1Y8RC

Sumo e1 activating enzyme sae1-sae2-sumo1-mg-atp complex
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
84
structure length
84
Chain Sequence
GDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords Ubiquitin-like 1 activating enzyme E1A
publication title Structures of the SUMO E1 provide mechanistic insights into SUMO activation and E2 recruitment to E1
pubmed doi rcsb
source organism Homo sapiens
total genus 19
structure length 84
sequence length 84
chains with identical sequence F
ec nomenclature
pdb deposition date 2004-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1y8rC00
4NPNA 4FHJA 1WXVA 4WJNA 3N30A 4K7SA 5KHOA 4E71A 1X1MA 2KWVB 2VRRB 2ZVNA 3RCZA 3DOWA 2FCQA 3L08A 1J0GA 3ZUNA 2O2VB 1KJTA 3TCAA 1R4MI 1Y8RC 4LDTD 2IBIB 3A1QB 2BWFA 1WMHA 1XD3B 2FIDA 1RAXA 3APCA 2O6VA 2G45B 4W9IA 4DHJD 4ASWC 5D94A 2FCNA 3ZRCA 4PS8A 2LRWA 4GDLA 3ZO5B 3QJZA 4GN1A 2NBVB 3QA8A 3UF8A 5JH5C 4TQ0A 4KIKB 1QZEA 2L3ZA 3R3MA 3KYCD 4N9F4 3ZIMA 3UQAA 1EUVB 2KTRA 1J8CA 4WWPA 4AUQC 2RGFA 2HTHA 2JT4B 4ANVA 1CMXB 3QWZB 2IZVB 4WWNA 1WRDB 4BKTA 3KUZA 3PRZA 2KJRA 3WAMA 1V6EA 1V49A 4EKUA 3MTNB 2AWTA 1UH6A 2EMTA 5JHBA 5J18A 3W1SA 4FJVB 2LVPA 4FJZA 3T9LA 5HKHA 2BF8B 1KOTA 4MSQB 2KMCA 3HK0A 3RUIB 4XC2A 1V80A 2N1VA 2FCSA 2WWZA 3ML8A 3QC8B 4HXDA 2ZNVB 4IWOA 3U30A 2IO1B 4GDKB 2KQSA 1WX8A 2A4ZA 1WX9A 1YX5B 2DAJA 2LASA 3IFWB 3UQBA 4HK2A 2HE7A 3KYDD 4DDID 2DAFA 3ZNZB 1OQYA 2KN5A 3C0RB 3DVGY 4MEMA 3JYUA 3V62A 4MH0E 4HVBA 1Z2MA 1S1QB 1V9JA 1V81A 2LGYA 2O6VD 4IWQA 2AEHA 2GMIC 3X0WA 3ZRFA 3PT2B 4IM2A 4GSWA 2DENB 2ZPNA 1C1YB 4EOYA 1P3QU 3DDCB 3EHVA 4GOCA 3WANA 3DVGX 3RT3B 4IG7B 4EFOA 4IM0A 4FN2A 5AZHA 1WGRA 3ZDMC 1V86A 5LXIB 2JRIB 1ZGUB 2MBBB 4IWPA 1H8CA 1NBFC 2KFKB 2R2OA 3VUXA 4BOSC 4FLHA 3VTVA 2UWQA 2DZMA 2BYEA 4AJYB 3A1QA 2NS5A 3UIOB 2FUHB 3RULA 2PJHA 3QX1A 3JSVA 3TJPA 3H7PB 3T8MA 5KHQA 4TUUA 3V6EB 2L7RA 2N1WA 4NJ7A 1WI0A 1VCBA 2YLMA 3DBSA 1TGZB 3GZNI 3PRMB 3LJ3A 3CF6E 3VXWA 2C7MB 3DCGA 2MP2B 1MG8A 4KIKA 2BWES 1K8RB 3ECIA 3MHSD 1H4RA 2KVRA 3PGEA 3M62B 1WY8A 2FAZA 2MBHA 2W9NA 3HIZA 2DYMA 5FR6A 2GOWA 4NY0A 1WF9A 2M17A 3NZSA 3MJWA 2CR5A 2LUEA 4AP4C 4P7IA 1U4AA 2EKEC 4EUTA 4AWJA 3IVFA 1E8ZA 3PSEB 4JQWC 4MELA 4DHZE 2GBRA 2KC2A 1V2YA 2JZ3B 1AARA 3L16A 2JZZA 3N32A 3SD5A 1G6JA 4OVUA 1YD8U 3A9JB 1A5RA 2ZVOA 3VUWA 4HJKA 2LGXA 3DBLI 2KQ7A 3ZNID 4MSMB 3VHTC 3GOEA 4RM9A 1I42A 2MSED 2XK5A 1WR1A 3DVNU 2IO3B 3PZDA 1L2NA 3KVFB 5CHFA 4EZLA 2V3SA 4II3B 1I35A 1YIWA 2KX0A 3ZNHB 2CHZA 2L0FA 3OAWA 2KLGA 1OTRB 2ZCCA 2NPTA 4M0WB 5AEKB 1WIAA 3A9KB 2I1KA 4XX5A 4BKSD 1WXMA 4BFRA 4AOFA 2BGFA 2FCMA 5L95C 2GBMA 2DZJA 1WJUA 3NS8A 1Q1OA 3VFKA 3WAPA 5IA7A 4WQOB 1SE9A 2JRHA 3ONSA 4PS7A 5J17A 4G3XB 4K7WA 3R66C 5BO4B 2C9WB 3PHWB 2MQJA 2N4FA 2KO3A 4TV3A 1WJ6A 4WWOA 3A4SC 2CHWA 1WJNA 4DDGD 2ZNVC 2IO2B 3KUCB 2Z0EB 2IY1B 1OEYJ 4JL9A 3BY4B 1WZ3A 2L05A 1R4NI 2KD0A 4KDLB 4TQ1A 4HCPB 4E3CA 2V1YA 1KM7A 2ASQA 4JLCA 2RD0A 3UGBB 1S3SG 1PQSA 2MP2A 4HCNB 4K81A 4WJOA 1WGDA 5JHAA 3SU8X 1GC6A 2J0JA 4MM3A 1ZW7A 2K1FA 3A4RA 4W9FA 4ZYNA 3X23A 1GJZA 4B9KA 1WE6A 4LDTB 4GMVA 5E6PA 2JF5A 3DVNV 2I1JA 2K39A 3O65B 1Q0WB 3DBHI 1E8WA 1P1AA 5G2NA 4DHJB 1Z5SB 2C5LC 1TTNA 2GBNA 3K9OB 3U7DA 3VVWB 2MBOA 1E8YA 3KUDB 4ICVA 4URKA 2J0KA 3Q3JA 1LM8B 1TZ1A 1ZKHA 2KKCA 4X57B 4KSKC 1L7YA 2KFJA 1BT0A 5DPRA 2FNJB 3KH0A 2PE6B 4ANUA 3S2AA 2IY0B 2ZJDA 2KOXA 5E6NA 2G4DB 4BOZB 2BYFA 1WH3A 2IO0B 3NZUA 1E8XA 2K8CA 2YVCA 4W9CA 1F9JA 4HPLB 2D3GA 1LXDA 2NCNA 2ZZPB 4MJSB 4A3OA 1YX6B 1WGHA 2D11A 2RSUA 3UIPB 3VAWA 2DYBA 2O2VA 3QHTA 2KX3A 3DBRI 2JY6A 4FA6A 2DHZA 2D2QA 4K7UA 2A5UA 2LVQA 3K9PB 3L54A 4I6NB 1WM3A 5DPWA 3VTWA 4YL8A 1TBEA 1OEYA 4KSLC 4NAWB 2PEAA 1UBQA 2EMSA 3PLVA 3KW5B 4A20A 2KLCA 2L76A 2LXAA 2D07B 2O6VB 3DPDA 4WAAA 5LLIA 3UINB 3D32A 1WFYA 4GDLB 4OVVA 2KWCA 4LJPB 1WX7A 4J6IA 1EF1A 1T0YA 2CS4A 3W1YA 2KJ6A 3L0WB 4CHKA 4GIVA 4GGQA 4PYZA 5E6OA 3VUYA 1WXSA 3QCAA 3OJ4B 5D7GA 2KZRA 4GB9A 1UELA 1EF5A 4CO7A 4GXBA 3WIMA 2K6DB 2J7QB 3OLMD 2OJRA 2AL3A 3HM3A 1WXAA 2K6QA 2KNBA 2ZCBA 3N3KB 2KANA 1WR6E 4W9GA 1HE8A 3AU5A 3V60A 2XEWA 4IW0A 4GDKA 2N7EA 2MWSB 3H7SA 1GNUA 3ENEA 3Q3FA 2LVOA 4PS3A 3AI5A 2LI5A 1WZ0A 2OOBB 1UGMA 2N9EB 5CHWA 5CHVC 4KDIC 4BBNC 1SGHA 4RM8A 5D6JB 4HDOA 3QIJA 5LXHA 1LQBA 2LGDA 4G50A 3TMPB 3ZVVA 2PE9A 2MLBA 3ZDTA 1P0RA 3R7QA 3TIXA 4LCDE 2KMAA 4WJPA 1WM2A 3PREA 4F8CB 1GG3A 1WE7A 4DBGA 2GBJA 3SHQA 2BPSA 1RRBA 1YJ1A 3QK0A 2L0TA 5CTRC 3ZNGC 1VD2A 4RMAA 3IG3A 4MDKE 2LRUA 4MJSA 2LXCA 4PYUA 4ZDVA 3ZTDA 1NI2A 2DZIA 3QARA 2KFKA 4NQKE 2PPHA 5TR5A 3VH3B 4BKGA 3IBEA 2JPHA 3CSTA 3JVZX 3RYTA 4DK5A 4DHZB 4ANWA 3H7PA 4KV2A 3V6CB 2C7HA 3WAOA 3QAQA 4F7ZA 2R2QA 2KHWB 4NAWA 4FJYA 2KTFA 3ALBA 4II2B 3U8ZA 5AZGA 3EC8A 1E7UA 2CU1A 4BBNF 3ZTCA 2KDFB 3RZFA 3JSVB 3VTUA 2JUOA 3TBLD 1XQQA 2WX1A 4FADA 2MRPA 3B0AA 4KVGB 4K1RB 2D10A 3AULA 1FXTB 2LZ6A 3H6NA 2Y5BB 3NHEB 5DPTA 2LJ5A 3M3JA 2MCNB 2Z0DB 3HM6X 2M1MA 1KLVA 1Q5WB 3AXCA 1XT9B 3H1UA 2GBKA 2LD9A 3BINA 3AU4A 2KDBA 1WGYA 2KDEB 2HD5B 2V4LA 4HDQA 5C1ZA 4IC7B 4NJ6A 2B3AA 3A9JA 4B6WA 4EZKA 3M95A 4XZ4A 2KC1A 3PTFC 1IPGA 2AL6A 4G0NB 2M4NA 4HPMB 2RR9A 4B95A 3PV1A 2XBBC 2N7DA 3V61A 3QQ8B 4GU2A 2JXXA 3PS6A 2G3QB 2ZEQA 4W9KA 3TL5A 4TKNA 1V5OA 1P98A 1RLFA 4NQLB 2WDTB 3IHPC 1RFAA 3L13A 5D2MB 5IAAC 2N9XA 2XK5B 4MGYE 2MX2A 3A9KA 3B1LX 2LWPA 3HHMA 2BKFA 1GC7A 4HWIB 3A33B 4I6LB 5CX3A 1ISNA 4ZRJA 5G55A 4A3PA 4ANXA 1UBIA 2IYDB 4G11A 2HJ8A 3VQIA 2NPTB 1WGGA 4DWFA 2L00B 1IYFA 3ML9A 2BKRB 2MW5A 4F1SA 2NBWB 1IP9A 2MA9B 2NVUI 3EECA 4EEWA 4MGZE 1WMHB 3NOBA 3VDZA 1NDDA 2RPQA 3H9DA 3W1SC 3WA0A 3ZW3A 4IUMB 4HLEA 2AYOB 2DYOA 2CHXA 3SDLC 4E74A 2C60A 4JGHB 4M8NA 3APDA 4IM3A 5C23A 2JVCA 4W9HA 2K25A 3P2BA 3VH4B 4LJOB 1C3TA 1P9DU 3PLUA 3NY5A 1J19A 2FIFA 2KXJA 3PHXB 1EO6A 4W9EA 3LDZE 5AZFA 2KJHB 4JIOU 2M0XA 1D3ZA 4EZJA 2KTRB 4BVUC 2KK8A 3PPAA 2BYVE 2N9PC 2KWUB 4ZRIA 1UD7A 4BKSA 4ZRKA 3WALA 1E7VA 3CMMB 4KZCA 2CKHB 1SIFA 4I6PA 1JRUA 2WX0A 3L17A 3DQVA 5DPSA 2WYQA 3ZKJC 3CSFA 2JWZA 2MBEA 5GMVA 3RZWC 3M63B 2K8BA 4FHKA 2J0MA 4ICUA 3ZLZA 1GUAB 2DX5B 4DXAB 3PRPB 2QHOA 3JW0X 3APFA 2M8SA 3EFUA 3L10B 1V5TA 3RD2A 5L83A 3PVLA 2ZPYA 5JZEB 1YQBA 2Z59B 4AJWA 3OJ3A 5EDSA 2L8JA 4FULA 4KZ0A 4NNJB 4MGIE 4CYEA 2KDIA 2REXA 2C7NB 2G4SA 4W9LA 2NR2A 4W9JA 4FBJB 4M8MA 1WYWB 2MBQA 4W9DA 4WJQA 1E90A 1LFDA 2K8HA 1WJ4A 2NBUA 5DCNA 3R7RA 5J2RA 1UZXB 1M94A 2UYZB 2DZKA 3I3TB 3B08A 4MGKE 1E5WA 1OGWA
chains in the Genus database with same CATH superfamily
