1V1PA

The structure ssl from staphylococcus aureus from an orthorhombic crystal form
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
191
structure length
191
Chain Sequence
HLHDIRDLHRYYSSESFEYSNVSGKVENYNGSNVVRFNPQNHQLFLLGKDKEQYKEGLQGQNVFVVQELIDPNGRLSTVGGVTKKNNKTSETNTPLFVNKVNGEDLDASIDSFLIQKEEISLKELDFKIRQQLVNNYGLYKGTSKYGKIIINLKDENKVEIDLGDKLQFERMGDVLNSKDIRGISVTINQI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Relationships and Cellular Tropism of Staphylococcal Superantigen-Like Proteins
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Virulence factor
molecule keywords EXOTOXIN 1
total genus 49
structure length 191
sequence length 191
ec nomenclature
pdb deposition date 2004-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
A PF09199 SSL_OB Staphylococcal superantigen-like OB-fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1v1pA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1v1pA01
1PTOC 1PTOD 3BVZA 3DWQA 1AW7A 1BXTA 1I4PA 5TSSA 1JQYD 1SXTA 5FKAC 1G8ZD 1I4HA 1AN8A 1PZID 3OWEB 1MD2D 4ZYSA 1EU3A 1PRTD 1TS3A 3BYTB 1LT5D 3DWPA 4L6TB 1YN5A 1YN3A 1LTRD 1FNWA 1QILA 1JWUD 3KLSX 5FK9C 1KLGD 2NTSA 3BYYB 1FD7D 1JWMD 3DWAA 1M4VA 4RGNA 1SJED 4RHSA 1PZKD 1HTLD 5ELEA 1ET9A 1I4GA 1D6EC 1S5ED 1L0YB 3BVGA 1RDPD 1KTKA 4RCOA 1PZJD 1S5FD 2RDHA 2XNAC 1I4QA 2AQ1B 1L0XB 1CHPD 5ELFA 1PTOF 2AQ2B 1BCPD 3GP7A 1BCPF 1LTGD 1HXYD 1V1OA 2AQ3B 1D5ZC 3R2TA 5ELBA 2G9HD 3TSSA 1S5BD 3V05A 2CHBD 1UUPA 1S5DD 1LTTD 1I4XA 2R61A 4OHJA 3CHBD 3SEBA 1LTID 1SJHD 2XRSD 1TY0A 1DYQA 4RGTA 2WV6D 1KLUD 1ET6A 1RF2D 2TSSA 1JWSD 1BCPB 3O13A 1S5CD 1F77A 1PYWD 5D3DA 1LLRD 1CQVA 1FNUA 1SEBD 2Z8LA 3BZDB 1XTCD 1LTAD 4L63B 3URYA 1HQRD 1CHQD 1SE2A 1CK1A 2O2LD 1LT4D 2ICIA 1BCPC 1V1PB 1PTOH 1PTOB 3BVMA 4RFBA 1PRTC 1HA5A 1GOZA 4TSSA 1B1ZA 1RD9D 2XN9C 3MFGA 1EEID 4RHRA 1D5XC 1ESFA 2J4XA 3EFXD 4C56C 4DXFA 1EU4A 2IPKD 5I4DA 4O1NA 4UDUC 1TS4A 1CT1D 3MC0B 4BWGB 4RGMA 1PRTF 1EWCA 1RCVD 1D5MC 1LO5D 1JR0D 1I4RA 1LT3D 1ENFA 4K6LA 1LTBD 3R2IA 2IJ0A 1V1PA 1DJRD 1EFID 2NTTA 5ELDA 3EA6A 1SE4A 2QEJC 4RGOS 1SBBB 1JCKB 5D3IB 2QILA 5ELCA 1FNVA 4Z9CB 2SEBD 4DXGA 3W2DA 1STEA 3R8BA 4RH6A 1T5XD 1LTSD 1UNSA 1EEFD 1B44D 4NZLB 1TS2A 1TY2A 2RDGA 1FGBD 1PRTB 1SE3A 1LT6D 1XXGA 1TS5A 2XRQD 1YN4A
chains in the Genus database with same CATH superfamily
4XDXA 4AJYB 4H13C 4LF7L 1JOKA 1Q8IA 3DWQA 1JWBD 1Q0WB 3I90A 2KJRA 3BG3A 4A3BG 5A2QE 3HOYH 1TWAB 1RYJA 1KF6B 2J0TD 3TZUA 3ZRCA 1K8OA 2HE7A 1IBLL 3PUZA 3PV0A 3A55A 2B63G 1L1OA 3HOZH 1C9OA 5I6YA 3LDZE 1OXVA 4DV0Q 1UBQA 4HK2A 1ICWA 3S1MH 3T3NA 4A3BH 3OLMD 2WDQB 3DVNU 1VQDA 1NVID 1YNXA 5HKHA 3QWZB 1XT9B 1JOOA 2JA5H 4GN3B 1SSNA 3GTQH 2NVUI 3Q3OC 2NN6G 2E76C 3BYYB 2J0JA 3W1GA 3KYCD 3WCQA 3NWTA 4W9KA 2LRUA 4A3JB 3ZUNA 2EYHA 3R66C 2MBBB 1NE3A 1ET9A 1N33Q 2NBWB 4GB9A 4ICUA 2KUMA 3G6EA 2NVXH 3PCOB 3GTMH 4WORA 2KHSA 3WOFA 3PMFA 5BMIA 1WFYA 4R8NA 4X57B 2KHWB 1BCPD 1MG8A 1BCPF 3K6OA 3R2TA 2BS3B 2MBEA 3HRDD 1YJNA 5GADC 3OMCA 1S5BD 2MH7A 3V3XA 3L0WB 1ZYRC 1XD3B 1KLVA 3QJZA 3F2CA 4HN7A 3CC7A 3GOEA 1X54A 3P20A 4OHJA 2G9DA 4A3MG 3GTKB 1L0WA 1E8YA 1JROA 4DR3L 1B4OA 1FIQA 1PGAA 3D31A 2B76B 1F9PA 2LGIA 4KD3A 2M0AA 2WXQA 1LYLA 5J3BA 1XPUA 4HJ8A 2QDBA 5L95C 2R7ZG 4FJZA 2F4IA 2AHOB 2FHTA 3HGBA 3K0XA 1Z5SB 1WR6E 2CQOA 4IG7B 2D9UA 1K0SA 1EL0A 1P7EA 2GBMA 4AWJA 4USAA 4PZ6A 3TUOA 1NBWA 1UZXB 4R3DA 4NB3A 1QOGA 1CA5A 4BBRH 1HA5A 4PYZA 4JPBW 3T1HQ 3MXNA 3S1NB 2JPHA 4R4TA 3GV6A 2WXFA 3SU8X 4YXDB 2L7RA 1K3BC 2A69C 1U9RA 5IP9H 3KOJA 1CT1D 1PRTF 3TS0A 4XC2A 1Q8KA 1B3QA 4GDKA 1YOVB 3J80c 1ENFA 1M94A 4YSXB 2X69A 4X62L 4LF9L 2A68C 1JCKB 2QKIC 1DD2A 4H44C 3M62B 2EE1A 5J39A 1PDQA 4XDCA 1NI3A 2ASQA 4GOPC 1C8CA 2EZVA 4DR6Q 1UNSA 3K57A 3LJ3A 4GSWA 1GVPA 1PRTB 3NTIA 4V190 2IT1A 1GAQB 5NUCA 2KCMA 2RKSA 1CSPA 3AYHB 4F87A 3OG5A 4BKGA 4D2KA 1Z7TA 3MXNB 5EPKA 4MTKA 1Y1VH 4LF4Q 2IDYA 4KDLB 2M0XA 1A2UA 2LXKA 2KA7A 1WTVA 1II3A 3CXCA 3CCEA 1AFPA 3HOWG 3U52E 4OX9L 1VQPA 2K03A 3IAYA 2R93G 1S3OA 1ISNA 1Y1WH 3Q0AA 1PZID 1C76A 3P4SB 4ANXA 2P5ZX 4ZAIA 1Y1VG 3C3LA 5M5WB 4C80A 3TJPA 1SNPA 4XE0A 3H7SA 3OHXC 1PH3A 2CH4W 1SFOB 2F03A 1XNQQ 1IUEA 2FIFA 1PGBA 4A76A 2IGGA 2MWSB 2PTLA 5BO4B 1IBLQ 1MKHA 3IG3A 4LNQA 1B3AA 2RR9A 3F2BA 4G50A 1XCTL 4EUTA 3NTHA 2W3RA 1PFMA 1V80A 1SJED 4HROA 4L2YA 1XQQA 2QF7A 4A3DH 1WX9A 2Z0SA 3QB3A 2IBIB 2WXOA 3A7AB 5IGCA 5JAVA 1TWHB 1YVCA 1LM8B 3GQBA 3H8HA 3VTVA 3H0GG 4DR7Q 2UYZB 1DGSA 3VRAB 2WINB 3NUCA 3U4ZA 1WR1A 3PTFC 2A6ED 2JWUA 5JJKA 5G5HA 4BA2I 5ELFA 3NP8A 4B08A 4LNNA 5BMGA 3W1SA 1WM2A 5C3EB 3D4DA 1V43A 1ASYA 3PGEA 1HXYD 1MGSA 2PYKA 2SNMA 4EZJA 1P3QU 1EY4A 1WFQA 2K1FA 4HPMB 4ZUIA 1KAAA 2JA8H 4KKJA 4LJOB 4DPGA 1V81A 4ZRIA 4IUPA 1VQ9A 4NMZA 5KEEA 4C00A 2EJMA 2AUKA 5LL6X 2WXJA 2RGFA 2EDGA 4M1UB 1EY8A 1W2BA 1BUIC 2D11A 2L05A 3ECIA 1D3ZA 4PNYA 2J0KA 3GD7A 1JWSD 4K7UA 3O13A 4WIPA 1F77A 5D14A 4DR2Q 5CV5A 4G0NB 2Z8LA 4XT3B 2R7ZB 1XTCD 3K8AA 2G4DB 5GQOA 2EYLA 2ZXOA 4R4OA 4TV3A 3K5NA 3Q6BA 3S16H 1W3SA 3NVYA 1SMXA 2KWCA 3ABVB 3FDTA 1PFSA 4C1NI 3KQ4A 2ENBA 1O78A 4QB4A 4RA8A 2F4VQ 1T5EA 3B0AA 1EF5A 1PH1A 2PPBC 3TEHB 5LXIB 1P0RA 4U673 2PI2A 