1TGZB

Structure of human senp2 in complex with sumo-1
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
78
structure length
78
Chain Sequence
EYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle, hydrolase
molecule keywords Sentrin-specific protease 2
publication title A basis for SUMO protease specificity provided by analysis of human Senp2 and a Senp2-SUMO complex
pubmed doi rcsb
source organism Homo sapiens
total genus 15
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2004-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1tgzB00
2O6VB 3VH4B 5CHVC 2KMCA 4A20A 1WH3A 1WF9A 5G55A 4GN1A 3X0WA 4IW0A 1E7VA 2KMAA 1YJ1A 3K9PB 4II3B 1XT9B 2PE9A 2L05A 5CHFA 5J2RA 4FHJA 3VDZA 3ZDMC 2OOBB 4DDID 4BOZB 3N3KB 2MP2A 4MSQB 3ZLZA 3L13A 4PYZA 2K1FA 4FULA 4F7ZA 2K25A 2KVRA 4XC2A 2DZMA 1V9JA 1NBFC 3B1LX 4M0WB 1YQBA 1J19A 1WI0A 4HDQA 5AZHA 1UD7A 3UIOB 4EKUA 2MP2B 2Z59B 3A33B 3NY5A 1WMHA 2L76A 3ZKJC 4ZDVA 2XK5B 2K8BA 2MRPA 1P1AA 2LVPA 2FCNA 4GIVA 4RMAA 3W1SA 2KLCA 3WAPA 5HKHA 3L08A 4I6LB 5D7GA 4EOYA 1WE6A 1WR1A 4P7IA 4WJNA 1Q0WB 2CKHB 5DPTA 2G4SA 3ZO5B 3KW5B 3QA8A 1WM3A 2NS5A 5JZEB 1E8WA 4CHKA 3O65B 3KUDB 1A5RA 1EF5A 1S3SG 2KX0A 3PS6A 4IM2A 4NAWB 4BKSD 4ANVA 2VRRB 4GGQA 3UQAA 3ZUNA 3DBSA 4BFRA 2KKCA 2R2QA 2RD0A 4YL8A 3EFUA 3KVFB 1LQBA 3PTFC 3JSVB 1EUVB 1WY8A 1XQQA 2KDBA 3SD5A 4BOSC 3RT3B 3NZUA 3UQBA 2YVCA 3GZNI 1H8CA 2BKRB 3W1YA 1V80A 2MW5A 4B6WA 1J0GA 2LXCA 4FBJB 2KJRA 2KTRB 4JL9A 4PS7A 4AOFA 1S1QB 2FIDA 2IZVB 2ZVNA 4HDOA 1E5WA 2N1VA 4G11A 2DYBA 4OVVA 3A9JA 4GMVA 1MG8A 1G6JA 3QWZB 1UBQA 2V1YA 2GBNA 3QAQA 3MJWA 3PT2B 4HWIB 4BVUC 2WX0A 1R4MI 4FADA 3PSEB 4HCPB 4K1RB 4G50A 4JIOU 3QJZA 2PJHA 4GOCA 4ANWA 2M4NA 4DHZB 1TBEA 2N4FA 3QARA 1AARA 2FCSA 2KFJA 2MBQA 2Z0EB 3M95A 4MGYE 1PQSA 2BF8B 2I1JA 4EZJA 4GDLB 1OQYA 1WGDA 2ZNVC 2L0FA 1WXAA 2WWZA 3W1SC 1LXDA 4W9EA 1WGHA 4X57B 4HCNB 3V61A 2IBIB 2MBHA 3AULA 3JYUA 1V6EA 3K9OB 3RULA 4TQ1A 3RZFA 3V62A 4FA6A 5DPRA 2W9NA 3BY4B 3VFKA 1YX6B 3IBEA 1WM2A 2KWVB 3TL5A 4TKNA 4FJYA 2DX5B 4AJWA 2M17A 3PRMB 1VCBA 3WAMA 4KDIC 3VUWA 2LGDA 2D11A 2LJ5A 1Z2MA 3ECIA 4DDGD 5AEKB 2NR2A 5KHQA 3DBRI 3PHWB 1WZ0A 2UYZB 4M8NA 4AJYB 2KJ6A 4KIKB 1YIWA 1L2NA 3L10B 4DK5A 1E8XA 3QCAA 2D3GA 4LJPB 4FJZA 2C9WB 5J17A 5KHOA 1V49A 4KZ0A 3HK0A 4MELA 1E7UA 4HXDA 1WJNA 4LDTD 1C3TA 1RLFA 2EMSA 2L7RA 3Q3FA 4W9JA 3NHEB 1UH6A 3RYTA 1JRUA 4JGHB 5E6OA 1WYWB 3DBHI 1F9JA 4WJPA 1X1MA 1GC7A 2LRWA 5FR6A 2O6VA 2JVCA 1SIFA 2JY6A 2I1KA 2NVUI 3PRZA 2G4DB 2C60A 5E6PA 1K8RB 1EO6A 3PRPB 2A4ZA 3ZNZB 3U7DA 2RPQA 3RD2A 4IM3A 2KFKB 1Q5WB 2DZIA 5CTRC 2REXA 3WALA 2J0KA 3VXWA 4DHJD 1WXVA 2K8HA 2IO2B 3ALBA 2EMTA 4WJQA 2ZJDA 3CSTA 4IWOA 5LXHA 2V3SA 1RFAA 2JRIB 4W9LA 3VTUA 2ZCBA 2CHWA 2JRHA 3CSFA 2NBUA 2XK5A 3A1QB 3VH3B 3UF8A 1WE7A 2HD5B 2LUEA 2M0XA 2D07B 2FAZA 4DWFA 4EUTA 4DBGA 4NPNA 4BKGA 2ZEQA 4JLCA 4KZCA 1WXSA 4K7UA 1GG3A 5BO4B 4F1SA 1P0RA 2KTFA 5D6JB 2NBWB 4G0NB 4NAWA 2KNBA 3Q3JA 4HPMB 1RRBA 2BWES 3QC8B 4K7WA 1WR6E 3R3MA 2JZZA 2KK8A 2PPHA 4TV3A 3SDLC 3B08A 2JT4B 3JSVA 3QX1A 1HE8A 3D32A 3UIPB 2BYVE 5G2NA 2N7DA 2DAJA 3DPDA 4FLHA 4I6PA 1C1YB 3DVGY 2JUOA 4W9GA 1U4AA 2LWPA 1P3QU 2KX3A 1H4RA 1TTNA 2IO0B 3OLMD 2L8JA 3RZWC 2KTRA 3H7PA 4EEWA 2LASA 4NJ6A 4NJ7A 2GBMA 2CHXA 1EF1A 3EC8A 4W9CA 5AZFA 3HM3A 1LM8B 1GNUA 5L83A 3ENEA 4GSWA 4J6IA 2BPSA 3A9KB 4BBNF 2GBKA 3H7PB 3AXCA 1M94A 2KDFB 4AWJA 4W9IA 1V2YA 5TR5A 3H1UA 4B95A 2MQJA 4A3PA 1WX8A 2LZ6A 1V5OA 4URKA 3PPAA 3TBLD 2BYEA 3VTWA 4ZRJA 3ZRFA 2N7EA 4GDLA 3SU8X 1R4NI 3HM6X 1UZXB 1GC6A 2FIFA 2QHOA 1NDDA 2FNJB 3VTVA 5D94A 5JHBA 5LXIB 2LGYA 2G45B 2KC1A 1SE9A 2D2QA 2KQSA 3N32A 3TCAA 2KWUB 2KLGA 4EZKA 2KHWB 4HJKA 4II2B 2J7QB 4XX5A 4W9FA 3ZTDA 3OJ3A 3R7QA 3TMPB 3V6CB 4TUUA 3L17A 3ZNID 2V4LA 4KIKA 2N9XA 3ZTCA 3GOEA 1T0YA 2MCNB 3PVLA 3ML9A 1Q1OA 2Z0DB 3M3JA 2MBBB 4DHZE 1WX9A 3PV1A 1RAXA 3KUZA 5IA7A 2AWTA 3ZIMA 5LLIA 3QIJA 2HE7A 1OEYA 2FCQA 1L7YA 5CX3A 1GUAB 2IO1B 3U30A 3QK0A 4TQ0A 2XBBC 3PGEA 2DAFA 3WA0A 3ZNHB 3AU4A 1LFDA 3DVNU 1ISNA 2J0JA 4GB9A 4ASWC 4LDTB 3C0RB 2KJHB 4KV2A 4MM3A 4IM0A 3PLVA 5C1ZA 1V81A 3I3TB 3X23A 2NCNA 4CYEA 2KFKA 2Y5BB 2KO3A 4IC7B 1I42A 2L3ZA 1OTRB 1WGYA 3DDCB 2DENB 4HK2A 1E8ZA 1Z5SB 4GDKB 4ZYNA 5IAAC 3LJ3A 4PS3A 3DOWA 3ZVVA 2PE6B 5J18A 4RM9A 4FJVB 2MBEA 4NQKE 4IWQA 3RUIB 3UINB 1QZEA 2JF5A 4ZRKA 3T9LA 2C7NB 2KWCA 2JZ3B 4F8CB 1WXMA 2DHZA 2IY0B 2UWQA 3A1QA 2KDIA 3BINA 2AEHA 1WGGA 4DHJB 2LXAA 2FUHB 2LD9A 2LI5A 2MA9B 2O2VB 3H7SA 2K39A 3UGBB 1E8YA 2CHZA 2A5UA 2PEAA 3LDZE 3ONSA 4KVGB 2WYQA 4PS8A 3VVWB 2RGFA 2XEWA 1I35A 2N9EB 2JXXA 3ZRCA 3P2BA 5E6NA 4ZRIA 3EHVA 3VUXA 2B3AA 2O6VD 1ZW7A 2MLBA 1TGZB 3ZW3A 3APFA 2J0MA 4WAAA 4FHKA 3SHQA 2K6QA 1TZ1A 2BGFA 2NBVB 2ZPYA 1YD8U 2ZZPB 2CS4A 4MJSA 5D2MB 3V60A 4BKSA 2LRUA 2M1MA 2KZRA 3JVZX 1KOTA 2GBJA 2KXJA 4G3XB 3R7RA 4MH0E 2WDTB 1NI2A 4DXAB 3ML8A 2C7HA 3NZSA 4I6NB 1WGRA 4KSKC 4W9DA 4MJSB 3KUCB 2AL6A 2BWFA 2MWSB 3PLUA 4NY0A 1WZ3A 4MGKE 1GJZA 2G3QB 5DPWA 3IFWB 2R2OA 4W9HA 2KQ7A 1FXTB 3A9KA 4ICUA 2RR9A 2OJRA 3WIMA 3VUYA 4JQWC 1P9DU 1WX7A 2ZVOA 1V5TA 2K8CA 2LVQA 2MSED 4MSMB 2IO3B 5L95C 3EECA 4ANXA 4E74A 1V86A 1WMHB 3IHPC 4PYUA 2KANA 4BKTA 3A4RA 2ZNVB 3APCA 3CMMB 2BKFA 3B0AA 1KM7A 4FN2A 1SGHA 3H6NA 1BT0A 3L16A 2DYOA 4MGZE 1IP9A 4OVUA 3ZDTA 4HLEA 1J8CA 5GMVA 4WJOA 4A3OA 1KJTA 4M8MA 4KDLB 1OEYJ 2M8SA 3M63B 2L0TA 2KC2A 3TIXA 3OAWA 1KLVA 1P98A 4GXBA 3OJ4B 4WWOA 4AP4C 3ZNGC 1Y8RC 2YLMA 4EFOA 3L0WB 2JPHA 2GOWA 2FCMA 2GMIC 4E71A 5DCNA 4LCDE 3H9DA 5DPSA 2DYMA 1XD3B 3KYCD 2KDEB 3N30A 1WJ4A 4NQLB 1OGWA 3KH0A 3VHTC 3IVFA 2LGXA 3DVGX 3HIZA 2K6DB 4AUQC 3AI5A 3PHXB 4NNJB 3IG3A 4IWPA 2HTHA 1D3ZA 3A9JB 3PREA 3L54A 2BYFA 4HPLB 4KSLC 2IYDB 4LJOB 1UELA 1ZKHA 1WJ6A 1ZGUB 2DZKA 3APDA 2LVOA 3MHSD 4WQOB 5JHAA 2CU1A 3WAOA 4N9F4 2DZJA 4MGIE 2CR5A 3AU5A 5CHWA 4XZ4A 5JH5C 3R66C 5C23A 1UGMA 3VQIA 3VAWA 4GDKA 1YX5B 3PZDA 1UBIA 2C7MB 2NPTA 4B9KA 2EKEC 3QQ8B 3MTNB 4IG7B 4CO7A 3WANA 1E90A 2WX1A 3RCZA 4HVBA 2NPTB 5EDSA 1IPGA 2L00B 2O2VA 3KYDD 3M62B 2IY1B 4IUMB 2MX2A 3QHTA 3S2AA 1WIAA 4ICVA 4MEMA 4W9KA 2AL3A 3JW0X 5AZGA 4K81A 2N9PC 3V6EB 2KN5A 4E3CA 2HJ8A 3NS8A 3U8ZA 2C5LC 3A4SC 2N1WA 1WJUA 3CF6E 4GU2A 3NOBA 2AYOB 4WWNA 4ANUA 3TJPA 3DVNV 1WRDB 2GBRA 2MBOA 1CMXB 2ZCCA 4BBNC 1IYFA 2JWZA 2ASQA 3DBLI 1WFYA 4MDKE 3T8MA 2D10A 2KD0A 4RM8A 4EZLA 4WWPA 1VD2A 2KOXA 3DCGA 4K7SA 3HHMA 2RSUA 2ZPNA 3DQVA
chains in the Genus database with same CATH superfamily