1ZXHA 4ACFA 3I63C 4FHJA 1PDXA 4YWGG 4K7SA 5KHOA 2INNE 2BS4B 3RCZA 4DXFA 1QOBA 3TCAA 3R8BA 3MC8A 2CJOA 2G45B 4DHJD 4ASWC 4GDLA 3P4SB 2NBVB 3QA8A 4TQ0A 2K3UA 4KIKB 1QZEA 3ZIMA 1MHXA 2RGFA 4ANVA 1CMXB 2IZVB 4HROA 4XYCA 2KJRA 1V6EA 3MTNB 1UH6A 5JHBA 2BVCA 2LVPA 2ZW1A 3T9LA 2K0PA 2BF8B 1HTOA 4HXDA 2IO1B 1MHHE 1TS4A 4DDID 1K51A 1OQYA 4LNOA 1TS2A 2O6VD 3X0WA 3ZRFA 2INPE 3P1MA 2ZPNA 3TEZA 1C1YB 4YT0B 3ZQ4A 4EOYA 3DDCB 3WANA 3DVGX 3RT3B 4EFOA 4IWPA 2MBBB 2AX5A 2R2OA 2ICIA 3VR9B 2BYEA 3UIOB 1YN3A 3AN1A 2PJHA 3H7PB 5KHQA 1VCBA 4BZAA 1TGZB 3GZNI 1K52A 3BWUD 3VXWA 2WXRA 3AEGB 1MG8A 3ECIA 1H4RA 2KVRA 3O13A 1WY8A 1GB4A 2MBHA 3FKYA 1WF9A 2WP9B 2CR5A 2WDVB 3N9YC 1E8ZA 4MELA 3DHGC 5EE0A 3AH7A 4DHZE 1ZP0B 4OVUA 1SE3A 5T8IA 3VUWA 4HJKA 1UWMA 1JQ4A 5BYRA 3DVNU 3PZDA 3KVFB 3ZNHB 2CHZA 2M0AA 2KLGA 4XWWA 3C19A 5AEKB 1DOXA 2I1KA 2BGFA 2FCMA 2L52A 3VFKA 3R66C 5BO4B 5IN7A 3KUCB 1AW7A 2IY1B 1C78A 3BY4B 3SFDB 2L05A 1VDVA 3B9JA 4D2KA 4KDLB 4TQ1A 4E3CA 1SE2A 2ASQA 3ABVB 2QCZA 1FXIA 1V1OA 2MP2A 4K81A 5JHAA 4LNIA 2J0JA 2K1FA 1GJZA 1Q0WB 3RMKC 1P1AA 3E56A 1V97A 3KWVA 5BMHA 5DPRA 3VRBB 3KH0A 2CJNA 3S2AA 2V3NA 2WHIA 1WH3A 3NZUA 1E8XA 2KQ4X 1N60A 1FPYA 2KMMA 2RDGA 1LXDA 2R61A 3AEDB 3P4QB 1E10A 2OJWA 2ZZPB 1AWDA 4M0WA 2ONQA 2D3BA 3UIPB 2DYBA 1XLPA 2FBWB 5DPWA 1OEYA 4NAWB 2PEAA 1VJKA 3PLVA 3KW5B 2LXAA 5LLIA 3AE1B 1TZOA 4GDLB 2KWCA 2IGDA 4LJPB 3MC0B 1WX7A 2LHDA 1XLOA 1I4QA 3MHZA 4REZA 4CHKA 1TS5A 3QCAA 5C3JB 4GLSC 3DHHC 3MC9A 2KACA 1QILA 2OJRA 2EKIA 1FNUA 2KNBA 3N3KB 3EA6A 3GE3C 3AU5A 3C8YA 4GDKA 2N7EA 1ZDVA 3H7SA 1GNUA 3ENEA 3AE9B 2LVOA 3Q3FA 3AE4B 1WZ0A 2WXIA 4KDIC 4RM8A 4HDOA 1JALA 1L4DB 2N9LA 3H8HA 1VZ8A 1WE7A 2N7JA 2V4IB 4C4VA 4PYUA 1E6EB 1SF0A 1NI2A 3QARA 5TR5A 1ROEA 3VH3B 2K9XA 3IBEA 3JVZX 3RYTA 3AEBB 5TSSA 2H88B 4DHZB 4KV2A 2LMCA 3WAOA 3QAQA 2KHWB 4JX1C 3AE7B 2KTFA 5BYQA 3AEFB 3VTUA 1XQQA 2LZ6A 3HVDA 3H6NA 3NHEB 2E6XA 1E7PB 3W5UB 1DOIA 1FIQA 2N9KA 1CK1A 3HM6X 1Y56A 2JU6X 4RGTA 2GBKA 1FMAD 3Q3NC 5C1ZA 4NJ6A 2B3AA 1N63A 3A9JA 2BT6A 4B6WA 3M95A 2YEPF 2KC1A 1IPGA 1T0RC 3PV1A 2PVGC 3QQ8B 4GU2A 1C77A 2ZEQA 2M56B 1P98A 1RLFA 3GZNB 3L13A 2SAKA 2N9XA 2BKFA 1GC7A 2MJDA 4I6LB 1ISNA 4ZRJA 5G55A 2CU3A 4G11A 1P7FA 4ZHPA 1IYFA 2D5GA 1CZPA 2MA9B 1WMHB 4HLEA 3WA0A 3U4EG 2DYOA 4W9HA 1C3TA 4LJOB 2LUMA 3PLUA 1J19A 3BVMA 2QC8A 3LDZE 3AECB 2M0XA 4YSZB 2UU7A 4MH8A 4BVUC 2KK8A 4L1BA 5E6JA 3RI7C 2N9PC 4ZRIA 1E7VA 3CMMB 1SIFA 3ZKJC 1ET9A 3GE8C 2MBEA 3RZWC 1YQ4B 2DX5B 1FFUA 1KFYB 2QHOA 2XNAC 2KVZA 2LHEA 4ITKA 3DHIC 1YQBA 3KWLA 5EDSA 4K3CA 2L8JA 4FULA 2DWQA 4NNJB 1T0SC 2V3PA 1WYWB 3BK2A 4NAMA 3CIRB 1E90A 3T3OA 2VH2A 5C2TB 1OGWA 4NPNA 1I4HA 1C76A 2JWUA 3Q8EA 2VRRB 3L08A 4Q2JA 4LDTD 3A1QB 2FIDA 3APCA 1BMLC 1P7EA 5D94A 3TSSA 2LRWA 1B1ZA 5JH5C 1FRRA 4HJGE 2L3ZA 3KYCD 4N9F4 1EUVB 2KTRA 4WWPA 1SE4A 3FILA 4M02A 2X8XX 4BKTA 3KUZA 1IBXA 3P63A 1F1HA 1LO5D 1V49A 4JE3B 4EKUA 1BXTA 3W1SA 1ZOYB 1KOTA 2KMCA 4XC2A 3QC8B 2IGHA 2WWZA 5HG2A 4S17A 2ZNVB 3BVZA 4GDKB 2A4ZA 3UQBA 3IFWB 1UWXA 1YX5B 2DAJA 2LASA 5D3IB 2DAFA 3C0RB 2VZKD 4HVBA 4ZOHC 1Z2MA 1V9JA 4IWQA 2GMIC 3AE6B 3PT2B 2DENB 1P3QU 3EHVA 4KGRA 4C4VB 3BK1A 4IG7B 3W5VB 5FK9C 1WGRA 1V86A 4OZCA 1ZGUB 3VUXA 4O1NA 4BOSC 2NS5A 3RNGC 3QX1A 3JSVA 1D5ZC 1V1PB 1L0YB 4NJ7A 3NVYA 4A6QA 2K5PA 2WXPA 3I9V1 2J53A 3W9CB 1F77A 1K8RB 4MM3B 3PGEA 3V3XA 5FR6A 3RN9C 1L6VA 3NUHB 4P7IA 1PUTA 5EE1A 3AB5A 3SEBA 3NS1A 2GBRA 2JZ3B 1AARA 2INCC 3A9JB 2JZPA 2ZVOA 1R4NB 3URYA 2JYEA 2LGXA 2Y5CA 3VHTC 2XK5A 3P4RB 2IO3B 5CHFA 4II3B 1T6BX 2KX0A 1XO3A 2E3TA 1WIAA 2WXFA 3DWMA 4BKSD 1WXMA 4AOFA 3MFGA 2GBMA 3NVZA 2GB1A 1WJUA 1Q1OA 3HRDD 2W3SA 2M19A 2JRHA 4K7WA 1QLBB 2WS3B 4TV3A 2KO3A 4WWOA 1WJNA 1C4AA 4WWMA 1J7AA 4HEA1 1DGJA 1WZ3A 2QDFA 5I4DA 1TJEA 4S0RA 1C79A 3UGBB 1TKEA 1S3SG 1WGDA 2Z8LA 3SU8X 4ZRQA 1ZDXA 3TUOA 4W9FA 3X23A 4B9KA 3BIID 1E9MA 5E6PA 4WAFA 1EU4A 1E8WA 2PKOA 4TMAB 3ZYYX 2C5LC 4NZLB 2GBNA 2FE8A 3U7DA 4URKA 2J0KA 3Q3JA 1LM8B 2INDC 1TZ1A 3GP7A 3IAM1 4KSKC 1EM7A 5MPOA 2PE6B 4ANUA 2WQYB 2ZJDA 4BOZB 3RFZB 3BYYB 2YVCA 3R2IA 2QJLA 4MJSB 2D11A 2NTSA 4HPPA 5HI1A 3VAWA 1HTQA 2O2VA 2KX3A 2JY6A 1M4VA 4OZAA 4ZYSA 1WM3A 2KN4A 4KSLC 4USAA 1D5MC 1HXYD 1UBQA 3DPDA 4WAAA 2D07B 1FXAA 3D32A 2LGIA 4J6IA 1NYRA 2CS4A 4GGQA 3VUYA 4HRSA 4GB9A 3T3NA 4CO7A 4GXBA 1C4PA 1IBXB 2J7QB 3OLMD 2AL3A 3P4PB 1ET6A 1WXAA 1WSPA 1HE8A 1JMLA 4C7YA 3V60A 2XEWA 4IW0A 1JWAD 4PS3A 2LI5A 5IO9A 2N9EB 1I4GA 1QQRA 2OEDA 1F0ZA 1LQBA 2L32A 2LGDA 2NMQA 1AN8A 3ZDTA 4TSSA 3TIXA 1WM2A 2GBJA 3QK0A 2L0TA 4DQOC 1VD2A 2LEKA 2LRUA 4WURA 5IP4D 4ZDVA 5G5HA 2KFKA 2PPHA 2JPHA 3FC4A 1FCCC 4LK0M 3VR8B 4ANWA 1HQRD 1JWBD 2JX5A 2C7HA 2R2QA 1FEHA 1D5XC 4DXGA 3U8ZA 3ALBA 5AZGA 2KDFB 3JSVB 4US9A 4FADA 3AULA 4LLGM 5DPTA 3RPFC 2W54A 2Z0DB 2M1MA 1XT9B 3H1UA 3OWEB 2LD9A 3BINA 2YEPB 4EZKA 3IT4B 2QIEB 3AEEB 3PTFC 2M4NA 2RR9A 1SSNA 4B95A 2MJ3A 2XBBC 2N7DA 1UGJA 2G3QB 4W9KA 1QKZA 4NQLB 3IHPC 5D2MB 5EE3A 2XK5B 1FO4A 3N1YC 4AS1A 3A9KA 3B1LX 1DYQA 2BB6A 2LWPA 3SR6A 1L0VB 2WXHA 1UBIA 2L00B 4KGTA 2MW5A 2NVUI 3H9DA 2RDHA 4L2YA 3SDLC 4E74A 3BZDB 4JGHB 3ETRA 3I57A 1P9DU 4P16A 1WXQA 1EO6A 1F2RI 3MJ5A 1HZ6A 1TY2A 3PZ8A 1KF6B 3PPAA 2BYVE 5G5GA 4BKSA 4ZRKA 3I5JC 3WALA 3RNCC 4KZCA 5DPSA 2WX0A 3DQVA 5AUKA 4FHKA 3ZLZA 3JW0X 3AE5B 4RF1A 1SEBD 3P42A 1TIFA 5JZEB 4AJWA 4KZ0A 4MGIE 4C7ZA 2KDIA 2REXA 4W9LA 1PGAA 2NR2A 4W9JA 4W9DA 5AUIA 3ZJTA 3L4PA 3I3TB 1CJEA 1YQ3B 1WXVA 3Q8AA 3N30A 4WJNA 3IAS1 3EFCA 1L4ZB 2KWVB 2O2VB 1R4MI 1Y8RC 5IKCM 2IBIB 2O6VA 4W9IA 1NEKB 1TT5B 3ZRCA 4PS8A 3ZO5B 3QJZA 1N6ZA 4GN1A 2PIAA 3UF8A 4B0EA 4P6VF 1MJDA 3R3MA 2IPKD 4AUQC 1FNVA 1WRDB 2WNMA 1RM6C 1FFVA 3LXFA 3PRZA 4RCOA 3WAMA 1JW9D 1VR9A 2MH7A 2EMTA 5J18A 5IOIA 4YTPB 1MPEA 2KDMA 5HKHA 4JPSA 4M00A 2WDRB 1V80A 2N1VA 2FCSA 2QSDA 4IWOA 2KQSA 2BW2A 1WX8A 1WX9A 2ACZB 2KN5A 3DVGY 3N20C 3JYUA 4MH0E 4US8A 4LNFA 1YJJA 2WXNA 1OQQA 2LGYA 2AEHA 4IM2A 3BVGA 3GB1A 5GXGB 2LJIA 4FN2A 2N0SB 3ZDMC 2JRIB 2Y5PA 4P1BC 2KFKB 4HKZE 1UNSA 1RFKA 2BS3B 4AJYB 1XLQA 2FUHB 1YJIA 3TJPA 4TUUA 3V6EB 1KRHA 2N1WA 2YLMA 3PRMB 4KKJA 1GB1A 3CF6E 1YN5A 2MP2B 4KIKA 2BWES 4ARCA 3M62B 2W9NA 2DYMA 1FNWA 4AP4C 2BBCA 3PZ7A 1U4AA 2EKEC 4EUTA 2PTLA 4KKIA 2KC2A 1V2YA 2BQQA 2JZZA 1G6JA 2DBYA 1A5RA 3Q69A 1MVKA 1XCTL 1XXGA 3ZGZA 3NVVA 2KQ7A 3ZNID 4YTNB 3GOEA 1I42A 2MSED 5LNK1 2EELA 4EZLA 3AM9A 1YIWA 2D3CA 1SJHD 2L0FA 3OAWA 2NPTA 4M0WB 3A9KB 4XX5A 1WRIA 4A55A 3WAPA 3NS8A 5IA7A 4PS7A 5J17A 4G3XB 2C9WB 1GAQB 1WJ6A 3A4SC 4DDGD 2ZNVC 2IO2B 1QF6A 2Z0EB 3LYYA 1AYFA 2MEKA 4HCPB 2V1YA 4RH6A 1KM7A 2RD0A 4BAXA 1PQSA 2MHJA 1B9RA 1GC6A 1UF0A 1ZW7A 1D4BA 2GI9A 4ZYNA 1WE6A 4GMVA 1N5XA 3O65B 3DBHI 1YMHE 5G2NA 4DHJB 1STEA 4OVZA 3B2FA 4C00A 3K9OB 3VVWB 4ICVA 1ZKHA 2KKCA 4X57B 2X38A 4RF0A 1L7YA 1FRDA 2IDYA 2IY0B 3DWGC 1BUIC 2BS2B 2BYFA 2WXLA 2K8CA 1NVID 4W9CA 1F9JA 4HPLB 4OW0A 3NZ3A 1TKYA 4A3OA 1WGHA 2RSUA 3QHTA 1XCQL 3DBRI 4FA6A 2DHZA 2A5UA 2LVQA 3NJTA 3K9PB 3L54A 4I6NB 1EWCA 1TBEA 1T3QA 2EMSA 3E9SA 4A20A 2O6VB 3UINB 1WFYA 3Q2AC 4OVVA 4RGNA 4C56C 2J42A 1EF1A 2JQRB 3W1YA 2KJ6A 3L0WB 4GIVA 1N5WA 4PYZA 5E6OA 1WXSA 2WU5B 3OJ4B 1NI3A 5D7GA 2KZRA 1HZ5A 3AE3B 1I4PA 3HM3A 4W9GA 1L6UA 1R4MB 1N61A 4R3DA 3OG5A 1QOGA 2OOBB 1J7CA 1UGMA 5CHWA 5CHVC 4C80A 1TS3A 4G50A 2PE9A 2MLBA 1P0RA 3R7QA 3PREA 4J3OD 3SHQA 1GPXA 1RRBA 1YJ1A 1I4RA 1EWYC 2RMMA 1I4XA 4RMAA 2WXJA 4MDKE 3NVWA 1L5PA 1FCLA 2DZIA 4NQKE 4BKGA 1ZE3D 3CSTA 4IOIE 1YNTE 4DK5A 2OHFA 3V6CB 2BTEA 4F7ZA 3U52E 4NAWA 1VLBA 4FJYA 3RNEC 1E7UA 4BBNF 3ZTCA 4A8XC 2JXTA 2JUOA 3TBLD 4K3BA 2MRPA 1QT9A 2KAJA 3B0AA 4K1RB 2D10A 4KVGB 4LNKA 3AE2B 1FXTB 2Y5BB 1KLUD 2G9HD 1XLNA 2LJ5A 1L0XB 2MCNB 1XEEA 4WQMA 1KLVA 3SFEB 3LB8C 2JYTA 3AU4A 2KDBA 2KDEB 2HD5B 2DLBA 2V0GA 1QOFA 4IC7B 4MT5A 5BMIA 2WLBA 2AL6A 3V61A 3PS6A 3TL5A 4JWSC 1V5OA 2WDTB 3W2DA 1TY0A 2W55A 1ZUD2 1J7BA 3A33B 5CX3A 4ANXA 4A3PA 3VRAB 3B2GA 3VQIA 2HJ8A 2NPTB 1WGGA 4DWFA 4OZBA 3ML9A 2AQ1B 1YN4A 4F1SA 2NBWB 4LTUA 3EECA 4EEWA 1WGKA 