3EC8A

The crystal structure of the ra domain of flj10324 (radil)
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
149
structure length
139
Chain Sequence
GTENLYFQSMDPAELSTQLSAPGVLKVFGDSTGTHYKSVLATGTSSARELVKEALERYALDPRQAGQYVLCDVVGWQARCFRVFGDSEKPLLIQELWKPREGLSRRFELRKRSDVEELAAKEVDTITAGINAQARRLQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of the RA domain of FLJ10324 (RADIL)
rcsb
source organism Homo sapiens
molecule tags Cell adhesion
molecule keywords Putative uncharacterized protein FLJ10324
total genus 41
structure length 139
sequence length 149
ec nomenclature
pdb deposition date 2008-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00788 RA Ras association (RalGDS/AF-6) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3ec8A00
3JVZX 3N30A 3APFA 2BYVE 3VAWA 3R7RA 3VXWA 5KHOA 1WXVA 4BFRA 4F1SA 4FULA 3M95A 5KHQA 4FJZA 4ZDVA 2ZPNA 2DAJA 2KKCA 3Q3JA 3NHEB 4GN1A 5AEKB 4B6WA 2PEAA 4IWQA 4IM2A 1V81A 2GBKA 3SHQA 4DXAB 3A9KB 2JZZA 2QHOA 2KDFB 4B9KA 4XZ4A 4IM0A 2DAFA 1E8ZA 1Q0WB 2V4LA 4WJNA 3V61A 2L0FA 2LVPA 4TV3A 4FN2A 2K8BA 1LQBA 4ZRIA 1YQBA 1WIAA 2BKFA 3VVWB 2KMCA 3QK0A 1CMXB 2N9PC 2ZNVC 3W1SC 2DZMA 2KOXA 2IY0B 2R2QA 3ZLZA 3V62A 2WX0A 2KMAA 2J0JA 5LXHA 5CHWA 2KXJA 2XEWA 4MSMB 1EF1A 3T8MA 1D3ZA 1R4MI 1V5OA 3DDCB 2DENB 4PS7A 3V6EB 3APDA 1WR6E 3IG3A 3UIPB 4MJSB 5D6JB 1C3TA 1P3QU 2N9XA 1WMHA 2C60A 2MCNB 4BOZB 1WE7A 2O2VA 3OJ3A 3H1UA 2L0TA 3IFWB 1WY8A 3TCAA 2FIFA 1TTNA 2NBUA 1LXDA 1V2YA 3NZUA 4ZRKA 5J2RA 2KTFA 3H7PA 2KJRA 3NY5A 1WJ6A 2N4FA 4AOFA 1Z5SB 3DVGX 2L05A 3ECIA 4DK5A 2JF5A 3OLMD 4I6PA 3QARA 1OQYA 3O65B 1P98A 2D2QA 3DBHI 1Q1OA 3R7QA 4AP4C 3A9KA 3RULA 1P1AA 4W9LA 5AZGA 3WAPA 2LD9A 2BWES 4NY0A 3PRPB 1YJ1A 3A4SC 3QQ8B 4IW0A 4KV2A 1UD7A 3U8ZA 2WX1A 3EC8A 3JW0X 2HD5B 1HE8A 2KHWB 5FR6A 4MGIE 3ZIMA 5CTRC 2NPTA 5LLIA 4HPLB 4WJQA 1J8CA 1WMHB 3UQBA 2V1YA 3WAMA 1L2NA 1Z2MA 1WGHA 1WFYA 2ZNVB 4GIVA 3ZUNA 4K81A 2D07B 2M0XA 1GJZA 3MHSD 3PREA 3DBSA 4KDIC 2N7DA 3C0RB 1RFAA 3N3KB 2J0MA 3VUXA 2BYEA 4EZJA 4K1RB 3NZSA 3BINA 1YD8U 4RM9A 2NBWB 3HK0A 3ZRFA 3GZNI 4P7IA 2IO1B 3ZW3A 3KVFB 2KTRB 2A5UA 3DOWA 2O6VB 1WRDB 4CYEA 3ZRCA 3H9DA 5DCNA 1NDDA 2MBOA 3LDZE 4K7WA 1TGZB 2DYOA 1Q5WB 4K7SA 4F8CB 2G3QB 4JIOU 3KH0A 1IPGA 5DPSA 4E71A 5L83A 2Z0DB 1R4NI 3L10B 3ZTDA 3L13A 2G45B 1GNUA 1JRUA 3PHWB 1ISNA 1SIFA 2N9EB 1SE9A 4KVGB 3WA0A 5BO4B 2FCQA 4HLEA 1E5WA 2KX3A 4HCPB 3W1SA 3JSVB 4TQ0A 1H8CA 4NJ7A 2KWVB 4DHZB 4FADA 4PYUA 2LXCA 1V80A 3CF6E 4WJOA 2W9NA 4BKGA 3MJWA 2C5LC 2MWSB 2JZ3B 2NCNA 4ANXA 3IVFA 1WGGA 2MBBB 1WXAA 4E74A 2KFKA 4EZLA 2KO3A 4MEMA 2ZJDA 3PRMB 4FHKA 4HDQA 4IWOA 3M63B 2ASQA 1J19A 5L95C 2L00B 3QC8B 4BKTA 5J17A 5JHAA 4PS8A 2CHZA 4DBGA 5JZEB 3UGBB 2ZPYA 4FJVB 4DWFA 3NS8A 2O6VA 4WWPA 4BOSC 1XT9B 2DYMA 4NQLB 4KIKB 4K7UA 1KLVA 4GMVA 1E8YA 1WGRA 1WZ3A 3L54A 4WQOB 4ICUA 2XK5B 3ZKJC 1WX9A 2Z0EB 1NBFC 2CU1A 5TR5A 3ENEA 2BYFA 2JVCA 4HWIB 3PS6A 2KWUB 3HM3A 4GOCA 1E7UA 4MJSA 3QAQA 4EUTA 4A3PA 2K8HA 4JQWC 3U7DA 3I3TB 1V5TA 3WALA 2FCMA 2LUEA 2LI5A 3Q3FA 2RGFA 3L08A 3V6CB 2DX5B 2K8CA 2AYOB 4B95A 4AJYB 3VTUA 2R2OA 5AZHA 1VD2A 2KDEB 2LVOA 4MDKE 5CHFA 4W9CA 3R66C 3U30A 2KN5A 3ZVVA 2CKHB 1OEYA 4BBNF 4EOYA 1U4AA 2L7RA 4G0NB 3RZWC 2KNBA 4RM8A 5E6OA 4F7ZA 1WJNA 2AL6A 4RMAA 4URKA 3R3MA 2J7QB 4A3OA 2MW5A 1E90A 1P9DU 4MSQB 1XQQA 4E3CA 4PYZA 2I1KA 2ZVNA 1WX7A 4W9FA 2CHXA 2LZ6A 1OGWA 2BWFA 2PE6B 1KJTA 5DPRA 3WANA 2MLBA 2MBQA 4TUUA 2OOBB 5LXIB 4II2B 3ZO5B 2KZRA 2WWZA 2ZCCA 2FUHB 3UQAA 4I6NB 3WIMA 5AZFA 1WI0A 2EMSA 1S3SG 4W9EA 3TMPB 2UYZB 5C23A 3VTWA 3GOEA 3K9OB 3W1YA 3ML9A 3PVLA 5HKHA 2OJRA 2ZVOA 1ZGUB 1WGYA 1UZXB 4GDLB 3TIXA 4GDKA 1RAXA 3VFKA 1Y8RC 3L17A 2KC1A 5IA7A 3AU4A 3SU8X 2A4ZA 4G50A 4JLCA 4NJ6A 1I35A 3M3JA 2KDIA 3ZTCA 1GG3A 3MTNB 3QIJA 3DVGY 1GC6A 4TQ1A 3CSTA 1WM3A 2WDTB 3QA8A 3DVNV 2KD0A 4KZ0A 2IO3B 2IY1B 2GBMA 5DPTA 2MP2A 3ML8A 3B1LX 4ICVA 3RUIB 2IO0B 2LGYA 3ZDTA 3L0WB 3JSVA 4MM3A 4XX5A 2JWZA 2MP2B 4ZYNA 4A20A 2D3GA 2MRPA 2KVRA 3PLVA 2L8JA 4DDID 3ALBA 1UGMA 1UBIA 4TKNA 3AULA 3T9LA 2NBVB 2ZCBA 1BT0A 4MGKE 1V49A 2Y5BB 3B08A 4IC7B 1PQSA 3KYDD 2KDBA 3VH4B 2K1FA 1FXTB 2GMIC 2N1WA 2K39A 2JUOA 2YVCA 3NOBA 3PT2B 2IO2B 4II3B 1I42A 1WR1A 2L3ZA 5JH5C 4HJKA 2LRWA 1G6JA 2EKEC 4IM3A 3ZDMC 1WGDA 2RR9A 4XC2A 4G11A 5G55A 1X1MA 4LDTD 1IP9A 2K6DB 2KJHB 1EF5A 2NPTB 1EO6A 3QJZA 4DDGD 3H6NA 4OVVA 4DHZE 2RPQA 3A1QA 3DVNU 2CR5A 2IYDB 1WZ0A 2M1MA 1UELA 2MBHA 2AEHA 4BKSD 2M17A 3K9PB 3DBRI 3OJ4B 1WM2A 1YX6B 2G4DB 4X57B 2C7HA 3D32A 3JYUA 1E7VA 2J0KA 4LCDE 4WWNA 1F9JA 2KC2A 2BPSA 3BY4B 1V86A 2MX2A 2YLMA 4IWPA 3VDZA 3VH3B 3ZNGC 1NI2A 2JRIB 3CMMB 3A1QB 3P2BA 4EKUA 3A9JA 4EEWA 5C1ZA 4W9DA 3QHTA 3EFUA 3TBLD 2MQJA 2L76A 2O6VD 2AL3A 2KWCA 2UWQA 1YX5B 5GMVA 1KOTA 4HDOA 1LFDA 1P0RA 4GDLA 3QX1A 2NVUI 4ANVA 2GBNA 3S2AA 3DBLI 2MBEA 3AXCA 2KANA 1QZEA 1RLFA 2FCSA 1LM8B 4FHJA 3ZNZB 3UINB 1V6EA 3LJ3A 2PPHA 3PPAA 5DPWA 3X0WA 4NPNA 2MSED 5E6PA 3QWZB 1WXMA 1GC7A 1YIWA 3X23A 2JY6A 3V60A 4FA6A 4NAWA 4FJYA 2XK5A 4BVUC 4CO7A 3PTFC 3N32A 4ZRJA 4KSLC 3HM6X 2FIDA 2PE9A 3DPDA 3KUZA 4IUMB 1WF9A 4JGHB 4KZCA 4GGQA 4I6LB 4HXDA 5D7GA 3VHTC 2LJ5A 3PV1A 1C1YB 1T0YA 4YL8A 4G3XB 2DZJA 3SDLC 3HIZA 2K25A 4NQKE 3PLUA 4OVUA 4FBJB 1M94A 2CHWA 3A4RA 3WAOA 4AUQC 2D10A 3A33B 2KQSA 4BBNC 4W9IA 1OTRB 3B0AA 2IZVB 4LDTB 2B3AA 2BGFA 1AARA 3OAWA 3ZNID 5JHBA 2GBJA 4GXBA 1WXSA 2O2VB 5D94A 1EUVB 3RCZA 3DCGA 3PZDA 2N7EA 1SGHA 2MA9B 2NR2A 1WYWB 3PSEB 3VQIA 4W9HA 2KFJA 4KSKC 3VTVA 4GDKB 1UH6A 3EECA 4HPMB 5D2MB 1E8XA 4EZKA 1V9JA 3IHPC 1WJUA 4KIKA 5CHVC 4CHKA 1J0GA 2GBRA 2JXXA 4J6IA 4WWOA 4EFOA 3HHMA 2LVQA 3UIOB 2KTRA 2JPHA 2HTHA 2DHZA 2M4NA 4MGYE 1K8RB 5EDSA 3RD2A 1WH3A 1KM7A 2M8SA 4GU2A 1MG8A 1OEYJ 2G4SA 4KDLB 1ZW7A 2KLGA 2NS5A 2ZZPB 2AWTA 2C7MB 2JT4B 4JL9A 2BKRB 3KUDB 3A9JB 2DZKA 2C9WB 2KFKB 4AJWA 4FLHA 2Z59B 2RSUA 3PRZA 5J18A 1ZKHA 1WE6A 3APCA 2KX0A 3IBEA 3PHXB 4PS3A 4DHJD 3SD5A 3PGEA 3ONSA 2PJHA 3KW5B 2KJ6A 1GUAB 4N9F4 4DHJB 1WJ4A 3EHVA 1H4RA 3M62B 2FAZA 3AU5A 4MGZE 2GOWA 4AWJA 3AI5A 2CS4A 2JRHA 3QCAA 3KYCD 4HCNB 2LRUA 4NNJB 5CX3A 2C7NB 2ZEQA 2DZIA 4GB9A 1S1QB 1WX8A 2K6QA 2LASA 3ZNHB 5E6NA 3TL5A 4MELA 4WJPA 2VRRB 2LGXA 2KLCA 2EMTA 2FNJB 3RZFA 1IYFA 4M8NA 4NAWB 1UBQA 2XBBC 4HVBA 4IG7B 4W9JA 4WAAA 3TJPA 3H7PB 5IAAC 1TZ1A 1TBEA 1L7YA 2BF8B 2HE7A 3RT3B 2N1VA 1E8WA 4LJOB 2I1JA 2HJ8A 4HK2A 5G2NA 4ASWC 2LGDA 1VCBA 3CSFA 3UF8A 4M0WB 4MH0E 3RYTA 2D11A 1RRBA 2WYQA 4ANUA 2KQ7A 2KK8A 4W9KA 1XD3B 3DQVA 4GSWA 2REXA 3L16A 2LXAA 4LJPB 3VUYA 2FCNA 4BKSA 2LWPA 4ANWA 3H7SA 2IBIB 4M8MA 4W9GA 3VUWA 2RD0A 1A5RA 2V3SA 2DYBA 3KUCB
chains in the Genus database with same CATH superfamily
