3EC8A

The crystal structure of the ra domain of flj10324 (radil)
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
149
structure length
139
Chain Sequence
GTENLYFQSMDPAELSTQLSAPGVLKVFGDSTGTHYKSVLATGTSSARELVKEALERYALDPRQAGQYVLCDVVGWQARCFRVFGDSEKPLLIQELWKPREGLSRRFELRKRSDVEELAAKEVDTITAGINAQARRLQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of the RA domain of FLJ10324 (RADIL)
rcsb
source organism Homo sapiens
molecule tags Cell adhesion
molecule keywords Putative uncharacterized protein FLJ10324
total genus 41
structure length 139
sequence length 149
ec nomenclature
pdb deposition date 2008-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00788 RA Ras association (RalGDS/AF-6) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3ec8A00
2FCQA 4F8CB 4IWPA 4J6IA 1WM2A 1XQQA 4ZRIA 2AWTA 1AARA 3JVZX 1F9JA 2R2OA 3BY4B 2MSED 1E5WA 1Z5SB 4LDTB 2FCSA 2GMIC 1L7YA 2LGYA 3A4SC 3PV1A 2DHZA 2LXAA 1TTNA 3L13A 4DDID 4K1RB 2DENB 3UF8A 3ENEA 4TQ0A 2IO2B 5AEKB 2O2VB 1GC6A 4WWOA 1QZEA 2K6QA 3QX1A 1LFDA 1R4NI 1WE7A 2LGXA 4GB9A 3TMPB 3VTVA 4N9F4 1UZXB 2HD5B 4HDQA 4HVBA 4G11A 2BPSA 1YX5B 4FHJA 1J19A 4K7UA 3M62B 4DHZB 3VVWB 3A1QB 1IPGA 2KO3A 4ZDVA 4G50A 3UQAA 2ZJDA 2W9NA 2BYFA 3UIOB 2MCNB 1NDDA 4MH0E 2MQJA 2K6DB 3APFA 3U7DA 4MGYE 3V6EB 3X23A 2N1VA 1EF5A 2ZCCA 4NNJB 2JY6A 3WIMA 1OEYA 2J0MA 3KH0A 3IHPC 4KSKC 2J0KA 1WF9A 1KJTA 3VUXA 1WMHB 3W1YA 5CX3A 4AWJA 2NS5A 3JW0X 4BOSC 1WE6A 3NY5A 2G3QB 4ANWA 2LVPA 2GBNA 2V4LA 2KWCA 4MGIE 4WJQA 2KWVB 3PHWB 2LVOA 5J2RA 3L10B 3PGEA 3VTWA 4CO7A 2NR2A 3PRPB 1V80A 2FAZA 3DVNV 3OLMD 2KHWB 4X57B 1WGHA 1V5OA 3JSVA 3QAQA 1TBEA 4EZJA 3H7PB 4TV3A 1GC7A 2OOBB 4FA6A 1C1YB 1NI2A 1UGMA 2DAJA 3WANA 4NAWB 2FIFA 2PEAA 2KD0A 3IBEA 3ONSA 1OGWA 4MGKE 3PTFC 5KHQA 5IAAC 4IW0A 3D32A 4W9GA 3CF6E 1P98A 2I1KA 5JZEB 1WZ0A 1WXSA 2J0JA 1WZ3A 5AZGA 2D11A 1MG8A 4IG7B 4MSQB 2A4ZA 2BYVE 1WX8A 2KX3A 2Y5BB 2KNBA 1P9DU 2WDTB 3SD5A 1EUVB 2M0XA 4W9DA 3R3MA 2L00B 2IZVB 3QA8A 4RM9A 3MTNB 4BKSD 3TJPA 4FADA 4DDGD 2O6VA 4M8NA 4W9CA 1E8XA 3VXWA 3V62A 2NCNA 4BKGA 4LJPB 2GBMA 4CYEA 3DVGY 1GJZA 3ZIMA 3L0WB 4GDKA 2C9WB 3RZWC 1WJNA 2WX0A 1I35A 4KV2A 1T0YA 3VFKA 2D07B 1U4AA 2LI5A 1S3SG 3NS8A 2REXA 3PREA 3SU8X 3X0WA 5CHFA 2KJRA 4KIKA 2RSUA 2G45B 4XC2A 1ZW7A 2NBVB 3PHXB 4II3B 4A20A 4NPNA 5E6NA 2L0TA 2K8BA 2LVQA 2MX2A 2ZVOA 3APDA 1WX7A 3H6NA 4HDOA 4TQ1A 4KZCA 2DYOA 4B6WA 2G4SA 2KTRA 5C1ZA 3HM3A 4W9IA 2MP2B 4GIVA 2LXCA 4WWPA 2LASA 3A1QA 3A9JA 2CHXA 3TIXA 2IO3B 2N1WA 2AL6A 4W9FA 1WRDB 5FR6A 2HE7A 3ZVVA 4PYUA 3PRMB 1UBQA 5DPWA 3ZKJC 3KYDD 2C5LC 4WAAA 5DPTA 2ZPYA 5CHVC 4DXAB 2V3SA 4KSLC 3VHTC 2N9XA 4ANVA 2KN5A 4DHJB 2L76A 3ZTDA 2NPTA 2M4NA 3V60A 3M95A 2ZCBA 1E90A 2FUHB 3C0RB 2DYBA 2CHWA 4JQWC 5J17A 2JVCA 4MSMB 2DAFA 4GN1A 3A9KA 3R7QA 2OJRA 1BT0A 3KVFB 4HJKA 5AZHA 3KUCB 3MJWA 3N30A 2CHZA 3GZNI 2M17A 2ZEQA 4W9LA 1P3QU 4XX5A 4FBJB 2UWQA 3HM6X 3PVLA 2KLCA 4K7SA 2BF8B 3H7SA 2A5UA 1TZ1A 2LZ6A 2JT4B 2KXJA 2WX1A 2L3ZA 5D94A 4EEWA 2NBWB 2RD0A 1SE9A 2MWSB 3IFWB 4ICUA 3HIZA 1RAXA 4IM3A 4HCPB 1Q5WB 2ZVNA 2AL3A 3A33B 4AP4C 3U30A 2YVCA 1RFAA 4MJSA 3NHEB 2CU1A 4ZRJA 3U8ZA 2JRHA 1A5RA 2KQSA 2MBQA 3VUWA 4ANUA 2KX0A 2KZRA 3ALBA 4URKA 3OJ3A 2RGFA 3PRZA 3ZNHB 5D6JB 1WH3A 4I6PA 1IP9A 1WFYA 1CMXB 1WGGA 1V81A 1I42A 4EFOA 3R66C 5AZFA 2CKHB 3L08A 2B3AA 4IUMB 3HHMA 4GXBA 3AI5A 4OVUA 1KLVA 3H1UA 2Z0EB 3W1SA 3QIJA 1WX9A 1WY8A 4BKSA 1YJ1A 2C7HA 2KOXA 1WR1A 2MLBA 3AXCA 2K8HA 3I3TB 2DYMA 4GDKB 2KFKA 4W9HA 2DZMA 2FNJB 5G2NA 4HPLB 3V6CB 3DVGX 4A3OA 1P1AA 3LJ3A 4YL8A 2KFJA 4CHKA 1H4RA 4FJYA 3EECA 2JXXA 4P7IA 5DCNA 4KIKB 3ZO5B 4HK2A 2DZIA 2EMTA 2GOWA 2J7QB 3PSEB 3V61A 4B95A 2IY1B 3PLUA 4IM0A 2EMSA 3T9LA 3S2AA 2IO0B 4FJZA 2KDIA 4M8MA 3H9DA 4EUTA 3CSTA 4JIOU 5EDSA 1UELA 1WIAA 2CR5A 2N7EA 4LJOB 1YD8U 1PQSA 4FLHA 1M94A 5JHAA 1ISNA 1Q1OA 2MP2A 3TCAA 5D7GA 2HTHA 3A9JB 4AOFA 2LRUA 3DBHI 5LLIA 3EC8A 2XK5B 1IYFA 2KDFB 4M0WB 1EO6A 3ZRCA 1ZGUB 3KUZA 2YLMA 3RYTA 2JZ3B 4IC7B 1LM8B 4MEMA 3PPAA 4GGQA 4HXDA 4JLCA 2NPTB 4E3CA 1FXTB 3AU5A 3N32A 4ICVA 1S1QB 4DHZE 2MBOA 4IWOA 4TKNA 3O65B 1V6EA 1WXAA 2XEWA 1WM3A 3QARA 4LDTD 2O2VA 3PLVA 1RRBA 5CTRC 5TR5A 2JRIB 3CSFA 2WWZA 3RCZA 1G6JA 4DBGA 1WJ4A 3NZSA 3WAMA 1JRUA 5C23A 3JYUA 2MW5A 3M63B 3QK0A 4MDKE 3A4RA 2FCMA 3DBSA 3SHQA 4NJ6A 3QWZB 2L05A 3L54A 2C60A 4BOZB 2NBUA 2LWPA 3JSVB 1XT9B 2M1MA 2DZJA 2NVUI 4XZ4A 3VH4B 4NJ7A 4A3PA 2CS4A 2AEHA 4JL9A 2L8JA 3R7RA 4DWFA 3T8MA 2MBEA 3TL5A 2KJ6A 4PS7A 3VQIA 2K39A 1J8CA 2KTFA 3ML8A 4DHJD 3DCGA 2UYZB 4JGHB 4BFRA 3ML9A 3NOBA 1OTRB 3QCAA 3VH3B 1D3ZA 2LD9A 4EOYA 2ASQA 3M3JA 4GOCA 2KK8A 2K1FA 3RULA 3ZDTA 4BVUC 1GG3A 1WJUA 1YQBA 2IBIB 1VD2A 2M8SA 4MM3A 1GNUA 2O6VB 3RT3B 2KKCA 4AUQC 4PS8A 2IO1B 4EZLA 4AJWA 1X1MA 1KOTA 1R4MI 1E8WA 1V9JA 3MHSD 3EFUA 2WYQA 2N4FA 5KHOA 1WGRA 2GBJA 4G0NB 2JWZA 2G4DB 3H7PA 3KUDB 1V5TA 2PE6B 4NAWA 2BGFA 3WA0A 2BWFA 4OVVA 3AULA 1LQBA 3GOEA 2N9PC 4GDLB 1TGZB 4KDIC 1YIWA 2BYEA 2KJHB 2LRWA 2Z0DB 3B08A 3QHTA 4F7ZA 4NQLB 2KANA 2KMAA 1GUAB 3DPDA 4WJNA 3QC8B 1LXDA 3ZDMC 3SDLC 3K9PB 2C7NB 3QQ8B 4I6LB 4ZYNA 3PS6A 3W1SC 3WAPA 2ZNVB 2JF5A 3Q3JA 5E6OA 2JPHA 2N9EB 4E74A 5LXHA 4F1SA 3L17A 1ZKHA 1EF1A 3DVNU 4K7WA 4BBNC 4BKTA 3ZNGC 2R2QA 2D3GA 2LUEA 4ZRKA 2D2QA 1OQYA 2AYOB 4FN2A 2MBHA 2XK5A 2I1JA 1YX6B 4ASWC 2PPHA 4IM2A 4MELA 2MRPA 2VRRB 3VDZA 4WWNA 2V1YA 4WQOB 3TBLD 4BBNF 1KM7A 2ZNVC 4G3XB 4RM8A 1WYWB 2BWES 4HWIB 4W9KA 1J0GA 2L0FA 2ZZPB 3ZNID 3WAOA 2HJ8A 3RD2A 2FIDA 3DQVA 3ZRFA 2GBKA 2LGDA 4FJVB 5J18A 2PE9A 3APCA 3RUIB 1NBFC 4I6NB 2MA9B 3DOWA 1HE8A 1V86A 2GBRA 3PZDA 2PJHA 5G55A 5BO4B 4DK5A 4HPMB 5LXIB 3L16A 1E7VA 2KTRB 4W9EA 5E6PA 1H8CA 4WJPA 1UH6A 1OEYJ 3Q3FA 5L83A 2ZPNA 4ANXA 3UINB 3KYCD 2N7DA 2LJ5A 2JUOA 5GMVA 3K9OB 3DDCB 3UQBA 2QHOA 4MGZE 3CMMB 3ECIA 3BINA 3VAWA 3ZLZA 3EHVA 4GU2A 4IWQA 3AU4A 5HKHA 4NQKE 1E7UA 3VUYA 3ZUNA 4B9KA 1L2NA 3WALA 2KC1A 2K8CA 1SGHA 2EKEC 2FCNA 1Q0WB 4MJSB 3RZFA 1C3TA 2RPQA 1Z2MA 3HK0A 4KDLB 3ZNZB 4GSWA 1P0RA 2DZKA 2BKFA 3N3KB 1WMHA 4AJYB 5IA7A 3OJ4B 4II2B 5D2MB 4E71A 1VCBA 2KWUB 3A9KB 3B0AA 3KW5B 4FULA 4K81A 2DX5B 3ZW3A 2KDEB 1V49A 1E8ZA 2IY0B 1RLFA 4RMAA 4PYZA 2O6VD 4NY0A 4FHKA 4TUUA 1Y8RC 1WXVA 2Z59B 3IVFA 2D10A 3OAWA 3PT2B 5JH5C 5DPRA 1WJ6A 2KDBA 1WR6E 3DBLI 2KVRA 2JZZA 2KFKB 3NZUA 2IYDB 4PS3A 2K25A 4LCDE 3DBRI 4KZ0A 3IG3A 1K8RB 3VTUA 2C7MB 2MBBB 2XBBC 3UIPB 5JHBA 4HCNB 5DPSA 4GDLA 1WGYA 4EKUA 2RR9A 4WJOA 2KQ7A 2KC2A 5CHWA 1WI0A 3QJZA 4HLEA 1UD7A 1XD3B 4W9JA 5L95C 1UBIA 2KMCA 4GMVA 3UGBB 3ZTCA 4EZKA 1SIFA 2BKRB 4KVGB 3LDZE 3B1LX 1E8YA 1WGDA 1WXMA 2KLGA 1V2YA 2L7RA 3P2BA
chains in the Genus database with same CATH superfamily
