1TGZB

Structure of human senp2 in complex with sumo-1
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
78
structure length
78
Chain Sequence
EYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A basis for SUMO protease specificity provided by analysis of human Senp2 and a Senp2-SUMO complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle, hydrolase
molecule keywords Sentrin-specific protease 2
total genus 15
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2004-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1tgzB00
4J6IA 2HD5B 3N32A 2DENB 4K7SA 3ZNHB 4AOFA 1E7UA 3H7PA 1WIAA 1WJNA 2DZKA 2D2QA 5C1ZA 4ICUA 2LJ5A 4BKGA 4K7UA 1NBFC 2NBVB 1EUVB 2RSUA 4DHJD 2KDFB 4CO7A 2EKEC 4HCPB 1KLVA 2A5UA 2UWQA 3QX1A 2D3GA 1YJ1A 4ICVA 2C7HA 3AU5A 2HE7A 2O6VD 3PRMB 4LCDE 3W1SC 3KVFB 4KDLB 1MG8A 2M4NA 4LJOB 3WALA 1V80A 4GDLB 3DBRI 2ZVNA 2LD9A 3WANA 2V1YA 3LJ3A 3TL5A 4N9F4 4EFOA 4JL9A 4EZJA 4KSKC 3UQAA 1E5WA 3BINA 2BKRB 3IVFA 2DAJA 5GMVA 2N9XA 2JUOA 1V6EA 3JVZX 1WM3A 4JLCA 3CSFA 4HCNB 2K39A 1WX8A 5DPRA 2K25A 3B08A 3P2BA 4MGIE 3EC8A 4IWQA 3H1UA 2AEHA 1HE8A 1WY8A 2JY6A 4II3B 3HHMA 3I3TB 5KHQA 3KH0A 4GXBA 2Z0EB 2KFKB 4NAWA 2MCNB 4ANXA 2JRIB 3QK0A 4WWOA 5J17A 3ZKJC 3DBHI 3L13A 2OOBB 4F1SA 3PT2B 4NPNA 3A33B 4BOZB 4XX5A 1SE9A 3R7RA 2AWTA 3QC8B 3L10B 2JVCA 1GJZA 4ZRJA 5JZEB 5CHWA 2LRWA 3ZVVA 5AEKB 4II2B 1V5OA 5CHFA 1UBQA 2EMTA 2M0XA 3OJ4B 4ZYNA 4FN2A 5E6PA 3ZNZB 1J19A 3JYUA 2PPHA 5DPWA 1GC7A 4GOCA 1XQQA 4WJQA 1YIWA 2Z59B 3AXCA 5L95C 3B1LX 4X57B 4W9JA 2KMAA 3A4RA 4KZ0A 4W9HA 2CHZA 2J7QB 3PLUA 4AJYB 1UH6A 2NR2A 3UIPB 4G50A 2DYBA 2ZCCA 3U30A 3PRPB 4HLEA 2WX1A 2FCNA 1Y8RC 3V62A 2FIDA 4TV3A 4IUMB 4MM3A 4CHKA 1U4AA 2HTHA 5LXIB 4HPLB 2G3QB 2KFJA 1WJ6A 3M62B 4FJZA 3LDZE 4HPMB 4FHKA 2G45B 2LWPA 2ZPNA 1WGYA 3QIJA 4KIKB 3VUWA 2L3ZA 3VUYA 4PYUA 5CTRC 2NBWB 5AZFA 4GDLA 4DXAB 1VD2A 3VTUA 1G6JA 4OVVA 3QCAA 3PGEA 3QARA 2IO1B 2KWCA 2R2QA 2V4LA 3DDCB 2MA9B 3IBEA 3QAQA 4FLHA 3VH3B 4E74A 2KX3A 1TBEA 4BFRA 4K81A 4MGKE 3RUIB 3ZRFA 3ZRCA 3HK0A 2ZVOA 3PHXB 1LQBA 4WQOB 4HDOA 1K8RB 2KFKA 1P1AA 2GBJA 2RD0A 1WF9A 4GDKA 2LASA 4FJVB 2B3AA 2CS4A 4KIKA 2HJ8A 2RPQA 2WWZA 1ZKHA 3VUXA 1V86A 1WR1A 2O6VA 2MP2A 3IG3A 4RM9A 2KWVB 2GBRA 2C7NB 3NS8A 4EOYA 1RRBA 4MGYE 2GBMA 3PRZA 4EZKA 1P3QU 2FCSA 2ZZPB 2GBNA 2KWUB 2ZEQA 4F8CB 2L0FA 2L76A 4W9DA 3APDA 2MBOA 4MEMA 5G55A 1IPGA 2J0KA 1YQBA 3AULA 2BWES 3KW5B 4W9IA 5D94A 2V3SA 4FHJA 2IO2B 4GSWA 2A4ZA 3JSVA 4BKSD 3L54A 2ZJDA 3M63B 4GN1A 2FAZA 2LRUA 3OAWA 4AUQC 1WFYA 1KJTA 3X23A 5AZHA 4ANUA 1P0RA 1GNUA 2KDIA 1LFDA 1F9JA 3ZTCA 3RZWC 1H4RA 3R3MA 4P7IA 4B9KA 3VQIA 1R4MI 3L16A 3ML9A 3AI5A 3DBSA 3DBLI 3PVLA 4IWPA 4W9EA 3V6EB 1H8CA 2RR9A 4FADA 1WE7A 4HWIB 4I6NB 1YX6B 2N9PC 4MSQB 3SDLC 3ZNID 4GGQA 5LLIA 2JWZA 2BF8B 2CHXA 4NJ7A 2KVRA 1OQYA 1XD3B 3U7DA 5TR5A 2OJRA 3A4SC 1R4NI 2D10A 2LI5A 4EUTA 4G3XB 3X0WA 2GBKA 2MWSB 2BWFA 2BYEA 1GG3A 1TGZB 3R66C 4PS8A 4PS3A 2KTFA 5DPSA 4HXDA 1WI0A 1NI2A 2LGYA 4TUUA 3TCAA 4TQ1A 3QA8A 4IM0A 4MELA 4G11A 4JIOU 2KKCA 4MDKE 3PSEB 1KM7A 4GB9A 2IO0B 1E8WA 3PHWB 3OLMD 1V49A 2AL3A 3DQVA 4JQWC 4BVUC 2MBBB 2O2VB 4XZ4A 4AJWA 4TQ0A 1ZGUB 3ECIA 5EDSA 2KQSA 2KHWB 4E3CA 2ZPYA 2D07B 2IBIB 2NCNA 4RMAA 3WIMA 3PZDA 4HJKA 4EKUA 2CKHB 3BY4B 1Q5WB 1OGWA 3GZNI 3VTWA 1E8XA 1AARA 3NHEB 1L2NA 1Z2MA 4IWOA 3TJPA 2BYFA 4B6WA 2PEAA 1E8ZA 3WAOA 3UIOB 1E90A 2JPHA 4K7WA 3PV1A 3VXWA 2KOXA 3K9OB 2KO3A 3VDZA 4DBGA 1TZ1A 2C5LC 2K8CA 3APCA 3CF6E 3HIZA 4ZRIA 2N9EB 2NPTB 4MJSA 5IA7A 4WAAA 2M17A 1ZW7A 3SU8X 1GUAB 2KLGA 4MSMB 2K6DB 3M95A 2FNJB 3GOEA 1FXTB 1J0GA 2ZCBA 3QQ8B 3V6CB 3EFUA 4M0WB 2BYVE 3ALBA 3UINB 1WM2A 2EMSA 1WX9A 2WDTB 4YL8A 2JXXA 3N3KB 3S2AA 2CR5A 2K8HA 3HM3A 5JHBA 4K1RB 2M8SA 1Q0WB 4NQLB 4LDTD 1WGDA 1UGMA 4A3PA 4DDID 1WYWB 2LGXA 3MTNB 1V5TA 3DCGA 3N30A 4DWFA 2KJHB 3RYTA 4GU2A 3L08A 2KJ6A 1Q1OA 1OEYA 3RD2A 5DCNA 3PS6A 3Q3FA 2LVPA 2LZ6A 4IW0A 1WRDB 3MJWA 2IO3B 5JHAA 5LXHA 3IHPC 4IM2A 2KX0A 2NVUI 3JW0X 2I1JA 4EEWA 3H7SA 2DZMA 2I1KA 2WYQA 4MGZE 4ANVA 3A9JB 3HM6X 4BBNF 3ZIMA 4M8MA 1E8YA 1WGHA 1V9JA 2IY0B 2PE6B 5CX3A 3R7QA 1NDDA 1C1YB 2K6QA 2KC2A 4I6LB 2KLCA 2GOWA 2L00B 1WMHB 2AYOB 4FJYA 4ASWC 4BKTA 4IC7B 2JF5A 4AWJA 2C60A 3OJ3A 2J0JA 4DHJB 3ZNGC 1D3ZA 5D2MB 4IG7B 4LDTB 3NZSA 4FBJB 2DYMA 1CMXB 1VCBA 2MX2A 2L0TA 3ZO5B 4IM3A 2KZRA 4ANWA 5IAAC 3ZDMC 4HK2A 4PYZA 1I42A 2C9WB 3NZUA 2MBEA 4NAWB 1V81A 4A20A 5D7GA 3RZFA 2DYOA 2ZNVC 3DPDA 1WMHA 2R2OA 4OVUA 2RGFA 1YD8U 2BPSA 4JGHB 1C3TA 4RM8A 1XT9B 1UELA 1LM8B 3B0AA 4AP4C 3DVNU 3PREA 2N1VA 3A9KB 2N1WA 4NQKE 3KYDD 4I6PA 3A9KA 3H6NA 1WR6E 2NBUA 2CHWA 2JZZA 2JZ3B 2N7EA 2Y5BB 4FULA 5KHOA 4BKSA 2KMCA 1P9DU 3A1QA 2KJRA 1WE6A 1UD7A 2KDEB 1S1QB 2XEWA 2LVQA 1BT0A 3RCZA 1M94A 1Z5SB 1EO6A 3KUDB 3VTVA 3K9PB 4A3OA 1IP9A 4GDKB 3EECA 1QZEA 4DK5A 2ZNVB 3W1SA 4KV2A 1V2YA 1YX5B 4G0NB 2XK5A 5J2RA 1ISNA 4WJPA 2PJHA 2K1FA 3DOWA 4HDQA 1TTNA 2XK5B 4TKNA 1WXSA 3CSTA 2IYDB 2DHZA 2KANA 1EF1A 2PE9A 2UYZB 2XBBC 3PTFC 4WJOA 2KQ7A 2CU1A 5BO4B 4BOSC 5E6OA 3KUZA 2MBQA 1A5RA 2VRRB 1OTRB 3D32A 3VFKA 1WJ4A 4KSLC 4KDIC 2KK8A 4E71A 3KYCD 3NY5A 2QHOA 2MW5A 3QWZB 2MBHA 3VAWA 1OEYJ 3ZTDA 2N7DA 2Z0DB 3VHTC 2KNBA 2DZJA 1I35A 2DAFA 2ASQA 5E6NA 2YLMA 2MLBA 3U8ZA 4DHZE 5D6JB 3ZDTA 1WH3A 2MQJA 2KC1A 2L7RA 2FCQA 2KTRB 1PQSA 2KDBA 3WAPA 4W9GA 3ZLZA 3ML8A 3UGBB 2D11A 2N4FA 4KZCA 2MSED 2DX5B 1WJUA 3TIXA 5L83A 2LUEA 2KD0A 4NNJB 2IY1B 4W9CA 4GIVA 2K8BA 4B95A 1S3SG 3T8MA 4WWNA 3A1QB 3NOBA 2AL6A 3M3JA 4HVBA 3H7PB 4XC2A 5C23A 2LXAA 3UQBA 1EF5A 4LJPB 3JSVB 1E7VA 1JRUA 1RLFA 3H9DA 4WJNA 4MJSB 4ZDVA 2L05A 3QJZA 4GMVA 4W9LA 3CMMB 5CHVC 2KTRA 3RT3B 2MRPA 3VVWB 3L17A 5JH5C 3KUCB 1UZXB 3ENEA 1GC6A 5DPTA 3WAMA 3ONSA 2WX0A 3ZUNA 2O6VB 2FCMA 3SD5A 3A9JA 1IYFA 5J18A 3AU4A 4M8NA 2C7MB 2LXCA 4WWPA 3V61A 1J8CA 4ZRKA 4EZLA 3TMPB 2MP2B 3ZW3A 3L0WB 1WGRA 2YVCA 4DDGD 4NJ6A 3TBLD 4W9KA 3SHQA 3PLVA 2FIFA 3VH4B 3V60A 4CYEA 5HKHA 3IFWB 1RFAA 1RAXA 3EHVA 3RULA 1WXVA 2W9NA 3O65B 4NY0A 2IZVB 2DZIA 2O2VA 4BBNC 3UF8A 1WXMA 3WA0A 1WZ0A 3MHSD 2NS5A 5G2NA 1X1MA 2FUHB 3DVGY 2J0MA 2JRHA 5AZGA 1WZ3A 4URKA 1KOTA 4DHZB 2G4DB 3QHTA 3DVNV 1SIFA 1T0YA 3APFA 3PPAA 1LXDA 1UBIA 2KN5A 2L8JA 3C0RB 4F7ZA 2NPTA 1WGGA 1WXAA 2JT4B 4FA6A 2LGDA 2G4SA 1WX7A 4KVGB 1P98A 3Q3JA 1L7YA 3T9LA 3W1YA 1SGHA 4MH0E 2M1MA 5FR6A 2LVOA 2KXJA 3DVGX 2BGFA 2GMIC 2REXA 4W9FA 2BKFA 4PS7A
chains in the Genus database with same CATH superfamily
