2LI5A

Nmr structure of atg8-atg7c30 complex
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
117
structure length
117
Chain Sequence
b'HMKSTFKSEYPFEKRKAESERIADRFPNRIPVICEKAEKSDIPEIDKRKYLVPADLTVGQFVYVIRKRIMLPPEKAIFIFVNDTLPPTAALMSAIYQEHKDKDGFLYVTYSGENTFG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Autophagy-related protein 8
publication title Structural basis of Atg8 activation by a homodimeric E1, Atg7.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
total genus 15
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2011-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02991 Atg8 Autophagy protein Atg8 ubiquitin like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2li5A00
2DZIA 1E8ZA 3SD5A 1J8CA 4ANVA 1S1QB 4I6PA 1SGHA 3JVZX 1P1AA 4FBJB 3ZO5B 1E90A 3UIOB 3NY5A 3A4SC 3ALBA 1E8XA 4II2B 4LDTD 3SHQA 1S3SG 3I3TB 3CF6E 3L54A 5E6NA 2IY1B 3B1LX 4IUMB 5KHOA 2Y5BB 2MP2A 4HJKA 2KJHB 1WJNA 3A1QB 3R7RA 4GMVA 5D6JB 3ZUNA 2G45B 2JWZA 3HIZA 4MSMB 3DVGX 3QX1A 4URKA 1UH6A 2IZVB 1YJ1A 3PHWB 3NS8A 3PRPB 4E71A 3IG3A 4F8CB 2KFJA 4KV2A 2O6VB 2KX3A 2JT4B 2ZNVC 4WJOA 3DDCB 5KHQA 1JRUA 4WAAA 2KDEB 1G6JA 3TIXA 3D32A 2KN5A 1V80A 2N9PC 3KYDD 2HJ8A 4HDOA 3VH4B 3Q3JA 4RM8A 3Q3FA 2KXJA 5J2RA 3M62B 2LWPA 1QZEA 3VDZA 2GOWA 5E6PA 1YQBA 2BWFA 2K6QA 1Y8RC 4NNJB 2GBJA 4HPMB 3L10B 2JY6A 4EKUA 4MSQB 2KWVB 2MSED 2N7DA 5CHVC 4GOCA 1P98A 2JF5A 1V6EA 2RGFA 2CHXA 2K39A 1XQQA 3RCZA 1OGWA 1WX9A 3VHTC 4AJYB 3TCAA 2D2QA 1AARA 2JRHA 4A3OA 3IVFA 1U4AA 1WY8A 2LI5A 2FCQA 4NJ7A 3V62A 4NQKE 1UBIA 2GBMA 3DVNV 3QHTA 2I1KA 4EOYA 5FR6A 2MCNB 4ZDVA 4MJSA 1TTNA 3A9KB 4II3B 1WXMA 1WR6E 3IBEA 1M94A 2GMIC 2MX2A 3VXWA 3UQAA 2KJRA 2MBOA 3T9LA 1RRBA 3RD2A 2BYFA 2I1JA 5LLIA 2KLCA 3U8ZA 4GDKA 3ZNHB 3VUYA 2CR5A 3OLMD 1OQYA 2EMTA 2NR2A 2PJHA 2WWZA 4W9LA 5IA7A 2W9NA 3RT3B 4DDGD 2N7EA 4YL8A 2L0TA 5DCNA 3ENEA 2CHZA 3A9JA 4FJVB 2D11A 1Q5WB 2DZMA 4ASWC 2N9EB 2JZ3B 4KIKA 2IO1B 4NY0A 2JUOA 4IM2A 2MBBB 4I6NB 5JH5C 3ML8A 2LVQA 4N9F4 4W9IA 4ANWA 1FXTB 5DPRA 4GU2A 3M95A 3UQBA 2LXCA 1GJZA 1X1MA 3DQVA 3HM6X 1RLFA 4AUQC 1NI2A 3NOBA 5LXIB 4BOSC 1TGZB 4XC2A 1WJ4A 4P7IA 2J7QB 3H7SA 2L3ZA 3QCAA 1LFDA 1V2YA 1CMXB 3C0RB 4GXBA 4DXAB 4FHJA 5BO4B 3PHXB 1V49A 2V1YA 3JSVA 2MP2B 4LCDE 1IPGA 2CS4A 4BBNF 1C3TA 5D94A 2LVOA 4FJZA 2AYOB 3MHSD 1WH3A 3PGEA 4BOZB 1H4RA 2FIFA 2ZJDA 2HTHA 4HLEA 3NZUA 4NPNA 3RZWC 3WIMA 2C60A 2BKRB 4CO7A 2NBWB 3R66C 1BT0A 2LJ5A 1GUAB 4MDKE 3VTUA 4IW0A 3AXCA 3ZNGC 2O6VD 4G50A 4HDQA 4IM3A 3A33B 1P0RA 3EC8A 1WGRA 3VFKA 3TL5A 3VVWB 1LM8B 2KNBA 3ONSA 3JW0X 4KZCA 1YX5B 4PS7A 2GBRA 1EF5A 2G3QB 2MW5A 1VD2A 4EZJA 3R7QA 4DHZE 2EKEC 2LUEA 5AZFA 4W9JA 3OAWA 1SE9A 3OJ4B 2FIDA 1EO6A 2D10A 3GZNI 4KSKC 3V60A 4AWJA 2RR9A 3WAMA 4IM0A 1WGDA 4K81A 4BFRA 2NPTA 2UYZB 4EZKA 2ZNVB 1L7YA 3PZDA 3VUXA 1VCBA 3PV1A 3V6CB 3VQIA 3H9DA 4ZRIA 3TJPA 4MJSB 1Q0WB 2DAJA 4W9FA 2GBKA 4WJQA 2DAFA 3HHMA 3QC8B 3VAWA 2C7NB 3ZNID 2L00B 2XK5A 5D7GA 1NDDA 4HPLB 2IO0B 2R2QA 4FHKA 2V4LA 1WX8A 3PT2B 4HVBA 1E8WA 2YLMA 1WGGA 3QARA 3VH3B 3WAOA 3NHEB 4GDKB 3AI5A 4MEMA 2KHWB 2DZJA 2JXXA 2L76A 2Z59B 4ANXA 2PPHA 5IAAC 3WAPA 4FLHA 3CSTA 3RZFA 4A3PA 3MJWA 1V5TA 3A9JB 2K8CA 4WWNA 3W1YA 4AOFA 4GDLA 2CU1A 1EUVB 2XEWA 2KK8A 4LJPB 2KFKB 1WMHA 4KIKB 4B9KA 2WX0A 4W9GA 3O65B 2JZZA 3QQ8B 1UGMA 3KUCB 2V3SA 4GN1A 2RSUA 1HE8A 1GC7A 3WALA 1V5OA 2DENB 1K8RB 1ISNA 3OJ3A 4K7WA 4A20A 3CMMB 1ZW7A 2IO2B 3HM3A 4MH0E 2MRPA 1WI0A 2BGFA 2NCNA 4ANUA 3K9PB 2AL6A 2REXA 4ZRJA 2KD0A 1WE7A 2C7MB 4JGHB 3AULA 3LDZE 3PS6A 2C9WB 5CHFA 3PREA 2KTRA 3H7PA 2NBUA 4K7SA 4BKSA 3KVFB 2L8JA 4JIOU 3ZDMC 2IBIB 3UIPB 2O2VB 2LZ6A 2UWQA 2KKCA 3ZNZB 2KLGA 3ZLZA 1V86A 4K7UA 3KH0A 2PE6B 1E7UA 2KMAA 4CYEA 1OEYA 3KW5B 1WZ3A 2A4ZA 5G2NA 2MLBA 3ZRCA 2FCNA 4IC7B 2NS5A 2JPHA 2NBVB 1WM2A 4J6IA 5LXHA 4B6WA 1WYWB 1WM3A 3L08A 2FCMA 1E5WA 2WX1A 4JLCA 3L16A 1R4MI 4KZ0A 2PEAA 4F7ZA 3P2BA 4W9DA 4K1RB 4KSLC 5C1ZA 2KMCA 3RUIB 3QJZA 4FULA 4NAWA 4NAWB 4I6LB 4KVGB 4GIVA 2FUHB 2FAZA 1OEYJ 3DBLI 4MGZE 3UINB 2K8HA 2ZPYA 3W1SC 2KDBA 4NQLB 4FADA 4XZ4A 4TQ0A 3ZW3A 2ZVNA 4FJYA 3DVNU 3WANA 3IHPC 2NPTB 2KJ6A 2KVRA 5J17A 2AWTA 3ZTDA 1Z2MA 1LQBA 2DZKA 3V6EB 3X0WA 2FCSA 2KDIA 3DBHI 2IO3B 3M63B 2CHWA 4JL9A 4PYUA 2K1FA 5L95C 2XK5B 1WXAA 4WWOA 1Q1OA 2RD0A 1D3ZA 3B08A 5J18A 2MBEA 4IWPA 1SIFA 2LRUA 3EFUA 3KUDB 2JVCA 4HXDA 2K8BA 4MGIE 4PS3A 2MBHA 5CHWA 3W1SA 3ZVVA 1F9JA 4M8MA 1MG8A 1J19A 3IFWB 2BWES 4BBNC 2M1MA 4NJ6A 2BF8B 2KZRA 3AU5A 1NBFC 1WMHB 4GGQA 2LGXA 4EZLA 2DYMA 1P9DU 2L7RA 2OOBB 3N32A 3QK0A 4FN2A 3RULA 2WDTB 4ZYNA 3B0AA 4WQOB 4ICUA 3ZTCA 1V9JA 3APCA 3GOEA 3U30A 3PVLA 4JQWC 3T8MA 1PQSA 2ZPNA 3ZRFA 2G4SA 2Z0DB 5AZHA 3WA0A 4EUTA 2C5LC 1WFYA 2WYQA 3SU8X 4OVUA 1YD8U 4IWOA 1WXVA 5C23A 5JZEB 1YIWA 1A5RA 2LVPA 3AU4A 2ZCBA 2KTRB 1ZKHA 3H7PB 4MELA 2CKHB 2D3GA 4MGYE 1GNUA 2ZCCA 4GSWA 2N9XA 2KWCA 3TMPB 3N3KB 3JYUA 1H8CA 2IY0B 4ZRKA 2LRWA 3KYCD 1EF1A 4B95A 5D2MB 4RMAA 2KO3A 3EHVA 3U7DA 2J0JA 4TUUA 2MQJA 1IYFA 4FA6A 1YX6B 2L0FA 1WX7A 2JRIB 1C1YB 1OTRB 5AEKB 2M0XA 3SDLC 3APDA 2J0MA 4DHZB 2HD5B 3L17A 2AEHA 2D07B 1WGYA 1WR1A 4TQ1A 4OVVA 3RYTA 3DOWA 4MGKE 5DPWA 3MTNB 4W9HA 4G11A 4DHJD 2NVUI 1WJUA 5EDSA 4LDTB 4F1SA 1TZ1A 2LGDA 4ICVA 1UBQA 5DPTA 3PPAA 5DPSA 5AZGA 1WGHA 1XD3B 1TBEA 3K9OB 4XX5A 2QHOA 5HKHA 2DHZA 1Z5SB 2C7HA 2EMSA 2LASA 2LGYA 2N1WA 5E6OA 2GBNA 1LXDA 1WF9A 2BYEA 2M8SA 2G4DB 2R2OA 3ECIA 3L0WB 3APFA 1GC6A 3PLVA 4HWIB 1UZXB 1I42A 2VRRB 4BKTA 2KTFA 3A1QA 4X57B 2FNJB 2OJRA 3JSVB 3X23A 3H1UA 4M0WB 3NZSA 4PS8A 1KLVA 1WXSA 4IWQA 4BKGA 3H6NA 1RFAA 4KDIC 5CTRC 5CX3A 2BPSA 3KUZA 2O6VA 4G3XB 4HCPB 4DHJB 2N1VA 4M8NA 4DBGA 2LXAA 1WJ6A 1E7VA 2J0KA 2B3AA 4EEWA 3HK0A 2MA9B 3DBRI 2N4FA 3DBSA 1XT9B 3QWZB 2KDFB 1GG3A 3QA8A 3PRZA 1UELA 1IP9A 3DVGY 3DPDA 2MBQA 2XBBC 2YVCA 3ML9A 3BY4B 3QAQA 3A4RA 4GB9A 1J0GA 1WRDB 2KX0A 3CSFA 2DYOA 2KANA 2Z0EB 3ZKJC 4AP4C 3R3MA 3QIJA 3TBLD 4KDLB 4WJNA 4E3CA 1T0YA 2ASQA 2DX5B 2M17A 2ZZPB 3L13A 4AJWA 2KFKA 2A5UA 5L83A 5G55A 1P3QU 5JHAA 2LD9A 4PYZA 4W9CA 4TV3A 4E74A 3PLUA 2KC1A 2BKFA 3DCGA 3ZIMA 4IG7B 4DWFA 3M3JA 4HCNB 2ZEQA 1RAXA 3BINA 4BVUC 1I35A 2PE9A 1KJTA 1L2NA 3UGBB 3A9KA 2KQ7A 2L05A 4WWPA 2AL3A 5JHBA 3ZDTA 1KM7A 4RM9A 4TKNA 5GMVA 3S2AA 1V81A 3VTVA 4HK2A 2K25A 3N30A 2M4NA 1KOTA 3V61A 4W9KA 2K6DB 4W9EA 3VUWA 1WIAA 3PTFC 1UD7A 2KQSA 2HE7A 4LJOB 3UF8A 1R4NI 1ZGUB 2KOXA 3LJ3A 5TR5A 2O2VA 1WE6A 3PRMB 4DDID 3PSEB 3VTWA 1E8YA 4BKSD 2KWUB 2KC2A 1WZ0A 4G0NB 2MWSB 2RPQA 4GDLB 4MM3A 4WJPA 4EFOA 2IYDB 3EECA 4DK5A 2BYVE 4CHKA 2DYBA 2ZVOA
chains in the Genus database with same CATH superfamily
