1V1PA

The structure ssl from staphylococcus aureus from an orthorhombic crystal form
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
191
structure length
191
Chain Sequence
HLHDIRDLHRYYSSESFEYSNVSGKVENYNGSNVVRFNPQNHQLFLLGKDKEQYKEGLQGQNVFVVQELIDPNGRLSTVGGVTKKNNKTSETNTPLFVNKVNGEDLDASIDSFLIQKEEISLKELDFKIRQQLVNNYGLYKGTSKYGKIIINLKDENKVEIDLGDKLQFERMGDVLNSKDIRGISVTINQI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virulence factor
molecule keywords EXOTOXIN 1
publication title Structural Relationships and Cellular Tropism of Staphylococcal Superantigen-Like Proteins
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 49
structure length 191
sequence length 191
ec nomenclature
pdb deposition date 2004-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
A PF09199 SSL_OB Staphylococcal superantigen-like OB-fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1v1pA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1v1pA01
1AN8A 2AQ2B 4C56C 3TSSA 1BCPF 1FNUA 1BCPD 4Z9CB 3O13A 4NZLB 4TSSA 2QILA 2XRSD 1D6EC 1BCPB 1FD7D 1KLUD 1JQYD 3V05A 2RDGA 4RGTA 1EEID 2CHBD 2SEBD 3DWQA 1JWMD 1QILA 1LTBD 1SE2A 4BWGB 1HTLD 2J4XA 1SJED 4L6TB 1SE4A 5ELDA 1T5XD 1CK1A 4K6LA 3R8BA 4RGMA 1HQRD 1LT4D 1D5MC 1YN5A 1FNWA 1KLGD 1JCKB 1YN4A 1LT6D 1L0YB 1LTSD 1LTGD 1D5XC 1PZJD 2Z8LA 1JR0D 1F77A 4O1NA 1BCPC 1V1PB 4RFBA 4RGNA 3SEBA 1EEFD 1PRTF 4DXGA 1PRTD 2NTSA 1ET6A 1L0XB 1LO5D 1V1OA 1LTRD 1EWCA 2WV6D 3MFGA 2ICIA 1PRTB 4RHRA 4ZYSA 1XXGA 1RF2D 1STEA 2XNAC 3BVMA 4RHSA 1S5ED 1S5DD 2QEJC 1B44D 1B1ZA 1FGBD 1KTKA 1SJHD 2NTTA 5D3IB 1LTTD 3W2DA 3DWAA 2RDHA 4L63B 2XN9C 1RCVD 5TSSA 3KLSX 2TSSA 4RGOS 3BVGA 1I4PA 1JWSD 1EU4A 5ELEA 2XRQD 2AQ1B 1TY2A 1I4XA 3GP7A 1ESFA 3EFXD 4OHJA 5D3DA 1PTOF 1PTOD 1CQVA 1PZKD 1EFID 1UNSA 1FNVA 5FKAC 3URYA 1PRTC 1S5FD 1TS3A 3CHBD 5ELBA 1PTOB 1CHQD 4RH6A 4RCOA 1RDPD 2O2LD 1I4QA 3BYYB 3OWEB 1PTOH 1ENFA 1ET9A 1CHPD 3BVZA 1TS5A 1TS4A 1UUPA 3EA6A 1I4GA 3DWPA 5ELFA 2G9HD 4DXFA 1LT5D 3R2IA 1LTID 1LTAD 1AW7A 1G8ZD 1I4RA 3BYTB 1HXYD 1HA5A 2R61A 1DJRD 3MC0B 5ELCA 1EU3A 1RD9D 1YN3A 1LLRD 1TY0A 1SE3A 1DYQA 1S5CD 1BXTA 1M4VA 1D5ZC 5FK9C 1SEBD 1SXTA 3BZDB 1PTOC 1LT3D 1V1PA 4UDUC 1PYWD 1JWUD 1PZID 1I4HA 1XTCD 1SBBB 1TS2A 1GOZA 3R2TA 5I4DA 2IPKD 1CT1D 1MD2D 2IJ0A 2AQ3B 1S5BD
chains in the Genus database with same CATH superfamily
1BCPF 4LUVA 4ABNA 1C8CA 1ZXTA 3O13A 3BY4B 2ZTEA 3Q8DA 2O4XA 2EELA 4BFRA 4ULLA 4LFAQ 1UEAB 1BCPB 1MFWA 3DHHC 1FO4A 1OXTA 1W6JA 1R4MB 4RGTA 2UXBQ 2CHBD 4WWNA 3WANA 4DWFA 4QL5A 2R93G 4FVMA 3FRPB 1XYIA 4AQYL 2MP1A 5M3FB 2JZZA 4NJ7A 4DHJB 2OHFA 4JWSC 2ZXPA 3A9KA 4A93G 5M3FH 1I7HA 2PIAA 3IHPC 1RWSA 2WX0A 3T56B 3M85A 2QJLA 1A3UA 5M3MB 4HEDA 2A6EC 1T5XD 1VQNA 4ALPA 2MBHA 5DM63 3I63C 5M3MH 1G2TA 3PRPB 1FNWA 4C3JG 1NBFC 4YHHL 2Y5PA 3A8KE 1G6ZA 2RVLA 3I4NB 1PZJD 1JR0D 3M7NA 3X3MA 1D8LA 2B29A 3I4NH 2R3ZA 2O5JC 2FNJB 2X69A 4YCVA 4A3CH 1PRTF 4LNKA 1II3A 4LUOA 2Q8IB 3AULA 5H92C 4AOFA 4A3EB 3DBSA 1B4OA 3I8ZA 1Y69U 3HOVB 4I6PA 3ERSX 4AWJA 1LABA 1N6ZA 1PRTB 3CCSA 1VQJA 4A3EH 1HRJA 3HOVH 2SDFA 2C5CA 1X56A 5JAVA 2NVXB 1NAPA 3PO2B 1O7YA 1VQMA 2YVCA 1X32A 1WFYA 3L4PA 1UWXA 3T4AC 4K5VA 1U4MA 2NVXH 3SGIA 3M4YA 1WTVA 3S15B 2IHFA 2Z1CA 3PO2H 1LGRA 4RCNA 1OTRB 1L2NA 3J81E 2D9UA 2W55A 1E5WA 3A9KB 5CMDA 3S15H 2LVQA 3LWUA 5BN4A 3RN2A 3M63B 4L2YA 5JVH3 2WAQG 1XQQA 3ZIMA 2J0TD 3NG0A 2WB1E 4PZ8A 4LMQD 1FXAA 1VQFA 1TY2A 2E76C 3AEEB 3OWFA 4JVZA 2H1EA 1CQVA 1P16A 2CWPA 1D2BA 2KXJA 1PFBA 2ASBA 4AUQC 4REZA 1GUSA 1IZ6A 3HOWG 4R8NA 3CPFA 1XMOQ 2E2IB 2XVSA 3DEOA 4RH6A 4RCOA 2O2LD 2ZW1A 3AEBB 1NEKB 3OWEB 1EWYC 3Q8FA 4ZRQA 1FYCA 1ET9A 2E2IH 1FRDA 2LGIA 2LSSA 1MBYA 1TGZB 1WM2A 1YD8U 1Y1VB 4DR1Q 5AZGA 2F4IA 2ES2A 1I6VC 1VS0A 5CV4A 3R2IA 2IGGA 1Q46A 1LTID 1Y1VH 1VQ9A 1TZOA 4A3OA 4HKZE 3VA5A 2IX3A 3HOUG 3PPAA 5E1FA 2YEPF 2B63G 4ZAIA 4JBWA 1EU3A 3T1HQ 4MHEA 4LDTD 3A4SC 1S5CD 2YEPB 5EBDA 2V1YA 2A69D 2AUJD 3VDYA 4B3TL 2KTFA 2K3UA 2RMMA 3HKZG 2PNHA 4DPGA 2UXCL 2JPHA 4ZHPA 4M1UB 2ZXRA 4JBKA 4DR5L 2HDLA 1I4HA 4I6NB 1I5FA 4DV2L 5M5XB 5CV9A 4RMFA 3TMEA 3CCUA 5AUIA 2ZJPA 2R7DA 5M5XH 2KC2A 4WAFA 3CQZB 3TP7A 2K6QA 3ULPA 1E90A 3T9LA 1Z47A 4JI2L 1IGDA 1E2VA 1J8CA 2ACZB 3L10B 2JSOA 3CQZH 4GGQA 1B70B 5EAYA 1RLFA 1R4QB 4IOCA 1A63A 1WY8A 5EGTA 2WDRB 3A54A 2L1AA 2QKIC 4A3PA 2KDBA 3H6NA 3D8GA 3CCJA 3ALBA 2KHSA 2MJ3A 4A3IB 3RMKC 2DENB 2K6DB 3NP8A 2DNCA 4BBRG 3ZRFA 1YNNC 4A3IH 2L0CA 2NZOA 2JT4B 3NTHA 2J7ZA 2Z4IA 1J7CA 3EJIA 2WXFA 4RGMA 4P72A 2K5NA 2XWJB 4ZYNA 1LT4D 3VHTC 5GXGB 1YEZA 2JK8A 4R9WA 4GOPC 2F0QA 2HJ1A 2L8JA 4BBSG 1LTSD 3PF5A 2J53A 2H89B 1B9NA 3OJ4B 4NAWA 4DGZA 4FBJB 1IL2A 2MBQA 4X3UA 1VQHA 4JG2A 4WJ4A 1V1QA 4IWOA 2EJFC 2IGHA 3KQ4A 1ILPA 2BPSA 4X3TA 5E4WC 2LXCA 4G7HC 3NWTA 3HRDD 1WYWB 4ZUJA 4JOIC 5LMUL 1C77A 2XIWA 2BVCA 2D0OA 3NS1A 3UQBA 2BOSA 1H9KA 1NUCA 4P6VF 2MH7A 4DK0A 1WR1A 2FJ2A 2MRPA 5IP9G 3RULA 2WKDA 3K9OB 4W9EA 5GAGC 1NNXA 4JWUC 4F8MA 3PVLA 5CHWA 1B1ZA 1FGBD 4KZCA 2PW5A 3WOFA 3K81C 4IUVA 2F03A 2REXA 3SD5A 3IBEA 2FCQA 1HQMC 1HR0L 3FMCA 5E6NA 5JOBA 3CCEA 1WTOA 2E74C 4H7BA 2KQ7A 4MGYE 3IKJA 4DK6C 2C9OA 4PQXA 3HZXA 4W9HA 3C2PA 