2LI5A

Nmr structure of atg8-atg7c30 complex
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
117
structure length
117
Chain Sequence
HMKSTFKSEYPFEKRKAESERIADRFPNRIPVICEKAEKSDIPEIDKRKYLVPADLTVGQFVYVIRKRIMLPPEKAIFIFVNDTLPPTAALMSAIYQEHKDKDGFLYVTYSGENTFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords Autophagy-related protein 8
publication title Structural basis of Atg8 activation by a homodimeric E1, Atg7.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 15
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2011-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02991 Atg8 Autophagy protein Atg8 ubiquitin like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2li5A00
1TZ1A 3WAOA 2GBMA 3VHTC 4MGIE 2ZZPB 4W9CA 2WYQA 1KLVA 2R2OA 2N4FA 4CHKA 3OJ3A 4FULA 3M62B 2OOBB 2O2VA 3TJPA 3ALBA 3LJ3A 4HLEA 2UWQA 4K1RB 4BKSA 4MJSA 3UQAA 4BOZB 2LD9A 3U7DA 2I1JA 3DBLI 2MX2A 1YQBA 3Q3FA 1Q0WB 2KFKB 3QJZA 2K6QA 2I1KA 2C7MB 2L0FA 2MBEA 1F9JA 3QHTA 3UF8A 2M4NA 4NNJB 2KK8A 3R7RA 4EUTA 4IM0A 2JXXA 4EZKA 3RD2A 2O6VD 4CYEA 3CMMB 1C1YB 3W1YA 1WE7A 4HVBA 5E6OA 5JZEB 2JF5A 3A9KB 1WMHA 3ZNID 1E90A 2CU1A 1WM3A 2MWSB 4IUMB 3VUWA 1YJ1A 2EMTA 4NPNA 3PLVA 2AL6A 4PS7A 2A4ZA 3IG3A 4DBGA 1G6JA 2M1MA 2PEAA 1WR6E 1CMXB 1WJNA 3DVNU 4KSKC 1TBEA 2C60A 4MM3A 2MBBB 4FJVB 2KOXA 1UH6A 2L00B 3ZLZA 5JH5C 4WJQA 1GC7A 4W9GA 3AXCA 3UGBB 2KNBA 4DK5A 4EEWA 5CHWA 1A5RA 2BF8B 1OTRB 2KWCA 4XZ4A 5AZFA 3VXWA 3K9OB 2J7QB 4KZCA 3VVWB 4IWQA 3JSVA 2L05A 1E7UA 3U30A 2KN5A 5J2RA 1Z2MA 2KTRA 3ZNHB 4EFOA 4HCNB 2CR5A 3M95A 1TGZB 1WH3A 4IW0A 1YX6B 2FCNA 4IM3A 4MSQB 4BVUC 5C1ZA 4YL8A 3HM6X 3N32A 4LCDE 4GU2A 2JVCA 4WJNA 4B95A 4W9LA 3CSTA 4AJYB 2HJ8A 2L7RA 5D2MB 5FR6A 2K1FA 4WJOA 3ZW3A 3H7SA 2KFKA 2D2QA 3KH0A 3M63B 3PV1A 4GGQA 4M8MA 3WAPA 5LXIB 2YVCA 1E8YA 3L0WB 2AEHA 1WJUA 2RGFA 3H9DA 1E8XA 5CHVC 3T8MA 5HKHA 2K6DB 3EC8A 4BFRA 3A9KA 3PRMB 3CF6E 1WFYA 3OJ4B 3QWZB 4KIKA 4B6WA 1P9DU 2KKCA 2CS4A 2N9XA 2HE7A 2C9WB 2IZVB 3QCAA 4JGHB 2LVPA 4ZDVA 5BO4B 1ISNA 2GBJA 4HK2A 1OEYA 4HPMB 4FBJB 3PTFC 2ZCBA 1WGGA 3JW0X 1RFAA 3ML9A 1LQBA 4MELA 1WXVA 2BWFA 2VRRB 2KJ6A 2Z0EB 3KYDD 1NDDA 3HK0A 4BKSD 2LVQA 2KMCA 2LXCA 2M17A 2A5UA 3DDCB 4AUQC 4MGYE 1NI2A 2MA9B 3ZVVA 4FA6A 4ICUA 2M8SA 4LJPB 1NBFC 4BKGA 5D94A 2Z59B 4DHZE 3RZWC 3WIMA 4BOSC 3EECA 3X23A 4EZLA 5KHOA 4A3OA 1I42A 1WZ3A 2BWES 2CHXA 3VDZA 3PZDA 3N3KB 2KJHB 4GDKB 1MG8A 3P2BA 4TUUA 3B0AA 4ZRJA 4G0NB 3VH4B 1UELA 2K8CA 1P98A 1D3ZA 2LWPA 4DXAB 2DAFA 4WWOA 1P3QU 2B3AA 3PHWB 1M94A 3ECIA 3RZFA 1FXTB 3W1SC 4GOCA 1WX7A 2QHOA 3I3TB 5L83A 3VTUA 1WJ4A 5G2NA 1TTNA 2JT4B 1UD7A 1V2YA 4I6LB 3KVFB 5D7GA 3LDZE 1RRBA 3B1LX 2IYDB 2LXAA 4E71A 3ZUNA 2LGYA 3KUDB 3A33B 4MSMB 4X57B 1V9JA 2KC2A 2K8BA 1S3SG 2GBNA 3CSFA 4IC7B 3L10B 4AWJA 4HWIB 2IO0B 4TQ0A 2YLMA 2KHWB 3DVGY 4TV3A 4KV2A 3DOWA 3OAWA 1EO6A 2KDBA 3SU8X 2GMIC 4W9DA 4G11A 2CHWA 2KDEB 1WX8A 4NQLB 2LRUA 3C0RB 2UYZB 5DPRA 1XT9B 1KJTA 2K39A 1WXMA 5DPWA 5J17A 2HTHA 2KDFB 4GDKA 4W9KA 1X1MA 2DZMA 1EF5A 1WE6A 4FJYA 3UIOB 4TQ1A 3KYCD 3V6CB 4ANXA 4HXDA 3X0WA 1VCBA 2MBOA 4FHKA 4NQKE 4ZRKA 1WYWB 2JUOA 2V3SA 3V62A 4WJPA 2EMSA 2BKRB 1WGDA 1WGRA 2N1VA 3HM3A 2L0TA 2DZJA 1K8RB 2C7NB 3PPAA 4ANVA 1GC6A 1KOTA 3IFWB 4JL9A 1RLFA 3DCGA 2C5LC 3PRZA 1WXAA 4JLCA 5L95C 2NPTB 1UZXB 4E3CA 2EKEC 2AL3A 1I35A 4FHJA 1LXDA 4RM8A 2BPSA 4BKTA 2NBVB 5JHAA 3RCZA 2OJRA 2PE9A 3RUIB 3MTNB 1WRDB 3PT2B 4PS3A 3DPDA 3BINA 2JZ3B 3ZRFA 1VD2A 3QX1A 1V49A 2FIDA 2ZVOA 2MRPA 4IWPA 3VTVA 2IBIB 4K81A 2KWVB 2PPHA 4NJ6A 1BT0A 3NHEB 3VH3B 1E8WA 4DDGD 4W9HA 3ZNGC 2DYMA 3QIJA 3VQIA 1Y8RC 1IPGA 4DHZB 4CO7A 1P1AA 3ZIMA 5DPTA 3AU4A 4MGKE 4AOFA 1LFDA 1L7YA 3GZNI 1WF9A 4F1SA 2LGDA 3PHXB 2ZVNA 4HPLB 3PREA 3WAMA 2NS5A 4JQWC 4WWPA 2KMAA 5LLIA 4E74A 4IWOA 1SIFA 3V6EB 1IP9A 2JWZA 3QK0A 4PYZA 4W9EA 4MH0E 2BGFA 4WWNA 3UIPB 3VUXA 2FCMA 3SHQA 4FLHA 1LM8B 2LASA 3S2AA 3TCAA 4FADA 3R66C 2LGXA 3SD5A 2LZ6A 4B9KA 5GMVA 5G55A 1XQQA 1ZGUB 3QQ8B 2PE6B 1IYFA 3EHVA 4II2B 1J8CA 2JRHA 4GXBA 4ICVA 3ZTDA 1HE8A 1SGHA 1WXSA 2D10A 1WX9A 2NPTA 4NJ7A 2BYEA 2IY0B 2NCNA 5AEKB 1E5WA 2N1WA 4JIOU 3WA0A 2J0MA 1V80A 2ZEQA 3ML8A 4PYUA 4KDIC 2J0KA 4RM9A 1UBQA 2KX3A 5IA7A 3W1SA 3WANA 2IY1B 2GBKA 4LDTD 2RPQA 3O65B 5DCNA 2RR9A 3ZDMC 2DX5B 4AJWA 3R7QA 1WM2A 2KLGA 4I6NB 3DBRI 4WQOB 4DHJD 4KDLB 1WGYA 4FN2A 2ZNVC 3IBEA 3ENEA 4GN1A 3JVZX 2REXA 2G45B 1GJZA 3DVNV 3KUZA 2MLBA 2ZPYA 4AP4C 3ONSA 3AU5A 1H8CA 4I6PA 1AARA 3D32A 2WWZA 4W9FA 2IO1B 1ZKHA 2N7EA 2KC1A 2K8HA 2DYBA 2MW5A 2BYVE 3PS6A 3JSVB 2DZIA 3ZKJC 4EKUA 2DENB 4PS8A 2MCNB 2C7HA 2KX0A 2KTRB 2HD5B 1WJ6A 4K7WA 3R3MA 3RT3B 2N7DA 3H7PB 1T0YA 4HDOA 2RD0A 3GOEA 4NY0A 1YIWA 2CHZA 2LUEA 4GDLB 4KVGB 4W9IA 2KFJA 4XX5A 3WALA 2KANA 3KUCB 3DQVA 2N9PC 3NOBA 4G50A 3DBHI 2D07B 4F8CB 2DZKA 2DYOA 2O6VB 3AULA 4ASWC 1S1QB 3L08A 1L2NA 4DDID 2FIFA 2KQSA 2LRWA 3IHPC 1GNUA 4J6IA 2L3ZA 1XD3B 4XC2A 3ZNZB 4BBNF 4FJZA 2PJHA 2ASQA 4GMVA 1V5OA 5TR5A 4MDKE 2KWUB 3ZDTA 2BYFA 1YD8U 2XBBC 4URKA 3RYTA 4KIKB 1OEYJ 1E8ZA 2ZJDA 4NAWB 2D11A 4K7SA 1WZ0A 2KJRA 5EDSA 4A3PA 4K7UA 5LXHA 3L17A 2G4DB 3L13A 5DPSA 3B08A 2JRIB 2L8JA 1UBIA 2KVRA 2M0XA 2NVUI 5IAAC 2WX1A 2XEWA 3QARA 4BBNC 1Z5SB 2JPHA 1RAXA 2KO3A 3HHMA 3NZUA 3PVLA 4EZJA 4KZ0A 1ZW7A 4ANWA 3DVGX 3PRPB 4GIVA 2ZNVB 4GB9A 2NBWB 2MQJA 4GSWA 3H7PA 2G4SA 3OLMD 3M3JA 4TKNA 1H4RA 4GDLA 2MSED 1R4MI 3QA8A 2XK5B 3A1QB 2V4LA 3TL5A 2FCQA 2O6VA 3ZO5B 1KM7A 1J0GA 4IG7B 4ZYNA 5JHBA 2W9NA 2FAZA 3IVFA 2D3GA 4EOYA 4ZRIA 2RSUA 4WAAA 1E7VA 3V61A 1QZEA 1V81A 3L16A 3NS8A 1EUVB 5CX3A 3L54A 3APCA 1J19A 4RMAA 2CKHB 1WI0A 3ZTCA 4W9JA 2V1YA 3A9JB 3UINB 2NR2A 3K9PB 5AZGA 3TMPB 3PSEB 5KHQA 1V6EA 2LI5A 2MP2B 4MGZE 2JZZA 4N9F4 1OGWA 2KTFA 3QAQA 4IM2A 3DBSA 4P7IA 4NAWA 1Q5WB 2N9EB 5D6JB 4OVVA 2FUHB 2O2VB 2DHZA 2GBRA 4II3B 4LJOB 4KSLC 4MJSB 2DAJA 5CTRC 2KQ7A 3AI5A 3V60A 2ZPNA 2KLCA 3KW5B 1GUAB 4OVUA 2IO3B 2KZRA 5E6NA 1YX5B 1V5TA 2FNJB 2R2QA 3N30A 5AZHA 3TBLD 3HIZA 4G3XB 4MEMA 3MHSD 1C3TA 2Y5BB 4HJKA 2KDIA 1OQYA 4A20A 5C23A 2GOWA 1UGMA 2K25A 3PLUA 3RULA 3Q3JA 4F7ZA 1WY8A 3UQBA 2AYOB 1R4NI 2ZCCA 1U4AA 2BKFA 1WMHB 2Z0DB 2G3QB 3SDLC 1WIAA 3APDA 2LVOA 3PGEA 3NY5A 4M0WB 2FCSA 3H1UA 3NZSA 4DWFA 2XK5A 3A1QA 2MBQA 4LDTB 2MBHA 3JYUA 3VUYA 1WR1A 4ANUA 2WX0A 3ZRCA 1JRUA 5CHFA 2IO2B 4M8NA 3T9LA 1P0RA 2AWTA 3A4SC 2LJ5A 2L76A 2NBUA 1V86A 1WGHA 4HCPB 4DHJB 5J18A 4HDQA 3H6NA 3APFA 3QC8B 1PQSA 3MJWA 3TIXA 2KXJA 3BY4B 3U8ZA 3A9JA 3A4RA 5E6PA 3VAWA 2J0JA 2WDTB 1Q1OA 3VFKA 3VTWA 2KD0A 1EF1A 2JY6A 2MP2A 1GG3A 1SE9A 3EFUA
chains in the Genus database with same CATH superfamily