3CWIA 4A20A 4OZCA 3R8BA 2Y5PA 1WF9A 4GN1A 2KMAA 3Q3OC 3K9PB 3ZDMC 1SF0A 2MP2A 4MSQB 3ZLZA 3IT4B 4F7ZA 4P1CC 1FCCC 1F77A 1F2RI 4JWUC 5AZHA 3A33B 1MJDA 2L76A 1B9RA 3ETRA 3TUOA 1P1AA 4GIVA 3W1SA 4I6LB 5D7GA 1WE6A 1WR1A 5DPTA 3ZO5B 3KW5B 5JZEB 3KLSX 4HJGE 4US9A 2XNAC 1DGJA 1N5XA 1FPYA 1TS5A 3OG5A 3ZUNA 1BXTA 2QIEB 5EE3A 2R2QA 4YL8A 3KVFB 3PTFC 1EUVB 2KDBA 3SD5A 1C9FA 1NYRA 2XN9C 2MW5A 2WXLA 5IO9A 1UWMA 1J0GA 4OW0A 1FD6A 4FBJB 4N6EB 2QCZA 4AOFA 2FUG1 2D3BA 4OVVA 3A9JA 2VH2A 4KGTA 3MJWA 3URYA 3ZJUA 3PSEB 4HCPB 2LJIA 1R7SA 3GE3C 4ANWA 2M4NA 2N4FA 2FCSA 2ICIA 2Z0EB 4MGYE 5C3JB 2I1JA 4EZJA 1WXAA 2WWZA 1ZXHA 1LXDA 1TS3A 4LNOA 3RULA 2MBHA 1V6EA 2VH1A 2N7JA 1C4CA 1QILA 1IBXA 1YX6B 4FJYA 4AJWA 2PW9A 3LB8C 1OQQA 4LTUA 4OZBA 1VCBA 3WAMA 4KDIC 3VUWA 2J53A 2LJ5A 2NR2A 3DBRI 4M8NA 1WRIA 4YSYB 4DK5A 1E8XA 4M02A 5KHOA 1V49A 3TEYA 4MELA 2WXQA 1YJJA 4HXDA 4LDTD 1RLFA 2L7RA 1J7AA 3DHGC 1JRUA 3DBHI 4WJPA 3GE8C 3NJTA 2O6VA 2BT6A 2G4DB 2WNMA 5E6PA 1MPEA 3ZNZB 1ET9A 2RPQA 4HRSA 3I9V1 5BYQA 2KFKB 1TY0A 1Q5WB 2REXA 3WALA 2WXPA 2J0KA 2RDBC 1TKGA 3CSTA 2WXJA 5LXHA 5IN7A 3P42A 3Q8AA 1EM7A 1F52A 3HUIA 2XK5A 2WHIA 2HD5B 2D07B 2FAZA 3AB5A 4DBGA 4BKGA 4K7UA 3H8HA 1SE2A 4RNAA 5D6JB 2DWQA 4G0NB 4NAWA 2M56B 4HPMB 3QC8B 4K7WA 1WR6E 2JZZA 2KDMA 2YEPF 3QX1A 1I4XA 1HE8A 4K3BA 2BYVE 5G2NA 3UIPB 4WAFA 1FIQA 1U4AA 1L4ZB 4US8A 1TS2A 1P3QU 3GZNB 1FFVA 2CHXA 3P4QB 5AZFA 1T0QC 1L0YB 4J6IA 2BPSA 2GBKA 1TY2A 2KDFB 4AWJA 3H1UA 1R4MB 2LZ6A 2KT7A 2QJLA 3Q8EA 3U4EG 3SU8X 3IAS1 1UGJA 1UWXA 1MFWA 2WXIA 5JHBA 4OHJA 1STEA 2LGYA 5EE1A 2KQSA 1RFKA 4EZKA 2KHWB 4HJKA 1SE4A 3ZTDA 3R7QA 1J7CA 4ZOHC 2WP9B 3ZGZA 3PZ8A 3ZNID 3V3XA 4KIKA 2N9XA 3ZTCA 2Z0DB 4HEA1 1RAXA 4RH6A 3KUZA 2AWTA 3ZIMA 3QIJA 1OEYA 1L7YA 4BZAA 2Y3AA 1YN4A 3U30A 4TQ0A 1QKZA 3ZNHB 3DVNU 4M00A 2WQYB 3WCQA 2IGGA 2WS3B 5C1ZA 1V81A 4CYEA 1FXIA 2KO3A 2L1AA 1LGRA 4IC7B 1OTRB 3RFZB 1Z5SB 4RGTA 2X38A 1JWSD 3RUIB 3AE6B 3OWEB 2C7NB 3BINA 2MA9B 4KVGB 4YT0B 3ONSA 5D3DA 2WYQA 2J4XA 4ZRIA 3VUXA 1PGBA 4JPSA 2J0MA 4WAAA 1PFDA 1TZ1A 3CIRB 1YD8U 2ZZPB 2CS4A 2GLSA 4MJSA 5D2MB 1KOTA 3R7RA 1WWTA 4MH0E 2WDTB 1K52A 3R2TA 1P7FA 3KUCB 4JWSC 2RDHA 3Q8BA 1C79A 2ONQA 4W9HA 1FXTB 3A9KA 2KVZA 2RR9A 2INDC 3VUYA 4JQWC 2Y5CA 1WX7A 1F2RC 2ZVOA 2CJOA 3EECA 3T3OA 1V86A 3IHPC 5HFYA 4BKTA 3KQ4A 5TSSA 3APCA 1E6EB 3CMMB 1V1OA 2DYOA 4MGZE 1IP9A 2VZKB 1J8CA 5GMVA 4PT5A 4A3OA 4M8MA 4KDLB 3M63B 2TSSA 3OAWA 4LNIA 1VZ8A 2CJNA 3OJ4B 2R61A 4WWOA 4BAXA 3ZNGC 1Y8RC 1VR9A 3L0WB 2JPHA 2YEPB 5BYSA 2KWDA 5DPSA 3KYCD 1WJ4A 4TMAB 3VHTC 3IAM1 3IVFA 4REZA 3DVGX 4O1NA 4OZAA 3AI5A 3PHXB 3RI7C 3L54A 4KSLC 3AEEB 4KX6B 1ZKHA 2JX5A 2EKIA 3APDA 5JHAA 2CU1A 4N9F4 1UUPA 2DZJA 4MT5A 2WXRA 2CR5A 3AU5A 1L6VA 3RPFC 3TEWA 2C7MB 5BMHA 4C4VA 2EKEC 1PGAA 3MTNB 1N5WA 1RWSA 1E90A 2RDGA 2NPTB 5I4DA 5EDSA 1IPGA 2L00B 4ICVA 4MEMA 4W9KA 2GB1A 4L23A 4K81A 4E3CA 3CF6E 1I4QA 4IKGA 3U52E 1FNVA 2ZCCA 2AX5A 1XF5L 2D10A 4EZLA 4WWPA 1VD2A 1XLQA 4K7SA 1E10A 3HHMA 4FHJA 2RSUA 5CHWA 2QMTA 2KMCA 4WIPA 1WH3A 4R3DA 1E7VA 2L05A 2BQQA 3BYTB 4DDID 4BOZB 3N3KB 3NUHB 2L83A 2KAJA 3UI3A 4KGSA 3L13A 2K25A 1ZP0B 3E56A 2DZMA 1V9JA 3DHHC 1TT5B 1YQBA 1FNWA 2CU3A 1WMHA 3ZKJC 2RPVA 2K8BA 3R2IA 2FCNA 2V9HA 4P7IA 1Q0WB 3IT6B 3MFGA 3QA8A 2LGIA 1E8WA 2G1EA 3O65B 1N6ZA 3RNCC 2KX0A 4BKSD 2OJWA 4GGQA 5HI1A 4BFRA 3C8YA 3W5VB 3JSVB 4BOSC 4RFBA 3NZUA 3UQBA 2BS4B 4B6WA 3BIID 2OEDA 4PS7A 2FIDA 4HDOA 4RF0A 1EU3A 2DYBA 4G11A 4GMVA 2GBNA 2WX0A 3NVZA 4G50A 1EWCA 3FAHA 3Q14C 1MG4A 1AARA 2I2YA 2MBQA 1HA5A 1OQYA 1WGDA 2ZNVC 3W1SC 4W9EA 4X57B 3MC8A 3IBEA 2KWVB 3FKYA 4TKNA 2DX5B 2M17A 3PRMB 2LGDA 1Z2MA 4XGAB 1DOXA 4JE3B 1WZ0A 2UYZB 3AECB 4MH8A 4AJYB 2KJ6A 1YIWA 2WXKA 2D3GA 4FJZA 1L0XB 5J17A 2DNFA 2INPE 3HK0A 1F1HA 4RGMA 2QEJC 2INNE 1WYWB 4RF1A 1F9JA 1X1MA 1GC7A 2LRWA 2JY6A 2V3NA 3ZXVA 1TYGB 4USAA 3PRPB 1RYJA 3MHZA 4XDDA 4IM3A 1PUTA 3BWUD 3AN1A 2BB5A 2K8HA 4P6VF 3RNGC 2V3SA 2JRIB 4W9LA 2ZCBA 2W3SA 2BB6A 1T5XD 3A1QB 3N9YC 1WE7A 2LUEA 2DBYA 5HG2A 4JLCA 4KZCA 3RNBC 2NBWB 5G5HA 2KNBA 1OQRA 4C7ZA 1C4PA 1Q10A 3PO0A 1N63A 3B2GA 2JT4B 1ET6A 3DPDA 4P16A 3DVGY 1TTNA 2KTRA 1AYFA 1NEKB 4EEWA 4NJ6A 4ZRPA 4H2AA 1YN3A 1LM8B 5H8YE 4BBNF 3H7PB 1HEZE 4C80A 4W9IA 2K0PA 1V2YA 3P1MA 5TR5A 4B95A 1GPXA 1WX8A 5IKCM 1I4RA 2HJ1A 4ZRJA 4GDLA 1GC6A 1C4AA 2WXMA 4K3CA 2LEKA 1SE9A 2PTLA 1L4DB 3OJ3A 3V6CB 3L17A 2MHJA 2W3RA 3DBRB 3GOEA 2IDYA 1NYQA 3PV1A 3Q8CA 5IA7A 5LLIA 2HE7A 2KYWA 5CX3A 4XWWA 3Q2AC 3MJ5A 1JWAD 1LFDA 3DBHB 4KKJA 4YTMB 4ASWC 1SSNA 4KV2A 3W5UB 3RNAC 3AE2B 5T8IA 2NCNA 2L3ZA 1WGYA 2DENB 4HK2A 3Q8FA 3DOWA 3AMZA 5J18A 3V05A 4IWQA 1TZOA 2AQ3B 2JF5A 4ZRKA 3T9LA 3U7ZA 2DHZA 1ZE3D 4DHJB 2LXAA 2FUHB 2LD9A 1WGKA 4ARIA 3ABVB 1FFUA 3H7SA 3EGRA 1E8YA 1JWBD 2CHZA 4PS8A 2RGFA 3FC4A 2XEWA 2JWUA 3IXSA 2IPKD 4C7YA 3SR6A 5E6NA 1TGZB 3ZW3A 1AN8A 2GRIA 3APFA 3BVGA 1GOZA 4S0RA 3SHQA 3BVMA 4WWMA 1T3QA 3V60A 2QDFA 4BKSA 2ACZB 2M1MA 3JVZX 4KKIA 4P1BC 2KXJA 4G3XB 3Q69A 1K53A 1YQ4B 3ML8A 1SB3C 1WGRA 2AL6A 2BWFA 3PLUA 1GJZA 2G3QB 4HPPA 3IFWB 4ICUA 2WXNA 4L2YA 1P9DU 2K8CA 4YSZB 4E74A 4PYUA 4A8XC 3A4RA 2ZNVB 1FRDA 2BVCA 3FILB 2BKFA 3B0AA 1KTKA 1KM7A 4FN2A 4FXCA 4N58A 2J52A 1VZ7A 3ZDTA 4WJOA 4YWGG 1KJTA 1OEYJ 2L0TA 3TIXA 2BTEA 1DYQA 2SAKA 1P98A 4AP4C 3AE4B 3SFDB 4E71A 4LCDE 3H9DA 2DYMA 3U2SC 3N30A 3KH0A 5G5GA 2WXFA 4Q2JA 2K6DB 3TEZA 4NNJB 1JW9D 2HTHA 1D3ZA 3A9JB 3PREA 1PGXA 2GI9A 4JX1C 4LNFA 1ZGUB 2DZKA 3MHSD 3MC9A 1HZ6A 4XZ4A 5C23A 1UGMA 4GDKA 3AV8A 2IGHA 1YX5B 3PZDA 3Q6BA 2NPTA 1NENB 3B2FA 3QQ8B 2LFIA 4CO7A 1IBXB 2AQ2B 4WURA 2O2VA 4IUMB 1I4GA 3C19A 3QHTA 4NZLB 3JW0X 5AZGA 2N9PC 2HJ8A 3NS8A 2WLBA 3A4SC 4GU2A 2AYOB 4ANUA 3TJPA 3DVNV 2GBRA 1CMXB 1QF6A 3Q3MC 1WFYA 3I63C 4RM8A 2KD0A 2G9HD 1V1PA 4J3OD 2SEBD 3BYYB 4NJCA 2O6VB 2D5GA 3VH4B 1ZOYB 1M4VA 5G55A 5CHFA 5J2RA 4MACA 1MVKA 2Q5WD 1HZ5A 1JALA 2ZW1A 3VRBB 1IGDA 1FEHA 4M0WB 4UDUC 1WI0A 4HDQA 5EE0A 2Z59B 1WSPA 3NY5A 1ZUD2 2XK5B 5BMGA 2LVPA 3LYYA 1VZ6A 4RMAA 2KLCA 2CKHB 1WM3A 2NS5A 4ITKA 4CHKA 1UF0A 3LXFA 1EF5A 5IP4D 3PS6A 4IM2A 4NAWB 1N61A 2HDEA 4RCOA 3DBSA 2KKCA 1HQRD 3RT3B 3T3NA 2PVOD 1YOVB 1N60A 2BKRB 3W1YA 3BK1A 2LXCA 2W54A 4JL9A 3EFCA 1S1QB 1E5WA 2N1VA 2JXTA 1UBQA 1JMLA 3QWZB 3QAQA 4HWIB 2NMQA 3PT2B 4BVUC 4K1RB 3QJZA 4GOCA 4C56C 4DHZB 3KWVA 3QARA 1C77A 2KFJA 1PQSA 1MHHE 3NS1A 2L0FA 1ESFA 1D6EC 1HTOA 1WGHA 3ZQ4A 3V61A 2IBIB 3JYUA 3K9OB 4FA6A 3V62A 4TQ1A 2W9NA 1WM2A 2PLPA 3ECIA 4DDGD 1L5PA 5AEKB 2LHDA 3PHWB 2IJ0A 2V4IB 1CZPA 4KIKB 5EE9A 3QCAA 5MPOA 4HKZE 2C9WB 2V0GA 4KZ0A 1E7UA 1WJNA 5E6JA 2EMSA 3Q3FA 2NTTA 3PZ7A 4JGHB 1ROEA 4IOIE 5H92C 5FR6A 2JVCA 3GP7A 1V97A 2I1KA 2NVUI 1K8RB 1EO6A 2A4ZA 2FE8A 1FNUA 3U7DA 3AH7A 4L1BA 3VXWA 1WXVA 2EMTA 2ZJDA 3MC0B 1VLBA 1WYGA 4IWOA 1RFAA 3VTUA 1J7BA 2CHWA 2JRHA 3CSFA 2NBUA 4XDCA 1VJKA 3VH3B 2E6XA 3UF8A 2M0XA 4DWFA 1E0ZA 4EUTA 3AE7B 1YNTE 2K5PA 1GG3A 5BO4B 4F1SA 1P0RA 2KTFA 2BWES 3R3MA 2KK8A 2PPHA 3SDLC 3B08A 4CQNA 3D32A 2DAJA 4I6PA 4FLHA 2KN4A 2LWPA 1H4RA 2IO0B 2L8JA 3RZWC 3H7PA 2LASA 1AWDA 4NJ7A 2GBMA 1XCTL 1EF1A 3EC8A 4RGNA 3HM3A 4C00A 1GNUA 5L83A 1SBBB 4GSWA 3A9KB 4PK1A 1M94A 3N1YC 4A3PA 2L52A 4URKA 1EWYC 3PPAA 3HVDA 3TBLD 2MJ3A 2BYEA 2VZKD 3ZRFA 3NRZA 5GXGB 2JZPA 3HM6X 1FXAA 2FNJB 1GB4A 5D94A 4EE2A 5C2TB 5LXIB 1IUEA 2KLGA 2WU5B 1KLGD 2WXHA 1DOYA 4TUUA 1T0YA 2MCNB 3PVLA 3ML9A 4NAMA 5BYRA 2WDRB 1L6UA 3P4PB 2PVGC 4ZHPA 3RNEC 3RMKC 3PGEA 4ACFA 1ENFA 1I7HA 3AU4A 1ZDXA 2J0JA 4GB9A 4LDTB 1ZXIA 3KWLA 1XLNA 1FCLA 3C0RB 4IM0A 3PLVA 3AE1B 3I3TB 3X23A 2KFKA 3AE5B 1KLUD 3DDCB 1E8ZA 5IAAC 3VR9B 4C4VB 4MM3B 2PE6B 4FJVB 2K22A 4F8CB 2KDIA 2WGSA 1WGGA 2LI5A 3NG0A 3UGBB 1CQVA 5FK9C 2PEAA 3LDZE 1FRRA 2ON8A 2M0AA 2UU7A 1JROA 4DXGA 1I35A 1KFYB 2JXXA 3HRDD 1JWUD 2B3AA 5FR3A 2MLBA 1VRAB 3N1ZC 2QILA 4FHKA 2K6QA 2EELA 1T0SC 2BGFA 3ZYYX 2D3CA 3AEFB 2LRUA 2KZRA 1XLPA 2GBJA 1FMAD 4DXAB 2C7HA 2JU6X 3VTWA 4KSKC 4W9DA 1D5XC 2MWSB 4NY0A 1WZ3A 4MGKE 5DPWA 2KQ7A 1L0VB 4D2KA 3EUB2 2OJRA 3WIMA 2MSED 3FILA 2IO3B 3P4RB 1TIFA 1WMHB 