2PZUA 1ACCA 4A3FB 1ESFA 1X55A 4XDCA 4AJYB 2D62A 4X3SA 3FKIG 2JE6I 3SHLA 4OWWB 1PZKD 2C7NB 2LJIA 4A3FH 3RPFC 5JZEB 1GVPA 4Q0FA 1X1MA 4IFDG 1QKZA 1WD1A 4K1RB 1DOLA 1PV4A 1JE4A 4J15A 4MTKA 4CDDC 1XNQL 3HOYG 1SF0A 4NAWB 1I4QA 2KCMA 4JC0A 3TMPB 1PMRA 1G2SA 1PH1A 2RSNA 1A6XA 5I9PA 2JA5G 1SYBA 3DVGY 3DWPA 2NVTB 4AJWA 3STBD 1EY0A 1E2WA 1W6KA 3CU7A 3NUHB 2LRUA 2NVTH 4X6AH 4O0AA 3OW2A 4K7UA 2VH2A 3S1RB 1DJRD 2MUYA 4DR7Q 1UZXB 2ZJRA 4A4IA 1Q7YC 5T8IA 4RWSC 2KNBA 2J0KA 1LLRD 4NQKE 3S1RH 4JCVE 3E0EA 4K8IA 5M5YB 3WIMA 1QOHA 2AL6A 2D07B 1M4VA 3M4QA 3W1GA 3JVZX 2Q2IA 5M5YH 1HZCA 3OMCA 1YIWA 4B3SL 3RYTA 1BF4A 4BXXH 1MKHA 3PT2B 2A8VA 1V2YA 1XX8A 5HFYA 2G9DA 5J39A 3DOWA 4WURA 1HPCA 1QE6A 1IBML 3CRKC 3R7RA 2PI2E 4GN1A 5CC4A 5IWAL 2IW3A 1C79A 1RFAA 5EKLA 3E6ZX 1N36L 2FAZA 4JPBW 2WP8J 4ZRJA 3ZNGC 5LL6X 1FD7D 1O80A 1STGA 4DUYL 3AECB 1K73C 2KOXA 1FJGL 2UU7A 1IYUA 3KF6A 4IFDJ 2R2OA 4PS8A 3TS2A 5CBEE 3PF4A 2ICEC 2W9NA 2A69C 1BMLC 1O7IA 4J6IA 2DNEA 2V4LA 5ELDA 1YJ1A 4B3MQ 4ZRIA 4FF4A 5IE8A 1ZXIA 4XE0A 5DLQE 5C3EB 2L3ZA 2WLBA 4YCWA 3RZDB 4KHVA 1I94L 1WVLA 3CMAA 1NDDA 5C3EH 4KDLB 2I2YA 3RZDH 1XCQL 4L5QA 5L37A 3V96A 3Q3MC 4M0WA 2M17A 1DOYA 1TU2B 1O7ZA 2F0GA 3BU2A 4BS9A 1XLQA 5CHVC 4H44C 4G11A 4HN7A 5IIFA 1U4PA 2HD3A 4X64L 2PE9A 2EYFA 2O6VB 2LXJA 3CCLA 1FXTB 1YNJD 1WMHA 1EIYB 4FJZA 3BVMA 1GUTA 1S5ED 1GAQB 1A70A 4DR3Q 3L16A 3G7LA 4OO1I 1V43A 3CKIB 4HCEA 1I42A 2JWUA 4MGKE 2H88B 3GTLB 2FCMA 3KF6B 2L11A 1J5EQ 3U7DA 1HTOA 1V5TA 3ZXVA 1MSHA 5L83A 3TN2A 2QA4A 1WJ4A 3WAMA 4HLEA 1XNRQ 3GTLH 2HQEA 5T1IA 3TP6A 4LNFA 2XRQD 3CC7A 2V1CC 4OHJA 5GAHC 1YJIA 5KHOA 2WAQE 2CVRA 2FMMA 4ARCA 2WDQB 1EYCA 1QB5D 2N0SB 2WXLA 4YWLA 3Q0AA 4MELA 1GB1A 3C3LA 4LF9L 2HE7A 5IOIA 2KBNA 3VYUA 3A5UA 4DV4Q 4M0WB 4DU9A 1WJNA 1RODA 4V0BA 1X3QA 1V81A 2WS3B 2LWPA 4KTAA 2E5LQ 2NBUA 3EHVA 3V6CB 4WJWA 1WMHB 2K5PA 4LK0M 2ASQA 4DAVA 1E8XA 4K6DA 2J0JA 4X66Q 5L95C 2NYZD 5IAAC 3CWIA 3VR3A 3IRBA 4LAAA 2VQEL 3SU8X 4EZLA 4LF6Q 2KVZA 4A3MG 1E7VA 1YHQA 2BS3B 2GLSA 3LYYA 2RHQB 5E6JA 4DV7L 1YNXA 1U4RA 1V1PA 1XLNA 2FIDA 3K5NA 3APFA 4KSKC 4M01A 5JEAJ 3ZDTA 5J18A 3HKZE 4ODGA 1SBBB 3H3VC 4A9AA 1DONA 2IJ0A 1UE1A 4IKGA 4C56C 2KT7A 4IOIE 4US8A 1WXQA 1JC7A 3UIPB 4XC2A 1ZDVA 4XT3B 2E2DC 4XXEA 2L0FA 1CI3M 1VCBA 2JYEA 3STBC 3UE0A 2MGSA 3DBRI 2Y0SE 1Q81C 1C0AA 3UINB 3V60A 1NMGA 2B2UA 4HVBA 1GB4A 2SEBD 2O6VD 3NVYA 1FFUA 3BZKA 3I56A 2Q5WD 2NB0A 3FEWX 3S1QB 1NENB 1FGUA 2IO3B 5BMIA 4JI7L 5FLXE 2HIXA 1GM5A 1EUJA 1VMCA 3PTFC 3V6EB 1OTCA 3S1QH 2EKIA 2MJEA 3AEFB 4ANXA 1F2LA 1O78A 4JE3B 2BWFA 3BK1A 1VCIA 1ZKOA 2PPHA 5AZFA 3U58A 4C7ZA 5FJ8G 3WWVA 2R92B 2KC1A 2MP2A 3MA2B 4XTCS 1C76A 5FR3A 1LT6D 2WXPA 1WX9A 1X9NA 2BWES 2HCIA 1ZP0B 2WQYB 2R92H 5FLMH 1EUVB 4F88A 4HK2A 4LLGM 3KLWA 2JA5B 1V1PB 3BS1A 4PG3A 2K05A 3DVNV 1M1KC 2ATWA 3NS8A 3M9BA 4LJZC 2BS4B 2A6HD 4UHVA 2LI5A 2JA5H 3J7YW 1V80A 1O7LA 2NTSA 4HIDA 4KY5A 4QJFA 3H15A 3HFZB 4A3GB 2FCSA 3CF5A 3GS2A 3ZJYC 1AZPA 5K36G 5G3LD 3L7ZC 4AQYQ 4JI1L 2HT1A 2D3CA 1VQAA 3N30A 4OONA 2HQLA 4JI4L 3N1ZC 2ZZPB 1E3PA 3I2ZA 2VY3A 1V8CA 3F1ZA 4TV3A 5C5MA 4QGUA 5DEHA 4RKBA 1R7SA 1NE3A 2ONQA 5COYA 2ZJDA 4JI6Q 1EZ6A 2I38A 2M4NA 3KLSX 2FE8A 5AJ3L 1DGJA 5CR3A 4DAMA 4LWCA 4YHHQ 3CCRA 1XEEA 2D3GA 3EBEA 4LNNA 2F52A 1TVXA 5IYCG 4GIVA 1KAAA 2O5IC 2XGTA 5D3DA 4EQNA 4EEWA 3NEMA 2MP2B 2F0FA 3A4RA 3P1HA 4CDCC 3JYUA 4TUUA 3M3JA 4ACFA 1CKNA 2A5UA 5ELBA 1EIFA 1FR3A 1SYCA 1FVIA 2EYLA 2JF5A 2B76B 2C7MB 3W5UB 1Y8NB 1PDQA 4ZKBB 3NQTA 4N8FA 1WOCA 3I91A 1MG8A 3NXWA 1YNJC 1QVGA 3BG3A 1J9OA 1E6EB 1F2ZA 3SXHA 1R4MI 1VJKA 4HRSA 4RG1A 1WI0A 2DYMA 3Q6SA 1FD6A 3VTUA 2P5ZX 2WB1G 1LTAD 3E9HA 1X6OA 3J80E 1NI2A 1KABA 4APVA 3T16A 4G4KA 3U7ZA 3MC0B 2B2WA 4EUTA 4DBGA 3PUYA 4GKJQ 2BDNA 4EQOA 3LB8C 1IBLQ 5EKIA 2D2QA 1B3AA 5BN3A 4HEA1 4B0MA 3ER0A 1D5ZC 3BDOA 5C4ZA 3HM6X 3VXWA 3DCGA 2NVUI 5C0XH 3AEVA 4U673 1IBXA 2IO1B 1WGHA 3TEYA 2JN4A 3VR5A 1N34L 1K3BC 4CKEA 2IPKD 4DV1Q 3NVZA 1TWCB 1IUEA 2HTME 1CKNB 2XBBC 2D10A 1TWCH 1XPOA 3VUWA 2VQFL 1NYQA 3QR8A 1I35A 3JAML 1FL0A 2QMTA 1SE9A 2H5XA 2HUGA 2JA8B 1LTBD 4OO1H 1SE2A 2G4SA 1GUOA 3OHXC 4X65L 5D14A 2PO4A 2K4KA 4TMAB 2JA8H 2LJ5A 4J6HA 4GN5A 4EFOA 2K39A 1TZ1A 4MEMA 1N5WA 3P4SB 4B9KA 1I3QB 4KKIA 2UXCQ 1YN5A 5CTRC 5IT9c 2KO3A 1I3QH 2N9XA 3S24A 1YN4A 2C60A 4KD3A 4UAIA 1HZ6A 4LF5Q 3GTKB 1V49A 1LTGD 1XWEA 3PZDA 3AB9A 1MSGA 4FF2A 1QQRA 4EKUA 2EMTA 4EQ5A 3GTKH 3VYSA 3MC9A 4JI2Q 1WSPA 1JT8A 3NHEB 1VZ7A 1PUTA 1N32Q 4KZ0A 3NPPA 2Q2TA 5KYIA 1B8AA 1L0XB 1CSPA 4HCSA 4KMUC 3KBGA 4JI3L 1YJNA 1C7YA 3AE3B 1HTQA 2CKZB 2D0PA 1WWTA 2JYTA 3R3MA 3RZOB 5G5HA 1STHA 1SGHA 2QGQA 4ZKCB 4C3IG 1ILQA 3N6RA 2UUAL 3RUIB 2MBBB 3RD4A 3TZUA 1EY8A 4C2MB 3RZOH 1AARA 1E24A 1VZ8A 3MHZA 4C3HB 1I50B 1QLBB 4HDOA 4C2MH 2MLBA 1U4LA 4MT5A 4C3HH 1I50H 5AUKA 1PFDA 4N6EB 2QCPX 3PO3B 1BUVT 1OXUA 3J81i 1UF0A 2JRIB 3R3OA 4UP9A 2OJRA 3I9V1 2KD0A 1GUAB 2DNFA 2EMSA 1YHBA 5DNFA 1BOSA 3PO3H 1UAPA 3MXGA 3P75A 3E9IA 3KUZA 3N1XC 4K2KA 3CCVA 1PTOD 4FXDA 2A6HC 1ZW7A 2IT1A 2VZAA 3ONAB 1X3PA 1HHVA 4FP5D 1JRUA 3MWYW 2MJDA 5EE0A 1NI3A 4ANUA 3DBRB 4TVAB 4R4TA 4KHPL 4DV6L 5KNBA 5LMUQ 4A3JG 3A8JE 4IZ8A 2HDMA 1WJUA 3T53B 4PZ7A 