1D5XC

X-ray crystal structure of hla-dr4 complexed with dipeptide mimetic and seb
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
237
structure length
223
Chain Sequence
SQPDPKPDELHKSSKFTGLMENMKVLYDDNHVSAINVKSIDQFLYFDLIYSIKDTKLGNYDNVRVEFKNKDLADKYKDKYVDVFGANYYYQCYFSKTCMYGGVTEHNGNQLDKYRSITVRVFEDGKNLLSFDVQTNKKKVTAQELDYLTRHYLVKNKKLYEFNNSPYETGYIKFIENENSFWYDMMPAPGDKFDQSKYLMMYNDNKMVDSKDVKIEVYLTTKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system/peptide inhibitor
molecule keywords HLA CLASS II HISTOCOMPATIBILITY ANTIGEN
publication title Peptide and peptide mimetic inhibitors of antigen presentation by HLA-DR class II MHC molecules. Design, structure-activity relationships, and X-ray crystal structures.
pubmed doi rcsb
source organism Homo sapiens
total genus 53
structure length 223
sequence length 237
ec nomenclature
pdb deposition date 1999-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
C PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1d5xC01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1d5xC02
1S5BD 1CT1D 3EA6A 1LLRD 3MC0B 1KLUD 1D5MC 1SBBB 1BCPC 1FGBD 1LTBD 1S5ED 2XNAC 1ET9A 1HA5A 1UUPA 1LO5D 3KLSX 4RHSA 5FK9C 1B44D 1SE3A 2G9HD 1PTOB 1KTKA 2XRSD 1F77A 3OWEB 1S5FD 1SJHD 1SJED 5ELDA 1UNSA 1SE4A 2RDGA 1PTOC 1EFID 3R2IA 1TS3A 4L63B 1LTID 2SEBD 1L0YB 3DWAA 1JCKB 2CHBD 1HXYD 1LT3D 2Z8LA 4TSSA 1PYWD 1JWMD 1TY2A 1AW7A 1BCPD 1PZKD 2XN9C 1TS2A 1EEID 1PTOH 1SEBD 1TY0A 2IJ0A 2QEJC 5ELBA 1FD7D 1V1PA 1KLGD 1LTGD 1EWCA 1I4RA 4K6LA 3R8BA 1I4GA 2O2LD 1BCPF 1LTTD 1MD2D 2TSSA 4RCOA 1XXGA 3R2TA 4RGNA 1PTOD 2QILA 3DWQA 5D3DA 4L6TB 4BWGB 2NTSA 1DYQA 1PRTB 1D5XC 1G8ZD 2RDHA 1YN3A 1SXTA 1PTOF 1TS5A 3TSSA 1PRTC 3BVMA 1PZJD 4RH6A 1HTLD 1LTSD 1EEFD 4O1NA 1I4HA 1LT6D 1GOZA 5ELCA 1FNVA 1S5DD 1YN5A 1FNWA 1BCPB 1RD9D 1DJRD 2J4XA 1LT5D 1STEA 3SEBA 2NTTA 1CQVA 1ENFA 2R61A 5TSSA 3EFXD 1ET6A 1EU3A 1LTRD 1TS4A 4RGTA 3W2DA 5I4DA 1YN4A 3V05A 3CHBD 1JWUD 1BXTA 1HQRD 1QILA 4RGMA 1CK1A 5D3IB 2IPKD 1XTCD 1I4XA 4OHJA 4NZLB 1ESFA 4ZYSA 1LTAD 1D6EC 1PRTD 2AQ2B 2WV6D 5ELFA 3BVZA 4DXGA 1EU4A 2ICIA 1FNUA 3GP7A 3O13A 1I4QA 1LT4D 1PRTF 1L0XB 1I4PA 1S5CD 1T5XD 1PZID 1CHPD 5ELEA 4UDUC 1M4VA 5FKAC 1B1ZA 1CHQD 1V1OA 2XRQD 3BVGA 1RF2D 2AQ3B 1D5ZC 3DWPA 1JR0D 3BYTB 4Z9CB 3BZDB 1V1PB 1JQYD 3MFGA 3BYYB 3URYA 4C56C 4RHRA 1RDPD 2AQ1B 4RFBA 1RCVD 4RGOS 1JWSD 1AN8A 4DXFA 1SE2A
chains in the Genus database with same CATH superfamily
2N3SA 1S5BD 1CT1D 2VQEL 2BA1A 2Q8TA 4C3JH 2MJ3A 3AEAB 3T4AC 2I46A 2B3GA 4OGQC 2ZW0A 1PQSA 3L4PA 4DK6C 1HR0Q 3NUHB 2JA8B 2OJWA 2WU5B 1L6VA 3H9DA 3OIQA 4O42A 3AE3B 3PO3G 1CA5A 1WRDB 4JI8Q 2K32A 3E0EA 2RGFA 1SJED 1SE4A 1EY5A 1F1HA 4J6IA 2F0QA 4JE3B 2VNUD 4GN4B 5EE1A 3TEYA 2A69C 2FIDA 3DVNV 1BT0A 1Y1VB 2R92G 2LVPA 2QHOA 3NY5A 1WR6E 2EJFC 1JJ2A 3VR4A 1JWMD 1YQ4B 4WWOA 4KV2A 2QF7A 4DHJD 3HOUB 3NK9A 1WXAA 2KX3A 4ULLA 1XYIA 4A3FG 3PUVA 2PE6B 3Q6BA 1BF4A 4N8X1 3APFA 2H1EA 4C2MH 4G4KA 3I3TB 4NNJB 3AEBB 1EUJA 3T1YL 1PTOD 4KKJA 2WB1G 4L6TB 4GOPB 4RMAA 4A8XC 1S72A 3G71A 1QF6A 2KDBA 4C3HB 2RDHA 3Q8EA 3UDFA 3PO3H 2YTVA 1Q7YC 5EE9A 3CPFA 4UY8C 3DUZA 2K5VA 2MP1A 4YHHL 2JYEA 1WI0A 1PZJD 3H1UA 1NY4A 1KRSA 4JI2Q 3O65B 4KTAA 3V3XA 1YITA 4JI4L 2KT7A 3ND9A 2DYMA 3RMKC 2KWCA 4ALPA 3A4SC 3APDA 2VZKB 4HJ7A 4ZRJA 3AM9A 2HCIA 4NXML 3QC8B 4B3SL 4LWCA 4L2YA 2M2LA 3IVFA 3L0WB 5EAYA 1E8YA 2NCNA 3FDTA 3RZFA 4A3FH 1WX8A 2BS2B 4MIUA 3S14B 4A3PA 4R8NA 1K83H 1ZEQX 5BR8L 3GTQB 2NVTB 1S3OA 1PGAA 1RRBA 2KNBA 1CTMA 1SMXA 3DEOA 1MJEA 3PO2G 3A1QB 5CX3A 1WGKA 2J53A 3VFKA 4XYCA 2Q8IB 1OXVA 4UAIA 2EY2A 4OZAA 1X3FA 3N32A 1V9PA 4LF6Q 1LM8B 2F0KA 3DHIC 2NPTA 2D3BA 2FCSA 4XDXA 3W1GA 3NWSA 1OXXK 3LX0A 3C0RB 1M4VA 1A0IA 4HSPA 3MXPA 1EOTA 1WCMB 1FXTB 2BGFA 2H89B 3K9OB 2QSDA 2LRWA 2CFMA 1EWIA 2Q2IA 1JQYD 1U4RA 4HXDA 4LCDE 1K8OA 1BUVT 1OEYJ 2EQSA 4JBJA 3SK6A 4HWIB 1XD3B 3WDNA 4A3GH 1B7YB 1XTDA 2AQ1B 3E9HA 3HKZB 1L1OA 1SE8A 2VQFL 1EL0A 2WACA 1C79A 3R93A 1MI2A 2KQ3A 3WAMA 1QG7A 3Q8CA 2XNAC 4JI6L 1XLPA 2SNSA 1B44D 4YWLA 1E90A 2D10A 3B2FA 3H0GB 3PMFA 1YNXA 3PO2H 2BB5A 3CF5A 1MSHA 2D5DA 4NMZA 5C44B 4LF4Q 1SYBA 1SJHD 5GXGB 2IZVB 1I42A 5E6PA 5FLXc 4FF2A 5F2DA 1HHVA 4TUUA 3V61A 1WH3A 3ZJUA 2JA8G 2EYJA 1TS3A 4L63B 1L0YB 3VHTC 4S0RA 2HUGA 3AMUA 2RHSB 2JYOA 1PYWD 2LJ5A 3NBHB 5EBDA 3V96A 2DAJA 1GUGA 2DZJA 4YSXB 3M4YA 3RZDB 5CGKA 3QWZB 5D14A 3U4ZA 1Y1VG 1JJCB 3HOXB 2K1BA 4IDIA 3RNFC 3PV0A 1Q12A 1IBMQ 4HMJA 2DNFA 3P4RB 1VQGA 5LL6S 1I4GA 4DGZA 2ZVNA 1IW7C 2Y0SE 4CJ2C 4DKAC 1PH3A 3MP9A 3CCMA 4HJKA 3HOUG 1VMPA 4W9JA 2I2YA 2KBNA 1N5XA 4FHJA 1F2ZA 3DHQA 2A69D 1JALA 2KYWA 3L54A 1K9MC 3SK8A 4DV2L 2Z0DB 4LFAQ 2LHDA 1YHQA 2INDC 2ZZPB 3GV3A 1TT2A 2N88A 1X32A 2KENA 3BJUA 4IURA 1E2ZA 3GV6A 1A8VA 4KD4A 4YY3Q 1MG4A 3ECIA 4LDTD 2ZEQA 4DV1Q 2XBBC 4LF7L 4IFDJ 2GBNA 2CHWA 3MC8A 2K5HA 2L05A 5DM73 4H7BA 3PHWB 1H9JA 4C3HG 4DV6Q 5DPWA 1GPXA 1ZYRD 3A56A 4MH8A 3K5LA 1UEAB 3PS6A 2OF1A 5BMGA 1LT5D 2LI5A 5AZHA 2NTTA 3VYTA 5FO8B 4KGRA 2F3WA 4N8FA 4OWXB 2Z6KC 3T1HQ 1Q90A 3H7PB 4IUVA 5EKKA 1Y1VH 2E2DC 2I5HA 3PIOA 4JQWC 1E3PA 3MFYA 4B3MQ 3PLUA 4GU2A 1JRUA 3KDFB 3M4OB 1O78A 4B0MA 2HIXA 3KWVA 