1D5XC

X-ray crystal structure of hla-dr4 complexed with dipeptide mimetic and seb
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
237
structure length
223
Chain Sequence
SQPDPKPDELHKSSKFTGLMENMKVLYDDNHVSAINVKSIDQFLYFDLIYSIKDTKLGNYDNVRVEFKNKDLADKYKDKYVDVFGANYYYQCYFSKTCMYGGVTEHNGNQLDKYRSITVRVFEDGKNLLSFDVQTNKKKVTAQELDYLTRHYLVKNKKLYEFNNSPYETGYIKFIENENSFWYDMMPAPGDKFDQSKYLMMYNDNKMVDSKDVKIEVYLTTKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA CLASS II HISTOCOMPATIBILITY ANTIGEN
publication title Peptide and peptide mimetic inhibitors of antigen presentation by HLA-DR class II MHC molecules. Design, structure-activity relationships, and X-ray crystal structures.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/peptide inhibitor
total genus 53
structure length 223
sequence length 237
ec nomenclature
pdb deposition date 1999-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
C PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1d5xC01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1d5xC02
1KLUD 1PTOF 1S5ED 1PTOB 3BVGA 1ET9A 3BYYB 1EFID 1LTRD 4NZLB 2IJ0A 3SEBA 1YN4A 4OHJA 1HQRD 1SEBD 1PZID 1CHPD 1I4PA 1KLGD 1LLRD 1YN3A 1I4XA 1TY2A 2QILA 4RFBA 1V1PB 1DJRD 1F77A 1HXYD 1I4QA 1SJED 2XRQD 3BVMA 3EA6A 1S5CD 4RCOA 1LTID 3MC0B 1PYWD 2AQ3B 2AQ1B 3CHBD 1JWSD 1HTLD 4DXGA 1JCKB 1RDPD 1LTBD 1FD7D 1I4GA 3DWAA 1LTSD 1PTOH 5D3IB 2O2LD 3O13A 4C56C 1AW7A 4UDUC 3W2DA 1PTOC 1SXTA 1FNUA 1EEID 2NTSA 1LT4D 1ESFA 1PRTD 1D5ZC 4TSSA 1CK1A 3BVZA 2XN9C 4O1NA 1S5BD 1LTAD 3KLSX 1FNWA 3DWPA 1FGBD 4RGTA 5ELFA 1STEA 1D5XC 2Z8LA 1SE4A 3R8BA 1DYQA 1LT3D 1PRTF 1EEFD 2QEJC 5I4DA 1PRTB 1LTTD 1HA5A 1TS3A 3R2TA 5ELBA 2XNAC 1RF2D 1BCPD 1QILA 1CT1D 1XXGA 2WV6D 2XRSD 5ELCA 1SE3A 2TSSA 3GP7A 1G8ZD 1BCPF 5ELDA 1L0YB 1BCPB 1PZKD 3URYA 1KTKA 1T5XD 2RDHA 5FKAC 1D5MC 3EFXD 1B44D 3OWEB 1JQYD 1PZJD 1SJHD 1RD9D 1EU3A 3BZDB 1PTOD 3TSSA 2NTTA 4RGNA 1V1OA 5TSSA 1PRTC 5D3DA 1LT6D 2ICIA 4RH6A 1YN5A 1RCVD 1ET6A 1SE2A 4RHRA 1JWMD 3MFGA 1LTGD 1MD2D 1EWCA 1L0XB 4Z9CB 1D6EC 4BWGB 1M4VA 1CQVA 1JR0D 1V1PA 1BXTA 1LT5D 1UUPA 5ELEA 2IPKD 1UNSA 3BYTB 1I4RA 3R2IA 4RGMA 2RDGA 1TS2A 2R61A 1FNVA 2AQ2B 1BCPC 2J4XA 4RGOS 1B1ZA 1XTCD 2G9HD 1ENFA 4RHSA 4L6TB 1EU4A 1I4HA 1GOZA 1S5FD 1S5DD 4DXFA 1TS4A 1TY0A 4K6LA 4L63B 1CHQD 5FK9C 4ZYSA 2SEBD 1LO5D 1TS5A 2CHBD 1SBBB 1JWUD 1AN8A 3V05A 3DWQA
chains in the Genus database with same CATH superfamily
3KLRA 1HJPA 1NTGA 3E9IA 3PLVA 3U30A 2LSSA 4KHZA 2KC1A 2DJGC 5EAYA 3PV0A 4XWTA 3CP0A 1PH1A 1UAPA 1R4QB 1FCCC 2QSDA 2PW9A 5C3EB 3KW5B 5GMVA 1WXVA 1KOTA 1SN8A 3K7UC 5JH5C 2F0OA 3CSFA 2LXAA 3P7JA 2MFIA 4PNYA 4QL5A 4WJ4A 2Y3AA 1SIJA 4DR7Q 3M4OB 2DWQA 1SNOA 1MGSA 3F2CA 4OZAA 2YYZA 3B2FA 2AMCB 4DXGA 1JCKB 5M5XH 3I3TB 2EYMA 3DDCB 4IOIE 4HKQA 3ZIMA 1HTPA 3CF6E 3TS2A 2PE6B 2KO3A 5D3IB 1OXVA 4WFN3 3Q3JA 4YSYB 2VH1A 4X6AH 3KFUA 2K6QA 1D1IA 5C3EH 1N8RC 1YNTE 4ME3A 4OO1H 1N5WA 2X8XX 3MZ5A 1MG4A 4HJ5A 3OJ4B 2AKWB 2JUOA 4KY7A 2EY5A 2Y0SE 2ZTEA 1IKMA 4IM0A 3L0OA 4L5TA 1SGHA 1PXUA 4RGTA 1QVGA 1W6KA 4PG3A 3NQIA 2FCMA 1SE4A 3RNFC 1E1TA 1EEFD 2CU3A 2B63G 1JE5A 4P1CC 5JJZA 3S9WA 5C23A 1VR9A 4JWUC 4E6IA 3Q23A 1V9PA 5HGTA 4E74A 4DWFA 2VUMB 3APDA 3U52E 2F0TA 2BGFA 2GBKA 3PGZA 4N9PA 4XZ4A 3ZVVA 3K8AA 1UEAB 3TZUA 4JI0Q 4IFDI 2WYQA 3HGBA 1JW9D 1I50B 4W9HA 5CORA 1PV4A 2F0WA 3EC8A 2JA8G 3CW2C 2LWPA 4II2B 4HJ8A 4KV2A 5AEKB 5IT9E 2LXKA 2H88B 1V8QA 2MBEA 3AU7A 5EGTA 5M5YH 3A55A 3I9V1 4KGRA 3VR3A 2MQHA 4DNTB 1YHBA 2E2IB 2KUMA 3B1LX 4OL7A 4QY7A 2WLBA 2VQEL 1DGJA 3MC9A 4GOCA 1J0GA 1X54A 5C5LA 5JJKA 3C2PA 1S3OA 2B8FA 4IO9A 2INCC 2N9PC 1FFUA 3M4YA 1V8CA 3DHIC 2A73B 1TWHH 2NUCA 4HCEA 4F87A 5C0XI 1SNCA 1CQVA 1DCZA 2EXDA 3TZDA 5IP4D 2HHHQ 2L9HA 1N6ZA 5C4ZA 3B08A 1DOMA 3MXNB 3DWMA 4B3RQ 3D3RA 3Q0AA 1BCPC 3Q3FA 4BOSC 3PCOB 2G3QB 2IWHA 1PH9A 3ZXRA 2VNUD 2IHEA 1MI2A 4XGAB 4YTNB 1UBQA 1QG7A 3V2TA 4DXFA 1E8XA 4PZ8A 1FRDA 2KVZA 4GKKQ 1EWYC 3ULPA 4O2DA 5KHOA 3A4RA 1QOAA 1PH7A 5K36G 1Q10A 3V05A 4AUQC 4HXDA 1NBFC 4LW1A 2PMZB 1PTOF 4ZCKA 4CHKA 1N36L 2L52A 4OELB 4A3MG 5IT9L 5IGCA 5KYLA 1AEXA 3SEBA 4G11A 4KZ0A 1K8AC 3DVGY 4K0KQ 2KJHB 3VUYA 3I57A 1AH9A 1FXIA 4RNAA 2QW7A 5HFYA 1FMAD 1MFWA 2FUHB 3S15B 4QCLA 2E2DC 2RDFA 4P71A 5HHDG 4HKZE 4PK1A 1EY0A 2KWCA 3T8MA 2IGHA 1GJZA 4JPSA 1AZQA 4GN3B 3MAQA 2UXCL 2CW0D 1TKYA 2KLCA 4ZRPA 2LZ6A 1ILQA 1P3QU 4G3XB 4A3GB 3WALA 3KYDD 1EY4A 3RNUA 1ZE3D 1MPEA 2WXFA 4J6IA 3DWAA 3KLSA 2A69D 3FILA 5M3MB 2N78A 3O13A 2E2JH 2KX3A 4L8JA 4HJGE 1KC8C 1W6JA 3SK5A 4DKAC 4A3MH 1PUTA 1N33Q 3W1YA 2BS2B 4DPGA 2V1YA 1PH4A 2AL6A 1E24A 2XWJB 4D2KA 4G50A 2JWZA 1MBYA 2RSOA 2LJ5A 3TBLD 4LF6Q 2DNFA 3D4DA 4ZRIA 1D5XC 4ID6A 3W5UB 1KDCA 1C48A 4YCVA 3E56A 2PKOA 2K5HA 2JA7G 2EYPA 3V6EB 3AE7B 1QWYA 1Q5WB 2IO1B 3AE2B 2HUGA 2PI2A 3MEFA 4FF4A 3CKIB 4FLHA 3S1RH 3VXWA 3PUVA 4A75A 3QX1A 1F2YA 3A7LA 3ZYYX 5BO4B 5M3MH 5I9PA 1S1QB 2KTFA 3PIP3 1SE3A 4ULLA 3T1YL 4W9DA 1G8ZD 3CXCA 4YSXB 3Q24A 5EKIA 4JPBW 2NN6H 4F88A 1GUOA 3AU4A 4W9EA 4GN5A 5FKAC 2ZJDA 2L00B 1Y8OB 2JPHA 4MN3A 1IBLL 2D10A 5D2MB 1EYCA 4N8FA 4JVZA 2NZOA 2QGQA 2D5GA 3N30A 2F0EA 1JE4A 1LUZA 4LF4L 3I90A 3ZNHB 4H7BA 