1F52A 1K52A 1ESRA 3S9WA 4E6IA 2NN6H 1JOOA 2BE5D 4DNIA 1JRPA 4HJAA 4PS3A 5C3WA 5BYSA 1KLVA 2KKCA 2F0VA 4YTMB 2Z6KA 2PEAA 3DQVA 3F2DA 2DZKA 1E1TA 3FVQA 4W9LA 4JYAL 1HR0Q 5A35A 2EIFA 2L4NA 3FDTA 4HIMA 4PMWA 2WINB 1E7PB 1JMCA 2KCCA 1HUMA 3ZNID 3I73A 5D6JB 1GKHA 1ZYRD 4IUNA 4KV6A 4LFCL 3AI5A 4IURA 2VW9A 3I4MG 1HR0W 3E5SA 2SNSA 3A7AB 3NENA 1GOZA 3ZVVA 1B2TA 1EWIA 1XNQQ 3ZO5B 4X62L 1AN8A 2BA0A 1QOFA 2UUBQ 2B8GA 2D5DA 1YI2A 2NBWB 1T6BX 5CV7A 3L9AX 4HIKA 1KNEA 2GA4B 4DV3Q 3NWSA 1PGXA 2AYOB 1RIPA 1GJXA 1N62A 2KQSA 3P63A 2OQ0A 3JC66 3OTOL 1E10A 2M19A 1KDAA 1K3RA 1WTRA 3BK2A 3A0JA 3MEFA 3M62B 1DM0B 1HTLD 3Q23A 3K0YA 1QJOA 1Z7TA 3WDNA 1LQBA 1ZDXA 3QAQA 5LLIA 1IYFA 4Y7NB 1YQBA 3OPOA 2RQXA 2SNMA 3RD2A 3TBLD 4XZ4A 5GADC 2G1EA 5IYCH 2OTLA 3D32A 2B2TC 3PSEB 4Y7NH 4B3SQ 1AYFA 2A19A 1QWYA 1KFYB 1MG4A 3N20C 1HZAA 2VNUD 1HZBA 2N78A 4NAMA 1KQSA 2FXQA 2L5TA 3A9JA 5BO4B 4BKSA 4ASWC 2K1BA 1AFPA 3TP5A 2NZ1D 3PSIA 1TIID 2F3VA 1MJEA 1IBMQ 2Z59B 4TRDA 4K14A 1V8QA 3X3NA 4XWWA 5IYBG 5IWAQ 2AMCB 1VR9A 1S3SG 2DAFA 2PPBC 1EEFD 4HSVA 1DOKA 1KHIA 4HAEA 4DUYQ 2VUMG 2M9VA 3MXPA 2NZHA 3QB3A 1G51A 1WE6A 4X57B 2Z9HA 1CFMA 4I6LB 4NQLB 1FJGQ 2KA7A 1F9JA 2XNAC 1L6VA 1N5XA 3CSTA 2K9XA 3S16B 3AMUA 1HZ9A 4IUTA 3RT3B 1H8CA 1B44D 1BNZA 3PZ8A 1IGCA 5MPOA 3G71A 1Y1WB 3S16H 3RLOA 3ZXRA 3TREA 4I7ZC 2BYFA 4NP5A 4B3RL 1Y1WH 2HHHL 1UWMA 1EFWA 3ZJVA 1I4PA 2RGFA 4ANVA 2L76A 2HCCA 3PGZA 1I94Q 5IP7G 1UBIA 3P4QB 1P3QU 4QB4A 1T0QC 3PHXB 3FILA 1ENAA 2EKEC 2VZKB 2JEBI 1GD7A 2K5WA 3A9JB 3AE2B 5A2QE 2JA9A 5IP4D 3QCAA 3CW2C 2CHWA 3I55A 1RDPD 5D94A 2KWUB 3PHWB 3EGRA 2OWOA 4X64Q 3TRZA 4DR2L 2INNE 4JV5L 1GNUA 1ASYA 3SK5A 2EY2A 1UUPA 3LDZE 1VQPA 4WFN3 4CHKA 4FO2A 2OOBB 3NELA 4WJPA 4K0KL 4ANWA 1WFQA 1Y8PB 3BYTB 3ZKJC 2JZPA 5KNCA 2MSED 3C0RB 3IAM1 3KUDB 1VQIA 1R4PB 2XTIA 4GNXA 4TQ1A 1E0BA 1YN3A 5K5PA 1EO6A 3W1SA 2LD9A 1IBKL 2QDBA 2EXZA 1UGJA 2NBVB 2ZXOA 4YY3L 3BZDB 4KLKA 2F0NA 4BA2I 1PTOC 3TS0A 4ICVA 1Y14B 2V3NA 2ZJQA 4S3SA 1TT5B 2VS1A 2WXGA 1EOTA 2WWZA 1WD0A 2FHTA 4K5WA 2BCOA 4HCPB 3FILB 2RSUA 3ND8A 3Q8AA 1E7UA 1LTLA 2AL3A 3BZCA 3TSSA 2KDEB 4YWMA 2GVBA 1BCPD 3HOZG 4QQBX 1Q86C 3Q3NC 1VQ5A 3ITPA 4KJOA 4NZLB 4DK5A 2QILA 1WJJA 2I07B 2BE5C 3S1NB 5EBCA 4DHJD 4XQQA 2LKVA 3VTVA 2G3QB 1L0WA 4KY6A 3JAME 3ULLA 3S1NH 1FMAD 1JJ2A 1F9QA 3EVQA 4HJ7A 2LZ6A 5IGFA 1KRTA 3M7GA 3JW0X 1NY4A 4H13C 2VQEQ 4DR6L 3E56A 5HURA 2Q2HA 3NE5B 4P16A 1MGSA 3R8BA 1ZYRC 4DV7Q 4EZJA 2EOTA 4XDXA 1JCKB 1XMQL 3ZGZA 2LRWA 1OXVA 2Y0SG 3NVWA 1PLFA 4PMCA 4U68A 2LXKA 5ELOA 2IWHA 2UXDL 3SR6A 2QHOA 4RNAA 5J17A 2N7DA 4OZAA 2MFIA 3HS0C 1F1HA 4ILWA 1C4AA 4TKNA 2AWTA 1ONLA 4X3KA 4WIPA 3NY5A 1YQ3B 4I65A 1PRTD 5CX3A 4UY8C 4N9TA 2PI2A 1J6QA 4CGYB 1WXAA 2F0KA 2PKOA 1K0RA 5EPJA 5IYDG 4NW2A 3P7JA 3CF6E 3I5JC 3A33B 3H6MA 2INCC 4II3B 1XLOA 1YMHE 3P20A 4MN3A 2BT6A 5C3JB 2DZMA 3G6JB 4R3DA 2OF1A 4WORA 4JLCA 1KTKA 2CQAA 3W2DA 2WYQA 2AWOA 2RDHA 1WTWA 3ZTCA 4CBVA 2EXDA 3PCOB 3H91A 3D6CA 1DOIA 1PH8A 3F2CA 1L1OA 4CDEC 1AWDA 3MZ5A 1BR9A 4R4IA 4BY7G 1J19A 2ZT9C 3H0GB 1VF5C 2JJQA 3K5LA 3H94A 2BA1A 3H0GH 4LCDE 2PVOD 3PUVA 3SR1A 5KGUA 5E3FA 4LF8Q 1C4PA 1V5OA 1QZEA 4DR4Q 4JI1Q 4A3LG 1ENCA 1OEYJ 2B2YC 4XQJA 2QDFA 3VR4A 1GHJA 2PNRC 1S40A 2JU6X 1T0SC 1EQQA 3DM3A 1FRRA 4RA8A 1Q8IA 3GTMB 4MZ9A 1CMXB 3NVVA 3QIJA 4DV0L 3HG9A 1XO3A 2KHWB 2ZNVC 3GTMH 5CHFA 3VH4B 1EYAA 4RKLA 1EIHA 3KYCD 2N9PC 1SNPA 4A3DG 3MVVA 4FLHA 2EPBA 4CKBA 4ZRPA 4P1CC 2ZCBA 5IGDA 2R93B 3OYYA 3L3OC 2KJ6A 2KLCA 2VUMB 5EDSA 1JWUD 1PZID 1L1OB 5M9OA 3VYRA 1V86A 3RNAC 3NBHA 3R2TA 2R93H 4A93B 1HNZL 1L5PA 3KW5B 2VUMH 4BY1G 4RMAA 5EQ0A 3Q2AC 2WU2B 4JL9A 1W2BA 1FNUA 4FDBA 4A93H 2G5DA 4IUQA 3R93A 2MHVA 1X54A 1HFGA 1ML0D 5J22A 4UPAA 2CQOA 2K7VA 2XSCA 4PMBA 1UE7A 3PRMB 2K0PA 1BQQT 2KHIA 4C3JB 3DPDA 1NJIC 2QIEB 3AE1B 3J7A5 1TTNA 3EFUA 2E3TA 3HVDA 4BWGB 2YU9B 4C3JH 4JBMA 1KRSA 2MCNB 5H8YE 1A8VA 1KDCA 2RBMA 1OXSC 1M90C 2YU9H 3MFYA 1LXDA 3S2AA 1TT2A 4O42A 3ZW3A 1CZGA 1SE4A 2EY6A 2KEEA 2NVYB 1RYJA 1WXVA 1PVOA 4LF4Q 3NK9A 2HJ8A 1P9DU 1NR2A 2V0GA 3TEZA 2NVYH 1JQ4A 4ID6A 3U9OA 1N34Q 1IYJB 1WZ3A 3HVZA 1VQ6A 5J2RA 4ARIA 3UDFA 4IWQA 3RMHA 3V62A 2X6GA 1BCPC 1XF5L 2L7RA 1P98A 1QOGA 3CIRB 3NBHB 5AFWA 2OEDA 3B0AA 2VQFQ 4USAA 3BIID 1MIUA 3TZDA 4DAPA 1UE6A 2EJGC 2WAQB 3UI2A 2RHSB 4EQPA 5LMNL 1I6HB 2AX5A 4Q2JA 4DN4M 2L32A 3AE9B 4LF7Q 2MO0A 4X65Q 2MHJA 4RHSA 3TJPA 2KWVB 3VR9B 1I6HH 4DUZL 1HZ5A 1HH2P 3IVFA 4C1NI 3HOWB 4K7SA 3Q3OC 4W9KA 2PQAA 4OIKA 5D3IB 2WX1A 1LTTD 1WCMG 2BDOA 1VQLA 4WJ3M 3KF8A 3V61A 4BZAA 3CSFA 3HOWH 1B3QA 2BBCA 1UWVA 3PREA 5C0XI 3F2BA 2WXMA 3ZJUA 2KWCA 4IO9A 1L4DB 5JPMC 1QCBD 2JA7G 1I4XA 1V97A 4YSXB 3W5VB 4WJNA 2VXWA 1TKWB 4NKLA 1XTDA 3D4WA 3J7ZC 3FC4A 4RF1A 2KECA 1OQQA 3HOUB 3APCA 1L0VB 3B2FA 3AFQA 1ZUD2 2OXPA 1PRTC 2B63B 2R7FA 4WWPA 3HOUH 4JBJA 2XK5A 3U4VA 2B63H 3DDCB 2NVQB 5BN5A 2K32A 5JEAG 3PMFA 2J7QB 3HKZB 3VR8B 2UUAQ 2NVQH 1I4GA 2MQHA 4HSPA 5ELFA 2UUCQ 1HCZA 2G9HD 4DXFA 1N33L 1LT5D 1Q3LA 4K7WA 1BBWA 1SROA 3SK6A 1KJTA 2N1VA 1I4RA 1T5EA 2B3AA 1GUWA 3LXFA 4JI5Q 2BF8B 4H02A 2K01A 1Y8RC 2BQQA 4KIKA 4F87A 1ZEQX 3J80i 1DYQA 1GHKA 3CD6A 3T3OA 1EY9A 2PQAB 3FPPA 5M5WH 1BUIC 2QEXA 