3BK2A 1TTNA 3L13A 4DDID 1HZ6A 4TQ0A 2O2VB 1QZEA 3QX1A 5LNK1 2NTTA 2LGXA 1ZUD2 1UZXB 2HD5B 2BS4B 4US9A 2BPSA 3BK1A 4RF1A 1J19A 3M62B 3U52E 4G50A 2DBYA 4MGYE 1F2RI 1EF5A 4HJGE 2QJLA 2J52A 1OEYA 2J0MA 2BW2A 4S17A 1WMHB 4L2YA 1QT9A 2NS5A 3JW0X 3NY5A 2G3QB 1P7FA 2KWCA 3NZ3A 2KWVB 2WXGA 3PHWB 4WJQA 2LVOA 5FK9C 5J2RA 5BYRA 2FAZA 2KHWB 3Q8FA 4EZJA 1GC7A 1AYFA 1VRAB 1ZDXA 3ONSA 4LTUA 4OVZA 2I1KA 2WXFA 1WZ0A 1ZPSA 2J0JA 1MG8A 4IG7B 2A4ZA 2KX3A 1P9DU 1QOAA 2M0XA 4XGAB 3Q3NC 2L00B 1TKEA 3MHZA 3TJPA 3AE5B 4MM3B 4FADA 3W9CB 1E8XA 3VXWA 1CQVA 3ZIMA 4GDKA 2C9WB 2WX0A 4YTPB 1HZ5A 1FNVA 1U4AA 4A8XC 3PREA 1ENFA 5CHFA 1C77A 1UNSA 2W3RA 4RGOS 1I4RA 5E6NA 3H8HA 2IPKD 2ZVOA 3EA6A 4YTNB 3B2GA 2G4SA 2XNAC 4ZRQA 4GIVA 4WWPA 2LASA 3A1QA 2CHXA 5IOIA 2IO3B 2AL6A 2ON8A 5CHVC 4DXAB 4KSLC 3VHTC 2N9XA 2IGDA 3IAM1 2L76A 1YQ4B 2M4NA 1ET9A 1KLGD 3C0RB 1YN5A 3V05A 4JQWC 2JX5A 2PMVA 4REZA 4GN1A 2OJRA 1FNUA 4HEA1 3ETRA 2ZEQA 4W9LA 3PVLA 2KLCA 1WXQA 1TY0A 2LHDA 2A5UA 1JCKB 1ESFA 4WIPA 5D94A 2MWSB 2GRIA 3NUHB 2RPVA 3AECB 3LYYA 3A33B 3U30A 1OQRA 4C4VA 4KGTA 2CU1A 3U8ZA 2X38A 2N9KA 2KQSA 2RGFA 5D6JB 1WH3A 1WFYA 4EFOA 2CKHB 2NMQA 3L08A 3P4SB 2AX5A 5BYSA 3FILA 1QKZA 1TS5A 3HHMA 3AI5A 2G1EA 2Z0EB 3W1SA 1WY8A 1L5PA 4W9HA 5HHDG 1FRRA 4KKIA 3LJ3A 2KFJA 1K52A 1H4RA 4FJYA 3Q8CA 3AE2B 2EMTA 3V61A 2WLBA 4P16A 2IO0B 2MJEA 2ZW0A 3CSTA 5EDSA 1UELA 2B76B 1YD8U 2N0SB 3MFGA 1Q1OA 5EE1A 3NS1A 4JX1C 2DLBA 5D7GA 3A9JB 3RNGC 1T0SC 3ZYYX 2KVZA 4OZAA 3EC8A 4DQOC 2INNE 1XCQL 1TT5B 1WYGA 5D3IB 4A9AA 3N32A 1S1QB 4DHZE 4TKNA 1PDXA 1V6EA 4RGTA 3MC0B 3TEWA 1G6JA 1TKYA 1WJ4A 5C23A 2MW5A 3LB8C 2H89B 3A4RA 4M01A 3GP7A 3DBSA 1QOFA 2C60A 2GLSA 2PKOA 1XT9B 2IGHA 4XZ4A 4A3PA 4NJ7A 3NVVA 1ZXHA 2LEKA 3P1MA 4DWFA 3T8MA 1J7CA 4RFBA 2KJ6A 4PS7A 1QOGA 2I38A 3DHIC 4YSYB 2MEKA 4DHJD 1L4ZB 1T6BX 3MC8A 1B9RA 3QCAA 4EOYA 4IOIE 4DXGA 1WJUA 4YT0B 1VD2A 4N6EB 4PS8A 2IO1B 1KOTA 1V9JA 3MHSD 1KH0A 2VZKD 3H7PA 3KUDB 4H2AA 4ZRPA 1YOVB 1NYRA 2BGFA 2V4IB 1LQBA 3RNAC 1V97A 2KJHB 2LRWA 5H92C 4NQLB 4WJNA 1LXDA 3K9PB 2C7NB 3QQ8B 4ZYNA 3W1SC 3PS6A 3WAPA 2CJOA 3Q3JA 1UWXA 3L17A 1ZKHA 5AUKA 2R2QA 2LUEA 2JYTA 1GOZA 1N5XA 4FN2A 2XK5A 4RGNA 2I1JA 1YX6B 3DBRB 4ASWC 2PPHA 5IO9A 2MRPA 2LHEA 5BYQA 2V1YA 4HWIB 2WHIA 1N6ZA 2GBKA 2LGDA 3AEBB 1F52A 3RUIB 4I6NB 2GBRA 3PZDA 3WCQA 5LXIB 5BMHA 2QMTA 1UH6A 2L32A 1D5MC 4ANXA 4P1CC 1I4HA 3W5UB 3CMMB 3ZLZA 5HKHA 2RDBC 1L2NA 1STEA 4ACFA 3WALA 2KC1A 2FCNA 1Q0WB 2FE8A 1VJKA 2TSSA 3Q6BA 2KDEB 1E8ZA 2O6VD 4LLGM 4TUUA 1Y8RC 4J3OD 2QDFA 1IGCA 2Z59B 5DPRA 1WJ6A 1WR6E 2WDVB 3P42A 2KVRA 3NZUA 1JROA 1RWSA 4LCDE 3DBRI 2L83A 4KZ0A 5T8IA 2H88B 2C7MB 1OQQA 2MBBB 5G5GA 4HCNB 4GDLA 2RR9A 4WJOA 2W3SA 4ITKA 3BYYB 3QJZA 5L95C 1NI3A 2YEPB 2N7JA 1E8YA 3P4QB 3AMZA 1VDVA 4IWPA 5IP4D 1WM2A 3AE3B 1XQQA 3C8YA 1SSNA 1F9JA 1E5WA 2W82A 1UWMA 1Z5SB 4LDTB 2GMIC 2LGYA 1L7YA 3PO0A 4HRSA 4K1RB 4WH4A 3TSSA 3ENEA 4LNOA 1GC6A 4WWOA 2K6QA 2INDC 1N60A 4GB9A 1BXTA 4N9F4 4HDQA 4G11A 2K22A 4IDIA 1IPGA 3UQAA 4JE3B 2BYFA 3ZJTA 2MCNB 1NDDA 2MQJA 3U7DA 1XLOA 3V6EB 2WXJA 3X23A 1XXGA 2N1VA 1LGRA 1PGBA 1R7SA 4US8A 1KJTA 5CX3A 4BOSC 1PGAA 4ANWA 3L10B 1V80A 3DVNV 1T0QC 3OLMD 4X57B 4OZCA 1WGHA 3JSVA 1TBEA 2QEJC 2W55A 2OOBB 1C1YB 3WANA 3SFDB 2PEAA 2KD0A 4MGKE 3PTFC 5KHQA 4IW0A 1KTKA 1E7PB 4MSQB 1K50A 2BYVE 1WX8A 4NJCA 3SD5A 2M19A 2IZVB 1I4PA 3MTNB 1C4AA 5TSSA 4YWGG 4BKGA 4LJPB 3DVGY 1F77A 1R4NB 1XLPA 4B0EA 3RZWC 1I35A 4KV2A 1S3SG 3NG0A 2E3TA 1KFYB 1V1PB 4L23A 4II3B 2NBVB 4NPNA 2LVQA 3H6NA 2K5PA 3APDA 4HDOA 3AE6B 3DWMA 4TQ1A 4RCOA 4KZCA 3B9JA 2VH2A 5C1ZA 3HM3A 4W9IA 2K3UA 2OEDA 2N1WA 1WRDB 5FR6A 2HE7A 1GAQB 3ZKJC 4WAAA 3UI3A 2Y5PA 2ZPYA 1N62A 4ZHOA 3BWUD 3AE9B 2INCC 1JMLA 3M95A 3V60A 1RYJA 3MC9A 2FUHB 2DYBA 2RDGA 5J17A 2JVCA 3R7QA 3A9KA 1TYGB 3AE7B 4HJKA 1ROEA 4FBJB 2QCZA 4K7SA 3N9YC 2BF8B 1R4MB 2LZ6A 4EEWA 1D4BA 1UF0A 2RD0A 1A70A 1HTOA 1SE9A 3IFWB 4ICUA 1RAXA 4IM3A 4HCPB 4ARCA 2AL3A 2AQ2B 3I9V1 2IGGA 1RFAA 3NHEB 1RM6C 1AWDA 3GE8C 4NAMA 1KLUD 4AS1A 1N5WA 3R66C 2BB6A 2B3AA 3ZQ4A 4GXBA 1JWSD 2LMCA 3H1UA 1WX9A 2I2YA 1YJ1A 3FAHA 2C7HA 2PW9A 2ONQA 3I3TB 4GDKB 2KFKA 5G2NA 1NEKB 2K9XA 2ICIA 4KX6B 1C4PA 3EECA 4P7IA 5DCNA 2DZIA 4EE2A 3AE4B 5EE0A 3S2AA 2KDIA 4M8MA 2WDQB 5AUIA 4XDCA 4JIOU 2CR5A 2R61A 2N7EA 1M94A 3VRBB 4AOFA 2LRUA 3DBHI 5LLIA 2XK5B 1IYFA 1L0XB 3E56A 1ZGUB 1PYWD 1LM8B 4HXDA 2HJ1A 3Q69A 2NPTB 4E3CA 1FXTB 4ICVA 2MBOA 3O65B 1WXAA 3ZNHB 1WM3A 3PLVA 5TR5A 3SFEB 2JRIB 3CSFA 2WWZA 3WAMA 3QK0A 4NJ6A 1XLQA 2L05A 3L54A 1AW7A 4JL9A 2L8JA 3R7RA 3OWEB 5EE3A 1E10A 3VQIA 1FD6A 2YEPF 1L0VB 2UYZB 3KWLA 1QILA 4JGHB 1JWBD 1OTRB 3VH3B 2G9HD 1JWUD 2ASQA 4GOCA 2KK8A 2NTSA 3RULA 4USAA 2IBIB 1NYQA 4AUQC 1GNUA 2O6VB 4KGRA 4LNKA 1WRIA 3EFUA 1WGKA 1WGRA 3N20C 4G0NB 2JWZA 1JWMD 1HXYD 3WA0A 3GOEA 4GDLB 4KDIC 3DHGC 2BYEA 3QHTA 1V1PA 2KANA 4RGMA 3ZDMC 3QC8B 3SEBA 2BTEA 2L1AA 4FXCA 3SDLC 1C9FA 3AEDB 3VRAB 3T3NA 5E6OA 2N9EB 5LXHA 1I4XA 1J7AA 4BBNC 2V9HA 1OQYA 4A6QA 2MBHA 4GLSC 3VDZA 3RN9C 4RH6A 1EU3A 1D5XC 1J0GA 2ZW1A 2L0FA 3ZNID 3RD2A 4FJVB 2PE9A 3DOWA 4DK5A 3L16A 1E7VA 3IT4B 3VR8B 3HUIA 2KTRB 1DOIA 3I63C 4W9EA 1HEZE 4WJPA 5E6PA 1H8CA 2ZPNA 2N7DA 1CK1A 2JUOA 2LJ5A 5GMVA 5I4DA 3K9OB 4R3DA 4XDDA 3ECIA 3EHVA 4IWQA 2WXHA 1E7UA 1FCLA 2WXLA 4MJSB 1C3TA 4D2KA 3P4RB 2RPQA 1Z2MA 4KDLB 1ZDVA 4GSWA 1TS3A 3RNEC 3N3KB 5IA7A 4II2B 5D2MB 2BQQA 2KWUB 3ZW3A 2KWDA 2IY0B 1RLFA 3NJTA 4RMAA 1UGJA 4YTMB 3FKYA 4NY0A 2OJWA 2W54A 3OAWA 5JH5C 2KDBA 2KN4A 3W2DA 1L6UA 3GB1A 2IYDB 1I4QA 3CWIA 1K8RB 4N58A 5IN7A 1C76A 5C3JB 3EFCA 1MFWA 2D3AA 2KQ7A 2KACA 5CHWA 1FCCC 1WI0A 3PZ7A 4C7YA 1XD3B 4W9JA 4GMVA 1HTQA 2BB5A 1SIFA 2X8XX 4XYCA 4OZBA 2MHJA 3B1LX 3RFZB 1WXMA 5EE9A 3FILB 1V2YA 1MG4A 3P2BA 1DYQA 1FFUA 4J6IA 2KAJA 1M4VA 2LUMA 2AWTA 3BY4B 1IGDA 2FCSA 3A4SC 2LXAA 2DENB 5AEKB 1LFDA 1R4NI 1ZOYB 3TMPB 3VTVA 1SE2A 3J9CA 4ZHPA 3Q3MC 4FHJA 4K7UA 4ZDVA 5D3DA 2W9NA 3UIOB 2QILA 3T3OA 4MH0E 2K6DB 1FIQA 1FPYA 2ZCCA 4NNJB 4KSKC 2WU5B 2J0KA 2PLPA 2V0GA 4AWJA 3P4PB 1WE6A 4K3BA 4HPPA 1ZXIA 5HI1A 2GBNA 4MGIE 1E6EB 1FEHA 3PGEA 3VTWA 4CO7A 2EELA 4YXDB 1QOBA 3B2FA 1V5OA 4Q2JA 4TV3A 1NI2A 4C7ZA 1XCTL 3W5VB 2PIAA 3D32A 4W9GA 2V3NA 3BIID 5AZGA 2D11A 1T5XD 2KNBA 1EUVB 1VLBA 2JQRB 1GB4A 3R3MA 2WXIA 4DDGD 4W9CA 4M8NA 3V62A 2GBMA 1GJZA 4HROA 1VZ8A 4HKZE 3OG5A 3IAS1 1T0YA 3VFKA 2LI5A 2WNMA 5FKAC 3SU8X 2HDEA 3X0WA 4KIKA 2RSUA 2G45B 3CIRB 4XC2A 1ZW7A 1TY2A 1WX7A 4AQ7A 1FRDA 2KTRA 2Z8LA 2LXCA 4W9FA 1WWTA 3ZVVA 5DPWA 4PYUA 1JALA 5GXGB 4DHJB 2NPTA 1E90A 4P1BC 3N1YC 1BT0A 5AZHA 1TJEA 1K51A 3MJWA 3N30A 2CHZA 4XE0A 1P3QU 4XX5A 2UWQA 3HM6X 3MJ5A 4NZLB 2WX1A 2JT4B 2KXJA 2L3ZA 3ZGZA 3HIZA 4L1BA 1IUEA 1C4CA 2ZVNA 4AP4C 4C00A 2V3PA 4ZRJA 2JRHA 2QSDA 1A5RA 3IXSA 4XWTA 2KX0A 2KZRA 3ALBA 3OJ3A 1PGXA 1T3QA 2FUG1 2LGIA 3PRZA 1C78A 1F2RC 1WGGA 1CMXB 3HVDA 1V81A 2SEBD 1I42A 1N61A 4IUMB 2J4XA 4OVUA 1KLVA 3QIJA 2KOXA 1WR1A 2HTME 2MLBA 2K8HA 3AXCA 3V6CB 4YL8A 3ZO5B 3DBHB 3PSEB 4B95A 2IY1B 1ZE3D 2EMSA 3BVZA 3IT6B 4N59A 5JHAA 2WXKA 4LJOB 4FLHA 1PQSA 2MP2A 3AE8B 2D3BA 3TCAA 2HTHA 2KDFB 3ZRCA 1EO6A 1EU4A 1KF6B 3KUZA 4MEMA 4JLCA 3AEFB 3AU5A 1AN8A 4LDTD 2XEWA 1RRBA 1C79A 3DBLB 1SB3C 4A55A 3NZSA 2JYEA 1EWYC 1YMHE 3M63B 4OW0A 2FCMA 3TEYA 3SHQA 4IKGA 3U4EG 4ZYSA 4BOZB 2NBUA 2M1MA 1Y56A 2WDRB 2CS4A 2AEHA 1L4DB 4WURA 2KDMA 1J8CA 1B1ZA 2KTFA 2L52A 3ML8A 1FFVA 1SE3A 3KLSX 3AN1A 3ML9A 3NOBA 2DNFA 1VR9A 4JWUC 1VZ6A 4WWMA 3DHHC 4RNAA 2WXOA 4MM3A 3RT3B 4AJWA 1X1MA 4MT5A 1R4MI 1E8WA 5C2TB 1FXIA 3ZJVA 2WYQA 2N4FA 5KHOA 2GBJA 1DOXA 1TIFA 2WXQA 2G4DB 1V5TA 1Q10A 4K3CA 4NAWA 2BWFA 4OVVA 2VH1A 2N9PC 1TGZB 3B08A 3DPDA 1GUAB 2LGSA 3AE1B 5IKCM 2BS2B 2WU2B 2JPHA 2GI9A 1SXTA 1NENB 3ZNGC 3RNCC 4ZRKA 3NVYA 4M0WA 4MELA 2VRRB 3Q2AC 4BBNF 4WQOB 1KM7A 2E6XA 3AH7A 4G3XB 2BYTA 2BWES 2ZZPB 2HJ8A 2FIDA 3DQVA 2PVOD 3APCA 2WS3B 2IDYA 