2LI5A

Nmr structure of atg8-atg7c30 complex
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
117
structure length
117
Chain Sequence
HMKSTFKSEYPFEKRKAESERIADRFPNRIPVICEKAEKSDIPEIDKRKYLVPADLTVGQFVYVIRKRIMLPPEKAIFIFVNDTLPPTAALMSAIYQEHKDKDGFLYVTYSGENTFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Autophagy-related protein 8
publication title Structural basis of Atg8 activation by a homodimeric E1, Atg7.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
total genus 15
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2011-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02991 Atg8 Autophagy protein Atg8 ubiquitin like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2li5A00
3DBLI 2JF5A 2KX3A 5FR6A 2KWVB 5EDSA 4GXBA 3EECA 2ZVNA 2EMTA 3VUXA 1KJTA 3WAMA 2O6VA 3ZRCA 2KDIA 4A20A 1UH6A 1WGHA 1V5TA 2MWSB 3VH4B 5LXIB 1WFYA 3V6EB 2RSUA 2GBNA 1WE6A 2L05A 4K7WA 5GMVA 2BGFA 3OAWA 4TKNA 2FUHB 2MP2A 3WIMA 2R2OA 1YD8U 2I1KA 3U7DA 1J8CA 3UGBB 4NAWB 1UBQA 2K8HA 2IZVB 2KTRB 4HXDA 3ECIA 1YX6B 2IO1B 2AEHA 4W9CA 1TZ1A 4MELA 1GC7A 3JSVB 3VUYA 3AULA 4ASWC 4CHKA 4URKA 1QZEA 4W9LA 4AP4C 1P1AA 4HJKA 2JT4B 5D6JB 2DZJA 4WJQA 2J7QB 3W1SC 3ZIMA 4GN1A 4II2B 3UQAA 4DHZB 2KDBA 3VTWA 4TV3A 4J6IA 4BOZB 1TTNA 4W9EA 2PEAA 2WX0A 3UIOB 2C7MB 2QHOA 4RMAA 1V86A 3WA0A 4B9KA 4GGQA 4B95A 2LWPA 4JQWC 1F9JA 2M1MA 2DZIA 3HM3A 2J0MA 4XC2A 2O6VD 4GIVA 2LGYA 2W9NA 4TQ0A 2FCQA 2N1WA 1BT0A 1WZ0A 2CR5A 1WJ6A 2FCNA 4GDLB 5CTRC 1WX9A 2KLCA 1WJ4A 3H7PB 4EKUA 2WYQA 3PRPB 3QA8A 4MEMA 2DAJA 2BWFA 2LUEA 2ZNVC 2KMCA 4GU2A 1WXVA 4PS3A 2NPTB 3L0WB 4W9HA 3R66C 3UINB 1Y8RC 3ZNGC 2KC1A 4MH0E 4WWPA 2KQ7A 4DWFA 1K8RB 3IFWB 2AL6A 2K25A 3QCAA 5G55A 3APFA 3WANA 4BKGA 2UYZB 1Z2MA 4JL9A 3A9JA 1EO6A 3W1SA 2BKRB 2JWZA 5JHBA 5DPWA 3NZSA 2ASQA 3SHQA 1ISNA 4II3B 4WJOA 4FLHA 4KDIC 2CHXA 2HD5B 4KVGB 2MW5A 3ALBA 3KW5B 1R4MI 1C1YB 3KH0A 3RZWC 4DXAB 1E8ZA 2CS4A 1Q0WB 3BY4B 3KUCB 4K7UA 4LCDE 5DPTA 2D2QA 5J17A 1WGYA 3RUIB 4XZ4A 4MGIE 2M8SA 3PZDA 4WWOA 3GZNI 2KANA 3QAQA 1SGHA 3NY5A 4MM3A 2Z0EB 3AI5A 4GMVA 3KYDD 3M63B 2KOXA 4IWQA 5TR5A 1TBEA 1E8XA 4HCNB 1ZW7A 2DX5B 2GBMA 2HTHA 2KC2A 2MBEA 1A5RA 4ANVA 4W9DA 2AYOB 4WJPA 1L7YA 1M94A 2DZMA 2XEWA 4OVUA 1P0RA 1J19A 3CF6E 1HE8A 2FIDA 5D7GA 3QK0A 3EHVA 4DBGA 2D11A 1VD2A 4MGKE 4FHKA 4DHJB 4RM9A 3ZNHB 1CMXB 4GSWA 1ZGUB 3M95A 4BKTA 1D3ZA 3A1QA 3I3TB 1UD7A 1WX8A 4BFRA 3RZFA 4EZLA 3R7RA 2IO2B 2MSED 2D3GA 3NZUA 3TJPA 2KZRA 2CHWA 3X0WA 5J18A 4NJ7A 4BVUC 2KDFB 4HPLB 3ZLZA 2JY6A 2MBBB 3L54A 3HHMA 2NBVB 3V6CB 4GDKB 4CYEA 1V80A 2KNBA 2JZ3B 3ONSA 2C60A 2KWUB 4DHJD 3V61A 2JXXA 2NS5A 4M8NA 1WRDB 4JIOU 5AEKB 2L00B 2KN5A 2WDTB 3JYUA 1SIFA 4IWOA 3U8ZA 4DK5A 4WJNA 1RLFA 4PYUA 3NOBA 4KIKB 2NBWB 3AXCA 4IWPA 2KK8A 5BO4B 1I42A 1XT9B 3ZVVA 2UWQA 3A9KB 3TIXA 2G4SA 3RCZA 2LASA 3L13A 4BOSC 2LXCA 3DVGY 4E71A 3P2BA 4NAWA 2EKEC 4EOYA 3PREA 1KOTA 1IP9A 4W9IA 3H9DA 2GOWA 1C3TA 2L7RA 2O6VB 4JGHB 2A4ZA 3APDA 4LJOB 2L3ZA 2JRHA 5LLIA 4AJYB 2J0JA 4NJ6A 4AJWA 4GB9A 3WAOA 3ZUNA 3KVFB 5L83A 3PTFC 4NY0A 3H7SA 3VVWB 1WR6E 4AWJA 4LJPB 2KQSA 3KUZA 4MGYE 3B1LX 1LM8B 4M8MA 2MCNB 2Z0DB 4IM3A 3VTVA 3K9PB 3VTUA 2D07B 1I35A 1KLVA 4ANXA 2PJHA 3VHTC 1GJZA 3ML9A 1RRBA 3IG3A 2LZ6A 4WAAA 2BF8B 4PYZA 2OJRA 4FJZA 1IPGA 5HKHA 4HCPB 2BWES 2C9WB 1OEYJ 2IY0B 1LXDA 3QJZA 4HDOA 4EEWA 2BPSA 2KO3A 3R3MA 4BBNF 3L16A 3PT2B 2K39A 3DBRI 1WI0A 2O2VA 3JVZX 1NI2A 3A4SC 2XK5B 2Y5BB 3RD2A 1MG8A 2BYVE 3PLUA 4GDLA 4KSLC 3V60A 4ICVA 4ANWA 2V4LA 3T9LA 5C23A 2BYFA 1J0GA 3VQIA 2CHZA 2ZEQA 3MTNB 4DDGD 3ZTDA 4FN2A 4KV2A 2RPQA 1V49A 3T8MA 2K8CA 1G6JA 1P9DU 2GBKA 2IO0B 3DPDA 1WGDA 1WJNA 3DVGX 2MQJA 2MBQA 1E8YA 3VH3B 2FAZA 3QIJA 1OTRB 4IC7B 2N1VA 3S2AA 3QARA 2C7HA 3TCAA 4EUTA 2NR2A 4F7ZA 3U30A 1V81A 4G0NB 3QX1A 1GC6A 4MJSA 1LQBA 2G45B 1T0YA 2G3QB 2NBUA 1OQYA 1WM2A 2KDEB 3VAWA 4ANUA 3DBHI 3PRZA 5IA7A 4FADA 2LVPA 2DENB 3A4RA 3MJWA 1GUAB 3VFKA 3PGEA 3ZKJC 2RR9A 1AARA 3PVLA 2MBHA 1P3QU 2K6DB 2DYBA 2REXA 3Q3FA 4KDLB 1L2NA 2WWZA 2GMIC 4K7SA 4HDQA 3H6NA 4HWIB 1WH3A 2PE6B 3PRMB 1Q5WB 1EF1A 1WJUA 4EZJA 4FA6A 5CHFA 1E7UA 2LVOA 2OOBB 2V1YA 1WM3A 3H1UA 4NNJB 1S1QB 4ZRIA 5E6PA 5AZGA 3ZW3A 1NDDA 3ZO5B 3IHPC 4I6LB 1X1MA 5D94A 3N32A 2KVRA 2J0KA 1WMHA 3QHTA 4E74A 2IO3B 2ZPNA 3D32A 3KUDB 4W9FA 3OJ4B 2AWTA 1GNUA 2MBOA 3OJ3A 1V5OA 4KSKC 3ZRFA 1UZXB 3LDZE 3HIZA 2A5UA 2EMSA 1YIWA 2LRWA 2N9PC 3MHSD 1E90A 2FNJB 2ZNVB 3AU5A 3ENEA 5L95C 5C1ZA 2RD0A 3ZNID 2PPHA 3W1YA 1YX5B 4LDTD 2JRIB 2KFKA 1WIAA 2K8BA 1OGWA 4MSMB 2Z59B 2B3AA 3K9OB 2DAFA 4GDKA 3WALA 1EF5A 2M0XA 4E3CA 1WGGA 3DBSA 2N9XA 3CSTA 3VDZA 1KM7A 4AUQC 2PE9A 2MRPA 1WZ3A 2GBRA 2N7DA 2HJ8A 4KIKA 1E7VA 2KXJA 3B0AA 3TBLD 2C5LC 4BKSA 3DVNV 3SD5A 4DHZE 2MA9B 2BYEA 1H8CA 3C0RB 3PHXB 1ZKHA 2KJHB 5G2NA 2KTFA 3RT3B 2LGDA 3QWZB 4FBJB 4OVVA 1V9JA 2IYDB 2KTRA 4A3OA 2V3SA 4HLEA 1WR1A 2K6QA 1WE7A 4W9KA 2KFJA 2N7EA 2CKHB 3M3JA 5KHQA 2N9EB 3JSVA 4TQ1A 1U4AA 4KZ0A 2L8JA 2WX1A 3PV1A 1S3SG 1WX7A 2KJRA 2DZKA 3A33B 3OLMD 2KHWB 2VRRB 3UQBA 2N4FA 3VXWA 1H4RA 2BKFA 2MP2B 3PSEB 4ZRKA 2M17A 1Q1OA 2RGFA 3NHEB 1YJ1A 4F8CB 2C7NB 2LD9A 5JHAA 3HK0A 2ZPYA 4RM8A 1TGZB 5E6OA 2YVCA 4IM2A 1UGMA 5JH5C 3N30A 4DDID 4EZKA 4WWNA 4KZCA 2DYOA 4ZRJA 2LJ5A 3DQVA 3VUWA 4A3PA 1WGRA 2I1JA 2XK5A 4FHJA 4NQKE 2L0FA 3H7PA 3SU8X 4BKSD 1XD3B 2ZCCA 5DCNA 3IVFA 3CSFA 4PS7A 4I6PA 1WXSA 3BINA 2FCSA 1WY8A 2NPTA 3O65B 4HK2A 1GG3A 1RFAA 4ICUA 1RAXA 3QC8B 3L10B 3ML8A 3PHWB 1V6EA 2DHZA 4NQLB 5E6NA 1XQQA 1OEYA 5CHWA 2LRUA 2FIFA 2ZZPB 3IBEA 2ZVOA 4PS8A 2ZCBA 2O2VB 1NBFC 4ZDVA 4FULA 2K1FA 1EUVB 1WF9A 5JZEB 3UF8A 2DYMA 4MDKE 1E5WA 2LGXA 2LVQA 2JVCA 1UBIA 3JW0X 4G50A 3R7QA 4IW0A 4NPNA 2NVUI 2MX2A 1JRUA 4FJVB 4MGZE 5DPRA 5J2RA 3KYCD 2LXAA 3ZTCA 1YQBA 1E8WA 4G11A 4F1SA 1LFDA 2KLGA 3EFUA 4AOFA 3DOWA 3N3KB 3UIPB 5LXHA 3X23A 3ZNZB 2MLBA 4CO7A 3A9JB 2G4DB 4GOCA 2KD0A 1WXMA 5KHOA 2L0TA 2GBJA 2NCNA 3QQ8B 2YLMA 4X57B 3L08A 4XX5A 4MJSB 4JLCA 2AL3A 3L17A 1R4NI 5DPSA 1FXTB 4IM0A 1PQSA 4W9GA 4BBNC 2JZZA 4LDTB 2IBIB 4YL8A 3TL5A 3DVNU 5IAAC 1P98A 5CX3A 3PS6A 4ZYNA 3SDLC 3EC8A 2FCMA 4K1RB 2XBBC 5AZFA 1WYWB 3GOEA 4EFOA 4G3XB 4K81A 3AU4A 3DDCB 3RYTA 4IUMB 1UELA 4B6WA 3B08A 4FJYA 1Z5SB 3PLVA 1IYFA 2HE7A 3TMPB 3ZDTA 2KMAA 2KWCA 1WXAA 1SE9A 5D2MB 4TUUA 2L76A 4P7IA 3RULA 5AZHA 2LI5A 1V2YA 4IG7B 2D10A 1WMHB 2CU1A 2KX0A 2KJ6A 3V62A 3PPAA 3LJ3A 2M4NA 4WQOB 3A1QB 3DCGA 3Q3JA 3NS8A 4I6NB 4M0WB 2JPHA 1VCBA 2R2QA 4HVBA 3CMMB 5CHVC 2KKCA 3A9KA 2ZJDA 4HPMB 3M62B 3APCA 4W9JA 3ZDMC 2IY1B 2JUOA 2KFKB 3HM6X 3WAPA 4MSQB 4N9F4
chains in the Genus database with same CATH superfamily