1CZPA 1S1QB 2SAKA 3H8HA 3UIOB 3I9V1 2JYEA 3ALBA 1E8XA 4II2B 3SHQA 1Q10A 3L54A 1C77A 4IUMB 4O1NA 5JXVA 3BYTB 3W9CB 2KJHB 1KLUD 3MC0B 3NZ3A 4XWTA 3DVGX 5BYRA 4URKA 4F8CB 4KV2A 2ZNVC 5FR3A 1QOAA 4RGOS 3TIXA 4HDOA 4AQ7A 2RPVA 4WAFA 2KXJA 1YOVB 5T8IA 1QZEA 2GOWA 1Y8RC 4HPMB 3L10B 1FD6A 4WIPA 2MSED 5E6JA 1V6EA 1AYFA 1VZ6A 3LB8C 1WX9A 3VHTC 4Q2JA 3NG0A 1WSPA 1PGXA 4US9A 2QJLA 4NQKE 1UBIA 3DVNV 2I1KA 2I38A 2D3BA 5BMIA 1VZ7A 1WR6E 1AW7A 1P7EA 2QMTA 2KJRA 2W3RA 4A55A 2BYFA 2I1JA 2KLCA 1P7FA 1SE4A 1OQYA 4TSSA 2PJHA 3C8YA 3RT3B 3TSSA 1BUIC 2L0TA 3ENEA 4FJVB 2D11A 4ASWC 2DZMA 3I57A 3LYYA 2INNE 2MBBB 5JH5C 2BS4B 4W9IA 1FXTB 3MJ5A 1KF6B 3M95A 2WS3B 2IGGA 2LXCA 1GJZA 4L1BA 1PUTA 1X1MA 2QC8A 2WXHA 1RLFA 2ZW1A 2M56B 5LXIB 3FKYA 1KLGD 3P42A 1LFDA 3QCAA 1V2YA 4GXBA 3RNGC 4DXAB 5BO4B 3PHXB 2V1YA 3SEBA 1YQ3B 3GS2A 1FXIA 2EKIA 2PLPA 4WQMA 3W5VB 3MHSD 1WYGA 2LFIA 3AECB 2FIFA 3BK2A 2ZJDA 4JE3B 1IBXA 4NPNA 2BKRB 1ZXIA 1SF0A 4USAA 3U2SC 2O6VD 4IM3A 3DBHB 2QDFA 1CK1A 1WGRA 1NVID 3RNFC 1YX5B 1VZ8A 1EF5A 2G3QB 3DHGC 1PDXA 2QCZA 1QILA 3OJ4B 2FIDA 1EO6A 3GZNI 4KSKC 1JROA 4IM0A 1FFUA 3VUXA 1VCBA 3TEZA 3VQIA 4XWWA 3H9DA 4ZRIA 1Q0WB 3HUIA 3QC8B 2C7NB 2IGDA 3ZNID 5D7GA 1J7AA 2YLMA 1WGGA 3QARA 2INCC 3AI5A 2KHWB 5EE3A 2Z59B 2J52A 4FLHA 2Z8LA 4WWNA 1SE3A 2XEWA 4LJPB 1DYQA 2WX0A 1UGMA 3KUCB 2IJ0A 1HE8A 3WALA 1K8RB 2WXLA 4K7WA 2IO2B 2RMMA 3MFGA 4BZAA 4ZRJA 1WE7A 3Q8CA 3ZDMC 2LGSA 2IBIB 2O2VB 2LZ6A 3ZNZB 2KLGA 1ZPSA 1FNVA 1V86A 3KH0A 3BIID 3NS1A 2A4ZA 3ZRCA 1KTKA 2NBVB 5LXHA 3DHHC 1WYWB 3P63A 1D6EC 3L16A 1T6BX 2PEAA 2WGSA 2XN9C 3DBRB 1EU3A 2KMCA 4NAWA 2K9XA 1Y56A 4P1CC 1PYWD 4I6LB 3DBLI 3W1SC 3AMZA 4FJYA 2IDYA 2KVRA 1L0VB 2DZKA 2W3SA 3X0WA 4TMAB 2KACA 2KDIA 1MPEA 1J7CA 4OHJA 4M00A 2K1FA 2M19A 4NZLB 2LHDA 4WWOA 1Q1OA 2RD0A 3B08A 4IWPA 2BTEA 3KUDB 2K8BA 2JYTA 5CHWA 3LXFA 1I4RA 3I63C 2BWES 2M1MA 4NJ6A 2KZRA 4GGQA 2OOBB 4FN2A 4JWSC 4ZYNA 4WQOB 3APCA 4KGRA 3T8MA 3ZRFA 3WA0A 2C5LC 4KGSA 4ACFA 2WXMA 4N58A 1TIFA 3RN9C 2KAJA 1YD8U 2LUMA 1WXVA 2GI9A 2E6XA 4ZHOA 1A5RA 3BVMA 1GB4A 4MGYE 2ZCCA 1WRIA 3N3KB 1HXYD 1EF1A 5D2MB 4TUUA 1YX6B 2L0FA 2M0XA 3RNEC 4TQ1A 4OVVA 3DOWA 4XDDA 1UF0A 3AE6B 5LNK1 3GE8C 4DHJD 2NTSA 4LDTB 5DPSA 5AZGA 1XD3B 1QF6A 2R2OA 3APFA 1I42A 1UZXB 4OW0A 3GB1A 2BW2A 3X23A 1WXSA 3AV8A 3V3XA 3MHZA 5CX3A 4IDIA 1N63A 1BMLC 4DHJB 3E56A 1E7VA 1EU4A 2X8XX 2MA9B 2ONQA 4KKIA 1XT9B 4HPPA 1IP9A 1YJJA 2CJOA 1FCCC 3DPDA 3V05A 3TUOA 1J0GA 4PT5A 1TJEA 4AP4C 3AM9A 4LK0M 2M17A 3L13A 2OHFA 1EM7A 2KFKA 1M4VA 3ZQ4A 2A5UA 4W9CA 1WGKA 2KC1A 1SBBB 2BKFA 3ZIMA 4HCNB 2ZEQA 3BINA 1I35A 5EE9A 3KWLA 3A9KA 2KQ7A 3BVGA 2GRIA 4P16A 4RM9A 2KYWA 2BS2B 2WXPA 3VTVA 4HK2A 2K25A 2JSVX 2DNFA 1KOTA 4W9KA 2KQSA 2PVGC 3AH7A 1ZGUB 2INDC 3PRMB 2HDEA 1E8YA 2FBWB 1YNTE 1MG4A 1HZ5A 4GDLB 2IYDB 2LMCA 4CHKA 2UWQA 2ZVOA 2DZIA 3RFZB 1I4HA 4I6PA 4FBJB 2K3UA 5GXGB 1E90A 3ZO5B 1ZOYB 3BYYB 2KMMA 3A4SC 4ARIA 1PFDA 4XYCA 1NENB 3B1LX 5TSSA 2MP2A 1FPYA 5D6JB 1MVKA 3ZUNA 2G45B 1I7HA 5BMHA 4MSMB 3HRDD 3QX1A 1UH6A 1YJ1A 1XCQL 3PRPB 2KX3A 1FO4A 4WJOA 3DDCB 5KHQA 1G6JA 2QIEB 1JCKB 3D32A 2KN5A 3KYDD 3RMKC 4RM8A 3L4PA 2KDMA 3AEBB 4EKUA 2JY6A 2K39A 2VH1A 1TY0A 1OGWA 3RCZA 3TCAA 1AARA 4A3OA 4MACA 1WY8A 2FCQA 3V62A 3OG5A 4OZAA 1XEEA 1ENFA 1TTNA 3IBEA 2ICIA 2MX2A 3VXWA 3UQAA 2OJWA 3T9LA 1RRBA 2WDVB 4B0MA 2JWUA 1UGJA 1F52A 2EMTA 2NR2A 2WWZA 4KGTA 4DDGD 2N7EA 3VR8B 1TKYA 3BK1A 4KKJA 4KIKA 2JUOA 3ML8A 4N9F4 4K3CA 2NMQA 3AE7B 4AUQC 3VR9B 1UUPA 1NI2A 3NOBA 4BOSC 4XC2A 4P6VF 3H7SA 2VZKB 4HKQA 1YMHE 3C0RB 1GB1A 1V49A 1ACCA 4LCDE 4M0WA 1WH3A 4BOZB 3RZWC 2NBWB 1BT0A 2PW9A 1GUAB 1DOYA 2WXRA 1K50A 4G50A 3A33B 1QOGA 3VFKA 3TL5A 3VVWB 2KQ4X 3ONSA 1E7PB 1QOBA 4DHZE 1A70A 2RR9A 3WAMA 1JALA 1WGDA 3SFDB 2AQ1B 2UYZB 1QQRA 1TKEA 1L7YA 3PZDA 1L4ZB 3PV1A 1UNSA 3TJPA 2DAJA 4DXGA 2GBKA 3HHMA 3VAWA 3PO0A 1UWMA 2XK5A 4NAMA 1FXAA 4HPLB 2IO0B 2MHJA 4FHKA 2V4LA 1WX8A 3AE4B 3PT2B 3NHEB 3FC4A 4MEMA 1CQVA 3RPFC 3P4QB 2PPHA 5IAAC 3WAPA 2K8CA 1EUVB 2KK8A 1WMHA 1PGAA 2BBCA 3QQ8B 3T3OA 2V3SA 1K53A 2WXQA 1V5OA 2DENB 4LNFA 3AEAB 3OJ3A 1T5XD 2MRPA 2KT7A 2C7MB 4JGHB 3LDZE 2C9WB 3PREA 2KTRA 1JQ4A 4BKSA 3KVFB 3NVVA 2WQYB 1TKGA 3EGRA 2NTTA 3AE3B 4CYEA 3KW5B 1WZ3A 4RF0A 5MPOA 1IBXB 2MLBA 2JQRB 1XLPA 4B6WA 3ZJVA 5FK9C 3L08A 2FCMA 1E5WA 1EWCA 1E10A 1R4MI 2RDBC 1N61A 4KZ0A 4F7ZA 3P2BA 4K1RB 4KSLC 5C1ZA 1T3QA 3RUIB 5EE0A 2W54A 1HTQA 1TZOA 4KVGB 1IUEA 2FAZA 1JWBD 3ZYYX 1XLQA 3BVZA 3AEEB 2KJ6A 5J17A 1ZXHA 1Z2MA 3V6EB 2FCSA 1GOZA 4PYUA 4PK1A 1WXAA 1EWYC 2PMVA 1D3ZA 4LNNA 1SIFA 3ABVB 2JVCA 4LLGM 4S0RA 3W1SA 4M8MA 4HKZE 3RNAC 1PGBA 4UDUC 1MG8A 3IFWB 4OZCA 1AN8A 2L7RA 3QK0A 3RULA 3B0AA 4ICUA 3W5UB 3PVLA 4JQWC 4BAXA 2H88B 3AEGB 1V1PA 1FNWA 4OVZA 5JZEB 4LNOA 4MELA 2CKHB 2GB1A 4J3OD 3JYUA 1H8CA 2LRWA 3KYCD 3U7DA 3SR6A 2V0GA 1WX7A 3NVYA 3APDA 2N0SB 2HD5B 1YN5A 1TS4A 2L32A 4MGKE 2QILA 2WLBA 5EDSA 5HI1A 1MHXA 2LGDA 4ICVA 1UBQA 1ET9A 5HKHA 1SB3C 2DHZA 1FIQA 2XNAC 2C7HA 5IN7A 2LGYA 4YTPB 2GBNA 1WF9A 3PLVA 2PKOA 4NAWB 3ECIA 2L52A 3A1QA 4X57B 4R3DA 3JSVB 3H1UA 4PS8A 4IWQA 4BKGA 3H6NA 5CTRC 2D3AA 2BPSA 1L0YB 2O6VA 4HCPB 2N1VA 4ZOHC 3VRAB 1WJ6A 2J0KA 1VDVA 4DQOC 3AB5A 3KQ4A 2K0PA 3HK0A 5H8YE 2N4FA 2KDFB 1GG3A 3IXSA 3AEDB 3QA8A 3DVGY 4GB9A 3QAQA 3A4RA 3CSFA 2DYOA 2Z0EB 3QIJA 2DX5B 4AJWA 1C9FA 2WNMA 1JW9D 4PYZA 1NYRA 3PLUA 3DCGA 1F2RC 3P4PB 4S17A 3KLSX 1KJTA 1L2NA 2AL3A 5JHBA 1C79A 4YSZB 1FCLA 5GMVA 1V81A 2BB6A 3V61A 2K6DB 4W9EA 4WH4A 1WWTA 2HE7A 3LJ3A 5TR5A 2O2VA 1NI3A 4ZHPA 3EUB2 3VTWA 4REZA 2KC2A 4G0NB 1TS3A 4MM3A 4WJPA 4B0EA 2BYVE 4M01A 2RDHA 2DYBA 4XX5A 4AS1A 1QLBB 1SGHA 5IKCM 2ZW0A 4N6EB 1TY2A 2LGIA 3NY5A 4OZBA 4LDTD 1S3SG 3CF6E 5E6NA 2IY1B 5KHOA 2EELA 1WJNA 3R7RA 4IOIE 2JWZA 2WXJA 3HIZA 2N9LA 3N1XC 4E71A 1V97A 3IG3A 3GZNB 2KFJA 4WAAA 3UI3A 2N9PC 3DWMA 1RM6C 3Q3JA 1L6VA 5J2RA 1N62A 1C76A 2LWPA 3VDZA 1YQBA 2BWFA 2GBJA 2WXGA 2KWVB 4K3BA 1C4CA 4GOCA 1P98A 5CHVC 5AUKA 4EE2A 2RGFA 2CHXA 1YQ4B 1XQQA 3IT4B 2JRHA 2LI5A 3Q6BA 4HEA1 1RYJA 2GBMA 3QHTA 4EOYA 2MCNB 4ZDVA 4MJSA 3A9KB 1WXMA 2QEJC 3P1MA 1FEHA 1SEBD 1JRPA 3U8ZA 4GDKA 2PTLA 1GAQB 1T0RC 1SSNA 2IGHA 1DOIA 2W9NA 4FXCA 5IA7A 4WWMA 1JWAD 5DCNA 2CHZA 1I4PA 3A9JA 3AE8B 4JPSA 2JZ3B 4NY0A 4IM2A 4US8A 2LVQA 3IAM1 4ANWA 4GU2A 3UQBA 1E0ZA 3DQVA 2PIAA 3URYA 1OQQA 1OQRA 3HVZA 1WJ4A 4LNKA 1KH0A 4FHJA 4C80A 2MP2B 2BB5A 2CS4A 3W2DA 1STEA 5H92C 3U7ZA 5D94A 4KX6B 1IGCA 4FJZA 1FNUA 1ZP0B 2E3TA 3DBLB 1H4RA 1T0SC 4HLEA 2C60A 2IPKD 3R66C 4YSXB 2LJ5A 3VTUA 4IW0A 4HJGE 1TS2A 4HDQA 1LM8B 2KNBA 1C78A 4KZCA 2GBRA 4EZJA 3R7QA 2CU3A 2EKEC 2LUEA 2Y5PA 4W9JA 3OAWA 2K5PA 2JXTA 2I2YA 2D10A 3V60A 3AEFB 2LHEA 4K81A 2LJIA 1SJHD 2NPTA 2ZNVB 1KFYB 1N5XA 1TS5A 4A8XC 3R8BA 4RCOA 2DAFA 1ET6A 5FKAC 2L00B 3SFEB 5C2TB 1NDDA 1ZDXA 2N9KA 4HVBA 3VH3B 2HJ1A 1RWSA 4ANXA 5BYSA 4ZRQA 3CSTA 4A3PA 3MJWA 4AOFA 4GDLA 4KIKB 4XE0A 3O65B 2JZZA 3B2FA 4GN1A 5HG2A 1GC7A 3FILA 2MJDA 1ISNA 3CMMB 1ZW7A 3HM3A 4MH0E 1HA5A 1HZ6A 4C7ZA 3K9PB 4C4VA 2KD0A 3PS6A 1MHHE 3H7PA 2NBUA 2V3NA 4K7SA 4JIOU 3R2IA 1MJDA 1F2RI 2VZKD 2UU7A 2KKCA 2Y3AA 4HROA 5I4DA 2PE6B 3T3NA 2KMAA 3Q3OC 5G2NA 2WU2B 2FCNA 3TEYA 2NS5A 2JPHA 3NVWA 4C00A 4CQNA 1XXGA 1YN3A 1OFFA 4XGAB 3ZXRA 2WX1A 1QOFA 4YTNB 4M02A 4W9DA 4FULA 4GIVA 2FUHB 2K8HA 1MI0A 2ZPYA 2JX5A 2KDBA 4NQLB 4FADA 2L1AA 4XZ4A 3ZW3A 2ZVNA 3DVNU 1FM0D 3GE3C 4RNAA 2AWTA 3ZTDA 1LQBA 3DBHI 3M63B 2CHWA 4JL9A 2MJ3A 1N6ZA 2XK5B 2MBEA 2LRUA 3Q14C 4HXDA 1ZE3D 4A90A 2MBHA 2MEKA 2WDRB 3N9YC 1F9JA 3RI7C 1L0XB 1JMLA 3IAS1 2BF8B 1ZDVA 1WMHB 4EZLA 1C4PA 1D4BA 2DYMA 3N32A 2WDTB 2OEDA 2GLSA 3AE9B 3VRBB 3ZTCA 3GOEA 1PQSA 2G4SA 4EUTA 2CJNA 4HRSA 2WYQA 4IWOA 5C23A 2LVPA 3AU4A 2KTRB 1ZKHA 4GSWA 2KWCA 1RFKA 4L2YA 4B95A 4RMAA 3EHVA 1IYFA 2MQJA 4FA6A 1OTRB 1AWDA 3SDLC 3L17A 2AEHA 1WR1A 3C19A 3RYTA 1T0QC 5DPWA 1L6UA 4G11A 1WJUA 3AE1B 5DPTA 3E9SA 3IT6B 2QHOA 4N59A 1R7SA 2EMSA 