5DM73 5EPKA 4G7OC 1V5TA 4RH6A 3T16A 1HNZQ 2XK5A 1CM9A 1FPYA 1RCVD 1YHQA 4JOIC 3KUDB 5HY6A 3RUIB 5DNFA 3MA2B 2J53A 3NVVA 4RAUC 4AYBB 4G0NB 3GTKB 5DAUA 1E1OA 4LDTB 3N1ZC 4HVBA 1PGAA 1BXTA 1DGSA 3CRKC 4C1NK 1F0ZA 1Q1BA 4BY7B 3H9DA 3R2IA 3ECIA 1FXAA 1V97A 2R61A 4RGOS 1E2WA 1ZEQX 1LFDA 4KJNA 3NOBA 4GB9A 4IALA 3CCQA 1WZ3A 1VQOA 3NZ3A 4GKJL 4BBNF 2ZCCA 1F2LA 5IN7A 1XPOA 1S5FD 4H13C 4NPSA 3JAMc 1YNNC 1N61A 3VQIA 2ZVNA 5G5GA 3K9OB 4LJPB 3NRZA 1ZXTA 2A68D 4IWPA 3K5MA 4X62Q 1XLQA 5BR8Q 3U8ZA 4C3IB 2LS01 2IDYA 2R2OA 1E22A 3JW0X 3DWQA 4FJVB 4GNXB 3GTKH 3FHWA 1KD1C 1TT2A 4AQ7A 1GUSA 3RCZA 1MSGA 2RBMA 3VR2A 2FE8A 3PVLA 4BY7H 3RD2A 5IP7G 4E3CA 1MG8A 1O7IA 1V6EA 2M4NA 2HDEA 4WURA 3W1SC 3KWLA 3RUZA 4C3JG 4YWMA 4HIOA 4DV0L 1OXXK 1ROEA 3GTLB 4Y52H 1RJTA 3OW7A 1GUTA 2HDMA 3J81c 2OJRA 2INPE 3NY5A 3AE6B 3GV3A 1PYWD 3HP3A 1VQLA 1Y1VG 1KNAA 2K5QA 3CHBD 1UWMA 3I72A 4C3IH 3IHPC 2YU9B 4B9KA 1F52A 3A56A 3CRLC 1X3EA 3QG1A 1F9PA 4BY1B 2MW5A 4NJCA 4AWJA 4BKSA 4LNNA 4KY5A 2I5HA 2HD5B 5M3FB 3DM3A 2G4DB 3PREA 3LWUA 2NZHA 2KYWA 1PDXA 5DPTA 1NYRA 1V86A 3JAML 1BBWA 2N9LA 2F52A 3UDFA 1PH2A 1EEID 1NAPA 1LT4D 5IP7H 2OWOA 3HOUG 2D2QA 3GZNI 4NXMQ 1R7SA 5KIXA 2XVSA 2GLSA 1C78A 2F0SA 4C3JH 4JI0L 1QJOA 1PA6A 4LFCQ 3Q8CA 2C35B 1Y56A 3CCJA 3G6JB 3HS0C 1KRSA 2EY6A 3JYUA 1Y1VH 4OVVA 5GROA 1J7BA 3Q3MC 4X57B 2YV5A 3WAPA 1U4LA 1QILA 2VB3X 4RKBA 5M3FH 2EMTA 4XDDA 4B08A 4KMUC 3BU2A 3ULLA 3HOZB 2Z6BA 2OOBB 1RFAA 3C3LA 2KD0A 1FXTB 1V2YA 2LMCA 1JROA 1GHKA 4FXDA 2K1FA 2R93G 3ZNZB 1EY5A 1L0YB 3Q14C 3HOUH 3RPFC 4TKNA 4EEWA 2MBOA 2EOTA 3EBEA 4ANUA 2ZT9C 4ZRKA 3B6YA 5I6YA 4ILWA 2MHJA 1EWIA 3EFXD 4A3JG 5FLXE 1M8AA 2E6XA 1WMHA 1SJHD 2EYOA 1G91A 1B8AA 1ZDXA 3HKZE 4LDTD 1E7PB 1Z2MA 2OQ0A 4NMZA 1V1OA 4YL8A 1EF5A 3DPDA 1GO3E 2GRIA 2N0SB 1YIJA 4F7XA 2NBWB 3PPAA 1OO9B 1B4OA 1SSOA 3X3NA 5K5PA 3I55A 3HOZH 1L0XB 4N9F4 2OF1A 2XK5B 2C9OA 3V60A 1YNJC 5EE3A 3A8KE 4MACA 2J0TD 1UNSA 4H0LC 2LASA 3NVWA 2R93H 2K6AA 2AWOA 2K39A 2M1MA 2WB1G 5FLMG 4LF7L 1UEBA 1UE6A 1PH6A 1PH5A 1CA6A 4LF8L 1IYUA 4OWTB 2M8SA 2V3SA 4HRSA 4A3JH 3FAHA 2WIIB 2VY3A 2K8HA 4K0KL 4KN4C 4A8XC 2J7ZA 4FN2A 2JQOA 3GTOB 1EUJA 3P20A 2PMVA 4KX6B 5HG2A 1B9RA 1C3TA 1D4BA 3P63A 3R7QA 3V3XA 3HZXA 2KJXA 2RCFA 1STYA 4IUQA 4GNXC 4WJQA 1CZWA 4EZLA 4MHEA 5A2QE 2JSOA 2J0MA 3NS8A 1ET9A 2MPMA 5FLXL 3RMKC 5A35A 4M8NA 2K52A 1KDBA 1SMYD 4GOPB 3VH4B 4R9WA 1HUMA 2C7HA 4K1RB 3KVFB 2EYFA 2AHOB 3CCUA 2BWFA 5JEAJ 5M5WH 3QWNA 5FLMH 2N9EB 4IKGA 1SJED 2PVOD 2BYVE 4B0EA 1LM0A 1SYBA 1CTMA 2ZPNA 2K3UA 4GDLA 2K5PA 1V81A 1P0RA 2MSED 1N9WA 3PO3G 1QF6A 2PTLA 2LRUA 1TYGB 1NDDA 1B9MA 1IKLA 1VQ5A 4HMJA 2BPSA 1EIYB 1X32A 3VYTA 5IGEA 4HIKA 3T13A 2Z0EB 1EWHA 1CKMA 1C76A 3TQYA 5FOBB 4LTUA 4G4KA 2AWTA 1C77A 1C0AA 4ZHPA 1ESFA 1ZYRD 4JI1L 4POFA 2CKHB 2J7QB 1GJXA 1TBEA 3KH0A 2KWDA 4UPAA 4C2MB 3IAM1 2WU2B 5LHY1 1VZ8A 2BOSA 1X3PA 2MUYA 5CHVC 2NVXB 3MTNB 4R4CA 1P8LA 3R8BA 2N7EA 1HR0W 2A6ED 5A2QL 1K83B 1J9OA 1C4PA 3PO3H 4MEMA 1EQTA 2BYEA 4TUUA 3SFDB 3V61A 3MFYA 2I2YA 2WXGA 2FCQA 2FJ2A 2KEDA 1HNZL 3HIZA 4ZHOA 1SYDA 3A9JA 3DXJC 2WAQG 2KFKB 2N9XA 1W2BA 2Z0SA 3J9CA 1YJJA 3HOWG 3VH3B 3TUOA 2OT2A 4IFDJ 2LMCB 3OTOL 4JI7Q 4A3KB 5IGFA 4IZ8A 3S16B 1HTOA 1L5PA 2NVXH 1MHXA 1PZJD 4OZCA 3ZNGC 1L1OA 3SK6A 3PO2G 4IUUA 1YIWA 4X3KA 2ZW0A 5BYRA 4LNIA 1ML0D 1YJ1A 3NHHA 2DZIA 2JQRB 2F0PA 2QJLA 4GLSC 3RNBC 1PYSB 2ICIA 4OONA 1E6EB 2HQEA 2B2WC 2EY2A 3VVWB 3IBEA 4WQOB 3K80C 4J1MA 4A3OA 2MJDA 1R4NB 1FL0A 4R1JA 3J7ZC 2F0IA 1E8WA 2UXDL 2BQQA 5C0XJ 4YTPB 1R9TH 2BW2A 1H95A 1E90A 5EE9A 2J4XA 4HN7A 4J15A 1WE6A 2E5LQ 3HOWH 5ISRA 4A3KH 3S16H 3FC4A 3R66C 3PUWA 3A5ZB 4K5XA 1B50A 1V43A 4A3EG 5T8IA 3KJOA 3ZLZA 5JXVA 1WCMG 3PO2H 3MXUA 4EQ5A 2EZVA 1A6XA 3AFPA 1VQMA 2WXIA 1TKWB 3W5VB 4AOFA 1P9DU 3IAS1 2PCFB 2B2VC 3U50C 4CBVA 2J52A 2D2CC 3CQZB 1JWUD 3HOYB 5CHFA 3E0JA 4REZA 5IYBG 2M2LA 4CKBA 1PTOB 5IWAL 2LJIA 3BVGA 4X66L 1VQPA 1YITA 3NUHB 1WTQA 5KRUA 1QUQB 1T5EA 4YSZB 2BA0A 2FXQA 5EBCA 1YD8U 2KQ4X 4TQUS 2C9WB 3WA0A 4QMGA 1CHPD 3DVGX 1Q0WB 2BDNA 4MGKE 2QILA 1YJIA 2VQEQ 1ENCA 2N7JA 1EZ6A 4M8MA 5JPNC 2XRQD 4NQKE 4H44C 1LTID 1SE8A 4A3EH 1AP0A 1WCMH 5I2XA 3NPPA 3EUB2 1LTLA 2BCOA 1U9RA 1Z7TA 4N9TA 2M56B 3LB8C 4OEMB 3CC2A 3CQZH 2PPBC 4DHJB 4E71A 4Y7NB 3OW2A 3VR4A 3MHSD 4GDLB 3QA8A 2CWAA 1PTOH 4RWSC 5JPMC 1STBA 5BMHA 4KKUA 1NMFA 2KXJA 1SYEA 1RFKA 2SAKA 1LACA 4YY3L 4P75A 2BS3B 1WRIA 3C19A 3T56B 1IBKL 2NTSA 3VTWA 2EELA 2JEAI 2WP8J 2TMPA 1WJ4A 3H0GB 2Z4HA 1LTAD 2V4DA 5CYUA 5IYCG 4DGZA 4RM8A 1Y69U 3ML9A 4IURA 4JLCA 2WINB 3P4RB 1QKZA 2R2QA 1EIGA 5LMNW 5EE0A 1TWFB 1VQKA 4A3DB 1FEHA 2XTIA 3I4LA 1N36Q 4DAVA 4WJOA 2DAFA 4Y7NH 5C4JB 1L6VA 4FVMA 1XXGA 3DEOA 5I6WA 1YJWA 3EFCA 2WKDA 4HWIB 4CKCA 4I65A 3UDGA 2NS5A 3GP7A 1C9OA 3RZWC 3UQAA 1N60A 2RSNA 1KABA 4UP9A 1ILPA 4JI2Q 3L54A 3PRZA 4FULA 4EFOA 2GVAA 4A93B 2NZ1D 3MHZA 1J19A 4P73A 3V96A 1OTRB 2KWVB 5LXIB 2V4LA 5EBDA 2UXCQ 3A9JB 4MTKA 5IYCH 3AE8B 1NNXA 4QAYA 2MO1A 3QIJA 1TWFH 2PMZE 4A3DH 3NBIA 4I6LB 3T1HL 1K53A 2GBMA 4WWPA 4FJZA 5C4JH 1L1OB 4OW0A 3GOEA 1SE2A 2LGDA 5J22A 1LTGD 2IY1B 3U9OA 1MD2D 3BDLA 2WXOA 4YIJA 2F0UA 3D6CA 2IYDB 3QWZB 4B6WA 4WJ3M 1XMQQ 1UUPA 4FHJA 3AE3B 3K57A 4US8A 4NQLB 4BBRG 4A93H 5CBEE 1FNVA 3PUYA 1NI2A 1HH2P 2Q2IA 4L6TB 1EU4A 2NPTA 3A9KA 3SE0A 1XLPA 1Y8PB 1XYIA 4LAAA 5CV9A 3RMHA 4ALPA 2C60A 4LF5Q 2KLGA 3OHXC 1NR4A 1E9MA 3AEBB 2DYBA 4UP7A 4M01A 1IBXA 2KQ3A 3MXPA 5IGBA 3PRMB 4MJSA 1TS5A 1I7HA 1IXRA 2CHBD 1KJTA 3A5UA 1WJNA 2KQ7A 1TIID 3R93A 3ERQA 2WU5B 3K5OA 1FVIA 1FM0D 3NVYA 4F1SA 3G7LA 3BYYB 1EFID 2ZXPA 5FO8B 4NZLB 4R4TA 1II3A 3L0WB 4WORA 2PIAA 3TP5A 4DDID 1IBLQ 2AYOB 1HQRD 4OIJA 3PF4A 1WGGA 2DY8A 1I4PA 2JY6A 1KLGD 2CKZB 2NMQA 2WDRB 3H6NA 1VQDA 2BVCA 3W3AA 3P1MA 4LF4Q 1K50A 1PQSA 1UD7A 2K5WA 4KN7C 4JOIA 3EA6A 1HXYD 1CZPA 2V9HA 3GE8C 1WXAA 3CPFA 4K6DA 1QQRA 2JSVX 1C8CA 4DAYA 2F0JA 2ZPYA 5CV6A 2Z0DB 2LHEA 1GB1A 1P1AA 1E3PA 1XNRL 4KV6A 2Y5CA 2RVLA 3NHEB 1C4AA 2L05A 3T53B 4PS3A 4DV7L 1WD0A 3A33B 2IX3A 4HROA 3F8TA 2RR9A 4JWSC 3AMUA 4TRDA 1JRUA 1EF1A 1QVFA 3HOVB 2EYLA 4IOCA 1L4ZB 2D11A 1AW7A 2PJHA 4LF9L 3QK0A 1YI2A 1FNUA 1KLVA 5C3EG 2ZNVB 4GKJQ 3ZGZA 4OO1G 3EN2A 3C0RB 4JW0A 4KHVA 1QOFA 5KGUA 3FEWX 2I5MX 3DWGC 3CCMA 2CJNA 1F1HA 1K73C 2MH7A 5G5HA 2WFWA 5GAHC 1BDOA 3K59A 1DYQA 1D7QA 1XF5L 4L5QA 2FIFA 4GXBA 1LTTD 4DU9A 2KVRA 4K3BA 4JI7L 3HEJA 1W3SA 2JN4A 2C5LC 4R3DA 1CI3M 1GUGA 3T4AC 2LUMA 4LLGM 4CQNA 1DOIA 1SLJA 4DNIA 2CHZA 2KHWB 4ME5A 3HOVH 1FD6A 2D07B 5ELCA 2ZXOA 5EQ0A 1D8LA 5T1IA 2J42A 4MSQB 3X0WA 4KD4A 1L2NA 3S2HB 3S14B 1NJIC 2R3ZA 2QDBA 4HLEA 2KDEB 5JEAH 4DV0Q 4NXNL 1WM3A 3AEFB 2HCCA 4ZOHC 2B29A 1SRUA 3PO0A 3KF6B 3ULJA 5H1SE 3RNAC 2I5LX 4HIDA 1A62A 3GB1A 3A4SC 4KLKA 3ZTDA 2HIVA 2NVYB 2J0JA 1OXUA 5J1ZA 2L3ZA 1GKHA 4DK3C 3APFA 5FO9B 4WWOA 3SK4A 2JXTA 4DV6Q 1CSQA 1Q90A 3M4OH 3R3MA 2XEWA 2E5LL 5JHAA 2X6LA 1LT6D 3NG0A 1VQ7A 4BA2I 4BKTA 4MM3B 4USAA 2VUMG 5C4XB 4IPDA 3F1ZA 5CBAE 3GO5A 4X65L 3VDYA 1U4AA 1E7ZA 2W82A 3FKYA 4F7ZA 4Z9CB 2BTEA 4RF0A 4J8QA 3CAMA 3S2HH 2R7FA 3D8GA 2E2HB 3NZSA 4YT0B 3BDOA 2FUG1 3DHQA 3PF5A 3RNCC 3HOXB 4MTNA 1B3QA 3C8YA 3H94A 3L16A 1WTHA 3E0EA 1KH0A 1JALA 1I6HB 1VCIA 5JJIA 5IT9c 4IN3A 4QB4A 3KBGA 2JA6B 4ACFA 4HMIA 2ASQA 4AQYL 3HM3A 4LFAQ 3A0JA 1R4PB 1LABA 2H1EA 5KEEA 4PT5A 2KX0A 5C4XH 1SBBB 2F3VA 2KCMA 5C0XG 5E6OA 3N52A 2VUMH 2OTJA 4GMVA 1DOKA 1S5ED 2MBQA 3TEXA 1CUKA 2E2HH 2CH4W 2N49A 4IFDH 1B2TA 4APVA 3HOXH 1GAQB 1YQ3B 1I50H 4KKSA 5C5MA 1IGCA 1JJ2A 1E10A 3CF5A 4DR4Q 3QOLA 3ZRFA 2A1AA 4A3LG 1N32Q 1JICA 2B8GA 4AP4C 1HZ9A 1WE7A 1WFYA 2E2IH 1ACCA 1E2ZA 4WAFA 1GHJA 4MIUA 1AYFA 1UWVA 3DBLI 3MEHA 1UBIA 2Z4IA 1WTRA 1JORA 2M19A 3ZDTA 5J2RA 2B3GA 1LTBD 4KJOA 2M0XA 4ZDVA 3OJ3A 1Q82C 1WGHA 4WWMA 2HE7A 5D6JB 5C0XH 4FHKA 2D0OA 3K5NA 4QIWB 1TWGB 4C56C 4H02A 3OSOA 3PMFA 3VRBB 2EE1A 3PIO3 5TR5A 1IPGA 4WAAA 2W55A 4LF7Q 1Z5SB 3B9JA 2PZUA 3SXHA 4LF8Q 2W3SA 2BT6A 2NCNA 1SSNA 2XN9C 1NENB 4JL9A 4LUOA 3UDIA 4HIMA 4A3LH 1UE7A 1X6OA 4JI2L 5D65A 1GM5A 2K25A 2PLPA 3PQIA 3DEPA 1PRTF 3N32A 4DK6C 2Y5BB 4IWQA 3R2TA 3F2UA 3PHWB 1HR0Q 3JSVA 1FR3A 4A3GG 3RN2A 2IHFA 1AE3A 2KCCA 1YZ6A 1CJEA 1EM7A 1DOXA 3RLNA 1IHZA 1TKGA 3J81j 2X38A 3RZFA 2LXJA 2ICEC 5M3MG 1S40A 1PFSA 4OWWB 1C4CA 3D32A 3AM9A 4A20A 5IY0A 4PZ7A 2WB1E 1WSPA 1STHA 4CJ2C 2VQFL 4TQ0A 1KM7A 2ZJRA 4DHZE 4ZAIA 5CC4A 3WIMA 2NN6G 4PMWA 1WX9A 1XQQA 4S0RA 4XX5A 2N88A 3ZRCA 1IZ6A 3Q8FA 1XMQL 3S15H 4GN4B 2A69C 1YVCA 2F0DA 1VF5C 1EU3A 3K7AB 5D14A 2UUBL 4HTHA 4DR2L 2SDFA 1KAAA 4RGNA 2QHOA 4CO7A 4K3CA 4ARIA 1VDVA 4A3GH 1WM2A 2A4ZA 2KWUB 1EY8A 4W9IA 1VMPA 3OMGA 1GC7A 4LF5L 2XBBC 1PFDA 4JI1Q 4BS9A 2JXXA 1D6EC 4LCDE 3TL5A 5CHWA 2R92B 1Q8IA 2LGXA 2L4NA 3S2AA 3AE4B 1Q46A 3PV1A 1PFNA 2F03A 1G6JA 3FKIB 2M9VA 2K04A 4U673 2KOLA 1YMHE 3BZKA 1KF6B 3T9LA 2V0GA 3S1MB 3ZJUA 4BVUC 1WJUA 1HNWQ 3K7AH 3VR8B 2ENBA 1T0YA 2GI9A 2KN4A 2RPVA 4HPPA 2B2TC 4DR5L 2VZKD 3QR8A 2JT4B 2BDOA 1C1YB 4ZK9B 1WFQA 1KDAA 3QIAA 3NENA 1I3QB 1LO5D 4GLAC 3DCGA 2KMMA 3VTVA 1AN8A 3ZJYC 3OLMD 4X64L 1KRTA 1HUNA 3NEMA 4AYBG 1ZDVA 1ZXHA 3L3OC 3OWFA 1CSPA 1VQ8A 4FF3A 3GE3C 1Y1WB 5G2NA 4B95A 1TU2B 4BY7G 4DDGD 2IJ0A 3OTOQ 1VQEA 3FKIH 3ZW3A 4L23A 2JP1A 2G45B 1SNMA 1PZID 5J3BA 3BK2A 3S1NB 3IAYA 2KC2A 3RZDB 2ID0A 1HRJA 3S1MH 3A1QA 3BWUD 3UF8A 2B2WA 4IUPA 2Q2UA 5GAGC 1F77A 4KIKA 3PUZA 2G1EA 1E7UA 4RCOA 1BUVT 3VUXA 4C3HB 3ALBA 1HZ6A 2O4XA 1PGXA 4DV2L 3M62B 1GNUA 2IGDA 3PGEA 3F2BA 1V9JA 4C3IG 1JWSD 2FFKB 2BB5A 3S2DB 3MJ5A 5D94A 2UXDQ 3N1YC 1KHIA 1WY8A 2WAQE 3STBC 1CKOA 1HFGA 2N1WA 2WXLA 5KHQA 1YNND 1Y1WH 3GTQB 1SXTA 1IGDA 3H7PA 4RA8A 2RHQB 3J7YW 1I42A 3QAQA 1BUIC 3S1QB 3ZTCA 1QB5D 4ASWC 4KGSA 1S5BD 2KT7A 2UWQA 1I5FA 3TBIB 2K0PA 4QUCA 1FGBD 2PZWA 4DAPA 2DN8A 1XPRA 1M94A 1STEA 2NWGA 4C3HH 3U7ZA 2L5TA 1SF0A 3RD4A 2WXMA 1QOHA 5LMNQ 4TV3A 3VUWA 2Y0SB 2L1BA 3S2DH 3VR5A 5IWAQ 5EE1A 4BY1G 4X66Q 5E4WC 4C7YA 1EYDA 1JMLA 5GAEC 1MVKA 5M3FG 2IGGA 5BN3A 4DV6L 2H4OA 2KZRA 3JSVB 2NR2A 3GTQH 4HPLB 4XIGS 2TSSA 1XLOA 3KK7A 3OG5A 1O80A 2N3SA 1XNQL 1BCPF 2JK8A 3S1QH 3AULA 3GZNB 1HZAA 3SU8X 2IO0B 3FILB 3PTFC 5IODA 2REXA 4ANXA 3D31A 1FYCA 4A3CG 4WWNA 2BE5C 2KMCA 2R6GA 3GTLH 4MGYE 2BBCA 1WXQA 3K58A 2ZJQA 4OGQC 1K0SA 1WX7A 3CCVA 5HGQA 4JCVE 2UU7A 1EIFA 4JK1C 2MHVA 2YU9H 2IT1A 4BY1H 1OTCA 4YY3Q 1ET6A 3I4MB 2DZKA 3CMEA 1JWMD 1IBKQ 2ZXRA 3HOZG 2WGSA 4LFAL 2HIXA 1V1PA 3EJIA 3P75A 1UZXB 