1V1PA

The structure ssl from staphylococcus aureus from an orthorhombic crystal form
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
191
structure length
191
Chain Sequence
HLHDIRDLHRYYSSESFEYSNVSGKVENYNGSNVVRFNPQNHQLFLLGKDKEQYKEGLQGQNVFVVQELIDPNGRLSTVGGVTKKNNKTSETNTPLFVNKVNGEDLDASIDSFLIQKEEISLKELDFKIRQQLVNNYGLYKGTSKYGKIIINLKDENKVEIDLGDKLQFERMGDVLNSKDIRGISVTINQI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EXOTOXIN 1
publication title Structural Relationships and Cellular Tropism of Staphylococcal Superantigen-Like Proteins
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Virulence factor
total genus 49
structure length 191
sequence length 191
ec nomenclature
pdb deposition date 2004-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
A PF09199 SSL_OB Staphylococcal superantigen-like OB-fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1v1pA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1v1pA01
2O2LD 1LTRD 1PTOB 5FK9C 1CHPD 1HTLD 1CK1A 2AQ3B 2AQ2B 4OHJA 2ICIA 1S5FD 2IPKD 1LTBD 1ENFA 1V1PB 5D3DA 1KLUD 1RF2D 1RDPD 1MD2D 3GP7A 3SEBA 1PRTC 3URYA 1KLGD 1PRTF 1PTOH 4ZYSA 1ET9A 1PTOC 1PZKD 1G8ZD 4K6LA 1EU3A 2XNAC 4RCOA 1YN3A 1FD7D 1B1ZA 1V1OA 1TS4A 3OWEB 1DJRD 3BVGA 1TY2A 2RDHA 1T5XD 1L0XB 2SEBD 1LT6D 1PRTB 5ELFA 1JQYD 2NTTA 5ELCA 1I4RA 3R2IA 3W2DA 1BCPC 3BVZA 5I4DA 1SEBD 1SE4A 1BCPF 4RHRA 1AN8A 1UNSA 1LTTD 1YN5A 1S5BD 1ESFA 1HXYD 3BYTB 1SBBB 5ELBA 1PZJD 2XRQD 1FNWA 1LTGD 1BCPB 3BZDB 1LT4D 4RH6A 2QILA 1S5CD 4Z9CB 4C56C 3TSSA 1YN4A 3DWAA 1SJED 2J4XA 1TS5A 1UUPA 1KTKA 1V1PA 1FGBD 1PTOD 1SJHD 1L0YB 3EFXD 1AW7A 1FNVA 4RGTA 4RGNA 1PZID 1I4HA 2RDGA 1ET6A 2AQ1B 1RD9D 1LTSD 1LT3D 4O1NA 1BXTA 1QILA 2CHBD 1I4PA 1TS2A 2IJ0A 4RFBA 1JCKB 1D5XC 1GOZA 1FNUA 1HA5A 3V05A 3R8BA 1CQVA 5TSSA 1SXTA 1BCPD 3CHBD 2QEJC 3BYYB 3DWQA 2NTSA 4NZLB 3MC0B 1SE2A 1D5ZC 1LLRD 1S5DD 5ELDA 1PYWD 1EFID 3O13A 4RGMA 1I4GA 1XTCD 2R61A 4TSSA 1DYQA 1PRTD 3R2TA 4DXFA 2XRSD 1HQRD 1CHQD 4DXGA 4L63B 4BWGB 1JWSD 2TSSA 3EA6A 1LTAD 2XN9C 3DWPA 1LT5D 1EEID 1D6EC 2WV6D 3KLSX 1TS3A 3MFGA 4RHSA 1RCVD 3BVMA 1I4QA 1JWUD 1STEA 5FKAC 1PTOF 1I4XA 1D5MC 1JR0D 2G9HD 4RGOS 1EWCA 1TY0A 1LTID 1M4VA 4UDUC 5D3IB 4L6TB 1CT1D 1JWMD 1XXGA 1SE3A 1S5ED 2Z8LA 1EEFD 5ELEA 1F77A 1EU4A 1LO5D 1B44D
chains in the Genus database with same CATH superfamily
4A3EH 4OO1G 1B3QA 1HTLD 2XTIA 5DPWA 4NKLA 4NXML 2LD9A 2MH7A 1NI2A 2WX0A 3M62B 1XX8A 3P75A 4JI5Q 2JRIB 2XK5B 3GP7A 3OMCA 1E1TA 2UUAQ 2WXMA 3CPFA 2AX5A 4XYCA 2CW0D 3SK4A 1X54A 1G8ZD 2KJ6A 2PMZB 3KFUA 4JPSA 2ZJDA 5MPOA 1HUNA 2KNBA 3IL8A 4F8MA 3CCJA 3KWLA 3Q8FA 4A3LH 4KHPQ 3OWEB 3L54A 3UE1A 2KDFB 1Y1WH 2IX0A 4LJZC 5ELFA 3ZJUA 3Q8BA 1LT6D 3UQAA 2I46A 3VVWB 1JQYD 1VLBA 1I4RA 1UE7A 3R2IA 3HOZH 1OXVA 4FO2A 3WOEA 4OZBA 3HOVB 1NNXA 1IGCA 3CCMA 1MHXA 4YY3L 2FAZA 2EYFA 1N33Q 3GTGH 1GAQB 3I9V1 3F8TA 1Y1WB 1FIQA 4IM2A 1F2MA 4FXDA 1T5EA 1IBMQ 2DENB 2ZEQA 4DGZA 4DV3L 2Y5CA 3TJPA 3HOZB 1V5TA 3AEFB 1J8IA 2QILA 4C56C 1NR4A 5BYQA 3ZIMA 4JI2Q 4GMVA 3N6RA 3ZJTA 1V9JA 3HOXH 3H6NA 3HM6X 3L16A 2YV5A 1CA6A 4A4IA 4QIWB 2ATWA 2ACZB 2IY1B 4P2CB 5HI1A 2KCTA 1DONA 1ET6A 4KV6A 4A3MH 3I4NH 3S1NH 1MG8A 2B2WA 3QG1A 3UIPB 2JPHA 2JRHA 4HVBA 1C76A 4DXAB 5KNBA 1V86A 3T1HQ 3TS2A 3TN2A 2LKVA 2XWJB 2KQ3A 3HOXB 2BDOA 1ZXTA 2K14A 2QEJC 3DQVA 3OAWA 4R9WA 3I4MH 2BDNA 4QQBX 4A3MB 3I4NB 1NE3A 5D6JB 1YJWA 2HDLA 1DGJA 3NK9A 1UE5A 3RNGC 3NP8A 4XWWA 1D2BA 1PRTD 4OO1H 2WAQB 4F8CB 3C3LA 4R4QA 2F0LA 2LVQA 3EBEA 1GG3A 1T9HA 2I2YA 4HAEA 4P6VF 4DXGA 3AE7B 4FF3A 2VQEL 3S2HB 3FRPB 3OG5A 4X62Q 4A3KB 1IBXA 2R2QA 1FCLA 3I2ZA 2MQJA 4M01A 2INCC 2KWUB 3MAQA 1XLOA 3TL5A 2WACA 5FO7B 3W1BA 4A3DG 4JYAQ 2KCMA 4M8AA 3A5UA 1KC8C 1HTQA 1K53A 1D5MC 1O78A 2XGTA 3M95A 2JWUA 5E6NA 3NBHB 3RZOB 2L9HA 1WFYA 2D3AA 1WX7A 3ZDMC 1H4RA 2A19A 2O6VD 4H0LC 4EQPA 1QUQB 1WRDB 3G48A 3S1MH 1WTVA 4G57A 4I6PA 5L37A 2F1MA 1P3QU 4XX5A 2DN8A 3TBIB 2E76C 5L95C 2BA1A 2K5DA 4MGYE 3GDEA 3ER0A 4PZ6A 2JA7B 1TJEA 2DZKA 5D3DA 4L23A 1RF2D 3EQLC 4YCUA 4WJQA 4S17A 3K0YA 1WD1A 2JZPA 4BS9A 4AQYQ 3RI7C 5BN3A 3VYRA 1PRTF 2BH2A 1KAWA 3S1MB 1P1AA 2M19A 4OX9L 4N8FA 1UWXA 3C19A 5LXIB 4A3GG 3RD4A 4CYEA 1KNEA 5GROA 1Q90A 1D4BA 3HM3A 1Q8IA 5AJ3Q 2X38A 1F9RA 1QG7A 4REZA 2Z6BA 3VDYA 1HZCA 3L08A 4TVAB 5ELCA 3W2DA 2Z0EB 4JOIC 1QVFA 2DNFA 4W9JA 4LAAA 4IFDI 4YWLA 1F9SA 3GTQH 1W6JA 2SNSA 3J80i 5EKIA 1VZ6A 2HD5B 2NS5A 4LNFA 1R4NI 1SNMA 2KMMA 4EOYA 4UAIA 3IKJA 3RN2A 2A5HA 1VQOA 3K0XA 1IZ6A 4X57B 2BCOA 5C4XH 3PIPA 1LTGD 1BCPB 2INPE 1PUTA 3SFEB 3WAMA 2VZAA 4DAYA 2OXPA 1LT4D 1VF7A 4BXXG 2Y0SE 1KRHA 2C7NB 4JX1C 1K8AC 4BKGA 1IP9A 1PFBA 3RZFA 1TIID 3HFZB 5M5YH 3T56B 1D7QA 2CHXA 1Q8KA 1BVSA 2RDGA 2WIIB 2KENA 4GGQA 1LUZA 4N9PA 4K0KQ 3WWVA 2UXBL 2J0JA 3JC66 5C4XB 3OIQA 3MHZA 5LL6S 3FEWX 5CYUA 4JBWA 3UGBB 2VQFL 4A3DH 3S2DB 5C44G 1I35A 4JV5Q 4ZCKA 4LF8L 3I3TB 1NCVA 4MSMB 1YNJD 1A15A 3RLFA 2NTSA 2KACA 2K22A 1LLRD 5JZEB 4ZRQA 3CF5A 4DV5Q 4EFOA 2GOWA 3AE6B 3QWZB 3PIO3 1B3AA 2R61A 2V4DA 4Y52H 2EKEC 3R2TA 5CV7A 1C7YA 3LXFA 3R7QA 3GTOH 3A4SC 1WFQA 2E75C 1TKEA 3ZKJC 3ND8A 3A9JB 3NVZA 5J3BA 3J81i 4CJ1B 4IUQA 3AFPA 5TR5A 5JVG3 