2WXMA 3V3XA 1ET6A 2MA9B 1HE8A 1SE4A 1V86A 5G55A 2PJHA 5BO4B 4LNIA 4PT5A 3Q3FA 1OEYJ 1D5ZC 3UINB 3KYCD 2INPE 4KKJA 1TZOA 3DDCB 2QHOA 3AU4A 4LK0M 2QIEB 4NQKE 1SGHA 3Q14C 3ABVB 1E0ZA 1P0RA 2DZKA 1N63A 2BKFA 1WMHA 4AJYB 2KYWA 3OJ4B 3AV8A 4E71A 3A9KB 3KW5B 4K81A 4ZOHC 4FHKA 1T0RC 3GE3C 2MJDA 1L0YB 3IVFA 3PT2B 1K53A 1MPEA 1JRPA 4PS3A 2K25A 2WP9B 3VTUA 2XBBC 2KC2A 2Q5WD 3BYTB 4QAYA 1UBIA 2KMCA 3E9SA 4EZKA 3LDZE 1I7HA 1WGDA 1HA5A 2QC8A 2L7RA 2FCQA 4ZRIA 1AARA 2RDHA 3GZNB 3JVZX 2R2OA 4M00A 2MSED 1XLNA 3PV1A 2DHZA 2N9LA 4O1NA 2PVGC 3UF8A 2IO2B 1WE7A 2CJNA 1YN4A 3U7ZA 4OHJA 4C80A 4HVBA 3N1ZC 2RMMA 3AB5A 2AQ1B 1YX5B 4DHZB 3VVWB 3RI7C 3A1QB 2KO3A 2ZJDA 1FO4A 1F0ZA 1XF5L 4JWSC 2XN9C 3APFA 1FMAD 4P6VF 2WGSA 3WIMA 2JY6A 3KH0A 3IHPC 1WF9A 1FXAA 3VUXA 3W1YA 4C56C 2LVPA 1TS2A 2GB1A 2V4LA 5BMGA 2NR2A 3PRPB 2SAKA 2JSVX 4HKQA 3QAQA 3H7PB 3N1XC 4FA6A 2DAJA 1EM7A 1UGMA 1ZP0B 4NAWB 2FIFA 1E9MA 3IBEA 1JQ4A 1OFFA 1OGWA 1ACCA 5IAAC 1V8CA 3CF6E 3LXFA 1P98A 5JZEB 1YQ3B 1WXSA 1WZ3A 1PFDA 2Y5BB 2WDTB 4YSXB 1IBXB 4W9DA 3QA8A 1DGJA 4RM9A 4BKSD 1VZ7A 2O6VA 2NCNA 4CYEA 3L0WB 1F1HA 1WJNA 2D07B 1SIJA 3BVMA 3NS8A 1TS4A 2REXA 3HRDD 2K0PA 2JWUA 2KJRA 5H8YE 1LO5D 3PHXB 4A20A 2L0TA 2K8BA 2MX2A 1CJEA 1TKGA 2DYOA 3URYA 4B6WA 2MP2B 4CQNA 3A9JA 2JU6X 3TIXA 3SR6A 3PRMB 1UBQA 1QLBB 2ACZB 2C5LC 3KYDD 5DPTA 2V3SA 3KWVA 1YJIA 4RF0A 2KN5A 4ANVA 3ZTDA 1QF6A 2ZCBA 4MH8A 2CHWA 4MSMB 2DAFA 3KVFB 3RNBC 3KUCB 2M0AA 3C19A 3GZNI 2M17A 3ZXRA 2EKIA 2WXRA 3H7SA 1TZ1A 1RFKA 2WQYB 4BAXA 2NBWB 2Y3AA 1XEEA 1Q5WB 2YVCA 4MJSA 2PTLA 3FC4A 2AQ3B 4ARIA 2VZKB 2MBQA 3VUWA 4TSSA 2BS3B 4ANUA 4URKA 3RPFC 1IP9A 4I6PA 1MJDA 5G5HA 5AZFA 3PZ8A 1JWAD 4BKSA 2DYMA 2DZMA 2FNJB 4HPLB 1DOYA 3DVGX 4A3OA 1P1AA 3GS2A 4CHKA 2JXXA 4KIKB 4HK2A 2GOWA 2J7QB 1SBBB 3PLUA 4IM0A 3T9LA 3BVGA 4FJZA 3H9DA 4EUTA 2CU3A 2UU7A 1WIAA 1KRHA 1ISNA 1JW9D 1YNTE 3ZJUA 4M0WB 3AM9A 2YLMA 3RYTA 5FR3A 2JZ3B 4IC7B 3ZXVA 3PPAA 4GGQA 1V1OA 5MPOA 1UUPA 3TUOA 2JXTA 4IWOA 3EUB2 2FBWB 3QARA 3ZNZB 4F8CB 5CTRC 2O2VA 4UDUC 3RCZA 4DBGA 4YSZB 1JRUA 2JZPA 3JYUA 4MDKE 4M02A 1QQRA 1YJJA 3EGRA 4TMAB 4BZAA 3QWZB 1SF0A 4DXFA 2BVCA 2M56B 2LWPA 3JSVB 2DZJA 2NVUI 3VH4B 3R2IA 2J42A 2WXNA 2MBEA 3TL5A 1MHXA 3Q8EA 3AEEB 1MHHE 2K39A 2IJ0A 3DCGA 4BFRA 2BT6A 5HG2A 1D3ZA 2LD9A 3M3JA 1SJED 3ZDTA 2K1FA 4BVUC 1GG3A 1YQBA 4B0MA 2M8SA 1NVID 2KKCA 4EZLA 2LJIA 4PK1A 1GPXA 1CZPA 2D3CA 2PE6B 3R8BA 3KQ4A 3AULA 2LFIA 3AEGB 1YIWA 2Z0DB 4F7ZA 3NVZA 1FM0D 2KMAA 1L6VA 1SEBD 3TEZA 4LNFA 4I6LB 2ZNVB 2JF5A 3RNFC 4E74A 2D5GA 4F1SA 1SJHD 2KQ4X 1EF1A 3DVNU 4K7WA 4BKTA 2D3GA 2D2QA 2AYOB 3R2TA 3Q8BA 4IM2A 1GB1A 4WWNA 3L4PA 3TBLD 3VR9B 2ZNVC 1P7EA 4RM8A 5JXVA 1WYWB 4W9KA 3O13A 4A90A 1BUIC 3WAOA 3ZRFA 3P63A 5J18A 1NBFC 1XO3A 3HVZA 3TEXA 1PUTA 4HPMB 5L83A 1WSPA 2OHFA 4WQMA 2WXPA 1MVKA 1D6EC 3UQBA 4MGZE 4XWWA 3BINA 3VAWA 4GU2A 3RMKC 3ZUNA 3VUYA 4B9KA 2J53A 1MI0A 4JPSA 2K8CA 3RZFA 2EKEC 1FNWA 3HK0A 3U2SC 2BBCA 1VCBA 4FULA 3B0AA 2DX5B 2KT7A 1I4GA 5HFYA 1EWCA 1V49A 3NVWA 3I5JC 4PYZA 2MJ3A 2Y5CA 3I57A 4S0RA 1BMLC 1WXVA 2D10A 3BZDB 5BMIA 3DBLI 3DWGC 2JZZA 2KFKB 3MP9A 4WAFA 4C4VB 3IG3A 4LNNA 1YN3A 3AEAB 3UIPB 5JHBA 3Q8AA 5DPSA 1WGYA 4EKUA 1J7BA 2MH7A 2KMMA 4HLEA 2DWQA 1UD7A 3Q3OC 5E6JA 3NRZA 4KGSA 3UGBB 3ZTCA 1IBXA 2BKRB 4KVGB 1HQRD 2KLGA 4MACA
chains in the Genus database with same CATH topology
2FCQA 4F8CB 4IWPA 4J6IA 1WM2A 1XQQA 4ZRIA 2AWTA 1AARA 3JVZX 1F9JA 2R2OA 3BY4B 2MSED 1E5WA 1Z5SB 4LDTB 2FCSA 2GMIC 1L7YA 2LGYA 3A4SC 3PV1A 2DHZA 2LXAA 1TTNA 3L13A 4DDID 4K1RB 2DENB 3UF8A 3ENEA 4TQ0A 2IO2B 5AEKB 2O2VB 1GC6A 4WWOA 1QZEA 2K6QA 3QX1A 1LFDA 1R4NI 1WE7A 2LGXA 4GB9A 3TMPB 3VTVA 4N9F4 1UZXB 2HD5B 4HDQA 4HVBA 4G11A 2BPSA 1YX5B 4FHJA 1J19A 4K7UA 3M62B 4DHZB 3VVWB 3A1QB 1IPGA 2KO3A 4ZDVA 4G50A 3UQAA 2ZJDA 2W9NA 2BYFA 3UIOB 2MCNB 1NDDA 4MH0E 2MQJA 2K6DB 3APFA 3U7DA 4MGYE 3V6EB 3X23A 2N1VA 1EF5A 2ZCCA 4NNJB 2JY6A 3WIMA 1OEYA 2J0MA 3KH0A 3IHPC 4KSKC 2J0KA 1WF9A 1KJTA 3VUXA 1WMHB 3W1YA 5CX3A 4AWJA 2NS5A 3JW0X 4BOSC 1WE6A 3NY5A 2G3QB 4ANWA 2LVPA 2GBNA 2V4LA 2KWCA 4MGIE 4WJQA 2KWVB 3PHWB 2LVOA 5J2RA 3L10B 3PGEA 3VTWA 4CO7A 2NR2A 3PRPB 1V80A 2FAZA 3DVNV 3OLMD 2KHWB 4X57B 1WGHA 1V5OA 3JSVA 3QAQA 1TBEA 4EZJA 3H7PB 4TV3A 1GC7A 2OOBB 4FA6A 1C1YB 1NI2A 1UGMA 2DAJA 3WANA 4NAWB 2FIFA 2PEAA 2KD0A 3IBEA 3ONSA 1OGWA 4MGKE 3PTFC 5KHQA 5IAAC 4IW0A 3D32A 4W9GA 3CF6E 1P98A 2I1KA 5JZEB 1WZ0A 1WXSA 2J0JA 1WZ3A 5AZGA 2D11A 1MG8A 4IG7B 4MSQB 2A4ZA 2BYVE 1WX8A 2KX3A 2Y5BB 2KNBA 1P9DU 2WDTB 3SD5A 1EUVB 2M0XA 4W9DA 3R3MA 2L00B 2IZVB 3QA8A 4RM9A 3MTNB 4BKSD 3TJPA 4FADA 4DDGD 2O6VA 4M8NA 4W9CA 1E8XA 3VXWA 3V62A 2NCNA 4BKGA 4LJPB 2GBMA 4CYEA 3DVGY 1GJZA 3ZIMA 3L0WB 4GDKA 2C9WB 3RZWC 1WJNA 2WX0A 1I35A 4KV2A 1T0YA 3VFKA 2D07B 1U4AA 2LI5A 1S3SG 3NS8A 2REXA 3PREA 3SU8X 3X0WA 5CHFA 2KJRA 4KIKA 2RSUA 2G45B 4XC2A 1ZW7A 2NBVB 3PHXB 4II3B 4A20A 4NPNA 5E6NA 2L0TA 2K8BA 2LVQA 2MX2A 2ZVOA 3APDA 1WX7A 3H6NA 4HDOA 4TQ1A 4KZCA 2DYOA 4B6WA 2G4SA 2KTRA 5C1ZA 3HM3A 4W9IA 2MP2B 4GIVA 2LXCA 4WWPA 2LASA 3A1QA 3A9JA 2CHXA 3TIXA 2IO3B 2N1WA 2AL6A 4W9FA 1WRDB 5FR6A 2HE7A 3ZVVA 4PYUA 3PRMB 1UBQA 5DPWA 3ZKJC 3KYDD 2C5LC 4WAAA 5DPTA 2ZPYA 5CHVC 4DXAB 2V3SA 4KSLC 3VHTC 2N9XA 4ANVA 2KN5A 4DHJB 2L76A 3ZTDA 2NPTA 2M4NA 3V60A 3M95A 2ZCBA 1E90A 2FUHB 3C0RB 2DYBA 2CHWA 4JQWC 5J17A 2JVCA 4MSMB 2DAFA 4GN1A 3A9KA 3R7QA 2OJRA 1BT0A 3KVFB 4HJKA 5AZHA 3KUCB 3MJWA 3N30A 2CHZA 3GZNI 2M17A 2ZEQA 4W9LA 1P3QU 4XX5A 4FBJB 2UWQA 3HM6X 3PVLA 2KLCA 4K7SA 2BF8B 3H7SA 2A5UA 1TZ1A 2LZ6A 2JT4B 2KXJA 2WX1A 2L3ZA 5D94A 4EEWA 2NBWB 2RD0A 1SE9A 2MWSB 3IFWB 4ICUA 3HIZA 1RAXA 4IM3A 4HCPB 1Q5WB 2ZVNA 2AL3A 3A33B 4AP4C 3U30A 2YVCA 1RFAA 4MJSA 3NHEB 2CU1A 4ZRJA 3U8ZA 2JRHA 1A5RA 2KQSA 2MBQA 3VUWA 4ANUA 2KX0A 2KZRA 3ALBA 4URKA 3OJ3A 2RGFA 3PRZA 3ZNHB 5D6JB 1WH3A 4I6PA 1IP9A 1WFYA 1CMXB 1WGGA 1V81A 1I42A 4EFOA 3R66C 5AZFA 2CKHB 3L08A 2B3AA 4IUMB 3HHMA 4GXBA 3AI5A 4OVUA 1KLVA 3H1UA 2Z0EB 3W1SA 3QIJA 1WX9A 1WY8A 4BKSA 1YJ1A 2C7HA 2KOXA 1WR1A 2MLBA 3AXCA 2K8HA 3I3TB 2DYMA 4GDKB 2KFKA 4W9HA 2DZMA 2FNJB 5G2NA 4HPLB 3V6CB 3DVGX 4A3OA 1P1AA 3LJ3A 4YL8A 2KFJA 4CHKA 1H4RA 4FJYA 3EECA 2JXXA 4P7IA 5DCNA 4KIKB 3ZO5B 4HK2A 2DZIA 2EMTA 2GOWA 2J7QB 3PSEB 3V61A 4B95A 2IY1B 3PLUA 4IM0A 2EMSA 3T9LA 3S2AA 2IO0B 4FJZA 2KDIA 4M8MA 3H9DA 4EUTA 3CSTA 4JIOU 5EDSA 1UELA 1WIAA 2CR5A 2N7EA 4LJOB 1YD8U 1PQSA 4FLHA 1M94A 5JHAA 1ISNA 1Q1OA 2MP2A 3TCAA 5D7GA 2HTHA 3A9JB 4AOFA 2LRUA 3DBHI 5LLIA 3EC8A 2XK5B 1IYFA 2KDFB 4M0WB 1EO6A 3ZRCA 1ZGUB 3KUZA 2YLMA 3RYTA 2JZ3B 4IC7B 1LM8B 4MEMA 3PPAA 4GGQA 4HXDA 4JLCA 2NPTB 4E3CA 1FXTB 3AU5A 3N32A 4ICVA 1S1QB 4DHZE 2MBOA 4IWOA 4TKNA 3O65B 1V6EA 1WXAA 2XEWA 1WM3A 3QARA 4LDTD 2O2VA 3PLVA 1RRBA 5CTRC 5TR5A 2JRIB 3CSFA 2WWZA 3RCZA 1G6JA 4DBGA 1WJ4A 3NZSA 3WAMA 1JRUA 5C23A 3JYUA 2MW5A 3M63B 3QK0A 4MDKE 3A4RA 2FCMA 3DBSA 3SHQA 4NJ6A 3QWZB 2L05A 3L54A 2C60A 4BOZB 2NBUA 2LWPA 3JSVB 1XT9B 2M1MA 2DZJA 2NVUI 4XZ4A 3VH4B 4NJ7A 4A3PA 2CS4A 2AEHA 4JL9A 2L8JA 3R7RA 4DWFA 3T8MA 2MBEA 3TL5A 2KJ6A 4PS7A 3VQIA 2K39A 1J8CA 2KTFA 3ML8A 4DHJD 3DCGA 2UYZB 4JGHB 4BFRA 3ML9A 3NOBA 1OTRB 3QCAA 3VH3B 1D3ZA 2LD9A 4EOYA 2ASQA 3M3JA 4GOCA 2KK8A 2K1FA 3RULA 3ZDTA 4BVUC 1GG3A 1WJUA 1YQBA 2IBIB 1VD2A 