1TGZB

Structure of human senp2 in complex with sumo-1
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
78
structure length
78
Chain Sequence
EYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sentrin-specific protease 2
publication title A basis for SUMO protease specificity provided by analysis of human Senp2 and a Senp2-SUMO complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle, hydrolase
total genus 15
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2004-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1tgzB00
3W1SC 2LVOA 3L17A 3H9DA 1L2NA 5AZGA 2FCNA 1LQBA 1HE8A 5AEKB 2L0FA 2K1FA 4EKUA 3AU4A 3PT2B 4MJSB 1UGMA 4MGKE 4HDOA 4BKSA 2B3AA 2WX1A 3IG3A 1H8CA 1UBIA 3KYCD 3WALA 4A3OA 1C1YB 1F9JA 2MRPA 1SGHA 5BO4B 1YX5B 3KVFB 2JZZA 4OVUA 3H7PB 2RSUA 3M63B 3QCAA 4HWIB 1Q1OA 2KQSA 2W9NA 3UF8A 2KO3A 4JQWC 1KM7A 2BF8B 2KLCA 2LXCA 3IBEA 4MGZE 2ASQA 2LGYA 2NVUI 3SD5A 4B9KA 1OEYA 4IW0A 2IYDB 1WXAA 4XX5A 4XZ4A 2KN5A 3ZDTA 1J19A 3L10B 1P0RA 4A3PA 3B08A 3L54A 3PLUA 2O6VD 2LD9A 1WGYA 4I6NB 4TKNA 2L0TA 4AJYB 3OAWA 5L83A 2KDIA 1WX9A 2FCQA 3B1LX 2EMSA 3L08A 1WX7A 1AARA 4MM3A 3EFUA 2C5LC 2HE7A 2RGFA 4GOCA 3ZNZB 4W9KA 3VH3B 2D07B 4DDID 4II2B 3PRMB 4BOSC 4E3CA 2KWUB 3P2BA 4NNJB 3DCGA 3IFWB 1P9DU 5CHWA 3HM3A 3A9JA 2MLBA 5E6PA 3ZW3A 3PTFC 1GJZA 1YQBA 2D2QA 2JY6A 1E7VA 2MP2B 3KYDD 3V60A 2O6VB 4BFRA 1J0GA 1WRDB 2M4NA 2LRUA 1UBQA 2FUHB 4IM3A 3ZNHB 1I42A 3PLVA 2MWSB 3APCA 2IO3B 1WM3A 1NDDA 1Z2MA 2ZNVB 3PHWB 3NZUA 2N1WA 4PS3A 3R7RA 2MA9B 3EHVA 2JUOA 3EECA 4WAAA 2BYEA 3RZWC 2LVPA 2M1MA 1E8WA 4I6LB 2L05A 4WJNA 3VTWA 5DPSA 4IUMB 2JF5A 4NY0A 2D3GA 4ICVA 1A5RA 2Y5BB 2LWPA 3DVGX 2CHWA 2AYOB 1IPGA 2C9WB 5D2MB 2D11A 4FJVB 5E6OA 2N9EB 4DDGD 1EO6A 2VRRB 1M94A 5D7GA 4IWOA 4FULA 1WJUA 2XK5B 2KFJA 2LI5A 2DENB 2EKEC 4G11A 4E71A 3PVLA 2RR9A 3A1QB 4IWPA 2KK8A 2YLMA 4LJPB 3TCAA 4PYZA 3RULA 1OEYJ 4EZLA 3QC8B 2ZPYA 2MCNB 3DBRI 1XT9B 1VD2A 1GUAB 1WMHA 2FNJB 3T8MA 3ZDMC 2MBBB 5JZEB 1R4NI 3RCZA 2CU1A 3ZNGC 1LXDA 1WYWB 3AU5A 1R4MI 4XC2A 3LDZE 2PPHA 2KTFA 3K9OB 1WY8A 4JLCA 2KVRA 1XD3B 3O65B 4KV2A 2IO1B 4M8NA 1V2YA 2WWZA 4AJWA 3L0WB 2M17A 4WJOA 1GG3A 3RYTA 2DYOA 2LZ6A 2N7EA 1V80A 2FIDA 2RPQA 1V81A 3L13A 4CO7A 5LXHA 3UIPB 2G4SA 2V1YA 2CHZA 2ZNVC 2IY0B 5IAAC 2KTRA 4W9LA 2NBVB 1H4RA 3MTNB 5J17A 3HK0A 1UELA 3AULA 1WJ4A 1V49A 3M3JA 2GMIC 2MW5A 3ZO5B 1WX8A 3V6EB 4BBNF 2KDBA 3PS6A 3GOEA 2NPTA 4MSQB 3ZVVA 3VAWA 1JRUA 2BKFA 1Q0WB 1WZ3A 2PEAA 2C7MB 3VUYA 2KWVB 3NHEB 2LGXA 5TR5A 3V61A 2V4LA 4YL8A 4A20A 3CSTA 2ZVNA 3KUCB 4FJYA 2ZVOA 3ZTCA 3PRZA 2JPHA 4WJPA 2HD5B 4NQLB 4F7ZA 3ONSA 4BKGA 2JWZA 3JSVA 1S3SG 2KHWB 3K9PB 1WXMA 1V9JA 4M8MA 1E5WA 4TQ0A 3V6CB 2WDTB 4MSMB 1YD8U 3I3TB 1G6JA 4W9CA 3VQIA 3PHXB 3C0RB 4DHZB 3RZFA 3QK0A 2IO2B 2MBOA 2LJ5A 3A9JB 4HJKA 5HKHA 4AP4C 2HTHA 2HJ8A 3ML9A 1WGHA 4IG7B 3VUXA 1NBFC 2FCMA 4TQ1A 4AUQC 2L00B 2XBBC 3QARA 2L8JA 4K81A 4W9FA 5DPTA 3ZIMA 2CKHB 3OJ3A 3CF6E 2K8BA 2KC2A 4FJZA 3EC8A 4FHKA 3WAMA 4DHJD 2NBUA 3QHTA 3UIOB 4URKA 1KOTA 4PYUA 3ML8A 3UQAA 4NPNA 4FA6A 2KDEB 1OTRB 2DZIA 1BT0A 3H7SA 4EZJA 4K7SA 4KSKC 2WX0A 3DVGY 4LJOB 4MGIE 2GBJA 2N1VA 2O2VA 2ZCCA 4E74A 2KWCA 4RM9A 4DHZE 1P98A 2JXXA 2JRIB 4K7WA 4WWNA 4KDLB 4P7IA 1WFYA 1WGRA 3QJZA 1TBEA 1WH3A 2FAZA 1T0YA 3MHSD 2BWES 4GDKA 4MGYE 2Z59B 2FCSA 1SE9A 2DX5B 4BVUC 2BYVE 3DDCB 1V5OA 4F8CB 4DHJB 4HDQA 1QZEA 3A4SC 4GU2A 1WJNA 5J2RA 4DXAB 3HIZA 1WMHB 4W9DA 3V62A 3QA8A 2AL3A 2R2OA 4ZYNA 1RRBA 1UD7A 1V86A 3ZUNA 3AI5A 3WAOA 3LJ3A 3N30A 1E7UA 1Q5WB 2KX0A 1X1MA 2I1KA 4ANWA 2EMTA 2IY1B 4GSWA 4B95A 2KNBA 1Y8RC 2N9XA 4FHJA 4KIKA 3BY4B 3VH4B 3W1YA 3X23A 2L3ZA 4BKSD 2BKRB 2MQJA 4FBJB 2BWFA 4W9JA 2MBQA 4WQOB 3PRPB 2D10A 5JH5C 4KVGB 2AWTA 2KTRB 3QX1A 3GZNI 1Z5SB 4BOZB 2KLGA 1V5TA 2DZJA 3RD2A 3B0AA 4LDTD 2IZVB 4DK5A 5DPWA 1WI0A 3TMPB 2DZKA 2DYMA 3QQ8B 5D94A 3M62B 2KQ7A 5LLIA 4CYEA 5CHVC 1WGDA 3VTVA 4JIOU 3OJ4B 1XQQA 2Z0DB 3DBHI 3DOWA 3DBSA 4EUTA 5FR6A 3JW0X 1YX6B 1WE6A 2CHXA 2JZ3B 4KSLC 4MH0E 5CHFA 5JHAA 3ENEA 1E8YA 4W9HA 1WZ0A 4KDIC 4HPLB 3QIJA 1WR6E 2J0KA 3DBLI 4HVBA 3W1SA 4PS8A 2G3QB 3D32A 4WWPA 2KMCA 4ANXA 4KZ0A 3M95A 3A9KA 3JSVB 4GDLA 1ZW7A 2K25A 2OOBB 3ZTDA 1C3TA 2KFKA 4OVVA 2KJRA 2K6DB 1UH6A 4LDTB 2N9PC 4MEMA 4FADA 4JGHB 4NAWA 2DAFA 4FN2A 4IWQA 5KHQA 4J6IA 1NI2A 2DYBA 2G45B 1WF9A 2L76A 1GNUA 3NOBA 3X0WA 3L16A 2LRWA 4GMVA 1MG8A 4II3B 4ZRIA 1EF5A 4PS7A 3VUWA 1ZGUB 4DWFA 4EEWA 4HXDA 2V3SA 1E90A 4GIVA 2K8HA 3R3MA 2MX2A 1WXSA 2JT4B 2K6QA 2KD0A 3APFA 5DCNA 2LASA 3WA0A 3ZRFA 1IYFA 1L7YA 4TV3A 3PGEA 3NY5A 1GC7A 5L95C 2OJRA 5JHBA 3UINB 3ZRCA 2KANA 2PE6B 4IM2A 1EUVB 2ZZPB 4EZKA 3DPDA 4FLHA 2KDFB 3NZSA 3T9LA 3DQVA 2LUEA 1J8CA 3N3KB 2A5UA 2J0MA 3PV1A 2J0JA 2WYQA 2O2VB 3HM6X 3TBLD 1OGWA 2QHOA 4I6PA 4G3XB 3KUZA 3UGBB 2GBKA 2MBHA 1E8XA 4TUUA 3BINA 4RMAA 5LXIB 1WGGA 4W9IA 1I35A 2C7HA 4MDKE 3ECIA 4GGQA 4F1SA 4GDKB 3R7QA 4G0NB 2CR5A 4ANVA 3JVZX 2KJHB 2A4ZA 2JVCA 4HCNB 2BYFA 3VFKA 2JRHA 4KZCA 3SU8X 4NJ6A 1RLFA 1TGZB 1WR1A 2AEHA 2LVQA 3KUDB 1S1QB 3TJPA 3TL5A 1IP9A 2MSED 4MJSA 4K7UA 5IA7A 2IO0B 4JL9A 1SIFA 1E8ZA 2FIFA 4NQKE 1WE7A 5KHOA 3DVNU 3H1UA 3U8ZA 1TTNA 3DVNV 4N9F4 2NS5A 4BBNC 4GB9A 2GBNA 1RFAA 4MELA 2DHZA 2GBMA 3A4RA 3MJWA 3H7PA 3SDLC 1D3ZA 3HHMA 3WAPA 2YVCA 4IM0A 4KIKB 3TIXA 3R66C 3WIMA 3IHPC 4EFOA 1KLVA 5CTRC 1WIAA 2NR2A 4GXBA 1UZXB 1LFDA 3ZNID 5C1ZA 4RM8A 1ISNA 1WM2A 4HCPB 4ZRKA 1GC6A 2KXJA 4HPMB 5DPRA 2UWQA 2C7NB 3H6NA 4ICUA 4DBGA 2REXA 2NCNA 3IVFA 3CMMB 2N7DA 1VCBA 3KW5B 5G55A 2I1JA 3ALBA 4W9EA 5AZHA 2M0XA 3PSEB 4G50A 1TZ1A 4B6WA 1LM8B 3VHTC 3ZLZA 1ZKHA 3PZDA 4CHKA 4LCDE 1OQYA 2IBIB 4ZDVA 5E6NA 3AXCA 3QWZB 1EF1A 2LGDA 5AZFA 4BKTA 2NBWB 2KOXA 4WJQA 1WJ6A 2CS4A 3SHQA 2N4FA 2MP2A 2L7RA 4WWOA 4HLEA 3A9KB 4GDLB 2O6VA 3U30A 2G4DB 2KFKB 3VVWB 2KKCA 2NPTB 1YJ1A 2PE9A 3RT3B 3U7DA 4NAWB 1CMXB 3S2AA 2ZEQA 4AOFA 5GMVA 2KZRA 2LXAA 5G2NA 2ZPNA 2KC1A 2MBEA 2J7QB 4NJ7A 4IC7B 3Q3FA 2ZCBA 3VDZA 2K8CA 2BGFA 4EOYA 3WANA 5EDSA 2XEWA 1RAXA 3N32A 3UQBA 2BPSA 4ASWC 3PPAA 3CSFA 3JYUA 2KJ6A 3A33B 5CX3A 4M0WB 2R2QA 3VTUA 1P3QU 2AL6A 4X57B 3APDA 1KJTA 2DAJA 3PREA 3NS8A 1K8RB 1P1AA 1YIWA 3OLMD 2DZMA 2M8SA 2GOWA 2RD0A 1WXVA 2XK5A 3QAQA 2GBRA 2K39A 3VXWA 4ZRJA 3A1QA 2KMAA 4W9GA 2UYZB 1PQSA 2Z0EB 1V6EA 3Q3JA 2KX3A 4K1RB 4ANUA 3KH0A 2PJHA 1FXTB 5D6JB 5J18A 3RUIB 4AWJA 2C60A 4HK2A 4GN1A 1U4AA 5C23A 2ZJDA 3ZKJC
chains in the Genus database with same CATH superfamily
