1TGZB

Structure of human senp2 in complex with sumo-1
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
78
structure length
78
Chain Sequence
EYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A basis for SUMO protease specificity provided by analysis of human Senp2 and a Senp2-SUMO complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle, hydrolase
molecule keywords Sentrin-specific protease 2
total genus 15
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2004-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1tgzB00
3VHTC 2DZKA 2JY6A 1P98A 1WFYA 2REXA 1EF1A 5LXIB 5J17A 2DHZA 2ZNVC 4MGKE 3UF8A 2D3GA 3VFKA 2KO3A 4BBNC 3DPDA 2LGYA 1VCBA 2NCNA 4TQ0A 3RZWC 1WX7A 2KFKA 3KH0A 4HK2A 1Z2MA 2V4LA 3N30A 3PV1A 5E6PA 3WAPA 3QHTA 3QQ8B 2LVQA 2D11A 1ZW7A 2JRHA 2OOBB 5L95C 4GDKB 3ZLZA 2C5LC 2KANA 3DVNU 2KHWB 2KWUB 4N9F4 3TL5A 4A3PA 1P0RA 2L3ZA 4MGZE 1AARA 1NDDA 4RM8A 3ZDMC 4CYEA 4DDID 5JHBA 4CO7A 1ZKHA 3APCA 3PRZA 2CHZA 1WXVA 1H4RA 2DAJA 2LGDA 4MGIE 5DPWA 2FNJB 1OEYA 3QA8A 4GN1A 4IC7B 4GU2A 2NBUA 2BWES 2LGXA 3NZUA 4NJ6A 3CMMB 2MQJA 3UIPB 1E8YA 2DZIA 3A1QB 4ZRJA 3JYUA 4G11A 4WWPA 3AULA 2NVUI 1YIWA 1Y8RC 2IBIB 1E90A 4KZCA 1P1AA 5D94A 1YJ1A 3N32A 2FIFA 1GNUA 1M94A 2KJHB 2KJRA 2NR2A 3B1LX 4ZRIA 4GMVA 3RD2A 1WGRA 5J18A 3PS6A 1I42A 2O2VA 4II2B 1WZ0A 4M8NA 3KYDD 3RZFA 3DBLI 1YX6B 3A9KB 3VTUA 5JH5C 3V60A 1WH3A 3HM6X 1J8CA 4BVUC 1NBFC 2K8CA 3A4SC 2NPTB 2KLGA 4EFOA 3ZIMA 4KSLC 4A3OA 3KYCD 4HLEA 3SDLC 2ZNVB 2LJ5A 1EUVB 5LXHA 2G45B 4X57B 5DCNA 4OVUA 5CX3A 3U7DA 4AUQC 4AWJA 2KD0A 4MDKE 2FAZA 1GC7A 1WM2A 2RR9A 3IG3A 3PREA 4IWQA 2MP2B 4W9KA 3VUYA 2MLBA 2K8HA 3A1QA 3DBSA 3ML9A 2NBWB 3PLVA 1F9JA 2CS4A 1YX5B 2KX3A 3AI5A 4GSWA 2BKFA 4FJVB 3W1SC 3EC8A 2NS5A 3V6CB 1RFAA 1WM3A 3VUWA 2WX1A 2ZJDA 3KVFB 2KLCA 3ZTCA 4A20A 4ASWC 2AL6A 3T9LA 3ECIA 3M95A 4IM2A 1YD8U 2A4ZA 4IM3A 3DVNV 4HCNB 4W9CA 4E71A 2KMCA 2BGFA 3L08A 1KLVA 2RSUA 4M8MA 3OLMD 2C60A 1V86A 1E7UA 4MJSB 4E74A 4YL8A 1LM8B 2KTRA 5E6NA 5EDSA 1E8XA 5G55A 1GJZA 1WXMA 2KTFA 3ZDTA 4EUTA 2MWSB 3V6EB 2EMSA 4RM9A 1V5OA 3MHSD 1V9JA 2GBMA 2UYZB 4I6NB 2N7DA 1QZEA 3DBHI 1LQBA 4G3XB 4FHJA 2IY1B 2NPTA 3EECA 4MGYE 4AJYB 3WA0A 2KXJA 3ZVVA 5C1ZA 4FADA 2KNBA 3DBRI 1I35A 4ICUA 4AJWA 2N1VA 2MBEA 4NPNA 4BOZB 1R4NI 1WX9A 4JGHB 3W1SA 1WE6A 1RLFA 3IHPC 2GBKA 3LJ3A 2KOXA 3IVFA 4MH0E 4EKUA 2LUEA 3P2BA 4DXAB 2JT4B 2JZ3B 1WZ3A 3KUDB 4K7UA 1TGZB 2N7EA 5GMVA 5JZEB 3RT3B 1WGHA 3DCGA 3I3TB 2KDBA 2LI5A 5CHFA 2PPHA 1WJNA 3D32A 3QJZA 4J6IA 1C3TA 3JSVA 3MTNB 3UINB 2R2QA 4ICVA 5AZHA 3K9OB 1RAXA 4W9EA 3ALBA 2K6DB 3WALA 1UGMA 3L54A 2M8SA 5CHVC 3WANA 2KZRA 3DVGY 3QIJA 3ZNZB 3X0WA 2WX0A 2JVCA 2N9PC 1S3SG 3T8MA 2N9EB 5G2NA 3ONSA 3U8ZA 3SD5A 2MRPA 1WF9A 1V6EA 2C9WB 1UD7A 2I1KA 2KK8A 1WR1A 3QK0A 1PQSA 4ZRKA 4B95A 2V3SA 1Q1OA 2W9NA 3R3MA 3QWZB 4BKSD 1Z5SB 2OJRA 3AU4A 2G4DB 3W1YA 3H7SA 2JF5A 4GDKA 4PS7A 4DHZE 4TV3A 1OEYJ 3B0AA 4JIOU 2MA9B 2AWTA 2JXXA 2L7RA 3M63B 3TIXA 4ANXA 3B08A 4PYUA 1UBQA 4MM3A 3PSEB 2BWFA 5IA7A 3WAMA 5J2RA 3APDA 4BFRA 1V49A 5LLIA 2LVOA 2VRRB 1WMHB 4PS3A 4W9HA 3TMPB 4GDLA 3HM3A 4K1RB 2IO3B 1WYWB 5D2MB 4KDIC 3L13A 4MEMA 4W9DA 2Z0DB 2WDTB 4I6LB 4BKSA 4BBNF 2N4FA 3PRPB 4KVGB 4NQLB 2C7NB 1WRDB 4B6WA 5JHAA 4TKNA 3VTVA 4E3CA 2KN5A 4KSKC 3VDZA 3U30A 3PLUA 3ZO5B 2LZ6A 4XZ4A 1WGYA 2WWZA 1WXSA 2NBVB 3RYTA 3TJPA 4WJPA 1C1YB 2MP2A 3Q3FA 5DPTA 1WI0A 4II3B 4HVBA 4M0WB 1WGDA 2MBBB 2K25A 2L8JA 3L0WB 2M4NA 4RMAA 4ANVA 4MSMB 2Y5BB 3APFA 3R7QA 2CHXA 3EFUA 2IO0B 1D3ZA 4GGQA 4FJZA 1EO6A 1L7YA 2LASA 4LDTB 1WX8A 1CMXB 1HE8A 4NY0A 5DPRA 3SHQA 4DWFA 4EOYA 2JRIB 2JZZA 2RPQA 2IO1B 1WIAA 2D10A 2GBJA 4IUMB 2XBBC 2V1YA 2ZZPB 1IYFA 4EEWA 3NZSA 2LRWA 2L00B 4MELA 3ZRCA 2ZVNA 2K1FA 4HPLB 4MJSA 1J19A 2CR5A 4DK5A 4AP4C 1BT0A 2KTRB 3BINA 3M62B 3GOEA 3GZNI 4W9JA 2BKRB 2DYOA 2BYFA 2N9XA 1XT9B 4NNJB 1UZXB 2O6VB 5CHWA 1V5TA 3QARA 5L83A 4EZJA 3L10B 4F7ZA 5KHOA 2CHWA 4KIKA 3OJ3A 3PHXB 1E5WA 4NAWB 3R7RA 3NHEB 2MW5A 3O65B 1Q5WB 4HXDA 2MBHA 4TUUA 3PRMB 2R2OA 2CKHB 3ZNGC 3VUXA 2ZCBA 1WY8A 4EZLA 2ASQA 5D7GA 2AEHA 1P9DU 3JVZX 4WAAA 3CSTA 4BKGA 4MSQB 4JL9A 5E6OA 3N3KB 4WJQA 1TZ1A 2J0JA 3CSFA 5KHQA 2J0KA 2PE9A 1OTRB 2YVCA 3MJWA 4B9KA 2M1MA 3NOBA 3QCAA 3ZTDA 2FCNA 4HJKA 2DENB 4HCPB 4ZDVA 2ZCCA 2KC2A 4DDGD 4IM0A 4OVVA 1GC6A 1K8RB 3UQAA 3ZRFA 2C7MB 2FCQA 4DBGA 1V2YA 5BO4B 4AOFA 1T0YA 5AZFA 4F1SA 2ZPNA 1G6JA 2BPSA 4JQWC 3RCZA 1SIFA 4BOSC 2FIDA 3ENEA 2MBOA 3VQIA 1A5RA 4WWOA 2I1JA 1WJ6A 2AYOB 4W9FA 4KV2A 4PYZA 4GB9A 1U4AA 1NI2A 3LDZE 3PGEA 3PTFC 5DPSA 4HPMB 3RULA 2LXAA 2MSED 3QAQA 4GOCA 3CF6E 5AZGA 2KJ6A 2L0FA 4I6PA 2KDFB 4W9GA 2LWPA 3PPAA 1MG8A 3AXCA 3UIOB 3HIZA 1ISNA 3A9JB 2KQ7A 3DVGX 3PZDA 2K6QA 2A5UA 3H6NA 4URKA 4ANUA 3K9PB 4FULA 4KZ0A 3KUZA 2FCSA 2MBQA 1VD2A 3NY5A 4NJ7A 4G0NB 4XC2A 1UH6A 1LFDA 4GDLB 1IP9A 4IWOA 2B3AA 4LJPB 1GUAB 2ZVOA 1EF5A 2BYVE 3HHMA 3UGBB 3BY4B 4JLCA 4PS8A 4XX5A 4IG7B 3A9KA 1L2NA 4FN2A 3VH3B 3JW0X 4WJNA 5C23A 1WJUA 2KMAA 1WJ4A 3L16A 3RUIB 3TCAA 2JWZA 1ZGUB 3SU8X 2L76A 3WIMA 1WR6E 4ANWA 2PEAA 1OQYA 3Q3JA 4HDQA 1JRUA 2YLMA 1S1QB 3ZNID 3OJ4B 3ZKJC 3ZNHB 3QX1A 3EHVA 2IY0B 1YQBA 2O6VD 3NS8A 4ZYNA 5HKHA 1H8CA 3WAOA 2AL3A 3VH4B 1UELA 2G4SA 2DZMA 2O2VB 2PE6B 3R66C 3X23A 2GOWA 3DDCB 4WQOB 1UBIA 4FHKA 5AEKB 3KUCB 3VVWB 2D2QA 2KC1A 4WJOA 4HWIB 2JUOA 2LRUA 2EMTA 1E8WA 2ZPYA 3A33B 3V61A 4W9IA 4LJOB 4CHKA 3DOWA 1SGHA 2K8BA 2KWVB 2JPHA 1WXAA 3HK0A 2L05A 3S2AA 2XK5A 1P3QU 3PHWB 3ZUNA 2J0MA 2D07B 4LDTD 5IAAC 3H7PA 3ML8A 4W9LA 2CU1A 2Z0EB 5D6JB 2RGFA 2EKEC 3C0RB 4K7WA 1R4MI 4GXBA 2HD5B 2RD0A 3TBLD 1LXDA 2KDEB 2K39A 2DAFA 4WWNA 4IWPA 2KX0A 2IZVB 4FBJB 2M17A 3VXWA 1WMHA 4KDLB 2J7QB 1TBEA 2Z59B 3VAWA 2IO2B 5FR6A 1WE7A 4FA6A 2DZJA 2XEWA 2DX5B 2LXCA 3PT2B 1FXTB 4EZKA 2GBNA 3A9JA 3QC8B 1KOTA 2QHOA 1Q0WB 4G50A 5CTRC 4K7SA 2DYBA 2WYQA 1E7VA 4DHZB 2MCNB 2LVPA 1XQQA 3VTWA 1TTNA 3UQBA 1XD3B 2HE7A 2IYDB 3L17A 2DYMA 5TR5A 2L0TA 1RRBA 2C7HA 2FCMA 3DQVA 1OGWA 2KWCA 3V62A 2KVRA 4K81A 2LD9A 2ZEQA 1V81A 3H9DA 2BYEA 4HDOA 4DHJB 1GG3A 4LCDE 1E8ZA 2PJHA 3ZW3A 1IPGA 4IW0A 2UWQA 4NAWA 4P7IA 1KM7A 2HJ8A 3A4RA 1V80A 3M3JA 2M0XA 3IBEA 1J0GA 1X1MA 3JSVB 4GIVA 2N1WA 3AU5A 3PVLA 2FUHB 2KFJA 1KJTA 2KQSA 2O6VA 3IFWB 4KIKB 2GBRA 2G3QB 1WGGA 2GMIC 2HTHA 4FLHA 2KFKB 2BF8B 1SE9A 4TQ1A 3KW5B 4F8CB 2XK5B 4DHJD 4NQKE 3OAWA 3H1UA 4FJYA 3H7PB 2KKCA 2MX2A 4BKTA 2KDIA
chains in the Genus database with same CATH superfamily