2LASA 4GLSC 3L0WB 2BYEA 2M8SA 2W82A 4RH6A 4HWIB 1K51A 2VRRB 4BKTA 2VH2A 1FRRA 4RF1A 1JWUD 3NZSA 1KLVA 3MC9A 1RFAA 4KDIC 1BXTA 3RNCC 3B2GA 3KUZA 4G3XB 2DLBA 4M8NA 4DBGA 3RNBC 2LXAA 3MP9A 2RDGA 3ZJTA 2B3AA 4EEWA 3DHIC 2D5GA 3DBRI 3QWZB 4YT0B 3PRZA 1UELA 2ACZB 3NRZA 5G5GA 2XBBC 2YVCA 3ML9A 3BY4B 2KWDA 2KX0A 2KANA 3R3MA 4IKGA 3TBLD 4WJNA 4E3CA 1T0YA 2ASQA 2V9HA 2ZZPB 2K22A 2WXIA 2MH7A 1P3QU 5JHAA 2LD9A 4TV3A 5G5HA 3Q3MC 4ITKA 2INPE 4E74A 2WDQB 4DWFA 4IG7B 1B9RA 1RAXA 1SIJA 2PE9A 1SE2A 1XLOA 3ZDTA 1KM7A 1V1PB 3O13A 3S2AA 1ESFA 3HVDA 3N30A 3EA6A 3OWEB 3VUWA 1GPXA 1ZUD2 2V3PA 3PTFC 3ZXVA 1UD7A 1R4NI 1YN4A 2WU5B 2KOXA 1XCTL 2X38A 3PSEB 2J4XA 2KWUB 1CJEA 1WZ0A 2RPQA 4EFOA 3NUHB 3EECA 4DK5A 4LNIA 1E8ZA 3SD5A 1J8CA 4ANVA 3FAHA 3KWVA 3JVZX 1P1AA 3I3TB 2JZPA 3U52E 2Y5BB 4HJKA 1F0ZA 1D5ZC 1KRHA 3A1QB 4GMVA 2IZVB 2PVOD 3PHWB 4A6QA 2B76B 3NS8A 4D2KA 2O6VB 2JT4B 1JRUA 2KDEB 1V80A 2HJ8A 3VH4B 3N20C 3Q3FA 1NEKB 1VLBA 3M62B 1VJKA 5E6PA 2TSSA 3BWUD 2K6QA 4NNJB 4MSQB 2N7DA 2JF5A 4AJYB 2D2QA 3IVFA 1U4AA 4NJ7A 1FFVA 5FR6A 3BZDB 3WCQA 3CIRB 4II3B 2H89B 1V8CA 1M94A 2GMIC 1L4DB 2MBOA 1C4AA 2WP9B 1K52A 3RD2A 5LLIA 1I4QA 2DBYA 3ZNHB 3VUYA 2CR5A 1XLNA 3OLMD 4W9LA 4NJCA 4YL8A 2DWQA 1Q5WB 2N9EB 3P4SB 2IO1B 2WXKA 4MM3B 4YXDB 3Q8AA 4I6NB 4L23A 5HHDG 1HEZE 2BT6A 5DPRA 3TEXA 4WURA 2AQ3B 3HM6X 5BYQA 1TGZB 1J7BA 4P7IA 2J7QB 1FRDA 2L3ZA 1N5WA 1CMXB 2FUG1 1R4MB 3JSVA 1IPGA 3ETRA 2G1EA 5IP4D 4BBNF 1C3TA 2LVOA 2AYOB 3PGEA 2HTHA 3NZUA 3WIMA 3R2TA 4QAYA 4CO7A 4MDKE 3AXCA 3ZNGC 3PZ8A 1P0RA 3EC8A 2N7JA 5C3JB 2L83A 3JW0X 3N1ZC 4PS7A 2MW5A 1VD2A 2W55A 1R4NB 5AZFA 1SE9A 2AX5A 1L5PA 4AWJA 1I4GA 1F77A 2V4IB 2WXFA 2BYTA 4BFRA 3MC8A 4EZKA 2BQQA 2KN4A 3V6CB 4MJSB 4W9FA 5BMGA 1IGDA 1MFWA 1V1OA 4WJQA 4RFBA 1WXQA 2BVCA 2R2QA 3PZ7A 1E8WA 2D3CA 4XDCA 3WAOA 4GDKB 2DZJA 2JXXA 2KVZA 5D3IB 2L76A 3RZFA 3W1YA 1V5TA 3A9JB 2CU1A 4RGMA 2Q5WD 2KFKB 4B9KA 4W9GA 4RGNA 4A9AA 1TYGB 4DXFA 2RSUA 2WHIA 4A20A 1QT9A 1B1ZA 3ZGZA 1WI0A 2BGFA 2NCNA 4RGTA 4ANUA 2AL6A 2REXA 2G9HD 1D5MC 5CHFA 3AULA 3U4EG 1VRAB 2L8JA 3UIPB 2R61A 1JWMD 4YWGG 1YJIA 3ZLZA 4K7UA 1E7UA 2WXOA 1OEYA 1NYQA 2J42A 4IC7B 3Q8FA 3GP7A 4J6IA 1WM2A 3CWIA 3AE5B 1WM3A 1ROEA 4JLCA 1TT5B 2SEBD 3QJZA 4YTMB 3NJTA 1OEYJ 4MGZE 3UINB 5IOIA 4TQ0A 2M0AA 3WANA 3EFCA 3IHPC 2NPTB 4MH8A 3AN1A 1UWXA 2IO3B 3Q8BA 5L95C 5AUIA 3ZJUA 2J53A 5J18A 3EFUA 3N1YC 5IO9A 3AE2B 4MGIE 3B9JA 4PS3A 3J9CA 3ZVVA 1E6EB 1J19A 3DWGC 4BBNC 3AU5A 1NBFC 2LGXA 1HTOA 1P9DU 1HQRD 5EE1A 3FILB 5D3DA 2JU6X 1D5XC 1V9JA 3U30A 2ZPNA 5AZHA 2Z0DB 1WFYA 2Y5CA 3SU8X 4OVUA 4C4VB 4ZRPA 1YIWA 1N60A 2ZCBA 3H7PB 2HTME 1SXTA 2D3GA 1GNUA 2N9XA 3TMPB 2IY0B 4ZRKA 2FE8A 3Q8EA 1XO3A 4P1BC 2KO3A 2J0JA 3NVZA 2BS3B 2JRIB 1C1YB 5AEKB 3Q3NC 2J0MA 4DHZB 3TEWA 1VR9A 2D07B 1WGYA 1LO5D 4C7YA 3MTNB 4W9HA 2LEKA 3Q2AC 2NVUI 4F1SA 1TZ1A 3PPAA 1WGHA 1TBEA 1SJED 3K9OB 4JWUC 1Z5SB 2N1WA 5E6OA 1E9MA 1LXDA 2G4DB 1GC6A 4MT5A 2KTFA 2FNJB 2OJRA 4M0WB 1DOXA 2YEPF 2MJEA 2YEPB 1F1HA 4LTUA 3DBSA 2QSDA 4H2AA 1JWSD 5HFYA 2MBQA 1WRDB 3ZKJC 4JX1C 1LGRA 1FMAD 4KDLB 5L83A 5G55A 4ARCA 4C56C 4ZYSA 2ON8A 1QKZA 3M3JA 4BVUC 3UGBB 2L05A 4WWPA 1XF5L 4TKNA 2M4NA 2AQ2B 1WIAA 4LJOB 3UF8A 2WXNA 1WE6A 3Q69A 4DDID 4YSYB 4BKSD 2MWSB 3I5JC 1DGJA 1I4XA 3P4RB
chains in the Genus database with same CATH topology
2DZIA 1E8ZA 3SD5A 1J8CA 4ANVA 1S1QB 4I6PA 1SGHA 3JVZX 1P1AA 4FBJB 3ZO5B 1E90A 3UIOB 3NY5A 3A4SC 3ALBA 1E8XA 4II2B 4LDTD 3SHQA 1S3SG 3I3TB 3CF6E 3L54A 5E6NA 2IY1B 3B1LX 4IUMB 5KHOA 2Y5BB 2MP2A 4HJKA 2KJHB 1WJNA 3A1QB 3R7RA 4GMVA 5D6JB 3ZUNA 2G45B 2JWZA 3HIZA 4MSMB 3DVGX 3QX1A 4URKA 1UH6A 2IZVB 1YJ1A 3PHWB 3NS8A 3PRPB 4E71A 3IG3A 4F8CB 2KFJA 4KV2A 2O6VB 2KX3A 2JT4B 2ZNVC 4WJOA 3DDCB 5KHQA 1JRUA 4WAAA 2KDEB 1G6JA 3TIXA 3D32A 2KN5A 1V80A 2N9PC 3KYDD 2HJ8A 4HDOA 3VH4B 3Q3JA 4RM8A 3Q3FA 2KXJA 5J2RA 3M62B 2LWPA 1QZEA 3VDZA 2GOWA 5E6PA 1YQBA 2BWFA 2K6QA 1Y8RC 4NNJB 2GBJA 4HPMB 3L10B 2JY6A 4EKUA 4MSQB 2KWVB 2MSED 2N7DA 5CHVC 4GOCA 1P98A 2JF5A 1V6EA 2RGFA 2CHXA 2K39A 1XQQA 3RCZA 1OGWA 1WX9A 3VHTC 4AJYB 3TCAA 2D2QA 1AARA 2JRHA 4A3OA 3IVFA 1U4AA 1WY8A 2LI5A 2FCQA 4NJ7A 3V62A 4NQKE 1UBIA 2GBMA 3DVNV 3QHTA 2I1KA 4EOYA 5FR6A 2MCNB 4ZDVA 4MJSA 1TTNA 3A9KB 4II3B 1WXMA 1WR6E 3IBEA 1M94A 2GMIC 2MX2A 3VXWA 3UQAA 2KJRA 2MBOA 3T9LA 1RRBA 3RD2A 2BYFA 2I1JA 5LLIA 2KLCA 3U8ZA 4GDKA 3ZNHB 3VUYA 2CR5A 3OLMD 1OQYA 2EMTA 2NR2A 2PJHA 2WWZA 4W9LA 5IA7A 2W9NA 3RT3B 4DDGD 2N7EA 4YL8A 2L0TA 5DCNA 3ENEA 2CHZA 3A9JA 4FJVB 2D11A 1Q5WB 2DZMA 4ASWC 2N9EB 2JZ3B 4KIKA 2IO1B 4NY0A 2JUOA 4IM2A 2MBBB 4I6NB 5JH5C 3ML8A 2LVQA 4N9F4 4W9IA 4ANWA 1FXTB 5DPRA 4GU2A 3M95A 3UQBA 2LXCA 1GJZA 1X1MA 3DQVA 3HM6X 1RLFA 4AUQC 1NI2A 3NOBA 5LXIB 4BOSC 1TGZB 4XC2A 1WJ4A 4P7IA 2J7QB 3H7SA 2L3ZA 3QCAA 1LFDA 1V2YA 1CMXB 3C0RB 4GXBA 4DXAB 4FHJA 5BO4B 3PHXB 1V49A 2V1YA 3JSVA 2MP2B 4LCDE 1IPGA 2CS4A 4BBNF 1C3TA 5D94A 2LVOA 4FJZA 2AYOB 3MHSD 1WH3A 3PGEA 4BOZB 1H4RA 2FIFA 2ZJDA 2HTHA 4HLEA 3NZUA 4NPNA 3RZWC 3WIMA 2C60A 2BKRB 4CO7A 2NBWB 3R66C 1BT0A 2LJ5A 1GUAB 4MDKE 3VTUA 4IW0A 3AXCA 3ZNGC 2O6VD 4G50A 4HDQA 4IM3A 3A33B 1P0RA 3EC8A 1WGRA 3VFKA 3TL5A 3VVWB 1LM8B 2KNBA 3ONSA 3JW0X 4KZCA 1YX5B 4PS7A 2GBRA 1EF5A 2G3QB 2MW5A 1VD2A 4EZJA 3R7QA 4DHZE 2EKEC 2LUEA 5AZFA 4W9JA 3OAWA 1SE9A 3OJ4B 2FIDA 1EO6A 2D10A 3GZNI 4KSKC 3V60A 4AWJA 2RR9A 3WAMA 4IM0A 1WGDA 4K81A 4BFRA 2NPTA 2UYZB 4EZKA 2ZNVB 1L7YA 3PZDA 3VUXA 1VCBA 3PV1A 3V6CB 3VQIA 3H9DA 4ZRIA 3TJPA 4MJSB 1Q0WB 2DAJA 4W9FA 2GBKA 4WJQA 2DAFA 3HHMA 3QC8B 3VAWA 2C7NB 3ZNID 2L00B 2XK5A 5D7GA 1NDDA 4HPLB 2IO0B 2R2QA 4FHKA 2V4LA 1WX8A 3PT2B 4HVBA 1E8WA 2YLMA 1WGGA 3QARA 3VH3B 3WAOA 3NHEB 4GDKB 3AI5A 4MEMA 2KHWB 2DZJA 2JXXA 2L76A 2Z59B 4ANXA 2PPHA 5IAAC 3WAPA 4FLHA 3CSTA 3RZFA 4A3PA 3MJWA 1V5TA 3A9JB 2K8CA 4WWNA 3W1YA 4AOFA 4GDLA 2CU1A 1EUVB 2XEWA 2KK8A 4LJPB 2KFKB 1WMHA 4KIKB 4B9KA 2WX0A 4W9GA 3O65B 2JZZA 3QQ8B 1UGMA 3KUCB 2V3SA 4GN1A 2RSUA 1HE8A 1GC7A 3WALA 1V5OA 2DENB 1K8RB 1ISNA 3OJ3A 4K7WA 4A20A 3CMMB 1ZW7A 2IO2B 3HM3A 4MH0E 2MRPA 1WI0A 2BGFA 2NCNA 4ANUA 3K9PB 2AL6A 2REXA 4ZRJA 2KD0A 1WE7A 2C7MB 4JGHB 3AULA 3LDZE 3PS6A 2C9WB 5CHFA 3PREA 2KTRA 3H7PA 2NBUA 4K7SA 4BKSA 3KVFB 2L8JA 4JIOU 3ZDMC 2IBIB 3UIPB 2O2VB 2LZ6A 2UWQA 2KKCA 3ZNZB 2KLGA 3ZLZA 1V86A 4K7UA 3KH0A 2PE6B 1E7UA 2KMAA 4CYEA 1OEYA 3KW5B 1WZ3A 2A4ZA 5G2NA 2MLBA 3ZRCA 2FCNA 4IC7B 2NS5A 2JPHA 2NBVB 1WM2A 4J6IA 5LXHA 4B6WA 1WYWB 1WM3A 3L08A 2FCMA 1E5WA 2WX1A 4JLCA 3L16A 1R4MI 4KZ0A 2PEAA 4F7ZA 3P2BA 4W9DA 4K1RB 4KSLC 5C1ZA 2KMCA 3RUIB 3QJZA 4FULA 4NAWA 4NAWB 4I6LB 4KVGB 4GIVA 2FUHB 2FAZA 1OEYJ 3DBLI 4MGZE 3UINB 2K8HA 2ZPYA 3W1SC 2KDBA 4NQLB 4FADA 4XZ4A 4TQ0A 3ZW3A 2ZVNA 4FJYA 3DVNU 3WANA 3IHPC 2NPTB 2KJ6A 2KVRA 5J17A 2AWTA 3ZTDA 1Z2MA 1LQBA 2DZKA 3V6EB 3X0WA 2FCSA 2KDIA 3DBHI 2IO3B 3M63B 2CHWA 4JL9A 4PYUA 2K1FA 5L95C 2XK5B 1WXAA 4WWOA 1Q1OA 2RD0A 1D3ZA 3B08A 5J18A 2MBEA 4IWPA 1SIFA 2LRUA 3EFUA 3KUDB 2JVCA 4HXDA 2K8BA 4MGIE 4PS3A 2MBHA 5CHWA 3W1SA 3ZVVA 1F9JA 4M8MA 1MG8A 1J19A 3IFWB 2BWES 4BBNC 2M1MA 4NJ6A 2BF8B 2KZRA 3AU5A 1NBFC 1WMHB 4GGQA 2LGXA 4EZLA 2DYMA 1P9DU 2L7RA 2OOBB 3N32A 3QK0A 4FN2A 3RULA 2WDTB 4ZYNA 3B0AA 4WQOB 4ICUA 3ZTCA 1V9JA 3APCA 3GOEA 3U30A 3PVLA 4JQWC 3T8MA 1PQSA 2ZPNA 3ZRFA 