3SFDB

Crystal structure of porcine mitochondrial respiratory complex ii bound with oxaloacetate and pentachlorophenol
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
239
structure length
239
Chain Sequence
PRIKKFAIYRWDPDKTGDKPHMQTYEIDLNNCGPMVLDALIKIKNEIDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTNLDKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEEREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTGTCPKGLNPGKAIAEIKKMMATYKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
publication title Thiabendazole inhibits ubiquinone reduction activity of mitochondrial respiratory complex II via a water molecule mediated binding feature.
pubmed doi rcsb
total genus 61
structure length 239
sequence length 239
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2011-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 3sfdB02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3sfdB01
3AE8B 1XLOA 1YJIA 1DOYA 3P4SB 4US8A 1YQ4B 3AE6B 2MJEA 3AE2B 4A9AA 1WXQA 1OQRA 2W55A 1KFYB 3AE7B 1DOIA 5GXGB 1WGKA 4YT0B 1XLQA 3NRZA 4FXCA 4HRSA 5AUIA 1GPXA 2DWQA 3HUIA 2WU2B 4YTNB 1RFKA 1N5XA 3ABVB 3AE9B 1CJEA 1NI3A 2MH7A 1YQ3B 3DWMA 5EE9A 1QT9A 1UWMA 3P4RB 2PIAA 3AE5B 3AB5A 3P4QB 3HVZA 1AYFA 1JW9D 2L52A 4JX1C 1XLPA 2MJDA 4WQMA 1WRIA 2Q5WD 1ZP0B 3AH7A 4N58A 3AEFB 1TYGB 2BT6A 3NVVA 3L4PA 2WDQB 3SFDB 1GTEA 4ZHOA 3W9CB 1JROA 4YSYB 3AEGB 4KX6B 1JRPA 3ZYYX 1NVID 2FBWB 2JX5A 5C2TB 1DGJA 1N5WA 2L83A 2PKOA 2PVGC 2QJLA 1L6UA 1AWDA 1WYGA 1NENB 2WLBA 2AX5A 2DBYA 3CIRB 1PDXA 1V97A 1E0ZA 1E9MA 1N62A 3AECB 1RWSA 3P63A 1N61A 1FXIA 1VJKA 5H92C 4C80A 3AE1B 1JALA 4ITKA 3BIID 3HRDD 4YTPB 1L5PA 1RYJA 3LXFA 3VRAB 4IDIA 2G1EA 4USAA 1FFVA 1VLBA 1QOBA 1TKYA 3AEAB 1YJJA 4WWMA 4ZOHC 2H88B 4JWSC 5EE3A 3AEBB 2W3RA 3RPFC 1TJEA 2H89B 1JWAD 4N59A 1FO4A 4P6VF 1CZPA 3B2GA 1ZOYB 1PFDA 1IUEA 2K22A 1A70A 1FMAD 2N0SB 4US9A 1ZUD2 3W5UB 4YXDB 2KMMA 1KF6B 1B9RA 1EWYC 2MJ3A 2KAJA 1KRHA 3AMZA 3ETRA 4JWUC 3SFEB 3AEEB 1FXAA 1TKEA 1H7XA 1QOGA 1N60A 1NYQA 1FRRA 2CJNA 3NVWA 2ACZB 5C3JB 1E6EB 1RM6C 1PUTA 1QLBB 1SB3C 1WWTA 2M56B 3CWIA 3P1MA 5G5GA 1L6VA 2BS3B 2WP9B 1JQ4A 2EKIA 1E10A 1L0VB 2LEKA 1J7BA 5G5HA 1J7AA 5AUKA 2CJOA 3SR6A 4YSZB 1FIQA 3FC4A 2B76B 3AN1A 2HTME 3AV8A 5EE0A 1JWBD 3AE4B 2WU5B 3P4PB 2BS4B 2WS3B 1J7CA 1FM0D 2E3TA 2OHFA 4YSXB 3AE3B 1GTHA 3W5VB 4YTMB 4ZHPA 5H8YE 1R7SA 5EE1A 1FRDA 1OQQA 1QOFA 2WQYB 3B2FA 1DOXA 1ZXIA 3AEDB 1NYRA 1VDVA 2BS2B 1QOAA 2W54A 4C7ZA 4HROA 2JQRB 4C7YA 3FAHA 1F0ZA 3B9JA 1H7WA 4LTUA 1TKGA 1QF6A 1OFFA 3DWGC 1SIJA 1V8CA 1T3QA 3VR8B 2Y5CA 3NS1A 2WDRB 3PO0A 3WCQA 2M19A 1GT8A 3AM9A 2PVOD 1I7HA 3NVZA 5MPOA 2CU3A 3CF4A 2QIEB 1SF0A 2K9XA 1XO3A 1XLNA 2K5PA 3LB8C 3NVYA 1NEKB 1N63A 3VRBB 1FFUA 2W3SA 3EUB2 3KWLA 1GAQB 2WDVB 1E7PB 4N6EB 1ROEA 3VR9B
chains in the Genus database with same CATH superfamily
3L16A 3N1ZC 3Q8BA 2R2OA 1I4XA 3QARA 1P1AA 4G3XB 1KH0A 4HXDA 1PQSA 1WX7A 3R2TA 2INPE 3ZO5B 3X23A 2J52A 1YQ3B 2KWUB 5EE9A 2C9WB 1RLFA 1NI2A 4K1RB 3WALA 2MJDA 2Y5PA 2LRUA 1E7UA 3SFDB 2ZJDA 3ZYYX 3V3XA 2GBMA 1N5WA 4S17A 1XF5L 2KFKA 4C56C 1N62A 3AECB 3H7PB 2FIFA 2WXNA 2AYOB 2V4IB 3RNFC 2WXOA 3RMKC 4ARIA 3ENEA 3Q69A 1SJHD 4A8XC 3H1UA 5L95C 2RD0A 2C7HA 1S1QB 4HCPB 2ZVNA 2X8XX 1TS3A 4OW0A 1L4ZB 4JWUC 1PGBA 2PLPA 5BYQA 1UBIA 3BVZA 4NJ7A 4CHKA 3P42A 4ANUA 2QMTA 5E6PA 2BS3B 2MLBA 2HE7A 2WX0A 3I3TB 1D5XC 1GG3A 3QA8A 3OWEB 1AARA 1T0YA 4BBNF 1V1PA 2WU5B 3KVFB 1B1ZA 1MJDA 2UU7A 2WQYB 1K51A 1DOXA 3EC8A 1E7VA 1WE6A 3MHSD 4DWFA 1P9DU 4L1BA 3DVNU 1TY2A 2NTSA 4TUUA 5JHBA 1F2RC 4FHJA 1U4AA 1GAQB 2KNBA 4DBGA 4JL9A 3KW5B 2KZRA 2FAZA 2Z0DB 2W82A 4A9AA 4K7UA 1KFYB 3DBLB 3ZXRA 4C4VB 5GXGB 3Q3NC 1NI3A 3MC0B 4MT5A 4A20A 2PPHA 3URYA 1WRIA 1TYGB 3NVVA 1UELA 2Y5BB 2KDFB 5C2TB 2B3AA 3LDZE 4NQKE 1YN4A 1ZPSA 2NR2A 2ZVOA 1GB4A 3I63C 3IAM1 5IAAC 4AOFA 4O1NA 2K0PA 2Z0EB 2AL6A 1TS4A 4HPPA 2O2VA 2K1FA 3W2DA 1QOBA 2OOBB 3IXSA 2H88B 1MHHE 2JRHA 1K53A 1YJ1A 3HM3A 3PGEA 5TSSA 4K7SA 4US9A 1MG4A 2AL3A 3DBLI 5AZFA 2GRIA 1JWSD 1TS5A 3EFCA 3IVFA 2HJ1A 3WA0A 4D2KA 3MFGA 1XEEA 3H7SA 2ACZB 2M56B 2INNE 2ZPYA 1YNTE 1P0RA 3QK0A 5G5HA 2ONQA 1XXGA 4HDQA 3AE4B 4YSXB 3W5VB 2E6XA 1C78A 2GLSA 1V6EA 4JPSA 4IM0A 4MSQB 2YEPB 3EFUA 2KK8A 2M19A 4MEMA 3SHQA 2AQ1B 2D10A 3NVZA 2NTTA 2L0FA 2MRPA 1NEKB 1OEYA 2VRRB 3VR9B 3Q8EA 1WH3A 1DOYA 4MGKE 4KZCA 4IG7B 3AE7B 2HTHA 5G2NA 3NRZA 5AUIA 3A4RA 2DWQA 4YTNB 2KN4A 2WDTB 4ZYNA 2PE6B 3DDCB 1AW7A 5AZGA 1VZ7A 4MH0E 1M4VA 1QT9A 2J42A 3SEBA 4RGTA 3N3KB 3GE8C 1JW9D 1IPGA 3PHXB 1UGMA 2WXGA 4P1BC 5TR5A 4YSYB 2L7RA 1HZ6A 3N1YC 5D3DA 5BO4B 2IDYA 2LVQA 2QJLA 2JWUA 3PHWB 3RNBC 3RD2A 1EWCA 3DBRB 1Y8RC 2BW2A 4WIPA 4C80A 2W9NA 2LZ6A 2DZIA 4FHKA 4WWMA 2IZVB 2WXQA 3RPFC 3BWUD 4LNOA 1CZPA 3PRZA 1XT9B 4BAXA 3GOEA 1PGXA 1SSNA 2NPTA 3ONSA 1ET9A 2EMTA 1TKEA 1WY8A 1QOGA 3I9V1 3ZRFA 1PUTA 1F9JA 2BB6A 2RMMA 3CF6E 3ZNZB 4BKSA 1D5MC 3KUCB 2WXHA 1WZ3A 2B76B 3AN1A 1KJTA 5EE0A 4RF0A 4MACA 1P7FA 3ZJUA 5LLIA 5H8YE 1Z5SB 4OVUA 4NAWB 2KMAA 1K8RB 1F0ZA 3DBRI 2LD9A 3U7ZA 2LGDA 4MH8A 1OFFA 2MP2A 3U8ZA 4HJGE 1WJUA 5D7GA 3TJPA 4WJNA 3H8HA 2LMCA 2NCNA 2D2QA 1SF0A 3MP9A 1SIFA 4M0WA 3RNGC 2ZW1A 1Q5WB 1OQYA 3Q3JA 1Q0WB 3ZTDA 2LJ5A 4TV3A 3RI7C 1D3ZA 3ABVB 3IG3A 4LDTB 2PTLA 1PGAA 1UD7A 1WX8A 1ZP0B 2YLMA 4ZHOA 1DYQA 4FA6A 2FBWB 1VZ6A 1UBQA 4RGNA 2PKOA 3VUXA 2IO3B 2AX5A 2MQJA 3P63A 3JW0X 3UQBA 4KZ0A 3HRDD 1L5PA 1JWMD 4RGOS 1WGRA 2C7MB 4KDLB 1KM7A 1RRBA 4TQ0A 2KLCA 4ZYSA 3RUIB 3MJ5A 1VZ8A 3BYTB 3LJ3A 5FR3A 1L7YA 1WWTA 3RULA 2EKEC 2FCQA 2KDMA 3PV1A 2KC2A 1KOTA 5BYSA 3R3MA 4XYCA 1QILA 1EF1A 2R2QA 3WAPA 4PK1A 4EZLA 3U2SC 2LXAA 2ZNVC 3DVGY 1H4RA 4HK2A 3VHTC 1YQBA 1TT5B 1Y56A 2LGSA 2J0MA 1WJNA 1J0GA 