4A6QA

Crystal structure of mouse sap18 residues 6-143
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
143
structure length
143
Chain Sequence
GPDSMRVTQEEIKKEPEKPIDREKTCPLLLRVFTTNNGRHHRMDEFSRGNVPSSELQIYTWMDATLKELTSLVKEVYPEARKKGTHFNFAIVFMDLKRPGYRVKEIGSTMSGRKGTDDSMTLQSQKFQIGDYLDIAITPPNRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords HISTONE DEACETYLASE COMPLEX SUBUNIT SAP18
publication title The Structure of the Asap Core Complex Reveals the Existence of a Pinin-Containing Psap Complex
pubmed doi rcsb
source organism Mus musculus
total genus 29
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2011-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06487 SAP18 Sin3 associated polypeptide p18 (SAP18)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.550 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4a6qA00
4A8XC 4A6QA 2HDEA 4A90A
chains in the Genus database with same CATH superfamily
1TZ1A 4ZHOA 3Q3OC 3DWGC 4JLCA 3B2GA 5HFYA 2WXNA 4YTNB 2LVOA 4OZBA 1FEHA 2ZPYA 2RDGA 3AE9B 4II2B 4IG7B 4D2KA 2ZCBA 2KX3A 1EM7A 2MQJA 2BKRB 3AI5A 3ONSA 2N7EA 4WWNA 2IGGA 3E9SA 4KZCA 4AS1A 2L52A 1QOBA 1KLVA 3PLUA 2IGDA 2PW9A 4XC2A 2QJLA 1ET9A 1YJ1A 1WMHA 1N5WA 3NY5A 3IXSA 1WRDB 3SR6A 2JSVX 5H8YE 3OG5A 1SJHD 2LGDA 4DQOC 5GMVA 1I4HA 4MACA 2K0PA 1TS5A 4DHJD 4EOYA 2IZVB 4IDIA 2DX5B 3N1XC 1STEA 2V3SA 4NJ7A 4E71A 3TSSA 4USAA 4WWOA 5D94A 2VZKB 2IGHA 1FNUA 1YX5B 5EE0A 1JWMD 4N9F4 1FXIA 3ZO5B 1GC7A 4PT5A 1VDVA 5JXVA 3Q3FA 4NPNA 1NYRA 3JVZX 2IO3B 2MEKA 4W9JA 1TBEA 3ZJTA 1BMLC 2L3ZA 4JWSC 2LMCA 4S0RA 1VJKA 2IYDB 1NENB 2FUG1 1GC6A 1P3QU 3QC8B 5HG2A 3AE1B 4ZHPA 2JXXA 3HVDA 4DDID 2CHWA 1SXTA 3URYA 2MBOA 3P4QB 1YQ3B 1KM7A 1OQYA 1UZXB 1Q5WB 3DBHI 3H7SA 4YXDB 4NY0A 2J0KA 2M0XA 1WGHA 2DENB 3DBLB 4KGTA 3ZNID 3GZNI 2ON8A 3RPFC 2QEJC 1TGZB 3TBLD 2J42A 4NAWA 1NBFC 2FNJB 1V2YA 4JIOU 4KGRA 1Q0WB 1NVID 2KQ7A 4F8CB 3N30A 2AEHA 4K3BA 2WXPA 1MVKA 5IA7A 1GUAB 1WWTA 1XT9B 4G0NB 4XYCA 4ZYNA 4C4VA 1I4XA 1WJNA 3EC8A 1WE6A 4BKSD 3C8YA 3CF6E 1N62A 4IWOA 4FLHA 3H7PA 2PE9A 1XEEA 3QA8A 4EFOA 1GPXA 1ISNA 4L23A 2N9KA 4ZRKA 3V05A 3L16A 1QKZA 4PK1A 5HI1A 2NPTB 2BWES 2K3UA 4XZ4A 4MELA 4KSLC 2BVCA 1QOAA 2YEPF 3VRBB 2C7MB 3R3MA 3O65B 1HEZE 2MP2B 3L08A 5AUKA 4MT5A 4OVZA 4LK0M 4GN1A 4DXFA 1YD8U 2VRRB 3NJTA 2LEKA 4MH0E 2WU5B 1MI0A 2ZNVC 1XLQA 3PGEA 1WR6E 4PS7A 2OJWA 3ZNGC 1TKEA 2KLCA 2WLBA 3BYYB 3DHGC 1OQRA 4FBJB 3NZSA 4AWJA 3ZRCA 1KLGD 5MPOA 3HHMA 2RDBC 3I63C 2LI5A 2N9LA 4P1BC 3OAWA 1TTNA 1UGJA 3I3TB 3Q8EA 2EKEC 5HHDG 3DDCB 3WIMA 1KTKA 1TY0A 1IBXB 1L4ZB 5I4DA 2DZKA 2QSDA 4ITKA 1ZKHA 3VR9B 1YX6B 2NTSA 4LNNA 5TR5A 3N9YC 1D4BA 4AJWA 2WXGA 3H6NA 1E0ZA 1IGCA 4N58A 1Z5SB 5JH5C 1I4PA 2FIFA 2V3NA 4GMVA 2V1YA 3QIJA 2HE7A 4A3PA 4B9KA 4LDTB 1MFWA 2KDIA 2PLPA 3T8MA 4A6QA 2D3BA 3CIRB 3DBLI 4TQ1A 1R4NB 2JX5A 1EF5A 1SEBD 2X38A 1QZEA 1YN5A 5EE3A 1K52A 3TMPB 1L6VA 4C7ZA 1PYWD 2D5GA 2INPE 1WH3A 2V4LA 5LLIA 3Q3MC 1UF0A 3U2SC 4MGYE 1ZXHA 3QHTA 4M01A 1JWUD 2YEPB 3A9KB 3ZDMC 3RUIB 1V1PA 4C80A 3BINA 3T3OA 2RPVA 1UD7A 3M3JA 1M94A 2KOXA 2LGIA 4M00A 1XCQL 4M0WB 4RGNA 3HUIA 4IKGA 4FULA 1T6BX 2O2VA 4KIKB 2G1EA 1PDXA 2VZKD 1AARA 5FKAC 4DXAB 5G55A 1WZ0A 3ETRA 3PHXB 3TL5A 1CQVA 2XN9C 4KV2A 1E7PB 1JW9D 1VLBA 2AQ1B 1HA5A 5G5HA 1DOXA 2JWUA 1TY2A 5C2TB 4F1SA 4MJSA 2XK5B 3VHTC 2Q5WD 4MM3A 4FADA 5BMIA 2DZIA 3AM9A 2M56B 1TKYA 3QJZA 2PE6B 1P9DU 2JU6X 2RGFA 3AE5B 5E6OA 1EU3A 1GG3A 3A4SC 2BKFA 2MCNB 3MC8A 1SBBB 4EZJA 4HPPA 2WXLA 4WURA 2BS4B 1AWDA 1RLFA 3UQAA 1MHXA 2FCSA 4WJNA 1VCBA 3KW5B 4AUQC 2WXJA 4RH6A 2PEAA 2KANA 2I2YA 2D3CA 1QILA 1WXSA 4XWWA 2RMMA 2BTEA 2GLSA 2QIEB 1B1ZA 1ZOYB 3AE8B 5HKHA 4C56C 1YQBA 4LNKA 1RFAA 4IM2A 1WM2A 3P4SB 2XBBC 1V5TA 3R8BA 1D5MC 1E9MA 2AYOB 2KZRA 1FCCC 2JT4B 1YIWA 4W9KA 1DYQA 3SEBA 2KFJA 1K50A 3UQBA 1GB1A 3AE3B 4P7IA 3VAWA 4W9FA 3CMMB 2N1WA 4HCPB 2E6XA 4I6LB 3LB8C 3W9CB 1U4AA 3DVNU 5E6PA 3AXCA 1F0ZA 3RN9C 2M19A 3N20C 1WGGA 4YWGG 1WI0A 4A9AA 1ENFA 1WJ6A 3IAM1 3MFGA 1X1MA 1R4MB 4AQ7A 3L54A 1WX7A 2LJ5A 3N3KB 3QCAA 1ZP0B 3AE4B 2B76B 2W9NA 3B1LX 4TMAB 1L2NA 2RD0A 3N1ZC 3P2BA 2N9EB 2KO3A 2NR2A 3DVGY 4KKIA 1C4AA 2CJNA 2DYMA 3QK0A 3ZGZA 4ZRJA 2TSSA 2JXTA 4FJVB 5IN7A 1K8RB 5BYSA 1LQBA 2ZPNA 1LFDA 1NI2A 4DK5A 2IY0B 1YJJA 2KN5A 3ZVVA 3P4PB 3CWIA 2KTRB 3AE2B 2G3QB 1V1OA 2NCNA 4RGOS 1I35A 1DOYA 4GU2A 4AJYB 1ESFA 5IOIA 2GBRA 3LXFA 2MHJA 4ZRQA 2MH7A 3NS8A 3MHSD 2K25A 4P1CC 1PGXA 4JWUC 1EU4A 3BK2A 3J9CA 3NUHB 2PJHA 2AL6A 1XLPA 1FM0D 2BS2B 3BIID 1N6ZA 2QCZA 3H1UA 2C7NB 4G50A 5C23A 4JGHB 3BVGA 4REZA 1KH0A 3DBHB 2KHWB 3R7QA 2X8XX 4HDQA 1GNUA 5D6JB 2ZEQA 2FE8A 2GOWA 3VRAB 3PLVA 1DOIA 4RM8A 1P1AA 4PS3A 1TYGB 1F77A 4BVUC 4ACFA 2L76A 3OJ4B 1K51A 4KX6B 3RZWC 3V61A 2JZPA 3BY4B 2IO1B 2JZZA 2KMAA 5LNK1 1JROA 3R7RA 4CQNA 2DAFA 2KTFA 1L0YB 3MJWA 1XQQA 3NRZA 3TIXA 2C60A 1CZPA 3SHQA 2QMTA 3PPAA 2L32A 3P63A 2WDQB 3IVFA 1JCKB 4LDTD 2KDEB 4GLSC 5IO9A 3SDLC 3S2AA 3HM3A 1YN3A 4YSYB 2MW5A 4OVUA 4MDKE 4F7ZA 2WXFA 2KWDA 1A5RA 2GMIC 1OEYA 3ENEA 3VFKA 1WR1A 5AEKB 3ZTDA 1I7HA 2DWQA 3ZRFA 4RF0A 2L83A 2ZZPB 3RI7C 2BB5A 2BBCA 2N7DA 