1R4NI 1EYGA 3KF8B 1SEBD 2PZWA 3MC8A 3TUOA 3L2PA 1TJEA 3N32A 1LT3D 1AE2A 1X3EA 2KCNA 2AWNA 3HGBA 3J7AV 2IY5B 1J7BA 5C44G 3B2GA 4MDKE 4ZDVA 4EE2A 1EM7A 4BBNF 3NBIA 4BOZB 3HM3A 2JQOA 1KAWA 3Q6BA 4KHPQ 4DV6Q 1XCTL 1F9SA 4BBRB 5JJLA 4M8MA 5TR5A 2N3SA 3PUZA 3ZYYX 5DM73 3LNNA 3GD7A 4HMIA 1H9RA 1E9MA 4NNJB 2CH4W 3E3XA 1MVKA 1SIJA 4PYZA 4BBRH 4YTNB 1YBYA 2XK5B 5EE3A 4KGSA 5EPKA 1HNXQ 1ZKHA 3T3NA 3V05A 1AZQA 2K22A 2RDGA 3KWLA 2K25A 1V6EA 4O2DA 2KMAA 2OJWA 5D7GA 1JWMD 1QILA 3QIAA 1GG3A 1WGYA 4BBSB 2K8CA 2HD5B 3ERQA 2ON8A 2ZPYA 3ML9A 4MH0E 4JYAQ 2K8HA 3J80c 4BBSH 3KJOA 2FCNA 1DXMA 4R8IA 2R2QA 3KWVA 1NSNS 2B2VA 3D4RA 1Z2MA 2ZTCA 4HPMB 4KIKB 1H9JA 2MPMA 3PO0A 5E4XA 1A15A 2BYTA 1N61A 3DEPA 4LFCQ 1KLGD 1SYEA 5JJIA 3RLFA 2L52A 3NTIA 5JJZA 1Z9FA 1C48A 4X62Q 3DLLA 4GN4B 3W9CB 1KIXA 2PVGC 4L8JA 4LFBL 4XYQA 4OVVA 5IP9H 4RFBA 1OQRA 2G45B 4QY7A 4A3LH 2N7EA 2GI9A 1A2UA 4OZBA 4DHZB 5IA7A 4DV5L 1N8RC 5LXIB 1ET6A 3CRLC 3NJTA 1LTRD 4K8JA 2NN6I 3G6EA 2ICIA 2OQKA 3MXUA 1EL0A 3GZNI 4WJQA 2PYKA 3F2UA 3K6OA 4FNFA 2R7ZG 2KDMA 4FYDA 2L05A 3KK7A 1VDZA 4QIWB 3PLUA 3R7QA 2X6LA 3FKIB 1G91A 1WGKA 5C3XA 2WHIA 4BOSC 5JPNC 3FKIH 1ASZA 2DJFC 3VTWA 3JSVA 3HOYB 1QT9A 4IFDH 2F0PA 1VQCA 4R4OA 4RGOS 3SK4A 3HOYH 2DLBA 4PV1C 5ELEA 5HKHA 3J81j 3CCMA 2XWBB 4C7YA 1N9WA 5IT9L 2JA6G 2J52A 1TWHB 4BY1H 3H09A 3EQLC 3DXJC 3L0OA 4RF0A 5IGEA 1TWHH 2DZIA 5GMVA 1S5FD 3OJ3A 1JOKA 1V9PA 1SSNA 5IKCM 3PIPA 1PFSA 2K28A 3I57A 4P1BC 4GB9A 3DHGC 3EROA 1TS5A 4A3KG 5EE1A 2DN8A 3FHWA 4YTPB 2UU9L 2LVPA 4IALA 4QMGA 1VDVA 3AN1A 3TIXA 1T0YA 4N8X1 3I4OA 4GKKL 2EYMA 4IUPA 3KDFA 4K5XA 2F4VL 1DZ1A 4WAAA 2Q8RE 2CW0D 5C4XG 1RKNA 1JB7A 3QK0A 2WU5B 3ABVB 4B3RQ 1Q1BA 1HJPA 1QG7A 2PMZB 4AYBE 3HOXG 4IUUA 1OFFA 1TYGB 3PUWA 2OCEA 3K59A 2INPE 4KKTA 2KQ4X 2MBEA 3K80C 2NPTA 3CMEA 5DPWA 1P8LA 1BBUA 4A3BG 4Y52H 2GN5A 3T8MA 4ICUA 3AE5B 4YWKA 2LUMA 4WWOA 1XTCD 1HTPA 1Q5WB 3P4RB 3L08A 2MNAA 4R4CA 1FCLA 5C4HA 2JXMB 4DR2Q 4JV5Q 4IM2A 4TSSA 1WXSA 3AU7A 4J1MA 4CHTB 3ZQ4A 5HGTA 2D3AA 4K0KQ 1KH0A 1YJWA 4KHZA 2KJXA 4PYUA 5E6OA 1N63A 3DWQA 4UP7A 3UDGA 4GLAC 4QAYA 3H7SA 1A3VA 4B95A 4IC7B 1QZHA 1PDXA 1ROEA 1C4QA 1SJED 1QVCA 3KDFB 4H0LC 1SFOB 4N58A 1IBKQ 3U52E 4E74A 4YY3Q 2NBFA 2WACA 1EF5A 4BKTA 3N52A 5CBAE 1SFOH 1OGWA 4KKSA 3J81L 1RRBA 3RNBC 5EJWA 2JVCA 3OOCA 3I7FA 4GS3A 4KI0A 1VQ7A 1IKLA 3MEHA 3GQBA 3M95A 4MSMB 1GXDC 1ZXHA 2NPTB 5M3FG 4EX5A 3TCAA 3PLVA 4HJGE 2BKFA 1PFNA 2G4DB 3U4EG 1JROA 2GBKA 1HFNA 3CPWA 1WH3A 3SDLC 2QC8A 2BYVE 2IX0A 1JOQA 4G57A 3A56A 3E9SA 1GO3E 4DXGA 5M3MG 2WXNA 1BBXC 2PCFB 4K3CA 3PIP3 4EOYA 1H9SA 1PGBA 4YXDB 4J8QA 1WI5A 3DMUA 4RHRA 2JQRB 1XXGA 2RSOA 3NZ3A 4R4QA 1RF2D 1XD3B 2OT2A 1SMYD 2NWGA 2KACA 4GLXA 4B3TQ 1MHWC 4DR6Q 4IG7B 1R4NB 2KTRA 1HEZE 2RKSA 3QOJA 4L63B 1WF9A 4DR5Q 2IDYA 3P2BA 4MACA 2Y3AA 4YWGG 4DV2Q 4A3EG 4I7AA 4IDIA 3BVGA 3HOVG 4IOAA 4NJCA 1XMQQ 1IBXB 4DDID 2E2JB 2UXDQ 2Z4HA 1HNWL 1K8AC 4DDGD 2F0DA 3T1YL 4IM0A 4GXBA 5IGGA 3PO2G 2E2JH 2KDFB 1U4AA 1DOMA 3S17B 4G3XB 4GOPA 4IQZA 4YL8A 2QDLA 1SE8A 4HPLB 4FJVB 3S17H 1YQ4B 1WM3A 4A3MB 4HMJA 1QOAA 1ZOYB 1XT9B 3CC4A 2KANA 3GOEA 4A3MH 1H9SB 4WJOA 4WQMA 2JUOA 1XJVA 1WX7A 4JOIA 1XLPA 2DUDA 1FFVA 2LFNA 2QSDA 3Q8BA 1HA5A 5I6WA 2F3WA 1YJ9A 1B9MA 3W5OA 4QUFA 1TY0A 1TIFA 2C35B 3RNCC 2AKWB 3QJZA 1RAXA 2WIIB 1A0IA 1SXTA 1Y1VG 1E8ZA 2LMCA 3IFWB 1BDOA 1PYBA 3Q3JA 3RI7C 3VAWA 1J5EL 3OIPA 3IT4B 1FIQA 3C8YA 2I5MX 4C00A 4ITKA 5I4DA 4ZQ3A 1XNRL 3P4PB 1MD2D 1P7EA 1QNKA 1YNTE 3R66C 4XWTA 2AQ2B 2JXTA 3GZNB 4DA2A 3W1BA 3M4OB 4BBNC 1LV9A 4L1BA 5FOBB 5EE9A 4HIOA 4Z9CB 4GOPB 4FADA 1JWBD 1VQDA 3M4OH 1E0ZA 4IJHA 4POGA 2O2VA 4HJ8A 5KHQA 3QQ8B 3P42A 2FIFA 2GMIC 4US9A 5T1GA 2CW0C 1EF1A 3HEJA 1J7AA 5FJ8H 2GBMA 4DV0Q 1K83B 1FXIA 2FUG1 1HUNA 1KOTA 5EPLA 3J81c 1KXLA 4DQOC 4DV4L 3JAMi 1L7YA 4P7IA 1F2RI 1K83H 4HTHA 2GOWA 3RCZA 4FF1A 1KF6B 1UE5A 1RTNA 2F0UA 2E5LL 1SDFA 3ENEA 4GU2A 1D3ZA 1SLJA 2KFKA 1IL8A 3QHTA 4BAXA 4IPCA 3KJPA 1D5MC 2K5DA 1PH9A 1MHXA 4FXGC 4K3BA 5K36H 4DK1A 1L0YB 1YHAA 2Z8LA 4M02A 2DY8A 4A3IG 1F77A 2YYZA 4LNQA 4GDLA 1E2ZA 1GUNA 5GAEC 3Q69A 4RM8A 1EZ8A 2GVAA 2N1WA 4LJPB 5D2MB 3S14B 1VMPA 4RAUC 3MFGA 3QX1A 4G0NB 1CUKA 2EZVA 4ZYSA 4LNIA 4HDQA 3S14H 5BYQA 1IXRA 1CM9A 3QO2A 4GOCA 3CAMA 3I72A 3K58A 3HOXB 1JW9D 5NUCA 1E22A 2O2VB 4S17A 5BMGA 1YX5B 1JALA 3AU5A 1S5DD 3HOXH 2AEHA 4F7ZA 2KMCA 3KVFB 5CGKA 1RM6C 4HCNB 1SNOA 2LGYA 4A3BH 3OAWA 1H9MA 1A3TA 2EYPA 3M3YB 4NPNA 2KQ3A 1VD2A 1RHPA 2KMMA 3ZJTA 4B08A 1IYVA 3GP7A 5DCNA 1F2YA 3M3YH 2L0TA 4C4VA 3I4LA 1TQOA 5IT9E 3DVNU 1F9RA 2WB1B 1N36Q 3O65B 4S0RA 2IBIB 3BJUA 3CHBD 4KK7A 3WA0A 1QZGA 1JE5A 4MSQB 4YIJA 1PH4A 3UF8A 3TEWA 1ENFA 5LMNQ 2B2UC 2K5VA 3IFDA 1TS4A 1SMYC 3MJ5A 2KZRA 3TL5A 1Q82C 4DUZQ 4A3FG 1YITA 1C9OA 1STNA 5C4JB 2KWDA 4CJ2C 5HHDG 4A76A 2FBWB 2DBYA 3QARA 5J1ZA 5LMNW 5CV6A 1R9TB 5C4JH 2CWAA 2VL6A 1SNQA 3RLNA 2KJHB 4PT5A 2MEKA 1SE3A 1WZ0A 1DCZA 4KY7A 1R9TH 1JWAD 4A6QA 3BDCA 4ME5A 5H1SE 4KGRA 2N7JA 3C19A 4LDTB 3WCQA 3H7PA 2FFKB 1TBEA 5CORA 3PRZA 1U5KA 3H1UA 3BDLA 2TMPA 3T13A 1PYWD 4DKAC 4OX9L 3D4DA 1S4ZA 4NXNL 3SDZA 3TDQA 2PQEA 4JI6L 1UBQA 2L83A 4FXCA 3AYHB 3K5OA 1G6PA 4C4VB 1L2FA 3KBXA 1LACA 