3SFDB

Crystal structure of porcine mitochondrial respiratory complex ii bound with oxaloacetate and pentachlorophenol
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
239
structure length
239
Chain Sequence
PRIKKFAIYRWDPDKTGDKPHMQTYEIDLNNCGPMVLDALIKIKNEIDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTNLDKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEEREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTGTCPKGLNPGKAIAEIKKMMATYKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
publication title Thiabendazole inhibits ubiquinone reduction activity of mitochondrial respiratory complex II via a water molecule mediated binding feature.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 61
structure length 239
sequence length 239
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2011-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 3sfdB02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3sfdB01
1JRPA 1H7XA 3AE3B 1QOFA 2HTME 1GT8A 3AE5B 3VRBB 3AEAB 3P4QB 1FFVA 1WXQA 3AEDB 1E10A 3ABVB 2K9XA 4WQMA 3AE4B 1DGJA 3AV8A 3RPFC 4C80A 1FIQA 4ZHOA 1FO4A 3AECB 3AB5A 3LXFA 2BS2B 1XLOA 4US8A 1WRIA 1VLBA 2CJNA 2G1EA 1ROEA 1FXAA 1XLNA 2W54A 1SIJA 1QOAA 4YSZB 1J7AA 1L6VA 2OHFA 4ITKA 1FRDA 4YTPB 3DWGC 2Q5WD 1YQ4B 1JWBD 4JWUC 1JALA 3AE7B 1NVID 4IDIA 2W3RA 1J7BA 2WP9B 3CIRB 2JQRB 1QOGA 1TKYA 1OFFA 3AEEB 5EE1A 1J7CA 1FMAD 1NYRA 2KMMA 2AX5A 4YTNB 1ZP0B 4YXDB 3HRDD 2L83A 1ZXIA 3AH7A 5AUIA 3SFEB 1GAQB 1SB3C 3AE6B 2N0SB 1L0VB 1JROA 3NVWA 4JWSC 4USAA 1I7HA 4A9AA 3PO0A 1VJKA 4WWMA 4C7ZA 2PVGC 3NVVA 1PDXA 3B9JA 1JQ4A 1N63A 2WU2B 1WYGA 3ZYYX 1NEKB 2WDQB 1L5PA 3AM9A 2PKOA 1XLPA 5MPOA 3P4SB 5H92C 2KAJA 1QT9A 1CJEA 1N5XA 1OQQA 1VDVA 3HUIA 4N58A 4HROA 1ZOYB 1N5WA 3W5VB 1RWSA 3W5UB 4C7YA 1RM6C 3P4PB 1AWDA 3NVYA 4YSYB 2MJEA 3HVZA 3AE8B 3AEBB 1GTHA 4ZOHC 3P4RB 2WDVB 3EUB2 3FC4A 3NRZA 1CZPA 4P6VF 5G5HA 3ETRA 3P63A 3AE9B 1E9MA 2M56B 4N59A 3B2GA 3NVZA 1TKEA 4ZHPA 2PVOD 4US9A 1QF6A 1PUTA 3VR8B 1SF0A 1WGKA 3DWMA 3SR6A 2BT6A 2DBYA 2W3SA 1PFDA 3LB8C 2WLBA 2LEKA 1V97A 1AYFA 1FFUA 3AEFB 3VR9B 1UWMA 2K22A 3AMZA 3AEGB 1A70A 1QOBA 4HRSA 3WCQA 5GXGB 5G5GA 4YT0B 5C3JB 2BS3B 1H7WA 1E6EB 2ACZB 1DOIA 1N60A 1JW9D 2WU5B 2W55A 1FM0D 2H88B 2PIAA 2Y5CA 3FAHA 1B9RA 3AE1B 1RFKA 1XO3A 2M19A 2CJOA 1L6UA 2E3TA 2BS4B 2WQYB 4LTUA 1V8CA 2B76B 3L4PA 5EE0A 1T3QA 1YQ3B 1OQRA 1E7PB 2MJDA 5C2TB 3CWIA 1NENB 4JX1C 1TKGA 5EE9A 1YJIA 1R7SA 2QIEB 1EWYC 5EE3A 1KFYB 1FRRA 2EKIA 2L52A 2QJLA 1E0ZA 1TJEA 3P1MA 3NS1A 2CU3A 2JX5A 1QLBB 3CF4A 5AUKA 1DOYA 1GPXA 3VRAB 3AE2B 5H8YE 1FXIA 3AN1A 1ZUD2 4YTMB 1KRHA 1JWAD 1NI3A 1NYQA 4FXCA 2FBWB 4YSXB 2MH7A 4N6EB 1WWTA 2MJ3A 3BIID 2WS3B 4KX6B 1IUEA 1N62A 3B2FA 3KWLA 1GTEA 3W9CB 1DOXA 2H89B 1TYGB 1KF6B 1N61A 1RYJA 1XLQA 2DWQA 1F0ZA 2K5PA 1YJJA 2WDRB 3SFDB
chains in the Genus database with same CATH superfamily
2KJ6A 4GDLA 4LNNA 4B6WA 2V3SA 3NZUA 2KC2A 3AV8A 3FKYA 1F9JA 4WWPA 1TGZB 3QX1A 3SR6A 3ZJVA 4JWUC 3TL5A 1J7BA 2AQ3B 1ZE3D 2BYTA 3EECA 1J7CA 2BYVE 4GOCA 4ZRJA 4ZYSA 2DNFA 4XE0A 1HEZE 2BPSA 2NMQA 2WU2B 4EKUA 4E71A 1TY2A 1TT5B 3Q8EA 5JXVA 2JT4B 2D3AA 4BKSD 1F2RC 5JZEB 2IGGA 4TSSA 2KT7A 4PYUA 3EUB2 4FADA 4WJPA 5LXIB 2DYBA 3ZXRA 4WJQA 1HZ5A 2ONQA 2AL3A 1ZKHA 3HVDA 1JWMD 4MJSB 4BZAA 4K3BA 3R7RA 1R4MI 3VR8B 2GI9A 2JXXA 1PQSA 4GDKB 3UI3A 1SIFA 2WXLA 1CK1A 2K8CA 2IYDB 3PZ7A 5GXGB 4IM3A 1CQVA 1E6EB 2BKRB 3OAWA 4BFRA 4IUMB 2EMSA 1ZDXA 1K50A 4ZDVA 2WQYB 1ZPSA 2FCMA 1NBFC 1UBQA 2HDEA 2ZJDA 1EWYC 2RMMA 3HM6X 3A1QA 2V4IB 4HPMB 4WJOA 4AUQC 4BKSA 2QEJC 2LFIA 2IO1B 1KRHA 1NYQA 4YSXB 3ZNID 3TBLD 3B08A 2G9HD 4RFBA 3WAMA 1E7UA 2KDBA 2D10A 2KJRA 3ABVB 1EM7A 1C4PA 4AP4C 3QIJA 1R4NI 4US8A 1WRIA 2WXNA 3ZNZB 4YSZB 2PMVA 1YD8U 2N1WA 2MRPA 4J3OD 1GNUA 3KUCB 1TKYA 3WAPA 4EE2A 2WXFA 2OJWA 2W9NA 4ASWC 3PSEB 3SHQA 5D3DA 4RH6A 2FCSA 3PO0A 4B0EA 3M63B 2LGXA 1RLFA 2MBQA 1JRUA 3IAM1 2WXIA 5IN7A 4W9IA 2J52A 1I4PA 2IY1B 4FHKA 3U8ZA 2JY6A 4RGMA 1WSPA 3T3NA 1I4HA 5TSSA 3KQ4A 4W9DA 4GDKA 4A8XC 1FFUA 2K1FA 4C00A 3WALA 2MBHA 4P1BC 5G5GA 2BS3B 1H7WA 1JW9D 4WJNA 4NAMA 4HPPA 5JHAA 3TEWA 4WWNA 2D3BA 1IBXB 1ZDVA 2C7HA 1R4MB 1WR6E 4KZ0A 3AULA 2L52A 3NHEB 2KOXA 2N1VA 2LHEA 1WZ3A 2INNE 4DXAB 2ZZPB 2C60A 1FXIA 3IHPC 1WJNA 3H1UA 1PGAA 2K3UA 3W9CB 4L1BA 2K25A 3ZTDA 5BMHA 1EWCA 1P0RA 2WXRA 1F0ZA 5TR5A 2K5PA 4II2B 4DWFA 1TBEA 3VRBB 2NR2A 5E6JA 1E10A 3AEDB 2JYTA 3L16A 4RCOA 3RI7C 3PHWB 1TY0A 3C19A 3Q6BA 4ICUA 2JZZA 2CJNA 4DHZB 2BB6A 2W54A 1SIJA 4F7ZA 2I2YA 2AQ2B 1I4RA 2AYOB 3ZUNA 1NVID 1WE7A 3CIRB 1LQBA 3GP7A 1Q1OA 1UGMA 4YL8A 1FMAD 4HJGE 3SD5A 3V6CB 1R4NB 2D3CA 4EUTA 4NY0A 1JROA 3B1LX 4USAA 1SSNA 3ZRCA 1JQ4A 2GRIA 1D4BA 2LUEA 2BWES 2KWCA 4RGTA 3P4SB 3I5JC 1HE8A 1I4QA 4IKGA 2JPHA 3C8YA 1V5OA 2MP2B 3OJ3A 4NAWB 1WJ4A 2BGFA 5LNK1 1UUPA 2INDC 4NQKE 1E90A 1KTKA 5CHFA 5L83A 5IKCM 3AU5A 3NOBA 2ACZB 1UGJA 2IO0B 1TS3A 3ML9A 3U2SC 1MI0A 4HXDA 3VUYA 4IG7B 2LJ5A 4OVVA 5EE3A 2ASQA 4EZJA 2KYWA 3URYA 2CU3A 1GPXA 1LM8B 2BTEA 2MEKA 1WH3A 1L0XB 3W1YA 3T8MA 3B2FA 1D5MC 2KMCA 3N20C 5G2NA 4ACFA 3AE4B 2SAKA 5IO9A 3RUIB 3A9KA 3PS6A 3Q3FA 1GJZA 3W1SC 2WXOA 1IGCA 1YQBA 3TUOA 5FR3A 4GMVA 3W1SA 3U7DA 3B0AA 4A55A 2K39A 5EDSA 5HFYA 3VTVA 1SBBB 1C9FA 3NVVA 3UF8A 3B9JA 3L08A 1WIAA 3PTFC 3FILA 3RNCC 3ZLZA 2WDQB 1C76A 3J9CA 1C77A 3KYDD 2L0FA 1RFAA 2KX0A 4W9CA 2CU1A 4YSYB 1V1PB 2INPE 2WDVB 3AE9B 2M56B 3B2GA 3O65B 5DPRA 2D2QA 4ZHPA 4X57B 1XEEA 1L7YA 1QQRA 2LEKA 2DYMA 2MX2A 3L10B 4FJYA 5DPWA 1A70A 2KQ7A 1F2RI 3IAS1 4M00A 2V0GA 4LNOA 2NS5A 4I6NB 4JQWC 1YQ3B 4EOYA 2WNMA 2LMCA 4OVZA 1E0ZA 4C4VA 4WWOA 2L8JA 1ZW7A 3APFA 3PZ8A 4M8NA 3AXCA 3AN1A 3MJWA 3ZDTA 2WWZA 4A90A 4N6EB 1XD3B 1N61A 2WXHA 4PS3A 2BVCA 