3SFDB

Crystal structure of porcine mitochondrial respiratory complex ii bound with oxaloacetate and pentachlorophenol
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
239
structure length
239
Chain Sequence
PRIKKFAIYRWDPDKTGDKPHMQTYEIDLNNCGPMVLDALIKIKNEIDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTNLDKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEEREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTGTCPKGLNPGKAIAEIKKMMATYKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
publication title Thiabendazole inhibits ubiquinone reduction activity of mitochondrial respiratory complex II via a water molecule mediated binding feature.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 61
structure length 239
sequence length 239
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2011-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 3sfdB02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3sfdB01
3B9JA 4WQMA 3P4RB 1CZPA 2W3RA 4HRSA 4HROA 1TKGA 3NRZA 1FXAA 2JQRB 2N0SB 1DGJA 3AMZA 5G5HA 5EE0A 2WS3B 3AM9A 2L52A 1ZUD2 1GT8A 1J7CA 2G1EA 2B76B 2L83A 4USAA 5H92C 2QIEB 1KF6B 1OQRA 1DOXA 3AE3B 1WRIA 1YJJA 1J7AA 1E6EB 1FIQA 2E3TA 3W5UB 1N60A 1QOGA 1ZOYB 1TKYA 3BIID 3FAHA 1NENB 5AUIA 1SF0A 1H7WA 5C3JB 1JWBD 2K22A 2KMMA 1KRHA 1NYQA 4JX1C 1QT9A 2HTME 1WXQA 2K9XA 3AEGB 1DOIA 3VRAB 2EKIA 3AEFB 1GTHA 4YT0B 2H89B 3VRBB 2CJOA 2WLBA 1N5WA 3P1MA 1QOBA 1VJKA 4C7YA 1JW9D 1AWDA 1QF6A 4YSXB 3HVZA 5EE3A 1TJEA 1E0ZA 1V97A 2H88B 3ZYYX 1RWSA 1F0ZA 2WDRB 2WDVB 2KAJA 3AN1A 3WCQA 1N63A 2DWQA 2BS2B 3P4PB 2ACZB 1FMAD 1L6UA 2WU2B 5MPOA 1PFDA 1FXIA 1OQQA 4WWMA 1XLQA 5C2TB 4JWUC 4YSZB 1PUTA 3B2GA 2WDQB 1NYRA 1TYGB 3LXFA 3CWIA 4US8A 1RFKA 3AE7B 3AEAB 1XLPA 4ITKA 1JROA 1XO3A 4ZHPA 1B9RA 1ROEA 1KFYB 2PVOD 1L6VA 1NVID 3CIRB 1NEKB 1L5PA 1FM0D 3AE4B 2MJ3A 2K5PA 4YTMB 1XLOA 2Y5CA 4KX6B 3AV8A 3NVYA 3SFEB 4YTPB 3SFDB 1UWMA 3HUIA 3SR6A 1QOAA 3L4PA 1XLNA 2AX5A 1JALA 1WYGA 2PKOA 1OFFA 1TKEA 3AB5A 1ZP0B 3DWMA 1N62A 1VDVA 1AYFA 1CJEA 1J7BA 5GXGB 2WP9B 3NVVA 5EE9A 2FBWB 5H8YE 2Q5WD 1E9MA 3VR9B 1WWTA 1JRPA 1N5XA 1EWYC 1FFUA 2M56B 2BS4B 3P63A 4A9AA 3W9CB 2DBYA 4FXCA 1PDXA 2CJNA 3EUB2 1A70A 2BT6A 2MJEA 2JX5A 1GTEA 3P4SB 3KWLA 4LTUA 4N6EB 3DWGC 1FO4A 1YQ4B 1NI3A 3AE8B 3AE2B 1IUEA 3B2FA 3AEBB 3FC4A 1YJIA 3VR8B 1JWAD 2MJDA 2QJLA 1RYJA 1DOYA 1FRRA 3CF4A 1RM6C 3NS1A 3HRDD 2PVGC 3ETRA 5G5GA 1JQ4A 1QLBB 1H7XA 4JWSC 1FRDA 3NVWA 4C80A 3RPFC 3AE6B 1T3QA 1WGKA 3AE5B 1ZXIA 1L0VB 5EE1A 1I7HA 3NVZA 5AUKA 2MH7A 1R7SA 2W55A 1N61A 2W54A 3AEEB 2WU5B 4US9A 4ZHOA 4YSYB 1FFVA 1E10A 4YXDB 4ZOHC 2WQYB 2CU3A 1E7PB 2W3SA 4C7ZA 4N59A 3AE1B 4N58A 1QOFA 3AE9B 3AEDB 2OHFA 4P6VF 1YQ3B 3P4QB 1SB3C 4IDIA 2M19A 2BS3B 2LEKA 1V8CA 1VLBA 3AH7A 3AECB 3W5VB 4YTNB 2PIAA 3LB8C 3PO0A 1SIJA 1GPXA 1GAQB 3ABVB
chains in the Genus database with same CATH superfamily
4IG7B 1UH6A 4M02A 3AM9A 2BYFA 4IWOA 4BKSD 4A90A 3NG0A 1SF0A 2C5LC 2KVRA 1JWBD 2N7JA 1WXQA 2LUMA 4K7SA 3DQVA 3QHTA 3VRAB 5IN7A 3ZW3A 3IHPC 4TUUA 4ZRIA 3OWEB 2VZKB 5HI1A 2ZZPB 4B0MA 1LGRA 4XYCA 1HA5A 3WCQA 2BBCA 4MM3A 4R3DA 1TTNA 5C2TB 1PUTA 1KOTA 4JE3B 4W9LA 2KTRB 3Q14C 3PVLA 4MGZE 2JZ3B 3A9JA 3L17A 1MPEA 5DPRA 1TZOA 4YTMB 4NNJB 1UWMA 2KDMA 5E6PA 3U2SC 5J17A 3L4PA 2WXFA 1RAXA 1QKZA 5EE9A 1D3ZA 3RNCC 4BKSA 3PPAA 4MSMB 1J19A 4CYEA 4KKJA 3A4RA 2NS5A 2IYDB 3VUXA 1SEBD 3GZNB 1YJIA 2FCMA 3SU8X 3ECIA 3PZ8A 2NBWB 1RM6C 3Q2AC 1V81A 3HIZA 1UBIA 3PS6A 4OZBA 1N6ZA 3V60A 2BWES 3ZXVA 4XWTA 2RDBC 1E7PB 3ENEA 2KN5A 5JHAA 4P6VF 3TEYA 1WR6E 3N1XC 1ET6A 2VH1A 1QQRA 4MSQB 3ZKJC 5JXVA 2ZCBA 5MPOA 4J3OD 2NTSA 1Q0WB 2V1YA 2RSUA 1D6EC 5GMVA 4GDKB 1C9FA 1J7AA 3ZGZA 4M01A 4LDTB 3OLMD 1KRHA 2H89B 4AWJA 2IO0B 2WXJA 4LJPB 4M8MA 1UUPA 2KLCA 3UINB 5IO9A 1JWMD 3VDZA 2L7RA 2KC1A 1TYGB 3V61A 1HE8A 2A4ZA 2WXHA 3AXCA 2WXOA 5CHFA 4OW0A 4A55A 1L5PA 4HPLB 3AV8A 1XLOA 3SR6A 2R61A 4FJYA 4AS1A 2PKOA 1GC7A 2JU6X 4OVVA 2LRUA 2FBWB 4ZRJA 5L95C 4A9AA 2QCZA 1MJDA 1TZ1A 4XWWA 3PRMB 1P98A 3AE2B 5LLIA 4NJCA 5IA7A 2BYEA 3QJZA 2PVGC 1BMLC 2FUG1 3RI7C 3Q8AA 1H8CA 2INCC 3RNGC 2JF5A 1E10A 1ZDVA 4YXDB 3EFUA 2WXMA 2O6VB 2IGHA 4AP4C 1MHHE 3KVFB 2JZPA 4WJOA 1STEA 3W5VB 4Q2JA 4FA6A 2JRIB 4EUTA 3P4RB 3NRZA 2MLBA 2KKCA 3TJPA 3TCAA 5AUIA 1QOGA 1T5XD 2GBJA 2BB6A 3NZUA 4O1NA 2KMMA 4M8NA 4BFRA 2YEPF 3T9LA 1WXMA 4L23A 1WI0A 3P1MA 4IC7B 1N5WA 3J9CA 1E8ZA 1JW9D 3PZDA 3A1QA 1WSPA 3VVWB 3QA8A 1IPGA 2RDGA 3TEWA 3I9V1 1L6UA 2XN9C 2PE6B 4ICUA 3B2GA 3GZNI 1F52A 4RMAA 2KMAA 3VFKA 3RCZA 1GC6A 2KWUB 1MVKA 2KJ6A 4OHJA 2UU7A 1K51A 2IY1B 5C1ZA 2NR2A 3KWVA 4NPNA 4RM8A 2AX5A 2AQ1B 3IXSA 2KDFB 2WXNA 1N62A 3SEBA 2HDEA 1PQSA 1YN4A 5AZFA 4HJGE 2IDYA 3EGRA 4N6EB 1ZDXA 4LTUA 1YJ1A 1YQBA 3AE8B 2DYOA 3W1SC 1LFDA 1C77A 3W1YA 4GDLA 1FRRA 3R2IA 4XZ4A 3L13A 1K8RB 2YVCA 2KT7A 2LVPA 3HM6X 4FJZA 4GN1A 3ZNZB 3APDA 4WWNA 1ZKHA 4P16A 3SHQA 4C56C 1WMHB 3IG3A 2WYQA 2ZJDA 2V3PA 3M63B 2MP2B 3DHGC 2JQRB 3N1ZC 2LVQA 4BOZB 5H92C 4HK2A 2RPQA 2KQ4X 1WGYA 1N60A 1S1QB 1ZOYB 4MELA 5BYRA 3I63C 4KV2A 4KZCA 2ZPYA 2KQSA 5E6NA 4I6PA 2DNFA 2HTME 3RNBC 3MC0B 1GTHA 1VZ6A 4ANUA 1XCTL 4REZA 4E74A 4AJWA 4OZCA 4NQKE 4RGTA 3I57A 4DHZB 1NYRA 4FBJB 3NY5A 2JXXA 4CO7A 2I1KA 2BTEA 1VR9A 4D2KA 1XO3A 2FE8A 1KFYB 2ZNVB 4J6IA 3MHZA 1MG4A 3TUOA 2ASQA 4W9HA 3RD2A 3PT2B 3ZNHB 1AYFA 2DAJA 1WH3A 4MM3B 3V62A 4LNOA 4XGAB 3PHXB 3X23A 4IM3A 3P63A 2BS4B 2JYEA 3BYYB 1KLGD 2RDHA 4L1BA 2YLMA 3QAQA 3AI5A 3A9JB 3TEXA 3IFWB 2MJDA 1I42A 3ML9A 1SE9A 2Y3AA 3AULA 4E71A 4FULA 3GP7A 1KH0A 3QARA 2WU5B 2KK8A 4LLGM 3NZSA 3DBRB 2LVOA 3RT3B 4EZJA 2G45B 4KDIC 1EO6A 1EF5A 1R4MB 4IDIA 3EFCA 3HHMA 1BXTA 3GE3C 1I35A 2L52A 2MEKA 1SE2A 4HKZE 1D5MC 1TKGA 2N0SB 1EU3A 3AMZA 