1D5XC

X-ray crystal structure of hla-dr4 complexed with dipeptide mimetic and seb
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
237
structure length
223
Chain Sequence
SQPDPKPDELHKSSKFTGLMENMKVLYDDNHVSAINVKSIDQFLYFDLIYSIKDTKLGNYDNVRVEFKNKDLADKYKDKYVDVFGANYYYQCYFSKTCMYGGVTEHNGNQLDKYRSITVRVFEDGKNLLSFDVQTNKKKVTAQELDYLTRHYLVKNKKLYEFNNSPYETGYIKFIENENSFWYDMMPAPGDKFDQSKYLMMYNDNKMVDSKDVKIEVYLTTKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA CLASS II HISTOCOMPATIBILITY ANTIGEN
publication title Peptide and peptide mimetic inhibitors of antigen presentation by HLA-DR class II MHC molecules. Design, structure-activity relationships, and X-ray crystal structures.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/peptide inhibitor
total genus 53
structure length 223
sequence length 237
ec nomenclature
pdb deposition date 1999-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
C PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1d5xC01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1d5xC02
1XXGA 1HXYD 4NZLB 1LT3D 4OHJA 1L0XB 2G9HD 2RDHA 1G8ZD 1LTAD 2ICIA 1PTOH 1TS3A 1JWUD 2IJ0A 1EFID 3W2DA 1UUPA 1SEBD 1S5CD 1FGBD 1CQVA 1SJHD 1LT4D 1QILA 1S5DD 4C56C 1GOZA 5TSSA 1CHQD 1PRTD 3BZDB 3BVMA 5FKAC 2NTSA 1KLUD 1SBBB 3TSSA 3MFGA 5FK9C 1S5FD 1LTBD 1S5BD 3R2TA 1TY2A 1FNVA 1D5ZC 5ELDA 1FD7D 1PTOD 4RGMA 1I4GA 1L0YB 2IPKD 4RHRA 2SEBD 1LTGD 2AQ2B 4RGTA 4TSSA 4RFBA 5ELCA 1YN5A 1BCPD 2NTTA 1LO5D 5ELBA 1I4HA 1F77A 1RF2D 1PZKD 1XTCD 1TY0A 1D6EC 1PYWD 1V1PA 3DWAA 1KTKA 1V1PB 5D3DA 1ESFA 1ENFA 1I4QA 4ZYSA 4RHSA 1I4XA 1PZID 1HQRD 1CK1A 1SE3A 1SE4A 3KLSX 1SJED 2TSSA 1EU4A 3DWQA 1EEFD 1M4VA 2XRQD 1I4RA 1LTSD 1JQYD 1RD9D 1TS5A 1AN8A 1LT6D 2XNAC 1YN4A 1LLRD 3BYYB 2O2LD 4O1NA 1LTTD 1SE2A 3SEBA 1AW7A 1DJRD 2J4XA 3CHBD 1I4PA 1ET9A 1LTRD 1CT1D 1BXTA 4L6TB 1D5XC 1HA5A 1TS4A 2CHBD 1T5XD 5I4DA 1YN3A 3BYTB 1CHPD 1D5MC 1SXTA 2AQ3B 1FNWA 1FNUA 3EA6A 4DXGA 5ELFA 1UNSA 1JCKB 1RCVD 4L63B 3URYA 3EFXD 1LT5D 1HTLD 1MD2D 2XN9C 4UDUC 4RGNA 1DYQA 1EWCA 3BVZA 1PZJD 1B44D 3V05A 1ET6A 1RDPD 1JR0D 1PRTF 4BWGB 1B1ZA 3MC0B 4Z9CB 1V1OA 1PTOB 1PTOC 2WV6D 2QILA 3OWEB 4RCOA 1JWSD 1STEA 1BCPB 1BCPC 1KLGD 2XRSD 1EEID 5ELEA 2R61A 3BVGA 3DWPA 5D3IB 1TS2A 2RDGA 1PTOF 3R8BA 3R2IA 2AQ1B 3GP7A 1LTID 2Z8LA 4RGOS 1BCPF 1EU3A 3O13A 1JWMD 4K6LA 1S5ED 4DXFA 2QEJC 4RH6A 1PRTB 1PRTC
chains in the Genus database with same CATH superfamily
2CVRA 3HOWH 2C60A 5C23A 4JGHB 1TWCB 1CM9A 3VR5A 4TQUS 3DCGA 3Q8FA 1RTNA 2JA5G 4IDIA 4YT0B 1V81A 1ZE3D 4KHZA 2NYZD 4DK1A 2D3BA 2N9PC 1M1KC 3ML8A 3GTKH 5IP9H 4GDLA 4K0KL 2DLBA 2UUBL 2WXNA 4W9LA 1S5CD 2RDBC 1VRAB 3PIOA 4WAFA 2F0SA 5C44H 2WQYB 4P6VF 3V6CB 1B9NA 3U9SA 3A0JA 1H95A 4IG7B 3MFGA 4MZ9A 2XVSA 1SFOB 1F2RI 2BE5D 1U4AA 1IYJB 4IQZA 2JYOA 2FIFA 2D0PA 1CKMA 3TEWA 5EPKA 1ZEQX 4YCUA 1X6OA 1G6JA 2B76B 2V9HA 3H6NA 2WU2B 1L2FA 4RF0A 1J5EL 3PHWB 3FPUB 2B63B 4YL8A 4NPSA 1GUTA 3I4LA 4KGRA 4M8AA 4GDLB 1G6PA 3SK8A 3DHHC 2FJ2A 3MZ5A 1ILQA 3V96A 4DR5L 3HOUG 1I4QA 1RKNA 1Q7YC 3I4MH 2MEKA 1B2TA 3K8AA 4POGA 1SE3A 1NTGA 3BDOA 1GXDC 3PO3G 3KLSX 1Y14B 3QR8A 1IBKQ 3K81C 1N62A 3PLVA 1U9RA 1HTPA 4KV6A 4US9A 3FKYA 2RSOA 2R7DA 5KNBA 4O42A 1E2ZA 4EQOA 4A3BG 3RD4A 3G4SA 4W9JA 2W55A 3NVZA 4K6DA 3WANA 4C7ZA 3H7PA 3X3MA 2LI5A 3KYHC 2WDTB 2UU9L 5C3EG 3IT6B 4LJOB 3V3XA 3SEBA 1WYWB 3G6JB 2I5HA 1K8MA 2FMCA 3NS8A 4KGSA 1EIFA 1KFYB 2A6HD 2WGSA 3ERQA 4YTPB 1BMLC 2DUDA 2VY3A 3L2PA 1SGHA 3BYTB 1YN3A 4Y7NB 1CHPD 3KK7A 3CQZH 1HH2P 2PW5A 4XT3B 1TU2B 3T8MA 1HZBA 4DXGA 1ZP0B 2RQXA 2FUG1 2JQRB 1PH6A 2M0XA 4C00A 1BDOA 4GGQA 4LNNA 2WLBA 3L3OC 2XN9C 3KBXA 3LWEA 1EF1A 4CBVA 2E6XA 5GAGC 5E6JA 4W9EA 5D2MB 1L1OA 1HNWL 3VHTC 5HHDG 4V0BA 4WORA 3ITPA 4JI7L 3GDEA 3KW5B 2C7HA 3H7PB 3EECA 1IPGA 3CC2A 1F52A 4PYUA 3KJPA 4A3JB 1VQ9A 3GTPH 3E5SA 3K5OA 1Q86C 2RR9A 3L0OA 4IZ8A 1VQIA 2F0WA 2K5QA 1EEID 1KJTA 2CR5A 1WM2A 1PGAA 4HRSA 3R7QA 1PTOF 3IXSA 5C4XH 1C8CA 4BXXG 2N0SB 4JI0L 4DV1Q 1EUVB 1J8IA 1XCTL 2AQ1B 1VQHA 3RZOB 2ZXOA 2KLCA 1V1QA 3BDCA 1VZ6A 1Q8IA 2CW0D 1VQDA 3K9OB 1Q46A 5KIXA 2WX1A 4JBMA 4IUMB 1WTRA 4R4CA 5HGQA 3CMMB 3HOZH 2VQFL 1ROEA 2KJ6A 3DBHI 5FLMH 3A56A 1L1OB 1L1OC 5JVH3 1WGHA 2V4LA 3RFZB 1F2MA 5AEKB 3P1MA 2NZ1D 4PYZA 2QC8A 2UUCL 2CH4A 1NAPA 1R4PB 2IHEA 2ZW0A 1JE4A 3AFPA 4AIMA 3PRMB 4MT5A 2F0KA 1IGDA 5IO9A 3W2DA 3PGEA 4KV2A 4JYAQ 4II2B 3OTOL 3OOCA 2EY5A 2ZW1A 5M5XB 4LF8L 3QWNA 3I7FA 1JT8A 4A3DG 4ICVA 2JY6A 2NB0A 1WFQA 1I3QB 3PIP3 4ALPA 4YSYB 2HE7A 2SAKA 3DBRI 2E2HH 2QDBA 1D4BA 3QJYA 3TS0A 4XYQA 2VUMG 1A8VA 2YVCA 4DAYB 1SMYD 5IODA 1JRUA 3NY5A 2GRIA 4KX6B 4A3CH 4A93H 5EAYA 1UBIA 2HJ8A 2K9XA 1NNXA 1AE3A 2HIXA 2BS4B 2G4DB 2RVLA 3AM9A 2D07B 2F4VL 3ENEA 2K03A 4GLAC 2KWUB 5BR8L 4ZOHC 1DM0B 4ZRQA 1LQBA 2A1AA 1WGDA 2XBBC 2VNUD 4DHJD 2LSSA 5M3MH 3NZSA 3M3JA 1EIHA 4CJ1B 2K4KA 4KTAA 1EOTA 4RHSA 1Z6HA 4A3IG 1EF5A 1OGWA 4LAAA 2A4ZA 2PIAA 4DV7L 3LJ3A 2NVYB 5CV8A 2SNSA 3GTGB 2DHZA 4LMQD 2W3RA 3BY4B 1NR4A 2RDFA 1GHKA 4J3OD 2JF5A 1KRSA 2ZJDA 4MH0E 2A69D 4IUPA 3OJ3A 3NJTA 2OF1A 4FDBA 4G50A 2KLGA 4K0KQ 3PRPB 1E1OA 3QA8A 4N6EB 4CKBA 2F0LA 4WJPA 3UINB 1FGUA 1N63A 1ZGUB 2JA9A 3OIQA 