1Y8RC

Sumo e1 activating enzyme sae1-sae2-sumo1-mg-atp complex
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
84
structure length
84
Chain Sequence
GDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of the SUMO E1 provide mechanistic insights into SUMO activation and E2 recruitment to E1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords Ubiquitin-like 1 activating enzyme E1A
total genus 19
structure length 84
sequence length 84
chains with identical sequence F
ec nomenclature
pdb deposition date 2004-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1y8rC00
3VAWA 2C9WB 3GZNI 2WX0A 2NVUI 1P1AA 1A5RA 1UGMA 5FR6A 4CHKA 3PZDA 3H1UA 4XZ4A 4JL9A 1YIWA 2M17A 1RFAA 1WGRA 4DDGD 1KLVA 2K8CA 1IPGA 1WJ6A 3A4SC 3A9KA 1WE6A 4I6NB 5CHWA 2LRUA 1YD8U 1WY8A 1LFDA 3V62A 3VHTC 5L95C 2LXCA 1WXSA 2PEAA 2CHXA 2O6VD 2KMCA 4GU2A 1WJUA 2MA9B 4BBNC 2MBBB 4FHJA 4CYEA 1YQBA 2XK5A 3PV1A 1WJNA 5AZHA 2OOBB 4GMVA 1J8CA 3AU4A 1S3SG 3HHMA 3IBEA 4KZ0A 1QZEA 1WXVA 4FULA 4NY0A 4AJWA 2CU1A 3MHSD 3T8MA 3L0WB 3L13A 3NS8A 3SHQA 4B9KA 1OQYA 1V80A 3TJPA 1J19A 3D32A 4NNJB 2JWZA 4A3PA 3WAOA 5CHVC 4LDTB 3DDCB 3RT3B 2KLGA 4RMAA 1ZW7A 2NPTB 3ONSA 4WWOA 5AZFA 4FADA 2ZZPB 2Z59B 1OEYA 2N9XA 4KDLB 1FXTB 2IY0B 1UZXB 3VH3B 4KDIC 5L83A 1GJZA 2KFKB 2B3AA 4WWPA 3IVFA 2BKRB 3APDA 1P3QU 4NJ7A 3A1QB 3BINA 1Y8RC 2XBBC 4MGIE 4EEWA 3QQ8B 2BGFA 1SE9A 3ZW3A 3OAWA 4N9F4 4HVBA 4II2B 4J6IA 2N1VA 4TQ1A 3IHPC 1E8ZA 2WX1A 4FN2A 3V61A 2CHZA 3VDZA 1C3TA 2KLCA 1WIAA 2KWVB 4URKA 4PS8A 5JHBA 1ZGUB 4MDKE 1WZ3A 2R2OA 5E6NA 3ZRFA 4W9DA 2DAFA 2KTRA 2MBOA 2IO1B 3R66C 3QA8A 5TR5A 2W9NA 4FBJB 1KJTA 4IM3A 3QCAA 1IP9A 3CMMB 4M0WB 2V1YA 3RUIB 1KM7A 3VFKA 4ANVA 5IA7A 2BF8B 5C1ZA 2RR9A 2IO3B 4HXDA 3AI5A 3R7RA 1TBEA 3DBSA 3A33B 4W9KA 5DCNA 4NQKE 1Q1OA 1V5TA 4NPNA 3UGBB 3CF6E 1V86A 1F9JA 1CMXB 1NBFC 2R2QA 4B95A 2UWQA 3TMPB 2AL6A 2FIFA 3QARA 1WX7A 3KUCB 4WJQA 1YX5B 2KVRA 3DQVA 1Z5SB 1OTRB 1UH6A 1WZ0A 3LDZE 2KQSA 1R4NI 1E8WA 3EHVA 2CHWA 4MGZE 1WI0A 3QK0A 1RRBA 4GDLA 4B6WA 2L8JA 2HTHA 1EF5A 2KWUB 3PTFC 1V6EA 3RZFA 2KDEB 1UBIA 2MWSB 1RLFA 1Q0WB 2MBQA 2M0XA 4EOYA 4HPMB 4W9GA 1E8XA 4GB9A 4HPLB 4DXAB 2D07B 2DHZA 1WGGA 3JVZX 3UIPB 3WANA 2LGXA 1K8RB 1SGHA 2AYOB 2O2VA 3DBLI 3QHTA 3L10B 2MCNB 1GC7A 2KDBA 2KDIA 3B1LX 3K9PB 3QWZB 1LM8B 2L76A 3T9LA 3PT2B 1S1QB 4ZDVA 1GNUA 2WYQA 2Z0DB 4OVVA 4W9IA 2O2VB 2GBRA 2KOXA 2RPQA 4JQWC 1I42A 4NAWB 4I6PA 3RULA 4ZRIA 3EECA 2O6VA 2RGFA 3DVNU 1H8CA 3WAMA 3QC8B 3ZO5B 2KK8A 2JZZA 3VUWA 2DENB 3ZDTA 3HIZA 4IWQA 3Q3FA 5BO4B 4EZKA 3SD5A 2NBUA 2CS4A 1V49A 4MH0E 1WYWB 2MSED 2Y5BB 4GDLB 1GUAB 2N1WA 4M8MA 4MSMB 2JRHA 2PE9A 4MM3A 3ZNID 4BBNF 4OVUA 4WJNA 2C5LC 3KUZA 1WMHB 3PS6A 2D2QA 3TBLD 2IO0B 4IM2A 3VTWA 3VVWB 1JRUA 2BWFA 1UELA 4K7UA 2LD9A 2LWPA 4ZYNA 4AP4C 4ANWA 3DBHI 2N7EA 1WM2A 1L2NA 4A3OA 5CHFA 1LXDA 3JSVB 3L54A 3OJ3A 3LJ3A 2ZNVC 3PLUA 4W9JA 4MELA 5DPWA 4GN1A 3DPDA 1TGZB 5J18A 3IFWB 4BKSD 3P2BA 3QJZA 3KYDD 3PPAA 4P7IA 3UIOB 5DPTA 5DPSA 2DYMA 2LJ5A 3U30A 2FCSA 3HM3A 5HKHA 1WF9A 2BYFA 3PSEB 4FJZA 4WJPA 2NR2A 2FIDA 1E5WA 4IWPA 2C7MB 2WWZA 2BPSA 3B0AA 4PYUA 1VD2A 3L08A 2LASA 3W1YA 4F7ZA 5LLIA 2FCQA 3L17A 2I1JA 3GOEA 1WJ4A 2MLBA 1NDDA 2KD0A 2VRRB 3PLVA 1V2YA 2HE7A 1WR1A 3PRMB 3WALA 2C7NB 2N9PC 3CSTA 4KSLC 1WM3A 1TZ1A 2L00B 3L16A 4KSKC 4PS3A 2DYBA 4GSWA 4RM8A 3EFUA 3X0WA 2J0KA 5G2NA 2KXJA 2DZJA 3UF8A 1HE8A 2HD5B 2DZIA 1WGDA 1XQQA 4TUUA 4W9HA 3ZTCA 4G11A 3A1QA 3SU8X 2KQ7A 2LZ6A 2K39A 3DVGY 2L7RA 4A20A 4GDKB 1I35A 2PE6B 2IYDB 3NZSA 3TIXA 4ZRJA 2LI5A 2K8BA 2KX3A 2CKHB 2J7QB 3DCGA 3BY4B 5JH5C 5DPRA 2L05A 4G3XB 4F8CB 1WGYA 3ECIA 2J0JA 2LVOA 5AEKB 2KKCA 2G4DB 3ML9A 4HWIB 3U7DA 1E7VA 4ANXA 5AZGA 3DVGX 4YL8A 1WXMA 3VH4B 2M1MA 1XD3B 3KUDB 3VQIA 2PPHA 4ZRKA 4BVUC 5JHAA 2AL3A 3B08A 2IBIB 1GG3A 4CO7A 4HCNB 2OJRA 4TQ0A 4KVGB 2KNBA 3UQAA 2LXAA 4EKUA 3A9JB 3QX1A 4F1SA 2HJ8A 4G50A 3JSVA 3W1SC 3H9DA 2BWES 3DVNV 3VXWA 1WFYA 4EZJA 3OLMD 2KX0A 1WX8A 1XT9B 1SIFA 3A9KB 3KVFB 3O65B 4K7SA 1ZKHA 2MBEA 3PHXB 4LJOB 4EUTA 2GBMA 4GXBA 4MGKE 3ZNHB 4AWJA 4I6LB 3WIMA 1P9DU 4K1RB 4KZCA 5J17A 1E7UA 2V3SA 2K1FA 3N30A 2Z0EB 2I1KA 2UYZB 3MTNB 2BYVE 2K6QA 4M8NA 3MJWA 2O6VB 2BKFA 4KV2A 3VTVA 4GDKA 2NS5A 2ZCBA 4BKGA 2KC2A 4ICUA 4K7WA 3KW5B 4KIKB 1KOTA 2K25A 4GGQA 1D3ZA 5JZEB 4XX5A 3U8ZA 4LCDE 3A4RA 2ZVNA 4IW0A 1UBQA 1NI2A 1P98A 5EDSA 3APFA 3PRZA 2LVPA 3ZDMC 4DWFA 4E71A 5J2RA 3TCAA 2MBHA 3PRPB 4DHZB 2GBJA 1VCBA 2N7DA 3NY5A 4PS7A 3ZTDA 4EZLA 3H7PA 4XC2A 2JXXA 2DX5B 3RZWC 4IUMB 2LRWA 1L7YA 5GMVA 3HM6X 1Z2MA 2KTFA 3RCZA 2FAZA 4JIOU 2KTRB 4MJSA 3APCA 2GBNA 2ASQA 4AOFA 2JUOA 2NBWB 2GMIC 4FA6A 3R3MA 4IG7B 2C7HA 3ML8A 4LJPB 5IAAC 3H6NA 2MP2B 1H4RA 4WAAA 3W1SA 4BKSA 2JF5A 4RM9A 2L3ZA 4NJ6A 2L0FA 2C60A 5C23A 4DHJB 1M94A 2MRPA 4KIKA 4E3CA 1WMHA 2D11A 4BOZB 3AU5A 3Q3JA 2AEHA 5CTRC 3S2AA 1WH3A 2ZCCA 2LGYA 4HCPB 2XEWA 1C1YB 4HDOA 2RSUA 2MW5A 4MEMA 1GC6A 5D2MB 1RAXA 4ASWC 3V6EB 1V9JA 1AARA 4MJSB 3ZKJC 3RYTA 2G3QB 1E90A 2KWCA 4G0NB 4DDID 3JYUA 2ZNVB 3PREA 3QAQA 1Q5WB 2D10A 2MX2A 2DYOA 3KH0A 1T0YA 2IO2B 3M62B 4FJYA 1YX6B 1IYFA 1WE7A 4HDQA 2GBKA 4W9CA 3AULA 4W9FA 2LVQA 2KHWB 4PYZA 4W9EA 3C0RB 3ZNGC 2ZPYA 2KZRA 2ZVOA 2BYEA 3A9JA 4WJOA 2KDFB 3SDLC 3IG3A 4GIVA 3ZLZA 3ZNZB 4AUQC 2V4LA 4IWOA 2JY6A 2G4SA 4DHZE 1TTNA 2IZVB 2LGDA 3H7SA 3CSFA 1PQSA 3OJ4B 3WA0A 4IC7B 2K6DB 3HK0A 2DAJA 4E74A 1WRDB 2JT4B 2KANA 4NQLB 2CR5A 3I3TB 3RD2A 2KFKA 4II3B 4FJVB 3R7QA 1G6JA 4ANUA 4TKNA 4MGYE 2NBVB 4DK5A 4X57B 3ZUNA 3AXCA 2EMTA 2KJ6A 2M8SA 2L0TA 3TL5A 3VUYA 3VTUA 2NPTA 2FUHB 2KN5A 4BKTA 3M95A 3N3KB 1OEYJ 2EKEC 1LQBA 4HK2A 4DHJD 2REXA 2MQJA 3ENEA 4NAWA 2KMAA 3PGEA 5KHOA 3K9OB 5E6OA 3V60A 3KYCD 2YLMA 3V6CB 3ZIMA 1WGHA 2K8HA 4EFOA 4IM0A 4MSQB 2KJHB 2PJHA 2ZEQA 5D7GA 1J0GA 1X1MA 2MP2A 5D6JB 4DBGA 5CX3A 1EF1A 1WXAA 3UINB 2AWTA 4HJKA 2JZ3B 1U4AA 1BT0A 1MG8A 3N32A 2XK5B 4FLHA 2KFJA 1UD7A 3VUXA 2ZPNA 1EUVB 2EMSA 3ZRCA 3PHWB 3QIJA 2DZMA 4HLEA 2A5UA 1YJ1A 2LUEA 3DBRI 3DOWA 5G55A 5LXHA 4GOCA 4JLCA 1OGWA 2KJRA 2JRIB 1P0RA 1E8YA 3EC8A 2QHOA 1V81A 2DZKA 2FCMA 1EO6A 3H7PB 5LXIB 2G45B 4WQOB 4WWNA 4ICVA 3JW0X 3X23A 2JVCA 5KHQA 3M63B 4BFRA 2KC1A 1WR6E 4TV3A 2NCNA 3NOBA 2YVCA 3ZVVA 4AJYB 2IY1B 4BOSC 2KO3A 3NHEB 4LDTD 3M3JA 4W9LA 2FCNA 1ISNA 2GOWA 2N9EB 3ALBA 4FHKA 2FNJB 2M4NA 3NZUA 2ZJDA 2RD0A 2A4ZA 3WAPA 2JPHA 3PVLA 2WDTB 4JGHB 2N4FA 1R4MI 4K81A 1WX9A 5D94A 3UQBA 5E6PA 2J0MA 1V5OA 2D3GA
chains in the Genus database with same CATH superfamily