3X0WA 2J42A 1ZUD2 2NBUA 2KZRA 4HJKA 2K6DB 3ZXRA 4LK0M 1SXTA 2KX0A 4KKIA 2FCSA 4B0EA 1F1HA 3RZWC 1WX8A 1VJKA 3Q6BA 3NOBA 3WA0A 2H88B 4TKNA 1R4NB 4JLCA 1SE3A 3L54A 2GOWA 1V49A 3ZRCA 1BT0A 2IZVB 2GBNA 2WXGA 3M62B 2AEHA 1E8WA 5LXHA 4MEMA 4F8CB 5CHVC 2FUHB 1V9JA 4BZAA 5KHQA 1WYWB 1MI0A 3HUIA 2QILA 5G2NA 4KGTA 5TR5A 1UD7A 3KUDB 1ZE3D 4LCDE 2JY6A 2K0PA 3QC8B 1UWXA 2A5UA 1V6EA 3Q8BA 2DBYA 2XK5B 2MJEA 4WAFA 1NI3A 3DBHB 4MGYE 3KLSX 3RUIB 2GI9A 4AUQC 1TS4A 3HVDA 5EDSA 2C7HA 5D2MB 4PS3A 4C00A 5DPSA 4DQOC 4C80A 3MC8A 4K3CA 1I7HA 4WAAA 1Q10A 2EMSA 2KTFA 4EKUA 4C7ZA 3BVMA 4NAWA 3KYCD 3DBLI 3AEDB 4XDDA 2N1VA 1VLBA 2D5GA 3ALBA 2KJRA 3V3XA 2MP2A 3B9JA 2D10A 1JMLA 5EE0A 2WS3B 4LJOB 4KDLB 1GT8A 1J7CA 2MHJA 3PHWB 5IAAC 4DHZE 2INPE 2G4DB 1Y56A 1KLVA 2BGFA 4LNIA 1V1PB 4A8XC 5D3DA 2REXA 2LD9A 2L00B 1DOIA 2EKIA 3VRBB 2BVCA 3GE8C 5BO4B 3PLVA 1KTKA 2BS2B 4G0NB 5DPTA 4YSZB 1GB1A 3Q8EA 1J8CA 1PGBA 2DZIA 4ITKA 4K81A 1ROEA 2N7EA 4PK1A 4ICVA 1T0YA 2DAFA 3W2DA 3ZDTA 3NVYA 1V5OA 3B1LX 4F1SA 3A1QB 3N3KB 3DBRI 1VZ7A 3JW0X 1J7BA 1V1OA 4GB9A 3ZDMC 4BOSC 1R4MI 4IKGA 2L3ZA 2DZMA 5D7GA 3M3JA 3W9CB 2CJNA 2DYBA 1WRDB 5HG2A 1J0GA 2JX5A 1GTEA 3KWLA 1YQ4B 1IUEA 4GIVA 3N30A 4HWIB 1HZ6A 1AN8A 2ZCCA 1UBQA 3N32A 4B9KA 3S2AA 5D94A 4NY0A 1LO5D 1PGAA 4NJ6A 2QDFA 3FILA 3ZTCA 2CU3A 3PREA 1SB3C 2M19A 2ZW0A 1E90A 3AECB 4GDLB 4LNNA 2BPSA 1KM7A 3V6CB 1SIJA 2GMIC 4A3PA 4KSLC 5G5HA 3TSSA 3PRZA 2L83A 2MBOA 4FLHA 1F9JA 2D3BA 1E6EB 4XX5A 1WY8A 5D6JB 3RNFC 1L4DB 2LRWA 3JYUA 3HVZA 3MJ5A 1XD3B 3P4PB 4ANVA 1LQBA 2JXTA 2K8HA 2KDBA 4W9EA 3ZLZA 1XQQA 1NI2A 2V3NA 4HEA1 1WE7A 1I4XA 2CHZA 3URYA 2HJ8A 3HK0A 3ZTDA 3SFEB 3O13A 2MWSB 4EFOA 5IOIA 1WJ4A 2KFKB 1VDVA 1CJEA 1F2RC 3A9KA 4G3XB 5E6OA 1WWTA 5LXIB 1WGRA 4MDKE 1CMXB 1PDXA 2X8XX 1A70A 1MFWA 2XK5A 3ZJVA 4KGRA 2QJLA 1DOYA 1C78A 2BB5A 3T8MA 4YL8A 3QX1A 1T3QA 3PSEB 3DVGY 2SEBD 2MBQA 1SSNA 3NVZA 4ZRQA 1R7SA 4US9A 2I1JA 1V86A 1AARA 1ENFA 1SE4A 1FFVA 3U7ZA 3QQ8B 3ZJUA 2KFJA 3AU4A 3L08A 4JGHB 4N59A 1T0QC 2LEKA 4HDOA 4L2YA 4I6LB 5C23A 4HVBA 3PO0A 2L0TA 2N9XA 1WX7A 4FHJA 2QHOA 2NPTB 5FK9C 1ZGUB 1YJJA 1FIQA 1QZEA 2FNJB 4ANXA 3BK1A 1V1PA 1NYQA 4DHJB 3AEGB 1WGDA 2GRIA 1M4VA 2G3QB 3Q3JA 1TJEA 1ZXHA 2KNBA 4ASWC 2WDVB 2IBIB 1N63A 4LNFA 2M4NA 3T3NA 1FMAD 2MBBB 1D4BA 1FXIA 1OQQA 2BQQA 2UWQA 3BYTB 3AEAB 4MGKE 4ANWA 1X1MA 3IBEA 3ZRFA 4II3B 3PGEA 2AWTA 3WAPA 3ZIMA 1JALA 1XF5L 1OFFA 1WXSA 3RN9C 4M00A 4PYUA 1N5XA 1UZXB 2CKHB 2N9EB 2OEDA 3NHEB 4DK5A 2DENB 3P4SB 1SJHD 2C60A 2ICIA 4HKQA 3KUZA 1VD2A 3CF4A 2RMMA 3NS1A 2LGYA 2NCNA 3DVGX 3E9SA 3RPFC 2HE7A 3CMMB 2KX3A 2LI5A 5AUKA 1N61A 5G55A 4ZHOA 2GBMA 2MA9B 4ZOHC 4NQLB 2OHFA 2ZVNA 4WWOA 2IJ0A 4EOYA 4DXFA 3C0RB 2LUEA 1TBEA 1GAQB 4MJSB 1KLUD 3PLUA 4WJNA 2UYZB 2KMCA 1C4PA 4W9DA 5I4DA 2KHWB 4PS8A 1RLFA 4RH6A 3FAHA 1NENB 4GU2A 4NAWB 4OVZA 3CF6E 4NJ7A 1F2RI 2Z8LA 2INDC 2LGIA 3A33B 3MFGA 3VUYA 1K52A 1PFDA 1WIAA 3LXFA 5BYSA 2KC2A 2JZZA 4HDQA 2KVZA 3FKYA 4KX6B 3SFDB 2N1WA 2BF8B 1WE6A 5GXGB 2Z59B 2KFKA 2DHZA 2WX0A 1JRPA 2N9LA 1UELA 2D3GA 1TGZB 5JZEB 2DZJA 2D11A 5BMHA 2ZNVC 1JWAD 2M17A 1VZ8A 2V9HA 4DHJD 3RMKC 2L0FA 3LJ3A 3ZUNA 1H7XA 2GBRA 1P0RA 5CX3A 3KUCB 3R3MA 1ZXIA 2BKRB 1L0VB 2CS4A 1MG8A 4DWFA 1I4HA 4GMVA 2G9HD 4A20A 1YN3A 1C4CA 3AE9B 1WGGA 1NBFC 3H8HA 4GLSC 1V8CA 2CR5A 1IYFA 4K7WA 3VTWA 4YTNB 5JH5C 2I38A 3GB1A 3NZ3A 3APFA 1FXAA 5IP4D 2NPTA 2CU1A 3D32A 3FILB 1L7YA 3MP9A 2OJRA 4HPMB 4DBGA 2BYTA 2CJOA 5CHWA 4KGSA 3ZYYX 2L1AA 4RF0A 3PV1A 2R2OA 3RNEC 2WXRA 4PT5A 5L83A 3CSTA 2JVCA 2D2QA 2LGSA 3BVZA 3DOWA 1A5RA 3H7PA 2JWUA 1JWUD 2MJ3A 2Y5CA 2LASA 3I5JC 4AJYB 3WANA 1VCBA 2D3AA 3TL5A 1C79A 5H8YE 2J0JA 2J0KA 2PW9A 1QILA 2AL6A 3EUB2 1YN5A 4XDCA 2N4FA 2K25A 1K53A 3VH3B 3WAMA 3KH0A 3ETRA 3UQBA 2KWVB 1SBBB 4TQ1A 4BAXA 4FADA 3AE6B 3IAM1 3AE5B 3A9KB 4W9FA 2V4LA 4AQ7A 4N58A 4K7UA 1I4RA 5IKCM 4EZKA 1WFYA 3BVGA 4BBNC 2LZ6A 3WAOA 4S0RA 2MQJA 1GPXA 2TSSA 2B3AA 4K3BA 4WQMA 2V0GA 4HCPB 1S3SG 3DHHC 4K1RB 4MJSA 3VTUA 1T0RC 1LXDA 1FEHA 2MBHA 1KJTA 2KWCA 4ZYNA 2WXKA 3BY4B 1WF9A 2IO2B 1FD6A 2K6QA 3DVNV 3AEFB 3EECA 4YT0B 2O2VA 1QOBA 1AWDA 4JQWC 2WXPA 5EE3A 3OJ3A 1V97A 1RWSA 4RFBA 3M95A 2JWZA 2D07B 2BYVE 2KXJA 3DVNU 2BWFA 4ARIA 4TMAB 4W9CA 5D3IB 2GLSA 3B08A 3ZNGC 2KDIA 4ZDVA 3CIRB 1NEKB 1LM8B 1FM0D 2KJHB 1C1YB 3ZNID 2PPHA 2QEJC 4GSWA 1E8XA 2ONQA 1F77A 5TSSA 2DZKA 2KQ7A 3QIJA 3AB5A 1ZP0B 2L05A 3GOEA 3O65B 3QK0A 5KHOA 3OJ4B 2D3CA 4P7IA 3VR9B 3NJTA 1Z2MA 2IO3B 2G4SA 3JVZX 4FXCA 1TT5B 3B2FA 3SDLC 3Q3NC 1U4AA 4OZAA 4URKA 2J53A 4MT5A 2AQ2B 5DPWA 4GGQA 2MW5A 1WM2A 2NMQA 4MH0E 2W54A 3ZQ4A 1HQRD 2VH2A 3WIMA 2E6XA 3P42A 1YQ3B 2ON8A 2Y5BB 3U8ZA 2MRPA 1ESFA 1IBXA 3LB8C 4ZRPA 2WX1A 1GOZA 5FKAC 1P1AA 3QCAA 2AQ3B 4HPPA 2RD0A 4MGIE 2B76B 2QIEB 2N9KA 1P7FA 3UIOB 4MACA 3SD5A 2E3TA 3RZFA 3W5UB 3BIID 4DXGA 1H7WA 4JX1C 1YX5B 1ACCA 2K9XA 3R66C 1NDDA 1R4NI 1WXVA 4N9F4 4KSKC 2WLBA 4JL9A 1FNUA 3V05A 1GNUA 1OEYJ 1L2NA 2IO1B 2ACZB 3JSVB 2WU2B 2K8CA 4M0WA 3I3TB 2WDQB 2FCQA 2DX5B 4IM0A 3KW5B 3ML8A 3VUWA 3DDCB 3VQIA 3VHTC 1L6VA 4JIOU 4RNAA 1RFAA 2K5PA 4YTPB 4P1CC 2WNMA 1P7EA 1TKEA 1YNTE 5J18A 2LXAA 1OGWA 4WJPA 1E9MA 1V80A 3BK2A 2L76A 4BVUC 3DBHI 4I6NB 2V3SA 2IY0B 5JHBA 2PE9A 3RYTA 2LHDA 4RCOA 2XNAC 2M1MA 2AL3A 4TSSA 3Q8FA 2OJWA 2M0XA 1YD8U 2LFIA 1PGXA 3C19A 2LWPA 4BKTA 3RFZB 2HJ1A 2W3SA 4C4VA 4G50A 2LXCA 2SAKA 4P1BC 2XEWA 2JYTA 3P4QB 1OQYA 3AH7A 2EMTA 5HHDG 2PIAA 4ZRKA 3IVFA 4JPSA 2W3RA 4HROA 2M8SA 3R8BA 2XBBC 3L10B 5AZGA 3CSFA 2RGFA 1T6BX 4USAA 4IUMB 1FNWA 1H4RA 1C76A 5C3JB 4PYZA 2PTLA 3IT6B 5HFYA 3U4EG 1HTQA 1XT9B 2FAZA 4YSXB 2IGDA 2KACA 1E8YA 4IWQA 2JT4B 3PZ7A 2DWQA 1FPYA 3MC9A 1ISNA 1SJED 1RFKA 3AE7B 4KZ0A 3U7DA 4ZHPA 2CHWA 3ZVVA 2PVOD 3T3OA 3PRPB 3Q8CA 1WYGA 