1IGDA 2HD5B 2DENB 2QIEB 4K7SA 3ZNHB 2M19A 2X38A 1WIAA 4LNNA 5C1ZA 4ITKA 2WDRB 3EUB2 4XWWA 2MJEA 4YSXB 3UI3A 3QX1A 2WXKA 2ON8A 2C7HA 3AU5A 1I4HA 3BK1A 1V80A 2WP9B 1YQ3B 1UWXA 3LJ3A 5C2TB 4KSKC 2DAJA 1T0SC 3JVZX 2V3NA 3EGRA 3DHHC 4HCNB 2K39A 1WY8A 3T3OA 1F52A 2W3RA 5IP4D 3AE7B 2Y5CA 5KHQA 2Z0EB 3SEBA 3NVVA 2JRIB 3DBHI 2H88B 1FRRA 2RDHA 3A33B 3PT2B 3R7RA 1R4NB 5CHWA 4II2B 3OJ4B 3W2DA 4ZYNA 3AE9B 2CJNA 1TYGB 4GOCA 1XQQA 2LJIA 2DBYA 2CHZA 2J7QB 1UH6A 2NR2A 1L4DB 1GB1A 4HLEA 2WX1A 2WS3B 1C78A 3N9YC 4CHKA 5LXIB 3P63A 4UDUC 2KFJA 3M62B 4FHKA 1WGYA 4K3CA 3VUWA 3VUYA 5CTRC 1FXIA 3PGEA 2WXRA 2MA9B 3IBEA 1R4MB 2AQ3B 2KX3A 1TBEA 2G1EA 3ZRFA 2ZVOA 4JWUC 1KRHA 1JRPA 1P1AA 2RPVA 2LASA 2K3UA 3AN1A 2CS4A 2HJ8A 1WR1A 3ABVB 2C7NB 2GBMA 3PRZA 2KWDA 2FCSA 4XDCA 2BQQA 2MBOA 1Y56A 3AULA 4JX1C 1B9RA 1ZXHA 4CQNA 2V3SA 4FHJA 4GSWA 1CQVA 1T6BX 2A4ZA 3JSVA 4OZBA 3Q3OC 4GN1A 3OAWA 1HZ5A 2Y5PA 1XEEA 3RNEC 4ANUA 3RFZB 3TEXA 1F9JA 1WXQA 1T0QC 3IXSA 3L16A 2WXQA 2G9HD 1SE3A 3IAM1 1YX6B 3MHZA 1ZE3D 2CHXA 1TY2A 1XD3B 3NUHB 3TUOA 4ZHOA 1E0ZA 1R4NI 4WAFA 4EUTA 4G3XB 2MWSB 3R66C 5DPSA 2K5PA 1FCCC 3AM9A 1NI2A 3TCAA 4TQ1A 4IM0A 4G11A 3P42A 4TMAB 1PUTA 4BVUC 4IDIA 4XZ4A 1ZGUB 1IUEA 1MPEA 3LXFA 2ZW0A 2ZPYA 4WQMA 3WIMA 4HJKA 4EKUA 3BY4B 1OGWA 3VTWA 1E8XA 2WXMA 4IWOA 2MEKA 3PV1A 3VXWA 1FNWA 5G5GA 5BMHA 2K9XA 4DBGA 1TZ1A 1J7AA 3R8BA 2K6DB 3GOEA 4MM3B 2Z8LA 1FXTB 5HG2A 3V6CB 2LHDA 3UINB 1V1PB 3IT4B 3N3KB 4M0WA 3S2AA 5H8YE 2K8HA 5JHBA 3HM3A 2M8SA 1V5TA 4DWFA 2KJHB 3RYTA 1E9MA 4XE0A 1OEYA 2LVPA 1ACCA 1HQRD 5LXHA 3IHPC 1JWBD 1TT5B 2I1JA 1ZDXA 2DZMA 2Q5WD 4Q2JA 4ANVA 4J3OD 1E8YA 2IY0B 1NDDA 2KC2A 4I6LB 2KLCA 2NTTA 4IC7B 3BVGA 2D5GA 3ZNGC 3VRAB 4M02A 2KN4A 4IG7B 4LDTB 4A8XC 5IN7A 1CMXB 1VCBA 2L0TA 4YWGG 3MJ5A 4RGNA 1I42A 3URYA 4ZRQA 3RZFA 3FILA 1WMHA 4YTMB 2XNAC 4RM8A 1LM8B 1UELA 2AQ2B 2IDYA 4P6VF 2N1VA 2N1WA 4NQKE 4RCOA 3N1YC 1XLQA 2GRIA 4BKSA 2Y5BB 3DBHB 2KJRA 4BZAA 2XEWA 2LVQA 4A3OA 4GDKB 1QZEA 1SIJA 1FEHA 5J2RA 4WJPA 2GLSA 1HTQA 2BS4B 2PJHA 1Q10A 3DOWA 4YTPB 5FKAC 4TKNA 3CSTA 1FCLA 2PE9A 2XBBC 2PKOA 2KQ7A 2PIAA 1XLNA 3D32A 1ZOYB 2QJLA 3VFKA 4KDIC 2M0AA 1RWSA 2J4XA 1OEYJ 1I4XA 3VHTC 2ASQA 5E6NA 1C79A 4YTNB 1JCKB 1VLBA 2JYTA 3U8ZA 4PT5A 5D6JB 2NMQA 3RNFC 4XYCA 2BYTA 3WAPA 3ML8A 2N7JA 2N4FA 2DX5B 3TIXA 5L83A 4LTUA 2K8BA 4WWNA 4HVBA 1CJEA 3CWIA 2QILA 1FO4A 3RNBC 4JWSC 3AEFB 5E6JA 4XWTA 1JRUA 1WRIA 3Q8BA 4ZDVA 4KKIA 2KTRA 4OZCA 2MRPA 1F77A 3ENEA 3WAMA 1DYQA 2WX0A 2O6VB 1K50A 3A9JA 1AN8A 4WWPA 4P16A 1J8CA 2BBCA 1RYJA 4ZRKA 4EZLA 2MP2B 3ZW3A 3L0WB 1WGRA 2YVCA 3NVWA 1ET9A 4NJ6A 1BXTA 3SHQA 1DGJA 2FIFA 3VH4B 4CYEA 2W82A 3EHVA 1C4AA 2DZIA 2IZVB 2O2VA 4N58A 3C8YA 3WA0A 3MHSD 2NS5A 1WGKA 1X1MA 3P4RB 1JWUD 1YQ4B 1F2RC 2ONQA 1SIFA 1N63A 3AMZA 3PPAA 5FR3A 2KN5A 3AEBB 2NPTA 4KVGB 2CU3A 1L7YA 3T9LA 5FR6A 3BVZA 2GMIC 2VZKD 3DWGC 2BKFA 1F2RI 2JSVX 3N32A 4AOFA 1E7UA 1JROA 2DZKA 1T5XD 2JZPA 4BKGA 4GLSC 2EKEC 4HCPB 2WXIA 2QEJC 2A5UA 2D3GA 1N61A 2FBWB 4ICVA 1QF6A 4KDLB 1MG8A 1CZPA 3MC9A 1V1PA 1K52A 1C77A 2PMVA 3WANA 3B2GA 4N9F4 5BYRA 4EFOA 3UQAA 4EE2A 3DBLB 2JUOA 4QAYA 3CSFA 5DPRA 4MGIE 3P2BA 2V9HA 4IWQA 1HE8A 2ACZB 2JY6A 1TS2A 5BMIA 5IKCM 2WNMA 3HHMA 3KH0A 2MCNB 2KFKB 3VR8B 4WWOA 3L13A 4BOZB 2AWTA 3L10B 4BAXA 3HVDA 1UBQA 1V8CA 2QMTA 1KF6B 1MHHE 1J19A 1ENFA 1JQ4A 1FFUA 1L6VA 1V97A 3AXCA 5L95C 4X57B 4W9JA 3MP9A 4KZ0A 2WDVB 4AJYB 2DYBA 2ZCCA 3U30A 4HRSA 2FIDA 3HRDD 1U4AA 4HPLB 1KLUD 1WJ6A 4FJZA 2G45B 2LWPA 4KIKB 4XDDA 2L3ZA 1VZ8A 3E56A 2NBWB 5AZFA 4KGRA 3MFGA 3VTUA 1G6JA 4HEA1 4OVVA 1LGRA 2IO1B 1C76A 2KWCA 2R2QA 3QAQA 1YJIA 5IOIA 3W9CB 2TSSA 2HJ1A 2YEPB 3BK2A 1K8RB 3VRBB 5AUKA 3AEAB 4GDKA 2KVZA 1ZKHA 1V86A 3IG3A 1EU4A 3NS8A 1VZ7A 1RRBA 2M56B 1FPYA 4EZKA 5GXGB 2GBNA 2KWUB 2ZEQA 4F8CB 4W9DA 3APDA 4MEMA 5G55A 2E3TA 5D94A 1JALA 2IO2B 3O13A 2ZJDA 1STEA 4OVZA 4ZOHC 5EE1A 3X23A 3I63C 2KDIA 1LFDA 2ICIA 3ZTCA 3ZYYX 2AX5A 1H4RA 2K22A 3VQIA 4IWPA 3PVLA 4W9EA 3V6EB 1H8CA 3Q8FA 1WE7A 1UUPA 3AE6B 3OG5A 2N9PC 4MSQB 3ZNID 5LLIA 4B0MA 4L2YA 3U7DA 2KQ4X 2LGIA 2OJRA 2D10A 1SE4A 2WXHA 2VZKB 4PS3A 2WGSA 2R61A 4RNAA 1A70A 4TUUA 1TKEA 2V4IB 4JIOU 1N60A 4K3BA 1SBBB 2IO0B 1V49A 1NENB 4E3CA 4IOIE 4NZLB 3U2SC 4RMAA 4REZA 3GZNI 1Z2MA 4B6WA 2PEAA 3NZ3A 3WAOA 3AH7A 2C5LC 2K8CA 3CF6E 2NPTB 4WAAA 2M17A 4HROA 1GUAB 2X8XX 3AB5A 3I5JC 2FNJB 3W5VB 2ZCBA 4YT0B 3EFUA 1FNUA 3ALBA 1KH0A 2EMSA 2CR5A 1LO5D 4DDID 1Q0WB 2J53A 1QLBB 1I4RA 1QOBA 1TS5A 3DCGA 1ET6A 2WXLA 3Q3FA 1E10A 1WRDB 5EE0A 1QOFA 3PZ8A 2I1KA 2WYQA 1C4CA 2GB1A 4M8MA 1V9JA 2PE6B 3R7QA 5CX3A 2ZW1A 1C1YB 1XCQL 2GOWA 1WMHB 1ZXIA 2AYOB 4FJYA 4BKTA 1D5MC 1XF5L 3LYYA 3P4QB 2C60A 3OJ3A 4DHJB 2B76B 4JPSA 1KFYB 4C7ZA 1E7PB 4C00A 3NZSA 1UGJA 4HK2A 3NZUA 3OWEB 4NAWB 1V81A 3BYYB 4A20A 1NEKB 1P7EA 1FMAD 5AUIA 1YD8U 1C3TA 3J9CA 1XT9B 3KWVA 3A9KA 2RDGA 2CHWA 2JZ3B 4FULA 1P9DU 3A1QA 4XGAB 1BT0A 1M94A 4NJCA 1EO6A 4ACFA 2ZNVB 3W1SA 4C80A 1YX5B 4MH8A 4HDQA 4PK1A 4H2AA 4A55A 1I4PA 2KANA 2UYZB 3PTFC 1IBXA 1OTRB 1AW7A 1UWMA 4E71A 3KYCD 1SJHD 2QHOA 4WIPA 2MW5A 1T0RC 2MBHA 2YLMA 2FCQA 2KDBA 2MH7A 3ZLZA 4C56C 2OJWA 2KD0A 4W9CA 3NOBA 1SXTA 4TSSA 3UQBA 4USAA 4LJPB 1E7VA 4WJNA 4MJSB 3V3XA 3QJZA 5CHVC 5EE3A 1UZXB 2EKIA 2FCMA 3P4SB 1IYFA 3R2TA 2C7MB 2LXCA 2KMMA 3V61A 1FIQA 3Q3NC 2RMMA 2DNFA 1RFAA 1RAXA 1UNSA 1WZ0A 5G2NA 2FUHB 3DVGY 3I57A 2QC8A 2JRHA 1WZ3A 3Q14C 4DHZB 3QHTA 2D3AA 1T0YA 3U4EG 1UBIA 4DXFA 4F7ZA 3Q8AA 1WGGA 3Q3JA 2IGGA 3W1YA 4LK0M 4MH0E 2LVOA 2KXJA 3DVGX 2REXA 3RNGC 4W9FA 4RF0A 3R2IA 1YN5A 4HPPA 3H7PA 1WJNA 3RN9C 2D2QA 2LJ5A 2RSUA 4DHJD 1EUVB 4CO7A 3AEDB 4KGSA 1YJ1A 1VDVA 1L0YB 1PDXA 2O6VD 3PRMB 3KVFB 2M4NA 3WALA 1L0VB 2W54A 2ZVNA 2LD9A 2V1YA 1PGBA 3TL5A 4JL9A 4EZJA 1E5WA 3BINA 1V6EA 4JLCA 1MI0A 2K25A 3Q2AC 3H1UA 2AEHA 1UF0A 2LEKA 3I3TB 1L5PA 4GXBA 4ANXA 1HXYD 2QCZA 5J17A 3ZKJC 4F1SA 4XX5A 3QC8B 4ZRJA 4ZRPA 3ZVVA 4RGTA 1V5OA 4D2KA 5CHFA 1QILA 3ZNZB 5DPWA 3B1LX 2KMAA 3A4RA 1MG4A 1Y8RC 4YSYB 2HTHA 1QT9A 1SEBD 2HTME 3RNAC 4HPMB 3Q8EA 1D5ZC 4PYUA 2IJ0A 4DXAB 2PW9A 2DWQA 2L1AA 5C3JB 3QARA 3U7ZA 1B1ZA 4OHJA 3DDCB 1MHXA 3RUIB 3ZRCA 3HK0A 3PHXB 1LQBA 4WQOB 4KX6B 2SAKA 2L32A 2RD0A 1EU3A 3GP7A 2W55A 4FJVB 4KIKA 2RPQA 3VUXA 3RPFC 2O6VA 2MP2A 4RM9A 4MGYE 3HUIA 2JQRB 1XLOA 2ZZPB 1XO3A 3SFEB 2L0FA 2L76A 4W9IA 2J0KA 3KWLA 4A6QA 3N1XC 2EELA 4BKSD 3L54A 1D5XC 2FAZA 1HEZE 1N5WA 1WFYA 1KJTA 1SJED 2MJDA 3AECB 1GNUA 3RZWC 3R3MA 3DBSA 3LB8C 2NTSA 1PFDA 2RR9A 2WLBA 4FADA 1F0ZA 2BVCA 4I6NB 1GPXA 1KLGD 3SDLC 4GGQA 2JWZA 2BF8B 2KVRA 1OQYA 1BUIC 5TR5A 3A4SC 4M01A 1ZUD2 2WXFA 2GBKA 2BYEA 1GG3A 3FILB 2N9LA 3GB1A 5D3IB 3IAS1 4RGOS 4US8A 1TKGA 2KKCA 3PSEB 4GB9A 2PTLA 1FFVA 1E8WA 1MJDA 1AWDA 3DQVA 4JQWC 2CJOA 2MBBB 2GI9A 4TQ0A 5EDSA 1JWSD 2KQSA 2KHWB 2D07B 2NCNA 3AEGB 4MACA 3KQ4A 1ZPSA 2CKHB 1Q5WB 4KKJA 1L2NA 1AARA 1WYGA 3NHEB 1D6EC 2MJ3A 4K7WA 5I4DA 2KOXA 3K9OB 2KO3A 3HIZA 5IA7A 4ZRIA 4MJSA 2KLGA 3M95A 1J0GA 3QQ8B 3DWMA 2AQ1B 1SSNA 2WDTB 4K1RB 4NQLB 4LDTD 1WGDA 1UGMA 4A3PA 4DXGA 4A90A 4L1BA 3DBRB 4FXCA 4GU2A 2KYWA 1FXAA 1HZ6A 1VJKA 5TSSA 3MJWA 2IO3B 4IM2A 2KX0A 2NVUI 3NG0A 3JW0X 4EEWA 3H7SA 3A9JB 3HM6X 3ZIMA 2WXPA 3SR6A 1I4GA 2JWUA 2L00B 3B2FA 3VR9B 4AWJA 2J0JA 4N59A 4FBJB 2DYMA 4IM3A 2KZRA 4ANWA 3ZDMC 4PYZA 5D7GA 2ZNVC 4C7YA 2R2OA 1EWYC 2LHEA 3PREA 2WU2B 3A9KB 5LNK1 2IGDA 1AYFA 2D3BA 4I6PA 3AE8B 3H6NA 1XXGA 2NBUA 2JZZA 5KHOA 5BYSA 5HI1A 1S1QB 3AE1B 2HDEA 1RM6C 3U52E 1Z5SB 3KUDB 5BMGA 1HA5A 1V1OA 1L4ZB 2UU7A 1V2YA 4G0NB 1ISNA 3ZXRA 2RDBC 2W3SA 2YEPF 2K1FA 2XK5B 1OQQA 2DHZA 4WJOA 5BO4B 4BOSC 4RFBA 3KUZA 1A5RA 2VRRB 1WJ4A 2I2YA 2KK8A 5HHDG 3NJTA 1TY0A 1TJEA 2N7DA 4US9A 3ZTDA 2Z0DB 2DZJA 2MLBA 3W5UB 3ZDTA 1WH3A 2KC1A 1QOAA 1WWTA 1YN3A 2INDC 2MSED 1FM0D 3TEWA 1L0XB 4NNJB 2IY1B 2BS2B 3I9V1 1YJJA 1S3SG 3T8MA 2AL6A 2LUMA 4XC2A 5C23A 2BS3B 1VRAB 2FUG1 3JSVB 1E6EB 3Q6BA 5IO9A 1RLFA 4ZYSA 1QKZA 3RT3B 3VVWB 3EA6A 4NAMA 1DOIA 3ZUNA 5J18A 3AU4A 3AE3B 1I4QA 1L6UA 2D3CA 4DDGD 1C4PA 3Q69A 2LMCA 1FNVA 5HKHA 1EM7A 3O65B 1KTKA 4BBNC 