4OZBA 3VHTC 2R2OA 3MC9A 1NENB 1KF6B 3N1XC 3OJ3A 3GZNB 2OOBB 2UWQA 2LD9A 3BYYB 2I1JA 3DBLI 2MX2A 4M01A 1ENFA 2KFKB 4YXDB 2I1KA 3AEEB 2C7MB 2MBEA 2M4NA 2WP9B 3R7RA 2JXXA 3RD2A 2JF5A 3LB8C 1WMHA 2H88B 3AB5A 3VUWA 1XO3A 4NPNA 2JU6X 5HFYA 3SR6A 2A4ZA 4DBGA 1HZ6A 3DVNU 1TBEA 3C8YA 2KOXA 2G9HD 4RGMA 4WJQA 2SEBD 1GC7A 2TSSA 4DK5A 1JRPA 4EEWA 4RGTA 5AZFA 2KQ4X 3GE3C 3K9OB 2J7QB 4KZCA 4US9A 3U30A 2KN5A 1Z2MA 4HCNB 2CR5A 2M0AA 2QEJC 1WSPA 2JVCA 2WLBA 4B95A 4AJYB 2HJ8A 2LHEA 3ZW3A 5BYSA 1MVKA 1MFWA 4GGQA 4M8MA 3WAPA 3SEBA 3L0WB 2AEHA 3DHIC 2W3RA 2AX5A 1E8XA 5C3JB 1TYGB 1WFYA 4B6WA 1P9DU 5EE9A 1KRHA 1YOVB 3NVYA 2LVPA 1ISNA 1OEYA 4FBJB 1WGGA 4MT5A 4MELA 2KJ6A 2BT6A 4BKSD 2LVQA 3AE9B 2WU2B 2M17A 2A5UA 4R3DA 4AUQC 3MP9A 4FA6A 2WXLA 4LJPB 4BKGA 1C79A 3AE6B 1JQ4A 2RDHA 2KN4A 2VH2A 5BMIA 3MC0B 4BAXA 3VDZA 1F1HA 2KJHB 4IDIA 5TSSA 2QIEB 3P2BA 4TUUA 1UUPA 1CQVA 2GRIA 4ZRJA 1QOGA 4G0NB 3VH4B 3BIID 1P98A 1D3ZA 2B3AA 1M94A 3ECIA 5C2TB 2KACA 1NYQA 4GOCA 3BWUD 1GB1A 4P6VF 1V2YA 4I6LB 3N1ZC 1RRBA 3B1LX 2LXAA 2LGYA 1JALA 4X57B 2KC2A 3TSSA 1YQ4B 4AWJA 1QQRA 1D5ZC 4HRSA 3AEDB 2YLMA 2KHWB 1RM6C 1BMLC 4TV3A 3NRZA 3OAWA 2LHDA 1SEBD 4G11A 4B0MA 1WX8A 1YMHE 2X8XX 3C0RB 2LRUA 1VR9A 1XT9B 1SE4A 1TS2A 1WXMA 1NEKB 4XYCA 2HTHA 2DZMA 2BBCA 5H92C 4FJYA 3UIOB 1FFUA 1XLOA 1VCBA 4ZRKA 2JUOA 1FMAD 2V3SA 3EGRA 4JL9A 2FBWB 3PRZA 1PGBA 2W55A 3GE8C 4JLCA 5LNK1 1C78A 4RCOA 1LXDA 1JWSD 1KLGD 2BPSA 3URYA 5JHAA 3RCZA 3MTNB 3C19A 3DBLB 2JZ3B 1V49A 4IWPA 3B2GA 2PPHA 1BT0A 1E8WA 3MFGA 1VZ7A 1YN3A 1IPGA 2QSDA 2WS3B 2ZVNA 4IKGA 2Z8LA 5G5GA 4E74A 1SIFA 3V6EB 2JWZA 4W9EA 2JWUA 2ACZB 2BGFA 1PGXA 2WXHA 4FLHA 3TCAA 2IGHA 5GMVA 5G55A 3QQ8B 2PE6B 1L4DB 2JRHA 4ICVA 4JX1C 1VDVA 1WXSA 1SIJA 2BYEA 3NJTA 2N1WA 4JIOU 1V80A 2J52A 1IGCA 3W1SA 4WAFA 1L4ZB 3ZDMC 1JW9D 3R7QA 4KDLB 2REXA 1GJZA 1N60A 4AP4C 3FC4A 1H8CA 4JE3B 1V8CA 1ZKHA 2KC1A 2BYVE 3JSVB 3ZKJC 2DENB 4PS8A 4YWGG 2C7HA 2IPKD 1LO5D 3H7PB 1T0YA 3AEAB 2RD0A 4XX5A 4NY0A 1YIWA 3CIRB 2KFJA 1FNWA 3NOBA 4OVZA 2O6VB 4MACA 1E0ZA 2WDQB 3NUHB 2FIFA 2LRWA 2L3ZA 4XC2A 2BB6A 3ZNZB 2LGIA 3BZDB 1V5OA 3AV8A 1PUTA 2QILA 1F77A 1B1ZA 2BS2B 2INCC 4N59A 2XBBC 4YSYB 3RYTA 4KIKB 1T0QC 2ZJDA 4NAWB 4K7SA 4WH4A 1WZ0A 5EDSA 2BB5A 5LXHA 2G4DB 3L13A 1AYFA 3P4PB 4WWMA 2BQQA 1WYGA 3Q8FA 1Z5SB 2LFIA 2JPHA 1RAXA 2KWDA 1ZW7A 2QCZA 1XLQA 3M3JA 3IT6B 1H4RA 3ZQ4A 2XK5B 3I9V1 3ZO5B 5JHBA 2W9NA 4ZRIA 1EUVB 1J19A 4RMAA 3ZTCA 3A9JB 3K9PB 5AZGA 4RFBA 2JZZA 3SFDB 4N9F4 1OGWA 3R2IA 4IM2A 3W5UB 4RH6A 2BS3B 2FUHB 3MHZA 2GBRA 4LJOB 2WDVB 2IJ0A 5CTRC 3AI5A 4J3OD 2IO3B 2JQRB 3BVGA 1RFKA 1V5TA 2FNJB 5AZHA 3TBLD 3MHSD 2Y5BB 4HJKA 1OQYA 3RULA 3Q3JA 3R2TA 1ROEA 2AYOB 1U4AA 2Z0DB 3UI3A 3APDA 3PGEA 3NY5A 3H1UA 4DWFA 3A1QA 3KLSX 4ZHOA 2MBHA 3JYUA 2WX0A 1V1PA 2IO2B 4M8NA 4P16A 3TEZA 3A4SC 2LJ5A 3ZJUA 1V86A 5IOIA 1FNUA 4XDCA 3QC8B 3MJWA 2KXJA 3A4RA 4USAA 3NS1A 1EM7A 1GG3A 3EFUA 3Q6BA 3EFCA 4Q2JA 1VJKA 1AN8A 1GPXA 2J42A 1YJJA 2N4FA 4CHKA 2JXTA 3U4EG 2PVGC 1I4RA 1C77A 3N1YC 3H8HA 4BOZB 3AEFB 1Q0WB 3UF8A 5BMHA 4NNJB 2DLBA 5HI1A 1ZXIA 3CMMB 1M4VA 1C1YB 1MI0A 3W1YA 1WE7A 3AMZA 5E6OA 4HVBA 5JZEB 4EE2A 2CU1A 2MWSB 4PS7A 1G6JA 1PYWD 2MBBB 3ZXRA 1YN4A 5JH5C 5FKAC 1RWSA 3OWEB 2KNBA 3LXFA 5CHWA 2KWCA 4XZ4A 3E9SA 5J2RA 1E6EB 4MSQB 2FCNA 4YL8A 3N32A 2VZKD 3W2DA 3CSTA 3I5JC 5D2MB 3TUOA 2K1FA 4WJOA 1XF5L 1IBXA 2KFKA 1V97A 2PLPA 5JXVA 2WHIA 4A8XC 1WJUA 2RGFA 3H9DA 3AE5B 5HKHA 3EC8A 2ONQA 3OJ4B 3QWZB 4O1NA 4WQMA 3Q8EA 2HE7A 1OFFA 3QCAA 4ZDVA 1ESFA 4HK2A 2ZCBA 3DHGC 3ML9A 2EKIA 2CU3A 2LGSA 2LXCA 2JX5A 1ZPSA 3DDCB 3VRBB 2JYEA 2MA9B 3ZVVA 2IGDA 1YN5A 2M8SA 2L32A 2Y5PA 1F2RI 4DHZE 2N0SB 3AM9A 4A3OA 1I42A 1ET6A 3SFEB 3PZDA 4C7ZA 3N3KB 3GB1A 1L0XB 3B0AA 1KFYB 1JWMD 1ZDXA 4H2AA 4WWOA 3PHWB 3W1SC 1FXTB 2I38A 5L83A 2D5GA 2PW9A 3VTUA 1WJ4A 1D5XC 5G2NA 1TTNA 2JT4B 1E7PB 1T0RC 3KVFB 5D7GA 3KUDB 3A33B 4MSMB 1F0ZA 1JWAD 3CSFA 3U7ZA 1L6UA 4IC7B 1I4QA 4HWIB 1QOAA 2R61A 2KDBA 3SU8X 2GMIC 2KDEB 1TS4A 2K39A 3Q8AA 4ZOHC 1GOZA 3W9CB 4NZLB 4A9AA 4C4VB 4TQ1A 3V6CB 4WURA 4HXDA 4S17A 2EMSA 3TEYA 2DZJA 2C7NB 3FAHA 4ANVA 1KOTA 1VRAB 1RLFA 1D6EC 5L95C 1TY2A 1UZXB 1I35A 3J9CA 4RM8A 2K9XA 2PE9A 3RUIB 3DWGC 2OEDA 3ZRFA 2I2YA 2MRPA 1SJHD 2CJOA 4K81A 2QDFA 3FILB 3Q2AC 3LYYA 4W9HA 1YQ3B 1QOBA 4CO7A 1P1AA 3ZIMA 4HPLB 2BYTA 5LLIA 4IWOA 5EE0A 1CJEA 4WWNA 3VUXA 3DHHC 1LM8B 1QT9A 1JMLA 4FADA 1TKEA 2MH7A 2V4IB 1I7HA 4FXCA 1ZGUB 3MC8A 1GB4A 5MPOA 1HE8A 1SGHA 4NJ7A 1WX9A 2IY0B 5I4DA 3B9JA 4PYUA 4KDIC 2J0KA 4RM9A 5E6JA 4LDTD 2RPQA 5DCNA 4AJWA 3PZ7A 4I6NB 4WQOB 2MJDA 4DHJD 1V1OA 1WGYA 3GS2A 3IBEA 4LNKA 1FPYA 1N5XA 3KUZA 2ZPYA 3ONSA 4D2KA 4I6PA 1WGKA 4UDUC 3U52E 2K8HA 2DYBA 2MW5A 2DZIA 1ZDVA 2MCNB 4C80A 3P42A 4L1BA 1TKGA 1N63A 4HDOA 2LUEA 4GDLB 4F1SA 3WALA 2KANA 3KUCB 3DQVA 4F8CB 3DBHI 2DYOA 3KWLA 1S1QB 3L08A 2M19A 1XD3B 4L2YA 4BBNF 4C00A 2PJHA 2ASQA 5TR5A 1YJIA 2KWUB 4LNNA 1YD8U 4URKA 3NVWA 1QOFA 2WXNA 4JPSA 4A3PA 1C9FA 2K3UA 2WU5B 3B08A 2INDC 1NYRA 1UBIA 3QARA 4HROA 4RF1A 4BBNC 5EE1A 2KO3A 3HHMA 4EZJA 3DVGX 3PRPB 2MJ3A 4GIVA 2ZNVB 2NBWB 2X38A 2WXPA 3H7PA 2RDBC 1P7EA 3OLMD 2NTTA 4TKNA 3QA8A 1SJED 2V4LA 1C4CA 3TL5A 2O6VA 4PK1A 1KM7A 1J7AA 4ZYNA 2FAZA 1HXYD 2L52A 4WAAA 1E7VA 1QZEA 3L16A 1FRDA 3APCA 5T8IA 2CKHB 2GI9A 2WXJA 2NR2A 3TMPB 1B9RA 1L6VA 3QAQA 4HJGE 2YEPB 4TSSA 3OG5A 4NAWA 3L4PA 4M00A 2O2VB 2DHZA 4HKZE 4MJSB 2KQ7A 1ZUD2 2QC8A 4NAMA 5E6NA 2R2QA 3N30A 3HIZA 1ZOYB 4MEMA 3P4QB 4A20A 2G1EA 1WY8A 5IO9A 2BKFA 2LVOA 4M0WB 3FKYA 3NZSA 2XK5A 4LDTB 2PKOA 1JRUA 5CHFA 4MM3B 2AWTA 4DHJB 2L76A 1FO4A 1E9MA 5J18A 2ON8A 1PQSA 5H8YE 3BY4B 3U8ZA 3A9JA 5E6PA 1I4PA 2OHFA 2J0JA 2WDTB 3VAWA 3VFKA 2B76B 5AUIA 2JY6A 4DXGA 3W5VB 4B0EA 2PTLA 4W9CA 1HA5A 1KLVA 4FULA 4LNIA 3M62B 3N20C 3ALBA 2JYTA 3RNGC 1N62A 1NI3A 3ABVB 2WXFA 1YQBA 3AECB 3QJZA 2L0FA 1F9JA 3GP7A 2BTEA 4YTMB 4KKJA 4EUTA 4IM0A 4EZKA 1I4HA 3A9KB 3ZNID 1YJ1A 2EMTA 2AL6A 2E3TA 3IG3A 1HTOA 4KX6B 2E6XA 1WR6E 4BZAA 3EA6A 4KSKC 2C60A 2ICIA 3U2SC 1IUEA 4FJVB 1UH6A 1T5XD 2L00B 4L23A 3ZLZA 1TS5A 3AXCA 3UGBB 1A5RA 1OTRB 3VXWA 4IWQA 1E7UA 3Q69A 2Y3AA 3P4SB 2KTRA 1L0YB 1ET9A 3M95A 1WH3A 4IW0A 4BVUC 1YX6B 2JZPA 5C1ZA 3KWVA 4LCDE 1QF6A 4GU2A 4RGOS 4K3BA 4W9LA 1WRIA 1VZ8A 2WXIA 5FR6A 1I4GA 3KH0A 3PV1A 5LXIB 3RI7C 2YVCA 1E8YA 3DBHB 2ZW1A 4QAYA 3T8MA 3PRMB 1DGJA 3RPFC 1LGRA 2CS4A 2N9XA 2C9WB 2QJLA 3IXSA 5BO4B 1J7CA 4LTUA 2GBJA 4CQNA 1SE2A 2J53A 1EU3A 4RNAA 1RFAA 2BWFA 2Z0EB 1NDDA 3HK0A 2JSVX 4MGYE 1NI2A 3AH7A 1F2RC 5IN7A 1NBFC 5D94A 3ZYYX 1UGJA 4EZLA 5KHOA 5EE3A 2CHXA 1STEA 3NVVA 4GDKB 1MG8A 2PIAA 1FNVA 1UELA 2K8CA 2VH1A 2MJEA 4DXAB 2DWQA 3RZFA 1WX7A 1Q10A 2AQ3B 3B2FA 3HRDD 1EWCA 1JWBD 3ZUNA 2LEKA 1V9JA 1IGDA 1S3SG 2GBNA 3HVZA 2KAJA 1HTQA 2IO0B 5IKCM 2N9LA 1QKZA 3DVGY 3DOWA 2CHWA 3BK2A 1SXTA 3VRAB 1CZPA 1T6BX 2UYZB 4N58A 5J17A 4W9KA 1X1MA 2K5PA 2BVCA 2MHJA 3KYCD 1DOXA 3N9YC 4ANXA 3X0WA 1WYWB 3V62A 2BKRB 1WGRA 1K8RB 4DQOC 3PPAA 2NPTB 4E3CA 4P1BC 1ZXHA 2EKEC 1TJEA 4BKTA 2NBVB 2OJRA 1DYQA 2BW2A 2WXMA 3P4RB 4PS3A 3DPDA 3QX1A 2FIDA 3VTVA 4A90A 2KWVB 4NJ6A 1A70A 3NHEB 2L83A 2W54A 1V1PB 4DDGD 4YT0B 3ZNGC 2DYMA 3QIJA 2OJWA 4ZRPA 3I57A 5DPTA 3AU4A 1D5MC 3ZJTA 3WAMA 3AE7B 3T3OA 4JQWC 4OHJA 2KMAA 4C4VA 1FEHA 1PDXA 3UIPB 3SHQA 2LASA 3P1MA 4RGNA 3S2AA 3R66C 2LZ6A 4B9KA 1SF0A 1XQQA 2V3PA 1IYFA 3EHVA 4II2B 4GXBA 1TZOA 2D10A 3WA0A 2J0MA 2ZEQA 1KH0A 1UBQA 2KX3A 3WANA 2GBKA 3O65B 3AE4B 4K3CA 2QMTA 2WXRA 3DBRI 3RNCC 4FN2A 4JWSC 3FILA 4GN1A 3JVZX 4KGSA 1SSNA 5HHDG 3AU5A 1K52A 3D32A 4W9FA 4YSZB 1WWTA 3NVZA 2KX0A 2HD5B 4K7WA 3R3MA 3RT3B 3ZGZA 1PGAA 4KVGB 3V3XA 1L2NA 2N9PC 2DZKA 3AULA 5BMGA 5G5HA 1R7SA 2KQSA 1GNUA 4J6IA 1FXAA 1IBXB 2MEKA 2LUMA 1F52A 4MDKE 1T3QA 3HUIA 4XDDA 2BYFA 1OEYJ 1E8ZA 2PMVA 1CK1A 3CWIA 3RN9C 2K0PA 4M02A 3L17A 5DPSA 4AS1A 2JRIB 2L8JA 2KVRA 2M0XA 2RPVA 2WX1A 2VZKB 5FR3A 3NZUA 4XWTA 4GSWA 2G4SA 4GDLA 2MSED 1R4MI 