2M8SA 4MM3A 1GNUA 2O6VB 3RT3B 2KKCA 4AUQC 4PS8A 2IO1B 4EZLA 4AJWA 1X1MA 1KOTA 1R4MI 1E8WA 1V9JA 3MHSD 3EFUA 2WYQA 2N4FA 5KHOA 1WGRA 2GBJA 4G0NB 2JWZA 2G4DB 3H7PA 3KUDB 1V5TA 2PE6B 4NAWA 2BGFA 3WA0A 2BWFA 4OVVA 3AULA 1LQBA 3GOEA 2N9PC 4GDLB 1TGZB 4KDIC 1YIWA 2BYEA 2KJHB 2LRWA 2Z0DB 3B08A 3QHTA 4F7ZA 4NQLB 2KANA 2KMAA 1GUAB 3DPDA 4WJNA 3QC8B 1LXDA 3ZDMC 3SDLC 3K9PB 2C7NB 3QQ8B 4I6LB 4ZYNA 3PS6A 3W1SC 3WAPA 2ZNVB 2JF5A 3Q3JA 5E6OA 2JPHA 2N9EB 4E74A 5LXHA 4F1SA 3L17A 1ZKHA 1EF1A 3DVNU 4K7WA 4BBNC 4BKTA 3ZNGC 2R2QA 2D3GA 2LUEA 4ZRKA 2D2QA 1OQYA 2AYOB 4FN2A 2MBHA 2XK5A 2I1JA 1YX6B 4ASWC 2PPHA 4IM2A 4MELA 2MRPA 2VRRB 3VDZA 4WWNA 2V1YA 4WQOB 3TBLD 4BBNF 1KM7A 2ZNVC 4G3XB 4RM8A 1WYWB 2BWES 4HWIB 4W9KA 1J0GA 2L0FA 2ZZPB 3ZNID 3WAOA 2HJ8A 3RD2A 2FIDA 3DQVA 3ZRFA 2GBKA 2LGDA 4FJVB 5J18A 2PE9A 3APCA 3RUIB 1NBFC 4I6NB 2MA9B 3DOWA 1HE8A 1V86A 2GBRA 3PZDA 2PJHA 5G55A 5BO4B 4DK5A 4HPMB 5LXIB 3L16A 1E7VA 2KTRB 4W9EA 5E6PA 1H8CA 4WJPA 1UH6A 1OEYJ 3Q3FA 5L83A 2ZPNA 4ANXA 3UINB 3KYCD 2N7DA 2LJ5A 2JUOA 5GMVA 3K9OB 3DDCB 3UQBA 2QHOA 4MGZE 3CMMB 3ECIA 3BINA 3VAWA 3ZLZA 3EHVA 4GU2A 4IWQA 3AU4A 5HKHA 4NQKE 1E7UA 3VUYA 3ZUNA 4B9KA 1L2NA 3WALA 2KC1A 2K8CA 1SGHA 2EKEC 2FCNA 1Q0WB 4MJSB 3RZFA 1C3TA 2RPQA 1Z2MA 3HK0A 4KDLB 3ZNZB 4GSWA 1P0RA 2DZKA 2BKFA 3N3KB 1WMHA 4AJYB 5IA7A 3OJ4B 4II2B 5D2MB 4E71A 1VCBA 2KWUB 3A9KB 3B0AA 3KW5B 4FULA 4K81A 2DX5B 3ZW3A 2KDEB 1V49A 1E8ZA 2IY0B 1RLFA 4RMAA 4PYZA 2O6VD 4NY0A 4FHKA 4TUUA 1Y8RC 1WXVA 2Z59B 3IVFA 2D10A 3OAWA 3PT2B 5JH5C 5DPRA 1WJ6A 2KDBA 1WR6E 3DBLI 2KVRA 2JZZA 2KFKB 3NZUA 2IYDB 4PS3A 2K25A 4LCDE 3DBRI 4KZ0A 3IG3A 1K8RB 3VTUA 2C7MB 2MBBB 2XBBC 3UIPB 5JHBA 4HCNB 5DPSA 4GDLA 1WGYA 4EKUA 2RR9A 4WJOA 2KQ7A 2KC2A 5CHWA 1WI0A 3QJZA 4HLEA 1UD7A 1XD3B 4W9JA 5L95C 1UBIA 2KMCA 4GMVA 3UGBB 3ZTCA 4EZKA 1SIFA 2BKRB 4KVGB 3LDZE 3B1LX 1E8YA 1WGDA 1WXMA 2KLGA 1V2YA 2L7RA 3P2BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FCQ A;  4F8C B;  4IWP A;  4J6I A;  1WM2 A;  1XQQ A;  4ZRI A;  2AWT A;  1AAR A;  3JVZ X;  1F9J A;  2R2O A;  3BY4 B;  2MSE D;  1E5W A;  1Z5S B;  4LDT B;  2FCS A;  2GMI C;  1L7Y A;  2LGY A;  3A4S C;  3PV1 A;  2DHZ A;  2LXA A;  1TTN A;  3L13 A;  4DDI D;  4K1R B;  2DEN B;  3UF8 A;  3ENE A;  4TQ0 A;  2IO2 B;  5AEK B;  2O2V B;  1GC6 A;  4WWO A;  1QZE A;  2K6Q A;  3QX1 A;  1LFD A;  1R4N I;  1WE7 A;  2LGX A;  4GB9 A;  3TMP B;  3VTV A;  4N9F 4;  1UZX B;  2HD5 B;  4HDQ A;  4HVB A;  4G11 A;  2BPS A;  1YX5 B;  4FHJ A;  1J19 A;  4K7U A;  3M62 B;  4DHZ B;  3VVW B;  3A1Q B;  1IPG A;  2KO3 A;  4ZDV A;  4G50 A;  3UQA A;  2ZJD A;  2W9N A;  2BYF A;  3UIO B;  2MCN B;  1NDD A;  4MH0 E;  2MQJ A;  2K6D B;  3APF A;  3U7D A;  4MGY E;  3V6E B;  3X23 A;  2N1V A;  1EF5 A;  2ZCC A;  4NNJ B;  2JY6 A;  3WIM A;  1OEY A;  2J0M A;  3KH0 A;  3IHP C;  4KSK C;  2J0K A;  1WF9 A;  1KJT A;  3VUX A;  1WMH B;  3W1Y A;  5CX3 A;  4AWJ A;  2NS5 A;  3JW0 X;  4BOS C;  1WE6 A;  3NY5 A;  2G3Q B;  4ANW A;  2LVP A;  2GBN A;  2V4L A;  2KWC A;  4MGI E;  4WJQ A;  2KWV B;  3PHW B;  2LVO A;  5J2R A;  3L10 B;  3PGE A;  3VTW A;  4CO7 A;  2NR2 A;  3PRP B;  1V80 A;  2FAZ A;  3DVN V;  3OLM D;  2KHW B;  4X57 B;  1WGH A;  1V5O A;  3JSV A;  3QAQ A;  1TBE A;  4EZJ A;  3H7P B;  4TV3 A;  1GC7 A;  2OOB B;  4FA6 A;  1C1Y B;  1NI2 A;  1UGM A;  2DAJ A;  3WAN A;  4NAW B;  2FIF A;  2PEA A;  2KD0 A;  3IBE A;  3ONS A;  1OGW A;  4MGK E;  3PTF C;  5KHQ A;  5IAA C;  4IW0 A;  3D32 A;  4W9G A;  3CF6 E;  1P98 A;  2I1K A;  5JZE B;  1WZ0 A;  1WXS A;  2J0J A;  1WZ3 A;  5AZG A;  2D11 A;  1MG8 A;  4IG7 B;  4MSQ B;  2A4Z A;  2BYV E;  1WX8 A;  2KX3 A;  2Y5B B;  2KNB A;  1P9D U;  2WDT B;  3SD5 A;  1EUV B;  2M0X A;  4W9D A;  3R3M A;  2L00 B;  2IZV B;  3QA8 A;  4RM9 A;  3MTN B;  4BKS D;  3TJP A;  4FAD A;  4DDG D;  2O6V A;  4M8N A;  4W9C A;  1E8X A;  3VXW A;  3V62 A;  2NCN A;  4BKG A;  4LJP B;  2GBM A;  4CYE A;  3DVG Y;  1GJZ A;  3ZIM A;  3L0W B;  4GDK A;  2C9W B;  3RZW C;  1WJN A;  2WX0 A;  1I35 A;  4KV2 A;  1T0Y A;  3VFK A;  2D07 B;  1U4A A;  2LI5 A;  1S3S G;  3NS8 A;  2REX A;  3PRE A;  3SU8 X;  3X0W A;  5CHF A;  2KJR A;  4KIK A;  2RSU A;  2G45 B;  4XC2 A;  1ZW7 A;  2NBV B;  3PHX B;  4II3 B;  4A20 A;  4NPN A;  5E6N A;  2L0T A;  2K8B A;  2LVQ A;  2MX2 A;  2ZVO A;  3APD A;  1WX7 A;  3H6N A;  4HDO A;  4TQ1 A;  4KZC A;  2DYO A;  4B6W A;  2G4S A;  2KTR A;  5C1Z A;  3HM3 A;  4W9I A;  2MP2 B;  4GIV A;  2LXC A;  4WWP A;  2LAS A;  3A1Q A;  3A9J A;  2CHX A;  3TIX A;  2IO3 B;  2N1W A;  2AL6 A;  4W9F A;  1WRD B;  5FR6 A;  2HE7 A;  3ZVV A;  4PYU A;  3PRM B;  1UBQ A;  5DPW A;  3ZKJ C;  3KYD D;  2C5L C;  4WAA A;  5DPT A;  2ZPY A;  5CHV C;  4DXA B;  2V3S A;  4KSL C;  3VHT C;  2N9X A;  4ANV A;  2KN5 A;  4DHJ B;  2L76 A;  3ZTD A;  2NPT A;  2M4N A;  3V60 A;  3M95 A;  2ZCB A;  1E90 A;  2FUH B;  3C0R B;  2DYB A;  2CHW A;  4JQW C;  5J17 A;  2JVC A;  4MSM B;  2DAF A;  4GN1 A;  3A9K A;  3R7Q A;  2OJR A;  1BT0 A;  3KVF B;  4HJK A;  5AZH A;  3KUC B;  3MJW A;  3N30 A;  2CHZ A;  3GZN I;  2M17 A;  2ZEQ A;  4W9L A;  1P3Q U;  4XX5 A;  4FBJ B;  2UWQ A;  3HM6 X;  3PVL A;  2KLC A;  4K7S A;  2BF8 B;  3H7S A;  2A5U A;  1TZ1 A;  2LZ6 A;  2JT4 B;  2KXJ A;  2WX1 A;  2L3Z A;  5D94 A;  4EEW A;  2NBW B;  2RD0 A;  1SE9 A;  2MWS B;  3IFW B;  4ICU A;  3HIZ A;  1RAX A;  4IM3 A;  4HCP B;  1Q5W B;  2ZVN A;  2AL3 A;  3A33 B;  4AP4 C;  3U30 A;  2YVC A;  1RFA A;  4MJS A;  3NHE B;  2CU1 A;  4ZRJ A;  3U8Z A;  2JRH A;  1A5R A;  2KQS A;  2MBQ A;  3VUW A;  4ANU A;  2KX0 A;  2KZR A;  3ALB A;  4URK A;  3OJ3 A;  2RGF A;  3PRZ A;  3ZNH B;  5D6J B;  1WH3 A;  4I6P A;  1IP9 A;  1WFY A;  1CMX B;  1WGG A;  1V81 A;  1I42 A;  4EFO A;  3R66 C;  5AZF A;  2CKH B;  3L08 A;  2B3A A;  4IUM B;  3HHM A;  4GXB A;  3AI5 A;  4OVU A;  1KLV A;  3H1U A;  2Z0E B;  3W1S A;  3QIJ A;  1WX9 A;  1WY8 A;  4BKS A;  1YJ1 A;  2C7H A;  2KOX A;  1WR1 A;  2MLB A;  3AXC A;  2K8H A;  3I3T B;  2DYM A;  4GDK B;  2KFK A;  4W9H A;  2DZM A;  2FNJ B;  5G2N A;  4HPL B;  3V6C B;  3DVG X;  4A3O A;  1P1A A;  3LJ3 A;  4YL8 A;  2KFJ A;  4CHK A;  1H4R A;  4FJY A;  3EEC A;  2JXX A;  4P7I A;  5DCN A;  4KIK B;  3ZO5 B;  4HK2 A;  2DZI A;  2EMT A;  2GOW A;  2J7Q B;  3PSE B;  3V61 A;  4B95 A;  2IY1 B;  3PLU A;  4IM0 A;  2EMS A;  3T9L A;  3S2A A;  2IO0 B;  4FJZ A;  2KDI A;  4M8M A;  3H9D A;  4EUT A;  3CST A;  4JIO U;  5EDS A;  1UEL A;  1WIA A;  2CR5 A;  2N7E A;  4LJO B;  1YD8 U;  1PQS A;  4FLH A;  1M94 A;  5JHA A;  1ISN A;  1Q1O A;  2MP2 A;  3TCA A;  5D7G A;  2HTH A;  3A9J B;  4AOF A;  2LRU A;  3DBH I;  5LLI A;  3EC8 A;  2XK5 B;  1IYF A;  2KDF B;  4M0W B;  1EO6 A;  3ZRC A;  1ZGU B;  3KUZ A;  2YLM A;  3RYT A;  2JZ3 B;  4IC7 B;  1LM8 B;  4MEM A;  3PPA A;  4GGQ A;  4HXD A;  4JLC A;  2NPT B;  4E3C A;  1FXT B;  3AU5 A;  3N32 A;  4ICV A;  1S1Q B;  4DHZ E;  2MBO A;  4IWO A;  4TKN A;  3O65 B;  1V6E A;  1WXA A;  2XEW A;  1WM3 A;  3QAR A;  4LDT D;  2O2V A;  3PLV A;  1RRB A;  5CTR C;  5TR5 A;  2JRI B;  3CSF A;  2WWZ A;  3RCZ A;  1G6J A;  4DBG A;  1WJ4 A;  3NZS A;  3WAM A;  1JRU A;  5C23 A;  3JYU A;  2MW5 A;  3M63 B;  3QK0 A;  4MDK E;  3A4R A;  2FCM A;  3DBS A;  3SHQ A;  4NJ6 A;  3QWZ B;  2L05 A;  3L54 