2PJHA 4RMAA 1N63A 2JPHA 3K9OB 2Z8LA 2MJEA 1IP9A 4OVVA 1HTQA 4K3BA 4EOYA 1Z2MA 1FCCC 1WGGA 3L08A 4XZ4A 2JU6X 4NJCA 1GC6A 2KHWB 2LVPA 3AB5A 1GC7A 1WGDA 2GBJA 3S2AA 4KV2A 1AWDA 2O6VB 4ANVA 1V97A 2N1WA 2IBIB 4BKSD 1L0YB 3C0RB 1JALA 2K39A 1RYJA 1Q10A 1I35A 2RDHA 4A55A 2BWFA 2H89B 2KTRA 3B2GA 2OJWA 2DENB 2K22A 2KJHB 2CKHB 2INDC 2KYWA 1NDDA 3VTVA 2DYOA 2MX2A 3UINB 4E71A 2CJNA 3AI5A 4DHZE 4XWTA 4AJWA 1JQ4A 2K8BA 2EKIA 3M95A 1J7AA 2CJOA 3VDZA 4L23A 4HKZE 2LI5A 4WWPA 2OHFA 1C4AA 2BYFA 2IO2B 1IBXB 3ZDTA 2JUOA 2SEBD 1NYRA 1JRUA 2CHWA 3V60A 1V5OA 1SIJA 2DYBA 5FKAC 3UIPB 3R7QA 2INCC 4XC2A 1LXDA 1TY0A 4KIKA 1M94A 1YX6B 3EHVA 3A9KA 1WMHA 1BXTA 1YJIA 3ZDMC 3AE2B 5FK9C 1UGJA 3ML9A 3E56A 1CK1A 1DOIA 2QSDA 2J53A 1XLQA 1L0XB 2D3GA 3HUIA 3Q3MC 1ISNA 2LWPA 4B9KA 2BYTA 3KUDB 3KQ4A 3JVZX 3P4RB 3RCZA 3P4QB 1XQQA 4EEWA 3EA6A 1FPYA 5DPTA 4ZRKA 2C7NB 1HE8A 2M1MA 2N7JA 1YOVB 3A9JB 1WR6E 1C4CA 3OJ4B 1TIFA 1FFVA 4OZCA 3FILA 3I5JC 4JWSC 2J0KA 2MBQA 2VZKD 3GS2A 4LNIA 4WJQA 1TZOA 2BBCA 2JXXA 2KFJA 2MJ3A 4EZKA 4AP4C 3IHPC 1F2RI 2JVCA 2FNJB 1FXAA 3B08A 3A1QB 3FKYA 1UNSA 2KQSA 3CWIA 3ZNID 2V3NA 4A3OA 3T3NA 3PZ7A 1L0VB 1J7BA 3QAQA 3SR6A 4MJSA 1FIQA 2KDEB 4WJPA 3P4PB 2WS3B 1SXTA 4YTMB 3Q8AA 5EE1A 5L83A 1VRAB 2DZMA 2BWES 1J19A 2IGGA 3QWZB 2KX3A 1FNVA 4FJVB 4C7YA 4F8CB 4PYZA 5IKCM 3PT2B 1P98A 4F1SA 2RPVA 2KJRA 2RDGA 2PVOD 2QIEB 3NVYA 3KWLA 2WDVB 1HXYD 2WXRA 2JF5A 2MHJA 4GDLA 2V0GA 5DPRA 2L0TA 1L4DB 2BKRB 4CQNA 4EZJA 5CTRC 1YIWA 4NNJB 4RF1A 1VD2A 4XGAB 1UZXB 4IUMB 3SD5A 4P16A 1UWMA 3J9CA 2WYQA 1E8XA 4PS8A 1ZW7A 2FUG1 4GDKA 2KQ7A 2RPQA 4ICVA 3AEGB 2FE8A 2LGIA 5JXVA 2HDEA 3W1YA 2WLBA 4NPNA 5DCNA 2K8HA 2GB1A 1VJKA 2KD0A 1ZGUB 3KWVA 3PS6A 4KGTA 2LASA 4IM2A 1WM3A 2M4NA 1BUIC 1GB1A 4GXBA 4K7WA 4K81A 3V61A 2XNAC 4FJYA 2NMQA 3BY4B 2ZZPB 2RR9A 1GNUA 1ZKHA 4W9LA 1IGCA 2G4DB 2MBBB 4MM3A 1F52A 1HA5A 2GBRA 3AMZA 3M3JA 2KTFA 2N7DA 2DLBA 1NYQA 1GUAB 2YEPF 3B1LX 3W1SC 4A6QA 2ON8A 4DXAB 3V05A 2M17A 1V86A 4GU2A 3VFKA 2JT4B 2E3TA 2LUMA 2J7QB 2KACA 3DQVA 4W9HA 3PLUA 1BMLC 3RNCC 4HPLB 1MHXA 1TKGA 3QHTA 1SE9A 1V8CA 2HD5B 3NS1A 1SE4A 2XK5B 3MC8A 1WXAA 2K6QA 2XBBC 3V6CB 2JYEA 4LJOB 1FFUA 2JZZA 2LVOA 4HKQA 1WYWB 4X57B 3TCAA 4US8A 2QILA 4XDCA 3PPAA 3V6EB 3PVLA 1E8YA 1MFWA 4YT0B 1EU3A 1I4PA 3VTUA 3ZJTA 3HVDA 3VUWA 1VCBA 2BKFA 1UH6A 1FNUA 2MBEA 4BKTA 1JROA 1NVID 2KFKB 1SJED 1K50A 1TGZB 3VUYA 2LFIA 2HJ8A 2JWZA 1C1YB 5GMVA 1TTNA 2L00B 4UDUC 2KWCA 2W3RA 5LXIB 4BVUC 4W9EA 2N9LA 3Q3OC 3MJWA 1KRHA 1K52A 3AEEB 2L1AA 2A4ZA 3B0AA 3BZDB 1STEA 2M8SA 1V1PB 1E10A 3DCGA 3JSVA 4IWOA 2ZEQA 3Q2AC 3AE3B 1R7SA 1SE3A 2RSUA 4FADA 1AN8A 4HROA 2JQRB 2BB5A 2D11A 3WAMA 4WAAA 3V62A 3VR8B 2GMIC 1LFDA 2CR5A 2KN5A 4HPMB 4G0NB 4KKJA 4K3CA 4ASWC 4N6EB 1ROEA 1ET6A 1EF5A 2ZNVB 2CS4A 3U4EG 2FIDA 3OJ3A 1E8WA 4HRSA 2KT7A 3GZNB 3RFZB 4PYUA 4LJPB 2MH7A 3DWMA 3RN9C 1WXMA 1V9JA 5LNK1 1J8CA 4AJYB 3AE5B 5D94A 3D32A 2FCNA 3NHEB 1SEBD 3L17A 4ZRPA 2QDFA 1V81A 4FN2A 3PREA 2O2VB 2N4FA 4FULA 5FR6A 2AQ2B 3IT4B 2GBKA 3R8BA 3MHZA 3IBEA 2D07B 2GBNA 1OTRB 2KMCA 2ZCBA 1UUPA 1YJJA 3U7DA 3CSTA 2I1KA 4A90A 1WRDB 1WJ6A 3ZNGC 2PW9A 1F77A 3T9LA 4MGIE 2D3CA 4HVBA 3SFEB 3KUZA 3GZNI 2G45B 2BGFA 5G5GA 1I42A 1SE2A 4N9F4 4GIVA 2WXKA 5AUKA 4YSZB 3E9SA 4A3PA 3LYYA 2UWQA 3O13A 1IGDA 4KDIC 1I4HA 1SBBB 3B2FA 1ZXIA 3ZTCA 2Y3AA 5HFYA 4KGSA 3RNAC 2REXA 4LTUA 2N9PC 1LO5D 1T0SC 4NY0A 3PO0A 3Q8FA 2LRWA 3AM9A 3IFWB 2CU3A 4LNFA 4RNAA 4RM8A 1XLNA 3VVWB 2V3SA 1T5XD 1CQVA 1BT0A 5D2MB 3CMMB 4PS3A 5CX3A 3APFA 3AE6B 3NS8A 1WXSA 2AQ3B 3HK0A 4JQWC 4KKIA 1WE7A 2BYVE 2LHDA 1JMLA 1QKZA 2J0JA 3ALBA 2GI9A 3DBHB 1EM7A 3N9YC 1I4QA 2MBHA 2BT6A 3L4PA 2L32A 4DXGA 2LGYA 1WYGA 3OAWA 3QIJA 2ICIA 1N61A 3TL5A 2M0AA 4REZA 5JHAA 4WWNA 2LHEA 3H7PA 4W9IA 4IM3A 4ZOHC 3DBSA 1HEZE 4RFBA 2NPTB 4ANXA 2NBVB 1EWYC 2R61A 1E90A 2G9HD 2DHZA 2LUEA 2Z59B 3DHGC 3N20C 4B0MA 1H7XA 5C3JB 1RM6C 4DHZB 3DBHI 3WIMA 3U30A 5IN7A 2DYMA 3ZGZA 2C60A 3FC4A 4P7IA 3EECA 3Q14C 3TUOA 1XD3B 5HHDG 2MA9B 2MP2B 4GLSC 1QOAA 2IO1B 2DAJA 1D4BA 5KHOA 4DHJD 2V3PA 2WNMA 3AXCA 1T3QA 3DHIC 5KHQA 3WCQA 3WAOA 4J6IA 2WXMA 5HI1A 2NBUA 3N1XC 4M0WB 4MGYE 1E7PB 3AE8B 1RAXA 3IAS1 1YQ4B 1WJ4A 4I6PA 4IW0A 3HM6X 1WSPA 3UI3A 4HJKA 3DHHC 3NZUA 2IJ0A 5E6JA 4C4VA 1CJEA 1E8ZA 4W9JA 5BMHA 3TEYA 1XCTL 2PIAA 4TSSA 2KVZA 2L52A 4ZRIA 1XLPA 4JE3B 3BYYB 2CU1A 4B95A 4C00A 1DGJA 4TQ1A 2DBYA 5H92C 3O65B 4EE2A 3LXFA 3KYCD 4USAA 3ZXVA 4N59A 3EGRA 4LK0M 4KGRA 3CSFA 1V1OA 5JZEB 3W5UB 3PRPB 2LXCA 1R4NB 2IGHA 3NVWA 5I4DA 4MSMB 3A4SC 2LEKA 4EFOA 3UF8A 2XK5A 3ZVVA 4R3DA 2HTME 1V80A 1J7CA 2IY1B 3AU4A 4GGQA 2VZKB 4OHJA 2LJIA 4G50A 1OQQA 4FLHA 2M0XA 1FNWA 1MVKA 1T0QC 2PE9A 1TBEA 2WDRB 2WXPA 5BYRA 3VAWA 4OZAA 4WQOB 5J17A 3CF4A 4M00A 3P1MA 3EUB2 2W3SA 3VRBB 2N9KA 5AZHA 4B6WA 1UF0A 1V5TA 4GN1A 2FCMA 3TMPB 1R4NI 4FXCA 4DXFA 1D5ZC 1WGHA 2WX1A 3BK1A 3UIOB 2ZPNA 3ZIMA 2JSVX 1ZE3D 1SGHA 3HVZA 4WQMA 4N58A 4YL8A 3AEFB 4RH6A 1OGWA 4KX6B 1C79A 3TEXA 1WM2A 3DVGX 4ZRQA 1C9FA 3CIRB 1PDXA 1R4MB 3VXWA 1F1HA 3BVMA 3SDLC 2BYEA 3MC9A 2VH2A 2IYDB 1KTKA 2PEAA 2YVCA 4HDOA 5JH5C 1VLBA 2KTRB 2WXJA 3TBLD 5EE3A 1TJEA 4YWGG 5D6JB 4BZAA 3ZNHB 1QQRA 4EKUA 2N0SB 1YN3A 4OVZA 2KVRA 1B9RA 3KH0A 4II3B 4M8NA 2KQ4X 4BKGA 3Q3FA 1JCKB 1X1MA 2MSED 4XX5A 2C5LC 3QQ8B 3N30A 4HCNB 2GOWA 4FBJB 1EO6A 1HTOA 4BFRA 3ML8A 4ZHPA 5DPWA 5E6OA 1QOFA 3JYUA 1R4MI 1VDVA 2W54A 3AU5A 3Q8CA 3U52E 3DOWA 4IKGA 4NAWA 2BTEA 3DWGC 4IOIE 4GSWA 4HLEA 4KIKB 3KYDD 2OEDA 4NZLB 2G3QB 3A9KB 2K6DB 1WMHB 5AEKB 3RZWC 1WIAA 4AUQC 2K25A 2N7EA 3B9JA 1H8CA 3X0WA 3ZLZA 1LM8B 4GMVA 1WXQA 1OQRA 4PT5A 1LQBA 3I57A 1GPXA 2IGDA 3AE9B 1YX5B 1WI0A 4WAFA 1AYFA 3PTFC 4JX1C 3RZFA 2JRIB 4ZDVA 1FD6A 3PZ8A 2JX5A 1MG8A 2JZPA 4E3CA 1WF9A 2L3ZA 