4B3MQ 4DDID 3T1YL 1X3FA 3DBLB 3DWPA 1TT5B 2R6GA 2WXNA 5C3EH 1J9OA 4LF5L 2JA8B 1TS3A 1FEHA 5CC4A 3V6EB 2XVSA 3OJ3A 3BVMA 2PW7A 1JWUD 1G6PA 1VMPA 2RDFA 3GTOB 5JPNC 4GOPB 1AARA 2VH1A 4DR1Q 5HGTA 3JW0X 5G5GA 1A70A 1VQCA 3UQBA 1ZPSA 1LTID 1J6QA 2K75A 3DHHC 3NQTA 4PYZA 4L6TB 4B3TQ 2M0XA 2F0SA 1EEFD 3HOYH 5C3EB 1OTCA 4IJHA 3G71A 4B3SQ 2FINB 3MXGA 3J7AV 1G6ZA 3S15B 1RODA 3MZ5A 5DCNA 2B2UA 4R4IA 4GOPC 3ICEA 2ZCCA 2L7RA 3OLMD 4BFRA 3RUZA 5C1ZA 2IPKD 2UUBL 3VTUA 4RNAA 2F0WA 3RUIB 1RDPD 3HG9A 1XNQL 5JVH3 5JH5C 2B2VA 3URYA 3OWFA 4ZUJA 1PFMA 4GLXA 1L1OA 1UEBA 3CC4A 3HOYB 2CS4A 4WWOA 4L5SA 2ID0A 1QNUA 2EYHA 2MJ8A 4BXXH 2JSVX 2MLBA 1DOXA 4RMFA 1TS4A 1X6OA 3H0GH 4HIOA 1HNWL 2RSNA 4H13C 2IW3A 4ZRZA 1UBIA 5H92C 3CIRB 2PPHA 1QZEA 2V1YA 4CO7A 5A2QE 3WA0A 2L1BA 3DM1A 4NDXA 2OTLA 4JI0Q 1V49A 1PYBA 1HRJA 2WXQA 2A6ED 3QQ8B 1WIAA 1NTGA 2VRRB 5C44H 3Q3FA 1H9SA 4PS7A 3HS0C 3H0GB 1F2LA 1ESFA 1WYDA 1QWYA 4DR4Q 1GUGA 2MW5A 3AEBB 4MACA 4X3TA 2FMCA 3Q6SA 2PZTA 3GTMH 3NHEB 1LACA 2F0PA 4DV7Q 4LNKA 2PQAB 1E8XA 2P5ZX 3VR6A 3LNNA 4X3SA 2M9VA 1PH6A 4R8IA 4JI7L 4A93G 1X1MA 4I6LB 1TTNA 1LV9A 4K3BA 3P4QB 4K14A 2F3IA 1KFYB 5IGDA 3T8MA 2C9WB 4KJNA 2B2TA 5C44B 4JI6Q 4MEMA 3M7NA 1FGBD 1HFGA 2F0UA 3HP3A 4LF6L 1ZDVA 1FNVA 4MH8A 1NYRA 1DOKA 3PUVA 1HEZE 2LGDA 2MP1A 3RT3B 3BS1A 4ID6A 1BBUA 4RFBA 2R92H 1ZYRC 2IJ0A 4DAPA 2JJQA 2PMZE 2MX2A 2M2LA 3W1SC 4F87A 4HMIA 3L17A 4HJKA 2JE6I 4QY7A 1EY0A 3UINB 1BCPD 3NWTA 2JEAI 1HH2P 3HUIA 1S5DD 5ELDA 2WFWA 1EFID 4JI8Q 2K50A 1LM8B 2KN4A 2YTXA 3O13A 3H7SA 2ZTCA 3SK6A 1E5WA 1E1OA 2KJHB 5HY6A 1I50B 2A1AA 3S16H 3RN5A 2R92B 1GJXA 2O2VB 5E3FA 2LUEA 2F4VL 2MEKA 4HN7A 2WB1E 1FD6A 4JCVE 4N9F4 3TZDA 1L0VB 4N6EB 2MHJA 4H44C 1NENB 2INNE 3BY4B 2HDMA 1SSOA 2PKOA 3UIOB 2L76A 4W9HA 4HIDA 1ROEA 1EY9A 2I0QA 1ML0D 4NJ6A 3SK5A 1KXLA 3A9KA 3DCGA 3CCQA 4FULA 3S16B 1SYDA 3D4RA 3J81j 3VTVA 3TBLD 3JAMc 4DK6C 1EWCA 2LMCA 2WXIA 3MEHA 1EIHA 1RTNA 2XSCA 1K51A 3MHBA 3FILB 1WCMB 2QJLA 4XWTA 4QIWE 4WRDA 2R2OA 1Q1EA 4WORA 1SYFA 3L9AX 1EU4A 1U9RA 1YVCA 3FKIG 1WR1A 3I73A 1Y1VG 1YJ1A 1YBYA 2K39A 3SHQA 2AHOB 1QVCA 1NBWA 2Z6KA 4D2KA 3WAPA 3QIAA 3B1LX 1V5OA 1M1KC 5C23A 3D8GA 1MD2D 1YIJA 1MVKA 1QQRA 2ON8A 1B2TA 1SNOA 1HTOA 4JI1L 2Z4HA 1L5PA 2GBMA 2EYLA 5D14A 1RIPA 1PDXA 3AEDB 1FJGL 1F2RC 2YU9H 4WQMA 1EYGA 2BE5D 4WQOB 4B0EA 3RNBC 1SE9A 4LF9Q 1J5EL 2QDBA 4A93H 3M4QA 1N34Q 2F0GA 2I07B 1HZAA 1B1ZA 4JVZA 1E90A 1WMHB 2HJ1A 2V3SA 4J1MA 3E9SA 2H89B 2PCFB 4IZ8A 5IP7G 1Z6HA 3KBXA 4AWJA 1R4QB 3BIID 3OW7A 5J17A 4ARIA 3U58A 3VDZA 3MA2B 3NQIA 1Y56A 1EO6A 3TMPB 1PH2A 3UDFA 3ML8A 4YSYB 1AN8A 4RAUC 4NPSA 4A93B 4KK7A 4C2MH 3AMUA 1KAAA 5JOBA 2R93G 1LFDA 3AEGB 1YN5A 1C48A 2W54A 3ZXRA 3K7UC 4L5TA 5I2YA 2V9HA 3A1QA 1B9RA 1SNPA 2BYEA 3WALA 3Q23A 1ZXIA 4K3CA 1ZKHA 3CC2A 1VQDA 1WOCA 3MVVA 3TDQA 5DPTA 1I6VC 1VQ9A 1KDAA 2CHZA 2MBBB 2V3NA 5DEHA 3TSSA 1PQSA 2RF4A 3EFXD 1QCBD 1L0YB 4HXDA 1KRSA 4RGNA 2L83A 2XK5A 1WJ6A 1PGBA 3OTOQ 4AH6A 1LTSD 4LK0M 2A69D 1OO9B 3PZ8A 1QILA 1CQFA 2VB2X 4IM0A 2HCCA 2AUJD 3KDFB 4P75A 1HNZL 2Q5WD 1F2YA 3PHXB 3NPPA 1MBYA 2L8JA 1IW7D 2C60A 5EE3A 4DV0L 3NTKA 5KHQA 4NJCA 4ITKA 5TSSA 2O4XA 3A74A 1WYGA 2IYDB 3PS6A 4A8XC 1NI3A 3DDCB 2QDFA 2AYOB 3CSTA 4I6NB 4M1UB 4KSKC 1SE2A 5AFWA 2DJFC 2F0JA 1Y8RC 4G11A 1FR3A 4IWPA 2EIFA 1I42A 4FF1A 3FKIH 5KEEA 2D2CC 3J80E 3NUHB 1EOVA 2B2YC 1Y1VH 4EZKA 4LFCL 2QCPX 1JRUA 1Z47A 2HQLA 3BK1A 4W9IA 4JI3L 3GV6A 1JWSD 3KF6B 4FJVB 2NVQH 4HK2A 1EWHA 2BKRB 4CHTB 4W9KA 5I6WA 1C78A 3V96A 4MGZE 1D6EC 1VQEA 2LXCA 4B9WA 4H2AA 3T3NA 2KJRA 2LGYA 3Q69A 3FKIB 4GLAC 4FLHA 3ZXVA 2K8CA 1SYCA 5E1FA 3QR8A 4R3DA 4XDDA 1A8VA 1NAPA 1VDZA 3MEFA 4OWXB 2E5LQ 2WXOA 3N52A 3ENEA 1UD7A 1YHAA 2RMMA 1UE1A 1ONLA 2DNEA 1L1OB 3PGEA 2ZXPA 3BDCA 1SMXA 1UAPA 5IP7H 2NVQB 3KVFB 2ZM6L 2Z8LA 5FO9B 1EF1A 1QOFA 3HHMA 5I2XA 1P8LA 4MH0E 3C0RB 1KLVA 3I5JC 3ZTCA 4KI0A 4HSVA 1E7ZA 1V97A 2HTHA 3STBC 2R93H 2X8XX 1JALA 4E6IA 1X65A 4A90A 3AI5A 3UI3A 4PT5A 4HJAA 1QT9A 1XNRQ 2ZW1A 3HOUG 1DGSA 5GXGB 3J81E 2Q2IA 2M56B 2IGDA 4DV6L 2KLCA 3SR6A 1H95A 4DR2Q 1XEEA 1YJJA 3UF8A 4ICVA 4YHHL 4YWKA 1EWIA 1EL0A 2AL6A 2IWHA 1L0XB 3E0EA 2VZKD 2KDBA 5FJ8G 3MJWA 2NN6G 3IFTA 1WZ0A 2F0KA 4J6IA 1V8CA 4L1BA 1E22A 3VYTA 3N9YC 3DBSA 5M9OA 1K3RA 1VQKA 3FVQA 4DR5Q 3H3VH 4LF4L 3M3YH 4LJOB 4BBSG 2I5MX 1EQQA 2MO0A 4ZOHC 4HDOA 4TMAB 2WINB 5C3WA 5C4JB 5G55A 4JI5L 4AP4C 3NBHA 1SMYD 1A0IA 4Q0FA 2UUAL 3GTPH 2JXXA 1Y8OB 1OXXK 3N3KB 4X6AH 1S5CD 1EQRA 3M3YB 3CKIB 5A2QL 1IKMA 1TS5A 3QOLA 1KTKA 2VL6A 1GUNA 3TQYA 1PVOA 4KHPL 1R7SA 5CBEE 4MELA 3D0FA 1ZW7A 4LFBQ 4RF1A 4G0NB 2UXCQ 4BKSA 4DK5A 1ILQA 2PI2A 1BOSA 4FF4A 3GTPB 2L00B 1RWSA 4ZLTF 2UUCQ 1FRRA 2KWDA 3V6CB 1I4PA 4JOIA 4IPCA 2NVYB 2GRIA 4JWSC 1FNUA 4NPNA 2MGSA 1CQVA 1HCZA 4Y7NB 3ONSA 3PGZA 4YIJA 2WKCA 1N33L 2ZNVC 4DHZE 3HOVG 4IN3A 1EF5A 2OJWA 1PLFA 3RFZB 3TREA 2WYQA 3VRBB 2KWCA 1XMOQ 1IBML 3PQIA 4R4TA 5I9OA 4KY5A 3AULA 2RCFA 2LMCB 3C8YA 4KVGB 1XTDA 4XIGS 1Y1WG 2Z0DB 1EY8A 3M3JA 1VQAA 1IKLA 3GTJH 2CKZB 2WXFA 2K9XA 4JI2L 2QKIC 1C9OA 5BN4A 2NBWB 2N0SB 3AV8A 4EKUA 2KMCA 2MPMA 5IO9A 3SFDB 2GVBA 1SNQA 1WGDA 4JBJA 2K6QA 2KZRA 1I6HH 3ZYYX 4WH4A 2WV6D 2IY0B 1STBA 