2LI5A

Nmr structure of atg8-atg7c30 complex
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
117
structure length
117
Chain Sequence
HMKSTFKSEYPFEKRKAESERIADRFPNRIPVICEKAEKSDIPEIDKRKYLVPADLTVGQFVYVIRKRIMLPPEKAIFIFVNDTLPPTAALMSAIYQEHKDKDGFLYVTYSGENTFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of Atg8 activation by a homodimeric E1, Atg7.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
molecule keywords Autophagy-related protein 8
total genus 15
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2011-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02991 Atg8 Autophagy protein Atg8 ubiquitin like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2li5A00
5DPSA 1WR6E 3ZTCA 4ICUA 1C3TA 3ZW3A 2XK5B 1D3ZA 4MH0E 4FADA 3BINA 2N9EB 2AWTA 1ISNA 1WMHB 4MDKE 3ZNID 4HVBA 2HD5B 2PE9A 1UD7A 1EUVB 4K7WA 3A4SC 2MP2B 2KHWB 2KTRB 3APCA 1LFDA 3H7SA 1WFYA 2N1VA 1F9JA 1L7YA 2KJRA 2KTFA 2LASA 3RUIB 3N30A 3VUWA 2R2OA 3MTNB 5L95C 1Z2MA 2YVCA 1GNUA 4BKSD 4IUMB 5LXHA 3NOBA 2LXCA 2BYFA 2BYEA 3ECIA 3OAWA 2J7QB 1YD8U 4F7ZA 2ZNVC 1S3SG 2LRWA 3GZNI 2N9XA 4N9F4 3SD5A 1WZ0A 1M94A 2CS4A 4BBNC 2KMCA 2G4DB 1UZXB 2L05A 5CTRC 4DBGA 1UELA 2KFJA 4MGYE 2J0JA 4FULA 3W1SC 4DXAB 2GOWA 1X1MA 3W1YA 5CHVC 5JZEB 2BKRB 2JXXA 1E8YA 2JUOA 1KLVA 4AWJA 3UIPB 3PS6A 4DDGD 3LJ3A 4HK2A 2BGFA 4RM8A 4FHKA 1KOTA 2JPHA 1WJNA 4NQLB 4FA6A 4HCPB 1R4NI 3UIOB 1YJ1A 3R7QA 2OOBB 2LRUA 2AL6A 2KNBA 1U4AA 1WJ6A 3PGEA 2L7RA 2RSUA 3ZIMA 4URKA 3K9PB 3ZDMC 1UBIA 1H8CA 4HJKA 2G4SA 1WE7A 3QX1A 1WF9A 2XBBC 4M8MA 1G6JA 1UBQA 3RZFA 2MBEA 2JVCA 3CF6E 2A5UA 3IHPC 4G11A 2KANA 2M4NA 2M0XA 3ZTDA 3N32A 3QWZB 2Z59B 2KDIA 1P3QU 2XEWA 4BKSA 2OJRA 1Q5WB 1WGYA 2PJHA 3M63B 2CHZA 3QQ8B 1GC6A 2KX0A 3KYDD 2O6VA 3AULA 2C60A 3PTFC 4AOFA 2DYMA 3NY5A 2JWZA 1S1QB 4A3OA 5AEKB 2PE6B 1LM8B 4JLCA 3UQBA 3QHTA 4NJ7A 2KLGA 1RFAA 3O65B 5D2MB 4K1RB 3PRMB 2FUHB 1TGZB 2M17A 4KZ0A 2JZZA 2B3AA 5G2NA 2KDBA 4KDLB 2ASQA 3QCAA 2UYZB 4BOZB 3PREA 1OEYJ 4DHJD 3MJWA 1KJTA 4DDID 3A33B 3KUDB 2K6DB 4IW0A 3CSFA 3H7PA 5KHOA 1AARA 2KJHB 2L76A 1WR1A 2WDTB 5J17A 2LVQA 3R66C 5C1ZA 4WWPA 3APFA 3L13A 2BYVE 2LUEA 1WGDA 2WYQA 4ANXA 2LD9A 4NAWB 1FXTB 4MJSA 4PYUA 5TR5A 2K25A 4A3PA 2MCNB 2YLMA 4B95A 3EC8A 4GDKA 1VD2A 2DAJA 2MQJA 4HWIB 1I35A 1YIWA 3DVGX 1WH3A 4HDOA 2HE7A 2KFKB 4GMVA 1YX6B 5BO4B 3PVLA 4NNJB 1WYWB 3KVFB 3KUCB 4W9GA 2I1JA 3U8ZA 5JHBA 2GBRA 2ZNVB 1WGGA 3B1LX 3R7RA 1E7VA 1RRBA 2LWPA 4GIVA 1WMHA 4CHKA 5E6NA 3NS8A 2FNJB 2C7MB 3T9LA 2KZRA 3VH3B 3HM6X 3QA8A 2PPHA 3TL5A 5GMVA 2RR9A 4EUTA 4KSLC 2JRIB 3QJZA 1LQBA 4E71A 2MW5A 3KW5B 3RYTA 2RPQA 4GDLB 2IO3B 3PRZA 4JIOU 1WX7A 2JRHA 4ICVA 4KV2A 3ZNHB 1QZEA 3PLVA 4IC7B 3DQVA 4DHZE 4MJSB 1SIFA 4B9KA 2K6QA 2NPTB 2LGDA 4NAWA 4I6NB 2NR2A 1WGRA 3ONSA 3RD2A 3SHQA 4E3CA 4HCNB 4OVVA 4TKNA 2KWUB 4WQOB 3VTUA 2KC2A 4GDLA 3UINB 5FR6A 2IO2B 4CYEA 1JRUA 5DPTA 1V5TA 3A9KA 3WALA 2DAFA 3TMPB 4ASWC 1WX8A 1IPGA 3AXCA 4WJNA 3SU8X 2K39A 5AZFA 3JSVA 1E7UA 5CHFA 5D7GA 5KHQA 1IYFA 3VUYA 1TBEA 2WX1A 3L17A 4HPLB 2L8JA 5D94A 3Q3JA 2FIFA 2DYBA 4I6LB 2EMSA 4XZ4A 4AUQC 1C1YB 2KDFB 1P0RA 3DVGY 2W9NA 3UGBB 1GC7A 1EF1A 1BT0A 2O6VB 3SDLC 2Z0EB 4EKUA 2K8HA 4AP4C 2DZJA 3W1SA 4TUUA 3QAQA 2V1YA 3HK0A 4GOCA 4NY0A 4W9CA 2M8SA 2KVRA 3VQIA 4BKGA 1SGHA 4OVUA 3VUXA 4FJZA 2LXAA 2KTRA 2M1MA 4W9IA 2N1WA 2N9PC 2IYDB 3L16A 2IZVB 2NBWB 3VTVA 3PHWB 2LGYA 1ZW7A 2ZEQA 4EOYA 2Z0DB 2KQSA 1P98A 2V3SA 4MGIE 2MA9B 5LLIA 1XQQA 3WAMA 1RLFA 3X0WA 4BKTA 1J0GA 3D32A 4MM3A 1IP9A 2J0MA 3A9KB 3V6CB 2FCSA 5IA7A 5D6JB 4AJWA 2FAZA 3TCAA 3DPDA 4J6IA 3T8MA 2GMIC 3NZUA 3LDZE 4EZKA 3K9OB 1I42A 2C9WB 4GDKB 2KWVB 3L54A 1E8WA 2CR5A 1WI0A 3WANA 4FBJB 1WIAA 2KXJA 1GG3A 1V49A 2KWCA 2Y5BB 1L2NA 3EECA 3VFKA 3MHSD 4XC2A 3EHVA 3H7PB 3L0WB 2MRPA 3VH4B 4GN1A 2L0TA 2N7EA 2ZJDA 3V61A 1K8RB 1V2YA 2L3ZA 3JSVB 3U30A 1P9DU 2ZZPB 2PEAA 3NZSA 4GB9A 4DHZB 4WJQA 3V62A 4DWFA 2KD0A 2MBHA 2L00B 4NQKE 2CHXA 2FCMA 1OQYA 1Z5SB 2L0FA 4TV3A 3A9JA 4FLHA 1YX5B 1CMXB 1WX9A 2KC1A 2NBUA 3DBSA 4PYZA 1MG8A 2G3QB 4ZYNA 3V6EB 1WXMA 2J0KA 4ZRIA 4ZDVA 3PV1A 2O2VA 3QIJA 4II2B 5AZHA 3HM3A 5JHAA 3B08A 2O6VD 2NPTA 3ZUNA 2FCNA 4HDQA 4LDTB 1UGMA 4MGKE 1OGWA 1PQSA 3KYCD 3H6NA 2ZVNA 3X23A 2A4ZA 2V4LA 1NDDA 3GOEA 1VCBA 3Q3FA 4ZRKA 2MWSB 4W9HA 3PT2B 3IVFA 4WJOA 3VTWA 1V5OA 3H9DA 2BKFA 3PHXB 3ZNGC 4IM3A 1H4RA 2KX3A 2JT4B 3EFUA 4EZJA 4G3XB 2RGFA 2KQ7A 1EF5A 5JH5C 2KK8A 4E74A 4EZLA 3ZDTA 1UH6A 5J2RA 2MBBB 3WAPA 1OEYA 2KKCA 3M62B 3OLMD 4LJOB 1WM2A 3U7DA 4II3B 1Q0WB 3TBLD 1WGHA 1WZ3A 5IAAC 3NHEB 3DBRI 4WWNA 3PLUA 5AZGA 5EDSA 4GU2A 3VAWA 2CU1A 4B6WA 4FJYA 4IWOA 4FHJA 3AU5A 2NS5A 3PPAA 2EKEC 1V9JA 2BWES 5DPRA 3WAOA 3A9JB 3V60A 3QK0A 4FN2A 3C0RB 2HJ8A 4MSMB 4IWQA 2MP2A 1WJ4A 2JY6A 1EO6A 2BF8B 1WXSA 3PRPB 4I6PA 3DBLI 4M8NA 3ZKJC 5DPWA 1Y8RC 2IO0B 2K8BA 3A1QA 4W9JA 2GBMA 2K8CA 3ZRFA 4TQ1A 2N4FA 2D11A 2QHOA 3OJ4B 2GBKA 1E5WA 1J19A 3DOWA 4BVUC 2MSED 3A4RA 2DZIA 5G55A 1NBFC 4LCDE 1A5RA 2WX0A 1XT9B 4LJPB 1GJZA 3JYUA 4XX5A 3ENEA 1SE9A 2JZ3B 2MBQA 3TIXA 4IG7B 1V80A 2LGXA 3DVNU 5C23A 3R3MA 2AYOB 3WA0A 3AI5A 3DDCB 5E6PA 2DZMA 3P2BA 4K7SA 2WWZA 2KMAA 4GSWA 3CMMB 2R2QA 4IM0A 2BWFA 2O2VB 2C5LC 3HHMA 2EMTA 2N7DA 4PS3A 5L83A 1TTNA 1R4MI 4KIKA 4A20A 2FIDA 4IWPA 4F1SA 4MEMA 4PS7A 4KZCA 4JQWC 4EEWA 1E8XA 3H1UA 4DHJB 2KDEB 2KOXA 1J8CA 4MGZE 3ZNZB 4FJVB 2HTHA 3RT3B 4G0NB 3DBHI 3ALBA 1TZ1A 5J18A 2LVPA 3ZRCA 3B0AA 2VRRB 3RULA 2KLCA 3ML9A 2GBJA 3UF8A 5CX3A 2LI5A 4NPNA 2NVUI 2KJ6A 2K1FA 2MBOA 3HIZA 4YL8A 5HKHA 4JGHB 2D3GA 1T0YA 3KH0A 3BY4B 3UQAA 2ZPNA 4G50A 4ZRJA 3I3TB 2ZCBA 1WE6A 2ZPYA 1P1AA 2LVOA 4CO7A 2DX5B 4ANUA 4W9KA 3CSTA 3KUZA 4M0WB 4AJYB 3ZO5B 4KDIC 1WXAA 3DVNV 3L08A 2REXA 4WWOA 1WJUA 2C7HA 3M95A 1KM7A 1E8ZA 3L10B 2AEHA 3APDA 2NBVB 1WRDB 2BPSA 1YQBA 2IO1B 2ZCCA 1Q1OA 5DCNA 2ZVOA 1V86A 2XK5A 1ZKHA 4KIKB 3OJ3A 1GUAB 2FCQA 4KVGB 1LXDA 3AU4A 2LZ6A 4RM9A 4X57B 3VXWA 1WXVA 3IG3A 4GGQA 4PS8A 3S2AA 2D07B 2UWQA 1RAXA 3RCZA 4W9FA 4K7UA 2DYOA 4LDTD 2JF5A 1HE8A 2C7NB 1OTRB 2D10A 4ANVA 2IY0B 2I1KA 3IFWB 2G45B 3QC8B 1WM3A 5CHWA 1XD3B 2MLBA 4RMAA 4HXDA 3JVZX 3QARA 4P7IA 3PZDA 2AL3A 4MSQB 3A1QB 2CKHB 4K81A 3N3KB 3VVWB 4KSKC 3WIMA 4MELA 2KO3A 2LJ5A 2D2QA 3ML8A 4WAAA 4W9LA 3M3JA 4ANWA 1NI2A 2DHZA 2KFKA 2NCNA 3VHTC 3PSEB 4BFRA 3ZLZA 3DCGA 5E6OA 4DK5A 1V6EA 2IBIB 2MX2A 4TQ0A 4BOSC 1WY8A 3ZVVA 4JL9A 3IBEA 2KN5A 4W9DA 4NJ6A 2DENB 3TJPA 3VDZA 4GXBA 4IM2A 1ZGUB 4F8CB 5LXIB 3JW0X 4W9EA 4HLEA 4WJPA 2CHWA 1V81A 1E90A 4BBNF 2RD0A 2DZKA 4HPMB 4EFOA 3RZWC 2IY1B 2GBNA
chains in the Genus database with same CATH superfamily
