3EC8A

The crystal structure of the ra domain of flj10324 (radil)
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
149
structure length
139
Chain Sequence
GTENLYFQSMDPAELSTQLSAPGVLKVFGDSTGTHYKSVLATGTSSARELVKEALERYALDPRQAGQYVLCDVVGWQARCFRVFGDSEKPLLIQELWKPREGLSRRFELRKRSDVEELAAKEVDTITAGINAQARRLQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein FLJ10324
publication title The crystal structure of the RA domain of FLJ10324 (RADIL)
rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 41
structure length 139
sequence length 149
ec nomenclature
pdb deposition date 2008-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00788 RA Ras association (RalGDS/AF-6) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3ec8A00
2ZPNA 5JHAA 2K6DB 2LVOA 4KDIC 4HDQA 2J0KA 4IWPA 4NAWB 4RMAA 5E6OA 5AZFA 3VTVA 1WXMA 1KOTA 1UGMA 3QC8B 2LGYA 3VFKA 3RT3B 2GBJA 5IAAC 4BBNF 1X1MA 4E71A 1I35A 4MJSA 2N7EA 2MQJA 2KC1A 4GDKA 4JLCA 2C7HA 2KTRA 2LJ5A 3ZTDA 2AYOB 2O6VB 1G6JA 2V3SA 2M17A 4K7UA 2CHWA 3PTFC 4EZLA 2LRUA 2ZZPB 3PRMB 4FHKA 4GGQA 2KVRA 3GOEA 2KJ6A 2NBWB 3V6CB 4LJPB 3TJPA 1GJZA 3HHMA 4CHKA 2KO3A 4JIOU 4MM3A 3ZO5B 4NAWA 3VH4B 1XT9B 3L16A 4FULA 2D2QA 1ZGUB 4N9F4 1J8CA 2DYOA 3R7QA 2DHZA 4BKSA 2FCMA 1GG3A 5D94A 1OTRB 4E3CA 4IM0A 3KYCD 3R3MA 3R7RA 1H8CA 2LVQA 2DYMA 2O6VA 1ZW7A 3EHVA 5KHOA 4DHJB 1WZ0A 2JPHA 1Y8RC 5DPRA 3ZDMC 5TR5A 2MBQA 3L0WB 1E8ZA 2C7MB 4ANUA 3TMPB 2N1VA 2Z0EB 3R66C 2NCNA 4MGZE 4X57B 3V62A 3ZNID 1LQBA 2KLGA 3ZRFA 5JHBA 4FN2A 1RAXA 1TBEA 4NJ7A 4ZRJA 2VRRB 4F7ZA 2CKHB 2BGFA 1WX9A 5G2NA 4W9HA 3SD5A 5AZGA 3PVLA 3KUZA 3HM3A 1UELA 2FAZA 3H7PB 2BWFA 2MBBB 1MG8A 2ZVOA 1D3ZA 3VVWB 4A20A 4AWJA 4W9GA 5DPSA 1NBFC 4A3OA 2KK8A 1WIAA 3NZUA 5CHWA 4B9KA 4I6NB 3ZNHB 4JQWC 4EOYA 1OEYJ 1WXAA 4PS8A 1WJ6A 2LASA 3X23A 1P0RA 2AL6A 1RRBA 2GBMA 4GSWA 4NPNA 4BFRA 4WQOB 3QIJA 3CSFA 4K81A 4PS7A 5GMVA 1GC6A 2GBRA 1V2YA 2DZKA 2I1KA 1WJUA 5HKHA 2Z0DB 3ONSA 4FHJA 2K39A 5C1ZA 3H9DA 3RULA 2LGDA 3MTNB 4YL8A 2FCNA 4E74A 2IO2B 2MX2A 3H7PA 1V5OA 2ZPYA 2KMAA 2KDFB 2WYQA 3B08A 4BOZB 2JRIB 3DCGA 2UYZB 1YX5B 3UGBB 2RR9A 1IPGA 2KD0A 2GBKA 5E6PA 1OGWA 2Z59B 3VUWA 2ZNVB 4BKSD 3M62B 1OEYA 3UINB 1SIFA 3U8ZA 3P2BA 3NY5A 3PHXB 2LD9A 1C3TA 1WRDB 2IY1B 3AI5A 3NS8A 2LUEA 2D3GA 1WXVA 2LZ6A 1E5WA 2O6VD 2CHXA 1J0GA 3M95A 1P9DU 2A5UA 4HDOA 4PYZA 4W9EA 2ZCCA 3N3KB 2FIFA 2NR2A 3B1LX 2MBOA 4DXAB 1F9JA 2ZEQA 3A9KB 1IYFA 1RFAA 2IO0B 4HK2A 1P1AA 4KV2A 3PLVA 3BINA 4KDLB 4NQKE 3M3JA 2KX3A 1EUVB 2G45B 2REXA 4IM2A 4LCDE 2C60A 4MGKE 1J19A 2AWTA 3LDZE 2JZ3B 2MSED 5L83A 1YQBA 2DAJA 2IY0B 4IW0A 3W1SA 2K8BA 3DBLI 3ML9A 4FJVB 1NI2A 2FNJB 3N30A 3KW5B 5DPWA 5DCNA 3U30A 3VDZA 4GDLB 4AUQC 2LXCA 4TUUA 2BKRB 2BWES 2OJRA 2KNBA 2L0TA 4GXBA 1V6EA 2PE9A 2XBBC 4FBJB 5D7GA 4F1SA 4DHJD 4KVGB 3ZW3A 5J18A 4IG7B 4TQ0A 2R2QA 3A9KA 4ANXA 5KHQA 4RM8A 2JZZA 4II2B 1KLVA 2AEHA 2KLCA 3IBEA 3KUDB 1LM8B 4M0WB 2V1YA 3L08A 4B6WA 2D07B 1EO6A 3OJ4B 4GB9A 3T9LA 3L10B 5J2RA 2N7DA 3V61A 3A33B 1CMXB 2G4SA 1WYWB 5DPTA 2KWVB 1WX8A 2DZIA 2MA9B 4LJOB 4B95A 2EMTA 3HIZA 4LDTB 3SHQA 1GC7A 3QAQA 2B3AA 3A4SC 2CS4A 4GDLA 4ZRIA 3OJ3A 4EFOA 2DAFA 1GNUA 2N9EB 1E7VA 2DZJA 1WI0A 2PEAA 3JVZX 4P7IA 1Z2MA 3IFWB 3UIOB 1KJTA 1WFYA 5C23A 4HCPB 1H4RA 1UBQA 3GZNI 1EF5A 1GUAB 2KKCA 5AEKB 2FIDA 3ZRCA 3TBLD 3CSTA 2KMCA 3KH0A 3O65B 3MHSD 1E8WA 1XD3B 2J0MA 3RZFA 2ZCBA 3V60A 2ZNVC 2V4LA 3W1SC 3K9OB 2N4FA 3RUIB 1AARA 3PSEB 2PE6B 2G4DB 2IYDB 2G3QB 1TGZB 2A4ZA 2DX5B 3HM6X 2L00B 2EKEC 2M1MA 2BPSA 4W9IA 2N1WA 1P98A 1WM2A 3ECIA 2DZMA 1YJ1A 2KJHB 4W9KA 1Q5WB 5CHVC 2XEWA 2XK5B 3I3TB 2KANA 3PREA 5LXHA 2JXXA 5J17A 3DBHI 3DVNU 2D11A 4JL9A 2M8SA 4EZKA 4G0NB 2Y5BB 3ALBA 1I42A 1FXTB 3QCAA 3NOBA 1WX7A 3DBSA 1WGYA 3APDA 4ANWA 3IG3A 3PV1A 3QJZA 5CX3A 3ZDTA 1WGHA 4BBNC 5LXIB 3RYTA 2RPQA 2O2VB 4IWQA 4GN1A 2KN5A 2L76A 3UIPB 1WR6E 4HLEA 2MRPA 2OOBB 4J6IA 2KQ7A 2N9XA 2NBVB 4FJZA 5JH5C 3AXCA 2MBHA 3PZDA 2K6QA 2GMIC 4W9CA 4IC7B 3VUXA 4DK5A 3RCZA 4A3PA 2XK5A 1WM3A 2WX0A 4F8CB 1R4MI 3QQ8B 1V5TA 1WGGA 4G3XB 2LI5A 4TV3A 3QARA 2HD5B 4W9FA 5CTRC 1ZKHA 2RD0A 1V86A 3KUCB 3X0WA 5EDSA 2O2VA 3QHTA 4ZRKA 4M8NA 4EEWA 2ASQA 2L0FA 3DDCB 2DYBA 4URKA 2J0JA 2IZVB 5D6JB 4WWNA 3TL5A 3WALA 2EMSA 1L7YA 2CR5A 2CU1A 2KTFA 3L13A 4KSLC 4M8MA 3WA0A 1TTNA 3WIMA 4ICUA 3SDLC 3ZLZA 2JRHA 2IO3B 4HXDA 2W9NA 2KFKB 3KVFB 2JVCA 3DBRI 4LDTD 4IUMB 4MSQB 4RM9A 4FLHA 3WAPA 4I6PA 1OQYA 1S3SG 2IO1B 2BF8B 2WWZA 3AU4A 3IVFA 3N32A 4IWOA 4HPMB 4KIKB 3JSVB 4ZYNA 4GMVA 3ZNGC 2BYVE 4WJNA 1WH3A 1C1YB 3OLMD 4W9DA 3WAOA 3QWZB 3Q3FA 3K9PB 1WMHB 1LXDA 3ZUNA 3U7DA 4MGYE 4DHZB 3TIXA 3OAWA 1E8YA 2MP2B 3JW0X 4FA6A 3Q3JA 3B0AA 1E90A 4MELA 4MH0E 3V6EB 4W9LA 1WE6A 3VAWA 4EUTA 3ENEA 1L2NA 4PS3A 1V49A 4ZDVA 2FCSA 2KFKA 4KZ0A 3PS6A 2K8CA 1IP9A 2HTHA 2WDTB 1SGHA 4IM3A 4EZJA 1WJNA 4K1RB 3VH3B 1T0YA 4GIVA 3VXWA 4WAAA 4GU2A 5E6NA 4AP4C 1YD8U 4KIKA 3JSVA 1S1QB 4AJYB 1A5RA 1WGRA 1RLFA 2FCQA 3BY4B 4NNJB 4DDGD 2KFJA 2RSUA 1V81A 3EFUA 4DWFA 2KZRA 1WMHA 3RD2A 3UQBA 1NDDA 4NJ6A 1M94A 2FUHB 2KXJA 3IHPC 4K7WA 1QZEA 2MCNB 2NBUA 2YLMA 2MP2A 1VCBA 2K1FA 4MSMB 3APCA 3D32A 2LRWA 3A4RA 4NQLB 3ZVVA 3PRPB 4WWPA 4W9JA 5D2MB 2JUOA 3ZNZB 2KWUB 4DHZE 2GOWA 3APFA 4XX5A 2UWQA 5AZHA 1PQSA 1WXSA 4KSKC 3UQAA 2JF5A 3L17A 4PYUA 5LLIA 1UH6A 1E8XA 2ZVNA 2LGXA 1YX6B 3NHEB 3CF6E 1KM7A 2PPHA 1WR1A 3DPDA 1XQQA 3VTUA 3ZTCA 2J7QB 4MGIE 3ZKJC 4FJYA 2KDEB 2MBEA 3MJWA 2C9WB 3PGEA 2JY6A 3LJ3A 2DENB 2KQSA 2M4NA 3WANA 3KYDD 2R2OA 3RZWC 4WJPA 1WGDA 2IBIB 2I1JA 4WJOA 2QHOA 1YIWA 4II3B 4JGHB 2HJ8A 4OVVA 1K8RB 2NS5A 3VUYA 3QK0A 2NPTB 4HCNB 3H7SA 4CYEA 3PHWB 4ICVA 4BKGA 4G50A 2LVPA 3ZIMA 4ANVA 1WY8A 4WWOA 1P3QU 4OVUA 3DVGY 4HPLB 3L54A 2BYFA 1U4AA 3HK0A 3QA8A 5L95C 1EF1A 3ML8A 5BO4B 1ISNA 4G11A 4AOFA 5IA7A 5CHFA 3DOWA 3VHTC 3DVNV 1WE7A 3WAMA 3JYUA 4NY0A 3PLUA 4HVBA 4HWIB 1UZXB 4HJKA 4TQ1A 3DVGX 3H1UA 3M63B 5JZEB 2HE7A 2MWSB 3C0RB 2L05A 1V9JA 4FADA 3PPAA 2LXAA 2KDBA 2MW5A 2D10A 2N9PC 4K7SA 3DQVA 3A9JB 4MDKE 2JT4B 3VTWA 3TCAA 1SE9A 2NPTA 2LWPA 2MLBA 2GBNA 2WX1A 1Q1OA 5G55A 3S2AA 4XZ4A 4BVUC 2NVUI 3A1QB 2KC2A 2K8HA 3T8MA 2CHZA 2ZJDA 2C7NB 2L8JA 2BYEA 1E7UA 4DBGA 2JWZA 2L7RA 4I6LB 1V80A 2C5LC 1BT0A 1UD7A 1WJ4A 3CMMB 3NZSA 4BKTA 2KJRA 2AL3A 1WF9A 3H6NA 4CO7A 2KDIA 4MEMA 1VD2A 3AU5A 2M0XA 2KOXA 4TKNA 3PT2B 4AJWA 2L3ZA 2KHWB 3AULA 3VQIA 3EECA 4GOCA 2K25A 1Z5SB 4KZCA 2PJHA 1R4NI 4MJSB 4ASWC 3A9JA 4GDKB 2KTRB 3UF8A 1JRUA 1WZ3A 2KWCA 1HE8A 5FR6A 3A1QA 3W1YA 2BKFA 4DDID 3QX1A 4BOSC 1LFDA 1Q0WB 2YVCA 4EKUA 3PRZA 1TZ1A 1UBIA 2RGFA 3EC8A 4WJQA 3SU8X 2KX0A 4XC2A
chains in the Genus database with same CATH superfamily