5EKLA 3P1HA 2CVRA 3HOUH 3M63B 2PZUA 2KYWA 2NYZD 3AU5A 3L2PA 2G9HD 3GTJB 5HFYA 2X69A 3EVQA 3T1HL 4QAYA 4GN5A 2F0IA 5G5HA 2KHSA 1OGWA 4ANWA 3AE5B 3ULPA 1NDDA 4N58A 5LMUQ 1MI2A 1WJNA 2G5DA 2KVRA 2PNRC 2NN6H 3FDTA 4W9FA 2B63G 1F77A 3GV3A 4PMBA 4YWMA 4LW1A 3TP8A 5IGBA 1STYA 1EIYB 3CSFA 4NY0A 3R7RA 1PDQA 1NR2A 5FK9C 5JEAG 3HOXG 2LJ5A 4TQ1A 4EGVA 2QCZA 2L05A 1PH3A 4BBRH 5FLXc 1AFPA 4KMUC 3GTLH 4BBSH 4HKQA 4HCSA 3ZDTA 4A3MG 3I4NG 4CHKA 5NUCA 1E6EB 5IE8A 1GC6A 2W9NA 3HGBA 1PRTC 2LVOA 5DPRA 2ZPNA 4X62L 2WAQG 4ZYSA 4ZHOA 1SIFA 5CTRC 3RR5A 2OHFA 2KEDA 2FHTA 4YHHQ 3PSEB 3TMEA 3EFCA 1IL8A 2M1MA 1VQGA 1YJ9A 3MC9A 2EYPA 3GQBA 3HEJA 4RCOA 1FD7D 4BBRB 4X65Q 4A3KG 4JYAL 2IY5B 1DJRD 3BVGA 3GTLB 1H8CA 2C7HA 5H1SE 1BO0A 4WWMA 3E0JA 3H94A 2X6GA 3ZRFA 5KIXA 2RA4A 1VQFA 3ERQA 3RMHA 3V2TA 3QK0A 2PVGC 3VR4A 1F9PA 3GE8C 2DWQA 1NMGA 3M9BA 2DGYA 2MWSB 2MFIA 1FFVA 3B2GA 3LJ3A 2WKDA 4ZRKA 2PJHA 4GOPA 1GKHA 2O5IC 1XT9B 1ZUD2 3F2UA 2G1EA 4MZ9A 2WU5B 1J7AA 2HJ8A 5BYSA 3GO5A 2QHOA 2YTVA 2KFKB 3DBRB 3UDIA 4AYBG 3HOVH 2DAJA 1ISNA 4AQYL 1VF5C 4C3HH 2JA7G 2F03A 1GM5A 3C1FA 1Q82C 1TWFH 2BB5A 3K5OA 1SLJA 1YQBA 3P42A 3AE8B 3KUCB 3JAMi 3I63C 3RPFC 3PIOA 4QF4A 4IUVA 1KHIA 5CGKA 4MGIE 1EY6A 2R7FA 5KRUA 5AJ3L 2H1EA 4HRSA 4MDKE 2K4KA 2NWGA 3L0OA 3N1XC 3A0JA 1HJPA 4C3HB 2GLSA 1VQLA 2JY6A 3Q8AA 1V43A 4LNOA 4DR3Q 2K5QA 3C46A 2EMTA 2IHEA 2XEWA 4WJPA 1TWFB 1LXDA 3U4EG 1EUVB 1Q0WB 1E0BA 2FCNA 3GE3C 1WD0A 3HKZB 2KX3A 1EIFA 4PK1A 5L83A 2N4FA 1SIJA 2ZPYA 1RTOA 4P71A 2MHVA 4XXEA 2C7MB 1PYWD 4I7AA 3APFA 3EHVA 4R4OA 4RM9A 1HE8A 5HG2A 1XTCD 2F0EA 2B63H 1JORA 3EGRA 3VQIA 3VAWA 1E8ZA 1YD8U 2D62A 1KL9A 5JEAH 1A62A 1HQMC 2WP9B 3MFYA 1N8RC 2L5TA 5ELOA 1SN8A 3PVLA 4GDKB 3H09A 2F0TA 2KCNA 3OPOA 2L1AA 1S3SG 1L2NA 3W1GA 1LT5D 1FXIA 4A55A 1K83B 2KXJA 4HROA 2PQAA 2B63B 4K0KL 1JJCB 1SDFA 4ODGA 3A5ZB 4RHSA 1OEYJ 2EY1A 1MSHA 1HZ6A 3ONAB 2K05A 5EPJA 1EFWA 2EYOA 3S2HH 2KMAA 4US8A 2KOXA 2F52A 3TP5A 4A3KH 2ZVOA 3J80L 4JV5L 2LVPA 5IIFA 4HJ8A 4QJFA 5C4XG 1CTMA 2DY7A 2RSOA 1QKZA 1J0GA 1YMHE 2K1FA 4K7WA 4KZ0A 1SXTA 2LFNA 2PW9A 4DV5L 1YNJC 2ZJQA 1PTOB 2A5UA 2I38A 4IUMB 1ASYA 3G6JB 2Y5BB 3DBLI 3ZNID 3A4RA 4P1CC 2Z9HA 3RZOH 2G9DA 4JIOU 4APVA 5IGCA 4LUZA 4B3ML 2E3TA 3QB3A 1PTOC 3Q0AA 2K1BA 4IOIE 1WH3A 1H9RA 2ICEC 4YCVA 2JA7H 3NS8A 1KOTA 1VQNA 1JRPA 2O2VA 3VRAB 2N9XA 2F3WA 1QOAA 2QIEB 1F0ZA 1CZWA 4KD4A 4DR1L 2JA8G 3PF4A 4EEWA 1G2SA 1FYCA 4AJWA 1ENAA 2NVUI 4B3TL 4AYBB 1HZBA 1R4MB 2EOTA 1SEBD 1SE4A 1PA6A 1DCZA 4B3SL 4MJSA 4DN4M 1KDBA 3M85A 3G6EA 2BS2B 3J81L 2FUG1 5C3EG 1JICA 4BZAA 4WFN3 4KN4C 2ONQA 2KN5A 3FILA 4ABNA 3HOWB 1FPYA 2BOSA 1MJDA 2MBQA 1XPOA 1CSPA 4Z9CB 1TZOA 4K2LA 3T4AC 1B70B 2XWBB 2N49A 3TZUA 1JMLA 1OFFA 3IAYA 5C3JB 2JA9A 3CCUA 2K5NA 2N8NA 1JB7A 1DOYA 3HOYG 4K2KA 2WDVB 3R3OA 4WJ4A 4XQJA 4DQOC 1VQ6A 2N7EA 1GOZA 1QE6A 4MSQB 4JI0L 5GMVA 4KY7A 2PO4A 1KABA 2NBVB 1WMHA 1A3TA 1EYCA 2HTME 2N9KA 3PPAA 2D07B 1Y14B 5JPMC 4DR4L 4H7BA 1XO3A 1E9MA 2A6EC 1VZ7A 2K6DB 5CHWA 3AB5A 3I8ZA 4ZQ3A 3DM3A 4DV7L 2D3CA 3S2DH 3B9JA 4DUZQ 3H0GG 3QARA 1CFMA 3HK0A 2E2DC 5E6PA 4PMWA 2LFIA 1NYQA 2F0MA 4LLGM 2LRUA 3HIZA 2M00A 1O7ZA 2PNHA 1I94Q 2FBWB 4JI6L 4P72A 3VUYA 3NZ3A 3DEPA 1VQHA 2K8HA 1K8MA 5JJKA 1A5RA 2B76B 3Q22A 1VR9A 4KSLC 3VYSA 2KTFA 3IRBA 1BNZA 1C1YB 5FKAC 3X23A 2L4NA 2BH8A 3CCLA 2L3ZA 2OEDA 2XBBC 3QAQA 3CCVA 3K80C 3MC8A 4X66Q 3H91A 4BA2I 4F7XA 1WGHA 4HLEA 3BDLA 5IA7A 3V60A 2JA8H 1U5KA 1ZDXA 2LXAA 4JGHB 3RNEC 1XPRA 2BW2A 5BYRA 3C1EA 2Y5PA 2BGFA 1MG4A 1VMCA 4JI8L 2L0FA 3CCSA 3SD5A 1EOTA 1C8CA 3KUZA 2AQ2B 3H15A 1JJ2A 3KDFA 3E6ZX 2NVXB 5A35A 2B2YA 4JE3B 4ICUA 5M5WH 2CH4A 2JU6X 3IT4B 5HURA 5D2MB 5IGGA 4FADA 1AEXA 1BBWA 5BO4B 2B29A 1TYGB 4CBVA 1SROA 1SFOH 2R92G 3S15H 2WXHA 4JW0A 2WQYB 4KHZA 4A3PA 3KYHC 5BR8Q 1C3TA 1MKHA 2JVCA 4AQ7A 2L52A 3K9OB 4HEDA 3N1ZC 2VW9A 1N62A 4KN7C 3D31A 4OEMB 4E71A 5M5WB 2CCZA 3KF6A 2H88B 4ZRIA 5E4XA 3RZDH 1SFOB 3N1YC 4WURA 4N9TA 3EJIA 5FLMG 1WTWA 3B0AA 4FNFA 3G7LA 2LXKA 3KK7A 1K0SA 4NXNQ 2EPBA 1DOIA 2K33A 1B9MA 1U4AA 2DZIA 2NCNA 3TEXA 4MIUA 4AJYB 1WCMG 2D11A 2YEPB 4KDIC 3BYTB 3F2DA 5LMNQ 2WS3B 3L13A 3IBEA 2F3VA 4ME3A 4IALA 2LEKA 3RZDB 3LX0A 4K8JA 1VCBA 3JSVB 3KUPA 4FA6A 3PUYA 4M8MA 2D2QA 3IG3A 1PHJA 2EY2A 1TWHH 4QL5A 4XT1B 3RULA 1RL2A 2MBOA 3U9OA 4BBNC 2UXDQ 4LF9L 2BQQA 3KWVA 3NENA 1N34L 1IL2A 3CW2C 3VR3A 2ZJRA 1N61A 2BE5C 1T3QA 5IP4D 1STHA 2AQ1B 1WSPA 1DZ1A 2WXJA 1QB5D 4ILWA 1HNXQ 2KHWB 4R1JA 4DNIA 2L32A 2VNUD 4LWCA 3K6OA 5FR3A 2AMCB 1LQBA 1TWHB 1JCKB 2MJDA 3LB8C 1WZ3A 1JE5A 1R9TB 2WP8J 3PZDA 1WTHA 1YHQA 1A63A 4CDDC 1ZOYB 5G2NA 2ZXOA 4EUTA 3GB1A 2BPSA 2EMSA 4HCNB 3ZW3A 5J2RA 4A3OA 2Z0SA 5D94A 4DR7Q 3E56A 1UH6A 4J15A 3WOFA 1YJIA 5E4WC 4A3CG 1RM6C 1B53A 4KLKA 2PE6B 3ALBA 3PV1A 2GVAA 1WX8A 1EZ8A 1CHQD 5M5XB 4JBMA 2BWES 3MJ5A 3A7LA 1VQBA 3DVGX 4DA2A 1LTLA 4UHVA 3AECB 1I50H 3SHLA 2DYBA 2ZZPB 3I70A 3OTOL 3KLSX 3TRZA 1QOHA 4LFAQ 3ZGZA 3WCQA 3JAME 3S9WA 3JYUA 3O65B 1QJOA 1TWGH 2PW5A 1X3PA 2LI5A 3PO3G 4C1NI 2QA4A 5C4HA 3S1RH 1FGUA 3FKYA 2A69C 1Q12A 4POFA 4P73A 4HIKA 5CV9A 4IM3A 1A2TA 5FR6A 1X55A 1XXGA 4WJ3M 2RR9A 3M4OB 3QC8B 2K3UA 1B44D 5C0XG 4N59A 1A6XA 2O2LD 5FLMH 