2JYEA 2GRIA 5FR6A 1SB3C 2ZVNA 2KYWA 1TY0A 2KDIA 1V5TA 3VH4B 3V6EB 1WRIA 2LJIA 1JWSD 2L05A 1ET6A 2FUHB 2R2OA 3U7DA 2JXTA 2IZVB 3IAS1 1OQQA 2AEHA 4MELA 3AULA 4CHKA 4URKA 3B2FA 5EE1A 3ZIMA 3UQAA 2J42A 4DHZB 2WX0A 2C7MB 4RMAA 2Q5WD 4B9KA 1F9JA 2DZIA 4ARCA 4GIVA 4ITKA 1BT0A 1T0SC 4YSYB 1KF6B 2KLCA 1WJ4A 4EKUA 1N5WA 2WYQA 3QA8A 1R4MB 2DAJA 2BWFA 1TS5A 3L0WB 4W9HA 4DXFA 3R66C 5HI1A 5T8IA 2KC1A 3U7ZA 3ZNGC 1LGRA 3RFZB 1C76A 1K8RB 5MPOA 2AL6A 4XGAB 1ZPSA 1Z2MA 4JL9A 3A9JA 3W1SA 5JHBA 5DPWA 3SHQA 1ISNA 5FR3A 4KDIC 2SEBD 1YN3A 2Z8LA 3KW5B 1R4MI 1C9FA 3EGRA 3OWEB 2BB6A 3NRZA 4XZ4A 2J52A 4MGIE 2IGGA 1E0ZA 1E7PB 1NVID 1EM7A 4IWQA 1E8XA 4HCNB 3GS2A 5IO9A 4ANVA 4WJPA 2DZMA 3UI3A 1SE4A 2D11A 4FHKA 3VRBB 1V1PA 3R2TA 4GSWA 3M95A 3A1QA 1V1OA 2JSVX 1MG4A 3NZUA 2KZRA 1BMLC 3RNBC 4NJ7A 2JY6A 2KNBA 3GP7A 2GI9A 4OZBA 2INDC 5AEKB 4HJGE 3AE4B 1RLFA 2NBWB 3AXCA 4IWPA 2KK8A 3ZVVA 2UWQA 1HA5A 1TKYA 3A9KB 3L13A 2EKEC 4EOYA 4W9IA 4JGHB 2PVGC 5LLIA 4C80A 1I7HA 4LJPB 4MGYE 2DBYA 1LM8B 4IM3A 3VTVA 3K9PB 2D07B 1I35A 1C79A 1ZOYB 1GJZA 3ZXRA 3I5JC 4WAAA 4XWWA 1SSNA 4PT5A 1IPGA 5HKHA 2AX5A 3FILA 4HCPB 1OEYJ 3QJZA 1LXDA 3R3MA 4BBNF 2GB1A 5HG2A 2O2VA 4YT0B 2Y5BB 4S17A 1MG8A 2BYVE 2M19A 4ANWA 5C23A 4B0MA 4XE0A 3ZTDA 4KV2A 1XF5L 1N61A 1ZUD2 1P9DU 2GBKA 1WGDA 5IP4D 1WJNA 2MQJA 3QIJA 1ET9A 2C7HA 4EUTA 2QEJC 1V81A 4G0NB 4WURA 1A70A 4MJSA 4JX1C 2KDEB 4ANUA 3PRZA 3HVDA 1KLUD 2LVPA 4LK0M 1VZ7A 1XO3A 4YTMB 1FNVA 2RR9A 2Y5PA 3MC0B 2MBHA 1AN8A 1JMLA 3N20C 2GMIC 4HDQA 3H6NA 1XXGA 1YQ4B 1QOBA 5CHFA 4NNJB 3H1UA 1WM3A 5E6PA 4ZRIA 3ZO5B 2BVCA 2BQQA 3N32A 2KVRA 1TS3A 2J0KA 4E74A 2NMQA 1UWXA 4W9FA 3OJ4B 1HEZE 1GNUA 2JYTA 2VH1A 1N60A 3ZRFA 2OHFA 3U52E 1E90A 3AU5A 5L95C 3PZ7A 4LDTD 1FFUA 3AEBB 1OGWA 2E3TA 4GDKA 3K9OB 2DAFA 1PGBA 5D3DA 2M0XA 4E3CA 1FPYA 1C4AA 1N63A 2K5PA 2N9XA 3DBSA 3CSTA 3VDZA 4AUQC 2GBRA 1FEHA 4KIKA 3OG5A 4BKSA 2BYEA 2WXJA 5EE3A 4A3OA 4HLEA 1UUPA 4W9KA 2N7EA 3FKYA 4A9AA 2JWUA 2KJRA 2DZKA 3BWUD 3UQBA 2BS3B 3NHEB 4R3DA 1F2RC 4ZOHC 2ZPYA 1WXQA 1TGZB 3TEZA 3AE9B 3DQVA 1WGRA 2I1JA 2JZPA 3CWIA 3NJTA 4BKSD 1XD3B 1ZXIA 3IVFA 3TEWA 1WXSA 2V3PA 4M01A 1WY8A 3O65B 3KQ4A 2WXFA 3QC8B 3AEFB 2D3CA 3L10B 3ML8A 3PHWB 1XQQA 1JWBD 1KTKA 4LNIA 2INPE 3HUIA 1P7FA 3UF8A 2W82A 1JRPA 4G50A 2LVQA 1IUEA 3BYTB 5LXHA 2WLBA 3A9JB 2NCNA 3TSSA 3RNAC 4JLCA 3AN1A 3L17A 1PQSA 2VH2A 3ZXVA 1FCLA 2INCC 4K1RB 5FK9C 2XBBC 5AZFA 1WYWB 4EFOA 1HQRD 3BIID 3B08A 1IYFA 2HE7A 2W3RA 3TEXA 3TMPB 2WXGA 1F0ZA 3E9SA 2KWCA 1VZ8A 2CU1A 2KQ4X 2WXPA 1C4PA 3A1QB 3DCGA 2WXOA 4M0WB 3NS8A 2JPHA 1F77A 3CMMB 5CHVC 2KKCA 2ACZB 2ZJDA 3A9KA 3APCA 4HRSA 2IY1B 3WAPA 4MSQB 4ZYNA 2XN9C 4GXBA 3EECA 1C4CA 3SR6A 3WAMA 2L1AA 2MJEA 3Q8BA 1E6EB 5LXIB 3MJ5A 2AQ3B 2ONQA 1WE6A 1STEA 2JX5A 5IN7A 2V0GA 1YD8U 5D3IB 3Q8CA 4KKIA 1UBQA 4HXDA 4W9CA 1JWAD 1QZEA 4W9LA 1SBBB 3RNEC 1L4ZB 3C19A 4GN1A 4JWSC 2KDBA 3VTWA 4RH6A 3I9V1 3DHHC 4W9EA 1V86A 3BK1A 4GGQA 2LWPA 2MJDA 2M1MA 2LGYA 2FCQA 1DOYA 4IDIA 1J7BA 5CTRC 3H7PB 4RF1A 1VRAB 1NYQA 4MEMA 1XLOA 2ZNVC 4YSXB 4LNNA 3MC8A 1TZOA 4DWFA 2WU5B 2K25A 1FRDA 3APFA 3KLSX 4BKGA 2RMMA 4OVZA 1ZDXA 4FLHA 2X8XX 4YSZB 2CHXA 1WSPA 1C1YB 1E8ZA 1Q0WB 4LCDE 5DPTA 3DWMA 1TY2A 1KRHA 4WWOA 3GZNI 1XCQL 2KANA 1BXTA 4NZLB 2PIAA 3AI5A 2KOXA 1TBEA 1ZW7A 2DX5B 1WWTA 3ZGZA 3NG0A 1A5RA 1M94A 2XEWA 1AW7A 1J19A 2FIDA 4MGKE 1CMXB 1ZGUB 3NZ3A 4XDCA 1WX8A 4BFRA 4EZLA 3R7RA 4QAYA 1RWSA 3TJPA 5J18A 4BVUC 2KDFB 4HPLB 3ZLZA 2MBBB 2NBVB 3V6CB 4GDKB 3T3NA 4DHJD 1CZPA 2JXXA 2KWDA 1SIFA 4WJNA 4KIKB 3AE7B 3BZDB 1I42A 1XT9B 3RCZA 2WDRB 4RCOA 1WYGA 3Q3MC 3BK2A 1KOTA 5BYSA 1DGJA 2GOWA 2O6VB 4RF0A 2A4ZA 4Q2JA 1KFYB 2MH7A 4AJWA 4NJ6A 5L83A 4RGTA 3AE2B 3H7SA 3DHGC 4AWJA 2KQSA 4XYCA 2IJ0A 1KLVA 4N58A 3VHTC 3ML9A 4FJZA 4HPPA 2BWES 2C9WB 4EEWA 1YOVB 3PT2B 2BS2B 2Y5CA 3JVZX 1NI2A 2LEKA 1JW9D 3RD2A 4GDLA 3PLUA 2TSSA 1J0GA 3DBHB 3VQIA 2CHZA 1LO5D 2M0AA 1T0QC 1V49A 1G6JA 2FBWB 1KH0A 2IO0B 3DWGC 2MBQA 1E8YA 1OTRB 3BVGA 5TSSA 1JWUD 3S2AA 3QARA 4YTPB 3QX1A 1SJED 4C7YA 3MP9A 1LQBA 2G45B 1CK1A 1OQYA 1WM2A 3DBHI 4NJCA 3SFEB 1IGCA 1GUAB 2WXIA 2MEKA 4A90A 2DYBA 2N0SB 1FXIA 4KDLB 4D2KA 2WWZA 1ZP0B 3PRMB 1Q5WB 1EF1A 2OEDA 2OOBB 3ZW3A 1NDDA 1C77A 2EKIA 1VJKA 3N1XC 3KUDB 3D32A 1FCCC 3P4SB 3J9CA 3OJ3A 1MFWA 1V5OA 3ONSA 1UZXB 4LTUA 2FNJB 2ZNVB 4M0WA 2PPHA 1YX5B 1EWYC 2Z59B 2B3AA 2ZW0A 1YNTE 1GAQB 3BYYB 1KM7A 2PE9A 2BYTA 1K50A 2N7DA 3B0AA 1ZDVA 4DHZE 2MA9B 2WXNA 2PVOD 1ZKHA 5G2NA 2KTFA 2LGDA 3QWZB 4OVVA 1V9JA 4US8A 1GOZA 2IYDB 1VZ6A 3R8BA 2K6QA 1WE7A 3Q3OC 5KHQA 1T5XD 4TQ1A 1L6UA 1U4AA 4KZ0A 1YJIA 1PYWD 1BUIC 1S3SG 2JQRB 4OZCA 3OLMD 2KHWB 2N4FA 1L4DB 2WXLA 1H4RA 3PSEB 2M17A 1Q1OA 1YJ1A 4OHJA 4F8CB 2BS4B 2C7NB 2KAJA 2LD9A 1SJHD 3NVVA 1ENFA 2EELA 1ESFA 4IM2A 1L5PA 4MH8A 3V3XA 4EZKA 3GE8C 2DYOA 1MJDA 2LJ5A 1PDXA 3VUWA 2XK5A 3H7PA 3SU8X 4GLSC 2WQYB 4HK2A 4HKQA 4P6VF 4ICUA 1ROEA 3URYA 4NQLB 3IBEA 4PS8A 2ZCBA 2E6XA 4JWUC 4L1BA 5I4DA 3VR8B 4FULA 4KKJA 2ON8A 5JZEB 1E5WA 2JVCA 1UBIA 1FD6A 4IW0A 2LHDA 1XLQA 1JRUA 4FJVB 2LXAA 4US9A 4G11A 1DYQA 2LUMA 1LFDA 2KLGA 3EFUA 4AOFA 3N3KB 2I2YA 3X23A 3ZNZB 2BBCA 2MLBA 4CO7A 2G4DB 1I4QA 4USAA 1WXMA 1J7CA 2L0TA 2GBJA 4WH4A 2V4IB 4H2AA 4X57B 3ZJVA 2AL3A 3LXFA 5DPSA 2NTSA 2JZZA 2IBIB 1N5XA 3DVNU 4P16A 5IAAC 3CIRB 1YN5A 2BW2A 1P98A 5CX3A 4J3OD 1EU4A 3P63A 1QF6A 2FCMA 3GOEA 1XLPA 1TKEA 3ABVB 4G3XB 4WQMA 2WXMA 3AE5B 4B6WA 2MHJA 4FJYA 3PLVA 4IKGA 3EFCA 3DBLB 1WXAA 1SE9A 4TUUA 2L76A 4P7IA 2LI5A 1V2YA 4IG7B 2D10A 4L23A 1WMHB 4M02A 2KX0A 2KJ6A 5H8YE 1F1HA 3AE6B 5AUKA 3HRDD 4DQOC 3Q3JA 4HVBA 2N7JA 2WXRA 3HM6X 3ZJTA 4N9F4 3DBLI 2JF5A 2KX3A 1SE2A 2EMTA 1KJTA 2O6VA 1VR9A 3ZRCA 1QOAA 2WXQA 2MWSB 1E10A 1ZE3D 1WFYA 2RSUA 2GBNA 2BT6A 2CJOA 2BGFA 3WIMA 1J8CA 2I1KA 3UGBB 5C2TB 5BYQA 3ECIA 1YX6B 2IPKD 1TZ1A 1GC7A 3JSVB 4ASWC 3RNFC 1P1AA 5D6JB 2DZJA 1YMHE 4II2B 1FM0D 3EA6A 3PZ8A 1HXYD 3UIOB 2QHOA 5BMIA 2J0MA 1MVKA 2O6VD 1CJEA 2N1WA 2UU7A 1I4RA 5IKCM 1WJ6A 2FCNA 4GDLB 2BTEA 1SXTA 2KMCA 4GU2A 4PS3A 4ZYSA 4WIPA 3NVZA 4MH0E 4WWPA 2KQ7A 3QCAA 5G55A 3WANA 3W9CB 1IBXA 3IXSA 2FUG1 1PFDA 4II3B 2WNMA 4WJOA 2HD5B 4KVGB 2MW5A 1K53A 3KH0A 1C78A 3BY4B 4K7UA 3RUIB 1HTOA 2HDEA 3QAQA 1OFFA 1SGHA 3NY5A 4MM3A 2Z0EB 3NVWA 2K0PA 1I4GA 5TR5A 1QLBB 2GBMA 2HTHA 2KC2A 2QIEB 2MBEA 4IOIE 1MHXA 4OVUA 1P0RA 3CF6E 1HE8A 3EHVA 2H88B 1SIJA 5GXGB 1D6EC 1VD2A 4AS1A 2I38A 3L4PA 3EUB2 4FXCA 1L0VB 4BKTA 3DHIC 3I3TB 4YTNB 3RZFA 2MSED 3ETRA 1RM6C 2D3GA 3L54A 3HHMA 4ZHOA 2ICIA 1DOXA 2HJ1A 4CYEA 2JZ3B 2B76B 2KWUB 3V61A 2NS5A 4M8NA 1WRDB 4JIOU 2L00B 2WDTB 4IWOA 1RYJA 3AM9A 4PYUA 3NOBA 5BO4B 1MI0A 1TKGA 3TIXA 2LASA 1L0YB 2INNE 2LXCA 3DVGY 3P2BA 4NAWA 3PREA 1IP9A 4LJOB 3APDA 4AJYB 3ZUNA 3KVFB 4YXDB 3B1LX 2MCNB 3VTUA 3IAM1 2PW9A 2GLSA 2DNFA 1RRBA 3IG3A 3AECB 1JCKB 3H8HA 2BF8B 4PYZA 4XDDA 1L0XB 1YN4A 4BAXA 2YEPF 2IY0B 1R7SA 2AQ1B 4HDOA 2BPSA 2KO3A 3L16A 2K39A 1XEEA 2L83A 3A4SC 2XK5B 4RFBA 3V60A 4KSLC 4ICVA 1V8CA 2BB5A 2V4LA 3T9LA 2N9LA 2BYFA 2ZEQA 3MTNB 3RNGC 3SEBA 1FO4A 3T8MA 2PKOA 3DPDA 3O13A 1FMAD 2QC8A 3GZNB 3VH3B 2FAZA 4IC7B 2NR2A 4K3CA 4F7ZA 2FE8A 1TS2A 1T0YA 1ACCA 2NBUA 5EE0A 2DENB 2OJWA 2VZKB 3AEDB 3A4RA 3VFKA 1OQRA 1P3QU 1KLGD 3I57A 2W55A 1M4VA 1UGJA 3Q3FA 1L2NA 4K7SA 4HWIB 5G5GA 3N1YC 4JE3B 2PLPA 4PK1A 1E7UA 1D5XC 2V1YA 1F2RI 3IHPC 1QT9A 1X1MA 4I6LB 1RFKA 4RNAA 1WMHA 3QHTA 4JPSA 4HKZE 2IO3B 2AWTA 3LDZE 2EMSA 1YIWA 2WXHA 3ENEA 5C1ZA 1J7AA 2KMMA 4RGOS 2JRIB 2K8BA 3MC9A 1D5ZC 4MSMB 2KT7A 2MJ3A 2HJ8A 5BYRA 1E7VA 1FIQA 3DVNV 3RI7C 3SD5A 3C0RB 3HVZA 4ZHPA 2QDFA 2NTTA 1WR1A 2CKHB 4K3BA 3JSVA 5HHDG 2WXKA 2L8JA 2WX1A 2RDGA 3V05A 1WX7A 1XCTL 2VRRB 3VXWA 3VR9B 4ZRKA 5JHAA 4RM8A 1JROA 1HTQA 2YVCA 5IOIA 1UGMA 5JH5C 1GB1A 3N30A 4KX6B 4BZAA 4A3PA 4FHJA 2L0FA 2ZCCA 3CSFA 4I6PA 3BINA 2FCSA 2DLBA 4MT5A 1RFAA 1RAXA 2DHZA 5E6NA 1T0RC 2LRUA 3ZYYX 4P1CC 2ZVOA 4P1BC 3W5VB 2IGHA 2QILA 2K1FA 1EUVB 2DYMA 