4MM3B 5JHAA 2LVOA 1UGMA 1MFWA 2GBJA 5IAAC 1X1MA 3NUHB 1I35A 1UWMA 3RNGC 2KTRA 2LJ5A 3BK2A 1G6JA 5BYQA 2M17A 4K7UA 1YMHE 2ZZPB 2JYEA 2KJ6A 3MP9A 2KAJA 1FNWA 2KO3A 4CHKA 2G9HD 2VZKD 1KFYB 1XT9B 3L16A 1RFKA 4BKSA 1FMAD 1GG3A 4IM0A 3R3MA 2MEKA 2WXRA 2JXTA 3ETRA 1GPXA 1FO4A 1JWAD 1FNVA 3L0WB 1E8ZA 2C7MB 2WXHA 3R66C 1RAXA 1TBEA 1UUPA 2BGFA 3SD5A 3PVLA 1UELA 3BWUD 2FAZA 2FE8A 3DWMA 1MJDA 2PVGC 1TS4A 2MBBB 3Q8BA 1D3ZA 1NBFC 2KK8A 3NZUA 5CHWA 4I6NB 1AWDA 3ZNHB 5FR3A 4EOYA 2E6XA 4PS8A 1YQ4B 2X8XX 1ZXIA 1RRBA 2GBMA 4GSWA 5HKHA 2ONQA 4FHJA 2K39A 4TMAB 1L6UA 1V97A 3H9DA 3GS2A 2FCNA 1NI3A 2ZPYA 5BYSA 2KDFB 3FILB 3B08A 4BOZB 2JRIB 2JX5A 1YX5B 2KYWA 4PK1A 2KD0A 4JWSC 1HA5A 2YEPF 1OEYA 3UINB 3P2BA 2WQYB 3NY5A 3NS8A 3MFGA 2LZ6A 2CHXA 4HDOA 1ZDVA 5LNK1 1IYFA 4HJGE 1F9JA 1P1AA 3M3JA 1DOYA 1UNSA 2AWTA 3LDZE 4LNFA 1TS2A 2E3TA 2L52A 4IW0A 3W1SA 2K8BA 4FJVB 2FNJB 2KT7A 5DPWA 4AUQC 2LXCA 5H92C 3T3NA 2Y3AA 2XBBC 1Y56A 1JALA 2R2QA 4P1BC 3A9KA 4ANXA 1WGKA 4RM8A 4L1BA 1F0ZA 2JZZA 1KLVA 2AEHA 3IBEA 1LM8B 4JX1C 4RF0A 1CMXB 1WYWB 1YJIA 4B95A 2MJEA 3SHQA 3P4RB 3AE4B 2AQ2B 2B3AA 3HUIA 3OJ3A 2WLBA 2DAFA 2IJ0A 1E7VA 3UIOB 3EGRA 1QOFA 4N58A 3ZRCA 3TBLD 3CSTA 3MHSD 2PMVA 1IBXA 1XD3B 3RZFA 2V9HA 3V60A 3P4QB 3K9OB 1KRHA 2G4DB 3HM6X 2G3QB 2DX5B 2L00B 2M1MA 4W9IA 4KKJA 2AQ1B 2DZMA 4W9KA 3EA6A 5LXHA 3NVVA 2M8SA 1I42A 1FXTB 4YTPB 3NOBA 3IG3A 4BBNC 5LXIB 2CJNA 2O2VB 4GN1A 1D6EC 2WU5B 2MBHA 3PZDA 3AEBB 4W9CA 3Q3OC 4A3PA 1KLGD 1IGCA 3NG0A 4F8CB 1V5TA 1DOIA 1VZ8A 1PGXA 3GE8C 1QKZA 3N1XC 4W9FA 5CTRC 1V86A 4ZRKA 4MH8A 3PZ8A 2ASQA 2L0FA 4EEWA 3DDCB 2DYBA 2J0JA 2IZVB 3HVDA 2EMSA 4USAA 1L7YA 3WALA 2CU1A 2KTFA 1TTNA 4HKZE 4HXDA 4IUMB 4OZCA 4MSQB 3IT4B 4I6PA 2IO1B 1FXIA 2WWZA 3IVFA 4KIKB 3JSVB 2D5GA 2BYVE 1QLBB 1WH3A 3QWZB 2Q5WD 3AE3B 5H8YE 1WMHB 2HTME 3NRZA 4DHZB 3C19A 1D4BA 2Y5PA 4GLSC 3Q3JA 3B0AA 1E90A 4MH0E 5I4DA 3BYYB 3VAWA 3IAS1 1IP9A 2WDTB 1SGHA 4YXDB 4REZA 1S1QB 3BVMA 2FCQA 3BY4B 1HXYD 4NNJB 4WQMA 1I4RA 1I4GA 2WXQA 3V05A 1NDDA 4NJ6A 1M94A 2FUHB 3B9JA 4K7WA 2YLMA 2D3CA 2MP2A 1VCBA 1F2RI 4DXGA 5HFYA 3APCA 3D32A 2LRWA 2LEKA 2QJLA 1SJED 3PRPB 4RF1A 4A8XC 2KWUB 2GOWA 4XX5A 5AZHA 1AN8A 1PQSA 2WXMA 3UQAA 2JF5A 5LLIA 1UH6A 2KWDA 1KM7A 2PPHA 3VTUA 2J7QB 4FJYA 1I4QA 2C9WB 3MJWA 3PGEA 3LJ3A 1FNUA 2M4NA 3WANA 2I1JA 4II3B 1NEKB 2RDHA 1K8RB 3RPFC 3VRBB 3VUYA 2V3PA 4NAMA 2NPTB 4HCNB 1CQVA 4ICVA 3AH7A 2LVPA 4OVUA 4HPLB 3HK0A 5L95C 4AOFA 2INNE 3VHTC 4YSYB 3WAMA 3VR9B 4HVBA 1FRDA 3C0RB 2L05A 3BYTB 2LXAA 3PPAA 2D10A 3L4PA 2WX1A 3S2AA 3DBRB 2NVUI 2BYTA 2K8HA 1PUTA 1F2RC 3P1MA 1HTOA 2JWZA 4I6LB 4JWUC 2CU3A 3NZSA 3I9V1 3RNBC 4K3BA 4MEMA 3PZ7A 1VRAB 3PT2B 2KHWB 3VQIA 2EELA 2WDRB 1TY0A 4LNNA 2WXPA 1R4NI 3A9JA 2KTRB 3UF8A 1JRUA 1QOAA 3AE1B 1K53A 1DGJA 3A1QA 3W1YA 3RI7C 1V1PA 3AE6B 2YVCA 4EKUA 1E9MA 5TSSA 3PRZA 1TZ1A 2FUG1 3EC8A 4WJQA 2K6DB 2J0KA 1KTKA 4RMAA 5AZFA 1WXMA 3IAM1 3QC8B 2LGYA 1C4CA 3VFKA 5IO9A 1M4VA 4MJSA 2MQJA 2KC1A 1BUIC 4LK0M 1B9RA 3PRMB 2B76B 4FHKA 3Q8CA 2KVRA 1ZUD2 3R2TA 2W3RA 4JIOU 4WIPA 3ZO5B 4H2AA 1VDVA 4NAWA 4FULA 2IGDA 2ACZB 1OTRB 3KYCD 1H8CA 1SJHD 2O6VA 5AUKA 3EHVA 4ZRPA 1CZPA 2PTLA 2MBQA 3TEZA 1GOZA 3DHHC 3AE5B 3TMPB 2Z0EB 1RYJA 2NCNA 3V62A 1LQBA 3ZRFA 5JHBA 4ZRJA 1T0SC 1WX9A 2GLSA 5G2NA 3KUZA 3HM3A 4QAYA 2ZVOA 4B9KA 4JQWC 1WJ6A 3X23A 4N59A 4BFRA 3QIJA 2ICIA 3W5VB 2I1KA 1WJUA 1EU4A 1TY2A 2Z0DB 3LXFA 2LGDA 4YL8A 4DXFA 3H7PA 1GB4A 2J42A 4C4VA 4P1CC 2KDMA 2LFIA 3WCQA 2GBKA 1OGWA 4YSZB 1F52A 2Z59B 1YJJA 2ZNVB 2BVCA 3FKYA 4BKSD 5E6JA 1LO5D 2DNFA 2LD9A 4OW0A 1C3TA 1QOGA 1RWSA 1EWYC 2MJDA 4RGOS 1P9DU 2D3AA 1UGJA 2AX5A 4PYZA 4W9EA 2ZCCA 2MBOA 3A9KB 1RFAA 4XDCA 4ZHPA 4KV2A 5EE3A 3PLVA 3BINA 2REXA 2C60A 1J19A 3BVGA 1N5WA 1QT9A 2JZ3B 2MSED 1WWTA 3MC0B 2BKRB 2BWES 1YOVB 2OJRA 1V6EA 2PE9A 4F1SA 2OHFA 4KVGB 4OHJA 2OEDA 3ZW3A 5J18A 2W82A 4TQ0A 4II2B 1SE2A 3KUDB 3NVYA 2D07B 1BMLC 3SFDB 4GB9A 3OJ4B 1IBXB 5J2RA 1MG4A 2IDYA 4IOIE 3A33B 5DPTA 2DZIA 4LJOB 2EMTA 1XEEA 4LDTB 3A4SC 4GDLA 4EFOA 1L0VB 1D5XC 2N9EB 2PEAA 1XCQL 1D5ZC 1KJTA 4HCPB 3I63C 1I7HA 3AEEB 1N5XA 1XLNA 1KLUD 1E8WA 1NYRA 2ON8A 4K3CA 2ZCBA 4KX6B 2ZNVC 2M0AA 1VLBA 2KACA 3W1SC 2LUMA 2PVOD 3PSEB 1HQRD 2A4ZA 2QSDA 1P98A 1WM2A 3ECIA 1YJ1A 2KJHB 2IPKD 1Q5WB 3Q3MC 1CK1A 3PREA 2SEBD 2Y5BB 2BQQA 1VR9A 1WX7A 5G5HA 4ANWA 3ZDTA 4YTMB 1WGHA 3R2IA 2RPQA 2OOBB 2NBVB 1ZXHA 5JH5C 1I4XA 3VUXA 1WRIA 3RCZA 4HRSA 2JYTA 2XK5A 4M00A 3KWLA 2WX0A 2MJ3A 3I57A 4M01A 1NENB 4LLGM 5G5GA 2WU2B 2J52A 2LI5A 1JCKB 2HD5B 1ZOYB 2RD0A 5EDSA 2KQ4X 1HZ6A 4M8NA 2K5PA 2NMQA 3RN9C 1FEHA 2K22A 3TL5A 1FCLA 4KSLC 2MH7A 4ICUA 3SDLC 2L1AA 2IO3B 2BS2B 2JVCA 5BMHA 4LDTD 1TKEA 4ZRQA 4RCOA 3RFZB 2JWUA 1S3SG 3Q6BA 4IWOA 3ZNGC 4ZYNA 1PYWD 4YTNB 3SEBA 1F77A 2WXOA 4MGYE 4A9AA 4XGAB 3OAWA 2MP2B 4W9LA 1V49A 2KFKA 3PS6A 2HTHA 2K3UA 5HI1A 4EZJA 1WJNA 1T0YA 5E6NA 2PKOA 1OFFA 1NYQA 1YD8U 4AJYB 4AP4C 1RM6C 1A5RA 1WGRA 1RLFA 2DWQA 4WWMA 1V81A 4PT5A 3UQBA 2KXJA 1QZEA 2NBUA 1FFUA 4MSMB 3A4RA 1TT5B 4W9JA 1UWXA 4DHZE 4BAXA 4YT0B 1C77A 2QCZA 1STEA 3LYYA 1GB1A 3L17A 2RDGA 2ZVNA 2LGXA 1YX6B 3W2DA 1T6BX 3DPDA 4MGIE 3ZKJC 1K51A 3CWIA 1JW9D 4N6EB 4WJPA 2BBCA 1VZ6A 1L6VA 1YIWA 1PGBA 4UDUC 2NS5A 5EE1A 2D3BA 1TJEA 2LHEA 3H7SA 3RNCC 1J7CA 3TUOA 3PHWB 4G50A 3ZIMA 4WWOA 1K50A 1P3QU 2I2YA 3L54A 2BYFA 3QA8A 5BO4B 1ISNA 2KN4A 5CHFA 1PGAA 3JYUA 4NY0A 4B0MA 4WH4A 3DVGX 3M63B 3KLSX 4D2KA 1TS3A 2N9PC 1OQQA 4K7SA 3DQVA 3A9JB 3VR8B 3VTWA 3TCAA 1D5MC 3A1QB 1V1PB 1AYFA 2CHZA 3U52E 1E7UA 2L7RA 3AMZA 2C5LC 3CMMB 1BT0A 1WJ4A 3DBLB 4BKTA 2AL3A 1WF9A 3H6NA 1VD2A 4IKGA 4AJWA 2W3SA 3EECA 2OJWA 2PJHA 1ROEA 4ARIA 4MJSB 1T3QA 4ASWC 1WZ3A 2KWCA 3BK1A 3RNFC 1HE8A 3TEWA 3P42A 3QX1A 5BMGA 3OWEB 1Q0WB 3ZQ4A 1UBIA 2PLPA 2KX0A 4NAWB 2BT6A 4P6VF 1KOTA 3P63A 1FXAA 4M02A 3RT3B 4JLCA 1P7FA 2O6VB 2CHWA 3PTFC 4EZLA 3AEFB 2GI9A 4P16A 2WS3B 3V6CB 3OG5A 3TJPA 1T0QC 3HHMA 1CJEA 2IGHA 3VH4B 2D2QA 3ZJUA 1ZGUB 1JMLA 4US8A 1P7EA 2DYOA 1R7SA 5D94A 2LVQA 3LB8C 2WP9B 1ZP0B 4DHJB 3NS1A 2JPHA 1Y8RC 5EE9A 3ZDMC 5TR5A 1FCCC 1JWSD 4J3OD 5BYRA 4ANUA 4XWWA 2N1VA 3P4PB 3BIID 4MGZE 3ZNID 1XCTL 4NJ7A 2PIAA 4F7ZA 2CKHB 3H7PB 2BWFA 1KF6B 1MG8A 1WYGA 4A20A 4AWJA 5DPSA 4C4VB 1QOBA 1WIAA 1BXTA 1OEYJ 1C76A 1IUEA 1WXAA 1ZPSA 2LASA 2K9XA 3CSFA 4PS7A 5GMVA 3AEDB 1GC6A 3RMKC 1V2YA 1LGRA 2DZKA 3ONSA 3MTNB 4E74A 4RGTA 2KMAA 2LMCA 5BMIA 3DCGA 2RR9A 1IPGA 4L2YA 1PDXA 3VUWA 3M62B 1SIFA 1R4NB 2D3GA 1WXVA 2O6VD 2WXIA 1J0GA 3M95A 1ESFA 3N3KB 2NR2A 3B1LX 1YN3A 2HDEA 4KDLB 2NTTA 1V8CA 1I4PA 1EUVB 2G45B 4IM2A 2QMTA 4LCDE 5AUIA 2WXJA 1YQBA 2DAJA 2IY0B 3ML9A 3N30A 3Q8FA 5DCNA 1N62A 4GDLB 2KMMA 1E10A 4DHJD 1J7BA 3ZXRA 1MHHE 1MI0A 2KLCA 2WXLA 4LNKA 4B6WA 4OZBA 4US9A 1EO6A 3T9LA 1MVKA 3L10B 4ITKA 2INPE 2BTEA 4HPPA 3IXSA 2MA9B 3HIZA 1GC7A 1XLPA 3QAQA 4DQOC 1GNUA 1SE3A 2DZJA 1WI0A 3GB1A 3JVZX 1Z2MA 3IFWB 1WFYA 2V4IB 1SXTA 1UBQA 3GZNI 1EF5A 4KGTA 5AEKB 4ACFA 4M0WA 2KMCA 3KH0A 3O65B 3AE2B 4B0EA 3Q2AC 3GP7A 2N4FA 1TIFA 3KQ4A 1AARA 5C2TB 2PE6B 1TGZB 3GE3C 2EKEC 2BPSA 2N1WA 3B2GA 5CHVC 2XEWA 2XK5B 5MPOA 3I3TB 2KANA 2JXXA 5J17A 3DBHI 3DVNU 2D11A 3BVZA 4G0NB 3ALBA 1NVID 3PV1A 3QJZA 5CX3A 3URYA 4IWQA 2KN5A 2L76A 3UIPB 1WR6E 3Q8EA 4HLEA 2MRPA 4J6IA 2KQ7A 2N9XA 4FJZA 4RNAA 2DBYA 5D3IB 3I5JC 2K6QA 2GMIC 4IC7B 4DK5A 4CQNA 3U2SC 1VJKA 1R4MI 2JU6X 1C9FA 1WGGA 5IP4D 4G3XB 2WXNA 3QARA 1ZKHA 3KUCB 2SAKA 3FC4A 4ZHOA 3AN1A 2WXFA 5D6JB 2WGSA 2JQRB 1SSNA 2FBWB 3ZLZA 2JRHA 2W9NA 2KFKB 5IKCM 4RM9A 4FLHA 3WAPA 1OQYA 2BF8B 4EZKA 3AU4A 4HPMB 2N7JA 1FFVA 4L23A 1YN5A 4WJNA 1C1YB 2W55A 1JROA 1N6ZA 3Q3FA 3K9PB 3DWGC 1N60A 3TIXA 4MELA 3ENEA 4PS3A 2FCSA 2ZW1A 4RH6A 3N20C 4IM3A 4MACA 3J9CA 4K1RB 1HTQA 4GIVA 1VZ7A 2KFJA 4DWFA 2KZRA 3RD2A 1DOXA 1TKGA 3IHPC 3MJ5A 1T0RC 4KGRA 2WNMA 2K1FA 4EE2A 1E0ZA 1ZDXA 4NQLB 3ZVVA 4AQ7A 5D2MB 3NVZA 3C8YA 3HVZA 4ZOHC 2TSSA 3AEAB 3IT6B 2UWQA 