1LTRD 2BYTA 3NVVA 1S5FD 1TWGB 1ENFA 1K9MC 3LGJA 1HR0Q 1DD2A 1K8RB 3F1ZA 1KLUD 1WCMH 3NTIA 3S1RB 1C79A 1WRIA 3Q3JA 5T8IA 1MFWA 2IX3A 1VCIA 1RRBA 1Q1OA 2CU3A 5GAHC 1C77A 1GC7A 4MJSB 2K5PA 3PT2B 1AE3A 1QNKA 4CKCA 5CMDA 2QGQA 4HCEA 3S1QH 3GZNB 1G2TA 4ANUA 1U4RA 1MPEA 4KHVA 2CWAA 2WNMA 5DPSA 4S0RA 2DUDA 4B9XA 2E5LL 1T5XD 2SEBD 3KF8B 2LJIA 2MP2A 4J6HA 4ZDVA 2I5LX 1IBKQ 2NTTA 2Z1CA 4DK0A 2PTLA 5I4DA 2MBEA 1BCPF 3IFDA 2PE9A 4RHRA 3R3MA 1AH9A 3S1QB 3TP6A 4KKTA 1N36Q 1U4LA 1JROA 1S1QB 3AM9A 4IDIA 3U7DA 4F1SA 4F7ZA 4FXGC 5DM63 1ENCA 1HXYD 3D4WA 3PIP3 1SBBB 2OF1A 3DHGC 3ETRA 5DAUA 4GKKQ 1IYVA 2Q2TA 1G91A 3FPPA 2BKFA 3H1UA 4DFAA 3HZXA 1QZGA 5AUIA 1EYDA 4FXKC 2I1KA 2BYFA 4MGKE 1XJVA 2VUMG 5IY0A 1DXMA 1PH1A 1XNRL 1XLQA 1MIUA 3B6YA 2WAQE 3MXNB 4A3CH 3WIMA 2ZTDA 3H9DA 4P16A 2PIAA 4TKNA 5C5MA 2XIWA 4EZLA 1C4AA 1GNUA 5JEAJ 2IL8A 4DR2L 3J7ZC 4TKOB 3DUZA 5CV4A 2ZJPA 3L3OC 2NBUA 3ZO5B 5BMGA 2QMTA 5IWAQ 1PFNA 2N55A 4ZKBB 5T1GA 4C1NK 1A3VA 2FCMA 2IGHA 5IT9E 1VQJA 1HA5A 5IGEA 1PFDA 1UGMA 3HRDD 1Y69U 3NXWA 2D5DA 3K9PB 4DR5L 2ZTEA 4II3B 4NJ7A 1ZGUB 4ANXA 3PO3H 2J0MA 1HTPA 2O6VA 3MP9A 1UWMA 5H8YE 1K52A 4PS8A 2KO3A 1T0YA 3H3VI 3KUDB 3T3OA 1HUMA 2FIFA 2IBIB 3SDZA 4M02A 4ZAIA 4ACFA 4AYBE 5DM73 5C0XH 1IUEA 1TWCH 4BY7B 2G4DB 2JX5A 1P9DU 2XRSD 3D32A 4JI4Q 1KDCA 2QSDA 2WDTB 4LTUA 3BK2A 4IJLA 3RYTA 2QDLA 3EA6A 3PO3B 5IYBH 3AB9A 1E7VA 2VY3A 1LTAD 3RCZA 1YITA 1ZE3D 2PI2E 2KFKA 4LFBL 1GB1A 1WGRA 1XMQQ 2UXCL 2K8BA 4NAWA 2Q2HA 1KRTA 2O5JC 2CJOA 3VTWA 4A20A 2UUCL 1TWCB 2K32A 2KBNA 1FRDA 2JQOA 5J39A 2F0HA 1JR0D 1Q46A 2GI9A 5AZGA 3SVMA 2SOBA 4M00A 4B0MA 3FC4A 1ZYRD 3PRPB 2CFMA 1I3QH 1H9JA 4DUYQ 1LO5D 1YNND 4IUPA 3IAS1 1XMOL 1WXVA 1HR0W 2WXGA 3ZJYC 2UU9Q 1F1HA 4OZAA 3A54A 2H5XA 3H6MA 3KLRA 1J19A 2A68D 4WAFA 1WM2A 2EXZA 2LXJA 3DBHI 2RBMA 3VYUA 4ZYNA 4NAMA 2KD0A 1U0LA 1WGYA 4PG3A 3S24A 2C5CA 2L0CA 5EBCA 3R66C 3T16A 1I3QB 1W2BA 2OQ0A 3AE1B 3ZNHB 4E74A 2VUMH 5GADC 2XNAC 4MHEA 4CDEC 1YNTE 1YQ4B 4WWNA 3VUWA 1N32L 3U8ZA 1TY2A 3PUZA 4KY6A 4WWPA 3NEMA 4GDKA 4M8NA 1TWAH 1S40A 3SXHA 4YL8A 4PS3A 3VR9B 5LMUL 3NOBA 4GNXC 2BT6A 5IYDG 1KJTA 2K0PA 4OGQC 3UDGA 1OXUA 1JOKA 3CMEA 2VUMB 3Q2AC 3SK8A 4HR7B 5KHOA 2HIXA 3HVDA 1BR9A 2G45B 3DVGY 1S5BD 2NN6I 1YNXA 4BY1B 3N30A 3NSWA 2WWZA 1SYBA 3WDNA 4L5QA 1TWAB 4EQNA 5IODA 5D65A 2FE8A 3SU8X 3MXPA 3TP7A 2KLGA 4RH6A 3JVZX 5AEKB 3VR8B 1X3QA 1K50A 2IO2B 3U9SA 1AZPA 2NVTH 4Q2JA 4YSZB 2OJRA 1BKBA 2ASQA 5C4JH 2J4XA 2M0AA 4WAAA 5CV8A 3J80c 5ELNA 4X65L 3TS0A 1IPGA 3TEHB 2J42A 1E2WA 4MNOA 4RGTA 3RNFC 3BJUA 3W5VB 1I4HA 3AU4A 1ACCA 2FUHB 4OVZA 4PNYA 3ULLA 1GB4A 4O1NA 4A3FG 4BBRG 2NR2A 4HMJA 2E2JB 1HA6A 1V80A 2KHIA 1QVGA 2V0GA 4YWGG 4IW0A 3DBRI 2NVTB 4E3CA 4TQ0A 1SAPA 4IO9A 1Q81C 2GBJA 2CKHB 3NVYA 3BYYB 3TEYA 1JC7A 3K7AH 5IYCG 4X64Q 4RG1A 3AXCA 3MC0B 2WU2B 4YT0B 5EBDA 3VR2A 3PUXA 1JE4A 1UE6A 1GO3E 1TGZB 4HEA1 1D1KA 1I4GA 2NVYH 4DR6Q 3U52E 2CU1A 1IXRA 4Y7NH 1KF6B 3OSOA 2CW0C 2Y0SB 3M4YA 5EKKA 1JMCA 2G3QB 3NWSA 1STAA 4O0AA 1CA5A 2PPBC 5I9PA 2BYVE 4GKJQ 2KQSA 5JHBA 4C00A 4UY8C 2KA7A 2RPQA 1VS0A 2ZNVB 4UP8A 3AQQA 1EQVA 3K58A 3K7AB 1SB3C 2ZT9C 1VQMA 3H8HA 2EJGC 2OOBB 4XYQA 1CMXB 2J0KA 1GVPA 2D0OA 1RJTA 3OOCA 1XWEA 2RHSB 4KKSA 4DR3L 3CD6A 3RNUA 2LRWA 5C3XA 1K0RA 3J81c 3K5NA 1J7CA 2EJMA 1CT1D 1L2FA 1PFSA 4C3HG 5CHFA 1PMRA 4OWTB 1AZQA 3P1MA 3CMAA 3K8AA 2KT7A 4K5XA 1EQTA 2AL3A 4TRDA 1UELA 2SAKA 4HTHA 5FLXE 5IYDH 1T0RC 5G3LD 1CHPD 1ESRA 2AQ3B 4OHJA 3HKZG 4CKBA 1Q10A 2BBCA 1E8YA 3IXSA 5IN7A 1BMLC 5T1IA 4K7UA 2KVZA 2MP2B 4I7ZC 3CF6E 3LYYA 3ZVVA 4UPAA 3JAML 4G7OC 1QOBA 1XD3B 2EY5A 4KD3A 4GXBA 2JA6B 1CSQA 1CKOA 3GD7A 2N1VA 5F2DA 2PZWA 4NB3A 4CQNA 1N32Q 2QF7A 1EU3A 4KKIA 1IGDA 1XLNA 3E5SA 2JYOA 4LNIA 3AU7A 1II3A 1PH4A 2N78A 4CGYB 3AE4B 2RDHA 1AP0A 2RHQB 2ALYB 4DHJB 1PRTB 4HKZE 5KYIA 2RDBC 3NBIA 2GBKA 3RD2A 4IOAA 5KNCA 1WJ4A 4PQXA 1PXUA 2B8GA 2NB0A 1X9NA 2HUGA 3DWMA 3NJTA 4MTNA 5LXHA 2PEAA 4DV2Q 2PVOD 4A3FH 1AE2A 2RD0A 3K59A 2KUMA 5BN5A 2AWOA 2HHHQ 1EY5A 4J3OD 1C9FA 4A3JG 2N9EB 1XQQA 2W82A 4MM3B 1V9PA 2OEOA 1WTQA 1FXAA 1UZXB 3RZWC 1C4QA 2A6HD 1C0AA 1NUCA 3U30A 5IYCH 1KNAA 1CKNA 1MSGA 5J1ZA 4R4CA 4ARCA 3Q3OC 2KQ7A 4POGA 1WY8A 3EROA 5EAYA 1CZGA 3QOJA 1P7FA 4A3FB 2L0TA 3SE0A 3ECIA 2INDC 1X56A 1T0QC 4N8X1 5IAAC 2J7QB 4IKGA 1N63A 2O6VB 3KYCD 3S14B 3QJZA 2CQAA 5C2TB 2AWNA 1XCTL 2KTRA 1OQQA 1O7LA 5E7NA 1R4MI 3CXCA 2FXQA 4DV4Q 1P0RA 2KECA 5IKCM 4P1BC 1LM0A 1RD9D 1HFNA 5CORA 1BBXC 2LGSA 2DJGC 2N88A 4GLSC 2YLMA 1XLPA 1IHZA 3QIJA 4KZCA 4IG7B 2WXLA 1KD1C 2ENBA 3R8BA 3NHHA 1BF4A 3GTKH 1C4PA 1G291 4IQZA 3WANA 1YIWA 3EIVA 1WTOA 1Z2MA 4U673 3EFUA 1X3GA 5I6YA 3QHTA 3RNCC 1EY4A 4L2YA 2MQHA 4NAWB 1IYFA 4LJPB 2LGIA 2GMIC 1OTRB 2SDFA 4B08A 4DK3C 1JJGA 4ME5A 2JSOA 4C3IH 4DPGA 1DYQA 2DZMA 3U2SC 1NSNS 1O7YA 1TBEA 3VH4B 2MO1A 4LK1C 3GTKB 3QA8A 2N3SA 2ASBA 5IT9L 4L63B 3HOWG 2TSSA 1AYFA 4YTMB 2F4IA 3T51B 4W9EA 4ZKCB 1EUJA 4QB4A 3U4ZA 1KM7A 2C5LC 1OXTA 4IUNA 1WXQA 4P7IA 4LF7Q 3VR5A 1LGRA 2D10A 3JSVA 1D3ZA 1E0ZA 3MFGA 4RCNA 4C3IB 2OWOA 1RCVD 4A3EB 1O7IA 2N9PC 2ZW0A 1TKWB 2IGGA 4DV1Q 3LWUA 1E8WA 1IBLQ 1E10A 3Q8DA 2JF5A 1BDOA 1K83H 4OIKA 4KKJA 3AE2B 3V62A 