4A6QA

Crystal structure of mouse sap18 residues 6-143
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
143
structure length
143
Chain Sequence
GPDSMRVTQEEIKKEPEKPIDREKTCPLLLRVFTTNNGRHHRMDEFSRGNVPSSELQIYTWMDATLKELTSLVKEVYPEARKKGTHFNFAIVFMDLKRPGYRVKEIGSTMSGRKGTDDSMTLQSQKFQIGDYLDIAITPPNRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HISTONE DEACETYLASE COMPLEX SUBUNIT SAP18
publication title The Structure of the Asap Core Complex Reveals the Existence of a Pinin-Containing Psap Complex
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription
total genus 29
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2011-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06487 SAP18 Sin3 associated polypeptide p18 (SAP18)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.550 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4a6qA00
4A90A 4A6QA 4A8XC 2HDEA
chains in the Genus database with same CATH superfamily
1K52A 1C3TA 1V86A 3PSEB 3HM6X 3N1YC 1FM0D 2IJ0A 3R66C 1YNTE 2VRRB 3GZNB 2KWDA 3DBHI 2I38A 2N7DA 2PEAA 3Q8AA 2JF5A 2WX0A 3GP7A 5HI1A 2IGGA 4KX6B 1EU3A 1FRRA 1F2RC 2EELA 2KOXA 5E6JA 1Q0WB 3DQVA 2LI5A 2FCQA 2O6VB 1NI3A 4LJPB 1AN8A 3DBLI 5DCNA 1F1HA 3OAWA 2AYOB 3QWZB 1JALA 1BUIC 1GB1A 2PMVA 1WXVA 3SFDB 2L7RA 4RGOS 4A3PA 2LVPA 2EKEC 5D3DA 4D2KA 2DZKA 2KK8A 4GLSC 2KVRA 4MSQB 4US8A 4ARCA 2C7HA 3R7QA 2N9PC 3ZVVA 1GC6A 3AEFB 4DBGA 1L0YB 4MJSB 3AMZA 3H8HA 1DOXA 3OG5A 2NTTA 2MLBA 2KFKA 4WQOB 2KTFA 2YLMA 1D5MC 2AEHA 2KMMA 3RCZA 3V05A 5J17A 4DDGD 1PQSA 4HEA1 1V5TA 1TKEA 4MDKE 2D2QA 1I7HA 3URYA 1WGRA 3AE9B 2FIDA 2LVOA 2UWQA 2L0TA 4RH6A 1YIWA 1WE6A 1GPXA 1HZ6A 1OQRA 2N4FA 4BOZB 1TYGB 2MEKA 5D7GA 4LDTD 5LNK1 3FAHA 4G50A 4F7ZA 2QIEB 2WXGA 3ZUNA 1WXAA 4OZBA 3GE8C 3JSVB 2PIAA 5KHQA 2M4NA 1EWCA 3WAMA 4M0WB 4FJYA 2DENB 2WDTB 2KQ4X 1JWUD 1RAXA 4LNNA 2JPHA 4JWUC 3QHTA 1D5XC 2LGSA 4HXDA 2DX5B 1LFDA 3ZNHB 5C2TB 1KLUD 4ANXA 3ALBA 3OJ3A 3PHXB 4N59A 3PLVA 3UI3A 5IP4D 2FBWB 1UGMA 2KC2A 3TL5A 1WR6E 3PRPB 4RNAA 2YEPB 3W5VB 3P4QB 1R4NB 1ZXHA 2IO3B 1T3QA 2KDMA 5EE1A 4JQWC 3BVGA 1E8YA 1L5PA 1UELA 1YQBA 3KYCD 3RNBC 3N20C 3PRMB 3RI7C 5L83A 1Y8RC 2BB5A 1ACCA 3GE3C 2LXCA 5CHFA 4HDQA 4GU2A 1MG8A 4FJVB 2VZKB 4MT5A 3UIOB 2WXHA 2W55A 3NS1A 4BBNF 1LQBA 1MJDA 4DHZE 2ZZPB 5JXVA 2K8BA 2L1AA 2L83A 4BBNC 2NPTA 4HWIB 3W1SC 3WCQA 5HKHA 2RMMA 4PS7A 2IO0B 4OZAA 4WJOA 4EE2A 4GSWA 4JGHB 1MI0A 1HTQA 5D94A 1V2YA 1JRUA 1FD6A 4IWPA 4WAAA 3PGEA 1WRDB 1C79A 2FCMA 1F9JA 3KWLA 4KIKB 1AYFA 3AXCA 2XEWA 2ZPYA 4C4VA 4G0NB 1X1MA 2BYEA 1A5RA 1EF5A 1N62A 2MCNB 3AEBB 2JRIB 5I4DA 2AQ1B 4KGTA 3U52E 2KO3A 4M01A 2PVOD 1C9FA 1AWDA 2C7NB 4ZRQA 1WE7A 5AEKB 2PKOA 1E8ZA 2A5UA 1QILA 4BFRA 5C3JB 4DDID 5DPWA 3VTVA 5CHVC 4FLHA 4ZDVA 3CIRB 3CWIA 4O1NA 2D11A 3VAWA 3WIMA 1DYQA 1VZ8A 3P63A 2I1JA 4PYZA 5FK9C 3BWUD 4B95A 1FCCC 1WH3A 2JT4B 1WGYA 5L95C 3A1QB 3VVWB 2J7QB 3W9CB 3I5JC 1C4PA 2AX5A 3JYUA 3AE6B 1VCBA 2GOWA 1QOGA 2Z0DB 5H8YE 4HDOA 3DHGC 3BYYB 2MA9B 1TTNA 3AEGB 1ZP0B 1TY0A 1L2NA 3B2GA 2DNFA 1D4BA 1FNUA 1UWMA 2WXMA 2B3AA 3LB8C 3ZNID 3IBEA 3PVLA 3IFWB 3WANA 2GBNA 2KLCA 2VH1A 1I42A 1I4XA 1FPYA 2Y5CA 2KAJA 3NZ3A 3QCAA 1WIAA 1ZKHA 3VH3B 4RF1A 2LGIA 2WU5B 2CHXA 3P4RB 2RPVA 3DVGY 3KH0A 1L0VB 2RDHA 1JW9D 1WJUA 2JQRB 3M95A 4NJ6A 2ZVNA 1SB3C 4GB9A 3NZUA 4NZLB 4WIPA 2J0KA 1JQ4A 4YSZB 2LRUA 2JY6A 2ZNVC 4DWFA 3DWGC 3WA0A 1VZ7A 3RULA 1JWAD 1YMHE 4W9GA 2L52A 5E6PA 5C1ZA 2WWZA 5DPRA 2MH7A 2FCSA 1SJHD 3FILA 2MJEA 3ZQ4A 3MC8A 1EWYC 2D3BA 4ACFA 2MHJA 3MTNB 4YTNB 2C60A 1BMLC 4IW0A 1OQYA 2JYTA 3DPDA 2PE9A 4BKTA 4DXFA 1EU4A 2NR2A 4IDIA 4KGRA 1EM7A 3AE7B 4HK2A 3VRBB 1E10A 3Q8BA 4ZOHC 3GB1A 3U8ZA 3HRDD 2Z0EB 3TBLD 3L54A 2PLPA 1WMHA 2BWFA 3RN9C 3VFKA 3VTUA 2DYOA 3PRZA 2GBJA 3DVGX 2V0GA 3MHZA 1YJJA 1V6EA 1UZXB 1WJ6A 4HPLB 2DYMA 2KWVB 1LO5D 2KDIA 3A9JA 1JCKB 3AU5A 4WWPA 3V60A 2PJHA 3AN1A 3NVYA 2KKCA 2KQ7A 5JZEB 3KQ4A 2QJLA 3QK0A 4M00A 4MSMB 1FXTB 4YT0B 2RD0A 1XXGA 3PHWB 4AOFA 1QOFA 2IYDB 5KHOA 1RFKA 3EFCA 4XWTA 2DAJA 3ZJVA 4QAYA 4PK1A 1NYQA 2J42A 2N0SB 3HHMA 4MH8A 1C4AA 1K51A 1ZOYB 1TS3A 3AECB 3GZNI 1MPEA 3RUIB 2K8CA 3ZLZA 2JXTA 1SSNA 4HJKA 4NAWB 2L3ZA 3AI5A 4N9F4 3TCAA 3D32A 2Y3AA 3PZ8A 1QF6A 2V4LA 2KMAA 4WJNA 2M17A 4ASWC 3KUZA 1V49A 2D3GA 3QIJA 1GC7A 3Q3OC 2BQQA 4K3BA 4RGNA 3AE5B 2PPHA 1KRHA 1QOAA 1R4MB 2ONQA 1J19A 5MPOA 4TSSA 2X8XX 4RGMA 2B76B 4M8NA 1TY2A 3EFUA 3FKYA 3Q6BA 4KKIA 4ICVA 4C00A 1STEA 3R2IA 2R2QA 3J9CA 1WGDA 3RZFA 2JZPA 2OJRA 2WNMA 4EZLA 5FR3A 2ZPNA 3PPAA 4NJCA 1I35A 1SIJA 1XCTL 1HZ5A 2KD0A 3QX1A 4HRSA 5AZGA 4JX1C 3TMPB 1VDVA 2KJ6A 2IO1B 1FXIA 5BMHA 3A9KA 4BKGA 2LJ5A 1ISNA 3NG0A 3AEAB 1WXMA 2LMCA 2KDEB 1N5WA 3SEBA 2Z8LA 1I4PA 4J6IA 1WF9A 2H89B 1GOZA 3DOWA 3B9JA 4CQNA 4X57B 1Q10A 1RRBA 1GNUA 4TMAB 1WZ3A 3M3JA 4B6WA 1SE4A 4KZCA 2KN5A 1U4AA 1QT9A 3B1LX 4OZCA 2KWUB 4WWOA 4RFBA 3QC8B 3KWVA 3IAM1 2FAZA 1V9JA 1CK1A 1SXTA 2D3CA 1YX6B 3SHQA 1E0ZA 1V1PA 1KM7A 3VH4B 1TBEA 1MHXA 4WWNA 1R4NI 2JU6X 3ZIMA 2DZJA 3UGBB 3ENEA 5BYRA 1SJED 4GOCA 5JHAA 5LXHA 1EUVB 2TSSA 3MC9A 2KDBA 4B0EA 2K1FA 3ZGZA 1WR1A 3IAS1 1TGZB 3Q3JA 2IGHA 