1V1PA

The structure ssl from staphylococcus aureus from an orthorhombic crystal form
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
191
structure length
191
Chain Sequence
HLHDIRDLHRYYSSESFEYSNVSGKVENYNGSNVVRFNPQNHQLFLLGKDKEQYKEGLQGQNVFVVQELIDPNGRLSTVGGVTKKNNKTSETNTPLFVNKVNGEDLDASIDSFLIQKEEISLKELDFKIRQQLVNNYGLYKGTSKYGKIIINLKDENKVEIDLGDKLQFERMGDVLNSKDIRGISVTINQI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Relationships and Cellular Tropism of Staphylococcal Superantigen-Like Proteins
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Virulence factor
molecule keywords EXOTOXIN 1
total genus 49
structure length 191
sequence length 191
ec nomenclature
pdb deposition date 2004-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
A PF09199 SSL_OB Staphylococcal superantigen-like OB-fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1v1pA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1v1pA01
1LT6D 3V05A 4K6LA 1LTSD 2J4XA 1EEFD 1SXTA 3R8BA 2O2LD 1L0YB 3BYYB 1JWSD 1S5DD 2NTSA 4Z9CB 1JCKB 1T5XD 1HXYD 1JWUD 1M4VA 1D5ZC 1S5FD 1S5CD 1STEA 1TY0A 1UNSA 1XXGA 4C56C 1YN4A 1KTKA 1ET6A 1YN3A 5I4DA 1L0XB 1I4RA 1D5XC 1FNVA 1HTLD 1CK1A 1SE4A 1DYQA 3BVGA 1LTTD 3SEBA 3OWEB 3W2DA 4RHRA 5D3IB 1LT3D 1SE2A 1EEID 4DXGA 1PTOD 3CHBD 1LT5D 1PTOH 2WV6D 3EFXD 4RGNA 1CQVA 1D5MC 1SBBB 1AN8A 2QEJC 2XN9C 1LTAD 1PRTB 1QILA 4L63B 1PTOC 1PTOF 2G9HD 1SJED 4TSSA 1SE3A 1SEBD 1F77A 1UUPA 1PZID 1B44D 1EU3A 1RD9D 4RHSA 1S5BD 2R61A 1LTID 1SJHD 3DWAA 4RGTA 1EWCA 5ELEA 5ELDA 5TSSA 2CHBD 2QILA 1LTRD 1AW7A 5ELCA 2ICIA 1PRTD 5ELBA 3BVZA 1BCPF 1EFID 1LLRD 1TS2A 1V1OA 1ESFA 2XNAC 3MC0B 1B1ZA 4O1NA 1EU4A 1JQYD 1PRTC 1GOZA 1CHPD 1I4GA 1I4PA 2RDGA 4RGOS 1V1PA 1YN5A 1PRTF 1G8ZD 3DWQA 1BCPD 2NTTA 1PZKD 4DXFA 3BZDB 4RGMA 2XRSD 2Z8LA 1KLUD 1KLGD 4NZLB 1TS3A 4OHJA 1TY2A 1JR0D 1V1PB 1RCVD 1TS4A 1FD7D 3EA6A 2IJ0A 1I4XA 2AQ2B 1LT4D 3MFGA 1PYWD 5D3DA 2XRQD 1RF2D 3BYTB 1CHQD 4L6TB 3DWPA 1BCPC 1CT1D 3R2TA 1LTGD 1MD2D 4RCOA 1BXTA 1DJRD 4RFBA 2TSSA 4ZYSA 1FGBD 2AQ1B 2RDHA 1XTCD 4BWGB 1I4HA 1HQRD 1LTBD 4UDUC 1HA5A 3KLSX 1ET9A 1I4QA 3O13A 1FNWA 2AQ3B 1PZJD 1PTOB 5FK9C 2SEBD 3R2IA 5ELFA 1RDPD 1FNUA 4RH6A 1D6EC 1ENFA 1JWMD 5FKAC 3URYA 1S5ED 2IPKD 3GP7A 1BCPB 1TS5A 3BVMA 3TSSA 1LO5D
chains in the Genus database with same CATH superfamily
1FO4A 1EY4A 3M63B 2D3BA 3W1BA 1DOYA 5H8YE 4DR6L 2EYMA 3BDLA 1RL2A 4EX5A 3QB3A 4XQJA 1PA6A 3HOYG 4KLKA 3BYYB 1WD1A 3OOCA 2HCCA 2L4NA 4Q2JA 4RKBA 4Z9CB 5LMNW 1KNAA 4ZRZA 1AYFA 2LGSA 3CP0A 4A3DB 1PDQA 1YMHE 3ML9A 4GN3B 4PS3A 1ZUD2 3KDFB 1MJDA 2W3RA 2YEPF 4JOIC 5LHY1 2CJOA 2LASA 2N3SA 4LF7L 3AE9B 3PSEB 3OWEB 2EY2A 3SD5A 1L7YA 3HIZA 1TVXA 2JPHA 3UI3A 5KYLA 2B2WC 4AQYQ 2F0DA 4IQZA 4UY8C 2D0PA 1STNA 2DWQA 2WX1A 2WFWA 3MAQA 1A6XA 3NZUA 2ID0A 2O2VB 2HIXA 2R92B 1I94L 1QCBD 1TWAH 1HR0Q 5C0XI 3JSVA 1X56A 1U4MA 4Q5VA 2HCIA 4I7AA 4L63B 2NPTB 1R4MI 1PTOC 2B76B 1JQ4A 4AQ7A 3NEMA 5JAVA 1C0AA 3DM3A 3RUIB 4BVUC 1JB3A 3DMUA 1FFVA 4XQNA 3R93A 3GTKH 4LDTB 4A55A 2MBEA 1RD9D 1E22A 1GJXA 3PZ8A 3OPOA 1GVPA 4FF4A 4HPMB 4KKIA 1GUTA 4TUUA 4OX9Q 5AJ3Q 1CZWA 1XPOA 4CJ0B 3FPPA 3L13A 1SIJA 3I91A 3IAM1 4YHHQ 4JLCA 1U4RA 4BY7B 4NQLB 3W9CB 1FPYA 1CHPD 1HZ9A 3T16A 1AH9A 4JW0A 2JWZA 3TBLD 4FADA 1V1PA 4GKKQ 5C1ZA 3ZXVA 1IKMA 4OEMB 3NVZA 2LWPA 2L05A 1VQDA 3RLNA 1H9SA 2PI2E 1I7HA 4X65Q 3N32A 2KDBA 3NZSA 4DDID 3L9AX 4MELA 1GHJA 2Z1CA 1SFOB 1YBYA 2AWNA 2DAFA 4GN1A 3I4NH 1UH6A 5HURA 4A3LG 2WAQE 3DM1A 1U4PA 3A56A 3I5JC 1S40A 2BKRB 1MKHA 5AEKB 4WH4A 3HVZA 1HTPA 1O7YA 3EA6A 1N5XA 3KLRA 4KD3A 5D3DA 2NUCA 3MXUA 5M3MB 3E6ZX 5C23A 1RTNA 2JA8G 3JAME 1R4NB 1EL0A 4A93G 4HJ5A 3QJZA 2G9DA 1KD1C 2C9WB 1MG4A 3EBEA 3H7SA 1LV9A 2RKSA 3L08A 3K0YA 4A3CH 5CV6A 3H3VI 3ONAB 1V8CA 2W82A 3GTPH 4MGIE 3ER0A 3O13A 3DVGY 2NBVB 3PIO3 2PW5A 2C7MB 3DHIC 4DDGD 3RN9C 1L1OB 1YJ1A 4NPNA 4ZKCB 1KM7A 2WP8J 4J8QA 3SDZA 2HDEA 3C0RB 1DGSA 1Q81C 4HR7B 2L15A 1KQSA 2JP1A 1F9JA 1ONLA 4DV5L 2IO0B 1MSHA 2Q2TA 2OEDA 3NUHB 4GU2A 4H2AA 1X3GA 2KT7A 1VMPA 3PIOA 3OJ3A 2RHQB 2XIWA 2E2HH 4ZHOA 1K73C 4OO1H 2F4VQ 2R93B 5FJ8G 1WXQA 3HOZG 1GHKA 5M3MG 5IOIA 3UDXA 4GOPA 2Z6KA 2VS1A 3SR6A 3BK2A 3EUB2 2N7JA 5T8IA 3MXGA 4IN3A 4FF2A 4NNJB 1E0ZA 2EY1A 5IT9E 3I57A 1IBLL 3R7RA 2V3PA 1F2ZA 4IJHA 4DV0L 1AP0A 2B63G 1HPCA 3A8IE 2K5PA 3Q14C 2QSDA 4MM3B 3DHQA 1O7ZA 1HCZA 5CGKA 2JZZA 4DUYL 4IWQA 5DCNA 4IFDG 4NJ6A 4ULLA 2OHFA 1HRJA 2NS5A 2QJLA 4NXMQ 1QOGA 5HKHA 4TRDA 2XK5B 3AMUA 1IBXA 1PTOH 3D6WA 3K58A 2WXKA 2B2WA 3RNAC 2E75C 1KH0A 4ZK9B 1MHWC 4H13C 4DF7A 2IHFA 2V0GA 5JEAG 3HOXB 1SNMA 1F9SA 4NDXA 1B2TA 2DX5B 4FHKA 1K83B 1QVCA 2EYLA 3D31A 4JPBW 4BY1G 1VDVA 3KVFB 2Y3AA 4R3DA 1WJNA 1E7UA 5BN4A 5C4ZA 4JI3L 2DGYA 4JI1Q 1OO9B 1PZID 1BT0A 1EU3A 4N8FA 4JV5Q 2A69D 2GBKA 2AUJD 4X66Q 1QT9A 1IBML 2NVYB 3QR8A 4LF9L 4KSLC 2EOTA 4A75A 4EZLA 3GTLH 1ILQA 4JE3B 3BVZA 2PPHA 3Q3NC 3A54A 4DBGA 4A3KB 1XNQL 3ONSA 1B1ZA 3NTKA 1SIFA 2N88A 1EF1A 3A74A 3RLOA 2LRUA 1HNXQ 1TKEA 2UXCQ 3V61A 2JA7G 4KHZA 5E6NA 3WAOA 5DNFA 5J18A 4IFDH 2NTTA 2NN6H 3CCVA 1CJEA 1L4ZB 4JI8Q 3ECIA 3J81E 3QX1A 4N58A 4LAAA 3MEFA 1KC8C 2IDYA 3TQYA 1STYA 2EJFC 4B08A 