2GRIA 2R61A 2H89B 4PYUA 2I38A 1E8XA 3CF6E 3ZTCA 1XXGA 1YNTE 4OVZA 3O13A 2KQSA 3KYDD 2R2OA 1WGDA 2IBIB 3MC9A 4O1NA 4JGHB 3FAHA 1XLQA 2JZPA 1WXQA 2QILA 1U4AA 3TSSA 2YEPB 1EM7A 5IA7A 1C79A 4HWIB 2UU7A 4HJKA 4TQ1A 5JZEB 3H1UA 3VRAB 2HE7A 1QF6A 1V9JA 2KDBA 1TS5A 5D3DA 2JT4B 1SE9A 1JRPA 2LWPA 1Q1OA 5G55A 4XZ4A 2KC2A 1XLOA 2ZJDA 2C7NB 3W5UB 2BYEA 4DBGA 2WHIA 1V80A 1UD7A 2AQ3B 3N1YC 2KDIA 5T8IA 3AU5A 2KOXA 1HZ5A 3AULA 1SBBB 1Z5SB 2Y5CA 5C3JB 1L5PA 3TEYA 1TZOA 2BKFA 1C4AA 1L0YB 2V3NA 2RGFA 4WAFA 2ZPNA 4KGSA 4KDIC 4HDQA 4IWPA 5E6OA 3BZDB 3VTVA 3ZYYX 3SR6A 3PO0A 4BBNF 3NVWA 4E71A 1V1OA 2N7EA 4RFBA 4GDKA 2C7HA 3ZTDA 2AYOB 3AB5A 2V3SA 4C00A 2LRUA 4GGQA 3GOEA 2NBWB 4LJPB 1GJZA 2M56B 4MM3A 3R8BA 2PW9A 4N9F4 1J8CA 4S17A 3R7QA 2DHZA 1E7PB 1B1ZA 2FCMA 4E3CA 1SEBD 5JXVA 2KVZA 3R7RA 2DYMA 1SIJA 1ZW7A 5KHOA 1WZ0A 3H8HA 5DPRA 3SFEB 1T5XD 1OQRA 2WDVB 4X57B 2KLGA 3W9CB 4FN2A 2VRRB 2INCC 1ACCA 4W9HA 5AZGA 3UI3A 4S0RA 2RMMA 3NZ3A 3VVWB 4W9GA 4A3OA 5EE0A 2QIEB 1P0RA 2AL6A 4NPNA 3RNAC 4WQOB 4K81A 2GBRA 3ZGZA 5C1ZA 3RULA 2IO2B 2MX2A 1ET6A 1V5OA 1ET9A 2WYQA 1SE4A 1ENFA 4C80A 2UYZB 3UGBB 3AE9B 1SF0A 1HEZE 5E6PA 5FKAC 1A70A 3AEGB 3ZJTA 3T3OA 3U8ZA 2H88B 3PHXB 1WRDB 2IY1B 3AI5A 2GB1A 2LUEA 1ZE3D 1E5WA 2A5UA 3NJTA 2FIFA 4DXAB 1TYGB 2ZEQA 2IO0B 3ZXVA 4HK2A 1MHXA 3FILA 4NQKE 4YWGG 2KX3A 2HJ1A 1JWUD 1SB3C 4MGKE 1JWMD 5L83A 3DBLI 1NI2A 1E6EB 3KW5B 5IOIA 3U30A 3VDZA 1JQ4A 4TUUA 4GXBA 2KNBA 2L0TA 1QILA 3P4SB 4FBJB 5D7GA 4IG7B 4XE0A 3U7ZA 5KHQA 4YSXB 2INDC 4AS1A 4M0WB 2V1YA 3L08A 2N7DA 3V61A 2G4SA 2KWVB 1WX8A 1AW7A 3MHZA 4ZYSA 4ZRIA 2CS4A 2J4XA 4P7IA 3Q14C 1GAQB 3AM9A 5C23A 3RNEC 1H4RA 1GUAB 2KKCA 2FIDA 2X38A 3N9YC 4XDDA 4C7ZA 2J0MA 4WURA 1FD6A 1J7AA 2LHDA 5FK9C 2V4LA 2ZW0A 4NJCA 3RUIB 2IYDB 1L4DB 3DHGC 5HHDG 4ARCA 2WXKA 3E56A 2RPVA 3V3XA 4JL9A 1PFDA 3QCAA 1K52A 4XYCA 3DBSA 1WGYA 3APDA 3RYTA 2K0PA 2QDFA 4JE3B 1KH0A 4XWTA 3AXCA 2VH1A 1C4PA 3Q8AA 4HEA1 3N1ZC 1WM3A 3B2FA 3AECB 3QQ8B 2QC8A 4RGNA 4TV3A 2EKIA 3U4EG 3X0WA 2BS3B 2O2VA 3QHTA 2RDBC 1JWBD 2WXGA 2N9LA 2M19A 3ZJVA 4URKA 2DLBA 2W54A 4WWNA 1FPYA 2CR5A 4NZLB 3L13A 3CIRB 4M8MA 3WA0A 3WIMA 3KVFB 3DBRI 2N0SB 3AE8B 4HROA 1YN4A 3N32A 4GMVA 4IDIA 3WAOA 3OLMD 4W9DA 1L0XB 3ZUNA 1LXDA 3Q3NC 3U7DA 1YQ3B 4LNIA 1E8YA 3JW0X 4FA6A 4EUTA 3V6EB 4C7YA 4FXCA 1WE6A 1L2NA 4ZDVA 4KZ0A 4KKIA 2K8CA 2JSVX 2BB6A 3VH3B 4LNOA 3VXWA 4WAAA 4GU2A 4KIKA 3JSVA 3KWVA 4DDGD 2XN9C 2RSUA 3EFUA 3GZNB 1WMHA 3EFCA 2LJIA 2N9KA 3DHIC 3HRDD 4MT5A 2MCNB 1EWCA 4OZAA 2V0GA 3ABVB 4WWPA 1F1HA 1Q10A 2JUOA 1FIQA 3ZNZB 3APFA 1QQRA 2BB5A 2BW2A 1WXSA 4KSKC 3DBHB 2QEJC 1FM0D 1IGDA 3TEXA 3NHEB 4R3DA 2MHJA 1WR1A 1XQQA 2G1EA 2KDEB 2MBEA 2LGIA 2VH2A 2JY6A 2DENB 2BS4B 1N63A 3RZWC 1L4ZB 1WSPA 4WJOA 2QHOA 3EUB2 2HJ8A 4OVVA 2VZKB 5GXGB 3QK0A 3MC8A 4C56C 4CYEA 4A6QA 4BKGA 1R4MB 4ANVA 1WY8A 3DVGY 1EF1A 3ML8A 4G11A 4BZAA 4Q2JA 1XO3A 3DOWA 1EU3A 3DVNV 1WE7A 2CJOA 3E9SA 3PLUA 2L32A 1UZXB 2MWSB 4FADA 1TKYA 2MW5A 4LTUA 4MDKE 2NPTA 2MLBA 2GBNA 4BVUC 1MPEA 2NTSA 5IN7A 3T8MA 4HKQA 2L8JA 4RGMA 2Z8LA 4TSSA 5HG2A 2KJRA 4CO7A 1FRRA 2XNAC 4JPSA 4TKNA 2M0XA 2L3ZA 4GOCA 2K25A 1C78A 4KZCA 1DYQA 1XF5L 1I4HA 2L83A 1UF0A 4GDKB 2WDQB 1N61A 2J53A 5FR6A 2LGSA 4DDID 4A90A 4BOSC 1LFDA 2IGGA 3Q69A 4A55A 3AE7B 3SU8X 4XC2A 3AV8A
chains in the Genus database with same CATH topology
2ZPNA 5JHAA 2K6DB 2LVOA 4KDIC 4HDQA 2J0KA 4IWPA 4NAWB 4RMAA 5E6OA 5AZFA 3VTVA 1WXMA 1KOTA 1UGMA 3QC8B 2LGYA 3VFKA 3RT3B 2GBJA 5IAAC 4BBNF 1X1MA 4E71A 1I35A 4MJSA 2N7EA 2MQJA 2KC1A 4GDKA 4JLCA 2C7HA 2KTRA 2LJ5A 3ZTDA 2AYOB 2O6VB 1G6JA 2V3SA 2M17A 4K7UA 2CHWA 3PTFC 4EZLA 2LRUA 2ZZPB 3PRMB 4FHKA 4GGQA 2KVRA 3GOEA 2KJ6A 2NBWB 3V6CB 4LJPB 3TJPA 1GJZA 3HHMA 4CHKA 2KO3A 4JIOU 4MM3A 3ZO5B 4NAWA 3VH4B 1XT9B 3L16A 4FULA 2D2QA 1ZGUB 4N9F4 1J8CA 2DYOA 3R7QA 2DHZA 4BKSA 2FCMA 1GG3A 5D94A 1OTRB 4E3CA 4IM0A 3KYCD 3R3MA 3R7RA 1H8CA 2LVQA 2DYMA 2O6VA 1ZW7A 3EHVA 5KHOA 4DHJB 1WZ0A 2JPHA 1Y8RC 5DPRA 3ZDMC 5TR5A 2MBQA 3L0WB 1E8ZA 2C7MB 4ANUA 3TMPB 2N1VA 2Z0EB 3R66C 2NCNA 4MGZE 4X57B 3V62A 3ZNID 1LQBA 2KLGA 3ZRFA 5JHBA 4FN2A 1RAXA 1TBEA 4NJ7A 4ZRJA 2VRRB 4F7ZA 2CKHB 2BGFA 1WX9A 5G2NA 4W9HA 3SD5A 5AZGA 3PVLA 3KUZA 3HM3A 1UELA 2FAZA 3H7PB 2BWFA 2MBBB 1MG8A 2ZVOA 1D3ZA 3VVWB 4A20A 4AWJA 4W9GA 5DPSA 1NBFC 4A3OA 2KK8A 1WIAA 3NZUA 5CHWA 4B9KA 4I6NB 3ZNHB 4JQWC 4EOYA 1OEYJ 1WXAA 4PS8A 1WJ6A 2LASA 3X23A 1P0RA 2AL6A 1RRBA 2GBMA 4GSWA 4NPNA 4BFRA 4WQOB 3QIJA 3CSFA 4K81A 4PS7A 5GMVA 1GC6A 2GBRA 1V2YA 2DZKA 2I1KA 1WJUA 5HKHA 2Z0DB 3ONSA 4FHJA 2K39A 5C1ZA 3H9DA 3RULA 2LGDA 3MTNB 4YL8A 2FCNA 4E74A 2IO2B 2MX2A 3H7PA 1V5OA 2ZPYA 2KMAA 2KDFB 2WYQA 3B08A 4BOZB 2JRIB 3DCGA 2UYZB 1YX5B 3UGBB 2RR9A 1IPGA 2KD0A 2GBKA 5E6PA 1OGWA 2Z59B 3VUWA 2ZNVB 4BKSD 3M62B 1OEYA 3UINB 1SIFA 3U8ZA 3P2BA 3NY5A 3PHXB 2LD9A 1C3TA 1WRDB 2IY1B 3AI5A 3NS8A 2LUEA 2D3GA 1WXVA 2LZ6A 1E5WA 2O6VD 2CHXA 1J0GA 3M95A 1P9DU 2A5UA 4HDOA 4PYZA 4W9EA 2ZCCA 3N3KB 2FIFA 2NR2A 3B1LX 2MBOA 4DXAB 1F9JA 2ZEQA 3A9KB 1IYFA 1RFAA 2IO0B 4HK2A 1P1AA 4KV2A 3PLVA 3BINA 4KDLB 4NQKE 3M3JA 2KX3A 1EUVB 2G45B 2REXA 4IM2A 4LCDE 2C60A 4MGKE 1J19A 2AWTA 3LDZE 2JZ3B 2MSED 5L83A 1YQBA 2DAJA 2IY0B 4IW0A 3W1SA 2K8BA 3DBLI 3ML9A 4FJVB 1NI2A 2FNJB 3N30A 3KW5B 5DPWA 5DCNA 3U30A 3VDZA 4GDLB 4AUQC 2LXCA 4TUUA 2BKRB 2BWES 2OJRA 2KNBA 2L0TA 4GXBA 1V6EA 2PE9A 2XBBC 4FBJB 5D7GA 4F1SA 4DHJD 4KVGB 3ZW3A 5J18A 4IG7B 4TQ0A 2R2QA 3A9KA 4ANXA 5KHQA 4RM8A 2JZZA 4II2B 1KLVA 2AEHA 2KLCA 3IBEA 3KUDB 1LM8B 4M0WB 2V1YA 3L08A 4B6WA 2D07B 1EO6A 3OJ4B 4GB9A 3T9LA 3L10B 5J2RA 2N7DA 3V61A 3A33B 1CMXB 2G4SA 1WYWB 5DPTA 2KWVB 1WX8A 2DZIA 2MA9B 4LJOB 4B95A 2EMTA 3HIZA 4LDTB 3SHQA 1GC7A 3QAQA 2B3AA 3A4SC 2CS4A 4GDLA 4ZRIA 3OJ3A 4EFOA 2DAFA 1GNUA 2N9EB 1E7VA 2DZJA 1WI0A 2PEAA 3JVZX 4P7IA 1Z2MA 3IFWB 3UIOB 1KJTA 1WFYA 5C23A 4HCPB 1H4RA 1UBQA 3GZNI 1EF5A 1GUAB 2KKCA 5AEKB 2FIDA 3ZRCA 3TBLD 3CSTA 2KMCA 3KH0A 3O65B 3MHSD 1E8WA 1XD3B 2J0MA 3RZFA 2ZCBA 3V60A 2ZNVC 2V4LA 3W1SC 3K9OB 2N4FA 3RUIB 1AARA 3PSEB 2PE6B 2G4DB 2IYDB 2G3QB 1TGZB 2A4ZA 2DX5B 3HM6X 2L00B 2EKEC 2M1MA 2BPSA 4W9IA 2N1WA 1P98A 1WM2A 3ECIA 2DZMA 1YJ1A 2KJHB 4W9KA 1Q5WB 5CHVC 2XEWA 2XK5B 3I3TB 2KANA 3PREA 5LXHA 2JXXA 5J17A 3DBHI 3DVNU 2D11A 4JL9A 2M8SA 4EZKA 4G0NB 2Y5BB 3ALBA 1I42A 1FXTB 3QCAA 3NOBA 1WX7A 3DBSA 1WGYA 3APDA 4ANWA 3IG3A 3PV1A 3QJZA 5CX3A 3ZDTA 1WGHA 4BBNC 5LXIB 3RYTA 2RPQA 2O2VB 4IWQA 4GN1A 2KN5A 2L76A 3UIPB 1WR6E 4HLEA 2MRPA 2OOBB 4J6IA 2KQ7A 2N9XA 2NBVB 4FJZA 5JH5C 3AXCA 2MBHA 3PZDA 2K6QA 2GMIC 4W9CA 4IC7B 3VUXA 4DK5A 3RCZA 4A3PA 2XK5A 1WM3A 2WX0A 4F8CB 1R4MI 3QQ8B 1V5TA 1WGGA 4G3XB 2LI5A 4TV3A 3QARA 2HD5B 4W9FA 5CTRC 1ZKHA 2RD0A 1V86A 3KUCB 3X0WA 5EDSA 2O2VA 3QHTA 4ZRKA 4M8NA 4EEWA 2ASQA 2L0FA 3DDCB 2DYBA 4URKA 2J0JA 2IZVB 5D6JB 4WWNA 3TL5A 3WALA 2EMSA 1L7YA 2CR5A 2CU1A 2KTFA 3L13A 4KSLC 4M8MA 3WA0A 1TTNA 3WIMA 4ICUA 3SDLC 3ZLZA 2JRHA 2IO3B 4HXDA 2W9NA 2KFKB 3KVFB 2JVCA 3DBRI 4LDTD 4IUMB 4MSQB 4RM9A 4FLHA 3WAPA 4I6PA 1OQYA 1S3SG 2IO1B 2BF8B 2WWZA 3AU4A 3IVFA 3N32A 4IWOA 4HPMB 4KIKB 3JSVB 4ZYNA 4GMVA 3ZNGC 2BYVE 4WJNA 1WH3A 1C1YB 3OLMD 4W9DA 3WAOA 3QWZB 3Q3FA 3K9PB 1WMHB 1LXDA 3ZUNA 3U7DA 4MGYE 4DHZB 3TIXA 3OAWA 1E8YA 2MP2B 3JW0X 4FA6A 3Q3JA 3B0AA 1E90A 4MELA 