1I4XA 3L17A 3R2TA 2K3UA 1LQBA 1HE8A 3HRDD 4HDOA 4BKSA 5LNK1 1C1YB 3M63B 3DWGC 3QCAA 1Q1OA 1HA5A 1HQRD 3UF8A 2KO3A 2KLCA 5IKCM 2NVUI 1OEYA 4IW0A 4HEA1 1WXAA 1YOVB 2LD9A 5L83A 2FCQA 3L08A 3EFUA 2EELA 3KWLA 2JQRB 1MFWA 1C76A 5G5HA 4DDID 3PRMB 4XYCA 5CHWA 2QC8A 1XLOA 5E6PA 4XWWA 1E7VA 1SE3A 2O6VB 1VZ8A 2CJNA 1WRDB 2LRUA 4JWUC 4IM3A 3PLVA 3Q8FA 3APCA 3PHWB 3R7RA 1QOFA 1XLNA 2N1WA 4WAAA 2BYEA 2M1MA 1FNUA 2INNE 1TIFA 2E3TA 2LWPA 1SEBD 2CHWA 1ZDVA 1IPGA 3HUIA 2N9EB 1EO6A 2K5PA 3NZ3A 1WRIA 4G11A 4E71A 2RR9A 3A1QB 1V97A 4LJPB 3TCAA 4PYZA 3RULA 2I38A 1EWYC 2MCNB 1VD2A 5E6JA 1Q10A 4YXDB 2CU1A 2DWQA 5BYQA 4ARIA 3RNCC 2PMVA 2KTFA 2ONQA 1WY8A 3K9OB 3O65B 1JQ4A 2IO1B 1VZ6A 4AJWA 3L0WB 1GG3A 2LZ6A 2N7EA 1V80A 2IDYA 1SIJA 3TSSA 1EM7A 2MJDA 4ZHPA 1E7PB 2WXGA 3ZO5B 1HZ5A 4BBNF 3W5UB 1K50A 3GOEA 3PS6A 2PEAA 2C7MB 4L2YA 2LGXA 1FRDA 2V0GA 4OVZA 2V4LA 3PZ8A 2ZVNA 4LNOA 2WHIA 3PRZA 4WJPA 1UNSA 4F7ZA 2PVGC 1MJDA 3JSVA 3K9PB 3SFEB 4MACA 1E5WA 2WDTB 3N1XC 3I3TB 1G6JA 3AEFB 4YTNB 1TS2A 1SBBB 3C0RB 4DHZB 2IO2B 2MBOA 5HKHA 4HJKA 1TY0A 2HTHA 1NVID 3RI7C 3TEYA 2XBBC 2L8JA 2CKHB 1MG4A 3CF6E 2K8BA 1T0QC 5G5GA 1TZOA 3QHTA 3UIOB 3ML8A 3WCQA 1FCCC 3B9JA 4LJOB 1K52A 3EUB2 1JW9D 4KDLB 1JCKB 3GE3C 1WGRA 2BWES 2W3SA 2Z59B 4TMAB 1ACCA 2M0AA 4BVUC 1V5OA 2QDFA 3A4SC 5J2RA 4DXAB 3HIZA 1QOAA 4W9DA 1HTOA 3NVZA 3QA8A 2AL3A 3RN9C 2N0SB 4FXCA 3N30A 1E7UA 1X1MA 2J52A 2OJWA 1JRPA 2JZPA 1YN4A 2KNBA 3C8YA 1MPEA 3VH4B 4BKSD 4FBJB 1J7AA 4HJGE 1XLQA 3J9CA 3PRPB 4WQOB 2AWTA 2V3NA 5IP4D 3ZXRA 4BOZB 1HEZE 1V5TA 3RD2A 1WI0A 3TMPB 2WU5B 2Z8LA 1WGDA 2VH1A 4JIOU 2BTEA 3OJ4B 2Z0DB 3DBHI 2KAJA 1WE6A 1YQ4B 2CHXA 4KSLC 1SJHD 2KACA 1QF6A 3RNGC 4HVBA 4PS8A 2G3QB 1TT5B 2KMCA 4GDLA 3JSVB 3ZTDA 3SEBA 2Y3AA 4LDTB 4FADA 3CIRB 1FFVA 2LEKA 2DYBA 2L76A 1GNUA 1WSPA 4PT5A 3VUWA 4ZRIA 1E90A 1KLGD 2MX2A 4P6VF 1WXSA 5DCNA 3IT4B 1B1ZA 2INDC 2KANA 1XCQL 4IM2A 1EUVB 2ZZPB 3P4PB 2LUEA 5BMHA 1BUIC 2J0JA 2WYQA 2QHOA 2MJEA 4G3XB 3KUZA 2L83A 3UGBB 4ZOHC 2D3CA 3BINA 4MDKE 1FEHA 5H8YE 3ECIA 4F1SA 2KT7A 2D3AA 4G0NB 4ANVA 3TEWA 3DHIC 2A4ZA 3AEGB 2BYFA 3NUHB 4KZCA 4NJ6A 1TGZB 2AEHA 3C19A 1IP9A 4MJSA 5AUKA 5IA7A 2DLBA 2WGSA 1CQVA 3U8ZA 3AE6B 1TTNA 1KRHA 2NS5A 2GBNA 1RFAA 4MELA 3SDLC 5BYSA 3WAPA 4RH6A 4IM0A 2WXQA 1L0YB 1KLVA 1WIAA 4GXBA 4RGOS 1E6EB 1ISNA 4WAFA 1UF0A 1GC6A 2KXJA 5DPRA 4ICUA 2NCNA 4PK1A 1DOYA 2N7DA 4OZCA 4LTUA 1TZ1A 3VHTC 2X38A 3QWZB 2NBWB 1ZOYB 2KOXA 3SHQA 2L7RA 4A6QA 4GDLB 3U30A 2WNMA 5IO9A 2PE9A 1ZPSA 2OHFA 1C78A 3S2AA 3W9CB 2LXAA 2NMQA 2MBEA 1JROA 3H8HA 3DBRB 3VDZA 3AE8B 1R4NB 4EOYA 1RAXA 2MEKA 3PPAA 1C77A 1D4BA 1BMLC 4KGRA 2WXHA 1KJTA 1YIWA 1QOGA 2RD0A 2J42A 5IOIA 4ZRPA 5T8IA 4C7YA 1V6EA 1JWMD 4K1RB 1FXTB 4L1BA 4US8A 1CJEA 3ZJTA 5JXVA 2KYWA 3AB5A 4HK2A 3RNEC 3BK2A 2ZJDA 3KLSX 3W1SC 4S17A 3AM9A 2K1FA 2INCC 3RPFC 2QIEB 3PT2B 4MJSB 1UGMA 1H8CA 3WALA 2PKOA 1I7HA 2JX5A 2WXRA 3E56A 2W82A 3Q8BA 3SFDB 1YX5B 1DYQA 2JZZA 4HWIB 1L0XB 2QSDA 2KQSA 4RGNA 4JQWC 1KM7A 2LXCA 4B9KA 3PZ7A 2AX5A 2IYDB 4XX5A 1N61A 3ZDTA 3L10B 2SEBD 4A3PA 3PLUA 4P1CC 1WGYA 4I6NB 3LB8C 3OAWA 4LK0M 1AARA 4D2KA 2RGFA 1OQQA 4GOCA 4W9KA 3URYA 2D07B 4E3CA 4NNJB 2NTTA 3RMKC 1P9DU 4RNAA 1I4QA 3FILA 2MLBA 3MC8A 2JY6A 3V60A 4HKQA 4BFRA 3UI3A 1UBQA 2FUHB 3ZNHB 4YWGG 2MWSB 4LNFA 1GB4A 1NDDA 2ZNVB 3NZUA 3OWEB 2TSSA 4US9A 4NJCA 3Q14C 4WJNA 5D3IB 2Y5BB 2KN4A 3DVGX 3BK1A 4RCOA 3GP7A 5D2MB 4FJVB 2LI5A 2DENB 3P4RB 4EZLA 3DBRI 2G9HD 3T8MA 5JZEB 1R4NI 1TS3A 1LXDA 4XE0A 3AU5A 4XC2A 4M02A 1PFDA 1UWXA 1XD3B 2XNAC 4M8NA 2WWZA 2KWDA 4YTPB 3RYTA 1RWSA 2RPQA 4XGAB 1V81A 2AQ3B 4A9AA 2BW2A 3KWVA 3R8BA 2DBYA 2K0PA 2KTRA 5J17A 3BVGA 3HK0A 1UELA 3Q8EA 1PGBA 4XDCA 3V6EB 1WWTA 2VZKB 1JRUA 1WZ3A 4A55A 1I4HA 3NHEB 4A20A 4NZLB 4FJYA 2ZVOA 3P4SB 3NRZA 4NQLB 1N6ZA 3P42A 1N63A 1S3SG 2KHWB 4OZBA 4TQ0A 4BZAA 1FRRA 3RZFA 3FILB 2LJ5A 4AP4C 3BYYB 3ML9A 4USAA 1VRAB 1WGHA 4IG7B 1WGKA 2FCMA 4UDUC 4AUQC 3T3NA 3QARA 4K81A 4W9FA 2LFIA 1F2RI 3WAMA 3EC8A 4DHJD 1KOTA 4NPNA 2YEPF 2KDEB 4C56C 2DZIA 3H7SA 4EZJA 4K7SA 3AE2B 4KSKC 4KKJA 2L32A 3DVGY 4MGIE 3EA6A 1YJIA 1DOXA 4RM9A 5FR3A 3DHHC 2GLSA 1P98A 2JXTA 1FFUA 1TBEA 4R3DA 3MHSD 2QMTA 2DX5B 2BYVE 1KH0A 4GU2A 1WJNA 1FNWA 1FO4A 4ZYNA 1RRBA 1UD7A 3LJ3A 1XXGA 4ANWA 2IY1B 1F0ZA 1LGRA 2N9XA 3W1YA 3BY4B 2L3ZA 2MQJA 4W9JA 1KF6B 2KTRB 2K22A 3QX1A 1ET6A 3MHZA 1NENB 1XCTL 1Z5SB 4DK5A 5DPWA 3B0AA 1T0SC 2VZKD 1FPYA 5D94A 2JU6X 1V1PA 1CK1A 5LLIA 3DBHB 3VTVA 5FR6A 3JW0X 2J53A 4MH0E 5CHFA 1MHHE 3ENEA 1WZ0A 3P63A 3QIJA 1WR6E 2J0KA 4A8XC 3Q8AA 1J7BA 3IAM1 3M95A 2OOBB 4OVVA 2G1EA 2K6DB 1UH6A 4JGHB 4NAWA 2DAFA 1DOIA 1SXTA 4FN2A 3TEXA 1NI3A 2BVCA 1IUEA 1NI2A 3NOBA 1AYFA 4II3B 1XLPA 1EF5A 4PS7A 4DWFA 1ZGUB 3EGRA 2V3SA 2K6QA 3APFA 2HDEA 3N9YC 1L7YA 1IYFA 4TV3A 5L95C 2OJRA 5HG2A 3UINB 2PE6B 4DXGA 2KMMA 3NZSA 4AQ7A 3T9LA 3DQVA 4S0RA 1TKYA 1J8CA 3VRAB 2J0MA 4AS1A 1J7CA 3Q2AC 3AEEB 2DNFA 2GBKA 1E8XA 1OQRA 4RMAA 1WGGA 3NJTA 2LHEA 2KJHB 2JVCA 4OW0A 4EE2A 2WDQB 4JWSC 1NYQA 1RLFA 1WR1A 1S1QB 2IO0B 4JL9A 4NQKE 5KHOA 2YEPB 3DVNU 2BS4B 3DVNV 4BBNC 4LLGM 2GBMA 1JWAD 2WP9B 1TKGA 1D3ZA 3HHMA 1FXIA 3WIMA 3IHPC 2WS3B 4RM8A 4HKZE 2LHDA 3Q3MC 1C79A 2HTME 3IXSA 3H6NA 4DBGA 2V4IB 2W3RA 2OEDA 4N6EB 3CMMB 4KKIA 1V1PB 4N59A 3ALBA 5AZHA 2M0XA 4RF1A 3PSEB 1KTKA 1M4VA 1LM8B 3PZDA 1NYRA 4ZDVA 2LGDA 3PO0A 1WJ6A 2N4FA 1B9RA 3AEAB 2BS2B 1YJ1A 2PLPA 4NAWB 5GMVA 2FE8A 2KC1A 2RDHA 4IC7B 3Q3FA 2KVZA 1L5PA 2E6XA 2K8CA 1K53A 2BPSA 1R4MB 3A33B 3AN1A 3VTUA 3IAS1 1P1AA 4MH8A 3Q3NC 1JWBD 2GOWA 1C4AA 1WXVA 4ZRJA 5H92C 4W9GA 2UYZB 3CWIA 3AEBB 5J18A 3KQ4A 2C60A 1MHXA 4GN1A 5C23A 2QCZA 1R7SA 2FCNA 2L0FA 2M19A 4M00A 5GXGB 1STEA 1VJKA 4N58A 4DQOC 2QJLA 4MGKE 2B3AA 1FXAA 2WX1A 3IG3A 3ZXVA 4A3OA 1F9JA 2MRPA 1SGHA 5BO4B 1FNVA 4OVUA 2RSUA 1PUTA 3I9V1 2BF8B 3SD5A 1JMLA 2L52A 4XZ4A 2KN5A 4Q2JA 2L0TA 1YQ3B 2KDIA 4ARCA 3B1LX 2EMSA 1UGJA 3AH7A 2C5LC 2HE7A 2WXNA 3ZNZB 2LGSA 4BOSC 2KWUB 3P2BA 2FUG1 3HM3A 3A9JA 3PTFC 1GJZA 1TKEA 1IGCA 2D2QA 1HTQA 1J0GA 2X8XX 2M4NA 2IPKD 1I42A 2PVOD 1WXQA 2IO3B 1WM3A 3AE5B 3MFGA 1Z2MA 1C4PA 2I2YA 2MA9B 2M56B 3RZWC 4IUMB 3TEZA 3I63C 3MP9A 4ICVA 4P16A 1GB1A 2AYOB 2C9WB 2SAKA 2D11A 3NVWA 1F77A 5E6OA 1M94A 4IWOA 4FULA 5EE3A 1WJUA 2KFJA 3PVLA 4IWPA 1OFFA 2KK8A 1F2RC 2YLMA 2J4XA 3BVZA 4YSZB 1XT9B 1WMHA 2FNJB 3EFCA 2MBBB 3AECB 2D5GA 2XN9C 3RCZA 1WYWB 3I5JC 1XO3A 1R4MI 4NAMA 4JLCA 2JYEA 1SSNA 2D3BA 4JPSA 4WJOA 3L13A 4CO7A 3TUOA 1C9FA 2WXIA 3L4PA 3DBLB 2V1YA 2ZNVC 2NBVB 1FMAD 3AULA 1T6BX 1TS4A 2KDBA 2NPTA 3VAWA 2BKFA 1Q0WB 1SE4A 1MVKA 3VUYA 2KWVB 2JPHA 1GPXA 1JWUD 1SB3C 3ONSA 2GI9A 3U52E 4BKGA 1V8CA 2JWZA 1WXMA 1V9JA 4M8MA 2ZW1A 1TJEA 3VQIA 1ENFA 1SJED 4ZRQA 3PHXB 3N20C 2CU3A 1L4ZB 3A9JB 2HJ8A 1K51A 1NBFC 4TQ1A 4B0EA 5DPTA 3OJ3A 2KC2A 4FJZA 4WH4A 4URKA 2NBUA 3UQAA 4FA6A 1OTRB 4M01A 2WX0A 1YMHE 2ZCCA 4WIPA 4B0MA 2KWCA 2JXXA 4ZHOA 4K7WA 2BBCA 4WWNA 1CZPA 3QJZA 2FAZA 2ZW0A 1T0YA 4MGYE 1HXYD 2AQ1B 1SE9A 1TY2A 4DHJB 1YN5A 1KFYB 1QZEA 3V05A 1WMHB 3V62A 1QLBB 2R2OA 5AUIA 1SE2A 3HVZA 3ZUNA 3WAOA 3NVYA 5MPOA 4K3CA 2EMTA 3SR6A 2WQYB 1L4DB 1Y8RC 1WYGA 4KIKA 2BS3B 1P7FA 2BKRB 1FM0D 2BWFA 1I4RA 2MBQA 2UU7A 5JH5C 1TS5A 2RPVA 4LNIA 3RFZB 3DWMA 2KLGA 3NG0A 3U4EG 3P4QB 3U2SC 5CHVC 2WXOA 4XDDA 3DOWA 4EUTA 3DBSA 5EE1A 5JHAA 1E8YA 3MC9A 4W9HA 1VLBA 5IN7A 3AE1B 3DBLI 5BMIA 4WWPA 4ANXA 4KZ0A 3A9KA 1RFKA 1ZW7A 1FIQA 2K25A 3VR9B 2KFKA 1C3TA 2KJRA 2WXMA 4MEMA 1UUPA 1T3QA 1E0ZA 4KGTA 4IWQA 1QT9A 4TSSA 5KHQA 4J6IA 3Q69A 3L16A 1I4GA 2LRWA 4GMVA 4EEWA 4JX1C 2V3PA 2PIAA 3P1MA 3R3MA 2JT4B 2KD0A 3FKYA 4WURA 4M0WA 5EE0A 3PGEA 2WXLA 3NY5A 3VR8B 1GC7A 3ZRCA 2BB6A 3V3XA 2LJIA 3N3KB 2RDBC 2A5UA 2MJ3A 4H2AA 3TBLD 1OGWA 4I6PA 1V1OA 2MBHA 4TUUA 4LNKA 2CR5A 1T5XD 2JRHA 2LMCA 3KUDB 2LVQA 3TL5A 2PTLA 4K7UA 1SIFA 1QILA 3ABVB 1E8ZA 2FIFA 3FC4A 4GB9A 2DHZA 1N62A 3A4RA 3MJWA 3H7PA 1D5MC 4KIKB 3TIXA 3R66C 2V9HA 1L6VA 4HPPA 2GB1A 5CTRC 2NR2A 3ETRA 1UZXB 5C1ZA 1WM2A 2Y5PA 2B76B 4ZRKA 1EU4A 2UWQA 2C7NB 2REXA 3N1YC 4RGMA 3KW5B 5G55A 5I4DA 5D3DA 