2KANA 3DHIC 3RNFC 3SFEB 4OVZA 3H6NA 1BT0A 2D3AA 3L16A 4OVUA 4HLEA 2M8SA 2KC2A 1KLVA 4N59A 2YLMA 4EFOA 1WXQA 2GOWA 2N9KA 2HTME 4B0EA 2I38A 1KRHA 2KDEB 1OGWA 2LGXA 3HIZA 2L32A 3IG3A 3E9SA 1LO5D 2BYFA 3AM9A 1XEEA 1WJ6A 4WQOB 1JWMD 4MGIE 5JH5C 1T0RC 3VAWA 2Z8LA 2K3UA 4B9KA 1XLOA 2NTSA 4TSSA 2WX1A 3RCZA 4HVBA 1I4HA 1NI3A 3M62B 2IY1B 2MX2A 4DXFA 2KN5A 1PYWD 3DBLB 3NOBA 1IYFA 2ASQA 3DBLI 3N20C 4MDKE 2KACA 5CHVC 2JQRB 4IDIA 3X0WA 4IW0A 4II3B 1YJ1A 3NVWA 1XT9B 2PE9A 4ZYSA 3NVYA 3VDZA 2OOBB 3N1XC 4M0WA 1OFFA 4YTNB 5HHDG 2W82A 4PYZA 2K1FA 4FULA 2KVRA 4RGOS 4XC2A 4AS1A 2W55A 1NBFC 3B1LX 3AE3B 1J19A 1UD7A 3UIOB 2N9LA 1A70A 2MP2B 4EKUA 2AQ1B 4ZDVA 3GB1A 3AEAB 2LGSA 1D5MC 2MRPA 1UNSA 3NVVA 2KQ4X 3WAPA 5HKHA 3L08A 4EOYA 4WJNA 4A90A 2G4SA 4B0MA 3KUDB 1A5RA 1NVID 4DQOC 1S3SG 4ANVA 2VRRB 3NZ3A 1CJEA 3UQAA 3I5JC 2RD0A 3EFUA 1LQBA 1WY8A 1XQQA 3DWGC 5FKAC 2YVCA 3GZNI 1H8CA 1V80A 2INCC 2WXGA 3AEBB 2KJRA 2KTRB 1JQ4A 2ZVNA 2IZVB 2QSDA 1Y56A 2J42A 1EU4A 1MG8A 1G6JA 1P7EA 2V1YA 1CK1A 1R4MI 4FADA 4JIOU 3DWMA 2PJHA 1TBEA 4LNKA 3M95A 2BF8B 4GDLB 5AUKA 3ZJVA 3BZDB 2BS3B 1K50A 4HCNB 3RZFA 3AULA 1GB1A 5DPRA 3BY4B 3VFKA 2E3TA 4LNNA 1KH0A 3TL5A 3TSSA 2D11A 1QT9A 2H88B 5KHQA 2K9XA 1D5ZC 5IOIA 1L2NA 4LLGM 3L10B 1JRPA 1MI0A 4LJPB 2WU2B 4HROA 4A55A 1C3TA 1HTQA 4W9JA 3NHEB 1UH6A 2IGDA 3RYTA 3SEBA 5E6OA 1AW7A 1MHXA 1SIFA 3PRZA 3ZXRA 2C60A 1IGCA 1TS4A 3BVZA 3RD2A 5AUIA 1FM0D 4ZHOA 2DZIA 5CTRC 3GS2A 4DHJD 3W2DA 2IO2B 3ALBA 4WJQA 3HVZA 1HXYD 1T6BX 4S17A 2JSVX 2N0SB 1TKYA 1SEBD 1D4BA 3B9JA 1BMLC 4NPNA 3O13A 1QOGA 2ZEQA 1WXSA 2MJEA 3BK2A 1GAQB 1ACCA 2RMMA 1K51A 3Q3JA 4A6QA 1RRBA 3TEXA 1KF6B 3AEGB 4TV3A 3JSVA 4M01A 4GLSC 4ARCA 2N7DA 1XCQL 1C78A 1C1YB 2JUOA 4W9GA 3VR8B 2KX3A 3OLMD 3AE8B 2QC8A 3P63A 2MJDA 3EA6A 2B76B 4W9CA 1ZPSA 3ENEA 3AXCA 3Q3NC 2MQJA 1R4NB 1V5OA 4HKQA 1XO3A 2N7EA 1R4NI 1UZXB 2FIFA 2QHOA 1NDDA 2WDQB 3VTVA 2G45B 2KC1A 3TCAA 2D2QA 3N32A 2KWUB 2X8XX 4YXDB 5BMIA 2OHFA 4II2B 1RM6C 2J7QB 2LUMA 4W9FA 4XX5A 3TMPB 1PDXA 3I57A 4LK0M 2V4LA 1Q1OA 1N62A 3M3JA 2MBBB 4DHZE 3L4PA 1WX9A 2JYTA 1JCKB 2FCQA 1GUAB 2IO1B 3QK0A 2XBBC 2DAFA 2BW2A 3WA0A 2M19A 1YJIA 1ISNA 1QOBA 2KJHB 1TKEA 4MM3A 2Y5BB 1I42A 1SE3A 4GDKB 4ZYNA 4WH4A 3RN9C 3LJ3A 4PS3A 3ZVVA 4RM9A 2MBEA 4NQKE 4XE0A 3UINB 1QZEA 2KWCA 1XXGA 2JZ3B 1WXMA 2IY0B 2UWQA 3A1QA 5JXVA 3J9CA 2AEHA 1B1ZA 2O2VB 1FO4A 2K39A 2ZW0A 1SJHD 2A5UA 1V8CA 3VVWB 5LNK1 2N9EB 3ZRCA 3P2BA 2PIAA 3EHVA 2O6VD 1ZW7A 2NBVB 2ZPYA 1V1PB 2WXOA 2BYTA 1DOIA 1NI2A 3NZSA 4YSXB 4I6NB 2LMCA 4MJSB 2R2OA 2LHEA 3P4SB 1I4PA 1BUIC 3AEDB 1SIJA 1V5TA 2LVQA 4MSMB 5L95C 4ANXA 1C76A 1SJED 1E9MA 1YMHE 1F0ZA 1SGHA 2MH7A 2DLBA 1QQRA 4XYCA 1YQ3B 4YTPB 4GXBA 2WDVB 2PMVA 5D3IB 2FCMA 2GMIC 5DCNA 2H89B 1XD3B 2V3PA 4NQLB 3VRAB 4XWTA 3MP9A 4AUQC 4IWPA 4AQ7A 4HPLB 2IYDB 4LJOB 1UELA 2LVOA 3WAOA 2KMMA 1QOAA 2PKOA 3R66C 3VQIA 1ZDVA 2BS2B 1UBIA 3ZJTA 1QLBB 1E7PB 2JYEA 4KGRA 4IG7B 1TJEA 3W9CB 3WANA 1QOFA 1VDVA 2BBCA 3KYDD 3S2AA 1WIAA 2AL3A 3V6EB 2MEKA 3U8ZA 2C5LC 2N1WA 1WJUA 4WWNA 4ZRQA 1YN5A 2FBWB 1WRDB 2MBOA 4BBNC 2JWZA 3T8MA 1SXTA 4WQMA 2KOXA 3DCGA 4QAYA 3AE9B 4A9AA 2ZPNA 3DQVA
chains in the Genus database with same CATH topology
2O6VB 3VH4B 5CHVC 2KMCA 4A20A 1WH3A 1WF9A 5G55A 4GN1A 3X0WA 4IW0A 1E7VA 2KMAA 1YJ1A 3K9PB 4II3B 1XT9B 2PE9A 2L05A 5CHFA 5J2RA 4FHJA 3VDZA 3ZDMC 2OOBB 4DDID 4BOZB 3N3KB 2MP2A 4MSQB 3ZLZA 3L13A 4PYZA 2K1FA 4FULA 4F7ZA 2K25A 2KVRA 4XC2A 2DZMA 1V9JA 1NBFC 3B1LX 4M0WB 1YQBA 1J19A 1WI0A 4HDQA 5AZHA 1UD7A 3UIOB 4EKUA 2MP2B 2Z59B 3A33B 3NY5A 1WMHA 2L76A 3ZKJC 4ZDVA 2XK5B 2K8BA 2MRPA 1P1AA 2LVPA 2FCNA 4GIVA 4RMAA 3W1SA 2KLCA 3WAPA 5HKHA 3L08A 4I6LB 5D7GA 4EOYA 1WE6A 1WR1A 4P7IA 4WJNA 1Q0WB 2CKHB 5DPTA 2G4SA 3ZO5B 3KW5B 3QA8A 1WM3A 2NS5A 5JZEB 1E8WA 4CHKA 3O65B 3KUDB 1A5RA 1EF5A 1S3SG 2KX0A 3PS6A 4IM2A 4NAWB 4BKSD 4ANVA 2VRRB 4GGQA 3UQAA 3ZUNA 3DBSA 4BFRA 2KKCA 2R2QA 2RD0A 4YL8A 3EFUA 3KVFB 1LQBA 3PTFC 3JSVB 1EUVB 1WY8A 1XQQA 2KDBA 3SD5A 4BOSC 3RT3B 3NZUA 3UQBA 2YVCA 3GZNI 1H8CA 2BKRB 3W1YA 1V80A 2MW5A 4B6WA 1J0GA 2LXCA 4FBJB 2KJRA 2KTRB 4JL9A 4PS7A 4AOFA 1S1QB 2FIDA 2IZVB 2ZVNA 4HDOA 1E5WA 2N1VA 4G11A 2DYBA 4OVVA 3A9JA 4GMVA 1MG8A 1G6JA 3QWZB 1UBQA 2V1YA 2GBNA 3QAQA 3MJWA 3PT2B 4HWIB 4BVUC 2WX0A 1R4MI 4FADA 3PSEB 4HCPB 4K1RB 4G50A 4JIOU 3QJZA 2PJHA 4GOCA 4ANWA 2M4NA 4DHZB 1TBEA 2N4FA 3QARA 1AARA 2FCSA 2KFJA 2MBQA 2Z0EB 3M95A 4MGYE 1PQSA 2BF8B 2I1JA 4EZJA 4GDLB 1OQYA 1WGDA 2ZNVC 2L0FA 1WXAA 2WWZA 3W1SC 1LXDA 4W9EA 1WGHA 4X57B 4HCNB 3V61A 2IBIB 2MBHA 3AULA 3JYUA 1V6EA 3K9OB 3RULA 4TQ1A 3RZFA 3V62A 4FA6A 5DPRA 2W9NA 3BY4B 3VFKA 1YX6B 3IBEA 1WM2A 2KWVB 3TL5A 4TKNA 4FJYA 2DX5B 4AJWA 2M17A 3PRMB 1VCBA 3WAMA 4KDIC 3VUWA 2LGDA 2D11A 2LJ5A 1Z2MA 3ECIA 4DDGD 5AEKB 2NR2A 5KHQA 3DBRI 3PHWB 1WZ0A 2UYZB 4M8NA 4AJYB 2KJ6A 4KIKB 1YIWA 1L2NA 3L10B 4DK5A 1E8XA 3QCAA 2D3GA 4LJPB 4FJZA 2C9WB 5J17A 5KHOA 1V49A 4KZ0A 3HK0A 4MELA 1E7UA 4HXDA 1WJNA 4LDTD 1C3TA 1RLFA 2EMSA 2L7RA 3Q3FA 4W9JA 3NHEB 1UH6A 3RYTA 1JRUA 4JGHB 5E6OA 1WYWB 3DBHI 1F9JA 4WJPA 1X1MA 1GC7A 2LRWA 5FR6A 2O6VA 2JVCA 1SIFA 2JY6A 2I1KA 2NVUI 3PRZA 2G4DB 2C60A 5E6PA 1K8RB 1EO6A 3PRPB 2A4ZA 3ZNZB 3U7DA 2RPQA 3RD2A 4IM3A 2KFKB 1Q5WB 2DZIA 5CTRC 2REXA 3WALA 2J0KA 3VXWA 4DHJD 1WXVA 2K8HA 2IO2B 3ALBA 2EMTA 4WJQA 2ZJDA 3CSTA 4IWOA 5LXHA 2V3SA 1RFAA 2JRIB 4W9LA 3VTUA 2ZCBA 2CHWA 2JRHA 3CSFA 2NBUA 2XK5A 3A1QB 3VH3B 3UF8A 1WE7A 2HD5B 2LUEA 2M0XA 2D07B 2FAZA 4DWFA 4EUTA 4DBGA 4NPNA 4BKGA 2ZEQA 4JLCA 4KZCA 1WXSA 4K7UA 1GG3A 5BO4B 4F1SA 1P0RA 2KTFA 5D6JB 2NBWB 4G0NB 4NAWA 2KNBA 3Q3JA 4HPMB 1RRBA 2BWES 3QC8B 4K7WA 1WR6E 3R3MA 2JZZA 2KK8A 2PPHA 4TV3A 3SDLC 3B08A 2JT4B 3JSVA 3QX1A 1HE8A 3D32A 3UIPB 2BYVE 5G2NA 2N7DA 2DAJA 3DPDA 4FLHA 4I6PA 1C1YB 3DVGY 2JUOA 4W9GA 1U4AA 2LWPA 1P3QU 2KX3A 1H4RA 1TTNA 2IO0B 3OLMD 2L8JA 3RZWC 2KTRA 3H7PA 4EEWA 2LASA 4NJ6A 4NJ7A 2GBMA 2CHXA 1EF1A 3EC8A 4W9CA 5AZFA 3HM3A 1LM8B 1GNUA 5L83A 3ENEA 4GSWA 4J6IA 2BPSA 3A9KB 4BBNF 2GBKA 3H7PB 3AXCA 1M94A 2KDFB 4AWJA 4W9IA 1V2YA 5TR5A 3H1UA 4B95A 2MQJA 4A3PA 1WX8A 2LZ6A 1V5OA 4URKA 3PPAA 3TBLD 2BYEA 3VTWA 4ZRJA 3ZRFA 2N7EA 4GDLA 3SU8X 1R4NI 3HM6X 1UZXB 1GC6A 2FIFA 2QHOA 1NDDA 2FNJB 3VTVA 5D94A 5JHBA 5LXIB 2LGYA 2G45B 2KC1A 1SE9A 2D2QA 2KQSA 3N32A 3TCAA 2KWUB 2KLGA 4EZKA 2KHWB 4HJKA 4II2B 2J7QB 4XX5A 4W9FA 3ZTDA 3OJ3A 3R7QA 3TMPB 3V6CB 4TUUA 3L17A 3ZNID 2V4LA 4KIKA 2N9XA 3ZTCA 3GOEA 1T0YA 2MCNB 3PVLA 3ML9A 1Q1OA 2Z0DB 3M3JA 2MBBB 4DHZE 1WX9A 3PV1A 1RAXA 3KUZA 5IA7A 2AWTA 3ZIMA 5LLIA 3QIJA 2HE7A 1OEYA 2FCQA 1L7YA 5CX3A 1GUAB 2IO1B 3U30A 3QK0A 4TQ0A 2XBBC 3PGEA 2DAFA 3WA0A 3ZNHB 3AU4A 1LFDA 3DVNU 1ISNA 2J0JA 4GB9A 4ASWC 4LDTB 3C0RB 2KJHB 4KV2A 4MM3A 4IM0A 3PLVA 5C1ZA 1V81A 3I3TB 3X23A 2NCNA 4CYEA 2KFKA 2Y5BB 2KO3A 4IC7B 1I42A 2L3ZA 1OTRB 1WGYA 3DDCB 2DENB 4HK2A 1E8ZA 1Z5SB 4GDKB 4ZYNA 5IAAC 3LJ3A 4PS3A 3DOWA 3ZVVA 2PE6B 5J18A 4RM9A 4FJVB 2MBEA 4NQKE 4IWQA 3RUIB 3UINB 1QZEA 2JF5A 4ZRKA 3T9LA 2C7NB 2KWCA 2JZ3B 4F8CB 1WXMA 2DHZA 2IY0B 2UWQA 3A1QA 2KDIA 3BINA 2AEHA 1WGGA 4DHJB 2LXAA 2FUHB 2LD9A 2LI5A 2MA9B 2O2VB 3H7SA 2K39A 3UGBB 1E8YA 2CHZA 2A5UA 2PEAA 3LDZE 3ONSA 4KVGB 2WYQA 4PS8A 3VVWB 2RGFA 2XEWA 1I35A 2N9EB 2JXXA 3ZRCA 3P2BA 