1D5XC

X-ray crystal structure of hla-dr4 complexed with dipeptide mimetic and seb
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
237
structure length
223
Chain Sequence
SQPDPKPDELHKSSKFTGLMENMKVLYDDNHVSAINVKSIDQFLYFDLIYSIKDTKLGNYDNVRVEFKNKDLADKYKDKYVDVFGANYYYQCYFSKTCMYGGVTEHNGNQLDKYRSITVRVFEDGKNLLSFDVQTNKKKVTAQELDYLTRHYLVKNKKLYEFNNSPYETGYIKFIENENSFWYDMMPAPGDKFDQSKYLMMYNDNKMVDSKDVKIEVYLTTKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Peptide and peptide mimetic inhibitors of antigen presentation by HLA-DR class II MHC molecules. Design, structure-activity relationships, and X-ray crystal structures.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/peptide inhibitor
molecule keywords HLA CLASS II HISTOCOMPATIBILITY ANTIGEN
total genus 53
structure length 223
sequence length 237
ec nomenclature
pdb deposition date 1999-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
C PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1d5xC01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1d5xC02
2J4XA 2Z8LA 1EEFD 2AQ2B 1FNUA 1BCPF 4TSSA 3BVMA 1LTRD 3BVGA 4RH6A 1PRTC 2CHBD 4UDUC 1KLGD 1LTID 1PYWD 4RGOS 2NTSA 3O13A 5TSSA 1SJHD 3MFGA 4L6TB 5ELDA 4OHJA 4RGTA 1PRTF 1EFID 1FNWA 1PZKD 5ELFA 4ZYSA 3BYYB 1JQYD 4RGNA 1JWUD 2O2LD 4L63B 5D3IB 1G8ZD 1RCVD 1LT3D 1SJED 1HXYD 4RCOA 3KLSX 1STEA 1DYQA 1B1ZA 3GP7A 2G9HD 1FGBD 4RHRA 3BYTB 1S5CD 1S5DD 4BWGB 5ELBA 5FKAC 1LTBD 1TY0A 4DXFA 3URYA 4C56C 3DWQA 1ET9A 1F77A 1CHPD 1LTTD 2XNAC 2AQ3B 4NZLB 1LO5D 1PZID 1EU4A 1FD7D 3R2TA 1CK1A 1D5XC 3TSSA 1PRTD 5ELEA 1HQRD 1PZJD 1D5MC 1HA5A 1FNVA 1V1OA 5ELCA 1LT5D 2QILA 2IJ0A 1I4HA 1S5BD 3DWPA 1SBBB 1SE3A 1XXGA 1PTOF 1AN8A 5FK9C 1PTOH 1HTLD 1I4GA 2TSSA 4O1NA 3W2DA 1JCKB 1LTGD 1RDPD 1SE4A 1ENFA 1AW7A 4K6LA 2ICIA 1B44D 3EA6A 1CT1D 2QEJC 1YN5A 1JR0D 1KTKA 1PRTB 1I4PA 1LT6D 1I4RA 2WV6D 1TS2A 5I4DA 1YN4A 1TS4A 1PTOD 3V05A 2NTTA 1JWMD 1QILA 1RF2D 1SXTA 2XN9C 3MC0B 3OWEB 2IPKD 2RDHA 1CHQD 1LLRD 3CHBD 1L0YB 1TY2A 2AQ1B 1GOZA 1L0XB 1CQVA 1S5ED 2XRQD 4RHSA 1ESFA 4Z9CB 3R2IA 1KLUD 1V1PB 3DWAA 2XRSD 1V1PA 1EEID 1BCPC 1M4VA 1BCPB 1D6EC 1DJRD 1BCPD 3SEBA 1D5ZC 2RDGA 1UNSA 1UUPA 4RGMA 1SEBD 1BXTA 5D3DA 2R61A 1I4XA 3BVZA 1YN3A 1PTOB 1LTAD 1LTSD 3BZDB 1RD9D 1T5XD 1PTOC 1TS3A 1TS5A 1LT4D 1EWCA 1ET6A 1I4QA 1MD2D 4RFBA 1EU3A 1JWSD 4DXGA 2SEBD 3R8BA 1SE2A 1XTCD 1S5FD 3EFXD
chains in the Genus database with same CATH superfamily
3FHWA 3HHMA 3CCUA 2WU2B 1PH9A 2Z6BA 1XPRA 3HK0A 1D1KA 3DBLI 3PLVA 3TS0A 1LTID 2KLCA 3EHVA 2OJWA 4IWPA 1WCMG 3S1QH 2WXOA 3S1RB 4BBSB 1OEYA 1D3ZA 1K0RA 3OPOA 1AP0A 2J7QB 3NZSA 4KY5A 4FXKC 4DR5Q 5M3FG 2SAKA 4BOSC 1L1OB 3AE9B 2PYKA 2KT7A 3S1MH 4A3FB 4XIGS 3F8TA 1ILPA 3Q69A 1EY9A 5IP7G 1JQYD 1E8ZA 2KX3A 4A4IA 4FYDA 2JQRB 3NVYA 3V61A 4A3BB 1LT3D 1X3FA 4GN4B 3AN1A 5BN3A 1FFVA 3H7PB 3CRKC 1QF6A 4KIKA 3EUB2 1VQPA 3U9OA 2N55A 4BWGB 1VF7A 4ANWA 2AEHA 3HG9A 1MSGA 1MG8A 2WB1B 1IPGA 4DXFA 1VQOA 2MCNB 2CU1A 4XDCA 4X57B 4FXGC 1NEKB 4JI3Q 1F2RI 3PGEA 2UU9Q 4PYUA 1T5EA 2FHTA 2INPE 2D5GA 2O2VA 3C0RB 5CHVC 1WR1A 1PFMA 1QG7A 2V0GA 4NQLB 1JJCB 1V8CA 3AEGB 4CJ2C 2RHSB 4JI4L 1JJGA 3IXSA 2BB5A 3FKIB 2PMZB 3RNBC 4YIJA 1HH2P 3QK0A 4HCSA 4E6IA 3UINB 1LT5D 1U5KA 3I57A 2A69D 1A15A 1SBBB 4GKJL 4PS8A 4NQKE 2I0QA 3KQ4A 4R4QA 4OWXB 3PHWB 3FILB 1KDAA 2PQAA 3LX0A 5GAEC 1Z5SB 4YY3Q 1FXAA 2I38A 3DMUA 4O1NA 3VH3B 3T13A 3PUWA 2Z0DB 3RLOA 2B8GA 3RI7C 3PGZA 4MM3B 5JJKA 4LAAA 4RKLA 3N3KB 4HJ8A 3AEVA 4G0NB 2MA9B 4N59A 2F0TA 2EKEC 4JBJA 1OGWA 3CMAA 1SB3C 3TIXA 1B9MA 4IW0A 4CDDC 2F0LA 3ZJTA 4LF6L 1KTKA 2INNE 3NTHA 1LT6D 2IY1B 2L9HA 4IWOA 4WJOA 1PTOD 2F0WA 2NTTA 1KNAA 1QILA 3BJUA 3ZVVA 5FOBB 1RODA 3ML8A 3UE1A 1CHQD 3OHXC 1B50A 2B3GA 1TY2A 3MHBA 1YHAA 2FCMA 1CQVA 5LMNQ 2LXAA 4JX1C 3DBLB 4UAIA 3NELA 1E8XA 2ZW1A 4TUUA 3VRAB 2KHJA 3S16H 2FCQA 1TIFA 2HUGA 1VDVA 2LVQA 3K81C 4R3DA 5C3EH 3QQ8B 5IN7A 3T56B 4DR6Q 2Y5BB 1OXXK 4DKAC 4RCNA 3BVZA 4QL5A 3H6NA 1GKHA 5C3EG 1LTAD 1EY8A 2V4DA 2CVRA 2WX0A 2QHOA 4FBJB 2PZTA 2L4NA 3F2UA 1EWCA 1TWFH 2RF4A 4DFAA 3M4OH 5HGQA 2SNSA 1F9QA 5JPNC 3GTQB 3A1QA 1SE2A 3C8YA 4DV5Q 5COYA 1RFKA 4JBWA 3CMMB 5HKHA 4DV6Q 1EEFD 2RMMA 2AQ2B 2HD5B 1FNUA 4TVAB 2E2IB 1VLBA 4DHZB 2BKFA 1WJUA 2E75C 4XGAB 1OQYA 1HZ5A 3VYUA 1W2BA 2H5XA 4IURA 4BBRG 2KTFA 2MJDA 4EEWA 4ZDVA 4KJNA 3IRBA 1VQAA 2D3CA 2M19A 1XX8A 3OTOQ 4PMWA 1WGKA 4K6DA 2JRHA 2HQEA 2JZ3B 4DR5L 1EUVB 4B0EA 4YTMB 2JA6B 4XQNA 2LFNA 1BVSA 2VQFL 4IPHA 4R1JA 4AS1A 3RLNA 5DM73 1XNQL 4MEMA 4NJCA 1H9SB 3E5SA 4NDXA 2J0KA 3M3YH 1KHIA 2VL6A 2C9OA 1WGHA 3KLSX 5CC4A 3P4RB 2A5HA 2K28A 2K50A 2NYZD 3CC4A 4HJAA 3P42A 2FUG1 4F8MA 3NS8A 5CV7A 1U0LA 1FVIA 2KQ4X 3QX1A 1VS0A 2K1FA 4X3KA 4MJSA 2XBBC 2HDMA 2I2YA 5CX3A 4DHZE 1DOMA 3VR4A 2B76B 3ULJA 3W9CB 2XEWA 2Z4IA 4H2AA 5CTRC 1DD2A 4JBKA 2M2LA 5CBEE 4LNKA 2IO2B 2MP2A 3D31A 3M7GA 1HA5A 1WTOA 2LWPA 2NS5A 5ELCA 4BY7H 5AUKA 3AYHB 2O6VB 4PZ8A 4D2KA 1SE3A 2NPTB 3Q24A 5DAUA 4DR2Q 2SDFA 2KNBA 3BZKA 1DXMA 4HIOA 1GB1A 3TJPA 5FK9C 1YNJD 4FA6A 3AB9A 4JW0A 1JMCA 3E9IA 3HOYH 3ZO5B 3K5NA 2YU9H 2LS01 1MFWA 2QDFA 4UP7A 5BR8Q 1YJNA 3A9JB 1K8AC 5BMIA 1V5OA 4HMIA 3I3CA 