2PVGC 2YTXA 4G57A 4JK1C 3ZKJC 3M3YB 2F0FA 2N4FA 1F9QA 3KBXA 4DUZL 1UGJA 1KL9A 2JYTA 3DEOA 1KDCA 4WJQA 4YWMA 2E76C 1P7FA 3KUCB 1A0IA 3VR2A 1F1HA 4DV2Q 2MBHA 1NY4A 2WXPA 3VUYA 1BR9A 1SNOA 4P72A 5HY6A 2I46A 2TSSA 1VQ5A 1B3QA 2WS3B 4A3MB 4WRDA 4I6NB 2AWOA 1P3QU 4OW0A 1LTBD 1SRUA 4NAWB 3K80C 3HOUG 4HIOA 1YI2A 2L00B 3GZNI 4HTHA 4TQ1A 1PTOB 1SDFA 4UP8A 1TJEA 2PLPA 4A3LH 1MPEA 2FE8A 4CYEA 4K0KL 1RDPD 4BKSA 3KF6B 1D6EC 4ZDVA 4XTCS 4R4OA 4APVA 2JXTA 3MHSD 2IPKD 1ZXTA 2UU9Q 3GTMH 2K6AA 4GLSC 1QVGA 2K5NA 1YNND 2CW0C 3IXSA 4A93H 3KYCD 5IYDG 2DLBA 1WM2A 4C3JH 1JOOA 4K6LA 2PZWA 4ZHPA 1HTQA 2NCNA 5M3FH 1SXTA 4X6AH 2BDNA 3AU7A 2MHVA 3KK7A 1ISNA 3S14B 4ME5A 4XQQA 4PYUA 2HIVA 1K28A 1HA6A 2WU5B 4F1SA 3NE5B 1V43A 4KJOA 1QWYA 2PNHA 3ZRFA 1D5ZC 3V2TA 4A3GH 4IM2A 4MT5A 2KMMA 2A5UA 1MSGA 2JA5B 1PQSA 3EVQA 1YN3A 1FCLA 4P73A 2EMSA 3RNFC 2K5DA 3AEAB 1Z7TA 3GO5A 5LMUQ 5L95C 2V4IB 1N32L 1TGZB 4ACFA 1PLFA 3DCGA 2XWJB 3M85A 3TEHB 4DR4Q 3PPAA 1V1QA 4EOYA 1EIGA 4WAFA 1V9PA 2ZPNA 2K1FA 3CMMB 4K5WA 3EFXD 1ILPA 3I90A 4BY7G 1LQBA 4DR7L 1F9RA 1EY9A 1I6VC 1Y1VB 2E74C 3V96A 5M9OA 1WTRA 2MJ3A 3RLFA 4UP7A 3RPFC 3H0GB 1ZP0B 2UYZB 4DV4Q 5HGQA 1JB7A 3X3MA 2UUBL 2INNE 2MHJA 4G50A 1ZXHA 2VZAA 1YX6B 3H3VH 2JJQA 2PZUA 3I55A 2IY5B 4NAMA 1SEBD 2KVZA 2Q2UA 1JICA 2FMMA 1Z47A 4PZ6A 3UIOB 1DOXA 2DN8A 2K4KA 3GS2A 4L1BA 1PFMA 1SJHD 2KUMA 3I73A 4IPGA 4TKOB 2ZTCA 1BUIC 1SMXA 4KHVA 1DOKA 3MTSA 3FILB 1Q5WB 4KV2A 3LYYA 5FR6A 5AFWA 2VH1A 4HMIA 1HNZL 1V1OA 3CCJA 3PSIA 4LMQD 3AE1B 2F1MA 3I4NB 2IZVB 2Y5PA 2VZKB 3D4DA 3TCAA 1TWHH 2M19A 4E74A 1QZEA 3HFZB 2C60A 1BO0A 2BYFA 3APDA 4LK1C 4LUOA 1SNDA 3DWQA 3PHXB 2QF7A 1XMOL 3Q8EA 4UP9A 1EQVA 1XMOQ 1YHQA 1WI0A 3BWUD 4JOIA 5A2QE 1J7CA 4BOZB 2EJGC 5T1IA 1I94Q 2EELA 2KA7A 1K53A 5COYA 4II3B 1NAPA 2NMQA 4A3OA 1JR0D 3HHMA 5LMNL 1L2NA 2VW9A 2JY6A 1D4BA 4DR1L 3MFGA 2J42A 1LUZA 2AL6A 1N5WA 4W9HA 2PQEA 4X62L 1WR1A 4X64Q 5I9PA 2A68C 3P2BA 3PO3H 3J7A5 1WZ0A 2MWSB 1FGBD 2K33A 1NMFA 1YIWA 2BE5C 2JXMB 1HQRD 2MP1A 1WZ3A 1QOHA 1NTGA 3K7AH 5CV7A 2AMCB 2LHEA 5JPNC 4W9KA 1YX5B 1BBWA 2FAZA 2ZW1A 3TJPA 5E3FA 1BCPB 3NSWA 2I5HA 3QJYA 4X65L 1EWIA 1F2LA 4C3IH 1K51A 3N1YC 2MNAA 4JCVE 1LO5D 1VMCA 1HE8A 1NENB 2L0FA 2EKEC 4PZ7A 2TMPA 3UDGA 2NZ1D 3VQIA 3EC8A 1NNXA 5T1GA 3S2AA 3RNGC 3HOUH 4JYAQ 4GNXC 4O0AA 3ZJUA 1P1AA 3T3OA 2I5MX 3E0JA 2D5GA 1T5XD 4DAPA 1XXGA 4FO2A 2HJ8A 5G55A 5KHOA 3VFKA 5AUKA 2ENBA 3X23A 5JEAJ 2D10A 3NHEB 1XD3B 3I4MB 1D5XC 2DNFA 3HKZG 2PYKA 1PV4A 4GDKB 5GXGB 1LTTD 2IGDA 4I6LB 2UU9L 2KVRA 1PGBA 4PT5A 2KECA 2WB1G 2V3SA 1LT3D 3D3RA 1SE2A 5LL6X 2LXJA 3CHBD 2GRIA 4ZRKA 2E2JB 5AUIA 1XTDA 4K3BA 2BWES 5G3LF 1WYWB 4Y7NB 2ZPYA 2WDVB 2WB1B 4IZ8A 1RODA 3OTOL 3HOXH 4HXDA 3VRAB 2PZTA 1T9HA 3RMHA 3EROA 3RD2A 1X3EA 2V4DA 4UHVA 4CDFC 3T1YL 3B6YA 3GDEA 1AEXA 3UF8A 3ICEA 1TQOA 3R7QA 3ULPA 1I6HH 4C3IG 1LTID 4ZRPA 1WRDB 3JVZX 3VYTA 1LFDA 2L7RA 2ASBA 3HS0C 5ELCA 1K8AC 4KGTA 2H4OA 1EY5A 4O1NA 3H7PA 2EYPA 1XCTL 4YWLA 2KKCA 3DBHB 1UZXB 4K14A 4KIKA 2XSCA 1A2TA 3D4WA 3FMCA 3S2DH 1G8ZD 3PUYA 4DAYB 2KOXA 3A9KB 2R3ZA 1N33Q 4JI0L 1PGAA 4C7ZA 2RCNA 1YOVB 3D4RA 1PH6A 2KXJA 2LS01 2EYFA 1Y1WH 4HJ9A 1MIUA 1WGYA 2KTRB 1O7LA 3NG0A 4JI7L 4IM3A 4KTAA 4JPSA 2WU2B 4K8IA 3CSFA 1X55A 4ILWA 2F03A 1K8OA 5JVG3 2DBYA 1RIPA 4YTMB 3Q22A 3M4OB 3KUZA 2C9OA 2IJ0A 2ATWA 1QE6A 1HTOA 4OXPA 4WAAA 4NAWA 2NZOA 1XYIA 4KKSA 3QG1A 2XVSA 1MD2D 5LL6S 2I1JA 4DV4L 1U9RA 3HOWH 4KVGB 1B53A 4DR3L 1M90C 2H89B 3IAYA 1XTCD 2D9UA 2KFKA 2LEKA 4YSXB 3KLSX 4AUQC 5EBCA 5BYRA 4AP4C 2NVTB 5M3MH 3B0AA 4BBRG 2KLCA 4DK6C 2L0TA 3EGRA 4GOCA 4YSYB 2B2TC 1ENFA 3GTJB 4JBMA 1XQQA 2YTYA 4MSQB 2OTJA 2Q8TA 3GTGB 1A62A 2EQSA 1NYRA 2Z59B 4WWMA 2O6VD 3U7ZA 4DR1Q 2D3CA 4MEMA 2B2UC 1IUEA 2L76A 5IGGA 1WY8A 2J4XA 1MG8A 1WGDA 1PGXA 4GMVA 4N6EB 3F2CA 2XTIA 3TP5A 3U4VA 2OQKA 4B9XA 3K5NA 4RKLA 3CMAA 3KBGA 3P75A 4A3JG 2NTSA 4J6HA 3L16A 2J53A 1JCKB 2MFIA 5AJ3L 3G48A 2DYBA 2E5LL 4A20A 5DPSA 4C3IB 1CKNA 4P75A 4BY7H 1WIAA 1S1QB 1WYDA 1ET6A 2A6EC 4HCSA 3TN2A 1XWEA 2D07B 3QWZB 5H1SE 1CK1A 2FNJB 1KXLA 2RHSB 3KF8B 3NXWA 2N0SB 5JPMC 3A55A 3C46A 1YHAA 2F0EA 2F0QA 3BJUA 3GV6A 4CDDC 3ERSX 1WE6A 5CYUA 2BS3B 2CR5A 2DY8A 1WX8A 3V62A 2O6VA 4ARIA 2F0NA 5IT9L 5IODA 1WTQA 2BS2B 2KJ6A 2EMTA 3FAHA 3I4NG 2MGSA 4IJLA 1XPRA 4OX9L 4HEA1 4GN5A 4DV7Q 2CH4A 1QUQA 3HOVG 2EYJA 1GUGA 3IHPC 5H92C 4QIWE 3J80c 4JI6Q 3HOWG 1TYGB 4P1BC 3ABVB 2UWQA 2Q8IB 2V9HA 4R8NA 4IKGA 2PJHA 3CCMA 1NSNS 4US8A 1QB5D 4C1NK 4LJOB 2R6GA 4X3TA 3AEVA 1SE9A 4LF5Q 4L2YA 2KTRA 3MP9A 4IOIE 1EYDA 4KY5A 3DXJC 5J2RA 1N36Q 2VUMB 1EFID 1G2SA 2OXPA 1E8XA 4S3SA 4JVZA 2DUDA 2CWPA 2F0VA 2K14A 2LUEA 1A2UA 4A9AA 5IY0A 3P20A 4LJZC 1N32Q 1Q10A 1Q1OA 2CU1A 2DHZA 1TWHB 5AZGA 4A8XC 4IC7B 4C3HG 3DBSA 3HK0A 5IP9G 3LB8C 1H8CA 3EN2A 1EQTA 3OWFA 1KLUD 1KLGD 3AFPA 3U8ZA 1P7EA 2KCNA 2E6XA 5KRUA 1EOTA 5I6WA 2A1AA 3EFCA 1FRDA 3BS1A 4IW0A 2B2VC 3JW0X 3P1HA 3C3LA 2NVXB 1YD8U 2HDLA 1EWHA 1C7YA 2KACA 1Q90A 4DQOC 4P7IA 5HHDG 3BYTB 4NP5A 3WA0A 3DVNV 2D0OA 1LABA 3J81L 2R93G 2CWAA 5E4XA 2IHEA 1H95A 2I1KA 1LTGD 3X0WA 4RCOA 1M94A 1WXMA 5M5YB 2MRPA 4DV3L 1Q7YC 1UE5A 4DUYQ 1K9MC 3ZVVA 5FO7B 4HVBA 4M1UB 3SK5A 