1P1AA 1A5RA 2PMVA 1YIWA 2M17A 4ZHOA 2WU5B 2K8CA 2WXIA 3A4SC 1J7AA 3A9KA 5CHWA 4I6NB 3C8YA 2LRUA 1YD8U 1WY8A 1LFDA 5L95C 3Q3MC 2KMCA 2INCC 2MA9B 3TEYA 5AZHA 2OOBB 1TKGA 3ZGZA 1SEBD 4KZ0A 1WXVA 1AW7A 3T8MA 1VZ8A 4ZYSA 2JX5A 3DBLB 1T5XD 3D32A 2MJDA 4A3PA 1WXQA 1T3QA 2KLGA 2NPTB 4NJCA 4FADA 3VH3B 1UZXB 1C4AA 4KDIC 1GJZA 1FPYA 3Q14C 1JALA 5D3DA 3BINA 4MGIE 1B1ZA 1SE9A 1AWDA 2J52A 2KWDA 4TQ1A 3V61A 1WIAA 4MDKE 1WZ3A 2R2OA 1UGJA 2IO1B 3QA8A 2W9NA 1KJTA 4M0WB 4ANVA 1KM7A 2CU3A 2D3BA 5C1ZA 2FE8A 2IO3B 3CWIA 1HTOA 2KACA 3AI5A 5BMIA 5DCNA 4NQKE 4NPNA 3CF6E 1NBFC 1C76A 2R2QA 3LYYA 2UWQA 2V4IB 3TMPB 2WDRB 1WX7A 1I4XA 1YX5B 1DOYA 2KVRA 3MFGA 1FD6A 1UH6A 1WZ0A 3LDZE 3RMKC 2KQSA 1E8WA 3EHVA 2WP9B 4MGZE 1DGJA 4S17A 3PTFC 2KDEB 1RLFA 4DXGA 1E8XA 2BTEA 4DXAB 3FILA 1K8RB 3P63A 2AYOB 2O2VA 3ZXRA 2KDBA 3ZJTA 4DQOC 5IN7A 2BS2B 2WDQB 3P4QB 2KOXA 4JQWC 1I42A 1N61A 2HJ1A 3EECA 1H8CA 3WAMA 2KK8A 4AQ7A 1RYJA 3AMZA 1L4DB 4IWQA 3SD5A 3TJPA 4MSMB 2MSED 2BT6A 3AH7A 3KUZA 2PLPA 1QF6A 3VVWB 2BWFA 4ZRQA 2I2YA 3DHGC 1LXDA 3OJ3A 4MELA 5DPWA 4GN1A 1KF6B 2D5GA 3R2IA 5C3JB 4BKSD 1NI3A 3P2BA 1DYQA 3QJZA 3PPAA 3UIOB 1HQRD 3U30A 4C00A 3RPFC 1NEKB 2BB6A 2SAKA 4IWPA 2WWZA 3B0AA 3NVZA 3GE3C 3W1YA 4XYCA 2FCQA 1EM7A 2MLBA 3AE6B 1NDDA 2KD0A 1V2YA 2HE7A 5JXVA 3WALA 2C7NB 3BVZA 3RNAC 1WM3A 1TZ1A 4RM8A 4GSWA 3J9CA 2DZIA 1XQQA 4A90A 1FEHA 2NTTA 3A1QA 2KQ7A 3NRZA 4L2YA 1JQ4A 2MJEA 5DPRA 3ECIA 2XN9C 1TJEA 2LVOA 2G4DB 4HWIB 2SEBD 4ANXA 3DVGX 2M1MA 1T0SC 2PPHA 5JHAA 2IGGA 2AL3A 3BK1A 3W2DA 1R7SA 2YEPB 2LXAA 3LXFA 3VR9B 3H9DA 3DVNV 4S0RA 4EZJA 2KX0A 3BK2A 1WX8A 2GI9A 3O65B 1SIFA 3A9KB 1QOBA 4K7SA 1VZ6A 4EUTA 2WXPA 1FFUA 4AWJA 3NZ3A 3VRBB 2UYZB 3P4PB 2BYVE 4M8NA 3MJWA 5EE9A 4GDKA 2NS5A 4ICUA 4K7WA 5BYQA 1D3ZA 5JZEB 1OFFA 4JX1C 3U8ZA 1L5PA 4LCDE 4XWWA 2OHFA 5EDSA 3AE9B 2CJNA 1C77A 4AS1A 2W54A 4REZA 1E10A 2GBJA 2N7DA 4ITKA 1JROA 3H7PA 2JXXA 4XC2A 4PK1A 1VJKA 4IUMB 5GMVA 1JMLA 1L0VB 3APCA 4RH6A 4FA6A 1TY2A 2GMIC 4BZAA 4XE0A 2WXHA 3ML8A 1FM0D 3EFCA 3H6NA 2MP2B 4WAAA 2JF5A 4RM9A 4NJ6A 2L0FA 2C60A 2WU2B 5C23A 3T3OA 2IJ0A 2INNE 1M94A 4KIKA 1TS5A 1TS3A 1FRDA 2D11A 3AV8A 3AU5A 5CTRC 1E9MA 4HDOA 4MEMA 2MW5A 5D2MB 1NENB 4OZCA 3IAS1 2B76B 2G3QB 3QAQA 2IO2B 2WXOA 2QJLA 3M62B 1YX6B 4YXDB 4HDQA 4K3CA 3C0RB 3A9JA 2KZRA 3ZNZB 1D5XC 4YT0B 2G4SA 2PVOD 2IZVB 2LGDA 3HK0A 4E74A 4NQLB 1SIJA 1QKZA 4MGYE 3AXCA 2M8SA 2L0TA 1ZPSA 4HK2A 1EU3A 4NAWA 2MH7A 5KHOA 3P42A 2Y5PA 2J4XA 1A70A 1D6EC 3KYCD 3V6CB 1WGHA 4IM0A 2KJHB 2PJHA 5D7GA 5D6JB 4DBGA 1EF1A 1C9FA 3FC4A 2XK5B 4RGTA 2KFJA 3ZRCA 2DZMA 1WYGA 2A5UA 3DBRI 3DOWA 5HHDG 5LXHA 2JRIB 1P0RA 3EC8A 5D3IB 2DZKA 3H7PB 5LXIB 2G45B 4ICVA 3X23A 1B9RA 3NUHB 1ZXIA 2XNAC 2ZW0A 4AJYB 4P16A 2Q5WD 3NHEB 3KWLA 4KGTA 2N9EB 4FHKA 3NVYA 2FNJB 5IKCM 2INPE 2Z8LA 2RD0A 1VZ7A 3HVZA 2JPHA 4WWMA 3ABVB 3GZNB 3AEDB 1MG4A 2PKOA 1UUPA 2WXGA 4XWTA 5D94A 3UQBA 2J0MA 2D3GA 3VAWA 2C9WB 3GZNI 1HXYD 2WX0A 1FNWA 1HZ6A 4JL9A 3N20C 3PO0A 3TEWA 1KLVA 2KDMA 1TYGB 4RGOS 3NG0A 1WE6A 3B2GA 4YSYB 1WXSA 1XF5L 2O6VD 4GU2A 3Q8EA 1YQBA 1FIQA 3PV1A 1UWXA 1WJNA 3DWGC 2N9LA 2QEJC 3IBEA 4FULA 4AJWA 4L1BA 3Q2AC 3L13A 3NS8A 1XLOA 1MHHE 1J19A 4WH4A 2JWZA 1TS4A 3WAOA 2V3PA 4HROA 2J42A 4WQMA 3ONSA 5AZFA 1V97A 2N9XA 1FXTB 1JRPA 2KFKB 3RNBC 3APDA 1P3QU 3MC0B 3A1QB 4NJ7A 3AE4B 1Y8RC 1YOVB 4EEWA 3QQ8B 4PT5A 1ROEA 4RNAA 4HVBA 4II2B 4J6IA 5G5GA 3IHPC 2LGIA 2LUMA 3NS1A 1C3TA 5EE3A 4URKA 1VLBA 1ZGUB 4W9DA 2LJIA 2MBOA 1K50A 3QCAA 1IP9A 3AECB 2QC8A 2RR9A 1TBEA 3MJ5A 4W9KA 4L23A 4MACA 3QARA 3KUCB 1T6BX 2PIAA 1XLPA 3DQVA 4M00A 3IT4B 4OVZA 3HUIA 1FO4A 1R4NI 3PZ8A 1Y56A 2WXLA 3BWUD 1R4NB 4GDLA 4B6WA 2J53A 2KWUB 4N59A 3AE2B 4EOYA 5G5HA 2N0SB 2WLBA 4GB9A 4HPLB 2DHZA 3Q8CA 3BZDB 1UWMA 2W3RA 5EE0A 1MVKA 4WAFA 2RDBC 3L10B 2MCNB 1GC7A 2KDIA 5TSSA 2M56B 2L76A 1UNSA 4ZDVA 1S1QB 4YWGG 2LEKA 2QMTA 2JYTA 1GNUA 2Z0DB 1ZP0B 3Q8BA 4C80A 2RPQA 2L52A 3RULA 1ZXHA 3QC8B 3C19A 2DENB 3ZDTA 4EZKA 5BO4B 3Q3FA 2V3NA 2NBUA 4GDLB 2Y5BB 2N1WA 2PE9A 1QOAA 1WMHB 2OJWA 3PS6A 2D2QA 1L0XB 1JRUA 4K7UA 2LD9A 4ANWA 2N7EA 1WM2A 1L2NA 1F2RI 1BXTA 5CHFA 3JSVB 3L54A 4OZBA 2KYWA 1I4HA 1TGZB 3AE3B 1EWYC 3MC8A 1KRHA 3HM3A 1XO3A 2BYFA 4BAXA 4FJZA 4WJPA 5GXGB 1E5WA 1PFDA 2BPSA 3I63C 4M0WA 1VD2A 1PGXA 2LASA 4F7ZA 1C4PA 1TS2A 3HRDD 3L17A 5LLIA 1WJ4A 2K22A 3PLVA 1K53A 4FXCA 4KSLC 4RCOA 1CZPA 1D4BA 4PS3A 2X8XX 2KXJA 2KAJA 2Y5CA 1WGDA 3ZTCA 2K39A 4A8XC 5BYSA 2PE6B 5I4DA 4M01A 3TIXA 4ZRJA 2CKHB 3NVVA 2L05A 2EELA 3KQ4A 4RF0A 4LTUA 4P1CC 3DBRB 3U7DA 4B0MA 4P1BC 1E7VA 5AZGA 1WXMA 3VH4B 1QT9A 4CO7A 3B08A 1HEZE 5HFYA 4HKQA 2ON8A 2KNBA 2LHDA 3A9JB 2NMQA 1QQRA 2L1AA 4F1SA 3JSVA 3W1SC 3RN9C 2BWES 2HDEA 1XT9B 1VDVA 3PHXB 4LJOB 4MGKE 3ZNHB 1SF0A 5MPOA 1RWSA 1P9DU 4K1RB 3SFEB 2K1FA 2WXFA 3MTNB 2O6VB 1YMHE 2BKFA 4KV2A 2BS4B 3AE1B 4BKGA 2RMMA 1KOTA 2K25A 2D3AA 1FXAA 1ZOYB 2W82A 1MPEA 3A4RA 4US8A 2ZVNA 1WWTA 1RFKA 1XLQA 2LVPA 3SFDB 3NJTA 5J2RA 3TCAA 1VCBA 4PS7A 2DX5B 2WXMA 4LNKA 2KTFA 2FAZA 1F52A 2KTRB 2GBNA 5FR3A 3R3MA 4LJPB 3W1SA 1C79A 4DHJB 1K52A 4E3CA 1M4VA 2AQ3B 2M0AA 3Q3JA 1XLNA 1RM6C 4HCPB 2XEWA 1C1YB 2RSUA 1AYFA 4TMAB 1RAXA 4ASWC 4R3DA 3ZKJC 1E90A 4DDID 2ZNVB 4MT5A 3PREA 2MX2A 1P7FA 2WDVB 1N5WA 1GOZA 2VH1A 3L4PA 1IYFA 4W9FA 2KHWB 4HRSA 1XCTL 1SBBB 3ZNGC 2L32A 2ZPYA 1T0QC 3I9V1 3FKYA 4HPPA 4A9AA 2IGDA 1PQSA 2K6DB 1E0ZA 1WRDB 2JT4B 4JE3B 1XCQL 4II3B 4IKGA 5T8IA 3R7QA 1GB1A 4ANUA 4MM3B 4X57B 2AQ2B 3VTUA 2NPTA 2KN5A 3M95A 3N3KB 4DHJD 4C4VA 3ZIMA 3MP9A 4WIPA 2K8HA 4MSQB 4O1NA 4JWSC 3RFZB 2BW2A 3UINB 4HJKA 4EE2A 3N32A 1IGCA 2WXJA 4FLHA 1N63A 1EUVB 4HLEA 1YJ1A 2WXKA 2FCMA 4WQOB 3DWMA 2V0GA 2JVCA 4BFRA 2KC1A 2YVCA 3ZVVA 4BOSC 2FCNA 1ISNA 1HZ5A 4USAA 2M4NA 2ZJDA 1YJIA 3WAPA 4JGHB 2H88B 1WX9A 3ZJUA 1F1HA 5E6PA 2QCZA 1V5OA 3B9JA 1JWSD 2NVUI 3PZDA 2JQRB 1WGRA 4DDGD 2V9HA 2VZKD 1FCLA 5EE1A 1PYWD 3V62A 1WGKA 3VHTC 1OQRA 1V8CA 2LXCA 4C56C 4BBNC 2MBBB 4CYEA 2XK5A 1I4QA 3Q3NC 4LNOA 3BVGA 3RNFC 1YN4A 3AU4A 1J8CA 1N6ZA 1S3SG 2BQQA 1SE3A 2ZW1A 3GB1A 1QZEA 3MHSD 1OQYA 3GP7A 1Q10A 4NNJB 5CHVC 1HA5A 1ZW7A 4WWOA 2IY0B 2WXRA 2AQ1B 2B3AA 4WWPA 3IVFA 2BKRB 2JYEA 1D5MC 1FXIA 2BGFA 3ZW3A 2KN4A 1E8ZA 1SJED 3H8HA 1KH0A 1P7EA 2KLCA 4PS8A 5JHBA 3ZRFA 2N7JA 4ZHPA 2DAFA 2KTRA 4FBJB 1YNTE 4IM3A 3VFKA 2V1YA 1IBXB 4HXDA 1FNVA 3A33B 2INDC 1Q1OA 4KGSA 5IP4D 2K5PA 2MHJA 1V86A 1F9JA 1CMXB 4B95A 1YQ3B 3ETRA 2AL6A 4K3BA 3R8BA 2ACZB 2JZPA 1OTRB 4DXFA 2R61A 3PZ7A 1WI0A 2QIEB 1K51A 2HTHA 1EF5A 3RZFA 1V6EA 2MWSB 2RDGA 1DOXA 4HPMB 4W9GA 2D07B 3JVZX 1WGGA 3WANA 2LGXA 3U7ZA 1DOIA 3DBLI 4RF1A 3QHTA 2DLBA 3P1MA 3SR6A 3E56A 5AUIA 1LM8B 2WGSA 3T9LA 3P4RB 1SB3C 3PT2B 4A6QA 1ZDXA 3WCQA 3AB5A 1STEA 4OVVA 2O2VB 2GBRA 4NAWB 4I6PA 4ZRIA 2O6VA 3DVNU 3HIZA 4YTMB 2WS3B 2CS4A 4MH0E 4M8MA 4MM3A 3ZNID 4OVUA 1BMLC 2C5LC 3TBLD 4IM2A 1UELA 3DBHI 2LGSA 4A3OA 3DBHB 3DPDA 1CK1A 3IFWB 3KYDD 4P7IA 5DPTA 3RI7C 2M19A 5HKHA 2NR2A 1I4PA 2FIDA 1NVID 4PYUA 3L08A 1WRIA 1FCCC 2JU6X 2VRRB 1WR1A 3PRMB 2N9PC 3CSTA 3OWEB 3RNEC 2DYBA 1SE4A 1UF0A 2ICIA 3EFUA 2J0KA 5G2NA 2DZJA 1KLUD 3SU8X 3BVMA 3U2SC 2LZ6A 2LFIA 2L7RA 2LMCA 4A20A 4N58A 4GDKB 1I35A 2LI5A 4XDCA 2J7QB 5JH5C 4F8CB 1WGYA 1J7BA 5AEKB 1YN5A 1NYQA 2KKCA 3TSSA 4YL8A 1XD3B 3VQIA 4BVUC 4ZRKA 3T3NA 4B0EA 2IBIB 4HCNB 1ZDVA 2WXNA 2WHIA 3UQAA 4EKUA 4RGNA 2W55A 1NYRA 2K0PA 3OLMD 3URYA 3O13A 3E9SA 1ZKHA 2GBMA 1PGAA 3IXSA 4I6LB 5J17A 2DNFA 2I1KA 2K6QA 5LNK1 4M02A 5HG2A 3IAM1 2ZCBA 3KW5B 2KQ4X 1GB4A 1AN8A 2HTME 4IW0A 1P98A 3IT6B 3APFA 3V05A 1I4RA 4OZAA 4E71A 3PRPB 1LO5D 1SE2A 3ZTDA 1L7YA 3HM6X 1IGDA 4YSXB 4KKIA 1E7PB 2ASQA 4AOFA 2NBWB 4KGRA 1V1OA 4IG7B 1EWCA 2C7HA 2GB1A 1H4RA 4ZRPA 4A55A 4KKJA 2MRPA 1WMHA 4BOZB 1JWAD 2AEHA 3S2AA 1WH3A 2ZCCA 1E6EB 3N1YC 2LGYA 2ONQA 5FK9C 1GC6A 4OHJA 5H92C 1V9JA 4MJSB 2KWCA 4N6EB 4G0NB 3JYUA 1IUEA 1Q5WB 2D10A 2DYOA 3KH0A 1T0YA 1GPXA 2E3TA 1JWBD 3I57A 1ENFA 2GBKA 4W9CA 4PYZA 3N9YC 2ZVOA 3EA6A 2BYEA 4WJOA 2KDFB 3SDLC 4AUQC 2V4LA 1J7CA 2GLSA 3H7SA 3CSFA 