3UF8A 3AE2B 1WXMA 1OQRA 2J0MA 1KOTA 5G5HA 4ARIA 2L8JA 4AQ7A 1BMLC 2G4SA 1P98A 2M1MA 2I38A 3AV8A 4J6IA 2JX5A 4LNFA 3BVMA 1N5XA 4WWMA 4ICUA 4K7UA 1NBFC 2NBVB 1J7BA 1K51A 2KACA 2KDFB 1KLVA 2V3PA 3AEEB 2UWQA 1PGXA 1ZP0B 2HE7A 4LCDE 3W1SC 4LJOB 4GDLB 3DBRI 3B9JA 2MHJA 3P1MA 1RFKA 2PLPA 1ZDVA 4DQOC 1FD6A 2BKRB 3IVFA 5GMVA 2KT7A 2N9XA 3ZJUA 1WM3A 4ZHPA 1YMHE 1WX8A 3FC4A 1ROEA 3B08A 4S0RA 1C9FA 3EC8A 1F1HA 4II3B 1TZOA 1NVID 3TSSA 4NAWA 1ESFA 2QDFA 3QK0A 2OOBB 4NPNA 1SF0A 3P4PB 1SE9A 3GS2A 1TKYA 4KGTA 2JVCA 1GJZA 5JZEB 2LRWA 5AEKB 1IGCA 4IKGA 4WURA 2EMTA 2M0XA 2WXGA 1OFFA 4FN2A 5E6PA 1GAQB 3JYUA 2PPHA 4P1CC 1GC7A 3N1ZC 4WJQA 1YIWA 2Z59B 1D4BA 4W9HA 3PLUA 2J42A 3UIPB 4G50A 3PRPB 2FCNA 3V62A 2INPE 4TV3A 4IUMB 1MFWA 4MM3A 3NS1A 2INNE 4B0EA 2G3QB 3Q3MC 3LDZE 2ZPNA 3QIJA 3NRZA 5EE9A 2OHFA 3KLSX 4GDLA 1VD2A 3TEYA 2N0SB 3QCAA 2V4LA 4FLHA 4RGMA 3VH3B 4E74A 4BFRA 4K81A 4MGKE 4HDOA 2KFKA 2GBJA 2PVOD 1GB4A 1WF9A 1XLPA 2B3AA 4P1BC 2WWZA 3ETRA 2KWVB 2GBRA 4EOYA 3PO0A 1VZ6A 1P3QU 1XCTL 4LNIA 3GE3C 5H92C 1YOVB 1IPGA 3KW5B 1YQBA 2BWES 3DHGC 2LGSA 1GOZA 3C19A 3CIRB 1HTOA 3EFCA 2WXOA 3M63B 2LRUA 4AUQC 2IPKD 2WXJA 3DHIC 5AZHA 1P0RA 3H8HA 4P7IA 4B9KA 1R4MI 3ML9A 3AI5A 3DBLI 2BTEA 3L4PA 2WDQB 2BB6A 1TS3A 4HWIB 3FKYA 4WH4A 4JE3B 5BYQA 4HJGE 4NJ7A 5FK9C 2WU5B 2H89B 1R7SA 2LI5A 3X0WA 2KDMA 2BWFA 4PS8A 1TGZB 2K0PA 2KTFA 4HXDA 2QSDA 1WI0A 2LGYA 3MC8A 3BWUD 1PYWD 3QA8A 1WSPA 1NI3A 4MELA 4MDKE 1KM7A 4HKZE 3PHWB 1JW9D 3ZJVA 3OLMD 1J7CA 2AL3A 4RF1A 2O2VB 4AJWA 3ECIA 2IBIB 1NYRA 2LFIA 3PZDA 3TJPA 3BIID 2BYFA 1E8ZA 3N20C 3UIOB 3ZJTA 1E90A 2JPHA 3TEZA 3VDZA 2WXNA 3APCA 2N9EB 1DOYA 1ZW7A 3PZ7A 3SU8X 2FE8A 1TS4A 2IGHA 4MSMB 1N6ZA 4YXDB 1EWCA 2BT6A 4M0WB 2BYVE 1WM2A 1YNTE 1WX9A 3FAHA 4YL8A 2JXXA 1IBXB 3RMKC 1WYWB 2LGXA 2OEDA 3MTNB 3N30A 3L08A 2KJ6A 1Q1OA 1K53A 3RD2A 5DCNA 3PS6A 2LZ6A 2E6XA 4IW0A 1N62A 5JHAA 1M4VA 4MGZE 4BBNF 1WGHA 2K6QA 5HFYA 4ASWC 2JF5A 2JYEA 4A9AA 5JXVA 3WCQA 1SB3C 3HVZA 2BW2A 1D3ZA 5D2MB 4LNKA 2MX2A 3NVZA 1PGAA 3ZO5B 5IAAC 2C9WB 2MBEA 3IT6B 1FRDA 2DYOA 2BB5A 3DPDA 3BYTB 4OVUA 2RGFA 2BPSA 4JGHB 3B0AA 4AP4C 3DVNU 1JWMD 3KYDD 3SFDB 4ARCA 1WR6E 2N7EA 1CK1A 2KMCA 2Y3AA 1WE6A 1UD7A 2KDEB 1QOGA 3RCZA 4RH6A 4OZAA 3VTVA 3K9PB 1IP9A 3ZGZA 2VH2A 3GE8C 3EECA 4DK5A 3RI7C 4KV2A 3MC0B 2XK5A 4M00A 1JWAD 1TTNA 1WXSA 2IYDB 5T8IA 1EF1A 3RNCC 4YSZB 2CU1A 5E6OA 2MBQA 3Q8CA 2INCC 4KSLC 3NY5A 4L23A 1VR9A 3QWZB 3VAWA 1SE2A 1T3QA 2KNBA 1I35A 2DAFA 3NVYA 4MT5A 3AE5B 3GZNB 4DHZE 2MQJA 2L7RA 2KTRB 1PQSA 4W9GA 2XN9C 3UGBB 2D11A 3BZDB 4KZCA 3T3NA 4C4VB 1WJUA 3V05A 3ZQ4A 2LUEA 4S17A 4N6EB 4GIVA 4HKQA 3ZXVA 4B95A 4OW0A 2KAJA 5D3DA 3A1QB 2V0GA 3M3JA 2JU6X 3H7PB 2LXAA 3E9SA 1EF5A 2WHIA 3H9DA 2L05A 4AS1A 4GMVA 4W9LA 3CMMB 1DOXA 3AE4B 2J52A 3L17A 2SEBD 5JH5C 1I7HA 3KUCB 4R3DA 1GC6A 5DPTA 2L83A 3ONSA 3SD5A 1MVKA 2PVGC 4M8NA 1TIFA 3TMPB 1NYQA 2DLBA 3TBLD 4W9KA 3PLVA 3V60A 2JXTA 2N9KA 3IFWB 4LNOA 3RULA 1WXVA 2W9NA 4NY0A 4O1NA 1QQRA 5AZGA 1P7FA 4URKA 2L52A 2WQYB 5MPOA 2G4DB 3DVNV 2VH1A 4LLGM 3APFA 4C4VA 1LXDA 3C0RB 4FA6A 1WXAA 2JT4B 2LGDA 1WX7A 1SGHA 1YN4A 2BGFA 1JMLA 4PS7A
chains in the Genus database with same CATH topology
4J6IA 2HD5B 3N32A 2DENB 4K7SA 3ZNHB 4AOFA 1E7UA 3H7PA 1WIAA 1WJNA 2DZKA 2D2QA 5C1ZA 4ICUA 2LJ5A 4BKGA 4K7UA 1NBFC 2NBVB 1EUVB 2RSUA 4DHJD 2KDFB 4CO7A 2EKEC 4HCPB 1KLVA 2A5UA 2UWQA 3QX1A 2D3GA 1YJ1A 4ICVA 2C7HA 3AU5A 2HE7A 2O6VD 3PRMB 4LCDE 3W1SC 3KVFB 4KDLB 1MG8A 2M4NA 4LJOB 3WALA 1V80A 4GDLB 3DBRI 2ZVNA 2LD9A 3WANA 2V1YA 3LJ3A 3TL5A 4N9F4 4EFOA 4JL9A 4EZJA 4KSKC 3UQAA 1E5WA 3BINA 2BKRB 3IVFA 2DAJA 5GMVA 2N9XA 2JUOA 1V6EA 3JVZX 1WM3A 4JLCA 3CSFA 4HCNB 2K39A 1WX8A 5DPRA 2K25A 3B08A 3P2BA 4MGIE 3EC8A 4IWQA 3H1UA 2AEHA 1HE8A 1WY8A 2JY6A 4II3B 3HHMA 3I3TB 5KHQA 3KH0A 4GXBA 2Z0EB 2KFKB 4NAWA 2MCNB 4ANXA 2JRIB 3QK0A 4WWOA 5J17A 3ZKJC 3DBHI 3L13A 2OOBB 4F1SA 3PT2B 4NPNA 3A33B 4BOZB 4XX5A 1SE9A 3R7RA 2AWTA 3QC8B 3L10B 2JVCA 1GJZA 4ZRJA 5JZEB 5CHWA 2LRWA 3ZVVA 5AEKB 4II2B 1V5OA 5CHFA 1UBQA 2EMTA 2M0XA 3OJ4B 4ZYNA 4FN2A 5E6PA 3ZNZB 1J19A 3JYUA 2PPHA 5DPWA 1GC7A 4GOCA 1XQQA 4WJQA 1YIWA 2Z59B 3AXCA 5L95C 3B1LX 4X57B 4W9JA 2KMAA 3A4RA 4KZ0A 4W9HA 2CHZA 2J7QB 3PLUA 4AJYB 1UH6A 2NR2A 3UIPB 4G50A 2DYBA 2ZCCA 3U30A 3PRPB 4HLEA 2WX1A 2FCNA 1Y8RC 3V62A 2FIDA 4TV3A 4IUMB 4MM3A 4CHKA 1U4AA 2HTHA 5LXIB 4HPLB 2G3QB 2KFJA 1WJ6A 3M62B 4FJZA 3LDZE 4HPMB 4FHKA 2G45B 2LWPA 2ZPNA 1WGYA 3QIJA 4KIKB 3VUWA 2L3ZA 3VUYA 4PYUA 5CTRC 2NBWB 5AZFA 4GDLA 4DXAB 1VD2A 3VTUA 1G6JA 4OVVA 3QCAA 3PGEA 3QARA 2IO1B 2KWCA 2R2QA 2V4LA 3DDCB 2MA9B 3IBEA 3QAQA 4FLHA 3VH3B 4E74A 2KX3A 1TBEA 4BFRA 4K81A 4MGKE 3RUIB 3ZRFA 3ZRCA 3HK0A 2ZVOA 3PHXB 1LQBA 4WQOB 4HDOA 1K8RB 2KFKA 1P1AA 2GBJA 2RD0A 1WF9A 4GDKA 2LASA 4FJVB 2B3AA 2CS4A 4KIKA 2HJ8A 2RPQA 2WWZA 1ZKHA 3VUXA 1V86A 1WR1A 2O6VA 2MP2A 3IG3A 4RM9A 2KWVB 2GBRA 2C7NB 3NS8A 4EOYA 1RRBA 4MGYE 2GBMA 3PRZA 4EZKA 1P3QU 2FCSA 2ZZPB 2GBNA 2KWUB 2ZEQA 4F8CB 2L0FA 2L76A 4W9DA 3APDA 2MBOA 4MEMA 5G55A 1IPGA 2J0KA 1YQBA 3AULA 2BWES 3KW5B 4W9IA 5D94A 2V3SA 4FHJA 2IO2B 4GSWA 2A4ZA 3JSVA 4BKSD 3L54A 2ZJDA 3M63B 4GN1A 2FAZA 2LRUA 3OAWA 4AUQC 1WFYA 1KJTA 3X23A 5AZHA 4ANUA 1P0RA 1GNUA 2KDIA 1LFDA 1F9JA 3ZTCA 3RZWC 1H4RA 3R3MA 4P7IA 4B9KA 3VQIA 1R4MI 3L16A 3ML9A 3AI5A 3DBSA 3DBLI 3PVLA 4IWPA 4W9EA 3V6EB 1H8CA 2RR9A 4FADA 1WE7A 4HWIB 4I6NB 1YX6B 2N9PC 4MSQB 3SDLC 3ZNID 4GGQA 5LLIA 2JWZA 2BF8B 2CHXA 4NJ7A 2KVRA 1OQYA 1XD3B 3U7DA 5TR5A 2OJRA 3A4SC 1R4NI 2D10A 2LI5A 4EUTA 4G3XB 3X0WA 2GBKA 2MWSB 2BWFA 2BYEA 1GG3A 1TGZB 3R66C 4PS8A 4PS3A 2KTFA 5DPSA 4HXDA 1WI0A 1NI2A 2LGYA 4TUUA 3TCAA 4TQ1A 3QA8A 4IM0A 4MELA 4G11A 4JIOU 2KKCA 4MDKE 3PSEB 1KM7A 4GB9A 2IO0B 1E8WA 3PHWB 3OLMD 1V49A 2AL3A 3DQVA 4JQWC 4BVUC 2MBBB 2O2VB 4XZ4A 4AJWA 4TQ0A 1ZGUB 3ECIA 5EDSA 2KQSA 2KHWB 4E3CA 2ZPYA 2D07B 2IBIB 2NCNA 4RMAA 3WIMA 3PZDA 4HJKA 4EKUA 2CKHB 3BY4B 1Q5WB 1OGWA 3GZNI 3VTWA 1E8XA 1AARA 3NHEB 1L2NA 1Z2MA 4IWOA 3TJPA 2BYFA 4B6WA 2PEAA 1E8ZA 3WAOA 3UIOB 1E90A 2JPHA 4K7WA 3PV1A 3VXWA 2KOXA 3K9OB 2KO3A 3VDZA 4DBGA 1TZ1A 2C5LC 2K8CA 3APCA 3CF6E 3HIZA 4ZRIA 2N9EB 2NPTB 4MJSA 5IA7A 4WAAA 2M17A 1ZW7A 3SU8X 1GUAB 2KLGA 4MSMB 2K6DB 3M95A 2FNJB 3GOEA 1FXTB 1J0GA 2ZCBA 3QQ8B 3V6CB 3EFUA 4M0WB 2BYVE 3ALBA 3UINB 1WM2A 2EMSA 1WX9A 2WDTB 4YL8A 2JXXA 3N3KB 3S2AA 2CR5A 2K8HA 3HM3A 5JHBA 4K1RB 2M8SA 1Q0WB 4NQLB 4LDTD 1WGDA 1UGMA 4A3PA 4DDID 1WYWB 2LGXA 3MTNB 1V5TA 3DCGA 3N30A 4DWFA 2KJHB 3RYTA 4GU2A 3L08A 2KJ6A 1Q1OA 1OEYA 3RD2A 5DCNA 3PS6A 3Q3FA 2LVPA 2LZ6A 4IW0A 1WRDB 3MJWA 2IO3B 5JHAA 5LXHA 3IHPC 4IM2A 2KX0A 2NVUI 3JW0X 2I1JA 4EEWA 3H7SA 2DZMA 2I1KA 2WYQA 4MGZE 4ANVA 3A9JB 3HM6X 4BBNF 3ZIMA 4M8MA 1E8YA 1WGHA 1V9JA 2IY0B 2PE6B 5CX3A 3R7QA 1NDDA 1C1YB 2K6QA 2KC2A 4I6LB 2KLCA 2GOWA 2L00B 1WMHB 2AYOB 4FJYA 4ASWC 4BKTA 4IC7B 2JF5A 4AWJA 2C60A 3OJ3A 2J0JA 4DHJB 3ZNGC 1D3ZA 5D2MB 4IG7B 4LDTB 3NZSA 4FBJB 2DYMA 1CMXB 1VCBA 2MX2A 2L0TA 3ZO5B 4IM3A 2KZRA 4ANWA 5IAAC 3ZDMC 4HK2A 4PYZA 1I42A 2C9WB 3NZUA 2MBEA 4NAWB 1V81A 4A20A 5D7GA 3RZFA 2DYOA 2ZNVC 3DPDA 1WMHA 2R2OA 4OVUA 2RGFA 1YD8U 2BPSA 4JGHB 1C3TA 4RM8A 1XT9B 1UELA 1LM8B 3B0AA 4AP4C 3DVNU 3PREA 2N1VA 3A9KB 2N1WA 4NQKE 3KYDD 4I6PA 3A9KA 3H6NA 