2KWDA 2VZKD 1FNVA 3DWMA 3E56A 3Q3MC 3R2TA 2WGSA 5E6JA 2K1FA 3H6NA 3UI3A 2WXIA 5CTRC 2EKEC 4XE0A 1B1ZA 3DWGC 3H7PB 1TY2A 3AU5A 2JRHA 5BMGA 3TIXA 4KIKA 3LDZE 2INNE 1JQ4A 3Q3FA 4JWSC 2FIFA 3UIPB 2HD5B 1BUIC 4IWPA 4W9IA 2Z0DB 3Q69A 2RPVA 4W9JA 1T0SC 3MJWA 1QOFA 2BS3B 2WXQA 1D5ZC 1OTRB 2IPKD 3NS8A 1L0YB 1CZPA 1I4QA 1JCKB 5LNK1 1IGCA 2OOBB 2MCNB 1JWSD 2G1EA 2LGDA 1KF6B 1IGDA 1OQRA 3AE3B 1D5XC 1L4ZB 2KTRA 1I4PA 4DDGD 2K22A 4OVUA 1WX9A 1EU4A 3DPDA 1EF1A 4FJVB 2KD0A 1P9DU 1XXGA 2C9WB 3UF8A 3U52E 3AN1A 1TY0A 1FXTB 2Z0EB 3EHVA 2L8JA 3JSVA 2MBEA 3VTVA 1UGMA 4G11A 3ZJTA 4EZLA 5FR3A 5HKHA 3B0AA 4LDTD 2NBVB 2O2VB 4A6QA 3MTNB 2RR9A 1QOAA 4TV3A 3V6EB 2KANA 2DLBA 2MSED 3RNAC 2DYMA 4WURA 2K3UA 3A4SC 3ZO5B 4W9KA 4QAYA 2NTTA 4BBNF 4RGOS 2R2QA 2PEAA 2M0AA 1FO4A 3KYDD 1GUAB 4MH8A 1XEEA 3VR8B 1E5WA 1EWCA 2JSVX 1RYJA 3TEZA 1QLBB 2N9PC 5DCNA 1FRDA 3L16A 3NVWA 4IW0A 3TMPB 4AOFA 2LHEA 5EE1A 1Q5WB 1WXAA 2MH7A 2W55A 2QC8A 4YSYB 4GDKA 3P2BA 3U30A 3H7SA 2J7QB 5T8IA 4A3OA 3AE1B 4B95A 4FHKA 1P3QU 3H1UA 1C4AA 4RGMA 4II2B 4E3CA 2KOXA 3PTFC 3WALA 3DBLB 1TIFA 3DBSA 2J52A 1EM7A 1MHXA 1DGJA 2CHXA 3Q3OC 4XC2A 1WZ0A 2WHIA 4KVGB 4ARCA 4B6WA 2Y5PA 4CQNA 1M94A 3K9OB 1CQVA 1TKYA 2FCNA 2KLGA 3UGBB 4DDID 1DYQA 2NVUI 3OAWA 1GG3A 3KQ4A 2O6VD 1Q1OA 2AYOB 1IBXB 4GOCA 2J0MA 5AEKB 1E0ZA 5BYQA 1F0ZA 2ZPNA 1YIWA 4ACFA 2KAJA 2KDEB 1SGHA 1WJ6A 3ONSA 2LMCA 3C8YA 3UQAA 1JROA 4CHKA 2I2YA 1L0XB 1NVID 2QMTA 3AE4B 2PLPA 1HZ5A 3IAS1 3N9YC 1VRAB 2YEPB 2LJIA 2WP9B 1SIFA 3NVVA 2ZEQA 4NAMA 4M0WB 4F7ZA 1FFUA 2M56B 5FR6A 3N20C 2JUOA 3TBLD 4UDUC 4X57B 2O6VA 2X38A 5J2RA 4WWPA 3R7RA 3AEBB 1EUVB 2WWZA 1WR1A 1PYWD 3BWUD 2K8BA 1ET9A 1Z5SB 5G5GA 2C7NB 4WJQA 3VXWA 1WGKA 1ZPSA 1HXYD 2KN4A 3VH4B 1WJUA 2K39A 4S17A 2ZVOA 4RF1A 2BKFA 3N1YC 3IT4B 2GBKA 3GS2A 1YOVB 1UF0A 2WXLA 1WZ3A 1ZW7A 4H2AA 1WM3A 5AZHA 1WGHA 2L32A 4DXAB 4HRSA 1C3TA 2LGXA 4HLEA 3RULA 2PMVA 2QSDA 3OG5A 2WDTB 2JPHA 4TQ0A 4WH4A 1DOXA 1WRIA 3EA6A 4C4VB 4RM9A 1QT9A 1YMHE 4ZYSA 3QWZB 1GJZA 4C7YA 3H9DA 2GB1A 2PJHA 1K50A 1V2YA 1QF6A 3NUHB 2WDRB 3HM3A 2J4XA 4HXDA 1RRBA 4W9GA 1HEZE 4WWMA 1XLQA 3LYYA 4JWUC 1WJNA 3DHIC 3K9PB 3CWIA 3BZDB 4US8A 2W82A 1TS2A 1XLPA 1B9RA 1V5TA 2MX2A 1IP9A 2V4IB 2C7MB 3APCA 2FIDA 1GB4A 1YX6B 3W1SA 4RGNA 1UGJA 2W9NA 4IM2A 2ZW1A 4EEWA 4GXBA 4HCNB 3R7QA 1I4GA 1XLNA 4BKGA 2EELA 1AW7A 4YWGG 2Q5WD 3DCGA 4WIPA 1EWYC 4LNKA 2KYWA 1HTOA 1CK1A 2BT6A 1TS5A 1FCLA 4IOIE 1G6JA 1WMHA 1JRUA 3FC4A 4FN2A 4NZLB 3BINA 3L0WB 1XCQL 3HRDD 2BW2A 2VRRB 4EE2A 1UNSA 1TS3A 2HTHA 1Y8RC 3MHSD 1FCCC 3AEEB 1OEYA 2WQYB 1E7VA 1E7UA 4PS7A 3VAWA 2N7DA 3EC8A 2LJ5A 4WQOB 5BMIA 4KIKB 2KO3A 2IGGA 3ABVB
chains in the Genus database with same CATH topology
1KLUD 4HKZE 1D5MC 4JPSA 2W3RA 4HROA 1TKGA 3R8BA 2N0SB 1EU3A 3AMZA 2J42A 1T6BX 1ZUD2 1C4PA 3AM9A 4USAA 5I4DA 4LK0M 1FNWA 1SXTA 4RH6A 4KKIA 3FAHA 1NENB 4A90A 1C76A 1SF0A 4NAWB 4B0EA 5C3JB 1JWBD 4OVZA 2N7JA 2PTLA 3IT6B 1WXQA 2LUMA 5HFYA 1F2RI 3VRAB 2Z8LA 3U4EG 2LGIA 1VJKA 3OWEB 2VZKB 5HI1A 4YSXB 2IGDA 2KACA 2H88B 4B0MA 3MFGA 3WCQA 1HA5A 1SE3A 3PZ7A 2DWQA 2BBCA 1K52A 4R3DA 1PFDA 5C2TB 1PUTA 2WXGA 3LXFA 1SJED 5BYSA 4JE3B 1RFKA 3AE7B 4ZHPA 2PVOD 1MPEA 3T3OA 4YTMB 4KX6B 1MI0A 1UWMA 2KDMA 3SFDB 3HUIA 3Q8CA 2QILA 3U2SC 3L4PA 1WYGA 2WXFA 2KWDA 2VZKD 1FNVA 4KGTA 3DWMA 5GXGB 1QKZA 3E56A 1ZE3D 5EE9A 3R2TA 5E6JA 2K0PA 1UWXA 1JRPA 3UI3A 2N9LA 3Q8BA 2DBYA 2WXIA 4KKJA 4XE0A 2MJEA 4WAFA 1B1ZA 3DWGC 1TY2A 1NI3A 1SEBD 5BMHA 1YJIA 3KLSX 1JWAD 3PZ8A 5BMGA 2GI9A 1TS4A 1VZ8A 1RM6C 3HVDA 2INNE 1JQ4A 1H7XA 4JWSC 4DQOC 4C80A 1ZXIA 4OZBA 1L0VB 1BUIC 1I7HA 1I4HA 1Q10A 3Q69A 2RPVA 4XWTA 1E7PB 4C7ZA 2G9HD 3BVMA 1YN3A 1C4CA 3AE9B 1QOFA 3AEDB 4P6VF 3H8HA 2BS3B 2WXQA 1D5ZC 3TEYA 4GLSC 4XDDA 1V8CA 1VLBA 1ET6A 2D5GA 4YTNB 2IPKD 2I38A 1QQRA 3GB1A 3V3XA 5JXVA 1L0YB 3B9JA 1CZPA 1I4QA 3NZ3A 1JCKB 1FXAA 1JMLA 5LNK1 5EE0A 2WS3B 5MPOA 1IGCA 1GT8A 1J7CA 1JWSD 2G1EA 2NTSA 4J3OD 1D6EC 1KF6B 1IGDA 1OQRA 3FILB 3AE3B 4GDKB 1C9FA 1J7AA 2INPE 1D5XC 3MP9A 1Y56A 3ZGZA 1L4ZB 1V1PB 1I4PA 4A8XC 5D3DA 2K22A 1KRHA 1EU4A 1DOIA 2BYTA 2EKIA 3VRBB 2H89B 2CJOA 2WXJA 4KGSA 1XXGA 1UUPA 3ZYYX 2L1AA 4RF0A 3U52E 3AN1A 1KTKA 1JWMD 1TY0A 2BS2B 2WXRA 4YSZB 4PT5A 1TYGB 1GB1A 3Q8EA 1PGBA 4ITKA 3ZJTA 2WXHA 3BVZA 5FR3A 2WXOA 1ROEA 4OW0A 2JWUA 4A55A 3W2DA 1JWUD 1L5PA 2MJ3A 4A6QA 2Y5CA 3AV8A 1XLOA 3NVYA 3SR6A 3ABVB 2R61A 1QOAA 4AS1A 2PKOA 1VZ7A 2DLBA 2JU6X 2DYMA 4WURA 2K3UA 1J7BA 1V1OA 1C79A 4IKGA 2FBWB 5H8YE 2NTTA 5D7GA 2PW9A 4RGOS 1QILA 4A9AA 3W9CB 2CJNA 3EUB2 5HG2A 4XWWA 1YN5A 2M0AA 2JX5A 1GTEA 3KWLA 4XDCA 1FO4A 1YQ4B 1K53A 4MH8A 3AE2B 1IUEA 1XEEA 3VR8B 1HZ6A 1EWCA 1AN8A 2JSVX 1RYJA 4NJCA 3TEZA 2PVGC 1BMLC 3ETRA 1QLBB 1SBBB 2FUG1 4TQ1A 1FRDA 3NVWA 3AE6B 3IAM1 3AE5B 2LHEA 3Q8AA 5EE1A 1LO5D 1PGAA 2MH7A 2W55A 3FILA 4YSYB 1E10A 1ZDVA 4YXDB 2CU3A 5T8IA 4AQ7A 3AE1B 2WXMA 4N58A 1I4RA 2IGHA 1SB3C 1C4AA 1MHHE 2M19A 3BVGA 4RGMA 2JZPA 2ZW0A 1STEA 3AECB 4GDLB 2IGGA 3W5VB 4Q2JA 1SIJA 1GPXA 2TSSA 4WQMA 3P4RB 2V0GA 3NRZA 2J52A 1EM7A 1MHXA 1DGJA 5G5HA 3TSSA 4ARCA 2Y5PA 2L83A 4CQNA 1FEHA 1E6EB 1CQVA 5AUIA 1QOGA 1T5XD 1TKYA 2BB6A 2WXKA 4O1NA 1FD6A 2KMMA 1DYQA 2YEPF 3KQ4A 3AEFB 1L4DB 4YT0B 3P1MA 4L23A 1N5WA 1QOBA 1IBXB 3J9CA 1JW9D 1AWDA 2WXPA 3HVZA 5EE3A 1WSPA 3MJ5A 1E0ZA 1V97A 5BYQA 1RWSA 1F0ZA 2RDGA 2KAJA 3TEWA 4RFBA 3P4PB 3I9V1 1L6UA 2JXTA 2XN9C 3B2GA 4ARIA 4TMAB 2LMCA 3C8YA 1JROA 1MVKA 2V3NA 5D3IB 4HEA1 4OHJA 1I4XA 1L0XB 2I2YA 3URYA 1NVID 1K51A 2QMTA 3CIRB 1NEKB 1FM0D 3AE4B 2PLPA 1HZ5A 3SFEB 3KWVA 2QEJC 3IAS1 3O13A 2ONQA 1F77A 3N9YC 2AX5A 2AQ1B 5TSSA 3IXSA 1VRAB 3AB5A 2YEPB 1ZP0B 2WXNA 2LJIA 1N62A 1VDVA 1CJEA 1F2RC 2WP9B 3NVVA 3SEBA 4NAMA 2HDEA 3VR9B 1WWTA 1FFUA 1YN4A 2M56B 