2DHZA 2V1YA 2NBVB 1TT5B 3AH7A 3L08A 4US9A 5CTRC 2W82A 3PO0A 2N7EA 1GAQB 2LJIA 3M62B 4P6VF 3NHEB 2ZEQA 1WGKA 3UINB 2LHDA 3RFZB 2O2VB 4MM3A 2V3PA 1QLBB 3ML9A 3SFEB 3UQAA 3PREA 1WYWB 2NS5A 2K25A 3UQBA 5HFYA 4IG7B 1G6JA 5HG2A 3O13A 3IG3A 2Y5PA 2EKIA 4RM8A 2L00B 3QQ8B 5J2RA 1ZE3D 1ROEA 4WJPA 1YQ4B 4LLGM 1C77A 4L2YA 1YX5B 2KJHB 4B0MA 5EDSA 4YWGG 2QC8A 2N9EB 4EZJA 4WAFA 4DQOC 5AUKA 1P3QU 4MGYE 1XLPA 4NY0A 5LLIA 4XDCA 4L23A 2OOBB 1A70A 3RPFC 2O6VA 2MJ3A 2CJOA 1HTOA 4DHJD 1HXYD 3H7PB 2GBRA 2J0JA 2QSDA 2WDQB 4K7SA 4DHZB 2BTEA 2N7JA 4S17A 2LASA 4L1BA 2AL3A 1D3ZA 1IPGA 3Q8CA 4MJSA 1XD3B 2D5GA 1D5ZC 4DXAB 4WURA 2KNBA 3ZNZB 3NS8A 1NI2A 1XLNA 5D3IB 1VJKA 1QQRA 2IY1B 3ZJUA 5CHWA 1J8CA 1RM6C 2XBBC 1WXQA 3AE1B 1B1ZA 1ET6A 4BAXA 3BY4B 2BKFA 4G11A 4W9KA 2JUOA 3NZSA 3RNFC 2LWPA 2LFIA 4M02A 3KW5B 2WXIA 1E7UA 2O2VA 3NVZA 3N3KB 2BYFA 4YXDB 2J4XA 3SD5A 1YJ1A 4JIOU 1UBIA 1GB4A 2W3RA 3NY5A 3TUOA 2K39A 2KFJA 2QHOA 5D2MB 4KGSA 3PV1A 4BOSC 3JSVA 3HUIA 2K5PA 2DZIA 4P1BC 1IBXB 2AQ3B 3PTFC 2OHFA 2D10A 5C23A 3RYTA 1KFYB 4M0WA 5IN7A 1FXAA 2IDYA 2JZZA 3WAOA 3Q8FA 2GMIC 1P1AA 4CO7A 3OJ4B 4DK5A 1SBBB 3PZDA 1FFVA 4WWMA 4II3B 2MBBB 4AQ7A 4I6PA 2BB6A 3NUHB 3QARA 2BWES 3ECIA 1FMAD 2WP9B 2MX2A 3E56A 2QDFA 1PGAA 3Q8EA 4HVBA 1NDDA 3O65B 3N1ZC 3TSSA 2NBUA 2GBMA 2K9XA 3PLUA 2N9KA 4IM3A 1RWSA 3LDZE 2DYBA 1JWMD 3MFGA 2V9HA 2WS3B 1XF5L 3GS2A 2WX1A 3K9OB 3RNAC 4FADA 2ZCCA 3APFA 4ANVA 2QILA 1DGJA 4GDKB 2FE8A 3MC0B 1N63A 3X23A 2LRWA 5BYSA 1KJTA 3OLMD 2KMCA 3ZXRA 1NYRA 3ZTCA 1JMLA 3CF6E 1NBFC 3I63C 3BYTB 5G5GA 4E71A 2O6VD 1MVKA 2RDGA 2CJNA 4KIKA 1PFDA 2XN9C 2K3UA 2ICIA 2LZ6A 1UD7A 4OHJA 4A9AA 4NQLB 3RZWC 1PUTA 2WDRB 2ZVOA 2HJ1A 1J7BA 2ZCBA 1FCLA 1T0QC 1T0RC 2LVQA 4MGZE 4JL9A 3TJPA 4ZRKA 2INNE 2KYWA 2BS4B 2G9HD 1I4GA 1EO6A 1P7EA 2ASQA 1K8RB 2BF8B 2R2OA 3L13A 4LNKA 2SEBD 4WJQA 2MBOA 4XX5A 2W3SA 3ZJTA 4FXCA 4K1RB 3ZTDA 4JLCA 2M0XA 5TSSA 2CU1A 3WALA 5HHDG 2M19A 4MEMA 4ZRJA 3U7DA 4XWWA 2DZMA 2M1MA 3H9DA 2PVGC 4FN2A 2QEJC 4A8XC 2BGFA 1Q5WB 3A1QA 1Y56A 4RF0A 1NVID 1R4MI 1UWXA 1WX7A 3VR8B 1KTKA 2UU7A 4E3CA 4KDIC 1XCQL 3AE2B 2KTRB 3W1SA 1IUEA 1UNSA 2KHWB 2LGXA 3ONSA 3MP9A 2K22A 3HK0A 3T3OA 2HTME 4HPMB 1YN5A 1OEYJ 3X0WA 1XT9B 1T5XD 3DDCB 1PGBA 3FC4A 2WDVB 1T6BX 3V6CB 2JXXA 4C7ZA 4RGTA 2IY0B 2D07B 2DWQA 2KVZA 1UUPA 5BO4B 1L4DB 3ZDMC 1E7VA 4HCNB 3A33B 1N5XA 1FRDA 3KVFB 3JVZX 4ZRPA 1LGRA 3HIZA 3OWEB 1FNVA 1VRAB 1GG3A 2CU3A 4MGKE 1Z2MA 1V1OA 4JWSC 1ZXIA 2GB1A 1C1YB 4KDLB 3AE3B 2IZVB 2ZNVB 3VRAB 4HLEA 1K53A 2DBYA 2ACZB 1OTRB 2WXFA 3M63B 2VZKD 3C19A 3ZDTA 2IPKD 2WHIA 1L0XB 1TIFA 4C80A 3Q14C 4ANWA 1MFWA 2L8JA 4XGAB 2ZW1A 4M8MA 3WAPA 1E8XA 4MH0E 1Q1OA 1YN4A 4LTUA 1Z5SB 3UF8A 2AQ2B 1WGHA 4IC7B 3RNCC 4NAMA 2PW9A 3N9YC 3MJ5A 1KF6B 2WXLA 2N1WA 4HCPB 4AJYB 3SR6A 3EECA 2LUMA 4LNOA 4W9FA 1WX9A 2J52A 2G45B 2QMTA 5E6NA 4W9CA 3NVWA 4R3DA 2LGYA 2JRHA 2BS3B 4EEWA 1KLVA 1WM3A 5FR6A 4IOIE 3Q3MC 1CMXB 2WU2B 1YN3A 1FFUA 2ZW0A 1IGCA 2X38A 2ZJDA 2Q5WD 2BVCA 2WXOA 2G3QB 2N1VA 1T0SC 1V97A 2WLBA 2BT6A 2PTLA 4K81A 4GN1A 2GBKA 3IXSA 3MHSD 4CYEA 4URKA 3K9PB 3BK1A 3AM9A 5GMVA 1FIQA 2MBHA 4IM0A 2UYZB 4B9KA 4A90A 4LNIA 3I3TB 1F2RI 4KSKC 3VXWA 2V4IB 4KV2A 3IT6B 2INDC 4NAWA 4BVUC 1WXSA 2MQJA 2J53A 4NPNA 2WXKA 1QKZA 1TS4A 3HVDA 2E3TA 4YL8A 4TUUA 2H88B 5IOIA 2W54A 2JX5A 3A4RA 2GRIA 1BXTA 5G2NA 3PZ7A 1J7AA 3Q3FA 4GGQA 4HROA 2KDFB 1YJIA 2WXQA 2V3SA 4GMVA 2YEPF 4KKJA 1RFAA 3EHVA 1HEZE 3R8BA 1PYWD 2NCNA 4EOYA 3KLSX 2C7MB 4TQ0A 1YD8U 5T8IA 4FA6A 3P42A 3TEYA 4PS8A 2G4DB 3NVVA 2Y5BB 1NEKB 1C76A 3EGRA 3C0RB 1IP9A 1IYFA 2M0AA 4HJGE 3IHPC 3T3NA 1TKGA 1EF1A 3VQIA 1E8WA 2G4SA 4ICUA 1OFFA 1FEHA 3ZRCA 4KZ0A 1XQQA 1H8CA 2W9NA 3ZRFA 1AARA 3RMKC 2NPTB 2KX3A 3ZNGC 1TS5A 3DBRB 1L4ZB 3U2SC 4ANUA 4K7WA 3BVMA 4IM2A 1ZDVA 4MACA 2RGFA 2NBWB 3BINA 1C78A 4P7IA 1P9DU 2MP2B 4XYCA 4ZHOA 1J7CA 3CSTA 2HDEA 2K6QA 3DWMA 4UDUC 1F77A 3DBHB 4OVVA 4N58A 3L10B 4C4VB 1GUAB 1YQ3B 3DHHC 1FNWA 3L4PA 4IUMB 2JYEA 1WY8A 2L05A 4ITKA 3SU8X 2VH2A 3ZO5B 4YTMB 2G1EA 3DBLB 5FKAC 4F1SA 4GDLB 4YSYB 3ZYYX 3C8YA 1MHHE 3AULA 1LXDA 2LHEA 1AW7A 4XZ4A 1OQQA 1I4RA 3A4SC 1TZOA 5EE9A 1ZPSA 3EUB2 4NQKE 1UH6A 1XO3A 2K8HA 3LJ3A 1M4VA 1C4CA 4NNJB 2RPQA 2C5LC 5CX3A 3P4SB 3VHTC 4A20A 2MW5A 1WZ0A 2KZRA 3AE8B 2K6DB 2NVUI 3GOEA 1WGGA 4FBJB 3IVFA 4J3OD 1TJEA 2BKRB 3V62A 2RR9A 3V6EB 4OW0A 1DOIA 3B0AA 1K50A 3T9LA 1E5WA 2LGDA 3Q2AC 1NENB 5IAAC 2WGSA 2V3NA 5DPSA 1IGDA 2INPE 3IT4B 4ZHPA 4RM9A 3ZXVA 4LJOB 1V81A 1WJNA 4RMAA 5EE0A 2GI9A 1MG4A 1V8CA 3ZKJC 2MP2A 3TEWA 3VUYA 4CHKA 5EE3A 1V5OA 4BKSA 4USAA 1E7PB 4W9JA 5BMGA 2MRPA 1E90A 1XLOA 2FUG1 1BT0A 2KLGA 2IBIB 1PGXA 2GLSA 3R7RA 3AEDB 1H4RA 5GXGB 4MELA 4P1CC 5G55A 1I4HA 1S1QB 3KUDB 2K0PA 3QA8A 2AWTA 2KANA 1P7FA 4EKUA 2HD5B 3AE4B 1RYJA 4RCOA 3H7SA 3N1XC 3H7PA 3JW0X 4GDLA 1L6VA 2L76A 1JWSD 1J0GA 1ZW7A 3HVZA 2RDBC 3TIXA 4LK0M 3U7ZA 5D6JB 4ARIA 3I9V1 5IKCM 1WYGA 2AL6A 2KT7A 5G5HA 3VR9B 1SIFA 4KVGB 4N6EB 1KLGD 3R2TA 1I4QA 4JE3B 3HM3A 3FILB 3L17A 1LM8B 4Q2JA 4TV3A 3U4EG 2LEKA 5IO9A 3AV8A 1SF0A 2JWUA 4IKGA 2CHZA 5J18A 4A3OA 1WRIA 1SEBD 3PS6A 3EC8A 3PT2B 3AU4A 3RNGC 2PE6B 1HA5A 