A;  2C60 A;  4BOZ B;  2NBU A;  2LWP A;  3JSV B;  1XT9 B;  2M1M A;  2DZJ A;  2NVU I;  4XZ4 A;  3VH4 B;  4NJ7 A;  4A3P A;  2CS4 A;  2AEH A;  4JL9 A;  2L8J A;  3R7R A;  4DWF A;  3T8M A;  2MBE A;  3TL5 A;  2KJ6 A;  4PS7 A;  3VQI A;  2K39 A;  1J8C A;  2KTF A;  3ML8 A;  4DHJ D;  3DCG A;  2UYZ B;  4JGH B;  4BFR A;  3ML9 A;  3NOB A;  1OTR B;  3QCA A;  3VH3 B;  1D3Z A;  2LD9 A;  4EOY A;  2ASQ A;  3M3J A;  4GOC A;  2KK8 A;  2K1F A;  3RUL A;  3ZDT A;  4BVU C;  1GG3 A;  1WJU A;  1YQB A;  2IBI B;  1VD2 A;  2M8S A;  4MM3 A;  1GNU A;  2O6V B;  3RT3 B;  2KKC A;  4AUQ C;  4PS8 A;  2IO1 B;  4EZL A;  4AJW A;  1X1M A;  1KOT A;  1R4M I;  1E8W A;  1V9J A;  3MHS D;  3EFU A;  2WYQ A;  2N4F A;  5KHO A;  1WGR A;  2GBJ A;  4G0N B;  2JWZ A;  2G4D B;  3H7P A;  3KUD B;  1V5T A;  2PE6 B;  4NAW A;  2BGF A;  3WA0 A;  2BWF A;  4OVV A;  3AUL A;  1LQB A;  3GOE A;  2N9P C;  4GDL B;  1TGZ B;  4KDI C;  1YIW A;  2BYE A;  2KJH B;  2LRW A;  2Z0D B;  3B08 A;  3QHT A;  4F7Z A;  4NQL B;  2KAN A;  2KMA A;  1GUA B;  3DPD A;  4WJN A;  3QC8 B;  1LXD A;  3ZDM C;  3SDL C;  3K9P B;  2C7N B;  3QQ8 B;  4I6L B;  4ZYN A;  3PS6 A;  3W1S C;  3WAP A;  2ZNV B;  2JF5 A;  3Q3J A;  5E6O A;  2JPH A;  2N9E B;  4E74 A;  5LXH A;  4F1S A;  3L17 A;  1ZKH A;  1EF1 A;  3DVN U;  4K7W A;  4BBN C;  4BKT A;  3ZNG C;  2R2Q A;  2D3G A;  2LUE A;  4ZRK A;  2D2Q A;  1OQY A;  2AYO B;  4FN2 A;  2MBH A;  2XK5 A;  2I1J A;  1YX6 B;  4ASW C;  2PPH A;  4IM2 A;  4MEL A;  2MRP A;  2VRR B;  3VDZ A;  4WWN A;  2V1Y A;  4WQO B;  3TBL D;  4BBN F;  1KM7 A;  2ZNV C;  4G3X B;  4RM8 A;  1WYW B;  2BWE S;  4HWI B;  4W9K A;  1J0G A;  2L0F A;  2ZZP B;  3ZNI D;  3WAO A;  2HJ8 A;  3RD2 A;  2FID A;  3DQV A;  3ZRF A;  2GBK A;  2LGD A;  4FJV B;  5J18 A;  2PE9 A;  3APC A;  3RUI B;  1NBF C;  4I6N B;  2MA9 B;  3DOW A;  1HE8 A;  1V86 A;  2GBR A;  3PZD A;  2PJH A;  5G55 A;  5BO4 B;  4DK5 A;  4HPM B;  5LXI B;  3L16 A;  1E7V A;  2KTR B;  4W9E A;  5E6P A;  1H8C A;  4WJP A;  1UH6 A;  1OEY J;  3Q3F A;  5L83 A;  2ZPN A;  4ANX A;  3UIN B;  3KYC D;  2N7D A;  2LJ5 A;  2JUO A;  5GMV A;  3K9O B;  3DDC B;  3UQB A;  2QHO A;  4MGZ E;  3CMM B;  3ECI A;  3BIN A;  3VAW A;  3ZLZ A;  3EHV A;  4GU2 A;  4IWQ A;  3AU4 A;  5HKH A;  4NQK E;  1E7U A;  3VUY A;  3ZUN A;  4B9K A;  1L2N A;  3WAL A;  2KC1 A;  2K8C A;  1SGH A;  2EKE C;  2FCN A;  1Q0W B;  4MJS B;  3RZF A;  1C3T A;  2RPQ A;  1Z2M A;  3HK0 A;  4KDL B;  3ZNZ B;  4GSW A;  1P0R A;  2DZK A;  2BKF A;  3N3K B;  1WMH A;  4AJY B;  5IA7 A;  3OJ4 B;  4II2 B;  5D2M B;  4E71 A;  1VCB A;  2KWU B;  3A9K B;  3B0A A;  3KW5 B;  4FUL A;  4K81 A;  2DX5 B;  3ZW3 A;  2KDE B;  1V49 A;  1E8Z A;  2IY0 B;  1RLF A;  4RMA A;  4PYZ A;  2O6V D;  4NY0 A;  4FHK A;  4TUU A;  1Y8R C;  1WXV A;  2Z59 B;  3IVF A;  2D10 A;  3OAW A;  3PT2 B;  5JH5 C;  5DPR A;  1WJ6 A;  2KDB A;  1WR6 E;  3DBL I;  2KVR A;  2JZZ A;  2KFK B;  3NZU A;  2IYD B;  4PS3 A;  2K25 A;  4LCD E;  3DBR I;  4KZ0 A;  3IG3 A;  1K8R B;  3VTU A;  2C7M B;  2MBB B;  2XBB C;  3UIP B;  5JHB A;  4HCN B;  5DPS A;  4GDL A;  1WGY A;  4EKU A;  2RR9 A;  4WJO A;  2KQ7 A;  2KC2 A;  5CHW A;  1WI0 A;  3QJZ A;  4HLE A;  1UD7 A;  1XD3 B;  4W9J A;  5L95 C;  1UBI A;  2KMC A;  4GMV A;  3UGB B;  3ZTC A;  4EZK A;  1SIF A;  2BKR B;  4KVG B;  3LDZ E;  3B1L X;  1E8Y A;  1WGD A;  1WXM A;  2KLG A;  1V2Y A;  2L7R A;  3P2B A; 
#chains in the Genus database with same CATH topology
 3BK2 A;  1TTN A;  3L13 A;  4DDI D;  1HZ6 A;  4TQ0 A;  2O2V B;  1QZE A;  3QX1 A;  5LNK 1;  2NTT A;  2LGX A;  1ZUD 2;  1UZX B;  2HD5 B;  2BS4 B;  4US9 A;  2BPS A;  3BK1 A;  4RF1 A;  1J19 A;  3M62 B;  3U52 E;  4G50 A;  2DBY A;  4MGY E;  1F2R I;  1EF5 A;  4HJG E;  2QJL A;  2J52 A;  1OEY A;  2J0M A;  2BW2 A;  4S17 A;  1WMH B;  4L2Y A;  1QT9 A;  2NS5 A;  3JW0 X;  3NY5 A;  2G3Q B;  1P7F A;  2KWC A;  3NZ3 A;  2KWV B;  2WXG A;  3PHW B;  4WJQ A;  2LVO A;  5FK9 C;  5J2R A;  5BYR A;  2FAZ A;  2KHW B;  3Q8F A;  4EZJ A;  1GC7 A;  1AYF A;  1VRA B;  1ZDX A;  3ONS A;  4LTU A;  4OVZ A;  2I1K A;  2WXF A;  1WZ0 A;  1ZPS A;  2J0J A;  1MG8 A;  4IG7 B;  2A4Z A;  2KX3 A;  1P9D U;  1QOA A;  2M0X A;  4XGA B;  3Q3N C;  2L00 B;  1TKE A;  3MHZ A;  3TJP A;  3AE5 B;  4MM3 B;  4FAD A;  3W9C B;  1E8X A;  3VXW A;  1CQV A;  3ZIM A;  4GDK A;  2C9W B;  2WX0 A;  4YTP B;  1HZ5 A;  1FNV A;  1U4A A;  4A8X C;  3PRE A;  1ENF A;  5CHF A;  1C77 A;  1UNS A;  2W3R A;  4RGO S;  1I4R A;  5E6N A;  3H8H A;  2IPK D;  2ZVO A;  3EA6 A;  4YTN B;  3B2G A;  2G4S A;  2XNA C;  4ZRQ A;  4GIV A;  4WWP A;  2LAS A;  3A1Q A;  2CHX A;  5IOI A;  2IO3 B;  2AL6 A;  2ON8 A;  5CHV C;  4DXA B;  4KSL C;  3VHT C;  2N9X A;  2IGD A;  3IAM 1;  2L76 A;  1YQ4 B;  2M4N A;  1ET9 A;  1KLG D;  3C0R B;  1YN5 A;  3V05 A;  4JQW C;  2JX5 A;  2PMV A;  4REZ A;  4GN1 A;  2OJR A;  1FNU A;  4HEA 1;  3ETR A;  2ZEQ A;  4W9L A;  3PVL A;  2KLC A;  1WXQ A;  1TY0 A;  2LHD A;  2A5U A;  1JCK B;  1ESF A;  4WIP A;  5D94 A;  2MWS B;  2GRI A;  3NUH B;  2RPV A;  3AEC B;  3LYY A;  3A33 B;  3U30 A;  1OQR A;  4C4V A;  4KGT A;  2CU1 A;  3U8Z A;  2X38 A;  2N9K A;  2KQS A;  2RGF A;  5D6J B;  1WH3 A;  1WFY A;  4EFO A;  2CKH B;  2NMQ A;  3L08 A;  3P4S B;  2AX5 A;  5BYS A;  3FIL A;  1QKZ A;  1TS5 A;  3HHM A;  3AI5 A;  2G1E A;  2Z0E B;  3W1S A;  1WY8 A;  1L5P A;  4W9H A;  5HHD G;  1FRR A;  4KKI A;  3LJ3 A;  2KFJ A;  1K52 A;  1H4R A;  4FJY A;  3Q8C A;  3AE2 B;  2EMT A;  3V61 A;  2WLB A;  4P16 A;  2IO0 B;  2MJE A;  2ZW0 A;  3CST A;  5EDS A;  1UEL A;  2B76 B;  1YD8 U;  2N0S B;  3MFG A;  1Q1O A;  5EE1 A;  3NS1 A;  4JX1 C;  2DLB A;  5D7G A;  3A9J B;  3RNG C;  1T0S C;  3ZYY X;  2KVZ A;  4OZA A;  3EC8 A;  4DQO C;  2INN E;  1XCQ L;  1TT5 B;  1WYG A;  5D3I B;  4A9A A;  3N32 A;  1S1Q B;  4DHZ E;  4TKN A;  1PDX A;  1V6E A;  4RGT A;  3MC0 B;  3TEW A;  1G6J A;  1TKY A;  1WJ4 A;  5C23 A;  2MW5 A;  3LB8 C;  2H89 B;  3A4R A;  4M01 A;  3GP7 A;  3DBS A;  1QOF A;  2C60 A;  2GLS A;  2PKO A;  1XT9 B;  2IGH A;  4XZ4 A;  4A3P A;  4NJ7 A;  3NVV A;  1ZXH A;  2LEK A;  3P1M A;  4DWF A;  3T8M A;  1J7C A;  4RFB A;  2KJ6 A;  4PS7 A;  1QOG A;  2I38 A;  3DHI C;  4YSY B;  2MEK A;  4DHJ D;  1L4Z B;  1T6B X;  3MC8 A;  1B9R A;  3QCA A;  4EOY A;  4IOI E;  4DXG A;  1WJU A;  4YT0 B;  1VD2 A;  4N6E B;  4PS8 A;  2IO1 B;  1KOT A;  1V9J A;  3MHS D;  1KH0 A;  2VZK D;  3H7P A;  3KUD B;  4H2A A;  4ZRP A;  1YOV B;  1NYR A;  2BGF A;  2V4I B;  1LQB A;  3RNA C;  1V97 A;  2KJH B;  2LRW A;  5H92 C;  4NQL B;  4WJN A;  1LXD A;  3K9P B;  2C7N B;  3QQ8 B;  4ZYN A;  3W1S C;  3PS6 A;  3WAP A;  2CJO A;  3Q3J A;  1UWX A;  3L17 A;  1ZKH A;  5AUK A;  2R2Q A;  2LUE A;  2JYT A;  1GOZ A;  1N5X A;  4FN2 A;  2XK5 A;  4RGN A;  2I1J A;  1YX6 B;  3DBR B;  4ASW C;  2PPH A;  5IO9 A;  2MRP A;  2LHE A;  5BYQ A;  2V1Y A;  4HWI B;  2WHI A;  1N6Z A;  2GBK A;  2LGD A;  3AEB B;  1F52 A;  3RUI B;  4I6N B;  2GBR A;  3PZD A;  3WCQ A;  5LXI B;  5BMH A;  2QMT A;  1UH6 A;  2L32 A;  1D5M C;  4ANX A;  4P1C C;  1I4H A;  3W5U B;  3CMM B;  3ZLZ A;  5HKH A;  2RDB C;  1L2N A;  1STE A;  4ACF A;  3WAL A;  2KC1 A;  2FCN A;  1Q0W B;  2FE8 A;  1VJK A;  2TSS A;  3Q6B A;  2KDE B;  1E8Z A;  2O6V D;  4LLG M;  4TUU A;  