  2EMT A;  2BYE A;  5AZH A;  2FID A;  2L76 A;  3LJ3 A;  4KV2 A;  2IY0 B;  1P3Q U;  2KJH B;  3ZTD A;  4G11 A;  1V9J A;  3PRM B;  5CHW A;  1XQQ A;  2DZI A;  2M8S A;  4HVB A;  5KHO A;  2JRI B;  3EHV A;  4NY0 A;  2IBI B;  4CYE A;  2D2Q A;  4IWP A;  2DZJ A;  1K8R B;  4LDT D;  4EEW A;  1WY8 A;  3ML9 A;  4TUU A;  3A9K A;  3PHX B;  1WM2 A;  4EZK A;  3K9O B;  3DOW A;  3PGE A;  3ZDM C;  3ZRC A;  2OJR A;  3ZLZ A;  1WR6 E;  4TV3 A;  1V80 A;  3T9L A;  4DK5 A;  5CX3 A;  2LXC A;  2WYQ A;  2ZVO A;  2ZJD A;  2BF8 B;  5E6P A;  2GOW A;  4E74 A;  1EF5 A;  5G55 A;  1ZGU B;  2KMC A;  1EO6 A;  4K1R B;  2WWZ A;  4MH0 E;  4EOY A;  3R7Q A;  4RM9 A;  4DDG D;  4AJW A;  3KUC B;  4FLH A;  3OLM D;  2GMI C;  2BKR B;  2GBJ A;  2HD5 B;  2JPH A;  4HCN B;  4TKN A;  3H7P B;  4IM3 A;  4ZDV A;  1UEL A;  2KAN A;  4F7Z A;  2I1J A;  2FAZ A;  2LVP A;  2N7D A;  3N32 A;  4EZJ A;  3UGB B;  4XX5 A;  3WAO A;  4KDL B;  4MSM B;  2MBQ A;  2MBH A;  5G2N A;  2MRP A;  1WX9 A;  2ZNV C;  1GNU A;  3TJP A;  2DAF A;  1TZ1 A;  1Q0W B;  1OEY J;  4W9F A;  5DPT A;  2KXJ A;  5GMV A;  2JXX A;  3H9D A;  2KDI A;  2DEN B;  1WJ4 A;  3VFK A;  4EFO A;  2M4N A;  2AWT A;  1WXM A;  2MLB A;  3TMP B;  3DVN U;  3L13 A;  2CS4 A;  2KQS A;  4K7S A;  2W9N A;  2KJR A;  1P1A A;  3V6C B;  3VUW A;  3ML8 A;  2KKC A;  4B95 A;  1UGM A;  4ANU A;  1E7U A;  3QWZ B;  5E6N A;  3KVF B;  3AXC A;  2AEH A;  1OGW A;  3A9K B;  1V49 A;  4A20 A;  2RPQ A;  4G3X B;  4JQW C;  3DVG Y;  3PRE A;  5BO4 B;  2KO3 A;  2PPH A;  4KIK A;  4ZRK A;  4MM3 A;  4E71 A;  4MSQ B;  2ZPN A;  4AOF A;  3QX1 A;  1Q5W B;  2KWV B;  3IHP C;  4W9D A;  3WIM A;  1J8C A;  3TCA A;  5IAA C;  1I42 A;  1JRU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...