1LM0A 3L4PA 1WYWB 5I4DA 4B3MQ 1IBXA 2PW9A 4LDTB 3G48A 1HNZQ 1ZEQX 4JI2L 3M85A 3CIRB 4WFN3 5GMVA 4HJGE 3NZSA 3NZ3A 3RNGC 1KABA 2MJDA 3FRPB 4JWUC 4JI3L 1UE1A 2FXQA 2SEBD 3HOVG 4DXGA 3S1QB 3DCGA 3EHVA 2F0SA 2E2IH 4APVA 3H3VC 4UAIA 2KDFB 4ME5A 2PEAA 4EVOA 2QDFA 2B39A 1WGKA 4HDOA 2JXTA 4DAVA 3P75A 1MSGA 3S2DH 5EPJA 3KJOA 4YL8A 3AXCA 3BY4B 3I7FA 1I6HH 4XQNA 1ZKHA 3ND9A 2JXMB 5C6AA 1EF1A 2OF1A 1KAWA 5M5XH 5LMNW 1C1YB 2DX5B 2PVOD 2HHHL 2ACZB 4P75A 5DPSA 3HP3A 1WD0A 1SXTA 4WJPA 4LLGM 4AQ7A 5EQ0A 1EUJA 3HOWH 5HFYA 1WGHA 1WVLA 2IZVB 1MJCA 1UAPA 2MGSA 3I8ZA 2DZIA 1I5FA 3U30A 4C3JG 4NPNA 4MNOA 1AWDA 4BZAA 4YTMB 1KXLA 5IYCG 1LABA 5FJ8H 1KC8C 4W9LA 3M63B 4KK7A 2R6GA 1C4AA 3RT3B 3CPWA 2NTSA 2BB6A 3ZNHB 3CSTA 2EIFA 3ML8A 1WZ0A 1V97A 2JVCA 2KMMA 2R7DA 3AE2B 4AIMA 1TGZB 1N8RC 1KH0A 1C3TA 4FJVB 4JOIC 2DZMA 5LLIA 3AEAB 3FKIG 1KTKA 4DF7A 3WAPA 5BN4A 1VQHA 3Q3JA 4URKA 4W9GA 3IAS1 4NXNQ 4J15A 1I50B 3J7A5 4IM2A 3QOJA 1HNWQ 3TBLD 1SMYC 1SYEA 1YJ9A 1NBFC 2RDBC 3W1SC 3SFEB 3GP7A 5IOIA 3TQYA 2JF5A 3MVVA 5ELBA 4LMQD 1FEHA 3ULJA 4C2MH 1GC7A 4GNXB 1VQMA 2DLBA 1OO9B 1S3SG 3MXGA 2LHEA 2MJ8A 5E6OA 2F1MA 5GAGC 2K8BA 2L83A 1H9KA 4R9WA 4YWLA 4EQNA 3RN5A 4PMWA 4OL7A 4DR2L 1KDCA 2NVQH 4IUQA 2L4NA 4IZ8A 3ZNZB 3VR8B 3NY5A 3DVGX 2QGQA 5BN5A 3I56A 4GGQA 3U7DA 2VL6A 5IWAQ 3GZNB 3Q2AC 5KIXA 5DPRA 2JX5A 4X3KA 2M4NA 2WDTB 5BR8Q 3FVQA 1YQ3B 1IXRA 2OWOA 1YX6B 1A62A 1T9HA 2AYOB 4UP8A 3E9HA 3O65B 1Z2MA 1J9OA 1HQRD 4BKSD 3HOXH 3NZUA 2NPTA 4FYDA 4CDFC 4YWGG 2ZXPA 2PW5A 1KFYB 1VQ4A 2WKCA 2L3ZA 5IODA 3OTOL 1PRTC 3S24A 4JI5Q 1WGRA 2LVOA 1YJWA 3ZJYC 3PF4A 4ZYNA 2MX2A 4GIVA 1J5EL 3DBHB 4OIJA 3A9JA 3U8ZA 1EWYC 1EY9A 1RTNA 2BA1A 3MP9A 4O1NA 1TS4A 1C9FA 3MC0B 3I4MB 2Q2TA 1EWCA 2WXNA 2F0GA 3PS6A 3ZO5B 4AQYQ 2ZCCA 4REZA 3R2IA 1NUCA 1X6OA 2ALYB 2M9VA 3FHWA 2NVTH 4MTNA 3S17B 1OQYA 2LRWA 5T1IA 3FPUB 4G57A 1ONLA 2AL3A 3R8BA 3HHMA 2V3SA 3OW7A 2HIVA 2ZM6Q 3DWGC 4GDLA 4WRDA 3OAWA 5EKLA 2AX5A 2ZM6L 3RN2A 1IKLA 1JB3A 1XXGA 2UU9Q 1YNJD 1GJXA 5IYCH 1TZ1A 4F8MA 1E2ZA 1U0LA 4KN4C 4BKSA 5FLMG 1IYFA 3UIOB 4PV1C 2BH8A 1TKWB 4DV7Q 3HUIA 5GAHC 5H8YE 3P7JA 2KACA 1Q86C 3UE0A 1BXTA 4PMBA 2N4FA 1GB4A 1TWAH 4O42A 3APDA 3SXHA 3DBRB 5FKAC 4FBJB 3Q8EA 2WXKA 2KZRA 3QAQA 4FNFA 1XF5L 3HOZB 4ICVA 3KWVA 5JVG3 5AUIA 2IGDA 1WTRA 4K2LA 2OHFA 4NJCA 3S1MB 4A3BB 4II2B 2JA7G 5IOCA 1YN5A 1Q1OA 4M0WA 2HTME 5JHAA 2WB1E 4JV5Q 2JA5B 2MNAA 2VRRB 3AMZA 2BA0A 2N0SB 4IURA 1UBIA 2LGDA 1DM0B 3RNBC 3EIVA 1UF0A 2KYWA 4BY7G 3KDFA 5D65A 5JJZA 5M3MG 3OPOA 3ENEA 2DZJA 4K1RB 2HDMA 4A3JH 4DHJB 1WMHB 4JI4Q 3L16A 1TQOA 3HOVB 2N1VA 3RUIB 2WKDA 2VQFL 1WI5A 3BVGA 1L0YB 1E2WA 2CHXA 4FVMA 1BBWA 3NELA 1S5FD 1R4PB 2NVXB 4NJ7A 3GTMB 2DBYA 3UINB 3GTOH 4P7IA 4KDIC 1ROEA 3T1HL 2KBNA 3J80L 1XNRL 2A73B 1M1KC 5EE1A 1M8AA 4IOCA 4ZCKA 2ZTDA 4OZCA 3IVFA 2ZNVB 1DOIA 4R1JA 4HKQA 2DNFA 1AP0A 2V9HA 2WXHA 2C35B 4JI4L 3B08A 4LF5L 4DK5A 5T1GA 4ARIA 4QIWE 3CHBD 4HMIA 4NKLA 3SEBA 4X64L 1EQQA 5JJLA 1WTOA 2FCQA 4MT5A 1SJHD 1VQBA 3W5UB 3PHXB 4IFDJ 1WXQA 2R92G 4TVAB 2D3GA 3U50C 1HCZA 3DM1A 4I6PA 5C3XA 4BY1B 4ZRJA 4OO1G 3I5JC 3MEFA 4E74A 3JSVB 4II3B 1XMQL 3HOUB 2UXCQ 1V5TA 4ANWA 4S3SA 2Y0SE 3EFUA 4HSPA 1A0IA 4N8FA 5C23A 4BKTA 2H5XA 3G71A 4Q0FA 4HCEA 1SE2A 3QR8A 2J7ZA 2O2LD 2LGSA 4J1MA 1PV4A 1SMYD 3NWSA 5C0XJ 1R4MI 2ZW1A 1C4QA 5CV7A 4FULA 3TP5A 2ES2A 3NQTA 3EUB2 2F0WA 3MFGA 3MAQA 3PIP3 4A3IB 1D5XC 1Q7YC 4UHVA 2YU9H 3S1NH 2FINB 4F1SA 4AS1A 2XIWA 4I6NB 2CW0C 2QJLA 4ZQ3A 4GN5A 5C3EG 3ITPA 1DOXA 4DR1Q 4K5XA 3DHQA 4K7WA 1V1PA 4YSYB 3T9LA 5I9PA 2UUAQ 3JAML 2L52A 2WB1B 1WCMH 3HM3A 3TN2A 2DWQA 3AEBB 4GU2A 3GZNI 2N9EB 4G7ZC 2MP2A 3KYDD 4TMAB 4BS9A 2C60A 2ZJRA 4A3DG 3AULA 4RH6A 4KZ0A 1RLFA 4FP5D 3RR5A 1GUNA 4DV0L 2PMVA 3ZW3A 4BBNF 1H9MA 1TR5A 4CBVA 3FILA 2BYTA 4B6WA 2XRQD 2QW7A 1SNOA 3GDEA 3VXWA 2WYQA 4I7AA 4X65Q 2K25A 4JI5L 4DDGD 1BKBA 2EQSA 4B3TL 2VUMB 1Y1VB 1AW7A 3Q3FA 4JOIA 3PREA 4KX6B 4LK0M 1PLFA 1TWCB 5JOBA 1Y1WG 2GMIC 1O7ZA 1VQJA 3CP0A 4A3LG 3V62A 4XTCS 1G8ZD 1T0SC 2VB3X 3OYYA 1NYQA 4MJSA 2N1WA 4XQQA 2UXCL 1OFFA 3S15B 3D4WA 4YCWA 1V8CA 3CCUA 4TKNA 1HQMC 2MLBA 2VS1A 3STBD 3PO3B 1MBYA 1QOHA 1GM5A 1P8LA 1D7QA 3QX1A 1SYGA 4E6IA 2PMZB 3HKZB 5I2XA 2F0KA 4DQOC 4PT5A 5CX3A 2INCC 2KNBA 1Q46A 1D8LA 1M4VA 2WXPA 4YHHL 3V96A 4HWIB 4P16A 1ACCA 3FC4A 2R2OA 5A2QL 3S14B 2CH4A 1PGXA 2CJNA 2KKCA 2HD3A 3TCAA 1HZBA 1K8MA 4X66L 3MFYA 4ACFA 1PZJD 4KKTA 2H89B 2HT1A 4A3EG 1QVCA 2OTLA 1XLPA 4CJ0B 5IGDA 3ER0A 2UUBQ 2LVQA 4XZ4A 3AFPA 2C9OA 1YBYA 3I9V1 1SN8A 2MP1A 3H91A 4N8X1 5CBEE 1OEYA 1YNNC 2JA8B 5IN7A 1UUPA 1S5DD 3A1QB 1LTTD 3KF6B 3Q8BA 2QCZA 2GBKA 2ZZPB 1AEXA 5FLXc 1NAPA 4M01A 2FFKB 4R4IA 3WWVA 3S9WA 2BKFA 4S17A 1LTID 1P9DU 3RZDH 2KDBA 1SLJA 2KX3A 1DYQA 3M7NA 4HEDA 3RD4A 3BK2A 4HPPA 1KLUD 3TEXA 2TSSA 4AUQC 4JGHB 3I3CA 3EQLC 1JW9D 3JW0X 2C9WB 1Y8RC 2VZKB 1ILQA 1UE7A 4IPGA 1XMOQ 1T6BX 3G4SA 1YX5B 2IY1B 2UXBL 3UDFA 1LTAD 3P4RB 5EJWA 3U9OA 1O7YA 2OJRA 4ANVA 4L63B 4EQPA 1Q82C 2B2VA 3KUPA 4HJ5A 4MSQB 2KECA 1V1PB 4BBNC 4FJYA 3A8IE 2XWJB 4CKEA 3B9JA 2A6EC 1WJ4A 3QQ8B 1BF4A 4KZCA 4MDKE 2L11A 1V49A 3K7AB 3DBSA 4MGZE 1GUGA 2BKRB 2K5PA 2QSDA 2WAQG 3HKZG 2O6VD 1NMGA 