1V1PA

The structure ssl from staphylococcus aureus from an orthorhombic crystal form
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
191
structure length
191
Chain Sequence
b'HLHDIRDLHRYYSSESFEYSNVSGKVENYNGSNVVRFNPQNHQLFLLGKDKEQYKEGLQGQNVFVVQELIDPNGRLSTVGGVTKKNNKTSETNTPLFVNKVNGEDLDASIDSFLIQKEEISLKELDFKIRQQLVNNYGLYKGTSKYGKIIINLKDENKVEIDLGDKLQFERMGDVLNSKDIRGISVTINQI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EXOTOXIN 1
publication title Structural Relationships and Cellular Tropism of Staphylococcal Superantigen-Like Proteins
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Virulence factor
total genus 49
structure length 191
sequence length 191
ec nomenclature
pdb deposition date 2004-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
A PF09199 SSL_OB Staphylococcal superantigen-like OB-fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1v1pA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1v1pA01
1GOZA 2XRQD 3BYTB 1B44D 4RCOA 1PZKD 4RFBA 1I4GA 3EA6A 1S5FD 3CHBD 1YN3A 1RDPD 1PRTC 1S5BD 2CHBD 3TSSA 2ICIA 3R8BA 1DJRD 1FGBD 2AQ1B 1RF2D 1BCPB 1ET6A 4RGNA 1SJED 4ZYSA 1HTLD 1HQRD 1LTAD 2O2LD 1SXTA 4TSSA 5D3IB 1PZID 1LTSD 1SJHD 3R2TA 1ESFA 1PYWD 1TS2A 1BCPC 5ELDA 1ET9A 5FK9C 1I4RA 3BZDB 3DWPA 4BWGB 1B1ZA 1PRTD 1SBBB 1D5MC 1S5CD 1CT1D 2RDGA 3DWQA 5ELCA 1STEA 2QILA 2RDHA 1MD2D 1SE3A 3MFGA 1TY2A 4Z9CB 1SE2A 1HXYD 2IJ0A 4RHRA 1JQYD 5D3DA 5ELFA 4NZLB 1PRTF 4RGOS 5FKAC 1YN4A 1D6EC 3EFXD 1V1PA 2XN9C 3MC0B 2SEBD 1I4PA 1EFID 5ELEA 4DXGA 4OHJA 1S5DD 1SEBD 2TSSA 1YN5A 3URYA 1KLUD 1LTBD 1KLGD 1S5ED 1LT6D 1UNSA 2XRSD 1RD9D 1BCPF 1AN8A 3BVMA 5I4DA 1FNUA 1SE4A 1LT3D 4L6TB 1UUPA 5ELBA 2G9HD 1EEFD 1LO5D 1V1OA 2R61A 1JWUD 1CK1A 1PTOB 1TS5A 3OWEB 1M4VA 1TS4A 1V1PB 4RH6A 1PZJD 1DYQA 3DWAA 1D5ZC 1I4HA 1LTRD 4DXFA 1EEID 4RGMA 1ENFA 1BXTA 1EWCA 1TY0A 1XXGA 1BCPD 2QEJC 1FD7D 2J4XA 1PTOC 3BVZA 2AQ3B 1JCKB 4RHSA 1EU3A 1LTGD 1AW7A 1LTTD 1CQVA 1LT5D 1L0XB 1FNVA 1JR0D 1PTOH 3SEBA 3V05A 3W2DA 1TS3A 1RCVD 1L0YB 2NTTA 3BVGA 3BYYB 1CHPD 1I4QA 1T5XD 2IPKD 4K6LA 1XTCD 1QILA 2XNAC 2Z8LA 3O13A 1PTOD 3KLSX 4UDUC 1HA5A 3R2IA 3GP7A 1JWMD 1KTKA 1LTID 2WV6D 4O1NA 4L63B 5TSSA 1FNWA 1JWSD 1CHQD 1D5XC 1EU4A 1I4XA 1PTOF 1G8ZD 2AQ2B 2NTSA 4RGTA 4C56C 1LLRD 1PRTB 1LT4D 1F77A
chains in the Genus database with same CATH superfamily
1ZUD2 1PDQA 2LASA 3FKIG 3HOYH 1DD2A 1HTPA 3ZNHB 4M8AA 4YWKA 5CV9A 4JBWA 3IHPC 5FLXc 2KOLA 4LJPB 2I46A 3L9AX 3V2TA 3WWVA 1RWSA 2PNHA 3UDGA 2KD0A 4DR6L 1C78A 4A75A 1EUJA 2AL3A 3E3XA 1EY8A 1T6BX 3GQBA 4ZYSA 4LF7Q 2EQSA 2Z0SA 1BNZA 4V190 2DAJA 4ANXA 1WGRA 3SFEB 2MP2A 2FUG1 3VDYA 2MHJA 2A5UA 1QLBB 3BWUD 2RSNA 4JI3L 5JVG3 2IYDB 3PS6A 4ZRZA 4JE3B 3D6CA 4JX1C 4LF9Q 2O5JC 2BOSA 2B39A 3H3VH 1MIUA 1WX7A 4JI2L 1IP9A 2QW7A 3LX0A 4PNYA 3VR2A 4FXDA 1QB5D 3AE3B 5ELCA 5C23A 3VUWA 3E0JA 4YSYB 3U7DA 3JAMc 4A6QA 4US9A 3AFPA 2K1BA 4LFCL 5FLMH 5BN4A 4II3B 3Q22A 1YN4A 1J6QA 3D31A 4BA2I 1ZW7A 3DBHI 4MJSB 1PV4A 2M1MA 4OWXB 2DZIA 3E0EA 4DXGA 4OHJA 3GTPH 3NVVA 4HCPB 1KDCA 4GDLA 4EE2A 1STAA 1L4DB 3NQIA 3KWVA 3VDZA 3HOXB 2BE5D 1KJTA 3NBHB 2KQ7A 2WXIA 2F0VA 2PTLA 2RPVA 4DK5A 2I2YA 1SE4A 1LT3D 1AZPA 1QUQA 2EYLA 1BMLC 1IBXA 2NB0A 4OIJA 1LO5D 4MNOA 4W9GA 2R93G 2KECA 2VY3A 3C8YA 2LXKA 2D2CC 1HNZL 4IUMB 3PIP3 1U4MA 2C5LC 3IFTA 1M4VA 2I07B 1VQJA 4NXNL 1Q12A 4C4VA 3H8HA 1D4BA 4I7ZC 3R7RA 3SD5A 5H1SE 4B0MA 2Y0SG 5M3FB 2ZVOA 3S14B 4XYQA 3MVVA 3TREA 1WVLA 5J3BA 4K81A 3DHQA 4I6PA 4X3KA 3WCQA 1VCBA 1FXIA 1ZE3D 4QMGA 5IP7G 2VB2X 2VQFQ 3C19A 3NJTA 4EZJA 1WTQA 4A3IB 5HURA 4A3LH 3JSVA 5JH5C 1L7YA 1WXMA 1MI0A 3IAM1 3Q3FA 2OQKA 3RUZA 3ZNZB 3HG9A 5C44G 3BVGA 3HOUH 4S0RA 4B6WA 4DN4M 2W3SA 5I6WA 1D3ZA 1E8YA 3I9V1 2H89B 4JI8L 4QCLA 1ZDVA 5J17A 4JWSC 1VF7A 4S3SA 4AJWA 3T4AC 1HA5A 2NVXB 3I3CA 4WJ4A 4O0AA 4QUCA 4DV3L 2JT4B 2OJWA 2DUDA 1WE6A 3E9SA 3AXCA 1SNDA 4LAAA 5IODA 4J6HA 3AE8B 3DWMA 4BY7G 2UU9L 1WZ0A 2OHFA 2CW0D 1WD1A 2NTSA 1H95A 2ZXRA 1FMAD 2A8VA 1YZ6A 3TS2A 5I2YA 1V81A 4HKQA 4JGHB 2JJQA 4UP9A 2MLBA 2NN6I 1VLBA 2WX0A 2RHQB 2D9UA 1RJTA 2NVYB 3RNCC 2K01A 1RRBA 4F7XA 4K6DA 3Q69A 1YN3A 4JV5Q 5M5YB 1BDOA 4NAMA 3LWUA 4I65A 4C2MB 1UF0A 1SR3A 1O7ZA 5FO7B 4DNIA 3J81L 1Y1WB 2RCFA 1MJDA 4EQNA 3N52A 1JJCB 3CRKC 4B9XA 5C0XJ 1K9MC 4L5RC 4MJSA 2Y3AA 1SJED 2QMTA 3EFCA 1S4ZA 5ISRA 2UU7A 3NP8A 1HQRD 2O2LD 4C1NK 1QKZA 1RYJA 2B2TC 3Q6SA 3W1GA 2ZJDA 1EZ8A 3WOEA 5KEEA 2O6VA 1NR2A 2R7ZB 1C48A 3NBHA 2WB1G 1AE3A 1TWAB 5CV5A 2JU6X 4KSKC 2MQJA 4R8NA 1UEBA 4QIWE 2WXJA 3CP0A 5E4XA 1STEA 3EJIA 2K33A 4X66Q 4HDOA 3HRZC 3CPFA 3FVQA 4B3MQ 5AZFA 1QF6A 3GO5A 3QCAA 2KT7A 3M85A 2AL6A 4P72A 2BPSA 3E56A 3MTNB 2JA6B 1OFFA 3DBRI 3K0YA 2JA8G 4JIOU 3H9DA 1TKGA 1I3QB 1NMFA 5JJZA 2L5TA 3ONSA 1S5DD 5H92C 4A3MB 1JJGA 5CHVC 2SNMA 1G51A 4PS8A 5GXGB 5HKHA 3DDCB 1VQEA 2K6AA 5JEAG 3RD4A 5L37A 4X65L 3OTOQ 3I4MG 5IT9E 1M94A 1BR9A 1UGMA 4A3BG 2Z59B 2CQAA 4K2KA 4DR3L 4LF6L 4BXXG 5E6JA 2EDGA 1Q1BA 4R8IA 4J15A 1UWMA 4ZRKA 4E3CA 3BY4B 2IHFA 1C4CA 2J0TD 1JMLA 1EIFA 5DCNA 1TWHH 3ZJUA 1YIJA 4P2CB 3VRBB 1X55A 4BY1G 1WMHB 1LTLA 2J42A 3ULJA 4A3KH 4QAYA 3HS0C 1PYSB 3U50C 1C7YA 3C3LA 4P73A 4HJAA 