2VH1A 3QCAA 4WWOA 2J4XA 4KVGB 1FXIA 3FILB 3BIID 1RFAA 4IDIA 1YN5A 5D3IB 3A33B 2ASQA 4AQ7A 2KC1A 4M01A 1G6JA 1FO4A 4XDDA 2KWVB 2D5GA 4NJ6A 1KLGD 1P7EA 4YXDB 2KMMA 2DZJA 4TMAB 1TS2A 4XE0A 4HWIB 1FXTB 1EU4A 4MJSB 5C23A 2UYZB 3SU8X 2IY0B 2CHZA 3RT3B 2KXJA 4I6LB 4URKA 2BS4B 1FM0D 2BPSA 3QJZA 4BOSC 2JXTA 5E6NA 3APDA 3ZJVA 3H6NA 2G4SA 5T8IA 4C7ZA 4PS7A 2WHIA 2KWDA 3VH3B 1FCLA 1GT8A 1HQRD 3K9PB 3RYTA 4CYEA 2K9XA 3PRMB 2WGSA 4W9KA 3HIZA 3N32A 4NQLB 4GDLB 4JIOU 1XLOA 4LCDE 4LLGM 1MI0A 4BBNC 3GE3C 5G55A 2JZ3B 2A5UA 4MGZE 2W55A 2IO0B 2V1YA 1WGYA 1WXVA 1RFKA 1N5XA 5J18A 2TSSA 3MTNB 2DZKA 1Q1OA 3L54A 4GDKB 2MBOA 1TZ1A 5LXHA 5BMIA 2Q5WD 1GOZA 2WDQB 3W9CB 4RM9A 3QX1A 3L10B 2KX0A 2PVGC 3R66C 1NENB 4IWQA 4WH4A 2K8CA 1RWSA 3L0WB 2O6VA 3T3OA 4ZRJA 4G11A 2NVUI 3NY5A 3DVNV 2SAKA 3BK2A 3ZKJC 3AEAB 1YMHE 2OJRA 4W9GA 4RCOA 2KO3A 1IUEA 3ZQ4A 4MM3B 1FMAD 1VR9A 4W9CA 4S0RA 3APCA 1ZXHA 1N60A 2MCNB 1QLBB 1T6BX 1ACCA 2EELA 1HZ5A 5IO9A 3AV8A 1JWBD 2MEKA 2JYTA 2XEWA 1FEHA 2WXFA 1GTHA 5IP4D 3AEDB 3Q6BA 4H2AA 2BS2B 2V4LA 4XWWA 2L05A 1L2NA 2FCSA 3FAHA 1IBXA 1E5WA 2QCZA 4IC7B 2KOXA 2MWSB 4LDTD 1QZEA 3NZSA 2WXIA 4DDGD 2N9EB 5MPOA 3TIXA 1C3TA 3NUHB 1P3QU 4DQOC 2NBWB 3H9DA 3R7RA 3NJTA 1GJZA 1XCQL 4JLCA 1N6ZA 4JGHB 4EUTA 2NS5A 1KLVA 1WGKA 1D6EC 3M63B 2DX5B 2QHOA 5CHWA 1I4GA 4ANWA 1A5RA 5J2RA 2N9XA 2KLGA 3L13A 3HHMA 2JY6A 4AWJA 1JRPA 4M02A 4E74A 3VH4B 4W9DA 2L83A 4KSKC 3BVGA 2QC8A 2D3BA 2D3AA 4HEA1 4I6NB 3WANA 3A9JA 1T0RC 3AE1B 4ITKA 4LNNA 2BVCA 2ZCCA 2G1EA 3C8YA 4QAYA 4ARCA 1WZ0A 1JWAD 2N1VA 4ACFA 1ZDVA 2WXLA 3IT6B 4RGMA 3NG0A 2QEJC 2KDIA 4OZBA 3QC8B 3TEZA 2L8JA 1ZDXA 2I2YA 3W1SA 1SB3C 2WP9B 3A1QA 2RGFA 3JSVB 4WURA 2AEHA 1YD8U 2BQQA 3NZ3A 4L2YA 3PZDA 3VTWA 5CHFA 5IA7A 3GP7A 4F7ZA 3M62B 3PLVA 1UWXA 4AS1A 2L76A 2LGXA 1OEYJ 4LNKA 3DPDA 1QF6A 2ZW0A 1C76A 4W9FA 3P2BA 4B0EA 4KSLC 4P1CC 1I7HA 1XO3A 3LB8C 4J3OD 1I4RA 3ZW3A 3OLMD 3T8MA 5HG2A 4NAMA 2K5PA 3TSSA 5EDSA 3P4SB 2O6VD 2WWZA 3ZUNA 2X38A 4ICUA 3OG5A 2WU2B 2RDBC 1WX9A 2K3UA 1C77A 4DHJB 3GB1A 3VQIA 4MELA 2I38A 2MW5A 3AH7A 5BMGA 4TKNA 1GTEA 1NBFC 2DNFA 3BINA 1WFYA 1L6UA 2FUHB 1MPEA 2IPKD 3NOBA 1E0ZA 2CHXA 2KDBA 1E9MA 4II2B 1LGRA 2V9HA 2KKCA 2AWTA 4YTPB 3PSEB 3VRAB 2PMVA 3R2IA 1TKYA 1PYWD 3AEBB 4GOCA 1IYFA 4P6VF 1C4PA 1ZOYB 5C1ZA 1PFDA 1A70A 2DAFA 3TEWA 1S3SG 1ZUD2 4BOZB 1KF6B 5DPSA 2KAJA 4GB9A 4WJOA 3ETRA 5IOIA 2KJ6A 3UQAA 1FRRA 3AULA 1E6EB 1WR1A 2KANA 3C19A 3RNEC 1L6VA 1EUVB 1KLUD 4DK5A 4MDKE 3ECIA 1FRDA 2XN9C 3KLSX 4FJZA 1V2YA 4CO7A 4DDID 1ESFA 1H7WA 3UGBB 4IWPA 1ENFA 1JWUD 2BF8B 4Q2JA 2Y5CA 1V49A 1CMXB 3ZRCA 5CHVC 2EMSA 4M8MA 2I1JA 5HKHA
chains in the Genus database with same CATH topology
2Z8LA 3Q8BA 2MJEA 3U4EG 1WXQA 1I4XA 1OQRA 4PT5A 3I57A 1KH0A 4HRSA 1GPXA 3R2TA 2IGDA 2INPE 3AE9B 3RFZB 1FCCC 2MH7A 2J52A 1YQ3B 3DWMA 5EE9A 2JU6X 5LNK1 4NJCA 3AE5B 3AB5A 4WAFA 1AYFA 4JX1C 2MJDA 2Y5PA 3SFDB 1SEBD 1FD6A 3ZYYX 4ZRPA 3V3XA 3PZ8A 2JX5A 1N5WA 2JZPA 1AWDA 1XF5L 4C56C 1V97A 1N62A 2J4XA 3AECB 1FXIA 1L0YB 2AQ2B 3IT4B 3R8BA 3MHZA 2WXNA 1JALA 3FILB 3BIID 1RYJA 1Q10A 4IDIA 1YN5A 2RDHA 2V4IB 5D3IB 1UUPA 1YJJA 4AQ7A 4A55A 2WXOA 4ARIA 2H89B 4A90A 1FO4A 3Q69A 1SJHD 4XDDA 3B2GA 4A8XC 2K22A 2D5GA 2PW9A 1F77A 1KLGD 1P7EA 4YXDB 2KMMA 1TS3A 4OW0A 1L4ZB 4JWUC 1PGBA 2DYOA 2PLPA 4TMAB 5BYQA 3SFEB 3BVZA 1TS2A 4XE0A 2CJNA 5G5GA 3P42A 2QMTA 1EU4A 1SE2A 4XWTA 2BS3B 1JQ4A 1D5XC 2EKIA 3OWEB 1J7AA 2WXKA 2CJOA 5AUKA 4YSZB 3E9SA 1V1PA 4L23A 3LYYA 4HKZE 3O13A 2WU5B 2BS4B 1FM0D 2OHFA 1C4AA 1IGDA 2JXTA 1B1ZA 3ZJVA 1I4HA 1IBXB 1SBBB 2WQYB 1K51A 2SEBD 1ZXIA 3B2FA 5T8IA 1DOXA 1NYRA 2Y3AA 4C7ZA 5HFYA 4KGSA 4LTUA 1SIJA 1LO5D 4L1BA 5FKAC 2KWDA 1TY2A 2NTSA 3PO0A 3Q8FA 1FCLA 1GT8A 3AM9A 1HQRD 1F2RC 1TY0A 2CU3A 4RNAA 2K9XA 1XLNA 1T5XD 1GAQB 1CQVA 4GDLB 4LLGM 1XLOA 1BXTA 1MI0A 1YJIA 3AE6B 2W82A 2AQ3B 3AE2B 5FK9C 4A9AA 1UGJA 2W55A 1KFYB 1CK1A 3E56A 1DOIA 2QSDA 4KKIA 5GXGB 2J53A 1XLQA 2LHDA 1JMLA 1L0XB 3HUIA 1QKZA 1RFKA 1N5XA 2TSSA 2GI9A 1NI3A 3MC0B 2BYTA 4MT5A 3KQ4A 4GDKB 3P4RB 3P4QB 1EM7A 3N9YC 1I4QA 3URYA 5BMIA 1WRIA 2Q5WD 1GOZA 3EA6A 1TYGB 2BT6A 3NVVA 3L4PA 2WDQB 2L32A 3W9CB 5C2TB 4DXGA 1YN4A 2PVGC 2N7JA 1ZPSA 1WYGA 1NENB 4WH4A 1GB4A 3IAM1 1C4CA 4O1NA 1RWSA 2K0PA 2ICIA 1N61A 1TS4A 3T3OA 2M0AA 4REZA 2LHEA 2SAKA 3W2DA 3BK2A 1FFVA 4OZCA 1QOBA 3FILA 3AEAB 3IXSA 4ZOHC 1YMHE 2H88B 4JWSC 1HEZE 1MHHE 1K53A 4RCOA 4RFBA 5TSSA 2VZKD 1IUEA 3ZQ4A 4MM3B 3GS2A 1FMAD 1VR9A 4US9A 1TZOA 2BBCA 2GRIA 1JWSD 1EWYC 1TS5A 2MJ3A 2R61A 2G9HD 1F2RI 1ZXHA 4B0MA 4D2KA 1FXAA 3MFGA 1H7XA 1XEEA 1N60A 1UNSA 2ACZB 5C3JB 3CWIA 1RM6C 1QLBB 2M56B 2INNE 2V3NA 1T6BX 1ACCA 3T3NA 2EELA 1YNTE 1L0VB 3PZ7A 1J7BA 5G5HA 3SR6A 2DYMA 1HZ5A 2ONQA 1XXGA 3ZGZA 1FIQA 3FC4A 3AV8A 1JWBD 3AE4B 2MEKA 3P4PB 2WS3B 3TUOA 1SXTA 2JYTA 4YSXB 1FEHA 2WXFA 3W5VB 1GTHA 2E6XA 4YTMB 1C78A 3Q8AA 5EE1A 4JPSA 1VRAB 5HHDG 2IGGA 3AEDB 4H2AA 4GLSC 2BS2B 1QOAA 1FNVA 2YEPB 4C7YA 4XWWA 1D4BA 3FAHA 1IBXA 2V3PA 2WNMA 1T3QA 2RPVA 2WXIA 3WCQA 2M19A 2AQ1B 2RDGA 2PVOD 3NVZA 2NTTA 5MPOA 2QIEB 2WXMA 5HI1A 3NVYA 1NEKB 3KWLA 3NUHB 2WDVB 1E7PB 4DQOC 1HXYD 3VR9B 3AE8B 2WXRA 3Q8EA 3IAS1 1DOYA 1YQ4B 1XCQL 2V0GA 3AE7B 1WSPA 3UI3A 1WGKA 1L4DB 1D6EC 3NRZA 5AUIA 4CQNA 2DWQA 4YTNB 2IJ0A 2KN4A 5E6JA 1CJEA 1AW7A 4RF1A 1I4GA 1VZ7A 5BMHA 1M4VA 3TEYA 1QT9A 1XCTL 2J42A 3SEBA 4P16A 1UWMA 4RGTA 2PIAA 3J9CA 4TSSA 1JW9D 2L52A 1XLPA 2FUG1 4JE3B 2WXGA 3BYYB 1JRPA 4YSYB 3AEGB 2FE8A 2LGIA 1HZ6A 5D3DA 1DGJA 2IDYA 5JXVA 2L83A 2QJLA 2HDEA 2JWUA 4TQ1A 3BVGA 2WLBA 2DBYA 4HEA1 1EWCA 2GB1A 1VJKA 5H92C 2BW2A 4WIPA 4C80A 3AE1B 4EE2A 4ITKA 3KWVA 3LXFA 4KGTA 2G1EA 4USAA 1BUIC 3C8YA 1GB1A 4WWMA 2WXQA 2XNAC 3RPFC 4ARCA 3BWUD 4N59A 1JWAD 1CZPA 3EGRA 