1Y8RC

Sumo e1 activating enzyme sae1-sae2-sumo1-mg-atp complex
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
84
structure length
84
Chain Sequence
b'GDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin-like 1 activating enzyme E1A
publication title Structures of the SUMO E1 provide mechanistic insights into SUMO activation and E2 recruitment to E1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 19
structure length 84
sequence length 84
chains with identical sequence F
ec nomenclature
pdb deposition date 2004-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1y8rC00
3VTVA 3DOWA 2KHWB 4AJWA 4IM3A 2HTHA 1Q5WB 5C23A 3S2AA 2FNJB 1QZEA 4ANUA 3RCZA 2C5LC 3L17A 3ZDMC 1ZW7A 3GOEA 2KJRA 1UGMA 4HWIB 4NAWA 4W9CA 3X23A 4AOFA 1UH6A 2MRPA 2WYQA 2PJHA 1EUVB 4KSKC 4OVUA 1GG3A 3ZW3A 2L3ZA 3JYUA 3L08A 2UYZB 2CU1A 4FBJB 5DCNA 1Q0WB 4HDQA 1EF1A 4BBNC 3V6EB 2BGFA 3L54A 4FULA 2Z0EB 4ICVA 3HHMA 1I35A 2KN5A 4GMVA 3WA0A 5GMVA 2K6DB 2IBIB 3ZRCA 4DHJD 5G55A 3VFKA 2LGXA 3KYDD 1WX7A 4RMAA 3NS8A 3BINA 2KKCA 5CX3A 2NS5A 4F8CB 4K7WA 4BBNF 3L16A 2IYDB 2MBQA 2CKHB 2NR2A 3VXWA 2WWZA 2I1KA 2K1FA 2J0MA 1AARA 2FAZA 3PTFC 2MX2A 4GU2A 3KH0A 3PHWB 3R66C 2XK5B 3DVGY 3QCAA 3SD5A 1BT0A 2L8JA 2M8SA 3APCA 3PT2B 4KSLC 3VVWB 3OAWA 2JY6A 4FHJA 3UIPB 2LZ6A 4M0WB 3RT3B 2WX1A 3W1SA 1V2YA 1J8CA 1J0GA 2LI5A 1L7YA 3H6NA 2HE7A 2Y5BB 3HK0A 2D11A 4II3B 4MSQB 4G0NB 2XEWA 3R7QA 1U4AA 1T0YA 4I6PA 2ZCBA 1OQYA 2MA9B 1IPGA 1YD8U 3IVFA 4NPNA 5DPRA 1ZGUB 3M3JA 3EHVA 4W9EA 4B9KA 4DHJB 3IHPC 3N3KB 3RZWC 2LASA 2NBUA 2J0JA 3DVNU 4W9JA 2KX0A 2ZJDA 1WGRA 1WX8A 2DAFA 2MBEA 4K81A 1WRDB 3TL5A 2ZVNA 2AWTA 2VRRB 4CHKA 3PREA 3R3MA 2JRHA 5D7GA 1GJZA 4P7IA 4DDID 4HLEA 1RAXA 4IWQA 2AL6A 3B0AA 3D32A 2ZVOA 4W9LA 2RSUA 4ANXA 2KQSA 2DZIA 2NPTB 2KWUB 2KXJA 1UELA 2DYBA 3C0RB 2N1VA 3B08A 3EC8A 2BYVE 1WFYA 2PE6B 2KMCA 3PRZA 4M8MA 5AZFA 3ZNID 1S1QB 1C1YB 4BKSA 3IG3A 4ZRIA 2MP2A 2MQJA 2N1WA 4MEMA 3N32A 4NY0A 2ASQA 2DENB 1D3ZA 3V62A 3VUYA 3LJ3A 4MJSB 1WJNA 2NVUI 2KQ7A 3JSVA 2MLBA 4BKGA 1WGYA 2NBVB 3H9DA 4EUTA 2V4LA 4B6WA 1WGHA 2M4NA 2JRIB 3U7DA 2ZCCA 5EDSA 4MELA 4NJ6A 1WGGA 4GN1A 1H4RA 4MH0E 4GDKB 2REXA 3A9KB 4IWPA 1G6JA 2M0XA 3QJZA 4LJOB 3UIOB 3WANA 3RYTA 4AUQC 3U30A 2DZMA 2LJ5A 4EZLA 3SHQA 1WE6A 2JT4B 4KIKA 2IY0B 3ZNHB 3ZNZB 3PVLA 2JXXA 3WIMA 4MGZE 4AP4C 3KW5B 4NAWB 2KFJA 2JUOA 4EEWA 4LJPB 2DZKA 4B95A 3HIZA 2D2QA 1V80A 2D07B 2GBKA 3NHEB 4IC7B 1FXTB 3M63B 3IFWB 1UBIA 1KOTA 5CTRC 3QQ8B 2YLMA 3W1YA 1YIWA 1UD7A 3VAWA 2K25A 2ZNVB 3PHXB 3ZDTA 4GXBA 3EECA 4XC2A 1E8ZA 1LXDA 3OLMD 3UGBB 3SDLC 3ZVVA 2KWVB 3MTNB 4GOCA 3EFUA 5J18A 4I6LB 2JZ3B 4A3PA 2KX3A 1IYFA 5C1ZA 3V60A 1S3SG 5JZEB 2J0KA 2IO2B 4ZRJA 2MBOA 5LLIA 1E7UA 1WH3A 2YVCA 3A1QA 3AI5A 3DBRI 1V6EA 1WMHA 2LRWA 1YX5B 5LXHA 4M8NA 5CHVC 2L05A 4W9HA 3N30A 3PSEB 4F1SA 1WR6E 1EO6A 1WI0A 1WY8A 3P2BA 4ANVA 1GUAB 1NI2A 2G4DB 2CR5A 2EMSA 3K9PB 4BKSD 1YQBA 3QARA 1R4MI 2K8BA 3ECIA 2ZNVC 3DCGA 3ZTCA 5JHBA 3ENEA 3PPAA 4G50A 4G11A 4ZDVA 2KD0A 2LVOA 2C7HA 4PS3A 2EMTA 2IY1B 4GSWA 2ZPNA 3V61A 2BYFA 2FIDA 4W9IA 4KZ0A 3ZNGC 4A20A 4DHZE 2O6VA 1TTNA 5TR5A 4ICUA 4KZCA 1ISNA 5IAAC 2L0FA 2RPQA 3QA8A 3JW0X 1L2NA 1X1MA 1XD3B 1LQBA 2MBBB 3JVZX 1WXSA 4ZRKA 1GNUA 2LWPA 4ASWC 2NBWB 2D3GA 5L83A 3VUWA 1E7VA 1OEYA 2V1YA 5DPSA 4WJNA 5IA7A 2WDTB 3A9JA 2KOXA 5FR6A 3DBHI 2KDFB 2XBBC 2KC2A 3TCAA 3NZSA 2L7RA 1H8CA 3W1SC 2FIFA 3U8ZA 3UINB 5JH5C 2N7DA 3CSTA 3APDA 3QIJA 2BYEA 4FJYA 2AL3A 2MP2B 4GIVA 3M95A 3VHTC 2L76A 3QC8B 3VUXA 3A4SC 2WX0A 4CO7A 3ZO5B 2KTFA 1RLFA 2JPHA 3TBLD 1WXAA 2KDEB 1OGWA 3JSVB 2LXAA 3ALBA 2KWCA 4JL9A 2GBJA 2BWES 3DBSA 4WWOA 2DZJA 2IO0B 4J6IA 2AYOB 3KUDB 2DAJA 2G3QB 2KMAA 4BVUC 2KTRB 3KYCD 4IW0A 3O65B 1WF9A 2K6QA 2PE9A 1MG8A 3PZDA 3DQVA 4HDOA 4XZ4A 3T8MA 1RFAA 1SIFA 2RD0A 4MGKE 5HKHA 4OVVA 4HCPB 4AWJA 2D10A 1KLVA 3UQAA 2J7QB 4KIKB 2LVQA 1C3TA 3DVNV 5LXIB 4MGIE 2GMIC 4GGQA 4JGHB 5DPWA 5D94A 3DBLI 2GBMA 3WAOA 3QX1A 2KTRA 1HE8A 3DDCB 3VTUA 3GZNI 4JQWC 2IZVB 3IBEA 4FJZA 1TBEA 2JF5A 4NQLB 2CHWA 2R2OA 1XT9B 2FCQA 5L95C 2A5UA 2ZEQA 2DYOA 3B1LX 3ZTDA 3H7SA 4WJQA 2N9PC 5E6NA 2G45B 1WM2A 2BKFA 3Q3FA 4TV3A 3H1UA 1J19A 4TQ1A 2Z59B 2W9NA 3L13A 2L0TA 1E8WA 3T9LA 1V49A 2JVCA 3AULA 3I3TB 3PGEA 2FUHB 2K8HA 1P1AA 1P3QU 2C9WB 2HD5B 2O6VD 4BKTA 5JHAA 3RULA 2B3AA 2N4FA 3ONSA 1RRBA 3OJ3A 1E8XA 3PRPB 4HXDA 1OTRB 4HCNB 3RUIB 1Z5SB 4II2B 4DHZB 3DVGX 5KHOA 3A1QB 3WAMA 4TKNA 4NJ7A 1NDDA 2AEHA 1SE9A 2LD9A 4HJKA 2ZPYA 3WAPA 1WMHB 5J17A 2DYMA 1Q1OA 1I42A 3CF6E 3ML9A 4WAAA 3TIXA 3UQBA 4W9FA 2LUEA 2KNBA 4EOYA 4BOZB 3HM6X 1E90A 4PS7A 2LRUA 2RR9A 5E6PA 2NCNA 4E74A 2LVPA 3A4RA 1WXMA 2BPSA 2C60A 2IO1B 4GDLA 2KFKA 3PV1A 2O2VA 2MSED 4EKUA 4TQ0A 1UZXB 3ML8A 1YX6B 4MDKE 1EF5A 5J2RA 2KC1A 2MBHA 1WJ6A 2KJ6A 1P9DU 4X57B 1XQQA 4HPLB 1TGZB 3WALA 1TZ1A 2KK8A 4FA6A 4FLHA 2O6VB 2GBRA 2V3SA 1WJ4A 5AZHA 4IG7B 2LXCA 5CHWA 3VH3B 1A5RA 4KDLB 5AEKB 2Z0DB 2OOBB 3H7PB 4HK2A 4K7SA 2MW5A 3CMMB 2GOWA 1V86A 1LM8B 3APFA 4IUMB 2QHOA 2KDBA 1WIAA 2I1JA 3A33B 4I6NB 2MCNB 3MHSD 2JWZA 4FADA 1WZ0A 3A9JB 4MSMB 2CHXA 2KANA 2G4SA 2L00B 1WR1A 3L0WB 3L10B 4KV2A 3ZLZA 4BFRA 3VH4B 3AXCA 4DWFA 2K8CA 3H7PA 3ZUNA 3VQIA 3PS6A 2DX5B 2BWFA 4JIOU 4RM9A 4W9KA 3V6CB 3KUCB 4ZYNA 3KVFB 5D2MB 2R2QA 1WX9A 2LGYA 1VD2A 4WJPA 4HPMB 2GBNA 4W9GA 2PPHA 1E8YA 4WQOB 5E6OA 1WYWB 2EKEC 5AZGA 1WGDA 1Y8RC 2PEAA 3TMPB 4ANWA 1P98A 4E3CA 1LFDA 3NZUA 3ZKJC 4LDTD 3NOBA 4FJVB 1KJTA 2JZZA 2KZRA 4DBGA 1GC7A 2BF8B 4FN2A 1Z2MA 2M1MA 1PQSA 4KVGB 2OJRA 4YL8A 2XK5A 3MJWA 2LGDA 5DPTA 4PYUA 3R7RA 2KJHB 3PLVA 2RGFA 5D6JB 3M62B 1YJ1A 2CHZA 4JLCA 4KDIC 4NQKE 4WWNA 3ZRFA 4HVBA 2M17A 5G2NA 3TJPA 2K39A 3AU4A 2N9EB 4EZKA 1CMXB 2BKRB 4G3XB 4EZJA 2KDIA 3VTWA 4WWPA 1OEYJ 1V5OA 3LDZE 1WM3A 1R4NI 4TUUA 1K8RB 2KO3A 1GC6A 4F7ZA 3QAQA 3QK0A 3UF8A 4LDTB 2N9XA 3AU5A 1WE7A 4N9F4 1JRUA 4IWOA 4K1RB 2N7EA 1P0RA 3X0WA 4CYEA 4XX5A 3OJ4B 1E5WA 4IM0A 2KVRA 2KLCA 2MWSB 2NPTA 3QWZB 1V81A 1V5TA 1WZ3A 2C7MB 2HJ8A 2IO3B 4E71A 4W9DA 3VDZA 4DXAB 3Q3JA 1VCBA 4NNJB 1WJUA 3K9OB 1WXVA 2A4ZA 4A3OA 3NY5A 4GB9A 3SU8X 3RZFA 3PRMB 2ZZPB 1SGHA 3RD2A 2CS4A 5CHFA 4MJSA 2DHZA 4DDGD 2FCSA 3QHTA 4GDLB 2KFKB 4URKA 2O2VB 2FCMA 4FHKA 4PYZA 1V9JA 2C7NB 3KUZA 4WJOA 4AJYB 4EFOA 1M94A 1ZKHA 2KLGA 3BY4B 2UWQA 3DPDA 4K7UA 4MM3A 1NBFC 1F9JA 1KM7A 1IP9A 4LCDE 3ZIMA 3CSFA 5BO4B 4PS8A 1UBQA 4RM8A 3PLUA 4DK5A 4MGYE 4GDKA 3A9KA 3HM3A 5KHQA 4IM2A 2FCNA 4BOSC
chains in the Genus database with same CATH superfamily