1R4MI 3L10B 4TQ0A 3Q14C 4PYZA 5AZHA 2IO0B 4HJGE 4GDKB 3PS6A 2INNE 2CHZA 3I9V1 3HIZA 1I4QA 4LLGM 1Y56A 2LGYA 1T0QC 1OEYJ 4W9EA 1E90A 2MJEA 4N59A 3KQ4A 2WXHA 4XDCA 3CSTA 4FJZA 4EKUA 2ZNVB 3APCA 5D3IB 3DBSA 2NBUA 2WXRA 1JWBD 3VH3B 2Z8LA 3DWMA 5IKCM 4YSZB 2DHZA 2AL3A 2DZJA 4GB9A 2M1MA 2K8HA 1QT9A 3JYUA 2KD0A 2FCMA 4AP4C 1WGRA 2A5UA 2C9WB 4B95A 1TT5B 4ZOHC 1ZGUB 2M8SA 3H7PB 4HLEA 3PHWB 3KUZA 4A90A 4M8NA 1SJED 3ZNHB 4JE3B 4E3CA 2GI9A 3EFUA 2EELA 4HCNB 3KUCB 4YTMB 2IDYA 4ZDVA 1UH6A 2HD5B 3NVWA 1IPGA 1PQSA 4K7SA 3VXWA 2V0GA 3TUOA 1RAXA 2ZW1A 1J7CA 3RYTA 2WX1A 1BT0A 2N9XA 1ZE3D 3CSFA 1J19A 2R2OA 1WY8A 4MH8A 3PZ7A 5AZGA 4C7YA 2PVOD 4TUUA 2LVQA 1LGRA 4RGMA 1FMAD 3R2TA 2WDRB 3DVNV 5AZFA 2D3GA 2XEWA 3VH4B 2W3SA 1BXTA 3NHEB 3H8HA 3OJ3A 5CHWA 2KDMA 2W55A 2QHOA 3V60A 4ARCA 1OGWA 2K1FA 2V9HA 4JQWC 2GBNA 4HWIB 1VR9A 2JYEA 3BVMA 2XNAC 2CJOA 3W2DA 4L2YA 2CHXA 3FKYA 3PRPB 1XXGA 2BT6A 4IM0A 4K7UA 2LRWA 3AEBB 2KC1A 1WFYA 4M02A 5D7GA 2W82A 1M4VA 3A33B 1TJEA 3MP9A 2CR5A 1EF1A 2L8JA 4LNOA 2KMCA 3ZW3A 1FXTB 1ZDVA 1H8CA 3AV8A 4MSQB 1JRUA 3AE7B 1OQQA 3KLSX 3UINB 1EUVB 3LJ3A 3PZ8A 1E8WA 3L17A 3FILB 2BPSA 3B2FA 5G5GA 1J7AA 3V6CB 1SF0A 1HZ5A 1WYGA 2K5PA 5L83A 4WH4A 2I1KA 2HTHA 1KLUD 4YSXB 5EE9A 4MGIE 1P0RA 4NAMA 1VZ8A 3IT4B 1GOZA 2K22A 3Q8CA 1WGYA 3RNBC 2LGSA 1C1YB 4XX5A 1WXAA 1BUIC 2LVPA 1JQ4A 1L6UA 4DDGD 5LXIB 2MBEA 4HROA 2VH2A 5T8IA 3BZDB 4WWMA 1FD6A 3MC9A 5AUIA 2BW2A 3P42A 3TEYA 1FFVA 3I57A 1P7FA 2KT7A 4H2AA 5E6NA 2NBWB 1L7YA 2NPTA 5IAAC 3AMZA 3KWLA 3T3NA 3LDZE 4ICVA 3OLMD 5EDSA 4OZCA 2MP2A 1XF5L 4OW0A 4W9LA 3RULA 5C1ZA 2K39A 2W54A 4MJSB 4A20A 1C79A 1WGKA 3JSVB 3ZJUA 1XCTL 3W1SA 3GE8C 1PGAA 3AU4A 3Q8FA 1C4CA 1RRBA 5CHVC 3ZUNA 2AWTA 3TEXA 1MHHE 2IO2B 1H4RA 4B0MA 3RNGC 1GB4A 3A9JB 3MJ5A 1JRPA 3B9JA 2M0AA 3T9LA 3Q3JA 4J3OD 4BKGA 3SU8X 1KF6B 2WXQA 4EEWA 2K6QA 2NVUI 1PUTA 1XO3A 1QQRA 2L0FA 2LGXA 2PKOA 1TS3A 4WJPA 4GDLB 2RDHA 4W9DA 1IBXA 3ZYYX 1UBQA 3HM6X 3VTUA 4I6PA 4NQKE 4W9HA 2MX2A 1CK1A 2N1VA 2MJDA 4ANVA 2JRHA 3Q8AA 2NTTA 4NQLB 1V86A 1D5ZC 4K3CA 1WSPA 1KJTA 3A1QA 2MBQA 3EECA 2IJ0A 3NVYA 4XWTA 2K8CA 2LHEA 3E56A 3U7ZA 3W1SC 2J0MA 5LXHA 4HDOA 1FNWA 1AYFA 3NVVA 1VZ6A 1TZOA 1V81A 3ML8A 4BOZB 1V49A 1KFYB 4UDUC 3RD2A 4FN2A 4YL8A 4G11A 4KVGB 1LM8B 5KHOA 3AULA 2GBJA 4BAXA 3U7DA 5DPRA 1MPEA 1N5XA 1NDDA 3EA6A 1L0VB 4M0WA 1UBIA 1N60A 4KIKA 1J7BA 2DLBA 1YJIA 2BYTA 1YN4A 2BQQA 1EWYC 4QAYA 2Y5CA 1PFDA 1WZ3A 5FR3A 2KK8A 3AEGB 1C78A 2XK5A 3ML9A 1S3SG 3KVFB 2INDC 2UYZB 2J0JA 3DBRI 4IWQA 4PS8A 1F9JA 1YNTE 2KFKA 1V97A 5DPSA 4WWPA 1I4GA 1F1HA 3DOWA 2G45B 3QARA 1JMLA 2FAZA 2KWVB 1DGJA 4HVBA 1SB3C 2MA9B 1OFFA 1XLOA 1HZ6A 4LTUA 2FIDA 4OZAA 1WXVA 5BMHA 1TIFA 1TS2A 2CU3A 2O6VB 5DPTA 1JWSD 2N9PC 2KX0A 3A4RA 2K8BA 2SAKA 2J53A 2WS3B 1EWCA 4X57B 4JL9A 2KWUB 5L95C 4K81A 3MTNB 1FRDA 2GRIA 3WA0A 2LUEA 2PIAA 1F2RC 4WIPA 3M62B 1KOTA 4A3OA 2EMSA 4YTPB 2LHDA 2QILA 2DNFA 1XLNA 3DPDA 2D2QA 1C3TA 3VUXA 3SFDB 2KAJA 1HE8A 4RCOA 3WAMA 2L0TA 3NS1A 4CHKA 4IOIE 1N63A 2BS3B 3DHHC 2DAJA 4GSWA 4ASWC 1WMHB 4BKSA 1P98A 1ROEA 3W5UB 3IFWB 3MC0B 3ZDTA 4NJ6A 4I6NB 1ZDXA 1AW7A 4S17A 1LO5D 5J18A 4DHZE 2KLGA 4GIVA 3PREA 2WDVB 3ZXRA 1Q10A 4WQMA 3ALBA 3KYCD 3RMKC 4ZYSA 1L5PA 1NI3A 4EUTA 2KNBA 2KTRA 4LJPB 2JPHA 2JF5A 4US8A 3V6EB 3R2IA 4K7WA 3WANA 3RFZB 2JVCA 2W3RA 1IUEA 1WXQA 2JUOA 2EMTA 4KKJA 2HTME 3IG3A 4HPLB 3APDA 2WXKA 3NOBA 1WIAA 4II3B 2V3PA 1FCLA 1WXMA 2DYOA 2L00B 4EZKA 5E6JA 2PTLA 4ANXA 2L1AA 3NVZA 2CKHB 1VZ7A 1V80A 1QLBB 2OHFA 2KN4A 1UNSA 3VUYA 1S1QB 3DHIC 3K9OB 4WAFA 1Q1OA 1E7VA 3WALA 4TV3A 2N4FA 1IGDA 2ZW0A 1FIQA 1MJDA 4IUMB 1FO4A 5CTRC 2MBBB 1YQ4B 3ZKJC 3DVGX 3N1YC 3QX1A 4IWPA 2ZCCA 3UIPB 1T0SC 1WX9A 2FUHB 1JWAD 2AX5A 1C77A 4NAWB 3U8ZA 2Y5BB 2NBVB 3AH7A 1T3QA 3UGBB 1UGMA 2BYVE 2WYQA 1WF9A 1Y8RC 2BWFA 2L05A 3HRDD 3GS2A 1UWXA 3IHPC 3EUB2 1QF6A 4E74A 2WHIA 4IW0A 4HKQA 2OOBB 4C4VB 2KQSA 1RM6C 1HXYD 4BFRA 1SE9A 4ZRIA 1G6JA 3SFEB 1YOVB 3U30A 3X0WA 3PVLA 1SE2A 1ACCA 4A55A 2GB1A 2WGSA 4KSKC 1P7EA 3TCAA 2L7RA 2LFIA 2LWPA 3L0WB 2IY1B 1ZXIA 4FHJA 3GE3C 4BKTA 4RGTA 5G2NA 3UI3A 2NS5A 1V9JA 1FNVA 2RSUA 4GDKA 2RPQA 2HJ1A 3JW0X 3BWUD 2BF8B 4XE0A 2Z0EB 2LD9A 2DYBA 1E8XA 3AECB 4ANWA 2A4ZA 2MWSB 2Z59B 4HRSA 1EO6A 4GOCA 4B0EA 1E6EB 3PSEB 2REXA 2ONQA 4BOSC 4K1RB 3GOEA 3Q2AC 2PVGC 2UU7A 3VUWA 1I4RA 2QC8A 1LXDA 3Q3NC 2KJRA 4JPSA 3PT2B 2WNMA 2WXOA 4TKNA 2WXMA 2JY6A 1QOGA 4W9GA 3H9DA 4XDDA 3PZDA 2JYTA 4FXCA 4C00A 3APFA 4NNJB 2SEBD 3W5VB 3ZTCA 4BBNF 1IYFA 3AEFB 5D3DA 4MGKE 3RZFA 1J0GA 1OTRB 2M17A 2J52A 2O6VD 3IBEA 2KDFB 2KVRA 1L4DB 4M8MA 4LNIA 1FFUA 4IC7B 4PYUA 5FR6A 5J2RA 2VH1A 3EHVA 3IAS1 3VR8B 4IM3A 2LUMA 5CHFA 4WJQA 1WYWB 1C4PA 2ASQA 1WGDA 1SIFA 2E3TA 4LNFA 1QOFA 2GBMA 4GGQA 2R61A 2UWQA 2RR9A 4HPMB 1PGBA 2ZVNA 1NYQA 3WCQA 1CMXB 3Q69A 1C9FA 4KDIC 2D11A 1F52A 2LXAA 4MSMB 3AE6B 2M4NA 3BK1A 3M63B 4WAAA 2FCQA 2HDEA 2QDFA 4DWFA 4L1BA 2LZ6A 1GJZA 2YLMA 2D10A 4XGAB 2WWZA 4ARIA 2OEDA 1HTQA 1JALA 4G3XB 1V1PB 5H92C 4TSSA 4ICUA 3PV1A 3IT6B 2JWZA 3RNFC 2J7QB 1E10A 1HQRD 2O2VB 3RNCC 2INCC 2N0SB 3DBRB 3PRMB 4NZLB 3K9PB 3VTVA 2MSED 3P1MA 3KH0A 4R3DA 