1E2WA 1UEBA 3PUZA 3P20A 4A3LG 1YQ3B 2YU9H 1U4MA 1XNQQ 4BBSH 3H9DA 4XWWA 1SSOA 4OO1G 1TS4A 2JA8B 3IFWB 3Q6SA 1EFWA 4ZDVA 1HR0W 1SNQA 5AUKA 3DM3A 1L7YA 4N9PA 2EXDA 4N8FA 3KQ4A 4ZRZA 5KYLA 2C5LC 2PVOD 3NOBA 3APDA 4L23A 4H7BA 2L76A 2MPMA 3HOWB 5HI1A 2E5LL 3J81E 5LMNQ 1I6VC 4IPCA 3DMUA 4JBWA 1Z5SB 2K25A 2OTJA 5EE1A 3DPDA 3RN5A 4BVUC 1PRTF 4G11A 3GTKB 4IFDG 4FHJA 4EZJA 4O0AA 2ZM6Q 2QJLA 1RL2A 4B9WA 4DUZL 3DVNV 4NJ7A 3M95A 1QOHA 1P0RA 2GMIC 2EELA 1NYRA 3RT3B 1SYCA 4DR6L 3VTWA 2YTXA 5CBAE 5C44B 2Z59B 3S24A 4C3JH 4US8A 2L5TA 4WWPA 3GP7A 5BN4A 2Z8LA 4IOIE 4WJOA 3DWGC 1AH9A 2YV5A 3A33B 2N55A 2UU9Q 3L17A 2G4SA 2MGSA 1AEXA 1ICFB 4KJNA 4ULLA 4E3CA 2ASBA 3ZYYX 4RCNA 4ILWA 4DNRB 1G2SA 4YCWA 1WJ4A 1PHJA 5K36G 2G45B 4JE3B 2LJIA 2N9KA 1VQ7A 2MSED 1JOKA 1HPCA 2DY7A 2RCNA 1N34L 2IO1B 3H1UA 1N5WA 4P71A 4A3BH 4JI5Q 4BY1H 2KWDA 2EYFA 1LUZA 1S5DD 3I56A 3TDQA 2KZRA 1EL0A 2PKOA 3MP9A 2DYMA 3Q8DA 3AMUA 1A6XA 3ML9A 3RZWC 3UDXA 3ZJVA 2INDC 2YTVA 3H3VI 3L10B 1NMGA 5D6JB 1WRIA 1U4PA 4EZKA 3MVVA 4KDIC 3VA5A 2B63G 1P3QU 3TUOA 2EE1A 4CGYB 2CU1A 3DHGC 2Z4IA 2KAJA 3I2ZA 4GN4B 4ANWA 3FRPB 1PTOD 2J42A 4QJFA 3AEEB 4RHRA 1VLBA 4FJYA 2Z9HA 2FCNA 2V3NA 5LXIB 4OVUA 4ME5A 2WXKA 3FAHA 3FDTA 1HTQA 2L00B 2D11A 4ZRJA 2B2WA 3PSEB 3NVYA 1N36Q 3VH4B 3DWAA 2H5XA 4POFA 3ZO5B 1O7IA 1LGRA 4JPBW 1DGSA 1SYGA 3ZKJC 5HY6A 1GUAB 1CZPA 2IY1B 1MI0A 1YOVB 3U8ZA 5ELOA 4UP9A 2CH4W 4ASWC 1HZ9A 2L0TA 1C9OA 3CU7A 1VQ4A 2E3TA 2KMAA 3C2PA 4AP4C 1MBYA 2DGYA 3RLFA 3F1ZA 3K0XA 2UUCQ 3S1MH 4EKUA 5DNFA 2G5DA 1NJIC 5JJLA 4IN3A 4LUZA 2WXJA 3IHPC 4QGUA 1GUWA 4YHHQ 1VQKA 3MXGA 4J6HA 3GTPB 2ZTDA 4BS9A 1J0GA 3AMZA 2SDFA 3ND8A 3GTLH 4KSKC 4LJPB 3TMPB 4C3IH 3IFTA 1X3EA 2XTIA 1FVIA 3HRZC 4DK0A 5C4XB 1HA5A 3QG1A 1TT2A 2B2WC 4X3UA 1VQNA 3MJ5A 2KQ7A 1VF5C 4KLKA 5TR5A 3HUIA 5IT9E 5KNCA 3WA0A 1IYFA 2LFIA 4F87A 1K3RA 2EKIA 2CWPA 3Q3FA 4C3HG 3HOZB 1V6EA 4A55A 2FNJB 3NP8A 4A3JG 4MEMA 1GB4A 3B2FA 3QCAA 2I5LX 3MEHA 1JMCA 3LWUA 1TYGB 2D2CC 2A5UA 1O7ZA 2GVBA 4A3EH 3U4VA 4DUYL 3V05A 3TZUA 5C4ZA 2MUYA 4HAEA 1O7YA 1WE7A 4Z9CB 4BKGA 1PUTA 4AYBE 2V3SA 1DONA 3RULA 1MHWC 1STEA 2C35B 2XRSD 3CCVA 2EZVA 4RKLA 1AYFA 1RFAA 5JEAG 4LDTB 3A74A 3KDFA 3PZDA 4OZCA 2K6AA 2QMTA 5IAAC 1X9NA 1EZ8A 3I4NG 4ZUIA 2E2HB 2MHVA 2GBKA 5IP7G 3AE7B 2LVPA 4YSXB 5LHY1 4MJSA 2PYKA 1S5ED 5J39A 3PIPA 3IBEA 2DZMA 4JI1L 4A93B 1IW7D 2JRHA 4DAMA 4ITKA 1L0VB 1KDAA 5KRUA 4GKJQ 3ZNID 4BKSA 2X6GA 4IPDA 3JAML 2NVTH 2KANA 3B9JA 5LL6X 2JA6H 3ZXVA 4JBJA 3AFQA 4EZLA 1C7YA 3VAWA 2DBYA 5IGEA 1WX7A 2R7FA 3CIRB 5M3MB 1C0AA 3ETRA 1TZOA 1WX9A 1IUEA 3STBC 4MGYE 1K52A 1OXSC 4C56C 4B0EA 4GN5A 1CHQD 1PRTD 2GI9A 3KDFB 1B53A 1TR5A 4IOCA 4XXEA 4B3TQ 2N7DA 1C3TA 1T0YA 2FE8A 3ZTDA 1N5XA 1HJPA 1V8QA 3DHIC 4MJSB 4NXNQ 4MSQB 2WKDA 1EIYB 4A3LH 1E90A 3EUB2 1WOCA 3A5UA 5ELDA 1K53A 5CHFA 1GUSA 3FPPA 4OO1H 3Q8AA 3MWYW 5IN7A 3A54A 3I63C 1WI5A 4RGTA 2ZT9C 2UXDQ 2IYDB 3H15A 3IRBA 2YU9B 4BBSB 1YBYA 3L08A 3ZXRA 5FLXL 1ISNA 2AWTA 3HOXH 1F9JA 2J0MA 1V5OA 4PG3A 3O65B 1NEKB 1XMQL 3PT2B 2PPBC 3BK2A 2VZKB 3GTOH 4FP5D 1W6KA 2JT4B 4NMZA 1E5WA 2IT1A 1HQRD 4OL7A 4R4TA 5CV9A 1YHAA 4CHTB 5EPLA 4ACFA 3P75A 4IFDH 1QVFA 4NB3A 1WTHA 2XRQD 2N1VA 2IO2B 4XC2A 4B95A 2F0MA 3NPPA 4X64Q 1N34Q 3NZUA 2A68D 3T51B 1GJXA 2JA8G 5ELNA 4IO9A 2CHZA 2M9VA 4MSMB 3ZDTA 2O2LD 1XNRQ 3FILA 4J8QA 2KDIA 2BB6A 5CGKA 1CT1D 4C3JB 3R66C 1L2NA 2XK5B 1JWBD 3HOWG 1Z7TA 2DNCA 3NK9A 3W5OA 2KCTA 3C19A 3A9JA 2M1MA 2D62A 4HCNB 3TEYA 5K36H 3OYYA 1PFSA 3AE4B 2K7VA 1YNND 1YZ6A 4YY3L 3C3LA 2B8GA 4KGTA 2N3SA 3SFDB 5CMDA 3CWIA 3X0WA 3E0JA 1GNUA 5C3JB 4EVOA 2ATWA 1PZJD 2ZJQA 5T1IA 5C44G 2LRUA 1RDPD 5EKLA 1VQPA 1WVLA 1JRPA 2UUAL 3H8HA 2ES2A 2BYTA 1SE9A 3FILB 2K33A 3KLWA 3KYDD 1RLFA 1KNEA 4A3BB 2JK8A 4BY1B 2D0OA 2BWFA 4EFOA 5CHWA 5LNK1 4YTNB 1SROA 3PUVA 1FD6A 1WGYA 2L4NA 3V6EB 2CU3A 5C5LA 3A9JB 4IJHA 3ULJA 1V9JA 1YJIA 4Q0FA 4QUFA 3R3MA 2QCPX 1MIUA 1DD2A 4BFRA 2IHFA 2N78A 2RSUA 4FJZA 2NCNA 1UEAB 2KNBA 1JB3A 4G7ZC 3AEBB 2BYVE 2W9NA 3Q24A 4QL5A 1VCBA 1KOTA 5J17A 1KC8C 3I72A 3N30A 1X3FA 2MCNB 5ISRA 4AYBB 3UIPB 4DR7Q 4B6WA 3PUYA 5DPTA 1OXVA 1BT0A 1JWUD 4HJ5A 4LF7L 4Q2JA 3SDZA 3TS2A 2M00A 4C80A 1CQVA 3DBLI 3N1XC 2JVCA 3D8GA 1GOZA 1NYQA 4CDDC 4X6AH 2EYHA 1PXUA 2IW3A 3RNUA 3RMKC 3A7LA 3S1MB 4A3FG 2UWQA 1UGJA 1WXSA 5NUCA 2V1YA 2AWNA 3X3NA 2MRPA 2EQSA 2D2QA 1PFBA 3JYUA 2N49A 3T16A 4LTUA 3UI3A 4OVZA 4RGMA 1IBKL 1CMXB 3GTLB 4JVZA 4C3IB 2KC2A 2AQ2B 1OFFA 2H4OA 3SU8X 4XYCA 2FINB 4PV1C 1X65A 5I9PA 1FXIA 1RIPA 4L5RC 3WAOA 2WU5B 4C3HH 4UPAA 3FEWX 3J81c 3A5ZB 2DY8A 1V1PB 4OEMB 3HVZA 1YJWA 3L16A 2DJFC 3NHEB 3I57A 3GTQH 3KFUA 1PZID 4HMJA 1PQSA 5H92C 1MG4A 3AE2B 1E8WA 3DWMA 3OPOA 2IBIB 1BBWA 5JZEB 3L9AX 1IKLA 5BMHA 5DM73 2ZZPB 4MNOA 4A3EB 3I3CA 2HIVA 3T1YQ 3UQAA 1SE8A 4FXDA 5C4XG 4NPNA 4WWOA 3ULLA 1E0ZA 1EIGA 4DPGA 1K28A 1BOSA 4NNJB 3W5UB 2G9DA 2F3WA 1HR0L 1EY4A 3E9IA 4YTMB 2IO0B 1WTPA 3I4NH 1JICA 2FHTA 2VL6A 2R93H 2D3GA 2K5VA 3N1YC 3Q3JA 2EMSA 2CHBD 5FLMG 2JWZA 3Q8CA 1WJJA 4ANVA 1V86A 3U4ZA 3NVWA 2A8VA 1LXDA 1S3SG 2HT1A 3L7ZC 3LYYA 2KBNA 1C48A 3J80E 2E76C 5DAUA 2BS2B 1T0SC 4PMBA 4M00A 1MJCA 2IGHA 1PFMA 1FRDA 2BGFA 5E4WC 4DV1L 2WXIA 2AWOA 