1Q5WB 1WSPA 3S2AA 2FNJB 3RCZA 1ET6A 3AEGB 4W9CA 1R7SA 4H2AA 1D5ZC 1K50A 2WYQA 1EU3A 4KSKC 4OVUA 3ZW3A 2L3ZA 3L08A 3FILA 1L6VA 2CU1A 4FBJB 1EF1A 3GE8C 1BUIC 4ICVA 1I35A 4GMVA 2NTTA 4D2KA 2KDMA 3KYDD 1WX7A 3NS8A 3GB1A 3WCQA 4K7WA 1SJED 4C00A 1HZ6A 1YNTE 2CKHB 1AYFA 2XNAC 1AARA 2FAZA 2MX2A 4GU2A 3QCAA 2L8JA 3PT2B 3UIPB 1NI3A 1IUEA 4OVZA 1V2YA 2HJ1A 3P4QB 4G0NB 3R7QA 2WLBA 1FIQA 3ZJUA 2IJ0A 4ZHOA 3Q3OC 4I6PA 2ZCBA 1YD8U 4NPNA 1DGJA 4W9JA 1B1ZA 1WGRA 2DAFA 2MBEA 4K81A 2AWTA 4LNNA 1GJZA 4A90A 2AL6A 4P1CC 3D32A 4W9LA 2BQQA 4ANXA 2KXJA 1UELA 2DYBA 2PW9A 2PE6B 3RNGC 2M56B 4BKSA 4WQMA 1V1PB 4MEMA 1SB3C 3N32A 4NY0A 3LJ3A 4ACFA 1C4PA 1YOVB 2V4LA 2M4NA 3R2IA 4IDIA 1ZUD2 2JRIB 4MM3B 5LNK1 3U7DA 1TS5A 5EDSA 4MELA 1QILA 4GN1A 4MH0E 5D3IB 3WANA 2LJ5A 1WE6A 2IY0B 1GOZA 4P16A 4TSSA 2KN4A 2JUOA 1V80A 4IC7B 3UI3A 1YJJA 1FXTB 1UBIA 3SFEB 4WIPA 4XYCA 2MJEA 4LNKA 3W1YA 1FD6A 3VAWA 2LUMA 4GXBA 4XC2A 4HROA 1E8ZA 3OLMD 1I7HA 1SXTA 3LB8C 2V3PA 4A3PA 5C1ZA 1E7UA 3A1QA 1SBBB 1YX5B 2WXHA 2W54A 2L05A 3DBLB 4W9HA 4F1SA 5T8IA 1WI0A 2TSSA 3DWGC 4MACA 2G4DB 3IXSA 3IT6B 1N63A 3DCGA 3AB5A 3DHHC 4G50A 2LVOA 4A20A 4W9IA 4RH6A 5TR5A 1ISNA 3QA8A 4ZRKA 2W82A 1ET9A 4MH8A 2OEDA 3GS2A 1UWMA 2YEPB 3VUWA 1E7VA 5TSSA 3AEDB 5IA7A 3NVWA 3A9JA 5FR6A 4USAA 2WU2B 3ZGZA 1MVKA 1EWCA 4FJYA 2W55A 3KWVA 4C7YA 1RFKA 2KTFA 2JPHA 1N5WA 1OGWA 2KDEB 4YSYB 4RGTA 3NRZA 3TUOA 3HRDD 3AN1A 5GXGB 2DZJA 4P6VF 4C7ZA 1NENB 2KMAA 2Q5WD 2PE9A 4HDOA 3TEWA 4MGKE 5FR3A 3AEFB 4MGIE 2GMIC 2ZW0A 4JGHB 2J53A 1MFWA 3BVMA 3DBLI 2GBMA 1NVID 1HE8A 5IP4D 3N1YC 3VTUA 4FJZA 1TBEA 2JF5A 4NQLB 3PO0A 2DYOA 4XGAB 4RFBA 3H7SA 1F0ZA 2J4XA 2BKFA 3Q3FA 3V3XA 3H1UA 4TQ1A 2L0TA 3PGEA 2K8HA 1P1AA 1K53A 1KTKA 5JHAA 2N4FA 1RRBA 3OJ3A 4HXDA 1OTRB 1Z5SB 4OHJA 4OZAA 1NYRA 1NDDA 4NJ7A 1P7EA 2DYMA 1T0RC 3CF6E 3ML9A 3UQBA 4W9FA 2LUEA 2KNBA 4EOYA 1OQQA 2LRUA 2RR9A 3AV8A 4ZYSA 3A4RA 1WXMA 4N59A 1SJHD 4A9AA 2MSED 4YXDB 1STEA 4LNOA 3ML8A 1YX6B 4XDCA 2MEKA 2G1EA 2KC1A 1WJ6A 1DOYA 3WALA 2KK8A 4FA6A 2I38A 4FLHA 2O6VB 2GBRA 1I4RA 2LXCA 5CHWA 2KVZA 2VZKB 4KDLB 1SEBD 1E7PB 2KDBA 2QDFA 2MCNB 2ZW1A 1BMLC 2L00B 3ETRA 3L10B 1I4QA 3VH4B 3VQIA 3J9CA 3PS6A 4ZYNA 1JROA 5D2MB 2R2QA 1WX9A 1C4CA 1VD2A 3AEAB 2PPHA 5E6OA 1WYWB 1WGDA 1Y8RC 2PEAA 3L4PA 3DWMA 4ANWA 1LFDA 3NZUA 3NG0A 1FPYA 4DBGA 1GC7A 4FN2A 5EE3A 2VH1A 2LMCA 5D6JB 1AWDA 4REZA 3M62B 2CHZA 4AQ7A 3TJPA 2SAKA 2N9EB 1TS4A 4WWPA 3OG5A 3NS1A 1K8RB 4IOIE 1L6UA 4RNAA 4JE3B 1FXAA 2KACA 3RNCC 4N9F4 2JWUA 2N7EA 1P0RA 1TZOA 4XX5A 5C3JB 1QQRA 2GB1A 3VDZA 5H8YE 1VCBA 2IGGA 3NY5A 1V1PA 1ZPSA 3PRMB 2ZZPB 2VZKD 5CHFA 3AM9A 2DHZA 4DDGD 4GDLB 4URKA 4FHKA 3KUZA 4LK0M 3B9JA 1M94A 2KLGA 1C4AA 3DPDA 4MM3A 1KM7A 1IP9A 3ZIMA 4US8A 4IM3A 5C23A 1YJIA 4ANUA 2C5LC 3L17A 3VRBB 1ZW7A 1KLGD 1UGMA 4HWIB 2Z8LA 2INCC 3MC0B 3HUIA 1KF6B 3N1XC 2QMTA 1FCLA 2UYZB 3I9V1 4JPSA 4HDQA 1SE2A 2BGFA 1FRRA 2Z0EB 3HHMA 2K6DB 2WXGA 2BS3B 3VFKA 1XEEA 3BINA 3T3OA 3Q69A 2IYDB 2NR2A 1ZP0B 2MHJA 3PHWB 2XK5B 1BT0A 2M8SA 4KSLC 3VVWB 4M0WB 3W1SA 3HK0A 3H6NA 2Y5BB 4II3B 4ITKA 2PKOA 2MA9B 3M3JA 4B9KA 4HEA1 3IHPC 3N3KB 2J42A 2LASA 2J0JA 2ZJDA 5C2TB 4OW0A 4BZAA 3RPFC 1ENFA 2JXTA 2EKIA 2JRHA 4DDID 4ZRPA 1RAXA 1AN8A 1JWSD 4WWMA 3B0AA 2KQSA 2WS3B 2NPTB 2KWUB 4RCOA 2N1VA 3B08A 2BYVE 1WFYA 3ZNID 3PRZA 1KH0A 4M8MA 5AZFA 5IOIA 1F52A 4M01A 3IG3A 2IGHA 4R3DA 3SR6A 3VUYA 1F77A 4MJSB 5H92C 2KQ7A 4BKGA 2NBVB 4B6WA 4KGTA 2H89B 2INDC 5FK9C 4Q2JA 3NVZA 1G6JA 3P1MA 3U30A 1RM6C 2JT4B 1N60A 1XLOA 3Q3NC 3ZNHB 2JXXA 4NAWB 4EEWA 5AUKA 3RFZB 4LJPB 2DZKA 4XE0A 2GBKA 3NHEB 3P42A 3M63B 5CTRC 3QQ8B 2YLMA 2EELA 1TS2A 1I4HA 3MTNB 2QCZA 2Y3AA 1PDXA 2JZ3B 2KX3A 3V60A 3W5VB 2IO2B 2MBOA 3VRAB 3DBRI 3P4PB 2LRWA 3GE3C 3N30A 3PSEB 1YN3A 1WR6E 2FBWB 1EO6A 3P2BA 1V1OA 4ARIA 2PTLA 2EMSA 1MG4A 3AE5B 3K9PB 2WDRB 1YQBA 1R4MI 1XLPA 2ZNVC 3C8YA 5JHBA 2INNE 3ENEA 3PPAA 3Q8AA 4G11A 2N7JA 2C7HA 4C4VA 4M02A 4KZ0A 2O6VA 1TTNA 4ICUA 2KT7A 4JWUC 2RPQA 3C19A 1X1MA 2MBBB 1WXSA 2ACZB 4HKZE 1OEYA 2V1YA 5DPSA 1HXYD 1TJEA 1XCTL 3BVZA 1FO4A 1T5XD 1JRPA 2GLSA 3AE1B 2XBBC 1H8CA 3NZSA 1JMLA 3MHZA 3APDA 2PLPA 2MP2B 1TIFA 3Q14C 5HG2A 3BIID 3A4SC 4CO7A 3ZO5B 2GRIA 3TBLD 1WXAA 2INPE 4WWOA 4J6IA 2AYOB 3KUDB 1LO5D 3PZDA 1RFAA 5HKHA 4OVVA 3HVZA 4YTNB 1D4BA 2J7QB 4JWSC 2WGSA 2AX5A 1RYJA 2KTRA 1FFVA 2WXRA 4ZOHC 3DDCB 2WQYB 4ZRQA 2CHWA 1XT9B 2LGIA 2GI9A 1HEZE 3B2FA 2G45B 2BS2B 1J19A 2Z59B 2W9NA 3L13A 1E8WA 1UGJA 3T9LA 1V49A 3PZ7A 2FUHB 1P3QU 2WXJA 2C9WB 1MHXA 1I4GA 5EE9A 3RULA 3ONSA 4KGSA 3PRPB 3B2GA 2LEKA 4TKNA 2LD9A 1WMHB 5J17A 2BBCA 4YT0B 4RGNA 3TIXA 1ACCA 3AE7B 3AH7A 4BOZB 3IAS1 3HM6X 1E90A 4YTPB 1FNUA 5E6PA 4N6EB 4YSZB 3MC9A 4GDLA 2BPSA 1UZXB 4ARCA 1B9RA 4C80A 5J2RA 1P9DU 2RMMA 4QAYA 1WJ4A 3FAHA 4IG7B 1JWMD 1A5RA 2Z0DB 4HK2A 4HRSA 3APFA 5HFYA 1J7BA 2QHOA 1FM0D 4RGOS 3I57A 3LXFA 2G4SA 1VDVA 1WR1A 4BFRA 4DWFA 2K8CA 3H7PA 2IDYA 3FC4A 2DX5B 2BWFA 2BVCA 1FEHA 2LGYA 3IT4B 4WQOB 2EKEC 5AZGA 3TMPB 3V05A 3ZKJC 2BB6A 3NOBA 4FJVB 1KJTA 2JZZA 5BMIA 2BF8B 1PQSA 2OJRA 2XK5A 1F2RC 4PYUA 2KJHB 3PLVA 2MH7A 4NQKE 1YJ1A 3ZRFA 4M0WA 2M17A 4HVBA 2CJNA 1HZ5A 4L23A 3N20C 1MHHE 2WXOA 4G3XB 2L52A 2AQ1B 3VTWA 2BT6A 1A70A 1WM3A 1QT9A 2WXNA 1CJEA 2WXPA 3QAQA 1L5PA 2QSDA 2IPKD 3AU5A 1WE7A 4DQOC 2LHDA 1WWTA 5HI1A 1L0VB 2M19A 3X0WA 3OWEB 2RDHA 2WDQB 1E5WA 4IM0A 2WXKA 3T3NA 2KLCA 3NVYA 2NPTA 3QWZB 1XLNA 1V5TA 2X8XX 2CJOA 2IO3B 4YSXB 1EU4A 2WXFA 1PUTA 1C79A 1JQ4A 3RI7C 1WJUA 2A4ZA 3SU8X 4GB9A 3RZFA 2QEJC 2HTME 4S0RA 1SGHA 1T0SC 4K3CA 4B0MA 4MJSA 2KFKB 2WXIA 4EFOA 4AJYB 4A8XC 1ZOYB 5BO4B 4DK5A 3DOWA 2HTHA 3FILB 1FFUA 2DBYA 1QZEA 2OJWA 3ZDMC 2KJRA 2RDBC 4NAWA 2MRPA 2NMQA 4US9A 1GG3A 2KQ4X 3Q8BA 2WHIA 3U52E 2E3TA 3RN9C 4BBNC 3V6EB 4N58A 3ZQ4A 3L54A 4FULA 1JW9D 2IBIB 4OZBA 3ZRCA 4DHJD 2LGXA 1PGXA 2VH2A 4RMAA 4BAXA 1KLUD 5CX3A 4AS1A 1BXTA 2NS5A 3N1ZC 3ZXRA 1OQRA 1VR9A 4BBNF 1E9MA 1L0YB 3E56A 2K1FA 3W5UB 1ZE3D 4O1NA 4ZHPA 1JALA 3BYYB 3KH0A 2N0SB 3DVGY 2OHFA 2MJ3A 3APCA 4FHJA 2LZ6A 3RT3B 1PGAA 1J8CA 1J0GA 2LI5A 4S17A 1L7YA 3ABVB 2HE7A 2D11A 1D5XC 3I5JC 1CQVA 1T0YA 3ZYYX 1OQYA 2JYEA 3IVFA 5DPRA 3EHVA 4W9EA 2DWQA 3Q3MC 3RZWC 2NBUA 1EWYC 2Y5PA 3DVNU 2KX0A 3O13A 3VR8B 3TL5A 2VRRB 4CHKA 3BYTB 3PREA 5D7GA 1ZDVA 4IWQA 1I4XA 4P1BC 2RSUA 4XWTA 4OZCA 3C0RB 2KMCA 1S1QB 1N6ZA 3W9CB 2MP2A 2MQJA 2N1WA 1QOFA 3MFGA 1WJNA 2NVUI 1TT5B 3R2TA 1WGYA 3H9DA 4EUTA 1FXIA 3KQ4A 2ZCCA 4NJ6A 1WGGA 2V0GA 2REXA 2M0XA 4AUQC 3BZDB 3RYTA 3AECB 4KGRA 3SHQA 1J7CA 3EGRA 1I4PA 1C76A 3PVLA 2BTEA 4AP4C 1XCQL 2KFJA 3Q2AC 4B95A 1QOAA 2XN9C 2D2QA 2D07B 1TYGB 1L4ZB 2LFIA 2UU7A 3IFWB 2K5PA 1YIWA 1UD7A 2K25A 1N61A 1UNSA 3ZDTA 1LXDA 4NZLB 4LNFA 3SDLC 4CQNA 2KWVB 4GOCA 1WXQA 1WYGA 1IYFA 1ROEA 2J52A 4WAFA 1S3SG 5G5GA 5JZEB 2J0KA 4ZRJA 1SF0A 1QOBA 1WH3A 2YVCA 3AI5A 2W3SA 1V6EA 1ESFA 1WMHA 3P4SB 3EUB2 5LXHA 5CHVC 1MJDA 3MP9A 1FNWA 3AMZA 4ANVA 1GUAB 2KMMA 1NI2A 2FUG1 3ZJVA 3AE4B 4BKSD 3QARA 3ECIA 5G5HA 4GLSC 3ZTCA 3R8BA 4ZDVA 1V8CA 2EMTA 3VR9B 2IY1B 4GSWA 2ZPNA 3ZNGC 2BYFA 2FIDA 4DHZE 4KZCA 1XF5L 5IAAC 2L0FA 2H88B 1N62A 3JW0X 1L2NA 1XD3B 5BYQA 3JVZX 4YWGG 2RDGA 1Y56A 4ASWC 2NBWB 3BK1A 1K52A 2JU6X 4WJNA 1EM7A 3TCAA 2L7RA 3W1SC 2FIFA 3UINB 2N7DA 1GB1A 3QIJA 2ON8A 2AL3A 4GIVA 3M95A 3VHTC 2L76A 1L0XB 2R61A 1JWBD 1RLFA 3KLSX 4JL9A 1K51A 3JSVB 2KWCA 3DBSA 2N9LA 1V97A 2IO0B 4BVUC 3KYCD 4IW0A 3O65B 1WF9A 1MG8A 4XZ4A 2X38A 2KWDA 4HCPB 4AWJA 1HTOA 1TKEA 3UQAA 4KIKB 3DVNV 4MT5A 2QILA 5DPWA 1JWUD 5E6JA 3CIRB 2PVGC 2IZVB 2R2OA 2YEPF 5L95C 2A5UA 2ZEQA 3B1LX 3ZTDA 4TV3A 1WM2A 5FKAC 2ICIA 2JVCA 3I3TB 4LTUA 1HA5A 2HD5B 2B3AA 1ZDXA 4DHZB 3WAMA 4HJKA 2ZPYA 1I42A 4WAAA 3AE8B 1OFFA 2WP9B 3Q6BA 3RNEC 3DHIC 4E74A 2BW2A 2IO1B 2LJIA 2KFKA 3PV1A 2RPVA 1C77A 4TQ0A 1R4NB 4MDKE 1VZ6A 2MBHA 2QC8A 4HPLB 1TZ1A 1QKZA 2AQ2B 2HDEA 1QOGA 2V3SA 5AZHA 4KX6B 1TY0A 2W3RA 4K7SA 3CMMB 5BMHA 4IUMB 5IKCM 1WIAA 2I1JA 3A33B 1DOXA 3MHSD 1WZ0A 2WU5B 1NEKB 2KANA 2I2YA 3AXCA 3ZUNA 1UWXA 3CWIA 3SFDB 4RM9A 4W9KA 