5L95C 3BK2A 3N32A 2JSVX 2OJRA 3KUZA 4ITKA 1C79A 3UINB 4OZAA 3R7QA 3VUXA 2KX3A 3AE7B 1QOGA 5BMIA 1WM2A 4YXDB 2NBVB 1SE2A 1Z2MA 3N30A 4HVBA 1L0VB 4OHJA 1C4CA 1FXTB 4DHJB 1C78A 4P1CC 3ZNHB 3RCZA 1Z5SB 1EUVB 3SU8X 1J8CA 4LNKA 2VZKD 1LO5D 3Q8BA 1L0YB 2ZCCA 3TJPA 3I9V1 2KHWB 4KGTA 5E6PA 3ETRA 4A3PA 1J19A 4OW0A 3Q8CA 5IAAC 4KGSA 1UD7A 5D2MB 5E6NA 4L23A 1L4ZB 4XYCA 1Y56A 3WA0A 4I6PA 1V97A 1MG8A 3JYUA 1Y8RC 4NJCA 1VZ6A 2NPTA 4KZCA 2XNAC 2Y3AA 3RNEC 2QIEB 4K7WA 1KFYB 2QJLA 4ZRIA 1SXTA 3P1MA 2MBEA 3DHIC 2IGHA 3VTUA 3A4SC 4HCNB 4PT5A 4YTMB 1ENFA 4C56C 1ACCA 3H7PB 3NZ3A 1BMLC 2KTFA 4AJYB 4TMAB 3KLSX 4FJZA 1TS5A 1MJDA 3RZWC 2BS2B 3A1QB 2G1EA 1ROEA 2G4DB 4XX5A 2CKHB 1VCBA 1NDDA 3KW5B 1HA5A 5LLIA 2WXJA 2LZ6A 2AQ1B 4RF1A 2FCQA 1MFWA 3IT6B 2N9EB 1VJKA 2KFKA 3ENEA 4C7ZA 1MVKA 4MELA 4URKA 1WYGA 4KDLB 2V9HA 1VR9A 1XT9B 3AM9A 2AEHA 4GIVA 3X23A 1QT9A 4N58A 4FJVB 2Z0EB 3MC8A 4XDCA 5HI1A 2RPVA 4HCPB 2LVQA 1WGDA 4GN1A 2QCZA 2X8XX 1SGHA 2KMAA 4GGQA 3V6EB 1PUTA 1LFDA 2BT6A 2I1JA 3N9YC 1WZ0A 2EELA 1K53A 4M02A 1X1MA 3ML8A 1N6ZA 2IDYA 1N60A 3IT4B 1L6UA 1IYFA 3CMMB 2IJ0A 1YNTE 1WRDB 1EF5A 2EKIA 2O2VA 2GMIC 3VRAB 1WXSA 1JWAD 1D3ZA 1WWTA 2MQJA 2BQQA 3H7PA 1TYGB 1KF6B 4MSMB 1P9DU 2BYEA 2N7DA 1H7XA 3AE3B 2HTME 2NCNA 4PYZA 2WXGA 2J42A 4C80A 3AECB 1KOTA 1YX5B 4WH4A 4FULA 4W9LA 4HLEA 1V49A 3LYYA 1KLUD 4REZA 2PLPA 4W9HA 3E9SA 3GB1A 2JUOA 2FNJB 3A9JA 1OFFA 5D6JB 1WI0A 2DAJA 2C5LC 1SB3C 4DXGA 1UNSA 3X0WA 3UIOB 1L2NA 1V86A 2JWZA 1GUAB 4EZKA 3ZW3A 2PE9A 3MC9A 2DYOA 1KLGD 3IVFA 4TQ0A 3PVLA 2Z8LA 1NI2A 2G4SA 3BYTB 2WXKA 1XF5L 1N5XA 1OQQA 3HUIA 1KLVA 3VHTC 4C7YA 2MJEA 2JRHA 3KUDB 1T0SC 3DBSA 3O13A 1ESFA 2RDBC 2XEWA 2RDGA 3P63A 4N59A 4HEA1 1K52A 1WY8A 3VQIA 2KJHB 4A3OA 1WJUA 2WLBA 4GB9A 1AYFA 4WAAA 3QCAA 1UH6A 4YT0B 5AZHA 3VH3B 1GOZA 1KJTA 1XXGA 2VH2A 2WU5B 3FAHA 2H88B 4KKJA 1XO3A 1J0GA 3LDZE 5EE0A 4JIOU 2C7NB 2TSSA 4K3CA 2I1KA 2DENB 2WGSA 2MA9B 2JF5A 1WMHB 4K1RB 2BF8B 1GB4A 3ZDMC 2WS3B 2J53A 2ZW0A 1FCLA 1YJJA 3BVGA 1WXQA 1FFVA 4KVGB 5KHOA 2HE7A 1AW7A 1FIQA 3DQVA 4WIPA 1V1OA 5D94A 1J7AA 4ANXA 3PRZA 3T3OA 2KDMA 3ZXVA 1B1ZA 2W3RA 1ISNA 1OQYA 2QHOA 4YTNB 3P2BA 4XWWA 4AQ7A 4B95A 3AE6B 1SE4A 1I7HA 4MGKE 2MWSB 3A33B 4PS8A 2ZW1A 2PJHA 2QILA 3TEZA 1TZOA 3A9KB 1I4XA 3R2TA 5CTRC 3UQAA 1EO6A 2KLCA 3VFKA 3EFUA 1VDVA 5HG2A 1ZOYB 5JH5C 4FHJA 3DPDA 4BAXA 3AEBB 2XK5B 2WYQA 4JLCA 2O6VD 2RPQA 4W9FA 4P6VF 3PT2B 2PVOD 4US9A 3M62B 3QA8A 2DBYA 2YEPF 3R8BA 5C23A 1JWUD 3FILB 2K22A 1QOBA 1B9RA 1FM0D 5KHQA 2L76A 2ZVNA 1E8XA 1V8CA 2B76B 4G3XB 3CWIA 4ZHOA 2MJDA 1TKGA 4ARIA 2X38A 2JRIB 3QARA 1WMHA 4G11A 1TS4A 2KACA 2FUG1 3BZDB 4KIKA 3BYYB 2LI5A 4G0NB 3ONSA 3L54A 2MH7A 2O6VA 1N62A 3DVGX 1GTEA 4G50A 2WDRB 2JVCA 3Q69A 2K8HA 3AE5B 3AEAB 4S0RA 1P98A 1H8CA 1QILA 5BYRA 4C4VB 3BVMA 2OHFA 1FRDA 2EMTA 4N9F4 3VUWA 4ARCA 1C4AA 5EE1A 1EU4A 2ZVOA 1ZXIA 3AH7A 3UQBA 2MSED 1GAQB 1SEBD 2GBJA 4WWMA 1WE6A 4IM0A 1NEKB 2RDHA 4F8CB 5MPOA 2CHZA 5J2RA 1XCQL 1AARA 3VH4B 1RM6C 3P4PB 1PYWD 2XK5A 2WXMA 4JE3B 4DK5A 3MP9A 3TSSA 4ICVA 2L05A 2HJ8A 2KANA 2ZCBA 1QF6A 4GU2A 3IXSA 2VH1A 3RN9C 5JHBA 3VR9B 3LJ3A 4MGIE 1VRAB 2WX0A 4K7UA 2LXCA 4AJWA 3AU4A 3U7ZA 2W55A 4MGZE 4OZBA 1RFKA 4MDKE 3VTWA 2YVCA 3MHZA 1SJED 3Q8AA 2IZVB 3NG0A 3APDA 2BB5A 1DOYA 4B9KA 1FNUA 1YIWA 2YLMA 4XC2A 1IUEA 4W9EA 1A5RA 1WXMA 2NPTB 2R2OA 1TZ1A 2BWFA 2IO2B 1YOVB 4RM8A 4LNIA 3HIZA 2DZJA 2KWDA 4RGOS 2VZKB 1QOAA 2JZPA 4NQLB 3VXWA 2KC1A 4RGNA 4DXFA 4J6IA 3KVFB 2J7QB 2R61A 2KMMA 1LXDA 1BUIC 2GBKA 2FIDA 4ANUA 2N7JA 3A4RA 3HK0A 1D5ZC 1UELA 2LWPA 2VRRB 4NNJB 3RD2A 2KK8A 2PKOA 2W82A 2LUMA 3S2AA 2ZPYA 4IWOA 3EFCA 4BOZB 5FKAC 3P4RB 4HKQA 1T0YA 3VDZA 3PREA 1I42A 3VVWB 2M8SA 3NUHB 4TV3A 2KFKB 1SF0A 2LHDA 3DWMA 3Q8FA 2W3SA 4RNAA 3WIMA 3TMPB 5IA7A 1UWMA 1YMHE 1WX8A 3ZKJC 2D3GA 2Y5PA 3L0WB 3PHXB 2E6XA 2PIAA 4ANVA 2KTRA 3GOEA 3T9LA 3RNFC 1E7PB 5C2TB 3C0RB 1YJIA 2K8BA 2KNBA 3DHHC 5J17A 2K0PA 2PE6B 3ZGZA 3CF4A 1FNWA 5CHWA 2UWQA 4MT5A 4D2KA 2K6QA 1JWSD 1VZ7A 4YWGG 1WR1A 1C1YB 1RYJA 3PV1A 4JL9A 4XZ4A 3E56A 2QSDA 2IY0B 4WQMA 2RR9A 1DGJA 2KDFB 2GBNA 1F77A 2AWTA 4H2AA 5FR6A 2O2VB 1V6EA 1L6VA 3BWUD 3Q3OC 4BVUC 2J0KA 4FN2A 2D07B 2G45B 5BYSA 3DBRI 3L13A 2LGIA 1NYRA 1GC6A 2AX5A 4ANWA 2L83A 4ZRKA 5AUIA 1Q10A 2NVUI 3QHTA 3U52E 5HHDG 1HZ6A 2KQ4X 1P1AA 2RGFA 3PRMB 2CHXA 2PVGC 2XBBC 5AZFA 2IGDA 1MPEA 2PPHA 3I3TB 1H4RA 2C7MB 2GBRA 2KAJA 2KVZA 3OJ4B 3PPAA 4A6QA 4AOFA 4M0WA 1RWSA 3H7SA 3NVYA 4ZOHC 2V3PA 3CSTA 3A9JB 4FA6A 3NRZA 4MH8A 2DZKA 4WURA 1U4AA 1E5WA 3GZNB 3TCAA 1TKEA 4HK2A 1WF9A 4EEWA 2KFJA 4A20A 4HRSA 1AN8A 1QKZA 1V9JA 5G55A 3NVWA 4TUUA 3PGEA 3AE1B 3ZVVA 4MM3A 1SE3A 4P7IA 5E6OA 4BKGA 3KWVA 4PS7A 4NZLB 5DPSA 1R7SA 1WYWB 5LXHA 3ZRFA 2JWUA 4AWJA 4E74A 2NBWB 3RNBC 1GC7A 2JX5A 3V61A 1GG3A 1FCCC 1EU3A 2ICIA 5AUKA 3QJZA 1UWXA 2N7EA 3ECIA 1NI3A 1KH0A 3OG5A 2M0XA 1DOXA 2H89B 5AEKB 1XLQA 3H6NA 3I63C 1M94A 1V5TA 1K51A 4EFOA 2LXAA 4OVUA 4BKTA 2LVOA 2KWUB 2CR5A 4E3CA 1FO4A 3MJ5A 4DBGA 1VLBA 2IPKD 2YEPB 3APCA 4IC7B 3HM3A 4GLSC 2WP9B 4KGRA 1ZP0B 4DDID 4FLHA 3BK1A 4XWTA 2WHIA 4A9AA 3JSVA 4KV2A 3DVNV 4KDIC 3IFWB 3DBHI 1N63A 2GBMA 3PRPB 3DBRB 1L5PA 2KN4A 4II3B 1T0RC 1XLPA 2AL6A 4RM9A 4L2YA 1MHXA 2OEDA 2N9PC 2Z59B 3W5VB 2BW2A 3JW0X 3N1YC 3HVZA 3AE8B 3MTNB 3ZIMA 1CZPA 3QAQA 1UF0A 4IM2A 1SJHD 2QDFA 2FCNA 1E7VA 1Q0WB 2D11A 4ZRQA 1PGBA 3ZNGC 3PLUA 1PFDA 3K9OB 5I4DA 3L17A 4BOSC 3AEGB 3RNGC 1HQRD 1OTRB 2DAFA 3IBEA 2FIFA 4HPLB 2D5GA 2KLGA 2M19A 2E3TA 3R66C 2CJOA 1BT0A 2BS4B 4LTUA 2L00B 4Q2JA 3ZJTA 4WAFA 2WDTB 2ZNVB 2JYEA 2L7RA 4TKNA 2CS4A 4DQOC 1E8WA 2KDEB 2V1YA 2KXJA 3EHVA 2MJ3A 4KX6B 1HXYD 2NTTA 1ZXHA 2LGDA 2MCNB 3DDCB 1STEA 2K9XA 1TTNA 2DZIA 1P7FA 1FEHA 1EF1A 4FBJB 2JU6X 1FPYA 4EZLA 1BXTA 