3HEJA 2BYVE 1SSOA 1NMFA 4C1NK 1XMQQ 3AULA 2K14A 3RNCC 2EMSA 5EKIA 1QVGA 2FNJB 1J9OA 1C4QA 2JPHA 5C3WA 2IWHA 5BN3A 5C23A 1SIFA 4CDEC 4IM3A 1EZ6A 1OXSC 3CC2A 4A4IA 1X54A 4FJZA 2IY5B 3VA7A 2AWNA 3VYUA 3K58A 3ZNGC 4G11A 2AQ3B 3ZLZA 1P8LA 3I72A 4N9F4 1JC7A 5I6YA 1QVCA 1V1PB 4FJYA 3H3VC 4BA2I 1L5PA 1CFMA 3LWEA 4PT5A 3N30A 1C76A 4PV1C 2PVOD 1PA6A 4DPGA 4Q5VA 5H1SE 1WCMG 3SHLA 2RR9A 1TWHB 5J18A 3IFWB 2UXBQ 2KQ7A 3AEGB 1GM5A 2L4NA 3M95A 2MJDA 3MC0B 4CHTB 2N1WA 1Y8PB 2JZ3B 4YSYB 1STNA 5DNFA 3OLMD 2XK5A 3ZDTA 1IHZA 1FJGQ 1ILPA 2AMCB 1OFFA 2PZUA 3HKZG 1I50B 3D31A 1NJIC 2Q2TA 2BCOA 1WZ3A 2RD0A 1TT5B 2DY7A 4AQYQ 1P98A 2O2VB 5JJLA 1NBWA 1UNSA 2YU9B 4CBVA 2G5DA 3GTQH 1SYFA 4H02A 2DY8A 3S1NB 1PVOA 3H0GG 1JCKB 1EQVA 5JPNC 5C44G 3R3MA 3NTKA 1HXYD 4JK1C 2PCFB 4R4QA 5LMNQ 3IRBA 4JI0L 5HGTA 3H91A 4P74A 4KHVA 3E3XA 1N36Q 3KYDD 4KDLB 5IOIA 3VR8B 4FADA 1WTWA 1DD2A 2NB0A 2UYZB 5JXVA 3PRMB 4E74A 3QIAA 1WCMH 2CKZB 2RSNA 2LD9A 3J7YW 4A3KB 3T13A 2KHWB 4C4VA 1X3GA 2MJEA 1EOVA 4JWSC 4POFA 3E9SA 1E1TA 2J42A 4I65A 1KM7A 2PZWA 1UWMA 4JI2L 2O6VD 2F0DA 1O7YA 4KDIC 1X9NA 1U9RA 1DYQA 3HOXG 4X65L 3PRPB 3NELA 4KI0A 1MVKA 1N33L 3NSWA 1VQHA 4HJAA 5HG2A 1MHWC 2PNHA 4LK1C 2GBRA 1XCTL 4H2AA 5BN4A 3RN2A 3M9BA 4JPSA 3DBHB 3M4QA 3H0GH 2HQEA 3IXSA 1SRUA 3FC4A 1VQJA 3QO2A 4POGA 2G3QB 3H6NA 3S1MB 1C77A 1IW7D 3NBIA 1K3RA 5KEEA 2R61A 3ZJTA 2ZW1A 4HTHA 4DV7L 4HPPA 3B9JA 4KIKA 4N58A 3RNBC 2IY0B 3T3OA 1NENB 3L13A 4EVOA 2VL6A 3KUZA 1MHXA 4ANWA 1CK1A 3NQTA 5D3IB 3ABVB 4IOAA 3V6CB 1B70B 1IYVA 4MACA 1E22A 5ELFA 2IO2B 4K5VA 2JXXA 4OZCA 4HLEA 3RZDH 4V190 1GNUA 4RNAA 3O13A 3HOXH 2Z1CA 4LNQA 2LXCA 1Y1WH 3IAM1 1WGDA 4US9A 2M0XA 3EQLC 1L6UA 1LV9A 5C6AA 1B8AA 2KAJA 2B2YC 5ELEA 3RLOA 4R4CA 1N63A 3TIXA 2DZMA 3BVGA 3IT4B 4G50A 3ZRFA 2DBYA 4FF4A 3AU4A 5EDSA 2ZM6Q 1WFYA 4ILWA 3W1BA 3S2AA 2NVQB 3SU8X 4R8IA 2DYOA 2Z0EB 1RODA 4EUTA 2M19A 3EJIA 4KJNA 4NXNQ 4ICVA 1IYFA 4AH6A 1Y69U 2D0PA 5JOBA 5LMNW 4DNRB 2DNCA 4BKGA 4XQQA 2E2HB 4OWWB 3EUB2 1DCZA 1SMYC 2A68D 4IN3A 1LLRD 3PIPA 1UGJA 5DPSA 3UQBA 2NBFA 2OTLA 2K0PA 4TKOB 1VCBA 1SGHA 4AIMA 2ZVOA 2CWAA 1LO5D 5JVH3 2JJQA 4JBWA 3VYSA 4JWUC 4L5TA 1CQFA 3BDOA 5JEAJ 3PREA 1OQQA 2PNRC 3K5OA 3BINA 1VZ6A 3SR6A 3M4OH 2OWOA 3N20C 4US8A 1TWFB 4N9TA 1WXSA 4JC0A 1E2VA 2D2QA 4BY1B 2EOTA 2QIEB 2E76C 5KIXA 3CCSA 3UDXA 1IBML 3PPAA 5IE8A 3CPWA 2QEXA 4B6WA 3UE1A 1RWSA 3P42A 2O6VA 1R4MB 4AJWA 1GVPA 2F3VA 2MRPA 1TS2A 1NYQA 3PGEA 3J81j 3PSIA 1EYGA 2INNE 5BMIA 4DUYQ 4B9KA 4C00A 1KLGD 2J7ZA 2K5WA 5GAEC 4K6LA 1ASZA 3R8BA 4KY6A 4HEDA 1E5WA 4PS7A 2PZTA 4ABNA 3QOJA 3GE3C 1MD2D 2JA7B 3ULPA 3F2BA 1O7IA 2IW3A 4KK7A 3VH4B 1N34Q 4MTKA 1EM7A 3NVWA 4IPHA 4DV6L 2E5LQ 3ZNID 4A3KG 2Z0SA 2F4IA 4IW0A 1YNTE 4AUQC 4DR4L 5EPJA 4QQBX 3TBIB 2Z9HA 1CZGA 1HTLD 4B9XA 1WX7A 1WTHA 2KZRA 2IX3A 1P7EA 4OIJA 2CCZA 2EJGC 4B3ML 1I50H 1QNUA 1WJUA 2N7DA 4K1RB 1W6JA 2ZPNA 3QQ8B 1FNVA 2LGYA 4I6PA 1R4NB 4WH4A 1STEA 2CW0C 4XWTA 3V60A 2YU9H 4ZDVA 1U5KA 1XMQL 1WRIA 1ENFA 3OSOA 3G6JB 1B4OA 1ML0D 5EJWA 2UUCQ 2F0GA 1WSPA 1FFUA 1XO3A 2INPE 4K5WA 3C8YA 3S1NH 2F1MA 1H4RA 2BWES 2DLBA 5LL6X 4RGMA 3HKZE 4XYOA 3PO0A 1PFMA 1WX9A 4FXCA 4JBKA 2L8JA 4HEA1 1J8CA 5FLXE 4DK3C 1TWAB 2LZ6A 2OEDA 3R3OA 4TV3A 2MP2A 4LNIA 2KCCA 1JROA 3ZJYC 2Z6KA 2K3UA 3NRZA 4MSMB 4TQUS 3VVWB 5T1IA 2WXPA 2C5LC 1I4QA 1MBYA 2FHTA 3EBEA 3HOVB 3APCA 3IHPC 5KHOA 2VUMB 4A3KH 5A2QL 4IFDG 1S5CD 2EJMA 3I90A 4ZUJA 4C3JB 2XEWA 4IC7B 2G4SA 3T56B 2TMPA 1E8ZA 3OJ4B 1YBYA 5KNBA 2Z4HA 3MXNA 1JB3A 2AKWB 2UXBL 1BUIC 2L0FA 5COYA 3A1QA 5JJZA 2BDOA 2K1FA 4OIKA 1B2TA 2WDVB 2Y0SB 4GKKL 4MGYE 1AYFA 2M9VA 1BO0A 2BVCA 3CCEA 1TU2B 3ETRA 3UQAA 2JQRB 4P75A 2OT2A 1DOLA 4DAMA 4ME5A 4GKJQ 3F8TA 3N3KB 4W9EA 5E6JA 4OL7A 3NJTA 4TRDA 4DK5A 2JVCA 3NZ3A 1S5ED 4ITKA 2X6GA 1UUPA 4RWSC 3S1MH 2PJHA 1STGA 2C7MB 1MG8A 1WD1A 3PZDA 4REZA 2KECA 5LMNL 4MEMA 3OWEB 3S1QB 2KHJA 2EYOA 1SFOB 2H88B 3J7ZC 4HMIA 4AS1A 4IFDH 3DDCB 1MPEA 3EFUA 2D07B 1VQEA 2CQAA 1VQ5A 3MZ5A 4C7YA 1XPUA 2ZXRA 2LY7A 1PH6A 4IWQA 3T53B 2K04A 2Z8LA 2L0TA 4YWKA 1RYJA 1F9PA 2K39A 1PH8A 3W1SC 1TY2A 1SMYD 5IGFA 3M7NA 4EX5A 3PF5A 1CSQA 2KVZA 4LFBL 3QX1A 1GUOA 2LJIA 3NS8A 4W9DA 3RT3B 1FD7D 1AARA 4FBJB 4BS9A 5CC4A 1LTGD 1I4RA 1GUWA 1XNQQ 4CJ1B 2O2LD 2ZJDA 3DM1A 3FHWA 2NVQH 2WFWA 4EEWA 3BK2A 1FPYA 2MGSA 3A8KE 5HHDG 2C7HA 3NBHA 3MXGA 1PRTB 1G8ZD 1NAPA 4X64Q 1NEKB 1XLQA 3P4QB 4KY5A 4C1NI 3LYYA 2F0TA 1SYCA 2E2HH 3TCAA 1YNJC 2KFKB 4HROA 4MM3B 5M5YB 3RUZA 2JA7G 4LUZA 4KN4C 3CC7A 1UD7A 1XCQL 4K14A 2KUMA 4P2CB 1LTSD 1K83B 1CA6A 4K3CA 5FR3A 3P4SB 4KKTA 1LGRA 5ELCA 1JB7A 2VY3A 2KC1A 4MELA 3N9YC 4DDGD 1CM9A 2IT1A 1L2NA 3AU7A 5GROA 2OOBB 3NE5B 4NDXA 3HOYB 3KBGA 1TYGB 3BZCA 3J7AF 1I35A 1TGZB 1QB5D 3A8IE 4PS8A 3A5ZB 3AQQA 2K5DA 2WS3B 1CQVA 1K52A 1PHJA 2MBOA 2ZJRA 2KEEA 1VCIA 2KLCA 1Z47A 4BKTA 1YQ3B 2KACA 4HPMB 1T5EA 4GNXB 4BY1H 3CSTA 3VTWA 1X3PA 1I7HA 1V81A 2K4KA 1GC6A 1C9OA 5GQOA 2NBVB 5D94A 3S9WA 5JHBA 4A3OA 2C60A 3ZTDA 3CMEA 1AH9A 3L10B 4IWOA 2DUDA 3M7GA 4DAYA 2Z59B 4GDLB 4ZRPA 2INCC 3CIRB 2WQYB 1RTNA 1XMOQ 4A3LH 1Q86C 3S17B 3EVQA 3H7PA 4FDBA 5LHY1 1WWTA 1MJCA 1YNNC 1ZP0B 2JA7H 1JICA 4CYEA 2CW0D 4NXNL 3KDFA 1WGGA 5CORA 2ALYB 