3TEZA 4FJZA 1OGWA 3V3XA 3VDZA 1E9MA 5AZHA 1WFYA 1WMHB 4EUTA 1P0RA 3V61A 3B2FA 3ML8A 1UBQA 3N32A 4I6NB 3RNEC 2I1KA 1JRPA 3H1UA 4FHKA 3NOBA 3T8MA 3A9JB 4A55A 4AUQC 3BZDB 2BW2A 3KYDD 3VTWA 1WSPA 1T0YA 1WI0A 1E6EB 4EFOA 3BVZA 1IBXA 3QJZA 5AUIA 4S0RA 2JVCA 3W2DA 3DHIC 4W9LA 2MSED 5JH5C 1KOTA 4IWOA 4AS1A 1L6UA 2QCZA 4YSXB 5LXIB 2BS2B 2M56B 4H2AA 1TS2A 2JZ3B 4W9IA 3VUXA 3MJWA 4E74A 2LXAA 2I2YA 2EMSA 1YOVB 1SE2A 3APDA 2KX0A 2KXJA 2C9WB 4K7UA 4LDTB 1ZDXA 4TQ1A 3KUCB 1UGJA 3DBSA 2DLBA 1DOYA 1JROA 1QOBA 4HKQA 2XNAC 2LD9A 1SE3A 2WQYB 4EZKA 4P16A 4C7YA 1F52A 2CKHB 2DAFA 2WXJA 4HPPA 2BYVE 2KACA 4IWQA 4G3XB 2KJRA 2MJDA 4KSLC 2FUHB 2MBEA 4MGIE 4GDKA 3L16A 1XEEA 2EMTA 2N9LA 2KN4A 2SAKA 5AZFA 3VUWA 1N6ZA 3DVNU 3NRZA 1RLFA 4HKZE 3R3MA 4ZYSA 3P2BA 4WH4A 4BKSD 5JHBA 1ZUD2 4K3CA 1VLBA 4OVUA 1ENFA 3NJTA 2XK5B 3ABVB 4DHJB 4I6LB 1TKYA 1V80A 1CZPA 1WWTA 3BIID 4GIVA 1WM2A 2BBCA 2CHWA 1F0ZA 4NJ7A 1ZGUB 2R61A 4PS3A 3L0WB 4AWJA 3RT3B 2IO2B 2KQSA 4GXBA 3A9KB 1UF0A 2FIFA 1D6EC 1R7SA 2HE7A 2JSVX 2YVCA 4W9EA 4XDDA 1L7YA 2HTHA 2J0MA 5IA7A 2NTSA 1VR9A 5BMIA 3LXFA 1CQVA 3I57A 4WQMA 2BPSA 3BK2A 2REXA 3Q3NC 4AP4C 3LYYA 3ZW3A 3U30A 3RD2A 2BYTA 3DCGA 3CMMB 1M94A 1N60A 1XLQA 2D3AA 3DVNV 2L0FA 4LNFA 1JWBD 4REZA 2HJ8A 1N61A 2IGDA 2MBQA 1S3SG 2M8SA 4PT5A 4FHJA 4C56C 3SDLC 3CSFA 3AEEB 2JWZA 2KWCA 1VZ6A 2OEDA 1HQRD 2FNJB 4PYUA 2E6XA 3W1YA 2WXNA 1GJZA 2FCNA 3P4PB 1PDXA 4AJWA 4DXGA 4II2B 1WX8A 3UIPB 2MWSB 1V1PB 4OVZA 4ZYNA 3N30A 2L32A 4F8CB 4TKNA 2NMQA 5DPTA 2LUEA 4W9HA 2KC1A 1ET9A 3TEXA 1ESFA 3APCA 2INCC 4ZRIA 1SE9A 3W5UB 2WXPA 1WJ4A 2KTRA 2A4ZA 1CJEA 4BZAA 1TZ1A 1KH0A 2KFKB 1B9RA 3P1MA 4XC2A 1SGHA 4A6QA 2WXRA 2OJWA 4YTPB 5H92C 3AB5A 4FULA 2XK5A 2RSUA 2Z59B 2WYQA 3QAQA 4LCDE 4MM3B 4W9DA 5BYQA 3E9SA 3H6NA 3ETRA 3DBRI 1HE8A 3EA6A 1QZEA 5E6OA 2CS4A 2N9XA 4JPSA 3Q69A 1FO4A 1VD2A 1OEYA 3B08A 4XE0A 3S2AA 2ON8A 5TR5A 2CR5A 1P98A
chains in the Genus database with same CATH topology
1K52A 5FKAC 1YJJA 4GDLB 2WS3B 4YSYB 3ZYYX 1XF5L 3C8YA 3GS2A 1MHHE 2DYMA 2LHEA 1AW7A 1OQQA 1LO5D 1FM0D 2IJ0A 1I4RA 1TZOA 5EE9A 1YNTE 1JCKB 2QILA 1ZPSA 1DGJA 3EUB2 2KWDA 4GDKB 1XO3A 3AN1A 3NVYA 2FE8A 2I38A 3MC0B 3Q8AA 3GP7A 1N63A 5HI1A 2IGGA 4KX6B 1M4VA 1C4CA 3KQ4A 5BYSA 1EU3A 1FRRA 1F2RC 2QJLA 2EELA 3P4SB 4YT0B 5E6JA 1XXGA 1NYRA 1QOFA 1NI3A 1RFKA 1AN8A 1JMLA 4XWTA 3BYTB 5G5GA 3ZJVA 1JALA 3AE8B 1BUIC 1NYQA 2J42A 2N0SB 2PMVA 4MH8A 1GB1A 1C4AA 1K51A 1MVKA 1ZOYB 4J3OD 1TJEA 2RDGA 3SFDB 2CJNA 1PFDA 1TS3A 2XN9C 2K3UA 3AECB 4RGOS 4OW0A 2ICIA 1DOIA 4OHJA 1K50A 1MPEA 5D3DA 4D2KA 4A9AA 2JXTA 1NENB 4GLSC 1SSNA 4US8A 4NAWB 4ARCA 1PUTA 2V3NA 2WDRB 1IGDA 2INPE 3AEFB 3IT4B 1J7BA 1L0YB 1FCLA 3AMZA 3H8HA 1DOXA 2Y3AA 4ZHPA 3PZ8A 1QF6A 2NTTA 2INNE 5EE0A 2BS4B 2GI9A 2G9HD 1I4GA 1P7EA 1V8CA 4RGNA 3AE5B 3TEWA 1KRHA 1D5MC 1QOAA 2KMMA 3V05A 2SEBD 5EE3A 2ONQA 5MPOA 2W3SA 4TSSA 3ZJTA 4FXCA 4RGMA 2B76B 1TY2A 4HEA1 4USAA 5TSSA 1TKEA 1E7PB 5BMGA 4KKIA 1I7HA 5HHDG 1XLOA 3URYA 2M19A 2FUG1 1STEA 3AE9B 1PGXA 4RH6A 3R2IA 3AEDB 3J9CA 5GXGB 1GPXA 1HZ6A 1OQRA 2JZPA 1TYGB 1I4HA 2WNMA 2MEKA 5FR3A 4XWWA 5D7GA 2K0PA 4NJCA 5LNK1 3FAHA 2PVGC 1P7FA 2QEJC 3AE4B 1RYJA 1SIJA 1XCTL 2QIEB 2WXGA 4RCOA 4A8XC 1HZ5A 1Y56A 4RF0A 1NVID 1L6VA 4HRSA 4OZBA 1JWSD 1UWXA 3VR8B 4JX1C 1KTKA 2PIAA 3HVZA 1VDVA 4LK0M 3U7ZA 1XCQL 1EWCA 1FXIA 3AE2B 3W1SA 5BMHA 1IUEA 1UNSA 4ARIA 3MP9A 3I9V1 2K22A 1WYGA 3T3OA 5G5HA 2HTME 2KQ4X 3VR9B 1JWUD 4N6EB 1KLGD 3AEAB 3R2TA 1I4QA 1YN5A 4JE3B 3FILB 2LMCA 4JWUC 1D5XC 1T5XD 1N5WA 3SEBA 2Z8LA 1PGBA 5C2TB 4Q2JA 1KLUD 3FC4A 1I4PA 3U4EG 2LEKA 3AV8A 1SF0A 2JWUA 2WDVB 4IKGA 4N59A 1T6BX 3UI3A 2FBWB 1WRIA 1SEBD 2H89B 4RNAA 4C7ZA 1GOZA 4RGTA 3B9JA 2YEPB 3W5VB 3P4QB 4CQNA 1HA5A 1Q10A 1ZXHA 3TEZA 4TMAB 2DWQA 1T3QA 2KDMA 5EE1A 3BVGA 3V3XA 1E9MA 1UUPA 1SE4A 1L4DB 1L5PA 1QT9A 4OZCA 1N5XA 1FRDA 4ZRPA 4RFBA 3OWEB 1FNVA 1VRAB 3KWVA 2CU3A 3B2FA 3IAM1 1V1OA 1CK1A 1ZXIA 4JWSC 2GB1A 2BB5A 1ACCA 1SXTA 1JRPA 3AE3B 1E0ZA 2VZKB 1V1PA 4MT5A 3VRAB 4A55A 2WXHA 2W55A 1K53A 3BZDB 2DBYA 2ACZB 2BW2A 3NS1A 2WXFA 1MHXA 1WSPA 2JU6X 2VZKD 5BYRA 1SJED 1E6EB 2IPKD 5JXVA 3BVZA 2L1AA 2L83A 3WCQA 1IBXA 2RMMA 2TSSA 5AUIA 1L0XB 4OZAA 4B0EA 4EE2A 3W2DA 4C80A 3ZGZA 1MI0A 4AS1A 3IAS1 1L6UA 4YSXB 2IGHA 2BS2B 3AH7A 4US9A 2M56B 4H2AA 2W82A 2ZW1A 1TS2A 3PO0A 1FD6A 2I2YA 1GAQB 1YN4A 1C79A 4LTUA 1SE2A 2LJIA 3KWLA 1AYFA 4P6VF 1WGKA 2AQ2B 2LHDA 3RFZB 2V3PA 1QLBB 2PW9A 4NAMA 1ZDXA 4TQ1A 3SFEB 1N62A 3N9YC 3MJ5A 3AEBB 1UGJA 2DLBA 1DOYA 1JROA 1QOBA 1KF6B 2WXLA 5I4DA 2AQ1B 4KGTA 5HFYA 3U52E 4HKQA 2PVOD 2XNAC 3SR6A 2LUMA 1C9FA 1AWDA 1SE3A 2WQYB 5HG2A 4P16A 4C7YA 4ZRQA 2J52A 3O13A 2WXJA 2QMTA 2Y5PA 2EKIA 2PKOA 1QILA 2KACA 3NVWA 4R3DA 2MJDA 1ZE3D 1ROEA 2BS3B 5C3JB 1YQ4B 4IOIE 4LLGM 3CIRB 1XEEA 3CWIA 1C77A 4O1NA 2N9LA 2WU2B 2KN4A 2SAKA 4L2YA 1YN3A 4B0MA 1FFUA 2ZW0A 1IGCA 4YWGG 2X38A 2Q5WD 1DYQA 4WAFA 1VZ8A 3NRZA 4DQOC 4HKZE 3P63A 4ZYSA 4WH4A 5AUKA 2WXOA 1XLPA 1ZUD2 1VLBA 5FK9C 3BWUD 1ENFA 1V97A 4XDCA 2WLBA 4L23A 2BT6A 3ABVB 2PTLA 1A70A 1TKYA 3IXSA 3RPFC 1CZPA 1FCCC 2MJ3A 1WWTA 2CJOA 3BIID 3BK1A 1HXYD 3AM9A 2BBCA 