1V1PA

The structure ssl from staphylococcus aureus from an orthorhombic crystal form
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
191
structure length
191
Chain Sequence
HLHDIRDLHRYYSSESFEYSNVSGKVENYNGSNVVRFNPQNHQLFLLGKDKEQYKEGLQGQNVFVVQELIDPNGRLSTVGGVTKKNNKTSETNTPLFVNKVNGEDLDASIDSFLIQKEEISLKELDFKIRQQLVNNYGLYKGTSKYGKIIINLKDENKVEIDLGDKLQFERMGDVLNSKDIRGISVTINQI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Relationships and Cellular Tropism of Staphylococcal Superantigen-Like Proteins
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Virulence factor
molecule keywords EXOTOXIN 1
total genus 49
structure length 191
sequence length 191
ec nomenclature
pdb deposition date 2004-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
A PF09199 SSL_OB Staphylococcal superantigen-like OB-fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1v1pA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1v1pA01
1S5FD 5ELEA 1AW7A 4RFBA 1LTAD 1I4QA 2J4XA 2Z8LA 4DXFA 1BCPC 2IPKD 1PTOC 1F77A 1TS5A 1PYWD 3R2TA 2G9HD 4TSSA 1LT5D 1FD7D 4RH6A 4RGNA 1EFID 2SEBD 3O13A 4BWGB 1PTOF 1PZID 1PRTB 2XRSD 1LT4D 1LT3D 5FK9C 2ICIA 1RD9D 1JCKB 1L0YB 1TY2A 2WV6D 1L0XB 1PTOB 5ELCA 1PRTF 1I4GA 3MC0B 2RDGA 2XN9C 1S5BD 1KLUD 1SE2A 1CHPD 1PZKD 1T5XD 1V1OA 5ELDA 3DWPA 1TS4A 1TY0A 1SJED 1GOZA 4O1NA 3BYTB 1CHQD 5ELBA 1LTGD 4DXGA 1HXYD 1LTSD 1FNWA 4RGMA 1FNUA 3DWQA 1SBBB 4RGTA 1YN3A 2O2LD 3EA6A 1LTTD 1I4HA 1I4RA 1JR0D 1TS2A 3TSSA 4OHJA 1DYQA 4L6TB 3R2IA 1LTRD 1D6EC 1HTLD 2NTSA 3BYYB 1PZJD 4RHSA 1RDPD 1SE3A 2QILA 3CHBD 4RGOS 1D5XC 1STEA 1B1ZA 1CQVA 1FNVA 1XXGA 3EFXD 1EEID 1KTKA 1EU3A 4C56C 1SXTA 1ET6A 2IJ0A 1PTOH 2XRQD 2AQ3B 5TSSA 1LTBD 2NTTA 1JWSD 3KLSX 1JWUD 4RCOA 1V1PA 1SJHD 3BZDB 1RF2D 2AQ1B 1UUPA 2TSSA 1LO5D 1G8ZD 1ENFA 1YN4A 1JWMD 1RCVD 1V1PB 1FGBD 3DWAA 5I4DA 3OWEB 1BXTA 1MD2D 4ZYSA 4K6LA 1BCPB 3BVZA 1EWCA 3URYA 2R61A 5FKAC 3R8BA 1I4PA 1BCPF 3GP7A 1B44D 3BVGA 3W2DA 1XTCD 1JQYD 1S5DD 5D3DA 3SEBA 1SEBD 1I4XA 2XNAC 1HQRD 1KLGD 1AN8A 3V05A 1HA5A 5D3IB 1UNSA 1PRTD 4NZLB 1CT1D 1LTID 1ET9A 1M4VA 5ELFA 1ESFA 1BCPD 1CK1A 4RHRA 1LLRD 4UDUC 1D5MC 2RDHA 1DJRD 1QILA 1LT6D 4L63B 1S5CD 1EU4A 2AQ2B 4Z9CB 1S5ED 1PRTC 1SE4A 1TS3A 1PTOD 1YN5A 1D5ZC 1EEFD 3MFGA 3BVMA 2QEJC 2CHBD
chains in the Genus database with same CATH superfamily
4DR4L 5FR6A 1KAAA 4LMQD 4PMCA 4TQ0A 4ZRIA 4L5TA 1PFNA 3DEPA 1EY5A 3EJIA 2A6ED 1E1OA 3FKIH 4OWXB 2B8GA 1XNQQ 1PXUA 2WB1B 4A4IA 1ESRA 1QOAA 3NZSA 5G3LD 3N1ZC 1FD7D 2SEBD 1XX8A 3LDZE 1XMQQ 1WIAA 5IN7A 4QGUA 3HOVG 1LT4D 3NWSA 2KHJA 3MJWA 1GB1A 2V3SA 2ZJRA 4IURA 4G0NB 2QC8A 2ZCCA 1GVPA 5IT9L 1SMYD 1WJ4A 2WDTB 2D3CA 1HQMC 4GKJQ 2BDNA 3DWPA 1SFOH 3PO3B 2Q2TA 3R3MA 3PO2H 1CHQD 2QF7A 1IYVA 3K5LA 3SDLC 2SDFA 2M00A 3H7PB 4QB4A 3DWQA 2H4OA 1MI0A 1OGWA 1SMYC 1KLVA 3B08A 2JN4A 3BINA 2GVAA 1I3QB 3CCJA 5T1IA 1LABA 3NTKA 5KNDA 2ONQA 4OIKA 3CMAA 3RNBC 3SDZA 3TBIB 1RJTA 3U7DA 3C3LA 1RL2A 4DV1L 3I90A 3GTMB 4DR2Q 4RKLA 1XLOA 2EQSA 3I4OA 2A68D 3K9PB 1L2FA 4C56C 1I50H 4KKTA 1JOOA 4LNQA 2ZXPA 1N6ZA 5FLXE 4XC2A 2LHEA 2DAFA 1RIPA 1JWUD 1C48A 2VXWA 3PV0A 3CC2A 2B8FA 2Q8IB 1FXIA 2INNE 2JT4B 1MSHA 4LF5L 1WM3A 4Y52H 5C4JB 4HIMA 1UZXB 5D65A 3E9HA 1B2TA 1JICA 2FCSA 2AMCB 2IO1B 1ZXTA 1E8ZA 2ZNVB 4MGYE 1H95A 5I4DA 3GTGB 3A1QA 4K3CA 1BXTA 5IKCM 3AB5A 4DV3Q 5GAHC 1FRDA 4LFBQ 1AP0A 2J0TD 3L4PA 3WWVA 1D8LA 1YX5B 3QHTA 1UGMA 1EQQA 1VQNA 2FUHB 1B44D 2QCPX 3VAWA 3A74A 3W2DA 1Q86C 4FJYA 1EYAA 4OL7A 2JY6A 3ZNID 2XNAC 3D6WA 4K0KL 3P4PB 4DA2A 2N9KA 1KLGD 5KYLA 4FXCA 3QOLA 1VQPA 4GNXA 4P6VF 2WXRA 3M4OB 2BWFA 4DDID 1UWXA 1M8AA 2N55A 3TZDA 5BR8L 4DV4L 4JI6L 3HHMA 3M3YB 3L0OA 2BA0A 2HHHQ 4AS1A 4G3XB 1FM0D 4JPSA 3UGBB 4NXMQ 1L4ZB 4DR7L 2PLPA 1IBXA 4A3FB 1EO6A 3VXWA 3QG1A 3NHEB 2WU5B 3I4NH 2PJHA 4HMJA 2IO3B 4KGSA 2JXTA 4MT5A 1C76A 2MRPA 3D0FA 4N9PA 4LF6L 3VRAB 2K6QA 5ELEA 2XEWA 4ME3A 3QJZA 2F0MA 1SNMA 2Z8LA 3V96A 2B63H 1N62A 1WCMG 2V1CC 4YWMA 4A3LG 4KN7C 2J52A 2N7JA 4A3PA 2M0XA 4QL5A 1TIID 2CU3A 1F1HA 3VTUA 2NVXB 4IKGA 4XZ4A 1Y56A 2JE6I 2LGSA 3RN2A 4FJVB 3WAPA 2K5QA 1WI0A 3I3TB 5H8YE 2OT2A 2JA5H 1HNWL 2X38A 3DVNV 2IW3A 2KVRA 4GN1A 4CJ2C 4EVOA 2KTRA 3DDCB 5TR5A 2A4ZA 1HR0L 3UQAA 1V49A 5DM63 2B2YA 3HKSA 3JSVA 2EYLA 3X3NA 1GHKA 4LJZC 3NBIA 4A90A 4BKSD 2WAQE 3P20A 1AYFA 3Q6BA 4DV2Q 2NUCA 1D4BA 2WGSA 1K8OA 4O1NA 5HHDG 2WXJA 2WINB 4XXEA 2F4VQ 1SYEA 1Q0WB 2RF4A 4P71A 1CKMA 5JEAH 2A6EC 3QB3A 2LXAA 5E7NA 2RMMA 2W9NA 2PW5A 4NJ6A 3Q24A 3B9JA 1STAA 4B3TQ 4X64L 3BIID 3HIZA 5LLIA 1LTRD 4YL8A 2NTSA 3ZVVA 2KO3A 2CH4A 3APDA 1MJEA 1QVCA 5FLXL 5EE1A 1QNUA 3AE4B 2LKVA 2PW9A 2F3VA 3RUZA 5C3EH 1YHQA 1XLNA 3T8MA 4YWKA 3RMHA 4C3JH 3MXNB 3A5UA 3AE7B 3S9WA 3QWNA 4HJ5A 4PYZA 4KI0A 2Y0SG 4FO2A 2KWCA 3MJ5A 1C3TA 2BWES 2GA4B 2LRUA 2NTTA 2JA6G 1B9MA 2L3ZA 1MKHA 3BZDB 3HGBA 1M1KC 1LFDA 1VF5C 3H7SA 3U8ZA 4ID6A 2W54A 1X9NA 4X65Q 1XPRA 1C4QA 1Q5WB 2GB1A 2KLCA 4JI2Q 1MFWA 2REXA 2O5JC 4FHKA 2YVCA 4XYOA 4WJPA 4N9F4 3ZLZA 2ENBA 2Z0SA 1AH9A 2JP1A 1PH8A 1XJVA 2PMZB 5BN4A 4A93G 4FP5D 3ONSA 1O7YA 2E5LL 3GV3A 1RYJA 4IPHA 1WVLA 4BOZB 5IA7A 4ODGA 3T53B 3TS2A 3KBGA 2VQEL 4WAAA 5D7GA 3M62B 