2XRQD 1IYUA 4N9PA 4Q0FA 1SNQA 3NVYA 2JXTA 2MBEA 3A54A 4I7ZC 1CKNB 1FRRA 5IN7A 4NB3A 4EGVA 5M5XH 2K5QA 4PG3A 3HOVG 5CHFA 4BBNC 1VQNA 1EQRA 4JPBW 4OXPA 2ATWA 1SR3A 2VUMG 2JSVX 3NVZA 4C3JG 1J7BA 3PSEB 4ARCA 2B2YA 4M8MA 5HGQA 1P1AA 4KHZA 3ALBA 1V9JA 1TKEA 4KD3A 1BCPB 4BXXG 1IZ6A 2L1AA 2Y3AA 4M0WA 1W2BA 2Z6BA 4IOCA 5ELNA 2KOLA 3VYRA 2R2OA 4WJPA 2Y0SG 4M02A 3AFQA 5E3FA 4B0EA 1H9SA 3HZXA 5CV4A 2KQSA 1EZ8A 2CKHB 4X6AH 4JX1C 3NHEB 1SE3A 4K8IA 2MEKA 3D6CA 1WE6A 3DBRB 3JVZX 2IY1B 1S5FD 4FYDA 4LJOB 1G91A 3QG1A 2WLBA 1II3A 1WJJA 1WXQA 2HHHL 4FHKA 5HFYA 1KH0A 3J7A5 1L2FA 1TWAH 4MGKE 1ILQA 4A6QA 1BR9A 2SEBD 2PTLA 3N1YC 3FAHA 2N55A 3H8HA 4HCNB 4OVUA 2RDFA 1GHKA 4HIOA 1QZGA 3P1HA 3HOVH 4K0KQ 2GBJA 1ONLA 1PFBA 2NN6G 2VUMH 1OEYA 2NS5A 3J81E 1YHBA 4HJ9A 2MBHA 5FO7B 4HCSA 1N34L 4YCUA 3ZW3A 2D11A 1ZGUB 1F2LA 3ZQ4A 4XDCA 5IT9L 4BXXH 4CGYB 5CV7A 1AWDA 4WFN3 3S15B 1D7QA 4ZQ3A 3SFEB 2HQLA 3IFDA 3P2BA 4BOSC 2DGYA 2P5ZX 3R2TA 1MIUA 2WINB 2V4LA 3KLWA 2W3SA 5JEAG 4JYAQ 1HNZQ 3VDYA 5D2MB 4LAAA 2D0OA 2KMAA 4RAUC 5E4XA 2O5JC 3BZKA 3HOWB 1C1YB 2PQEA 3TSSA 1PRTC 3A5UA 1Y14B 1VQFA 1JWAD 2W54A 4R4OA 4DU9A 1E1OA 2D9UA 2MO0A 4ZAIA 4GDKB 1TZOA 2WNMA 1V8CA 4IZ8A 3A33B 3M62B 5J39A 1LXDA 1PH4A 1YJ1A 1L4ZB 1Q8KA 2NVUI 1JQ4A 4NKLA 3S1QH 1FNWA 4DR2Q 2NVXB 4ARIA 1ZYRC 4LF5Q 1SFOH 2N7JA 2NN6H 4CJ0B 2A74C 1NI2A 4HAEA 1TWGB 1V80A 2PLPA 2LASA 1CZPA 2BYTA 5TR5A 1YJNA 4OX9L 5IODA 4LJPB 2KCMA 3WALA 5J17A 2MHVA 3HOYG 3ZXVA 1ESFA 5IAAC 2BWFA 1E7ZA 1YNJD 3I4OA 2ES2A 3RNGC 5G55A 4GN3B 1MFWA 1SROA 2LGXA 3PTFC 4WQOB 4DXGA 4ASWC 5JEAH 3W5OA 2ICIA 4IUNA 4DF7A 3KJPA 3UIPB 3VAWA 1KNEA 4WQMA 4GLXA 2ZCBA 5C5MA 3NVVA 3AE4B 1TVXA 3DBHI 4YT0B 3RD2A 1D3ZA 1I4PA 2EVBA 3RNUA 1SE9A 3VTVA 2YTYA 4C7ZA 2K33A 2W55A 1D5ZC 2CVRA 4A3GG 4GKJL 3A9JB 1LM0A 1VZ7A 1QUQB 2SDFA 3ZNHB 5M5YH 3GTOB 4P6VF 1YHAA 4A55A 4IFDI 1Q1OA 1RCVD 1JE4A 4H0LC 2KOXA 1B9NA 1SE2A 4X3SA 5C2TB 2FCMA 4WWPA 1HFNA 1YQBA 3HOYH 4ICUA 1BCPC 1STHA 4F8MA 3IFTA 3JW0X 5FK9C 1YNND 2UU9Q 2MBBB 5T8IA 1HR0W 1QZEA 5IA7A 4CKBA 3B6YA 1QLBB 3J9CA 4I6LB 3Q8AA 2AUKA 5C4ZA 4M8AA 4K81A 2NYZD 3Q69A 1JWBD 4LNNA 1QOBA 4YIJA 4ZOHC 2WXNA 3HS0C 5E4WC 2KC2A 2PQAA 2M4NA 1WM2A 4JGHB 4KGSA 3NTIA 1STAA 3DWAA 3EROA 2DN8A 2N9EB 4L1BA 4WWNA 4TSSA 1VJKA 2IHFA 4RA8A 3R7QA 2KCNA 3S17H 5LMUQ 1E6EB 1RL2A 2QGQA 3CP0A 1H8CA 1AEXA 1NE3A 1XLOA 4PYZA 4X64L 1A63A 4MDKE 3GD7A 1DOMA 4RKLA 4QCLA 2KTRB 3A4RA 2UXDL 3W1SA 1LTTD 4EFOA 2XGTA 1BMLC 1LABA 1AZQA 3E9IA 3GTJB 4WJNA 1R9TB 4JV5Q 3WCQA 3P20A 2HDLA 4TVAB 4CDFC 1E24A 1HRJA 3NHHA 3KF8B 4GLVB 2BH2A 1IBXA 2K75A 2FMMA 2K05A 1T9HA 2HD3A 2QMTA 1KL9A 2KWDA 4J8QA 3IBEA 2AL6A 3CSFA 2KJ6A 3DPDA 2PI2E 3BVMA 3TMEA 3I4NH 3EFCA 3U4EG 1G2TA 1R4MI 5ELOA 3MHSD 3ULJA 1V5OA 3J80L 2L83A 1JRPA 2CJNA 4XYQA 3OW7A 3HOWG 1RD9D 1Y1WB 4P7IA 4XGAB 2J52A 4MN3A 2LRUA 4JL9A 3ZNZB 1FGUA 2PO4A 2MFIA 1TS4A 2RHQB 4BBRB 4ZLTF 2GBKA 3KWLA 3ND8A 3W2DA 1CZWA 5I4DA 3V05A 3CCQA 1VQIA 3KW5B 3SD5A 1PGBA 2JP1A 2JA6B 2H5XA 3AB9A 1XMOL 4M01A 1HTPA 1UBQA 2A1AA 2E3TA 2NZOA 2DENB 2LUMA 5AZFA 3U52E 1PRTD 1XWEA 3FVQA 4II2B 1S3SG 5T1GA 4GOPC 1Q82C 4JI5L 1EU4A 1EQTA 1PFDA 2K25A 3JSVB 3ZXRA 2LXJA 1TIID 2LS01 4A3MB 1NSNS 1O7ZA 1XQQA 4AJYB 1NNXA 3F2CA 5IP9G 3S15H 1VQ6A 2V4DA 1ISNA 4IQZA 4Y7NB 1R4NI 2AYOB 1KHIA 1O80A 2BPSA 4MJSB 4XIGS 2JZZA 2EYFA 4NAMA 4C3IB 2K8HA 3QIJA 1GO3E 2JQOA 1WVLA 3HOWH 2LXKA 1GUNA 3HM3A 1T0YA 1RDPD 3QCAA 4RFBA 5D7GA 1JWSD 1VQOA 2FBWB 1HUMA 3SHQA 4WWMA 2BYEA 5AEKB 2XTIA 1Y56A 4EZKA 3HGBA 2NVXH 2A68C 1A6XA 1H9KA 3PUWA 3IG3A 4NJ6A 1AE3A 1ET9A 3KLSX 2OXPA 3TEHB 1TWGH 5M3MB 3F2UA 2FXQA 3AE7B 1GUTA 4LMQD 1WTVA 1TWCB 2NWGA 2OQKA 2UUAL 3K9PB 3ZRCA 3KFUA 3AB5A 3KF6B 1NR2A 4X3KA 3FEWX 1K3BC 1R4QB 1A3TA 4JW0A 3OTOQ 3A55A 5IP9H 3HVZA 1EFID 4IG7B 1PDXA 2F0HA 1NTGA 1QWYA 2KWUB 2BTEA 4B08A 3CCUA 1HR0L 2E75C 4GXBA 1OTCA 3SE0A 2QC8A 3ITPA 1TZ1A 3Q3NC 2IGHA 2K28A 3FPUB 2KFJA 3TP5A 1LYLA 1NR4A 1WYDA 4LJZC 4U673 4JI8L 4FF3A 4J3OD 3SDLC 1QJOA 1BCPD 2QCPX 3P75A 1FCCC 5M3FH 5IYBG 2DJGC 4ZRZA 1QVFA 1SB3C 3GDEA 5C0XG 3TP7A 5I9PA 1EWCA 4G7HC 1V1QA 1NDDA 1A5RA 3GTKB 2B2VC 1TTNA 2WWZA 3DWMA 1KF6B 3L0OA 3LGJA 4ZRKA 2VS1A 4OZBA 3AEVA 2CS4A 3GTOH 3RPFC 5BN5A 2NN6I 1QOFA 4XDDA 1X3QA 1C3TA 2H4OA 1CKMA 3PUZA 2QJLA 1KRHA 1XPOA 3MJWA 5CBAE 2DX5B 1H95A 3PUXA 4PNYA 5IP4D 5H8YE 2EIFA 1WR1A 3H15A 1WTQA 2IO1B 1U4MA 1XNRQ 1BBXC 1NUCA 3S2HB 4W9IA 1YN5A 4NY0A 2OTJA 4YCVA 1VLBA 3HM6X 1VQ7A 1V2YA 2WXIA 1DGSA 3RLNA 1BKBA 4N59A 3ZIMA 5IYBH 3PGZA 1T0RC 5C0XH 1AE2A 2B63H 4EOYA 1Y1WG 4K6DA 1GJZA 2B2UC 4A75A 4ZYSA 3S16H 1J5EQ 5GAGC 4CHKA 4KKSA 2F0SA 3HK0A 5AJ3Q 1UE6A 2ZJPA 4BBRG 4DV3Q 4DNIA 1KAWA 3VRAB 3C19A 1RKNA 1IBLQ 1VDVA 2WXRA 2E2IB 3VR3A 2BB6A 3HG9A 2JA6G 5KGUA 3VUWA 4DFAA 4NAWA 1ZKHA 1PZID 3B2GA 1CHPD 3GTJH 3DMUA 1B3QA 4A3DH 5G3LF 1R9TH 2ZNVB 2KDFB 1U4PA 1EWYC 2LUEA 1RF2D 3Q24A 3D0FA 2K8BA 2A6EC 5EE3A 4FXDA 4A3MG 2XIWA 2JRIB 2ZJQA 5LXIB 3VR2A 3CCLA 1WXVA 3U8ZA 3G4SA 2GVBA 2N9XA 3TJPA 4LF6L 2UU9L 2KDEB 1J6QA 2GBMA 1NCVA 2KO3A 4QUCA 3J81c 1TKGA 5C3JB 1EO6A 4DR6Q 3FMCA 1HJPA 2QDFA 1P9DU 4C3IG 3FILB 4DBGA 3ER0A 3CKIB 1MSGA 2N0SB 1WJ4A 3J81i 3JYUA 2LGIA 2N9KA 2RPQA 3I4LA 