4MH0E 3V6EB 4W9LA 1WE6A 3VAWA 4EUTA 3ENEA 1L2NA 4PS3A 1V49A 4ZDVA 2FCSA 2KFKA 4KZ0A 3PS6A 2K8CA 1IP9A 2HTHA 2WDTB 1SGHA 4IM3A 4EZJA 1WJNA 4K1RB 3VH3B 1T0YA 4GIVA 3VXWA 4WAAA 4GU2A 5E6NA 4AP4C 1YD8U 4KIKA 3JSVA 1S1QB 4AJYB 1A5RA 1WGRA 1RLFA 2FCQA 3BY4B 4NNJB 4DDGD 2KFJA 2RSUA 1V81A 3EFUA 4DWFA 2KZRA 1WMHA 3RD2A 3UQBA 1NDDA 4NJ6A 1M94A 2FUHB 2KXJA 3IHPC 4K7WA 1QZEA 2MCNB 2NBUA 2YLMA 2MP2A 1VCBA 2K1FA 4MSMB 3APCA 3D32A 2LRWA 3A4RA 4NQLB 3ZVVA 3PRPB 4WWPA 4W9JA 5D2MB 2JUOA 3ZNZB 2KWUB 4DHZE 2GOWA 3APFA 4XX5A 2UWQA 5AZHA 1PQSA 1WXSA 4KSKC 3UQAA 2JF5A 3L17A 4PYUA 5LLIA 1UH6A 1E8XA 2ZVNA 2LGXA 1YX6B 3NHEB 3CF6E 1KM7A 2PPHA 1WR1A 3DPDA 1XQQA 3VTUA 3ZTCA 2J7QB 4MGIE 3ZKJC 4FJYA 2KDEB 2MBEA 3MJWA 2C9WB 3PGEA 2JY6A 3LJ3A 2DENB 2KQSA 2M4NA 3WANA 3KYDD 2R2OA 3RZWC 4WJPA 1WGDA 2IBIB 2I1JA 4WJOA 2QHOA 1YIWA 4II3B 4JGHB 2HJ8A 4OVVA 1K8RB 2NS5A 3VUYA 3QK0A 2NPTB 4HCNB 3H7SA 4CYEA 3PHWB 4ICVA 4BKGA 4G50A 2LVPA 3ZIMA 4ANVA 1WY8A 4WWOA 1P3QU 4OVUA 3DVGY 4HPLB 3L54A 2BYFA 1U4AA 3HK0A 3QA8A 5L95C 1EF1A 3ML8A 5BO4B 1ISNA 4G11A 4AOFA 5IA7A 5CHFA 3DOWA 3VHTC 3DVNV 1WE7A 3WAMA 3JYUA 4NY0A 3PLUA 4HVBA 4HWIB 1UZXB 4HJKA 4TQ1A 3DVGX 3H1UA 3M63B 5JZEB 2HE7A 2MWSB 3C0RB 2L05A 1V9JA 4FADA 3PPAA 2LXAA 2KDBA 2MW5A 2D10A 2N9PC 4K7SA 3DQVA 3A9JB 4MDKE 2JT4B 3VTWA 3TCAA 1SE9A 2NPTA 2LWPA 2MLBA 2GBNA 2WX1A 1Q1OA 5G55A 3S2AA 4XZ4A 4BVUC 2NVUI 3A1QB 2KC2A 2K8HA 3T8MA 2CHZA 2ZJDA 2C7NB 2L8JA 2BYEA 1E7UA 4DBGA 2JWZA 2L7RA 4I6LB 1V80A 2C5LC 1BT0A 1UD7A 1WJ4A 3CMMB 3NZSA 4BKTA 2KJRA 2AL3A 1WF9A 3H6NA 4CO7A 2KDIA 4MEMA 1VD2A 3AU5A 2M0XA 2KOXA 4TKNA 3PT2B 4AJWA 2L3ZA 2KHWB 3AULA 3VQIA 3EECA 4GOCA 2K25A 1Z5SB 4KZCA 2PJHA 1R4NI 4MJSB 4ASWC 3A9JA 4GDKB 2KTRB 3UF8A 1JRUA 1WZ3A 2KWCA 1HE8A 5FR6A 3A1QA 3W1YA 2BKFA 4DDID 3QX1A 4BOSC 1LFDA 1Q0WB 2YVCA 4EKUA 3PRZA 1TZ1A 1UBIA 2RGFA 3EC8A 4WJQA 3SU8X 2KX0A 4XC2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZPN A;  5JHA A;  2K6D B;  2LVO A;  4KDI C;  4HDQ A;  2J0K A;  4IWP A;  4NAW B;  4RMA A;  5E6O A;  5AZF A;  3VTV A;  1WXM A;  1KOT A;  1UGM A;  3QC8 B;  2LGY A;  3VFK A;  3RT3 B;  2GBJ A;  5IAA C;  4BBN F;  1X1M A;  4E71 A;  1I35 A;  4MJS A;  2N7E A;  2MQJ A;  2KC1 A;  4GDK A;  4JLC A;  2C7H A;  2KTR A;  2LJ5 A;  3ZTD A;  2AYO B;  2O6V B;  1G6J A;  2V3S A;  2M17 A;  4K7U A;  2CHW A;  3PTF C;  4EZL A;  2LRU A;  2ZZP B;  3PRM B;  4FHK A;  4GGQ A;  2KVR A;  3GOE A;  2KJ6 A;  2NBW B;  3V6C B;  4LJP B;  3TJP A;  1GJZ A;  3HHM A;  4CHK A;  2KO3 A;  4JIO U;  4MM3 A;  3ZO5 B;  4NAW A;  3VH4 B;  1XT9 B;  3L16 A;  4FUL A;  2D2Q A;  1ZGU B;  4N9F 4;  1J8C A;  2DYO A;  3R7Q A;  2DHZ A;  4BKS A;  2FCM A;  1GG3 A;  5D94 A;  1OTR B;  4E3C A;  4IM0 A;  3KYC D;  3R3M A;  3R7R A;  1H8C A;  2LVQ A;  2DYM A;  2O6V A;  1ZW7 A;  3EHV A;  5KHO A;  4DHJ B;  1WZ0 A;  2JPH A;  1Y8R C;  5DPR A;  3ZDM C;  5TR5 A;  2MBQ A;  3L0W B;  1E8Z A;  2C7M B;  4ANU A;  3TMP B;  2N1V A;  2Z0E B;  3R66 C;  2NCN A;  4MGZ E;  4X57 B;  3V62 A;  3ZNI D;  1LQB A;  2KLG A;  3ZRF A;  5JHB A;  4FN2 A;  1RAX A;  1TBE A;  4NJ7 A;  4ZRJ A;  2VRR B;  4F7Z A;  2CKH B;  2BGF A;  1WX9 A;  5G2N A;  4W9H A;  3SD5 A;  5AZG A;  3PVL A;  3KUZ A;  3HM3 A;  1UEL A;  2FAZ A;  3H7P B;  2BWF A;  2MBB B;  1MG8 A;  2ZVO A;  1D3Z A;  3VVW B;  4A20 A;  4AWJ A;  4W9G A;  5DPS A;  1NBF C;  4A3O A;  2KK8 A;  1WIA A;  3NZU A;  5CHW A;  4B9K A;  4I6N B;  3ZNH B;  4JQW C;  4EOY A;  1OEY J;  1WXA A;  4PS8 A;  1WJ6 A;  2LAS A;  3X23 A;  1P0R A;  2AL6 A;  1RRB A;  2GBM A;  4GSW A;  4NPN A;  4BFR A;  4WQO B;  3QIJ A;  3CSF A;  4K81 A;  4PS7 A;  5GMV A;  1GC6 A;  2GBR A;  1V2Y A;  2DZK A;  2I1K A;  1WJU A;  5HKH A;  2Z0D B;  3ONS A;  4FHJ A;  2K39 A;  5C1Z A;  3H9D A;  3RUL A;  2LGD A;  3MTN B;  4YL8 A;  2FCN A;  4E74 A;  2IO2 B;  2MX2 A;  3H7P A;  1V5O A;  2ZPY A;  2KMA A;  2KDF B;  2WYQ A;  3B08 A;  4BOZ B;  2JRI B;  3DCG A;  2UYZ B;  1YX5 B;  3UGB B;  2RR9 A;  1IPG A;  2KD0 A;  2GBK A;  5E6P A;  1OGW A;  2Z59 B;  3VUW A;  2ZNV B;  4BKS D;  3M62 B;  1OEY A;  3UIN B;  1SIF A;  3U8Z A;  3P2B A;  3NY5 A;  3PHX B;  2LD9 A;  1C3T A;  1WRD B;  2IY1 B;  3AI5 A;  3NS8 A;  2LUE A;  2D3G A;  1WXV A;  2LZ6 A;  1E5W A;  2O6V D;  2CHX A;  1J0G A;  3M95 A;  1P9D U;  2A5U A;  4HDO A;  4PYZ A;  4W9E A;  2ZCC A;  3N3K B;  2FIF A;  2NR2 A;  3B1L X;  2MBO A;  4DXA B;  1F9J A;  2ZEQ A;  3A9K B;  1IYF A;  1RFA A;  2IO0 B;  4HK2 A;  1P1A A;  4KV2 A;  3PLV A;  3BIN A;  4KDL B;  4NQK E;  3M3J A;  2KX3 A;  1EUV B;  2G45 B;  2REX A;  4IM2 A;  4LCD E;  2C60 A;  4MGK E;  1J19 A;  2AWT A;  3LDZ E;  2JZ3 B;  2MSE D;  5L83 A;  1YQB A;  2DAJ A;  2IY0 B;  4IW0 A;  3W1S A;  2K8B A;  3DBL I;  3ML9 A;  4FJV B;  1NI2 A;  2FNJ B;  3N30 A;  3KW5 B;  5DPW A;  5DCN A;  3U30 A;  3VDZ A;  4GDL B;  4AUQ C;  2LXC A;  4TUU A;  2BKR B;  2BWE S;  2OJR A;  2KNB A;  2L0T A;  4GXB A;  1V6E A;  2PE9 A;  2XBB C;  4FBJ B;  5D7G A;  4F1S A;  4DHJ D;  4KVG B;  3ZW3 A;  5J18 A;  4IG7 B;  4TQ0 A;  2R2Q A;  3A9K A;  4ANX A;  5KHQ A;  4RM8 A;  2JZZ A;  4II2 B;  1KLV A;  2AEH A;  2KLC A;  3IBE A;  3KUD B;  1LM8 B;  4M0W B;  2V1Y A;  3L08 A;  4B6W A;  2D07 B;  1EO6 A;  3OJ4 B;  4GB9 A;  3T9L A;  3L10 B;  5J2R A;  2N7D A;  3V61 A;  3A33 B;  1CMX B;  2G4S A;  1WYW B;  5DPT A;  2KWV B;  1WX8 A;  2DZI A;  2MA9 B;  4LJO B;  4B95 A;  2EMT A;  3HIZ A;  4LDT B;  3SHQ A;  1GC7 A;  3QAQ A;  2B3A A;  3A4S C;  2CS4 A;  4GDL A;  4ZRI A;  3OJ3 A;  4EFO A;  2DAF A;  1GNU A;  2N9E B;  1E7V A;  2DZJ A;  1WI0 A;  2PEA A;  3JVZ X;  4P7I A;  1Z2M A;  3IFW B;  3UIO B;  1KJT A;  1WFY A;  5C23 A;  4HCP B;  1H4R A;  1UBQ A;  3GZN I;  1EF5 A;  1GUA B;  2KKC A;  5AEK B;  2FID A;  3ZRC A;  3TBL D;  3CST A;  2KMC A;  3KH0 A;  3O65 B;  3MHS D;  1E8W A;  1XD3 B;  2J0M A;  3RZF A;  2ZCB A;  3V60 A;  2ZNV C;  2V4L A;  3W1S C;  3K9O B;  2N4F A;  3RUI B;  1AAR A;  3PSE B;  2PE6 B;  2G4D B;  2IYD B;  2G3Q B;  1TGZ B;  2A4Z A;  2DX5 B;  3HM6 X;  2L00 B;  2EKE C;  2M1M A;  2BPS A;  4W9I A;  2N1W A;  1P98 A;  1WM2 A;  3ECI A;  2DZM A;  1YJ1 A;  2KJH B;  4W9K A;  1Q5W B;  5CHV C;  2XEW A;  2XK5 B;  3I3T B;  2KAN A;  3PRE A;  5LXH A;  2JXX A;  5J17 A;  3DBH I;  3DVN U;  2D11 A;  4JL9 A;  2M8S A;  4EZK A;  4G0N B;  2Y5B B;  3ALB A;  1I42 A;  1FXT B;  3QCA A;  3NOB A;  1WX7 A;  3DBS A;  1WGY A;  3APD A;  4ANW A;  3IG3 A;  3PV1 A;  3QJZ A;  5CX3 A;  3ZDT A;  1WGH A;  4BBN C;  5LXI B;  3RYT A;  2RPQ A;  2O2V B;  4IWQ A;  4GN1 A;  2KN5 A;  2L76 A;  3UIP B;  1WR6 E;  4HLE A;  2MRP A;  2OOB B;  4J6I A;  2KQ7 A;  2N9X A;  2NBV B;  4FJZ A;  5JH5 C;  3AXC A;  2MBH A;  3PZD A;  2K6Q A;  2GMI C;  4W9C A;  4IC7 B;  3VUX A;  4DK5 A;  3RCZ A;  4A3P A;  2XK5 A;  1WM3 A;  2WX0 A;  4F8C B;  1R4M I;  3QQ8 B;  1V5T A;  1WGG A;  4G3X B;  2LI5 A;  4TV3 A;  3QAR A;  2HD5 B;  4W9F A;  5CTR C;  1ZKH A;  2RD0 A;  1V86 A;  3KUC B;  3X0W A;  5EDS A;  2O2V A;  3QHT A;  4ZRK A;  4M8N A;  4EEW A;  2ASQ A;  2L0F A;  3DDC B;  2DYB A;  4URK A;  2J0J A;  2IZV B;  5D6J B;  4WWN A;  3TL5 A;  3WAL A;  2EMS A;  1L7Y A;  2CR5 A;  2CU1 A;  2KTF A;  3L13 A;  4KSL C;  4M8M A;  3WA0 A;  1TTN A;  3WIM A;  4ICU A;  3SDL C;  