4KGRA 1J6QA 2F3IA 4C00A 1JE5A 4KTAA 1QCBD 4BY1H 3M4OB 4FXDA 1WJNA 1TS2A 3G7LA 1T0RC 1WSPA 5FR6A 2D62A 4ICVA 2K1BA 5C1ZA 1MHWC 2N88A 5F2DA 4BBRB 1VQIA 1GOZA 2B8FA 2VH2A 1F0ZA 3D6WA 2V3NA 4LF9Q 2LHEA 3PSEB 4J6IA 3DWAA 4WAFA 5H1SE 2LMCB 3PRMB 4F88A 4AOFA 1BCPB 3UE0A 4DDGD 1E0ZA 3S1NB 1E7PB 4B9XA 3N1YC 1R4MI 2ZJDA 4IM3A 2D0OA 3HP3A 4HSVA 4ALPA 1VD2A 2OOBB 4F8CB 3BZDB 3DBHI 4NPNA 3RNAC 1ZEQX 2KDIA 2SNMA 1NAPA 4DV5L 1HTOA 2KWDA 4IUQA 1ZDXA 3HRDD 3D0FA 3RZOH 3U52E 1IGDA 4FLHA 1STNA 3J9CA 4KKIA 2W9NA 4ULLA 4JLCA 5EKKA 1PV4A 1I3QH 1I6VC 3FKIG 1SAPA 3PO3B 3HKSA 2CHBD 2PPBC 3A1QB 4P75A 4B3TL 3O13A 1K50A 2BYEA 2LRUA 1ICWA 1RIPA 1WRDB 4NXML 4CYEA 1RJTA 4JI0L 1VQDA 2ON8A 4G3XB 4HROA 1OO9B 4MJSB 5BYSA 5IIFA 1EQQA 4KN4C 1YNNC 4RGTA 1VQ8A 2WB1G 2HJ1A 5ELFA 2LKVA 3A55A 4H0LC 3T51B 3DWMA 1Y8OB 3HZXA 4BY7B 5KEEA 1S40A 4GN3B 1ACCA 1CMXB 3TP8A 1SJED 1PDQA 2EJGC 2V1CC 1K3RA 1R9TH 3IKJA 1STEA 3RR5A 5IYCG 2BWFA 2NCNA 2WDRB 5J3BA 2E5LL 3PS6A 3Q6BA 4P7IA 1CUKA 2Z6KC 5ELBA 5AFWA 4L5RC 3KBXA 1PH7A 4JWSC 3NZUA 4G7OC 4LFBQ 5M3FB 2B2TC 2KVZA 3E0JA 5EPKA 3GTOB 1ET9A 1EZ8A 2GBRA 2ZCBA 4HTHA 2A69C 1MJCA 3AU5A 3N1ZC 2K25A 4GZYC 1Q8KA 4K2LA 2H88B 1K51A 4KVGB 1TWHB 1VQBA 2PW9A 3W5UB 1IYUA 1XWEA 3P2BA 1FR3A 1EY0A 3WALA 2OTJA 4GDKA 1JT8A 1ZYRD 4BS9A 1OXVA 4N8FA 1BO0A 4GLAC 4MHEA 1B8AA 3PUZA 4DF7A 2V1YA 3HIZA 2ZXRA 1VCIA 4ME3A 1P8LA 2NN6G 1SROA 1ICFB 1B3AA 2WP9B 4IZ8A 1B9NA 4MZ9A 2KN5A 3SFEB 5JEAJ 2WV6D 1TZ1A 4Q2JA 4A3DH 1WCMB 5LL6X 1GC7A 2IX0A 4E71A 1JWMD 1UH6A 1QQRA 4V0BA 2K75A 3CKIB 3KYHC 4I6PA 4DV2L 2B63H 1CA6A 4QIWB 2UU9L 5CYUA 1DOXA 2EJMA 1LV9A 3J81j 2JSOA 4LF5L 3ZNZB 3A8JE 4YCUA 1FM0D 2IGHA 4A93B 1WD0A 2L76A 1V8QA 1PFSA 5ISRA 1E0BA 2E5LQ 3R7QA 1FXIA 4DNIA 3VYRA 1D5ZC 4ZK9B 1RM6C 4OGQC 2A6HC 2G4SA 1UUPA 1N5XA 3ULLA 1N63A 1MKHA 1WTRA 3K7AH 3DHIC 1KRTA 1DGJA 1Q90A 4GKJQ 3VQIA 2DY8A 3KOJA 2XVSA 4KD4A 2LGXA 3ICEA 4IUNA 2KHWB 1EIFA 4A75A 3NY5A 2FMMA 1J5EQ 1SYDA 1Y8NB 4C3HH 2CU3A 2DGYA 3NTKA 4KY6A 4P72A 4ODGA 2J4XA 4RGOS 2L3ZA 1T9HA 2KFKA 3VUXA 4XYCA 3ZXVA 4M8AA 5FLMG 5BYQA 2KMAA 3QOJA 4RF0A 4TRDA 1WGRA 3PZ7A 2KFJA 2WXQA 3B0AA 3JC66 2KHIA 3GTOH 4TQ0A 1UGJA 3WANA 1C4QA 3AULA 2JRIB 2MGSA 3AFPA 2I5HA 4QMGA 3TP7A 3RD2A 5EE0A 3QG1A 4JK1C 4P74A 1E8YA 1RRBA 1RTNA 4ZHPA 1TWHH 4PT5A 1WJ4A 3U4ZA 1JWUD 3QC8B 3HOZG 3SR6A 4C3IB 1LM8B 1V49A 2L15A 2B2UA 1X3QA 1B1ZA 3AE2B 3DVGY 3NEMA 4RHRA 1WH3A 2PNRC 1S5DD 1P98A 1M90C 2MO1A 2RQXA 3H91A 1WGDA 3IG3A 2DN8A 1PDXA 2KCNA 4XWWA 3U8ZA 4Q0FA 4KV2A 4YSXB 1Q3LA 1STBA 4PYZA 3SHQA 4W9EA 2PTLA 1G91A 3TBIB 4XZ4A 1YVCA 2EYLA 3P1HA 2BF8B 2CS4A 2OHFA 3W5VB 1V9PA 3R7RA 1F2ZA 3J80c 1WD1A 3IBEA 3A4SC 1XMQQ 3TEYA 1S4ZA 3VA7A 4RMFA 2B63B 1J9OA 3C46A 2RCFA 1IL8A 2WACA 2RSNA 3T1HQ 3KBGA 2DAJA 1QNUA 4LF4L 5IE8A 2DZJA 2KJHB 1LM0A 1C3TA 2RKSA 3SK4A 3E0EA 4MELA 2MPMA 3AEFB 4L23A 4XTCS 2PO4A 5D6JB 2LGSA 3NQTA 1QVGA 3O65B 3NENA 1PGBA 3IAS1 4DHJB 2EY6A 4DBGA 2NVTH 2DNCA 5IO9A 3CQZH 1LGRA 1JR0D 5AEKB 1F9JA 2L5TA 4X66L 5EGTA 2ENBA 2OEOA 1I4PA 2BCOA 2JE6I 1YN4A 4CJ1B 1ZYRC 1IKLA 4HIDA 1T0SC 3ZW3A 3E9HA 1VQ4A 1HZ9A 2MBHA 3MC0B 3AQQA 1L0XB 4RHSA 2WKDA 1ESRA 3A7AB 2GB1A 5LXIB 4IG7B 4ZRKA 4HR7B 4KJOA 1TIID 3VTUA 1SFOB 4ZCKA 2CWPA 2ZVOA 1IBXA 3ZJVA 3OJ3A 1BCPC 4LJZC 1NR2A 2F0QA 2QF7A 1U4AA 3D3RA 5FO7B 2IHEA 4DAPA 3K0YA 1EY4A 5IWAQ 1EFWA 1EO6A 2PEAA 3RNFC 2HHHQ 1WFQA 4PMBA 3SD5A 1X3PA 3HOVH 3S14B 4A3LH 2ES2A 1RTOA 1UEBA 2PE6B 4F1SA 2WQYB 3R8BA 4GN5A 4C3IH 4LF7L 2F0JA 1SYFA 4W9JA 2JK8A 3RZDB 1BOSA 2QIEB 1ENCA 3BVMA 1L6VA 4RH6A 3T8MA 3DHGC 4FF3A 2QJLA 2ZW0A 3SHLA 1UF0A 3MJ5A 3DPDA 4A3KB 4K81A 2GBMA 3PCOB 2KEDA 4HXDA 2E2HH 1EOTA 1VQHA 4K1RB 3TZDA 2QC8A 1SMYD 3S24A 3SK8A 2EYJA 2EJFC 2K6DB 2MX2A 4B0MA 2E6XA 5K5PA 2A1AA 3HOZB 1E10A 1PFBA 4R4TA 1NE3A 1XTDA 1BT0A 2V4IB 1A8VA 4N9TA 2QDLA 1G8ZD 3N9YC 1STAA 4Y7NH 2B29A 1YI2A 3S2HB 2XK5A 3B9JA 4YSYB 1E2ZA 2O4XA 3PO2G 1H9MA 3I8ZA 2G9HD 4HPPA 3QO2A 4C2MH 2IL8A 2N9KA 3I63C 3L17A 4WWOA 1EYGA 3J81L 4DV1Q 3EGRA 4W9IA 1TY0A 1PH5A 5C3JB 2N0SB 1EYAA 3OIPA 1FIQA 4C56C 5IGCA 3CCRA 3RYTA 3H9DA 2K05A 2MLBA 3VDZA 5D14A 1Y1VB 3PF5A 2FIFA 3CQZB 4NZLB 3LJ3A 3Q3JA 1GAQB 4TKOB 3GTGB 3PO0A 4II3B 1IP9A 3HOUG 4OONA 2BB6A 3CF5A 5JOBA 1PZJD 3ZRFA 2OF1A 1ZOYB 3S1RH 4HKQA 1XLNA 1RFAA 5FJ8G 1GUAB 2VH1A 3DWPA 2F0EA 1YX5B 2WX1A 3IAM1 3K5OA 3TCAA 2WYQA 1JRPA 3CCLA 4YHHQ 5FR3A 4KGSA 5IA7A 2MQHA 1N6ZA 1I6HH 1MHXA 4C1NI 1SLJA 2FMCA 3ENEA 5CHWA 3V62A 1WI5A 3HGBA 3ZGZA 3AE7B 1ASYA 2NB0A 2AX5A 4A3IB 1IBKQ 1E22A 1AW7A 3MHSD 5H92C 4JI8L 1FJGQ 4KHPQ 4RWSC 2Q8TA 2G4DB 1HNZL 2R2OA 4EGVA 4JYAL 1G51A 1SGHA 1PRTB 1DOKA 1DM0B 1NJIC 2GBKA 1NBWA 1T6BX 2UUCL 3UGBB 3N52A 4B3RQ 3WWVA 5C0XI 5E6PA 1JWAD 2XGTA 2NBUA 3TBLD 2V4LA 1J8IA 2L7RA 4M00A 4DR1L 5JH5C 1SYGA 2AWNA 1KLUD 2A19A 1SSNA 1P16A 4TMAB 4JE3B 1N62A 1BBXC 2C7MB 3Q3MC 4MGYE 1Y14B 1SNMA 2W3RA 3A9JA 1YZ6A 2F03A 3U2SC 5TR5A 2AYOB 2W3SA 1Q1EA 4JIOU 4MH8A 1YQ4B 5G5HA 1B53A 1F9SA 4K8IA 2QSDA 3JSVA 1K83B 4J15A 1GHKA 3VDYA 3WCQA 4BBNF 2K14A 2ZM6Q 2PW5A 2JA7B 4DR6L 2F0SA 2NVQB 2JXTA 2W55A 2YTVA 3PHXB 4NAMA 1TS5A 4OWTB 5JHBA 3KLSA 1IYJB 3NBHA 2IW3A 3K80C 1TGZB 2N4FA 1X56A 2R92G 1NENB 