5DPSA 4L1BA 4GLSC 1XF5L 2XK5B 4ZHOA 1PGXA 2K22A 4A90A 1UF0A 2PE9A 2BB5A 2KHWB 2KTRB 3H7SA 3Q8BA 1ZDXA 5L95C 3N30A 2R2OA 1K52A 3MTNB 4C00A 3DBRB 4IUMB 1N5XA 2GI9A 4JWUC 1YJIA 2BYFA 3OAWA 3MC0B 2J7QB 4F7ZA 2E3TA 4EE2A 1V1OA 1QQRA 4MGYE 4FULA 4DXAB 3N1ZC 1X1MA 4DXGA 1KLVA 3MHZA 4R3DA 1KOTA 1R4NI 1YNTE 2QDFA 4M01A 3AE7B 4TMAB 4LNIA 1BXTA 4C7YA 1WJ6A 2L7RA 3ZDMC 1H8CA 4HJKA 1WE7A 1T0SC 5TSSA 3RZFA 3IHPC 4G11A 2OHFA 2WXFA 1FXAA 2KDIA 2KYWA 3M63B 2JSVX 3QQ8B 2KX0A 3NY5A 2JWZA 2PE6B 2SEBD 1C79A 4XDDA 3UQBA 1MJDA 2JZZA 2B3AA 3E56A 2Z8LA 2W3RA 1NI3A 1RYJA 2KT7A 3PREA 1OEYJ 4DHJD 1MHXA 2KVZA 4D2KA 1WR1A 2LVQA 5C1ZA 4WWPA 4RNAA 2ACZB 4ANXA 2WHIA 5AUIA 4NAWB 3AEFB 5TR5A 1UNSA 4GDKA 2WXQA 2PIAA 2FUG1 1XCQL 1KLGD 2AQ2B 1WH3A 3PVLA 2QCZA 3KVFB 3KUCB 2I1JA 1HTQA 2C7MB 1QOAA 3AE4B 2KZRA 3VH3B 3BIID 3RNGC 4KSLC 1SE4A 2DNFA 1IBXA 4GDLB 1WX7A 1QZEA 4IC7B 2Y3AA 1UWMA 4MJSB 1VDVA 2LGDA 1WGRA 3SHQA 4E3CA 4OVVA 4TKNA 4LLGM 1SB3C 3DHGC 1XLNA 2IO2B 3FAHA 1DYQA 3SU8X 5AZFA 2R61A 4HPLB 2L8JA 4HPPA 2FIFA 2DYBA 1HQRD 4JE3B 4XZ4A 4OZAA 4AUQC 1C1YB 1DOIA 1P0RA 3DVGY 2W9NA 3RPFC 1GC7A 1BT0A 2O6VB 4EKUA 2D3CA 3QAQA 4GOCA 3NUHB 4OVUA 3VUXA 2M1MA 1C4AA 3VTVA 1LGRA 1J7BA 2L52A 2MA9B 1CJEA 1Q10A 1F52A 2NTSA 3D32A 3R8BA 2J0MA 2FCSA 5IA7A 3TCAA 2YEPF 2GMIC 4P1BC 1FD6A 3K9OB 1I42A 2B76B 1E8WA 2GRIA 1WI0A 3WANA 5MPOA 1GG3A 1V49A 1L2NA 4GN1A 2N7EA 1QF6A 3V61A 1K8RB 1V2YA 4DHZB 4WJQA 2MBHA 4NQKE 1KRHA 2CHXA 1OQYA 2Y5CA 2W55A 4K3CA 1XO3A 3ZXRA 1YN4A 4ZYNA 3BWUD 3V6EB 1MFWA 1FFVA 5EE0A 4MH8A 4YWGG 1EWYC 2NPTA 4US8A 2ON8A 3H6NA 2ZVNA 1FXIA 1KH0A 1VCBA 3Q3FA 4W9HA 1JALA 3ZNGC 1V5OA 3PHXB 2BKFA 4XWTA 2KX3A 1MHHE 1OEYA 3OLMD 1WM2A 3DWGC 2Y5PA 4Q2JA 1WZ3A 3NHEB 3DBRI 1AWDA 4B6WA 1K53A 3QK0A 4JPSA 2MP2A 3FC4A 5DPWA 1UGJA 2K8BA 1WRIA 3AMZA 2QHOA 2JXTA 2GBKA 3RNCC 2DZIA 2WX0A 3N9YC 4LJPB 4XX5A 1SE9A 2JZ3B 3TIXA 1V80A 2D3BA 2V4IB 3WA0A 3AI5A 3DDCB 4K7SA 2KMAA 4IM0A 1PDXA 2EMTA 4KIKA 4A20A 5JXVA 1HZ5A 1T5XD 3DHIC 5EE9A 4IWPA 4PS7A 1QILA 4KZCA 3LB8C 2M19A 3RNAC 4MGZE 1JWBD 2WDQB 3RNBC 1GB1A 2HTHA 1TZ1A 4S0RA 5J18A 2LVPA 1GOZA 2NTTA 2VRRB 4OZBA 4NPNA 3HIZA 2MBOA 5HKHA 1T0YA 3KH0A 4YTMB 4ZRJA 4O1NA 4ANUA 2KDMA 4P1CC 2WU2B 2LGSA 3GE8C 3B9JA 3DVNV 1XLPA 3M95A 1NEKB 1WRDB 1YQBA 1YMHE 2XK5A 2L1AA 1GUAB 2V3PA 3Q8EA 1XLOA 3AV8A 1KTKA 3S2AA 2UWQA 4LDTD 4ANVA 3W5VB 3NVYA 3GE3C 1N61A 4MSQB 2VH2A 3AE1B 4KSKC 3I5JC 4MELA 3FKYA 2D2QA 4USAA 4WAAA 4W9LA 3DCGA 1UUPA 1V6EA 2IBIB 4XWWA 2KACA 2RPVA 4NJ6A 3VDZA 5LXIB 1ZGUB 4IOIE 2IGDA 1I4HA 1B9RA 3RZWC 2IY1B 1IPGA 2GBNA 3DBHB 3ZXVA 2IGHA 1D3ZA 3BINA 1L6UA 2AWTA 1ISNA 1P7FA 4K7WA 3A4SC 1L7YA 2LASA 3VUWA 4BKSD 5LXHA 2K0PA 4KKIA 2W3SA 2BYEA 3DWMA 1YD8U 1S3SG 2N9XA 3Q69A 4ZYSA 1WZ0A 2CS4A 3SEBA 3MJ5A 1UZXB 2L05A 3P4RB 3B2GA 1UELA 2KFJA 4IKGA 1ROEA 4M0WA 5JZEB 4DDGD 2I2YA 4HK2A 2BGFA 2L32A 4FHKA 4RM8A 1WJNA 4FA6A 1T6BX 1YJ1A 2AL6A 1U4AA 3AE6B 2INDC 3ZIMA 1UBIA 2G4SA 1WF9A 2K9XA 1UBQA 1F1HA 2JVCA 3CF6E 1L0VB 2XEWA 4BKSA 3SFDB 2PJHA 1GC6A 3ZJVA 1WXQA 2DYMA 4A3OA 1FM0D 1FIQA 2KLGA 2KN4A 1RFAA 3ZYYX 3N1XC 3VR9B 2FUHB 2M17A 5G2NA 2KDBA 3V05A 1JWAD 2ZW0A 2BS4B 3MJWA 1KJTA 4DDID 3A33B 1K51A 2KJHB 2WDTB 2XNAC 2PVGC 3L13A 2BYVE 1C77A 4DXFA 2Q5WD 4MJSA 2K25A 4B0MA 3AEEB 1KF6B 1VD2A 1L0XB 1C9FA 1AW7A 1CQVA 2W54A 5JHBA 2ZNVB 3R7RA 1AYFA 4GIVA 1WMHA 1D5ZC 4CHKA 5E6NA 3NS8A 3RN9C 2IGGA 3T9LA 1HA5A 3HM6X 3QA8A 2PPHA 5GMVA 3T3NA 4YT0B 3QJZA 2MW5A 3KW5B 3RYTA 3EFCA 4S17A 1R4NB 4JIOU 2JRHA 4KV2A 3ZNHB 3AEDB 4DHZE 3Q3NC 1SIFA 4B9KA 4AS1A 2K6QA 1FEHA 2MHJA 4RGOS 3UINB 1MI0A 1T3QA 3TMPB 4ASWC 1WX8A 4WJNA 3JSVA 5KHQA 3FILB 1FCCC 3ZJUA 1TBEA 3L17A 4LNFA 3Q3JA 2LGIA 4I6LB 2EMSA 3VR8B 4PK1A 2KDFB 3SR6A 2K8HA 2DZJA 2V1YA 3HK0A 2KVRA 1OFFA 1SGHA 2N9PC 3L16A 4WURA 2NBWB 3MFGA 5D3DA 2WGSA 3IT4B 2KQSA 1P98A 2V3SA 1I4GA 1NENB 4A8XC 3WAMA 1RLFA 3DBLB 4XGAB 4MM3A 1IP9A 3A9KB 3Q14C 4BAXA 1TKYA 2MH7A 2FAZA 3DPDA 4J6IA 3RNFC 1VR9A 3LDZE 2C9WB 4GDKB 4RH6A 3L54A 2NMQA 1SEBD 4JX1C 1YJJA 4FBJB 1RFKA 5HFYA 1CK1A 4RF0A 2Y5BB 2LJIA 3MHSD 3EHVA 5C2TB 1ESFA 2QILA 1B1ZA 5AUKA 3JSVB 3U30A 3NZSA 4GB9A 4A55A 3WCQA 1V1PB 2BQQA 3V62A 4DWFA 1NYRA 2FE8A 1MPEA 2LMCA 4TV3A 3A9JA 2INPE 1WX9A 4PYZA 1MG8A 4MT5A 3QIJA 4HROA 3HM3A 5JHAA 2O6VD 4AQ7A 1OGWA 4P16A 3URYA 4HRSA 1NDDA 1FCLA 2AX5A 1IUEA 1JWSD 4ZRKA 2MWSB 3PT2B 3W2DA 2JT4B 2JU6X 3EFUA 2OJWA 2RGFA 1FMAD 1EF5A 2KQ7A 4RGNA 4EZLA 3ZDTA 4H2AA 3P4SB 4LJOB 4II3B 5LNK1 5IAAC 4M02A 3PLUA 4WWNA 2V3NA 5EDSA 4GU2A 1Y56A 4FJYA 4IWOA 1I7HA 4FHJA 3AU5A 2NS5A 4OHJA 2QJLA 2EKEC 4FN2A 1SBBB 1WJ4A 2MJ3A 2JY6A 1EO6A 2BF8B 3PRPB 3ZKJC 2J42A 1C4CA 1E7PB 3A1QA 1VLBA 2GBMA 1ET6A 1GPXA 2BVCA 2J4XA 3ABVB 2SAKA 1WGKA 2D11A 2RDHA 1RWSA 2WDRB 2MSED 5G55A 1A5RA 1GJZA 3JYUA 4IG7B 2LGXA 2V0GA 3DVNU 2AYOB 5E6PA 2DZMA 4ZHPA 1MG4A 4PS3A 1R4MI 1ZPSA 3U4EG 4DHJB 1L6VA 4G0NB 3VRAB 2W82A 2WLBA 2J52A 3B0AA 3RULA 2KLCA 5CX3A 1F2RC 2D3GA 5HI1A 1L4ZB 4G50A 1PGBA 5G5GA 3I3TB 2ZCBA 1P1AA 1CZPA 1SJED 3NVWA 4W9KA 4B0EA 1TY2A 1WXAA 3L08A 4OW0A 4WWOA 1WJUA 2C7HA 1KM7A 1QOGA 1V86A 5GXGB 2WXPA 4KIKB 1T0RC 1ZP0B 2HDEA 3AU4A 3GZNB 1HXYD 3BVMA 3IG3A 1JW9D 2RDBC 1KLUD 1QT9A 2DYOA 1HE8A 2C7NB 4NJCA 2IY0B 3IFWB 2WXKA 3NG0A 5CHWA 4HKZE 5T8IA 2MLBA 4RMAA 4HXDA 3BK1A 5IKCM 4P7IA 3A1QB 2CKHB 4K81A 2KAJA 3VVWB 2BYTA 2LJ5A 5IP4D 1ENFA 2WQYB 4KKJA 4ANWA 1NI2A 2DHZA 2KFKA 2NCNA 3PSEB 4BFRA 3ZLZA 2LHDA 2X38A 4BOSC 5C3JB 3GS2A 3MC9A 1JMLA 1TKEA 2WXLA 3KWLA 4W9EA 4RCOA 4WJPA 1V81A 2YEPB 2MEKA 2LHEA 1WR6E 3ZTCA 4ICUA 3ZW3A 4MH0E 2N9EB 1TT5B 3RMKC 4MDKE 3ZNID 1TS3A 4HVBA 1ZDVA 4ACFA 4LNKA 1EUVB 3BVZA 1WFYA 1F9JA 2KJRA 5IOIA 3RUIB 1Z2MA 2YVCA 1GNUA 3NS1A 4QAYA 2HJ1A 1GAQB 1ZE3D 3KQ4A 2DBYA 3NOBA 3ECIA 3P1MA 3AECB 1ZXIA 3SD5A 3P63A 3C8YA 3Q8AA 2PKOA 3BYYB 4BBNC 4C4VA 3E9SA 2J0JA 1GB4A 5CHVC 2BKRB 2JXXA 1WWTA 1STEA 3UIPB 5G5HA 3NZ3A 4NQLB 2OOBB 2LRUA 4A9AA 3B2FA 3L4PA 3Q2AC 3PGEA 2IDYA 2D3AA 3K9PB 3H8HA 1SE2A 4PT5A 2INCC 3AEGB 3QX1A 4LNOA 2XBBC 3AE8B 3PZ8A 1G6JA 2N9KA 2WNMA 3CIRB 2KANA 2M4NA 2M0XA 3ZTDA 4YTNB 1EWCA 1SSNA 2JYTA 2OJRA 1Q5WB 2WP9B 3I63C 1WGYA 2AQ3B 2O6VA 3AULA 4YTPB 3ZGZA 3PTFC 3Q3OC 4AOFA 3TUOA 1S1QB 3Q8CA 2EELA 1OQRA 5D2MB 4K1RB 3PRMB 3U52E 4K3BA 2KMMA 2WXGA 4KZ0A 2WXOA 4KDLB 5H8YE 3I57A 2K6DB 4IW0A 3CSFA 5KHOA 1N62A 2L76A 3R66C 3APFA 1WGDA 2LD9A 1TS2A 4A3PA 2MCNB 2YLMA 1RM6C 2DAJA 2MQJA 4HWIB 4YXDB 4HDOA 2WS3B 1I4XA 5BO4B 2JX5A 1WYWB 4W9GA 2GBRA 1WGGA 1E7VA 2LWPA 5FKAC 2RR9A 4EUTA 2X8XX 3AH7A 4E71A 1HZ6A 1ZOYB 2KQ4X 4N58A 4ICVA 2FBWB 1NVID 1YQ4B 2WXRA 2L83A 5EE1A 5EE3A 2NPTB 4REZA 1R4MB 3R2TA 4NAWA 4I6NB 2NR2A 3RD2A 2KWUB 2ICIA 3VTUA 4GDLA 5FR6A 4ZRQA 1TIFA 3CWIA 1JRUA 5DPTA 4HKQA 1QKZA 1V5TA 3DHHC 2DAFA 3NJTA 3RFZB 5BMGA 2K39A 1E7UA 3SFEB 1QOBA 3VUYA 4N59A 5D94A 2MJEA 4ARCA 2G1EA 3UGBB 2N7JA 2G9HD 3SDLC 4AP4C 2BTEA 1E6EB 4KGTA 4NZLB 3W1SA 4TUUA 2BBCA 4BKGA 2VH1A 2LXAA 4FJZA 4W9IA 1YN5A 4L23A 3AEBB 3GB1A 2IYDB 2IZVB 3PHWB 2LGYA 3ETRA 1ZW7A 1QLBB 4MGIE 4RGTA 5I4DA 5LLIA 1XQQA 1AN8A 3V6CB 5D6JB 4AJWA 3T8MA 1EU3A 4EZKA 2KWVB 2RDGA 2PMVA 2KXJA 1D6EC 2KWCA 3EECA 3VFKA 3EGRA 3H7PB 5HG2A 3VH4B 3HRDD 1I4RA 2L3ZA 2ZZPB 1E9MA 1FFUA 2L00B 1Z5SB 1FRRA 2INNE 2KC1A 3DBSA 2NBUA 1WXMA 2J0KA 3IT6B 4ZRIA 3PV1A 2O2VA 4II2B 3B08A 1N63A 2FCNA 4HDQA 4LDTB 1UGMA 4MGKE 3KYCD 2V4LA 2JYEA 2K5PA 4A6QA 1N6ZA 3J9CA 5BMHA 4WJOA 2QC8A 1IBXB 3AM9A 4IM3A 1H4RA 4EZJA 4G3XB 2KK8A 4E74A 1UH6A 3M62B 2KKCA 4YSXB 1SXTA 3IXSA 1Q0WB 3TBLD 4HEA1 1L4DB 5AZGA 1R7SA 2CU1A 1BUIC 4WWMA 1E0ZA 5DPRA 4XE0A 3W5UB 3C0RB 1C4PA 4MSMB 1ZXHA 4IWQA 1TS4A 1WXSA 2JWUA 3AE9B 3DBLI 4M8NA 2K8CA 4TQ1A 2N4FA 1L5PA 3OJ4B 3DOWA 3U7ZA 3A4RA 1E10A 1NBFC 4LCDE 1F77A 2VZKD 5JH5C 3R3MA 3Q8FA 3P2BA 2WWZA 2TSSA 4RGMA 3EUB2 3R2IA 1OQQA 5L83A 1N5WA 1TTNA 3PZ7A 2FIDA 4WQMA 1E8XA 3H1UA 2KOXA 5BYQA 1J8CA 3ZNZB 1C78A 2XN9C 1MVKA 2GBJA 1FNVA 2KJ6A 2K1FA 2NVUI 4YL8A 1I4QA 1DOXA 