3V05A 2FCQA 4EOYA 3IVFA 3V61A 3NS8A 1V81A 2HJ1A 2XN9C 1WI0A 2V1YA 3PZ8A 3IT4B 2LI5A 2MP2B 4MGZE 2KTFA 3DBSA 2N9EB 1HQRD 3AE2B 4OVVA 4II3B 1DOYA 1FRRA 2PVOD 2ZPNA 5D3DA 1GUAB 3Q3NC 1EU4A 2GLSA 1YX5B 3AE3B 3BK1A 4G3XB 1C3TA 2KDIA 5C23A 2K25A 3PLUA 4F7ZA 3UQBA 1R4NI 2ZCCA 2L1AA 1WMHB 1VZ6A 1C4AA 1P7FA 2FCSA 1MHXA 2MBQA 3VUYA 1WR1A 1N61A 1K51A 3E56A 1KLUD 1TKYA 3T9LA 1P0RA 2NBUA 3BVMA 3APFA 4DXFA 1Q1OA 2KD0A 4YTNB 1EF1A 2HTME 1UF0A 1TZ1A 3WAOA 2GBMA 3NG0A 4MGIE 2ZZPB 2WYQA 3KQ4A 4IOIE 3VR8B 1HZ5A 2O2VA 3TJPA 4LK0M 1N6ZA 3LJ3A 4HLEA 1NVID 4K1RB 4BKSA 1FIQA 4MJSA 3UQAA 3U7DA 3Q3FA 2K6QA 2DNFA 3QHTA 2KK8A 3VR9B 2O6VD 4CYEA 2WQYB 1E90A 1WM3A 4IUMB 4M0WA 4RF0A 3PLVA 1XEEA 1JROA 1SE3A 2M1MA 2PEAA 1CMXB 1WJNA 1XLPA 4MM3A 1L0VB 3Q8BA 4OW0A 1BXTA 4W9GA 2W3SA 4XGAB 1TS3A 3DBRB 2BF8B 4P1CC 4LNOA 3VVWB 3JSVA 2L05A 1OQQA 2KMMA 4EFOA 3ZNHB 2N7JA 1TGZB 4IM3A 4XE0A 3HM6X 4OZCA 4WJNA 2L7RA 2J4XA 2W82A 1MG4A 3H7SA 2D2QA 3M63B 1XCQL 4ARCA 5CHVC 4HEA1 2AQ1B 2K6DB 3PO0A 4BFRA 3A9KA 3RNEC 5BYRA 3CF6E 4KIKA 2KKCA 2IZVB 5GXGB 4JGHB 4HPMB 1FXIA 3PTFC 1K53A 4ARIA 3JW0X 1LQBA 1WXVA 2VRRB 4N6EB 3KYDD 2FE8A 4LLGM 2KMCA 3Q8CA 2V0GA 4GLSC 1C76A 1MPEA 4ICUA 4HKQA 2Z59B 3AEBB 3RZWC 3WIMA 3MJ5A 1VLBA 3O13A 4BOSC 3EECA 3X23A 1C4PA 1I4XA 3T3NA 1WZ3A 2BWES 4ITKA 4ACFA 2D3AA 1R4MB 2NMQA 3AE8B 2LWPA 4YTPB 2DAFA 1P3QU 4ZRQA 1TT5B 4AQ7A 2CJNA 2QHOA 3I3TB 3RNBC 5D3IB 2H89B 1UD7A 2HDEA 3LDZE 2IYDB 3ETRA 2V9HA 4E71A 2BS4B 2D3BA 3Q3OC 2EELA 1ZE3D 2K8BA 1WXQA 3L10B 4TQ0A 2M56B 2LMCA 4KV2A 2WXOA 1EO6A 3ZJVA 1SBBB 4W9DA 3WCQA 4NQLB 1R4NB 5DPRA 3AEGB 1KJTA 1XXGA 5DPWA 4MH8A 2KDFB 4GDKA 4A55A 1EF5A 4C7YA 1WE6A 2SAKA 2XNAC 2LJIA 4NQKE 2MBOA 4FHKA 1UWXA 1RYJA 1N5WA 4WJPA 1WGDA 2N1VA 3HM3A 2L0TA 1GC6A 3IFWB 3DCGA 2C5LC 3DWMA 1WXAA 2KVZA 1FCLA 4OZAA 2AL3A 2RMMA 4S0RA 4FHJA 2WNMA 1PFDA 1WRDB 3PT2B 1JWUD 3BINA 1VD2A 1MHHE 4KKIA 2ZVOA 2K22A 3RNFC 2IBIB 4NJCA 3VH3B 3IAS1 1BUIC 1AW7A 3VQIA 3RMKC 1Y8RC 4DHZB 4MGKE 2KDMA 1TY0A 4AOFA 4US8A 1LFDA 1L7YA 3GZNI 1WF9A 2LGDA 3PHXB 3PREA 2NS5A 4WWPA 2INNE 1IP9A 3QK0A 4PYZA 4MH0E 1EWYC 2NTSA 2FCMA 3I63C 2LGXA 3SD5A 2KT7A 1L5PA 1XCTL 1J8CA 1DOIA 5AUKA 3ZTDA 4HPPA 2NPTA 5AEKB 1ZP0B 2NCNA 1E10A 1E5WA 3ML8A 2WGSA 5IA7A 2IY1B 2RR9A 2DX5B 1WM2A 2KLGA 1JCKB 2ZNVC 2YEPF 1T0SC 3ENEA 3Q14C 2RDGA 2G45B 2ZW0A 3DVNV 2MLBA 1GAQB 3ZXVA 1AARA 2WWZA 2IO1B 2N7EA 3PS6A 4EKUA 2DBYA 2KTRB 1WJ6A 2N7DA 3AN1A 1QILA 3GOEA 2WXGA 2CHZA 4YSXB 4W9IA 1FD6A 2AQ2B 1UNSA 2D07B 4G50A 3HVDA 4ASWC 1D4BA 4DDID 3IHPC 3RNAC 4FJZA 5IP4D 3IAM1 4GMVA 4KGTA 2UU7A 2KYWA 3ZDTA 1TIFA 2D11A 2KJRA 2IDYA 3EUB2 4XWWA 4K7UA 1YNTE 3TEXA 3AE1B 3P63A 2NVUI 5IAAC 2XEWA 3PVLA 4KZ0A 4KGRA 4ANWA 2D3CA 4GB9A 1OQRA 2MQJA 1K50A 4REZA 1MJDA 3A1QB 1J0GA 4IG7B 2D3GA 2RSUA 5CX3A 3NZ3A 3L54A 4W9JA 4ZHPA 3UINB 2V3NA 3Q3MC 2Y5CA 4LNFA 2GB1A 5KHQA 3PSEB 5HG2A 1V6EA 3BYTB 4PT5A 5BYQA 5FK9C 2WDRB 4P7IA 1Q5WB 5D6JB 4A6QA 1XLNA 4KSLC 2DAJA 3V60A 2WXQA 1KTKA 2KLCA 3KW5B 4ZYSA 3RFZB 4WIPA 4OVUA 2KZRA 2GOWA 1UGMA 2Q5WD 2IGGA 1AWDA 1J7BA 1UWMA 1QLBB 4C56C 2G3QB 4TMAB 3SDLC 1WIAA 2FUG1 1ACCA 1HEZE 3BVZA 4ANUA 3ZRCA 1FCCC 1SB3C 3TEWA 3R8BA 2WXKA 4HCPB 1WGHA 4HDQA 1Y56A 3H6NA 3TIXA 2N9KA 1FFVA 2INPE 3VTWA 1FM0D 4JWUC 2MP2A 1SE9A
chains in the Genus database with same CATH topology
1TZ1A 3WAOA 2GBMA 3VHTC 4MGIE 2ZZPB 4W9CA 2WYQA 1KLVA 2R2OA 2N4FA 4CHKA 3OJ3A 4FULA 3M62B 2OOBB 2O2VA 3TJPA 3ALBA 3LJ3A 4HLEA 2UWQA 4K1RB 4BKSA 4MJSA 3UQAA 4BOZB 2LD9A 3U7DA 2I1JA 3DBLI 2MX2A 1YQBA 3Q3FA 1Q0WB 2KFKB 3QJZA 2K6QA 2I1KA 2C7MB 2L0FA 2MBEA 1F9JA 3QHTA 3UF8A 2M4NA 4NNJB 2KK8A 3R7RA 4EUTA 4IM0A 2JXXA 4EZKA 3RD2A 2O6VD 4CYEA 3CMMB 1C1YB 3W1YA 1WE7A 4HVBA 5E6OA 5JZEB 2JF5A 3A9KB 1WMHA 3ZNID 1E90A 2CU1A 1WM3A 2MWSB 4IUMB 3VUWA 1YJ1A 2EMTA 4NPNA 3PLVA 2AL6A 4PS7A 2A4ZA 3IG3A 4DBGA 1G6JA 2M1MA 2PEAA 1WR6E 1CMXB 1WJNA 3DVNU 4KSKC 1TBEA 2C60A 4MM3A 2MBBB 4FJVB 2KOXA 1UH6A 2L00B 3ZLZA 5JH5C 4WJQA 1GC7A 4W9GA 3AXCA 3UGBB 2KNBA 4DK5A 4EEWA 5CHWA 1A5RA 2BF8B 1OTRB 2KWCA 4XZ4A 5AZFA 3VXWA 3K9OB 2J7QB 4KZCA 3VVWB 4IWQA 3JSVA 2L05A 1E7UA 3U30A 2KN5A 5J2RA 1Z2MA 2KTRA 3ZNHB 4EFOA 4HCNB 2CR5A 3M95A 1TGZB 1WH3A 4IW0A 1YX6B 2FCNA 4IM3A 4MSQB 4BVUC 5C1ZA 4YL8A 3HM6X 3N32A 4LCDE 4GU2A 2JVCA 4WJNA 4B95A 4W9LA 3CSTA 4AJYB 2HJ8A 2L7RA 5D2MB 5FR6A 2K1FA 4WJOA 3ZW3A 3H7SA 2KFKA 2D2QA 3KH0A 3M63B 3PV1A 4GGQA 4M8MA 3WAPA 5LXIB 2YVCA 1E8YA 3L0WB 2AEHA 1WJUA 2RGFA 3H9DA 1E8XA 5CHVC 3T8MA 5HKHA 2K6DB 3EC8A 4BFRA 3A9KA 3PRMB 3CF6E 1WFYA 3OJ4B 3QWZB 4KIKA 4B6WA 1P9DU 2KKCA 2CS4A 2N9XA 2HE7A 2C9WB 2IZVB 3QCAA 4JGHB 2LVPA 4ZDVA 5BO4B 1ISNA 2GBJA 4HK2A 1OEYA 4HPMB 4FBJB 3PTFC 2ZCBA 1WGGA 3JW0X 1RFAA 3ML9A 1LQBA 4MELA 1WXVA 2BWFA 2VRRB 2KJ6A 2Z0EB 3KYDD 1NDDA 3HK0A 4BKSD 2LVQA 2KMCA 2LXCA 2M17A 2A5UA 3DDCB 4AUQC 4MGYE 1NI2A 2MA9B 3ZVVA 4FA6A 4ICUA 2M8SA 4LJPB 1NBFC 4BKGA 5D94A 2Z59B 4DHZE 3RZWC 3WIMA 4BOSC 3EECA 3X23A 4EZLA 5KHOA 4A3OA 1I42A 1WZ3A 2BWES 2CHXA 3VDZA 3PZDA 3N3KB 2KJHB 4GDKB 1MG8A 3P2BA 4TUUA 3B0AA 4ZRJA 4G0NB 3VH4B 1UELA 2K8CA 1P98A 1D3ZA 2LWPA 4DXAB 2DAFA 4WWOA 1P3QU 2B3AA 3PHWB 1M94A 3ECIA 3RZFA 1FXTB 3W1SC 4GOCA 1WX7A 2QHOA 3I3TB 5L83A 3VTUA 1WJ4A 5G2NA 1TTNA 2JT4B 1UD7A 1V2YA 4I6LB 3KVFB 5D7GA 3LDZE 1RRBA 3B1LX 2IYDB 2LXAA 4E71A 3ZUNA 2LGYA 3KUDB 3A33B 4MSMB 4X57B 1V9JA 2KC2A 2K8BA 1S3SG 2GBNA 3CSFA 4IC7B 3L10B 4AWJA 4HWIB 2IO0B 4TQ0A 2YLMA 2KHWB 3DVGY 4TV3A 4KV2A 3DOWA 3OAWA 1EO6A 2KDBA 3SU8X 2GMIC 4W9DA 4G11A 2CHWA 2KDEB 1WX8A 4NQLB 2LRUA 3C0RB 2UYZB 5DPRA 1XT9B 1KJTA 2K39A 1WXMA 5DPWA 5J17A 2HTHA 2KDFB 4GDKA 4W9KA 1X1MA 2DZMA 1EF5A 1WE6A 4FJYA 3UIOB 4TQ1A 3KYCD 3V6CB 4ANXA 4HXDA 3X0WA 1VCBA 2MBOA 4FHKA 4NQKE 4ZRKA 1WYWB 2JUOA 2V3SA 3V62A 4WJPA 2EMSA 2BKRB 1WGDA 1WGRA 2N1VA 3HM3A 2L0TA 2DZJA 1K8RB 2C7NB 3PPAA 4ANVA 1GC6A 1KOTA 3IFWB 4JL9A 1RLFA 3DCGA 2C5LC 3PRZA 1WXAA 4JLCA 5L95C 2NPTB 1UZXB 4E3CA 2EKEC 2AL3A 1I35A 4FHJA 1LXDA 4RM8A 2BPSA 4BKTA 2NBVB 5JHAA 3RCZA 2OJRA 2PE9A 3RUIB 3MTNB 1WRDB 3PT2B 4PS3A 3DPDA 3BINA 2JZ3B 3ZRFA 1VD2A 3QX1A 1V49A 2FIDA 2ZVOA 2MRPA 4IWPA 3VTVA 2IBIB 4K81A 2KWVB 2PPHA 4NJ6A 1BT0A 3NHEB 3VH3B 1E8WA 4DDGD 4W9HA 3ZNGC 2DYMA 3QIJA 3VQIA 1Y8RC 1IPGA 4DHZB 4CO7A 1P1AA 3ZIMA 5DPTA 3AU4A 4MGKE 4AOFA 1LFDA 1L7YA 3GZNI 1WF9A 4F1SA 2LGDA 3PHXB 2ZVNA 4HPLB 3PREA 3WAMA 2NS5A 4JQWC 4WWPA 2KMAA 5LLIA 4E74A 4IWOA 1SIFA 3V6EB 1IP9A 2JWZA 3QK0A 4PYZA 4W9EA 4MH0E 2BGFA 4WWNA 3UIPB 3VUXA 2FCMA 3SHQA 4FLHA 1LM8B 2LASA 3S2AA 3TCAA 4FADA 3R66C 2LGXA 3SD5A 2LZ6A 4B9KA 5GMVA 5G55A 1XQQA 1ZGUB 3QQ8B 2PE6B 1IYFA 3EHVA 4II2B 1J8CA 2JRHA 4GXBA 4ICVA 3ZTDA 1HE8A 1SGHA 1WXSA 2D10A 1WX9A 2NPTA 4NJ7A 2BYEA 2IY0B 2NCNA 5AEKB 1E5WA 2N1WA 4JIOU 3WA0A 2J0MA 1V80A 2ZEQA 3ML8A 4PYUA 4KDIC 2J0KA 4RM9A 1UBQA 2KX3A 5IA7A 3W1SA 3WANA 2IY1B 2GBKA 4LDTD 2RPQA 3O65B 5DCNA 2RR9A 3ZDMC 2DX5B 4AJWA 3R7QA 1WM2A 2KLGA 4I6NB 3DBRI 4WQOB 4DHJD 4KDLB 1WGYA 4FN2A 2ZNVC 3IBEA 3ENEA 4GN1A 3JVZX 2REXA 2G45B 1GJZA 3DVNV 3KUZA 2MLBA 2ZPYA 4AP4C 3ONSA 3AU5A 1H8CA 4I6PA 1AARA 3D32A 2WWZA 4W9FA 2IO1B 1ZKHA 2N7EA 2KC1A 2K8HA 2DYBA 2MW5A 2BYVE 3PS6A 3JSVB 2DZIA 3ZKJC 4EKUA 2DENB 4PS8A 2MCNB 2C7HA 2KX0A 2KTRB 2HD5B 1WJ6A 4K7WA 3R3MA 3RT3B 2N7DA 3H7PB 1T0YA 4HDOA 2RD0A 