1STYA 5M3MG 4C4VA 4G4KA 4C2MB 1E2VA 2K33A 2EY2A 5DNFA 1PRTC 4K14A 1F52A 4TQ1A 1C4CA 3H15A 3DXJC 3T3OA 4AIMA 1K53A 1VF5C 4WORA 2NTSA 4S0RA 2BA1A 2L05A 4WJQA 1Z7TA 2X6LA 4NMZA 2F4VL 2O5IC 2ZNVB 2KUMA 2ZTDA 2ZTEA 1KABA 3BY4B 1TQOA 3LXFA 4G11A 3OTOL 4A9AA 1FL0A 3FC4A 5ELDA 2R7ZB 5LL6S 4DK6C 3NVZA 2YYZA 1L2FA 2FFKB 4C3HG 1MPEA 2Q2TA 5EJWA 1MVKA 4IPCA 3W1BA 2A4ZA 4R4CA 3IL8A 4RGNA 3AEEB 4A55A 3I5JC 5HHDG 2VS1A 2D3GA 1I5FA 1X65A 1YJIA 1QZHA 3AH7A 3GTMH 2IX1A 1UGMA 2CQAA 3PO2H 1V1QA 3PIOA 2DENB 2YVCA 1Z2MA 4F7ZA 4POGA 5GAGC 3GTQH 5EKLA 2V3PA 4DV3Q 3Q8FA 5BYRA 3VRBB 1V97A 5LMNW 1WTQA 3HUIA 3KWLA 1SIJA 3STBC 3UF8A 2H89B 2WXNA 3AEAB 4K5VA 2Z9HA 2Y0SE 1YJ1A 4OO1G 3AE1B 3OW7A 2IY0B 3R2TA 3DQVA 4OZCA 3JYUA 5IP4D 2BW2A 3S9WA 5J1ZA 1PRTD 2F0VA 3Q8EA 4KHZA 2J0JA 2RSUA 4QIWE 3AE6B 2EKIA 4MSMB 4C80A 2LJIA 4YHHL 2M0AA 2EXDA 2NN6H 3EIVA 1U9RA 5I6WA 4FADA 5IGEA 1GM5A 3GOEA 2VQEL 1QOBA 1JB7A 1ZXHA 1S3SG 1V5TA 1A3VA 2OT2A 2ZCCA 2KVRA 3F1ZA 2HE7A 4NY0A 1LTGD 3KH0A 5AZGA 4HPLB 4A3MB 4MACA 3LWUA 2AWTA 4DUZL 3T1YL 4W9FA 5J2RA 4NPSA 3TL5A 2ZT9C 4NXNQ 1HE8A 2MBEA 4WJ4A 1FRRA 2N78A 4ZRQA 4DXAB 1HRJA 1JE4A 3MC8A 2PKOA 5JAVA 2UUCQ 3PF4A 1JORA 3EECA 3FPUB 1WXSA 5CV5A 4B3RL 1P1AA 1TS4A 3I4LA 2CHXA 2LD9A 2EIFA 5BO4B 5C2TB 2JA5B 1PA6A 3GTPB 4ANVA 2F1MA 1KOTA 1CSQA 4ANUA 3AI5A 2HDEA 4NJ7A 2OJRA 3QCAA 4ASWC 3KDFA 1FEHA 1NY4A 5EBDA 5M5XH 4ILWA 4DV2Q 3ERQA 2BS2B 4WJWA 1M4VA 3RN9C 5M5WB 2K0PA 1B9RA 3Q0AA 4IC7B 4P6VF 3I4NG 1ASZA 2LRWA 2BH2A 1YNND 1VQGA 4QUCA 3EQLC 4HEDA 1MJEA 2EYFA 2K3UA 1E6EB 5C0XJ 5BMGA 3S2DB 3PIO3 3FILA 1MHHE 2A6EC 3TEXA 4AJWA 3RMHA 1DGSA 3OWFA 4PZ7A 2F3WA 4AP4C 1EU3A 3U50C 2RPQA 2BPSA 2WAQB 4DA2A 4LJPB 1SSOA 1Y8PB 4BXXH 1WTPA 1MG4A 1VQLA 1JJ2A 2N1VA 4HJGE 1SMYC 4KHVA 5JJLA 3ZDTA 3ERSX 1ZXIA 4O42A 3JAMc 2RHQB 1JB3A 2WB1E 3J81i 3ULPA 4G50A 1F2YA 3MC9A 3CCVA 3FKIH 3J80L 3APDA 4HDOA 3CCEA 1VQKA 5JPMC 2H1EA 2ASBA 2D10A 5GADC 2E8GA 3VHTC 1GXDC 2KTRA 2F0OA 2H4OA 2K04A 1AEXA 3JW0X 1OXUA 2VNUD 1PRTF 4XT1B 4CDFC 2Y3AA 3AXCA 5GMVA 4CHKA 1V43A 1ZUD2 2Z59B 2F0DA 2KJ6A 2RVLA 1KNEA 2PMZE 4IUVA 2NR2A 4QQBX 1UWXA 3ONSA 4P1BC 3BDLA 3CD6A 2UWQA 4MIUA 3VYSA 4JYAQ 4BKTA 1HZAA 5BN4A 2UYZB 1EIGA 1KAWA 3AM9A 3GP7A 2BDOA 1K3BC 3GTLB 4XYOA 1R4QB 2MO0A 1WTWA 2F0IA 3OMCA 3A8IE 4S17A 1ISNA 4DV7L 5DLQE 3AU4A 3OG5A 4IWQA 3UIOB 1O7LA 1N61A 2DHZA 2FCNA 3DWQA 2KAJA 2DZMA 1G2SA 2PPHA 3Q6SA 4R4IA 3HKZE 3DM1A 2FXQA 2VUMG 4OO1H 1WX7A 1L0WA 1ZDVA 2AQ3B 1A5RA 1AZQA 2K5PA 2R7FA 4ZRZA 2GMIC 2Q8RE 1GUOA 4H02A 2NMQA 5CR3A 2X69A 1F9RA 3GZNB 2KECA 2HQLA 3KK7A 1J7BA 2HTHA 2IJ0A 1RKNA 3HKZG 4OXPA 5C3EB 3QWNA 1HZ6A 1NBFC 1YHQA 2D11A 1HTQA 2SOBA 1EWIA 1FPYA 2KQ3A 2NVYB 3S15H 1IL2A 3C2PA 1VQNA 1H9RA 1C78A 3WAOA 3UQBA 1RL2A 2DJGC 3H0GH 1P9DU 1TWFB 1JCKB 5JJZA 1BKBA 2WXMA 2ZXPA 1AWDA 4IALA 3EVQA 3H09A 1N34L 4GOPA 3OMGA 3Q3OC 1TXYA 1K73C 2QEJC 5IGBA 4GNXC 1N34Q 5LMUL 2KDEB 1FCLA 2YEPB 4B3TQ 1CZGA 2KXJA 1CI3M 5EAYA 4MGZE 3CAMA 3IFDA 2N3SA 3TP5A 2JY6A 4WH4A 5BMHA 1NTGA 4DR4L 5M9OA 3CWIA 2AL6A 4XDXA 4GDLA 5FLXL 3H1UA 4QY7A 5C5LA 4JG2A 3I7FA 4JBMA 1Q1BA 2OTLA 1L0YB 3GV6A 2DNFA 2NWGA 2N9LA 4EUTA 1Q5WB 2JP1A 1OQQA 5D7GA 2Q2UA 2VUMH 4CKCA 3P7JA 1N33L 1HUMA 3TZUA 4E3CA 3D4WA 1Q7YC 4LF5Q 3RD4A 1WIAA 1ML0D 1KXLA 2I1KA 4CGYB 4DPGA 2EE1A 4WWPA 3V6CB 4FF4A 4UP9A 5G55A 2MRPA 1TKGA 2UUAL 1VDZA 4RGMA 3BDOA 2VZAA 5JHAA 4O0AA 1KD1C 3S1MB 3AMUA 1SF0A 3K5LA 2WLBA 3VR2A 1TR5A 4WQMA 1Y69U 4A3GH 1R4MB 3L7ZC 3AE5B 1HFGA 2SEBD 4POFA 3CC2A 2E74C 3TS2A 1QOFA 2KQ7A 3MTNB 3V3XA 2UXBQ 2RSOA 4CDCC 2EYMA 4A3EB 1RAXA 4OW0A 1XD3B 2D3AA 4TSSA 2HIVA 3ND9A 1PH8A 4DV0L 2MEKA 2I5LX 4LFAQ 1BR9A 2CW0C 1EY6A 2AUJD 4KHPL 2JYEA 3FRPB 3EROA 1S3OA 4AQYL 4URKA 2HIXA 4RG1A 2FBWB 3A9KB 3DDCB 5E6OA 1PFDA 1F1HA 2A6HD 1L2NA 3DBHB 2A73B 1DZ1A 2LVOA 2REXA 3BG3A 3KJPA 4A3BG 2CKHB 2R2QA 2LMCA 3HOYB 2ZPYA 4OX9Q 1E3PA 4KKTA 2UU7A 4EZKA 4IUUA 2EMTA 4EQ5A 5J22A 2OXPA 2B2WC 2PCFB 5IYCH 1FGBD 5FJ8H 1ENAA 3RMKC 4GSWA 1PHJA 1QZEA 3RULA 3P63A 2PZUA 2VW9A 5AJ3Q 2XWJB 4BY1B 3R3OA 4K5WA 1RYJA 4C3JB 1K8MA 3APCA 4BA1I 2JEAI 2GVAA 4B08A 2BTEA 3PUVA 2A68D 1SNQA 2BBCA 1GUNA 1IGCA 3IT6B 1LABA 1HZBA 1MI2A 5A2QL 1QJOA 3VA5A 1WXMA 1FD7D 2OQKA 2BOSA 4K0KL 2KOXA 2AKWB 1XMQL 4IOCA 2CW0D 1SIFA 1BF4A 1N36L 4AYBE 1M8AA 5C4HA 2VXWA 4UPAA 1A2UA 4KSLC 3RT3B 3KF6A 2QKIC 1D2BA 1XXGA 2WXJA 4MGIE 4DHJD 4YWLA 1PTOF 3KF8A 4TQUS 4HSPA 2JF5A 1GJZA 2BYFA 4FHJA 1HTLD 3U4VA 1L5PA 3ZXRA 3H0GG 4DU9A 1NUCA 3MA2B 1U4MA 1ENFA 3QARA 5I2XA 2G45B 1P0RA 3NUHB 5DPTA 5E1FA 4B9KA 2ZXOA 1KFYB 3M9BA 1O7IA 2NZHA 1WZ3A 4GLVB 2EDGA 3CPFA 1Q8IA 1WZ0A 3I73A 2ZVNA 1QE6A 4A3PA 3S2AA 4RF1A 5C4JH 3QHTA 3PO3H 2MP1A 4JI0Q 1GD7A 1H95A 4IOIE 4DNRB 3RNGC 4N8X1 3WA0A 1TYGB 2XN9C 1WGYA 1GB4A 4A3EH 2RDHA 4P2CB 2LHDA 4A3JG 2MP2B 2WDQB 1VMCA 1UWVA 2DUDA 2EYPA 2F0HA 1GHJA 4HJ9A 5FLXc 1V1PA 1NCVA 3TUOA 4AYBB 1VQ6A 2Z4HA 3JAMi 3J81c 3ZKJC 1CKNA 2KHSA 3MWYW 1TWCB 1WOCA 5EBCA 5IWAL 3GTJB 2J53A 3LYYA 1RWSA 4U673 1SNCA 4JI5L 2L83A 3HOXB 4CO7A 1UE6A 1AFPA 3PUXA 4J3OD 1EQTA 4M1UB 2WINB 3ML9A 1X1MA 2JUOA 3MAQA 1I4XA 5IYDG 4JI7L 1YN3A 2VZKB 4CKBA 1Q10A 1LT4D 2UUBQ 3R93A 1Y8RC 4OZBA 2HTME 2D2CC 