2C60A 3DVGX 3TCAA 1U4LA 3TMPB 3HGBA 3PUYA 2BKFA 3DOWA 2AWTA 2DNFA 1GUWA 4K5WA 2W54A 1SMYD 2JE6I 3EROA 4GLVB 1STHA 2JP1A 4K14A 4NXML 5AUIA 5IGGA 1JR0D 1OQYA 4A3FB 1TQOA 3M4OH 4IFDG 3RUIB 2GVAA 2DENB 4K0KL 4X62L 2JZPA 1T5XD 2WXNA 4MIUA 2XNAC 5DPSA 3Q8DA 3HOZB 3VUYA 2Z6KC 1VZ8A 5ELNA 3PF4A 2LRUA 1ENCA 2V3NA 1DZ1A 2KJ6A 2KWUB 4EKUA 1AZQA 3ER0A 2FXQA 4W9IA 4JI5Q 4C3IG 1D5XC 1EY0A 4EX5A 4DV6Q 1C8CA 1KHIA 3HKZB 3S1QB 1DOXA 3PGEA 3CQZB 3WANA 4PZ7A 1WJ4A 1D8LA 2ZJRA 1TWCB 2OEOA 3F2DA 1GOZA 1V43A 4DUZQ 4LF7L 1OXVA 3P2BA 2O4XA 1GNUA 3WAPA 3AQQA 3VUXA 5A2QE 2GBKA 4ZRIA 3ZW3A 1BBWA 2L11A 2BS2B 2DN8A 4K7UA 3VH3B 3JW0X 2CHBD 1FRDA 2KQSA 3TSSA 1T3QA 1PH9A 5J1ZA 3J81i 3ML9A 4E74A 2AQ1B 3DEOA 2C7HA 5C4HA 1V5OA 3Q3OC 2BGFA 3AE2B 3HUIA 2ZJQA 4TRDA 2PPBC 4WQOB 1HTLD 2BS4B 1GC6A 3N1XC 1VMPA 1P9DU 2R3ZA 3S16B 4DUYQ 4WJ3M 2M4NA 4KIKB 2ZEQA 2V9HA 5AEKB 1E8ZA 2QCZA 1FRRA 3CXCA 2A6ED 5I9PA 2MJ8A 5M3MG 2NUCA 1YQBA 1JMCA 4NB3A 5IP9H 1BF4A 3F2UA 2B2VC 5C3WA 4BBRB 2D11A 3DWQA 5M5WB 4WJOA 2VUMH 1CSQA 1ESRA 3HOXG 2IL8A 5EBCA 4Z9CB 3RFZB 1UWXA 3LYYA 1JQYD 3PIPA 1K0SA 3AEGB 3KBGA 2OCEA 1S72A 4P74A 4IPGA 1WIAA 2KTRB 1VZ6A 1EM7A 1T0QC 1WMHA 3EC8A 2LEKA 2N78A 1WI0A 2M0XA 2KDMA 1CQFA 1A3TA 1LYLA 3ICEA 2ICEC 1EFWA 1RAXA 2HD5B 2IX0A 1OXUA 2K52A 2KC2A 4BKSA 3D4WA 4CBVA 3U8ZA 2IWHA 1A8VA 2K9XA 2L0FA 4ZUJA 5I4DA 3KUPA 5C3EG 4Q2JA 3CSTA 4BKGA 5M3FG 1WR1A 3G7LA 3H09A 1WYGA 3ONAB 5EQ0A 4BVUC 1T0SC 2VQFL 3DQVA 2JF5A 2JRIB 3HP3A 4MDKE 3RI7C 1UE5A 4DK0A 5JPMC 2CHWA 3VVWB 5KHQA 4A3IG 3K6OA 3CAMA 1HR0Q 5C4XG 1TZOA 4Y7NB 4MELA 2N1WA 4B9WA 2WLBA 4A3DH 1BOSA 4DXFA 5IT9c 4KD3A 1EEID 4XT3B 2D0OA 1MVKA 3HK0A 1WJ6A 2EZVA 3C0RB 2K5NA 4AYBE 5IGEA 1NEKB 4G50A 2WACA 4QUFA 1VCIA 5A35A 1IBKQ 2E2IH 1IGCA 4NJCA 1JCKB 4IJLA 3BK2A 1A63A 4LDTD 4KD4A 3D3RA 1I35A 4A3GB 1N63A 1UGJA 5FLXL 4G7ZC 3ML8A 1L0XB 3M3YB 1P8LA 4CJ0B 2FINB 3V05A 1Z7TA 2N9EB 3KUCB 5CV4A 3PUWA 5EE1A 4W9HA 2I5HA 5LMUQ 1ACCA 2L9HA 3P4RB 3AV8A 3V6EB 1PTOD 3N6RA 3KLRA 2EKIA 2HTME 2M56B 3IT4B 5K5PA 4HK2A 2JWUA 4H13C 3V60A 1Q46A 4DAPA 4JV5L 1FD6A 4QL5A 3A56A 4DV7Q 4BBSB 3GE3C 1KRSA 2KDIA 3GV6A 4DK3C 2PNRC 1G6PA 4KIKA 2DY8A 1Y1WG 1EIHA 2LGYA 1WOCA 3HKSA 1FL0A 4ZUIA 2F3WA 3D6WA 2QHOA 1XX8A 3H7PB 2CKHB 4IZ8A 4BBNC 1I4GA 2QF7A 4IPHA 1R4NB 4XYOA 4YWMA 4BFRA 4MH0E 2R7ZG 1B4OA 3CMMB 3OLMD 1K53A 4A3OA 1LFDA 2HDMA 3NHHA 4TKNA 1VJKA 1OTRB 3PVLA 2J7ZA 1BCPB 2KTRA 1JC7A 2LHEA 2NCNA 4FULA 4ALPA 3H3VC 3CCSA 2JA7B 2KCMA 1N5WA 4CYEA 4B3ML 1O80A 5D3IB 4HVBA 1LTSD 1TT2A 1TXYA 4NAWB 3R2TA 3IBEA 1KNAA 2NVTH 2JA6G 1YHQA 2J0KA 1B1ZA 1VDZA 4IW0A 1SBBB 1UBIA 3CF5A 3S15B 3J7AF 3TBIB 2LUEA 4ZOHC 4DHJD 1ZYRC 2L0CA 1L5PA 3PO2H 2QILA 4A3MG 2KTFA 1XF5L 1XPOA 3OTOL 5D2MB 2LJIA 3PUZA 4LF5Q 1E0ZA 3ZNID 1L4ZB 4OZCA 5KGUA 2SEBD 3IT6B 2KKCA 2C5CA 1WE7A 4YCVA 2FNJB 1C9OA 2FUHB 4ZHOA 1GO3E 2C7MB 1YN5A 2XWJB 2E5LQ 1WXSA 3BZCA 2EMSA 2LSSA 1NBFC 1X1MA 3T13A 5M5XH 4RM8A 3QX1A 3MA2B 3FPPA 1QG7A 3BZKA 2AKWB 1EOVA 1PHJA 2JSVX 4OZBA 4H44C 2MPMA 1XNQQ 4YIJA 1Q0WB 3MC9A 1WCMB 1EEFD 2MP1A 1FFUA 4KHZA 3GTLB 1JWUD 2IZVB 3Q8AA 2KYWA 2F0WA 1X3PA 1VQMA 1PQSA 1NMGA 2OQ0A 2MEKA 3GTMB 3S1RB 5H8YE 4AP4C 1NBWA 3LGJA 2ZTCA 2HD3A 2BW2A 1GB1A 3ZUNA 3PV1A 4XX5A 2RD0A 4A3FG 3AE1B 3Q8EA 1P16A 1ASYA 1Q1OA 2NS5A 1BXTA 3UI2A 1LGRA 3K58A 3AEVA 5G2NA 1GC7A 4C7ZA 2NBFA 2N49A 3G48A 4NJ6A 3NVYA 1SFOB 3NVZA 3HOZG 3NPPA 4YY3Q 4OX9L 1WXQA 2ZVNA 1GUTA 1AW7A 4LF8Q 3S1MB 4P75A 3T1YQ 1T9HA 4JI5L 2F03A 4GS3A 4A90A 3ND8A 4G3XB 1XMOQ 3H7PA 3K5LA 2O2VB 3D4RA 3MXPA 2EXDA 4DK1A 4FXGC 1KRTA 5HGTA 1ZGUB 4IUTA 2JQOA 1A5RA 1IXRA 1W3SA 1BO0A 3QIJA 1J5EL 5CMDA 2I1JA 3LDZE 4KVGB 4B3RQ 1DCZA 1U4RA 2QDLA 4DUZL 1QVFA 2Q8IB 4A93G 4I6NB 4EZLA 3T3OA 4FLHA 2JYEA 4DV1Q 2GN5A 4QY7A 3ZXVA 1N33Q 2R92B 4PZ8A 1ZXHA 1L2FA 3BINA 3S1NH 3SE0A 3B6YA 5IOCA 2QIEB 2QGQA 1HE8A 1GJZA 1HNXQ 5I2XA 3WAMA 2PZTA 4RGTA 3JAMi 2B3AA 4NAWA 4GXBA 3TJPA 5G5HA 1E7UA 1I5FA 4IG7B 1S3SG 2F0HA 3GTGH 2KZRA 3AU4A 3BYTB 1B44D 4KLKA 2RSOA 3W3AA 1F9PA 2KXJA 5NUCA 5BN5A 2LVQA 2Z1CA 2UUAQ 1JRPA 1K8MA 2EYOA 4FDBA 1YJ9A 5C3XA 3GB1A 4BBRG 2AX5A 1B9NA 4N59A 3H6NA 1PFSA 4QIWB 3KUZA 5JJLA 3AULA 4MGIE 1MKHA 3L54A 4EVOA 3MJWA 1SSOA 2Z9HA 3KDFB 1V8QA 4JG2A 2FIDA 3DPDA 1JT8A 3A9JB 2A1AA 3I57A 2JA5H 5C0XG 1FO4A 1N36L 1ZEQX 4LNFA 1QQRA 2RDGA 4HWIB 1BVSA 4BBNF 2B2YC 3S17B 1WM3A 4P1CC 4HJKA 3D4DA 1HXYD 4RHRA 1H9SB 3PHXB 3SK5A 3FKIH 2N3SA 3BDCA 1E3PA 2WDQB 1I6HH 2C9OA 3EFXD 4R1JA 2LHDA 2DZJA 2N9KA 4BA1I 1F2RI 1U0LA 2DZMA 1GVPA 3QA8A 2DBYA 3K8AA 1R9TH 5C4JB 1SEBD 5LXHA 2V4LA 1NY4A 4HJ7A 2LZ6A 5JXVA 2XK5B 3RNGC 5AJ3Q 1SYFA 1AN8A 1CKNB 2RVLA 5G3LD 1HRJA 1JE5A 3W5OA 4AQYQ 2WS3B 3AU5A 2LKVA 4W9CA 2JQRB 5LMNL 1IBKL 3AECB 1TWGH 2ZT9C 1STNA 4B3SL 2C7NB 4XDXA 1M1KC 2WAQE 2O2VA 4MM3B 4DWFA 1SNOA 5FJ8G 2JVCA 2REXA 1Q8KA 1PTOB 2KN4A 2NZOA 4N8FA 4A3GG 4G7OC 1E6EB 5CGKA 1Z9FA 1V1PB 2KC1A 4K3BA 3RULA 3SR6A 1R7SA 3C1EA 4JI1L 3ZIMA 5HGQA 4PYUA 1OEYA 1GB4A 4U673 1A62A 3OIQA 4NNJB 3CIRB 1TVXA 1KXLA 1UE7A 4LFAL 4EFOA 3H94A 4I7AA 1QT9A 4LK0M 5C1ZA 1LTGD 3EIVA 4OIKA 1WJUA 4MSMB 3ZKJC 3AFQA 1F2MA 4DV7L 1UAPA 3AYHB 5F2DA 1C0AA 2E6XA 4D2KA 1RFKA 1AARA 4AIMA 2MJ3A 