2KN5A 4KKIA 3PZDA 3QQ8B 4HDQA 4HWIB 3N1ZC 4KIKB 1JWBD 3I57A 1WGYA 1WGGA 1VZ8A 2O6VB 4F1SA 3CF6E 3RZFA 1Q5WB 4HJKA 4PK1A 3H8HA 2QC8A 3SFEB 4CYEA 2EKEC 4MJSA 3WANA 2L0TA 1JMLA 2OOBB 3KYCD 3RULA 3DHGC 2LJIA 1VD2A 1JCKB 1YN3A 2J0MA 3HHMA 2M0AA 3ZQ4A 1N5WA 4LLGM 3W5UB 3TEXA 3PLVA 3DBHB 1K8RB 2B3AA 4IWQA 2JZ3B 3CSFA 4MSQB 3DOWA 3V3XA 3GS2A 4M8MA 4NJ6A 5C3JB 4QAYA 1WXAA 2LD9A 2SEBD 2ZNVC 1P3QU 1E8ZA 2WXPA 4MGYE 3DBLI 4JX1C 3BY4B 1M4VA 4NPNA 5DPTA 1FRRA 1WXVA 2DLBA 1XCTL 1QLBB 1ET9A 3AE2B 3IG3A 4O1NA 2HJ1A 2M17A 1HTQA 3OLMD 4CQNA 1TS2A 3NJTA 3GE3C 3R2IA 2DWQA 3M95A 4TQ1A 5IOIA 1YX6B 2WX1A 4XDDA 2BYFA 1PGXA 2KKCA 2ON8A 3LXFA 3M3JA 1XLOA 5J18A 2NTSA 2MBOA 3DVGY 4YTPB 4B0MA 1UBIA 3RNAC 1JALA 4IDIA 2RSUA 5HKHA 3AEEB 1P7EA 3HRDD 3V05A 1S1QB 1HTOA 2NBUA 4LDTB 2KD0A 4MH0E 4JWSC 5C1ZA 4K81A 2Y5BB 1G6JA 2KVRA 1I35A 2DHZA 5T8IA 5FK9C 3RYTA 3ZJUA 2MHJA 3K9PB 2I38A 1YN4A 3RMKC 1OGWA 1FD6A 2FAZA 1IBXA 2PTLA 1WGRA 4JGHB 1SE9A 4HDOA 4GSWA 1DYQA 1E9MA 4W9KA 5D3IB 3NVZA 5GMVA 1WGKA 1CMXB 1V81A 2REXA 2C9WB 4DHZE 1V80A 4UDUC 5AZGA 3UIPB 4LJOB 2INCC 1F1HA 1FNVA 4AS1A 3NZSA 3MFGA 4HKZE 5EE9A 3Q3MC 3ZTCA 2UU7A 1MHHE 1T0QC 3TEYA 4CO7A 4LDTD 3DVNU 5H8YE 4OZCA 3P42A 2IO3B 1ET6A 3BIID 4GXBA 3KWLA 3DBLB 2V3NA 4RF0A 2LRWA 1LGRA 2MW5A 2J0JA 2KTRB 2FUHB 3SEBA 1YJ1A 3RPFC 1F52A 1QZEA 4IWPA 1XLNA 1IP9A 1C3TA 3GE8C 1RAXA 4CHKA 3OWEB 3V60A 2G3QB 5CX3A 1WM3A 4RMAA 2MP2A 4NAWA 3UGBB 2GOWA 4K7SA 4W9GA 2KO3A 2LGYA 2Z0DB 2GLSA 1D5XC 1ZGUB 2PEAA 3QK0A 1IPGA 4BBNC 5H92C 4ZYNA 2XN9C 3Q3JA 2IBIB 3W2DA 1AWDA 2HTHA 3ZO5B 1GTHA 3ALBA 2BKFA 4W9JA 5DCNA 5G5HA 1WFYA 3BVZA 1E8YA 1WGHA 2WXQA 1T5XD 2LASA 3LB8C 5BYQA 3AEFB 2KWVB 3AMZA 2ZPNA 3GZNI 4LJPB 1DOIA 1S3SG 2R2QA 4M0WB 2DX5B 2N9KA 1V2YA 3N1XC 3QWZB 3L4PA 2PW9A 1T3QA 1GB1A 1WX9A 5BMGA 4S17A 1WJ6A 2UYZB 1TJEA 3NS1A 2J4XA 2LGSA 3D32A 3U30A 2HD5B 5IP4D 2DZMA 4FXCA 2K6DB 2GB1A 2M1MA 3DCGA 4LK0M 2FE8A 3EGRA 4KSLC 2L3ZA 4LNFA 3RT3B 1JRPA 1QOFA 1GT8A 4GDLB 4MM3B 3P4QB 1OEYA 2A4ZA 3BINA 2MBBB 3AB5A 2KQSA 4ZRPA 3R3MA 1FXAA 4R3DA 2BBCA 2KZRA 3DWGC 2Q5WD 5BO4B 1YQ4B 1KM7A 1IGDA 3Q2AC 2JQRB 1V1PA 1YN5A 2M4NA 4MACA 4M01A 2N9LA 2LRUA 4BBNF 3U4EG 2N0SB 4IOIE 1L4DB 1RRBA 3Q14C 1PDXA 3TIXA 3ZYYX 4DDGD 3JVZX 3NS8A 3VAWA 1XQQA 3N3KB 1CJEA 4HROA 2A5UA 4XGAB 3RFZB 5D7GA 3FC4A 3Q3NC 1I4GA 3MHSD 3EA6A 4JPSA 2QMTA 3JSVB 5CHVC 3KH0A 2N9XA 4DHJD 2V4LA 3WAOA 3WCQA 2JXTA 3V62A 2Y5CA 3EC8A 1D6EC 1T6BX 4MEMA 2CHWA 4KSKC 3H9DA 1OQRA 1NENB 4I6LB 2RD0A 4NJ7A 1MG4A 4LCDE 1UZXB 2LVPA 3AI5A 4WQOB 2KDIA 2L32A 2L1AA 4IW0A 3NY5A 1WX7A 1OEYJ 1TIFA 3QC8B 1ZUD2 3SDLC 2FBWB 3MC0B 2MLBA 2ZEQA 2N4FA 4P16A 3SFDB
chains in the Genus database with same CATH topology
3Q69A 3AE5B 3AEAB 2K9XA 3BK2A 3AV8A 1P7FA 2JSVX 1FEHA 1QILA 5BYRA 2JU6X 3SR6A 3BVMA 1BXTA 2OHFA 4ITKA 1C79A 4KKIA 3ZJVA 1FRDA 4OZAA 1JWBD 3I57A 4JWUC 3AE7B 4ARCA 1J7BA 1VZ8A 2AQ3B 1ZE3D 2BYTA 1QOGA 1C4AA 5EE1A 1J7CA 1EU4A 5BMIA 4YXDB 3H8HA 1SE2A 1ZXIA 3AH7A 3SFEB 1GAQB 1SEBD 1L0VB 4ZYSA 4OHJA 1JMLA 4XE0A 1C4CA 1HEZE 4WWMA 1C78A 2NMQA 2WU2B 1NEKB 1TY2A 2RDHA 2LJIA 5MPOA 3Q8EA 1JCKB 5JXVA 1YN3A 2VZKD 1XCQL 1LO5D 2M0AA 3Q8BA 3ZQ4A 1N5WA 4LLGM 1L0YB 3W5UB 1RM6C 3P4PB 1F2RC 1PYWD 3I9V1 2IGGA 4TSSA 3TEXA 2WXMA 3EUB2 4KGTA 4JE3B 3MP9A 3TSSA 1HZ5A 2ONQA 3ETRA 3HVDA 1JWMD 4OW0A 3Q8CA 1QF6A 4KGSA 3VR8B 2GI9A 3IXSA 4L23A 1L4ZB 3V3XA 1Y56A 3GS2A 4GDKB 1V97A 3UI3A 2WXLA 1CK1A 3VR9B 1VRAB 3PZ7A 5GXGB 5C3JB 1CQVA 1E6EB 3U7ZA 2W55A 4OZBA 2SEBD 4NJCA 1VZ6A 1RFKA 1ZDXA 1K50A 2WQYB 2XNAC 1ZPSA 2WXPA 2Y3AA 4JX1C 3MHZA 2HDEA 1M4VA 2QIEB 1EWYC 1KFYB 1SJED 1FRRA 2RMMA 2QJLA 3Q8AA 2DLBA 2V4IB 1XCTL 1SXTA 3P1MA 1QLBB 1ET9A 2BB5A 2IGHA 1DOYA 3AE2B 2QEJC 4O1NA 2LFIA 4PT5A 4YTMB 1KRHA 1NYQA 4YSXB 1FNUA 1ENFA 4C56C 1IUEA 4CQNA 1TS2A 1ACCA 3NZ3A 1BMLC 3R2IA 2DWQA 2G9HD 4RFBA 4TMAB 3SFDB 4TQ1A 3KLSX 3ABVB 1EM7A 4XDDA 1TS5A 1C4PA 1PGXA 2ON8A 3LXFA 2BS2B 1XLOA 4US8A 1WRIA 2G1EA 2KWDA 2NTSA 1ROEA 4RGOS 2VZKB 2WXNA 1QOAA 4YSZB 2JZPA 2PMVA 4YTPB 4B0MA 4RGNA 4DXFA 1JALA 4J3OD 4IDIA 1HA5A 1TKYA 2WXJA 4EE2A 3AEEB 2R61A 2WXFA 2KMMA 1P7EA 2AQ1B 3HRDD 4RF1A 3V05A 1BUIC 5D3DA 4RH6A 3IT6B 2N7JA 4JWSC 3PO0A 1VJKA 1D5ZC 4C7ZA 1MVKA 4B0EA 1WYGA 1VR9A 3AM9A 5FK9C 2PKOA 5T8IA 3ZJUA 2W82A 2I38A 2LUMA 3IAM1 1YN4A 1QT9A 4N58A 1FD6A 2WXIA 1IBXA 4XDCA 2J52A 2PTLA 2RPVA 3P4RB 1I4PA 5FKAC 5HI1A 4HKQA 4RGMA 1DYQA 1WSPA 3T3NA 1E9MA 1I4HA 5D3IB 3NUHB 3NVZA 5TSSA 1PUTA 1SF0A 1WGKA 2LHDA 3DWMA 3KQ4A 2BT6A 3Q8FA 2W3SA 3N9YC 4A8XC 2EELA 4RNAA 1FFUA 1K53A 1UWMA 1YMHE 5G5GA 2IDYA 2Y5PA 2BS3B 1H7WA 4UDUC 1N60A 1JW9D 2E6XA 2PIAA 4NAMA 3IT4B 1FNVA 3TEWA 1L6UA 4AS1A 1IBXB 3MFGA 1E7PB 1ZDVA 5C2TB 2IJ0A 4HKZE 5EE9A 1YJIA 1YNTE 2K0PA 1MHHE 3TEYA 2EKIA 2L52A 3ZGZA 2LHEA 3CF4A 2INNE 3VRAB 1FNWA 5H8YE 1FXIA 4OZCA 4MT5A 4D2KA 3P42A 1JWSD 1JWAD 1ET6A 1WWTA 1PGAA 1VZ7A 2K3UA 3BIID 4L1BA 3W9CB 3KWLA 5BMHA 4YWGG 1EWCA 2V3NA 2WXRA 4RF0A 1TYGB 1KF6B 1RYJA 1F0ZA 2K5PA 1H7XA 3AE3B 2HTME 2QSDA 3E56A 3VRBB 5E6JA 1E10A 3SEBA 3AEDB 2WXGA 4WQMA 2J42A 1DGJA 2JYTA 4RCOA 1F77A 3RPFC 4C80A 3AECB 1TY0A 4H2AA 4WH4A 2CJNA 2BB6A 2W54A 1XLNA 1SIJA 1L6VA 3BWUD 2I2YA 3LYYA 3OWEB 1KLUD 4REZA 2AQ2B 2PLPA 1I4RA 5BYSA 3E9SA 3GB1A 1NVID 3CIRB 3GP7A 2LGIA 1OFFA 1FMAD 1NYRA 4HJGE 2AX5A 2L83A 5AUIA 3U52E 1Q10A 1SB3C 5HHDG 1HZ6A 4DXGA 2KQ4X 1JROA 4USAA 1UNSA 1SSNA 2PVGC 1JQ4A 2GRIA 1D4BA 1D5XC 1MPEA 2DYOA 1KLGD 2IGDA 4TQ0A 2Z8LA 4RGTA 3BYTB 3P4SB 2WXKA 5H92C 2KAJA 2XN9C 1XF5L 4A6QA 1I4QA 1OQQA 1N5XA 3HUIA 4M0WA 4IKGA 1RWSA 3W2DA 4C7YA 1AWDA 3NVYA 2MJEA 4ZOHC 2V3PA 3C8YA 1GTHA 4NAWB 3NRZA 4MH8A 4WURA 3O13A 5G5HA 1ESFA 3P63A 2RDGA 4N59A 5LNK1 1UUPA 4HEA1 3BVZA 1TKEA 1K52A 2WXQA 3VQIA 1T5XD 3LB8C 