1BBXC 1HR0Q 3OTOQ 2MEKA 5JEAH 3AU4A 4ZRQA 4DK1A 1V8QA 2F0UA 2EY1A 1WH3A 1LTBD 1IBKL 2L1BA 2BOSA 1DCZA 2I5MX 2MFIA 5J17A 1WJJA 4KTAA 2Q8IB 4LF4L 1KRHA 2CU1A 2CHZA 2F0IA 2GVBA 3S1QH 2VZKD 4KJOA 5KNCA 2ZPYA 4WQOB 5EE0A 1EYAA 3T8MA 3CCJA 2A6HD 3NBHA 1EEFD 4M8MA 2NB0A 1RRBA 3IT4B 1RWSA 4QUCA 3S2DB 1YQ4B 1TS5A 4IWOA 4MH0E 1YN4A 1EOTA 1B9RA 3MXPA 2L15A 2KCNA 1F9SA 2AUJD 4XXEA 2YTVA 3ONAB 1H4RA 5DPTA 5M5XB 2LUEA 2WGSA 2A19A 1ZE3D 4M8NA 1C48A 4KY7A 2B2WA 3A74A 4NAMA 3LGJA 1STNA 4W9EA 2RD0A 2OJWA 1HZ6A 1E7VA 1WJUA 3HOYG 1RODA 4HLEA 5IE8A 1L1OC 4LJPB 4C7ZA 3H0GH 1WRIA 3T13A 5C3JB 4K2KA 3KBGA 1VZ7A 1N32Q 1FMAD 2FE8A 2JEBI 3ICEA 4FHKA 1EZ8A 1HZ9A 3V60A 4ZHPA 1UWVA 3KLSX 1IL2A 1W6KA 5IT9E 4TRDA 2M56B 3R93A 3SR1A 1LV9A 2XK5B 4G11A 4IM3A 3ZTCA 1EIGA 1KNEA 2EXDA 4EZKA 1QVGA 1I42A 3JVZX 2YTYA 1FCCC 5J18A 2ZT9C 2MBOA 1Y14B 3KH0A 3ZDTA 4FDBA 1STHA 4ABNA 2GA4B 1HH2P 1VRAB 2NPTB 4ZK9B 3CC2A 4US8A 2E2DC 2XGTA 2EELA 4KKIA 2EOTA 1I4QA 4OGQC 1I50H 4E71A 3A1QA 2IW3A 2OEOA 2MBHA 3NOBA 1OXTA 1N33L 3AN1A 4B3SL 1RM6C 2KJ6A 4DK6C 3TSSA 1A70A 2F0MA 2PLPA 2HHHQ 2VH2A 4C2MB 3TEYA 1EWHA 3S1RB 2ZTEA 4DV7L 4DV6L 4ZHOA 2KQ4X 5C44G 4LNOA 3T16A 2Y5CA 1HZCA 4B3TQ 4KSKC 3D32A 2K05A 4CO7A 3IL8A 2DYBA 3PZ7A 2JA6H 2Q5WD 1OXSC 1RF2D 1SR3A 1F0ZA 3RLOA 1FO4A 1K51A 2PI2E 5H1SE 2XVSA 2QCPX 1H9SB 2KENA 3BZDB 5HY6A 3VYRA 1KRTA 2CQAA 4L5QA 4DV3Q 4DV2L 1OTCA 4QAYA 1IW7D 1STBA 3P1MA 4OVZA 4W9HA 3QWNA 3NBIA 3HOXB 2N9PC 4IM0A 4N9TA 2KANA 2WXRA 3DHIC 4IOAA 1U4AA 2GOWA 2TMPA 2H4OA 1BCPC 4NQLB 4QUFA 4DR5Q 5C0XI 4MJSB 1DOYA 1RD9D 5CHWA 4A3IG 1JC7A 2A6HC 1P98A 3DXJC 3MC9A 3PO0A 5KNBA 1X3QA 4DV5L 1CSQA 3PF5A 1SGHA 2PNHA 3UI2A 3J80E 2FMMA 4DR6L 1VJKA 4RGMA 4P2CB 2ZPNA 3OIPA 1FJGL 2YEPF 1JR0D 3C1FA 3ZQ4A 1UH6A 4IFDI 1GXDC 2DY7A 4HSVA 4A3GB 3K7UC 3TIXA 1SE4A 1QG7A 2BW2A 2L76A 4POGA 5IWAL 1YIJA 4B0MA 4L5SA 3M7GA 4GOPA 1LTSD 1YZ6A 3MHSD 1T0QC 2MO1A 3CCQA 3HRZC 2MA9B 4WWOA 3NS8A 5C1ZA 2RDFA 5JH5C 1YHBA 4YCVA 4BBSB 2OXPA 4OO1I 3M3JA 1JALA 1D4BA 3M3YH 3RZOH 5BYSA 2CJOA 3BVZA 3M4PA 1KIXA 5FLXE 1ENAA 2C7HA 4C3HB 5A35A 1AYFA 5C5LA 2I38A 1S72A 1QNUA 2J7QB 3Q8AA 4AYBE 2BH2A 5M5YB 2INNE 3EECA 3N9YC 4KV2A 4US9A 2UXDQ 3VR3A 2HTHA 1TKYA 1GJZA 1XTDA 4DA2A 1B50A 3BYTB 3I4MG 3PHWB 3MJWA 1HNXL 4JX1C 2VQEL 2JA9A 3NUHB 5M3MH 3U58A 4BY7B 3J81j 3D0FA 5JZEB 2VXWA 4N9PA 3Q8CA 3JSVA 3U9SA 3U2SC 1E2VA 2JSOA 4RG1A 3PIO3 1GG3A 3KJPA 3I4NB 1JE5A 3HOVH 3TBIB 2ZVNA 1YNND 3TZDA 1ICFB 3W1YA 2RDHA 4IJHA 1P16A 4DV5Q 4YWKA 3GTOB 4KGSA 4LDTD 3S2HB 1Z6HA 3X0WA 3J7YW 4LF6Q 2INPE 1WOCA 1Q1BA 3AQQA 4EEWA 1XLOA 1E1OA 5EKIA 1HFNA 2Q8RE 4KN7C 4DU9A 1Z9FA 3V05A 4BBSG 4I65A 2EMTA 2L00B 5ISRA 3B1LX 4ASWC 4DAPA 3H7PA 5I2YA 2R61A 5H92C 3OOCA 1V9JA 2D07B 2K8HA 2K6DB 3PUXA 1EFWA 3CRLC 2LJ5A 5IP7H 2AWTA 1Q1EA 2EY5A 3ZTDA 5EBDA 1NENB 5CYUA 2QIEB 4X64Q 2K5NA 4BY1H 5CTRC 1HE8A 1J5EQ 1MSHA 2K5VA 3IRBA 4NP5A 2X38A 2CWAA 1YHAA 3HOUH 3I63C 4RKLA 5AFWA 4Y7NB 2PJHA 2RMMA 5CV9A 1IW7C 3Q24A 4UPAA 1QNKA 3CCMA 1C77A 2BT6A 2I07B 3AFQA 3URYA 3C8YA 3A4SC 1U4LA 2C7MB 1DOMA 2ZTCA 4B9WA 4JQWC 3DPDA 3PV1A 4KY6A 1YITA 2KFJA 4ZRKA 5DPWA 4R4QA 4MM3B 3ZGZA 4GS3A 4A3IH 3CCLA 2DHZA 1Q90A 3WOEA 2YU9B 1PQSA 2VY3A 2IY5B 4B9XA 4KHPQ 4RCNA 2NWGA 1NNXA 2G5DA 3RMKC 4C3JB 4NAWB 3E56A 1VQEA 1O80A 3LB8C 1LO5D 2DNEA 3D4RA 3QK0A 2SAKA 2NZHA 4RAUC 2GBNA 2K32A 3H94A 2PQEA 2DUDA 1WCMB 3T4AC 1B2TA 4A9AA 1LUZA 1DGJA 3VTWA 2PZUA 4EX5A 1NDDA 2LXAA 2LHDA 3ND8A 3W2DA 2IO3B 2O2VB 3E9SA 3KW5B 1TVXA 1IYUA 5KRUA 2O5JC 2MQJA 2JUOA 1SNDA 5LMNQ 2LFIA 1TS2A 1IYJB 2CWPA 4WWMA 1IPGA 3ZIMA 3HS0C 3DVGY 1R4MB 4DUZL 1U5KA 2M2LA 2VUMH 5D6JB 1E8WA 4XYQA 1ZGUB 1TWCH 1UE6A 4FLHA 1N6ZA 2ID0A 3KYHC 1I4HA 4MN3A 1STAA 1WJ6A 3FKIB 2MQHA 3S15H 3AE1B 2IO0B 2V4DA 1RJTA 4KHPL 2PO4A 3PO3H 4C3IH 5KYIA 1A63A 3I72A 2IY0B 4NY0A 4YTNB 1XLNA 3L9AX 4DR5L 2KDEB 1JWMD 3MZ5A 5FJ8G 4IKGA 4RGNA 1HPCA 3ULPA 2Q2IA 2OQKA 3F8TA 1WTPA 4KGTA 1PZKD 3UE1A 4GNXC 2CCZA 4IUMB 5C4XG 3K5OA 3VR9B 2EYPA 5IGFA 1PH6A 3S14H 4DNIA 4I6LB 1S5ED 1L0VB 3PLVA 2KTRB 2G4SA 2BB5A 1BQQT 1J0GA 3GTLB 1SYFA 2J53A 2K04A 2N9LA 3J80i 4IPDA 4B0EA 3CMAA 4JI7Q 2FJ2A 5D2MB 2BDNA 1FXAA 5IY0A 3NVWA 4J6HA 2K01A 1U4RA 1SNMA 4KLKA 2WX1A 2JY6A 5GROA 3FKYA 2KO3A 3RNFC 4P73A 1F2ZA 1FXIA 3WA0A 4XYCA 3VUYA 3RN9C 2CS4A 2HD5B 1CZPA 4B95A 1WZ3A 1HNXQ 4JL9A 5MPOA 2Z6BA 3V6CB 4WJNA 2L9HA 2KEDA 3NEMA 3RZDB 1BO0A 1B70B 1TY0A 2C5CA 3M95A 4RGTA 4LJZC 5IYBG 1VS0A 3UI3A 4CGYB 4LUVA 5C2TB 1J7BA 1SYDA 1YI2A 2WDRB 3L13A 2JE6I 3CPFA 5KNDA 1WSPA 3DBHI 1CQVA 2LASA 4QY7A 3GTPB 4JE3B 2WAQE 1SE9A 3VH4B 2F52A 2FMCA 2JN4A 4XIGS 2D2CC 5IYBH 3A4RA 3N1XC 4WQMA 1LT4D 4TUUA 3HZXA 2ASBA 4DGZA 1R9TH 1MI2A 4DAMA 1HNWL 4WURA 1PTOH 5CGKA 4PMCA 4RFBA 3X23A 1ZOYB 3DWMA 2KMAA 4XWWA 3KK7A 3DQVA 3K7AH 3PLUA 1QJOA 3W3AA 5C44H 3D8GA 1WE6A 1MJEA 1EUVB 3EVQA 3PSIA 1R7SA 3QOLA 4GLXA 1PH4A 4BWGB 2Y5PA 1VMPA 3Q3MC 2KD0A 5E3FA 4YHHQ 1L5PA 1UEAB 2NVYB 4PZ8A 4OEMB 3Q14C 1F2LA 2QILA 2K5DA 5C5MA 5DAUA 1J6QA 2Z4HA 4CDDC 5CHVC 2BWFA 1PVOA 2Y0SB 2KC1A 4F8CB 2JQOA 3VR2A 2BE5C 1C78A 3PRZA 4NZLB 4BXXG 1XO3A 3HK0A 1R4NI 2LFNA 3ERQA 4TQUS 1K52A 4BA1I 2JA8G 3A5ZB 3FPPA 2UUAL 2PVGC 1TJEA 