1NEKB 4J3OD 1QQRA 4ACFA 2VH2A 1N60A 1ZKHA 1OQYA 2IBIB 1EF1A 5AZFA 4BKTA 3W2DA 2LGIA 4WJQA 2CS4A 2MP2A 4WWOA 3A9KB 1XF5L 2KFKB 2AQ2B 3VVWB 2KKCA 2WXKA 1JWSD 1VR9A 3RT3B 4AOFA 5G2NA 2J7QB 2BGFA 4C00A 3UQBA 3WANA 5EDSA 1E10A 1SF0A 4ASWC 3CSFA 3JYUA 2KJ6A 4IOIE 3AMZA 4CQNA 4M0WB 2R2QA 2QILA 2AL6A 4X57B 2DAJA 1PGAA 3PREA 1K8RB 3OLMD 2WDVB 2DZMA 2M8SA 4IKGA 2XK5A 2GBRA 4P1BC 3VXWA 2KMAA 1PQSA 2Z0EB 3Q3JA 4K3BA 2KX3A 4ANUA 2PJHA 5C3JB 3RNAC 4AWJA 4JE3B 1U4AA 2LVOA 2WXJA 2WXPA 3H9DA 1L2NA 2NTSA 5AZGA 3OG5A 5AEKB 4EKUA 3AU4A 1D5XC 1QKZA 1UBIA 3KYCD 4KGSA 1BXTA 1YN3A 1AN8A 3KVFB 4XWTA 2HJ1A 3H7PB 3T3OA 2W9NA 1XEEA 3IBEA 4MGZE 2ASQA 2LGYA 4DXFA 3AE3B 3GE8C 3DHGC 1J19A 1P0RA 3B08A 3L54A 2O6VD 1A70A 4TKNA 2RDGA 4AJYB 1WX9A 1ET9A 1WX7A 3ZJUA 4MM3A 2BB5A 4C7ZA 3VH3B 4II2B 4WWMA 2WXFA 3DCGA 3IFWB 3ZYYX 3B2GA 3ZW3A 1YQBA 2MP2B 2BT6A 3KYDD 3U7ZA 3ZQ4A 4PS3A 4C4VA 3BYTB 3EHVA 2JUOA 3EECA 2LVPA 4I6LB 1E8WA 2WDRB 2L05A 2MH7A 3VTWA 5DPSA 2JF5A 4NY0A 3BIID 4LNNA 2D3GA 1A5RA 3MJ5A 3BWUD 1IBXA 1L0VB 2L1AA 4DDGD 2VRRB 5D7GA 2H88B 2XK5B 3R2IA 2EKEC 1ZDXA 2ON8A 1GAQB 1OEYJ 1N5XA 3QC8B 2ZPYA 1GUAB 3ZDMC 3GZNB 3LYYA 3ZNGC 2ICIA 1VZ7A 3LDZE 2PPHA 2KVRA 1MI0A 4KV2A 1JALA 1V2YA 2M17A 2DYOA 1ZUD2 2FIDA 5LXHA 3UIPB 2G4SA 1L6UA 2CHZA 1N5WA 2IY0B 5IAAC 4W9LA 1H4RA 3MTNB 3GB1A 1ESFA 1WJ4A 1V49A 1QOBA 3M3JA 2GMIC 2MW5A 3LXFA 1WX8A 4C80A 2GRIA 3ZVVA 4MSQB 1D5ZC 2JYTA 2KDMA 5TR5A 3V61A 4YL8A 3CSTA 3KUCB 3ZTCA 2CJOA 2HD5B 2JSVX 4OHJA 3Q3OC 2W54A 4MM3B 2WLBA 3FAHA 3V6CB 2Q5WD 4MSMB 1YD8U 5FKAC 4W9CA 3E9SA 4O1NA 4YSXB 3QK0A 2ACZB 1D6EC 3VUXA 5EE9A 2L00B 3ZIMA 4E74A 3AE4B 4C4VB 4FHKA 1Y56A 4PYUA 4REZA 5TSSA 1AW7A 1BT0A 4QAYA 4WQMA 2GBJA 5HFYA 2N1VA 2O2VA 4DHZE 2IJ0A 2JRIB 3B2FA 4P7IA 1WFYA 1IBXB 3Q8CA 1WH3A 2JWUA 4OZAA 4GDKA 2FCSA 2N7JA 3DDCB 4F8CB 4RFBA 3BVMA 4HDQA 4RGTA 3AE7B 1PGXA 1V86A 3GS2A 3AI5A 1PDXA 1Q5WB 2KX0A 2I1KA 4ITKA 4GSWA 2QEJC 1LO5D 4B95A 1KLUD 4FHJA 3X23A 2D10A 4KVGB 1F52A 1IGDA 4IDIA 5C2TB 3GZNI 3AEDB 2DZJA 2RMMA 2W55A 4LDTD 2IZVB 2DZKA 2DYMA 3QQ8B 3M62B 2KQ7A 4CYEA 1XQQA 1YX6B 2JZ3B 1HZ6A 2INPE 4KDIC 1UWMA 3ZGZA 4HPLB 2BYTA 1FD6A 3W1SA 4A90A 2R61A 3D32A 1AWDA 4YTMB 3VRBB 1ZE3D 1VDVA 2K9XA 2N9PC 4YSYB 2G45B 1WF9A 1E9MA 3X0WA 3N1ZC 1MG8A 3ZJVA 4HXDA 4GIVA 5HHDG 2K8HA 2IGDA 2LASA 3WA0A 3ZRFA 3HVDA 2IGGA 1P7EA 1ROEA 5JHBA 4GLSC 4EZKA 2PW9A 3DPDA 3NVVA 2KDFB 4FLHA 3I57A 1RM6C 3PV1A 3HM6X 2O2VB 1ZXIA 5HI1A 5BMGA 2IGHA 5LXIB 2N9LA 4W9IA 1I35A 2C7HA 4GGQA 4GDKB 3R7QA 3JVZX 3VFKA 4HCNB 3SU8X 3TJPA 2KQ4X 2MSED 1GOZA 1YNTE 1WE7A 3H1UA 2WU2B 4N9F4 3O13A 1YJJA 2EKIA 2H89B 2YVCA 4EFOA 2Y5CA 3Q6BA 4ZYSA 1LFDA 3ZNID 4YT0B 4HCPB 4HPMB 2LUMA 3IVFA 1RYJA 1VCBA 2I1JA 4MT5A 3RNBC 1FCLA 4W9EA 4G50A 1ZP0B 1DGJA 2N9KA 4B6WA 5BYRA 3ZLZA 1C4CA 4CHKA 4LCDE 1TYGB 5E6NA 3AXCA 3W5VB 4HLEA 2O6VA 2G4DB 3RNFC 4BAXA 4RF0A 2NPTB 3U7DA 4KX6B 1CMXB 2MHJA 1PYWD 2ZEQA 2KZRA 5FK9C 2ZPNA 4HRSA 4NJ7A 1T0RC 2ZCBA 2XEWA 3N32A 1I4PA 5CX3A 3AV8A 1P3QU 3APDA 3NS8A 2BQQA 3QAQA 1ZXHA 1F1HA 1EU3A 2K39A 3BZDB 3A1QA 3NS1A 4L23A 3KH0A 3MC0B 5D6JB 1EWCA 3RUIB 3IT6B 2FBWB 3AE9B 4HROA 3ZKJC
chains in the Genus database with same CATH topology
3W1SC 2LVOA 3L17A 3H9DA 1L2NA 5AZGA 2FCNA 1LQBA 1HE8A 5AEKB 2L0FA 2K1FA 4EKUA 3AU4A 3PT2B 4MJSB 1UGMA 4MGKE 4HDOA 4BKSA 2B3AA 2WX1A 3IG3A 1H8CA 1UBIA 3KYCD 3WALA 4A3OA 1C1YB 1F9JA 2MRPA 1SGHA 5BO4B 1YX5B 3KVFB 2JZZA 4OVUA 3H7PB 2RSUA 3M63B 3QCAA 4HWIB 1Q1OA 2KQSA 2W9NA 3UF8A 2KO3A 4JQWC 1KM7A 2BF8B 2KLCA 2LXCA 3IBEA 4MGZE 2ASQA 2LGYA 2NVUI 3SD5A 4B9KA 1OEYA 4IW0A 2IYDB 1WXAA 4XX5A 4XZ4A 2KN5A 3ZDTA 1J19A 3L10B 1P0RA 4A3PA 3B08A 3L54A 3PLUA 2O6VD 2LD9A 1WGYA 4I6NB 4TKNA 2L0TA 4AJYB 3OAWA 5L83A 2KDIA 1WX9A 2FCQA 3B1LX 2EMSA 3L08A 1WX7A 1AARA 4MM3A 3EFUA 2C5LC 2HE7A 2RGFA 4GOCA 3ZNZB 4W9KA 3VH3B 2D07B 4DDID 4II2B 3PRMB 4BOSC 4E3CA 2KWUB 3P2BA 4NNJB 3DCGA 3IFWB 1P9DU 5CHWA 3HM3A 3A9JA 2MLBA 5E6PA 3ZW3A 3PTFC 1GJZA 1YQBA 2D2QA 2JY6A 1E7VA 2MP2B 3KYDD 3V60A 2O6VB 4BFRA 1J0GA 1WRDB 2M4NA 2LRUA 1UBQA 2FUHB 4IM3A 3ZNHB 1I42A 3PLVA 2MWSB 3APCA 2IO3B 1WM3A 1NDDA 1Z2MA 2ZNVB 3PHWB 3NZUA 2N1WA 4PS3A 3R7RA 2MA9B 3EHVA 2JUOA 3EECA 4WAAA 2BYEA 3RZWC 2LVPA 2M1MA 1E8WA 4I6LB 2L05A 4WJNA 3VTWA 5DPSA 4IUMB 2JF5A 4NY0A 2D3GA 4ICVA 1A5RA 2Y5BB 2LWPA 3DVGX 2CHWA 2AYOB 1IPGA 2C9WB 5D2MB 2D11A 4FJVB 5E6OA 2N9EB 4DDGD 1EO6A 2VRRB 1M94A 5D7GA 4IWOA 4FULA 1WJUA 2XK5B 2KFJA 2LI5A 2DENB 2EKEC 4G11A 4E71A 3PVLA 2RR9A 3A1QB 4IWPA 2KK8A 2YLMA 4LJPB 3TCAA 4PYZA 3RULA 1OEYJ 4EZLA 3QC8B 2ZPYA 2MCNB 3DBRI 1XT9B 1VD2A 1GUAB 1WMHA 2FNJB 3T8MA 3ZDMC 2MBBB 5JZEB 1R4NI 3RCZA 2CU1A 3ZNGC 1LXDA 1WYWB 3AU5A 1R4MI 4XC2A 3LDZE 2PPHA 2KTFA 3K9OB 1WY8A 4JLCA 2KVRA 1XD3B 3O65B 4KV2A 2IO1B 4M8NA 1V2YA 2WWZA 4AJWA 3L0WB 2M17A 4WJOA 1GG3A 3RYTA 2DYOA 2LZ6A 2N7EA 1V80A 2FIDA 2RPQA 1V81A 3L13A 4CO7A 5LXHA 3UIPB 2G4SA 2V1YA 2CHZA 2ZNVC 2IY0B 5IAAC 2KTRA 4W9LA 2NBVB 1H4RA 3MTNB 5J17A 3HK0A 1UELA 3AULA 1WJ4A 1V49A 3M3JA 2GMIC 2MW5A 3ZO5B 1WX8A 3V6EB 4BBNF 2KDBA 3PS6A 3GOEA 2NPTA 4MSQB 3ZVVA 3VAWA 1JRUA 2BKFA 1Q0WB 1WZ3A 2PEAA 2C7MB 3VUYA 2KWVB 3NHEB 2LGXA 5TR5A 3V61A 2V4LA 4YL8A 4A20A 3CSTA 2ZVNA 3KUCB 4FJYA 2ZVOA 3ZTCA 3PRZA 2JPHA 4WJPA 2HD5B 4NQLB 4F7ZA 3ONSA 4BKGA 2JWZA 3JSVA 1S3SG 2KHWB 3K9PB 1WXMA 1V9JA 4M8MA 1E5WA 4TQ0A 3V6CB 2WDTB 4MSMB 1YD8U 3I3TB 1G6JA 4W9CA 3VQIA 3PHXB 3C0RB 4DHZB 3RZFA 3QK0A 2IO2B 2MBOA 2LJ5A 3A9JB 4HJKA 5HKHA 4AP4C 2HTHA 2HJ8A 3ML9A 1WGHA 4IG7B 3VUXA 1NBFC 2FCMA 4TQ1A 4AUQC 2L00B 2XBBC 3QARA 2L8JA 4K81A 4W9FA 5DPTA 3ZIMA 2CKHB 3OJ3A 3CF6E 2K8BA 2KC2A 4FJZA 3EC8A 4FHKA 3WAMA 4DHJD 2NBUA 3QHTA 3UIOB 4URKA 1KOTA 4PYUA 3ML8A 3UQAA 4NPNA 4FA6A 2KDEB 1OTRB 2DZIA 1BT0A 3H7SA 4EZJA 4K7SA 4KSKC 2WX0A 3DVGY 4LJOB 4MGIE 2GBJA 2N1VA 2O2VA 2ZCCA 4E74A 2KWCA 4RM9A 4DHZE 1P98A 2JXXA 2JRIB 4K7WA 4WWNA 4KDLB 4P7IA 1WFYA 1WGRA 3QJZA 1TBEA 1WH3A 2FAZA 1T0YA 3MHSD 2BWES 4GDKA 4MGYE 2Z59B 2FCSA 1SE9A 2DX5B 4BVUC 2BYVE 3DDCB 1V5OA 4F8CB 4DHJB 4HDQA 1QZEA 3A4SC 4GU2A 1WJNA 5J2RA 4DXAB 3HIZA 1WMHB 4W9DA 3V62A 3QA8A 2AL3A 2R2OA 4ZYNA 1RRBA 1UD7A 1V86A 3ZUNA 3AI5A 3WAOA 3LJ3A 3N30A 1E7UA 1Q5WB 2KX0A 1X1MA 2I1KA 4ANWA 2EMTA 2IY1B 4GSWA 4B95A 2KNBA 1Y8RC 2N9XA 4FHJA 4KIKA 3BY4B 3VH4B 3W1YA 3X23A 2L3ZA 4BKSD 2BKRB 2MQJA 4FBJB 2BWFA 4W9JA 2MBQA 4WQOB 3PRPB 2D10A 5JH5C 4KVGB 2AWTA 2KTRB 3QX1A 3GZNI 1Z5SB 4BOZB 2KLGA 1V5TA 2DZJA 3RD2A 3B0AA 4LDTD 2IZVB 4DK5A 5DPWA 1WI0A 3TMPB 2DZKA 2DYMA 3QQ8B 5D94A 3M62B 2KQ7A 5LLIA 4CYEA 5CHVC 1WGDA 3VTVA 4JIOU 3OJ4B 1XQQA 2Z0DB 3DBHI 3DOWA 3DBSA 4EUTA 5FR6A 3JW0X 1YX6B 1WE6A 2CHXA 2JZ3B 4KSLC 4MH0E 5CHFA 5JHAA 3ENEA 1E8YA 4W9HA 1WZ0A 4KDIC 4HPLB 3QIJA 1WR6E 2J0KA 3DBLI 4HVBA 3W1SA 4PS8A 2G3QB 3D32A 4WWPA 2KMCA 4ANXA 4KZ0A 3M95A 3A9KA 3JSVB 4GDLA 1ZW7A 2K25A 2OOBB 3ZTDA 1C3TA 2KFKA 4OVVA 2KJRA 2K6DB 1UH6A 4LDTB 2N9PC 4MEMA 4FADA 4JGHB 4NAWA 2DAFA 4FN2A 4IWQA 5KHQA 4J6IA 1NI2A 2DYBA 2G45B 1WF9A 2L76A 1GNUA 3NOBA 3X0WA 3L16A 2LRWA 4GMVA 1MG8A 4II3B 4ZRIA 1EF5A 4PS7A 3VUWA 1ZGUB 4DWFA 4EEWA 4HXDA 2V3SA 1E90A 4GIVA 2K8HA 3R3MA 2MX2A 1WXSA 2JT4B 2K6QA 2KD0A 3APFA 5DCNA 2LASA 3WA0A 3ZRFA 1IYFA 1L7YA 4TV3A 3PGEA 3NY5A 1GC7A 5L95C 2OJRA 5JHBA 3UINB 3ZRCA 