1WE6A 3NVZA 2LVOA 4NAMA 4CO7A 3CSTA 2ONQA 4KDIC 3ZO5B 2REXA 1E8ZA 3L10B 2AEHA 2OEDA 2NBVB 2BPSA 4C56C 2IO1B 1Q1OA 4LK0M 4OZCA 2LUMA 5DCNA 1LXDA 1IGCA 4RM9A 4X57B 3VXWA 1WXVA 4GGQA 4W9FA 2JF5A 1NYQA 1OTRB 2D10A 2I1KA 1TYGB 5E6JA 2H88B 3JVZX 3N3KB 2KO3A 1XEEA 3ML8A 4UDUC 3M3JA 3NRZA 2DWQA 5E6OA 2E6XA 3ZVVA 4WIPA 3IBEA 3C19A 3TJPA 4F8CB 4HLEA 1E90A 3IAM1 4BBNF 3FILA 4EFOA 1V8CA 1C3TA 2CU3A 4FADA 1WMHB 1JQ4A 2HD5B 1UD7A 2MP2B 3APCA 1LFDA 3MP9A 2N1VA 2KTFA 2IPKD 1TKGA 1J7CA 3EA6A 4RF1A 2LXCA 2ZNVC 2LRWA 3GZNI 4N9F4 4ARIA 3NVVA 1VZ8A 1M94A 2KMCA 2G4DB 3LXFA 5CTRC 4DBGA 3W1SC 3OWEB 2GOWA 1ZUD2 1EM7A 3W1YA 3V3XA 1KFYB 1E8YA 2JUOA 3N1YC 4AWJA 3PS6A 3LJ3A 2JPHA 3P4PB 4HCPB 3UIOB 3U2SC 1JWUD 3R7QA 2ZW1A 2KNBA 1VZ6A 1M4VA 4J3OD 2RSUA 4URKA 1JCKB 3IAS1 4ZRPA 1UWXA 3ZJTA 4M8MA 1C76A 2WDVB 1FRDA 2MBEA 2A5UA 4HJGE 1PUTA 3N32A 3QWZB 2Z59B 1P3QU 1IGDA 1DOYA 1TS5A 1WSPA 2CHZA 3KYDD 2C60A 1SE3A 5AEKB 1F2RI 1LM8B 4JLCA 3W9CB 3QHTA 4NJ7A 2WXIA 3O65B 5IO9A 3AE5B 5FK9C 1TGZB 2BT6A 3N20C 3GP7A 2ASQA 3QCAA 2UYZB 4BOZB 3TEYA 1JRPA 3KUDB 2N9LA 3H7PA 1JWMD 1AARA 5FR3A 5J17A 4L2YA 2LUEA 2WYQA 3BZDB 4PYUA 1FXTB 1VZ7A 4LTUA 1SIJA 4B95A 3EC8A 4ITKA 1VRAB 1I35A 1YIWA 2CJOA 3DVGX 1YN3A 3KLSX 2HE7A 2KFKB 4GMVA 3UI3A 1YX6B 3ZQ4A 4FXCA 3KWVA 4N6EB 5D3IB 4NNJB 3U8ZA 2H89B 3B1LX 1RRBA 1EU4A 2FNJB 5IN7A 1DGJA 1FPYA 3AN1A 3TL5A 1FNWA 2JRIB 1LQBA 3VRBB 2RPQA 2GB1A 2IO3B 3PRZA 3PLVA 3DQVA 1LO5D 2AQ1B 1HTOA 2WU5B 2GLSA 3ONSA 4HCNB 1XCTL 4WQOB 1SF0A 1JROA 2KC2A 1SJHD 1ACCA 4CYEA 1TZOA 4OVZA 3A9KA 3WALA 1V1PA 2WXMA 3AXCA 3TSSA 5CHFA 5D7GA 1IYFA 2WX1A 2PW9A 1EF1A 3HVDA 3Q3MC 2Z0EB 1YOVB 4W9CA 4NY0A 2M8SA 3BVGA 3VQIA 1PGAA 2KTRA 1N60A 2N1WA 2ZEQA 4EOYA 2Z0DB 3BYTB 2BS3B 2LEKA 3X0WA 4BKTA 1FO4A 1J0GA 1F0ZA 1WYGA 3HVZA 4XYCA 1I4PA 3LYYA 1XXGA 3NZUA 5HHDG 4DQOC 1QOFA 2CR5A 2MJDA 1WIAA 4XDCA 4XC2A 3L0WB 4TSSA 2MRPA 3TEXA 4C7ZA 2L0TA 2ZJDA 3P4QB 2QMTA 1P9DU 2PEAA 1PYWD 1HEZE 2IJ0A 2KD0A 2FCMA 2L0FA 4FLHA 1YX5B 1CMXB 3AEAB 4ZDVA 2G3QB 2BS2B 5AZHA 4YSYB 3ZUNA 3TEZA 3RNEC 4WH4A 2DLBA 1PQSA 1TJEA 2WXHA 3X23A 2A4ZA 4KGRA 3GOEA 1K50A 2M56B 3VTWA 4P6VF 3H9DA 2QSDA 3AE3B 5J2RA 2MBBB 3WAPA 3U7DA 1WGHA 2WXNA 3BK2A 3VAWA 1BMLC 3PPAA 2UU7A 1V9JA 2V9HA 3MC8A 2BWES 5BMIA 4RFBA 3A9JB 4IDIA 3V60A 2PTLA 3WAOA 2QIEB 2HJ8A 1V97A 4I6PA 3Q6BA 2JZPA 1Y8RC 2IO0B 4W9JA 3I9V1 4M00A 2QEJC 3ZRFA 2HTME 4C80A 1E5WA 1J19A 4BVUC 3TEWA 1D5XC 5H92C 1XT9B 3ENEA 2KWDA 2MBQA 5C23A 1P7EA 4GSWA 3CMMB 2R2QA 2K3UA 1VJKA 2BWFA 2O2VB 3PO0A 4ZOHC 2C5LC 3HHMA 2N7DA 4C4VB 4MM3B 2PLPA 1FNUA 1T0QC 4F1SA 4MEMA 2BB6A 4JQWC 4EEWA 1J7AA 2KDEB 2PVOD 3AE2B 3HUIA 4FJVB 3RI7C 3RT3B 3DBHI 3ALBA 1PFDA 4US9A 3ZRCA 5BYRA 3UF8A 3ML9A 2LI5A 3T3OA 4JGHB 3BY4B 4KGSA 3UQAA 2ZPNA 1D4BA 2N0SB 2ZPYA 2J53A 4WAFA 2DX5B 2D5GA 4BZAA 3KUZA 4M0WB 4AJYB 2VZKB 2WXJA 3APDA 2BW2A 2ZCCA 2ZVOA 1ZKHA 4KVGB 3OJ3A 2FCQA 2LZ6A 4MACA 3O13A 1XLQA 4PS8A 2D07B 1RAXA 3RCZA 1TY0A 4K7UA 4CQNA 2CJNA 5BYSA 3QC8B 2G45B 1A70A 1WM3A 2EKIA 1XD3B 3AB5A 3QARA 2JQRB 3PZDA 2AL3A 4YSZB 4KX6B 3WIMA 1YQ3B 3P42A 1ET9A 3VHTC 2I38A 3OG5A 4JWSC 4DK5A 2MX2A 4TQ0A 1WY8A 2RMMA 4JL9A 2KN5A 4LNNA 4W9DA 2DENB 1L0YB 4GXBA 4IM2A 3JW0X 2LFIA 2CHWA 2M0AA 1D5MC 2RD0A 2DZKA 4HPMB 3IVFA
chains in the Genus database with same CATH topology
5DPSA 1WR6E 3ZTCA 4ICUA 1C3TA 3ZW3A 2XK5B 1D3ZA 4MH0E 4FADA 3BINA 2N9EB 2AWTA 1ISNA 1WMHB 4MDKE 3ZNID 4HVBA 2HD5B 2PE9A 1UD7A 1EUVB 4K7WA 3A4SC 2MP2B 2KHWB 2KTRB 3APCA 1LFDA 3H7SA 1WFYA 2N1VA 1F9JA 1L7YA 2KJRA 2KTFA 2LASA 3RUIB 3N30A 3VUWA 2R2OA 3MTNB 5L95C 1Z2MA 2YVCA 1GNUA 4BKSD 4IUMB 5LXHA 3NOBA 2LXCA 2BYFA 2BYEA 3ECIA 3OAWA 2J7QB 1YD8U 4F7ZA 2ZNVC 1S3SG 2LRWA 3GZNI 2N9XA 4N9F4 3SD5A 1WZ0A 1M94A 2CS4A 4BBNC 2KMCA 2G4DB 1UZXB 2L05A 5CTRC 4DBGA 1UELA 2KFJA 4MGYE 2J0JA 4FULA 3W1SC 4DXAB 2GOWA 1X1MA 3W1YA 5CHVC 5JZEB 2BKRB 2JXXA 1E8YA 2JUOA 1KLVA 4AWJA 3UIPB 3PS6A 4DDGD 3LJ3A 4HK2A 2BGFA 4RM8A 4FHKA 1KOTA 2JPHA 1WJNA 4NQLB 4FA6A 4HCPB 1R4NI 3UIOB 1YJ1A 3R7QA 2OOBB 2LRUA 2AL6A 2KNBA 1U4AA 1WJ6A 3PGEA 2L7RA 2RSUA 3ZIMA 4URKA 3K9PB 3ZDMC 1UBIA 1H8CA 4HJKA 2G4SA 1WE7A 3QX1A 1WF9A 2XBBC 4M8MA 1G6JA 1UBQA 3RZFA 2MBEA 2JVCA 3CF6E 2A5UA 3IHPC 4G11A 2KANA 2M4NA 2M0XA 3ZTDA 3N32A 3QWZB 2Z59B 2KDIA 1P3QU 2XEWA 4BKSA 2OJRA 1Q5WB 1WGYA 2PJHA 3M63B 2CHZA 3QQ8B 1GC6A 2KX0A 3KYDD 2O6VA 3AULA 2C60A 3PTFC 4AOFA 2DYMA 3NY5A 2JWZA 1S1QB 4A3OA 5AEKB 2PE6B 1LM8B 4JLCA 3UQBA 3QHTA 4NJ7A 2KLGA 1RFAA 3O65B 5D2MB 4K1RB 3PRMB 2FUHB 1TGZB 2M17A 4KZ0A 2JZZA 2B3AA 5G2NA 2KDBA 4KDLB 2ASQA 3QCAA 2UYZB 4BOZB 3PREA 1OEYJ 4DHJD 3MJWA 1KJTA 4DDID 3A33B 3KUDB 2K6DB 4IW0A 3CSFA 3H7PA 5KHOA 1AARA 2KJHB 2L76A 1WR1A 2WDTB 5J17A 2LVQA 3R66C 5C1ZA 4WWPA 3APFA 3L13A 2BYVE 2LUEA 1WGDA 2WYQA 4ANXA 2LD9A 4NAWB 1FXTB 4MJSA 4PYUA 5TR5A 2K25A 4A3PA 2MCNB 2YLMA 4B95A 3EC8A 4GDKA 1VD2A 2DAJA 2MQJA 4HWIB 1I35A 1YIWA 3DVGX 1WH3A 4HDOA 2HE7A 2KFKB 4GMVA 1YX6B 5BO4B 3PVLA 4NNJB 1WYWB 3KVFB 3KUCB 4W9GA 2I1JA 3U8ZA 5JHBA 2GBRA 2ZNVB 1WGGA 3B1LX 3R7RA 1E7VA 1RRBA 2LWPA 4GIVA 1WMHA 4CHKA 5E6NA 3NS8A 2FNJB 2C7MB 3T9LA 2KZRA 3VH3B 3HM6X 3QA8A 2PPHA 3TL5A 5GMVA 2RR9A 4EUTA 4KSLC 2JRIB 3QJZA 1LQBA 4E71A 2MW5A 3KW5B 3RYTA 2RPQA 4GDLB 2IO3B 3PRZA 4JIOU 1WX7A 2JRHA 4ICVA 4KV2A 3ZNHB 1QZEA 3PLVA 4IC7B 3DQVA 4DHZE 4MJSB 1SIFA 4B9KA 2K6QA 2NPTB 2LGDA 4NAWA 4I6NB 2NR2A 1WGRA 3ONSA 3RD2A 3SHQA 4E3CA 4HCNB 4OVVA 4TKNA 2KWUB 4WQOB 3VTUA 2KC2A 4GDLA 3UINB 5FR6A 2IO2B 4CYEA 1JRUA 5DPTA 1V5TA 3A9KA 3WALA 2DAFA 3TMPB 4ASWC 1WX8A 1IPGA 3AXCA 4WJNA 3SU8X 2K39A 5AZFA 3JSVA 1E7UA 5CHFA 5D7GA 5KHQA 1IYFA 3VUYA 1TBEA 2WX1A 3L17A 4HPLB 2L8JA 5D94A 3Q3JA 2FIFA 2DYBA 4I6LB 2EMSA 4XZ4A 4AUQC 1C1YB 2KDFB 1P0RA 3DVGY 2W9NA 3UGBB 1GC7A 1EF1A 1BT0A 2O6VB 3SDLC 2Z0EB 4EKUA 2K8HA 4AP4C 2DZJA 3W1SA 4TUUA 3QAQA 2V1YA 3HK0A 4GOCA 4NY0A 4W9CA 2M8SA 2KVRA 3VQIA 4BKGA 1SGHA 4OVUA 3VUXA 4FJZA 2LXAA 2KTRA 2M1MA 4W9IA 2N1WA 2N9PC 2IYDB 3L16A 2IZVB 2NBWB 3VTVA 3PHWB 2LGYA 1ZW7A 2ZEQA 4EOYA 2Z0DB 2KQSA 1P98A 2V3SA 4MGIE 2MA9B 5LLIA 1XQQA 3WAMA 1RLFA 3X0WA 4BKTA 1J0GA 3D32A 4MM3A 1IP9A 2J0MA 3A9KB 3V6CB 2FCSA 5IA7A 5D6JB 4AJWA 2FAZA 3TCAA 3DPDA 4J6IA 3T8MA 2GMIC 3NZUA 3LDZE 4EZKA 3K9OB 1I42A 2C9WB 4GDKB 2KWVB 3L54A 1E8WA 2CR5A 1WI0A 3WANA 4FBJB 1WIAA 2KXJA 1GG3A 1V49A 2KWCA 2Y5BB 1L2NA 3EECA 3VFKA 3MHSD 4XC2A 3EHVA 3H7PB 3L0WB 2MRPA 3VH4B 4GN1A 2L0TA 2N7EA 2ZJDA 3V61A 1K8RB 1V2YA 2L3ZA 3JSVB 3U30A 1P9DU 2ZZPB 2PEAA 3NZSA 4GB9A 4DHZB 4WJQA 3V62A 4DWFA 2KD0A 2MBHA 2L00B 4NQKE 2CHXA 2FCMA 1OQYA 1Z5SB 2L0FA 4TV3A 3A9JA 4FLHA 1YX5B 1CMXB 1WX9A 2KC1A 2NBUA 3DBSA 4PYZA 1MG8A 2G3QB 4ZYNA 3V6EB 1WXMA 2J0KA 4ZRIA 4ZDVA 3PV1A 2O2VA 3QIJA 4II2B 5AZHA 3HM3A 5JHAA 3B08A 2O6VD 2NPTA 3ZUNA 2FCNA 4HDQA 4LDTB 1UGMA 4MGKE 1OGWA 1PQSA 3KYCD 3H6NA 2ZVNA 3X23A 2A4ZA 2V4LA 1NDDA 3GOEA 1VCBA 3Q3FA 4ZRKA 2MWSB 4W9HA 3PT2B 3IVFA 4WJOA 3VTWA 1V5OA 3H9DA 2BKFA 3PHXB 3ZNGC 4IM3A 1H4RA 2KX3A 2JT4B 3EFUA 4EZJA 4G3XB 2RGFA 2KQ7A 1EF5A 5JH5C 2KK8A 4E74A 4EZLA 3ZDTA 1UH6A 5J2RA 2MBBB 3WAPA 1OEYA 2KKCA 3M62B 3OLMD 4LJOB 1WM2A 3U7DA 4II3B 1Q0WB 3TBLD 1WGHA 1WZ3A 5IAAC 3NHEB 3DBRI 4WWNA 3PLUA 5AZGA 5EDSA 4GU2A 3VAWA 2CU1A 4B6WA 4FJYA 4IWOA 4FHJA 3AU5A 2NS5A 3PPAA 2EKEC 1V9JA 