3NJTA 3KUCB 2WDVB 3KVFB 4HPMB 2GBNA 4W9GA 1E8YA 4E3CA 2JZPA 2L32A 4LDTD 3Q8FA 1Z2MA 2JSVX 2M1MA 4KVGB 3MJWA 5DPTA 3MJ5A 4PT5A 2RGFA 2JX5A 4KDIC 2Y5CA 1CMXB 2BKRB 4EZJA 2KDIA 1OEYJ 1V5OA 1TY2A 2KYWA 1JWAD 3LDZE 1R4NI 1QF6A 2WNMA 2KO3A 3QK0A 1UF0A 1JRUA 4K1RB 5HHDG 2WXMA 2V9HA 1TKYA 1J7AA 1GB4A 4RF1A 1VZ7A 1JCKB 1HTQA 2V3NA 3Q3JA 4WURA 4NNJB 1WXVA 2N9KA 3QHTA 2O2VB 2FCMA 3TEZA 1L4DB 2C7NB 1MI0A 1ZKHA 3BY4B 2UWQA 1NBFC 1F9JA 4PS8A 3PLUA 1FCCC 3Q8EA 1PGBA 5KHQA 2LHEA 3VTVA 2KHWB 4AJWA 3HVDA 4LNIA 1SE4A 3GOEA 3X23A 4AOFA 1UH6A 1T6BX 2PJHA 1EUVB 1F1HA 3JYUA 1MPEA 5DCNA 1Q0WB 1AW7A 1IGCA 1D5MC 4NAMA 3ZJTA 4KKIA 2KN5A 3WA0A 5GMVA 4HJGE 5G55A 4EE2A 5IN7A 2KKCA 4F8CB 1E10A 3L16A 2MBQA 1IBXB 3VXWA 2WWZA 1YMHE 2I1KA 2J0MA 4UDUC 3PTFC 3AE2B 3R66C 1YN5A 3SD5A 3OAWA 2JY6A 3NZ3A 2WX1A 3U4EG 4IKGA 5MPOA 4MSQB 2XEWA 2D5GA 4NJCA 1U4AA 1IPGA 3AE3B 1ZGUB 4DHJB 3W2DA 1DOIA 1WX8A 1WRDB 2ZVNA 3R3MA 4P7IA 2D3BA 4HLEA 5I4DA 2DLBA 1RWSA 2IGDA 2ZVOA 1N5XA 4RF0A 2DZIA 2ONQA 2NTSA 3EC8A 4C56C 1E0ZA 1C1YB 1KFYB 4ZRIA 2FE8A 2ASQA 2DENB 1D3ZA 3V62A 3JSVA 2MLBA 1P7FA 2WXLA 1VZ8A 1WGHA 1XXGA 1H4RA 2K22A 3Q8CA 4GDKB 3A9KB 2CU3A 4IWPA 5BYSA 3QJZA 4LJOB 3UIOB 2DZMA 4EZLA 3N9YC 4KIKA 4HKQA 3ZNZB 3WIMA 4MGZE 1QLBB 3KW5B 3DBHB 5EE1A 5BMGA 3URYA 3HIZA 1FRDA 1VJKA 3MC8A 1KOTA 2E6XA 3RNAC 1ZXHA 2ZNVB 2BS4B 4J3OD 4TMAB 3PHXB 3EECA 3UGBB 3ZVVA 1WRIA 5J18A 1M4VA 3EFUA 4I6LB 1C9FA 3U7ZA 1FMAD 1D6EC 5LLIA 1YN4A 2MJDA 1LGRA 1UUPA 4M8NA 2L1AA 3EFCA 4C4VB 1WY8A 1HQRD 3GZNB 2CR5A 3P4RB 2D3CA 2K8BA 3GP7A 4KKJA 2KD0A 2WXQA 4PS3A 1YQ3B 5D3DA 3V61A 3EA6A 4LLGM 1WGKA 2G9HD 3I63C 1LQBA 1GNUA 2LWPA 1SE3A 2D3GA 5L83A 2AQ3B 3BWUD 2WDTB 2KOXA 3DBHI 1FNVA 2KDFB 2KC2A 2JYTA 1Q10A 3U8ZA 5JH5C 1DYQA 3H8HA 3CSTA 4XWWA 2BYEA 3VUXA 3QC8B 2WX0A 4DXFA 3NUHB 3ALBA 1PFDA 2LXAA 2V4IB 2GBJA 2BWES 2L83A 3AEEB 2PMVA 3TEXA 2DAJA 2G3QB 3IAM1 2KTRB 2PIAA 2K6QA 3T8MA 3DQVA 3RNBC 1SIFA 1VRAB 2RD0A 1ZXIA 2D10A 1KLVA 5EE0A 2LVQA 5AUIA 1E6EB 3P63A 5LXIB 1C3TA 4GGQA 1GAQB 5D94A 1TS3A 2BYTA 3WAOA 2K9XA 3QX1A 2LGSA 3GZNI 4JQWC 3IBEA 1XLQA 2FCQA 3BVGA 3RMKC 2BB5A 4WJQA 2SEBD 2N9PC 5E6NA 5BYRA 3AULA 2K3UA 4BKTA 2O6VD 1XO3A 4JX1C 1E8XA 1SSNA 4HCNB 3RUIB 4II2B 3DVGX 5KHOA 3A1QB 3AEBB 2AEHA 1SE9A 3DHGC 3WAPA 4B0EA 1Q1OA 1GPXA 2KAJA 4DXGA 3KWLA 4PS7A 2NCNA 2LVPA 3PZ8A 1VLBA 2C60A 4EKUA 2O2VA 1SIJA 4XDDA 2D3AA 4FXCA 1EF5A 2QJLA 2KJ6A 4X57B 1XQQA 1NYQA 1TGZB 2QIEB 1KRHA 1TKGA 3BK2A 4M00A 3VH3B 5AEKB 2OOBB 3H7PB 2MW5A 1V86A 1LM8B 2GOWA 2PVOD 1YQ4B 3LYYA 4I6NB 2JWZA 4FADA 3A9JB 4MSMB 2CHXA 3L0WB 4KV2A 4RGMA 3ZLZA 1IGDA 4JIOU 3V6CB 2M0AA 4WJPA 4L1BA 3TEYA 4A55A 1P98A 3AE9B 1IBXA 2KZRA 2B76B 4YL8A 3SEBA 2LGDA 3R7RA 1T3QA 5IO9A 1T0QC 4JLCA 4WWNA 4L2YA 5G2NA 2K39A 5JXVA 3TSSA 3AU4A 3RNFC 4EZKA 3ZXVA 1CK1A 3DBRB 4YTMB 4TUUA 3U2SC 1GC6A 4K3BA 4F7ZA 2JQRB 3UF8A 4LDTB 1CZPA 2N9XA 3FKYA 4IWOA 1R4MB 4CYEA 1PYWD 3OJ4B 2KVRA 2MWSB 1V81A 1WZ3A 2C7MB 2HJ8A 4E71A 4W9DA 1F2RI 4DXAB 3NVVA 3K9OB 4A3OA 3E9SA 3RD2A 2CS4A 2FCSA 2K0PA 4PYZA 1V9JA 4HPPA 4WJOA 3AE6B 4A6QA 4K7UA 1C78A 4WH4A 4LCDE 4PK1A 3CSFA 4RM8A 1UBQA 4MGYE 2DNFA 3A9KA 3HM3A 4GDKA 4IM2A 2FCNA 4BOSC
chains in the Genus database with same CATH topology
3VTVA 3DOWA 2KHWB 4AJWA 4IM3A 2HTHA 1Q5WB 5C23A 3S2AA 2FNJB 1QZEA 4ANUA 3RCZA 2C5LC 3L17A 3ZDMC 1ZW7A 3GOEA 2KJRA 1UGMA 4HWIB 4NAWA 4W9CA 3X23A 4AOFA 1UH6A 2MRPA 2WYQA 2PJHA 1EUVB 4KSKC 4OVUA 1GG3A 3ZW3A 2L3ZA 3JYUA 3L08A 2UYZB 2CU1A 4FBJB 5DCNA 1Q0WB 4HDQA 1EF1A 4BBNC 3V6EB 2BGFA 3L54A 4FULA 2Z0EB 4ICVA 3HHMA 1I35A 2KN5A 4GMVA 3WA0A 5GMVA 2K6DB 2IBIB 3ZRCA 4DHJD 5G55A 3VFKA 2LGXA 3KYDD 1WX7A 4RMAA 3NS8A 3BINA 2KKCA 5CX3A 2NS5A 4F8CB 4K7WA 4BBNF 3L16A 2IYDB 2MBQA 2CKHB 2NR2A 3VXWA 2WWZA 2I1KA 2K1FA 2J0MA 1AARA 2FAZA 3PTFC 2MX2A 4GU2A 3KH0A 3PHWB 3R66C 2XK5B 3DVGY 3QCAA 3SD5A 1BT0A 2L8JA 2M8SA 3APCA 3PT2B 4KSLC 3VVWB 3OAWA 2JY6A 4FHJA 3UIPB 2LZ6A 4M0WB 3RT3B 2WX1A 3W1SA 1V2YA 1J8CA 1J0GA 2LI5A 1L7YA 3H6NA 2HE7A 2Y5BB 3HK0A 2D11A 4II3B 4MSQB 4G0NB 2XEWA 3R7QA 1U4AA 1T0YA 4I6PA 2ZCBA 1OQYA 2MA9B 1IPGA 1YD8U 3IVFA 4NPNA 5DPRA 1ZGUB 3M3JA 3EHVA 4W9EA 4B9KA 4DHJB 3IHPC 3N3KB 3RZWC 2LASA 2NBUA 2J0JA 3DVNU 4W9JA 2KX0A 2ZJDA 1WGRA 1WX8A 2DAFA 2MBEA 4K81A 1WRDB 3TL5A 2ZVNA 2AWTA 2VRRB 4CHKA 3PREA 3R3MA 2JRHA 5D7GA 1GJZA 4P7IA 4DDID 4HLEA 1RAXA 4IWQA 2AL6A 3B0AA 3D32A 2ZVOA 4W9LA 2RSUA 4ANXA 2KQSA 2DZIA 2NPTB 2KWUB 2KXJA 1UELA 2DYBA 3C0RB 2N1VA 3B08A 3EC8A 2BYVE 1WFYA 2PE6B 2KMCA 3PRZA 4M8MA 5AZFA 3ZNID 1S1QB 1C1YB 4BKSA 3IG3A 4ZRIA 2MP2A 2MQJA 2N1WA 4MEMA 3N32A 4NY0A 2ASQA 2DENB 1D3ZA 3V62A 3VUYA 3LJ3A 4MJSB 1WJNA 2NVUI 2KQ7A 3JSVA 2MLBA 4BKGA 1WGYA 2NBVB 3H9DA 4EUTA 2V4LA 4B6WA 1WGHA 2M4NA 2JRIB 3U7DA 2ZCCA 5EDSA 4MELA 4NJ6A 1WGGA 4GN1A 1H4RA 4MH0E 4GDKB 2REXA 3A9KB 4IWPA 1G6JA 2M0XA 3QJZA 4LJOB 3UIOB 3WANA 3RYTA 4AUQC 3U30A 2DZMA 2LJ5A 4EZLA 3SHQA 1WE6A 2JT4B 4KIKA 2IY0B 3ZNHB 3ZNZB 3PVLA 2JXXA 3WIMA 4MGZE 4AP4C 3KW5B 4NAWB 2KFJA 2JUOA 4EEWA 4LJPB 2DZKA 4B95A 3HIZA 2D2QA 1V80A 2D07B 2GBKA 3NHEB 4IC7B 1FXTB 3M63B 3IFWB 1UBIA 1KOTA 5CTRC 3QQ8B 2YLMA 3W1YA 1YIWA 1UD7A 3VAWA 2K25A 2ZNVB 3PHXB 3ZDTA 4GXBA 3EECA 4XC2A 1E8ZA 1LXDA 3OLMD 3UGBB 3SDLC 3ZVVA 2KWVB 3MTNB 4GOCA 3EFUA 5J18A 4I6LB 2JZ3B 4A3PA 2KX3A 1IYFA 5C1ZA 3V60A 1S3SG 5JZEB 2J0KA 2IO2B 4ZRJA 2MBOA 5LLIA 1E7UA 1WH3A 2YVCA 3A1QA 3AI5A 3DBRI 1V6EA 1WMHA 2LRWA 1YX5B 5LXHA 4M8NA 5CHVC 2L05A 4W9HA 3N30A 3PSEB 4F1SA 1WR6E 1EO6A 1WI0A 1WY8A 3P2BA 4ANVA 1GUAB 1NI2A 2G4DB 2CR5A 2EMSA 3K9PB 4BKSD 1YQBA 3QARA 1R4MI 2K8BA 3ECIA 2ZNVC 3DCGA 3ZTCA 5JHBA 3ENEA 3PPAA 4G50A 4G11A 4ZDVA 2KD0A 2LVOA 2C7HA 4PS3A 2EMTA 2IY1B 4GSWA 2ZPNA 3V61A 2BYFA 2FIDA 4W9IA 4KZ0A 3ZNGC 4A20A 4DHZE 2O6VA 1TTNA 5TR5A 4ICUA 4KZCA 1ISNA 5IAAC 2L0FA 2RPQA 3QA8A 3JW0X 1L2NA 1X1MA 1XD3B 1LQBA 2MBBB 3JVZX 1WXSA 4ZRKA 1GNUA 2LWPA 4ASWC 2NBWB 2D3GA 5L83A 3VUWA 1E7VA 1OEYA 2V1YA 5DPSA 4WJNA 5IA7A 2WDTB 3A9JA 2KOXA 5FR6A 3DBHI 2KDFB 2XBBC 2KC2A 3TCAA 3NZSA 2L7RA 1H8CA 3W1SC 2FIFA 3U8ZA 3UINB 5JH5C 2N7DA 3CSTA 3APDA 3QIJA 2BYEA 4FJYA 2AL3A 2MP2B 4GIVA 3M95A 3VHTC 2L76A 3QC8B 3VUXA 3A4SC 2WX0A 4CO7A 3ZO5B 2KTFA 1RLFA 2JPHA 3TBLD 1WXAA 2KDEB 1OGWA 3JSVB 2LXAA 3ALBA 2KWCA 4JL9A 2GBJA 2BWES 3DBSA 4WWOA 2DZJA 2IO0B 4J6IA 2AYOB 3KUDB 2DAJA 2G3QB 2KMAA 4BVUC 2KTRB 3KYCD 4IW0A 3O65B 1WF9A 2K6QA 2PE9A 1MG8A 3PZDA 3DQVA 4HDOA 4XZ4A 3T8MA 1RFAA 1SIFA 2RD0A 4MGKE 5HKHA 4OVVA 4HCPB 4AWJA 2D10A 1KLVA 3UQAA 2J7QB 4KIKB 2LVQA 1C3TA 3DVNV 5LXIB 4MGIE 2GMIC 4GGQA 4JGHB 5DPWA 5D94A 3DBLI 2GBMA 3WAOA 3QX1A 2KTRA 1HE8A 3DDCB 3VTUA 3GZNI 4JQWC 2IZVB 3IBEA 4FJZA 1TBEA 2JF5A 4NQLB 2CHWA 2R2OA 1XT9B 2FCQA 5L95C 2A5UA 2ZEQA 2DYOA 3B1LX 3ZTDA 3H7SA 4WJQA 2N9PC 5E6NA 2G45B 1WM2A 2BKFA 3Q3FA 4TV3A 3H1UA 1J19A 4TQ1A 2Z59B 2W9NA 3L13A 2L0TA 1E8WA 3T9LA 1V49A 2JVCA 3AULA 3I3TB 3PGEA 2FUHB 2K8HA 1P1AA 1P3QU 2C9WB 2HD5B 2O6VD 4BKTA 5JHAA 3RULA 2B3AA 2N4FA 3ONSA 1RRBA 3OJ3A 1E8XA 3PRPB 4HXDA 1OTRB 4HCNB 3RUIB 1Z5SB 4II2B 4DHZB 3DVGX 5KHOA 3A1QB 3WAMA 4TKNA 4NJ7A 1NDDA 2AEHA 1SE9A 2LD9A 4HJKA 2ZPYA 3WAPA 1WMHB 5J17A 2DYMA 1Q1OA 1I42A 3CF6E 3ML9A 4WAAA 3TIXA 3UQBA 4W9FA 2LUEA 2KNBA 4EOYA 4BOZB 3HM6X 1E90A 4PS7A 2LRUA 2RR9A 5E6PA 