2ASQA 2VL6A 2KHIA 5KEEA 2VUMH 1FM0D 4A6QA 1FNWA 3IL8A 4MNOA 2K1BA 3P4RB 4DKAC 2LVQA 1R4NI 3ENEA 3CU7A 3R2IA 4JIOU 1YJ9A 3K0XA 4A3IH 4B3RL 1TS5A 2A8VA 2A19A 4A3GB 2OCEA 2LY7A 4TKNA 3T4AC 1A3VA 1NEKB 3ZJTA 1DOLA 3PS6A 1JE5A 3A8KE 4POFA 2LXCA 1H9SB 4BBNF 3U58A 2EY6A 1FIQA 2MEKA 2F0IA 3CRLC 1AZPA 4P16A 4LNNA 1UE1A 3NTIA 1NR2A 2SNMA 1QJOA 2RQXA 2LMCA 1RJTA 1XNQQ 2LJ5A 1Q8IA 1JJGA 4DK0A 1SMYD 5D65A 2I0QA 2OTLA 4IOAA 1NYQA 2AEHA 1KTKA 3D6CA 4X3UA 1QOBA 1IP9A 4BS9A 5I4DA 2CHWA 3PRPB 3SK4A 1PH3A 2GVAA 2A6HC 3S15H 1PDXA 4WJNA 1TKWB 4YSZB 5CV4A 3CXCA 1B9NA 4FXGC 4NB3A 4MGKE 3HOXG 3U2SC 4F7ZA 1V5TA 4A3EB 4ARCA 1IYUA 2GBJA 3TP7A 2N7DA 4ANXA 4A3EH 3CCUA 2JE6I 2WXMA 3MJ5A 4B95A 1CQVA 3Q24A 3UQAA 1WOCA 1EWYC 1TWAB 2LXKA 4RCNA 3AXCA 4H7BA 1XLNA 1VQFA 3J80i 4EZJA 5C44G 4AJWA 1HR0W 3QAQA 5CHFA 2LGYA 1CTMA 3J81i 3ZYYX 3QHTA 2IW3A 4OO1G 1BMLC 4V0BA 2LGIA 3CAMA 2RR9A 3G6JB 1VQ8A 1GXDC 1HZAA 3NY5A 3M3YH 4OVUA 1GG3A 4GKKL 1RFAA 5TSSA 3JAMi 2AL3A 2REXA 3RN2A 1GUAB 4CJ1B 2YEPB 3Q8AA 3VVWB 1FMAD 1VQ7A 2M1MA 3HEJA 1IXRA 2Z6BA 1PFDA 4KGRA 1LLRD 1PH1A 4JI4Q 4UPAA 2XNAC 3NBHA 4FXDA 4DR2L 3MTNB 2KO3A 1VRAB 4ABNA 2RDGA 2LFIA 2ZEQA 3V60A 1RYJA 3I72A 1YEZA 2FFKB 4MH0E 3ZTCA 3LWEA 3TS0A 1CI3M 3Q8BA 5HFYA 1GNUA 3WOFA 3AFQA 2WINB 2PIAA 2NYZD 4YCWA 2QC8A 3IBEA 2KWCA 2ZTDA 4WWPA 2WXOA 4OHJA 2NVTH 2G4SA 3CW2C 4XYCA 5D94A 2HHHL 1UE7A 2K6DB 5G5HA 4YCVA 5C3EB 4DHZE 1AE2A 3PVLA 5MPOA 1SN8A 4HN7A 4OIKA 1RTOA 3EECA 1QQRA 2K0PA 2JA8B 3AQQA 4FXCA 3TEZA 3J7AF 4WJ3M 1C78A 1NR4A 4FXKC 4L5TA 1L6VA 3Q8FA 1ZDVA 1Q8KA 3KOJA 2A5HA 4OWWB 3M4OH 3PREA 2Z0DB 1XMQL 1GUWA 3S17B 1ZKOA 2HE7A 3J81c 2KOLA 2KWDA 2JA5H 2AYOB 4FJZA 5FKAC 4HEDA 3FRPB 1R4MB 4LF5L 3I8ZA 2QA4A 2JA6H 4LNFA 2O5IC 4DR3Q 4RWSC 3AEEB 4C7YA 4Y52H 3DWGC 3EFUA 1VQCA 2KEEA 1LT6D 1VZ6A 5EPJA 3X3NA 4HIMA 3PGEA 1L6UA 3NS8A 3A5ZB 5K36G 1ENCA 2L55A 4MIUA 4KV6A 3CKIB 1IBKL 4HPLB 1P9DU 1IBKQ 4BOSC 2CKHB 1T0YA 3AE8B 3VHTC 5JHAA 2F0PA 3MWYW 3IRBA 3PLVA 5M5XB 4LJPB 1E8WA 3MHBA 3RZOB 3PV1A 3HOZH 1Y8RC 1K0SA 2D3GA 4WURA 2L12A 3NS1A 3M95A 1D7QA 4LF7Q 4QF4A 2UUBQ 1TT5B 4K7SA 4W9CA 3AULA 3GTPB 2MPMA 4DXAB 1CZPA 1DGJA 2G4DB 2LZ6A 4RGNA 4LNKA 1EOVA 1N60A 1D5MC 1SBBB 3SHLA 3PF5A 1JRPA 4ZRQA 1QF6A 4ZUIA 1J5EQ 1YJIA 3FKIH 2WXJA 4KZ0A 3AE3B 1VS0A 2G9HD 4HCNB 2Z6KC 1AWDA 3PLUA 4CGYB 3K5MA 1OQQA 3F2BA 1HUMA 2FINB 1UUPA 1VQLA 1E8YA 3Q3JA 1PFBA 1STGA 4RHSA 2F3VA 4C2MB 3CCEA 4GN4B 2F0UA 3DWAA 5C6AA 2L9HA 3CQZB 5J1ZA 4C4VA 3VUXA 2IX3A 1A3TA 2UXDQ 4YT0B 3T1HL 4H0LC 4XT3B 1SROA 1KOTA 3P63A 3MC0B 4GIVA 3QA8A 3H1UA 4DFAA 4HJGE 2WNMA 2M56B 5IOCA 4XWWA 3LJ3A 3WDNA 3CF5A 4ICUA 1QG7A 1VQBA 2M2LA 1STBA 3FVQA 2MP2A 4LNQA 3JYUA 2CQAA 1FXAA 5HG2A 2XRSD 2Z8LA 2BPSA 3UE1A 2BT6A 5IGFA 4LFAQ 3ML8A 1MI0A 3ULLA 3SGIA 2MBOA 2CKZB 4DAMA 3DQVA 3Q2AC 2YLMA 3K7AB 1OXSC 1TY2A 2GVBA 2MP2B 2OEOA 1JT8A 4CDEC 2H88B 3N1XC 4W9IA 2MO1A 3VH4B 4FLHA 4ZKBB 1HR0L 1HHVA 1FD6A 3KF6A 2BF8B 1UEAB 1L1OC 2ZCBA 2PKOA 4IFDI 1R4QB 2LI5A 3AMZA 1Q1BA 4MTNA 1KF6B 2J0TD 2VQEL 4HKZE 3J80E 4HK2A 3R2TA 5EPLA 5JH5C 4PMCA 4C4VB 1WM3A 3AYHB 3I63C 5CV9A 1DD2A 3CQZH 3W5VB 1IBXB 2O6VB 4XXEA 3A7LA 1MFWA 4DU9A 1A5RA 2B39A 3BDCA 5IP4D 3M4PA 1WJ4A 5CV8A 2AQ3B 2E5LQ 1TR5A 4EQOA 1GUOA 4CHTB 4MM3A 2E2DC 1UE6A 1F2RC 1GUSA 1QZHA 3B2FA 3KYHC 3UGBB 2DJGC 3T1YQ 1AE3A 2J0MA 4IPHA 4MACA 4A3BG 2R93H 1J19A 5EE1A 2CQOA 1N34Q 1VQEA 3U9OA 4WJWA 3Q6BA 4WORA 4ID6A 2N9XA 4M8MA 4A3IB 1S5DD 2K5WA 1C3TA 4YTPB 4OVZA 1YN4A 3Q23A 2HUGA 2WYQA 5FJ8H 5BMIA 4LF6Q 1HFGA 1J6QA 3VXWA 1YJWA 1FNVA 3QIJA 4GLAC 1T5EA 2GN5A 1OQRA 4IPCA 1L1OA 4YWKA 5IWAL 3TS2A 3NBHB 4LUVA 4L5QA 3IKJA 1RAXA 1KDBA 2E2JH 1MGSA 2KJXA 1LT5D 2WWZA 2WV6D 2GI9A 3AE2B 3UINB 1IZ6A 2MO0A 4GZYC 4QUCA 4L5SA 1L0WA 4HJ8A 4JI7Q 5FLXc 3HKZE 3TZDA 3R66C 3L7ZC 4Q0FA 1V5OA 4FA6A 2IGGA 2KHWB 1KDAA 3HKSA 2C5LC 1L5PA 2JVCA 1FVIA 3EQLC 2Q2HA 2L11A 1PTOF 3E9HA 3P4PB 4B3TL 2HTHA 2LVOA 1Y8NB 1HQMC 1R4PB 4B3ML 4QL5A 4JWUC 4S17A 1R9TH 1OXXK 3W3AA 4W9GA 3FHWA 3Q8CA 2FBWB 1NE3A 3UI2A 2R2QA 2CH4W 1E7VA 2F0GA 3DEPA 5L37A 4DGZA 1AARA 2KNBA 2KD0A 1EY8A 1PVOA 3RZWC 5KHQA 3U9SA 1E24A 2KDIA 1EF5A 3HOYB 3B1LX 3KYDD 1ESFA 3NVYA 3VUWA 3MC9A 4DR6Q 4HAEA 1WE7A 3KQ4A 4HDOA 2AUKA 2J7ZA 2NN6I 4Y7NH 3SU8X 1VZ8A 4KIKB 1F2MA 4B3SQ 1PRTF 1Q82C 5AZHA 4UAIA 4QUFA 2L1BA 3ULJA 5C3JB 2MH7A 3IVFA 2KHSA 1K8MA 4KI0A 3A8JE 4JI4L 3MFYA 3I56A 2EKIA 4IDIA 3TP8A 3DBRB 2NZHA 3T51B 1BOSA 1MJCA 2KN5A 2FCSA 2L8JA 4K2LA 1GD7A 4IALA 4A3JH 3MVVA 3E5SA 4GS3A 3NWTA 1B50A 4BA1I 2GA4B 1RF2D 2NPTA 1S4ZA 3KLWA 3OG5A 1Q3LA 1VZ7A 1TKYA 1PH9A 4JI3Q 1E9MA 5D7GA 2JK8A 5ISRA 3HZXA 3NJTA 1HFNA 4HDQA 2O2VA 3FILA 1YJNA 2CCZA 2E2IH 2EPBA 2K05A 1CA6A 1V8QA 4G11A 4K2KA 1HNWQ 3PF4A 4XYOA 4G7HC 2PE6B 3QK0A 2HT1A 1IKLA 1ET9A 3SDLC 2Z0EB 1C79A 2M00A 4P2CB 5BMHA 1IYVA 5C4XG 4XDCA 1VQGA 4RH6A 4URKA 2F3WA 5AZFA 1JROA 3LGJA 4WJPA 3PZDA 4XGAB 1L4DB 3BVMA 2H1EA 2JSVX 5CORA 4ZRIA 3UE0A 3LNNA 3ZDTA 2INPE 4G0NB 1B7YB 3TIXA 4HMJA 3ND8A 5ELOA 1D1IA 1WR6E 1XJVA 5C0XJ 1SLJA 2V4LA 3MZ5A 2A74C 1EEFD 3CC4A 3H15A 4XC2A 5TR5A 4ME3A 2ZJRA 1V80A 4LTUA 4ZAIA 1T3QA 3AECB 3GTJH 3GTLB 3DBLI 1N36L 4CO7A 4TV3A 1SYCA 1CSPA 5M5XH 2QEXA 