2G4SA 2Z0DB 5AZHA 3WA0A 4EUTA 2C5LC 1WFYA 2WYQA 3SU8X 4OVUA 1YD8U 4IWOA 1WXVA 5C23A 5JZEB 1YIWA 1A5RA 2LVPA 3AU4A 2ZCBA 2KTRB 1ZKHA 3H7PB 4MELA 2CKHB 2D3GA 4MGYE 1GNUA 2ZCCA 4GSWA 2N9XA 2KWCA 3TMPB 3N3KB 3JYUA 1H8CA 2IY0B 4ZRKA 2LRWA 3KYCD 1EF1A 4B95A 5D2MB 4RMAA 2KO3A 3EHVA 3U7DA 2J0JA 4TUUA 2MQJA 1IYFA 4FA6A 1YX6B 2L0FA 1WX7A 2JRIB 1C1YB 1OTRB 5AEKB 2M0XA 3SDLC 3APDA 2J0MA 4DHZB 2HD5B 3L17A 2AEHA 2D07B 1WGYA 1WR1A 4TQ1A 4OVVA 3RYTA 3DOWA 4MGKE 5DPWA 3MTNB 4W9HA 4G11A 4DHJD 2NVUI 1WJUA 5EDSA 4LDTB 4F1SA 1TZ1A 2LGDA 4ICVA 1UBQA 5DPTA 3PPAA 5DPSA 5AZGA 1WGHA 1XD3B 1TBEA 3K9OB 4XX5A 2QHOA 5HKHA 2DHZA 1Z5SB 2C7HA 2EMSA 2LASA 2LGYA 2N1WA 5E6OA 2GBNA 1LXDA 1WF9A 2BYEA 2M8SA 2G4DB 2R2OA 3ECIA 3L0WB 3APFA 1GC6A 3PLVA 4HWIB 1UZXB 1I42A 2VRRB 4BKTA 2KTFA 3A1QA 4X57B 2FNJB 2OJRA 3JSVB 3X23A 3H1UA 4M0WB 3NZSA 4PS8A 1KLVA 1WXSA 4IWQA 4BKGA 3H6NA 1RFAA 4KDIC 5CTRC 5CX3A 2BPSA 3KUZA 2O6VA 4G3XB 4HCPB 4DHJB 2N1VA 4M8NA 4DBGA 2LXAA 1WJ6A 1E7VA 2J0KA 2B3AA 4EEWA 3HK0A 2MA9B 3DBRI 2N4FA 3DBSA 1XT9B 3QWZB 2KDFB 1GG3A 3QA8A 3PRZA 1UELA 1IP9A 3DVGY 3DPDA 2MBQA 2XBBC 2YVCA 3ML9A 3BY4B 3QAQA 3A4RA 4GB9A 1J0GA 1WRDB 2KX0A 3CSFA 2DYOA 2KANA 2Z0EB 3ZKJC 4AP4C 3R3MA 3QIJA 3TBLD 4KDLB 4WJNA 4E3CA 1T0YA 2ASQA 2DX5B 2M17A 2ZZPB 3L13A 4AJWA 2KFKA 2A5UA 5L83A 5G55A 1P3QU 5JHAA 2LD9A 4PYZA 4W9CA 4TV3A 4E74A 3PLUA 2KC1A 2BKFA 3DCGA 3ZIMA 4IG7B 4DWFA 3M3JA 4HCNB 2ZEQA 1RAXA 3BINA 4BVUC 1I35A 2PE9A 1KJTA 1L2NA 3UGBB 3A9KA 2KQ7A 2L05A 4WWPA 2AL3A 5JHBA 3ZDTA 1KM7A 4RM9A 4TKNA 5GMVA 3S2AA 1V81A 3VTVA 4HK2A 2K25A 3N30A 2M4NA 1KOTA 3V61A 4W9KA 2K6DB 4W9EA 3VUWA 1WIAA 3PTFC 1UD7A 2KQSA 2HE7A 4LJOB 3UF8A 1R4NI 1ZGUB 2KOXA 3LJ3A 5TR5A 2O2VA 1WE6A 3PRMB 4DDID 3PSEB 3VTWA 1E8YA 4BKSD 2KWUB 2KC2A 1WZ0A 4G0NB 2MWSB 2RPQA 4GDLB 4MM3A 4WJPA 4EFOA 2IYDB 3EECA 4DK5A 2BYVE 4CHKA 2DYBA 2ZVOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DZI A;  1E8Z A;  3SD5 A;  1J8C A;  4ANV A;  1S1Q B;  4I6P A;  1SGH A;  3JVZ X;  1P1A A;  4FBJ B;  3ZO5 B;  1E90 A;  3UIO B;  3NY5 A;  3A4S C;  3ALB A;  1E8X A;  4II2 B;  4LDT D;  3SHQ A;  1S3S G;  3I3T B;  3CF6 E;  3L54 A;  5E6N A;  2IY1 B;  3B1L X;  4IUM B;  5KHO A;  2Y5B B;  2MP2 A;  4HJK A;  2KJH B;  1WJN A;  3A1Q B;  3R7R A;  4GMV A;  5D6J B;  3ZUN A;  2G45 B;  2JWZ A;  3HIZ A;  4MSM B;  3DVG X;  3QX1 A;  4URK A;  1UH6 A;  2IZV B;  1YJ1 A;  3PHW B;  3NS8 A;  3PRP B;  4E71 A;  3IG3 A;  4F8C B;  2KFJ A;  4KV2 A;  2O6V B;  2KX3 A;  2JT4 B;  2ZNV C;  4WJO A;  3DDC B;  5KHQ A;  1JRU A;  4WAA A;  2KDE B;  1G6J A;  3TIX A;  3D32 A;  2KN5 A;  1V80 A;  2N9P C;  3KYD D;  2HJ8 A;  4HDO A;  3VH4 B;  3Q3J A;  4RM8 A;  3Q3F A;  2KXJ A;  5J2R A;  3M62 B;  2LWP A;  1QZE A;  3VDZ A;  2GOW A;  5E6P A;  1YQB A;  2BWF A;  2K6Q A;  1Y8R C;  4NNJ B;  2GBJ A;  4HPM B;  3L10 B;  2JY6 A;  4EKU A;  4MSQ B;  2KWV B;  2MSE D;  2N7D A;  5CHV C;  4GOC A;  1P98 A;  2JF5 A;  1V6E A;  2RGF A;  2CHX A;  2K39 A;  1XQQ A;  3RCZ A;  1OGW A;  1WX9 A;  3VHT C;  4AJY B;  3TCA A;  2D2Q A;  1AAR A;  2JRH A;  4A3O A;  3IVF A;  1U4A A;  1WY8 A;  2LI5 A;  2FCQ A;  4NJ7 A;  3V62 A;  4NQK E;  1UBI A;  2GBM A;  3DVN V;  3QHT A;  2I1K A;  4EOY A;  5FR6 A;  2MCN B;  4ZDV A;  4MJS A;  1TTN A;  3A9K B;  4II3 B;  1WXM A;  1WR6 E;  3IBE A;  1M94 A;  2GMI C;  2MX2 A;  3VXW A;  3UQA A;  2KJR A;  2MBO A;  3T9L A;  1RRB A;  3RD2 A;  2BYF A;  2I1J A;  5LLI A;  2KLC A;  3U8Z A;  4GDK A;  3ZNH B;  3VUY A;  2CR5 A;  3OLM D;  1OQY A;  2EMT A;  2NR2 A;  2PJH A;  2WWZ A;  4W9L A;  5IA7 A;  2W9N A;  3RT3 B;  4DDG D;  2N7E A;  4YL8 A;  2L0T A;  5DCN A;  3ENE A;  2CHZ A;  3A9J A;  4FJV B;  2D11 A;  1Q5W B;  2DZM A;  4ASW C;  2N9E B;  2JZ3 B;  4KIK A;  2IO1 B;  4NY0 A;  2JUO A;  4IM2 A;  2MBB B;  4I6N B;  5JH5 C;  3ML8 A;  2LVQ A;  4N9F 4;  4W9I A;  4ANW A;  1FXT B;  5DPR A;  4GU2 A;  3M95 A;  3UQB A;  2LXC A;  1GJZ A;  1X1M A;  3DQV A;  3HM6 X;  1RLF A;  4AUQ C;  1NI2 A;  3NOB A;  5LXI B;  4BOS C;  1TGZ B;  4XC2 A;  1WJ4 A;  4P7I A;  2J7Q B;  3H7S A;  2L3Z A;  3QCA A;  1LFD A;  1V2Y A;  1CMX B;  3C0R B;  4GXB A;  4DXA B;  4FHJ A;  5BO4 B;  3PHX B;  1V49 A;  2V1Y A;  3JSV A;  2MP2 B;  4LCD E;  1IPG A;  2CS4 A;  4BBN F;  1C3T A;  5D94 A;  2LVO A;  4FJZ A;  2AYO B;  3MHS D;  1WH3 A;  3PGE A;  4BOZ B;  1H4R A;  2FIF A;  2ZJD A;  2HTH A;  4HLE A;  3NZU A;  4NPN A;  3RZW C;  3WIM A;  2C60 A;  2BKR B;  4CO7 A;  2NBW B;  3R66 C;  1BT0 A;  2LJ5 A;  1GUA B;  4MDK E;  3VTU A;  4IW0 A;  3AXC A;  3ZNG C;  2O6V D;  4G50 A;  4HDQ A;  4IM3 A;  3A33 B;  1P0R A;  3EC8 A;  1WGR A;  3VFK A;  3TL5 A;  3VVW B;  1LM8 B;  2KNB A;  3ONS A;  3JW0 X;  4KZC A;  1YX5 B;  4PS7 A;  2GBR A;  1EF5 A;  2G3Q B;  2MW5 A;  1VD2 A;  4EZJ A;  3R7Q A;  4DHZ E;  2EKE C;  2LUE A;  5AZF A;  4W9J A;  3OAW A;  1SE9 A;  3OJ4 B;  2FID A;  1EO6 A;  2D10 A;  3GZN I;  4KSK C;  3V60 A;  4AWJ A;  2RR9 A;  3WAM A;  4IM0 A;  1WGD A;  4K81 A;  4BFR A;  2NPT A;  2UYZ B;  4EZK A;  2ZNV B;  1L7Y A;  3PZD A;  3VUX A;  1VCB A;  3PV1 A;  3V6C B;  3VQI A;  3H9D A;  4ZRI A;  3TJP A;  4MJS B;  1Q0W B;  2DAJ A;  4W9F A;  2GBK A;  4WJQ A;  2DAF A;  3HHM A;  3QC8 B;  3VAW A;  2C7N B;  3ZNI D;  2L00 B;  2XK5 A;  5D7G A;  1NDD A;  4HPL B;  2IO0 B;  2R2Q A;  4FHK A;  2V4L A;  1WX8 A;  3PT2 B;  4HVB A;  1E8W A;  2YLM A;  1WGG A;  3QAR A;  3VH3 B;  3WAO A;  3NHE B;  4GDK B;  3AI5 A;  4MEM A;  2KHW B;  2DZJ A;  2JXX A;  2L76 A;  2Z59 B;  4ANX A;  2PPH A;  5IAA C;  3WAP A;  4FLH A;  3CST A;  3RZF A;  4A3P A;  3MJW A;  1V5T A;  3A9J B;  2K8C A;  4WWN A;  3W1Y A;  4AOF A;  4GDL A;  2CU1 A;  1EUV B;  2XEW A;  2KK8 A;  4LJP B;  2KFK B;  1WMH A;  4KIK B;  4B9K A;  2WX0 A;  4W9G A;  3O65 B;  2JZZ A;  3QQ8 B;  1UGM A;  3KUC B;  2V3S A;  4GN1 A;  2RSU A;  1HE8 A;  1GC7 A;  3WAL A;  1V5O A;  2DEN B;  1K8R B;  1ISN A;  3OJ3 A;  4K7W A;  4A20 A;  3CMM B;  1ZW7 A;  2IO2 B;  3HM3 A;  4MH0 E;  2MRP A;  1WI0 A;  2BGF A;  2NCN A;  4ANU A;  3K9P B;  2AL6 A;  2REX A;  4ZRJ A;  2KD0 A;  1WE7 A;  2C7M B;  4JGH B;  3AUL A;  3LDZ E;  3PS6 A;  2C9W B;  5CHF A;  3PRE A;  2KTR A;  3H7P A;  2NBU A;  4K7S A;  4BKS A;  3KVF B;  2L8J A;  4JIO U;  3ZDM C;  2IBI B;  3UIP B;  2O2V B;  2LZ6 A;  2UWQ A;  2KKC A;  3ZNZ B;  2KLG A;  3ZLZ A;  1V86 A;  4K7U A;  3KH0 A;  2PE6 B;  1E7U A;  2KMA A;  4CYE A;  1OEY A;  3KW5 B;  1WZ3 A;  2A4Z A;  5G2N A;  2MLB A;  3ZRC A;  2FCN A;  4IC7 B;  2NS5 A;  2JPH A;  2NBV B;  1WM2 A;  4J6I A;  5LXH A;  4B6W A;  1WYW B;  1WM3 A;  3L08 A;  2FCM A;  1E5W A;  2WX1 A;  4JLC A;  3L16 A;  1R4M I;  4KZ0 A;  2PEA A;  4F7Z A;  3P2B A;  4W9D A;  4K1R B;  4KSL C;  5C1Z A;  2KMC A;  3RUI B;  3QJZ A;  4FUL A;  4NAW A;  4NAW B;  4I6L B;  4KVG B;  4GIV A;  2FUH B;  2FAZ A;  1OEY J;  3DBL I;  4MGZ E;  3UIN B;  2K8H A;  2ZPY A;  3W1S C;  2KDB A;  4NQL B;  4FAD A;  4XZ4 A;  4TQ0 A;  3ZW3 A;  2ZVN A;  4FJY A;  3DVN U;  3WAN A;  3IHP C;  2NPT B;  2KJ6 A;  2KVR A;  5J17 A;  2AWT A;  3ZTD A;  1Z2M A;  1LQB A;  2DZK A;  3V6E B;  3X0W A;  2FCS A;  2KDI A;  3DBH I;  2IO3 B;  3M63 B;  2CHW A;  4JL9 A;  4PYU A;  2K1F A;  5L95 C;  2XK5 B;  1WXA A;  4WWO A;  1Q1O A;  2RD0 A;  1D3Z