3GOEA 4NY0A 1YIWA 2CHZA 2LUEA 4GDLB 4KVGB 4W9IA 2KFJA 4XX5A 3WALA 2KANA 3KUCB 3DQVA 2N9PC 3NOBA 4G50A 3DBHI 2D07B 4F8CB 2DZKA 2DYOA 2O6VB 3AULA 4ASWC 1S1QB 3L08A 1L2NA 4DDID 2FIFA 2KQSA 2LRWA 3IHPC 1GNUA 4J6IA 2L3ZA 1XD3B 4XC2A 3ZNZB 4BBNF 4FJZA 2PJHA 2ASQA 4GMVA 1V5OA 5TR5A 4MDKE 2KWUB 3ZDTA 2BYFA 1YD8U 2XBBC 4URKA 3RYTA 4KIKB 1OEYJ 1E8ZA 2ZJDA 4NAWB 2D11A 4K7SA 1WZ0A 2KJRA 5EDSA 4A3PA 4K7UA 5LXHA 3L17A 2G4DB 3L13A 5DPSA 3B08A 2JRIB 2L8JA 1UBIA 2KVRA 2M0XA 2NVUI 5IAAC 2WX1A 2XEWA 3QARA 4BBNC 1Z5SB 2JPHA 1RAXA 2KO3A 3HHMA 3NZUA 3PVLA 4EZJA 4KZ0A 1ZW7A 4ANWA 3DVGX 3PRPB 4GIVA 2ZNVB 4GB9A 2NBWB 2MQJA 4GSWA 3H7PA 2G4SA 3OLMD 3M3JA 4TKNA 1H4RA 4GDLA 2MSED 1R4MI 3QA8A 2XK5B 3A1QB 2V4LA 3TL5A 2FCQA 2O6VA 3ZO5B 1KM7A 1J0GA 4IG7B 4ZYNA 5JHBA 2W9NA 2FAZA 3IVFA 2D3GA 4EOYA 4ZRIA 2RSUA 4WAAA 1E7VA 3V61A 1QZEA 1V81A 3L16A 3NS8A 1EUVB 5CX3A 3L54A 3APCA 1J19A 4RMAA 2CKHB 1WI0A 3ZTCA 4W9JA 2V1YA 3A9JB 3UINB 2NR2A 3K9PB 5AZGA 3TMPB 3PSEB 5KHQA 1V6EA 2LI5A 2MP2B 4MGZE 2JZZA 4N9F4 1OGWA 2KTFA 3QAQA 4IM2A 3DBSA 4P7IA 4NAWA 1Q5WB 2N9EB 5D6JB 4OVVA 2FUHB 2O2VB 2DHZA 2GBRA 4II3B 4LJOB 4KSLC 4MJSB 2DAJA 5CTRC 2KQ7A 3AI5A 3V60A 2ZPNA 2KLCA 3KW5B 1GUAB 4OVUA 2IO3B 2KZRA 5E6NA 1YX5B 1V5TA 2FNJB 2R2QA 3N30A 5AZHA 3TBLD 3HIZA 4G3XB 4MEMA 3MHSD 1C3TA 2Y5BB 4HJKA 2KDIA 1OQYA 4A20A 5C23A 2GOWA 1UGMA 2K25A 3PLUA 3RULA 3Q3JA 4F7ZA 1WY8A 3UQBA 2AYOB 1R4NI 2ZCCA 1U4AA 2BKFA 1WMHB 2Z0DB 2G3QB 3SDLC 1WIAA 3APDA 2LVOA 3PGEA 3NY5A 4M0WB 2FCSA 3H1UA 3NZSA 4DWFA 2XK5A 3A1QA 2MBQA 4LDTB 2MBHA 3JYUA 3VUYA 1WR1A 4ANUA 2WX0A 3ZRCA 1JRUA 5CHFA 2IO2B 4M8NA 3T9LA 1P0RA 2AWTA 3A4SC 2LJ5A 2L76A 2NBUA 1V86A 1WGHA 4HCPB 4DHJB 5J18A 4HDQA 3H6NA 3APFA 3QC8B 1PQSA 3MJWA 3TIXA 2KXJA 3BY4B 3U8ZA 3A9JA 3A4RA 5E6PA 3VAWA 2J0JA 2WDTB 1Q1OA 3VFKA 3VTWA 2KD0A 1EF1A 2JY6A 2MP2A 1GG3A 1SE9A 3EFUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TZ1 A;  3WAO A;  2GBM A;  3VHT C;  4MGI E;  2ZZP B;  4W9C A;  2WYQ A;  1KLV A;  2R2O A;  2N4F A;  4CHK A;  3OJ3 A;  4FUL A;  3M62 B;  2OOB B;  2O2V A;  3TJP A;  3ALB A;  3LJ3 A;  4HLE A;  2UWQ A;  4K1R B;  4BKS A;  4MJS A;  3UQA A;  4BOZ B;  2LD9 A;  3U7D A;  2I1J A;  3DBL I;  2MX2 A;  1YQB A;  3Q3F A;  1Q0W B;  2KFK B;  3QJZ A;  2K6Q A;  2I1K A;  2C7M B;  2L0F A;  2MBE A;  1F9J A;  3QHT A;  3UF8 A;  2M4N A;  4NNJ B;  2KK8 A;  3R7R A;  4EUT A;  4IM0 A;  2JXX A;  4EZK A;  3RD2 A;  2O6V D;  4CYE A;  3CMM B;  1C1Y B;  3W1Y A;  1WE7 A;  4HVB A;  5E6O A;  5JZE B;  2JF5 A;  3A9K B;  1WMH A;  3ZNI D;  1E90 A;  2CU1 A;  1WM3 A;  2MWS B;  4IUM B;  3VUW A;  1YJ1 A;  2EMT A;  4NPN A;  3PLV A;  2AL6 A;  4PS7 A;  2A4Z A;  3IG3 A;  4DBG A;  1G6J A;  2M1M A;  2PEA A;  1WR6 E;  1CMX B;  1WJN A;  3DVN U;  4KSK C;  1TBE A;  2C60 A;  4MM3 A;  2MBB B;  4FJV B;  2KOX A;  1UH6 A;  2L00 B;  3ZLZ A;  5JH5 C;  4WJQ A;  1GC7 A;  4W9G A;  3AXC A;  3UGB B;  2KNB A;  4DK5 A;  4EEW A;  5CHW A;  1A5R A;  2BF8 B;  1OTR B;  2KWC A;  4XZ4 A;  5AZF A;  3VXW A;  3K9O B;  2J7Q B;  4KZC A;  3VVW B;  4IWQ A;  3JSV A;  2L05 A;  1E7U A;  3U30 A;  2KN5 A;  5J2R A;  1Z2M A;  2KTR A;  3ZNH B;  4EFO A;  4HCN B;  2CR5 A;  3M95 A;  1TGZ B;  1WH3 A;  4IW0 A;  1YX6 B;  2FCN A;  4IM3 A;  4MSQ B;  4BVU C;  5C1Z A;  4YL8 A;  3HM6 X;  3N32 A;  4LCD E;  4GU2 A;  2JVC A;  4WJN A;  4B95 A;  4W9L A;  3CST A;  4AJY B;  2HJ8 A;  2L7R A;  5D2M B;  5FR6 A;  2K1F A;  4WJO A;  3ZW3 A;  3H7S A;  2KFK A;  2D2Q A;  3KH0 A;  3M63 B;  3PV1 A;  4GGQ A;  4M8M A;  3WAP A;  5LXI B;  2YVC A;  1E8Y A;  3L0W B;  2AEH A;  1WJU A;  2RGF A;  3H9D A;  1E8X A;  5CHV C;  3T8M A;  5HKH A;  2K6D B;  3EC8 A;  4BFR A;  3A9K A;  3PRM B;  3CF6 E;  1WFY A;  3OJ4 B;  3QWZ B;  4KIK A;  4B6W A;  1P9D U;  2KKC A;  2CS4 A;  2N9X A;  2HE7 A;  2C9W B;  2IZV B;  3QCA A;  4JGH B;  2LVP A;  4ZDV A;  5BO4 B;  1ISN A;  2GBJ A;  4HK2 A;  1OEY A;  4HPM B;  4FBJ B;  3PTF C;  2ZCB A;  1WGG A;  3JW0 X;  1RFA A;  3ML9 A;  1LQB A;  4MEL A;  1WXV A;  2BWF A;  2VRR B;  2KJ6 A;  2Z0E B;  3KYD D;  1NDD A;  3HK0 A;  4BKS D;  2LVQ A;  2KMC A;  2LXC A;  2M17 A;  2A5U A;  3DDC B;  4AUQ C;  4MGY E;  1NI2 A;  2MA9 B;  3ZVV A;  4FA6 A;  4ICU A;  2M8S A;  4LJP B;  1NBF C;  4BKG A;  5D94 A;  2Z59 B;  4DHZ E;  3RZW C;  3WIM A;  4BOS C;  3EEC A;  3X23 A;  4EZL A;  5KHO A;  4A3O A;  1I42 A;  1WZ3 A;  2BWE S;  2CHX A;  3VDZ A;  3PZD A;  3N3K B;  2KJH B;  4GDK B;  1MG8 A;  3P2B A;  4TUU A;  3B0A A;  4ZRJ A;  4G0N B;  3VH4 B;  1UEL A;  2K8C A;  1P98 A;  1D3Z A;  2LWP A;  4DXA B;  2DAF A;  4WWO A;  1P3Q U;  2B3A A;  3PHW B;  1M94 A;  3ECI A;  3RZF A;  1FXT B;  3W1S C;  4GOC A;  1WX7 A;  2QHO A;  3I3T B;  5L83 A;  3VTU A;  1WJ4 A;  5G2N A;  1TTN A;  2JT4 B;  1UD7 A;  1V2Y A;  4I6L B;  3KVF B;  5D7G A;  3LDZ E;  1RRB A;  3B1L X;  2IYD B;  2LXA A;  4E71 A;  3ZUN A;  2LGY A;  3KUD B;  3A33 B;  4MSM B;  4X57 B;  1V9J A;  2KC2 A;  2K8B A;  1S3S G;  2GBN A;  3CSF A;  4IC7 B;  3L10 B;  4AWJ A;  4HWI B;  2IO0 B;  4TQ0 A;  2YLM A;  2KHW B;  3DVG Y;  4TV3 A;  4KV2 A;  3DOW A;  3OAW A;  1EO6 A;  2KDB A;  3SU8 X;  2GMI C;  4W9D A;  4G11 A;  2CHW A;  2KDE B;  1WX8 A;  4NQL B;  2LRU A;  3C0R B;  2UYZ B;  5DPR A;  1XT9 B;  1KJT A;  2K39 A;  1WXM A;  5DPW A;  5J17 A;  2HTH A;  2KDF B;  4GDK A;  4W9K A;  1X1M A;  2DZM A;  1EF5 A;  1WE6 A;  4FJY A;  3UIO B;  4TQ1 A;  3KYC D;  3V6C B;  4ANX A;  4HXD A;  3X0W A;  1VCB A;  2MBO A;  4FHK A;  4NQK E;  4ZRK A;  1WYW B;  2JUO A;  2V3S A;  3V62 A;  4WJP A;  2EMS A;  2BKR B;  1WGD A;  1WGR A;  2N1V A;  3HM3 A;  2L0T A;  2DZJ A;  1K8R B;  2C7N B;  3PPA A;  4ANV A;  1GC6 A;  1KOT A;  3IFW B;  4JL9 A;  1RLF A;  3DCG A;  2C5L C;  3PRZ A;  1WXA A;  4JLC A;  5L95 C;  2NPT B;  1UZX B;  4E3C A;  2EKE C;  2AL3 A;  1I35 A;  4FHJ A;  1LXD A;  4RM8 A;  2BPS A;  4BKT A;  2NBV B;  5JHA A;  3RCZ A;  2OJR A;  2PE9 A;  3RUI B;  3MTN B;  1WRD B;  3PT2 B;  4PS3 A;  3DPD A;  3BIN A;  2JZ3 B;  3ZRF A;  1VD2 A;  3QX1 A;  1V49 A;  2FID A;  2ZVO A;  2MRP A;  4IWP A;  3VTV A;  2IBI B;  4K81 A;  2KWV B;  2PPH A;  4NJ6 A;  1BT0 A;  3NHE B;  3VH3 B;  1E8W A;  4DDG D;  4W9H A;  3ZNG C;  2DYM A;  3QIJ A;  3VQI A;  1Y8R C;  1IPG A;  4DHZ B;  4CO7 A;  1P1A A;  3ZIM A;  5DPT A;  3AU4 A;  4MGK E;  4AOF A;  1LFD A;  1L7Y A;  3GZN I;  1WF9 A;  4F1S A;  2LGD A;  3PHX B;  2ZVN A;  4HPL B;  3PRE A;  3WAM A;  2NS5 A;  4JQW C;  4WWP A;  2KMA A;  5LLI A;  4E74 A;  4IWO A;  1SIF A;  3V6E B;  1IP9 A;  2JWZ A;  3QK0 A;  4PYZ A;  4W9E A;  4MH0 E;  2BGF A;  4WWN A;  3UIP B;  3VUX A;  2FCM A;  3SHQ A;  4FLH A;  1LM8 B;  2LAS A;  3S2A A;  3TCA A;  4FAD A;  3R66 C;  2LGX A;  3SD5 A;  2LZ6 A;  4B9K A;  5GMV A;  5G55 A;  1XQQ A;  1ZGU B;  3QQ8 B;  2PE6 B;  1IYF A;  3EHV A;  4II2 B;  1J8C A;  2JRH A;  4GXB A;  4ICV A;  3ZTD A;  1HE8 A;  1SGH A;  1WXS A;  2D10 A;  1WX9 A;  2NPT A;  4NJ7 A;  2BYE A;  2IY0 B;  2NCN A;  5AEK B;  1E5W A;  2N1W A;  4JIO U;  3WA0 A;  2J0M A;  1V80 A;  2ZEQ A;  3ML8 A;  4PYU A;  4KDI C;  2J0K A;  4RM9 A;  1UBQ A;  2KX3 A;  5IA7 A;  3W1S A;  3WAN A;  2IY1 B;  2GBK A;  4LDT D;  2RPQ A;  3O65 B;  5DCN A;  2RR9 A;  3ZDM C;  2DX5 B;  4AJW A;  3R7Q A;  