4YT0B 2NMQA 1E5WA 1TKGA 3B0AA 4KZ0A 4MM3B 3FILA 3GB1A 1I42A 3Q8BA 4JX1C 3L13A 2J4XA 2H89B 4WQOB 2WXIA 1CJEA 2LASA 3A1QB 2KXJA 3NZ3A 2BYEA 4B6WA 1A70A 3FAHA 1K53A 1ZUD2 3VVWB 4FHKA 3U4EG 2C5LC 2EKIA 4N6EB 1V8CA 3ZNZB 5IP4D 2YVCA 3TEWA 4EE2A 5JHBA 4WJOA 1SIJA 1D6EC 3O13A 2FCNA 1WM3A 1ET6A 4DHJB 3SD5A 1RWSA 5D2MB 1FPYA 2N7JA 3RNAC 4HEA1 1WX8A 2ZJDA 2CS4A 3DQVA 2KMMA 4DXGA 3EFCA 2JRIB 2V4IB 1T0RC 2LJIA 5EE1A 3B08A 4GXBA 5DCNA 1RYJA 3GP7A 3PRZA 3ABVB 1HTOA 3D32A 3L4PA 3VTWA 2KJHB 2D07B 1VRAB 3W1YA 3N32A 1YMHE 1ZPSA 4CYEA 1J8CA 5FK9C 3ZJVA 4US9A 2DZMA 3JSVA 5BMGA 3QAQA 1UELA 2HJ8A 4RM9A 4OVVA 2BB6A 1C76A 3LYYA 2Z0DB 2I38A 2LXCA 2JZ3B 1V5OA 4A8XC 2KFKB 3RCZA 1NEKB 2CU1A 3C0RB 5CX3A 3OWEB 1Z2MA 4HJKA 2D3AA 4LJOB 4MEMA 4CO7A 2BGFA 3DCGA 2WDTB 2ICIA 3A9JA 3ZQ4A 2WP9B 3V3XA 2KDBA 2ACZB 2I1JA 3A9KA 3AB5A 2MLBA 5DPWA 4OHJA 2FBWB 4EZLA 3FC4A 3MHZA 4LCDE 5C3JB 4URKA 1FRRA 4KDLB 2KJ6A 4RFBA 4HK2A 2ZVOA 2C7HA 3KUDB 4J6IA 2OJRA 2Y5PA 4P16A 4Q2JA 1WRIA 1UWMA 4GDLA 5BO4B 2KQ4X 1V6EA 2PMVA 3AU5A 3PO0A 1N61A 4MGZE 5J17A 1T5XD 3BYTB 4HKZE 1D3ZA 3AN1A 3X23A 1FXAA 1D5XC 2AQ3B 2MBHA 4W9IA 1WJUA 3HVZA 4NJCA 2WU2B 3ECIA 3C19A 2G4SA 3P4RB 5JHAA 3QWZB 2MJ3A 3ZIMA 1MG8A 2KYWA 2JQRB 2KVZA 3I5JC 1SSNA 1SE4A 2G4DB 3KWVA 3UIOB 4BBNC 2IPKD 2WX0A 2GBKA 3AEDB 4P6VF 3U52E 5JZEB 1MG4A 2BYFA 3Q6BA 4FA6A 1E7UA 3ZLZA 3ZXVA 1R4NI 1L0XB 4DBGA 5BYQA 5GXGB 4RNAA 3HK0A 2K9XA 2WQYB 4RF1A 1TS4A 1WE7A 3RT3B 2KACA 2PPHA 3V62A 1KRHA 3PTFC 2G9HD 3AEAB 1B9RA 3KYDD 3R66C 4BZAA 3WAPA 2Y3AA 3AEEB 4DHZB 1RFKA 2DBYA 2H88B 2B3AA 1WJ4A 3NZUA 1VD2A 3UF8A 3EGRA 4HXDA 3VDZA 4AOFA 5BYRA 3QQ8B 1T0YA 1F2RI 2IBIB 2KWCA 2KC2A 2AQ2B 4KGSA 3NG0A 1XD3B 1AN8A 1SGHA 4ZRPA 3RNEC 4ANUA 1R7SA 3TEZA 4W9CA 3M95A 2LRUA 1E8ZA 3GZNB 2MRPA 2KKCA 2K6DB 1SE3A 1UUPA 1ZW7A 1GAQB 1IP9A 4FJYA 4O1NA 5TSSA 3BVZA 4RMAA 3WAOA 3TJPA 5KHQA 1E8YA 2R2QA 2O6VA 3VQIA
chains in the Genus database with same CATH topology
3R8BA 4ZHOA 1D5MC 1E9MA 3DWGC 1FCCC 3B2GA 5HFYA 2WXNA 1DYQA 3AMZA 3KWLA 4YTNB 3SEBA 3T3NA 4OZBA 3BWUD 4XE0A 1K50A 1FEHA 1GB1A 3AE3B 4OZCA 1XF5L 4OW0A 2RDGA 3AE9B 2E6XA 3LB8C 3AECB 2W54A 3W9CB 4D2KA 1C79A 1WGKA 4HRSA 3ZJUA 1XCTL 1F0ZA 3W1SA 4B0EA 1E6EB 1EM7A 1PGAA 2ONQA 2M19A 3Q8FA 4YWGG 1C4CA 4A9AA 2PVGC 1ENFA 1I4RA 3IAM1 3TEXA 3MFGA 2IGGA 3E9SA 4JPSA 4AS1A 1MHHE 4AQ7A 2L52A 1QOBA 4B0MA 2IGDA 2PW9A 1ZP0B 2QJLA 3AE4B 1ET9A 1GB4A 2B76B 2WNMA 1N5WA 2WXOA 3MJ5A 1JRPA 4TMAB 3IXSA 3B9JA 2M0AA 2WXMA 1QOGA 3SR6A 2JSVX 4J3OD 5H8YE 4KKIA 1C4AA 2CJNA 1SJHD 2DYMA 4XDDA 2JYTA 3ZGZA 2TSSA 2JXTA 1KF6B 4DQOC 4FXCA 2WXQA 2SEBD 3W5VB 1PUTA 1XO3A 5BYSA 1I4HA 4MACA 2K0PA 1TS5A 1QQRA 3AEFB 5D3DA 4IDIA 1STEA 2PKOA 1TS3A 1YJJA 2J52A 4GDLB 2RDHA 3TSSA 3P4PB 3CWIA 4USAA 3AE2B 1IBXA 3ZYYX 1V1OA 2IGHA 2VZKB 4RGOS 1FNUA 1L4DB 1DOYA 1ESFA 3LXFA 1FFUA 4ZRQA 3IAS1 3VR8B 2MH7A 2LUMA 5EE0A 1JWMD 1CK1A 1PGXA 1C4PA 4JWUC 1FXIA 2MJDA 1EU4A 3BK2A 1VDVA 3J9CA 4PT5A 3NUHB 5JXVA 2E3TA 1QOFA 2R61A 3Q8AA 1NYRA 1XLPA 2NTTA 2MEKA 1FM0D 1PGBA 1D5ZC 2BS2B 3BIID 1WSPA 1NYQA 3ZJTA 3WCQA 1BMLC 3Q69A 4JWSC 3BVGA 2LMCA 1C9FA 4REZA 1KH0A 1VJKA 1NENB 2IJ0A 3NVYA 4XWTA 2FUG1 3AE6B 3BK1A 3E56A 2LHEA 3U7ZA 2HDEA 5HG2A 3AE1B 4L1BA 1FNWA 1AYFA 4ZHPA 2FE8A 3HVDA 3NVVA 1VZ6A 3VRAB 4ARIA 1DOIA 1TZOA 2OEDA 1JALA 1SXTA 1KFYB 1V1PB 5H92C 3URYA 3P4QB 1YQ3B 4TSSA 1TYGB 1F77A 4UDUC 3IT6B 1E10A 1K51A 4KX6B 2JZPA 1HQRD 4YXDB 5LNK1 1JROA 2N0SB 4CQNA 1MPEA 1N5XA 4NZLB 3EA6A 1L0VB 4M0WA 4KGTA 1L0YB 1N60A 3P1MA 3NRZA 1J7BA 2ON8A 4R3DA 4YT0B 2DLBA 2NMQA 1CZPA 1YJIA 1TKGA 2BYTA 1YN4A 3RPFC 2QEJC 2QMTA 1EWYC 4MM3B 2Y5CA 3FILA 1PFDA 2L32A 3GB1A 2WDQB 3P63A 3Q8BA 1JCKB 2J42A 4JX1C 4GLSC 5FR3A 2J4XA 3AEGB 2H89B 1C78A 4KGRA 2WXIA 1NVID 1YN3A 4YSYB 1CJEA 2WXPA 1MVKA 3NZ3A 2WXFA 2KWDA 1A70A 1YNTE 1V97A 3FAHA 1K53A 1WWTA 1ZUD2 3U4EG 2EKIA 4N6EB 1V8CA 1I4GA 1I4XA 1JMLA 1DGJA 3C8YA 3TEWA 4EE2A 1N62A 1I7HA 2DWQA 1SIJA 1SB3C 4RF0A 1OFFA 1XLOA 1D6EC 2L83A 1HZ6A 3O13A 4LTUA 4OZAA 1XEEA 1ET6A 2BB5A 1RWSA 2BBCA 5BMHA 1GPXA 4L23A 2N9KA 1TS2A 3V05A 4TQ0A 2N7JA 2CU3A 1JWSD 1QKZA 4HEA1 5HI1A 4HJGE 4GDKB 4DXGA 2KMMA 2SAKA 2J53A 2WS3B 2K3UA 2INNE 1EWCA 3I9V1 2V4IB 2LJIA 1I4QA 5EE1A 1QOAA 2YEPF 4LLGM 1Y56A 1RYJA 3GP7A 3VRBB 1HEZE 3ABVB 2MJEA 4N59A 1FRDA 3KQ4A 3L4PA 2GRIA 2WXHA 4MT5A 5AUKA 2PIAA 4OVZA 4LK0M 4XDCA 1F2RC 1VRAB 4WIPA 4DXFA 1YMHE 4YTPB 5D3IB 2LHDA 2QILA 1XLNA 2LEKA 1ZPSA 2WXRA 3SFDB 1JWBD 2KAJA 2WU5B 5FK9C 1MI0A 3ZJVA 2Z8LA 4RCOA 4US9A 3DWMA 1XLQA 3NS1A 5BMGA 4YSZB 4IOIE 1N63A 2BS3B 1TKEA 2BB6A 1C76A 3LYYA 2WLBA 3BYYB 2I38A 1OQRA 4A8XC 1NEKB 1QT9A 1KLGD 3OWEB 1ROEA 3W5UB 3MC0B 5MPOA 2N9LA 2ICIA 3ZQ4A 2WP9B 1ZDXA 1AW7A 3V3XA 1LO5D 1UGJA 4ZOHC 2ACZB 3Q8EA 3AB5A 4OHJA 2FBWB 4A90A 3FC4A 5HHDG 2WDVB 1SJED 3MHZA 1KTKA 1TY0A 5C3JB 4JE3B 1FRRA 2GI9A 1Q10A 2EELA 4WQMA 4RFBA 4YTMB 1IBXB 1L4ZB 5I4DA 2IDYA 3NVWA 2QSDA 4ITKA 4ZYSA 3VR9B 2Y5PA 2V0GA 3TUOA 2NTSA 1L5PA 4P16A 1WRIA 4Q2JA 1UWMA 2ZW1A 3N9YC 1D4BA 1NI3A 2WXGA 2KQ4X 1E0ZA 1J7CA 1IGCA 3PO0A 2PMVA 4N58A 1N61A 1ZE3D 4US8A 1I4PA 1T5XD 3BYTB 4HKZE 3AN1A 2V3NA 4MH8A 