2RGFA 2V4IB 4JI6L 3CD6A 4JV5L 1WYGA 2MO0A 3I4OA 3M7GA 1A3TA 4RGMA 3O65B 1TS2A 1C4QA 2KHIA 2Z6KC 3HG9A 1RIPA 4DK1A 1B1ZA 5I2YA 5L37A 2KOXA 3ZDMC 4ARCA 4IUNA 4JIOU 1JQ4A 3DQVA 2Q8RE 1H9RA 3A54A 4A3CH 2YTYA 2R7ZB 1TZOA 5FLXc 1EQVA 1EZ8A 3EVQA 3GQBA 3TREA 3QHTA 3EHVA 4DR4L 4K6LA 4POGA 3BINA 2UUAQ 2IBIB 2ZZPB 3FRPB 1N32L 4KHPL 2K9XA 3NS1A 4LNKA 3I4NB 1UH6A 1ISNA 2A6HC 4NDXA 4OWXB 2DUDA 3W9CB 5CR3A 3TP8A 2EPBA 3LXFA 2VZAA 1WXMA 1KL9A 2PO4A 4JI5L 3I70A 1LXDA 1UGMA 2WS3B 1YN4A 4P72A 1EQQA 2CHXA 3D6WA 1EY9A 2PW5A 5CX3A 1TY2A 2I38A 3L13A 3T1HQ 1U0LA 4FXCA 3AEDB 4KGTA 4HSPA 4OVUA 1DZ1A 2R7ZH 2FIDA 1A2TA 4H2AA 3S24A 4N59A 1S5CD 2IO3B 2E3TA 1YNJD 4ABNA 1P16A 4NNJB 2DNCA 3UQBA 1V80A 2FNJB 1YBYA 2PVGC 4KIKB 3TMPB 3ZJTA 3TJPA 2O2VA 5DM63 3I4NH 1RTNA 1OXSC 3X23A 1J8CA 2ASBA 3H91A 4A3IB 1LTSD 1RYJA 2Z1CA 1BQQT 1HR0L 4PS7A 4FF1A 1NMGA 3LGJA 5IE8A 2R7DA 1DD2A 3UE0A 3R3OA 1VLBA 3NTKA 3LX0A 4NAWA 4M02A 1RAXA 2OTLA 2WP9B 1SNDA 5C3WA 3DHGC 2O5IC 1FNWA 2VXWA 1A63A 2BB6A 3QJZA 4C4VA 1LV9A 2LRWA 3TP6A 3UI2A 4JYAL 1MJDA 2OJWA 3NE5B 4DF7A 3H3VI 1SE9A 1GD7A 1Y8NB 3FMCA 4FF2A 3M4PA 3GTOH 3I5JC 1SMYC 4CHTB 1E8YA 1HEZE 1EQRA 1HE8A 2BYFA 3CWIA 2XNAC 4I6PA 2HCIA 4XQNA 4ANVA 4A3IH 1X3FA 1UF0A 1GXDC 3M3YB 4O0AA 2L7RA 3DVNV 3QQ8B 1J6QA 1JMCA 1TWAB 4GS3A 4LUZA 1VQHA 3PIOA 1QCBD 4ICUA 2CS4A 3LDZE 2KVMA 2L1AA 4W9JA 2KDFB 3SD5A 5ELDA 4HSVA 4W9FA 4K7SA 1NBWA 4ZKBB 1WD1A 1CZGA 5CV8A 5C44B 4HR7B 1J5EL 3ITPA 1RRBA 2VH2A 4YWLA 1B9NA 1F9SA 3J80i 1F2RI 5HI1A 3U7DA 1XNRQ 1JQYD 1AZPA 1BF4A 1RD9D 4NAMA 1T3QA 2NB0A 5E1FA 2BF8B 4DV7Q 3AE9B 2EIFA 1GUAB 1SB3C 1TQOA 2HJ8A 3FDTA 2KDIA 2PZTA 1WVLA 2LVQA 1QOGA 4LF9Q 1IYJB 1HNWL 3OIQA 4KSKC 2UUCQ 2WKCA 4DFAA 2L8JA 1RL2A 3M3YH 2ON8A 1IW7C 3M4QA 1L7YA 5GQOA 4G7HC 3DBSA 2HTME 5KYIA 2N55A 2K50A 4DR3L 3ZQ4A 4IQZA 3TEYA 5C3XA 2IPKD 3U9SA 3OOCA 2CJOA 3CSTA 1EYGA 2AQ2B 2IY5B 1TJEA 5FJ8G 4A3KG 2D3AA 1D3ZA 4C2MH 3KYCD 4P2CB 2LGIA 1OXTA 1QNKA 3S17B 1K52A 5EKLA 1SAPA 1MJCA 4X3UA 2SNMA 1L0VB 1WTVA 2LD9A 3IG3A 4XQJA 4WJNA 1F9RA 2D62A 4TQ1A 5FK9C 4JG2A 3FVQA 1K83H 1RLFA 1L2FA 1O7ZA 2BS4B 2MJEA 3B0AA 2KEEA 1WMHB 2L15A 1X1MA 1G6PA 2UYZB 3GTGB 4PYZA 3D0FA 4LNFA 2M00A 4NXNQ 2D3CA 2GB1A 1GUNA 4R4QA 2AUJD 3PIPA 2YVCA 2NBVB 2WDTB 2Q8TA 2F0GA 4K8IA 2FAZA 2KJ6A 4K2LA 4OHJA 4KVGB 4NY0A 5MPOA 2D5DA 3H15A 3TIXA 4GGQA 3OYYA 5FJ8H 5BN5A 4QGUA 3RLOA 3P4SB 3KF8A 3UIPB 2JZ3B 4CKEA 2K5NA 5IOCA 4I6NB 2L32A 1VQJA 2AQ3B 4X65Q 1F2ZA 2K4KA 3AN1A 2KCTA 2L11A 1ZPSA 1YHAA 3DOWA 4KTAA 4KY6A 2EVBA 4JE3B 1NUCA 3HOYG 2UXBQ 4QJFA 5E3FA 3KUPA 3T51B 5LMNL 3VR6A 1H4RA 1TKEA 5FR6A 4IW0A 4GLVB 3AMZA 2H89B 1RODA 5DCNA 2LVPA 1YJNA 2VL6A 1VS0A 2F0LA 4GOPC 2E76C 1YQBA 5DPWA 1TT5B 2QA4A 4AQYQ 2LEKA 3DBHB 1PFBA 4HJKA 2EJMA 1R4MB 3DBHI 3HUIA 1M1KC 4MGIE 2CHWA 5ELFA 1R4MI 4NAWB 1PLFA 2EQSA 1F9JA 3ICEA 4LK0M 2K7VA 5I4DA 3IT6B 1PRTB 3WOEA 3DLLA 3N1XC 1WXSA 3CMMB 3ZUNA 3E9SA 1BOSA 5JOBA 1WIAA 1X9NA 4BFRA 3KDFA 2CQAA 3AB9A 3HOYH 4K2KA 1ASZA 1SFOB 1P7FA 2E74C 4R4OA 2DZJA 4P1BC 3CIRB 3J80E 1N63A 5FR3A 1VMCA 3OPOA 3KWVA 4HK2A 1HCZA 1RTOA 4S17A 2BH8A 3H0GG 4FP5D 4DR6Q 3RLFA 3GV6A 1B44D 1JT8A 1FRRA 1KQSA 2AL3A 2ZTDA 5C4HA 2VB2X 5BN4A 4A3DG 2HJ1A 1UE1A 4B9WA 2NTTA 1BVSA 4DV4L 2MJ3A 3NZUA 2K22A 3WAMA 5D3DA 4KSLC 4LUVA 3DBRB 4JC0A 1VQGA 3HKSA 4MNOA 1YOVB 3DBRI 2MP1A 4HDQA 2KCNA 4P6VF 3K81C 3HKZB 1A3UA 2A74C 2UUAL 1HTQA 2A5HA 1JR0D 5CV7A 4DQOC 1WX8A 4KDIC 5CV5A 2Q2TA 2B2YC 4HAEA 4L1BA 3UINB 4MGZE 4A93G 1JB3A 4MZ9A 3B2GA 2B3AA 2FINB 3H0GH 2ZJPA 3L2PA 1RHPA 1NVID 3BS1A 1WGKA 1KNEA 3EECA 4R4IA 4K8JA 1MKHA 3SR1A 1ZXIA 4QIWE 4DV5L 1AARA 4LJZC 2EYHA 3AFQA 4LWCA 2JRIB 5JZEB 3J80L 1DOYA 2MCNB 2I07B 4DK0A 2LY7A 5EJWA 2VQFQ 4BKGA 1K0RA 1PFMA 4N58A 4B3MQ 3W5OA 5GXGB 2GVBA 5G3LD 2OEOA 1VRAB 3RULA 2PQAA 3K0XA 3APCA 1OQQA 3PSIA 2K01A 2UUBQ 2QF7A 4DR2Q 1YNXA 4BA1I 4K5WA 1N62A 1OGWA 2FBWB 2JF5A 2O6VA 3VHTC 4B3SL 4DV3L 2F4VL 1PYBA 1IL8A 5CMDA 3N3KB 2OCEA 3A74A 2JJQA 3KF8B 2PNHA 1VQ6A 3PRPB 2SNSA 5BMGA 1JJGA 1I4GA 1MIUA 1ZKHA 1YX5B 2IO2B 2O2LD 1UWXA 2DAJA 4DUYQ 4YTMB 1PTOC 2F4IA 3KJPA 1BKBA 3IKJA 4A3BG 1XLNA 2NVUI 4NJ7A 4HCNB 3IRBA 3NBHA 5ELOA 2B2TA 3TDQA 4A3BB 5AZHA 5IKCM 1PRTD 3CPWA 3NK9A 2N7DA 4UP8A 2I0QA 4DR5Q 4FNFA 1YEZA 2KN5A 3KLSX 2LI5A 3I63C 1KXLA 3I56A 4BBSB 1TR5A 5LMUL 1M90C 2K1BA 4FJYA 3PZDA 4BOZB 4LMQD 4X64Q 2WNMA 2E75C 2K05A 3NTHA 1Y8RC 1VZ7A 2EDGA 3KOJA 4XQQA 4DV1Q 3IVFA 3E9HA 4KK7A 3PZ8A 3MXNA 4EZJA 3HOVG 3TCAA 1GVPA 3H8HA 3TEZA 3RYTA 1X55A 2OHFA 3TEHB 3KDFB 1Q81C 5JEAG 2UUCL 4A3BH 4DBGA 2MNAA 1J8IA 3RN5A 1IYVA 1BCPB 1PZKD 4ZKCB 3C1FA 1RWSA 3EROA 4Q5VA 4DV2Q 1HZCA 5J17A 1KIXA 1NR2A 4F8CB 2C5CA 4A3FB 2CFMA 3TSSA 3PHXB 1F2MA 2UU9L 3PT2B 3E3XA 1TGZB 2WDQB 4CYEA 2K6DB 1E7VA 4AYBE 1U4RA 3C1EA 4YWKA 1N34Q 3Q3OC 3UDXA 4DR1L 5IOIA 4ITKA 1FCLA 1HQMC 2JEBI 3MFGA 5LL6S 3EQLC 4EX5A 2WXKA 1DOLA 3W1SA 1QNUA 4BWGB 1OQYA 2HTHA 4CJ1B 2BH2A 3W1BA 2DX5B 1BR9A 3CCLA 4HPMB 1NEKB 4OO1I 3ONAB 1JOKA 1D1KA 3MWYW 4IJHA 5DPSA 3LYYA 3HRDD 1ENAA 2XWBB 3BZCA 4A3FH 4GZYC 4PMCA 5DEHA 1GOZA 5HKHA 2JYOA 3I91A 3UI3A 1XEEA 5BYQA 2ONQA 1JWBD 2RPQA 4OVZA 2EY1A 2KNBA 4JI8L 1PGBA 3TRZA 2ZM6Q 1VQAA 4JI3L 5EPLA 5C4XG 