2JYEA 1MHHE 1WI5A 4YXDB 2ICIA 3A8JE 3MXUA 4B3RQ 3P63A 4DUZL 3PUWA 3W5UB 2WB1B 1V1PB 1H9KA 2IDYA 1GUWA 1NBFC 3GS2A 3HVZA 4A3JH 2NUCA 4US9A 4IOCA 2YTYA 5EDSA 2EELA 1I94L 1PTOH 1PH5A 2KWVB 4RA8A 1TXYA 2JP1A 3AFQA 3A8IE 4K6DA 4PMCA 4IUTA 1JWBD 4HPPA 2BF8B 1N9WA 4K5WA 3ML9A 3W1SA 3K81C 5CX3A 5EJWA 4XDCA 3VFKA 1W6KA 4X66L 4A3JB 4I65A 3GTGB 1J7BA 2HE7A 4KIKB 3D3RA 3FP9A 2HD3A 2EDGA 2IZVB 2EQSA 4IURA 3CRLC 1B7YB 2EJFC 4XQNA 1PYSB 1Q86C 3BWUD 4HCPB 5EGTA 1VJKA 3PMFA 4QCLA 4PZ7A 2ZXRA 2M4NA 1ILPA 3H7PA 4NQLB 3K5LA 2KC1A 1S3OA 2RGFA 4AS1A 2XRQD 2MUYA 4ULLA 1FNWA 1I7HA 3AEEB 5KGUA 4YTPB 3S1NB 1GHKA 3BZDB 1GPXA 5BR8L 2PQEA 3LDZE 4DHJD 1TR5A 2FIDA 3DWAA 1K8GA 1SNDA 5C0XJ 1STGA 4AIMA 5JAVA 1V1QA 1WTPA 1WTXA 4W9LA 1YZ6A 3OMGA 1TZ1A 3HOWH 5M3FG 3PLVA 3D6WA 3DEOA 1AWDA 3I4MB 2JA5G 4J8QA 1TS2A 5AUKA 3V05A 4EX5A 2QC8A 1N6ZA 2V4LA 3TUOA 1EWYC 4NXNL 2K01A 2KDMA 2MSED 4GDLB 3I3CA 1DOMA 3I4OA 5EE1A 3B2FA 3KF8A 3CRKC 2EYMA 3QWNA 4S3SA 5LMNL 3W3AA 3Q6BA 4RKBA 1MHWC 2RKSA 1ZP0B 3P7JA 3P4SB 1FMAD 3BDOA 4NXMQ 4HJGE 3E3XA 3OYYA 4X3UA 2IO1B 2WXPA 4TV3A 5D7GA 3DWGC 1ICFB 3E9HA 4F88A 4OONA 4A75A 4GN4B 1HQRD 2KHJA 2FMMA 4C3JG 3W5OA 3MTSA 4O42A 2N7DA 3N32A 2UXDL 2BTEA 4XTCS 2C9OA 3HRZC 4G4KA 4ZRPA 4FDBA 3CCRA 1W3SA 3RN9C 2VB3X 5AZHA 1V8QA 2WX1A 4EE2A 1G51A 3P20A 1OQRA 1HNXL 4A3BG 2NPTB 3OHXC 4IPDA 1GJZA 3CPWA 2RVLA 4JK1C 3MXNA 1I4XA 1PH8A 4RGOS 4GN3B 1FFUA 2N1WA 2A8VA 1U4PA 4PV1C 1JOOA 3NZSA 4CKEA 3NG0A 2LHDA 4YY3Q 2WHIA 1IYUA 3V61A 4QUFA 1YHBA 4DR7L 4C4VA 1YJNA 3AEAB 1QZHA 2DNCA 3PO0A 3CCEA 1SGHA 3ND9A 1O80A 2M8SA 3N20C 2B3AA 2CJNA 2MJ3A 3VXWA 4XYOA 1BT0A 4USAA 5CV6A 4AUQC 4BVUC 4DV3Q 4P74A 1YEZA 4FN2A 5K36G 2KCCA 1OXSC 4KKUA 1PV4A 4GN1A 2IT1A 1F52A 1PZKD 3WAOA 2L55A 4NMZA 4O2DA 2NVXH 1Q3LA 1E2ZA 5JJLA 2R3ZA 4LFAL 3QCAA 4WJNA 1OEYA 1SRUA 1YX6B 4K7SA 1L4ZB 1YOVB 4IFDG 2K52A 3PV0A 5FLXL 5HGQA 3GTQB 1D1IA 3ZRCA 1CKNB 4JBKA 4BAXA 2EY6A 1CI3M 2WLBA 5M3FH 4QMGA 4CDFC 1N60A 3PRZA 3ZTDA 4LNNA 4A3IG 1BCPC 4DWFA 2JA5H 1NMFA 1B8AA 1VQ8A 2A74C 3DMUA 1Q7YC 2KTRB 2MCNB 3BG3A 1YX5B 2KK8A 3E9IA 2GBRA 1YQ3B 1HR0L 5ELBA 3SR1A 1PZJD 3FHWA 2L11A 1K73C 4ZHPA 5M3FB 3DLLA 5M5YB 2JT4B 1WWTA 3GZNI 4GIVA 3QO2A 4GB9A 4XE0A 2B39A 4C7YA 2JA5B 1ZXHA 1FVIA 2WXRA 2K03A 2VQEQ 1SJED 1FCCC 4C3JH 4A3DB 1F2RI 4GSWA 1PTOD 2OTJA 3AH7A 1AW7A 4C7ZA 3KBGA 1PZID 1WI0A 2DHZA 1KH0A 1VD2A 1WXSA 1JOQA 2WDRB 5M3MG 3I7FA 3BZCA 1IBKL 1CUKA 2BA0A 4FJYA 2CHBD 4GNXA 4A3BH 1X3EA 4NQKE 1A2UA 1ZEQX 3P4PB 4DKAC 4A3GH 2JQRB 3CHBD 4C3JB 1N36L 2UU7A 3ULJA 1PGXA 4YSXB 1P98A 4R8NA 2JZZA 3CQZH 3J7YW 4GKKL 4FXCA 3FMCA 2K5HA 4XC2A 3A56A 1UEAB 1TIFA 1EYAA 3AMZA 2AEHA 1WR6E 1R9TH 1RFKA 2LZ6A 2OQKA 4A6QA 4A3BB 2KAJA 1WF9A 5KNDA 4WJOA 4GZYC 3NY5A 4BWGB 4BKTA 4A3GB 3MHSD 3PLUA 3M4PA 4II2B 4OVVA 3NZUA 4K1RB 3S2AA 2XN9C 2LASA 1V81A 2JXTA 1UF0A 3TEWA 5K36H 2HCIA 3CQZB 2A73B 4NNJB 4OX9Q 4BKSD 3A7AB 5BMHA 5IGFA 4DAVA 3KH0A 5IWAL 2OT2A 1NEKB 1WXAA 2Y3AA 1I4QA 1ICWA 5M5XH 4QGUA 1PTOF 1WXMA 1LABA 4LUOA 4K8IA 2RSUA 1TY0A 4IFDH 1A3UA 1BQQT 2Q8TA 1RYJA 4DHZB 5CBAE 3RLNA 1SE3A 1S5ED 5IOCA 1L4DB 2YVCA 4ZK9B 4A3IH 4BA1I 3I55A 1SF0A 3KJOA 1MJCA 2WXKA 4RF0A 2N7JA 1H9MA 2D5GA 3NTHA 1EY7A 4JI4L 2PLPA 2JWZA 3AYHB 2F0OA 3SEBA 3M4OH 4TUUA 5C0XI 1GHJA 2V4IB 4B6WA 4BY7G 3IAM1 4KJOA 4XQQA 1B50A 1BUIC 1R4NB 1L7YA 1VQ4A 4A3IB 1XMQL 3ABVB 3W9CB 2D0PA 1YN3A 2ES2A 3H7PB 1V1OA 1STNA 3KLWA 2C35B 3DHQA 3NE5B 5IOIA 1TT2A 2Z4IA 1K8OA 1E2VA 1T6BX 5E6JA 1UGJA 4NW2A 4JL9A 2UXBQ 1IW7C 2B2WC 2EXDA 1GUAB 1XCQL 3DPDA 4OXPA 1GUTA 1SNCA 4LDTB 2JN4A 3GTMB 2L15A 2AUKA 5M3MH 3I90A 5CV5A 2VQFQ 3R93A 1VQ7A 3VA7A 4DUYL 4BOSC 3EC8A 3KLSA 4LF8Q 3NELA 3PCOB 2IO3B 1LTTD 2PYKA 3EN2A 5IYBG 2NBFA 3PZ7A 2UU9L 3TEZA 1S72A 1YNNC 3HKZE 4M0WA 5IP9G 1RKNA 1IBXB 5KYLA 1CJEA 3L0WB 3DXJC 1WJUA 1XYIA 5E6OA 1NY4A 3PF5A 3VUXA 3Q24A 2LSSA 4LNQA 5FO8B 2M17A 2HT1A 5M3MB 3IHPC 2A68C 4WIPA 3APDA 3RMKC 4RKLA 4PYUA 1VQIA 4DK1A 4HDQA 4OW0A 5DLQE 1TU2B 1WE7A 4ASWC 4X3KA 1Y8PB 1UUPA 3T1YQ 1VQPA 5GQOA 1ASZA 2D3BA 4YCWA 1WE6A 4HPLB 3IFWB 4HIMA 4LF5Q 2W3SA 2PMVA 1M94A 4JPBW 3K5MA 1KQSA 2AWTA 4BOZB 2B8FA 1EZ6A 4OWWB 1LYLA 4L5RC 3ZNGC 3SGIA 5LMNW 3J7A5 3X3NA 5LL6X 3X0WA 2CQOA 1BUVT 2E8GA 3CC7A 1FXTB 5AZFA 4NZLB 1D5ZC 2IX1A 1TKGA 4EVOA 5JJZA 2Q8IB 4JC0A 4AOFA 1EIGA 4EQ5A 3CWIA 2V3PA 3CAMA 2DY8A 3MTNB 2EKIA 3P4RB 1B9NA 3DOWA 2E2HH 2UUBQ 2VZKB 3SDLC 4BY1G 2D3GA 4QUCA 1WM3A 1XNQQ 3QJYA 2VXWA 2N9LA 2Q2UA 3J7AF 4MM3A 2REXA 3UI2A 3F2BA 1E24A 1WX9A 4LCDE 3BINA 1Q1BA 1EEID 4XT3B 1F9JA 2D9UA 4C4VB 2AKWB 4BY7H 1RAXA 2IO0B 4JG2A 3VA5A 1YI2A 1Z7TA 1HNWQ 1QOGA 2E2HB 4IC7B 3TCAA 2R7ZG 3ZUNA 4HJ7A 2E2IH 4OL7A 1RFAA 1VDVA 5D3IB 4L8JA 5EE9A 1DOLA 3D4DA 3UDXA 4X64L 3M7GA 5ELEA 1F2ZA 3ZLZA 2TMPA 3K57A 3T9LA 4DAYB 2GB1A 2NZOA 4DR6L 3I57A 1SMYC 1CK1A 3I72A 2YU9B 1WGGA 3Q8EA 1S4ZA 2EVBA 3I91A 1FL0A 2KVMA 3Q3NC 2G4SA 5LLIA 2RQXA 5LNK1 5K5PA 4PZ8A 4GKJL 2E2IB 1RHPA 3BU2A 5IP9H 5ISRA 4OVUA 1KLGD 2NZ1D 1U4MA 1WTRA 2KANA 4CJ2C 2KDIA 1QF6A 1UWVA 2Y0SG 1ET9A 2K04A 1E3PA 4JI7Q 1JW9D 1L6UA 1FO4A 3V3XA 1SR3A 3FAHA 4XGAB 2EYJA 4DDGD 2BS4B 1E7UA 2GBNA 4RMAA 4LF6Q 3IVFA 4C2MB 4LMQD 4BBNF 5J18A 3AEVA 