3TEWA 5DPRA 4ARCA 3S17B 1XTCD 4YY3L 1R4PB 3EFXD 4PZ6A 1SYBA 2A8VA 1EUJA 3K9PB 2CJNA 4BKGA 5KNCA 1OFFA 1X32A 2KACA 2KWUB 1TKEA 2JX5A 2C5LC 4L5SA 3GDEA 3UIPB 3QOLA 4UDUC 4X62L 4ICUA 4JL9A 1YNJC 3APFA 1WY8A 3H8HA 1AE3A 4OVUA 2MHJA 4K3CA 5EE1A 1X9NA 2LFIA 1SJHD 3PV0A 2BKRB 4BXXG 3G6EA 1HNXQ 3KLWA 3ECIA 1G6JA 3I56A 2JA5G 5H8YE 4IJHA 4JVZA 2VQFQ 2GLSA 4DR1Q 1KDBA 3QR8A 1PH6A 1KRHA 3ZQ4A 4JI2Q 2WXGA 1O78A 3NVVA 4LNOA 5EE3A 2B2TA 1NMGA 2K6QA 4KKUA 1HXYD 1SMXA 2LGDA 2HT1A 2KC1A 5IP9G 2KENA 5M5YH 4A3MG 4OL7A 4ABNA 4IFDJ 4IM0A 1HUNA 1D7QA 4ANXA 4A3DB 3GB1A 1Z6HA 2EXZA 3I72A 4A6QA 2TMPA 3U9SA 3BS1A 2ZNVC 1F77A 1MIUA 2ATWA 1CHPD 4ZUIA 5KNBA 4A8XC 4JI3L 4GB9A 4NW2A 5EKIA 1WRIA 5A2QE 2D2QA 3NVWA 5C4JB 4W9CA 4DNTB 4ZYNA 1R4NI 4LLGM 1H8CA 2EPBA 2C7HA 3D6CA 4L5TA 2L12A 4BBRH 2L0TA 2HHHL 4JI4Q 2JT4B 4JI7Q 2GBNA 1B70B 3OOCA 1YJJA 3IT4B 3Q14C 2WFWA 1UELA 1PH4A 3N30A 4LDTD 3KFUA 1C48A 3M4YA 2IGGA 4B3SL 1AN8A 1S72A 1GC6A 1EF1A 1PTOH 2GA4B 4EQPA 4B3SQ 2TSSA 1EOVA 5ELNA 3I4MG 1GUTA 3CCJA 4JI8Q 3J80E 1FJGL 1YX6B 2JXXA 1A63A 1HPCA 2G9DA 2PQEA 3EA6A 3MXGA 4GNXB 5FO9B 2MQJA 3DBRB 4DUZQ 2DNEA 4M02A 3VUWA 4HIMA 4ZQ3A 1J19A 1YN5A 1WM2A 5EE9A 2KX0A 4DK0A 1N60A 3OYYA 1EL0A 1I4RA 1LUZA 3PUYA 1QVFA 4TKNA 3QIAA 5ELOA 4RA8A 2IBIB 2WS3B 4NKLA 1WGGA 4H7BA 1JWBD 4JI6L 5FLMH 5C3XA 4WFN3 1PVOA 4DAMA 5I2YA 4KIKB 2FUHB 3DVNU 3NSWA 3AFQA 2L55A 4X64L 1JICA 2KVMA 3GTGH 4OX9L 3MXPA 2BYTA 5C4XG 1IUEA 1EEID 1TWGB 1CKMA 5GAHC 1BCPD 2BS4B 4K7UA 3ETRA 2WXLA 1UD7A 1VQ7A 1VCBA 2L52A 5HFYA 1WX8A 1BDOA 3D4RA 5M3MB 3AV8A 4X3TA 2JWZA 4DUYQ 2R92B 3P4PB 2IYDB 4DR7L 3BK1A 1AE2A 1LTSD 2NVUI 3AMZA 1MJDA 4IKGA 3UI3A 2E2JH 4B6WA 4MNOA 1CJEA 4ZAIA 1G6PA 1PGXA 1E9MA 1EF5A 5C4XH 2F52A 3BYYB 2JA7G 4KSKC 1TZOA 3D4DA 4KDIC 2J7ZA 4GDLB 1N5WA 1VQ9A 1IXRA 2WP8J 4FHKA 1HTPA 2Q8IB 4DV6L 1TKYA 4OWWB 3FP9A 4BAXA 1F9PA 2ZJRA 3TRZA 4HJKA 2NBVB 3IAYA 2ZEQA 2CKZB 3A4RA 3M62B 1HFNA 2ZPNA 4RM9A 1TWAH 5TSSA 3ZYYX 4HJ7A 1M94A 2N7EA 4XQQA 1JALA 3I91A 3MXNA 2L0FA 3DVNV 1UEAB 1QZGA 2F4IA 1QOHA 1Y1WG 3BINA 1YNXA 3MHZA 4F87A 4QUFA 5LLIA 3I4MH 3KUPA 3J7A5 2WXIA 3PZDA 2EVBA 3NWSA 1QLBB 3BZCA 2ID0A 1FCCC 2O2LD 1IYVA 3KW5B 3V6EB 4IQZA 1G2TA 3P4QB 4BVUC 4CKEA 4ZUJA 4KV6A 2Y0SB 1YITA 4G7ZC 3IVFA 2I1JA 4A3CG 3CW2C 1NYRA 5JEAG 2JA8G 1XT9B 1JRUA 5IP7H 2IO3B 1EQRA 3URYA 1PGAA 3CSFA 4IPGA 2B39A 1G6ZA 5GROA 2M1MA 4W9GA 4IPDA 4LFBL 2IX3A 1PH1A 4ZRIA 4DR3L 4XDDA 4J8QA 2J52A 1UE7A 5C3WA 5IOCA 1XPUA 1GPXA 2W54A 3J7AF 2F0FA 1CM9A 2K6AA 4NB3A 3J7ZC 2MWSB 3N6RA 5KNDA 1HQRD 5FO8B 3CMEA 3KUDB 3V2TA 4REZA 5L83A 4MT5A 2AWOA 1FFUA 2G3QB 2JA8B 1QUQA 2MBBB 1OTCA 4R8NA 4JPBW 2IY5B 4KZCA 3H7SA 2Y0SG 4L5QA 3L4PA 2KJXA 3PIP3 1GG3A 4DDID 2NZ1D 1I4GA 4A93H 2VQEQ 1OQRA 5DCNA 1PFNA 3DBSA 4YXDB 5G3LF 1EWHA 1C76A 2K8BA 2LGIA 2EYOA 4ACFA 4XE0A 4FP5D 3KYDD 3PO2B 1YMHE 1DOIA 2HCCA 2DYMA 3RLFA 1Y1WB 1X6OA 4XXEA 3HEJA 4IM2A 1ZW7A 1LQBA 4II2B 5G5GA 3OJ4B 2E2DC 1RF2D 4A3KH 1IBMQ 1U4RA 1FMAD 1VZ7A 3CHBD 4B9WA 2ALYB 4GOPC 5DEHA 1KC8C 4XYQA 1E7VA 4WJPA 2N7DA 2XRSD 1WE7A 4I6NB 2QCZA 2MW5A 1PXUA 4A3KG 3NWTA 5J39A 1N33Q 4BOZB 1IBLQ 2KD0A 5J18A 4K7SA 3RNEC 4K0KQ 4C7ZA 4PQXA 5EQ0A 5HGTA 4FULA 1BUIC 1SE8A 2KOLA 1I94Q 3S2HH 1SEBD 1Y56A 5JVH3 2R61A 5CV4A 3PMFA 3I4MB 1MGSA 1XQQA 3BDCA 3L0OA 3P1MA 4BBNC 2R93B 3JAML 2KMCA 4KDLB 3NBIA 3PVLA 4RKBA 3JSVB 2LXKA 2VY3A 3EN2A 3WAPA 3JAME 3PRZA 3BVGA 2NZOA 2LUMA 3T53B 2J42A 3WOFA 3G4SA 2RA4A 3L16A 4N58A 3ZJUA 4DV0Q 4GS3A 1NDDA 1FXTB 1MI0A 3AE8B 4WURA 4NXMQ 2KJRA 3S16B 4CDEC 3GTPH 5A35A 2KKCA 3PZ8A 2GN5A 2QW7A 1AH9A 1TBEA 5C44H 3U58A 2OQ0A 2BGFA 1XCTL 2RD0A 2EOTA 3M3JA 4HMJA 4LF8Q 2IO1B 2YEPF 3ALBA 3UQAA 5JEAH 2JA8H 3CRLC 1RCVD 4JOIA 5CV8A 4A3IH 1AARA 3NJTA 2K7VA 1DYQA 1C8CA 1NR4A 3PT2B 2J0TD 3A5ZB 1IBML 3K6OA 2D3BA 2WNMA 2Y5CA 4MN3A 2Q2HA 4N9PA 2D5DA 5T1GA 5I9OA 4QGUA 2NVXB 4L1BA 3Q8BA 5LHY1 4I65A 3LNNA 5GQOA 1LTTD 4G7HC 3EBEA 1L4DB 1VZ8A 2QDBA 1WR6E 4R4OA 3VR5A 2B63G 4KX6B 4S3SA 5IGGA 1LO5D 3NHHA 1IBLL 1YIWA 1PMRA 3QJZA 2DBYA 1HCZA 1HR0W 3V96A 3TSSA 2AMCB 1XLOA 3N32A 2JJQA 1CKNB 2A5UA 1I50H 2FJ2A 2JQOA 2EYHA 2Q2IA 2RCNA 5CORA 2L8JA 1KLVA 4DAVA 4DR7Q 4UY8C 3FAHA 1A3UA 4YCVA 1CZWA 4YCWA 3K0XA 2G5DA 5CBAE 1K83H 1E7UA 4ZKCB 3QA8A 4KD3A 2JA7H 1VR9A 3HRZC 1XPOA 3CCSA 3T1YQ 3TDQA 3W2DA 5AZHA 4GXBA 1RDPD 4NXNL 4A3BH 1E1TA 3L2PA 2Z0EB 1BBUA 4AJYB 3Q22A 1WM3A 4K6LA 3RNUA 4OIKA 4DAYA 2K5WA 2CWAA 3SK5A 1GJXA 2D07B 1MBYA 2RDFA 1G291 4M8MA 3HOXG 1CT1D 2E76C 2NBFA 1YIJA 4OVVA 2O2VB 1A62A 1GUWA 1DOYA 3LB8C 2DJFC 2JPHA 1GUGA 2O5JC 1LFDA 3NOBA 4PK1A 2WDVB 1BNZA 3HOWB 1V9JA 3AU7A 4YSZB 1ROEA 2LXCA 4GGQA 5IT9c 3SK6A 5C0XH 1LLRD 3RCZA 4MGKE 3SU8X 5NUCA 4PV1C 3X3MA 2V9HA 4W9HA 1U4PA 4LUOA 4LCDE 3ZJYC 2PE9A 5LNK1 2INDC 1TT2A 4CHTB 5C23A 4JI1L 1IW7D 3NPPA 1WYWB 4A3GG 2JA9A 5E3FA 4AWJA 5HG2A 1DJRD 1HNWL 2XK5B 3NRZA 4K7WA 2F0UA 2K5HA 2X8XX 1VQEA 3LWEA 2F3VA 4EZJA 4MM3A 5J17A 2NVYH 4ZOHC 2NPTA 1BQQT 3GO5A 4NAWA 2EQSA 2O6VA 2WGSA 5D3DA 1H9SA 2YTYA 5HY6A 3UDFA 3HOZH 4FJYA 3U30A 3A33B 2F0NA 1PTOC 1TS3A 3OSOA 4GU2A 1ET6A 1I4QA 4HAEA 1CA5A 3NBHB 1YQBA 4LF4Q 1V6EA 3N1XC 4Y7NB 3FDTA 1QOGA 2ZZPB 4FNFA 1YJ9A 4KI0A 