2JA6B 1B4OA 3U7ZA 3SR1A 4CHKA 2MBBB 4BWGB 1VQJA 1SF0A 5BMGA 1XJVA 3JW0X 4R8NA 1PH3A 1YI2A 2WV6D 2JZPA 3Q3OC 4N9F4 3TCAA 3TP7A 3VR2A 3NE5B 1G91A 2FIDA 4NAMA 3Q3NC 2HHHL 3AEGB 5D3IB 4A93G 4RKBA 2QHOA 2W82A 1P16A 1QB5D 2IL8A 1MFWA 3QO2A 2I5MX 1BCPF 4ZHPA 2X69A 4RM9A 5D94A 4EX5A 4K6LA 4RG1A 2BVCA 1G6ZA 2JUOA 4RMFA 4WJWA 5M3MG 1WTVA 1B7YB 4RAUC 3UDIA 4XWTA 2KVZA 1Q10A 2N7EA 3AH7A 5T8IA 1BVSA 3RZDH 4UY8C 4OHJA 5J3BA 3HOXB 1EO6A 1WZ0A 2YEPB 3PUWA 3Q69A 5IYDH 5DCNA 1JMLA 2ICIA 2PW9A 3S1QH 5IKCM 3GTOB 4GLSC 1SEBD 1WTQA 3VUYA 4KK7A 2MHJA 1LT4D 1WGRA 4LNKA 2B2VA 1JQ4A 1O80A 1B9RA 3EJIA 1NBFC 1SSNA 2OJRA 2XGTA 2Y5PA 4UP7A 2JXMB 2RD0A 2E2JH 4A3MG 1NI3A 1I50H 5IP4D 1QF6A 2EY6A 2L0FA 4KY7A 3IAYA 1QNUA 5C0XI 1K73C 4BOSC 4JC0A 4EGVA 2PZUA 5K5PA 1SRUA 3M3YH 4LFBQ 1WYGA 1EQTA 2EPBA 5IT9c 4TV3A 2IGGA 4KI0A 4WURA 1TZ1A 4A3OA 3K6OA 2BH2A 5ELBA 3H94A 4A75A 1X3PA 4CQNA 2PMZE 2JEAI 5D14A 2M4NA 1VQBA 5J22A 2BCOA 4IJLA 3LB8C 3ULPA 1EYDA 1C4QA 5D3DA 1WSPA 3DBSA 3M63B 4YWKA 4IPHA 3TBLD 2B2VC 2NZHA 2L32A 2UXCQ 1XNQL 3TL5A 1QWYA 4JLCA 3ER0A 1VQ6A 1M4VA 2L1AA 1YIWA 4KKIA 3ICEA 3CF5A 3PPAA 4FF1A 4FN2A 3VR4A 4C3JG 4LF9Q 1LABA 2XNAC 4LF7Q 2O5JC 2WDRB 4O1NA 1L6VA 3W5VB 2OQ0A 1HNXQ 1DOIA 2WDQB 1QZEA 2BDOA 2WXRA 1QNKA 4N8X1 1SYBA 1TKEA 1LACA 5LMNL 1S1QB 1I94Q 2L12A 3DHQA 5KHQA 3OIPA 2SNMA 2UXBQ 3HZXA 4PK1A 1WX8A 2AQ3B 3PGZA 5G3LF 2ZM6L 1TQOA 3AB9A 3EFCA 3HKZE 4B3RQ 1TIFA 1AE2A 1JCKB 3PUXA 2PEAA 1YEZA 2QA4A 2DZKA 3CF6E 4O2DA 1LM8B 4RGNA 2KJXA 1HRJA 3A8IE 4BY1G 3RNAC 2F0HA 3J81i 4HK2A 5MPOA 1DOYA 3Q23A 4CO7A 2O4XA 3A1QA 1BF4A 1MHXA 1WR6E 3PCOB 2YYZA 1FFVA 2KVRA 4F8CB 1SYEA 3WDNA 2QW7A 2F0FA 4A3FH 2N9XA 1ZKHA 2VH2A 1YNJC 2K3UA 3E9SA 4K1RB 4WWMA 1TS2A 3QHTA 3R8BA 4HJ8A 1HA6A 3U2SC 5BN5A 4BBNC 2QEXA 2ZJPA 3KH0A 3QIAA 1B50A 2WINB 3HKSA 1K9MC 2RBMA 3FHWA 4HJKA 1CUKA 5JJZA 1HR0Q 2PVGC 4JI5L 2JQOA 4AYBG 5FO7B 2DAJA 2ZCCA 1CQFA 3RLNA 3DQVA 5G55A 2KX0A 4NZLB 1LT3D 1ESRA 1CFMA 3A1QB 3TEZA 4FXGC 4N9TA 2DJGC 4C3HB 4FYDA 2M19A 4H13C 3NWSA 3D0FA 1GKHA 4PQXA 1IHZA 4TKOB 1TS3A 3NTHA 3J7ZC 3UDGA 3M4OH 2ON8A 3V61A 3GTQB 2YTYA 4P1CC 5CHVC 3A8KE 1Y8NB 3GO5A 4FF2A 3Q3MC 5DPSA 3WWVA 2RHSB 2JSOA 1KQSA 4IUNA 1K50A 1UE5A 3L4PA 3LX0A 1R9TH 4CJ0B 1KLUD 4C3IG 3GE3C 2I2YA 2Y3AA 3KVFB 4KJOA 3P42A 4P16A 1N36L 3GZNI 1S5BD 1KD1C 1JB7A 3ZW3A 4FA6A 4DAYA 1E2VA 1EYGA 2WXHA 5CC4A 2BA1A 3P4QB 4LFAQ 3ZRFA 4GOCA 2GN5A 2IPKD 2V1CC 2B29A 3M4QA 2I1JA 2B2UA 1PH7A 2HHHQ 3SK4A 3I4NB 2R93B 4ZAIA 1BCPD 3DVGX 2KA7A 4W9DA 4QCLA 1ZXTA 1CZWA 2CWAA 4JX1C 3MA2B 1I4HA 2WNMA 1C9FA 1EWYC 2WHIA 1IYUA 3K9PB 3DEPA 4YHHL 4A3EG 3AU4A 2F3VA 3HRDD 2L7RA 3VA7A 2ZVNA 4B3ML 1KHIA 4XDXA 2VH1A 1IBLL 2M8SA 4CJ2C 2WXPA 2TSSA 3LXFA 3CPWA 1UWMA 4ZK9B 1TKGA 3U30A 1OEYA 2INPE 1HUMA 2NWGA 2ZJRA 2A19A 2LUMA 1EY8A 3SXHA 3MHSD 1WH3A 2TMPA 4KN4C 2LXJA 4GIVA 4JI3L 4A8XC 2B2UC 3M62B 4DNTB 1P1AA 3NELA 2K0PA 4HROA 5JVG3 2EYOA 3S2AA 1LTRD 2PMZB 4IUQA 3WAPA 1D5XC 1T9HA 5IGDA 1IGCA 4BA2I 1IL2A 4M8NA 2UU7A 1SXTA 2JA6G 3MEFA 5A2QL 2LFNA 5DPRA 2J0JA 4RA8A 1UNSA 4X66Q 1GUNA 5FJ8G 3M85A 2VZAA 3S16H 1DXMA 4DWFA 3NUCA 5F2DA 3ZJYC 5BMIA 1XLQA 4OZBA 4I6LB 4HJGE 3RZDB 1EY6A 1XPOA 3UIOB 2L52A 5GAEC 1XWEA 4LNQA 4KHPQ 3CD6A 2M56B 4WJ4A 1OQRA 3OAWA 2NBVB 4HPPA 4IM2A 3S1QB 3K57A 3RN2A 2JA7H 2PE6B 2VRRB 4A3MH 4GKJL 1PH4A 2WXMA 4YWLA 3EIVA 3TREA 1DOLA 4HJAA 2F3IA 3DUZA 4JL9A 1B8AA 3MC9A 4WJNA 5EBDA 1F9RA 4DR1Q 2A5HA 4HJ7A 2E2JB 3HKZB 1I50B 5JJKA 4NY0A 4DDID 3KLSA 1N9WA 3HOXG 5CV6A 4DKAC 5BO4B 3M3YB 1Q1OA 2OEOA 1I6HH 1K83B 1EY0A 5AUIA 3A8JE 1YHQA 1WI0A 1B9MA 4B3TL 1OQQA 4HCEA 1FPYA 1MSGA 5G3LD 3K58A 4HKZE 4RNAA 5JH5C 3WOEA 5A35A 2W3SA 3OG5A 2ZXPA 2NVXH 3FMCA 1BUIC 1WXAA 2NVUI 2V0GA 4NXNL 4QMGA 4LDTD 4LFCQ 2OHFA 1PTOH 4IUVA 2O2VA 1PMRA 2IX1A 3ZTCA 1STAA 1UUPA 5C0XJ 1JJGA 1FGBD 2LASA 2A6HC 2UXDL 4W9HA 2K1FA 4ZRKA 3LNNA 4K14A 5I6WA 1TVXA 5C2TB 5C5MA 2MJEA 2KEEA 3QX1A 4KY6A 5FK9C 4KMUC 2HQLA 4FF4A 4DXAB 1ACCA 1OTRB 4DAVA 2KHIA 2ENBA 4HN7A 3PO0A 1C79A 5I2YA 4S17A 2KFKA 3PF4A 3E6ZX 1H4RA 2SEBD 1R7SA 1K3BC 3J80c 2Z4HA 3STBD 1VQ8A 2F0UA 2C7MB 5BYRA 3NTKA 1QOFA 1PGXA 1YJNA 1BR9A 3KUCB 3S14H 1CA6A 5IOCA 2IX3A 4X64L 2KN5A 2LGYA 1ZXIA 1TY0A 2L9HA 4RWSC 1TIID 2O2VB 3APCA 1ESFA 4DV4Q 1XNRL 2FCMA 2MA9B 1EM7A 2W54A 1N33Q 3TQYA 1C77A 1YMHE 4HR7B 5C4JH 4P2CB 5EKKA 1CA5A 1Q0WB 1GB1A 1TWAH 1LYLA 4HSVA 1QKZA 2K6DB 2CW0C 1TS5A 4IUTA 2AHOB 2VQEQ 2PE9A 2KFKB 1L4ZB 4RF1A 1PGBA 4LK1C 1R4MB 2INCC 4A3FB 3T53B 1QZHA 3DDCB 2Z0SA 2K5WA 5D65A 3J7AV 2BYFA 1UH6A 5J2RA 2WS3B 4OIJA 2HCIA 3PLUA 3ALBA 2A74C 4K8JA 3EA6A 1CSPA 3DBLB 4WFN3 3M4PA 4JOIA 4R3DA 4L63B 4FXCA 2EDGA 1CKNA 4IC7B 1MD2D 4ICUA 2MBHA 2BT6A 1VZ7A 4MHEA 2WFWA 3CRKC 1GUOA 4ZLTF 1MVKA 2HDEA 2WX0A 4PS8A 2F0DA 4R4OA 1II3A 4HWIB 1VD2A 1OO9B 1UWVA 2F0OA 3M4OB 5AZHA 2EJMA 2L3ZA 4B3MQ 2ZPNA 1IBLQ 3DVGY 3ABVB 1KLGD 4S3SA 4GDKA 3IKJA 4HIKA 2R61A 2YEPF 3J7A5 4MGIE 3T3NA 2P5ZX 1R9TB 1XPRA 2Q8IB 1Z9FA 1LTID 1HZ5A 2KYWA 1IP9A 1C4AA 3VXWA 4DR7L 2B3AA 1L5PA 2FMMA 2DZJA 1FJGQ 4JOIC 4DXFA 3KUPA 4JI3Q 1E9MA 1IBXA 1LTLA 1CKNB 1NY4A 5M5YB 2PI2A 3NBIA 4CKCA 4DR3L 3EQLC 5IIFA 1C4CA 2A69C 3L0WB 2KCNA 2GA4B 3MTSA 2MJDA 4B9KA 