4HJGE 4FXCA 1PDXA 4UDUC 2IDYA 1A70A 3EGRA 4N6EB 1ZDXA 4LTUA 2X38A 3ZJVA 4KGRA 3AE8B 3B2FA 3AEBB 2DYOA 4OZAA 1C77A 2QJLA 1PYWD 2J53A 1C78A 1FRRA 1ET9A 3BWUD 3R2IA 2AQ2B 4MT5A 1DOYA 5G5GA 2BB5A 1WGKA 1T3QA 1ZPSA 1HXYD 2KN4A 2NMQA 2SEBD 1D4BA 1SSNA 3NVZA 4ZRQA 1R7SA 4US9A 2W54A 3ZQ4A 1ENFA 1SE4A 3U7ZA 1FFVA 3ZJUA 1HQRD 4RF1A 4P16A 4N59A 4C56C 2E6XA 3P42A 3IT4B 1YQ3B 3GS2A 2LEKA 2ON8A 2WXLA 2V3PA 4H2AA 4L2YA 1ESFA 1IBXA 3LB8C 3PO0A 4ZRPA 2L32A 1GOZA 4HRSA 5FKAC 2JQRB 2PMVA 2AQ3B 2QSDA 5FK9C 5H92C 2B76B 4TQ0A 2QIEB 4WH4A 1DOXA 1WRIA 2KQ4X 1P7FA 1YJJA 2N9KA 1FIQA 4MACA 2E3TA 3EA6A 3W5UB 1N60A 1ZOYB 3BIID 5BYRA 4DXGA 1H7WA 3BK1A 1V1PA 1NYQA 4JX1C 1QT9A 1ACCA 1YMHE 2HTME 2K9XA 4ZYSA 3MC0B 3AEGB 1GTHA 1VZ6A 2WLBA 1FNUA 4C7YA 1XCTL 2GB1A 4REZA 1K50A 2GRIA 1M4VA 1QF6A 1TJEA 1ZXHA 3V05A 3NUHB 4OZCA 2WDRB 2WDVB 1N63A 2J4XA 3T3NA 2ACZB 1FMAD 4RGTA 2WU2B 1HEZE 3I57A 1FXIA 1OQQA 4WWMA 1XLQA 3LYYA 4JWUC 4M0WA 2WDQB 1NYRA 3BYTB 3CWIA 3BZDB 4US8A 2W82A 2BTEA 1TS2A 3AEAB 1VR9A 1XLPA 4D2KA 1XO3A 3VQIA 2FE8A 1B9RA 1KFYB 1L6VA 2V4IB 4RNAA 1GB4A 3W1SA 2K5PA 4RGNA 1UGJA 4YTPB 2ZW1A 3MHZA 3TUOA 1I4GA 1XLNA 2WNMA 1JALA 1XF5L 2EELA 1P7EA 1OFFA 1TKEA 1YNTE 1AYFA 1AW7A 4YWGG 4MM3B 2Q5WD 1E9MA 4WIPA 3BK2A 1N5XA 1EWYC 3P63A 2BS4B 2JYEA 3BYYB 1KLGD 2OEDA 1CK1A 2BT6A 2RDHA 1TS5A 3P4SB 1SJHD 4IOIE 1FCLA 2ICIA 2LHDA 4L1BA 4RCOA 2XNAC 3FC4A 4HKQA 3TEXA 2MJDA 4TSSA 4NZLB 3CF4A 2RMMA 3NS1A 1XCQL 3HRDD 3Q8FA 2BW2A 4EE2A 2Y3AA 3E9SA 3RPFC 1UNSA 1TS3A 3GP7A 2LFIA 1KH0A 1PGXA 1FCCC 5AUKA 1N61A 3AEEB 2WU5B 4ZHOA 4LLGM 4ZOHC 3RFZB 2WQYB 2W3SA 2SAKA 2OHFA 2JYTA 3P4QB 4IDIA 2IJ0A 1BXTA 3AH7A 5BMIA 4DXFA 5HHDG 2PIAA 2L52A 2MEKA 1GAQB 1TZOA 1SE2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B9J A;  4WQM A;  3P4R B;  1CZP A;  2W3R A;  4HRS A;  4HRO A;  1TKG A;  3NRZ A;  1FXA A;  2JQR B;  2N0S B;  1DGJ A;  3AMZ A;  5G5H A;  5EE0 A;  2WS3 B;  3AM9 A;  2L52 A;  1ZUD 2;  1GT8 A;  1J7C A;  2G1E A;  2B76 B;  2L83 A;  4USA A;  5H92 C;  2QIE B;  1KF6 B;  1OQR A;  1DOX A;  3AE3 B;  1WRI A;  1YJJ A;  1J7A A;  1E6E B;  1FIQ A;  2E3T A;  3W5U B;  1N60 A;  1QOG A;  1ZOY B;  1TKY A;  3BII D;  3FAH A;  1NEN B;  5AUI A;  1SF0 A;  1H7W A;  5C3J B;  1JWB D;  2K22 A;  2KMM A;  1KRH A;  1NYQ A;  4JX1 C;  1QT9 A;  2HTM E;  1WXQ A;  2K9X A;  3AEG B;  1DOI A;  3VRA B;  2EKI A;  3AEF B;  1GTH A;  4YT0 B;  2H89 B;  3VRB B;  2CJO A;  2WLB A;  1N5W A;  3P1M A;  1QOB A;  1VJK A;  4C7Y A;  1JW9 D;  1AWD A;  1QF6 A;  4YSX B;  3HVZ A;  5EE3 A;  1TJE A;  1E0Z A;  1V97 A;  2H88 B;  3ZYY X;  1RWS A;  1F0Z A;  2WDR B;  2WDV B;  2KAJ A;  3AN1 A;  3WCQ A;  1N63 A;  2DWQ A;  2BS2 B;  3P4P B;  2ACZ B;  1FMA D;  1L6U A;  2WU2 B;  5MPO A;  1PFD A;  1FXI A;  1OQQ A;  4WWM A;  1XLQ A;  5C2T B;  4JWU C;  4YSZ B;  1PUT A;  3B2G A;  2WDQ B;  1NYR A;  1TYG B;  3LXF A;  3CWI A;  4US8 A;  1RFK A;  3AE7 B;  3AEA B;  1XLP A;  4ITK A;  1JRO A;  1XO3 A;  4ZHP A;  1B9R A;  1ROE A;  1KFY B;  2PVO D;  1L6V A;  1NVI D;  3CIR B;  1NEK B;  1L5P A;  1FM0 D;  3AE4 B;  2MJ3 A;  2K5P A;  4YTM B;  1XLO A;  2Y5C A;  4KX6 B;  3AV8 A;  3NVY A;  3SFE B;  4YTP B;  3SFD B;  1UWM A;  3HUI A;  3SR6 A;  1QOA A;  3L4P A;  1XLN A;  2AX5 A;  1JAL A;  1WYG A;  2PKO A;  1OFF A;  1TKE A;  3AB5 A;  1ZP0 B;  3DWM A;  1N62 A;  1VDV A;  1AYF A;  1CJE A;  1J7B A;  5GXG B;  2WP9 B;  3NVV A;  5EE9 A;  2FBW B;  5H8Y E;  2Q5W D;  1E9M A;  3VR9 B;  1WWT A;  1JRP A;  1N5X A;  1EWY C;  1FFU A;  2M56 B;  2BS4 B;  3P63 A;  4A9A A;  3W9C B;  2DBY A;  4FXC A;  1PDX A;  2CJN A;  3EUB 2;  1A70 A;  2BT6 A;  2MJE A;  2JX5 A;  1GTE A;  3P4S B;  3KWL A;  4LTU A;  4N6E B;  3DWG C;  1FO4 A;  1YQ4 B;  1NI3 A;  3AE8 B;  3AE2 B;  1IUE A;  3B2F A;  3AEB B;  3FC4 A;  1YJI A;  3VR8 B;  1JWA D;  2MJD A;  2QJL A;  1RYJ A;  1DOY A;  1FRR A;  3CF4 A;  1RM6 C;  3NS1 A;  3HRD D;  2PVG C;  3ETR A;  5G5G A;  1JQ4 A;  1QLB B;  1H7X A;  4JWS C;  1FRD A;  3NVW A;  4C80 A;  3RPF C;  3AE6 B;  1T3Q A;  1WGK A;  3AE5 B;  1ZXI A;  1L0V B;  5EE1 A;  1I7H A;  3NVZ A;  5AUK A;  2MH7 A;  1R7S A;  2W55 A;  1N61 A;  2W54 A;  3AEE B;  2WU5 B;  4US9 A;  4ZHO A;  4YSY B;  1FFV A;  1E10 A;  4YXD B;  4ZOH C;  2WQY B;  2CU3 A;  1E7P B;  2W3S A;  4C7Z A;  4N59 A;  3AE1 B;  4N58 A;  1QOF A;  3AE9 B;  3AED B;  2OHF A;  4P6V F;  1YQ3 B;  3P4Q B;  1SB3 C;  4IDI A;  2M19 A;  2BS3 B;  2LEK A;  1V8C A;  1VLB A;  3AH7 A;  3AEC B;  3W5V B;  4YTN B;  2PIA A;  3LB8 C;  3PO0 A;  1SIJ A;  1GPX A;  1GAQ B;  3ABV B; 
#chains in the Genus database with same CATH topology
 4IG7 B;  1UH6 A;  4M02 A;  3AM9 A;  2BYF A;  4IWO A;  4BKS D;  4A90 A;  3NG0 A;  1SF0 A;  2C5L C;  2KVR A;  1JWB D;  2N7J A;  1WXQ A;  2LUM A;  4K7S A;  3DQV A;  3QHT A;  3VRA B;  5IN7 A;  3ZW3 A;  3IHP C;  4TUU A;  4ZRI A;  3OWE B;  2VZK B;  5HI1 A;  2ZZP B;  4B0M A;  1LGR A;  4XYC A;  1HA5 A;  3WCQ A;  2BBC A;  4MM3 A;  4R3D A;  1TTN A;  5C2T B;  1PUT A;  1KOT A;  4JE3 B;  4W9L A;  2KTR B;  3Q14 C;  3PVL A;  4MGZ E;  2JZ3 B;  3A9J A;  3L17 A;  1MPE A;  5DPR A;  1TZO A;  4YTM B;  4NNJ B;  1UWM A;  2KDM A;  5E6P A;  3U2S C;  5J17 A;  3L4P A;  2WXF A;  1RAX A;  1QKZ A;  5EE9 A;  1D3Z A;  3RNC C;  4BKS A;  3PPA A;  4MSM B;  1J19 A;  4CYE A;  4KKJ A;  3A4R A;  2NS5 A;  2IYD B;  3VUX A;  1SEB D;  3GZN B;  1YJI A;  2FCM A;  3SU8 X;  3ECI A;  3PZ8 A;  2NBW B;  1RM6 C;  3Q2A C;  1V81 A;  3HIZ A;  1UBI A;  3PS6 A;  4OZB A;  1N6Z A;  3V60 A;  2BWE S;  3ZXV A;  4XWT A;  2RDB C;  1E7P B;  3ENE A;  2KN5 A;  5JHA A;  4P6V F;  3TEY A;  1WR6 E;  3N1X C;  1ET6 A;  2VH1 A;  1QQR A;  4MSQ B;  3ZKJ C;  5JXV A;  2ZCB A;  5MPO A;  4J3O D;  2NTS