1JB3A 1YNJC 1C9OA 4A6QA 1D1KA 5D2MB 1DOYA 3NTHA 4CKEA 4BS9A 3PRZA 4TUUA 1ICFB 4LNOA 1HFNA 1WY8A 2K7VA 3GD7A 3PUWA 3J80E 1LTID 1BVSA 4JLCA 1I94Q 4PV1C 1MJCA 1CK1A 5EBCA 1D1IA 2BT6A 1AE3A 4GLAC 3D8GA 2HCIA 1ZYRC 3PRMB 1TGZB 2NZHA 1MSGA 3BU2A 1U0LA 4MDKE 1ACCA 4L63B 1X3QA 4JV5L 2KDIA 3E56A 1SLJA 1TS3A 3FKYA 4ACFA 1IBKL 3GTLH 2UWQA 5LL6S 1R4NI 2CHBD 5K5PA 4GZYC 4IJHA 4DK0A 1C4AA 2J4XA 1I4QA 2DBYA 3M3JA 4DK5A 1X3EA 5FO8B 1STHA 1WGHA 2V4IB 1F77A 2N3SA 5JVG3 4XYQA 4JQWC 4NPNA 3DQVA 3RULA 1GHJA 5IP4D 4QUFA 4YSYB 4AYBG 4QJFA 2XRSD 1PLFA 5DAUA 4C3IH 4J6HA 3S1NH 4D2KA 1L0YB 3A5ZB 1TWAH 4W9IA 1A15A 2PQAA 2X8XX 1TIFA 1OO9B 3F2BA 2VH1A 3VR4A 1KLUD 1VQGA 2MEKA 2ACZB 3H91A 4ZCKA 3TMEA 3P75A 1PFSA 1E0BA 2QMTA 4LJPB 2JZZA 1MHHE 1GUAB 2BKRB 4DBGA 1WGDA 4IPGA 4O42A 1VQKA 5GXGB 1A62A 2PNHA 3GTLB 3IL8A 4QY7A 1W6JA 3CD6A 1N5XA 3GTQH 1TS2A 2RKSA 2EMSA 1DYQA 5EKKA 4DR3Q 3VR9B 2LI5A 2KN5A 2F0VA 2ZZPB 3ZDMC 1A8VA 2JRHA 2BOSA 2FHTA 5CV8A 1J19A 3NQTA 1SE3A 3E6ZX 3T3NA 1F2MA 3IRBA 3ENEA 4TV3A 5AZGA 1P1AA 3J7ZC 2INPE 3KF6B 4ZRQA 4X3TA 3F1ZA 2OQKA 1KTKA 5M5WH 4L1BA 1ZEQX 3PGZA 1Q90A 4LDTD 2JA6H 2JYOA 3WALA 4C80A 4HIKA 1ILQA 1CI3M 3E3XA 4CGYB 1SJHD 4A3EG 3IAYA 2N9PC 1QNKA 1JMLA 2KVMA 3ML8A 2ALYB 3MXGA 4K5VA 4BY7H 1VDZA 5AEKB 2WDRB 1B9RA 3P1MA 1V86A 3ITPA 1CZWA 4W9DA 3BY4B 1C77A 2L9HA 3QA8A 5GADC 3DWAA 2W55A 4MN3A 3HOXG 3L3OC 3QR8A 3AB9A 4JG2A 3J81E 3CKIB 3A56A 4KGRA 5C2TB 4LF7Q 4B9KA 4P74A 4JI4L 4DUZQ 1WD1A 3KWVA 4K0KQ 1PYSB 5KGUA 2AHOB 3UE1A 3KJOA 1WM2A 1F2RC 1S72A 3KW5B 4C7YA 1SNOA 3J7A5 1XT9B 1XTCD 1WZ3A 3L10B 5LNK1 2B2TA 3NVZA 1EY0A 3Q3OC 4NPSA 3IG3A 1O7ZA 4I7AA 1PH6A 3DHGC 1TWFB 1JOKA 4N8FA 1I6HH 2KKCA 3HOYH 3KK7A 4GOPB 4MJSB 1H9JA 4AQ7A 3APFA 4TVAB 3QK0A 2P5ZX 3I7FA 2LHDA 1P9DU 3D4DA 2KA7A 3KWLA 2VS1A 1VQ9A 4R3DA 2WHIA 4V0BA 2R92G 3WA0A 2F3WA 4Z9CB 1H9MA 4JW0A 4R9WA 4JC0A 5C0XH 2R7ZB 5C0XG 3EQLC 1YZ6A 1E2ZA 3MXUA 2HJ1A 4YT0B 1IUEA 5KRUA 3L9AX 2KFKB 1LTAD 5T8IA 4TQ1A 1EIFA 1WCMH 2F0PA 4QAYA 5I6WA 2WXIA 1PTOC 2KVZA 2KWDA 5G5HA 4HEDA 1HNXQ 4RH6A 1GUGA 3IFTA 2FIDA 3VDZA 3NEMA 1KNAA 3QIAA 3OTOL 2D0OA 1PRTB 2EY2A 1GJXA 1WJUA 3I57A 1IYFA 1MGSA 4XT1B 3Q8CA 1FR3A 1NYRA 2M19A 2IZVB 3A8KE 1TT2A 1WOCA 4FVMA 1EZ6A 2H5XA 4BBSH 1G91A 5HGQA 1WSPA 2ZPNA 4LF9L 4HLEA 3VRBB 3PO3H 2A5HA 1T5XD 3DUZA 2L32A 4OO1G 4XX5A 2Y3AA 4CDCC 2WXKA 3KJPA 1YI2A 4NQKE 4FYDA 4CHKA 3TEWA 2NVQB 1A5RA 3MWYW 1LTSD 1HNXL 4X65L 4MELA 4NMZA 1KQSA 5E6NA 1G6JA 4W9KA 2JWUA 4REZA 1JR0D 3TSSA 4CJ0B 3PSIA 3M3YH 2D11A 3KLWA 3W5VB 2E3TA 3RT3B 1EUVB 3RZOB 1KRTA 1D7QA 3EFXD 2WYQA 5DPTA 4DV2L 1J7BA 1R4MI 4PMWA 4L5RC 2IY1B 1PTOH 1IGCA 2C7NB 3OJ4B 4IQZA 1JWSD 3BDLA 3RN5A 4A3IG 2MHVA 1YITA 3J81L 1JMCA 5J22A 3V62A 4EZJA 5BN3A 1Y1WB 4ARCA 1QUQA 4IWOA 3PUYA 2LXKA 4JL9A 1ENFA 3V60A 1JWMD 5LMNQ 2SNMA 3IKJA 2JXXA 3TUOA 1VQ5A 2MP1A 3FVQA 3DM3A 4IOCA 1NVID 2IBIB 3AE2B 2F0SA 4R4OA 1AZQA 1WFQA 2KMMA 3CRLC 4JV5Q 2OOBB 4BBRB 3BZCA 4U68A 4QCLA 4B3ML 3I56A 3R8BA 3RNCC 4HAEA 3ND8A 4JI8Q 4C00A 4I6LB 1EM7A 5IGCA 2O5IC 2MNAA 1K0RA 4W9HA 4XDCA 3ERQA 2MP2B 3TEYA 3NRZA 2EELA 5D3DA 2D5DA 1I6HB 3H0GB 3IAS1 5BYSA 3CXCA 1E10A 3UE0A 2I0QA 3V05A 1HA5A 4LF4L 2DX5B 5ELNA 4IFDG 4A3EB 5FLXc 5ELOA 5IOCA 3K7AB 3T1HL 4W9JA 3BS1A 1TWHB 2A6HC 2EY6A 3MAQA 1EY7A 1HE8A 3WAOA 4RWSC 4P72A 1N61A 1E2VA 4HVBA 1SR3A 1WYWB 3NOBA 1EIGA 4A3JB 3H3VH 1VZ6A 4HCNB 2K28A 4B0MA 5DPSA 2HCCA 1WTQA 2IX0A 3QJYA 1WX7A 3TEHB 2QEJC 5FO7B 2DZMA 1D2BA 3HRDD 3ML9A 2B2WC 4JPBW 1C4CA 3AMZA 5COYA 1EQTA 1IHZA 3L08A 1WR6E 4LF7L 1KIXA 1P98A 1Y14B 2M4NA 2DY7A 2D07B 3S15H 3CWIA 1YNND 2WP8J 4NQLB 2L0CA 4ANUA 2VRRB 4HTHA 1E8XA 1ZGUB 3I63C 5M3FB 5ELCA 1NI2A 4DAVA 3R7RA 3NQIA 5IWAL 4BBNF 2XIWA 3MXPA 1ZXIA 1UH6A 1QVGA 1SE2A 3FKIB 3P4RB 4BBRH 1CHPD 2K5DA 3SVMA 1BBUA 5I2XA 3PHWB 5KIXA 3CCMA 1QZGA 1QT9A 2PE6B 4CQNA 1TY0A 1PFBA 3D31A 5JJZA 2K52A 2K8HA 5G55A 3IT6B 4P16A 1T9HA 4QUCA 1LM0A 3TQYA 5I2YA 2PIAA 3ZJTA 1ENAA 1KDBA 4JVZA 1Z5SB 4W9GA 5AZFA 3DBHI 5H92C 1IW7D 1QZEA 4FF1A 2UYZB 4AJWA 5CHWA 3U58A 3M85A 2K1BA 2KEDA 5E6PA 3DLLA 4XDXA 4DF7A 2K5VA 2L11A 3K81C 4OWTB 2ZM6L 1BR9A 1HRJA 2BS3B 2GBRA 1AARA 1K73C 1N33Q 3EC8A 2FNJB 3W1YA 3Q2AC 3QQ8B 1DONA 5A2QE 3EFCA 3I2ZA 4JI3L 5C3EG 4PYUA 2BH8A 2KC1A 2KXJA 3PT2B 1NENB 3NVWA 3HOWH 3K7UC 1I5FA 2QW7A 3NHHA 3OTOQ 2F0IA 1E7VA 4K14A 1ENCA 1X65A 3I4LA 4JI5L 4POGA 4BY1B 1C78A 3CF6E 1KHIA 4HIDA 1VJKA 1RFKA 3U50C 2F0TA 1IKLA 4LF4Q 3LJ3A 2VZKD 1IL8A 4TKOB 3K6OA 1LTLA 1F9RA 1FGBD 1XYIA 1PH9A 1J5EL 3JAMc 4FJZA 2K50A 2EYMA 4H0LC 2HJ8A 3IHPC 1VQMA 1TTNA 3PREA 5JZEB 2LGDA 3DHIC 3ND9A 3K58A 1G291 1NJIC 1Y1VB 4PMBA 3DVGX 1VZ8A 2OHFA 4HROA 3I91A 5HGTA 2BYVE 2KJ6A 1I94L 2RQXA 3DVNU 2FAZA 1SMXA 2JA7G 3T4AC 1R4MB 2KDMA 3M95A 3PLVA 1HTQA 2K4KA 2DNEA 3I70A 3SK8A 3UDXA 4KIKA 1QOGA 5BYRA 4LF6Q 3NUCA 3KLSA 1HZ5A 4BFRA 3W9CB 2BYEA 1EIYB 2K5HA 4KLKA 2SOBA 5BMIA 1WTRA 2RSUA 1ESFA 1BCPD 3C19A 1IXRA 4RHRA 3SK5A 4DN4M 1X1MA 2PEAA 4JBJA 3DBRB 2JYTA 4GDKA 2MQHA 4ZRJA 3X0WA 1PH1A 2KAJA 5BR8Q 2FCQA 5M3MH 4RM9A 1S5CD 3BK1A 3TMPB 4DV6L 3I4NG 1TR5A 3S16H 1GKHA 1SAPA 1TWFH 1Z6HA 2F0UA 3HOXB 1JORA 2KN4A 3ABVB 1E8WA 4JI8L 3A4SC 5AJ3Q 2G4DB 