3Q3OC 1FRRA 1ET6A 3OJ4B 3WA0A 4IC7B 3Q69A 2DAJA 3ZQ4A 2KANA 3RD2A 4FJVB 1G6JA 3FILB 1N60A 4TKNA 2NBVB 4DK5A 3ZUNA 2EMTA 2KJ6A 4J3OD 3TL5A 3VUYA 2FUHB 4BKTA 1OEYJ 1LQBA 1I7HA 5BMHA 4XDDA 1JW9D 3AEEB 2REXA 3ENEA 2KMAA 4ZOHC 3GS2A 1TIFA 3K9OB 1PGBA 3AE5B 5E6OA 3BYTB 3TEZA 2KVZA 1SJHD 5CX3A 1U4AA 1BT0A 1QOGA 2BB5A 3PHWB 2JWUA 2IGHA 2LUEA 5G55A 4GOCA 1E8YA 4NZLB 3AE7B 1EO6A 2VZKB 4WWNA 3JW0X 3M63B 5BYRA 4TV3A 2NCNA 3NOBA 1L6UA 2KO3A 4RGMA 4LDTD 3M3JA 4W9LA 3EUB2 2KMMA 2GOWA 3B2FA 1HTQA 2JXTA 3PVLA 4LNNA 3HVDA 2N4FA 1R4MI 4JPSA 4K81A 1JCKB 1C78A 2YEPF 1CQVA 1L6VA 4XGAB 1UGMA 5FR6A 4CHKA 3H1UA 4XZ4A 1RFAA 1IPGA 2AX5A 2IPKD 1WJ6A 3VRAB 2PEAA 2CHXA 3R2TA 1WJUA 4FHJA 2EKIA 1TKYA 3VR8B 4GMVA 4CQNA 1FFVA 3HHMA 2MJ3A 5C2TB 2BBCA 1FMAD 4NY0A 2CU1A 3L0WB 2K3UA 4GLSC 3SHQA 2RPVA 4B9KA 1T0RC 1V80A 2DWQA 4P6VF 1CJEA 3N1XC 4LDTB 3DDCB 3RT3B 4RMAA 1LGRA 2ZZPB 5IOIA 2Z59B 1OEYA 4KDLB 1OQQA 5L83A 2K9XA 3TEXA 2KT7A 2XBBC 3OAWA 4N9F4 4OW0A 2X38A 2N1VA 4IOIE 2I38A 3VDZA 1ZE3D 2WX1A 4FN2A 2CHZA 2KWVB 1D5ZC 4NAMA 2QDFA 5E6NA 3R66C 2IDYA 5TR5A 3CMMB 5HI1A 3RUIB 5IA7A 2BF8B 4IDIA 3R7RA 3DBSA 3EGRA 4HEA1 1V5TA 3W9CB 3UGBB 1JWUD 4ARIA 2FIFA 1KFYB 4WJQA 3DHIC 4YSZB 4C4VB 1Z5SB 4MH8A 1MJDA 2L83A 2D3CA 2CHWA 1QLBB 3QK0A 1RRBA 2L8JA 2FBWB 1UBIA 1YQ4B 1Q0WB 2MBQA 2M0XA 3TUOA 3AM9A 3MHZA 3UIPB 2QILA 1SGHA 3V3XA 3AE8B 4YTNB 2BVCA 3UI3A 3B1LX 2TSSA 3K9PB 1VRAB 1YN3A 3QWZB 3BIID 5H8YE 1I4GA 1XXGA 2G1EA 4QAYA 1TT5B 2WYQA 3CIRB 4W9IA 3Q6BA 1MFWA 2RGFA 3U4EG 1R4MB 3ZO5B 3MC9A 2JZZA 3VUWA 1V1PB 2PVGC 1V49A 1WYWB 1GUAB 2JRHA 4BBNF 2WQYB 4WJNA 1L0YB 2IO0B 3VTWA 3GE8C 4C7ZA 2LWPA 4AP4C 4ZYNA 3ZXVA 2PTLA 1SSNA 3P4SB 3LJ3A 2ZNVC 3PLUA 4W9JA 2LHEA 5J18A 4LNIA 1TKEA 1MHXA 5DPSA 4US9A 2DYMA 2LJ5A 2WNMA 3ZYYX 2FCSA 2VH2A 1WF9A 2GRIA 3PSEB 2C7MB 2I1JA 3KWVA 3GOEA 2FUG1 2L00B 3L16A 4KSKC 3X0WA 3UF8A 1HE8A 2HD5B 4TUUA 4W9HA 5AUKA 4HKZE 3DVGY 2IYDB 3NZSA 2K8BA 2KX3A 3DCGA 3BY4B 1TY0A 4G3XB 1BUIC 2J0JA 3AEGB 4H2AA 2E6XA 3ML9A 1GAQB 3RNCC 3KUDB 1GG3A 2BS3B 2WXQA 2OJRA 4TQ0A 4KVGB 1TZOA 1EU4A 3Q8AA 1ESFA 3QX1A 4RFBA 2HJ8A 4G50A 3VXWA 1WFYA 3KVFB 2MBEA 4GXBA 3WIMA 4KZCA 1E7UA 2V3SA 3N30A 2Z0EB 3NVWA 3VTVA 3AN1A 4HJGE 3N1ZC 2JSVX 2H89B 2KC2A 1F77A 4KIKB 4GGQA 4XX5A 3Q8FA 1PDXA 1UBQA 1NI2A 3PRZA 3ZDMC 4DWFA 2MBHA 4DHZB 3NY5A 3AEFB 3RNGC 4EZLA 3RZWC 2LRWA 4ARCA 1YJJA 1Z2MA 5BMGA 1FNUA 3RCZA 4JIOU 4MJSA 1C4CA 4D2KA 1XEEA 2JUOA 3AEBB 4YTPB 5IAAC 2NTSA 4UDUC 4BKSA 2L3ZA 1VR9A 1PUTA 1KLGD 3OG5A 2DBYA 1QOFA 1KTKA 1ACCA 4WURA 2BYTA 1MI0A 3V6EB 4KX6B 1V1PA 1AARA 3RYTA 1WSPA 4LK0M 4FJYA 1F2RC 1WE7A 2W3SA 3AULA 2LVQA 4W9EA 4ACFA 3SEBA 2N9KA 4C7YA 4LNFA 3IG3A 4GIVA 3ZLZA 4IWOA 2JY6A 4DHZE 1TTNA 2RDHA 4Q2JA 3BYYB 2CR5A 3I3TB 2KFKA 3I5JC 1ET9A 2EKEC 2UU7A 2MQJA 1N5XA 3PGEA 2CJOA 3V60A 2PW9A 4LLGM 2YLMA 4EFOA 2QSDA 2ZEQA 1J0GA 1X1MA 2MP2A 3KLSX 2Y3AA 1WXAA 3W5UB 2AWTA 1L4ZB 2JZ3B 1MG8A 1UD7A 3VUXA 2ZPNA 2EMSA 1QILA 3QIJA 5FKAC 1SXTA 1ZUD2 4JLCA 1OGWA 2KJRA 2QHOA 1V81A 1IBXA 2OEDA 5KHQA 1JWMD 3AEAB 1WR6E 2IY1B 3DHHC 2MEKA 3LB8C 4JWUC 5IO9A 3ALBA 4TSSA 5E6JA 3NZUA 2G9HD 2A4ZA 3W5VB 1F0ZA 1N62A 2WDTB 3U52E 4G11A 3ZJVA 3FAHA
chains in the Genus database with same CATH topology
3VAWA 2C9WB 3GZNI 2WX0A 2NVUI 1P1AA 1A5RA 1UGMA 5FR6A 4CHKA 3PZDA 3H1UA 4XZ4A 4JL9A 1YIWA 2M17A 1RFAA 1WGRA 4DDGD 1KLVA 2K8CA 1IPGA 1WJ6A 3A4SC 3A9KA 1WE6A 4I6NB 5CHWA 2LRUA 1YD8U 1WY8A 1LFDA 3V62A 3VHTC 5L95C 2LXCA 1WXSA 2PEAA 2CHXA 2O6VD 2KMCA 4GU2A 1WJUA 2MA9B 4BBNC 2MBBB 4FHJA 4CYEA 1YQBA 2XK5A 3PV1A 1WJNA 5AZHA 2OOBB 4GMVA 1J8CA 3AU4A 1S3SG 3HHMA 3IBEA 4KZ0A 1QZEA 1WXVA 4FULA 4NY0A 4AJWA 2CU1A 3MHSD 3T8MA 3L0WB 3L13A 3NS8A 3SHQA 4B9KA 1OQYA 1V80A 3TJPA 1J19A 3D32A 4NNJB 2JWZA 4A3PA 3WAOA 5CHVC 4LDTB 3DDCB 3RT3B 2KLGA 4RMAA 1ZW7A 2NPTB 3ONSA 4WWOA 5AZFA 4FADA 2ZZPB 2Z59B 1OEYA 2N9XA 4KDLB 1FXTB 2IY0B 1UZXB 3VH3B 4KDIC 5L83A 1GJZA 2KFKB 2B3AA 4WWPA 3IVFA 2BKRB 3APDA 1P3QU 4NJ7A 3A1QB 3BINA 1Y8RC 2XBBC 4MGIE 4EEWA 3QQ8B 2BGFA 1SE9A 3ZW3A 3OAWA 4N9F4 4HVBA 4II2B 4J6IA 2N1VA 4TQ1A 3IHPC 1E8ZA 2WX1A 4FN2A 3V61A 2CHZA 3VDZA 1C3TA 2KLCA 1WIAA 2KWVB 4URKA 4PS8A 5JHBA 1ZGUB 4MDKE 1WZ3A 2R2OA 5E6NA 3ZRFA 4W9DA 2DAFA 2KTRA 2MBOA 2IO1B 3R66C 3QA8A 5TR5A 2W9NA 4FBJB 1KJTA 4IM3A 3QCAA 1IP9A 3CMMB 4M0WB 2V1YA 3RUIB 1KM7A 3VFKA 4ANVA 5IA7A 2BF8B 5C1ZA 2RR9A 2IO3B 4HXDA 3AI5A 3R7RA 1TBEA 3DBSA 3A33B 4W9KA 5DCNA 4NQKE 1Q1OA 1V5TA 4NPNA 3UGBB 3CF6E 1V86A 1F9JA 1CMXB 1NBFC 2R2QA 4B95A 2UWQA 3TMPB 2AL6A 2FIFA 3QARA 1WX7A 3KUCB 4WJQA 1YX5B 2KVRA 3DQVA 1Z5SB 1OTRB 1UH6A 1WZ0A 3LDZE 2KQSA 1R4NI 1E8WA 3EHVA 2CHWA 4MGZE 1WI0A 3QK0A 1RRBA 4GDLA 4B6WA 2L8JA 2HTHA 1EF5A 2KWUB 3PTFC 1V6EA 3RZFA 2KDEB 1UBIA 2MWSB 1RLFA 1Q0WB 2MBQA 2M0XA 4EOYA 4HPMB 4W9GA 1E8XA 4GB9A 4HPLB 4DXAB 2D07B 2DHZA 1WGGA 3JVZX 3UIPB 3WANA 2LGXA 1K8RB 1SGHA 2AYOB 2O2VA 3DBLI 3QHTA 3L10B 2MCNB 1GC7A 2KDBA 2KDIA 3B1LX 3K9PB 3QWZB 1LM8B 2L76A 3T9LA 3PT2B 1S1QB 4ZDVA 1GNUA 2WYQA 2Z0DB 4OVVA 4W9IA 2O2VB 2GBRA 2KOXA 2RPQA 4JQWC 1I42A 4NAWB 4I6PA 3RULA 4ZRIA 3EECA 2O6VA 2RGFA 3DVNU 1H8CA 3WAMA 3QC8B 3ZO5B 2KK8A 2JZZA 3VUWA 2DENB 3ZDTA 3HIZA 4IWQA 3Q3FA 5BO4B 4EZKA 3SD5A 2NBUA 2CS4A 1V49A 4MH0E 1WYWB 2MSED 2Y5BB 4GDLB 1GUAB 2N1WA 4M8MA 4MSMB 2JRHA 2PE9A 4MM3A 3ZNID 4BBNF 4OVUA 4WJNA 2C5LC 3KUZA 1WMHB 3PS6A 2D2QA 3TBLD 2IO0B 4IM2A 3VTWA 3VVWB 1JRUA 2BWFA 1UELA 4K7UA 2LD9A 2LWPA 4ZYNA 4AP4C 4ANWA 3DBHI 2N7EA 1WM2A 1L2NA 4A3OA 5CHFA 1LXDA 3JSVB 3L54A 3OJ3A 3LJ3A 2ZNVC 3PLUA 4W9JA 4MELA 5DPWA 4GN1A 3DPDA 1TGZB 5J18A 3IFWB 4BKSD 3P2BA 3QJZA 3KYDD 3PPAA 4P7IA 3UIOB 5DPTA 5DPSA 2DYMA 2LJ5A 3U30A 2FCSA 3HM3A 5HKHA 1WF9A 2BYFA 3PSEB 4FJZA 4WJPA 2NR2A 2FIDA 1E5WA 4IWPA 2C7MB 2WWZA 2BPSA 3B0AA 4PYUA 1VD2A 3L08A 2LASA 3W1YA 4F7ZA 5LLIA 2FCQA 3L17A 2I1JA 3GOEA 1WJ4A 2MLBA 1NDDA 2KD0A 2VRRB 3PLVA 1V2YA 2HE7A 1WR1A 3PRMB 3WALA 2C7NB 2N9PC 3CSTA 4KSLC 1WM3A 1TZ1A 2L00B 3L16A 4KSKC 4PS3A 2DYBA 4GSWA 4RM8A 3EFUA 3X0WA 2J0KA 5G2NA 2KXJA 2DZJA 3UF8A 1HE8A 2HD5B 2DZIA 1WGDA 1XQQA 4TUUA 4W9HA 3ZTCA 4G11A 3A1QA 3SU8X 2KQ7A 2LZ6A 2K39A 3DVGY 2L7RA 4A20A 4GDKB 1I35A 2PE6B 2IYDB 3NZSA 3TIXA 4ZRJA 2LI5A 2K8BA 2KX3A 2CKHB 2J7QB 3DCGA 3BY4B 5JH5C 5DPRA 2L05A 4G3XB 4F8CB 1WGYA 3ECIA 2J0JA 2LVOA 5AEKB 2KKCA 2G4DB 3ML9A 4HWIB 3U7DA 1E7VA 4ANXA 5AZGA 3DVGX 4YL8A 1WXMA 3VH4B 2M1MA 1XD3B 3KUDB 3VQIA 2PPHA 4ZRKA 4BVUC 5JHAA 2AL3A 3B08A 2IBIB 1GG3A 4CO7A 4HCNB 2OJRA 4TQ0A 4KVGB 2KNBA 3UQAA 2LXAA 4EKUA 3A9JB 3QX1A 4F1SA 2HJ8A 4G50A 3JSVA 3W1SC 3H9DA 2BWES 3DVNV 3VXWA 1WFYA 4EZJA 3OLMD 2KX0A 1WX8A 1XT9B 1SIFA 3A9KB 3KVFB 3O65B 4K7SA 1ZKHA 2MBEA 3PHXB 4LJOB 4EUTA 2GBMA 4GXBA 4MGKE 3ZNHB 4AWJA 4I6LB 3WIMA 1P9DU 4K1RB 4KZCA 5J17A 1E7UA 2V3SA 2K1FA 3N30A 2Z0EB 2I1KA 2UYZB 3MTNB 2BYVE 2K6QA 4M8NA 3MJWA 2O6VB 2BKFA 4KV2A 3VTVA 4GDKA 2NS5A 2ZCBA 4BKGA 2KC2A 4ICUA 4K7WA 3KW5B 4KIKB 1KOTA 2K25A 4GGQA 1D3ZA 5JZEB 4XX5A 3U8ZA 4LCDE 3A4RA 2ZVNA 4IW0A 1UBQA 1NI2A 1P98A 5EDSA 3APFA 3PRZA 2LVPA 3ZDMC 4DWFA 4E71A 5J2RA 3TCAA 2MBHA 3PRPB 4DHZB 2GBJA 1VCBA 2N7DA 3NY5A 4PS7A 3ZTDA 4EZLA 3H7PA 4XC2A 2JXXA 2DX5B 3RZWC 4IUMB 2LRWA 1L7YA 5GMVA 3HM6X 1Z2MA 2KTFA 3RCZA 2FAZA 4JIOU 2KTRB 4MJSA 3APCA 2GBNA 2ASQA 4AOFA 