1F0ZA 1FIQA 2QSDA 2R61A 2WDQB 2BTEA 3W9CB 2N7JA 4A90A 1F2RI 1C4PA 2V4IB 2AX5A 3AE6B 3IT6B 1QOGA 5H8YE 4L1BA 3BYYB 1D6EC 2J53A 1R7SA 3AEGB 1ZP0B 2JSVX 3Q8CA 2WXKA 4XDDA 1QKZA 1TY0A 1TS4A 2D5GA 1D5ZC 2NTSA 1VR9A 3B2GA 5BMIA 3LXFA 4WURA 3HVDA 1CQVA 2E3TA 1D4BA 1FNUA 3I57A 4WQMA 3BK2A 1UWMA 2H88B 2W54A 2WXMA 3LB8C 3LYYA 1XLNA 2JX5A 1VJKA 1QQRA 5D3IB 3ZJUA 2BYTA 2GRIA 1BXTA 1I4XA 1J7AA 1RM6C 1N60A 1XLQA 2Y5CA 3PZ7A 2KAJA 1WXQA 3AE1B 1B1ZA 1ET6A 3NZ3A 4HROA 4REZA 1JWBD 1N61A 2IGDA 1YJIA 2WXQA 4PT5A 4C56C 2YEPF 4RF1A 2LGIA 2WU5B 2LFIA 4KKJA 1HEZE 3AEEB 3R8BA 2WXIA 1PYWD 3P4RB 1VZ6A 2OEDA 2RPVA 3NVZA 1HQRD 4YXDB 2J4XA 3KLSX 1L0VB 2RDHA 4TQ0A 5T8IA 1JW9D 2E6XA 2JQRB 2WXNA 3P42A 3TEYA 1GB4A 3P4PB 3NVVA 1PDXA 2W3RA 4DXGA 1NEKB 1C76A 3EGRA 3TUOA 1SB3C 1V1PB 4OVZA 2M0AA 4HJGE 2L32A 2NMQA 1TKGA 3T3NA 3VQIA 1OFFA 4KGSA 4NZLB 1ET9A 1FEHA 4WIPA 1ESFA 3TEXA 1JQ4A 3HUIA 4YSZB 2K5PA 3W5UB 2WXPA 1IBXB 2AQ3B 2OHFA 3DWGC 1CJEA 1VZ7A 1TS5A 1L4ZB 1KFYB 4M0WA 1JWAD 3U2SC 1YMHE 1FXAA 2IDYA 3BVMA 2L52A 1ZDVA 4MACA 1KH0A 1B9RA 3Q8FA 2MH7A 1C78A 3P1MA 4A6QA 1SJHD 3FILA 2WXRA 2MJEA 3ZQ4A 4YTPB 1EWYC 4ZHOA 5H92C 1J7CA 4YTNB 1SBBB 3AB5A 2HDEA 1FFVA 4WWMA 1BMLC 3DWMA 4UDUC 2JYTA 1F77A 4DXFA 1EU4A 4AQ7A 2BB6A 3NUHB 4IDIA 4KGRA 1EM7A 1FMAD 2WP9B 4N58A 3AE7B 3E56A 3VRBB 1PGAA 4MM3B 3Q8EA 5BYQA 3Q8BA 1E10A 1YQ3B 3E9SA 4ZOHC 3GB1A 3TSSA 3HRDD 3ETRA 1FNWA 2JYEA 3L4PA 4ITKA 3EA6A 2K9XA 2PLPA 2N9KA 4JPSA 3Q69A 1FO4A 4YTMB 1RWSA 2DYOA 2G1EA 4XE0A 1JWMD 2V0GA 2ON8A 3MHZA 3MFGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A90 A;  4A6Q A;  4A8X C;  2HDE A; 
#chains in the Genus database with same CATH topology
 1K52 A;  1C3T A;  1V86 A;  3PSE B;  3HM6 X;  3N1Y C;  1FM0 D;  2IJ0 A;  3R66 C;  1YNT E;  2VRR B;  3GZN B;  2KWD A;  3DBH I;  2I38 A;  2N7D A;  2PEA A;  3Q8A A;  2JF5 A;  2WX0 A;  3GP7 A;  5HI1 A;  2IGG A;  4KX6 B;  1EU3 A;  1FRR A;  1F2R C;  2EEL A;  2KOX A;  5E6J A;  1Q0W B;  3DQV A;  2LI5 A;  2FCQ A;  2O6V B;  1NI3 A;  4LJP B;  1AN8 A;  3DBL I;  5DCN A;  1F1H A;  3OAW A;  2AYO B;  3QWZ B;  1JAL A;  1BUI C;  1GB1 A;  2PMV A;  1WXV A;  3SFD B;  2L7R A;  4RGO S;  4A3P A;  2LVP A;  2EKE C;  5D3D A;  4D2K A;  2DZK A;  2KK8 A;  4GLS C;  2KVR A;  4MSQ B;  4US8 A;  4ARC A;  2C7H A;  3R7Q A;  2N9P C;  3ZVV A;  1GC6 A;  3AEF B;  4DBG A;  1L0Y B;  4MJS B;  3AMZ A;  3H8H A;  1DOX A;  3OG5 A;  2NTT A;  2MLB A;  2KFK A;  4WQO B;  2KTF A;  2YLM A;  1D5M C;  2AEH A;  2KMM A;  3RCZ A;  3V05 A;  5J17 A;  4DDG D;  1PQS A;  4HEA 1;  1V5T A;  1TKE A;  4MDK E;  2D2Q A;  1I7H A;  3URY A;  1WGR A;  3AE9 B;  2FID A;  2LVO A;  2UWQ A;  2L0T A;  4RH6 A;  1YIW A;  1WE6 A;  1GPX A;  1HZ6 A;  1OQR A;  2N4F A;  4BOZ B;  1TYG B;  2MEK A;  5D7G A;  4LDT D;  5LNK 1;  3FAH A;  4G50 A;  4F7Z A;  2QIE B;  2WXG A;  3ZUN A;  1WXA A;  4OZB A;  3GE8 C;  3JSV B;  2PIA A;  5KHQ A;  2M4N A;  1EWC A;  3WAM A;  4M0W B;  4FJY A;  2DEN B;  2WDT B;  2KQ4 X;  1JWU D;  1RAX A;  4LNN A;  2JPH A;  4JWU C;  3QHT A;  1D5X C;  2LGS A;  4HXD A;  2DX5 B;  1LFD A;  3ZNH B;  5C2T B;  1KLU D;  4ANX A;  3ALB A;  3OJ3 A;  3PHX B;  4N59 A;  3PLV A;  3UI3 A;  5IP4 D;  2FBW B;  1UGM A;  2KC2 A;  3TL5 A;  1WR6 E;  3PRP B;  4RNA A;  2YEP B;  3W5V B;  3P4Q B;  1R4N B;  1ZXH A;  2IO3 B;  1T3Q A;  2KDM A;  5EE1 A;  4JQW C;  3BVG A;  1E8Y A;  1L5P A;  1UEL A;  1YQB A;  3KYC D;  3RNB C;  3N20 C;  3PRM B;  3RI7 C;  5L83 A;  1Y8R C;  2BB5 A;  1ACC A;  3GE3 C;  2LXC A;  5CHF A;  4HDQ A;  4GU2 A;  1MG8 A;  4FJV B;  2VZK B;  4MT5 A;  3UIO B;  2WXH A;  2W55 A;  3NS1 A;  4BBN F;  1LQB A;  1MJD A;  4DHZ E;  2ZZP B;  5JXV A;  2K8B A;  2L1A A;  2L83 A;  4BBN C;  2NPT A;  4HWI B;  3W1S C;  3WCQ A;  5HKH A;  2RMM A;  4PS7 A;  2IO0 B;  4OZA A;  4WJO A;  4EE2 A;  4GSW A;  4JGH B;  1MI0 A;  1HTQ A;  5D94 A;  1V2Y A;  1JRU A;  1FD6 A;  4IWP A;  4WAA A;  3PGE A;  1WRD B;  1C79 A;  2FCM A;  1F9J A;  3KWL A;  4KIK B;  1AYF A;  3AXC A;  2XEW A;  2ZPY A;  4C4V A;  4G0N B;  1X1M A;  2BYE A;  1A5R A;  1EF5 A;  1N62 A;  2MCN B;  3AEB B;  2JRI B;  5I4D A;  2AQ1 B;  4KGT A;  3U52 E;  2KO3 A;  4M01 A;  2PVO D;  1C9F A;  1AWD A;  2C7N B;  4ZRQ A;  1WE7 A;  5AEK B;  2PKO A;  1E8Z A;  2A5U A;  1QIL A;  4BFR A;  5C3J B;  4DDI D;  5DPW A;  3VTV A;  5CHV C;  4FLH A;  4ZDV A;  3CIR B;  3CWI A;  4O1N A;  2D11 A;  3VAW A;  3WIM A;  1DYQ A;  1VZ8 A;  3P63 A;  2I1J A;  4PYZ A;  5FK9 C;  3BWU D;  4B95 A;  1FCC C;  1WH3 A;  2JT4 B;  1WGY A;  5L95 C;  3A1Q B;  3VVW B;  2J7Q B;  3W9C B;  3I5J C;  1C4P A;  2AX5 A;  3JYU A;  3AE6 B;  1VCB A;  2GOW A;  1QOG A;  2Z0D B;  5H8Y E;  4HDO A;  3DHG C;  3BYY B;  2MA9 B;  1TTN A;  3AEG B;  1ZP0 B;  1TY0 A;  1L2N A;  3B2G A;  2DNF A;  1D4B A;  1FNU A;  1UWM A;  2WXM A;  2B3A A;  3LB8 C;  3ZNI D;  3IBE A;  3PVL A;  3IFW B;  3WAN A;  2GBN A;  2KLC A;  2VH1 A;  1I42 A;  1I4X A;  1FPY A;  2Y5C A;  2KAJ A;  3NZ3 A;  3QCA A;  1WIA A;  1ZKH A;  3VH3 B;  4RF1 A;  2LGI A;  2WU5 B;  2CHX A;  3P4R B;  2RPV A;  3DVG Y;  3KH0 A;  1L0V B;  2RDH A;  1JW9 