5J2RA 2RCFA 1RIPA 1E22A 1WTQA 2OTJA 3DEOA 1G51A 1JWAD 1SIFA 2IGHA 4MM3A 4ZUJA 2JYTA 4N6EB 1QQRA 1VQCA 4WH4A 1NYRA 4A20A 1OXUA 2DNCA 1Y69U 1STYA 1EM7A 1IKMA 2KC2A 4GKJQ 3PRPB 3JAME 1UGMA 4JPSA 5IGEA 1VF7A 3C2PA 2LMCA 5KHOA 3JAMi 3K9OB 1AN8A 1C7YA 3H0GB 3L7ZC 4ME3A 2Z59B 4ZYSA 4DDID 3KWLA 1EU3A 2XTIA 4WJOA 5E6PA 1FR3A 1RFKA 4N58A 1FNWA 1WGYA 3AEDB 4J6IA 1QILA 2WXLA 4CDCC 2O4XA 4OWWB 2Z4IA 1VCBA 2VZAA 4DK3C 4JBMA 1OQRA 2CHWA 4G7HC 2LJIA 1XJVA 3T1YQ 2B8FA 1XMQQ 1GB1A 4IFDG 1F2RI 2PNRC 2C5LC 2GI9A 1E10A 1C4PA 2Y0SG 3F2DA 2K14A 1FFVA 3MTSA 2SOBA 4LUOA 2ZJQA 5DM73 1JRUA 4J8QA 4XDDA 3KDFB 2XNAC 4K0KQ 3BDLA 3FP9A 2REXA 2F0JA 4MACA 2V1CC 4LFCQ 5IAAC 1WWTA 5CV6A 1HTOA 3KF8A 2KX0A 2AQ3B 1BDOA 3AEFB 4X3TA 1G6ZA 5D94A 3EGRA 1UEBA 2INDC 2NBUA 5C0XG 5E7NA 4DKAC 2KMCA 3BK1A 1Q3LA 3S1RH 3AE9B 2CHBD 4WAAA 1T0YA 2KLGA 1CZWA 2CFMA 2CW0D 1HJPA 2D10A 1HEZE 4FHJA 2B2YC 1HUNA 4HAEA 2PZTA 3R7RA 2XRSD 5CV8A 2LKVA 2JWZA 2UXDL 1DOKA 3RFZB 4XYOA 2JA6B 1WX8A 2I46A 2B2TA 3A8KE 1BCPB 2E6XA 4DAYA 1WXVA 2PIAA 1LLRD 3X3MA 4RKBA 4A3CG 3TL5A 2HQLA 4YCUA 1IZ6A 3CC4A 4H7BA 4IUUA 1K8GA 1VQ8A 2IX3A 1J7CA 1N61A 2KN5A 2J52A 4GDLB 2K3UA 3L2PA 4JV5L 5CMDA 4W9IA 1XYIA 2ICIA 1J8IA 2RBMA 5DCNA 1AE2A 3U4VA 3WALA 4YY3Q 5C4JH 4POFA 2E2HH 4DUZQ 3AEVA 4KI0A 3DM3A 1CMXB 1X3PA 3BIID 2LZ6A 2NN6H 1N9WA 1UGJA 3VR5A 1N63A 1VQFA 2KT7A 3E5SA 1JMCA 3I4OA 2V4IB 2D2QA 2PPHA 2PE9A 4KJNA 5DM63 3VYTA 1Z47A 3D3RA 1L4ZB 1TIFA 3L08A 5G5GA 2B29A 3RYTA 4K3CA 4C4VA 1N34L 4XT1B 2L8JA 2B63H 2KFKB 3A56A 4A3GH 1YIWA 4UP7A 1XPOA 4RGOS 1ZDXA 3RNEC 2NN6I 2BE5D 3QIAA 4AJWA 4JIOU 4CKCA 1SAPA 4FF1A 5I9OA 3TRZA 4FXDA 3K9PB 3UF8A 3DEPA 1X56A 1TZOA 3SD5A 2HDLA 2MP2B 2UU7A 1E90A 4A4IA 4RF1A 2CU3A 4BVUC 4H2AA 2DGYA 4C7YA 1SDFA 1IGDA 4BBSH 4KGRA 3SK5A 2I1KA 1ESRA 2L0TA 3DHGC 5JJIA 3M3YB 3RZOB 1FVIA 3IAM1 3J81i 1EO6A 1GUSA 1WXAA 1JRPA 4FXGC 5BYRA 3S2AA 4C3HH 4DUYL 3CWIA 4KIKB 1EY0A 1A3UA 3CQZB 1GHJA 2JYOA 1K50A 2MRPA 4KSLC 5M5YH 2Z0DB 4ZLTF 4A3LH 2JYEA 2WS3B 2KN4A 1HR0L 5EPLA 2YEPB 1KQSA 1BUVT 2K4KA 4HR7B 5HHDG 3NSWA 4DWFA 2BS2B 4ID6A 4X62Q 1OTRB 4OX9Q 4WJ4A 3NRZA 5M3MB 4BY7H 4GLSC 4FF2A 4KVGB 5HI1A 3SK6A 2E8GA 1I94L 3I4LA 1LGRA 3N30A 4HJKA 2KOXA 4A3PA 2JA5G 1YNJC 4B9KA 1AH9A 4R8IA 5GXGB 3KUDB 3NVVA 2LUMA 5EAYA 2PE6B 3A0JA 3I4NH 1YJ1A 1D1IA 3K5MA 1XPRA 3AE3B 4LFBQ 1HHVA 3H3VH 4RF0A 1WCMG 3APCA 1VQKA 1G2SA 2AQ1B 2Z9HA 1V9PA 3PUWA 4CKBA 3S2HH 1QKZA 3L54A 5AZGA 1FFUA 5KYLA 4K81A 2MO0A 2CKZB 2RSOA 2JEAI 1D5ZC 3L0OA 3RNUA 4EKUA 3MHZA 4ZDVA 1RFAA 2E75C 3AV8A 1VZ8A 3PT2B 2N7DA 5IGGA 3MTNB 1CFMA 3HEJA 1OEYJ 2C7NB 1KHIA 3CAMA 2Y5BB 3I3TB 2OT2A 4NDXA 2YLMA 1GNUA 3K81C 2E2JB 3H1UA 1N32L 3ML9A 2IX0A 3RNAC 3EBEA 2RCNA 2L0CA 1EOVA 3NQIA 5C4HA 2MSED 4IO9A 2N7EA 3JYUA 3MXUA 1KNAA 2G1EA 1KL9A 2JZZA 5D3DA 4Y7NH 4WWNA 3J81E 1KOTA 2M00A 1U4MA 2BS4B 3RULA 2K39A 2N3SA 1SYCA 3F2UA 4PZ7A 1EYGA 5EGTA 1CHQD 3KBXA 2LMCB 2JA6G 1MG4A 1TBEA 3SR6A 2GN5A 2LXJA 4PYUA 2L12A 4AH6A 4K0KL 1B9MA 3ZDMC 1QF6A 2J4XA 3RNCC 4O0AA 3R3OA 3C46A 2VB2X 4C3JH 3E0EA 5CR3A 1ZXTA 4GOCA 3E3XA 4F7XA 2PKOA 2K28A 3BU2A 3AE4B 1TKEA 1DJRD 3B2GA 1EFID 2QEJC 1K53A 2WDVB 3HIZA 4NW2A 3UQAA 4Z9CB 1K73C 1QOBA 2QDLA 3AE5B 5G3LD 1UE5A 3E0JA 2RQXA 3NK9A 5FO8B 2A69D 2NYZD 3L17A 4IPHA 1MFWA 2N9KA 1E3PA 2A74C 1T0RC 3NG0A 2BTEA 1TWFB 4CHKA 3H7PB 3D6CA 2UWQA 4K8IA 4Q5VA 5EDSA 1A3TA 2JA7H 3NTKA 4X3UA 4MGYE 1H8CA 4PS8A 1VDVA 4B3ML 1M90C 4OONA 3AE7B 1CI3M 2VH1A 1A5RA 4A93B 1MD2D 3FKIH 1YJIA 3QG1A 1QB5D 2WIIB 2ATWA 2F4VL 5E4WC 5F2DA 5JEAG 3VDZA 1E7PB 1LTRD 4C3IB 1WXSA 5ELNA 2CR5A 4N9F4 1CA6A 4JI3Q 4JBKA 1UWXA 3C0RB 1HZAA 1PFNA 4LAAA 1ZYRD 1X32A 5K36H 2A5UA 3QCAA 3U4EG 2ZXRA 4Q2JA 1ZUD2 2LEKA 4RHSA 5HURA 4A75A 5JPNC 2I2YA 3KF6A 3LNNA 4OWTB 4M0WB 1VQAA 4FF4A 4DV4Q 2WNMA 4M8AA 5ELEA 2EYJA 1PH5A 1C79A 4GN1A 3ZKJC 5DNFA 1DXMA 1K83H 1PYSB 4JBWA 2E5LL 2V3PA 4HCSA 1B53A 4KV6A 2ZJPA 3GTLH 3J7AF 4ILWA 1L0XB 4CJ1B 1AZPA 1VR9A 4ZKBB 4H02A 2KJXA 1LTGD 1K28A 1V1OA 1WY8A 1EY7A 3LX0A 2LWPA 2M1MA 4EOYA 2JP1A 3T53B 3R7QA 4QMGA 4HIOA 3ZJTA 1PH9A 3TMEA 1I4XA 1ML0D 5M3FB 2EXZA 4NXMQ 2QHOA 2ON8A 2L0FA 3L10B 3VR6A 2RSUA 3I57A 2EYFA 1FL0A 5E1FA 3C19A 2L1AA 2Z1CA 2ZCBA 3J81c 2GLSA 2RPVA 1HTQA 1BT0A 4QIWB 5JXVA 1WX7A 2K1BA 1KRSA 3I73A 1JOQA 3P4PB 4B3RL 1A6XA 1NTGA 3RLFA 3CW2C 3GTPH 2JJQA 2VQFQ 2KCCA 1E5WA 5HG2A 4MHEA 1YHQA 2IHFA 4MIUA 4DV4L 2BF8B 1E8ZA 1FPYA 4HEA1 3W5VB 4EQ5A 1IYVA 1R9TB 2DAFA 1PTOB 3PZ8A 3A9JB 5K5PA 3VUXA 1VZ6A 2FIDA 2KEEA 4HIKA 4A3KH 2B2YA 4HRSA 2OCEA 3L3OC 5AUKA 3N20C 4JI1Q 5C44B 4IJLA 2I5HA 2L5TA 1J19A 2O6VA 5IT9c 4KKUA 4EFOA 1SNQA 4GN4B 1CJEA 4P1BC 4OXPA 3W1BA 1JE4A 1PH7A 3V6EB 4KKSA 1IP9A 4KY5A 3T51B 1WTXA 5ELOA 2NVYH 2NTTA 4YIJA 1JB7A 3W9CB 2HIXA 2R93B 1WMHA 1ZKOA 1ZXHA 4JYAQ 4H0LC 2K5WA 4AOFA 1ZDVA 2O5IC 4WJQA 4A6QA 5C4XB 3OSOA 2WFWA 4MZ9A 2F0OA 4IUTA 4JI8Q 5JEAJ 5IIFA 4LF6L 2FCNA 4JI1L 4PQXA 3KUZA 1B44D 2AEHA 2KDMA 3IFWB 1F9QA 4IW0A 2DYMA 1EWIA 2F0HA 3AU5A 1SE3A 1GD7A 3SE0A 1D1KA 4X6AH 2GB1A 2WQYB 4C3IG 2PZWA 4K7SA 1PTOC 1PTOD 3DVNV 1O7IA 4JG2A 4GKJL 2NZ1D 1IHZA 3N32A 4QQBX 2W9NA 4DBGA 4A93G 3VFKA 1IBXB 3T1YL 1VLBA 3VYSA 1SNCA 2RA4A 1H95A 