1NTGA 4LW1A 2A69C 5C5MA 5KYIA 1XTCD 1JWAD 2LGIA 1YNJC 2J52A 1LM8B 1R4NI 3MJ5A 3E5SA 1WD0A 1GG3A 1XT9B 1Y1VB 1X65A 1Y8OB 3HEJA 4XYCA 3I4MB 4WAAA 4LWCA 4IOIE 1G291 1LTID 1S3OA 3S2DB 1FNWA 1O7LA 4C3HB 4A3BB 2LJ5A 4ARCA 1JWSD 4JOIC 5HY6A 1WWTA 2IO2B 1YJNA 3BU2A 2DHZA 2K7VA 2QDFA 2C35B 4M8MA 1Z47A 4DV5L 2H4OA 2UUCQ 4JI4Q 2PJHA 5IGBA 1Q82C 2K8BA 3KDFA 1LLRD 4C56C 4KDIC 4P6VF 3A9JA 1FR3A 1R4QB 1CI3M 2EPBA 3Q24A 3W5UB 4RCOA 5IP7H 2KJXA 3H91A 1TJEA 4ZAIA 1YX5B 1B9RA 1S5FD 2YEPB 3TUOA 1SYBA 5JAVA 5BR8L 2UUBQ 1K8AC 2F0NA 1H9SA 4YCWA 1DONA 1UE6A 2G45B 2DNEA 4DR7Q 3NUHB 1O7IA 1TZ1A 2E2DC 3G4SA 2OF1A 2A5HA 1NCVA 2KBNA 1ET6A 4LFBQ 3TP8A 4P16A 1GJXA 2ZW1A 5JHAA 4ODGA 2WXRA 3Q3MC 3APCA 4FXCA 4R9WA 3K59A 4OWWB 3J7AV 2WXFA 4DV4Q 2WXHA 4RMAA 1XWEA 2ID0A 4BKSD 1TS2A 2XK5A 5IWAQ 2BWES 1EO6A 1SF0A 1UZXB 1CKNA 4RCNA 1L0WA 4BY7H 2GLSA 3RPFC 3PO3H 3MEFA 2Z0EB 1OXXK 5IT9L 1IKMA 3KW5B 3G71A 1EY5A 2X6GA 3GTQH 3QWNA 3NRZA 4IOAA 4MM3A 4AUQC 4US8A 4C3IB 3TRZA 1HFGA 1XNQL 5FKAC 2G4SA 2SAKA 2XEWA 1KNEA 1STGA 3EVQA 2Q5WD 1S40A 1V1PA 1Q90A 3RT3B 3B2FA 4JI6L 1AP0A 1I4PA 1WCMG 1UH6A 1ZPSA 2RR9A 4C00A 4CKEA 1C76A 1HZ6A 4KJOA 2NN6H 2TSSA 3C1FA 5FO8B 2GBRA 2CFMA 3J80E 4ANUA 4MGZE 1K3RA 4HSVA 3IVFA 5IN7A 2K28A 2X69A 2MW5A 1NNXA 1QOGA 4LNNA 4EOYA 1MI2A 2F52A 2KX3A 2LY7A 1EQVA 4HN7A 1LABA 3I7FA 2VW9A 3U2SC 3I56A 3MHSD 4GN3B 4WRDA 4C7YA 3H0GH 1E2WA 4LF8L 2MO0A 2K5PA 3T1YL 3OWEB 3PLVA 3UF8A 4AYBB 3UI3A 1X3GA 4X64Q 1N61A 4FYDA 1SYCA 3CCEA 3AN1A 4ZRQA 2IT1A 2KLCA 3T53B 5M3MB 1T5EA 3VHTC 5FR6A 1J0GA 4CDDC 4X3UA 1XMQQ 4CJ1B 2CU1A 2IY5B 1RM6C 4ZYNA 3P20A 4GOCA 4XQJA 3UDIA 5IYCG 2JA8H 3PRMB 4WWMA 1VQPA 5IO9A 1DGSA 4KDLB 4IKGA 2E76C 3UINB 4F1SA 1XYIA 1Q7YC 3PIO3 2R92G 3RZOB 5BYSA 5EGTA 2MGSA 2QCPX 1TIFA 1XCQL 5JEAH 1ML0D 3PUVA 2X38A 1E0BA 4KMUC 1QWYA 4DR2L 2WDVB 4HJGE 3L17A 4HMIA 2Z8LA 3EFUA 4KKSA 1D1IA 3NE5B 5A2QL 2KAJA 1MG8A 4KKUA 5LHY1 1RFAA 2V1CC 3KLSA 3R2IA 3KYDD 4PT5A 3RMKC 1WJJA 1C1YB 1HA6A 3HFZB 3K5OA 5C3EB 5FR3A 1WJNA 2PI2A 2L3ZA 2HIVA 4Q0FA 2UXCQ 2VZKB 4GNXC 2K22A 1XPRA 3GZNB 2JWZA 5JJIA 1MFWA 4N6EB 1RODA 5IA7A 4LUOA 4B95A 3RMHA 5C4XB 3VYTA 3M3JA 1PFBA 3E9IA 3U9SA 1XNRL 3UIOB 1YHBA 3GTKH 2BE5C 4A3JB 1WH3A 3ALBA 2GBJA 5IAAC 4ZDVA 2I5MX 5EAYA 2AYOB 5AZHA 4IFDH 1L1OB 1WFYA 2JRHA 3PLUA 1CZGA 2OWOA 4X3SA 2KVZA 4RGNA 4KKTA 1PH1A 1KOTA 2HHHQ 1IL8A 1QOFA 4FADA 1C4QA 3OJ4B 4L2YA 1SMXA 1TT5B 4A3KB 2K6QA 5ELDA 3CC7A 3OW7A 3KLWA 2LWPA 5IGFA 1J7CA 3JC66 3J7ZC 1MGSA 2K39A 2WXGA 3RNBC 4DDID 5E7NA 3BIID 4NW2A 2N8NA 4JCVE 4MZ9A 2ZNVC 1RTNA 1QVCA 2MX2A 1J7AA 4HEA1 1K0RA 1K51A 1IZ6A 2VRRB 5J39A 2L83A 4AQYL 3GTJB 4USAA 3I55A 4HR7B 4NQLB 1EY7A 3MC0B 2EY6A 2OXPA 2HE7A 3VR8B 1YBYA 1UWVA 4FVMA 1UE1A 3NEMA 4L5TA 1F2RC 4NJ7A 1TWFB 1N6ZA 1LT6D 2BBCA 1YOVB 1J9OA 4JI0L 3RN2A 4L5SA 3STBD 3DVNV 1MSHA 1N34L 4P7IA 3VTVA 1YD8U 3VTUA 1UD7A 2CH4A 3G6EA 1SIFA 2L4NA 3ZRCA 2VXWA 2CW0C 2E75C 3LJ3A 4OVUA 2WXOA 2UXDQ 4XWWA 1FJGQ 1G6JA 2MH7A 2B3GA 3J80c 1WFQA 1HCZA 3DWAA 1I4HA 1GHKA 2D10A 3HOXH 4M01A 4ZRPA 2HUGA 3KBXA 5CV7A 3CCUA 3K7AB 1BCPD 2I5LX 3CU7A 4HPLB 4IM0A 1MG4A 1WI5A 1YMHE 4F8CB 3J7A5 2F0IA 4GN4B 4PV1C 3RZDB 4A55A 3GTOB 3PRPB 3ZDMC 2CJNA 1CKOA 1Y1VG 3PSIA 3W1SC 3P42A 1CQVA 5AUKA 4ZLTF 4DAVA 4C3HG 3FHWA 1VDVA 2JXXA 5DPRA 1SLJA 2JZZA 2N9XA 3PQIA 3FAHA 3ERQA 4TQ0A 3RN9C 2ES2A 2SOBA 1VF5C 2KLGA 4HIMA 3HOVB 5M3FH 3S14H 1N8RC 3MP9A 2E2JB 1PLFA 1G91A 1HJPA 1L6VA 1RHPA 3PZDA 2ZM6Q 3DVGY 1L1OA 1BQQT 1YEZA 2B2UA 5TSSA 5DPTA 2N88A 4URKA 3T1HQ 4A8XC 2RPQA 2UYZB 4OEMB 3EUB2 4ARIA 4IUPA 2UUBL 2N7EA 5EKIA 2R2OA 4GB9A 3CCLA 1WZ3A 1XCTL 4IFDI 2BTEA 5D65A 2A4ZA 4TSSA 2WXKA 3I4NH 3TP7A 3HM3A 4RM9A 2D5DA 4DR1Q 1IBLQ 4WWNA 1HNWQ 3EQLC 4HIOA 1Q8IA 3MWYW 4WQMA 2NVXH 2N7DA 1E2VA 3CHBD 2ZCCA 1F2YA 1DGJA 2PCFB 2N4FA 3OJ3A 2VB3X 3GE8C 1ILPA 4XQQA 5EBDA 4YCUA 3X3NA 4L5QA 3CPWA 4W9DA 2FMMA 5AFWA 4IWOA 4M0WB 4XGAB 4JVZA 4YHHQ 4BKTA 3AU7A 3TMEA 1N62A 2G9DA 3SVMA 2F0PA 4ZKCB 2NVYH 1I4RA 3DWPA 3DUZA 1ZXIA 3MHZA 1X54A 5BMHA 5M5YH 4A93B 2V0GA 3G6JB 1K8OA 3ND9A 1WF9A 1X56A 4C2MH 1VQ5A 3AH7A 3D32A 4YL8A 1Y1WH 1SMYC 4PS7A 1CJEA 1SE3A 4JOIA 2EJFC 4LF9L 2MQHA 2H88B 2ZXPA 3A74A 2K03A 4PQXA 3AE6B 3V62A 1VQFA 2KEDA 3KK7A 1XD3B 4EGVA 4TQUS 4HTHA 2R7ZH 1FYCA 3F2CA 2DJGC 4ZQ3A 4X64L 4PMCA 1TWAH 2PW5A 2KJHB 3IL8A 4E6IA 2KMMA 4AYBG 1EYAA 1FXAA 2VH2A 4GOPC 3DXJC 4KY7A 1ICWA 4IURA 4LNQA 2D07B 4GGQA 2KJRA 4OWTB 1B7YB 5T1IA 1Q10A 1CKMA 2B29A 2A6HC 2KHJA 2Y5BB 3PIOA 1EUVB 3NG0A 5GROA 3NTKA 2PMVA 2R6GA 2FCNA 4BOSC 2JA6H 3NHEB 1TS5A 1I3QH 4GNXB 3R3OA 5G5GA 3GD7A 4K2LA 4ABNA 4IM2A 5IYDH 3PRZA 4A3MH 1SE8A 3SHQA 1KABA 5KRUA 1HZAA 1CZWA 3PO0A 1A2UA 2NZ1D 5CBEE 2F4VQ 4HIDA 1HUNA 3WDNA 3AMZA 3EHVA 4GLSC 2DY7A 3BVZA 5E1FA 1Y8RC 3ZNGC 1M8AA 2ZPYA 3QQ8B 3CCQA 4A3EH 1MBYA 3WALA 2FAZA 1II3A 4PG3A 3K81C 1FM0D 3GZNI 1OQRA 1VQ9A 2BA0A 4DU9A 1SN8A 4HCSA 1K83B 1LQBA 1V6EA 1H9MA 2ZXOA 1A2TA 3Q23A 5G55A 2M0AA 3CKIB 3U30A 3A33B 3X23A 3K0XA 1F2LA 4II2B 2CWPA 4A4IA 1WGYA 5COYA 3OPOA 3IFWB 3NK9A 2ZTDA 4UDUC 1SIJA 4IALA 2D3CA 4HIKA 2INPE 2I0QA 3SDLC 2WV6D 4BOZB 4A3JG 4GKJQ 1X3FA 2F0JA 3B2GA 3BG3A 2NVQB 2PZUA 3I91A 2WP8J 4M0WA 