1Y8R C;  4J3O D;  2QDF A;  1IGC A;  2Z59 B;  5DPR A;  1WJ6 A;  1WR6 E;  2WDV B;  3P42 A;  2KVR A;  3NZU A;  1JRO A;  1RWS A;  4LCD E;  3DBR I;  2L83 A;  4KZ0 A;  5T8I A;  2H88 B;  2C7M B;  1OQQ A;  2MBB B;  5G5G A;  4HCN B;  4GDL A;  2RR9 A;  4WJO A;  2W3S A;  4ITK A;  3BYY B;  3QJZ A;  5L95 C;  1NI3 A;  2YEP B;  2N7J A;  1E8Y A;  3P4Q B;  3AMZ A;  1VDV A;  4IWP A;  5IP4 D;  1WM2 A;  3AE3 B;  1XQQ A;  3C8Y A;  1SSN A;  1F9J A;  1E5W A;  2W82 A;  1UWM A;  1Z5S B;  4LDT B;  2GMI C;  2LGY A;  1L7Y A;  3PO0 A;  4HRS A;  4K1R B;  4WH4 A;  3TSS A;  3ENE A;  4LNO A;  1GC6 A;  4WWO A;  2K6Q A;  2IND C;  1N60 A;  4GB9 A;  1BXT A;  4N9F 4;  4HDQ A;  4G11 A;  2K22 A;  4IDI A;  1IPG A;  3UQA A;  4JE3 B;  2BYF A;  3ZJT A;  2MCN B;  1NDD A;  2MQJ A;  3U7D A;  1XLO A;  3V6E B;  2WXJ A;  3X23 A;  1XXG A;  2N1V A;  1LGR A;  1PGB A;  1R7S A;  4US8 A;  1KJT A;  5CX3 A;  4BOS C;  1PGA A;  4ANW A;  3L10 B;  1V80 A;  3DVN V;  1T0Q C;  3OLM D;  4X57 B;  4OZC A;  1WGH A;  3JSV A;  1TBE A;  2QEJ C;  2W55 A;  2OOB B;  1C1Y B;  3WAN A;  3SFD B;  2PEA A;  2KD0 A;  4MGK E;  3PTF C;  5KHQ A;  4IW0 A;  1KTK A;  1E7P B;  4MSQ B;  1K50 A;  2BYV E;  1WX8 A;  4NJC A;  3SD5 A;  2M19 A;  2IZV B;  1I4P A;  3MTN B;  1C4A A;  5TSS A;  4YWG G;  4BKG A;  4LJP B;  3DVG Y;  1F77 A;  1R4N B;  1XLP A;  4B0E A;  3RZW C;  1I35 A;  4KV2 A;  1S3S G;  3NG0 A;  2E3T A;  1KFY B;  1V1P B;  4L23 A;  4II3 B;  2NBV B;  4NPN A;  2LVQ A;  3H6N A;  2K5P A;  3APD A;  4HDO A;  3AE6 B;  3DWM A;  4TQ1 A;  4RCO A;  4KZC A;  3B9J A;  2VH2 A;  5C1Z A;  3HM3 A;  4W9I A;  2K3U A;  2OED A;  2N1W A;  1WRD B;  5FR6 A;  2HE7 A;  1GAQ B;  3ZKJ C;  4WAA A;  3UI3 A;  2Y5P A;  2ZPY A;  1N62 A;  4ZHO A;  3BWU D;  3AE9 B;  2INC C;  1JML A;  3M95 A;  3V60 A;  1RYJ A;  3MC9 A;  2FUH B;  2DYB A;  2RDG A;  5J17 A;  2JVC A;  3R7Q A;  3A9K A;  1TYG B;  3AE7 B;  4HJK A;  1ROE A;  4FBJ B;  2QCZ A;  4K7S A;  3N9Y C;  2BF8 B;  1R4M B;  2LZ6 A;  4EEW A;  1D4B A;  1UF0 A;  2RD0 A;  1A70 A;  1HTO A;  1SE9 A;  3IFW B;  4ICU A;  1RAX A;  4IM3 A;  4HCP B;  4ARC A;  2AL3 A;  2AQ2 B;  3I9V 1;  2IGG A;  1RFA A;  3NHE B;  1RM6 C;  1AWD A;  3GE8 C;  4NAM A;  1KLU D;  4AS1 A;  1N5W A;  3R66 C;  2BB6 A;  2B3A A;  3ZQ4 A;  4GXB A;  1JWS D;  2LMC A;  3H1U A;  1WX9 A;  2I2Y A;  1YJ1 A;  3FAH A;  2C7H A;  2PW9 A;  2ONQ A;  3I3T B;  4GDK B;  2KFK A;  5G2N A;  1NEK B;  2K9X A;  2ICI A;  4KX6 B;  1C4P A;  3EEC A;  4P7I A;  5DCN A;  2DZI A;  4EE2 A;  3AE4 B;  5EE0 A;  3S2A A;  2KDI A;  4M8M A;  2WDQ B;  5AUI A;  4XDC A;  4JIO U;  2CR5 A;  2R61 A;  2N7E A;  1M94 A;  3VRB B;  4AOF A;  2LRU A;  3DBH I;  5LLI A;  2XK5 B;  1IYF A;  1L0X B;  3E56 A;  1ZGU B;  1PYW D;  1LM8 B;  4HXD A;  2HJ1 A;  3Q69 A;  2NPT B;  4E3C A;  1FXT B;  4ICV A;  2MBO A;  3O65 B;  1WXA A;  3ZNH B;  1WM3 A;  3PLV A;  5TR5 A;  3SFE B;  2JRI B;  3CSF A;  2WWZ A;  3WAM A;  3QK0 A;  4NJ6 A;  1XLQ A;  2L05 A;  3L54 A;  1AW7 A;  4JL9 A;  2L8J A;  3R7R A;  3OWE B;  5EE3 A;  1E10 A;  3VQI A;  1FD6 A;  2YEP F;  1L0V B;  2UYZ B;  3KWL A;  1QIL A;  4JGH B;  1JWB D;  1OTR B;  3VH3 B;  2G9H D;  1JWU D;  2ASQ A;  4GOC A;  2KK8 A;  2NTS A;  3RUL A;  4USA A;  2IBI B;  1NYQ A;  4AUQ C;  1GNU A;  2O6V B;  4KGR A;  4LNK A;  1WRI A;  3EFU A;  1WGK A;  1WGR A;  3N20 C;  4G0N B;  2JWZ A;  1JWM D;  1HXY D;  3WA0 A;  3GOE A;  4GDL B;  4KDI C;  3DHG C;  2BYE A;  3QHT A;  1V1P A;  2KAN A;  4RGM A;  3ZDM C;  3QC8 B;  3SEB A;  2BTE A;  2L1A A;  4FXC A;  3SDL C;  1C9F A;  3AED B;  3VRA B;  3T3N A;  5E6O A;  2N9E B;  5LXH A;  1I4X A;  1J7A A;  4BBN C;  2V9H A;  1OQY A;  4A6Q A;  2MBH A;  4GLS C;  3VDZ A;  3RN9 C;  4RH6 A;  1EU3 A;  1D5X C;  1J0G A;  2ZW1 A;  2L0F A;  3ZNI D;  3RD2 A;  4FJV B;  2PE9 A;  3DOW A;  4DK5 A;  3L16 A;  1E7V A;  3IT4 B;  3VR8 B;  3HUI A;  2KTR B;  1DOI A;  3I63 C;  4W9E A;  1HEZ E;  4WJP A;  5E6P A;  1H8C A;  2ZPN A;  2N7D A;  1CK1 A;  2JUO A;  2LJ5 A;  5GMV A;  5I4D A;  3K9O B;  4R3D A;  4XDD A;  3ECI A;  3EHV A;  4IWQ A;  2WXH A;  1E7U A;  1FCL A;  2WXL A;  4MJS B;  1C3T A;  4D2K A;  3P4R B;  2RPQ A;  1Z2M A;  4KDL B;  1ZDV A;  4GSW A;  1TS3 A;  3RNE C;  3N3K B;  5IA7 A;  4II2 B;  5D2M B;  2BQQ A;  2KWU B;  3ZW3 A;  2KWD A;  2IY0 B;  1RLF A;  3NJT A;  4RMA A;  1UGJ A;  4YTM B;  3FKY A;  4NY0 A;  2OJW A;  2W54 A;  3OAW A;  5JH5 C;  2KDB A;  2KN4 A;  3W2D A;  1L6U A;  3GB1 A;  2IYD B;  1I4Q A;  3CWI A;  1K8R B;  4N58 A;  5IN7 A;  1C76 A;  5C3J B;  3EFC A;  1MFW A;  2D3A A;  2KQ7 A;  2KAC A;  5CHW A;  1FCC C;  1WI0 A;  3PZ7 A;  4C7Y A;  1XD3 B;  4W9J A;  4GMV A;  1HTQ A;  2BB5 A;  1SIF A;  2X8X X;  4XYC A;  4OZB A;  2MHJ A;  3B1L X;  3RFZ B;  1WXM A;  5EE9 A;  3FIL B;  1V2Y A;  1MG4 A;  3P2B A;  1DYQ A;  1FFU A;  4J6I A;  2KAJ A;  1M4V A;  2LUM A;  2AWT A;  3BY4 B;  1IGD A;  2FCS A;  3A4S C;  2LXA A;  2DEN B;  5AEK B;  1LFD A;  1R4N I;  1ZOY B;  3TMP B;  3VTV A;  1SE2 A;  3J9C A;  4ZHP A;  3Q3M C;  4FHJ A;  4K7U A;  4ZDV A;  5D3D A;  2W9N A;  3UIO B;  2QIL A;  3T3O A;  4MH0 E;  2K6D B;  1FIQ A;  1FPY A;  2ZCC A;  4NNJ B;  4KSK C;  2WU5 B;  2J0K A;  2PLP A;  2V0G A;  4AWJ A;  3P4P B;  1WE6 A;  4K3B A;  4HPP A;  1ZXI A;  5HI1 A;  2GBN A;  4MGI E;  1E6E B;  1FEH A;  3PGE A;  3VTW A;  4CO7 A;  2EEL A;  4YXD B;  1QOB A;  3B2F A;  1V5O A;  4Q2J A;  4TV3 A;  1NI2 A;  4C7Z A;  1XCT L;  3W5V B;  2PIA A;  3D32 A;  4W9G A;  2V3N A;  3BII D;  5AZG A;  2D11 A;  1T5X D;  2KNB A;  1EUV B;  1VLB A;  2JQR B;  1GB4 A;  3R3M A;  2WXI A;  4DDG D;  4W9C A;  4M8N A;  3V62 A;  2GBM A;  1GJZ A;  4HRO A;  1VZ8 A;  4HKZ E;  3OG5 A;  3IAS 1;  1T0Y A;  3VFK A;  2LI5 A;  2WNM A;  5FKA C;  3SU8 X;  2HDE A;  3X0W A;  4KIK A;  2RSU A;  2G45 B;  3CIR B;  4XC2 A;  1ZW7 A;  1TY2 A;  1WX7 A;  4AQ7 A;  1FRD A;  2KTR A;  2Z8L A;  2LXC A;  4W9F A;  1WWT A;  3ZVV A;  5DPW A;  4PYU A;  1JAL A;  5GXG B;  4DHJ B;  2NPT A;  1E90 A;  4P1B C;  3N1Y C;  1BT0 A;  5AZH A;  1TJE A;  1K51 A;  3MJW A;  3N30 A;  2CHZ A;  4XE0 A;  1P3Q U;  4XX5 A;  2UWQ A;  3HM6 X;  3MJ5 A;  4NZL B;  2WX1 A;  2JT4 B;  2KXJ A;  2L3Z A;  3ZGZ A;  3HIZ A;  4L1B A;  1IUE A;  1C4C A;  2ZVN A;  4AP4 C;  4C00 A;  2V3P A;  4ZRJ A;  2JRH A;  2QSD A;  1A5R A;  3IXS A;  4XWT A;  2KX0 A;  2KZR A;  3ALB A;  3OJ3 A;  1PGX A;  1T3Q A;  2FUG 1;  2LGI A;  3PRZ A;  1C78 A;  1F2R C;  1WGG A;  1CMX B;  3HVD A;  1V81 A;  2SEB D;  1I42 A;  1N61 A;  4IUM B;  2J4X A;  4OVU A;  1KLV A;  3QIJ A;  2KOX A;  1WR1 A;  2HTM E;  2MLB A;  2K8H A;  3AXC A;  3V6C B;  4YL8 A;  3ZO5 B;  3DBH B;  3PSE B;  4B95 A;  2IY1 B;  1ZE3 D;  2EMS A;  3BVZ A;  3IT6 B;  4N59 A;  5JHA A;  2WXK A;  4LJO B;  4FLH A;  1PQS A;  2MP2 A;  3AE8 B;  2D3B A;  3TCA A;  2HTH A;  2KDF B;  3ZRC A;  1EO6 A;  1EU4 A;  1KF6 B;  3KUZ A;  4MEM A;  4JLC A;  3AEF B;  3AU5 A;  1AN8 A;  4LDT D;  2XEW A;  1RRB A;  1C79 A;  3DBL B;  1SB3 C;  4A55 A;  3NZS A;  2JYE A;  1EWY C;  1YMH E;  3M63 B;  4OW0 A;  2FCM A;  3TEY A;  3SHQ A;  4IKG A;  3U4E G;  4ZYS A;  4BOZ B;  2NBU A;  2M1M A;  1Y56 A;  2WDR B;  2CS4 A;  2AEH A;  1L4D B;  4WUR A;  2KDM A;  1J8C A;  1B1Z A;  2KTF A;  2L52 A;  3ML8 A;  1FFV