3ULLA 1BCPC 4J8QA 3HOVB 4KX6B 5KNBA 3RNAC 1GNUA 1UWVA 1HNZL 4LK1C 2B2WA 2CWPA 3MXNA 1JT8A 2JZPA 3PGEA 4TSSA 4N59A 4W9LA 3RNFC 4JYAQ 3ZNHB 1A0IA 2F0OA 3NTIA 3O13A 2LGYA 4YWGG 3CU7A 3E0EA 5M9OA 2QIEB 1LT3D 3K9OB 5EE9A 4NB3A 4R8IA 3TRZA 5GMVA 4UP7A 3KDFA 1A6XA 1EY8A 3EROA 2BH2A 1K8MA 2CJOA 2N7DA 3ZRCA 4C3HB 2BE5D 1TWHH 4YY3L 2LMCB 5K36H 4A3KH 3RLFA 1WMHA 1T0QC 4DR3L 1PGBA 3EBEA 2WXQA 1LTGD 1HTOA 4JI5Q 1HXYD 4QIWE 3GTGH 4ZKCB 2BS4B 3EUB2 5C3WA 2ZEQA 3ZKJC 4AQYL 3MC9A 4X6AH 1IBLL 1DOKA 4A3DH 1ZPSA 1I4RA 4HSVA 4KJOA 1Z47A 4OHJA 1E5WA 4DFAA 1WXAA 2HQLA 1WFYA 2JQOA 4JI1L 2JA6B 2AYOB 4NXNQ 2K0PA 3SD5A 1YIJA 1E6EB 4LFCL 1XNRL 1X56A 3M7NA 2IO2B 3GTKB 3PZDA 2NBWB 1WTWA 4B3RQ 2Y5PA 3UF8A 2H89B 1CA6A 5M5YB 1D5XC 1GG3A 1STEA 2O4XA 1JC7A 2JEBI 1WGYA 3C1EA 1SROA 2D3BA 2HDEA 4NNJB 2LJIA 1LYLA 2N88A 2FCNA 5ISRA 2L1AA 1F2YA 4IM3A 4A8XC 2BVCA 3DOWA 1PDXA 1EU3A 3FAHA 5LL6X 3L16A 2XRQD 5EPLA 3EVQA 4EFOA 4DKAC 4M8MA 1HR0Q 2I2YA 3AQQA 2DYMA 4OEMB 3GTOB 2OTLA 1B53A 3AN1A 2WX0A 4G50A 1QOHA 1G8ZD 4NP5A 1L6VA 1O7LA 2ZT9C 4PS8A 5M3FH 4LFAQ 3GB1A 4OZAA 1E9MA 2DHZA 4JBWA 3RI7C 1FXTB 2L55A 4N8X1 3WCQA 4ZQ3A 1BCPB 2GN5A 3E9IA 2JA8B 3URYA 4C2MB 1RFAA 3HM6X 2F0HA 4KMUC 1SYBA 4HPMB 5E6JA 3UINB 2DZIA 5LMUQ 4KSKC 4GN3B 3LWEA 4BKSA 2DLBA 3KF8A 2VQFL 1TWCB 1PDQA 2JA9A 4R4CA 4BBSG 3EN2A 4X62L 3I8ZA 3JAME 5CC4A 4FF4A 2JVCA 3RZWC 3DBLB 2AWNA 5DLQE 4NKLA 2F52A 4KV6A 1WXQA 4NZLB 2JA8H 5EAYA 3OIPA 5JOBA 4RF0A 4FXGC 4NAWB 5C3JB 1D3ZA 3A8JE 1I6VC 2LUMA 4KD4A 3QIJA 4UHVA 4K8IA 1SFOB 3ZXVA 4DUZL 1GB4A 2NVTH 3G71A 1HCZA 3ICEA 5BYQA 3N20C 3G48A 2EY5A 1EWIA 1X32A 2QJLA 2AQ2B 4OW0A 1DM0B 3X23A 1R4NB 2N9LA 3R66C 4H2AA 2NYZD 1Y1VG 1ILPA 4N9TA 3TP6A 3J7AF 4LFBL 4BAXA 1SYGA 2G3QB 2IPKD 4XWTA 3DPDA 1FIQA 2Q8RE 2LY7A 2V4LA 4YHHQ 1OFFA 1JJCB 1YOVB 4OWWB 1DCZA 4GS3A 4BA2I 2I5LX 4DU9A 5IIFA 5J18A 3Q8DA 4K2KA 2JSOA 1N5WA 1K3RA 4E6IA 3PUVA 2VUMG 2D9UA 4GSWA 5CORA 4HEA1 4F8MA 4A3DB 3Q8AA 2IY5B 3S17H 4F87A 1S5BD 4DWFA 4HSPA 5G2NA 1V1OA 3SFDB 2VZAA 1WWTA 4YWLA 3DM1A 1G6PA 5C0XI 3L7ZC 3CC7A 2BW2A 1PA6A 4MEMA 4A3KB 3S1QH 3J81c 3ZXRA 3U7ZA 4GDLB 1OQQA 4O2DA 4C3JB 2R7DA 1W2BA 4HCEA 3JYUA 1V81A 3E5SA 3F8TA 2ZTDA 1XPOA 1CA5A 1C7YA 1Y1VH 2UXCQ 3HVZA 3PLUA 4GN4B 4YSZB 2EVBA 1GPXA 2VUMB 1WMHB 1N36L 1AFPA 4A3LH 2C7HA 4ANXA 4NAWA 4RG1A 4CKCA 2QILA 1BMLC 2K8CA 4GOPA 1KAWA 2R2OA 2MFIA 2AX5A 3STBD 2V9HA 1CQVA 2LZ6A 1BQQT 1SIFA 2Y5CA 2PCFB 1TBEA 1XF5L 4L23A 4BY1H 2RPVA 3RZFA 5TSSA 4A3GH 2MBQA 2A68C 4MSMB 2PW7A 2VUMH 3C1FA 4KTAA 3H9DA 2WX1A 1CFMA 2ZJQA 4YIJA 2O6VB 2AQ1B 4K2LA 3Q8BA 2C9WB 4K7WA 2M2LA 3ONAB 4IUPA 1X3GA 4MZ9A 4KGTA 1E1TA 4F1SA 2ZW0A 3S1QB 3KLRA 4P73A 2K32A 2SNSA 1SYFA 3WOEA 1VQ4A 3DWGC 5M5XH 3GTPH 3N9YC 3PIOA 3OW2A 2J53A 2JRIB 1K51A 2PTLA 3VH3B 4HR7B 4HCPB 2NVYB 2R61A 3ULJA 1Z9FA 1P7FA 1FO4A 2IGGA 4JI0L 4JI7L 2KFJA 2AKWB 3PZ7A 4J3OD 1F9PA 4KHPQ 3W1GA 4A3GG 4PT5A 3W1SC 2F3IA 4DV4Q 1Q81C 4JI6Q 1I4XA 4YSXB 4HMIA 2PI2A 2EOTA 2R7ZH 4R1JA 2NS5A 5IGEA 2EZVA 2F0GA 4NY0A 1CT1D 2Q2HA 3N32A 4DHZB 2MA9B 4KZCA 4LF8Q 3UDFA 1KF6B 1EY6A 4BZAA 2OF1A 1PFMA 4L5QA 3PF4A 2LRWA 3SK4A 2RHQB 1D5MC 3N1XC 2EJMA 2A1AA 1QZHA 1DGSA 3PMFA 2WDQB 1KFYB 1YBYA 1V8CA 4JI0Q 1UBQA 1UE7A 4RAUC 2QHOA 5KHQA 4AJYB 4CJ1B 3P7JA 3TN2A 4ZUJA 1Q8IA 4A3GB 2IHEA 1MBYA 1K50A 2KEEA 2OWOA 1A3UA 3TS0A 4DXFA 5JPMC 4C7ZA 3H3VC 1FCLA 3E0JA 4X57B 1AE2A 2WXMA 2N49A 1IPGA 1WTXA 3UIPB 4ZDVA 1IBLQ 2F0NA 1LACA 4LCDE 3CW2C 2LXJA 3TP7A 1WTHA 4CDEC 2EXZA 4LF5Q 1EFID 1JJGA 2LFNA 4CO7A 3NE5B 5FR3A 1JRPA 1WJ6A 1EYDA 2K6DB 2ICIA 1OXTA 3VR6A 4DAMA 3GTJH 1L4DB 1WF9A 1DZ1A 1ZDVA 1VD2A 2FBWB 1R7SA 3KUCB 4EX5A 1N34L 1QUQB 3RNGC 1II3A 1J8CA 3MC0B 1PMRA 4RKBA 2XN9C 1WTOA 3F2UA 2LJ5A 2ZTEA 4WJNA 3BG3A 4J1MA 1XLQA 4G4KA 2C5LC 3H0GH 2KWUB 1SJED 4M0WB 2JA5B 5IT9E 4WWMA 5C3XA 5JHAA 4LNNA 5C4XH 3JAMi 1LV9A 3I73A 1BT0A 1KL9A 1OEYJ 1PH7A 4YCVA 2WQYB 3DEOA 4MTNA 2UU9Q 2GLSA 2B63B 4AUQC 3NXWA 3W1BA 5FJ8G 2R93B 2KNBA 2HD5B 2L52A 1EOTA 4EQOA 5G3LF 3GTMH 3BDOA 2FXQA 4IUNA 3HFZB 5E3FA 1OXUA 4DV0L 2RHSB 2EYOA 1VQ7A 2A5UA 2KX3A 2JA5G 2RSNA 4KN4C 1B9NA 4A55A 1C79A 2PMZE 3CPWA 2DWQA 2KDBA 2MWSB 4GOCA 5KNCA 1B8AA 5H1SE 2RD0A 1IW7C 1V1QA 2PZUA 4OONA 1NCVA 3DMUA 2TSSA 4IFDH 2LEKA 2O6VA 1PH3A 1ZE3D 2RDFA 4DK6C 1RCVD 3C46A 2IX1A 2EYPA 3S14H 1FPYA 1LQBA 1TZ1A 2G5DA 4IOIE 3BWUD 2GOWA 1YHAA 2K01A 1WR1A 3Q22A 2ZJDA 3LB8C 5HI1A 1K83B 1MHWC 2D62A 1EFWA 1TYGB 2ATWA 3BVGA 2K04A 1G2SA 3G6EA 1ZUD2 5T1GA 2NBVB 2VNUD 3A9KB 4WJ3M 1ICWA 1Q7YC 4H13C 2HD3A 4G7OC 3N1YC 1WXSA 2INCC 3RZDH 1WI5A 2R92B 1FGUA 3NENA 1NDDA 4MNOA 3RPFC 4KKSA 1TJEA 2MQJA 4JIOU 3HOVH 2KQ4X 3HP3A 3R3OA 4KKUA 4G57A 3ZJYC 2J7QB 1QILA 4G11A 2DNFA 1U4MA 5C4HA 3M4PA 3VR2A 4DR7Q 1EEFD 2NB0A 4IPDA 3AEVA 2YU9H 3BVMA 2LFIA 1ZDXA 1JQ4A 2UXBQ 5HFYA 2DY8A 3GTJB 2CW0D 5LXIB 2PI2E 4IUQA 3UI3A 3FRPB 3OIQA 4KY6A 3HOZH 4TMAB 1XCQL 3VYSA 5D6JB 1WD0A 4OZBA 1PYWD 1F9SA 1G6ZA 4L8JA 2IHFA 3RNUA 4DHJD 1L1OB 3U4VA 3S1NB 3S1RH 1VQDA 4EQPA 2Z9HA 1PTOF 4BWGB 5FO9B 3T9LA 1EY4A 1PHJA 1N32L 1GUTA 4JBMA 2V1YA 4WURA 3VQIA 4K8JA 1TY2A 1YMHE 1K83H 3EIVA 2WV6D 1L0XB 2KFKA 1VDVA 5DEHA 1EF5A 5FLMH 4YTPB 3QARA 5IP7G 2MLBA 1M94A 