3KBGA 2D3AA 1V9PA 1Q5WB 4L2YA 2WXGA 3OJ4B 1S3OA 2BYEA 1H9SA 2KEDA 2XWBB 4CDCC 3CRLC 3PREA 1A63A 1G51A 1O7LA 3VYSA 1K0RA 2QF7A 1N60A 2KWVB 5C6AA 1QILA 4GDKB 1HUNA 4K7UA 3ZGZA 4DV6Q 2R93G 1EY9A 3HEJA 2Z6KA 3I55A 1F1HA 1AZPA 3P63A 4G7HC 2EOTA 4OGQC 1YJ9A 1HNZL 1IBXB 1FNVA 4OWXB 1FM0D 2I1KA 2BA0A 4DR4Q 4I65A 1L0YB 3EN2A 4HCSA 2QDFA 5JXVA 1V80A 1LTGD 2F0IA 1NI2A 1EWHA 3VDZA 1V43A 3T1YL 2NN6I 4WJ3M 1H9SB 1BKBA 5DEHA 5FJ8H 2PPHA 3K5MA 2ZVOA 3IAM1 5JHAA 1VF7A 1H9KA 1PYWD 1SDFA 3SHLA 4C1NK 4EQ5A 5GMVA 4F7XA 3HFZB 1UF0A 1Y8RC 2BW2A 1I4XA 3S16B 2PNHA 4KD3A 2WACA 1EOVA 3AE6B 2VB2X 4DV3Q 3TJPA 3K7UC 1GM5A 3OMCA 2Z6KC 2JSVX 2KDBA 1JQYD 3JAME 3F2BA 2K5NA 1IBMQ 2K5PA 4R8IA 4EEWA 3JVZX 4DN4M 1D1IA 3FKIH 1RYJA 1LLRD 2L0CA 1KNAA 1WMHA 2JA7B 4K5XA 4NW2A 4A3MB 2F1MA 2K14A 1MGSA 4USAA 1I4PA 2E74C 1M90C 1ET9A 1BXTA 3PF5A 4GZYC 2XK5A 4DV5Q 2NZOA 1NR2A 5M5WH 1ZDVA 5I4DA 1ENAA 3B2GA 2N88A 3HIZA 2KQ3A 4K2LA 1Y1WH 1WTXA 1F2YA 3MHBA 5CBEE 1NE3A 1PVOA 3AE9B 3ZNGC 5IYDG 2KDMA 1I6HB 1B3AA 5DLQE 3URYA 4AWJA 1R4NB 4BBNF 4ZHOA 2VS1A 1M94A 4TVAB 4XDCA 4OONA 1STGA 5KEEA 4MGZE 4BAXA 2JYTA 4U68A 1WY8A 2NVXB 1WTOA 4X62Q 5FLXE 1DOXA 1PTOB 1PTOC 3UQBA 1T0QC 3HKZG 2K5HA 1HCZA 5J1ZA 1WMHB 2IDYA 3GOEA 3AI5A 2M0AA 1VQLA 3TP6A 1WIAA 3NZ3A 3BVGA 2REXA 3H0GH 3QQ8B 1ENCA 2K32A 2DX5B 4KKJA 1F2LA 2ZNVB 2ZNVC 3SE0A 2HTHA 2F0PA 1WD0A 2MQJA 1Q12A 2JZZA 4BOZB 1W6JA 2JWUA 4XIGS 2LKVA 2QEJC 1KAWA 3DXJC 2LRWA 5DPWA 4IFDJ 3OLMD 5E6PA 3VDYA 1XXGA 4JK1C 4LCDE 1VR9A 2LVQA 1F2RC 2WWZA 1DOMA 3CCUA 2CHWA 2FAZA 2NR2A 1ILPA 2LY7A 4LUVA 4DK3C 2R7ZH 3S14B 2D9UA 3U50C 3VTVA 3VYTA 1G291 4OX9Q 2AX5A 3CSFA 4C7YA 1MKHA 3RI7C 1E3PA 3NQTA 3EGRA 1ZYRD 3PIO3 4HIDA 5C3WA 4LFBL 3B0AA 1EFID 4FVMA 1JW9D 4GU2A 4LF5Q 1RJTA 1SIJA 1WXMA 4HSPA 5L95C 2LGIA 5C4JB 2LD9A 2PLPA 3QB3A 3IG3A 1TWAB 2MFIA 4A3KH 1HZ6A 1MI2A 4TRDA 3HHMA 1LTBD 1AP0A 3AU7A 1H9RA 2RCFA 1PDQA 2L8JA 1QG7A 3K5LA 3W1SA 1Y8OB 2N4FA 3T1HQ 4YWGG 3H3VH 2R2QA 3E56A 4NQLB 2EVBA 2AKWB 4KD4A 2UXCL 2MH7A 2K1BA 2WKCA 3CKIB 1ICWA 2L83A 4B0MA 2K75A 1BQQT 1EWIA 3GE8C 4JQWC 2HTME 2K52A 3VYRA 3RPFC 1XTCD 1WTWA 3P1HA 4EQPA 2V4DA 3CMAA 1BUVT 1V1PA 1TWHH 2MQHA 4LF9L 1F2ZA 2KVMA 4LF6Q 1IL8A 1X55A 4DR3Q 1HNXL 1YJ1A 4JV5Q 4TKNA 5JPMC 1PYSB 2F0NA 3HG9A 1K8GA 4R9WA 1I94L 1GG3A 1VQCA 1EYAA 1QQRA 2CKHB 4OVVA 1O78A 5AJ3Q 1IKMA 5EGTA 2UXBL 3S15H 3NUHB 2BF8B 2OEDA 3GTJH 2AYOB 1PYBA 2Y5CA 4B3RL 3W1SC 5L37A 3TN2A 4ME3A 3NVVA 5FR3A 3BYYB 5FR6A 1MG8A 1SE2A 4KKTA 1UGMA 3J7YW 4NQKE 2K28A 1ASYA 3U58A 3CHBD 1C76A 3R7RA 4G4KA 1N32Q 1P9DU 4BBRB 2MW5A 3D4WA 5GROA 2KX3A 2EYPA 1A62A 1EYCA 4K81A 4W9FA 3R3OA 1HNZQ 3SHQA 2MBOA 5H8YE 4JIOU 1UELA 1KF6B 2LEKA 5ELFA 3Q8BA 4HPMB 1RCVD 2IWHA 2CS4A 5IGBA 3HM3A 3QJZA 1TT5B 1Y1VH 1VQMA 2WP8J 3VVWB 1STYA 4DF7A 2OWOA 3NXWA 4HDOA 4K2KA 2V4IB 1W2BA 4MH8A 4J15A 2JE6I 5AFWA 4WIPA 5LXHA 1WXVA 1QOBA 3QK0A 5BYQA 3ZNHB 4AS1A 1XD3B 3C1EA 3DBHB 1JOQA 2JRIB 1WE6A 4TQ1A 2KXJA 2PW7A 1J7CA 4ODGA 1XMOQ 1CSQA 3MXPA 2CHXA 1Q8KA 1FFUA 4XQNA 2Q2TA 3AEVA 2KC1A 4F1SA 1E8XA 3QC8B 4NAWA 2K8HA 1CZGA 2PZTA 3I90A 3SR6A 4A3PA 5HFYA 4X3SA 4U673 1Y69U 1A15A 3CC4A 5IGGA 5IYBG 1WJUA 1GD7A 4DFAA 4MACA 2XEWA 4KY5A 3DBRB 2EYJA 2R92H 3ND9A 1EQQA 1K8AC 2LMCA 2X6LA 1RAXA 3HOYH 3H7SA 5M9OA 3AULA 4I6PA 2L55A 4PMCA 5JEAJ 3BZKA 2BQQA 4IWPA 2VB3X 1XLPA 3RD2A 3ZJTA 4LFAL 2G3QB 2CFMA 2JXTA 3U52E 3SK5A 4F88A 2PTLA 4BY7H 4HMIA 4NAWB 2IO3B 1FL0A 2C7NB 3NHHA 4QQBX 4QF4A 4H02A 3KWVA 3BDLA 2IGDA 1F9PA 3NENA 3FC4A 2MWSB 3ZIMA 2Y0SG 3FKIB 1WZ3A 2O6VA 1YNXA 2C9WB 1GJZA 1L4DB 4WAAA 1D7QA 3KOJA 1UE1A 5IY0A 4RFBA 2LMCB 4IW0A 2PO4A 3X23A 1U4LA 2KTRA 5M5WB 5I2XA 2K05A 2E2IH 1Y1WB 2X8XX 3TMEA 5H1SE 1KDBA 3QARA 2KOXA 4S0RA 2Y5BB 3A9KA 4JI6Q 5EPJA 3P7JA 4M1UB 1SYDA 1SE4A 3VR8B 5C3XA 5IWAQ 1SJED 4W9GA 3MJWA 3PZ7A 4FF3A 2KUMA 5HGTA 4HIMA 1VQOA 1U4RA 3DEOA 2JA7G 1WFYA 5AZGA 3SD5A 1KL9A 1U5KA 1ZDXA 2JN4A 4CDFC 2XSCA 4N59A 1L6UA 1KRHA 1TBEA 4X66L 1K83H 2NS5A 2O6VB 2BH8A 1YN4A 2DZIA 3GD7A 2KACA 2V3PA 2YLMA 4LK0M 2Z0EB 1NMFA 4GLVB 4TUUA 3BK1A 2CQOA 2K50A 4HPLB 3N3KB 4Q5VA 1BO0A 2KTRB 1PA6A 1TTNA 3H0GB 3FVQA 4K3BA 4KHPL 2JEBI 3AV8A 1VJKA 1D5MC 5I9OA 4X65Q 2J0KA 3RNCC 3A9KB 2C9OA 2QDLA 2K22A 2N9LA 4WJQA 3ZNZB 1YQ4B 2PMVA 3ZQ4A 1K8OA 1SNCA 1X54A 1FEHA 1HTLD 4FHKA 4ZCKA 1MJDA 1NVID 1K8RB 4J1MA 3EFUA 2ZXRA 2LGDA 4XX5A 5IE8A 3RZFA 3V60A 2WYQA 2R7ZB 4DR1L 3F2DA 1ET6A 4LW1A 3KUDB 3CCMA 4NP5A 3MC0B 2DNFA 3WIMA 4QIWB 4G0NB 5EDSA 4FULA 3HOVH 2NBUA 3GB1A 1SR3A 2QILA 4MTNA 3OW2A 5JAVA 4KN7C 1ZW7A 2QSDA 2ACZB 2GLSA 2PJHA 3VQIA 3KJOA 3FP9A 4H44C 3OWFA 1ZUD2 3CCSA 4KIKA 1J7AA 3V62A 3R2IA 4A3KB 2LGXA 1LFDA 4MM3A 2A6EC 3IT4B 1YITA 4I7ZC 1T6BX 3BIID 1H8CA 4LFCL 3G48A 1PH5A 3VRAB 5E7NA 2XWJB 2LXCA 2B2YA 3H3VC 1XTDA 1YQBA 2I38A 4FADA 4MGKE 4DQOC 1HXYD 1FXTB 4A3GH 4AQ7A 3C46A 3NEMA 1WM3A 2N9EB 2RPQA 4RMAA 1X3GA 1ZKOA 2Q8RE 5EE0A 3VH3B 4ABNA 1L0XB 1G8ZD 1ONLA 4DGZA 4DV2L 1HZCA 2K04A 1TWHB 1JJCB 1SYFA 3JAMc 4K7WA 4LF4Q 1VQGA 3MC8A 3VR6A 1SJHD 3CCEA 4KIKB 2Z1CA 3RLOA 2NTSA 1ZOYB 4MM3B 1SBBB 4DK6C 3S15B 4K5VA 2BOSA 1UE7A 4FO2A 3GTJB 4QB4A 4P73A 1AZQA 3K80C 5LL6S 3F2CA 1TY2A 2B2YC 4DV4L 3S1RH 1OQYA 4IM3A 4REZA 