3NOBA 3VDZA 2RPQA 3W1SC 3ZXRA 2CHXA 2C60A 5C23A 3P2BA 3VH4B 2FIFA 2KXJA 3PHXB 4JIOU 4B0MA 4EZJA 2KTRB 1SIJA 3FILB 2AQ2B 2CKHB 4I6PA 2WXOA 3CSFA 1PGXA 2JWZA 2K8BA 2J0MA 4ICUA 4DXAB 3PRPB 3TEXA 3APFA 3L10B 3PVLA 1PFDA 2Z59B 3OJ3A 5H8YE 2QMTA 1K50A 3NRZA 2C7NB 2G4SA 3Q3OC 4M8MA 2MBQA 4WJQA 5DCNA 3R7RA 1T0QC 1YOVB 1UZXB 2UYZB 2DZKA 3KQ4A 4XDDA 1E5WA 1SXTA 3TEYA 4RGMA 2G1EA 4E71A 1X1MA 2ZVNA 2QEJC 3DOWA 2FCQA 1J0GA 3ZUNA 3DBHB 1KJTA 1VRAB 4M01A 4EE2A 2BWFA 1WMHA 1FD6A 1XD3B 1RAXA 2RDBC 4KGSA 2FCNA 2PW9A 1IUEA 1ENFA 2I38A 1HA5A 3UQAA 1GOZA 1J8CA 2HTHA 2JT4B 3QWZB 3KLSX 4WWNA 3MP9A 2PLPA 3AE8B 2AWTA 4CQNA 2GLSA 4FJVB 3Q14C 3RNAC 4FXCA 3DBRB 2NTTA 2Y3AA 1VZ7A 2W3RA 4FJZA 1C4CA 1CQVA 4MSQB 1R7SA 3RUIB 2KT7A 3HK0A 3ML8A 3U30A 5HHDG 1TYGB 1KLGD 4HK2A 2HE7A 3CWIA 3KYDD 1HEZE 3ZNZB 2WXQA 1PGBA 4MEMA 3V62A 1S1QB 1V81A 1T5XD 4H2AA 3J9CA 3HVZA 2WXGA 2FUG1 4GSWA 1MI0A 2L1AA 2LFIA 4GOCA 1SBBB 4IM0A 1VZ6A 5AZHA 5LXIB 5FR3A 1H8CA 1NBFC 4FLHA 3VTVA 1A70A 2DZMA 2UWQA 3A1QA 3RULA 2IJ0A 3T8MA 2L7RA 1WI0A 3DBSA 1D6EC 3LJ3A 2C7MB 2HDEA 3DCGA 3UI3A 3MHSD 2FAZA 1XF5L 3HIZA 2GOWA 4NY0A 2BB5A 2M17A 3NZSA 2J52A 3MJWA 2LUEA 1K53A 4AWJA 3IVFA 3PSEB 4JQWC 1JWMD 1Q10A 3SD5A 3N32A 3L16A 2AQ3B 1YD8U 1EU3A 3DBLI 2LGSA 4MSMB 1SJED 4RM9A 2DNFA 1WR1A 1QOAA 3AV8A 1L2NA 4YTMB 4LNNA 1ZXIA 2V3SA 1I35A 4A90A 4A9AA 3PO0A 4AQ7A 1OTRB 2ZCCA 2VH1A 4BFRA 5L95C 2DZJA 2WDQB 4WQOB 1SE9A 2J4XA 3ONSA 3PHWB 2MQJA 2N4FA 4ARIA 2CHWA 2WGSA 1OEYJ 4JL9A 4L23A 3Q8BA 2SEBD 1V1PA 1R4NI 2KD0A 3Q8FA 1V8CA 4JLCA 3FAHA 4HCNB 1OQRA 4WJOA 2K22A 4MM3A 3A4RA 4LDTB 2JF5A 3DVNV 4IKGA 2I1JA 2K39A 1ESFA 2QILA 2IGGA 1Z5SB 1TTNA 2MBOA 1E8YA 3KUDB 5FKAC 4JWUC 4RNAA 2KFJA 1BT0A 2FNJB 4YSYB 2JSVX 4WH4A 1E0ZA 2KOXA 5E6NA 5BYSA 2G4DB 1OFFA 4XGAB 2IO0B 3Q8CA 1IGDA 1IGCA 2D3GA 2NCNA 1YX6B 3ZJUA 3ZJVA 2V9HA 2D2QA 4K7UA 1I7HA 3RNBC 3VTWA 4YL8A 3Q6BA 3V05A 2VZKB 3IT6B 2KLCA 2L76A 2WXMA 4HKQA 1PYWD 3ZXVA 1F52A 2B76B 3U2SC 1T0YA 1JWUD 2ON8A 3N1XC 1UELA 1EF5A 3WCQA 2HJ1A 4UDUC 3WIMA 2RPVA 2K6DB 5HFYA 2K6QA 2ZCBA 2KANA 1WR6E 3AMZA 3EGRA 1JROA 2MWSB 1ZPSA 3AI5A 2WXKA 4BBNC 1SGHA 3N1ZC 5D6JB 3QIJA 1ACCA 5LXHA 3ZVVA 3TMPB 4LCDE 2KMAA 4WJPA 4F8CB 1GG3A 4DBGA 1JRPA 2BPSA 5CTRC 1RWSA 3ZNGC 4OHJA 3IG3A 4MJSA 2LXCA 1DOYA 4ZRPA 3ZTDA 3Q3MC 1NENB 4KX6B 2PMVA 3H7PA 4QAYA 3AEAB 4II2B 1N62A 3EC8A 3HUIA 2CU1A 5D3DA 2KWDA 3RZFA 2PVOD 3BYTB 1F2RC 2WX1A 4WIPA 4ZHOA 3M3JA 3EUB2 1Q5WB 3AXCA 1NYQA 3NG0A 1WGYA 2V4LA 4HDQA 2Q5WD 2HTME 4XZ4A 4G0NB 3R2TA 4HPMB 4PT5A 4XWTA 4YXDB 2JXXA 4IDIA 4TKNA 1RFAA 5IAAC 4MGYE 2MX2A 3HHMA 4HWIB 5H92C 1KTKA 2BYTA 2IYDB 2ZW0A 4XDCA 3TEWA 2BKRB 1RYJA 1IP9A 4MGZE 3IXSA 1NDDA 3ZW3A 4NJCA 4IUMB 2L83A 2AYOB 4M8NA 3APDA 4IM3A 2JVCA 2K25A 2W82A 2MJEA 3NY5A 2I2YA 2GRIA 3GS2A 2WU2B 4W9EA 5JXVA 5AZFA 2KJHB 5BMGA 3DBLB 1D3ZA 1FM0D 3U7ZA 1WYGA 4N59A 2KWUB 1UD7A 4RFBA 3RNFC 4P1CC 4YSXB 1JRUA 3L17A 1C9FA 2WYQA 1JCKB 1MG4A 5GMVA 1LGRA 3M63B 1GUAB 4XE0A 1WWTA 2TSSA 2D3AA 2M8SA 3EFUA 3RD2A 1V5TA 5L83A 2KYWA 4PK1A 2ZPYA 4MACA 5EE9A 4N58A 4CYEA 1SB3C 4FBJB 2H89B 4N6EB 1UUPA 1LFDA 1WJ4A 2K8HA 2NBUA 4RGOS 5J2RA 1TKGA 1MFWA 1M94A 2XN9C 3B08A 1KH0A 4MGKE 1JWSD
chains in the Genus database with same CATH topology
4NPNA 4FHJA 1WXVA 4WJNA 3N30A 4K7SA 5KHOA 4E71A 1X1MA 2KWVB 2VRRB 2ZVNA 3RCZA 3DOWA 2FCQA 3L08A 1J0GA 3ZUNA 2O2VB 1KJTA 3TCAA 1R4MI 1Y8RC 4LDTD 2IBIB 3A1QB 2BWFA 1WMHA 1XD3B 2FIDA 1RAXA 3APCA 2O6VA 2G45B 4W9IA 4DHJD 4ASWC 5D94A 2FCNA 3ZRCA 4PS8A 2LRWA 4GDLA 3ZO5B 3QJZA 4GN1A 2NBVB 3QA8A 3UF8A 5JH5C 4TQ0A 4KIKB 1QZEA 2L3ZA 3R3MA 3KYCD 4N9F4 3ZIMA 3UQAA 1EUVB 2KTRA 1J8CA 4WWPA 4AUQC 2RGFA 2HTHA 2JT4B 4ANVA 1CMXB 3QWZB 2IZVB 4WWNA 1WRDB 4BKTA 3KUZA 3PRZA 2KJRA 3WAMA 1V6EA 1V49A 4EKUA 3MTNB 2AWTA 1UH6A 2EMTA 5JHBA 5J18A 3W1SA 4FJVB 2LVPA 4FJZA 3T9LA 5HKHA 2BF8B 1KOTA 4MSQB 2KMCA 3HK0A 3RUIB 4XC2A 1V80A 2N1VA 2FCSA 2WWZA 3ML8A 3QC8B 4HXDA 2ZNVB 4IWOA 3U30A 2IO1B 4GDKB 2KQSA 1WX8A 2A4ZA 1WX9A 1YX5B 2DAJA 2LASA 3IFWB 3UQBA 4HK2A 2HE7A 3KYDD 4DDID 2DAFA 3ZNZB 1OQYA 2KN5A 3C0RB 3DVGY 4MEMA 3JYUA 3V62A 4MH0E 4HVBA 1Z2MA 1S1QB 1V9JA 1V81A 2LGYA 2O6VD 4IWQA 2AEHA 2GMIC 3X0WA 3ZRFA 3PT2B 4IM2A 4GSWA 2DENB 2ZPNA 1C1YB 4EOYA 1P3QU 3DDCB 3EHVA 4GOCA 3WANA 3DVGX 3RT3B 4IG7B 4EFOA 4IM0A 4FN2A 5AZHA 1WGRA 3ZDMC 1V86A 5LXIB 2JRIB 1ZGUB 2MBBB 4IWPA 1H8CA 1NBFC 2KFKB 2R2OA 3VUXA 4BOSC 4FLHA 3VTVA 2UWQA 2DZMA 2BYEA 4AJYB 3A1QA 2NS5A 3UIOB 2FUHB 3RULA 2PJHA 3QX1A 3JSVA 3TJPA 3H7PB 3T8MA 5KHQA 4TUUA 3V6EB 2L7RA 2N1WA 4NJ7A 1WI0A 1VCBA 2YLMA 3DBSA 1TGZB 3GZNI 3PRMB 3LJ3A 3CF6E 3VXWA 2C7MB 3DCGA 2MP2B 1MG8A 4KIKA 2BWES 1K8RB 3ECIA 3MHSD 1H4RA 2KVRA 3PGEA 3M62B 1WY8A 2FAZA 2MBHA 2W9NA 3HIZA 2DYMA 5FR6A 2GOWA 4NY0A 1WF9A 2M17A 3NZSA 3MJWA 2CR5A 2LUEA 4AP4C 4P7IA 1U4AA 2EKEC 4EUTA 4AWJA 3IVFA 1E8ZA 3PSEB 4JQWC 4MELA 4DHZE 2GBRA 2KC2A 1V2YA 2JZ3B 1AARA 3L16A 2JZZA 3N32A 3SD5A 1G6JA 4OVUA 1YD8U 3A9JB 1A5RA 2ZVOA 3VUWA 4HJKA 2LGXA 3DBLI 2KQ7A 3ZNID 4MSMB 3VHTC 3GOEA 4RM9A 1I42A 2MSED 2XK5A 1WR1A 3DVNU 2IO3B 3PZDA 1L2NA 3KVFB 5CHFA 4EZLA 2V3SA 4II3B 1I35A 1YIWA 2KX0A 3ZNHB 2CHZA 2L0FA 3OAWA 2KLGA 1OTRB 2ZCCA 2NPTA 4M0WB 5AEKB 1WIAA 3A9KB 2I1KA 4XX5A 4BKSD 1WXMA 4BFRA 4AOFA 2BGFA 2FCMA 5L95C 2GBMA 2DZJA 1WJUA 3NS8A 1Q1OA 3VFKA 3WAPA 5IA7A 4WQOB 1SE9A 2JRHA 3ONSA 4PS7A 5J17A 4G3XB 4K7WA 3R66C 5BO4B 2C9WB 3PHWB 2MQJA 2N4FA 2KO3A 4TV3A 1WJ6A 4WWOA 3A4SC 2CHWA 1WJNA 4DDGD 2ZNVC 2IO2B 3KUCB 2Z0EB 2IY1B 1OEYJ 4JL9A 3BY4B 1WZ3A 2L05A 1R4NI 2KD0A 4KDLB 4TQ1A 4HCPB 4E3CA 2V1YA 1KM7A 2ASQA 4JLCA 2RD0A 3UGBB 1S3SG 1PQSA 2MP2A 4HCNB 4K81A 4WJOA 1WGDA 5JHAA 3SU8X 1GC6A 2J0JA 4MM3A 1ZW7A 2K1FA 3A4RA 4W9FA 4ZYNA 3X23A 1GJZA 4B9KA 1WE6A 4LDTB 4GMVA 5E6PA 2JF5A 3DVNV 2I1JA 2K39A 3O65B 1Q0WB 3DBHI 1E8WA 1P1AA 5G2NA 4DHJB 1Z5SB 2C5LC 1TTNA 2GBNA 3K9OB 3U7DA 3VVWB 2MBOA 1E8YA 3KUDB 4ICVA 4URKA 2J0KA 3Q3JA 1LM8B 1TZ1A 1ZKHA 2KKCA 4X57B 4KSKC 1L7YA 2KFJA 1BT0A 5DPRA 2FNJB 3KH0A 2PE6B 4ANUA 3S2AA 2IY0B 2ZJDA 2KOXA 5E6NA 2G4DB 4BOZB 2BYFA 1WH3A 2IO0B 3NZUA 1E8XA 2K8CA 2YVCA 4W9CA 1F9JA 4HPLB 2D3GA 1LXDA 2NCNA 2ZZPB 4MJSB 4A3OA 1YX6B 1WGHA 2D11A 2RSUA 3UIPB 3VAWA 2DYBA 2O2VA 3QHTA 2KX3A 3DBRI 2JY6A 4FA6A 2DHZA 2D2QA 4K7UA 2A5UA 2LVQA 3K9PB 3L54A 4I6NB 1WM3A 5DPWA 3VTWA 4YL8A 1TBEA 1OEYA 4KSLC 4NAWB 2PEAA 1UBQA 2EMSA 3PLVA 3KW5B 4A20A 2KLCA 2L76A 2LXAA 2D07B 2O6VB 3DPDA 4WAAA 5LLIA 3UINB 3D32A 1WFYA 4GDLB 4OVVA 2KWCA 4LJPB 1WX7A 4J6IA 1EF1A 1T0YA 2CS4A 3W1YA 2KJ6A 3L0WB 4CHKA 4GIVA 4GGQA 4PYZA 5E6OA 3VUYA 1WXSA 3QCAA 3OJ4B 5D7GA 2KZRA 4GB9A 1UELA 1EF5A 4CO7A 4GXBA 3WIMA 2K6DB 2J7QB 3OLMD 2OJRA 2AL3A 3HM3A 1WXAA 2K6QA 2KNBA 2ZCBA 3N3KB 2KANA 1WR6E 4W9GA 1HE8A 3AU5A 3V60A 2XEWA 4IW0A 4GDKA 2N7EA 2MWSB 3H7SA 1GNUA 3ENEA 3Q3FA 2LVOA 4PS3A 3AI5A 2LI5A 1WZ0A 2OOBB 1UGMA 2N9EB 5CHWA 5CHVC 4KDIC 4BBNC 1SGHA 4RM8A 5D6JB 4HDOA 3QIJA 5LXHA 1LQBA 2LGDA 4G50A 3TMPB 3ZVVA 2PE9A 2MLBA 3ZDTA 1P0RA 3R7QA 3TIXA 4LCDE 2KMAA 4WJPA 1WM2A 3PREA 4F8CB 1GG3A 1WE7A 4DBGA 2GBJA 3SHQA 2BPSA 1RRBA 1YJ1A 3QK0A 2L0TA 5CTRC 3ZNGC 1VD2A 4RMAA 3IG3A 4MDKE 2LRUA 4MJSA 2LXCA 4PYUA 4ZDVA 3ZTDA 1NI2A 2DZIA 3QARA 2KFKA 4NQKE 2PPHA 5TR5A 3VH3B 4BKGA 3IBEA 2JPHA 3CSTA 3JVZX 3RYTA 