A;  3B08 A;  5J18 A;  2MBE A;  4IWP A;  1SIF A;  2LRU A;  3EFU A;  3KUD B;  2JVC A;  4HXD A;  2K8B A;  4MGI E;  4PS3 A;  2MBH A;  5CHW A;  3W1S A;  3ZVV A;  1F9J A;  4M8M A;  1MG8 A;  1J19 A;  3IFW B;  2BWE S;  4BBN C;  2M1M A;  4NJ6 A;  2BF8 B;  2KZR A;  3AU5 A;  1NBF C;  1WMH B;  4GGQ A;  2LGX A;  4EZL A;  2DYM A;  1P9D U;  2L7R A;  2OOB B;  3N32 A;  3QK0 A;  4FN2 A;  3RUL A;  2WDT B;  4ZYN A;  3B0A A;  4WQO B;  4ICU A;  3ZTC A;  1V9J A;  3APC A;  3GOE A;  3U30 A;  3PVL A;  4JQW C;  3T8M A;  1PQS A;  2ZPN A;  3ZRF A;  2G4S A;  2Z0D B;  5AZH A;  3WA0 A;  4EUT A;  2C5L C;  1WFY A;  2WYQ A;  3SU8 X;  4OVU A;  1YD8 U;  4IWO A;  1WXV A;  5C23 A;  5JZE B;  1YIW A;  1A5R A;  2LVP A;  3AU4 A;  2ZCB A;  2KTR B;  1ZKH A;  3H7P B;  4MEL A;  2CKH B;  2D3G A;  4MGY E;  1GNU A;  2ZCC A;  4GSW A;  2N9X A;  2KWC A;  3TMP B;  3N3K B;  3JYU A;  1H8C A;  2IY0 B;  4ZRK A;  2LRW A;  3KYC D;  1EF1 A;  4B95 A;  5D2M B;  4RMA A;  2KO3 A;  3EHV A;  3U7D A;  2J0J A;  4TUU A;  2MQJ A;  1IYF A;  4FA6 A;  1YX6 B;  2L0F A;  1WX7 A;  2JRI B;  1C1Y B;  1OTR B;  5AEK B;  2M0X A;  3SDL C;  3APD A;  2J0M A;  4DHZ B;  2HD5 B;  3L17 A;  2AEH A;  2D07 B;  1WGY A;  1WR1 A;  4TQ1 A;  4OVV A;  3RYT A;  3DOW A;  4MGK E;  5DPW A;  3MTN B;  4W9H A;  4G11 A;  4DHJ D;  2NVU I;  1WJU A;  5EDS A;  4LDT B;  4F1S A;  1TZ1 A;  2LGD A;  4ICV A;  1UBQ A;  5DPT A;  3PPA A;  5DPS A;  5AZG A;  1WGH A;  1XD3 B;  1TBE A;  3K9O B;  4XX5 A;  2QHO A;  5HKH A;  2DHZ A;  1Z5S B;  2C7H A;  2EMS A;  2LAS A;  2LGY A;  2N1W A;  5E6O A;  2GBN A;  1LXD A;  1WF9 A;  2BYE A;  2M8S A;  2G4D B;  2R2O A;  3ECI A;  3L0W B;  3APF A;  1GC6 A;  3PLV A;  4HWI B;  1UZX B;  1I42 A;  2VRR B;  4BKT A;  2KTF A;  3A1Q A;  4X57 B;  2FNJ B;  2OJR A;  3JSV B;  3X23 A;  3H1U A;  4M0W B;  3NZS A;  4PS8 A;  1KLV A;  1WXS A;  4IWQ A;  4BKG A;  3H6N A;  1RFA A;  4KDI C;  5CTR C;  5CX3 A;  2BPS A;  3KUZ A;  2O6V A;  4G3X B;  4HCP B;  4DHJ B;  2N1V A;  4M8N A;  4DBG A;  2LXA A;  1WJ6 A;  1E7V A;  2J0K A;  2B3A A;  4EEW A;  3HK0 A;  2MA9 B;  3DBR I;  2N4F A;  3DBS A;  1XT9 B;  3QWZ B;  2KDF B;  1GG3 A;  3QA8 A;  3PRZ A;  1UEL A;  1IP9 A;  3DVG Y;  3DPD A;  2MBQ A;  2XBB C;  2YVC A;  3ML9 A;  3BY4 B;  3QAQ A;  3A4R A;  4GB9 A;  1J0G A;  1WRD B;  2KX0 A;  3CSF A;  2DYO A;  2KAN A;  2Z0E B;  3ZKJ C;  4AP4 C;  3R3M A;  3QIJ A;  3TBL D;  4KDL B;  4WJN A;  4E3C A;  1T0Y A;  2ASQ A;  2DX5 B;  2M17 A;  2ZZP B;  3L13 A;  4AJW A;  2KFK A;  2A5U A;  5L83 A;  5G55 A;  1P3Q U;  5JHA A;  2LD9 A;  4PYZ A;  4W9C A;  4TV3 A;  4E74 A;  3PLU A;  2KC1 A;  2BKF A;  3DCG A;  3ZIM A;  4IG7 B;  4DWF A;  3M3J A;  4HCN B;  2ZEQ A;  1RAX A;  3BIN A;  4BVU C;  1I35 A;  2PE9 A;  1KJT A;  1L2N A;  3UGB B;  3A9K A;  2KQ7 A;  2L05 A;  4WWP A;  2AL3 A;  5JHB A;  3ZDT A;  1KM7 A;  4RM9 A;  4TKN A;  5GMV A;  3S2A A;  1V81 A;  3VTV A;  4HK2 A;  2K25 A;  3N30 A;  2M4N A;  1KOT A;  3V61 A;  4W9K A;  2K6D B;  4W9E A;  3VUW A;  1WIA A;  3PTF C;  1UD7 A;  2KQS A;  2HE7 A;  4LJO B;  3UF8 A;  1R4N I;  1ZGU B;  2KOX A;  3LJ3 A;  5TR5 A;  2O2V A;  1WE6 A;  3PRM B;  4DDI D;  3PSE B;  3VTW A;  1E8Y A;  4BKS D;  2KWU B;  2KC2 A;  1WZ0 A;  4G0N B;  2MWS B;  2RPQ A;  4GDL B;  4MM3 A;  4WJP A;  4EFO A;  2IYD B;  3EEC A;  4DK5 A;  2BYV E;  4CHK A;  2DYB A;  2ZVO A; 
#chains in the Genus database with same CATH topology
 1CZP A;  1S1Q B;  2SAK A;  3H8H A;  3UIO B;  3I9V 1;  2JYE A;  3ALB A;  1E8X A;  4II2 B;  3SHQ A;  1Q10 A;  3L54 A;  1C77 A;  4IUM B;  4O1N A;  5JXV A;  3BYT B;  3W9C B;  2KJH B;  1KLU D;  3MC0 B;  3NZ3 A;  4XWT A;  3DVG X;  5BYR A;  4URK A;  4F8C B;  4KV2 A;  2ZNV C;  5FR3 A;  1QOA A;  4RGO S;  3TIX A;  4HDO A;  4AQ7 A;  2RPV A;  4WAF A;  2KXJ A;  1YOV B;  5T8I A;  1QZE A;  2GOW A;  1Y8R C;  4HPM B;  3L10 B;  1FD6 A;  4WIP A;  2MSE D;  5E6J A;  1V6E A;  1AYF A;  1VZ6 A;  3LB8 C;  1WX9 A;  3VHT C;  4Q2J A;  3NG0 A;  1WSP A;  1PGX A;  4US9 A;  2QJL A;  4NQK E;  1UBI A;  3DVN V;  2I1K A;  2I38 A;  2D3B A;  5BMI A;  1VZ7 A;  1WR6 E;  1AW7 A;  1P7E A;  2QMT A;  2KJR A;  2W3R A;  4A55 A;  2BYF A;  2I1J A;  2KLC A;  1P7F A;  1SE4 A;  1OQY A;  4TSS A;  2PJH A;  3C8Y A;  3RT3 B;  3TSS A;  1BUI C;  2L0T A;  3ENE A;  4FJV B;  2D11 A;  4ASW C;  2DZM A;  3I57 A;  3LYY A;  2INN E;  2MBB B;  5JH5 C;  2BS4 B;  4W9I A;  1FXT B;  3MJ5 A;  1KF6 B;  3M95 A;  2WS3 B;  2IGG A;  2LXC A;  1GJZ A;  4L1B A;  1PUT A;  1X1M A;  2QC8 A;  2WXH A;  1RLF A;  2ZW1 A;  2M56 B;  5LXI B;  3FKY A;  1KLG D;  3P42 A;  1LFD A;  3QCA A;  1V2Y A;  4GXB A;  3RNG C;  4DXA B;  5BO4 B;  3PHX B;  2V1Y A;  3SEB A;  1YQ3 B;  3GS2 A;  1FXI A;  2EKI A;  2PLP A;  4WQM A;  3W5V B;  3MHS D;  1WYG A;  2LFI A;  3AEC B;  2FIF A;  3BK2 A;  2ZJD A;  4JE3 B;  1IBX A;  4NPN A;  2BKR B;  1ZXI A;  1SF0 A;  4USA A;  3U2S C;  2O6V D;  4IM3 A;  3DBH B;  2QDF A;  1CK1 A;  1WGR A;  1NVI D;  3RNF C;  1YX5 B;  1VZ8 A;  1EF5 A;  2G3Q B;  3DHG C;  1PDX A;  2QCZ A;  1QIL A;  3OJ4 B;  2FID A;  1EO6 A;  3GZN I;  4KSK C;  1JRO A;  4IM0 A;  1FFU A;  3VUX A;  1VCB A;  3TEZ A;  3VQI A;  4XWW A;  3H9D A;  4ZRI A;  1Q0W B;  3HUI A;  3QC8 B;  2C7N B;  2IGD A;  3ZNI D;  5D7G A;  1J7A A;  2YLM A;  1WGG A;  3QAR A;  2INC C;  3AI5 A;  2KHW B;  5EE3 A;  2Z59 B;  2J52 A;  4FLH A;  2Z8L A;  4WWN A;  1SE3 A;  2XEW A;  4LJP B;  1DYQ A;  2WX0 A;  1UGM A;  3KUC B;  2IJ0 A;  1HE8 A;  3WAL A;  1K8R B;  2WXL A;  4K7W A;  2IO2 B;  2RMM A;  3MFG A;  4BZA A;  4ZRJ A;  1WE7 A;  3Q8C A;  3ZDM C;  2LGS A;  2IBI B;  2O2V B;  2LZ6 A;  3ZNZ B;  2KLG A;  1ZPS A;  1FNV A;  1V86 A;  3KH0 A;  3BII D;  3NS1 A;  2A4Z A;  3ZRC A;  1KTK A;  2NBV B;  5LXH A;  3DHH C;  1WYW B;  3P63 A;  1D6E C;  3L16 A;  1T6B X;  2PEA A;  2WGS A;  2XN9 C;  3DBR B;  1EU3 A;  2KMC A;  4NAW A;  2K9X A;  1Y56 A;  4P1C C;  1PYW D;  4I6L B;  3DBL I;  3W1S C;  3AMZ A;  4FJY A;  2IDY A;  2KVR A;  1L0V B;  2DZK A;  2W3S A;  3X0W A;  4TMA B;  2KAC A;  2KDI A;  1MPE A;  1J7C A;  4OHJ A;  4M00 A;  2K1F A;  2M19 A;  4NZL B;  2LHD A;  4WWO A;  1Q1O A;  2RD0 A;  3B08 A;  4IWP A;  2BTE A;  3KUD B;  2K8B A;  2JYT A;  5CHW A;  3LXF A;  1I4R A;  3I63 C;  2BWE S;  2M1M A;  4NJ6 A;  2KZR A;  4GGQ A;  2OOB B;  4FN2 A;  4JWS C;  4ZYN A;  4WQO B;  3APC A;  4KGR A;  3T8M A;  3ZRF A;  3WA0 A;  2C5L C;  4KGS A;  4ACF A;  2WXM A;  4N58 A;  1TIF A;  3RN9 C;  2KAJ A;  1YD8 U;  2LUM A;  1WXV A;  2GI9 A;  2E6X A;  4ZHO A;  1A5R A;  3BVM A;  1GB4 A;  4MGY E;  2ZCC A;  1WRI A;  3N3K B;  1HXY D;  1EF1 A;  5D2M B;  4TUU A;  1YX6 B;  2L0F A;  2M0X A;  3RNE C;  4TQ1 A;  4OVV A;  3DOW A;  4XDD A;  1UF0 A;  3AE6 B;  5LNK 1;  3GE8 C;  4DHJ D;  2NTS A;  4LDT B;  5DPS A;  5AZG A;  1XD3 B;  1QF6 A;  2R2O A;  3APF A;  1I42 A;  1UZX B;  4OW0 A;  3GB1 A;  2BW2 A;  3X23 A;  1WXS A;  3AV8 A;  3V3X A;  3MHZ A;  5CX3 A;  4IDI A;  1N63 A;  1BML C;  4DHJ B;  3E56 A;  1E7V A;  1EU4 A;  2X8X X;  2MA9 B;  2ONQ A;  4KKI A;  1XT9 B;  4HPP A;  1IP9 A;  1YJJ A;  2CJO A;  1FCC C;  3DPD A;  3V05 A;  3TUO A;  1J0G A;  4PT5 A;  1TJE A;  4AP4 C;  3AM9 A;  4LK0 M;  2M17 A;  3L13 A;  2OHF A;  1EM7 A;  2KFK A;  1M4V A;  