4MDKE 2LGXA 4M00A 4ZRPA 2K22A 5EE9A 4NPNA 3P42A 2MX2A 2D5GA 3I63C 5DPRA 3KYCD 1YQBA 1E8WA 3KWVA 4F1SA 1IBXB 4GOCA 3QQ8B 2YLMA 4XX5A 4A6QA 3RN9C 1FXAA 4W9GA 2JU6X 2LFIA 4YL8A 3TL5A 3PS6A 3Q14C 2LHEA 1V97A 4ACFA 1ZXHA 4MM3B 3W2DA 1QOGA 4K81A 3AU4A 3NS1A 1YQ3B 1UELA 2QJLA 1XLNA 3MFGA 1Z5SB 4N59A 3E56A 4C56C 5D2MB 4YWGG 3RULA 5AZHA 2DWQA 3NVYA 2KVZA 2RDBC 3PPAA 2M4NA 2KN4A 3AE3B 3AMZA 3P1MA 2R2QA 1SEBD 4HPMB 4W9JA 2JUOA 2KFKB 2KWVB 4LLGM 2L52A 5EDSA 1I4PA 4RGMA 3VUXA 1UWMA 4A20A 1UH6A 1WGHA 1GPXA 1HZ6A 1PGXA 2LGIA 4K7WA 5GMVA 1VLBA 3OAWA 4TKNA 2MP2A 1UNSA 4NAWB 2K8HA 2KTRB 1QOFA 2IO1B 3VUYA 3W5UB 4LNFA 4AP4C 1CQVA 4HJKA 2JT4B 4WJQA 2PMVA 2J7QB 3W1SC 3WCQA 1MHHE 5C3JB 4TV3A 4J6IA 4BOZB 1TTNA 2PEAA 2W3SA 3IT6B 3WA0A 2WHIA 4B95A 4JQWC 1HZ5A 3HM3A 4XC2A 1TIFA 4TQ0A 2W9NA 1WZ0A 2CR5A 1WX9A 4WAFA 3PRPB 4AQ7A 5BMHA 1FRRA 1L6VA 2LUEA 1WXVA 2NPTB 3Q8AA 5E6JA 3UINB 1Y8RC 5G5HA 3IFWB 5HFYA 2UYZB 1EO6A 2BKRB 2JWZA 2KDMA 4UDUC 3NZSA 2QMTA 2ASQA 2J53A 1D5MC 3ALBA 3RZWC 4DXAB 2CS4A 3N9YC 1T6BX 3KUCB 1TYGB 2D2QA 5J17A 1EWCA 1WGYA 2M8SA 3PZDA 1GB4A 4GMVA 3KYDD 3M63B 1K52A 3Q8EA 4W9DA 2AYOB 1L7YA 2KACA 2WP9B 1QQRA 3QK0A 5D7GA 2VZKD 4DBGA 4DXGA 3MHZA 4DHJB 4RM9A 3RPFC 3ZNHB 4OW0A 2R61A 1AYFA 1D3ZA 2ZW1A 1UD7A 1JALA 4C4VB 2IO2B 3ZQ4A 4A8XC 4OZAA 2CHWA 3X0WA 1E9MA 4N6EB 2SAKA 1DOIA 1V80A 3U4EG 2C60A 4HROA 2KN5A 3JYUA 3U8ZA 1Y56A 4DK5A 1D4BA 1PGAA 1YJJA 1JWMD 2G4SA 4BOSC 3AEAB 4E71A 1FNUA 1WGKA 3H9DA 2IGDA 1C3TA 4S0RA 2L7RA 2XNAC 3DBRB 5FKAC 2L3ZA 2JRHA 3LB8C 2J0JA 4GB9A 3WAOA 3PTFC 4NY0A 3VVWB 1WR6E 1NYRA 3KUZA 3Q6BA 4M8MA 2Z0DB 1AWDA 4KGRA 4ANXA 2PJHA 1TT5B 2LZ6A 2W54A 1SE3A 1I4HA 2OJRA 2V9HA 5LNK1 1K51A 4TMAB 3AB5A 3DBRI 1WI0A 2CJNA 2PTLA 2QSDA 2LGSA 2G9HD 2WDQB 4DDGD 2J4XA 4FN2A 2RPQA 2K8CA 3DVGX 2Y3AA 2N1VA 3TCAA 4XWTA 1VDVA 3U30A 2QCZA 1GC6A 2G3QB 5BMGA 3VAWA 5IA7A 1B1ZA 3KWLA 4FADA 1EU3A 3U2SC 3MJWA 4KGTA 3Q69A 3PGEA 3ZKJC 4NAMA 3BVMA 1AARA 3PVLA 2K6DB 3BVZA 2REXA 4KGSA 2N9KA 3FC4A 1WH3A 2PE6B 4ARIA 1WJUA 4EZJA 4FA6A 3AH7A 2LVOA 5AZGA 1S1QB 5D94A 3RNCC 2ZPNA 1P7EA 2MBOA 4KSKC 4DDID 3HIZA 2A5UA 2LRWA 2N9PC 3MHSD 3AV8A 2RD0A 3ZNID 5JXVA 1Q10A 3AE8B 3W1YA 2KFKA 1WIAA 2K9XA 3WALA 4B0EA 1EF5A 4A55A 1WGGA 1V1PB 2M56B 3B9JA 2MRPA 1WZ3A 5H92C 1N6ZA 2YEPB 3TBLD 2KXJA 2C5LC 4REZA 4LNOA 3VRAB 1H8CA 3PHXB 2KJHB 3RT3B 3NUHB 4FBJB 2KTRA 2WS3B 1B9RA 2V3SA 1QKZA 2KFJA 3M3JA 3R2IA 2N9EB 3SFDB 3TEYA 1MPEA 3PV1A 2D3BA 3A33B 3P4RB 1FNWA 3C8YA 2BKFA 2MP2B 2WGSA 2RGFA 3AEGB 3HK0A 4O1NA 4RGNA 2RDHA 5E6OA 1JQ4A 1TJEA 1I4XA 1SF0A 4WWNA 4KZCA 2G1EA 4ZRJA 1NENB 4NQKE 4C00A 5DCNA 4PS7A 1NEKB 2NPTA 1GG3A 4C7ZA 3FILB 3P4PB 1V6EA 1OEYA 3Q2AC 5CHWA 1IGDA 2FIFA 2HTME 2ZZPB 1NI3A 2O2VB 1NBFC 3GB1A 4ZDVA 1WF9A 1R4NB 2IDYA 3IT4B 3B2GA 3R7QA 3JW0X 3TUOA 1FFVA 3N1ZC 2NVUI 4MGZE 5J2RA 4WWMA 3ZTCA 3P4QB 1F52A 4LNKA 3DOWA 3UIPB 2KD0A 5KHOA 4MACA 3L08A 4MJSB 2WU2B 1R4NI 1FXTB 4IM0A 2H89B 4EE2A 4BBNC 4LDTB 3RMKC 2CU3A 4ZRQA 1PUTA 2WDVB 5AUIA 3SDLC 3EC8A 3GE3C 1UF0A 2X38A 3DDCB 1N62A 3RYTA 2L32A 4IUMB 1T3QA 2D3AA 4C4VA 4HEA1 3PO0A 3ZDTA 2KMAA 4TSSA 3AE1B 2AQ2B 3V62A 3LJ3A 3T3OA 2K3UA 4CQNA 3AEEB 4WQOB 1TS4A 3LYYA 4L2YA 4I6NB 2V3NA 3FAHA 1VCBA 2LMCA 3Q3NC 1QILA 3ZDMC 3M62B 2RPVA 3Q8FA 3ZJUA
chains in the Genus database with same CATH topology
3DBLI 2JF5A 2KX3A 5FR6A 2KWVB 5EDSA 4GXBA 3EECA 2ZVNA 2EMTA 3VUXA 1KJTA 3WAMA 2O6VA 3ZRCA 2KDIA 4A20A 1UH6A 1WGHA 1V5TA 2MWSB 3VH4B 5LXIB 1WFYA 3V6EB 2RSUA 2GBNA 1WE6A 2L05A 4K7WA 5GMVA 2BGFA 3OAWA 4TKNA 2FUHB 2MP2A 3WIMA 2R2OA 1YD8U 2I1KA 3U7DA 1J8CA 3UGBB 4NAWB 1UBQA 2K8HA 2IZVB 2KTRB 4HXDA 3ECIA 1YX6B 2IO1B 2AEHA 4W9CA 1TZ1A 4MELA 1GC7A 3JSVB 3VUYA 3AULA 4ASWC 4CHKA 4URKA 1QZEA 4W9LA 4AP4C 1P1AA 4HJKA 2JT4B 5D6JB 2DZJA 4WJQA 2J7QB 3W1SC 3ZIMA 4GN1A 4II2B 3UQAA 4DHZB 2KDBA 3VTWA 4TV3A 4J6IA 4BOZB 1TTNA 4W9EA 2PEAA 2WX0A 3UIOB 2C7MB 2QHOA 4RMAA 1V86A 3WA0A 4B9KA 4GGQA 4B95A 2LWPA 4JQWC 1F9JA 2M1MA 2DZIA 3HM3A 2J0MA 4XC2A 2O6VD 4GIVA 2LGYA 2W9NA 4TQ0A 2FCQA 2N1WA 1BT0A 1WZ0A 2CR5A 1WJ6A 2FCNA 4GDLB 5CTRC 1WX9A 2KLCA 1WJ4A 3H7PB 4EKUA 2WYQA 3PRPB 3QA8A 4MEMA 2DAJA 2BWFA 2LUEA 2ZNVC 2KMCA 4GU2A 1WXVA 4PS3A 2NPTB 3L0WB 4W9HA 3R66C 3UINB 1Y8RC 3ZNGC 2KC1A 4MH0E 4WWPA 2KQ7A 4DWFA 1K8RB 3IFWB 2AL6A 2K25A 3QCAA 5G55A 3APFA 3WANA 4BKGA 2UYZB 1Z2MA 4JL9A 3A9JA 1EO6A 3W1SA 2BKRB 2JWZA 5JHBA 5DPWA 3NZSA 2ASQA 3SHQA 1ISNA 4II3B 4WJOA 4FLHA 4KDIC 2CHXA 2HD5B 4KVGB 2MW5A 3ALBA 3KW5B 1R4MI 1C1YB 3KH0A 3RZWC 4DXAB 1E8ZA 2CS4A 1Q0WB 3BY4B 3KUCB 4K7UA 4LCDE 5DPTA 2D2QA 5J17A 1WGYA 3RUIB 4XZ4A 4MGIE 2M8SA 3PZDA 4WWOA 3GZNI 2KANA 3QAQA 1SGHA 3NY5A 4MM3A 2Z0EB 3AI5A 4GMVA 3KYDD 3M63B 2KOXA 4IWQA 5TR5A 1TBEA 1E8XA 4HCNB 1ZW7A 2DX5B 2GBMA 2HTHA 2KC2A 2MBEA 1A5RA 4ANVA 4W9DA 2AYOB 4WJPA 1L7YA 1M94A 2DZMA 2XEWA 4OVUA 1P0RA 1J19A 3CF6E 1HE8A 2FIDA 5D7GA 3QK0A 3EHVA 4DBGA 2D11A 1VD2A 4MGKE 4FHKA 4DHJB 4RM9A 3ZNHB 1CMXB 4GSWA 1ZGUB 3M95A 4BKTA 1D3ZA 3A1QA 3I3TB 1UD7A 1WX8A 4BFRA 3RZFA 4EZLA 3R7RA 2IO2B 2MSED 2D3GA 3NZUA 3TJPA 2KZRA 2CHWA 3X0WA 5J18A 4NJ7A 4BVUC 2KDFB 4HPLB 3ZLZA 2JY6A 2MBBB 3L54A 3HHMA 2NBVB 3V6CB 4GDKB 4CYEA 1V80A 2KNBA 2JZ3B 3ONSA 2C60A 2KWUB 4DHJD 3V61A 2JXXA 2NS5A 4M8NA 1WRDB 4JIOU 5AEKB 2L00B 2KN5A 2WDTB 3JYUA 1SIFA 4IWOA 3U8ZA 4DK5A 4WJNA 1RLFA 4PYUA 3NOBA 4KIKB 2NBWB 3AXCA 4IWPA 2KK8A 5BO4B 1I42A 1XT9B 3ZVVA 2UWQA 3A9KB 3TIXA 2G4SA 3RCZA 2LASA 3L13A 4BOSC 2LXCA 3DVGY 4E71A 3P2BA 4NAWA 2EKEC 4EOYA 3PREA 1KOTA 1IP9A 4W9IA 3H9DA 2GOWA 1C3TA 2L7RA 2O6VB 4JGHB 2A4ZA 3APDA 4LJOB 2L3ZA 2JRHA 5LLIA 4AJYB 2J0JA 4NJ6A 4AJWA 4GB9A 3WAOA 3ZUNA 3KVFB 5L83A 3PTFC 4NY0A 3H7SA 3VVWB 1WR6E 4AWJA 4LJPB 2KQSA 3KUZA 4MGYE 3B1LX 1LM8B 4M8MA 2MCNB 2Z0DB 4IM3A 3VTVA 3K9PB 3VTUA 2D07B 1I35A 1KLVA 4ANXA 2PJHA 3VHTC 1GJZA 3ML9A 1RRBA 3IG3A 2LZ6A 4WAAA 2BF8B 4PYZA 2OJRA 4FJZA 1IPGA 5HKHA 4HCPB 2BWES 2C9WB 1OEYJ 2IY0B 1LXDA 3QJZA 4HDOA 4EEWA 2BPSA 2KO3A 3R3MA 4BBNF 3L16A 3PT2B 2K39A 3DBRI 1WI0A 2O2VA 3JVZX 1NI2A 3A4SC 2XK5B 2Y5BB 3RD2A 1MG8A 2BYVE 3PLUA 4GDLA 4KSLC 3V60A 4ICVA 4ANWA 2V4LA 3T9LA 5C23A 2BYFA 1J0GA 3VQIA 2CHZA 2ZEQA 3MTNB 4DDGD 3ZTDA 4FN2A 4KV2A 2RPQA 1V49A 3T8MA 2K8CA 1G6JA 1P9DU 2GBKA 2IO0B 3DPDA 1WGDA 1WJNA 3DVGX 2MQJA 2MBQA 1E8YA 3VH3B 2FAZA 3QIJA 1OTRB 4IC7B 2N1VA 3S2AA 3QARA 2C7HA 3TCAA 4EUTA 2NR2A 4F7ZA 3U30A 1V81A 4G0NB 3QX1A 1GC6A 4MJSA 1LQBA 2G45B 1T0YA 2G3QB 2NBUA 1OQYA 1WM2A 2KDEB 3VAWA 4ANUA 3DBHI 3PRZA 5IA7A 4FADA 2LVPA 2DENB 3A4RA 3MJWA 1GUAB 3VFKA 3PGEA 3ZKJC 2RR9A 1AARA 3PVLA 2MBHA 1P3QU 2K6DB 2DYBA 2REXA 3Q3FA 4KDLB 1L2NA 2WWZA 2GMIC 4K7SA 4HDQA 3H6NA 4HWIB 1WH3A 2PE6B 3PRMB 1Q5WB 1EF1A 1WJUA 4EZJA 4FA6A 5CHFA 1E7UA 2LVOA 2OOBB 2V1YA 1WM3A 3H1UA 4NNJB 1S1QB 4ZRIA 5E6PA 5AZGA 3ZW3A 1NDDA 3ZO5B 3IHPC 4I6LB 1X1MA 5D94A 3N32A 2KVRA 2J0KA 1WMHA 3QHTA 4E74A 2IO3B 2ZPNA 3D32A 3KUDB 4W9FA 3OJ4B 2AWTA 1GNUA 2MBOA 3OJ3A 1V5OA 4KSKC 3ZRFA 1UZXB 3LDZE 3HIZA 2A5UA 2EMSA 1YIWA 2LRWA 2N9PC 3MHSD 1E90A 2FNJB 2ZNVB 3AU5A 3ENEA 5L95C 5C1ZA 2RD0A 3ZNID 2PPHA 3W1YA 1YX5B 4LDTD 2JRIB 2KFKA 1WIAA 2K8BA 1OGWA 4MSMB 2Z59B 2B3AA 3K9OB 2DAFA 4GDKA 3WALA 1EF5A 2M0XA 4E3CA 1WGGA 3DBSA 2N9XA 3CSTA 3VDZA 1KM7A 4AUQC 2PE9A 2MRPA 1WZ3A 2GBRA 2N7DA 2HJ8A 