5E6NA 4ZRIA 3EHVA 3VUXA 2B3AA 2O6VD 1ZW7A 2MLBA 1TGZB 3ZW3A 3APFA 2J0MA 4WAAA 4FHKA 3SHQA 2K6QA 1TZ1A 2BGFA 2NBVB 2ZPYA 1YD8U 2ZZPB 2CS4A 4MJSA 5D2MB 3V60A 4BKSA 2LRUA 2M1MA 2KZRA 3JVZX 1KOTA 2GBJA 2KXJA 4G3XB 3R7RA 4MH0E 2WDTB 1NI2A 4DXAB 3ML8A 2C7HA 3NZSA 4I6NB 1WGRA 4KSKC 4W9DA 4MJSB 3KUCB 2AL6A 2BWFA 2MWSB 3PLUA 4NY0A 1WZ3A 4MGKE 1GJZA 2G3QB 5DPWA 3IFWB 2R2OA 4W9HA 2KQ7A 1FXTB 3A9KA 4ICUA 2RR9A 2OJRA 3WIMA 3VUYA 4JQWC 1P9DU 1WX7A 2ZVOA 1V5TA 2K8CA 2LVQA 2MSED 4MSMB 2IO3B 5L95C 3EECA 4ANXA 4E74A 1V86A 1WMHB 3IHPC 4PYUA 2KANA 4BKTA 3A4RA 2ZNVB 3APCA 3CMMB 2BKFA 3B0AA 1KM7A 4FN2A 1SGHA 3H6NA 1BT0A 3L16A 2DYOA 4MGZE 1IP9A 4OVUA 3ZDTA 4HLEA 1J8CA 5GMVA 4WJOA 4A3OA 1KJTA 4M8MA 4KDLB 1OEYJ 2M8SA 3M63B 2L0TA 2KC2A 3TIXA 3OAWA 1KLVA 1P98A 4GXBA 3OJ4B 4WWOA 4AP4C 3ZNGC 1Y8RC 2YLMA 4EFOA 3L0WB 2JPHA 2GOWA 2FCMA 2GMIC 4E71A 5DCNA 4LCDE 3H9DA 5DPSA 2DYMA 1XD3B 3KYCD 2KDEB 3N30A 1WJ4A 4NQLB 1OGWA 3KH0A 3VHTC 3IVFA 2LGXA 3DVGX 3HIZA 2K6DB 4AUQC 3AI5A 3PHXB 4NNJB 3IG3A 4IWPA 2HTHA 1D3ZA 3A9JB 3PREA 3L54A 2BYFA 4HPLB 4KSLC 2IYDB 4LJOB 1UELA 1ZKHA 1WJ6A 1ZGUB 2DZKA 3APDA 2LVOA 3MHSD 4WQOB 5JHAA 2CU1A 3WAOA 4N9F4 2DZJA 4MGIE 2CR5A 3AU5A 5CHWA 4XZ4A 5JH5C 3R66C 5C23A 1UGMA 3VQIA 3VAWA 4GDKA 1YX5B 3PZDA 1UBIA 2C7MB 2NPTA 4B9KA 2EKEC 3QQ8B 3MTNB 4IG7B 4CO7A 3WANA 1E90A 2WX1A 3RCZA 4HVBA 2NPTB 5EDSA 1IPGA 2L00B 2O2VA 3KYDD 3M62B 2IY1B 4IUMB 2MX2A 3QHTA 3S2AA 1WIAA 4ICVA 4MEMA 4W9KA 2AL3A 3JW0X 5AZGA 4K81A 2N9PC 3V6EB 2KN5A 4E3CA 2HJ8A 3NS8A 3U8ZA 2C5LC 3A4SC 2N1WA 1WJUA 3CF6E 4GU2A 3NOBA 2AYOB 4WWNA 4ANUA 3TJPA 3DVNV 1WRDB 2GBRA 2MBOA 1CMXB 2ZCCA 4BBNC 1IYFA 2JWZA 2ASQA 3DBLI 1WFYA 4MDKE 3T8MA 2D10A 2KD0A 4RM8A 4EZLA 4WWPA 1VD2A 2KOXA 3DCGA 4K7SA 3HHMA 2RSUA 2ZPNA 3DQVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O6V B;  3VH4 B;  5CHV C;  2KMC A;  4A20 A;  1WH3 A;  1WF9 A;  5G55 A;  4GN1 A;  3X0W A;  4IW0 A;  1E7V A;  2KMA A;  1YJ1 A;  3K9P B;  4II3 B;  1XT9 B;  2PE9 A;  2L05 A;  5CHF A;  5J2R A;  4FHJ A;  3VDZ A;  3ZDM C;  2OOB B;  4DDI D;  4BOZ B;  3N3K B;  2MP2 A;  4MSQ B;  3ZLZ A;  3L13 A;  4PYZ A;  2K1F A;  4FUL A;  4F7Z A;  2K25 A;  2KVR A;  4XC2 A;  2DZM A;  1V9J A;  1NBF C;  3B1L X;  4M0W B;  1YQB A;  1J19 A;  1WI0 A;  4HDQ A;  5AZH A;  1UD7 A;  3UIO B;  4EKU A;  2MP2 B;  2Z59 B;  3A33 B;  3NY5 A;  1WMH A;  2L76 A;  3ZKJ C;  4ZDV A;  2XK5 B;  2K8B A;  2MRP A;  1P1A A;  2LVP A;  2FCN A;  4GIV A;  4RMA A;  3W1S A;  2KLC A;  3WAP A;  5HKH A;  3L08 A;  4I6L B;  5D7G A;  4EOY A;  1WE6 A;  1WR1 A;  4P7I A;  4WJN A;  1Q0W B;  2CKH B;  5DPT A;  2G4S A;  3ZO5 B;  3KW5 B;  3QA8 A;  1WM3 A;  2NS5 A;  5JZE B;  1E8W A;  4CHK A;  3O65 B;  3KUD B;  1A5R A;  1EF5 A;  1S3S G;  2KX0 A;  3PS6 A;  4IM2 A;  4NAW B;  4BKS D;  4ANV A;  2VRR B;  4GGQ A;  3UQA A;  3ZUN A;  3DBS A;  4BFR A;  2KKC A;  2R2Q A;  2RD0 A;  4YL8 A;  3EFU A;  3KVF B;  1LQB A;  3PTF C;  3JSV B;  1EUV B;  1WY8 A;  1XQQ A;  2KDB A;  3SD5 A;  4BOS C;  3RT3 B;  3NZU A;  3UQB A;  2YVC A;  3GZN I;  1H8C A;  2BKR B;  3W1Y A;  1V80 A;  2MW5 A;  4B6W A;  1J0G A;  2LXC A;  4FBJ B;  2KJR A;  2KTR B;  4JL9 A;  4PS7 A;  4AOF A;  1S1Q B;  2FID A;  2IZV B;  2ZVN A;  4HDO A;  1E5W A;  2N1V A;  4G11 A;  2DYB A;  4OVV A;  3A9J A;  4GMV A;  1MG8 A;  1G6J A;  3QWZ B;  1UBQ A;  2V1Y A;  2GBN A;  3QAQ A;  3MJW A;  3PT2 B;  4HWI B;  4BVU C;  2WX0 A;  1R4M I;  4FAD A;  3PSE B;  4HCP B;  4K1R B;  4G50 A;  4JIO U;  3QJZ A;  2PJH A;  4GOC A;  4ANW A;  2M4N A;  4DHZ B;  1TBE A;  2N4F A;  3QAR A;  1AAR A;  2FCS A;  2KFJ A;  2MBQ A;  2Z0E B;  3M95 A;  4MGY E;  1PQS A;  2BF8 B;  2I1J A;  4EZJ A;  4GDL B;  1OQY A;  1WGD A;  2ZNV C;  2L0F A;  1WXA A;  2WWZ A;  3W1S C;  1LXD A;  4W9E A;  1WGH A;  4X57 B;  4HCN B;  3V61 A;  2IBI B;  2MBH A;  3AUL A;  3JYU A;  1V6E A;  3K9O B;  3RUL A;  4TQ1 A;  3RZF A;  3V62 A;  4FA6 A;  5DPR A;  2W9N A;  3BY4 B;  3VFK A;  1YX6 B;  3IBE A;  1WM2 A;  2KWV B;  3TL5 A;  4TKN A;  4FJY A;  2DX5 B;  4AJW A;  2M17 A;  3PRM B;  1VCB A;  3WAM A;  4KDI C;  3VUW A;  2LGD A;  2D11 A;  2LJ5 A;  1Z2M A;  3ECI A;  4DDG D;  5AEK B;  2NR2 A;  5KHQ A;  3DBR I;  3PHW B;  1WZ0 A;  2UYZ B;  4M8N A;  4AJY B;  2KJ6 A;  4KIK B;  1YIW A;  1L2N A;  3L10 B;  4DK5 A;  1E8X A;  3QCA A;  2D3G A;  4LJP B;  4FJZ A;  2C9W B;  5J17 A;  5KHO A;  1V49 A;  4KZ0 A;  3HK0 A;  4MEL A;  1E7U A;  4HXD A;  1WJN A;  4LDT D;  1C3T A;  1RLF A;  2EMS A;  2L7R A;  3Q3F A;  4W9J A;  3NHE B;  1UH6 A;  3RYT A;  1JRU A;  4JGH B;  5E6O A;  1WYW B;  3DBH I;  1F9J A;  4WJP A;  1X1M A;  1GC7 A;  2LRW A;  5FR6 A;  2O6V A;  2JVC A;  1SIF A;  2JY6 A;  2I1K A;  2NVU I;  3PRZ A;  2G4D B;  2C60 A;  5E6P A;  1K8R B;  1EO6 A;  3PRP B;  2A4Z A;  3ZNZ B;  3U7D A;  2RPQ A;  3RD2 A;  4IM3 A;  2KFK B;  1Q5W B;  2DZI A;  5CTR C;  2REX A;  3WAL A;  2J0K A;  3VXW A;  4DHJ D;  1WXV A;  2K8H A;  2IO2 B;  3ALB A;  2EMT A;  4WJQ A;  2ZJD A;  3CST A;  4IWO A;  5LXH A;  2V3S A;  1RFA A;  2JRI B;  4W9L A;  3VTU A;  2ZCB A;  2CHW A;  2JRH A;  3CSF A;  2NBU A;  2XK5 A;  3A1Q B;  3VH3 B;  3UF8 A;  1WE7 A;  2HD5 B;  2LUE A;  2M0X A;  2D07 B;  2FAZ A;  4DWF A;  4EUT A;  4DBG A;  4NPN A;  4BKG A;  2ZEQ A;  4JLC A;  4KZC A;  1WXS A;  4K7U A;  1GG3 A;  5BO4 B;  4F1S A;  1P0R A;  2KTF A;  5D6J B;  2NBW B;  4G0N B;  4NAW A;  2KNB A;  3Q3J A;  4HPM B;  1RRB A;  2BWE S;  3QC8 B;  4K7W A;  1WR6 E;  3R3M A;  2JZZ A;  2KK8 A;  2PPH A;  4TV3 A;  3SDL C;  3B08 A;  2JT4 B;  3JSV A;  3QX1 A;  1HE8 A;  3D32 A;  3UIP B;  2BYV E;  5G2N A;  2N7D A;  2DAJ A;  3DPD A;  4FLH A;  4I6P A;  1C1Y B;  3DVG Y;  2JUO A;  4W9G A;  1U4A A;  2LWP A;  1P3Q U;  2KX3 A;  1H4R A;  1TTN A;  2IO0 B;  3OLM D;  2L8J A;  3RZW C;  2KTR A;  3H7P A;  4EEW A;  2LAS A;  4NJ6 A;  4NJ7 A;  2GBM A;  2CHX A;  1EF1 A;  3EC8 A;  4W9C A;  5AZF A;  3HM3 A;  1LM8 B;  1GNU A;  5L83 A;  3ENE A;  4GSW A;  4J6I A;  2BPS A;  3A9K B;  4BBN F;  2GBK A;  3H7P B;  3AXC A;  1M94 A;  2KDF B;  4AWJ A;  4W9I A;  1V2Y A;  5TR5 A;  3H1U A;  4B95 A;  2MQJ A;  4A3P A;  1WX8 A;  2LZ6 A;  1V5O A;  4URK A;  3PPA A;  3TBL D;  2BYE A;  3VTW A;  4ZRJ A;  3ZRF A;  2N7E A;  4GDL A;  3SU8 X;  1R4N I;  3HM6 X;  1UZX B;  1GC6 A;  2FIF A;  2QHO A;  1NDD A;  2FNJ B;  3VTV A;  5D94 A;  5JHB A;  5LXI B;  2LGY A;  2G45 B;  2KC1 A;  1SE9 A;  2D2Q A;  2KQS A;  3N32 A;  3TCA A;  2KWU B;  2KLG A;  4EZK A;  2KHW B;  4HJK A;  4II2 B;  2J7Q B;  4XX5 A;  4W9F A;  3ZTD A;  3OJ3 A;  3R7Q A;  3TMP B;  3V6C B;  4TUU A;  3L17 A;  3ZNI D;  2V4L A;  4KIK A;  2N9X A;  3ZTC A;  3GOE A;  1T0Y A;  2MCN B;  3PVL A;  3ML9 A;  1Q1O A;  2Z0D B;  3M3J A;  2MBB B;  4DHZ E;  1WX9 A;  3PV1 A;  1RAX A;  3KUZ A;  5IA7 A;  2AWT A;  3ZIM A;  5LLI A;  3QIJ A;  2HE7 A;  1OEY A;  2FCQ A;  1L7Y A;  5CX3 A;  1GUA B;  2IO1 B;  3U30 A;  3QK0 A;  4TQ0 A;  2XBB C;  3PGE A;  2DAF A;  3WA0 A;  3ZNH B;  3AU4 A;  1LFD A;  3DVN U;  1ISN A;  2J0J A;  4GB9 A;  4ASW C;  4LDT B;  3C0R B;  2KJH B;  4KV2 A;  4MM3 A;  4IM0 A;  3PLV A;  5C1Z A;  1V81 A;  3I3T B;  3X23 A;  2NCN A;  4CYE A;  2KFK A;  2Y5B B;  2KO3 A;  4IC7 B;  1I42 A;  2L3Z A;  1OTR B;  1WGY