1L1OC 3M85A 2RF4A 1HNXL 1XNQQ 2YEPF 4WH4A 1HFNA 2BWES 2DBYA 1JB7A 3VAWA 1PH3A 2F0VA 4KD3A 1VCBA 1LTRD 3DVNU 3SR6A 3S14H 2YTVA 3I2ZA 4IFDG 2FMCA 1V5OA 2IX1A 3HOXG 2UXBL 2DJFC 1E8ZA 4R8IA 2QIEB 1HHVA 3Q8AA 1I4XA 1VQNA 5CGKA 3RR5A 1DM0B 2ATWA 1EFWA 2KJRA 2OEDA 1IL2A 5M5YB 4II3B 2NVYH 4XT3B 2PQAB 2JA6G 2KFJA 3VYSA 1ESRA 4BBNC 2MLBA 5M9OA 2LUEA 1B53A 2DYOA 2AQ1B 2B63B 1WRDB 2L76A 2O6VB 4LFBQ 2EXZA 4FBJB 2CH4A 1RDPD 2NPTB 3A9KB 4RF1A 1VZ6A 2Z6KA 1TWHB 4JI6Q 4IUVA 4JV5Q 1Q1EA 4MDKE 4OX9L 3W2DA 4KDLB 2ALYB 2RDBC 1IBXB 4MJSB 3HK0A 4A3PA 3SVMA 2VZKB 3BIID 4W9CA 4FA6A 3GTPB 4PS8A 2K5DA 1ASYA 3PS6A 1AFPA 3JVZX 2F3IA 3BVZA 2MJ8A 4XYOA 3VYUA 2JA8B 3MXGA 4DUZQ 1HA6A 1P98A 1X3QA 1C79A 2IW3A 3DWPA 4WIPA 5AZGA 3NBHB 5JAVA 2G5DA 2EJFC 1I6HH 3GDEA 5I9OA 1VQIA 4KHPQ 3A7AB 4FXKC 2H5XA 2HQLA 3FP9A 5AFWA 5G3LF 5HURA 5IIFA 2JA6H 2I1JA 5GADC 2B63H 4YWGG 4YXDB 4HJ7A 1HA5A 1TS3A 4DR6L 3DBLB 1MJEA 4LK1C 3N6RA 2WXJA 2PI2E 2AWNA 4JI5Q 1BCPD 2JX5A 1IP9A 1MHWC 3RNEC 1SIFA 4DAYB 4M1UB 4DA2A 1NE3A 4PV1C 1I94L 3SGIA 3AE5B 1WI0A 4IM3A 3H1UA 2IX0A 4ODGA 5IYDG 5JVG3 3GTPH 2V3NA 2J0KA 1A15A 1O7LA 2ZNVC 3ER0A 4W9LA 1Q1OA 2W3RA 4EZKA 2GOWA 2JA8H 3M9BA 3MC8A 4G7ZC 2L55A 2EMSA 2RDHA 3AYHB 3VA7A 5LL6X 2RSUA 1OEYA 1B70B 1TTNA 1Z6HA 3BZDB 4AH6A 4GIVA 1WTOA 1L6UA 4GNXA 4YHHL 3I8ZA 2JRHA 2B2UC 2YLMA 2B76B 4PYUA 2MBBB 3JAMi 3ABVB 1MI0A 2LVOA 4IPHA 5IGDA 5BYSA 3L10B 2L12A 4PQXA 3SDZA 2E2JB 1WR6E 1TWGH 1XMOQ 2MX2A 2WX0A 3U4EG 3ZNID 1Z9FA 4A3MB 1LT5D 4FO2A 2KTRA 4GSWA 5J18A 5IYDH 1WZ0A 2ES2A 4QQBX 4JYAQ 2CVRA 2CW0C 2Q5WD 4B3ML 3KYHC 1IBML 3HHMA 1ENFA 2JA9A 4M0WA 3W1GA 2WXHA 4EUTA 2EKEC 1I4HA 1QVCA 3G4SA 1WYWB 2K75A 4V0BA 4QUFA 2ACZB 5AUKA 4L63B 3Q2AC 1SYFA 1WJJA 1WH3A 2LKVA 3J81i 3N20C 4US9A 2BYTA 2FHTA 3Q8EA 3S1RB 5K36H 5C1ZA 2NVQB 2G4SA 2R92G 1FFVA 2KBNA 3P2BA 1K51A 2KMAA 1J5EQ 1XCTL 4JI4Q 1B3AA 1SR3A 3EGRA 3NELA 3BY4B 3FKIG 3VA5A 2F0NA 1VQBA 2DHZA 3QO2A 1ZGUB 1STNA 2O6VD 1H9SA 4ZYNA 3VR9B 2NN6I 4DUYL 1QZEA 4KKTA 3M3JA 3LNNA 1BBXC 3A8IE 1DJRD 3BVMA 1BT0A 4KKIA 3HVDA 2WWZA 3P4PB 2ZCBA 2HD3A 3CCEA 4NJ6A 4K81A 1EOTA 4B3TQ 2C7NB 4BZAA 4A6QA 4JGHB 2GBRA 2JA7B 4P16A 1LM8B 3VDZA 2XIWA 3AI5A 4DR3Q 2NVQH 1X65A 4I7AA 3ENEA 1G6ZA 1NCVA 3KUZA 4GDKA 3CMAA 1Y1WG 3Q8DA 4UDUC 5F2DA 2R92H 4FYDA 4DV1L 1STAA 3NJTA 2PW7A 4R8NA 2HDLA 4TKOB 3ETRA 5DPRA 3HRZC 1C9FA 2G9DA 4HCPB 2ZVOA 1ZKOA 2LGSA 4RMFA 3AEVA 1XX8A 2PYKA 4Q2JA 4C3HG 1H9MA 4C80A 1EIHA 1U5KA 4MH0E 2QEJC 4JBJA 2LFNA 2JA7H 2Z9HA 2F0HA 1T0RC 1Q12A 3MVVA 2WXRA 5LXHA 1I3QH 2CR5A 2MP2A 1AWDA 2KDBA 3P4QB 2L0CA 4RKLA 1CT1D 2O5JC 1TVXA 2WV6D 5AJ3L 2XRSD 5DLQE 3CC4A 4IJLA 4P7IA 5D7GA 1G51A 3CCSA 2BA1A 1S72A 1N34L 2EJGC 1K3RA 4ANWA 2A68C 3EIVA 5KNBA 4JBKA 2K32A 2KANA 4LNQA 1EUVB 1YX6B 2D9UA 4MT5A 4W9GA 1VQFA 3TEWA 3S1NH 3RZDH 1BBUA 3NWTA 1XTDA 3STBD 3MJWA 2DLBA 3PZ7A 2B2VA 3JAME 3VYRA 1TXYA 1K9MC 4C00A 2B39A 4G57A 3RFZB 4A9AA 3QJYA 2DENB 3EFUA 2Y0SG 1Z47A 1STGA 1KFYB 1A3VA 3TMEA 1FJGQ 1XPUA 4DR7L 4GOPA 4RHRA 1UELA 4IG7B 3L08A 2NBUA 4DNRB 2ZM6L 1F9QA 1KAWA 1SDFA 5NUCA 4K7UA 1J7CA 3T3NA 2N4FA 2D3BA 3M7NA 4KI0A 2VS1A 1UE5A 1LYLA 2G9HD 1SROA 2KTRB 3E6ZX 4RCNA 3J81E 2CU1A 2CQOA 1Q3LA 3BJUA 4C3JB 2LHDA 3AXCA 3KQ4A 1I35A 3IXSA 1TS4A 4M0WB 5IO9A 4ZYSA 1Y1VB 3QB3A 1SYCA 2JU6X 3L7ZC 5COYA 4HJ9A 3I4MG 1XCQL 3RN9C 4ZRQA 2MGSA 2F3WA 3Q3NC 2BE5D 3RT3B 2ZEQA 2A19A 2K33A 3L17A 4LFBL 3NQTA 1H9JA 1PH8A 3DMUA 3V62A 2SOBA 4HCSA 1EL0A 4KZCA 2KAJA 1SEBD 3HOUB 4WJPA 1A70A 1TWCB 4DV4Q 2P5ZX 2HT1A 3H09A 1WTXA 5EPJA 2R7ZG 3UIOB 2A8VA 1T6BX 3WANA 3D4WA 3U2SC 1H9SB 1A2UA 3MC0B 3SK8A 4DUZL 4WRDA 5E7NA 4L5SA 2N9KA 3SFEB 2PE9A 3OIPA 4EQOA 2B2YA 3I4NG 4M00A 1LGRA 1FD7D 1Q8KA 1SNQA 3I4MH 2KFKA 2L83A 4XDCA 4WJWA 3TP7A 4LNOA 2RA4A 3J81L 2X6GA 1HZBA 4QF4A 1QE6A 4V190 1ZP0B 1E0ZA 3NWSA 2M0AA 5E6JA 1XT9B 2R93B 4GDKB 1L4DB 1TWCH 4EQPA 1RM6C 2D3GA 2Z59B 3HM6X 3NSWA 5T1GA 2A6HD 3P1HA 4DV5Q 2HHHL 1Y14B 1HZ5A 3K5LA 2I1KA 2KQSA 4A3JB 3J7AF 4B3RL 1N5XA 2DNEA 1WF9A 4K14A 5KNDA 4XXEA 2W54A 2INDC 4UHVA 3A1QB 3V6CB 5IA7A 2IY0B 5ELBA 1VF7A 4MSMB 1EY7A 3UE1A 4P74A 4A3IG 1K8GA 3QC8B 4GKKL 1QT9A 2VRRB 4O42A 1ZOYB 5J39A 2FCNA 1X3GA 2MP2B 4ZLTF 1A8VA 2N8NA 1ZW7A 3RNGC 2BKFA 4GN1A 5E6NA 3KUCB 4B3SQ 3URYA 4DV3Q 2F4VQ 1V49A 2W9NA 2XSCA 1XMOL 1WGDA 4JQWC 1VQCA 2NVTB 2WB1B 1QZGA 5M5WB 4HJAA 3DUZA 2JZZA 3ZKJC 3H7PB 3HFZB 3PLUA 2KDMA 3AQQA 1LQBA 1Q7YC 4DHZB 4AJWA 5ELNA 3PUXA 4CDEC 4JX1C 2AEHA 1PHJA 2MA9B 4IWOA 2GMIC 3MTSA 2QDFA 4IM2A 1A0IA 3R7RA 3SHLA 1OFFA 1D2BA 1O78A 3KBXA 2RMMA 5KNCA 1QUQA 3FPUB 3TN2A 3J7A5 2MWSB 1ONLA 3IT4B 2WXNA 1CMXB 3OMCA 2LXCA 4XYQA 1IUEA 1M4VA 4CJ0B 1PDQA 3IFDA 1S3SG 1WJ6A 4WQMA 5JVH3 3H6MA 5EKKA 4RG1A 4XTCS 5EDSA 4NB3A 3QOJA 3BYTB 1I4RA 4U68A 5LMUQ 5C44G 1K8OA 4RM9A 5LLIA 2NVTH 1TIFA 3AV8A 4ICVA 4RHSA 1A5RA 4NW2A 5G55A 4JI4L 4EGVA 1N33L 1WGRA 5BMIA 4IC7B 2PQEA 2WX1A 2IL8A 4FADA 1S5DD 1V1QA 1WOCA 3H3VH 1SNPA 1J7AA 2QEXA 3K9PB 1ICWA 1K3BC 1O7YA 4LF6L 3GTMB 1FO4A 1GPXA 1RKNA 3PO3B 1ZYRC 2INNE 3K0YA 2K8CA 2I46A 4X3TA 4B3TL 2YEPB 1VQ9A 4IOAA 1TWAH 2VW9A 3VFKA 2LGYA 3N9YC 2DYMA 2FMMA 2A6EC 2L0FA 3HVZA 2AX5A 3WCQA 2KHSA 1LLRD 4CDFC 5E4XA 4EQNA 2UU9Q 