4LK0M 4KGRA 1V1OA 2NMQA 1ZDVA 2WXLA 1PGXA 1IGCA 3IT6B 4RGMA 3W5UB 1SSNA 2QEJC 1HA5A 4OZBA 3AMZA 1ET9A 3TEZA 1ZDXA 1TKEA 2I2YA 2IGHA 1QOGA 2DLBA 3I9V1 1NYQA 3NVWA 3W1SA 1PUTA 1SB3C 2YEPF 5I4DA 2BB6A 2RMMA 2WP9B 4A6QA 2ON8A 4WURA 2LEKA 1D5MC 3NZ3A 2WXHA 4L2YA 2B76B 3AN1A 2HTME 4R3DA 5EE0A 3V05A 4RF0A 4MACA 1P7FA 1J7CA 2E3TA 3ZJUA 2LUMA 2KACA 3GP7A 4OHJA 2VZKB 5H8YE 2LJIA 1OQQA 1UWXA 4NAWB 4AS1A 1BMLC 1F0ZA 1MHXA 3U7ZA 1QF6A 1TKGA 2ZW0A 1FNWA 1OFFA 4MH8A 1MVKA 1C76A 1V8CA 4HJGE 5D7GA 3NS1A 5BYRA 2WDRB 1SE4A 2WXPA 4B0EA 4OZAA 3H8HA 2LMCA 1I7HA 3CF4A 1SF0A 1XO3A 3LB8C 2JYEA 3P1MA 3MP9A 3EUB2 2W3SA 3VRBB 1FFUA 1I4RA 4J3OD 2N9KA 5HG2A 4NAMA 2K5PA 4HKQA 3TSSA 4M0WA 3P4SB 2ZW1A 4US8A 2QILA 4XDCA 2X38A 4FXCA 4YT0B 1EU3A 1I4PA 4DXFA 2WU2B 3ZJTA 1D5ZC 3HVDA 3BK1A 2K3UA 3ABVB 1C77A 3GB1A 3VQIA 2PTLA 1PGAA 2JSVX 1ZE3D 3HVZA 2I38A 4WQMA 4N58A 1ZP0B 3AH7A 3AEFB 5BMGA 1GTEA 1FNUA 4ZHOA 1DYQA 1JROA 4RH6A 4KX6B 1NVID 1C79A 2FBWB 1VZ6A 3TEXA 4RGNA 2PKOA 4ZRQA 1SJED 1L6UA 2AX5A 1K50A 1MPEA 3CIRB 1PDXA 2IPKD 1C9FA 2LFIA 1E0ZA 1E9MA 3BVMA 3P63A 1KTKA 3HRDD 4YTPB 1L5PA 1JWMD 4RGOS 3VRAB 2PMVA 4UDUC 3R2IA 1VLBA 1TKYA 1PYWD 2WXJA 5EE3A 3AEBB 2W3RA 4TQ0A 1TJEA 4ZYSA 4P6VF 4YWGG 1C4PA 1ZOYB 1PFDA 3MJ5A 1A70A 1QQRA 3TEWA 2N0SB 1YN3A 2N9LA 1ZUD2 4OVZA 1KF6B 1VZ8A 1B9RA 2KAJA 3BYTB 1KRHA 3ETRA 2KQ4X 1K52A 3AEEB 5FR3A 1JCKB 2L1AA 1FRRA 1E6EB 1WWTA 3BZDB 1L6VA 1STEA 1V1PB 1E10A 2KDMA 1KLUD 5BYSA 1QILA 3AE3B 4ZHPA 1R7SA 1SE3A 1FRDA 2XN9C 3KLSX 1QOFA 1VDVA 2W54A 3Q8CA 1AN8A 4HROA 2JQRB 2BB5A 3U2SC 1ESFA 3U52E 3B9JA 1H7WA 4IKGA 2BTEA 1ENFA 3DWGC 4IOIE 1JWUD 4Q2JA 3VR8B 2Y5CA 2OEDA 1Y56A 4NZLB 4KKJA 1N63A 4N6EB 1ROEA 1ET6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AE8 B;  1XLO A;  1YJI A;  1DOY A;  3P4S B;  4US8 A;  1YQ4 B;  3AE6 B;  2MJE A;  3AE2 B;  4A9A A;  1WXQ A;  1OQR A;  2W55 A;  1KFY B;  3AE7 B;  1DOI A;  5GXG B;  1WGK A;  4YT0 B;  1XLQ A;  3NRZ A;  4FXC A;  4HRS A;  5AUI A;  1GPX A;  2DWQ A;  3HUI A;  2WU2 B;  4YTN B;  1RFK A;  1N5X A;  3ABV B;  3AE9 B;  1CJE A;  1NI3 A;  2MH7 A;  1YQ3 B;  3DWM A;  5EE9 A;  1QT9 A;  1UWM A;  3P4R B;  2PIA A;  3AE5 B;  3AB5 A;  3P4Q B;  3HVZ A;  1AYF A;  1JW9 D;  2L52 A;  4JX1 C;  1XLP A;  2MJD A;  4WQM A;  1WRI A;  2Q5W D;  1ZP0 B;  3AH7 A;  4N58 A;  3AEF B;  1TYG B;  2BT6 A;  3NVV A;  3L4P A;  2WDQ B;  3SFD B;  1GTE A;  4ZHO A;  3W9C B;  1JRO A;  4YSY B;  3AEG B;  4KX6 B;  1JRP A;  3ZYY X;  1NVI D;  2FBW B;  2JX5 A;  5C2T B;  1DGJ A;  1N5W A;  2L83 A;  2PKO A;  2PVG C;  2QJL A;  1L6U A;  1AWD A;  1WYG A;  1NEN B;  2WLB A;  2AX5 A;  2DBY A;  3CIR B;  1PDX A;  1V97 A;  1E0Z A;  1E9M A;  1N62 A;  3AEC B;  1RWS A;  3P63 A;  1N61 A;  1FXI A;  1VJK A;  5H92 C;  4C80 A;  3AE1 B;  1JAL A;  4ITK A;  3BII D;  3HRD D;  4YTP B;  1L5P A;  1RYJ A;  3LXF A;  3VRA B;  4IDI A;  2G1E A;  4USA A;  1FFV A;  1VLB A;  1QOB A;  1TKY A;  3AEA B;  1YJJ A;  4WWM A;  4ZOH C;  2H88 B;  4JWS C;  5EE3 A;  3AEB B;  2W3R A;  3RPF C;  1TJE A;  2H89 B;  1JWA D;  4N59 A;  1FO4 A;  4P6V F;  1CZP A;  3B2G A;  1ZOY B;  1PFD A;  1IUE A;  2K22 A;  1A70 A;  1FMA D;  2N0S B;  4US9 A;  1ZUD 2;  3W5U B;  4YXD B;  2KMM A;  1KF6 B;  1B9R A;  1EWY C;  2MJ3 A;  2KAJ A;  1KRH A;  3AMZ A;  3ETR A;  4JWU C;  3SFE B;  3AEE B;  1FXA A;  1TKE A;  1H7X A;  1QOG A;  1N60 A;  1NYQ A;  1FRR A;  2CJN A;  3NVW A;  2ACZ B;  5C3J B;  1E6E B;  1RM6 C;  1PUT A;  1QLB B;  1SB3 C;  1WWT A;  2M56 B;  3CWI A;  3P1M A;  5G5G A;  1L6V A;  2BS3 B;  2WP9 B;  1JQ4 A;  2EKI A;  1E10 A;  1L0V B;  2LEK A;  1J7B A;  5G5H A;  1J7A A;  5AUK A;  2CJO A;  3SR6 A;  4YSZ B;  1FIQ A;  3FC4 A;  2B76 B;  3AN1 A;  2HTM E;  3AV8 A;  5EE0 A;  1JWB D;  3AE4 B;  2WU5 B;  3P4P B;  2BS4 B;  2WS3 B;  1J7C A;  1FM0 D;  2E3T A;  2OHF A;  4YSX B;  3AE3 B;  1GTH A;  3W5V B;  4YTM B;  4ZHP A;  5H8Y E;  1R7S A;  5EE1 A;  1FRD A;  1OQQ A;  1QOF A;  2WQY B;  3B2F A;  1DOX A;  1ZXI A;  3AED B;  1NYR A;  1VDV A;  2BS2 B;  1QOA A;  2W54 A;  4C7Z A;  4HRO A;  2JQR B;  4C7Y A;  3FAH A;  1F0Z A;  3B9J A;  1H7W A;  4LTU A;  1TKG A;  1QF6 A;  1OFF A;  3DWG C;  1SIJ A;  1V8C A;  1T3Q A;  3VR8 B;  2Y5C A;  3NS1 A;  2WDR B;  3PO0 A;  3WCQ A;  2M19 A;  1GT8 A;  3AM9 A;  2PVO D;  1I7H A;  3NVZ A;  5MPO A;  2CU3 A;  3CF4 A;  2QIE B;  1SF0 A;  2K9X A;  1XO3 A;  1XLN A;  2K5P A;  3LB8 C;  3NVY A;  1NEK B;  1N63 A;  3VRB B;  1FFU A;  2W3S A;  3EUB 2;  3KWL A;  1GAQ B;  2WDV B;  1E7P B;  4N6E B;  1ROE A;  3VR9 B; 
#chains in the Genus database with same CATH topology
 3L16 A;  3N1Z C;  3Q8B A;  2R2O A;  1I4X A;  3QAR A;  1P1A A;  4G3X B;  1KH0 A;  4HXD A;  1PQS A;  1WX7 A;  3R2T A;  2INP E;  3ZO5 B;  3X23 A;  2J52 A;  1YQ3 B;  2KWU B;  5EE9 A;  2C9W B;  1RLF A;  1NI2 A;  4K1R B;  3WAL A;  2MJD A;  2Y5P A;  2LRU A;  1E7U A;  3SFD B;  2ZJD A;  3ZYY X;  3V3X A;  2GBM A;  1N5W A;  4S17 A;  1XF5 L;  2KFK A;  4C56 C;  1N62 A;  3AEC B;  3H7P B;  2FIF A;  2WXN A;  2AYO B;  2V4I B;  3RNF C;  2WXO A;  3RMK C;  4ARI A;  3ENE A;  3Q69 A;  1SJH D;  4A8X C;  3H1U A;  5L95 C;  2RD0 A;  2C7H A;  1S1Q B;  4HCP B;  2ZVN A;  2X8X X;  1TS3 A;  4OW0 A;  1L4Z B;  4JWU C;  1PGB A;  2PLP A;  5BYQ A;  1UBI A;  3BVZ A;  4NJ7 A;  4CHK A;  3P42 A;  4ANU A;  2QMT A;  5E6P A;  2BS3 B;  2MLB A;  2HE7 A;  2WX0 A;  3I3T B;  1D5X C;  1GG3 A;  3QA8 A;  3OWE B;  1AAR A;  1T0Y A;  4BBN F;  1V1P A;  2WU5 B;  3KVF B;  1B1Z A;  1MJD A;  2UU7 A;  2WQY B;  1K51 A;  1DOX A;  3EC8 A;  1E7V A;  1WE6 A;  3MHS D;  4DWF A;  1P9D U;  4L1B A;  3DVN U;  1TY2 A;  2NTS A;  4TUU A;  5JHB A;  1F2R C;  4FHJ A;  1U4A A;  1GAQ B;  2KNB A;  4DBG A;  4JL9 A;  