3PZ7A 1FXAA 1D5XC 2AQ3B 3R2IA 4C7YA 3RFZB 2PVOD 2W3RA 3HVZA 1IUEA 1WXQA 4NJCA 2WU2B 4KKJA 1FMAD 2HTME 3R2TA 4RGMA 2PLPA 4A6QA 2WDRB 3P4RB 3CIRB 4TQ1A 2MJ3A 2WXKA 2W3SA 1BXTA 2JX5A 3H8HA 1SEBD 2KDMA 2W55A 2X38A 2V3PA 1FCLA 4ARCA 1YN5A 2JQRB 5EE3A 1SSNA 1SE4A 1K52A 1L6VA 4C7ZA 1PYWD 2D5GA 2INPE 3KWVA 2DYOA 1VR9A 2JYEA 2IPKD 3BVMA 2XNAC 2CJOA 3AEDB 4P6VF 3U2SC 3W2DA 5E6JA 2PTLA 3U52E 2L1AA 4L2YA 1ZXHA 3NVZA 1JWUD 1VZ7A 1XXGA 2BT6A 2YEPB 1QLBB 2OHFA 1L0XB 1V1PA 2KN4A 4C80A 5BYQA 1UNSA 5GXGB 3AEBB 4RNAA 3T3OA 2RPVA 4WAFA 2K9XA 2WQYB 4RF1A 5D7GA 2W82A 1M4VA 1TS4A 1TJEA 2LGIA 3MP9A 1XCQL 2KACA 1IGDA 2ZW0A 4RGNA 1FIQA 1FO4A 3HUIA 4IKGA 1T6BX 1KRHA 2G9HD 2G1EA 3AEAB 1YQ4B 1PDXA 1ZDVA 1B9RA 2VZKD 3AV8A 5FKAC 3AE7B 1OQQA 3ETRA 3KLSX 3PZ8A 1JWAD 2AX5A 1CQVA 2XN9C 2Y3AA 3B2FA 1E7PB 3FILB 5G5GA 1J7AA 1JW9D 1VLBA 2AQ1B 1HA5A 3AEEB 1C77A 1SF0A 5G5HA 4NAWB 1DOXA 1HZ5A 1RFKA 1WYGA 2DBYA 2K5PA 2H88B 2JWUA 1TY2A 5C2TB 4WH4A 3AH7A 1T3QA 2Q5WD 1KLUD 4YSXB 5EE9A 5BMIA 4NAMA 1VZ8A 3EGRA 3AM9A 3IT4B 5BYRA 2M56B 1GOZA 1F2RI 1TKYA 2K22A 3HRDD 3GS2A 1UWXA 3EUB2 3Q8CA 1QF6A 2AQ2B 2JU6X 3AE5B 4HKQA 1EU3A 1BUIC 4KGSA 1RM6C 1HXYD 1JQ4A 1SBBB 1L6UA 1AN8A 2WXLA 4WURA 2BS4B 1AWDA 4ZRPA 1R7SA 1MHXA 3SFEB 3TEZA 1SE2A 1ACCA 4A55A 2GB1A 2WXJA 1P7EA 4RH6A 1SE3A 4HROA 2I2YA 2LFIA 5T8IA 3BZDB 4WWMA 1FD6A 1QILA 1UUPA 5AUIA 4XWWA 2RMMA 2BW2A 3P42A 1ZXIA 1GAQB 3TEYA 2BTEA 4O1NA 5TSSA 3BVZA 2QIEB 1B1ZA 1ZOYB 1FFVA 3AE8B 4RGTA 3I57A 1P7FA 4C56C 4H2AA 3VQIA 3P4SB 3UI3A 1FNVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A8X C;  4A6Q A;  2HDE A;  4A90 A; 
#chains in the Genus database with same CATH topology
 1TZ1 A;  4ZHO A;  3Q3O C;  3DWG C;  4JLC A;  3B2G A;  5HFY A;  2WXN A;  4YTN B;  2LVO A;  4OZB A;  1FEH A;  2ZPY A;  2RDG A;  3AE9 B;  4II2 B;  4IG7 B;  4D2K A;  2ZCB A;  2KX3 A;  1EM7 A;  2MQJ A;  2BKR B;  3AI5 A;  3ONS A;  2N7E A;  4WWN A;  2IGG A;  3E9S A;  4KZC A;  4AS1 A;  2L52 A;  1QOB A;  1KLV A;  3PLU A;  2IGD A;  2PW9 A;  4XC2 A;  2QJL A;  1ET9 A;  1YJ1 A;  1WMH A;  1N5W A;  3NY5 A;  3IXS A;  1WRD B;  3SR6 A;  2JSV X;  5H8Y E;  3OG5 A;  1SJH D;  2LGD A;  4DQO C;  5GMV A;  1I4H A;  4MAC A;  2K0P A;  1TS5 A;  4DHJ D;  4EOY A;  2IZV B;  4IDI A;  2DX5 B;  3N1X C;  1STE A;  2V3S A;  4NJ7 A;  4E71 A;  3TSS A;  4USA A;  4WWO A;  5D94 A;  2VZK B;  2IGH A;  1FNU A;  1YX5 B;  5EE0 A;  1JWM D;  4N9F 4;  1FXI A;  3ZO5 B;  1GC7 A;  4PT5 A;  1VDV A;  5JXV A;  3Q3F A;  4NPN A;  1NYR A;  3JVZ X;  2IO3 B;  2MEK A;  4W9J A;  1TBE A;  3ZJT A;  1BML C;  2L3Z A;  4JWS C;  2LMC A;  4S0R A;  1VJK A;  2IYD B;  1NEN B;  2FUG 1;  1GC6 A;  1P3Q U;  3QC8 B;  5HG2 A;  3AE1 B;  4ZHP A;  2JXX A;  3HVD A;  4DDI D;  2CHW A;  1SXT A;  3URY A;  2MBO A;  3P4Q B;  1YQ3 B;  1KM7 A;  1OQY A;  1UZX B;  1Q5W B;  3DBH I;  3H7S A;  4YXD B;  4NY0 A;  2J0K A;  2M0X A;  1WGH A;  2DEN B;  3DBL B;  4KGT A;  3ZNI D;  3GZN I;  2ON8 A;  3RPF C;  2QEJ C;  1TGZ B;  3TBL D;  2J42 A;  4NAW A;  1NBF C;  2FNJ B;  1V2Y A;  4JIO U;  4KGR A;  1Q0W B;  1NVI D;  2KQ7 A;  4F8C B;  3N30 A;  2AEH A;  4K3B A;  2WXP A;  1MVK A;  5IA7 A;  1GUA B;  1WWT A;  1XT9 B;  4G0N B;  4XYC A;  4ZYN A;  4C4V A;  1I4X A;  1WJN A;  3EC8 A;  1WE6 A;  4BKS D;  3C8Y A;  3CF6 E;  1N62 A;  4IWO A;  4FLH A;  3H7P A;  2PE9 A;  1XEE A;  3QA8 A;  4EFO A;  1GPX A;  1ISN A;  4L23 A;  2N9K A;  4ZRK A;  3V05 A;  3L16 A;  1QKZ A;  4PK1 A;  5HI1 A;  2NPT B;  2BWE S;  2K3U A;  4XZ4 A;  4MEL A;  4KSL C;  2BVC A;  1QOA A;  2YEP F;  3VRB B;  2C7M B;  3R3M A;  3O65 B;  1HEZ E;  2MP2 B;  3L08 A;  5AUK A;  4MT5 A;  4OVZ A;  4LK0 M;  4GN1 A;  4DXF A;  1YD8 U;  2VRR B;  3NJT A;  2LEK A;  4MH0 E;  2WU5 B;  1MI0 A;  2ZNV C;  1XLQ A;  3PGE A;  1WR6 E;  4PS7 A;  2OJW A;  3ZNG C;  1TKE A;  2KLC A;  2WLB A;  3BYY B;  3DHG C;  1OQR A;  4FBJ B;  3NZS A;  4AWJ A;  3ZRC A;  1KLG D;  5MPO A;  3HHM A;  2RDB C;  3I63 C;  2LI5 A;  2N9L A;  4P1B C;  3OAW A;  1TTN A;  1UGJ A;  3I3T B;  3Q8E A;  2EKE C;  5HHD G;  3DDC B;  3WIM A;  1KTK A;  1TY0 A;  1IBX B;  1L4Z B;  5I4D A;  2DZK A;  2QSD A;  4ITK A;  1ZKH A;  3VR9 B;  1YX6 B;  2NTS A;  4LNN A;  5TR5 A;  3N9Y C;  1D4B A;  4AJW A;  2WXG A;  3H6N A;  1E0Z A;  1IGC A;  4N58 A;  1Z5S B;  5JH5 C;  1I4P A;  2FIF A;  2V3N A;  4GMV A;  2V1Y A;  3QIJ A;  2HE7 A;  4A3P A;  4B9K A;  4LDT B;  1MFW A;  2KDI A;  2PLP A;  3T8M A;  4A6Q A;  2D3B A;  3CIR B;  3DBL I;  4TQ1 A;  1R4N B;  2JX5 A;  1EF5 A;  1SEB D;  2X38 A;  1QZE A;  1YN5 A;  5EE3 A;  1K52 A;  3TMP B;  1L6V A;  4C7Z A;  1PYW D;  2D5G A;  2INP E;  1WH3 A;  2V4L A;  5LLI A;  3Q3M C;  1UF0 A;  3U2S C;  4MGY E;  1ZXH A;  3QHT A;  4M01 A;  1JWU D;  2YEP B;  3A9K B;  3ZDM C;  3RUI B;  1V1P A;  4C80 A;  3BIN A;  3T3O A;  2RPV A;  1UD7 A;  3M3J A;  1M94 A;  2KOX A;  2LGI A;  4M00 A;  1XCQ L;  4M0W B;  4RGN A;  3HUI A;  4IKG A;  4FUL A;  1T6B X;  2O2V A;  4KIK B;  2G1E A;  1PDX A;  2VZK D;  1AAR A;  5FKA C;  4DXA B;  5G55 A;  1WZ0 A;  3ETR A;  3PHX B;  3TL5 A;  1CQV A;  2XN9 C;  4KV2 A;  1E7P B;  