1KTKA 2WLBA 5BYQA 1AYFA 3AEFB 3AMZA 4HRSA 4YT0B 1AN8A 1QKZA 1GOZA 1XXGA 2ACZB 1DOIA 3NVWA 2WU5B 1UGJA 3FAHA 2H88B 4KKJA 1TS3A 3AE1B 1XO3A 2N9KA 1SE3A 5EE0A 3L4PA 2PW9A 3KWVA 1T3QA 1GB1A 3U2SC 1MI0A 4NZLB 2TSSA 5BMGA 1R7SA 5EE3A 2JWUA 1TJEA 3URYA 3NS1A 2CU3A 2JX5A 1GPXA 1FCCC 1EU3A 2ICIA 5AUKA 2BTEA 2MEKA 1UWXA 2J4XA 1NI3A 4FXCA 1L0XB 1GB4A 1KH0A 2WS3B 2GB1A 3B2FA 1DOXA 2H89B 2J53A 2FE8A 2ZW0A 3EGRA 1D5MC 1XLQA 4LK0M 1FCLA 1YJJA 1K51A 3BVGA 1JRPA 1QOFA 1GT8A 1FFVA 1WXQA 4GDLB 3P4QB 4MM3B 1AW7A 3AE4B 2SAKA 1FO4A 1FIQA 3MJ5A 3AB5A 4WIPA 1V1OA 1VLBA 4ZRPA 1FXAA 4R3DA 2IPKD 1J7AA 2BBCA 2YEPB 3T3OA 3DWGC 2Q5WD 1YQ4B 2KDMA 2WXOA 1IGCA 4GLSC 1B1ZA 2W3RA 3TUOA 2WP9B 1IGDA 4KGRA 5FR3A 2JQRB 1V1PA 1YN5A 4MACA 3W1SA 4YTNB 1ZP0B 2N9LA 4XWWA 4AQ7A 4A55A 3AE6B 3U4EG 1SE4A 2N0SB 5HFYA 3BK1A 4XWTA 1I7HA 4A9AA 4IOIE 1SBBB 2ZW1A 1L4DB 1C9FA 3NVVA 1PDXA 3B9JA 2QILA 3TEZA 1N63A 1TZOA 1I4XA 3FILA 3R2TA 3ZYYX 2WDQB 1L5PA 2KN4A 1C76A 1XLPA 3J9CA 1C77A 4L2YA 1CJEA 1MHXA 1VDVA 2OEDA 4HROA 5HG2A 1ZOYB 3W5VB 2BW2A 4YSYB 3HVZA 3AE8B 3AEBB 1V1PB 2INPE 5D7GA 2WDVB 3FC4A 3RFZB 1I4GA 1CZPA 4P6VF 3AE9B 1SJHD 2M56B 3EA6A 4JPSA 2QMTA 3B2GA 4ZHPA 2PVOD 4US9A 4ZRQA 1PGBA 1XEEA 2DBYA 1PFDA 2YEPF 5I4DA 3R8BA 1QQRA 2LEKA 2DYMA 1JWUD 3FILB 2K22A 3WCQA 3AEGB 1A70A 1QOBA 1F2RI 1HQRD 3IAS1 2JXTA 1B9RA 2Y5CA 2V0GA 1FM0D 2D5GA 1D6EC 2M19A 2E3TA 2CJOA 2BS4B 1T6BX 4LTUA 1V8CA 2B76B 1YQ3B 1OQRA 2MJDA 3CWIA 4ZHOA 1NENB 1TKGA 4Q2JA 3ZJTA 2WNMA 4WAFA 2LMCA 4ARIA 2X38A 4OVZA 1E0ZA 2JYEA 3PZ8A 1TS4A 2KACA 2L32A 2L1AA 2FUG1 3BZDB 3BYYB 4DQOC 3AN1A 1ZUD2 2FBWB 2MH7A 3MC0B 4N6EB 2MJ3A 4A90A 4KX6B 1N62A 1GTEA 1HXYD 2NTTA 1ZXHA 1N61A 2WXHA 4P16A 2WDRB 1STEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JRP A;  1H7X A;  3AE3 B;  1QOF A;  2HTM E;  1GT8 A;  3AE5 B;  3VRB B;  3AEA B;  3P4Q B;  1FFV A;  1WXQ A;  3AED B;  1E10 A;  3ABV B;  2K9X A;  4WQM A;  3AE4 B;  1DGJ A;  3AV8 A;  3RPF C;  4C80 A;  1FIQ A;  4ZHO A;  1FO4 A;  3AEC B;  3AB5 A;  3LXF A;  2BS2 B;  1XLO A;  4US8 A;  1WRI A;  1VLB A;  2CJN A;  2G1E A;  1ROE A;  1FXA A;  1XLN A;  2W54 A;  1SIJ A;  1QOA A;  4YSZ B;  1J7A A;  1L6V A;  2OHF A;  4ITK A;  1FRD A;  4YTP B;  3DWG C;  2Q5W D;  1YQ4 B;  1JWB D;  4JWU C;  1JAL A;  3AE7 B;  1NVI D;  4IDI A;  2W3R A;  1J7B A;  2WP9 B;  3CIR B;  2JQR B;  1QOG A;  1TKY A;  1OFF A;  3AEE B;  5EE1 A;  1J7C A;  1FMA D;  1NYR A;  2KMM A;  2AX5 A;  4YTN B;  1ZP0 B;  4YXD B;  3HRD D;  2L83 A;  1ZXI A;  3AH7 A;  5AUI A;  3SFE B;  1GAQ B;  1SB3 C;  3AE6 B;  2N0S B;  1L0V B;  1JRO A;  3NVW A;  4JWS C;  4USA A;  1I7H A;  4A9A A;  3PO0 A;  1VJK A;  4WWM A;  4C7Z A;  2PVG C;  3NVV A;  1PDX A;  3B9J A;  1JQ4 A;  1N63 A;  2WU2 B;  1WYG A;  3ZYY X;  1NEK B;  2WDQ B;  1L5P A;  3AM9 A;  2PKO A;  1XLP A;  5MPO A;  3P4S B;  5H92 C;  2KAJ A;  1QT9 A;  1CJE A;  1N5X A;  1OQQ A;  1VDV A;  3HUI A;  4N58 A;  4HRO A;  1ZOY B;  1N5W A;  3W5V B;  1RWS A;  3W5U B;  4C7Y A;  1RM6 C;  3P4P B;  1AWD A;  3NVY A;  4YSY B;  2MJE A;  3HVZ A;  3AE8 B;  3AEB B;  1GTH A;  4ZOH C;  3P4R B;  2WDV B;  3EUB 2;  3FC4 A;  3NRZ A;  1CZP A;  4P6V F;  5G5H A;  3ETR A;  3P63 A;  3AE9 B;  1E9M A;  2M56 B;  4N59 A;  3B2G A;  3NVZ A;  1TKE A;  4ZHP A;  2PVO D;  4US9 A;  1QF6 A;  1PUT A;  3VR8 B;  1SF0 A;  1WGK A;  3DWM A;  3SR6 A;  2BT6 A;  2DBY A;  2W3S A;  1PFD A;  3LB8 C;  2WLB A;  2LEK A;  1V97 A;  1AYF A;  1FFU A;  3AEF B;  3VR9 B;  1UWM A;  2K22 A;  3AMZ A;  3AEG B;  1A70 A;  1QOB A;  4HRS A;  3WCQ A;  5GXG B;  5G5G A;  4YT0 B;  5C3J B;  2BS3 B;  1H7W A;  1E6E B;  2ACZ B;  1DOI A;  1N60 A;  1JW9 D;  2WU5 B;  2W55 A;  1FM0 D;  2H88 B;  2PIA A;  2Y5C A;  3FAH A;  1B9R A;  3AE1 B;  1RFK A;  1XO3 A;  2M19 A;  2CJO A;  1L6U A;  2E3T A;  2BS4 B;  2WQY B;  4LTU A;  1V8C A;  2B76 B;  3L4P A;  5EE0 A;  1T3Q A;  1YQ3 B;  1OQR A;  1E7P B;  2MJD A;  5C2T B;  3CWI A;  1NEN B;  4JX1 C;  1TKG A;  5EE9 A;  1YJI A;  1R7S A;  2QIE B;  1EWY C;  5EE3 A;  1KFY B;  1FRR A;  2EKI A;  2L52 A;  2QJL A;  1E0Z A;  1TJE A;  3P1M A;  3NS1 A;  2CU3 A;  2JX5 A;  1QLB B;  3CF4 A;  5AUK A;  1DOY A;  1GPX A;  3VRA B;  3AE2 B;  5H8Y E;  1FXI A;  3AN1 A;  1ZUD 2;  4YTM B;  1KRH A;  1JWA D;  1NI3 A;  1NYQ A;  4FXC A;  2FBW B;  4YSX B;  2MH7 A;  4N6E B;  1WWT A;  2MJ3 A;  3BII D;  2WS3 B;  4KX6 B;  1IUE A;  1N62 A;  3B2F A;  3KWL A;  1GTE A;  3W9C B;  1DOX A;  2H89 B;  1TYG B;  1KF6 B;  1N61 A;  1RYJ A;  1XLQ A;  2DWQ A;  1F0Z A;  2K5P A;  1YJJ A;  2WDR B;  3SFD B; 
#chains in the Genus database with same CATH topology
 2KJ6 A;  4GDL A;  4LNN A;  4B6W A;  2V3S A;  3NZU A;  2KC2 A;  3AV8 A;  3FKY A;  1F9J A;  4WWP A;  1TGZ B;  3QX1 A;  3SR6 A;  3ZJV A;  4JWU C;  3TL5 A;  1J7B A;  2AQ3 B;  1ZE3 D;  2BYT A;  3EEC A;  1J7C A;  2BYV E;  4GOC A;  4ZRJ A;  4ZYS A;  2DNF A;  4XE0 A;  1HEZ E;  2BPS A;  2NMQ A;  2WU2 B;  4EKU A;  4E71 A;  1TY2 A;  1TT5 B;  3Q8E A;  5JXV A;  2JT4 B;  2D3A A;  4BKS D;  1F2R C;  5JZE B;  2IGG A;  4TSS A;  2KT7 A;  4PYU A;  3EUB 2;  4FAD A;  4WJP A;  5LXI B;  2DYB A;  3ZXR A;  4WJQ A;  1HZ5 A;  2ONQ A;  2AL3 A;  1ZKH A;  3HVD A;  1JWM D;  4MJS B;  4BZA A;  4K3B A;  3R7R A;  1R4M I;  3VR8 B;  2GI9 A;  2JXX A;  1PQS A;  4GDK B;  3UI3 A;  1SIF A;  2WXL A;  1CK1 A;  2K8C A;  2IYD B;  3PZ7 A;  5GXG B;  4IM3 A;  1CQV A;  1E6E B;  2BKR B;  3OAW A;  4BFR A;  4IUM B;  2EMS A;  1ZDX A;  1K50 A;  4ZDV A;  2WQY B;  1ZPS A;  2FCM A;  1NBF C;  1UBQ A;  2HDE A;  2ZJD A;  1EWY C;  2RMM A;  3HM6 X;  3A1Q A;  2V4I B;  4HPM B;  4WJO A;  4AUQ C;  4BKS A;  2QEJ C;  2LFI A;  2IO1 B;  1KRH A;  1NYQ A;  4YSX B;  3ZNI D;  3TBL D;  3B08 A;  2G9H