4LNFA 3VHTC 2BBCA 2REXA 3AEEB 5LXIB 1E6EB 2KO3A 3DPDA 2LGYA 4TQ0A 4Q2JA 3U7ZA 2LUMA 3PV1A 1PYWD 3BZDB 1JW9D 2H89B 1AWDA 3DVNU 1SEBD 1AARA 1NDDA 4RM8A 2WXKA 4DDID 2CHZA 1MHXA 2LGDA 3AE1B 3Q8CA 2FNJB 3IT6B 2N9KA 4O1NA 1IGCA 3A1QB 1MJDA 3HVZA 1KTKA 3I57A 1Y56A 3V3XA 2JZPA 3B1LX 4ZRIA 5J18A 3O13A 1FNVA 5JH5C 1J8CA 1NBFC 2K8CA 3A4SC 2L1AA 1L0XB 1DOIA 5LNK1 1TKYA 3KYCD 1YNTE 1EUVB 4OVUA 1I4XA 1I4HA 5CX3A 4AUQC 2RR9A 4W9KA 1YX5B 5IO9A 4A55A 5IOIA 3PZ7A 3W1SC 3V6CB 1WM3A 2ZJDA 3ZTCA 4A20A 1IBXB 1YN5A 2ICIA 1YD8U 2A4ZA 2AQ1B 4HCNB 1ZP0B 4E71A 2BGFA 4M8MA 3OLMD 2N9LA 1LM8B 3BVZA 1E8XA 3DBLB 2KTFA 1FRDA 1PFDA 1JRPA 1MFWA 3KQ4A 1D5MC 2GBMA 4I6NB 1QZEA 3DBHI 4G3XB 1D6EC 3BIID 2NPTA 5D3IB 3EECA 3N9YC 4MGYE 3WA0A 3DHHC 4FADA 3DBRI 1IGDA 1RFKA 2N1VA 4NPNA 3W1SA 3IHPC 1GPXA 3IVFA 1TYGB 1YQ3B 2JT4B 2JZ3B 4ITKA 5GMVA 3B2GA 1ZUD2 1WGHA 1YJJA 2PPHA 1C3TA 1V1OA 2R2QA 3WALA 3K9OB 1RAXA 1UGMA 2GB1A 5CHVC 3WANA 2HDEA 3T8MA 2ZW1A 5G2NA 2JQRB 4WAFA 1BXTA 1GB4A 2JYTA 1SXTA 1PQSA 4ZRKA 3R3MA 3QWZB 3AU4A 4TV3A 1AW7A 2UU7A 2JXXA 1UBQA 1N62A 1XLNA 3PSEB 3C19A 1MI0A 1V49A 1SJHD 5LLIA 2VRRB 3TMPB 3HM3A 2IO3B 4MEMA 3VRAB 3DWMA 3BYYB 4BBNF 5JHAA 4B6WA 4NQLB 1WRDB 5EE1A 4L2YA 2MP2A 3AE7B 4II3B 1V1PB 1M4VA 3Q2AC 4ANVA 1YQ4B 2WQYB 1C4PA 2IO0B 3SHQA 2JSVX 4NY0A 2R61A 2V1YA 3ZRCA 1KLUD 2IDYA 3Q8BA 2WXPA 4DK5A 3WCQA 3GZNI 2DYOA 1VJKA 3QARA 4MACA 4F7ZA 4KIKA 1E5WA 1FMAD 1STEA 3PRMB 3U2SC 2KACA 2DWQA 2J4XA 2ZCBA 2ASQA 4N58A 4WAAA 4BKGA 3ZXVA 4JL9A 2J0JA 3CSFA 2J0KA 4XE0A 1F1HA 2KAJA 3NJTA 1N63A 4OVZA 4HJKA 4RF1A 4HCPB 5C3JB 1I7HA 2D3AA 2J53A 3UQAA 4BZAA 3ZRFA 2C7MB 1V2YA 5BO4B 4US8A 1N60A 5AZFA 2ZPNA 4KKIA 1E9MA 4BOSC 4WWOA 4PYZA 1U4AA 3PGEA 4XDCA 2MSED 3QAQA 3RNBC 2L0FA 4I6PA 2KDFB 1QLBB 4W9GA 2PLPA 2FE8A 1ISNA 2KQ7A 3DVGX 4URKA 4FULA 4KZ0A 3C8YA 1FXIA 4NJ7A 4XC2A 2B3AA 4LJPB 1GUAB 2ZVOA 2BYVE 3NS1A 1EU3A 1HXYD 4WJNA 1JWAD 3L16A 1V97A 4ANWA 2PEAA 4IDIA 1S1QB 2BS2B 4P16A 3QX1A 3VH4B 2KN4A 2O2VB 3MC0B 4WQOB 4FHKA 3KUCB 4WJOA 2JUOA 3V61A 1L6UA 4LJOB 3DOWA 2Y3AA 2K8BA 2KWVB 2JPHA 3ZUNA 1T6BX 2D07B 3H7PA 2WXOA 3ML8A 2CU1A 4W9LA 5HFYA 2RD0A 3TBLD 2NTSA 1HTQA 4IWPA 3N1XC 3NVVA 2KX0A 1CQVA 2M17A 1C4CA 3VXWA 1TZOA 2J7QB 2NTTA 2K5PA 3E9SA 1QT9A 3B9JA 3PT2B 2GLSA 2WU2B 4R3DA 1LO5D 2NMQA 3QC8B 4YTNB 2WXRA 4OHJA 2WYQA 2ACZB 2LVPA 4RGOS 1XQQA 1TTNA 5H8YE 3V05A 1EU4A 2PKOA 5TR5A 3B2FA 3GP7A 2FCMA 3AECB 4HEA1 1WXQA 2KWCA 4RH6A 2LD9A 4XYCA 2ZEQA 1AYFA 1TT5B 4LCDE 5BYSA 2WXNA 1IPGA 1OQQA 2UWQA 4P7IA 1KH0A 1KM7A 3M3JA 2GI9A 4ZHPA 1J0GA 2PVOD 3JSVB 3AMZA 3N1YC 3PVLA 2FUHB 3IFWB 4KIKB 2GBRA 2G3QB 2WXLA 1FPYA 4FLHA 2WDVB 2KFKB 3KW5B 2XK5B 4NQKE 3H1UA 3PZ8A 4YSYB 2JY6A 2V3NA 4YTPB 5J17A 4S17A 2RMMA 5BYRA 2ZNVC 4MGKE 2BS3B 2D3GA 1P7EA 1N61A 1FCCC 2NCNA 3I63C 2VZKB 3KH0A 4HK2A 3Q8FA 2V4LA 4C4VA 3QHTA 2LVQA 3W2DA 2D11A 1ZW7A 2JRHA 2OOBB 4GDKB 4ACFA 2C5LC 2KANA 2KHWB 4DXFA 1FNWA 3TL5A 4A3PA 4XWWA 3CWIA 4K3BA 5GXGB 4CYEA 3OWEB 4KX6B 4CO7A 1ZKHA 1I4PA 4MGIE 4LNKA 1P7FA 2NBUA 2BWES 1UGJA 2LGXA 3J9CA 2FBWB 4NJ6A 4A6QA 1E8YA 1L6VA 3TEYA 3ZJTA 3AV8A 2NVUI 2IBIB 1E90A 1V8CA 1YJ1A 2WP9B 2KJHB 1M94A 4GMVA 3RD2A 2AQ3B 3LYYA 2HJ1A 2LGIA 4II2B 4M8NA 3KYDD 3A9KB 3V60A 3Q14C 4BVUC 2NPTB 4KSLC 4DXGA 4A3OA 2V3PA 2QILA 4HLEA 2INPE 1UNSA 2ZNVB 2LJ5A 5LXHA 2G45B 4X57B 2FAZA 4IWQA 2MP2B 1NENB 1XLOA 4KKJA 3A1QA 4NJCA 2L52A 2NBWB 2V4IB 2LHEA 2KX3A 4GSWA 2BKFA 2NS5A 1ENFA 1VDVA 2WX1A 2G9HD 3KVFB 3URYA 2KLCA 3Q8EA 2AL6A 4J3OD 3EFCA 5FR3A 4IM3A 3DVNV 3LB8C 4W9CA 3NVYA 2OJWA 3Q69A 4HKZE 2RSUA 4YWGG 2C60A 2BT6A 5G5HA 1VRAB 4YL8A 2MHJA 5EDSA 5G55A 1GJZA 3ZDTA 3MC9A 2MWSB 4KGTA 1SE2A 2UYZB 2N7DA 1LQBA 4EE2A 1SJED 2W54A 1I35A 3IT4B 2MBEA 1WX9A 4JGHB 1JWSD 1RLFA 3U4EG 1AN8A 4MM3B 3KUDB 1WZ3A 2MH7A 5JZEB 2VZKD 2KDBA 3I3TB 3D32A 1T5XD 1WJNA 2LJIA 3JSVA 3MTNB 3UINB 5AZHA 3ALBA 2KZRA 3DVGY 3QIJA 4A9AA 3GZNB 3R2TA 1FEHA 4ZRQA 2N9EB 4B0MA 3U8ZA 1V6EA 4REZA 2I1KA 2KK8A 1E7PB 1WR1A 3L4PA 1GOZA 3RN9C 1Q1OA 1QILA 2J42A 2OJRA 2G4DB 1YMHE 4DHZE 1YOVB 3TIXA 1MG4A 3M63B 3B08A 2KQ4X 2BB5A 5IA7A 3MFGA 4GDLA 3L13A 4W9DA 2WDTB 2W3RA 1QOGA 2C7NB 1N5XA 3Q3NC 1XXGA 2KN5A 3SFDB 3PLUA 3ZO5B 2WWZA 1WXSA 3MJ5A 2JX5A 4WJPA 3Q3FA 4HVBA 3AEBB 2L8JA 3L0WB 2KT7A 3NRZA 3BVMA 2MJDA 3TSSA 4FJZA 2LASA 5DPRA 4WH4A 2D10A 4IUMB 2XBBC 3AE2B 1KLGD 1J7BA 2M56B 4HPLB 1NEKB 2CR5A 4D2KA 1BT0A 3GOEA 2BKRB 4L1BA 2O6VB 1QOBA 1C9FA 1FD6A 2CHWA 3PHXB 1TY2A 4NAWB 3R7RA 1QF6A 3IAM1 2R2OA 3ZYYX 4XDDA 4EZLA 1P9DU 3N3KB 1L4ZB 2BQQA 5KHQA 2YVCA 1FFVA 3AE6B 2M1MA 2INNE 4RGMA 1EWYC 3FILA 3ZTDA 2DENB 5C2TB 2ZCCA 2KC2A 3KLSX 2QSDA 4C4VB 4LLGM 3RNAC 3VRBB 4TMAB 1TKGA 1TKEA 2FCQA 3DBRB 1QKZA 4AOFA 1GAQB 1G6JA 2BPSA 4JQWC 1SIFA 5TSSA 2FIDA 3ENEA 4W9FA 2LGSA 1JWMD 3LDZE 1I4GA 4GB9A 3EA6A 3RULA 3AE4B 1VR9A 3RNCC 3SEBA 1MG8A 3BK1A 2K6QA 3K9PB 3KUZA 5E6JA 3NY5A 1LFDA 4GDLB 5EE9A 5J2RA 3UGBB 3BY4B 4PS8A 4IG7B 3RNEC 1K51A 2KWDA 1L2NA 4N6EB 2W55A 5C23A 2KMAA 3RUIB 2JWZA 2WDRB 2I2YA 1MPEA 1OQYA 2IGGA 1UF0A 1ZE3D 2YLMA 3ZKJC 1TS5A 3EHVA 2IY0B 3NS8A 4YT0B 5HKHA 1ET6A 2G4SA 2DZMA 2PE6B 5AEKB 3DDCB 3I5JC 2D2QA 2D3CA 3ZQ4A 3NUHB 4W9IA 5EE3A 4CHKA 4LNNA 3W9CB 3HK0A 2L05A 3KWVA 3P4QB 2Z0EB 4K7WA 4GXBA 2HD5B 2KDEB 3RMKC 4RGNA 2IZVB 1C4AA 4KDLB 1KF6B 1NVID 1TBEA 2DZJA 2DLBA 3A9JA 1Q0WB 4CQNA 4G50A 1TIFA 2SAKA 2DYBA 1XLPA 3AB5A 2MCNB 2K0PA 3UQBA 2IYDB 2LFIA 1L5PA 2L0TA 1RRBA 2C7HA 2VH1A 1OGWA 3MP9A 3OG5A 1XCTL 1HA5A 2BS4B 4DHJB 1E8ZA 4K3CA 3ZW3A 3EUB2 3AEFB 4NAWA 2BB6A 4GIVA 3DHIC 2KFJA 3VR8B 2W82A 2Y5PA 5T8IA 4IKGA 2AX5A 2KYWA 4KGRA 4ZHOA 1L4DB 4F8CB 5IKCM 4DHJD 2PVGC 4FJYA 3P4SB 2DZKA 2QJLA 3MHZA 4LNIA 5D3DA 2WU5B 2WXMA 4BBNC 3ZJUA 1R7SA 3RZWC 1ZOYB 1Z2MA 3N30A 5E6PA 3WAPA 2ZW0A 3QQ8B 1ACCA 5L95C 4OZCA 4RCOA 2KWUB 4NZLB 3Q3MC 3ZDMC 1YN4A 3APCA 3BK2A 5IP4D 1H4RA 2DAJA 5DPWA 1OEYA 3HUIA 4IC7B 3CMMB 2MQJA 4C00A 1J7AA 1E10A 2DZIA 3TEZA 3GE3C 1TJEA 3JYUA 4G11A 4KZCA 1P1AA 3SR6A 5D94A 3DBHB 2FIFA 2NR2A 4JX1C 1WGRA 3ZJVA 3PS6A 3R2IA 1I42A 2CJNA 2O2VA 3RZFA 3DBLI 1YX6B 3AE9B 1JMLA 3VTUA 1GB1A 1WH3A 3HM6X 4C56C 2KLGA 2X8XX 3SDLC 3TUOA 3U7DA 3IG3A 1WM2A 3VUYA 3DBSA 3ML9A 3AI5A 2W3SA 1BMLC 3N1ZC 1YJIA 1RFAA 2V9HA 2DNFA 3T9LA 2WXQA 4IM2A 2M0AA 1JWBD 1KLVA 4MJSB 4E74A 1FIQA 1OFFA 5E6NA 5AUKA 1WXMA 3IAS1 5BMGA 4EUTA 4BAXA 2EMSA 2V0GA 1V5OA 3KWLA 1V9JA 2D3BA 1VZ6A 4FHJA 2IY1B 5H92C 4AJYB 2WDQB 3MC8A 3TEXA 2KNBA 4ICUA 2QDFA 1IBXA 3LJ3A 2KOXA 3CIRB 2IPKD 3P2BA 4EKUA 1SB3C 4K7UA 1D4BA 2N7EA 3DCGA 5CHFA 2K6DB 3L54A 2M8SA 1SE4A 3ZNZB 3X0WA 4ARCA 1S3SG 4HRSA 2J52A 3SD5A 2MRPA 1WF9A 5HG2A 4KGSA 1CJEA 2C9WB 4L23A 2JU6X 1B1ZA 4B95A 4BKSD 3W1YA 3AE5B 3H7SA 4GDKA 1QQRA 3B0AA 4XWTA 3RI7C 4JIOU 1F77A 3AEAB 2WLBA 3WAMA 3APDA 1TS4A 1WMHB 4PS3A 4W9HA 2IGDA 4KDIC 3NG0A 2Z0DB 4I6LB 4BKSA 2RDBC 1CK1A 2N4FA 2VH2A 3VTVA 3U30A 2QC8A 2LZ6A 1I4RA 2PIAA 2YEPF 1UWMA 4AS1A 1F0ZA 1A70A 4M0WB 3E56A 2MBBB 2K25A 2M4NA 2EKIA 4MSMB 2Y5BB 4JWUC 1JROA 2WXJA 3R7QA 1HZ6A 1F52A 4GGQA 4MT5A 1EO6A 4LDTB 1WX8A 1CMXB 1HE8A 4DWFA 1FRRA 4EOYA 2JZZA 2RPQA 1R4NB 1WIAA 2IO1B 2ZZPB 2B76B 4EEWA 3NZSA 2L00B 2SEBD 3AEGB 2K1FA 4RF0A 1J19A 4MJSA 4AP4C 3AE8B 2KTRB 3M62B 4W9JA 5CHWA 4NNJB 1XT9B 1V5TA 1T0RC 2EELA 4EZJA 1FFUA 3OJ3A 2N7JA 1C78A 2MW5A 2MBHA 3Q8AA 4TUUA 2CKHB 4PK1A 3ZNGC 3VUXA 4P1BC 1WY8A 2ON8A 5D7GA 3JVZX 1JALA 1TY0A 1TS3A 5E6OA 1N5WA 3MJWA 4LTUA 1I4QA 1OTRB 2PE9A 4HPPA 1FNUA 4B9KA 3W5UB 1XLQA 3QCAA 1SIJA 1HZ5A 4ZDVA 1HQRD 4DDGD 3H8HA 4IM0A 4OVVA 2WGSA 1GC6A 2RPVA 3AEDB 1V1PA 1T0YA 1FM0D 1D5ZC 2INDC 1SF0A 4KV2A 5DPSA 4RGTA 3UI3A 2LXAA 4GOCA 1PUTA 3CF6E 2KJ6A 1XCQL 2LWPA 3PPAA 1PDXA 3AXCA 2RDHA 3UIOB 3HIZA 3PZDA 4AQ7A 3NZ3A 2IGHA 4OW0A 2A5UA 4P6VF 2FCSA 2MBQA 1VD2A 3P4RB 4G0NB 1UH6A 1XF5L 4IWOA 3GB1A 1EF5A 1FXAA 3A9KA 4FN2A 3VH3B 1ZXHA 3JW0X 3U52E 1T0SC 4JE3B 1WJ4A 3SU8X 2L76A 2QMTA 2K22A 3Q3JA 4HDQA 4ZRPA 3ZNID 5AUIA 2O6VD 1YQBA 4ZYNA 4OZAA 3X23A 2KC1A 5IN7A 4HWIB 2LRUA 2ZPYA 1E8WA 2CU3A 3S2AA 2XK5A 5HI1A 2J0MA 4LDTD 2OHFA 1ZDVA 2RGFA 2K39A 4WWNA 