1GC6A 2EY2A 3MAQA 2F0VA 4L8JA 1N33L 1VQFA 1XPUA 1E7ZA 3TEXA 1JC7A 5ELCA 1GAQB 4JI4Q 1C1YB 1R4QB 1EY5A 1E8ZA 5M3FG 1B3QA 4BA1I 5IYCH 1F77A 3MXUA 4DR2L 1NBWA 1DOKA 2ICEC 2JZ3B 2VQEL 1QT9A 2AUJD 4LNFA 4WQMA 1F0ZA 1OXUA 4W9CA 3ZLZA 1UAPA 1ENFA 1V2YA 5BN3A 3PO2H 2J0TD 2QGQA 5FLXc 1WF9A 1Y1VB 3PMFA 2EMTA 2FCSA 2ZCBA 4DDGD 4EE2A 2F0EA 2LHDA 1VDVA 4JBKA 4YSZB 3QOJA 4XQQA 1DZ1A 3AU5A 1FO4A 5IOIA 3RNBC 1FR3A 5LMUQ 1D3ZA 4DV0Q 4H0LC 4BBRG 4AQYQ 3RN9C 1Y8PB 3CPFA 2DN8A 5M5YH 4GKKL 3CCQA 4QAYA 1Q1EA 3M4YA 1X3QA 4XTCS 2J4XA 2K8CA 5HKHA 5G2NA 4A20A 4L6TB 4DNIA 1PDXA 4JWUC 5IYBH 1T5XD 2I0QA 2FCQA 1OTCA 1SNDA 1TWGH 3BZCA 1KM7A 1QOGA 4OZAA 2KWCA 3Q0AA 2MNAA 1XX8A 2HUGA 4L5QA 1WJNA 1Q1BA 1STHA 2NPTA 4XZ4A 2WB1G 2LXKA 1MSHA 2KDEB 3V2TA 4CYEA 3UDFA 2R92B 3S17H 1FRRA 2F0GA 2GBRA 4NKLA 4GMVA 1WJ6A 3CP0A 4H2AA 3HOYB 1BNZA 2GB1A 3RYTA 4LJZC 3KF8A 3E3XA 1KDCA 2MJ8A 1E6EB 4JI8Q 2HD5B 1V1OA 1FJGL 1KRTA 1WCMH 4N58A 2BWES 1E10A 1IZ6A 5EBCA 2VW9A 3QIJA 3VTUA 4ZUJA 1B70B 1KXLA 2ASQA 4X57B 4WH4A 4NXML 2NBWB 3TRZA 2RDGA 4BY7B 2BPSA 3I5JC 5L83A 1NUCA 1MJEA 4IUUA 5IGCA 4ZRIA 4OWWB 3I4OA 1QUQA 5CV4A 5EE9A 2NPTB 3N1ZC 2OCEA 2PNRC 4IWQA 1YN5A 4P75A 3HGBA 3N52A 3BS1A 3Q2AC 4HXDA 5I6YA 1KH0A 2C5CA 4JWSC 2EXZA 3BG3A 2BE5C 2NMQA 4DV6L 3K5NA 4HEA1 4EUTA 3KF8B 2F03A 3QOLA 2G9HD 2E2IB 2KJHB 3AECB 4JW0A 2DAFA 5GAHC 3Q22A 1YX5B 2RF4A 2JX5A 2Q5WD 4KKSA 4DR4L 2DWQA 3SK6A 3W1GA 3OSOA 5A2QE 1GHJA 1EUJA 2BS3B 3PHXB 4F8MA 3FKIG 1UE6A 3ONAB 4MN3A 2EJFC 1S72A 2WDVB 3BVMA 4OO1I 1YVCA 1QUQB 2BTEA 1T0RC 1JWAD 1QLBB 4PZ6A 3S2DH 3I3TB 4W9KA 4RM8A 1YNTE 2LXAA 4HKQA 3F8TA 1WGGA 3TP5A 4YXDB 5EQ0A 2PI2E 1Y1WG 1A5RA 2UUBQ 2PQEA 2K5DA 4HIOA 1YJJA 3J81L 3VUXA 3MXNA 1N6ZA 3AQQA 4DV3L 4L5TA 2WAQE 2NVQH 2MJ3A 5C0XH 3G7LA 3IL8A 1PH1A 3C1FA 1IBML 1VS0A 1J6QA 1PZKD 3I70A 2Y0SE 2KK8A 2KKCA 3UE0A 1CKOA 1J8CA 4UAIA 4IFDI 3WAMA 1D6EC 3M9BA 5GQOA 1KTKA 1OXXK 2N7JA 2N1WA 2I07B 3TEHB 1H9JA 2GOWA 3EHVA 3LGJA 3ZVVA 2Q2UA 4PT5A 2JA5H 4B9XA 1Y56A 3W9CB 3AEAB 1J5EQ 4DV5L 3KWLA 1QCBD 5BYSA 1UZXB 1I4RA 3T9LA 2LS01 1LTSD 2N8NA 1E1TA 4MTKA 4KHVA 2EIFA 2KMMA 1TKWB 1IXRA 3JAMi 4DV2Q 3H0GG 4DAPA 1DGJA 4G3XB 4EOYA 4M02A 2I46A 3D4DA 1TJEA 4I7AA 2PCFB 2O5IC 1YIJA 1D1KA 3GTMH 3HOVB 2EKEC 3DOWA 4DR5Q 2M17A 2L11A 3D31A 1JROA 3W1BA 4A76A 2Q2IA 3MXNB 1AW7A 1LV9A 2KCMA 2KHWB 2B8FA 2MO1A 5KNDA 1AWDA 2RGFA 1PV4A 4X62L 2MO0A 5CV5A 2JP1A 3Q6BA 1I35A 3TBIB 1FNWA 2R7ZG 1TGZB 3VRBB 2ONQA 1XF5L 3Q8EA 4NDXA 3WALA 3OW7A 4P74A 4BKTA 2WIIB 1RODA 3AEDB 4P1BC 4II3B 2KO3A 2LGSA 4BKSD 3I9V1 1DYQA 1PFNA 4A3GB 3J9CA 2AMCB 2JU6X 1Z47A 4DR2Q 1PLFA 3D4RA 2J52A 1FXAA 2KT7A 4FNFA 3AB5A 3HOUH 4NJCA 1VQ5A 4JPSA 1JR0D 1NENB 4A3KG 2FBWB 4I6NB 4UP8A 3PO3H 1YHBA 3OWEB 4P72A 4A90A 2VZKD 3I4MB 1BCPB 1BCPC 4IKGA 3D6WA 1HZAA 2E2DC 3DWPA 4EQNA 1E7UA 3SDLC 5EE3A 5C4HA 4JCVE 2L1BA 1HNWQ 4OX9L 4CDEC 1C4PA 3CCRA 1SMXA 1RM6C 3K0YA 4PNYA 3A7AB 5C3EH 4JI7Q 2F52A 3S1RB 1T5EA 3S1NH 4GKKQ 2IZVB 4XDDA 1QVGA 1FCCC 4FJVB 4IM0A 2CJOA 5M3FH 4LF5L 3AEFB 3NG0A 3EROA 4YCVA 4LNIA 3VUWA 4G57A 4WQOB 1LM0A 4HVBA 4M0WA 2F0QA 2MX2A 5EJWA 4X3TA 2NUCA 2GBNA 3A4SC 4JI0Q 1GVPA 1SMYC 2IY5B 2ZPYA 4DA2A 5LLIA 5FOBB 3CQZB 3M7GA 3T1HL 4XQJA 3PO2B 2LUEA 3U4EG 3I8ZA 2VQFQ 2Z6BA 2RHQB 5TSSA 4DHJB 4BBRH 1SNOA 3GQBA 2KDFB 5FKAC 3HK0A 3VR9B 3ZDMC 3PSIA 3TSSA 4GS3A 1P7FA 1V49A 5IT9L 4KZ0A 3BWUD 1S5FD 2L15A 3RCZA 1CJEA 2MLBA 1TXYA 3ERSX 3AE8B 3TP8A 3RMHA 3ONSA 3UI2A 3BINA 2HDLA 3OHXC 4LF6L 4K3CA 4JV5L 2MP2A 2OXPA 1I4GA 3OTOQ 2MBQA 4BXXH 1HHVA 1XT9B 1Q3LA 1P98A 1ML0D 2R6GA 4LF8Q 4JG2A 4NXMQ 1UWXA 4M0WB 4BZAA 4OIKA 1Y1VG 4XT1B 1P7EA 5AJ3L 4R4QA 1TKYA 4M8MA 4C4VA 2PQAA 1S40A 3GV6A 1RF2D 3N6RA 2AEHA 3DM1A 1VCIA 3BU2A 1KABA 2J7ZA 4YWMA 2QCZA 1TWGB 1PH2A 4DHZE 2KCCA 2KHSA 5IA7A 5KYIA 5LMNW 3L13A 4E71A 1CK1A 3D3RA 3J81j 1RFKA 2LVOA 2KOLA 4ZQ3A 1PH8A 4YIJA 1TWFH 5E6OA 2F4VQ 3S17B 1N32L 2D5DA 1RHPA 1EU4A 4GXBA 5BR8Q 5JPNC 1RWSA 1GO3E 4ID6A 3HP3A 3RNGC 1MHHE 1JOOA 1XQQA 4L1BA 1Z2MA 1D8LA 4LWCA 2WXLA 3CC7A 1Q81C 1WCMB 2MBEA 2MP2B 4A3DH 1LTTD 2F0JA 1WWTA 2RA4A 4KVGB 1GC7A 1X56A 3H6MA 3SGIA 3Q14C 2WAQB 1DJRD 2H1EA 3EBEA 4DV7Q 1XYIA 2D10A 1YX6B 3CSTA 1KAAA 5E4XA 4C4VB 2PQAB 1WXQA 3AE1B 2Y0SB 4TMAB 2VUMH 2R92G 1NSNS 3KF6A 2DYOA 4XYOA 3APFA 1N61A 3EC8A 2JJQA 2KQ4X 3HOYG 4MELA 3S2HH 2ALYB 5E1FA 4UHVA 1XMOL 4C2MH 4DU9A 3VYUA 2K8BA 3HVDA 4HLEA 4QUCA 5E6NA 3RUIB 1XCQL 4PZ8A 3CCLA 1K51A 1EWCA 3BVZA 5D7GA 3T3OA 1B44D 2NN6G 2DENB 1V5TA 4KZCA 3MFYA 3T4AC 4BY7G 1IYVA 4MDKE 3RR5A 1B1ZA 4A3IH 2OTLA 1GUGA 2WB1E 1QE6A 1VMPA 4IWOA 5GXGB 4AOFA 3EVQA 1FMAD 1A3UA 3I73A 3JC66 1P8LA 4AJYB 4HJ9A 1E24A 1JWSD 1WR1A 2GVAA 2HQEA 4K5WA 2E5LQ 4GOPA 3AN1A 3UF8A 3KF6B 3PVLA 3B08A 2PZWA 2E8GA 4A4IA 1QZGA 2H89B 2E75C 3S2DB 1X32A 3O13A 3J80i 1J7BA 2OJWA 1A2TA 1WGKA 4RH6A 4DUZQ 2BKRB 5CX3A 2SOBA 4ANXA 1I5FA 1SLJA 4DR6Q 1HFGA 3G71A 2K01A 2NVQB 1A3TA 2NBFA 1MPEA 1BBXC 3PQIA 4HEDA 2RDHA 5COYA 1LTAD 4R4IA 2HDMA 2ZTCA 3QWZB 2INNE 4E74A 2KFJA 3W1YA 3UE1A 2IY0B 1HTOA 1M8AA 3K7AH 2JA5B 1N8RC 1JALA 1E7PB 4GOPB 4GOPC 1SNMA 2FFKB 3CCJA 3MTNB 4J6IA 1VMCA 2ZTEA 1F9SA 1OXTA 1V97A 1GPXA 2BKFA 2GBJA 3N20C 3TZDA 2WXFA 2BB5A 