2JYOA 4X6AH 4C4VB 3PPAA 2M00A 2M9VA 1EM7A 1IBXB 1Q0WB 2MJEA 3KF8B 5IT9E 3NE5B 4A3JB 4GKKQ 2F0MA 4CBVA 3ONAB 1NSNS 3VR8B 3ZDMC 4CQNA 2QEXA 2KDMA 3KUCB 3Q23A 1Y1VH 2IGDA 3AB5A 4WAAA 3NTIA 1HHVA 1STHA 1SYEA 4HK2A 3RUIB 3HM3A 1A70A 3G48A 2M8SA 3K9OB 3PRPB 3P4SB 1EFID 1FNWA 3PQIA 1WJ6A 3QAQA 2CHZA 5AUIA 4EFOA 1I50B 5GXGB 2K4KA 3GS2A 4DK1A 2X38A 3RZOB 4JI2L 3W1SA 1K28A 3H3VC 2EELA 2PZWA 1B2TA 3CC7A 3I55A 1E90A 1W6JA 1I6HB 3KVFB 4A3OA 3A74A 5D65A 1I3QB 2ACZB 3ZUNA 2RR9A 3VUYA 3ER0A 2C60A 3E56A 3CPWA 1D8LA 1JROA 4FJVB 3K58A 4AQ7A 1WXVA 4KGTA 4US8A 1X55A 4BA2I 1HZCA 3MJWA 2HD3A 2RBMA 4C7YA 1EY7A 2E2IH 2XIWA 2K5DA 4LDTB 1QNKA 2N9XA 1PZID 3TEHB 5KYLA 1ZGUB 2EY5A 2I5MX 5ELEA 1D5MC 5FLXE 3DOWA 4C3JG 3MZ5A 2FNJB 1FNVA 4BY1G 2QCPX 1I4HA 3J81E 4MDKE 3DCGA 2K01A 3OW2A 1R9TB 1WYGA 3DVGX 3K8AA 3M85A 2ONQA 5LXHA 4YWGG 4FF2A 3S2DH 5IOIA 2JU6X 1V81A 4HVBA 4UHVA 1XMOL 3ZLZA 1TU2B 2BA0A 1XYIA 3WAMA 4KY7A 1E7ZA 3HOYG 2WXFA 3NUCA 1J7CA 3M95A 3NP8A 1BBWA 1PYSB 4ZLTF 2NVQH 1S1QB 4DR4Q 4HCNB 1X3EA 4BY7G 3VH4B 4C3JH 2MJ8A 4X3SA 2BS3B 2LASA 4B95A 1WVLA 1VQMA 2CJOA 1JOQA 1C77A 5E4XA 1T3QA 3MXNB 4FO2A 4YL8A 5CGKA 3S1QB 1C0AA 3PSIA 4YWKA 4USAA 5BN5A 4DV3L 3KWVA 2XRQD 2LI5A 5AZFA 4KK7A 3EFUA 4LFCL 3TEZA 4ZRJA 4A3EG 3FVQA 2QGQA 3GE3C 2J0MA 1KDCA 3W3AA 1WXAA 4HDQA 5IKCM 4A3FH 5E6JA 4O2DA 5KGUA 3PO3G 3PREA 4HCPB 5IGFA 5T1IA 3T4AC 1PH2A 4MTNA 4M8NA 2UXDL 3N20C 5DPWA 4IFDH 1ZKHA 2WWZA 1SR3A 3R3MA 4DV4Q 3A5UA 2C5CA 2WKCA 3I4NH 1NMFA 3A9KA 3Q2AC 4LWCA 1HA6A 1T5XD 2MUYA 3B08A 4IN3A 2B3AA 4AUQC 4LNIA 1E8WA 1CZPA 4MSQB 4DXGA 4HPMB 1QKZA 3UI2A 1FYCA 2K5QA 1S5FD 1IW7C 4NJ6A 3M4QA 3GTMB 2CQOA 3M4PA 1TT5B 1H9JA 1LYLA 3DLLA 2L1BA 1IBKL 4LF7Q 2R7DA 1ZP0B 1UE5A 3J7YW 2MBQA 5BR8L 3X23A 3RN2A 5IT9L 3E6ZX 2K52A 1VMPA 3KDFB 1XLPA 1UBQA 4KKSA 4DN4M 2KWVB 1HNXL 1IHZA 2VB2X 2B2WA 1L7YA 1WTXA 4NNJB 3VFKA 3H7PA 1D1IA 4ZHOA 4NP5A 2B2VC 2L1AA 3VR3A 1NVID 2CR5A 3H6MA 1TWCH 5KYIA 5D2MB 3DHQA 5CMDA 3S1NH 2BWES 4JWUC 3ZTDA 2ASQA 5IYBG 1PLFA 2WXPA 1J8CA 1P7FA 4GN1A 3SE0A 3DM3A 3ND8A 5DM63 3HKZB 1I94L 3C19A 2B2YC 1YBYA 2C35B 2EMSA 5T8IA 3VAWA 2F0PA 2XNAC 2KFKB 4BFRA 1GUSA 2CHWA 4QJFA 1IKMA 5I9PA 3CSTA 2VUMB 3Q8AA 4HEA1 2F0KA 2UXDQ 2BYVE 2DYBA 2KO3A 2R3ZA 3NHEB 3OAWA 3T3NA 1V1OA 3T1HL 2QILA 2VZKD 3SDZA 4DWFA 2WXKA 1WE6A 2WAQG 1P7EA 2MH7A 2BQQA 2INCC 5MPOA 2K5NA 4V190 1J5EL 2QA4A 1ZXTA 4AH6A 4A3GB 5M5WH 3IHPC 1SE4A 3RZWC 2FIDA 1BUVT 1ZE3D 1V2YA 4LF8L 4LFAL 4PS7A 1HNZQ 2Z0SA 4L8JA 4X65Q 3DUZA 3ZRCA 3I4NB 4FVMA 2JXMB 3C1EA 4X62Q 4JV5L 1A0IA 1A3TA 1L1OA 4XQJA 3CP0A 1WI0A 5EPJA 2AL3A 4JV5Q 2DX5B 2KCCA 2P5ZX 3B2GA 3HOWG 4FN2A 1QUQB 3OIQA 4ME5A 1E1OA 4TV3A 3GTKH 1WX9A 5JVG3 2KWCA 4X64Q 3SDLC 3I9V1 2AQ1B 2B2UC 2DWQA 3HFZB 2JA6G 4LNNA 1Q82C 1WTVA 2JA6H 1VQCA 1XLQA 2GVBA 3R2IA 1R4NB 1UAPA 2N8NA 2LUEA 3PIPA 1K52A 2X6GA 2HDLA 1C7YA 1YOVB 4LUZA 2FE8A 2JWUA 4XC2A 1HEZE 4KN7C 3SXHA 3D32A 2JVCA 1D6EC 4DQOC 4N9F4 3H3VI 4R9WA 3M3YB 1KM7A 2DYOA 2KBNA 2RDGA 3C3LA 2WIIB 3IFWB 4QAYA 1IYFA 3A0JA 5AJ3L 4OZAA 1JW9D 1L1OC 2OCEA 1SE9A 1PTOB 4H44C 3HS0C 1FO4A 1XJVA 1NYQA 2IO0B 2Z1CA 5L95C 3UDIA 1WMHB 1B7YB 5JJIA 1QT9A 3V60A 1AYFA 3NS1A 2LEKA 4ITKA 3GTLH 4I7AA 5E7NA 2LXJA 1LTRD 4J6HA 3ABVB 5JZEB 3STBD 1EZ6A 2V3SA 3EFCA 3CU7A 2NN6I 4EQNA 2JZPA 1WCMH 2CFMA 2K5VA 1W3SA 2LGYA 4HJ5A 2ZJQA 4RMAA 3B1LX 1SNDA 4KMUC 2JEBI 3OLMD 4EQOA 3M7NA 4L6TB 5D94A 4FJZA 4OHJA 3QIJA 2Z6KA 1N32Q 1EWYC 1NI2A 4YTPB 3L08A 3S14H 4H13C 3A56A 1XF5L 2LSSA 4X65L 2E3TA 1R7SA 1CFMA 2AUKA 4L63B 2YU9B 4OVZA 3K7UC 1KAAA 1OTRB 1T0QC 4YTNB 4WIPA 3SGIA 4RM8A 1VQJA 1C79A 3RZDH 4EZLA 3K7AB 5IYBH 2I46A 1S5CD 3C1FA 2E2JB 3SFDB 3R66C 4M0WA 4HKZE 4LNFA 4C3HB 2ICEC 1FD6A 4OEMB 2L11A 4LFCQ 2DY7A 2E2HB 5K36G 4LK1C 2XSCA 1X54A 5KHOA 2BE5C 2PVGC 3W1GA 5CV9A 2PVOD 1SDFA 3HVDA 5C0XG 1L6UA 1EU4A 4APVA 3A54A 4DR3Q 1DOLA 1EIHA 2FCSA 4B3ML 4JI5Q 2JYTA 2R93G 1TWAB 3GTKB 3GV3A 4GOCA 1E2WA 2D0PA 2K32A 4LW1A 3GTJH 2ZM6L 4P16A 1E5WA 1FRDA 3Q3FA 2ZTCA 3MFYA 1SRUA 3HOXH 3RPFC 1PQSA 1I35A 5E6NA 3NZ3A 1XNRQ 2BVCA 4EOYA 2UXCL 1IZ6A 3HM6X 1JMLA 1UE1A 1YJWA 1XNRL 4IFDI 1QB5D 1L0VB 4BZAA 3A8KE 2N49A 2WHIA 2WU5B 3EJIA 3IFTA 4J1MA 3CCMA 3TQYA 4HN7A 5C6AA 3S17H 1B44D 1QVCA 3H3VH 1WFYA 4BKSD 1A6XA 2R7ZG 1B4OA 4PMCA 4QF4A 1GO3E 2NUCA 3T9LA 2PI2E 1II3A 2VB3X 4DK3C 5I4DA 4IO9A 3VR6A 1ZKOA 2DZKA 3ZIMA 4A3FG 4JGHB 2I07B 2N9EB 3E3XA 3NXWA 1SXTA 3TP6A 4DV7Q 1N8RC 3L10B 2HCIA 4IOAA 2BE5D 2FAZA 3MP9A 2MNAA 2IPKD 4LTUA 4GDKB 4LF9L 1I7HA 1GVPA 1XNQQ 3EC8A 4CJ0B 3DEOA 4BBSG 1V1PB 1T0YA 2N9PC 2KDFB 4WJ3M 4ZKBB 1ONLA 4IUPA 3UDXA 1Z9FA 2W82A 4A3CH 4DUYL 3VVWB 3GQBA 3FEWX 1P3QU 1BXTA 4A3IG 3SVMA 1NNXA 2JZZA 3TMEA 4JPSA 4US9A 4RFBA 1JWSD 4FF1A 4HLEA 3FMCA 3RFZB 1CQFA 1QOAA 1J0GA 5M3FH 3NG0A 4MTKA 4YT0B 4OIJA 1Y1WH 2XWBB 2NVTB 3I3TB 4B3MQ 1OXSC 1NI3A 1TJEA 1XCQL 1RHPA 3I4OA 2F4VQ 1Q12A 1UZXB 2PLPA 5LMUQ 2N1WA 1PYWD 3MVVA 4GKKL 4DGZA 3L3OC 2D9UA 1H4RA 3WIMA 1WTHA 3WDNA 3MFGA 1TTNA 4FDBA 2UXCQ 4W9KA 2PMVA 2L32A 2EY1A 1SFOH 1Q81C 1YD8U 3MXUA 4WQOB 4IJLA 3X3NA 4Y52H 4EKUA 1X3GA 1YEZA 4R8IA 1VRAB 3E9SA 2L00B 4LJOB 1EIYB 2PI2A 3PLUA 2RGFA 1KL9A 1YQ3B 2A6ED 3U4EG 5EPLA 