1PZKD 3R93A 4LDTB 3L0WB 5ELDA 4WJ4A 4KHVA 4ICVA 1PYBA 2Z6KA 5GROA 3BYTB 2F4IA 2FMMA 2M56B 1N33L 4LJOB 4LFCQ 3Q69A 4OVZA 4MHEA 4MACA 1ASZA 1FNUA 1WJJA 3M9BA 4KY7A 1E24A 1HEZE 5C3EB 2PZWA 2N9XA 2PO4A 4C4VB 3PQIA 2ASQA 2Z0EB 2WB1E 1CTMA 4QF4A 4L6TB 1IKMA 5FJ8H 1I7HA 4A20A 2E75C 1WH3A 1V43A 3OSOA 3UDIA 2UXBL 1EWHA 1HPCA 1VCIA 1VLBA 3AYHB 1GJZA 4CHTB 4FNFA 4Y7NH 2L0FA 2C9OA 1QLBB 1E7UA 4DV1Q 2JYEA 5IP7H 1XXGA 3K5OA 1FNVA 2KQ7A 4IFDJ 3RFZB 1XMQL 5M3MB 4XQJA 2F0JA 2E2HH 2F0FA 1MG4A 2F0DA 4EZKA 2F0EA 1WCMB 1RRBA 1ET6A 3P42A 5HKHA 4DV7L 4JCVE 1OXVA 1P0RA 3GZNB 4US8A 3DBSA 5I9OA 1P3QU 2X69A 3ETRA 4USAA 2NPTB 3L13A 2X6LA 1HFGA 3J80c 3J7AV 1BOSA 1CZGA 2WB1G 2PNRC 1WX9A 1V6EA 4A3OA 2W3SA 4A3KG 3A7AB 3J81i 2EJFC 4POFA 1Q1EA 1H9RA 4DNTB 5C44G 1F2LA 4ZYSA 4A3MH 4K6LA 3VR3A 4NAMA 3CC4A 1B4OA 2B2UA 3PV1A 4NJ7A 3KF6A 2HQEA 4EOYA 3WDNA 3K5MA 2G1EA 4GLXA 4BXXH 1BCPF 3AEEB 1V97A 1IGDA 4HJ7A 1R9TH 1PUTA 1BKBA 1EF1A 3VA5A 2D5GA 1OTCA 2K9XA 4LF8L 4M01A 4PZ6A 3PZ8A 3ERSX 3GO5A 3U52E 4DR1L 1DXMA 2KHSA 1ZOYB 3PO2B 4S0RA 3I4NB 1PRTD 1MJDA 4N58A 2B2TC 4H02A 1UAPA 1YVCA 4DR6L 2ZVOA 2RPQA 3TIXA 4JOIA 3T1HQ 2K3UA 2C7MB 1FD6A 3L2PA 4GKKQ 5KHOA 5IP9H 2PPBC 5C5MA 1PH2A 1B3QA 1Q10A 2B76B 2KMCA 4G7ZC 1JW9D 5F2DA 4E3CA 3J80L 4ZHPA 3NS8A 4LUOA 4APVA 5KEEA 1KOTA 5EE3A 3TL5A 3Q0AA 4JI2L 2LS01 1VRAB 3NVVA 3TCAA 2I07B 4AP4C 4US9A 1XQQA 4LNKA 1O80A 5GAEC 4B3TL 2A6HD 5M5WB 5IYDH 4C3HG 2JSVX 3A1QB 4M02A 4HPPA 1V5TA 4AQYQ 2INDC 1O7IA 3SHLA 3MZ5A 1EYGA 1XLPA 1TS5A 2IX3A 5CV7A 2G9HD 5LHY1 2B29A 2WXOA 4KKIA 1CMXB 4R4TA 5E4XA 3IAM1 3D3RA 4WJWA 5FK9C 3AFQA 1KNEA 4A3CG 4RF1A 4DXAB 1PH5A 2NVYH 4A3IH 4PZ7A 3ZJUA 1VQ6A 2EKIA 5M5XB 3GTPB 4KSLC 2VB3X 2BB5A 4XWWA 1CKNA 5NUCA 1YQBA 4JI1Q 2C35B 2L15A 2CKZB 1QJOA 5GAGC 1EWYC 2MO1A 1GOZA 1K28A 4DAPA 4CDDC 1N36Q 2OEOA 3JW0X 2BE5C 5HG2A 3ZDTA 4W9CA 1B70B 3RUIB 4HKQA 3EA6A 3OHXC 4ANWA 2DZKA 3K8AA 1YQ3B 2MJDA 3KF8B 4JK1C 3AV8A 3MHSD 2NWGA 1B50A 1UEBA 3H3VI 4XTCS 3A9KA 2OTJA 3BYYB 2MJ8A 4OIJA 4RHSA 1VQOA 2MP2A 1JRUA 1L0WA 5L37A 3H6NA 5FLMG 1WRDB 1BUVT 1NY4A 2PQEA 3SR1A 1KDAA 1SGHA 2EE1A 2IGHA 2L00B 4IWQA 3V6EB 1YJJA 4LNIA 4NXML 1HNWQ 4A3JH 1H9KA 1XD3B 3Q3MC 4GGQA 1ZYRD 4JYAL 3U4EG 2VL6A 4LWCA 2CR5A 2W82A 3L17A 3NP8A 1WZ0A 2MW5A 1XMOQ 1L1OA 4X3KA 1SSNA 1V1PA 2A73B 4XQQA 4A75A 2JEAI 3CRKC 1PGXA 4YCUA 1J9OA 1XO3A 2IYDB 2ID0A 4S3SA 3K59A 1C9FA 3K57A 2EMTA 5JJLA 4B0EA 4I6PA 2HIXA 1T0YA 2R6GA 2N7EA 3AEBB 2NVQH 1RLFA 5DCNA 3OWEB 1L7YA 4KHPL 2WU2B 1IBMQ 3VUWA 5E6OA 3W5OA 1B7YB 1NE3A 2Z4HA 4FDBA 5IT9c 3PVLA 4IM2A 4DUYQ 2I46A 1QOBA 2XSCA 4LF9Q 1RHPA 2LASA 3KVFB 3CQZH 1SF0A 3AE3B 3HRZC 3CSTA 5C4XB 4EUTA 5MPOA 4B3SQ 4W9EA 4ZRKA 2NN6H 3GDEA 3CCRA 5LMUL 2IGDA 2B3GA 4WWNA 2ZPYA 3ECIA 2BQQA 3RYTA 3FP9A 4HRSA 5EKLA 3OMGA 4FN2A 4C1NI 5BMGA 4X62Q 4DK1A 1TXYA 3S2DB 1FCCC 3KYDD 1I3QH 1J6QA 2J42A 3ZO5B 3SHQA 5J17A 2JUOA 3PPAA 1X6OA 5JAVA 4UY8C 1LGRA 1B3AA 1U4AA 3LWUA 4CKBA 1TKGA 1SNPA 3X3MA 2OJWA 4L2YA 4H44C 2K03A 5CYUA 1ISNA 1LT6D 4ME5A 1Q46A 3VH4B 1VR9A 2Z4IA 3IBEA 3RNEC 4B6WA 4Q5VA 1YN5A 2KYWA 2M17A 1A70A 1EYCA 1MHXA 2M0AA 2UUBQ 3LGJA 2DUDA 1GO3E 5IGFA 3ZYYX 1BF4A 5JJIA 2C60A 4FADA 5CBEE 2KQ3A 2FFKB 5G5GA 2NMQA 3WIMA 1YD8U 1RODA 5EQ0A 1FMAD 1VF7A 3K0XA 2E6XA 1UE1A 4K3BA 4RGNA 4A76A 3CIRB 2KJRA 5JXVA 2YTVA 1FJGQ 4A3BH 2E2JH 4M8NA 2I5MX 1RD9D 3Q8FA 1JCKB 4NJCA 1RTOA 4C2MH 5DPWA 3ZGZA 2CHXA 2QDBA 1DOIA 4FF2A 3KYCD 4RCNA 1V2YA 4ZOHC 5CV6A 5JEAJ 3CAMA 2WDVB 1JB7A 2MX2A 3LX0A 1TS4A 2KCTA 2GI9A 2JXMB 1AZPA 3AU7A 1FRRA 5ELBA 4OXPA 2BS2B 3AI5A 4GB9A 3A54A 4RGMA 1AWDA 2VZKB 3OG5A 4MM3B 1CKOA 4PG3A 4R4QA 4DK3C 1R4QB 1Y8PB 1Q1BA 1HZBA 2ZCBA 1EIHA 3DBHB 4IM0A 2KTFA 3VDYA 2UXCL 3W5UB 5CV4A 2F03A 3ZJVA 2BBCA 2OEDA 1YNXA 3VUXA 2LMCA 4AH6A 4WRDA 4DHJB 1L6UA 4OO1I 5DPRA 1XNRQ 4FLHA 2R7ZG 2NVUI 4GMVA 3GTKH 1E7ZA 3HOYG 4GU2A 1VMPA 3OMCA 4HJAA 1LXDA 2J7ZA 2KHIA 1EEID 4E74A 3RZDB 3BZKA 2V3PA 1LUZA 4B9XA 3D4RA 1GUNA 3G7LA 4RA8A 3TREA 3T56B 3PIPA 2MGSA 3CCLA 3T51B 4OVVA 3V61A 3VTVA 4RCOA 2KBNA 2Z1CA 1UF0A 2PKOA 4OZCA 4ARIA 3AEDB 4UAIA 2AUJD 1TWGB 5LXHA 2RSOA 2NBFA 4Y7NB 1HNZQ 4YY3Q 3D32A 3SGIA 2JZ3B 1JE5A 1LO5D 4II2B 5FOBB 1VMCA 3B1LX 5J2RA 3SXHA 2RCNA 2WFWA 1C1YB 3VR5A 4AYBB 3OYYA 4C3HH 3VR8B 3NK9A 1QF6A 1EZ8A 2K5PA 4DR1Q 2KC2A 4KY5A 2LVPA 2JA7B 4OVUA 3NUHB 3KH0A 1YJ1A 3NVYA 1DOLA 3BJUA 3EHVA 4JI7Q 3T16A 3I4MB 4PZ8A 4DQOC 5J39A 5CX3A 4GNXC 2QKIC 3CCEA 4B9WA 5C4ZA 2DN8A 4CYEA 1NUCA 4XQNA 1W3SA 1BBWA 1AN8A 4A3MB 3OOCA 4IW0A 2XWJB 1WE7A 1U4LA 2QDFA 2Y0SE 3NZ3A 4JWUC 4XIGS 3F2DA 4MM3A 3HKZB 1SYDA 1K0SA 2PMVA 4WJQA 2L4NA 2N1VA 2UXDL 1R4PB 1SE8A 1T0SC 3MA2B 4WQMA 4URKA 3UQBA 1PH4A 1DGJA 3HOUH 4BY7B 4R4IA 1IBML 2PVOD 1MIUA 1EU4A 1ML0D 4L5SA 1QKZA 1EQRA 4MIUA 4IUVA 3NPPA 3C0RB 4LFAL 3AU4A 3VYRA 2F0LA 4O0AA 4UP9A 3I4MG 2D2QA 3T3OA 1X3FA 2Q8TA 1SN8A 4A3IB 2CJNA 2YU9B 5DM73 1C8CA 5C44H 4A3MG 2KD0A 2MBBB 1YIWA 1TQOA 1IZ6A 4Q0FA 2I38A 2KHWB 4IWPA 3LNNA 1Q3LA 4GN5A 4EGVA 1MVKA 3D4WA 1NYQA 2WLBA 4EQ5A 1SE9A 1YNJD 1CQFA 1NNXA 4DV3L 4C3IG 1RAXA 2IWHA 3AE9B 4RMAA 1V8QA 1PTOB 4MSQB 2V4DA 3CCUA 3N30A 2KCNA 2L8JA 1XTDA 2BTEA 1VQHA 4GNXB 2AUKA 3VTWA 2E5LQ 