D;  4RFB A;  3WAM A;  1E7U A;  2KDB A;  2D10 A;  2KJR A;  3ABV B;  1EM7 A;  1C4P A;  4AP4 C;  3QIJ A;  1R4N I;  4US8 A;  1WRI A;  2WXN A;  3ZNZ B;  4YSZ B;  2PMV A;  1YD8 U;  2N1W A;  2MRP A;  4J3O D;  1GNU A;  3KUC B;  1TKY A;  3WAP A;  4EE2 A;  2WXF A;  2OJW A;  2W9N A;  4ASW C;  3PSE B;  3SHQ A;  5D3D A;  4RH6 A;  2FCS A;  3PO0 A;  4B0E A;  3M63 B;  2LGX A;  1RLF A;  2MBQ A;  1JRU A;  3IAM 1;  2WXI A;  5IN7 A;  4W9I A;  2J52 A;  1I4P A;  2IY1 B;  4FHK A;  3U8Z A;  2JY6 A;  4RGM A;  1WSP A;  3T3N A;  1I4H A;  5TSS A;  3KQ4 A;  4W9D A;  4GDK A;  4A8X C;  1FFU A;  2K1F A;  4C00 A;  3WAL A;  2MBH A;  4P1B C;  5G5G A;  2BS3 B;  1H7W A;  1JW9 D;  4WJN A;  4NAM A;  4HPP A;  5JHA A;  3TEW A;  4WWN A;  2D3B A;  1IBX B;  1ZDV A;  2C7H A;  1R4M B;  1WR6 E;  4KZ0 A;  3AUL A;  2L52 A;  3NHE B;  2KOX A;  2N1V A;  2LHE A;  1WZ3 A;  2INN E;  4DXA B;  2ZZP B;  2C60 A;  1FXI A;  3IHP C;  1WJN A;  3H1U A;  1PGA A;  2K3U A;  3W9C B;  4L1B A;  2K25 A;  3ZTD A;  5BMH A;  1EWC A;  1P0R A;  2WXR A;  1F0Z A;  5TR5 A;  2K5P A;  4II2 B;  4DWF A;  1TBE A;  3VRB B;  2NR2 A;  5E6J A;  1E10 A;  3AED B;  2JYT A;  3L16 A;  4RCO A;  3RI7 C;  3PHW B;  1TY0 A;  3C19 A;  3Q6B A;  4ICU A;  2JZZ A;  2CJN A;  4DHZ B;  2BB6 A;  2W54 A;  1SIJ A;  4F7Z A;  2I2Y A;  2AQ2 B;  1I4R A;  2AYO B;  3ZUN A;  1NVI D;  1WE7 A;  3CIR B;  1LQB A;  3GP7 A;  1Q1O A;  1UGM A;  4YL8 A;  1FMA D;  4HJG E;  3SD5 A;  3V6C B;  1R4N B;  2D3C A;  4EUT A;  4NY0 A;  1JRO A;  3B1L X;  4USA A;  1SSN A;  3ZRC A;  1JQ4 A;  2GRI A;  1D4B A;  2LUE A;  2BWE S;  2KWC A;  4RGT A;  3P4S B;  3I5J C;  1HE8 A;  1I4Q A;  4IKG A;  2JPH A;  3C8Y A;  1V5O A;  2MP2 B;  3OJ3 A;  4NAW B;  1WJ4 A;  2BGF A;  5LNK 1;  1UUP A;  2IND C;  4NQK E;  1E90 A;  1KTK A;  5CHF A;  5L83 A;  5IKC M;  3AU5 A;  3NOB A;  2ACZ B;  1UGJ A;  2IO0 B;  1TS3 A;  3ML9 A;  3U2S C;  1MI0 A;  4HXD A;  3VUY A;  4IG7 B;  2LJ5 A;  4OVV A;  5EE3 A;  2ASQ A;  4EZJ A;  2KYW A;  3URY A;  2CU3 A;  1GPX A;  1LM8 B;  2BTE A;  2MEK A;  1WH3 A;  1L0X B;  3W1Y A;  3T8M A;  3B2F A;  1D5M C;  2KMC A;  3N20 C;  5G2N A;  4ACF A;  3AE4 B;  2SAK A;  5IO9 A;  3RUI B;  3A9K A;  3PS6 A;  3Q3F A;  1GJZ A;  3W1S C;  2WXO A;  1IGC A;  1YQB A;  3TUO A;  5FR3 A;  4GMV A;  3W1S A;  3U7D A;  3B0A A;  4A55 A;  2K39 A;  5EDS A;  5HFY A;  3VTV A;  1SBB B;  1C9F A;  3NVV A;  3UF8 A;  3B9J A;  3L08 A;  1WIA A;  3PTF C;  3FIL A;  3RNC C;  3ZLZ A;  2WDQ B;  1C76 A;  3J9C A;  1C77 A;  3KYD D;  2L0F A;  1RFA A;  2KX0 A;  4W9C A;  2CU1 A;  4YSY B;  1V1P B;  2INP E;  2WDV B;  3AE9 B;  2M56 B;  3B2G A;  3O65 B;  5DPR A;  2D2Q A;  4ZHP A;  4X57 B;  1XEE A;  1L7Y A;  1QQR A;  2LEK A;  2DYM A;  2MX2 A;  3L10 B;  4FJY A;  5DPW A;  1A70 A;  2KQ7 A;  1F2R I;  3IAS 1;  4M00 A;  2V0G A;  4LNO A;  2NS5 A;  4I6N B;  4JQW C;  1YQ3 B;  4EOY A;  2WNM A;  2LMC A;  4OVZ A;  1E0Z A;  4C4V A;  4WWO A;  2L8J A;  1ZW7 A;  3APF A;  3PZ8 A;  4M8N A;  3AXC A;  3AN1 A;  3MJW A;  3ZDT A;  2WWZ A;  4A90 A;  4N6E B;  1XD3 B;  1N61 A;  2WXH A;  4PS3 A;  2BVC A;  5L95 C;  3BK2 A;  3N32 A;  2JSV X;  2OJR A;  3KUZ A;  4ITK A;  1C79 A;  3UIN B;  4OZA A;  3R7Q A;  3VUX A;  2KX3 A;  3AE7 B;  1QOG A;  5BMI A;  1WM2 A;  4YXD B;  2NBV B;  1SE2 A;  1Z2M A;  3N30 A;  4HVB A;  1L0V B;  4OHJ A;  1C4C A;  1FXT B;  4DHJ B;  1C78 A;  4P1C C;  3ZNH B;  3RCZ A;  1Z5S B;  1EUV B;  3SU8 X;  1J8C A;  4LNK A;  2VZK D;  1LO5 D;  3Q8B A;  1L0Y B;  2ZCC A;  3TJP A;  3I9V 1;  2KHW B;  4KGT A;  5E6P A;  3ETR A;  4A3P A;  1J19 A;  4OW0 A;  3Q8C A;  5IAA C;  4KGS A;  1UD7 A;  5D2M B;  5E6N A;  4L23 A;  1L4Z B;  4XYC A;  1Y56 A;  3WA0 A;  4I6P A;  1V97 A;  1MG8 A;  3JYU A;  1Y8R C;  4NJC A;  1VZ6 A;  2NPT A;  4KZC A;  2XNA C;  2Y3A A;  3RNE C;  2QIE B;  4K7W A;  1KFY B;  2QJL A;  4ZRI A;  1SXT A;  3P1M A;  2MBE A;  3DHI C;  2IGH A;  3VTU A;  3A4S C;  4HCN B;  4PT5 A;  4YTM B;  1ENF A;  4C56 C;  1ACC A;  3H7P B;  3NZ3 A;  1BML C;  2KTF A;  4AJY B;  4TMA B;  3KLS X;  4FJZ A;  1TS5 A;  1MJD A;  3RZW C;  2BS2 B;  3A1Q B;  2G1E A;  1ROE A;  2G4D B;  4XX5 A;  2CKH B;  1VCB A;  1NDD A;  3KW5 B;  1HA5 A;  5LLI A;  2WXJ A;  2LZ6 A;  2AQ1 B;  4RF1 A;  2FCQ A;  1MFW A;  3IT6 B;  2N9E B;  1VJK A;  2KFK A;  3ENE A;  4C7Z A;  1MVK A;  4MEL A;  4URK A;  1WYG A;  4KDL B;  2V9H A;  1VR9 A;  1XT9 B;  3AM9 A;  2AEH A;  4GIV A;  3X23 A;  1QT9 A;  4N58 A;  4FJV B;  2Z0E B;  3MC8 A;  4XDC A;  5HI1 A;  2RPV A;  4HCP B;  2LVQ A;  1WGD A;  4GN1 A;  2QCZ A;  2X8X X;  1SGH A;  2KMA A;  4GGQ A;  3V6E B;  1PUT A;  1LFD A;  2BT6 A;  2I1J A;  3N9Y C;  1WZ0 A;  2EEL A;  1K53 A;  4M02 A;  1X1M A;  3ML8 A;  1N6Z A;  2IDY A;  1N60 A;  3IT4 B;  1L6U A;  1IYF A;  3CMM B;  2IJ0 A;  1YNT E;  1WRD B;  1EF5 A;  2EKI A;  2O2V A;  2GMI C;  3VRA B;  1WXS A;  1JWA D;  1D3Z A;  1WWT A;  2MQJ A;  2BQQ A;  3H7P A;  1TYG B;  1KF6 B;  4MSM B;  1P9D U;  2BYE A;  2N7D A;  1H7X A;  3AE3 B;  2HTM E;  2NCN A;  4PYZ A;  2WXG A;  2J42 A;  4C80 A;  3AEC B;  1KOT A;  1YX5 B;  4WH4 A;  4FUL A;  4W9L A;  4HLE A;  1V49 A;  3LYY A;  1KLU D;  4REZ A;  2PLP A;  4W9H A;  3E9S A;  3GB1 A;  2JUO A;  2FNJ B;  3A9J A;  1OFF A;  5D6J B;  1WI0 A;  2DAJ A;  2C5L C;  1SB3 C;  4DXG A;  1UNS A;  3X0W A;  3UIO B;  1L2N A;  1V86 A;  2JWZ A;  1GUA B;  4EZK A;  3ZW3 A;  2PE9 A;  3MC9 A;  2DYO A;  1KLG D;  3IVF A;  4TQ0 A;  3PVL A;  2Z8L A;  1NI2 A;  2G4S A;  3BYT B;  2WXK A;  1XF5 L;  1N5X A;  1OQQ A;  3HUI A;  1KLV A;  3VHT C;  4C7Y A;  2MJE A;  2JRH A;  3KUD B;  1T0S C;  3DBS A;  3O13 A;  1ESF A;  2RDB C;  2XEW A;  2RDG A;  3P63 A;  4N59 A;  4HEA 1;  1K52 A;  1WY8 A;  3VQI A;  2KJH