2BWES 5DPRA 3WAOA 3A9JB 3V60A 3QK0A 4FN2A 3C0RB 2HJ8A 4MSMB 4IWQA 2MP2A 1WJ4A 2JY6A 1EO6A 2BF8B 1WXSA 3PRPB 4I6PA 3DBLI 4M8NA 3ZKJC 5DPWA 1Y8RC 2IO0B 2K8BA 3A1QA 4W9JA 2GBMA 2K8CA 3ZRFA 4TQ1A 2N4FA 2D11A 2QHOA 3OJ4B 2GBKA 1E5WA 1J19A 3DOWA 4BVUC 2MSED 3A4RA 2DZIA 5G55A 1NBFC 4LCDE 1A5RA 2WX0A 1XT9B 4LJPB 1GJZA 3JYUA 4XX5A 3ENEA 1SE9A 2JZ3B 2MBQA 3TIXA 4IG7B 1V80A 2LGXA 3DVNU 5C23A 3R3MA 2AYOB 3WA0A 3AI5A 3DDCB 5E6PA 2DZMA 3P2BA 4K7SA 2WWZA 2KMAA 4GSWA 3CMMB 2R2QA 4IM0A 2BWFA 2O2VB 2C5LC 3HHMA 2EMTA 2N7DA 4PS3A 5L83A 1TTNA 1R4MI 4KIKA 4A20A 2FIDA 4IWPA 4F1SA 4MEMA 4PS7A 4KZCA 4JQWC 4EEWA 1E8XA 3H1UA 4DHJB 2KDEB 2KOXA 1J8CA 4MGZE 3ZNZB 4FJVB 2HTHA 3RT3B 4G0NB 3DBHI 3ALBA 1TZ1A 5J18A 2LVPA 3ZRCA 3B0AA 2VRRB 3RULA 2KLCA 3ML9A 2GBJA 3UF8A 5CX3A 2LI5A 4NPNA 2NVUI 2KJ6A 2K1FA 2MBOA 3HIZA 4YL8A 5HKHA 4JGHB 2D3GA 1T0YA 3KH0A 3BY4B 3UQAA 2ZPNA 4G50A 4ZRJA 3I3TB 2ZCBA 1WE6A 2ZPYA 1P1AA 2LVOA 4CO7A 2DX5B 4ANUA 4W9KA 3CSTA 3KUZA 4M0WB 4AJYB 3ZO5B 4KDIC 1WXAA 3DVNV 3L08A 2REXA 4WWOA 1WJUA 2C7HA 3M95A 1KM7A 1E8ZA 3L10B 2AEHA 3APDA 2NBVB 1WRDB 2BPSA 1YQBA 2IO1B 2ZCCA 1Q1OA 5DCNA 2ZVOA 1V86A 2XK5A 1ZKHA 4KIKB 3OJ3A 1GUAB 2FCQA 4KVGB 1LXDA 3AU4A 2LZ6A 4RM9A 4X57B 3VXWA 1WXVA 3IG3A 4GGQA 4PS8A 3S2AA 2D07B 2UWQA 1RAXA 3RCZA 4W9FA 4K7UA 2DYOA 4LDTD 2JF5A 1HE8A 2C7NB 1OTRB 2D10A 4ANVA 2IY0B 2I1KA 3IFWB 2G45B 3QC8B 1WM3A 5CHWA 1XD3B 2MLBA 4RMAA 4HXDA 3JVZX 3QARA 4P7IA 3PZDA 2AL3A 4MSQB 3A1QB 2CKHB 4K81A 3N3KB 3VVWB 4KSKC 3WIMA 4MELA 2KO3A 2LJ5A 2D2QA 3ML8A 4WAAA 4W9LA 3M3JA 4ANWA 1NI2A 2DHZA 2KFKA 2NCNA 3VHTC 3PSEB 4BFRA 3ZLZA 3DCGA 5E6OA 4DK5A 1V6EA 2IBIB 2MX2A 4TQ0A 4BOSC 1WY8A 3ZVVA 4JL9A 3IBEA 2KN5A 4W9DA 4NJ6A 2DENB 3TJPA 3VDZA 4GXBA 4IM2A 1ZGUB 4F8CB 5LXIB 3JW0X 4W9EA 4HLEA 4WJPA 2CHWA 1V81A 1E90A 4BBNF 2RD0A 2DZKA 4HPMB 4EFOA 3RZWC 2IY1B 2GBNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DPS A;  1WR6 E;  3ZTC A;  4ICU A;  1C3T A;  3ZW3 A;  2XK5 B;  1D3Z A;  4MH0 E;  4FAD A;  3BIN A;  2N9E B;  2AWT A;  1ISN A;  1WMH B;  4MDK E;  3ZNI D;  4HVB A;  2HD5 B;  2PE9 A;  1UD7 A;  1EUV B;  4K7W A;  3A4S C;  2MP2 B;  2KHW B;  2KTR B;  3APC A;  1LFD A;  3H7S A;  1WFY A;  2N1V A;  1F9J A;  1L7Y A;  2KJR A;  2KTF A;  2LAS A;  3RUI B;  3N30 A;  3VUW A;  2R2O A;  3MTN B;  5L95 C;  1Z2M A;  2YVC A;  1GNU A;  4BKS D;  4IUM B;  5LXH A;  3NOB A;  2LXC A;  2BYF A;  2BYE A;  3ECI A;  3OAW A;  2J7Q B;  1YD8 U;  4F7Z A;  2ZNV C;  1S3S G;  2LRW A;  3GZN I;  2N9X A;  4N9F 4;  3SD5 A;  1WZ0 A;  1M94 A;  2CS4 A;  4BBN C;  2KMC A;  2G4D B;  1UZX B;  2L05 A;  5CTR C;  4DBG A;  1UEL A;  2KFJ A;  4MGY E;  2J0J A;  4FUL A;  3W1S C;  4DXA B;  2GOW A;  1X1M A;  3W1Y A;  5CHV C;  5JZE B;  2BKR B;  2JXX A;  1E8Y A;  2JUO A;  1KLV A;  4AWJ A;  3UIP B;  3PS6 A;  4DDG D;  3LJ3 A;  4HK2 A;  2BGF A;  4RM8 A;  4FHK A;  1KOT A;  2JPH A;  1WJN A;  4NQL B;  4FA6 A;  4HCP B;  1R4N I;  3UIO B;  1YJ1 A;  3R7Q A;  2OOB B;  2LRU A;  2AL6 A;  2KNB A;  1U4A A;  1WJ6 A;  3PGE A;  2L7R A;  2RSU A;  3ZIM A;  4URK A;  3K9P B;  3ZDM C;  1UBI A;  1H8C A;  4HJK A;  2G4S A;  1WE7 A;  3QX1 A;  1WF9 A;  2XBB C;  4M8M A;  1G6J A;  1UBQ A;  3RZF A;  2MBE A;  2JVC A;  3CF6 E;  2A5U A;  3IHP C;  4G11 A;  2KAN A;  2M4N A;  2M0X A;  3ZTD A;  3N32 A;  3QWZ B;  2Z59 B;  2KDI A;  1P3Q U;  2XEW A;  4BKS A;  2OJR A;  1Q5W B;  1WGY A;  2PJH A;  3M63 B;  2CHZ A;  3QQ8 B;  1GC6 A;  2KX0 A;  3KYD D;  2O6V A;  3AUL A;  2C60 A;  3PTF C;  4AOF A;  2DYM A;  3NY5 A;  2JWZ A;  1S1Q B;  4A3O A;  5AEK B;  2PE6 B;  1LM8 B;  4JLC A;  3UQB A;  3QHT A;  4NJ7 A;  2KLG A;  1RFA A;  3O65 B;  5D2M B;  4K1R B;  3PRM B;  2FUH B;  1TGZ B;  2M17 A;  4KZ0 A;  2JZZ A;  2B3A A;  5G2N A;  2KDB A;  4KDL B;  2ASQ A;  3QCA A;  2UYZ B;  4BOZ B;  3PRE A;  1OEY J;  4DHJ D;  3MJW A;  1KJT A;  4DDI D;  3A33 B;  3KUD B;  2K6D B;  4IW0 A;  3CSF A;  3H7P A;  5KHO A;  1AAR A;  2KJH B;  2L76 A;  1WR1 A;  2WDT B;  5J17 A;  2LVQ A;  3R66 C;  5C1Z A;  4WWP A;  3APF A;  3L13 A;  2BYV E;  2LUE A;  1WGD A;  2WYQ A;  4ANX A;  2LD9 A;  4NAW B;  1FXT B;  4MJS A;  4PYU A;  5TR5 A;  2K25 A;  4A3P A;  2MCN B;  2YLM A;  4B95 A;  3EC8 A;  4GDK A;  1VD2 A;  2DAJ A;  2MQJ A;  4HWI B;  1I35 A;  1YIW A;  3DVG X;  1WH3 A;  4HDO A;  2HE7 A;  2KFK B;  4GMV A;  1YX6 B;  5BO4 B;  3PVL A;  4NNJ B;  1WYW B;  3KVF B;  3KUC B;  4W9G A;  2I1J A;  3U8Z A;  5JHB A;  2GBR A;  2ZNV B;  1WGG A;  3B1L X;  3R7R A;  1E7V A;  1RRB A;  2LWP A;  4GIV A;  1WMH A;  4CHK A;  5E6N A;  3NS8 A;  2FNJ B;  2C7M B;  3T9L A;  2KZR A;  3VH3 B;  3HM6 X;  3QA8 A;  2PPH A;  3TL5 A;  5GMV A;  2RR9 A;  4EUT A;  4KSL C;  2JRI B;  3QJZ A;  1LQB A;  4E71 A;  2MW5 A;  3KW5 B;  3RYT A;  2RPQ A;  4GDL B;  2IO3 B;  3PRZ A;  4JIO U;  1WX7 A;  2JRH A;  4ICV A;  4KV2 A;  3ZNH B;  1QZE A;  3PLV A;  4IC7 B;  3DQV A;  4DHZ E;  4MJS B;  1SIF A;  4B9K A;  2K6Q A;  2NPT B;  2LGD A;  4NAW A;  4I6N B;  2NR2 A;  1WGR A;  3ONS A;  3RD2 A;  3SHQ A;  4E3C A;  4HCN B;  4OVV A;  4TKN A;  2KWU B;  4WQO B;  3VTU A;  2KC2 A;  4GDL A;  3UIN B;  5FR6 A;  2IO2 B;  4CYE A;  1JRU A;  5DPT A;  1V5T A;  3A9K A;  3WAL A;  2DAF A;  3TMP B;  4ASW C;  1WX8 A;  1IPG A;  3AXC A;  4WJN A;  3SU8 X;  2K39 A;  5AZF A;  3JSV A;  1E7U A;  5CHF A;  5D7G A;  5KHQ A;  1IYF A;  3VUY A;  1TBE A;  2WX1 A;  3L17 A;  4HPL B;  2L8J A;  5D94 A;  3Q3J A;  2FIF A;  2DYB A;  4I6L B;  2EMS A;  4XZ4 A;  4AUQ C;  1C1Y B;  2KDF B;  1P0R A;  3DVG Y;  2W9N A;  3UGB B;  1GC7 A;  1EF1 A;  1BT0 A;  2O6V B;  3SDL C;  2Z0E B;  4EKU A;  2K8H A;  4AP4 C;  2DZJ A;  3W1S A;  4TUU A;  3QAQ A;  2V1Y A;  3HK0 A;  4GOC A;  4NY0 A;  4W9C A;  2M8S A;  2KVR A;  3VQI A;  4BKG A;  1SGH A;  4OVU A;  3VUX A;  4FJZ A;  2LXA A;  2KTR A;  2M1M A;  4W9I A;  2N1W A;  2N9P C;  2IYD B;  3L16 A;  2IZV B;  2NBW B;  3VTV A;  3PHW B;  2LGY A;  1ZW7 A;  2ZEQ A;  4EOY A;  2Z0D B;  2KQS A;  1P98 A;  2V3S A;  4MGI E;  2MA9 B;  5LLI A;  1XQQ A;  3WAM A;  1RLF A;  3X0W A;  4BKT A;  1J0G A;  3D32 A;  4MM3 A;  1IP9 A;  2J0M A;  3A9K B;  3V6C B;  2FCS A;  5IA7 A;  5D6J B;  4AJW A;  2FAZ A;  3TCA A;  3DPD A;  4J6I A;  3T8M A;  2GMI C;  3NZU A;  3LDZ E;  4EZK A;  3K9O B;  1I42 A;  2C9W B;  4GDK B;  2KWV B;  3L54 A;  1E8W A;  2CR5 A;  1WI0 A;  3WAN A;  4FBJ B;  1WIA A;  2KXJ A;  1GG3 A;  1V49 A;  2KWC A;  2Y5B B;  1L2N A;  3EEC A;  3VFK A;  3MHS D;  4XC2 A;  3EHV A;  3H7P B;  3L0W B;  2MRP A;  3VH4 B;  4GN1 A;  2L0T A;  2N7E A;  2ZJD A;  3V61 A;  1K8R B;  1V2Y A;  2L3Z A;  3JSV B;  3U30 A;  1P9D U;  2ZZP B;  2PEA A;  3NZS A;  4GB9 A;  4DHZ B;  4WJQ A;  3V62 A;  4DWF A;  2KD0 A;  2MBH A;  2L00 B;  4NQK E;  2CHX A;  2FCM A;  1OQY A;  1Z5S B;  2L0F A;  4TV3 A;  3A9J A;  4FLH A;  1YX5 B;  1CMX B;  1WX9 A;  2KC1 A;  2NBU A;  3DBS A;  4PYZ A;  1MG8 A;  2G3Q B;  4ZYN A;  3V6E B;  1WXM A;  2J0K A;  4ZRI A;  4ZDV A;  3PV1 A;  2O2V A;  3QIJ A;  4II2 B;  5AZH A;  3HM3 A;  5JHA A;  3B08 A;  2O6V D;  2NPT A;  3ZUN A;  2FCN A;  4HDQ A;  4LDT B;  1UGM A;  4MGK E;  1OGW A;  1PQS A;  3KYC D;  3H6N A;  2ZVN A;  3X23 A;  2A4Z A;  2V4L A;  1NDD A;  3GOE A;  1VCB A;  3Q3F A;  4ZRK A;  2MWS B;  4W9H