1XPUA 4HPLB 4AOFA 3NG0A 4C3JG 2R93G 1NMGA 3J80i 1TWCH 3IXSA 3CMMB 3RCZA 2OXPA 4MH0E 5BMHA 2R7FA 4PNYA 5LMNL 4DXGA 5EPJA 4DNRB 2WXGA 3WANA 3VA7A 4DR5Q 1H8CA 1VQFA 3Q3NC 1E90A 3MHBA 1RM6C 3G6JB 1F52A 2O2LD 3VHTC 2IDYA 1NBWA 1BBXC 4BKTA 2AEHA 4II3B 3ZIMA 4HJ9A 1UE5A 1STGA 3H94A 2ZXOA 4XT3B 2XBBC 3AEFB 3AE1B 3CHBD 2E2DC 2F4VL 4RGOS 4F88A 1PV4A 2WS3B 2WXHA 3HVDA 2WWZA 1OEYA 4GDLA 5CR3A 4LTUA 2KECA 2K5WA 2KTRB 1SXTA 2DJFC 1FJGL 2SAKA 3TBLD 4GLVB 1N8RC 3CCSA 4ZRZA 3GOEA 1CSQA 2JQRB 5A2QL 2NN6I 3JSVB 2BF8B 2YEPF 3AECB 5JEAG 2NPTA 1F9QA 3HKZE 2OQ0A 3K80C 1IYJB 2RBMA 3AU5A 2HE7A 3Q3JA 4YHHL 2KOXA 1KC8C 2MHJA 2XK5B 4IG7B 4MGZE 1I42A 5J1ZA 2PYKA 5M3FG 2EYFA 3M7GA 5C4JH 4DR4Q 2KDEB 3U2SC 1K53A 1GAQB 5J3BA 2CS4A 5D14A 1JE4A 1EUJA 3BVZA 4C1NK 5CV9A 1TZOA 2MSED 4JX1C 5HY6A 1U5KA 4HJ8A 2MPMA 2K75A 1XWEA 4A93B 3DXJC 4DR6Q 2XWBB 1AEXA 2EJGC 4QMGA 1PGAA 2RGFA 3QX1A 5EE0A 3FMCA 2CCZA 5GQOA 2WKDA 3SEBA 2D2CC 3B6YA 3VYUA 5HURA 1KJTA 3ZTCA 1VQEA 1NBFC 3APCA 1DOXA 3P2BA 4WWOA 4KVGB 3OPOA 3NJTA 2MUYA 2AL3A 1IL2A 3H6MA 1F2RI 1OTRB 4KDLB 3AMUA 3SU8X 2FE8A 3LYYA 2VQEQ 4HKZE 2A69C 1RKNA 4IC7B 5C1ZA 4WJOA 4UDUC 3SR6A 1UWMA 1RTNA 1HUMA 3N6RA 2IY0B 4LK0M 2WIIB 4C4VA 4JI3Q 4KHZA 4ZAIA 3ULPA 1CJEA 4IUMB 2DGYA 3M4QA 4HJGE 1PTOD 2CVRA 4CBVA 3MFGA 1YN3A 3JVZX 4YXDB 4OX9Q 1SSOA 5K36G 3K7AH 1V9JA 3FC4A 1WYDA 3H15A 3HS0C 2ASBA 3HOZG 1BNZA 2UU7A 2YLMA 2KJHB 2QEXA 4GLSC 3PHXB 2N0SB 1LT5D 1PFDA 4DAYA 1Y1WG 3S24A 1HR0W 2D10A 4KJNA 1K9MC 1N63A 4ZUIA 1XEEA 3HKZG 5IE8A 3FEWX 1L5PA 3NZUA 2WXLA 1KRHA 3NS1A 1YX6B 4BY7G 2LGIA 2A74C 2QSDA 3W1SA 5LMNW 2KX0A 4IZ8A 1JWAD 1G2TA 1FXAA 4YCWA 5E4WC 4B3RL 2UU9L 2E2IB 1L0VB 3AE6B 3I72A 3A9JA 4JE3B 2ZJPA 3U9OA 2C5CA 3S2DH 5M3MG 4WFN3 2CU1A 1SB3C 2LWPA 2N9EB 1XNQL 3B2FA 1LTTD 3PO0A 1I4HA 3AE8B 2EY1A 4ZHOA 1QB5D 3CP0A 1VQIA 3KOJA 3R2IA 2BPSA 2IO0B 1A3TA 1VQJA 2NN6G 5M5YH 1U4RA 2KT7A 3LXFA 4PQXA 2F0KA 4A9AA 4G7HC 4KIKB 3E9SA 2EYHA 3OW7A 1BDOA 3J81j 1B1ZA 2LUEA 3R7QA 3Q6SA 4A3JG 1O78A 2EYJA 1JOQA 1QWYA 4GOPC 3ZW3A 2LVOA 3ALBA 3KDFB 3T1YQ 1T3QA 3N52A 4LUZA 2BB6A 2GBKA 2AQ3B 3HG9A 5C5LA 5IWAQ 2BA1A 2JPHA 2Z6BA 4JBKA 3ZQ4A 3SE0A 5JH5C 2HIVA 3O65B 4IOAA 1A63A 1X54A 3ZNGC 1C4PA 2D3AA 1HTPA 2GBMA 1YN4A 4HWIB 3PUZA 1T5EA 2VQFQ 1IBKQ 3S14B 2A69D 2YTYA 1TU2B 3S1MH 1EL0A 1ROEA 3M4YA 4B3SL 3S1RB 1E2WA 4K6DA 3PO2G 3GQBA 4DAYB 2K25A 3L54A 1MD2D 3NSWA 3SK6A 2X6GA 5BN5A 2YTXA 2WXFA 1EWCA 2CWAA 4X3UA 1I4PA 2Z6KC 2B2VA 3MTNB 2RR9A 5C23A 4OX9L 3GP7A 2UUCQ 1WE6A 1QE6A 4GKKL 1KRSA 4S17A 3PIO3 2I1JA 1VCBA 1MPEA 4LAAA 2WACA 4K5WA 3RLNA 2F0WA 3I3CA 2EKEC 4DPGA 2JU6X 4DNIA 2K14A 3GTQB 2CKHB 4FBJB 3KBXA 1MI2A 4UPAA 1SIJA 4P75A 2B39A 3A4RA 1JJ2A 5D94A 2MCNB 1BO0A 4WIPA 4FXDA 1VQCA 1T6BX 3JAML 2HHHL 5I6YA 1UELA 4WWPA 2CQAA 1SNQA 2FMCA 3NELA 1XCTL 1DJRD 3MC8A 3QO2A 4IUUA 1OXSC 1JWBD 2UUCL 4IALA 4QQBX 1S3OA 1UD7A 2MJEA 1D5ZC 1J5EQ 3AEAB 1S5FD 1VS0A 1DOMA 1S1QB 2PQAB 5IGGA 4GIVA 4JGHB 1S4ZA 4QIWB 1SRUA 1CSPA 2EDGA 2XK5A 4DHZE 4ANVA 3S15B 3ER0A 4P1CC 3HEJA 2ZM6Q 4HK2A 2K33A 3R2TA 3HUIA 1HZ9A 5C0XJ 4MTKA 1PZID 3HOWG 2NBUA 1X55A 1J7CA 1GUOA 4JI4Q 1V80A 1ZKHA 2KACA 2KZRA 3PTFC 4EEWA 3J9CA 4EE2A 2E8GA 4DGZA 4HN7A 5IYCH 3VFKA 4DV5L 1I4GA 1Q8KA 4A3EH 1HZCA 2RDGA 4MJSA 1Q12A 5I9PA 3AULA 2RCFA 2LGXA 4ABNA 1IYUA 3Q23A 5AUKA 3TP8A 3KUZA 4XGAB 2M8SA 1K8AC 2KQSA 3CMEA 2ZW1A 3A33B 3UIOB 1NTGA 1H9SA 4TQUS 4KKJA 2N1WA 1FNWA 4RGTA 1NEKB 5JHBA 3TDQA 2WXNA 3J7YW 1WX8A 2VH2A 3S2HB 3OAWA 3HOWB 4X64Q 2BKFA 2CFMA 2K5NA 1V5OA 2FIFA 4MGIE 4JWSC 5IO9A 2RA4A 4A3CH 1E3PA 5IY0A 3ZRFA 2QDLA 1VQLA 1D6EC 1HTLD 3H8HA 1PZJD 1RWSA 3FPUB 4ZLTF 2KMAA 1WXVA 1NI3A 1W6KA 1UBIA 2ZTCA 1BUIC 2VB2X 3U30A 1STBA 3HOUB 1YEZA 3GV6A 3IFWB 1WYGA 1JROA 3U4ZA 3U9SA 1HA6A 4FA6A 2L1BA 4LW1A 2Z0DB 3IVFA 1GUSA 2R3ZA 2IJ0A 3RR5A 1E7PB 2BCOA 1LTBD 1WGKA 3RN9C 1OQRA 4HXDA 3HM3A 2FINB 1H4RA 2N4FA 5C44B 4ICUA 1RF2D 1EY9A 1NR4A 3AFPA 2V3NA 3S2AA 3Q14C 4ITKA 1QG7A 5EKIA 2K05A 4BVUC 4IUTA 2NVXH 1WRIA 1V1PB 3DHQA 3I4MH 4I65A 1KH0A 2RDBC 2Y0SB 4U673 3HOUG 1KDCA 1ZP0B 2NR2A 3CCVA 1TWAB 2E76C 4HDOA 2ON8A 3Q3FA 3A0JA 5AZHA 3PCOB 1GC6A 4KZ0A 3TJPA 2DZJA 2BYTA 2BYFA 1YJIA 1SYCA 3DWMA 1NR2A 5L95C 4BA1I 2KLGA 2B63G 1S5DD 2ZXRA 2E2JB 3VVWB 2L0TA 1SEBD 4KV2A 4XYCA 4B3MQ 2KJXA 2EIFA 5A35A 2UUBL 4GXBA 1M4VA 2M9VA 3CPFA 3QCAA 4ZK9B 2EXDA 2QGQA 1GC7A 2DAJA 3AH7A 2RVLA 4W9FA 1Y8NB 1HHVA 3PS6A 1R9TB 2GMIC 2R2QA 3EECA 1TKWB 4WAFA 3W3AA 2K6AA 3MEFA 2N8NA 2ZNVC 5IYBG 1VQBA 1Y69U 2KCCA 1S5ED 1PRTC 2HT1A 1VZ7A 3GE8C 3G4SA 4LUVA 1E0ZA 1WJNA 4AWJA 1J8IA 2E74C 4UP8A 1UE6A 1AW7A 4ULLA 1WXMA 3HOXH 3KQ4A 1N60A 4XE0A 3UDGA 4NW2A 5EDSA 3MFYA 3MP9A 2K39A 1YQ4B 4LLGM 5EJWA 4A93H 2YV5A 5IODA 2ES2A 1GUWA 3BK2A 1V9PA 2WKCA 4PK1A 3V2TA 1F0ZA 3MTSA 3UI2A 1HJPA 2AWTA 3P1HA 4BY1G 4HCSA 4J15A 2B2VC 1MG8A 1F2ZA 1YJ9A 1PQSA 4BBNC 4J6IA 1PVOA 3CQZB 4DR5L 1QQRA 2UUAQ 2O2VA 2JA8G 4B95A 1TT5B 4HJKA 5JVH3 4DR2L 4P1BC 1A2TA 3GS2A 4RNAA 1E8YA 1M90C 3WAMA 2NVTB 2L12A 3NBHA 2L05A 3KUDB 5CTRC 3A8IE 3I55A 2QA4A 3HOYB 4M00A 1SBBB 2R92H 2HTHA 2J0JA 2MBHA 3FILA 4HDQA 3KUPA 4IJLA 3DCGA 2KUMA 5EBDA 2CH4W 4X3SA 2AL6A 1N9WA 1Z7TA 3A55A 4M1UB 2MO0A 