5C44H 1YN3A 3AB5A 4C7ZA 3GD7A 4RFBA 1V1PB 3UGBB 2KENA 3ML8A 2EKIA 4X3SA 1IW7D 4YCUA 3SDLC 4FDBA 4K7WA 2CWPA 3ONSA 3ZJVA 4DR1Q 3GTMH 3NP8A 1HTLD 2NBFA 2C7MB 3RI7C 3IL8A 3AEAB 4IPCA 2F0QA 1WWTA 4N6EB 1CKNA 4XT1B 2RHSB 3H7SA 3SHQA 5AZFA 2MBHA 4A76A 1JC7A 3IFWB 4HEDA 3Q8BA 4TSSA 2WAQB 1DONA 1NYQA 1R9TB 4RMAA 4L5RC 1CK1A 3WAOA 3NXWA 4AJYB 4O1NA 3VRAB 3G6EA 3HOWB 2K03A 2MQJA 1BMLC 4XYCA 4JI8Q 4M8AA 3GTJB 2RCNA 4JI3Q 1I6VC 2A5UA 2JYTA 2K8BA 3S17H 1SYGA 3PO2B 3U4VA 4FXGC 4A4IA 1HNXQ 2QC8A 4UY8C 3BDCA 3CU7A 2F1MA 4NKLA 3IFTA 4ZUJA 1C7YA 1L0WA 4W9KA 4OIKA 1WTPA 3I73A 1H9KA 3GTGH 1OQRA 1R4NI 2F0MA 4X62L 4NP5A 5AUIA 5BR8L 3ZXVA 3PSEB 3L9AX 3G71A 1B7YB 1QLBB 3QARA 2WACA 2V1CC 1FJGL 2O2VB 3M63B 1DXMA 3I3CA 2K28A 4K5VA 3QCAA 1KTKA 1T5XD 2L0TA 4ZUIA 1WI5A 3Q6SA 3GTJH 4HEA1 1D5MC 4AS1A 2M17A 1K8RB 1BNZA 4JBWA 2RKSA 4A3EB 2KKCA 3H3VC 4NPNA 2WXPA 1WCMB 4MH8A 2PEAA 4EOYA 4OX9Q 1FIQA 2ZTCA 3NUCA 1YN5A 4C4VB 3WDNA 3AH7A 1MSHA 3ND9A 1X56A 2RD0A 4ZRJA 3AEEB 2OQKA 3LJ3A 2DY7A 1EWCA 3BG3A 1HPCA 1QOBA 2JA5G 3DHHC 5JHBA 4N8X1 1T9HA 2F0FA 2KHJA 2JA5B 5FO7B 3J80c 4GLXA 2KECA 4PZ6A 4S3SA 5H8YE 2MRPA 4Q0FA 1XTCD 1E0BA 1SMXA 1F2RC 1WYDA 2FCSA 3OAWA 3NVZA 5C6AA 2LFIA 4EVOA 4NXML 3Q22A 1FGUA 4C1NI 4TVAB 1TY0A 2WDVB 4BKSD 1CHQD 4YCWA 1XJVA 2SEBD 2XGTA 2GBJA 3F2DA 2DGYA 1GG3A 1I94Q 4LFCL 4AIMA 1E2VA 1WTWA 5IP9G 2KA7A 1VJKA 1CQFA 3HKZG 4LJOB 4ZQ3A 2GN5A 1KLUD 1IYFA 5C3JB 5IYBH 1ICFB 1SFOH 5L95C 2JE6I 3J7AV 3CCRA 1G291 3ERSX 3MHBA 2JA5H 1WGYA 1VDZA 2GA4B 2QCPX 3DM1A 3MP9A 2JVCA 2B2UA 1PVOA 4IUTA 4CDCC 4B9XA 1CA5A 4YHHQ 4OZBA 3FPPA 1I4QA 2PNRC 2WXQA 1Q86C 4A90A 2K5VA 3NTIA 4DK5A 4XDXA 4IUMB 1YQ4B 4OXPA 4XC2A 5IP9H 3JC66 1CFMA 3KF6A 3K6OA 3M95A 2DZMA 4KKJA 4HDOA 2QCZA 1IBMQ 5C2TB 3Q69A 3E5SA 4EE2A 3I7FA 1JRPA 1EY6A 2AUKA 1G2TA 1CKNB 1QZHA 2QMTA 1D5ZC 2D0PA 2JXMB 2QKIC 4B0MA 3AEGB 1EO6A 2PPHA 1U4PA 4IDIA 3ZO5B 3L4PA 2RQXA 4MM3A 2K14A 5CTRC 5IGGA 2Z8LA 1AE2A 1NSNS 1NY4A 1LT3D 2NYZD 3ND8A 2WHIA 2ZW1A 1XO3A 3D4RA 4CDDC 3GS2A 2IZVB 1T0QC 1XD3B 5JJLA 1T0SC 3AECB 1RF2D 4URKA 1PMRA 5E6PA 1G2SA 3TS0A 1XWEA 2X69A 4EKUA 2CCZA 1GC6A 2Y5PA 2OXPA 2E8GA 4BXXG 1S4ZA 1KRHA 3RZOB 1BO0A 2JYEA 4MELA 4JBMA 1UGJA 4BBRB 4UAIA 3T3OA 4PMBA 4BBSG 4DN4M 1K8MA 3KLWA 3OWEB 1E5WA 3P42A 1TZ1A 2N1VA 1PTOD 1EOVA 5LNK1 2EYJA 3CC7A 1WR1A 3AE1B 1VQ4A 2V3PA 5TSSA 4BAXA 3T1YQ 1PRTC 4CGYB 2KK8A 4XE0A 3C46A 5H92C 3A8JE 3Q6BA 1GB4A 4F8MA 2MEKA 3BK1A 4GU2A 1K28A 2YTXA 5CV4A 2JWUA 1OEYJ 5L83A 2JZPA 4IPGA 2KACA 1JJCB 4TMAB 2BKRB 1U4MA 1NI3A 2GBNA 5ELEA 4J6HA 3RZOH 4BXXH 3AU5A 2Q8IB 2RDGA 4BBRH 3VTUA 4L2YA 3LWEA 1ZUD2 1MHHE 4DHJD 4DXAB 3WWVA 3WOFA 4A3FG 4I7ZC 4BBSH 3U4ZA 1JWAD 1H8CA 1P7EA 1JOQA 5IAAC 1EYAA 4ZRZA 1JOOA 5AJ3Q 4DAMA 3U58A 1VD2A 2WQYB 4J3OD 1YJ9A 4A55A 2QDLA 4XWWA 5M5XB 3G48A 3X3MA 2Q2HA 2F0KA 1GUWA
chains in the Genus database with same CATH topology
3KLRA 4KHZA 3PV0A 4XWTA 1UAPA 1R4QB 1FCCC 2QSDA 2PW9A 5C3EB 2F0OA 3P7JA 4PNYA 2Y3AA 1SIJA 3M4OB 2DWQA 1SNOA 1MGSA 4OZAA 2YYZA 3B2FA 4DXGA 1JCKB 2EYMA 4IOIE 4HKQA 1HTPA 5D3IB 1OXVA 4WFN3 4YSYB 1D1IA 1YNTE 4OO1H 1N5WA 3MZ5A 4KY7A 2EY5A 1IKMA 1PXUA 4RGTA 1W6KA 3NQIA 1SE4A 1EEFD 2CU3A 5JJZA 3S9WA 1VR9A 4JWUC 4E6IA 3Q23A 5HGTA 2VUMB 3U52E 2F0TA 4N9PA 1UEAB 3TZUA 4IFDI 3HGBA 1JW9D 1I50B 5CORA 2F0WA 5IT9E 2H88B 1V8QA 4KGRA 3AU7A 5EGTA 3I9V1 3A55A 3VR3A 4DNTB 2E2IB 2KUMA 4OL7A 2WLBA 1DGJA 5C5LA 3C2PA 2B8FA 1FFUA 3M4YA 1V8CA 2A73B 2NUCA 4HCEA 4F87A 5C0XI 1SNCA 1CQVA 1DCZA 3TZDA 2L9HA 5C4ZA 3DWMA 1DOMA 3D3RA 3Q0AA 1BCPC 2IWHA 2VNUD 1MI2A 4YTNB 1QG7A 3V2TA 4DXFA 1FRDA 1EWYC 1QOAA 5K36G 1Q10A 3V05A 2PMZB 1PTOF 2L52A 5IT9L 5IGCA 5KYLA 1AEXA 3SEBA 3I57A 1FXIA 4RNAA 5HFYA 1FMAD 3S15B 4QCLA 2E2DC 2RDFA 5HHDG 1EY0A 2IGHA 4JPSA 1AZQA 3MAQA 2CW0D 1TKYA 4ZRPA 1ILQA 4A3GB 1EY4A 1ZE3D 1MPEA 2WXFA 3DWAA 3KLSA 2A69D 3FILA 5M3MB 3O13A 4HJGE 4L8JA 1W6JA 3SK5A 1PUTA 2BS2B 2XWJB 4D2KA 1MBYA 2RSOA 3D4DA 1D5XC 4ID6A 3W5UB 1KDCA 1C48A 3E56A 2PKOA 2EYPA 3AE7B 1QWYA 3AE2B 2HUGA 4FF4A 3CKIB 3PUVA 1F2YA 3A7LA 3ZYYX 5I9PA 3PIP3 1SE3A 4ULLA 1G8ZD 4YSXB 3Q24A 5EKIA 2NN6H 4F88A 1GUOA 5FKAC 1Y8OB 4MN3A 1EYCA 2D5GA 2F0EA 1JE4A 3I90A 4H7BA 5DM73 5EPKA 4G7OC 4RH6A 3T16A 1CM9A 1RCVD 5DNFA 3MA2B 2J53A 3NVVA 4RAUC 4AYBB 3GTKB 5DAUA 1PGAA 1BXTA 3CRKC 4C1NK 1F0ZA 1Q1BA 4BY7B 3R2IA 1FXAA 1V97A 2R61A 4RGOS 1E2WA 1ZEQX 4KJNA 4IALA 3NZ3A 1F2LA 1S5FD 4H13C 1YNNC 1N61A 3VQIA 5G5GA 3NRZA 1ZXTA 2A68D 3K5MA 1XLQA 4C3IB 2LS01 2IDYA 3DWQA 4AQ7A 1TT2A 1GUSA 1MSGA 2RBMA 3VR2A 2FE8A 2HDEA 4WURA 3KWLA 3RUZA 4C3JG 1OXXK 1ROEA 3GTLB 1RJTA 3OW7A 1GUTA 2HDMA 2INPE 3AE6B 3GV3A 1PYWD 3HP3A 1UWMA 3CHBD 1KNAA 2K5QA 3I72A 2YU9B 3A56A 3CRLC 3QG1A 4NJCA 1F9PA 4BY1B 4KY5A 5M3FB 3LWUA 1PDXA 1NYRA 3JAML 2N9LA 1EEID 1NAPA 1LT4D 1R7SA 5KIXA 2XVSA 1C78A 2F0SA 1QJOA 3Q8CA 1Y56A 3G6JB 3HS0C 2EY6A 1J7BA 1U4LA 1QILA 2VB3X 4RKBA 4XDDA 4B08A 4KMUC 3HOZB 3C3LA 2LMCA 1JROA 1GHKA 4FXDA 1EY5A 1L0YB 3RPFC 2EOTA 2ZT9C 5I6YA 4ILWA 3EFXD 5FLXE 1M8AA 2E6XA 1SJHD 2EYOA 1G91A 1ZDXA 1E7PB 4NMZA 1V1OA 2GRIA 2N0SB 4F7XA 1OO9B 1B4OA 1SSOA 3X3NA 5K5PA 1L0XB 2OF1A 2C9OA 1YNJC 3A8KE 4MACA 2J0TD 1UNSA 4H0LC 3NVWA 2K6AA 