3A0JA 3TREA 5M5WH 1E2VA 1N62A 1FXTB 1OEYA 4IUTA 2L32A 2C5CA 3U50C 1RFKA 4LF4L 2A6HD 1DYQA 3E9IA 3L17A 5LXIB 3PCOB 2K28A 4DNIA 5KNCA 5JJLA 3PUVA 4P71A 3TEWA 2KCTA 1KNEA 5KNBA 3CMEA 1WGGA 3NPPA 4ZCKA 1Y1VG 2KENA 4IM0A 4C1NI 3S9WA 3PV0A 1VQHA 3K9PB 1F0ZA 2EXDA 3H6MA 2MBQA 1DONA 3OIPA 2JRHA 3PQIA 5D14A 5FO8B 3N1ZC 1CQFA 1H9RA 3MA2B 3RN5A 2V1CC 3K8AA 3NHHA 3TDQA 2QIEB 3N9YC 1QUQB 3HKZB 4N59A 3BZCA 5IA7A 4LF6L 2DY7A 4OGQC 1WJ6A 4JWSC 5DM73 1S5BD 2ZW0A 4JI5Q 2C7HA 3PT2B 4OVVA 3PHWB 1DZ1A 1EWCA 2OJWA 3UQBA 2WXGA 5C44B 3I4LA 1RKNA 3NQIA 4K5XA 3MC8A 3H09A 3BG3A 2BYVE 4HSPA 4WFN3 2RSNA 1PH4A 1ZDXA 2HTME 4C00A 1G6PA 1PRTC 4KDLB 2JT4B 4ALPA 3S2HB 1E10A 1I4GA 5IYCH 4JBKA 1I4PA 3E0EA 2OF1A 1AFPA 4KY6A 1F2RI 2B3GA 2KK8A 3GTMB 4RNAA 2NVXH 2C7NB 1XNRL 2JYEA 2GMIC 3VDZA 2EIFA 1NCVA 2F52A 5BR8Q 1IBLQ 2K5VA 2J0KA 1WJUA 2DYOA 4RM8A 1BBXC 3BK1A 1Z9FA 2AKWB 3TEYA 2RPVA 2MQJA 1O80A 1J5EL 1LXDA 1WTWA 5IP7H 3VA5A 2B2TA 5C0XH 1R7SA 1XF5L 4R9WA 4A3FG 2OWOA 1CKMA 3KH0A 2K8HA 1V2YA 3UDFA 2RD0A 1GO3E 3DWPA 3NP8A 1BCPC 4P1CC 3V3XA 1E1TA 4GGQA 5CR3A 3OMCA 1HUNA 1BXTA 1O78A 2CHZA 3GQBA 3HP3A 1HNXL 4W9DA 5E6OA 2YV5A 1FYCA 1WVLA 4TMAB 2R2OA 3Q3OC 2RF4A 3HOVH 3AE5B 2KFKB 1XCQL 2PEAA 2ZT9C 1J8IA 3NOBA 2G3QB 3CCSA 5FK9C 2PPBC 5EKLA 4F87A 2J7QB 2K01A 2ZNVC 5ELFA 4DUZQ 1SSOA 1JWMD 4LF9Q 4WJ4A 2HD3A 1WTPA 1H4RA 2KLGA 4GLVB 1QVFA 2XWBB 4PYZA 2MA9B 4R1JA 2Y5BB 2RGFA 3VR6A 2RPQA 4PS7A 3RUZA 2PW9A 4QJFA 5A2QL 2BA0A 3K5OA 3T56B 2JA7B 1QOAA 3DWMA 1EQRA 2BBCA 4XT1B 4KZCA 4A3KG 2R92H 1F9PA 2JSOA 4WWOA 2NVYH 3KF8A 3CCRA 3QIAA 1E7PB 2BWFA 1BVSA 3A33B 4AS1A 3HRDD 5KGUA 2QCPX 1C48A 4IPDA 3RNBC 2KFJA 2LHDA 4JX1C 1S5FD 4O2DA 1QOFA 1CKNB 2Y0SG 2F0SA 1VQMA 1L0XB 1I4RA 1K0RA 2QDBA 3C1EA 4OIJA 5IYBG 1HTLD 3W1GA 1IL2A 1C4CA 1SB3C 2FUG1 1YZ6A 1V9JA 2KCMA 4GOPB 2LD9A 1XLOA 2IGHA 4OZBA 3H7PB 3VR8B 5L83A 2GLSA 5IKCM 4JL9A 3S24A 3W2DA 5D3IB 1Q86C 2JZ3B 4HPPA 1ZYRD 4DK1A 2B2YC 2UUAQ 1P8LA 5DLQE 4P6VF 2OOBB 4M8AA 5BO4B 3OYYA 1EUVB 1MVKA 2KTFA 3Q69A 1Y8OB 4YHHL 1KABA 3DLLA 3M9BA 3H8HA 3CCLA 2VUMG 3SVMA 1JMLA 2ZJDA 2B29A 3WOEA 3S1MB 4A76A 3DVNU 3VRBB 3GTGH 2JEAI 1QILA 2KVMA 5KIXA 4NPSA 1SJED 4L8JA 4PMBA 4TSSA 1UWXA 3CC2A 3J9CA 1SE3A 4KKUA 1WYGA 1B44D 1X3FA 1B70B 2KQ4X 3OLMD 4ANWA 5M5YH 5LMUL 1G2TA 3RI7C 3RT3B 2QILA 1N9WA 1JW9D 4FN2A 2KANA 3GTOB 2R7DA 3QCAA 3A4RA 3GTQH 3ZLZA 4F8CB 2BYTA 4B0MA 1UGMA 2D62A 1ASYA 4YWGG 5ELNA 1XLPA 3Q3FA 1PFSA 2IX0A 5IP9H 2ZVOA 2IL8A 3AH7A 5FO9B 1A63A 4IUQA 1TWGB 1AZQA 2BCOA 4FDBA 5IYBH 4S0RA 4X3SA 1SYFA 4LK0M 4NQKE 2VB3X 4EZKA 1C1YB 3GTQB 3E3XA 1II3A 3A4SC 3B9JA 4JGHB 2HDMA 4HSVA 4DAYA 3S2HH 1V49A 3A9KA 3K6OA 3WAMA 4JI5L 3H9DA 1WTVA 3N6RA 5FOBB 1VQNA 4A3MG 5I6YA 4D2KA 1XMQQ 3S2DB 3MXNA 2KQSA 1WJJA 2J0JA 2D11A 2WAQB 2N49A 4OWXB 1S3OA 1HNZQ 2KDFB 1N8RC 3EJIA 4L6TB 1C77A 4C3JB 4C3JG 2LRWA 2UUCQ 3GD7A 2WAQG 2UUCL 2AQ1B 3STBC 4A3FH 3DDCB 1K8GA 1UELA 1EZ6A 3TMEA 1H9MA 2XK5A 3H6NA 2DZIA 1BKBA 5LXHA 2WIIB 1SFOH 3S17H 1NVID 2MW5A 2MUYA 2SEBD 2PTLA 5DAUA 4AH6A 2EZVA 1LTLA 1YQBA 2BYEA 3GB1A 4JV5L 1YNJD 4N9F4 1W6JA 4DR5L 4C80A 2KQ3A 3J7YW 3QO2A 3L3OC 3AE4B 3NZ3A 3CIRB 3JAMc 4RF0A 1TBEA 2RDBC 4EUTA 1I3QH 1B3AA 4ZQ3A 4X62Q 1OXVA 3D0FA 3MEHA 2KEDA 3T13A 5IT9c 2DENB 2NR2A 2WXLA 1H9JA 1KFYB 4OONA 4LUZA 1C4PA 1L0YB 5EAYA 2UXCL 1J9OA 1E7ZA 3A9JB 4M01A 4ZYNA 2UXDL 4OZCA 2KAJA 2LJIA 2DNEA 3U4ZA 4JI1L 3HM6X 2W54A 1Y8PB 3MHZA 2IY1B 4USAA 4BKSD 2ES2A 3SEBA 1D3ZA 4G7OC 3L0WB 2K6QA 1SYBA 1E1OA 1GC7A 1RLFA 2VY3A 1OXUA 1NBFC 4N9PA 2IBIB 2KDEB 1OEYJ 1X1MA 3AEDB 3ZNGC 4OL7A 4R8IA 1RHPA 1WF9A 1AN8A 3AI5A 1DCZA 1VCIA 1VF5C 1YHBA 3RD4A 2BH2A 4KDIC 4EKUA 2EVBA 2Y0SE 2N78A 3FPUB 4FNFA 4KKTA 2UU7A 4AOFA 1B9RA 4W9EA 4E3CA 4C3HH 3PO3G 2BS4B 5LNK1 4KMUC 3PGZA 4MJSA 4EQPA 4DK5A 4JC0A 4NY0A 2B8GA 1JJCB 3VTWA 3N52A 1JRUA 1WGKA 1TWFH 3HOWB 2K32A 4RGTA 2IO1B 1PMRA 1JOQA 3VYUA 1LYLA 4BFRA 2WXIA 3U4EG 3VTUA 4A3JB 3HVDA 4EGVA 1ZXIA 1DM0B 3LX0A 4LFAL 1MI2A 4OZAA 4LLGM 3RCZA 4A3KH 2R92G 1JQYD 2BE5D 4N9TA 5HI1A 2ZM6Q 4EVOA 1LACA 2K39A 1VD2A 3AU5A 3S15B 3ZQ4A 3NRZA 4LF8L 1IYJB 1LM8B 1TIID 3AB5A 5LLIA 3FC4A 3PTFC 5J22A 2LMCB 4QY7A 2I2YA 2K3UA 3VYRA 1Y1WB 1YNNC 2CW0D 2K8BA 5D6JB 3I4MG 3J81j 4A3PA 5EJWA 5GQOA 1X9NA 1TS3A 2B63H 2INDC 1XEEA 3Q6SA 2M0XA 1FFUA 4DWFA 4JBJA 1TZ1A 3RYTA 1TS4A 2K04A 2N7EA 3M7GA 2B8FA 2M17A 2FXQA 3KW5B 1JC7A 4OELB 4LDTD 1FXIA 1NMGA 1WWTA 1CT1D 3CWIA 3STBD 2EDGA 1YQ3B 1OTRB 5GMVA 1D1KA 1R9TB 2N9EB 1DJRD 4XDXA 1V86A 4ZYSA 4A3FB 5BYQA 2Z9HA 5CBAE 2WQYB 4AYBB 3OW2A 4MGZE 1JWAD 1WCMB 1I4QA 1OFFA 4CKCA 2JN4A 1KLVA 2WACA 4BBRB 4WQOB 3KUPA 2YVCA 3AU4A 3H94A 3URYA 3S1RB 2NVQB 4XZ4A 3GP7A 2IWHA 2XEWA 4AYBG 3T53B 5BR8L 1PHJA 1N61A 1CKOA 4JQWC 3B08A 2NBWB 4DAVA 1SR3A 2YYZA 4BKTA 1HZCA 5IYCG 3CC7A 1KJTA 5CX3A 3T3NA 2IT1A 5EDSA 1E3PA 1EYAA 1C76A 5GROA 2MQHA 3R8BA 1J7BA 3IAS1 4POGA 4II2B 1JWSD 3WCQA 4EFOA 3IG3A 2BOSA 5EBDA 2EXZA 2KHJA 4NJCA 1JE4A 3VR5A 3EHVA 3RMKC 1STEA 1TY0A 4C56C 3GE3C 1C8CA 4XIGS 4IUVA 5E7NA 1QKZA 2BGFA 1WXSA 5FLXL 5CHVC 5FLMH 2B3AA 1Y69U 5G3LD 4F88A 4A90A 2WKCA 2SOBA 3RZDB 5JVH3 4DR5Q 2N8NA 5FLMG 2HD5B 3OMGA 1EM7A 1IGDA 5BMGA 4US9A 5C4JB 