A;  1Q0W B;  2V1Y A;  2RSU A;  1D6E C;  5GMV A;  4GDK B;  1C9F A;  1J7A A;  3ZGZ A;  4M01 A;  4LDT B;  3OLM D;  1KRH A;  2H89 B;  4AWJ A;  2IO0 B;  2WXJ A;  4LJP B;  4M8M A;  1UUP A;  2KLC A;  3UIN B;  5IO9 A;  1JWM D;  3VDZ A;  2L7R A;  2KC1 A;  1TYG B;  3V61 A;  1HE8 A;  2A4Z A;  2WXH A;  3AXC A;  2WXO A;  5CHF A;  4OW0 A;  4A55 A;  1L5P A;  4HPL B;  3AV8 A;  1XLO A;  3SR6 A;  2R61 A;  4FJY A;  4AS1 A;  2PKO A;  1GC7 A;  2JU6 X;  4OVV A;  2LRU A;  2FBW B;  4ZRJ A;  5L95 C;  4A9A A;  2QCZ A;  1MJD A;  1TZ1 A;  4XWW A;  3PRM B;  1P98 A;  3AE2 B;  5LLI A;  4NJC A;  5IA7 A;  2BYE A;  3QJZ A;  2PVG C;  1BML C;  2FUG 1;  3RI7 C;  3Q8A A;  1H8C A;  2INC C;  3RNG C;  2JF5 A;  1E10 A;  1ZDV A;  4YXD B;  3EFU A;  2WXM A;  2O6V B;  2IGH A;  4AP4 C;  1MHH E;  3KVF B;  2JZP A;  4WJO A;  1STE A;  3W5V B;  4Q2J A;  4FA6 A;  2JRI B;  4EUT A;  3P4R B;  3NRZ A;  2MLB A;  2KKC A;  3TJP A;  3TCA A;  5AUI A;  1QOG A;  1T5X D;  2GBJ A;  2BB6 A;  3NZU A;  4O1N A;  2KMM A;  4M8N A;  4BFR A;  2YEP F;  3T9L A;  1WXM A;  4L23 A;  1WI0 A;  3P1M A;  4IC7 B;  1N5W A;  3J9C A;  1E8Z A;  1JW9 D;  3PZD A;  3A1Q A;  1WSP A;  3VVW B;  3QA8 A;  1IPG A;  2RDG A;  3TEW A;  3I9V 1;  1L6U A;  2XN9 C;  2PE6 B;  4ICU A;  3B2G A;  3GZN I;  1F52 A;  4RMA A;  2KMA A;  3VFK A;  3RCZ A;  1GC6 A;  2KWU B;  1MVK A;  2KJ6 A;  4OHJ A;  2UU7 A;  1K51 A;  2IY1 B;  5C1Z A;  2NR2 A;  3KWV A;  4NPN A;  4RM8 A;  2AX5 A;  2AQ1 B;  3IXS A;  2KDF B;  2WXN A;  1N62 A;  3SEB A;  2HDE A;  1PQS A;  1YN4 A;  5AZF A;  4HJG E;  2IDY A;  3EGR A;  4N6E B;  1ZDX A;  4LTU A;  1YJ1 A;  1YQB A;  3AE8 B;  2DYO A;  3W1S C;  1LFD A;  1C77 A;  3W1Y A;  4GDL A;  1FRR A;  3R2I A;  4XZ4 A;  3L13 A;  1K8R B;  2YVC A;  2KT7 A;  2LVP A;  3HM6 X;  4FJZ A;  4GN1 A;  3ZNZ B;  3APD A;  4WWN A;  1ZKH A;  4P16 A;  3SHQ A;  4C56 C;  1WMH B;  3IG3 A;  2WYQ A;  2ZJD A;  2V3P A;  3M63 B;  2MP2 B;  3DHG C;  2JQR B;  3N1Z C;  2LVQ A;  4BOZ B;  5H92 C;  4HK2 A;  2RPQ A;  2KQ4 X;  1WGY A;  1N60 A;  1S1Q B;  1ZOY B;  4MEL A;  5BYR A;  3I63 C;  4KV2 A;  4KZC A;  2ZPY A;  2KQS A;  5E6N A;  4I6P A;  2DNF A;  2HTM E;  3RNB C;  3MC0 B;  1GTH A;  1VZ6 A;  4ANU A;  1XCT L;  4REZ A;  4E74 A;  4AJW A;  4OZC A;  4NQK E;  4RGT A;  3I57 A;  4DHZ B;  1NYR A;  4FBJ B;  3NY5 A;  2JXX A;  4CO7 A;  2I1K A;  2BTE A;  1VR9 A;  4D2K A;  1XO3 A;  2FE8 A;  1KFY B;  2ZNV B;  4J6I A;  3MHZ A;  1MG4 A;  3TUO A;  2ASQ A;  4W9H A;  3RD2 A;  3PT2 B;  3ZNH B;  1AYF A;  2DAJ A;  1WH3 A;  4MM3 B;  3V62 A;  4LNO A;  4XGA B;  3PHX B;  3X23 A;  4IM3 A;  3P63 A;  2BS4 B;  2JYE A;  3BYY B;  1KLG D;  2RDH A;  4L1B A;  2YLM A;  3QAQ A;  3AI5 A;  3A9J B;  3TEX A;  3IFW B;  2MJD A;  1I42 A;  3ML9 A;  1SE9 A;  2Y3A A;  3AUL A;  4E71 A;  4FUL A;  3GP7 A;  1KH0 A;  3QAR A;  2WU5 B;  2KK8 A;  4LLG M;  3NZS A;  3DBR B;  2LVO A;  3RT3 B;  4EZJ A;  2G45 B;  4KDI C;  1EO6 A;  1EF5 A;  1R4M B;  4IDI A;  3EFC A;  3HHM A;  1BXT A;  3GE3 C;  1I35 A;  2L52 A;  2MEK A;  1SE2 A;  4HKZ E;  1D5M C;  1TKG A;  2N0S B;  1EU3 A;  3AMZ A;  3X0W A;  2J42 A;  1ZUD 2;  2NBU A;  2KZR A;  4HJK A;  2K6D B;  3ZXR A;  4LK0 M;  1SXT A;  2KX0 A;  4KKI A;  2FCS A;  4B0E A;  1F1H A;  3RZW C;  1WX8 A;  1VJK A;  3Q6B A;  3NOB A;  3WA0 A;  2H88 B;  4TKN A;  1R4N B;  4JLC A;  1SE3 A;  3L54 A;  2GOW A;  1V49 A;  3ZRC A;  1BT0 A;  2IZV B;  2GBN A;  2WXG A;  3M62 B;  2AEH A;  1E8W A;  5LXH A;  4MEM A;  4F8C B;  5CHV C;  2FUH B;  1V9J A;  4BZA A;  5KHQ A;  1WYW B;  1MI0 A;  3HUI A;  2QIL A;  5G2N A;  4KGT A;  5TR5 A;  1UD7 A;  3KUD B;  1ZE3 D;  4LCD E;  2JY6 A;  2K0P A;  3QC8 B;  1UWX A;  2A5U A;  1V6E A;  3Q8B A;  2DBY A;  2XK5 B;  2MJE A;  4WAF A;  1NI3 A;  3DBH B;  4MGY E;  3KLS X;  3RUI B;  2GI9 A;  4AUQ C;  1TS4 A;  3HVD A;  5EDS A;  2C7H A;  5D2M B;  4PS3 A;  4C00 A;  5DPS A;  4DQO C;  4C80 A;  3MC8 A;  4K3C A;  1I7H A;  4WAA A;  1Q10 A;  2EMS A;  2KTF A;  4EKU A;  4C7Z A;  3BVM A;  4NAW A;  3KYC D;  3DBL I;  3AED B;  4XDD A;  2N1V A;  1VLB A;  2D5G A;  3ALB A;  2KJR A;  3V3X A;  2MP2 A;  3B9J A;  2D10 A;  1JML A;  5EE0 A;  2WS3 B;  4LJO B;  4KDL B;  1GT8 A;  1J7C A;  2MHJ A;  3PHW B;  5IAA C;  4DHZ E;  2INP E;  2G4D B;  1Y56 A;  1KLV A;  2BGF A;  4LNI A;  1V1P B;  4A8X C;  5D3D A;  2REX A;  2LD9 A;  2L00 B;  1DOI A;  2EKI A;  3VRB B;  2BVC A;  3GE8 C;  5BO4 B;  3PLV A;  1KTK A;  2BS2 B;  4G0N B;  5DPT A;  4YSZ B;  1GB1 A;  3Q8E A;  1J8C A;  1PGB A;  2DZI A;  4ITK A;  4K81 A;  1ROE A;  2N7E A;  4PK1 A;  4ICV A;  1T0Y A;  2DAF A;  3W2D A;  3ZDT A;  3NVY A;  1V5O A;  3B1L X;  4F1S A;  3A1Q B;  3N3K B;  3DBR I;  1VZ7 A;  3JW0 X;  1J7B A;  1V1O A;  4GB9 A;  3ZDM C;  4BOS C;  1R4M I;  4IKG A;  2L3Z A;  2DZM A;  5D7G A;  3M3J A;  3W9C B;  2CJN A;  2DYB A;  1WRD B;  5HG2 A;  1J0G A;  2JX5 A;  1GTE A;  3KWL A;  1YQ4 B;  1IUE A;  4GIV A;  3N30 A;  4HWI B;  1HZ6 A;  1AN8 A;  2ZCC A;  1UBQ A;  3N32 A;  4B9K A;  3S2A A;  5D94 A;  4NY0 A;  1LO5 D;  1PGA A;  4NJ6 A;  2QDF A;  3FIL A;  3ZTC A;  2CU3 A;  3PRE A;  1SB3 C;  2M19 A;  2ZW0 A;  1E90 A;  3AEC B;  4GDL B;  4LNN A;  2BPS A;  1KM7 A;  3V6C B;  1SIJ A;  2GMI C;  4A3P A;  4KSL C;  5G5H A;  3TSS A;  3PRZ A;  2L83 A;  2MBO A;  4FLH A;  1F9J A;  2D3B A;  1E6E B;  4XX5 A;  1WY8 A;  5D6J B;  3RNF C;  1L4D B;  2LRW A;  3JYU A;  3HVZ A;  3MJ5 A;  1XD3 B;  3P4P B;  4ANV A;  1LQB A;  2JXT A;  2K8H A;  2KDB A;  4W9E A;  3ZLZ A;  1XQQ A;  1NI2 A;  2V3N A;  4HEA 1;  1WE7 A;  1I4X A;  2CHZ A;  3URY A;  2HJ8 A;  3HK0 A;  3ZTD A;  3SFE B;  3O13 A;  2MWS B;  4EFO A;  5IOI A;  1WJ4 A;  2KFK B;  1VDV A;  1CJE A;  1F2R C;  3A9K A;  4G3X B;  5E6O