3EJIA 3OWEB 4WJWA 4J3OD 2EMSA 3GS2A 1L2FA 4P72A 1TS3A 2F3WA 4Y52H 3AE6B 1LT5D 2GBRA 3P42A 1YN3A 5BMHA 4QJFA 4GZYC 3STBC 3ZJUA 1CKNB 1MJDA 5IO9A 3H6MA 3Q69A 4HKZE 5FK9C 3VAWA 1J8CA 3OIQA 1H9RA 4LF9Q 2B8GA 1MI0A 3KF8B 4FA6A 3BZCA 3DWAA 4RNAA 3H09A 3GTGB 2IHEA 1FGUA 1HFGA 2W55A 1NR4A 2OQ0A 2FCMA 2N9XA 3T3OA 4LFAL 1VQ6A 3RZWC 3DLLA 4RCOA 1PDXA 2EKEC 3CCRA 1PH8A 2UUBL 3BINA 1DOLA 3QC8B 2X6LA 4KD4A 1NI2A 1J7AA 1N5XA 1EZ6A 2R3ZA 3A54A 3RLNA 1K3RA 1MHWC 1KM7A 2G9HD 2D3BA 1FM0D 1WE7A 1YJJA 2MJEA 3KLRA 4TQ1A 4AP4C 5CHFA 3UDIA 2BYFA 3E6ZX 3NHEB 3A9KB 4OZAA 3FAHA 1YQBA 4A3MB 2JSVX 3FEWX 4HJ9A 1X9NA 4BAXA 4MSMB 4XX5A 2YTXA 3C1EA 2KHJA 3TEZA 3NBHB 4JK1C 4JWSC 4GXBA 3AI5A 1E6EB 2BGFA 1A15A 3GB1A 1Q12A 3UDGA 3HG9A 4LK1C 4PG3A 4CHTB 1FNUA 4DR3Q 4NPSA 4DN4M 2MBQA 1EQTA 2B2UC 4FXKC 4DR7L 3IBEA 2CVRA 5CC4A 2RPQA 3ZRFA 4QL5A 2R92H 3UIPB 2DJGC 1JJ2A 3BJUA 1G2TA 1VMCA 2HQEA 5C4JB 2N49A 4A3JG 2E2HB 4X65L 1F2YA 4ZOHC 1B1ZA 1F9RA 1I6VC 3HFZB 3NJTA 3NVZA 1PYBA 4LFCL 2MJ3A 1XNQL 3D6WA 2IPKD 2VW9A 1EIHA 2YVCA 1QUQA 3Q6SA 2SNSA 5LMUQ 4JYAL 2K9XA 3K5LA 3A9KA 1XLQA 4EQOA 1WI0A 4ZRPA 1ZXIA 1STGA 2R2QA 2D3AA 2LXCA 2B63B 3AM9A 4DV6Q 3NENA 4ALPA 1GUWA 2KHIA 2VQEQ 4A3EH 1SBBB 3H9DA 4K3BA 4UP9A 4ZRZA 4RM8A 3PSEB 3I4NG 5IP4D 4W9DA 3CRKC 1MHXA 4A3OA 4JCVE 4HDQA 3PUYA 2MHVA 1AZQA 1T5XD 4DHZE 1PMRA 3DBLI 4PK1A 3KUCB 2FAZA 2HUGA 2KVRA 3NE5B 1JICA 1BNZA 3RD2A 3DDCB 1WJNA 2MW5A 2F3VA 3A33B 2K8CA 2NR2A 3IXSA 4GDKB 4MGIE 1P1AA 1PH2A 4RMFA 2E3TA 2D0PA 3A8JE 2CKHB 2KFKA 2X8XX 4DFAA 1JQYD 3AU7A 3FMCA 3CQZH 4BOSC 2F0EA 3G7LA 1IBMQ 1I3QH 4A3FG 1A8VA 2DENB 3V61A 5EBCA 3M4OH 1ZP0B 4DR4Q 2FUG1 1VF5C 4GLVB 3DWPA 4L6TB 1FYCA 4IC7B 5FLMH 3VUWA 1QUQB 3OW2A 1MPEA 1X3GA 2J42A 2KK8A 2WXIA 3J7AV 4A90A 5C4ZA 2GVAA 3LWUA 4DHJD 1A3VA 1NJIC 3IT6B 4YY3L 1FD7D 5EE9A 5IA7A 1G291 4DV1Q 1C4CA 2L55A 2WWZA 2KVMA 2HDEA 4RM9A 4GNXA 4ARCA 1E7UA 4HPLB 4YSZB 3ALBA 1EY6A 1UELA 3I55A 3K0YA 2F3IA 2WB1G 2HJ1A 4LF8Q 1C0AA 3MC8A 4DNRB 1N36Q 4LFBL 2F0LA 4QGUA 1Q81C 2ZW0A 3SDLC 1WF9A 3PRMB 4IDIA 3TP8A 5L83A 4TQ0A 1R4QB 2K5HA 2BBCA 1TYGB 4JI0Q 2V4LA 1IL8A 1BBUA 4U68A 2W3SA 4OVUA 4W9FA 1U4PA 2WX0A 4K14A 2QEXA 3PO2H 3N1ZC 3TREA 3MJ5A 5FR3A 2E2JH 4IUNA 4ITKA 2K52A 1TWGB 2OEDA 1B7YB 2V3NA 2WV6D 2RF4A 2XK5A 2W82A 4JI6L 4F88A 4XGAB 1S5CD 3VQIA 2ZEQA 2NMQA 1SEBD 3MWYW 1S40A 4DUYQ 1N5WA 1HR0W 3GTJB 4L8JA 3T56B 5KGUA 1EQRA 2F0QA 2B2UA 1NEKB 5EKKA 1R4NB 1YD8U 2LD9A 2WXGA 3EN2A 2AKWB 3K59A 2WU2B 1GUTA 3BVMA 2BCOA 1Q10A 4TSSA 2FUHB 2LVPA 3CMMB 1JMLA 3NPPA 2RSNA 4CDEC 3AEGB 3I70A 1PUTA 2ONQA 1X3FA 2B3AA 1VCIA 2BQQA 3P1HA 4QCLA 4MELA 2R7FA 2LSSA 3EROA 3N1YC 1E24A 2N8NA 5LXHA 3VR4A 1FRRA 3H15A 2JZPA 1FD6A 5M9OA 2IJ0A 1ASZA 3Q8FA 4KHVA 3GE8C 2K33A 4QF4A 4A3FH 1QOAA 4PS7A 1E0ZA 5KHQA 2RHSB 2DZKA 3R3MA 5ELCA 2D62A 3WAOA 4OIKA 1ZW7A 5E6JA 2IWHA 1HNZL 1N36L 2EKIA 1EIFA 2EY2A 2JZ3B 2F0PA 2K6QA 4OWXB 4JI6Q 2RDGA 3PO2G 2DAJA 3PIPA 4HIMA 1Y8OB 1TWFH 1VQ5A 4JW0A 2H88B 1I35A 2A5HA 3NHHA 1OGWA 2I0QA 5G55A 2XBBC 2F0NA 4MGKE 1MVKA 2RVLA 1NY4A 2JA7B 3N3KB 1I4PA 2KQ3A 4K5VA 2LS01 5CV4A 3HOYB 1DONA 1G91A 1XEEA 2NUCA 2KDIA 3KFUA 3X3NA 1F1HA 2PMZE 3VDYA 1GC6A 1WXMA 3K80C 2K0PA 4LCDE 1FXTB 4A93H 3U7ZA 4A8XC 2RHQB 2N55A 3ZYYX 4M00A 4LFAQ 2ZJDA 2O6VB 4AYBB 2A8VA 1WTWA 3VVWB 3ONSA 3UQBA 4JC0A 5L37A 1XCQL 3GTQB 2PW7A 3F1ZA 1LACA 3AH7A 3AB9A 1I7HA 2XSCA 2KJHB 2JK8A 2IX1A 2HCCA 4OELB 1QZHA 4XQJA 3PGZA 1D6EC 5IKCM 1K83B 5E6NA 3JAMc 1PHJA 3ERSX 1S4ZA 3CU7A 4G7OC 2Q2HA 1CKOA 2KWDA 1P7FA 3DUZA 4A3GG 1QCBD 2WLBA 1WYDA 4WJ3M 2KQSA 4A3CH 3OWFA 3EC8A 1VQLA 3J81L 2QA4A 2AL6A 4JVZA 4M02A 4PS3A 1O7LA 2WAQB 2KXJA 2WXMA 4NNJB 1H9SA 5C3WA 2JXXA 3J9CA 4NQKE 5FR6A 4LNFA 1LFDA 4KMUC 5AJ3Q 5M3FH 3GTKH 1JQ4A 1QZEA 3VA5A 2F0DA 4LNIA 3VHTC 2K50A 1I94Q 2ZNVC 5C0XH 1L6UA 1X3EA 2D0OA 1RHPA 2EYMA 1QE6A 4RWSC 4JI8L 3SVMA 3HOXG 4JI7L 3HVDA 1YEZA 3WANA 4HCPB 1UWMA 3ZXRA 2KTRA 1L2NA 2KVZA 1KDAA 4L5RC 5EE3A 3GE3C 3PIOA 4CQNA 4ULLA 1RAXA 1CK1A 2K6AA 3LWEA 4GMVA 3CCSA 1K9MC 4IFDH 1HZ5A 2W54A 4BBRB 1LTLA 2IL8A 1F52A 3UGBB 1HRJA 4A3KB 1BMLC 3QHTA 3ZJVA 1V6EA 4X66Q 3I2ZA 1ESFA 4DV2Q 4DXFA 3CMEA 3OJ4B 2FNJB 4WWPA 2PQAB 4FXCA 3I91A 2PCFB 4UDUC 2OOBB 5FOBB 4DV1L 2WP9B 2KTFA 4RMAA 1EY5A 2Z6KA 4ODGA 2PQAA 3GV3A 3HVZA 4HJ7A 3IFDA 3DMUA 1LT3D 4K6LA 4LF5Q 3HM6X 1K8RB 3TDQA 3N6RA 2R93H 4JI0L 3SK8A 2X6GA 5D3IB 2UUCL 4K5WA 2KWVB 5BR8L 1TT2A 2K5QA 1SROA 5C4XH 1N34Q 1GPXA 1STEA 4KHZA 1WYGA 1RTOA 1A2TA 3CD6A 4ANUA 2KOLA 1IBML 4YT0B 4IN3A 5TR5A 2JQRB 1UD7A 4BXXH 1ZPSA 1WGGA 3QA8A 2EPBA 1PFDA 3MA2B 3PO3G 3PPAA 1SB3C 1L1OB 4OZBA 5AZHA 5G2NA 3EFCA 1TTNA 3M9BA 2Q2UA 1V5OA 5TSSA 1HA6A 2JRIB 1B8AA 4K8JA 1W6JA 1G6JA 2G45B 4YWMA 2B2WC 4DXAB 3PZDA 3IFTA 4MEMA 1AE3A 4HJAA 1Y1WB 2AWNA 3APFA 2I5LX 1BOSA 3PQIA 1IGCA 4NAWA 5BYQA 3SFDB 3SHQA 1NSNS 4DHZB 5M5WH 2Z0EB 1PRTD 2F0VA 2LY7A 2WACA 4W9CA 1CTMA 2NS5A 1SFOH 5IP9G 1K8AC 2KLCA 1WD1A 1LQBA 5GAEC 1CQFA 3Q3NC 3AE8B 2HCIA 1VQGA 5G3LF 2K7VA 1JT8A 2V1YA 1GUOA 2DY8A 2DJFC 1KLGD 1F2MA 1CM9A 1XX8A 3QO2A 4A3KG 2JRHA 3GTGH 1OXXK 4A3DB 2LI5A 4L5TA 1GO3E 1Y8PB 1FJGQ 3AMUA 4L1BA 3PUVA 2MCNB 1TWHH 1BR9A 1YMHE 2UU9L 3MHBA 3NS1A 2B2TC 