3EC8A 1QKZA 4NQKE 2HIVA 4BBRH 1VQ4A 4OELB 3SR1A 4KJOA 2L55A 3Q22A 1U4AA 1E7UA 2VZKD 3DOWA 2JA6H 2N9LA 1BBWA 5ELDA 4K2LA 2RDGA 4RMFA 2F0WA 5IOCA 5LMUL 2CU3A 2JF5A 4QY7A 2WXLA 3AE9B 3FP9A 5AUIA 1Y8OB 3UE0A 5GAHC 3L08A 1S1QB 2QW7A 4GZYC 1Z6HA 3EGRA 1HPCA 3FPPA 4A3MH 4PZ7A 2ZTEA 4DV5Q 4B3TQ 4R4IA 5EPLA 3KUPA 4XXEA 4LF4L 2IO3B 4K8JA 4JV5L 1E7PB 2I1KA 2WDQB 1EY6A 1WTOA 1VQMA 1PH7A 1VF7A 2N1VA 1KAAA 5ELBA 4XQJA 2F4VQ 3ML8A 3RLFA 4Y7NH 4A90A 4GSWA 1K53A 1MGSA 2FJ2A 3M63B 4C3IH 2WXJA 2UUBQ 3DBRI 2JWUA 2NPTB 4DXAB 4ACFA 1DGJA 4KY7A 3HOZB 3Q3OC 1G291 4KHPQ 3TEWA 1K73C 4HVBA 5E7NA 2IBIB 3MEHA 3CRLC 1PTOF 2LEKA 4FP5D 1EIFA 1PFNA 3BK1A 3GZNB 5EPKA 4A3IH 4O1NA 2K6QA 4DV0Q 4S17A 4H13C 5I6WA 2IDYA 4KN7C 1SYEA 5M3MH 4LK0M 4RM9A 3KLSA 4GS3A 3DLLA 1GAQB 2BA0A 3A9KB 2B2WC 3ONAB 4DR1Q 1IGCA 4OVZA 1L1OB 1S5DD 1TWCH 4YXDB 1UEBA 4R3DA 1PYSB 2KVMA 4EQOA 4ZRQA 4LFAL 3MTSA 2HT1A 5JPMC 5G5GA 1EU3A 4YY3L 3R7RA 3Q8BA 3D4DA 4DV1L 1WTPA 2X69A 2I38A 2MLBA 1Y8NB 3JAME 2AWOA 4WJQA 1S40A 4OHJA 4NZLB 2PKOA 3GS2A 5M5XB 1VQDA 2FINB 2L12A 3A0JA 2RDBC 3QHTA 2L5TA 2WV6D 3A8JE 3NENA 3ZYYX 1V6EA 3SXHA 5CYUA 4WJ4A 3DBLB 3ML9A 1J7AA 3LXFA 2Y5CA 3D6WA 3T1HL 2REXA 3U2SC 4C80A 5CV8A 1XLNA 2L7RA 4L5QA 3GTKH 4MT5A 1DONA 2A5HA 1FMAD 1DOIA 1HTOA 4GOPA 2LSSA 2WKCA 5EQ0A 3QARA 1RJTA 2VQEQ 4M1UB 1WMHB 5JVG3 1N61A 2KLGA 4OO1G 5C3XA 1DXMA 5EBCA 2EYPA 4K5XA 2MUYA 4Q2JA 4X66Q 4DR5Q 2WAQB 3GE8C 3KYCD 4R1JA 1UWXA 3W5UB 2R7FA 4P1CC 4LF9Q 4DXFA 1QOGA 5L37A 1K8GA 2R6GA 1FXIA 3TZDA 4JCVE 3ZGZA 3H6MA 3S2HH 4NJCA 3OTOL 1FGBD 2D62A 2EZVA 4FF1A 2JYTA 1RHPA 3NOBA 4RHSA 2HDEA 1HZ6A 2KDMA 4DDID 2L15A 1GUSA 2KKCA 4HIMA 1QUQA 5JJKA 1K8RB 3LB8C 4HRSA 2K01A 1ZXHA 2A6ED 3TS0A 3D4RA 5I9OA 2LMCB 4YWMA 1B9RA 1K28A 2J0TD 2V0GA 2OEOA 2E2JB 4QIWB 1OTRB 3MHZA 2JRHA 3OW2A 2HDMA 1Q1EA 2KTFA 3AN1A 3RN5A 1N60A 5CV5A 3Q0AA 1FJGL 4JI1Q 3GB1A 3U7ZA 5EE0A 2E2IH 3T1YQ 3P63A 5EGTA 4OO1H 2HJ8A 3ERQA 3FKIH 4AQYL 4DR7Q 2BS3B 1KABA 4IJLA 4IUMB 1AW7A 1PZKD 2QKIC 5IKCM 3TDQA 2WXQA 4LNKA 1HCZA 1IL2A 4GLSC 1ENAA 1G6ZA 2JA9A 3RZOB 3QAQA 2W3RA 2D5GA 2MNAA 1CJEA 3AE6B 3PUYA 3PIO3 3H09A 2KDIA 4TMAB 1ZPSA 3P4PB 4FO2A 2TSSA 1M8AA 1TR5A 5FOBB 4JI4Q 2JK8A 5C4JB 1Y8RC 2IX0A 1N36L 1QZHA 4AQ7A 3AI5A 2C35B 4BKSD 3CMAA 1XNRL 3RR5A 4G57A 3U58A 2MO1A 3M3YH 2WIIB 4YCWA 4B3SQ 2B2VA 1IUEA 3DBSA 5L83A 4EE2A 2F0EA 5C0XI 2UU7A 4D2KA 3K7UC 3NEMA 5CR3A 1ZXIA 3ZVVA 3SGIA 2F0FA 1M90C 3F1ZA 3HOZG 2WHIA 2M17A 2MHJA 2NBWB 1K0RA 5LXHA 1UH6A 3VTUA 5BR8Q 3KF8A 4BY1G 3LJ3A 3RNEC 3U9SA 1J5EL 5AZGA 5JJIA 4OWTB 1G6JA 3T8MA 4DV3L 2DYBA 3EFXD 2XK5B 1LTRD 3QK0A 1IBLL 2PYKA 2A4ZA 1VQAA 2ASQA 3W3AA 3KJOA 1V49A 4JLCA 4QMGA 1D6EC 1ZKOA 3WOFA 4A3LG 1JJGA 2G4DB 4HIDA 3MC9A 1SN8A 1D1IA 2JY6A 2WP9B 2ASBA 3RULA 3I2ZA 1Z7TA 4A3EB 4HKZE 1N6ZA 1Q3LA 5G2NA 4AWJA 5C1ZA 1ZXTA 1YJJA 4FJVB 1OXTA 2LVOA 3U30A 3K81C 2OQ0A 2R92B 2J7QB 2VRRB 1U4LA 2VH2A 4K3BA 1SYGA 1F2RI 5FKAC 1B1ZA 5DM63 4EKUA 3I9V1 3HOZH 1LTLA 4DR6L 1Q10A 2JXMB 3DWPA 5HI1A 2KK8A 4C4VB 2IGDA 1K50A 2F0MA 2E8GA 3Q6SA 3ICEA 1GC7A 2G45B 2B8GA 1YX6B 1E9MA 1GXDC 3QWNA 4WJ3M 3KUDB 2R3ZA 3H94A 4GLAC 2ZM6L 1WE7A 4MJSA 2EY5A 1ZDXA 4W9CA 2KHSA 1A2TA 4P73A 1EF5A 4K2KA 2MQHA 2WAQG 3X3MA 2YEPF 2ZXPA 3GTPB 1HEZE 2I5MX 4V0BA 5KNDA 2RSUA 2X6LA 4GOCA 2KVRA 3N1XC 4DV5L 4B3TL 2JA5B 1RAXA 4ZKBB 1Z5SB 1SF0A 2FCQA 1D8LA 4QUFA 1ZW7A 2CHZA 1DOKA 2PE9A 4EQPA 2DAFA 2R7DA 3CF6E 5C4XB 4IUPA 2LVQA 4ZRIA 3BIID 3RZWC 3D3RA 4XTCS 5FJ8G 3QJYA 3DEPA 4A76A 5KHQA 1W6KA 2ZTDA 1FEHA 3CAMA 4PZ8A 2FFKB 3IAYA 2F52A 2WDTB 3IL8A 2M56B 3KVFB 4QL5A 2JT4B 4HCEA 3LNNA 4GMVA 1F9QA 2NVYB 2K50A 4IWPA 1KJTA 4MGIE 3U7DA 3PHXB 3K0YA 1PTOH 4BAXA 3KF6A 4BKSA 4DN4M 5KNCA 5C0XJ 4DK0A 4KHPL 3I4NB 1KFYB 2LHEA 4BBSB 4XE0A 1V1PA 4UP8A 2M1MA 1NI3A 3KYHC 4GN5A 3NTHA 2HE7A 1UELA 2F3IA 5AUKA 2B76B 3I7FA 2KWVB 2RF4A 4AP4C 1VQ8A 2UXCQ 2B2TC 4RCOA 1Q46A 2QCZA 5MPOA 1J0GA 2DJFC 5IGBA 2KJHB 4L23A 4DV0L 5C4HA 1T3QA 2EKEC 2D2CC 3K5MA 2F03A 2L3ZA 3NQIA 1HE8A 2M0AA 2NMQA 2NR2A 4MSQB 2YEPB 5IO9A 4DWFA 2EY1A 2Y5PA 3STBC 4DUYL 3B1LX 5IYCG 1SLJA 2MCNB 1XEEA 2CU1A 3J80E 3DHGC 5DAUA 1TIFA 1ICWA 3A74A 4O2DA 5FLXL 1KXLA 2L32A 3HP3A 5DCNA 5FJ8H 5E6NA 2O2VA 1VD2A 3CCRA 3HHMA 1A3VA 5CMDA 4J1MA 1J19A 3WAPA 4QAYA 2J4XA 1FYCA 2PMZB 2E5LL 4XZ4A 1A70A 4KSKC 4XWWA 1FXAA 1WGRA 1Q8IA 4URKA 2E2JH 2WYQA 2WXKA 3HUIA 3OOCA 3E5SA 2VZAA 3NWTA 2N4FA 1JWUD 3ULLA 2B2WA 1N32Q 1HQRD 1PMRA 1FIQA 3RMHA 2AWTA 1EY0A 3AU5A 1C8CA 5G5HA 4II3B 1T0QC 4EQ5A 2EY6A 3PIP3 2BBCA 3ERSX 4ZYNA 3BVZA 2MSED 3CRKC 4ODGA 1EYDA 2N78A 3IT6B 2WGSA 3C1EA 3RZOH 2UUCL 5LLIA 2F0LA 1M1KC 1KOTA 2CJOA 1PV4A 1S4ZA 1WJNA 4FXGC 4OVVA 4HPLB 4E3CA 5IYCH 3ZDMC 2O6VB 4MTNA 4X66L 4DR5L 4UDUC 1GUAB 3CQZB 3QA8A 5C4JH 1UGMA 4LF9L 2WX1A 4A3EG 3BZDB 3G48A 5DPRA 3K57A 2VXWA 2FE8A 1VF5C 1YEZA 4A93B 1HZCA 2RA4A 3SK4A 5J22A 1QOHA 3WOEA 3HKSA 1FD6A 2IYDB 1MKHA 1ESRA 4GNXC 4PMCA 1X56A 2A6HC 3VQIA 5K5PA 3EA6A 3TREA 2L76A 1L0VB 4BOZB 4KZCA 1LTBD 3AEFB 3VXWA 1JOQA 4NW2A 1Q5WB 4TQ0A 4OO1I 2MBQA 4TQ1A 4UPAA 3VDZA 4JI1L 2SOBA 4JI0Q 4U68A 2F0IA 4X3UA 3C2PA 4PYUA 4JI7Q 1F77A 4F7XA 5M3FB 4PS3A 4J15A 3K5NA 1E8WA 2NZ1D 3OPOA 2V9HA 4HJGE 1Z2MA 4DR7L 