A;  3DDC B;  2DEN B;  4HK2 A;  1E8Z A;  1Z5S B;  4GDK B;  4ZYN A;  5IAA C;  3LJ3 A;  4PS3 A;  3DOW A;  3ZVV A;  2PE6 B;  5J18 A;  4RM9 A;  4FJV B;  2MBE A;  4NQK E;  4IWQ A;  3RUI B;  3UIN B;  1QZE A;  2JF5 A;  4ZRK A;  3T9L A;  2C7N B;  2KWC A;  2JZ3 B;  4F8C B;  1WXM A;  2DHZ A;  2IY0 B;  2UWQ A;  3A1Q A;  2KDI A;  3BIN A;  2AEH A;  1WGG A;  4DHJ B;  2LXA A;  2FUH B;  2LD9 A;  2LI5 A;  2MA9 B;  2O2V B;  3H7S A;  2K39 A;  3UGB B;  1E8Y A;  2CHZ A;  2A5U A;  2PEA A;  3LDZ E;  3ONS A;  4KVG B;  2WYQ A;  4PS8 A;  3VVW B;  2RGF A;  2XEW A;  1I35 A;  2N9E B;  2JXX A;  3ZRC A;  3P2B A;  5E6N A;  4ZRI A;  3EHV A;  3VUX A;  2B3A A;  2O6V D;  1ZW7 A;  2MLB A;  1TGZ B;  3ZW3 A;  3APF A;  2J0M A;  4WAA A;  4FHK A;  3SHQ A;  2K6Q A;  1TZ1 A;  2BGF A;  2NBV B;  2ZPY A;  1YD8 U;  2ZZP B;  2CS4 A;  4MJS A;  5D2M B;  3V60 A;  4BKS A;  2LRU A;  2M1M A;  2KZR A;  3JVZ X;  1KOT A;  2GBJ A;  2KXJ A;  4G3X B;  3R7R A;  4MH0 E;  2WDT B;  1NI2 A;  4DXA B;  3ML8 A;  2C7H A;  3NZS A;  4I6N B;  1WGR A;  4KSK C;  4W9D A;  4MJS B;  3KUC B;  2AL6 A;  2BWF A;  2MWS B;  3PLU A;  4NY0 A;  1WZ3 A;  4MGK E;  1GJZ A;  2G3Q B;  5DPW A;  3IFW B;  2R2O A;  4W9H A;  2KQ7 A;  1FXT B;  3A9K A;  4ICU A;  2RR9 A;  2OJR A;  3WIM A;  3VUY A;  4JQW C;  1P9D U;  1WX7 A;  2ZVO A;  1V5T A;  2K8C A;  2LVQ A;  2MSE D;  4MSM B;  2IO3 B;  5L95 C;  3EEC A;  4ANX A;  4E74 A;  1V86 A;  1WMH B;  3IHP C;  4PYU A;  2KAN A;  4BKT A;  3A4R A;  2ZNV B;  3APC A;  3CMM B;  2BKF A;  3B0A A;  1KM7 A;  4FN2 A;  1SGH A;  3H6N A;  1BT0 A;  3L16 A;  2DYO A;  4MGZ E;  1IP9 A;  4OVU A;  3ZDT A;  4HLE A;  1J8C A;  5GMV A;  4WJO A;  4A3O A;  1KJT A;  4M8M A;  4KDL B;  1OEY J;  2M8S A;  3M63 B;  2L0T A;  2KC2 A;  3TIX A;  3OAW A;  1KLV A;  1P98 A;  4GXB A;  3OJ4 B;  4WWO A;  4AP4 C;  3ZNG C;  1Y8R C;  2YLM A;  4EFO A;  3L0W B;  2JPH A;  2GOW A;  2FCM A;  2GMI C;  4E71 A;  5DCN A;  4LCD E;  3H9D A;  5DPS A;  2DYM A;  1XD3 B;  3KYC D;  2KDE B;  3N30 A;  1WJ4 A;  4NQL B;  1OGW A;  3KH0 A;  3VHT C;  3IVF A;  2LGX A;  3DVG X;  3HIZ A;  2K6D B;  4AUQ C;  3AI5 A;  3PHX B;  4NNJ B;  3IG3 A;  4IWP A;  2HTH A;  1D3Z A;  3A9J B;  3PRE A;  3L54 A;  2BYF A;  4HPL B;  4KSL C;  2IYD B;  4LJO B;  1UEL A;  1ZKH A;  1WJ6 A;  1ZGU B;  2DZK A;  3APD A;  2LVO A;  3MHS D;  4WQO B;  5JHA A;  2CU1 A;  3WAO A;  4N9F 4;  2DZJ A;  4MGI E;  2CR5 A;  3AU5 A;  5CHW A;  4XZ4 A;  5JH5 C;  3R66 C;  5C23 A;  1UGM A;  3VQI A;  3VAW A;  4GDK A;  1YX5 B;  3PZD A;  1UBI A;  2C7M B;  2NPT A;  4B9K A;  2EKE C;  3QQ8 B;  3MTN B;  4IG7 B;  4CO7 A;  3WAN A;  1E90 A;  2WX1 A;  3RCZ A;  4HVB A;  2NPT B;  5EDS A;  1IPG A;  2L00 B;  2O2V A;  3KYD D;  3M62 B;  2IY1 B;  4IUM B;  2MX2 A;  3QHT A;  3S2A A;  1WIA A;  4ICV A;  4MEM A;  4W9K A;  2AL3 A;  3JW0 X;  5AZG A;  4K81 A;  2N9P C;  3V6E B;  2KN5 A;  4E3C A;  2HJ8 A;  3NS8 A;  3U8Z A;  2C5L C;  3A4S C;  2N1W A;  1WJU A;  3CF6 E;  4GU2 A;  3NOB A;  2AYO B;  4WWN A;  4ANU A;  3TJP A;  3DVN V;  1WRD B;  2GBR A;  2MBO A;  1CMX B;  2ZCC A;  4BBN C;  1IYF A;  2JWZ A;  2ASQ A;  3DBL I;  1WFY A;  4MDK E;  3T8M A;  2D10 A;  2KD0 A;  4RM8 A;  4EZL A;  4WWP A;  1VD2 A;  2KOX A;  3DCG A;  4K7S A;  3HHM A;  2RSU A;  2ZPN A;  3DQV A; 
#chains in the Genus database with same CATH topology
 3CWI A;  4A20 A;  4OZC A;  3R8B A;  2Y5P A;  1WF9 A;  4GN1 A;  2KMA A;  3Q3O C;  3K9P B;  3ZDM C;  1SF0 A;  2MP2 A;  4MSQ B;  3ZLZ A;  3IT4 B;  4F7Z A;  4P1C C;  1FCC C;  1F77 A;  1F2R I;  4JWU C;  5AZH A;  3A33 B;  1MJD A;  2L76 A;  1B9R A;  3ETR A;  3TUO A;  1P1A A;  4GIV A;  3W1S A;  4I6L B;  5D7G A;  1WE6 A;  1WR1 A;  5DPT A;  3ZO5 B;  3KW5 B;  5JZE B;  3KLS X;  4HJG E;  4US9 A;  2XNA C;  1DGJ A;  1N5X A;  1FPY A;  1TS5 A;  3OG5 A;  3ZUN A;  1BXT A;  2QIE B;  5EE3 A;  2R2Q A;  4YL8 A;  3KVF B;  3PTF C;  1EUV B;  2KDB A;  3SD5 A;  1C9F A;  1NYR A;  2XN9 C;  2MW5 A;  2WXL A;  5IO9 A;  1UWM A;  1J0G A;  4OW0 A;  1FD6 A;  4FBJ B;  4N6E B;  2QCZ A;  4AOF A;  2FUG 1;  2D3B A;  4OVV A;  3A9J A;  2VH2 A;  4KGT A;  3MJW A;  3URY A;  3ZJU A;  3PSE B;  4HCP B;  2LJI A;  1R7S A;  3GE3 C;  4ANW A;  2M4N A;  2N4F A;  2FCS A;  2ICI A;  2Z0E B;  4MGY E;  5C3J B;  2I1J A;  4EZJ A;  1WXA A;  2WWZ A;  1ZXH A;  1LXD A;  1TS3 A;  4LNO A;  3RUL A;  2MBH A;  1V6E A;  2VH1 A;  2N7J A;  1C4C A;  1QIL A;  1IBX A;  1YX6 B;  4FJY A;  4AJW A;  2PW9 A;  3LB8 C;  1OQQ A;  4LTU A;  4OZB A;  1VCB A;  3WAM A;  4KDI C;  3VUW A;  2J53 A;  2LJ5 A;  2NR2 A;  3DBR I;  4M8N A;  1WRI A;  4YSY B;  4DK5 A;  1E8X A;  4M02 A;  5KHO A;  1V49 A;  3TEY A;  4MEL A;  2WXQ A;  1YJJ A;  4HXD A;  4LDT D;  1RLF A;  2L7R A;  1J7A A;  3DHG C;  1JRU A;  3DBH I;  4WJP A;  3GE8 C;  3NJT A;  2O6V A;  2BT6 A;  2G4D B;  2WNM A;  5E6P A;  1MPE A;  3ZNZ B;  1ET9 A;  2RPQ A;  4HRS A;  3I9V 1;  5BYQ A;  2KFK B;  1TY0 A;  1Q5W B;  2REX A;  3WAL A;  2WXP A;  2J0K A;  2RDB C;  1TKG A;  3CST A;  2WXJ A;  5LXH A;  5IN7 A;  3P42 A;  3Q8A A;  1EM7 A;  1F52 A;  3HUI A;  2XK5 A;  2WHI A;  2HD5 B;  2D07 B;  2FAZ A;  3AB5 A;  4DBG A;  4BKG A;  4K7U A;  3H8H A;  1SE2 A;  4RNA A;  5D6J B;  2DWQ A;  4G0N B;  4NAW A;  2M56 B;  4HPM B;  3QC8 B;  4K7W A;  1WR6 E;  2JZZ A;  2KDM A;  2YEP F;  3QX1 A;  1I4X A;  1HE8 A;  4K3B A;  2BYV E;  5G2N A;  3UIP B;  4WAF A;  1FIQ A;  1U4A A;  1L4Z B;  4US8 A;  1TS2 A;  1P3Q U;  3GZN B;  1FFV A;  2CHX A;  3P4Q B;  5AZF A;  1T0Q C;  1L0Y B;  4J6I A;  2BPS A;  2GBK A;  1TY2 A;  2KDF B;  4AWJ A;  3H1U A;  1R4M B;  2LZ6 A;  2KT7 A;  2QJL A;  3Q8E A;  3U4E G;  3SU8 X;  3IAS 1;  1UGJ A;  1UWX A;  1MFW A;  2WXI A;  5JHB A;  4OHJ A;  1STE A;  2LGY A;  5EE1 A;  2KQS A;  1RFK A;  4EZK A;  2KHW B;  4HJK A;  1SE4 A;  3ZTD A;  3R7Q A;  1J7C A;  4ZOH C;  2WP9 B;  3ZGZ A;  3PZ8 A;  3ZNI D;  3V3X A;  4KIK A;  2N9X A;  3ZTC A;  2Z0D B;  4HEA 1;  1RAX A;  4RH6 A;  3KUZ A;  2AWT A;  3ZIM A;  3QIJ A;  1OEY A;  1L7Y A;  4BZA A;  2Y3A A;  1YN4 A;  3U30 A;  4TQ0 A;  1QKZ A;  3ZNH B;  3DVN U;  4M00 A;  2WQY B;  3WCQ A;  2IGG A;  2WS3 B;  5C1Z A;  1V81 A;  4CYE A;  1FXI A;  2KO3 A;  2L1A A;  1LGR A;  4IC7 B;  1OTR B;  3RFZ B;  1Z5S B;  4RGT A;  2X38 A;  1JWS D;  3RUI B;  3AE6 B;  3OWE B;  2C7N B;  3BIN A;  2MA9 B;  4KVG B;  4YT0 B;  3ONS A;  5D3D A;  2WYQ A;  2J4X A;  4ZRI A;  3VUX A;  1PGB A;  4JPS A;  2J0M A;  4WAA A;  1PFD A;  1TZ1 A;  3CIR B;  1YD8 U;  2ZZP B;  2CS4 A;  2GLS A;  4MJS A;  5D2M B;  1KOT A;  3R7R A;  1WWT A;  4MH0 E;  2WDT B;  1K52 A;  3R2T A;  1P7F A;  3KUC B;  4JWS C;  2RDH A;  3Q8B A;  1C79 A;  2ONQ A;  4W9H A;  1FXT B;  3A9K A;  2KVZ A;  2RR9 A;  2IND C;  3VUY A;  4JQW C;  2Y5C A;  1WX7 A;  1F2R C;  2ZVO A;  2CJO A;  3EEC A;  3T3O A;  1V86 A;  3IHP C;  5HFY A;  4BKT A;  3KQ4 A;  5TSS A;  3APC A;  1E6E B;  3CMM B;  1V1O A;  2DYO A;  4MGZ E;  1IP9 A;  2VZK B;  1J8C A;  5GMV A;  4PT5 A;  4A3O A;  4M8M A;  4KDL B;  3M63 B;  2TSS A;  3OAW A;  4LNI A;  1VZ8 A;  2CJN A;  3OJ4 B;  2R61 A;  4WWO A;  4BAX A;  3ZNG C;  1Y8R C;  1VR9 A;  3L0W B;  2JPH A;  2YEP B;  5BYS A;  2KWD A;  5DPS A;  3KYC D;  1WJ4 A;  4TMA B;  3VHT C;  3IAM 1;  3IVF