3ZLZ A;  2JRH A;  2IO3 B;  4HXD A;  2W9N A;  2KFK B;  3KVF B;  2JVC A;  3DBR I;  4LDT D;  4IUM B;  4MSQ B;  4RM9 A;  4FLH A;  3WAP A;  4I6P A;  1OQY A;  1S3S G;  2IO1 B;  2BF8 B;  2WWZ A;  3AU4 A;  3IVF A;  3N32 A;  4IWO A;  4HPM B;  4KIK B;  3JSV B;  4ZYN A;  4GMV A;  3ZNG C;  2BYV E;  4WJN A;  1WH3 A;  1C1Y B;  3OLM D;  4W9D A;  3WAO A;  3QWZ B;  3Q3F A;  3K9P B;  1WMH B;  1LXD A;  3ZUN A;  3U7D A;  4MGY E;  4DHZ B;  3TIX A;  3OAW A;  1E8Y A;  2MP2 B;  3JW0 X;  4FA6 A;  3Q3J A;  3B0A A;  1E90 A;  4MEL A;  4MH0 E;  3V6E B;  4W9L A;  1WE6 A;  3VAW A;  4EUT A;  3ENE A;  1L2N A;  4PS3 A;  1V49 A;  4ZDV A;  2FCS A;  2KFK A;  4KZ0 A;  3PS6 A;  2K8C A;  1IP9 A;  2HTH A;  2WDT B;  1SGH A;  4IM3 A;  4EZJ A;  1WJN A;  4K1R B;  3VH3 B;  1T0Y A;  4GIV A;  3VXW A;  4WAA A;  4GU2 A;  5E6N A;  4AP4 C;  1YD8 U;  4KIK A;  3JSV A;  1S1Q B;  4AJY B;  1A5R A;  1WGR A;  1RLF A;  2FCQ A;  3BY4 B;  4NNJ B;  4DDG D;  2KFJ A;  2RSU A;  1V81 A;  3EFU A;  4DWF A;  2KZR A;  1WMH A;  3RD2 A;  3UQB A;  1NDD A;  4NJ6 A;  1M94 A;  2FUH B;  2KXJ A;  3IHP C;  4K7W A;  1QZE A;  2MCN B;  2NBU A;  2YLM A;  2MP2 A;  1VCB A;  2K1F A;  4MSM B;  3APC A;  3D32 A;  2LRW A;  3A4R A;  4NQL B;  3ZVV A;  3PRP B;  4WWP A;  4W9J A;  5D2M B;  2JUO A;  3ZNZ B;  2KWU B;  4DHZ E;  2GOW A;  3APF A;  4XX5 A;  2UWQ A;  5AZH A;  1PQS A;  1WXS A;  4KSK C;  3UQA A;  2JF5 A;  3L17 A;  4PYU A;  5LLI A;  1UH6 A;  1E8X A;  2ZVN A;  2LGX A;  1YX6 B;  3NHE B;  3CF6 E;  1KM7 A;  2PPH A;  1WR1 A;  3DPD A;  1XQQ A;  3VTU A;  3ZTC A;  2J7Q B;  4MGI E;  3ZKJ C;  4FJY A;  2KDE B;  2MBE A;  3MJW A;  2C9W B;  3PGE A;  2JY6 A;  3LJ3 A;  2DEN B;  2KQS A;  2M4N A;  3WAN A;  3KYD D;  2R2O A;  3RZW C;  4WJP A;  1WGD A;  2IBI B;  2I1J A;  4WJO A;  2QHO A;  1YIW A;  4II3 B;  4JGH B;  2HJ8 A;  4OVV A;  1K8R B;  2NS5 A;  3VUY A;  3QK0 A;  2NPT B;  4HCN B;  3H7S A;  4CYE A;  3PHW B;  4ICV A;  4BKG A;  4G50 A;  2LVP A;  3ZIM A;  4ANV A;  1WY8 A;  4WWO A;  1P3Q U;  4OVU A;  3DVG Y;  4HPL B;  3L54 A;  2BYF A;  1U4A A;  3HK0 A;  3QA8 A;  5L95 C;  1EF1 A;  3ML8 A;  5BO4 B;  1ISN A;  4G11 A;  4AOF A;  5IA7 A;  5CHF A;  3DOW A;  3VHT C;  3DVN V;  1WE7 A;  3WAM A;  3JYU A;  4NY0 A;  3PLU A;  4HVB A;  4HWI B;  1UZX B;  4HJK A;  4TQ1 A;  3DVG X;  3H1U A;  3M63 B;  5JZE B;  2HE7 A;  2MWS B;  3C0R B;  2L05 A;  1V9J A;  4FAD A;  3PPA A;  2LXA A;  2KDB A;  2MW5 A;  2D10 A;  2N9P C;  4K7S A;  3DQV A;  3A9J B;  4MDK E;  2JT4 B;  3VTW A;  3TCA A;  1SE9 A;  2NPT A;  2LWP A;  2MLB A;  2GBN A;  2WX1 A;  1Q1O A;  5G55 A;  3S2A A;  4XZ4 A;  4BVU C;  2NVU I;  3A1Q B;  2KC2 A;  2K8H A;  3T8M A;  2CHZ A;  2ZJD A;  2C7N B;  2L8J A;  2BYE A;  1E7U A;  4DBG A;  2JWZ A;  2L7R A;  4I6L B;  1V80 A;  2C5L C;  1BT0 A;  1UD7 A;  1WJ4 A;  3CMM B;  3NZS A;  4BKT A;  2KJR A;  2AL3 A;  1WF9 A;  3H6N A;  4CO7 A;  2KDI A;  4MEM A;  1VD2 A;  3AU5 A;  2M0X A;  2KOX A;  4TKN A;  3PT2 B;  4AJW A;  2L3Z A;  2KHW B;  3AUL A;  3VQI A;  3EEC A;  4GOC A;  2K25 A;  1Z5S B;  4KZC A;  2PJH A;  1R4N I;  4MJS B;  4ASW C;  3A9J A;  4GDK B;  2KTR B;  3UF8 A;  1JRU A;  1WZ3 A;  2KWC A;  1HE8 A;  5FR6 A;  3A1Q A;  3W1Y A;  2BKF A;  4DDI D;  3QX1 A;  4BOS C;  1LFD A;  1Q0W B;  2YVC A;  4EKU A;  3PRZ A;  1TZ1 A;  1UBI A;  2RGF A;  3EC8 A;  4WJQ A;  3SU8 X;  2KX0 A;  4XC2 A; 
#chains in the Genus database with same CATH topology
 4MM3 B;  5JHA A;  2LVO A;  1UGM A;  1MFW A;  2GBJ A;  5IAA C;  1X1M A;  3NUH B;  1I35 A;  1UWM A;  3RNG C;  2KTR A;  2LJ5 A;  3BK2 A;  1G6J A;  5BYQ A;  2M17 A;  4K7U A;  1YMH E;  2ZZP B;  2JYE A;  2KJ6 A;  3MP9 A;  2KAJ A;  1FNW A;  2KO3 A;  4CHK A;  2G9H D;  2VZK D;  1KFY B;  1XT9 B;  3L16 A;  1RFK A;  4BKS A;  1FMA D;  1GG3 A;  4IM0 A;  3R3M A;  2MEK A;  2WXR A;  2JXT A;  3ETR A;  1GPX A;  1FO4 A;  1JWA D;  1FNV A;  3L0W B;  1E8Z A;  2C7M B;  2WXH A;  3R66 C;  1RAX A;  1TBE A;  1UUP A;  2BGF A;  3SD5 A;  3PVL A;  1UEL A;  3BWU D;  2FAZ A;  2FE8 A;  3DWM A;  1MJD A;  2PVG C;  1TS4 A;  2MBB B;  3Q8B A;  1D3Z A;  1NBF C;  2KK8 A;  3NZU A;  5CHW A;  4I6N B;  1AWD A;  3ZNH B;  5FR3 A;  4EOY A;  2E6X A;  4PS8 A;  1YQ4 B;  2X8X X;  1ZXI A;  1RRB A;  2GBM A;  4GSW A;  5HKH A;  2ONQ A;  4FHJ A;  2K39 A;  4TMA B;  1L6U A;  1V97 A;  3H9D A;  3GS2 A;  2FCN A;  1NI3 A;  2ZPY A;  5BYS A;  2KDF B;  3FIL B;  3B08 A;  4BOZ B;  2JRI B;  2JX5 A;  1YX5 B;  2KYW A;  4PK1 A;  2KD0 A;  4JWS C;  1HA5 A;  2YEP F;  1OEY A;  3UIN B;  3P2B A;  2WQY B;  3NY5 A;  3NS8 A;  3MFG A;  2LZ6 A;  2CHX A;  4HDO A;  1ZDV A;  5LNK 1;  1IYF A;  4HJG E;  1F9J A;  1P1A A;  3M3J A;  1DOY A;  1UNS A;  2AWT A;  3LDZ E;  4LNF A;  1TS2 A;  2E3T A;  2L52 A;  4IW0 A;  3W1S A;  2K8B A;  4FJV B;  2FNJ B;  2KT7 A;  5DPW A;  4AUQ C;  2LXC A;  5H92 C;  3T3N A;  2Y3A A;  2XBB C;  1Y56 A;  1JAL A;  2R2Q A;  4P1B C;  3A9K A;  4ANX A;  1WGK A;  4RM8 A;  4L1B A;  1F0Z A;  2JZZ A;  1KLV A;  2AEH A;  3IBE A;  1LM8 B;  4JX1 C;  4RF0 A;  1CMX B;  1WYW B;  1YJI A;  4B95 A;  2MJE A;  3SHQ A;  3P4R B;  3AE4 B;  2AQ2 B;  2B3A A;  3HUI A;  3OJ3 A;  2WLB A;  2DAF A;  2IJ0 A;  1E7V A;  3UIO B;  3EGR A;  1QOF A;  4N58 A;  3ZRC A;  3TBL D;  3CST A;  3MHS D;  2PMV A;  1IBX A;  1XD3 B;  3RZF A;  2V9H A;  3V60 A;  3P4Q B;  3K9O B;  1KRH A;  2G4D B;  3HM6 X;  2G3Q B;  2DX5 B;  2L00 B;  2M1M A;  4W9I A;  4KKJ A;  2AQ1 B;  2DZM A;  4W9K A;  3EA6 A;  5LXH A;  3NVV A;  2M8S A;  1I42 A;  1FXT B;  4YTP B;  3NOB A;  3IG3 A;  4BBN C;  5LXI B;  2CJN A;  2O2V B;  4GN1 A;  1D6E C;  2WU5 B;  2MBH A;  3PZD A;  3AEB B;  4W9C A;  3Q3O C;  4A3P A;  1KLG D;  1IGC A;  3NG0 A;  4F8C B;  1V5T A;  1DOI A;  1VZ8 A;  1PGX A;  3GE8 C;  1QKZ A;  3N1X C;  4W9F A;  5CTR C;  1V86 A;  4ZRK A;  4MH8 A;  3PZ8 A;  2ASQ A;  2L0F A;  4EEW A;  3DDC B;  2DYB A;  2J0J A;  2IZV B;  3HVD A;  2EMS A;  4USA A;  1L7Y A;  3WAL A;  2CU1 A;  2KTF A;  1TTN A;  4HKZ E;  4HXD A;  4IUM B;  4OZC A;  4MSQ B;  3IT4 B;  4I6P A;  2IO1 B;  1FXI A;  2WWZ A;  3IVF A;  4KIK B;  3JSV B;  2D5G A;  2BYV E;  1QLB B;  1WH3 A;  3QWZ B;  2Q5W D;  3AE3 B;  5H8Y E;  1WMH B;  2HTM E;  3NRZ A;  4DHZ B;  3C19 A;  1D4B A;  2Y5P A;  4GLS C;  3Q3J A;  3B0A A;  1E90 A;  4MH0 E;  5I4D A;  3BYY B;  3VAW A;  3IAS 1;  1IP9 A;  2WDT B;  1SGH A;  4YXD B;  4REZ A;  1S1Q B;  3BVM A;  2FCQ A;  3BY4 B;  1HXY D;  4NNJ B;  4WQM A;  1I4R A;  1I4G A;  2WXQ A;  3V05 A;  1NDD A;  4NJ6 A;  1M94 A;  2FUH B;  3B9J A;  4K7W A;  2YLM A;  2D3C A;  2MP2 A;  1VCB A;  1F2R I;  4DXG A;  5HFY A;  3APC A;  3D32 A;  2LRW A;  2LEK A;  2QJL A;  1SJE D;  3PRP B;  4RF1 A;  4A8X C;  2KWU B;  2GOW A;  4XX5 A;  5AZH A;  1AN8 A;  1PQS A;  2WXM A;  3UQA A;  2JF5 A;  5LLI A;  1UH6 A;  2KWD A;  1KM7 A;  2PPH A;  3VTU A;  2J7Q B;  4FJY A;  1I4Q A;  2C9W B;  3MJW A;  3PGE A;  3LJ3 A;  1FNU A;  2M4N A;  3WAN A;  2I1J A;  4II3 B;  1NEK B;  2RDH A;  1K8R B;  3RPF C;  3VRB B;  3VUY A;  2V3P A;  4NAM A;  2NPT B;  4HCN B;  1CQV A;  4ICV A;  3AH7 A;  2LVP A;  4OVU A;  4HPL B;  3HK0 A;  5L95 C;  4AOF A;  2INN E;  3VHT C;  4YSY B;  3WAM A;  3VR9 B;  4HVB A;  1FRD A;  3C0R B;  2L05 A;  3BYT B;  2LXA A;  3PPA A;  