3KW5 B;  2KZR A;  2FAZ A;  2Z0D B;  2W82 A;  4A9A A;  4K7U A;  1KFY B;  3DBL B;  3ZXR A;  4C4V B;  5GXG B;  3Q3N C;  1NI3 A;  3MC0 B;  4MT5 A;  4A20 A;  2PPH A;  3URY A;  1WRI A;  1TYG B;  3NVV A;  1UEL A;  2Y5B B;  2KDF B;  5C2T B;  2B3A A;  3LDZ E;  4NQK E;  1YN4 A;  1ZPS A;  2NR2 A;  2ZVO A;  1GB4 A;  3I63 C;  3IAM 1;  5IAA C;  4AOF A;  4O1N A;  2K0P A;  2Z0E B;  2AL6 A;  1TS4 A;  4HPP A;  2O2V A;  2K1F A;  3W2D A;  1QOB A;  2OOB B;  3IXS A;  2H88 B;  1MHH E;  2JRH A;  1K53 A;  1YJ1 A;  3HM3 A;  3PGE A;  5TSS A;  4K7S A;  4US9 A;  1MG4 A;  2AL3 A;  3DBL I;  5AZF A;  2GRI A;  1JWS D;  1TS5 A;  3EFC A;  3IVF A;  2HJ1 A;  3WA0 A;  4D2K A;  3MFG A;  1XEE A;  3H7S A;  2ACZ B;  2M56 B;  2INN E;  2ZPY A;  1YNT E;  1P0R A;  3QK0 A;  5G5H A;  2ONQ A;  1XXG A;  4HDQ A;  3AE4 B;  4YSX B;  3W5V B;  2E6X A;  1C78 A;  2GLS A;  1V6E A;  4JPS A;  4IM0 A;  4MSQ B;  2YEP B;  3EFU A;  2KK8 A;  2M19 A;  4MEM A;  3SHQ A;  2AQ1 B;  2D10 A;  3NVZ A;  2NTT A;  2L0F A;  2MRP A;  1NEK B;  1OEY A;  2VRR B;  3VR9 B;  3Q8E A;  1WH3 A;  1DOY A;  4MGK E;  4KZC A;  4IG7 B;  3AE7 B;  2HTH A;  5G2N A;  3NRZ A;  5AUI A;  3A4R A;  2DWQ A;  4YTN B;  2KN4 A;  2WDT B;  4ZYN A;  2PE6 B;  3DDC B;  1AW7 A;  5AZG A;  1VZ7 A;  4MH0 E;  1M4V A;  1QT9 A;  2J42 A;  3SEB A;  4RGT A;  3N3K B;  3GE8 C;  1JW9 D;  1IPG A;  3PHX B;  1UGM A;  2WXG A;  4P1B C;  5TR5 A;  4YSY B;  2L7R A;  1HZ6 A;  3N1Y C;  5D3D A;  5BO4 B;  2IDY A;  2LVQ A;  2QJL A;  2JWU A;  3PHW B;  3RNB C;  3RD2 A;  1EWC A;  3DBR B;  1Y8R C;  2BW2 A;  4WIP A;  4C80 A;  2W9N A;  2LZ6 A;  2DZI A;  4FHK A;  4WWM A;  2IZV B;  2WXQ A;  3RPF C;  3BWU D;  4LNO A;  1CZP A;  3PRZ A;  1XT9 B;  4BAX A;  3GOE A;  1PGX A;  1SSN A;  2NPT A;  3ONS A;  1ET9 A;  2EMT A;  1TKE A;  1WY8 A;  1QOG A;  3I9V 1;  3ZRF A;  1PUT A;  1F9J A;  2BB6 A;  2RMM A;  3CF6 E;  3ZNZ B;  4BKS A;  1D5M C;  3KUC B;  2WXH A;  1WZ3 A;  2B76 B;  3AN1 A;  1KJT A;  5EE0 A;  4RF0 A;  4MAC A;  1P7F A;  3ZJU A;  5LLI A;  5H8Y E;  1Z5S B;  4OVU A;  4NAW B;  2KMA A;  1K8R B;  1F0Z A;  3DBR I;  2LD9 A;  3U7Z A;  2LGD A;  4MH8 A;  1OFF A;  2MP2 A;  3U8Z A;  4HJG E;  1WJU A;  5D7G A;  3TJP A;  4WJN A;  3H8H A;  2LMC A;  2NCN A;  2D2Q A;  1SF0 A;  3MP9 A;  1SIF A;  4M0W A;  3RNG C;  2ZW1 A;  1Q5W B;  1OQY A;  3Q3J A;  1Q0W B;  3ZTD A;  2LJ5 A;  4TV3 A;  3RI7 C;  1D3Z A;  3ABV B;  3IG3 A;  4LDT B;  2PTL A;  1PGA A;  1UD7 A;  1WX8 A;  1ZP0 B;  2YLM A;  4ZHO A;  1DYQ A;  4FA6 A;  2FBW B;  1VZ6 A;  1UBQ A;  4RGN A;  2PKO A;  3VUX A;  2IO3 B;  2AX5 A;  2MQJ A;  3P63 A;  3JW0 X;  3UQB A;  4KZ0 A;  3HRD D;  1L5P A;  1JWM D;  4RGO S;  1WGR A;  2C7M B;  4KDL B;  1KM7 A;  1RRB A;  4TQ0 A;  2KLC A;  4ZYS A;  3RUI B;  3MJ5 A;  1VZ8 A;  3BYT B;  3LJ3 A;  5FR3 A;  1L7Y A;  1WWT A;  3RUL A;  2EKE C;  2FCQ A;  2KDM A;  3PV1 A;  2KC2 A;  1KOT A;  5BYS A;  3R3M A;  4XYC A;  1QIL A;  1EF1 A;  2R2Q A;  3WAP A;  4PK1 A;  4EZL A;  3U2S C;  2LXA A;  2ZNV C;  3DVG Y;  1H4R A;  4HK2 A;  3VHT C;  1YQB A;  1TT5 B;  1Y56 A;  2LGS A;  2J0M A;  1WJN A;  1J0G A;  2PJH A;  4RMA A;  1N63 A;  2JPH A;  3K9O B;  2Z8L A;  2MJE A;  1IP9 A;  4OVV A;  1HTQ A;  4K3B A;  4EOY A;  1Z2M A;  1FCC C;  1WGG A;  3L08 A;  4XZ4 A;  2JU6 X;  4NJC A;  1GC6 A;  2KHW B;  2LVP A;  3AB5 A;  1GC7 A;  1WGD A;  2GBJ A;  3S2A A;  4KV2 A;  1AWD A;  2O6V B;  4ANV A;  1V97 A;  2N1W A;  2IBI B;  4BKS D;  1L0Y B;  3C0R B;  1JAL A;  2K39 A;  1RYJ A;  1Q10 A;  1I35 A;  2RDH A;  4A55 A;  2BWF A;  2H89 B;  2KTR A;  3B2G A;  2OJW A;  2DEN B;  2K22 A;  2KJH B;  2CKH B;  2IND C;  2KYW A;  1NDD A;  3VTV A;  2DYO A;  2MX2 A;  3UIN B;  4E71 A;  2CJN A;  3AI5 A;  4DHZ E;  4XWT A;  4AJW A;  1JQ4 A;  2K8B A;  2EKI A;  3M95 A;  1J7A A;  2CJO A;  3VDZ A;  4L23 A;  4HKZ E;  2LI5 A;  4WWP A;  2OHF A;  1C4A A;  2BYF A;  2IO2 B;  1IBX B;  3ZDT A;  2JUO A;  2SEB D;  1NYR A;  1JRU A;  2CHW A;  3V60 A;  1V5O A;  1SIJ A;  2DYB A;  5FKA C;  3UIP B;  3R7Q A;  2INC C;  4XC2 A;  1LXD A;  1TY0 A;  4KIK A;  1M94 A;  1YX6 B;  3EHV A;  3A9K A;  1WMH A;  1BXT A;  1YJI A;  3ZDM C;  3AE2 B;  5FK9 C;  1UGJ A;  3ML9 A;  3E56 A;  1CK1 A;  1DOI A;  2QSD A;  2J53 A;  1XLQ A;  1L0X B;  2D3G A;  3HUI A;  3Q3M C;  1ISN A;  2LWP A;  4B9K A;  2BYT A;  3KUD B;  3KQ4 A;  3JVZ X;  3P4R B;  3RCZ A;  3P4Q B;  1XQQ A;  4EEW A;  3EA6 A;  1FPY A;  5DPT A;  4ZRK A;  2C7N B;  1HE8 A;  2M1M A;  2N7J A;  1YOV B;  3A9J B;  1WR6 E;  1C4C A;  3OJ4 B;  1TIF A;  1FFV A;  4OZC A;  3FIL A;  3I5J C;  4JWS C;  2J0K A;  2MBQ A;  2VZK D;  3GS2 A;  4LNI A;  4WJQ A;  1TZO A;  2BBC A;  2JXX A;  2KFJ A;  2MJ3 A;  4EZK A;  4AP4 C;  3IHP C;  1F2R I;  2JVC A;  2FNJ B;  1FXA A;  3B08 A;  3A1Q B;  3FKY A;  1UNS A;  2KQS A;  3CWI A;  3ZNI D;  2V3N A;  4A3O A;  3T3N A;  3PZ7 A;  1L0V B;  1J7B A;  3QAQ A;  3SR6 A;  4MJS A;  1FIQ A;  2KDE B;  4WJP A;  3P4P B;  2WS3 B;  1SXT A;  4YTM B;  3Q8A A;  5EE1 A;  5L83 A;  1VRA B;  2DZM A;  2BWE S;  1J19 A;  2IGG A;  3QWZ B;  2KX3 A;  1FNV A;  4FJV B;  4C7Y A;  4F8C B;  4PYZ A;  5IKC M;  3PT2 B;  1P98 A;  4F1S A;  2RPV A;  2KJR A;  2RDG A;  2PVO D;  2QIE B;  3NVY A;  3KWL A;  2WDV B;  1HXY D;  2WXR A;  2JF5 A;  2MHJ A;  4GDL A;  2V0G A;  5DPR A;  2L0T A;  1L4D B;  2BKR B;  4CQN A;  4EZJ A;  5CTR C;  1YIW A;  4NNJ B;  4RF1 A;  1VD2 A;  4XGA B;  1UZX B;  4IUM B;  3SD5 A;  4P16 A;  1UWM A;  3J9C A;  2WYQ A;  1E8X A;  4PS8 A;  1ZW7 A;  2FUG 1;  4GDK A;  2KQ7 A;  2RPQ A;  4ICV A;  3AEG B;  2FE8 A;  2LGI A;  5JXV A;  2HDE A;  3W1Y A;  2WLB A;  4NPN A;  5DCN A;  2K8H A;  2GB1 A;  1VJK A;  2KD0 A;  1ZGU B;  3KWV A;  3PS6 A;  4KGT A;  2LAS