1HNWQ 4KLKA 3M63B 3B2FA 1J7AA 3HOVB 2PNHA 3CIRB 4K5XA 1PYBA 1KQSA 4DV4L 1HJPA 2R93H 4JI6Q 3W5OA 4XX5A 2KCTA 4XT3B 1C9OA 1CTMA 3G71A 4QCLA 5LMNL 1VJKA 1ZPSA 4WWMA 3HOUB 1KJTA 3RUZA 2L0CA 2M4NA 1A2TA 1C1YB 2VRRB 4C1NK 3KF6B 4LNQA 4OELB 3Q8CA 4GLSC 3X0WA 1Y1VG 3U7DA 4LMQD 3PV1A 1D5XC 2KN4A 5IODA 3DHHC 1JOKA 3P20A 1Q46A 2NBWB 2KZRA 2OEDA 3BWUD 1MSHA 2K39A 4KZ0A 5IGDA 1SNPA 4GLXA 3UDGA 2YLMA 1F2LA 1RLFA 1JOOA 5C44B 4HIKA 2CH4A 4HRSA 4BKSA 1V86A 1SN8A 5M3MH 2JN4A 2G1EA 2ZJPA 2R92H 1Q1OA 2PQAB 5C4ZA 4ZRPA 3GD7A 4K2KA 4GMVA 1HQMC 3BIID 4MH0E 3W1SC 1VQ5A 4WWNA 2K03A 5C4XB 2ICIA 1WWTA 5G3LD 4GNXA 2PW7A 3MEFA 2M0XA 1KIXA 1N9WA 3Q8DA 1GNUA 3KYCD 2R6GA 2KYWA 4EVOA 4N6EB 5IAAC 2NVXH 4X66Q 2Y5PA 3PTFC 2MHVA 3P75A 1VQFA 3OWEB 3F2CA 2Q5WD 4WRDA 2IT1A 2C7NB 3GZNI 1F2RC 3AE3B 5HI1A 4DK5A 1Z47A 1S5ED 3A7LA 4Z9CB 4W9LA 1CSPA 3DWGC 1DONA 1KRSA 3T16A 2YTXA 4OO1I 3L0WB 5G2NA 3RZFA 3U7ZA 3VR9B 2HJ8A 4L2YA 3DBRI 4IUMB 4A3MH 1JC7A 2GI9A 4PG3A 3H94A 2KQSA 1WF9A 1STGA 2IHFA 5IP9H 2WAQE 4WJNA 1N36Q 2RDBC 3LGJA 3VXWA 3VTWA 2UUAQ 2F0GA 3QJYA 4HCEA 4P1CC 4LUVA 4A90A 3K57A 4U68A 1MD2D 1SYCA 5JXVA 4LK0M 3MEHA 3MTSA 1D4BA 4P71A 3VYTA 2Z8LA 2JA5H 3DEPA 3KJOA 2JSVX 3K5MA 1BCPF 2KDBA 5M5YB 2N7JA 1H9KA 2A68C 2QMTA 1DCZA 2MSED 3QWZB 3KLRA 5I6YA 1QWYA 1KLGD 5M5XB 1HR0Q 3HOWH 4A3DG 2GOWA 1LXDA 2M56B 2WXHA 1LTLA 2M17A 3W1YA 1K8OA 4E74A 5EDSA 4DR2L 3HOUH 4DAYB 1K8RB 4EE2A 1C4AA 4F7XA 1UBIA 2A74C 1EYCA 4AQYQ 2EZVA 1V80A 1UWMA 4RAUC 3RN5A 3AEBB 3I2ZA 5KRUA 3Q3NC 1K9MC 2PJHA 3ZNGC 1PZKD 4ZYSA 2MBOA 3ZNID 5KHQA 3TMPB 1EYDA 5D3IB 5DPSA 3ITPA 3B6YA 4RCOA 1TVXA 2KTRB 5IYDH 1PH3A 3BYTB 1PUTA 3CF6E 5FKAC 2KCMA 4EX5A 2B2VA 5KIXA 2XTIA 3F2DA 3KUZA 1LTBD 2YV5A 3ZNHB 4M0WB 4A76A 1OEYJ 4RNAA 3AEDB 1SNOA 4W9DA 4DV1L 3G6JB 3J80i 1K0SA 1ILQA 1LACA 4BBSH 4NAWB 5C44G 4JCVE 3AECB 4JI1Q 3L13A 4HWIB 4GOPB 4IUTA 4A3JH 2O6VD 5E4WC 4QB4A 1EY5A 1XO3A 1C4PA 2AHOB 1CK1A 3K59A 4UP8A 3JVZX 4JQWC 2RPVA 5CHFA 2K9XA 3FKYA 2IWHA 2KA7A 2BDNA 2FINB 3HVZA 4YWMA 1S5BD 2DAFA 2GBJA 1TKWB 3CXCA 1YHBA 2R7ZH 3ZTCA 4I7ZC 1YNTE 2K8HA 1W6KA 3QB3A 4P73A 2KK8A 2LVPA 3BK2A 2C9WB 1XMOQ 4GIVA 3I90A 1O7ZA 1TWGH 1WYDA 4C3IG 4Q5VA 2UXBL 2CCZA 4X3UA 3NK9A 3NQIA 4JOIC 1N32L 4AYBG 3HOVG 4A3LG 2KC2A 2DLBA 4M01A 2KMMA 2LJ5A 4I6LB 4ID6A 4IDIA 2DZIA 1OXTA 5IY0A 1K8GA 2IDYA 1HR0L 4PNYA 5L37A 2PIAA 3BU2A 2GRIA 2K22A 1CKOA 1L4ZB 1O7YA 4JC0A 1XEEA 5CV6A 3CCQA 2B2YA 4LF6Q 1O80A 4G57A 3V05A 2LZ6A 2MJ3A 3I70A 1BMLC 4K8JA 4FXCA 3D8GA 3F2BA 1U4LA 1WJJA 3LDZE 4K3BA 1I42A 2LY7A 4KKJA 1ESFA 3AE4B 2BH8A 1Q86C 5K36H 2K8CA 2WXRA 2IZVB 3S15B 4PS3A 3FPPA 1EQVA 2WDTB 1FGUA 3WOEA 2KLGA 3H0GB 3RNCC 1JQ4A 1VZ6A 5HURA 3TREA 5C5MA 3SEBA 1M1KC 4ARIA 1WMHA 3J7AV 4XWTA 2BT6A 1WXQA 1UNSA 4IFDG 2UUBL 4A20A 1RD9D 1C9FA 3L54A 3SR1A 1KH0A 3L9AX 1F2MA 2MFIA 3VTVA 2CH4W 4A93G 1E24A 1B3QA 2KANA 3TN2A 2OWOA 3GE8C 2KEEA 1KF6B 1AZPA
chains in the Genus database with same CATH topology
2WU2B 1D1KA 1LTID 2WXOA 3S1RB 4BBSB 3OPOA 1AP0A 4KY5A 4FXKC 2SAKA 3AE9B 2PYKA 4A3FB 4XIGS 1ILPA 3Q69A 1EY9A 1JQYD 4FYDA 2JQRB 3NVYA 4A3BB 1LT3D 3AN1A 5BN3A 1FFVA 3CRKC 1QF6A 3EUB2 3U9OA 2N55A 4BWGB 1VF7A 3HG9A 1MSGA 2WB1B 4DXFA 4XDCA 4FXGC 1NEKB 1F2RI 1T5EA 2FHTA 2INPE 2D5GA 1PFMA 1QG7A 2V0GA 1V8CA 3AEGB 4CJ2C 3IXSA 2BB5A 3FKIB 2PMZB 4YIJA 4HCSA 4E6IA 1LT5D 3I57A 2A69D 1A15A 1SBBB 3KQ4A 3FILB 1KDAA 3LX0A 1FXAA 2I38A 3DMUA 4O1NA 3T13A 3PUWA 2B8GA 4MM3B 4LAAA 4RKLA 4N59A 2F0TA 1SB3C 1B9MA 2F0LA 3ZJTA 1KTKA 2INNE 3NTHA 1LT6D 2L9HA 1PTOD 2F0WA 2NTTA 1KNAA 1QILA 5FOBB 1RODA 1CHQD 3OHXC 1B50A 1TY2A 3MHBA 1CQVA 4JX1C 4UAIA 2ZW1A 3VRAB 2HUGA 1VDVA 3T56B 1OXXK 4RCNA 3BVZA 1LTAD 1EY8A 2V4DA 2CVRA 2PZTA 2L4NA 3F2UA 1EWCA 4DFAA 3GTQB 2SNSA 1F9QA 5JPNC 1SE2A 3C8YA 5COYA 1RFKA 4JBWA 1EEFD 2RMMA 2AQ2B 1FNUA 2E2IB 1VLBA 2E75C 1HZ5A 3VYUA 4IURA 2MJDA 4KJNA 2M19A 1XX8A 4PMWA 1WGKA 4K6DA 4B0EA 2HQEA 4YTMB 2JA6B 4XQNA 2LFNA 4AS1A 5DM73 4NJCA 1H9SB 3E5SA 4NDXA 2C9OA 3KLSX 5CC4A 3P4RB 2A5HA 2K28A 2NYZD 3P42A 2FUG1 4F8MA 5CV7A 2KQ4X 4X3KA 2HDMA 2I2YA 1DOMA 3VR4A 2B76B 3W9CB 4H2AA 2Z4IA 1DD2A 2M2LA 5CBEE 3D31A 3M7GA 1HA5A 1WTOA 5AUKA 5ELCA 4D2KA 1SE3A 3Q24A 5DAUA 2SDFA 1DXMA 1GB1A 5FK9C 1YNJD 3AB9A 3K5NA 2LS01 5BMIA 4HMIA 3I3CA 4KGRA 4KTAA 3M4OB 1QCBD 4FXDA 1TS2A 3G7LA 1WSPA 2D62A 2K1BA 2N88A 5F2DA 4BBRB 1GOZA 2B8FA 1F0ZA 3D6WA 2V3NA 2LHEA 4WAFA 3DWAA 2LMCB 4F88A 1BCPB 1E0ZA 3S1NB 1E7PB 4B9XA 3HP3A 4HSVA 3BZDB 1ZEQX 2KWDA 2SNMA 1NAPA 4IUQA 1ZDXA 3HRDD 3U52E 1IGDA 1STNA 3J9CA 4KKIA 4ULLA 5EKKA 1I6VC 1SAPA 3PO3B 2CHBD 2PPBC 3O13A 1K50A 1ICWA 1RJTA 2ON8A 4HROA 1OO9B 5BYSA 5IIFA 4KN4C 1YNNC 4RGTA 5ELFA 2LKVA 3A55A 4H0LC 3T51B 3DWMA 1Y8OB 3HZXA 4BY7B 5KEEA 1ACCA 3TP8A 1SJED 1PDQA 2EJGC 2WDRB 3IKJA 1STEA 5ELBA 5AFWA 3KBXA 4JWSC 4G7OC 5M3FB 2B2TC 3E0JA 5EPKA 3GTOB 1ET9A 1EZ8A 4HTHA 2A69C 4GZYC 4K2LA 2H88B 1K51A 1TWHB 2PW9A 3W5UB 1IYUA 1XWEA 1FR3A 1EY0A 1ZYRD 4BS9A 1OXVA 1BO0A 4MHEA 3PUZA 4DF7A 2ZXRA 1VCIA 2NN6G 1B3AA 2WP9B 4IZ8A 1B9NA 3SFEB 5JEAJ 2WV6D 4Q2JA 1WCMB 5LL6X 2IX0A 1JWMD 1QQRA 4V0BA 3CKIB 1CA6A 4QIWB 5CYUA 1DOXA 2EJMA 1LV9A 2JSOA 3A8JE 2IGHA 1FM0D 4A93B 1WD0A 