1WR6E 2NBUA 2CHWA 2JZZA 2JZ3B 2N7EA 2Y5BB 4FULA 5KHOA 4BKSA 2KMCA 1P9DU 3A1QA 2KJRA 1WE6A 1UD7A 2KDEB 1S1QB 2XEWA 2LVQA 1BT0A 3RCZA 1M94A 1Z5SB 1EO6A 3KUDB 3VTVA 3K9PB 4A3OA 1IP9A 4GDKB 3EECA 1QZEA 4DK5A 2ZNVB 3W1SA 4KV2A 1V2YA 1YX5B 4G0NB 2XK5A 5J2RA 1ISNA 4WJPA 2PJHA 2K1FA 3DOWA 4HDQA 1TTNA 2XK5B 4TKNA 1WXSA 3CSTA 2IYDB 2DHZA 2KANA 1EF1A 2PE9A 2UYZB 2XBBC 3PTFC 4WJOA 2KQ7A 2CU1A 5BO4B 4BOSC 5E6OA 3KUZA 2MBQA 1A5RA 2VRRB 1OTRB 3D32A 3VFKA 1WJ4A 4KSLC 4KDIC 2KK8A 4E71A 3KYCD 3NY5A 2QHOA 2MW5A 3QWZB 2MBHA 3VAWA 1OEYJ 3ZTDA 2N7DA 2Z0DB 3VHTC 2KNBA 2DZJA 1I35A 2DAFA 2ASQA 5E6NA 2YLMA 2MLBA 3U8ZA 4DHZE 5D6JB 3ZDTA 1WH3A 2MQJA 2KC1A 2L7RA 2FCQA 2KTRB 1PQSA 2KDBA 3WAPA 4W9GA 3ZLZA 3ML8A 3UGBB 2D11A 2N4FA 4KZCA 2MSED 2DX5B 1WJUA 3TIXA 5L83A 2LUEA 2KD0A 4NNJB 2IY1B 4W9CA 4GIVA 2K8BA 4B95A 1S3SG 3T8MA 4WWNA 3A1QB 3NOBA 2AL6A 3M3JA 4HVBA 3H7PB 4XC2A 5C23A 2LXAA 3UQBA 1EF5A 4LJPB 3JSVB 1E7VA 1JRUA 1RLFA 3H9DA 4WJNA 4MJSB 4ZDVA 2L05A 3QJZA 4GMVA 4W9LA 3CMMB 5CHVC 2KTRA 3RT3B 2MRPA 3VVWB 3L17A 5JH5C 3KUCB 1UZXB 3ENEA 1GC6A 5DPTA 3WAMA 3ONSA 2WX0A 3ZUNA 2O6VB 2FCMA 3SD5A 3A9JA 1IYFA 5J18A 3AU4A 4M8NA 2C7MB 2LXCA 4WWPA 3V61A 1J8CA 4ZRKA 4EZLA 3TMPB 2MP2B 3ZW3A 3L0WB 1WGRA 2YVCA 4DDGD 4NJ6A 3TBLD 4W9KA 3SHQA 3PLVA 2FIFA 3VH4B 3V60A 4CYEA 5HKHA 3IFWB 1RFAA 1RAXA 3EHVA 3RULA 1WXVA 2W9NA 3O65B 4NY0A 2IZVB 2DZIA 2O2VA 4BBNC 3UF8A 1WXMA 3WA0A 1WZ0A 3MHSD 2NS5A 5G2NA 1X1MA 2FUHB 3DVGY 2J0MA 2JRHA 5AZGA 1WZ3A 4URKA 1KOTA 4DHZB 2G4DB 3QHTA 3DVNV 1SIFA 1T0YA 3APFA 3PPAA 1LXDA 1UBIA 2KN5A 2L8JA 3C0RB 4F7ZA 2NPTA 1WGGA 1WXAA 2JT4B 4FA6A 2LGDA 2G4SA 1WX7A 4KVGB 1P98A 3Q3JA 1L7YA 3T9LA 3W1YA 1SGHA 4MH0E 2M1MA 5FR6A 2LVOA 2KXJA 3DVGX 2BGFA 2GMIC 2REXA 4W9FA 2BKFA 4PS7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J6I A;  2HD5 B;  3N32 A;  2DEN B;  4K7S A;  3ZNH B;  4AOF A;  1E7U A;  3H7P A;  1WIA A;  1WJN A;  2DZK A;  2D2Q A;  5C1Z A;  4ICU A;  2LJ5 A;  4BKG A;  4K7U A;  1NBF C;  2NBV B;  1EUV B;  2RSU A;  4DHJ D;  2KDF B;  4CO7 A;  2EKE C;  4HCP B;  1KLV A;  2A5U A;  2UWQ A;  3QX1 A;  2D3G A;  1YJ1 A;  4ICV A;  2C7H A;  3AU5 A;  2HE7 A;  2O6V D;  3PRM B;  4LCD E;  3W1S C;  3KVF B;  4KDL B;  1MG8 A;  2M4N A;  4LJO B;  3WAL A;  1V80 A;  4GDL B;  3DBR I;  2ZVN A;  2LD9 A;  3WAN A;  2V1Y A;  3LJ3 A;  3TL5 A;  4N9F 4;  4EFO A;  4JL9 A;  4EZJ A;  4KSK C;  3UQA A;  1E5W A;  3BIN A;  2BKR B;  3IVF A;  2DAJ A;  5GMV A;  2N9X A;  2JUO A;  1V6E A;  3JVZ X;  1WM3 A;  4JLC A;  3CSF A;  4HCN B;  2K39 A;  1WX8 A;  5DPR A;  2K25 A;  3B08 A;  3P2B A;  4MGI E;  3EC8 A;  4IWQ A;  3H1U A;  2AEH A;  1HE8 A;  1WY8 A;  2JY6 A;  4II3 B;  3HHM A;  3I3T B;  5KHQ A;  3KH0 A;  4GXB A;  2Z0E B;  2KFK B;  4NAW A;  2MCN B;  4ANX A;  2JRI B;  3QK0 A;  4WWO A;  5J17 A;  3ZKJ C;  3DBH I;  3L13 A;  2OOB B;  4F1S A;  3PT2 B;  4NPN A;  3A33 B;  4BOZ B;  4XX5 A;  1SE9 A;  3R7R A;  2AWT A;  3QC8 B;  3L10 B;  2JVC A;  1GJZ A;  4ZRJ A;  5JZE B;  5CHW A;  2LRW A;  3ZVV A;  5AEK B;  4II2 B;  1V5O A;  5CHF A;  1UBQ A;  2EMT A;  2M0X A;  3OJ4 B;  4ZYN A;  4FN2 A;  5E6P A;  3ZNZ B;  1J19 A;  3JYU A;  2PPH A;  5DPW A;  1GC7 A;  4GOC A;  1XQQ A;  4WJQ A;  1YIW A;  2Z59 B;  3AXC A;  5L95 C;  3B1L X;  4X57 B;  4W9J A;  2KMA A;  3A4R A;  4KZ0 A;  4W9H A;  2CHZ A;  2J7Q B;  3PLU A;  4AJY B;  1UH6 A;  2NR2 A;  3UIP B;  4G50 A;  2DYB A;  2ZCC A;  3U30 A;  3PRP B;  4HLE A;  2WX1 A;  2FCN A;  1Y8R C;  3V62 A;  2FID A;  4TV3 A;  4IUM B;  4MM3 A;  4CHK A;  1U4A A;  2HTH A;  5LXI B;  4HPL B;  2G3Q B;  2KFJ A;  1WJ6 A;  3M62 B;  4FJZ A;  3LDZ E;  4HPM B;  4FHK A;  2G45 B;  2LWP A;  2ZPN A;  1WGY A;  3QIJ A;  4KIK B;  3VUW A;  2L3Z A;  3VUY A;  4PYU A;  5CTR C;  2NBW B;  5AZF A;  4GDL A;  4DXA B;  1VD2 A;  3VTU A;  1G6J A;  4OVV A;  3QCA A;  3PGE A;  3QAR A;  2IO1 B;  2KWC A;  2R2Q A;  2V4L A;  3DDC B;  2MA9 B;  3IBE A;  3QAQ A;  4FLH A;  3VH3 B;  4E74 A;  2KX3 A;  1TBE A;  4BFR A;  4K81 A;  4MGK E;  3RUI B;  3ZRF A;  3ZRC A;  3HK0 A;  2ZVO A;  3PHX B;  1LQB A;  4WQO B;  4HDO A;  1K8R B;  2KFK A;  1P1A A;  2GBJ A;  2RD0 A;  1WF9 A;  4GDK A;  2LAS A;  4FJV B;  2B3A A;  2CS4 A;  4KIK A;  2HJ8 A;  2RPQ A;  2WWZ A;  1ZKH A;  3VUX A;  1V86 A;  1WR1 A;  2O6V A;  2MP2 A;  3IG3 A;  4RM9 A;  2KWV B;  2GBR A;  2C7N B;  3NS8 A;  4EOY A;  1RRB A;  4MGY E;  2GBM A;  3PRZ A;  4EZK A;  1P3Q U;  2FCS A;  2ZZP B;  2GBN A;  2KWU B;  2ZEQ A;  4F8C B;  2L0F A;  2L76 A;  4W9D A;  3APD A;  2MBO A;  4MEM A;  5G55 A;  1IPG A;  2J0K A;  1YQB A;  3AUL A;  2BWE S;  3KW5 B;  4W9I A;  5D94 A;  2V3S A;  4FHJ A;  2IO2 B;  4GSW A;  2A4Z A;  3JSV A;  4BKS D;  3L54 A;  2ZJD A;  3M63 B;  4GN1 A;  2FAZ A;  2LRU A;  3OAW A;  4AUQ C;  1WFY A;  1KJT A;  3X23 A;  5AZH A;  4ANU A;  1P0R A;  1GNU A;  2KDI A;  1LFD A;  1F9J A;  3ZTC A;  3RZW C;  1H4R A;  3R3M A;  4P7I A;  4B9K A;  3VQI A;  1R4M I;  3L16 A;  3ML9 A;  3AI5 A;  3DBS A;  3DBL I;  3PVL A;  4IWP A;  4W9E A;  3V6E B;  1H8C A;  2RR9 A;  4FAD A;  1WE7 A;  4HWI B;  4I6N B;  1YX6 B;  2N9P C;  4MSQ B;  3SDL C;  3ZNI D;  4GGQ A;  5LLI A;  2JWZ A;  2BF8 B;  2CHX A;  4NJ7 A;  2KVR A;  1OQY A;  1XD3 B;  3U7D A;  5TR5 A;  2OJR A;  3A4S C;  1R4N I;  2D10 A;  2LI5 A;  4EUT A;  4G3X B;  3X0W A;  2GBK A;  2MWS B;  2BWF A;  2BYE A;  1GG3 A;  1TGZ B;  3R66 C;  4PS8 A;  4PS3 A;  2KTF A;  5DPS A;  4HXD A;  1WI0 A;  1NI2 A;  2LGY A;  4TUU A;  3TCA A;  4TQ1 A;  3QA8 A;  4IM0 A;  4MEL A;  4G11 A;  4JIO U;  2KKC A;  4MDK E;  3PSE B;  1KM7 A;  4GB9 A;  2IO0 B;  1E8W A;  3PHW B;  3OLM D;  1V49 A;  2AL3 A;  3DQV A;  4JQW C;  4BVU C;  2MBB B;  2O2V B;  4XZ4 A;  4AJW A;  4TQ0 A;  1ZGU B;  3ECI A;  5EDS A;  2KQS A;  2KHW B;  4E3C A;  2ZPY A;  2D07 B;  2IBI B;  2NCN A;  4RMA A;  3WIM A;  3PZD A;  4HJK A;  4EKU A;  2CKH B;  3BY4 B;  1Q5W B;  1OGW A;  3GZN I;  3VTW A;  1E8X A;  1AAR A;  3NHE B;  1L2N A;  1Z2M A;  4IWO A;  3TJP A;  2BYF A;  4B6W A;  2PEA A;  1E8Z A;  3WAO A;  3UIO B;  1E90 A;  2JPH A;  4K7W A;  3PV1 A;  3VXW A;  2KOX A;  3K9O B;  2KO3 A;  3VDZ A;  4DBG A;  1TZ1 A;  2C5L C;  2K8C A;  3APC A;  3CF6 E;  3HIZ A;  4ZRI A;  2N9E B;  2NPT B;  4MJS A;  5IA7 A;  4WAA A;  2M17 A;  1ZW7 A;  3SU8 X;  1GUA B;  2KLG A;  4MSM B;  2K6D B;  3M95 A;  2FNJ B;  3GOE A;  1FXT B;  1J0G A;  2ZCB A;  3QQ8 B;  3V6C B;  3EFU A;  4M0W B;  2BYV E;  3ALB A;  3UIN B;  1WM2 A;  2EMS A;  1WX9 A;  2WDT B;  4YL8 A;  2JXX A;  3N3K B;  3S2A A;  2CR5 A;  2K8H A;  3HM3 A;  5JHB A;  4K1R B;  2M8S A;  1Q0W B;  4NQL B;  4LDT D;  1WGD A;  1UGM A;  4A3P A;  4DDI D;  1WYW B;  2LGX A;  3MTN B;  1V5T A;  3DCG A;  3N30 A;  4DWF A;  2KJH B;  3RYT A;  4GU2 A;  3L08 A;  2KJ6 A;  1Q1O A;  1OEY A;  3RD2 A;  5DCN A;  3PS6 A;  3Q3F A;  2LVP A;  2LZ6 A;  4IW0 A;  1WRD B;  3MJW A;  2IO3 B;  5JHA A;  5LXH A;  3IHP C;  4IM2 A;  2KX0 A;  2NVU I;  3JW0 X;  2I1J A;  4EEW A;  3H7S A;  2DZM A;  2I1K A;  2WYQ A;  4MGZ E;  4ANV A;  3A9J B;  3HM6 X;  4BBN F;  3ZIM A;  4M8M A;  1E8Y A;  1WGH A;  1V9J A;  2IY0 B;  2PE6 B;  5CX3 A;  3R7Q A;  1NDD A;  1C1Y B;  2K6Q A;  2KC2 A;  4I6L B;  2KLC A;  2GOW A;  2L00 B;  1WMH B;  2AYO