A;  4IM2 A;  1WM3 A;  2M4N A;  1BUI C;  1GB1 A;  4GXB A;  4K7W A;  4K81 A;  3V61 A;  2XNA C;  4FJY A;  2NMQ A;  3BY4 B;  2ZZP B;  2RR9 A;  1GNU A;  1ZKH A;  4W9L A;  1IGC A;  2G4D B;  2MBB B;  4MM3 A;  1F52 A;  1HA5 A;  2GBR A;  3AMZ A;  3M3J A;  2KTF A;  2N7D A;  2DLB A;  1NYQ A;  1GUA B;  2YEP F;  3B1L X;  3W1S C;  4A6Q A;  2ON8 A;  4DXA B;  3V05 A;  2M17 A;  1V86 A;  4GU2 A;  3VFK A;  2JT4 B;  2E3T A;  2LUM A;  2J7Q B;  2KAC A;  3DQV A;  4W9H A;  3PLU A;  1BML C;  3RNC C;  4HPL B;  1MHX A;  1TKG A;  3QHT A;  1SE9 A;  1V8C A;  2HD5 B;  3NS1 A;  1SE4 A;  2XK5 B;  3MC8 A;  1WXA A;  2K6Q A;  2XBB C;  3V6C B;  2JYE A;  4LJO B;  1FFU A;  2JZZ A;  2LVO A;  4HKQ A;  1WYW B;  4X57 B;  3TCA A;  4US8 A;  2QIL A;  4XDC A;  3PPA A;  3V6E B;  3PVL A;  1E8Y A;  1MFW A;  4YT0 B;  1EU3 A;  1I4P A;  3VTU A;  3ZJT A;  3HVD A;  3VUW A;  1VCB A;  2BKF A;  1UH6 A;  1FNU A;  2MBE A;  4BKT A;  1JRO A;  1NVI D;  2KFK B;  1SJE D;  1K50 A;  1TGZ B;  3VUY A;  2LFI A;  2HJ8 A;  2JWZ A;  1C1Y B;  5GMV A;  1TTN A;  2L00 B;  4UDU C;  2KWC A;  2W3R A;  5LXI B;  4BVU C;  4W9E A;  2N9L A;  3Q3O C;  3MJW A;  1KRH A;  1K52 A;  3AEE B;  2L1A A;  2A4Z A;  3B0A A;  3BZD B;  1STE A;  2M8S A;  1V1P B;  1E10 A;  3DCG A;  3JSV A;  4IWO A;  2ZEQ A;  3Q2A C;  3AE3 B;  1R7S A;  1SE3 A;  2RSU A;  4FAD A;  1AN8 A;  4HRO A;  2JQR B;  2BB5 A;  2D11 A;  3WAM A;  4WAA A;  3V62 A;  3VR8 B;  2GMI C;  1LFD A;  2CR5 A;  2KN5 A;  4HPM B;  4G0N B;  4KKJ A;  4K3C A;  4ASW C;  4N6E B;  1ROE A;  1ET6 A;  1EF5 A;  2ZNV B;  2CS4 A;  3U4E G;  2FID A;  3OJ3 A;  1E8W A;  4HRS A;  2KT7 A;  3GZN B;  3RFZ B;  4PYU A;  4LJP B;  2MH7 A;  3DWM A;  3RN9 C;  1WXM A;  1V9J A;  5LNK 1;  1J8C A;  4AJY B;  3AE5 B;  5D94 A;  3D32 A;  2FCN A;  3NHE B;  1SEB D;  3L17 A;  4ZRP A;  2QDF A;  1V81 A;  4FN2 A;  3PRE A;  2O2V B;  2N4F A;  4FUL A;  5FR6 A;  2AQ2 B;  3IT4 B;  2GBK A;  3R8B A;  3MHZ A;  3IBE A;  2D07 B;  2GBN A;  1OTR B;  2KMC A;  2ZCB A;  1UUP A;  1YJJ A;  3U7D A;  3CST A;  2I1K A;  4A90 A;  1WRD B;  1WJ6 A;  3ZNG C;  2PW9 A;  1F77 A;  3T9L A;  4MGI E;  2D3C A;  4HVB A;  3SFE B;  3KUZ A;  3GZN I;  2G45 B;  2BGF A;  5G5G A;  1I42 A;  1SE2 A;  4N9F 4;  4GIV A;  2WXK A;  5AUK A;  4YSZ B;  3E9S A;  4A3P A;  3LYY A;  2UWQ A;  3O13 A;  1IGD A;  4KDI C;  1I4H A;  1SBB B;  3B2F A;  1ZXI A;  3ZTC A;  2Y3A A;  5HFY A;  4KGS A;  3RNA C;  2REX A;  4LTU A;  2N9P C;  1LO5 D;  1T0S C;  4NY0 A;  3PO0 A;  3Q8F A;  2LRW A;  3AM9 A;  3IFW B;  2CU3 A;  4LNF A;  4RNA A;  4RM8 A;  1XLN A;  3VVW B;  2V3S A;  1T5X D;  1CQV A;  1BT0 A;  5D2M B;  3CMM B;  4PS3 A;  5CX3 A;  3APF A;  3AE6 B;  3NS8 A;  1WXS A;  2AQ3 B;  3HK0 A;  4JQW C;  4KKI A;  1WE7 A;  2BYV E;  2LHD A;  1JML A;  1QKZ A;  2J0J A;  3ALB A;  2GI9 A;  3DBH B;  1EM7 A;  3N9Y C;  1I4Q A;  2MBH A;  2BT6 A;  3L4P A;  2L32 A;  4DXG A;  2LGY A;  1WYG A;  3OAW A;  3QIJ A;  2ICI A;  1N61 A;  3TL5 A;  2M0A A;  4REZ A;  5JHA A;  4WWN A;  2LHE A;  3H7P A;  4W9I A;  4IM3 A;  4ZOH C;  3DBS A;  1HEZ E;  4RFB A;  2NPT B;  4ANX A;  2NBV B;  1EWY C;  2R61 A;  1E90 A;  2G9H D;  2DHZ A;  2LUE A;  2Z59 B;  3DHG C;  3N20 C;  4B0M A;  1H7X A;  5C3J B;  1RM6 C;  4DHZ B;  3DBH I;  3WIM A;  3U30 A;  5IN7 A;  2DYM A;  3ZGZ A;  2C60 A;  3FC4 A;  4P7I A;  3EEC A;  3Q14 C;  3TUO A;  1XD3 B;  5HHD G;  2MA9 B;  2MP2 B;  4GLS C;  1QOA A;  2IO1 B;  2DAJ A;  1D4B A;  5KHO A;  4DHJ D;  2V3P A;  2WNM A;  3AXC A;  1T3Q A;  3DHI C;  5KHQ A;  3WCQ A;  3WAO A;  4J6I A;  2WXM A;  5HI1 A;  2NBU A;  3N1X C;  4M0W B;  4MGY E;  1E7P B;  3AE8 B;  1RAX A;  3IAS 1;  1YQ4 B;  1WJ4 A;  4I6P A;  4IW0 A;  3HM6 X;  1WSP A;  3UI3 A;  4HJK A;  3DHH C;  3NZU A;  2IJ0 A;  5E6J A;  4C4V A;  1CJE A;  1E8Z A;  4W9J A;  5BMH A;  3TEY A;  1XCT L;  2PIA A;  4TSS A;  2KVZ A;  2L52 A;  4ZRI A;  1XLP A;  4JE3 B;  3BYY B;  2CU1 A;  4B95 A;  4C00 A;  1DGJ A;  4TQ1 A;  2DBY A;  5H92 C;  3O65 B;  4EE2 A;  3LXF A;  3KYC D;  4USA A;  3ZXV A;  4N59 A;  3EGR A;  4LK0 M;  4KGR A;  3CSF A;  1V1O A;  5JZE B;  3W5U B;  3PRP B;  2LXC A;  1R4N B;  2IGH A;  3NVW A;  5I4D A;  4MSM B;  3A4S C;  2LEK A;  4EFO A;  3UF8 A;  2XK5 A;  3ZVV A;  4R3D A;  2HTM E;  1V80 A;  1J7C A;  2IY1 B;  3AU4 A;  4GGQ A;  2VZK B;  4OHJ A;  2LJI A;  4G50 A;  1OQQ A;  4FLH A;  2M0X A;  1FNW A;  1MVK A;  1T0Q C;  2PE9 A;  1TBE A;  2WDR B;  2WXP A;  5BYR A;  3VAW A;  4OZA A;  4WQO B;  5J17 A;  3CF4 A;  4M00 A;  3P1M A;  3EUB 2;  2W3S A;  3VRB B;  2N9K A;  5AZH A;  4B6W A;  1UF0 A;  1V5T A;  4GN1 A;  2FCM A;  3TMP B;  1R4N I;  4FXC A;  4DXF A;  1D5Z C;  1WGH A;  2WX1 A;  3BK1 A;  3UIO B;  2ZPN A;  3ZIM A;  2JSV X;  1ZE3 D;  1SGH A;  3HVZ A;  4WQM A;  4N58 A;  4YL8 A;  3AEF B;  4RH6 A;  1OGW A;  4KX6 B;  1C79 A;  3TEX A;  1WM2 A;  3DVG X;  4ZRQ A;  1C9F A;  3CIR B;  1PDX A;  1R4M B;  3VXW A;  1F1H A;  3BVM A;  3SDL C;  2BYE A;  3MC9 A;  2VH2 A;  2IYD B;  1KTK A;  2PEA A;  2YVC A;  4HDO A;  5JH5 C;  1VLB A;  2KTR B;  2WXJ A;  3TBL D;  5EE3 A;  1TJE A;  4YWG G;  5D6J B;  4BZA A;  3ZNH B;  1QQR A;  4EKU A;  2N0S B;  1YN3 A;  4OVZ A;  2KVR A;  1B9R A;  3KH0 A;  4II3 B;  4M8N A;  2KQ4 X;  4BKG A;  3Q3F A;  1JCK B;  1X1M A;  2MSE D;  4XX5 A;  2C5L C;  3QQ8 B;  3N30 A;  4HCN B;  2GOW A;  4FBJ B;  1EO6 A;  1HTO A;  4BFR A;  3ML8 A;  4ZHP A;  5DPW A;  5E6O A;  1QOF A;  3JYU A;  1R4M I;  1VDV A;  2W54 A;  3AU5 A;  3Q8C A;  3U52 E;  3DOW A;  4IKG A;  4NAW A;  2BTE A;  3DWG C;  4IOI E;  4GSW A;  4HLE A;  4KIK B;  3KYD D;  2OED A;  4NZL B;  2G3Q B;  3A9K B;  2K6D B;  1WMH B;  5AEK B;  3RZW C;  1WIA A;  4AUQ C;  2K25 A;  2N7E A;  3B9J A;  1H8C A;  3X0W