1JW9 D;  1VLB A;  2AQ1 B;  1HA5 A;  5G5H A;  1DOX A;  2JWU A;  1TY2 A;  5C2T B;  4F1S A;  4MJS A;  2XK5 B;  3VHT C;  2Q5W D;  4MM3 A;  4FAD A;  5BMI A;  2DZI A;  3AM9 A;  2M56 B;  1TKY A;  3QJZ A;  2PE6 B;  1P9D U;  2JU6 X;  2RGF A;  3AE5 B;  5E6O A;  1EU3 A;  1GG3 A;  3A4S C;  2BKF A;  2MCN B;  3MC8 A;  1SBB B;  4EZJ A;  4HPP A;  2WXL A;  4WUR A;  2BS4 B;  1AWD A;  1RLF A;  3UQA A;  1MHX A;  2FCS A;  4WJN A;  1VCB A;  3KW5 B;  4AUQ C;  2WXJ A;  4RH6 A;  2PEA A;  2KAN A;  2I2Y A;  2D3C A;  1QIL A;  1WXS A;  4XWW A;  2RMM A;  2BTE A;  2GLS A;  2QIE B;  1B1Z A;  1ZOY B;  3AE8 B;  5HKH A;  4C56 C;  1YQB A;  4LNK A;  1RFA A;  4IM2 A;  1WM2 A;  3P4S B;  2XBB C;  1V5T A;  3R8B A;  1D5M C;  1E9M A;  2AYO B;  2KZR A;  1FCC C;  2JT4 B;  1YIW A;  4W9K A;  1DYQ A;  3SEB A;  2KFJ A;  1K50 A;  3UQB A;  1GB1 A;  3AE3 B;  4P7I A;  3VAW A;  4W9F A;  3CMM B;  2N1W A;  4HCP B;  2E6X A;  4I6L B;  3LB8 C;  3W9C B;  1U4A A;  3DVN U;  5E6P A;  3AXC A;  1F0Z A;  3RN9 C;  2M19 A;  3N20 C;  1WGG A;  4YWG G;  1WI0 A;  4A9A A;  1ENF A;  1WJ6 A;  3IAM 1;  3MFG A;  1X1M A;  1R4M B;  4AQ7 A;  3L54 A;  1WX7 A;  2LJ5 A;  3N3K B;  3QCA A;  1ZP0 B;  3AE4 B;  2B76 B;  2W9N A;  3B1L X;  4TMA B;  1L2N A;  2RD0 A;  3N1Z C;  3P2B A;  2N9E B;  2KO3 A;  2NR2 A;  3DVG Y;  4KKI A;  1C4A A;  2CJN A;  2DYM A;  3QK0 A;  3ZGZ A;  4ZRJ A;  2TSS A;  2JXT A;  4FJV B;  5IN7 A;  1K8R B;  5BYS A;  1LQB A;  2ZPN A;  1LFD A;  1NI2 A;  4DK5 A;  2IY0 B;  1YJJ A;  2KN5 A;  3ZVV A;  3P4P B;  3CWI A;  2KTR B;  3AE2 B;  2G3Q B;  1V1O A;  2NCN A;  4RGO S;  1I35 A;  1DOY A;  4GU2 A;  4AJY B;  1ESF A;  5IOI A;  2GBR A;  3LXF A;  2MHJ A;  4ZRQ A;  2MH7 A;  3NS8 A;  3MHS D;  2K25 A;  4P1C C;  1PGX A;  4JWU C;  1EU4 A;  3BK2 A;  3J9C A;  3NUH B;  2PJH A;  2AL6 A;  1XLP A;  1FM0 D;  2BS2 B;  3BII D;  1N6Z A;  2QCZ A;  3H1U A;  2C7N B;  4G50 A;  5C23 A;  4JGH B;  3BVG A;  4REZ A;  1KH0 A;  3DBH B;  2KHW B;  3R7Q A;  2X8X X;  4HDQ A;  1GNU A;  5D6J B;  2ZEQ A;  2FE8 A;  2GOW A;  3VRA B;  3PLV A;  1DOI A;  4RM8 A;  1P1A A;  4PS3 A;  1TYG B;  1F77 A;  4BVU C;  4ACF A;  2L76 A;  3OJ4 B;  1K51 A;  4KX6 B;  3RZW C;  3V61 A;  2JZP A;  3BY4 B;  2IO1 B;  2JZZ A;  2KMA A;  5LNK 1;  1JRO A;  3R7R A;  4CQN A;  2DAF A;  2KTF A;  1L0Y B;  3MJW A;  1XQQ A;  3NRZ A;  3TIX A;  2C60 A;  1CZP A;  3SHQ A;  2QMT A;  3PPA A;  2L32 A;  3P63 A;  2WDQ B;  3IVF A;  1JCK B;  4LDT D;  2KDE B;  4GLS C;  5IO9 A;  3SDL C;  3S2A A;  3HM3 A;  1YN3 A;  4YSY B;  2MW5 A;  4OVU A;  4MDK E;  4F7Z A;  2WXF A;  2KWD A;  1A5R A;  2GMI C;  1OEY A;  3ENE A;  3VFK A;  1WR1 A;  5AEK B;  3ZTD A;  1I7H A;  2DWQ A;  3ZRF A;  4RF0 A;  2L83 A;  2ZZP B;  3RI7 C;  2BB5 A;  2BBC A;  2N7D A;  1R4M I;  3L10 B;  4TQ0 A;  3Q14 C;  4PYZ A;  5AZH A;  2IO0 B;  4HJG E;  4GDK B;  3PS6 A;  2INN E;  2CHZ A;  3I9V 1;  3HIZ A;  1I4Q A;  4LLG M;  1Y56 A;  2LGY A;  1T0Q C;  1OEY J;  4W9E A;  1E90 A;  2MJE A;  4N59 A;  3KQ4 A;  2WXH A;  4XDC A;  3CST A;  4FJZ A;  4EKU A;  2ZNV B;  3APC A;  5D3I B;  3DBS A;  2NBU A;  2WXR A;  1JWB D;  3VH3 B;  2Z8L A;  3DWM A;  5IKC M;  4YSZ B;  2DHZ A;  2AL3 A;  2DZJ A;  4GB9 A;  2M1M A;  2K8H A;  1QT9 A;  3JYU A;  2KD0 A;  2FCM A;  4AP4 C;  1WGR A;  2A5U A;  2C9W B;  4B95 A;  1TT5 B;  4ZOH C;  1ZGU B;  2M8S A;  3H7P B;  4HLE A;  3PHW B;  3KUZ A;  4A90 A;  4M8N A;  1SJE D;  3ZNH B;  4JE3 B;  4E3C A;  2GI9 A;  3EFU A;  2EEL A;  4HCN B;  3KUC B;  4YTM B;  2IDY A;  4ZDV A;  1UH6 A;  2HD5 B;  3NVW A;  1IPG A;  1PQS A;  4K7S A;  3VXW A;  2V0G A;  3TUO A;  1RAX A;  2ZW1 A;  1J7C A;  3RYT A;  2WX1 A;  1BT0 A;  2N9X A;  1ZE3 D;  3CSF A;  1J19 A;  2R2O A;  1WY8 A;  4MH8 A;  3PZ7 A;  5AZG A;  4C7Y A;  2PVO D;  4TUU A;  2LVQ A;  1LGR A;  4RGM A;  1FMA D;  3R2T A;  2WDR B;  3DVN V;  5AZF A;  2D3G A;  2XEW A;  3VH4 B;  2W3S A;  1BXT A;  3NHE B;  3H8H A;  3OJ3 A;  5CHW A;  2KDM A;  2W55 A;  2QHO A;  3V60 A;  4ARC A;  1OGW A;  2K1F A;  2V9H A;  4JQW C;  2GBN A;  4HWI B;  1VR9 A;  2JYE A;  3BVM A;  2XNA C;  2CJO A;  3W2D A;  4L2Y A;  2CHX A;  3FKY A;  3PRP B;  1XXG A;  2BT6 A;  4IM0 A;  4K7U A;  2LRW A;  3AEB B;  2KC1 A;  1WFY A;  4M02 A;  5D7G A;  2W82 A;  1M4V A;  3A33 B;  1TJE A;  3MP9 A;  2CR5 A;  1EF1 A;  2L8J A;  4LNO A;  2KMC A;  3ZW3 A;  1FXT B;  1ZDV A;  1H8C A;  3AV8 A;  4MSQ B;  1JRU A;  3AE7 B;  1OQQ A;  3KLS X;  3UIN B;  1EUV B;  3LJ3 A;  3PZ8 A;  1E8W A;  3L17 A;  3FIL B;  2BPS A;  3B2F A;  5G5G A;  1J7A A;  3V6C B;  1SF0 A;  1HZ5 A;  1WYG A;  2K5P A;  5L83 A;  4WH4 A;  2I1K A;  2HTH A;  1KLU D;  4YSX B;  5EE9 A;  4MGI E;  1P0R A;  4NAM A;  1VZ8 A;  3IT4 B;  1GOZ A;  2K22 A;  3Q8C A;  1WGY A;  3RNB C;  2LGS A;  1C1Y B;  4XX5 A;  1WXA A;  1BUI C;  2LVP A;  1JQ4 A;  1L6U A;  4DDG D;  5LXI B;  2MBE A;  4HRO A;  2VH2 A;  5T8I A;  3BZD B;  4WWM A;  1FD6 A;  3MC9 A;  5AUI A;  2BW2 A;  3P42 A;  3TEY A;  1FFV A;  3I57 A;  1P7F A;  2KT7 A;  4H2A A;  5E6N A;  2NBW B;  1L7Y A;  2NPT A;  5IAA C;  3AMZ A;  3KWL A;  3T3N A;  3LDZ E;  4ICV A;  3OLM D;  