2JA7H 3FHWA 2NZOA 1ZXHA 4K1RB 4EKUA 1EOVA 1HH2P 1WGRA 2JWZA 1K52A 2H88B 2K8BA 2LD9A 1J0GA 1ASYA 5IYDG 1FYCA 3T1YL 2F1MA 2KK8A 2MJ3A 2L5TA 3QWZB 3GE3C 3SFEB 1G51A 1A3VA 2JX5A 3DBRI 2M1MA 3H1UA 4DV5Q 4ILWA 4TRDA 2MH7A 1OXXK 4A3BB 5C6AA 2KWVB 4IPCA 5AJ3L 2CW0C 1TWGH 2GVBA 3RD4A 5IP9G 3KLSX 1C0AA 1P7EA 4ZYNA 5DNFA 5CHVC 2D3GA 2TMPA 2DNCA 5IOIA 2I5HA 3BDCA 3P4SB 4K81A 4HIOA 3AEGB 5IGBA 2FJ2A 4A3FG 3GTOH 1HZ6A 3D6CA 2LXCA 3P63A 4R8NA 1TVXA 1N34Q 1ZW7A 2Q2IA 2XGTA 5C4XG 1YNTE 4K7UA 2OJRA 2XVSA 3EGRA 3N3KB 1JALA 5FKAC 2KOLA 3NWTA 4BXXG 1TKYA 4A3DG 3AM9A 3GZNI 3CCQA 1Y1WH 1KXLA 1Q1OA 1S40A 1ONLA 2F0QA 2WP9B 4FULA 2OCEA 2KENA 4V190 1OQYA 2QCZA 1JQYD 1CZPA 3AXCA 2E2IH 4F8CB 1F9JA 4WQOB 1HQRD 1YJNA 2WXPA 3TP5A 4CDFC 5D3IB 3ZUNA 2DYOA 4FXKC 2FCMA 4AYBE 4MH8A 3IT4B 4F7ZA 3CF5A 1ET9A 3IFDA 1I50B 2MBEA 2BGFA 3QAQA 4M0WA 4IO9A 3RZOH 1H9SB 3H0GG 1LLRD 2J0MA 2Y5BB 3JC66 3PIP3 2UXDQ 1K8GA 1WGGA 2RDHA 2L7RA 1UEAB 2A19A 2KANA 1WTVA 4ZKBB 4MGKE 3NY5A 2CHWA 1NAPA 4OGQC 1L1OC 2JJQA 3PO3G 3C8YA 4C3IB 1TKEA 1Z2MA 4I7ZC 4RFBA 3M4OH 2Z59B 3C2PA 3EFUA 3DBLI 3WOFA 3FDTA 4H7BA 3ZNZB 1CUKA 4OELB 2A8VA 3ZTDA 1XMOL 3TEXA 1KABA 3P4QB 2PE9A 1FL0A 3I5JC 5IGDA 1L2NA 4WORA 1T0RC 1QOFA 4WH4A 1KD1C 2WNMA 1FFVA 4K7SA 3PF5A 1NSNS 2B3AA 4GDKB 1U9RA 2AWOA 4EQNA 1PRTF 4KK7A 2NZ1D 3DVGY 2HDMA 3TEZA 2J0KA 2VW9A 2NCNA 4I6NB 4E71A 4DUYL 2R93H 2B2UC 2GRIA 3S17B 1J7AA 2FUG1 2W3RA 2B2YC 3F2CA 3H7PA 2N78A 3HZXA 1Q82C 5JJKA 2DENB 2K22A 3KFUA 3V6CB 3A7LA 1KM7A 2LVQA 5EPKA 4ASWC 3FKIG 2HDLA 4KD3A 1Y8OB 1YHBA 3S16B 3I9V1 2E2HB 1IBXB 2IT1A 1STNA 4ALPA 3DHHC 4PS3A 5BO4B 3RMKC 4DDGD 1U4PA 3MEHA 2O6VD 3S2HH 1FFUA 4LNFA 1I35A 4AIMA 3NBHB 2DJGC 1VQ8A 4XDDA 1RDPD 4BOSC 3QC8B 4P2CB 4JOIC 1DD2A 1WTPA 1CKNB 3B2GA 1QVFA 4DV0Q 2JF5A 4GKJL 1GD7A 1A2UA 2CQOA 3CSFA 3AE5B 3OLMD 1FVIA 4RMFA 1QCBD 1SNDA 3PUXA 3T13A 3KYHC 1N32Q 2YYZA 4IFDI 4P7IA 4TKNA 2BDOA 1E22A 2WAQB 1EQVA 2H1EA 3MVVA 5L83A 3OWFA 4F7XA 3FPPA 4NXNL 1Y8RC 5IYCG 2L83A 2MBOA 5AUIA 3MHZA 4M8AA 4Q2JA 5CBAE 1UGJA 1UUPA 1ZKOA 4YTNB 2EPBA 3S1MB 1K3BC 4A3FH 5CV5A 1SDFA 2KCMA 2G9DA 5KYIA 2UUAL 1LM8B 2I1KA 2KDFB 4NDXA 4DV6Q 4KDIC 1P8LA 5EGTA 1P16A 3K5NA 3PRPB 4K5XA 2ICEC 5CGKA 1FEHA 2D0PA 3RLOA 4RM8A 2PZTA 4FHJA 4X66L 4PS7A 1CM9A 1VQAA 2YEPB 2G4SA 4ZRPA 2JK8A 2WAQG 2XTIA 2Q5WD 3FILB 4B08A 2Q2UA 4FF3A 4A3BG 1GXDC 2CHZA 1STYA 2V0GA 1X3PA 2PVGC 4IN3A 1GM5A 3RD2A 3B0AA 1YNNC 4EZLA 1K8RB 5JPNC 2L76A 1HUNA 4YTMB 1UNSA 3VYTA 4BBSB 3STBC 2O2VB 3VUYA 3V3XA 4BBRG 2DYBA 2GBNA 4N6EB 5ELFA 2LSSA 1HZAA 4OO1H 2PPHA 1YJWA 4BKGA 5CHFA 4DV7Q 3HOZB 3A9JB 3OJ3A 3K0YA 3TZUA 5CMDA 1NMFA 2GBJA 5IAAC 3HK0A 4IDIA 2ZVNA 2IL8A 3H09A 4X66Q 2HTME 5IYBH 2VY3A 1IP9A 2K1FA 3QOJA 1SE4A 5E1FA 1SNCA 2HUGA 2G45B 3M63B 5AFWA 1S3SG 3PSEB 3Q8EA
chains in the Genus database with same CATH topology
1KAAA 4LMQD 4PMCA 4TQ0A 1PFNA 3DEPA 1EY5A 3EJIA 2A6ED 2B8GA 1PXUA 2WB1B 1QOAA 1ESRA 5G3LD 1FD7D 2SEBD 1XX8A 1LT4D 3NWSA 1GB1A 4IURA 5IT9L 1SMYD 1HQMC 2BDNA 3DWPA 3PO3B 1CHQD 2QF7A 1IYVA 3K5LA 2SDFA 2M00A 4QB4A 3DWQA 2H4OA 1MI0A 1SMYC 1I3QB 5T1IA 1LABA 3NTKA 5KNDA 2ONQA 4OIKA 3SDZA 3TBIB 1RJTA 3C3LA 3I90A 3GTMB 4RKLA 1XLOA 2A68D 4C56C 4KKTA 1JOOA 2ZXPA 5FLXE 2LHEA 1JWUD 1C48A 2VXWA 3PV0A 2B8FA 2Q8IB 1FXIA 2INNE 1MSHA 5C4JB 5D65A 1B2TA 1JICA 1ZXTA 5I4DA 3GTGB 1BXTA 3AB5A 1FRDA 1AP0A 2J0TD 3L4PA 1B44D 2QCPX 3W2DA 1EYAA 4OL7A 2XNAC 3D6WA 3P4PB 4DA2A 2N9KA 1KLGD 5KYLA 4FXCA 3QOLA 4P6VF 2WXRA 3M4OB 1UWXA 1M8AA 2N55A 3TZDA 3M3YB 2BA0A 4AS1A 1FM0D 4JPSA 1L4ZB 2PLPA 1IBXA 4A3FB 3QG1A 2WU5B 4KGSA 4HMJA 2JXTA 4MT5A 1C76A 4N9PA 3VRAB 5ELEA 2F0MA 1SNMA 2Z8LA 3V96A 1N62A 2J52A 4KN7C 2N7JA 1TIID 2CU3A 2NVXB 4IKGA 1Y56A 2JE6I 2K5QA 5H8YE 2OT2A 2X38A 2IW3A 4CJ2C 4EVOA 5DM63 2B2YA 4A90A 2EYLA 3X3NA 1GHKA 4LJZC 3NBIA 3P20A 1AYFA 2NUCA 1D4BA 1K8OA 4O1NA 5HHDG 2WXJA 2WINB 4XXEA 1SYEA 5JEAH 2A6EC 3QB3A 2RMMA 2PW5A 3Q24A 3B9JA 1STAA 3BIID 1LTRD 2NTSA 5FLXL 5EE1A 1QNUA 3AE4B 2LKVA 2PW9A 2F3VA 3RUZA 1XLNA 3RMHA 3AE7B 3S9WA 3QWNA 4KI0A 3MJ5A 4FO2A 2GA4B 2NTTA 1B9MA 3BZDB 3HGBA 1VF5C 4ID6A 2W54A 2GB1A 1C4QA 2O5JC 4XYOA 2ENBA 2JP1A 2PMZB 5BN4A 4FP5D 1O7YA 3GV3A 1RYJA 1WVLA 4ODGA 3T53B 3KBGA 5D7GA 1JB3A 1YNJC 4A6QA 1D1KA 1DOYA 3NTHA 4CKEA 4BS9A 1HFNA 2K7VA 3GD7A 3PUWA 3J80E 1LTID 4PV1C 1CK1A 5EBCA 1D1IA 2BT6A 3D8GA 2HCIA 1ZYRC 1MSGA 1ACCA 4L63B 1X3QA 3E56A 1TS3A 5LL6S 2CHBD 5K5PA 4GZYC 4DK0A 1C4AA 2J4XA 1I4QA 2DBYA 5FO8B 1STHA 2V4IB 1F77A 5JVG3 4XYQA 1GHJA 4QUFA 4YSYB 2XRSD 1PLFA 5DAUA 4D2KA 4J6HA 1L0YB 1A15A 1OO9B 3VR4A 1KLUD 2MEKA 2ACZB 3H91A 3TMEA 3P75A 2QMTA 1E0BA 1MHHE 4O42A 5GXGB 3GTLB 3IL8A 1W6JA 1N5XA 1TS2A 2RKSA 1DYQA 5EKKA 3VR9B 2F0VA 2BOSA 2FHTA 5CV8A 3NQTA 1SE3A 3E6ZX 3T3NA 1F2MA 2INPE 4ZRQA 4X3TA 1KTKA 4L1BA 1ZEQX 1Q90A 2JYOA 4C80A 1ILQA 3IAYA 1CI3M 4CGYB 1SJHD 1QNKA 1JMLA 2KVMA 4K5VA 3MXGA 1VDZA 2WDRB 1B9RA 3P1MA 3ITPA 1CZWA 1C77A 2L9HA 3DWAA 2W55A 4MN3A 3L3OC 3AB9A 3J81E 3CKIB 3A56A 4KGRA 5C2TB 1WD1A 3KWVA 5KGUA 1F2RC 4C7YA 1SNOA 1XTCD 5LNK1 2B2TA 3NVZA 1EY0A 1O7ZA 1TWFB 1JOKA 3KK7A 1H9JA 4AQ7A 2LHDA 3D4DA 2KA7A 3KWLA 4R3DA 4V0BA 2F3WA 4Z9CB 1H9MA 4R9WA 5C0XH 