2JUOA 2NBWB 2GMIC 4FA6A 3R3MA 4IG7B 2C7HA 3ML8A 4LJPB 5IAAC 3H6NA 2MP2B 1H4RA 4WAAA 3W1SA 4BKSA 2JF5A 4RM9A 2L3ZA 4NJ6A 2L0FA 2C60A 5C23A 4DHJB 1M94A 2MRPA 4KIKA 4E3CA 1WMHA 2D11A 4BOZB 3AU5A 3Q3JA 2AEHA 5CTRC 3S2AA 1WH3A 2ZCCA 2LGYA 4HCPB 2XEWA 1C1YB 4HDOA 2RSUA 2MW5A 4MEMA 1GC6A 5D2MB 1RAXA 4ASWC 3V6EB 1V9JA 1AARA 4MJSB 3ZKJC 3RYTA 2G3QB 1E90A 2KWCA 4G0NB 4DDID 3JYUA 2ZNVB 3PREA 3QAQA 1Q5WB 2D10A 2MX2A 2DYOA 3KH0A 1T0YA 2IO2B 3M62B 4FJYA 1YX6B 1IYFA 1WE7A 4HDQA 2GBKA 4W9CA 3AULA 4W9FA 2LVQA 2KHWB 4PYZA 4W9EA 3C0RB 3ZNGC 2ZPYA 2KZRA 2ZVOA 2BYEA 3A9JA 4WJOA 2KDFB 3SDLC 3IG3A 4GIVA 3ZLZA 3ZNZB 4AUQC 2V4LA 4IWOA 2JY6A 2G4SA 4DHZE 1TTNA 2IZVB 2LGDA 3H7SA 3CSFA 1PQSA 3OJ4B 3WA0A 4IC7B 2K6DB 3HK0A 2DAJA 4E74A 1WRDB 2JT4B 2KANA 4NQLB 2CR5A 3I3TB 3RD2A 2KFKA 4II3B 4FJVB 3R7QA 1G6JA 4ANUA 4TKNA 4MGYE 2NBVB 4DK5A 4X57B 3ZUNA 3AXCA 2EMTA 2KJ6A 2M8SA 2L0TA 3TL5A 3VUYA 3VTUA 2NPTA 2FUHB 2KN5A 4BKTA 3M95A 3N3KB 1OEYJ 2EKEC 1LQBA 4HK2A 4DHJD 2REXA 2MQJA 3ENEA 4NAWA 2KMAA 3PGEA 5KHOA 3K9OB 5E6OA 3V60A 3KYCD 2YLMA 3V6CB 3ZIMA 1WGHA 2K8HA 4EFOA 4IM0A 4MSQB 2KJHB 2PJHA 2ZEQA 5D7GA 1J0GA 1X1MA 2MP2A 5D6JB 4DBGA 5CX3A 1EF1A 1WXAA 3UINB 2AWTA 4HJKA 2JZ3B 1U4AA 1BT0A 1MG8A 3N32A 2XK5B 4FLHA 2KFJA 1UD7A 3VUXA 2ZPNA 1EUVB 2EMSA 3ZRCA 3PHWB 3QIJA 2DZMA 4HLEA 2A5UA 1YJ1A 2LUEA 3DBRI 3DOWA 5G55A 5LXHA 4GOCA 4JLCA 1OGWA 2KJRA 2JRIB 1P0RA 1E8YA 3EC8A 2QHOA 1V81A 2DZKA 2FCMA 1EO6A 3H7PB 5LXIB 2G45B 4WQOB 4WWNA 4ICVA 3JW0X 3X23A 2JVCA 5KHQA 3M63B 4BFRA 2KC1A 1WR6E 4TV3A 2NCNA 3NOBA 2YVCA 3ZVVA 4AJYB 2IY1B 4BOSC 2KO3A 3NHEB 4LDTD 3M3JA 4W9LA 2FCNA 1ISNA 2GOWA 2N9EB 3ALBA 4FHKA 2FNJB 2M4NA 3NZUA 2ZJDA 2RD0A 2A4ZA 3WAPA 2JPHA 3PVLA 2WDTB 4JGHB 2N4FA 1R4MI 4K81A 1WX9A 5D94A 3UQBA 5E6PA 2J0MA 1V5OA 2D3GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VAW A;  2C9W B;  3GZN I;  2WX0 A;  2NVU I;  1P1A A;  1A5R A;  1UGM A;  5FR6 A;  4CHK A;  3PZD A;  3H1U A;  4XZ4 A;  4JL9 A;  1YIW A;  2M17 A;  1RFA A;  1WGR A;  4DDG D;  1KLV A;  2K8C A;  1IPG A;  1WJ6 A;  3A4S C;  3A9K A;  1WE6 A;  4I6N B;  5CHW A;  2LRU A;  1YD8 U;  1WY8 A;  1LFD A;  3V62 A;  3VHT C;  5L95 C;  2LXC A;  1WXS A;  2PEA A;  2CHX A;  2O6V D;  2KMC A;  4GU2 A;  1WJU A;  2MA9 B;  4BBN C;  2MBB B;  4FHJ A;  4CYE A;  1YQB A;  2XK5 A;  3PV1 A;  1WJN A;  5AZH A;  2OOB B;  4GMV A;  1J8C A;  3AU4 A;  1S3S G;  3HHM A;  3IBE A;  4KZ0 A;  1QZE A;  1WXV A;  4FUL A;  4NY0 A;  4AJW A;  2CU1 A;  3MHS D;  3T8M A;  3L0W B;  3L13 A;  3NS8 A;  3SHQ A;  4B9K A;  1OQY A;  1V80 A;  3TJP A;  1J19 A;  3D32 A;  4NNJ B;  2JWZ A;  4A3P A;  3WAO A;  5CHV C;  4LDT B;  3DDC B;  3RT3 B;  2KLG A;  4RMA A;  1ZW7 A;  2NPT B;  3ONS A;  4WWO A;  5AZF A;  4FAD A;  2ZZP B;  2Z59 B;  1OEY A;  2N9X A;  4KDL B;  1FXT B;  2IY0 B;  1UZX B;  3VH3 B;  4KDI C;  5L83 A;  1GJZ A;  2KFK B;  2B3A A;  4WWP A;  3IVF A;  2BKR B;  3APD A;  1P3Q U;  4NJ7 A;  3A1Q B;  3BIN A;  1Y8R C;  2XBB C;  4MGI E;  4EEW A;  3QQ8 B;  2BGF A;  1SE9 A;  3ZW3 A;  3OAW A;  4N9F 4;  4HVB A;  4II2 B;  4J6I A;  2N1V A;  4TQ1 A;  3IHP C;  1E8Z A;  2WX1 A;  4FN2 A;  3V61 A;  2CHZ A;  3VDZ A;  1C3T A;  2KLC A;  1WIA A;  2KWV B;  4URK A;  4PS8 A;  5JHB A;  1ZGU B;  4MDK E;  1WZ3 A;  2R2O A;  5E6N A;  3ZRF A;  4W9D A;  2DAF A;  2KTR A;  2MBO A;  2IO1 B;  3R66 C;  3QA8 A;  5TR5 A;  2W9N A;  4FBJ B;  1KJT A;  4IM3 A;  3QCA A;  1IP9 A;  3CMM B;  4M0W B;  2V1Y A;  3RUI B;  1KM7 A;  3VFK A;  4ANV A;  5IA7 A;  2BF8 B;  5C1Z A;  2RR9 A;  2IO3 B;  4HXD A;  3AI5 A;  3R7R A;  1TBE A;  3DBS A;  3A33 B;  4W9K A;  5DCN A;  4NQK E;  1Q1O A;  1V5T A;  4NPN A;  3UGB B;  3CF6 E;  1V86 A;  1F9J A;  1CMX B;  1NBF C;  2R2Q A;  4B95 A;  2UWQ A;  3TMP B;  2AL6 A;  2FIF A;  3QAR A;  1WX7 A;  3KUC B;  4WJQ A;  1YX5 B;  2KVR A;  3DQV A;  1Z5S B;  1OTR B;  1UH6 A;  1WZ0 A;  3LDZ E;  2KQS A;  1R4N I;  1E8W A;  3EHV A;  2CHW A;  4MGZ E;  1WI0 A;  3QK0 A;  1RRB A;  4GDL A;  4B6W A;  2L8J A;  2HTH A;  1EF5 A;  2KWU B;  3PTF C;  1V6E A;  3RZF A;  2KDE B;  1UBI A;  2MWS B;  1RLF A;  1Q0W B;  2MBQ A;  2M0X A;  4EOY A;  4HPM B;  4W9G A;  1E8X A;  4GB9 A;  4HPL B;  4DXA B;  2D07 B;  2DHZ A;  1WGG A;  3JVZ X;  3UIP B;  3WAN A;  2LGX A;  1K8R B;  1SGH A;  2AYO B;  2O2V A;  3DBL I;  3QHT A;  3L10 B;  2MCN B;  1GC7 A;  2KDB A;  2KDI A;  3B1L X;  3K9P B;  3QWZ B;  1LM8 B;  2L76 A;  3T9L A;  3PT2 B;  1S1Q B;  4ZDV A;  1GNU A;  2WYQ A;  2Z0D B;  4OVV A;  4W9I A;  2O2V B;  2GBR A;  2KOX A;  2RPQ A;  4JQW C;  1I42 A;  4NAW B;  4I6P A;  3RUL A;  4ZRI A;  3EEC A;  2O6V A;  2RGF A;  3DVN U;  1H8C A;  3WAM A;  3QC8 B;  3ZO5 B;  2KK8 A;  2JZZ A;  3VUW A;  2DEN B;  3ZDT A;  3HIZ A;  4IWQ A;  3Q3F A;  5BO4 B;  4EZK A;  3SD5 A;  2NBU A;  2CS4 A;  1V49 A;  4MH0 E;  1WYW B;  2MSE D;  2Y5B B;  4GDL B;  1GUA B;  2N1W A;  4M8M A;  4MSM B;  2JRH A;  2PE9 A;  4MM3 A;  3ZNI D;  4BBN F;  4OVU A;  4WJN A;  2C5L C;  3KUZ A;  1WMH B;  3PS6 A;  2D2Q A;  3TBL D;  2IO0 B;  4IM2 A;  3VTW A;  3VVW B;  1JRU A;  2BWF A;  1UEL A;  4K7U A;  2LD9 A;  2LWP A;  4ZYN A;  4AP4 C;  4ANW A;  3DBH I;  2N7E A;  1WM2 A;  1L2N A;  4A3O A;  5CHF A;  1LXD A;  3JSV B;  3L54 A;  3OJ3 A;  3LJ3 A;  2ZNV C;  3PLU A;  4W9J A;  4MEL A;  5DPW A;  4GN1 A;  3DPD A;  1TGZ B;  5J18 A;  3IFW B;  4BKS D;  3P2B A;  3QJZ A;  3KYD D;  3PPA A;  4P7I A;  3UIO B;  5DPT A;  5DPS A;  2DYM A;  2LJ5 A;  3U30 A;  2FCS A;  3HM3 A;  5HKH A;  1WF9 A;  2BYF A;  3PSE B;  4FJZ A;  4WJP A;  2NR2 A;  2FID A;  1E5W A;  4IWP A;  2C7M B;  2WWZ A;  2BPS A;  3B0A A;  4PYU A;  1VD2 A;  3L08 A;  2LAS A;  3W1Y A;  4F7Z A;  5LLI A;  2FCQ A;  3L17 A;  2I1J A;  3GOE A;  1WJ4 A;  2MLB A;  1NDD A;  2KD0 A;  2VRR B;  3PLV A;  1V2Y A;  2HE7 A;  1WR1 A;  3PRM B;  3WAL A;  2C7N B;  2N9P C;  3CST A;  4KSL C;  1WM3 A;  1TZ1 A;  2L00 B;  3L16 A;  4KSK C;  4PS3 A;  2DYB A;  4GSW A;  4RM8 A;  3EFU A;  3X0W A;  2J0K A;  5G2N A;  2KXJ A;  2DZJ A;  3UF8 A;  1HE8 A;  2HD5 B;  2DZI A;  1WGD A;  1XQQ A;  4TUU A;  4W9H A;  3ZTC A;  4G11 A;  3A1Q A;  3SU8 X;  2KQ7 A;  2LZ6 A;  2K39 A;  3DVG Y;  2L7R A;  4A20 A;  4GDK B;  1I35 A;  2PE6 B;  2IYD B;  3NZS A;  3TIX A;  4ZRJ A;  2LI5 A;  2K8B A;  2KX3 A;  2CKH B;  2J7Q B;  3DCG A;  3BY4 B;  5JH5 C;  5DPR A;  2L05 A;  4G3X B;  4F8C B;  1WGY A;  3ECI A;  2J0J A;  2LVO A;  5AEK B;  2KKC A;  2G4D B;  3ML9 A;  4HWI B;  3U7D A;  1E7V A;  4ANX A;  5AZG A;  3DVG X;  4YL8 A;  1WXM A;  3VH4 B;  2M1M A;  1XD3 B;  3KUD B;  3VQI A;  2PPH A;  4ZRK A;  4BVU C;  5JHA A;  2AL3 A;  3B08 A;  2IBI B;  1GG3 A;  4CO7 A;  4HCN B;  2OJR A;  4TQ0 A;  4KVG B;  2KNB A;  3UQA A;  2LXA A;  4EKU A;  3A9J B;  3QX1 A;  4F1S A;  2HJ8 A;  4G50 A;  3JSV A;  3W1S C;  3H9D A;  2BWE S;  3DVN V;  3VXW A;  1WFY A;  4EZJ A;  3OLM D;  2KX0 A;  1WX8 A;  1XT9 B;  1SIF A;  3A9K B;  3KVF B;  3O65 B;  4K7S A;  1ZKH A;  2MBE A;  3PHX B;  4LJO B;  4EUT A;  2GBM A;  4GXB A;  4MGK E;  3ZNH B;  4AWJ A;  4I6L B;  3WIM A;  1P9D U;  4K1R B;  4KZC A;  5J17 A;  1E7U A;  2V3S A;  2K1F A;  3N30 A;  2Z0E B;  2I1K A;  2UYZ B;  3MTN B;  2BYV E;  2K6Q A;  4M8N A;  3MJW A;  2O6V B;  2BKF A;  4KV2 A;  