3SE0A 5DPWA 1HJPA 4BAXA 1ZW7A 4OO1I 1HH2P 1WH3A 4HIKA 4MSMB 5EQ0A 4JI2L 4YY3L 2Q5WD 3M3JA 1ENAA 3S1MH 4FULA 4B6WA 3NVWA 1LTAD 1G91A 5BN3A 3NELA 2FHTA 1SNPA 2L83A 3RZFA 5J17A 2UXBQ 3W5UB 1ZE3D 3PUWA 4LFCQ 3GTKB 4IWOA 3ZO5B 1LGRA 2ZXOA 4LWCA 4F8MA 5EKKA 3PO3B 2BB5A 4RF1A 2DAJA 2MJDA 5ELDA 2LSSA 3OSOA 3PIPA 2F0MA 3ZGZA 2PMZB 5C3XA 4A3IG 1HZ6A 2M8SA 2PE9A 2K9XA 2X6GA 3W1SA 3ZRCA 2DYMA 2Y5CA 1SYEA 1WRIA 3ZXRA 2ZXRA 2AWTA 4A3BB 1ROEA 4NKLA 1GOZA 1C4QA 2GBNA 2WDTB 2X8XX 2PNRC 4U68A 3D32A 5IAAC 1ZOYB 2NN6G 4CDCC 2JRIB 1T0SC 4REZA 3IFTA 3WAPA 1MHHE 2MJ8A 1I3QB 1C4AA 3R3MA 4NMZA 2WB1E 3KLSA 3H91A 5JJZA 1L0VB 1A15A 5C4XH 1A70A 3A1QA 3I70A 5GADC 1CMXB 3RR5A 5G2NA 4TQ0A 1W3SA 1CM9A 5K5PA 3QOLA 4ANVA 3OIQA 1MJEA 2ACZB 3AV8A 4RAUC 5NUCA 1I4XA 1SYGA 1PH8A 2F0WA 1NI3A 3NK9A 1Z2MA 1OQYA 1GB4A 5EGTA 4QAYA 4C2MH 4LF4Q 2PMZE 1E5WA 1YNTE 3HUIA 3AEGB 5DPTA 2BH8A 2EJMA 2CU3A 1IW7D 2LVPA 3CCQA 4A4IA 3ITPA 4XYQA 4DV6Q 1I42A 3M62B 4M00A 1X54A 2JA6G 1HEZE 3LXFA 1I50B 2N9PC 1PXUA 4IUPA 2KYWA 1S72A 1X3PA 1PZJD 3GE8C 4KJNA 3P42A 5I9OA 4ICVA 4DR2Q 3J7AV 5J39A 4FF3A 1FNUA 1WCMG 2K7VA 3H0GH 4KN7C 3JAML 1E6EB 2FCQA 1K83H 3TL5A 4KHPL 3RFZB 4RMAA 3P4SB 2JA9A 2D3AA 2VQFL 3HRZC 4KK7A 2KJHB 4K1RB 4DV1Q 1TT2A 2VH2A 1TWGH 3V05A 3IT6B 5E6PA 1Q46A 4G3XB 2JQOA 1BUVT 1LTSD 4EQNA 4DV0Q 4GKJQ 1J8CA 3DVGX 2BKFA 4B0EA 4BBSG 4V190 4U673 3G6EA 2O2LD 3S16H 1SSNA 2DZJA 4GXBA 1I35A 4RM9A 2JWUA 5C3EG 3QARA 1BNZA 2F0HA 1TWCB 1HZ5A 4DPGA 4GNXA 1HXYD 1JWUD 2D2CC 1STAA 2CVRA 3GV3A 4IURA 1S3SG 1Y56A 5M3FG 4HROA 5C5LA 4EQ5A 4E71A 1UF0A 1YQ4B 2PCFB 4PV1C 2NVQH 4ZLTF 3RNUA 4B3RQ 1IW7C 5CV5A 2KX0A 3AM9A 2JF5A 2C35B 3ZTDA 1STHA 1E2WA 1WCMH 2L5TA 3H0GG 3K57A 3C2PA 2E3TA 4B3TQ 1PTOD 3D8GA 2R7ZH 3PO2B 4K3CA 2PQAA 5IIFA 2M4NA 4IG7B 2Q8RE 1TKGA 1EO6A 1EY0A 3K59A 3AE6B 3QC8B 2F4IA 5CHWA 3ZJVA 2OJRA 3CPFA 1D2BA 1CUKA 2FIFA 1NJIC 1QZGA 4O42A 4X66L 1VQ9A 3OAWA 3VTVA 1KHIA 1FCCC 3M4QA 3SFEB 2QHOA 2GBMA 1EIYB 3ZNZB 2KWUB 1GJZA 2MX2A 4FVMA 4QB4A 2A4ZA 2I07B 3JSVB 1P16A 3HGBA 1TU2B 1FL0A 1WTHA 5EPKA 4K7WA 4IO9A 1K52A 3VR4A 3BIID 2QGQA 2CHBD 2ICIA 5C3WA 1WXVA 2RMMA 4EEWA 5C3EH 1BCPF 1VQOA 1DOIA 2CS4A 1LM0A 2M9VA 1WD0A 4GDKA 1EU4A 3KJOA 3ZNHB 4GNXB 4A3BH 2DJFC 5JXVA 5IN7A 4YIJA 2PMVA 4GOPC 1WTXA 1K3BC 1EYGA 4DNTB 3I2ZA 1ZEQX 2CFMA 1WFQA 5IE8A 5E4WC 2LGDA 3BINA 1BCPD 1CA5A 2A6ED 1KAAA 2NVUI 2L52A 2JA7H 1IPGA 5IGCA 1F52A 4FBJB 2KJRA 3LWUA 3N20C 1VQPA 2JA5G 2Y0SB 3OJ4B 2ZJQA 1TWFB 2WXFA 1U4LA 3HOUB 1YIJA 2QW7A 4W9JA 2ZM6L 2Z4IA 1SE8A 4I65A 1V1PB 3L54A 1FD7D 3SR1A 2PI2A 4GLXA 3ERQA 3C8YA 5K36H 1PYWD 5CBEE 2XRQD 2VNUD 4GSWA 2ON8A 4GDLA 3NTHA 4R4IA 3CF6E 1PYSB 2NBUA 2LXAA 4X64L 4RFBA 4K0KQ 4M0WA 4A3GG 1CZGA 5FLXE 2E2IB 3MXPA 2RDHA 3QWNA 3ND9A 5IGDA 1I4HA 2A73B 5JEAH 1M1KC 3KWLA 4ZUJA 2EY5A 2EYHA 3T1HQ 1ZKHA 2PW7A 1GC6A 5F2DA 4DA2A 1JJ2A 1FJGQ 2ZZPB 1GAQB 2Z4HA 1FJGL 2WHIA 3L4PA 2KMAA 2DZMA 4XE0A 4H44C 2IYDB 4G4KA 4IWPA 1WX9A 4CHKA 3F1ZA 1J7AA 1VQAA 5DEHA 4MHEA 2WGSA 5E6JA 3UIPB 3RNEC 1UBIA 5FR3A 3T8MA 3S1NB 4J3OD 1V81A 2FCNA 1TTNA 3DUZA 2VXWA 1W6KA 2AHOB 1EFWA 1NUCA 4F7XA 4DV7L 1TXYA 3JC66 5CMDA 1P0RA 4JYAL 1UWMA 2WDQB 1QNKA 4KSKC 4L23A 4DR4L 1JALA 4WWNA 1ESRA 1E90A 1KRHA 4BZAA 2JU6X 1PUTA 3VR3A 1BDOA 3KJPA 1VQ6A 2OQ0A 3ZJYC 4NXNQ 4JI0Q 2N1WA 3PUXA 3W1SC 2ZVNA 4DK3C 2WKDA 3FKIG 4RHRA 1XLQA 4LNOA 4MGYE 2E2HB 1TWCH 3B2GA 1PFNA 1GKHA 1EEID 2INCC 2O4XA 4BKGA 2BTEA 4FYDA 4BXXG 1DXMA 5IGEA 2FUHB 2N9KA 5DM63 2N1VA 3L10B 2R7ZG 3K7UC 1DOMA 4A3EG 4OWTB 1UEBA 3S1QH 3Q3MC 1IYFA 1OXTA 2WP9B 2XN9C 1SNCA 3W1YA 3SFDB 2WXRA 1PYBA 1X32A 2KN4A 2RA4A 4LFBQ 2JUOA 4LFBL 3FDTA 4B3MQ 1EQQA 2JA8H 1XO3A 2KC2A 1E2ZA 2K22A 1B9MA 2ZXPA 2B63B 1ZPSA 3C19A 4K5VA 1SGHA 2R61A 1Q0WB 3G71A 3O65B 4XWTA 3DOWA 4M0WB 3CD6A 2X38A 4YY3Q 4K6DA 2ZNVB 1A3UA 2YTVA 5JHBA 5ELBA 1I50H 4AQYL 2MSED 3NWSA 4J1MA 4LCDE 3ZDMC 2ONQA 4I6PA 5BN5A 3I4MH 1WGRA 3WIMA 5D2MB 2ZJPA 3PO2G 3PIP3 1G6JA 3IT4B 2KDMA 1GB1A 1YN5A 2RSUA 3PUZA 4DV3Q 5IWAQ 1X65A 1YVCA 1ML0D 4DXFA 4BY1H 2KC1A 3L0OA 1GM5A 1XPUA 2QKIC 1YJJA 2FCMA 3KUDB 4ZOHC 1GUNA 4ODGA 3PO0A 1XX8A 4FJYA 3P7JA 4KKJA 3N30A 2SAKA 1PH5A 3WWVA 4RMFA 2VZKD 4TQUS 2EE1A 3A5UA 2MBBB 4HCPB 3S14H 2QDFA 3ZW3A 2LKVA 2SNSA 3TRZA 2L0CA 2KWVB 3NUCA 3KFUA 2RSOA 2ICEC 1L2FA 2XGTA 4G7ZC 1CHQD 4A93B 2F3IA 4K81A 2HQLA 4EE2A 1IL8A 2PO4A 3WALA 2IO2B 2KQ7A 1VQKA 2F0JA 2VB2X 4IOCA 1W2BA 2L1AA 3IFWB 1SAPA 2K5QA 2FMCA 4UDUC 1PH7A 4M8NA 1HA5A 4KX6B 4MN3A 2IX1A 3AE7B 1WXAA 1B8AA 5C4XB 3ZUNA 2BB6A 4AYBE 3U30A 1EUJA 4KGSA 3F2DA 1NI2A 1EY7A 2A68D 2F0OA 4JI8L 4DV6L 4H02A 4PG3A 5DPRA 2PQAB 2G1EA 3KWVA 4DHJD 4LW1A 4YL8A 3RULA 4PMWA 3APCA 1M8AA 2Q2IA 3A9JA 1Y14B 1CFMA 3SXHA 1IHZA 2VQEQ 2KZRA 5C5MA 4JG2A 3QQ8B 1D8LA 2O5JC 3U52E 4FP5D 5CTRC 1Q1EA 3Q8DA 4JI2Q 3UDIA 4WJOA 2I5LX 2NB0A 4QGUA 1U4AA 2WXHA 2MCNB 4A3CG 3DBHI 1VF7A 3VYSA 3HOYH 4A3DH 1WTOA 1JWBD 1NBWA 1M4VA 1S5CD 1UWVA 3I3CA 1PH2A 3HM3A 1IGCA 4MTKA 2H5XA 2QMTA 4HWIB 3GOEA 4CJ2C 5I2YA 1KAWA 1SE4A 2K03A 3TP6A 3AEFB 5KNDA 4YTNB 1WMHA 3BZKA 4BY1B 4ZRJA 5CC4A 1Q12A 4IUMB 5EE3A 4PK1A 4LF8Q 3DHGC 3C1FA 2F0KA 2SDFA 1VQJA 4JBWA 3TMPB 3PO2H 2R7ZB 4MJSB 4N8X1 2EYOA 