D;  1WJU A;  2JQR B;  3M95 A;  4NJ6 A;  2ZVN A;  1SB3 C;  4GB9 A;  3NZU A;  4NZL B;  4WIP A;  2J0K A;  1JQ4 A;  4YSZ B;  2LRU A;  2JY6 A;  2ZNV C;  4DWF A;  3DWG C;  3WA0 A;  1VZ7 A;  3RUL A;  1JWA D;  1YMH E;  4W9G A;  2L52 A;  5E6P A;  5C1Z A;  2WWZ A;  5DPR A;  2MH7 A;  2FCS A;  1SJH D;  3FIL A;  2MJE A;  3ZQ4 A;  3MC8 A;  1EWY C;  2D3B A;  4ACF A;  2MHJ A;  3MTN B;  4YTN B;  2C60 A;  1BML C;  4IW0 A;  1OQY A;  2JYT A;  3DPD A;  2PE9 A;  4BKT A;  4DXF A;  1EU4 A;  2NR2 A;  4IDI A;  4KGR A;  1EM7 A;  3AE7 B;  4HK2 A;  3VRB B;  1E10 A;  3Q8B A;  4ZOH C;  3GB1 A;  3U8Z A;  3HRD D;  2Z0E B;  3TBL D;  3L54 A;  2PLP A;  1WMH A;  2BWF A;  3RN9 C;  3VFK A;  3VTU A;  2DYO A;  3PRZ A;  2GBJ A;  3DVG X;  2V0G A;  3MHZ A;  1YJJ A;  1V6E A;  1UZX B;  1WJ6 A;  4HPL B;  2DYM A;  2KWV B;  1LO5 D;  2KDI A;  3A9J A;  1JCK B;  3AU5 A;  4WWP A;  3V60 A;  2PJH A;  3AN1 A;  3NVY A;  2KKC A;  2KQ7 A;  5JZE B;  3KQ4 A;  2QJL A;  3QK0 A;  4M00 A;  4MSM B;  1FXT B;  4YT0 B;  2RD0 A;  1XXG A;  3PHW B;  4AOF A;  1QOF A;  2IYD B;  5KHO A;  1RFK A;  3EFC A;  4XWT A;  2DAJ A;  3ZJV A;  4QAY A;  4PK1 A;  1NYQ A;  2J42 A;  2N0S B;  3HHM A;  4MH8 A;  1C4A A;  1K51 A;  1ZOY B;  1TS3 A;  3AEC B;  3GZN I;  1MPE A;  3RUI B;  2K8C A;  3ZLZ A;  2JXT A;  1SSN A;  4HJK A;  4NAW B;  2L3Z A;  3AI5 A;  4N9F 4;  3TCA A;  3D32 A;  2Y3A A;  3PZ8 A;  1QF6 A;  2V4L A;  2KMA A;  4WJN A;  2M17 A;  4ASW C;  3KUZ A;  1V49 A;  2D3G A;  3QIJ A;  1GC7 A;  3Q3O C;  2BQQ A;  4K3B A;  4RGN A;  3AE5 B;  2PPH A;  1KRH A;  1QOA A;  1R4M B;  2ONQ A;  1J19 A;  5MPO A;  4TSS A;  2X8X X;  4RGM A;  2B76 B;  4M8N A;  1TY2 A;  3EFU A;  3FKY A;  3Q6B A;  4KKI A;  4ICV A;  4C00 A;  1STE A;  3R2I A;  2R2Q A;  3J9C A;  1WGD A;  3RZF A;  2JZP A;  2OJR A;  2WNM A;  4EZL A;  5FR3 A;  2ZPN A;  3PPA A;  4NJC A;  1I35 A;  1SIJ A;  1XCT L;  1HZ5 A;  2KD0 A;  3QX1 A;  4HRS A;  5AZG A;  4JX1 C;  3TMP B;  1VDV A;  2KJ6 A;  2IO1 B;  1FXI A;  5BMH A;  3A9K A;  4BKG A;  2LJ5 A;  1ISN A;  3NG0 A;  3AEA B;  1WXM A;  2LMC A;  2KDE B;  1N5W A;  3SEB A;  2Z8L A;  1I4P A;  4J6I A;  1WF9 A;  2H89 B;  1GOZ A;  3DOW A;  3B9J A;  4CQN A;  4X57 B;  1Q10 A;  1RRB A;  1GNU A;  4TMA B;  1WZ3 A;  3M3J A;  4B6W A;  1SE4 A;  4KZC A;  2KN5 A;  1U4A A;  1QT9 A;  3B1L X;  4OZC A;  2KWU B;  4WWO A;  4RFB A;  3QC8 B;  3KWV A;  3IAM 1;  2FAZ A;  1V9J A;  1CK1 A;  1SXT A;  2D3C A;  1YX6 B;  3SHQ A;  1E0Z A;  1V1P A;  1KM7 A;  3VH4 B;  1TBE A;  1MHX A;  4WWN A;  1R4N I;  2JU6 X;  3ZIM A;  2DZJ A;  3UGB B;  3ENE A;  5BYR A;  1SJE D;  4GOC A;  5JHA A;  5LXH A;  1EUV B;  2TSS A;  3MC9 A;  2KDB A;  4B0E A;  2K1F A;  3ZGZ A;  1WR1 A;  3IAS 1;  1TGZ B;  3Q3J A;  2IGH A;  2DHZ A;  2V1Y A;  2NBV B;  1TT5 B;  3AH7 A;  3L08 A;  4US9 A;  5CTR C;  2W82 A;  3PO0 A;  2N7E A;  1GAQ B;  2LJI A;  3M62 B;  4P6V F;  3NHE B;  2ZEQ A;  1WGK A;  3UIN B;  2LHD A;  3RFZ B;  2O2V B;  4MM3 A;  2V3P A;  1QLB B;  3ML9 A;  3SFE B;  3UQA A;  3PRE A;  1WYW B;  2NS5 A;  2K25 A;  3UQB A;  5HFY A;  4IG7 B;  1G6J A;  5HG2 A;  3O13 A;  3IG3 A;  2Y5P A;  2EKI A;  4RM8 A;  2L00 B;  3QQ8 B;  5J2R A;  1ZE3 D;  1ROE A;  4WJP A;  1YQ4 B;  4LLG M;  1C77 A;  4L2Y A;  1YX5 B;  2KJH B;  4B0M A;  5EDS A;  4YWG G;  2QC8 A;  2N9E B;  4EZJ A;  4WAF A;  4DQO C;  5AUK A;  1P3Q U;  4MGY E;  1XLP A;  4NY0 A;  5LLI A;  4XDC A;  4L23 A;  2OOB B;  1A70 A;  3RPF C;  2O6V A;  2MJ3 A;  2CJO A;  1HTO A;  4DHJ D;  1HXY D;  3H7P B;  2GBR A;  2J0J A;  2QSD A;  2WDQ B;  4K7S A;  4DHZ B;  2BTE A;  2N7J A;  4S17 A;  2LAS A;  4L1B A;  2AL3 A;  1D3Z A;  1IPG A;  3Q8C A;  4MJS A;  1XD3 B;  2D5G A;  1D5Z C;  4DXA B;  4WUR A;  2KNB A;  3ZNZ B;  3NS8 A;  1NI2 A;  1XLN A;  5D3I B;  1VJK A;  1QQR A;  2IY1 B;  3ZJU A;  5CHW A;  1J8C A;  1RM6 C;  2XBB C;  1WXQ A;  3AE1 B;  1B1Z A;  1ET6 A;  4BAX A;  3BY4 B;  2BKF A;  4G11 A;  4W9K A;  2JUO A;  3NZS A;  3RNF C;  2LWP A;  2LFI A;  4M02 A;  3KW5 B;  2WXI A;  1E7U A;  2O2V A;  3NVZ A;  3N3K B;  2BYF A;  4YXD B;  2J4X A;  3SD5 A;  1YJ1 A;  4JIO U;  1UBI A;  1GB4 A;  2W3R A;  3NY5 A;  3TUO A;  2K39 A;  2KFJ A;  2QHO A;  5D2M B;  4KGS A;  3PV1 A;  4BOS C;  3JSV A;  3HUI A;  2K5P A;  2DZI A;  4P1B C;  1IBX B;  2AQ3 B;  3PTF C;  2OHF A;  2D10 A;  5C23 A;  3RYT A;  1KFY B;  4M0W A;  5IN7 A;  1FXA A;  2IDY A;  2JZZ A;  3WAO A;  3Q8F A;  2GMI C;  1P1A A;  4CO7 A;  3OJ4 B;  4DK5 A;  1SBB B;  3PZD A;  1FFV A;  4WWM A;  4II3 B;  2MBB B;  4AQ7 A;  4I6P A;  2BB6 A;  3NUH B;  3QAR A;  2BWE S;  3ECI A;  1FMA D;  2WP9 B;  2MX2 A;  3E56 A;  2QDF A;  1PGA A;  3Q8E A;  4HVB A;  1NDD A;  3O65 B;  3N1Z C;  3TSS A;  2NBU A;  2GBM A;  2K9X A;  3PLU A;  2N9K A;  4IM3 A;  1RWS A;  3LDZ E;  2DYB A;  1JWM D;  3MFG A;  2V9H A;  2WS3 B;  1XF5 L;  3GS2 A;  2WX1 A;  3K9O B;  3RNA C;  4FAD A;  2ZCC A;  3APF A;  4ANV A;  2QIL A;  1DGJ A;  4GDK B;  2FE8 A;  3MC0 B;  1N63 A;  3X23 A;  2LRW A;  5BYS A;  1KJT A;  3OLM D;  2KMC A;  3ZXR A;  1NYR A;  3ZTC A;  1JML A;  3CF6 E;  1NBF C;  3I63 C;  3BYT B;  5G5G