1JRPA 1V1OA 3R7RA 3VXWA 1WXVA 3I63C 4F1SA 4FJZA 4YSXB 2ZPNA 2KKCA 4IM2A 1V81A 3KWLA 2JZZA 5IOIA 2WXFA 2DAFA 4WJNA 1YN5A 3W2DA 4TV3A 5FKAC 4ZRIA 2KMCA 2N9PC 2IPKD 2WX0A 4OZCA 1JALA 4A55A 5CHWA 2KXJA 2FBWB 4MSMB 1D3ZA 4NAMA 4PS7A 3V6EB 3APDA 3IG3A 5D6JB 3NUHB 2N9XA 2NTTA 4BOZB 2FIFA 2NBUA 1V2YA 3V3XA 1WYGA 1JWSD 2E3TA 3DVGX 4DK5A 1FIQA 4I6PA 1UGJA 1OQYA 3O65B 3DBHI 1Q1OA 3R7QA 3A9KA 4W9LA 5JXVA 5AZGA 3WAPA 1YJ1A 3QQ8B 3UI3A 2WX1A 4P6VF 5FR6A 2HD5B 1HE8A 4MGIE 3RNCC 3NJTA 3ZIMA 1NEKB 4RGMA 5CTRC 2NPTA 1T5XD 2H88B 1E6EB 4M00A 3MP9A 2ZNVB 1YMHE 4GIVA 2M0XA 2NTSA 1ZE3D 2JXTA 4KDIC 1VJKA 1J7BA 4REZA 4EZJA 3BINA 4MT5A 4P7IA 1JROA 2IO1B 3ABVB 2A5UA 2D3BA 2MBOA 1TGZB 2DYOA 2G3QB 3Q3OC 2M56B 1LO5D 1IPGA 4E71A 1R4NI 1RM6C 1GNUA 5I4DA 1SIFA 2D3CA 1SE9A 1GAQB 1QKZA 1H8CA 4M01A 5HHDG 4DHZB 1MPEA 2WNMA 1SSNA 4BKGA 2PTLA 2J53A 2MWSB 2QC8A 5BYQA 2MBBB 3U4EG 4MEMA 4IWOA 3M63B 2ASQA 5L95C 2L00B 5J17A 2ACZB 2K3UA 4M0WA 4KGTA 4DWFA 4WWPA 3C8YA 1EWCA 1XT9B 4BOSC 4NQLB 4BZAA 1CZPA 3L54A 4ICUA 1NBFC 2CU1A 3ENEA 2BYFA 3AH7A 4HWIB 2BS4B 2PIAA 2KWUB 3HM3A 4GOCA 4DXGA 2SEBD 4HROA 4XDDA 1DGJA 1BMLC 2AQ2B 4A9AA 4IDIA 1SF0A 2MJEA 2MJDA 2FCMA 1FPYA 1JWMD 1TKGA 2LI5A 3Q3FA 2VZKD 3L08A 4B95A 2R2OA 2LVOA 4MDKE 1YQ3B 5CHFA 3ZVVA 4EOYA 2L7RA 2WS3B 4KKJA 3RZWC 4RM8A 5E6OA 3FILB 1WJNA 2AL6A 2WDRB 4RMAA 3R3MA 1P9DU 2WP9B 1XQQA 4HRSA 4E3CA 1WX7A 1L0XB 5DPRA 1K52A 1E7PB 3Q3NC 1XLOA 2OOBB 2IGDA 4II2B 2RPVA 2ZCCA 2V4IB 4LLGM 2V3NA 1WI0A 1S3SG 4W9EA 3TMPB 2OJRA 1ZGUB 4GDKA 1STEA 1CJEA 1Y8RC 3AU4A 3SU8X 2A4ZA 3ZTCA 5FK9C 4TSSA 3DVGY 1I4HA 4K3CA 4KKIA 2KD0A 2MP2A 3B1LX 4ICVA 2IO0B 1I4XA 3IXSA 3JSVA 4A20A 2KT7A 4H2AA 1N5WA 1QOGA 2KVRA 4DDID 3T9LA 1UGMA 1UBIA 2NBVB 1BT0A 4MGKE 2BTEA 3NS1A 2DWQA 3VR8B 2I2YA 3BYYB 2PVOD 2G9HD 2GMIC 1TS3A 4CQNA 4RF1A 3P4QB 2L83A 3PT2B 2BT6A 1ESFA 3IT6B 4L2YA 4C4VA 5C3JB 1ZP0B 4GLSC 1DYQA 1DOIA 5G5HA 2K6DB 3H6NA 4DHZE 2BBCA 3RNAC 1UELA 4OVZA 5FR3A 1L5PA 3PO0A 4BKSD 1WM2A 3DBLB 3MC8A 4X57B 1BUIC 3W9CB 3JYUA 2J0KA 2WXKA 1EU3A 2BPSA 2W82A 1V86A 2YLMA 3BY4B 3EFCA 2JRIB 4EKUA 4EEWA 3MC0B 3EFUA 2L76A 2UWQA 2KWCA 1YX5B 5GMVA 4HDOA 3E9SA 2NVUI 4ANVA 3S2AA 1RLFA 1FO4A 2BVCA 1ZXIA 2PPHA 3PPAA 3KLSX 3QWZB 3ZJVA 1P7EA 1F77A 2XK5A 3N32A 4N59A 3DPDA 3KUZA 3PZ8A 5D7GA 4GGQA 2LJ5A 1C1YB 4G3XB 2DZJA 4OVUA 3BVMA 1K50A 3DHIC 2QDFA 3URYA 4AUQC 1ACCA 1I7HA 3A33B 2K22A 4BBNC 4W9IA 2OEDA 1OTRB 3B0AA 1F2RC 5JHBA 1I4GA 3HUIA 1EUVB 3DCGA 3NVYA 2NR2A 4JWSC 5E6JA 3Q8CA 4YTNB 4KSKC 4LNNA 3VTVA 1UH6A 1E8XA 4EZKA 4KIKA 1TS4A 3Q8FA 1J0GA 3SFDB 2GBRA 4J6IA 1F52A 1IGCA 1WSPA 2YEPF 1IUEA 2V9HA 3NG0A 1MVKA 1I4PA 5EDSA 4LNFA 3P1MA 1KM7A 1AN8A 1EU4A 4RNAA 2ZZPB 2AWTA 2C7MB 3GZNB 2JT4B 1VZ8A 2IJ0A 2WXQA 4LTUA 2Z59B 2RSUA 5J18A 1ZKHA 3APCA 2KX0A 3IBEA 3Q2AC 1TY2A 3C19A 4DHJB 3SR6A 2Q5WD 3EHVA 3GS2A 3QCAA 3KYCD 4B0EA 2LRUA 2ZEQA 1FXIA 1T0SC 4RCOA 4HVBA 4WAAA 1JW9D 1TZ1A 1VZ7A 1L7YA 2BF8B 3RT3B 4HK2A 1VCBA 5HFYA 1EM7A 4W9KA 4OHJA 1YN3A 1PFDA 3APFA 3BZDB 1QT9A 5KHQA 1L4DB 3NHEB 1FNWA 4S17A 5AEKB 2PEAA 3SHQA 4DXAB 4LNIA 3A9KB 1E0ZA 2QHOA 3AE5B 4R3DA 2K8BA 2PW9A 1YQBA 2BKFA 1LGRA 2WLBA 3ZLZA 1XXGA 3V62A 3AECB 1EF1A 1L0VB 2DENB 2MJ3A 1R7SA 1JQ4A 3UIPB 3LYYA 2QSDA 1WMHA 1WE7A 2O2VA 1HZ6A 5J2RA 2KTFA 3H7PA 1Z5SB 4JX1C 1ZDXA 2JF5A 1D4BA 3OLMD 2MHJA 2N9KA 1JWAD 3PRPB 3A4SC 4KV2A 3EC8A 2KHWB 1SEBD 1KF6B 2KACA 1WMHB 2JQRB 2V3PA 3UQBA 3BVZA 3WAMA 1AYFA 2D07B 3MHSD 3PREA 3Q8BA 3NZSA 4RM9A 2KWDA 3ZW3A 3BK2A 1WRDB 5DCNA 1F1HA 4K7WA 4K7SA 1K51A 4F8CB 1KFYB 3J9CA 3AE9B 2KAJA 2ZW1A 4KGRA 5L83A 2Z0DB 3L13A 4P16A 1JRUA 3PHWB 5BO4B 3GB1A 2KX3A 1WGKA 5EE0A 2KWVB 1QOFA 1V80A 2W9NA 2CU3A 2JZ3B 1UNSA 3IVFA 1JMLA 3RI7C 1SE2A 3BIID 4ZRQA 2KO3A 4JWUC 2ZJDA 1IBXB 2JYTA 2CHZA 1SIJA 4DBGA 5JZEB 4FJVB 3NS8A 2QCZA 1KLVA 4GMVA 4WQOB 3ZKJC 1WX9A 2Z0EB 3Q6BA 3B2FA 1V8CA 1IGDA 2X8XX 4MJSA 4A3PA 2JWUA 3U7DA 3WALA 3ZXRA 2KQ4X 2RGFA 2K8CA 1PGBA 4XGAB 2INNE 3B2GA 1VD2A 2KDEB 4BBNF 1YN4A 3NVZA 1U4AA 1HA5A 1L6VA 2KNBA 5GXGB 3DHGC 4F7ZA 1SB3C 4A3OA 2MW5A 4PYZA 4HPPA 4ARIA 1AWDA 2ZVNA 4XDCA 4TUUA 3MC9A 2WWZA 3RNEC 3RFZB 3UQAA 5C23A 2SAKA 3VTWA 3GOEA 3K9OB 3W1YA 3ML9A 5HKHA 1IBXA 1FEHA 1UZXB 4GDLB 1RAXA 3W5VB 2KC1A 3DHHC 4NJ6A 5D3DA 2KDIA 1GG3A 3MTNB 2VH2A 4BAXA 1C4CA 3CSTA 3QA8A 1JWUD 1T6BX 4O1NA 3TEWA 3RUIB 1UWXA 2LGYA 4ZYNA 3FAHA 2D3GA 5C2TB 2MRPA 3PLVA 5IP4D 5BMGA 4A90A 3CIRB 1V49A 1GPXA 2KDBA 4ZYSA 1FXTB 2K39A 2JUOA 3NOBA 5BYSA 1F2RI 4II3B 4PK1A 4N58A 2LRWA 3RNGC 4DQOC 4IM3A 1SXTA 1WGDA 2RR9A 3OG5A 4XC2A 4S0RA 5G55A 1X1MA 1IP9A 3R8BA 3QJZA 4DDGD 3DVNU 3WCQA 2M1MA 3P63A 1T0RC 1HZ5A 2MBHA 1N6ZA 2WXGA 3OJ4B 2WDQB 3NVWA 3N9YC 4YSYB 4LCDE 1F9JA 2LUMA 3FC4A 1QOBA 2PVGC 2LEKA 4IWPA 1K53A 1FRRA 4W9DA 3TBLD 3KQ4A 2ON8A 5IN7A 2AL3A 1KOTA 2W54A 1LFDA 4C4VB 2WU5B 1E10A 2MBEA 4RGTA 1V6EA 1FRDA 3X0WA 4NPNA 2MSED 2Z8LA 3X23A 3V60A 4FJYA 2LGSA 3PTFC 1I4QA 3HM6X 2FIDA 4IUMB 1HEZE 4AQ7A 1PGXA 4I6LB 5HI1A 3AEEB 3PV1A 3SDLC 4YL8A 1QLBB 2K25A 3PLUA 3P42A 5T8IA 4FBJB 4YTMB 1V1PA 2OJWA 4LDTB 2B3AA 1AARA 1XCTL 3OAWA 4LNKA 3RCZA 1ET9A 3AE1B 2WXMA 4LK0M 2LMCA 1MFWA 4HPMB 1V9JA 3IHPC 5CHVC 3U52E 4OZAA 3LXFA 4L1BA 4EFOA 2LVQA 3UIOB 2KTRA 1KLGD 2M8SA 4GU2A 1OEYJ 2G4SA 1RYJA 3KUDB 5EE1A 1FMAD 2C9WB 3R2TA 4AJWA 2WXPA 3VRBB 1WE6A 3DWMA 2PJHA 2IGGA 3KW5B 2KJ6A 1GUAB 2VH1A 1WJ4A 2N0SB 1H4RA 3AI5A 2CS4A 1TIFA 4HCNB 4NNJB 5CX3A 2C7NB 1GB1A 4GB9A 4WIPA 2YEPB 1XF5L 4MELA 3HRDD 3T3NA 1ENFA 2KLCA 3DBRB 2N7JA 4MH8A 3RZFA 4M8NA 4IG7B 3H7PB 2UU7A 1Q10A 1MHXA 1D6EC 5BYRA 2I1JA 3AE4B 3AE2B 3UF8A 4M0WB 1ET6A 2WYQA 2REXA 3L16A 2LXAA 2FCNA 5IO9A 1M4VA 2V3SA 3JVZX 1FM0D 3N30A 1TYGB 1NVID 3AEFB 4ZDVA 4GN1A 3Q3JA 4ACFA 4B6WA 3BWUD 2IDYA 1ROEA 3VRAB 1KLUD 2JZPA 2KDFB 3ZJTA 4P1CC 4IM0A 1Q0WB 1VRAB 2HJ1A 2LVPA 1FCLA 2H89B 4FN2A 1LQBA 1CMXB 1FXAA 2ZNVC 2DZMA 2KOXA 2IY0B 2R2QA 2KMAA 2J0JA 5LXHA 3T8MA 1PDXA 1V5OA 3SFEB 1WR6E 4HJGE 1C3TA 2C60A 2MCNB 3T3OA 3R2IA 3TCAA 1XLPA 1TTNA 2K5PA 4J3OD 3NZUA 5H8YE 4ZRKA 2KJRA 3NY5A 1C77A 2N4FA 4AOFA 1HQRD 3ECIA 2L05A 1HXYD 4ITKA 1TT5B 1P1AA 4QAYA 1NYQA 2LD9A 2BWES 1UD7A 3U8ZA 3JW0X 1J8CA 4WJQA 2GLSA 1CK1A 1N60A 3Q14C 1N63A 4OW0A 2V1YA 1L2NA 1Z2MA 1WGHA 5D3IB 1WFYA 3ZUNA 1YOVB 4K81A 1V1PB 1GJZA 3DBSA 1J7AA 2N7DA 2XNAC 1RFAA 3C0RB 3N3KB 1FNVA 1GB4A 4K1RB 3GZNI 2NMQA 1VZ6A 4CYEA 3ZRCA 5H92C 3LDZE 3I5JC 4JIOU 2WXLA 4M02A 3KH0A 5DPSA 2RDHA 3Q69A 2CJNA 2G45B 3TSSA 2ICIA 1ISNA 3PZ7A 2N9EB 2Y3AA 4KVGB 4HLEA 4HCPB 4MM3B 1YJIA 1FCCC 1FFVA 4PYUA 3AE6B 2LXCA 3CF6E 3MJWA 2NCNA 1WGGA 1WXAA 4E74A 1MG4A 4FHKA 3QC8B 5JHAA 4PS8A 4WQMA 3UGBB 2ZPYA 2O6VA 2DYMA 2XK5B 5TR5A 1N5XA 2JVCA 4ARCA 2AQ3B 2BS3B 3PS6A 1E7UA 3QAQA 4EUTA 3FILA 4RGNA 1V5TA 2LUEA 3P4RB 3GE3C 3V6CB 2DX5B 3U7ZA 4AJYB 4JE3B 5AZHA 3R66C 2CKHB 2J4XA 4G0NB 1P7FA 4L23A 4URKA 2J7QB 1E90A 4PT5A 2I1KA 4W9FA 2CHXA 3MHZA 2LZ6A 1OGWA 2PE6B 3WANA 2MLBA 2MBQA 4XWWA 3ZO5B 1PYWD 2KZRA 3PVLA 2X38A 2ZVOA 2BB5A 3ETRA 1I4RA 3VFKA 3L17A 3AV8A 4JLCA 4G50A 1FFUA 1I35A 1GC6A 4XYCA 3V05A 1WM3A 4A6QA 3AE3B 3DVNV 2IO3B 2IY1B 2GBMA 5DPTA 2HDEA 4XX5A 2JWZA 2MP2B 3ZJUA 2VZKB 2L8JA 3ALBA 3AULA 2ZCBA 2M19A 2Y5BB 4IC7B 3KYDD 3RN9C 2LHEA 2K1FA 2LGIA 4LNOA 1I42A 1R4NB 1WR1A 4HJKA 1G6JA 2K0PA 3DWGC 2WQYB 1UF0A 1TKYA 1EF5A 2Y5CA 1V97A 1EO6A 1N62A 4OVVA 2RPQA 2CR5A 2IYDB 4MACA 2AEHA 3KWVA 3DBRI 1YX6B 2G4DB 3D32A 4USAA 2KC2A 2WXJA 4ZRPA 3VH3B 3ZNGC 2WHIA 3P2BA 3A1QB 3A9JA 2BQQA 3QHTA 2MQJA 2IGHA 2WDVB 4GDLA 3QX1A 4IOIE 2WXIA 3AXCA 3B9JA 2QIEB 2KANA 1QZEA 1LM8B 2K9XA 3IAM1 4FHJA 3I9V1 3ZNZB 3LJ3A 4KX6B 1L6UA 1GC7A 1YIWA 2JY6A 4FA6A 2DBYA 1DOYA 4CO7A 4ZRJA 4KSLC 1WF9A 2ZW0A 4KZCA 1T0YA 4NQKE 3HVDA 4N6EB 1M94A 3ZYYX 2QILA 2D10A 1WWTA 3BVGA 2IZVB 1TS2A 3ZNID 3RMKC 4GXBA 5D94A 3PZDA 2N7EA 2EELA 1GOZA 1WYWB 2FE8A 3PSEB 4C56C 4WH4A 2KFJA 3IT4B 5AUKA 5D2MB 1WJUA 4RF0A 2KDMA 