2NCNA 4E74A 2LVPA 3A4RA 1WXMA 2BPSA 2C60A 2IO1B 4GDLA 2KFKA 3PV1A 2O2VA 2MSED 4EKUA 4TQ0A 1UZXB 3ML8A 1YX6B 4MDKE 1EF5A 5J2RA 2KC1A 2MBHA 1WJ6A 2KJ6A 1P9DU 4X57B 1XQQA 4HPLB 1TGZB 3WALA 1TZ1A 2KK8A 4FA6A 4FLHA 2O6VB 2GBRA 2V3SA 1WJ4A 5AZHA 4IG7B 2LXCA 5CHWA 3VH3B 1A5RA 4KDLB 5AEKB 2Z0DB 2OOBB 3H7PB 4HK2A 4K7SA 2MW5A 3CMMB 2GOWA 1V86A 1LM8B 3APFA 4IUMB 2QHOA 2KDBA 1WIAA 2I1JA 3A33B 4I6NB 2MCNB 3MHSD 2JWZA 4FADA 1WZ0A 3A9JB 4MSMB 2CHXA 2KANA 2G4SA 2L00B 1WR1A 3L0WB 3L10B 4KV2A 3ZLZA 4BFRA 3VH4B 3AXCA 4DWFA 2K8CA 3H7PA 3ZUNA 3VQIA 3PS6A 2DX5B 2BWFA 4JIOU 4RM9A 4W9KA 3V6CB 3KUCB 4ZYNA 3KVFB 5D2MB 2R2QA 1WX9A 2LGYA 1VD2A 4WJPA 4HPMB 2GBNA 4W9GA 2PPHA 1E8YA 4WQOB 5E6OA 1WYWB 2EKEC 5AZGA 1WGDA 1Y8RC 2PEAA 3TMPB 4ANWA 1P98A 4E3CA 1LFDA 3NZUA 3ZKJC 4LDTD 3NOBA 4FJVB 1KJTA 2JZZA 2KZRA 4DBGA 1GC7A 2BF8B 4FN2A 1Z2MA 2M1MA 1PQSA 4KVGB 2OJRA 4YL8A 2XK5A 3MJWA 2LGDA 5DPTA 4PYUA 3R7RA 2KJHB 3PLVA 2RGFA 5D6JB 3M62B 1YJ1A 2CHZA 4JLCA 4KDIC 4NQKE 4WWNA 3ZRFA 4HVBA 2M17A 5G2NA 3TJPA 2K39A 3AU4A 2N9EB 4EZKA 1CMXB 2BKRB 4G3XB 4EZJA 2KDIA 3VTWA 4WWPA 1OEYJ 1V5OA 3LDZE 1WM3A 1R4NI 4TUUA 1K8RB 2KO3A 1GC6A 4F7ZA 3QAQA 3QK0A 3UF8A 4LDTB 2N9XA 3AU5A 1WE7A 4N9F4 1JRUA 4IWOA 4K1RB 2N7EA 1P0RA 3X0WA 4CYEA 4XX5A 3OJ4B 1E5WA 4IM0A 2KVRA 2KLCA 2MWSB 2NPTA 3QWZB 1V81A 1V5TA 1WZ3A 2C7MB 2HJ8A 2IO3B 4E71A 4W9DA 3VDZA 4DXAB 3Q3JA 1VCBA 4NNJB 1WJUA 3K9OB 1WXVA 2A4ZA 4A3OA 3NY5A 4GB9A 3SU8X 3RZFA 3PRMB 2ZZPB 1SGHA 3RD2A 2CS4A 5CHFA 4MJSA 2DHZA 4DDGD 2FCSA 3QHTA 4GDLB 2KFKB 4URKA 2O2VB 2FCMA 4FHKA 4PYZA 1V9JA 2C7NB 3KUZA 4WJOA 4AJYB 4EFOA 1M94A 1ZKHA 2KLGA 3BY4B 2UWQA 3DPDA 4K7UA 4MM3A 1NBFC 1F9JA 1KM7A 1IP9A 4LCDE 3ZIMA 3CSFA 5BO4B 4PS8A 1UBQA 4RM8A 3PLUA 4DK5A 4MGYE 4GDKA 3A9KA 3HM3A 5KHQA 4IM2A 2FCNA 4BOSC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VTV A;  3DOW A;  2KHW B;  4AJW A;  4IM3 A;  2HTH A;  1Q5W B;  5C23 A;  3S2A A;  2FNJ B;  1QZE A;  4ANU A;  3RCZ A;  2C5L C;  3L17 A;  3ZDM C;  1ZW7 A;  3GOE A;  2KJR A;  1UGM A;  4HWI B;  4NAW A;  4W9C A;  3X23 A;  4AOF A;  1UH6 A;  2MRP A;  2WYQ A;  2PJH A;  1EUV B;  4KSK C;  4OVU A;  1GG3 A;  3ZW3 A;  2L3Z A;  3JYU A;  3L08 A;  2UYZ B;  2CU1 A;  4FBJ B;  5DCN A;  1Q0W B;  4HDQ A;  1EF1 A;  4BBN C;  3V6E B;  2BGF A;  3L54 A;  4FUL A;  2Z0E B;  4ICV A;  3HHM A;  1I35 A;  2KN5 A;  4GMV A;  3WA0 A;  5GMV A;  2K6D B;  2IBI B;  3ZRC A;  4DHJ D;  5G55 A;  3VFK A;  2LGX A;  3KYD D;  1WX7 A;  4RMA A;  3NS8 A;  3BIN A;  2KKC A;  5CX3 A;  2NS5 A;  4F8C B;  4K7W A;  4BBN F;  3L16 A;  2IYD B;  2MBQ A;  2CKH B;  2NR2 A;  3VXW A;  2WWZ A;  2I1K A;  2K1F A;  2J0M A;  1AAR A;  2FAZ A;  3PTF C;  2MX2 A;  4GU2 A;  3KH0 A;  3PHW B;  3R66 C;  2XK5 B;  3DVG Y;  3QCA A;  3SD5 A;  1BT0 A;  2L8J A;  2M8S A;  3APC A;  3PT2 B;  4KSL C;  3VVW B;  3OAW A;  2JY6 A;  4FHJ A;  3UIP B;  2LZ6 A;  4M0W B;  3RT3 B;  2WX1 A;  3W1S A;  1V2Y A;  1J8C A;  1J0G A;  2LI5 A;  1L7Y A;  3H6N A;  2HE7 A;  2Y5B B;  3HK0 A;  2D11 A;  4II3 B;  4MSQ B;  4G0N B;  2XEW A;  3R7Q A;  1U4A A;  1T0Y A;  4I6P A;  2ZCB A;  1OQY A;  2MA9 B;  1IPG A;  1YD8 U;  3IVF A;  4NPN A;  5DPR A;  1ZGU B;  3M3J A;  3EHV A;  4W9E A;  4B9K A;  4DHJ B;  3IHP C;  3N3K B;  3RZW C;  2LAS A;  2NBU A;  2J0J A;  3DVN U;  4W9J A;  2KX0 A;  2ZJD A;  1WGR A;  1WX8 A;  2DAF A;  2MBE A;  4K81 A;  1WRD B;  3TL5 A;  2ZVN A;  2AWT A;  2VRR B;  4CHK A;  3PRE A;  3R3M A;  2JRH A;  5D7G A;  1GJZ A;  4P7I A;  4DDI D;  4HLE A;  1RAX A;  4IWQ A;  2AL6 A;  3B0A A;  3D32 A;  2ZVO A;  4W9L A;  2RSU A;  4ANX A;  2KQS A;  2DZI A;  2NPT B;  2KWU B;  2KXJ A;  1UEL A;  2DYB A;  3C0R B;  2N1V A;  3B08 A;  3EC8 A;  2BYV E;  1WFY A;  2PE6 B;  2KMC A;  3PRZ A;  4M8M A;  5AZF A;  3ZNI D;  1S1Q B;  1C1Y B;  4BKS A;  3IG3 A;  4ZRI A;  2MP2 A;  2MQJ A;  2N1W A;  4MEM A;  3N32 A;  4NY0 A;  2ASQ A;  2DEN B;  1D3Z A;  3V62 A;  3VUY A;  3LJ3 A;  4MJS B;  1WJN A;  2NVU I;  2KQ7 A;  3JSV A;  2MLB A;  4BKG A;  1WGY A;  2NBV B;  3H9D A;  4EUT A;  2V4L A;  4B6W A;  1WGH A;  2M4N A;  2JRI B;  3U7D A;  2ZCC A;  5EDS A;  4MEL A;  4NJ6 A;  1WGG A;  4GN1 A;  1H4R A;  4MH0 E;  4GDK B;  2REX A;  3A9K B;  4IWP A;  1G6J A;  2M0X A;  3QJZ A;  4LJO B;  3UIO B;  3WAN A;  3RYT A;  4AUQ C;  3U30 A;  2DZM A;  2LJ5 A;  4EZL A;  3SHQ A;  1WE6 A;  2JT4 B;  4KIK A;  2IY0 B;  3ZNH B;  3ZNZ B;  3PVL A;  2JXX A;  3WIM A;  4MGZ E;  4AP4 C;  3KW5 B;  4NAW B;  2KFJ A;  2JUO A;  4EEW A;  4LJP B;  2DZK A;  4B95 A;  3HIZ A;  2D2Q A;  1V80 A;  2D07 B;  2GBK A;  3NHE B;  4IC7 B;  1FXT B;  3M63 B;  3IFW B;  1UBI A;  1KOT A;  5CTR C;  3QQ8 B;  2YLM A;  3W1Y A;  1YIW A;  1UD7 A;  3VAW A;  2K25 A;  2ZNV B;  3PHX B;  3ZDT A;  4GXB A;  3EEC A;  4XC2 A;  1E8Z A;  1LXD A;  3OLM D;  3UGB B;  3SDL C;  3ZVV A;  2KWV B;  3MTN B;  4GOC A;  3EFU A;  5J18 A;  4I6L B;  2JZ3 B;  4A3P A;  2KX3 A;  1IYF A;  5C1Z A;  3V60 A;  1S3S G;  5JZE B;  2J0K A;  2IO2 B;  4ZRJ A;  2MBO A;  5LLI A;  1E7U A;  1WH3 A;  2YVC A;  3A1Q A;  3AI5 A;  3DBR I;  1V6E A;  1WMH A;  2LRW A;  1YX5 B;  5LXH A;  4M8N A;  5CHV C;  2L05 A;  4W9H A;  3N30 A;  3PSE B;  4F1S A;  1WR6 E;  1EO6 A;  1WI0 A;  1WY8 A;  3P2B A;  4ANV A;  1GUA B;  1NI2 A;  2G4D B;  2CR5 A;  2EMS A;  3K9P B;  4BKS D;  1YQB A;  3QAR A;  1R4M I;  2K8B A;  3ECI A;  2ZNV C;  3DCG A;  3ZTC A;  5JHB A;  3ENE A;  3PPA A;  4G50 A;  4G11 A;  4ZDV A;  2KD0 A;  2LVO A;  2C7H A;  4PS3 A;  2EMT A;  2IY1 B;  4GSW A;  2ZPN A;  3V61 A;  2BYF A;  2FID A;  4W9I A;  4KZ0 A;  3ZNG C;  4A20 A;  4DHZ E;  2O6V A;  1TTN A;  5TR5 A;  4ICU A;  4KZC A;  1ISN A;  5IAA C;  2L0F A;  2RPQ A;  3QA8 A;  3JW0 X;  1L2N A;  1X1M A;  1XD3 B;  1LQB A;  2MBB B;  3JVZ X;  1WXS A;  4ZRK A;  1GNU A;  2LWP A;  4ASW C;  2NBW B;  2D3G A;  5L83 A;  3VUW A;  1E7V A;  1OEY A;  2V1Y A;  5DPS A;  4WJN A;  5IA7 A;  2WDT B;  3A9J A;  2KOX A;  5FR6 A;  3DBH I;  2KDF B;  2XBB C;  2KC2 A;  3TCA A;  3NZS A;  2L7R A;  1H8C A;  3W1S C;  2FIF A;  3U8Z A;  3UIN B;  5JH5 C;  2N7D A;  3CST A;  3APD A;  3QIJ A;  2BYE A;  4FJY A;  2AL3 A;  2MP2 B;  4GIV A;  3M95 A;  3VHT C;  2L76 A;  3QC8 B;  3VUX A;  3A4S C;  2WX0 A;  4CO7 A;  3ZO5 B;  2KTF A;  1RLF A;  2JPH A;  3TBL D;  1WXA A;  2KDE B;  1OGW A;  3JSV B;  2LXA A;  3ALB A;  2KWC A;  4JL9 A;  2GBJ A;  2BWE S;  3DBS A;  4WWO A;  2DZJ A;  2IO0 B;  4J6I A;  2AYO B;  3KUD B;  2DAJ A;  2G3Q B;  2KMA A;  4BVU C;  2KTR B;  3KYC D;  4IW0 A;  3O65 B;  1WF9 A;  2K6Q A;  2PE9 A;  1MG8 A;  3PZD A;  3DQV A;  4HDO A;  4XZ4 A;  3T8M A;  1RFA A;  1SIF A;  2RD0 A;  4MGK E;  5HKH A;  4OVV A;  4HCP B;  4AWJ A;  2D10 A;  1KLV A;  3UQA A;  2J7Q B;  4KIK B;  2LVQ A;  1C3T A;  3DVN V;  5LXI B;  4MGI E;  2GMI C;  4GGQ A;  4JGH B;  5DPW A;  5D94 A;  3DBL I;  2GBM A;  3WAO A;  3QX1 A;  2KTR A;  1HE8 A;  3DDC B;  3VTU A;  3GZN I;  4JQW C;  2IZV B;  3IBE A;  4FJZ A;  1TBE A;  2JF5 A;  4NQL B;  2CHW A;  2R2O A;  1XT9 B;  2FCQ A;  5L95 C;  2A5U A;  2ZEQ A;  2DYO A;  3B1L X;  3ZTD A;  3H7S A;  4WJQ A;  2N9P C;  5E6N A;  2G45 B;  1WM2 A;  2BKF A;  3Q3F A;  4TV3 A;  3H1U A;  1J19 A;  4TQ1 A;  2Z59 B;  2W9N A;  3L13 A;  2L0T A;  1E8W A;  