5EDS A;  4OZC A;  2MP2 A;  1XF5 L;  4OW0 A;  4W9L A;  3RUL A;  5C1Z A;  2K39 A;  2W54 A;  4MJS B;  4A20 A;  1C79 A;  1WGK A;  3JSV B;  3ZJU A;  1XCT L;  3W1S A;  3GE8 C;  1PGA A;  3AU4 A;  3Q8F A;  1C4C A;  1RRB A;  5CHV C;  3ZUN A;  2AWT A;  3TEX A;  1MHH E;  2IO2 B;  1H4R A;  4B0M A;  3RNG C;  1GB4 A;  3A9J B;  3MJ5 A;  1JRP A;  3B9J A;  2M0A A;  3T9L A;  3Q3J A;  4J3O D;  4BKG A;  3SU8 X;  1KF6 B;  2WXQ A;  4EEW A;  2K6Q A;  2NVU I;  1PUT A;  1XO3 A;  1QQR A;  2L0F A;  2LGX A;  2PKO A;  1TS3 A;  4WJP A;  4GDL B;  2RDH A;  4W9D A;  1IBX A;  3ZYY X;  1UBQ A;  3HM6 X;  3VTU A;  4I6P A;  4NQK E;  4W9H A;  2MX2 A;  1CK1 A;  2N1V A;  2MJD A;  4ANV A;  2JRH A;  3Q8A A;  2NTT A;  4NQL B;  1V86 A;  1D5Z C;  4K3C A;  1WSP A;  1KJT A;  3A1Q A;  2MBQ A;  3EEC A;  2IJ0 A;  3NVY A;  4XWT A;  2K8C A;  2LHE A;  3E56 A;  3U7Z A;  3W1S C;  2J0M A;  5LXH A;  4HDO A;  1FNW A;  1AYF A;  3NVV A;  1VZ6 A;  1TZO A;  1V81 A;  3ML8 A;  4BOZ B;  1V49 A;  1KFY B;  4UDU C;  3RD2 A;  4FN2 A;  4YL8 A;  4G11 A;  4KVG B;  1LM8 B;  5KHO A;  3AUL A;  2GBJ A;  4BAX A;  3U7D A;  5DPR A;  1MPE A;  1N5X A;  1NDD A;  3EA6 A;  1L0V B;  4M0W A;  1UBI A;  1N60 A;  4KIK A;  1J7B A;  2DLB A;  1YJI A;  2BYT A;  1YN4 A;  2BQQ A;  1EWY C;  4QAY A;  2Y5C A;  1PFD A;  1WZ3 A;  5FR3 A;  2KK8 A;  3AEG B;  1C78 A;  2XK5 A;  3ML9 A;  1S3S G;  3KVF B;  2IND C;  2UYZ B;  2J0J A;  3DBR I;  4IWQ A;  4PS8 A;  1F9J A;  1YNT E;  2KFK A;  1V97 A;  5DPS A;  4WWP A;  1I4G A;  1F1H A;  3DOW A;  2G45 B;  3QAR A;  1JML A;  2FAZ A;  2KWV B;  1DGJ A;  4HVB A;  1SB3 C;  2MA9 B;  1OFF A;  1XLO A;  1HZ6 A;  4LTU A;  2FID A;  4OZA A;  1WXV A;  5BMH A;  1TIF A;  1TS2 A;  2CU3 A;  2O6V B;  5DPT A;  1JWS D;  2N9P C;  2KX0 A;  3A4R A;  2K8B A;  2SAK A;  2J53 A;  2WS3 B;  1EWC A;  4X57 B;  4JL9 A;  2KWU B;  5L95 C;  4K81 A;  3MTN B;  1FRD A;  2GRI A;  3WA0 A;  2LUE A;  2PIA A;  1F2R C;  4WIP A;  3M62 B;  1KOT A;  4A3O A;  2EMS A;  4YTP B;  2LHD A;  2QIL A;  2DNF A;  1XLN A;  3DPD A;  2D2Q A;  1C3T A;  3VUX A;  3SFD B;  2KAJ A;  1HE8 A;  4RCO A;  3WAM A;  2L0T A;  3NS1 A;  4CHK A;  4IOI E;  1N63 A;  2BS3 B;  3DHH C;  2DAJ A;  4GSW A;  4ASW C;  1WMH B;  4BKS A;  1P98 A;  1ROE A;  3W5U B;  3IFW B;  3MC0 B;  3ZDT A;  4NJ6 A;  4I6N B;  1ZDX A;  1AW7 A;  4S17 A;  1LO5 D;  5J18 A;  4DHZ E;  2KLG A;  4GIV A;  3PRE A;  2WDV B;  3ZXR A;  1Q10 A;  4WQM A;  3ALB A;  3KYC D;  3RMK C;  4ZYS A;  1L5P A;  1NI3 A;  4EUT A;  2KNB A;  2KTR A;  4LJP B;  2JPH A;  2JF5 A;  4US8 A;  3V6E B;  3R2I A;  4K7W A;  3WAN A;  3RFZ B;  2JVC A;  2W3R A;  1IUE A;  1WXQ A;  2JUO A;  2EMT A;  4KKJ A;  2HTM E;  3IG3 A;  4HPL B;  3APD A;  2WXK A;  3NOB A;  1WIA A;  4II3 B;  2V3P A;  1FCL A;  1WXM A;  2DYO A;  2L00 B;  4EZK A;  5E6J A;  2PTL A;  4ANX A;  2L1A A;  3NVZ A;  2CKH B;  1VZ7 A;  1V80 A;  1QLB B;  2OHF A;  2KN4 A;  1UNS A;  3VUY A;  1S1Q B;  3DHI C;  3K9O B;  4WAF A;  1Q1O A;  1E7V A;  3WAL A;  4TV3 A;  2N4F A;  1IGD A;  2ZW0 A;  1FIQ A;  1MJD A;  4IUM B;  1FO4 A;  5CTR C;  2MBB B;  1YQ4 B;  3ZKJ C;  3DVG X;  3N1Y C;  3QX1 A;  4IWP A;  2ZCC A;  3UIP B;  1T0S C;  1WX9 A;  2FUH B;  1JWA D;  2AX5 A;  1C77 A;  4NAW B;  3U8Z A;  2Y5B B;  2NBV B;  3AH7 A;  1T3Q A;  3UGB B;  1UGM A;  2BYV E;  2WYQ A;  1WF9 A;  1Y8R C;  2BWF A;  2L05 A;  3HRD D;  3GS2 A;  1UWX A;  3IHP C;  3EUB 2;  1QF6 A;  4E74 A;  2WHI A;  4IW0 A;  4HKQ A;  2OOB B;  4C4V B;  2KQS A;  1RM6 C;  1HXY D;  4BFR A;  1SE9 A;  4ZRI A;  1G6J A;  3SFE B;  1YOV B;  3U30 A;  3X0W A;  3PVL A;  1SE2 A;  1ACC A;  4A55 A;  2GB1 A;  2WGS A;  4KSK C;  1P7E A;  3TCA A;  2L7R A;  2LFI A;  2LWP A;  3L0W B;  2IY1 B;  1ZXI A;  4FHJ A;  3GE3 C;  4BKT A;  4RGT A;  5G2N A;  3UI3 A;  2NS5 A;  1V9J A;  1FNV A;  2RSU A;  4GDK A;  2RPQ A;  2HJ1 A;  3JW0 X;  3BWU D;  2BF8 B;  4XE0 A;  2Z0E B;  2LD9 A;  2DYB A;  1E8X A;  3AEC B;  4ANW A;  2A4Z A;  2MWS B;  2Z59 B;  4HRS A;  1EO6 A;  4GOC A;  4B0E A;  1E6E B;  3PSE B;  2REX A;  2ONQ A;  4BOS C;  4K1R B;  3GOE A;  3Q2A C;  2PVG C;  2UU7 A;  3VUW A;  1I4R A;  2QC8 A;  1LXD A;  3Q3N C;  2KJR A;  4JPS A;  3PT2 B;  2WNM A;  2WXO A;  4TKN A;  2WXM A;  2JY6 A;  1QOG A;  4W9G A;  3H9D A;  4XDD A;  3PZD A;  2JYT A;  4FXC A;  4C00 A;  3APF A;  4NNJ B;  2SEB D;  3W5V B;  3ZTC A;  4BBN F;  1IYF A;  3AEF B;  5D3D A;  4MGK E;  3RZF A;  1J0G A;  1OTR B;  2M17 A;  2J52 A;  2O6V D;  3IBE A;  2KDF B;  2KVR A;  1L4D B;  4M8M A;  4LNI A;  1FFU A;  4IC7 B;  4PYU A;  5FR6 A;  5J2R A;  2VH1 A;  3EHV A;  3IAS 1;  3VR8 B;  4IM3 A;  2LUM A;  5CHF A;  4WJQ A;  1WYW B;  1C4P A;  2ASQ A;  1WGD A;  1SIF A;  2E3T A;  4LNF A;  1QOF A;  2GBM A;  4GGQ A;  2R61 A;  2UWQ A;  2RR9 A;  4HPM B;  1PGB A;  2ZVN A;  1NYQ A;  3WCQ A;  1CMX B;  3Q69 A;  1C9F A;  4KDI C;  2D11 A;  1F52 A;  2LXA A;  4MSM B;  3AE6 B;  2M4N A;  3BK1 A;  3M63 B;  4WAA A;  2FCQ A;  2HDE A;  2QDF A;  4DWF A;  4L1B A;  2LZ6 A;  1GJZ A;  2YLM A;  2D10 A;  4XGA B;  2WWZ A;  4ARI A;  2OED A;  1HTQ A;  1JAL A;  4G3X B;  1V1P B;  5H92 