2MH7A 1TJEA 3GE8C 2N9LA 3HHMA 3AEGB 2HTHA 2M4NA 5EE9A 3I57A 1MG8A 1ZW7A 2NS5A 2MEKA 4JL9A 2QEJC 2KN4A 4TMAB 3A9JB 4FLHA 1PUTA 3PRZA 1JWBD 4PS3A 4DHJD 1RWSA 2JX5A 4N9F4 3AEAB 2FAZA 3AU5A 3EA6A 3P4SB 2JRHA 5HG2A 5G5GA 1QOAA 3ZNHB 5E6NA 4NZLB 2VRRB 2WGSA 2LGXA 1OQRA 1UBQA 2XBBC 3TEXA 4W9JA 4YT0B 3MFGA 1TBEA 4LJOB 3HVZA 1E8WA 2N1VA 5G2NA 5BMIA 2W55A 3TEZA 3CSFA 1D5MC 1B1ZA 4MH0E 2V0GA 1L0YB 1J7CA 1PGAA 2KQ7A 4LJPB 3VUYA 4IKGA 4BKSA 2GB1A 4ANWA 2LWPA 3H7SA 2IBIB 4W9GA 2RD0A 1ZOYB 3KUCB 2KVZA 1KTKA 2BYVE 3VAWA 5KHOA 4BFRA 4FULA 2LHDA 3M95A 2DAJA 2BYTA 3N1YC 3EGRA 4IWQA 2GBKA 3AEBB 3TEYA 4B9KA 4XZ4A 2INCC 1E8ZA 2V4LA 3V61A 1NYRA 2L0FA 1WIAA 3H8HA 1C9FA 3VVWB 3QK0A 3NRZA 3W1SC 1JCKB 1YQ4B 2LJIA 2XEWA 1YJJA 1R4MI 1QQRA 3DDCB 3IAS1 4HKQA 2KMMA 4MJSB 2DNFA 1P3QU 3LB8C 3OJ3A 3H1UA 2L0TA 3IFWB 1WY8A 2HTME 1LXDA 1SJED 1WJ6A 1EWYC 4JPSA 3QARA 4RFBA 1P98A 2D2QA 4AP4C 3RULA 4K3BA 2B76B 1TZOA 4NY0A 4IW0A 3U2SC 4US8A 2DLBA 5LLIA 4YTPB 4HPLB 4P1BC 1QILA 2WXNA 3AMZA 1BXTA 1XEEA 2J0MA 3VUXA 2BYEA 1YD8U 2NBWB 3HK0A 3N1XC 3ZRFA 3KVFB 2KTRB 3DOWA 1XLQA 2O6VB 2QJLA 3H9DA 1NDDA 3EUB2 5TSSA 1Q5WB 4OZBA 3ZTDA 1SE3A 3L10B 4RGOS 3WA0A 2FCQA 1E5WA 3CWIA 2W3SA 4HKZE 3W1SA 3JSVB 4TQ0A 4NJ7A 2D5GA 4FADA 3Q8AA 4WJOA 1VLBA 2C5LC 4ANXA 1WXQA 2PLPA 2KFKA 4EZLA 3PRMB 4HDQA 1J19A 4BKTA 3W5UB 2W3RA 2J52A 1YNTE 1MJDA 1HTOA 3Q8EA 4RH6A 1XLNA 2E6XA 4KIKB 4K7UA 3AEDB 1E8YA 1WGRA 1WZ3A 4B0MA 1DOXA 4ZHOA 3VR9B 1C78A 4A8XC 2TSSA 2K8HA 2OHFA 3ZGZA 4JQWC 4EE2A 3I3TB 3Q3MC 2JU6X 2BW2A 2PKOA 1XCQL 2AYOB 3VTUA 1ZPSA 2CJOA 4W9CA 3U30A 2KN5A 1OEYA 1NENB 2GI9A 2FUG1 4MSQB 4Q2JA 2R61A 4KGSA 5AUIA 2BWFA 1C4PA 1KJTA 5LXIB 2AQ1B 3P4PB 4C7YA 2FUHB 3N1ZC 4I6NB 3WIMA 5AZFA 2EMSA 2UYZB 4DXFA 3ZQ4A 1F0ZA 1WGYA 3TIXA 1TS5A 1N61A 5IA7A 2LFIA 3M3JA 4C00A 2WXRA 1C76A 1VR9A 3QIJA 4YSZB 1AW7A 1FNUA 4TQ1A 2WDTB 2KYWA 3ZXVA 4C7ZA 4KZ0A 3AB5A 3BYTB 5BMHA 2D3AA 1SJHD 2RMMA 3ML8A 1ZDVA 4HEA1 3ZDTA 3L0WB 4MM3A 1ZUD2 2BS2B 4AS1A 4TKNA 3OWEB 4ZHPA 4C80A 1C4AA 3B08A 1PQSA 1B9RA 3VH4B 2N1WA 2YVCA 4ZOHC 2IO2B 3AE8B 2L3ZA 5JH5C 3NZ3A 2EKEC 3ZDMC 3RNFC 1SBBB 4WWMA 2J42A 4G11A 4D2KA 4LDTD 1T0QC 2KJHB 2RDBC 4NJCA 2NPTB 3RPFC 3A1QA 2QMTA 1WZ0A 1FD6A 1UUPA 3AE7B 2M17A 3K9PB 2C7HA 4WWNA 1D5ZC 1E7VA 5EE3A 3RNBC 2XN9C 3VDZA 2MX2A 3L4PA 1NI2A 3CMMB 5C1ZA 3TUOA 2O6VD 1C79A 5MPOA 1P0RA 2GBNA 1OQQA 4YWGG 3DBLI 1UWMA 2BB6A 1Y56A 2FCSA 3UINB 1KH0A 5DPWA 5E6PA 1WXMA 1CQVA 4NAWA 5IKCM 2WU2B 4FXCA 4BVUC 3AN1A 1VDVA 2PE9A 4JGHB 4HXDA 2Y5PA 3VHTC 3HIZA 2EKIA 2CHWA 3A4RA 3WAOA 3NVVA 1RFKA 2WXOA 5LNK1 2KQSA 2ONQA 2JYEA 1QF6A 2BGFA 1TKEA 2INPE 2GBJA 1WXSA 2O2VB 1HTQA 4US9A 1SGHA 2MA9B 2AX5A 3VQIA 1SE4A 3AM9A 1D5XC 4W9HA 4GDKB 3EECA 2I38A 4UDUC 1KRHA 1T3QA 4CHKA 1WRIA 2JSVX 2JXXA 3GP7A 4WWOA 2L52A 3DBHB 3E56A 3FKYA 4YXDB 2JPHA 1OFFA 2DHZA 4MGYE 1K8RB 3RD2A 1WH3A 4KDLB 4XE0A 2KLGA 1NI3A 2BKRB 3MJ5A 2DZKA 2KFKB 1E9MA 3BK1A 3PHXB 3SD5A 3PGEA 3ONSA 3O13A 2WXHA 1A70A 3M62B 2RDGA 1TY0A 4MGZE 4AWJA 1L4ZB 2GOWA 2DZIA 1XO3A 1S1QB 1WX8A 2K6QA 2GRIA 2LASA 3TL5A 4WJPA 1MHHE 2L1AA 4WURA 2EMTA 2FNJB 1IYFA 4NAWB 1MI0A 3TJPA 5IAAC 2M0AA 2L32A 2HE7A 4ASWC 2INDC 2HJ8A 2PMVA 4WAFA 2LGDA 3N20C 3RYTA 1R4MB 2D11A 3SEBA 1ZXHA 1RRBA 4ANUA 2G1EA 4XWTA 2KK8A 1XD3B 3DQVA 4GSWA 1A5RA 4M8MA 3VUWA 2DYBA
chains in the Genus database with same CATH topology
3JVZX 3N30A 3APFA 2BYVE 3VAWA 3R7RA 3VXWA 5KHOA 1WXVA 4BFRA 4F1SA 4FULA 3M95A 5KHQA 4FJZA 4ZDVA 2ZPNA 2DAJA 2KKCA 3Q3JA 3NHEB 4GN1A 5AEKB 4B6WA 2PEAA 4IWQA 4IM2A 1V81A 2GBKA 3SHQA 4DXAB 3A9KB 2JZZA 2QHOA 2KDFB 4B9KA 4XZ4A 4IM0A 2DAFA 1E8ZA 1Q0WB 2V4LA 4WJNA 3V61A 2L0FA 2LVPA 4TV3A 4FN2A 2K8BA 1LQBA 4ZRIA 1YQBA 1WIAA 2BKFA 3VVWB 2KMCA 3QK0A 1CMXB 2N9PC 2ZNVC 3W1SC 2DZMA 2KOXA 2IY0B 2R2QA 3ZLZA 3V62A 2WX0A 2KMAA 2J0JA 5LXHA 5CHWA 2KXJA 2XEWA 4MSMB 1EF1A 3T8MA 1D3ZA 1R4MI 1V5OA 3DDCB 2DENB 4PS7A 3V6EB 3APDA 1WR6E 3IG3A 3UIPB 4MJSB 5D6JB 1C3TA 1P3QU 2N9XA 1WMHA 2C60A 2MCNB 4BOZB 1WE7A 2O2VA 3OJ3A 3H1UA 2L0TA 3IFWB 1WY8A 3TCAA 2FIFA 1TTNA 2NBUA 1LXDA 1V2YA 3NZUA 4ZRKA 5J2RA 2KTFA 3H7PA 2KJRA 3NY5A 1WJ6A 2N4FA 4AOFA 1Z5SB 3DVGX 2L05A 3ECIA 4DK5A 2JF5A 3OLMD 4I6PA 3QARA 1OQYA 3O65B 1P98A 2D2QA 3DBHI 1Q1OA 3R7QA 4AP4C 3A9KA 3RULA 1P1AA 4W9LA 5AZGA 3WAPA 2LD9A 2BWES 4NY0A 3PRPB 1YJ1A 3A4SC 3QQ8B 4IW0A 4KV2A 1UD7A 3U8ZA 2WX1A 3EC8A 3JW0X 2HD5B 1HE8A 2KHWB 5FR6A 4MGIE 3ZIMA 5CTRC 2NPTA 5LLIA 4HPLB 4WJQA 1J8CA 1WMHB 3UQBA 2V1YA 3WAMA 1L2NA 1Z2MA 1WGHA 1WFYA 2ZNVB 4GIVA 3ZUNA 4K81A 2D07B 2M0XA 1GJZA 3MHSD 3PREA 3DBSA 4KDIC 2N7DA 3C0RB 1RFAA 3N3KB 2J0MA 3VUXA 2BYEA 4EZJA 4K1RB 3NZSA 3BINA 1YD8U 4RM9A 2NBWB 3HK0A 3ZRFA 3GZNI 4P7IA 2IO1B 3ZW3A 3KVFB 2KTRB 2A5UA 3DOWA 2O6VB 1WRDB 4CYEA 3ZRCA 3H9DA 5DCNA 1NDDA 2MBOA 3LDZE 4K7WA 1TGZB 2DYOA 1Q5WB 4K7SA 4F8CB 2G3QB 4JIOU 3KH0A 1IPGA 5DPSA 4E71A 5L83A 2Z0DB 1R4NI 3L10B 3ZTDA 3L13A 2G45B 1GNUA 1JRUA 3PHWB 1ISNA 1SIFA 2N9EB 1SE9A 4KVGB 3WA0A 5BO4B 2FCQA 4HLEA 1E5WA 2KX3A 4HCPB 3W1SA 3JSVB 4TQ0A 1H8CA 4NJ7A 2KWVB 4DHZB 4FADA 4PYUA 2LXCA 1V80A 3CF6E 4WJOA 2W9NA 4BKGA 3MJWA 2C5LC 2MWSB 2JZ3B 2NCNA 4ANXA 3IVFA 1WGGA 2MBBB 1WXAA 4E74A 2KFKA 4EZLA 2KO3A 4MEMA 2ZJDA 3PRMB 4FHKA 4HDQA 4IWOA 3M63B 2ASQA 1J19A 5L95C 2L00B 3QC8B 4BKTA 5J17A 5JHAA 4PS8A 2CHZA 4DBGA 5JZEB 3UGBB 2ZPYA 4FJVB 4DWFA 3NS8A 2O6VA 4WWPA 4BOSC 1XT9B 2DYMA 4NQLB 4KIKB 4K7UA 1KLVA 4GMVA 1E8YA 1WGRA 1WZ3A 3L54A 4WQOB 4ICUA 2XK5B 3ZKJC 1WX9A 2Z0EB 1NBFC 2CU1A 5TR5A 3ENEA 2BYFA 2JVCA 4HWIB 3PS6A 2KWUB 3HM3A 4GOCA 1E7UA 4MJSA 3QAQA 4EUTA 4A3PA 2K8HA 4JQWC 3U7DA 3I3TB 1V5TA 3WALA 2FCMA 2LUEA 2LI5A 3Q3FA 2RGFA 3L08A 3V6CB 2DX5B 2K8CA 2AYOB 4B95A 4AJYB 3VTUA 2R2OA 5AZHA 1VD2A 2KDEB 2LVOA 4MDKE 5CHFA 4W9CA 3R66C 3U30A 2KN5A 3ZVVA 2CKHB 1OEYA 4BBNF 4EOYA 1U4AA 2L7RA 4G0NB 3RZWC 2KNBA 4RM8A 5E6OA 4F7ZA 1WJNA 2AL6A 4RMAA 4URKA 3R3MA 2J7QB 4A3OA 2MW5A 1E90A 1P9DU 4MSQB 1XQQA 4E3CA 4PYZA 2I1KA 2ZVNA 1WX7A 4W9FA 2CHXA 2LZ6A 1OGWA 2BWFA 2PE6B 1KJTA 5DPRA 3WANA 2MLBA 2MBQA 4TUUA 2OOBB 5LXIB 4II2B 3ZO5B 2KZRA 2WWZA 2ZCCA 2FUHB 3UQAA 4I6NB 3WIMA 5AZFA 1WI0A 2EMSA 1S3SG 4W9EA 3TMPB 2UYZB 5C23A 3VTWA 3GOEA 3K9OB 3W1YA 3ML9A 3PVLA 5HKHA 2OJRA 2ZVOA 1ZGUB 1WGYA 1UZXB 4GDLB 3TIXA 4GDKA 1RAXA 3VFKA 1Y8RC 3L17A 2KC1A 5IA7A 3AU4A 3SU8X 2A4ZA 4G50A 4JLCA 4NJ6A 1I35A 3M3JA 2KDIA 3ZTCA 1GG3A 3MTNB 3QIJA 3DVGY 1GC6A 4TQ1A 3CSTA 1WM3A 2WDTB 3QA8A 3DVNV 2KD0A 4KZ0A 2IO3B 2IY1B 2GBMA 5DPTA 2MP2A 3ML8A 3B1LX 4ICVA 3RUIB 2IO0B 2LGYA 3ZDTA 3L0WB 3JSVA 4MM3A 4XX5A 2JWZA 2MP2B 4ZYNA 4A20A 2D3GA 2MRPA 2KVRA 3PLVA 2L8JA 4DDID 3ALBA 1UGMA 1UBIA 4TKNA 3AULA 3T9LA 2NBVB 2ZCBA 1BT0A 4MGKE 1V49A 2Y5BB 3B08A 4IC7B 1PQSA 3KYDD 2KDBA 3VH4B 2K1FA 1FXTB 2GMIC 2N1WA 2K39A 2JUOA 2YVCA 3NOBA 3PT2B 2IO2B 4II3B 1I42A 1WR1A 2L3ZA 5JH5C 4HJKA 2LRWA 1G6JA 2EKEC 4IM3A 3ZDMC 1WGDA 2RR9A 4XC2A 4G11A 5G55A 1X1MA 4LDTD 1IP9A 2K6DB 2KJHB 1EF5A 2NPTB 1EO6A 3QJZA 4DDGD 3H6NA 4OVVA 4DHZE 2RPQA 3A1QA 3DVNU 2CR5A 2IYDB 1WZ0A 2M1MA 1UELA 2MBHA 2AEHA 4BKSD 2M17A 3K9PB 3DBRI 3OJ4B 1WM2A 1YX6B 2G4DB 4X57B 2C7HA 3D32A 3JYUA 1E7VA 2J0KA 4LCDE 4WWNA 1F9JA 2KC2A 2BPSA 3BY4B 1V86A 2MX2A 2YLMA 4IWPA 3VDZA 3VH3B 3ZNGC 1NI2A 2JRIB 3CMMB 3A1QB 3P2BA 4EKUA 3A9JA 4EEWA 5C1ZA 4W9DA 3QHTA 