A;  4REZ A;  3DVG X;  4O1N A;  4OZA A;  3AI5 A;  3PHX B;  3RI7 C;  3L54 A;  4KSL C;  3AEE B;  4KX6 B;  1ZKH A;  2JX5 A;  2EKI A;  3APD A;  5JHA A;  2CU1 A;  4N9F 4;  1UUP A;  2DZJ A;  4MT5 A;  2WXR A;  2CR5 A;  3AU5 A;  1L6V A;  3RPF C;  3TEW A;  2C7M B;  5BMH A;  4C4V A;  2EKE C;  1PGA A;  3MTN B;  1N5W A;  1RWS A;  1E90 A;  2RDG A;  2NPT B;  5I4D A;  5EDS A;  1IPG A;  2L00 B;  4ICV A;  4MEM A;  4W9K A;  2GB1 A;  4L23 A;  4K81 A;  4E3C A;  3CF6 E;  1I4Q A;  4IKG A;  3U52 E;  1FNV A;  2ZCC A;  2AX5 A;  1XF5 L;  2D10 A;  4EZL A;  4WWP A;  1VD2 A;  1XLQ A;  4K7S A;  1E10 A;  3HHM A;  4FHJ A;  2RSU A;  5CHW A;  2QMT A;  2KMC A;  4WIP A;  1WH3 A;  4R3D A;  1E7V A;  2L05 A;  2BQQ A;  3BYT B;  4DDI D;  4BOZ B;  3N3K B;  3NUH B;  2L83 A;  2KAJ A;  3UI3 A;  4KGS A;  3L13 A;  2K25 A;  1ZP0 B;  3E56 A;  2DZM A;  1V9J A;  3DHH C;  1TT5 B;  1YQB A;  1FNW A;  2CU3 A;  1WMH A;  3ZKJ C;  2RPV A;  2K8B A;  3R2I A;  2FCN A;  2V9H A;  4P7I A;  1Q0W B;  3IT6 B;  3MFG A;  3QA8 A;  2LGI A;  1E8W A;  2G1E A;  3O65 B;  1N6Z A;  3RNC C;  2KX0 A;  4BKS D;  2OJW A;  4GGQ A;  5HI1 A;  4BFR A;  3C8Y A;  3W5V B;  3JSV B;  4BOS C;  4RFB A;  3NZU A;  3UQB A;  2BS4 B;  4B6W A;  3BII D;  2OED A;  4PS7 A;  2FID A;  4HDO A;  4RF0 A;  1EU3 A;  2DYB A;  4G11 A;  4GMV A;  2GBN A;  2WX0 A;  3NVZ A;  4G50 A;  1EWC A;  3FAH A;  3Q14 C;  1MG4 A;  1AAR A;  2I2Y A;  2MBQ A;  1HA5 A;  1OQY A;  1WGD A;  2ZNV C;  3W1S C;  4W9E A;  4X57 B;  3MC8 A;  3IBE A;  2KWV B;  3FKY A;  4TKN A;  2DX5 B;  2M17 A;  3PRM B;  2LGD A;  1Z2M A;  4XGA B;  1DOX A;  4JE3 B;  1WZ0 A;  2UYZ B;  3AEC B;  4MH8 A;  4AJY B;  2KJ6 A;  1YIW A;  2WXK A;  2D3G A;  4FJZ A;  1L0X B;  5J17 A;  2DNF A;  2INP E;  3HK0 A;  1F1H A;  4RGM A;  2QEJ C;  2INN E;  1WYW B;  4RF1 A;  1F9J A;  1X1M A;  1GC7 A;  2LRW A;  2JY6 A;  2V3N A;  3ZXV A;  1TYG B;  4USA A;  3PRP B;  1RYJ A;  3MHZ A;  4XDD A;  4IM3 A;  1PUT A;  3BWU D;  3AN1 A;  2BB5 A;  2K8H A;  4P6V F;  3RNG C;  2V3S A;  2JRI B;  4W9L A;  2ZCB A;  2W3S A;  2BB6 A;  1T5X D;  3A1Q B;  3N9Y C;  1WE7 A;  2LUE A;  2DBY A;  5HG2 A;  4JLC A;  4KZC A;  3RNB C;  2NBW B;  5G5H A;  2KNB A;  1OQR A;  4C7Z A;  1C4P A;  1Q10 A;  3PO0 A;  1N63 A;  3B2G A;  2JT4 B;  1ET6 A;  3DPD A;  4P16 A;  3DVG Y;  1TTN A;  2KTR A;  1AYF A;  1NEK B;  4EEW A;  4NJ6 A;  4ZRP A;  4H2A A;  1YN3 A;  1LM8 B;  5H8Y E;  4BBN F;  3H7P B;  1HEZ E;  4C80 A;  4W9I A;  2K0P A;  1V2Y A;  3P1M A;  5TR5 A;  4B95 A;  1GPX A;  1WX8 A;  5IKC M;  1I4R A;  2HJ1 A;  4ZRJ A;  4GDL A;  1GC6 A;  1C4A A;  2WXM A;  4K3C A;  2LEK A;  1SE9 A;  2PTL A;  1L4D B;  3OJ3 A;  3V6C B;  3L17 A;  2MHJ A;  2W3R A;  3DBR B;  3GOE A;  2IDY A;  1NYQ A;  3PV1 A;  3Q8C A;  5IA7 A;  5LLI A;  2HE7 A;  2KYW A;  5CX3 A;  4XWW A;  3Q2A C;  3MJ5 A;  1JWA D;  1LFD A;  3DBH B;  4KKJ A;  4YTM B;  4ASW C;  1SSN A;  4KV2 A;  3W5U B;  3RNA C;  3AE2 B;  5T8I A;  2NCN A;  2L3Z A;  1WGY A;  2DEN B;  4HK2 A;  3Q8F A;  3DOW A;  3AMZ A;  5J18 A;  3V05 A;  4IWQ A;  1TZO A;  2AQ3 B;  2JF5 A;  4ZRK A;  3T9L A;  3U7Z A;  2DHZ A;  1ZE3 D;  4DHJ B;  2LXA A;  2FUH B;  2LD9 A;  1WGK A;  4ARI A;  3ABV B;  1FFU A;  3H7S A;  3EGR A;  1E8Y A;  1JWB D;  2CHZ A;  4PS8 A;  2RGF A;  3FC4 A;  2XEW A;  2JWU A;  3IXS A;  2IPK D;  4C7Y A;  3SR6 A;  5E6N A;  1TGZ B;  3ZW3 A;  1AN8 A;  2GRI A;  3APF A;  3BVG A;  1GOZ A;  4S0R A;  3SHQ A;  3BVM A;  4WWM A;  1T3Q A;  3V60 A;  2QDF A;  4BKS A;  2ACZ B;  2M1M A;  3JVZ X;  4KKI A;  4P1B C;  2KXJ A;  4G3X B;  3Q69 A;  1K53 A;  1YQ4 B;  3ML8 A;  1SB3 C;  1WGR A;  2AL6 A;  2BWF A;  3PLU A;  1GJZ A;  2G3Q B;  4HPP A;  3IFW B;  4ICU A;  2WXN A;  4L2Y A;  1P9D U;  2K8C A;  4YSZ B;  4E74 A;  4PYU A;  4A8X C;  3A4R A;  2ZNV B;  1FRD A;  2BVC A;  3FIL B;  2BKF A;  3B0A A;  1KTK A;  1KM7 A;  4FN2 A;  4FXC A;  4N58 A;  2J52 A;  1VZ7 A;  3ZDT A;  4WJO A;  4YWG G;  1KJT A;  1OEY J;  2L0T A;  3TIX A;  2BTE A;  1DYQ A;  2SAK A;  1P98 A;  4AP4 C;  3AE4 B;  3SFD B;  4E71 A;  4LCD E;  3H9D A;  2DYM A;  3U2S C;  3N30 A;  3KH0 A;  5G5G A;  2WXF A;  4Q2J A;  2K6D B;  3TEZ A;  4NNJ B;  1JW9 D;  2HTH A;  1D3Z A;  3A9J B;  3PRE A;  1PGX A;  2GI9 A;  4JX1 C;  4LNF A;  1ZGU B;  2DZK A;  3MHS D;  3MC9 A;  1HZ6 A;  4XZ4 A;  5C23 A;  1UGM A;  4GDK A;  3AV8 A;  2IGH A;  1YX5 B;  3PZD A;  3Q6B A;  2NPT A;  1NEN B;  3B2F A;  3QQ8 B;  2LFI A;  4CO7 A;  1IBX B;  2AQ2 B;  4WUR A;  2O2V A;  4IUM B;  1I4G A;  3C19 A;  3QHT A;  4NZL B;  3JW0 X;  5AZG A;  2N9P C;  2HJ8 A;  3NS8 A;  2WLB A;  3A4S C;  4GU2 A;  2AYO B;  4ANU A;  3TJP A;  3DVN V;  2GBR A;  1CMX B;  1QF6 A;  3Q3M C;  1WFY A;  3I63 C;  4RM8 A;  2KD0 A;  2G9H D;  1V1P A;  4J3O D;  2SEB D;  3BYY B;  4NJC A;  2O6V B;  2D5G A;  3VH4 B;  1ZOY B;  1M4V A;  5G55 A;  5CHF A;  5J2R A;  4MAC A;  1MVK A;  2Q5W D;  1HZ5 A;  1JAL A;  2ZW1 A;  3VRB B;  1IGD A;  1FEH A;  4M0W B;  4UDU C;  1WI0 A;  4HDQ A;  5EE0 A;  2Z59 B;  1WSP A;  3NY5 A;  1ZUD 2;  2XK5 B;  5BMG A;  2LVP A;  3LYY A;  1VZ6 A;  4RMA A;  2KLC A;  2CKH B;  1WM3 A;  2NS5 A;  4ITK A;  4CHK A;  1UF0 A;  3LXF A;  1EF5 A;  5IP4 D;  3PS6 A;  4IM2 A;  4NAW B;  1N61 A;  2HDE A;  4RCO A;  3DBS A;  2KKC A;  1HQR D;  3RT3 B;  3T3N A;  2PVO D;  1YOV B;  1N60 A;  2BKR B;  3W1Y A;  3BK1 A;  2LXC A;  2W54 A;  4JL9 A;  3EFC A;  1S1Q B;  1E5W A;  2N1V A;  2JXT A;  1UBQ A;  1JML A;  3QWZ B;  3QAQ A;  4HWI B;  2NMQ A;  3PT2 B;  4BVU C;  4K1R B;  3QJZ A;  4GOC A;  4C56 C;  4DHZ B;  3KWV A;  3QAR A;  1C77 A;  2KFJ A;  1PQS A;  1MHH E;  3NS1 A;  2L0F A;  1ESF A;  1D6E C;  1HTO A;  1WGH A;  3ZQ4 A;  3V61 A;  2IBI B;  3JYU A;  3K9O B;  4FA6 A;  3V62 A;  4TQ1 A;  2W9N A;  1WM2 A;  2PLP A;  3ECI A;  4DDG D;  1L5P A;  5AEK B;  2LHD A;  3PHW B;  2IJ0 A;  2V4I B;  1CZP A;  4KIK B;  5EE9 A;  3QCA A;  5MPO A;  4HKZ E;  2C9W B;  2V0G A;  4KZ0 A;  1E7U A;  1WJN A;  5E6J A;  2EMS A;  3Q3F A;  2NTT A;  3PZ7 A;  4JGH B;  1ROE A;  4IOI E;  5H92 C;  5FR6 A;  2JVC A;  3GP7 A;  1V97 A;  2I1K A;  2NVU I;  1K8R B;  1EO6 A;  2A4Z A;  2FE8 A;  1FNU A;  3U7D A;  3AH7 A;  4L1B A;  3VXW A;  1WXV A;  2EMT A;  2ZJD A;  3MC0 B;  1VLB A;  1WYG A;  4IWO A;  1RFA A;  3VTU A;  1J7B A;  2CHW A;  2JRH A;  3CSF A;  2NBU A;  4XDC A;  1VJK A;  3VH3 B;  2E6X A;  3UF8 A;  2M0X A;  4DWF A;  1E0Z A;  4EUT A;  3AE7 B;  1YNT E;  2K5P A;  1GG3 A;  5BO4 B;  4F1S A;  1P0R A;  2KTF A;  2BWE S;  3R3M A;  2KK8 A;  2PPH A;  3SDL C;  3B08 A;  4CQN A;  3D32 A;  2DAJ A;  4I6P A;  4FLH A;  2KN4 A;  2LWP A;  1H4R A;  2IO0 B;  2L8J A;  3RZW C;  3H7P A;  2LAS A;  1AWD A;  4NJ7 A;  2GBM A;  1XCT L;  1EF1 A;  3EC8 A;  4RGN A;  3HM3 A;  4C00 A;  1GNU A;  5L83 A;  1SBB B;  4GSW A;  3A9K B;  4PK1 A;  1M94 A;  3N1Y C;  4A3P A;  2L52 A;  4URK A;  1EWY C;  3PPA A;  3HVD A;  3TBL D;  2MJ3 A;  2BYE A;  2VZK D;  3ZRF A;  3NRZ A;  5GXG B;  2JZP A;  3HM6 X;  1FXA A;  2FNJ B;  1GB4 A;  5D94 A;  4EE2 A;  5C2T B;  5LXI B;  1IUE A;  2KLG A;  2WU5 B;  1KLG D;  2WXH A;  1DOY A;  4TUU A;  1T0Y A;  2MCN B;  3PVL A;  3ML9 A;  4NAM A;  5BYR A;  2WDR B;  1L6U A;  3P4P B;  2PVG C;  4ZHP A;  3RNE C;  3RMK C;  