C;  4TSS A;  4ICU A;  3PV1 A;  3IT6 B;  2JWZ A;  3RNF C;  2J7Q B;  1E10 A;  1HQR D;  2O2V B;  3RNC C;  2INC C;  2N0S B;  3DBR B;  3PRM B;  4NZL B;  3K9P B;  3VTV A;  2MSE D;  3P1M A;  3KH0 A;  4R3D A;  4YT0 B;  2NMQ A;  1E5W A;  1TKG A;  3B0A A;  4KZ0 A;  4MM3 B;  3FIL A;  3GB1 A;  1I42 A;  3Q8B A;  4JX1 C;  3L13 A;  2J4X A;  2H89 B;  4WQO B;  2WXI A;  1CJE A;  2LAS A;  3A1Q B;  2KXJ A;  3NZ3 A;  2BYE A;  4B6W A;  1A70 A;  3FAH A;  1K53 A;  1ZUD 2;  3VVW B;  4FHK A;  3U4E G;  2C5L C;  2EKI A;  4N6E B;  1V8C A;  3ZNZ B;  5IP4 D;  2YVC A;  3TEW A;  4EE2 A;  5JHB A;  4WJO A;  1SIJ A;  1D6E C;  3O13 A;  2FCN A;  1WM3 A;  1ET6 A;  4DHJ B;  3SD5 A;  1RWS A;  5D2M B;  1FPY A;  2N7J A;  3RNA C;  4HEA 1;  1WX8 A;  2ZJD A;  2CS4 A;  3DQV A;  2KMM A;  4DXG A;  3EFC A;  2JRI B;  2V4I B;  1T0R C;  2LJI A;  5EE1 A;  3B08 A;  4GXB A;  5DCN A;  1RYJ A;  3GP7 A;  3PRZ A;  3ABV B;  1HTO A;  3D32 A;  3L4P A;  3VTW A;  2KJH B;  2D07 B;  1VRA B;  3W1Y A;  3N32 A;  1YMH E;  1ZPS A;  4CYE A;  1J8C A;  5FK9 C;  3ZJV A;  4US9 A;  2DZM A;  3JSV A;  5BMG A;  3QAQ A;  1UEL A;  2HJ8 A;  4RM9 A;  4OVV A;  2BB6 A;  1C76 A;  3LYY A;  2Z0D B;  2I38 A;  2LXC A;  2JZ3 B;  1V5O A;  4A8X C;  2KFK B;  3RCZ A;  1NEK B;  2CU1 A;  3C0R B;  5CX3 A;  3OWE B;  1Z2M A;  4HJK A;  2D3A A;  4LJO B;  4MEM A;  4CO7 A;  2BGF A;  3DCG A;  2WDT B;  2ICI A;  3A9J A;  3ZQ4 A;  2WP9 B;  3V3X A;  2KDB A;  2ACZ B;  2I1J A;  3A9K A;  3AB5 A;  2MLB A;  5DPW A;  4OHJ A;  2FBW B;  4EZL A;  3FC4 A;  3MHZ A;  4LCD E;  5C3J B;  4URK A;  1FRR A;  4KDL B;  2KJ6 A;  4RFB A;  4HK2 A;  2ZVO A;  2C7H A;  3KUD B;  4J6I A;  2OJR A;  2Y5P A;  4P16 A;  4Q2J A;  1WRI A;  1UWM A;  4GDL A;  5BO4 B;  2KQ4 X;  1V6E A;  2PMV A;  3AU5 A;  3PO0 A;  1N61 A;  4MGZ E;  5J17 A;  1T5X D;  3BYT B;  4HKZ E;  1D3Z A;  3AN1 A;  3X23 A;  1FXA A;  1D5X C;  2AQ3 B;  2MBH A;  4W9I A;  1WJU A;  3HVZ A;  4NJC A;  2WU2 B;  3ECI A;  3C19 A;  2G4S A;  3P4R B;  5JHA A;  3QWZ B;  2MJ3 A;  3ZIM A;  1MG8 A;  2KYW A;  2JQR B;  2KVZ A;  3I5J C;  1SSN A;  1SE4 A;  2G4D B;  3KWV A;  3UIO B;  4BBN C;  2IPK D;  2WX0 A;  2GBK A;  3AED B;  4P6V F;  3U52 E;  5JZE B;  1MG4 A;  2BYF A;  3Q6B A;  4FA6 A;  1E7U A;  3ZLZ A;  3ZXV A;  1R4N I;  1L0X B;  4DBG A;  5BYQ A;  5GXG B;  4RNA A;  3HK0 A;  2K9X A;  2WQY B;  4RF1 A;  1TS4 A;  1WE7 A;  3RT3 B;  2KAC A;  2PPH A;  3V62 A;  1KRH A;  3PTF C;  2G9H D;  3AEA B;  1B9R A;  3KYD D;  3R66 C;  4BZA A;  3WAP A;  2Y3A A;  3AEE B;  4DHZ B;  1RFK A;  2DBY A;  2H88 B;  2B3A A;  1WJ4 A;  3NZU A;  1VD2 A;  3UF8 A;  3EGR A;  4HXD A;  3VDZ A;  4AOF A;  5BYR A;  3QQ8 B;  1T0Y A;  1F2R I;  2IBI B;  2KWC A;  2KC2 A;  2AQ2 B;  4KGS A;  3NG0 A;  1XD3 B;  1AN8 A;  1SGH A;  4ZRP A;  3RNE C;  4ANU A;  1R7S A;  3TEZ A;  4W9C A;  3M95 A;  2LRU A;  1E8Z A;  3GZN B;  2MRP A;  2KKC A;  2K6D B;  1SE3 A;  1UUP A;  1ZW7 A;  1GAQ B;  1IP9 A;  4FJY A;  4O1N A;  5TSS A;  3BVZ A;  4RMA A;  3WAO A;  3TJP A;  5KHQ A;  1E8Y A;  2R2Q A;  2O6V A;  3VQI A; 
#chains in the Genus database with same CATH homology
 3R8B A;  4ZHO A;  1D5M C;  1E9M A;  3DWG C;  1FCC C;  3B2G A;  5HFY A;  2WXN A;  1DYQ A;  3AMZ A;  3KWL A;  4YTN B;  3SEB A;  3T3N A;  4OZB A;  3BWU D;  4XE0 A;  1K50 A;  1FEH A;  1GB1 A;  3AE3 B;  4OZC A;  1XF5 L;  4OW0 A;  2RDG A;  3AE9 B;  2E6X A;  3LB8 C;  3AEC B;  2W54 A;  3W9C B;  4D2K A;  1C79 A;  1WGK A;  4HRS A;  3ZJU A;  1XCT L;  1F0Z A;  3W1S A;  4B0E A;  1E6E B;  1EM7 A;  1PGA A;  2ONQ A;  2M19 A;  3Q8F A;  4YWG G;  1C4C A;  4A9A A;  2PVG C;  1ENF A;  1I4R A;  3IAM 1;  3TEX A;  3MFG A;  2IGG A;  3E9S A;  4JPS A;  4AS1 A;  1MHH E;  4AQ7 A;  2L52 A;  1QOB A;  4B0M A;  2IGD A;  2PW9 A;  1ZP0 B;  2QJL A;  3AE4 B;  1ET9 A;  1GB4 A;  2B76 B;  2WNM A;  1N5W A;  2WXO A;  3MJ5 A;  1JRP A;  4TMA B;  3IXS A;  3B9J A;  2M0A A;  2WXM A;  1QOG A;  3SR6 A;  2JSV X;  4J3O D;  5H8Y E;  4KKI A;  1C4A A;  2CJN A;  1SJH D;  2DYM A;  4XDD A;  2JYT A;  3ZGZ A;  2TSS A;  2JXT A;  1KF6 B;  4DQO C;  4FXC A;  2WXQ A;  2SEB D;  3W5V B;  1PUT A;  1XO3 A;  5BYS A;  1I4H A;  4MAC A;  2K0P A;  1TS5 A;  1QQR A;  3AEF B;  5D3D A;  4IDI A;  1STE A;  2PKO A;  1TS3 A;  1YJJ A;  2J52 A;  4GDL B;  2RDH A;  3TSS A;  3P4P B;  3CWI A;  4USA A;  3AE2 B;  1IBX A;  3ZYY X;  1V1O A;  2IGH A;  2VZK B;  4RGO S;  1FNU A;  1L4D B;  1DOY A;  1ESF A;  3LXF A;  1FFU A;  4ZRQ A;  3IAS 1;  3VR8 B;  2MH7 A;  2LUM A;  5EE0 A;  1JWM D;  1CK1 A;  1PGX A;  1C4P A;  4JWU C;  1FXI A;  2MJD A;  1EU4 A;  3BK2 A;  1VDV A;  3J9C A;  4PT5 A;  3NUH B;  5JXV A;  2E3T A;  1QOF A;  2R61 A;  3Q8A A;  1NYR A;  1XLP A;  2NTT A;  2MEK A;  1FM0 D;  1PGB A;  1D5Z C;  2BS2 B;  3BII D;  1WSP A;  1NYQ A;  3ZJT A;  3WCQ A;  1BML C;  3Q69 A;  4JWS C;  3BVG A;  2LMC A;  1C9F A;  4REZ A;  1KH0 A;  1VJK A;  1NEN B;  2IJ0 A;  3NVY A;  4XWT A;  2FUG 1;  3AE6 B;  3BK1 A;  3E56 A;  2LHE A;  3U7Z A;  2HDE A;  5HG2 A;  3AE1 B;  4L1B A;  1FNW A;  1AYF A;  4ZHP A;  2FE8 A;  3HVD A;  3NVV A;  1VZ6 A;  3VRA B;  4ARI