A;  3PT2 B;  3IVF A;  4WJO A;  3VTW A;  1V5O A;  3H9D A;  2BKF A;  3PHX B;  3ZNG C;  4IM3 A;  1H4R A;  2KX3 A;  2JT4 B;  3EFU A;  4EZJ A;  4G3X B;  2RGF A;  2KQ7 A;  1EF5 A;  5JH5 C;  2KK8 A;  4E74 A;  4EZL A;  3ZDT A;  1UH6 A;  5J2R A;  2MBB B;  3WAP A;  1OEY A;  2KKC A;  3M62 B;  3OLM D;  4LJO B;  1WM2 A;  3U7D A;  4II3 B;  1Q0W B;  3TBL D;  1WGH A;  1WZ3 A;  5IAA C;  3NHE B;  3DBR I;  4WWN A;  3PLU A;  5AZG A;  5EDS A;  4GU2 A;  3VAW A;  2CU1 A;  4B6W A;  4FJY A;  4IWO A;  4FHJ A;  3AU5 A;  2NS5 A;  3PPA A;  2EKE C;  1V9J A;  2BWE S;  5DPR A;  3WAO A;  3A9J B;  3V60 A;  3QK0 A;  4FN2 A;  3C0R B;  2HJ8 A;  4MSM B;  4IWQ A;  2MP2 A;  1WJ4 A;  2JY6 A;  1EO6 A;  2BF8 B;  1WXS A;  3PRP B;  4I6P A;  3DBL I;  4M8N A;  3ZKJ C;  5DPW A;  1Y8R C;  2IO0 B;  2K8B A;  3A1Q A;  4W9J A;  2GBM A;  2K8C A;  3ZRF A;  4TQ1 A;  2N4F A;  2D11 A;  2QHO A;  3OJ4 B;  2GBK A;  1E5W A;  1J19 A;  3DOW A;  4BVU C;  2MSE D;  3A4R A;  2DZI A;  5G55 A;  1NBF C;  4LCD E;  1A5R A;  2WX0 A;  1XT9 B;  4LJP B;  1GJZ A;  3JYU A;  4XX5 A;  3ENE A;  1SE9 A;  2JZ3 B;  2MBQ A;  3TIX A;  4IG7 B;  1V80 A;  2LGX A;  3DVN U;  5C23 A;  3R3M A;  2AYO B;  3WA0 A;  3AI5 A;  3DDC B;  5E6P A;  2DZM A;  3P2B A;  4K7S A;  2WWZ A;  2KMA A;  4GSW A;  3CMM B;  2R2Q A;  4IM0 A;  2BWF A;  2O2V B;  2C5L C;  3HHM A;  2EMT A;  2N7D A;  4PS3 A;  5L83 A;  1TTN A;  1R4M I;  4KIK A;  4A20 A;  2FID A;  4IWP A;  4F1S A;  4MEM A;  4PS7 A;  4KZC A;  4JQW C;  4EEW A;  1E8X A;  3H1U A;  4DHJ B;  2KDE B;  2KOX A;  1J8C A;  4MGZ E;  3ZNZ B;  4FJV B;  2HTH A;  3RT3 B;  4G0N B;  3DBH I;  3ALB A;  1TZ1 A;  5J18 A;  2LVP A;  3ZRC A;  3B0A A;  2VRR B;  3RUL A;  2KLC A;  3ML9 A;  2GBJ A;  3UF8 A;  5CX3 A;  2LI5 A;  4NPN A;  2NVU I;  2KJ6 A;  2K1F A;  2MBO A;  3HIZ A;  4YL8 A;  5HKH A;  4JGH B;  2D3G A;  1T0Y A;  3KH0 A;  3BY4 B;  3UQA A;  2ZPN A;  4G50 A;  4ZRJ A;  3I3T B;  2ZCB A;  1WE6 A;  2ZPY A;  1P1A A;  2LVO A;  4CO7 A;  2DX5 B;  4ANU A;  4W9K A;  3CST A;  3KUZ A;  4M0W B;  4AJY B;  3ZO5 B;  4KDI C;  1WXA A;  3DVN V;  3L08 A;  2REX A;  4WWO A;  1WJU A;  2C7H A;  3M95 A;  1KM7 A;  1E8Z A;  3L10 B;  2AEH A;  3APD A;  2NBV B;  1WRD B;  2BPS A;  1YQB A;  2IO1 B;  2ZCC A;  1Q1O A;  5DCN A;  2ZVO A;  1V86 A;  2XK5 A;  1ZKH A;  4KIK B;  3OJ3 A;  1GUA B;  2FCQ A;  4KVG B;  1LXD A;  3AU4 A;  2LZ6 A;  4RM9 A;  4X57 B;  3VXW A;  1WXV A;  3IG3 A;  4GGQ A;  4PS8 A;  3S2A A;  2D07 B;  2UWQ A;  1RAX A;  3RCZ A;  4W9F A;  4K7U A;  2DYO A;  4LDT D;  2JF5 A;  1HE8 A;  2C7N B;  1OTR B;  2D10 A;  4ANV A;  2IY0 B;  2I1K A;  3IFW B;  2G45 B;  3QC8 B;  1WM3 A;  5CHW A;  1XD3 B;  2MLB A;  4RMA A;  4HXD A;  3JVZ X;  3QAR A;  4P7I A;  3PZD A;  2AL3 A;  4MSQ B;  3A1Q B;  2CKH B;  4K81 A;  3N3K B;  3VVW B;  4KSK C;  3WIM A;  4MEL A;  2KO3 A;  2LJ5 A;  2D2Q A;  3ML8 A;  4WAA A;  4W9L A;  3M3J A;  4ANW A;  1NI2 A;  2DHZ A;  2KFK A;  2NCN A;  3VHT C;  3PSE B;  4BFR A;  3ZLZ A;  3DCG A;  5E6O A;  4DK5 A;  1V6E A;  2IBI B;  2MX2 A;  4TQ0 A;  4BOS C;  1WY8 A;  3ZVV A;  4JL9 A;  3IBE A;  2KN5 A;  4W9D A;  4NJ6 A;  2DEN B;  3TJP A;  3VDZ A;  4GXB A;  4IM2 A;  1ZGU B;  4F8C B;  5LXI B;  3JW0 X;  4W9E A;  4HLE A;  4WJP A;  2CHW A;  1V81 A;  1E90 A;  4BBN F;  2RD0 A;  2DZK A;  4HPM B;  4EFO A;  3RZW C;  2IY1 B;  2GBN A; 
#chains in the Genus database with same CATH topology
 5DPS A;  4L1B A;  4GLS C;  1XF5 L;  2XK5 B;  4ZHO A;  1PGX A;  2K22 A;  4A90 A;  1UF0 A;  2PE9 A;  2BB5 A;  2KHW B;  2KTR B;  3H7S A;  3Q8B A;  1ZDX A;  5L95 C;  3N30 A;  2R2O A;  1K52 A;  3MTN B;  4C00 A;  3DBR B;  4IUM B;  1N5X A;  2GI9 A;  4JWU C;  1YJI A;  2BYF A;  3OAW A;  3MC0 B;  2J7Q B;  4F7Z A;  2E3T A;  4EE2 A;  1V1O A;  1QQR A;  4MGY E;  4FUL A;  4DXA B;  3N1Z C;  1X1M A;  4DXG A;  1KLV A;  3MHZ A;  4R3D A;  1KOT A;  1R4N I;  1YNT E;  2QDF A;  4M01 A;  3AE7 B;  4TMA B;  4LNI A;  1BXT A;  4C7Y A;  1WJ6 A;  2L7R A;  3ZDM C;  1H8C A;  4HJK A;  1WE7 A;  1T0S C;  5TSS A;  3RZF A;  3IHP C;  4G11 A;  2OHF A;  2WXF A;  1FXA A;  2KDI A;  2KYW A;  3M63 B;  2JSV X;  3QQ8 B;  2KX0 A;  3NY5 A;  2JWZ A;  2PE6 B;  2SEB D;  1C79 A;  4XDD A;  3UQB A;  1MJD A;  2JZZ A;  2B3A A;  3E56 A;  2Z8L A;  2W3R A;  1NI3 A;  1RYJ A;  2KT7 A;  3PRE A;  1OEY J;  4DHJ D;  1MHX A;  2KVZ A;  4D2K A;  1WR1 A;  2LVQ A;  5C1Z A;  4WWP A;  4RNA A;  2ACZ B;  4ANX A;  2WHI A;  5AUI A;  4NAW B;  3AEF B;  5TR5 A;  1UNS A;  4GDK A;  2WXQ A;  2PIA A;  2FUG 1;  1XCQ L;  1KLG D;  2AQ2 B;  1WH3 A;  3PVL A;  2QCZ A;  3KVF B;  3KUC B;  2I1J A;  1HTQ A;  2C7M B;  1QOA A;  3AE4 B;  2KZR A;  3VH3 B;  3BII D;  3RNG C;  4KSL C;  1SE4 A;  2DNF A;  1IBX A;  4GDL B;  1WX7 A;  1QZE A;  4IC7 B;  2Y3A A;  1UWM A;  4MJS B;  1VDV A;  2LGD A;  1WGR A;  3SHQ A;  4E3C A;  4OVV A;  4TKN A;  4LLG M;  1SB3 C;  3DHG C;  1XLN A;  2IO2 B;  3FAH A;  1DYQ A;  3SU8 X;  5AZF A;  2R61 A;  4HPL B;  2L8J A;  4HPP A;  2FIF A;  2DYB A;  1HQR D;  4JE3 B;  4XZ4 A;  4OZA A;  4AUQ C;  1C1Y B;  1DOI A;  1P0R A;  3DVG Y;  2W9N A;  3RPF C;  1GC7 A;  1BT0 A;  2O6V B;  4EKU A;  2D3C A;  3QAQ A;  4GOC A;  3NUH B;  4OVU A;  3VUX A;  2M1M A;  1C4A A;  3VTV A;  1LGR A;  1J7B A;  2L52 A;  2MA9 B;  1CJE A;  1Q10 A;  1F52 A;  2NTS A;  3D32 A;  3R8B A;  2J0M A;  2FCS A;  5IA7 A;  3TCA A;  2YEP F;  2GMI C;  4P1B C;  1FD6 A;  3K9O B;  1I42 A;  2B76 B;  1E8W A;  2GRI A;  1WI0 A;  3WAN A;  5MPO A;  1GG3 A;  1V49 A;  1L2N A;  4GN1 A;  2N7E A;  1QF6 A;  3V61 A;  1K8R B;  1V2Y A;  4DHZ B;  4WJQ A;  2MBH A;  4NQK E;  1KRH A;  2CHX A;  1OQY A;  2Y5C A;  2W55 A;  4K3C A;  1XO3 A;  3ZXR A;  1YN4 A;  4ZYN A;  3BWU D;  3V6E B;  1MFW A;  1FFV A;  5EE0 A;  4MH8 A;  4YWG G;  1EWY C;  2NPT A;  4US8 A;  2ON8 A;  3H6N A;  2ZVN A;  1FXI A;  1KH0 A;  1VCB A;  3Q3F A;  4W9H A;  1JAL A;  3ZNG C;  1V5O A;  3PHX B;  2BKF A;  4XWT A;  2KX3 A;  1MHH E;  1OEY A;  3OLM D;  1WM2 A;  3DWG C;  2Y5P A;  4Q2J A;  1WZ3 A;  3NHE B;  3DBR I;  1AWD A;  4B6W A;  1K53 A;  3QK0 A;  4JPS A;  2MP2 A;  3FC4 A;  5DPW A;  1UGJ A;  2K8B A;  1WRI A;  3AMZ A;  2QHO A;  2JXT A;  2GBK A;  3RNC C;  2DZI A;  2WX0 A;  3N9Y C;  4LJP B;  4XX5 A;  1SE9 A;  2JZ3 B;  3TIX A;  1V80 A;  2D3B A;  2V4I B;  3WA0 A;  3AI5 A;  3DDC B;  4K7S A;  2KMA A;  4IM0 A;  1PDX A;  2EMT A;  4KIK A;  4A20 A;  5JXV A;  1HZ5 A;  1T5X D;  3DHI C;  5EE9 A;  4IWP A;  4PS7 A;  1QIL A;  4KZC A;  3LB8 C;  2M19 A;  3RNA C;  4MGZ E;  1JWB D;  2WDQ B;  3RNB C;  1GB1 A;  2HTH A;  1TZ1 A;  4S0R A;  5J18 A;  2LVP A;  1GOZ A;  2NTT A;  2VRR B;  4OZB A;  4NPN A;  3HIZ A;  2MBO A;  5HKH A;  1T0Y A;  3KH0 A;  4YTM B;  4ZRJ A;  4O1N A;  4ANU A;  2KDM A;  4P1C C;  2WU2 B;  2LGS A;  3GE8 C;  3B9J A;  3DVN V;  1XLP A;  3M95 A;  1NEK B;  1WRD B;  1YQB A;  1YMH E;  2XK5 A;  2L1A A;  1GUA B;  2V3P A;  3Q8E A;  1XLO A;  3AV8 A;  1KTK A;  3S2A A;  2UWQ A;  4LDT D;  4ANV A;  3W5V B;  3NVY A;  3GE3 C;  1N61 A;  4MSQ B;  2VH2 A;  3AE1 B;  4KSK C;  3I5J C;  4MEL A;  3FKY A;  2D2Q A;  4USA A;  4WAA A;  4W9L A;  3DCG A;  1UUP A;  1V6E A;  2IBI B;  4XWW A;  2KAC A;  2RPV A;  4NJ6 A;  3VDZ A;  5LXI B;  1ZGU B;  4IOI E;  2IGD A;  