4DK5A 4DHZB 4ANWA 3H7PA 4KV2A 3V6CB 2C7HA 3WAOA 3QAQA 4F7ZA 2R2QA 2KHWB 4NAWA 4FJYA 2KTFA 3ALBA 4II2B 3U8ZA 5AZGA 3EC8A 1E7UA 2CU1A 4BBNF 3ZTCA 2KDFB 3RZFA 3JSVB 3VTUA 2JUOA 3TBLD 1XQQA 2WX1A 4FADA 2MRPA 3B0AA 4KVGB 4K1RB 2D10A 3AULA 1FXTB 2LZ6A 3H6NA 2Y5BB 3NHEB 5DPTA 2LJ5A 3M3JA 2MCNB 2Z0DB 3HM6X 2M1MA 1KLVA 1Q5WB 3AXCA 1XT9B 3H1UA 2GBKA 2LD9A 3BINA 3AU4A 2KDBA 1WGYA 2KDEB 2HD5B 2V4LA 4HDQA 5C1ZA 4IC7B 4NJ6A 2B3AA 3A9JA 4B6WA 4EZKA 3M95A 4XZ4A 2KC1A 3PTFC 1IPGA 2AL6A 4G0NB 2M4NA 4HPMB 2RR9A 4B95A 3PV1A 2XBBC 2N7DA 3V61A 3QQ8B 4GU2A 2JXXA 3PS6A 2G3QB 2ZEQA 4W9KA 3TL5A 4TKNA 1V5OA 1P98A 1RLFA 4NQLB 2WDTB 3IHPC 1RFAA 3L13A 5D2MB 5IAAC 2N9XA 2XK5B 4MGYE 2MX2A 3A9KA 3B1LX 2LWPA 3HHMA 2BKFA 1GC7A 4HWIB 3A33B 4I6LB 5CX3A 1ISNA 4ZRJA 5G55A 4A3PA 4ANXA 1UBIA 2IYDB 4G11A 2HJ8A 3VQIA 2NPTB 1WGGA 4DWFA 2L00B 1IYFA 3ML9A 2BKRB 2MW5A 4F1SA 2NBWB 1IP9A 2MA9B 2NVUI 3EECA 4EEWA 4MGZE 1WMHB 3NOBA 3VDZA 1NDDA 2RPQA 3H9DA 3W1SC 3WA0A 3ZW3A 4IUMB 4HLEA 2AYOB 2DYOA 2CHXA 3SDLC 4E74A 2C60A 4JGHB 4M8NA 3APDA 4IM3A 5C23A 2JVCA 4W9HA 2K25A 3P2BA 3VH4B 4LJOB 1C3TA 1P9DU 3PLUA 3NY5A 1J19A 2FIFA 2KXJA 3PHXB 1EO6A 4W9EA 3LDZE 5AZFA 2KJHB 4JIOU 2M0XA 1D3ZA 4EZJA 2KTRB 4BVUC 2KK8A 3PPAA 2BYVE 2N9PC 2KWUB 4ZRIA 1UD7A 4BKSA 4ZRKA 3WALA 1E7VA 3CMMB 4KZCA 2CKHB 1SIFA 4I6PA 1JRUA 2WX0A 3L17A 3DQVA 5DPSA 2WYQA 3ZKJC 3CSFA 2JWZA 2MBEA 5GMVA 3RZWC 3M63B 2K8BA 4FHKA 2J0MA 4ICUA 3ZLZA 1GUAB 2DX5B 4DXAB 3PRPB 2QHOA 3JW0X 3APFA 2M8SA 3EFUA 3L10B 1V5TA 3RD2A 5L83A 3PVLA 2ZPYA 5JZEB 1YQBA 2Z59B 4AJWA 3OJ3A 5EDSA 2L8JA 4FULA 4KZ0A 4NNJB 4MGIE 4CYEA 2KDIA 2REXA 2C7NB 2G4SA 4W9LA 2NR2A 4W9JA 4FBJB 4M8MA 1WYWB 2MBQA 4W9DA 4WJQA 1E90A 1LFDA 2K8HA 1WJ4A 2NBUA 5DCNA 3R7RA 5J2RA 1UZXB 1M94A 2UYZB 2DZKA 3I3TB 3B08A 4MGKE 1E5WA 1OGWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NPN A;  4FHJ A;  1WXV A;  4WJN A;  3N30 A;  4K7S A;  5KHO A;  4E71 A;  1X1M A;  2KWV B;  2VRR B;  2ZVN A;  3RCZ A;  3DOW A;  2FCQ A;  3L08 A;  1J0G A;  3ZUN A;  2O2V B;  1KJT A;  3TCA A;  1R4M I;  1Y8R C;  4LDT D;  2IBI B;  3A1Q B;  2BWF A;  1WMH A;  1XD3 B;  2FID A;  1RAX A;  3APC A;  2O6V A;  2G45 B;  4W9I A;  4DHJ D;  4ASW C;  5D94 A;  2FCN A;  3ZRC A;  4PS8 A;  2LRW A;  4GDL A;  3ZO5 B;  3QJZ A;  4GN1 A;  2NBV B;  3QA8 A;  3UF8 A;  5JH5 C;  4TQ0 A;  4KIK B;  1QZE A;  2L3Z A;  3R3M A;  3KYC D;  4N9F 4;  3ZIM A;  3UQA A;  1EUV B;  2KTR A;  1J8C A;  4WWP A;  4AUQ C;  2RGF A;  2HTH A;  2JT4 B;  4ANV A;  1CMX B;  3QWZ B;  2IZV B;  4WWN A;  1WRD B;  4BKT A;  3KUZ A;  3PRZ A;  2KJR A;  3WAM A;  1V6E A;  1V49 A;  4EKU A;  3MTN B;  2AWT A;  1UH6 A;  2EMT A;  5JHB A;  5J18 A;  3W1S A;  4FJV B;  2LVP A;  4FJZ A;  3T9L A;  5HKH A;  2BF8 B;  1KOT A;  4MSQ B;  2KMC A;  3HK0 A;  3RUI B;  4XC2 A;  1V80 A;  2N1V A;  2FCS A;  2WWZ A;  3ML8 A;  3QC8 B;  4HXD A;  2ZNV B;  4IWO A;  3U30 A;  2IO1 B;  4GDK B;  2KQS A;  1WX8 A;  2A4Z A;  1WX9 A;  1YX5 B;  2DAJ A;  2LAS A;  3IFW B;  3UQB A;  4HK2 A;  2HE7 A;  3KYD D;  4DDI D;  2DAF A;  3ZNZ B;  1OQY A;  2KN5 A;  3C0R B;  3DVG Y;  4MEM A;  3JYU A;  3V62 A;  4MH0 E;  4HVB A;  1Z2M A;  1S1Q B;  1V9J A;  1V81 A;  2LGY A;  2O6V D;  4IWQ A;  2AEH A;  2GMI C;  3X0W A;  3ZRF A;  3PT2 B;  4IM2 A;  4GSW A;  2DEN B;  2ZPN A;  1C1Y B;  4EOY A;  1P3Q U;  3DDC B;  3EHV A;  4GOC A;  3WAN A;  3DVG X;  3RT3 B;  4IG7 B;  4EFO A;  4IM0 A;  4FN2 A;  5AZH A;  1WGR A;  3ZDM C;  1V86 A;  5LXI B;  2JRI B;  1ZGU B;  2MBB B;  4IWP A;  1H8C A;  1NBF C;  2KFK B;  2R2O A;  3VUX A;  4BOS C;  4FLH A;  3VTV A;  2UWQ A;  2DZM A;  2BYE A;  4AJY B;  3A1Q A;  2NS5 A;  3UIO B;  2FUH B;  3RUL A;  2PJH A;  3QX1 A;  3JSV A;  3TJP A;  3H7P B;  3T8M A;  5KHQ A;  4TUU A;  3V6E B;  2L7R A;  2N1W A;  4NJ7 A;  1WI0 A;  1VCB A;  2YLM A;  3DBS A;  1TGZ B;  3GZN I;  3PRM B;  3LJ3 A;  3CF6 E;  3VXW A;  2C7M B;  3DCG A;  2MP2 B;  1MG8 A;  4KIK A;  2BWE S;  1K8R B;  3ECI A;  3MHS D;  1H4R A;  2KVR A;  3PGE A;  3M62 B;  1WY8 A;  2FAZ A;  2MBH A;  2W9N A;  3HIZ A;  2DYM A;  5FR6 A;  2GOW A;  4NY0 A;  1WF9 A;  2M17 A;  3NZS A;  3MJW A;  2CR5 A;  2LUE A;  4AP4 C;  4P7I A;  1U4A A;  2EKE C;  4EUT A;  4AWJ A;  3IVF A;  1E8Z A;  3PSE B;  4JQW C;  4MEL A;  4DHZ E;  2GBR A;  2KC2 A;  1V2Y A;  2JZ3 B;  1AAR A;  3L16 A;  2JZZ A;  3N32 A;  3SD5 A;  1G6J A;  4OVU A;  1YD8 U;  3A9J B;  1A5R A;  2ZVO A;  3VUW A;  4HJK A;  2LGX A;  3DBL I;  2KQ7 A;  3ZNI D;  4MSM B;  3VHT C;  3GOE A;  4RM9 A;  1I42 A;  2MSE D;  2XK5 A;  1WR1 A;  3DVN U;  2IO3 B;  3PZD A;  1L2N A;  3KVF B;  5CHF A;  4EZL A;  2V3S A;  4II3 B;  1I35 A;  1YIW A;  2KX0 A;  3ZNH B;  2CHZ A;  2L0F A;  3OAW A;  2KLG A;  1OTR B;  2ZCC A;  2NPT A;  4M0W B;  5AEK B;  1WIA A;  3A9K B;  2I1K A;  4XX5 A;  4BKS D;  1WXM A;  4BFR A;  4AOF A;  2BGF A;  2FCM A;  5L95 C;  2GBM A;  2DZJ A;  1WJU A;  3NS8 A;  1Q1O A;  3VFK A;  3WAP A;  5IA7 A;  4WQO B;  1SE9 A;  2JRH A;  3ONS A;  4PS7 A;  5J17 A;  4G3X B;  4K7W A;  3R66 C;  5BO4 B;  2C9W B;  3PHW B;  2MQJ A;  2N4F A;  2KO3 A;  4TV3 A;  1WJ6 A;  4WWO A;  3A4S C;  2CHW A;  1WJN A;  4DDG D;  2ZNV C;  2IO2 B;  3KUC B;  2Z0E B;  2IY1 B;  1OEY J;  4JL9 A;  3BY4 B;  1WZ3 A;  2L05 A;  1R4N I;  2KD0 A;  4KDL B;  4TQ1 A;  4HCP B;  4E3C A;  2V1Y A;  1KM7 A;  2ASQ A;  4JLC A;  2RD0 A;  3UGB B;  1S3S G;  1PQS A;  2MP2 A;  4HCN B;  4K81 A;  4WJO A;  1WGD A;  5JHA A;  3SU8 X;  1GC6 A;  2J0J A;  4MM3 A;  1ZW7 A;  2K1F A;  3A4R A;  4W9F A;  4ZYN A;  3X23 A;  1GJZ A;  4B9K A;  1WE6 A;  4LDT B;  4GMV A;  5E6P A;  2JF5 A;  3DVN V;  2I1J A;  2K39 A;  3O65 B;  1Q0W B;  3DBH I;  1E8W A;  1P1A A;  5G2N A;  4DHJ B;  1Z5S B;  2C5L C;  1TTN A;  2GBN A;  3K9O B;  3U7D A;  3VVW B;  2MBO A;  1E8Y A;  3KUD B;  4ICV A;  4URK A;  2J0K A;  3Q3J A;  1LM8 B;  1TZ1 A;  1ZKH A;  2KKC A;  4X57 B;  4KSK C;  1L7Y A;  2KFJ A;  1BT0 A;  5DPR A;  2FNJ B;  3KH0 A;  2PE6 B;  4ANU A;  3S2A A;  2IY0 B;  2ZJD A;  2KOX A;  5E6N A;  2G4D B;  4BOZ B;  2BYF A;  1WH3 A;  2IO0 B;  3NZU A;  1E8X A;  2K8C A;  2YVC A;  4W9C A;  1F9J A;  4HPL B;  2D3G A;  1LXD A;  2NCN A;  2ZZP B;  4MJS B;  4A3O A;  1YX6 B;  1WGH A;  2D11 A;  2RSU A;  3UIP B;  3VAW A;  2DYB A;  2O2V A;  3QHT A;  2KX3 A;  3DBR I;  2JY6 A;  4FA6 A;  2DHZ A;  2D2Q A;  4K7U A;  2A5U A;  2LVQ A;  3K9P B;  3L54 A;  4I6N B;  1WM3 A;  5DPW A;  3VTW A;  4YL8 A;  1TBE A;  1OEY A;  4KSL C;  4NAW B;  2PEA A;  1UBQ A;  2EMS A;  3PLV A;  3KW5 B;  4A20 A;  2KLC A;  2L76 A;  2LXA A;  2D07 B;  2O6V B;  3DPD A;  4WAA A;  5LLI A;  3UIN B;  3D32 A;  1WFY A;  4GDL B;  4OVV A;  2KWC A;  4LJP B;  1WX7 A;  4J6I A;  1EF1 A;  1T0Y A;  2CS4 A;  3W1Y A;  2KJ6 A;  3L0W B;  4CHK A;  4GIV A;  4GGQ A;  4PYZ A;  5E6O A;  3VUY A;  1WXS A;  3QCA A;  3OJ4 B;  5D7G A;  2KZR A;  4GB9 A;  1UEL A;  1EF5 A;  4CO7 A;  4GXB A;  3WIM A;  2K6D B;  2J7Q B;  3OLM D;  2OJR A;  2AL3 A;  3HM3 A;  1WXA A;  2K6Q A;  2KNB A;  2ZCB A;  3N3K B;  2KAN A;  1WR6 E;  4W9G A;  1HE8 A;  3AU5 A;  3V60 A;  2XEW A;  4IW0 A;  4GDK A;  2N7E A;  2MWS B;  3H7S A;  1GNU A;  3ENE A;  3Q3F A;  2LVO A;  4PS3 A;  3AI5 A;  2LI5 A;  1WZ0 A;  2OOB B;  1UGM A;  2N9E B;  