B;  4A3O A;  1WJU A;  2WLB A;  4GB9 A;  1AYF A;  4WAA A;  3QCA A;  1UH6 A;  4YT0 B;  5AZH A;  3VH3 B;  1GOZ A;  1KJT A;  1XXG A;  2VH2 A;  2WU5 B;  3FAH A;  2H88 B;  4KKJ A;  1XO3 A;  1J0G A;  3LDZ E;  5EE0 A;  4JIO U;  2C7N B;  2TSS A;  4K3C A;  2I1K A;  2DEN B;  2WGS A;  2MA9 B;  2JF5 A;  1WMH B;  4K1R B;  2BF8 B;  1GB4 A;  3ZDM C;  2WS3 B;  2J53 A;  2ZW0 A;  1FCL A;  1YJJ A;  3BVG A;  1WXQ A;  1FFV A;  4KVG B;  5KHO A;  2HE7 A;  1AW7 A;  1FIQ A;  3DQV A;  4WIP A;  1V1O A;  5D94 A;  1J7A A;  4ANX A;  3PRZ A;  3T3O A;  2KDM A;  3ZXV A;  1B1Z A;  2W3R A;  1ISN A;  1OQY A;  2QHO A;  4YTN B;  3P2B A;  4XWW A;  4AQ7 A;  4B95 A;  3AE6 B;  1SE4 A;  1I7H A;  4MGK E;  2MWS B;  3A33 B;  4PS8 A;  2ZW1 A;  2PJH A;  2QIL A;  3TEZ A;  1TZO A;  3A9K B;  1I4X A;  3R2T A;  5CTR C;  3UQA A;  1EO6 A;  2KLC A;  3VFK A;  3EFU A;  1VDV A;  5HG2 A;  1ZOY B;  5JH5 C;  4FHJ A;  3DPD A;  4BAX A;  3AEB B;  2XK5 B;  2WYQ A;  4JLC A;  2O6V D;  2RPQ A;  4W9F A;  4P6V F;  3PT2 B;  2PVO D;  4US9 A;  3M62 B;  3QA8 A;  2DBY A;  2YEP F;  3R8B A;  5C23 A;  1JWU D;  3FIL B;  2K22 A;  1QOB A;  1B9R A;  1FM0 D;  5KHQ A;  2L76 A;  2ZVN A;  1E8X A;  1V8C A;  2B76 B;  4G3X B;  3CWI A;  4ZHO A;  2MJD A;  1TKG A;  4ARI A;  2X38 A;  2JRI B;  3QAR A;  1WMH A;  4G11 A;  1TS4 A;  2KAC A;  2FUG 1;  3BZD B;  4KIK A;  3BYY B;  2LI5 A;  4G0N B;  3ONS A;  3L54 A;  2MH7 A;  2O6V A;  1N62 A;  3DVG X;  1GTE A;  4G50 A;  2WDR B;  2JVC A;  3Q69 A;  2K8H A;  3AE5 B;  3AEA B;  4S0R A;  1P98 A;  1H8C A;  1QIL A;  5BYR A;  4C4V B;  3BVM A;  2OHF A;  1FRD A;  2EMT A;  4N9F 4;  3VUW A;  4ARC A;  1C4A A;  5EE1 A;  1EU4 A;  2ZVO A;  1ZXI A;  3AH7 A;  3UQB A;  2MSE D;  1GAQ B;  1SEB D;  2GBJ A;  4WWM A;  1WE6 A;  4IM0 A;  1NEK B;  2RDH A;  4F8C B;  5MPO A;  2CHZ A;  5J2R A;  1XCQ L;  1AAR A;  3VH4 B;  1RM6 C;  3P4P B;  1PYW D;  2XK5 A;  2WXM A;  4JE3 B;  4DK5 A;  3MP9 A;  3TSS A;  4ICV A;  2L05 A;  2HJ8 A;  2KAN A;  2ZCB A;  1QF6 A;  4GU2 A;  3IXS A;  2VH1 A;  3RN9 C;  5JHB A;  3VR9 B;  3LJ3 A;  4MGI E;  1VRA B;  2WX0 A;  4K7U A;  2LXC A;  4AJW A;  3AU4 A;  3U7Z A;  2W55 A;  4MGZ E;  4OZB A;  1RFK A;  4MDK E;  3VTW A;  2YVC A;  3MHZ A;  1SJE D;  3Q8A A;  2IZV B;  3NG0 A;  3APD A;  2BB5 A;  1DOY A;  4B9K A;  1FNU A;  1YIW A;  2YLM A;  4XC2 A;  1IUE A;  4W9E A;  1A5R A;  1WXM A;  2NPT B;  2R2O A;  1TZ1 A;  2BWF A;  2IO2 B;  1YOV B;  4RM8 A;  4LNI A;  3HIZ A;  2DZJ A;  2KWD A;  4RGO S;  2VZK B;  1QOA A;  2JZP A;  4NQL B;  3VXW A;  2KC1 A;  4RGN A;  4DXF A;  4J6I A;  3KVF B;  2J7Q B;  2R61 A;  2KMM A;  1LXD A;  1BUI C;  2GBK A;  2FID A;  4ANU A;  2N7J A;  3A4R A;  3HK0 A;  1D5Z C;  1UEL A;  2LWP A;  2VRR B;  4NNJ B;  3RD2 A;  2KK8 A;  2PKO A;  2W82 A;  2LUM A;  3S2A A;  2ZPY A;  4IWO A;  3EFC A;  4BOZ B;  5FKA C;  3P4R B;  4HKQ A;  1T0Y A;  3VDZ A;  3PRE A;  1I42 A;  3VVW B;  2M8S A;  3NUH B;  4TV3 A;  2KFK B;  1SF0 A;  2LHD A;  3DWM A;  3Q8F A;  2W3S A;  4RNA A;  3WIM A;  3TMP B;  5IA7 A;  1UWM A;  1YMH E;  1WX8 A;  3ZKJ C;  2D3G A;  2Y5P A;  3L0W B;  3PHX B;  2E6X A;  2PIA A;  4ANV A;  2KTR A;  3GOE A;  3T9L A;  3RNF C;  1E7P B;  5C2T B;  3C0R B;  1YJI A;  2K8B A;  2KNB A;  3DHH C;  5J17 A;  2K0P A;  2PE6 B;  3ZGZ A;  3CF4 A;  1FNW A;  5CHW A;  2UWQ A;  4MT5 A;  4D2K A;  2K6Q A;  1JWS D;  1VZ7 A;  4YWG G;  1WR1 A;  1C1Y B;  1RYJ A;  3PV1 A;  4JL9 A;  4XZ4 A;  3E56 A;  2QSD A;  2IY0 B;  4WQM A;  2RR9 A;  1DGJ A;  2KDF B;  2GBN A;  1F77 A;  2AWT A;  4H2A A;  5FR6 A;  2O2V B;  1V6E A;  1L6V A;  3BWU D;  3Q3O C;  4BVU C;  2J0K A;  4FN2 A;  2D07 B;  2G45 B;  5BYS A;  3DBR I;  3L13 A;  2LGI A;  1NYR A;  1GC6 A;  2AX5 A;  4ANW A;  2L83 A;  4ZRK A;  5AUI A;  1Q10 A;  2NVU I;  3QHT A;  3U52 E;  5HHD G;  1HZ6 A;  2KQ4 X;  1P1A A;  2RGF A;  3PRM B;  2CHX A;  2PVG C;  2XBB C;  5AZF A;  2IGD A;  1MPE A;  2PPH A;  3I3T B;  1H4R A;  2C7M B;  2GBR A;  2KAJ A;  2KVZ A;  3OJ4 B;  3PPA A;  4A6Q A;  4AOF A;  4M0W A;  1RWS A;  3H7S A;  3NVY A;  4ZOH C;  2V3P A;  3CST A;  3A9J B;  4FA6 A;  3NRZ A;  4MH8 A;  2DZK A;  4WUR A;  1U4A A;  1E5W A;  3GZN B;  3TCA A;  1TKE A;  4HK2 A;  1WF9 A;  4EEW A;  2KFJ A;  4A20 A;  4HRS A;  1AN8 A;  1QKZ A;  1V9J A;  5G55 A;  3NVW A;  4TUU A;  3PGE A;  3AE1 B;  3ZVV A;  4MM3 A;  1SE3 A;  4P7I A;  5E6O A;  4BKG A;  3KWV A;  4PS7 A;  4NZL B;  5DPS A;  1R7S A;  1WYW B;  5LXH A;  3ZRF A;  2JWU A;  4AWJ A;  4E74 A;  2NBW B;  3RNB C;  1GC7 A;  2JX5 A;  3V61 A;  1GG3 A;  1FCC C;  1EU3 A;  2ICI A;  5AUK A;  3QJZ A;  1UWX A;  2N7E A;  3ECI A;  1NI3 A;  1KH0 A;  3OG5 A;  2M0X A;  1DOX A;  2H89 B;  5AEK B;  1XLQ A;  3H6N A;  3I63 C;  1M94 A;  1V5T A;  1K51 A;  4EFO A;  2LXA A;  4OVU A;  4BKT A;  2LVO A;  2KWU B;  2CR5 A;  4E3C A;  1FO4 A;  3MJ5 A;  4DBG A;  1VLB A;  2IPK D;  2YEP B;  3APC A;  4IC7 B;  3HM3 A;  4GLS C;  2WP9 B;  4KGR A;  1ZP0 B;  4DDI D;  4FLH A;  3BK1 A;  4XWT A;  2WHI A;  4A9A A;  3JSV A;  4KV2 A;  3DVN V;  4KDI C;  3IFW B;  3DBH I;  1N63 A;  2GBM A;  3PRP B;  3DBR B;  1L5P A;  2KN4 A;  4II3 B;  1T0R C;  1XLP A;  2AL6 A;  4RM9 A;  4L2Y A;  1MHX A;  2OED A;  2N9P C;  2Z59 B;  3W5V B;  2BW2 A;  3JW0 X;  3N1Y C;  3HVZ A;  3AE8 B;  3MTN B;  3ZIM A;  1CZP A;  3QAQ A;  1UF0 A;  4IM2 A;  1SJH D;  2QDF A;  2FCN A;  1E7V A;  1Q0W B;  2D11 A;  4ZRQ A;  1PGB A;  3ZNG C;  3PLU A;  1PFD A;  3K9O B;  5I4D A;  3L17 A;  4BOS C;  3AEG B;  3RNG C;  1HQR D;  1OTR B;  2DAF A;  3IBE A;  2FIF A;  4HPL B;  2D5G A;  2KLG A;  2M19 A;  2E3T A;  3R66 C;  2CJO A;  1BT0 A;  2BS4 B;  4LTU A;  2L00 B;  4Q2J A;  3ZJT A;  4WAF A;  2WDT B;  2ZNV B;  2JYE A;  2L7R A;  4TKN A;  2CS4 