A;  1WWT A;  5LXI B;  1WGR A;  4MDK E;  1CMX B;  1PDX A;  2X8X X;  1A70 A;  1MFW A;  2XK5 A;  3ZJV A;  4KGR A;  2QJL A;  1DOY A;  1C78 A;  2BB5 A;  3T8M A;  4YL8 A;  3QX1 A;  1T3Q A;  3PSE B;  3DVG Y;  2SEB D;  2MBQ A;  1SSN A;  3NVZ A;  4ZRQ A;  1R7S A;  4US9 A;  2I1J A;  1V86 A;  1AAR A;  1ENF A;  1SE4 A;  1FFV A;  3U7Z A;  3QQ8 B;  3ZJU A;  2KFJ A;  3AU4 A;  3L08 A;  4JGH B;  4N59 A;  1T0Q C;  2LEK A;  4HDO A;  4L2Y A;  4I6L B;  5C23 A;  4HVB A;  3PO0 A;  2L0T A;  2N9X A;  1WX7 A;  4FHJ A;  2QHO A;  2NPT B;  5FK9 C;  1ZGU B;  1YJJ A;  1FIQ A;  1QZE A;  2FNJ B;  4ANX A;  3BK1 A;  1V1P A;  1NYQ A;  4DHJ B;  3AEG B;  1WGD A;  2GRI A;  1M4V A;  2G3Q B;  3Q3J A;  1TJE A;  1ZXH A;  2KNB A;  4ASW C;  2WDV B;  2IBI B;  1N63 A;  4LNF A;  2M4N A;  3T3N A;  1FMA D;  2MBB B;  1D4B A;  1FXI A;  1OQQ A;  2BQQ A;  2UWQ A;  3BYT B;  3AEA B;  4MGK E;  4ANW A;  1X1M A;  3IBE A;  3ZRF A;  4II3 B;  3PGE A;  2AWT A;  3WAP A;  3ZIM A;  1JAL A;  1XF5 L;  1OFF A;  1WXS A;  3RN9 C;  4M00 A;  4PYU A;  1N5X A;  1UZX B;  2CKH B;  2N9E B;  2OED A;  3NHE B;  4DK5 A;  2DEN B;  3P4S B;  1SJH D;  2C60 A;  2ICI A;  4HKQ A;  3KUZ A;  1VD2 A;  3CF4 A;  2RMM A;  3NS1 A;  2LGY A;  2NCN A;  3DVG X;  3E9S A;  3RPF C;  2HE7 A;  3CMM B;  2KX3 A;  2LI5 A;  5AUK A;  1N61 A;  5G55 A;  4ZHO A;  2GBM A;  2MA9 B;  4ZOH C;  4NQL B;  2OHF A;  2ZVN A;  4WWO A;  2IJ0 A;  4EOY A;  4DXF A;  3C0R B;  2LUE A;  1TBE A;  1GAQ B;  4MJS B;  1KLU D;  3PLU A;  4WJN A;  2UYZ B;  2KMC A;  1C4P A;  4W9D A;  5I4D A;  2KHW B;  4PS8 A;  1RLF A;  4RH6 A;  3FAH A;  1NEN B;  4GU2 A;  4NAW B;  4OVZ A;  3CF6 E;  4NJ7 A;  1F2R I;  2Z8L A;  2IND C;  2LGI A;  3A33 B;  3MFG A;  3VUY A;  1K52 A;  1PFD A;  1WIA A;  3LXF A;  5BYS A;  2KC2 A;  2JZZ A;  4HDQ A;  2KVZ A;  3FKY A;  4KX6 B;  3SFD B;  2N1W A;  2BF8 B;  1WE6 A;  5GXG B;  2Z59 B;  2KFK A;  2DHZ A;  2WX0 A;  1JRP A;  2N9L A;  1UEL A;  2D3G A;  1TGZ B;  5JZE B;  2DZJ A;  2D11 A;  5BMH A;  2ZNV C;  1JWA D;  2M17 A;  1VZ8 A;  2V9H A;  4DHJ D;  3RMK C;  2L0F A;  3LJ3 A;  3ZUN A;  1H7X A;  2GBR A;  1P0R A;  5CX3 A;  3KUC B;  3R3M A;  1ZXI A;  2BKR B;  1L0V B;  2CS4 A;  1MG8 A;  4DWF A;  1I4H A;  4GMV A;  2G9H D;  4A20 A;  1YN3 A;  1C4C A;  3AE9 B;  1WGG A;  1NBF C;  3H8H A;  4GLS C;  1V8C A;  2CR5 A;  1IYF A;  4K7W A;  3VTW A;  4YTN B;  5JH5 C;  2I38 A;  3GB1 A;  3NZ3 A;  3APF A;  1FXA A;  5IP4 D;  2NPT A;  2CU1 A;  3D32 A;  3FIL B;  1L7Y A;  3MP9 A;  2OJR A;  4HPM B;  4DBG A;  2BYT A;  2CJO A;  5CHW A;  4KGS A;  3ZYY X;  2L1A A;  4RF0 A;  3PV1 A;  2R2O A;  3RNE C;  2WXR A;  4PT5 A;  5L83 A;  3CST A;  2JVC A;  2D2Q A;  2LGS A;  3BVZ A;  3DOW A;  1A5R A;  3H7P A;  2JWU A;  1JWU D;  2MJ3 A;  2Y5C A;  2LAS A;  3I5J C;  4AJY B;  3WAN A;  1VCB A;  2D3A A;  3TL5 A;  1C79 A;  5H8Y E;  2J0J A;  2J0K A;  2PW9 A;  1QIL A;  2AL6 A;  3EUB 2;  1YN5 A;  4XDC A;  2N4F A;  2K25 A;  1K53 A;  3VH3 B;  3WAM A;  3KH0 A;  3ETR A;  3UQB A;  2KWV B;  1SBB B;  4TQ1 A;  4BAX A;  4FAD A;  3AE6 B;  3IAM 1;  3AE5 B;  3A9K B;  4W9F A;  2V4L A;  4AQ7 A;  4N58 A;  4K7U A;  1I4R A;  5IKC M;  4EZK A;  1WFY A;  3BVG A;  4BBN C;  2LZ6 A;  3WAO A;  4S0R A;  2MQJ A;  1GPX A;  2TSS A;  2B3A A;  4K3B A;  4WQM A;  2V0G A;  4HCP B;  1S3S G;  3DHH C;  4K1R B;  4MJS A;  3VTU A;  1T0R C;  1LXD A;  1FEH A;  2MBH A;  1KJT A;  2KWC A;  4ZYN A;  2WXK A;  3BY4 B;  1WF9 A;  2IO2 B;  1FD6 A;  2K6Q A;  3DVN V;  3AEF B;  3EEC A;  4YT0 B;  2O2V A;  1QOB A;  1AWD A;  4JQW C;  2WXP A;  5EE3 A;  3OJ3 A;  1V97 A;  1RWS A;  4RFB A;  3M95 A;  2JWZ A;  2D07 B;  2BYV E;  2KXJ A;  3DVN U;  2BWF A;  4ARI A;  4TMA B;  4W9C A;  5D3I B;  2GLS A;  3B08 A;  3ZNG C;  2KDI A;  4ZDV A;  3CIR B;  1NEK B;  1LM8 B;  1FM0 D;  2KJH B;  1C1Y B;  3ZNI D;  2PPH A;  2QEJ C;  4GSW A;  1E8X A;  2ONQ A;  1F77 A;  5TSS A;  2DZK A;  2KQ7 A;  3QIJ A;  3AB5 A;  1ZP0 B;  2L05 A;  3GOE A;  3O65 B;  3QK0 A;  5KHO A;  3OJ4 B;  2D3C A;  4P7I A;  3VR9 B;  3NJT A;  1Z2M A;  2IO3 B;  2G4S A;  3JVZ X;  4FXC A;  1TT5 B;  3B2F A;  3SDL C;  3Q3N C;  1U4A A;  4OZA A;  4URK A;  2J53 A;  4MT5 A;  2AQ2 B;  5DPW A;  4GGQ A;  2MW5 A;  1WM2 A;  2NMQ A;  4MH0 E;  2W54 A;  3ZQ4 A;  1HQR D;  2VH2 A;  3WIM A;  2E6X A;  3P42 A;  1YQ3 B;  2ON8 A;  2Y5B B;  3U8Z A;  2MRP A;  1ESF A;  1IBX A;  3LB8 C;  4ZRP A;  2WX1 A;  1GOZ A;  5FKA C;  1P1A A;  3QCA A;  2AQ3 B;  4HPP A;  2RD0 A;  4MGI E;  2B76 B;  2QIE B;  2N9K A;  1P7F A;  3UIO B;  4MAC A;  3SD5 A;  2E3T A;  3RZF A;  3W5U B;  3BII D;  4DXG A;  1H7W A;  4JX1 C;  1YX5 B;  1ACC A;  2K9X A;  3R66 C;  1NDD A;  1R4N I;  1WXV A;  4N9F 4;  4KSK C;  2WLB A;  4JL9 A;  1FNU A;  3V05 A;  1GNU A;  1OEY J;  1L2N A;  2IO1 B;  2ACZ B;  3JSV B;  2WU2 B;  2K8C A;  4M0W A;  3I3T B;  2WDQ B;  2FCQ A;  2DX5 B;  4IM0 A;  3KW5 B;  3ML8 A;  3VUW A;  3DDC B;  3VQI A;  3VHT C;  1L6V A;  4JIO U;  4RNA A;  1RFA A;  2K5P A;  4YTP B;  4P1C C;  2WNM A;  1P7E A;  1TKE A;  1YNT E;  5J18 A;  2LXA A;  1OGW A;  4WJP A;  1E9M A;  1V80 A;  3BK2 A;  2L76 A;  4BVU C;  3DBH I;  4I6N B;  2V3S A;  2IY0 B;  5JHB A;  2PE9 A;  3RYT A;  2LHD A;  4RCO A;  2XNA C;  2M1M A;  2AL3 A;  4TSS A;  3Q8F A;  2OJW A;  2M0X A;  1YD8 U;  2LFI A;  1PGX A;  3C19 A;  2LWP A;  4BKT A;  3RFZ B;  2HJ1 A;  2W3S A;  4C4V A;  4G50 A;  2LXC A;  2SAK A;  4P1B C;  2XEW A;  2JYT A;  3P4Q B;  1OQY A;  3AH7 A;  2EMT A;  5HHD G;  2PIA A;  4ZRK A;  3IVF A;  4JPS A;  2W3R A;  4HRO A;  2M8S A;  3R8B A;  2XBB C;  3L10 B;  5AZG A;  3CSF A;  2RGF A;  1T6B X;  4USA A;  4IUM B;  1FNW A;  1H4R A;  1C76 A;  5C3J B;  4PYZ A;  2PTL A;  3IT6 B;  5HFY A;  3U4E G;  1HTQ A;  1XT9 B;  2FAZ A;  4YSX B;  2IGD A;  2KAC A;  1E8Y A;  4IWQ A;  2JT4 B;  3PZ7 A;  2DWQ A;  1FPY A;  3MC9 A;  1ISN A;  1SJE D;  1RFK A;  3AE7 B;  4KZ0 A;  3U7D A;  4ZHP A;  2CHW A;  3ZVV A;  2PVO D;  3T3O A;  3PRP B;  3Q8C A;  1WYG A;  2KWD A;  2VZK D;  1FNV A;  3DWM A;  3E56 A;  3Q3M C;  3R2T A;  2WGS A;  5E6J A;  2K1F A;  3H6N A;  3UI3 A;  2WXI A;  5CTR C;  2EKE C;  4XE0 A;  1B1Z A;  3DWG C;  3H7P B;  1TY2 A;  3AU5 A;  2JRH A;  5BMG A;  3TIX A;  4KIK A;  3LDZ E;  2INN E;  1JQ4 A;  3Q3F A;  4JWS C;  2FIF A;  3UIP B;  2HD5 B;  1BUI C;  4IWP A;  4W9I A;  2Z0D B;  3Q69 A;  2RPV A;  4W9J A;  1T0S C;  3MJW A;  1QOF A;  2BS3 B;  2WXQ A;  1D5Z C;  1OTR B;  2IPK D;  3NS8 A;  1L0Y B;  1CZP A;  1I4Q A;  1JCK B;  5LNK 1;  1IGC A;  2OOB B;  2MCN B;  1JWS D;  2G1E A;  2LGD A;  1KF6 B;  1IGD A;  1OQR A;  3AE3 B;  1D5X C;  1L4Z B;  2KTR A;  1I4P A;  4DDG D;  2K22 A;  4OVU A;  1WX9 A;  1EU4 A;  3DPD A;  1EF1 A;  4FJV B;  2KD0 A;  1P9D U;  1XXG A;  2C9W B;  3UF8 A;  3U52 E;  3AN1 A;  1TY0 A;  1FXT B;  2Z0E B;  3EHV A;  2L8J A;  3JSV A;  2MBE A;  3VTV A;  1UGM A;  4G11 A;  3ZJT A;  4EZL A;  5FR3 A;  5HKH A;  3B0A A;  4LDT D;  2NBV B;  2O2V B;  4A6Q A;  3MTN B;  2RR9 A;  1QOA A;  4TV3 A;  3V6E B;  2KAN A;  2DLB A;  2MSE D;  3RNA C;  2DYM A;  4WUR A;  2K3U A;  3A4S C;  3ZO5 B;  4W9K A;  4QAY A;  2NTT A;  4BBN F;  4RGO S;  2R2Q A;  2PEA A;  2M0A A;  1FO4 A;  3KYD D;  1GUA B;  4MH8 A;  1XEE A;  3VR8 B;  1E5W A;  1EWC A;  2JSV X;  1RYJ A;  3TEZ A;  1QLB B;  2N9P C;  5DCN A;  1FRD A;  3L16 A;  3NVW A;  4IW0 A;  3TMP B;  4AOF A;  2LHE A;  5EE1 A;  1Q5W B;  1WXA A;  2MH7 A;  2W55 A;  2QC8 A;  4YSY B;  4GDK A;  3P2B A;  3U30 A;  3H7S A;  2J7Q B;  5T8I A;  4A3O A;  3AE1 B;  4B95 A;  4FHK A;  1P3Q U;  3H1U A;  1C4A A;  4RGM A;  4II2 B;  4E3C A;  2KOX A;  3PTF C;  3WAL A;  3DBL B;  1TIF A;  3DBS A;  2J52 A;  1EM7 A;  1MHX A;  1DGJ A;  2CHX A;  3Q3O C;  4XC2 A;  1WZ0 A;  2WHI A;  4KVG B;  4ARC A;  4B6W A;  2Y5P A;  4CQN A;  1M94 A;  3K9O B;  1CQV A;  1TKY A;  2FCN A;  2KLG A;  3UGB B;  4DDI D;  1DYQ A;  2NVU I;  3OAW A;  1GG3 A;  3KQ4 A;  2O6V D;  1Q1O A;  2AYO B;  1IBX B;  4GOC A;  2J0M A;  5AEK B;  1E0Z A;  5BYQ A;  1F0Z A;  2ZPN A;  1YIW A;  4ACF A;  2KAJ A;  2KDE B;  1SGH A;  1WJ6 A;  3ONS A;  2LMC A;  3C8Y A;  3UQA A;  1JRO A;  4CHK A;  2I2Y A;  1L0X B;  1NVI D;  2QMT A;  3AE4 B;  2PLP A;  1HZ5 A;  3IAS 1;  3N9Y C;  1VRA B;  2YEP B;  2LJI A;  2WP9 B;  1SIF A;  3NVV A;  2ZEQ A;  4NAM A;  4M0W B;  4F7Z A;  1FFU A;  2M56 B;  5FR6 A;  3N20 C;  2JUO A;  3TBL D;  4UDU C;  4X57 B;  2O6V A;  2X38 A;  5J2R A;  4WWP A;  3R7R A;  3AEB B;  1EUV B;  2WWZ A;  1WR1 A;  1PYW D;  3BWU D;  2K8B A;  1ET9 A;  1Z5S B;  5G5G A;  2C7N B;  4WJQ A;  3VXW A;  1WGK A;  1ZPS A;  1HXY D;  2KN4 A;  3VH4 B;  1WJU A;  2K39 A;  4S17 A;  2ZVO A;  4RF1 A;  2BKF A;  3N1Y C;  3IT4 B;  2GBK A;  3GS2 A;  1YOV B;  1UF0 A;  2WXL A;  1WZ3 A;  1ZW7 A;  4H2A A;  1WM3 A;  5AZH A;  1WGH A;  2L32 A;  4DXA B;  4HRS A;  1C3T A;  2LGX A;  4HLE A;  3RUL A;  2PMV A;  2QSD A;  3OG5 A;  2WDT B;  2JPH A;  4TQ0 A;  4WH4 A;  1DOX A;  1WRI A;  3EA6 A;  4C4V B;  4RM9 A;  1QT9 A;  1YMH E;  4ZYS A;  3QWZ B;  1GJZ A;  4C7Y A;  3H9D A;  2GB1 A;  2PJH A;  1K50 A;  1V2Y A;  1QF6 A;  3NUH B;  2WDR B;  3HM3 A;  2J4X A;  4HXD A;  1RRB A;  4W9G A;  1HEZ E;  4WWM A;  1XLQ A;  3LYY A;  4JWU C;  1WJN A;  3DHI C;  3K9P B;  3CWI A;  3BZD B;  4US8 A;  2W82 A;  1TS2 A;  1XLP A;  1B9R A;  1V5T A;  2MX2 A;  1IP9 A;  2V4I B;  2C7M B;  3APC A;  2FID A;  1GB4 A;  1YX6 B;  3W1S A;  4RGN A;  1UGJ A;  2W9N A;  4IM2 A;  2ZW1 A;  4EEW A;  4GXB A;  4HCN B;  3R7Q A;  1I4G A;  1XLN A;  4BKG A;  2EEL A;  1AW7 A;  4YWG G;  2Q5W D;  3DCG A;  4WIP A;  1EWY C;  4LNK A;  2KYW A;  1HTO A;  1CK1 A;  2BT6 A;  1TS5 A;  1FCL A;  4IOI E;  1G6J A;  1WMH A;  1JRU A;  3FC4 A;  4FN2 A;  4NZL B;  3BIN A;  3L0W B;  1XCQ L;  3HRD D;  2BW2 A;  2VRR B;  4EE2 A;  1UNS A;  1TS3 A;  2HTH A;  1Y8R C;  3MHS D;  1FCC C;  3AEE B;  1OEY A;  2WQY B;  1E7V A;  1E7U A;  4PS7 A;  3VAW A;  2N7D A;  3EC8 A;  2LJ5 A;  4WQO B;  5BMI A;  4KIK B;  2KO3 A;  2IGG A;  3ABV B; 
#chains in the Genus database with same CATH homology
 1KLU D;  4HKZ E;  1D5M C;  4JPS A;  2W3R A;  4HRO A;  1TKG A;  3R8B A;  2N0S B;  1EU3 A;  3AMZ A;  2J42 A;  1T6B X;  1ZUD 2;  1C4P A;  3AM9 A;  4USA A;  5I4D A;  4LK0 M;  1FNW A;  1SXT A;  4RH6 A;  4KKI A;  3FAH A;  1NEN B;  4A90 A;  1C76 A;  1SF0 A;  4NAW B;  4B0E A;  5C3J B;  1JWB D;  4OVZ A;  2N7J A;  2PTL A;  3IT6 B;  1WXQ A;  2LUM A;  5HFY A;  1F2R I;  3VRA B;  2Z8L A;  3U4E G;  2LGI A;  1VJK A;  3OWE B;  2VZK B;  5HI1 A;  4YSX B;  2IGD A;  2KAC A;  2H88 B;  4B0M A;  3MFG A;  3WCQ A;  1HA5 A;  1SE3 A;  3PZ7 A;  2DWQ A;  2BBC A;  1K52 A;  4R3D A;  1PFD A;  5C2T B;  1PUT A;  2WXG A;  3LXF A;  1SJE D;  5BYS A;  4JE3 B;  1RFK A;  3AE7 B;  4ZHP A;  2PVO D;  1MPE A;  3T3O A;  4YTM B;  4KX6 B;  1MI0 A;  1UWM A;  2KDM A;  3SFD B;  3HUI A;  3Q8C A;  2QIL A;  3U2S C;  3L4P A;  1WYG A;  2WXF A;  2KWD A;  2VZK D;  1FNV A;  4KGT A;  3DWM A;  5GXG B;  1QKZ A;  3E56 A;  1ZE3 D;  5EE9 A;  3R2T A;  5E6J A;  2K0P A;  1UWX A;  1JRP A;  3UI3 A;  2N9L A;  3Q8B A;  2DBY A;  2WXI A;  4KKJ A;  4XE0 A;  2MJE A;  4WAF A;  1B1Z A;  3DWG C;  1TY2 A;  1NI3 A;  1SEB D;  5BMH A;  1YJI A;  3KLS X;  1JWA D;  3PZ8 A;  5BMG A;  2GI9 A;  1TS4 A;  1VZ8 A;  1RM6 C;  3HVD A;  2INN E;  1JQ4 A;  1H7X A;  4JWS C;  4DQO C;  4C80 A;  1ZXI A;  4OZB A;  1L0V B;  1BUI C;  1I7H A;  1I4H A;  1Q10 A;  3Q69 A;  2RPV A;  4XWT A;  1E7P B;  4C7Z A;  2G9H D;  3BVM A;  1YN3 