3VTV A;  4GDK A;  2NS5 A;  2ZCB A;  4BKG A;  2KC2 A;  4ICU A;  4K7W A;  3KW5 B;  4KIK B;  1KOT A;  2K25 A;  4GGQ A;  1D3Z A;  5JZE B;  4XX5 A;  3U8Z A;  4LCD E;  3A4R A;  2ZVN A;  4IW0 A;  1UBQ A;  1NI2 A;  1P98 A;  5EDS A;  3APF A;  3PRZ A;  2LVP A;  3ZDM C;  4DWF A;  4E71 A;  5J2R A;  3TCA A;  2MBH A;  3PRP B;  4DHZ B;  2GBJ A;  1VCB A;  2N7D A;  3NY5 A;  4PS7 A;  3ZTD A;  4EZL A;  3H7P A;  4XC2 A;  2JXX A;  2DX5 B;  3RZW C;  4IUM B;  2LRW A;  1L7Y A;  5GMV A;  3HM6 X;  1Z2M A;  2KTF A;  3RCZ A;  2FAZ A;  4JIO U;  2KTR B;  4MJS A;  3APC A;  2GBN A;  2ASQ A;  4AOF A;  2JUO A;  2NBW B;  2GMI C;  4FA6 A;  3R3M A;  4IG7 B;  2C7H A;  3ML8 A;  4LJP B;  5IAA C;  3H6N A;  2MP2 B;  1H4R A;  4WAA A;  3W1S A;  4BKS A;  2JF5 A;  4RM9 A;  2L3Z A;  4NJ6 A;  2L0F A;  2C60 A;  5C23 A;  4DHJ B;  1M94 A;  2MRP A;  4KIK A;  4E3C A;  1WMH A;  2D11 A;  4BOZ B;  3AU5 A;  3Q3J A;  2AEH A;  5CTR C;  3S2A A;  1WH3 A;  2ZCC A;  2LGY A;  4HCP B;  2XEW A;  1C1Y B;  4HDO A;  2RSU A;  2MW5 A;  4MEM A;  1GC6 A;  5D2M B;  1RAX A;  4ASW C;  3V6E B;  1V9J A;  1AAR A;  4MJS B;  3ZKJ C;  3RYT A;  2G3Q B;  1E90 A;  2KWC A;  4G0N B;  4DDI D;  3JYU A;  2ZNV B;  3PRE A;  3QAQ A;  1Q5W B;  2D10 A;  2MX2 A;  2DYO A;  3KH0 A;  1T0Y A;  2IO2 B;  3M62 B;  4FJY A;  1YX6 B;  1IYF A;  1WE7 A;  4HDQ A;  2GBK A;  4W9C A;  3AUL A;  4W9F A;  2LVQ A;  2KHW B;  4PYZ A;  4W9E A;  3C0R B;  3ZNG C;  2ZPY A;  2KZR A;  2ZVO A;  2BYE A;  3A9J A;  4WJO A;  2KDF B;  3SDL C;  3IG3 A;  4GIV A;  3ZLZ A;  3ZNZ B;  4AUQ C;  2V4L A;  4IWO A;  2JY6 A;  2G4S A;  4DHZ E;  1TTN A;  2IZV B;  2LGD A;  3H7S A;  3CSF A;  1PQS A;  3OJ4 B;  3WA0 A;  4IC7 B;  2K6D B;  3HK0 A;  2DAJ A;  4E74 A;  1WRD B;  2JT4 B;  2KAN A;  4NQL B;  2CR5 A;  3I3T B;  3RD2 A;  2KFK A;  4II3 B;  4FJV B;  3R7Q A;  1G6J A;  4ANU A;  4TKN A;  4MGY E;  2NBV B;  4DK5 A;  4X57 B;  3ZUN A;  3AXC A;  2EMT A;  2KJ6 A;  2M8S A;  2L0T A;  3TL5 A;  3VUY A;  3VTU A;  2NPT A;  2FUH B;  2KN5 A;  4BKT A;  3M95 A;  3N3K B;  1OEY J;  2EKE C;  1LQB A;  4HK2 A;  4DHJ D;  2REX A;  2MQJ A;  3ENE A;  4NAW A;  2KMA A;  3PGE A;  5KHO A;  3K9O B;  5E6O A;  3V60 A;  3KYC D;  2YLM A;  3V6C B;  3ZIM A;  1WGH A;  2K8H A;  4EFO A;  4IM0 A;  4MSQ B;  2KJH B;  2PJH A;  2ZEQ A;  5D7G A;  1J0G A;  1X1M A;  2MP2 A;  5D6J B;  4DBG A;  5CX3 A;  1EF1 A;  1WXA A;  3UIN B;  2AWT A;  4HJK A;  2JZ3 B;  1U4A A;  1BT0 A;  1MG8 A;  3N32 A;  2XK5 B;  4FLH A;  2KFJ A;  1UD7 A;  3VUX A;  2ZPN A;  1EUV B;  2EMS A;  3ZRC A;  3PHW B;  3QIJ A;  2DZM A;  4HLE A;  2A5U A;  1YJ1 A;  2LUE A;  3DBR I;  3DOW A;  5G55 A;  5LXH A;  4GOC A;  4JLC A;  1OGW A;  2KJR A;  2JRI B;  1P0R A;  1E8Y A;  3EC8 A;  2QHO A;  1V81 A;  2DZK A;  2FCM A;  1EO6 A;  3H7P B;  5LXI B;  2G45 B;  4WQO B;  4WWN A;  4ICV A;  3JW0 X;  3X23 A;  2JVC A;  5KHQ A;  3M63 B;  4BFR A;  2KC1 A;  1WR6 E;  4TV3 A;  2NCN A;  3NOB A;  2YVC A;  3ZVV A;  4AJY B;  2IY1 B;  4BOS C;  2KO3 A;  3NHE B;  4LDT D;  3M3J A;  4W9L A;  2FCN A;  1ISN A;  2GOW A;  2N9E B;  3ALB A;  4FHK A;  2FNJ B;  2M4N A;  3NZU A;  2ZJD A;  2RD0 A;  2A4Z A;  3WAP A;  2JPH A;  3PVL A;  2WDT B;  4JGH B;  2N4F A;  1R4M I;  4K81 A;  1WX9 A;  5D94 A;  3UQB A;  5E6P A;  2J0M A;  1V5O A;  2D3G A; 
#chains in the Genus database with same CATH topology
 1P1A A;  1A5R A;  2PMV A;  1YIW A;  2M17 A;  4ZHO A;  2WU5 B;  2K8C A;  2WXI A;  3A4S C;  1J7A A;  3A9K A;  5CHW A;  4I6N B;  3C8Y A;  2LRU A;  1YD8 U;  1WY8 A;  1LFD A;  5L95 C;  3Q3M C;  2KMC A;  2INC C;  2MA9 B;  3TEY A;  5AZH A;  2OOB B;  1TKG A;  3ZGZ A;  1SEB D;  4KZ0 A;  1WXV A;  1AW7 A;  3T8M A;  1VZ8 A;  4ZYS A;  2JX5 A;  3DBL B;  1T5X D;  3D32 A;  2MJD A;  4A3P A;  1WXQ A;  1T3Q A;  2KLG A;  2NPT B;  4NJC A;  4FAD A;  3VH3 B;  1UZX B;  1C4A A;  4KDI C;  1GJZ A;  1FPY A;  3Q14 C;  1JAL A;  5D3D A;  3BIN A;  4MGI E;  1B1Z A;  1SE9 A;  1AWD A;  2J52 A;  2KWD A;  4TQ1 A;  3V61 A;  1WIA A;  4MDK E;  1WZ3 A;  2R2O A;  1UGJ A;  2IO1 B;  3QA8 A;  2W9N A;  1KJT A;  4M0W B;  4ANV A;  1KM7 A;  2CU3 A;  2D3B A;  5C1Z A;  2FE8 A;  2IO3 B;  3CWI A;  1HTO A;  2KAC A;  3AI5 A;  5BMI A;  5DCN A;  4NQK E;  4NPN A;  3CF6 E;  1NBF C;  1C76 A;  2R2Q A;  3LYY A;  2UWQ A;  2V4I B;  3TMP B;  2WDR B;  1WX7 A;  1I4X A;  1YX5 B;  1DOY A;  2KVR A;  3MFG A;  1FD6 A;  1UH6 A;  1WZ0 A;  3LDZ E;  3RMK C;  2KQS A;  1E8W A;  3EHV A;  2WP9 B;  4MGZ E;  1DGJ A;  4S17 A;  3PTF C;  2KDE B;  1RLF A;  4DXG A;  1E8X A;  2BTE A;  4DXA B;  3FIL A;  1K8R B;  3P63 A;  2AYO B;  2O2V A;  3ZXR A;  2KDB A;  3ZJT A;  4DQO C;  5IN7 A;  2BS2 B;  2WDQ B;  3P4Q B;  2KOX A;  4JQW C;  1I42 A;  1N61 A;  2HJ1 A;  3EEC A;  1H8C A;  3WAM A;  2KK8 A;  4AQ7 A;  1RYJ A;  3AMZ A;  1L4D B;  4IWQ A;  3SD5 A;  3TJP A;  4MSM B;  2MSE D;  2BT6 A;  3AH7 A;  3KUZ A;  2PLP A;  1QF6 A;  3VVW B;  2BWF A;  4ZRQ A;  2I2Y A;  3DHG C;  1LXD A;  3OJ3 A;  4MEL A;  5DPW A;  4GN1 A;  1KF6 B;  2D5G A;  3R2I A;  5C3J B;  4BKS D;  1NI3 A;  3P2B A;  1DYQ A;  3QJZ A;  3PPA A;  3UIO B;  1HQR D;  3U30 A;  4C00 A;  3RPF C;  1NEK B;  2BB6 A;  2SAK A;  4IWP A;  2WWZ A;  3B0A A;  3NVZ A;  3GE3 C;  3W1Y A;  4XYC A;  2FCQ A;  1EM7 A;  2MLB A;  3AE6 B;  1NDD A;  2KD0 A;  1V2Y A;  2HE7 A;  5JXV A;  3WAL A;  2C7N B;  3BVZ A;  3RNA C;  1WM3 A;  1TZ1 A;  4RM8 A;  4GSW A;  3J9C A;  2DZI A;  1XQQ A;  4A90 A;  1FEH A;  2NTT A;  3A1Q A;  2KQ7 A;  3NRZ A;  4L2Y A;  1JQ4 A;  2MJE A;  5DPR A;  3ECI A;  2XN9 C;  1TJE A;  2LVO A;  2G4D B;  4HWI B;  2SEB D;  4ANX A;  3DVG X;  2M1M A;  1T0S C;  2PPH A;  5JHA A;  2IGG A;  2AL3 A;  3BK1 A;  3W2D A;  1R7S A;  2YEP B;  2LXA A;  3LXF A;  3VR9 B;  3H9D A;  3DVN V;  4S0R A;  4EZJ A;  2KX0 A;  3BK2 A;  1WX8 A;  2GI9 A;  3O65 B;  1SIF A;  3A9K B;  1QOB A;  4K7S A;  1VZ6 A;  4EUT A;  2WXP A;  1FFU A;  4AWJ A;  3NZ3 A;  3VRB B;  2UYZ B;  3P4P B;  2BYV E;  4M8N A;  3MJW A;  5EE9 A;  4GDK A;  2NS5 A;  4ICU A;  4K7W A;  5BYQ A;  1D3Z A;  5JZE B;  1OFF A;  4JX1 C;  3U8Z A;  1L5P A;  4LCD E;  4XWW A;  2OHF A;  5EDS A;  3AE9 B;  2CJN A;  1C77 A;  4AS1 A;  2W54 A;  4REZ A;  1E10 A;  2GBJ A;  2N7D A;  4ITK A;  1JRO A;  3H7P A;  2JXX A;  4XC2 A;  4PK1 A;  1VJK A;  4IUM B;  5GMV A;  1JML A;  1L0V B;  3APC A;  4RH6 A;  4FA6 A;  1TY2 A;  2GMI C;  4BZA A;  4XE0 A;  2WXH A;  3ML8 A;  1FM0 D;  3EFC A;  3H6N A;  2MP2 B;  4WAA A;  2JF5 A;  4RM9 A;  4NJ6 A;  2L0F A;  2C60 A;  2WU2 B;  5C23 A;  3T3O A;  2IJ0 A;  2INN E;  1M94 A;  4KIK A;  1TS5 A;  1TS3 A;  1FRD A;  2D11 A;  3AV8 A;  3AU5 A;  5CTR C;  1E9M A;  4HDO A;  4MEM A;  2MW5 A;  5D2M B;  1NEN B;  4OZC A;  3IAS 1;  2B76 B;  2G3Q B;  3QAQ A;  2IO2 B;  2WXO A;  2QJL A;  3M62 B;  1YX6 B;  4YXD B;  4HDQ A;  4K3C A;  3C0R B;  3A9J A;  2KZR A;  3ZNZ B;  1D5X C;  4YT0 B;  2G4S A;  2PVO D;  2IZV B;  2LGD A;  3HK0 A;  4E74 A;  4NQL B;  1SIJ A;  1QKZ A;  4MGY E;  3AXC A;  2M8S A;  2L0T A;  1ZPS A;  4HK2 A;  1EU3 A;  4NAW A;  2MH7 A;  5KHO A;  3P42 A;  2Y5P A;  2J4X A;  1A70 A;  1D6E C;  3KYC D;  3V6C B;  1WGH A;  4IM0 A;  2KJH B;  2PJH A;  5D7G A;  5D6J B;  4DBG A;  1EF1 A;  1C9F A;  3FC4 A;  2XK5 B;  