4JPSA 3ZRFA 1G6ZA 4NKLA 1T0YA 1G2TA 3K9PB 3CW2C 1VQLA 4POFA 4YXDB 1IW7D 2L1BA 1F77A 1CM9A 1GKHA 5L95C 3K7UC 2HQLA 3V96A 2MFIA 3HOZH 4J6IA 4L1BA 4JC0A 2AHOB 4A3KG 2RDFA 4XDDA 3M9BA 1VQHA 3I2ZA 1RDPD 1VRAB 1PRTC 2FE8A 4R4TA 4MT5A 3RLOA 2F0SA 1B50A 2VL6A 3TP6A 2F0LA 4REZA 3S1QH 3Q2AC 4DR5Q 3NWTA 3RLNA 3CQZH 2YTVA 4OVVA 4IWQA 3NSWA 1V5TA 2DYMA 2MUYA 2MBQA 1TWCH 5IOIA 1OGWA 1CTMA 2UXBQ 1K52A 4HMJA 1SYDA 2B8GA 1ESFA 3TEWA 1NE3A 2O5IC 3V61A 1P3QU 3NTIA 3NUCA 4DAMA 4TQ1A 2KVMA 3Q8BA 4HXDA 1OXTA 4APVA 4JYAQ 4H02A 5GAGC 1EIGA 3MEHA 1JW9D 1J8CA 3QHTA 1NENB 1GD7A 2N9LA 1SE2A 2EXZA 2D2QA 4DV0Q 2PQAB 2DLBA 4LTUA 3GDEA 4GNXA 1WX9A 3RYTA 4Q5VA 3NY5A 3UQAA 3SXHA 2XN9C 1VQ6A 3S16H 3M62B 4RF1A 2PW7A 4FXKC 2WKCA 2E2HB 1ZKHA 3U7ZA 5CORA 4X66L 1H9RA 2K5HA 3SR1A 1FJGL 1KLUD 1S5ED 1Y69U 2VQEQ 4JI7Q 2LD9A 2MJEA 1ZYRD 4OO1I 4C3JB 1KAWA 4BBRH 1PGXA 1MSGA 2HDLA 2DGYA 3Q14C 1FNUA 1ICFB 1R4PB 1Z6HA 1DOLA 3GV3A 4K8IA 1V49A 2GBNA 4IQZA 3P7JA 3LXFA 1UUPA 4DPGA 4OO1G 1EL0A 3SK4A 5MPOA 3RLFA 2FCSA 3OMGA 1B3AA 3VQIA 3OSOA 2KWCA 4XC2A 2N9PC 4LUVA 2WHIA 2KOXA 2D62A 4JLCA 2MSED 2KDBA 1Q86C 5GADC 1D5ZC 1NDDA 1E7PB 4NY0A 4NP5A 2KCTA 5EPKA 3D8GA 1HHVA 2AQ3B 1XLPA 3HOVG 3TQYA 2ZM6L 3KH0A 2BWFA 2W82A 2R7DA 4N8X1 1EU3A 1PYBA 1LTTD 4X57B 2K14A 3VR3A 1IBMQ 3AE7B 4QJFA 2CWAA 3ETRA 4W9JA 1L2NA 4Y7NH 4K1RB 2ZZPB 4A3CH 4ASWC 2R2QA 1XLNA 4R4OA 1QCBD 3K5NA 1ONLA 1YVCA 4EQOA 3ZXRA 2IHEA 1DOIA 2B2TA 4IJHA 3S24A 4DGZA 3I4OA 2Q2TA 4IUUA 4KHPQ 3DBSA 1E10A 1PH6A 1M90C 1HTOA 5IIFA 3P1HA 1Q81C 2Q2UA 3M3YH 5LMNW 2AQ2B 4WFN3 2KHSA 1JROA 4WORA 4GIVA 4POGA 1VR9A 3Q3NC 1D2BA 2K05A 3CSFA 3QIAA 5GMVA 1A3VA 3PCOB 3QJZA 5IP4D 1H8CA 4DV6L 2DAFA 2J0MA 1IKLA 1YJJA 3EA6A 4ZKBB 1FXTB 5M9OA 3I5JC 5JEAJ 2Q2IA 2XWBB 3T16A 2YU9B 2XTIA 3SHLA 4YWGG 4BBSH 1BKBA 2PQAA 1SDFA 4JI3Q 3QJYA 2N7JA 4CKBA 4KGRA 4L8JA 3PPAA 3QOLA 4LMQD 5K36H 3SU8X 3ZJVA 1N32Q 3HIZA 4QQBX 1U9RA 2F0GA 3I73A 3VA7A 3IAYA 4IPDA 5LL6X 1F1HA 2BF8B 2M17A 3NZSA 1JQ4A 3E9HA 2F0TA 3AE9B 1NYRA 2X8XX 3TL5A 2WKDA 3N1ZC 4FBJB 2EELA 3DM3A 4LFCQ 3J80L 1HZBA 3VA5A 3P75A 1D5MC 3HZXA 2KO3A 3U4ZA 2VH1A 3NTHA 4DUYL 3AB5A 3R7QA 2BS3B 3DBHB 3SDZA 2WAQG 2KFJA 3VRAB 5D3DA 4NZLB 4JBMA 2JA7H 1IYUA 1PRTF 2MBEA 4GU2A 5IYBH 1CFMA 3H7SA 3MHBA 1MHHE 3SFDB 3QARA 1SYGA 4ICUA 3HOWH 1QNUA 4JPBW 4IFDJ 4C80A 4A9AA 2VS1A 3IG3A 3VR4A 5FOBB 2HCIA 5BN3A 3F2BA 1K28A 2DNCA 1F52A 4A20A 2CCZA 5C0XI 1QZEA 3ZJTA 3S15H 2OTJA 2VZKD 4MEMA 2PIAA 4P1BC 3ULLA 1DOYA 2EY5A 2B63B 4RKLA 1QOHA 4OVZA 1EY4A 3ITPA 3RD2A 1RKNA 4PK1A 2RA4A 4IUQA 2KUMA 2Z6KA 1WRIA 3IXSA 4IM3A 2R61A 1XLOA 3QO2A 1H4RA 2PMZE 2F1MA 1TIID 2BA1A 5I6YA 5IGDA 1SAPA 3X3MA 2FIFA 2MCNB 4O42A 2KMAA 1PZJD 2INDC 4RNAA 2JXMB 3PF5A 2KHWB 2V4DA 1X32A 1A70A 2LS01 2MWSB 1F0ZA 4J1MA 4PZ6A 2EYHA 4X6AH 2HJ1A 1HR0L 4WIPA 4UPAA 1V9JA 4RHSA 1WCMH 3A8JE 4JI8Q 4CDCC 2MNAA 3GTLH 1S1QB 3HHMA 3VH4B 3TS0A 2NPTB 4XTCS 1FNVA 3S2HB 2I1KA 3GTMH 1BUVT 4UAIA 2LVOA 2BDNA 3PZ7A 1A3UA 2ENBA 4DV3Q 3L3OC 2KN5A 3KUDB 1VQ8A 5CV6A 5CC4A 5HHDG 3PO3B 1HEZE 4FP5D 3HOYB 2GVBA 2OOBB 4F88A 4DV2Q 2A74C 2ZW0A 4GDKB 4NMZA 1SFOH 1JOQA 4DDGD 2Y5CA 1VQGA 1EY9A 1RTOA 3CCMA 1CSPA 5LMUL 3JAME 2WX1A 3PT2B 4HROA 1W6KA 1Y8PB 3S1MH 2D3BA 1U5KA 1NYQA 2XSCA 2A19A 2EY2A 1EYCA 2B2VA 3BDLA 1OXSC 4ITKA 5BYQA 2A69D 1EWHA 4DR5L 1LT4D 5D14A 3WIMA 2EVBA 5DAUA 4R3DA 2A68C 2L0TA 5IYCH 4H2AA 2GBMA 4RFBA 2UXBL 2Z0DB 1LACA 3PTFC 2INCC 4FO2A 4F7ZA 3K5MA 2R92H 4HCEA 2I38A 2M00A 1K73C 3ZQ4A 5T1GA 3VYRA 3RNAC 4BZAA 1FGBD 1SROA 3B08A 4JYAL 1CA6A 3DEPA 1SNPA 2R93H 4EQPA 1PH7A 1PUTA 1AE2A 1PVOA 1K3BC 2JK8A 1YJ1A 2LGXA 3O65B 2BB6A 1Q3LA 4ZCKA 3KF8B 4FHJA 1F9SA 4FJYA 1QZHA 1JB7A 3EN2A 1E8WA 1PYWD 2IO1B 3I4LA 3GTPB 2DYBA 3FP9A 3BZDB 4BWGB 2KDFB 2BH8A 2AMCB 4OGQC 1YQ3B 3I8ZA 1CUKA 2VQEL 4JI7L 1X9NA 3ABVB 1CT1D 5KNDA 4KN4C 1KDAA 1ILQA 1GUGA 4C3JG 1Q1EA 1SSNA 3RNFC 3NOBA 4DKAC 1K50A 4WAFA 5C44H 1E90A 2FFKB 2WFWA 1YNNC 4IOCA 1I50H 4DR3Q 1EFID 1CZPA 4GMVA 4DHZE 4RWSC 3A4SC 3U58A 1GHJA 3UGBB 4LF5L 1TYGB 2YLMA 1HZCA 1E22A 5C6AA 2XRSD 2OJRA 4MH8A 1YITA 1EQQA 4KHPL 4LNOA 1WTWA 3C2PA 3S17H 1UEAB 2BT6A 3J81j 2L32A 1IPGA 3VR6A 2NPTA 3ZLZA 5ELBA 3JYUA 2E5LL 1U4PA 5IY0A 2CS4A 3KQ4A 3TN2A 4JQWC 4K7WA 3RCZA 2BDOA 1X3QA 2EOTA 3PMFA 1E7ZA 1C4PA 2LGDA 5HFYA 5C4JH 3HOUB 3L2PA 2F0DA 1GUAB 2P5ZX 1A0IA 2DJFC 3KYCD 5C4ZA 4W9EA 4XXEA 1AWDA 2WU2B 4GDKA 4FA6A 1EWCA 1D1KA 1XXGA 4NXMQ 1NI3A 1B3QA 2MBHA 2KNBA 3LWEA 3HRDD 3T8MA 2K6DB 2KCNA 5J2RA 4KTAA 2HIXA 4X62Q 1PXUA 2PKOA 3N3KB 1SNQA 2F0UA 3EBEA 3NXWA 1DM0B 5KYLA 1NVID 4IDIA 3OW2A 4W9FA 5JZEB 5DPWA 4A3PA 4E71A 2ALYB 5CV8A 1PTOH 1TKYA 3VXWA 3SEBA 2PVOD 1P7EA 1B70B 5TR5A 4IPCA 2NBUA 4PS3A 2IPKD 3W1BA 4YY3L 4WURA 1GAQB 1L6UA 3QAQA 2EYJA 4V0BA 1HUMA 1C4AA 2L1AA 3JVZX 1VQ7A 1Y56A 5JPNC 4TKOB 2ACZB 3GP7A 3MC8A 1XMOL 2K04A 2N0SB 3VR5A 2KQ3A 4B3RL 3KF8A 1MPEA 1XTDA 4X3TA 3P4QB 4CKCA 4DV1L 1P7FA 1RCVD 1HQMC 1I4QA 4KY5A 3J7YW 1N33L 1N32L 4YSZB 4UP8A 1T0RC 4RG1A 4RA8A 2BYEA 5FO9B 1Y1VH 2QEXA 1VQKA 4DR4Q 2JYTA 3I4MH 1PH2A 1HNXL 2CH4W 1TKWB 3ECIA 2K50A 3S2DH 5L83A 3TZUA 4A3BH 4C3HH 2D0PA 3CC4A 4BXXH 1C77A 4OONA 2IO3B 3IKJA 3CC2A 2K8HA 2PEAA 2QSDA 