3EIVA 1VJKA 3K81C 1VDZA 4X57B 3FKIB 2KBNA 3SHQA 3P4QB 1PRTB 1YITA 3RZDH 1T6BX 1UD7A 3QOJA 2CHXA 2UUAL 4DHJB 2I38A 3CRKC 3MXNB 4JI6L 2WXNA 4GKJL 3WANA 1VCBA 2G45B 3FEWX 2BDOA 3A7AB 1VQ4A 3I9V1 4CQNA 2YU9B 2PVOD 3OTOQ 3S16B 2J52A 1AW7A 2G5DA 2ZTEA 4HKQA 1K3RA 3PRMB 3NENA 2BVCA 4BBSB 2CJNA 3HOZB 3PRZA 3RZOH 1F2YA 3W5OA 3R3OA 2NBFA 5JJKA 4MDKE 2WX0A 2A69C 2JEBI 2X69A 4HIDA 1KIXA 3E56A 3VH3B 2JXXA 2W55A 5IO9A 1PZKD 4W9FA 2DZKA 3A1QB 3BZDB 4DV5Q 4FJVB 3J80L 2HJ1A 3DBRI 2HQEA 2LUMA 4X3KA 1G291 4NZLB 1FGUA 3CPWA 4BBRH 3Q0AA 5M3FB 4A3DG 1E8ZA 3DBLB 4QIWB 4MH8A 4TVAB 4R4TA 1G51A 2WLBA 3S1QB 2JA6B 1RCVD 1QNUA 5EE9A 2JX5A 2FJ2A 1N63A 4B9KA 1UAPA 4CKBA 4KN4C 4DV1L 3F2UA 2D2QA 3LDZE 2KX3A 1I6HB 3VDYA 2WDRB 4ITKA 3FKYA 4DHZB 1RM6C 1YNJC 4I7ZC 1RRBA 4FHJA 4GB9A 4LNIA 4NW2A 4M02A 4B3SL 1SNQA 3I7FA 4BWGB 4K7UA 4A3MH 1I5FA 4ASWC 2X6LA 2BW2A 1WFYA 4W9LA 2IY0B 1WGHA 2N9LA 3F8TA 1U5KA 2OT2A 3M7NA 2R7FA 1K50A 1O7IA 4KD4A 4AIMA 1S5ED 2WXQA 2ZCCA 2F0TA 2GB1A 1XNRQ 1TIFA 4C3HB 2UXBL 1ICFB 1EY6A 1LTRD 4LFCL 3K5LA 4AWJA 3S1NH 3P1MA 2BQQA 2K52A 1VR9A 4HRSA 1X6OA 3M4YA 2RCFA 4DNRB 3TUOA 3CSTA 1WMHB 5EKIA 5LMNQ 1C9OA 3VA7A 4QQBX 3BY4B 4E6IA 1OTCA 4R4CA 3MJWA 1NDDA 3PMFA 1HNWL 1WI5A 5GAGC 2VRRB 3AEBB 5J3BA 4XDDA 4PZ8A 1UNSA 4XX5A 1V97A 5C4HA 4CKEA 1A8VA 4HJ7A 1HZBA 3APFA 2DNCA 3BVGA 1ZGUB 3DHHC 3N3KB 5G5GA 3HOVB 4WIPA 3FP9A 3ALBA 1GPXA 2XBBC 1ASZA 1BF4A 4QCLA 3BDOA 1JOKA 2N55A 1ICWA 4RG1A 5C4JH 3H3VC 4DXGA 4AJYB 1B4OA 5C2TB 2W9NA 2RDFA 2NWGA 5IGBA 3J7ZC 4P74A 3SK8A 4DN4M 2MJEA 3NVVA 1CSQA 3U7DA 1H9KA 4KY7A 2QEJC 1EIFA 3AN1A 3G7LA 4NXNL 1P98A 1Z6HA 2LGXA 2K5HA 3ZIMA 1FEHA 1KRSA 1UBQA 1MBYA 1F77A 1QLBB 4ANUA 2B2VA 1YNXA 2K50A 1J0GA 2ALYB 1Z5SB 1FR3A 4J15A 4IUUA 5ELEA 4L5RC 3TZUA 4J6IA 5C0XG 4NJ7A 4YXDB 1C9FA 5KYIA 4HJAA 4MZ9A 2MLBA 1PRTD 3BU2A 1SMYC 5A35A 5IP7G 1N6ZA 1TS2A 1ZYRC 4IUNA 2Z0SA 2JZPA 2K75A 4DR7Q 1SF0A 1TZOA 3K9OB 3G4SA 1ACCA 2AX5A 2E8GA 1WX7A 4RGOS 3KDFA 1XT9B 2RBMA 2F4VL 1EIHA 3TEXA 4RA8A 2K25A 1N34L 1V6EA 2BA1A 2VQFQ 1OGWA 4PQXA 1SYDA 2KMCA 2V3NA 3VR9B 4KHPQ 5C44H 4RGMA 3V6CB 1X3QA 2D5DA 3NBIA 1T0QC 2L3ZA 4DV2L 5E1FA 1VQIA 2GBRA 3IFDA 2IO3B 2M0AA 3I3TB 5HGTA 4PS8A 3T9LA 5I2XA 4BBNC 2QCZA 4K8JA 5BYSA 3E9SA 3OW7A 1U0LA 2F0LA 2HHHQ 1BBUA 2FIDA 1G6ZA 2AQ2B 4HCEA 1LT4D 4BBSH 4HLEA 1MHXA 3GZNB 5EE0A 2B2YA 2W3SA 1FRRA 1K8RB 3V6EB 1JORA 5GAHC 3OHXC 5IYDH 1RWSA 2B2UA 4QMGA 1BQQT 4WQMA 3VAWA 2GOWA 3ZNID 2YU9H 3DPDA 3SK6A 2JQRB 2V1YA 1EZ8A 1T0RC 3NQTA 3GTOH 3I4OA 1WSPA 3RNCC 3L2PA 1EYCA 3HG9A 4BA2I 2QDLA 2K8CA 3AB9A 4B9WA 1Y1VH 4YCUA 5M5WB 2LFNA 3S1RH 4BXXH 1VLBA 3ETRA 1KRTA 1Y1WG 4IFDJ 5JJIA 4R4QA 3TSSA 2JYOA 1E0BA 1JMCA 4GDLB 3PZ7A 3TBIB 4NXML 1IBMQ 4FF1A 4CBVA 5JZEB 5JOBA 2KCCA 1N33L 4PNYA 2RVLA 4HJKA 2P5ZX 5GAEC
chains in the Genus database with same CATH topology
1FO4A 1EY4A 1DOYA 5H8YE 2EYMA 3BDLA 3QB3A 4XQJA 3BYYB 1WD1A 3OOCA 2HCCA 2L4NA 4Q2JA 4RKBA 4Z9CB 1KNAA 4ZRZA 1AYFA 4A3DB 1PDQA 1YMHE 1ZUD2 2YEPF 2W3RA 5LHY1 2CJOA 3AE9B 3OWEB 2EY2A 1TVXA 3UI3A 5KYLA 2B2WC 2F0DA 4IQZA 2DWQA 1STNA 1A6XA 3MAQA 2ID0A 2R92B 1QCBD 5C0XI 1U4MA 4Q5VA 2HCIA 4L63B 2B76B 1PTOC 1JQ4A 4AQ7A 5JAVA 1JB3A 3DMUA 1FFVA 4XQNA 3R93A 4A55A 1RD9D 4KKIA 1GJXA 3PZ8A 3OPOA 4FF4A 1GUTA 1CZWA 4CJ0B 3FPPA 1SIJA 3I91A 3IAM1 1U4RA 4BY7B 3W9CB 1CHPD 3T16A 1V1PA 1IKMA 3NVZA 1H9SA 1I7HA 3L9AX 1GHJA 2Z1CA 1SFOB 2AWNA 5HURA 3DM1A 1U4PA 3A56A 4WH4A 3HVZA 1HTPA 1O7YA 3EA6A 1N5XA 3KLRA 4KD3A 5D3DA 2NUCA 3MXUA 5M3MB 3E6ZX 1RTNA 3JAME 1EL0A 2G9DA 1LV9A 2RKSA 3K0YA 5CV6A 3ONAB 1V8CA 2W82A 3O13A 3PIO3 2PW5A 4ZKCB 2WP8J 4J8QA 3SDZA 2HDEA 4HR7B 2JP1A 1ONLA 3NUHB 1MSHA 4H2AA 1VMPA 2XIWA 4ZHOA 4OO1H 1WXQA 2R93B 1GHKA 3SR6A 3BK2A 3EUB2 2N7JA 5T8IA 3MXGA 4IN3A 4FF2A 1E0ZA 2EY1A 5IT9E 3I57A 2V3PA 1F2ZA 1AP0A 1HPCA 3A8IE 2K5PA 2QSDA 4MM3B 3DHQA 1O7ZA 1HCZA 5CGKA 4IFDG 4ULLA 2OHFA 1HRJA 2QJLA 1QOGA 4TRDA 3AMUA 1IBXA 1PTOH 3D6WA 3K58A 2WXKA 2B2WA 2E75C 1KH0A 4ZK9B 4H13C 4DF7A 2V0GA 5JEAG 3HOXB 1SNMA 1F9SA 4NDXA 1B2TA 1K83B 2EYLA 3D31A 1VDVA 2Y3AA 4R3DA 5BN4A 5C4ZA 1OO9B 1PZID 1EU3A 2A69D 2AUJD 1QT9A 2NVYB 2EOTA 1ILQA 4JE3B 3BVZA 3A54A 4A3KB 1B1ZA 3NTKA 2N88A 1TKEA 4KHZA 5DNFA 4IFDH 2NTTA 2NN6H 1CJEA 1L4ZB 3J81E 4N58A 4LAAA 2IDYA 2PVGC 1STYA 2EJFC 4B08A 4G57A 4JK1C 3M3YB 2F0FA 1F9QA 3KBXA 1UGJA 2JYTA 3DEOA 1KDCA 2E76C 1P7FA 3VR2A 2WXPA 1BR9A 1SNOA 2I46A 2TSSA 2WS3B 4A3MB 4WRDA 4OW0A 2AWOA 1LTBD 4NAWB 4HTHA 4TQ1A 1PTOB 1SDFA 1TJEA 2PLPA 1MPEA 2FE8A 1RDPD 1D6EC 4XTCS 2JXTA 2IPKD 1ZXTA 2K6AA 4GLSC 1YNND 2CW0C 3IXSA 2DLBA 4ZHPA 1JOOA 4K6LA 2PZWA 1SXTA 2BDNA 3AU7A 2MHVA 3KK7A 3S14B 4ME5A 4XQQA 1HA6A 2WU5B 3NE5B 1V43A 4KJOA 1QWYA 1D5ZC 3V2TA 4MT5A 2KMMA 1MSGA 2JA5B 1FCLA 3EVQA 1YN3A 2K5DA 3AEAB 1Z7TA 3GO5A 2V4IB 1PLFA 2XWJB 3M85A 1EIGA 4WAFA 4K5WA 3EFXD 1ILPA 3I90A 1F9RA 1EY9A 3V96A 1I6VC 1Y1VB 2E74C 5M9OA 1WTRA 2MJ3A 3RLFA 3RPFC 3H0GB 1ZP0B 3X3MA 2INNE 1ZXHA 2PZUA 4NAMA 1SEBD 1JICA 2FMMA 1Z47A 1DOXA 2DN8A 3GS2A 4L1BA 1PFMA 1SJHD 2KUMA 3I73A 4TKOB 1BUIC 3FILB 4KHVA 1DOKA 3MTSA 3LYYA 5AFWA 4HMIA 1V1OA 3AE1B 4LMQD 2F1MA 3I4NB 2Y5PA 2VZKB 3D4DA 2M19A 1BO0A 4LK1C 1SNDA 3DWQA 