1I4H A;  1B9R A;  3RZW C;  2IY1 B;  1IPG A;  2GBN A;  3DBH B;  3ZXV A;  2IGH A;  1D3Z A;  3BIN A;  1L6U A;  2AWT A;  1ISN A;  1P7F A;  4K7W A;  3A4S C;  1L7Y A;  2LAS A;  3VUW A;  4BKS D;  5LXH A;  2K0P A;  4KKI A;  2W3S A;  2BYE A;  3DWM A;  1YD8 U;  1S3S G;  2N9X A;  3Q69 A;  4ZYS A;  1WZ0 A;  2CS4 A;  3SEB A;  3MJ5 A;  1UZX B;  2L05 A;  3P4R B;  3B2G A;  1UEL A;  2KFJ A;  4IKG A;  1ROE A;  4M0W A;  5JZE B;  4DDG D;  2I2Y A;  4HK2 A;  2BGF A;  2L32 A;  4FHK A;  4RM8 A;  1WJN A;  4FA6 A;  1T6B X;  1YJ1 A;  2AL6 A;  1U4A A;  3AE6 B;  2IND C;  3ZIM A;  1UBI A;  2G4S A;  1WF9 A;  2K9X A;  1UBQ A;  1F1H A;  2JVC A;  3CF6 E;  1L0V B;  2XEW A;  4BKS A;  3SFD B;  2PJH A;  1GC6 A;  3ZJV A;  1WXQ A;  2DYM A;  4A3O A;  1FM0 D;  1FIQ A;  2KLG A;  2KN4 A;  1RFA A;  3ZYY X;  3N1X C;  3VR9 B;  2FUH B;  2M17 A;  5G2N A;  2KDB A;  3V05 A;  1JWA D;  2ZW0 A;  2BS4 B;  3MJW A;  1KJT A;  4DDI D;  3A33 B;  1K51 A;  2KJH B;  2WDT B;  2XNA C;  2PVG C;  3L13 A;  2BYV E;  1C77 A;  4DXF A;  2Q5W D;  4MJS A;  2K25 A;  4B0M A;  3AEE B;  1KF6 B;  1VD2 A;  1L0X B;  1C9F A;  1AW7 A;  1CQV A;  2W54 A;  5JHB A;  2ZNV B;  3R7R A;  1AYF A;  4GIV A;  1WMH A;  1D5Z C;  4CHK A;  5E6N A;  3NS8 A;  3RN9 C;  2IGG A;  3T9L A;  1HA5 A;  3HM6 X;  3QA8 A;  2PPH A;  5GMV A;  3T3N A;  4YT0 B;  3QJZ A;  2MW5 A;  3KW5 B;  3RYT A;  3EFC A;  4S17 A;  1R4N B;  4JIO U;  2JRH A;  4KV2 A;  3ZNH B;  3AED B;  4DHZ E;  3Q3N C;  1SIF A;  4B9K A;  4AS1 A;  2K6Q A;  1FEH A;  2MHJ A;  4RGO S;  3UIN B;  1MI0 A;  1T3Q A;  3TMP B;  4ASW C;  1WX8 A;  4WJN A;  3JSV A;  5KHQ A;  3FIL B;  1FCC C;  3ZJU A;  1TBE A;  3L17 A;  4LNF A;  3Q3J A;  2LGI A;  4I6L B;  2EMS A;  3VR8 B;  4PK1 A;  2KDF B;  3SR6 A;  2K8H A;  2DZJ A;  2V1Y A;  3HK0 A;  2KVR A;  1OFF A;  1SGH A;  2N9P C;  3L16 A;  4WUR A;  2NBW B;  3MFG A;  5D3D A;  2WGS A;  3IT4 B;  2KQS A;  1P98 A;  2V3S A;  1I4G A;  1NEN B;  4A8X C;  3WAM A;  1RLF A;  3DBL B;  4XGA B;  4MM3 A;  1IP9 A;  3A9K B;  3Q14 C;  4BAX A;  1TKY A;  2MH7 A;  2FAZ A;  3DPD A;  4J6I A;  3RNF C;  1VR9 A;  3LDZ E;  2C9W B;  4GDK B;  4RH6 A;  3L54 A;  2NMQ A;  1SEB D;  4JX1 C;  1YJJ A;  4FBJ B;  1RFK A;  5HFY A;  1CK1 A;  4RF0 A;  2Y5B B;  2LJI A;  3MHS D;  3EHV A;  5C2T B;  1ESF A;  2QIL A;  1B1Z A;  5AUK A;  3JSV B;  3U30 A;  3NZS A;  4GB9 A;  4A55 A;  3WCQ A;  1V1P B;  2BQQ A;  3V62 A;  4DWF A;  1NYR A;  2FE8 A;  1MPE A;  2LMC A;  4TV3 A;  3A9J A;  2INP E;  1WX9 A;  4PYZ A;  1MG8 A;  4MT5 A;  3QIJ A;  4HRO A;  3HM3 A;  5JHA A;  2O6V D;  4AQ7 A;  1OGW A;  4P16 A;  3URY A;  4HRS A;  1NDD A;  1FCL A;  2AX5 A;  1IUE A;  1JWS D;  4ZRK A;  2MWS B;  3PT2 B;  3W2D A;  2JT4 B;  2JU6 X;  3EFU A;  2OJW A;  2RGF A;  1FMA D;  1EF5 A;  2KQ7 A;  4RGN A;  4EZL A;  3ZDT A;  4H2A A;  3P4S B;  4LJO B;  4II3 B;  5LNK 1;  5IAA C;  4M02 A;  3PLU A;  4WWN A;  2V3N A;  5EDS A;  4GU2 A;  1Y56 A;  4FJY A;  4IWO A;  1I7H A;  4FHJ A;  3AU5 A;  2NS5 A;  4OHJ A;  2QJL A;  2EKE C;  4FN2 A;  1SBB B;  1WJ4 A;  2MJ3 A;  2JY6 A;  1EO6 A;  2BF8 B;  3PRP B;  3ZKJ C;  2J42 A;  1C4C A;  1E7P B;  3A1Q A;  1VLB A;  2GBM A;  1ET6 A;  1GPX A;  2BVC A;  2J4X A;  3ABV B;  2SAK A;  1WGK A;  2D11 A;  2RDH A;  1RWS A;  2WDR B;  2MSE D;  5G55 A;  1A5R A;  1GJZ A;  3JYU A;  4IG7 B;  2LGX A;  2V0G A;  3DVN U;  2AYO B;  5E6P A;  2DZM A;  4ZHP A;  1MG4 A;  4PS3 A;  1R4M I;  1ZPS A;  3U4E G;  4DHJ B;  1L6V A;  4G0N B;  3VRA B;  2W82 A;  2WLB A;  2J52 A;  3B0A A;  3RUL A;  2KLC A;  5CX3 A;  1F2R C;  2D3G A;  5HI1 A;  1L4Z B;  4G50 A;  1PGB A;  5G5G A;  3I3T B;  2ZCB A;  1P1A A;  1CZP A;  1SJE D;  3NVW A;  4W9K A;  4B0E A;  1TY2 A;  1WXA A;  3L08 A;  4OW0 A;  4WWO A;  1WJU A;  2C7H A;  1KM7 A;  1QOG A;  1V86 A;  5GXG B;  2WXP A;  4KIK B;  1T0R C;  1ZP0 B;  2HDE A;  3AU4 A;  3GZN B;  1HXY D;  3BVM A;  3IG3 A;  1JW9 D;  2RDB C;  1KLU D;  1QT9 A;  2DYO A;  1HE8 A;  2C7N B;  4NJC A;  2IY0 B;  3IFW B;  2WXK A;  3NG0 A;  5CHW A;  4HKZ E;  5T8I A;  2MLB A;  4RMA A;  4HXD A;  3BK1 A;  5IKC M;  4P7I A;  3A1Q B;  2CKH B;  4K81 A;  2KAJ A;  3VVW B;  2BYT A;  2LJ5 A;  5IP4 D;  1ENF A;  2WQY B;  4KKJ A;  4ANW A;  1NI2 A;  2DHZ A;  2KFK A;  2NCN A;  3PSE B;  4BFR A;  3ZLZ A;  2LHD A;  2X38 A;  4BOS C;  5C3J B;  3GS2 A;  3MC9 A;  1JML A;  1TKE A;  2WXL A;  3KWL A;  4W9E A;  4RCO A;  4WJP A;  1V81 A;  2YEP B;  2MEK A;  2LHE A;  1WR6 E;  3ZTC A;  4ICU A;  3ZW3 A;  4MH0 E;  2N9E B;  1TT5 B;  3RMK C;  4MDK E;  3ZNI D;  1TS3 A;  4HVB A;  1ZDV A;  4ACF A;  4LNK A;  1EUV B;  3BVZ A;  1WFY A;  1F9J A;  2KJR A;  5IOI A;  3RUI B;  1Z2M A;  2YVC A;  1GNU A;  3NS1 A;  4QAY A;  2HJ1 A;  1GAQ B;  1ZE3 D;  3KQ4 A;  2DBY A;  3NOB A;  3ECI A;  3P1M A;  3AEC B;  1ZXI A;  3SD5 A;  3P63 A;  3C8Y A;  3Q8A A;  2PKO A;  3BYY B;  4BBN C;  4C4V A;  3E9S A;  2J0J A;  1GB4 A;  5CHV C;  2BKR B;  2JXX A;  1WWT A;  1STE A;  3UIP B;  5G5H A;  3NZ3 A;  4NQL B;  2OOB B;  2LRU A;  4A9A A;  3B2F A;  3L4P A;  3Q2A C;  3PGE A;  2IDY A;  2D3A A;  3K9P B;  3H8H A;  1SE2 A;  4PT5 A;  2INC C;  3AEG B;  3QX1 A;  4LNO A;  2XBB C;  3AE8 B;  3PZ8 A;  1G6J A;  2N9K A;  2WNM A;  3CIR B;  2KAN A;  2M4N A;  2M0X A;  3ZTD A;  4YTN B;  1EWC A;  1SSN A;  2JYT A;  2OJR A;  1Q5W B;  2WP9 B;  3I63 C;  1WGY A;  2AQ3 B;  2O6V A;  3AUL A;  4YTP B;  3ZGZ A;  3PTF C;  3Q3O C;  4AOF A;  3TUO A;  1S1Q B;  3Q8C A;  2EEL A;  1OQR A;  5D2M B;  4K1R B;  3PRM B;  3U52 E;  4K3B A;  2KMM A;  2WXG A;  4KZ0 A;  2WXO A;  4KDL B;  5H8Y E;  3I57 A;  2K6D B;  4IW0 A;  3CSF A;  5KHO A;  1N62 A;  2L76 A;  3R66 C;  3APF A;  1WGD A;  2LD9 A;  1TS2 A;  4A3P A;  2MCN B;  2YLM A;  1RM6 C;  2DAJ A;  2MQJ A;  4HWI B;  4YXD B;  4HDO A;  2WS3 B;  1I4X A;  5BO4 B;  2JX5 A;  1WYW B;  4W9G A;  2GBR A;  1WGG A;  1E7V A;  2LWP A;  5FKA C;  2RR9 A;  4EUT A;  2X8X X;  3AH7 A;  4E71 A;  1HZ6 A;  1ZOY B;  2KQ4 X;  4N58 A;  4ICV A;  2FBW B;  1NVI D;  1YQ4 B;  2WXR A;  2L83 A;  5EE1 A;  5EE3 A;  2NPT B;  4REZ A;  1R4M B;  3R2T A;  4NAW A;  4I6N B;  2NR2 A;  3RD2 A;  2KWU B;  2ICI A;  3VTU A;  4GDL A;  5FR6 A;  4ZRQ A;  1TIF A;  3CWI A;  1JRU A;  5DPT A;  4HKQ A;  1QKZ A;  1V5T A;  3DHH C;  2DAF A;  3NJT A;  3RFZ B;  5BMG A;  2K39 A;  1E7U A;  3SFE B;  1QOB A;  3VUY A;  4N59 A;  5D94 A;  2MJE A;  4ARC A;  2G1E A;  3UGB B;  2N7J A;  2G9H D;  3SDL C;  4AP4 C;  2BTE A;  1E6E B;  4KGT A;  4NZL B;  3W1S A;  4TUU A;  2BBC A;  4BKG A;  2VH1 A;  2LXA A;  4FJZ A;  4W9I A;  1YN5 A;  4L23 A;  3AEB B;  3GB1 A;  2IYD B;  2IZV B;  3PHW B;  2LGY A;  3ETR A;  1ZW7 A;  1QLB B;  4MGI E;  4RGT A;  5I4D A;  5LLI A;  1XQQ A;  1AN8 A;  3V6C B;  5D6J B;  4AJW A;  3T8M A;  1EU3 A;  4EZK A;  2KWV B;  2RDG A;  2PMV A;  2KXJ A;  1D6E C;  2KWC A;  3EEC A;  3VFK A;  3EGR A;  3H7P B;  5HG2 A;  3VH4 B;  3HRD D;  1I4R A;  2L3Z A;  2ZZP B;  1E9M A;  1FFU A;  2L00 B;  1Z5S B;  1FRR A;  2INN E;  2KC1 A;  3DBS A;  2NBU A;  1WXM A;  2J0K A;  3IT6 B;  4ZRI A;  3PV1 A;  2O2V A;  4II2 B;  3B08 A;  1N63 A;  2FCN A;  4HDQ A;  4LDT B;  1UGM A;  4MGK E;  3KYC D;  2V4L A;  2JYE A;  2K5P A;  4A6Q A;  1N6Z A;  3J9C A;  5BMH A;  4WJO A;  2QC8 A;  1IBX