5CHFA 1QE6A 3ERSX 3L0OA 2XIWA 2WINB 3MXNB 5E4WC 1QZGA 1KF6B 5J18A 3UQBA 3PUXA 3VYSA 1YJIA 2AEHA 3F1ZA 1J8IA 1LTAD 5KNCA 2BQQA 2WXPA 2WGSA 4CDEC 2UUAL 4MHEA 2CKZB 1MHXA 2Q8TA 4BY1H 1ET9A 5LLIA 4B3TQ 3VFKA 1F9JA 3M95A 2LRWA 1JORA 2RBMA 2BVCA 2G1EA 4KJNA 3P4SB 1WSPA 1IYJB 1BUIC 1Z5SB 2B8FA 4F87A 2JEAI 4DF7A 3L7ZC 1MD2D 5ELOA 3QB3A 1U4AA 5BMGA 1QOBA 4ILWA 2KDEB 1JJ2A 5G3LF 4ZK9B 4FF2A 2FJ2A 2B63G 4RGOS 2KENA 4HPPA 3K80C 2GB1A 2RSUA 1VQ4A 4CHKA 5DM73 1VQCA 3L08A 1FCCC 3OOCA 3QC8B 3Q0AA 1TWHB 1DXMA 2JSOA 2XVSA 2V1YA 3DHHC 1AEXA 3URYA 1YX6B 1WXAA 2J53A 3ZDTA 1NR4A 2LI5A 4AQ7A 5IE8A 1GM5A 5CTRC 5LNK1 2M9VA 4A76A 3BVMA 1C3TA 2VZAA 3GOEA 3AEEB 1JE4A 4C3IH 4ANVA 1FFVA 4YT0B 1UELA 2G9HD 4LNKA 1V1OA 3I4NB 4HJ5A 2D5GA 5E6PA 1KH0A 3FRPB 1CK1A 5AJ3L 2WU5B 2FMCA 3B9JA 1KM7A 3M4OB 1HZ5A 2QDBA 2MHVA 2F3IA 2PQEA 2WIIB 3CMAA 2ZPNA 1V80A 1LTRD 3DMUA 3S2AA 4FJZA 3ENEA 4OXPA 2PO4A 4Y52H 2Z4HA 1I42A 1WTPA 4DV2L 3PO3G 3HOYG 2CU3A 2ASBA 3AEBB 1VQNA 1AYFA 2IO0B 3DVNU 3A4RA 1N60A 3B1LX 4FJVB 2MJDA 3W2DA 4JL9A 2KA7A 2NTTA 1WRDB 2V4IB 4YTPB 2RGFA 1GUOA 2BYVE 2G5DA 2EY1A 5M3MH 2NN6G 1YQ4B 3V6CB 2AUJD 1H9JA 5KNBA 3H3VI 2E74C 2BYTA 4LK1C 3LNNA 2Y0SE 2Q2HA 3MXNA 3UIPB 2NWGA 1AFPA 2O6VB 3OG5A 4PYZA 3OYYA 3E6ZX 4GKKQ 1YJWA 2QKIC 3SGIA 3KYHC 4RMFA 3RZOH 1ISNA 4EQ5A 3AEDB 1ZP0B 3H0GG 2B2YA 2KHIA 2GA4B 2K5WA 5C5LA 3P63A 3AI5A 4HPMB 5FLMG 3STBC 5JJKA 5DEHA 4JI4L 2UUCL 2L15A 2HTHA 4EUTA 1O78A 4N9TA 2QC8A 3M7GA 1VZ7A 2FBWB 3V3XA 5C3EH 1S5BD 2WXLA 1VQAA 2RCNA 1KD1C 5DNFA 1IUEA 1W6JA 1A6XA 1QOAA 2VUMB 1SRUA 1BT0A 1I94Q 3AE4B 3M63B 1KAAA 2B76B 1OQQA 1V97A 2F0FA 4A3IH 3TP5A 5C4XH 3PZ8A 1F9QA 1PZID 3HVZA 4GLAC 2IY1B 4DR7L 4KI0A 4A3JH 2OT2A 3UE0A 3NZUA 1HPCA 2WNMA 1BCPC 3A54A 5FK9C 4FF3A 2KFKB 4LFBL 4XT1B 5JOBA 4ICVA 2G3QB 1TBEA 1TU2B 4A3EB 1WGHA 2NBVB 4F8MA 2F3VA 4CO7A 4TVAB 4DV4L 3VTWA 1SNMA 3SK8A 5GAEC 3C46A 2DZKA 2L05A 2WWZA 1WY8A 3M4QA 5ELFA 4XDCA 5IWAL 1JWBD 2BYFA 3A9KB 2K5QA 2WXQA 3TDQA 4IC7B 4MSQB 1Q5WB 4CHTB 1VQBA 3CF6E 2NR2A 4KSLC 4A3LG 2H5XA 4A3DB 3N1YC 4HJ8A 1XPUA 2MBBB 2WB1E 3HOUG 1HH2P 2PMZB 2L8JA 3F8TA 4DFAA 1P98A 4KN7C 2EJGC 4C1NI 1LXDA 4MTNA 2E2IB 3ZTDA 4U68A 1WM2A 3GTJH 2LUMA 5GAHC 2IGGA 5CX3A 1XJVA 5D7GA 2AWOA 2SNSA 2KANA 3R66C 4W9LA 2GOWA 2M19A 2RDBC 1TS4A 3CD6A 1TWFH 4OX9Q 4YTNB 1AH9A 2MRPA 4RGMA 1ENFA 1Y14B 1WXVA 2QEJC 5HI1A 1FD7D 1NUCA 2EIFA 2J4XA 2A6HD 1WYDA 2KCCA 4QGUA 3A5UA 5JVH3 1EWYC 1PFDA 2Y5PA 5CHWA 3QK0A 4K5VA 1VQOA 3TEZA 3RR5A 2IGDA 2AWNA 1UBQA 2NVUI 3CCVA 3ZTCA 2WAQB 4WWPA 3KJPA 1IYFA 1J5EQ 2D3AA 1VQDA 1WTOA 1WTXA 1XMQL 2C9WB 4TV3A 2N55A 3AB9A 2IDYA 4N9PA 3FMCA 1E7VA 1KRHA 3IRBA 1V86A 2IGHA 1QILA 2JN4A 3K7AH 3M4PA 3KLSX 4OO1H 3SK6A 2K5DA 3RZDH 3T51B 3FDTA 4L63B 1F2ZA 3GTOH 3A7AB 2B2WC 4G57A 4DR4L 2LVPA 2WYQA 1PGAA 4HDQA 1CHQD 4O2DA 1DOKA 1FVIA 1DOMA 1TKEA 3IFDA 2MO1A 4H7BA 3DBLB 2IX1A 3QWZB 4LF4Q 1ZOYB 3PV0A 2PI2E 2EKEC 2KFKA 3HOVH 5BMIA 3AEFB 2E2JH 2UXCL 1TTNA 3FILB 5KHOA 3ZO5B 3OHXC 1OTCA 2NVTB 3CCJA 3N20C 3A5ZB 3NS8A 2F0MA 5HG2A 2A6EC 4B3TL 1EF5A 3WOFA 4R4IA 1WTRA 4NQKE 3TEHB 2FCMA 4XWTA 3FEWX 3U4VA 3M7NA 1GXDC 3A9KA 3R93A 3PO2B 3AM9A 3APFA 3VYUA 1RF2D 5EPLA 2BKRB 2HQEA 2Z6BA 3AEAB 3W9CB 3CWIA 3Q8CA 1N36Q 3EGRA 4M00A 3ZGZA 2A73B 4BAXA 5E6OA 3VAWA 3UE1A 1SE9A 3MXUA 3DLLA 4KY6A 1V1QA 4A3FH 2ZNVB 3A55A 3L16A 3RZWC 4LNIA 1FCLA 4XZ4A 2F0KA 1D7QA 1WX8A 2IBIB 1KC8C 1PRTD 2X6LA 3L0WB 1IL2A 2HHHL 1IGDA 1JRUA 5M5XB 3PSEB 4XQNA 2WDRB 3J81E 2KWDA 1R4MB 4YTMB 3DHIC 3N32A 4DHZB 1TY2A 5EDSA 2EYFA 2IJ0A 1QVGA 2ATWA 3U4EG 1EOTA 4QF4A 2JXTA 1OEYJ 3CRLC 4K7SA 3RN5A 2JX5A 2KWVB 3CMEA 1PGBA 2J0JA 1KQSA 5ELEA 3I4NG 3OWFA 2PLPA 3ZYYX 4JW0A 5LMNQ 1V9PA 2BCOA 4A93H 5LXIB 4B3SQ 2J7QB 4QB4A 1NJIC 5AZGA 1V2YA 4HSPA 3NQTA 4CGYB 1BCPF 2YYZA 1WGKA 3U52E 3ZVVA 1HTQA 1XQQA 2M8SA 3Q3JA 2PZWA 4L6TB 1ENAA 1RLFA 4JI1Q 2KEEA 4FF4A 1FPYA 4AJYB 2EJMA 2K75A 5EE9A 1IW7C 2RKSA 4FHKA 2ON8A 1PH8A 2LXJA 2BH2A 4FN2A 1SNCA 4LFAQ 3TEYA 3MXGA 2ZJPA 4RH6A 3PREA 4B9KA 2EYPA 2K25A 1P1AA 2GMIC 1FIQA 3MAQA 4WWOA 2MBOA 3IAS1 1N9WA 1RL2A 2K3UA 1WR6E 2UXDL 3TIXA 2EE1A 1YNXA 1PTOC 3HM6X 5DLQE 5T8IA 2RHSB 5CR3A 2GI9A 1WTHA 3JAML 2Q8RE 5EKLA 1YI2A 1BBUA 5M5WH 3S1NB 1PFNA 4GKKL 4AS1A 1XEEA 4K8JA 1TS3A 1L0YB 2WP9B 3BYYB 2XGTA 3FILA 4JBKA 2V3SA 5DM63 4RF0A 4S17A 3T3NA 4KGSA 5EE0A 1Y8NB 1EYGA 3GTGB 5C0XH 4DV5Q 1JOOA 2LFIA 1EYDA 4DBGA 4UY8C 3A1QB 2JUOA 1KTKA 1STBA 4O1NA 3NWSA 3LB8C 4GSWA 5EE3A 3OMCA 1E2ZA 3FC4A 3T9LA 4CQNA 3HOWB 3CCRA 1G8ZD 4WH4A 1K83H 5IP9G 3KFUA 4GZYC 2L52A 2PW9A 3W1YA 3L4PA 5E3FA 4DXAB 4IUNA 4FNFA 5BR8Q 1I94L 2VUMG 1VS0A 2N1VA 1RIPA 3T1HL 3I63C 1KL9A 4WJPA 4ACFA 5IYDG 2RQXA 3T56B 3BS1A 3TZDA 2LFNA 2F0OA 3NENA 1TR5A 2SDFA 4GLXA 1PH3A 1IYVA 2CR5A 2HCCA 3FPUB 3NELA 4XE0A 4LLGM 3KOJA 2JA5B 1ROEA 4R4QA 4CDFC 2NVQH 3R8BA 4YWLA 1HR0W 4DR1L 1IBLL 4A3EG 4G11A 1HNWL 2F0EA 2FHTA 5FJ8H 3FKIB 2LXAA 5IKCM 1J7BA 1I6HB 5EJWA 4A3GH 2L00B 4H0LC 2TMPA 2H1EA 4HEDA 1PH4A 2CQOA 2LMCB 2WDTB 3HVDA 3NS1A 1JICA 4K3CA 1R9TB 2VNUD 1MJEA 4ANWA 5E6NA 2K32A 4B0EA 5BYRA 2BB5A 2PPHA 2CHXA 3U9OA 4J8QA 1S5CD 5IGCA 2D3GA 5EKKA 4YHHL 3ULPA 4JI6Q 1PDXA 2RDHA 4A3DG 4DR6Q 4IN3A 