A;  4E71 A;  2O6V D;  1MVK A;  2RDG A;  2CJN A;  4KIK A;  1PFD A;  2XN9 C;  2K3U A;  2ICI A;  2LZ6 A;  1UD7 A;  4OHJ A;  4A9A A;  4NQL B;  3RZW C;  1PUT A;  2WDR B;  2ZVO A;  2HJ1 A;  1J7B A;  2ZCB A;  1FCL A;  1T0Q C;  1T0R C;  2LVQ A;  4MGZ E;  4JL9 A;  3TJP A;  4ZRK A;  2INN E;  2KYW A;  2BS4 B;  2G9H D;  1I4G A;  1EO6 A;  1P7E A;  2ASQ A;  1K8R B;  2BF8 B;  2R2O A;  3L13 A;  4LNK A;  2SEB D;  4WJQ A;  2MBO A;  4XX5 A;  2W3S A;  3ZJT A;  4FXC A;  4K1R B;  3ZTD A;  4JLC A;  2M0X A;  5TSS A;  2CU1 A;  3WAL A;  5HHD G;  2M19 A;  4MEM A;  4ZRJ A;  3U7D A;  4XWW A;  2DZM A;  2M1M A;  3H9D A;  2PVG C;  4FN2 A;  2QEJ C;  4A8X C;  2BGF A;  1Q5W B;  3A1Q A;  1Y56 A;  4RF0 A;  1NVI D;  1R4M I;  1UWX A;  1WX7 A;  3VR8 B;  1KTK A;  2UU7 A;  4E3C A;  4KDI C;  1XCQ L;  3AE2 B;  2KTR B;  3W1S A;  1IUE A;  1UNS A;  2KHW B;  2LGX A;  3ONS A;  3MP9 A;  2K22 A;  3HK0 A;  3T3O A;  2HTM E;  4HPM B;  1YN5 A;  1OEY J;  3X0W A;  1XT9 B;  1T5X D;  3DDC B;  1PGB A;  3FC4 A;  2WDV B;  1T6B X;  3V6C B;  2JXX A;  4C7Z A;  4RGT A;  2IY0 B;  2D07 B;  2DWQ A;  2KVZ A;  1UUP A;  5BO4 B;  1L4D B;  3ZDM C;  1E7V A;  4HCN B;  3A33 B;  1N5X A;  1FRD A;  3KVF B;  3JVZ X;  4ZRP A;  1LGR A;  3HIZ A;  3OWE B;  1FNV A;  1VRA B;  1GG3 A;  2CU3 A;  4MGK E;  1Z2M A;  1V1O A;  4JWS C;  1ZXI A;  2GB1 A;  1C1Y B;  4KDL B;  3AE3 B;  2IZV B;  2ZNV B;  3VRA B;  4HLE A;  1K53 A;  2DBY A;  2ACZ B;  1OTR B;  2WXF A;  3M63 B;  2VZK D;  3C19 A;  3ZDT A;  2IPK D;  2WHI A;  1L0X B;  1TIF A;  4C80 A;  3Q14 C;  4ANW A;  1MFW A;  2L8J A;  4XGA B;  2ZW1 A;  4M8M A;  3WAP A;  1E8X A;  4MH0 E;  1Q1O A;  1YN4 A;  4LTU A;  1Z5S B;  3UF8 A;  2AQ2 B;  1WGH A;  4IC7 B;  3RNC C;  4NAM A;  2PW9 A;  3N9Y C;  3MJ5 A;  1KF6 B;  2WXL A;  2N1W A;  4HCP B;  4AJY B;  3SR6 A;  3EEC A;  2LUM A;  4LNO A;  4W9F A;  1WX9 A;  2J52 A;  2G45 B;  2QMT A;  5E6N A;  4W9C A;  3NVW A;  4R3D A;  2LGY A;  2JRH A;  2BS3 B;  4EEW A;  1KLV A;  1WM3 A;  5FR6 A;  4IOI E;  3Q3M C;  1CMX B;  2WU2 B;  1YN3 A;  1FFU A;  2ZW0 A;  1IGC A;  2X38 A;  2ZJD A;  2Q5W D;  2BVC A;  2WXO A;  2G3Q B;  2N1V A;  1T0S C;  1V97 A;  2WLB A;  2BT6 A;  2PTL A;  4K81 A;  4GN1 A;  2GBK A;  3IXS A;  3MHS D;  4CYE A;  4URK A;  3K9P B;  3BK1 A;  3AM9 A;  5GMV A;  1FIQ A;  2MBH A;  4IM0 A;  2UYZ B;  4B9K A;  4A90 A;  4LNI A;  3I3T B;  1F2R I;  4KSK C;  3VXW A;  2V4I B;  4KV2 A;  3IT6 B;  2IND C;  4NAW A;  4BVU C;  1WXS A;  2MQJ A;  2J53 A;  4NPN A;  2WXK A;  1QKZ A;  1TS4 A;  3HVD A;  2E3T A;  4YL8 A;  4TUU A;  2H88 B;  5IOI A;  2W54 A;  2JX5 A;  3A4R A;  2GRI A;  1BXT A;  5G2N A;  3PZ7 A;  1J7A A;  3Q3F A;  4GGQ A;  4HRO A;  2KDF B;  1YJI A;  2WXQ A;  2V3S A;  4GMV A;  2YEP F;  4KKJ A;  1RFA A;  3EHV A;  1HEZ E;  3R8B A;  1PYW D;  2NCN A;  4EOY A;  3KLS X;  2C7M B;  4TQ0 A;  1YD8 U;  5T8I A;  4FA6 A;  3P42 A;  3TEY A;  4PS8 A;  2G4D B;  3NVV A;  2Y5B B;  1NEK B;  1C76 A;  3EGR A;  3C0R B;  1IP9 A;  1IYF A;  2M0A A;  4HJG E;  3IHP C;  3T3N A;  1TKG A;  1EF1 A;  3VQI A;  1E8W A;  2G4S A;  4ICU A;  1OFF A;  1FEH A;  3ZRC A;  4KZ0 A;  1XQQ A;  1H8C A;  2W9N A;  3ZRF A;  1AAR A;  3RMK C;  2NPT B;  2KX3 A;  3ZNG C;  1TS5 A;  3DBR B;  1L4Z B;  3U2S C;  4ANU A;  4K7W A;  3BVM A;  4IM2 A;  1ZDV A;  4MAC A;  2RGF A;  2NBW B;  3BIN A;  1C78 A;  4P7I A;  1P9D U;  2MP2 B;  4XYC A;  4ZHO A;  1J7C A;  3CST A;  2HDE A;  2K6Q A;  3DWM A;  4UDU C;  1F77 A;  3DBH B;  4OVV A;  4N58 A;  3L10 B;  4C4V B;  1GUA B;  1YQ3 B;  3DHH C;  1FNW A;  3L4P A;  4IUM B;  2JYE A;  1WY8 A;  2L05 A;  4ITK A;  3SU8 X;  2VH2 A;  3ZO5 B;  4YTM B;  2G1E A;  3DBL B;  5FKA C;  4F1S A;  4GDL B;  4YSY B;  3ZYY X;  3C8Y A;  1MHH E;  3AUL A;  1LXD A;  2LHE A;  1AW7 A;  4XZ4 A;  1OQQ A;  1I4R A;  3A4S C;  1TZO A;  5EE9 A;  1ZPS A;  3EUB 2;  4NQK E;  1UH6 A;  1XO3 A;  2K8H A;  3LJ3 A;  1M4V A;  1C4C A;  4NNJ B;  2RPQ A;  2C5L C;  5CX3 A;  3P4S B;  3VHT C;  4A20 A;  2MW5 A;  1WZ0 A;  2KZR A;  3AE8 B;  2K6D B;  2NVU I;  3GOE A;  1WGG A;  4FBJ B;  3IVF A;  4J3O D;  1TJE A;  2BKR B;  3V62 A;  2RR9 A;  3V6E B;  4OW0 A;  1DOI A;  3B0A A;  1K50 A;  3T9L A;  1E5W A;  2LGD A;  3Q2A C;  1NEN B;  5IAA C;  2WGS A;  2V3N A;  5DPS A;  1IGD A;  2INP E;  3IT4 B;  4ZHP A;  4RM9 A;  3ZXV A;  4LJO B;  1V81 A;  1WJN A;  4RMA A;  5EE0 A;  2GI9 A;  1MG4 A;  1V8C A;  3ZKJ C;  2MP2 A;  3TEW A;  3VUY A;  4CHK A;  5EE3 A;  1V5O A;  4BKS A;  4USA A;  1E7P B;  4W9J A;  5BMG A;  2MRP A;  1E90 A;  1XLO A;  2FUG 1;  1BT0 A;  2KLG A;  2IBI B;  1PGX A;  2GLS A;  3R7R A;  3AED B;  1H4R A;  5GXG B;  4MEL A;  4P1C C;  5G55 A;  1I4H A;  1S1Q B;  3KUD B;  2K0P A;  3QA8 A;  2AWT A;  2KAN A;  1P7F A;  4EKU A;  2HD5 B;  3AE4 B;  1RYJ A;  4RCO A;  3H7S A;  3N1X C;  3H7P A;  3JW0 X;  4GDL A;  1L6V A;  2L76 A;  1JWS D;  1J0G A;  1ZW7 A;  3HVZ A;  2RDB C;  3TIX A;  4LK0 M;  3U7Z A;  5D6J B;  4ARI A;  3I9V 1;  5IKC M;  1WYG A;  2AL6 A;  2KT7 A;  5G5H A;  3VR9 B;  1SIF A;  4KVG B;  4N6E B;  1KLG D;  3R2T A;  1I4Q A;  4JE3 B;  3HM3 A;  3FIL B;  3L17 A;  