1R7SA 4HJ8A 3NZSA 2BKFA 4NPSA 1PH5A 4K7WA 3FILA 5C3EB 3W1YA 3RI7C 3NP8A 4FA6A 2NZHA 1F9RA 3BDCA 2CHBD 2VH1A 1EUVB 1RTOA 5FO9B 2ENBA 2LFIA 1X6OA 1ZE3D 4A3EH 2B8FA 4UHVA 4XT1B 2PPHA 2JA5G 1STYA 2BOSA 2K6AA 3HFZB 1MHHE 1XPRA 1PH2A 3VR9B 5IGGA 4DUZQ 4X65Q 4LW1A 2R92H 5C4XG 1KNAA 2IJ0A 3MVVA 3OMGA 5LNK1 2MP2B 2ONQA 1ENCA 1OGWA 3NUCA 4XT3B 1N33Q 2PW9A 2KMCA 3TBLD 3TEZA 2ICEC 4XQNA 3UGBB 4MNOA 1WJ6A 1UE7A 3JAMc 2HD5B 2MX2A 3IKJA 3U50C 3E6ZX 2NBUA 4BWGB 3ZJVA 4KLKA 5H92C 4KGTA 3I4NG 5GMVA 4BBSG 3MXNB 2KEDA 3JAMi 1IKMA 3I3CA 1YIWA 1TS5A 1SNCA 3PF4A 1XNQL 2B63B 1SNMA 4DV7Q 3L17A 2EELA 3TZUA 1HUNA 2K5PA 2L52A 3DVGX 3S16B 2I5LX 4DAPA 1UF0A 2WDRB 3GTPH 5AFWA 1C4CA 1P7FA 2C5CA 2JA5H 3V2TA 2BS4B 2L0CA 4A3CG 3TEXA 1XJVA 2QDBA 3ZKJC 3SDZA 1KRTA 1ET6A 5C4XH 4A3DB 1E8XA 3MXUA 3BS1A 4PZ6A 3AYHB 4L8JA 2WAQE 3UINB 2JWZA 3NZUA 2GOWA 4K7SA 2UWQA 3STBD 1PLFA 2KCTA 3A9KA 3L2PA 2NVYH 1IKLA 2IL8A 1TKWB 3ZUNA 1JOKA 1VRAB 2K03A 3EECA 3GZNI 3L7ZC 1FNUA 3MWYW 1TKYA 3AH7A 2RCNA 3TUOA 5HKHA 4BBSH 2CQOA 2FUHB 2WXHA 1XX8A 3AECB 4DR3Q 1T5XD 4UP9A 1EFWA 3HVDA 4A3JB 3W9CB 3ZO5B 4HDQA 2RQXA 3N6RA 3NPPA 2M8SA 2R93B 2RKSA 1I3QB 1KD1C 2KANA 4MZ9A 4QIWE 1IGDA 4PK1A 2KA7A 4ZHPA 2N9PC 1WI5A 1JR0D 3EN2A 5C5LA 2RVLA 3G7LA 3MFGA 4W9LA 3S2DH 3K6OA 2GLSA 4A3BB 3WA0A 1JORA 3OIPA 4P1BC 2F0JA 4JVZA 3I4MB 3Q14C 3UIOB 4A3CH 5IT9c 2WX0A 5IY0A 2DZIA 3KUCB 1VS0A 1EIHA 4M8NA 1I6HB 2LFNA 2K52A 3AV8A 3W5VB 1OQRA 3MTNB 3TL5A 3RFZB 2BKRB 4RM8A 2KD0A 1KLUD 1D5MC 4A93G 1WMHA 3DBLI 1NMGA 1ZOYB 5CBEE 3PV1A 4A20A 4OONA 2RBMA 1VMCA 4E6IA 1C48A 3J81L 3D32A 3Q8FA 3R66C 4JBMA 1B50A 4LLGM 2Q2HA 3JC66 3TS2A 5KRUA 1V8QA 5J3BA 1HTQA 1L4DB 2L9HA 2EMTA 1FO4A 3UF8A 5JAVA 2PW7A 3R2IA 3AXCA 4CO7A 3QJZA 1ASYA 1EIYB 4TKNA 3S24A 2PI2A 5M3FG 2BQQA 2A6HD 1SAPA 2UXCL 3M4PA 3CXCA 2JA8H 2KJRA 1P3QU 2PEAA 1EF1A 2BDNA 5C3EG 2MWSB 3I57A 4HCPB 1TY0A 3L9AX 2LMCA 3CQZH 3OWFA 4CKCA 4A3IB 1IP9A 4LF8Q 4DAYB 3J7AV 3AEDB 2B3AA 4HKQA 4DV4Q 4P72A 4DR4Q 1N9WA 1HQMC 3ONSA 4S3SA 3PLVA 1QT9A 2YVCA 4Y52H 2MH7A 1XXGA 4A93H 4BA1I 5M5WB 1E0ZA 2RCFA 4LNOA 1VQKA 4K0KL 2A5UA 1QQRA 1ROEA 4A9AA 5IYDG 4KV6A 5D65A 1QNKA 1MI0A 4RG1A 2BW2A 1YN3A 3GO5A 5FR6A 3HOUH 1SXTA 2ZPYA 1CSPA 2B2TA 4MH0E 1SNPA 4H44C 2E6XA 3NXWA 1AZPA 3FKYA 2D3GA 4QGUA 3PRZA 1QOAA 4JI3Q 2DNEA 4HN7A 2JE6I 4RKBA 3BDLA 4QB4A 2EDGA 1F9JA 3EIVA 1N32L 2AEHA 1F52A 4JYAL 3MAQA 4IUTA 1HNZL 3PQIA 2FCNA 3N52A 2MA9B 3LWUA 1I5FA 1Z9FA 2EPBA 3MJ5A 4M0WB 1YX5B 2N49A 1VQ9A 2B63G 2KN5A 3D4WA 2ACZB 3EHVA 1H9SB 2ON8A 4ZKCB 4C3HH 1P16A 4RGTA 5C3EH 4ZHOA 1G51A 2EYMA 1RFAA 3OAWA 4PMBA 1YD8U 3BWUD 3PZ8A 1V43A 5CHVC 1GB4A 4G3XB 4MHEA 2K8CA 1KIXA 3NS1A 2K9XA 1F0ZA 3DWGC 3OG5A 5FLMG 4DR2L 2WB1E 2K7VA 1PGXA 4LF5L 3TMPB 4A3DG 3OHXC 2FMCA 2PPBC 5BMHA 1VQLA 4AYBB 4X57B 3GP7A 1E2WA 5IYDH 1JW9D 5KYIA 4X62Q 4F7ZA 4FNFA 4GKKQ 1LT4D 3WAOA 3PCOB 4IOIE 1F2MA 1FCLA 1KLVA 3U9OA 3GOEA 1C0AA 4L5RC 1YJWA 4B95A 4FXKC 1KDCA 1CHQD 2AUJD 3S1RB 1JMLA 1WYGA 4KSLC 2A73B 2YYZA 4ZK9B 4FULA 4LNFA 5D6JB 1D4BA 4Z9CB 3S14H 2ZCCA 2KFKA 2JEBI 1F2RC 5KYLA 4MM3A 4AOFA 2XWJB 2NVTH 2C9OA 1X1MA 4USAA 3TP8A 3URYA 1TBEA 1WGYA 3CCJA 4A3JG 3K59A 4IUQA 1NBFC 4W9FA 3MHBA 3TN2A 1HZ5A 3VUYA 5IGCA 2R93G 1Q81C 1M94A 4DHZE 4ME3A 4JI7L 3A7AB 4J6HA 5CHWA 1A62A 5A2QE 2KX0A 4KKIA 4CQNA 4A3BG 1STBA 4JOIC 5E1FA 1HNXQ 3DCGA 3HRZC 3U4VA 4EZJA 3AFPA 3H3VH 3I4MG 5FLMH 3FKIB 1IXRA 1YIJA 4IO9A 1CUKA 2JUOA 3I70A 4GNXA 2JX5A 2MW5A 2G9HD 2Q5WD 3NG0A 2CR5A 2RPVA 3VRBB 5EKLA 1EY9A 1EQQA 3CMMB 4LFBQ 2E74C 1VQPA 2GRIA 4DA2A 2NUCA 4DUZL 2ZT9C 2XVSA 4HSVA 3TP6A 3DVGY 2F0PA 2K6DB 1V5TA 2V3NA 3B0AA 3AMZA 4GDLA 4PMWA 3J80c 3UDGA 1C4PA 2IO0B 1WXMA 1SYDA 2D3AA 3RUIB 1BVSA 3A7LA 3M3YB 4NPNA 1W3SA 2LGSA 3J80i 2CH4W 2DHZA 4GN1A 2V3SA 3H7SA 4A3JH 4KX6B 2PMZE 1BBUA 5C44H 2CH4A 2GA4B 2R93H 1CKNA 1I3QH 2FUG1 1WYWB 1GD7A 2O4XA 5HY6A 1G6PA 2L11A 4HJ5A 5DPTA 2N7EA 2CWPA 4A3BH 2N8NA 1O7LA 3K8AA 2A19A 3D8GA 5D3DA 3I4MH 4A3IG 1VDZA 2F0VA 5HURA 1D5XC 1TQOA 1J7CA 3GTGB 5IGEA 2KN4A 2QA4A 1I6HH 5M3MG 2EYHA 1HFGA 2CHXA 2LXAA 1G2SA 1I94Q 1OXUA 4APVA 1RFKA 1IYJB 3GQBA 2BYFA 1EEFD 2VB3X 2W82A 2C9WB 1I4HA 1C7YA 5GADC 4F1SA 3MEFA 1GOZA 2G1EA 5IGDA 3SVMA 2C7NB 1SNDA 1TJEA 1DJRD 3SEBA 2EYLA 3BU2A 1JT8A 1IBKQ 1LFDA 1GB1A 2EXDA 2WU2B 4OW0A 3AE5B 5DEHA 1WM3A 4XX5A 3Q3MC 4K7UA 1E0BA 4X3TA 3QOLA 1I4XA 3GTLB 4DR3L 3HRDD 4LTUA 3RYTA 1GKHA 3KH0A 3DQVA 5BYRA 2AQ2B 3AE2B 3FRPB 4NP5A 2YV5A 3Q2AC 4HDOA 1B9MA 1YVCA 5IIFA 5I2XA 4IM2A 1A2UA 2PQAB 2JN4A 3T51B 4F87A 2IX1A 4LFCQ 1A3UA 3G6EA 2D3CA 1V86A 4B3RQ 2X8XX 1IPGA 1NYRA 4OEMB 2DWQA 2Q8RE 4RF1A 5M5WH 4PQXA 5IWAQ 2GVAA 2Z4IA 3VA5A 4WAAA 4IJHA 1ZUD2 1C9FA 1WD0A 1PDQA 4YTMB 4I7AA 4AYBG 5JHAA 2HCCA 3BYTB 1UBIA 4EZLA 4W9GA 1HNWQ 1PH1A 1P0RA 2WXGA 3P7JA 1L0WA 4GDKA 1FR3A 3L16A 1D2BA 2B39A 4CKEA 4DHJB 3KLRA 4F88A 4RGOS 1IBXB 3TQYA 3E0JA 3GTMB 1CMXB 3X3NA 4N6EB 1EYCA 2HHHQ 2VW9A 3I5JC 4DAVA 2OHFA 3CWIA 1T0SC 1SBBB 3BY4B 1HA5A 4BVUC 1UE5A 1N8RC 1A15A 2GB1A 3RD4A 4O0AA 4KMUC 1C4AA 1KC8C 2WXMA 1PTOB 1FFVA 1KTKA 2PIAA 3X23A 1PXUA 4WURA 1UZXB 2M00A 1SDFA 1VR9A 1K51A 5DLQE 2ZNVC 2IHEA 1TWHH 3FKIG 3CW2C 3PVLA 4P16A 1LTID 2K5NA 2JEAI 1HH2P 