5CHW A;  5CHV C;  4KDI C;  4BBN C;  1SGH A;  4RM8 A;  5D6J B;  4HDO A;  3QIJ A;  5LXH A;  1LQB A;  2LGD A;  4G50 A;  3TMP B;  3ZVV A;  2PE9 A;  2MLB A;  3ZDT A;  1P0R A;  3R7Q A;  3TIX A;  4LCD E;  2KMA A;  4WJP A;  1WM2 A;  3PRE A;  4F8C B;  1GG3 A;  1WE7 A;  4DBG A;  2GBJ A;  3SHQ A;  2BPS A;  1RRB A;  1YJ1 A;  3QK0 A;  2L0T A;  5CTR C;  3ZNG C;  1VD2 A;  4RMA A;  3IG3 A;  4MDK E;  2LRU A;  4MJS A;  2LXC A;  4PYU A;  4ZDV A;  3ZTD A;  1NI2 A;  2DZI A;  3QAR A;  2KFK A;  4NQK E;  2PPH A;  5TR5 A;  3VH3 B;  4BKG A;  3IBE A;  2JPH A;  3CST A;  3JVZ X;  3RYT A;  4DK5 A;  4DHZ B;  4ANW A;  3H7P A;  4KV2 A;  3V6C B;  2C7H A;  3WAO A;  3QAQ A;  4F7Z A;  2R2Q A;  2KHW B;  4NAW A;  4FJY A;  2KTF A;  3ALB A;  4II2 B;  3U8Z A;  5AZG A;  3EC8 A;  1E7U A;  2CU1 A;  4BBN F;  3ZTC A;  2KDF B;  3RZF A;  3JSV B;  3VTU A;  2JUO A;  3TBL D;  1XQQ A;  2WX1 A;  4FAD A;  2MRP A;  3B0A A;  4KVG B;  4K1R B;  2D10 A;  3AUL A;  1FXT B;  2LZ6 A;  3H6N A;  2Y5B B;  3NHE B;  5DPT A;  2LJ5 A;  3M3J A;  2MCN B;  2Z0D B;  3HM6 X;  2M1M A;  1KLV A;  1Q5W B;  3AXC A;  1XT9 B;  3H1U A;  2GBK A;  2LD9 A;  3BIN A;  3AU4 A;  2KDB A;  1WGY A;  2KDE B;  2HD5 B;  2V4L A;  4HDQ A;  5C1Z A;  4IC7 B;  4NJ6 A;  2B3A A;  3A9J A;  4B6W A;  4EZK A;  3M95 A;  4XZ4 A;  2KC1 A;  3PTF C;  1IPG A;  2AL6 A;  4G0N B;  2M4N A;  4HPM B;  2RR9 A;  4B95 A;  3PV1 A;  2XBB C;  2N7D A;  3V61 A;  3QQ8 B;  4GU2 A;  2JXX A;  3PS6 A;  2G3Q B;  2ZEQ A;  4W9K A;  3TL5 A;  4TKN A;  1V5O A;  1P98 A;  1RLF A;  4NQL B;  2WDT B;  3IHP C;  1RFA A;  3L13 A;  5D2M B;  5IAA C;  2N9X A;  2XK5 B;  4MGY E;  2MX2 A;  3A9K A;  3B1L X;  2LWP A;  3HHM A;  2BKF A;  1GC7 A;  4HWI B;  3A33 B;  4I6L B;  5CX3 A;  1ISN A;  4ZRJ A;  5G55 A;  4A3P A;  4ANX A;  1UBI A;  2IYD B;  4G11 A;  2HJ8 A;  3VQI A;  2NPT B;  1WGG A;  4DWF A;  2L00 B;  1IYF A;  3ML9 A;  2BKR B;  2MW5 A;  4F1S A;  2NBW B;  1IP9 A;  2MA9 B;  2NVU I;  3EEC A;  4EEW A;  4MGZ E;  1WMH B;  3NOB A;  3VDZ A;  1NDD A;  2RPQ A;  3H9D A;  3W1S C;  3WA0 A;  3ZW3 A;  4IUM B;  4HLE A;  2AYO B;  2DYO A;  2CHX A;  3SDL C;  4E74 A;  2C60 A;  4JGH B;  4M8N A;  3APD A;  4IM3 A;  5C23 A;  2JVC A;  4W9H A;  2K25 A;  3P2B A;  3VH4 B;  4LJO B;  1C3T A;  1P9D U;  3PLU A;  3NY5 A;  1J19 A;  2FIF A;  2KXJ A;  3PHX B;  1EO6 A;  4W9E A;  3LDZ E;  5AZF A;  2KJH B;  4JIO U;  2M0X A;  1D3Z A;  4EZJ A;  2KTR B;  4BVU C;  2KK8 A;  3PPA A;  2BYV E;  2N9P C;  2KWU B;  4ZRI A;  1UD7 A;  4BKS A;  4ZRK A;  3WAL A;  1E7V A;  3CMM B;  4KZC A;  2CKH B;  1SIF A;  4I6P A;  1JRU A;  2WX0 A;  3L17 A;  3DQV A;  5DPS A;  2WYQ A;  3ZKJ C;  3CSF A;  2JWZ A;  2MBE A;  5GMV A;  3RZW C;  3M63 B;  2K8B A;  4FHK A;  2J0M A;  4ICU A;  3ZLZ A;  1GUA B;  2DX5 B;  4DXA B;  3PRP B;  2QHO A;  3JW0 X;  3APF A;  2M8S A;  3EFU A;  3L10 B;  1V5T A;  3RD2 A;  5L83 A;  3PVL A;  2ZPY A;  5JZE B;  1YQB A;  2Z59 B;  4AJW A;  3OJ3 A;  5EDS A;  2L8J A;  4FUL A;  4KZ0 A;  4NNJ B;  4MGI E;  4CYE A;  2KDI A;  2REX A;  2C7N B;  2G4S A;  4W9L A;  2NR2 A;  4W9J A;  4FBJ B;  4M8M A;  1WYW B;  2MBQ A;  4W9D A;  4WJQ A;  1E90 A;  1LFD A;  2K8H A;  1WJ4 A;  2NBU A;  5DCN A;  3R7R A;  5J2R A;  1UZX B;  1M94 A;  2UYZ B;  2DZK A;  3I3T B;  3B08 A;  4MGK E;  1E5W A;  1OGW A; 
#chains in the Genus database with same CATH topology
 1ZXH A;  4ACF A;  3I63 C;  4FHJ A;  1PDX A;  4YWG G;  4K7S A;  5KHO A;  2INN E;  2BS4 B;  3RCZ A;  4DXF A;  1QOB A;  3TCA A;  3R8B A;  3MC8 A;  2CJO A;  2G45 B;  4DHJ D;  4ASW C;  4GDL A;  3P4S B;  2NBV B;  3QA8 A;  4TQ0 A;  2K3U A;  4KIK B;  1QZE A;  3ZIM A;  1MHX A;  2RGF A;  4ANV A;  1CMX B;  2IZV B;  4HRO A;  4XYC A;  2KJR A;  1V6E A;  3MTN B;  1UH6 A;  5JHB A;  2BVC A;  2LVP A;  2ZW1 A;  3T9L A;  2K0P A;  2BF8 B;  1HTO A;  4HXD A;  2IO1 B;  1MHH E;  1TS4 A;  4DDI D;  1K51 A;  1OQY A;  4LNO A;  1TS2 A;  2O6V D;  3X0W A;  3ZRF A;  2INP E;  3P1M A;  2ZPN A;  3TEZ A;  1C1Y B;  4YT0 B;  3ZQ4 A;  4EOY A;  3DDC B;  3WAN A;  3DVG X;  3RT3 B;  4EFO A;  4IWP A;  2MBB B;  2AX5 A;  2R2O A;  2ICI A;  3VR9 B;  2BYE A;  3UIO B;  1YN3 A;  3AN1 A;  2PJH A;  3H7P B;  5KHQ A;  1VCB A;  4BZA A;  1TGZ B;  3GZN I;  1K52 A;  3BWU D;  3VXW A;  2WXR A;  3AEG B;  1MG8 A;  3ECI A;  1H4R A;  2KVR A;  3O13 A;  1WY8 A;  1GB4 A;  2MBH A;  3FKY A;  1WF9 A;  2WP9 B;  2CR5 A;  2WDV B;  3N9Y C;  1E8Z A;  4MEL A;  3DHG C;  5EE0 A;  3AH7 A;  4DHZ E;  1ZP0 B;  4OVU A;  1SE3 A;  5T8I A;  3VUW A;  4HJK A;  1UWM A;  1JQ4 A;  5BYR A;  3DVN U;  3PZD A;  3KVF B;  3ZNH B;  2CHZ A;  2M0A A;  2KLG A;  4XWW A;  3C19 A;  5AEK B;  1DOX A;  2I1K A;  2BGF A;  2FCM A;  2L52 A;  3VFK A;  3R66 C;  5BO4 B;  5IN7 A;  3KUC B;  1AW7 A;  2IY1 B;  1C78 A;  3BY4 B;  3SFD B;  2L05 A;  1VDV A;  3B9J A;  4D2K A;  4KDL B;  4TQ1 A;  4E3C A;  1SE2 A;  2ASQ A;  3ABV B;  2QCZ A;  1FXI A;  1V1O A;  2MP2 A;  4K81 A;  5JHA A;  4LNI A;  2J0J A;  2K1F A;  1GJZ A;  1Q0W B;  3RMK C;  1P1A A;  3E56 A;  1V97 A;  3KWV A;  5BMH A;  5DPR A;  3VRB B;  3KH0 A;  2CJN A;  3S2A A;  2V3N A;  2WHI A;  1WH3 A;  3NZU A;  1E8X A;  2KQ4 X;  1N60 A;  1FPY A;  2KMM A;  2RDG A;  1LXD A;  2R61 A;  3AED B;  3P4Q B;  1E10 A;  2OJW A;  2ZZP B;  1AWD A;  4M0W A;  2ONQ A;  2D3B A;  3UIP B;  2DYB A;  1XLP A;  2FBW B;  5DPW A;  1OEY A;  4NAW B;  2PEA A;  1VJK A;  3PLV A;  3KW5 B;  2LXA A;  5LLI A;  3AE1 B;  1TZO A;  4GDL B;  2KWC A;  2IGD A;  4LJP B;  3MC0 B;  1WX7 A;  2LHD A;  1XLO A;  1I4Q A;  3MHZ A;  4REZ A;  4CHK A;  1TS5 A;  3QCA A;  5C3J B;  4GLS C;  3DHH C;  3MC9 A;  2KAC A;  1QIL A;  2OJR A;  2EKI A;  1FNU A;  2KNB A;  3N3K B;  3EA6 A;  3GE3 C;  3AU5 A;  3C8Y A;  4GDK A;  2N7E A;  1ZDV A;  3H7S A;  1GNU A;  3ENE A;  3AE9 B;  2LVO A;  3Q3F A;  3AE4 B;  1WZ0 A;  2WXI A;  4KDI C;  4RM8 A;  4HDO A;  1JAL A;  1L4D B;  2N9L A;  3H8H A;  1VZ8 A;  1WE7 A;  2N7J A;  2V4I B;  4C4V A;  4PYU A;  1E6E B;  1SF0 A;  1NI2 A;  3QAR A;  5TR5 A;  1ROE A;  3VH3 B;  2K9X A;  3IBE A;  3JVZ X;  3RYT A;  3AEB B;  5TSS A;  2H88 B;  4DHZ B;  4KV2 A;  2LMC A;  3WAO A;  3QAQ A;  2KHW B;  4JX1 C;  3AE7 B;  2KTF A;  5BYQ A;  3AEF B;  3VTU A;  1XQQ A;  2LZ6 A;  3HVD A;  3H6N A;  3NHE B;  2E6X A;  1E7P B;  3W5U B;  1DOI A;  1FIQ A;  2N9K A;  1CK1 A;  3HM6 X;  1Y56 A;  2JU6 X;  4RGT A;  2GBK A;  1FMA D;  3Q3N C;  5C1Z A;  4NJ6 A;  2B3A A;  1N63 A;  3A9J A;  2BT6 A;  4B6W A;  3M95 A;  2YEP F;  2KC1 A;  1IPG A;  1T0R C;  3PV1 A;  2PVG C;  3QQ8 B;  4GU2 A;  1C77 A;  2ZEQ A;  2M56 B;  1P98 A;  1RLF A;  3GZN B;  3L13 A;  2SAK A;  2N9X A;  2BKF A;  1GC7 A;  2MJD A;  4I6L B;  1ISN A;  4ZRJ A;  5G55 A;  2CU3 A;  4G11 A;  1P7F A;  4ZHP A;  1IYF A;  2D5G A;  1CZP A;  2MA9 B;  1WMH B;  4HLE A;  3WA0 A;  3U4E G;  2DYO A;  4W9H A;  1C3T A;  4LJO B;  2LUM A;  3PLU A;  1J19 A;  3BVM A;  2QC8 A;  3LDZ E;  3AEC B;  2M0X A;  4YSZ B;  2UU7 A;  4MH8 A;  4BVU C;  2KK8 A;  4L1B A;  5E6J A;  3RI7 C;  2N9P C;  4ZRI A;  1E7V A;  3CMM B;  1SIF A;  3ZKJ C;  1ET9 A;  3GE8 C;  2MBE A;  3RZW C;  1YQ4 B;  2DX5 B;  1FFU A;  1KFY B;  2QHO A;  2XNA C;  2KVZ A;  2LHE A;  4ITK A;  3DHI C;  1YQB A;  3KWL A;  5EDS A;  4K3C