1ASZA 1E1OA 2WQYB 1PA6A 3MFGA 3DHGC 2W9NA 4OZAA 2R7FA 4DA2A 1VQIA 2KX0A 1TWGB 2YTXA 1D6EC 4GOPB 3OAWA 3Q6BA 4WJQA 1B8AA 3W1SA 3K9OB 4JI2Q 1LTBD 1KLGD 4JWUC 3J81c 4HKZE 3GS2A 3DCGA 3NVWA 2Z4IA 3OIPA 4HRSA 3D0FA 1GPXA 1A15A 2GRIA 1VMCA 1HFNA 1H9KA 2UWQA 1XO3A 1J19A 4LCDE 3M4YA 2KVRA 1WTVA 2W55A 3WAOA 4KZCA 2DWQA 3HKZG 4RKBA 3L13A 4HAEA 4UP7A 4KGTA 5CBAE 4MN3A 3RNUA 1WGDA 1GUSA 2E2HH 1YNTE 1WGGA 3VR9B 2L55A 2W3RA 1JALA 1EIYB 3H15A 3BDOA 1O7YA 4NDXA 3QR8A 4KK7A 3A1QA 2ZTEA 1TY0A 4C3JH 4M02A 1GUNA 1LUZA 2LGSA 2JEBI 3BK1A 5D94A 1I7HA 1ZXTA 2R93B 4DQOC 2IY0B 5LL6S 4EEWA 3KVFB 5C3JB 2PE6B 4DR2Q 3W5VB 2RF4A 1E5WA 4ME3A 1K8GA 1EZ6A 1BBXC 1HNZQ 2WXMA 3DBLI 2F4VL 4N58A 1LT5D 1JB3A 1XLQA 2RMMA 2KACA 3I70A 4NXNQ 2Y0SB 1X6OA 2ONQA 4LF4L 1Z2MA 2INNE 2K0PA 2L76A 2ZCBA 2DYOA 5I9OA 3S9WA 3O13A 1MHWC 5CYUA 2L7RA 1CA5A 2NBWB 4KV6A 3A8IE 4GN5A 4WJNA 1KFYB 3NZ3A 2K8CA 1X3EA 2M2LA 1ZDXA 3UDFA 4IO9A 3PGZA 1KIXA 1XNRQ 4JK1C 5C44B 2MA9B 1EWIA 1EU4A 2E3TA 2IW3A 1PTOF 3DM1A 1WYWB 2E8GA 5FLXE 2DX5B 4ME5A 1I50B 3EECA 1PMRA 2LMCA 4PMBA 3PO2G 4DNRB 2JZ3B 4OW0A 1E9MA 2PE9A 4GKJL 1PRTB 3ZJYC 4OL7A 2XRQD 3I90A 1K8RB 1QJOA 4NPSA 3AE5B 3S1RH 3AMUA 1PZKD 4GN1A 3HKZE 4RAUC 1YIWA 3Q8FA 4MACA 3K57A 3A8KE 4HCNB 3KF6B 1N5XA 4BY7B 1R4MI 3H1UA 3X0WA 2ICIA 1DJRD 4MTKA 2UU9Q 3GTQB 4PMWA 5KIXA 1C9FA 4GOPA 2YV5A 2K4KA 4OELB 3R3MA 3N9YC 2QA4A 3A0JA 1SXTA 2A68D 2PYKA 1B53A 4LDTB 1L1OC 2KMCA 1SJHD 3QG1A 2K1FA 4MGKE 2B2UC 4A3CG 2OTLA 1TGZB 1I6VC 4DAYB 4KHVA 3NBIA 4KKJA 2EYMA 4JBJA 2HT1A 2YU9H 4KX6B 1SB3C 2NMQA 1YNJD 1C79A 1HZ9A 1SYEA 2JA9A 2AUKA 4XIGS 1QNKA 1PFMA 1ZKOA 2B2WA 4NPNA 1KLVA 1VD2A 4BS9A 4UHVA 4ZHPA 4P71A 2LXCA 4JI0Q 3N30A 2HJ8A 2CVRA 1E8XA 4B08A 2JY6A 2NZHA 2WB1B 4IUVA 1N34Q 1NAPA 1CMXB 3H0GB 3QOJA 1FEHA 2KQ4X 4I6LB 3RZFA 2OEDA 1L0VB 1EQRA 1OO9B 4TUUA 2YEPF 3KWLA 2O6VD 1W2BA 2MP2B 4KKIA 4LJZC 4EZKA 4DV0L 2K5VA 1KDBA 4AH6A 4G4KA 1UNSA 4DK6C 5GQOA 4ZRJA 1RD9D 4HJ9A 2V3PA 2CHZA 5EPJA 1G2SA 4BBSG 3J80i 1LV9A 2JA8B 2F4IA 2PVGC 4AOFA 1YNND 1LM0A 3I3TB 4M8NA 1MJCA 4AWJA 5K36G 4W9KA 3A7LA 1EQTA 2JYOA 1NSNS 3DBRB 2IX3A 3WA0A 2F0QA 4R4CA 2XBBC 1SGHA 3TEXA 3J9CA 1DYQA 4LUZA 3RNEC 4X65Q 5BO4B 3KJOA 5C2TB 1F9RA 1YHAA 1P0RA 3PHWB 5D6JB 4GDLB 2L12A 4LF6Q 2B63H 3FKYA 2CJOA 4YSXB 4IWPA 1STYA 3MTSA 4G7HC 4N9F4 3DWGC 4K5XA 1IHZA 4ULLA 1E24A 1JOKA 1QUQB 3BJUA 2JA7G 2JPHA 4DHJB 1IBXB 1E1TA 5IYBG 4BY1B 1NI2A 4WJWA 4ID6A 3UDXA 1CHPD 3HOWG 4G0NB 2EMTA 2G4DB 4HLEA 2NYZD 4FF1A 1EF1A 3L10B 1B2TA 4K6LA 2QJLA 4KZ0A 1EY6A 5JHBA 3GTKB 3KF6A 4C4VB 1IBML 4LJOB 2ASQA 1PH5A 2YVCA 5J22A 3MZ5A 4M1UB 3TBLD 1JWMD 1FGUA 3P4PB 4MGYE 3P1MA 4TMAB 2KK8A 4J3OD 3B0AA 1V8CA 2FCQA 2JA5G 2YTYA 1I4XA 4KV2A 3I72A 3S2HH 3MFYA 4K0KQ 3APDA 2HDEA 3H6MA 1B9MA 4CJ2C 4DNTB 4L23A 3JSVB 4DAYA
chains in the Genus database with same CATH topology
1ZUD2 1PDQA 1DD2A 1HTPA 4M8AA 5CV9A 4JBWA 2KOLA 2I46A 3L9AX 3V2TA 1RWSA 1C78A 1EY8A 1T6BX 3GQBA 4ZYSA 1BNZA 4V190 3SFEB 2FUG1 3BWUD 1QLBB 2RSNA 5JVG3 4ZRZA 4JE3B 3D6CA 4JX1C 2O5JC 2BOSA 2B39A 3LX0A 3VR2A 4PNYA 4FXDA 3AE3B 1QB5D 5ELCA 3E0JA 4YSYB 4A6QA 4US9A 2K1BA 5BN4A 3Q22A 1YN4A 3D31A 4BA2I 4DXGA 3NVVA 4OHJA 4EE2A 1KDCA 1STAA 1L4DB 3NQIA 3KWVA 3HOXB 2BE5D 2WXIA 2F0VA 2PTLA 2RPVA 2I2YA 1SE4A 1LT3D 1AZPA 2EYLA 1BMLC 1IBXA 2NB0A 4OIJA 1LO5D 2KECA 3C8YA 2D2CC 3PIP3 1U4MA 3IFTA 1M4VA 2I07B 1Q12A 3H8HA 1D4BA 4I7ZC 4B0MA 5M3FB 3S14B 4XYQA 3MVVA 1WVLA 3DHQA 4X3KA 3WCQA 1FXIA 1ZE3D 4QMGA 2VB2X 1WTQA 4A3IB 5HURA 3IAM1 1MI0A 3RUZA 3HG9A 3BVGA 4DN4M 2W3SA 5I6WA 3I9V1 2H89B 4QCLA 1ZDVA 4JWSC 1VF7A 4S3SA 3T4AC 1HA5A 2NVXB 3I3CA 4QUCA 3E9SA 1SNDA 4LAAA 5IODA 4J6HA 3AE8B 3DWMA 2OHFA 2CW0D 1WD1A 2NTSA 2ZXRA 1FMAD 5I2YA 4HKQA 2NN6I 1VLBA 2D9UA 1RJTA 2NVYB 2K01A 4F7XA 4K6DA 3Q69A 1YN3A 5M5YB 1BDOA 4NAMA 3LWUA 4I65A 4C2MB 1O7ZA 5FO7B 3J81L 1Y1WB 4EQNA 3N52A 4B9XA 3CRKC 5C0XJ 2Y3AA 1SJED 2QMTA 1S4ZA 5ISRA 3NP8A 1HQRD 2O2LD 4C1NK 1QKZA 1RYJA 2B2TC 3Q6SA 1EZ8A 3WOEA 5KEEA 1NR2A 2R7ZB 1C48A 3NBHA 1TWAB 5CV5A 2JU6X 4R8NA 2WXJA 5E4XA 1STEA 3EJIA 2K33A 3HRZC 3FVQA 1QF6A 3GO5A 3M85A 3E56A 2JA6B 1OFFA 3K0YA 1TKGA 1I3QB 5JJZA 2L5TA 5H92C 1S5DD 4A3MB 2SNMA 5GXGB 2K6AA 5JEAG 3RD4A 5IT9E 1BR9A 2CQAA 4K2KA 5E6JA 2EDGA 1Q1BA 4R8IA 1UWMA 1C4CA 2J0TD 1JMLA 3ZJUA 4P2CB 3VRBB 2J42A 3HS0C 3C3LA 1U4LA 3HGBA 3PUYA 1GUWA 4K5WA 2W54A 1SMYD 2JE6I 3EROA 1STHA 2JP1A 4K14A 5AUIA 5IGGA 1JR0D 4A3FB 1TQOA 4IFDG 2JZPA 2WXNA 1T5XD 4MIUA 2XNAC 3HOZB 1VZ8A 1ENCA 2V3NA 1DZ1A 1AZQA 4C3IG 1D5XC 1EY0A 1C8CA 3HKZB 3S1QB 1DOXA 3CQZB 1TWCB 2OEOA 3TEYA 1GOZA 1V43A 1OXVA 2O4XA 5A2QE 2L11A 2BS2B 2DN8A 2CHBD 1FRDA 3TSSA 1T3QA 5J1ZA 2AQ1B 3DEOA 5C4HA 3AE2B 3HUIA 4TRDA 2PPBC 1HTLD 2BS4B 1VMPA 2R3ZA 3S16B 1FRRA 2A6ED 5I9PA 2MJ8A 2NUCA 1BF4A 3F2UA 2B2VC 5C3WA 4BBRB 3DWQA 5M5WB 1ESRA 2IL8A 5EBCA 4Z9CB 3RFZB 1UWXA 3LYYA 1JQYD 3AEGB 3KBGA 1VZ6A 1EM7A 2LEKA 2KDMA 1CQFA 1A3TA 2ICEC 2IX0A 1OXUA 3D4WA 4CBVA 2IWHA 2K9XA 4Q2JA 4ZUJA 5I4DA 3KUPA 3G7LA 3H09A 1WYGA 3ONAB 5EQ0A 3HP3A 4DK0A 5JPMC 3K6OA 1TZOA 4Y7NB 4B9WA 2WLBA 1BOSA 4DXFA 4KD3A 1EEID 4XT3B 1MVKA 2EZVA 5IGEA 1NEKB 2WACA 4QUFA 1VCIA 5A35A 1IGCA 4NJCA 1JCKB 