3ZQ4 A;  2A5U A;  4W9C A;  1WGK A;  2KC1 A;  1SBB B;  2BKF A;  3ZIM A;  4HCN B;  2ZEQ A;  3BIN A;  1I35 A;  5EE9 A;  3KWL A;  3A9K A;  2KQ7 A;  3BVG A;  2GRI A;  4P16 A;  4RM9 A;  2KYW A;  2BS2 B;  2WXP A;  3VTV A;  4HK2 A;  2K25 A;  2JSV X;  2DNF A;  1KOT A;  4W9K A;  2KQS A;  2PVG C;  3AH7 A;  1ZGU B;  2IND C;  3PRM B;  2HDE A;  1E8Y A;  2FBW B;  1YNT E;  1MG4 A;  1HZ5 A;  4GDL B;  2IYD B;  2LMC A;  4CHK A;  2UWQ A;  2ZVO A;  2DZI A;  3RFZ B;  1I4H A;  4I6P A;  4FBJ B;  2K3U A;  5GXG B;  1E90 A;  3ZO5 B;  1ZOY B;  3BYY B;  2KMM A;  3A4S C;  4ARI A;  1PFD A;  4XYC A;  1NEN B;  3B1L X;  5TSS A;  2MP2 A;  1FPY A;  5D6J B;  1MVK A;  3ZUN A;  2G45 B;  1I7H A;  5BMH A;  4MSM B;  3HRD D;  3QX1 A;  1UH6 A;  1YJ1 A;  1XCQ L;  3PRP B;  2KX3 A;  1FO4 A;  4WJO A;  3DDC B;  5KHQ A;  1G6J A;  2QIE B;  1JCK B;  3D32 A;  2KN5 A;  3KYD D;  3RMK C;  4RM8 A;  3L4P A;  2KDM A;  3AEB B;  4EKU A;  2JY6 A;  2K39 A;  2VH1 A;  1TY0 A;  1OGW A;  3RCZ A;  3TCA A;  1AAR A;  4A3O A;  4MAC A;  1WY8 A;  2FCQ A;  3V62 A;  3OG5 A;  4OZA A;  1XEE A;  1ENF A;  1TTN A;  3IBE A;  2ICI A;  2MX2 A;  3VXW A;  3UQA A;  2OJW A;  3T9L A;  1RRB A;  2WDV B;  4B0M A;  2JWU A;  1UGJ A;  1F52 A;  2EMT A;  2NR2 A;  2WWZ A;  4KGT A;  4DDG D;  2N7E A;  3VR8 B;  1TKY A;  3BK1 A;  4KKJ A;  4KIK A;  2JUO A;  3ML8 A;  4N9F 4;  4K3C A;  2NMQ A;  3AE7 B;  4AUQ C;  3VR9 B;  1UUP A;  1NI2 A;  3NOB A;  4BOS C;  4XC2 A;  4P6V F;  3H7S A;  2VZK B;  4HKQ A;  1YMH E;  3C0R B;  1GB1 A;  1V49 A;  1ACC A;  4LCD E;  4M0W A;  1WH3 A;  4BOZ B;  3RZW C;  2NBW B;  1BT0 A;  2PW9 A;  1GUA B;  1DOY A;  2WXR A;  1K50 A;  4G50 A;  3A33 B;  1QOG A;  3VFK A;  3TL5 A;  3VVW B;  2KQ4 X;  3ONS A;  1E7P B;  1QOB A;  4DHZ E;  1A70 A;  2RR9 A;  3WAM A;  1JAL A;  1WGD A;  3SFD B;  2AQ1 B;  2UYZ B;  1QQR A;  1TKE A;  1L7Y A;  3PZD A;  1L4Z B;  3PV1 A;  1UNS A;  3TJP A;  2DAJ A;  4DXG A;  2GBK A;  3HHM A;  3VAW A;  3PO0 A;  1UWM A;  2XK5 A;  4NAM A;  1FXA A;  4HPL B;  2IO0 B;  2MHJ A;  4FHK A;  2V4L A;  1WX8 A;  3AE4 B;  3PT2 B;  3NHE B;  3FC4 A;  4MEM A;  1CQV A;  3RPF C;  3P4Q B;  2PPH A;  5IAA C;  3WAP A;  2K8C A;  1EUV B;  2KK8 A;  1WMH A;  1PGA A;  2BBC A;  3QQ8 B;  3T3O A;  2V3S A;  1K53 A;  2WXQ A;  1V5O A;  2DEN B;  4LNF A;  3AEA B;  3OJ3 A;  1T5X D;  2MRP A;  2KT7 A;  2C7M B;  4JGH B;  3LDZ E;  2C9W B;  3PRE A;  2KTR A;  1JQ4 A;  4BKS A;  3KVF B;  3NVV A;  2WQY B;  1TKG A;  3EGR A;  2NTT A;  3AE3 B;  4CYE A;  3KW5 B;  1WZ3 A;  4RF0 A;  5MPO A;  1IBX B;  2MLB A;  2JQR B;  1XLP A;  4B6W A;  3ZJV A;  5FK9 C;  3L08 A;  2FCM A;  1E5W A;  1EWC A;  1E10 A;  1R4M I;  2RDB C;  1N61 A;  4KZ0 A;  4F7Z A;  3P2B A;  4K1R B;  4KSL C;  5C1Z A;  1T3Q A;  3RUI B;  5EE0 A;  2W54 A;  1HTQ A;  1TZO A;  4KVG B;  1IUE A;  2FAZ A;  1JWB D;  3ZYY X;  1XLQ A;  3BVZ A;  3AEE B;  2KJ6 A;  5J17 A;  1ZXH A;  1Z2M A;  3V6E B;  2FCS A;  1GOZ A;  4PYU A;  4PK1 A;  1WXA A;  1EWY C;  2PMV A;  1D3Z A;  4LNN A;  1SIF A;  3ABV B;  2JVC A;  4LLG M;  4S0R A;  3W1S A;  4M8M A;  4HKZ E;  3RNA C;  1PGB A;  4UDU C;  1MG8 A;  3IFW B;  4OZC A;  1AN8 A;  2L7R A;  3QK0 A;  3RUL A;  3B0A A;  4ICU A;  3W5U B;  3PVL A;  4JQW C;  4BAX A;  2H88 B;  3AEG B;  1V1P A;  1FNW A;  4OVZ A;  5JZE B;  4LNO A;  4MEL A;  2CKH B;  2GB1 A;  4J3O D;  3JYU A;  1H8C A;  2LRW A;  3KYC D;  3U7D A;  3SR6 A;  2V0G A;  1WX7 A;  3NVY A;  3APD A;  2N0S B;  2HD5 B;  1YN5 A;  1TS4 A;  2L32 A;  4MGK E;  2QIL A;  2WLB A;  5EDS A;  5HI1 A;  1MHX A;  2LGD A;  4ICV A;  1UBQ A;  1ET9 A;  5HKH A;  1SB3 C;  2DHZ A;  1FIQ A;  2XNA C;  2C7H A;  5IN7 A;  2LGY A;  4YTP B;  2GBN A;  1WF9 A;  3PLV A;  2PKO A;  4NAW B;  3ECI A;  2L52 A;  3A1Q A;  4X57 B;  4R3D A;  3JSV B;  3H1U A;  4PS8 A;  4IWQ A;  4BKG A;  3H6N A;  5CTR C;  2D3A A;  2BPS A;  1L0Y B;  2O6V A;  4HCP B;  2N1V A;  4ZOH C;  3VRA B;  1WJ6 A;  2J0K A;  1VDV A;  4DQO C;  3AB5 A;  3KQ4 A;  2K0P A;  3HK0 A;  5H8Y E;  2N4F A;  2KDF B;  1GG3 A;  3IXS A;  3AED B;  3QA8 A;  3DVG Y;  4GB9 A;  3QAQ A;  3A4R A;  3CSF A;  2DYO A;  2Z0E B;  3QIJ A;  2DX5 B;  4AJW A;  1C9F A;  2WNM A;  1JW9 D;  4PYZ A;  1NYR A;  3PLU A;  3DCG A;  1F2R C;  3P4P B;  4S17 A;  3KLS X;  1KJT A;  1L2N A;  2AL3 A;  5JHB A;  1C79 A;  4YSZ B;  1FCL A;  5GMV A;  1V81 A;  2BB6 A;  3V61 A;  2K6D B;  4W9E A;  4WH4 A;  1WWT A;  2HE7 A;  3LJ3 A;  5TR5 A;  2O2V A;  1NI3 A;  4ZHP A;  3EUB 2;  3VTW A;  4REZ A;  2KC2 A;  4G0N B;  1TS3 A;  4MM3 A;  4WJP A;  4B0E A;  2BYV E;  4M01 A;  2RDH A;  2DYB A;  4XX5 A;  4AS1 A;  1QLB B;  1SGH A;  5IKC M;  2ZW0 A;  4N6E B;  1TY2 A;  2LGI A;  3NY5 A;  4OZB A;  4LDT D;  1S3S G;  3CF6 E;  5E6N A;  2IY1 B;  5KHO A;  2EEL A;  1WJN A;  3R7R A;  4IOI E;  2JWZ A;  2WXJ A;  3HIZ A;  2N9L A;  3N1X C;  4E71 A;  1V97 A;  3IG3 A;  3GZN B;  2KFJ A;  4WAA A;  3UI3 A;  2N9P C;  3DWM A;  1RM6 C;  3Q3J A;  1L6V A;  5J2R A;  1N62 A;  1C76 A;  2LWP A;  3VDZ A;  1YQB A;  2BWF A;  2GBJ A;  2WXG A;  2KWV B;  4K3B A;  1C4C A;  4GOC A;  1P98 A;  5CHV C;  5AUK A;  4EE2 A;  2RGF A;  2CHX A;  1YQ4 B;  1XQQ A;  3IT4 B;  2JRH A;  2LI5 A;  3Q6B A;  4HEA 1;  1RYJ A;  2GBM A;  3QHT A;  4EOY A;  2MCN B;  4ZDV A;  4MJS A;  3A9K B;  1WXM A;  2QEJ C;  3P1M A;  1FEH A;  1SEB D;  1JRP A;  3U8Z A;  4GDK A;  2PTL A;  1GAQ B;  1T0R C;  1SSN A;  2IGH A;  1DOI A;  2W9N A;  4FXC A;  5IA7 A;  4WWM A;  1JWA D;  5DCN A;  2CHZ A;  1I4P A;  3A9J A;  3AE8 B;  4JPS A;  2JZ3 B;  4NY0 A;  4IM2 A;  4US8 A;  2LVQ A;  3IAM 1;  4ANW A;  4GU2 A;  3UQB A;  1E0Z A;  3DQV A;  2PIA A;  3URY A;  1OQQ A;  1OQR A;  3HVZ A;  1WJ4 A;  4LNK A;  1KH0 A;  4FHJ A;  4C80 A;  2MP2 B;  2BB5 A;  2CS4 A;  3W2D A;  1STE A;  5H92 C;  3U7Z A;  5D94 A;  4KX6 B;  1IGC A;  4FJZ A;  1FNU A;  1ZP0 B;  2E3T A;  3DBL B;  1H4R A;  1T0S C;  4HLE A;  2C60 A;  2IPK D;  3R66 C;  4YSX B;  2LJ5 A;  3VTU A;  4IW0 A;  4HJG E;  1TS2 A;  4HDQ A;  1LM8 B;  2KNB A;  1C78 A;  4KZC A;  2GBR A;  4EZJ A;  3R7Q A;  2CU3 A;  2EKE C;  2LUE A;  2Y5P A;  4W9J A;  3OAW A;  2K5P A;  2JXT A;  2I2Y A;  2D10 A;  3V60 A;  3AEF B;  2LHE A;  4K81 A;  2LJI A;  1SJH D;  2NPT A;  2ZNV B;  1KFY B;  1N5X A;  1TS5 A;  4A8X C;  3R8B A;  4RCO A;  2DAF A;  1ET6 A;  5FKA C;  2L00 B;  3SFE B;  5C2T B;  1NDD A;  1ZDX A;  2N9K A;  4HVB A;  3VH3 B;  2HJ1 A;  1RWS A;  4ANX A;  5BYS A;  4ZRQ A;  3CST A;  4A3P A;  3MJW A;  4AOF A;  4GDL A;  4KIK B;  4XE0 A;  3O65 B;  2JZZ A;  3B2F A;  4GN1 A;  5HG2 A;  1GC7 A;  3FIL A;  2MJD A;  1ISN A;  3CMM B;  1ZW7 A;  3HM3 A;  4MH0 E;  1HA5 A;  1HZ6 A;  4C7Z A;  3K9P B;  4C4V A;  2KD0 A;  3PS6 A;  1MHH E;  3H7P A;  2NBU A;  2V3N A;  4K7S A;  4JIO U;  3R2I A;  1MJD A;  1F2R I;  2VZK D;  2UU7 A;  2KKC A;  2Y3A A;  4HRO A;  5I4D A;  2PE6 B;  3T3N A;  2KMA A;  3Q3O C;  5G2N A;  2WU2 B;  2FCN A;  3TEY A;  2NS5 A;  2JPH A;  3NVW A;  4C00 A;  4CQN A;  1XXG A;  1YN3 A;  1OFF A;  4XGA B;  3ZXR A;  2WX1 A;  1QOF A;  4YTN B;  4M02 A;  4W9D A;  4FUL A;  4GIV A;  2FUH B;  2K8H A;  1MI0 A;  2ZPY A;  2JX5 A;  2KDB A;  4NQL B;  4FAD A;  2L1A A;  4XZ4 A;  3ZW3 A;  2ZVN A;  3DVN U;  1FM0 D;  3GE3 C;  4RNA A;  2AWT A;  3ZTD A;  