4KIKA 1E7VA 2KXJA 3B0AA 3TBLD 2C5LC 4BKSA 3DVNV 3SD5A 4DHZE 2MA9B 2BYEA 1H8CA 3C0RB 3PHXB 1ZKHA 2KJHB 5G2NA 2KTFA 3RT3B 2LGDA 3QWZB 4FBJB 4OVVA 1V9JA 2IYDB 2KTRA 4A3OA 2V3SA 4HLEA 1WR1A 2K6QA 1WE7A 4W9KA 2KFJA 2N7EA 2CKHB 3M3JA 5KHQA 2N9EB 3JSVA 4TQ1A 1U4AA 4KZ0A 2L8JA 2WX1A 3PV1A 1S3SG 1WX7A 2KJRA 2DZKA 3A33B 3OLMD 2KHWB 2VRRB 3UQBA 2N4FA 3VXWA 1H4RA 2BKFA 2MP2B 3PSEB 4ZRKA 2M17A 1Q1OA 2RGFA 3NHEB 1YJ1A 4F8CB 2C7NB 2LD9A 5JHAA 3HK0A 2ZPYA 4RM8A 1TGZB 5E6OA 2YVCA 4IM2A 1UGMA 5JH5C 3N30A 4DDID 4EZKA 4WWNA 4KZCA 2DYOA 4ZRJA 2LJ5A 3DQVA 3VUWA 4A3PA 1WGRA 2I1JA 2XK5A 4FHJA 4NQKE 2L0FA 3H7PA 3SU8X 4BKSD 1XD3B 2ZCCA 5DCNA 3IVFA 3CSFA 4PS7A 4I6PA 1WXSA 3BINA 2FCSA 1WY8A 2NPTA 3O65B 4HK2A 1GG3A 1RFAA 4ICUA 1RAXA 3QC8B 3L10B 3ML8A 3PHWB 1V6EA 2DHZA 4NQLB 5E6NA 1XQQA 1OEYA 5CHWA 2LRUA 2FIFA 2ZZPB 3IBEA 2ZVOA 4PS8A 2ZCBA 2O2VB 1NBFC 4ZDVA 4FULA 2K1FA 1EUVB 1WF9A 5JZEB 3UF8A 2DYMA 4MDKE 1E5WA 2LGXA 2LVQA 2JVCA 1UBIA 3JW0X 4G50A 3R7QA 4IW0A 4NPNA 2NVUI 2MX2A 1JRUA 4FJVB 4MGZE 5DPRA 5J2RA 3KYCD 2LXAA 3ZTCA 1YQBA 1E8WA 4G11A 4F1SA 1LFDA 2KLGA 3EFUA 4AOFA 3DOWA 3N3KB 3UIPB 5LXHA 3X23A 3ZNZB 2MLBA 4CO7A 3A9JB 2G4DB 4GOCA 2KD0A 1WXMA 5KHOA 2L0TA 2GBJA 2NCNA 3QQ8B 2YLMA 4X57B 3L08A 4XX5A 4MJSB 4JLCA 2AL3A 3L17A 1R4NI 5DPSA 1FXTB 4IM0A 1PQSA 4W9GA 4BBNC 2JZZA 4LDTB 2IBIB 4YL8A 3TL5A 3DVNU 5IAAC 1P98A 5CX3A 3PS6A 4ZYNA 3SDLC 3EC8A 2FCMA 4K1RB 2XBBC 5AZFA 1WYWB 3GOEA 4EFOA 4G3XB 4K81A 3AU4A 3DDCB 3RYTA 4IUMB 1UELA 4B6WA 3B08A 4FJYA 1Z5SB 3PLVA 1IYFA 2HE7A 3TMPB 3ZDTA 2KMAA 2KWCA 1WXAA 1SE9A 5D2MB 4TUUA 2L76A 4P7IA 3RULA 5AZHA 2LI5A 1V2YA 4IG7B 2D10A 1WMHB 2CU1A 2KX0A 2KJ6A 3V62A 3PPAA 3LJ3A 2M4NA 4WQOB 3A1QB 3DCGA 3Q3JA 3NS8A 4I6NB 4M0WB 2JPHA 1VCBA 2R2QA 4HVBA 3CMMB 5CHVC 2KKCA 3A9KA 2ZJDA 4HPMB 3M62B 3APCA 4W9JA 3ZDMC 2IY1B 2JUOA 2KFKB 3HM6X 3WAPA 4MSQB 4N9F4
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DBL I;  2JF5 A;  2KX3 A;  5FR6 A;  2KWV B;  5EDS A;  4GXB A;  3EEC A;  2ZVN A;  2EMT A;  3VUX A;  1KJT A;  3WAM A;  2O6V A;  3ZRC A;  2KDI A;  4A20 A;  1UH6 A;  1WGH A;  1V5T A;  2MWS B;  3VH4 B;  5LXI B;  1WFY A;  3V6E B;  2RSU A;  2GBN A;  1WE6 A;  2L05 A;  4K7W A;  5GMV A;  2BGF A;  3OAW A;  4TKN A;  2FUH B;  2MP2 A;  3WIM A;  2R2O A;  1YD8 U;  2I1K A;  3U7D A;  1J8C A;  3UGB B;  4NAW B;  1UBQ A;  2K8H A;  2IZV B;  2KTR B;  4HXD A;  3ECI A;  1YX6 B;  2IO1 B;  2AEH A;  4W9C A;  1TZ1 A;  4MEL A;  1GC7 A;  3JSV B;  3VUY A;  3AUL A;  4ASW C;  4CHK A;  4URK A;  1QZE A;  4W9L A;  4AP4 C;  1P1A A;  4HJK A;  2JT4 B;  5D6J B;  2DZJ A;  4WJQ A;  2J7Q B;  3W1S C;  3ZIM A;  4GN1 A;  4II2 B;  3UQA A;  4DHZ B;  2KDB A;  3VTW A;  4TV3 A;  4J6I A;  4BOZ B;  1TTN A;  4W9E A;  2PEA A;  2WX0 A;  3UIO B;  2C7M B;  2QHO A;  4RMA A;  1V86 A;  3WA0 A;  4B9K A;  4GGQ A;  4B95 A;  2LWP A;  4JQW C;  1F9J A;  2M1M A;  2DZI A;  3HM3 A;  2J0M A;  4XC2 A;  2O6V D;  4GIV A;  2LGY A;  2W9N A;  4TQ0 A;  2FCQ A;  2N1W A;  1BT0 A;  1WZ0 A;  2CR5 A;  1WJ6 A;  2FCN A;  4GDL B;  5CTR C;  1WX9 A;  2KLC A;  1WJ4 A;  3H7P B;  4EKU A;  2WYQ A;  3PRP B;  3QA8 A;  4MEM A;  2DAJ A;  2BWF A;  2LUE A;  2ZNV C;  2KMC A;  4GU2 A;  1WXV A;  4PS3 A;  2NPT B;  3L0W B;  4W9H A;  3R66 C;  3UIN B;  1Y8R C;  3ZNG C;  2KC1 A;  4MH0 E;  4WWP A;  2KQ7 A;  4DWF A;  1K8R B;  3IFW B;  2AL6 A;  2K25 A;  3QCA A;  5G55 A;  3APF A;  3WAN A;  4BKG A;  2UYZ B;  1Z2M A;  4JL9 A;  3A9J A;  1EO6 A;  3W1S A;  2BKR B;  2JWZ A;  5JHB A;  5DPW A;  3NZS A;  2ASQ A;  3SHQ A;  1ISN A;  4II3 B;  4WJO A;  4FLH A;  4KDI C;  2CHX A;  2HD5 B;  4KVG B;  2MW5 A;  3ALB A;  3KW5 B;  1R4M I;  1C1Y B;  3KH0 A;  3RZW C;  4DXA B;  1E8Z A;  2CS4 A;  1Q0W B;  3BY4 B;  3KUC B;  4K7U A;  4LCD E;  5DPT A;  2D2Q A;  5J17 A;  1WGY A;  3RUI B;  4XZ4 A;  4MGI E;  2M8S A;  3PZD A;  4WWO A;  3GZN I;  2KAN A;  3QAQ A;  1SGH A;  3NY5 A;  4MM3 A;  2Z0E B;  3AI5 A;  4GMV A;  3KYD D;  3M63 B;  2KOX A;  4IWQ A;  5TR5 A;  1TBE A;  1E8X A;  4HCN B;  1ZW7 A;  2DX5 B;  2GBM A;  2HTH A;  2KC2 A;  2MBE A;  1A5R A;  4ANV A;  4W9D A;  2AYO B;  4WJP A;  1L7Y A;  1M94 A;  2DZM A;  2XEW A;  4OVU A;  1P0R A;  1J19 A;  3CF6 E;  1HE8 A;  2FID A;  5D7G A;  3QK0 A;  3EHV A;  4DBG A;  2D11 A;  1VD2 A;  4MGK E;  4FHK A;  4DHJ B;  4RM9 A;  3ZNH B;  1CMX B;  4GSW A;  1ZGU B;  3M95 A;  4BKT A;  1D3Z A;  3A1Q A;  3I3T B;  1UD7 A;  1WX8 A;  4BFR A;  3RZF A;  4EZL A;  3R7R A;  2IO2 B;  2MSE D;  2D3G A;  3NZU A;  3TJP A;  2KZR A;  2CHW A;  3X0W A;  5J18 A;  4NJ7 A;  4BVU C;  2KDF B;  4HPL B;  3ZLZ A;  2JY6 A;  2MBB B;  3L54 A;  3HHM A;  2NBV B;  3V6C B;  4GDK B;  4CYE A;  1V80 A;  2KNB A;  2JZ3 B;  3ONS A;  2C60 A;  2KWU B;  4DHJ D;  3V61 A;  2JXX A;  2NS5 A;  4M8N A;  1WRD B;  4JIO U;  5AEK B;  2L00 B;  2KN5 A;  2WDT B;  3JYU A;  1SIF A;  4IWO A;  3U8Z A;  4DK5 A;  4WJN A;  1RLF A;  4PYU A;  3NOB A;  4KIK B;  2NBW B;  3AXC A;  4IWP A;  2KK8 A;  5BO4 B;  1I42 A;  1XT9 B;  3ZVV A;  2UWQ A;  3A9K B;  3TIX A;  2G4S A;  3RCZ A;  2LAS A;  3L13 A;  4BOS C;  2LXC A;  3DVG Y;  4E71 A;  3P2B A;  4NAW A;  2EKE C;  4EOY A;  3PRE A;  1KOT A;  1IP9 A;  4W9I A;  3H9D A;  2GOW A;  1C3T A;  2L7R A;  2O6V B;  4JGH B;  2A4Z A;  3APD A;  4LJO B;  2L3Z A;  2JRH A;  5LLI A;  4AJY B;  2J0J A;  4NJ6 A;  4AJW A;  4GB9 A;  3WAO A;  3ZUN A;  3KVF B;  5L83 A;  3PTF C;  4NY0 A;  3H7S A;  3VVW B;  1WR6 E;  4AWJ A;  4LJP B;  2KQS A;  3KUZ A;  4MGY E;  3B1L X;  1LM8 B;  4M8M A;  2MCN B;  2Z0D B;  4IM3 A;  3VTV A;  3K9P B;  3VTU A;  2D07 B;  1I35 A;  1KLV A;  4ANX A;  2PJH A;  3VHT C;  1GJZ A;  3ML9 A;  1RRB A;  3IG3 A;  2LZ6 A;  4WAA A;  2BF8 B;  4PYZ A;  2OJR A;  4FJZ A;  1IPG A;  5HKH A;  4HCP B;  2BWE S;  2C9W B;  1OEY J;  2IY0 B;  1LXD A;  3QJZ A;  4HDO A;  4EEW A;  2BPS A;  2KO3 A;  3R3M A;  4BBN F;  3L16 A;  3PT2 B;  2K39 A;  3DBR I;  1WI0 A;  2O2V A;  3JVZ X;  1NI2 A;  3A4S C;  2XK5 B;  2Y5B B;  3RD2 A;  1MG8 A;  2BYV E;  3PLU A;  4GDL A;  4KSL C;  3V60 A;  4ICV A;  4ANW A;  2V4L A;  3T9L A;  5C23 A;  2BYF A;  1J0G A;  3VQI A;  2CHZ A;  2ZEQ A;  3MTN B;  4DDG D;  3ZTD A;  4FN2 A;  4KV2 A;  2RPQ A;  1V49 A;  3T8M A;  2K8C A;  1G6J A;  1P9D U;  2GBK A;  2IO0 B;  3DPD A;  1WGD A;  1WJN A;  3DVG X;  2MQJ A;  2MBQ A;  1E8Y A;  3VH3 B;  2FAZ A;  3QIJ A;  1OTR B;  4IC7 B;  2N1V A;  3S2A A;  3QAR A;  2C7H A;  3TCA A;  4EUT A;  2NR2 A;  4F7Z A;  3U30 A;  1V81 A;  4G0N B;  3QX1 A;  1GC6 A;  4MJS A;  1LQB A;  2G45 B;  1T0Y A;  2G3Q B;  2NBU A;  1OQY A;  1WM2 A;  2KDE B;  3VAW A;  4ANU A;  3DBH I;  3PRZ A;  5IA7 A;  4FAD A;  2LVP A;  2DEN B;  3A4R A;  3MJW A;  1GUA B;  3VFK A;  3PGE A;  3ZKJ C;  2RR9 A;  1AAR A;  3PVL A;  2MBH A;  1P3Q U;  2K6D B;  2DYB A;  2REX A;  3Q3F A;  4KDL B;  1L2N A;  2WWZ A;  2GMI C;  4K7S A;  4HDQ A;  3H6N A;  4HWI B;  1WH3 A;  2PE6 B;  3PRM B;  1Q5W B;  1EF1 A;  1WJU A;  4EZJ A;  4FA6 A;  5CHF A;  1E7U A;  2LVO A;  2OOB B;  2V1Y A;  1WM3 A;  3H1U A;  4NNJ B;  1S1Q B;  4ZRI A;  5E6P A;  5AZG A;  3ZW3 A;  1NDD A;  3ZO5 B;  3IHP C;  4I6L B;  1X1M A;  5D94 A;  3N32 A;  2KVR A;  2J0K A;  1WMH A;  3QHT A;  4E74 A;  2IO3 B;  2ZPN A;  3D32 A;  3KUD B;  4W9F