3EFUA 3TBLD 2MQJA 2L76A 2O6VD 2AL3A 2KWCA 2UWQA 1YX5B 5GMVA 1KOTA 4HDOA 1LFDA 1P0RA 4GDLA 3QX1A 2NVUI 4ANVA 2GBNA 3S2AA 3DBLI 2MBEA 3AXCA 2KANA 1QZEA 1RLFA 2FCSA 1LM8B 4FHJA 3ZNZB 3UINB 1V6EA 3LJ3A 2PPHA 3PPAA 5DPWA 3X0WA 4NPNA 2MSED 5E6PA 3QWZB 1WXMA 1GC7A 1YIWA 3X23A 2JY6A 3V60A 4FA6A 4NAWA 4FJYA 2XK5A 4BVUC 4CO7A 3PTFC 3N32A 4ZRJA 4KSLC 3HM6X 2FIDA 2PE9A 3DPDA 3KUZA 4IUMB 1WF9A 4JGHB 4KZCA 4GGQA 4I6LB 4HXDA 5D7GA 3VHTC 2LJ5A 3PV1A 1C1YB 1T0YA 4YL8A 4G3XB 2DZJA 3SDLC 3HIZA 2K25A 4NQKE 3PLUA 4OVUA 4FBJB 1M94A 2CHWA 3A4RA 3WAOA 4AUQC 2D10A 3A33B 2KQSA 4BBNC 4W9IA 1OTRB 3B0AA 2IZVB 4LDTB 2B3AA 2BGFA 1AARA 3OAWA 3ZNID 5JHBA 2GBJA 4GXBA 1WXSA 2O2VB 5D94A 1EUVB 3RCZA 3DCGA 3PZDA 2N7EA 1SGHA 2MA9B 2NR2A 1WYWB 3PSEB 3VQIA 4W9HA 2KFJA 4KSKC 3VTVA 4GDKB 1UH6A 3EECA 4HPMB 5D2MB 1E8XA 4EZKA 1V9JA 3IHPC 1WJUA 4KIKA 5CHVC 4CHKA 1J0GA 2GBRA 2JXXA 4J6IA 4WWOA 4EFOA 3HHMA 2LVQA 3UIOB 2KTRA 2JPHA 2HTHA 2DHZA 2M4NA 4MGYE 1K8RB 5EDSA 3RD2A 1WH3A 1KM7A 2M8SA 4GU2A 1MG8A 1OEYJ 2G4SA 4KDLB 1ZW7A 2KLGA 2NS5A 2ZZPB 2AWTA 2C7MB 2JT4B 4JL9A 2BKRB 3KUDB 3A9JB 2DZKA 2C9WB 2KFKB 4AJWA 4FLHA 2Z59B 2RSUA 3PRZA 5J18A 1ZKHA 1WE6A 3APCA 2KX0A 3IBEA 3PHXB 4PS3A 4DHJD 3SD5A 3PGEA 3ONSA 2PJHA 3KW5B 2KJ6A 1GUAB 4N9F4 4DHJB 1WJ4A 3EHVA 1H4RA 3M62B 2FAZA 3AU5A 4MGZE 2GOWA 4AWJA 3AI5A 2CS4A 2JRHA 3QCAA 3KYCD 4HCNB 2LRUA 4NNJB 5CX3A 2C7NB 2ZEQA 2DZIA 4GB9A 1S1QB 1WX8A 2K6QA 2LASA 3ZNHB 5E6NA 3TL5A 4MELA 4WJPA 2VRRB 2LGXA 2KLCA 2EMTA 2FNJB 3RZFA 1IYFA 4M8NA 4NAWB 1UBQA 2XBBC 4HVBA 4IG7B 4W9JA 4WAAA 3TJPA 3H7PB 5IAAC 1TZ1A 1TBEA 1L7YA 2BF8B 2HE7A 3RT3B 2N1VA 1E8WA 4LJOB 2I1JA 2HJ8A 4HK2A 5G2NA 4ASWC 2LGDA 1VCBA 3CSFA 3UF8A 4M0WB 4MH0E 3RYTA 2D11A 1RRBA 2WYQA 4ANUA 2KQ7A 2KK8A 4W9KA 1XD3B 3DQVA 4GSWA 2REXA 3L16A 2LXAA 4LJPB 3VUYA 2FCNA 4BKSA 2LWPA 4ANWA 3H7SA 2IBIB 4M8MA 4W9GA 3VUWA 2RD0A 1A5RA 2V3SA 2DYBA 3KUCB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JVZ X;  3N30 A;  3APF A;  2BYV E;  3VAW A;  3R7R A;  3VXW A;  5KHO A;  1WXV A;  4BFR A;  4F1S A;  4FUL A;  3M95 A;  5KHQ A;  4FJZ A;  4ZDV A;  2ZPN A;  2DAJ A;  2KKC A;  3Q3J A;  3NHE B;  4GN1 A;  5AEK B;  4B6W A;  2PEA A;  4IWQ A;  4IM2 A;  1V81 A;  2GBK A;  3SHQ A;  4DXA B;  3A9K B;  2JZZ A;  2QHO A;  2KDF B;  4B9K A;  4XZ4 A;  4IM0 A;  2DAF A;  1E8Z A;  1Q0W B;  2V4L A;  4WJN A;  3V61 A;  2L0F A;  2LVP A;  4TV3 A;  4FN2 A;  2K8B A;  1LQB A;  4ZRI A;  1YQB A;  1WIA A;  2BKF A;  3VVW B;  2KMC A;  3QK0 A;  1CMX B;  2N9P C;  2ZNV C;  3W1S C;  2DZM A;  2KOX A;  2IY0 B;  2R2Q A;  3ZLZ A;  3V62 A;  2WX0 A;  2KMA A;  2J0J A;  5LXH A;  5CHW A;  2KXJ A;  2XEW A;  4MSM B;  1EF1 A;  3T8M A;  1D3Z A;  1R4M I;  1V5O A;  3DDC B;  2DEN B;  4PS7 A;  3V6E B;  3APD A;  1WR6 E;  3IG3 A;  3UIP B;  4MJS B;  5D6J B;  1C3T A;  1P3Q U;  2N9X A;  1WMH A;  2C60 A;  2MCN B;  4BOZ B;  1WE7 A;  2O2V A;  3OJ3 A;  3H1U A;  2L0T A;  3IFW B;  1WY8 A;  3TCA A;  2FIF A;  1TTN A;  2NBU A;  1LXD A;  1V2Y A;  3NZU A;  4ZRK A;  5J2R A;  2KTF A;  3H7P A;  2KJR A;  3NY5 A;  1WJ6 A;  2N4F A;  4AOF A;  1Z5S B;  3DVG X;  2L05 A;  3ECI A;  4DK5 A;  2JF5 A;  3OLM D;  4I6P A;  3QAR A;  1OQY A;  3O65 B;  1P98 A;  2D2Q A;  3DBH I;  1Q1O A;  3R7Q A;  4AP4 C;  3A9K A;  3RUL A;  1P1A A;  4W9L A;  5AZG A;  3WAP A;  2LD9 A;  2BWE S;  4NY0 A;  3PRP B;  1YJ1 A;  3A4S C;  3QQ8 B;  4IW0 A;  4KV2 A;  1UD7 A;  3U8Z A;  2WX1 A;  3EC8 A;  3JW0 X;  2HD5 B;  1HE8 A;  2KHW B;  5FR6 A;  4MGI E;  3ZIM A;  5CTR C;  2NPT A;  5LLI A;  4HPL B;  4WJQ A;  1J8C A;  1WMH B;  3UQB A;  2V1Y A;  3WAM A;  1L2N A;  1Z2M A;  1WGH A;  1WFY A;  2ZNV B;  4GIV A;  3ZUN A;  4K81 A;  2D07 B;  2M0X A;  1GJZ A;  3MHS D;  3PRE A;  3DBS A;  4KDI C;  2N7D A;  3C0R B;  1RFA A;  3N3K B;  2J0M A;  3VUX A;  2BYE A;  4EZJ A;  4K1R B;  3NZS A;  3BIN A;  1YD8 U;  4RM9 A;  2NBW B;  3HK0 A;  3ZRF A;  3GZN I;  4P7I A;  2IO1 B;  3ZW3 A;  3KVF B;  2KTR B;  2A5U A;  3DOW A;  2O6V B;  1WRD B;  4CYE A;  3ZRC A;  3H9D A;  5DCN A;  1NDD A;  2MBO A;  3LDZ E;  4K7W A;  1TGZ B;  2DYO A;  1Q5W B;  4K7S A;  4F8C B;  2G3Q B;  4JIO U;  3KH0 A;  1IPG A;  5DPS A;  4E71 A;  5L83 A;  2Z0D B;  1R4N I;  3L10 B;  3ZTD A;  3L13 A;  2G45 B;  1GNU A;  1JRU A;  3PHW B;  1ISN A;  1SIF A;  2N9E B;  1SE9 A;  4KVG B;  3WA0 A;  5BO4 B;  2FCQ A;  4HLE A;  1E5W A;  2KX3 A;  4HCP B;  3W1S A;  3JSV B;  4TQ0 A;  1H8C A;  4NJ7 A;  2KWV B;  4DHZ B;  4FAD A;  4PYU A;  2LXC A;  1V80 A;  3CF6 E;  4WJO A;  2W9N A;  4BKG A;  3MJW A;  2C5L C;  2MWS B;  2JZ3 B;  2NCN A;  4ANX A;  3IVF A;  1WGG A;  2MBB B;  1WXA A;  4E74 A;  2KFK A;  4EZL A;  2KO3 A;  4MEM A;  2ZJD A;  3PRM B;  4FHK A;  4HDQ A;  4IWO A;  3M63 B;  2ASQ A;  1J19 A;  5L95 C;  2L00 B;  3QC8 B;  4BKT A;  5J17 A;  5JHA A;  4PS8 A;  2CHZ A;  4DBG A;  5JZE B;  3UGB B;  2ZPY A;  4FJV B;  4DWF A;  3NS8 A;  2O6V A;  4WWP A;  4BOS C;  1XT9 B;  2DYM A;  4NQL B;  4KIK B;  4K7U A;  1KLV A;  4GMV A;  1E8Y A;  1WGR A;  1WZ3 A;  3L54 A;  4WQO B;  4ICU A;  2XK5 B;  3ZKJ C;  1WX9 A;  2Z0E B;  1NBF C;  2CU1 A;  5TR5 A;  3ENE A;  2BYF A;  2JVC A;  4HWI B;  3PS6 A;  2KWU B;  3HM3 A;  4GOC A;  1E7U A;  4MJS A;  3QAQ A;  4EUT A;  4A3P A;  2K8H A;  4JQW C;  3U7D A;  3I3T B;  1V5T A;  3WAL A;  2FCM A;  2LUE A;  2LI5 A;  3Q3F A;  2RGF A;  3L08 A;  3V6C B;  2DX5 B;  2K8C A;  2AYO B;  4B95 A;  4AJY B;  3VTU A;  2R2O A;  5AZH A;  1VD2 A;  2KDE B;  2LVO A;  4MDK E;  5CHF A;  4W9C A;  3R66 C;  3U30 A;  2KN5 A;  3ZVV A;  2CKH B;  1OEY A;  4BBN F;  4EOY A;  1U4A A;  2L7R A;  4G0N B;  3RZW C;  2KNB A;  4RM8 A;  5E6O A;  4F7Z A;  1WJN A;  2AL6 A;  4RMA A;  4URK A;  3R3M A;  2J7Q B;  4A3O A;  2MW5 A;  1E90 A;  1P9D U;  4MSQ B;  1XQQ A;  4E3C A;  4PYZ A;  2I1K A;  2ZVN A;  1WX7 A;  4W9F A;  2CHX A;  2LZ6 A;  1OGW A;  2BWF A;  2PE6 B;  1KJT A;  5DPR A;  3WAN A;  2MLB A;  2MBQ A;  4TUU A;  2OOB B;  5LXI B;  4II2 B;  3ZO5 B;  2KZR A;  2WWZ A;  2ZCC A;  2FUH B;  3UQA A;  4I6N B;  3WIM A;  5AZF A;  1WI0 A;  2EMS A;  1S3S G;  4W9E A;  3TMP B;  2UYZ B;  5C23 A;  3VTW A;  3GOE A;  3K9O B;  3W1Y A;  3ML9 A;  3PVL A;  5HKH A;  2OJR A;  2ZVO A;  1ZGU B;  1WGY A;  1UZX B;  4GDL B;  3TIX A;  4GDK A;  1RAX A;  3VFK A;  1Y8R C;  3L17 A;  2KC1 A;  5IA7 A;  3AU4 A;  3SU8 X;  2A4Z A;  4G50 A;  4JLC A;  4NJ6 A;  1I35 A;  3M3J A;  2KDI A;  3ZTC A;  1GG3 A;  3MTN B;  3QIJ A;  3DVG Y;  1GC6 A;  4TQ1 A;  3CST A;  1WM3 A;  2WDT B;  3QA8 A;  3DVN V;  2KD0 A;  4KZ0 A;  2IO3 B;  2IY1 B;  2GBM A;  5DPT A;  2MP2 A;  3ML8 A;  3B1L X;  4ICV A;  3RUI B;  2IO0 B;  2LGY A;  3ZDT A;  3L0W B;  3JSV A;  4MM3 A;  4XX5 A;  2JWZ A;  2MP2 B;  4ZYN A;  4A20 A;  2D3G A;  2MRP A;  2KVR A;  3PLV A;  2L8J A;  4DDI D;  3ALB A;  1UGM A;  1UBI A;  4TKN A;  3AUL A;  3T9L A;  2NBV B;  2ZCB A;  1BT0 A;  4MGK E;  1V49 A;  2Y5B B;  3B08 A;  4IC7 B;  1PQS A;  3KYD D;  2KDB A;  3VH4 B;  2K1F A;  1FXT B;  2GMI C;  2N1W A;  2K39 A;  2JUO A;  2YVC A;  3NOB A;  3PT2 B;  2IO2 B;  4II3 B;  1I42 A;  1WR1 A;  2L3Z A;  5JH5 C;  4HJK A;  2LRW A;  1G6J A;  2EKE C;  4IM3 A;  3ZDM C;  1WGD A;  2RR9 A;  4XC2 A;  4G11 A;  5G55 A;  1X1M A;  4LDT D;  1IP9 A;  2K6D B;  2KJH