B;  3AM9 A;  4IM3 A;  1H4R A;  4EZJ A;  4G3X B;  2KK8 A;  4E74 A;  1UH6 A;  3M62 B;  2KKC A;  4YSX B;  1SXT A;  3IXS A;  1Q0W B;  3TBL D;  4HEA 1;  1L4D B;  5AZG A;  1R7S A;  2CU1 A;  1BUI C;  4WWM A;  1E0Z A;  5DPR A;  4XE0 A;  3W5U B;  3C0R B;  1C4P A;  4MSM B;  1ZXH A;  4IWQ A;  1TS4 A;  1WXS A;  2JWU A;  3AE9 B;  3DBL I;  4M8N A;  2K8C A;  4TQ1 A;  2N4F A;  1L5P A;  3OJ4 B;  3DOW A;  3U7Z A;  3A4R A;  1E10 A;  1NBF C;  4LCD E;  1F77 A;  2VZK D;  5JH5 C;  3R3M A;  3Q8F A;  3P2B A;  2WWZ A;  2TSS A;  4RGM A;  3EUB 2;  3R2I A;  1OQQ A;  5L83 A;  1N5W A;  1TTN A;  3PZ7 A;  2FID A;  4WQM A;  1E8X A;  3H1U A;  2KOX A;  5BYQ A;  1J8C A;  3ZNZ B;  1C78 A;  2XN9 C;  1MVK A;  2GBJ A;  1FNV A;  2KJ6 A;  2K1F A;  2NVU I;  4YL8 A;  1I4Q A;  1DOX A;  1WE6 A;  3NVZ A;  2LVO A;  4NAM A;  4CO7 A;  3CST A;  2ONQ A;  4KDI C;  3ZO5 B;  2REX A;  1E8Z A;  3L10 B;  2AEH A;  2OED A;  2NBV B;  2BPS A;  4C56 C;  2IO1 B;  1Q1O A;  4LK0 M;  4OZC A;  2LUM A;  5DCN A;  1LXD A;  1IGC A;  4RM9 A;  4X57 B;  3VXW A;  1WXV A;  4GGQ A;  4W9F A;  2JF5 A;  1NYQ A;  1OTR B;  2D10 A;  2I1K A;  1TYG B;  5E6J A;  2H88 B;  3JVZ X;  3N3K B;  2KO3 A;  1XEE A;  3ML8 A;  4UDU C;  3M3J A;  3NRZ A;  2DWQ A;  5E6O A;  2E6X A;  3ZVV A;  4WIP A;  3IBE A;  3C19 A;  3TJP A;  4F8C B;  4HLE A;  1E90 A;  3IAM 1;  4BBN F;  3FIL A;  4EFO A;  1V8C A;  1C3T A;  2CU3 A;  4FAD A;  1WMH B;  1JQ4 A;  2HD5 B;  1UD7 A;  2MP2 B;  3APC A;  1LFD A;  3MP9 A;  2N1V A;  2KTF A;  2IPK D;  1TKG A;  1J7C A;  3EA6 A;  4RF1 A;  2LXC A;  2ZNV C;  2LRW A;  3GZN I;  4N9F 4;  4ARI A;  3NVV A;  1VZ8 A;  1M94 A;  2KMC A;  2G4D B;  3LXF A;  5CTR C;  4DBG A;  3W1S C;  3OWE B;  2GOW A;  1ZUD 2;  1EM7 A;  3W1Y A;  3V3X A;  1KFY B;  1E8Y A;  2JUO A;  3N1Y C;  4AWJ A;  3PS6 A;  3LJ3 A;  2JPH A;  3P4P B;  4HCP B;  3UIO B;  3U2S C;  1JWU D;  3R7Q A;  2ZW1 A;  2KNB A;  1VZ6 A;  1M4V A;  4J3O D;  2RSU A;  4URK A;  1JCK B;  3IAS 1;  4ZRP A;  1UWX A;  3ZJT A;  4M8M A;  1C76 A;  2WDV B;  1FRD A;  2MBE A;  2A5U A;  4HJG E;  1PUT A;  3N32 A;  3QWZ B;  2Z59 B;  1P3Q U;  1IGD A;  1DOY A;  1TS5 A;  1WSP A;  2CHZ A;  3KYD D;  2C60 A;  1SE3 A;  5AEK B;  1F2R I;  1LM8 B;  4JLC A;  3W9C B;  3QHT A;  4NJ7 A;  2WXI A;  3O65 B;  5IO9 A;  3AE5 B;  5FK9 C;  1TGZ B;  2BT6 A;  3N20 C;  3GP7 A;  2ASQ A;  3QCA A;  2UYZ B;  4BOZ B;  3TEY A;  1JRP A;  3KUD B;  2N9L A;  3H7P A;  1JWM D;  1AAR A;  5FR3 A;  5J17 A;  4L2Y A;  2LUE A;  2WYQ A;  3BZD B;  4PYU A;  1FXT B;  1VZ7 A;  4LTU A;  1SIJ A;  4B95 A;  3EC8 A;  4ITK A;  1VRA B;  1I35 A;  1YIW A;  2CJO A;  3DVG X;  1YN3 A;  3KLS X;  2HE7 A;  2KFK B;  4GMV A;  3UI3 A;  1YX6 B;  3ZQ4 A;  4FXC A;  3KWV A;  4N6E B;  5D3I B;  4NNJ B;  3U8Z A;  2H89 B;  3B1L X;  1RRB A;  1EU4 A;  2FNJ B;  5IN7 A;  1DGJ A;  1FPY A;  3AN1 A;  3TL5 A;  1FNW A;  2JRI B;  1LQB A;  3VRB B;  2RPQ A;  2GB1 A;  2IO3 B;  3PRZ A;  3PLV A;  3DQV A;  1LO5 D;  2AQ1 B;  1HTO A;  2WU5 B;  2GLS A;  3ONS A;  4HCN B;  1XCT L;  4WQO B;  1SF0 A;  1JRO A;  2KC2 A;  1SJH D;  1ACC A;  4CYE A;  1TZO A;  4OVZ A;  3A9K A;  3WAL A;  1V1P A;  2WXM A;  3AXC A;  3TSS A;  5CHF A;  5D7G A;  1IYF A;  2WX1 A;  2PW9 A;  1EF1 A;  3HVD A;  3Q3M C;  2Z0E B;  1YOV B;  4W9C A;  4NY0 A;  2M8S A;  3BVG A;  3VQI A;  1PGA A;  2KTR A;  1N60 A;  2N1W A;  2ZEQ A;  4EOY A;  2Z0D B;  3BYT B;  2BS3 B;  2LEK A;  3X0W A;  4BKT A;  1FO4 A;  1J0G A;  1F0Z A;  1WYG A;  3HVZ A;  4XYC A;  1I4P A;  3LYY A;  1XXG A;  3NZU A;  5HHD G;  4DQO C;  1QOF A;  2CR5 A;  2MJD A;  1WIA A;  4XDC A;  4XC2 A;  3L0W B;  4TSS A;  2MRP A;  3TEX A;  4C7Z A;  2L0T A;  2ZJD A;  3P4Q B;  2QMT A;  1P9D U;  2PEA A;  1PYW D;  1HEZ E;  2IJ0 A;  2KD0 A;  2FCM A;  2L0F A;  4FLH A;  1YX5 B;  1CMX B;  3AEA B;  4ZDV A;  2G3Q B;  2BS2 B;  5AZH A;  4YSY B;  3ZUN A;  3TEZ A;  3RNE C;  4WH4 A;  2DLB A;  1PQS A;  1TJE A;  2WXH A;  3X23 A;  2A4Z A;  4KGR A;  3GOE A;  1K50 A;  2M56 B;  3VTW A;  4P6V F;  3H9D A;  2QSD A;  3AE3 B;  5J2R A;  2MBB B;  3WAP A;  3U7D A;  1WGH A;  2WXN A;  3BK2 A;  3VAW A;  1BML C;  3PPA A;  2UU7 A;  1V9J A;  2V9H A;  3MC8 A;  2BWE S;  5BMI A;  4RFB A;  3A9J B;  4IDI A;  3V60 A;  2PTL A;  3WAO A;  2QIE B;  2HJ8 A;  1V97 A;  4I6P A;  3Q6B A;  2JZP A;  1Y8R C;  2IO0 B;  4W9J A;  3I9V 1;  4M00 A;  2QEJ C;  3ZRF A;  2HTM E;  4C80 A;  1E5W A;  1J19 A;  4BVU C;  3TEW A;  1D5X C;  5H92 C;  1XT9 B;  3ENE A;  2KWD A;  2MBQ A;  5C23 A;  1P7E A;  4GSW A;  3CMM B;  2R2Q A;  2K3U A;  1VJK A;  2BWF A;  2O2V B;  3PO0 A;  4ZOH C;  2C5L C;  3HHM A;  2N7D A;  4C4V B;  4MM3 B;  2PLP A;  1FNU A;  1T0Q C;  4F1S A;  4MEM A;  2BB6 A;  4JQW C;  4EEW A;  1J7A A;  2KDE B;  2PVO D;  3AE2 B;  3HUI A;  4FJV B;  3RI7 C;  3RT3 B;  3DBH I;  3ALB A;  1PFD A;  4US9 A;  3ZRC A;  5BYR A;  3UF8 A;  3ML9 A;  2LI5 A;  3T3O A;  4JGH B;  3BY4 B;  4KGS A;  3UQA A;  2ZPN A;  1D4B A;  2N0S B;  2ZPY A;  2J53 A;  4WAF A;  2DX5 B;  2D5G A;  4BZA A;  3KUZ A;  4M0W B;  4AJY B;  2VZK B;  2WXJ A;  3APD A;  2BW2 A;  2ZCC A;  2ZVO A;  1ZKH A;  4KVG B;  3OJ3 A;  2FCQ A;  2LZ6 A;  4MAC A;  3O13 A;  1XLQ A;  4PS8 A;  2D07 B;  1RAX A;  3RCZ A;  1TY0 A;  4K7U A;  4CQN A;  2CJN A;  5BYS A;  3QC8 B;  2G45 B;  1A70 A;  1WM3 A;  2EKI A;  1XD3 B;  3AB5 A;  3QAR A;  2JQR B;  3PZD A;  2AL3 A;  4YSZ B;  4KX6 B;  3WIM A;  1YQ3 B;  3P42 A;  1ET9 A;  3VHT C;  2I38 A;  3OG5 A;  4JWS C;  4DK5 A;  2MX2 A;  4TQ0 A;  1WY8 A;  2RMM A;  4JL9 A;  2KN5 A;  4LNN A;  4W9D A;  2DEN B;  1L0Y B;  4GXB A;  4IM2 A;  3JW0 X;  2LFI A;  2CHW A;  2M0A A;  1D5M C;  2RD0 A;  2DZK A;  4HPM B;  3IVF A; 
#chains in the Genus database with same CATH homology
 5DPS A;  1WR6 E;  3ZTC A;  4ICU A;  1C3T A;  3ZW3 A;  2XK5 B;  1D3Z A;  4MH0 E;  4FAD A;  3BIN A;  2N9E B;  2AWT A;  1ISN A;  1WMH B;  4MDK E;  3ZNI D;  4HVB A;  2HD5 B;  2PE9 A;  1UD7 A;  1EUV B;  4K7W A;  3A4S C;  2MP2 B;  2KHW B;  2KTR B;  3APC A;  1LFD A;  3H7S A;  1WFY A;  2N1V A;  1F9J A;  1L7Y A;  2KJR A;  2KTF A;  2LAS A;  3RUI B;  3N30 A;  3VUW A;  2R2O A;  3MTN B;  5L95 C;  1Z2M A;  2YVC A;  1GNU A;  4BKS D;  4IUM B;  5LXH A;  3NOB A;  2LXC A;  2BYF A;  2BYE A;  3ECI A;  3OAW A;  2J7Q B;  1YD8 U;  4F7Z A;  2ZNV C;  1S3S G;  2LRW A;  3GZN I;  2N9X A;  4N9F 4;  3SD5 A;  1WZ0 A;  1M94 A;  2CS4 A;  4BBN C;  2KMC A;  2G4D B;  1UZX B;  2L05 A;  5CTR C;  4DBG A;  1UEL A;  2KFJ A;  4MGY E;  2J0J A;  4FUL A;  3W1S C;  4DXA B;  2GOW A;  1X1M A;  3W1Y A;  5CHV C;  5JZE B;  2BKR B;  2JXX A;  1E8Y A;  2JUO A;  1KLV A;  4AWJ A;  3UIP B;  3PS6 A;  4DDG D;  3LJ3 A;  4HK2 A;  2BGF A;  4RM8 A;  4FHK A;  1KOT A;  2JPH A;  1WJN A;  4NQL B;  4FA6 A;  4HCP B;  1R4N I;  3UIO B;  1YJ1 A;  3R7Q A;  2OOB B;  2LRU A;  2AL6 A;  2KNB A;  1U4A A;  1WJ6 A;  3PGE A;  2L7R A;  2RSU A;  3ZIM A;  4URK A;  3K9P B;  3ZDM C;  1UBI A;  1H8C A;  4HJK A;  2G4S A;  1WE7 A;  3QX1 A;  1WF9 A;  2XBB C;  4M8M A;  1G6J A;  1UBQ A;  3RZF A;  2MBE A;  2JVC A;  3CF6 E;  2A5U A;  3IHP C;  4G11 A;  2KAN A;  2M4N A;  2M0X A;  3ZTD A;  3N32 A;  3QWZ B;  2Z59 B;  2KDI A;  1P3Q U;  2XEW A;  4BKS A;  2OJR A;  1Q5W B;  1WGY A;  2PJH A;  