B;  4FJY A;  4ASW C;  4BKT A;  4IC7 B;  2JF5 A;  4AWJ A;  2C60 A;  3OJ3 A;  2J0J A;  4DHJ B;  3ZNG C;  1D3Z A;  5D2M B;  4IG7 B;  4LDT B;  3NZS A;  4FBJ B;  2DYM A;  1CMX B;  1VCB A;  2MX2 A;  2L0T A;  3ZO5 B;  4IM3 A;  2KZR A;  4ANW A;  5IAA C;  3ZDM C;  4HK2 A;  4PYZ A;  1I42 A;  2C9W B;  3NZU A;  2MBE A;  4NAW B;  1V81 A;  4A20 A;  5D7G A;  3RZF A;  2DYO A;  2ZNV C;  3DPD A;  1WMH A;  2R2O A;  4OVU A;  2RGF A;  1YD8 U;  2BPS A;  4JGH B;  1C3T A;  4RM8 A;  1XT9 B;  1UEL A;  1LM8 B;  3B0A A;  4AP4 C;  3DVN U;  3PRE A;  2N1V A;  3A9K B;  2N1W A;  4NQK E;  3KYD D;  4I6P A;  3A9K A;  3H6N A;  1WR6 E;  2NBU A;  2CHW A;  2JZZ A;  2JZ3 B;  2N7E A;  2Y5B B;  4FUL A;  5KHO A;  4BKS A;  2KMC A;  1P9D U;  3A1Q A;  2KJR A;  1WE6 A;  1UD7 A;  2KDE B;  1S1Q B;  2XEW A;  2LVQ A;  1BT0 A;  3RCZ A;  1M94 A;  1Z5S B;  1EO6 A;  3KUD B;  3VTV A;  3K9P B;  4A3O A;  1IP9 A;  4GDK B;  3EEC A;  1QZE A;  4DK5 A;  2ZNV B;  3W1S A;  4KV2 A;  1V2Y A;  1YX5 B;  4G0N B;  2XK5 A;  5J2R A;  1ISN A;  4WJP A;  2PJH A;  2K1F A;  3DOW A;  4HDQ A;  1TTN A;  2XK5 B;  4TKN A;  1WXS A;  3CST A;  2IYD B;  2DHZ A;  2KAN A;  1EF1 A;  2PE9 A;  2UYZ B;  2XBB C;  3PTF C;  4WJO A;  2KQ7 A;  2CU1 A;  5BO4 B;  4BOS C;  5E6O A;  3KUZ A;  2MBQ A;  1A5R A;  2VRR B;  1OTR B;  3D32 A;  3VFK A;  1WJ4 A;  4KSL C;  4KDI C;  2KK8 A;  4E71 A;  3KYC D;  3NY5 A;  2QHO A;  2MW5 A;  3QWZ B;  2MBH A;  3VAW A;  1OEY J;  3ZTD A;  2N7D A;  2Z0D B;  3VHT C;  2KNB A;  2DZJ A;  1I35 A;  2DAF A;  2ASQ A;  5E6N A;  2YLM A;  2MLB A;  3U8Z A;  4DHZ E;  5D6J B;  3ZDT A;  1WH3 A;  2MQJ A;  2KC1 A;  2L7R A;  2FCQ A;  2KTR B;  1PQS A;  2KDB A;  3WAP A;  4W9G A;  3ZLZ A;  3ML8 A;  3UGB B;  2D11 A;  2N4F A;  4KZC A;  2MSE D;  2DX5 B;  1WJU A;  3TIX A;  5L83 A;  2LUE A;  2KD0 A;  4NNJ B;  2IY1 B;  4W9C A;  4GIV A;  2K8B A;  4B95 A;  1S3S G;  3T8M A;  4WWN A;  3A1Q B;  3NOB A;  2AL6 A;  3M3J A;  4HVB A;  3H7P B;  4XC2 A;  5C23 A;  2LXA A;  3UQB A;  1EF5 A;  4LJP B;  3JSV B;  1E7V A;  1JRU A;  1RLF A;  3H9D A;  4WJN A;  4MJS B;  4ZDV A;  2L05 A;  3QJZ A;  4GMV A;  4W9L A;  3CMM B;  5CHV C;  2KTR A;  3RT3 B;  2MRP A;  3VVW B;  3L17 A;  5JH5 C;  3KUC B;  1UZX B;  3ENE A;  1GC6 A;  5DPT A;  3WAM A;  3ONS A;  2WX0 A;  3ZUN A;  2O6V B;  2FCM A;  3SD5 A;  3A9J A;  1IYF A;  5J18 A;  3AU4 A;  4M8N A;  2C7M B;  2LXC A;  4WWP A;  3V61 A;  1J8C A;  4ZRK A;  4EZL A;  3TMP B;  2MP2 B;  3ZW3 A;  3L0W B;  1WGR A;  2YVC A;  4DDG D;  4NJ6 A;  3TBL D;  4W9K A;  3SHQ A;  3PLV A;  2FIF A;  3VH4 B;  3V60 A;  4CYE A;  5HKH A;  3IFW B;  1RFA A;  1RAX A;  3EHV A;  3RUL A;  1WXV A;  2W9N A;  3O65 B;  4NY0 A;  2IZV B;  2DZI A;  2O2V A;  4BBN C;  3UF8 A;  1WXM A;  3WA0 A;  1WZ0 A;  3MHS D;  2NS5 A;  5G2N A;  1X1M A;  2FUH B;  3DVG Y;  2J0M A;  2JRH A;  5AZG A;  1WZ3 A;  4URK A;  1KOT A;  4DHZ B;  2G4D B;  3QHT A;  3DVN V;  1SIF A;  1T0Y A;  3APF A;  3PPA A;  1LXD A;  1UBI A;  2KN5 A;  2L8J A;  3C0R B;  4F7Z A;  2NPT A;  1WGG A;  1WXA A;  2JT4 B;  4FA6 A;  2LGD A;  2G4S A;  1WX7 A;  4KVG B;  1P98 A;  3Q3J A;  1L7Y A;  3T9L A;  3W1Y A;  1SGH A;  4MH0 E;  2M1M A;  5FR6 A;  2LVO A;  2KXJ A;  3DVG X;  2BGF A;  2GMI C;  2REX A;  4W9F A;  2BKF A;  4PS7 A; 
#chains in the Genus database with same CATH topology
 1IGD A;  2HD5 B;  2DEN B;  2QIE B;  4K7S A;  3ZNH B;  2M19 A;  2X38 A;  1WIA A;  4LNN A;  5C1Z A;  4ITK A;  2WDR B;  3EUB 2;  4XWW A;  2MJE A;  4YSX B;  3UI3 A;  3QX1 A;  2WXK A;  2ON8 A;  2C7H A;  3AU5 A;  1I4H A;  3BK1 A;  1V80 A;  2WP9 B;  1YQ3 B;  1UWX A;  3LJ3 A;  5C2T B;  4KSK C;  2DAJ A;  1T0S C;  3JVZ X;  2V3N A;  3EGR A;  3DHH C;  4HCN B;  2K39 A;  1WY8 A;  3T3O A;  1F52 A;  2W3R A;  5IP4 D;  3AE7 B;  2Y5C A;  5KHQ A;  2Z0E B;  3SEB A;  3NVV A;  2JRI B;  3DBH I;  2H88 B;  1FRR A;  2RDH A;  3A33 B;  3PT2 B;  3R7R A;  1R4N B;  5CHW A;  4II2 B;  3OJ4 B;  3W2D A;  4ZYN A;  3AE9 B;  2CJN A;  1TYG B;  4GOC A;  1XQQ A;  2LJI A;  2DBY A;  2CHZ A;  2J7Q B;  1UH6 A;  2NR2 A;  1L4D B;  1GB1 A;  4HLE A;  2WX1 A;  2WS3 B;  1C78 A;  3N9Y C;  4CHK A;  5LXI B;  3P63 A;  4UDU C;  2KFJ A;  3M62 B;  4FHK A;  1WGY A;  4K3C A;  3VUW A;  3VUY A;  5CTR C;  1FXI A;  3PGE A;  2WXR A;  2MA9 B;  3IBE A;  1R4M B;  2AQ3 B;  2KX3 A;  1TBE A;  2G1E A;  3ZRF A;  2ZVO A;  4JWU C;  1KRH A;  1JRP A;  1P1A A;  2RPV A;  2LAS A;  2K3U A;  3AN1 A;  2CS4 A;  2HJ8 A;  1WR1 A;  3ABV B;  2C7N B;  2GBM A;  3PRZ A;  2KWD A;  2FCS A;  4XDC A;  2BQQ A;  2MBO A;  1Y56 A;  3AUL A;  4JX1 C;  1B9R A;  1ZXH A;  4CQN A;  2V3S A;  4FHJ A;  4GSW A;  1CQV A;  1T6B X;  2A4Z A;  3JSV A;  4OZB A;  3Q3O C;  4GN1 A;  3OAW A;  1HZ5 A;  2Y5P A;  1XEE A;  3RNE C;  4ANU A;  3RFZ B;  3TEX A;  1F9J A;  1WXQ A;  1T0Q C;  3IXS A;  3L16 A;  2WXQ A;  2G9H D;  1SE3 A;  3IAM 1;  1YX6 B;  3MHZ A;  1ZE3 D;  2CHX A;  1TY2 A;  1XD3 B;  3NUH B;  3TUO A;  4ZHO A;  1E0Z A;  1R4N I;  4WAF A;  4EUT A;  4G3X B;  2MWS B;  3R66 C;  5DPS A;  2K5P A;  1FCC C;  3AM9 A;  1NI2 A;  3TCA A;  4TQ1 A;  4IM0 A;  4G11 A;  3P42 A;  4TMA B;  1PUT A;  4BVU C;  4IDI A;  4XZ4 A;  1ZGU B;  1IUE A;  1MPE A;  3LXF A;  2ZW0 A;  2ZPY A;  4WQM A;  3WIM A;  4HJK A;  4EKU A;  3BY4 B;  1OGW A;  3VTW A;  1E8X A;  2WXM A;  4IWO A;  2MEK A;  3PV1 A;  3VXW A;  1FNW A;  5G5G A;  5BMH A;  2K9X A;  4DBG A;  1TZ1 A;  1J7A A;  3R8B A;  2K6D B;  3GOE A;  4MM3 B;  2Z8L A;  1FXT B;  5HG2 A;  3V6C B;  2LHD A;  3UIN B;  1V1P B;  3IT4 B;  3N3K B;  4M0W A;  3S2A A;  5H8Y E;  2K8H A;  5JHB A;  3HM3 A;  2M8S A;  1V5T A;  4DWF A;  2KJH B;  3RYT A;  1E9M A;  4XE0 A;  1OEY A;  2LVP A;  1ACC A;  1HQR D;  5LXH A;  3IHP C;  1JWB D;  1TT5 B;  2I1J A;  1ZDX A;  2DZM A;  2Q5W D;  4Q2J A;  4ANV A;  4J3O D;  1E8Y A;  2IY0 B;  1NDD A;  2KC2 A;  4I6L B;  2KLC A;  2NTT A;  4IC7 B;  3BVG A;  2D5G A;  3ZNG C;  3VRA B;  4M02 A;  2KN4 A;  4IG7 B;  4LDT B;  4A8X C;  5IN7 A;  1CMX B;  1VCB A;  2L0T A;  4YWG G;  3MJ5 A;  4RGN A;  1I42 A;  3URY A;  4ZRQ A;  3RZF A;  3FIL A;  1WMH A;  4YTM B;  2XNA C;  4RM8 A;  1LM8 B;  1UEL A;  2AQ2 B;  2IDY A;  4P6V F;  2N1V A;  2N1W A;  4NQK E;  4RCO A;  3N1Y C;  1XLQ A;  2GRI A;  4BKS A;  2Y5B B;  3DBH B;  2KJR A;  4BZA A;  2XEW A;  2LVQ A;  4A3O A;  4GDK B;  1QZE A;  1SIJ A;  1FEH A;  5J2R A;  4WJP A;  2GLS A;  1HTQ A;  2BS4 B;  2PJH A;  1Q10 A;  3DOW A;  4YTP B;  5FKA C;  4TKN A;  3CST A;  1FCL A;  2PE9 A;  2XBB C;  2PKO A;  2KQ7 A;  2PIA A;  1XLN A;  3D32 A;  1ZOY B;  2QJL A;  3VFK A;  4KDI C;  2M0A A;  1RWS A;  2J4X A;  1OEY J;  1I4X A;  3VHT C;  2ASQ A;  5E6N A;  1C79 A;  4YTN B;  1JCK B;  1VLB A;  2JYT A;  3U8Z A;  4PT5 A;  5D6J B;  2NMQ A;  3RNF C;  4XYC A;  2BYT A;  3WAP A;  3ML8 A;  2N7J A;  2N4F A;  2DX5 B;  3TIX A;  5L83 A;  4LTU A;  2K8B A;  4WWN A;  4HVB A;  1CJE A;  3CWI A;  2QIL A;  1FO4 A;  3RNB C;  4JWS C;  3AEF B;  5E6J A;  4XWT A;  1JRU A;  1WRI A;  3Q8B A;  4ZDV A;  4KKI A;  2KTR A;  4OZC A;  2MRP A;  1F77 A;  3ENE A;  3WAM A;  1DYQ A;  2WX0 A;  2O6V B;  1K50 A;  3A9J A;  1AN8 A;  4WWP A;  4P16 A;  1J8C A;  2BBC A;  1RYJ A;  4ZRK A;  4EZL A;  2MP2 B;  3ZW3 A;  3L0W B;  