2KANA 2PE6B 4IM2A 1EUVB 2ZZPB 4EZKA 3DPDA 4FLHA 2KDFB 3NZSA 3T9LA 3DQVA 2LUEA 1J8CA 3N3KB 2A5UA 2J0MA 3PV1A 2J0JA 2WYQA 2O2VB 3HM6X 3TBLD 1OGWA 2QHOA 4I6PA 4G3XB 3KUZA 3UGBB 2GBKA 2MBHA 1E8XA 4TUUA 3BINA 4RMAA 5LXIB 1WGGA 4W9IA 1I35A 2C7HA 4MDKE 3ECIA 4GGQA 4F1SA 4GDKB 3R7QA 4G0NB 2CR5A 4ANVA 3JVZX 2KJHB 2A4ZA 2JVCA 4HCNB 2BYFA 3VFKA 2JRHA 4KZCA 3SU8X 4NJ6A 1RLFA 1TGZB 1WR1A 2AEHA 2LVQA 3KUDB 1S1QB 3TJPA 3TL5A 1IP9A 2MSED 4MJSA 4K7UA 5IA7A 2IO0B 4JL9A 1SIFA 1E8ZA 2FIFA 4NQKE 1WE7A 5KHOA 3DVNU 3H1UA 3U8ZA 1TTNA 3DVNV 4N9F4 2NS5A 4BBNC 4GB9A 2GBNA 1RFAA 4MELA 2DHZA 2GBMA 3A4RA 3MJWA 3H7PA 3SDLC 1D3ZA 3HHMA 3WAPA 2YVCA 4IM0A 4KIKB 3TIXA 3R66C 3WIMA 3IHPC 4EFOA 1KLVA 5CTRC 1WIAA 2NR2A 4GXBA 1UZXB 1LFDA 3ZNID 5C1ZA 4RM8A 1ISNA 1WM2A 4HCPB 4ZRKA 1GC6A 2KXJA 4HPMB 5DPRA 2UWQA 2C7NB 3H6NA 4ICUA 4DBGA 2REXA 2NCNA 3IVFA 3CMMB 2N7DA 1VCBA 3KW5B 5G55A 2I1JA 3ALBA 4W9EA 5AZHA 2M0XA 3PSEB 4G50A 1TZ1A 4B6WA 1LM8B 3VHTC 3ZLZA 1ZKHA 3PZDA 4CHKA 4LCDE 1OQYA 2IBIB 4ZDVA 5E6NA 3AXCA 3QWZB 1EF1A 2LGDA 5AZFA 4BKTA 2NBWB 2KOXA 4WJQA 1WJ6A 2CS4A 3SHQA 2N4FA 2MP2A 2L7RA 4WWOA 4HLEA 3A9KB 4GDLB 2O6VA 3U30A 2G4DB 2KFKB 3VVWB 2KKCA 2NPTB 1YJ1A 2PE9A 3RT3B 3U7DA 4NAWB 1CMXB 3S2AA 2ZEQA 4AOFA 5GMVA 2KZRA 2LXAA 5G2NA 2ZPNA 2KC1A 2MBEA 2J7QB 4NJ7A 4IC7B 3Q3FA 2ZCBA 3VDZA 2K8CA 2BGFA 4EOYA 3WANA 5EDSA 2XEWA 1RAXA 3N32A 3UQBA 2BPSA 4ASWC 3PPAA 3CSFA 3JYUA 2KJ6A 3A33B 5CX3A 4M0WB 2R2QA 3VTUA 1P3QU 2AL6A 4X57B 3APDA 1KJTA 2DAJA 3PREA 3NS8A 1K8RB 1P1AA 1YIWA 3OLMD 2DZMA 2M8SA 2GOWA 2RD0A 1WXVA 2XK5A 3QAQA 2GBRA 2K39A 3VXWA 4ZRJA 3A1QA 2KMAA 4W9GA 2UYZB 1PQSA 2Z0EB 1V6EA 3Q3JA 2KX3A 4K1RB 4ANUA 3KH0A 2PJHA 1FXTB 5D6JB 5J18A 3RUIB 4AWJA 2C60A 4HK2A 4GN1A 1U4AA 5C23A 2ZJDA 3ZKJC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W1S C;  2LVO A;  3L17 A;  3H9D A;  1L2N A;  5AZG A;  2FCN A;  1LQB A;  1HE8 A;  5AEK B;  2L0F A;  2K1F A;  4EKU A;  3AU4 A;  3PT2 B;  4MJS B;  1UGM A;  4MGK E;  4HDO A;  4BKS A;  2B3A A;  2WX1 A;  3IG3 A;  1H8C A;  1UBI A;  3KYC D;  3WAL A;  4A3O A;  1C1Y B;  1F9J A;  2MRP A;  1SGH A;  5BO4 B;  1YX5 B;  3KVF B;  2JZZ A;  4OVU A;  3H7P B;  2RSU A;  3M63 B;  3QCA A;  4HWI B;  1Q1O A;  2KQS A;  2W9N A;  3UF8 A;  2KO3 A;  4JQW C;  1KM7 A;  2BF8 B;  2KLC A;  2LXC A;  3IBE A;  4MGZ E;  2ASQ A;  2LGY A;  2NVU I;  3SD5 A;  4B9K A;  1OEY A;  4IW0 A;  2IYD B;  1WXA A;  4XX5 A;  4XZ4 A;  2KN5 A;  3ZDT A;  1J19 A;  3L10 B;  1P0R A;  4A3P A;  3B08 A;  3L54 A;  3PLU A;  2O6V D;  2LD9 A;  1WGY A;  4I6N B;  4TKN A;  2L0T A;  4AJY B;  3OAW A;  5L83 A;  2KDI A;  1WX9 A;  2FCQ A;  3B1L X;  2EMS A;  3L08 A;  1WX7 A;  1AAR A;  4MM3 A;  3EFU A;  2C5L C;  2HE7 A;  2RGF A;  4GOC A;  3ZNZ B;  4W9K A;  3VH3 B;  2D07 B;  4DDI D;  4II2 B;  3PRM B;  4BOS C;  4E3C A;  2KWU B;  3P2B A;  4NNJ B;  3DCG A;  3IFW B;  1P9D U;  5CHW A;  3HM3 A;  3A9J A;  2MLB A;  5E6P A;  3ZW3 A;  3PTF C;  1GJZ A;  1YQB A;  2D2Q A;  2JY6 A;  1E7V A;  2MP2 B;  3KYD D;  3V60 A;  2O6V B;  4BFR A;  1J0G A;  1WRD B;  2M4N A;  2LRU A;  1UBQ A;  2FUH B;  4IM3 A;  3ZNH B;  1I42 A;  3PLV A;  2MWS B;  3APC A;  2IO3 B;  1WM3 A;  1NDD A;  1Z2M A;  2ZNV B;  3PHW B;  3NZU A;  2N1W A;  4PS3 A;  3R7R A;  2MA9 B;  3EHV A;  2JUO A;  3EEC A;  4WAA A;  2BYE A;  3RZW C;  2LVP A;  2M1M A;  1E8W A;  4I6L B;  2L05 A;  4WJN A;  3VTW A;  5DPS A;  4IUM B;  2JF5 A;  4NY0 A;  2D3G A;  4ICV A;  1A5R A;  2Y5B B;  2LWP A;  3DVG X;  2CHW A;  2AYO B;  1IPG A;  2C9W B;  5D2M B;  2D11 A;  4FJV B;  5E6O A;  2N9E B;  4DDG D;  1EO6 A;  2VRR B;  1M94 A;  5D7G A;  4IWO A;  4FUL A;  1WJU A;  2XK5 B;  2KFJ A;  2LI5 A;  2DEN B;  2EKE C;  4G11 A;  4E71 A;  3PVL A;  2RR9 A;  3A1Q B;  4IWP A;  2KK8 A;  2YLM A;  4LJP B;  3TCA A;  4PYZ A;  3RUL A;  1OEY J;  4EZL A;  3QC8 B;  2ZPY A;  2MCN B;  3DBR I;  1XT9 B;  1VD2 A;  1GUA B;  1WMH A;  2FNJ B;  3T8M A;  3ZDM C;  2MBB B;  5JZE B;  1R4N I;  3RCZ A;  2CU1 A;  3ZNG C;  1LXD A;  1WYW B;  3AU5 A;  1R4M I;  4XC2 A;  3LDZ E;  2PPH A;  2KTF A;  3K9O B;  1WY8 A;  4JLC A;  2KVR A;  1XD3 B;  3O65 B;  4KV2 A;  2IO1 B;  4M8N A;  1V2Y A;  2WWZ A;  4AJW A;  3L0W B;  2M17 A;  4WJO A;  1GG3 A;  3RYT A;  2DYO A;  2LZ6 A;  2N7E A;  1V80 A;  2FID A;  2RPQ A;  1V81 A;  3L13 A;  4CO7 A;  5LXH A;  3UIP B;  2G4S A;  2V1Y A;  2CHZ A;  2ZNV C;  2IY0 B;  5IAA C;  2KTR A;  4W9L A;  2NBV B;  1H4R A;  3MTN B;  5J17 A;  3HK0 A;  1UEL A;  3AUL A;  1WJ4 A;  1V49 A;  3M3J A;  2GMI C;  2MW5 A;  3ZO5 B;  1WX8 A;  3V6E B;  4BBN F;  2KDB A;  3PS6 A;  3GOE A;  2NPT A;  4MSQ B;  3ZVV A;  3VAW A;  1JRU A;  2BKF A;  1Q0W B;  1WZ3 A;  2PEA A;  2C7M B;  3VUY A;  2KWV B;  3NHE B;  2LGX A;  5TR5 A;  3V61 A;  2V4L A;  4YL8 A;  4A20 A;  3CST A;  2ZVN A;  3KUC B;  4FJY A;  2ZVO A;  3ZTC A;  3PRZ A;  2JPH A;  4WJP A;  2HD5 B;  4NQL B;  4F7Z A;  3ONS A;  4BKG A;  2JWZ A;  3JSV A;  1S3S G;  2KHW B;  3K9P B;  1WXM A;  1V9J A;  4M8M A;  1E5W A;  4TQ0 A;  3V6C B;  2WDT B;  4MSM B;  1YD8 U;  3I3T B;  1G6J A;  4W9C A;  3VQI A;  3PHX B;  3C0R B;  4DHZ B;  3RZF A;  3QK0 A;  2IO2 B;  2MBO A;  2LJ5 A;  3A9J B;  4HJK A;  5HKH A;  4AP4 C;  2HTH A;  2HJ8 A;  3ML9 A;  1WGH A;  4IG7 B;  3VUX A;  1NBF C;  2FCM A;  4TQ1 A;  4AUQ C;  2L00 B;  2XBB C;  3QAR A;  2L8J A;  4K81 A;  4W9F A;  5DPT A;  3ZIM A;  2CKH B;  3OJ3 A;  3CF6 E;  2K8B A;  2KC2 A;  4FJZ A;  3EC8 A;  4FHK A;  3WAM A;  4DHJ D;  2NBU A;  3QHT A;  3UIO B;  4URK A;  1KOT A;  4PYU A;  3ML8 A;  3UQA A;  4NPN A;  4FA6 A;  2KDE B;  1OTR B;  2DZI A;  1BT0 A;  3H7S A;  4EZJ A;  4K7S A;  4KSK C;  2WX0 A;  3DVG Y;  4LJO B;  4MGI E;  2GBJ A;  2N1V A;  2O2V A;  2ZCC A;  4E74 A;  2KWC A;  4RM9 A;  4DHZ E;  1P98 A;  2JXX A;  2JRI B;  4K7W A;  4WWN A;  4KDL B;  4P7I A;  1WFY A;  1WGR A;  3QJZ A;  1TBE A;  1WH3 A;  2FAZ A;  1T0Y A;  3MHS D;  2BWE S;  4GDK A;  4MGY E;  2Z59 B;  2FCS A;  1SE9 A;  2DX5 B;  4BVU C;  2BYV E;  3DDC B;  1V5O A;  4F8C B;  4DHJ B;  4HDQ A;  1QZE A;  3A4S C;  4GU2 A;  1WJN A;  5J2R A;  4DXA B;  3HIZ A;  1WMH B;  4W9D A;  3V62 A;  3QA8 A;  2AL3 A;  2R2O A;  4ZYN A;  1RRB A;  1UD7 A;  1V86 A;  3ZUN A;  3AI5 A;  3WAO A;  3LJ3 A;  3N30 A;  1E7U A;  1Q5W B;  2KX0 A;  1X1M A;  2I1K A;  4ANW A;  2EMT A;  2IY1 B;  4GSW A;  4B95 A;  2KNB A;  1Y8R C;  2N9X A;  4FHJ A;  4KIK A;  3BY4 B;  3VH4 B;  3W1Y A;  3X23 A;  2L3Z A;  4BKS D;  2BKR B;  2MQJ A;  4FBJ B;  2BWF A;  4W9J A;  2MBQ A;  4WQO B;  3PRP B;  2D10 A;  5JH5 C;  4KVG B;  2AWT A;  2KTR B;  3QX1 A;  3GZN I;  1Z5S B;  4BOZ B;  2KLG A;  1V5T A;  2DZJ A;  3RD2 A;  3B0A A;  4LDT D;  2IZV B;  4DK5 A;  5DPW A;  1WI0 A;  3TMP B;  2DZK A;  2DYM A;  3QQ8 B;  5D94 A;  3M62 B;  2KQ7 A;  5LLI A;  4CYE A;  5CHV C;  1WGD A;  3VTV A;  4JIO U;  3OJ4 B;  1XQQ A;  2Z0D B;  3DBH I;  3DOW A;  3DBS A;  4EUT A;  5FR6 A;  3JW0 X;  1YX6 B;  1WE6 A;  2CHX A;  2JZ3 B;  4KSL C;  4MH0 E;  5CHF A;  5JHA A;  3ENE A;  1E8Y A;  4W9H A;  1WZ0 A;  4KDI C;  4HPL B;  3QIJ A;  1WR6 E;  2J0K A;  3DBL I;  4HVB A;  3W1S A;  4PS8 A;  2G3Q B;  3D32 A;  4WWP A;  2KMC A;  4ANX A;  4KZ0 A;  3M95 A;  3A9K A;  3JSV B;  4GDL A;  1ZW7 A;  2K25 