3EGRA 2Z59B 3VAWA 1T0QC 1WE7A 2DBYA 1FXTB 2E6XA 2L32A 3BVGA 1KOTA 2QHOA 4LNOA 5CTRC 3I9V1 3FAHA 3VTWA 2PMVA 2HE7A 3L17A 2WS3B 4PT5A 1LGRA 2G1EA 2KVZA 4UDUC 4K81A 1UUPA 4H2AA 3H9DA 2PTLA 1GG3A 2MJEA 1VZ7A 4IW0A 4C7ZA 2HJ8A 3A4RA 3IBEA 2ONQA 2N1WA 3RFZB 3P1MA 1KJTA 2BYTA 5FK9C 2KQSA 2O6VA 1PGBA 2Z8LA 1WGGA 2WXIA 1SE9A 4TQ1A 2XNAC 2MX2A 4BKTA 2KDIA 1SE3A 4HKQA 1P98A 1WFYA 1EF1A 2DHZA 3UF8A 3VFKA 4HJGE 2E3TA 1VCBA 3RNFC 1WX7A 2KFKA 1TS2A 3AH7A 3ZLZA 1ET9A 4N9F4 1P0RA 2L3ZA 4MGZE 2LMCA 5HHDG 2QIEB 5JHBA 2OEDA 4ZYSA 3PRZA 1WXVA 4QAYA 3QA8A 4GN1A 3TEWA 4GU2A 3NZUA 3Q6BA 5EE0A 3UIPB 1F2RI 4ZRJA 4WWPA 3AULA 1YIWA 1Y8RC 1DOYA 1DGJA 3IXSA 3N32A 3SFEB 1GNUA 2KJRA 1JCKB 3VR9B 4LK0M 2WHIA 1WZ0A 4YXDB 1F2RC 1WWTA 4EFOA 3ZIMA 2KMMA 4P1CC 1ESFA 5DCNA 4AWJA 2KD0A 4MDKE 1GC7A 3PREA 4WWMA 3HVDA 2MLBA 2K8HA 3AM9A 3PLVA 2INCC 1F9JA 2CS4A 3BYTB 4FJVB 3NVWA 3EC8A 1RM6C 3VUWA 4ASWC 4C7YA 3ECIA 3M95A 2KMCA 3L08A 1V86A 1E7UA 2KTRA 2CJOA 4JWSC 2IJ0A 3V6EB 1YN3A 2RDGA 4RM9A 3MHSD 1KRHA 2BVCA 3ZXRA 2KXJA 3ZVVA 5C1ZA 2WNMA 4AJWA 3DHGC 4HROA 1K50A 4BOZB 1R4NI 1DOXA 1WE6A 2GBKA 4US9A 4MH0E 2LUEA 4DXAB 1DYQA 2XN9C 1JWUD 1TGZB 1B9RA 3RT3B 4TSSA 2LI5A 5BMHA 3QJZA 4J6IA 4C80A 2QCZA 4ICVA 4W9EA 1EWCA 2WX0A 2JVCA 2N9PC 2LEKA 2LHDA 4A90A 1HTOA 3ONSA 1UD7A 3QK0A 2HTME 2V3SA 2W9NA 1NYQA 1Z5SB 3P63A 2JF5A 4PS7A 5MPOA 2L83A 2WXFA 1OEYJ 1WSPA 2MA9B 2AWTA 4YSZB 2Q5WD 2L7RA 4ANXA 4PYUA 2WXHA 4MM3A 2H88B 1UWXA 2BWFA 2N0SB 4ZOHC 4BFRA 2LVOA 3P42A 2MJ3A 4K1RB 5D2MB 1WYWB 3FC4A 4KVGB 3PRPB 3NVZA 4TKNA 4E3CA 3BWUD 4KSKC 3VDZA 1XO3A 1ZXIA 2I38A 4XZ4A 1WGYA 2NBVB 3RYTA 3TJPA 1C1YB 3ZGZA 5DPTA 1WI0A 1WGDA 4RFBA 3R8BA 1N6ZA 4RMAA 1SBBB 1E0ZA 3APFA 2CHXA 4GLSC 3EFUA 1D3ZA 2Y5CA 1L7YA 5G5GA 1ZDXA 3RPFC 2JRIB 2GBJA 4S0RA 1WRIA 5BYQA 1RYJA 1IYFA 2PW9A 2LRWA 4MELA 2ZVNA 5FKAC 2JXTA 2YEPB 3T3OA 1L0VB 3BINA 3N20C 2MEKA 1WYGA 1R4MB 2BYFA 2N9XA 1UZXB 3Q3OC 1RWSA 5L83A 2FUG1 3L10B 5KHOA 3FILB 4YTMB 3P4PB 1L0YB 3NHEB 3O65B 4HXDA 1Q5WB 1FO4A 4A8XC 2AEHA 3CSTA 4MSQB 4WQMA 2GRIA 4WJQA 1TZ1A 3ETRA 1EM7A 4DQOC 2K9XA 3NOBA 3FKYA 2FCNA 4M01A 4RNAA 1VZ8A 5BMIA 2K3UA 3AN1A 1K8RB 1VLBA 4DBGA 2QEJC 4F1SA 1WGKA 1JQ4A 3RCZA 2MBOA 3VQIA 1A5RA 2I1JA 1WJ6A 2AYOB 1MHHE 1NI2A 3PTFC 4HPMB 4YSXB 5AZGA 1IUEA 3HRDD 2TSSA 1K52A 3T3NA 1FCLA 3A9JB 3H6NA 1T3QA 4ANUA 3RNGC 1CZPA 1IP9A 3HHMA 4JLCA 2M19A 4XX5A 1SSNA 2X38A 3DWGC 1WJUA 3TCAA 1ZGUB 2AQ2B 3W5VB 3WIMA 4USAA 1WR6E 4WURA 1JRUA 3OJ4B 3ZNHB 1H8CA 3WAOA 4M02A 2AL3A 2KDMA 1UELA 4OZBA 3R66C 2GOWA 1UBIA 3VVWB 3GS2A 2EMTA 3A33B 1SGHA 1C79A 1WXAA 1QOAA 4IOIE 1P3QU 3PHWB 1NYRA 4ARIA 4MH8A 1D5XC 5IAAC 3GE8C 5D6JB 2EKEC 3C0RB 1R4MI 2WXGA 2D5GA 1J7CA 1Q10A 1LXDA 3PO0A 1NI3A 4M0WA 2DAFA 3LXFA 4FBJB 1WMHA 1BUIC 4FA6A 2IO2B 5FR6A 5I4DA 1HEZE 2XEWA 2DX5B 2LXCA 4EZKA 2GBNA 4K7SA 4DHZB 1E7VA 2BTEA 5JXVA 1XD3B 2BW2A 2DYMA 4N59A 1OQRA 3DQVA 1C76A 3V62A 2KVRA 4B0EA 1ZPSA 1K53A 1ROEA 4NAMA 1V81A 2BYEA 4HDOA 3AE3B 2PJHA 1QOFA 1V80A 2M0XA 1X1MA 1PGAA 1PGXA 4JPSA 4M00A 3AU5A 1C77A 4XGAB 2GMIC 2HTHA 2BF8B 4WIPA 2JWUA 4FXCA 1MVKA 3ABVB 1KFYB 3OAWA 2JYEA 1XEEA 3H7PB 2KKCA
chains in the Genus database with same CATH topology
3VHTC 2DZKA 2JY6A 1P98A 1WFYA 2REXA 1EF1A 5LXIB 5J17A 2DHZA 2ZNVC 4MGKE 3UF8A 2D3GA 3VFKA 2KO3A 4BBNC 3DPDA 2LGYA 1VCBA 2NCNA 4TQ0A 3RZWC 1WX7A 2KFKA 3KH0A 4HK2A 1Z2MA 2V4LA 3N30A 3PV1A 5E6PA 3WAPA 3QHTA 3QQ8B 2LVQA 2D11A 1ZW7A 2JRHA 2OOBB 5L95C 4GDKB 3ZLZA 2C5LC 2KANA 3DVNU 2KHWB 2KWUB 4N9F4 3TL5A 4A3PA 1P0RA 2L3ZA 4MGZE 1AARA 1NDDA 4RM8A 3ZDMC 4CYEA 4DDID 5JHBA 4CO7A 1ZKHA 3APCA 3PRZA 2CHZA 1WXVA 1H4RA 2DAJA 2LGDA 4MGIE 5DPWA 2FNJB 1OEYA 3QA8A 4GN1A 4IC7B 4GU2A 2NBUA 2BWES 2LGXA 3NZUA 4NJ6A 3CMMB 2MQJA 3UIPB 1E8YA 2DZIA 3A1QB 4ZRJA 3JYUA 4G11A 4WWPA 3AULA 2NVUI 1YIWA 1Y8RC 2IBIB 1E90A 4KZCA 1P1AA 5D94A 1YJ1A 3N32A 2FIFA 1GNUA 1M94A 2KJHB 2KJRA 2NR2A 3B1LX 4ZRIA 4GMVA 3RD2A 1WGRA 5J18A 3PS6A 1I42A 2O2VA 4II2B 1WZ0A 4M8NA 3KYDD 3RZFA 3DBLI 1YX6B 3A9KB 3VTUA 5JH5C 3V60A 1WH3A 3HM6X 1J8CA 4BVUC 1NBFC 2K8CA 3A4SC 2NPTB 2KLGA 4EFOA 3ZIMA 4KSLC 4A3OA 3KYCD 4HLEA 3SDLC 2ZNVB 2LJ5A 1EUVB 5LXHA 2G45B 4X57B 5DCNA 4OVUA 5CX3A 3U7DA 4AUQC 4AWJA 2KD0A 4MDKE 2FAZA 1GC7A 1WM2A 2RR9A 3IG3A 3PREA 4IWQA 2MP2B 4W9KA 3VUYA 2MLBA 2K8HA 3A1QA 3DBSA 3ML9A 2NBWB 3PLVA 1F9JA 2CS4A 1YX5B 2KX3A 3AI5A 4GSWA 2BKFA 4FJVB 3W1SC 3EC8A 2NS5A 3V6CB 1RFAA 1WM3A 3VUWA 2WX1A 2ZJDA 3KVFB 2KLCA 3ZTCA 4A20A 4ASWC 2AL6A 3T9LA 3ECIA 3M95A 4IM2A 1YD8U 2A4ZA 4IM3A 3DVNV 4HCNB 4W9CA 4E71A 2KMCA 2BGFA 3L08A 1KLVA 2RSUA 4M8MA 3OLMD 2C60A 1V86A 1E7UA 4MJSB 4E74A 4YL8A 1LM8B 2KTRA 5E6NA 5EDSA 1E8XA 5G55A 1GJZA 1WXMA 2KTFA 3ZDTA 4EUTA 2MWSB 3V6EB 2EMSA 4RM9A 1V5OA 3MHSD 1V9JA 2GBMA 2UYZB 4I6NB 2N7DA 1QZEA 3DBHI 1LQBA 4G3XB 4FHJA 2IY1B 2NPTA 3EECA 4MGYE 4AJYB 3WA0A 2KXJA 3ZVVA 5C1ZA 4FADA 2KNBA 3DBRI 1I35A 4ICUA 4AJWA 2N1VA 2MBEA 4NPNA 4BOZB 1R4NI 1WX9A 4JGHB 3W1SA 1WE6A 1RLFA 3IHPC 2GBKA 3LJ3A 2KOXA 3IVFA 4MH0E 4EKUA 2LUEA 3P2BA 4DXAB 2JT4B 2JZ3B 1WZ3A 3KUDB 4K7UA 1TGZB 2N7EA 5GMVA 5JZEB 3RT3B 1WGHA 3DCGA 3I3TB 2KDBA 2LI5A 5CHFA 2PPHA 1WJNA 3D32A 3QJZA 4J6IA 1C3TA 3JSVA 3MTNB 3UINB 2R2QA 4ICVA 5AZHA 3K9OB 1RAXA 4W9EA 3ALBA 2K6DB 3WALA 1UGMA 3L54A 2M8SA 5CHVC 3WANA 2KZRA 3DVGY 3QIJA 3ZNZB 3X0WA 2WX0A 2JVCA 2N9PC 1S3SG 3T8MA 2N9EB 5G2NA 3ONSA 3U8ZA 3SD5A 2MRPA 1WF9A 1V6EA 2C9WB 1UD7A 2I1KA 2KK8A 1WR1A 3QK0A 1PQSA 4ZRKA 4B95A 2V3SA 1Q1OA 2W9NA 3R3MA 3QWZB 4BKSD 1Z5SB 2OJRA 3AU4A 2G4DB 3W1YA 3H7SA 2JF5A 4GDKA 4PS7A 4DHZE 4TV3A 1OEYJ 3B0AA 4JIOU 2MA9B 2AWTA 2JXXA 2L7RA 3M63B 3TIXA 4ANXA 3B08A 4PYUA 1UBQA 4MM3A 3PSEB 2BWFA 5IA7A 3WAMA 5J2RA 3APDA 4BFRA 1V49A 5LLIA 2LVOA 2VRRB 1WMHB 4PS3A 4W9HA 3TMPB 4GDLA 3HM3A 4K1RB 2IO3B 1WYWB 5D2MB 4KDIC 3L13A 4MEMA 4W9DA 2Z0DB 2WDTB 4I6LB 4BKSA 4BBNF 2N4FA 3PRPB 4KVGB 4NQLB 2C7NB 1WRDB 4B6WA 5JHAA 4TKNA 3VTVA 4E3CA 2KN5A 4KSKC 3VDZA 3U30A 3PLUA 3ZO5B 2LZ6A 4XZ4A 1WGYA 2WWZA 1WXSA 2NBVB 3RYTA 3TJPA 4WJPA 1C1YB 2MP2A 3Q3FA 5DPTA 1WI0A 4II3B 4HVBA 4M0WB 1WGDA 2MBBB 2K25A 2L8JA 3L0WB 2M4NA 4RMAA 4ANVA 4MSMB 2Y5BB 3APFA 3R7QA 2CHXA 3EFUA 2IO0B 1D3ZA 4GGQA 4FJZA 1EO6A 1L7YA 2LASA 4LDTB 1WX8A 1CMXB 1HE8A 4NY0A 5DPRA 3SHQA 4DWFA 4EOYA 2JRIB 2JZZA 2RPQA 2IO1B 1WIAA 2D10A 2GBJA 4IUMB 2XBBC 2V1YA 2ZZPB 1IYFA 4EEWA 3NZSA 2LRWA 2L00B 4MELA 3ZRCA 2ZVNA 2K1FA 4HPLB 4MJSA 1J19A 2CR5A 4DK5A 4AP4C 1BT0A 2KTRB 3BINA 3M62B 3GOEA 3GZNI 4W9JA 2BKRB 2DYOA 2BYFA 2N9XA 1XT9B 4NNJB 1UZXB 2O6VB 5CHWA 1V5TA 3QARA 5L83A 4EZJA 3L10B 4F7ZA 5KHOA 2CHWA 4KIKA 3OJ3A 3PHXB 1E5WA 4NAWB 3R7RA 3NHEB 2MW5A 3O65B 1Q5WB 4HXDA 2MBHA 4TUUA 3PRMB 2R2OA 2CKHB 3ZNGC 3VUXA 2ZCBA 1WY8A 4EZLA 2ASQA 5D7GA 2AEHA 1P9DU 3JVZX 4WAAA 3CSTA 4BKGA 4MSQB 4JL9A 5E6OA 3N3KB 4WJQA 1TZ1A 2J0JA 3CSFA 5KHQA 2J0KA 2PE9A 1OTRB 2YVCA 3MJWA 4B9KA 2M1MA 3NOBA 3QCAA 3ZTDA 2FCNA 4HJKA 2DENB 4HCPB 4ZDVA 2ZCCA 2KC2A 4DDGD 4IM0A 4OVVA 1GC6A 1K8RB 3UQAA 3ZRFA 2C7MB 2FCQA 4DBGA 1V2YA 5BO4B 4AOFA 1T0YA 5AZFA 4F1SA 2ZPNA 1G6JA 2BPSA 4JQWC 3RCZA 1SIFA 4BOSC 2FIDA 3ENEA 2MBOA 3VQIA 1A5RA 4WWOA 2I1JA 1WJ6A 2AYOB 4W9FA 4KV2A 4PYZA 4GB9A 1U4AA 1NI2A 3LDZE 3PGEA 3PTFC 5DPSA 4HPMB 3RULA 2LXAA 2MSED 3QAQA 4GOCA 3CF6E 5AZGA 