1LM8 B;  4Q2J A;  4TV3 A;  3U4E G;  2LEK A;  5IO9 A;  3AV8 A;  1SF0 A;  2JWU A;  4IKG A;  2CHZ A;  5J18 A;  4A3O A;  1WRI A;  1SEB D;  3PS6 A;  3EC8 A;  3PT2 B;  3AU4 A;  3RNG C;  2PE6 B;  1HA5 A;  3TEZ A;  4FJZ A;  1OGW A;  3V3X A;  3VDZ A;  1E9M A;  5AZH A;  1WFY A;  1WMH B;  4EUT A;  1P0R A;  3V61 A;  3B2F A;  3ML8 A;  1UBQ A;  3N32 A;  4I6N B;  3RNE C;  2I1K A;  1JRP A;  3H1U A;  4FHK A;  3NOB A;  3T8M A;  3A9J B;  4A55 A;  4AUQ C;  3BZD B;  2BW2 A;  3KYD D;  3VTW A;  1WSP A;  1T0Y A;  1WI0 A;  1E6E B;  4EFO A;  3BVZ A;  1IBX A;  3QJZ A;  5AUI A;  4S0R A;  2JVC A;  3W2D A;  3DHI C;  4W9L A;  2MSE D;  5JH5 C;  1KOT A;  4IWO A;  4AS1 A;  1L6U A;  2QCZ A;  4YSX B;  5LXI B;  2BS2 B;  2M56 B;  4H2A A;  1TS2 A;  2JZ3 B;  4W9I A;  3VUX A;  3MJW A;  4E74 A;  2LXA A;  2I2Y A;  2EMS A;  1YOV B;  1SE2 A;  3APD A;  2KX0 A;  2KXJ A;  2C9W B;  4K7U A;  4LDT B;  1ZDX A;  4TQ1 A;  3KUC B;  1UGJ A;  3DBS A;  2DLB A;  1DOY A;  1JRO A;  1QOB A;  4HKQ A;  2XNA C;  2LD9 A;  1SE3 A;  2WQY B;  4EZK A;  4P16 A;  4C7Y A;  1F52 A;  2CKH B;  2DAF A;  2WXJ A;  4HPP A;  2BYV E;  2KAC A;  4IWQ A;  4G3X B;  2KJR A;  2MJD A;  4KSL C;  2FUH B;  2MBE A;  4MGI E;  4GDK A;  3L16 A;  1XEE A;  2EMT A;  2N9L A;  2KN4 A;  2SAK A;  5AZF A;  3VUW A;  1N6Z A;  3DVN U;  3NRZ A;  1RLF A;  4HKZ E;  3R3M A;  4ZYS A;  3P2B A;  4WH4 A;  4BKS D;  5JHB A;  1ZUD 2;  4K3C A;  1VLB A;  4OVU A;  1ENF A;  3NJT A;  2XK5 B;  3ABV B;  4DHJ B;  4I6L B;  1TKY A;  1V80 A;  1CZP A;  1WWT A;  3BII D;  4GIV A;  1WM2 A;  2BBC A;  2CHW A;  1F0Z A;  4NJ7 A;  1ZGU B;  2R61 A;  4PS3 A;  3L0W B;  4AWJ A;  3RT3 B;  2IO2 B;  2KQS A;  4GXB A;  3A9K B;  1UF0 A;  2FIF A;  1D6E C;  1R7S A;  2HE7 A;  2JSV X;  2YVC A;  4W9E A;  4XDD A;  1L7Y A;  2HTH A;  2J0M A;  5IA7 A;  2NTS A;  1VR9 A;  5BMI A;  3LXF A;  1CQV A;  3I57 A;  4WQM A;  2BPS A;  3BK2 A;  2REX A;  3Q3N C;  4AP4 C;  3LYY A;  3ZW3 A;  3U30 A;  3RD2 A;  2BYT A;  3DCG A;  3CMM B;  1M94 A;  1N60 A;  1XLQ A;  2D3A A;  3DVN V;  2L0F A;  4LNF A;  1JWB D;  4REZ A;  2HJ8 A;  1N61 A;  2IGD A;  2MBQ A;  1S3S G;  2M8S A;  4PT5 A;  4FHJ A;  4C56 C;  3SDL C;  3CSF A;  3AEE B;  2JWZ A;  2KWC A;  1VZ6 A;  2OED A;  1HQR D;  2FNJ B;  4PYU A;  2E6X A;  3W1Y A;  2WXN A;  1GJZ A;  2FCN A;  3P4P B;  1PDX A;  4AJW A;  4DXG A;  4II2 B;  1WX8 A;  3UIP B;  2MWS B;  1V1P B;  4OVZ A;  4ZYN A;  3N30 A;  2L32 A;  4F8C B;  4TKN A;  2NMQ A;  5DPT A;  2LUE A;  4W9H A;  2KC1 A;  1ET9 A;  3TEX A;  1ESF A;  3APC A;  2INC C;  4ZRI A;  1SE9 A;  3W5U B;  2WXP A;  1WJ4 A;  2KTR A;  2A4Z A;  1CJE A;  4BZA A;  1TZ1 A;  1KH0 A;  2KFK B;  1B9R A;  3P1M A;  4XC2 A;  1SGH A;  4A6Q A;  2WXR A;  2OJW A;  4YTP B;  5H92 C;  3AB5 A;  4FUL A;  2XK5 A;  2RSU A;  2Z59 B;  2WYQ A;  3QAQ A;  4LCD E;  4MM3 B;  4W9D A;  5BYQ A;  3E9S A;  3H6N A;  3ETR A;  3DBR I;  1HE8 A;  3EA6 A;  1QZE A;  5E6O A;  2CS4 A;  2N9X A;  4JPS A;  3Q69 A;  1FO4 A;  1VD2 A;  1OEY A;  3B08 A;  4XE0 A;  3S2A A;  2ON8 A;  5TR5 A;  2CR5 A;  1P98 A; 
#chains in the Genus database with same CATH homology
 1K52 A;  5FKA C;  1YJJ A;  4GDL B;  2WS3 B;  4YSY B;  3ZYY X;  1XF5 L;  3C8Y A;  3GS2 A;  1MHH E;  2DYM A;  2LHE A;  1AW7 A;  1OQQ A;  1LO5 D;  1FM0 D;  2IJ0 A;  1I4R A;  1TZO A;  5EE9 A;  1YNT E;  1JCK B;  2QIL A;  1ZPS A;  1DGJ A;  3EUB 2;  2KWD A;  4GDK B;  1XO3 A;  3AN1 A;  3NVY A;  2FE8 A;  2I38 A;  3MC0 B;  3Q8A A;  3GP7 A;  1N63 A;  5HI1 A;  2IGG A;  4KX6 B;  1M4V A;  1C4C A;  3KQ4 A;  5BYS A;  1EU3 A;  1FRR A;  1F2R C;  2QJL A;  2EEL A;  3P4S B;  4YT0 B;  5E6J A;  1XXG A;  1NYR A;  1QOF A;  1NI3 A;  1RFK A;  1AN8 A;  1JML A;  4XWT A;  3BYT B;  5G5G A;  3ZJV A;  1JAL A;  3AE8 B;  1BUI C;  1NYQ A;  2J42 A;  2N0S B;  2PMV A;  4MH8 A;  1GB1 A;  1C4A A;  1K51 A;  1MVK A;  1ZOY B;  4J3O D;  1TJE A;  2RDG A;  3SFD B;  2CJN A;  1PFD A;  1TS3 A;  2XN9 C;  2K3U A;  3AEC B;  4RGO S;  4OW0 A;  2ICI A;  1DOI A;  4OHJ A;  1K50 A;  1MPE A;  5D3D A;  4D2K A;  4A9A A;  2JXT A;  1NEN B;  4GLS C;  1SSN A;  4US8 A;  4NAW B;  4ARC A;  1PUT A;  2V3N A;  2WDR B;  1IGD A;  2INP E;  3AEF B;  3IT4 B;  1J7B A;  1L0Y B;  1FCL A;  3AMZ A;  3H8H A;  1DOX A;  2Y3A A;  4ZHP A;  3PZ8 A;  1QF6 A;  2NTT A;  2INN E;  5EE0 A;  2BS4 B;  2GI9 A;  2G9H D;  1I4G A;  1P7E A;  1V8C A;  4RGN A;  3AE5 B;  3TEW A;  1KRH A;  1D5M C;  1QOA A;  2KMM A;  3V05 A;  2SEB D;  5EE3 A;  2ONQ A;  5MPO A;  2W3S A;  4TSS A;  3ZJT A;  4FXC A;  4RGM A;  2B76 B;  1TY2 A;  4HEA 1;  4USA A;  5TSS A;  1TKE A;  1E7P B;  5BMG A;  4KKI A;  1I7H A;  5HHD G;  1XLO A;  3URY A;  2M19 A;  2FUG 1;  1STE A;  3AE9 B;  1PGX A;  4RH6 A;  3R2I A;  3AED B;  3J9C A;  5GXG B;  1GPX A;  1HZ6 A;  1OQR A;  2JZP A;  1TYG B;  1I4H A;  2WNM A;  2MEK A;  5FR3 A;  4XWW A;  5D7G A;  2K0P A;  4NJC A;  5LNK 1;  3FAH A;  2PVG C;  1P7F A;  2QEJ C;  3AE4 B;  1RYJ A;  1SIJ A;  1XCT L;  2QIE B;  2WXG A;  4RCO A;  4A8X C;  1HZ5 A;  1Y56 A;  4RF0 A;  1NVI D;  1L6V A;  4HRS A;  4OZB A;  1JWS D;  1UWX A;  3VR8 B;  4JX1 C;  1KTK