2EJFC 3VRBB 3VTUA 4IWQA 4G4KA 2NZOA 4FN2A 1CKMA 4K6DA 5JVH3 4LUZA 4JBJA 1NMFA 1PFBA 5C3EH 3KVFB 2N7JA 1LXDA 4FADA 1X55A 1GHKA 1XWEA 4A3MH 5COYA 2A68D 3TEWA 5M3FG 4DV3L 4LTUA 1DZ1A 1E9MA 4P1CC 3CCVA 2A1AA 1WIAA 1ENCA 2NBFA 3K58A 4DK0A 1ILPA 1JORA 2H1EA 2LGXA 5DLQE 3BZKA 5FO7B 4YTPB 3RPFC 3MEHA 5CBAE 1TIID 1TT5B 2R7ZH 4C1NK 2KAJA 5T8IA 5AJ3L 4MH8A 4G3XB 1N62A 1CKNA 3S16B 1KD1C 1HTPA 4L23A 4GKKL 2R92B 1WM3A 3ZXVA 3V2TA 1HUMA 1SYBA 2FBWB 1TXYA 4V0BA 2XN9C 2G3QB 4RHRA 3Q23A 3KLSA 2D5GA 4N59A 5K36G 4BBRG 2UXBQ 3EFXD 3QARA 1FCLA 2BWES 4IUVA 2WU5B 1SRUA 1QLBB 3ZNID 1WRDB 3CSFA 3SHLA 4AYBG 3WIMA 2IO2B 4P6VF 3ZLZA 5BN3A 1T3QA 3DBLB 1SSOA 1OQQA 2YV5A 2HJ8A 1SIJA 1VDZA 2A4ZA 4UY8C 4FO2A 2KCTA 2BYEA 2ZVOA 4LNKA 1G6PA 5ELDA 3EA6A 4A3EB 2IYDB 1SE8A 1QWYA 3WDNA 1FNVA 1V86A 2BPSA 3IKJA 3VH3B 5I6WA 1KDBA 3SK4A 1B9NA 2E2IB 3E9IA 4BOZB 1KJTA 3A7LA 2BYVE 1WTHA 3Q22A 2MUYA 1VQ7A 3W5OA 1L7YA 4HIDA 4IALA 1TY2A 1PA6A 4ZKCB 3LXFA 4GOPB 2QMTA 1LT6D 4LWCA 4HXDA 1VQOA 2FCSA 4A55A 1BVSA 3TS2A 2EJGC 4GKKQ 1PXUA 1IBKQ 1I6HB 2DYOA 3AECB 1VQNA 4F7ZA 5JHBA 2QC8A 5HGTA 4IWPA 4CYEA 1EQVA 3Q8DA 1EYDA 3HOZG 3FILB 5IYDH 3OMGA 4W9JA 2GRIA 1VQIA 1QT9A 2V0GA 1I3QB 3RUZA 3M4OB 3HOWB 4C3HG 1TU2B 2J0MA 4EZLA 3BWUD 3M4YA 4C4VB 4P74A 1F2RC 1GKHA 2GBJA 3A5UA 2B3GA 2ICEC 2N78A 4LW1A 2VUMG 2NCNA 1Y56A 4OW0A 4HTHA 3BDOA 1FRDA 3DHHC 1JWUD 4TKOB 2E74C 2E5LQ 3AEEB 4AQYL 3BDCA 4IPCA 5E4XA 3ULLA 2F0FA 1EIYB 2M8SA 1F9JA 2K22A 5FLXL 2I1JA 1L6VA 1HTLD 1RL2A 4DR1L 1I4GA 1NCVA 1E1TA 1N60A 1RDPD 3M4QA 1RKNA 4HVBA 5LMUL 4EE2A 3ETRA 1CZGA 2Q8TA 2WHIA 3SGIA 3TP7A 4HCNB 1CHPD 4HMJA 1PTOF 2AQ2B 2WP8J 4DAYB 1SF0A 3H6NA 3BS1A 5AEKB 3P2BA 5J1ZA 1E0BA 1E7ZA 5D7GA 1S1QB 4IOIE 3P63A 4S0RA 3B2FA 1WGDA 1QVFA 1X1MA 5LL6S 3J7ZC 1QOFA 2EVBA 3TP6A 4LF7Q 3JC66 1Y8NB 3CF5A 2F0TA 4FF3A 3PO2B 4B3RQ 1MHHE 3QIJA 4KIKA 2JT4B 4GLAC 5IGBA 1Q5WB 3RMHA 3WAMA 1XMOL 2NVQB 4O2DA 2SDFA 4LF8L 1VD2A 4B3SQ 3N52A 2Y3AA 1TWGH 3P4QB 1ET6A 2MHJA 4WAFA 4IQZA 2Z6KC 3B6YA 4NXML 3RI7C 1E8XA 1PYWD 1CUKA 2DN8A 5AZFA 1TKGA 1NR2A 2BDOA 2K75A 4BFRA 1AARA 4JLCA 3GTJH 5IT9L 3HOUG 3SDZA 2M19A 3ZNGC 1JJCB 5JPMC 2B2VC 2AMCB 3PVLA 4XWTA 4OO1H 2D3CA 2EYOA 4BY1G 3H3VI 2NBVB 1X65A 5IP7G 3CKIB 1JJGA 4NJ6A 3TMPB 3RCZA 1GOZA 3HKSA 4X3SA 2YYZA 1EEID 4JI2Q 2D5DA 3KLWA 4C56C 2AWOA 1EU4A 2O2VA 2MPMA 5LMNL 3LYYA 2UUCQ 3QJYA 2JU6X 3UDXA 3G6JB 3I4MH 4E3CA 1RCVD 1D5MC 2L32A 1I4RA 1K0RA 1QZGA 3VA7A 2VNUD 2EY6A 5CORA 2KQ7A 4A3FB 3S17H 2NVTB 2BVCA 4P71A 2LGYA 4EGVA 3DOWA 3VYUA 4DNTB 3AB5A 5IYDG 5LHY1 1YNTE 3RZFA 3HKZE 4I7ZC 5FO9B 2IO1B 3ZVVA 1D2BA 3GO5A 1L4DB 3DBRI 4NXNL 5HGQA 2XEWA 5J22A 2M17A 1GUAB 3NXWA 4CJ2C 4DR4L 1EYCA 3OJ3A 1XNRQ 1MIUA 5LNK1 4R4CA 1FGBD 1H9JA 1V2YA 3IHPC 4OVVA 2KWUB 3CF6E 5DEHA 2XWBB 1V1QA 2N88A
chains in the Genus database with same CATH topology
4XDXA 4H13C 1JWBD 1JOKA 1Q8IA 3DWQA 3I90A 3BG3A 5A2QE 1TWAB 1RYJA 1KF6B 2J0TD 3TZUA 1K8OA 3PUZA 3PV0A 3A55A 5I6YA 1OXVA 3T3NA 1ICWA 2WDQB 1NVID 1JOOA 1SSNA 2NN6G 2E76C 3BYYB 3WCQA 3NWTA 4A3JB 2EYHA 1ET9A 2KUMA 4WORA 2KHSA 3WOFA 3PMFA 5BMIA 4R8NA 1BCPD 1BCPF 3K6OA 3R2TA 2BS3B 3HRDD 3OMCA 1S5BD 2MH7A 3V3XA 1ZYRC 4HN7A 3P20A 4OHJA 2G9DA 3GTKB 1JROA 1B4OA 1FIQA 1PGAA 3D31A 2B76B 1F9PA 2LGIA 4KD3A 2M0AA 2WXQA 2QDBA 2F4IA 2FHTA 3HGBA 2D9UA 1P7EA 1EL0A 4USAA 3TUOA 4R3DA 1QOGA 1CA5A 1HA5A 3MXNA 3S1NB 3GV6A 2WXFA 4YXDB 2A69C 1U9RA 1CT1D 1PRTF 1ENFA 4YSXB 2X69A 2A68C 1JCKB 2QKIC 1DD2A 4H44C 2EE1A 5J39A 1PDQA 4XDCA 1NI3A 1C8CA 2EZVA 1UNSA 3K57A 4V190 1PRTB 3NTIA 2IT1A 1GAQB 5NUCA 2RKSA 4F87A 4D2KA 1Z7TA 5EPKA 2IDYA 1A2UA 2KA7A 1WTVA 1II3A 1AFPA 3U52E 2K03A 3IAYA 3Q0AA 1PZID 1C76A 3P4SB 4ZAIA 3C3LA 5M5WB 4C80A 1SNPA 4XE0A 3OHXC 1SFOB 2F03A 1IUEA 2PTLA 1PGBA 2IGGA 1B3AA 1XCTL 3NTHA 2W3RA 1PFMA 4HROA 1SJED 4L2YA 2QF7A 3QB3A 2WXOA 3A7AB 5IGCA 5JAVA 1TWHB 3GQBA 3H8HA 3VRAB 2WINB 3NUCA 2A6ED 2JWUA 5G5HA 4BA2I 5ELFA 3NP8A 4B08A 5BMGA 3W1SA 5C3EB 3D4DA 1V43A 1HXYD 1MGSA 2PYKA 2SNMA 1EY4A 4ZUIA 1KAAA 4KKJA 4IUPA 4NMZA 5KEEA 2EJMA 2AUKA 5LL6X 2WXJA 2EDGA 4M1UB 1EY8A 1BUIC 4PNYA 3GD7A 1JWSD 3O13A 4WIPA 1F77A 5D14A 5CV5A 2Z8LA 4XT3B 2R7ZB 1XTCD 2EYLA 2ZXOA 3K5NA 3NVYA 3ABVB 3FDTA 4C1NI 3KQ4A 2ENBA 1O78A 4QB4A 4RA8A 1T5EA 2PPBC 4U673 3L4PA 5I4DA 1IBXA 2PW9A 1ZEQX 3M85A 3CIRB 4WFN3 4HJGE 3NZ3A 1KABA 2MJDA 3FRPB 4JWUC 2SEBD 4DXGA 3S1QB 2F0SA 3H3VC 4UAIA 4ME5A 4EVOA 2B39A 1WGKA 2JXTA 4DAVA 3P75A 1MSGA 5EPJA 4XQNA 3ND9A 2JXMB 5C6AA 2OF1A 2PVOD 2ACZB 3HP3A 1WD0A 1SXTA 4LLGM 4AQ7A 5EQ0A 5HFYA 1WVLA 1UAPA 2MGSA 3I8ZA 4C3JG 1AWDA 4YTMB 1LABA 4KK7A 2R6GA 1C4AA 2NTSA 2BB6A 1V97A 2KMMA 3AE2B 1KH0A 3AEAB 1KTKA 4DF7A 5BN4A 3IAS1 1I50B 3QOJA 1SMYC 1SYEA 3SFEB 3GP7A 3MVVA 5ELBA 4LMQD 1FEHA 2DLBA 1OO9B 3MXGA 2LHEA 2MJ8A 2F1MA 2L83A 1H9KA 4R9WA 4EQNA 4PMWA 4OL7A 1KDCA 4IUQA 2L4NA 4IZ8A 3VR8B 5BN5A 5KIXA 2JX5A 4X3KA 3FVQA 1YQ3B 1J9OA 1HQRD 4FYDA 4YWGG 2ZXPA 2PW5A 1KFYB 2WKCA 5IODA 1PRTC 4OIJA 1EWYC 1EY9A 1RTNA 2BA1A 3MP9A 4O1NA 1TS4A 1C9FA 3MC0B 3I4MB 1EWCA 2WXNA 2F0GA 4REZA 3R2IA 1NUCA 2M9VA 3S17B 5T1IA 3FPUB 4G57A 1ONLA 3R8BA 3OW7A 3DWGC 4WRDA 5EKLA 2AX5A 1IKLA 1JB3A 1XXGA 1YNJD 1GJXA 