4TQUS 3AM9A 4K81A 2F3IA 1D4BA 1T9HA 2WXKA 5BR8L 2BGFA 3AMZA 4HXDA 2NS5A 3Q8EA 2CH4A 4IN3A 2N9KA 4BXXG 2XRSD 1LFDA 3Q3FA 4L23A 2MA9B 4FN2A 1N33Q 3DHIC 2L12A 3H8HA 2ZVOA 2M56B 4W9JA 1JICA 2LGDA 4W9DA 3EFCA 3MJWA 4V190 2A68D 3SFEB 2KFJA 2GBJA 4RM9A 1SYFA 2V4DA 1QF6A 1WRIA 5I6YA 2CCZA 1QVFA 2CR5A 1CK1A 1K8GA 4W9FA 2CJNA 4MGIE 1TKGA 4KSLC 4KN4C 2Z0SA 5ISRA 4LF9Q 3UE1A 4NXML 2ID0A 1P1AA 1Y56A 3MTSA 4XYCA 4AP4C 1K8OA 1EQRA 1E1OA 4C3IB 3ZUNA 4NMZA 4GKJL 2UYZB 3H7PB 2LUEA 1IBLL 1WGRA 4O1NA 4HJ5A 3M4PA 4C3IH 3VVWB 3N1YC 2AUKA 3SEBA 2IY0B 1YIJA 3ND9A 1H4RA 3BWUD 2IX1A 4GMVA 3SHQA 4NJ6A 3NZUA 1LO5D 1EY5A 3NTKA 1U9RA 4DV1L 3DM1A 5C3EG 4XIGS 4HJ9A 4H2AA 1CJEA 1EY7A 1E8WA 4IWPA 2B2WC 3DUZA 2PMVA 1KL9A 3AEDB 2F0TA 1FM0D 2W3RA 2QEJC 5FO7B 3X23A 4GNXB 1F0ZA 3VR2A 4OVZA 1YX6B 1C4CA 4M8NA 3FKYA 1SB3C 2W54A 4NPSA 4AS1A 4A3JB 3NOBA 4QCLA 2F1MA 4A8XC 1TWFB 1CSQA 2K03A 1XPUA 4KDIC 1JWSD 4EGVA 3LX0A 3UDIA 2VZKD 3C1EA 3CP0A 1TWGB 1D1KA 5DAUA 2PW7A 4A3JH 1TWFH 5IO9A 4BKSD 3HUIA 4F8CB 2N4FA 4Q5VA 1PGAA 3W3AA 1TWGH 4LFBQ 1K28A 5FKAC 3KLRA 3URYA 5G2NA 4GZYC 3K8AA 1G291 4DV5Q 3OMGA 4YCUA 5GQOA 2F0SA 3AFPA 1PH2A 4B9WA 3N9YC 5KRUA 4OXPA 4LF5L 2DZJA 4JI7Q 2X38A 3GV6A 2RCFA 3J7AF 3IXSA 3KUPA 3H3VH 1QUQA 2KENA 1AW7A 1N32L 3I4MB 5EKKA 1A2TA 3K9PB 4G50A 3MP9A 4N9F4 3U4ZA 1HXYD 4IPGA 2MW5A 1Y8OB 4QUCA 3I4MH 1JMLA 4WH4A 4GLVB 2N9LA 2D5GA 4XDDA 4ZHOA 1STBA 1IW7D 2D3BA 1JB3A 1WXMA 3E0JA 4JI0L 5JXVA 4ZRKA 5FK9C 2FMCA 5FLXL 4LTUA 1TXYA 2EYHA 3KYHC 3I90A 1VQ4A 1VZ6A 4ZOHC 3A1QA 3RNEC 4IPDA 5C6AA 4CKCA 1C78A 2LHDA 3P1MA 1M8AA 1TS2A 2E75C 4JI8L 3TEXA 2VB2X 1S5BD 1L6UA 2E2HB 2IO2B 2KN5A 3PV1A 2C5LC 1Q12A 1K50A 4HR7B 4JI4Q 2E2HH 5AEKB 3IFTA 2K50A 3VUXA 4AYBG 1YJJA 3MTNB 2UU9Q 1SYDA 2JWZA 2K14A 2V3SA 1DD2A 2L55A 4GKKQ 2BS2B 3AB5A 2F4VQ 4OWTB 1E7ZA 5AJ3Q 1JORA 4POFA 5FR6A 3U30A 1QUQB 1WTXA 4IFDI 2J4XA 3RR5A 1ZE3D 1KD1C 2RR9A 2RDFA 5IYBH 4LJOB 2Z0DB 2IL8A 1SSOA 3L0WB 2ZM6L 2PTLA 3V2TA 1HQRD 2YLMA 3FPUB 3ML8A 2KCTA 3X0WA 2JRHA 2KDIA 2WXQA 4KN7C 2KUMA 4KD4A 4ZK9B 2Q2UA 2F0EA 4CDFC 1K8RB 2ZVNA 5IY0A 3UIOB 4F1SA 3OG5A 5KIXA 2WGSA 3HRZC 3A1QB 4RGNA 2DYBA 4P73A 4DAYA 3B1LX 2INDC 5I9OA 3ZNZB 3K0XA 5GROA 2K04A 2WV6D 2WDTB 4OL7A 1CA6A 1DGSA 2R92G 5FLMG 2V4IB 2Z6KC 3GV3A 2UUBL 2A68C 3W1YA 5IP7H 2EYOA 1GC7A 4YSZB 4C1NK 2ALYB 1VQEA 2EY1A 2DX5B 4DV3L 4PZ6A 3U8ZA 2IYDB 4ZLTF 3VDZA 3J80L 3K57A 1RCVD 4FHKA 3QG1A 4DK3C 1PH3A 4MH8A 4A3GG 3RZWC 2TSSA 4GSWA 2A4ZA 4IM3A 1EU4A 1NR4A 4HWIB 3Q22A 2AQ1B 1FEHA 2CFMA 2I1JA 1WTHA 2D11A 3AU4A 5DPSA 2WXIA 2QW7A 1EFID 3SVMA 2N55A 1OQYA 3AQQA 4G7ZC 5HI1A 2WNMA 1TS3A 1PHJA 2GBRA 1GC6A 2KYWA 3FP9A 2CS4A 1PXUA 1RFKA 3G4SA 1VLBA 4NDXA 2KK8A 2KX3A 1OEYA 3UGBB 3VUYA 1CHPD 2ENBA 4DAYB 5I2YA 3NUCA 1K53A 1UELA 5FO8B 3KYDD 4HJKA 4M00A 2YTXA 1LM8B 2L1BA 3LWEA 2Y5BB 4LFAL 4B6WA 2LGSA 4LNOA 2EJMA 1J8IA 2O6VA 4DXAB 2UXBL 4C80A 1MI2A 1BO0A 2EY5A 2KVMA 1TR5A 5FLXc 4NB3A 3B08A 4KJNA 4WRDA 3EN2A 3EECA 3VFKA 3HOZB 1WTPA 4A75A 2ZPNA 3WALA 1OO9B 1SMXA 2PZTA 3HOZH 4KKUA 1HNWQ 3ONSA 5JH5C 1KM7A 3NZSA 3T1YQ 1XPRA 3QC8B 3SE0A 3B6YA 1TKYA 1WX8A 2GB1A 1EOVA 1W3SA 2M0AA 2F0WA 4JX1C 2K33A 4JI3Q 5C2TB 2ZW0A 1VRAB 4R1JA 4IW0A 4MJSA 3OIQA 2RPVA 3QOLA 2AQ3B 1EY4A 1STYA 1B50A 2WP9B 3TP8A 5C0XG 3SK8A 1IP9A 5LXHA 1VQGA 4P75A 2J0MA 4KKJA 1RL2A 1JQYD 4CO7A 2I1KA 5BMHA 1T0RC 1Q8KA 4TKOB 3U50C 1SYGA 2YTVA 2Y0SB 5M5WB 1WGGA 1KC8C 5AZHA 3GE8C 4XYOA 1YVCA 1WYDA 1IW7C 3UQAA 3KH0A 3NRZA 2A74C 4L5RC 3ZDMC 1MJCA 4QF4A 2E8GA 2H4OA 4W9GA 3Q14C 4UP8A 2HDEA 2MQJA 4P74A 3PS6A 2I5LX 1K51A 2SAKA 4OO1G 1PFMA 5HY6A 4FJYA 4CQNA 2K75A 3DWMA 3D31A 1A5RA 3MXNA 4MIUA 2JA8G 4HKQA 2F0IA 2MJ8A 3AE8B 3I70A 1CZWA 3L17A 1MI0A 4JQWC 1QNUA 3J9CA 3C46A 5IYDH 2IY1B 2LHEA 1CKMA 3RNFC 1EQVA 4AQ7A 2JX5A 4OGQC 4MJSB 1XMOL 1T3QA 2NCNA 3IG3A 2M8SA 5G3LF 1NMFA 3L13A 2Q8TA 3Q24A 2F0HA 4DR1L 2ZCCA 4E3CA 2PW9A 5BYRA 4BY7B 3HHMA 5E6PA 4NY0A 4GNXC 4KGTA 5IODA 1Q90A 2KLGA 4FA6A 3ICEA 3CCQA 4BY7H 3W1SC 2NTTA 3PUXA 1TWAB 2XN9C 5C0XJ 2LVOA 1F2MA 3T1HL 2DJGC 5IN7A 3S1MB 2C7HA 2KEDA 3APDA 1TWAH 3RNGC 2LEKA 3EC8A 3DBHI 2B2TA 3F8TA 4OEMB 3GO5A 3S1MH 5HG2A 3EFXD 1TKEA 1UEBA 4W9CA 2RD0A 2NR2A 4AYBB 3MAQA 2HTHA 2UWQA 4C3HG 2L00B 2K52A 3MXNB 4N9PA 1M94A 2MWSB 2WXHA 4ME3A 5I2XA 3OTOQ 3D6WA 3KFUA 3PV0A 1CHQD 1VF7A 3S2DB 1SR3A 3B9JA 2Z6BA 1LUZA 4A3DB 2V9HA 3PO3G 2BKRB 3S2DH 1PA6A 1H95A 4B0EA 1CQFA 1RJTA 1PQSA 2F0OA 3KOJA 1F2RC 4A3DH 1ZGUB 5F2DA 4E71A 3LJ3A 1X3FA 3VA7A 2KOLA 4D2KA 1G8ZD 4FHJA 2B39A 3H9DA 2BB5A 2LY7A 3RN5A 3OLMD 4BY1B 4BA1I 2BB6A 1KDBA 1RD9D 4DNTB 1V9JA 1NYRA 2LFIA 3VH3B 2MO1A 3EUB2 2JXXA 1PH6A 2NN6G 3ZNHB 3I3CA 2N88A 1BKBA 2JSVX 4B9XA 1C1YB 3ECIA 4UDUC 3GTJB 3UDXA 1C9FA 4DFAA 1PH7A 2K6AA 3CMMB 3GTJH 2YTYA 4WQOB 1VQOA 4OZCA 3A7LA 3I3TB 2L15A 1P7FA 2F0MA 4OIJA 2JZ3B 1SNCA 2DGYA 3MHBA 1VQKA 1MPEA 1NTGA 1FPYA 2HHHQ 3PQIA 4MGZE 4P71A 1EYDA 4LW1A 4GDKA 1B7YB 4LF8L 2PJHA 4A3GH 4ZRZA 1WYGA 4DR4L 3RUZA 2WDVB 3JSVB 3OW7A 2CU3A 3UI3A 4CJ0B 4L6TB 2VH1A 5KEEA 2IO0B 1A62A 1KNAA 5CV8A 3TEHB 5JVG3 2ZEQA 1L1OC 3DVGX 3AEAB 4JIOU 4URKA 1DOXA 1Q1EA 2JEAI 3AE6B 4OX9Q 4TQ0A 4NXNQ 4OVUA 3GTOB 2B8FA 2W3SA 1OXXK 2L9HA 