2AWOA 1CA6A 1IYUA 4HRSA 3FAHA 2WIIB 4KN4C 4A8XC 2J7ZA 3GTOB 3P20A 2PMVA 4KX6B 5HG2A 1B9RA 1D4BA 3P63A 3V3XA 3HZXA 2KJXA 1STYA 4IUQA 1CZWA 4MHEA 5A2QE 2JSOA 1ET9A 2MPMA 5FLXL 5A35A 1KDBA 1SMYD 4R9WA 1HUMA 2EYFA 5JEAJ 3QWNA 4IKGA 1SJED 2PVOD 4B0EA 1SYBA 1CTMA 2K3UA 2K5PA 1QF6A 2PTLA 1TYGB 1B9MA 1IKLA 4HMJA 1X32A 3VYTA 5IGEA 3T13A 1EWHA 1C76A 5FOBB 4LTUA 4G4KA 1C77A 4ZHPA 1ESFA 1ZYRD 1GJXA 2KWDA 4C2MB 3IAM1 2WU2B 5LHY1 1VZ8A 2BOSA 1X3PA 2MUYA 2NVXB 3R8BA 2A6ED 5A2QL 1K83B 1J9OA 1C4PA 1EQTA 3SFDB 3MFYA 2I2YA 2WXGA 2FJ2A 2KEDA 4ZHOA 1SYDA 3DXJC 3J9CA 1YJJA 3TUOA 2OT2A 4IFDJ 2LMCB 3S16B 4A3KB 5IGFA 4IZ8A 1L5PA 1MHXA 1PZJD 4OZCA 3SK6A 4IUUA 5BYRA 4X3KA 2ZW0A 1ML0D 3NHHA 2QJLA 2JQRB 2F0PA 4GLSC 2ICIA 1E6EB 2HQEA 2B2WC 2EY2A 4J1MA 2MJDA 2F0IA 5C0XJ 4YTPB 2BW2A 5EE9A 2J4XA 4HN7A 5ISRA 3FC4A 3PUWA 4K5XA 1B50A 1V43A 5T8IA 5JXVA 3MXUA 1A6XA 2EZVA 2WXIA 1TKWB 3W5VB 3IAS1 2PCFB 2B2VC 4CBVA 2J52A 2D2CC 3CQZB 1JWUD 3HOYB 3E0JA 4REZA 2M2LA 4CKBA 1PTOB 2LJIA 3BVGA 3NUHB 1WTQA 5KRUA 1T5EA 4YSZB 2BA0A 5EBCA 2KQ4X 4TQUS 4QMGA 1CHPD 2BDNA 2QILA 1YJIA 1ENCA 2N7JA 1EZ6A 5JPNC 2XRQD 4H44C 1LTID 1AP0A 5I2XA 3EUB2 3NPPA 2BCOA 1U9RA 1Z7TA 4N9TA 2M56B 3LB8C 2PPBC 4Y7NB 3VR4A 4GDLB 1PTOH 4RWSC 5JPMC 1STBA 5BMHA 4KKUA 1SYEA 1RFKA 2SAKA 1LACA 2BS3B 1WRIA 3T56B 2NTSA 2EELA 2JEAI 2WP8J 2TMPA 3H0GB 2Z4HA 1LTAD 2V4DA 5CYUA 4DGZA 1Y69U 4IURA 2WINB 3P4RB 1QKZA 1EIGA 5EE0A 1TWFB 1FEHA 4A3DB 3I4LA 4DAVA 5C4JB 1L6VA 4FVMA 1XXGA 3DEOA 5I6WA 2WKDA 4CKCA 4I65A 3GP7A 1N60A 2RSNA 1KABA 1ILPA 4A93B 2NZ1D 3MHZA 3V96A 5EBDA 3AE8B 3NBIA 1K53A 4OW0A 1SE2A 5J22A 1LTGD 3U9OA 1MD2D 3BDLA 2WXOA 4YIJA 2F0UA 3D6CA 1UUPA 3AE3B 3K57A 4US8A 5CBEE 1FNVA 3PUYA 4L6TB 1EU4A 3SE0A 1XLPA 1Y8PB 1XYIA 4LAAA 5CV9A 3RMHA 3OHXC 1NR4A 1E9MA 3AEBB 1IBXA 2KQ3A 3MXPA 5IGBA 1TS5A 1I7HA 2CHBD 1TIID 3R93A 3ERQA 2WU5B 3K5OA 1FM0D 3NVYA 3G7LA 3BYYB 1EFID 2ZXPA 5FO8B 4NZLB 1II3A 4WORA 2PIAA 3TP5A 1HQRD 4OIJA 2WDRB 2DY8A 1I4PA 1KLGD 2NMQA 3W3AA 3P1MA 1K50A 5EE3A 2K5WA 4KN7C 3EA6A 1HXYD 1CZPA 2JSVX 4K6DA 1QQRA 1C8CA 4DAYA 2F0JA 1GB1A 5CV6A 2LHEA 4KV6A 2Y5CA 2RVLA 1C4AA 3T53B 1WD0A 2IX3A 4HROA 4JWSC 3AMUA 4TRDA 1L4ZB 3HOVB 2EYLA 1AW7A 1FNUA 3ZGZA 4OO1G 4KHVA 1QOFA 5KGUA 3FEWX 3DWGC 2CJNA 2MH7A 5G5HA 3K59A 1BDOA 1DYQA 1XF5L 1LTTD 4DU9A 3HEJA 4R3DA 1CI3M 1GUGA 3T4AC 2LUMA 4CQNA 1DOIA 4ME5A 1FD6A 5ELCA 2ZXOA 5EQ0A 5T1IA 2J42A 4KD4A 3S2HB 3S14B 2R3ZA 2QDBA 5JEAH 3AEFB 4ZOHC 2HCCA 3PO0A 3GB1A 2NVYB 1OXUA 5J1ZA 5FO9B 3SK4A 2JXTA 1Q90A 2X6LA 1LT6D 4BA2I 4MM3B 4USAA 5C4XB 2W82A 5CBAE 3GO5A 2BTEA 4Z9CB 4RF0A 4J8QA 3D8GA 2E2HB 4YT0B 3BDOA 2FUG1 3DHQA 3HOXB 3C8YA 3H94A 1KH0A 1JALA 1I6HB 1VCIA 4IN3A 4QB4A 3KBGA 2JA6B 4HMIA 1R4PB 1LABA 2H1EA 5KEEA 4PT5A 1SBBB 2F3VA 5C0XG 3N52A 1DOKA 1S5ED 3TEXA 4IFDH 1B2TA 1GAQB 1YQ3B 4KKSA 5C5MA 1IGCA 1E10A 3QOLA 1JICA 2B8GA 1ACCA 1E2ZA 4WAFA 1GHJA 4MIUA 1AYFA 3MEHA 2Z4IA 1WTRA 1JORA 2M19A 4KJOA 1LTBD 4WWMA 5C0XH 3K5NA 4QIWB 1TWGB 4C56C 3OSOA 3PMFA 3VRBB 2EE1A 3PIO3 2W55A 3B9JA 2PZUA 3SXHA 2W3SA 2BT6A 1SSNA 2XN9C 1NENB 5D65A 2PLPA 3DEPA 1PRTF 3R2TA 3F2UA 1FR3A 1DOXA 2KCCA 1CJEA 1EM7A 1IHZA 1TKGA 2X38A 2ICEC 1C4CA 3AM9A 1WSPA 1STHA 4CJ2C 4TQ0A 4ZAIA 5CC4A 2NN6G 4PMWA 2N88A 3Q8FA 2A69C 2F0DA 1VF5C 1EU3A 3K7AB 5D14A 4HTHA 2SDFA 1KAAA 4RGNA 4ARIA 1VDVA 1EY8A 1VMPA 3OMGA 1PFDA 4BS9A 1D6EC 2R92B 1Q8IA 2L4NA 3AE4B 1PFNA 2F03A 3FKIB 2M9VA 2K04A 4U673 2KOLA 1YMHE 1KF6B 2V0GA 3S1MB 3ZJUA 3VR8B 2ENBA 2GI9A 2KN4A 2RPVA 2B2TC 2VZKD 2BDOA 4ZK9B 1KDAA 3QIAA 1I3QB 1LO5D 2KMMA 1AN8A 1HUNA 1ZDVA 1ZXHA 3L3OC 3OWFA 4FF3A 1Y1WB 1TU2B 2IJ0A 4L23A 2JP1A 1SNMA 1PZID 3BK2A 3S1NB 3IAYA 3RZDB 2ID0A 1HRJA 3BWUD 2B2WA 4IUPA 1F77A 3PUZA 2G1EA 4RCOA 1BUVT 4C3HB 1HZ6A 2O4XA 1PGXA 4HKZE 2IGDA 4C3IG 1JWSD 2FFKB 2BB5A 3S2DB 3MJ5A 2WXLA 1HFGA 1YNND 3GTQB 1SXTA 1IGDA 4RA8A 3J7YW 1BUIC 3S1QB 1QB5D 4KGSA 1S5BD 3TBIB 2K0PA 4QUCA 1FGBD 2PZWA 4DAPA 2DN8A 1STEA 2NWGA 3U7ZA 2L5TA 1SF0A 3RD4A 2WXMA 1QOHA 2Y0SB 2L1BA 3VR5A 5EE1A 4C7YA 5E4WC 1EYDA 1JMLA 1MVKA 2IGGA 5BN3A 2H4OA 4XIGS 2TSSA 1XLOA 3KK7A 1O80A 1BCPF 3FILB 5IODA 3D31A 1FYCA 2BE5C 2R6GA 2BBCA 1WXQA 3K58A 4OGQC 4JK1C 2MHVA 2IT1A 3I4MB 1ET6A 1JWMD 2ZXRA 1V1PA 3EJIA 3P75A 2V4IB 1WYGA 3M7GA 1A3TA 4RGMA 1TS2A 1C4QA 5I2YA 4LLGM 3HG9A 4DK1A 4ARCA 1B1ZA 4IUNA 1JQ4A 2Q8RE 1H9RA 3A54A 2R7ZB 1TZOA 1EQVA 1EZ8A 3EVQA 3GQBA 4K6LA 3FRPB 2K9XA 3NS1A 3I4NB 4NDXA 2A6HC 3W9CB 5CR3A 3TP8A 2EPBA 3LXFA 2PO4A 3I70A 2WS3B 1YN4A 3D6WA 1EY9A 2PW5A 1TY2A 2I38A 4FXCA 4KGTA 3AEDB 4HSPA 1DZ1A 1A2TA 4H2AA 4N59A 1S5CD 2E3TA 1YNJD 4ABNA 2DNCA 2PVGC 3ZJTA 5DM63 1RTNA 1OXSC 3H91A 4A3IB 1LTSD 1RYJA 2Z1CA 1BQQT 4FF1A 1DD2A 3R3OA 1VLBA 3NTKA 3LX0A 2WP9B 1SNDA 5C3WA 2O5IC 1FNWA 2VXWA 2BB6A 1LV9A 3TP6A 3UI2A 3NE5B 4DF7A 1Y8NB 3FMCA 4FF2A 1SMYC 4CHTB 1HEZE 3CWIA 2XNAC 2HCIA 4XQNA 1GXDC 3M3YB 1TWAB 1QCBD 2KVMA 2L1AA 5ELDA 4HSVA 4ZKBB 1WD1A 1CZGA 5CV8A 5C44B 4HR7B 3ITPA 1B9NA 1F9SA 1F2RI 5HI1A 1JQYD 1AZPA 1BF4A 1RD9D 4NAMA 1T3QA 2NB0A 5E1FA 3AE9B 1SB3C 1TQOA 3FDTA 2PZTA 1WVLA 1QOGA 3OIQA 2WKCA 4DFAA 2ON8A 1IW7C 4G7HC 2HTME 5KYIA 2N55A 3ZQ4A 4IQZA 3TEYA 5C3XA 2IPKD 3U9SA 3OOCA 