2R7ZB 5C0XG 3EQLC 3MXUA 1E2ZA 4YT0B 1IUEA 5KRUA 3L9AX 1LTAD 5T8IA 4TQ1A 2F0PA 5I6WA 2WXIA 1PTOC 2KWDA 5G5HA 4HEDA 4RH6A 1GUGA 3IFTA 1KNAA 3QIAA 1GJXA 1PRTB 2EY2A 3I57A 1MGSA 4XT1B 3Q8CA 1FR3A 1NYRA 2M19A 3A8KE 1TT2A 4FVMA 1EZ6A 1G91A 1WSPA 3VRBB 2A5HA 1T5XD 3DUZA 2L32A 4OO1G 2Y3AA 2WXKA 4FYDA 3TEWA 2NVQB 3MWYW 1LTSD 4NMZA 2JWUA 4REZA 1JR0D 3TSSA 4CJ0B 3W5VB 2E3TA 3RZOB 3EFXD 1J7BA 4PMWA 1PTOH 1IGCA 4IQZA 1JWSD 3BDLA 2MHVA 3J81L 5J22A 5BN3A 1Y1WB 4ARCA 3PUYA 1ENFA 1JWMD 2SNMA 3IKJA 3TUOA 2MP1A 3FVQA 1NVID 3AE2B 2F0SA 1AZQA 2KMMA 3CRLC 4BBRB 4U68A 4QCLA 3R8BA 4HAEA 3ND8A 1EM7A 5IGCA 2O5IC 4XDCA 3TEYA 3ERQA 3NRZA 2EELA 5D3DA 2D5DA 1I6HB 3H0GB 3IAS1 5BYSA 1E10A 3V05A 1HA5A 4IFDG 4A3EB 5IOCA 3K7AB 3BS1A 1TWHB 2A6HC 2EY6A 3MAQA 1EY7A 4RWSC 1N61A 1E2VA 1EIGA 4A3JB 1VZ6A 2K28A 4B0MA 2HCCA 1WTQA 2IX0A 3QJYA 2QEJC 5FO7B 1D2BA 3HRDD 2B2WC 1C4CA 3AMZA 5COYA 1EQTA 1IHZA 2DY7A 3CWIA 1YNND 2WP8J 2L0CA 4HTHA 5M3FB 5ELCA 4DAVA 3NQIA 2XIWA 3MXPA 1ZXIA 1SE2A 3FKIB 3P4RB 1CHPD 2K5DA 3SVMA 5I2XA 5KIXA 1QT9A 4CQNA 1TY0A 1PFBA 3D31A 5JJZA 3IT6B 4P16A 4QUCA 5I2YA 2PIAA 3ZJTA 1ENAA 1KDBA 5H92C 1IW7D 4FF1A 3M85A 2K1BA 2KEDA 4XDXA 4DF7A 2K22A 2L11A 2ZW1A 2BS3B 1BR9A 1HRJA 1DONA 5A2QE 1NENB 3NVWA 3NHHA 2F0IA 4K14A 1ENCA 3I4LA 4BY1B 1C78A 1VJKA 1RFKA 2F0TA 1IKLA 2VZKD 1IL8A 4TKOB 3K6OA 1F9RA 1FGBD 1XYIA 2EYMA 4H0LC 3ND9A 3K58A 1G291 1Y1VB 4PMBA 1VZ8A 2OHFA 4HROA 3I91A 5HGTA 2RQXA 2KDMA 3T4AC 2DNEA 3I70A 3SK8A 1QOGA 5BYRA 3NUCA 3KLSA 1HZ5A 3W9CB 2SOBA 5BMIA 1WTRA 1ESFA 1BCPD 4RHRA 3SK5A 4DN4M 2JYTA 2KAJA 1S5CD 3BK1A 1TR5A 1JORA 1SAPA 1Z6HA 2F0UA 3HOXB 2KN4A 3ABVB 1BCPC 4J8QA 3HOVB 4KX6B 5KNBA 4LK1C 2B2WA 3MXNA 2JZPA 4TSSA 4N59A 2F0OA 3NTIA 3O13A 4YWGG 3CU7A 5M9OA 2QIEB 1LT3D 5EE9A 4R8IA 1A6XA 1EY8A 3EROA 1K8MA 2CJOA 4C3HB 2BE5D 2LMCB 5K36H 3RLFA 1PGBA 2WXQA 1LTGD 1HXYD 4ZKCB 2BS4B 3EUB2 5C3WA 1DOKA 1ZPSA 1I4RA 4HSVA 4KJOA 1Z47A 4OHJA 4DFAA 2JA6B 2K0PA 1E6EB 3M7NA 3GTKB 1WTWA 2Y5PA 2H89B 1CA6A 5M5YB 1D5XC 1STEA 2O4XA 1JC7A 2JEBI 3C1EA 2HDEA 2LJIA 2N88A 5ISRA 2L1AA 1F2YA 4A8XC 1PDXA 1EU3A 3FAHA 5LL6X 2XRQD 5EPLA 3EVQA 2I2YA 2DYMA 3GTOB 1B53A 3AN1A 1QOHA 1G8ZD 4NP5A 1L6VA 1O7LA 2ZT9C 3GB1A 4OZAA 1E9MA 4JBWA 2L55A 3WCQA 4ZQ3A 1BCPB 2JA8B 3URYA 4C2MB 2F0HA 4KMUC 1SYBA 5E6JA 3LWEA 2DLBA 3KF8A 1TWCB 1PDQA 3JAME 3I8ZA 4FF4A 5CC4A 2AWNA 4NKLA 4KV6A 1WXQA 4NZLB 5JOBA 3OIPA 4RF0A 4FXGC 4NAWB 5C3JB 3A8JE 1I6VC 2LUMA 4KD4A 4K8IA 1SFOB 1GB4A 1HCZA 5BYQA 2EY5A 1X32A 2QJLA 2AQ2B 4OW0A 1DM0B 2N9LA 4H2AA 2NYZD 1ILPA 4N9TA 3TP6A 3J7AF 1SYGA 2IPKD 4XWTA 1FIQA 2Q8RE 2LY7A 1OFFA 1DCZA 4BA2I 4DU9A 5IIFA 4K2KA 2JSOA 1N5WA 4E6IA 3PUVA 2D9UA 5CORA 4HEA1 4F8MA 4A3DB 3Q8AA 4F87A 1S5BD 4HSPA 1V1OA 3SFDB 1WWTA 3DM1A 5C0XI 3L7ZC 2BW2A 4A3KB 3U7ZA 4GDLB 1OQQA 4C3JB 4HCEA 3E5SA 1CA5A 3HVZA 4YSZB 2EVBA 1GPXA 2VUMB 1AFPA 4CKCA 2QILA 1BMLC 2AX5A 1CQVA 1BQQT 2Y5CA 2PCFB 1XF5L 4L23A 2RPVA 5TSSA 2A68C 2PW7A 3C1FA 4KTAA 1CFMA 3Q8BA 4YIJA 2AQ1B 4K2LA 2M2LA 3ONAB 4IUPA 4KGTA 2ZW0A 3S1QB 3KLRA 2K32A 2SNSA 1SYFA 3WOEA 3DWGC 3N9YC 2J53A 1K51A 2PTLA 4HR7B 2NVYB 2R61A 1P7FA 1FO4A 2IGGA 3PZ7A 4J3OD 1F9PA 4PT5A 4YSXB 1I4XA 4HMIA 2EOTA 5IGEA 2EZVA 2F0GA 1CT1D 1KF6B 1EY6A 2OF1A 1PFMA 3SK4A 1D5MC 2EJMA 3PMFA 2WDQB 1KFYB 1V8CA 4RAUC 4CJ1B 3P7JA 3TN2A 4ZUJA 1Q8IA 4A3GB 1K50A 1MBYA 2KEEA 1A3UA 4DXFA 5JPMC 4C7ZA 3H3VC 1FCLA 3E0JA 2WXMA 1WTXA 2F0NA 1LACA 3TP7A 2EXZA 1EFID 2LFNA 3NE5B 5FR3A 1JRPA 1EYDA 2ICIA 1OXTA 3VR6A 1L4DB 1ZDVA 1DZ1A 2FBWB 1R7SA 1II3A 3MC0B 1PMRA 4RKBA 2XN9C 1WTOA 3F2UA 3BG3A 4J1MA 1XLQA 4G4KA 1SJED 2JA5B 5IT9E 4WWMA 5C3XA 1LV9A 3I73A 2WQYB 3DEOA 2B63B 3NXWA 2R93B 2L52A 1EOTA 4EQOA 5G3LF 3BDOA 4IUNA 5E3FA 1OXUA 2EYOA 4A55A 2RSNA 4KN4C 1B9NA 1C79A 2DWQA 5KNCA 1IW7C 2PZUA 1NCVA 3DMUA 2TSSA 4IFDH 2LEKA 1ZE3D 2RDFA 1RCVD 3C46A 2IX1A 2EYPA 4IOIE 3BWUD 2K01A 3LB8C 3Q22A 5HI1A 1K83B 2D62A 1TYGB 3BVGA 2K04A 1G2SA 1ZUD2 5T1GA 2VNUD 1ICWA 4H13C 4G7OC 2R92B 3RPFC 4KKSA 1TJEA 2KQ4X 3HP3A 3R3OA 4KKUA 4G57A 1QILA 1U4MA 5C4HA 3VR2A 1EEFD 2NB0A 3BVMA 2LFIA 1ZDXA 1JQ4A 5HFYA 2DY8A 3GTJB 2CW0D 4IUQA 3UI3A 3FRPB 3OIQA 4KY6A 4TMAB 1XCQL 3VYSA 1WD0A 4OZBA 1PYWD 1F9SA 1G6ZA 4L8JA 3S1NB 4EQPA 4BWGB 1PTOF 5FO9B 1EY4A 1GUTA 4WURA 3VQIA 4K8JA 1TY2A 1YMHE 2WV6D 1L0XB 1VDVA 5DEHA 4YTPB 1PZKD 3R93A 5ELDA 4KHVA 3BYTB 2F4IA 2FMMA 2M56B 3Q69A 4OVZA 4MHEA 4MACA 1FNUA 4KY7A 1HEZE 5C3EB 2PZWA 2PO4A 1CTMA 4QF4A 4L6TB 1IKMA 1I7HA 2E75C 1VLBA 1V43A 3OSOA 1EWHA 1HPCA 1VCIA 4CHTB 4FNFA 2C9OA 1QLBB 2JYEA 1XXGA 3K5OA 1FNVA 3RFZB 4IFDJ 5M3MB 4XQJA 2F0JA 2F0FA 2F0DA 2F0EA 1WCMB 3P42A 1ET6A 1OXVA 4US8A 5I9OA 2X69A 3ETRA 4USAA 2X6LA 1HFGA 3J7AV 1BOSA 1CZGA 2PNRC 2W3SA 3A7AB 2EJFC 1Q1EA 1H9RA 4DNTB 1F2LA 4ZYSA 4NAMA 4K6LA 3VR3A 1B4OA 2B2UA 2HQEA 3WDNA 3K5MA 2G1EA 1BCPF 3AEEB 1V97A 1IGDA 1PUTA 3VA5A 2D5GA 2K9XA 3PZ8A 3GO5A 3U52E 1DXMA 2KHSA 1ZOYB 3PO2B 3I4NB 1PRTD 4N58A 2B2TC 1UAPA 2K3UA 1FD6A 2PPBC 5C5MA 1Q10A 2B76B 4G7ZC 1JW9D 5F2DA 3J80L 4ZHPA 5KEEA 5EE3A 3Q0AA 2LS01 1VRAB 3NVVA 2I07B 4US9A 1O80A 2JSVX 2A6HD 5M5WB 4C3HG 3SHLA 3MZ5A 1XLPA 2WXOA 1TS5A 2IX3A 5CV7A 2G9HD 5LHY1 4KKIA 5E4XA 