A;  3OJ4 B;  2AWT A;  1GNU A;  2MBO A;  3OJ3 A;  1V5O A;  4KSK C;  3ZRF A;  1UZX B;  3LDZ E;  3HIZ A;  2A5U A;  2EMS A;  1YIW A;  2LRW A;  2N9P C;  3MHS D;  1E90 A;  2FNJ B;  2ZNV B;  3AU5 A;  3ENE A;  5L95 C;  5C1Z A;  2RD0 A;  3ZNI D;  2PPH A;  3W1Y A;  1YX5 B;  4LDT D;  2JRI B;  2KFK A;  1WIA A;  2K8B A;  1OGW A;  4MSM B;  2Z59 B;  2B3A A;  3K9O B;  2DAF A;  4GDK A;  3WAL A;  1EF5 A;  2M0X A;  4E3C A;  1WGG A;  3DBS A;  2N9X A;  3CST A;  3VDZ A;  1KM7 A;  4AUQ C;  2PE9 A;  2MRP A;  1WZ3 A;  2GBR A;  2N7D A;  2HJ8 A;  4KIK A;  1E7V A;  2KXJ A;  3B0A A;  3TBL D;  2C5L C;  4BKS A;  3DVN V;  3SD5 A;  4DHZ E;  2MA9 B;  2BYE A;  1H8C A;  3C0R B;  3PHX B;  1ZKH A;  2KJH B;  5G2N A;  2KTF A;  3RT3 B;  2LGD A;  3QWZ B;  4FBJ B;  4OVV A;  1V9J A;  2IYD B;  2KTR A;  4A3O A;  2V3S A;  4HLE A;  1WR1 A;  2K6Q A;  1WE7 A;  4W9K A;  2KFJ A;  2N7E A;  2CKH B;  3M3J A;  5KHQ A;  2N9E B;  3JSV A;  4TQ1 A;  1U4A A;  4KZ0 A;  2L8J A;  2WX1 A;  3PV1 A;  1S3S G;  1WX7 A;  2KJR A;  2DZK A;  3A33 B;  3OLM D;  2KHW B;  2VRR B;  3UQB A;  2N4F A;  3VXW A;  1H4R A;  2BKF A;  2MP2 B;  3PSE B;  4ZRK A;  2M17 A;  1Q1O A;  2RGF A;  3NHE B;  1YJ1 A;  4F8C B;  2C7N B;  2LD9 A;  5JHA A;  3HK0 A;  2ZPY A;  4RM8 A;  1TGZ B;  5E6O A;  2YVC A;  4IM2 A;  1UGM A;  5JH5 C;  3N30 A;  4DDI D;  4EZK A;  4WWN A;  4KZC A;  2DYO A;  4ZRJ A;  2LJ5 A;  3DQV A;  3VUW A;  4A3P A;  1WGR A;  2I1J A;  2XK5 A;  4FHJ A;  4NQK E;  2L0F A;  3H7P A;  3SU8 X;  4BKS D;  1XD3 B;  2ZCC A;  5DCN A;  3IVF A;  3CSF A;  4PS7 A;  4I6P A;  1WXS A;  3BIN A;  2FCS A;  1WY8 A;  2NPT A;  3O65 B;  4HK2 A;  1GG3 A;  1RFA A;  4ICU A;  1RAX A;  3QC8 B;  3L10 B;  3ML8 A;  3PHW B;  1V6E A;  2DHZ A;  4NQL B;  5E6N A;  1XQQ A;  1OEY A;  5CHW A;  2LRU A;  2FIF A;  2ZZP B;  3IBE A;  2ZVO A;  4PS8 A;  2ZCB A;  2O2V B;  1NBF C;  4ZDV A;  4FUL A;  2K1F A;  1EUV B;  1WF9 A;  5JZE B;  3UF8 A;  2DYM A;  4MDK E;  1E5W A;  2LGX A;  2LVQ A;  2JVC A;  1UBI A;  3JW0 X;  4G50 A;  3R7Q A;  4IW0 A;  4NPN A;  2NVU I;  2MX2 A;  1JRU A;  4FJV B;  4MGZ E;  5DPR A;  5J2R A;  3KYC D;  2LXA A;  3ZTC A;  1YQB A;  1E8W A;  4G11 A;  4F1S A;  1LFD A;  2KLG A;  3EFU A;  4AOF A;  3DOW A;  3N3K B;  3UIP B;  5LXH A;  3X23 A;  3ZNZ B;  2MLB A;  4CO7 A;  3A9J B;  2G4D B;  4GOC A;  2KD0 A;  1WXM A;  5KHO A;  2L0T A;  2GBJ A;  2NCN A;  3QQ8 B;  2YLM A;  4X57 B;  3L08 A;  4XX5 A;  4MJS B;  4JLC A;  2AL3 A;  3L17 A;  1R4N I;  5DPS A;  1FXT B;  4IM0 A;  1PQS A;  4W9G A;  4BBN C;  2JZZ A;  4LDT B;  2IBI B;  4YL8 A;  3TL5 A;  3DVN U;  5IAA C;  1P98 A;  5CX3 A;  3PS6 A;  4ZYN A;  3SDL C;  3EC8 A;  2FCM A;  4K1R B;  2XBB C;  5AZF A;  1WYW B;  3GOE A;  4EFO A;  4G3X B;  4K81 A;  3AU4 A;  3DDC B;  3RYT A;  4IUM B;  1UEL A;  4B6W A;  3B08 A;  4FJY A;  1Z5S B;  3PLV A;  1IYF A;  2HE7 A;  3TMP B;  3ZDT A;  2KMA A;  2KWC A;  1WXA A;  1SE9 A;  5D2M B;  4TUU A;  2L76 A;  4P7I A;  3RUL A;  5AZH A;  2LI5 A;  1V2Y A;  4IG7 B;  2D10 A;  1WMH B;  2CU1 A;  2KX0 A;  2KJ6 A;  3V62 A;  3PPA A;  3LJ3 A;  2M4N A;  4WQO B;  3A1Q B;  3DCG A;  3Q3J A;  3NS8 A;  4I6N B;  4M0W B;  2JPH A;  1VCB A;  2R2Q A;  4HVB A;  3CMM B;  5CHV C;  2KKC A;  3A9K A;  2ZJD A;  4HPM B;  3M62 B;  3APC A;  4W9J A;  3ZDM C;  2IY1 B;  2JUO A;  2KFK B;  3HM6 X;  3WAP A;  4MSQ B;  4N9F 4; 
#chains in the Genus database with same CATH topology
 2JYE A;  2GRI A;  5FR6 A;  1SB3 C;  2ZVN A;  2KYW A;  1TY0 A;  2KDI A;  1V5T A;  3VH4 B;  3V6E B;  1WRI A;  2LJI A;  1JWS D;  2L05 A;  1ET6 A;  2FUH B;  2R2O A;  3U7D A;  2JXT A;  2IZV B;  3IAS 1;  1OQQ A;  2AEH A;  4MEL A;  3AUL A;  4CHK A;  4URK A;  3B2F A;  5EE1 A;  3ZIM A;  3UQA A;  2J42 A;  4DHZ B;  2WX0 A;  2C7M B;  4RMA A;  2Q5W D;  4B9K A;  1F9J A;  2DZI A;  4ARC A;  4GIV A;  4ITK A;  1BT0 A;  1T0S C;  4YSY B;  1KF6 B;  2KLC A;  1WJ4 A;  4EKU A;  1N5W A;  2WYQ A;  3QA8 A;  1R4M B;  2DAJ A;  2BWF A;  1TS5 A;  3L0W B;  4W9H A;  4DXF A;  3R66 C;  5HI1 A;  5T8I A;  2KC1 A;  3U7Z A;  3ZNG C;  1LGR A;  3RFZ B;  1C76 A;  1K8R B;  5MPO A;  2AL6 A;  4XGA B;  1ZPS A;  1Z2M A;  4JL9 A;  3A9J A;  3W1S A;  5JHB A;  5DPW A;  3SHQ A;  1ISN A;  5FR3 A;  4KDI C;  2SEB D;  1YN3 A;  2Z8L A;  3KW5 B;  1R4M I;  1C9F A;  3EGR A;  3OWE B;  2BB6 A;  3NRZ A;  4XZ4 A;  2J52 A;  4MGI E;  2IGG A;  1E0Z A;  1E7P B;  1NVI D;  1EM7 A;  4IWQ A;  1E8X A;  4HCN B;  3GS2 A;  5IO9 A;  4ANV A;  4WJP A;  2DZM A;  3UI3 A;  1SE4 A;  2D11 A;  4FHK A;  3VRB B;  1V1P A;  3R2T A;  4GSW A;  3M95 A;  3A1Q A;  1V1O A;  2JSV X;  1MG4 A;  3NZU A;  2KZR A;  1BML C;  3RNB C;  4NJ7 A;  2JY6 A;  2KNB A;  3GP7 A;  2GI9 A;  4OZB A;  2IND C;  5AEK B;  4HJG E;  3AE4 B;  1RLF A;  2NBW B;  3AXC A;  4IWP A;  2KK8 A;  3ZVV A;  2UWQ A;  1HA5 A;  1TKY A;  3A9K B;  3L13 A;  2EKE C;  4EOY A;  4W9I A;  4JGH B;  2PVG C;  5LLI A;  4C80 A;  1I7H A;  4LJP B;  4MGY E;  2DBY A;  1LM8 B;  4IM3 A;  3VTV A;  3K9P B;  2D07 B;  1I35 A;  1C79 A;  1ZOY B;  1GJZ A;  3ZXR A;  3I5J C;  4WAA A;  4XWW A;  1SSN A;  4PT5 A;  1IPG A;  5HKH A;  2AX5 A;  3FIL A;  4HCP B;  1OEY J;  3QJZ A;  1LXD A;  3R3M A;  4BBN F;  2GB1 A;  5HG2 A;  2O2V A;  4YT0 B;  2Y5B B;  4S17 A;  1MG8 A;  2BYV E;  2M19 A;  4ANW A;  5C23 A;  4B0M A;  4XE0 A;  3ZTD A;  4KV2 A;  1XF5 L;  1N61 A;  1ZUD 2;  1P9D U;  2GBK A;  1WGD A;  5IP4 D;  1WJN A;  2MQJ A;  3QIJ A;  1ET9 A;  2C7H A;  4EUT A;  2QEJ C;  1V81 A;  4G0N B;  4WUR A;  1A70 A;  4MJS A;  4JX1 C;  2KDE B;  4ANU A;  3PRZ A;  3HVD A;  1KLU D;  2LVP A;  4LK0 M;  1VZ7 A;  1XO3 A;  4YTM B;  1FNV A;  2RR9 A;  2Y5P A;  3MC0 B;  2MBH A;  1AN8 A;  1JML A;  3N20 C;  2GMI C;  4HDQ A;  3H6N A;  1XXG A;  1YQ4 B;  1QOB A;  5CHF A;  4NNJ B;  3H1U A;  1WM3 A;  5E6P A;  4ZRI A;  3ZO5 B;  2BVC A;  2BQQ A;  3N32 A;  2KVR A;  1TS3 A;  2J0K A;  4E74 A;  2NMQ A;  1UWX A;  4W9F A;  3OJ4 B;  1HEZ E;  1GNU A;  2JYT A;  2VH1 A;  1N60 A;  3ZRF A;  2OHF A;  3U52 E;  1E90 A;  3AU5 A;  5L95 C;  3PZ7 A;  4LDT D;  1FFU A;  3AEB B;  1OGW A;  2E3T A;  4GDK A;  3K9O B;  2DAF A;  1PGB A;  5D3D A;  2M0X A;  4E3C A;  1FPY A;  1C4A A;  1N63 A;  2K5P A;  2N9X A;  3DBS A;  3CST A;  3VDZ A;  4AUQ C;  2GBR A;  1FEH A;  4KIK A;  3OG5 A;  4BKS A;  2BYE A;  2WXJ A;  5EE3 A;  4A3O A;  4HLE A;  1UUP A;  4W9K A;  2N7E A;  3FKY A;  4A9A A;  2JWU A;  2KJR A;  2DZK A;  3BWU D;  3UQB A;  2BS3 B;  3NHE B;  4R3D A;  1F2R C;  4ZOH C;  2ZPY A;  1WXQ A;  1TGZ B;  3TEZ A;  3AE9 B;  3DQV A;  1WGR A;  2I1J A;  2JZP A;  3CWI A;  3NJT A;  4BKS D;  1XD3 B;  1ZXI A;  3IVF A;  3TEW A;  1WXS A;  2V3P A;  4M01 A;  1WY8 A;  3O65 B;  3KQ4 A;  2WXF A;  3QC8 B;  3AEF B;  2D3C A;  3L10 B;  3ML8 A;  3PHW B;  1XQQ A;  1JWB D;  1KTK A;  4LNI A;  2INP E;  3HUI A;  1P7F A;  3UF8 A;  2W82 A;  1JRP A;  4G50 A;  2LVQ A;  1IUE A;  3BYT B;  5LXH A;  2WLB A;  3A9J B;  2NCN A;  3TSS A;  3RNA C;  4JLC A;  3AN1 A;  3L17 A;  1PQS A;  2VH2 A;  3ZXV A;  1FCL A;  2INC C;  4K1R B;  5FK9 C;  2XBB C;  5AZF A;  1WYW B;  4EFO A;  1HQR D;  3BII D;  3B08 A;  1IYF A;  2HE7 A;  2W3R A;  3TEX A;  3TMP B;  2WXG A;  1F0Z A;  3E9S A;  2KWC A;  1VZ8 A;  2CU1 A;  2KQ4 X;  2WXP A;  1C4P