2KJ6A 2L0FA 4I6PA 2KDFB 4W9GA 2LWPA 3PPAA 1MG8A 3AXCA 3UIOB 3HIZA 1ISNA 3A9JB 2KQ7A 3DVGX 3PZDA 2K6QA 2A5UA 3H6NA 4URKA 4ANUA 3K9PB 4FULA 4KZ0A 3KUZA 2FCSA 2MBQA 1VD2A 3NY5A 4NJ7A 4G0NB 4XC2A 1UH6A 1LFDA 4GDLB 1IP9A 4IWOA 2B3AA 4LJPB 1GUAB 2ZVOA 1EF5A 2BYVE 3HHMA 3UGBB 3BY4B 4JLCA 4PS8A 4XX5A 4IG7B 3A9KA 1L2NA 4FN2A 3VH3B 3JW0X 4WJNA 5C23A 1WJUA 2KMAA 1WJ4A 3L16A 3RUIB 3TCAA 2JWZA 1ZGUB 3SU8X 2L76A 3WIMA 1WR6E 4ANWA 2PEAA 1OQYA 3Q3JA 4HDQA 1JRUA 2YLMA 1S1QB 3ZNID 3OJ4B 3ZKJC 3ZNHB 3QX1A 3EHVA 2IY0B 1YQBA 2O6VD 3NS8A 4ZYNA 5HKHA 1H8CA 3WAOA 2AL3A 3VH4B 1UELA 2G4SA 2DZMA 2O2VB 2PE6B 3R66C 3X23A 2GOWA 3DDCB 4WQOB 1UBIA 4FHKA 5AEKB 3KUCB 3VVWB 2D2QA 2KC1A 4WJOA 4HWIB 2JUOA 2LRUA 2EMTA 1E8WA 2ZPYA 3A33B 3V61A 4W9IA 4LJOB 4CHKA 3DOWA 1SGHA 2K8BA 2KWVB 2JPHA 1WXAA 3HK0A 2L05A 3S2AA 2XK5A 1P3QU 3PHWB 3ZUNA 2J0MA 2D07B 4LDTD 5IAAC 3H7PA 3ML8A 4W9LA 2CU1A 2Z0EB 5D6JB 2RGFA 2EKEC 3C0RB 4K7WA 1R4MI 4GXBA 2HD5B 2RD0A 3TBLD 1LXDA 2KDEB 2K39A 2DAFA 4WWNA 4IWPA 2KX0A 2IZVB 4FBJB 2M17A 3VXWA 1WMHA 4KDLB 2J7QB 1TBEA 2Z59B 3VAWA 2IO2B 5FR6A 1WE7A 4FA6A 2DZJA 2XEWA 2DX5B 2LXCA 3PT2B 1FXTB 4EZKA 2GBNA 3A9JA 3QC8B 1KOTA 2QHOA 1Q0WB 4G50A 5CTRC 4K7SA 2DYBA 2WYQA 1E7VA 4DHZB 2MCNB 2LVPA 1XQQA 3VTWA 1TTNA 3UQBA 1XD3B 2HE7A 2IYDB 3L17A 2DYMA 5TR5A 2L0TA 1RRBA 2C7HA 2FCMA 3DQVA 1OGWA 2KWCA 3V62A 2KVRA 4K81A 2LD9A 2ZEQA 1V81A 3H9DA 2BYEA 4HDOA 4DHJB 1GG3A 4LCDE 1E8ZA 2PJHA 3ZW3A 1IPGA 4IW0A 2UWQA 4NAWA 4P7IA 1KM7A 2HJ8A 3A4RA 1V80A 3M3JA 2M0XA 3IBEA 1J0GA 1X1MA 3JSVB 4GIVA 2N1WA 3AU5A 3PVLA 2FUHB 2KFJA 1KJTA 2KQSA 2O6VA 3IFWB 4KIKB 2GBRA 2G3QB 1WGGA 2GMIC 2HTHA 4FLHA 2KFKB 2BF8B 1SE9A 4TQ1A 3KW5B 4F8CB 2XK5B 4DHJD 4NQKE 3OAWA 3H1UA 4FJYA 3H7PB 2KKCA 2MX2A 4BKTA 2KDIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VHT C;  2DZK A;  2JY6 A;  1P98 A;  1WFY A;  2REX A;  1EF1 A;  5LXI B;  5J17 A;  2DHZ A;  2ZNV C;  4MGK E;  3UF8 A;  2D3G A;  3VFK A;  2KO3 A;  4BBN C;  3DPD A;  2LGY A;  1VCB A;  2NCN A;  4TQ0 A;  3RZW C;  1WX7 A;  2KFK A;  3KH0 A;  4HK2 A;  1Z2M A;  2V4L A;  3N30 A;  3PV1 A;  5E6P A;  3WAP A;  3QHT A;  3QQ8 B;  2LVQ A;  2D11 A;  1ZW7 A;  2JRH A;  2OOB B;  5L95 C;  4GDK B;  3ZLZ A;  2C5L C;  2KAN A;  3DVN U;  2KHW B;  2KWU B;  4N9F 4;  3TL5 A;  4A3P A;  1P0R A;  2L3Z A;  4MGZ E;  1AAR A;  1NDD A;  4RM8 A;  3ZDM C;  4CYE A;  4DDI D;  5JHB A;  4CO7 A;  1ZKH A;  3APC A;  3PRZ A;  2CHZ A;  1WXV A;  1H4R A;  2DAJ A;  2LGD A;  4MGI E;  5DPW A;  2FNJ B;  1OEY A;  3QA8 A;  4GN1 A;  4IC7 B;  4GU2 A;  2NBU A;  2BWE S;  2LGX A;  3NZU A;  4NJ6 A;  3CMM B;  2MQJ A;  3UIP B;  1E8Y A;  2DZI A;  3A1Q B;  4ZRJ A;  3JYU A;  4G11 A;  4WWP A;  3AUL A;  2NVU I;  1YIW A;  1Y8R C;  2IBI B;  1E90 A;  4KZC A;  1P1A A;  5D94 A;  1YJ1 A;  3N32 A;  2FIF A;  1GNU A;  1M94 A;  2KJH B;  2KJR A;  2NR2 A;  3B1L X;  4ZRI A;  4GMV A;  3RD2 A;  1WGR A;  5J18 A;  3PS6 A;  1I42 A;  2O2V A;  4II2 B;  1WZ0 A;  4M8N A;  3KYD D;  3RZF A;  3DBL I;  1YX6 B;  3A9K B;  3VTU A;  5JH5 C;  3V60 A;  1WH3 A;  3HM6 X;  1J8C A;  4BVU C;  1NBF C;  2K8C A;  3A4S C;  2NPT B;  2KLG A;  4EFO A;  3ZIM A;  4KSL C;  4A3O A;  3KYC D;  4HLE A;  3SDL C;  2ZNV B;  2LJ5 A;  1EUV B;  5LXH A;  2G45 B;  4X57 B;  5DCN A;  4OVU A;  5CX3 A;  3U7D A;  4AUQ C;  4AWJ A;  2KD0 A;  4MDK E;  2FAZ A;  1GC7 A;  1WM2 A;  2RR9 A;  3IG3 A;  3PRE A;  4IWQ A;  2MP2 B;  4W9K A;  3VUY A;  2MLB A;  2K8H A;  3A1Q A;  3DBS A;  3ML9 A;  2NBW B;  3PLV A;  1F9J A;  2CS4 A;  1YX5 B;  2KX3 A;  3AI5 A;  4GSW A;  2BKF A;  4FJV B;  3W1S C;  3EC8 A;  2NS5 A;  3V6C B;  1RFA A;  1WM3 A;  3VUW A;  2WX1 A;  2ZJD A;  3KVF B;  2KLC A;  3ZTC A;  4A20 A;  4ASW C;  2AL6 A;  3T9L A;  3ECI A;  3M95 A;  4IM2 A;  1YD8 U;  2A4Z A;  4IM3 A;  3DVN V;  4HCN B;  4W9C A;  4E71 A;  2KMC A;  2BGF A;  3L08 A;  1KLV A;  2RSU A;  4M8M A;  3OLM D;  2C60 A;  1V86 A;  1E7U A;  4MJS B;  4E74 A;  4YL8 A;  1LM8 B;  2KTR A;  5E6N A;  5EDS A;  1E8X A;  5G55 A;  1GJZ A;  1WXM A;  2KTF A;  3ZDT A;  4EUT A;  2MWS B;  3V6E B;  2EMS A;  4RM9 A;  1V5O A;  3MHS D;  1V9J A;  2GBM A;  2UYZ B;  4I6N B;  2N7D A;  1QZE A;  3DBH I;  1LQB A;  4G3X B;  4FHJ A;  2IY1 B;  2NPT A;  3EEC A;  4MGY E;  4AJY B;  3WA0 A;  2KXJ A;  3ZVV A;  5C1Z A;  4FAD A;  2KNB A;  3DBR I;  1I35 A;  4ICU A;  4AJW A;  2N1V A;  2MBE A;  4NPN A;  4BOZ B;  1R4N I;  1WX9 A;  4JGH B;  3W1S A;  1WE6 A;  1RLF A;  3IHP C;  2GBK A;  3LJ3 A;  2KOX A;  3IVF A;  4MH0 E;  4EKU A;  2LUE A;  3P2B A;  4DXA B;  2JT4 B;  2JZ3 B;  1WZ3 A;  3KUD B;  4K7U A;  1TGZ B;  2N7E A;  5GMV A;  5JZE B;  3RT3 B;  1WGH A;  3DCG A;  3I3T B;  2KDB A;  2LI5 A;  5CHF A;  2PPH A;  1WJN A;  3D32 A;  3QJZ A;  4J6I A;  1C3T A;  3JSV A;  3MTN B;  3UIN B;  2R2Q A;  4ICV A;  5AZH A;  3K9O B;  1RAX A;  4W9E A;  3ALB A;  2K6D B;  3WAL A;  1UGM A;  3L54 A;  2M8S A;  5CHV C;  3WAN A;  2KZR A;  3DVG Y;  3QIJ A;  3ZNZ B;  3X0W A;  2WX0 A;  2JVC A;  2N9P C;  1S3S G;  3T8M A;  2N9E B;  5G2N A;  3ONS A;  3U8Z A;  3SD5 A;  2MRP A;  1WF9 A;  1V6E A;  2C9W B;  1UD7 A;  2I1K A;  2KK8 A;  1WR1 A;  3QK0 A;  1PQS A;  4ZRK A;  4B95 A;  2V3S A;  1Q1O A;  2W9N A;  3R3M A;  3QWZ B;  4BKS D;  1Z5S B;  2OJR A;  3AU4 A;  2G4D B;  3W1Y A;  3H7S A;  2JF5 A;  4GDK A;  4PS7 A;  4DHZ E;  4TV3 A;  1OEY J;  3B0A A;  4JIO U;  2MA9 B;  2AWT A;  2JXX A;  2L7R A;  3M63 B;  3TIX A;  4ANX A;  3B08 A;  4PYU A;  1UBQ A;  4MM3 A;  3PSE B;  2BWF A;  5IA7 A;  3WAM A;  5J2R A;  3APD A;  4BFR A;  1V49 A;  5LLI A;  2LVO A;  2VRR B;  1WMH B;  4PS3 A;  4W9H A;  3TMP B;  4GDL A;  3HM3 A;  4K1R B;  2IO3 B;  1WYW B;  5D2M B;  4KDI C;  3L13 A;  4MEM A;  4W9D A;  2Z0D B;  2WDT B;  4I6L B;  4BKS A;  4BBN F;  2N4F A;  3PRP B;  4KVG B;  4NQL B;  2C7N B;  1WRD B;  4B6W A;  5JHA A;  4TKN A;  3VTV A;  4E3C A;  2KN5 A;  4KSK C;  3VDZ A;  3U30 A;  3PLU A;  3ZO5 B;  2LZ6 A;  4XZ4 A;  1WGY A;  2WWZ A;  1WXS A;  2NBV B;  3RYT A;  3TJP A;  4WJP A;  1C1Y B;  2MP2 A;  3Q3F A;  5DPT A;  1WI0 A;  4II3 B;  4HVB A;  4M0W B;  1WGD A;  2MBB B;  2K25 A;  2L8J A;  3L0W B;  2M4N A;  4RMA A;  4ANV A;  4MSM B;  2Y5B B;  3APF A;  3R7Q A;  2CHX A;  3EFU A;  2IO0 B;  1D3Z A;  4GGQ A;  4FJZ A;  1EO6 A;  1L7Y A;  2LAS A;  4LDT B;  1WX8 A;  1CMX B;  1HE8 A;  4NY0 A;  5DPR A;  3SHQ A;  4DWF A;  4EOY A;  2JRI B;  2JZZ A;  2RPQ A;  2IO1 B;  1WIA A;  2D10 A;  2GBJ A;  4IUM B;  2XBB C;  2V1Y A;  2ZZP B;  1IYF A;  4EEW A;  3NZS A;  2LRW A;  2L00 B;  4MEL A;  3ZRC A;  2ZVN A;  2K1F A;  4HPL B;  4MJS A;  1J19 A;  2CR5 A;  4DK5 A;  4AP4 C;  1BT0 A;  2KTR B;  3BIN A;  3M62 B;  3GOE A;  3GZN I;  4W9J A;  2BKR B;  2DYO A;  2BYF A;  2N9X A;  1XT9 B;  4NNJ B;  1UZX B;  2O6V B;  5CHW A;  1V5T A;  3QAR A;  5L83 A;  4EZJ A;  3L10 B;  4F7Z A;  5KHO A;  2CHW A;  4KIK A;  3OJ3 A;  3PHX B;  1E5W A;  4NAW B;  3R7R A;  3NHE B;  2MW5 A;  3O65 B;  1Q5W B;  4HXD A;  2MBH A;  4TUU A;  3PRM B;  2R2O A;  2CKH B;  3ZNG C;  3VUX A;  2ZCB A;  1WY8 A;  4EZL A;  2ASQ A;  5D7G A;  2AEH A;  1P9D U;  3JVZ X;  4WAA A;  3CST A;  4BKG A;  4MSQ B;  4JL9 A;  5E6O A;  3N3K B;  4WJQ A;  1TZ1 A;  2J0J A;  3CSF A;  5KHQ A;  2J0K A;  2PE9 A;  1OTR B;  2YVC A;  3MJW A;  4B9K A;  2M1M A;  3NOB A;  3QCA A;  3ZTD A;  2FCN A;  4HJK A;  2DEN B;  4HCP B;  4ZDV A;  2ZCC A;  2KC2 A;  4DDG D;  4IM0 A;  4OVV A;  1GC6 A;  1K8R B;  3UQA A;  3ZRF A;  2C7M B;  2FCQ A;  4DBG A;  1V2Y A;  5BO4 B;  4AOF A;  1T0Y A;  5AZF A;  4F1S A;  2ZPN A;  1G6J A;  2BPS A;  4JQW C;  3RCZ A;  1SIF A;  4BOS C;  2FID A;  3ENE A;  2MBO A;  3VQI A;  1A5R A;  4WWO A;  2I1J A;  1WJ6 A;  2AYO B;  4W9F A;  4KV2 A;  4PYZ A;  4GB9 A;  1U4A A;  1NI2 A;  3LDZ E;  3PGE A;  3PTF C;  5DPS A;  4HPM B;  3RUL A;  2LXA A;  2MSE D;  3QAQ A;  4GOC A;  3CF6 E;  5AZG A;  2KJ6 A;  2L0F A;  4I6P A;  2KDF B;  4W9G A;  2LWP A;  3PPA A;  1MG8 A;  3AXC A;  3UIO B;  3HIZ A;  1ISN A;  3A9J B;  2KQ7 A;  3DVG X;  3PZD A;  2K6Q A;  2A5U A;  3H6N A;  4URK A;  4ANU A;  3K9P B;  4FUL A;  4KZ0 A;  3KUZ A;  2FCS A;  2MBQ A;  1VD2 A;  3NY5 A;  4NJ7 A;  4G0N B;  4XC2 A;  1UH6 A;  1LFD A;  4GDL B;  1IP9 A;  4IWO A;  2B3A A;  4LJP B;  1GUA B;  2ZVO A;  1EF5 A;  2BYV E;  3HHM A;  3UGB B;  3BY4 B;  4JLC A;  4PS8 A;  4XX5 A;  4IG7 B;  3A9K A;  1L2N A;  4FN2 A;  3VH3 B;  3JW0 X;  4WJN A;  5C23 A;  1WJU A;  2KMA A;  1WJ4 A;  3L16 A;  3RUI B;  3TCA A;  2JWZ A;  1ZGU B;  3SU8 X;  2L76 A;  3WIM A;  1WR6 E;  4ANW A;  2PEA A;  1OQY A;  3Q3J A;  4HDQ A;  1JRU A;  2YLM A;  1S1Q B;  3ZNI D;  3OJ4 B;  3ZKJ C;  3ZNH B;  3QX1 A;  3EHV A;  2IY0 B;  1YQB A;  2O6V D;  3NS8 A;  4ZYN A;  5HKH A;  1H8C A;  3WAO A;  2AL3 A;  3VH4 B;  1UEL A;  2G4S A;  2DZM A;  2O2V B;  2PE6 B;  3R66 C;  3X23 A;  2GOW A;  3DDC B;  4WQO B;  1UBI A;  4FHK A;  5AEK B;  3KUC B;  3VVW B;  2D2Q A;  2KC1 A;  4WJO A;  4HWI B;  2JUO A;  2LRU A;  2EMT A;  1E8W A;  2ZPY A;  3A33 B;  3V61 A;  4W9I A;  4LJO B;  4CHK A;  3DOW A;  1SGH A;  2K8B A;  2KWV B;  2JPH A;  1WXA A;  3HK0 A;  2L05 A;  3S2A A;  2XK5 A;  1P3Q U;  3PHW B;  3ZUN A;  2J0M A;  2D07 B;  4LDT D;  5IAA C;  3H7P A;  3ML8 A;  4W9L A;  2CU1 A;  2Z0E B;  5D6J B;  2RGF A;  2EKE C;  3C0R B;  4K7W A;  1R4M I;  4GXB A;  2HD5 B;  2RD0 A;  3TBL D;  1LXD A;  2KDE B;  2K39 A;  2DAF A;  4WWN A;  4IWP A;  2KX0 A;  2IZV B;  4FBJ B;  2M17 A;  3VXW A;  1WMH A;  4KDL B;  2J7Q B;  1TBE A;  2Z59 B;  3VAW A;  2IO2 B;  5FR6 A;  1WE7 A;  4FA6 A;  2DZJ A;  2XEW A;  2DX5 B;  2LXC A;  3PT2 B;  1FXT B;  4EZK A;  2GBN A;  3A9J A;  3QC8 B;  1KOT A;  2QHO A;  1Q0W B;  4G50 A;  5CTR C;  4K7S A;  2DYB A;  2WYQ A;  1E7V A;  4DHZ B;  2MCN B;  2LVP A;  1XQQ A;  3VTW A;  1TTN A;  3UQB A;  1XD3 B;  2HE7 A;  2IYD B;  3L17 A;  2DYM A;  5TR5 A;  2L0T A;  1RRB A;  2C7H A;  2FCM A;  3DQV A;  1OGW A;  2KWC A;  3V62 A;  2KVR A;  4K81 A;  2LD9 A;  2ZEQ A;  1V81 A;  3H9D A;  2BYE A;  4HDO A;  4DHJ B;  1GG3 A;  4LCD E;  1E8Z A;  2PJH A;  3ZW3 A;  1IPG A;  4IW0 A;  2UWQ A;  4NAW A;  4P7I A;  1KM7 A;  2HJ8 A;  3A4R A;  1V80 A;  3M3J A;  2M0X A;  3IBE A;  1J0G A;  1X1M A;  3JSV B;  4GIV A;  2N1W A;  3AU5 A;  3PVL A;  2FUH B;  2KFJ A;  1KJT A;  2KQS A;  2O6V A;  3IFW B;  4KIK B;  2GBR A;  2G3Q B;  1WGG A;  2GMI C;  2HTH A;  4FLH A;  2KFK B;  2BF8 B;  1SE9 A;  4TQ1 A;  3KW5 B;  4F8C B;  2XK5 B;  4DHJ D;  4NQK E;  3OAW A;  3H1U A;  4FJY A;  3H7P B;  2KKC A;  2MX2 A;  4BKT A;  2KDI A; 
#chains in the Genus database with same CATH topology
 4LNF A;  3VHT C;  2BBC A;  2REX A;  3AEE B;  5LXI B;  1E6E B;  2KO3 A;  3DPD A;  2LGY A;  4TQ0 A;  4Q2J A;  3U7Z A;  2LUM A;  3PV1 A;  1PYW D;  3BZD B;  1JW9 D;  2H89 B;  1AWD A;  3DVN U;  1SEB D;  1AAR A;  1NDD A;  4RM8 A;  2WXK A;  4DDI D;  2CHZ A;  1MHX A;  2LGD A;  3AE1 B;  3Q8C A;  2FNJ B;  3IT6 B;  2N9K A;  4O1N A;  1IGC A;  3A1Q B;  1MJD A;  3HVZ A;  1KTK A;  3I57 A;  1Y56 A;  3V3X A;  2JZP A;  3B1L X;  4ZRI A;  5J18 A;  3O13 A;  1FNV A;  5JH5 C;  1J8C A;  1NBF C;  2K8C A;  3A4S C;  2L1A A;  1L0X B;  1DOI A;  5LNK 1;  1TKY A;  3KYC D;  1YNT E;  1EUV B;  4OVU A;  1I4X A;  1I4H A;  5CX3 A;  4AUQ C;  2RR9 A;  4W9K A;  1YX5 B;  5IO9 A;  4A55 A;  5IOI A;  3PZ7 A;  3W1S C;  3V6C B;  1WM3 A;  2ZJD A;  3ZTC A;  4A20 A;  1IBX B;  1YN5 A;  2ICI A;  1YD8 U;  2A4Z A;  2AQ1 B;  4HCN B;  1ZP0 B;  4E71 A;  2BGF A;  4M8M A;  3OLM D;  2N9L A;  1LM8 B;  3BVZ A;  1E8X A;  3DBL B;  2KTF A;  1FRD A;  1PFD A;  1JRP A;  1MFW A;  3KQ4 A;  1D5M C;  2GBM A;  4I6N B;  1QZE A;  3DBH I;  4G3X B;  1D6E C;  3BII D;  2NPT A;  5D3I B;  3EEC A;  3N9Y C;  4MGY E;  3WA0 A;  3DHH C;  4FAD A;  3DBR I;  1IGD A;  1RFK A;  2N1V A;  4NPN A;  3W1S A;  3IHP C;  1GPX A;  3IVF A;  1TYG B;  1YQ3 B;  2JT4 B;  2JZ3 B;  4ITK A;  5GMV A;  3B2G A;  1ZUD 2;  1WGH A;  1YJJ A;  2PPH A;  1C3T A;  1V1O A;  2R2Q A;  3WAL A;  3K9O B;  1RAX A;  1UGM A;  2GB1 A;  5CHV C;  3WAN A;  2HDE A;  3T8M A;  2ZW1 A;  5G2N A;  2JQR B;  4WAF A;  1BXT A;  1GB4 A;  2JYT A;  1SXT A;  1PQS A;  4ZRK A;  3R3M A;  3QWZ B;  3AU4 A;  4TV3 A;  1AW7 A;  2UU7 A;  2JXX A;  1UBQ A;  1N62 A;  1XLN A;  3PSE B;  3C19 A;  1MI0 A;  1V49 A;  1SJH D;  5LLI A;  2VRR B;  3TMP B;  3HM3 A;  2IO3 B;  4MEM A;  3VRA B;  3DWM A;  3BYY B;  4BBN F;  5JHA A;  4B6W A;  4NQL B;  1WRD B;  5EE1 A;  4L2Y A;  2MP2 A;  3AE7 B;  4II3 B;  1V1P B;  1M4V A;  3Q2A C;  4ANV A;  1YQ4 B;  2WQY B;  1C4P A;  2IO0 B;  3SHQ A;  2JSV X;  4NY0 A;  2R61 A;  2V1Y A;  3ZRC A;  1KLU D;  2IDY A;  3Q8B A;  2WXP A;  4DK5 A;  3WCQ A;  3GZN I;  2DYO A;  1VJK A;  3QAR A;  4MAC A;  4F7Z A;  4KIK A;  1E5W A;  1FMA D;  1STE A;  3PRM B;  3U2S C;  2KAC A;  2DWQ A;  2J4X A;  2ZCB A;  2ASQ A;  4N58 A;  4WAA A;  4BKG A;  3ZXV A;  4JL9 A;  2J0J A;  3CSF A;  2J0K A;  4XE0 A;  1F1H A;  2KAJ A;  3NJT A;  1N63 A;  4OVZ A;  4HJK A;  4RF1 A;  4HCP B;  5C3J B;  1I7H A;  2D3A A;  2J53 A;  3UQA A;  4BZA A;  3ZRF A;  2C7M B;  1V2Y A;  5BO4 B;  4US8 A;  1N60 A;  5AZF A;  2ZPN A;  4KKI A;  1E9M A;  4BOS C;  4WWO A;  4PYZ A;  1U4A A;  3PGE A;  4XDC A;  2MSE D;  3QAQ A;  3RNB C;  2L0F A;  4I6P A;  2KDF B;  1QLB B;  4W9G A;  2PLP A;  2FE8 A;  1ISN A;  2KQ7 A;  3DVG X;  4URK A;  4FUL A;  4KZ0 A;  3C8Y A;  1FXI A;  4NJ7 A;  4XC2 A;  2B3A A;  4LJP B;  1GUA B;  2ZVO A;  2BYV E;  3NS1 A;  1EU3 A;  1HXY D;  4WJN A;  1JWA D;  3L16 A;  1V97 A;  4ANW A;  2PEA A;  4IDI A;  1S1Q B;  2BS2 B;  4P16 A;  3QX1 A;  3VH4 B;  2KN4 A;  2O2V B;  3MC0 B;  4WQO B;  4FHK A;  3KUC B;  4WJO A;  2JUO A;  3V61 A;  1L6U A;  4LJO B;  3DOW A;  2Y3A A;  2K8B A;  2KWV B;  2JPH A;  3ZUN A;  1T6B X;  2D07 B;  3H7P A;  2WXO A;  3ML8 A;  2CU1 A;  4W9L A;  5HFY A;  2RD0 A;  3TBL D;  2NTS A;  1HTQ A;  4IWP A;  3N1X C;  3NVV A;  2KX0 A;  1CQV A;  2M17 A;  1C4C A;  3VXW A;  1TZO A;  2J7Q B;  2NTT A;  2K5P A;  3E9S A;  1QT9 A;  3B9J A;  3PT2 B;  2GLS A;  2WU2 B;  4R3D A;  1LO5 D;  2NMQ A;  3QC8 B;  4YTN B;  2WXR A;  4OHJ A;  2WYQ A;  2ACZ B;  2LVP A;  4RGO S;  1XQQ A;  1TTN A;  5H8Y E;  3V05 A;  1EU4 A;  2PKO A;  5TR5 A;  3B2F A;  3GP7 A;  2FCM A;  3AEC B;  4HEA 1;  1WXQ A;  2KWC A;  4RH6 A;  2LD9 A;  4XYC A;  2ZEQ A;  1AYF A;  1TT5 B;  4LCD E;  5BYS A;  2WXN A;  1IPG A;  1OQQ A;  2UWQ A;  4P7I A;  1KH0 A;  1KM7 A;  3M3J A;  2GI9 A;  4ZHP A;  1J0G A;  2PVO D;  3JSV B;  3AMZ A;  