1WGR A;  2YVC A;  3NVW A;  1ET9 A;  4NJ6 A;  1BXT A;  3SHQ A;  1DGJ A;  2FIF A;  3VH4 B;  4CYE A;  2W82 A;  3EHV A;  1C4A A;  2DZI A;  2IZV B;  2O2V A;  4N58 A;  3C8Y A;  3WA0 A;  3MHS D;  2NS5 A;  1WGK A;  1X1M A;  3P4R B;  1JWU D;  1YQ4 B;  1F2R C;  2ONQ A;  1SIF A;  1N63 A;  3AMZ A;  3PPA A;  5FR3 A;  2KN5 A;  3AEB B;  2NPT A;  4KVG B;  2CU3 A;  1L7Y A;  3T9L A;  5FR6 A;  3BVZ A;  2GMI C;  2VZK D;  3DWG C;  2BKF A;  1F2R I;  2JSV X;  3N32 A;  4AOF A;  1E7U A;  1JRO A;  2DZK A;  1T5X D;  2JZP A;  4BKG A;  4GLS C;  2EKE C;  4HCP B;  2WXI A;  2QEJ C;  2A5U A;  2D3G A;  1N61 A;  2FBW B;  4ICV A;  1QF6 A;  4KDL B;  1MG8 A;  1CZP A;  3MC9 A;  1V1P A;  1K52 A;  1C77 A;  2PMV A;  3WAN A;  3B2G A;  4N9F 4;  5BYR A;  4EFO A;  3UQA A;  4EE2 A;  3DBL B;  2JUO A;  4QAY A;  3CSF A;  5DPR A;  4MGI E;  3P2B A;  2V9H A;  4IWQ A;  1HE8 A;  2ACZ B;  2JY6 A;  1TS2 A;  5BMI A;  5IKC M;  2WNM A;  3HHM A;  3KH0 A;  2MCN B;  2KFK B;  3VR8 B;  4WWO A;  3L13 A;  4BOZ B;  2AWT A;  3L10 B;  4BAX A;  3HVD A;  1UBQ A;  1V8C A;  2QMT A;  1KF6 B;  1MHH E;  1J19 A;  1ENF A;  1JQ4 A;  1FFU A;  1L6V A;  1V97 A;  3AXC A;  5L95 C;  4X57 B;  4W9J A;  3MP9 A;  4KZ0 A;  2WDV B;  4AJY B;  2DYB A;  2ZCC A;  3U30 A;  4HRS A;  2FID A;  3HRD D;  1U4A A;  4HPL B;  1KLU D;  1WJ6 A;  4FJZ A;  2G45 B;  2LWP A;  4KIK B;  4XDD A;  2L3Z A;  1VZ8 A;  3E56 A;  2NBW B;  5AZF A;  4KGR A;  3MFG A;  3VTU A;  1G6J A;  4HEA 1;  4OVV A;  1LGR A;  2IO1 B;  1C76 A;  2KWC A;  2R2Q A;  3QAQ A;  1YJI A;  5IOI A;  3W9C B;  2TSS A;  2HJ1 A;  2YEP B;  3BK2 A;  1K8R B;  3VRB B;  5AUK A;  3AEA B;  4GDK A;  2KVZ A;  1ZKH A;  1V86 A;  3IG3 A;  1EU4 A;  3NS8 A;  1VZ7 A;  1RRB A;  2M56 B;  1FPY A;  4EZK A;  5GXG B;  2GBN A;  2KWU B;  2ZEQ A;  4F8C B;  4W9D A;  3APD A;  4MEM A;  5G55 A;  2E3T A;  5D94 A;  1JAL A;  2IO2 B;  3O13 A;  2ZJD A;  1STE A;  4OVZ A;  4ZOH C;  5EE1 A;  3X23 A;  3I63 C;  2KDI A;  1LFD A;  2ICI A;  3ZTC A;  3ZYY X;  2AX5 A;  1H4R A;  2K22 A;  3VQI A;  4IWP A;  3PVL A;  4W9E A;  3V6E B;  1H8C A;  3Q8F A;  1WE7 A;  1UUP A;  3AE6 B;  3OG5 A;  2N9P C;  4MSQ B;  3ZNI D;  5LLI A;  4B0M A;  4L2Y A;  3U7D A;  2KQ4 X;  2LGI A;  2OJR A;  2D10 A;  1SE4 A;  2WXH A;  2VZK B;  4PS3 A;  2WGS A;  2R61 A;  4RNA A;  1A70 A;  4TUU A;  1TKE A;  2V4I B;  4JIO U;  1N60 A;  4K3B A;  1SBB B;  2IO0 B;  1V49 A;  1NEN B;  4E3C A;  4IOI E;  4NZL B;  3U2S C;  4RMA A;  4REZ A;  3GZN I;  1Z2M A;  4B6W A;  2PEA A;  3NZ3 A;  3WAO A;  3AH7 A;  2C5L C;  2K8C A;  3CF6 E;  2NPT B;  4WAA A;  2M17 A;  4HRO A;  1GUA B;  2X8X X;  3AB5 A;  3I5J C;  2FNJ B;  3W5V B;  2ZCB A;  4YT0 B;  3EFU A;  1FNU A;  3ALB A;  1KH0 A;  2EMS A;  2CR5 A;  1LO5 D;  4DDI D;  1Q0W B;  2J53 A;  1QLB B;  1I4R A;  1QOB A;  1TS5 A;  3DCG A;  1ET6 A;  2WXL A;  3Q3F A;  1E10 A;  1WRD B;  5EE0 A;  1QOF A;  3PZ8 A;  2I1K A;  2WYQ A;  1C4C A;  2GB1 A;  4M8M A;  1V9J A;  2PE6 B;  3R7Q A;  5CX3 A;  2ZW1 A;  1C1Y B;  1XCQ L;  2GOW A;  1WMH B;  1ZXI A;  2AYO B;  4FJY A;  4BKT A;  1D5M C;  1XF5 L;  3LYY A;  3P4Q B;  2C60 A;  3OJ3 A;  4DHJ B;  2B76 B;  4JPS A;  1KFY B;  4C7Z A;  1E7P B;  4C00 A;  3NZS A;  1UGJ A;  4HK2 A;  3NZU A;  3OWE B;  4NAW B;  1V81 A;  3BYY B;  4A20 A;  1NEK B;  1P7E A;  1FMA D;  5AUI A;  1YD8 U;  1C3T A;  3J9C A;  1XT9 B;  3KWV A;  3A9K A;  2RDG A;  2CHW A;  2JZ3 B;  4FUL A;  1P9D U;  3A1Q A;  4XGA B;  1BT0 A;  1M94 A;  4NJC A;  1EO6 A;  4ACF A;  2ZNV B;  3W1S A;  4C80 A;  1YX5 B;  4MH8 A;  4HDQ A;  4PK1 A;  4H2A A;  4A55 A;  1I4P A;  2KAN A;  2UYZ B;  3PTF C;  1IBX A;  1OTR B;  1AW7 A;  1UWM A;  4E71 A;  3KYC D;  1SJH D;  2QHO A;  4WIP A;  2MW5 A;  1T0R C;  2MBH A;  2YLM A;  2FCQ A;  2KDB A;  2MH7 A;  3ZLZ A;  4C56 C;  2OJW A;  2KD0 A;  4W9C A;  3NOB A;  1SXT A;  4TSS A;  3UQB A;  4USA A;  4LJP B;  1E7V A;  4WJN A;  4MJS B;  3V3X A;  3QJZ A;  5CHV C;  5EE3 A;  1UZX B;  2EKI A;  2FCM A;  3P4S B;  1IYF A;  3R2T A;  2C7M B;  2LXC A;  2KMM A;  3V61 A;  1FIQ A;  3Q3N C;  2RMM A;  2DNF A;  1RFA A;  1RAX A;  1UNS A;  1WZ0 A;  5G2N A;  2FUH B;  3DVG Y;  3I57 A;  2QC8 A;  2JRH A;  1WZ3 A;  3Q14 C;  4DHZ B;  3QHT A;  2D3A A;  1T0Y A;  3U4E G;  1UBI A;  4DXF A;  4F7Z A;  3Q8A A;  1WGG A;  3Q3J A;  2IGG A;  3W1Y A;  4LK0 M;  4MH0 E;  2LVO A;  2KXJ A;  3DVG X;  2REX A;  3RNG C;  4W9F A;  4RF0 A;  3R2I A;  1YN5 A;  4HPP A;  3H7P A;  1WJN A;  3RN9 C;  2D2Q A;  2LJ5 A;  2RSU A;  4DHJ D;  1EUV B;  4CO7 A;  3AED B;  4KGS A;  1YJ1 A;  1VDV A;  1L0Y B;  1PDX A;  2O6V D;  3PRM B;  3KVF B;  2M4N A;  3WAL A;  1L0V B;  2W54 A;  2ZVN A;  2LD9 A;  2V1Y A;  1PGB A;  3TL5 A;  4JL9 A;  4EZJ A;  1E5W A;  3BIN A;  1V6E A;  4JLC A;  1MI0 A;  2K25 A;  3Q2A C;  3H1U A;  2AEH A;  1UF0 A;  2LEK A;  3I3T B;  1L5P A;  4GXB A;  4ANX A;  1HXY D;  2QCZ A;  5J17 A;  3ZKJ C;  4F1S A;  4XX5 A;  3QC8 B;  4ZRJ A;  4ZRP A;  3ZVV A;  4RGT A;  1V5O A;  4D2K A;  5CHF A;  1QIL A;  3ZNZ B;  5DPW A;  3B1L X;  2KMA A;  3A4R A;  1MG4 A;  1Y8R C;  4YSY B;  2HTH A;  1QT9 A;  1SEB D;  2HTM E;  3RNA C;  4HPM B;  3Q8E A;  1D5Z C;  4PYU A;  2IJ0 A;  4DXA B;  2PW9 A;  2DWQ A;  2L1A A;  5C3J B;  3QAR A;  3U7Z A;  1B1Z A;  4OHJ A;  3DDC B;  1MHX A;  3RUI B;  3ZRC A;  3HK0 A;  3PHX B;  1LQB A;  4WQO B;  4KX6 B;  2SAK A;  2L32 A;  2RD0 A;  1EU3 A;  3GP7 A;  2W55 A;  4FJV B;  4KIK A;  2RPQ A;  3VUX A;  3RPF C;  2O6V A;  2MP2 A;  4RM9 A;  4MGY E;  3HUI A;  2JQR B;  1XLO A;  2ZZP B;  1XO3 A;  3SFE B;  2L0F A;  2L76 A;  4W9I A;  2J0K A;  3KWL A;  4A6Q A;  3N1X C;  2EEL A;  4BKS D;  3L54 A;  1D5X C;  2FAZ A;  1HEZ E;  1N5W A;  1WFY A;  1KJT A;  1SJE D;  2MJD A;  3AEC B;  1GNU A;  3RZW C;  3R3M A;  3DBS A;  3LB8 C;  2NTS A;  1PFD A;  2RR9 A;  2WLB A;  4FAD A;  1F0Z A;  2BVC A;  4I6N B;  1GPX A;  1KLG D;  3SDL C;  4GGQ A;  2JWZ A;  2BF8 B;  2KVR A;  1OQY A;  1BUI C;  5TR5 A;  3A4S C;  4M01 A;  1ZUD 2;  2WXF A;  2GBK A;  2BYE A;  1GG3 A;  3FIL B;  2N9L A;  3GB1 A;  5D3I B;  3IAS 1;  4RGO S;  4US8 A;  1TKG A;  2KKC A;  3PSE B;  4GB9 A;  2PTL A;  1FFV A;  1E8W A;  1MJD A;  1AWD A;  3DQV A;  4JQW C;  2CJO A;  2MBB B;  2GI9 A;  4TQ0 A;  5EDS A;  1JWS D;  2KQS A;  2KHW B;  2D07 B;  2NCN A;  3AEG B;  4MAC A;  3KQ4 A;  1ZPS A;  2CKH B;  1Q5W B;  4KKJ A;  1L2N A;  1AAR A;  1WYG A;  3NHE B;  1D6E C;  2MJ3 A;  4K7W A;  5I4D A;  2KOX A;  3K9O B;  2KO3 A;  3HIZ A;  5IA7 A;  4ZRI A;  4MJS A;  2KLG A;  3M95 A;  1J0G A;  3QQ8 B;  3DWM A;  2AQ1 B;  1SSN A;  2WDT B;  4K1R B;  4NQL B;  4LDT D;  1WGD A;  1UGM A;  4A3P A;  4DXG A;  4A90 A;  4L1B A;  3DBR B;  4FXC A;  4GU2 A;  2KYW A;  1FXA A;  1HZ6 A;  1VJK A;  5TSS A;  3MJW A;  2IO3 B;  4IM2 A;  2KX0 A;  2NVU I;  3NG0 A;  3JW0 X;  4EEW A;  3H7S A;  3A9J B;  3HM6 X;  3ZIM A;  2WXP A;  3SR6 A;  1I4G A;  2JWU A;  2L00 B;  3B2F A;  3VR9 B;  4AWJ A;  2J0J A;  4N59 A;  4FBJ B;  2DYM A;  4IM3 A;  2KZR A;  4ANW A;  3ZDM C;  4PYZ A;  5D7G A;  2ZNV C;  4C7Y A;  2R2O A;  1EWY C;  2LHE A;  3PRE A;  2WU2 B;  3A9K B;  5LNK 1;  2IGD A;  1AYF A;  2D3B A;  4I6P A;  3AE8 B;  3H6N A;  1XXG A;  2NBU A;  2JZZ A;  5KHO A;  5BYS A;  5HI1 A;  1S1Q B;  3AE1 B;  2HDE A;  1RM6 C;  3U52 E;  1Z5S B;  3KUD B;  5BMG A;  1HA5 A;  1V1O A;  1L4Z B;  2UU7 A;  1V2Y A;  4G0N B;  1ISN A;  3ZXR A;  2RDB C;  2W3S A;  2YEP F;  2K1F A;  2XK5 B;  1OQQ A;  2DHZ A;  4WJO A;  5BO4 B;  4BOS C;  4RFB A;  3KUZ A;  1A5R A;  2VRR B;  1WJ4 A;  2I2Y A;  2KK8 A;  5HHD G;  3NJT A;  1TY0 A;  1TJE A;  2N7D A;  4US9 A;  3ZTD A;  2Z0D B;  2DZJ A;  2MLB A;  3W5U B;  3ZDT A;  1WH3 A;  2KC1 A;  1QOA A;  1WWT A;  1YN3 A;  2IND C;  2MSE D;  1FM0 D;  3TEW A;  1L0X B;  4NNJ B;  2IY1 B;  2BS2 B;  3I9V 1;  1YJJ A;  1S3S G;  3T8M A;  2AL6 A;  2LUM A;  4XC2 A;  5C23 A;  2BS3 B;  1VRA B;  2FUG 1;  3JSV B;  1E6E B;  3Q6B A;  5IO9 A;  1RLF A;  4ZYS A;  1QKZ A;  3RT3 B;  3VVW B;  3EA6 A;  4NAM A;  1DOI A;  3ZUN A;  5J18 A;  3AU4 A;  3AE3 B;  1I4Q A;  1L6U A;  2D3C A;  4DDG D;  1C4P A;  3Q69 A;  2LMC A;  1FNV A;  5HKH A;  1EM7 A;  3O65 B;  1KTK A;  4BBN C;  3UF8 A;  3AE2 B;  1WXM A;  1OQR A;  2J0M A;  1KOT A;  5G5H A;  4ARI A;  2L8J A;  4AQ7 A;  1BML C;  2G4S A;  1P98 A;  2M1M A;  2I38 A;  3AV8 A;  4J6I A;  2JX5 A;  4LNF A;  3BVM A;  1N5X A;  4WWM A;  4ICU A;  4K7U A;  1NBF C;  2NBV B;  1J7B A;  1K51 A;  2KAC A;  2KDF B;  1KLV A;  2V3P A;  3AEE B;  2UWQ A;  1PGX A;  1ZP0 B;  2HE7 A;  4LCD E;  3W1S C;  4LJO B;  4GDL B;  3DBR I;  3B9J A;  2MHJ A;  3P1M A;  1RFK A;  2PLP A;  1ZDV A;  4DQO C;  1FD6 A;  2BKR B;  3IVF A;  5GMV A;  2KT7 A;  2N9X A;  3ZJU A;  1WM3 A;  4ZHP A;  1YMH E;  1WX8 A;  3FC4 A;  1ROE A;  3B08 A;  4S0R A;  1C9F A;  3EC8 A;  1F1H A;  4II3 B;  1TZO A;  1NVI D;  3TSS A;  4NAW A;  1ESF A;  2QDF A;  3QK0 A;  2OOB B;  4NPN A;  1SF0 A;  3P4P B;  1SE9 A;  3GS2 A;  1TKY A;  4KGT A;  2JVC A;  1GJZ A;  5JZE B;  2LRW A;  5AEK B;  1IGC A;  4IKG A;  4WUR A;  2EMT A;  2M0X A;  2WXG A;  1OFF A;  4FN2 A;  5E6P A;  1GAQ B;  3JYU A;  2PPH A;  4P1C C;  1GC7 A;  3N1Z C;  4WJQ A;  1YIW A;  2Z59 B;  1D4B A;  4W9H A;  3PLU A;  2J42 A;  3UIP B;  4G50 A;  3PRP B;  2FCN A;  3V62 A;  2INP E;  4TV3 A;  4IUM B;  1MFW A;  4MM3 A;  3NS1 A;  2INN E;  4B0E A;  2G3Q B;  3Q3M C;  3LDZ E;  2ZPN A;  3QIJ A;  3NRZ A;  5EE9 A;  2OHF A;  3KLS X;  4GDL A;  1VD2 A;  3TEY A;  2N0S B;  3QCA A;  2V4L A;  4FLH A;  4RGM A;  3VH3 B;  4E74 A;  4BFR A;  4K81 A;  4MGK E;  4HDO A;  2KFK A;  2GBJ A;  2PVO D;  1GB4 A;  1WF9 A;  1XLP A;  2B3A A;  4P1B C;  2WWZ A;  3ETR A;  2KWV B;  2GBR A;  4EOY A;  3PO0 A;  1VZ6 A;  1P3Q U;  1XCT L;  4LNI A;  3GE3 C;  5H92 C;  1YOV B;  1IPG A;  3KW5 B;  1YQB A;  2BWE S;  3DHG C;  2LGS A;  1GOZ A;  3C19 A;  3CIR B;  1HTO A;  3EFC A;  2WXO A;  3M63 B;  2LRU A;  4AUQ C;  2IPK D;  2WXJ A;  3DHI C;  5AZH A;  1P0R A;  3H8H A;  4P7I A;  4B9K A;  1R4M I;  3ML9 A;  3AI5 A;  3DBL I;  2BTE A;  3L4P A;  2WDQ B;  2BB6 A;  1TS3 A;  4HWI B;  3FKY A;  4WH4 A;  4JE3 B;  5BYQ A;  4HJG E;  4NJ7 A;  5FK9 C;  2WU5 B;  2H89 B;  1R7S A;  2LI5 A;  3X0W A;  2KDM A;  2BWF A;  4PS8 A;  1TGZ B;  2K0P A;  2KTF A;  4HXD A;  2QSD A;  1WI0 A;  2LGY A;  3MC8 A;  3BWU D;  1PYW D;  3QA8 A;  1WSP A;  1NI3 A;  4MEL A;  4MDK E;  1KM7 A;  4HKZ E;  3PHW B;  1JW9 D;  3ZJV A;  3OLM D;  1J7C A;  2AL3 A;  4RF1 A;  2O2V B;  4AJW A;  3ECI A;  2IBI B;  1NYR A;  2LFI A;  3PZD A;  3TJP A;  3BII D;  2BYF A;  1E8Z A;  3N20 C;  3UIO B;  3ZJT A;  1E90 A;  2JPH A;  3TEZ A;  3VDZ A;  2WXN A;  3APC A;  2N9E B;  1DOY A;  1ZW7 A;  3PZ7 A;  3SU8 X;  2FE8 A;  1TS4 A;  2IGH A;  4MSM B;  1N6Z A;  4YXD B;  1EWC A;  2BT6 A;  4M0W B;  2BYV E;  1WM2 A;  1YNT E;  1WX9 A;  3FAH A;  4YL8 A;  2JXX A;  1IBX B;  3RMK C;  1WYW B;  2LGX A;  2OED A;  3MTN B;  3N30 A;  3L08 A;  2KJ6 A;  1Q1O A;  1K53 A;  3RD2 A;  5DCN A;  3PS6 A;  2LZ6 A;  2E6X A;  4IW0 A;  1N62 A;  5JHA A;  1M4V A;  4MGZ E;  4BBN F;  1WGH A;  2K6Q A;  5HFY A;  4ASW C;  2JF5 A;  2JYE A;  4A9A A;  5JXV A;  3WCQ A;  1SB3 C;  3HVZ A;  2BW2 A;  1D3Z A;  5D2M B;  4LNK A;  2MX2 A;  3NVZ A;  1PGA A;  3ZO5 B;  5IAA C;  2C9W B;  2MBE A;  3IT6 B;  1FRD A;  2DYO A;  2BB5 A;  3DPD A;  3BYT B;  4OVU A;  2RGF A;  2BPS A;  4JGH B;  3B0A A;  4AP4 C;  3DVN U;  1JWM D;  3KYD D;  3SFD B;  4ARC A;  1WR6 E;  2N7E A;  1CK1 A;  2KMC A;  2Y3A A;  1WE6 A;  1UD7 A;  2KDE B;  1QOG A;  3RCZ A;  4RH6 A;  4OZA A;  3VTV A;  3K9P B;  1IP9 A;  3ZGZ A;  2VH2 A;  3GE8 C;  3EEC A;  4DK5 A;  3RI7 C;  4KV2 A;  3MC0 B;  2XK5 A;  4M00 A;  1JWA D;  1TTN A;  1WXS A;  2IYD B;  5T8I A;  1EF1 A;  3RNC C;  4YSZ B;  2CU1 A;  5E6O A;  2MBQ A;  3Q8C A;  2INC C;  4KSL C;  3NY5 A;  4L23 A;  1VR9 A;  3QWZ B;  3VAW A;  1SE2 A;  1T3Q A;  2KNB A;  1I35 A;  2DAF A;  3NVY A;  4MT5 A;  3AE5 B;  3GZN B;  4DHZ E;  2MQJ A;  2L7R A;  2KTR B;  1PQS A;  4W9G A;  2XN9 C;  3UGB B;  2D11 A;  3BZD B;  4KZC A;  3T3N A;  4C4V B;  1WJU A;  3V05 A;  3ZQ4 A;  2LUE A;  4S17 A;  4N6E B;  4GIV A;  4HKQ A;  3ZXV A;  4B95 A;  4OW0 A;  2KAJ A;  5D3D A;  3A1Q B;  2V0G A;  3M3J A;  2JU6 X;  3H7P B;  2LXA A;  3E9S A;  1EF5 A;  2WHI A;  3H9D A;  2L05 A;  4AS1 A;  4GMV A;  4W9L A;  3CMM B;  1DOX A;  3AE4 B;  2J52 A;  3L17 A;  2SEB D;  5JH5 C;  1I7H A;  3KUC B;  4R3D A;  1GC6 A;  5DPT A;  2L83 A;  3ONS A;  3SD5 A;  1MVK A;  2PVG C;  4M8N A;  1TIF A;  3TMP B;  1NYQ A;  2DLB A;  3TBL D;  4W9K A;  3PLV A;  3V60 A;  2JXT A;  2N9K A;  3IFW B;  4LNO A;  3RUL A;  1WXV A;  2W9N A;  4NY0 A;  4O1N A;  1QQR A;  5AZG A;  1P7F A;  4URK A;  2L52 A;  2WQY B;  5MPO A;  2G4D B;  3DVN V;  2VH1 A;  4LLG M;  3APF A;  4C4V A;  1LXD A;  3C0R B;  4FA6 A;  1WXA A;  2JT4 B;  2LGD A;  1WX7 A;  1SGH A;  1YN4 A;  2BGF A;  1JML A;  4PS7 A; 
#chains in the Genus database with same CATH homology
 4J6I A;  2HD5 B;  3N32 A;  2DEN B;  4K7S A;  3ZNH B;  4AOF A;  1E7U A;  3H7P A;  1WIA A;  1WJN A;  2DZK A;  2D2Q A;  5C1Z A;  4ICU A;  2LJ5 A;  4BKG A;  4K7U A;  1NBF C;  2NBV B;  1EUV B;  2RSU A;  4DHJ D;  2KDF B;  4CO7 A;  2EKE C;  4HCP B;  1KLV A;  2A5U A;  2UWQ A;  3QX1 A;  2D3G A;  1YJ1 A;  4ICV A;  2C7H A;  3AU5 A;  2HE7 A;  2O6V D;  3PRM B;  4LCD E;  3W1S C;  3KVF B;  4KDL B;  1MG8 A;  2M4N A;  4LJO B;  3WAL A;  1V80 A;  4GDL B;  3DBR I;  2ZVN A;  2LD9 A;  3WAN A;  2V1Y A;  3LJ3 A;  3TL5 A;  4N9F 4;  4EFO A;  4JL9 A;  4EZJ A;  4KSK C;  3UQA A;  1E5W A;  3BIN A;  2BKR B;  3IVF A;  2DAJ A;  5GMV A;  2N9X A;  2JUO A;  1V6E A;  3JVZ X;  1WM3 A;  4JLC A;  3CSF A;  4HCN B;  2K39 A;  1WX8 A;  5DPR A;  2K25 A;  3B08 A;  3P2B A;  4MGI E;  3EC8 A;  4IWQ A;  3H1U A;  2AEH A;  1HE8 A;  1WY8 A;  2JY6 A;  4II3 B;  3HHM A;  3I3T B;  5KHQ A;  3KH0 A;  4GXB A;  2Z0E B;  2KFK B;  4NAW A;  2MCN B;  4ANX A;  2JRI B;  3QK0 A;  4WWO A;  5J17 A;  3ZKJ C;  3DBH I;  3L13 A;  2OOB B;  4F1S A;  3PT2 B;  4NPN A;  3A33 B;  4BOZ B;  4XX5 A;  1SE9 A;  3R7R A;  2AWT A;  3QC8 B;  3L10 B;  2JVC A;  1GJZ A;  4ZRJ A;  5JZE B;  5CHW A;  2LRW A;  3ZVV A;  5AEK B;  4II2 B;  1V5O A;  5CHF A;  1UBQ A;  2EMT A;  2M0X A;  3OJ4 B;  4ZYN A;  4FN2 A;  5E6P A;  3ZNZ B;  1J19 A;  3JYU A;  2PPH A;  5DPW A;  1GC7 A;  4GOC A;  1XQQ A;  4WJQ A;  1YIW A;  2Z59 B;  3AXC A;  5L95 C;  3B1L X;  4X57 B;  4W9J A;  2KMA A;  3A4R A;  4KZ0 A;  4W9H A;  2CHZ A;  