2D10 A;  3L4P A;  2WX1 A;  3S2A A;  3DBR B;  2NVU I;  2BYT A;  2K8H A;  1PUT A;  1F2R C;  3P1M A;  1HTO A;  2JWZ A;  4I6L B;  4JWU C;  2CU3 A;  3NZS A;  3I9V 1;  3RNB C;  4K3B A;  4MEM A;  3PZ7 A;  1VRA B;  3PT2 B;  2KHW B;  3VQI A;  2EEL A;  2WDR B;  1TY0 A;  4LNN A;  2WXP A;  1R4N I;  3A9J A;  2KTR B;  3UF8 A;  1JRU A;  1QOA A;  3AE1 B;  1K53 A;  1DGJ A;  3A1Q A;  3W1Y A;  3RI7 C;  1V1P A;  3AE6 B;  2YVC A;  4EKU A;  1E9M A;  5TSS A;  3PRZ A;  1TZ1 A;  2FUG 1;  3EC8 A;  4WJQ A;  2K6D B;  2J0K A;  1KTK A;  4RMA A;  5AZF A;  1WXM A;  3IAM 1;  3QC8 B;  2LGY A;  1C4C A;  3VFK A;  5IO9 A;  1M4V A;  4MJS A;  2MQJ A;  2KC1 A;  1BUI C;  4LK0 M;  1B9R A;  3PRM B;  2B76 B;  4FHK A;  3Q8C A;  2KVR A;  1ZUD 2;  3R2T A;  2W3R A;  4JIO U;  4WIP A;  3ZO5 B;  4H2A A;  1VDV A;  4NAW A;  4FUL A;  2IGD A;  2ACZ B;  1OTR B;  3KYC D;  1H8C A;  1SJH D;  2O6V A;  5AUK A;  3EHV A;  4ZRP A;  1CZP A;  2PTL A;  2MBQ A;  3TEZ A;  1GOZ A;  3DHH C;  3AE5 B;  3TMP B;  2Z0E B;  1RYJ A;  2NCN A;  3V62 A;  1LQB A;  3ZRF A;  5JHB A;  4ZRJ A;  1T0S C;  1WX9 A;  2GLS A;  5G2N A;  3KUZ A;  3HM3 A;  4QAY A;  2ZVO A;  4B9K A;  4JQW C;  1WJ6 A;  3X23 A;  4N59 A;  4BFR A;  3QIJ A;  2ICI A;  3W5V B;  2I1K A;  1WJU A;  1EU4 A;  1TY2 A;  2Z0D B;  3LXF A;  2LGD A;  4YL8 A;  4DXF A;  3H7P A;  1GB4 A;  2J42 A;  4C4V A;  4P1C C;  2KDM A;  2LFI A;  3WCQ A;  2GBK A;  1OGW A;  4YSZ B;  1F52 A;  2Z59 B;  1YJJ A;  2ZNV B;  2BVC A;  3FKY A;  4BKS D;  5E6J A;  1LO5 D;  2DNF A;  2LD9 A;  4OW0 A;  1C3T A;  1QOG A;  1RWS A;  1EWY C;  2MJD A;  4RGO S;  1P9D U;  2D3A A;  1UGJ A;  2AX5 A;  4PYZ A;  4W9E A;  2ZCC A;  2MBO A;  3A9K B;  1RFA A;  4XDC A;  4ZHP A;  4KV2 A;  5EE3 A;  3PLV A;  3BIN A;  2REX A;  2C60 A;  1J19 A;  3BVG A;  1N5W A;  1QT9 A;  2JZ3 B;  2MSE D;  1WWT A;  3MC0 B;  2BKR B;  2BWE S;  1YOV B;  2OJR A;  1V6E A;  2PE9 A;  4F1S A;  2OHF A;  4KVG B;  4OHJ A;  2OED A;  3ZW3 A;  5J18 A;  2W82 A;  4TQ0 A;  4II2 B;  1SE2 A;  3KUD B;  3NVY A;  2D07 B;  1BML C;  3SFD B;  4GB9 A;  3OJ4 B;  1IBX B;  5J2R A;  1MG4 A;  2IDY A;  4IOI E;  3A33 B;  5DPT A;  2DZI A;  4LJO B;  2EMT A;  1XEE A;  4LDT B;  3A4S C;  4GDL A;  4EFO A;  1L0V B;  1D5X C;  2N9E B;  2PEA A;  1XCQ L;  1D5Z C;  1KJT A;  4HCP B;  3I63 C;  1I7H A;  3AEE B;  1N5X A;  1XLN A;  1KLU D;  1E8W A;  1NYR A;  2ON8 A;  4K3C A;  2ZCB A;  4KX6 B;  2ZNV C;  2M0A A;  1VLB A;  2KAC A;  3W1S C;  2LUM A;  2PVO D;  3PSE B;  1HQR D;  2A4Z A;  2QSD A;  1P98 A;  1WM2 A;  3ECI A;  1YJ1 A;  2KJH B;  2IPK D;  1Q5W B;  3Q3M C;  1CK1 A;  3PRE A;  2SEB D;  2Y5B B;  2BQQ A;  1VR9 A;  1WX7 A;  5G5H A;  4ANW A;  3ZDT A;  4YTM B;  1WGH A;  3R2I A;  2RPQ A;  2OOB B;  2NBV B;  1ZXH A;  5JH5 C;  1I4X A;  3VUX A;  1WRI A;  3RCZ A;  4HRS A;  2JYT A;  2XK5 A;  4M00 A;  3KWL A;  2WX0 A;  2MJ3 A;  3I57 A;  4M01 A;  1NEN B;  4LLG M;  5G5G A;  2WU2 B;  2J52 A;  2LI5 A;  1JCK B;  2HD5 B;  1ZOY B;  2RD0 A;  5EDS A;  2KQ4 X;  1HZ6 A;  4M8N A;  2K5P A;  2NMQ A;  3RN9 C;  1FEH A;  2K22 A;  3TL5 A;  1FCL A;  4KSL C;  2MH7 A;  4ICU A;  3SDL C;  2L1A A;  2IO3 B;  2BS2 B;  2JVC A;  5BMH A;  4LDT D;  1TKE A;  4ZRQ A;  4RCO A;  3RFZ B;  2JWU A;  1S3S G;  3Q6B A;  4IWO A;  3ZNG C;  4ZYN A;  1PYW D;  4YTN B;  3SEB A;  1F77 A;  2WXO A;  4MGY E;  4A9A A;  4XGA B;  3OAW A;  2MP2 B;  4W9L A;  1V49 A;  2KFK A;  3PS6 A;  2HTH A;  2K3U A;  5HI1 A;  4EZJ A;  1WJN A;  1T0Y A;  5E6N A;  2PKO A;  1OFF A;  1NYQ A;  1YD8 U;  4AJY B;  4AP4 C;  1RM6 C;  1A5R A;  1WGR A;  1RLF A;  2DWQ A;  4WWM A;  1V81 A;  4PT5 A;  3UQB A;  2KXJ A;  1QZE A;  2NBU A;  1FFU A;  4MSM B;  3A4R A;  1TT5 B;  4W9J A;  1UWX A;  4DHZ E;  4BAX A;  4YT0 B;  1C77 A;  2QCZ A;  1STE A;  3LYY A;  1GB1 A;  3L17 A;  2RDG A;  2ZVN A;  2LGX A;  1YX6 B;  3W2D A;  1T6B X;  3DPD A;  4MGI E;  3ZKJ C;  1K51 A;  3CWI A;  1JW9 D;  4N6E B;  4WJP A;  2BBC A;  1VZ6 A;  1L6V A;  1YIW A;  1PGB A;  4UDU C;  2NS5 A;  5EE1 A;  2D3B A;  1TJE A;  2LHE A;  3H7S A;  3RNC C;  1J7C A;  3TUO A;  3PHW B;  4G50 A;  3ZIM A;  4WWO A;  1K50 A;  1P3Q U;  2I2Y A;  3L54 A;  2BYF A;  3QA8 A;  5BO4 B;  1ISN A;  2KN4 A;  5CHF A;  1PGA A;  3JYU A;  4NY0 A;  4B0M A;  4WH4 A;  3DVG X;  3M63 B;  3KLS X;  4D2K A;  1TS3 A;  2N9P C;  1OQQ A;  4K7S A;  3DQV A;  3A9J B;  3VR8 B;  3VTW A;  3TCA A;  1D5M C;  3A1Q B;  1V1P B;  1AYF A;  2CHZ A;  3U52 E;  1E7U A;  2L7R A;  3AMZ A;  2C5L C;  3CMM B;  1BT0 A;  1WJ4 A;  3DBL B;  4BKT A;  2AL3 A;  1WF9 A;  3H6N A;  1VD2 A;  4IKG A;  4AJW A;  2W3S A;  3EEC A;  2OJW A;  2PJH A;  1ROE A;  4ARI A;  4MJS B;  1T3Q A;  4ASW C;  1WZ3 A;  2KWC A;  3BK1 A;  3RNF C;  1HE8 A;  3TEW A;  3P42 A;  3QX1 A;  5BMG A;  3OWE B;  1Q0W B;  3ZQ4 A;  1UBI A;  2PLP A;  2KX0 A;  4NAW B;  2BT6 A;  4P6V F;  1KOT A;  3P63 A;  1FXA A;  4M02 A;  3RT3 B;  4JLC A;  1P7F A;  2O6V B;  2CHW A;  3PTF C;  4EZL A;  3AEF B;  2GI9 A;  4P16 A;  2WS3 B;  3V6C B;  3OG5 A;  3TJP A;  1T0Q C;  3HHM A;  1CJE A;  2IGH A;  3VH4 B;  2D2Q A;  3ZJU A;  1ZGU B;  1JML A;  4US8 A;  1P7E A;  2DYO A;  1R7S A;  5D94 A;  2LVQ A;  3LB8 C;  2WP9 B;  1ZP0 B;  4DHJ B;  3NS1 A;  2JPH A;  1Y8R C;  5EE9 A;  3ZDM C;  5TR5 A;  1FCC C;  1JWS D;  4J3O D;  5BYR A;  4ANU A;  4XWW A;  2N1V A;  3P4P B;  3BII D;  4MGZ E;  3ZNI D;  1XCT L;  4NJ7 A;  2PIA A;  4F7Z A;  2CKH B;  3H7P B;  2BWF A;  1KF6 B;  1MG8 A;  1WYG A;  4A20 A;  4AWJ A;  5DPS A;  4C4V B;  1QOB A;  1WIA A;  1BXT A;  1OEY J;  1C76 A;  1IUE A;  1WXA A;  1ZPS A;  2LAS A;  2K9X A;  3CSF A;  4PS7 A;  5GMV A;  3AED B;  1GC6 A;  3RMK C;  1V2Y A;  1LGR A;  2DZK A;  3ONS A;  3MTN B;  4E74 A;  4RGT A;  2KMA A;  2LMC A;  5BMI A;  3DCG A;  2RR9 A;  1IPG A;  4L2Y A;  1PDX A;  3VUW A;  3M62 B;  1SIF A;  1R4N B;  2D3G A;  1WXV A;  2O6V D;  2WXI A;  1J0G A;  3M95 A;  1ESF A;  3N3K B;  2NR2 A;  3B1L X;  1YN3 A;  2HDE A;  4KDL B;  2NTT A;  1V8C A;  1I4P A;  1EUV B;  2G45 B;  4IM2 A;  2QMT A;  4LCD E;  5AUI A;  2WXJ A;  1YQB A;  2DAJ A;  2IY0 B;  3ML9 A;  3N30 A;  3Q8F A;  5DCN A;  1N62 A;  4GDL B;  2KMM A;  1E10 A;  4DHJ D;  1J7B A;  3ZXR A;  1MHH E;  1MI0 A;  2KLC A;  2WXL A;  4LNK A;  4B6W A;  4OZB A;  4US9 A;  1EO6 A;  3T9L A;  1MVK A;  3L10 B;  4ITK A;  2INP E;  2BTE A;  4HPP A;  3IXS A;  2MA9 B;  3HIZ A;  1GC7 A;  1XLP A;  3QAQ A;  4DQO C;  1GNU A;  1SE3 A;  2DZJ A;  1WI0 A;  3GB1 A;  3JVZ X;  1Z2M A;  3IFW B;  1WFY A;  2V4I B;  1SXT A;  1UBQ A;  3GZN I;  1EF5 A;  4KGT A;  5AEK B;  4ACF A;  4M0W A;  2KMC A;  3KH0 A;  3O65 B;  3AE2 B;  4B0E A;  3Q2A C;  3GP7 A;  2N4F A;  1TIF A;  3KQ4 A;  1AAR A;  5C2T B;  2PE6 B;  1TGZ B;  3GE3 C;  2EKE C;  2BPS A;  2N1W A;  3B2G A;  5CHV C;  2XEW A;  2XK5 B;  5MPO A;  3I3T B;  2KAN A;  2JXX A;  5J17 A;  3DBH I;  3DVN U;  2D11 A;  3BVZ A;  4G0N B;  3ALB A;  1NVI D;  3PV1 A;  3QJZ A;  5CX3 A;  3URY A;  4IWQ A;  2KN5 A;  2L76 A;  3UIP B;  1WR6 E;  3Q8E A;  4HLE A;  2MRP A;  4J6I A;  2KQ7 A;  2N9X A;  4FJZ A;  4RNA A;  2DBY A;  5D3I B;  3I5J C;  2K6Q A;  2GMI C;  4IC7 B;  4DK5 A;  4CQN A;  3U2S C;  1VJK A;  1R4M I;  2JU6 X;  1C9F A;  1WGG A;  5IP4 D;  4G3X B;  2WXN A;  3QAR A;  1ZKH A;  3KUC