3N1Y C;  3PVL A;  2FUH B;  3IFW B;  4KIK B;  2GBR A;  2G3Q B;  2WXL A;  1FPY A;  4FLH A;  2WDV B;  2KFK B;  3KW5 B;  2XK5 B;  4NQK E;  3H1U A;  3PZ8 A;  4YSY B;  2JY6 A;  2V3N A;  4YTP B;  5J17 A;  4S17 A;  2RMM A;  5BYR A;  2ZNV C;  4MGK E;  2BS3 B;  2D3G A;  1P7E A;  1N61 A;  1FCC C;  2NCN A;  3I63 C;  2VZK B;  3KH0 A;  4HK2 A;  3Q8F A;  2V4L A;  4C4V A;  3QHT A;  2LVQ A;  3W2D A;  2D11 A;  1ZW7 A;  2JRH A;  2OOB B;  4GDK B;  4ACF A;  2C5L C;  2KAN A;  2KHW B;  4DXF A;  1FNW A;  3TL5 A;  4A3P A;  4XWW A;  3CWI A;  4K3B A;  5GXG B;  4CYE A;  3OWE B;  4KX6 B;  4CO7 A;  1ZKH A;  1I4P A;  4MGI E;  4LNK A;  1P7F A;  2NBU A;  2BWE S;  1UGJ A;  2LGX A;  3J9C A;  2FBW B;  4NJ6 A;  4A6Q A;  1E8Y A;  1L6V A;  3TEY A;  3ZJT A;  3AV8 A;  2NVU I;  2IBI B;  1E90 A;  1V8C A;  1YJ1 A;  2WP9 B;  2KJH B;  1M94 A;  4GMV A;  3RD2 A;  2AQ3 B;  3LYY A;  2HJ1 A;  2LGI A;  4II2 B;  4M8N A;  3KYD D;  3A9K B;  3V60 A;  3Q14 C;  4BVU C;  2NPT B;  4KSL C;  4DXG A;  4A3O A;  2V3P A;  2QIL A;  4HLE A;  2INP E;  1UNS A;  2ZNV B;  2LJ5 A;  5LXH A;  2G45 B;  4X57 B;  2FAZ A;  4IWQ A;  2MP2 B;  1NEN B;  1XLO A;  4KKJ A;  3A1Q A;  4NJC A;  2L52 A;  2NBW B;  2V4I B;  2LHE A;  2KX3 A;  4GSW A;  2BKF A;  2NS5 A;  1ENF A;  1VDV A;  2WX1 A;  2G9H D;  3KVF B;  3URY A;  2KLC A;  3Q8E A;  2AL6 A;  4J3O D;  3EFC A;  5FR3 A;  4IM3 A;  3DVN V;  3LB8 C;  4W9C A;  3NVY A;  2OJW A;  3Q69 A;  4HKZ E;  2RSU A;  4YWG G;  2C60 A;  2BT6 A;  5G5H A;  1VRA B;  4YL8 A;  2MHJ A;  5EDS A;  5G55 A;  1GJZ A;  3ZDT A;  3MC9 A;  2MWS B;  4KGT A;  1SE2 A;  2UYZ B;  2N7D A;  1LQB A;  4EE2 A;  1SJE D;  2W54 A;  1I35 A;  3IT4 B;  2MBE A;  1WX9 A;  4JGH B;  1JWS D;  1RLF A;  3U4E G;  1AN8 A;  4MM3 B;  3KUD B;  1WZ3 A;  2MH7 A;  5JZE B;  2VZK D;  2KDB A;  3I3T B;  3D32 A;  1T5X D;  1WJN A;  2LJI A;  3JSV A;  3MTN B;  3UIN B;  5AZH A;  3ALB A;  2KZR A;  3DVG Y;  3QIJ A;  4A9A A;  3GZN B;  3R2T A;  1FEH A;  4ZRQ A;  2N9E B;  4B0M A;  3U8Z A;  1V6E A;  4REZ A;  2I1K A;  2KK8 A;  1E7P B;  1WR1 A;  3L4P A;  1GOZ A;  3RN9 C;  1Q1O A;  1QIL A;  2J42 A;  2OJR A;  2G4D B;  1YMH E;  4DHZ E;  1YOV B;  3TIX A;  1MG4 A;  3M63 B;  3B08 A;  2KQ4 X;  2BB5 A;  5IA7 A;  3MFG A;  4GDL A;  3L13 A;  4W9D A;  2WDT B;  2W3R A;  1QOG A;  2C7N B;  1N5X A;  3Q3N C;  1XXG A;  2KN5 A;  3SFD B;  3PLU A;  3ZO5 B;  2WWZ A;  1WXS A;  3MJ5 A;  2JX5 A;  4WJP A;  3Q3F A;  4HVB A;  3AEB B;  2L8J A;  3L0W B;  2KT7 A;  3NRZ A;  3BVM A;  2MJD A;  3TSS A;  4FJZ A;  2LAS A;  5DPR A;  4WH4 A;  2D10 A;  4IUM B;  2XBB C;  3AE2 B;  1KLG D;  1J7B A;  2M56 B;  4HPL B;  1NEK B;  2CR5 A;  4D2K A;  1BT0 A;  3GOE A;  2BKR B;  4L1B A;  2O6V B;  1QOB A;  1C9F A;  1FD6 A;  2CHW A;  3PHX B;  1TY2 A;  4NAW B;  3R7R A;  1QF6 A;  3IAM 1;  2R2O A;  3ZYY X;  4XDD A;  4EZL A;  1P9D U;  3N3K B;  1L4Z B;  2BQQ A;  5KHQ A;  2YVC A;  1FFV A;  3AE6 B;  2M1M A;  2INN E;  4RGM A;  1EWY C;  3FIL A;  3ZTD A;  2DEN B;  5C2T B;  2ZCC A;  2KC2 A;  3KLS X;  2QSD A;  4C4V B;  4LLG M;  3RNA C;  3VRB B;  4TMA B;  1TKG A;  1TKE A;  2FCQ A;  3DBR B;  1QKZ A;  4AOF A;  1GAQ B;  1G6J A;  2BPS A;  4JQW C;  1SIF A;  5TSS A;  2FID A;  3ENE A;  4W9F A;  2LGS A;  1JWM D;  3LDZ E;  1I4G A;  4GB9 A;  3EA6 A;  3RUL A;  3AE4 B;  1VR9 A;  3RNC C;  3SEB A;  1MG8 A;  3BK1 A;  2K6Q A;  3K9P B;  3KUZ A;  5E6J A;  3NY5 A;  1LFD A;  4GDL B;  5EE9 A;  5J2R A;  3UGB B;  3BY4 B;  4PS8 A;  4IG7 B;  3RNE C;  1K51 A;  2KWD A;  1L2N A;  4N6E B;  2W55 A;  5C23 A;  2KMA A;  3RUI B;  2JWZ A;  2WDR B;  2I2Y A;  1MPE A;  1OQY A;  2IGG A;  1UF0 A;  1ZE3 D;  2YLM A;  3ZKJ C;  1TS5 A;  3EHV A;  2IY0 B;  3NS8 A;  4YT0 B;  5HKH A;  1ET6 A;  2G4S A;  2DZM A;  2PE6 B;  5AEK B;  3DDC B;  3I5J C;  2D2Q A;  2D3C A;  3ZQ4 A;  3NUH B;  4W9I A;  5EE3 A;  4CHK A;  4LNN A;  3W9C B;  3HK0 A;  2L05 A;  3KWV A;  3P4Q B;  2Z0E B;  4K7W A;  4GXB A;  2HD5 B;  2KDE B;  3RMK C;  4RGN A;  2IZV B;  1C4A A;  4KDL B;  1KF6 B;  1NVI D;  1TBE A;  2DZJ A;  2DLB A;  3A9J A;  1Q0W B;  4CQN A;  4G50 A;  1TIF A;  2SAK A;  2DYB A;  1XLP A;  3AB5 A;  2MCN B;  2K0P A;  3UQB A;  2IYD B;  2LFI A;  1L5P A;  2L0T A;  1RRB A;  2C7H A;  2VH1 A;  1OGW A;  3MP9 A;  3OG5 A;  1XCT L;  1HA5 A;  2BS4 B;  4DHJ B;  1E8Z A;  4K3C A;  3ZW3 A;  3EUB 2;  3AEF B;  4NAW A;  2BB6 A;  4GIV A;  3DHI C;  2KFJ A;  3VR8 B;  2W82 A;  2Y5P A;  5T8I A;  4IKG A;  2AX5 A;  2KYW A;  4KGR A;  4ZHO A;  1L4D B;  4F8C B;  5IKC M;  4DHJ D;  2PVG C;  4FJY A;  3P4S B;  2DZK A;  2QJL A;  3MHZ A;  4LNI A;  5D3D A;  2WU5 B;  2WXM A;  4BBN C;  3ZJU A;  1R7S A;  3RZW C;  1ZOY B;  1Z2M A;  3N30 A;  5E6P A;  3WAP A;  2ZW0 A;  3QQ8 B;  1ACC A;  5L95 C;  4OZC A;  4RCO A;  2KWU B;  4NZL B;  3Q3M C;  3ZDM C;  1YN4 A;  3APC A;  3BK2 A;  5IP4 D;  1H4R A;  2DAJ A;  5DPW A;  1OEY A;  3HUI A;  4IC7 B;  3CMM B;  2MQJ A;  4C00 A;  1J7A A;  1E10 A;  2DZI A;  3TEZ A;  3GE3 C;  1TJE A;  3JYU A;  4G11 A;  4KZC A;  1P1A A;  3SR6 A;  5D94 A;  3DBH B;  2FIF A;  2NR2 A;  4JX1 C;  1WGR A;  3ZJV A;  3PS6 A;  3R2I A;  1I42 A;  2CJN A;  2O2V A;  3RZF A;  3DBL I;  1YX6 B;  3AE9 B;  1JML A;  3VTU A;  1GB1 A;  1WH3 A;  3HM6 X;  4C56 C;  2KLG A;  2X8X X;  3SDL C;  3TUO A;  3U7D A;  3IG3 A;  1WM2 A;  3VUY A;  3DBS A;  3ML9 A;  3AI5 A;  2W3S A;  1BML C;  3N1Z C;  1YJI A;  1RFA A;  2V9H A;  2DNF A;  3T9L A;  2WXQ A;  4IM2 A;  2M0A A;  1JWB D;  1KLV A;  4MJS B;  4E74 A;  1FIQ A;  1OFF A;  5E6N A;  5AUK A;  1WXM A;  3IAS 1;  5BMG A;  4EUT A;  4BAX A;  2EMS A;  2V0G A;  1V5O A;  3KWL A;  1V9J A;  2D3B A;  1VZ6 A;  4FHJ A;  2IY1 B;  5H92 C;  4AJY B;  2WDQ B;  3MC8 A;  3TEX A;  2KNB A;  4ICU A;  2QDF A;  1IBX A;  3LJ3 A;  2KOX A;  3CIR B;  2IPK D;  3P2B A;  4EKU A;  1SB3 C;  4K7U A;  1D4B A;  2N7E A;  3DCG A;  5CHF A;  2K6D B;  3L54 A;  2M8S A;  1SE4 A;  3ZNZ B;  3X0W A;  4ARC A;  1S3S G;  4HRS A;  2J52 A;  3SD5 A;  2MRP A;  1WF9 A;  5HG2 A;  4KGS A;  1CJE A;  2C9W B;  4L23 A;  2JU6 X;  1B1Z A;  4B95 A;  4BKS D;  3W1Y A;  3AE5 B;  3H7S A;  4GDK A;  1QQR A;  3B0A A;  4XWT A;  3RI7 C;  4JIO U;  1F77 A;  3AEA B;  2WLB A;  3WAM A;  3APD A;  1TS4 A;  1WMH B;  4PS3 A;  4W9H A;  2IGD A;  4KDI C;  3NG0 A;  2Z0D B;  4I6L B;  4BKS A;  2RDB C;  1CK1 A;  2N4F A;  2VH2 A;  3VTV A;  3U30 A;  2QC8 A;  2LZ6 A;  1I4R A;  2PIA A;  2YEP F;  1UWM A;  4AS1 A;  1F0Z A;  1A70 A;  4M0W B;  3E56 A;  2MBB B;  2K25 A;  2M4N A;  2EKI A;  4MSM B;  2Y5B B;  4JWU C;  1JRO A;  2WXJ A;  3R7Q A;  1HZ6 A;  1F52 A;  4GGQ A;  4MT5 A;  1EO6 A;  4LDT B;  1WX8 A;  1CMX B;  1HE8 A;  4DWF A;  1FRR A;  4EOY A;  2JZZ A;  2RPQ A;  1R4N B;  1WIA A;  2IO1 B;  2ZZP B;  2B76 B;  4EEW A;  3NZS A;  2L00 B;  2SEB D;  3AEG B;  2K1F A;  4RF0 A;  1J19 A;  4MJS A;  4AP4 C;  3AE8 B;  2KTR B;  3M62 B;  4W9J A;  5CHW A;  4NNJ B;  1XT9 B;  1V5T A;  1T0R C;  2EEL A;  4EZJ A;  1FFU A;  3OJ3 A;  2N7J A;  1C78 A;  2MW5 A;  2MBH A;  3Q8A A;  4TUU A;  2CKH B;  4PK1 A;  3ZNG C;  3VUX A;  4P1B C;  1WY8 A;  2ON8 A;  5D7G A;  3JVZ X;  1JAL A;  1TY0 A;  1TS3 A;  5E6O A;  1N5W A;  3MJW A;  4LTU A;  1I4Q A;  1OTR B;  2PE9 A;  4HPP A;  1FNU