2WXQA 3CW2C 4X3KA 5AZFA 4LUOA 4JI6L 3GTMB 2KD0A 4ZKBB 3WCQA 2F0TA 3F2UA 4JI2L 5IWAL 2KTFA 4TSSA 2LJ5A 1TWCH 2WXOA 3ECIA 3L54A 1LO5D 2Q2HA 1E22A 2LWPA 4HCPB 4PS7A 1BBUA 1QOAA 2EY1A 2QKIC 3C8YA 1QVCA 3H09A 3G6EA 4P7IA 2RPVA 4XE0A 2D5GA 1V8CA 3NWTA 4K7SA 3RNEC 4ZYSA 2RKSA 3SVMA 5T1GA 3RUZA 3HOVG 5IP9G 3ZJUA 1G2TA 1A3VA 2KMCA 3E0EA 4ZYNA 1JJ2A 1EEFD 2A73B 5CR3A 4B3SL 1XLNA 1WD1A 4X65L 3HOUB 2LHEA 1AN8A 1SFOH 2F4IA 2DYBA 5J18A 4IOAA 4D2KA 5EKIA 1KIXA 3PO3B 4R1JA 4K8IA 2HJ1A 3AXCA 4FLHA 4Y52H 2HCCA 2RSNA 4ZKCB 2KECA 2ID0A 3J7AF 5KHOA 3NBHA 2CKZB 1Q82C 2UYZB 2B63H 1RRBA 2BDNA 1ZPSA 2WP9B 5FO9B 5FO8B 1ASZA 1J9OA 5C1ZA 3KLRA 1PH9A 5C3EB 4DK5A 4A3GG 3PV0A 4LLGM 4DHZB 3CMEA 1I7HA 3S1NB 1FNUA 3AE3B 4GN1A 3W3AA 3H91A 3BJUA 1HE8A 4URKA 1KLVA 1JE5A 1SN8A 1VQEA 2DNEA 5M3FB 2AL6A 1LT5D 4AH6A 2CQAA 4IPGA 2KQSA 3U9OA 3UGBB 1HFNA 2O6VD 2XIWA 4ANUA 4GLXA 3I4MG 3R93A 3T13A 3P4RB 1R4MI 1X1MA 3K59A 3I91A 4PZ7A 1IW7C 5JHBA 2K39A 1SIFA 4QIWE 4ARIA 5KGUA 3AYHB 4RCOA 3P4SB 4LNOA 2FXQA 4OWTB 4PS3A 3NBHB 4KDLB 1SB3C 1QJOA 4PMWA 2B2TA 4Y7NH 4DUYQ 2CCZA 1A2UA 3RNFC 1CTMA 1JWMD 5IYCG 1Q90A 3HS0C 4FXKC 4LF4L 1T3QA 4M01A 3SFEB 3A4RA 4GNXA 3ZRCA 1PRTB 1PRTC 2H88B 3D6CA 3HM6X 3N9YC 1VZ8A 1AFPA 2L05A 4A9AA 1AARA 2OT2A 3M7NA 1RTOA 3PO2G 1ZXHA 2G1EA 3GZNB 5G5HA 2BBCA 2KN4A 1E0BA 4WRDA 1SAPA 3KYCD 4KKUA 1D2BA 3NTIA 2EJGC 2WB1B 3IFDA 2HD3A 3PRZA 1W3SA 3CAMA 2A6ED 2IJ0A 3S9WA 1EZ6A 4A3JH 2R2OA 4JI1Q 3KUZA 1EY7A 1XLOA 1I42A 5IGFA 3PTFC 3LDZE 1TWFB 4ZRPA 1VDZA 2AUKA 4JI4L 3BZDB 1FIQA 4XGAB 1EQVA 2B2TC 4NJ6A 4QY7A 2KHJA 3RZOH 1DCZA 2RMMA 3J80L 3TIXA 4OELB 3PS6A 3E9HA 4E6IA 3PV1A 3R2TA 1VQAA 4V190 1K0SA 4GNXB 3NSWA 4GNXC 1D5ZC 3DLLA 1JORA 3DVNU 3JSVA 5HG2A 1J19A 4A3DB 4CKEA 1FD7D 2EYLA 5JEAH 2M2LA 4B08A 1STNA 3WOFA 5CORA 2NTTA 2D3CA 1YNJD 2A68C 1XEEA 1YD8U 5IP7H 1E8YA 2VUMB 2B39A 5HURA 5LMUL 3HOZG 1U0LA 2JYEA 4C1NI 3T56B 3NQIA 4DV0L 4AQYL 3A55A 2X38A 2KENA 3S2HB 3PZ8A 2B3GA 1A70A 3P4PB 3VFKA 1UBQA 4C2MB 4GSWA 1WCMG 2NN6H 5M5XH 1HQMC 1SNPA 2OQKA 4OXPA 1E7VA 2FUHB 2KJRA 3DWQA 1NDDA 1I3QH 2NVTB 1FYCA 2IX0A 2WAQG 1PFDA 3NRZA 1H9MA 1RD9D 1WRDB 3AE5B 3VR3A 1LT6D 2CJNA 4A3IB 5CYUA 1HEZE 3JSVB 2OOBB 1XMQQ 3P2BA 4L5SA 1YNNC 1L0WA 2MP1A 2Z0DB 4WWNA 3B6YA 4IALA 4A6QA 1A0IA 2GBMA 4G7OC 5CTRC 4A3CG 4W9IA 5JJIA 2LZ6A 3D32A 4AJWA 4TQ0A 1ZYRC 2EYMA 4JI8L 1C78A 1XO3A 1FCLA 3GV3A 2R3ZA 2ZEQA 1F9QA 3QAQA 4JI2Q 3EFXD 4JYAL 4MIUA 4DBGA 4FBJB 4F7ZA 4IURA 1CI3M 2AL3A 2NVYH 1EQRA 4UDUC 5CV7A 3GTGH 2K6QA 3ZUNA 4HDQA 2QIEB 5E3FA 5DM63 5JOBA 3MHZA 3N32A 5GADC 2JPHA 3GS2A 1STBA 1UD7A 5G5GA 3B1LX 3IVFA 4APVA 4KSLC 1NCVA 1OEYJ 2VXWA 1WYDA 3OMGA 3K7AB 3IAS1 5ELEA 2J7QB 4YY3Q 4OW0A 4B3SQ 2JA8H 2JXXA 4GB9A 1S4ZA 4AUQC 2Q8TA 1R4NI 3C0RB 4RGOS 1EU3A 5C0XG 3CXCA 4ARCA 4BBSG 4HTHA 3U7DA 2UUAQ 2J53A 4GN3B 3NS1A
chains in the Genus database with same CATH topology
2CVRA 1TWCB 1CM9A 3VR5A 4TQUS 3Q8FA 4YT0B 1RTNA 4IDIA 1ZE3D 4KHZA 2NYZD 4DK1A 2DLBA 2WXNA 1S5CD 1VRAB 4WAFA 2F0SA 2WQYB 4P6VF 1B9NA 3U9SA 3MFGA 2XVSA 1SFOB 1F2RI 2BE5D 4IQZA 2JYOA 3TEWA 5EPKA 1ZEQX 2B76B 2WU2B 4RF0A 3FPUB 2B63B 1GUTA 3I4LA 4KGRA 4M8AA 4GDLB 3SK8A 2FJ2A 3MZ5A 1ILQA 3V96A 1I4QA 1RKNA 2MEKA 1B2TA 1SE3A 1N62A 3BDOA 1GXDC 3KLSX 1U9RA 1HTPA 4KV6A 4US9A 2RSOA 5KNBA 4O42A 1E2ZA 4EQOA 3RD4A 2W55A 3NVZA 4K6DA 4C7ZA 3X3MA 3IT6B 3V3XA 3SEBA 3G6JB 1K8MA 2FMCA 4KGSA 1KFYB 2A6HD 3ERQA 4YTPB 1BMLC 1YN3A 3BYTB 4Y7NB 1CHPD 3KK7A 2PW5A 4XT3B 1TU2B 4DXGA 1ZP0B 2RQXA 2FUG1 2JQRB 1BDOA 2WLBA 3L3OC 2XN9C 3KBXA 3LWEA 4CBVA 2E6XA 5E6JA 5HHDG 4V0BA 4WORA 3ITPA 4A3JB 3E5SA 3K5OA 4IZ8A 2F0WA 2K5QA 1EEID 4HRSA 1PGAA 1PTOF 3IXSA 1C8CA 2N0SB 1XCTL 1J8IA 2AQ1B 3RZOB 2ZXOA 3BDCA 1VZ6A 1Q8IA 2CW0D 5KIXA 1WTRA 1ROEA 3A56A 5JVH3 3RFZB 1F2MA 3P1MA 2NZ1D 1NAPA 1R4PB 2ZW0A 1JE4A 4MT5A 2F0KA 1IGDA 3W2DA 3OOCA 2EY5A 2ZW1A 5M5XB 3QWNA 2NB0A 1I3QB 3PIP3 4YSYB 2SAKA 2QDBA 1D4BA 3QJYA 4XYQA 1E10A 1SMYD 5IODA 4KX6B 2GRIA 2K9XA 2BS4B 2RVLA 3AM9A 2K03A 4ZOHC 1DM0B 4ZRQA 2VNUD 1EIHA 4CJ1B 4KTAA 1EOTA 4RHSA 1Z6HA 4LAAA 2PIAA 2NVYB 5CV8A 2SNSA 3GTGB 4LMQD 2W3RA 1NR4A 2RDFA 1GHKA 4J3OD 2A69D 4IUPA 2OF1A 4N6EB 4CKBA 2F0LA 1N63A 3P20A 3OIQA 1E2WA 3PUZA 1YQ3B 1U4MA 4XWWA 1SSOA 4OO1G 1TS4A 2JA8B 3Q6SA 1SNQA 5AUKA 4N9PA 3KQ4A 4ZRZA 5KYLA 2PVOD 4L23A 4H7BA 2MPMA 3HOWB 3J81E 1I6VC 3DMUA 4JBWA 5EE1A 1PRTF 3GTKB 4IFDG 2QJLA 4B9WA 1QOHA 2EELA 1NYRA 1SYCA 5CBAE 5C44B 4US8A 2L5TA 3GP7A 5BN4A 2Z8LA 4IOIE 3DWGC 2N55A 2MGSA 1AEXA 4KJNA 4ULLA 3ZYYX 4RCNA 4ILWA 4DNRB 1G2SA 5K36G 4JE3B 2LJIA 2N9KA 1JOKA 1HPCA 2DY7A 1N5WA 2KWDA 2EYFA 3MP9A 1S5DD 3TDQA 3PZ8A 1EL0A 2PKOA 2DYMA 3AMUA 1A6XA 3ZJVA 1WRIA 1U4PA 3MVVA 3VA5A 3TUOA 2EE1A 4CGYB 2Z4IA 2KAJA 3FRPB 1PTOD 2J42A 3AEEB 4RHRA 1VLBA 2V3NA 4ME5A 2WXKA 3FAHA 3FDTA 2B2WA 3NVYA 3DWAA 1SYGA 1CZPA 1MI0A 3CU7A 2E3TA 3C2PA 1MBYA 3RLFA 5DNFA 4IN3A 1GUWA 3MXGA 4J6HA 3GTPB 4BS9A 3AMZA 2SDFA 3ND8A 3IFTA 4DK0A 3HRZC 5C4XB 1HA5A 3QG1A 1TT2A 2B2WC 4X3UA 3MJ5A 1VF5C 3HUIA 5IT9E 5KNCA 2LFIA 4F87A 2EKIA 4A55A 4C3HG 3HOZB 3NP8A 1GB4A 3B2FA 3MEHA 3LWUA 1TYGB 2D2CC 1O7ZA 3V05A 3TZUA 5C4ZA 2MUYA 4HAEA 1O7YA 4Z9CB 1PUTA 1DONA 1STEA 2XRSD 2EZVA 