3BK2A 4KD4A 3D3RA 4A3GB 1N63A 1UGJA 5FLXL 4G7ZC 1L0XB 3M3YB 4CJ0B 2FINB 3V05A 1Z7TA 5CV4A 3PUWA 5EE1A 1ACCA 2L9HA 3P4RB 3AV8A 1PTOD 3N6RA 3KLRA 2EKIA 2HTME 2M56B 3IT4B 5K5PA 2JWUA 4H13C 4DAPA 1FD6A 4BBSB 3A56A 3GV6A 2PNRC 2DY8A 1EIHA 4ZUIA 2F3WA 3D6WA 1XX8A 4IZ8A 1I4GA 2QF7A 4XYOA 1B4OA 1K53A 2HDMA 3NHHA 1VJKA 2J7ZA 1BCPB 2LHEA 1JC7A 3H3VC 1N5WA 2JA7B 1O80A 5D3IB 1LTSD 1TT2A 4NAWB 3R2TA 1KNAA 1B1ZA 1VDZA 1SBBB 3S15B 3J7AF 3TBIB 4ZOHC 1ZYRC 2L0CA 1L5PA 2QILA 1XF5L 2LJIA 3PUZA 1E0ZA 1L4ZB 4OZCA 5KGUA 2SEBD 3IT6B 2C5CA 4ZHOA 1YN5A 2XWJB 3T13A 1QG7A 3FPPA 3MA2B 2JSVX 4OZBA 4H44C 2MPMA 4YIJA 1WCMB 1EEFD 2MP1A 1FFUA 4KHZA 3GTLB 1JWUD 3Q8AA 2F0WA 1X3PA 2MEKA 3GTMB 3S1RB 5H8YE 2BW2A 1GB1A 3AE1B 3Q8EA 1BXTA 3UI2A 3K58A 4C7ZA 2NBFA 3NVYA 1SFOB 3NVZA 3NPPA 1WXQA 1GUTA 1AW7A 3S1MB 2F03A 4A90A 3ND8A 3K5LA 3D4RA 3MXPA 5HGTA 4DK1A 4FXGC 4IUTA 1BO0A 5CMDA 1DCZA 1U4RA 3T3OA 2Q8IB 2JYEA 2R92B 1ZXHA 3SE0A 5IOCA 2QIEB 5I2XA 2PZTA 4RGTA 5G5HA 2F0HA 3BYTB 1B44D 2RSOA 3W3AA 1F9PA 5NUCA 5BN5A 2Z1CA 1JRPA 1K8MA 2EYOA 5C3XA 3GB1A 2AX5A 1B9NA 4N59A 4QIWB 4EVOA 1SSOA 1V8QA 3I57A 1FO4A 5C0XG 1ZEQX 1QQRA 2RDGA 2B2YC 3S17B 3D4DA 1HXYD 4RHRA 1H9SB 3SK5A 3BDCA 2WDQB 2C9OA 3EFXD 2LHDA 2N9KA 4BA1I 1F2RI 2DBYA 5C4JB 1SEBD 5JXVA 1SYFA 1AN8A 2RVLA 5G3LD 1HRJA 2WS3B 2LKVA 2JQRB 3AECB 2ZT9C 1STNA 4MM3B 4XDXA 1SNOA 1PTOB 2KN4A 4G7OC 1E6EB 5CGKA 1V1PB 3SR6A 1R7SA 3C1EA 1GB4A 4U673 3OIQA 3CIRB 1TVXA 3H94A 1QT9A 4LK0M 1LTGD 4OIKA 1F2MA 1UAPA 5F2DA 2E6XA 4D2KA 1RFKA 2MJ3A 2A69C 5C5MA 5KYIA 1XTCD 1JWAD 2LGIA 1YNJC 2J52A 3MJ5A 3E5SA 1WD0A 1Y1VB 3HEJA 1Y8OB 3I4MB 4IOIE 1G291 1LTID 3S2DB 1FNWA 1O7LA 4C3HB 4A3BB 4ARCA 1JWSD 1WWTA 2K7VA 1Z47A 2H4OA 5IGBA 4C56C 1LLRD 4P6VF 1FR3A 1R4QB 1CI3M 2EPBA 3Q24A 3W5UB 4RCOA 2KJXA 3H91A 1TJEA 4ZAIA 1B9RA 1S5FD 2YEPB 3TUOA 1SYBA 5JAVA 2F0NA 1H9SA 3NUHB 1DONA 2DNEA 2E2DC 2OF1A 2A5HA 1NCVA 1ET6A 3TP8A 4P16A 1GJXA 2ZW1A 4ODGA 2WXRA 4FXCA 4R9WA 3K59A 3J7AV 2WXFA 2WXHA 1XWEA 2ID0A 1TS2A 1SF0A 4RCNA 3RPFC 1OXXK 5IT9L 1IKMA 3NRZA 1EY5A 2X6GA 3QWNA 4US8A 4C3IB 1HFGA 5FKAC 2SAKA 1KNEA 1STGA 3EVQA 2Q5WD 1V1PA 1Q90A 3B2FA 1AP0A 1I4PA 1ZPSA 4CKEA 1C76A 1HZ6A 4KJOA 2NN6H 2TSSA 3C1FA 5FO8B 3J80E 4HSVA 2K28A 2X69A 1QOGA 1MI2A 2LY7A 1EQVA 4HN7A 1LABA 3U2SC 4WRDA 4C7YA 1E2WA 2K5PA 3OWEB 4AYBB 3UI3A 1N61A 4FYDA 1SYCA 3AN1A 4ZRQA 2IT1A 3T53B 5M3MB 1T5EA 4X3UA 4CJ1B 1RM6C 3P20A 4XQJA 4WWMA 4IKGA 2E76C 1XYIA 3PIO3 3RZOB 5BYSA 5EGTA 2MGSA 2QCPX 1XCQL 2X38A 5JEAH 1ML0D 3PUVA 1E0BA 4KMUC 1QWYA 2WDVB 4HJGE 4HMIA 2Z8LA 4KKSA 1D1IA 3NE5B 5A2QL 2KAJA 4KKUA 5LHY1 4PT5A 3KLSA 3R2IA 1HA6A 3K5OA 5C3EB 5FR3A 4Q0FA 2VZKB 2K22A 4N6EB 1RODA 3RMHA 5C4XB 3VYTA 1PFBA 3U9SA 2BE5C 4A3JB 4IFDH 1CZGA 4X3SA 4RGNA 4KKTA 1IL8A 1QOFA 1C4QA 4L2YA 4A3KB 5ELDA 3OW7A 5IGFA 1J7CA 1MGSA 2WXGA 3BIID 4NW2A 1RTNA 1J7AA 4HEA1 1K51A 5J39A 2L83A 4USAA 3GTJB 4HR7B 1EY7A 3MC0B 2EY6A 2OXPA 3VR8B 4FVMA 1F2RC 1TWFB 2BBCA 1LT6D 1J9OA 1MSHA 2L4NA 2VXWA 2CW0C 2E75C 2WXOA 4XWWA 2MH7A 1HCZA 3DWAA 1I4HA 1GHKA 4ZRPA 2HUGA 3KBXA 5CV7A 3K7AB 1BCPD 3CU7A 1YMHE 2F0IA 4PV1C 3RZDB 4A55A 3GTOB 2CJNA 3P42A 1CQVA 5AUKA 4ZLTF 4DAVA 4C3HG 1VDVA 3FAHA 3ERQA 4TQ0A 2SOBA 1VF5C 3HOVB 3MP9A 2E2JB 1PLFA 1G91A 1L6VA 1RHPA 1BQQT 2B2UA 5TSSA 2N88A 4A8XC 4ARIA 3EUB2 4IUPA 5EKIA 1XCTL 4IFDI 2BTEA 5D65A 2WXKA 4TSSA 3TP7A 2D5DA 3EQLC 1Q8IA 3MWYW 4WQMA 1E2VA 3CHBD 1F2YA 1DGJA 2PCFB 2VB3X 1ILPA 4XQQA 5EBDA 3X3NA 2FMMA 5AFWA 3AU7A 3TMEA 1N62A 2G9DA 3SVMA 2F0PA 4ZKCB 5BMHA 1I4RA 3DWPA 3DUZA 1ZXIA 3MHZA 2V0GA 4A93B 3G6JB 1K8OA 3ND9A 3AH7A 1SMYC 1CJEA 1SE3A 2EJFC 2H88B 2ZXPA 4PQXA 2K03A 3AE6B 2KEDA 3KK7A 4EGVA 4TQUS 4HTHA 1FYCA 4ZQ3A 4PMCA 2PW5A 3IL8A 4E6IA 2KMMA 1EYAA 1FXAA 3DXJC 4KY7A 1ICWA 4IURA 5T1IA 1Q10A 2A6HC 3NTKA 2PMVA 2R6GA 1TS5A 3R3OA 5G5GA 3GD7A 4K2LA 4ABNA 1KABA 5KRUA 3PO0A 1CZWA 1A2UA 2NZ1D 5CBEE 1HUNA 3WDNA 3AMZA 4GLSC 2DY7A 3BVZA 5E1FA 1M8AA 1MBYA 1II3A 1FM0D 1OQRA 2BA0A 4DU9A 4HCSA 1K83B 1H9MA 2ZXOA 1A2TA 3Q23A 2M0AA 3CKIB 1F2LA 5COYA 3OPOA 3NK9A 4UDUC 1SIJA 4IALA 2INPE 2WV6D 2F0JA 3B2GA 3BG3A 2NVQB 2PZUA 3I91A 2WP8J 4M0WA 4JPSA 1G6ZA 4NKLA 1G2TA 4YXDB 1IW7D 2L1BA 1F77A 1CM9A 3V96A 4L1BA 2RDFA 4XDDA 1RDPD 1VRAB 1PRTC 2FE8A 4MT5A 2F0SA 1B50A 3TP6A 2F0LA 4REZA 3NWTA 3NSWA 2DYMA 2MUYA 1CTMA 1K52A 4HMJA 1SYDA 2B8GA 1ESFA 3TEWA 2O5IC 3NTIA 3NUCA 4TQ1A 2KVMA 3Q8BA 1OXTA 1EIGA 3MEHA 1JW9D 1NENB 2N9LA 1SE2A 2EXZA 2DLBA 4LTUA 4Q5VA 3SXHA 2XN9C 4RF1A 2PW7A 4FXKC 2WKCA 2E2HB 3U7ZA 5CORA 1H9RA 3SR1A 1KLUD 1S5ED 1Y69U 2MJEA 1ZYRD 4OO1I 4C3JB 1PGXA 1MSGA 2HDLA 1FNUA 1R4PB 1Z6HA 1DOLA 3GV3A 4K8IA 3LXFA 4IQZA 3P7JA 1UUPA 4OO1G 1EL0A 3SK4A 5MPOA 3RLFA 3OMGA 1B3AA 3VQIA 3OSOA 2D62A 1D5ZC 1E7PB 4NP5A 5EPKA 3D8GA 1HHVA 2AQ3B 1XLPA 2W82A 1EU3A 1LTTD 3VR3A 3AE7B 3ETRA 1XLNA 3K5NA 1QCBD 1ONLA 4EQOA 1DOIA 2B2TA 4DGZA 4IUUA 1E10A 5IIFA 3P1HA 2AQ2B 4WFN3 2KHSA 1JROA 4WORA 1VR9A 1D2BA 2K05A 3QIAA 1A3VA 1IKLA 1YJJA 3EA6A 4ZKBB 5M9OA 5JEAJ 2XWBB 3T16A 2YU9B 3SHLA 4YWGG 1SDFA 3QJYA 2N7JA 4CKBA 4KGRA 4L8JA 3QOLA 4LMQD 5K36H 3ZJVA 1U9RA 2F0GA 3I73A 3VA7A 3IAYA 1JQ4A 5LL6X 2F0TA 3AE9B 1NYRA 2WKDA 2EELA 3J80L 