A;  4B9K A;  3W5U B;  1XLQ A;  3QCA A;  1SIJ A;  1HZ5 A;  4ZDV A;  1HQR D;  4DDG D;  3H8H A;  4IM0 A;  4OVV A;  2WGS A;  1GC6 A;  2RPV A;  3AED B;  1V1P A;  1T0Y A;  1FM0 D;  1D5Z C;  2IND C;  1SF0 A;  4KV2 A;  5DPS A;  4RGT A;  3UI3 A;  2LXA A;  4GOC A;  1PUT A;  3CF6 E;  2KJ6 A;  1XCQ L;  2LWP A;  3PPA A;  1PDX A;  3AXC A;  2RDH A;  3UIO B;  3HIZ A;  3PZD A;  4AQ7 A;  3NZ3 A;  2IGH A;  4OW0 A;  2A5U A;  4P6V F;  2FCS A;  2MBQ A;  1VD2 A;  3P4R B;  4G0N B;  1UH6 A;  1XF5 L;  4IWO A;  3GB1 A;  1EF5 A;  1FXA A;  3A9K A;  4FN2 A;  3VH3 B;  1ZXH A;  3JW0 X;  3U52 E;  1T0S C;  4JE3 B;  1WJ4 A;  3SU8 X;  2L76 A;  2QMT A;  2K22 A;  3Q3J A;  4HDQ A;  4ZRP A;  3ZNI D;  5AUI A;  2O6V D;  1YQB A;  4ZYN A;  4OZA A;  3X23 A;  2KC1 A;  5IN7 A;  4HWI B;  2LRU A;  2ZPY A;  1E8W A;  2CU3 A;  3S2A A;  2XK5 A;  5HI1 A;  2J0M A;  4LDT D;  2OHF A;  1ZDV A;  2RGF A;  2K39 A;  4WWN A;  3EGR A;  2Z59 B;  3VAW A;  1T0Q C;  1WE7 A;  2DBY A;  1FXT B;  2E6X A;  2L32 A;  3BVG A;  1KOT A;  2QHO A;  4LNO A;  5CTR C;  3I9V 1;  3FAH A;  3VTW A;  2PMV A;  2HE7 A;  3L17 A;  2WS3 B;  4PT5 A;  1LGR A;  2G1E A;  2KVZ A;  4UDU C;  4K81 A;  1UUP A;  4H2A A;  3H9D A;  2PTL A;  1GG3 A;  2MJE A;  1VZ7 A;  4IW0 A;  4C7Z A;  2HJ8 A;  3A4R A;  3IBE A;  2ONQ A;  2N1W A;  3RFZ B;  3P1M A;  1KJT A;  2BYT A;  5FK9 C;  2KQS A;  2O6V A;  1PGB A;  2Z8L A;  1WGG A;  2WXI A;  1SE9 A;  4TQ1 A;  2XNA C;  2MX2 A;  4BKT A;  2KDI A;  1SE3 A;  4HKQ A;  1P98 A;  1WFY A;  1EF1 A;  2DHZ A;  3UF8 A;  3VFK A;  4HJG E;  2E3T A;  1VCB A;  3RNF C;  1WX7 A;  2KFK A;  1TS2 A;  3AH7 A;  3ZLZ A;  1ET9 A;  4N9F 4;  1P0R A;  2L3Z A;  4MGZ E;  2LMC A;  5HHD G;  2QIE B;  5JHB A;  2OED A;  4ZYS A;  3PRZ A;  1WXV A;  4QAY A;  3QA8 A;  4GN1 A;  3TEW A;  4GU2 A;  3NZU A;  3Q6B A;  5EE0 A;  3UIP B;  1F2R I;  4ZRJ A;  4WWP A;  3AUL A;  1YIW A;  1Y8R C;  1DOY A;  1DGJ A;  3IXS A;  3N32 A;  3SFE B;  1GNU A;  2KJR A;  1JCK B;  3VR9 B;  4LK0 M;  2WHI A;  1WZ0 A;  4YXD B;  1F2R C;  1WWT A;  4EFO A;  3ZIM A;  2KMM A;  4P1C C;  1ESF A;  5DCN A;  4AWJ A;  2KD0 A;  4MDK E;  1GC7 A;  3PRE A;  4WWM A;  3HVD A;  2MLB A;  2K8H A;  3AM9 A;  3PLV A;  2INC C;  1F9J A;  2CS4 A;  3BYT B;  4FJV B;  3NVW A;  3EC8 A;  1RM6 C;  3VUW A;  4ASW C;  4C7Y A;  3ECI A;  3M95 A;  2KMC A;  3L08 A;  1V86 A;  1E7U A;  2KTR A;  2CJO A;  4JWS C;  2IJ0 A;  3V6E B;  1YN3 A;  2RDG A;  4RM9 A;  3MHS D;  1KRH A;  2BVC A;  3ZXR A;  2KXJ A;  3ZVV A;  5C1Z A;  2WNM A;  4AJW A;  3DHG C;  4HRO A;  1K50 A;  4BOZ B;  1R4N I;  1DOX A;  1WE6 A;  2GBK A;  4US9 A;  4MH0 E;  2LUE A;  4DXA B;  1DYQ A;  2XN9 C;  1JWU D;  1TGZ B;  1B9R A;  3RT3 B;  4TSS A;  2LI5 A;  5BMH A;  3QJZ A;  4J6I A;  4C80 A;  2QCZ A;  4ICV A;  4W9E A;  1EWC A;  2WX0 A;  2JVC A;  2N9P C;  2LEK A;  2LHD A;  4A90 A;  1HTO A;  3ONS A;  1UD7 A;  3QK0 A;  2HTM E;  2V3S A;  2W9N A;  1NYQ A;  1Z5S B;  3P63 A;  2JF5 A;  4PS7 A;  5MPO A;  2L83 A;  2WXF A;  1OEY J;  1WSP A;  2MA9 B;  2AWT A;  4YSZ B;  2Q5W D;  2L7R A;  4ANX A;  4PYU A;  2WXH A;  4MM3 A;  2H88 B;  1UWX A;  2BWF A;  2N0S B;  4ZOH C;  4BFR A;  2LVO A;  3P42 A;  2MJ3 A;  4K1R B;  5D2M B;  1WYW B;  3FC4 A;  4KVG B;  3PRP B;  3NVZ A;  4TKN A;  4E3C A;  3BWU D;  4KSK C;  3VDZ A;  1XO3 A;  1ZXI A;  2I38 A;  4XZ4 A;  1WGY A;  2NBV B;  3RYT A;  3TJP A;  1C1Y B;  3ZGZ A;  5DPT A;  1WI0 A;  1WGD A;  4RFB A;  3R8B A;  1N6Z A;  4RMA A;  1SBB B;  1E0Z A;  3APF A;  2CHX A;  4GLS C;  3EFU A;  1D3Z A;  2Y5C A;  1L7Y A;  5G5G A;  1ZDX A;  3RPF C;  2JRI B;  2GBJ A;  4S0R A;  1WRI A;  5BYQ A;  1RYJ A;  1IYF A;  2PW9 A;  2LRW A;  4MEL A;  2ZVN A;  5FKA C;  2JXT A;  2YEP B;  3T3O A;  1L0V B;  3BIN A;  3N20 C;  2MEK A;  1WYG A;  1R4M B;  2BYF A;  2N9X A;  1UZX B;  3Q3O C;  1RWS A;  5L83 A;  2FUG 1;  3L10 B;  5KHO A;  3FIL B;  4YTM B;  3P4P B;  1L0Y B;  3NHE B;  3O65 B;  4HXD A;  1Q5W B;  1FO4 A;  4A8X C;  2AEH A;  3CST A;  4MSQ B;  4WQM A;  2GRI A;  4WJQ A;  1TZ1 A;  3ETR A;  1EM7 A;  4DQO C;  2K9X A;  3NOB A;  3FKY A;  2FCN A;  4M01 A;  4RNA A;  1VZ8 A;  5BMI A;  2K3U A;  3AN1 A;  1K8R B;  1VLB A;  4DBG A;  2QEJ C;  4F1S A;  1WGK A;  1JQ4 A;  3RCZ A;  2MBO A;  3VQI A;  1A5R A;  2I1J A;  1WJ6 A;  2AYO B;  1MHH E;  1NI2 A;  3PTF C;  4HPM B;  4YSX B;  5AZG A;  1IUE A;  3HRD D;  2TSS A;  1K52 A;  3T3N A;  1FCL A;  3A9J B;  3H6N A;  1T3Q A;  4ANU A;  3RNG C;  1CZP A;  1IP9 A;  3HHM A;  4JLC A;  2M19 A;  4XX5 A;  1SSN A;  2X38 A;  3DWG C;  1WJU A;  3TCA A;  1ZGU B;  2AQ2 B;  3W5V B;  3WIM A;  4USA A;  1WR6 E;  4WUR A;  1JRU A;  3OJ4 B;  3ZNH B;  1H8C A;  3WAO A;  4M02 A;  2AL3 A;  2KDM A;  1UEL A;  4OZB A;  3R66 C;  2GOW A;  1UBI A;  3VVW B;  3GS2 A;  2EMT A;  3A33 B;  1SGH A;  1C79 A;  1WXA A;  1QOA A;  4IOI E;  1P3Q U;  3PHW B;  1NYR A;  4ARI A;  4MH8 A;  1D5X C;  5IAA C;  3GE8 C;  5D6J B;  2EKE C;  3C0R B;  1R4M I;  2WXG A;  2D5G A;  1J7C A;  1Q10 A;  1LXD A;  3PO0 A;  1NI3 A;  4M0W A;  2DAF A;  3LXF A;  4FBJ B;  1WMH A;  1BUI C;  4FA6 A;  2IO2 B;  5FR6 A;  5I4D A;  1HEZ E;  2XEW A;  2DX5 B;  2LXC A;  4EZK A;  2GBN A;  4K7S A;  4DHZ B;  1E7V A;  2BTE A;  5JXV A;  1XD3 B;  2BW2 A;  2DYM A;  4N59 A;  1OQR A;  3DQV A;  1C76 A;  3V62 A;  2KVR A;  4B0E A;  1ZPS A;  1K53 A;  1ROE A;  4NAM A;  1V81 A;  2BYE A;  4HDO A;  3AE3 B;  2PJH A;  1QOF A;  1V80 A;  2M0X A;  1X1M A;  1PGA A;  1PGX A;  4JPS A;  4M00 A;  3AU5 A;  1C77 A;  4XGA B;  2GMI C;  2HTH A;  2BF8 B;  4WIP A;  2JWU A;  4FXC A;  1MVK A;  3ABV B;  1KFY B;  3OAW A;  2JYE A;  1XEE A;  3H7P B;  2KKC A; 
#chains in the Genus database with same CATH homology
 3VHT C;  2DZK A;  2JY6 A;  1P98 A;  1WFY A;  2REX A;  1EF1 A;  5LXI B;  5J17 A;  2DHZ A;  2ZNV C;  4MGK E;  3UF8 A;  2D3G A;  3VFK A;  2KO3 A;  4BBN C;  3DPD A;  2LGY A;  1VCB A;  2NCN A;  4TQ0 A;  3RZW C;  1WX7 A;  2KFK A;  3KH0 A;  4HK2 A;  1Z2M A;  2V4L A;  3N30 A;  3PV1 A;  5E6P A;  3WAP A;  3QHT A;  3QQ8 B;  2LVQ A;  2D11 A;  1ZW7 A;  2JRH A;  2OOB B;  5L95 C;  4GDK B;  3ZLZ A;  2C5L C;  2KAN A;  3DVN U;  2KHW B;  2KWU B;  4N9F 4;  3TL5 A;  4A3P A;  1P0R A;  2L3Z A;  4MGZ E;  1AAR A;  1NDD A;  4RM8 A;  3ZDM C;  4CYE A;  4DDI D;  5JHB A;  4CO7 A;  1ZKH A;  3APC A;  3PRZ A;  2CHZ A;  1WXV A;  1H4R A;  2DAJ A;  2LGD A;  4MGI E;  5DPW A;  2FNJ B;  1OEY A;  3QA8 A;  4GN1 A;  4IC7 B;  4GU2 A;  2NBU A;  2BWE S;  2LGX A;  3NZU A;  4NJ6 A;  3CMM B;  2MQJ A;  3UIP B;  1E8Y A;  2DZI A;  3A1Q B;  4ZRJ A;  3JYU A;  4G11 A;  4WWP A;  3AUL A;  2NVU I;  1YIW A;  1Y8R C;  2IBI B;  1E90 A;  4KZC A;  1P1A A;  5D94 A;  1YJ1 A;  3N32 A;  2FIF A;  1GNU A;  1M94 A;  2KJH B;  2KJR A;  2NR2 A;  3B1L X;  4ZRI A;  4GMV A;  3RD2 A;  1WGR A;  5J18 A;  3PS6 A;  1I42 A;  2O2V A;  4II2 B;  1WZ0 A;  4M8N A;  3KYD D;  3RZF A;  3DBL I;  1YX6 B;  3A9K B;  3VTU A;  5JH5 C;  3V60 A;  1WH3 A;  3HM6 X;  1J8C A;  4BVU C;  1NBF C;  2K8C A;  3A4S C;  2NPT B;  2KLG A;  4EFO A;  3ZIM A;  4KSL C;  4A3O A;  3KYC D;  4HLE A;  3SDL C;  2ZNV B;  2LJ5 A;  1EUV B;  5LXH A;  2G45 B;  4X57 B;  5DCN A;  4OVU A;  5CX3 A;  3U7D A;  4AUQ C;  4AWJ A;  2KD0 A;  