4RKLA 1AYFA 5JEAG 4OZCA 2K6AA 2QMTA 1EZ8A 2E2HB 4ZUIA 2MHVA 3AE7B 4YSXB 5LHY1 2PYKA 1S5ED 5J39A 4A93B 1IW7D 4ITKA 1L0VB 1KDAA 5KRUA 2X6GA 3JAML 3B9JA 5LL6X 2DBYA 5IGEA 3CIRB 5M3MB 3ETRA 1TZOA 1IUEA 1K52A 1OXSC 4C56C 4B0EA 1CHQD 2GI9A 1PRTD 1B53A 1TR5A 4XXEA 2FE8A 1N5XA 1V8QA 2WKDA 3EUB2 5ELDA 1K53A 1GUSA 3FPPA 4OO1H 3Q8AA 3MWYW 3A54A 4RGTA 2ZT9C 2YU9B 4BBSB 5FLXL 1NEKB 2PPBC 3BK2A 2VZKB 4FP5D 1W6KA 4NMZA 2IT1A 1HQRD 4OL7A 4CHTB 5CV9A 5EPLA 3P75A 4IFDH 2XRQD 2F0MA 3NPPA 2A68D 3T51B 1GJXA 2M9VA 2O2LD 3FILA 4J8QA 2BB6A 5CGKA 1CT1D 4C3JB 1JWBD 1Z7TA 2DNCA 3NK9A 2D62A 3TEYA 5K36H 3AE4B 2K7VA 1YNND 3C3LA 2B8GA 4KGTA 3SFDB 5CMDA 3CWIA 5C3JB 3E0JA 4EVOA 1PZJD 5T1IA 1RDPD 5EKLA 3H8HA 1WVLA 1JRPA 2BYTA 3FILB 2K33A 1KNEA 4A3BB 4BY1B 5LNK1 4YTNB 3PUVA 2L4NA 2CU3A 5C5LA 1YJIA 4Q0FA 4QUFA 2QCPX 1DD2A 1UEAB 1JB3A 4G7ZC 3AEBB 3Q24A 3I72A 5ISRA 4AYBB 3PUYA 1OXVA 1JWUD 4Q2JA 3SDZA 4C80A 2M00A 1CQVA 3D8GA 1GOZA 1NYQA 2EYHA 1PXUA 2IW3A 3A7LA 3S1MB 1UGJA 5NUCA 2AWNA 3X3NA 1PFBA 3T16A 4LTUA 3UI3A 4OVZA 4RGMA 3GTLB 4C3IB 2AQ2B 1OFFA 2H4OA 2FINB 4PV1C 5I9PA 1FXIA 2WU5B 3FEWX 2DY8A 1V1PB 3HVZA 3I57A 5H92C 1PZID 4HMJA 3AE2B 3DWMA 3OPOA 3L9AX 1IKLA 5BMHA 5DM73 4A3EB 3I3CA 4FXDA 1E0ZA 1EIGA 1BOSA 3W5UB 2G9DA 2F3WA 1EY4A 4YTMB 1WTPA 1JICA 2FHTA 2CHBD 3Q8CA 3NVWA 3LYYA 3L7ZC 3J80E 1C48A 2E76C 5DAUA 2BS2B 4PMBA 2IGHA 1PFMA 1FRDA 5E4WC 2WXIA 2AWOA 2JA6B 1B4OA 3U7ZA 3SR1A 4BWGB 1SF0A 5BMGA 4R8NA 2WV6D 2JZPA 3TP7A 3VR2A 3NE5B 1G91A 4NAMA 3AEGB 5D3IB 2W82A 4RKBA 1QB5D 2IL8A 3QO2A 1BCPF 4ZHPA 2X69A 4K6LA 1G6ZA 4WJWA 1WTVA 4RAUC 4XWTA 1Q10A 3AH7A 5T8IA 4OHJA 3HOXB 2YEPB 3PUWA 3Q69A 1JMLA 2ICIA 2PW9A 3GTOB 4GLSC 1SEBD 1WTQA 4KK7A 1LT4D 2B2VA 1JQ4A 1O80A 1B9RA 3EJIA 1SSNA 2Y5PA 2JXMB 1NI3A 1QF6A 2EY6A 4KY7A 3IAYA 1QNUA 5C0XI 4EGVA 2PZUA 5K5PA 1WYGA 1EQTA 2EPBA 2IGGA 4KI0A 4WURA 3K6OA 5ELBA 3H94A 1X3PA 4CQNA 2JEAI 5D14A 5J22A 2BCOA 3LB8C 1EYDA 1C4QA 5D3DA 1WSPA 2B2VC 2L32A 1QWYA 1M4VA 2L1AA 4KKIA 4FF1A 3VR4A 4C3JG 1LABA 2XNAC 2O5JC 2WDRB 4O1NA 1L6VA 3W5VB 1DOIA 2WDQB 2BDOA 2WXRA 1QNKA 1SYBA 1TKEA 1LACA 2L12A 3DHQA 3OIPA 2SNMA 3HZXA 2AQ3B 5G3LF 1TQOA 3AB9A 1JCKB 3PUXA 4RGNA 2KJXA 1HRJA 3A8IE 1DOYA 2F0HA 5MPOA 3Q23A 2O4XA 1BF4A 1MHXA 2YYZA 1FFVA 1SYEA 3WDNA 2F0FA 4WWMA 1YNJC 2K3UA 3E9SA 1TS2A 3R8BA 3U2SC 1HA6A 5BN5A 3QIAA 1B50A 2WINB 2RBMA 5JJZA 2PVGC 5FO7B 1CQFA 4NZLB 1LT3D 1ESRA 1CFMA 3TEZA 4FXGC 4N9TA 4C3HB 4FYDA 2M19A 4H13C 3NWSA 4PQXA 1IHZA 4TKOB 1TS3A 3NTHA 2ON8A 3GTQB 3A8KE 1Y8NB 3GO5A 4FF2A 2JSOA 4IUNA 1K50A 3L4PA 3LX0A 4CJ0B 1KLUD 4C3IG 2I2YA 2Y3AA 3P42A 4KJOA 4P16A 1S5BD 4DAYA 1E2VA 2WXHA 5CC4A 2BA1A 3P4QB 2IPKD 2B2UA 3SK4A 3I4NB 2R93B 4ZAIA 1BCPD 2KA7A 4QCLA 1ZXTA 1CZWA 4JX1C 3MA2B 1I4HA 2WNMA 1C9FA 1EWYC 1IYUA 3DEPA 2F3VA 3HRDD 3VA7A 4XDXA 4CJ2C 2WXPA 2TSSA 3LXFA 1UWMA 4ZK9B 1TKGA 2INPE 1HUMA 2NWGA 2LUMA 1EY8A 3SXHA 2TMPA 4KN4C 4A8XC 2B2UC 4DNTB 2K0PA 4HROA 5JVG3 2EYOA 1LTRD 2PMZB 4IUQA 1D5XC 5IGDA 1IGCA 4BA2I 1SXTA 5A2QL 2LFNA 4RA8A 1UNSA 1GUNA 3M85A 1DXMA 3NUCA 5F2DA 5BMIA 1XLQA 4OZBA 4HJGE 3RZDB 1EY6A 2L52A 1XWEA 2M56B 1OQRA 3S1QB 3K57A 2WXMA 1DOLA 3DUZA 5EBDA 1F9RA 2E2JB 2A5HA 3HKZB 1I50B 3KLSA 5CV6A 3M3YB 2OEOA 1K83B 1EY0A 5AUIA 3A8JE 1B9MA 1OQQA 4HCEA 1MSGA 5G3LD 3K58A 4HKZE 4RNAA 3WOEA 5A35A 2W3SA 2ZXPA 3FMCA 1BUIC 2V0GA 4QMGA 2OHFA 1PTOH 4IUVA 1PMRA 2IX1A 1STAA 1UUPA 5C0XJ 1FGBD 2A6HC 3LNNA 4K14A 5I6WA 1TVXA 5C2TB 5C5MA 2MJEA 2KEEA 4KY6A 5FK9C 4KMUC 4FF4A 1ACCA 4DAVA 4HN7A 2ENBA 3PO0A 1C79A 5I2YA 3E6ZX 2SEBD 1R7SA 2Z4HA 2F0UA 5BYRA 3NTKA 1QOFA 1PGXA 1BR9A 1CA6A 5IOCA 2IX3A 1ZXIA 1TY0A 2L9HA 4RWSC 1TIID 1ESFA 1EM7A 2W54A 1YMHE 1C77A 4HR7B 4P2CB 5EKKA 1CA5A 1GB1A 4HSVA 1QKZA 2CW0C 1TS5A 4IUTA 1L4ZB 4RF1A 1PGBA 4LK1C 4A3FB 3T53B 2K5WA 5D65A 3J7AV 2WS3B 4OIJA 2HCIA 2A74C 4K8JA 3EA6A 4WFN3 4R3DA 4L63B 4FXCA 2EDGA 1MD2D 2BT6A 1VZ7A 4MHEA 4ZLTF 3CRKC 1GUOA 1MVKA 2HDEA 2F0DA 1II3A 1OO9B 2F0OA 3M4OB 2EJMA 3ABVB 1KLGD 4S3SA 3IKJA 2R61A 2YEPF 3T3NA 1R9TB 2Q8IB 1LTID 1HZ5A 1C4AA 1L5PA 2FMMA 4DXFA 3KUPA 1E9MA 1IBXA 5M5YB 3NBIA 4CKCA 3EQLC 5IIFA 1C4CA 2A69C 2KCNA 2GA4B 3MTSA 2MJDA 3KBGA 2WXGA 1H9SA 2KEDA 2XWBB 3CRLC 1O7LA 3VYSA 2QF7A 1N60A 4GDKB 5C6AA 1QILA 1HUNA 3ZGZA 1EY9A 3HEJA 1AZPA 3P63A 4G7HC 2EOTA 4OGQC 1IBXB 1FNVA 1FM0D 2BA0A 4I65A 1L0YB 4HCSA 5JXVA 1LTGD 2F0IA 1EWHA 1V43A 2NN6I 1H9SB 5DEHA 3K5MA 3IAM1 1VF7A 1H9KA 1PYWD 1SDFA 3SHLA 4C1NK 4F7XA 2BW2A 1I4XA 3S16B 4KD3A 2WACA 3AE6B 2VB2X 3OMCA 2JSVX 1JQYD 3JAME 2K5PA 4R8IA 4DN4M 1D1IA 1RYJA 1LLRD 2L0CA 1KNAA 2JA7B 4K5XA 4NW2A 4A3MB 2F1MA 4USAA 1MGSA 1I4PA 2E74C 1ET9A 1BXTA 4GZYC 1ZDVA 3B2GA 1NR2A 5I4DA 1ENAA 2N88A 2KQ3A 4K2LA 1WTXA 1F2YA 3MHBA 5CBEE 3AE9B 2KDMA 1I6HB 1B3AA 3URYA 4ZHOA 4XDCA 1STGA 5KEEA 2JYTA 4U68A 2NVXB 1WTOA 5FLXE 1DOXA 1PTOB 1PTOC 5J1ZA 1HCZA 2IDYA 2M0AA 3TP6A 3NZ3A 3BVGA 1ENCA 2K32A 4KKJA 1F2LA 3SE0A 2F0PA 1WD0A 1Q12A 1W6JA 2JWUA 4XIGS 2LKVA 2QEJC 3DXJC 4IFDJ 1XXGA 4JK1C 1VR9A 1F2RC 1DOMA 1ILPA 2LY7A 3S14B 2D9UA 3VYTA 1G291 2AX5A 4C7YA 3NQTA 3EGRA 1ZYRD 3PIO3 5C3WA 1EFID 4FVMA 1JW9D 1RJTA 1SIJA 4HSPA 2LGIA 5C4JB 2PLPA 3QB3A 1TWAB 1HZ6A 1MI2A 4TRDA 