4LF8L 2A8VA 3K7AB 4W9HA 4W9KA 4DV4L 4BBNF 1LT3D 1LQBA 4MGZE 1DZ1A 1EYAA 4BY7B 3CU7A 3T16A 2ID0A 3I8ZA 1E10A 4G7OC 1FM0D 3I56A 4ZUIA 3I73A 3CD6A 1PUTA 5E6OA 3T9LA 3IAS1 2QEJC 2AHOB 1ZDVA 2J0MA 3N1ZC 1IL8A 2MPMA 4CDDC 3S1RH 3A9JA 1XT9B 2LWPA 2KHIA 2HJ1A 2WP8J 2VB2X 1BNZA 1EIGA 4I6NB 1ICFB 4KVGB 2KJXA 3SK5A 1V97A 4YTPB 4JI3L 1WIAA 4RGNA 1YMHE 4CDCC 4NQLB 4IUUA 2QILA 1YI2A 2LKVA 1CI3M 5JZEB 4YWGG 2L1BA 1HZBA 1H9RA 3PZ7A 1GHJA 1N62A 3ENEA 4KZ0A 3VUXA 4ID6A 1WOCA 1NVID 2EE1A 4DNTB 1FL0A 2R7ZB 3LDZE 4IKGA 4RH6A 2R2QA 1LACA 4OX9Q 3UI3A 5IT9E 3S2DB 4ANVA 3RN9C 1D1KA 4M00A 1UAPA 1BDOA 4HK2A 2SAKA 1QE6A 2BF8B 1YJ9A 1YJIA 3MA2B 1WZ0A 1L7YA 3I55A 2HTME 4ZCKA 3T3NA 4YHHQ 4B9WA 1JE5A 4LUOA 2WKDA 2WXOA 1KDAA 1CKOA 1YN4A 2V1YA 4X62L 1BXTA 1GJXA 1Q0WB 1J8IA 5ISRA 2IPKD 1WTXA 2XWBB 1SIJA 3M3JA 4NXMQ 2GN5A 2EKIA 2F0OA 2V3PA 3C1FA 1RM6C 4G0NB 3V62A 1K8MA 5J2RA 2L00B 2BE5C 1YZ6A 2KTRA 3KQ4A 4IPCA 4WJOA 5M9OA 4LUVA 1PRTF 1XF5L 1OO9B 3P1MA 1L0XB 1F2YA 1HZ9A 1EY4A 5L95C 1EY8A 3DVNU 4GGQA 1B53A 2DZKA 3X0WA 1N5WA 1V1OA 1WGHA 1DM0B 3H3VI 1PFSA 5AJ3L 1L1OC 4YL8A 1UWVA 4C2MB 3GTGH 3BYYB 1HNXL 3VR5A 4C56C 1LUZA 1X65A 2Y5BB 4RHRA 1RLFA 5CV9A 3V6EB 4ANUA 1I6VC 2PMVA 1F9SA 2J0KA 5CTRC 3PO3B 3VH3B 4YSZB 5JH5C 4HIKA 3OJ3A 1DOXA 1JMCA 1VQBA 3AE1B 4WAFA 2ZTCA 1T6BX 3AE8B 1MJDA 3QB3A 2B2UA 4IPGA 3AEEB 4IM0A 2XRSD 4HR7B 2VQFQ 2BH8A 1R4PB 4JOIA 3GTLH 4RF0A 3K0XA 3SFDB 1PTOC 4UP7A 4WRDA 4DQOC 1E7VA 1AFPA 4WIPA 1SNOA 3L3OC 4JI6Q 2V1CC 3JSVA 4FN2A 1WF9A 2UXDQ 1VZ8A 4JIOU 4A3FB 1ACCA 4LDTB 1FVIA 3Q3JA 3C46A 1U0LA 1QCBD 2G9DA 2JSOA 2FAZA 1HA6A 3DM3A 4EQNA 2BT6A 2FIFA 4YTNB 3C3LA 2J0JA 2I1JA 2XN9C 1EEID 1SEBD 2WB1B 3OYYA 2Q2UA 3I63C 3QR8A 4P71A 3CC4A 1BQQT 1VQCA 1H9MA 1DOYA 2RMMA 1BCPF 1I94L 2F0NA 3UI2A 4QJFA 4BY7G 1BOSA 2JU6X 1TWFH 3Q8DA 4R9WA 4NAWB 1WY8A 1EWHA 1C78A 5BYQA 4DK1A 3DWQA 5CV6A 5NUCA 5IP7G 2IGGA 2NTSA 5K36G 4BFRA 4GIVA 2I07B 4IPDA 1OQYA 2EXZA 2PW5A 2GI9A 2F4VL 2SNMA 3VR6A 1PYBA 3GTMH 1GG3A 2KMMA 1WTRA 2WXFA 3KOJA 4AYBE 1KQSA 1EY7A 2XSCA 3JAML 4KIKB 4L5SA 1IBKL 2ZXOA 3TRZA 4A3GB 3WANA 5BO4B 3B08A 4JG2A 1WFQA 2UUBL 3DHHC 4KKUA 1LT6D 4DHZB 1KDBA 2HTHA 2KXJA 4DV2Q 4FVMA 2V4IB 3RCZA 1AP0A 1B3AA 2X38A 4JI5Q 1HZAA 2R7ZG 4BZAA 3Q3FA 3I91A 3ZTCA 5TSSA 3M85A 1K8AC 3PO2B 3K80C 1SSNA 2OJRA 2W9NA 2LGDA 2YLMA 3RNAC 5BYSA 4LF7Q 4RCNA 4LFCL 3WWVA 3CHBD 3DXJC 2QDLA 5J1ZA 5A35A 4G7ZC 4B3RL 4FLHA 1QILA 3K7AH 1TXYA 1XTCD 2MJ8A 1UE1A 2PVGC 2RSOA 4IALA 1PH9A 4NJ7A 4DR1L 2B29A 3KK7A 4BY7H 1LTAD 5IWAL 3F2DA 5IP7H 5K36H 5G3LD 1Q1BA 4WJWA 2F0UA 1HNWL 2O5IC 2GMIC 2JZPA 3CCVA 3E56A 4ANXA 1YOVB 4QF4A 3PT2B 3WIMA 2OCEA 1FRDA 2K22A 1X3EA 3Q23A 4WORA 2KQ4X 4F8CB 4XC2A 3UDIA 1X55A 4E71A 2MQJA 3HIZA 4GB9A 3OMCA 2I0QA 3BG3A 2R7ZH 1K0SA 1JOOA 2UUAQ 5I2YA 2AX5A 4R4TA 2AL3A 3KBXA 1AN8A 2YTXA 2BE5D 1RIPA
chains in the Genus database with same CATH topology
1S5BD 1CT1D 2MJ3A 2BA1A 2Q8TA 3AEAB 3T4AC 2I46A 4OGQC 2ZW0A 3L4PA 3NUHB 2JA8B 2WU5B 1L6VA 3OIQA 4O42A 3AE3B 1CA5A 2K32A 1SJED 1SE4A 1EY5A 2F0QA 4JE3B 2VNUD 5EE1A 3TEYA 2A69C 1Y1VB 2EJFC 3VR4A 1JWMD 1YQ4B 2QF7A 3HOUB 3NK9A 4ULLA 1XYIA 3PUVA 1BF4A 2H1EA 4G4KA 3AEBB 1PTOD 4KKJA 4L6TB 4A8XC 1QF6A 4C3HB 2RDHA 3Q8EA 5EE9A 3DUZA 2MP1A 2JYEA 1PZJD 4KTAA 3V3XA 3ND9A 2DYMA 2VZKB 3AM9A 2HCIA 4L2YA 2M2LA 3FDTA 2BS2B 4MIUA 3S14B 4R8NA 1PGAA 1ZEQX 3GTQB 2NVTB 1CTMA 3DEOA 1WGKA 2J53A 2Q8IB 1OXVA 4UAIA 2EY2A 4OZAA 2F0KA 4XDXA 3NWSA 1OXXK 3LX0A 1M4VA 4HSPA 3MXPA 1EOTA 1WCMB 2H89B 2QSDA 1JQYD 1U4RA 1K8OA 1BUVT 3SK6A 3WDNA 2AQ1B 3HKZB 1EL0A 2WACA 1C79A 3R93A 1MI2A 2KQ3A 1QG7A 3Q8CA 2XNAC 1XLPA 2SNSA 1B44D 3B2FA 3P4QB 3H0GB 3PMFA 2BB5A 1MSHA 2D5DA 4NMZA 5C44B 1SYBA 1SJHD 5GXGB 4FF2A 5F2DA 1HHVA 3ZJUA 2EYJA 1TS3A 4L63B 1L0YB 2HUGA 3AMUA 2JYOA 1PYWD 3V96A 5EBDA 1GUGA 4YSXB 3M4YA 3RZDB 5CGKA 5D14A 3HOXB 2K1BA 4IDIA 3PV0A 1Q12A 4HMJA 3P4RB 5LL6S 1I4GA 4DGZA 1IW7C 4CJ2C 3MP9A 1VMPA 2I2YA 1N5XA 1F2ZA 3DHQA 2A69D 1JALA 3SK8A 2LHDA 3GV3A 1TT2A 2N88A 1X32A 4IURA 1E2ZA 3GV6A 4KD4A 4IFDJ 5DM73 4H7BA 1H9JA 4C3HG 1GPXA 1ZYRD 3A56A 4MH8A 3K5LA 1UEAB 2OF1A 5BMGA 1LT5D 2NTTA 3VYTA 5FO8B 4KGRA 2F3WA 1Q90A 4IUVA 5EKKA 2E2DC 3MFYA 3M4OB 1O78A 4B0MA 3KWVA 3HEJA 1SSOA 4C1NK 5EKIA 1J9OA 1C4QA 5C3WA 2IWHA 5BN3A 1EZ6A 1OXSC 3VA7A 2AWNA 3VYUA 3K58A 2AQ3B 3I72A 1JC7A 5I6YA 1V1PB 3H3VC 4BA2I 1L5PA 1CFMA 3LWEA 4PT5A 1C76A 4PV1C 2PVOD 4Q5VA 3SHLA 1TWHB 3AEGB 2L4NA 2MJDA 3MC0B 4CHTB 1Y8PB 4YSYB 1STNA 5DNFA 1IHZA 1ILPA 1OFFA 2PZUA 1I50B 3D31A 2BCOA 2DY7A 1UNSA 2YU9B 4CBVA 1SYFA 2DY8A 3S1NB 1JCKB 5JPNC 1EQVA 3NTKA 1HXYD 4JK1C 2PCFB 5HGTA 3H91A 4KHVA 3VR8B 1WTWA 1DD2A 2NB0A 5JXVA 3QIAA 2RSNA 3J7YW 4A3KB 3T13A 2MJEA 4JWSC 3E9SA 2J42A 4I65A 2PZWA 1UWMA 2F0DA 1O7YA 1U9RA 1DYQA 4KI0A 1MVKA 3NSWA 5HG2A 4LK1C 1XCTL 4H2AA 5BN4A 4JPSA 2HQEA 3IXSA 3FC4A 3QO2A 3S1MB 1C77A 1IW7D 3NBIA 5KEEA 2R61A 3ZJTA 2ZW1A 4HTHA 3B9JA 4N58A 3T3OA 1NENB 4EVOA 1MHXA 1CK1A 3NQTA 5D3IB 3ABVB 1IYVA 4MACA 5ELFA 4K5VA 4OZCA 4V190 4RNAA 3O13A 2Z1CA 3IAM1 4US9A 3EQLC 1L6UA 1LV9A 5C6AA 2KAJA 2B2YC 5ELEA 1N63A 3BVGA 3IT4B 2DBYA 4FF4A 4ILWA 2NVQB 4R8IA 2DYOA 1RODA 2M19A 3EJIA 4KJNA 1Y69U 5JOBA 4DNRB 