3T9L A;  1V49 A;  2JVC A;  3AUL A;  3I3T B;  3PGE A;  2FUH B;  2K8H A;  1P1A A;  1P3Q U;  2C9W B;  2HD5 B;  2O6V D;  4BKT A;  5JHA A;  3RUL A;  2B3A A;  2N4F A;  3ONS A;  1RRB A;  3OJ3 A;  1E8X A;  3PRP B;  4HXD A;  1OTR B;  4HCN B;  3RUI B;  1Z5S B;  4II2 B;  4DHZ B;  3DVG X;  5KHO A;  3A1Q B;  3WAM A;  4TKN A;  4NJ7 A;  1NDD A;  2AEH A;  1SE9 A;  2LD9 A;  4HJK A;  2ZPY A;  3WAP A;  1WMH B;  5J17 A;  2DYM A;  1Q1O A;  1I42 A;  3CF6 E;  3ML9 A;  4WAA A;  3TIX A;  3UQB A;  4W9F A;  2LUE A;  2KNB A;  4EOY A;  4BOZ B;  3HM6 X;  1E90 A;  4PS7 A;  2LRU A;  2RR9 A;  5E6P A;  2NCN A;  4E74 A;  2LVP A;  3A4R A;  1WXM A;  2BPS A;  2C60 A;  2IO1 B;  4GDL A;  2KFK A;  3PV1 A;  2O2V A;  2MSE D;  4EKU A;  4TQ0 A;  1UZX B;  3ML8 A;  1YX6 B;  4MDK E;  1EF5 A;  5J2R A;  2KC1 A;  2MBH A;  1WJ6 A;  2KJ6 A;  1P9D U;  4X57 B;  1XQQ A;  4HPL B;  1TGZ B;  3WAL A;  1TZ1 A;  2KK8 A;  4FA6 A;  4FLH A;  2O6V B;  2GBR A;  2V3S A;  1WJ4 A;  5AZH A;  4IG7 B;  2LXC A;  5CHW A;  3VH3 B;  1A5R A;  4KDL B;  5AEK B;  2Z0D B;  2OOB B;  3H7P B;  4HK2 A;  4K7S A;  2MW5 A;  3CMM B;  2GOW A;  1V86 A;  1LM8 B;  3APF A;  4IUM B;  2QHO A;  2KDB A;  1WIA A;  2I1J A;  3A33 B;  4I6N B;  2MCN B;  3MHS D;  2JWZ A;  4FAD A;  1WZ0 A;  3A9J B;  4MSM B;  2CHX A;  2KAN A;  2G4S A;  2L00 B;  1WR1 A;  3L0W B;  3L10 B;  4KV2 A;  3ZLZ A;  4BFR A;  3VH4 B;  3AXC A;  4DWF A;  2K8C A;  3H7P A;  3ZUN A;  3VQI A;  3PS6 A;  2DX5 B;  2BWF A;  4JIO U;  4RM9 A;  4W9K A;  3V6C B;  3KUC B;  4ZYN A;  3KVF B;  5D2M B;  2R2Q A;  1WX9 A;  2LGY A;  1VD2 A;  4WJP A;  4HPM B;  2GBN A;  4W9G A;  2PPH A;  1E8Y A;  4WQO B;  5E6O A;  1WYW B;  2EKE C;  5AZG A;  1WGD A;  1Y8R C;  2PEA A;  3TMP B;  4ANW A;  1P98 A;  4E3C A;  1LFD A;  3NZU A;  3ZKJ C;  4LDT D;  3NOB A;  4FJV B;  1KJT A;  2JZZ A;  2KZR A;  4DBG A;  1GC7 A;  2BF8 B;  4FN2 A;  1Z2M A;  2M1M A;  1PQS A;  4KVG B;  2OJR A;  4YL8 A;  2XK5 A;  3MJW A;  2LGD A;  5DPT A;  4PYU A;  3R7R A;  2KJH B;  3PLV A;  2RGF A;  5D6J B;  3M62 B;  1YJ1 A;  2CHZ A;  4JLC A;  4KDI C;  4NQK E;  4WWN A;  3ZRF A;  4HVB A;  2M17 A;  5G2N A;  3TJP A;  2K39 A;  3AU4 A;  2N9E B;  4EZK A;  1CMX B;  2BKR B;  4G3X B;  4EZJ A;  2KDI A;  3VTW A;  4WWP A;  1OEY J;  1V5O A;  3LDZ E;  1WM3 A;  1R4N I;  4TUU A;  1K8R B;  2KO3 A;  1GC6 A;  4F7Z A;  3QAQ A;  3QK0 A;  3UF8 A;  4LDT B;  2N9X A;  3AU5 A;  1WE7 A;  4N9F 4;  1JRU A;  4IWO A;  4K1R B;  2N7E A;  1P0R A;  3X0W A;  4CYE A;  4XX5 A;  3OJ4 B;  1E5W A;  4IM0 A;  2KVR A;  2KLC A;  2MWS B;  2NPT A;  3QWZ B;  1V81 A;  1V5T A;  1WZ3 A;  2C7M B;  2HJ8 A;  2IO3 B;  4E71 A;  4W9D A;  3VDZ A;  4DXA B;  3Q3J A;  1VCB A;  4NNJ B;  1WJU A;  3K9O B;  1WXV A;  2A4Z A;  4A3O A;  3NY5 A;  4GB9 A;  3SU8 X;  3RZF A;  3PRM B;  2ZZP B;  1SGH A;  3RD2 A;  2CS4 A;  5CHF A;  4MJS A;  2DHZ A;  4DDG D;  2FCS A;  3QHT A;  4GDL B;  2KFK B;  4URK A;  2O2V B;  2FCM A;  4FHK A;  4PYZ A;  1V9J A;  2C7N B;  3KUZ A;  4WJO A;  4AJY B;  4EFO A;  1M94 A;  1ZKH A;  2KLG A;  3BY4 B;  2UWQ A;  3DPD A;  4K7U A;  4MM3 A;  1NBF C;  1F9J A;  1KM7 A;  1IP9 A;  4LCD E;  3ZIM A;  3CSF A;  5BO4 B;  4PS8 A;  1UBQ A;  4RM8 A;  3PLU A;  4DK5 A;  4MGY E;  4GDK A;  3A9K A;  3HM3 A;  5KHQ A;  4IM2 A;  2FCN A;  4BOS C; 
#chains in the Genus database with same CATH topology
 1Q5W B;  1WSP A;  3S2A A;  2FNJ B;  3RCZ A;  1ET6 A;  3AEG B;  4W9C A;  1R7S A;  4H2A A;  1D5Z C;  1K50 A;  2WYQ A;  1EU3 A;  4KSK C;  4OVU A;  3ZW3 A;  2L3Z A;  3L08 A;  3FIL A;  1L6V A;  2CU1 A;  4FBJ B;  1EF1 A;  3GE8 C;  1BUI C;  4ICV A;  1I35 A;  4GMV A;  2NTT A;  4D2K A;  2KDM A;  3KYD D;  1WX7 A;  3NS8 A;  3GB1 A;  3WCQ A;  4K7W A;  1SJE D;  4C00 A;  1HZ6 A;  1YNT E;  2CKH B;  1AYF A;  2XNA C;  1AAR A;  2FAZ A;  2MX2 A;  4GU2 A;  3QCA A;  2L8J A;  3PT2 B;  3UIP B;  1NI3 A;  1IUE A;  4OVZ A;  1V2Y A;  2HJ1 A;  3P4Q B;  4G0N B;  3R7Q A;  2WLB A;  1FIQ A;  3ZJU A;  2IJ0 A;  4ZHO A;  3Q3O C;  4I6P A;  2ZCB A;  1YD8 U;  4NPN A;  1DGJ A;  4W9J A;  1B1Z A;  1WGR A;  2DAF A;  2MBE A;  4K81 A;  2AWT A;  4LNN A;  1GJZ A;  4A90 A;  2AL6 A;  4P1C C;  3D32 A;  4W9L A;  2BQQ A;  4ANX A;  2KXJ A;  1UEL A;  2DYB A;  2PW9 A;  2PE6 B;  3RNG C;  2M56 B;  4BKS A;  4WQM A;  1V1P B;  4MEM A;  1SB3 C;  3N32 A;  4NY0 A;  3LJ3 A;  4ACF A;  1C4P A;  1YOV B;  2V4L A;  2M4N A;  3R2I A;  4IDI A;  1ZUD 2;  2JRI B;  4MM3 B;  5LNK 1;  3U7D A;  1TS5 A;  5EDS A;  4MEL A;  1QIL A;  4GN1 A;  4MH0 E;  5D3I B;  3WAN A;  2LJ5 A;  1WE6 A;  2IY0 B;  1GOZ A;  4P16 A;  4TSS A;  2KN4 A;  2JUO A;  1V80 A;  4IC7 B;  3UI3 A;  1YJJ A;  1FXT B;  1UBI A;  3SFE B;  4WIP A;  4XYC A;  2MJE A;  4LNK A;  3W1Y A;  1FD6 A;  3VAW A;  2LUM A;  4GXB A;  4XC2 A;  4HRO A;  1E8Z A;  3OLM D;  1I7H A;  1SXT A;  3LB8 C;  2V3P A;  4A3P A;  5C1Z A;  1E7U A;  3A1Q A;  1SBB B;  1YX5 B;  2WXH A;  2W54 A;  2L05 A;  3DBL B;  4W9H A;  4F1S A;  5T8I A;  1WI0 A;  2TSS A;  3DWG C;  4MAC A;  2G4D B;  3IXS A;  3IT6 B;  1N63 A;  3DCG A;  3AB5 A;  3DHH C;  4G50 A;  2LVO A;  4A20 A;  4W9I A;  4RH6 A;  5TR5 A;  1ISN A;  3QA8 A;  4ZRK A;  2W82 A;  1ET9 A;  4MH8 A;  2OED A;  3GS2 A;  1UWM A;  2YEP B;  3VUW A;  1E7V A;  5TSS A;  3AED B;  5IA7 A;  3NVW A;  3A9J A;  5FR6 A;  4USA A;  2WU2 B;  3ZGZ A;  1MVK A;  1EWC A;  4FJY A;  2W55 A;  3KWV A;  4C7Y A;  1RFK A;  2KTF A;  2JPH A;  1N5W A;  1OGW A;  2KDE B;  4YSY B;  4RGT A;  3NRZ A;  3TUO A;  3HRD D;  3AN1 A;  5GXG B;  2DZJ A;  4P6V F;  4C7Z A;  1NEN B;  2KMA A;  2Q5W D;  2PE9 A;  4HDO A;  3TEW A;  4MGK E;  5FR3 A;  3AEF B;  4MGI E;  2GMI C;  2ZW0 A;  4JGH B;  2J53 A;  1MFW A;  3BVM A;  3DBL I;  2GBM A;  1NVI D;  1HE8 A;  5IP4 D;  3N1Y C;  3VTU A;  4FJZ A;  1TBE A;  2JF5 A;  4NQL B;  3PO0 A;  2DYO A;  4XGA B;  4RFB A;  3H7S A;  1F0Z A;  2J4X A;  2BKF A;  3Q3F A;  3V3X A;  3H1U A;  4TQ1 A;  2L0T A;  3PGE A;  2K8H A;  1P1A A;  1K53 A;  1KTK A;  5JHA A;  2N4F A;  1RRB A;  3OJ3 A;  4HXD A;  1OTR B;  1Z5S B;  4OHJ A;  4OZA A;  1NYR A;  1NDD A;  4NJ7 A;  1P7E A;  2DYM A;  1T0R C;  3CF6 E;  3ML9 A;  3UQB A;  4W9F A;  2LUE A;  2KNB A;  4EOY A;  1OQQ A;  2LRU A;  2RR9 A;  3AV8 A;  4ZYS A;  3A4R A;  1WXM A;  4N59 A;  1SJH D;  4A9A A;  2MSE D;  4YXD B;  1STE A;  4LNO A;  3ML8 A;  1YX6 B;  4XDC A;  2MEK A;  2G1E A;  2KC1 A;  1WJ6 A;  1DOY A;  3WAL A;  2KK8 A;  4FA6 A;  2I38 A;  4FLH A;  2O6V B;  2GBR A;  1I4R A;  2LXC A;  5CHW A;  2KVZ A;  2VZK B;  4KDL B;  1SEB D;  1E7P B;  2KDB A;  2QDF A;  2MCN B;  2ZW1 A;  1BML C;  2L00 B;  3ETR A;  3L10 B;  1I4Q A;  3VH4 B;  3VQI A;  3J9C A;  3PS6 A;  4ZYN A;  1JRO A;  5D2M B;  2R2Q A;  1WX9 A;  1C4C A;  1VD2 A;  3AEA B;  2PPH A;  5E6O A;  1WYW B;  1WGD A;  1Y8R C;  2PEA A;  3L4P A;  3DWM A;  4ANW A;  1LFD A;  3NZU A;  3NG0 A;  1FPY A;  4DBG A;  1GC7 A;  4FN2 A;  5EE3 A;  2VH1 A;  2LMC A;  5D6J B;  1AWD A;  4REZ A;  3M62 B;  2CHZ A;  4AQ7 A;  3TJP A;  2SAK A;  2N9E B;  1TS4 A;  4WWP A;  3OG5 A;  3NS1 A;  1K8R B;  4IOI E;  1L6U A;  4RNA A;  4JE3 B;  1FXA A;  2KAC A;  3RNC C;  4N9F 4;  2JWU A;  2N7E A;  1P0R A;  1TZO A;  4XX5 A;  5C3J B;  1QQR A;  2GB1 A;  3VDZ A;  5H8Y E;  