1LTBD 1AP0A 3AU7A 1H9RA 1PDQA 1QG7A 3K5LA 3W1SA 1Y8OB 4YWGG 3E56A 2EVBA 4KD4A 2MH7A 2K1BA 2WKCA 3CKIB 1ICWA 2L83A 4B0MA 1BQQT 2HTME 3VYRA 3RPFC 1XTCD 1WTWA 3P1HA 4EQPA 2V4DA 1BUVT 1V1PA 1F2ZA 2KVMA 1IL8A 5JPMC 2F0NA 3HG9A 4R9WA 1QQRA 1EYAA 1O78A 1IKMA 5EGTA 3NUHB 2OEDA 2Y5CA 3TN2A 3NVVA 5FR3A 3BYYB 1SE2A 4KKTA 3J7YW 2K28A 3CHBD 1C76A 4G4KA 4BBRB 3D4WA 2EYPA 1EYCA 3R3OA 5H8YE 1KF6B 2LEKA 5ELFA 3Q8BA 1RCVD 2IWHA 5IGBA 2WP8J 1STYA 4DF7A 3NXWA 4K2KA 2V4IB 4MH8A 2JE6I 5AFWA 4WIPA 1QOBA 5BYQA 4AS1A 3C1EA 1JOQA 4TQ1A 2PW7A 1J7CA 4ODGA 3MXPA 1FFUA 4XQNA 1CZGA 2PZTA 3I90A 3SR6A 5HFYA 4X3SA 4U673 1Y69U 1A15A 5IGGA 4DFAA 4MACA 4KY5A 2EYJA 3ND9A 2LMCA 2X6LA 5M9OA 2L55A 4PMCA 5JEAJ 2VB3X 1XLPA 3ZJTA 2JXTA 3U52E 3SK5A 4F88A 2PTLA 4HMIA 4NAWB 3NHHA 4QF4A 3KWVA 3BDLA 2IGDA 1F9PA 3FC4A 3FKIB 1L4DB 4RFBA 2LMCB 2PO4A 1U4LA 5M5WB 5I2XA 2K05A 1Y1WB 3TMEA 1KDBA 5EPJA 3P7JA 4M1UB 1SYDA 1SE4A 3VR8B 5C3XA 1SJED 3PZ7A 4FF3A 2KUMA 5HGTA 1U4RA 3DEOA 1ZDXA 2XSCA 4N59A 1L6UA 1KRHA 1YN4A 2V3PA 3GD7A 2KACA 4LK0M 3BK1A 4Q5VA 1BO0A 3H0GB 3FVQA 2JEBI 3AV8A 1VJKA 1D5MC 5I9OA 2C9OA 2N9LA 2K22A 1YQ4B 2PMVA 3ZQ4A 1K8OA 1SNCA 1FEHA 1HTLD 1NVID 4J1MA 2ZXRA 2R7ZB 1ET6A 4NP5A 3MC0B 4QIWB 3GB1A 2QILA 5JAVA 4KN7C 2QSDA 2ACZB 3VQIA 4H44C 3OWFA 1ZUD2 1J7AA 3R2IA 4A3KB 2A6EC 3IT4B 4I7ZC 1T6BX 3BIID 3VRAB 2XWJB 2B2YA 3H3VC 2I38A 4DQOC 1HXYD 4AQ7A 3C46A 1ZKOA 2Q8RE 5EE0A 4ABNA 1L0XB 1G8ZD 1ONLA 4DGZA 2K04A 1TWHB 1SYFA 3VR6A 1SJHD 2Z1CA 2NTSA 1ZOYB 4MM3B 1SBBB 3S15B 4K5VA 2BOSA 4FO2A 3GTJB 1MPEA 4QB4A 2WXJA 1AZQA 5LL6S 4L2YA 1TY2A 2B2YC 4REZA 2EY2A 3MAQA 2F0VA 4L8JA 3TEXA 1JC7A 5ELCA 1GAQB 1R4QB 1EY5A 4BA1I 1F77A 3MXUA 1DOKA 2ICEC 1QT9A 2AUJD 4WQMA 1F0ZA 1OXUA 1UAPA 1ENFA 5BN3A 2J0TD 1Y1VB 3PMFA 4EE2A 2F0EA 2LHDA 1VDVA 4YSZB 1FO4A 3QOJA 4XQQA 1DZ1A 1FR3A 4H0LC 1Y8PB 2DN8A 1Q1EA 3M4YA 1X3QA 4XTCS 2J4XA 4L6TB 1PDXA 4JWUC 1T5XD 1SNDA 1QOGA 4OZAA 3Q0AA 1XX8A 2HUGA 1Q1BA 1STHA 1MSHA 3V2TA 2R92B 1FRRA 2F0GA 4NKLA 4H2AA 3HOYB 1BNZA 2GB1A 4LJZC 3KF8A 1KDCA 2MJ8A 1E6EB 1V1OA 4N58A 5EBCA 4ZUJA 4WH4A 2RDGA 4BY7B 1NUCA 4IUUA 5IGCA 5CV4A 5EE9A 2PNRC 1YN5A 3HGBA 3N52A 3BS1A 5I6YA 1KH0A 2C5CA 4JWSC 2EXZA 3BG3A 2BE5C 2NMQA 3K5NA 4HEA1 2F03A 3QOLA 2G9HD 2E2IB 3AECB 3Q22A 2JX5A 2Q5WD 4KKSA 2DWQA 3SK6A 3OSOA 5A2QE 1GHJA 2BS3B 4F8MA 3ONAB 4MN3A 2EJFC 2WDVB 3BVMA 4OO1I 2BTEA 1JWAD 1QLBB 1YNTE 4HKQA 3TP5A 4YXDB 5EQ0A 2PQEA 2K5DA 1YJJA 3J81L 3MXNA 2MJ3A 5C0XH 3G7LA 3IL8A 3C1FA 1PZKD 3I70A 4UAIA 4IFDI 1D6EC 2N7JA 1KTKA 1OXXK 2I07B 1H9JA 4PT5A 4B9XA 1Y56A 3W9CB 3AEAB 3KWLA 1QCBD 5BYSA 1I4RA 2LS01 1LTSD 4KHVA 2KMMA 1FD6A 1TKWB 1DGJA 4DAPA 2I46A 3D4DA 1TJEA 2PCFB 2O5IC 1D1KA 3HOVB 2L11A 3D31A 1JROA 1AW7A 1LV9A 2B8FA 5KNDA 1AWDA 5CV5A 2JP1A 3TBIB 1FNWA 3VRBB 2ONQA 1XF5L 3Q8EA 4NDXA 3OW7A 2WIIB 1RODA 3AEDB 3I9V1 1DYQA 1PFNA 4A3GB 3J9CA 2JU6X 1Z47A 1PLFA 3D4RA 2J52A 1FXAA 4FNFA 3AB5A 4NJCA 4JPSA 1JR0D 1NENB 2FBWB 3OWEB 4A90A 2VZKD 3I4MB 1BCPB 1BCPC 4IKGA 3D6WA 2E2DC 4EQNA 3DWPA 5EE3A 5C4HA 1RM6C 2L1BA 1C4PA 3K0YA 4PNYA 3A7AB 3S1RB 1T5EA 4XDDA 1FCCC 2CJOA 3AEFB 3EROA 4G57A 4M0WA 2F0QA 5EJWA 4X3TA 2NUCA 1SMYC 4DA2A 5FOBB 3CQZB 3M7GA 4XQJA 3PO2B 3U4EG 3I8ZA 5TSSA 1SNOA 3GQBA 5FKAC 3VR9B 3TSSA 1P7FA 5IT9L 3BWUD 1S5FD 1CJEA 3AE8B 3TP8A 3RMHA 3UI2A 2HDLA 3OHXC 2OXPA 1I4GA 1HHVA 1Q3LA 1ML0D 2R6GA 1UWXA 4OIKA 4XT1B 1P7EA 1TKYA 3GV6A 1RF2D 3N6RA 3DM1A 1VCIA 1KABA 2J7ZA 1TWGB 2KCCA 2KHSA 5KYIA 1CK1A 3D3RA 1RFKA 2KOLA 4ZQ3A 4YIJA 3S17B 2D5DA 1RHPA 1EU4A 5JPNC 1RWSA 4ID6A 3HP3A 1MHHE 1JOOA 4L1BA 2WXLA 1WCMB 1LTTD 2F0JA 1WWTA 2RA4A 3H6MA 2WAQB 1DJRD 2H1EA 1XYIA 1KAAA 5E4XA 1WXQA 3AE1B 2Y0SB 4TMAB 1NSNS 2DYOA 4XYOA 1N61A 2KQ4X 5E1FA 4DU9A 3VYUA 3HVDA 4QUCA 1XCQL 1K51A 1EWCA 3BVZA 5D7GA 3T3OA 1B44D 2NN6G 3MFYA 3T4AC 1IYVA 1B1ZA 5GXGB 1GUGA 1QE6A 1VMPA 3EVQA 1FMAD 1A3UA 3I73A 1JWSD 2HQEA 4K5WA 3AN1A 2PZWA 2H89B 2E75C 3S2DB 1X32A 3O13A 1J7BA 1A2TA 1WGKA 4RH6A 2SOBA 1HFGA 2K01A 2NVQB 1A3TA 2NBFA 1BBXC 4HEDA 2RDHA 5COYA 1LTAD 2HDMA 2INNE 1M8AA 2JA5B 1JALA 1E7PB 1SNMA 2FFKB 1VMCA 1F9SA 1OXTA 1V97A 1GPXA 3TZDA 2WXFA 2BB5A 2WXQA 4X3KA 3GTMB 4ZKBB 3WCQA 2F0TA 3F2UA 4TSSA 2WXOA 1LO5D 1QOAA 2EY1A 2QKIC 3C8YA 3H09A 2RPVA 4XE0A 2D5GA 1V8CA 3NWTA 4ZYSA 2RKSA 3SVMA 5T1GA 3RUZA 3ZJUA 1G2TA 1A3VA 1EEFD 2A73B 5CR3A 1XLNA 1WD1A 3HOUB 2LHEA 1AN8A 2F4IA 4D2KA 5EKIA 3PO3B 4K8IA 2HCCA 2RSNA 4ZKCB 2KECA 2ID0A 3J7AF 3NBHA 2BDNA 1ZPSA 2WP9B 5FO9B 5FO8B 1J9OA 3KLRA 5C3EB 3PV0A 4LLGM 3AE3B 1I7HA 3S1NB 1FNUA 3W3AA 3H91A 2DNEA 5M3FB 1LT5D 2CQAA 3U9OA 1HFNA 2XIWA 3P4RB 3R93A 3T13A 3K59A 3I91A 1IW7C 4ARIA 5KGUA 4RCOA 3P4SB 1SB3C 1QJOA 4PMWA 2B2TA 1A2UA 1CTMA 1JWMD 1Q90A 3HS0C 4FXKC 1T3QA 3SFEB 1PRTB 1PRTC 2H88B 3D6CA 3N9YC 1VZ8A 1AFPA 4A9AA 1ZXHA 2OT2A 3M7NA 1RTOA 2G1EA 5G5HA 2BBCA 2KN4A 1E0BA 4WRDA 1SAPA 4KKUA 1D2BA 3NTIA 2EJGC 2WB1B 3IFDA 2A6ED 2IJ0A 3S9WA 1EZ6A 1EY7A 1XLOA 5IGFA 1TWFB 4ZRPA 1VDZA 2AUKA 3BZDB 1FIQA 1EQVA 2B2TC 2RMMA 1DCZA 3J80L 4E6IA 3R2TA 4V190 5HI1A 3NSWA 1D5ZC 1JORA 5HG2A 4A3DB 4CKEA 1FD7D 2EYLA 5JEAH 2M2LA 4B08A 1STNA 3WOFA 5CORA 2NTTA 1YNJD 2A68C 1XEEA 2VUMB 2B39A 5HURA 2JYEA 4C1NI 3T56B 3NQIA