2YEPF 1WJJA 3LWEA 2LHEA 1X32A 4XZ4A 3L4PA 2GA4B 2JXMB 2FCQA 3KOJA 3DVNU 2RPVA 2V1CC 4FHJA 1Z5SB 3ITPA 3CMMB 4G7HC 2LWPA 4G50A 4LUVA 5IT9c 1HPCA 4U68A 5J22A 1JB3A 3BZKA 1Z9FA 4WJWA 2MA9B 3APCA 4XDXA 3QX1A 1JQ4A 4GNXB 1P16A 1MI0A 5BMIA 1VZ8A 2OCEA 2DLBA 1DM0B 5JJIA 3PTFC 2F4VQ 4TQUS 2DYMA 4HPMB 4GOCA 2W3RA 1I5FA 2F0QA 4BY1H 2JA6G 1WGKA 4LDTD 1V1PA 5COYA 4UDUC 2HIVA 1SJHD 3OJ4B 3A8KE 2FCSA 1EM7A 3Q8CA 1RLFA 2KEEA 4FJZA 2HDEA 5CR3A 3NVWA 4G3XB 1LT3D 2KC2A 4A9AA 2LY7A 3A55A 1NVID 1SSNA 5JXVA 1P7EA 4DV2L 3I4LA 1C4CA 1HZ5A 2DZJA 2KOLA 5EPKA 1PH9A 2R7ZH 1Y1VB 2IHFA 4A76A 4G7ZC 2HHHL 1V6EA 4RM8A 3W1YA 1G6JA 3DWQA 1K3BC 3OW2A 3AE9B 2W55A 4IPGA 1M8AA 2E2JH 4GS3A 4RGMA 2BB6A 2FFKB 2LGXA 2UYZB 4KIKA 2B2UC 2KJXA 5LHY1 1Y8NB 1SYEA 4TSSA 1UBQA 2E74C 4FHKA 2JYTA 2A6HC 3RNAC 4V0BA 5C5LA 4OZCA 3NRZA 2I5HA 4KGTA 1HZ9A 2B2VC 2CHWA 2R7ZB 4KDLB 4B95A 4IWOA 4JI1Q 2DBYA 2J53A 1L1OC 2F0DA 1PH7A 1FJGQ 2DAFA 1VQ5A 1ZKOA 3I56A 2KX0A 2H4OA 2K7VA 2Q8RE 4HSPA 4DV4L 1J5EQ 1JT8A 1GUSA 3U4VA 1CZPA 3AN1A 3ZQ4A 1STEA 4W9CA 1H9SB 1XF5L 4KV2A 1M4VA 2J52A 2NMQA 3G4SA 4IUUA 2R93B 2QEXA 3CP0A 3OIPA 2SNMA 1JWMD 3F2CA 2KDEB 3KW5B 2K5WA 4NP5A 2CR5A 2J0TD 4C80A 3RLOA 3PSIA 4HJ5A 3EECA 4FVMA 5DNFA 1Q5WB 2CWPA 4GU2A 5HHDG 3T53B 3HKSA 5JHAA 1LTBD 1FM0D 2UWQA 3PRMB 1SE8A 2VS1A 4GDLA 3ZJVA 1HHVA 3PO2G 2WGSA 2LUMA 2K6AA 3A33B 3P2BA 2JEBI 3KQ4A 3VH3B 4FBJB 4K6LA 4MT5A 2KFJA 2K28A 1QUQA 3X3MA 4LF7L 4JLCA 4KX6B 2B2TC 4FP5D 2R7DA 3TIXA 2BWFA 4M0WB 1TVXA 3UE0A 1CM9A 2JA6H 2FJ2A 5EQ0A 2DX5B 2QW7A 4DV1L 2K25A 3EUB2 1IBLL 3PHWB 3Q14C 4C3IG 1L6VA 1T0SC 1HNZQ 1TKYA 4A3EG 3BVZA 4K5VA 1VRAB 3IT6B 4DNRB 1CKMA 4DV0Q 3PREA 4JQWC 4HJ9A 2B3GA 1E7PB 1UNSA 2NPTA 3H3VC 1PGAA 1WYWB 4JWUC 4DNTB 2MJEA 4YTNB 4B3RL 2GN5A 2X6LA 1GXDC 3NUCA 3S17H 2K5VA 1XPUA 1IYJB 3L10B 4KGSA 4ZRJA 3B08A 1J8CA 5HKHA 5CHVC 3A9KB 4IWQA 2WB1G 4ZUIA 4DF7A 4LFCQ 3L7ZC 3DHIC 2KKCA 4DAMA 4GLVB 4JI3Q 3J9CA 4A3LG 2CH4W 1YN4A 4CJ0B 3D6CA 2Z59B 5FOBB 1NJIC 4FYDA 1TQOA 5C6AA 2E6XA 4EZJA 3ERSX 2JK8A 5EPLA 1L0WA 2J7ZA 1MJEA 3S17B 2FNJB 4ANVA 5C4ZA 1MGSA 4ALPA 3HOZG 2KQ4X 2MRPA 1GD7A 3KJPA 4KGRA 4URKA 1BXTA 2L12A 2F0NA 4OIJA 2RCNA 2A4ZA 4OELB 1D5XC 3S14H 3DBHB 4V190 4UP7A 4B9KA 4IPHA 1M90C 2NZHA 4KTAA 1OQYA 2F0VA 2ZVNA 3VHTC 3FPUB 2ZM6Q 2EZVA 1KIXA 5GAGC 3CU7A 5G3LF 4FF2A 4IFDJ 3STBD 1B4OA 3DVNV 5FJ8H 3GOEA 2Z6KC 2BS3B 1I6HB 4W9GA 1GUOA 4MN3A 1QLBB 2ZCBA 2JZ3B 3T13A 4DXFA 2F0FA 1SYGA 4W9DA 2DYOA 3KYDD 3HOUB 4DBGA 4Q5VA 5GAEC 3U7ZA 1F9QA 4EQOA 1N5WA 3NS1A 3ZNZB 3PO2H 2EE1A 2BVCA 2I1JA 4OO1I 1WVLA 5EE0A 4DV6Q 4DU9A 1V2YA 4K81A 1JWAD 1R4PB 2WDQB 3U50C 2LS01 4UP9A 1N5XA 4CDCC 3MWYW 2MBHA 1D8LA 2HQEA 3Q3MC 4RWSC 3I4MG 2VH2A 4BBSB 3A1QB 3A9JA 4H02A 3AE3B 2MNAA 1K28A 4HWIB 2JUOA 3PO2B 2YYZA 3C2PA 4MTKA 4LF4Q
chains in the Genus database with same CATH topology
4OO1G 1HTLD 4NKLA 2MH7A 1XX8A 3P75A 3GP7A 3OMCA 2WXMA 2AX5A 2CW0D 3SK4A 1G8ZD 2PMZB 5MPOA 4JPSA 1HUNA 3IL8A 4F8MA 3Q8FA 3OWEB 2IX0A 4LJZC 5ELFA 3ZJUA 3Q8BA 1LT6D 2I46A 1JQYD 1VLBA 1I4RA 3R2IA 1OXVA 4FO2A 3WOEA 4OZBA 3HOVB 1IGCA 1MHXA 2EYFA 1GAQB 3I9V1 1Y1WB 1FIQA 1F2MA 4FXDA 1T5EA 4DGZA 2Y5CA 3HOZB 3AEFB 1J8IA 2QILA 4C56C 1NR4A 5BYQA 3ZJTA 3N6RA 1CA6A 4QIWB 2ACZB 4P2CB 5HI1A 1DONA 1ET6A 4KV6A 2B2WA 3QG1A 1C76A 5KNBA 3TN2A 2LKVA 2XWJB 2KQ3A 3HOXB 2BDOA 1ZXTA 2QEJC 4R9WA 2BDNA 4A3MB 3I4NB 2HDLA 1DGJA 3NK9A 3NP8A 4XWWA 1D2BA 1PRTD 4OO1H 2WAQB 3C3LA 2F0LA 2I2YA 4HAEA 4P6VF 4DXGA 3AE7B 4FF3A 3S2HB 3FRPB 4A3KB 1IBXA 1FCLA 3MAQA 1XLOA 2WACA 5FO7B 4M8AA 1K53A 1D5MC 1O78A 2JWUA 3RZOB 2L9HA 4H0LC 4EQPA 1WTVA 4G57A 2F1MA 2DN8A 3TBIB 2E76C 2BA1A 2K5DA 2JA7B 1TJEA 5D3DA 4L23A 1RF2D 3EQLC 3K0YA 1WD1A 2JZPA 4BS9A 5BN3A 3VYRA 1PRTF 3S1MB 2M19A 1UWXA 3RD4A 1KNEA 1Q90A 1D4BA 1Q8IA 2X38A 1F9RA 1QG7A 4REZA 5ELCA 3W2DA 4LAAA 4IFDI 1F9SA 1W6JA 2SNSA 5EKIA 1VZ6A 1SNMA 2KMMA 4UAIA 3IKJA 2A5HA 2BCOA 1LTGD 1BCPB 2INPE 1PUTA 3SFEB 4DAYA 2OXPA 1LT4D 1VF7A 4JX1C 1KRHA 1PFBA 1TIID 3T56B 2RDGA 2WIIB 4N9PA 5C4XB 3OIQA 3MHZA 5LL6S 3FEWX 5CYUA 4JBWA 3S2DB 1NCVA 1YNJD 1A15A 3RLFA 2NTSA 2KACA 2K22A 1LLRD 4ZRQA 3AE6B 3PIO3 1B3AA 2R61A 2V4DA 3LXFA 3R2TA 5CV7A 2E75C 1TKEA 3ND8A 3NVZA 4CJ1B 4IUQA 5JVG3 3DWPA 2R6GA 2WXNA 1J9OA 2JA8B 1TS3A 1FEHA 5CC4A 2XVSA 3BVMA 2PW7A 1JWUD 1VMPA 2RDFA 3GTOB 5JPNC 5HGTA 5G5GA 1A70A 1ZPSA 1LTID 3NQTA 4L6TB 2F0SA 1EEFD 5C3EB 2FINB 3MXGA 3J7AV 1G6ZA 3S15B 1RODA 3MZ5A 2B2UA 3RUZA 2IPKD 4RNAA 2F0WA 1RDPD 3HG9A 5JVH3 2B2VA 3URYA 3OWFA 4ZUJA 1PFMA 3HOYB 2ID0A 1QNUA 2EYHA 2MJ8A 2JSVX 1DOXA 1TS4A 2RSNA 4H13C 2IW3A 4ZRZA 5H92C 3CIRB 5A2QE 2L1BA 3DM1A 4NDXA 1HRJA 2WXQA 2A6ED 1H9SA 3HS0C 3H0GB 1F2LA 1ESFA 1QWYA 1GUGA 4MACA 3AEBB 4X3TA 2FMCA 3Q6SA 2PZTA 1LACA 2F0PA 3VR6A 3LNNA 4X3SA 2M9VA 4R8IA 1LV9A 3P4QB 4K14A 1KFYB 5IGDA 4KJNA 2B2TA 5C44B 3W5UB 3M7NA 1FGBD 1HFGA 2F0UA 3HP3A 1ZDVA 1FNVA 4MH8A 1NYRA 1DOKA 3PUVA 1HEZE 2MP1A 3BS1A 4ID6A 4RFBA 1ZYRC 2IJ0A 4DAPA 2M2LA 4F87A 4HMIA 2JE6I 1EY0A 1BCPD 3NWTA 2JEAI 3HUIA 1S5DD 5ELDA 2KN4A 1EFID 3O13A 3SK6A 1I50B 2R92B 1GJXA 5E3FA 2MEKA 4HN7A 1FD6A 3TZDA 1L0VB 4N6EB 4H44C 1NENB 2INNE 2HDMA 1SSOA 2PKOA 1ROEA 1EY9A 1ML0D 