A;  2L8J A;  4FUL A;  2DWQ A;  4NNJ B;  1T0S C;  2V3P A;  1WYW B;  3BK2 A;  4NAM A;  3CIR B;  1E90 A;  3T3O A;  2VH2 A;  5C2T B;  1OGW A;  4NPN A;  1I4H A;  1C76 A;  2JWU A;  3Q8E A;  2VRR B;  3L08 A;  4Q2J A;  4LDT D;  3A1Q B;  2FID A;  3APC A;  1BML C;  1P7E A;  5D94 A;  3TSS A;  2LRW A;  1B1Z A;  5JH5 C;  1FRR A;  4HJG E;  2L3Z A;  3KYC D;  4N9F 4;  1EUV B;  2KTR A;  4WWP A;  1SE4 A;  3FIL A;  4M02 A;  2X8X X;  4BKT A;  3KUZ A;  1IBX A;  3P63 A;  1F1H A;  1LO5 D;  1V49 A;  4JE3 B;  4EKU A;  1BXT A;  3W1S A;  1ZOY B;  1KOT A;  2KMC A;  4XC2 A;  3QC8 B;  2IGH A;  2WWZ A;  5HG2 A;  4S17 A;  2ZNV B;  3BVZ A;  4GDK B;  2A4Z A;  3UQB A;  3IFW B;  1UWX A;  1YX5 B;  2DAJ A;  2LAS A;  5D3I B;  2DAF A;  3C0R B;  2VZK D;  4HVB A;  4ZOH C;  1Z2M A;  1V9J A;  4IWQ A;  2GMI C;  3AE6 B;  3PT2 B;  2DEN B;  1P3Q U;  3EHV A;  4KGR A;  4C4V B;  3BK1 A;  4IG7 B;  3W5V B;  5FK9 C;  1WGR A;  1V86 A;  4OZC A;  1ZGU B;  3VUX A;  4O1N A;  4BOS C;  2NS5 A;  3RNG C;  3QX1 A;  3JSV A;  1D5Z C;  1V1P B;  1L0Y B;  4NJ7 A;  3NVY A;  4A6Q A;  2K5P A;  2WXP A;  3I9V 1;  2J53 A;  3W9C B;  1F77 A;  1K8R B;  4MM3 B;  3PGE A;  3V3X A;  5FR6 A;  3RN9 C;  1L6V A;  3NUH B;  4P7I A;  1PUT A;  5EE1 A;  3AB5 A;  3SEB A;  3NS1 A;  2GBR A;  2JZ3 B;  1AAR A;  2INC C;  3A9J B;  2JZP A;  2ZVO A;  1R4N B;  3URY A;  2JYE A;  2LGX A;  2Y5C A;  3VHT C;  2XK5 A;  3P4R B;  2IO3 B;  5CHF A;  4II3 B;  1T6B X;  2KX0 A;  1XO3 A;  2E3T A;  1WIA A;  2WXF A;  3DWM A;  4BKS D;  1WXM A;  4AOF A;  3MFG A;  2GBM A;  3NVZ A;  2GB1 A;  1WJU A;  1Q1O A;  3HRD D;  2W3S A;  2M19 A;  2JRH A;  4K7W A;  1QLB B;  2WS3 B;  4TV3 A;  2KO3 A;  4WWO A;  1WJN A;  1C4A A;  4WWM A;  1J7A A;  4HEA 1;  1DGJ A;  1WZ3 A;  2QDF A;  5I4D A;  1TJE A;  4S0R A;  1C79 A;  3UGB B;  1TKE A;  1S3S G;  1WGD A;  2Z8L A;  3SU8 X;  4ZRQ A;  1ZDX A;  3TUO A;  4W9F A;  3X23 A;  4B9K A;  3BII D;  1E9M A;  5E6P A;  4WAF A;  1EU4 A;  1E8W A;  2PKO A;  4TMA B;  3ZYY X;  2C5L C;  4NZL B;  2GBN A;  2FE8 A;  3U7D A;  4URK A;  2J0K A;  3Q3J A;  1LM8 B;  2IND C;  1TZ1 A;  3GP7 A;  3IAM 1;  4KSK C;  1EM7 A;  5MPO A;  2PE6 B;  4ANU A;  2WQY B;  2ZJD A;  4BOZ B;  3RFZ B;  3BYY B;  2YVC A;  3R2I A;  2QJL A;  4MJS B;  2D11 A;  2NTS A;  4HPP A;  5HI1 A;  3VAW A;  1HTQ A;  2O2V A;  2KX3 A;  2JY6 A;  1M4V A;  4OZA A;  4ZYS A;  1WM3 A;  2KN4 A;  4KSL C;  4USA A;  1D5M C;  1HXY D;  1UBQ A;  3DPD A;  4WAA A;  2D07 B;  1FXA A;  3D32 A;  2LGI A;  4J6I A;  1NYR A;  2CS4 A;  4GGQ A;  3VUY A;  4HRS A;  4GB9 A;  3T3N A;  4CO7 A;  4GXB A;  1C4P A;  1IBX B;  2J7Q B;  3OLM D;  2AL3 A;  3P4P B;  1ET6 A;  1WXA A;  1WSP A;  1HE8 A;  1JML A;  4C7Y A;  3V60 A;  2XEW A;  4IW0 A;  1JWA D;  4PS3 A;  2LI5 A;  5IO9 A;  2N9E B;  1I4G A;  1QQR A;  2OED A;  1F0Z A;  1LQB A;  2L32 A;  2LGD A;  2NMQ A;  1AN8 A;  3ZDT A;  4TSS A;  3TIX A;  1WM2 A;  2GBJ A;  3QK0 A;  2L0T A;  4DQO C;  1VD2 A;  2LEK A;  2LRU A;  4WUR A;  5IP4 D;  4ZDV A;  5G5H A;  2KFK A;  2PPH A;  2JPH A;  3FC4 A;  1FCC C;  4LK0 M;  3VR8 B;  4ANW A;  1HQR D;  1JWB D;  2JX5 A;  2C7H A;  2R2Q A;  1FEH A;  1D5X C;  4DXG A;  3U8Z A;  3ALB A;  5AZG A;  2KDF B;  3JSV B;  4US9 A;  4FAD A;  3AUL A;  4LLG M;  5DPT A;  3RPF C;  2W54 A;  2Z0D B;  2M1M A;  1XT9 B;  3H1U A;  3OWE B;  2LD9 A;  3BIN A;  2YEP B;  4EZK A;  3IT4 B;  2QIE B;  3AEE B;  3PTF C;  2M4N A;  2RR9 A;  1SSN A;  4B95 A;  2MJ3 A;  2XBB C;  2N7D A;  1UGJ A;  2G3Q B;  4W9K A;  1QKZ A;  4NQL B;  3IHP C;  5D2M B;  5EE3 A;  2XK5 B;  1FO4 A;  3N1Y C;  4AS1 A;  3A9K A;  3B1L X;  1DYQ A;  2BB6 A;  2LWP A;  3SR6 A;  1L0V B;  2WXH A;  1UBI A;  2L00 B;  4KGT A;  2MW5 A;  2NVU I;  3H9D A;  2RDH A;  4L2Y A;  3SDL C;  4E74 A;  3BZD B;  4JGH B;  3ETR A;  3I57 A;  1P9D U;  4P16 A;  1WXQ A;  1EO6 A;  1F2R I;  3MJ5 A;  1HZ6 A;  1TY2 A;  3PZ8 A;  1KF6 B;  3PPA A;  2BYV E;  5G5G A;  4BKS A;  4ZRK A;  3I5J C;  3WAL A;  3RNC C;  4KZC A;  5DPS A;  2WX0 A;  3DQV A;  5AUK A;  4FHK A;  3ZLZ A;  3JW0 X;  3AE5 B;  4RF1 A;  1SEB D;  3P42 A;  1TIF A;  5JZE B;  4AJW A;  4KZ0 A;  4MGI E;  4C7Z A;  2KDI A;  2REX A;  4W9L A;  1PGA A;  2NR2 A;  4W9J A;  4W9D A;  5AUI A;  3ZJT A;  3L4P A;  3I3T B;  1CJE A;  1YQ3 B;  1WXV A;  3Q8A A;  3N30 A;  4WJN A;  3IAS 1;  3EFC A;  1L4Z B;  2KWV B;  2O2V B;  1R4M I;  1Y8R C;  5IKC M;  2IBI B;  2O6V A;  4W9I A;  1NEK B;  1TT5 B;  3ZRC A;  4PS8 A;  3ZO5 B;  3QJZ A;  1N6Z A;  4GN1 A;  2PIA A;  3UF8 A;  4B0E A;  4P6V F;  1MJD A;  3R3M A;  2IPK D;  4AUQ C;  1FNV A;  1WRD B;  2WNM A;  1RM6 C;  1FFV A;  3LXF A;  3PRZ A;  4RCO A;  3WAM A;  1JW9 D;  1VR9 A;  2MH7 A;  2EMT A;  5J18 A;  5IOI A;  4YTP B;  1MPE A;  2KDM A;  5HKH A;  4JPS A;  4M00 A;  2WDR B;  1V80 A;  2N1V A;  2FCS A;  2QSD A;  4IWO A;  2KQS A;  2BW2 A;  1WX8 A;  1WX9 A;  2ACZ B;  2KN5 A;  3DVG Y;  3N20 C;  3JYU A;  4MH0 E;  4US8 A;  4LNF A;  1YJJ A;  2WXN A;  1OQQ A;  2LGY A;  2AEH A;  4IM2 A;  3BVG A;  3GB1 A;  5GXG B;  2LJI A;  4FN2 A;  2N0S B;  3ZDM C;  2JRI B;  2Y5P A;  4P1B C;  2KFK B;  4HKZ E;  1UNS A;  1RFK A;  2BS3 B;  4AJY B;  1XLQ A;  2FUH B;  1YJI A;  3TJP A;  4TUU A;  3V6E B;  1KRH A;  2N1W A;  2YLM A;  3PRM B;  4KKJ A;  1GB1 A;  3CF6 E;  1YN5 A;  2MP2 B;  4KIK A;  2BWE S;  4ARC A;  3M62 B;  2W9N A;  2DYM A;  1FNW A;  4AP4 C;  2BBC A;  3PZ7 A;  1U4A A;  2EKE C;  4EUT A;  2PTL A;  4KKI A;  2KC2 A;  1V2Y A;  2BQQ A;  2JZZ A;  1G6J A;  2DBY A;  1A5R A;  3Q69 A;  1MVK A;  1XCT L;  1XXG A;  3ZGZ A;  3NVV A;  2KQ7 A;  3ZNI D;  4YTN B;  3GOE A;  1I42 A;  2MSE D;  5LNK 1;  2EEL A;  4EZL A;  3AM9 A;  1YIW A;  2D3C A;  1SJH D;  2L0F A;  3OAW A;  2NPT A;  4M0W B;  3A9K B;  4XX5 A;  1WRI A;  4A55 A;  3WAP A;  3NS8 A;  5IA7 A;  4PS7 A;  5J17 A;  4G3X B;  2C9W B;  1GAQ B;  1WJ6 A;  3A4S C;  4DDG D;  2ZNV C;  2IO2 B;  1QF6 A;  2Z0E B;  3LYY A;  1AYF A;  2MEK A;  4HCP B;  2V1Y A;  4RH6 A;  1KM7 A;  2RD0 A;  4BAX A;  1PQS A;  2MHJ A;  1B9R A;  1GC6 A;  1UF0 A;  1ZW7 A;  1D4B A;  2GI9 A;  4ZYN A;  1WE6 A;  4GMV A;  1N5X A;  3O65 B;  3DBH I;  1YMH E;  5G2N A;  4DHJ B;  1STE A;  4OVZ A;  3B2F A;  4C00 A;  3K9O B;  3VVW B;  4ICV A;  1ZKH A;  2KKC A;  4X57 B;  2X38 A;  4RF0 A;  1L7Y A;  1FRD A;  2IDY A;  2IY0 B;  3DWG C;  1BUI C;  2BS2 B;  2BYF A;  2WXL A;  2K8C A;  1NVI D;  4W9C A;  1F9J A;  4HPL B;  4OW0 A;  3NZ3 A;  1TKY A;  4A3O A;  1WGH A;  2RSU A;  3QHT A;  1XCQ L;  3DBR I;  4FA6 A;  2DHZ A;  2A5U A;  2LVQ A;  3NJT A;  3K9P B;  3L54 A;  4I6N B;  1EWC A;  1TBE A;  1T3Q A;  2EMS A;  3E9S A;  4A20 A;  2O6V B;  3UIN B;  1WFY A;  3Q2A C;  4OVV A;  4RGN A;  4C56 C;  2J42 A;  1EF1 A;  2JQR B;  3W1Y A;  2KJ6 A;  3L0W B;  4GIV A;  1N5W A;  4PYZ A;  5E6O A;  1WXS A;  2WU5 B;  3OJ4 B;  1NI3 A;  5D7G A;  2KZR A;  1HZ5 A;  3AE3 B;  1I4P A;  3HM3 A;  4W9G A;  1L6U A;  1R4M B;  1N61 A;  4R3D A;  3OG5 A;  1QOG A;  2OOB B;  1J7C A;  1UGM A;  5CHW A;  5CHV C;  4C80 A;  1TS3 A;  4G50 A;  2PE9 A;  2MLB A;  1P0R A;  3R7Q A;  3PRE A;  4J3O D;  3SHQ A;  1GPX A;  1RRB A;  1YJ1 A;  1I4R A;  1EWY C;  2RMM A;  1I4X A;  4RMA A;  2WXJ A;  4MDK E;  3NVW A;  1L5P A;  1FCL A;  2DZI A;  