A;  1C4C A;  3AE9 B;  1QOF A;  3AED B;  4P6V F;  3H8H A;  2BS3 B;  2WXQ A;  1D5Z C;  3TEY A;  4GLS C;  4XDD A;  1V8C A;  1VLB A;  1ET6 A;  2D5G A;  4YTN B;  2IPK D;  2I38 A;  1QQR A;  3GB1 A;  3V3X A;  5JXV A;  1L0Y B;  3B9J A;  1CZP A;  1I4Q A;  3NZ3 A;  1JCK B;  1FXA A;  1JML A;  5LNK 1;  5EE0 A;  2WS3 B;  5MPO A;  1IGC A;  1GT8 A;  1J7C A;  1JWS D;  2G1E A;  2NTS A;  4J3O D;  1D6E C;  1KF6 B;  1IGD A;  1OQR A;  3FIL B;  3AE3 B;  4GDK B;  1C9F A;  1J7A A;  2INP E;  1D5X C;  3MP9 A;  1Y56 A;  3ZGZ A;  1L4Z B;  1V1P B;  1I4P A;  4A8X C;  5D3D A;  2K22 A;  1KRH A;  1EU4 A;  1DOI A;  2BYT A;  2EKI A;  3VRB B;  2H89 B;  2CJO A;  2WXJ A;  4KGS A;  1XXG A;  1UUP A;  3ZYY X;  2L1A A;  4RF0 A;  3U52 E;  3AN1 A;  1KTK A;  1JWM D;  1TY0 A;  2BS2 B;  2WXR A;  4YSZ B;  4PT5 A;  1TYG B;  1GB1 A;  3Q8E A;  1PGB A;  4ITK A;  3ZJT A;  2WXH A;  3BVZ A;  5FR3 A;  2WXO A;  1ROE A;  4OW0 A;  2JWU A;  4A55 A;  3W2D A;  1JWU D;  1L5P A;  2MJ3 A;  4A6Q A;  2Y5C A;  3AV8 A;  1XLO A;  3NVY A;  3SR6 A;  3ABV B;  2R61 A;  1QOA A;  4AS1 A;  2PKO A;  1VZ7 A;  2DLB A;  2JU6 X;  2DYM A;  4WUR A;  2K3U A;  1J7B A;  1V1O A;  1C79 A;  4IKG A;  2FBW B;  5H8Y E;  2NTT A;  5D7G A;  2PW9 A;  4RGO S;  1QIL A;  4A9A A;  3W9C B;  2CJN A;  3EUB 2;  5HG2 A;  4XWW A;  1YN5 A;  2M0A A;  2JX5 A;  1GTE A;  3KWL A;  4XDC A;  1FO4 A;  1YQ4 B;  1K53 A;  4MH8 A;  3AE2 B;  1IUE A;  1XEE A;  3VR8 B;  1HZ6 A;  1EWC A;  1AN8 A;  2JSV X;  1RYJ A;  4NJC A;  3TEZ A;  2PVG C;  1BML C;  3ETR A;  1QLB B;  1SBB B;  2FUG 1;  4TQ1 A;  1FRD A;  3NVW A;  3AE6 B;  3IAM 1;  3AE5 B;  2LHE A;  3Q8A A;  5EE1 A;  1LO5 D;  1PGA A;  2MH7 A;  2W55 A;  3FIL A;  4YSY B;  1E10 A;  1ZDV A;  4YXD B;  2CU3 A;  5T8I A;  4AQ7 A;  3AE1 B;  2WXM A;  4N58 A;  1I4R A;  2IGH A;  1SB3 C;  1C4A A;  1MHH E;  2M19 A;  3BVG A;  4RGM A;  2JZP A;  2ZW0 A;  1STE A;  3AEC B;  4GDL B;  2IGG A;  3W5V B;  4Q2J A;  1SIJ A;  1GPX A;  2TSS A;  4WQM A;  3P4R B;  2V0G A;  3NRZ A;  2J52 A;  1EM7 A;  1MHX A;  1DGJ A;  5G5H A;  3TSS A;  4ARC A;  2Y5P A;  2L83 A;  4CQN A;  1FEH A;  1E6E B;  1CQV A;  5AUI A;  1QOG A;  1T5X D;  1TKY A;  2BB6 A;  2WXK A;  4O1N A;  1FD6 A;  2KMM A;  1DYQ A;  2YEP F;  3KQ4 A;  3AEF B;  1L4D B;  4YT0 B;  3P1M A;  4L23 A;  1N5W A;  1QOB A;  1IBX B;  3J9C A;  1JW9 D;  1AWD A;  2WXP A;  3HVZ A;  5EE3 A;  1WSP A;  3MJ5 A;  1E0Z A;  1V97 A;  5BYQ A;  1RWS A;  1F0Z A;  2RDG A;  2KAJ A;  3TEW A;  4RFB A;  3P4P B;  3I9V 1;  1L6U A;  2JXT A;  2XN9 C;  3B2G A;  4ARI A;  4TMA B;  2LMC A;  3C8Y A;  1JRO A;  1MVK A;  2V3N A;  5D3I B;  4HEA 1;  4OHJ A;  1I4X A;  1L0X B;  2I2Y A;  3URY A;  1NVI D;  1K51 A;  2QMT A;  3CIR B;  1NEK B;  1FM0 D;  3AE4 B;  2PLP A;  1HZ5 A;  3SFE B;  3KWV A;  2QEJ C;  3IAS 1;  3O13 A;  2ONQ A;  1F77 A;  3N9Y C;  2AX5 A;  2AQ1 B;  5TSS A;  3IXS A;  1VRA B;  3AB5 A;  2YEP B;  1ZP0 B;  2WXN A;  2LJI A;  1N62 A;  1VDV A;  1CJE A;  1F2R C;  2WP9 B;  3NVV A;  3SEB A;  4NAM A;  2HDE A;  3VR9 B;  1WWT A;  1FFU A;  1YN4 A;  2M56 B;  4HJG E;  4FXC A;  1PDX A;  4UDU C;  2IDY A;  1A70 A;  3EGR A;  4N6E B;  1ZDX A;  4LTU A;  2X38 A;  3ZJV A;  4KGR A;  3AE8 B;  3B2F A;  3AEB B;  2DYO A;  4OZA A;  1C77 A;  2QJL A;  1PYW D;  2J53 A;  1C78 A;  1FRR A;  1ET9 A;  3BWU D;  3R2I A;  2AQ2 B;  4MT5 A;  1DOY A;  5G5G A;  2BB5 A;  1WGK A;  1T3Q A;  1ZPS A;  1HXY D;  2KN4 A;  2NMQ A;  2SEB D;  1D4B A;  1SSN A;  3NVZ A;  4ZRQ A;  1R7S A;  4US9 A;  2W54 A;  3ZQ4 A;  1ENF A;  1SE4 A;  3U7Z A;  1FFV A;  3ZJU A;  1HQR D;  4RF1 A;  4P16 A;  4N59 A;  4C56 C;  2E6X A;  3P42 A;  3IT4 B;  1YQ3 B;  3GS2 A;  2LEK A;  2ON8 A;  2WXL A;  2V3P A;  4H2A A;  4L2Y A;  1ESF A;  1IBX A;  3LB8 C;  3PO0 A;  4ZRP A;  2L32 A;  1GOZ A;  4HRS A;  5FKA C;  2JQR B;  2PMV A;  2AQ3 B;  2QSD A;  5FK9 C;  5H92 C;  2B76 B;  4TQ0 A;  2QIE B;  4WH4 A;  1DOX A;  1WRI A;  2KQ4 X;  1P7F A;  1YJJ A;  2N9K A;  1FIQ A;  4MAC A;  2E3T A;  3EA6 A;  3W5U B;  1N60 A;  1ZOY B;  3BII D;  5BYR A;  4DXG A;  1H7W A;  3BK1 A;  1V1P A;  1NYQ A;  4JX1 C;  1QT9 A;  1ACC A;  1YMH E;  2HTM E;  2K9X A;  4ZYS A;  3MC0 B;  3AEG B;  1GTH A;  1VZ6 A;  2WLB A;  1FNU A;  4C7Y A;  1XCT L;  2GB1 A;  4REZ A;  1K50 A;  2GRI A;  1M4V A;  1QF6 A;  1TJE A;  1ZXH A;  3V05 A;  3NUH B;  4OZC A;  2WDR B;  2WDV B;  1N63 A;  2J4X A;  3T3N A;  2ACZ B;  1FMA D;  4RGT A;  2WU2 B;  1HEZ E;  3I57 A;  1FXI A;  1OQQ A;  4WWM A;  1XLQ A;  3LYY A;  4JWU C;  4M0W A;  2WDQ B;  1NYR A;  3BYT B;  3CWI A;  3BZD B;  4US8 A;  2W82 A;  2BTE A;  1TS2 A;  3AEA B;  1VR9 A;  1XLP A;  4D2K A;  1XO3 A;  3VQI A;  2FE8 A;  1B9R A;  1KFY B;  1L6V A;  2V4I B;  4RNA A;  1GB4 A;  3W1S A;  2K5P A;  4RGN A;  1UGJ A;  4YTP B;  2ZW1 A;  3MHZ A;  3TUO A;  1I4G A;  1XLN A;  2WNM A;  1JAL A;  1XF5 L;  2EEL A;  1P7E A;  1OFF A;  1TKE A;  1YNT E;  1AYF A;  1AW7 A;  4YWG G;  4MM3 B;  2Q5W D;  1E9M A;  4WIP A;  3BK2 A;  1N5X A;  1EWY C;  3P63 A;  2BS4 B;  2JYE A;  3BYY B;  1KLG D;  2OED A;  1CK1 A;  2BT6 A;  2RDH A;  1TS5 A;  3P4S B;  1SJH D;  4IOI E;  1FCL A;  2ICI A;  2LHD A;  4L1B A;  4RCO A;  2XNA C;  3FC4 A;  4HKQ A;  3TEX A;  2MJD A;  4TSS A;  4NZL B;  3CF4 A;  2RMM A;  3NS1 A;  1XCQ L;  3HRD D;  3Q8F A;  2BW2 A;  4EE2 A;  2Y3A A;  3E9S A;  3RPF C;  1UNS A;  1TS3 A;  3GP7 A;  2LFI A;  1KH0 A;  1PGX A;  1FCC C;  5AUK A;  1N61 A;  3AEE B;  2WU5 B;  4ZHO A;  4LLG M;  4ZOH C;  3RFZ B;  2WQY B;  2W3S A;  2SAK A;  2OHF A;  2JYT A;  3P4Q B;  4IDI A;  2IJ0 A;  1BXT A;  3AH7 A;  5BMI A;  4DXF A;  5HHD G;  2PIA A;  2L52 A;  2MEK A;  1GAQ B;  1TZO A;  1SE2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...