3PGE A;  4ACF A;  1ENF A;  1I7H A;  3AU4 A;  1ZDX A;  2J0J A;  4GB9 A;  4LDT B;  1ZXI A;  3KWL A;  1XLN A;  1FCL A;  3C0R B;  4IM0 A;  3PLV A;  3AE1 B;  3I3T B;  3X23 A;  2KFK A;  3AE5 B;  1KLU D;  3DDC B;  1E8Z A;  5IAA C;  3VR9 B;  4C4V B;  4MM3 B;  2PE6 B;  4FJV B;  2K22 A;  4F8C B;  2KDI A;  2WGS A;  1WGG A;  2LI5 A;  3NG0 A;  3UGB B;  1CQV A;  5FK9 C;  2PEA A;  3LDZ E;  1FRR A;  2ON8 A;  2M0A A;  2UU7 A;  1JRO A;  4DXG A;  1I35 A;  1KFY B;  2JXX A;  3HRD D;  1JWU D;  2B3A A;  5FR3 A;  2MLB A;  1VRA B;  3N1Z C;  2QIL A;  4FHK A;  2K6Q A;  2EEL A;  1T0S C;  2BGF A;  3ZYY X;  2D3C A;  3AEF B;  2LRU A;  2KZR A;  1XLP A;  2GBJ A;  1FMA D;  4DXA B;  2C7H A;  2JU6 X;  3VTW A;  4KSK C;  4W9D A;  1D5X C;  2MWS B;  4NY0 A;  1WZ3 A;  4MGK E;  5DPW A;  2KQ7 A;  1L0V B;  4D2K A;  3EUB 2;  2OJR A;  3WIM A;  2MSE D;  3FIL A;  2IO3 B;  3P4R B;  1TIF A;  1WMH B;  2KAN A;  3DHI C;  3RNF C;  3SFE B;  4OVZ A;  3H6N A;  1BT0 A;  2D3A A;  3L16 A;  4OVU A;  4HLE A;  2M8S A;  2KC2 A;  1KLV A;  4N59 A;  2YLM A;  4EFO A;  1WXQ A;  2GOW A;  2N9K A;  2HTM E;  4B0E A;  2I38 A;  1KRH A;  2KDE B;  1OGW A;  2LGX A;  3HIZ A;  2L32 A;  3IG3 A;  3E9S A;  1LO5 D;  2BYF A;  3AM9 A;  1XEE A;  1WJ6 A;  4WQO B;  1JWM D;  4MGI E;  5JH5 C;  1T0R C;  3VAW A;  2Z8L A;  2K3U A;  4B9K A;  1XLO A;  2NTS A;  4TSS A;  2WX1 A;  3RCZ A;  4HVB A;  1I4H A;  1NI3 A;  3M62 B;  2IY1 B;  2MX2 A;  4DXF A;  2KN5 A;  1PYW D;  3DBL B;  3NOB A;  1IYF A;  2ASQ A;  3DBL I;  3N20 C;  4MDK E;  2KAC A;  5CHV C;  2JQR B;  4IDI A;  3X0W A;  4IW0 A;  4II3 B;  1YJ1 A;  3NVW A;  1XT9 B;  2PE9 A;  4ZYS A;  3NVY A;  3VDZ A;  2OOB B;  3N1X C;  4M0W A;  1OFF A;  4YTN B;  5HHD G;  2W82 A;  4PYZ A;  2K1F A;  4FUL A;  2KVR A;  4RGO S;  4XC2 A;  4AS1 A;  2W55 A;  1NBF C;  3B1L X;  3AE3 B;  1J19 A;  1UD7 A;  3UIO B;  2N9L A;  1A70 A;  2MP2 B;  4EKU A;  2AQ1 B;  4ZDV A;  3GB1 A;  3AEA B;  2LGS A;  1D5M C;  2MRP A;  1UNS A;  3NVV A;  2KQ4 X;  3WAP A;  5HKH A;  3L08 A;  4EOY A;  4WJN A;  4A90 A;  2G4S A;  4B0M A;  3KUD B;  1A5R A;  1NVI D;  4DQO C;  1S3S G;  4ANV A;  2VRR B;  3NZ3 A;  1CJE A;  3UQA A;  3I5J C;  2RD0 A;  3EFU A;  1LQB A;  1WY8 A;  1XQQ A;  3DWG C;  5FKA C;  2YVC A;  3GZN I;  1H8C A;  1V80 A;  2INC C;  2WXG A;  3AEB B;  2KJR A;  2KTR B;  1JQ4 A;  2ZVN A;  2IZV B;  2QSD A;  1Y56 A;  2J42 A;  1EU4 A;  1MG8 A;  1G6J A;  1P7E A;  2V1Y A;  1CK1 A;  1R4M I;  4FAD A;  4JIO U;  3DWM A;  2PJH A;  1TBE A;  4LNK A;  3M95 A;  2BF8 B;  4GDL B;  5AUK A;  3ZJV A;  3BZD B;  2BS3 B;  1K50 A;  4HCN B;  3RZF A;  3AUL A;  1GB1 A;  5DPR A;  3BY4 B;  3VFK A;  2E3T A;  4LNN A;  1KH0 A;  3TL5 A;  3TSS A;  2D11 A;  1QT9 A;  2H88 B;  5KHQ A;  2K9X A;  1D5Z C;  5IOI A;  1L2N A;  4LLG M;  3L10 B;  1JRP A;  1MI0 A;  4LJP B;  2WU2 B;  4HRO A;  4A55 A;  1C3T A;  1HTQ A;  4W9J A;  3NHE B;  1UH6 A;  2IGD A;  3RYT A;  3SEB A;  5E6O A;  1AW7 A;  1MHX A;  1SIF A;  3PRZ A;  3ZXR A;  2C60 A;  1IGC A;  1TS4 A;  3BVZ A;  3RD2 A;  5AUI A;  1FM0 D;  4ZHO A;  2DZI A;  5CTR C;  3GS2 A;  4DHJ D;  3W2D A;  2IO2 B;  3ALB A;  4WJQ A;  3HVZ A;  1HXY D;  1T6B X;  4S17 A;  2JSV X;  2N0S B;  1TKY A;  1SEB D;  1D4B A;  3B9J A;  1BML C;  4NPN A;  3O13 A;  1QOG A;  2ZEQ A;  1WXS A;  2MJE A;  3BK2 A;  1GAQ B;  1ACC A;  2RMM A;  1K51 A;  3Q3J A;  4A6Q A;  1RRB A;  3TEX A;  1KF6 B;  3AEG B;  4TV3 A;  3JSV A;  4M01 A;  4GLS C;  4ARC A;  2N7D A;  1XCQ L;  1C78 A;  1C1Y B;  2JUO A;  4W9G A;  3VR8 B;  2KX3 A;  3OLM D;  3AE8 B;  2QC8 A;  3P63 A;  2MJD A;  3EA6 A;  2B76 B;  4W9C A;  1ZPS A;  3ENE A;  3AXC A;  3Q3N C;  2MQJ A;  1R4N B;  1V5O A;  4HKQ A;  1XO3 A;  2N7E A;  1R4N I;  1UZX B;  2FIF A;  2QHO A;  1NDD A;  2WDQ B;  3VTV A;  2G45 B;  2KC1 A;  3TCA A;  2D2Q A;  3N32 A;  2KWU B;  2X8X X;  4YXD B;  5BMI A;  2OHF A;  4II2 B;  1RM6 C;  2J7Q B;  2LUM A;  4W9F A;  4XX5 A;  3TMP B;  1PDX A;  3I57 A;  4LK0 M;  2V4L A;  1Q1O A;  1N62 A;  3M3J A;  2MBB B;  4DHZ E;  3L4P A;  1WX9 A;  2JYT A;  1JCK B;  2FCQ A;  1GUA B;  2IO1 B;  3QK0 A;  2XBB C;  2DAF A;  2BW2 A;  3WA0 A;  2M19 A;  1YJI A;  1ISN A;  1QOB A;  2KJH B;  1TKE A;  4MM3 A;  2Y5B B;  1I42 A;  1SE3 A;  4GDK B;  4ZYN A;  4WH4 A;  3RN9 C;  3LJ3 A;  4PS3 A;  3ZVV A;  4RM9 A;  2MBE A;  4NQK E;  4XE0 A;  3UIN B;  1QZE A;  2KWC A;  1XXG A;  2JZ3 B;  1WXM A;  2IY0 B;  2UWQ A;  3A1Q A;  5JXV A;  3J9C A;  2AEH A;  1B1Z A;  2O2V B;  1FO4 A;  2K39 A;  2ZW0 A;  1SJH D;  2A5U A;  1V8C A;  3VVW B;  5LNK 1;  2N9E B;  3ZRC A;  3P2B A;  2PIA A;  3EHV A;  2O6V D;  1ZW7 A;  2NBV B;  2ZPY A;  1V1P B;  2WXO A;  2BYT A;  1DOI A;  1NI2 A;  3NZS A;  4YSX B;  4I6N B;  2LMC A;  4MJS B;  2R2O A;  2LHE A;  3P4S B;  1I4P A;  1BUI C;  3AED B;  1SIJ A;  1V5T A;  2LVQ A;  4MSM B;  5L95 C;  4ANX A;  1C76 A;  1SJE D;  1E9M A;  1YMH E;  1F0Z A;  1SGH A;  2MH7 A;  2DLB A;  1QQR A;  4XYC A;  1YQ3 B;  4YTP B;  4GXB A;  2WDV B;  2PMV A;  5D3I B;  2FCM A;  2GMI C;  5DCN A;  2H89 B;  1XD3 B;  2V3P A;  4NQL B;  3VRA B;  4XWT A;  3MP9 A;  4AUQ C;  4IWP A;  4AQ7 A;  4HPL B;  2IYD B;  4LJO B;  1UEL A;  2LVO A;  3WAO A;  2KMM A;  1QOA A;  2PKO A;  3R66 C;  3VQI A;  1ZDV A;  2BS2 B;  1UBI A;  3ZJT A;  1QLB B;  1E7P B;  2JYE A;  4KGR A;  4IG7 B;  1TJE A;  3W9C B;  3WAN A;  1QOF A;  1VDV A;  2BBC A;  3KYD D;  3S2A A;  1WIA A;  2AL3 A;  3V6E B;  2MEK A;  3U8Z A;  2C5L C;  2N1W A;  1WJU A;  4WWN A;  4ZRQ A;  1YN5 A;  2FBW B;  1WRD B;  2MBO A;  4BBN C;  2JWZ A;  3T8M A;  1SXT A;  4WQM A;  2KOX A;  3DCG A;  4QAY A;  3AE9 B;  4A9A A;  2ZPN A;  3DQV A; 
#chains in the Genus database with same CATH homology
 2O6V B;  3VH4 B;  5CHV C;  2KMC A;  4A20 A;  1WH3 A;  1WF9 A;  5G55 A;  4GN1 A;  3X0W A;  4IW0 A;  1E7V A;  2KMA A;  1YJ1 A;  3K9P B;  4II3 B;  1XT9 B;  2PE9 A;  2L05 A;  5CHF A;  5J2R A;  4FHJ A;  3VDZ A;  3ZDM C;  2OOB B;  4DDI D;  4BOZ B;  3N3K B;  2MP2 A;  4MSQ B;  3ZLZ A;  3L13 A;  4PYZ A;  2K1F A;  4FUL A;  4F7Z A;  2K25 A;  2KVR A;  4XC2 A;  2DZM A;  1V9J A;  1NBF C;  3B1L X;  4M0W B;  1YQB A;  1J19 A;  1WI0 A;  4HDQ A;  5AZH A;  1UD7 A;  3UIO B;  4EKU A;  2MP2 B;  2Z59 B;  3A33 B;  3NY5 A;  1WMH A;  2L76 A;  3ZKJ C;  4ZDV A;  2XK5 B;  2K8B A;  2MRP A;  1P1A A;  2LVP A;  2FCN A;  4GIV A;  4RMA A;  3W1S A;  2KLC A;  3WAP A;  5HKH A;  3L08 A;  4I6L B;  5D7G A;  4EOY A;  1WE6 A;  1WR1 A;  4P7I A;  4WJN A;  1Q0W B;  2CKH B;  5DPT A;  2G4S A;  3ZO5 B;  3KW5 B;  3QA8 A;  1WM3 A;  2NS5 A;  5JZE B;  1E8W A;  4CHK A;  3O65 B;  3KUD B;  1A5R A;  1EF5 A;  1S3S G;  2KX0 A;  3PS6 A;  4IM2 A;  4NAW B;  4BKS D;  4ANV A;  2VRR B;  4GGQ A;  3UQA A;  3ZUN A;  3DBS A;  4BFR A;  2KKC A;  2R2Q A;  2RD0 A;  4YL8 A;  3EFU A;  3KVF B;  1LQB A;  3PTF C;  3JSV B;  1EUV B;  1WY8 A;  1XQQ A;  2KDB A;  3SD5 A;  4BOS C;  3RT3 B;  3NZU A;  3UQB A;  2YVC A;  3GZN I;  1H8C A;  2BKR B;  3W1Y A;  1V80 A;  2MW5 A;  4B6W A;  1J0G A;  2LXC A;  4FBJ B;  2KJR A;  2KTR B;  4JL9 A;  4PS7 A;  4AOF A;  1S1Q B;  2FID A;  2IZV B;  2ZVN A;  4HDO A;  1E5W A;  2N1V A;  4G11 A;  2DYB A;  4OVV A;  3A9J A;  4GMV A;  1MG8 A;  1G6J A;  3QWZ B;  1UBQ A;  