4RGT A;  2KFJ A;  3ZRC A;  2DZM A;  1WYG A;  2A5U A;  3DBR I;  3DOW A;  5HHD G;  5LXH A;  2JRI B;  1P0R A;  3EC8 A;  5D3I B;  2DZK A;  3H7P B;  5LXI B;  2G45 B;  4ICV A;  3X23 A;  1B9R A;  3NUH B;  1ZXI A;  2XNA C;  2ZW0 A;  4AJY B;  4P16 A;  2Q5W D;  3NHE B;  3KWL A;  4KGT A;  2N9E B;  4FHK A;  3NVY A;  2FNJ B;  5IKC M;  2INP E;  2Z8L A;  2RD0 A;  1VZ7 A;  3HVZ A;  2JPH A;  4WWM A;  3ABV B;  3GZN B;  3AED B;  1MG4 A;  2PKO A;  1UUP A;  2WXG A;  4XWT A;  5D94 A;  3UQB A;  2J0M A;  2D3G A;  3VAW A;  2C9W B;  3GZN I;  1HXY D;  2WX0 A;  1FNW A;  1HZ6 A;  4JL9 A;  3N20 C;  3PO0 A;  3TEW A;  1KLV A;  2KDM A;  1TYG B;  4RGO S;  3NG0 A;  1WE6 A;  3B2G A;  4YSY B;  1WXS A;  1XF5 L;  2O6V D;  4GU2 A;  3Q8E A;  1YQB A;  1FIQ A;  3PV1 A;  1UWX A;  1WJN A;  3DWG C;  2N9L A;  2QEJ C;  3IBE A;  4FUL A;  4AJW A;  4L1B A;  3Q2A C;  3L13 A;  3NS8 A;  1XLO A;  1MHH E;  1J19 A;  4WH4 A;  2JWZ A;  1TS4 A;  3WAO A;  2V3P A;  4HRO A;  2J42 A;  4WQM A;  3ONS A;  5AZF A;  1V97 A;  2N9X A;  1FXT B;  1JRP A;  2KFK B;  3RNB C;  3APD A;  1P3Q U;  3MC0 B;  3A1Q B;  4NJ7 A;  3AE4 B;  1Y8R C;  1YOV B;  4EEW A;  3QQ8 B;  4PT5 A;  1ROE A;  4RNA A;  4HVB A;  4II2 B;  4J6I A;  5G5G A;  3IHP C;  2LGI A;  2LUM A;  3NS1 A;  1C3T A;  5EE3 A;  4URK A;  1VLB A;  1ZGU B;  4W9D A;  2LJI A;  2MBO A;  1K50 A;  3QCA A;  1IP9 A;  3AEC B;  2QC8 A;  2RR9 A;  1TBE A;  3MJ5 A;  4W9K A;  4L23 A;  4MAC A;  3QAR A;  3KUC B;  1T6B X;  2PIA A;  1XLP A;  3DQV A;  4M00 A;  3IT4 B;  4OVZ A;  3HUI A;  1FO4 A;  1R4N I;  3PZ8 A;  1Y56 A;  2WXL A;  3BWU D;  1R4N B;  4GDL A;  4B6W A;  2J53 A;  2KWU B;  4N59 A;  3AE2 B;  4EOY A;  5G5H A;  2N0S B;  2WLB A;  4GB9 A;  4HPL B;  2DHZ A;  3Q8C A;  3BZD B;  1UWM A;  2W3R A;  5EE0 A;  1MVK A;  4WAF A;  2RDB C;  3L10 B;  2MCN B;  1GC7 A;  2KDI A;  5TSS A;  2M56 B;  2L76 A;  1UNS A;  4ZDV A;  1S1Q B;  4YWG G;  2LEK A;  2QMT A;  2JYT A;  1GNU A;  2Z0D B;  1ZP0 B;  3Q8B A;  4C80 A;  2RPQ A;  2L52 A;  3RUL A;  1ZXH A;  3QC8 B;  3C19 A;  2DEN B;  3ZDT A;  4EZK A;  5BO4 B;  3Q3F A;  2V3N A;  2NBU A;  4GDL B;  2Y5B B;  2N1W A;  2PE9 A;  1QOA A;  1WMH B;  2OJW A;  3PS6 A;  2D2Q A;  1L0X B;  1JRU A;  4K7U A;  2LD9 A;  4ANW A;  2N7E A;  1WM2 A;  1L2N A;  1F2R I;  1BXT A;  5CHF A;  3JSV B;  3L54 A;  4OZB A;  2KYW A;  1I4H A;  1TGZ B;  3AE3 B;  1EWY C;  3MC8 A;  1KRH A;  3HM3 A;  1XO3 A;  2BYF A;  4BAX A;  4FJZ A;  4WJP A;  5GXG B;  1E5W A;  1PFD A;  2BPS A;  3I63 C;  4M0W A;  1VD2 A;  1PGX A;  2LAS A;  4F7Z A;  1C4P A;  1TS2 A;  3HRD D;  3L17 A;  5LLI A;  1WJ4 A;  2K22 A;  3PLV A;  1K53 A;  4FXC A;  4KSL C;  4RCO A;  1CZP A;  1D4B A;  4PS3 A;  2X8X X;  2KXJ A;  2KAJ A;  2Y5C A;  1WGD A;  3ZTC A;  2K39 A;  4A8X C;  5BYS A;  2PE6 B;  5I4D A;  4M01 A;  3TIX A;  4ZRJ A;  2CKH B;  3NVV A;  2L05 A;  2EEL A;  3KQ4 A;  4RF0 A;  4LTU A;  4P1C C;  3DBR B;  3U7D A;  4B0M A;  4P1B C;  1E7V A;  5AZG A;  1WXM A;  3VH4 B;  1QT9 A;  4CO7 A;  3B08 A;  1HEZ E;  5HFY A;  4HKQ A;  2ON8 A;  2KNB A;  2LHD A;  3A9J B;  2NMQ A;  1QQR A;  2L1A A;  4F1S A;  3JSV A;  3W1S C;  3RN9 C;  2BWE S;  2HDE A;  1XT9 B;  1VDV A;  3PHX B;  4LJO B;  4MGK E;  3ZNH B;  1SF0 A;  5MPO A;  1RWS A;  1P9D U;  4K1R B;  3SFE B;  2K1F A;  2WXF A;  3MTN B;  2O6V B;  1YMH E;  2BKF A;  4KV2 A;  2BS4 B;  3AE1 B;  4BKG A;  2RMM A;  1KOT A;  2K25 A;  2D3A A;  1FXA A;  1ZOY B;  2W82 A;  1MPE A;  3A4R A;  4US8 A;  2ZVN A;  1WWT A;  1RFK A;  1XLQ A;  2LVP A;  3SFD B;  3NJT A;  5J2R A;  3TCA A;  1VCB A;  4PS7 A;  2DX5 B;  2WXM A;  4LNK A;  2KTF A;  2FAZ A;  1F52 A;  2KTR B;  2GBN A;  5FR3 A;  3R3M A;  4LJP B;  3W1S A;  1C79 A;  4DHJ B;  1K52 A;  4E3C A;  1M4V A;  2AQ3 B;  2M0A A;  3Q3J A;  1XLN A;  1RM6 C;  4HCP B;  2XEW A;  1C1Y B;  2RSU A;  1AYF A;  4TMA B;  1RAX A;  4ASW C;  4R3D A;  3ZKJ C;  1E90 A;  4DDI D;  2ZNV B;  4MT5 A;  3PRE A;  2MX2 A;  1P7F A;  2WDV B;  1N5W A;  1GOZ A;  2VH1 A;  3L4P A;  1IYF A;  4W9F A;  2KHW B;  4HRS A;  1XCT L;  1SBB B;  3ZNG C;  2L32 A;  2ZPY A;  1T0Q C;  3I9V 1;  3FKY A;  4HPP A;  4A9A A;  2IGD A;  1PQS A;  2K6D B;  1E0Z A;  1WRD B;  2JT4 B;  4JE3 B;  1XCQ L;  4II3 B;  4IKG A;  5T8I A;  3R7Q A;  1GB1 A;  4ANU A;  4MM3 B;  4X57 B;  2AQ2 B;  3VTU A;  2NPT A;  2KN5 A;  3M95 A;  3N3K B;  4DHJ D;  4C4V A;  3ZIM A;  3MP9 A;  4WIP A;  2K8H A;  4MSQ B;  4O1N A;  4JWS C;  3RFZ B;  2BW2 A;  3UIN B;  4HJK A;  4EE2 A;  3N32 A;  1IGC A;  2WXJ A;  4FLH A;  1N63 A;  1EUV B;  4HLE A;  1YJ1 A;  2WXK A;  2FCM A;  4WQO B;  3DWM A;  2V0G A;  2JVC A;  4BFR A;  2KC1 A;  2YVC A;  3ZVV A;  4BOS C;  2FCN A;  1ISN A;  1HZ5 A;  4USA A;  2M4N A;  2ZJD A;  1YJI A;  3WAP A;  4JGH B;  2H88 B;  1WX9 A;  3ZJU A;  1F1H A;  5E6P A;  2QCZ A;  1V5O A;  3B9J A;  1JWS D;  2NVU I;  3PZD A;  2JQR B;  1WGR A;  4DDG D;  2V9H A;  2VZK D;  1FCL A;  5EE1 A;  1PYW D;  3V62 A;  1WGK A;  3VHT C;  1OQR A;  1V8C A;  2LXC A;  4C56 C;  4BBN C;  2MBB B;  4CYE A;  2XK5 A;  1I4Q A;  3Q3N C;  4LNO A;  3BVG A;  3RNF C;  1YN4 A;  3AU4 A;  1J8C A;  1N6Z A;  1S3S G;  2BQQ A;  1SE3 A;  2ZW1 A;  3GB1 A;  1QZE A;  3MHS D;  1OQY A;  3GP7 A;  1Q10 A;  4NNJ B;  5CHV C;  1HA5 A;  1ZW7 A;  4WWO A;  2IY0 B;  2WXR A;  2AQ1 B;  2B3A A;  4WWP A;  3IVF A;  2BKR B;  2JYE A;  1D5M C;  1FXI A;  2BGF A;  3ZW3 A;  2KN4 A;  1E8Z A;  1SJE D;  3H8H A;  1KH0 A;  1P7E A;  2KLC A;  4PS8 A;  5JHB A;  3ZRF A;  2N7J A;  4ZHP A;  2DAF A;  2KTR A;  4FBJ B;  1YNT E;  4IM3 A;  3VFK A;  2V1Y A;  1IBX B;  4HXD A;  1FNV A;  3A33 B;  2IND C;  1Q1O A;  4KGS A;  5IP4 D;  2K5P A;  2MHJ A;  1V86 A;  1F9J A;  1CMX B;  4B95 A;  1YQ3 B;  3ETR A;  2AL6 A;  4K3B A;  3R8B A;  2ACZ B;  2JZP A;  1OTR B;  4DXF A;  2R61 A;  3PZ7 A;  1WI0 A;  2QIE B;  1K51 A;  2HTH A;  1EF5 A;  3RZF A;  1V6E A;  2MWS B;  2RDG A;  1DOX A;  4HPM B;  4W9G A;  2D07 B;  3JVZ X;  1WGG A;  3WAN A;  2LGX A;  3U7Z A;  1DOI A;  3DBL I;  4RF1 A;  3QHT A;  2DLB A;  3P1M A;  3SR6 A;  3E56 A;  5AUI A;  1LM8 B;  2WGS A;  3T9L A;  3P4R B;  1SB3 C;  3PT2 B;  4A6Q A;  1ZDX A;  3WCQ A;  3AB5 A;  1STE A;  4OVV A;  2O2V B;  2GBR A;  4NAW B;  4I6P A;  4ZRI A;  2O6V A;  3DVN U;  3HIZ A;  4YTM B;  2WS3 B;  2CS4 A;  4MH0 E;  4M8M A;  4MM3 A;  3ZNI D;  4OVU A;  1BML C;  2C5L C;  3TBL D;  4IM2 A;  1UEL A;  3DBH I;  2LGS A;  4A3O A;  3DBH B;  3DPD A;  1CK1 A;  3IFW B;  3KYD D;  4P7I A;  5DPT A;  3RI7 C;  2M19 A;  5HKH A;  2NR2 A;  1I4P A;  2FID A;  1NVI D;  4PYU A;  3L08 A;  1WRI A;  1FCC C;  2JU6 X;  2VRR B;  1WR1 A;  3PRM B;  2N9P C;  3CST A;  3OWE B;  3RNE C;  2DYB A;  1SE4 A;  1UF0 A;  2ICI A;  3EFU A;  2J0K A;  5G2N A;  2DZJ A;  1KLU D;  3SU8 X;  3BVM A;  3U2S C;  2LZ6 A;  2LFI A;  2L7R A;  2LMC A;  4A20 A;  4N58 A;  4GDK B;  1I35 A;  2LI5 A;  4XDC A;  2J7Q B;  5JH5 C;  4F8C B;  1WGY A;  1J7B A;  5AEK B;  1YN5 A;  1NYQ A;  2KKC A;  3TSS A;  4YL8 A;  1XD3 B;  3VQI A;  4BVU C;  4ZRK A;  3T3N A;  4B0E A;  2IBI B;  4HCN B;  1ZDV A;  2WXN A;  2WHI A;  3UQA A;  4EKU A;  4RGN A;  2W55 A;  1NYR A;  2K0P A;  3OLM D;  3URY A;  3O13 A;  3E9S A;  1ZKH A;  2GBM A;  1PGA A;  3IXS A;  4I6L B;  5J17 A;  2DNF