2DNCA 4XQQA 2E2HB 3EUB2 1DCZA 1SMYC 2A68D 4IN3A 1LLRD 1UGJA 2NBFA 2K0PA 4TKOB 1LO5D 5JVH3 4JBWA 3VYSA 4JWUC 1CQFA 3BDOA 5JEAJ 1OQQA 2PNRC 3K5OA 1VZ6A 3SR6A 4US8A 1TWFB 4N9TA 1E2VA 4BY1B 2EOTA 2QIEB 2E76C 5KIXA 1RWSA 3P42A 2F3VA 1TS2A 1NYQA 2INNE 5BMIA 1KLGD 2J7ZA 2K5WA 4K6LA 3R8BA 4KY6A 4HEDA 2PZTA 4ABNA 3QOJA 1MD2D 2JA7B 2IW3A 4KK7A 1EM7A 3NVWA 2F4IA 1YNTE 5EPJA 3TBIB 1CZGA 1HTLD 4B9XA 2IX3A 1P7EA 4OIJA 2EJGC 1QNUA 1W6JA 1FNVA 4WH4A 1STEA 2CW0C 4XWTA 1WRIA 1ENFA 3OSOA 3G6JB 1B4OA 1ML0D 5EJWA 1XO3A 2F0GA 1WSPA 1FFUA 2INPE 3C8YA 4K5WA 2F1MA 2DLBA 5LL6X 4RGMA 4XYOA 3PO0A 1PFMA 4FXCA 4HEA1 5FLXE 1TWAB 2OEDA 3R3OA 2KCCA 1JROA 3NRZA 2K3UA 4TQUS 5T1IA 2WXPA 1I4QA 1MBYA 2FHTA 3HOVB 2VUMB 5A2QL 4IFDG 1S5CD 2EJMA 3I90A 4ZUJA 4C3JB 3T56B 2TMPA 5KNBA 2Z4HA 3MXNA 1JB3A 1BUIC 5COYA 5JJZA 2BDOA 2WDVB 4OIKA 1B2TA 2Y0SB 1AYFA 2M9VA 1BO0A 1TU2B 3ETRA 2JQRB 2OT2A 1DOLA 4ME5A 5E6JA 4OL7A 4TRDA 3NZ3A 1S5ED 4ITKA 2X6GA 1UUPA 4RWSC 1STGA 1WD1A 4REZA 2KECA 3OWEB 3S1QB 2EYOA 1SFOB 2H88B 4HMIA 4AS1A 4IFDH 1MPEA 2CQAA 3MZ5A 4C7YA 2ZXRA 2LY7A 3T53B 2K04A 2Z8LA 1RYJA 1F9PA 1TY2A 1SMYD 5IGFA 3M7NA 1GUOA 2LJIA 1FD7D 4BS9A 5CC4A 1LTGD 1I4RA 1GUWA 4CJ1B 2O2LD 3DM1A 3BK2A 2MGSA 3A8KE 5HHDG 3NBHA 3MXGA 1PRTB 1G8ZD 1NAPA 1NEKB 1XLQA 4KY5A 4C1NI 3LYYA 2F0TA 1SYCA 1YNJC 4HROA 4MM3B 5M5YB 3RUZA 4KN4C 1XCQL 4K14A 2KUMA 4P2CB 1LTSD 1K83B 1CA6A 5FR3A 3P4SB 4KKTA 5ELCA 3N9YC 1CM9A 2IT1A 3AU7A 3NE5B 4NDXA 3HOYB 3KBGA 1TYGB 3J7AF 1QB5D 3A8IE 2K5DA 2WS3B 1CQVA 1K52A 2KEEA 1VCIA 1Z47A 1YQ3B 2KACA 1T5EA 1X3PA 1I7HA 3S9WA 3M7GA 4DAYA 4GDLB 4ZRPA 3CIRB 2WQYB 1RTNA 3S17B 3EVQA 5LHY1 1WWTA 1YNNC 1ZP0B 1JICA 2CW0D 5CORA 2XRQD 1IYUA 4N9PA 4Q0FA 1SNQA 3NVYA 2JXTA 3A54A 4I7ZC 1FRRA 4EGVA 2K5QA 3NVZA 2JSVX 4C3JG 1J7BA 4ARCA 2B2YA 4KHZA 1TKEA 4KD3A 1BCPB 2L1AA 2Y3AA 4M0WA 2KOLA 3VYRA 4B0EA 5E3FA 1H9SA 3HZXA 5CV4A 1EZ8A 4JX1C 1SE3A 4K8IA 2MEKA 3D6CA 1S5FD 4FYDA 1G91A 3QG1A 2WLBA 1II3A 1WXQA 5HFYA 1KH0A 1ILQA 4A6QA 1BR9A 2SEBD 2PTLA 3FAHA 2N55A 3H8HA 2RDFA 1GHKA 3P1HA 1ONLA 1PFBA 2NN6G 3J81E 5FO7B 4HCSA 1F2LA 3ZQ4A 4XDCA 5IT9L 4CGYB 5CV7A 1AWDA 4WFN3 3S15B 4ZQ3A 3SFEB 3IFDA 3R2TA 2WINB 2W3SA 5JEAG 4LAAA 4RAUC 5E4XA 2O5JC 3HOWB 2PQEA 3TSSA 1PRTC 1JWAD 2W54A 4DU9A 2D9UA 4ZAIA 4GDKB 1TZOA 2WNMA 1V8CA 4IZ8A 5J39A 1L4ZB 1JQ4A 4NKLA 2NVXB 1FNWA 4ARIA 1ZYRC 2N7JA 2NN6H 4CJ0B 2A74C 4HAEA 1TWGB 2PLPA 1CZPA 2BYTA 5IODA 2MHVA 1ESFA 1YNJD 4DXGA 5JEAH 2ICIA 4IUNA 4DF7A 1KNEA 4WQMA 3NVVA 5C5MA 3AE4B 1TVXA 4YT0B 1I4PA 2EVBA 4C7ZA 2K33A 2W55A 1D5ZC 2CVRA 1VZ7A 2SDFA 3GTOB 4P6VF 4A55A 4IFDI 1RCVD 1JE4A 4H0LC 1B9NA 1SE2A 4X3SA 5C2TB 1HFNA 1BCPC 1STHA 4F8MA 3IFTA 5FK9C 1YNND 5T8IA 4CKBA 1QLBB 3J9CA 3Q8AA 2AUKA 5C4ZA 4M8AA 2NYZD 3Q69A 1JWBD 1QOBA 4YIJA 4ZOHC 2WXNA 3HS0C 5E4WC 4KGSA 3NTIA 1STAA 3DWAA 3EROA 2DN8A 4L1BA 4TSSA 1VJKA 4RA8A 2KCNA 1E6EB 1AEXA 1XLOA 3GD7A 1DOMA 4RKLA 4QCLA 3W1SA 1LTTD 1BMLC 1LABA 1AZQA 3GTJB 1R9TB 3WCQA 3P20A 2HDLA 1HRJA 1IBXA 3NHHA 2FMMA 2K05A 2QMTA 2KWDA 4J8QA 3BVMA 3TMEA 3U4EG 1G2TA 2L83A 3J80L 1JRPA 2CJNA 4XYQA 3OW7A 1RD9D 1Y1WB 2J52A 4MN3A 2PO4A 4ZLTF 1TS4A 4BBRB 3KWLA 3ND8A 3W2DA 1CZWA 5I4DA 3V05A 1PGBA 2JP1A 2JA6B 3AB9A 1HTPA 2E3TA 2LUMA 3U52E 1PRTD 1XWEA 3FVQA 5T1GA 1EU4A 1EQTA 1PFDA 1TIID 2LS01 4A3MB 1NSNS 1O7ZA 2V4DA 4IQZA 4Y7NB 1O80A 4XIGS 2EYFA 4NAMA 4C3IB 1WVLA 1GUNA 1RDPD 4RFBA 5D7GA 1JWSD 2FBWB 1HUMA 4WWMA 1Y56A 3HGBA 2A68C 1A6XA 1H9KA 3PUWA 1ET9A 3KLSX 2OXPA 5M3MB 3F2UA 3AE7B 1GUTA 4LMQD 1WTVA 1TWCB 2NWGA 3AB5A 1NR2A 4X3KA 3FEWX 1R4QB 1A3TA 3HVZA 3A55A 1EFID 1PDXA 2F0HA 2BTEA 1QWYA 4B08A 2E75C 3SE0A 3ITPA 2IGHA 2K28A 3FPUB 3TP5A 1NR4A 4LJZC 4U673 4FF3A 4J3OD 1QJOA 1BCPD 2QCPX 3P75A 1FCCC 4ZRZA 1SB3C 5C0XG 3TP7A 5I9PA 1EWCA 4G7HC 3GTKB 2B2VC 3DWMA 1KF6B 4OZBA 3RPFC 5BN5A 2NN6I 1QOFA 4XDDA 1X3QA 2H4OA 3PUZA 2QJLA 1KRHA 5CBAE 3PUXA 4PNYA 5H8YE 1WTQA 1U4MA 1BBXC 1NUCA 3S2HB 1YN5A 1VLBA 2WXIA 4N59A 5C0XH 4K6DA 2B2UC 4ZYSA 4KKSA 2F0SA 3VRAB 1RKNA 1VDVA 2WXRA 2E2IB 3VR3A 2BB6A 3HG9A 5KGUA 4DFAA 1PZID 3B2GA 1CHPD 3DMUA 5G3LF 1U4PA 1EWYC 1RF2D 3Q24A 2A6EC 5EE3A 4FXDA 2XIWA 3VR2A 1NCVA 4QUCA 5C3JB 1TKGA 3FMCA 4C3IG 3FILB 3CKIB 1MSGA 2N0SB 2LGIA 2N9KA 3I4LA 1QKZA 3SR1A 3Q22A 4KJOA 2L55A 2VZKD 2N9LA 5ELDA 4K2LA 2RDGA 2WXLA 2F0WA 5IOCA 2CU3A 3AE9B 5AUIA 1Y8OB 4GZYC 1Z6HA 3EGRA 1HPCA 3FPPA 5EPLA 3KUPA 4XXEA 2WDQB 4K8JA 1E7PB 1EY6A 1WTOA 1VF7A 1KAAA 5ELBA 4XQJA 3RLFA 4A90A 1K53A 1MGSA 2FJ2A 2WXJA 2JWUA 1DGJA 4KY7A 3HOZB 1G291 3TEWA 3MEHA 3CRLC 1PTOF 2LEKA 4FP5D 1PFNA 3BK1A 5EPKA 4O1NA 4H13C 5I6WA 2IDYA 4KN7C 1SYEA 4LK0M 3KLSA 1GAQB 2BA0A 4OVZA 2B2WC 3ONAB 1IGCA 4YXDB 1S5DD 4R3DA 2KVMA 4EQOA 4ZRQA 3MTSA 5JPMC 5G5GA 1EU3A 3Q8BA 3D4DA 1WTPA 2I38A 2X69A 1Y8NB 3JAME 2AWOA 4OHJA 4NZLB 2PKOA 3GS2A 5M5XB 2FINB 2L12A 2L5TA 2WV6D 3A8JE 3ZYYX 3SXHA 5CYUA 1J7AA 3LXFA 2Y5CA 3D6WA 3U2SC 4C80A 5CV8A 1XLNA 4MT5A 1DONA 2A5HA 1FMAD 1DOIA 2WKCA 5EQ0A 1RJTA 4M1UB 5JVG3 1N61A 4OO1G 5C3XA 1DXMA 5EBCA 2EYPA 4K5XA 2MUYA 4Q2JA 2WAQB 1UWXA 3W5UB 4DXFA 1QOGA 2R6GA 1FXIA 3TZDA 3ZGZA 3H6MA 4NJCA 1FGBD 2D62A 2EZVA 4FF1A 2JYTA 1RHPA 4RHSA 2HDEA 1HZ6A 2KDMA 1GUSA 3LB8C 4HRSA 