B;  1EF5 A;  2NPT B;  1EO6 A;  3QJZ A;  4DDG D;  3H6N A;  4OVV A;  4DHZ E;  2RPQ A;  3A1Q A;  3DVN U;  2CR5 A;  2IYD B;  1WZ0 A;  2M1M A;  1UEL A;  2MBH A;  2AEH A;  4BKS D;  2M17 A;  3K9P B;  3DBR I;  3OJ4 B;  1WM2 A;  1YX6 B;  2G4D B;  4X57 B;  2C7H A;  3D32 A;  3JYU A;  1E7V A;  2J0K A;  4LCD E;  4WWN A;  1F9J A;  2KC2 A;  2BPS A;  3BY4 B;  1V86 A;  2MX2 A;  2YLM A;  4IWP A;  3VDZ A;  3VH3 B;  3ZNG C;  1NI2 A;  2JRI B;  3CMM B;  3A1Q B;  3P2B A;  4EKU A;  3A9J A;  4EEW A;  5C1Z A;  4W9D A;  3QHT A;  3EFU A;  3TBL D;  2MQJ A;  2L76 A;  2O6V D;  2AL3 A;  2KWC A;  2UWQ A;  1YX5 B;  5GMV A;  1KOT A;  4HDO A;  1LFD A;  1P0R A;  4GDL A;  3QX1 A;  2NVU I;  4ANV A;  2GBN A;  3S2A A;  3DBL I;  2MBE A;  3AXC A;  2KAN A;  1QZE A;  1RLF A;  2FCS A;  1LM8 B;  4FHJ A;  3ZNZ B;  3UIN B;  1V6E A;  3LJ3 A;  2PPH A;  3PPA A;  5DPW A;  3X0W A;  4NPN A;  2MSE D;  5E6P A;  3QWZ B;  1WXM A;  1GC7 A;  1YIW A;  3X23 A;  2JY6 A;  3V60 A;  4FA6 A;  4NAW A;  4FJY A;  2XK5 A;  4BVU C;  4CO7 A;  3PTF C;  3N32 A;  4ZRJ A;  4KSL C;  3HM6 X;  2FID A;  2PE9 A;  3DPD A;  3KUZ A;  4IUM B;  1WF9 A;  4JGH B;  4KZC A;  4GGQ A;  4I6L B;  4HXD A;  5D7G A;  3VHT C;  2LJ5 A;  3PV1 A;  1C1Y B;  1T0Y A;  4YL8 A;  4G3X B;  2DZJ A;  3SDL C;  3HIZ A;  2K25 A;  4NQK E;  3PLU A;  4OVU A;  4FBJ B;  1M94 A;  2CHW A;  3A4R A;  3WAO A;  4AUQ C;  2D10 A;  3A33 B;  2KQS A;  4BBN C;  4W9I A;  1OTR B;  3B0A A;  2IZV B;  4LDT B;  2B3A A;  2BGF A;  1AAR A;  3OAW A;  3ZNI D;  5JHB A;  2GBJ A;  4GXB A;  1WXS A;  2O2V B;  5D94 A;  1EUV B;  3RCZ A;  3DCG A;  3PZD A;  2N7E A;  1SGH A;  2MA9 B;  2NR2 A;  1WYW B;  3PSE B;  3VQI A;  4W9H A;  2KFJ A;  4KSK C;  3VTV A;  4GDK B;  1UH6 A;  3EEC A;  4HPM B;  5D2M B;  1E8X A;  4EZK A;  1V9J A;  3IHP C;  1WJU A;  4KIK A;  5CHV C;  4CHK A;  1J0G A;  2GBR A;  2JXX A;  4J6I A;  4WWO A;  4EFO A;  3HHM A;  2LVQ A;  3UIO B;  2KTR A;  2JPH A;  2HTH A;  2DHZ A;  2M4N A;  4MGY E;  1K8R B;  5EDS A;  3RD2 A;  1WH3 A;  1KM7 A;  2M8S A;  4GU2 A;  1MG8 A;  1OEY J;  2G4S A;  4KDL B;  1ZW7 A;  2KLG A;  2NS5 A;  2ZZP B;  2AWT A;  2C7M B;  2JT4 B;  4JL9 A;  2BKR B;  3KUD B;  3A9J B;  2DZK A;  2C9W B;  2KFK B;  4AJW A;  4FLH A;  2Z59 B;  2RSU A;  3PRZ A;  5J18 A;  1ZKH A;  1WE6 A;  3APC A;  2KX0 A;  3IBE A;  3PHX B;  4PS3 A;  4DHJ D;  3SD5 A;  3PGE A;  3ONS A;  2PJH A;  3KW5 B;  2KJ6 A;  1GUA B;  4N9F 4;  4DHJ B;  1WJ4 A;  3EHV A;  1H4R A;  3M62 B;  2FAZ A;  3AU5 A;  4MGZ E;  2GOW A;  4AWJ A;  3AI5 A;  2CS4 A;  2JRH A;  3QCA A;  3KYC D;  4HCN B;  2LRU A;  4NNJ B;  5CX3 A;  2C7N B;  2ZEQ A;  2DZI A;  4GB9 A;  1S1Q B;  1WX8 A;  2K6Q A;  2LAS A;  3ZNH B;  5E6N A;  3TL5 A;  4MEL A;  4WJP A;  2VRR B;  2LGX A;  2KLC A;  2EMT A;  2FNJ B;  3RZF A;  1IYF A;  4M8N A;  4NAW B;  1UBQ A;  2XBB C;  4HVB A;  4IG7 B;  4W9J A;  4WAA A;  3TJP A;  3H7P B;  5IAA C;  1TZ1 A;  1TBE A;  1L7Y A;  2BF8 B;  2HE7 A;  3RT3 B;  2N1V A;  1E8W A;  4LJO B;  2I1J A;  2HJ8 A;  4HK2 A;  5G2N A;  4ASW C;  2LGD A;  1VCB A;  3CSF A;  3UF8 A;  4M0W B;  4MH0 E;  3RYT A;  2D11 A;  1RRB A;  2WYQ A;  4ANU A;  2KQ7 A;  2KK8 A;  4W9K A;  1XD3 B;  3DQV A;  4GSW A;  2REX A;  3L16 A;  2LXA A;  4LJP B;  3VUY A;  2FCN A;  4BKS A;  2LWP A;  4ANW A;  3H7S A;  2IBI B;  4M8M A;  4W9G A;  3VUW A;  2RD0 A;  1A5R A;  2V3S A;  2DYB A;  3KUC B; 
#chains in the Genus database with same CATH topology
 1JRP A;  1V1O A;  3R7R A;  3VXW A;  1WXV A;  3I63 C;  4F1S A;  4FJZ A;  4YSX B;  2ZPN A;  2KKC A;  4IM2 A;  1V81 A;  3KWL A;  2JZZ A;  5IOI A;  2WXF A;  2DAF A;  4WJN A;  1YN5 A;  3W2D A;  4TV3 A;  5FKA C;  4ZRI A;  2KMC A;  2N9P C;  2IPK D;  2WX0 A;  4OZC A;  1JAL A;  4A55 A;  5CHW A;  2KXJ A;  2FBW B;  4MSM B;  1D3Z A;  4NAM A;  4PS7 A;  3V6E B;  3APD A;  3IG3 A;  5D6J B;  3NUH B;  2N9X A;  2NTT A;  4BOZ B;  2FIF A;  2NBU A;  1V2Y A;  3V3X A;  1WYG A;  1JWS D;  2E3T A;  3DVG X;  4DK5 A;  1FIQ A;  4I6P A;  1UGJ A;  1OQY A;  3O65 B;  3DBH I;  1Q1O A;  3R7Q A;  3A9K A;  4W9L A;  5JXV A;  5AZG A;  3WAP A;  1YJ1 A;  3QQ8 B;  3UI3 A;  2WX1 A;  4P6V F;  5FR6 A;  2HD5 B;  1HE8 A;  4MGI E;  3RNC C;  3NJT A;  3ZIM A;  1NEK B;  4RGM A;  5CTR C;  2NPT A;  1T5X D;  2H88 B;  1E6E B;  4M00 A;  3MP9 A;  2ZNV B;  1YMH E;  4GIV A;  2M0X A;  2NTS A;  1ZE3 D;  2JXT A;  4KDI C;  1VJK A;  1J7B A;  4REZ A;  4EZJ A;  3BIN A;  4MT5 A;  4P7I A;  1JRO A;  2IO1 B;  3ABV B;  2A5U A;  2D3B A;  2MBO A;  1TGZ B;  2DYO A;  2G3Q B;  3Q3O C;  2M56 B;  1LO5 D;  1IPG A;  4E71 A;  1R4N I;  1RM6 C;  1GNU A;  5I4D A;  1SIF A;  2D3C A;  1SE9 A;  1GAQ B;  1QKZ A;  1H8C A;  4M01 A;  5HHD G;  4DHZ B;  1MPE A;  2WNM A;  1SSN A;  4BKG A;  2PTL A;  2J53 A;  2MWS B;  2QC8 A;  5BYQ A;  2MBB B;  3U4E G;  4MEM A;  4IWO A;  3M63 B;  2ASQ A;  5L95 C;  2L00 B;  5J17 A;  2ACZ B;  2K3U A;  4M0W A;  4KGT A;  4DWF A;  4WWP A;  3C8Y A;  1EWC A;  1XT9 B;  4BOS C;  4NQL B;  4BZA A;  1CZP A;  3L54 A;  4ICU A;  1NBF C;  2CU1 A;  3ENE A;  2BYF A;  3AH7 A;  4HWI B;  2BS4 B;  2PIA A;  2KWU B;  3HM3 A;  4GOC A;  4DXG A;  2SEB D;  4HRO A;  4XDD A;  1DGJ A;  1BML C;  2AQ2 B;  4A9A A;  4IDI A;  1SF0 A;  2MJE A;  2MJD A;  2FCM A;  1FPY A;  1JWM D;  1TKG A;  2LI5 A;  3Q3F A;  2VZK D;  3L08 A;  4B95 A;  2R2O A;  2LVO A;  4MDK E;  1YQ3 B;  5CHF A;  3ZVV A;  4EOY A;  2L7R A;  2WS3 B;  4KKJ A;  3RZW C;  4RM8 A;  5E6O A;  3FIL B;  1WJN A;  2AL6 A;  2WDR B;  4RMA A;  3R3M A;  1P9D U;  2WP9 B;  1XQQ A;  4HRS A;  4E3C A;  1WX7 A;  1L0X B;  5DPR A;  1K52 A;  1E7P B;  3Q3N C;  1XLO A;  2OOB B;  2IGD A;  4II2 B;  2RPV A;  2ZCC A;  2V4I B;  4LLG M;  2V3N A;  1WI0 A;  1S3S G;  4W9E A;  3TMP B;  2OJR A;  1ZGU B;  4GDK A;  1STE A;  1CJE A;  1Y8R C;  3AU4 A;  3SU8 X;  2A4Z A;  3ZTC A;  5FK9 C;  4TSS A;  3DVG Y;  1I4H A;  4K3C A;  4KKI A;  2KD0 A;  2MP2 A;  3B1L X;  4ICV A;  2IO0 B;  1I4X A;  3IXS A;  3JSV A;  4A20 A;  2KT7 A;  4H2A A;  1N5W A;  1QOG A;  2KVR A;  4DDI D;  3T9L A;  1UGM A;  1UBI A;  2NBV B;  1BT0 A;  4MGK E;  2BTE A;  3NS1 A;  2DWQ A;  3VR8 B;  2I2Y A;  3BYY B;  2PVO D;  2G9H D;  2GMI C;  1TS3 A;  4CQN A;  4RF1 A;  3P4Q B;  2L83 A;  3PT2 B;  2BT6 A;  1ESF A;  3IT6 B;  4L2Y A;  4C4V A;  5C3J B;  1ZP0 B;  4GLS C;  1DYQ A;  1DOI A;  5G5H A;  2K6D B;  3H6N A;  4DHZ E;  2BBC A;  3RNA C;  1UEL A;  4OVZ A;  5FR3 A;  1L5P A;  3PO0 A;  4BKS D;  1WM2 A;  3DBL B;  3MC8 A;  4X57 B;  1BUI C;  3W9C B;  3JYU A;  2J0K A;  2WXK A;  1EU3 A;  2BPS A;  2W82 A;  1V86 A;  2YLM A;  3BY4 B;  3EFC A;  2JRI B;  4EKU A;  4EEW A;  3MC0 B;  3EFU A;  2L76 A;  2UWQ A;  2KWC A;  1YX5 B;  5GMV A;  4HDO A;  3E9S A;  2NVU I;  4ANV A;  3S2A A;  1RLF A;  1FO4 A;  2BVC A;  1ZXI A;  2PPH A;  3PPA A;  3KLS X;  3QWZ B;  3ZJV A;  1P7E A;  1F77 A;  2XK5 A;  3N32 A;  4N59 A;  3DPD A;  3KUZ A;  3PZ8 A;  5D7G A;  4GGQ A;  2LJ5 A;  1C1Y B;  4G3X B;  2DZJ A;  4OVU A;  3BVM A;  1K50 A;  3DHI C;  2QDF A;  3URY A;  4AUQ C;  1ACC A;  1I7H A;  3A33 B;  2K22 A;  4BBN C;  4W9I A;  2OED A;  1OTR B;  3B0A A;  1F2R C;  5JHB A;  1I4G A;  3HUI A;  1EUV B;  3DCG A;  3NVY A;  2NR2 A;  4JWS C;  5E6J A;  3Q8C A;  4YTN B;  4KSK C;  4LNN A;  