A;  1SE3 A;  3KLS X;  3AN1 A;  3ML9 A;  3NOB A;  2DNF A;  1VR9 A;  4JWU C;  1VZ6 A;  4WWM A;  3DHH C;  4RNA A;  2WXO A;  4MM3 A;  3RT3 B;  4AJW A;  1X1M A;  4MT5 A;  1R4M I;  1E8W A;  5C2T B;  1FXI A;  3ZJV A;  2WYQ A;  2N4F A;  5KHO A;  2GBJ A;  1DOX A;  1TIF A;  2WXQ A;  2G4D B;  1V5T A;  1Q10 A;  4K3C A;  4NAW A;  2BWF A;  4OVV A;  2VH1 A;  2N9P C;  1TGZ B;  3B08 A;  3DPD A;  1GUA B;  2LGS A;  3AE1 B;  5IKC M;  2BS2 B;  2WU2 B;  2JPH A;  2GI9 A;  1SXT A;  1NEN B;  3ZNG C;  3RNC C;  4ZRK A;  3NVY A;  4M0W A;  4MEL A;  2VRR B;  3Q2A C;  4BBN F;  4WQO B;  1KM7 A;  2E6X A;  3AH7 A;  4G3X B;  2BYT A;  2BWE S;  2ZZP B;  2HJ8 A;  2FID A;  3DQV A;  2PVO D;  3APC A;  2WS3 B;  2IDY A;  2WXM A;  3V3X A;  1ET6 A;  2MA9 B;  1HE8 A;  1SE4 A;  1V86 A;  5G55 A;  2PJH A;  5BO4 B;  4LNI A;  4PT5 A;  3Q3F A;  1OEY J;  1D5Z C;  3UIN B;  3KYC D;  2INP E;  4KKJ A;  1TZO A;  3DDC B;  2QHO A;  3AU4 A;  4LK0 M;  2QIE B;  4NQK E;  1SGH A;  3Q14 C;  3ABV B;  1E0Z A;  1P0R A;  2DZK A;  1N63 A;  2BKF A;  1WMH A;  4AJY B;  2KYW A;  3OJ4 B;  3AV8 A;  4E71 A;  3A9K B;  3KW5 B;  4K81 A;  4ZOH C;  4FHK A;  1T0R C;  3GE3 C;  2MJD A;  1L0Y B;  3IVF A;  3PT2 B;  1K53 A;  1MPE A;  1JRP A;  4PS3 A;  2K25 A;  2WP9 B;  3VTU A;  2XBB C;  2KC2 A;  2Q5W D;  3BYT B;  4QAY A;  1UBI A;  2KMC A;  3E9S A;  4EZK A;  3LDZ E;  1I7H A;  1WGD A;  1HA5 A;  2QC8 A;  2L7R A;  2FCQ A;  4ZRI A;  1AAR A;  2RDH A;  3GZN B;  3JVZ X;  2R2O A;  4M00 A;  2MSE D;  1XLN A;  3PV1 A;  2DHZ A;  2N9L A;  4O1N A;  2PVG C;  3UF8 A;  2IO2 B;  1WE7 A;  2CJN A;  1YN4 A;  3U7Z A;  4OHJ A;  4C80 A;  4HVB A;  3N1Z C;  2RMM A;  3AB5 A;  2AQ1 B;  1YX5 B;  4DHZ B;  3VVW B;  3RI7 C;  3A1Q B;  2KO3 A;  2ZJD A;  1FO4 A;  1F0Z A;  1XF5 L;  4JWS C;  2XN9 C;  3APF A;  1FMA D;  4P6V F;  2WGS A;  3WIM A;  2JY6 A;  3KH0 A;  3IHP C;  1WF9 A;  1FXA A;  3VUX A;  3W1Y A;  4C56 C;  2LVP A;  1TS2 A;  2GB1 A;  2V4L A;  5BMG A;  2NR2 A;  3PRP B;  2SAK A;  2JSV X;  4HKQ A;  3QAQ A;  3H7P B;  3N1X C;  4FA6 A;  2DAJ A;  1EM7 A;  1UGM A;  1ZP0 B;  4NAW B;  2FIF A;  1E9M A;  3IBE A;  1JQ4 A;  1OFF A;  1OGW A;  1ACC A;  5IAA C;  1V8C A;  3CF6 E;  3LXF A;  1P98 A;  5JZE B;  1YQ3 B;  1WXS A;  1WZ3 A;  1PFD A;  2Y5B B;  2WDT B;  4YSX B;  1IBX B;  4W9D A;  3QA8 A;  1DGJ A;  4RM9 A;  4BKS D;  1VZ7 A;  2O6V A;  2NCN A;  4CYE A;  3L0W B;  1F1H A;  1WJN A;  2D07 B;  1SIJ A;  3BVM A;  3NS8 A;  1TS4 A;  2REX A;  3HRD D;  2K0P A;  2JWU A;  2KJR A;  5H8Y E;  1LO5 D;  3PHX B;  4A20 A;  2L0T A;  2K8B A;  2MX2 A;  1CJE A;  1TKG A;  2DYO A;  3URY A;  4B6W A;  2MP2 B;  4CQN A;  3A9J A;  2JU6 X;  3TIX A;  3SR6 A;  3PRM B;  1UBQ A;  1QLB B;  2ACZ B;  2C5L C;  3KYD D;  5DPT A;  2V3S A;  3KWV A;  1YJI A;  4RF0 A;  2KN5 A;  4ANV A;  3ZTD A;  1QF6 A;  2ZCB A;  4MH8 A;  2CHW A;  4MSM B;  2DAF A;  3KVF B;  3RNB C;  3KUC B;  2M0A A;  3C19 A;  3GZN I;  2M17 A;  3ZXR A;  2EKI A;  2WXR A;  3H7S A;  1TZ1 A;  1RFK A;  2WQY B;  4BAX A;  2NBW B;  2Y3A A;  1XEE A;  1Q5W B;  2YVC A;  4MJS A;  2PTL A;  3FC4 A;  2AQ3 B;  4ARI A;  2VZK B;  2MBQ A;  3VUW A;  4TSS A;  2BS3 B;  4ANU A;  4URK A;  3RPF C;  1IP9 A;  4I6P A;  1MJD A;  5G5H A;  5AZF A;  3PZ8 A;  1JWA D;  4BKS A;  2DYM A;  2DZM A;  2FNJ B;  4HPL B;  1DOY A;  3DVG X;  4A3O A;  1P1A A;  3GS2 A;  4CHK A;  2JXX A;  4KIK B;  4HK2 A;  2GOW A;  2J7Q B;  1SBB B;  3PLU A;  4IM0 A;  3T9L A;  3BVG A;  4FJZ A;  3H9D A;  4EUT A;  2CU3 A;  2UU7 A;  1WIA A;  1KRH A;  1ISN A;  1JW9 D;  1YNT E;  3ZJU A;  4M0W B;  3AM9 A;  2YLM A;  3RYT A;  5FR3 A;  2JZ3 B;  4IC7 B;  3ZXV A;  3PPA A;  4GGQ A;  1V1O A;  5MPO A;  1UUP A;  3TUO A;  2JXT A;  4IWO A;  3EUB 2;  2FBW B;  3QAR A;  3ZNZ B;  4F8C B;  5CTR C;  2O2V A;  4UDU C;  3RCZ A;  4DBG A;  4YSZ B;  1JRU A;  2JZP A;  3JYU A;  4MDK E;  4M02 A;  1QQR A;  1YJJ A;  3EGR A;  4TMA B;  4BZA A;  3QWZ B;  1SF0 A;  4DXF A;  2BVC A;  2M56 B;  2LWP A;  3JSV B;  2DZJ A;  2NVU I;  3VH4 B;  3R2I A;  2J42 A;  2WXN A;  2MBE A;  3TL5 A;  1MHX A;  3Q8E A;  3AEE B;  1MHH E;  2K39 A;  2IJ0 A;  3DCG A;  4BFR A;  2BT6 A;  5HG2 A;  1D3Z A;  2LD9 A;  3M3J A;  1SJE D;  3ZDT A;  2K1F A;  4BVU C;  1GG3 A;  1YQB A;  4B0M A;  2M8S A;  1NVI D;  2KKC A;  4EZL A;  2LJI A;  4PK1 A;  1GPX A;  1CZP A;  2D3C A;  2PE6 B;  3R8B A;  3KQ4 A;  3AUL A;  2LFI A;  3AEG B;  1YIW A;  2Z0D B;  4F7Z A;  3NVZ A;  1FM0 D;  2KMA A;  1L6V A;  1SEB D;  3TEZ A;  4LNF A;  4I6L B;  2ZNV B;  2JF5 A;  3RNF C;  4E74 A;  2D5G A;  4F1S A;  1SJH D;  2KQ4 X;  1EF1 A;  3DVN U;  4K7W A;  4BKT A;  2D3G A;  2D2Q A;  2AYO B;  3R2T A;  3Q8B A;  4IM2 A;  1GB1 A;  4WWN A;  3L4P A;  3TBL D;  3VR9 B;  2ZNV C;  1P7E A;  4RM8 A;  5JXV A;  1WYW B;  4W9K A;  3O13 A;  4A90 A;  1BUI C;  3WAO A;  3ZRF A;  3P63 A;  5J18 A;  1NBF C;  1XO3 A;  3HVZ A;  3TEX A;  1PUT A;  4HPM B;  5L83 A;  1WSP A;  2OHF A;  4WQM A;  2WXP A;  1MVK A;  1D6E C;  3UQB A;  4MGZ E;  4XWW A;  3BIN A;  3VAW A;  4GU2 A;  3RMK C;  3ZUN A;  3VUY A;  4B9K A;  2J53 A;  1MI0 A;  4JPS A;  2K8C A;  3RZF A;  2EKE C;  1FNW A;  3HK0 A;  3U2S C;  2BBC A;  1VCB A;  4FUL A;  3B0A A;  2DX5 B;  2KT7 A;  1I4G A;  5HFY A;  1EWC A;  1V49 A;  3NVW A;  3I5J C;  4PYZ A;  2MJ3 A;  2Y5C A;  3I57 A;  4S0R A;  1BML C;  1WXV A;  2D10 A;  3BZD B;  5BMI A;  3DBL I;  3DWG C;  2JZZ A;  2KFK B;  3MP9 A;  4WAF A;  4C4V B;  3IG3 A;  4LNN A;  1YN3 A;  3AEA B;  3UIP B;  5JHB A;  3Q8A A;  5DPS A;  1WGY A;  4EKU A;  1J7B A;  2MH7 A;  2KMM A;  4HLE A;  2DWQ A;  1UD7 A;  3Q3O C;  5E6J A;  3NRZ A;  4KGS A;  3UGB B;  3ZTC A;  1IBX A;  2BKR B;  4KVG B;  1HQR D;  2KLG A;  4MAC A; 
#chains in the Genus database with same CATH homology
 2FCQ A;  4F8C B;  4IWP A;  4J6I A;  1WM2 A;  1XQQ A;  4ZRI A;  2AWT A;  1AAR A;  3JVZ X;  1F9J A;  2R2O A;  3BY4 B;  2MSE D;  1E5W A;  1Z5S B;  4LDT B;  2FCS A;  2GMI C;  1L7Y A;  2LGY A;  3A4S C;  3PV1 A;  2DHZ A;  2LXA A;  1TTN A;  3L13 A;  4DDI D;  4K1R B;  2DEN B;  3UF8 A;  3ENE A;  4TQ0 A;  2IO2 B;  5AEK B;  2O2V B;  1GC6 A;  4WWO A;  1QZE A;  2K6Q A;  3QX1 A;  1LFD A;  1R4N I;  1WE7 A;  2LGX A;  4GB9 A;  3TMP B;  3VTV A;  4N9F 4;  1UZX B;  2HD5 B;  4HDQ A;  4HVB A;  4G11 A;  2BPS A;  1YX5 B;  4FHJ A;  1J19 A;  4K7U A;  3M62 B;  4DHZ B;  3VVW B;  3A1Q B;  1IPG A;  2KO3 A;  4ZDV A;  4G50 A;  3UQA A;  2ZJD A;  2W9N A;  2BYF A;  3UIO B;  2MCN B;  1NDD A;  4MH0 E;  2MQJ A;  2K6D B;  3APF A;  3U7D A;  4MGY E;  3V6E B;  3X23 A;  2N1V A;  1EF5 A;  2ZCC A;  4NNJ B;  2JY6 A;  3WIM A;  1OEY A;  2J0M A;  3KH0 A;  3IHP C;  4KSK C;  2J0K A;  1WF9 A;  1KJT A;  3VUX A;  1WMH B;  3W1Y A;  5CX3 A;  4AWJ A;  2NS5 A;  3JW0 X;  4BOS C;  1WE6 A;  3NY5 A;  2G3Q B;  4ANW A;  2LVP A;  2GBN A;  2V4L A;  2KWC A;  4MGI E;  4WJQ A;  2KWV B;  3PHW B;  2LVO A;  5J2R A;  3L10 B;  3PGE A;  3VTW A;  4CO7 A;  2NR2 A;  3PRP B;  1V80 A;  2FAZ A;  3DVN V;  3OLM D;  2KHW B;  4X57 B;  1WGH A;  1V5O A;  3JSV A;  3QAQ A;  1TBE A;  4EZJ A;  3H7P B;  4TV3 A;  1GC7 A;  2OOB B;  4FA6 A;  1C1Y B;  1NI2 A;  1UGM A;  2DAJ A;  3WAN A;  4NAW B;  2FIF A;  2PEA A;  2KD0 A;  3IBE A;  3ONS A;  1OGW A;  4MGK E;  3PTF C;  5KHQ A;  