1LQB A;  3DBH I;  3M63 B;  2CHW A;  4JL9 A;  2MJ3 A;  1N6Z A;  2XK5 B;  2MBE A;  2LRU A;  3Q14 C;  4HXD A;  1ZE3 D;  4A90 A;  2MBH A;  2MEK A;  2WDR B;  3N9Y C;  1F9J A;  3RI7 C;  1L0X B;  1JML A;  3IAS 1;  2BF8 B;  1ZDV A;  1WMH B;  4EZL A;  1C4P A;  1D4B A;  2DYM A;  3N32 A;  2WDT B;  2OED A;  2GLS A;  3AE9 B;  3VRB B;  3ZTC A;  3GOE A;  1PQS A;  2G4S A;  4EUT A;  2CJN A;  4HRS A;  2WYQ A;  4IWO A;  5C23 A;  2LVP A;  3AU4 A;  2KTR B;  1ZKH A;  4GSW A;  2KWC A;  1RFK A;  4L2Y A;  4B95 A;  4RMA A;  3EHV A;  1IYF A;  2MQJ A;  4FA6 A;  1OTR B;  1AWD A;  3SDL C;  3L17 A;  2AEH A;  1WR1 A;  3C19 A;  3RYT A;  1T0Q C;  5DPW A;  1L6U A;  4G11 A;  1WJU A;  3AE1 B;  5DPT A;  3E9S A;  3IT6 B;  2QHO A;  4N59 A;  1R7S A;  2EMS A;  2LAS A;  4GLS C;  3L0W B;  2BYE A;  2M8S A;  2W82 A;  4RH6 A;  4HWI B;  1K51 A;  2VRR B;  4BKT A;  2VH2 A;  1FRR A;  4RF1 A;  1JWU D;  3NZS A;  1KLV A;  3MC9 A;  1RFA A;  4KDI C;  1BXT A;  3RNC C;  3B2G A;  3KUZ A;  4G3X B;  2DLB A;  4M8N A;  4DBG A;  3RNB C;  2LXA A;  3MP9 A;  2RDG A;  3ZJT A;  2B3A A;  4EEW A;  3DHI C;  2D5G A;  3DBR I;  3QWZ B;  4YT0 B;  3PRZ A;  1UEL A;  2ACZ B;  3NRZ A;  5G5G A;  2XBB C;  2YVC A;  3ML9 A;  3BY4 B;  2KWD A;  2KX0 A;  2KAN A;  3R3M A;  4IKG A;  3TBL D;  4WJN A;  4E3C A;  1T0Y A;  2ASQ A;  2V9H A;  2ZZP B;  2K22 A;  2WXI A;  2MH7 A;  1P3Q U;  5JHA A;  2LD9 A;  4TV3 A;  5G5H A;  3Q3M C;  4ITK A;  2INP E;  4E74 A;  2WDQ B;  4DWF A;  4IG7 B;  1B9R A;  1RAX A;  1SIJ A;  2PE9 A;  1SE2 A;  1XLO A;  3ZDT A;  1KM7 A;  1V1P B;  3O13 A;  3S2A A;  1ESF A;  3HVD A;  3N30 A;  3EA6 A;  3OWE B;  3VUW A;  1GPX A;  1ZUD 2;  2V3P A;  3PTF C;  3ZXV A;  1UD7 A;  1R4N I;  1YN4 A;  2WU5 B;  2KOX A;  1XCT L;  2X38 A;  3PSE B;  2J4X A;  2KWU B;  1CJE A;  1WZ0 A;  2RPQ A;  4EFO A;  3NUH B;  3EEC A;  4DK5 A;  4LNI A;  1E8Z A;  3SD5 A;  1J8C A;  4ANV A;  3FAH A;  3KWV A;  3JVZ X;  1P1A A;  3I3T B;  2JZP A;  3U52 E;  2Y5B B;  4HJK A;  1F0Z A;  1D5Z C;  1KRH A;  3A1Q B;  4GMV A;  2IZV B;  2PVO D;  3PHW B;  4A6Q A;  2B76 B;  3NS8 A;  4D2K A;  2O6V B;  2JT4 B;  1JRU A;  2KDE B;  1V80 A;  2HJ8 A;  3VH4 B;  3N20 C;  3Q3F A;  1NEK B;  1VLB A;  3M62 B;  1VJK A;  5E6P A;  2TSS A;  3BWU D;  2K6Q A;  4NNJ B;  4MSQ B;  2N7D A;  2JF5 A;  4AJY B;  2D2Q A;  3IVF A;  1U4A A;  4NJ7 A;  1FFV A;  5FR6 A;  3BZD B;  3WCQ A;  3CIR B;  4II3 B;  2H89 B;  1V8C A;  1M94 A;  2GMI C;  1L4D B;  2MBO A;  1C4A A;  2WP9 B;  1K52 A;  3RD2 A;  5LLI A;  1I4Q A;  2DBY A;  3ZNH B;  3VUY A;  2CR5 A;  1XLN A;  3OLM D;  4W9L A;  4NJC A;  4YL8 A;  2DWQ A;  1Q5W B;  2N9E B;  3P4S B;  2IO1 B;  2WXK A;  4MM3 B;  4YXD B;  3Q8A A;  4I6N B;  4L23 A;  5HHD G;  1HEZ E;  2BT6 A;  5DPR A;  3TEX A;  4WUR A;  2AQ3 B;  3HM6 X;  5BYQ A;  1TGZ B;  1J7B A;  4P7I A;  2J7Q B;  1FRD A;  2L3Z A;  1N5W A;  1CMX B;  2FUG 1;  1R4M B;  3JSV A;  1IPG A;  3ETR A;  2G1E A;  5IP4 D;  4BBN F;  1C3T A;  2LVO A;  2AYO B;  3PGE A;  2HTH A;  3NZU A;  3WIM A;  3R2T A;  4QAY A;  4CO7 A;  4MDK E;  3AXC A;  3ZNG C;  3PZ8 A;  1P0R A;  3EC8 A;  2N7J A;  5C3J B;  2L83 A;  3JW0 X;  3N1Z C;  4PS7 A;  2MW5 A;  1VD2 A;  2W55 A;  1R4N B;  5AZF A;  1SE9 A;  2AX5 A;  1L5P A;  4AWJ A;  1I4G A;  1F77 A;  2V4I B;  2WXF A;  2BYT A;  4BFR A;  3MC8 A;  4EZK A;  2BQQ A;  2KN4 A;  3V6C B;  4MJS B;  4W9F A;  5BMG A;  1IGD A;  1MFW A;  1V1O A;  4WJQ A;  4RFB A;  1WXQ A;  2BVC A;  2R2Q A;  3PZ7 A;  1E8W A;  2D3C A;  4XDC A;  3WAO A;  4GDK B;  2DZJ A;  2JXX A;  2KVZ A;  5D3I B;  2L76 A;  3RZF A;  3W1Y A;  1V5T A;  3A9J B;  2CU1 A;  4RGM A;  2Q5W D;  2KFK B;  4B9K A;  4W9G A;  4RGN A;  4A9A A;  1TYG B;  4DXF A;  2RSU A;  2WHI A;  4A20 A;  1QT9 A;  1B1Z A;  3ZGZ A;  1WI0 A;  2BGF A;  2NCN A;  4RGT A;  4ANU A;  2AL6 A;  2REX A;  2G9H D;  1D5M C;  5CHF A;  3AUL A;  3U4E G;  1VRA B;  2L8J A;  3UIP B;  2R61 A;  1JWM D;  4YWG G;  1YJI A;  3ZLZ A;  4K7U A;  1E7U A;  2WXO A;  1OEY A;  1NYQ A;  2J42 A;  4IC7 B;  3Q8F A;  3GP7 A;  4J6I A;  1WM2 A;  3CWI A;  3AE5 B;  1WM3 A;  1ROE A;  4JLC A;  1TT5 B;  2SEB D;  3QJZ A;  4YTM B;  3NJT A;  1OEY J;  4MGZ E;  3UIN B;  5IOI A;  4TQ0 A;  2M0A A;  3WAN A;  3EFC A;  3IHP C;  2NPT B;  4MH8 A;  3AN1 A;  1UWX A;  2IO3 B;  3Q8B A;  5L95 C;  5AUI A;  3ZJU A;  2J53 A;  5J18 A;  3EFU A;  3N1Y C;  5IO9 A;  3AE2 B;  4MGI E;  3B9J A;  4PS3 A;  3J9C A;  3ZVV A;  1E6E B;  1J19 A;  3DWG C;  4BBN C;  3AU5 A;  1NBF C;  2LGX A;  1HTO A;  1P9D U;  1HQR D;  5EE1 A;  3FIL B;  5D3D A;  2JU6 X;  1D5X C;  1V9J A;  3U30 A;  2ZPN A;  5AZH A;  2Z0D B;  1WFY A;  2Y5C A;  3SU8 X;  4OVU A;  4C4V B;  4ZRP A;  1YIW A;  1N60 A;  2ZCB A;  3H7P B;  2HTM E;  1SXT A;  2D3G A;  1GNU A;  2N9X A;  3TMP B;  2IY0 B;  4ZRK A;  2FE8 A;  3Q8E A;  1XO3 A;  4P1B C;  2KO3 A;  2J0J A;  3NVZ A;  2BS3 B;  2JRI B;  1C1Y B;  5AEK B;  3Q3N C;  2J0M A;  4DHZ B;  3TEW A;  1VR9 A;  2D07 B;  1WGY A;  1LO5 D;  4C7Y A;  3MTN B;  4W9H A;  2LEK A;  3Q2A C;  2NVU I;  4F1S A;  1TZ1 A;  3PPA A;  1WGH A;  1TBE A;  1SJE D;  3K9O B;  4JWU C;  1Z5S B;  2N1W A;  5E6O A;  1E9M A;  1LXD A;  2G4D B;  1GC6 A;  4MT5 A;  2KTF A;  2FNJ B;  2OJR A;  4M0W B;  1DOX A;  2YEP F;  2MJE A;  2YEP B;  1F1H A;  4LTU A;  3DBS A;  2QSD A;  4H2A A;  1JWS D;  5HFY A;  2MBQ A;  1WRD B;  3ZKJ C;  4JX1 C;  1LGR A;  1FMA D;  4KDL B;  5L83 A;  5G55 A;  4ARC A;  4C56 C;  4ZYS A;  2ON8 A;  1QKZ A;  3M3J A;  4BVU C;  3UGB B;  2L05 A;  4WWP A;  1XF5 L;  4TKN A;  2M4N A;  2AQ2 B;  1WIA A;  4LJO B;  3UF8 A;  2WXN A;  1WE6 A;  3Q69 A;  4DDI D;  4YSY B;  4BKS D;  2MWS B;  3I5J C;  1DGJ A;  1I4X A;  3P4R B; 
#chains in the Genus database with same CATH homology
 2DZI A;  1E8Z A;  3SD5 A;  1J8C A;  4ANV A;  1S1Q B;  4I6P A;  1SGH A;  3JVZ X;  1P1A A;  4FBJ B;  3ZO5 B;  1E90 A;  3UIO B;  3NY5 A;  3A4S C;  3ALB A;  1E8X A;  4II2 B;  4LDT D;  3SHQ A;  1S3S G;  3I3T B;  3CF6 E;  3L54 A;  5E6N A;  2IY1 B;  3B1L X;  4IUM B;  5KHO A;  2Y5B B;  2MP2 A;  4HJK A;  2KJH B;  1WJN A;  3A1Q B;  3R7R A;  4GMV A;  5D6J B;  3ZUN A;  2G45 B;  2JWZ A;  3HIZ A;  4MSM B;  3DVG X;  3QX1 A;  4URK A;  1UH6 A;  2IZV B;  1YJ1 A;  3PHW B;  3NS8 A;  3PRP B;  4E71 A;  3IG3 A;  4F8C B;  2KFJ A;  4KV2 A;  2O6V B;  2KX3 A;  2JT4 B;  2ZNV C;  4WJO A;  3DDC B;  5KHQ A;  1JRU A;  4WAA A;  2KDE B;  1G6J A;  3TIX A;  3D32 A;  2KN5 A;  1V80 A;  2N9P C;  3KYD D;  2HJ8 A;  4HDO A;  3VH4 B;  3Q3J A;  4RM8 A;  3Q3F A;  2KXJ A;  5J2R A;  3M62 B;  2LWP A;  1QZE A;  3VDZ A;  2GOW A;  5E6P A;  1YQB A;  2BWF A;  2K6Q A;  1Y8R C;  4NNJ B;  2GBJ A;  4HPM B;  3L10 B;  2JY6 A;  4EKU A;  4MSQ B;  2KWV B;  2MSE D;  2N7D A;  5CHV C;  4GOC A;  1P98 A;  2JF5 A;  1V6E A;  2RGF A;  2CHX A;  2K39 A;  1XQQ A;  3RCZ A;  1OGW A;  1WX9 A;  3VHT C;  4AJY B;  3TCA A;  2D2Q A;  1AAR A;  2JRH A;  4A3O A;  3IVF A;  1U4A A;  1WY8 A;  2LI5 A;  2FCQ A;  4NJ7 A;  3V62 A;  4NQK E;  1UBI A;  2GBM A;  3DVN V;  3QHT A;  2I1K A;  4EOY A;  5FR6 A;  2MCN B;  4ZDV A;  4MJS A;  1TTN A;  3A9K B;  4II3 B;  1WXM A;  1WR6 E;  3IBE A;  1M94 A;  2GMI C;  2MX2 A;  3VXW A;  3UQA A;  2KJR A;  2MBO A;  3T9L A;  1RRB A;  3RD2 A;  2BYF A;  