2CJOA 2AQ2B 1TJEA 4P2CB 2LGIA 1OXTA 1QNKA 3S17B 1K52A 5EKLA 1SAPA 4X3UA 1L0VB 2SNMA 1WTVA 4XQJA 1F9RA 2D62A 4TQ1A 5FK9C 3FVQA 1O7ZA 2BS4B 2MJEA 2KEEA 3GTGB 2M00A 2GB1A 1GUNA 2AUJD 2Q8TA 2F0GA 4K8IA 4K2LA 4OHJA 5MPOA 2D5DA 5BN5A 3P4SB 3KF8A 4CKEA 5IOCA 2L32A 2AQ3B 1F2ZA 3AN1A 2L11A 1ZPSA 4KTAA 4KY6A 2EVBA 4JE3B 1NUCA 5E3FA 3KUPA 3T51B 3VR6A 1TKEA 3AMZA 2H89B 1RODA 2F0LA 2E76C 2LEKA 1PFBA 2EJMA 3HUIA 5ELFA 4NAWB 1PLFA 4LK0M 2K7VA 5I4DA 3IT6B 1PRTB 3WOEA 3E9SA 1BOSA 5JOBA 2CQAA 3AB9A 4K2KA 1SFOB 1P7FA 2E74C 5FR3A 3CIRB 3J80E 1N63A 1VMCA 3OPOA 3KWVA 1HCZA 1RTOA 4FP5D 3RLFA 3GV6A 1B44D 1FRRA 5C4HA 2VB2X 5BN4A 4B9WA 2NTTA 2MJ3A 2K22A 5D3DA 2MP1A 4P6VF 2KCNA 3HKZB 1A3UA 2A74C 2A5HA 1JR0D 5CV7A 4DQOC 5CV5A 2B2YC 4HAEA 4L1BA 1JB3A 3B2GA 2FINB 1RHPA 1NVID 3BS1A 1WGKA 1KNEA 4K8JA 3SR1A 1ZXIA 4LJZC 2EYHA 3J80L 1DOYA 2I07B 4DK0A 2LY7A 5EJWA 1PFMA 4N58A 5GXGB 5G3LD 2OEOA 1VRAB 1OQQA 2K01A 2QF7A 4BA1I 4K5WA 1N62A 2FBWB 1IL8A 5CMDA 2SNSA 5BMGA 1I4GA 2O2LD 1UWXA 4YTMB 1PTOC 2F4IA 3IKJA 1XLNA 3NBHA 2B2TA 3TDQA 4A3BB 1PRTD 3NK9A 4FNFA 3KLSX 4BBSB 1TR5A 2K1BA 4LMQD 2WNMA 2E75C 2K05A 3NTHA 1VZ7A 2EDGA 4XQQA 4KK7A 3PZ8A 3MXNA 3H8HA 3TEZA 2OHFA 5JEAG 1J8IA 1IYVA 1BCPB 1PZKD 4ZKCB 3C1FA 1RWSA 3EROA 4Q5VA 1NR2A 2C5CA 4A3FB 3TSSA 1F2MA 2WDQB 1U4RA 3C1EA 4ITKA 1FCLA 1HQMC 2JEBI 3MFGA 5LL6S 3EQLC 2WXKA 1DOLA 3W1SA 1QNUA 4BWGB 4CJ1B 1BR9A 1NEKB 4OO1I 3ONAB 1JOKA 1D1KA 3MWYW 3LYYA 3HRDD 1ENAA 2XWBB 4GZYC 4PMCA 5DEHA 1GOZA 2JYOA 3I91A 3UI3A 1XEEA 5BYQA 2ONQA 1JWBD 4OVZA 2EY1A 1PGBA 5EPLA 3M85A 2YEPF 4WH4A 1HFNA 2DBYA 2F0VA 4KD3A 1LTRD 3SR6A 4IFDG 2FMCA 2IX1A 4R8IA 2QIEB 1HHVA 3Q8AA 1I4XA 5CGKA 1DM0B 2OEDA 5M5YB 4XT3B 3VYSA 1ESRA 5M9OA 1B53A 2DYOA 2AQ1B 2B63B 2EXZA 4RF1A 1RDPD 1VZ6A 1TWHB 4IUVA 1Q1EA 3W2DA 1IBXB 3SVMA 2VZKB 3BIID 3GTPB 2K5DA 1AFPA 3BVZA 2MJ8A 4XYOA 3VYUA 2JA8B 3MXGA 1HA6A 1X3QA 1C79A 2IW3A 3DWPA 4WIPA 5JAVA 2EJFC 5I9OA 5HURA 3A7AB 4FXKC 5AFWA 5G3LF 4YWGG 5IIFA 4YXDB 1HA5A 1TS3A 4LK1C 3N6RA 2WXJA 2AWNA 1BCPD 2JX5A 4M1UB 4DA2A 4PV1C 3AE5B 2IX0A 4ODGA 5JVG3 2V3NA 1A15A 1O7LA 2W3RA 4G7ZC 2L55A 2RDHA 3VA7A 5LL6X 1Z6HA 3BZDB 1WTOA 1L6UA 3I8ZA 2B2UC 2B76B 3ABVB 1MI0A 5IGDA 5BYSA 2L12A 4PQXA 3SDZA 2E2JB 3U4EG 4A3MB 1LT5D 4FO2A 2Q5WD 2CVRA 2CW0C 1ENFA 4M0WA 2WXHA 1I4HA 4V0BA 4QUFA 2ACZB 5AUKA 4L63B 1SYFA 2LKVA 4US9A 2BYTA 2FHTA 3Q8EA 3S1RB 5K36H 2NVQB 1FFVA 1K51A 1XCTL 1B3AA 3EGRA 3VA5A 2F0NA 3QO2A 1STNA 3VR9B 1H9SA 2NN6I 4KKTA 3LNNA 1BBXC 3A8IE 1DJRD 3BVMA 4KKIA 3HVDA 3P4PB 1EOTA 4A6QA 2JA7B 4P16A 2XIWA 1G6ZA 1NCVA 4UDUC 5F2DA 4FYDA 1STAA 2PW7A 4R8NA 2HDLA 4TKOB 3ETRA 3HRZC 1C9FA 2G9DA 1ZKOA 1XX8A 2PYKA 4Q2JA 4C3HG 1H9MA 4C80A 1EIHA 2QEJC 2LFNA 2F0HA 1Q12A 3MVVA 2WXRA 1AWDA 3P4QB 2L0CA 4RKLA 1CT1D 2O5JC 1TVXA 2WV6D 2XRSD 5D7GA 2BA1A 2EJGC 2A68C 5KNBA 2K32A 2D9UA 4MT5A 3TEWA 3NWTA 2DLBA 3PZ7A 2B2VA 3JAME 3VYRA 2B39A 4G57A 3RFZB 4A9AA 3QJYA 1Z47A 1STGA 1KFYB 1A3VA 3TMEA 4RHRA 4DNRB 1F9QA 5NUCA 1SDFA 1J7CA 3T3NA 3M7NA 4KI0A 2G9HD 3E6ZX 4RCNA 3J81E 1Q3LA 4C3JB 2LHDA 3KQ4A 3IXSA 1TS4A 4ZYSA 1Y1VB 3QB3A 1SYCA 2JU6X 3L7ZC 5COYA 1XCQL 4ZRQA 2MGSA 2F3WA 2BE5D 2K33A 3NQTA 1H9JA 3DMUA 2SOBA 4HCSA 1EL0A 2KAJA 1SEBD 3HOUB 1A70A 1TWCB 3H09A 1WTXA 5EPJA 1T6BX 3D4WA 3U2SC 1H9SB 1A2UA 3MC0B 3SK8A 4WRDA 2N9KA 3SFEB 3OIPA 4EQOA 2B2YA 1FD7D 1SNQA 2L83A 4XDCA 4WJWA 3TP7A 2RA4A 3J81L 2X6GA 4QF4A 4V190 1QE6A 1ZP0B 1E0ZA 3NWSA 2M0AA 5E6JA 4GDKB 2R93B 1L4DB 4EQPA 1RM6C 3NSWA 5T1GA 2A6HD 3P1HA 1HZ5A 3K5LA 4A3JB 3J7AF 1N5XA 2DNEA 4K14A 5KNDA 4XXEA 2W54A 5ELBA 1VF7A 1EY7A 1QT9A 4O42A 1ZOYB 5J39A 4ZLTF 3URYA 2XSCA 2NVTB 2WB1B 5M5WB 3DUZA 2KDMA 3PUXA 4JX1C 3MTSA 3SHLA 1OFFA 1D2BA 1O78A 3KBXA 2RMMA 5KNCA 3FPUB 3TN2A 1ONLA 3IT4B 2WXNA 3OMCA 4XYQA 1IUEA 1M4VA 4CJ0B 1PDQA 3IFDA 4WQMA 5JVH3 3H6MA 5EKKA 4XTCS 3QOJA 3BYTB 1I4RA 4U68A 1K8OA 3AV8A 4RHSA 4NW2A 4EGVA 5BMIA 2PQEA 2IL8A 1S5DD 1J7AA 1SNPA 1ICWA 1O7YA 3GTMB 1GPXA 1FO4A 1RKNA 3PO3B 1ZYRC 2INNE 3K0YA 2I46A 4X3TA 2YEPB 3N9YC 2DYMA 2FMMA 2A6EC 3HVZA 2AX5A 3WCQA 2KHSA 1LLRD 1YN3A 5E4XA 4EQNA 3AB5A 4C7ZA 3GD7A 4RFBA 1V1PB 2EKIA 4X3SA 1IW7D 3ZJVA 3NP8A 1HTLD 2NBFA 3IL8A 3AEAB 2F0QA 1WWTA 4N6EB 4XT1B 1JC7A 3Q8BA 4HEDA 4TSSA 2WAQB 1DONA 1NYQA 1R9TB 1CK1A 3NXWA 4O1NA 3VRAB 3HOWB 2K03A 1BMLC 3GTJB 4M8AA 2JYTA 1I6VC 1SYGA 3PO2B 4FXGC 3BDCA 3CU7A 2F1MA 4NKLA 3IFTA 4ZUJA 4OIKA 1WTPA 3I73A 1H9KA 1OQRA 2F0MA 5AUIA 4NP5A 3L9AX 1QLBB 2WACA 1DXMA 3I3CA 2K28A 4K5VA 1KTKA 1T5XD 4ZUIA 3Q6SA 4HEA1 1D5MC 4AS1A 1BNZA 4JBWA 2RKSA 4A3EB 3H3VC 2WXPA 1WCMB 4MH8A 1FIQA 3NUCA 1YN5A 3WDNA 3AH7A 1MSHA 3ND9A 3AEEB 2DY7A 1EWCA 3BG3A 1HPCA 1QOBA 2F0FA 2JA5B 5FO7B 2KECA 4S3SA 5H8YE 4Q0FA 1XTCD 1E0BA 1F2RC 3NVZA 5C6AA 2LFIA 4EVOA 3Q22A 4C1NI 1TY0A 2WDVB 1CHQD 2SEBD 1E2VA 1WTWA 1VJKA 2KA7A 1CQFA 4ZQ3A 1KLUD 5C3JB 2JE6I 3J7AV 1G291 3MHBA 1VDZA 2GA4B 2QCPX 3DM1A 3MP9A 2B2UA 4IUTA 4B9XA 1CA5A 4OZBA 3FPPA 1I4QA 2PNRC 2WXQA 4A90A 3NTIA 4XDXA 1YQ4B 1CFMA 3K6OA 4KKJA 5C2TB 3Q69A 3E5SA 4EE2A 1JRPA 1EY6A 2AUKA 1G2TA 2QMTA 1D5ZC 2JXMB 2QKIC 4B0MA 3AEGB 4IDIA 1U4PA 3L4PA 2RQXA 5IGGA 2Z8LA 1NSNS 1LT3D 2NYZD 3ND8A 2ZW1A 3GS2A 1XO3A 3D4RA 3AECB