5IAA C;  4IW0 A;  3D32 A;  4W9G A;  3CF6 E;  1P98 A;  2I1K A;  5JZE B;  1WZ0 A;  1WXS A;  2J0J A;  1WZ3 A;  5AZG A;  2D11 A;  1MG8 A;  4IG7 B;  4MSQ B;  2A4Z A;  2BYV E;  1WX8 A;  2KX3 A;  2Y5B B;  2KNB A;  1P9D U;  2WDT B;  3SD5 A;  1EUV B;  2M0X A;  4W9D A;  3R3M A;  2L00 B;  2IZV B;  3QA8 A;  4RM9 A;  3MTN B;  4BKS D;  3TJP A;  4FAD A;  4DDG D;  2O6V A;  4M8N A;  4W9C A;  1E8X A;  3VXW A;  3V62 A;  2NCN A;  4BKG A;  4LJP B;  2GBM A;  4CYE A;  3DVG Y;  1GJZ A;  3ZIM A;  3L0W B;  4GDK A;  2C9W B;  3RZW C;  1WJN A;  2WX0 A;  1I35 A;  4KV2 A;  1T0Y A;  3VFK A;  2D07 B;  1U4A A;  2LI5 A;  1S3S G;  3NS8 A;  2REX A;  3PRE A;  3SU8 X;  3X0W A;  5CHF A;  2KJR A;  4KIK A;  2RSU A;  2G45 B;  4XC2 A;  1ZW7 A;  2NBV B;  3PHX B;  4II3 B;  4A20 A;  4NPN A;  5E6N A;  2L0T A;  2K8B A;  2LVQ A;  2MX2 A;  2ZVO A;  3APD A;  1WX7 A;  3H6N A;  4HDO A;  4TQ1 A;  4KZC A;  2DYO A;  4B6W A;  2G4S A;  2KTR A;  5C1Z A;  3HM3 A;  4W9I A;  2MP2 B;  4GIV A;  2LXC A;  4WWP A;  2LAS A;  3A1Q A;  3A9J A;  2CHX A;  3TIX A;  2IO3 B;  2N1W A;  2AL6 A;  4W9F A;  1WRD B;  5FR6 A;  2HE7 A;  3ZVV A;  4PYU A;  3PRM B;  1UBQ A;  5DPW A;  3ZKJ C;  3KYD D;  2C5L C;  4WAA A;  5DPT A;  2ZPY A;  5CHV C;  4DXA B;  2V3S A;  4KSL C;  3VHT C;  2N9X A;  4ANV A;  2KN5 A;  4DHJ B;  2L76 A;  3ZTD A;  2NPT A;  2M4N A;  3V60 A;  3M95 A;  2ZCB A;  1E90 A;  2FUH B;  3C0R B;  2DYB A;  2CHW A;  4JQW C;  5J17 A;  2JVC A;  4MSM B;  2DAF A;  4GN1 A;  3A9K A;  3R7Q A;  2OJR A;  1BT0 A;  3KVF B;  4HJK A;  5AZH A;  3KUC B;  3MJW A;  3N30 A;  2CHZ A;  3GZN I;  2M17 A;  2ZEQ A;  4W9L A;  1P3Q U;  4XX5 A;  4FBJ B;  2UWQ A;  3HM6 X;  3PVL A;  2KLC A;  4K7S A;  2BF8 B;  3H7S A;  2A5U A;  1TZ1 A;  2LZ6 A;  2JT4 B;  2KXJ A;  2WX1 A;  2L3Z A;  5D94 A;  4EEW A;  2NBW B;  2RD0 A;  1SE9 A;  2MWS B;  3IFW B;  4ICU A;  3HIZ A;  1RAX A;  4IM3 A;  4HCP B;  1Q5W B;  2ZVN A;  2AL3 A;  3A33 B;  4AP4 C;  3U30 A;  2YVC A;  1RFA A;  4MJS A;  3NHE B;  2CU1 A;  4ZRJ A;  3U8Z A;  2JRH A;  1A5R A;  2KQS A;  2MBQ A;  3VUW A;  4ANU A;  2KX0 A;  2KZR A;  3ALB A;  4URK A;  3OJ3 A;  2RGF A;  3PRZ A;  3ZNH B;  5D6J B;  1WH3 A;  4I6P A;  1IP9 A;  1WFY A;  1CMX B;  1WGG A;  1V81 A;  1I42 A;  4EFO A;  3R66 C;  5AZF A;  2CKH B;  3L08 A;  2B3A A;  4IUM B;  3HHM A;  4GXB A;  3AI5 A;  4OVU A;  1KLV A;  3H1U A;  2Z0E B;  3W1S A;  3QIJ A;  1WX9 A;  1WY8 A;  4BKS A;  1YJ1 A;  2C7H A;  2KOX A;  1WR1 A;  2MLB A;  3AXC A;  2K8H A;  3I3T B;  2DYM A;  4GDK B;  2KFK A;  4W9H A;  2DZM A;  2FNJ B;  5G2N A;  4HPL B;  3V6C B;  3DVG X;  4A3O A;  1P1A A;  3LJ3 A;  4YL8 A;  2KFJ A;  4CHK A;  1H4R A;  4FJY A;  3EEC A;  2JXX A;  4P7I A;  5DCN A;  4KIK B;  3ZO5 B;  4HK2 A;  2DZI A;  2EMT A;  2GOW A;  2J7Q B;  3PSE B;  3V61 A;  4B95 A;  2IY1 B;  3PLU A;  4IM0 A;  2EMS A;  3T9L A;  3S2A A;  2IO0 B;  4FJZ A;  2KDI A;  4M8M A;  3H9D A;  4EUT A;  3CST A;  4JIO U;  5EDS A;  1UEL A;  1WIA A;  2CR5 A;  2N7E A;  4LJO B;  1YD8 U;  1PQS A;  4FLH A;  1M94 A;  5JHA A;  1ISN A;  1Q1O A;  2MP2 A;  3TCA A;  5D7G A;  2HTH A;  3A9J B;  4AOF A;  2LRU A;  3DBH I;  5LLI A;  3EC8 A;  2XK5 B;  1IYF A;  2KDF B;  4M0W B;  1EO6 A;  3ZRC A;  1ZGU B;  3KUZ A;  2YLM A;  3RYT A;  2JZ3 B;  4IC7 B;  1LM8 B;  4MEM A;  3PPA A;  4GGQ A;  4HXD A;  4JLC A;  2NPT B;  4E3C A;  1FXT B;  3AU5 A;  3N32 A;  4ICV A;  1S1Q B;  4DHZ E;  2MBO A;  4IWO A;  4TKN A;  3O65 B;  1V6E A;  1WXA A;  2XEW A;  1WM3 A;  3QAR A;  4LDT D;  2O2V A;  3PLV A;  1RRB A;  5CTR C;  5TR5 A;  2JRI B;  3CSF A;  2WWZ A;  3RCZ A;  1G6J A;  4DBG A;  1WJ4 A;  3NZS A;  3WAM A;  1JRU A;  5C23 A;  3JYU A;  2MW5 A;  3M63 B;  3QK0 A;  4MDK E;  3A4R A;  2FCM A;  3DBS A;  3SHQ A;  4NJ6 A;  3QWZ B;  2L05 A;  3L54 A;  2C60 A;  4BOZ B;  2NBU A;  2LWP A;  3JSV B;  1XT9 B;  2M1M A;  2DZJ A;  2NVU I;  4XZ4 A;  3VH4 B;  4NJ7 A;  4A3P A;  2CS4 A;  2AEH A;  4JL9 A;  2L8J A;  3R7R A;  4DWF A;  3T8M A;  2MBE A;  3TL5 A;  2KJ6 A;  4PS7 A;  3VQI A;  2K39 A;  1J8C A;  2KTF A;  3ML8 A;  4DHJ D;  3DCG A;  2UYZ B;  4JGH B;  4BFR A;  3ML9 A;  3NOB A;  1OTR B;  3QCA A;  3VH3 B;  1D3Z A;  2LD9 A;  4EOY A;  2ASQ A;  3M3J A;  4GOC A;  2KK8 A;  2K1F A;  3RUL A;  3ZDT A;  4BVU C;  1GG3 A;  1WJU A;  1YQB A;  2IBI B;  1VD2 A;  2M8S A;  4MM3 A;  1GNU A;  2O6V B;  3RT3 B;  2KKC A;  4AUQ C;  4PS8 A;  2IO1 B;  4EZL A;  4AJW A;  1X1M A;  1KOT A;  1R4M I;  1E8W A;  1V9J A;  3MHS D;  3EFU A;  2WYQ A;  2N4F A;  5KHO A;  1WGR A;  2GBJ A;  4G0N B;  2JWZ A;  2G4D B;  3H7P A;  3KUD B;  1V5T A;  2PE6 B;  4NAW A;  2BGF A;  3WA0 A;  2BWF A;  4OVV A;  3AUL A;  1LQB A;  3GOE A;  2N9P C;  4GDL B;  1TGZ B;  4KDI C;  1YIW A;  2BYE A;  2KJH B;  2LRW A;  2Z0D B;  3B08 A;  3QHT A;  4F7Z A;  4NQL B;  2KAN A;  2KMA A;  1GUA B;  3DPD A;  4WJN A;  3QC8 B;  1LXD A;  3ZDM C;  3SDL C;  3K9P B;  2C7N B;  3QQ8 B;  4I6L B;  4ZYN A;  3PS6 A;  3W1S C;  3WAP A;  2ZNV B;  2JF5 A;  3Q3J A;  5E6O A;  2JPH A;  2N9E B;  4E74 A;  5LXH A;  4F1S A;  3L17 A;  1ZKH A;  1EF1 A;  3DVN U;  4K7W A;  4BBN C;  4BKT A;  3ZNG C;  2R2Q A;  2D3G A;  2LUE A;  4ZRK A;  2D2Q A;  1OQY A;  2AYO B;  4FN2 A;  2MBH A;  2XK5 A;  2I1J A;  1YX6 B;  4ASW C;  2PPH A;  4IM2 A;  4MEL A;  2MRP A;  2VRR B;  3VDZ A;  4WWN A;  2V1Y A;  4WQO B;  3TBL D;  4BBN F;  1KM7 A;  2ZNV C;  4G3X B;  4RM8 A;  1WYW B;  2BWE S;  4HWI B;  4W9K A;  1J0G A;  2L0F A;  2ZZP B;  3ZNI D;  3WAO A;  2HJ8 A;  3RD2 A;  2FID A;  3DQV A;  3ZRF A;  2GBK A;  2LGD A;  4FJV B;  5J18 A;  2PE9 A;  3APC A;  3RUI B;  1NBF C;  4I6N B;  2MA9 B;  3DOW A;  1HE8 A;  1V86 A;  2GBR A;  3PZD A;  2PJH A;  5G55 A;  5BO4 B;  4DK5 A;  4HPM B;  5LXI B;  3L16 A;  1E7V A;  2KTR B;  4W9E A;  5E6P A;  1H8C A;  4WJP A;  1UH6 A;  1OEY J;  3Q3F A;  5L83 A;  2ZPN A;  4ANX A;  3UIN B;  3KYC D;  2N7D A;  2LJ5 A;  2JUO A;  5GMV A;  3K9O B;  3DDC B;  3UQB A;  2QHO A;  4MGZ E;  3CMM B;  3ECI A;  3BIN A;  3VAW A;  3ZLZ A;  3EHV A;  4GU2 A;  4IWQ A;  3AU4 A;  5HKH A;  4NQK E;  1E7U A;  3VUY A;  3ZUN A;  4B9K A;  1L2N A;  3WAL A;  2KC1 A;  2K8C A;  1SGH A;  2EKE C;  2FCN A;  1Q0W B;  4MJS B;  3RZF A;  1C3T A;  2RPQ A;  1Z2M A;  3HK0 A;  4KDL B;  3ZNZ B;  4GSW A;  1P0R A;  2DZK A;  2BKF A;  3N3K B;  1WMH A;  4AJY B;  5IA7 A;  3OJ4 B;  4II2 B;  5D2M B;  4E71 A;  1VCB A;  2KWU B;  3A9K B;  3B0A A;  3KW5 B;  4FUL A;  4K81 A;  2DX5 B;  3ZW3 A;  2KDE B;  1V49 A;  1E8Z A;  2IY0 B;  1RLF A;  4RMA A;  4PYZ A;  2O6V D;  4NY0 A;  4FHK A;  4TUU A;  1Y8R C;  1WXV A;  2Z59 B;  3IVF A;  2D10 A;  3OAW A;  3PT2 B;  5JH5 C;  5DPR A;  1WJ6 A;  2KDB A;  1WR6 E;  3DBL I;  2KVR A;  2JZZ A;  2KFK B;  3NZU A;  2IYD B;  4PS3 A;  2K25 A;  4LCD E;  3DBR I;  4KZ0 A;  3IG3 A;  1K8R B;  3VTU A;  2C7M B;  2MBB B;  2XBB C;  3UIP B;  5JHB A;  4HCN B;  5DPS A;  4GDL A;  1WGY A;  4EKU A;  2RR9 A;  4WJO A;  2KQ7 A;  2KC2 A;  5CHW A;  1WI0 A;  3QJZ A;  4HLE A;  1UD7 A;  1XD3 B;  4W9J A;  5L95 C;  1UBI A;  2KMC A;  4GMV A;  3UGB B;  3ZTC A;  4EZK A;  1SIF A;  2BKR B;  4KVG B;  3LDZ E;  3B1L X;  1E8Y A;  1WGD A;  1WXM A;  2KLG A;  1V2Y A;  2L7R A;  3P2B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...