4F8MA 1E2ZA 4KN4C 4PV1C 1TKWB 3HUIA 5H8YE 3P7JA 2KACA 1BXTA 4PMBA 1GB4A 4O42A 3SXHA 5FKAC 3Q8EA 2WXKA 4FNFA 1XF5L 3HOZB 3KWVA 5JVG3 5AUIA 2IGDA 1WTRA 4K2LA 2OHFA 4NJCA 3S1MB 4A3BB 5IOCA 1YN5A 4M0WA 2HTME 2JA5B 3AMZA 2BA0A 2N0SB 4IURA 1DM0B 5JJZA 5D65A 3OPOA 2HDMA 1TQOA 3HOVB 2WKDA 3BVGA 1L0YB 1E2WA 4FVMA 1S5FD 1R4PB 2NVXB 3GTMB 2DBYA 1ROEA 3J80L 2A73B 5EE1A 1M8AA 4OZCA 1DOIA 4HKQA 2WXHA 1AP0A 5T1GA 4ARIA 3CHBD 4HMIA 4NKLA 3SEBA 1WTOA 4MT5A 1SJHD 3W5UB 4IFDJ 1WXQA 1HCZA 3DM1A 5C3XA 4BY1B 4OO1G 3HOUB 4S3SA 4HSPA 4Q0FA 4HCEA 1SE2A 2J7ZA 2O2LD 4J1MA 5C0XJ 1SMYD 3NWSA 2ZW1A 1C4QA 5CV7A 3TP5A 3NQTA 3EUB2 2F0WA 3MFGA 3MAQA 3PIP3 4A3IB 1D5XC 4AS1A 2FINB 2XIWA 2CW0C 2QJLA 4ZQ3A 3ITPA 1DOXA 4K5XA 3DHQA 1V1PA 4YSYB 5I9PA 2L52A 3JAML 2WB1B 3TN2A 2DWQA 3AEBB 4G7ZC 4TMAB 4BS9A 4RH6A 4FP5D 1GUNA 2PMVA 1TR5A 1H9MA 4CBVA 3FILA 2BYTA 2XRQD 1SNOA 2VUMB 1Y1VB 1AW7A 4KX6B 4LK0M 1PLFA 1TWCB 5JOBA 1O7ZA 4XTCS 1G8ZD 2VB3X 1NYQA 4XQQA 1OFFA 3S15B 3D4WA 1V8CA 1HQMC 4TQ1A 3PO3B 1MBYA 1QOHA 1SYGA 4E6IA 2PMZB 3HKZB 5I2XA 2F0KA 4DQOC 4PT5A 1M4VA 2WXPA 3V96A 4P16A 1ACCA 3FC4A 5A2QL 3S14B 1PGXA 2CJNA 1K8MA 3MFYA 1PZJD 4KKTA 2H89B 1XLPA 4CJ0B 5IGDA 2C9OA 3I9V1 2MP1A 3H91A 5CBEE 1YNNC 2JA8B 1UUPA 1S5DD 1LTTD 3Q8BA 1AEXA 1NAPA 2FFKB 3S9WA 1LTID 1DYQA 3M7NA 4HEDA 3RD4A 3BK2A 1KLUD 3TEXA 2TSSA 3I3CA 3EQLC 1JW9D 2VZKB 1ILQA 1T6BX 3P4RB 1LTAD 5EJWA 3U9OA 1O7YA 4L63B 4EQPA 2B2VA 3KUPA 2KECA 1V1PB 3A8IE 2XWJB 4CKEA 3B9JA 2A6EC 1BF4A 2L11A 3K7AB 1GUGA 2K5PA 2QSDA 1BBXC 2MEKA 5JEAH 4ZRQA 4DK1A 1V8QA 2F0UA 2EY1A 1LTBD 2L1BA 2BOSA 1DCZA 4KTAA 2Q8IB 1KRHA 2F0IA 2VZKD 4KJOA 5KNCA 5EE0A 1EYAA 2A6HD 3NBHA 1EEFD 2NB0A 3IT4B 1RWSA 4QUCA 3S2DB 1YQ4B 1TS5A 1YN4A 1EOTA 1B9RA 3MXPA 2KCNA 1F9SA 2AUJD 4XXEA 3ONAB 5M5XB 1ZE3D 1C48A 4KY7A 2B2WA 4NAMA 1STNA 1HZ6A 1RODA 4C7ZA 1WRIA 3T13A 5C3JB 4K2KA 3KBGA 1VZ7A 1FMAD 2FE8A 2JEBI 1EZ8A 4ZHPA 3KLSX 2M56B 4HEA1 1W6KA 5IT9E 4TRDA 3R93A 3SR1A 1LV9A 1EIGA 1KNEA 1FCCC 2ZT9C 1STHA 4ABNA 2GA4B 1VRAB 4ZK9B 4US8A 2E2DC 2EELA 4KKIA 2EOTA 1I4QA 4OGQC 2IW3A 2OEOA 1OXTA 3AN1A 1RM6C 1A70A 3TSSA 2F0MA 2PLPA 4C2MB 3TEYA 1EWHA 3S1RB 4ZHOA 2KQ4X 3T16A 2Y5CA 2K05A 3IL8A 3PZ7A 2Q5WD 1OXSC 1RF2D 1F0ZA 1FO4A 1K51A 2XVSA 2QCPX 1H9SB 3VYRA 3BZDB 2CQAA 1IW7D 1STBA 3P1MA 4OVZA 3QWNA 3NBIA 3HOXB 4N9TA 2WXRA 2TMPA 2H4OA 1BCPC 4QUFA 5C0XI 1DOYA 1RD9D 1JC7A 2A6HC 3DXJC 3PO0A 5KNBA 1X3QA 3UI2A 3J80E 2FMMA 1VJKA 4RGMA 4P2CB 3OIPA 2YEPF 1JR0D 3C1FA 3ZQ4A 4IFDI 1GXDC 2DY7A 4HSVA 4A3GB 1SE4A 1QG7A 2BW2A 4B0MA 3M7GA 1LTSD 3HRZC 2RDFA 4BBSB 2OXPA 4OO1I 1D4BA 1JALA 5BYSA 2CJOA 3BVZA 5FLXE 1ENAA 4C3HB 5A35A 1AYFA 5C5LA 2I38A 1QNUA 3Q8AA 5M5YB 2INNE 3N9YC 4US9A 3VR3A 1TKYA 4DA2A 1B50A 3BYTB 4JX1C 3NUHB 4BY7B 2VXWA 4N9PA 3Q8CA 3U9SA 3U2SC 1E2VA 2JSOA 3PIO3 3I4NB 3TBIB 1YNND 3TZDA 2RDHA 3GTOB 4KGSA 3S2HB 1Z6HA 3J7YW 2INPE 1Q1BA 1XLOA 5EKIA 1HFNA 2Q8RE 4KN7C 4DU9A 3V05A 4I65A 5ISRA 4DAPA 5I2YA 2R61A 5H92C 3OOCA 3PUXA 3CRLC 1Q1EA 2EY5A 5EBDA 1NENB 5CYUA 2QIEB 1MSHA 4NP5A 2X38A 4RKLA 5AFWA 4Y7NB 2RMMA 5CV9A 1IW7C 3Q24A 1QNKA 1C77A 2BT6A 2I07B 3URYA 3C8YA 1U4LA 1DOMA 4B9WA 4KY6A 4MM3B 3ZGZA 1Q90A 3WOEA 2YU9B 4B9XA 4RCNA 2NWGA 4C3JB 4NAWB 3E56A 1O80A 3LB8C 1LO5D 2DNEA 3D4RA 2SAKA 4RAUC 2K32A 3H94A 2PQEA 1WCMB 3T4AC 1B2TA 4A9AA 1DGJA 2PZUA 2LHDA 3ND8A 3W2DA 3E9SA 1TVXA 1IYUA 5KRUA 2O5JC 1SNDA 2LFIA 1TS2A 4WWMA 3HS0C 2M2LA 4XYQA 2ID0A 1I4HA 4MN3A 1STAA 3FKIB 3AE1B 2V4DA 1RJTA 2PO4A 5KYIA 3I72A 4YTNB 1XLNA 3L9AX 1JWMD 3MZ5A 4IKGA 4RGNA 1HPCA 1WTPA 4KGTA 1PZKD 3VR9B 3K5OA 2EYPA 5IGFA 1S5ED 1L0VB 2BB5A 1BQQT 3GTLB 1SYFA 2J53A 2K04A 2N9LA 4B0EA 2FJ2A 2BDNA 1FXAA 3NVWA 4J6HA 2K01A 1U4RA 1SNMA 1F2ZA 1FXIA 1CZPA 5MPOA 2L9HA 2KEDA 3RZDB 1BO0A 1TY0A 2C5CA 4RGTA 4LJZC 3UI3A 4CGYB 5C2TB 1J7BA 1SYDA 2WDRB 2JE6I 5KNDA 1WSPA 1CQVA 4JE3B 3GTPB 2FMCA 4XIGS 2D2CC 4WQMA 1LT4D 3HZXA 4DGZA 1MI2A 4WURA 1PTOH 5CGKA 4PMCA 4RFBA 1ZOYB 3DWMA 4XWWA 3KK7A 1QJOA 3W3AA 3D8GA 3EVQA 1R7SA 3QOLA 4BWGB 2Y5PA 1VMPA 5E3FA 1L5PA 1UEAB 2NVYB 1F2LA 2QILA 2K5DA 5C5MA 5DAUA 2Z4HA 2Y0SB 3VR2A 2BE5C 1C78A 4NZLB 1XO3A 2LFNA 3ERQA 4TQUS 1K52A 4BA1I 2PVGC 3FPPA 1TJEA 1WTQA 3DEOA 2IGHA 1JWAD 4ZUJA 2JYTA 4N6EB 1QQRA 4WH4A 1NYRA 1OXUA 2DNCA 1Y69U 1STYA 1EM7A 1IKMA 3JAME 4JPSA 5IGEA 1VF7A 3C2PA 2LMCA 1AN8A 3H0GB 3L7ZC 4ZYSA 3KWLA 1EU3A 1FR3A 1RFKA 4N58A 1FNWA 3AEDB 1QILA 2WXLA 2O4XA 2Z4IA 1OQRA 4G7HC 2LJIA 2B8FA 1GB1A 4IFDG 1F2RI 2PNRC 2GI9A 1E10A 1C4PA 1FFVA 3MTSA 2SOBA 5DM73 4XDDA 4J8QA 2XNAC 3BDLA 2F0JA 4MACA 1WWTA 5CV6A 3KF8A 3AEFB 2AQ3B 1BDOA 4X3TA 1G6ZA 3EGRA 3BK1A 5C0XG 1Q3LA 3AE9B 2CHBD 1CZWA 2CW0D 1HEZE 2B2YC 1HUNA 4HAEA 2PZTA 2XRSD 5CV8A 2LKVA 1DOKA 3RFZB 4XYOA 2JA6B 2I46A 2B2TA 3A8KE 1BCPB 2E6XA 4DAYA 2PIAA 1LLRD 3X3MA 4RKBA 4H7BA 4IUUA 1N61A 1J7CA 2IX3A 2J52A 4GDLB 2K3UA 5CMDA 1XYIA 2ICIA 1J8IA 2RBMA 4KI0A 3BIID 1X3PA 2NN6H 1UGJA 3VR5A 1N63A 3E5SA 2V4IB 4KJNA 5DM63 3VYTA 1Z47A 3D3RA 1L4ZB 5G5GA 4XT1B 3A56A 4RGOS 1ZDXA 2NN6I 2BE5D 3QIAA 4CKCA 1SAPA 4FF1A 5I9OA 4FXDA 3DEPA 1TZOA 2HDLA 4RF1A 2CU3A 4H2AA 4C7YA 1SDFA 1IGDA 4KGRA 3SK5A 1ESRA 3M3YB 3RZOB 3IAM1 1GUSA 1JRPA 4FXGC 