3IAM1 3D3RA 4WJWA 5FK9C 4RF1A 1KNEA 3ZJUA 2EKIA 5M5XB 3GTPB 2VB3X 2BB5A 4XWWA 5NUCA 1QJOA 1EWYC 1GOZA 4DAPA 2OEOA 2BE5C 5HG2A 4HKQA 3EA6A 3OHXC 1YQ3B 2MJDA 4JK1C 3AV8A 2NWGA 1B50A 4XTCS 3BYYB 2MJ8A 4OIJA 4RHSA 1BUVT 2PQEA 3SR1A 1KDAA 2IGHA 2EE1A 1YJJA 1H9KA 1ZYRD 3U4EG 2W82A 3NP8A 4X3KA 1SSNA 1V1PA 2A73B 4XQQA 1PGXA 2JEAI 3CRKC 1XO3A 1J9OA 2ID0A 4S3SA 3K59A 1C9FA 3K57A 4B0EA 2R6GA 3AEBB 3OWEB 2WU2B 2Z4HA 2I46A 1QOBA 2XSCA 1RHPA 1SF0A 3AE3B 3HRZC 5MPOA 5C4XB 2NN6H 2IGDA 4HRSA 5EKLA 3OMGA 4C1NI 5BMGA 4DK1A 3S2DB 1FCCC 2J42A 5JAVA 1B3AA 3LWUA 4CKBA 1TKGA 1SNPA 3X3MA 4L2YA 4H44C 2K03A 5CYUA 1LT6D 4ME5A 1VR9A 2Z4IA 4Q5VA 1YN5A 1A70A 1EYCA 1MHXA 2M0AA 5IGFA 3ZYYX 1BF4A 5CBEE 2KQ3A 2FFKB 5G5GA 2NMQA 1RODA 5EQ0A 1FMAD 1VF7A 2E6XA 4RGNA 5JXVA 3CIRB 1RD9D 3Q8FA 1JCKB 4NJCA 1RTOA 3ZGZA 2QDBA 1DOIA 4FF2A 4RCNA 4ZOHC 5CV6A 5JEAJ 2WDVB 3LX0A 1TS4A 2GI9A 2JXMB 1AZPA 3AU7A 1FRRA 5ELBA 2BS2B 3A54A 4RGMA 1AWDA 2VZKB 4MM3B 1R4QB 1Y8PB 1Q1BA 1EIHA 3W5UB 5CV4A 2F03A 3ZJVA 2BBCA 2OEDA 2LMCA 4WRDA 1L6UA 4OO1I 1VMPA 3OMCA 2J7ZA 1EEID 3RZDB 2V3PA 4B9XA 3D4RA 1GUNA 3G7LA 4RA8A 3T56B 2MGSA 3T51B 4RCOA 2Z1CA 4ARIA 4OZCA 2PKOA 3AEDB 4UAIA 2AUJD 1TWGB 2RSOA 2NBFA 4Y7NB 1LO5D 5FOBB 1VMCA 3SXHA 3VR5A 4AYBB 3VR8B 3NK9A 1QF6A 1EZ8A 2K5PA 4KY5A 2JA7B 3NUHB 3NVYA 1DOLA 3T16A 3I4MB 4DQOC 5J39A 2QKIC 4B9WA 5C4ZA 2DN8A 1NUCA 4XQNA 4A3MB 1AN8A 3OOCA 2XWJB 1U4LA 3NZ3A 4JWUC 4XIGS 3HKZB 1SYDA 2PMVA 2L4NA 1R4PB 4WQMA 3MA2B 1DGJA 4BY7B 2PVOD 1QKZA 1EU4A 1ML0D 4MIUA 4IUVA 3NPPA 3VYRA 2F0LA 3T3OA 2Q8TA 4A3IB 2CJNA 2YU9B 5DM73 1C8CA 1TQOA 4Q0FA 2I38A 3LNNA 1Q3LA 4EGVA 1MVKA 3D4WA 1NYQA 2WLBA 1YNJD 1CQFA 4C3IG 3AE9B 2IWHA 1V8QA 1PTOB 2V4DA 2KCNA 2BTEA 2AUKA 4C3JG 3IXSA 2OXPA 5BMHA 4PNYA 4DXGA 5EPJA 4DNRB 2WXGA 3VA7A 3MHBA 1RM6C 3G6JB 2O2LD 2IDYA 1BBXC 1STGA 3H94A 2ZXOA 4XT3B 3AEFB 3AE1B 3CHBD 2E2DC 3HVDA 4RGOS 4F88A 2WS3B 5CR3A 4LTUA 2KECA 2K5WA 1SXTA 2SAKA 4ZRZA 2JQRB 5A2QL 2NN6I 2YEPF 3AECB 5JEAG 1F9QA 2RBMA 5J1ZA 2PYKA 2EYFA 3M7GA 3U2SC 1K53A 1GAQB 5D14A 1JE4A 3BVZA 4C1NK 5CV9A 1TZOA 4JX1C 2MPMA 4A93B 1XWEA 3DXJC 2XWBB 1AEXA 2EJGC 4QMGA 1PGAA 5EE0A 3FMCA 2WKDA 3SEBA 2D2CC 3VYUA 5HURA 1DOXA 3OPOA 2MUYA 3H6MA 1F2RI 3AMUA 2FE8A 3LYYA 4HKZE 2A69C 1RKNA 4UDUC 3SR6A 1UWMA 1RTNA 1HUMA 3N6RA 4LK0M 2WIIB 4KHZA 4ZAIA 1CJEA 4HJGE 1PTOD 2CVRA 4CBVA 3MFGA 1YN3A 4YXDB 1SSOA 5K36G 3FC4A 3HS0C 1BNZA 4GLSC 2N0SB 1LT5D 1PFDA 4DAYA 4KJNA 1N63A 4ZUIA 1XEEA 3FEWX 1L5PA 2WXLA 1KRHA 3NS1A 2LGIA 2A74C 2QSDA 3W1SA 4IZ8A 1JWAD 1G2TA 1FXAA 2E2IB 5E4WC 3AE6B 1L0VB 3I72A 4JE3B 3U9OA 2C5CA 4WFN3 1SB3C 3B2FA 1LTTD 3PO0A 1I4HA 3AE8B 2EY1A 4ZHOA 1QB5D 3R2IA 1A3TA 2NN6G 1U4RA 3LXFA 4PQXA 2F0KA 4A9AA 4G7HC 3E9SA 2EYHA 3OW7A 1BDOA 1B1ZA 3Q6SA 1O78A 2EYJA 1JOQA 1QWYA 1T3QA 3N52A 2BB6A 2AQ3B 3HG9A 5C5LA 2BA1A 3ZQ4A 3SE0A 1C4PA 1HTPA 1YN4A 3PUZA 1T5EA 3S14B 2A69D 1EL0A 1TU2B 1ROEA 3M4YA 3S1RB 1E2WA 4K6DA 3GQBA 1MD2D 3NSWA 3SK6A 2X6GA 5BN5A 2WXFA 1EWCA 4X3UA 1I4PA 2B2VA 3GP7A 1QE6A 3PIO3 1MPEA 4LAAA 2WACA 4K5WA 2F0WA 3I3CA 2JU6X 3GTQB 3KBXA 1MI2A 1SIJA 2B39A 1BO0A 4WIPA 4FXDA 1T6BX 3JAML 5I6YA 2CQAA 1SNQA 2FMCA 1XCTL 1DJRD 3QO2A 4IUUA 1OXSC 1JWBD 4IALA 2MJEA 1D5ZC 3AEAB 1S5FD 1DOMA 5IGGA 1S4ZA 4QIWB 2EDGA 3S15B 3HEJA 2K33A 3R2TA 3HUIA 5C0XJ 1PZID 1J7CA 1GUOA 2KACA 4EE2A 3J9CA 4DGZA 4HN7A 1I4GA 2RDGA 1Q12A 5I9PA 4ABNA 1IYUA 3Q23A 5AUKA 3TP8A 4TQUS 1H9SA 4KKJA 1FNWA 4RGTA 1NEKB 3TDQA 2WXNA 3J7YW 3S2HB 3HOWB 4JWSC 2RA4A 1D6EC 1HTLD 3H8HA 1PZJD 1RWSA 3FPUB 4ZLTF 1NI3A 1W6KA 1BUIC 2VB2X 1STBA 3HOUB 3GV6A 1WYGA 1JROA 3U9SA 1HA6A 2L1BA 1GUSA 2R3ZA 2IJ0A 1E7PB 2BCOA 1LTBD 1WGKA 1OQRA 2FINB 5C44B 1RF2D 1EY9A 1NR4A 2V3NA 4ITKA 1QG7A 5EKIA 2K05A 4IUTA 1WRIA 1V1PB 3DHQA 4I65A 1KH0A 2Y0SB 4U673 1KDCA 1ZP0B 1TWAB 2E76C 2ON8A 2BYTA 1YJIA 1SYCA 3DWMA 1NR2A 4BA1I 1S5DD 2ZXRA 2E2JB 1SEBD 2KJXA 5A35A 1M4VA 2M9VA 4ZK9B 3AH7A 2RVLA 1Y8NB 1HHVA 1R9TB 1TKWB 4WAFA 3W3AA 2K6AA 1Y69U 2KCCA 1S5ED 1PRTC 1VZ7A 1E0ZA 1J8IA 2E74C 1AW7A 4ULLA 3KQ4A 1N60A 4XE0A 4NW2A 3MFYA 3MP9A 1YQ4B 4LLGM 5EJWA 5IODA 1GUWA 3BK2A 2WKCA 3V2TA 1F0ZA 3MTSA 3UI2A 3P1HA 4HCSA 2B2VC 1F2ZA 3CQZB 1QQRA 5JVH3 1A2TA 3GS2A 4RNAA 2NVTB 2L12A 3NBHA 3A8IE 3HOYB 1SBBB 3FILA 3KUPA 2KUMA 5EBDA 4X3SA 1Z7TA 3A55A 4M1UB 1ZXHA 1K52A 2H88B 1FYCA 2F1MA 2MJ3A 2L5TA 3SFEB 1A3VA 2JX5A 4ILWA 4TRDA 2MH7A 1OXXK 4A3BB 5C6AA 2CW0C 3RD4A 3KLSX 1P7EA 5DNFA 2TMPA 2DNCA 3BDCA 3P4SB 3AEGB 5IGBA 2FJ2A 1HZ6A 3D6CA 3P63A 4R8NA 1TVXA 1YNTE 2XVSA 3EGRA 1JALA 5FKAC 2KOLA 3NWTA 1TKYA 3AM9A 1ONLA 2F0QA 2WP9B 4V190 1JQYD 1CZPA 1HQRD 2WXPA 3TP5A 5D3IB 2DYOA 4FXKC 4MH8A 3IT4B 1ET9A 3IFDA 1I50B 4M0WA 1H9SB 1LLRD 3PIP3 2RDHA 1UEAB 1WTVA 4ZKBB 1NAPA 4OGQC 3C8YA 4C3IB 1TKEA 4I7ZC 4RFBA 3C2PA 3WOFA 3FDTA 4H7BA 3TEXA 1KABA 3P4QB 5IGDA 4WORA 1QOFA 4WH4A 2WNMA 1FFVA 1NSNS 4GDKB 1U9RA 2AWOA 4EQNA 1PRTF 4KK7A 2NZ1D 2HDMA 3TEZA 2B2UC 2GRIA 3S17B 1J7AA 2FUG1 2W3RA 2B2YC 3HZXA 3A7LA 5EPKA 2HDLA 4KD3A 1Y8OB 3S16B 3I9V1 2E2HB 1IBXB 2IT1A 1STNA 1U4PA 3MEHA 1FFUA 4XDDA 1RDPD 4P2CB 1DD2A 1WTPA 3B2GA 1A2UA 3AE5B 1QCBD 1SNDA 3PUXA 3T13A 2YYZA 4IFDI 2BDOA 2WAQB 1EQVA 2H1EA 3MVVA