4MDK E;  2FAZ A;  1GC7 A;  1WM2 A;  2RR9 A;  3IG3 A;  3PRE A;  4IWQ A;  2MP2 B;  4W9K A;  3VUY A;  2MLB A;  2K8H A;  3A1Q A;  3DBS A;  3ML9 A;  2NBW B;  3PLV A;  1F9J A;  2CS4 A;  1YX5 B;  2KX3 A;  3AI5 A;  4GSW A;  2BKF A;  4FJV B;  3W1S C;  3EC8 A;  2NS5 A;  3V6C B;  1RFA A;  1WM3 A;  3VUW A;  2WX1 A;  2ZJD A;  3KVF B;  2KLC A;  3ZTC A;  4A20 A;  4ASW C;  2AL6 A;  3T9L A;  3ECI A;  3M95 A;  4IM2 A;  1YD8 U;  2A4Z A;  4IM3 A;  3DVN V;  4HCN B;  4W9C A;  4E71 A;  2KMC A;  2BGF A;  3L08 A;  1KLV A;  2RSU A;  4M8M A;  3OLM D;  2C60 A;  1V86 A;  1E7U A;  4MJS B;  4E74 A;  4YL8 A;  1LM8 B;  2KTR A;  5E6N A;  5EDS A;  1E8X A;  5G55 A;  1GJZ A;  1WXM A;  2KTF A;  3ZDT A;  4EUT A;  2MWS B;  3V6E B;  2EMS A;  4RM9 A;  1V5O A;  3MHS D;  1V9J A;  2GBM A;  2UYZ B;  4I6N B;  2N7D A;  1QZE A;  3DBH I;  1LQB A;  4G3X B;  4FHJ A;  2IY1 B;  2NPT A;  3EEC A;  4MGY E;  4AJY B;  3WA0 A;  2KXJ A;  3ZVV A;  5C1Z A;  4FAD A;  2KNB A;  3DBR I;  1I35 A;  4ICU A;  4AJW A;  2N1V A;  2MBE A;  4NPN A;  4BOZ B;  1R4N I;  1WX9 A;  4JGH B;  3W1S A;  1WE6 A;  1RLF A;  3IHP C;  2GBK A;  3LJ3 A;  2KOX A;  3IVF A;  4MH0 E;  4EKU A;  2LUE A;  3P2B A;  4DXA B;  2JT4 B;  2JZ3 B;  1WZ3 A;  3KUD B;  4K7U A;  1TGZ B;  2N7E A;  5GMV A;  5JZE B;  3RT3 B;  1WGH A;  3DCG A;  3I3T B;  2KDB A;  2LI5 A;  5CHF A;  2PPH A;  1WJN A;  3D32 A;  3QJZ A;  4J6I A;  1C3T A;  3JSV A;  3MTN B;  3UIN B;  2R2Q A;  4ICV A;  5AZH A;  3K9O B;  1RAX A;  4W9E A;  3ALB A;  2K6D B;  3WAL A;  1UGM A;  3L54 A;  2M8S A;  5CHV C;  3WAN A;  2KZR A;  3DVG Y;  3QIJ A;  3ZNZ B;  3X0W A;  2WX0 A;  2JVC A;  2N9P C;  1S3S G;  3T8M A;  2N9E B;  5G2N A;  3ONS A;  3U8Z A;  3SD5 A;  2MRP A;  1WF9 A;  1V6E A;  2C9W B;  1UD7 A;  2I1K A;  2KK8 A;  1WR1 A;  3QK0 A;  1PQS A;  4ZRK A;  4B95 A;  2V3S A;  1Q1O A;  2W9N A;  3R3M A;  3QWZ B;  4BKS D;  1Z5S B;  2OJR A;  3AU4 A;  2G4D B;  3W1Y A;  3H7S A;  2JF5 A;  4GDK A;  4PS7 A;  4DHZ E;  4TV3 A;  1OEY J;  3B0A A;  4JIO U;  2MA9 B;  2AWT A;  2JXX A;  2L7R A;  3M63 B;  3TIX A;  4ANX A;  3B08 A;  4PYU A;  1UBQ A;  4MM3 A;  3PSE B;  2BWF A;  5IA7 A;  3WAM A;  5J2R A;  3APD A;  4BFR A;  1V49 A;  5LLI A;  2LVO A;  2VRR B;  1WMH B;  4PS3 A;  4W9H A;  3TMP B;  4GDL A;  3HM3 A;  4K1R B;  2IO3 B;  1WYW B;  5D2M B;  4KDI C;  3L13 A;  4MEM A;  4W9D A;  2Z0D B;  2WDT B;  4I6L B;  4BKS A;  4BBN F;  2N4F A;  3PRP B;  4KVG B;  4NQL B;  2C7N B;  1WRD B;  4B6W A;  5JHA A;  4TKN A;  3VTV A;  4E3C A;  2KN5 A;  4KSK C;  3VDZ A;  3U30 A;  3PLU A;  3ZO5 B;  2LZ6 A;  4XZ4 A;  1WGY A;  2WWZ A;  1WXS A;  2NBV B;  3RYT A;  3TJP A;  4WJP A;  1C1Y B;  2MP2 A;  3Q3F A;  5DPT A;  1WI0 A;  4II3 B;  4HVB A;  4M0W B;  1WGD A;  2MBB B;  2K25 A;  2L8J A;  3L0W B;  2M4N A;  4RMA A;  4ANV A;  4MSM B;  2Y5B B;  3APF A;  3R7Q A;  2CHX A;  3EFU A;  2IO0 B;  1D3Z A;  4GGQ A;  4FJZ A;  1EO6 A;  1L7Y A;  2LAS A;  4LDT B;  1WX8 A;  1CMX B;  1HE8 A;  4NY0 A;  5DPR A;  3SHQ A;  4DWF A;  4EOY A;  2JRI B;  2JZZ A;  2RPQ A;  2IO1 B;  1WIA A;  2D10 A;  2GBJ A;  4IUM B;  2XBB C;  2V1Y A;  2ZZP B;  1IYF A;  4EEW A;  3NZS A;  2LRW A;  2L00 B;  4MEL A;  3ZRC A;  2ZVN A;  2K1F A;  4HPL B;  4MJS A;  1J19 A;  2CR5 A;  4DK5 A;  4AP4 C;  1BT0 A;  2KTR B;  3BIN A;  3M62 B;  3GOE A;  3GZN I;  4W9J A;  2BKR B;  2DYO A;  2BYF A;  2N9X A;  1XT9 B;  4NNJ B;  1UZX B;  2O6V B;  5CHW A;  1V5T A;  3QAR A;  5L83 A;  4EZJ A;  3L10 B;  4F7Z A;  5KHO A;  2CHW A;  4KIK A;  3OJ3 A;  3PHX B;  1E5W A;  4NAW B;  3R7R A;  3NHE B;  2MW5 A;  3O65 B;  1Q5W B;  4HXD A;  2MBH A;  4TUU A;  3PRM B;  2R2O A;  2CKH B;  3ZNG C;  3VUX A;  2ZCB A;  1WY8 A;  4EZL A;  2ASQ A;  5D7G A;  2AEH A;  1P9D U;  3JVZ X;  4WAA A;  3CST A;  4BKG A;  4MSQ B;  4JL9 A;  5E6O A;  3N3K B;  4WJQ A;  1TZ1 A;  2J0J A;  3CSF A;  5KHQ A;  2J0K A;  2PE9 A;  1OTR B;  2YVC A;  3MJW A;  4B9K A;  2M1M A;  3NOB A;  3QCA A;  3ZTD A;  2FCN A;  4HJK A;  2DEN B;  4HCP B;  4ZDV A;  2ZCC A;  2KC2 A;  4DDG D;  4IM0 A;  4OVV A;  1GC6 A;  1K8R B;  3UQA A;  3ZRF A;  2C7M B;  2FCQ A;  4DBG A;  1V2Y A;  5BO4 B;  4AOF A;  1T0Y A;  5AZF A;  4F1S A;  2ZPN A;  1G6J A;  2BPS A;  4JQW C;  3RCZ A;  1SIF A;  4BOS C;  2FID A;  3ENE A;  2MBO A;  3VQI A;  1A5R A;  4WWO A;  2I1J A;  1WJ6 A;  2AYO B;  4W9F A;  4KV2 A;  4PYZ A;  4GB9 A;  1U4A A;  1NI2 A;  3LDZ E;  3PGE A;  3PTF C;  5DPS A;  4HPM B;  3RUL A;  2LXA A;  2MSE D;  3QAQ A;  4GOC A;  3CF6 E;  5AZG A;  2KJ6 A;  2L0F A;  4I6P A;  2KDF B;  4W9G A;  2LWP A;  3PPA A;  1MG8 A;  3AXC A;  3UIO B;  3HIZ A;  1ISN A;  3A9J B;  2KQ7 A;  3DVG X;  3PZD A;  2K6Q A;  2A5U A;  3H6N A;  4URK A;  4ANU A;  3K9P B;  4FUL A;  4KZ0 A;  3KUZ A;  2FCS A;  2MBQ A;  1VD2 A;  3NY5 A;  4NJ7 A;  4G0N B;  4XC2 A;  1UH6 A;  1LFD A;  4GDL B;  1IP9 A;  4IWO A;  2B3A A;  4LJP B;  1GUA B;  2ZVO A;  1EF5 A;  2BYV E;  3HHM A;  3UGB B;  3BY4 B;  4JLC A;  4PS8 A;  4XX5 A;  4IG7 B;  3A9K A;  1L2N A;  4FN2 A;  3VH3 B;  3JW0 X;  4WJN A;  5C23 A;  1WJU A;  2KMA A;  1WJ4 A;  3L16 A;  3RUI B;  3TCA A;  2JWZ A;  1ZGU B;  3SU8 X;  2L76 A;  3WIM A;  1WR6 E;  4ANW A;  2PEA A;  1OQY A;  3Q3J A;  4HDQ A;  1JRU A;  2YLM A;  1S1Q B;  3ZNI D;  3OJ4 B;  3ZKJ C;  3ZNH B;  3QX1 A;  3EHV A;  2IY0 B;  1YQB A;  2O6V D;  3NS8 A;  4ZYN A;  5HKH A;  1H8C A;  3WAO A;  2AL3 A;  3VH4 B;  1UEL A;  2G4S A;  2DZM A;  2O2V B;  2PE6 B;  3R66 C;  3X23 A;  2GOW A;  3DDC B;  4WQO B;  1UBI A;  4FHK A;  5AEK B;  3KUC B;  3VVW B;  2D2Q A;  2KC1 A;  4WJO A;  4HWI B;  2JUO A;  2LRU A;  2EMT A;  1E8W A;  2ZPY A;  3A33 B;  3V61 A;  4W9I A;  4LJO B;  4CHK A;  3DOW A;  1SGH A;  2K8B A;  2KWV B;  2JPH A;  1WXA A;  3HK0 A;  2L05 A;  3S2A A;  2XK5 A;  1P3Q U;  3PHW B;  3ZUN A;  2J0M A;  2D07 B;  4LDT D;  5IAA C;  3H7P A;  3ML8 A;  4W9L A;  2CU1 A;  2Z0E B;  5D6J B;  2RGF A;  2EKE C;  3C0R B;  4K7W A;  1R4M I;  4GXB A;  2HD5 B;  2RD0 A;  3TBL D;  1LXD A;  2KDE B;  2K39 A;  2DAF A;  4WWN A;  4IWP A;  2KX0 A;  2IZV B;  4FBJ B;  2M17 A;  3VXW A;  1WMH A;  4KDL B;  2J7Q B;  1TBE A;  2Z59 B;  3VAW A;  2IO2 B;  5FR6 A;  1WE7 A;  4FA6 A;  2DZJ A;  2XEW A;  2DX5 B;  2LXC A;  3PT2 B;  1FXT B;  4EZK A;  2GBN A;  3A9J A;  3QC8 B;  1KOT A;  2QHO A;  1Q0W B;  4G50 A;  5CTR C;  4K7S A;  2DYB A;  2WYQ A;  1E7V A;  4DHZ B;  2MCN B;  2LVP A;  1XQQ A;  3VTW A;  1TTN A;  3UQB A;  1XD3 B;  2HE7 A;  2IYD B;  3L17 A;  2DYM A;  5TR5 A;  2L0T A;  1RRB A;  2C7H A;  2FCM A;  3DQV A;  1OGW A;  2KWC A;  3V62 A;  2KVR A;  4K81 A;  2LD9 A;  2ZEQ A;  1V81 A;  3H9D A;  2BYE A;  4HDO A;  4DHJ B;  1GG3 A;  4LCD E;  1E8Z A;  2PJH A;  3ZW3 A;  1IPG A;  4IW0 A;  2UWQ A;  4NAW A;  4P7I A;  1KM7 A;  2HJ8 A;  3A4R A;  1V80 A;  3M3J A;  2M0X A;  3IBE A;  1J0G A;  1X1M A;  3JSV B;  4GIV A;  2N1W A;  3AU5 A;  3PVL A;  2FUH B;  2KFJ A;  1KJT A;  2KQS A;  2O6V A;  3IFW B;  4KIK B;  2GBR A;  2G3Q B;  1WGG A;  2GMI C;  2HTH A;  4FLH A;  2KFK B;  2BF8 B;  1SE9 A;  4TQ1 A;  3KW5 B;  4F8C B;  2XK5 B;  4DHJ D;  4NQK E;  3OAW A;  3H1U A;  4FJY A;  3H7P B;  2KKC A;  2MX2 A;  4BKT A;  2KDI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...