3Q8EA 2QF7A 1EQVA 3BWUD 5A2QE 1J7CA 2EJGC 5T1IA 2EELA 2KA7A 1K53A 5COYA 1NAPA 2NMQA 1JR0D 1D4BA 3MFGA 2J42A 1N5WA 2PQEA 5I9PA 2A68C 1FGBD 2K33A 2BE5C 2JXMB 1HQRD 2MP1A 1QOHA 5CV7A 2LHEA 5JPNC 2ZW1A 5E3FA 1BCPB 3NSWA 3QJYA 1F2LA 1K51A 1LO5D 1VMCA 1NENB 2TMPA 2NZ1D 3VQIA 5T1GA 3T3OA 3E0JA 2D5GA 1T5XD 4DAPA 1XXGA 4FO2A 5AUKA 2ENBA 5JEAJ 3I4MB 1D5XC 2PYKA 4GDKB 5GXGB 1LTTD 2IGDA 1PGBA 4PT5A 2KECA 1LT3D 3D3RA 1SE2A 5LL6X 3CHBD 2GRIA 2E2JB 5AUIA 5G3LF 4Y7NB 2WDVB 2WB1B 4IZ8A 1RODA 3VRAB 2PZTA 3RMHA 3EROA 2V4DA 1AEXA 1TQOA 4C3IG 1LTID 4ZRPA 3VYTA 3HS0C 5ELCA 4KGTA 2H4OA 1EY5A 4O1NA 2EYPA 1XCTL 4K14A 2XSCA 1A2TA 3D4WA 3FMCA 1G8ZD 3PUYA 2R3ZA 1PGAA 4C7ZA 3D4RA 2LS01 2EYFA 1O7LA 4KTAA 4JPSA 2WU2B 4K8IA 4ILWA 2F03A 1K8OA 5JVG3 2DBYA 4YTMB 3Q22A 3M4OB 2C9OA 2IJ0A 1QE6A 1XYIA 4KKSA 3QG1A 2XVSA 1MD2D 5LL6S 1U9RA 1B53A 2H89B 3IAYA 1XTCD 2D9UA 4YSXB 2LEKA 3KLSX 5EBCA 5BYRA 2NVTB 3EGRA 4YSYB 2B2TC 1ENFA 3GTJB 2Q8TA 3GTGB 1NYRA 4WWMA 3U7ZA 2B2UC 1IUEA 5IGGA 2J4XA 1PGXA 4N6EB 3TP5A 3K5NA 3P4SB 4B9XA 4RKLA 3KBGA 3P75A 2NTSA 4J6HA 2J53A 1JCKB 4C3IB 1ET6A 2A6EC 4HCSA 3TN2A 1XWEA 1CK1A 2N0SB 3NXWA 5JPMC 3A55A 3C46A 2F0EA 2F0QA 3GV6A 5CYUA 2BS3B 2DY8A 4ARIA 2F0NA 5IT9L 5IODA 1WTQA 2BS2B 3FAHA 2MGSA 4HEA1 2EYJA 1GUGA 5H92C 1TYGB 3ABVB 2Q8IB 4R8NA 4IKGA 1NSNS 4US8A 1QB5D 4C1NK 2R6GA 4X3TA 4L2YA 3MP9A 4IOIE 1EYDA 4KY5A 3DXJC 2VUMB 1EFID 1G2SA 2OXPA 4S3SA 2F0VA 1A2UA 4A9AA 4A6QA 3P20A 4LJZC 1Q10A 1TWHB 4A8XC 4C3HG 3LB8C 1EQTA 3OWFA 1KLUD 1KLGD 1P7EA 2KCNA 2E6XA 5KRUA 1EOTA 5I6WA 1FRDA 3BS1A 2B2VC 3P1HA 3C3LA 2NVXB 2HDLA 1EWHA 2KACA 1Q90A 4DQOC 5HHDG 3BYTB 4NP5A 1LABA 3J81L 5E4XA 1LTGD 4RCOA 5M5YB 5FO7B 4M1UB 3SK5A 5KEEA 1FM0D 1FNWA 3IL8A 2K1BA 3P4RB 3CU7A 3R2IA 1TS5A 4A3GB 2LY7A 3T4AC 1A3VA 1NEKB 3ZJTA 1DOLA 3A8KE 1H9SB 2EY6A 1FIQA 2MEKA 2F0IA 3CRLC 1AZPA 4P16A 3NTIA 1NR2A 2SNMA 1QJOA 2RQXA 2LMCA 1RJTA 1Q8IA 4DK0A 1SMYD 5D65A 1NYQA 1KTKA 3D6CA 4X3UA 1QOBA 5I4DA 4BS9A 3SK4A 2A6HC 1PDXA 1TKWB 4YSZB 5CV4A 1B9NA 4FXGC 3U2SC 4A3EB 4ARCA 1IYUA 3TP7A 2JE6I 2WXMA 3MJ5A 1CQVA 3Q24A 1EWYC 1TWAB 4RCNA 4H7BA 1XLNA 1CTMA 3ZYYX 2IW3A 4OO1G 1BMLC 4V0BA 2LGIA 3G6JB 1GXDC 5TSSA 3Q8AA 2YEPB 4CJ1B 1FMAD 3HEJA 1PFDA 4KGRA 1LLRD 2XNAC 3NBHA 4FXDA 1VRAB 4ABNA 2RDGA 2LFIA 1RYJA 3I72A 2FFKB 3LWEA 5HFYA 1CI3M 3Q8BA 3WOFA 2WINB 2PIAA 2NYZD 2WXOA 4OHJA 5G5HA 5C3EB 5MPOA 4HN7A 4OIKA 1RTOA 1QQRA 2K0PA 2JA8B 4FXCA 3TEZA 3J7AF 1C78A 1NR4A 4FXKC 3Q8FA 1L6VA 1ZDVA 2A5HA 1GUWA 3S17B 1ZKOA 2KOLA 2KWDA 5FKAC 4HEDA 3FRPB 3I8ZA 2O5IC 4RWSC 3AEEB 4C7YA 3DWGC 2KEEA 1LT6D 1VZ6A 5EPJA 3X3NA 1L6UA 5K36G 1ENCA 2L55A 4MIUA 4KV6A 3CKIB 3AE8B 2F0PA 3MWYW 5M5XB 3MHBA 3RZOB 4WURA 2L12A 3NS1A 4QF4A 3GTPB 2MPMA 1CZPA 1DGJA 4RGNA 1N60A 1D5MC 1SBBB 3SHLA 1JRPA 4ZRQA 1QF6A 4ZUIA 1YJIA 2WXJA 3AE3B 2G9HD 1AWDA 4CGYB 3K5MA 1OQQA 1HUMA 2FINB 1UUPA 1PFBA 1STGA 4C2MB 2F3VA 4RHSA 2F0UA 3DWAA 5C6AA 2L9HA 3CQZB 5J1ZA 2IX3A 1A3TA 4YT0B 4H0LC 4XT3B 3P63A 3MC0B 4DFAA 4HJGE 2WNMA 2M56B 5IOCA 4XWWA 3WDNA 1QG7A 2M2LA 3FVQA 1STBA 2CQAA 1FXAA 5HG2A 2XRSD 2Z8LA 2BT6A 5IGFA 1MI0A 3K7AB 1OXSC 1TY2A 2OEOA 2H88B 4ZKBB 1HHVA 1FD6A 1UEAB 2PKOA 4IFDI 1R4QB 3AMZA 1Q1BA 1KF6B 2J0TD 4HKZE 3J80E 3R2TA 5EPLA 4PMCA 5CV9A 1DD2A 3W5VB 1IBXB 4XXEA 3A7LA 4DU9A 2B39A 3BDCA 5CV8A 2AQ3B 1TR5A 4EQOA 1GUOA 4CHTB 2E2DC 1F2RC 1GUSA 3B2FA 4MACA 5EE1A 3U9OA 4WJWA 4WORA 4ID6A 4A3IB 1S5DD 2K5WA 4YTPB 4OVZA 1YN4A 3Q23A 2HUGA 5BMIA 1HFGA 1FNVA 1T5EA 1OQRA 3IKJA 1KDBA 1MGSA 2KJXA 1LT5D 2WV6D 2GI9A 3AE2B 4GZYC 4QUCA 3TZDA 3L7ZC 4Q0FA 2IGGA 1KDAA 1L5PA 3EQLC 2L11A 1PTOF 3P4PB 1Y8NB 1HQMC 1R4PB 4JWUC 1OXXK 3W3AA 3Q8CA 2FBWB 3UI2A 2F0GA 3DEPA 4DGZA 1EY8A 3U9SA 3HOYB 3NVYA 1ESFA 4HAEA 3KQ4A 2AUKA 2J7ZA 2NN6I 1VZ8A 1F2MA 1PRTF 4UAIA 4QUFA 2L1BA 5C3JB 2MH7A 2KHSA 1K8MA 4KI0A 3A8JE 3MFYA 2EKIA 4IDIA 3TP8A 3T51B 1BOSA 4K2LA 4IALA 3MVVA 3E5SA 1B50A 3NWTA 4BA1I 2GA4B 1RF2D 1S4ZA 1Q3LA 1VZ7A 1TKYA 1E9MA 5D7GA 5ISRA 3HZXA 1HFNA 3FILA 2EPBA 2K05A 1CA6A 1V8QA 4K2KA 4XYOA 4G7HC 1IKLA 1ET9A 1C79A 2M00A 4P2CB 5BMHA 1IYVA 4XDCA 4RH6A 2F3WA 1JROA 1L4DB 3BVMA 2H1EA 2JSVX 5CORA 3LNNA 2INPE 4HMJA 3ND8A 1D1IA 5C0XJ 3MZ5A 2A74C 1EEFD 4LTUA 4ZAIA 1T3QA 3AECB 3GTLB 1SYCA 1E2VA 1N62A 4IUTA 2L32A 2C5CA 1RFKA 2A6HD 1DYQA 2K28A 5KNCA 3PUVA 3TEWA 1KNEA 5KNBA 3NPPA 4C1NI 3S9WA 3PV0A 1F0ZA 3H6MA 1DONA 3OIPA 5D14A 5FO8B 1CQFA 1H9RA 3MA2B 3TDQA 3NHHA 2QIEB 3N9YC 3HKZB 4N59A 2DY7A 4OGQC 4JWSC 5DM73 1S5BD 2ZW0A 1DZ1A 1EWCA 2WXGA 5C44B 3I4LA 1RKNA 3NQIA 4K5XA 3H09A 3BG3A 4HSPA 4WFN3 2RSNA 1ZDXA 2HTME 1PRTC 3S2HB 1E10A 1I4GA 1I4PA 2OF1A 1AFPA 4KY6A 1F2RI 4RNAA 3GTMB 2JYEA 1NCVA 2DYOA 1BBXC 3BK1A 3TEYA 2RPVA 1O80A 1WTWA 3VA5A 2B2TA 5C0XH 1R7SA 1XF5L 4R9WA 3DWPA 3NP8A 1BCPC 3V3XA 5CR3A 3OMCA 1HUNA 1BXTA 1O78A 3GQBA 3HP3A 1WVLA 1FYCA 4TMAB 3AE5B 1XCQL 2ZT9C 1J8IA 5FK9C 2PPBC 5EKLA 4F87A 2K01A 5ELFA 1SSOA 1JWMD 1WTPA 2XWBB 3VR6A 3RUZA 2PW9A 5A2QL 2BA0A 3K5OA 3T56B 2JA7B 1QOAA 3DWMA 2BBCA 4XT1B 1F9PA 2JSOA 3KF8A 1E7PB 3QIAA 4AS1A 3HRDD 5KGUA 2QCPX 1C48A 4JX1C 2LHDA 1S5FD 1QOFA 2F0SA 1L0XB 1I4RA 2QDBA 3C1EA 4OIJA 1C4CA 1SB3C 1HTLD 3ZJUA 2FUG1 1XLOA 