2I1J A;  5LLI A;  2KLC A;  3U8Z A;  4GDK A;  3ZNH B;  3VUY A;  2CR5 A;  3OLM D;  1OQY A;  2EMT A;  2NR2 A;  2PJH A;  2WWZ A;  4W9L A;  5IA7 A;  2W9N A;  3RT3 B;  4DDG D;  2N7E A;  4YL8 A;  2L0T A;  5DCN A;  3ENE A;  2CHZ A;  3A9J A;  4FJV B;  2D11 A;  1Q5W B;  2DZM A;  4ASW C;  2N9E B;  2JZ3 B;  4KIK A;  2IO1 B;  4NY0 A;  2JUO A;  4IM2 A;  2MBB B;  4I6N B;  5JH5 C;  3ML8 A;  2LVQ A;  4N9F 4;  4W9I A;  4ANW A;  1FXT B;  5DPR A;  4GU2 A;  3M95 A;  3UQB A;  2LXC A;  1GJZ A;  1X1M A;  3DQV A;  3HM6 X;  1RLF A;  4AUQ C;  1NI2 A;  3NOB A;  5LXI B;  4BOS C;  1TGZ B;  4XC2 A;  1WJ4 A;  4P7I A;  2J7Q B;  3H7S A;  2L3Z A;  3QCA A;  1LFD A;  1V2Y A;  1CMX B;  3C0R B;  4GXB A;  4DXA B;  4FHJ A;  5BO4 B;  3PHX B;  1V49 A;  2V1Y A;  3JSV A;  2MP2 B;  4LCD E;  1IPG A;  2CS4 A;  4BBN F;  1C3T A;  5D94 A;  2LVO A;  4FJZ A;  2AYO B;  3MHS D;  1WH3 A;  3PGE A;  4BOZ B;  1H4R A;  2FIF A;  2ZJD A;  2HTH A;  4HLE A;  3NZU A;  4NPN A;  3RZW C;  3WIM A;  2C60 A;  2BKR B;  4CO7 A;  2NBW B;  3R66 C;  1BT0 A;  2LJ5 A;  1GUA B;  4MDK E;  3VTU A;  4IW0 A;  3AXC A;  3ZNG C;  2O6V D;  4G50 A;  4HDQ A;  4IM3 A;  3A33 B;  1P0R A;  3EC8 A;  1WGR A;  3VFK A;  3TL5 A;  3VVW B;  1LM8 B;  2KNB A;  3ONS A;  3JW0 X;  4KZC A;  1YX5 B;  4PS7 A;  2GBR A;  1EF5 A;  2G3Q B;  2MW5 A;  1VD2 A;  4EZJ A;  3R7Q A;  4DHZ E;  2EKE C;  2LUE A;  5AZF A;  4W9J A;  3OAW A;  1SE9 A;  3OJ4 B;  2FID A;  1EO6 A;  2D10 A;  3GZN I;  4KSK C;  3V60 A;  4AWJ A;  2RR9 A;  3WAM A;  4IM0 A;  1WGD A;  4K81 A;  4BFR A;  2NPT A;  2UYZ B;  4EZK A;  2ZNV B;  1L7Y A;  3PZD A;  3VUX A;  1VCB A;  3PV1 A;  3V6C B;  3VQI A;  3H9D A;  4ZRI A;  3TJP A;  4MJS B;  1Q0W B;  2DAJ A;  4W9F A;  2GBK A;  4WJQ A;  2DAF A;  3HHM A;  3QC8 B;  3VAW A;  2C7N B;  3ZNI D;  2L00 B;  2XK5 A;  5D7G A;  1NDD A;  4HPL B;  2IO0 B;  2R2Q A;  4FHK A;  2V4L A;  1WX8 A;  3PT2 B;  4HVB A;  1E8W A;  2YLM A;  1WGG A;  3QAR A;  3VH3 B;  3WAO A;  3NHE B;  4GDK B;  3AI5 A;  4MEM A;  2KHW B;  2DZJ A;  2JXX A;  2L76 A;  2Z59 B;  4ANX A;  2PPH A;  5IAA C;  3WAP A;  4FLH A;  3CST A;  3RZF A;  4A3P A;  3MJW A;  1V5T A;  3A9J B;  2K8C A;  4WWN A;  3W1Y A;  4AOF A;  4GDL A;  2CU1 A;  1EUV B;  2XEW A;  2KK8 A;  4LJP B;  2KFK B;  1WMH A;  4KIK B;  4B9K A;  2WX0 A;  4W9G A;  3O65 B;  2JZZ A;  3QQ8 B;  1UGM A;  3KUC B;  2V3S A;  4GN1 A;  2RSU A;  1HE8 A;  1GC7 A;  3WAL A;  1V5O A;  2DEN B;  1K8R B;  1ISN A;  3OJ3 A;  4K7W A;  4A20 A;  3CMM B;  1ZW7 A;  2IO2 B;  3HM3 A;  4MH0 E;  2MRP A;  1WI0 A;  2BGF A;  2NCN A;  4ANU A;  3K9P B;  2AL6 A;  2REX A;  4ZRJ A;  2KD0 A;  1WE7 A;  2C7M B;  4JGH B;  3AUL A;  3LDZ E;  3PS6 A;  2C9W B;  5CHF A;  3PRE A;  2KTR A;  3H7P A;  2NBU A;  4K7S A;  4BKS A;  3KVF B;  2L8J A;  4JIO U;  3ZDM C;  2IBI B;  3UIP B;  2O2V B;  2LZ6 A;  2UWQ A;  2KKC A;  3ZNZ B;  2KLG A;  3ZLZ A;  1V86 A;  4K7U A;  3KH0 A;  2PE6 B;  1E7U A;  2KMA A;  4CYE A;  1OEY A;  3KW5 B;  1WZ3 A;  2A4Z A;  5G2N A;  2MLB A;  3ZRC A;  2FCN A;  4IC7 B;  2NS5 A;  2JPH A;  2NBV B;  1WM2 A;  4J6I A;  5LXH A;  4B6W A;  1WYW B;  1WM3 A;  3L08 A;  2FCM A;  1E5W A;  2WX1 A;  4JLC A;  3L16 A;  1R4M I;  4KZ0 A;  2PEA A;  4F7Z A;  3P2B A;  4W9D A;  4K1R B;  4KSL C;  5C1Z A;  2KMC A;  3RUI B;  3QJZ A;  4FUL A;  4NAW A;  4NAW B;  4I6L B;  4KVG B;  4GIV A;  2FUH B;  2FAZ A;  1OEY J;  3DBL I;  4MGZ E;  3UIN B;  2K8H A;  2ZPY A;  3W1S C;  2KDB A;  4NQL B;  4FAD A;  4XZ4 A;  4TQ0 A;  3ZW3 A;  2ZVN A;  4FJY A;  3DVN U;  3WAN A;  3IHP C;  2NPT B;  2KJ6 A;  2KVR A;  5J17 A;  2AWT A;  3ZTD A;  1Z2M A;  1LQB A;  2DZK A;  3V6E B;  3X0W A;  2FCS A;  2KDI A;  3DBH I;  2IO3 B;  3M63 B;  2CHW A;  4JL9 A;  4PYU A;  2K1F A;  5L95 C;  2XK5 B;  1WXA A;  4WWO A;  1Q1O A;  2RD0 A;  1D3Z A;  3B08 A;  5J18 A;  2MBE A;  4IWP A;  1SIF A;  2LRU A;  3EFU A;  3KUD B;  2JVC A;  4HXD A;  2K8B A;  4MGI E;  4PS3 A;  2MBH A;  5CHW A;  3W1S A;  3ZVV A;  1F9J A;  4M8M A;  1MG8 A;  1J19 A;  3IFW B;  2BWE S;  4BBN C;  2M1M A;  4NJ6 A;  2BF8 B;  2KZR A;  3AU5 A;  1NBF C;  1WMH B;  4GGQ A;  2LGX A;  4EZL A;  2DYM A;  1P9D U;  2L7R A;  2OOB B;  3N32 A;  3QK0 A;  4FN2 A;  3RUL A;  2WDT B;  4ZYN A;  3B0A A;  4WQO B;  4ICU A;  3ZTC A;  1V9J A;  3APC A;  3GOE A;  3U30 A;  3PVL A;  4JQW C;  3T8M A;  1PQS A;  2ZPN A;  3ZRF A;  2G4S A;  2Z0D B;  5AZH A;  3WA0 A;  4EUT A;  2C5L C;  1WFY A;  2WYQ A;  3SU8 X;  4OVU A;  1YD8 U;  4IWO A;  1WXV A;  5C23 A;  5JZE B;  1YIW A;  1A5R A;  2LVP A;  3AU4 A;  2ZCB A;  2KTR B;  1ZKH A;  3H7P B;  4MEL A;  2CKH B;  2D3G A;  4MGY E;  1GNU A;  2ZCC A;  4GSW A;  2N9X A;  2KWC A;  3TMP B;  3N3K B;  3JYU A;  1H8C A;  2IY0 B;  4ZRK A;  2LRW A;  3KYC D;  1EF1 A;  4B95 A;  5D2M B;  4RMA A;  2KO3 A;  3EHV A;  3U7D A;  2J0J A;  4TUU A;  2MQJ A;  1IYF A;  4FA6 A;  1YX6 B;  2L0F A;  1WX7 A;  2JRI B;  1C1Y B;  1OTR B;  5AEK B;  2M0X A;  3SDL C;  3APD A;  2J0M A;  4DHZ B;  2HD5 B;  3L17 A;  2AEH A;  2D07 B;  1WGY A;  1WR1 A;  4TQ1 A;  4OVV A;  3RYT A;  3DOW A;  4MGK E;  5DPW A;  3MTN B;  4W9H A;  4G11 A;  4DHJ D;  2NVU I;  1WJU A;  5EDS A;  4LDT B;  4F1S A;  1TZ1 A;  2LGD A;  4ICV A;  1UBQ A;  5DPT A;  3PPA A;  5DPS A;  5AZG A;  1WGH A;  1XD3 B;  1TBE A;  3K9O B;  4XX5 A;  2QHO A;  5HKH A;  2DHZ A;  1Z5S B;  2C7H A;  2EMS A;  2LAS A;  2LGY A;  2N1W A;  5E6O A;  2GBN A;  1LXD A;  1WF9 A;  2BYE A;  2M8S A;  2G4D B;  2R2O A;  3ECI A;  3L0W B;  3APF A;  1GC6 A;  3PLV A;  4HWI B;  1UZX B;  1I42 A;  2VRR B;  4BKT A;  2KTF A;  3A1Q A;  4X57 B;  2FNJ B;  2OJR A;  3JSV B;  3X23 A;  3H1U A;  4M0W B;  3NZS A;  4PS8 A;  1KLV A;  1WXS A;  4IWQ A;  4BKG A;  3H6N A;  1RFA A;  4KDI C;  5CTR C;  5CX3 A;  2BPS A;  3KUZ A;  2O6V A;  4G3X B;  4HCP B;  4DHJ B;  2N1V A;  4M8N A;  4DBG A;  2LXA A;  1WJ6 A;  1E7V A;  2J0K A;  2B3A A;  4EEW A;  3HK0 A;  2MA9 B;  3DBR I;  2N4F A;  3DBS A;  1XT9 B;  3QWZ B;  2KDF B;  1GG3 A;  3QA8 A;  3PRZ A;  1UEL A;  1IP9 A;  3DVG Y;  3DPD A;  2MBQ A;  2XBB C;  2YVC A;  3ML9 A;  3BY4 B;  3QAQ A;  3A4R A;  4GB9 A;  1J0G A;  1WRD B;  2KX0 A;  3CSF A;  2DYO A;  2KAN A;  2Z0E B;  3ZKJ C;  4AP4 C;  3R3M A;  3QIJ A;  3TBL D;  4KDL B;  4WJN A;  4E3C A;  1T0Y A;  2ASQ A;  2DX5 B;  2M17 A;  2ZZP B;  3L13 A;  4AJW A;  2KFK A;  2A5U A;  5L83 A;  5G55 A;  1P3Q U;  5JHA A;  2LD9 A;  4PYZ A;  4W9C A;  4TV3 A;  4E74 A;  3PLU A;  2KC1 A;  2BKF A;  3DCG A;  3ZIM A;  4IG7 B;  4DWF A;  3M3J A;  4HCN B;  2ZEQ A;  1RAX A;  3BIN A;  4BVU C;  1I35 A;  2PE9 A;  1KJT A;  1L2N A;  3UGB B;  3A9K A;  2KQ7 A;  2L05 A;  4WWP A;  2AL3 A;  5JHB A;  3ZDT A;  1KM7 A;  4RM9 A;  4TKN A;  5GMV A;  3S2A A;  1V81 A;  3VTV A;  4HK2 A;  2K25 A;  3N30 A;  2M4N A;  1KOT A;  3V61 A;  4W9K A;  2K6D B;  4W9E A;  3VUW A;  1WIA A;  3PTF C;  1UD7 A;  2KQS A;  2HE7 A;  4LJO B;  3UF8 A;  1R4N I;  1ZGU B;  2KOX A;  3LJ3 A;  5TR5 A;  2O2V A;  1WE6 A;  3PRM B;  4DDI D;  3PSE B;  3VTW A;  1E8Y A;  4BKS D;  2KWU B;  2KC2 A;  1WZ0 A;  4G0N B;  2MWS B;  2RPQ A;  4GDL B;  4MM3 A;  4WJP A;  4EFO A;  2IYD B;  3EEC A;  4DK5 A;  2BYV E;  4CHK A;  2DYB A;  2ZVO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...