3VTV A;  1UH6 A;  1E8X A;  4EZK A;  4KIK A;  1TS4 A;  3Q8F A;  1J0G A;  3SFD B;  2GBR A;  4J6I A;  1F52 A;  1IGC A;  1WSP A;  2YEP F;  1IUE A;  2V9H A;  3NG0 A;  1MVK A;  1I4P A;  5EDS A;  4LNF A;  3P1M A;  1KM7 A;  1AN8 A;  1EU4 A;  4RNA A;  2ZZP B;  2AWT A;  2C7M B;  3GZN B;  2JT4 B;  1VZ8 A;  2IJ0 A;  2WXQ A;  4LTU A;  2Z59 B;  2RSU A;  5J18 A;  1ZKH A;  3APC A;  2KX0 A;  3IBE A;  3Q2A C;  1TY2 A;  3C19 A;  4DHJ B;  3SR6 A;  2Q5W D;  3EHV A;  3GS2 A;  3QCA A;  3KYC D;  4B0E A;  2LRU A;  2ZEQ A;  1FXI A;  1T0S C;  4RCO A;  4HVB A;  4WAA A;  1JW9 D;  1TZ1 A;  1VZ7 A;  1L7Y A;  2BF8 B;  3RT3 B;  4HK2 A;  1VCB A;  5HFY A;  1EM7 A;  4W9K A;  4OHJ A;  1YN3 A;  1PFD A;  3APF A;  3BZD B;  1QT9 A;  5KHQ A;  1L4D B;  3NHE B;  1FNW A;  4S17 A;  5AEK B;  2PEA A;  3SHQ A;  4DXA B;  4LNI A;  3A9K B;  1E0Z A;  2QHO A;  3AE5 B;  4R3D A;  2K8B A;  2PW9 A;  1YQB A;  2BKF A;  1LGR A;  2WLB A;  3ZLZ A;  1XXG A;  3V62 A;  3AEC B;  1EF1 A;  1L0V B;  2DEN B;  2MJ3 A;  1R7S A;  1JQ4 A;  3UIP B;  3LYY A;  2QSD A;  1WMH A;  1WE7 A;  2O2V A;  1HZ6 A;  5J2R A;  2KTF A;  3H7P A;  1Z5S B;  4JX1 C;  1ZDX A;  2JF5 A;  1D4B A;  3OLM D;  2MHJ A;  2N9K A;  1JWA D;  3PRP B;  3A4S C;  4KV2 A;  3EC8 A;  2KHW B;  1SEB D;  1KF6 B;  2KAC A;  1WMH B;  2JQR B;  2V3P A;  3UQB A;  3BVZ A;  3WAM A;  1AYF A;  2D07 B;  3MHS D;  3PRE A;  3Q8B A;  3NZS A;  4RM9 A;  2KWD A;  3ZW3 A;  3BK2 A;  1WRD B;  5DCN A;  1F1H A;  4K7W A;  4K7S A;  1K51 A;  4F8C B;  1KFY B;  3J9C A;  3AE9 B;  2KAJ A;  2ZW1 A;  4KGR A;  5L83 A;  2Z0D B;  3L13 A;  4P16 A;  1JRU A;  3PHW B;  5BO4 B;  3GB1 A;  2KX3 A;  1WGK A;  5EE0 A;  2KWV B;  1QOF A;  1V80 A;  2W9N A;  2CU3 A;  2JZ3 B;  1UNS A;  3IVF A;  1JML A;  3RI7 C;  1SE2 A;  3BII D;  4ZRQ A;  2KO3 A;  4JWU C;  2ZJD A;  1IBX B;  2JYT A;  2CHZ A;  1SIJ A;  4DBG A;  5JZE B;  4FJV B;  3NS8 A;  2QCZ A;  1KLV A;  4GMV A;  4WQO B;  3ZKJ C;  1WX9 A;  2Z0E B;  3Q6B A;  3B2F A;  1V8C A;  1IGD A;  2X8X X;  4MJS A;  4A3P A;  2JWU A;  3U7D A;  3WAL A;  3ZXR A;  2KQ4 X;  2RGF A;  2K8C A;  1PGB A;  4XGA B;  2INN E;  3B2G A;  1VD2 A;  2KDE B;  4BBN F;  1YN4 A;  3NVZ A;  1U4A A;  1HA5 A;  1L6V A;  2KNB A;  5GXG B;  3DHG C;  4F7Z A;  1SB3 C;  4A3O A;  2MW5 A;  4PYZ A;  4HPP A;  4ARI A;  1AWD A;  2ZVN A;  4XDC A;  4TUU A;  3MC9 A;  2WWZ A;  3RNE C;  3RFZ B;  3UQA A;  5C23 A;  2SAK A;  3VTW A;  3GOE A;  3K9O B;  3W1Y A;  3ML9 A;  5HKH A;  1IBX A;  1FEH A;  1UZX B;  4GDL B;  1RAX A;  3W5V B;  2KC1 A;  3DHH C;  4NJ6 A;  5D3D A;  2KDI A;  1GG3 A;  3MTN B;  2VH2 A;  4BAX A;  1C4C A;  3CST A;  3QA8 A;  1JWU D;  1T6B X;  4O1N A;  3TEW A;  3RUI B;  1UWX A;  2LGY A;  4ZYN A;  3FAH A;  2D3G A;  5C2T B;  2MRP A;  3PLV A;  5IP4 D;  5BMG A;  4A90 A;  3CIR B;  1V49 A;  1GPX A;  2KDB A;  4ZYS A;  1FXT B;  2K39 A;  2JUO A;  3NOB A;  5BYS A;  1F2R I;  4II3 B;  4PK1 A;  4N58 A;  2LRW A;  3RNG C;  4DQO C;  4IM3 A;  1SXT A;  1WGD A;  2RR9 A;  3OG5 A;  4XC2 A;  4S0R A;  5G55 A;  1X1M A;  1IP9 A;  3R8B A;  3QJZ A;  4DDG D;  3DVN U;  3WCQ A;  2M1M A;  3P63 A;  1T0R C;  1HZ5 A;  2MBH A;  1N6Z A;  2WXG A;  3OJ4 B;  2WDQ B;  3NVW A;  3N9Y C;  4YSY B;  4LCD E;  1F9J A;  2LUM A;  3FC4 A;  1QOB A;  2PVG C;  2LEK A;  4IWP A;  1K53 A;  1FRR A;  4W9D A;  3TBL D;  3KQ4 A;  2ON8 A;  5IN7 A;  2AL3 A;  1KOT A;  2W54 A;  1LFD A;  4C4V B;  2WU5 B;  1E10 A;  2MBE A;  4RGT A;  1V6E A;  1FRD A;  3X0W A;  4NPN A;  2MSE D;  2Z8L A;  3X23 A;  3V60 A;  4FJY A;  2LGS A;  3PTF C;  1I4Q A;  3HM6 X;  2FID A;  4IUM B;  1HEZ E;  4AQ7 A;  1PGX A;  4I6L B;  5HI1 A;  3AEE B;  3PV1 A;  3SDL C;  4YL8 A;  1QLB B;  2K25 A;  3PLU A;  3P42 A;  5T8I A;  4FBJ B;  4YTM B;  1V1P A;  2OJW A;  4LDT B;  2B3A A;  1AAR A;  1XCT L;  3OAW A;  4LNK A;  3RCZ A;  1ET9 A;  3AE1 B;  2WXM A;  4LK0 M;  2LMC A;  1MFW A;  4HPM B;  1V9J A;  3IHP C;  5CHV C;  3U52 E;  4OZA A;  3LXF A;  4L1B A;  4EFO A;  2LVQ A;  3UIO B;  2KTR A;  1KLG D;  2M8S A;  4GU2 A;  1OEY J;  2G4S A;  1RYJ A;  3KUD B;  5EE1 A;  1FMA D;  2C9W B;  3R2T A;  4AJW A;  2WXP A;  3VRB B;  1WE6 A;  3DWM A;  2PJH A;  2IGG A;  3KW5 B;  2KJ6 A;  1GUA B;  2VH1 A;  1WJ4 A;  2N0S B;  1H4R A;  3AI5 A;  2CS4 A;  1TIF A;  4HCN B;  4NNJ B;  5CX3 A;  2C7N B;  1GB1 A;  4GB9 A;  4WIP A;  2YEP B;  1XF5 L;  4MEL A;  3HRD D;  3T3N A;  1ENF A;  2KLC A;  3DBR B;  2N7J A;  4MH8 A;  3RZF A;  4M8N A;  4IG7 B;  3H7P B;  2UU7 A;  1Q10 A;  1MHX A;  1D6E C;  5BYR A;  2I1J A;  3AE4 B;  3AE2 B;  3UF8 A;  4M0W B;  1ET6 A;  2WYQ A;  2REX A;  3L16 A;  2LXA A;  2FCN A;  5IO9 A;  1M4V A;  2V3S A;  3JVZ X;  1FM0 D;  3N30 A;  1TYG B;  1NVI D;  3AEF B;  4ZDV A;  4GN1 A;  3Q3J A;  4ACF A;  4B6W A;  3BWU D;  2IDY A;  1ROE A;  3VRA B;  1KLU D;  2JZP A;  2KDF B;  3ZJT A;  4P1C C;  4IM0 A;  1Q0W B;  1VRA B;  2HJ1 A;  2LVP A;  1FCL A;  2H89 B;  4FN2 A;  1LQB A;  1CMX B;  1FXA A;  2ZNV C;  2DZM A;  2KOX A;  2IY0 B;  2R2Q A;  2KMA A;  2J0J A;  5LXH A;  3T8M A;  1PDX A;  1V5O A;  3SFE B;  1WR6 E;  4HJG E;  1C3T A;  2C60 A;  2MCN B;  3T3O A;  3R2I A;  3TCA A;  1XLP A;  1TTN A;  2K5P A;  4J3O D;  3NZU A;  5H8Y E;  4ZRK A;  2KJR A;  3NY5 A;  1C77 A;  2N4F A;  4AOF A;  1HQR D;  3ECI A;  2L05 A;  1HXY D;  4ITK A;  1TT5 B;  1P1A A;  4QAY A;  1NYQ A;  2LD9 A;  2BWE S;  1UD7 A;  3U8Z A;  3JW0 X;  1J8C A;  4WJQ A;  2GLS A;  1CK1 A;  1N60 A;  3Q14 C;  1N63 A;  4OW0 A;  2V1Y A;  1L2N A;  1Z2M A;  1WGH A;  5D3I B;  1WFY A;  3ZUN A;  1YOV B;  4K81 A;  1V1P B;  1GJZ A;  3DBS A;  1J7A A;  2N7D A;  2XNA C;  1RFA A;  3C0R B;  3N3K B;  1FNV A;  1GB4 A;  4K1R B;  3GZN I;  2NMQ A;  1VZ6 A;  4CYE A;  3ZRC A;  5H92 C;  3LDZ E;  3I5J C;  4JIO U;  2WXL A;  4M02 A;  3KH0 A;  5DPS A;  2RDH A;  3Q69 A;  2CJN A;  2G45 B;  3TSS A;  2ICI A;  1ISN A;  3PZ7 A;  2N9E B;  2Y3A A;  4KVG B;  4HLE A;  4HCP B;  4MM3 B;  1YJI A;  1FCC C;  1FFV A;  4PYU A;  3AE6 B;  2LXC A;  3CF6 E;  3MJW A;  2NCN A;  1WGG A;  1WXA A;  4E74 A;  1MG4 A;  4FHK A;  3QC8 B;  5JHA A;  4PS8 A;  4WQM A;  3UGB B;  2ZPY A;  2O6V A;  2DYM A;  2XK5 B;  5TR5 A;  1N5X A;  2JVC A;  4ARC A;  2AQ3 B;  2BS3 B;  3PS6 A;  1E7U A;  3QAQ A;  4EUT A;  3FIL A;  4RGN A;  1V5T A;  2LUE A;  3P4R B;  3GE3 C;  3V6C B;  2DX5 B;  3U7Z A;  4AJY B;  4JE3 B;  5AZH A;  3R66 C;  2CKH B;  2J4X A;  4G0N B;  1P7F A;  4L23 A;  4URK A;  2J7Q B;  1E90 A;  4PT5 A;  2I1K A;  4W9F A;  2CHX A;  3MHZ A;  2LZ6 A;  1OGW A;  2PE6 B;  3WAN A;  2MLB A;  2MBQ A;  4XWW A;  3ZO5 B;  1PYW D;  2KZR A;  3PVL A;  2X38 A;  2ZVO A;  2BB5 A;  3ETR A;  1I4R A;  3VFK A;  3L17 A;  3AV8 A;  4JLC A;  4G50 A;  1FFU A;  1I35 A;  1GC6 A;  4XYC A;  3V05 A;  1WM3 A;  4A6Q A;  3AE3 B;  3DVN V;  2IO3 B;  2IY1 B;  2GBM A;  5DPT A;  2HDE A;  4XX5 A;  2JWZ A;  2MP2 B;  3ZJU A;  2VZK B;  2L8J A;  3ALB A;  3AUL A;  2ZCB A;  2M19 A;  2Y5B B;  4IC7 B;  3KYD D;  3RN9 C;  2LHE A;  2K1F A;  2LGI A;  4LNO A;  1I42 A;  1R4N B;  1WR1 A;  4HJK A;  1G6J A;  2K0P A;  3DWG C;  2WQY B;  1UF0 A;  1TKY A;  1EF5 A;  2Y5C A;  1V97 A;  1EO6 A;  1N62 A;  4OVV A;  2RPQ A;  2CR5 A;  2IYD B;  4MAC A;  2AEH A;  3KWV A;  3DBR I;  1YX6 B;  2G4D B;  3D32 A;  4USA