2IGHA 4OZBA 3VR8B 3W2DA 5D3IB 1ZYRD 4DK1A 2B2YC 4P6VF 4M8AA 3Q69A 1MVKA 1Y8OB 1KABA 3H8HA 1JMLA 3SVMA 3WOEA 3S1MB 3VRBB 2JEAI 1QILA 2KVMA 5KIXA 1SJED 4L8JA 4PMBA 4TSSA 1UWXA 3J9CA 1SE3A 4KKUA 1WYGA 1B44D 2KQ4X 1G2TA 2QILA 1JW9D 3GTOB 2BYTA 2D62A 4YWGG 1XLPA 2IX0A 2IL8A 3AH7A 5FO9B 4IUQA 1TWGB 1AZQA 2BCOA 4X3SA 1SYFA 4LK0M 2VB3X 3GTQB 3B9JA 1II3A 2HDMA 4HSVA 4DAYA 3K6OA 1WTVA 3N6RA 5FOBB 5I6YA 4D2KA 3S2DB 3MXNA 2WAQB 1C77A 3EJIA 4L6TB 4C3JB 4C3JG 3GD7A 2AQ1B 1EZ6A 3TMEA 1H9MA 2WIIB 1NVID 2MUYA 2SEBD 2PTLA 5DAUA 2EZVA 3GB1A 1YNJD 1W6JA 4C80A 2KQ3A 3J7YW 3QO2A 3L3OC 3AE4B 3NZ3A 3CIRB 4RF0A 1B3AA 4ZQ3A 1OXVA 3MEHA 2KEDA 3T13A 2WXLA 1H9JA 1KFYB 1C4PA 1L0YB 1J9OA 4OZCA 2KAJA 2LJIA 2DNEA 2W54A 1Y8PB 3MHZA 4USAA 3SEBA 4G7OC 1SYBA 1OXUA 4N9PA 3AEDB 4OL7A 4R8IA 1RHPA 1AN8A 1DCZA 1VCIA 1VF5C 3RD4A 2EVBA 4FNFA 1B9RA 3FPUB 4KKTA 2BS4B 5LNK1 4KMUC 4EQPA 2B8GA 3N52A 1WGKA 3HOWB 2K32A 4RGTA 1PMRA 1JOQA 3VYUA 2WXIA 3U4EG 4A3JB 3HVDA 4EGVA 1ZXIA 1DM0B 3LX0A 4OZAA 1MI2A 4LLGM 1JQYD 2BE5D 4N9TA 5HI1A 4EVOA 1LACA 3S15B 3ZQ4A 3NRZA 3AB5A 1TIID 3FC4A 5J22A 2LMCB 2I2YA 2K3UA 3VYRA 1Y1WB 1YNNC 2CW0D 5EJWA 1TS3A 1XEEA 3Q6SA 1FFUA 1TS4A 2K04A 3M7GA 2B8FA 1JC7A 1FXIA 1WWTA 1CT1D 3CWIA 2EDGA 1YQ3B 1D1KA 1R9TB 1DJRD 4XDXA 4ZYSA 4A3FB 5BYQA 5CBAE 2WQYB 4AYBB 1JWAD 1WCMB 1I4QA 1OFFA 4CKCA 2WACA 4BBRB 3KUPA 3H94A 3URYA 3S1RB 2NVQB 3GP7A 2IWHA 3T53B 1N61A 4DAVA 2YYZA 3T3NA 2IT1A 1EYAA 1C76A 3R8BA 1J7BA 3IAS1 3WCQA 1JWSD 2BOSA 5EBDA 2EXZA 4NJCA 1JE4A 3VR5A 1STEA 1TY0A 4C56C 1C8CA 4XIGS 4IUVA 1QKZA 5FLXL 1Y69U 5G3LD 4F88A 4A90A 2WKCA 2SOBA 3RZDB 5JVH3 3OMGA 1EM7A 1IGDA 5BMGA 4US9A 5C4JB 3SE0A 4OO1I 5EQ0A 2Q5WD 1ENAA 3NVWA 1LTAD 1G91A 5BN3A 2FHTA 1SNPA 2L83A 3W5UB 1ZE3D 3PUWA 3GTKB 2ZXOA 4F8MA 5EKKA 3PO3B 2BB5A 4RF1A 2MJDA 5ELDA 3OSOA 3ZGZA 2F0MA 2PMZB 5C3XA 1HZ6A 2K9XA 2X6GA 3W1SA 2DYMA 2Y5CA 1SYEA 1WRIA 2ZXRA 4A3BB 1ROEA 1GOZA 4NKLA 1C4QA 2PNRC 4U68A 1ZOYB 2NN6G 4REZA 3IFTA 1MHHE 2MJ8A 1I3QB 1C4AA 4NMZA 3KLSA 3H91A 5JJZA 1L0VB 1A15A 1A70A 3I70A 5K5PA 1CM9A 3QOLA 3OIQA 2ACZB 3AV8A 4RAUC 5NUCA 1I4XA 1SYGA 2F0WA 1NI3A 3NK9A 1GB4A 5EGTA 1YNTE 3HUIA 3AEGB 2EJMA 2CU3A 1IW7D 3ITPA 4XYQA 1HEZE 3LXFA 1I50B 1PXUA 4IUPA 1X3PA 1PZJD 4KJNA 3P42A 5I9OA 3J7AV 5J39A 4FF3A 1FNUA 2K7VA 4KN7C 3JAML 1E6EB 3RFZB 3HRZC 4KK7A 1TT2A 3V05A 3IT6B 1BUVT 1LTSD 4EQNA 4B0EA 4V190 4U673 2O2LD 1SSNA 2JWUA 1BNZA 2F0HA 1TWCB 1HZ5A 1HXYD 1JWUD 2D2CC 1STAA 2CVRA 3GV3A 4IURA 1Y56A 2OEDA 4HROA 5C5LA 1YQ4B 2PCFB 4PV1C 4ZLTF 1IW7C 5CV5A 3AM9A 1STHA 1E2WA 3K57A 2L5TA 3C2PA 2E3TA 1PTOD 3D8GA 3PO2B 5IIFA 2Q8RE 1TKGA 1EY0A 3K59A 3AE6B 2F4IA 3ZJVA 1D2BA 4O42A 1FCCC 3SFEB 4FVMA 4QB4A 2I07B 3HGBA 1TU2B 5EPKA 1K52A 3VR4A 3BIID 2CHBD 2ICIA 5C3WA 2RMMA 1BCPF 1DOIA 1WD0A 2M9VA 1EU4A 5JXVA 4YIJA 2PMVA 1WTXA 4DNTB 1ZEQX 5E4WC 1BCPD 1CA5A 2A6ED 1KAAA 2L52A 5IGCA 3LWUA 2Y0SB 1TWFB 2WXFA 1U4LA 3HOUB 2Z4IA 4I65A 1V1PB 1FD7D 3SR1A 3ERQA 3C8YA 5K36H 1PYWD 5CBEE 2XRQD 2VNUD 2ON8A 3NTHA 4RFBA 4M0WA 1CZGA 5FLXE 2E2IB 3MXPA 2RDHA 3QWNA 3ND9A 5IGDA 1I4HA 2A73B 5JEAH 3KWLA 4ZUJA 2EY5A 2EYHA 2PW7A 5F2DA 4DA2A 1GAQB 2Z4HA 3L4PA 4XE0A 4H44C 4G4KA 1J7AA 5DEHA 4MHEA 5E6JA 5FR3A 3S1NB 4J3OD 3DUZA 2VXWA 1W6KA 1NUCA 4F7XA 5CMDA 1UWMA 2WDQB 1QNKA 4L23A 1JALA 1ESRA 1KRHA 2JU6X 1PUTA 3VR3A 1BDOA 3PUXA 4B0MA 2WKDA 4RHRA 1XLQA 2E2HB 3B2GA 1PFNA 1EEID 2BTEA 2O4XA 4FYDA 1DXMA 5IGEA 2N9KA 5DM63 1DOMA 1OXTA 2WP9B 2XN9C 1SNCA 3SFDB 2WXRA 1X32A 2KN4A 2RA4A 3FDTA 1XO3A 1E2ZA 2K22A 1B9MA 2ZXPA 2B63B 1ZPSA 4K5VA 2R61A 4XWTA 2X38A 4K6DA 1A3UA 5ELBA 3NWSA 4J1MA 2ONQA 5BN5A 3PIP3 3IT4B 2KDMA 1GB1A 1YN5A 3PUZA 1ML0D 4DXFA 2QKIC 1YJJA 4ZOHC 1GUNA 4ODGA 3PO0A 1XX8A 3P7JA 4KKJA 2SAKA 2VZKD 4TQUS 2EE1A 2LKVA 2SNSA 2L0CA 3NUCA 2RSOA 2ICEC 4G7ZC 1CHQD 4A93B 4EE2A 1IL8A 2PO4A 2F0JA 2VB2X 2L1AA 1SAPA 2K5QA 2FMCA 4UDUC 1HA5A 4KX6B 4MN3A 2IX1A 3AE7B 5C4XB 2BB6A 4KGSA 1EY7A 2A68D 2F0OA 2G1EA 3KWVA 4PMWA 1M8AA 1CFMA 3SXHA 1IHZA 5C5MA 2O5JC 3U52E 4FP5D 1Q1EA 2NB0A 2WXHA 3VYSA 1VF7A 1JWBD 1WTOA 1S5CD 1M4VA 3I3CA 1IGCA 2QMTA 4CJ2C 5I2YA 1SE4A 2K03A 3TP6A 3AEFB 5KNDA 4YTNB 4BY1B 5CC4A 1Q12A 5EE3A 3C1FA 2F0KA 2SDFA 4JBWA 2R7ZB 2EYOA 1VJKA 1VDZA 3FKIB 3P4QB 1PRTB 1T6BX 3QOJA 2I38A 3CRKC 2WXNA 3FEWX 2BDOA 3A7AB 3I9V1 4CQNA 2YU9B 2PVOD 3S16B 2J52A 1AW7A 4HKQA 4BBSB 2CJNA 3HOZB 1F2YA 3R3OA 2NBFA 2A69C 2JEBI 2X69A 3E56A 2W55A 1PZKD 3BZDB 3J80L 2HQEA 2LUMA 4X3KA 1G291 4NZLB 3Q0AA 5M3FB 4QIWB 4MH8A 2WLBA 3S1QB 2JA6B 1RCVD 1QNUA 5EE9A 2JX5A 2FJ2A 1N63A 1UAPA 4CKBA 4KN4C 3F2UA 2WDRB 1I6HB 4ITKA 1RM6C 1YNJC 4I7ZC 4NW2A 1SNQA 4BWGB 2X6LA 2BW2A 2N9LA 2OT2A 3M7NA 1K50A 4KD4A 1S5ED 2WXQA 2F0TA 2GB1A 4C3HB 1EY6A 1LTRD 3K5LA 3P1MA 1VR9A 4HRSA 3M4YA 4DNRB 3TUOA 5EKIA 3VA7A 4E6IA 3PMFA 3AEBB 4XDDA 1UNSA 1V97A 5C4HA 4CKEA 2DNCA 3BVGA 5G5GA 3HOVB 4WIPA 1GPXA 1BF4A 4QCLA 3BDOA 1JOKA 2N55A 1ICWA 4TQ0A 3H3VC 4DXGA 1B4OA 5C2TB 2RDFA 2NWGA 5IGBA 2MJEA 3NVVA 3SK8A 4DN4M 1H9KA 4KY7A 2QEJC 3AN1A 3G7LA 1Z6HA 1FEHA 1MBYA 1F77A 1QLBB 2B2VA 1FR3A 4IUUA 5ELEA 4YXDB 3TZUA 5C0XG 1C9FA 5KYIA 1PRTD 5A35A 1SMYC 1TS2A 1ZYRC 4IUNA 2JZPA 1SF0A 1TZOA 2AX5A 1ACCA