B;  2SAK A;  3FC4 A;  4ZHO A;  3AN1 A;  2WXF A;  5D6J B;  2WGS A;  2JQR B;  1SSN A;  2FBW B;  3ZLZ A;  2JRH A;  2W9N A;  2KFK B;  5IKC M;  4RM9 A;  4FLH A;  3WAP A;  1OQY A;  2BF8 B;  4EZK A;  3AU4 A;  4HPM B;  2N7J A;  1FFV A;  4L23 A;  1YN5 A;  4WJN A;  1C1Y B;  2W55 A;  1JRO A;  1N6Z A;  3Q3F A;  3K9P B;  3DWG C;  1N60 A;  3TIX A;  4MEL A;  3ENE A;  4PS3 A;  2FCS A;  2ZW1 A;  4RH6 A;  3N20 C;  4IM3 A;  4MAC A;  3J9C A;  4K1R B;  1HTQ A;  4GIV A;  1VZ7 A;  2KFJ A;  4DWF A;  2KZR A;  3RD2 A;  1DOX A;  1TKG A;  3IHP C;  3MJ5 A;  1T0R C;  4KGR A;  2WNM A;  2K1F A;  4EE2 A;  1E0Z A;  1ZDX A;  4NQL B;  3ZVV A;  4AQ7 A;  5D2M B;  3NVZ A;  3C8Y A;  3HVZ A;  4ZOH C;  2TSS A;  3AEA B;  3IT6 B;  2UWQ A;  2GRI A;  2R61 A;  2H89 B;  4PYU A;  2I38 A;  1E8X A;  3CF6 E;  3ZTC A;  1XXG A;  1YNT E;  4OVZ A;  3O13 A;  2KQS A;  3KYD D;  2R2O A;  1WGD A;  2IBI B;  3MC9 A;  4O1N A;  4JGH B;  3FAH A;  1XLQ A;  2JZP A;  1WXQ A;  2QIL A;  1U4A A;  3TSS A;  2YEP B;  1EM7 A;  5IA7 A;  1C79 A;  4HWI B;  2UU7 A;  4HJK A;  4TQ1 A;  5JZE B;  3H1U A;  3VRA B;  2HE7 A;  1QF6 A;  1V9J A;  2KDB A;  1TS5 A;  5D3D A;  2JT4 B;  1SE9 A;  1JRP A;  2LWP A;  1Q1O A;  5G55 A;  4XZ4 A;  2KC2 A;  1XLO A;  2ZJD A;  2C7N B;  3W5U B;  2BYE A;  4DBG A;  2WHI A;  1V80 A;  1UD7 A;  2AQ3 B;  3N1Y C;  2KDI A;  5T8I A;  3AU5 A;  2KOX A;  1HZ5 A;  3AUL A;  1SBB B;  1Z5S B;  2Y5C A;  5C3J B;  1L5P A;  3TEY A;  1TZO A;  2BKF A;  1C4A A;  1L0Y B;  2V3N A;  2RGF A;  4WAF A;  2ZPN A;  4KGS A;  4KDI C;  4HDQ A;  4IWP A;  5E6O A;  3BZD B;  3VTV A;  3ZYY X;  3SR6 A;  3PO0 A;  4BBN F;  3NVW A;  4E71 A;  1V1O A;  2N7E A;  4RFB A;  4GDK A;  2C7H A;  3ZTD A;  2AYO B;  3AB5 A;  2V3S A;  4C00 A;  2LRU A;  4GGQ A;  3GOE A;  2NBW B;  4LJP B;  1GJZ A;  2M56 B;  4MM3 A;  3R8B A;  2PW9 A;  4N9F 4;  1J8C A;  4S17 A;  3R7Q A;  2DHZ A;  1E7P B;  1B1Z A;  2FCM A;  4E3C A;  1SEB D;  5JXV A;  2KVZ A;  3R7R A;  2DYM A;  1SIJ A;  1ZW7 A;  5KHO A;  1WZ0 A;  3H8H A;  5DPR A;  3SFE B;  1T5X D;  1OQR A;  2WDV B;  4X57 B;  2KLG A;  3W9C B;  4FN2 A;  2VRR B;  2INC C;  1ACC A;  4W9H A;  5AZG A;  3UI3 A;  4S0R A;  2RMM A;  3NZ3 A;  3VVW B;  4W9G A;  4A3O A;  5EE0 A;  2QIE B;  1P0R A;  2AL6 A;  4NPN A;  3RNA C;  4WQO B;  4K81 A;  2GBR A;  3ZGZ A;  5C1Z A;  3RUL A;  2IO2 B;  2MX2 A;  1ET6 A;  1V5O A;  1ET9 A;  2WYQ A;  1SE4 A;  1ENF A;  4C80 A;  2UYZ B;  3UGB B;  3AE9 B;  1SF0 A;  1HEZ E;  5E6P A;  5FKA C;  1A70 A;  3AEG B;  3ZJT A;  3T3O A;  3U8Z A;  2H88 B;  3PHX B;  1WRD B;  2IY1 B;  3AI5 A;  2GB1 A;  2LUE A;  1ZE3 D;  1E5W A;  2A5U A;  3NJT A;  2FIF A;  4DXA B;  1TYG B;  2ZEQ A;  2IO0 B;  3ZXV A;  4HK2 A;  1MHX A;  3FIL A;  4NQK E;  4YWG G;  2KX3 A;  2HJ1 A;  1JWU D;  1SB3 C;  4MGK E;  1JWM D;  5L83 A;  3DBL I;  1NI2 A;  1E6E B;  3KW5 B;  5IOI A;  3U30 A;  3VDZ A;  1JQ4 A;  4TUU A;  4GXB A;  2KNB A;  2L0T A;  1QIL A;  3P4S B;  4FBJ B;  5D7G A;  4IG7 B;  4XE0 A;  3U7Z A;  5KHQ A;  4YSX B;  2IND C;  4AS1 A;  4M0W B;  2V1Y A;  3L08 A;  2N7D A;  3V61 A;  2G4S A;  2KWV B;  1WX8 A;  1AW7 A;  3MHZ A;  4ZYS A;  4ZRI A;  2CS4 A;  2J4X A;  4P7I A;  3Q14 C;  1GAQ B;  3AM9 A;  5C23 A;  3RNE C;  1H4R A;  1GUA B;  2KKC A;  2FID A;  2X38 A;  3N9Y C;  4XDD A;  4C7Z A;  2J0M A;  4WUR A;  1FD6 A;  1J7A A;  2LHD A;  5FK9 C;  2V4L A;  2ZW0 A;  4NJC A;  3RUI B;  2IYD B;  1L4D B;  3DHG C;  5HHD G;  4ARC A;  2WXK A;  3E56 A;  2RPV A;  3V3X A;  4JL9 A;  1PFD A;  3QCA A;  1K52 A;  4XYC A;  3DBS A;  1WGY A;  3APD A;  3RYT A;  2K0P A;  2QDF A;  4JE3 B;  1KH0 A;  4XWT A;  3AXC A;  2VH1 A;  1C4P A;  3Q8A A;  4HEA 1;  3N1Z C;  1WM3 A;  3B2F A;  3AEC B;  3QQ8 B;  2QC8 A;  4RGN A;  4TV3 A;  2EKI A;  3U4E G;  3X0W A;  2BS3 B;  2O2V A;  3QHT A;  2RDB C;  1JWB D;  2WXG A;  2N9L A;  2M19 A;  3ZJV A;  4URK A;  2DLB A;  2W54 A;  4WWN A;  1FPY A;  2CR5 A;  4NZL B;  3L13 A;  3CIR B;  4M8M A;  3WA0 A;  3WIM A;  3KVF B;  3DBR I;  2N0S B;  3AE8 B;  4HRO A;  1YN4 A;  3N32 A;  4GMV A;  4IDI A;  3WAO A;  3OLM D;  4W9D A;  1L0X B;  3ZUN A;  1LXD A;  3Q3N C;  3U7D A;  1YQ3 B;  4LNI A;  1E8Y A;  3JW0 X;  4FA6 A;  4EUT A;  3V6E B;  4C7Y A;  4FXC A;  1WE6 A;  1L2N A;  4ZDV A;  4KZ0 A;  4KKI A;  2K8C A;  2JSV X;  2BB6 A;  3VH3 B;  4LNO A;  3VXW A;  4WAA A;  4GU2 A;  4KIK A;  3JSV A;  3KWV A;  4DDG D;  2XN9 C;  2RSU A;  3EFU A;  3GZN B;  1WMH A;  3EFC A;  2LJI A;  2N9K A;  3DHI C;  3HRD D;  4MT5 A;  2MCN B;  1EWC A;  4OZA A;  2V0G A;  3ABV B;  4WWP A;  1F1H A;  1Q10 A;  2JUO A;  1FIQ A;  3ZNZ B;  3APF A;  1QQR A;  2BB5 A;  2BW2 A;  1WXS A;  4KSK C;  3DBH B;  2QEJ C;  1FM0 D;  1IGD A;  3TEX A;  3NHE B;  4R3D A;  2MHJ A;  1WR1 A;  1XQQ A;  2G1E A;  2KDE B;  2MBE A;  2LGI A;  2VH2 A;  2JY6 A;  2DEN B;  2BS4 B;  1N63 A;  3RZW C;  1L4Z B;  1WSP A;  4WJO A;  2QHO A;  3EUB 2;  2HJ8 A;  4OVV A;  2VZK B;  5GXG B;  3QK0 A;  3MC8 A;  4C56 C;  4CYE A;  4A6Q A;  4BKG A;  1R4M B;  4ANV A;  1WY8 A;  3DVG Y;  1EF1 A;  3ML8 A;  4G11 A;  4BZA A;  4Q2J A;  1XO3 A;  3DOW A;  1EU3 A;  3DVN V;  1WE7 A;  2CJO A;  3E9S A;  3PLU A;  2L32 A;  1UZX B;  2MWS B;  4FAD A;  1TKY A;  2MW5 A;  4LTU A;  4MDK E;  2NPT A;  2MLB A;  2GBN A;  4BVU C;  1MPE A;  2NTS A;  5IN7 A;  3T8M A;  4HKQ A;  2L8J A;  4RGM A;  2Z8L A;  4TSS A;  5HG2 A;  2KJR A;  4CO7 A;  1FRR A;  2XNA C;  4JPS A;  4TKN A;  2M0X A;  2L3Z A;  4GOC A;  2K25 A;  1C78 A;  4KZC A;  1DYQ A;  1XF5 L;  1I4H A;  2L83 A;  1UF0 A;  4GDK B;  2WDQ B;  1N61 A;  2J53 A;  5FR6 A;  2LGS A;  4DDI D;  4A90 A;  4BOS C;  1LFD A;  2IGG A;  3Q69 A;  4A55 A;  3AE7 B;  3SU8 X;  4XC2 A;  3AV8 A; 
#chains in the Genus database with same CATH homology
 2ZPN A;  5JHA A;  2K6D B;  2LVO A;  4KDI C;  4HDQ A;  2J0K A;  4IWP A;  4NAW B;  4RMA A;  5E6O A;  5AZF A;  3VTV A;  1WXM A;  1KOT A;  1UGM A;  3QC8 B;  2LGY A;  3VFK A;  3RT3 B;  2GBJ A;  5IAA C;  4BBN F;  1X1M A;  4E71 A;  1I35 A;  4MJS A;  2N7E A;  2MQJ A;  2KC1 A;  4GDK A;  4JLC A;  2C7H A;  2KTR A;  2LJ5 A;  3ZTD A;  2AYO B;  2O6V B;  1G6J A;  2V3S A;  2M17 A;  4K7U A;  2CHW A;  3PTF C;  4EZL A;  2LRU A;  2ZZP B;  3PRM B;  4FHK A;  4GGQ A;  2KVR A;  3GOE A;  2KJ6 A;  2NBW B;  3V6C B;  4LJP B;  3TJP A;  1GJZ A;  3HHM A;  4CHK A;  2KO3 A;  4JIO U;  4MM3 A;  3ZO5 B;  4NAW A;  3VH4 B;  1XT9 B;  3L16 A;  4FUL A;  2D2Q A;  1ZGU B;  4N9F 4;  1J8C A;  2DYO A;  3R7Q A;  2DHZ A;  4BKS A;  2FCM A;  1GG3 A;  5D94 A;  1OTR B;  4E3C A;  4IM0 A;  3KYC D;  3R3M A;  3R7R A;  1H8C A;  2LVQ A;  2DYM A;  2O6V A;  1ZW7 A;  3EHV A;  5KHO A;  4DHJ B;  1WZ0 A;  2JPH A;  1Y8R C;  5DPR A;  3ZDM C;  5TR5 A;  2MBQ A;  3L0W B;  1E8Z A;  2C7M B;  4ANU A;  3TMP B;  2N1V A;  2Z0E B;  3R66 C;  2NCN A;  4MGZ E;  4X57 B;  3V62 A;  3ZNI D;  1LQB A;  2KLG A;  3ZRF A;  5JHB A;  4FN2 A;  1RAX A;  1TBE A;  4NJ7 A;  4ZRJ A;  2VRR B;  4F7Z A;  2CKH B;  2BGF A;  1WX9 A;  5G2N A;  4W9H A;  3SD5 A;  5AZG A;  3PVL A;  3KUZ A;  3HM3 A;  1UEL A;  2FAZ A;  3H7P B;  2BWF A;  2MBB B;  1MG8 A;  2ZVO A;  1D3Z A;  3VVW B;  4A20 A;  4AWJ A;  4W9G A;  5DPS A;  1NBF C;  4A3O A;  2KK8 A;  1WIA A;  3NZU A;  5CHW A;  4B9K A;  4I6N B;  3ZNH