1WM2 A;  2KLG A;  4I6N B;  3DBR I;  4WQO B;  4DHJ D;  4KDL B;  1WGY A;  4FN2 A;  2ZNV C;  3IBE A;  3ENE A;  4GN1 A;  3JVZ X;  2REX A;  2G45 B;  1GJZ A;  3DVN V;  3KUZ A;  2MLB A;  2ZPY A;  4AP4 C;  3ONS A;  3AU5 A;  1H8C A;  4I6P A;  1AAR A;  3D32 A;  2WWZ A;  4W9F A;  2IO1 B;  1ZKH A;  2N7E A;  2KC1 A;  2K8H A;  2DYB A;  2MW5 A;  2BYV E;  3PS6 A;  3JSV B;  2DZI A;  3ZKJ C;  4EKU A;  2DEN B;  4PS8 A;  2MCN B;  2C7H A;  2KX0 A;  2KTR B;  2HD5 B;  1WJ6 A;  4K7W A;  3R3M A;  3RT3 B;  2N7D A;  3H7P B;  1T0Y A;  4HDO A;  2RD0 A;  3GOE A;  4NY0 A;  1YIW A;  2CHZ A;  2LUE A;  4GDL B;  4KVG B;  4W9I A;  2KFJ A;  4XX5 A;  3WAL A;  2KAN A;  3KUC B;  3DQV A;  2N9P C;  3NOB A;  4G50 A;  3DBH I;  2D07 B;  4F8C B;  2DZK A;  2DYO A;  2O6V B;  3AUL A;  4ASW C;  1S1Q B;  3L08 A;  1L2N A;  4DDI D;  2FIF A;  2KQS A;  2LRW A;  3IHP C;  1GNU A;  4J6I A;  2L3Z A;  1XD3 B;  4XC2 A;  3ZNZ B;  4BBN F;  4FJZ A;  2PJH A;  2ASQ A;  4GMV A;  1V5O A;  5TR5 A;  4MDK E;  2KWU B;  3ZDT A;  2BYF A;  1YD8 U;  2XBB C;  4URK A;  3RYT A;  4KIK B;  1OEY J;  1E8Z A;  2ZJD A;  4NAW B;  2D11 A;  4K7S A;  1WZ0 A;  2KJR A;  5EDS A;  4A3P A;  4K7U A;  5LXH A;  3L17 A;  2G4D B;  3L13 A;  5DPS A;  3B08 A;  2JRI B;  2L8J A;  1UBI A;  2KVR A;  2M0X A;  2NVU I;  5IAA C;  2WX1 A;  2XEW A;  3QAR A;  4BBN C;  1Z5S B;  2JPH A;  1RAX A;  2KO3 A;  3HHM A;  3NZU A;  3PVL A;  4EZJ A;  4KZ0 A;  1ZW7 A;  4ANW A;  3DVG X;  3PRP B;  4GIV A;  2ZNV B;  4GB9 A;  2NBW B;  2MQJ A;  4GSW A;  3H7P A;  2G4S A;  3OLM D;  3M3J A;  4TKN A;  1H4R A;  4GDL A;  2MSE D;  1R4M I;  3QA8 A;  2XK5 B;  3A1Q B;  2V4L A;  3TL5 A;  2FCQ A;  2O6V A;  3ZO5 B;  1KM7 A;  1J0G A;  4IG7 B;  4ZYN A;  5JHB A;  2W9N A;  2FAZ A;  3IVF A;  2D3G A;  4EOY A;  4ZRI A;  2RSU A;  4WAA A;  1E7V A;  3V61 A;  1QZE A;  1V81 A;  3L16 A;  3NS8 A;  1EUV B;  5CX3 A;  3L54 A;  3APC A;  1J19 A;  4RMA A;  2CKH B;  1WI0 A;  3ZTC A;  4W9J A;  2V1Y A;  3A9J B;  3UIN B;  2NR2 A;  3K9P B;  5AZG A;  3TMP B;  3PSE B;  5KHQ A;  1V6E A;  2LI5 A;  2MP2 B;  4MGZ E;  2JZZ A;  4N9F 4;  1OGW A;  2KTF A;  3QAQ A;  4IM2 A;  3DBS A;  4P7I A;  4NAW A;  1Q5W B;  2N9E B;  5D6J B;  4OVV A;  2FUH B;  2O2V B;  2DHZ A;  2GBR A;  4II3 B;  4LJO B;  4KSL C;  4MJS B;  2DAJ A;  5CTR C;  2KQ7 A;  3AI5 A;  3V60 A;  2ZPN A;  2KLC A;  3KW5 B;  1GUA B;  4OVU A;  2IO3 B;  2KZR A;  5E6N A;  1YX5 B;  1V5T A;  2FNJ B;  2R2Q A;  3N30 A;  5AZH A;  3TBL D;  3HIZ A;  4G3X B;  4MEM A;  3MHS D;  1C3T A;  2Y5B B;  4HJK A;  2KDI A;  1OQY A;  4A20 A;  5C23 A;  2GOW A;  1UGM A;  2K25 A;  3PLU A;  3RUL A;  3Q3J A;  4F7Z A;  1WY8 A;  3UQB A;  2AYO B;  1R4N I;  2ZCC A;  1U4A A;  2BKF A;  1WMH B;  2Z0D B;  2G3Q B;  3SDL C;  1WIA A;  3APD A;  2LVO A;  3PGE A;  3NY5 A;  4M0W B;  2FCS A;  3H1U A;  3NZS A;  4DWF A;  2XK5 A;  3A1Q A;  2MBQ A;  4LDT B;  2MBH A;  3JYU A;  3VUY A;  1WR1 A;  4ANU A;  2WX0 A;  3ZRC A;  1JRU A;  5CHF A;  2IO2 B;  4M8N A;  3T9L A;  1P0R A;  2AWT A;  3A4S C;  2LJ5 A;  2L76 A;  2NBU A;  1V86 A;  1WGH A;  4HCP B;  4DHJ B;  5J18 A;  4HDQ A;  3H6N A;  3APF A;  3QC8 B;  1PQS A;  3MJW A;  3TIX A;  2KXJ A;  3BY4 B;  3U8Z A;  3A9J A;  3A4R A;  5E6P A;  3VAW A;  2J0J A;  2WDT B;  1Q1O A;  3VFK A;  3VTW A;  2KD0 A;  1EF1 A;  2JY6 A;  2MP2 A;  1GG3 A;  1SE9 A;  3EFU A; 
#chains in the Genus database with same CATH topology
 4OZB A;  3VHT C;  2R2O A;  3MC9 A;  1NEN B;  1KF6 B;  3N1X C;  3OJ3 A;  3GZN B;  2OOB B;  2UWQ A;  2LD9 A;  3BYY B;  2I1J A;  3DBL I;  2MX2 A;  4M01 A;  1ENF A;  2KFK B;  4YXD B;  2I1K A;  3AEE B;  2C7M B;  2MBE A;  2M4N A;  2WP9 B;  3R7R A;  2JXX A;  3RD2 A;  2JF5 A;  3LB8 C;  1WMH A;  2H88 B;  3AB5 A;  3VUW A;  1XO3 A;  4NPN A;  2JU6 X;  5HFY A;  3SR6 A;  2A4Z A;  4DBG A;  1HZ6 A;  3DVN U;  1TBE A;  3C8Y A;  2KOX A;  2G9H D;  4RGM A;  4WJQ A;  2SEB D;  1GC7 A;  2TSS A;  4DK5 A;  1JRP A;  4EEW A;  4RGT A;  5AZF A;  2KQ4 X;  3GE3 C;  3K9O B;  2J7Q B;  4KZC A;  4US9 A;  3U30 A;  2KN5 A;  1Z2M A;  4HCN B;  2CR5 A;  2M0A A;  2QEJ C;  1WSP A;  2JVC A;  2WLB A;  4B95 A;  4AJY B;  2HJ8 A;  2LHE A;  3ZW3 A;  5BYS A;  1MVK A;  1MFW A;  4GGQ A;  4M8M A;  3WAP A;  3SEB A;  3L0W B;  2AEH A;  3DHI C;  2W3R A;  2AX5 A;  1E8X A;  5C3J B;  1TYG B;  1WFY A;  4B6W A;  1P9D U;  5EE9 A;  1KRH A;  1YOV B;  3NVY A;  2LVP A;  1ISN A;  1OEY A;  4FBJ B;  1WGG A;  4MT5 A;  4MEL A;  2KJ6 A;  2BT6 A;  4BKS D;  2LVQ A;  3AE9 B;  2WU2 B;  2M17 A;  2A5U A;  4R3D A;  4AUQ C;  3MP9 A;  4FA6 A;  2WXL A;  4LJP B;  4BKG A;  1C79 A;  3AE6 B;  1JQ4 A;  2RDH A;  2KN4 A;  2VH2 A;  5BMI A;  3MC0 B;  4BAX A;  3VDZ A;  1F1H A;  2KJH B;  4IDI A;  5TSS A;  2QIE B;  3P2B A;  4TUU A;  1UUP A;  1CQV A;  2GRI A;  4ZRJ A;  1QOG A;  4G0N B;  3VH4 B;  3BII D;  1P98 A;  1D3Z A;  2B3A A;  1M94 A;  3ECI A;  5C2T B;  2KAC A;  1NYQ A;  4GOC A;  3BWU D;  1GB1 A;  4P6V F;  1V2Y A;  4I6L B;  3N1Z C;  1RRB A;  3B1L X;  2LXA A;  2LGY A;  1JAL A;  4X57 B;  2KC2 A;  3TSS A;  1YQ4 B;  4AWJ A;  1QQR A;  1D5Z C;  4HRS A;  3AED B;  2YLM A;  2KHW B;  1RM6 C;  1BML C;  4TV3 A;  3NRZ A;  3OAW A;  2LHD A;  1SEB D;  4G11 A;  4B0M A;  1WX8 A;  1YMH E;  2X8X X;  3C0R B;  2LRU A;  1VR9 A;  1XT9 B;  1SE4 A;  1TS2 A;  1WXM A;  1NEK B;  4XYC A;  2HTH A;  2DZM A;  2BBC A;  5H92 C;  4FJY A;  3UIO B;  1FFU A;  1XLO A;  1VCB A;  4ZRK A;  2JUO A;  1FMA D;  2V3S A;  3EGR A;  4JL9 A;  2FBW B;  3PRZ A;  1PGB A;  2W55 A;  3GE8 C;  4JLC A;  5LNK 1;  1C78 A;  4RCO A;  1LXD A;  1JWS D;  1KLG D;  2BPS A;  3URY A;  5JHA A;  3RCZ A;  3MTN B;  3C19 A;  3DBL B;  2JZ3 B;  1V49 A;  4IWP A;  3B2G A;  2PPH A;  1BT0 A;  1E8W A;  3MFG A;  1VZ7 A;  1YN3 A;  1IPG A;  2QSD A;  2WS3 B;  2ZVN A;  4IKG A;  2Z8L A;  5G5G A;  4E74 A;  1SIF A;  3V6E B;  2JWZ A;  4W9E A;  2JWU A;  2ACZ B;  2BGF A;  1PGX A;  2WXH A;  4FLH A;  3TCA A;  2IGH A;  5GMV A;  5G55 A;  3QQ8 B;  2PE6 B;  1L4D B;  2JRH A;  4ICV A;  4JX1 C;  1VDV A;  1WXS A;  1SIJ A;  2BYE A;  3NJT A;  2N1W A;  4JIO U;  1V80 A;  2J52 A;  1IGC A;  3W1S A;  4WAF A;  1L4Z B;  3ZDM C;  1JW9 D;  3R7Q A;  4KDL B;  2REX A;  1GJZ A;  1N60 A;  4AP4 C;  3FC4 A;  1H8C A;  4JE3 B;  1V8C A;  1ZKH A;  2KC1 A;  2BYV E;  3JSV B;  3ZKJ C;  2DEN B;  4PS8 A;  4YWG G;  2C7H A;  2IPK D;  1LO5 D;  3H7P B;  1T0Y A;  3AEA B;  2RD0 A;  4XX5 A;  4NY0 A;  1YIW A;  3CIR B;  2KFJ A;  1FNW A;  3NOB A;  4OVZ A;  2O6V B;  4MAC A;  1E0Z A;  2WDQ B;  3NUH B;  2FIF A;  2LRW A;  2L3Z A;  4XC2 A;  2BB6 A;  3ZNZ B;  2LGI A;  3BZD B;  1V5O A;  3AV8 A;  1PUT A;  2QIL A;  1F77 A;  1B1Z A;  2BS2 B;  2INC C;  4N59 A;  2XBB C;  4YSY B;  3RYT A;  4KIK B;  1T0Q C;  2ZJD A;  4NAW B;  4K7S A;  4WH4 A;  1WZ0 A;  5EDS A;  2BB5 A;  5LXH A;  2G4D B;  3L13 A;  1AYF A;  3P4P B;  4WWM A;  2BQQ A;  1WYG A;  3Q8F A;  1Z5S B;  2LFI A;  2JPH A;  1RAX A;  2KWD A;  1ZW7 A;  2QCZ A;  1XLQ A;  3M3J A;  3IT6 B;  1H4R A;  3ZQ4 A;  2XK5 B;  3I9V 1;  3ZO5 B;  5JHB A;  2W9N A;  4ZRI A;  1EUV B;  1J19 A;  4RMA A;  3ZTC A;  3A9J B;  3K9P B;  5AZG A;  4RFB A;  2JZZ A;  3SFD B;  4N9F 4;  1OGW A;  3R2I A;  4IM2 A;  3W5U B;  4RH6 A;  2BS3 B;  2FUH B;  3MHZ A;  2GBR A;  4LJO B;  2WDV B;  2IJ0 A;  5CTR C;  3AI5 A;  4J3O D;  2IO3 B;  2JQR B;  3BVG A;  1RFK A;  1V5T A;  2FNJ B;  5AZH A;  3TBL D;  3MHS D;  2Y5B B;  4HJK A;  1OQY A;  3RUL A;  3Q3J A;  3R2T A;  1ROE A;  2AYO B;  1U4A A;  2Z0D B;  3UI3 A;  3APD A;  3PGE A;  3NY5 A;  3H1U A;  4DWF A;  3A1Q A;  3KLS X;  4ZHO A;  2MBH A;  3JYU A;  2WX0 A;  1V1P A;  2IO2 B;  4M8N A;  4P16 A;  3TEZ A;  3A4S C;  2LJ5 A;  3ZJU A;  1V86 A;  5IOI A;  1FNU A;  4XDC A;  3QC8 B;  3MJW A;  2KXJ A;  3A4R A;  4USA A;  3NS1 A;  1EM7 A;  1GG3 A;  3EFU A;  3Q6B A;  3EFC A;  4Q2J A;  1VJK A;  1AN8 A;  1GPX A;  2J42 A;  1YJJ A;  2N4F A;  4CHK A;  2JXT A;  3U4E G;  2PVG C;  1I4R A;  1C77 A;  3N1Y C;  3H8H A;  4BOZ B;  3AEF B;  1Q0W B;  3UF8 A;  5BMH A;  4NNJ B;  2DLB A;  5HI1 A;  1ZXI A;  3CMM B;  1M4V A;  1C1Y B;  1MI0 A;  3W1Y A;  1WE7 A;  3AMZ A;  5E6O A;  4HVB A;  5JZE B;  4EE2 A;  2CU1 A;  2MWS B;  4PS7 A;  1G6J A;  1PYW D;  2MBB B;  3ZXR A;  1YN4 A;  5JH5 C;  5FKA C;  1RWS A;  3OWE B;  2KNB A;  3LXF A;  5CHW A;  2KWC A;  4XZ4 A;  3E9S A;  5J2R A;  1E6E B;  4MSQ B;  2FCN A;  4YL8 A;  3N32 A;  2VZK D;  3W2D A;  3CST A;  3I5J C;  5D2M B;  3TUO A;  2K1F A;  4WJO A;  1XF5 L;  1IBX A;  2KFK A;  1V97 A;  2PLP A;  5JXV A;  2WHI A;  4A8X C;  1WJU A;  2RGF A;  3H9D A;  3AE5 B;  5HKH A;  3EC8 A;  2ONQ A;  3OJ4 B;  3QWZ B;  4O1N A;  4WQM A;  3Q8E A;  2HE7 A;  1OFF A;  3QCA A;  4ZDV A;  1ESF A;  4HK2 A;  2ZCB A;  3DHG C;  3ML9 A;  2EKI A;  2CU3 A;  2LGS A;  2LXC A;  2JX5 A;  1ZPS A;  3DDC B;  3VRB B;  2JYE A;  2MA9 B;  3ZVV A;  2IGD A;  1YN5 A;  2M8S A;  2L32 A;  2Y5P A;  1F2R I;  4DHZ E;  2N0S B;  3AM9 A;  4A3O A;  1I42 A;  1ET6 A;  3SFE B;  3PZD A;  4C7Z A;  3N3K B;  3GB1 A;  1L0X B;  3B0A A;  1KFY B;  1JWM D;  1ZDX A;  4H2A A;  4WWO A;  3PHW B;  3W1S C;  1FXT B;  2I38 A;  5L83 A;  2D5G A;  2PW9 A;  3VTU A;  1WJ4 A;  1D5X C;  5G2N A;  1TTN A;  2JT4 B;  1E7P B;  1T0R C;  3KVF B;  5D7G A;  3KUD B;  3A33 B;  4MSM B;  1F0Z A;  1JWA D;  3CSF A;  3U7Z A;  1L6U A;  4IC7 B;  1I4Q A;  4HWI B;  1QOA A;  2R61 A;  2KDB A;  3SU8 X;  2GMI C;  2KDE B;  1TS4 A;  2K39 A;  3Q8A A;  4ZOH C;  1GOZ A;  3W9C B;  4NZL B;  4A9A A;  4C4V B;  4TQ1 A;  3V6C B;  4WUR A;  4HXD A;  4S17 A;  2EMS A;  3TEY A;  2DZJ A;  2C7N B;  3FAH A;  4ANV A;  1KOT A;  1VRA B;  1RLF A;  1D6E C;  5L95 C;  1TY2 A;  1UZX B;  1I35 A;  3J9C A;  4RM8 A;  2K9X A;  2PE9 A;  3RUI B;  3DWG C;  2OED A;  3ZRF A;  2I2Y A;  2MRP A;  1SJH D;  2CJO A;  4K81 A;  2QDF A;  3FIL B;  3Q2A C;  3LYY A;  4W9H A;  1YQ3 B;  1QOB A;  4CO7 A;  1P1A A;  3ZIM A;  4HPL B;  2BYT A;  5LLI A;  4IWO A;  5EE0 A;  1CJE A;  4WWN A;  3VUX A;  3DHH C;  1LM8 B;  1QT9 A;  1JML A;  4FAD A;  1TKE A;  2MH7 A;  2V4I B;  1I7H A;  4FXC A;  1ZGU B;  3MC8 A;  1GB4 A;  5MPO A;  1HE8 A;  1SGH A;  4NJ7 A;  1WX9 A;  2IY0 B;  5I4D A;  3B9J A;  4PYU A;  4KDI C;  2J0K A;  4RM9 A;  5E6J A;  4LDT D;  2RPQ A;  5DCN A;  4AJW A;  3PZ7 A;  4I6N B;  4WQO B;  2MJD A;  4DHJ D;  1V1O A;  1WGY A;  3GS2 A;  3IBE A;  4LNK A;  1FPY A;  1N5X A;  3KUZ A;  2ZPY A;  3ONS A;  4D2K A;  4I6P A;  1WGK A;  4UDU C;  3U52 E;  2K8H A;  2DYB A;  2MW5 A;  2DZI A;  1ZDV A;  2MCN B;  4C80 A;  3P42 A;  4L1B A;  1TKG A;  1N63 A;  4HDO A;  2LUE A;  4GDL B;  4F1S A;  3WAL A;  2KAN A;  3KUC B;  3DQV A;  4F8C B;  3DBH I;  2DYO A;  3KWL A;  1S1Q B;  3L08 A;  2M19 A;  1XD3 B;  4L2Y A;  4BBN F;  4C00 A;  2PJH A;  2ASQ A;  5TR5 A;  1YJI A;  2KWU B;  4LNN A;  1YD8 U;  4URK A;  3NVW A;  1QOF A;  2WXN A;  4JPS A;  4A3P A;  1C9F A;  2K3U A;  2WU5 B;  3B08 A;  2IND C;  1NYR A;  1UBI A;  3QAR A;  4HRO A;  4RF1 A;  4BBN C;  5EE1 A;  2KO3 A;  3HHM A;  4EZJ A;  3DVG X;  3PRP B;  2MJ3 A;  4GIV A;  2ZNV B;  2NBW B;  2X38 A;  2WXP A;  3H7P A;  2RDB C;  1P7E A;  3OLM D;  2NTT A;  4TKN A;  3QA8 A;  1SJE D;  2V4L A;  1C4C A;  3TL5 A;  2O6V A;  4PK1 A;  1KM7 A;  1J7A A;  4ZYN A;  2FAZ A;  1HXY D;  2L52 A;  4WAA A;  1E7V A;  1QZE A;  3L16 A;  1FRD A;  3APC A;  5T8I A;  2CKH B;  2GI9 A;  2WXJ A;  2NR2 A;  3TMP B;  1B9R A;  1L6V A;  3QAQ A;  4HJG E;  2YEP B;  4TSS A;  3OG5 A;  4NAW A;  3L4P A;  4M00 A;  2O2V B;  2DHZ A;  4HKZ E;  4MJS B;  2KQ7 A;  1ZUD 2;  2QC8 A;  4NAM A;  5E6N A;  2R2Q A;  3N30 A;  3HIZ A;  1ZOY B;  4MEM A;  3P4Q B;  4A20 A;  2G1E A;  1WY8 A;  5IO9 A;  2BKF A;  2LVO A;  4M0W B;  3FKY A;  3NZS A;  2XK5 A;  4LDT B;  2PKO A;  1JRU A;  5CHF A;  4MM3 B;  2AWT A;  4DHJ B;  2L76 A;  1FO4 A;  1E9M A;  5J18 A;  2ON8 A;  1PQS A;  5H8Y E;  3BY4 B;  3U8Z A;  3A9J A;  5E6P A;  1I4P A;  2OHF A;  2J0J A;  2WDT B;  3VAW A;  3VFK A;  2B76 B;  5AUI A;  2JY6 A;  4DXG A;  3W5V B;  4B0E A;  2PTL A;  4W9C A;  1HA5 A;  1KLV A;  4FUL A;  4LNI A;  3M62 B;  3N20 C;  3ALB A;  2JYT A;  3RNG C;  1N62 A;  1NI3 A;  3ABV B;  2WXF A;  1YQB A;  3AEC B;  3QJZ A;  2L0F A;  1F9J A;  3GP7 A;  2BTE A;  4YTM B;  4KKJ A;  4EUT A;  4IM0 A;  4EZK A;  1I4H A;  3A9K B;  3ZNI D;  1YJ1 A;  2EMT A;  2AL6 A;  2E3T A;  3IG3 A;  1HTO A;  4KX6 B;  2E6X A;  1WR6 E;  4BZA A;  3EA6 A;  4KSK C;  2C60 A;  2ICI A;  3U2S C;  1IUE A;  4FJV B;  1UH6 A;  1T5X D;  2L00 B;  4L23 A;  3ZLZ A;  1TS5 A;  3AXC A;  3UGB B;  1A5R A;  1OTR B;  3VXW A;  4IWQ A;  1E7U A;  3Q69 A;  2Y3A A;  3P4S B;  2KTR A;  1L0Y B;  1ET9 A;  3M95 A;  1WH3 A;  4IW0 A;  4BVU C;  1YX6 B;  2JZP A;  5C1Z A;  3KWV A;  4LCD E;  1QF6 A;  4GU2 A;  4RGO S;  4K3B A;  4W9L A;  1WRI A;  1VZ8 A;  2WXI A;  5FR6 A;  1I4G A;  3KH0 A;  3PV1 A;  5LXI B;  3RI7 C;  2YVC A;  1E8Y A;  3DBH B;  2ZW1 A;  4QAY A;  3T8M A;  3PRM B;  1DGJ A;  3RPF C;  1LGR A;  2CS4 A;  2N9X A;  2C9W B;  2QJL A;  3IXS A;  5BO4 B;  1J7C A;  4LTU A;  2GBJ A;  4CQN A;  1SE2 A;  2J53 A;  1EU3 A;  4RNA A;  1RFA A;  2BWF A;  2Z0E B;  1NDD A;  3HK0 A;  2JSV X;  4MGY E;  1NI2 A;  3AH7 A;  1F2R C;  5IN7 A;  1NBF C;  5D94 A;  3ZYY X;  1UGJ A;  4EZL A;  5KHO A;  5EE3 A;  2CHX A;  1STE A;  3NVV A;  4GDK B;  1MG8 A;  2PIA A;  1FNV A;  1UEL A;  2K8C A;  2VH1 A;  2MJE A;  4DXA B;  2DWQ A;  3RZF A;  1WX7 A;  1Q10 A;  2AQ3 B;  3B2F A;  3HRD D;  1EWC A;  1JWB D;  3ZUN A;  2LEK A;  1V9J A;  1IGD A;  1S3S G;  2GBN A;  3HVZ A;  2KAJ A;  1HTQ A;  2IO0 B;  5IKC M;  2N9L A;  1QKZ A;  3DVG Y;  3DOW A;  2CHW A;  3BK2 A;  1SXT A;  3VRA B;  1CZP A;  1T6B X;  2UYZ B;  4N58 A;  5J17 A;  4W9K A;  1X1M A;  2K5P A;  2BVC A;  2MHJ A;  3KYC D;  1DOX A;  3N9Y C;  4ANX A;  3X0W A;  1WYW B;  3V62 A;  2BKR B;  1WGR A;  1K8R B;  4DQO C;  3PPA A;  2NPT B;  4E3C A;  4P1B C;  1ZXH A;  2EKE C;  1TJE A;  4BKT A;  2NBV B;  2OJR A;  1DYQ A;  2BW2 A;  2WXM A;  3P4R B;  4PS3 A;  3DPD A;  3QX1 A;  2FID A;  3VTV A;  4A90 A;  2KWV B;  4NJ6 A;  1A70 A;  3NHE B;  2L83 A;  2W54 A;  1V1P B;  4DDG D;  4YT0 B;  3ZNG C;  2DYM A;  3QIJ A;  2OJW A;  4ZRP A;  3I57 A;  5DPT A;  3AU4 A;  1D5M C;  3ZJT A;  3WAM A;  3AE7 B;  3T3O A;  4JQW C;  4OHJ A;  2KMA A;  4C4V A;  1FEH A;  1PDX A;  3UIP B;  3SHQ A;  2LAS A;  3P1M A;  4RGN A;  3S2A A;  3R66 C;  2LZ6 A;  4B9K A;  1SF0 A;  1XQQ A;  2V3P A;  1IYF A;  3EHV A;  4II2 B;  4GXB A;  1TZO A;  2D10 A;  3WA0 A;  2J0M A;  2ZEQ A;  1KH0 