3SK5A 3S16B 1SYDA 3D4RA 1EWCA 2LMCA 2WXIA 3MEHA 1EIHA 1RTNA 2XSCA 1K51A 3MHBA 3FILB 1WCMB 2QJLA 4XWTA 4WRDA 1Q1EA 4WORA 1SYFA 3L9AX 1EU4A 1U9RA 3I73A 4D2KA 3QIAA 3D8GA 1MD2D 1MVKA 1QQRA 2ON8A 1B2TA 1SNOA 1L5PA 2Z4HA 2EYLA 5D14A 1PDXA 3AEDB 1F2RC 4WQMA 2BE5D 4B0EA 2QDBA 2F0GA 2I07B 1B1ZA 4J1MA 3E9SA 2H89B 2PCFB 4IZ8A 1Z6HA 3KBXA 1R4QB 3BIID 3OW7A 4ARIA 3MA2B 3NQIA 1Y56A 4YSYB 1AN8A 4RAUC 4A93B 3KWLA 4KK7A 3AMUA 3AEGB 1KAAA 5JOBA 1YN5A 1C48A 2W54A 5I2YA 1B9RA 1SNPA 3Q23A 1ZXIA 3MVVA 3TDQA 1I6VC 1KDAA 2V3NA 5DEHA 3TSSA 3EFXD 1QCBD 1L0YB 4RGNA 2L83A 1PGBA 1LTSD 4LK0M 2A69D 1OO9B 3PZ8A 1QILA 1CQFA 2VB2X 2HCCA 2AUJD 2Q5WD 1F2YA 3NPPA 1MBYA 1IW7D 5EE3A 3NTKA 4NJCA 4ITKA 5TSSA 2O4XA 1WYGA 4A8XC 1NI3A 4M1UB 1SE2A 5AFWA 2F0JA 1FR3A 4FF1A 5KEEA 2D2CC 3J80E 3NUHB 2B2YC 2QCPX 1Z47A 3BK1A 3GV6A 1JWSD 1EWHA 4CHTB 5I6WA 1C78A 3V96A 1D6EC 4B9WA 4H2AA 3T3NA 3Q69A 3FKIB 1SYCA 5E1FA 4R3DA 4XDDA 1NAPA 1VDZA 2WXOA 3N52A 2RMMA 1ONLA 2DNEA 2ZXPA 3BDCA 2NVQB 1UAPA 2Z8LA 5FO9B 1QOFA 5I2XA 4KI0A 4HSVA 1V97A 1JALA 4E6IA 4A90A 3UI3A 4PT5A 1QT9A 2ZW1A 5GXGB 3J81E 2M56B 2IGDA 3SR6A 1YJJA 1XEEA 1EL0A 2IWHA 1L0XB 2VZKD 2NN6G 3IFTA 2F0KA 1V8CA 4L1BA 3VYTA 3N9YC 5M9OA 3FVQA 4ZOHC 4TMAB 2WINB 5C3WA 5C4JB 3NBHA 1SMYD 4Q0FA 1Y8OB 1OXXK 1S5CD 3M3YB 3CKIB 5A2QL 1IKMA 1TS5A 3QOLA 1KTKA 1GUNA 1R7SA 5CBEE 4RF1A 1ILQA 4FF4A 1BOSA 3GTPB 1RWSA 4ZLTF 1FRRA 2KWDA 1I4PA 2NVYB 2GRIA 4JWSC 1FNUA 2MGSA 1CQVA 1HCZA 4Y7NB 4YIJA 2WKCA 4IN3A 1PLFA 3RFZB 3VRBB 5I9OA 4KY5A 3C8YA 2LMCB 4XIGS 1EY8A 1IKLA 2WXFA 2K9XA 2QKIC 5BN4A 2N0SB 3AV8A 2MPMA 3SFDB 1SNQA 3ZYYX 4WH4A 2WV6D 1STBA 5EKLA 3P1HA 2CVRA 2PZUA 2NYZD 2G9HD 3GTJB 5HFYA 2X69A 3EVQA 5G5HA 2F0IA 2KHSA 3AE5B 4N58A 1MI2A 2PNRC 2NN6H 3FDTA 1F77A 3GV3A 4PMBA 3TP8A 5IGBA 1STYA 1PDQA 1NR2A 5FK9C 5JEAG 4TQ1A 4EGVA 1AFPA 4KMUC 4HKQA 4HCSA 5NUCA 1E6EB 3HGBA 1PRTC 4ZYSA 4ZHOA 2OHFA 2KEDA 2FHTA 3TMEA 1IL8A 2EYPA 3GQBA 3HEJA 4RCOA 1FD7D 4BBRB 1DJRD 3BVGA 3GTLB 1BO0A 4WWMA 3E0JA 3H94A 2X6GA 5KIXA 2RA4A 3ERQA 3RMHA 3V2TA 2PVGC 3VR4A 1F9PA 2DWQA 1FFVA 3B2GA 2WKDA 2O5IC 1ZUD2 2G1EA 3F2UA 2WU5B 1J7AA 5BYSA 3GO5A 1VF5C 2F03A 3C1FA 2BB5A 3K5OA 3P42A 3AE8B 3RPFC 4QF4A 4IUVA 5CGKA 1EY6A 5KRUA 4HRSA 2H1EA 2NWGA 4C3HB 3Q8AA 1V43A 2K5QA 3C46A 1TWFB 3U4EG 1E0BA 1WD0A 3HKZB 1SIJA 1RTOA 2MHVA 4XXEA 1PYWD 5HG2A 1XTCD 2F0EA 1JORA 3VQIA 3EGRA 2D62A 5JEAH 1HQMC 2WP9B 3MFYA 2L5TA 4GDKB 3H09A 2F0TA 2KCNA 3OPOA 2L1AA 1LT5D 1FXIA 4A55A 1K83B 4HROA 2B63B 1SDFA 4ODGA 4RHSA 2EY1A 1MSHA 1HZ6A 3ONAB 2K05A 5EPJA 4US8A 2EYOA 3TP5A 3J80L 5IIFA 1CTMA 2DY7A 2RSOA 1QKZA 1YMHE 1SXTA 2LFNA 2PW9A 1YNJC 1PTOB 2I38A 3G6JB 2G9DA 5IGCA 2E3TA 3QB3A 1PTOC 3Q0AA 2K1BA 4IOIE 1H9RA 2ICEC 1JRPA 2F3WA 1QOAA 2QIEB 1F0ZA 1CZWA 4KD4A 1G2SA 1FYCA 1ENAA 4AYBB 2EOTA 1SEBD 1SE4A 1DCZA 4DN4M 1KDBA 3M85A 2BS2B 3J81L 2FUG1 1JICA 4WFN3 4KN4C 2ONQA 3FILA 4ABNA 3HOWB 2BOSA 4Z9CB 1TZOA 4K2LA 3T4AC 3TZUA 2XWBB 1OFFA 1JMLA 5C3JB 3IAYA 1DOYA 4K2KA 2WDVB 3R3OA 4XQJA 4DQOC 1GOZA 1QE6A 4KY7A 2PO4A 1KABA 1A3TA 1EYCA 2HTME 2N9KA 5JPMC 4H7BA 1XO3A 1E9MA 2A6EC 1VZ7A 3AB5A 3I8ZA 4ZQ3A 3B9JA 1CFMA 2E2DC 4PMWA 2LFIA 1NYQA 2F0MA 4LLGM 2M00A 1O7ZA 2FBWB 3NZ3A 3DEPA 1K8MA 2B76B 3Q22A 1VR9A 3VYSA 1BNZA 5FKAC 2L4NA 2OEDA 3VRAB 3H91A 4BA2I 4F7XA 3BDLA 1ZDXA 2BW2A 5BYRA 3C1EA 2Y5PA 1VMCA 1EOTA 1C8CA 2AQ2B 3E6ZX 2NVXB 5A35A 2B2YA 4JE3B 2JU6X 3IT4B 5HURA 5IGGA 1AEXA 1TYGB 4CBVA 2WXHA 2WQYB 4KHZA 4AQ7A 2L52A 4HEDA 1N62A 4KN7C 3D31A 5M5WB 2H88B 5E4XA 1SFOB 4WURA 4N9TA 3EJIA 1WTWA 4FNFA 3G7LA 3KK7A 2EPBA 1DOIA 2K33A 1B9MA 3TEXA 4MIUA 2YEPB 3BYTB 2WS3B 2F3VA 2LEKA 4IALA 3RZDB 3LX0A 4K8JA 3KUPA 3PUYA 2EY2A 4XT1B 3U9OA 3KWVA 3VR3A 1N61A 2BE5C 1T3QA 1STHA 2AQ1B 1WSPA 1DZ1A 2WXJA 1QB5D 4ILWA 2L32A 2VNUD 3K6OA 5FR3A 2MJDA 1TWHB 1JCKB 3LB8C 1R9TB 2WP8J 1ZOYB 2ZXOA 3GB1A 3E56A 3WOFA 1YJIA 5E4WC 1RM6C 1B53A 1EZ8A 1CHQD 5M5XB 3MJ5A 3A7LA 4DA2A 3AECB 3SHLA 3I70A 3KLSX 1QOHA 3ZGZA 3WCQA 3JAME 3S9WA 1QJOA 2PW5A 1X3PA 4C1NI 5C4HA 2A69C 1Q12A 5CV9A 1A2TA 1XXGA 3M4OB 2K3UA 1B44D 5C0XG 4N59A 1A6XA 2O2LD 1LTRD 2BYTA 3NVVA 1S5FD 1TWGB 1ENFA 1DD2A 1WRIA 1KLUD 3NTIA 3S1RB 1C79A 5T8IA 2IX3A 1VCIA 2CU3A 1C77A 2K5PA 1QNKA 4CKCA 5CMDA 4HCEA 1G2TA 1U4RA 1MPEA 4KHVA 2WNMA 4B9XA 1T5XD 2SEBD 2LJIA 4J6HA 2NTTA 2Z1CA 4DK0A 2PTLA 5I4DA 1BCPF 3IFDA 4RHRA 3S1QB 3TP6A 4KKTA 1JROA 1U4LA 3AM9A 4IDIA 4FXGC 5DM63 1ENCA 1HXYD 3D4WA 3PIP3 1SBBB 2OF1A 3ETRA 5DAUA 1IYVA 1G91A 3FPPA 4DFAA 3HZXA 5AUIA 1EYDA 4FXKC 1DXMA 1XLQA 4P16A 2PIAA 5C5MA 2XIWA 1C4AA 5JEAJ 2IL8A 4TKOB 3DUZA 5CV4A 3L3OC 5BMGA 2QMTA 1PFNA 2N55A 4ZKBB 5T1GA 4C1NK 1A3VA 2IGHA 5IT9E 1HA5A 5IGEA 1PFDA 3HRDD 1Y69U 3NXWA 2D5DA 1HTPA 3MP9A 1UWMA 5H8YE 1K52A 3T3OA 1HUMA 3SDZA 4ZAIA 5DM73 5C0XH 1IUEA 2JX5A 4BY7B 2XRSD 2QSDA 1KDCA 4LTUA 3BK2A 3EA6A 3PO3B 3AB9A 1LTAD 1ZE3D 1GB1A 2O5JC 2CJOA 1TWCB 2K32A 1FRDA 5J39A 2F0HA 1JR0D 2GI9A 3SVMA 2SOBA 4B0MA 3FC4A 1ZYRD 1H9JA 1LO5D 1YNND 4IUPA 3IAS1 2WXGA 4OZAA 3A54A 3H6MA 3KLRA 2A68D 4WAFA 2EXZA 2RBMA 3VYUA 4NAMA 2C5CA 2L0CA 5EBCA 3T16A 1I3QB 3AE1B 2XNAC 4MHEA 1YNTE 1YQ4B 1TY2A 3PUZA 4KY6A 3SXHA 3VR9B 2BT6A 2K0PA 4OGQC 1OXUA 