A;  2OOB B;  3ZTD A;  1C3T A;  2KFK A;  4OVV A;  2KJR A;  2K6D B;  1UH6 A;  4LDT B;  2N9P C;  4MEM A;  4FAD A;  4JGH B;  4NAW A;  2DAF A;  4FN2 A;  4IWQ A;  5KHQ A;  4J6I A;  1NI2 A;  2DYB A;  2G45 B;  1WF9 A;  2L76 A;  1GNU A;  3NOB A;  3X0W A;  3L16 A;  2LRW A;  4GMV A;  1MG8 A;  4II3 B;  4ZRI A;  1EF5 A;  4PS7 A;  3VUW A;  1ZGU B;  4DWF A;  4EEW A;  4HXD A;  2V3S A;  1E90 A;  4GIV A;  2K8H A;  3R3M A;  2MX2 A;  1WXS A;  2JT4 B;  2K6Q A;  2KD0 A;  3APF A;  5DCN A;  2LAS A;  3WA0 A;  3ZRF A;  1IYF A;  1L7Y A;  4TV3 A;  3PGE A;  3NY5 A;  1GC7 A;  5L95 C;  2OJR A;  5JHB A;  3UIN B;  3ZRC A;  2KAN A;  2PE6 B;  4IM2 A;  1EUV B;  2ZZP B;  4EZK A;  3DPD A;  4FLH A;  2KDF B;  3NZS A;  3T9L A;  3DQV A;  2LUE A;  1J8C A;  3N3K B;  2A5U A;  2J0M A;  3PV1 A;  2J0J A;  2WYQ A;  2O2V B;  3HM6 X;  3TBL D;  1OGW A;  2QHO A;  4I6P A;  4G3X B;  3KUZ A;  3UGB B;  2GBK A;  2MBH A;  1E8X A;  4TUU A;  3BIN A;  4RMA A;  5LXI B;  1WGG A;  4W9I A;  1I35 A;  2C7H A;  4MDK E;  3ECI A;  4GGQ A;  4F1S A;  4GDK B;  3R7Q A;  4G0N B;  2CR5 A;  4ANV A;  3JVZ X;  2KJH B;  2A4Z A;  2JVC A;  4HCN B;  2BYF A;  3VFK A;  2JRH A;  4KZC A;  3SU8 X;  4NJ6 A;  1RLF A;  1TGZ B;  1WR1 A;  2AEH A;  2LVQ A;  3KUD B;  1S1Q B;  3TJP A;  3TL5 A;  1IP9 A;  2MSE D;  4MJS A;  4K7U A;  5IA7 A;  2IO0 B;  4JL9 A;  1SIF A;  1E8Z A;  2FIF A;  4NQK E;  1WE7 A;  5KHO A;  3DVN U;  3H1U A;  3U8Z A;  1TTN A;  3DVN V;  4N9F 4;  2NS5 A;  4BBN C;  4GB9 A;  2GBN A;  1RFA A;  4MEL A;  2DHZ A;  2GBM A;  3A4R A;  3MJW A;  3H7P A;  3SDL C;  1D3Z A;  3HHM A;  3WAP A;  2YVC A;  4IM0 A;  4KIK B;  3TIX A;  3R66 C;  3WIM A;  3IHP C;  4EFO A;  1KLV A;  5CTR C;  1WIA A;  2NR2 A;  4GXB A;  1UZX B;  1LFD A;  3ZNI D;  5C1Z A;  4RM8 A;  1ISN A;  1WM2 A;  4HCP B;  4ZRK A;  1GC6 A;  2KXJ A;  4HPM B;  5DPR A;  2UWQ A;  2C7N B;  3H6N A;  4ICU A;  4DBG A;  2REX A;  2NCN A;  3IVF A;  3CMM B;  2N7D A;  1VCB A;  3KW5 B;  5G55 A;  2I1J A;  3ALB A;  4W9E A;  5AZH A;  2M0X A;  3PSE B;  4G50 A;  1TZ1 A;  4B6W A;  1LM8 B;  3VHT C;  3ZLZ A;  1ZKH A;  3PZD A;  4CHK A;  4LCD E;  1OQY A;  2IBI B;  4ZDV A;  5E6N A;  3AXC A;  3QWZ B;  1EF1 A;  2LGD A;  5AZF A;  4BKT A;  2NBW B;  2KOX A;  4WJQ A;  1WJ6 A;  2CS4 A;  3SHQ A;  2N4F A;  2MP2 A;  2L7R A;  4WWO A;  4HLE A;  3A9K B;  4GDL B;  2O6V A;  3U30 A;  2G4D B;  2KFK B;  3VVW B;  2KKC A;  2NPT B;  1YJ1 A;  2PE9 A;  3RT3 B;  3U7D A;  4NAW B;  1CMX B;  3S2A A;  2ZEQ A;  4AOF A;  5GMV A;  2KZR A;  2LXA A;  5G2N A;  2ZPN A;  2KC1 A;  2MBE A;  2J7Q B;  4NJ7 A;  4IC7 B;  3Q3F A;  2ZCB A;  3VDZ A;  2K8C A;  2BGF A;  4EOY A;  3WAN A;  5EDS A;  2XEW A;  1RAX A;  3N32 A;  3UQB A;  2BPS A;  4ASW C;  3PPA A;  3CSF A;  3JYU A;  2KJ6 A;  3A33 B;  5CX3 A;  4M0W B;  2R2Q A;  3VTU A;  1P3Q U;  2AL6 A;  4X57 B;  3APD A;  1KJT A;  2DAJ A;  3PRE A;  3NS8 A;  1K8R B;  1P1A A;  1YIW A;  3OLM D;  2DZM A;  2M8S A;  2GOW A;  2RD0 A;  1WXV A;  2XK5 A;  3QAQ A;  2GBR A;  2K39 A;  3VXW A;  4ZRJ A;  3A1Q A;  2KMA A;  4W9G A;  2UYZ B;  1PQS A;  2Z0E B;  1V6E A;  3Q3J A;  2KX3 A;  4K1R B;  4ANU A;  3KH0 A;  2PJH A;  1FXT B;  5D6J B;  5J18 A;  3RUI B;  4AWJ A;  2C60 A;  4HK2 A;  4GN1 A;  1U4A A;  5C23 A;  2ZJD A;  3ZKJ C; 
#chains in the Genus database with same CATH topology
 1I4X A;  3L17 A;  3R2T A;  2K3U A;  1LQB A;  1HE8 A;  3HRD D;  4HDO A;  4BKS A;  5LNK 1;  1C1Y B;  3M63 B;  3DWG C;  3QCA A;  1Q1O A;  1HA5 A;  1HQR D;  3UF8 A;  2KO3 A;  2KLC A;  5IKC M;  2NVU I;  1OEY A;  4IW0 A;  4HEA 1;  1WXA A;  1YOV B;  2LD9 A;  5L83 A;  2FCQ A;  3L08 A;  3EFU A;  2EEL A;  3KWL A;  2JQR B;  1MFW A;  1C76 A;  5G5H A;  4DDI D;  3PRM B;  4XYC A;  5CHW A;  2QC8 A;  1XLO A;  5E6P A;  4XWW A;  1E7V A;  1SE3 A;  2O6V B;  1VZ8 A;  2CJN A;  1WRD B;  2LRU A;  4JWU C;  4IM3 A;  3PLV A;  3Q8F A;  3APC A;  3PHW B;  3R7R A;  1QOF A;  1XLN A;  2N1W A;  4WAA A;  2BYE A;  2M1M A;  1FNU A;  2INN E;  1TIF A;  2E3T A;  2LWP A;  1SEB D;  2CHW A;  1ZDV A;  1IPG A;  3HUI A;  2N9E B;  1EO6 A;  2K5P A;  3NZ3 A;  1WRI A;  4G11 A;  4E71 A;  2RR9 A;  3A1Q B;  1V97 A;  4LJP B;  3TCA A;  4PYZ A;  3RUL A;  2I38 A;  1EWY C;  2MCN B;  1VD2 A;  5E6J A;  1Q10 A;  4YXD B;  2CU1 A;  2DWQ A;  5BYQ A;  4ARI A;  3RNC C;  2PMV A;  2KTF A;  2ONQ A;  1WY8 A;  3K9O B;  3O65 B;  1JQ4 A;  2IO1 B;  1VZ6 A;  4AJW A;  3L0W B;  1GG3 A;  2LZ6 A;  2N7E A;  1V80 A;  2IDY A;  1SIJ A;  3TSS A;  1EM7 A;  2MJD A;  4ZHP A;  1E7P B;  2WXG A;  3ZO5 B;  1HZ5 A;  4BBN F;  3W5U B;  1K50 A;  3GOE A;  3PS6 A;  2PEA A;  2C7M B;  4L2Y A;  2LGX A;  1FRD A;  2V0G A;  4OVZ A;  2V4L A;  3PZ8 A;  2ZVN A;  4LNO A;  2WHI A;  3PRZ A;  4WJP A;  1UNS A;  4F7Z A;  2PVG C;  1MJD A;  3JSV A;  3K9P B;  3SFE B;  4MAC A;  1E5W A;  2WDT B;  3N1X C;  3I3T B;  1G6J A;  3AEF B;  4YTN B;  1TS2 A;  1SBB B;  3C0R B;  4DHZ B;  2IO2 B;  2MBO A;  5HKH A;  4HJK A;  1TY0 A;  2HTH A;  1NVI D;  3RI7 C;  3TEY A;  2XBB C;  2L8J A;  2CKH B;  1MG4 A;  3CF6 E;  2K8B A;  1T0Q C;  5G5G A;  1TZO A;  3QHT A;  3UIO B;  3ML8 A;  3WCQ A;  1FCC C;  3B9J A;  4LJO B;  1K52 A;  3EUB 2;  1JW9 D;  4KDL B;  1JCK B;  3GE3 C;  1WGR A;  2BWE S;  2W3S A;  2Z59 B;  4TMA B;  1ACC A;  2M0A A;  4BVU C;  1V5O A;  2QDF A;  3A4S C;  5J2R A;  4DXA B;  3HIZ A;  1QOA A;  4W9D A;  1HTO A;  3NVZ A;  3QA8 A;  2AL3 A;  3RN9 C;  2N0S B;  4FXC A;  3N30 A;  1E7U A;  1X1M A;  2J52 A;  2OJW A;  1JRP A;  2JZP A;  1YN4 A;  2KNB A;  3C8Y A;  1MPE A;  3VH4 B;  4BKS D;  4FBJ B;  1J7A A;  4HJG E;  1XLQ A;  3J9C A;  3PRP B;  4WQO B;  2AWT A;  2V3N A;  5IP4 D;  3ZXR A;  4BOZ B;  1HEZ E;  1V5T A;  3RD2 A;  1WI0 A;  3TMP B;  2WU5 B;  2Z8L A;  1WGD A;  2VH1 A;  4JIO U;  2BTE A;  3OJ4 B;  2Z0D B;  3DBH I;  2KAJ A;  1WE6 A;  1YQ4 B;  2CHX A;  4KSL C;  1SJH D;  2KAC A;  1QF6 A;  3RNG C;  4HVB A;  4PS8 A;  2G3Q B;  1TT5 B;  2KMC A;  4GDL A;  3JSV B;  3ZTD A;  3SEB A;  2Y3A A;  4LDT B;  4FAD A;  3CIR B;  1FFV A;  2LEK A;  2DYB A;  2L76 A;  1GNU A;  1WSP A;  4PT5 A;  3VUW A;  4ZRI A;  1E90 A;  1KLG D;  2MX2 A;  4P6V F;  1WXS A;  5DCN A;  3IT4 B;  1B1Z A;  2IND C;  2KAN A;  1XCQ L;  4IM2 A;  1EUV B;  2ZZP B;  3P4P B;  2LUE A;  5BMH A;  1BUI C;  2J0J A;  2WYQ A;  2QHO A;  2MJE A;  4G3X B;  3KUZ A;  2L83 A;  3UGB B;  4ZOH C;  2D3C A;  3BIN A;  4MDK E;  1FEH A;  5H8Y E;  3ECI A;  4F1S A;  2KT7 A;  2D3A A;  4G0N B;  4ANV A;  3TEW A;  3DHI C;  2A4Z A;  3AEG B;  2BYF A;  3NUH B;  4KZC A;  4NJ6 A;  1TGZ B;  2AEH A;  3C19 A;  1IP9 A;  4MJS A;  5AUK A;  5IA7 A;  2DLB A;  2WGS A;  1CQV A;  3U8Z A;  3AE6 B;  1TTN A;  1KRH A;  2NS5 A;  2GBN A;  1RFA A;  4MEL A;  3SDL C;  5BYS A;  3WAP A;  4RH6 A;  4IM0 A;  2WXQ A;  1L0Y B;  1KLV A;  1WIA A;  4GXB A;  4RGO S;  1E6E B;  1ISN A;  4WAF A;  1UF0 A;  1GC6 A;  2KXJ A;  5DPR A;  4ICU A;  2NCN A;  4PK1 A;  1DOY A;  2N7D A;  4OZC A;  4LTU A;  1TZ1 A;  3VHT C;  2X38 A;  3QWZ B;  2NBW B;  1ZOY B;  2KOX A;  3SHQ A;  2L7R A;  4A6Q A;  4GDL B;  3U30 A;  2WNM A;  5IO9 A;  2PE9 A;  1ZPS A;  2OHF A;  1C78 A;  3S2A A;  3W9C B;  2LXA A;  2NMQ A;  2MBE A;  1JRO A;  3H8H A;  3DBR B;  3VDZ A;  3AE8 B;  