3M63 B;  2CHZ A;  3QQ8 B;  1GC6 A;  2KX0 A;  3KYD D;  2O6V A;  3AUL A;  2C60 A;  3PTF C;  4AOF A;  2DYM A;  3NY5 A;  2JWZ A;  1S1Q B;  4A3O A;  5AEK B;  2PE6 B;  1LM8 B;  4JLC A;  3UQB A;  3QHT A;  4NJ7 A;  2KLG A;  1RFA A;  3O65 B;  5D2M B;  4K1R B;  3PRM B;  2FUH B;  1TGZ B;  2M17 A;  4KZ0 A;  2JZZ A;  2B3A A;  5G2N A;  2KDB A;  4KDL B;  2ASQ A;  3QCA A;  2UYZ B;  4BOZ B;  3PRE A;  1OEY J;  4DHJ D;  3MJW A;  1KJT A;  4DDI D;  3A33 B;  3KUD B;  2K6D B;  4IW0 A;  3CSF A;  3H7P A;  5KHO A;  1AAR A;  2KJH B;  2L76 A;  1WR1 A;  2WDT B;  5J17 A;  2LVQ A;  3R66 C;  5C1Z A;  4WWP A;  3APF A;  3L13 A;  2BYV E;  2LUE A;  1WGD A;  2WYQ A;  4ANX A;  2LD9 A;  4NAW B;  1FXT B;  4MJS A;  4PYU A;  5TR5 A;  2K25 A;  4A3P A;  2MCN B;  2YLM A;  4B95 A;  3EC8 A;  4GDK A;  1VD2 A;  2DAJ A;  2MQJ A;  4HWI B;  1I35 A;  1YIW A;  3DVG X;  1WH3 A;  4HDO A;  2HE7 A;  2KFK B;  4GMV A;  1YX6 B;  5BO4 B;  3PVL A;  4NNJ B;  1WYW B;  3KVF B;  3KUC B;  4W9G A;  2I1J A;  3U8Z A;  5JHB A;  2GBR A;  2ZNV B;  1WGG A;  3B1L X;  3R7R A;  1E7V A;  1RRB A;  2LWP A;  4GIV A;  1WMH A;  4CHK A;  5E6N A;  3NS8 A;  2FNJ B;  2C7M B;  3T9L A;  2KZR A;  3VH3 B;  3HM6 X;  3QA8 A;  2PPH A;  3TL5 A;  5GMV A;  2RR9 A;  4EUT A;  4KSL C;  2JRI B;  3QJZ A;  1LQB A;  4E71 A;  2MW5 A;  3KW5 B;  3RYT A;  2RPQ A;  4GDL B;  2IO3 B;  3PRZ A;  4JIO U;  1WX7 A;  2JRH A;  4ICV A;  4KV2 A;  3ZNH B;  1QZE A;  3PLV A;  4IC7 B;  3DQV A;  4DHZ E;  4MJS B;  1SIF A;  4B9K A;  2K6Q A;  2NPT B;  2LGD A;  4NAW A;  4I6N B;  2NR2 A;  1WGR A;  3ONS A;  3RD2 A;  3SHQ A;  4E3C A;  4HCN B;  4OVV A;  4TKN A;  2KWU B;  4WQO B;  3VTU A;  2KC2 A;  4GDL A;  3UIN B;  5FR6 A;  2IO2 B;  4CYE A;  1JRU A;  5DPT A;  1V5T A;  3A9K A;  3WAL A;  2DAF A;  3TMP B;  4ASW C;  1WX8 A;  1IPG A;  3AXC A;  4WJN A;  3SU8 X;  2K39 A;  5AZF A;  3JSV A;  1E7U A;  5CHF A;  5D7G A;  5KHQ A;  1IYF A;  3VUY A;  1TBE A;  2WX1 A;  3L17 A;  4HPL B;  2L8J A;  5D94 A;  3Q3J A;  2FIF A;  2DYB A;  4I6L B;  2EMS A;  4XZ4 A;  4AUQ C;  1C1Y B;  2KDF B;  1P0R A;  3DVG Y;  2W9N A;  3UGB B;  1GC7 A;  1EF1 A;  1BT0 A;  2O6V B;  3SDL C;  2Z0E B;  4EKU A;  2K8H A;  4AP4 C;  2DZJ A;  3W1S A;  4TUU A;  3QAQ A;  2V1Y A;  3HK0 A;  4GOC A;  4NY0 A;  4W9C A;  2M8S A;  2KVR A;  3VQI A;  4BKG A;  1SGH A;  4OVU A;  3VUX A;  4FJZ A;  2LXA A;  2KTR A;  2M1M A;  4W9I A;  2N1W A;  2N9P C;  2IYD B;  3L16 A;  2IZV B;  2NBW B;  3VTV A;  3PHW B;  2LGY A;  1ZW7 A;  2ZEQ A;  4EOY A;  2Z0D B;  2KQS A;  1P98 A;  2V3S A;  4MGI E;  2MA9 B;  5LLI A;  1XQQ A;  3WAM A;  1RLF A;  3X0W A;  4BKT A;  1J0G A;  3D32 A;  4MM3 A;  1IP9 A;  2J0M A;  3A9K B;  3V6C B;  2FCS A;  5IA7 A;  5D6J B;  4AJW A;  2FAZ A;  3TCA A;  3DPD A;  4J6I A;  3T8M A;  2GMI C;  3NZU A;  3LDZ E;  4EZK A;  3K9O B;  1I42 A;  2C9W B;  4GDK B;  2KWV B;  3L54 A;  1E8W A;  2CR5 A;  1WI0 A;  3WAN A;  4FBJ B;  1WIA A;  2KXJ A;  1GG3 A;  1V49 A;  2KWC A;  2Y5B B;  1L2N A;  3EEC A;  3VFK A;  3MHS D;  4XC2 A;  3EHV A;  3H7P B;  3L0W B;  2MRP A;  3VH4 B;  4GN1 A;  2L0T A;  2N7E A;  2ZJD A;  3V61 A;  1K8R B;  1V2Y A;  2L3Z A;  3JSV B;  3U30 A;  1P9D U;  2ZZP B;  2PEA A;  3NZS A;  4GB9 A;  4DHZ B;  4WJQ A;  3V62 A;  4DWF A;  2KD0 A;  2MBH A;  2L00 B;  4NQK E;  2CHX A;  2FCM A;  1OQY A;  1Z5S B;  2L0F A;  4TV3 A;  3A9J A;  4FLH A;  1YX5 B;  1CMX B;  1WX9 A;  2KC1 A;  2NBU A;  3DBS A;  4PYZ A;  1MG8 A;  2G3Q B;  4ZYN A;  3V6E B;  1WXM A;  2J0K A;  4ZRI A;  4ZDV A;  3PV1 A;  2O2V A;  3QIJ A;  4II2 B;  5AZH A;  3HM3 A;  5JHA A;  3B08 A;  2O6V D;  2NPT A;  3ZUN A;  2FCN A;  4HDQ A;  4LDT B;  1UGM A;  4MGK E;  1OGW A;  1PQS A;  3KYC D;  3H6N A;  2ZVN A;  3X23 A;  2A4Z A;  2V4L A;  1NDD A;  3GOE A;  1VCB A;  3Q3F A;  4ZRK A;  2MWS B;  4W9H A;  3PT2 B;  3IVF A;  4WJO A;  3VTW A;  1V5O A;  3H9D A;  2BKF A;  3PHX B;  3ZNG C;  4IM3 A;  1H4R A;  2KX3 A;  2JT4 B;  3EFU A;  4EZJ A;  4G3X B;  2RGF A;  2KQ7 A;  1EF5 A;  5JH5 C;  2KK8 A;  4E74 A;  4EZL A;  3ZDT A;  1UH6 A;  5J2R A;  2MBB B;  3WAP A;  1OEY A;  2KKC A;  3M62 B;  3OLM D;  4LJO B;  1WM2 A;  3U7D A;  4II3 B;  1Q0W B;  3TBL D;  1WGH A;  1WZ3 A;  5IAA C;  3NHE B;  3DBR I;  4WWN A;  3PLU A;  5AZG A;  5EDS A;  4GU2 A;  3VAW A;  2CU1 A;  4B6W A;  4FJY A;  4IWO A;  4FHJ A;  3AU5 A;  2NS5 A;  3PPA A;  2EKE C;  1V9J A;  2BWE S;  5DPR A;  3WAO A;  3A9J B;  3V60 A;  3QK0 A;  4FN2 A;  3C0R B;  2HJ8 A;  4MSM B;  4IWQ A;  2MP2 A;  1WJ4 A;  2JY6 A;  1EO6 A;  2BF8 B;  1WXS A;  3PRP B;  4I6P A;  3DBL I;  4M8N A;  3ZKJ C;  5DPW A;  1Y8R C;  2IO0 B;  2K8B A;  3A1Q A;  4W9J A;  2GBM A;  2K8C A;  3ZRF A;  4TQ1 A;  2N4F A;  2D11 A;  2QHO A;  3OJ4 B;  2GBK A;  1E5W A;  1J19 A;  3DOW A;  4BVU C;  2MSE D;  3A4R A;  2DZI A;  5G55 A;  1NBF C;  4LCD E;  1A5R A;  2WX0 A;  1XT9 B;  4LJP B;  1GJZ A;  3JYU A;  4XX5 A;  3ENE A;  1SE9 A;  2JZ3 B;  2MBQ A;  3TIX A;  4IG7 B;  1V80 A;  2LGX A;  3DVN U;  5C23 A;  3R3M A;  2AYO B;  3WA0 A;  3AI5 A;  3DDC B;  5E6P A;  2DZM A;  3P2B A;  4K7S A;  2WWZ A;  2KMA A;  4GSW A;  3CMM B;  2R2Q A;  4IM0 A;  2BWF A;  2O2V B;  2C5L C;  3HHM A;  2EMT A;  2N7D A;  4PS3 A;  5L83 A;  1TTN A;  1R4M I;  4KIK A;  4A20 A;  2FID A;  4IWP A;  4F1S A;  4MEM A;  4PS7 A;  4KZC A;  4JQW C;  4EEW A;  1E8X A;  3H1U A;  4DHJ B;  2KDE B;  2KOX A;  1J8C A;  4MGZ E;  3ZNZ B;  4FJV B;  2HTH A;  3RT3 B;  4G0N B;  3DBH I;  3ALB A;  1TZ1 A;  5J18 A;  2LVP A;  3ZRC A;  3B0A A;  2VRR B;  3RUL A;  2KLC A;  3ML9 A;  2GBJ A;  3UF8 A;  5CX3 A;  2LI5 A;  4NPN A;  2NVU I;  2KJ6 A;  2K1F A;  2MBO A;  3HIZ A;  4YL8 A;  5HKH A;  4JGH B;  2D3G A;  1T0Y A;  3KH0 A;  3BY4 B;  3UQA A;  2ZPN A;  4G50 A;  4ZRJ A;  3I3T B;  2ZCB A;  1WE6 A;  2ZPY A;  1P1A A;  2LVO A;  4CO7 A;  2DX5 B;  4ANU A;  4W9K A;  3CST A;  3KUZ A;  4M0W B;  4AJY B;  3ZO5 B;  4KDI C;  1WXA A;  3DVN V;  3L08 A;  2REX A;  4WWO A;  1WJU A;  2C7H A;  3M95 A;  1KM7 A;  1E8Z A;  3L10 B;  2AEH A;  3APD A;  2NBV B;  1WRD B;  2BPS A;  1YQB A;  2IO1 B;  2ZCC A;  1Q1O A;  5DCN A;  2ZVO A;  1V86 A;  2XK5 A;  1ZKH A;  4KIK B;  3OJ3 A;  1GUA B;  2FCQ A;  4KVG B;  1LXD A;  3AU4 A;  2LZ6 A;  4RM9 A;  4X57 B;  3VXW A;  1WXV A;  3IG3 A;  4GGQ A;  4PS8 A;  3S2A A;  2D07 B;  2UWQ A;  1RAX A;  3RCZ A;  4W9F A;  4K7U A;  2DYO A;  4LDT D;  2JF5 A;  1HE8 A;  2C7N B;  1OTR B;  2D10 A;  4ANV A;  2IY0 B;  2I1K A;  3IFW B;  2G45 B;  3QC8 B;  1WM3 A;  5CHW A;  1XD3 B;  2MLB A;  4RMA A;  4HXD A;  3JVZ X;  3QAR A;  4P7I A;  3PZD A;  2AL3 A;  4MSQ B;  3A1Q B;  2CKH B;  4K81 A;  3N3K B;  3VVW B;  4KSK C;  3WIM A;  4MEL A;  2KO3 A;  2LJ5 A;  2D2Q A;  3ML8 A;  4WAA A;  4W9L A;  3M3J A;  4ANW A;  1NI2 A;  2DHZ A;  2KFK A;  2NCN A;  3VHT C;  3PSE B;  4BFR A;  3ZLZ A;  3DCG A;  5E6O A;  4DK5 A;  1V6E A;  2IBI B;  2MX2 A;  4TQ0 A;  4BOS C;  1WY8 A;  3ZVV A;  4JL9 A;  3IBE A;  2KN5 A;  4W9D A;  4NJ6 A;  2DEN B;  3TJP A;  3VDZ A;  4GXB A;  4IM2 A;  1ZGU B;  4F8C B;  5LXI B;  3JW0 X;  4W9E A;  4HLE A;  4WJP A;  2CHW A;  1V81 A;  1E90 A;  4BBN F;  2RD0 A;  2DZK A;  4HPM B;  4EFO A;  3RZW C;  2IY1 B;  2GBN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...