1CTMA 4KVGB 1ZPSA 4DHZE 3GTOH 2CHXA 1UD7A 3GTQB 5BR8Q 1YOVB 3DBLI 1WCMB 2YV5A 1EQTA 2EYJA 3GTQH 3HK0A 5A2QL 4FXKC 1WCMH 2EQSA 3CC2A 1EWCA 2Z0EB 3DWGC 3ETRA 4QIWE 2N49A 2WFWA 2JA7B 2QF7A 2WXOA 3V3XA 4A90A 2KHJA 3GTPB 1JJCB 3PGEA 2HIVA 2JA7H 4F7XA 2SOBA 2KN4A 2VB3X 2BTEA 3WOEA 3GTPH 3GTGB 5DPTA 3WAOA 1EWHA 1X65A 4GDKB 3SFDB 1ICWA 3DHQA 4MNOA 4AH6A 2DYOA 3PIOA 4DR7L 1UH6A 3ZRCA 3AE7B 3GTGH 1Q1OA 5TSSA 1S1QB 2V3PA 1STAA 4NXMQ 1VQ8A 4M8AA 2DY7A 1Z6HA 2IZVB 3K7AB 1B9RA 1CA5A 2M00A 3N3KB 5JEAH 1PTOF 2KJRA 3L54A 4YSYB 5G55A 3K7AH 1S3OA 2CHZA 1MJDA 1FNVA 2A1AA 1Q10A 1UGMA 4LF4L 1LYLA 3VR6A 3A55A 4DF7A 1WJ6A 1PTOB 1Y1WG 2D2CC 1GJZA 4OWXB 3GE3C 1VQBA 5D65A 2QCZA 3BYYB 2I0QA 2FUHB 5KYLA 1PTOH 2M2LA 2K1FA 2MBOA 5JHBA 3I4NG 2DAJA 4PNYA 4A3CG 2EDGA 1P0RA 3EA6A 1B53A 2N8NA 3U9SA 2BYEA 5G5GA 4N59A 5C44B 1E8YA 3GB1A 5LNK1 3QWZB 1HE8A 2CKHB 2LASA 2PMZE 1K9MC 5C44H 2JP1A 2K8BA 3RZFA 5ELCA 4L5TA 2I46A 4LF7L 3KLSA 4PS7A 4CJ1B 4HPPA 1F9PA 1BXTA 1SRUA 4JPSA 4GLSC 4JK1C 1IHZA 2N9EB 3BINA 4B3ML 3VQIA 4PK1A 2A6ED 1PH5A 1X3GA 4XGAB 4L5SA 3RN9C 4OW0A 4W9IA 2NUCA 3VRAB 1CZPA 1K8MA 4ZCKA 2K5HA 3AH7A 2RDBC 2CU1A 2WXJA 4IPHA 1KRHA 2DHZA 1AH9A 2M1MA 2IGDA 1ISNA 5E7NA 1Q0WB 4JGHB 1D6EC 3T51B 1NCVA 1KLUD 3ZLZA 2W82A 4DNRB 2PLPA 1EEID 4FF3A 4IJLA 5J3BA 3S2HB 1BT0A 3A8IE 2B2YA 2JYOA 1RTOA 3CXCA 2KTRB 1MHHE 2WKCA 3S2HH 1IPGA 4DR3L 5DPRA 3HP3A 2F0LA 2LS01 2J42A 3DBHB 2UUCL 3U2SC 4MM3A 4JI0Q 1WRDB 2A5HA 1QOBA 3HKSA 4K6LA 2M0XA 2WXRA 2FINB 3PIO3 1LM0A 2BW2A 4JI5L 4YT0B 2JY6A 4CYEA 2R7ZB 1N60A 4G7OC 2XEWA 4JI8Q 1NVID 2R7ZH 1SN8A 1D5XC 1BVSA 4OELB 1NBWA 3AXCA 3Q8CA 3VRBB 4EVOA 1L4ZB 3QJYA 3GDEA 1AP0A 5CV5A 1EIGA 3FAHA 4BVUC 3D3RA 4AIMA 5C1ZA 1AEXA 1CKOA 3WAPA 1GUGA 2F0JA 1V1OA 2K5QA 3VYTA 3H3VI 3TBIB 5JJKA 2DWQA 3IL8A 5ELNA 2GRIA 3ULJA 3G48A 2AHOB 5LL6S 2JA6B 2NMQA 1STEA 3NQIA 2Y5CA 2IHEA 4HROA 2BH8A 2KX0A 2JA6H 1WGDA 2LXAA 4IUMB 5JHAA 4JW0A 4ZUIA 1HNXL 1SJHD 2RPQA 2RCNA 3DWAA 1S72A 1J0GA 2ZM6Q 3ZTDA 4X66L 3MHSD 1C3TA 3LGJA 2LGXA 4LK1C 2X8XX 1U0LA 2LMCB 2MX2A 4A20A 1HNZQ 2E6XA 3HIZA 2OEOA 4A3KB 5C5LA 5IGCA 4LF6L 4MM3B 4KV2A 4A55A 2ZNVB 5HGQA 3IAYA 4P2CB 4A3KH 3C1FA 2BH2A 4J3OD 3KUCB 5C23A 1UNSA 1JJGA 2B3GA 3IAS1 3D0FA 1WR6E 3IT6B 2OTJA 5C4XB 4FULA 1G6JA 5LHY1 3A74A 3RFZB 3K5MA 3PZ7A 1SAPA 5C4XH 4MTNA 2R6GA 2RA4A 5IOCA 3RNUA 1D1IA 3BVZA 4XQNA 3AEGB 3JAMc 1Z5SB 4A3BB 3OSOA 2ZTDA 3AE4B 2KAJA 4GN3B 4LUZA 1FCCC 3QA8A 3H0GG 1EY6A 4WWMA 4EZKA 1WE7A 1GPXA 2R61A 2KVRA 5FO9B 1WTQA 1IKMA 2B2VC 5CYUA 4BKGA 4KX6B 3NHHA 2C9WB 2KFKB 1HA6A 1AE3A 1D7QA 4XT1B 5KNDA 5IGBA 1SNMA 2VRRB 1YNND 1WIAA 1ICFB 1SNDA 3QWNA 2GBNA 2PE6B 4II2B 3EIVA 1YZ6A 2RF4A 3AV8A 3DBLB 2EVBA 1PYSB 1K0SA 4XX5A 2CJOA 4GDLB 1SIFA 4K2LA 3K7UC 2EE1A 3A5ZB 2I5HA 3NSWA 3TQYA 1CT1D 2A73B
chains in the Genus database with same CATH topology
1BCPF 4ABNA 1C8CA 1ZXTA 3O13A 2O4XA 2EELA 4ULLA 1UEAB 1BCPB 1FO4A 1OXTA 1W6JA 4RGTA 2CHBD 4FVMA 3FRPB 1XYIA 2MP1A 5M3FB 2OHFA 4JWSC 2ZXPA 1I7HA 2PIAA 1RWSA 3T56B 3M85A 2QJLA 1A3UA 5M3MB 4HEDA 2A6EC 1T5XD 5DM63 1G2TA 1FNWA 4C3JG 2Y5PA 3A8KE 1G6ZA 2RVLA 3I4NB 1PZJD 1JR0D 3M7NA 3X3MA 2O5JC 2R3ZA 2X69A 1PRTF 1II3A 2Q8IB 5H92C 4A3EB 1B4OA 3I8ZA 1Y69U 3HOVB 1LABA 1PRTB 1HRJA 2SDFA 2C5CA 5JAVA 2NVXB 1NAPA 3PO2B 1O7YA 1X32A 3L4PA 1UWXA 3T4AC 4K5VA 1U4MA 1WTVA 3M4YA 3S15B 2Z1CA 4RCNA 3J81E 2D9UA 2W55A 5CMDA 3LWUA 5BN4A 4L2YA 5JVH3 2J0TD 1FXAA 4LMQD 1TY2A 2E76C 3AEEB 3OWFA 2H1EA 1CQVA 1D2BA 1PFBA 4REZA 1GUSA 4R8NA 2E2IB 2XVSA 3DEOA 4RH6A 4RCOA 2O2LD 2ZW1A 3AEBB 1NEKB 3OWEB 1EWYC 3Q8FA 4ZRQA 1FYCA 1ET9A 1FRDA 2LGIA 1MBYA 1Y1VB 2F4IA 1I6VC 2IGGA 5CV4A 3R2IA 1LTID 1TZOA 4HKZE 3VA5A 2IX3A 5E1FA 2YEPF 4ZAIA 4JBWA 1EU3A 4MHEA 1S5CD 2YEPB 5EBDA 2A69D 2AUJD 2RMMA 2K3UA 4ZHPA 4M1UB 2ZXRA 2HDLA 1I4HA 5M5XB 5CV9A 3TMEA 5AUIA 4WAFA 3CQZB 3TP7A 1Z47A 1IGDA 1E2VA 2ACZB 2JSOA 1R4QB 5EGTA 2WDRB 3A54A 2L1AA 2QKIC 3D8GA 2KHSA 2MJ3A 4A3IB 3NP8A 2DNCA 1YNNC 2L0CA 3NTHA 2J7ZA 2Z4IA 1J7CA 3EJIA 2WXFA 4RGMA 2XWJB 1LT4D 5GXGB 4R9WA 2F0QA 1LTSD 2J53A 2H89B 1B9NA 4DGZA 4X3UA 2EJFC 2IGHA 3KQ4A 1ILPA 4X3TA 5E4WC 4G7HC 3NWTA 3HRDD 3NS1A 4ZUJA 1C77A 2XIWA 2BOSA 1H9KA 1NUCA 4P6VF 2MH7A 4DK0A 2FJ2A 2WKDA 4JWUC 4F8MA 1B1ZA 1FGBD 2PW5A 3WOFA 2F03A 4IUVA 1HQMC 3FMCA 5JOBA 1WTOA 2E74C 4H7BA 3IKJA 2C9OA 4PQXA 3HZXA 3C2PA 2PZUA 1ACCA 4A3FB 1ESFA 4XDCA 2D62A 4X3SA 2JE6I 3SHLA 3RPFC 1PZKD 2LJIA 4Q0FA 4IFDG 1QKZA 1WD1A 1DOLA 1JE4A 1SF0A 4NAWB 1I4QA 1PMRA 1G2SA 2RSNA 1A6XA 5I9PA 1SYBA 3DWPA 2NVTB 1EY0A 1E2WA 1W6KA 3CU7A 3NUHB 3S1RB 1DJRD 2MUYA 5T8IA 4RWSC 1LLRD 4K8IA 5M5YB 1QOHA 1M4VA 3OMCA 1BF4A 5HFYA 1XX8A 2G9DA 5J39A 4WURA 1HPCA 1QE6A 3CRKC 5CC4A 2IW3A 1C79A 5EKLA 3E6ZX 2WP8J 5LL6X 1FD7D 1O80A 1STGA 3AECB 1IYUA 4IFDJ 5CBEE 2ICEC 2A69C 1BMLC 2DNEA 5ELDA 4FF4A 1ZXIA 4XE0A 2WLBA 5C3EB 3RZDB 4KHVA 1WVLA 2I2YA 1XCQL 3V96A 4M0WA 1DOYA 1TU2B 1O7ZA 2F0GA 4BS9A 1XLQA 4H44C 4HN7A 5IIFA 1U4PA 2EYFA 1YNJD 3BVMA 1GUTA 1S5ED 1GAQB 1A70A 3G7LA 4OO1I 1V43A 3CKIB 4HCEA 2JWUA 2H88B 3GTLB 2L11A 1MSHA 3TN2A 2HQEA 5T1IA 3TP6A 2XRQD 4OHJA 1YJIA 2CVRA 2FMMA 4ARCA 2WDQB 1EYCA 1QB5D 2N0SB 2WXLA 3Q0AA 1GB1A 3C3LA 