4NQK E;  4BKG A;  1ZE3 D;  3CST A;  4IOI E;  1YNT E;  4DK5 A;  2OHF A;  3V6C B;  2BTE A;  4F7Z A;  3U52 E;  4NAW A;  1VLB A;  4FJY A;  3RNE C;  1E7U A;  4BBN F;  3ZTC A;  4A8X C;  2JXT A;  2JUO A;  3TBL D;  4K3B A;  2MRP A;  1QT9 A;  2KAJ A;  3B0A A;  4K1R B;  2D10 A;  4KVG B;  4LNK A;  3AE2 B;  1FXT B;  2Y5B B;  1KLU D;  2G9H D;  1XLN A;  2LJ5 A;  1L0X B;  2MCN B;  1XEE A;  4WQM A;  1KLV A;  3SFE B;  3LB8 C;  2JYT A;  3AU4 A;  2KDB A;  2KDE B;  2HD5 B;  2DLB A;  2V0G A;  1QOF A;  4IC7 B;  4MT5 A;  5BMI A;  2WLB A;  2AL6 A;  3V61 A;  3PS6 A;  3TL5 A;  4JWS C;  1V5O A;  2WDT B;  3W2D A;  1TY0 A;  2W55 A;  1ZUD 2;  1J7B A;  3A33 B;  5CX3 A;  4ANX A;  4A3P A;  3VRA B;  3B2G A;  3VQI A;  2HJ8 A;  2NPT B;  1WGG A;  4DWF A;  4OZB A;  3ML9 A;  2AQ1 B;  1YN4 A;  4F1S A;  2NBW B;  4LTU A;  3EEC A;  4EEW A;  1WGK A;  3NOB A;  3VDZ A;  2RPQ A;  3W1S C;  3ZXR A;  2CHX A;  2C60 A;  5C23 A;  3P2B A;  3VH4 B;  2FIF A;  2KXJ A;  3PHX B;  4JIO U;  4B0M A;  4EZJ A;  2KTR B;  1SIJ A;  3FIL B;  2AQ2 B;  2CKH B;  4I6P A;  2WXO A;  3CSF A;  1PGX A;  2JWZ A;  2K8B A;  2J0M A;  4ICU A;  4DXA B;  3PRP B;  3TEX A;  3APF A;  3L10 B;  3PVL A;  1PFD A;  2Z59 B;  3OJ3 A;  5H8Y E;  2QMT A;  1K50 A;  3NRZ A;  2C7N B;  2G4S A;  3Q3O C;  4M8M A;  2MBQ A;  4WJQ A;  5DCN A;  3R7R A;  1T0Q C;  1YOV B;  1UZX B;  2UYZ B;  2DZK A;  3KQ4 A;  4XDD A;  1E5W A;  1SXT A;  3TEY A;  4RGM A;  2G1E A;  4E71 A;  1X1M A;  2ZVN A;  2QEJ C;  3DOW A;  2FCQ A;  1J0G A;  3ZUN A;  3DBH B;  1KJT A;  1VRA B;  4M01 A;  4EE2 A;  2BWF A;  1WMH A;  1FD6 A;  1XD3 B;  1RAX A;  2RDB C;  4KGS A;  2FCN A;  2PW9 A;  1IUE A;  1ENF A;  2I38 A;  1HA5 A;  3UQA A;  1GOZ A;  1J8C A;  2HTH A;  2JT4 B;  3QWZ B;  3KLS X;  4WWN A;  3MP9 A;  2PLP A;  3AE8 B;  2AWT A;  4CQN A;  2GLS A;  4FJV B;  3Q14 C;  3RNA C;  4FXC A;  3DBR B;  2NTT A;  2Y3A A;  1VZ7 A;  2W3R A;  4FJZ A;  1C4C A;  1CQV A;  4MSQ B;  1R7S A;  3RUI B;  2KT7 A;  3HK0 A;  3ML8 A;  3U30 A;  5HHD G;  1TYG B;  1KLG D;  4HK2 A;  2HE7 A;  3CWI A;  3KYD D;  1HEZ E;  3ZNZ B;  2WXQ A;  1PGB A;  4MEM A;  3V62 A;  1S1Q B;  1V81 A;  1T5X D;  4H2A A;  3J9C A;  3HVZ A;  2WXG A;  2FUG 1;  4GSW A;  1MI0 A;  2L1A A;  2LFI A;  4GOC A;  1SBB B;  4IM0 A;  1VZ6 A;  5AZH A;  5LXI B;  5FR3 A;  1H8C A;  1NBF C;  4FLH A;  3VTV A;  1A70 A;  2DZM A;  2UWQ A;  3A1Q A;  3RUL A;  2IJ0 A;  3T8M A;  2L7R A;  1WI0 A;  3DBS A;  1D6E C;  3LJ3 A;  2C7M B;  2HDE A;  3DCG A;  3UI3 A;  3MHS D;  2FAZ A;  1XF5 L;  3HIZ A;  2GOW A;  4NY0 A;  2BB5 A;  2M17 A;  3NZS A;  2J52 A;  3MJW A;  2LUE A;  1K53 A;  4AWJ A;  3IVF A;  3PSE B;  4JQW C;  1JWM D;  1Q10 A;  3SD5 A;  3N32 A;  3L16 A;  2AQ3 B;  1YD8 U;  1EU3 A;  3DBL I;  2LGS A;  4MSM B;  1SJE D;  4RM9 A;  2DNF A;  1WR1 A;  1QOA A;  3AV8 A;  1L2N A;  4YTM B;  4LNN A;  1ZXI A;  2V3S A;  1I35 A;  4A90 A;  4A9A A;  3PO0 A;  4AQ7 A;  1OTR B;  2ZCC A;  2VH1 A;  4BFR A;  5L95 C;  2DZJ A;  2WDQ B;  4WQO B;  1SE9 A;  2J4X A;  3ONS A;  3PHW B;  2MQJ A;  2N4F A;  4ARI A;  2CHW A;  2WGS A;  1OEY J;  4JL9 A;  4L23 A;  3Q8B A;  2SEB D;  1V1P A;  1R4N I;  2KD0 A;  3Q8F A;  1V8C A;  4JLC A;  3FAH A;  4HCN B;  1OQR A;  4WJO A;  2K22 A;  4MM3 A;  3A4R A;  4LDT B;  2JF5 A;  3DVN V;  4IKG A;  2I1J A;  2K39 A;  1ESF A;  2QIL A;  2IGG A;  1Z5S B;  1TTN A;  2MBO A;  1E8Y A;  3KUD B;  5FKA C;  4JWU C;  4RNA A;  2KFJ A;  1BT0 A;  2FNJ B;  4YSY B;  2JSV X;  4WH4 A;  1E0Z A;  2KOX A;  5E6N A;  5BYS A;  2G4D B;  1OFF A;  4XGA B;  2IO0 B;  3Q8C A;  1IGD A;  1IGC A;  2D3G A;  2NCN A;  1YX6 B;  3ZJU A;  3ZJV A;  2V9H A;  2D2Q A;  4K7U A;  1I7H A;  3RNB C;  3VTW A;  4YL8 A;  3Q6B A;  3V05 A;  2VZK B;  3IT6 B;  2KLC A;  2L76 A;  2WXM A;  4HKQ A;  1PYW D;  3ZXV A;  1F52 A;  2B76 B;  3U2S C;  1T0Y A;  1JWU D;  2ON8 A;  3N1X C;  1UEL A;  1EF5 A;  3WCQ A;  2HJ1 A;  4UDU C;  3WIM A;  2RPV A;  2K6D B;  5HFY A;  2K6Q A;  2ZCB A;  2KAN A;  1WR6 E;  3AMZ A;  3EGR A;  1JRO A;  2MWS B;  1ZPS A;  3AI5 A;  2WXK A;  4BBN C;  1SGH A;  3N1Z C;  5D6J B;  3QIJ A;  1ACC A;  5LXH A;  3ZVV A;  3TMP B;  4LCD E;  2KMA A;  4WJP A;  4F8C B;  1GG3 A;  4DBG A;  1JRP A;  2BPS A;  5CTR C;  1RWS A;  3ZNG C;  4OHJ A;  3IG3 A;  4MJS A;  2LXC A;  1DOY A;  4ZRP A;  3ZTD A;  3Q3M C;  1NEN B;  4KX6 B;  2PMV A;  3H7P A;  4QAY A;  3AEA B;  4II2 B;  1N62 A;  3EC8 A;  3HUI A;  2CU1 A;  5D3D A;  2KWD A;  3RZF A;  2PVO D;  3BYT B;  1F2R C;  2WX1 A;  4WIP A;  4ZHO A;  3M3J A;  3EUB 2;  1Q5W B;  3AXC A;  1NYQ A;  3NG0 A;  1WGY A;  2V4L A;  4HDQ A;  2Q5W D;  2HTM E;  4XZ4 A;  4G0N B;  3R2T A;  4HPM B;  4PT5 A;  4XWT A;  4YXD B;  2JXX A;  4IDI A;  4TKN A;  1RFA A;  5IAA C;  4MGY E;  2MX2 A;  3HHM A;  4HWI B;  5H92 C;  1KTK A;  2BYT A;  2IYD B;  2ZW0 A;  4XDC A;  3TEW A;  2BKR B;  1RYJ A;  1IP9 A;  4MGZ E;  3IXS A;  1NDD A;  3ZW3 A;  4NJC A;  4IUM B;  2L83 A;  2AYO B;  4M8N A;  3APD A;  4IM3 A;  2JVC A;  2K25 A;  2W82 A;  2MJE A;  3NY5 A;  2I2Y A;  2GRI A;  3GS2 A;  2WU2 B;  4W9E A;  5JXV A;  5AZF A;  2KJH B;  5BMG A;  3DBL B;  1D3Z A;  1FM0 D;  3U7Z A;  1WYG A;  4N59 A;  2KWU B;  1UD7 A;  4RFB A;  3RNF C;  4P1C C;  4YSX B;  1JRU A;  3L17 A;  1C9F A;  2WYQ A;  1JCK B;  1MG4 A;  5GMV A;  1LGR A;  3M63 B;  1GUA B;  4XE0 A;  1WWT A;  2TSS A;  2D3A A;  2M8S A;  3EFU A;  3RD2 A;  1V5T A;  5L83 A;  2KYW A;  4PK1 A;  2ZPY A;  4MAC A;  5EE9 A;  4N58 A;  4CYE A;  1SB3 C;  4FBJ B;  2H89 B;  4N6E B;  1UUP A;  1LFD A;  1WJ4 A;  2K8H A;  2NBU A;  4RGO S;  5J2R A;  1TKG A;  1MFW A;  1M94 A;  2XN9 C;  3B08 A;  1KH0 A;  4MGK E;  1JWS D; 
#chains in the Genus database with same CATH homology
 4NPN A;  4FHJ A;  1WXV A;  4WJN A;  3N30 A;  4K7S A;  5KHO A;  4E71 A;  1X1M A;  2KWV B;  2VRR B;  2ZVN A;  3RCZ A;  3DOW A;  2FCQ A;  3L08 A;  1J0G A;  3ZUN A;  2O2V B;  1KJT A;  3TCA A;  1R4M I;  1Y8R C;  4LDT D;  2IBI B;  3A1Q B;  2BWF A;  1WMH A;  1XD3 B;  2FID A;  1RAX A;  3APC A;  2O6V A;  2G45 B;  4W9I A;  4DHJ D;  4ASW C;  5D94 A;  2FCN A;  3ZRC A;  4PS8 A;  2LRW A;  4GDL A;  3ZO5 B;  3QJZ A;  4GN1 A;  2NBV B;  3QA8 A;  3UF8 A;  5JH5 C;  4TQ0 A;  4KIK B;  1QZE A;  2L3Z A;  3R3M A;  3KYC D;  4N9F 4;  3ZIM A;  3UQA A;  1EUV B;  2KTR A;  1J8C A;  4WWP A;  4AUQ C;  2RGF A;  2HTH A;  2JT4 B;  4ANV A;  1CMX B;  3QWZ B;  2IZV B;  4WWN A;  1WRD B;  4BKT A;  3KUZ A;  3PRZ A;  2KJR A;  3WAM A;  1V6E A;  1V49 A;  4EKU A;  3MTN B;  2AWT A;  1UH6 A;  2EMT A;  5JHB A;  5J18 A;  3W1S A;  4FJV B;  2LVP A;  4FJZ A;  3T9L A;  5HKH A;  2BF8 B;  1KOT A;  4MSQ B;  2KMC A;  3HK0 A;  3RUI B;  4XC2 A;  1V80 A;  2N1V A;  2FCS A;  2WWZ A;  3ML8 A;  3QC8 B;  4HXD A;  2ZNV B;  4IWO A;  3U30 A;  2IO1 B;  4GDK B;  2KQS A;  1WX8 A;  2A4Z A;  1WX9 A;  1YX5 B;  2DAJ A;  2LAS A;  3IFW B;  3UQB A;  4HK2 A;  2HE7 A;  3KYD D;  4DDI D;  2DAF A;  3ZNZ B;  1OQY A;  2KN5 A;  3C0R B;  3DVG Y;  4MEM A;  3JYU A;  3V62 A;  4MH0 E;  4HVB A;  1Z2M A;  1S1Q B;  1V9J A;  1V81 A;  2LGY A;  2O6V D;  4IWQ A;  2AEH A;  2GMI C;  3X0W A;  3ZRF A;  3PT2 B;  4IM2 A;  4GSW A;  2DEN B;  2ZPN A;  1C1Y B;  4EOY A;  1P3Q U;  3DDC B;  3EHV A;  4GOC A;  