A;  2KC2 A;  2WXJ A;  4ZRP A;  3VH3 B;  3ZNG C;  2WHI A;  3P2B A;  3A1Q B;  3A9J A;  2BQQ A;  3QHT A;  2MQJ A;  2IGH A;  2WDV B;  4GDL A;  3QX1 A;  4IOI E;  2WXI A;  3AXC A;  3B9J A;  2QIE B;  2KAN A;  1QZE A;  1LM8 B;  2K9X A;  3IAM 1;  4FHJ A;  3I9V 1;  3ZNZ B;  3LJ3 A;  4KX6 B;  1L6U A;  1GC7 A;  1YIW A;  2JY6 A;  4FA6 A;  2DBY A;  1DOY A;  4CO7 A;  4ZRJ A;  4KSL C;  1WF9 A;  2ZW0 A;  4KZC A;  1T0Y A;  4NQK E;  3HVD A;  4N6E B;  1M94 A;  3ZYY X;  2QIL A;  2D10 A;  1WWT A;  3BVG A;  2IZV B;  1TS2 A;  3ZNI D;  3RMK C;  4GXB A;  5D94 A;  3PZD A;  2N7E A;  2EEL A;  1GOZ A;  1WYW B;  2FE8 A;  3PSE B;  4C56 C;  4WH4 A;  2KFJ A;  3IT4 B;  5AUK A;  5D2M B;  1WJU A;  4RF0 A;  2KDM A;  2MH7 A;  1TJE A;  3GE8 C;  2N9L A;  3HHM A;  3AEG B;  2HTH A;  2M4N A;  5EE9 A;  3I57 A;  1MG8 A;  1ZW7 A;  2NS5 A;  2MEK A;  4JL9 A;  2QEJ C;  2KN4 A;  4TMA B;  3A9J B;  4FLH A;  1PUT A;  3PRZ A;  1JWB D;  4PS3 A;  4DHJ D;  1RWS A;  2JX5 A;  4N9F 4;  3AEA B;  2FAZ A;  3AU5 A;  3EA6 A;  3P4S B;  2JRH A;  5HG2 A;  5G5G A;  1QOA A;  3ZNH B;  5E6N A;  4NZL B;  2VRR B;  2WGS A;  2LGX A;  1OQR A;  1UBQ A;  2XBB C;  3TEX A;  4W9J A;  4YT0 B;  3MFG A;  1TBE A;  4LJO B;  3HVZ A;  1E8W A;  2N1V A;  5G2N A;  5BMI A;  2W55 A;  3TEZ A;  3CSF A;  1D5M C;  1B1Z A;  4MH0 E;  2V0G A;  1L0Y B;  1J7C A;  1PGA A;  2KQ7 A;  4LJP B;  3VUY A;  4IKG A;  4BKS A;  2GB1 A;  4ANW A;  2LWP A;  3H7S A;  2IBI B;  4W9G A;  2RD0 A;  1ZOY B;  3KUC B;  2KVZ A;  1KTK A;  2BYV E;  3VAW A;  5KHO A;  4BFR A;  4FUL A;  2LHD A;  3M95 A;  2DAJ A;  2BYT A;  3N1Y C;  3EGR A;  4IWQ A;  2GBK A;  3AEB B;  3TEY A;  4B9K A;  4XZ4 A;  2INC C;  1E8Z A;  2V4L A;  3V61 A;  1NYR A;  2L0F A;  1WIA A;  3H8H A;  1C9F A;  3VVW B;  3QK0 A;  3NRZ A;  3W1S C;  1JCK B;  1YQ4 B;  2LJI A;  2XEW A;  1YJJ A;  1R4M I;  1QQR A;  3DDC B;  3IAS 1;  4HKQ A;  2KMM A;  4MJS B;  2DNF A;  1P3Q U;  3LB8 C;  3OJ3 A;  3H1U A;  2L0T A;  3IFW B;  1WY8 A;  2HTM E;  1LXD A;  1SJE D;  1WJ6 A;  1EWY C;  4JPS A;  3QAR A;  4RFB A;  1P98 A;  2D2Q A;  4AP4 C;  3RUL A;  4K3B A;  2B76 B;  1TZO A;  4NY0 A;  4IW0 A;  3U2S C;  4US8 A;  2DLB A;  5LLI A;  4YTP B;  4HPL B;  4P1B C;  1QIL A;  2WXN A;  3AMZ A;  1BXT A;  1XEE A;  2J0M A;  3VUX A;  2BYE A;  1YD8 U;  2NBW B;  3HK0 A;  3N1X C;  3ZRF A;  3KVF B;  2KTR B;  3DOW A;  1XLQ A;  2O6V B;  2QJL A;  3H9D A;  1NDD A;  3EUB 2;  5TSS A;  1Q5W B;  4OZB A;  3ZTD A;  1SE3 A;  3L10 B;  4RGO S;  3WA0 A;  2FCQ A;  1E5W A;  3CWI A;  2W3S A;  4HKZ E;  3W1S A;  3JSV B;  4TQ0 A;  4NJ7 A;  2D5G A;  4FAD A;  3Q8A A;  4WJO A;  1VLB A;  2C5L C;  4ANX A;  1WXQ A;  2PLP A;  2KFK A;  4EZL A;  3PRM B;  4HDQ A;  1J19 A;  4BKT A;  3W5U B;  2W3R A;  2J52 A;  1YNT E;  1MJD A;  1HTO A;  3Q8E A;  4RH6 A;  1XLN A;  2E6X A;  4KIK B;  4K7U A;  3AED B;  1E8Y A;  1WGR A;  1WZ3 A;  4B0M A;  1DOX A;  4ZHO A;  3VR9 B;  1C78 A;  4A8X C;  2TSS A;  2K8H A;  2OHF A;  3ZGZ A;  4JQW C;  4EE2 A;  3I3T B;  3Q3M C;  2JU6 X;  2BW2 A;  2PKO A;  1XCQ L;  2AYO B;  3VTU A;  1ZPS A;  2CJO A;  4W9C A;  3U30 A;  2KN5 A;  1OEY A;  1NEN B;  2GI9 A;  2FUG 1;  4MSQ B;  4Q2J A;  2R61 A;  4KGS A;  5AUI A;  2BWF A;  1C4P A;  1KJT A;  5LXI B;  2AQ1 B;  3P4P B;  4C7Y A;  2FUH B;  3N1Z C;  4I6N B;  3WIM A;  5AZF A;  2EMS A;  2UYZ B;  4DXF A;  3ZQ4 A;  1F0Z A;  1WGY A;  3TIX A;  1TS5 A;  1N61 A;  5IA7 A;  2LFI A;  3M3J A;  4C00 A;  2WXR A;  1C76 A;  1VR9 A;  3QIJ A;  4YSZ B;  1AW7 A;  1FNU A;  4TQ1 A;  2WDT B;  2KYW A;  3ZXV A;  4C7Z A;  4KZ0 A;  3AB5 A;  3BYT B;  5BMH A;  2D3A A;  1SJH D;  2RMM A;  3ML8 A;  1ZDV A;  4HEA 1;  3ZDT A;  3L0W B;  4MM3 A;  1ZUD 2;  2BS2 B;  4AS1 A;  4TKN A;  3OWE B;  4ZHP A;  4C80 A;  1C4A A;  3B08 A;  1PQS A;  1B9R A;  3VH4 B;  2N1W A;  2YVC A;  4ZOH C;  2IO2 B;  3AE8 B;  2L3Z A;  5JH5 C;  3NZ3 A;  2EKE C;  3ZDM C;  3RNF C;  1SBB B;  4WWM A;  2J42 A;  4G11 A;  4D2K A;  4LDT D;  1T0Q C;  2KJH B;  2RDB C;  4NJC A;  2NPT B;  3RPF C;  3A1Q A;  2QMT A;  1WZ0 A;  1FD6 A;  1UUP A;  3AE7 B;  2M17 A;  3K9P B;  2C7H A;  4WWN A;  1D5Z C;  1E7V A;  5EE3 A;  3RNB C;  2XN9 C;  3VDZ A;  2MX2 A;  3L4P A;  1NI2 A;  3CMM B;  5C1Z A;  3TUO A;  2O6V D;  1C79 A;  5MPO A;  1P0R A;  2GBN A;  1OQQ A;  4YWG G;  3DBL I;  1UWM A;  2BB6 A;  1Y56 A;  2FCS A;  3UIN B;  1KH0 A;  5DPW A;  5E6P A;  1WXM A;  1CQV A;  4NAW A;  5IKC M;  2WU2 B;  4FXC A;  4BVU C;  3AN1 A;  1VDV A;  2PE9 A;  4JGH B;  4HXD A;  2Y5P A;  3VHT C;  3HIZ A;  2EKI A;  2CHW A;  3A4R A;  3WAO A;  3NVV A;  1RFK A;  2WXO A;  5LNK 1;  2KQS A;  2ONQ A;  2JYE A;  1QF6 A;  2BGF A;  1TKE A;  2INP E;  2GBJ A;  1WXS A;  2O2V B;  1HTQ A;  4US9 A;  1SGH A;  2MA9 B;  2AX5 A;  3VQI A;  1SE4 A;  3AM9 A;  1D5X C;  4W9H A;  4GDK B;  3EEC A;  2I38 A;  4UDU C;  1KRH A;  1T3Q A;  4CHK A;  1WRI A;  2JSV X;  2JXX A;  3GP7 A;  4WWO A;  2L52 A;  3DBH B;  3E56 A;  3FKY A;  4YXD B;  2JPH A;  1OFF A;  2DHZ A;  4MGY E;  1K8R B;  3RD2 A;  1WH3 A;  4KDL B;  4XE0 A;  2KLG A;  1NI3 A;  2BKR B;  3MJ5 A;  2DZK A;  2KFK B;  1E9M A;  3BK1 A;  3PHX B;  3SD5 A;  3PGE A;  3ONS A;  3O13 A;  2WXH A;  1A70 A;  3M62 B;  2RDG A;  1TY0 A;  4MGZ E;  4AWJ A;  1L4Z B;  2GOW A;  2DZI A;  1XO3 A;  1S1Q B;  1WX8 A;  2K6Q A;  2GRI A;  2LAS A;  3TL5 A;  4WJP A;  1MHH E;  2L1A A;  4WUR A;  2EMT A;  2FNJ B;  1IYF A;  4NAW B;  1MI0 A;  3TJP A;  5IAA C;  2M0A A;  2L32 A;  2HE7 A;  4ASW C;  2IND C;  2HJ8 A;  2PMV A;  4WAF A;  2LGD A;  3N20 C;  3RYT A;  1R4M B;  2D11 A;  3SEB A;  1ZXH A;  1RRB A;  4ANU A;  2G1E A;  4XWT A;  2KK8 A;  1XD3 B;  3DQV A;  4GSW A;  1A5R A;  4M8M A;  3VUW A;  2DYB A; 
#chains in the Genus database with same CATH homology
 3JVZ X;  3N30 A;  3APF A;  2BYV E;  3VAW A;  3R7R A;  3VXW A;  5KHO A;  1WXV A;  4BFR A;  4F1S A;  4FUL A;  3M95 A;  5KHQ A;  4FJZ A;  4ZDV A;  2ZPN A;  2DAJ A;  2KKC A;  3Q3J A;  3NHE B;  4GN1 A;  5AEK B;  4B6W A;  2PEA A;  4IWQ A;  4IM2 A;  1V81 A;  2GBK A;  3SHQ A;  4DXA B;  3A9K B;  2JZZ A;  2QHO A;  2KDF B;  4B9K A;  4XZ4 A;  4IM0 A;  2DAF A;  1E8Z A;  1Q0W B;  2V4L A;  4WJN A;  3V61 A;  2L0F A;  2LVP A;  4TV3 A;  4FN2 A;  2K8B A;  1LQB A;  4ZRI A;  1YQB A;  1WIA A;  2BKF A;  3VVW B;  2KMC A;  3QK0 A;  1CMX B;  2N9P C;  2ZNV C;  3W1S C;  2DZM A;  2KOX A;  2IY0 B;  2R2Q A;  3ZLZ A;  3V62 A;  2WX0 A;  2KMA A;  2J0J A;  5LXH A;  5CHW A;  2KXJ A;  2XEW A;  4MSM B;  1EF1 A;  3T8M A;  1D3Z A;  1R4M I;  1V5O A;  3DDC B;  2DEN B;  4PS7 A;  3V6E B;  3APD A;  1WR6 E;  3IG3 A;  3UIP B;  4MJS B;  5D6J B;  1C3T A;  1P3Q U;  2N9X A;  1WMH A;  2C60 A;  2MCN B;  4BOZ B;  1WE7 A;  2O2V A;  3OJ3 A;  3H1U A;  2L0T A;  3IFW B;  1WY8 A;  3TCA A;  2FIF A;  1TTN A;  2NBU A;  1LXD A;  1V2Y A;  3NZU A;  4ZRK A;  5J2R A;  2KTF A;  3H7P A;  2KJR A;  3NY5 A;  1WJ6 A;  2N4F A;  4AOF A;  1Z5S B;  3DVG X;  2L05 A;  3ECI A;  4DK5 A;  2JF5 A;  3OLM D;  4I6P A;  3QAR A;  1OQY A;  3O65 B;  1P98 A;  2D2Q A;  3DBH I;  1Q1O A;  3R7Q A;  4AP4 C;  3A9K A;  3RUL A;  1P1A A;  4W9L A;  5AZG A;  3WAP A;  2LD9 A;  2BWE S;  4NY0 A;  3PRP B;  1YJ1 A;  3A4S C;  3QQ8 B;  4IW0 A;  4KV2 A;  1UD7 A;  3U8Z A;  2WX1 A;  3EC8 A;  