1V8QA 5ISRA 1E0BA 1FXIA 3VYRA 1D5ZC 4ZK9B 1RM6C 4OGQC 2A6HC 1UUPA 1N5XA 1N63A 1WTRA 1DGJA 1Q90A 3VQIA 2DY8A 2XVSA 4KD4A 4IUNA 2FMMA 1SYDA 1Y8NB 2CU3A 3NTKA 4KY6A 4RGOS 4ODGA 2J4XA 4M8AA 5BYQA 3QOJA 4RF0A 4TRDA 3PZ7A 2WXQA 4TQ0A 1UGJA 1C4QA 2MGSA 4QMGA 3TP7A 5EE0A 3QG1A 4JK1C 1RTNA 4ZHPA 4PT5A 1JWUD 3SR6A 4C3IB 2B2UA 1X3QA 1B1ZA 3AE2B 4RHRA 2PNRC 1S5DD 2RQXA 3H91A 2DN8A 1PDXA 2KCNA 4XWWA 4Q0FA 4YSXB 1Q3LA 1STBA 2PTLA 1G91A 3TBIB 2EYLA 3P1HA 2OHFA 3W5VB 1F2ZA 1WD1A 3TEYA 1S4ZA 2B63B 3VA7A 1J9OA 3C46A 1IL8A 2WACA 2RSNA 3KBGA 1QNUA 2RKSA 3SK4A 2MPMA 3AEFB 4L23A 4XTCS 2PO4A 3NQTA 1PGBA 3IAS1 2EY6A 2DNCA 1JR0D 2L5TA 5EGTA 2ENBA 2OEOA 1I4PA 2BCOA 2JE6I 1YN4A 4CJ1B 1ZYRC 1IKLA 3MC0B 1L0XB 4RHSA 2WKDA 1ESRA 3A7AB 2GB1A 4HR7B 4KJOA 1TIID 1SFOB 1IBXA 3ZJVA 1BCPC 4LJZC 1NR2A 2F0QA 2QF7A 3D3RA 5FO7B 4DAPA 3K0YA 1EY4A 4PMBA 1X3PA 3S14B 1RTOA 2WQYB 3R8BA 2F0JA 1SYFA 3RZDB 1BOSA 2QIEB 1ENCA 3BVMA 1L6VA 4RH6A 4FF3A 2QJLA 2ZW0A 3SHLA 3MJ5A 4A3KB 2KEDA 1EOTA 3TZDA 1SMYD 3SK8A 2EYJA 2EJFC 4B0MA 2E6XA 5K5PA 3HOZB 1E10A 1PFBA 2V4IB 4N9TA 1G8ZD 3N9YC 1STAA 3S2HB 3B9JA 4YSYB 1E2ZA 2O4XA 1H9MA 3I8ZA 2G9HD 3QO2A 2IL8A 2N9KA 3J81L 3EGRA 1TY0A 5C3JB 2N0SB 1EYAA 3OIPA 1FIQA 4C56C 5IGCA 2K05A 5D14A 1Y1VB 3CQZB 4NZLB 1GAQB 4TKOB 3GTGB 3PO0A 2BB6A 5JOBA 1PZJD 2OF1A 1ZOYB 4HKQA 1XLNA 3DWPA 2F0EA 3IAM1 3K5OA 1JRPA 5FR3A 4KGSA 1MHXA 4C1NI 2FMCA 3ZGZA 3HGBA 3AE7B 2NB0A 2AX5A 4A3IB 1AW7A 5H92C 4RWSC 2Q8TA 4EGVA 1PRTB 1DOKA 1DM0B 1T6BX 3N52A 5C0XI 1JWAD 1J8IA 1SYGA 2AWNA 1KLUD 1SSNA 4TMAB 4JE3B 1N62A 1BBXC 1SNMA 2W3RA 3U2SC 2F03A 4MH8A 2W3SA 1Q1EA 5G5HA 1YQ4B 1B53A 1F9SA 4K8IA 2QSDA 1K83B 3WCQA 1GHKA 2PW5A 2JA7B 2NVQB 2F0SA 2JXTA 2W55A 4NAMA 1TS5A 3KLSA 3NBHA 2IW3A 1NENB 1STYA 4G4KA 4C2MB 1E2VA 2K33A 2EY2A 5DNFA 1PRTC 4K14A 4TQ1A 1C4CA 3DXJC 3T3OA 1K53A 1VF5C 4WORA 2NTSA 2BA1A 1Z7TA 2X6LA 4NMZA 2O5IC 2KUMA 3LXFA 1KABA 1TQOA 4A9AA 3FC4A 5ELDA 2R7ZB 5LL6S 3NVZA 2YYZA 2FFKB 4C3HG 1MPEA 5EJWA 1MVKA 3AEEB 3IL8A 4RGNA 4A55A 5HHDG 1YJIA 3AH7A 2IX1A 2CQAA 5EKLA 2V3PA 3Q8FA 5BYRA 3VRBB 1V97A 1WTQA 3HUIA 3KWLA 1SIJA 2H89B 2WXNA 3AEAB 4K5VA 4OO1G 3AE1B 3OW7A 3R2TA 4OZCA 2BW2A 3S9WA 5J1ZA 1PRTD 2F0VA 3Q8EA 4KHZA 4C80A 3AE6B 2EKIA 2LJIA 2M0AA 2NN6H 1U9RA 5I6WA 5IGEA 1QOBA 1ZXHA 1A3VA 2OT2A 1LTGD 4A3MB 4MACA 3LWUA 2ZT9C 1FRRA 4ZRQA 1HRJA 1JE4A 2PKOA 5JAVA 1JORA 3FPUB 5CV5A 1TS4A 3I4LA 5C2TB 2JA5B 3GTPB 2F1MA 2HDEA 1FEHA 5EBDA 4ILWA 3ERQA 2BS2B 4WJWA 1M4VA 5M5WB 2K0PA 1B9RA 3Q0AA 4P6VF 1YNND 4QUCA 3EQLC 4HEDA 2K3UA 2EYFA 1E6EB 5C0XJ 5BMGA 3S2DB 3PIO3 3FILA 1MHHE 2A6EC 3TEXA 3RMHA 3OWFA 2F3WA 1EU3A 2WAQB 4DA2A 1SSOA 1Y8PB 1WTPA 4HJGE 1SMYC 4KHVA 1ZXIA 4O42A 1JB3A 1F2YA 3J80L 5JPMC 2H1EA 1GXDC 2F0OA 2H4OA 2K04A 1AEXA 1OXUA 2VNUD 1PRTF 4XT1B 2Y3AA 1V43A 1ZUD2 2F0DA 2RVLA 1KNEA 4IUVA 1UWXA 3BDLA 4MIUA 3VYSA 5BN4A 1EIGA 3AM9A 3GP7A 2BDOA 3GTLB 4XYOA 1R4QB 1WTWA 2F0IA 3OMCA 3A8IE 1O7LA 1N61A 3DWQA 2KAJA 1G2SA 3Q6SA 4OO1H 3DM1A 1ZDVA 2AQ3B 1AZQA 2K5PA 4ZRZA 2Q8RE 1GUOA 2NMQA 5CR3A 2X69A 1F9RA 2KECA 3KK7A 1J7BA 2IJ0A 1RKNA 1HZ6A 5C3EB 3QWNA 2SOBA 2KQ3A 2NVYB 3C2PA 1C78A 1H9RA 1TWFB 1JCKB 5JJZA 2WXMA 2ZXPA 1AWDA 4IALA 3EVQA 3H09A 3OMGA 2QEJC 5IGBA 1FCLA 2YEPB 1CZGA 1CI3M 3IFDA 3TP5A 4WH4A 5BMHA 5M9OA 3CWIA 4XDXA 5FLXL 5C5LA 1Q1BA 1L0YB 3GV6A 2NWGA 2N9LA 2JP1A 1OQQA 5D7GA 4CKCA 3P7JA 1HUMA 3TZUA 3D4WA 3RD4A 1ML0D 4CGYB 2EE1A 4FF4A 1TKGA 1VDZA 4RGMA 3BDOA 2WLBA 3S1MB 3AMUA 1SF0A 3K5LA 3VR2A 1TR5A 4WQMA 1Y69U 3L7ZC 3AE5B 1HFGA 2SEBD 3V3XA 2E74C 1QOFA 2RSOA 2EYMA 4A3EB 4OW0A 4TSSA 3ND9A 2MEKA 1BR9A 2CW0C 1EY6A 2AUJD 2JYEA 3FRPB 3EROA 2FBWB 1PFDA 2A6HD 2A73B 1DZ1A 3BG3A 2LMCA 3HOYB 4KKTA 4IUUA 5J22A 2OXPA 2B2WC 2PCFB 1FGBD 1ENAA 3P63A 2PZUA 4BY1B 2XWJB 3R3OA 4K5WA 1RYJA 4C3JB 1K8MA 4BA1I 2JEAI 4B08A 2BTEA 3PUVA 2A68D 1SNQA 2BBCA 1GUNA 1IGCA 3IT6B 1LABA 1MI2A 5A2QL 1QJOA 3VA5A 1FD7D 2BOSA 2CW0D 1BF4A 1M8AA 5C4HA 2VXWA 1A2UA 2QKIC 1D2BA 1XXGA 2WXJA 1PTOF 3KF8A 4TQUS 4HSPA 1HTLD 1L5PA 4DU9A 1NUCA 3MA2B 1U4MA 1ENFA 5I2XA 3NUHB 5E1FA 2ZXOA 1KFYB 2EDGA 1Q8IA 3I73A 1QE6A 4RF1A 2MP1A 4IOIE 4DNRB 1GB4A 1TYGB 2XN9C 2LHDA 2RDHA 4P2CB 2WDQB 1VMCA 2EYPA 2F0HA 1GHJA 1V1PA 1NCVA 3TUOA 4AYBB 2Z4HA 2KHSA 3MWYW 1TWCB 5EBCA 3GTJB 2J53A 3LYYA 1RWSA 4U673 1SNCA 2L83A 3HOXB 1AFPA 3PUXA 4J3OD 1EQTA 4M1UB 2WINB 3MAQA 1I4XA 2VZKB 1YN3A 4CKBA 1Q10A 1LT4D 3R93A 4OZBA 2HTME 2D2CC 3TEWA 4ARCA 3S17B 1XTCD 1R4PB 3EFXD 1SYBA 2CJNA 5KNCA 1OFFA 1X32A 2KACA 1TKEA 2JX5A 3QOLA 4UDUC 1YNJC 3H8HA 5EE1A 2LFIA 1SJHD 3PV0A 5H8YE 1KDBA 1KRHA 3ZQ4A 2WXGA 3NVVA 1O78A 5EE3A 2B2TA 4KKUA 1HXYD 4OL7A 4ABNA 4IFDJ 1HUNA 4A3DB 3GB1A 1Z6HA 2EXZA 3I72A 4A6QA 2TMPA 3U9SA 3BS1A 1F77A 1CHPD 4ZUIA 5KNBA 4A8XC 4NW2A 5EKIA 1WRIA 5A2QE 3NVWA 5C4JB 4DNTB 4LLGM 2EPBA 3D6CA 2L12A 3OOCA 1YJJA 3IT4B 1C48A 3M4YA 2IGGA 1AN8A 1PTOH 2GA4B 4EQPA 2TSSA 1GUTA 3J80E 4XDDA 1HPCA 2G9DA 2PQEA 3EA6A 3MXGA 5FO9B 2DNEA 4ZQ3A 1YN5A 5EE9A 4DK0A 1N60A 1EL0A 1I4RA 3PUYA 3QIAA 4RA8A 2WS3B 4NKLA 4H7BA 1JWBD 5C3XA 4WFN3 5I2YA 3NSWA 2L55A 1JICA 2KVMA 3MXPA 2BYTA 1IUEA 1EEID 1TWGB 1BCPD 2BS4B 3ETRA 2WXLA 2L52A 5HFYA 1BDOA 3D4RA 