1VCB A;  2IGG A;  3NY5 A;  1V1P A;  1ZPS A;  3PRM B;  2ZZP B;  2VZK D;  5CHF A;  3AM9 A;  2DHZ A;  4DDG D;  4GDL B;  4URK A;  4FHK A;  3KUZ A;  4LK0 M;  3B9J A;  1M94 A;  2KLG A;  1C4A A;  3DPD A;  4MM3 A;  1KM7 A;  1IP9 A;  3ZIM A;  4US8 A;  4IM3 A;  5C23 A;  1YJI A;  4ANU A;  2C5L C;  3L17 A;  3VRB B;  1ZW7 A;  1KLG D;  1UGM A;  4HWI B;  2Z8L A;  2INC C;  3MC0 B;  3HUI A;  1KF6 B;  3N1X C;  2QMT A;  1FCL A;  2UYZ B;  3I9V 1;  4JPS A;  4HDQ A;  1SE2 A;  2BGF A;  1FRR A;  2Z0E B;  3HHM A;  2K6D B;  2WXG A;  2BS3 B;  3VFK A;  1XEE A;  3BIN A;  3T3O A;  3Q69 A;  2IYD B;  2NR2 A;  1ZP0 B;  2MHJ A;  3PHW B;  2XK5 B;  1BT0 A;  2M8S A;  4KSL C;  3VVW B;  4M0W B;  3W1S A;  3HK0 A;  3H6N A;  2Y5B B;  4II3 B;  4ITK A;  2PKO A;  2MA9 B;  3M3J A;  4B9K A;  4HEA 1;  3IHP C;  3N3K B;  2J42 A;  2LAS A;  2J0J A;  2ZJD A;  5C2T B;  4OW0 A;  4BZA A;  3RPF C;  1ENF A;  2JXT A;  2EKI A;  2JRH A;  4DDI D;  4ZRP A;  1RAX A;  1AN8 A;  1JWS D;  4WWM A;  3B0A A;  2KQS A;  2WS3 B;  2NPT B;  2KWU B;  4RCO A;  2N1V A;  3B08 A;  2BYV E;  1WFY A;  3ZNI D;  3PRZ A;  1KH0 A;  4M8M A;  5AZF A;  5IOI A;  1F52 A;  4M01 A;  3IG3 A;  2IGH A;  4R3D A;  3SR6 A;  3VUY A;  1F77 A;  4MJS B;  5H92 C;  2KQ7 A;  4BKG A;  2NBV B;  4B6W A;  4KGT A;  2H89 B;  2IND C;  5FK9 C;  4Q2J A;  3NVZ A;  1G6J A;  3P1M A;  3U30 A;  1RM6 C;  2JT4 B;  1N60 A;  1XLO A;  3Q3N C;  3ZNH B;  2JXX A;  4NAW B;  4EEW A;  5AUK A;  3RFZ B;  4LJP B;  2DZK A;  4XE0 A;  2GBK A;  3NHE B;  3P42 A;  3M63 B;  5CTR C;  3QQ8 B;  2YLM A;  2EEL A;  1TS2 A;  1I4H A;  3MTN B;  2QCZ A;  2Y3A A;  1PDX A;  2JZ3 B;  2KX3 A;  3V60 A;  3W5V B;  2IO2 B;  2MBO A;  3VRA B;  3DBR I;  3P4P B;  2LRW A;  3GE3 C;  3N30 A;  3PSE B;  1YN3 A;  1WR6 E;  2FBW B;  1EO6 A;  3P2B A;  1V1O A;  4ARI A;  2PTL A;  2EMS A;  1MG4 A;  3AE5 B;  3K9P B;  2WDR B;  1YQB A;  1R4M I;  1XLP A;  2ZNV C;  3C8Y A;  5JHB A;  2INN E;  3ENE A;  3PPA A;  3Q8A A;  4G11 A;  2N7J A;  2C7H A;  4C4V A;  4M02 A;  4KZ0 A;  2O6V A;  1TTN A;  4ICU A;  2KT7 A;  4JWU C;  2RPQ A;  3C19 A;  1X1M A;  2MBB B;  1WXS A;  2ACZ B;  4HKZ E;  1OEY A;  2V1Y A;  5DPS A;  1HXY D;  1TJE A;  1XCT L;  3BVZ A;  1FO4 A;  1T5X D;  1JRP A;  2GLS A;  3AE1 B;  2XBB C;  1H8C A;  3NZS A;  1JML A;  3MHZ A;  3APD A;  2PLP A;  2MP2 B;  1TIF A;  3Q14 C;  5HG2 A;  3BII D;  3A4S C;  4CO7 A;  3ZO5 B;  2GRI A;  3TBL D;  1WXA A;  2INP E;  4WWO A;  4J6I A;  2AYO B;  3KUD B;  1LO5 D;  3PZD A;  1RFA A;  5HKH A;  4OVV A;  3HVZ A;  4YTN B;  1D4B A;  2J7Q B;  4JWS C;  2WGS A;  2AX5 A;  1RYJ A;  2KTR A;  1FFV A;  2WXR A;  4ZOH C;  3DDC B;  2WQY B;  4ZRQ A;  2CHW A;  1XT9 B;  2LGI A;  2GI9 A;  1HEZ E;  3B2F A;  2G45 B;  2BS2 B;  1J19 A;  2Z59 B;  2W9N A;  3L13 A;  1E8W A;  1UGJ A;  3T9L A;  1V49 A;  3PZ7 A;  2FUH B;  1P3Q U;  2WXJ A;  2C9W B;  1MHX A;  1I4G A;  5EE9 A;  3RUL A;  3ONS A;  4KGS A;  3PRP B;  3B2G A;  2LEK A;  4TKN A;  2LD9 A;  1WMH B;  5J17 A;  2BBC A;  4YT0 B;  4RGN A;  3TIX A;  1ACC A;  3AE7 B;  3AH7 A;  4BOZ B;  3IAS 1;  3HM6 X;  1E90 A;  4YTP B;  1FNU A;  5E6P A;  4N6E B;  4YSZ B;  3MC9 A;  4GDL A;  2BPS A;  1UZX B;  4ARC A;  1B9R A;  4C80 A;  5J2R A;  1P9D U;  2RMM A;  4QAY A;  1WJ4 A;  3FAH A;  4IG7 B;  1JWM D;  1A5R A;  2Z0D B;  4HK2 A;  4HRS A;  3APF A;  5HFY A;  1J7B A;  2QHO A;  1FM0 D;  4RGO S;  3I57 A;  3LXF A;  2G4S A;  1VDV A;  1WR1 A;  4BFR A;  4DWF A;  2K8C A;  3H7P A;  2IDY A;  3FC4 A;  2DX5 B;  2BWF A;  2BVC A;  1FEH A;  2LGY A;  3IT4 B;  4WQO B;  2EKE C;  5AZG A;  3TMP B;  3V05 A;  3ZKJ C;  2BB6 A;  3NOB A;  4FJV B;  1KJT A;  2JZZ A;  5BMI A;  2BF8 B;  1PQS A;  2OJR A;  2XK5 A;  1F2R C;  4PYU A;  2KJH B;  3PLV A;  2MH7 A;  4NQK E;  1YJ1 A;  3ZRF A;  4M0W A;  2M17 A;  4HVB A;  2CJN A;  1HZ5 A;  4L23 A;  3N20 C;  1MHH E;  2WXO A;  4G3X B;  2L52 A;  2AQ1 B;  3VTW A;  2BT6 A;  1A70 A;  1WM3 A;  1QT9 A;  2WXN A;  1CJE A;  2WXP A;  3QAQ A;  1L5P A;  2QSD A;  2IPK D;  3AU5 A;  1WE7 A;  4DQO C;  2LHD A;  1WWT A;  5HI1 A;  1L0V B;  2M19 A;  3X0W A;  3OWE B;  2RDH A;  2WDQ B;  1E5W A;  4IM0 A;  2WXK A;  3T3N A;  2KLC A;  3NVY A;  2NPT A;  3QWZ B;  1XLN A;  1V5T A;  2X8X X;  2CJO A;  2IO3 B;  4YSX B;  1EU4 A;  2WXF A;  1PUT A;  1C79 A;  1JQ4 A;  3RI7 C;  1WJU A;  2A4Z A;  3SU8 X;  4GB9 A;  3RZF A;  2QEJ C;  2HTM E;  4S0R A;  1SGH A;  1T0S C;  4K3C A;  4B0M A;  4MJS A;  2KFK B;  2WXI A;  4EFO A;  4AJY B;  4A8X C;  1ZOY B;  5BO4 B;  4DK5 A;  3DOW A;  2HTH A;  3FIL B;  1FFU A;  2DBY A;  1QZE A;  2OJW A;  3ZDM C;  2KJR A;  2RDB C;  4NAW A;  2MRP A;  2NMQ A;  4US9 A;  1GG3 A;  2KQ4 X;  3Q8B A;  2WHI A;  3U52 E;  2E3T A;  3RN9 C;  4BBN C;  3V6E B;  4N58 A;  3ZQ4 A;  3L54 A;  4FUL A;  1JW9 D;  2IBI B;  4OZB A;  3ZRC A;  4DHJ D;  2LGX A;  1PGX A;  2VH2 A;  4RMA A;  4BAX A;  1KLU D;  5CX3 A;  4AS1 A;  1BXT A;  2NS5 A;  3N1Z C;  3ZXR A;  1OQR A;  1VR9 A;  4BBN F;  1E9M A;  1L0Y B;  3E56 A;  2K1F A;  3W5U B;  1ZE3 D;  4O1N A;  4ZHP A;  1JAL A;  3BYY B;  3KH0 A;  2N0S B;  3DVG Y;  2OHF A;  2MJ3 A;  3APC A;  4FHJ A;  2LZ6 A;  3RT3 B;  1PGA A;  1J8C A;  1J0G A;  2LI5 A;  4S17 A;  1L7Y A;  3ABV B;  2HE7 A;  2D11 A;  1D5X C;  3I5J C;  1CQV A;  1T0Y A;  3ZYY X;  1OQY A;  2JYE A;  3IVF A;  5DPR A;  3EHV A;  4W9E A;  2DWQ A;  3Q3M C;  3RZW C;  2NBU A;  1EWY C;  2Y5P A;  3DVN U;  2KX0 A;  3O13 A;  3VR8 B;  3TL5 A;  2VRR B;  4CHK A;  3BYT B;  3PRE A;  5D7G A;  1ZDV A;  4IWQ A;  1I4X A;  4P1B C;  2RSU A;  4XWT A;  4OZC A;  3C0R B;  2KMC A;  1S1Q B;  1N6Z A;  3W9C B;  2MP2 A;  2MQJ A;  2N1W A;  1QOF A;  3MFG A;  1WJN A;  2NVU I;  1TT5 B;  3R2T A;  1WGY A;  3H9D A;  4EUT A;  1FXI A;  3KQ4 A;  2ZCC A;  4NJ6 A;  1WGG A;  2V0G A;  2REX A;  2M0X A;  4AUQ C;  3BZD B;  3RYT A;  3AEC B;  4KGR A;  3SHQ A;  1J7C A;  3EGR A;  1I4P A;  1C76 A;  3PVL A;  2BTE A;  4AP4 C;  1XCQ L;  2KFJ A;  3Q2A C;  4B95 A;  1QOA A;  2XN9 C;  2D2Q A;  2D07 B;  1TYG B;  1L4Z B;  2LFI A;  2UU7 A;  3IFW B;  2K5P A;  1YIW A;  1UD7 A;  2K25 A;  1N61 A;  1UNS A;  3ZDT A;  1LXD A;  4NZL B;  4LNF A;  3SDL C;  4CQN A;  2KWV B;  4GOC A;  1WXQ A;  1WYG A;  1IYF A;  1ROE A;  2J52 A;  4WAF A;  1S3S G;  5G5G A;  5JZE B;  2J0K A;  4ZRJ A;  1SF0 A;  1QOB A;  1WH3 A;  2YVC A;  3AI5 A;  2W3S A;  1V6E A;  1ESF A;  1WMH A;  3P4S B;  3EUB 2;  5LXH A;  5CHV C;  1MJD A;  3MP9 A;  1FNW A;  3AMZ A;  4ANV A;  1GUA B;  2KMM A;  1NI2 A;  2FUG 1;  3ZJV A;  3AE4 B;  4BKS D;  3QAR A;  3ECI A;  5G5H A;  4GLS C;  3ZTC A;  3R8B A;  4ZDV A;  1V8C A;  2EMT A;  3VR9 B;  2IY1 B;  4GSW A;  2ZPN A;  3ZNG C;  2BYF A;  2FID A;  4DHZ E;  4KZC A;  1XF5 L;  5IAA C;  2L0F A;  2H88 B;  1N62 A;  3JW0 X;  1L2N A;  1XD3 B;  5BYQ A;  3JVZ X;  4YWG G;  2RDG A;  1Y56 A;  4ASW C;  2NBW B;  3BK1 A;  1K52 A;  2JU6 X;  4WJN A;  1EM7 A;  3TCA A;  2L7R A;  3W1S C;  2FIF A;  3UIN B;  2N7D A;  1GB1 A;  3QIJ A;  2ON8 A;  2AL3 A;  4GIV A;  3M95 A;  3VHT C;  2L76 A;  1L0X B;  2R61 A;  1JWB D;  1RLF A;  3KLS X;  4JL9 A;  1K51 A;  3JSV B;  2KWC A;  3DBS A;  2N9L A;  1V97 A;  2IO0 B;  4BVU C;  3KYC D;  4IW0 A;  3O65 B;  1WF9 A;  1MG8 A;  4XZ4 A;  2X38 A;  2KWD