3VA5A 3P75A 1D5MC 3HZXA 3NTHA 3AB5A 2BS3B 3SDZA 3VRAB 5D3DA 4NZLB 1IYUA 1PRTF 1CFMA 3MHBA 1MHHE 3SFDB 1SYGA 1QNUA 4IFDJ 4C80A 4A9AA 3VR4A 5FOBB 2HCIA 5BN3A 2DNCA 5C0XI 3ZJTA 2VZKD 2PIAA 1DOYA 2EY5A 2B63B 4RKLA 1QOHA 4OVZA 1EY4A 3ITPA 1RKNA 2RA4A 4IUQA 2KUMA 1WRIA 3IXSA 2R61A 1XLOA 3QO2A 2F1MA 1TIID 2BA1A 5I6YA 5IGDA 1SAPA 3X3MA 4O42A 1PZJD 4RNAA 2JXMB 2V4DA 1X32A 1A70A 2LS01 1F0ZA 4J1MA 2EYHA 4WIPA 4RHSA 3A8JE 4XTCS 1FNVA 3S2HB 1BUVT 4UAIA 2BDNA 3PZ7A 1A3UA 2ENBA 3L3OC 5CV6A 5CC4A 5HHDG 3PO3B 1HEZE 4FP5D 3HOYB 4F88A 2A74C 2ZW0A 4GDKB 4NMZA 1JOQA 2Y5CA 1EY9A 1RTOA 3JAME 4HROA 1W6KA 1Y8PB 1NYQA 2XSCA 2EY2A 1EYCA 2B2VA 3BDLA 1OXSC 4ITKA 5BYQA 2A69D 1EWHA 1LT4D 5D14A 2EVBA 5DAUA 4R3DA 2A68C 4H2AA 4RFBA 1LACA 4FO2A 3K5MA 4HCEA 2I38A 2M00A 3ZQ4A 5T1GA 3VYRA 1FGBD 1CA6A 3DEPA 1SNPA 4EQPA 1PUTA 2BB6A 1Q3LA 1F9SA 1PYWD 3I4LA 3GTPB 3BZDB 4BWGB 4OGQC 1YQ3B 3I8ZA 3ABVB 1CT1D 5KNDA 4KN4C 1KDAA 1ILQA 1GUGA 4C3JG 1Q1EA 1SSNA 1K50A 4WAFA 2FFKB 1YNNC 1EFID 1CZPA 4RWSC 1GHJA 1TYGB 5C6AA 2XRSD 4MH8A 1WTWA 3C2PA 2BT6A 1UEAB 2L32A 3VR6A 5ELBA 1U4PA 3KQ4A 3TN2A 2BDOA 1X3QA 2EOTA 3PMFA 1C4PA 5HFYA 3HOUB 2F0DA 5C4ZA 4XXEA 1AWDA 2WU2B 1EWCA 1D1KA 1XXGA 1NI3A 3LWEA 3HRDD 2KCNA 4KTAA 1PXUA 2PKOA 1SNQA 2F0UA 3NXWA 5KYLA 1DM0B 1NVID 4IDIA 5CV8A 1PTOH 1TKYA 3SEBA 2PVOD 1P7EA 2IPKD 4WURA 1GAQB 1L6UA 2EYJA 4V0BA 1HUMA 1C4AA 2L1AA 1Y56A 5JPNC 4TKOB 2ACZB 3GP7A 2K04A 2N0SB 3VR5A 2KQ3A 3KF8A 1MPEA 4X3TA 3P4QB 4CKCA 1P7FA 1RCVD 1HQMC 1I4QA 4KY5A 3J7YW 4YSZB 4RA8A 5FO9B 2JYTA 1TKWB 3TZUA 1C77A 2QSDA 3IKJA 1QE6A 2XIWA 2WINB 5E4WC 1KF6B 3PUXA 3VYSA 1YJIA 1J8IA 1LTAD 5KNCA 2WXPA 4MHEA 1MHXA 2Q8TA 1ET9A 1JORA 2RBMA 2G1EA 4KJNA 3P4SB 1WSPA 1BUIC 2B8FA 4F87A 2JEAI 4DF7A 3L7ZC 1MD2D 5BMGA 3QB3A 1QOBA 4ILWA 5G3LF 4ZK9B 4FF2A 2FJ2A 4RGOS 2GB1A 5DM73 1FCCC 3OOCA 3Q0AA 1TWHB 1DXMA 2JSOA 2XVSA 1AEXA 3URYA 2J53A 1NR4A 4AQ7A 5LNK1 2M9VA 3BVMA 3AEEB 1JE4A 1FFVA 4YT0B 2G9HD 1V1OA 3I4NB 2D5GA 1KH0A 3FRPB 1CK1A 2WU5B 2FMCA 3B9JA 3M4OB 1HZ5A 2QDBA 2MHVA 2PQEA 2WIIB 1LTRD 3DMUA 2PO4A 2Z4HA 1WTPA 2CU3A 3AEBB 1AYFA 1N60A 2MJDA 3W2DA 2KA7A 2NTTA 2V4IB 4YTPB 1GUOA 2EY1A 2NN6G 1YQ4B 5KNBA 1H9JA 2AUJD 2BYTA 2E74C 4LK1C 3LNNA 3MXNA 2NWGA 1AFPA 3E6ZX 2QKIC 3AEDB 1ZP0B 2B2YA 5C5LA 2GA4B 2K5WA 3P63A 5DEHA 1O78A 4N9TA 3M7GA 1VZ7A 2FBWB 3V3XA 1S5BD 2WXLA 5DNFA 1IUEA 1W6JA 1A6XA 1QOAA 2VUMB 3AE4B 1KAAA 2B76B 1OQQA 1V97A 2F0FA 3TP5A 3PZ8A 1F9QA 1PZID 3HVZA 4KI0A 2OT2A 1HPCA 2WNMA 1BCPC 3A54A 5FK9C 4FF3A 4XT1B 5JOBA 1TU2B 4A3EB 4F8MA 2F3VA 1SNMA 3SK8A 3C46A 5ELFA 4XDCA 1JWBD 2K5QA 2WXQA 3TDQA 4CHTB 4A3DB 2PMZB 4DFAA 4KN7C 2EJGC 4C1NI 2E2IB 4U68A 2LUMA 2IGGA 5D7GA 2AWOA 2SNSA 2M19A 1TS4A 4YTNB 4RGMA 1ENFA 2QEJC 5HI1A 1FD7D 1NUCA 2J4XA 2A6HD 5JVH3 2KCCA 1EWYC 1PFDA 2Y5PA 4K5VA 3TEZA 2IGDA 2AWNA 2WAQB 1WTXA 1WTOA 2N55A 3AB9A 2IDYA 4N9PA 3FMCA 1KRHA 2IGHA 1QILA 3KLSX 4OO1H 3SK6A 2K5DA 3T51B 3FDTA 4L63B 1F2ZA 3A7AB 2B2WC 4G57A 1PGAA 1CHQD 1DOKA 1DOMA 1TKEA 3IFDA 4H7BA 2IX1A 1ZOYB 3PV0A 5BMIA 3AEFB 3FILB 3OHXC 2NVTB 5HG2A 2F0MA 2A6EC 3WOFA 1WTRA 4XWTA 3FEWX 3M7NA 1GXDC 3R93A 3PO2B 3AM9A 3VYUA 1RF2D 5EPLA 2HQEA 3AEAB 3W9CB 3CWIA 3Q8CA 3EGRA 3ZGZA 2A73B 3MXUA 4KY6A 1FCLA 3A55A 2F0KA 1PRTD 2X6LA 1IGDA 5M5XB 4XQNA 2WDRB 3J81E 2KWDA 4YTMB 1TY2A 2EYFA 2IJ0A 3U4EG 1EOTA 4QF4A 2JXTA 3CRLC 2JX5A 1PGBA 5ELEA 2PLPA 3OWFA 3ZYYX 2BCOA 4QB4A 4HSPA 3NQTA 4CGYB 1BCPF 2YYZA 1WGKA 3U52E 2PZWA 4L6TB 1ENAA 2KEEA 4FF4A 2EJMA 5EE9A 1IW7C 2RKSA 2ON8A 1SNCA 3MXGA 4RH6A 2EYPA 1FIQA 3MAQA 3IAS1 2K3UA 2EE1A 1PTOC 5T8IA 5CR3A 2GI9A 3JAML 2Q8RE 5EKLA 3S1NB 1PFNA 4AS1A 1XEEA 4K8JA 1TS3A 1L0YB 2WP9B 3BYYB 3FILA 5DM63 4RF0A 3T3NA 4KGSA 5EE0A 1Y8NB 3GTGB 5C0XH 1JOOA 2LFIA 1EYDA 1KTKA 1STBA 4O1NA 3NWSA 3LB8C 5EE3A 3OMCA 1E2ZA 3FC4A 4CQNA 3HOWB 1G8ZD 4WH4A 2L52A 4GZYC 2PW9A 3L4PA 5E3FA 4IUNA 4FNFA 3BS1A 2RQXA 3T56B 3TZDA 2LFNA 2F0OA 1IYVA 1TR5A 2SDFA 2HCCA 3FPUB 4XE0A 4LLGM 2JA5B 1ROEA 3R8BA 2F0EA 2FHTA 3FKIB 1J7BA 1I6HB 5EJWA 4H0LC 2TMPA 2H1EA 4HEDA 2LMCB 3HVDA 3NS1A 1JICA 1R9TB 2VNUD 2K32A 4B0EA 5BYRA 2BB5A 3U9OA 4J8QA 1S5CD 5IGCA 5EKKA 1PDXA 2RDHA 4IN3A 2WQYB 3MFGA 4OZAA 4DA2A 1TWGB 1D6EC 3W1SA 1LTBD 1KLGD 4JWUC 4HKZE 3GS2A 3NVWA 2Z4IA 3OIPA 4HRSA 1GPXA 1A15A 2GRIA 1VMCA 1HFNA 1H9KA 1XO3A 3M4YA 1WTVA 2W55A 2DWQA 4RKBA 4HAEA 4KGTA 5CBAE 4MN3A 1YNTE 1GUSA 3VR9B 2L55A 2W3RA 1JALA 3BDOA 1O7YA 4NDXA 4KK7A 1TY0A 1GUNA 2JEBI 3BK1A 1I7HA 1ZXTA 2R93B 4DQOC 5LL6S 5C3JB 3W5VB 1BBXC 1EZ6A 2WXMA 4N58A 1LT5D 1JB3A 1XLQA 2RMMA 2KACA 3I70A 2Y0SB 2ONQA 2INNE 2K0PA 2DYOA 5I9OA 3S9WA 3O13A 5CYUA 1CA5A 4KV6A 3A8IE 1KFYB 3NZ3A 2M2LA 1ZDXA 4JK1C 5C44B 1EU4A 2E3TA 2IW3A 1PTOF 3DM1A 5FLXE 4ME5A 1I50B 1PMRA 2LMCA 4PMBA 4OW0A 4DNRB 1E9MA 1PRTB 4OL7A 2XRQD 3I90A 3AE5B 1QJOA 3AMUA 1PZKD 4RAUC 3Q8FA 4MACA 3K57A 3A8KE 1N5XA 4BY7B 2ICIA 1DJRD 3GTQB 4PMWA 5KIXA 1C9FA 3N9YC 1SXTA 2A68D 2PYKA 1B53A 1SJHD 3QG1A 2B2UC 1I6VC 4KHVA 3NBIA 4KKJA 2EYMA 4KX6B 1SB3C 2NMQA 1YNJD 1C79A 1SYEA 2AUKA 4XIGS 1QNKA 1PFMA 1ZKOA 2B2WA 4BS9A 4ZHPA 2CVRA 4B08A 2WB1B 4IUVA 1FEHA 2KQ4X 1NAPA 3H0GB 3QOJA 2OEDA 1L0VB 1OO9B 2YEPF 3KWLA 4KKIA 4LJZC