2V1Y A;  2GBN A;  3QAQ A;  3MJW A;  3PT2 B;  4HWI B;  4BVU C;  2WX0 A;  1R4M I;  4FAD A;  3PSE B;  4HCP B;  4K1R B;  4G50 A;  4JIO U;  3QJZ A;  2PJH A;  4GOC A;  4ANW A;  2M4N A;  4DHZ B;  1TBE A;  2N4F A;  3QAR A;  1AAR A;  2FCS A;  2KFJ A;  2MBQ A;  2Z0E B;  3M95 A;  4MGY E;  1PQS A;  2BF8 B;  2I1J A;  4EZJ A;  4GDL B;  1OQY A;  1WGD A;  2ZNV C;  2L0F A;  1WXA A;  2WWZ A;  3W1S C;  1LXD A;  4W9E A;  1WGH A;  4X57 B;  4HCN B;  3V61 A;  2IBI B;  2MBH A;  3AUL A;  3JYU A;  1V6E A;  3K9O B;  3RUL A;  4TQ1 A;  3RZF A;  3V62 A;  4FA6 A;  5DPR A;  2W9N A;  3BY4 B;  3VFK A;  1YX6 B;  3IBE A;  1WM2 A;  2KWV B;  3TL5 A;  4TKN A;  4FJY A;  2DX5 B;  4AJW A;  2M17 A;  3PRM B;  1VCB A;  3WAM A;  4KDI C;  3VUW A;  2LGD A;  2D11 A;  2LJ5 A;  1Z2M A;  3ECI A;  4DDG D;  5AEK B;  2NR2 A;  5KHQ A;  3DBR I;  3PHW B;  1WZ0 A;  2UYZ B;  4M8N A;  4AJY B;  2KJ6 A;  4KIK B;  1YIW A;  1L2N A;  3L10 B;  4DK5 A;  1E8X A;  3QCA A;  2D3G A;  4LJP B;  4FJZ A;  2C9W B;  5J17 A;  5KHO A;  1V49 A;  4KZ0 A;  3HK0 A;  4MEL A;  1E7U A;  4HXD A;  1WJN A;  4LDT D;  1C3T A;  1RLF A;  2EMS A;  2L7R A;  3Q3F A;  4W9J A;  3NHE B;  1UH6 A;  3RYT A;  1JRU A;  4JGH B;  5E6O A;  1WYW B;  3DBH I;  1F9J A;  4WJP A;  1X1M A;  1GC7 A;  2LRW A;  5FR6 A;  2O6V A;  2JVC A;  1SIF A;  2JY6 A;  2I1K A;  2NVU I;  3PRZ A;  2G4D B;  2C60 A;  5E6P A;  1K8R B;  1EO6 A;  3PRP B;  2A4Z A;  3ZNZ B;  3U7D A;  2RPQ A;  3RD2 A;  4IM3 A;  2KFK B;  1Q5W B;  2DZI A;  5CTR C;  2REX A;  3WAL A;  2J0K A;  3VXW A;  4DHJ D;  1WXV A;  2K8H A;  2IO2 B;  3ALB A;  2EMT A;  4WJQ A;  2ZJD A;  3CST A;  4IWO A;  5LXH A;  2V3S A;  1RFA A;  2JRI B;  4W9L A;  3VTU A;  2ZCB A;  2CHW A;  2JRH A;  3CSF A;  2NBU A;  2XK5 A;  3A1Q B;  3VH3 B;  3UF8 A;  1WE7 A;  2HD5 B;  2LUE A;  2M0X A;  2D07 B;  2FAZ A;  4DWF A;  4EUT A;  4DBG A;  4NPN A;  4BKG A;  2ZEQ A;  4JLC A;  4KZC A;  1WXS A;  4K7U A;  1GG3 A;  5BO4 B;  4F1S A;  1P0R A;  2KTF A;  5D6J B;  2NBW B;  4G0N B;  4NAW A;  2KNB A;  3Q3J A;  4HPM B;  1RRB A;  2BWE S;  3QC8 B;  4K7W A;  1WR6 E;  3R3M A;  2JZZ A;  2KK8 A;  2PPH A;  4TV3 A;  3SDL C;  3B08 A;  2JT4 B;  3JSV A;  3QX1 A;  1HE8 A;  3D32 A;  3UIP B;  2BYV E;  5G2N A;  2N7D A;  2DAJ A;  3DPD A;  4FLH A;  4I6P A;  1C1Y B;  3DVG Y;  2JUO A;  4W9G A;  1U4A A;  2LWP A;  1P3Q U;  2KX3 A;  1H4R A;  1TTN A;  2IO0 B;  3OLM D;  2L8J A;  3RZW C;  2KTR A;  3H7P A;  4EEW A;  2LAS A;  4NJ6 A;  4NJ7 A;  2GBM A;  2CHX A;  1EF1 A;  3EC8 A;  4W9C A;  5AZF A;  3HM3 A;  1LM8 B;  1GNU A;  5L83 A;  3ENE A;  4GSW A;  4J6I A;  2BPS A;  3A9K B;  4BBN F;  2GBK A;  3H7P B;  3AXC A;  1M94 A;  2KDF B;  4AWJ A;  4W9I A;  1V2Y A;  5TR5 A;  3H1U A;  4B95 A;  2MQJ A;  4A3P A;  1WX8 A;  2LZ6 A;  1V5O A;  4URK A;  3PPA A;  3TBL D;  2BYE A;  3VTW A;  4ZRJ A;  3ZRF A;  2N7E A;  4GDL A;  3SU8 X;  1R4N I;  3HM6 X;  1UZX B;  1GC6 A;  2FIF A;  2QHO A;  1NDD A;  2FNJ B;  3VTV A;  5D94 A;  5JHB A;  5LXI B;  2LGY A;  2G45 B;  2KC1 A;  1SE9 A;  2D2Q A;  2KQS A;  3N32 A;  3TCA A;  2KWU B;  2KLG A;  4EZK A;  2KHW B;  4HJK A;  4II2 B;  2J7Q B;  4XX5 A;  4W9F A;  3ZTD A;  3OJ3 A;  3R7Q A;  3TMP B;  3V6C B;  4TUU A;  3L17 A;  3ZNI D;  2V4L A;  4KIK A;  2N9X A;  3ZTC A;  3GOE A;  1T0Y A;  2MCN B;  3PVL A;  3ML9 A;  1Q1O A;  2Z0D B;  3M3J A;  2MBB B;  4DHZ E;  1WX9 A;  3PV1 A;  1RAX A;  3KUZ A;  5IA7 A;  2AWT A;  3ZIM A;  5LLI A;  3QIJ A;  2HE7 A;  1OEY A;  2FCQ A;  1L7Y A;  5CX3 A;  1GUA B;  2IO1 B;  3U30 A;  3QK0 A;  4TQ0 A;  2XBB C;  3PGE A;  2DAF A;  3WA0 A;  3ZNH B;  3AU4 A;  1LFD A;  3DVN U;  1ISN A;  2J0J A;  4GB9 A;  4ASW C;  4LDT B;  3C0R B;  2KJH B;  4KV2 A;  4MM3 A;  4IM0 A;  3PLV A;  5C1Z A;  1V81 A;  3I3T B;  3X23 A;  2NCN A;  4CYE A;  2KFK A;  2Y5B B;  2KO3 A;  4IC7 B;  1I42 A;  2L3Z A;  1OTR B;  1WGY A;  3DDC B;  2DEN B;  4HK2 A;  1E8Z A;  1Z5S B;  4GDK B;  4ZYN A;  5IAA C;  3LJ3 A;  4PS3 A;  3DOW A;  3ZVV A;  2PE6 B;  5J18 A;  4RM9 A;  4FJV B;  2MBE A;  4NQK E;  4IWQ A;  3RUI B;  3UIN B;  1QZE A;  2JF5 A;  4ZRK A;  3T9L A;  2C7N B;  2KWC A;  2JZ3 B;  4F8C B;  1WXM A;  2DHZ A;  2IY0 B;  2UWQ A;  3A1Q A;  2KDI A;  3BIN A;  2AEH A;  1WGG A;  4DHJ B;  2LXA A;  2FUH B;  2LD9 A;  2LI5 A;  2MA9 B;  2O2V B;  3H7S A;  2K39 A;  3UGB B;  1E8Y A;  2CHZ A;  2A5U A;  2PEA A;  3LDZ E;  3ONS A;  4KVG B;  2WYQ A;  4PS8 A;  3VVW B;  2RGF A;  2XEW A;  1I35 A;  2N9E B;  2JXX A;  3ZRC A;  3P2B A;  5E6N A;  4ZRI A;  3EHV A;  3VUX A;  2B3A A;  2O6V D;  1ZW7 A;  2MLB A;  1TGZ B;  3ZW3 A;  3APF A;  2J0M A;  4WAA A;  4FHK A;  3SHQ A;  2K6Q A;  1TZ1 A;  2BGF A;  2NBV B;  2ZPY A;  1YD8 U;  2ZZP B;  2CS4 A;  4MJS A;  5D2M B;  3V60 A;  4BKS A;  2LRU A;  2M1M A;  2KZR A;  3JVZ X;  1KOT A;  2GBJ A;  2KXJ A;  4G3X B;  3R7R A;  4MH0 E;  2WDT B;  1NI2 A;  4DXA B;  3ML8 A;  2C7H A;  3NZS A;  4I6N B;  1WGR A;  4KSK C;  4W9D A;  4MJS B;  3KUC B;  2AL6 A;  2BWF A;  2MWS B;  3PLU A;  4NY0 A;  1WZ3 A;  4MGK E;  1GJZ A;  2G3Q B;  5DPW A;  3IFW B;  2R2O A;  4W9H A;  2KQ7 A;  1FXT B;  3A9K A;  4ICU A;  2RR9 A;  2OJR A;  3WIM A;  3VUY A;  4JQW C;  1P9D U;  1WX7 A;  2ZVO A;  1V5T A;  2K8C A;  2LVQ A;  2MSE D;  4MSM B;  2IO3 B;  5L95 C;  3EEC A;  4ANX A;  4E74 A;  1V86 A;  1WMH B;  3IHP C;  4PYU A;  2KAN A;  4BKT A;  3A4R A;  2ZNV B;  3APC A;  3CMM B;  2BKF A;  3B0A A;  1KM7 A;  4FN2 A;  1SGH A;  3H6N A;  1BT0 A;  3L16 A;  2DYO A;  4MGZ E;  1IP9 A;  4OVU A;  3ZDT A;  4HLE A;  1J8C A;  5GMV A;  4WJO A;  4A3O A;  1KJT A;  4M8M A;  4KDL B;  1OEY J;  2M8S A;  3M63 B;  2L0T A;  2KC2 A;  3TIX A;  3OAW A;  1KLV A;  1P98 A;  4GXB A;  3OJ4 B;  4WWO A;  4AP4 C;  3ZNG C;  1Y8R C;  2YLM A;  4EFO A;  3L0W B;  2JPH A;  2GOW A;  2FCM A;  2GMI C;  4E71 A;  5DCN A;  4LCD E;  3H9D A;  5DPS A;  2DYM A;  1XD3 B;  3KYC D;  2KDE B;  3N30 A;  1WJ4 A;  4NQL B;  1OGW A;  3KH0 A;  3VHT C;  3IVF A;  2LGX A;  3DVG X;  3HIZ A;  2K6D B;  4AUQ C;  3AI5 A;  3PHX B;  4NNJ B;  3IG3 A;  4IWP A;  2HTH A;  1D3Z A;  3A9J B;  3PRE A;  3L54 A;  2BYF A;  4HPL B;  4KSL C;  2IYD B;  4LJO B;  1UEL A;  1ZKH A;  1WJ6 A;  1ZGU B;  2DZK A;  3APD A;  2LVO A;  3MHS D;  4WQO B;  5JHA A;  2CU1 A;  3WAO A;  4N9F 4;  2DZJ A;  4MGI E;  2CR5 A;  3AU5 A;  5CHW A;  4XZ4 A;  5JH5 C;  3R66 C;  5C23 A;  1UGM A;  3VQI A;  3VAW A;  4GDK A;  1YX5 B;  3PZD A;  1UBI A;  2C7M B;  2NPT A;  4B9K A;  2EKE C;  3QQ8 B;  3MTN B;  4IG7 B;  4CO7 A;  3WAN A;  1E90 A;  2WX1 A;  3RCZ A;  4HVB A;  2NPT B;  5EDS A;  1IPG A;  2L00 B;  2O2V A;  3KYD D;  3M62 B;  2IY1 B;  4IUM B;  2MX2 A;  3QHT A;  3S2A A;  1WIA A;  4ICV A;  4MEM A;  4W9K A;  2AL3 A;  3JW0 X;  5AZG A;  4K81 A;  2N9P C;  3V6E B;  2KN5 A;  4E3C A;  2HJ8 A;  3NS8 A;  3U8Z A;  2C5L C;  3A4S C;  2N1W A;  1WJU A;  3CF6 E;  4GU2 A;  3NOB A;  2AYO B;  4WWN A;  4ANU A;  3TJP A;  3DVN V;  1WRD B;  2GBR A;  2MBO A;  1CMX B;  2ZCC A;  4BBN C;  1IYF A;  2JWZ A;  2ASQ A;  3DBL I;  1WFY A;  4MDK E;  3T8M A;  2D10 A;  2KD0 A;  4RM8 A;  4EZL A;  4WWP A;  1VD2 A;  2KOX A;  3DCG A;  4K7S A;  3HHM A;  2RSU A;  2ZPN A;  3DQV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...