A;  4DQO C;  1E8W A;  2KDE B;  2V1Y A;  2KXJ A;  3EHV A;  2MJ3 A;  4KX6 B;  1HXY D;  2NTT A;  1ZXH A;  2LGD A;  2MCN B;  3DDC B;  1STE A;  2K9X A;  1TTN A;  2DZI A;  1P7F A;  1FEH A;  1EF1 A;  4FBJ B;  2JU6 X;  1FPY A;  4EZL A;  1BXT A;  2KN5 A;  4KKI A;  3PZD A;  3QQ8 B;  4HDQ A;  4HWI B;  3N1Z C;  4KIK B;  1JWB D;  3I57 A;  1WGY A;  1WGG A;  1VZ8 A;  2O6V B;  4F1S A;  3CF6 E;  3RZF A;  1Q5W B;  4HJK A;  4PK1 A;  3H8H A;  2QC8 A;  3SFE B;  4CYE A;  2EKE C;  4MJS A;  3WAN A;  2L0T A;  1JML A;  2OOB B;  3KYC D;  3RUL A;  3DHG C;  2LJI A;  1VD2 A;  1JCK B;  1YN3 A;  2J0M A;  3HHM A;  2M0A A;  3ZQ4 A;  1N5W A;  4LLG M;  3W5U B;  3TEX A;  3PLV A;  3DBH B;  1K8R B;  2B3A A;  4IWQ A;  2JZ3 B;  3CSF A;  4MSQ B;  3DOW A;  3V3X A;  3GS2 A;  4M8M A;  4NJ6 A;  5C3J B;  4QAY A;  1WXA A;  2LD9 A;  2SEB D;  2ZNV C;  1P3Q U;  1E8Z A;  2WXP A;  4MGY E;  3DBL I;  4JX1 C;  3BY4 B;  1M4V A;  4NPN A;  5DPT A;  1FRR A;  1WXV A;  2DLB A;  1XCT L;  1QLB B;  1ET9 A;  3AE2 B;  3IG3 A;  4O1N A;  2HJ1 A;  2M17 A;  1HTQ A;  3OLM D;  4CQN A;  1TS2 A;  3NJT A;  3GE3 C;  3R2I A;  2DWQ A;  3M95 A;  4TQ1 A;  5IOI A;  1YX6 B;  2WX1 A;  4XDD A;  2BYF A;  1PGX A;  2KKC A;  2ON8 A;  3LXF A;  3M3J A;  1XLO A;  5J18 A;  2NTS A;  2MBO A;  3DVG Y;  4YTP B;  4B0M A;  1UBI A;  3RNA C;  1JAL A;  4IDI A;  2RSU A;  5HKH A;  3AEE B;  1P7E A;  3HRD D;  3V05 A;  1S1Q B;  1HTO A;  2NBU A;  4LDT B;  2KD0 A;  4MH0 E;  4JWS C;  5C1Z A;  4K81 A;  2Y5B B;  1G6J A;  2KVR A;  1I35 A;  2DHZ A;  5T8I A;  5FK9 C;  3RYT A;  3ZJU A;  2MHJ A;  3K9P B;  2I38 A;  1YN4 A;  3RMK C;  1OGW A;  1FD6 A;  2FAZ A;  1IBX A;  2PTL A;  1WGR A;  4JGH B;  1SE9 A;  4HDO A;  4GSW A;  1DYQ A;  1E9M A;  4W9K A;  5D3I B;  3NVZ A;  5GMV A;  1WGK A;  1CMX B;  1V81 A;  2REX A;  2C9W B;  4DHZ E;  1V80 A;  4UDU C;  5AZG A;  3UIP B;  4LJO B;  2INC C;  1F1H A;  1FNV A;  4AS1 A;  3NZS A;  3MFG A;  4HKZ E;  5EE9 A;  3Q3M C;  3ZTC A;  2UU7 A;  1MHH E;  1T0Q C;  3TEY A;  4CO7 A;  4LDT D;  3DVN U;  5H8Y E;  4OZC A;  3P42 A;  2IO3 B;  1ET6 A;  3BII D;  4GXB A;  3KWL A;  3DBL B;  2V3N A;  4RF0 A;  2LRW A;  1LGR A;  2MW5 A;  2J0J A;  2KTR B;  2FUH B;  3SEB A;  1YJ1 A;  3RPF C;  1F52 A;  1QZE A;  4IWP A;  1XLN A;  1IP9 A;  1C3T A;  3GE8 C;  1RAX A;  4CHK A;  3OWE B;  3V60 A;  2G3Q B;  5CX3 A;  1WM3 A;  4RMA A;  2MP2 A;  4NAW A;  3UGB B;  2GOW A;  4K7S A;  4W9G A;  2KO3 A;  2LGY A;  2Z0D B;  2GLS A;  1D5X C;  1ZGU B;  2PEA A;  3QK0 A;  1IPG A;  4BBN C;  5H92 C;  4ZYN A;  2XN9 C;  3Q3J A;  2IBI B;  3W2D A;  1AWD A;  2HTH A;  3ZO5 B;  1GTH A;  3ALB A;  2BKF A;  4W9J A;  5DCN A;  5G5H A;  1WFY A;  3BVZ A;  1E8Y A;  1WGH A;  2WXQ A;  1T5X D;  2LAS A;  3LB8 C;  5BYQ A;  3AEF B;  2KWV B;  3AMZ A;  2ZPN A;  3GZN I;  4LJP B;  1DOI A;  1S3S G;  2R2Q A;  4M0W B;  2DX5 B;  2N9K A;  1V2Y A;  3N1X C;  3QWZ B;  3L4P A;  2PW9 A;  1T3Q A;  1GB1 A;  1WX9 A;  5BMG A;  4S17 A;  1WJ6 A;  2UYZ B;  1TJE A;  3NS1 A;  2J4X A;  2LGS A;  3D32 A;  3U30 A;  2HD5 B;  5IP4 D;  2DZM A;  4FXC A;  2K6D B;  2GB1 A;  2M1M A;  3DCG A;  4LK0 M;  2FE8 A;  3EGR A;  4KSL C;  2L3Z A;  4LNF A;  3RT3 B;  1JRP A;  1QOF A;  1GT8 A;  4GDL B;  4MM3 B;  3P4Q B;  1OEY A;  2A4Z A;  3BIN A;  2MBB B;  3AB5 A;  2KQS A;  4ZRP A;  3R3M A;  1FXA A;  4R3D A;  2BBC A;  2KZR A;  3DWG C;  2Q5W D;  5BO4 B;  1YQ4 B;  1KM7 A;  1IGD A;  3Q2A C;  2JQR B;  1V1P A;  1YN5 A;  2M4N A;  4MAC A;  4M01 A;  2N9L A;  2LRU A;  4BBN F;  3U4E G;  2N0S B;  4IOI E;  1L4D B;  1RRB A;  3Q14 C;  1PDX A;  3TIX A;  3ZYY X;  4DDG D;  3JVZ X;  3NS8 A;  3VAW A;  1XQQ A;  3N3K B;  1CJE A;  4HRO A;  2A5U A;  4XGA B;  3RFZ B;  5D7G A;  3FC4 A;  3Q3N C;  1I4G A;  3MHS D;  3EA6 A;  4JPS A;  2QMT A;  3JSV B;  5CHV C;  3KH0 A;  2N9X A;  4DHJ D;  2V4L A;  3WAO A;  3WCQ A;  2JXT A;  3V62 A;  2Y5C A;  3EC8 A;  1D6E C;  1T6B X;  4MEM A;  2CHW A;  4KSK C;  3H9D A;  1OQR A;  1NEN B;  4I6L B;  2RD0 A;  4NJ7 A;  1MG4 A;  4LCD E;  1UZX B;  2LVP A;  3AI5 A;  4WQO B;  2KDI A;  2L32 A;  2L1A A;  4IW0 A;  3NY5 A;  1WX7 A;  1OEY J;  1TIF A;  3QC8 B;  1ZUD 2;  3SDL C;  2FBW B;  3MC0 B;  2MLB A;  2ZEQ A;  2N4F A;  4P16 A;  3SFD B; 
#chains in the Genus database with same CATH homology
 3Q69 A;  3AE5 B;  3AEA B;  2K9X A;  3BK2 A;  3AV8 A;  1P7F A;  2JSV X;  1FEH A;  1QIL A;  5BYR A;  2JU6 X;  3SR6 A;  3BVM A;  1BXT A;  2OHF A;  4ITK A;  1C79 A;  4KKI A;  3ZJV A;  1FRD A;  4OZA A;  1JWB D;  3I57 A;  4JWU C;  3AE7 B;  4ARC A;  1J7B A;  1VZ8 A;  2AQ3 B;  1ZE3 D;  2BYT A;  1QOG A;  1C4A A;  5EE1 A;  1J7C A;  1EU4 A;  5BMI A;  4YXD B;  3H8H A;  1SE2 A;  1ZXI A;  3AH7 A;  3SFE B;  1GAQ B;  1SEB D;  1L0V B;  4ZYS A;  4OHJ A;  1JML A;  4XE0 A;  1C4C A;  1HEZ E;  4WWM A;  1C78 A;  2NMQ A;  2WU2 B;  1NEK B;  1TY2 A;  2RDH A;  2LJI A;  5MPO A;  3Q8E A;  1JCK B;  5JXV A;  1YN3 A;  2VZK D;  1XCQ L;  1LO5 D;  2M0A A;  3Q8B A;  3ZQ4 A;  1N5W A;  4LLG M;  1L0Y B;  3W5U B;  1RM6 C;  3P4P B;  1F2R C;  1PYW D;  3I9V 1;  2IGG A;  4TSS A;  3TEX A;  2WXM A;  3EUB 2;  4KGT A;  4JE3 B;  3MP9 A;  3TSS A;  1HZ5 A;  2ONQ A;  3ETR A;  3HVD A;  1JWM D;  4OW0 A;  3Q8C A;  1QF6 A;  4KGS A;  3VR8 B;  2GI9 A;  3IXS A;  4L23 A;  1L4Z B;  3V3X A;  1Y56 A;  3GS2 A;  4GDK B;  1V97 A;  3UI3 A;  2WXL A;  1CK1 A;  3VR9 B;  1VRA B;  3PZ7 A;  5GXG B;  5C3J B;  1CQV A;  1E6E B;  3U7Z A;  2W55 A;  4OZB A;  2SEB D;  4NJC A;  1VZ6 A;  1RFK A;  1ZDX A;  1K50 A;  2WQY B;  2XNA C;  1ZPS A;  2WXP A;  2Y3A A;  4JX1 C;  3MHZ A;  2HDE A;  1M4V A;  2QIE B;  1EWY C;  1KFY B;  1SJE D;  1FRR A;  2RMM A;  2QJL A;  3Q8A A;  2DLB A;  2V4I B;  1XCT L;  1SXT A;  3P1M