1JOKA 2VUMB 3SK8A 4HR7B 3HVDA 1BR9A 1S5BD 2NN6I 4BY1B 3NSWA 1SYBA 3WDNA 1TWAB 4EQNA 5IODA 5D65A 2FE8A 3MXPA 3TP7A 4RH6A 3VR8B 1X3QA 1K50A 4Q2JA 3U9SA 1AZPA 4YSZB 2J4XA 2M0AA 5CV8A 3W5VB 2J42A 1E2WA 4RGTA 1I4HA 1ACCA 4OVZA 4PNYA 1GB4A 4O1NA 4HMJA 2E2JB 1HA6A 2V0GA 4YWGG 2NVTB 4TQ0A 1SAPA 3TEYA 3NVYA 3BYYB 1JC7A 4YT0B 3MC0B 2WU2B 5EBDA 3VR2A 3PUXA 1JE4A 4HEA1 1D1KA 1I4GA 3U52E 1KF6B 3OSOA 2CW0C 2Y0SB 3M4YA 5EKKA 3NWSA 1STAA 1CA5A 2PPBC 5I9PA 2KA7A 1EQVA 3K58A 3K7AB 1SB3C 2ZT9C 3H8HA 2EJGC 4XYQA 1RJTA 3OOCA 1XWEA 4KKSA 5C3XA 3K5NA 1J7CA 2EJMA 1CT1D 4C3HG 1PMRA 1AZQA 3P1MA 4K5XA 1EQTA 4TRDA 2SAKA 4HTHA 5FLXE 5G3LD 4CKBA 1CHPD 1ESRA 2AQ3B 4OHJA 1Q10A 2BBCA 3IXSA 1BMLC 5T1IA 4I7ZC 3LYYA 3JAML 4G7OC 1QOBA 2EY5A 4KD3A 2JA6B 3GD7A 5F2DA 2PZWA 4CQNA 2QF7A 1EU3A 4KKIA 1IGDA 1XLNA 3E5SA 2JYOA 3AU7A 1II3A 4CGYB 3AE4B 2RDHA 1AP0A 1PRTB 4HKZE 5KYIA 3NBIA 5KNCA 3DWMA 4PQXA 1PXUA 2B8GA 2NB0A 2HUGA 2PVOD 3K59A 2KUMA 5BN5A 2AWOA 1EY5A 4J3OD 1C9FA 2W82A 4MM3B 2OEOA 1FXAA 1WTQA 1C4QA 2A6HD 1NUCA 1KNAA 1MSGA 5J1ZA 4ARCA 3EROA 1P7FA 1CZGA 3QOJA 4A3FB 3SE0A 4IKGA 1N63A 3S14B 2CQAA 5C2TB 2AWNA 1XCTL 1OQQA 1O7LA 2KECA 1RD9D 1HFNA 5CORA 1BBXC 4GLSC 2N88A 1XLPA 1IHZA 2WXLA 2ENBA 3R8BA 3NHHA 1BF4A 1C4PA 1G291 4IQZA 1WTOA 4U673 5I6YA 1EY4A 4L2YA 4NAWB 2LGIA 2SDFA 4B08A 4ME5A 2JSOA 1DYQA 3U2SC 1NSNS 1O7YA 3GTKB 4LK1C 5IT9L 4L63B 4YTMB 2TSSA 1AYFA 2F4IA 3T51B 4ZKCB 4QB4A 1OXTA 4IUNA 1WXQA 3VR5A 1E0ZA 3MFGA 4RCNA 4C3IB 1RCVD 4A3EB 2ZW0A 1TKWB 2IGGA 3LWUA 1E10A 1BDOA 4OIKA 4KKJA 3AE2B 2JYEA 1MHHE 4YXDB 2ICIA 3A8JE 3MXUA 3P63A 3PUWA 2WB1B 1V1PB 1H9KA 2IDYA 1GUWA 3GS2A 3HVZA 2NUCA 4US9A 2EELA 1PTOH 4RA8A 2JP1A 3A8IE 4K6DA 4PMCA 4IUTA 1JWBD 4K5WA 3W1SA 5EJWA 4XDCA 1W6KA 4A3JB 3GTGB 4I65A 1J7BA 3D3RA 2EDGA 4IURA 3CRLC 2EJFC 4XQNA 3BWUD 5EGTA 1VJKA 3PMFA 4QCLA 2ZXRA 1ILPA 3K5LA 4AS1A 2XRQD 2MUYA 4ULLA 1FNWA 1I7HA 3AEEB 5KGUA 4YTPB 3S1NB 1GHKA 3BZDB 1GPXA 2PQEA 1TR5A 3DWAA 1SNDA 5C0XJ 1STGA 5JAVA 1WTPA 1WTXA 3OMGA 3D6WA 3DEOA 1AWDA 3I4MB 4J8QA 1TS2A 5AUKA 3V05A 3TUOA 1EWYC 2K01A 2KDMA 4GDLB 3I3CA 1DOMA 5EE1A 3B2FA 3KF8A 3CRKC 2EYMA 3QWNA 4S3SA 3W3AA 4RKBA 2RKSA 1ZP0B 3P7JA 3P4SB 1FMAD 3BDOA 4HJGE 2WXPA 4X3UA 5D7GA 3DWGC 4F88A 1HQRD 2FMMA 4C3JG 3MTSA 4O42A 2BTEA 4XTCS 2C9OA 3HRZC 4G4KA 4ZRPA 2VB3X 1V8QA 4EE2A 3P20A 1OQRA 3OHXC 2RVLA 4JK1C 1I4XA 3MXNA 4RGOS 1FFUA 1U4PA 4PV1C 1JOOA 4CKEA 2LHDA 1IYUA 4QUFA 3AEAB 2DNCA 3PO0A 3ND9A 1O80A 2CJNA 2MJ3A 4XYOA 4USAA 5CV6A 5K36G 2KCCA 1OXSC 4KKUA 2IT1A 1PZKD 2L55A 4NMZA 1Q3LA 1E2ZA 2R3ZA 1L4ZB 4IFDG 3PV0A 5FLXL 3GTQB 1D1IA 2EY6A 1CI3M 2WLBA 1N60A 4QMGA 1BCPC 2A74C 3DMUA 3BG3A 1YQ3B 5ELBA 3SR1A 1PZJD 2L11A 4ZHPA 5M3FB 5M5YB 1WWTA 3QO2A 4XE0A 2B39A 4C7YA 2JA5B 1ZXHA 2WXRA 2K03A 1SJED 1FCCC 4A3DB 1F2RI 1PTOD 3AH7A 4C7ZA 1AW7A 3KBGA 1PZID 1KH0A 1JOQA 2WDRB 2BA0A 2CHBD 1A2UA 1ZEQX 3P4PB 2JQRB 3CHBD 4C3JB 1PGXA 4YSXB 4R8NA 3J7YW 4FXCA 3FMCA 3A56A 1UEAB 1EYAA 3AMZA 1RFKA 4A6QA 4A3BB 2KAJA 5KNDA 4GZYC 4BWGB 4A3GB 2XN9C 2JXTA 3TEWA 5K36H 2HCIA 3CQZB 2A73B 3A7AB 5BMHA 5IGFA 4DAVA 2OT2A 1NEKB 2Y3AA 1I4QA 1ICWA 1PTOF 1LABA 4K8IA 1TY0A 4IFDH 1A3UA 1BQQT 2Q8TA 1RYJA 5CBAE 1SE3A 1S5ED 5IOCA 1L4DB 4ZK9B 4BA1I 1SF0A 4RF0A 2WXKA 2N7JA 1H9MA 2D5GA 3NTHA 1EY7A 2PLPA 2F0OA 3SEBA 5C0XI 1GHJA 2V4IB 3IAM1 4KJOA 4XQQA 1B50A 1BUIC 4A3IB 3ABVB 3W9CB 1YN3A 1V1OA 1STNA 3DHQA 3NE5B 1TT2A 2Z4IA 1K8OA 1E2VA 1T6BX 5E6JA 1UGJA 4NW2A 1IW7C 2B2WC 1XCQL 1GUTA 1SNCA 3GTMB 2AUKA 3I90A 5CV5A 3R93A 3VA7A 3KLSA 1LTTD 2PYKA 3TEZA 2NBFA 3PZ7A 1YNNC 4M0WA 1RKNA 1IBXB 5KYLA 1CJEA 3DXJC 1XYIA 3Q24A 5FO8B 5M3MB 2A68C 4WIPA 4RKLA 4DK1A 4OW0A 1TU2B 4X3KA 1Y8PB 1UUPA 2W3SA 2PMVA 3K5MA 2B8FA 1EZ6A 3X3NA 5LL6X 1BUVT 4NZLB 1D5ZC 2IX1A 1TKGA 4EVOA 5JJZA 2Q8IB 1EIGA 3CWIA 2V3PA 2DY8A 2EKIA 3P4RB 1B9NA 2VZKB 4QUCA 3QJYA 2VXWA 2N9LA 3J7AF 3UI2A 1Q1BA 1EEID 4XT3B 2D9UA 3VA5A 1Z7TA 1QOGA 2E2HB 4OL7A 1VDVA 5D3IB 4L8JA 5EE9A 1DOLA 3D4DA 3M7GA 5ELEA 1F2ZA 2TMPA 3K57A 2GB1A 3I57A 1SMYC 1CK1A 3I72A 2YU9B 3Q8EA 1S4ZA 2EVBA 3I91A 2KVMA 2RQXA 5LNK1 5K5PA 2E2IB 1RHPA 5ISRA 1KLGD 2NZ1D 1U4MA 1WTRA 4CJ2C 1QF6A 1ET9A 2K04A 1JW9D 1FO4A 1L6UA 3V3XA 3FAHA 2EYJA 2BS4B 4C2MB 4LMQD 2YEPF 3LWEA 2LHEA 1X32A 3L4PA 2GA4B 2JXMB 2RPVA 3ITPA 4G7HC 1HPCA 4U68A 5J22A 1JB3A 4WJWA 4XDXA 1JQ4A 1MI0A 5BMIA 1VZ8A 2DLBA 1DM0B 4TQUS 2DYMA 2W3RA 2F0QA 1WGKA 1V1PA 5COYA 4UDUC 1SJHD 3A8KE 1EM7A 3Q8CA 2KEEA 2HDEA 5CR3A 3NVWA 4A9AA 1LT3D 2LY7A 3A55A 1NVID 1SSNA 5JXVA 1P7EA 3I4LA 1C4CA 1HZ5A 2KOLA 5EPKA 1Y1VB 4G7ZC 3DWQA 3AE9B 2W55A 1M8AA 4RGMA 2BB6A 2FFKB 2B2UC 2KJXA 5LHY1 1Y8NB 1SYEA 4TSSA 2E74C 2JYTA 2A6HC 4V0BA 5C5LA 4OZCA 3NRZA 4KGTA 2B2VC 2R7ZB 2DBYA 2J53A 2F0DA 1ZKOA 2H4OA 2K7VA 2Q8RE 4HSPA 1GUSA 1CZPA 3AN1A 3ZQ4A 1STEA 1H9SB 1XF5L 1M4VA 2J52A 2NMQA 4IUUA 2R93B 3OIPA 2SNMA 1JWMD 2K5WA 4NP5A 2J0TD 4C80A 4FVMA 5DNFA 5HHDG 3T53B 1LTBD 1FM0D 3ZJVA 1HHVA 2LUMA 2K6AA 2JEBI 3KQ4A 4K6LA 4MT5A 2K28A 3X3MA 4KX6B 2B2TC 4FP5D 1TVXA 1CM9A 2FJ2A 5EQ0A 3EUB2 4C3IG 1L6VA 1TKYA 1VRAB 3BVZA 4K5VA 3IT6B 4DNRB 1E7PB 1UNSA 3H3VC 1PGAA 4JWUC 4DNTB 2MJEA 4YTNB 2X6LA 1GXDC 3NUCA 4KGSA 4ZUIA 4DF7A