3VYUA 4DU9A 1RODA 4V0BA 1X3QA 2WS3B 4KTAA 4WJWA 2K5PA 4LK0M 4DAVA 4K6DA 2NYZD 3CWIA 3VR3A 4LAAA 2BS3B 3LYYA 5E6JA 1XLNA 1U4RA 1V1PA 3K5NA 5JEAJ 4ODGA 1SBBB 3H3VC 4A9AA 1DONA 2IJ0A 4IKGA 4C56C 4IOIE 4US8A 1WXQA 1JC7A 1ZDVA 4XT3B 2E2DC 4XXEA 1CI3M 2JYEA 2MGSA 2B2UA 1GB4A 2SEBD 3NVYA 1FFUA 2Q5WD 2NB0A 3FEWX 3S1QB 1NENB 5BMIA 5FLXE 1VMCA 3AEFB 2EKIA 2MJEA 1F2LA 1O78A 4JE3B 3BK1A 1VCIA 1ZKOA 4C7ZA 2R92B 3MA2B 4XTCS 1C76A 5FR3A 1LT6D 2WXPA 2WQYB 2HCIA 1ZP0B 4F88A 4LLGM 2JA5B 1V1PB 3BS1A 2K05A 4LJZC 2BS4B 2A6HD 3J7YW 1O7LA 2NTSA 4A3GB 4KY5A 3GS2A 1AZPA 5K36G 5G3LD 3L7ZC 1V8CA 5C5MA 5DEHA 4RKBA 1R7SA 2ONQA 5COYA 1EZ6A 2I38A 3KLSX 2FE8A 1DGJA 5CR3A 1XEEA 1TVXA 1KAAA 2O5IC 5D3DA 4EQNA 2F0FA 3P1HA 5ELBA 2EYLA 1FR3A 1SYCA 2B76B 3W5UB 1Y8NB 1PDQA 4ZKBB 3NQTA 3I91A 3NXWA 1YNJC 3BG3A 1J9OA 1E6EB 1F2ZA 3SXHA 1VJKA 4HRSA 2DYMA 3Q6SA 1FD6A 1LTAD 3J80E 1KABA 3T16A 4G4KA 3U7ZA 3MC0B 2B2WA 3PUYA 2BDNA 4EQOA 3LB8C 5EKIA 1B3AA 5BN3A 4HEA1 4B0MA 5C4ZA 1D5ZC 3BDOA 5C0XH 4U673 1IBXA 3TEYA 3VR5A 4CKEA 2IPKD 3NVZA 1TWCB 1IUEA 2HTME 1NYQA 3JAML 2QMTA 2HUGA 2JA8B 1LTBD 4OO1H 1SE2A 1GUOA 3OHXC 5D14A 2PO4A 4TMAB 4J6HA 1N5WA 3P4SB 1I3QB 4KKIA 1YN5A 1YN4A 4KD3A 4UAIA 1HZ6A 3GTKB 1LTGD 1XWEA 3AB9A 1MSGA 4FF2A 1QQRA 3VYSA 1WSPA 1VZ7A 1PUTA 3NPPA 5KYIA 1L0XB 4HCSA 4KMUC 3KBGA 3AE3B 2JYTA 1WWTA 3RZOB 5G5HA 1STHA 4ZKCB 4C3IG 1ILQA 3N6RA 3RD4A 3TZUA 1EY8A 4C2MB 1VZ8A 3MHZA 4C3HB 1I50B 1QLBB 4MT5A 1U4LA 5AUKA 1PFDA 4N6EB 2QCPX 3PO3B 1BUVT 1OXUA 3I9V1 3R3OA 5DNFA 1BOSA 1UAPA 3MXGA 3P75A 4K2KA 1PTOD 4FXDA 2A6HC 2IT1A 3ONAB 1HHVA 1X3PA 2MJDA 4FP5D 5EE0A 3MWYW 1NI3A 5KNBA 3A8JE 4IZ8A 2HDMA 3T53B 1K52A 1ESRA 3S9WA 4E6IA 2NN6H 1JOOA 2BE5D 1JRPA 5BYSA 5C3WA 4YTMB 2F0VA 3FVQA 5A35A 2L4NA 3FDTA 4PMWA 2WINB 1E7PB 2KCCA 1HUMA 3I73A 1ZYRD 4IUNA 4KV6A 4IURA 3E5SA 2SNSA 3A7AB 1GOZA 1B2TA 1AN8A 2BA0A 1QOFA 2B8GA 2D5DA 1T6BX 5CV7A 3L9AX 1KNEA 2GA4B 1PGXA 3NWSA 1GJXA 1N62A 3P63A 1E10A 2M19A 1KDAA 1WTRA 3BK2A 1DM0B 1HTLD 3Q23A 3K0YA 1QJOA 1Z7TA 3WDNA 1ZDXA 4Y7NB 3OPOA 2RQXA 2SNMA 2G1EA 2B2TC 1AYFA 1QWYA 1KFYB 4NAMA 2VNUD 2L5TA 2K1BA 1AFPA 3TP5A 2NZ1D 1TIID 2F3VA 4TRDA 4K14A 1V8QA 3X3NA 4XWWA 1VR9A 2PPBC 1EEFD 4HSVA 1DOKA 4HAEA 2M9VA 3MXPA 3QB3A 1CFMA 2KA7A 2XNAC 1L6VA 1N5XA 2K9XA 3S16B 3AMUA 4IUTA 1B44D 1BNZA 3PZ8A 1IGCA 5MPOA 1Y1WB 4I7ZC 4NP5A 1UWMA 3ZJVA 1I4PA 2HCCA 4QB4A 3FILA 1ENAA 2VZKB 2JEBI 2K5WA 3AE2B 5A2QE 1RDPD 3EGRA 2INNE 3SK5A 2EY2A 1UUPA 4WFN3 4FO2A 1Y8PB 3BYTB 2JZPA 5KNCA 3IAM1 1R4PB 4TQ1A 1E0BA 1YN3A 5K5PA 3W1SA 2QDBA 2EXZA 1UGJA 2ZXOA 3BZDB 2F0NA 4BA2I 1PTOC 2V3NA 4S3SA 2WXGA 1EOTA 1WD0A 2FHTA 4K5WA 2BCOA 3FILB 3ND8A 3Q8AA 3TSSA 1BCPD 3ITPA 4KJOA 4NZLB 2QILA 2I07B 2BE5C 3S1NB 5EBCA 4XQQA 2LKVA 3JAME 4KY6A 1FMAD 1F9QA 3EVQA 5IGFA 3M7GA 4H13C 3E56A 5HURA 3NE5B 4P16A 1MGSA 3R8BA 1ZYRC 2EOTA 4XDXA 1JCKB 3ZGZA 1OXVA 3NVWA 1PLFA 4PMCA 4U68A 2IWHA 3SR6A 4RNAA 4OZAA 3HS0C 4ILWA 1C4AA 1ONLA 4X3KA 4WIPA 1YQ3B 4I65A 1PRTD 4N9TA 4CGYB 2F0KA 2PKOA 5EPJA 4NW2A 3P7JA 3H6MA 1XLOA 1YMHE 3P20A 4MN3A 2BT6A 5C3JB 3G6JB 4R3DA 2OF1A 4WORA 1KTKA 2CQAA 3W2DA 2AWOA 2RDHA 1WTWA 4CBVA 3H91A 3D6CA 1DOIA 1AWDA 3MZ5A 1BR9A 2ZT9C 3H0GB 1VF5C 3K5LA 3H94A 2BA1A 2PVOD 3PUVA 3SR1A 5KGUA 5E3FA 1C4PA 1ENCA 2B2YC 4XQJA 3VR4A 1GHJA 2PNRC 2JU6X 1FRRA 4RA8A 1Q8IA 3GTMB 3NVVA 3HG9A 1XO3A 1EYAA 4RKLA 1EIHA 1SNPA 3MVVA 2EPBA 4CKBA 4ZRPA 5IGDA 2R93B 3L3OC 2VUMB 1JWUD 1PZID 5M9OA 3VYRA 3NBHA 3R2TA 4A93B 1L5PA 5EQ0A 2WU2B 1FNUA 4IUQA 3R93A 2MHVA 1HFGA 1ML0D 5J22A 2K7VA 2XSCA 4PMBA 2K0PA 1BQQT 4C3JB 2QIEB 3AE1B 2E3TA 3HVDA 4BWGB 2YU9B 5H8YE 1KDCA 2RBMA 1OXSC 3MFYA 1TT2A 4O42A 1CZGA 1SE4A 2EY6A 2KEEA 2NVYB 1RYJA 3NK9A 1NR2A 2V0GA 1JQ4A 4ID6A 3U9OA 3HVZA 4ARIA 3RMHA 2X6GA 1BCPC 1XF5L 3CIRB 1QOGA 5AFWA 2OEDA 4USAA 3BIID 3TZDA 4DAPA 2WAQB 2EJGC 3UI2A 4EQPA 1I6HB 2AX5A 4Q2JA 4DN4M 2L32A 3AE9B 3VR9B 4RHSA 1HZ5A 4C1NI 3HOWB 4OIKA 5D3IB 1LTTD 2BDOA 3KF8A 2BBCA 5C0XI 2WXMA 3ZJUA 1L4DB 5JPMC 1QCBD 1I4XA 1V97A 4YSXB 3W5VB 2VXWA 1TKWB 4NKLA 3FC4A 3D4WA 4RF1A 2KECA 1OQQA 3HOUB 1L0VB 3B2FA 1ZUD2 2OXPA 1PRTC 2B63B 2NVQB 5BN5A 2K32A 5JEAG 3PMFA 3VR8B 3HKZB 1I4GA 4HSPA 5ELFA 1HCZA 2G9HD 4DXFA 1LT5D 1Q3LA 3SK6A 1I4RA 1T5EA 3LXFA 1GUWA 2K01A 4F87A 1ZEQX 1DYQA 1GHKA 3T3OA 1EY9A 3FPPA 1BUIC 1SEBD 2PZWA 3TUOA 1TJEA 1LT3D 2KCNA 3HGBA 3J7AV 2AWNA 1J7BA 3B2GA 4EE2A 1EM7A 3NBIA 1XCTL 1F9SA 4BBRB 3PUZA 3ZYYX 5DM73 3LNNA 3GD7A 4HMIA 1H9RA 1E9MA 4YTNB 1SIJA 1MVKA 5EE3A 4KGSA 5EPKA 3T3NA 3V05A 1AZQA 2K22A 2RDGA 3KWLA 5D7GA 1JWMD 1QILA 3QIAA 4BBSB 2ON8A 3ERQA 1DXMA 4R8IA 3KWVA 1NSNS 2B2VA 3D4RA 1H9JA 2MPMA 3PO0A 5E4XA 1A15A 2BYTA 1N61A 3DEPA 1KLGD 1SYEA 3RLFA 2L52A 3NTIA 5JJZA 1C48A 3W9CB 2PVGC 4L8JA 4XYQA 4RFBA 1OQRA 4OZBA 2GI9A 1A2UA 1ET6A 3CRLC 1LTRD 4K8JA 2NN6I 2ICIA 3MXUA 1EL0A 2PYKA 3F2UA 3K6OA 4FNFA 2KDMA 4FYDA 3KK7A 1VDZA 4QIWB 2X6LA 3FKIB 1G91A 1WGKA 5C3XA 5JPNC 3HOYB 1QT9A 4IFDH 2F0PA 4RGOS 3SK4A 2DLBA 4PV1C 5ELEA 2XWBB 4C7YA 5IT9L 2J52A 1TWHB 3H09A 3EQLC 3DXJC 4RF0A 5IGEA 1S5FD 1JOKA 1SSNA 2K28A 3I57A 3EROA 1TS5A 5EE1A 2DN8A 4YTPB 4IALA 4QMGA 1VDVA 3AN1A 2EYMA 4IUPA 4K5XA 1DZ1A 2Q8RE 2CW0D 