2J7Q B;  3PLU A;  4AJY B;  1UH6 A;  2NR2 A;  3UIP B;  4G50 A;  2DYB A;  2ZCC A;  3U30 A;  3PRP B;  4HLE A;  2WX1 A;  2FCN A;  1Y8R C;  3V62 A;  2FID A;  4TV3 A;  4IUM B;  4MM3 A;  4CHK A;  1U4A A;  2HTH A;  5LXI B;  4HPL B;  2G3Q B;  2KFJ A;  1WJ6 A;  3M62 B;  4FJZ A;  3LDZ E;  4HPM B;  4FHK A;  2G45 B;  2LWP A;  2ZPN A;  1WGY A;  3QIJ A;  4KIK B;  3VUW A;  2L3Z A;  3VUY A;  4PYU A;  5CTR C;  2NBW B;  5AZF A;  4GDL A;  4DXA B;  1VD2 A;  3VTU A;  1G6J A;  4OVV A;  3QCA A;  3PGE A;  3QAR A;  2IO1 B;  2KWC A;  2R2Q A;  2V4L A;  3DDC B;  2MA9 B;  3IBE A;  3QAQ A;  4FLH A;  3VH3 B;  4E74 A;  2KX3 A;  1TBE A;  4BFR A;  4K81 A;  4MGK E;  3RUI B;  3ZRF A;  3ZRC A;  3HK0 A;  2ZVO A;  3PHX B;  1LQB A;  4WQO B;  4HDO A;  1K8R B;  2KFK A;  1P1A A;  2GBJ A;  2RD0 A;  1WF9 A;  4GDK A;  2LAS A;  4FJV B;  2B3A A;  2CS4 A;  4KIK A;  2HJ8 A;  2RPQ A;  2WWZ A;  1ZKH A;  3VUX A;  1V86 A;  1WR1 A;  2O6V A;  2MP2 A;  3IG3 A;  4RM9 A;  2KWV B;  2GBR A;  2C7N B;  3NS8 A;  4EOY A;  1RRB A;  4MGY E;  2GBM A;  3PRZ A;  4EZK A;  1P3Q U;  2FCS A;  2ZZP B;  2GBN A;  2KWU B;  2ZEQ A;  4F8C B;  2L0F A;  2L76 A;  4W9D A;  3APD A;  2MBO A;  4MEM A;  5G55 A;  1IPG A;  2J0K A;  1YQB A;  3AUL A;  2BWE S;  3KW5 B;  4W9I A;  5D94 A;  2V3S A;  4FHJ A;  2IO2 B;  4GSW A;  2A4Z A;  3JSV A;  4BKS D;  3L54 A;  2ZJD A;  3M63 B;  4GN1 A;  2FAZ A;  2LRU A;  3OAW A;  4AUQ C;  1WFY A;  1KJT A;  3X23 A;  5AZH A;  4ANU A;  1P0R A;  1GNU A;  2KDI A;  1LFD A;  1F9J A;  3ZTC A;  3RZW C;  1H4R A;  3R3M A;  4P7I A;  4B9K A;  3VQI A;  1R4M I;  3L16 A;  3ML9 A;  3AI5 A;  3DBS A;  3DBL I;  3PVL A;  4IWP A;  4W9E A;  3V6E B;  1H8C A;  2RR9 A;  4FAD A;  1WE7 A;  4HWI B;  4I6N B;  1YX6 B;  2N9P C;  4MSQ B;  3SDL C;  3ZNI D;  4GGQ A;  5LLI A;  2JWZ A;  2BF8 B;  2CHX A;  4NJ7 A;  2KVR A;  1OQY A;  1XD3 B;  3U7D A;  5TR5 A;  2OJR A;  3A4S C;  1R4N I;  2D10 A;  2LI5 A;  4EUT A;  4G3X B;  3X0W A;  2GBK A;  2MWS B;  2BWF A;  2BYE A;  1GG3 A;  1TGZ B;  3R66 C;  4PS8 A;  4PS3 A;  2KTF A;  5DPS A;  4HXD A;  1WI0 A;  1NI2 A;  2LGY A;  4TUU A;  3TCA A;  4TQ1 A;  3QA8 A;  4IM0 A;  4MEL A;  4G11 A;  4JIO U;  2KKC A;  4MDK E;  3PSE B;  1KM7 A;  4GB9 A;  2IO0 B;  1E8W A;  3PHW B;  3OLM D;  1V49 A;  2AL3 A;  3DQV A;  4JQW C;  4BVU C;  2MBB B;  2O2V B;  4XZ4 A;  4AJW A;  4TQ0 A;  1ZGU B;  3ECI A;  5EDS A;  2KQS A;  2KHW B;  4E3C A;  2ZPY A;  2D07 B;  2IBI B;  2NCN A;  4RMA A;  3WIM A;  3PZD A;  4HJK A;  4EKU A;  2CKH B;  3BY4 B;  1Q5W B;  1OGW A;  3GZN I;  3VTW A;  1E8X A;  1AAR A;  3NHE B;  1L2N A;  1Z2M A;  4IWO A;  3TJP A;  2BYF A;  4B6W A;  2PEA A;  1E8Z A;  3WAO A;  3UIO B;  1E90 A;  2JPH A;  4K7W A;  3PV1 A;  3VXW A;  2KOX A;  3K9O B;  2KO3 A;  3VDZ A;  4DBG A;  1TZ1 A;  2C5L C;  2K8C A;  3APC A;  3CF6 E;  3HIZ A;  4ZRI A;  2N9E B;  2NPT B;  4MJS A;  5IA7 A;  4WAA A;  2M17 A;  1ZW7 A;  3SU8 X;  1GUA B;  2KLG A;  4MSM B;  2K6D B;  3M95 A;  2FNJ B;  3GOE A;  1FXT B;  1J0G A;  2ZCB A;  3QQ8 B;  3V6C B;  3EFU A;  4M0W B;  2BYV E;  3ALB A;  3UIN B;  1WM2 A;  2EMS A;  1WX9 A;  2WDT B;  4YL8 A;  2JXX A;  3N3K B;  3S2A A;  2CR5 A;  2K8H A;  3HM3 A;  5JHB A;  4K1R B;  2M8S A;  1Q0W B;  4NQL B;  4LDT D;  1WGD A;  1UGM A;  4A3P A;  4DDI D;  1WYW B;  2LGX A;  3MTN B;  1V5T A;  3DCG A;  3N30 A;  4DWF A;  2KJH B;  3RYT A;  4GU2 A;  3L08 A;  2KJ6 A;  1Q1O A;  1OEY A;  3RD2 A;  5DCN A;  3PS6 A;  3Q3F A;  2LVP A;  2LZ6 A;  4IW0 A;  1WRD B;  3MJW A;  2IO3 B;  5JHA A;  5LXH A;  3IHP C;  4IM2 A;  2KX0 A;  2NVU I;  3JW0 X;  2I1J A;  4EEW A;  3H7S A;  2DZM A;  2I1K A;  2WYQ A;  4MGZ E;  4ANV A;  3A9J B;  3HM6 X;  4BBN F;  3ZIM A;  4M8M A;  1E8Y A;  1WGH A;  1V9J A;  2IY0 B;  2PE6 B;  5CX3 A;  3R7Q A;  1NDD A;  1C1Y B;  2K6Q A;  2KC2 A;  4I6L B;  2KLC A;  2GOW A;  2L00 B;  1WMH B;  2AYO B;  4FJY A;  4ASW C;  4BKT A;  4IC7 B;  2JF5 A;  4AWJ A;  2C60 A;  3OJ3 A;  2J0J A;  4DHJ B;  3ZNG C;  1D3Z A;  5D2M B;  4IG7 B;  4LDT B;  3NZS A;  4FBJ B;  2DYM A;  1CMX B;  1VCB A;  2MX2 A;  2L0T A;  3ZO5 B;  4IM3 A;  2KZR A;  4ANW A;  5IAA C;  3ZDM C;  4HK2 A;  4PYZ A;  1I42 A;  2C9W B;  3NZU A;  2MBE A;  4NAW B;  1V81 A;  4A20 A;  5D7G A;  3RZF A;  2DYO A;  2ZNV C;  3DPD A;  1WMH A;  2R2O A;  4OVU A;  2RGF A;  1YD8 U;  2BPS A;  4JGH B;  1C3T A;  4RM8 A;  1XT9 B;  1UEL A;  1LM8 B;  3B0A A;  4AP4 C;  3DVN U;  3PRE A;  2N1V A;  3A9K B;  2N1W A;  4NQK E;  3KYD D;  4I6P A;  3A9K A;  3H6N A;  1WR6 E;  2NBU A;  2CHW A;  2JZZ A;  2JZ3 B;  2N7E A;  2Y5B B;  4FUL A;  5KHO A;  4BKS A;  2KMC A;  1P9D U;  3A1Q A;  2KJR A;  1WE6 A;  1UD7 A;  2KDE B;  1S1Q B;  2XEW A;  2LVQ A;  1BT0 A;  3RCZ A;  1M94 A;  1Z5S B;  1EO6 A;  3KUD B;  3VTV A;  3K9P B;  4A3O A;  1IP9 A;  4GDK B;  3EEC A;  1QZE A;  4DK5 A;  2ZNV B;  3W1S A;  4KV2 A;  1V2Y A;  1YX5 B;  4G0N B;  2XK5 A;  5J2R A;  1ISN A;  4WJP A;  2PJH A;  2K1F A;  3DOW A;  4HDQ A;  1TTN A;  2XK5 B;  4TKN A;  1WXS A;  3CST A;  2IYD B;  2DHZ A;  2KAN A;  1EF1 A;  2PE9 A;  2UYZ B;  2XBB C;  3PTF C;  4WJO A;  2KQ7 A;  2CU1 A;  5BO4 B;  4BOS C;  5E6O A;  3KUZ A;  2MBQ A;  1A5R A;  2VRR B;  1OTR B;  3D32 A;  3VFK A;  1WJ4 A;  4KSL C;  4KDI C;  2KK8 A;  4E71 A;  3KYC D;  3NY5 A;  2QHO A;  2MW5 A;  3QWZ B;  2MBH A;  3VAW A;  1OEY J;  3ZTD A;  2N7D A;  2Z0D B;  3VHT C;  2KNB A;  2DZJ A;  1I35 A;  2DAF A;  2ASQ A;  5E6N A;  2YLM A;  2MLB A;  3U8Z A;  4DHZ E;  5D6J B;  3ZDT A;  1WH3 A;  2MQJ A;  2KC1 A;  2L7R A;  2FCQ A;  2KTR B;  1PQS A;  2KDB A;  3WAP A;  4W9G A;  3ZLZ A;  3ML8 A;  3UGB B;  2D11 A;  2N4F A;  4KZC A;  2MSE D;  2DX5 B;  1WJU A;  3TIX A;  5L83 A;  2LUE A;  2KD0 A;  4NNJ B;  2IY1 B;  4W9C A;  4GIV A;  2K8B A;  4B95 A;  1S3S G;  3T8M A;  4WWN A;  3A1Q B;  3NOB A;  2AL6 A;  3M3J A;  4HVB A;  3H7P B;  4XC2 A;  5C23 A;  2LXA A;  3UQB A;  1EF5 A;  4LJP B;  3JSV B;  1E7V A;  1JRU A;  1RLF A;  3H9D A;  4WJN A;  4MJS B;  4ZDV A;  2L05 A;  3QJZ A;  4GMV A;  4W9L A;  3CMM B;  5CHV C;  2KTR A;  3RT3 B;  2MRP A;  3VVW B;  3L17 A;  5JH5 C;  3KUC B;  1UZX B;  3ENE A;  1GC6 A;  5DPT A;  3WAM A;  3ONS A;  2WX0 A;  3ZUN A;  2O6V B;  2FCM A;  3SD5 A;  3A9J A;  1IYF A;  5J18 A;  3AU4 A;  4M8N A;  2C7M B;  2LXC A;  4WWP A;  3V61 A;  1J8C A;  4ZRK A;  4EZL A;  3TMP B;  2MP2 B;  3ZW3 A;  3L0W B;  1WGR A;  2YVC A;  4DDG D;  4NJ6 A;  3TBL D;  4W9K A;  3SHQ A;  3PLV A;  2FIF A;  3VH4 B;  3V60 A;  4CYE A;  5HKH A;  3IFW B;  1RFA A;  1RAX A;  3EHV A;  3RUL A;  1WXV A;  2W9N A;  3O65 B;  4NY0 A;  2IZV B;  2DZI A;  2O2V A;  4BBN C;  3UF8 A;  1WXM A;  3WA0 A;  1WZ0 A;  3MHS D;  2NS5 A;  5G2N A;  1X1M A;  2FUH B;  3DVG Y;  2J0M A;  2JRH A;  5AZG A;  1WZ3 A;  4URK A;  1KOT A;  4DHZ B;  2G4D B;  3QHT A;  3DVN V;  1SIF A;  1T0Y A;  3APF A;  3PPA A;  1LXD A;  1UBI A;  2KN5 A;  2L8J A;  3C0R B;  4F7Z A;  2NPT A;  1WGG A;  1WXA A;  2JT4 B;  4FA6 A;  2LGD A;  2G4S A;  1WX7 A;  4KVG B;  1P98 A;  3Q3J A;  1L7Y A;  3T9L A;  3W1Y A;  1SGH A;  4MH0 E;  2M1M A;  5FR6 A;  2LVO A;  2KXJ A;  3DVG X;  2BGF A;  2GMI C;  2REX A;  4W9F A;  2BKF A;  4PS7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...