A;  2I1K A;  2K6Q A;  5LNK 1;  4M02 A;  5HG2 A;  3IAM 1;  2ZCB A;  3KW5 B;  2KQ4 X;  1GB4 A;  1AN8 A;  2HTM E;  4IW0 A;  1P98 A;  3IT6 B;  3APF A;  3V05 A;  1I4R A;  4OZA A;  4E71 A;  3PRP B;  1LO5 D;  1SE2 A;  3ZTD A;  1L7Y A;  3HM6 X;  1IGD A;  4YSX B;  4KKI A;  1E7P B;  2ASQ A;  4AOF A;  2NBW B;  4KGR A;  1V1O A;  4IG7 B;  1EWC A;  2C7H A;  2GB1 A;  1H4R A;  4ZRP A;  4A55 A;  4KKJ A;  2MRP A;  1WMH A;  4BOZ B;  1JWA D;  2AEH A;  3S2A A;  1WH3 A;  2ZCC A;  1E6E B;  3N1Y C;  2LGY A;  2ONQ A;  5FK9 C;  1GC6 A;  4OHJ A;  5H92 C;  1V9J A;  4MJS B;  2KWC A;  4N6E B;  4G0N B;  3JYU A;  1IUE A;  1Q5W B;  2D10 A;  2DYO A;  3KH0 A;  1T0Y A;  1GPX A;  2E3T A;  1JWB D;  3I57 A;  1ENF A;  2GBK A;  4W9C A;  4PYZ A;  3N9Y C;  2ZVO A;  3EA6 A;  2BYE A;  4WJO A;  2KDF B;  3SDL C;  4AUQ C;  2V4L A;  1J7C A;  2GLS A;  3H7S A;  3CSF A;  3Q3O C;  1FRR A;  1ET6 A;  3OJ4 B;  3WA0 A;  4IC7 B;  3Q69 A;  2DAJ A;  3ZQ4 A;  2KAN A;  3RD2 A;  4FJV B;  1G6J A;  3FIL B;  1N60 A;  4TKN A;  2NBV B;  4DK5 A;  3ZUN A;  2EMT A;  2KJ6 A;  4J3O D;  3TL5 A;  3VUY A;  2FUH B;  4BKT A;  1OEY J;  1LQB A;  1I7H A;  5BMH A;  4XDD A;  1JW9 D;  3AEE B;  2REX A;  3ENE A;  2KMA A;  4ZOH C;  3GS2 A;  1TIF A;  3K9O B;  1PGB A;  3AE5 B;  5E6O A;  3BYT B;  3TEZ A;  2KVZ A;  1SJH D;  5CX3 A;  1U4A A;  1BT0 A;  1QOG A;  2BB5 A;  3PHW B;  2JWU A;  2IGH A;  2LUE A;  5G55 A;  4GOC A;  1E8Y A;  4NZL B;  3AE7 B;  1EO6 A;  2VZK B;  4WWN A;  3JW0 X;  3M63 B;  5BYR A;  4TV3 A;  2NCN A;  3NOB A;  1L6U A;  2KO3 A;  4RGM A;  4LDT D;  3M3J A;  4W9L A;  3EUB 2;  2KMM A;  2GOW A;  3B2F A;  1HTQ A;  2JXT A;  3PVL A;  4LNN A;  3HVD A;  2N4F A;  1R4M I;  4JPS A;  4K81 A;  1JCK B;  1C78 A;  2YEP F;  1CQV A;  1L6V A;  4XGA B;  1UGM A;  5FR6 A;  4CHK A;  3H1U A;  4XZ4 A;  1RFA A;  1IPG A;  2AX5 A;  2IPK D;  1WJ6 A;  3VRA B;  2PEA A;  2CHX A;  3R2T A;  1WJU A;  4FHJ A;  2EKI A;  1TKY A;  3VR8 B;  4GMV A;  4CQN A;  1FFV A;  3HHM A;  2MJ3 A;  5C2T B;  2BBC A;  1FMA D;  4NY0 A;  2CU1 A;  3L0W B;  2K3U A;  4GLS C;  3SHQ A;  2RPV A;  4B9K A;  1T0R C;  1V80 A;  2DWQ A;  4P6V F;  1CJE A;  3N1X C;  4LDT B;  3DDC B;  3RT3 B;  4RMA A;  1LGR A;  2ZZP B;  5IOI A;  2Z59 B;  1OEY A;  4KDL B;  1OQQ A;  5L83 A;  2K9X A;  3TEX A;  2KT7 A;  2XBB C;  3OAW A;  4N9F 4;  4OW0 A;  2X38 A;  2N1V A;  4IOI E;  2I38 A;  3VDZ A;  1ZE3 D;  2WX1 A;  4FN2 A;  2CHZ A;  2KWV B;  1D5Z C;  4NAM A;  2QDF A;  5E6N A;  3R66 C;  2IDY A;  5TR5 A;  3CMM B;  5HI1 A;  3RUI B;  5IA7 A;  2BF8 B;  4IDI A;  3R7R A;  3DBS A;  3EGR A;  4HEA 1;  1V5T A;  3W9C B;  3UGB B;  1JWU D;  4ARI A;  2FIF A;  1KFY B;  4WJQ A;  3DHI C;  4YSZ B;  4C4V B;  1Z5S B;  4MH8 A;  1MJD A;  2L83 A;  2D3C A;  2CHW A;  1QLB B;  3QK0 A;  1RRB A;  2L8J A;  2FBW B;  1UBI A;  1YQ4 B;  1Q0W B;  2MBQ A;  2M0X A;  3TUO A;  3AM9 A;  3MHZ A;  3UIP B;  2QIL A;  1SGH A;  3V3X A;  3AE8 B;  4YTN B;  2BVC A;  3UI3 A;  3B1L X;  2TSS A;  3K9P B;  1VRA B;  1YN3 A;  3QWZ B;  3BII D;  5H8Y E;  1I4G A;  1XXG A;  2G1E A;  4QAY A;  1TT5 B;  2WYQ A;  3CIR B;  4W9I A;  3Q6B A;  1MFW A;  2RGF A;  3U4E G;  1R4M B;  3ZO5 B;  3MC9 A;  2JZZ A;  3VUW A;  1V1P B;  2PVG C;  1V49 A;  1WYW B;  1GUA B;  2JRH A;  4BBN F;  2WQY B;  4WJN A;  1L0Y B;  2IO0 B;  3VTW A;  3GE8 C;  4C7Z A;  2LWP A;  4AP4 C;  4ZYN A;  3ZXV A;  2PTL A;  1SSN A;  3P4S B;  3LJ3 A;  2ZNV C;  3PLU A;  4W9J A;  2LHE A;  5J18 A;  4LNI A;  1TKE A;  1MHX A;  5DPS A;  4US9 A;  2DYM A;  2LJ5 A;  2WNM A;  3ZYY X;  2FCS A;  2VH2 A;  1WF9 A;  2GRI A;  3PSE B;  2C7M B;  2I1J A;  3KWV A;  3GOE A;  2FUG 1;  2L00 B;  3L16 A;  4KSK C;  3X0W A;  3UF8 A;  1HE8 A;  2HD5 B;  4TUU A;  4W9H A;  5AUK A;  4HKZ E;  3DVG Y;  2IYD B;  3NZS A;  2K8B A;  2KX3 A;  3DCG A;  3BY4 B;  1TY0 A;  4G3X B;  1BUI C;  2J0J A;  3AEG B;  4H2A A;  2E6X A;  3ML9 A;  1GAQ B;  3RNC C;  3KUD B;  1GG3 A;  2BS3 B;  2WXQ A;  2OJR A;  4TQ0 A;  4KVG B;  1TZO A;  1EU4 A;  3Q8A A;  1ESF A;  3QX1 A;  4RFB A;  2HJ8 A;  4G50 A;  3VXW A;  1WFY A;  3KVF B;  2MBE A;  4GXB A;  3WIM A;  4KZC A;  1E7U A;  2V3S A;  3N30 A;  2Z0E B;  3NVW A;  3VTV A;  3AN1 A;  4HJG E;  3N1Z C;  2JSV X;  2H89 B;  2KC2 A;  1F77 A;  4KIK B;  4GGQ A;  4XX5 A;  3Q8F A;  1PDX A;  1UBQ A;  1NI2 A;  3PRZ A;  3ZDM C;  4DWF A;  2MBH A;  4DHZ B;  3NY5 A;  3AEF B;  3RNG C;  4EZL A;  3RZW C;  2LRW A;  4ARC A;  1YJJ A;  1Z2M A;  5BMG A;  1FNU A;  3RCZ A;  4JIO U;  4MJS A;  1C4C A;  4D2K A;  1XEE A;  2JUO A;  3AEB B;  4YTP B;  5IAA C;  2NTS A;  4UDU C;  4BKS A;  2L3Z A;  1VR9 A;  1PUT A;  1KLG D;  3OG5 A;  2DBY A;  1QOF A;  1KTK A;  1ACC A;  4WUR A;  2BYT A;  1MI0 A;  3V6E B;  4KX6 B;  1V1P A;  1AAR A;  3RYT A;  1WSP A;  4LK0 M;  4FJY A;  1F2R C;  1WE7 A;  2W3S A;  3AUL A;  2LVQ A;  4W9E A;  4ACF A;  3SEB A;  2N9K A;  4C7Y A;  4LNF A;  3IG3 A;  4GIV A;  3ZLZ A;  4IWO A;  2JY6 A;  4DHZ E;  1TTN A;  2RDH A;  4Q2J A;  3BYY B;  2CR5 A;  3I3T B;  2KFK A;  3I5J C;  1ET9 A;  2EKE C;  2UU7 A;  2MQJ A;  1N5X A;  3PGE A;  2CJO A;  3V60 A;  2PW9 A;  4LLG M;  2YLM A;  4EFO A;  2QSD A;  2ZEQ A;  1J0G A;  1X1M A;  2MP2 A;  3KLS X;  2Y3A A;  1WXA A;  3W5U B;  2AWT A;  1L4Z B;  2JZ3 B;  1MG8 A;  1UD7 A;  3VUX A;  2ZPN A;  2EMS A;  1QIL A;  3QIJ A;  5FKA C;  1SXT A;  1ZUD 2;  4JLC A;  1OGW A;  2KJR A;  2QHO A;  1V81 A;  1IBX A;  2OED A;  5KHQ A;  1JWM D;  3AEA B;  1WR6 E;  2IY1 B;  3DHH C;  2MEK A;  3LB8 C;  4JWU C;  5IO9 A;  3ALB A;  4TSS A;  5E6J A;  3NZU A;  2G9H D;  2A4Z A;  3W5V B;  1F0Z A;  1N62 A;  2WDT B;  3U52 E;  4G11 A;  3ZJV A;  3FAH A; 
#chains in the Genus database with same CATH homology
 3VAW A;  2C9W B;  3GZN I;  2WX0 A;  2NVU I;  1P1A A;  1A5R A;  1UGM A;  5FR6 A;  4CHK A;  3PZD A;  3H1U A;  4XZ4 A;  4JL9 A;  1YIW A;  2M17 A;  1RFA A;  1WGR A;  4DDG D;  1KLV A;  2K8C A;  1IPG A;  1WJ6 A;  3A4S C;  3A9K A;  1WE6 A;  4I6N B;  5CHW A;  2LRU A;  1YD8 U;  1WY8 A;  1LFD A;  3V62 A;  3VHT C;  5L95 C;  2LXC A;  1WXS A;  2PEA A;  2CHX A;  2O6V D;  2KMC A;  4GU2 A;  1WJU A;  2MA9 B;  4BBN C;  2MBB B;  4FHJ A;  4CYE A;  1YQB A;  2XK5 A;  3PV1 A;  1WJN A;  5AZH A;  2OOB B;  4GMV A;  1J8C A;  3AU4 A;  1S3S G;  3HHM A;  3IBE A;  4KZ0 A;  1QZE A;  1WXV A;  4FUL A;  4NY0 A;  4AJW A;  2CU1 A;  3MHS D;  3T8M A;  3L0W B;  3L13 A;  3NS8 A;  3SHQ A;  4B9K A;  1OQY A;  1V80 A;  3TJP A;  1J19 A;  3D32 A;  4NNJ B;  2JWZ A;  4A3P A;  3WAO A;  5CHV C;  4LDT B;  3DDC B;  3RT3 B;  2KLG A;  4RMA A;  1ZW7 A;  2NPT B;  3ONS A;  4WWO A;  5AZF A;  4FAD A;  2ZZP B;  2Z59 B;  1OEY A;  2N9X A;  4KDL B;  1FXT B;  2IY0 B;  1UZX B;  3VH3 B;  4KDI C;  5L83 A;  1GJZ A;  2KFK B;  2B3A A;  4WWP A;  3IVF A;  2BKR B;  3APD A;  1P3Q U;  4NJ7 A;  3A1Q B;  3BIN A;  1Y8R C;  2XBB C;  4MGI E;  4EEW A;  3QQ8 B;  2BGF A;  1SE9 A;  3ZW3 A;  3OAW A;  4N9F 4;  4HVB A;  4II2 B;  4J6I A;  2N1V A;  4TQ1 A;  3IHP C;  1E8Z A;  2WX1 A;  4FN2 A;  3V61 A;  2CHZ A;  3VDZ A;  1C3T A;  2KLC A;  1WIA A;  2KWV B;  4URK A;  4PS8 A;  5JHB A;  1ZGU B;  4MDK E;  1WZ3 A;  2R2O A;  5E6N A;  3ZRF A;  4W9D A;  2DAF A;  2KTR A;  2MBO A;  2IO1 B;  3R66 C;  3QA8 