A;  3ZLZ A;  1LM8 B;  4GMV A;  1WXQ A;  1OQR A;  4PT5 A;  1LQB A;  3I57 A;  1GPX A;  2IGD A;  3AE9 B;  1YX5 B;  1WI0 A;  4WAF A;  1AYF A;  3PTF C;  4JX1 C;  3RZF A;  2JRI B;  4ZDV A;  1FD6 A;  3PZ8 A;  2JX5 A;  1MG8 A;  2JZP A;  4E3C A;  1WF9 A;  2L3Z A;  2VH1 A;  3QCA A;  4WWO A;  2J4X A;  4KVG B;  1FXI A;  3FIL B;  3BII D;  1RFA A;  4IDI A;  1YN5 A;  5D3I B;  3A33 B;  2ASQ A;  4AQ7 A;  2KC1 A;  4M01 A;  1G6J A;  1FO4 A;  4XDD A;  2KWV B;  2D5G A;  4NJ6 A;  1KLG D;  1P7E A;  4YXD B;  2KMM A;  2DZJ A;  4TMA B;  1TS2 A;  4XE0 A;  4HWI B;  1FXT B;  1EU4 A;  4MJS B;  5C23 A;  2UYZ B;  3SU8 X;  2IY0 B;  2CHZ A;  3RT3 B;  2KXJ A;  4I6L B;  4URK A;  2BS4 B;  1FM0 D;  2BPS A;  3QJZ A;  4BOS C;  2JXT A;  5E6N A;  3APD A;  3ZJV A;  3H6N A;  2G4S A;  5T8I A;  4C7Z A;  4PS7 A;  2WHI A;  2KWD A;  3VH3 B;  1FCL A;  1GT8 A;  1HQR D;  3K9P B;  3RYT A;  4CYE A;  2K9X A;  3PRM B;  2WGS A;  4W9K A;  3HIZ A;  3N32 A;  4NQL B;  4GDL B;  4JIO U;  1XLO A;  4LCD E;  4LLG M;  1MI0 A;  4BBN C;  3GE3 C;  5G55 A;  2JZ3 B;  2A5U A;  4MGZ E;  2W55 A;  2IO0 B;  2V1Y A;  1WGY A;  1WXV A;  1RFK A;  1N5X A;  5J18 A;  2TSS A;  3MTN B;  2DZK A;  1Q1O A;  3L54 A;  4GDK B;  2MBO A;  1TZ1 A;  5LXH A;  5BMI A;  2Q5W D;  1GOZ A;  2WDQ B;  3W9C B;  4RM9 A;  3QX1 A;  3L10 B;  2KX0 A;  2PVG C;  3R66 C;  1NEN B;  4IWQ A;  4WH4 A;  2K8C A;  1RWS A;  3L0W B;  2O6V A;  3T3O A;  4ZRJ A;  4G11 A;  2NVU I;  3NY5 A;  3DVN V;  2SAK A;  3BK2 A;  3ZKJ C;  3AEA B;  1YMH E;  2OJR A;  4W9G A;  4RCO A;  2KO3 A;  1IUE A;  3ZQ4 A;  4MM3 B;  1FMA D;  1VR9 A;  4W9C A;  4S0R A;  3APC A;  1ZXH A;  1N60 A;  2MCN B;  1QLB B;  1T6B X;  1ACC A;  2EEL A;  1HZ5 A;  5IO9 A;  3AV8 A;  1JWB D;  2MEK A;  2JYT A;  2XEW A;  1FEH A;  2WXF A;  1GTH A;  5IP4 D;  3AED B;  3Q6B A;  4H2A A;  2BS2 B;  2V4L A;  4XWW A;  2L05 A;  1L2N A;  2FCS A;  3FAH A;  1IBX A;  1E5W A;  2QCZ A;  4IC7 B;  2KOX A;  2MWS B;  4LDT D;  1QZE A;  3NZS A;  2WXI A;  4DDG D;  2N9E B;  5MPO A;  3TIX A;  1C3T A;  3NUH B;  1P3Q U;  4DQO C;  2NBW B;  3H9D A;  3R7R A;  3NJT A;  1GJZ A;  1XCQ L;  4JLC A;  1N6Z A;  4JGH B;  4EUT A;  2NS5 A;  1KLV A;  1WGK A;  1D6E C;  3M63 B;  2DX5 B;  2QHO A;  5CHW A;  1I4G A;  4ANW A;  1A5R A;  5J2R A;  2N9X A;  2KLG A;  3L13 A;  3HHM A;  2JY6 A;  4AWJ A;  1JRP A;  4M02 A;  4E74 A;  3VH4 B;  4W9D A;  2L83 A;  4KSK C;  3BVG A;  2QC8 A;  2D3B A;  2D3A A;  4HEA 1;  4I6N B;  3WAN A;  3A9J A;  1T0R C;  3AE1 B;  4ITK A;  4LNN A;  2BVC A;  2ZCC A;  2G1E A;  3C8Y A;  4QAY A;  4ARC A;  1WZ0 A;  1JWA D;  2N1V A;  4ACF A;  1ZDV A;  2WXL A;  3IT6 B;  4RGM A;  3NG0 A;  2QEJ C;  2KDI A;  4OZB A;  3QC8 B;  3TEZ A;  2L8J A;  1ZDX A;  2I2Y A;  3W1S A;  1SB3 C;  2WP9 B;  3A1Q A;  2RGF A;  3JSV B;  4WUR A;  2AEH A;  1YD8 U;  2BQQ A;  3NZ3 A;  4L2Y A;  3PZD A;  3VTW A;  5CHF A;  5IA7 A;  3GP7 A;  4F7Z A;  3M62 B;  3PLV A;  1UWX A;  4AS1 A;  2L76 A;  2LGX A;  1OEY J;  4LNK A;  3DPD A;  1QF6 A;  2ZW0 A;  1C76 A;  4W9F A;  3P2B A;  4B0E A;  4KSL C;  4P1C C;  1I7H A;  1XO3 A;  3LB8 C;  4J3O D;  1I4R A;  3ZW3 A;  3OLM D;  3T8M A;  5HG2 A;  4NAM A;  2K5P A;  3TSS A;  5EDS A;  3P4S B;  2O6V D;  2WWZ A;  3ZUN A;  2X38 A;  4ICU A;  3OG5 A;  2WU2 B;  2RDB C;  1WX9 A;  2K3U A;  1C77 A;  4DHJ B;  3GB1 A;  3VQI A;  4MEL A;  2I38 A;  2MW5 A;  3AH7 A;  5BMG A;  4TKN A;  1GTE A;  1NBF C;  2DNF A;  3BIN A;  1WFY A;  1L6U A;  2FUH B;  1MPE A;  2IPK D;  3NOB A;  1E0Z A;  2CHX A;  2KDB A;  1E9M A;  4II2 B;  1LGR A;  2V9H A;  2KKC A;  2AWT A;  4YTP B;  3PSE B;  3VRA B;  2PMV A;  3R2I A;  1TKY A;  1PYW D;  3AEB B;  4GOC A;  1IYF A;  4P6V F;  1C4P A;  1ZOY B;  5C1Z A;  1PFD A;  1A70 A;  2DAF A;  3TEW A;  1S3S G;  1ZUD 2;  4BOZ B;  1KF6 B;  5DPS A;  2KAJ A;  4GB9 A;  4WJO A;  3ETR A;  5IOI A;  2KJ6 A;  3UQA A;  1FRR A;  3AUL A;  1E6E B;  1WR1 A;  2KAN A;  3C19 A;  3RNE C;  1L6V A;  1EUV B;  1KLU D;  4DK5 A;  4MDK E;  3ECI A;  1FRD A;  2XN9 C;  3KLS X;  4FJZ A;  1V2Y A;  4CO7 A;  4DDI D;  1ESF A;  1H7W A;  3UGB B;  4IWP A;  1ENF A;  1JWU D;  2BF8 B;  4Q2J A;  2Y5C A;  1V49 A;  1CMX B;  3ZRC A;  5CHV C;  2EMS A;  4M8M A;  2I1J A;  5HKH A; 
#chains in the Genus database with same CATH homology
 2Z8L A;  3Q8B A;  2MJE A;  3U4E G;  1WXQ A;  1I4X A;  1OQR A;  4PT5 A;  3I57 A;  1KH0 A;  4HRS A;  1GPX A;  3R2T A;  2IGD A;  2INP E;  3AE9 B;  3RFZ B;  1FCC C;  2MH7 A;  2J52 A;  1YQ3 B;  3DWM A;  5EE9 A;  2JU6 X;  5LNK 1;  4NJC A;  3AE5 B;  3AB5 A;  4WAF A;  1AYF A;  4JX1 C;  2MJD A;  2Y5P A;  3SFD B;  1SEB D;  1FD6 A;  3ZYY X;  4ZRP A;  3V3X A;  3PZ8 A;  2JX5 A;  1N5W A;  2JZP A;  1AWD A;  1XF5 L;  4C56 C;  1V97 A;  1N62 A;  2J4X A;  3AEC B;  1FXI A;  1L0Y B;  2AQ2 B;  3IT4 B;  3R8B A;  3MHZ A;  2WXN A;  1JAL A;  3FIL B;  3BII D;  1RYJ A;  1Q10 A;  4IDI A;  1YN5 A;  2RDH A;  2V4I B;  5D3I B;  1UUP A;  1YJJ A;  4AQ7 A;  4A55 A;  2WXO A;  4ARI A;  2H89 B;  4A90 A;  1FO4 A;  3Q69 A;  1SJH D;  4XDD A;  3B2G A;  4A8X C;  2K22 A;  2D5G A;  2PW9 A;  1F77 A;  1KLG D;  1P7E A;  4YXD B;  2KMM A;  1TS3 A;  4OW0 A;  1L4Z B;  4JWU C;  1PGB A;  2DYO A;  2PLP A;  4TMA B;  5BYQ A;  3SFE B;  3BVZ A;  1TS2 A;  4XE0 A;  2CJN A;  5G5G A;  3P42 A;  2QMT A;  1EU4 A;  1SE2 A;  4XWT A;  2BS3 B;  1JQ4 A;  1D5X C;  2EKI A;  3OWE B;  1J7A A;  2WXK A;  2CJO A;  5AUK A;  4YSZ B;  3E9S A;  1V1P A;  4L23 A;  3LYY A;  4HKZ E;  3O13 A;  2WU5 B;  2BS4 B;  1FM0 D;  2OHF A;  1C4A A;  1IGD A;  2JXT A;  1B1Z A;  3ZJV A;  1I4H A;  1IBX B;  1SBB B;  2WQY B;  1K51 A;  2SEB D;  1ZXI A;  3B2F A;  5T8I A;  1DOX A;  1NYR A;  2Y3A A;  4C7Z A;  5HFY A;  4KGS A;  4LTU A;  