A;  3A1Q B;  3DCG A;  2WXO A;  4M0W B;  3NS8 A;  2JPH A;  1F77 A;  3CMM B;  5CHV C;  2KKC A;  2ACZ B;  2ZJD A;  3A9K A;  3APC A;  4HRS A;  2IY1 B;  3WAP A;  4MSQ B;  4ZYN A;  2XN9 C;  4GXB A;  3EEC A;  1C4C A;  3SR6 A;  3WAM A;  2L1A A;  2MJE A;  3Q8B A;  1E6E B;  5LXI B;  3MJ5 A;  2AQ3 B;  2ONQ A;  1WE6 A;  1STE A;  2JX5 A;  5IN7 A;  2V0G A;  1YD8 U;  5D3I B;  3Q8C A;  4KKI A;  1UBQ A;  4HXD A;  4W9C A;  1JWA D;  1QZE A;  4W9L A;  1SBB B;  3RNE C;  1L4Z B;  3C19 A;  4GN1 A;  4JWS C;  2KDB A;  3VTW A;  4RH6 A;  3I9V 1;  3DHH C;  4W9E A;  1V86 A;  3BK1 A;  4GGQ A;  2LWP A;  2MJD A;  2M1M A;  2LGY A;  2FCQ A;  1DOY A;  4IDI A;  1J7B A;  5CTR C;  3H7P B;  4RF1 A;  1VRA B;  1NYQ A;  4MEM A;  1XLO A;  2ZNV C;  4YSX B;  4LNN A;  3MC8 A;  1TZO A;  4DWF A;  2WU5 B;  2K25 A;  1FRD A;  3APF A;  3KLS X;  4BKG A;  2RMM A;  4OVZ A;  1ZDX A;  4FLH A;  2X8X X;  4YSZ B;  2CHX A;  1WSP A;  1C1Y B;  1E8Z A;  1Q0W B;  4LCD E;  5DPT A;  3DWM A;  1TY2 A;  1KRH A;  4WWO A;  3GZN I;  1XCQ L;  2KAN A;  1BXT A;  4NZL B;  2PIA A;  3AI5 A;  2KOX A;  1TBE A;  1ZW7 A;  2DX5 B;  1WWT A;  3ZGZ A;  3NG0 A;  1A5R A;  1M94 A;  2XEW A;  1AW7 A;  1J19 A;  2FID A;  4MGK E;  1CMX B;  1ZGU B;  3NZ3 A;  4XDC A;  1WX8 A;  4BFR A;  4EZL A;  3R7R A;  4QAY A;  1RWS A;  3TJP A;  5J18 A;  4BVU C;  2KDF B;  4HPL B;  3ZLZ A;  2MBB B;  2NBV B;  3V6C B;  4GDK B;  3T3N A;  4DHJ D;  1CZP A;  2JXX A;  2KWD A;  1SIF A;  4WJN A;  4KIK B;  3AE7 B;  3BZD B;  1I42 A;  1XT9 B;  3RCZ A;  2WDR B;  4RCO A;  1WYG A;  3Q3M C;  3BK2 A;  1KOT A;  5BYS A;  1DGJ A;  2GOW A;  2O6V B;  4RF0 A;  2A4Z A;  4Q2J A;  1KFY B;  2MH7 A;  4AJW A;  4NJ6 A;  5L83 A;  4RGT A;  3AE2 B;  3H7S A;  3DHG C;  4AWJ A;  2KQS A;  4XYC A;  2IJ0 A;  1KLV A;  4N58 A;  3VHT C;  3ML9 A;  4FJZ A;  4HPP A;  2BWE S;  2C9W B;  4EEW A;  1YOV B;  3PT2 B;  2BS2 B;  2Y5C A;  3JVZ X;  1NI2 A;  2LEK A;  1JW9 D;  3RD2 A;  4GDL A;  3PLU A;  2TSS A;  1J0G A;  3DBH B;  3VQI A;  2CHZ A;  1LO5 D;  2M0A A;  1T0Q C;  1V49 A;  1G6J A;  2FBW B;  1KH0 A;  2IO0 B;  3DWG C;  2MBQ A;  1E8Y A;  1OTR B;  3BVG A;  5TSS A;  1JWU D;  3S2A A;  3QAR A;  4YTP B;  3QX1 A;  1SJE D;  4C7Y A;  3MP9 A;  1LQB A;  2G45 B;  1CK1 A;  1OQY A;  1WM2 A;  3DBH I;  4NJC A;  3SFE B;  1IGC A;  1GUA B;  2WXI A;  2MEK A;  4A90 A;  2DYB A;  2N0S B;  1FXI A;  4KDL B;  4D2K A;  2WWZ A;  1ZP0 B;  3PRM B;  1Q5W B;  1EF1 A;  2OED A;  2OOB B;  3ZW3 A;  1NDD A;  1C77 A;  2EKI A;  1VJK A;  3N1X C;  3KUD B;  3D32 A;  1FCC C;  3P4S B;  3J9C A;  3OJ3 A;  1MFW A;  1V5O A;  3ONS A;  1UZX B;  4LTU A;  2FNJ B;  2ZNV B;  4M0W A;  2PPH A;  1YX5 B;  1EWY C;  2Z59 B;  2B3A A;  2ZW0 A;  1YNT E;  1GAQ B;  3BYY B;  1KM7 A;  2PE9 A;  2BYT A;  1K50 A;  2N7D A;  3B0A A;  1ZDV A;  4DHZ E;  2MA9 B;  2WXN A;  2PVO D;  1ZKH A;  5G2N A;  2KTF A;  2LGD A;  3QWZ B;  4OVV A;  1V9J A;  4US8 A;  1GOZ A;  2IYD B;  1VZ6 A;  3R8B A;  2K6Q A;  1WE7 A;  3Q3O C;  5KHQ A;  1T5X D;  4TQ1 A;  1L6U A;  1U4A A;  4KZ0 A;  1YJI A;  1PYW D;  1BUI C;  1S3S G;  2JQR B;  4OZC A;  3OLM D;  2KHW B;  2N4F A;  1L4D B;  2WXL A;  1H4R A;  3PSE B;  2M17 A;  1Q1O A;  1YJ1 A;  4OHJ A;  4F8C B;  2BS4 B;  2C7N B;  2KAJ A;  2LD9 A;  1SJH D;  3NVV A;  1ENF A;  2EEL A;  1ESF A;  4IM2 A;  1L5P A;  4MH8 A;  3V3X A;  4EZK A;  3GE8 C;  2DYO A;  1MJD A;  2LJ5 A;  1PDX A;  3VUW A;  2XK5 A;  3H7P A;  3SU8 X;  4GLS C;  2WQY B;  4HK2 A;  4HKQ A;  4P6V F;  4ICU A;  1ROE A;  3URY A;  4NQL B;  3IBE A;  4PS8 A;  2ZCB A;  2E6X A;  4JWU C;  4L1B A;  5I4D A;  3VR8 B;  4FUL A;  4KKJ A;  2ON8 A;  5JZE B;  1E5W A;  2JVC A;  1UBI A;  1FD6 A;  4IW0 A;  2LHD A;  1XLQ A;  1JRU A;  4FJV B;  2LXA A;  4US9 A;  4G11 A;  1DYQ A;  2LUM A;  1LFD A;  2KLG A;  3EFU A;  4AOF A;  3N3K B;  2I2Y A;  3X23 A;  3ZNZ B;  2BBC A;  2MLB A;  4CO7 A;  2G4D B;  1I4Q A;  4USA A;  1WXM A;  1J7C A;  2L0T A;  2GBJ A;  4WH4 A;  2V4I B;  4H2A A;  4X57 B;  3ZJV A;  2AL3 A;  3LXF A;  5DPS A;  2NTS A;  2JZZ A;  2IBI B;  1N5X A;  3DVN U;  4P16 A;  5IAA C;  3CIR B;  1YN5 A;  2BW2 A;  1P98 A;  5CX3 A;  4J3O D;  1EU4 A;  3P63 A;  1QF6 A;  2FCM A;  3GOE A;  1XLP A;  1TKE A;  3ABV B;  4G3X B;  4WQM A;  2WXM A;  3AE5 B;  4B6W A;  2MHJ A;  4FJY A;  3PLV A;  4IKG A;  3EFC A;  3DBL B;  1WXA A;  1SE9 A;  4TUU A;  2L76 A;  4P7I A;  2LI5 A;  1V2Y A;  4IG7 B;  2D10 A;  4L23 A;  1WMH B;  4M02 A;  2KX0 A;  2KJ6 A;  5H8Y E;  1F1H A;  3AE6 B;  5AUK A;  3HRD D;  4DQO C;  3Q3J A;  4HVB A;  2N7J A;  2WXR A;  3HM6 X;  3ZJT A;  4N9F 4;  3DBL I;  2JF5 A;  2KX3 A;  1SE2 A;  2EMT A;  1KJT A;  2O6V A;  1VR9 A;  3ZRC A;  1QOA A;  2WXQ A;  2MWS B;  1E10 A;  1ZE3 D;  1WFY A;  2RSU A;  2GBN A;  2BT6 A;  2CJO A;  2BGF A;  3WIM A;  1J8C A;  2I1K A;  3UGB B;  5C2T B;  5BYQ A;  3ECI A;  1YX6 B;  2IPK D;  1TZ1 A;  1GC7 A;  3JSV B;  4ASW C;  3RNF C;  1P1A A;  5D6J B;  2DZJ A;  1YMH E;  4II2 B;  1FM0 D;  3EA6 A;  3PZ8 A;  1HXY D;  3UIO B;  2QHO A;  5BMI A;  2J0M A;  1MVK A;  2O6V D;  1CJE A;  2N1W A;  2UU7 A;  1I4R A;  5IKC M;  1WJ6 A;  2FCN A;  4GDL B;  2BTE A;  1SXT A;  2KMC A;  4GU2 A;  4PS3 A;  4ZYS A;  4WIP A;  3NVZ A;  4MH0 E;  4WWP A;  2KQ7 A;  3QCA A;  5G55 A;  3WAN A;  3W9C B;  1IBX A;  3IXS A;  2FUG 1;  1PFD A;  4II3 B;  2WNM A;  4WJO A;  2HD5 B;  4KVG B;  2MW5 A;  1K53 A;  3KH0 A;  1C78 A;  3BY4 B;  4K7U A;  3RUI B;  1HTO A;  2HDE A;  3QAQ A;  1OFF A;  1SGH A;  3NY5 A;  4MM3 A;  2Z0E B;  3NVW A;  2K0P A;  1I4G A;  5TR5 A;  1QLB B;  2GBM A;  2HTH A;  2KC2 A;  2QIE B;  2MBE A;  4IOI E;  1MHX A;  4OVU A;  1P0R A;  3CF6 E;  1HE8 A;  3EHV A;  2H88 B;  1SIJ A;  5GXG B;  1D6E C;  1VD2 A;  4AS1 A;  2I38 A;  3L4P A;  3EUB 2;  4FXC A;  1L0V B;  4BKT A;  3DHI C;  3I3T B;  4YTN B;  3RZF A;  2MSE D;  3ETR A;  1RM6 C;  2D3G A;  3L54 A;  3HHM A;  4ZHO A;  2ICI A;  1DOX A;  2HJ1 A;  4CYE A;  2JZ3 B;  2B76 B;  2KWU B;  3V61 A;  2NS5 A;  4M8N A;  1WRD B;  4JIO U;  2L00 B;  2WDT B;  4IWO A;  1RYJ A;  3AM9 A;  4PYU A;  3NOB A;  5BO4 B;  1MI0 A;  1TKG A;  3TIX A;  2LAS A;  1L0Y B;  2INN E;  2LXC A;  3DVG Y;  3P2B A;  4NAW A;  3PRE A;  1IP9 A;  4LJO B;  3APD A;  4AJY B;  3ZUN A;  3KVF B;  4YXD B;  3B1L X;  2MCN B;  3VTU A;  3IAM 1;  2PW9 A;  2GLS A;  2DNF A;  1RRB A;  3IG3 A;  3AEC B;  1JCK B;  3H8H A;  2BF8 B;  4PYZ A;  4XDD A;  1L0X B;  1YN4 A;  4BAX A;  2YEP F;  2IY0 B;  1R7S A;  2AQ1 B;  4HDO A;  2BPS A;  2KO3 A;  3L16 A;  2K39 A;  1XEE A;  2L83 A;  3A4S C;  2XK5 B;  4RFB A;  3V60 A;  4KSL C;  4ICV A;  1V8C A;  2BB5 A;  2V4L A;  3T9L A;  2N9L A;  2BYF A;  2ZEQ A;  3MTN B;  3RNG C;  3SEB A;  1FO4 A;  3T8M A;  2PKO A;  3DPD A;  3O13 A;  1FMA D;  2QC8 A;  3GZN B;  3VH3 B;  2FAZ A;  4IC7 B;  2NR2 A;  4K3C A;  4F7Z A;  2FE8 A;  1TS2 A;  1T0Y A;  1ACC A;  2NBU A;  5EE0 A;  2DEN B;  2OJW A;  2VZK B;  3AED B;  3A4R A;  3VFK A;  1OQR A;  1P3Q U;  1KLG D;  3I57 A;  2W55 A;  1M4V A;  1UGJ A;  3Q3F A;  1L2N A;  4K7S A;  4HWI B;  5G5G A;  3N1Y C;  4JE3 B;  2PLP A;  4PK1 A;  1E7U A;  1D5X C;  2V1Y A;  1F2R I;  3IHP C;  1QT9 A;  1X1M A;  4I6L B;  1RFK A;  4RNA A;  1WMH A;  3QHT A;  4JPS A;  4HKZ E;  2IO3 B;  2AWT A;  3LDZ E;  2EMS A;  1YIW A;  2WXH A;  3ENE A;  5C1Z A;  1J7A A;  2KMM A;  4RGO S;  2JRI B;  2K8B A;  3MC9 A;  1D5Z C;  4MSM B;  2KT7 A;  2MJ3 A;  2HJ8 A;  5BYR A;  1E7V A;  1FIQ A;  3DVN V;  3RI7 C;  3SD5 A;  3C0R B;  3HVZ A;  4ZHP A;  2QDF A;  2NTT A;  1WR1 A;  2CKH B;  4K3B A;  3JSV A;  5HHD G;  2WXK A;  2L8J A;  2WX1 A;  2RDG A;  3V05 A;  1WX7 A;  1XCT L;  2VRR B;  3VXW A;  3VR9 B;  4ZRK A;  5JHA A;  4RM8 A;  1JRO A;  1HTQ A;  2YVC A;  5IOI A;  1UGM A;  5JH5 C;  1GB1 A;  3N30 A;  4KX6 B;  4BZA A;  4A3P A;  4FHJ A;  2L0F A;  2ZCC A;  3CSF A;  4I6P A;  3BIN A;  2FCS A;  2DLB A;  4MT5 A;  1RFA A;  1RAX A;  2DHZ A;  5E6N A;  1T0R C;  2LRU A;  3ZYY X;  4P1C C;  2ZVO A;  4P1B C;  3W5V B;  2IGH A;  2QIL A;  2K1F A;  1EUV B;  2DYM A;  4MDK E;  2LGX A;  4M00 A;  4ZRP A;  2K22 A;  5EE9 A;  4NPN A;  3P42 A;  2MX2 A;  2D5G A;  3I63 C;  5DPR A;  3KYC D;  1YQB A;  1E8W A;  3KWV A;  4F1S A;  1IBX B;  4GOC A;  3QQ8 B;  2YLM A;  4XX5 A;  4A6Q A;  3RN9 C;  1FXA A;  4W9G A;  2JU6 X;  2LFI A;  4YL8 A;  3TL5 A;  3PS6 A;  3Q14 C;  2LHE A;  1V97 A;  4ACF A;  1ZXH A;  4MM3 B;  3W2D A;  1QOG A;  4K81 A;  3AU4 A;  3NS1 A;  1YQ3 B;  1UEL A;  2QJL A;  1XLN A;  3MFG A;  1Z5S B;  4N59 A;  3E56 A;  4C56 C;  5D2M B;  4YWG G;  3RUL A;  5AZH A;  2DWQ A;  3NVY A;  2KVZ A;  2RDB C;  3PPA A;  2M4N A;  2KN4 A;  3AE3 B;  3AMZ A;  3P1M A;  2R2Q A;  1SEB D;  4HPM B;  4W9J A;  2JUO A;  2KFK B;  2KWV B;  4LLG M;  2L52 A;  5EDS A;  1I4P A;  4RGM A;  3VUX A;  1UWM A;  4A20 A;  1UH6 A;  1WGH A;  1GPX A;  1HZ6 A;  1PGX A;  2LGI A;  4K7W A;  5GMV A;  1VLB A;  3OAW A;  4TKN A;  2MP2 A;  1UNS A;  4NAW B;  2K8H A;  2KTR B;  1QOF A;  2IO1 B;  3VUY A;  3W5U B;  4LNF A;  4AP4 C;  1CQV A;  4HJK A;  2JT4 B;  4WJQ A;  2PMV A;  2J7Q B;  3W1S C;  3WCQ A;  1MHH E;  5C3J B;  4TV3 A;  4J6I A;  4BOZ B;  1TTN A;  2PEA A;  2W3S A;  3IT6 B;  3WA0 A;  2WHI A;  4B95 A;  4JQW C;  1HZ5 A;  3HM3 A;  4XC2 A;  1TIF A;  4TQ0 A;  2W9N A;  1WZ0 A;  2CR5 A;  1WX9 A;  4WAF A;  3PRP B;  4AQ7 A;  5BMH A;  1FRR A;  1L6V A;  2LUE A;  1WXV A;  2NPT B;  3Q8A A;  5E6J A;  3UIN B;  1Y8R C;  5G5H A;  3IFW B;  5HFY A;  2UYZ B;  1EO6 A;  2BKR B;  2JWZ A;  2KDM A;  4UDU C;  3NZS A;  2QMT A;  2ASQ A;  2J53 A;  1D5M C;  3ALB A;  3RZW C;  4DXA B;  2CS4 A;  3N9Y C;  1T6B X;  3KUC B;  1TYG B;  2D2Q A;  5J17 A;  1EWC A;  1WGY A;  2M8S A;  3PZD A;  1GB4 A;  4GMV A;  3KYD D;  3M63 B;  1K52 A;  3Q8E A;  4W9D A;  2AYO B;  1L7Y A;  2KAC A;  2WP9 B;  1QQR A;  3QK0 A;  5D7G A;  2VZK D;  4DBG A;  4DXG A;  3MHZ A;  4DHJ B;  4RM9 A;  3RPF C;  3ZNH B;  4OW0 A;  2R61 A;  1AYF A;  1D3Z A;  2ZW1 A;  1UD7 A;  1JAL A;  4C4V B;  2IO2 B;  3ZQ4 A;  4A8X C;  4OZA A;  2CHW A;  3X0W A;  1E9M A;  4N6E B;  2SAK A;  1DOI A;  1V80 A;  3U4E G;  2C60 A;  4HRO A;  2KN5 A;  3JYU A;  3U8Z A;  1Y56 A;  4DK5 A;  1D4B A;  1PGA A;  1YJJ A;  1JWM D;  2G4S A;  4BOS C;  3AEA B;  4E71 A;  1FNU A;  1WGK A;  3H9D A;  2IGD A;  1C3T A;  4S0R A;  2L7R A;  2XNA C;  3DBR B;  5FKA C;  2L3Z A;  2JRH A;  3LB8 C;  2J0J A;  4GB9 A;  3WAO A;  3PTF C;  4NY0 A;  3VVW B;  1WR6 E;  1NYR A;  3KUZ A;  3Q6B A;  4M8M A;  2Z0D B;  1AWD A;  4KGR A;  4ANX A;  2PJH A;  1TT5 B;  2LZ6 A;  2W54 A;  1SE3 A;  1I4H A;  2OJR A;  2V9H A;  5LNK 1;  1K51 A;  4TMA B;  3AB5 A;  3DBR I;  1WI0 A;  2CJN A;  2PTL A;  2QSD A;  2LGS A;  2G9H D;  2WDQ B;  4DDG D;  2J4X A;  4FN2 A;  2RPQ A;  2K8C A;  3DVG X;  2Y3A A;  2N1V A;  3TCA A;  4XWT A;  1VDV A;  3U30 A;  2QCZ A;  1GC6 A;  2G3Q B;  5BMG A;  3VAW A;  5IA7 A;  1B1Z A;  3KWL A;  4FAD A;  1EU3 A;  3U2S C;  3MJW A;  4KGT A;  3Q69 A;  3PGE A;  3ZKJ C;  4NAM A;  3BVM A;  1AAR A;  3PVL A;  2K6D B;  3BVZ A;  2REX A;  4KGS A;  2N9K A;  3FC4 A;  1WH3 A;  2PE6 B;  4ARI A;  1WJU A;  4EZJ A;  4FA6 A;  3AH7 A;  2LVO A;  5AZG A;  1S1Q B;  5D94 A;  3RNC C;  2ZPN A;  1P7E A;  2MBO A;  4KSK C;  4DDI D;  3HIZ A;  2A5U A;  2LRW A;  2N9P C;  3MHS D;  3AV8 A;  2RD0 A;  3ZNI D;  5JXV A;  1Q10 A;  3AE8 B;  3W1Y A;  2KFK A;  1WIA A;  2K9X A;  3WAL A;  4B0E A;  1EF5 A;  4A55 A;  1WGG A;  1V1P B;  2M56 B;  3B9J A;  2MRP A;  1WZ3 A;  5H92 C;  1N6Z A;  2YEP B;  3TBL D;  2KXJ A;  2C5L C;  4REZ A;  4LNO A;  3VRA B;  1H8C A;  3PHX B;  2KJH B;  3RT3 B;  3NUH B;  4FBJ B;  2KTR A;  2WS3 B;  1B9R A;  2V3S A;  1QKZ A;  2KFJ A;  3M3J A;  3R2I A;  2N9E B;  3SFD B;  3TEY A;  1MPE A;  3PV1 A;  2D3B A;  3A33 B;  3P4R B;  1FNW A;  3C8Y A;  2BKF A;  2MP2 B;  2WGS A;  2RGF A;  3AEG B;  3HK0 A;  4O1N A;  4RGN A;  2RDH A;  5E6O A;  1JQ4 A;  1TJE A;  1I4X A;  1SF0 A;  4WWN A;  4KZC A;  2G1E A;  4ZRJ A;  1NEN B;  4NQK E;  4C00 A;  5DCN A;  4PS7 A;  1NEK B;  2NPT A;  1GG3 A;  4C7Z A;  3FIL B;  3P4P B;  1V6E A;  1OEY A;  3Q2A C;  5CHW A;  1IGD A;  2FIF A;  2HTM E;  2ZZP B;  1NI3 A;  2O2V B;  1NBF C;  3GB1 A;  4ZDV A;  1WF9 A;  1R4N B;  2IDY A;  3IT4 B;  3B2G A;  3R7Q A;  3JW0 X;  3TUO A;  1FFV A;  3N1Z C;  2NVU I;  4MGZ E;  5J2R A;  4WWM A;  3ZTC A;  3P4Q B;  1F52 A;  4LNK A;  3DOW A;  3UIP B;  2KD0 A;  5KHO A;  4MAC A;  3L08 A;  4MJS B;  2WU2 B;  1R4N I;  1FXT B;  4IM0 A;  2H89 B;  4EE2 A;  4BBN C;  4LDT B;  3RMK C;  2CU3 A;  4ZRQ A;  1PUT A;  2WDV B;  5AUI A;  3SDL C;  3EC8 A;  3GE3 C;  1UF0 A;  2X38 A;  3DDC B;  1N62 A;  3RYT A;  2L32 A;  4IUM B;  1T3Q A;  2D3A A;  4C4V A;  4HEA 1;  3PO0 A;  3ZDT A;  2KMA A;  4TSS A;  3AE1 B;  2AQ2 B;  3V62 A;  3LJ3 A;  3T3O A;  2K3U A;  4CQN A;  3AEE B;  4WQO B;  1TS4 A;  3LYY A;  4L2Y A;  4I6N B;  2V3N A;  3FAH A;  1VCB A;  2LMC A;  3Q3N C;  1QIL A;  3ZDM C;  3M62 B;  2RPV A;  3Q8F A;  3ZJU A; 
#chains in the Genus database with same CATH homology
 3DBL I;  2JF5 A;  2KX3 A;  5FR6 A;  2KWV B;  5EDS A;  4GXB A;  3EEC A;  2ZVN A;  2EMT A;  3VUX A;  1KJT A;  3WAM A;  2O6V A;  3ZRC A;  2KDI A;  4A20 A;  1UH6 A;  1WGH A;  1V5T A;  2MWS B;  3VH4 B;  5LXI B;  1WFY A;  3V6E B;  2RSU A;  2GBN A;  1WE6 A;  2L05 A;  4K7W A;  5GMV A;  2BGF A;  3OAW A;  4TKN A;  2FUH B;  2MP2 A;  3WIM A;  2R2O A;  1YD8 U;  2I1K A;  3U7D A;  1J8C A;  3UGB B;  4NAW B;  1UBQ A;  2K8H A;  2IZV B;  2KTR B;  4HXD A;  3ECI A;  1YX6 B;  2IO1 B;  2AEH A;  4W9C A;  1TZ1 A;  4MEL A;  1GC7 A;  3JSV B;  3VUY A;  3AUL A;  4ASW C;  4CHK A;  4URK A;  1QZE A;  4W9L A;  4AP4 C;  1P1A A;  4HJK A;  2JT4 B;  5D6J B;  2DZJ A;  4WJQ A;  2J7Q B;  3W1S C;  3ZIM A;  4GN1 A;  4II2 B;  3UQA A;  4DHZ B;  2KDB A;  3VTW A;  4TV3 A;  4J6I A;  4BOZ B;  1TTN A;  4W9E A;  2PEA A;  2WX0 A;  3UIO B;  2C7M B;  2QHO A;  4RMA A;  1V86 A;  3WA0 A;  4B9K A;  4GGQ A;  4B95 A;  2LWP A;  4JQW C;  1F9J A;  2M1M A;  2DZI A;  3HM3 A;  2J0M A;  4XC2 A;  2O6V D;  4GIV A;  2LGY A;  2W9N A;  4TQ0 A;  2FCQ A;  2N1W A;  1BT0 A;  1WZ0 A;  2CR5 A;  1WJ6 A;  2FCN A;  4GDL B;  5CTR C;  1WX9 A;  2KLC A;  1WJ4 A;  3H7P B;  4EKU A;  2WYQ A;  3PRP B;  3QA8 A;  4MEM A;  2DAJ A;  2BWF A;  2LUE A;  2ZNV C;  2KMC A;  4GU2 A;  1WXV A;  4PS3 A;  2NPT B;  3L0W B;  4W9H A;  3R66 C;  3UIN B;  1Y8R C;  3ZNG C;  2KC1 A;  4MH0 E;  4WWP A;  2KQ7 A;  4DWF A;  1K8R B;  3IFW B;  2AL6 A;  2K25 A;  3QCA A;  5G55 A;  3APF A;  3WAN A;  4BKG A;  