A;  1DOI A;  1TZO A;  2OED A;  1JAL A;  1SXT A;  1KFY B;  1V1P B;  5H92 C;  3URY A;  3P4Q B;  1YQ3 B;  4TSS A;  1TYG B;  1F77 A;  4UDU C;  3IT6 B;  1E10 A;  1K51 A;  4KX6 B;  2JZP A;  1HQR D;  4YXD B;  5LNK 1;  1JRO A;  2N0S B;  4CQN A;  1MPE A;  1N5X A;  4NZL B;  3EA6 A;  1L0V B;  4M0W A;  4KGT A;  1L0Y B;  1N60 A;  3P1M A;  3NRZ A;  1J7B A;  2ON8 A;  4R3D A;  4YT0 B;  2DLB A;  2NMQ A;  1CZP A;  1YJI A;  1TKG A;  2BYT A;  1YN4 A;  3RPF C;  2QEJ C;  2QMT A;  1EWY C;  4MM3 B;  2Y5C A;  3FIL A;  1PFD A;  2L32 A;  3GB1 A;  2WDQ B;  3P63 A;  3Q8B A;  1JCK B;  2J42 A;  4JX1 C;  4GLS C;  5FR3 A;  2J4X A;  3AEG B;  2H89 B;  1C78 A;  4KGR A;  2WXI A;  1NVI D;  1YN3 A;  4YSY B;  1CJE A;  2WXP A;  1MVK A;  3NZ3 A;  2WXF A;  2KWD A;  1A70 A;  1YNT E;  1V97 A;  3FAH A;  1K53 A;  1WWT A;  1ZUD 2;  3U4E G;  2EKI A;  4N6E B;  1V8C A;  1I4G A;  1I4X A;  1JML A;  1DGJ A;  3C8Y A;  3TEW A;  4EE2 A;  1N62 A;  1I7H A;  2DWQ A;  1SIJ A;  1SB3 C;  4RF0 A;  1OFF A;  1XLO A;  1D6E C;  2L83 A;  1HZ6 A;  3O13 A;  4LTU A;  4OZA A;  1XEE A;  1ET6 A;  2BB5 A;  1RWS A;  2BBC A;  5BMH A;  1GPX A;  4L23 A;  2N9K A;  1TS2 A;  3V05 A;  4TQ0 A;  2N7J A;  2CU3 A;  1JWS D;  1QKZ A;  4HEA 1;  5HI1 A;  4HJG E;  4GDK B;  4DXG A;  2KMM A;  2SAK A;  2J53 A;  2WS3 B;  2K3U A;  2INN E;  1EWC A;  3I9V 1;  2V4I B;  2LJI A;  1I4Q A;  5EE1 A;  1QOA A;  2YEP F;  4LLG M;  1Y56 A;  1RYJ A;  3GP7 A;  3VRB B;  1HEZ E;  3ABV B;  2MJE A;  4N59 A;  1FRD A;  3KQ4 A;  3L4P A;  2GRI A;  2WXH A;  4MT5 A;  5AUK A;  2PIA A;  4OVZ A;  4LK0 M;  4XDC A;  1F2R C;  1VRA B;  4WIP A;  4DXF A;  1YMH E;  4YTP B;  5D3I B;  2LHD A;  2QIL A;  1XLN A;  2LEK A;  1ZPS A;  2WXR A;  3SFD B;  1JWB D;  2KAJ A;  2WU5 B;  5FK9 C;  1MI0 A;  3ZJV A;  2Z8L A;  4RCO A;  4US9 A;  3DWM A;  1XLQ A;  3NS1 A;  5BMG A;  4YSZ B;  4IOI E;  1N63 A;  2BS3 B;  1TKE A;  2BB6 A;  1C76 A;  3LYY A;  2WLB A;  3BYY B;  2I38 A;  1OQR A;  4A8X C;  1NEK B;  1QT9 A;  1KLG D;  3OWE B;  1ROE A;  3W5U B;  3MC0 B;  5MPO A;  2N9L A;  2ICI A;  3ZQ4 A;  2WP9 B;  1ZDX A;  1AW7 A;  3V3X A;  1LO5 D;  1UGJ A;  4ZOH C;  2ACZ B;  3Q8E A;  3AB5 A;  4OHJ A;  2FBW B;  4A90 A;  3FC4 A;  5HHD G;  2WDV B;  1SJE D;  3MHZ A;  1KTK A;  1TY0 A;  5C3J B;  4JE3 B;  1FRR A;  2GI9 A;  1Q10 A;  2EEL A;  4WQM A;  4RFB A;  4YTM B;  1IBX B;  1L4Z B;  5I4D A;  2IDY A;  3NVW A;  2QSD A;  4ITK A;  4ZYS A;  3VR9 B;  2Y5P A;  2V0G A;  3TUO A;  2NTS A;  1L5P A;  4P16 A;  1WRI A;  4Q2J A;  1UWM A;  2ZW1 A;  3N9Y C;  1D4B A;  1NI3 A;  2WXG A;  2KQ4 X;  1E0Z A;  1J7C A;  1IGC A;  3PO0 A;  2PMV A;  4N58 A;  1N61 A;  1ZE3 D;  4US8 A;  1I4P A;  1T5X D;  3BYT B;  4HKZ E;  3AN1 A;  2V3N A;  4MH8 A;  3PZ7 A;  1FXA A;  1D5X C;  2AQ3 B;  3R2I A;  4C7Y A;  3RFZ B;  2PVO D;  2W3R A;  3HVZ A;  1IUE A;  1WXQ A;  4NJC A;  2WU2 B;  4KKJ A;  1FMA D;  2HTM E;  3R2T A;  4RGM A;  2PLP A;  4A6Q A;  2WDR B;  3P4R B;  3CIR B;  4TQ1 A;  2MJ3 A;  2WXK A;  2W3S A;  1BXT A;  2JX5 A;  3H8H A;  1SEB D;  2KDM A;  2W55 A;  2X38 A;  2V3P A;  1FCL A;  4ARC A;  1YN5 A;  2JQR B;  5EE3 A;  1SSN A;  1SE4 A;  1K52 A;  1L6V A;  4C7Z A;  1PYW D;  2D5G A;  2INP E;  3KWV A;  2DYO A;  1VR9 A;  2JYE A;  2IPK D;  3BVM A;  2XNA C;  2CJO A;  3AED B;  4P6V F;  3U2S C;  3W2D A;  5E6J A;  2PTL A;  3U52 E;  2L1A A;  4L2Y A;  1ZXH A;  3NVZ A;  1JWU D;  1VZ7 A;  1XXG A;  2BT6 A;  2YEP B;  1QLB B;  2OHF A;  1L0X B;  1V1P A;  2KN4 A;  4C80 A;  5BYQ A;  1UNS A;  5GXG B;  3AEB B;  4RNA A;  3T3O A;  2RPV A;  4WAF A;  2K9X A;  2WQY B;  4RF1 A;  5D7G A;  2W82 A;  1M4V A;  1TS4 A;  1TJE A;  2LGI A;  3MP9 A;  1XCQ L;  2KAC A;  1IGD A;  2ZW0 A;  4RGN A;  1FIQ A;  1FO4 A;  3HUI A;  4IKG A;  1T6B X;  1KRH A;  2G9H D;  2G1E A;  3AEA B;  1YQ4 B;  1PDX A;  1ZDV A;  1B9R A;  2VZK D;  3AV8 A;  5FKA C;  3AE7 B;  1OQQ A;  3ETR A;  3KLS X;  3PZ8 A;  1JWA D;  2AX5 A;  1CQV A;  2XN9 C;  2Y3A A;  3B2F A;  1E7P B;  3FIL B;  5G5G A;  1J7A A;  1JW9 D;  1VLB A;  2AQ1 B;  1HA5 A;  3AEE B;  1C77 A;  1SF0 A;  5G5H A;  4NAW B;  1DOX A;  1HZ5 A;  1RFK A;  1WYG A;  2DBY A;  2K5P A;  2H88 B;  2JWU A;  1TY2 A;  5C2T B;  4WH4 A;  3AH7 A;  1T3Q A;  2Q5W D;  1KLU D;  4YSX B;  5EE9 A;  5BMI A;  4NAM A;  1VZ8 A;  3EGR A;  3AM9 A;  3IT4 B;  5BYR A;  2M56 B;  1GOZ A;  1F2R I;  1TKY A;  2K22 A;  3HRD D;  3GS2 A;  1UWX A;  3EUB 2;  3Q8C A;  1QF6 A;  2AQ2 B;  2JU6 X;  3AE5 B;  4HKQ A;  1EU3 A;  1BUI C;  4KGS A;  1RM6 C;  1HXY D;  1JQ4 A;  1SBB B;  1L6U A;  1AN8 A;  2WXL A;  4WUR A;  2BS4 B;  1AWD A;  4ZRP A;  1R7S A;  1MHX A;  3SFE B;  3TEZ A;  1SE2 A;  1ACC A;  4A55 A;  2GB1 A;  2WXJ A;  1P7E A;  4RH6 A;  1SE3 A;  4HRO A;  2I2Y A;  2LFI A;  5T8I A;  3BZD B;  4WWM A;  1FD6 A;  1QIL A;  1UUP A;  5AUI A;  4XWW A;  2RMM A;  2BW2 A;  3P42 A;  1ZXI A;  1GAQ B;  3TEY A;  2BTE A;  4O1N A;  5TSS A;  3BVZ A;  2QIE B;  1B1Z A;  1ZOY B;  1FFV A;  3AE8 B;  4RGT A;  3I57 A;  1P7F A;  4C56 C;  4H2A A;  3VQI A;  3P4S B;  3UI3 A;  1FNV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...