3WAN A;  3DVG X;  3RT3 B;  4IG7 B;  4EFO A;  4IM0 A;  4FN2 A;  5AZH A;  1WGR A;  3ZDM C;  1V86 A;  5LXI B;  2JRI B;  1ZGU B;  2MBB B;  4IWP A;  1H8C A;  1NBF C;  2KFK B;  2R2O A;  3VUX A;  4BOS C;  4FLH A;  3VTV A;  2UWQ A;  2DZM A;  2BYE A;  4AJY B;  3A1Q A;  2NS5 A;  3UIO B;  2FUH B;  3RUL A;  2PJH A;  3QX1 A;  3JSV A;  3TJP A;  3H7P B;  3T8M A;  5KHQ A;  4TUU A;  3V6E B;  2L7R A;  2N1W A;  4NJ7 A;  1WI0 A;  1VCB A;  2YLM A;  3DBS A;  1TGZ B;  3GZN I;  3PRM B;  3LJ3 A;  3CF6 E;  3VXW A;  2C7M B;  3DCG A;  2MP2 B;  1MG8 A;  4KIK A;  2BWE S;  1K8R B;  3ECI A;  3MHS D;  1H4R A;  2KVR A;  3PGE A;  3M62 B;  1WY8 A;  2FAZ A;  2MBH A;  2W9N A;  3HIZ A;  2DYM A;  5FR6 A;  2GOW A;  4NY0 A;  1WF9 A;  2M17 A;  3NZS A;  3MJW A;  2CR5 A;  2LUE A;  4AP4 C;  4P7I A;  1U4A A;  2EKE C;  4EUT A;  4AWJ A;  3IVF A;  1E8Z A;  3PSE B;  4JQW C;  4MEL A;  4DHZ E;  2GBR A;  2KC2 A;  1V2Y A;  2JZ3 B;  1AAR A;  3L16 A;  2JZZ A;  3N32 A;  3SD5 A;  1G6J A;  4OVU A;  1YD8 U;  3A9J B;  1A5R A;  2ZVO A;  3VUW A;  4HJK A;  2LGX A;  3DBL I;  2KQ7 A;  3ZNI D;  4MSM B;  3VHT C;  3GOE A;  4RM9 A;  1I42 A;  2MSE D;  2XK5 A;  1WR1 A;  3DVN U;  2IO3 B;  3PZD A;  1L2N A;  3KVF B;  5CHF A;  4EZL A;  2V3S A;  4II3 B;  1I35 A;  1YIW A;  2KX0 A;  3ZNH B;  2CHZ A;  2L0F A;  3OAW A;  2KLG A;  1OTR B;  2ZCC A;  2NPT A;  4M0W B;  5AEK B;  1WIA A;  3A9K B;  2I1K A;  4XX5 A;  4BKS D;  1WXM A;  4BFR A;  4AOF A;  2BGF A;  2FCM A;  5L95 C;  2GBM A;  2DZJ A;  1WJU A;  3NS8 A;  1Q1O A;  3VFK A;  3WAP A;  5IA7 A;  4WQO B;  1SE9 A;  2JRH A;  3ONS A;  4PS7 A;  5J17 A;  4G3X B;  4K7W A;  3R66 C;  5BO4 B;  2C9W B;  3PHW B;  2MQJ A;  2N4F A;  2KO3 A;  4TV3 A;  1WJ6 A;  4WWO A;  3A4S C;  2CHW A;  1WJN A;  4DDG D;  2ZNV C;  2IO2 B;  3KUC B;  2Z0E B;  2IY1 B;  1OEY J;  4JL9 A;  3BY4 B;  1WZ3 A;  2L05 A;  1R4N I;  2KD0 A;  4KDL B;  4TQ1 A;  4HCP B;  4E3C A;  2V1Y A;  1KM7 A;  2ASQ A;  4JLC A;  2RD0 A;  3UGB B;  1S3S G;  1PQS A;  2MP2 A;  4HCN B;  4K81 A;  4WJO A;  1WGD A;  5JHA A;  3SU8 X;  1GC6 A;  2J0J A;  4MM3 A;  1ZW7 A;  2K1F A;  3A4R A;  4W9F A;  4ZYN A;  3X23 A;  1GJZ A;  4B9K A;  1WE6 A;  4LDT B;  4GMV A;  5E6P A;  2JF5 A;  3DVN V;  2I1J A;  2K39 A;  3O65 B;  1Q0W B;  3DBH I;  1E8W A;  1P1A A;  5G2N A;  4DHJ B;  1Z5S B;  2C5L C;  1TTN A;  2GBN A;  3K9O B;  3U7D A;  3VVW B;  2MBO A;  1E8Y A;  3KUD B;  4ICV A;  4URK A;  2J0K A;  3Q3J A;  1LM8 B;  1TZ1 A;  1ZKH A;  2KKC A;  4X57 B;  4KSK C;  1L7Y A;  2KFJ A;  1BT0 A;  5DPR A;  2FNJ B;  3KH0 A;  2PE6 B;  4ANU A;  3S2A A;  2IY0 B;  2ZJD A;  2KOX A;  5E6N A;  2G4D B;  4BOZ B;  2BYF A;  1WH3 A;  2IO0 B;  3NZU A;  1E8X A;  2K8C A;  2YVC A;  4W9C A;  1F9J A;  4HPL B;  2D3G A;  1LXD A;  2NCN A;  2ZZP B;  4MJS B;  4A3O A;  1YX6 B;  1WGH A;  2D11 A;  2RSU A;  3UIP B;  3VAW A;  2DYB A;  2O2V A;  3QHT A;  2KX3 A;  3DBR I;  2JY6 A;  4FA6 A;  2DHZ A;  2D2Q A;  4K7U A;  2A5U A;  2LVQ A;  3K9P B;  3L54 A;  4I6N B;  1WM3 A;  5DPW A;  3VTW A;  4YL8 A;  1TBE A;  1OEY A;  4KSL C;  4NAW B;  2PEA A;  1UBQ A;  2EMS A;  3PLV A;  3KW5 B;  4A20 A;  2KLC A;  2L76 A;  2LXA A;  2D07 B;  2O6V B;  3DPD A;  4WAA A;  5LLI A;  3UIN B;  3D32 A;  1WFY A;  4GDL B;  4OVV A;  2KWC A;  4LJP B;  1WX7 A;  4J6I A;  1EF1 A;  1T0Y A;  2CS4 A;  3W1Y A;  2KJ6 A;  3L0W B;  4CHK A;  4GIV A;  4GGQ A;  4PYZ A;  5E6O A;  3VUY A;  1WXS A;  3QCA A;  3OJ4 B;  5D7G A;  2KZR A;  4GB9 A;  1UEL A;  1EF5 A;  4CO7 A;  4GXB A;  3WIM A;  2K6D B;  2J7Q B;  3OLM D;  2OJR A;  2AL3 A;  3HM3 A;  1WXA A;  2K6Q A;  2KNB A;  2ZCB A;  3N3K B;  2KAN A;  1WR6 E;  4W9G A;  1HE8 A;  3AU5 A;  3V60 A;  2XEW A;  4IW0 A;  4GDK A;  2N7E A;  2MWS B;  3H7S A;  1GNU A;  3ENE A;  3Q3F A;  2LVO A;  4PS3 A;  3AI5 A;  2LI5 A;  1WZ0 A;  2OOB B;  1UGM A;  2N9E B;  5CHW A;  5CHV C;  4KDI C;  4BBN C;  1SGH A;  4RM8 A;  5D6J B;  4HDO A;  3QIJ A;  5LXH A;  1LQB A;  2LGD A;  4G50 A;  3TMP B;  3ZVV A;  2PE9 A;  2MLB A;  3ZDT A;  1P0R A;  3R7Q A;  3TIX A;  4LCD E;  2KMA A;  4WJP A;  1WM2 A;  3PRE A;  4F8C B;  1GG3 A;  1WE7 A;  4DBG A;  2GBJ A;  3SHQ A;  2BPS A;  1RRB A;  1YJ1 A;  3QK0 A;  2L0T A;  5CTR C;  3ZNG C;  1VD2 A;  4RMA A;  3IG3 A;  4MDK E;  2LRU A;  4MJS A;  2LXC A;  4PYU A;  4ZDV A;  3ZTD A;  1NI2 A;  2DZI A;  3QAR A;  2KFK A;  4NQK E;  2PPH A;  5TR5 A;  3VH3 B;  4BKG A;  3IBE A;  2JPH A;  3CST A;  3JVZ X;  3RYT A;  4DK5 A;  4DHZ B;  4ANW A;  3H7P A;  4KV2 A;  3V6C B;  2C7H A;  3WAO A;  3QAQ A;  4F7Z A;  2R2Q A;  2KHW B;  4NAW A;  4FJY A;  2KTF A;  3ALB A;  4II2 B;  3U8Z A;  5AZG A;  3EC8 A;  1E7U A;  2CU1 A;  4BBN F;  3ZTC A;  2KDF B;  3RZF A;  3JSV B;  3VTU A;  2JUO A;  3TBL D;  1XQQ A;  2WX1 A;  4FAD A;  2MRP A;  3B0A A;  4KVG B;  4K1R B;  2D10 A;  3AUL A;  1FXT B;  2LZ6 A;  3H6N A;  2Y5B B;  3NHE B;  5DPT A;  2LJ5 A;  3M3J A;  2MCN B;  2Z0D B;  3HM6 X;  2M1M A;  1KLV A;  1Q5W B;  3AXC A;  1XT9 B;  3H1U A;  2GBK A;  2LD9 A;  3BIN A;  3AU4 A;  2KDB A;  1WGY A;  2KDE B;  2HD5 B;  2V4L A;  4HDQ A;  5C1Z A;  4IC7 B;  4NJ6 A;  2B3A A;  3A9J A;  4B6W A;  4EZK A;  3M95 A;  4XZ4 A;  2KC1 A;  3PTF C;  1IPG A;  2AL6 A;  4G0N B;  2M4N A;  4HPM B;  2RR9 A;  4B95 A;  3PV1 A;  2XBB C;  2N7D A;  3V61 A;  3QQ8 B;  4GU2 A;  2JXX A;  3PS6 A;  2G3Q B;  2ZEQ A;  4W9K A;  3TL5 A;  4TKN A;  1V5O A;  1P98 A;  1RLF A;  4NQL B;  2WDT B;  3IHP C;  1RFA A;  3L13 A;  5D2M B;  5IAA C;  2N9X A;  2XK5 B;  4MGY E;  2MX2 A;  3A9K A;  3B1L X;  2LWP A;  3HHM A;  2BKF A;  1GC7 A;  4HWI B;  3A33 B;  4I6L B;  5CX3 A;  1ISN A;  4ZRJ A;  5G55 A;  4A3P A;  4ANX A;  1UBI A;  2IYD B;  4G11 A;  2HJ8 A;  3VQI A;  2NPT B;  1WGG A;  4DWF A;  2L00 B;  1IYF A;  3ML9 A;  2BKR B;  2MW5 A;  4F1S A;  2NBW B;  1IP9 A;  2MA9 B;  2NVU I;  3EEC A;  4EEW A;  4MGZ E;  1WMH B;  3NOB A;  3VDZ A;  1NDD A;  2RPQ A;  3H9D A;  3W1S C;  3WA0 A;  3ZW3 A;  4IUM B;  4HLE A;  2AYO B;  2DYO A;  2CHX A;  3SDL C;  4E74 A;  2C60 A;  4JGH B;  4M8N A;  3APD A;  4IM3 A;  5C23 A;  2JVC A;  4W9H A;  2K25 A;  3P2B A;  3VH4 B;  4LJO B;  1C3T A;  1P9D U;  3PLU A;  3NY5 A;  1J19 A;  2FIF A;  2KXJ A;  3PHX B;  1EO6 A;  4W9E A;  3LDZ E;  5AZF A;  2KJH B;  4JIO U;  2M0X A;  1D3Z A;  4EZJ A;  2KTR B;  4BVU C;  2KK8 A;  3PPA A;  2BYV E;  2N9P C;  2KWU B;  4ZRI A;  1UD7 A;  4BKS A;  4ZRK A;  3WAL A;  1E7V A;  3CMM B;  4KZC A;  2CKH B;  1SIF A;  4I6P A;  1JRU A;  2WX0 A;  3L17 A;  3DQV A;  5DPS A;  2WYQ A;  3ZKJ C;  3CSF A;  2JWZ A;  2MBE A;  5GMV A;  3RZW C;  3M63 B;  2K8B A;  4FHK A;  2J0M A;  4ICU A;  3ZLZ A;  1GUA B;  2DX5 B;  4DXA B;  3PRP B;  2QHO A;  3JW0 X;  3APF A;  2M8S A;  3EFU A;  3L10 B;  1V5T A;  3RD2 A;  5L83 A;  3PVL A;  2ZPY A;  5JZE B;  1YQB A;  2Z59 B;  4AJW A;  3OJ3 A;  5EDS A;  2L8J A;  4FUL A;  4KZ0 A;  4NNJ B;  4MGI E;  4CYE A;  2KDI A;  2REX A;  2C7N B;  2G4S A;  4W9L A;  2NR2 A;  4W9J A;  4FBJ B;  4M8M A;  1WYW B;  2MBQ A;  4W9D A;  4WJQ A;  1E90 A;  1LFD A;  2K8H A;  1WJ4 A;  2NBU A;  5DCN A;  3R7R A;  5J2R A;  1UZX B;  1M94 A;  2UYZ B;  2DZK A;  3I3T B;  3B08 A;  4MGK E;  1E5W A;  1OGW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...