3JW0 X;  2HD5 B;  1HE8 A;  2KHW B;  5FR6 A;  4MGI E;  3ZIM A;  5CTR C;  2NPT A;  5LLI A;  4HPL B;  4WJQ A;  1J8C A;  1WMH B;  3UQB A;  2V1Y A;  3WAM A;  1L2N A;  1Z2M A;  1WGH A;  1WFY A;  2ZNV B;  4GIV A;  3ZUN A;  4K81 A;  2D07 B;  2M0X A;  1GJZ A;  3MHS D;  3PRE A;  3DBS A;  4KDI C;  2N7D A;  3C0R B;  1RFA A;  3N3K B;  2J0M A;  3VUX A;  2BYE A;  4EZJ A;  4K1R B;  3NZS A;  3BIN A;  1YD8 U;  4RM9 A;  2NBW B;  3HK0 A;  3ZRF A;  3GZN I;  4P7I A;  2IO1 B;  3ZW3 A;  3KVF B;  2KTR B;  2A5U A;  3DOW A;  2O6V B;  1WRD B;  4CYE A;  3ZRC A;  3H9D A;  5DCN A;  1NDD A;  2MBO A;  3LDZ E;  4K7W A;  1TGZ B;  2DYO A;  1Q5W B;  4K7S A;  4F8C B;  2G3Q B;  4JIO U;  3KH0 A;  1IPG A;  5DPS A;  4E71 A;  5L83 A;  2Z0D B;  1R4N I;  3L10 B;  3ZTD A;  3L13 A;  2G45 B;  1GNU A;  1JRU A;  3PHW B;  1ISN A;  1SIF A;  2N9E B;  1SE9 A;  4KVG B;  3WA0 A;  5BO4 B;  2FCQ A;  4HLE A;  1E5W A;  2KX3 A;  4HCP B;  3W1S A;  3JSV B;  4TQ0 A;  1H8C A;  4NJ7 A;  2KWV B;  4DHZ B;  4FAD A;  4PYU A;  2LXC A;  1V80 A;  3CF6 E;  4WJO A;  2W9N A;  4BKG A;  3MJW A;  2C5L C;  2MWS B;  2JZ3 B;  2NCN A;  4ANX A;  3IVF A;  1WGG A;  2MBB B;  1WXA A;  4E74 A;  2KFK A;  4EZL A;  2KO3 A;  4MEM A;  2ZJD A;  3PRM B;  4FHK A;  4HDQ A;  4IWO A;  3M63 B;  2ASQ A;  1J19 A;  5L95 C;  2L00 B;  3QC8 B;  4BKT A;  5J17 A;  5JHA A;  4PS8 A;  2CHZ A;  4DBG A;  5JZE B;  3UGB B;  2ZPY A;  4FJV B;  4DWF A;  3NS8 A;  2O6V A;  4WWP A;  4BOS C;  1XT9 B;  2DYM A;  4NQL B;  4KIK B;  4K7U A;  1KLV A;  4GMV A;  1E8Y A;  1WGR A;  1WZ3 A;  3L54 A;  4WQO B;  4ICU A;  2XK5 B;  3ZKJ C;  1WX9 A;  2Z0E B;  1NBF C;  2CU1 A;  5TR5 A;  3ENE A;  2BYF A;  2JVC A;  4HWI B;  3PS6 A;  2KWU B;  3HM3 A;  4GOC A;  1E7U A;  4MJS A;  3QAQ A;  4EUT A;  4A3P A;  2K8H A;  4JQW C;  3U7D A;  3I3T B;  1V5T A;  3WAL A;  2FCM A;  2LUE A;  2LI5 A;  3Q3F A;  2RGF A;  3L08 A;  3V6C B;  2DX5 B;  2K8C A;  2AYO B;  4B95 A;  4AJY B;  3VTU A;  2R2O A;  5AZH A;  1VD2 A;  2KDE B;  2LVO A;  4MDK E;  5CHF A;  4W9C A;  3R66 C;  3U30 A;  2KN5 A;  3ZVV A;  2CKH B;  1OEY A;  4BBN F;  4EOY A;  1U4A A;  2L7R A;  4G0N B;  3RZW C;  2KNB A;  4RM8 A;  5E6O A;  4F7Z A;  1WJN A;  2AL6 A;  4RMA A;  4URK A;  3R3M A;  2J7Q B;  4A3O A;  2MW5 A;  1E90 A;  1P9D U;  4MSQ B;  1XQQ A;  4E3C A;  4PYZ A;  2I1K A;  2ZVN A;  1WX7 A;  4W9F A;  2CHX A;  2LZ6 A;  1OGW A;  2BWF A;  2PE6 B;  1KJT A;  5DPR A;  3WAN A;  2MLB A;  2MBQ A;  4TUU A;  2OOB B;  5LXI B;  4II2 B;  3ZO5 B;  2KZR A;  2WWZ A;  2ZCC A;  2FUH B;  3UQA A;  4I6N B;  3WIM A;  5AZF A;  1WI0 A;  2EMS A;  1S3S G;  4W9E A;  3TMP B;  2UYZ B;  5C23 A;  3VTW A;  3GOE A;  3K9O B;  3W1Y A;  3ML9 A;  3PVL A;  5HKH A;  2OJR A;  2ZVO A;  1ZGU B;  1WGY A;  1UZX B;  4GDL B;  3TIX A;  4GDK A;  1RAX A;  3VFK A;  1Y8R C;  3L17 A;  2KC1 A;  5IA7 A;  3AU4 A;  3SU8 X;  2A4Z A;  4G50 A;  4JLC A;  4NJ6 A;  1I35 A;  3M3J A;  2KDI A;  3ZTC A;  1GG3 A;  3MTN B;  3QIJ A;  3DVG Y;  1GC6 A;  4TQ1 A;  3CST A;  1WM3 A;  2WDT B;  3QA8 A;  3DVN V;  2KD0 A;  4KZ0 A;  2IO3 B;  2IY1 B;  2GBM A;  5DPT A;  2MP2 A;  3ML8 A;  3B1L X;  4ICV A;  3RUI B;  2IO0 B;  2LGY A;  3ZDT A;  3L0W B;  3JSV A;  4MM3 A;  4XX5 A;  2JWZ A;  2MP2 B;  4ZYN A;  4A20 A;  2D3G A;  2MRP A;  2KVR A;  3PLV A;  2L8J A;  4DDI D;  3ALB A;  1UGM A;  1UBI A;  4TKN A;  3AUL A;  3T9L A;  2NBV B;  2ZCB A;  1BT0 A;  4MGK E;  1V49 A;  2Y5B B;  3B08 A;  4IC7 B;  1PQS A;  3KYD D;  2KDB A;  3VH4 B;  2K1F A;  1FXT B;  2GMI C;  2N1W A;  2K39 A;  2JUO A;  2YVC A;  3NOB A;  3PT2 B;  2IO2 B;  4II3 B;  1I42 A;  1WR1 A;  2L3Z A;  5JH5 C;  4HJK A;  2LRW A;  1G6J A;  2EKE C;  4IM3 A;  3ZDM C;  1WGD A;  2RR9 A;  4XC2 A;  4G11 A;  5G55 A;  1X1M A;  4LDT D;  1IP9 A;  2K6D B;  2KJH B;  1EF5 A;  2NPT B;  1EO6 A;  3QJZ A;  4DDG D;  3H6N A;  4OVV A;  4DHZ E;  2RPQ A;  3A1Q A;  3DVN U;  2CR5 A;  2IYD B;  1WZ0 A;  2M1M A;  1UEL A;  2MBH A;  2AEH A;  4BKS D;  2M17 A;  3K9P B;  3DBR I;  3OJ4 B;  1WM2 A;  1YX6 B;  2G4D B;  4X57 B;  2C7H A;  3D32 A;  3JYU A;  1E7V A;  2J0K A;  4LCD E;  4WWN A;  1F9J A;  2KC2 A;  2BPS A;  3BY4 B;  1V86 A;  2MX2 A;  2YLM A;  4IWP A;  3VDZ A;  3VH3 B;  3ZNG C;  1NI2 A;  2JRI B;  3CMM B;  3A1Q B;  3P2B A;  4EKU A;  3A9J A;  4EEW A;  5C1Z A;  4W9D A;  3QHT A;  3EFU A;  3TBL D;  2MQJ A;  2L76 A;  2O6V D;  2AL3 A;  2KWC A;  2UWQ A;  1YX5 B;  5GMV A;  1KOT A;  4HDO A;  1LFD A;  1P0R A;  4GDL A;  3QX1 A;  2NVU I;  4ANV A;  2GBN A;  3S2A A;  3DBL I;  2MBE A;  3AXC A;  2KAN A;  1QZE A;  1RLF A;  2FCS A;  1LM8 B;  4FHJ A;  3ZNZ B;  3UIN B;  1V6E A;  3LJ3 A;  2PPH A;  3PPA A;  5DPW A;  3X0W A;  4NPN A;  2MSE D;  5E6P A;  3QWZ B;  1WXM A;  1GC7 A;  1YIW A;  3X23 A;  2JY6 A;  3V60 A;  4FA6 A;  4NAW A;  4FJY A;  2XK5 A;  4BVU C;  4CO7 A;  3PTF C;  3N32 A;  4ZRJ A;  4KSL C;  3HM6 X;  2FID A;  2PE9 A;  3DPD A;  3KUZ A;  4IUM B;  1WF9 A;  4JGH B;  4KZC A;  4GGQ A;  4I6L B;  4HXD A;  5D7G A;  3VHT C;  2LJ5 A;  3PV1 A;  1C1Y B;  1T0Y A;  4YL8 A;  4G3X B;  2DZJ A;  3SDL C;  3HIZ A;  2K25 A;  4NQK E;  3PLU A;  4OVU A;  4FBJ B;  1M94 A;  2CHW A;  3A4R A;  3WAO A;  4AUQ C;  2D10 A;  3A33 B;  2KQS A;  4BBN C;  4W9I A;  1OTR B;  3B0A A;  2IZV B;  4LDT B;  2B3A A;  2BGF A;  1AAR A;  3OAW A;  3ZNI D;  5JHB A;  2GBJ A;  4GXB A;  1WXS A;  2O2V B;  5D94 A;  1EUV B;  3RCZ A;  3DCG A;  3PZD A;  2N7E A;  1SGH A;  2MA9 B;  2NR2 A;  1WYW B;  3PSE B;  3VQI A;  4W9H A;  2KFJ A;  4KSK C;  3VTV A;  4GDK B;  1UH6 A;  3EEC A;  4HPM B;  5D2M B;  1E8X A;  4EZK A;  1V9J A;  3IHP C;  1WJU A;  4KIK A;  5CHV C;  4CHK A;  1J0G A;  2GBR A;  2JXX A;  4J6I A;  4WWO A;  4EFO A;  3HHM A;  2LVQ A;  3UIO B;  2KTR A;  2JPH A;  2HTH A;  2DHZ A;  2M4N A;  4MGY E;  1K8R B;  5EDS A;  3RD2 A;  1WH3 A;  1KM7 A;  2M8S A;  4GU2 A;  1MG8 A;  1OEY J;  2G4S A;  4KDL B;  1ZW7 A;  2KLG A;  2NS5 A;  2ZZP B;  2AWT A;  2C7M B;  2JT4 B;  4JL9 A;  2BKR B;  3KUD B;  3A9J B;  2DZK A;  2C9W B;  2KFK B;  4AJW A;  4FLH A;  2Z59 B;  2RSU A;  3PRZ A;  5J18 A;  1ZKH A;  1WE6 A;  3APC A;  2KX0 A;  3IBE A;  3PHX B;  4PS3 A;  4DHJ D;  3SD5 A;  3PGE A;  3ONS A;  2PJH A;  3KW5 B;  2KJ6 A;  1GUA B;  4N9F 4;  4DHJ B;  1WJ4 A;  3EHV A;  1H4R A;  3M62 B;  2FAZ A;  3AU5 A;  4MGZ E;  2GOW A;  4AWJ A;  3AI5 A;  2CS4 A;  2JRH A;  3QCA A;  3KYC D;  4HCN B;  2LRU A;  4NNJ B;  5CX3 A;  2C7N B;  2ZEQ A;  2DZI A;  4GB9 A;  1S1Q B;  1WX8 A;  2K6Q A;  2LAS A;  3ZNH B;  5E6N A;  3TL5 A;  4MEL A;  4WJP A;  2VRR B;  2LGX A;  2KLC A;  2EMT A;  2FNJ B;  3RZF A;  1IYF A;  4M8N A;  4NAW B;  1UBQ A;  2XBB C;  4HVB A;  4IG7 B;  4W9J A;  4WAA A;  3TJP A;  3H7P B;  5IAA C;  1TZ1 A;  1TBE A;  1L7Y A;  2BF8 B;  2HE7 A;  3RT3 B;  2N1V A;  1E8W A;  4LJO B;  2I1J A;  2HJ8 A;  4HK2 A;  5G2N A;  4ASW C;  2LGD A;  1VCB A;  3CSF A;  3UF8 A;  4M0W B;  4MH0 E;  3RYT A;  2D11 A;  1RRB A;  2WYQ A;  4ANU A;  2KQ7 A;  2KK8 A;  4W9K A;  1XD3 B;  3DQV A;  4GSW A;  2REX A;  3L16 A;  2LXA A;  4LJP B;  3VUY A;  2FCN A;  4BKS A;  2LWP A;  4ANW A;  3H7S A;  2IBI B;  4M8M A;  4W9G A;  3VUW A;  2RD0 A;  1A5R A;  2V3S A;  2DYB A;  3KUC B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...