1SIJ A;  1LO5 D;  4L1B A;  5FKA C;  2KWD A;  1TY2 A;  2NTS A;  3PO0 A;  3Q8F A;  1FCL A;  1GT8 A;  3AM9 A;  1HQR D;  1F2R C;  1TY0 A;  2CU3 A;  4RNA A;  2K9X A;  1XLN A;  1T5X D;  1GAQ B;  1CQV A;  4GDL B;  4LLG M;  1XLO A;  1BXT A;  1MI0 A;  1YJI A;  3AE6 B;  2W82 A;  2AQ3 B;  3AE2 B;  5FK9 C;  4A9A A;  1UGJ A;  2W55 A;  1KFY B;  1CK1 A;  3E56 A;  1DOI A;  2QSD A;  4KKI A;  5GXG B;  2J53 A;  1XLQ A;  2LHD A;  1JML A;  1L0X B;  3HUI A;  1QKZ A;  1RFK A;  1N5X A;  2TSS A;  2GI9 A;  1NI3 A;  3MC0 B;  2BYT A;  4MT5 A;  3KQ4 A;  4GDK B;  3P4R B;  3P4Q B;  1EM7 A;  3N9Y C;  1I4Q A;  3URY A;  5BMI A;  1WRI A;  2Q5W D;  1GOZ A;  3EA6 A;  1TYG B;  2BT6 A;  3NVV A;  3L4P A;  2WDQ B;  2L32 A;  3W9C B;  5C2T B;  4DXG A;  1YN4 A;  2PVG C;  2N7J A;  1ZPS A;  1WYG A;  1NEN B;  4WH4 A;  1GB4 A;  3IAM 1;  1C4C A;  4O1N A;  1RWS A;  2K0P A;  2ICI A;  1N61 A;  1TS4 A;  3T3O A;  2M0A A;  4REZ A;  2LHE A;  2SAK A;  3W2D A;  3BK2 A;  1FFV A;  4OZC A;  1QOB A;  3FIL A;  3AEA B;  3IXS A;  4ZOH C;  1YMH E;  2H88 B;  4JWS C;  1HEZ E;  1MHH E;  1K53 A;  4RCO A;  4RFB A;  5TSS A;  2VZK D;  1IUE A;  3ZQ4 A;  4MM3 B;  3GS2 A;  1FMA D;  1VR9 A;  4US9 A;  1TZO A;  2BBC A;  2GRI A;  1JWS D;  1EWY C;  1TS5 A;  2MJ3 A;  2R61 A;  2G9H D;  1F2R I;  1ZXH A;  4B0M A;  4D2K A;  1FXA A;  3MFG A;  1H7X A;  1XEE A;  1N60 A;  1UNS A;  2ACZ B;  5C3J B;  3CWI A;  1RM6 C;  1QLB B;  2M56 B;  2INN E;  2V3N A;  1T6B X;  1ACC A;  3T3N A;  2EEL A;  1YNT E;  1L0V B;  3PZ7 A;  1J7B A;  5G5H A;  3SR6 A;  2DYM A;  1HZ5 A;  2ONQ A;  1XXG A;  3ZGZ A;  1FIQ A;  3FC4 A;  3AV8 A;  1JWB D;  3AE4 B;  2MEK A;  3P4P B;  2WS3 B;  3TUO A;  1SXT A;  2JYT A;  4YSX B;  1FEH A;  2WXF A;  3W5V B;  1GTH A;  2E6X A;  4YTM B;  1C78 A;  3Q8A A;  5EE1 A;  4JPS A;  1VRA B;  5HHD G;  2IGG A;  3AED B;  4H2A A;  4GLS C;  2BS2 B;  1QOA A;  1FNV A;  2YEP B;  4C7Y A;  4XWW A;  1D4B A;  3FAH A;  1IBX A;  2V3P A;  2WNM A;  1T3Q A;  2RPV A;  2WXI A;  3WCQ A;  2M19 A;  2AQ1 B;  2RDG A;  2PVO D;  3NVZ A;  2NTT A;  5MPO A;  2QIE B;  2WXM A;  5HI1 A;  3NVY A;  1NEK B;  3KWL A;  3NUH B;  2WDV B;  1E7P B;  4DQO C;  1HXY D;  3VR9 B;  3AE8 B;  2WXR A;  3Q8E A;  3IAS 1;  1DOY A;  1YQ4 B;  1XCQ L;  2V0G A;  3AE7 B;  1WSP A;  3UI3 A;  1WGK A;  1L4D B;  1D6E C;  3NRZ A;  5AUI A;  4CQN A;  2DWQ A;  4YTN B;  2IJ0 A;  2KN4 A;  5E6J A;  1CJE A;  1AW7 A;  4RF1 A;  1I4G A;  1VZ7 A;  5BMH A;  1M4V A;  3TEY A;  1QT9 A;  1XCT L;  2J42 A;  3SEB A;  4P16 A;  1UWM A;  4RGT A;  2PIA A;  3J9C A;  4TSS A;  1JW9 D;  2L52 A;  1XLP A;  2FUG 1;  4JE3 B;  2WXG A;  3BYY B;  1JRP A;  4YSY B;  3AEG B;  2FE8 A;  2LGI A;  1HZ6 A;  5D3D A;  1DGJ A;  2IDY A;  5JXV A;  2L83 A;  2QJL A;  2HDE A;  2JWU A;  4TQ1 A;  3BVG A;  2WLB A;  2DBY A;  4HEA 1;  1EWC A;  2GB1 A;  1VJK A;  5H92 C;  2BW2 A;  4WIP A;  4C80 A;  3AE1 B;  4EE2 A;  4ITK A;  3KWV A;  3LXF A;  4KGT A;  2G1E A;  4USA A;  1BUI C;  3C8Y A;  1GB1 A;  4WWM A;  2WXQ A;  2XNA C;  3RPF C;  4ARC A;  3BWU D;  4N59 A;  1JWA D;  1CZP A;  3EGR A;  4LK0 M;  4KGR A;  1V1O A;  2NMQ A;  1ZDV A;  2WXL A;  1PGX A;  1IGC A;  3IT6 B;  4RGM A;  3W5U B;  1SSN A;  2QEJ C;  1HA5 A;  4OZB A;  3AMZ A;  1ET9 A;  3TEZ A;  1ZDX A;  1TKE A;  2I2Y A;  2IGH A;  1QOG A;  2DLB A;  3I9V 1;  1NYQ A;  3NVW A;  3W1S A;  1PUT A;  1SB3 C;  2YEP F;  5I4D A;  2BB6 A;  2RMM A;  2WP9 B;  4A6Q A;  2ON8 A;  4WUR A;  2LEK A;  1D5M C;  3NZ3 A;  2WXH A;  4L2Y A;  2B76 B;  3AN1 A;  2HTM E;  4R3D A;  5EE0 A;  3V05 A;  4RF0 A;  4MAC A;  1P7F A;  1J7C A;  2E3T A;  3ZJU A;  2LUM A;  2KAC A;  3GP7 A;  4OHJ A;  2VZK B;  5H8Y E;  2LJI A;  1OQQ A;  1UWX A;  4NAW B;  4AS1 A;  1BML C;  1F0Z A;  1MHX A;  3U7Z A;  1QF6 A;  1TKG A;  2ZW0 A;  1FNW A;  1OFF A;  4MH8 A;  1MVK A;  1C76 A;  1V8C A;  4HJG E;  5D7G A;  3NS1 A;  5BYR A;  2WDR B;  1SE4 A;  2WXP A;  4B0E A;  4OZA A;  3H8H A;  2LMC A;  1I7H A;  3CF4 A;  1SF0 A;  1XO3 A;  3LB8 C;  2JYE A;  3P1M A;  3MP9 A;  3EUB 2;  2W3S A;  3VRB B;  1FFU A;  1I4R A;  4J3O D;  2N9K A;  5HG2 A;  4NAM A;  2K5P A;  4HKQ A;  3TSS A;  4M0W A;  3P4S B;  2ZW1 A;  4US8 A;  2QIL A;  4XDC A;  2X38 A;  4FXC A;  4YT0 B;  1EU3 A;  1I4P A;  4DXF A;  2WU2 B;  3ZJT A;  1D5Z C;  3HVD A;  3BK1 A;  2K3U A;  3ABV B;  1C77 A;  3GB1 A;  3VQI A;  2PTL A;  1PGA A;  2JSV X;  1ZE3 D;  3HVZ A;  2I38 A;  4WQM A;  4N58 A;  1ZP0 B;  3AH7 A;  3AEF B;  5BMG A;  1GTE A;  1FNU A;  4ZHO A;  1DYQ A;  1JRO A;  4RH6 A;  4KX6 B;  1NVI D;  1C79 A;  2FBW B;  1VZ6 A;  3TEX A;  4RGN A;  2PKO A;  4ZRQ A;  1SJE D;  1L6U A;  2AX5 A;  1K50 A;  1MPE A;  3CIR B;  1PDX A;  2IPK D;  1C9F A;  2LFI A;  1E0Z A;  1E9M A;  3BVM A;  3P63 A;  1KTK A;  3HRD D;  4YTP B;  1L5P A;  1JWM D;  4RGO S;  3VRA B;  2PMV A;  4UDU C;  3R2I A;  1VLB A;  1TKY A;  1PYW D;  2WXJ A;  5EE3 A;  3AEB B;  2W3R A;  4TQ0 A;  1TJE A;  4ZYS A;  4P6V F;  4YWG G;  1C4P A;  1ZOY B;  1PFD A;  3MJ5 A;  1A70 A;  1QQR A;  3TEW A;  2N0S B;  1YN3 A;  2N9L A;  1ZUD 2;  4OVZ A;  1KF6 B;  1VZ8 A;  1B9R A;  2KAJ A;  3BYT B;  1KRH A;  3ETR A;  2KQ4 X;  1K52 A;  3AEE B;  5FR3 A;  1JCK B;  2L1A A;  1FRR A;  1E6E B;  1WWT A;  3BZD B;  1L6V A;  1STE A;  1V1P B;  1E10 A;  2KDM A;  1KLU D;  5BYS A;  1QIL A;  3AE3 B;  4ZHP A;  1R7S A;  1SE3 A;  1FRD A;  2XN9 C;  3KLS X;  1QOF A;  1VDV A;  2W54 A;  3Q8C A;  1AN8 A;  4HRO A;  2JQR B;  2BB5 A;  3U2S C;  1ESF A;  3U52 E;  3B9J A;  1H7W A;  4IKG A;  2BTE A;  1ENF A;  3DWG C;  4IOI E;  1JWU D;  4Q2J A;  3VR8 B;  2Y5C A;  2OED A;  1Y56 A;  4NZL B;  4KKJ A;  1N63 A;  4N6E B;  1ROE A;  1ET6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...