1RKNA 2WU5B 3ABVB 1Q1BA 1QG7A 2PMZB 4IUUA 1OFFA 1TYGB 3PUWA 3K59A 2INPE 4KKTA 2KQ4X 3AE5B 2LUMA 1XTCD 1HTPA 3P4RB 1FCLA 5C4HA 2JXMB 4TSSA 3AU7A 4J1MA 4CHTB 3ZQ4A 5HGTA 1KH0A 4KHZA 2KJXA 1N63A 3DWQA 1A3VA 1PDXA 1ROEA 1C4QA 1SJED 4H0LC 1SFOB 4N58A 3U52E 2NBFA 2WACA 3N52A 5CBAE 4KKSA 3J81L 5EJWA 3OOCA 4KI0A 1IKLA 3MEHA 3GQBA 1GXDC 1ZXHA 4HJGE 1PFNA 3U4EG 1JROA 1HFNA 2IX0A 1JOQA 4G57A 3A56A 3E9SA 4DXGA 2WXNA 1BBXC 2PCFB 3PIP3 1H9SA 1PGBA 4YXDB 4J8QA 3DMUA 4RHRA 2JQRB 1XXGA 2RSOA 3NZ3A 1RF2D 2OT2A 1SMYD 2NWGA 2KACA 1HEZE 2RKSA 3QOJA 4L63B 2IDYA 4YWGG 4MACA 2Y3AA 4IDIA 3BVGA 4NJCA 1IBXB 2E2JB 2Z4HA 2F0DA 5IGGA 1DOMA 3S17B 4IQZA 1YQ4B 4A3MB 4HMJA 1QOAA 1ZOYB 4WQMA 1H9SB 1XLPA 1FFVA 2LFNA 2QSDA 3Q8BA 1HA5A 5I6WA 2F3WA 1B9MA 4QUFA 1TY0A 2WIIB 1SXTA 2LMCA 1BDOA 3OIPA 3IT4B 1FIQA 3C8YA 4ITKA 5I4DA 4ZQ3A 3P4PB 1MD2D 1P7EA 1QNKA 1YNTE 4XWTA 2AQ2B 2JXTA 4DA2A 3M4OB 1LV9A 4L1BA 5FOBB 5EE9A 4Z9CB 1JWBD 1E0ZA 3P42A 4US9A 5T1GA 2CW0C 3HEJA 1J7AA 1FXIA 1K83B 2FUG1 1HUNA 5EPLA 4DQOC 1F2RI 4HTHA 4FF1A 1KF6B 1RTNA 2F0UA 1SDFA 1IL8A 1D5MC 2K5DA 1MHXA 4FXGC 5K36H 4DK1A 1L0YB 2Z8LA 2DY8A 1F77A 2YYZA 1E2ZA 1GUNA 3Q69A 1EZ8A 3S14B 1VMPA 4RAUC 3MFGA 2EZVA 4ZYSA 5BYQA 1CM9A 3QO2A 3HOXB 3I72A 3K58A 1JW9D 5NUCA 5BMGA 1JALA 1S5DD 5CGKA 1RM6C 1SNOA 1H9MA 1A3TA 2EYPA 3M3YB 2KQ3A 1RHPA 2KMMA 3ZJTA 4B08A 1IYVA 3GP7A 1F2YA 4AQ7A 3I4LA 1TQOA 5IT9E 1F9RA 2WB1B 3CHBD 4KK7A 4YIJA 3TEWA 1ENFA 2B2UC 3IFDA 1TS4A 1SMYC 3MJ5A 1STNA 5C4JB 2KWDA 4CJ2C 5HHDG 2FBWB 2DBYA 5J1ZA 5CV6A 1R9TB 1SNQA 4PT5A 2MEKA 1SE3A 1DCZA 4KY7A 4A6QA 1JWAD 3BDCA 4ME5A 4KGRA 2N7JA 3WCQA 2FFKB 5CORA 3BDLA 2TMPA 3T13A 1PYWD 3TDQA 3D4DA 1S4ZA 3SDZA 2L83A 2PQEA 4FXCA 3SFEB 3K5OA 3KBXA 1LACA 4TQUS 3AM9A 1D4BA 2WXKA 3AMZA 3Q8EA 4IN3A 2N9KA 4L23A 2XRSD 3H8HA 2L12A 2M56B 1JICA 4V190 2A68D 1SYFA 2V4DA 1QF6A 1WRIA 5I6YA 1CK1A 2CJNA 1TKGA 4KN4C 5ISRA 1Y56A 3P4QB 2ID0A 3MTSA 1K8OA 4C3IB 4NMZA 4O1NA 2AUKA 3SEBA 3ND9A 3BWUD 2IX1A 1LO5D 1EY5A 3NTKA 1U9RA 3DM1A 4XIGS 4H2AA 1CJEA 1EY7A 2B2WC 3DUZA 2PMVA 3AEDB 2F0TA 1FM0D 2W3RA 2QEJC 5FO7B 1F0ZA 3VR2A 4OVZA 1C4CA 1SB3C 2W54A 4AS1A 4A3JB 4QCLA 2F1MA 4A8XC 1TWFB 2K03A 1JWSD 4EGVA 3LX0A 2VZKD 3C1EA 5DAUA 1TWGB 1D1KA 2PW7A 3HUIA 4Q5VA 1PGAA 3W3AA 5FKAC 3KLRA 3URYA 4GZYC 1G291 3OMGA 2F0SA 3N9YC 4B9WA 5KRUA 2X38A 3GV6A 3J7AF 3IXSA 3KUPA 1AW7A 3I4MB 5EKKA 1A2TA 3MP9A 1HXYD 1Y8OB 4QUCA 1JMLA 4WH4A 2N9LA 2D5GA 4XDDA 4ZHOA 1STBA 1IW7D 1JB3A 3E0JA 5JXVA 5FK9C 2FMCA 5FLXL 4LTUA 2EYHA 3I90A 1VZ6A 4ZOHC 5C6AA 4CKCA 1C78A 2LHDA 3P1MA 1M8AA 1TS2A 2E75C 3TEXA 2VB2X 1S5BD 1L6UA 2E2HB 1Q12A 1K50A 4HR7B 3IFTA 1YJJA 1SYDA 1DD2A 2L55A 2BS2B 3AB5A 1JORA 1WTXA 4IFDI 2J4XA 1ZE3D 2RDFA 2IL8A 1SSOA 2PTLA 3V2TA 1HQRD 3FPUB 2WXQA 4KN7C 2KUMA 4KD4A 4ZK9B 2F0EA 5KIXA 3HRZC 4RGNA 4DAYA 5I9OA 2K04A 2WV6D 4OL7A 1CA6A 2V4IB 3GV3A 2A68C 2EYOA 4YSZB 4C1NK 2EY1A 4ZLTF 3J80L 3K57A 1RCVD 3QG1A 4MH8A 2TSSA 1EU4A 1NR4A 3Q22A 2AQ1B 1FEHA 2WXIA 1EFID 3SVMA 2N55A 4G7ZC 5HI1A 2WNMA 1TS3A 1PXUA 1RFKA 1VLBA 4NDXA 1CHPD 2ENBA 5I2YA 3NUCA 1K53A 5FO8B 2L1BA 3LWEA 2EJMA 1J8IA 4C80A 1MI2A 1BO0A 2EY5A 2KVMA 1TR5A 4KJNA 4WRDA 3HOZB 1WTPA 1OO9B 2PZTA 4KKUA 3SE0A 1TKYA 2GB1A 2M0AA 2F0WA 4JX1C 2K33A 5C2TB 2ZW0A 1VRAB 3OIQA 2RPVA 3QOLA 2AQ3B 1EY4A 1STYA 1B50A 2WP9B 3TP8A 5C0XG 3SK8A 4KKJA 1JQYD 5BMHA 4TKOB 1SYGA 5M5WB 2Y0SB 4XYOA 1IW7C 3NRZA 2A74C 4QF4A 2H4OA 2HDEA 1K51A 2SAKA 4OO1G 1PFMA 4CQNA 3DWMA 3D31A 3MXNA 4MIUA 4HKQA 2F0IA 2MJ8A 3AE8B 3I70A 1CZWA 1MI0A 1QNUA 3J9CA 3C46A 2LHEA 1EQVA 2JX5A 4OGQC 1T3QA 5G3LF 2Q8TA 3Q24A 2F0HA 2PW9A 5BYRA 4BY7B 4KGTA 5IODA 1Q90A 2NTTA 3PUXA 1TWAB 2XN9C 5C0XJ 1F2MA 3S1MB 2KEDA 2LEKA 2B2TA 5HG2A 3GO5A 3EFXD 1TKEA 4AYBB 3MAQA 4C3HG 4N9PA 2WXHA 5I2XA 3D6WA 3PV0A 1CHQD 1VF7A 3S2DB 3B9JA 4A3DB 4B0EA 1CQFA 1RJTA 2F0OA 1F2RC 5F2DA 3VA7A 2KOLA 4D2KA 1G8ZD 2B39A 2BB5A 2LY7A 4BY1B 4BA1I 2BB6A 1KDBA 1RD9D 4DNTB 2LFIA 1NYRA 3EUB2 2NN6G 3I3CA 2N88A 2JSVX 4B9XA 4UDUC 3GTJB 1C9FA 4DFAA 2K6AA 4OZCA 3A7LA 1P7FA 2F0MA 4OIJA 1SNCA 3MHBA 1MPEA 1EYDA 2WDVB 4ZRZA 1WYGA 3TEZA 3RUZA 3OW7A 2CU3A 3UI3A 4CJ0B 4L6TB 5KEEA 1KNAA 5CV8A 5JVG3 3AEAB 1DOXA 1Q1EA 2JEAI 3AE6B 4TQ0A 3GTOB 2B8FA 2W3SA 1OXXK 2L9HA 1CTMA 1ZPSA 3GTQB 1WCMB 1EQTA 2EYJA 5A2QL 4FXKC 1EWCA 3ETRA 3DWGC 2JA7B 2QF7A 2WXOA 3V3XA 4A90A 3GTPB 4F7XA 2SOBA 2KN4A 2VB3X 2BTEA 3WOEA 3GTGB 1EWHA 4GDKB 3SFDB 1ICWA 3DHQA 2DYOA 3AE7B 2V3PA 5TSSA 1STAA 4M8AA 2DY7A 1Z6HA 3K7AB 1B9RA 1CA5A 2M00A 5JEAH 1PTOF 4YSYB 1FNVA 1Q10A 3VR6A 3A55A 4DF7A 1PTOB 2D2CC 5D65A 3BYYB 5KYLA 1PTOH 2M2LA 4PNYA 2EDGA 3EA6A 1B53A 3U9SA 5G5GA 4N59A 5C44B 3GB1A 5LNK1 2JP1A 5ELCA 2I46A 3KLSA 4CJ1B 1F9PA 1BXTA 4JPSA 4GLSC 4JK1C 1IHZA 3VQIA 2A6ED 4OW0A 3VRAB 2NUCA 1CZPA 1K8MA 3AH7A 2WXJA 1KRHA 2IGDA 1D6EC 3T51B 1NCVA 1KLUD 2W82A 4DNRB 2PLPA 1EEID 4FF3A 3S2HB 3A8IE 2B2YA 2JYOA 1RTOA 1MHHE 2WKCA 3HP3A 2F0LA 2LS01 2J42A 3U2SC 2A5HA 1QOBA 2WXRA 4K6LA 2FINB 3PIO3 2BW2A 4YT0B 2R7ZB 1N60A 4G7OC 1NVID 1D5XC 3Q8CA 3VRBB 4EVOA 1L4ZB 3QJYA 1AP0A 5CV5A 1EIGA 3FAHA 3D3RA 1AEXA 1GUGA 2F0JA 1V1OA 2K5QA 3VYTA 3TBIB 2DWQA 3IL8A 2GRIA 5LL6S 2JA6B 2NMQA 1STEA 3NQI<