A;  1QLB B;  1ET9 A;  2BB5 A;  2IGH A;  1DOY A;  3AE2 B;  2QEJ C;  4O1N A;  2LFI A;  4PT5 A;  4YTM B;  1KRH A;  1NYQ A;  4YSX B;  1FNU A;  1ENF A;  4C56 C;  1IUE A;  4CQN A;  1TS2 A;  1ACC A;  3NZ3 A;  1BML C;  3R2I A;  2DWQ A;  2G9H D;  4RFB A;  4TMA B;  3SFD B;  4TQ1 A;  3KLS X;  3ABV B;  1EM7 A;  4XDD A;  1TS5 A;  1C4P A;  1PGX A;  2ON8 A;  3LXF A;  2BS2 B;  1XLO A;  4US8 A;  1WRI A;  2G1E A;  2KWD A;  2NTS A;  1ROE A;  4RGO S;  2VZK B;  2WXN A;  1QOA A;  4YSZ B;  2JZP A;  2PMV A;  4YTP B;  4B0M A;  4RGN A;  4DXF A;  1JAL A;  4J3O D;  4IDI A;  1HA5 A;  1TKY A;  2WXJ A;  4EE2 A;  3AEE B;  2R61 A;  2WXF A;  2KMM A;  1P7E A;  2AQ1 B;  3HRD D;  4RF1 A;  3V05 A;  1BUI C;  5D3D A;  4RH6 A;  3IT6 B;  2N7J A;  4JWS C;  3PO0 A;  1VJK A;  1D5Z C;  4C7Z A;  1MVK A;  4B0E A;  1WYG A;  1VR9 A;  3AM9 A;  5FK9 C;  2PKO A;  5T8I A;  3ZJU A;  2W82 A;  2I38 A;  2LUM A;  3IAM 1;  1YN4 A;  1QT9 A;  4N58 A;  1FD6 A;  2WXI A;  1IBX A;  4XDC A;  2J52 A;  2PTL A;  2RPV A;  3P4R B;  1I4P A;  5FKA C;  5HI1 A;  4HKQ A;  4RGM A;  1DYQ A;  1WSP A;  3T3N A;  1E9M A;  1I4H A;  5D3I B;  3NUH B;  3NVZ A;  5TSS A;  1PUT A;  1SF0 A;  1WGK A;  2LHD A;  3DWM A;  3KQ4 A;  2BT6 A;  3Q8F A;  2W3S A;  3N9Y C;  4A8X C;  2EEL A;  4RNA A;  1FFU A;  1K53 A;  1UWM A;  1YMH E;  5G5G A;  2IDY A;  2Y5P A;  2BS3 B;  1H7W A;  4UDU C;  1N60 A;  1JW9 D;  2E6X A;  2PIA A;  4NAM A;  3IT4 B;  1FNV A;  3TEW A;  1L6U A;  4AS1 A;  1IBX B;  3MFG A;  1E7P B;  1ZDV A;  5C2T B;  2IJ0 A;  4HKZ E;  5EE9 A;  1YJI A;  1YNT E;  2K0P A;  1MHH E;  3TEY A;  2EKI A;  2L52 A;  3ZGZ A;  2LHE A;  3CF4 A;  2INN E;  3VRA B;  1FNW A;  5H8Y E;  1FXI A;  4OZC A;  4MT5 A;  4D2K A;  3P42 A;  1JWS D;  1JWA D;  1ET6 A;  1WWT A;  1PGA A;  1VZ7 A;  2K3U A;  3BII D;  4L1B A;  3W9C B;  3KWL A;  5BMH A;  4YWG G;  1EWC A;  2V3N A;  2WXR A;  4RF0 A;  1TYG B;  1KF6 B;  1RYJ A;  1F0Z A;  2K5P A;  1H7X A;  3AE3 B;  2HTM E;  2QSD A;  3E56 A;  3VRB B;  5E6J A;  1E10 A;  3SEB A;  3AED B;  2WXG A;  4WQM A;  2J42 A;  1DGJ A;  2JYT A;  4RCO A;  1F77 A;  3RPF C;  4C80 A;  3AEC B;  1TY0 A;  4H2A A;  4WH4 A;  2CJN A;  2BB6 A;  2W54 A;  1XLN A;  1SIJ A;  1L6V A;  3BWU D;  2I2Y A;  3LYY A;  3OWE B;  1KLU D;  4REZ A;  2AQ2 B;  2PLP A;  1I4R A;  5BYS A;  3E9S A;  3GB1 A;  1NVI D;  3CIR B;  3GP7 A;  2LGI A;  1OFF A;  1FMA D;  1NYR A;  4HJG E;  2AX5 A;  2L83 A;  5AUI A;  3U52 E;  1Q10 A;  1SB3 C;  5HHD G;  1HZ6 A;  4DXG A;  2KQ4 X;  1JRO A;  4USA A;  1UNS A;  1SSN A;  2PVG C;  1JQ4 A;  2GRI A;  1D4B A;  1D5X C;  1MPE A;  2DYO A;  1KLG D;  2IGD A;  4TQ0 A;  2Z8L A;  4RGT A;  3BYT B;  3P4S B;  2WXK A;  5H92 C;  2KAJ A;  2XN9 C;  1XF5 L;  4A6Q A;  1I4Q A;  1OQQ A;  1N5X A;  3HUI A;  4M0W A;  4IKG A;  1RWS A;  3W2D A;  4C7Y A;  1AWD A;  3NVY A;  2MJE A;  4ZOH C;  2V3P A;  3C8Y A;  1GTH A;  4NAW B;  3NRZ A;  4MH8 A;  4WUR A;  3O13 A;  5G5H A;  1ESF A;  3P63 A;  2RDG A;  4N59 A;  5LNK 1;  1UUP A;  4HEA 1;  3BVZ A;  1TKE A;  1K52 A;  2WXQ A;  3VQI A;  1T5X D;  3LB8 C;  1KTK A;  2WLB A;  5BYQ A;  1AYF A;  3AEF B;  3AMZ A;  4HRS A;  4YT0 B;  1AN8 A;  1QKZ A;  1GOZ A;  1XXG A;  2ACZ B;  1DOI A;  3NVW A;  2WU5 B;  1UGJ A;  3FAH A;  2H88 B;  4KKJ A;  1TS3 A;  3AE1 B;  1XO3 A;  2N9K A;  1SE3 A;  5EE0 A;  3L4P A;  2PW9 A;  3KWV A;  1T3Q A;  1GB1 A;  3U2S C;  1MI0 A;  4NZL B;  2TSS A;  5BMG A;  1R7S A;  5EE3 A;  2JWU A;  1TJE A;  3URY A;  3NS1 A;  2CU3 A;  2JX5 A;  1GPX A;  1FCC C;  1EU3 A;  2ICI A;  5AUK A;  2BTE A;  2MEK A;  1UWX A;  2J4X A;  1NI3 A;  4FXC A;  1L0X B;  1GB4 A;  1KH0 A;  2WS3 B;  2GB1 A;  3B2F A;  1DOX A;  2H89 B;  2J53 A;  2FE8 A;  2ZW0 A;  3EGR A;  1D5M C;  1XLQ A;  4LK0 M;  1FCL A;  1YJJ A;  1K51 A;  3BVG A;  1JRP A;  1QOF A;  1GT8 A;  1FFV A;  1WXQ A;  4GDL B;  3P4Q B;  4MM3 B;  1AW7 A;  3AE4 B;  2SAK A;  1FO4 A;  1FIQ A;  3MJ5 A;  3AB5 A;  4WIP A;  1V1O A;  1VLB A;  4ZRP A;  1FXA A;  4R3D A;  2IPK D;  1J7A A;  2BBC A;  2YEP B;  3T3O A;  3DWG C;  2Q5W D;  1YQ4 B;  2KDM A;  2WXO A;  1IGC A;  4GLS C;  1B1Z A;  2W3R A;  3TUO A;  2WP9 B;  1IGD A;  4KGR A;  5FR3 A;  2JQR B;  1V1P A;  1YN5 A;  4MAC A;  3W1S A;  4YTN B;  1ZP0 B;  2N9L A;  4XWW A;  4AQ7 A;  4A55 A;  3AE6 B;  3U4E G;  1SE4 A;  2N0S B;  5HFY A;  3BK1 A;  4XWT A;  1I7H A;  4A9A A;  4IOI E;  1SBB B;  2ZW1 A;  1L4D B;  1C9F A;  3NVV A;  1PDX A;  3B9J A;  2QIL A;  3TEZ A;  1N63 A;  1TZO A;  1I4X A;  3FIL A;  3R2T A;  3ZYY X;  2WDQ B;  1L5P A;  2KN4 A;  1C76 A;  1XLP A;  3J9C A;  1C77 A;  4L2Y A;  1CJE A;  1MHX A;  1VDV A;  2OED A;  4HRO A;  5HG2 A;  1ZOY B;  3W5V B;  2BW2 A;  4YSY B;  3HVZ A;  3AE8 B;  3AEB B;  1V1P B;  2INP E;  5D7G A;  2WDV B;  3FC4 A;  3RFZ B;  1I4G A;  1CZP A;  4P6V F;  3AE9 B;  1SJH D;  2M56 B;  3EA6 A;  4JPS A;  2QMT A;  3B2G A;  4ZHP A;  2PVO D;  4US9 A;  4ZRQ A;  1PGB A;  1XEE A;  2DBY A;  1PFD A;  2YEP F;  5I4D A;  3R8B A;  1QQR A;  2LEK A;  2DYM A;  1JWU D;  3FIL B;  2K22 A;  3WCQ A;  3AEG B;  1A70 A;  1QOB A;  1F2R I;  1HQR D;  3IAS 1;  2JXT A;  1B9R A;  2Y5C A;  2V0G A;  1FM0 D;  2D5G A;  1D6E C;  2M19 A;  2E3T A;  2CJO A;  2BS4 B;  1T6B X;  4LTU A;  1V8C A;  2B76 B;  1YQ3 B;  1OQR A;  2MJD A;  3CWI A;  4ZHO A;  1NEN B;  1TKG A;  4Q2J A;  3ZJT A;  2WNM A;  4WAF A;  2LMC A;  4ARI A;  2X38 A;  4OVZ A;  1E0Z A;  2JYE A;  3PZ8 A;  1TS4 A;  2KAC A;  2L32 A;  2L1A A;  2FUG 1;  3BZD B;  3BYY B;  4DQO C;  3AN1 A;  1ZUD 2;  2FBW B;  2MH7 A;  3MC0 B;  4N6E B;  2MJ3 A;  4A90 A;  4KX6 B;  1N62 A;  1GTE A;  1HXY D;  2NTT A;  1ZXH A;  1N61 A;  2WXH A;  4P16 A;  2WDR B;  1STE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...