A;  4HCP B;  4AWJ A;  1HTO A;  1TKE A;  3UQA A;  4KIK B;  3DVN V;  4MT5 A;  2QIL A;  5DPW A;  1JWU D;  5E6J A;  3CIR B;  2PVG C;  2IZV B;  2R2O A;  2YEP F;  5L95 C;  2A5U A;  2ZEQ A;  3B1L X;  3ZTD A;  4TV3 A;  1WM2 A;  5FKA C;  2ICI A;  2JVC A;  3I3T B;  4LTU A;  1HA5 A;  2HD5 B;  2B3A A;  1ZDX A;  4DHZ B;  3WAM A;  4HJK A;  2ZPY A;  1I42 A;  4WAA A;  3AE8 B;  1OFF A;  2WP9 B;  3Q6B A;  3RNE C;  3DHI C;  4E74 A;  2BW2 A;  2IO1 B;  2LJI A;  2KFK A;  3PV1 A;  2RPV A;  1C77 A;  4TQ0 A;  1R4N B;  4MDK E;  1VZ6 A;  2MBH A;  2QC8 A;  4HPL B;  1TZ1 A;  1QKZ A;  2AQ2 B;  2HDE A;  1QOG A;  2V3S A;  5AZH A;  4KX6 B;  1TY0 A;  2W3R A;  4K7S A;  3CMM B;  5BMH A;  4IUM B;  5IKC M;  1WIA A;  2I1J A;  3A33 B;  1DOX A;  3MHS D;  1WZ0 A;  2WU5 B;  1NEK B;  2KAN A;  2I2Y A;  3AXC A;  3ZUN A;  1UWX A;  3CWI A;  3SFD B;  4RM9 A;  4W9K A;  3NJT A;  3KUC B;  2WDV B;  3KVF B;  4HPM B;  2GBN A;  4W9G A;  1E8Y A;  4E3C A;  2JZP A;  2L32 A;  4LDT D;  3Q8F A;  1Z2M A;  2JSV X;  2M1M A;  4KVG B;  3MJW A;  5DPT A;  3MJ5 A;  4PT5 A;  2RGF A;  2JX5 A;  4KDI C;  2Y5C A;  1CMX B;  2BKR B;  4EZJ A;  2KDI A;  1OEY J;  1V5O A;  1TY2 A;  2KYW A;  1JWA D;  3LDZ E;  1R4N I;  1QF6 A;  2WNM A;  2KO3 A;  3QK0 A;  1UF0 A;  1JRU A;  4K1R B;  5HHD G;  2WXM A;  2V9H A;  1TKY A;  1J7A A;  1GB4 A;  4RF1 A;  1VZ7 A;  1JCK B;  1HTQ A;  2V3N A;  3Q3J A;  4WUR A;  4NNJ B;  1WXV A;  2N9K A;  3QHT A;  2O2V B;  2FCM A;  3TEZ A;  1L4D B;  2C7N B;  1MI0 A;  1ZKH A;  3BY4 B;  2UWQ A;  1NBF C;  1F9J A;  4PS8 A;  3PLU A;  1FCC C;  3Q8E A;  1PGB A;  5KHQ A;  2LHE A;  3VTV A;  2KHW B;  4AJW A;  3HVD A;  4LNI A;  1SE4 A;  3GOE A;  3X23 A;  4AOF A;  1UH6 A;  1T6B X;  2PJH A;  1EUV B;  1F1H A;  3JYU A;  1MPE A;  5DCN A;  1Q0W B;  1AW7 A;  1IGC A;  1D5M C;  4NAM A;  3ZJT A;  4KKI A;  2KN5 A;  3WA0 A;  5GMV A;  4HJG E;  5G55 A;  4EE2 A;  5IN7 A;  2KKC A;  4F8C B;  1E10 A;  3L16 A;  2MBQ A;  1IBX B;  3VXW A;  2WWZ A;  1YMH E;  2I1K A;  2J0M A;  4UDU C;  3PTF C;  3AE2 B;  3R66 C;  1YN5 A;  3SD5 A;  3OAW A;  2JY6 A;  3NZ3 A;  2WX1 A;  3U4E G;  4IKG A;  5MPO A;  4MSQ B;  2XEW A;  2D5G A;  4NJC A;  1U4A A;  1IPG A;  3AE3 B;  1ZGU B;  4DHJ B;  3W2D A;  1DOI A;  1WX8 A;  1WRD B;  2ZVN A;  3R3M A;  4P7I A;  2D3B A;  4HLE A;  5I4D A;  2DLB A;  1RWS A;  2IGD A;  2ZVO A;  1N5X A;  4RF0 A;  2DZI A;  2ONQ A;  2NTS A;  3EC8 A;  4C56 C;  1E0Z A;  1C1Y B;  1KFY B;  4ZRI A;  2FE8 A;  2ASQ A;  2DEN B;  1D3Z A;  3V62 A;  3JSV A;  2MLB A;  1P7F A;  2WXL A;  1VZ8 A;  1WGH A;  1XXG A;  1H4R A;  2K22 A;  3Q8C A;  4GDK B;  3A9K B;  2CU3 A;  4IWP A;  5BYS A;  3QJZ A;  4LJO B;  3UIO B;  2DZM A;  4EZL A;  3N9Y C;  4KIK A;  4HKQ A;  3ZNZ B;  3WIM A;  4MGZ E;  1QLB B;  3KW5 B;  3DBH B;  5EE1 A;  5BMG A;  3URY A;  3HIZ A;  1FRD A;  1VJK A;  3MC8 A;  1KOT A;  2E6X A;  3RNA C;  1ZXH A;  2ZNV B;  2BS4 B;  4J3O D;  4TMA B;  3PHX B;  3EEC A;  3UGB B;  3ZVV A;  1WRI A;  5J18 A;  1M4V A;  3EFU A;  4I6L B;  1C9F A;  3U7Z A;  1FMA D;  1D6E C;  5LLI A;  1YN4 A;  2MJD A;  1LGR A;  1UUP A;  4M8N A;  2L1A A;  3EFC A;  4C4V B;  1WY8 A;  1HQR D;  3GZN B;  2CR5 A;  3P4R B;  2D3C A;  2K8B A;  3GP7 A;  4KKJ A;  2KD0 A;  2WXQ A;  4PS3 A;  1YQ3 B;  5D3D A;  3V61 A;  3EA6 A;  4LLG M;  1WGK A;  2G9H D;  3I63 C;  1LQB A;  1GNU A;  2LWP A;  1SE3 A;  2D3G A;  5L83 A;  2AQ3 B;  3BWU D;  2WDT B;  2KOX A;  3DBH I;  1FNV A;  2KDF B;  2KC2 A;  2JYT A;  1Q10 A;  3U8Z A;  5JH5 C;  1DYQ A;  3H8H A;  3CST A;  4XWW A;  2BYE A;  3VUX A;  3QC8 B;  2WX0 A;  4DXF A;  3NUH B;  3ALB A;  1PFD A;  2LXA A;  2V4I B;  2GBJ A;  2BWE S;  2L83 A;  3AEE B;  2PMV A;  3TEX A;  2DAJ A;  2G3Q B;  3IAM 1;  2KTR B;  2PIA A;  2K6Q A;  3T8M A;  3DQV A;  3RNB C;  1SIF A;  1VRA B;  2RD0 A;  1ZXI A;  2D10 A;  1KLV A;  5EE0 A;  2LVQ A;  5AUI A;  1E6E B;  3P63 A;  5LXI B;  1C3T A;  4GGQ A;  1GAQ B;  5D94 A;  1TS3 A;  2BYT A;  3WAO A;  2K9X A;  3QX1 A;  2LGS A;  3GZN I;  4JQW C;  3IBE A;  1XLQ A;  2FCQ A;  3BVG A;  3RMK C;  2BB5 A;  4WJQ A;  2SEB D;  2N9P C;  5E6N A;  5BYR A;  3AUL A;  2K3U A;  4BKT A;  2O6V D;  1XO3 A;  4JX1 C;  1E8X A;  1SSN A;  4HCN B;  3RUI B;  4II2 B;  3DVG X;  5KHO A;  3A1Q B;  3AEB B;  2AEH A;  1SE9 A;  3DHG C;  3WAP A;  4B0E A;  1Q1O A;  1GPX A;  2KAJ A;  4DXG A;  3KWL A;  4PS7 A;  2NCN A;  2LVP A;  3PZ8 A;  1VLB A;  2C60 A;  4EKU A;  2O2V A;  1SIJ A;  4XDD A;  2D3A A;  4FXC A;  1EF5 A;  2QJL A;  2KJ6 A;  4X57 B;  1XQQ A;  1NYQ A;  1TGZ B;  2QIE B;  1KRH A;  1TKG A;  3BK2 A;  4M00 A;  3VH3 B;  5AEK B;  2OOB B;  3H7P B;  2MW5 A;  1V86 A;  1LM8 B;  2GOW A;  2PVO D;  1YQ4 B;  3LYY A;  4I6N B;  2JWZ A;  4FAD A;  3A9J B;  4MSM B;  2CHX A;  3L0W B;  4KV2 A;  4RGM A;  3ZLZ A;  1IGD A;  4JIO U;  3V6C B;  2M0A A;  4WJP A;  4L1B A;  3TEY A;  4A55 A;  1P98 A;  3AE9 B;  1IBX A;  2KZR A;  2B76 B;  4YL8 A;  3SEB A;  2LGD A;  3R7R A;  1T3Q A;  5IO9 A;  1T0Q C;  4JLC A;  4WWN A;  4L2Y A;  5G2N A;  2K39 A;  5JXV A;  3TSS A;  3AU4 A;  3RNF C;  4EZK A;  3ZXV A;  1CK1 A;  3DBR B;  4YTM B;  4TUU A;  3U2S C;  1GC6 A;  4K3B A;  4F7Z A;  2JQR B;  3UF8 A;  4LDT B;  1CZP A;  2N9X A;  3FKY A;  4IWO A;  1R4M B;  4CYE A;  1PYW D;  3OJ4 B;  2KVR A;  2MWS B;  1V81 A;  1WZ3 A;  2C7M B;  2HJ8 A;  4E71 A;  4W9D A;  1F2R I;  4DXA B;  3NVV A;  3K9O B;  4A3O A;  3E9S A;  3RD2 A;  2CS4 A;  2FCS A;  2K0P A;  4PYZ A;  1V9J A;  4HPP A;  4WJO A;  3AE6 B;  4A6Q A;  4K7U A;  1C78 A;  4WH4 A;  4LCD E;  4PK1 A;  3CSF A;  4RM8 A;  1UBQ A;  4MGY E;  2DNF A;  3A9K A;  3HM3 A;  4GDK A;  4IM2 A;  2FCN A;  4BOS C; 
#chains in the Genus database with same CATH homology
 3VTV A;  3DOW A;  2KHW B;  4AJW A;  4IM3 A;  2HTH A;  1Q5W B;  5C23 A;  3S2A A;  2FNJ B;  1QZE A;  4ANU A;  3RCZ A;  2C5L C;  3L17 A;  3ZDM C;  1ZW7 A;  3GOE A;  2KJR A;  1UGM A;  4HWI B;  4NAW A;  4W9C A;  3X23 A;  4AOF A;  1UH6 A;  2MRP A;  2WYQ A;  2PJH A;  1EUV B;  4KSK C;  4OVU A;  1GG3 A;  3ZW3 A;  2L3Z A;  3JYU A;  3L08 A;  2UYZ B;  2CU1 A;  4FBJ B;  5DCN A;  1Q0W B;  4HDQ A;  1EF1 A;  4BBN C;  3V6E B;  2BGF A;  3L54 A;  4FUL A;  2Z0E B;  4ICV A;  3HHM A;  1I35 A;  2KN5 A;  4GMV A;  3WA0 A;  5GMV A;  2K6D B;  2IBI B;  3ZRC A;  4DHJ D;  5G55 A;  3VFK A;  2LGX A;  3KYD D;  1WX7 A;  4RMA A;  3NS8 A;  3BIN A;  2KKC A;  5CX3 A;  2NS5 A;  4F8C B;  4K7W A;  4BBN F;  3L16 A;  2IYD B;  2MBQ A;  2CKH B;  2NR2 A;  3VXW A;  2WWZ A;  2I1K A;  2K1F A;  2J0M A;  1AAR A;  2FAZ A;  3PTF C;  2MX2 A;  4GU2 A;  3KH0 A;  3PHW B;  3R66 C;  2XK5 B;  3DVG Y;  3QCA A;  3SD5 A;  1BT0 A;  2L8J A;  2M8S A;  3APC A;  3PT2 B;  4KSL C;  3VVW B;  3OAW A;  2JY6 A;  4FHJ A;  3UIP B;  2LZ6 A;  4M0W B;  3RT3 B;  2WX1 A;  3W1S A;  1V2Y A;  1J8C A;  1J0G A;  2LI5 A;  1L7Y A;  3H6N A;  2HE7 A;  2Y5B B;  3HK0 A;  2D11 A;  4II3 B;  4MSQ B;  4G0N B;  2XEW A;  3R7Q A;  1U4A A;  1T0Y A;  4I6P A;  2ZCB A;  1OQY A;  2MA9 B;  1IPG A;  1YD8 U;  3IVF A;  4NPN A;  5DPR A;  1ZGU B;  3M3J A;  3EHV A;  4W9E A;  4B9K A;  4DHJ B;  3IHP C;  3N3K B;  3RZW C;  2LAS A;  2NBU A;  2J0J A;  3DVN U;  4W9J A;  2KX0 A;  2ZJD A;  1WGR A;  1WX8 A;  2DAF A;  2MBE