A;  2PIA A;  3HVZ A;  1VDV A;  4LK0 M;  3U7Z A;  1XCQ L;  1EWC A;  1FXI A;  3AE2 B;  3W1S A;  5BMH A;  1IUE A;  1UNS A;  4ARI A;  3MP9 A;  3I9V 1;  2K22 A;  1WYG A;  3T3O A;  5G5H A;  2HTM E;  2KQ4 X;  3VR9 B;  1JWU D;  4N6E B;  1KLG D;  3AEA B;  3R2T A;  1I4Q A;  1YN5 A;  4JE3 B;  3FIL B;  2LMC A;  4JWU C;  1D5X C;  1T5X D;  1N5W A;  3SEB A;  2Z8L A;  1PGB A;  5C2T B;  4Q2J A;  1KLU D;  3FC4 A;  1I4P A;  3U4E G;  2LEK A;  3AV8 A;  1SF0 A;  2JWU A;  2WDV B;  4IKG A;  4N59 A;  1T6B X;  3UI3 A;  2FBW B;  1WRI A;  1SEB D;  2H89 B;  4RNA A;  4C7Z A;  1GOZ A;  4RGT A;  3B9J A;  2YEP B;  3W5V B;  3P4Q B;  4CQN A;  1HA5 A;  1Q10 A;  1ZXH A;  3TEZ A;  4TMA B;  2DWQ A;  1T3Q A;  2KDM A;  5EE1 A;  3BVG A;  3V3X A;  1E9M A;  1UUP A;  1SE4 A;  1L4D B;  1L5P A;  1QT9 A;  4OZC A;  1N5X A;  1FRD A;  4ZRP A;  4RFB A;  3OWE B;  1FNV A;  1VRA B;  3KWV A;  2CU3 A;  3B2F A;  3IAM 1;  1V1O A;  1CK1 A;  1ZXI A;  4JWS C;  2GB1 A;  2BB5 A;  1ACC A;  1SXT A;  1JRP A;  3AE3 B;  1E0Z A;  2VZK B;  1V1P A;  4MT5 A;  3VRA B;  4A55 A;  2WXH A;  2W55 A;  1K53 A;  3BZD B;  2DBY A;  2ACZ B;  2BW2 A;  3NS1 A;  2WXF A;  1MHX A;  1WSP A;  2JU6 X;  2VZK D;  5BYR A;  1SJE D;  1E6E B;  2IPK D;  5JXV A;  3BVZ A;  2L1A A;  2L83 A;  3WCQ A;  1IBX A;  2RMM A;  2TSS A;  5AUI A;  1L0X B;  4OZA A;  4B0E A;  4EE2 A;  3W2D A;  4C80 A;  3ZGZ A;  1MI0 A;  4AS1 A;  3IAS 1;  1L6U A;  4YSX B;  2IGH A;  2BS2 B;  3AH7 A;  4US9 A;  2M56 B;  4H2A A;  2W82 A;  2ZW1 A;  1TS2 A;  3PO0 A;  1FD6 A;  2I2Y A;  1GAQ B;  1YN4 A;  1C79 A;  4LTU A;  1SE2 A;  2LJI A;  3KWL A;  1AYF A;  4P6V F;  1WGK A;  2AQ2 B;  2LHD A;  3RFZ B;  2V3P A;  1QLB B;  2PW9 A;  4NAM A;  1ZDX A;  4TQ1 A;  3SFE B;  1N62 A;  3N9Y C;  3MJ5 A;  3AEB B;  1UGJ A;  2DLB A;  1DOY A;  1JRO A;  1QOB A;  1KF6 B;  2WXL A;  5I4D A;  2AQ1 B;  4KGT A;  5HFY A;  3U52 E;  4HKQ A;  2PVO D;  2XNA C;  3SR6 A;  2LUM A;  1C9F A;  1AWD A;  1SE3 A;  2WQY B;  5HG2 A;  4P16 A;  4C7Y A;  4ZRQ A;  2J52 A;  3O13 A;  2WXJ A;  2QMT A;  2Y5P A;  2EKI A;  2PKO A;  1QIL A;  2KAC A;  3NVW A;  4R3D A;  2MJD A;  1ZE3 D;  1ROE A;  2BS3 B;  5C3J B;  1YQ4 B;  4IOI E;  4LLG M;  3CIR B;  1XEE A;  3CWI A;  1C77 A;  4O1N A;  2N9L A;  2WU2 B;  2KN4 A;  2SAK A;  4L2Y A;  1YN3 A;  4B0M A;  1FFU A;  2ZW0 A;  1IGC A;  4YWG G;  2X38 A;  2Q5W D;  1DYQ A;  4WAF A;  1VZ8 A;  3NRZ A;  4DQO C;  4HKZ E;  3P63 A;  4ZYS A;  4WH4 A;  5AUK A;  2WXO A;  1XLP A;  1ZUD 2;  1VLB A;  5FK9 C;  3BWU D;  1ENF A;  1V97 A;  4XDC A;  2WLB A;  4L23 A;  2BT6 A;  3ABV B;  2PTL A;  1A70 A;  1TKY A;  3IXS A;  3RPF C;  1CZP A;  1FCC C;  2MJ3 A;  1WWT A;  2CJO A;  3BII D;  3BK1 A;  1HXY D;  3AM9 A;  2BBC A;  1F0Z A;  1FIQ A;  2QSD A;  2R61 A;  2WDQ B;  2BTE A;  3W9C B;  2N7J A;  4A90 A;  1F2R I;  1C4P A;  2V4I B;  2AX5 A;  3AE6 B;  3IT6 B;  1QOG A;  5H8Y E;  4L1B A;  3BYY B;  1D6E C;  2J53 A;  1R7S A;  3AEG B;  1ZP0 B;  2JSV X;  3Q8C A;  2WXK A;  4XDD A;  1QKZ A;  1TY0 A;  1TS4 A;  2D5G A;  1D5Z C;  2NTS A;  1VR9 A;  3B2G A;  5BMI A;  3LXF A;  4WUR A;  3HVD A;  1CQV A;  2E3T A;  1D4B A;  1FNU A;  3I57 A;  4WQM A;  3BK2 A;  1UWM A;  2H88 B;  2W54 A;  2WXM A;  3LB8 C;  3LYY A;  1XLN A;  2JX5 A;  1VJK A;  1QQR A;  5D3I B;  3ZJU A;  2BYT A;  2GRI A;  1BXT A;  1I4X A;  1J7A A;  1RM6 C;  1N60 A;  1XLQ A;  2Y5C A;  3PZ7 A;  2KAJ A;  1WXQ A;  3AE1 B;  1B1Z A;  1ET6 A;  3NZ3 A;  4HRO A;  4REZ A;  1JWB D;  1N61 A;  2IGD A;  1YJI A;  2WXQ A;  4PT5 A;  4C56 C;  2YEP F;  4RF1 A;  2LGI A;  2WU5 B;  2LFI A;  4KKJ A;  1HEZ E;  3AEE B;  3R8B A;  2WXI A;  1PYW D;  3P4R B;  1VZ6 A;  2OED A;  2RPV A;  3NVZ A;  1HQR D;  4YXD B;  2J4X A;  3KLS X;  1L0V B;  2RDH A;  4TQ0 A;  5T8I A;  1JW9 D;  2E6X A;  2JQR B;  2WXN A;  3P42 A;  3TEY A;  1GB4 A;  3P4P B;  3NVV A;  1PDX A;  2W3R A;  4DXG A;  1NEK B;  1C76 A;  3EGR A;  3TUO A;  1SB3 C;  1V1P B;  4OVZ A;  2M0A A;  4HJG E;  2L32 A;  2NMQ A;  1TKG A;  3T3N A;  3VQI A;  1OFF A;  4KGS A;  4NZL B;  1ET9 A;  1FEH A;  4WIP A;  1ESF A;  3TEX A;  1JQ4 A;  3HUI A;  4YSZ B;  2K5P A;  3W5U B;  2WXP A;  1IBX B;  2AQ3 B;  2OHF A;  3DWG C;  1CJE A;  1VZ7 A;  1TS5 A;  1L4Z B;  1KFY B;  4M0W A;  1JWA D;  3U2S C;  1YMH E;  1FXA A;  2IDY A;  3BVM A;  2L52 A;  1ZDV A;  4MAC A;  1KH0 A;  1B9R A;  3Q8F A;  2MH7 A;  1C78 A;  3P1M A;  4A6Q A;  1SJH D;  3FIL A;  2WXR A;  2MJE A;  3ZQ4 A;  4YTP B;  1EWY C;  4ZHO A;  5H92 C;  1J7C A;  4YTN B;  1SBB B;  3AB5 A;  2HDE A;  1FFV A;  4WWM A;  1BML C;  3DWM A;  4UDU C;  2JYT A;  1F77 A;  4DXF A;  1EU4 A;  4AQ7 A;  2BB6 A;  3NUH B;  4IDI A;  4KGR A;  1EM7 A;  1FMA D;  2WP9 B;  4N58 A;  3AE7 B;  3E56 A;  3VRB B;  1PGA A;  4MM3 B;  3Q8E A;  5BYQ A;  3Q8B A;  1E10 A;  1YQ3 B;  3E9S A;  4ZOH C;  3GB1 A;  3TSS A;  3HRD D;  3ETR A;  1FNW A;  2JYE A;  3L4P A;  4ITK A;  3EA6 A;  2K9X A;  2PLP A;  2N9K A;  4JPS A;  3Q69 A;  1FO4 A;  4YTM B;  1RWS A;  2DYO A;  2G1E A;  4XE0 A;  1JWM D;  2V0G A;  2ON8 A;  3MHZ A;  3MFG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...