A;  1UBQ A;  2KX3 A;  3WAN A;  2GBK A;  3O65 B;  3AE4 B;  4K3C A;  2QMT A;  2WXR A;  3DBR I;  3RNC C;  4FN2 A;  4JWS C;  3FIL A;  4GN1 A;  3JVZ X;  4KGS A;  1SSN A;  5HHD G;  3AU5 A;  1K52 A;  3D32 A;  4W9F A;  4YSZ B;  1WWT A;  3NVZ A;  2KX0 A;  2HD5 B;  4K7W A;  3R3M A;  3RT3 B;  3ZGZ A;  1PGA A;  4KVG B;  3V3X A;  1L2N A;  2N9P C;  2DZK A;  3AUL A;  5BMG A;  5G5H A;  1R7S A;  2KQS A;  1GNU A;  4J6I A;  1FXA A;  1IBX B;  2MEK A;  2LUM A;  1F52 A;  4MDK E;  1T3Q A;  3HUI A;  4XDD A;  2BYF A;  1OEY J;  1E8Z A;  2PMV A;  1CK1 A;  3CWI A;  3RN9 C;  2K0P A;  4M02 A;  3L17 A;  5DPS A;  4AS1 A;  2JRI B;  2L8J A;  2KVR A;  2M0X A;  2RPV A;  2WX1 A;  2VZK B;  5FR3 A;  3NZU A;  4XWT A;  4GSW A;  2G4S A;  4GDL A;  2MSE D;  1R4M I;  3V05 A;  2FCQ A;  4EOY A;  3IVF A;  3V61 A;  3NS8 A;  1V81 A;  2HJ1 A;  2XN9 C;  1WI0 A;  2V1Y A;  3PZ8 A;  3IT4 B;  2LI5 A;  2MP2 B;  4MGZ E;  2KTF A;  3DBS A;  2N9E B;  1HQR D;  3AE2 B;  4OVV A;  4II3 B;  1DOY A;  1FRR A;  2PVO D;  2ZPN A;  5D3D A;  1GUA B;  3Q3N C;  1EU4 A;  2GLS A;  1YX5 B;  3AE3 B;  3BK1 A;  4G3X B;  1C3T A;  2KDI A;  5C23 A;  2K25 A;  3PLU A;  4F7Z A;  3UQB A;  1R4N I;  2ZCC A;  2L1A A;  1WMH B;  1VZ6 A;  1C4A A;  1P7F A;  2FCS A;  1MHX A;  2MBQ A;  3VUY A;  1WR1 A;  1N61 A;  1K51 A;  3E56 A;  1KLU D;  1TKY A;  3T9L A;  1P0R A;  2NBU A;  3BVM A;  3APF A;  4DXF A;  1Q1O A;  2KD0 A;  4YTN B;  1EF1 A;  2HTM E;  1UF0 A;  1TZ1 A;  3WAO A;  2GBM A;  3NG0 A;  4MGI E;  2ZZP B;  2WYQ A;  3KQ4 A;  4IOI E;  3VR8 B;  1HZ5 A;  2O2V A;  3TJP A;  4LK0 M;  1N6Z A;  3LJ3 A;  4HLE A;  1NVI D;  4K1R B;  4BKS A;  1FIQ A;  4MJS A;  3UQA A;  3U7D A;  3Q3F A;  2K6Q A;  2DNF A;  3QHT A;  2KK8 A;  3VR9 B;  2O6V D;  4CYE A;  2WQY B;  1E90 A;  1WM3 A;  4IUM B;  4M0W A;  4RF0 A;  3PLV A;  1XEE A;  1JRO A;  1SE3 A;  2M1M A;  2PEA A;  1CMX B;  1WJN A;  1XLP A;  4MM3 A;  1L0V B;  3Q8B A;  4OW0 A;  1BXT A;  4W9G A;  2W3S A;  4XGA B;  1TS3 A;  3DBR B;  2BF8 B;  4P1C C;  4LNO A;  3VVW B;  3JSV A;  2L05 A;  1OQQ A;  2KMM A;  4EFO A;  3ZNH B;  2N7J A;  1TGZ B;  4IM3 A;  4XE0 A;  3HM6 X;  4OZC A;  4WJN A;  2L7R A;  2J4X A;  2W82 A;  1MG4 A;  3H7S A;  2D2Q A;  3M63 B;  1XCQ L;  4ARC A;  5CHV C;  4HEA 1;  2AQ1 B;  2K6D B;  3PO0 A;  4BFR A;  3A9K A;  3RNE C;  5BYR A;  3CF6 E;  4KIK A;  2KKC A;  2IZV B;  5GXG B;  4JGH B;  4HPM B;  1FXI A;  3PTF C;  1K53 A;  4ARI A;  3JW0 X;  1LQB A;  1WXV A;  2VRR B;  4N6E B;  3KYD D;  2FE8 A;  4LLG M;  2KMC A;  3Q8C A;  2V0G A;  4GLS C;  1C76 A;  1MPE A;  4ICU A;  4HKQ A;  2Z59 B;  3AEB B;  3RZW C;  3WIM A;  3MJ5 A;  1VLB A;  3O13 A;  4BOS C;  3EEC A;  3X23 A;  1C4P A;  1I4X A;  3T3N A;  1WZ3 A;  2BWE S;  4ITK A;  4ACF A;  2D3A A;  1R4M B;  2NMQ A;  3AE8 B;  2LWP A;  4YTP B;  2DAF A;  1P3Q U;  4ZRQ A;  1TT5 B;  4AQ7 A;  2CJN A;  2QHO A;  3I3T B;  3RNB C;  5D3I B;  2H89 B;  1UD7 A;  2HDE A;  3LDZ E;  2IYD B;  3ETR A;  2V9H A;  4E71 A;  2BS4 B;  2D3B A;  3Q3O C;  2EEL A;  1ZE3 D;  2K8B A;  1WXQ A;  3L10 B;  4TQ0 A;  2M56 B;  2LMC A;  4KV2 A;  2WXO A;  1EO6 A;  3ZJV A;  1SBB B;  4W9D A;  3WCQ A;  4NQL B;  1R4N B;  5DPR A;  3AEG B;  1KJT A;  1XXG A;  5DPW A;  4MH8 A;  2KDF B;  4GDK A;  4A55 A;  1EF5 A;  4C7Y A;  1WE6 A;  2SAK A;  2XNA C;  2LJI A;  4NQK E;  2MBO A;  4FHK A;  1UWX A;  1RYJ A;  1N5W A;  4WJP A;  1WGD A;  2N1V A;  3HM3 A;  2L0T A;  1GC6 A;  3IFW B;  3DCG A;  2C5L C;  3DWM A;  1WXA A;  2KVZ A;  1FCL A;  4OZA A;  2AL3 A;  2RMM A;  4S0R A;  4FHJ A;  2WNM A;  1PFD A;  1WRD B;  3PT2 B;  1JWU D;  3BIN A;  1VD2 A;  1MHH E;  4KKI A;  2ZVO A;  2K22 A;  3RNF C;  2IBI B;  4NJC A;  3VH3 B;  3IAS 1;  1BUI C;  1AW7 A;  3VQI A;  3RMK C;  1Y8R C;  4DHZ B;  4MGK E;  2KDM A;  1TY0 A;  4AOF A;  4US8 A;  1LFD A;  1L7Y A;  3GZN I;  1WF9 A;  2LGD A;  3PHX B;  3PRE A;  2NS5 A;  4WWP A;  2INN E;  1IP9 A;  3QK0 A;  4PYZ A;  4MH0 E;  1EWY C;  2NTS A;  2FCM A;  3I63 C;  2LGX A;  3SD5 A;  2KT7 A;  1L5P A;  1XCT L;  1J8C A;  1DOI A;  5AUK A;  3ZTD A;  4HPP A;  2NPT A;  5AEK B;  1ZP0 B;  2NCN A;  1E10 A;  1E5W A;  3ML8 A;  2WGS A;  5IA7 A;  2IY1 B;  2RR9 A;  2DX5 B;  1WM2 A;  2KLG A;  1JCK B;  2ZNV C;  2YEP F;  1T0S C;  3ENE A;  3Q14 C;  2RDG A;  2G45 B;  2ZW0 A;  3DVN V;  2MLB A;  1GAQ B;  3ZXV A;  1AAR A;  2WWZ A;  2IO1 B;  2N7E A;  3PS6 A;  4EKU A;  2DBY A;  2KTR B;  1WJ6 A;  2N7D A;  3AN1 A;  1QIL A;  3GOE A;  2WXG A;  2CHZ A;  4YSX B;  4W9I A;  1FD6 A;  2AQ2 B;  1UNS A;  2D07 B;  4G50 A;  3HVD A;  4ASW C;  1D4B A;  4DDI D;  3IHP C;  3RNA C;  4FJZ A;  5IP4 D;  3IAM 1;  4GMV A;  4KGT A;  2UU7 A;  2KYW A;  3ZDT A;  1TIF A;  2D11 A;  2KJR A;  2IDY A;  3EUB 2;  4XWW A;  4K7U A;  1YNT E;  3TEX A;  3AE1 B;  3P63 A;  2NVU I;  5IAA C;  2XEW A;  3PVL A;  4KZ0 A;  4KGR A;  4ANW A;  2D3C A;  4GB9 A;  1OQR A;  2MQJ A;  1K50 A;  4REZ A;  1MJD A;  3A1Q B;  1J0G A;  4IG7 B;  2D3G A;  2RSU A;  5CX3 A;  3NZ3 A;  3L54 A;  4W9J A;  4ZHP A;  3UIN B;  2V3N A;  3Q3M C;  2Y5C A;  4LNF A;  2GB1 A;  5KHQ A;  3PSE B;  5HG2 A;  1V6E A;  3BYT B;  4PT5 A;  5BYQ A;  5FK9 C;  2WDR B;  4P7I A;  1Q5W B;  5D6J B;  4A6Q A;  1XLN A;  4KSL C;  2DAJ A;  3V60 A;  2WXQ A;  1KTK A;  2KLC A;  3KW5 B;  4ZYS A;  3RFZ B;  4WIP A;  4OVU A;  2KZR A;  2GOW A;  1UGM A;  2Q5W D;  2IGG A;  1AWD A;  1J7B A;  1UWM A;  1QLB B;  4C56 C;  2G3Q B;  4TMA B;  3SDL C;  1WIA A;  2FUG 1;  1ACC A;  1HEZ E;  3BVZ A;  4ANU A;  3ZRC A;  1FCC C;  1SB3 C;  3TEW A;  3R8B A;  2WXK A;  4HCP B;  1WGH A;  4HDQ A;  1Y56 A;  3H6N A;  3TIX A;  2N9K A;  1FFV A;  2INP E;  3VTW A;  1FM0 D;  4JWU C;  2MP2 A;  1SE9 A; 
#chains in the Genus database with same CATH homology
 1TZ1 A;  3WAO A;  2GBM A;  3VHT C;  4MGI E;  2ZZP B;  4W9C A;  2WYQ A;  1KLV A;  2R2O A;  2N4F A;  4CHK A;  3OJ3 A;  4FUL A;  3M62 B;  2OOB B;  2O2V A;  3TJP A;  3ALB A;  3LJ3 A;  4HLE A;  2UWQ A;  4K1R B;  4BKS A;  4MJS A;  3UQA A;  4BOZ B;  2LD9 A;  3U7D A;  2I1J A;  3DBL I;  2MX2 A;  1YQB A;  3Q3F A;  1Q0W B;  2KFK B;  3QJZ A;  2K6Q A;  2I1K A;  2C7M B;  2L0F A;  2MBE A;  1F9J A;  3QHT A;  3UF8 A;  2M4N A;  4NNJ B;  2KK8 A;  3R7R A;  4EUT A;  4IM0 A;  2JXX A;  4EZK A;  3RD2 A;  2O6V D;  4CYE A;  3CMM B;  1C1Y B;  3W1Y A;  1WE7 A;  4HVB A;  5E6O A;  5JZE B;  2JF5 A;  3A9K B;  1WMH A;  3ZNI D;  1E90 A;  2CU1 A;  1WM3 A;  2MWS B;  4IUM B;  3VUW A;  1YJ1 A;  2EMT A;  4NPN A;  3PLV A;  2AL6 A;  4PS7 A;  2A4Z A;  3IG3 A;  4DBG A;  1G6J A;  2M1M A;  2PEA A;  1WR6 E;  1CMX B;  1WJN A;  3DVN U;  4KSK C;  1TBE A;  2C60 A;  4MM3 A;  2MBB B;  4FJV B;  2KOX A;  1UH6 A;  2L00 B;  3ZLZ A;  5JH5 C;  4WJQ A;  1GC7 A;  4W9G A;  3AXC A;  3UGB B;  2KNB A;  4DK5 A;  4EEW A;  5CHW A;  1A5R A;  2BF8 B;  1OTR B;  2KWC A;  4XZ4 A;  5AZF A;  3VXW A;  3K9O B;  2J7Q B;  4KZC A;  3VVW B;  4IWQ A;  3JSV A;  2L05 A;  1E7U A;  3U30 A;  2KN5 A;  5J2R A;  1Z2M A;  2KTR A;  3ZNH B;  4EFO A;  4HCN B;  2CR5 A;  3M95 A;  1TGZ B;  1WH3 A;  4IW0 A;  1YX6 B;  2FCN A;  4IM3 A;  4MSQ B;  4BVU C;  5C1Z A;  4YL8 A;  3HM6 X;  3N32 A;  4LCD E;  4GU2 A;  2JVC A;  4WJN A;  4B95 A;  4W9L A;  3CST A;  4AJY B;  2HJ8 A;  2L7R A;  5D2M B;  