A;  5TR5 A;  2W9N A;  4FBJ B;  1KJT A;  4IM3 A;  3QCA A;  1IP9 A;  3CMM B;  4M0W B;  2V1Y A;  3RUI B;  1KM7 A;  3VFK A;  4ANV A;  5IA7 A;  2BF8 B;  5C1Z A;  2RR9 A;  2IO3 B;  4HXD A;  3AI5 A;  3R7R A;  1TBE A;  3DBS A;  3A33 B;  4W9K A;  5DCN A;  4NQK E;  1Q1O A;  1V5T A;  4NPN A;  3UGB B;  3CF6 E;  1V86 A;  1F9J A;  1CMX B;  1NBF C;  2R2Q A;  4B95 A;  2UWQ A;  3TMP B;  2AL6 A;  2FIF A;  3QAR A;  1WX7 A;  3KUC B;  4WJQ A;  1YX5 B;  2KVR A;  3DQV A;  1Z5S B;  1OTR B;  1UH6 A;  1WZ0 A;  3LDZ E;  2KQS A;  1R4N I;  1E8W A;  3EHV A;  2CHW A;  4MGZ E;  1WI0 A;  3QK0 A;  1RRB A;  4GDL A;  4B6W A;  2L8J A;  2HTH A;  1EF5 A;  2KWU B;  3PTF C;  1V6E A;  3RZF A;  2KDE B;  1UBI A;  2MWS B;  1RLF A;  1Q0W B;  2MBQ A;  2M0X A;  4EOY A;  4HPM B;  4W9G A;  1E8X A;  4GB9 A;  4HPL B;  4DXA B;  2D07 B;  2DHZ A;  1WGG A;  3JVZ X;  3UIP B;  3WAN A;  2LGX A;  1K8R B;  1SGH A;  2AYO B;  2O2V A;  3DBL I;  3QHT A;  3L10 B;  2MCN B;  1GC7 A;  2KDB A;  2KDI A;  3B1L X;  3K9P B;  3QWZ B;  1LM8 B;  2L76 A;  3T9L A;  3PT2 B;  1S1Q B;  4ZDV A;  1GNU A;  2WYQ A;  2Z0D B;  4OVV A;  4W9I A;  2O2V B;  2GBR A;  2KOX A;  2RPQ A;  4JQW C;  1I42 A;  4NAW B;  4I6P A;  3RUL A;  4ZRI A;  3EEC A;  2O6V A;  2RGF A;  3DVN U;  1H8C A;  3WAM A;  3QC8 B;  3ZO5 B;  2KK8 A;  2JZZ A;  3VUW A;  2DEN B;  3ZDT A;  3HIZ A;  4IWQ A;  3Q3F A;  5BO4 B;  4EZK A;  3SD5 A;  2NBU A;  2CS4 A;  1V49 A;  4MH0 E;  1WYW B;  2MSE D;  2Y5B B;  4GDL B;  1GUA B;  2N1W A;  4M8M A;  4MSM B;  2JRH A;  2PE9 A;  4MM3 A;  3ZNI D;  4BBN F;  4OVU A;  4WJN A;  2C5L C;  3KUZ A;  1WMH B;  3PS6 A;  2D2Q A;  3TBL D;  2IO0 B;  4IM2 A;  3VTW A;  3VVW B;  1JRU A;  2BWF A;  1UEL A;  4K7U A;  2LD9 A;  2LWP A;  4ZYN A;  4AP4 C;  4ANW A;  3DBH I;  2N7E A;  1WM2 A;  1L2N A;  4A3O A;  5CHF A;  1LXD A;  3JSV B;  3L54 A;  3OJ3 A;  3LJ3 A;  2ZNV C;  3PLU A;  4W9J A;  4MEL A;  5DPW A;  4GN1 A;  3DPD A;  1TGZ B;  5J18 A;  3IFW B;  4BKS D;  3P2B A;  3QJZ A;  3KYD D;  3PPA A;  4P7I A;  3UIO B;  5DPT A;  5DPS A;  2DYM A;  2LJ5 A;  3U30 A;  2FCS A;  3HM3 A;  5HKH A;  1WF9 A;  2BYF A;  3PSE B;  4FJZ A;  4WJP A;  2NR2 A;  2FID A;  1E5W A;  4IWP A;  2C7M B;  2WWZ A;  2BPS A;  3B0A A;  4PYU A;  1VD2 A;  3L08 A;  2LAS A;  3W1Y A;  4F7Z A;  5LLI A;  2FCQ A;  3L17 A;  2I1J A;  3GOE A;  1WJ4 A;  2MLB A;  1NDD A;  2KD0 A;  2VRR B;  3PLV A;  1V2Y A;  2HE7 A;  1WR1 A;  3PRM B;  3WAL A;  2C7N B;  2N9P C;  3CST A;  4KSL C;  1WM3 A;  1TZ1 A;  2L00 B;  3L16 A;  4KSK C;  4PS3 A;  2DYB A;  4GSW A;  4RM8 A;  3EFU A;  3X0W A;  2J0K A;  5G2N A;  2KXJ A;  2DZJ A;  3UF8 A;  1HE8 A;  2HD5 B;  2DZI A;  1WGD A;  1XQQ A;  4TUU A;  4W9H A;  3ZTC A;  4G11 A;  3A1Q A;  3SU8 X;  2KQ7 A;  2LZ6 A;  2K39 A;  3DVG Y;  2L7R A;  4A20 A;  4GDK B;  1I35 A;  2PE6 B;  2IYD B;  3NZS A;  3TIX A;  4ZRJ A;  2LI5 A;  2K8B A;  2KX3 A;  2CKH B;  2J7Q B;  3DCG A;  3BY4 B;  5JH5 C;  5DPR A;  2L05 A;  4G3X B;  4F8C B;  1WGY A;  3ECI A;  2J0J A;  2LVO A;  5AEK B;  2KKC A;  2G4D B;  3ML9 A;  4HWI B;  3U7D A;  1E7V A;  4ANX A;  5AZG A;  3DVG X;  4YL8 A;  1WXM A;  3VH4 B;  2M1M A;  1XD3 B;  3KUD B;  3VQI A;  2PPH A;  4ZRK A;  4BVU C;  5JHA A;  2AL3 A;  3B08 A;  2IBI B;  1GG3 A;  4CO7 A;  4HCN B;  2OJR A;  4TQ0 A;  4KVG B;  2KNB A;  3UQA A;  2LXA A;  4EKU A;  3A9J B;  3QX1 A;  4F1S A;  2HJ8 A;  4G50 A;  3JSV A;  3W1S C;  3H9D A;  2BWE S;  3DVN V;  3VXW A;  1WFY A;  4EZJ A;  3OLM D;  2KX0 A;  1WX8 A;  1XT9 B;  1SIF A;  3A9K B;  3KVF B;  3O65 B;  4K7S A;  1ZKH A;  2MBE A;  3PHX B;  4LJO B;  4EUT A;  2GBM A;  4GXB A;  4MGK E;  3ZNH B;  4AWJ A;  4I6L B;  3WIM A;  1P9D U;  4K1R B;  4KZC A;  5J17 A;  1E7U A;  2V3S A;  2K1F A;  3N30 A;  2Z0E B;  2I1K A;  2UYZ B;  3MTN B;  2BYV E;  2K6Q A;  4M8N A;  3MJW A;  2O6V B;  2BKF A;  4KV2 A;  3VTV A;  4GDK A;  2NS5 A;  2ZCB A;  4BKG A;  2KC2 A;  4ICU A;  4K7W A;  3KW5 B;  4KIK B;  1KOT A;  2K25 A;  4GGQ A;  1D3Z A;  5JZE B;  4XX5 A;  3U8Z A;  4LCD E;  3A4R A;  2ZVN A;  4IW0 A;  1UBQ A;  1NI2 A;  1P98 A;  5EDS A;  3APF A;  3PRZ A;  2LVP A;  3ZDM C;  4DWF A;  4E71 A;  5J2R A;  3TCA A;  2MBH A;  3PRP B;  4DHZ B;  2GBJ A;  1VCB A;  2N7D A;  3NY5 A;  4PS7 A;  3ZTD A;  4EZL A;  3H7P A;  4XC2 A;  2JXX A;  2DX5 B;  3RZW C;  4IUM B;  2LRW A;  1L7Y A;  5GMV A;  3HM6 X;  1Z2M A;  2KTF A;  3RCZ A;  2FAZ A;  4JIO U;  2KTR B;  4MJS A;  3APC A;  2GBN A;  2ASQ A;  4AOF A;  2JUO A;  2NBW B;  2GMI C;  4FA6 A;  3R3M A;  4IG7 B;  2C7H A;  3ML8 A;  4LJP B;  5IAA C;  3H6N A;  2MP2 B;  1H4R A;  4WAA A;  3W1S A;  4BKS A;  2JF5 A;  4RM9 A;  2L3Z A;  4NJ6 A;  2L0F A;  2C60 A;  5C23 A;  4DHJ B;  1M94 A;  2MRP A;  4KIK A;  4E3C A;  1WMH A;  2D11 A;  4BOZ B;  3AU5 A;  3Q3J A;  2AEH A;  5CTR C;  3S2A A;  1WH3 A;  2ZCC A;  2LGY A;  4HCP B;  2XEW A;  1C1Y B;  4HDO A;  2RSU A;  2MW5 A;  4MEM A;  1GC6 A;  5D2M B;  1RAX A;  4ASW C;  3V6E B;  1V9J A;  1AAR A;  4MJS B;  3ZKJ C;  3RYT A;  2G3Q B;  1E90 A;  2KWC A;  4G0N B;  4DDI D;  3JYU A;  2ZNV B;  3PRE A;  3QAQ A;  1Q5W B;  2D10 A;  2MX2 A;  2DYO A;  3KH0 A;  1T0Y A;  2IO2 B;  3M62 B;  4FJY A;  1YX6 B;  1IYF A;  1WE7 A;  4HDQ A;  2GBK A;  4W9C A;  3AUL A;  4W9F A;  2LVQ A;  2KHW B;  4PYZ A;  4W9E A;  3C0R B;  3ZNG C;  2ZPY A;  2KZR A;  2ZVO A;  2BYE A;  3A9J A;  4WJO A;  2KDF B;  3SDL C;  3IG3 A;  4GIV A;  3ZLZ A;  3ZNZ B;  4AUQ C;  2V4L A;  4IWO A;  2JY6 A;  2G4S A;  4DHZ E;  1TTN A;  2IZV B;  2LGD A;  3H7S A;  3CSF A;  1PQS A;  3OJ4 B;  3WA0 A;  4IC7 B;  2K6D B;  3HK0 A;  2DAJ A;  4E74 A;  1WRD B;  2JT4 B;  2KAN A;  4NQL B;  2CR5 A;  3I3T B;  3RD2 A;  2KFK A;  4II3 B;  4FJV B;  3R7Q A;  1G6J A;  4ANU A;  4TKN A;  4MGY E;  2NBV B;  4DK5 A;  4X57 B;  3ZUN A;  3AXC A;  2EMT A;  2KJ6 A;  2M8S A;  2L0T A;  3TL5 A;  3VUY A;  3VTU A;  2NPT A;  2FUH B;  2KN5 A;  4BKT A;  3M95 A;  3N3K B;  1OEY J;  2EKE C;  1LQB A;  4HK2 A;  4DHJ D;  2REX A;  2MQJ A;  3ENE A;  4NAW A;  2KMA A;  3PGE A;  5KHO A;  3K9O B;  5E6O A;  3V60 A;  3KYC D;  2YLM A;  3V6C B;  3ZIM A;  1WGH A;  2K8H A;  4EFO A;  4IM0 A;  4MSQ B;  2KJH B;  2PJH A;  2ZEQ A;  5D7G A;  1J0G A;  1X1M A;  2MP2 A;  5D6J B;  4DBG A;  5CX3 A;  1EF1 A;  1WXA A;  3UIN B;  2AWT A;  4HJK A;  2JZ3 B;  1U4A A;  1BT0 A;  1MG8 A;  3N32 A;  2XK5 B;  4FLH A;  2KFJ A;  1UD7 A;  3VUX A;  2ZPN A;  1EUV B;  2EMS A;  3ZRC A;  3PHW B;  3QIJ A;  2DZM A;  4HLE A;  2A5U A;  1YJ1 A;  2LUE A;  3DBR I;  3DOW A;  5G55 A;  5LXH A;  4GOC A;  4JLC A;  1OGW A;  2KJR A;  2JRI B;  1P0R A;  1E8Y A;  3EC8 A;  2QHO A;  1V81 A;  2DZK A;  2FCM A;  1EO6 A;  3H7P B;  5LXI B;  2G45 B;  4WQO B;  4WWN A;  4ICV A;  3JW0 X;  3X23 A;  2JVC A;  5KHQ A;  3M63 B;  4BFR A;  2KC1 A;  1WR6 E;  4TV3 A;  2NCN A;  3NOB A;  2YVC A;  3ZVV A;  4AJY B;  2IY1 B;  4BOS C;  2KO3 A;  3NHE B;  4LDT D;  3M3J A;  4W9L A;  2FCN A;  1ISN A;  2GOW A;  2N9E B;  3ALB A;  4FHK A;  2FNJ B;  2M4N A;  3NZU A;  2ZJD A;  2RD0 A;  2A4Z A;  3WAP A;  2JPH A;  3PVL A;  2WDT B;  4JGH B;  2N4F A;  1R4M I;  4K81 A;  1WX9 A;  5D94 A;  3UQB A;  5E6P A;  2J0M A;  1V5O A;  2D3G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...