5BYRA 3CWIA 1EY0A 1A3UA 3CQZB 1GHJA 2JYOA 1K50A 4ZLTF 2JYEA 2WS3B 2KN4A 5EPLA 2YEPB 1BUVT 4HR7B 5HHDG 3NSWA 2BS2B 4ID6A 3NRZA 4GLSC 5HI1A 5M3MB 4FF2A 3SK6A 3I4LA 1YNJC 4R8IA 5GXGB 3NVVA 2LUMA 1D1IA 3K5MA 3AE3B 1HHVA 4RF0A 1G2SA 2AQ1B 3PUWA 4CKBA 1QKZA 1FFUA 5KYLA 2RSOA 2JEAI 1D5ZC 3MHZA 3AV8A 2E75C 1VZ8A 5IGGA 1CFMA 3HEJA 2OT2A 4NDXA 2E2JB 2IX0A 3NQIA 2L0CA 5C4HA 3MXUA 1KNAA 2G1EA 5D3DA 3J81E 2M00A 1U4MA 2BS4B 1SYCA 3F2UA 5EGTA 1CHQD 3KBXA 2LMCB 3SR6A 2L12A 1B9MA 1QF6A 2J4XA 3R3OA 3C46A 2VB2X 5CR3A 1ZXTA 4F7XA 2PKOA 2K28A 3AE4B 1TKEA 1DJRD 3B2GA 1EFID 2QEJC 1K53A 2WDVB 4NW2A 4Z9CB 1QOBA 3AE5B 5G3LD 3E0JA 2RQXA 3NK9A 5FO8B 2A69D 2NYZD 2N9KA 2A74C 2BTEA 1TWFB 3D6CA 4K8IA 4Q5VA 1A3TA 3NTKA 4X3UA 1VDVA 3AE7B 1CI3M 4A93B 1MD2D 1YJIA 1QB5D 3QG1A 2WIIB 5E4WC 5F2DA 5JEAG 1E7PB 1LTRD 4C3IB 1CA6A 1UWXA 1ZYRD 1PFNA 4LAAA 5K36H 1X32A 3U4EG 2ZXRA 4Q2JA 1ZUD2 2LEKA 4RHSA 5HURA 5JPNC 2I2YA 3LNNA 4FF4A 2WNMA 4M8AA 5ELEA 2EYJA 1C79A 5DNFA 1DXMA 4JBWA 2V3PA 4HCSA 1B53A 4KV6A 3J7AF 4ILWA 1L0XB 4CJ1B 1AZPA 1VR9A 4ZKBB 2KJXA 1LTGD 1V1OA 1EY7A 3LX0A 2JP1A 3T53B 4QMGA 3ZJTA 3TMEA 1I4XA 1ML0D 5M3FB 2EXZA 2ON8A 3VR6A 3I57A 2EYFA 5E1FA 2L1AA 2Z1CA 2RPVA 4QIWB 5JXVA 2K1BA 3I73A 1JOQA 3P4PB 1A6XA 3RLFA 2KCCA 5HG2A 4MHEA 4MIUA 3W5VB 1IYVA 1R9TB 1PTOB 3PZ8A 5K5PA 1VZ6A 4HRSA 2KEEA 5AUKA 2B2YA 3L3OC 5C44B 2L5TA 4KKUA 1SNQA 1CJEA 1JE4A 4KKSA 4KY5A 3T51B 1WTXA 3W9CB 2NTTA 4YIJA 2R93B 1ZKOA 1ZXHA 4H0LC 2K5WA 1ZDVA 2O5IC 5C4XB 3OSOA 4IUTA 2F0OA 5JEAJ 5IIFA 4PQXA 1B44D 2KDMA 1F9QA 2DYMA 2F0HA 3ZJUA 1SE3A 3SE0A 2GB1A 1D1KA 2WQYB 4C3IG 2PZWA 1PTOC 1PTOD 2NZ1D 1IHZA 1IBXB 1VLBA 3VYSA 1SNCA 2RA4A 3EJIA 3OWEB 4WJWA 4J3OD 3GS2A 1TS3A 2F3WA 3AE6B 1LT5D 3P42A 1YN3A 5BMHA 4GZYC 3H6MA 3Q69A 4HKZE 5FK9C 3OIQA 1H9RA 1MI0A 2B8GA 3DWAA 4RNAA 3H09A 3GTGB 1HFGA 2W55A 1NR4A 3T3OA 4RCOA 1PDXA 1DOLA 2X6LA 4KD4A 1N5XA 1J7AA 1EZ6A 2R3ZA 3A54A 2G9HD 1FM0D 1YJJA 2MJEA 3KLRA 3E6ZX 4OZAA 3FAHA 4A3MB 2JSVX 3FEWX 3C1EA 3TEZA 4JK1C 4JWSC 1E6EB 1A15A 3GB1A 1Q12A 3HG9A 4LK1C 4CHTB 1FNUA 4DN4M 1EQTA 2B2UC 4FXKC 2CVRA 5CC4A 1G2TA 1VMCA 2HQEA 5C4JB 2E2HB 1F2YA 4ZOHC 1B1ZA 1F9RA 1I6VC 3NVZA 2MJ3A 3D6WA 2IPKD 1EIHA 3Q6SA 2SNSA 2K9XA 3K5LA 1XLQA 4EQOA 4ZRPA 1ZXIA 1STGA 2B63B 3AM9A 1GUWA 1SBBB 4ZRZA 3CRKC 1MHXA 3PUYA 2MHVA 1AZQA 1T5XD 1PMRA 2HUGA 3NE5B 1JICA 1BNZA 2F3VA 3IXSA 4GDKB 2E3TA 3A8JE 4DFAA 1JQYD 3AU7A 3FMCA 2F0EA 3G7LA 5EBCA 1ZP0B 2FUG1 1VF5C 3DWPA 4L6TB 1FYCA 1MPEA 2J42A 2WXIA 3J7AV 4A90A 5C4ZA 3LWUA 1A3VA 3IT6B 1FD7D 5EE9A 1G291 1C4CA 2L55A 2KVMA 2HDEA 4ARCA 4YSZB 1EY6A 3K0YA 4DNRB 2F0LA 2ZW0A 4IDIA 3TP8A 4TQ0A 1R4QB 2BBCA 1TYGB 1IL8A 4U68A 2W3SA 1U4PA 4K14A 3MJ5A 5FR3A 4IUNA 4ITKA 2OEDA 1TWGB 2V3NA 2WV6D 2W82A 4F88A 3VQIA 1S5CD 2NMQA 1SEBD 3MWYW 1N5WA 3GTJB 4L8JA 3T56B 5KGUA 2F0QA 2B2UA 1NEKB 5EKKA 2WXGA 3K59A 2WU2B 1GUTA 3BVMA 2BCOA 1Q10A 4TSSA 1JMLA 3NPPA 2RSNA 3AEGB 3I70A 1PUTA 2ONQA 1VCIA 3P1HA 4QCLA 3EROA 3VR4A 1FRRA 2JZPA 1FD6A 5M9OA 2IJ0A 3Q8FA 4KHVA 2K33A 4QF4A 1QOAA 1E0ZA 5ELCA 2D62A 4OIKA 5E6JA 2IWHA 2EKIA 2EY2A 2F0PA 2RDGA 1Y8OB 2H88B 2A5HA 3NHHA 2F0NA 1MVKA 2RVLA 2JA7B 1I4PA 2KQ3A 5CV4A 2LS01 3HOYB 4K5VA 1DONA 1G91A 1XEEA 2NUCA 3X3NA 4A6QA 2K0PA 3U7ZA 4A8XC 2N55A 3ZYYX 4AYBB 1WTWA 1XCQL 3GTQB 2PW7A 1LACA 3AH7A 3AB9A 1I7HA 2XSCA 2IX1A 2HCCA 4XQJA 1D6EC 1K83B 1S4ZA 3CU7A 4G7OC 2KWDA 2WLBA 1P7FA 3DUZA 1QCBD 3OWFA 3J81L 1O7LA 2WAQB 2WXMA 1H9SA 5C3WA 3J9CA 4KMUC 1JQ4A 3VA5A 2F0DA 5C0XH 1L6UA 2EYMA 1RHPA 1QE6A 4RWSC 3SVMA 3HVDA 1UWMA 1KDAA 5EE3A 4CQNA 4ULLA 1CK1A 2K6AA 3LWEA 4IFDH 1HZ5A 2W54A 4BBRB 2IL8A 1HRJA 4A3KB 1BMLC 3ZJVA 1ESFA 4DXFA 4FXCA 3I91A 2PCFB 4UDUC 5FOBB 2WP9B 1EY5A 4ODGA 3GV3A 3HVZA 3IFDA 3DMUA 1LT3D 4K6LA 3TDQA 3N6RA 3SK8A 2X6GA 5D3IB 4K5WA 1TT2A 2K5QA 1GPXA 1STEA 4KHZA 1WYGA 1RTOA 1A2TA 2KOLA 4YT0B 4IN3A 2JQRB 1ZPSA 2EPBA 1PFDA 3MA2B 1SB3C 4OZBA 5TSSA 1HA6A 4K8JA 1W6JA 2B2WC 3IFTA 1Y1WB 2AWNA 5BYQA 1BOSA 1IGCA 3SFDB 1NSNS 1PRTD 2F0VA 2LY7A 2WACA 1CTMA 1WD1A 1CQFA 3AE8B 2HCIA 5G3LF 2K7VA 1GUOA 2DY8A 1KLGD 1F2MA 1CM9A 1XX8A 3QO2A 1OXXK 4A3DB 1Y8PB 3AMUA 4L1BA 3PUVA 1BR9A 1YMHE 3NS1A 3MHBA 2B2TC 2EJFC 3VRBB 4G4KA 4K6DA 5JVH3 1PFBA 2N7JA 1GHKA 1XWEA 5COYA 2A68D 3TEWA 4LTUA 1DZ1A 1E9MA 1ENCA 2NBFA 3K58A 4DK0A 1ILPA 1JORA 2H1EA 5FO7B 4YTPB 3RPFC 3MEHA 5CBAE 1TIID 4C1NK 2KAJA 5T8IA 4MH8A 1N62A 3S16B 1HTPA 4L23A 2R92B 3V2TA 1HUMA 1SYBA 2FBWB 4V0BA 2XN9C 4RHRA 3Q23A 3KLSA 2D5GA 4N59A 5K36G 3EFXD 1FCLA 4IUVA 2WU5B 1QLBB 3SHLA 4P6VF 5BN3A 1T3QA 1SSOA 1OQQA 1SIJA 1VDZA 4FO2A 5ELDA 3EA6A 4A3EB 1QWYA 3WDNA 1FNVA 3IKJA 5I6WA 1KDBA 3SK4A 1B9NA 2E2IB 3A7LA 3Q22A 2MUYA 3LXFA 4IALA 1TY2A 4ZKCB 2QMTA 1LT6D 4A55A 2EJGC 1PXUA 1I6HB 2DYOA 3AECB 5HGTA 1EQVA 1EYDA 3FILB 3OMGA 2GRIA 1QT9A 2V0GA 1I3QB 3RUZA 3M4OB 3HOWB 4C3HG 1TU2B 3BWUD 3M4YA 1F2RC 2ICEC 4OW0A 1Y56A 4HTHA 3BDOA 1FRDA 1JWUD 4TKOB 2E74C 3AEEB 3BDCA 5E4XA 2F0FA 2K22A 5FLXL 1L6VA 1HTLD 1I4GA 1NCVA 1N60A 1RDPD 1RKNA 4EE2A 3ETRA 1CZGA 2Q8TA 3TP7A 1CHPD 4HMJA 1PTOF 2AQ2B 2WP8J 1SF0A 3BS1A 5J1ZA 1E0BA 5D7GA 4IOIE 3P63A 3B2FA 5LL6S 1QOFA 2EVBA 3TP6A 1Y8NB 3PO2B 2F0TA 4FF3A 1MHHE 5IGBA