A;  4K81 A;  1WRD B;  3TL5 A;  2ZVN A;  2AWT A;  2VRR B;  4CHK A;  3PRE A;  3R3M A;  2JRH A;  5D7G A;  1GJZ A;  4P7I A;  4DDI D;  4HLE A;  1RAX A;  4IWQ A;  2AL6 A;  3B0A A;  3D32 A;  2ZVO A;  4W9L A;  2RSU A;  4ANX A;  2KQS A;  2DZI A;  2NPT B;  2KWU B;  2KXJ A;  1UEL A;  2DYB A;  3C0R B;  2N1V A;  3B08 A;  3EC8 A;  2BYV E;  1WFY A;  2PE6 B;  2KMC A;  3PRZ A;  4M8M A;  5AZF A;  3ZNI D;  1S1Q B;  1C1Y B;  4BKS A;  3IG3 A;  4ZRI A;  2MP2 A;  2MQJ A;  2N1W A;  4MEM A;  3N32 A;  4NY0 A;  2ASQ A;  2DEN B;  1D3Z A;  3V62 A;  3VUY A;  3LJ3 A;  4MJS B;  1WJN A;  2NVU I;  2KQ7 A;  3JSV A;  2MLB A;  4BKG A;  1WGY A;  2NBV B;  3H9D A;  4EUT A;  2V4L A;  4B6W A;  1WGH A;  2M4N A;  2JRI B;  3U7D A;  2ZCC A;  5EDS A;  4MEL A;  4NJ6 A;  1WGG A;  4GN1 A;  1H4R A;  4MH0 E;  4GDK B;  2REX A;  3A9K B;  4IWP A;  1G6J A;  2M0X A;  3QJZ A;  4LJO B;  3UIO B;  3WAN A;  3RYT A;  4AUQ C;  3U30 A;  2DZM A;  2LJ5 A;  4EZL A;  3SHQ A;  1WE6 A;  2JT4 B;  4KIK A;  2IY0 B;  3ZNH B;  3ZNZ B;  3PVL A;  2JXX A;  3WIM A;  4MGZ E;  4AP4 C;  3KW5 B;  4NAW B;  2KFJ A;  2JUO A;  4EEW A;  4LJP B;  2DZK A;  4B95 A;  3HIZ A;  2D2Q A;  1V80 A;  2D07 B;  2GBK A;  3NHE B;  4IC7 B;  1FXT B;  3M63 B;  3IFW B;  1UBI A;  1KOT A;  5CTR C;  3QQ8 B;  2YLM A;  3W1Y A;  1YIW A;  1UD7 A;  3VAW A;  2K25 A;  2ZNV B;  3PHX B;  3ZDT A;  4GXB A;  3EEC A;  4XC2 A;  1E8Z A;  1LXD A;  3OLM D;  3UGB B;  3SDL C;  3ZVV A;  2KWV B;  3MTN B;  4GOC A;  3EFU A;  5J18 A;  4I6L B;  2JZ3 B;  4A3P A;  2KX3 A;  1IYF A;  5C1Z A;  3V60 A;  1S3S G;  5JZE B;  2J0K A;  2IO2 B;  4ZRJ A;  2MBO A;  5LLI A;  1E7U A;  1WH3 A;  2YVC A;  3A1Q A;  3AI5 A;  3DBR I;  1V6E A;  1WMH A;  2LRW A;  1YX5 B;  5LXH A;  4M8N A;  5CHV C;  2L05 A;  4W9H A;  3N30 A;  3PSE B;  4F1S A;  1WR6 E;  1EO6 A;  1WI0 A;  1WY8 A;  3P2B A;  4ANV A;  1GUA B;  1NI2 A;  2G4D B;  2CR5 A;  2EMS A;  3K9P B;  4BKS D;  1YQB A;  3QAR A;  1R4M I;  2K8B A;  3ECI A;  2ZNV C;  3DCG A;  3ZTC A;  5JHB A;  3ENE A;  3PPA A;  4G50 A;  4G11 A;  4ZDV A;  2KD0 A;  2LVO A;  2C7H A;  4PS3 A;  2EMT A;  2IY1 B;  4GSW A;  2ZPN A;  3V61 A;  2BYF A;  2FID A;  4W9I A;  4KZ0 A;  3ZNG C;  4A20 A;  4DHZ E;  2O6V A;  1TTN A;  5TR5 A;  4ICU A;  4KZC A;  1ISN A;  5IAA C;  2L0F A;  2RPQ A;  3QA8 A;  3JW0 X;  1L2N A;  1X1M A;  1XD3 B;  1LQB A;  2MBB B;  3JVZ X;  1WXS A;  4ZRK A;  1GNU A;  2LWP A;  4ASW C;  2NBW B;  2D3G A;  5L83 A;  3VUW A;  1E7V A;  1OEY A;  2V1Y A;  5DPS A;  4WJN A;  5IA7 A;  2WDT B;  3A9J A;  2KOX A;  5FR6 A;  3DBH I;  2KDF B;  2XBB C;  2KC2 A;  3TCA A;  3NZS A;  2L7R A;  1H8C A;  3W1S C;  2FIF A;  3U8Z A;  3UIN B;  5JH5 C;  2N7D A;  3CST A;  3APD A;  3QIJ A;  2BYE A;  4FJY A;  2AL3 A;  2MP2 B;  4GIV A;  3M95 A;  3VHT C;  2L76 A;  3QC8 B;  3VUX A;  3A4S C;  2WX0 A;  4CO7 A;  3ZO5 B;  2KTF A;  1RLF A;  2JPH A;  3TBL D;  1WXA A;  2KDE B;  1OGW A;  3JSV B;  2LXA A;  3ALB A;  2KWC A;  4JL9 A;  2GBJ A;  2BWE S;  3DBS A;  4WWO A;  2DZJ A;  2IO0 B;  4J6I A;  2AYO B;  3KUD B;  2DAJ A;  2G3Q B;  2KMA A;  4BVU C;  2KTR B;  3KYC D;  4IW0 A;  3O65 B;  1WF9 A;  2K6Q A;  2PE9 A;  1MG8 A;  3PZD A;  3DQV A;  4HDO A;  4XZ4 A;  3T8M A;  1RFA A;  1SIF A;  2RD0 A;  4MGK E;  5HKH A;  4OVV A;  4HCP B;  4AWJ A;  2D10 A;  1KLV A;  3UQA A;  2J7Q B;  4KIK B;  2LVQ A;  1C3T A;  3DVN V;  5LXI B;  4MGI E;  2GMI C;  4GGQ A;  4JGH B;  5DPW A;  5D94 A;  3DBL I;  2GBM A;  3WAO A;  3QX1 A;  2KTR A;  1HE8 A;  3DDC B;  3VTU A;  3GZN I;  4JQW C;  2IZV B;  3IBE A;  4FJZ A;  1TBE A;  2JF5 A;  4NQL B;  2CHW A;  2R2O A;  1XT9 B;  2FCQ A;  5L95 C;  2A5U A;  2ZEQ A;  2DYO A;  3B1L X;  3ZTD A;  3H7S A;  4WJQ A;  2N9P C;  5E6N A;  2G45 B;  1WM2 A;  2BKF A;  3Q3F A;  4TV3 A;  3H1U A;  1J19 A;  4TQ1 A;  2Z59 B;  2W9N A;  3L13 A;  2L0T A;  1E8W A;  3T9L A;  1V49 A;  2JVC A;  3AUL A;  3I3T B;  3PGE A;  2FUH B;  2K8H A;  1P1A A;  1P3Q U;  2C9W B;  2HD5 B;  2O6V D;  4BKT A;  5JHA A;  3RUL A;  2B3A A;  2N4F A;  3ONS A;  1RRB A;  3OJ3 A;  1E8X A;  3PRP B;  4HXD A;  1OTR B;  4HCN B;  3RUI B;  1Z5S B;  4II2 B;  4DHZ B;  3DVG X;  5KHO A;  3A1Q B;  3WAM A;  4TKN A;  4NJ7 A;  1NDD A;  2AEH A;  1SE9 A;  2LD9 A;  4HJK A;  2ZPY A;  3WAP A;  1WMH B;  5J17 A;  2DYM A;  1Q1O A;  1I42 A;  3CF6 E;  3ML9 A;  4WAA A;  3TIX A;  3UQB A;  4W9F A;  2LUE A;  2KNB A;  4EOY A;  4BOZ B;  3HM6 X;  1E90 A;  4PS7 A;  2LRU A;  2RR9 A;  5E6P A;  2NCN A;  4E74 A;  2LVP A;  3A4R A;  1WXM A;  2BPS A;  2C60 A;  2IO1 B;  4GDL A;  2KFK A;  3PV1 A;  2O2V A;  2MSE D;  4EKU A;  4TQ0 A;  1UZX B;  3ML8 A;  1YX6 B;  4MDK E;  1EF5 A;  5J2R A;  2KC1 A;  2MBH A;  1WJ6 A;  2KJ6 A;  1P9D U;  4X57 B;  1XQQ A;  4HPL B;  1TGZ B;  3WAL A;  1TZ1 A;  2KK8 A;  4FA6 A;  4FLH A;  2O6V B;  2GBR A;  2V3S A;  1WJ4 A;  5AZH A;  4IG7 B;  2LXC A;  5CHW A;  3VH3 B;  1A5R A;  4KDL B;  5AEK B;  2Z0D B;  2OOB B;  3H7P B;  4HK2 A;  4K7S A;  2MW5 A;  3CMM B;  2GOW A;  1V86 A;  1LM8 B;  3APF A;  4IUM B;  2QHO A;  2KDB A;  1WIA A;  2I1J A;  3A33 B;  4I6N B;  2MCN B;  3MHS D;  2JWZ A;  4FAD A;  1WZ0 A;  3A9J B;  4MSM B;  2CHX A;  2KAN A;  2G4S A;  2L00 B;  1WR1 A;  3L0W B;  3L10 B;  4KV2 A;  3ZLZ A;  4BFR A;  3VH4 B;  3AXC A;  4DWF A;  2K8C A;  3H7P A;  3ZUN A;  3VQI A;  3PS6 A;  2DX5 B;  2BWF A;  4JIO U;  4RM9 A;  4W9K A;  3V6C B;  3KUC B;  4ZYN A;  3KVF B;  5D2M B;  2R2Q A;  1WX9 A;  2LGY A;  1VD2 A;  4WJP A;  4HPM B;  2GBN A;  4W9G A;  2PPH A;  1E8Y A;  4WQO B;  5E6O A;  1WYW B;  2EKE C;  5AZG A;  1WGD A;  1Y8R C;  2PEA A;  3TMP B;  4ANW A;  1P98 A;  4E3C A;  1LFD A;  3NZU A;  3ZKJ C;  4LDT D;  3NOB A;  4FJV B;  1KJT A;  2JZZ A;  2KZR A;  4DBG A;  1GC7 A;  2BF8 B;  4FN2 A;  1Z2M A;  2M1M A;  1PQS A;  4KVG B;  2OJR A;  4YL8 A;  2XK5 A;  3MJW A;  2LGD A;  5DPT A;  4PYU A;  3R7R A;  2KJH B;  3PLV A;  2RGF A;  5D6J B;  3M62 B;  1YJ1 A;  2CHZ A;  4JLC A;  4KDI C;  4NQK E;  4WWN A;  3ZRF A;  4HVB A;  2M17 A;  5G2N A;  3TJP A;  2K39 A;  3AU4 A;  2N9E B;  4EZK A;  1CMX B;  2BKR B;  4G3X B;  4EZJ A;  2KDI A;  3VTW A;  4WWP A;  1OEY J;  1V5O A;  3LDZ E;  1WM3 A;  1R4N I;  4TUU A;  1K8R B;  2KO3 A;  1GC6 A;  4F7Z A;  3QAQ A;  3QK0 A;  3UF8 A;  4LDT B;  2N9X A;  3AU5 A;  1WE7 A;  4N9F 4;  1JRU A;  4IWO A;  4K1R B;  2N7E A;  1P0R A;  3X0W A;  4CYE A;  4XX5 A;  3OJ4 B;  1E5W A;  4IM0 A;  2KVR A;  2KLC A;  2MWS B;  2NPT A;  3QWZ B;  1V81 A;  1V5T A;  1WZ3 A;  2C7M B;  2HJ8 A;  2IO3 B;  4E71 A;  4W9D A;  3VDZ A;  4DXA B;  3Q3J A;  1VCB A;  4NNJ B;  1WJU A;  3K9O B;  1WXV A;  2A4Z A;  4A3O A;  3NY5 A;  4GB9 A;  3SU8 X;  3RZF A;  3PRM B;  2ZZP B;  1SGH A;  3RD2 A;  2CS4 A;  5CHF A;  4MJS A;  2DHZ A;  4DDG D;  2FCS A;  3QHT A;  4GDL B;  2KFK B;  4URK A;  2O2V B;  2FCM A;  4FHK A;  4PYZ A;  1V9J A;  2C7N B;  3KUZ A;  4WJO A;  4AJY B;  4EFO A;  1M94 A;  1ZKH A;  2KLG A;  3BY4 B;  2UWQ A;  3DPD A;  4K7U A;  4MM3 A;  1NBF C;  1F9J A;  1KM7 A;  1IP9 A;  4LCD E;  3ZIM A;  3CSF A;  5BO4 B;  4PS8 A;  1UBQ A;  4RM8 A;  3PLU A;  4DK5 A;  4MGY E;  4GDK A;  3A9K A;  3HM3 A;  5KHQ A;  4IM2 A;  2FCN A;  4BOS C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...