B;  4JQW C;  4EOY A;  1OEY J;  1WXA A;  4PS8 A;  1WJ6 A;  2LAS A;  3X23 A;  1P0R A;  2AL6 A;  1RRB A;  2GBM A;  4GSW A;  4NPN A;  4BFR A;  4WQO B;  3QIJ A;  3CSF A;  4K81 A;  4PS7 A;  5GMV A;  1GC6 A;  2GBR A;  1V2Y A;  2DZK A;  2I1K A;  1WJU A;  5HKH A;  2Z0D B;  3ONS A;  4FHJ A;  2K39 A;  5C1Z A;  3H9D A;  3RUL A;  2LGD A;  3MTN B;  4YL8 A;  2FCN A;  4E74 A;  2IO2 B;  2MX2 A;  3H7P A;  1V5O A;  2ZPY A;  2KMA A;  2KDF B;  2WYQ A;  3B08 A;  4BOZ B;  2JRI B;  3DCG A;  2UYZ B;  1YX5 B;  3UGB B;  2RR9 A;  1IPG A;  2KD0 A;  2GBK A;  5E6P A;  1OGW A;  2Z59 B;  3VUW A;  2ZNV B;  4BKS D;  3M62 B;  1OEY A;  3UIN B;  1SIF A;  3U8Z A;  3P2B A;  3NY5 A;  3PHX B;  2LD9 A;  1C3T A;  1WRD B;  2IY1 B;  3AI5 A;  3NS8 A;  2LUE A;  2D3G A;  1WXV A;  2LZ6 A;  1E5W A;  2O6V D;  2CHX A;  1J0G A;  3M95 A;  1P9D U;  2A5U A;  4HDO A;  4PYZ A;  4W9E A;  2ZCC A;  3N3K B;  2FIF A;  2NR2 A;  3B1L X;  2MBO A;  4DXA B;  1F9J A;  2ZEQ A;  3A9K B;  1IYF A;  1RFA A;  2IO0 B;  4HK2 A;  1P1A A;  4KV2 A;  3PLV A;  3BIN A;  4KDL B;  4NQK E;  3M3J A;  2KX3 A;  1EUV B;  2G45 B;  2REX A;  4IM2 A;  4LCD E;  2C60 A;  4MGK E;  1J19 A;  2AWT A;  3LDZ E;  2JZ3 B;  2MSE D;  5L83 A;  1YQB A;  2DAJ A;  2IY0 B;  4IW0 A;  3W1S A;  2K8B A;  3DBL I;  3ML9 A;  4FJV B;  1NI2 A;  2FNJ B;  3N30 A;  3KW5 B;  5DPW A;  5DCN A;  3U30 A;  3VDZ A;  4GDL B;  4AUQ C;  2LXC A;  4TUU A;  2BKR B;  2BWE S;  2OJR A;  2KNB A;  2L0T A;  4GXB A;  1V6E A;  2PE9 A;  2XBB C;  4FBJ B;  5D7G A;  4F1S A;  4DHJ D;  4KVG B;  3ZW3 A;  5J18 A;  4IG7 B;  4TQ0 A;  2R2Q A;  3A9K A;  4ANX A;  5KHQ A;  4RM8 A;  2JZZ A;  4II2 B;  1KLV A;  2AEH A;  2KLC A;  3IBE A;  3KUD B;  1LM8 B;  4M0W B;  2V1Y A;  3L08 A;  4B6W A;  2D07 B;  1EO6 A;  3OJ4 B;  4GB9 A;  3T9L A;  3L10 B;  5J2R A;  2N7D A;  3V61 A;  3A33 B;  1CMX B;  2G4S A;  1WYW B;  5DPT A;  2KWV B;  1WX8 A;  2DZI A;  2MA9 B;  4LJO B;  4B95 A;  2EMT A;  3HIZ A;  4LDT B;  3SHQ A;  1GC7 A;  3QAQ A;  2B3A A;  3A4S C;  2CS4 A;  4GDL A;  4ZRI A;  3OJ3 A;  4EFO A;  2DAF A;  1GNU A;  2N9E B;  1E7V A;  2DZJ A;  1WI0 A;  2PEA A;  3JVZ X;  4P7I A;  1Z2M A;  3IFW B;  3UIO B;  1KJT A;  1WFY A;  5C23 A;  4HCP B;  1H4R A;  1UBQ A;  3GZN I;  1EF5 A;  1GUA B;  2KKC A;  5AEK B;  2FID A;  3ZRC A;  3TBL D;  3CST A;  2KMC A;  3KH0 A;  3O65 B;  3MHS D;  1E8W A;  1XD3 B;  2J0M A;  3RZF A;  2ZCB A;  3V60 A;  2ZNV C;  2V4L A;  3W1S C;  3K9O B;  2N4F A;  3RUI B;  1AAR A;  3PSE B;  2PE6 B;  2G4D B;  2IYD B;  2G3Q B;  1TGZ B;  2A4Z A;  2DX5 B;  3HM6 X;  2L00 B;  2EKE C;  2M1M A;  2BPS A;  4W9I A;  2N1W A;  1P98 A;  1WM2 A;  3ECI A;  2DZM A;  1YJ1 A;  2KJH B;  4W9K A;  1Q5W B;  5CHV C;  2XEW A;  2XK5 B;  3I3T B;  2KAN A;  3PRE A;  5LXH A;  2JXX A;  5J17 A;  3DBH I;  3DVN U;  2D11 A;  4JL9 A;  2M8S A;  4EZK A;  4G0N B;  2Y5B B;  3ALB A;  1I42 A;  1FXT B;  3QCA A;  3NOB A;  1WX7 A;  3DBS A;  1WGY A;  3APD A;  4ANW A;  3IG3 A;  3PV1 A;  3QJZ A;  5CX3 A;  3ZDT A;  1WGH A;  4BBN C;  5LXI B;  3RYT A;  2RPQ A;  2O2V B;  4IWQ A;  4GN1 A;  2KN5 A;  2L76 A;  3UIP B;  1WR6 E;  4HLE A;  2MRP A;  2OOB B;  4J6I A;  2KQ7 A;  2N9X A;  2NBV B;  4FJZ A;  5JH5 C;  3AXC A;  2MBH A;  3PZD A;  2K6Q A;  2GMI C;  4W9C A;  4IC7 B;  3VUX A;  4DK5 A;  3RCZ A;  4A3P A;  2XK5 A;  1WM3 A;  2WX0 A;  4F8C B;  1R4M I;  3QQ8 B;  1V5T A;  1WGG A;  4G3X B;  2LI5 A;  4TV3 A;  3QAR A;  2HD5 B;  4W9F A;  5CTR C;  1ZKH A;  2RD0 A;  1V86 A;  3KUC B;  3X0W A;  5EDS A;  2O2V A;  3QHT A;  4ZRK A;  4M8N A;  4EEW A;  2ASQ A;  2L0F A;  3DDC B;  2DYB A;  4URK A;  2J0J A;  2IZV B;  5D6J B;  4WWN A;  3TL5 A;  3WAL A;  2EMS A;  1L7Y A;  2CR5 A;  2CU1 A;  2KTF A;  3L13 A;  4KSL C;  4M8M A;  3WA0 A;  1TTN A;  3WIM A;  4ICU A;  3SDL C;  3ZLZ A;  2JRH A;  2IO3 B;  4HXD A;  2W9N A;  2KFK B;  3KVF B;  2JVC A;  3DBR I;  4LDT D;  4IUM B;  4MSQ B;  4RM9 A;  4FLH A;  3WAP A;  4I6P A;  1OQY A;  1S3S G;  2IO1 B;  2BF8 B;  2WWZ A;  3AU4 A;  3IVF A;  3N32 A;  4IWO A;  4HPM B;  4KIK B;  3JSV B;  4ZYN A;  4GMV A;  3ZNG C;  2BYV E;  4WJN A;  1WH3 A;  1C1Y B;  3OLM D;  4W9D A;  3WAO A;  3QWZ B;  3Q3F A;  3K9P B;  1WMH B;  1LXD A;  3ZUN A;  3U7D A;  4MGY E;  4DHZ B;  3TIX A;  3OAW A;  1E8Y A;  2MP2 B;  3JW0 X;  4FA6 A;  3Q3J A;  3B0A A;  1E90 A;  4MEL A;  4MH0 E;  3V6E B;  4W9L A;  1WE6 A;  3VAW A;  4EUT A;  3ENE A;  1L2N A;  4PS3 A;  1V49 A;  4ZDV A;  2FCS A;  2KFK A;  4KZ0 A;  3PS6 A;  2K8C A;  1IP9 A;  2HTH A;  2WDT B;  1SGH A;  4IM3 A;  4EZJ A;  1WJN A;  4K1R B;  3VH3 B;  1T0Y A;  4GIV A;  3VXW A;  4WAA A;  4GU2 A;  5E6N A;  4AP4 C;  1YD8 U;  4KIK A;  3JSV A;  1S1Q B;  4AJY B;  1A5R A;  1WGR A;  1RLF A;  2FCQ A;  3BY4 B;  4NNJ B;  4DDG D;  2KFJ A;  2RSU A;  1V81 A;  3EFU A;  4DWF A;  2KZR A;  1WMH A;  3RD2 A;  3UQB A;  1NDD A;  4NJ6 A;  1M94 A;  2FUH B;  2KXJ A;  3IHP C;  4K7W A;  1QZE A;  2MCN B;  2NBU A;  2YLM A;  2MP2 A;  1VCB A;  2K1F A;  4MSM B;  3APC A;  3D32 A;  2LRW A;  3A4R A;  4NQL B;  3ZVV A;  3PRP B;  4WWP A;  4W9J A;  5D2M B;  2JUO A;  3ZNZ B;  2KWU B;  4DHZ E;  2GOW A;  3APF A;  4XX5 A;  2UWQ A;  5AZH A;  1PQS A;  1WXS A;  4KSK C;  3UQA A;  2JF5 A;  3L17 A;  4PYU A;  5LLI A;  1UH6 A;  1E8X A;  2ZVN A;  2LGX A;  1YX6 B;  3NHE B;  3CF6 E;  1KM7 A;  2PPH A;  1WR1 A;  3DPD A;  1XQQ A;  3VTU A;  3ZTC A;  2J7Q B;  4MGI E;  3ZKJ C;  4FJY A;  2KDE B;  2MBE A;  3MJW A;  2C9W B;  3PGE A;  2JY6 A;  3LJ3 A;  2DEN B;  2KQS A;  2M4N A;  3WAN A;  3KYD D;  2R2O A;  3RZW C;  4WJP A;  1WGD A;  2IBI B;  2I1J A;  4WJO A;  2QHO A;  1YIW A;  4II3 B;  4JGH B;  2HJ8 A;  4OVV A;  1K8R B;  2NS5 A;  3VUY A;  3QK0 A;  2NPT B;  4HCN B;  3H7S A;  4CYE A;  3PHW B;  4ICV A;  4BKG A;  4G50 A;  2LVP A;  3ZIM A;  4ANV A;  1WY8 A;  4WWO A;  1P3Q U;  4OVU A;  3DVG Y;  4HPL B;  3L54 A;  2BYF A;  1U4A A;  3HK0 A;  3QA8 A;  5L95 C;  1EF1 A;  3ML8 A;  5BO4 B;  1ISN A;  4G11 A;  4AOF A;  5IA7 A;  5CHF A;  3DOW A;  3VHT C;  3DVN V;  1WE7 A;  3WAM A;  3JYU A;  4NY0 A;  3PLU A;  4HVB A;  4HWI B;  1UZX B;  4HJK A;  4TQ1 A;  3DVG X;  3H1U A;  3M63 B;  5JZE B;  2HE7 A;  2MWS B;  3C0R B;  2L05 A;  1V9J A;  4FAD A;  3PPA A;  2LXA A;  2KDB A;  2MW5 A;  2D10 A;  2N9P C;  4K7S A;  3DQV A;  3A9J B;  4MDK E;  2JT4 B;  3VTW A;  3TCA A;  1SE9 A;  2NPT A;  2LWP A;  2MLB A;  2GBN A;  2WX1 A;  1Q1O A;  5G55 A;  3S2A A;  4XZ4 A;  4BVU C;  2NVU I;  3A1Q B;  2KC2 A;  2K8H A;  3T8M A;  2CHZ A;  2ZJD A;  2C7N B;  2L8J A;  2BYE A;  1E7U A;  4DBG A;  2JWZ A;  2L7R A;  4I6L B;  1V80 A;  2C5L C;  1BT0 A;  1UD7 A;  1WJ4 A;  3CMM B;  3NZS A;  4BKT A;  2KJR A;  2AL3 A;  1WF9 A;  3H6N A;  4CO7 A;  2KDI A;  4MEM A;  1VD2 A;  3AU5 A;  2M0X A;  2KOX A;  4TKN A;  3PT2 B;  4AJW A;  2L3Z A;  2KHW B;  3AUL A;  3VQI A;  3EEC A;  4GOC A;  2K25 A;  1Z5S B;  4KZC A;  2PJH A;  1R4N I;  4MJS B;  4ASW C;  3A9J A;  4GDK B;  2KTR B;  3UF8 A;  1JRU A;  1WZ3 A;  2KWC A;  1HE8 A;  5FR6 A;  3A1Q A;  3W1Y A;  2BKF A;  4DDI D;  3QX1 A;  4BOS C;  1LFD A;  1Q0W B;  2YVC A;  4EKU A;  3PRZ A;  1TZ1 A;  1UBI A;  2RGF A;  3EC8 A;  4WJQ A;  3SU8 X;  2KX0 A;  4XC2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...