1R4N B;  4EOY A;  1RAX A;  2MEK A;  3PPA A;  1C77 A;  1D4B A;  1BML C;  4KGR A;  2WXH A;  1KJT A;  1YIW A;  1QOG A;  2RD0 A;  2J42 A;  5IOI A;  4ZRP A;  5T8I A;  4C7Y A;  1V6E A;  1JWM D;  4K1R B;  1FXT B;  4L1B A;  4US8 A;  1CJE A;  3ZJT A;  5JXV A;  2KYW A;  3AB5 A;  4HK2 A;  3RNE C;  3BK2 A;  2ZJD A;  3KLS X;  3W1S C;  4S17 A;  3AM9 A;  2K1F A;  2INC C;  3RPF C;  2QIE B;  3PT2 B;  4MJS B;  1UGM A;  1H8C A;  3WAL A;  2PKO A;  1I7H A;  2JX5 A;  2WXR A;  3E56 A;  2W82 A;  3Q8B A;  3SFD B;  1YX5 B;  1DYQ A;  2JZZ A;  4HWI B;  1L0X B;  2QSD A;  2KQS A;  4RGN A;  4JQW C;  1KM7 A;  2LXC A;  4B9K A;  3PZ7 A;  2AX5 A;  2IYD B;  4XX5 A;  1N61 A;  3ZDT A;  3L10 B;  2SEB D;  4A3P A;  3PLU A;  4P1C C;  1WGY A;  4I6N B;  3LB8 C;  3OAW A;  4LK0 M;  1AAR A;  4D2K A;  2RGF A;  1OQQ A;  4GOC A;  4W9K A;  3URY A;  2D07 B;  4E3C A;  4NNJ B;  2NTT A;  3RMK C;  1P9D U;  4RNA A;  1I4Q A;  3FIL A;  2MLB A;  3MC8 A;  2JY6 A;  3V60 A;  4HKQ A;  4BFR A;  3UI3 A;  1UBQ A;  2FUH B;  3ZNH B;  4YWG G;  2MWS B;  4LNF A;  1GB4 A;  1NDD A;  2ZNV B;  3NZU A;  3OWE B;  2TSS A;  4US9 A;  4NJC A;  3Q14 C;  4WJN A;  5D3I B;  2Y5B B;  2KN4 A;  3DVG X;  3BK1 A;  4RCO A;  3GP7 A;  5D2M B;  4FJV B;  2LI5 A;  2DEN B;  3P4R B;  4EZL A;  3DBR I;  2G9H D;  3T8M A;  5JZE B;  1R4N I;  1TS3 A;  1LXD A;  4XE0 A;  3AU5 A;  4XC2 A;  4M02 A;  1PFD A;  1UWX A;  1XD3 B;  2XNA C;  4M8N A;  2WWZ A;  2KWD A;  4YTP B;  3RYT A;  1RWS A;  2RPQ A;  4XGA B;  1V81 A;  2AQ3 B;  4A9A A;  2BW2 A;  3KWV A;  3R8B A;  2DBY A;  2K0P A;  2KTR A;  5J17 A;  3BVG A;  3HK0 A;  1UEL A;  3Q8E A;  1PGB A;  4XDC A;  3V6E B;  1WWT A;  2VZK B;  1JRU A;  1WZ3 A;  4A55 A;  1I4H A;  3NHE B;  4A20 A;  4NZL B;  4FJY A;  2ZVO A;  3P4S B;  3NRZ A;  4NQL B;  1N6Z A;  3P42 A;  1N63 A;  1S3S G;  2KHW B;  4OZB A;  4TQ0 A;  4BZA A;  1FRR A;  3RZF A;  3FIL B;  2LJ5 A;  4AP4 C;  3BYY B;  3ML9 A;  4USA A;  1VRA B;  1WGH A;  4IG7 B;  1WGK A;  2FCM A;  4UDU C;  4AUQ C;  3T3N A;  3QAR A;  4K81 A;  4W9F A;  2LFI A;  1F2R I;  3WAM A;  3EC8 A;  4DHJ D;  1KOT A;  4NPN A;  2YEP F;  2KDE B;  4C56 C;  2DZI A;  3H7S A;  4EZJ A;  4K7S A;  3AE2 B;  4KSK C;  4KKJ A;  2L32 A;  3DVG Y;  4MGI E;  3EA6 A;  1YJI A;  1DOX A;  4RM9 A;  5FR3 A;  3DHH C;  2GLS A;  1P98 A;  2JXT A;  1FFU A;  1TBE A;  4R3D A;  3MHS D;  2QMT A;  2DX5 B;  2BYV E;  1KH0 A;  4GU2 A;  1WJN A;  1FNW A;  1FO4 A;  4ZYN A;  1RRB A;  1UD7 A;  3LJ3 A;  1XXG A;  4ANW A;  2IY1 B;  1F0Z A;  1LGR A;  2N9X A;  3W1Y A;  3BY4 B;  2L3Z A;  2MQJ A;  4W9J A;  1KF6 B;  2KTR B;  2K22 A;  3QX1 A;  1ET6 A;  3MHZ A;  1NEN B;  1XCT L;  1Z5S B;  4DK5 A;  5DPW A;  3B0A A;  1T0S C;  2VZK D;  1FPY A;  5D94 A;  2JU6 X;  1V1P A;  1CK1 A;  5LLI A;  3DBH B;  3VTV A;  5FR6 A;  3JW0 X;  2J53 A;  4MH0 E;  5CHF A;  1MHH E;  3ENE A;  1WZ0 A;  3P63 A;  3QIJ A;  1WR6 E;  2J0K A;  4A8X C;  3Q8A A;  1J7B A;  3IAM 1;  3M95 A;  2OOB B;  4OVV A;  2G1E A;  2K6D B;  1UH6 A;  4JGH B;  4NAW A;  2DAF A;  1DOI A;  1SXT A;  4FN2 A;  3TEX A;  1NI3 A;  2BVC A;  1IUE A;  1NI2 A;  3NOB A;  1AYF A;  4II3 B;  1XLP A;  1EF5 A;  4PS7 A;  4DWF A;  1ZGU B;  3EGR A;  2V3S A;  2K6Q A;  3APF A;  2HDE A;  3N9Y C;  1L7Y A;  1IYF A;  4TV3 A;  5L95 C;  2OJR A;  5HG2 A;  3UIN B;  2PE6 B;  4DXG A;  2KMM A;  3NZS A;  4AQ7 A;  3T9L A;  3DQV A;  4S0R A;  1TKY A;  1J8C A;  3VRA B;  2J0M A;  4AS1 A;  1J7C A;  3Q2A C;  3AEE B;  2DNF A;  2GBK A;  1E8X A;  1OQR A;  4RMA A;  1WGG A;  3NJT A;  2LHE A;  2KJH B;  2JVC A;  4OW0 A;  4EE2 A;  2WDQ B;  4JWS C;  1NYQ A;  1RLF A;  1WR1 A;  1S1Q B;  2IO0 B;  4JL9 A;  4NQK E;  5KHO A;  2YEP B;  3DVN U;  2BS4 B;  3DVN V;  4BBN C;  4LLG M;  2GBM A;  1JWA D;  2WP9 B;  1TKG A;  1D3Z A;  3HHM A;  1FXI A;  3WIM A;  3IHP C;  2WS3 B;  4RM8 A;  4HKZ E;  2LHD A;  3Q3M C;  1C79 A;  2HTM E;  3IXS A;  3H6N A;  4DBG A;  2V4I B;  2W3R A;  2OED A;  4N6E B;  3CMM B;  4KKI A;  1V1P B;  4N59 A;  3ALB A;  5AZH A;  2M0X A;  4RF1 A;  3PSE B;  1KTK A;  1M4V A;  1LM8 B;  3PZD A;  1NYR A;  4ZDV A;  2LGD A;  3PO0 A;  1WJ6 A;  2N4F A;  1B9R A;  3AEA B;  2BS2 B;  1YJ1 A;  2PLP A;  4NAW B;  5GMV A;  2FE8 A;  2KC1 A;  2RDH A;  4IC7 B;  3Q3F A;  2KVZ A;  1L5P A;  2E6X A;  2K8C A;  1K53 A;  2BPS A;  1R4M B;  3A33 B;  3AN1 A;  3VTU A;  3IAS 1;  1P1A A;  4MH8 A;  3Q3N C;  1JWB D;  2GOW A;  1C4A A;  1WXV A;  4ZRJ A;  5H92 C;  4W9G A;  2UYZ B;  3CWI A;  3AEB B;  5J18 A;  3KQ4 A;  2C60 A;  1MHX A;  4GN1 A;  5C23 A;  2QCZ A;  1R7S A;  2FCN A;  2L0F A;  2M19 A;  4M00 A;  5GXG B;  1STE A;  1VJK A;  4N58 A;  4DQO C;  2QJL A;  4MGK E;  2B3A A;  1FXA A;  2WX1 A;  3IG3 A;  3ZXV A;  4A3O A;  1F9J A;  2MRP A;  1SGH A;  5BO4 B;  1FNV A;  4OVU A;  2RSU A;  1PUT A;  3I9V 1;  2BF8 B;  3SD5 A;  1JML A;  2L52 A;  4XZ4 A;  2KN5 A;  4Q2J A;  2L0T A;  1YQ3 B;  2KDI A;  4ARC A;  3B1L X;  2EMS A;  1UGJ A;  3AH7 A;  2C5L C;  2HE7 A;  2WXN A;  3ZNZ B;  2LGS A;  4BOS C;  2KWU B;  3P2B A;  2FUG 1;  3HM3 A;  3A9J A;  3PTF C;  1GJZ A;  1TKE A;  1IGC A;  2D2Q A;  1HTQ A;  1J0G A;  2X8X X;  2M4N A;  2IPK D;  1I42 A;  2PVO D;  1WXQ A;  2IO3 B;  1WM3 A;  3AE5 B;  3MFG A;  1Z2M A;  1C4P A;  2I2Y A;  2MA9 B;  2M56 B;  3RZW C;  4IUM B;  3TEZ A;  3I63 C;  3MP9 A;  4ICV A;  4P16 A;  1GB1 A;  2AYO B;  2C9W B;  2SAK A;  2D11 A;  3NVW A;  1F77 A;  5E6O A;  1M94 A;  4IWO A;  4FUL A;  5EE3 A;  1WJU A;  2KFJ A;  3PVL A;  4IWP A;  1OFF A;  2KK8 A;  1F2R C;  2YLM A;  2J4X A;  3BVZ A;  4YSZ B;  1XT9 B;  1WMH A;  2FNJ B;  3EFC A;  2MBB B;  3AEC B;  2D5G A;  2XN9 C;  3RCZ A;  1WYW B;  3I5J C;  1XO3 A;  1R4M I;  4NAM A;  4JLC A;  2JYE A;  1SSN A;  2D3B A;  4JPS A;  4WJO A;  3L13 A;  4CO7 A;  3TUO A;  1C9F A;  2WXI A;  3L4P A;  3DBL B;  2V1Y A;  2ZNV C;  2NBV B;  1FMA D;  3AUL A;  1T6B X;  1TS4 A;  2KDB A;  2NPT A;  3VAW A;  2BKF A;  1Q0W B;  1SE4 A;  1MVK A;  3VUY A;  2KWV B;  2JPH A;  1GPX A;  1JWU D;  1SB3 C;  3ONS A;  2GI9 A;  3U52 E;  4BKG A;  1V8C A;  2JWZ A;  1WXM A;  1V9J A;  4M8M A;  2ZW1 A;  1TJE A;  3VQI A;  1ENF A;  1SJE D;  4ZRQ A;  3PHX B;  3N20 C;  2CU3 A;  1L4Z B;  3A9J B;  2HJ8 A;  1K51 A;  1NBF C;  4TQ1 A;  4B0E A;  5DPT A;  3OJ3 A;  2KC2 A;  4FJZ A;  4WH4 A;  4URK A;  2NBU A;  3UQA A;  4FA6 A;  1OTR B;  4M01 A;  2WX0 A;  1YMH E;  2ZCC A;  4WIP A;  4B0M A;  2KWC A;  2JXX A;  4ZHO A;  4K7W A;  2BBC A;  4WWN A;  1CZP A;  3QJZ A;  2FAZ A;  2ZW0 A;  1T0Y A;  4MGY E;  1HXY D;  2AQ1 B;  1SE9 A;  1TY2 A;  4DHJ B;  1YN5 A;  1KFY B;  1QZE A;  3V05 A;  1WMH B;  3V62 A;  1QLB B;  2R2O A;  5AUI A;  1SE2 A;  3HVZ A;  3ZUN A;  3WAO A;  3NVY A;  5MPO A;  4K3C A;  2EMT A;  3SR6 A;  2WQY B;  1L4D B;  1Y8R C;  1WYG A;  4KIK A;  2BS3 B;  1P7F A;  2BKR B;  1FM0 D;  2BWF A;  1I4R A;  2MBQ A;  2UU7 A;  5JH5 C;  1TS5 A;  2RPV A;  4LNI A;  3RFZ B;  3DWM A;  2KLG A;  3NG0 A;  3U4E G;  3P4Q B;  3U2S C;  5CHV C;  2WXO A;  4XDD A;  3DOW A;  4EUT A;  3DBS A;  5EE1 A;  5JHA A;  1E8Y A;  3MC9 A;  4W9H A;  1VLB A;  5IN7 A;  3AE1 B;  3DBL I;  5BMI A;  4WWP A;  4ANX A;  4KZ0 A;  3A9K A;  1RFK A;  1ZW7 A;  1FIQ A;  2K25 A;  3VR9 B;  2KFK A;  1C3T A;  2KJR