2K01A 1ZXHA 2A6ED 3D4RA 5I9OA 2LMCB 1B9RA 2J0TD 2V0GA 2OEOA 2E2JB 4QIWB 3MHZA 2HDMA 1Q1EA 3AN1A 1N60A 5CV5A 3Q0AA 3GB1A 3U7ZA 5EE0A 3P63A 5EGTA 4OO1H 3ERQA 2BS3B 1KABA 1AW7A 1PZKD 2QKIC 3TDQA 2WXQA 1HCZA 4GLSC 1ENAA 1G6ZA 3RZOB 2W3RA 2D5GA 1CJEA 3AE6B 3PUYA 3PIO3 3H09A 4TMAB 1ZPSA 3P4PB 4FO2A 2TSSA 1M8AA 1TR5A 5FOBB 5C4JB 2IX0A 4AQ7A 4G57A 2WIIB 2B2VA 1IUEA 4EE2A 2F0EA 5C0XI 4D2KA 5CR3A 1ZXIA 2F0FA 3KF8A 3U9SA 3EFXD 1LTRD 2PYKA 3W3AA 4QMGA 1D6EC 1ZKOA 3WOFA 1D1IA 2WP9B 4HKZE 1Z7TA 4A3EB 1Q3LA 1ZXTA 1YJJA 1OXTA 2R92B 1U4LA 1SYGA 1F2RI 5FKAC 1B1ZA 5DM63 3I9V1 1Q10A 2JXMB 3DWPA 5HI1A 2IGDA 1K50A 2F0MA 3Q6SA 2B8GA 1E9MA 1GXDC 3QWNA 2R3ZA 3H94A 2EY5A 1ZDXA 2KHSA 1A2TA 4K2KA 3X3MA 2YEPF 2ZXPA 3GTPB 1HEZE 4V0BA 5KNDA 2X6LA 2JA5B 4ZKBB 1SF0A 4QUFA 1DOKA 4EQPA 5C4XB 4IUPA 3BIID 3D3RA 4XTCS 3QJYA 3DEPA 1W6KA 1FEHA 3IAYA 2FFKB 3IL8A 2M56B 4HCEA 3LNNA 1F9QA 2NVYB 3K0YA 1PTOH 4DN4M 5KNCA 5C0XJ 4DK0A 1KFYB 3I4NB 2LHEA 4XE0A 4BBSB 1V1PA 1NI3A 3NTHA 5AUKA 2B76B 5MPOA 2B2TC 4RCOA 5IGBA 4L23A 5C4HA 1T3QA 2NMQA 2D2CC 3K5MA 2F03A 3NQIA 2M0AA 2YEPB 2EY1A 2Y5PA 1XEEA 3J80E 5DAUA 1ICWA 5FLXL 2L32A 3HP3A 1A3VA 5CMDA 4J1MA 2J4XA 1FYCA 2PMZB 1A70A 4XWWA 1FXAA 1Q8IA 2WXKA 3HUIA 3OOCA 3E5SA 3NWTA 1JWUD 2B2WA 1HQRD 1PMRA 1FIQA 3RMHA 1EY0A 5G5HA 1C8CA 2EY6A 3PIP3 2BBCA 3BVZA 3CRKC 4ODGA 1EYDA 3IT6B 3C1EA 2F0LA 2CJOA 1S4ZA 4FXGC 4UDUC 3CQZB 3BZDB 3K57A 2VXWA 2FE8A 1VF5C 4A93B 5J22A 2RA4A 3SK4A 1QOHA 3WOEA 1FD6A 1ESRA 4PMCA 2A6HC 3VQIA 5K5PA 3EA6A 1L0VB 1LTBD 3AEFB 1JOQA 4NW2A 4TQ0A 4OO1I 4TQ1A 2SOBA 3C2PA 4U68A 2F0IA 4X3UA 1F77A 4F7XA 5M3FB 3K5NA 2NZ1D 3OPOA 4HJGE 1R7SA 3FILA 5C3EB 3NP8A 1F9RA 3BDCA 2CHBD 1RTOA 5FO9B 2ENBA 2LFIA 1ZE3D 2B8FA 4XT1B 1STYA 2BOSA 2K6AA 1MHHE 3VR9B 5IGGA 5LNK1 1KNAA 2IJ0A 3MVVA 3OMGA 2ONQA 1ENCA 3NUCA 4XT3B 3TEZA 2PW9A 2ICEC 4XQNA 3IKJA 3E6ZX 4BWGB 3ZJVA 5H92C 4KGTA 2KEDA 1IKMA 3I3CA 1TS5A 1SNCA 2B63B 1SNMA 2EELA 3TZUA 1HUNA 2K5PA 2L52A 3S16B 4DAPA 2WDRB 5AFWA 1C4CA 1P7FA 2C5CA 3V2TA 2BS4B 2L0CA 2QDBA 3SDZA 1ET6A 4A3DB 3MXUA 3BS1A 4L8JA 1PLFA 1IKLA 2IL8A 1TKWB 1JOKA 1VRAB 2K03A 3L7ZC 1FNUA 3MWYW 1TKYA 3AH7A 3TUOA 2WXHA 1XX8A 3AECB 3W9CB 1T5XD 3HVDA 4A3JB 2RQXA 3N6RA 3NPPA 2R93B 2RKSA 1I3QB 4ZHPA 1IGDA 2KA7A 1JR0D 5C5LA 2RVLA 3G7LA 3MFGA 3K6OA 4A3BB 1JORA 3OIPA 2F0JA 3I4MB 1EIHA 1I6HB 2LFNA 3W5VB 3AV8A 1OQRA 3RFZB 1KLUD 1D5MC 1ZOYB 5CBEE 2RBMA 1VMCA 4E6IA 1C48A 3J81L 3Q8FA 1B50A 4LLGM 5KRUA 1V8QA 1L4DB 2L9HA 1FO4A 5JAVA 2PW7A 3R2IA 2A6HD 1SAPA 2BDNA 3I57A 1TY0A 3L9AX 2LMCA 3OWFA 4CKCA 4A3IB 3J7AV 3AEDB 4HKQA 1HQMC 4S3SA 1QT9A 2MH7A 1XXGA 4BA1I 5M5WB 1E0ZA 1QQRA 1ROEA 4A9AA 4KV6A 5D65A 1QNKA 1MI0A 2BW2A 1YN3A 3GO5A 1SXTA 2B2TA 1SNPA 4H44C 2E6XA 3NXWA 1AZPA 1QOAA 2DNEA 4HN7A 2JE6I 4RKBA 3BDLA 4QB4A 2EDGA 3MAQA 4IUTA 3N52A 3LWUA 2EPBA 3MJ5A 3D4WA 2ACZB 1H9SB 2ON8A 4ZKCB 4RGTA 4ZHOA 2EYMA 4PMBA 3BWUD 3PZ8A 1V43A 1GB4A 4MHEA 3NS1A 2K9XA 1F0ZA 3DWGC 1PGXA 2K7VA 3OHXC 2FMCA 2PPBC 5BMHA 4AYBB 3GP7A 1E2WA 1JW9D 5KYIA 4FNFA 1LT4D 4IOIE 1F2MA 1FCLA 3U9OA 4FXKC 1KDCA 1CHQD 2AUJD 3S1RB 1JMLA 1WYGA 2A73B 2YYZA 4ZK9B 1D4BA 4Z9CB 2JEBI 1F2RC 5KYLA 2XWJB 2C9OA 4USAA 3TP8A 3URYA 3K59A 4IUQA 3MHBA 3TN2A 1HZ5A 5IGCA 3A7AB 4J6HA 5A2QE 4KKIA 4CQNA 1STBA 5E1FA 3HRZC 2JX5A 3FKIB 2Q5WD 3I70A 2G9HD 2RPVA 3VRBB 5EKLA 1EY9A 2E74C 2GRIA 4DA2A 2NUCA 2ZT9C 2XVSA 4HSVA 3TP6A 2F0PA 2V3NA 3AMZA 4PMWA 1C4PA 1SYDA 3A7LA 3M3YB 4KX6B 2GA4B 2FUG1 2O4XA 2L11A 1O7LA 3D8GA 5D3DA 1VDZA 2F0VA 5HURA 1D5XC 1TQOA 1J7CA 3GTGB 5IGEA 2KN4A 2EYHA 1HFGA 1G2SA 1OXUA 1RFKA 3GQBA 2W82A 1EEFD 2VB3X 1I4HA 1GOZA 2G1EA 5IGDA 3SVMA 1SNDA 1TJEA 1DJRD 3SEBA 2EYLA 1GB1A 2WU2B 4OW0A 3AE5B 5DEHA 1E0BA 4X3TA 3QOLA 1I4XA 3GTLB 3HRDD 4LTUA 5BYRA 2AQ2B 3AE2B 3FRPB 4NP5A 1B9MA 5IIFA 5I2XA 1A2UA 3T51B 4F87A 2IX1A 1A3UA 1NYRA 2DWQA 2Q8RE 4RF1A 4PQXA 3VA5A 2Z4IA 1ZUD2 1C9FA 1WD0A 1PDQA 4YTMB 2HCCA 3BYTB 2WXGA 3P7JA 1FR3A 1D2BA 2B39A 4CKEA 3KLRA 4F88A 4RGOS 1IBXB 3E0JA 3GTMB 3X3NA 4N6EB 1EYCA 4DAVA 2OHFA 3CWIA 1SBBB 1HA5A 2GB1A 1A15A 3RD4A 4KMUC 1C4AA 2WXMA 1PTOB 1FFVA 1KTKA 2PIAA 1PXUA 4WURA 2M00A 1SDFA 1VR9A 1K51A 4P16A 1LTID 2JEAI 3K7AB 1LT3D 1DZ1A 1EYAA 4BY7B 3CU7A 3T16A 2ID0A 3I8ZA 1E10A 4G7OC 1FM0D 4ZUIA 3I73A 1PUTA 3IAS1 2QEJC 1ZDVA 1IL8A 2MPMA 2WP8J 2VB2X 1BNZA 1EIGA 2KJXA 3SK5A 1V97A 4YTPB 4RGNA 1YMHE 4IUUA 2QILA 2LKVA 1CI3M 4YWGG 2L1BA 3PZ7A 1H9RA 1GHJA 1N62A 4ID6A 1NVID 2EE1A 4DNTB 2R7ZB 4IKGA 4RH6A 1LACA 3UI3A 5IT9E 3S2DB 1D1KA 1UAPA 1BDOA 2SAKA 1QE6A 1YJIA 3MA2B 3T3NA 2HTME 4B9WA 2WKDA 2WXOA 1KDAA 1YN4A 1BXTA 1GJXA 1J8IA 5ISRA 2IPKD 1WTXA 2XWBB 1SIJA 2EKIA 2F0OA 2V3PA 3C1FA 1RM6C 1K8MA 2BE5C 3KQ4A 5M9OA 1PRTF 1XF5L 1OO9B 3P1MA 1L0XB 1F2YA 1EY4A 1EY8A 1B53A 1N5WA 1V1OA 1DM0B 4C2MB 3BYYB 3VR5A 4C56C 4RHRA 5CV9A 1I6VC 2PMVA 1F9SA 3PO3B 4YSZB 1DOXA 3AE1B 4WAFA 1T6BX 3AE8B 3QB3A 2B2UA 3AEEB 2XRSD 4HR7B 1R4PB 4RF0A 3SFDB 1PTOC 4WRDA 4DQOC 1AFPA 4WIPA 1SNOA 3L3OC 1VZ8A 4A3FB 1ACCA 3C46A 1QCBD 2G9DA 2JSOA 1HA6A 4EQNA 4YTNB 2BT6A 3C3LA 2XN9C 1EEID 1SEBD 2WB1B 1BQQT 1H9MA 1DOYA 2RMMA 1BCPF 2F0NA 3UI2A 1BOSA 2JU6X 4R9WA 4NAWB 1EWHA 1C78A 5BYQA 4DK1A 3DWQA 5CV6A 5NUCA