5FR6 A;  2K1F A;  4WJO A;  3ZW3 A;  3H7S A;  2KFK A;  2D2Q A;  3KH0 A;  3M63 B;  3PV1 A;  4GGQ A;  4M8M A;  3WAP A;  5LXI B;  2YVC A;  1E8Y A;  3L0W B;  2AEH A;  1WJU A;  2RGF A;  3H9D A;  1E8X A;  5CHV C;  3T8M A;  5HKH A;  2K6D B;  3EC8 A;  4BFR A;  3A9K A;  3PRM B;  3CF6 E;  1WFY A;  3OJ4 B;  3QWZ B;  4KIK A;  4B6W A;  1P9D U;  2KKC A;  2CS4 A;  2N9X A;  2HE7 A;  2C9W B;  2IZV B;  3QCA A;  4JGH B;  2LVP A;  4ZDV A;  5BO4 B;  1ISN A;  2GBJ A;  4HK2 A;  1OEY A;  4HPM B;  4FBJ B;  3PTF C;  2ZCB A;  1WGG A;  3JW0 X;  1RFA A;  3ML9 A;  1LQB A;  4MEL A;  1WXV A;  2BWF A;  2VRR B;  2KJ6 A;  2Z0E B;  3KYD D;  1NDD A;  3HK0 A;  4BKS D;  2LVQ A;  2KMC A;  2LXC A;  2M17 A;  2A5U A;  3DDC B;  4AUQ C;  4MGY E;  1NI2 A;  2MA9 B;  3ZVV A;  4FA6 A;  4ICU A;  2M8S A;  4LJP B;  1NBF C;  4BKG A;  5D94 A;  2Z59 B;  4DHZ E;  3RZW C;  3WIM A;  4BOS C;  3EEC A;  3X23 A;  4EZL A;  5KHO A;  4A3O A;  1I42 A;  1WZ3 A;  2BWE S;  2CHX A;  3VDZ A;  3PZD A;  3N3K B;  2KJH B;  4GDK B;  1MG8 A;  3P2B A;  4TUU A;  3B0A A;  4ZRJ A;  4G0N B;  3VH4 B;  1UEL A;  2K8C A;  1P98 A;  1D3Z A;  2LWP A;  4DXA B;  2DAF A;  4WWO A;  1P3Q U;  2B3A A;  3PHW B;  1M94 A;  3ECI A;  3RZF A;  1FXT B;  3W1S C;  4GOC A;  1WX7 A;  2QHO A;  3I3T B;  5L83 A;  3VTU A;  1WJ4 A;  5G2N A;  1TTN A;  2JT4 B;  1UD7 A;  1V2Y A;  4I6L B;  3KVF B;  5D7G A;  3LDZ E;  1RRB A;  3B1L X;  2IYD B;  2LXA A;  4E71 A;  3ZUN A;  2LGY A;  3KUD B;  3A33 B;  4MSM B;  4X57 B;  1V9J A;  2KC2 A;  2K8B A;  1S3S G;  2GBN A;  3CSF A;  4IC7 B;  3L10 B;  4AWJ A;  4HWI B;  2IO0 B;  4TQ0 A;  2YLM A;  2KHW B;  3DVG Y;  4TV3 A;  4KV2 A;  3DOW A;  3OAW A;  1EO6 A;  2KDB A;  3SU8 X;  2GMI C;  4W9D A;  4G11 A;  2CHW A;  2KDE B;  1WX8 A;  4NQL B;  2LRU A;  3C0R B;  2UYZ B;  5DPR A;  1XT9 B;  1KJT A;  2K39 A;  1WXM A;  5DPW A;  5J17 A;  2HTH A;  2KDF B;  4GDK A;  4W9K A;  1X1M A;  2DZM A;  1EF5 A;  1WE6 A;  4FJY A;  3UIO B;  4TQ1 A;  3KYC D;  3V6C B;  4ANX A;  4HXD A;  3X0W A;  1VCB A;  2MBO A;  4FHK A;  4NQK E;  4ZRK A;  1WYW B;  2JUO A;  2V3S A;  3V62 A;  4WJP A;  2EMS A;  2BKR B;  1WGD A;  1WGR A;  2N1V A;  3HM3 A;  2L0T A;  2DZJ A;  1K8R B;  2C7N B;  3PPA A;  4ANV A;  1GC6 A;  1KOT A;  3IFW B;  4JL9 A;  1RLF A;  3DCG A;  2C5L C;  3PRZ A;  1WXA A;  4JLC A;  5L95 C;  2NPT B;  1UZX B;  4E3C A;  2EKE C;  2AL3 A;  1I35 A;  4FHJ A;  1LXD A;  4RM8 A;  2BPS A;  4BKT A;  2NBV B;  5JHA A;  3RCZ A;  2OJR A;  2PE9 A;  3RUI B;  3MTN B;  1WRD B;  3PT2 B;  4PS3 A;  3DPD A;  3BIN A;  2JZ3 B;  3ZRF A;  1VD2 A;  3QX1 A;  1V49 A;  2FID A;  2ZVO A;  2MRP A;  4IWP A;  3VTV A;  2IBI B;  4K81 A;  2KWV B;  2PPH A;  4NJ6 A;  1BT0 A;  3NHE B;  3VH3 B;  1E8W A;  4DDG D;  4W9H A;  3ZNG C;  2DYM A;  3QIJ A;  3VQI A;  1Y8R C;  1IPG A;  4DHZ B;  4CO7 A;  1P1A A;  3ZIM A;  5DPT A;  3AU4 A;  4MGK E;  4AOF A;  1LFD A;  1L7Y A;  3GZN I;  1WF9 A;  4F1S A;  2LGD A;  3PHX B;  2ZVN A;  4HPL B;  3PRE A;  3WAM A;  2NS5 A;  4JQW C;  4WWP A;  2KMA A;  5LLI A;  4E74 A;  4IWO A;  1SIF A;  3V6E B;  1IP9 A;  2JWZ A;  3QK0 A;  4PYZ A;  4W9E A;  4MH0 E;  2BGF A;  4WWN A;  3UIP B;  3VUX A;  2FCM A;  3SHQ A;  4FLH A;  1LM8 B;  2LAS A;  3S2A A;  3TCA A;  4FAD A;  3R66 C;  2LGX A;  3SD5 A;  2LZ6 A;  4B9K A;  5GMV A;  5G55 A;  1XQQ A;  1ZGU B;  3QQ8 B;  2PE6 B;  1IYF A;  3EHV A;  4II2 B;  1J8C A;  2JRH A;  4GXB A;  4ICV A;  3ZTD A;  1HE8 A;  1SGH A;  1WXS A;  2D10 A;  1WX9 A;  2NPT A;  4NJ7 A;  2BYE A;  2IY0 B;  2NCN A;  5AEK B;  1E5W A;  2N1W A;  4JIO U;  3WA0 A;  2J0M A;  1V80 A;  2ZEQ A;  3ML8 A;  4PYU A;  4KDI C;  2J0K A;  4RM9 A;  1UBQ A;  2KX3 A;  5IA7 A;  3W1S A;  3WAN A;  2IY1 B;  2GBK A;  4LDT D;  2RPQ A;  3O65 B;  5DCN A;  2RR9 A;  3ZDM C;  2DX5 B;  4AJW A;  3R7Q A;  1WM2 A;  2KLG A;  4I6N B;  3DBR I;  4WQO B;  4DHJ D;  4KDL B;  1WGY A;  4FN2 A;  2ZNV C;  3IBE A;  3ENE A;  4GN1 A;  3JVZ X;  2REX A;  2G45 B;  1GJZ A;  3DVN V;  3KUZ A;  2MLB A;  2ZPY A;  4AP4 C;  3ONS A;  3AU5 A;  1H8C A;  4I6P A;  1AAR A;  3D32 A;  2WWZ A;  4W9F A;  2IO1 B;  1ZKH A;  2N7E A;  2KC1 A;  2K8H A;  2DYB A;  2MW5 A;  2BYV E;  3PS6 A;  3JSV B;  2DZI A;  3ZKJ C;  4EKU A;  2DEN B;  4PS8 A;  2MCN B;  2C7H A;  2KX0 A;  2KTR B;  2HD5 B;  1WJ6 A;  4K7W A;  3R3M A;  3RT3 B;  2N7D A;  3H7P B;  1T0Y A;  4HDO A;  2RD0 A;  3GOE A;  4NY0 A;  1YIW A;  2CHZ A;  2LUE A;  4GDL B;  4KVG B;  4W9I A;  2KFJ A;  4XX5 A;  3WAL A;  2KAN A;  3KUC B;  3DQV A;  2N9P C;  3NOB A;  4G50 A;  3DBH I;  2D07 B;  4F8C B;  2DZK A;  2DYO A;  2O6V B;  3AUL A;  4ASW C;  1S1Q B;  3L08 A;  1L2N A;  4DDI D;  2FIF A;  2KQS A;  2LRW A;  3IHP C;  1GNU A;  4J6I A;  2L3Z A;  1XD3 B;  4XC2 A;  3ZNZ B;  4BBN F;  4FJZ A;  2PJH A;  2ASQ A;  4GMV A;  1V5O A;  5TR5 A;  4MDK E;  2KWU B;  3ZDT A;  2BYF A;  1YD8 U;  2XBB C;  4URK A;  3RYT A;  4KIK B;  1OEY J;  1E8Z A;  2ZJD A;  4NAW B;  2D11 A;  4K7S A;  1WZ0 A;  2KJR A;  5EDS A;  4A3P A;  4K7U A;  5LXH A;  3L17 A;  2G4D B;  3L13 A;  5DPS A;  3B08 A;  2JRI B;  2L8J A;  1UBI A;  2KVR A;  2M0X A;  2NVU I;  5IAA C;  2WX1 A;  2XEW A;  3QAR A;  4BBN C;  1Z5S B;  2JPH A;  1RAX A;  2KO3 A;  3HHM A;  3NZU A;  3PVL A;  4EZJ A;  4KZ0 A;  1ZW7 A;  4ANW A;  3DVG X;  3PRP B;  4GIV A;  2ZNV B;  4GB9 A;  2NBW B;  2MQJ A;  4GSW A;  3H7P A;  2G4S A;  3OLM D;  3M3J A;  4TKN A;  1H4R A;  4GDL A;  2MSE D;  1R4M I;  3QA8 A;  2XK5 B;  3A1Q B;  2V4L A;  3TL5 A;  2FCQ A;  2O6V A;  3ZO5 B;  1KM7 A;  1J0G A;  4IG7 B;  4ZYN A;  5JHB A;  2W9N A;  2FAZ A;  3IVF A;  2D3G A;  4EOY A;  4ZRI A;  2RSU A;  4WAA A;  1E7V A;  3V61 A;  1QZE A;  1V81 A;  3L16 A;  3NS8 A;  1EUV B;  5CX3 A;  3L54 A;  3APC A;  1J19 A;  4RMA A;  2CKH B;  1WI0 A;  3ZTC A;  4W9J A;  2V1Y A;  3A9J B;  3UIN B;  2NR2 A;  3K9P B;  5AZG A;  3TMP B;  3PSE B;  5KHQ A;  1V6E A;  2LI5 A;  2MP2 B;  4MGZ E;  2JZZ A;  4N9F 4;  1OGW A;  2KTF A;  3QAQ A;  4IM2 A;  3DBS A;  4P7I A;  4NAW A;  1Q5W B;  2N9E B;  5D6J B;  4OVV A;  2FUH B;  2O2V B;  2DHZ A;  2GBR A;  4II3 B;  4LJO B;  4KSL C;  4MJS B;  2DAJ A;  5CTR C;  2KQ7 A;  3AI5 A;  3V60 A;  2ZPN A;  2KLC A;  3KW5 B;  1GUA B;  4OVU A;  2IO3 B;  2KZR A;  5E6N A;  1YX5 B;  1V5T A;  2FNJ B;  2R2Q A;  3N30 A;  5AZH A;  3TBL D;  3HIZ A;  4G3X B;  4MEM A;  3MHS D;  1C3T A;  2Y5B B;  4HJK A;  2KDI A;  1OQY A;  4A20 A;  5C23 A;  2GOW A;  1UGM A;  2K25 A;  3PLU A;  3RUL A;  3Q3J A;  4F7Z A;  1WY8 A;  3UQB A;  2AYO B;  1R4N I;  2ZCC A;  1U4A A;  2BKF A;  1WMH B;  2Z0D B;  2G3Q B;  3SDL C;  1WIA A;  3APD A;  2LVO A;  3PGE A;  3NY5 A;  4M0W B;  2FCS A;  3H1U A;  3NZS A;  4DWF A;  2XK5 A;  3A1Q A;  2MBQ A;  4LDT B;  2MBH A;  3JYU A;  3VUY A;  1WR1 A;  4ANU A;  2WX0 A;  3ZRC A;  1JRU A;  5CHF A;  2IO2 B;  4M8N A;  3T9L A;  1P0R A;  2AWT A;  3A4S C;  2LJ5 A;  2L76 A;  2NBU A;  1V86 A;  1WGH A;  4HCP B;  4DHJ B;  5J18 A;  4HDQ A;  3H6N A;  3APF A;  3QC8 B;  1PQS A;  3MJW A;  3TIX A;  2KXJ A;  3BY4 B;  3U8Z A;  3A9J A;  3A4R A;  5E6P A;  3VAW A;  2J0J A;  2WDT B;  1Q1O A;  3VFK A;  3VTW A;  2KD0 A;  1EF1 A;  2JY6 A;  2MP2 A;  1GG3 A;  1SE9 A;  3EFU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...