A;  2WXM A;  4MEM A;  1UUP A;  1T3Q A;  1E0Z A;  4KGT A;  4IWQ A;  1QT9 A;  4TSS A;  5KHQ A;  4J6I A;  3Q69 A;  3L16 A;  1I4G A;  2LRW A;  4GMV A;  4EEW A;  4JX1 C;  2V3P A;  2PIA A;  3P1M A;  3R3M A;  2JT4 B;  2KD0 A;  3FKY A;  4WUR A;  4M0W A;  5EE0 A;  3PGE A;  2WXL A;  3NY5 A;  3VR8 B;  1GC7 A;  3ZRC A;  2BB6 A;  3V3X A;  2LJI A;  3N3K B;  2RDB C;  2A5U A;  2MJ3 A;  4H2A A;  3TBL D;  1OGW A;  4I6P A;  1V1O A;  2MBH A;  4TUU A;  4LNK A;  2CR5 A;  1T5X D;  2JRH A;  2LMC A;  3KUD B;  2LVQ A;  3TL5 A;  2PTL A;  4K7U A;  1SIF A;  1QIL A;  3ABV B;  1E8Z A;  2FIF A;  3FC4 A;  4GB9 A;  2DHZ A;  1N62 A;  3A4R A;  3MJW A;  3H7P A;  1D5M C;  4KIK B;  3TIX A;  3R66 C;  2V9H A;  1L6V A;  4HPP A;  2GB1 A;  5CTR C;  2NR2 A;  3ETR A;  1UZX B;  5C1Z A;  1WM2 A;  2Y5P A;  2B76 B;  4ZRK A;  1EU4 A;  2UWQ A;  2C7N B;  2REX A;  3N1Y C;  4RGM A;  3KW5 B;  5G55 A;  5I4D A;  5D3D A;  1NEK B;  4J3O D;  1QQR A;  4ACF A;  2VH2 A;  1N60 A;  1ZKH A;  1OQY A;  2IBI B;  1EF1 A;  5AZF A;  4BKT A;  3W2D A;  2LGI A;  4WJQ A;  2CS4 A;  2MP2 A;  4WWO A;  3A9K B;  1XF5 L;  2KFK B;  2AQ2 B;  3VVW B;  2KKC A;  2WXK A;  1JWS D;  1VR9 A;  3RT3 B;  4AOF A;  5G2N A;  2J7Q B;  2BGF A;  4C00 A;  3UQB A;  3WAN A;  5EDS A;  1E10 A;  1SF0 A;  4ASW C;  3CSF A;  3JYU A;  2KJ6 A;  4IOI E;  3AMZ A;  4CQN A;  4M0W B;  2R2Q A;  2QIL A;  2AL6 A;  4X57 B;  2DAJ A;  1PGA A;  3PRE A;  1K8R B;  3OLM D;  2WDV B;  2DZM A;  2M8S A;  4IKG A;  2XK5 A;  2GBR A;  4P1B C;  3VXW A;  2KMA A;  1PQS A;  2Z0E B;  3Q3J A;  4K3B A;  2KX3 A;  4ANU A;  2PJH A;  5C3J B;  3RNA C;  4AWJ A;  4JE3 B;  1U4A A;  2LVO A;  2WXJ A;  2WXP A;  3H9D A;  1L2N A;  2NTS A;  5AZG A;  3OG5 A;  5AEK B;  4EKU A;  3AU4 A;  1D5X C;  1QKZ A;  1UBI A;  3KYC D;  4KGS A;  1BXT A;  1YN3 A;  1AN8 A;  3KVF B;  4XWT A;  2HJ1 A;  3H7P B;  3T3O A;  2W9N A;  1XEE A;  3IBE A;  4MGZ E;  2ASQ A;  2LGY A;  4DXF A;  3AE3 B;  3GE8 C;  3DHG C;  1J19 A;  1P0R A;  3B08 A;  3L54 A;  2O6V D;  1A70 A;  4TKN A;  2RDG A;  4AJY B;  1WX9 A;  1ET9 A;  1WX7 A;  3ZJU A;  4MM3 A;  2BB5 A;  4C7Z A;  3VH3 B;  4II2 B;  4WWM A;  2WXF A;  3DCG A;  3IFW B;  3ZYY X;  3B2G A;  3ZW3 A;  1YQB A;  2MP2 B;  2BT6 A;  3KYD D;  3U7Z A;  3ZQ4 A;  4PS3 A;  4C4V A;  3BYT B;  3EHV A;  2JUO A;  3EEC A;  2LVP A;  4I6L B;  1E8W A;  2WDR B;  2L05 A;  2MH7 A;  3VTW A;  5DPS A;  2JF5 A;  4NY0 A;  3BII D;  4LNN A;  2D3G A;  1A5R A;  3MJ5 A;  3BWU D;  1IBX A;  1L0V B;  2L1A A;  4DDG D;  2VRR B;  5D7G A;  2H88 B;  2XK5 B;  3R2I A;  2EKE C;  1ZDX A;  2ON8 A;  1GAQ B;  1OEY J;  1N5X A;  3QC8 B;  2ZPY A;  1GUA B;  3ZDM C;  3GZN B;  3LYY A;  3ZNG C;  2ICI A;  1VZ7 A;  3LDZ E;  2PPH A;  2KVR A;  1MI0 A;  4KV2 A;  1JAL A;  1V2Y A;  2M17 A;  2DYO A;  1ZUD 2;  2FID A;  5LXH A;  3UIP B;  2G4S A;  1L6U A;  2CHZ A;  1N5W A;  2IY0 B;  5IAA C;  4W9L A;  1H4R A;  3MTN B;  3GB1 A;  1ESF A;  1WJ4 A;  1V49 A;  1QOB A;  3M3J A;  2GMI C;  2MW5 A;  3LXF A;  1WX8 A;  4C80 A;  2GRI A;  3ZVV A;  4MSQ B;  1D5Z C;  2JYT A;  2KDM A;  5TR5 A;  3V61 A;  4YL8 A;  3CST A;  3KUC B;  3ZTC A;  2CJO A;  2HD5 B;  2JSV X;  4OHJ A;  3Q3O C;  2W54 A;  4MM3 B;  2WLB A;  3FAH A;  3V6C B;  2Q5W D;  4MSM B;  1YD8 U;  5FKA C;  4W9C A;  3E9S A;  4O1N A;  4YSX B;  3QK0 A;  2ACZ B;  1D6E C;  3VUX A;  5EE9 A;  2L00 B;  3ZIM A;  4E74 A;  3AE4 B;  4C4V B;  4FHK A;  1Y56 A;  4PYU A;  4REZ A;  5TSS A;  1AW7 A;  1BT0 A;  4QAY A;  4WQM A;  2GBJ A;  5HFY A;  2N1V A;  2O2V A;  4DHZ E;  2IJ0 A;  2JRI B;  3B2F A;  4P7I A;  1WFY A;  1IBX B;  3Q8C A;  1WH3 A;  2JWU A;  4OZA A;  4GDK A;  2FCS A;  2N7J A;  3DDC B;  4F8C B;  4RFB A;  3BVM A;  4HDQ A;  4RGT A;  3AE7 B;  1PGX A;  1V86 A;  3GS2 A;  3AI5 A;  1PDX A;  1Q5W B;  2KX0 A;  2I1K A;  4ITK A;  4GSW A;  2QEJ C;  1LO5 D;  4B95 A;  1KLU D;  4FHJ A;  3X23 A;  2D10 A;  4KVG B;  1F52 A;  1IGD A;  4IDI A;  5C2T B;  3GZN I;  3AED B;  2DZJ A;  2RMM A;  2W55 A;  4LDT D;  2IZV B;  2DZK A;  2DYM A;  3QQ8 B;  3M62 B;  2KQ7 A;  4CYE A;  1XQQ A;  1YX6 B;  2JZ3 B;  1HZ6 A;  2INP E;  4KDI C;  1UWM A;  3ZGZ A;  4HPL B;  2BYT A;  1FD6 A;  3W1S A;  4A90 A;  2R61 A;  3D32 A;  1AWD A;  4YTM B;  3VRB B;  1ZE3 D;  1VDV A;  2K9X A;  2N9P C;  4YSY B;  2G45 B;  1WF9 A;  1E9M A;  3X0W A;  3N1Z C;  1MG8 A;  3ZJV A;  4HXD A;  4GIV A;  5HHD G;  2K8H A;  2IGD A;  2LAS A;  3WA0 A;  3ZRF A;  3HVD A;  2IGG A;  1P7E A;  1ROE A;  5JHB A;  4GLS C;  4EZK A;  2PW9 A;  3DPD A;  3NVV A;  2KDF B;  4FLH A;  3I57 A;  1RM6 C;  3PV1 A;  3HM6 X;  2O2V B;  1ZXI A;  5HI1 A;  5BMG A;  2IGH A;  5LXI B;  2N9L A;  4W9I A;  1I35 A;  2C7H A;  4GGQ A;  4GDK B;  3R7Q A;  3JVZ X;  3VFK A;  4HCN B;  3SU8 X;  3TJP A;  2KQ4 X;  2MSE D;  1GOZ A;  1YNT E;  1WE7 A;  3H1U A;  2WU2 B;  4N9F 4;  3O13 A;  1YJJ A;  2EKI A;  2H89 B;  2YVC A;  4EFO A;  2Y5C A;  3Q6B A;  4ZYS A;  1LFD A;  3ZNI D;  4YT0 B;  4HCP B;  4HPM B;  2LUM A;  3IVF A;  1RYJ A;  1VCB A;  2I1J A;  4MT5 A;  3RNB C;  1FCL A;  4W9E A;  4G50 A;  1ZP0 B;  1DGJ A;  2N9K A;  4B6W A;  5BYR A;  3ZLZ A;  1C4C A;  4CHK A;  4LCD E;  1TYG B;  5E6N A;  3AXC A;  3W5V B;  4HLE A;  2O6V A;  2G4D B;  3RNF C;  4BAX A;  4RF0 A;  2NPT B;  3U7D A;  4KX6 B;  1CMX B;  2MHJ A;  1PYW D;  2ZEQ A;  2KZR A;  5FK9 C;  2ZPN A;  4HRS A;  4NJ7 A;  1T0R C;  2ZCB A;  2XEW A;  3N32 A;  1I4P A;  5CX3 A;  3AV8 A;  1P3Q U;  3APD A;  3NS8 A;  2BQQ A;  3QAQ A;  1ZXH A;  1F1H A;  1EU3 A;  2K39 A;  3BZD B;  3A1Q A;  3NS1 A;  4L23 A;  3KH0 A;  3MC0 B;  5D6J B;  1EWC A;  3RUI B;  3IT6 B;  2FBW B;  3AE9 B;  4HRO A;  3ZKJ C; 
#chains in the Genus database with same CATH homology
 3W1S C;  2LVO A;  3L17 A;  3H9D A;  1L2N A;  5AZG A;  2FCN A;  1LQB A;  1HE8 A;  5AEK B;  2L0F A;  2K1F A;  4EKU A;  3AU4 A;  3PT2 B;  4MJS B;  1UGM A;  4MGK E;  4HDO A;  4BKS A;  2B3A A;  2WX1 A;  3IG3 A;  1H8C A;  1UBI A;  3KYC D;  3WAL A;  4A3O A;  1C1Y B;  1F9J A;  2MRP A;  1SGH A;  5BO4 B;  1YX5 B;  3KVF B;  2JZZ A;  4OVU A;  3H7P B;  2RSU A;  3M63 B;  3QCA A;  4HWI B;  1Q1O A;  2KQS A;  2W9N A;  3UF8 A;  2KO3 A;  4JQW C;  1KM7 A;  2BF8 B;  2KLC A;  2LXC A;  3IBE A;  4MGZ E;  2ASQ A;  2LGY A;  2NVU I;  3SD5 A;  4B9K A;  1OEY A;  4IW0 A;  2IYD B;  1WXA A;  4XX5 A;  4XZ4 A;  2KN5 A;  3ZDT A;  1J19 A;  3L10 B;  1P0R A;  4A3P A;  3B08 A;  3L54 A;  3PLU A;  2O6V D;  2LD9 A;  1WGY A;  4I6N B;  4TKN A;  2L0T A;  4AJY B;  3OAW A;  5L83 A;  2KDI A;  1WX9 A;  2FCQ A;  3B1L X;  2EMS A;  3L08 A;  1WX7 A;  1AAR A;  4MM3 A;  3EFU A;  2C5L C;  2HE7 A;  2RGF A;  4GOC A;  3ZNZ B;  4W9K A;  3VH3 B;  2D07 B;  4DDI D;  4II2 B;  3PRM B;  4BOS C;  4E3C A;  2KWU B;  3P2B A;  4NNJ B;  3DCG A;  3IFW B;  1P9D U;  5CHW A;  3HM3 A;  3A9J A;  2MLB A;  5E6P A;  3ZW3 A;  3PTF C;  1GJZ A;  1YQB A;  2D2Q A;  2JY6 A;  1E7V A;  2MP2 B;  3KYD D;  3V60 A;  2O6V B;  4BFR A;  1J0G A;  1WRD B;  2M4N A;  2LRU A;  1UBQ A;  2FUH B;  4IM3 A;  3ZNH B;  1I42 A;  3PLV A;  2MWS B;  3APC A;  2IO3 B;  1WM3 A;  1NDD A;  1Z2M A;  2ZNV B;  3PHW B;  3NZU A;  2N1W A;  4PS3 A;  3R7R A;  2MA9 B;  3EHV A;  2JUO A;  3EEC A;  4WAA A;  2BYE A;  3RZW C;  2LVP A;  