2UYZ B;  1Z2M A;  4JL9 A;  3A9J A;  1EO6 A;  3W1S A;  2BKR B;  2JWZ A;  5JHB A;  5DPW A;  3NZS A;  2ASQ A;  3SHQ A;  1ISN A;  4II3 B;  4WJO A;  4FLH A;  4KDI C;  2CHX A;  2HD5 B;  4KVG B;  2MW5 A;  3ALB A;  3KW5 B;  1R4M I;  1C1Y B;  3KH0 A;  3RZW C;  4DXA B;  1E8Z A;  2CS4 A;  1Q0W B;  3BY4 B;  3KUC B;  4K7U A;  4LCD E;  5DPT A;  2D2Q A;  5J17 A;  1WGY A;  3RUI B;  4XZ4 A;  4MGI E;  2M8S A;  3PZD A;  4WWO A;  3GZN I;  2KAN A;  3QAQ A;  1SGH A;  3NY5 A;  4MM3 A;  2Z0E B;  3AI5 A;  4GMV A;  3KYD D;  3M63 B;  2KOX A;  4IWQ A;  5TR5 A;  1TBE A;  1E8X A;  4HCN B;  1ZW7 A;  2DX5 B;  2GBM A;  2HTH A;  2KC2 A;  2MBE A;  1A5R A;  4ANV A;  4W9D A;  2AYO B;  4WJP A;  1L7Y A;  1M94 A;  2DZM A;  2XEW A;  4OVU A;  1P0R A;  1J19 A;  3CF6 E;  1HE8 A;  2FID A;  5D7G A;  3QK0 A;  3EHV A;  4DBG A;  2D11 A;  1VD2 A;  4MGK E;  4FHK A;  4DHJ B;  4RM9 A;  3ZNH B;  1CMX B;  4GSW A;  1ZGU B;  3M95 A;  4BKT A;  1D3Z A;  3A1Q A;  3I3T B;  1UD7 A;  1WX8 A;  4BFR A;  3RZF A;  4EZL A;  3R7R A;  2IO2 B;  2MSE D;  2D3G A;  3NZU A;  3TJP A;  2KZR A;  2CHW A;  3X0W A;  5J18 A;  4NJ7 A;  4BVU C;  2KDF B;  4HPL B;  3ZLZ A;  2JY6 A;  2MBB B;  3L54 A;  3HHM A;  2NBV B;  3V6C B;  4GDK B;  4CYE A;  1V80 A;  2KNB A;  2JZ3 B;  3ONS A;  2C60 A;  2KWU B;  4DHJ D;  3V61 A;  2JXX A;  2NS5 A;  4M8N A;  1WRD B;  4JIO U;  5AEK B;  2L00 B;  2KN5 A;  2WDT B;  3JYU A;  1SIF A;  4IWO A;  3U8Z A;  4DK5 A;  4WJN A;  1RLF A;  4PYU A;  3NOB A;  4KIK B;  2NBW B;  3AXC A;  4IWP A;  2KK8 A;  5BO4 B;  1I42 A;  1XT9 B;  3ZVV A;  2UWQ A;  3A9K B;  3TIX A;  2G4S A;  3RCZ A;  2LAS A;  3L13 A;  4BOS C;  2LXC A;  3DVG Y;  4E71 A;  3P2B A;  4NAW A;  2EKE C;  4EOY A;  3PRE A;  1KOT A;  1IP9 A;  4W9I A;  3H9D A;  2GOW A;  1C3T A;  2L7R A;  2O6V B;  4JGH B;  2A4Z A;  3APD A;  4LJO B;  2L3Z A;  2JRH A;  5LLI A;  4AJY B;  2J0J A;  4NJ6 A;  4AJW A;  4GB9 A;  3WAO A;  3ZUN A;  3KVF B;  5L83 A;  3PTF C;  4NY0 A;  3H7S A;  3VVW B;  1WR6 E;  4AWJ A;  4LJP B;  2KQS A;  3KUZ A;  4MGY E;  3B1L X;  1LM8 B;  4M8M A;  2MCN B;  2Z0D B;  4IM3 A;  3VTV A;  3K9P B;  3VTU A;  2D07 B;  1I35 A;  1KLV A;  4ANX A;  2PJH A;  3VHT C;  1GJZ A;  3ML9 A;  1RRB A;  3IG3 A;  2LZ6 A;  4WAA A;  2BF8 B;  4PYZ A;  2OJR A;  4FJZ A;  1IPG A;  5HKH A;  4HCP B;  2BWE S;  2C9W B;  1OEY J;  2IY0 B;  1LXD A;  3QJZ A;  4HDO A;  4EEW A;  2BPS A;  2KO3 A;  3R3M A;  4BBN F;  3L16 A;  3PT2 B;  2K39 A;  3DBR I;  1WI0 A;  2O2V A;  3JVZ X;  1NI2 A;  3A4S C;  2XK5 B;  2Y5B B;  3RD2 A;  1MG8 A;  2BYV E;  3PLU A;  4GDL A;  4KSL C;  3V60 A;  4ICV A;  4ANW A;  2V4L A;  3T9L A;  5C23 A;  2BYF A;  1J0G A;  3VQI A;  2CHZ A;  2ZEQ A;  3MTN B;  4DDG D;  3ZTD A;  4FN2 A;  4KV2 A;  2RPQ A;  1V49 A;  3T8M A;  2K8C A;  1G6J A;  1P9D U;  2GBK A;  2IO0 B;  3DPD A;  1WGD A;  1WJN A;  3DVG X;  2MQJ A;  2MBQ A;  1E8Y A;  3VH3 B;  2FAZ A;  3QIJ A;  1OTR B;  4IC7 B;  2N1V A;  3S2A A;  3QAR A;  2C7H A;  3TCA A;  4EUT A;  2NR2 A;  4F7Z A;  3U30 A;  1V81 A;  4G0N B;  3QX1 A;  1GC6 A;  4MJS A;  1LQB A;  2G45 B;  1T0Y A;  2G3Q B;  2NBU A;  1OQY A;  1WM2 A;  2KDE B;  3VAW A;  4ANU A;  3DBH I;  3PRZ A;  5IA7 A;  4FAD A;  2LVP A;  2DEN B;  3A4R A;  3MJW A;  1GUA B;  3VFK A;  3PGE A;  3ZKJ C;  2RR9 A;  1AAR A;  3PVL A;  2MBH A;  1P3Q U;  2K6D B;  2DYB A;  2REX A;  3Q3F A;  4KDL B;  1L2N A;  2WWZ A;  2GMI C;  4K7S A;  4HDQ A;  3H6N A;  4HWI B;  1WH3 A;  2PE6 B;  3PRM B;  1Q5W B;  1EF1 A;  1WJU A;  4EZJ A;  4FA6 A;  5CHF A;  1E7U A;  2LVO A;  2OOB B;  2V1Y A;  1WM3 A;  3H1U A;  4NNJ B;  1S1Q B;  4ZRI A;  5E6P A;  5AZG A;  3ZW3 A;  1NDD A;  3ZO5 B;  3IHP C;  4I6L B;  1X1M A;  5D94 A;  3N32 A;  2KVR A;  2J0K A;  1WMH A;  3QHT A;  4E74 A;  2IO3 B;  2ZPN A;  3D32 A;  3KUD B;  4W9F A;  3OJ4 B;  2AWT A;  1GNU A;  2MBO A;  3OJ3 A;  1V5O A;  4KSK C;  3ZRF A;  1UZX B;  3LDZ E;  3HIZ A;  2A5U A;  2EMS A;  1YIW A;  2LRW A;  2N9P C;  3MHS D;  1E90 A;  2FNJ B;  2ZNV B;  3AU5 A;  3ENE A;  5L95 C;  5C1Z A;  2RD0 A;  3ZNI D;  2PPH A;  3W1Y A;  1YX5 B;  4LDT D;  2JRI B;  2KFK A;  1WIA A;  2K8B A;  1OGW A;  4MSM B;  2Z59 B;  2B3A A;  3K9O B;  2DAF A;  4GDK A;  3WAL A;  1EF5 A;  2M0X A;  4E3C A;  1WGG A;  3DBS A;  2N9X A;  3CST A;  3VDZ A;  1KM7 A;  4AUQ C;  2PE9 A;  2MRP A;  1WZ3 A;  2GBR A;  2N7D A;  2HJ8 A;  4KIK A;  1E7V A;  2KXJ A;  3B0A A;  3TBL D;  2C5L C;  4BKS A;  3DVN V;  3SD5 A;  4DHZ E;  2MA9 B;  2BYE A;  1H8C A;  3C0R B;  3PHX B;  1ZKH A;  2KJH B;  5G2N A;  2KTF A;  3RT3 B;  2LGD A;  3QWZ B;  4FBJ B;  4OVV A;  1V9J A;  2IYD B;  2KTR A;  4A3O A;  2V3S A;  4HLE A;  1WR1 A;  2K6Q A;  1WE7 A;  4W9K A;  2KFJ A;  2N7E A;  2CKH B;  3M3J A;  5KHQ A;  2N9E B;  3JSV A;  4TQ1 A;  1U4A A;  4KZ0 A;  2L8J A;  2WX1 A;  3PV1 A;  1S3S G;  1WX7 A;  2KJR A;  2DZK A;  3A33 B;  3OLM D;  2KHW B;  2VRR B;  3UQB A;  2N4F A;  3VXW A;  1H4R A;  2BKF A;  2MP2 B;  3PSE B;  4ZRK A;  2M17 A;  1Q1O A;  2RGF A;  3NHE B;  1YJ1 A;  4F8C B;  2C7N B;  2LD9 A;  5JHA A;  3HK0 A;  2ZPY A;  4RM8 A;  1TGZ B;  5E6O A;  2YVC A;  4IM2 A;  1UGM A;  5JH5 C;  3N30 A;  4DDI D;  4EZK A;  4WWN A;  4KZC A;  2DYO A;  4ZRJ A;  2LJ5 A;  3DQV A;  3VUW A;  4A3P A;  1WGR A;  2I1J A;  2XK5 A;  4FHJ A;  4NQK E;  2L0F A;  3H7P A;  3SU8 X;  4BKS D;  1XD3 B;  2ZCC A;  5DCN A;  3IVF A;  3CSF A;  4PS7 A;  4I6P A;  1WXS A;  3BIN A;  2FCS A;  1WY8 A;  2NPT A;  3O65 B;  4HK2 A;  1GG3 A;  1RFA A;  4ICU A;  1RAX A;  3QC8 B;  3L10 B;  3ML8 A;  3PHW B;  1V6E A;  2DHZ A;  4NQL B;  5E6N A;  1XQQ A;  1OEY A;  5CHW A;  2LRU A;  2FIF A;  2ZZP B;  3IBE A;  2ZVO A;  4PS8 A;  2ZCB A;  2O2V B;  1NBF C;  4ZDV A;  4FUL A;  2K1F A;  1EUV B;  1WF9 A;  5JZE B;  3UF8 A;  2DYM A;  4MDK E;  1E5W A;  2LGX A;  2LVQ A;  2JVC A;  1UBI A;  3JW0 X;  4G50 A;  3R7Q A;  4IW0 A;  4NPN A;  2NVU I;  2MX2 A;  1JRU A;  4FJV B;  4MGZ E;  5DPR A;  5J2R A;  3KYC D;  2LXA A;  3ZTC A;  1YQB A;  1E8W A;  4G11 A;  4F1S A;  1LFD A;  2KLG A;  3EFU A;  4AOF A;  3DOW A;  3N3K B;  3UIP B;  5LXH A;  3X23 A;  3ZNZ B;  2MLB A;  4CO7 A;  3A9J B;  2G4D B;  4GOC A;  2KD0 A;  1WXM A;  5KHO A;  2L0T A;  2GBJ A;  2NCN A;  3QQ8 B;  2YLM A;  4X57 B;  3L08 A;  4XX5 A;  4MJS B;  4JLC A;  2AL3 A;  3L17 A;  1R4N I;  5DPS A;  1FXT B;  4IM0 A;  1PQS A;  4W9G A;  4BBN C;  2JZZ A;  4LDT B;  2IBI B;  4YL8 A;  3TL5 A;  3DVN U;  5IAA C;  1P98 A;  5CX3 A;  3PS6 A;  4ZYN A;  3SDL C;  3EC8 A;  2FCM A;  4K1R B;  2XBB C;  5AZF A;  1WYW B;  3GOE A;  4EFO A;  4G3X B;  4K81 A;  3AU4 A;  3DDC B;  3RYT A;  4IUM B;  1UEL A;  4B6W A;  3B08 A;  4FJY A;  1Z5S B;  3PLV A;  1IYF A;  2HE7 A;  3TMP B;  3ZDT A;  2KMA A;  2KWC A;  1WXA A;  1SE9 A;  5D2M B;  4TUU A;  2L76 A;  4P7I A;  3RUL A;  5AZH A;  2LI5 A;  1V2Y A;  4IG7 B;  2D10 A;  1WMH B;  2CU1 A;  2KX0 A;  2KJ6 A;  3V62 A;  3PPA A;  3LJ3 A;  2M4N A;  4WQO B;  3A1Q B;  3DCG A;  3Q3J A;  3NS8 A;  4I6N B;  4M0W B;  2JPH A;  1VCB A;  2R2Q A;  4HVB A;  3CMM B;  5CHV C;  2KKC A;  3A9K A;  2ZJD A;  4HPM B;  3M62 B;  3APC A;  4W9J A;  3ZDM C;  2IY1 B;  2JUO A;  2KFK B;  3HM6 X;  3WAP A;  4MSQ B;  4N9F 4; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...