2M1M A;  1E8W A;  4I6L B;  2L05 A;  4WJN A;  3VTW A;  5DPS A;  4IUM B;  2JF5 A;  4NY0 A;  2D3G A;  4ICV A;  1A5R A;  2Y5B B;  2LWP A;  3DVG X;  2CHW A;  2AYO B;  1IPG A;  2C9W B;  5D2M B;  2D11 A;  4FJV B;  5E6O A;  2N9E B;  4DDG D;  1EO6 A;  2VRR B;  1M94 A;  5D7G A;  4IWO A;  4FUL A;  1WJU A;  2XK5 B;  2KFJ A;  2LI5 A;  2DEN B;  2EKE C;  4G11 A;  4E71 A;  3PVL A;  2RR9 A;  3A1Q B;  4IWP A;  2KK8 A;  2YLM A;  4LJP B;  3TCA A;  4PYZ A;  3RUL A;  1OEY J;  4EZL A;  3QC8 B;  2ZPY A;  2MCN B;  3DBR I;  1XT9 B;  1VD2 A;  1GUA B;  1WMH A;  2FNJ B;  3T8M A;  3ZDM C;  2MBB B;  5JZE B;  1R4N I;  3RCZ A;  2CU1 A;  3ZNG C;  1LXD A;  1WYW B;  3AU5 A;  1R4M I;  4XC2 A;  3LDZ E;  2PPH A;  2KTF A;  3K9O B;  1WY8 A;  4JLC A;  2KVR A;  1XD3 B;  3O65 B;  4KV2 A;  2IO1 B;  4M8N A;  1V2Y A;  2WWZ A;  4AJW A;  3L0W B;  2M17 A;  4WJO A;  1GG3 A;  3RYT A;  2DYO A;  2LZ6 A;  2N7E A;  1V80 A;  2FID A;  2RPQ A;  1V81 A;  3L13 A;  4CO7 A;  5LXH A;  3UIP B;  2G4S A;  2V1Y A;  2CHZ A;  2ZNV C;  2IY0 B;  5IAA C;  2KTR A;  4W9L A;  2NBV B;  1H4R A;  3MTN B;  5J17 A;  3HK0 A;  1UEL A;  3AUL A;  1WJ4 A;  1V49 A;  3M3J A;  2GMI C;  2MW5 A;  3ZO5 B;  1WX8 A;  3V6E B;  4BBN F;  2KDB A;  3PS6 A;  3GOE A;  2NPT A;  4MSQ B;  3ZVV A;  3VAW A;  1JRU A;  2BKF A;  1Q0W B;  1WZ3 A;  2PEA A;  2C7M B;  3VUY A;  2KWV B;  3NHE B;  2LGX A;  5TR5 A;  3V61 A;  2V4L A;  4YL8 A;  4A20 A;  3CST A;  2ZVN A;  3KUC B;  4FJY A;  2ZVO A;  3ZTC A;  3PRZ A;  2JPH A;  4WJP A;  2HD5 B;  4NQL B;  4F7Z A;  3ONS A;  4BKG A;  2JWZ A;  3JSV A;  1S3S G;  2KHW B;  3K9P B;  1WXM A;  1V9J A;  4M8M A;  1E5W A;  4TQ0 A;  3V6C B;  2WDT B;  4MSM B;  1YD8 U;  3I3T B;  1G6J A;  4W9C A;  3VQI A;  3PHX B;  3C0R B;  4DHZ B;  3RZF A;  3QK0 A;  2IO2 B;  2MBO A;  2LJ5 A;  3A9J B;  4HJK A;  5HKH A;  4AP4 C;  2HTH A;  2HJ8 A;  3ML9 A;  1WGH A;  4IG7 B;  3VUX A;  1NBF C;  2FCM A;  4TQ1 A;  4AUQ C;  2L00 B;  2XBB C;  3QAR A;  2L8J A;  4K81 A;  4W9F A;  5DPT A;  3ZIM A;  2CKH B;  3OJ3 A;  3CF6 E;  2K8B A;  2KC2 A;  4FJZ A;  3EC8 A;  4FHK A;  3WAM A;  4DHJ D;  2NBU A;  3QHT A;  3UIO B;  4URK A;  1KOT A;  4PYU A;  3ML8 A;  3UQA A;  4NPN A;  4FA6 A;  2KDE B;  1OTR B;  2DZI A;  1BT0 A;  3H7S A;  4EZJ A;  4K7S A;  4KSK C;  2WX0 A;  3DVG Y;  4LJO B;  4MGI E;  2GBJ A;  2N1V A;  2O2V A;  2ZCC A;  4E74 A;  2KWC A;  4RM9 A;  4DHZ E;  1P98 A;  2JXX A;  2JRI B;  4K7W A;  4WWN A;  4KDL B;  4P7I A;  1WFY A;  1WGR A;  3QJZ A;  1TBE A;  1WH3 A;  2FAZ A;  1T0Y A;  3MHS D;  2BWE S;  4GDK A;  4MGY E;  2Z59 B;  2FCS A;  1SE9 A;  2DX5 B;  4BVU C;  2BYV E;  3DDC B;  1V5O A;  4F8C B;  4DHJ B;  4HDQ A;  1QZE A;  3A4S C;  4GU2 A;  1WJN A;  5J2R A;  4DXA B;  3HIZ A;  1WMH B;  4W9D A;  3V62 A;  3QA8 A;  2AL3 A;  2R2O A;  4ZYN A;  1RRB A;  1UD7 A;  1V86 A;  3ZUN A;  3AI5 A;  3WAO A;  3LJ3 A;  3N30 A;  1E7U A;  1Q5W B;  2KX0 A;  1X1M A;  2I1K A;  4ANW A;  2EMT A;  2IY1 B;  4GSW A;  4B95 A;  2KNB A;  1Y8R C;  2N9X A;  4FHJ A;  4KIK A;  3BY4 B;  3VH4 B;  3W1Y A;  3X23 A;  2L3Z A;  4BKS D;  2BKR B;  2MQJ A;  4FBJ B;  2BWF A;  4W9J A;  2MBQ A;  4WQO B;  3PRP B;  2D10 A;  5JH5 C;  4KVG B;  2AWT A;  2KTR B;  3QX1 A;  3GZN I;  1Z5S B;  4BOZ B;  2KLG A;  1V5T A;  2DZJ A;  3RD2 A;  3B0A A;  4LDT D;  2IZV B;  4DK5 A;  5DPW A;  1WI0 A;  3TMP B;  2DZK A;  2DYM A;  3QQ8 B;  5D94 A;  3M62 B;  2KQ7 A;  5LLI A;  4CYE A;  5CHV C;  1WGD A;  3VTV A;  4JIO U;  3OJ4 B;  1XQQ A;  2Z0D B;  3DBH I;  3DOW A;  3DBS A;  4EUT A;  5FR6 A;  3JW0 X;  1YX6 B;  1WE6 A;  2CHX A;  2JZ3 B;  4KSL C;  4MH0 E;  5CHF A;  5JHA A;  3ENE A;  1E8Y A;  4W9H A;  1WZ0 A;  4KDI C;  4HPL B;  3QIJ A;  1WR6 E;  2J0K A;  3DBL I;  4HVB A;  3W1S A;  4PS8 A;  2G3Q B;  3D32 A;  4WWP A;  2KMC A;  4ANX A;  4KZ0 A;  3M95 A;  3A9K A;  3JSV B;  4GDL A;  1ZW7 A;  2K25 A;  2OOB B;  3ZTD A;  1C3T A;  2KFK A;  4OVV A;  2KJR A;  2K6D B;  1UH6 A;  4LDT B;  2N9P C;  4MEM A;  4FAD A;  4JGH B;  4NAW A;  2DAF A;  4FN2 A;  4IWQ A;  5KHQ A;  4J6I A;  1NI2 A;  2DYB A;  2G45 B;  1WF9 A;  2L76 A;  1GNU A;  3NOB A;  3X0W A;  3L16 A;  2LRW A;  4GMV A;  1MG8 A;  4II3 B;  4ZRI A;  1EF5 A;  4PS7 A;  3VUW A;  1ZGU B;  4DWF A;  4EEW A;  4HXD A;  2V3S A;  1E90 A;  4GIV A;  2K8H A;  3R3M A;  2MX2 A;  1WXS A;  2JT4 B;  2K6Q A;  2KD0 A;  3APF A;  5DCN A;  2LAS A;  3WA0 A;  3ZRF A;  1IYF A;  1L7Y A;  4TV3 A;  3PGE A;  3NY5 A;  1GC7 A;  5L95 C;  2OJR A;  5JHB A;  3UIN B;  3ZRC A;  2KAN A;  2PE6 B;  4IM2 A;  1EUV B;  2ZZP B;  4EZK A;  3DPD A;  4FLH A;  2KDF B;  3NZS A;  3T9L A;  3DQV A;  2LUE A;  1J8C A;  3N3K B;  2A5U A;  2J0M A;  3PV1 A;  2J0J A;  2WYQ A;  2O2V B;  3HM6 X;  3TBL D;  1OGW A;  2QHO A;  4I6P A;  4G3X B;  3KUZ A;  3UGB B;  2GBK A;  2MBH A;  1E8X A;  4TUU A;  3BIN A;  4RMA A;  5LXI B;  1WGG A;  4W9I A;  1I35 A;  2C7H A;  4MDK E;  3ECI A;  4GGQ A;  4F1S A;  4GDK B;  3R7Q A;  4G0N B;  2CR5 A;  4ANV A;  3JVZ X;  2KJH B;  2A4Z A;  2JVC A;  4HCN B;  2BYF A;  3VFK A;  2JRH A;  4KZC A;  3SU8 X;  4NJ6 A;  1RLF A;  1TGZ B;  1WR1 A;  2AEH A;  2LVQ A;  3KUD B;  1S1Q B;  3TJP A;  3TL5 A;  1IP9 A;  2MSE D;  4MJS A;  4K7U A;  5IA7 A;  2IO0 B;  4JL9 A;  1SIF A;  1E8Z A;  2FIF A;  4NQK E;  1WE7 A;  5KHO A;  3DVN U;  3H1U A;  3U8Z A;  1TTN A;  3DVN V;  4N9F 4;  2NS5 A;  4BBN C;  4GB9 A;  2GBN A;  1RFA A;  4MEL A;  2DHZ A;  2GBM A;  3A4R A;  3MJW A;  3H7P A;  3SDL C;  1D3Z A;  3HHM A;  3WAP A;  2YVC A;  4IM0 A;  4KIK B;  3TIX A;  3R66 C;  3WIM A;  3IHP C;  4EFO A;  1KLV A;  5CTR C;  1WIA A;  2NR2 A;  4GXB A;  1UZX B;  1LFD A;  3ZNI D;  5C1Z A;  4RM8 A;  1ISN A;  1WM2 A;  4HCP B;  4ZRK A;  1GC6 A;  2KXJ A;  4HPM B;  5DPR A;  2UWQ A;  2C7N B;  3H6N A;  4ICU A;  4DBG A;  2REX A;  2NCN A;  3IVF A;  3CMM B;  2N7D A;  1VCB A;  3KW5 B;  5G55 A;  2I1J A;  3ALB A;  4W9E A;  5AZH A;  2M0X A;  3PSE B;  4G50 A;  1TZ1 A;  4B6W A;  1LM8 B;  3VHT C;  3ZLZ A;  1ZKH A;  3PZD A;  4CHK A;  4LCD E;  1OQY A;  2IBI B;  4ZDV A;  5E6N A;  3AXC A;  3QWZ B;  1EF1 A;  2LGD A;  5AZF A;  4BKT A;  2NBW B;  2KOX A;  4WJQ A;  1WJ6 A;  2CS4 A;  3SHQ A;  2N4F A;  2MP2 A;  2L7R A;  4WWO A;  4HLE A;  3A9K B;  4GDL B;  2O6V A;  3U30 A;  2G4D B;  2KFK B;  3VVW B;  2KKC A;  2NPT B;  1YJ1 A;  2PE9 A;  3RT3 B;  3U7D A;  4NAW B;  1CMX B;  3S2A A;  2ZEQ A;  4AOF A;  5GMV A;  2KZR A;  2LXA A;  5G2N A;  2ZPN A;  2KC1 A;  2MBE A;  2J7Q B;  4NJ7 A;  4IC7 B;  3Q3F A;  2ZCB A;  3VDZ A;  2K8C A;  2BGF A;  4EOY A;  3WAN A;  5EDS A;  2XEW A;  1RAX A;  3N32 A;  3UQB A;  2BPS A;  4ASW C;  3PPA A;  3CSF A;  3JYU A;  2KJ6 A;  3A33 B;  5CX3 A;  4M0W B;  2R2Q A;  3VTU A;  1P3Q U;  2AL6 A;  4X57 B;  3APD A;  1KJT A;  2DAJ A;  3PRE A;  3NS8 A;  1K8R B;  1P1A A;  1YIW A;  3OLM D;  2DZM A;  2M8S A;  2GOW A;  2RD0 A;  1WXV A;  2XK5 A;  3QAQ A;  2GBR A;  2K39 A;  3VXW A;  4ZRJ A;  3A1Q A;  2KMA A;  4W9G A;  2UYZ B;  1PQS A;  2Z0E B;  1V6E A;  3Q3J A;  2KX3 A;  4K1R B;  4ANU A;  3KH0 A;  2PJH A;  1FXT B;  5D6J B;  5J18 A;  3RUI B;  4AWJ A;  2C60 A;  4HK2 A;  4GN1 A;  1U4A A;  5C23 A;  2ZJD A;  3ZKJ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...