5M3MB 3AV8A 4X3TA 3P4PB 2R92B 3BK1A 1LTSD 4IKGA 3UI3A 3AMZA 1CJEA 4ZAIA 1PGXA 1E9MA 3BYYB 1TZOA 3D4DA 2J7ZA 4GDLB 1N5WA 2WP8J 1HTPA 2Q8IB 1TKYA 1F9PA 3IAYA 1HFNA 5TSSA 3ZYYX 4XQQA 1JALA 3I91A 3MXNA 1UEAB 2F4IA 1QOHA 3MHZA 4F87A 4QUFA 3KUPA 2WXIA 2EVBA 3NWSA 1QLBB 2ID0A 1FCCC 2O2LD 1IYVA 4IQZA 1G2TA 3P4QB 4CKEA 4ZUJA 4KV6A 2Y0SB 4G7ZC 1NYRA 5JEAG 3URYA 1PGAA 1G6ZA 2B39A 2IX3A 4J8QA 2J52A 5C3WA 5IOCA 1GPXA 2W54A 3J7AF 2F0FA 1CM9A 2K6AA 3N6RA 5KNDA 1HQRD 5FO8B 4REZA 3V2TA 4MT5A 2AWOA 1FFUA 2JA8B 4R8NA 3L4PA 2KJXA 3PIP3 2NZ1D 1I4GA 1OQRA 1PFNA 4YXDB 5G3LF 1EWHA 1C76A 2LGIA 2EYOA 4XE0A 4FP5D 3PO2B 1YMHE 1DOIA 2HCCA 2DYMA 3RLFA 1Y1WB 4XXEA 3HEJA 5G5GA 2E2DC 1RF2D 1U4RA 1FMAD 1VZ7A 3CHBD 4B9WA 5DEHA 4XYQA 2XRSD 1PXUA 3NWTA 5J39A 4C7ZA 4PQXA 5EQ0A 5HGTA 1BUIC 2KOLA 1SEBD 1Y56A 5JVH3 2R61A 5CV4A 3PMFA 3I4MB 1MGSA 3BDCA 3P1MA 2R93B 3JAML 3NBIA 4RKBA 3JAME 3BVGA 2LUMA 3T53B 2J42A 3WOFA 3ZJUA 2RA4A 4N58A 3AE8B 1MI0A 4WURA 3S16B 5A35A 3PZ8A 1XCTL 2EOTA 4HMJA 2YEPF 5JEAH 3CRLC 1RCVD 5CV8A 2K7VA 1DYQA 1C8CA 1NR4A 2J0TD 3K6OA 2WNMA 2Y5CA 4MN3A 5T1GA 4N9PA 2D5DA 5I9OA 2NVXB 4L1BA 3Q8BA 5LHY1 4I65A 3LNNA 4G7HC 1LTTD 1L4DB 1VZ8A 2QDBA 3VR5A 4KX6B 4S3SA 5IGGA 1LO5D 3NHHA 1PMRA 2DBYA 1HCZA 3V96A 3TSSA 1XLOA 2FJ2A 2EYHA 5CORA 4DAVA 3FAHA 1A3UA 1CZWA 5CBAE 4ZKCB 4KD3A 1VR9A 3HRZC 3TDQA 3W2DA 1RDPD 3Q22A 4K6LA 4OIKA 4DAYA 2K5WA 3SK5A 1GJXA 1MBYA 2RDFA 1G291 1CT1D 2E76C 2NBFA 1GUWA 1DOYA 3LB8C 1GUGA 2O5JC 2WDVB 1BNZA 3HOWB 3AU7A 4YSZB 1ROEA 3SK6A 5C0XH 1LLRD 5NUCA 4PV1C 3X3MA 1U4PA 5LNK1 1TT2A 4CHTB 1IW7D 3NPPA 5E3FA 5HG2A 1DJRD 3NRZA 2F0UA 3LWEA 2F3VA 4ZOHC 1BQQT 3GO5A 5D3DA 1H9SA 2F0NA 1TS3A 1PTOC 3OSOA 1ET6A 1I4QA 4HAEA 1CA5A 4Y7NB 3FDTA 1QOGA 4FNFA 4KI0A 2JYOA 2M00A 2M9VA 1EM7A 1IBXB 2MJEA 5IT9E 3NE5B 4A3JB 2F0MA 4CBVA 3ONAB 1NSNS 3VR8B 4CQNA 2KDMA 3Q23A 2IGDA 3AB5A 3NTIA 1HHVA 1STHA 1SYEA 1A70A 3P4SB 1EFID 1FNWA 5AUIA 1I50B 5GXGB 3GS2A 4DK1A 2X38A 3RZOB 3W1SA 3H3VC 2EELA 2PZWA 1B2TA 1W6JA 1I6HB 5D65A 1I3QB 2ACZB 3E56A 4AQ7A 1JROA 3K58A 4KGTA 4US8A 4BA2I 4C7YA 2RBMA 1EY7A 2XIWA 2K5DA 1QNKA 1PZID 5KYLA 2EY5A 5ELEA 1D5MC 5FLXE 4C3JG 3MZ5A 1FNVA 2QCPX 1I4HA 3J81E 2K01A 1R9TB 1WYGA 3M85A 2ONQA 4YWGG 4FF2A 2JU6X 1XYIA 1TU2B 2BA0A 4KY7A 2WXFA 3NUCA 1J7CA 3NP8A 4ZLTF 2MJ8A 4X3SA 2BS3B 1WVLA 2CJOA 1JOQA 1C77A 5E4XA 1T3QA 4FO2A 5CGKA 3S1QB 4USAA 5BN5A 3KWVA 2XRQD 4KK7A 3TEZA 3FVQA 1KDCA 3W3AA 5E6JA 5KGUA 5IGFA 5T1IA 3T4AC 4IFDH 2C5CA 2WKCA 1HA6A 1T5XD 2MUYA 4IN3A 1CZPA 4DXGA 1QKZA 3UI2A 1FYCA 2K5QA 1S5FD 1IW7C 3GTMB 1H9JA 2L1BA 1ZP0B 3J7YW 5IT9L 3E6ZX 1XLPA 1VMPA 4KKSA 4DN4M 1IHZA 2VB2X 2B2WA 1WTXA 1D1IA 4ZHOA 4NP5A 2B2VC 2L1AA 3VR3A 1NVID 3H6MA 5KYIA 3DHQA 5CMDA 4JWUC 2WXPA 1PLFA 1P7FA 3SE0A 3ND8A 5DM63 3HKZB 2B2YC 5T8IA 2F0PA 2XNAC 1GUSA 1IKMA 5I9PA 2VUMB 3Q8AA 4HEA1 2F0KA 2R3ZA 3T3NA 1V1OA 2QILA 2VZKD 3SDZA 2WXKA 2MH7A 1P7EA 5MPOA 4V190 1ZXTA 4A3GB 1SE4A 1BUVT 1ZE3D 4L8JA 3DUZA 3I4NB 4FVMA 2JXMB 3C1EA 1A3TA 4XQJA 5EPJA 2KCCA 3B2GA 4ME5A 3OIQA 5JVG3 3I9V1 2AQ1B 2B2UC 2DWQA 1WTVA 1XLQA 3R2IA 1UAPA 1K52A 2X6GA 2HDLA 2FE8A 2JWUA 1HEZE 4KN7C 3SXHA 4DQOC 1D6EC 4R9WA 3M3YB 2DYOA 3C3LA 2RDGA 2WIIB 4OZAA 1JW9D 1PTOB 4H44C 3HS0C 1FO4A 1NYQA 2Z1CA 1QT9A 1AYFA 3NS1A 2LEKA 4ITKA 1LTRD 4J6HA 3ABVB 1EZ6A 3CU7A 2NN6I 4EQNA 2JZPA 1SNDA 4KMUC 2JEBI 4EQOA 3M7NA 4L6TB 4OHJA 1EWYC 4YTPB 4H13C 3A56A 1XF5L 2E3TA 1R7SA 1CFMA 2AUKA 4L63B 2YU9B 4OVZA 4YTNB 1KAAA 4WIPA 1C79A 3K7AB 2I46A 1S5CD 3C1FA 2E2JB 3SFDB 4M0WA 4HKZE 4C3HB 2ICEC 1FD6A 2L11A 2DY7A 2E2HB 5K36G 4LK1C 2XSCA 2BE5C 2PVGC 3HVDA 5CV9A 2PVOD 1SDFA 5C0XG 1L6UA 1EU4A 1EIHA 3A54A 1DOLA 2JYTA 1TWAB 3GTKB 3GV3A 1E2WA 2K32A 4P16A 1FRDA 3MFYA 3RPFC 3NZ3A 1JMLA 4IFDI 1L0VB 1QB5D 3A8KE 2WU5B 3EJIA 3IFTA 4J1MA 5C6AA 4HN7A 1B44D 1A6XA 1B4OA 4PMCA 4QF4A 2NUCA 1II3A 2VB3X 5I4DA 3VR6A 1ZKOA 2I07B 3NXWA 1SXTA 3TP6A 3MP9A 2HCIA 2BE5D 2IPKD 4LTUA 4GDKB 1I7HA 4CJ0B 3DEOA 1V1PB 4ZKBB 1ONLA 4IUPA 2W82A 3GQBA 3FEWX 1BXTA 3SVMA 3TMEA 4JPSA 4US9A 4RFBA 1JWSD 4FF1A 3FMCA 3RFZB 1CQFA 1QOAA 4YT0B 4OIJA 2NVTB 2XWBB 1OXSC 1NI3A 1TJEA 1XCQL 1RHPA 1Q12A 2PLPA 1PYWD 3MVVA 4DGZA 3L3OC 2D9UA 3WDNA 3MFGA 2PMVA 2L32A 2EY1A 3MXUA 3X3NA 4R8IA 1VRAB 3E9SA 1YQ3B 3U4EG 2A6ED 5EPLA 3B2FA 1J7AA 3HOVB 3CIRB 4K5XA 4XT3B 1CTMA 1ZPSA 4QCLA 1VJKA 4WWMA 3HOUB 3RUZA 2L0CA 1A2TA 4C1NK 3Q8CA 4GLSC 4LMQD 1D5XC 2KN4A 5IODA 1JOKA 3P20A 2OEDA 3BWUD 1MSHA 5IGDA 1SNPA 1F2LA 1JOOA 5C44B 4HRSA 2G1EA 5C4ZA 4ZRPA 3GD7A 4K2KA 1HQMC 3BIID 2K03A 5C4XB 2ICIA 1WWTA 5G3LD 2PW7A 2R6GA 4EVOA 4N6EB 2Y5PA 2MHVA 3P75A 2Q5WD 3OWEB 4WRDA 2IT1A 1F2RC 3AE3B 5HI1A 1Z47A 1S5ED 3A7LA 4Z9CB 3DWGC 1DONA 3T16A 3VR9B 4OO1I 3U7ZA 4L2YA 2GI9A 1JC7A 3H94A 1STGA 2F0GA 3QJYA 4HCEA 4A90A 3K57A 4U68A 1MD2D 1SYCA 5JXVA 4LK0M 3MEHA 3MTSA 1D4BA 3VYTA 2Z8LA 3DEPA 2JSVX 3K5MA 1BCPF 5M5YB 2N7JA 1H9KA 2A68C 2QMTA 1DCZA 3KLRA 5I6YA 1QWYA 1KLGD 5M5XB 4R3DA 2M56B 2WXHA 1K8OA 4EE2A 1C4AA 4F7XA 2A74C 1EYCA 2EZVA 1UWMA 4RAUC 3AEBB 5KRUA 1PZKD 4ZYSA 1EYDA 5D3IB 3ITPA 4RCOA 1TVXA 3BYTB 1PUTA 5FKAC 2B2VA 5KIXA 1LTBD 4RNAA 3AEDB 1SNOA 3G6JB 1ILQA 1LACA 4NAWB 3AECB 4IUTA 5E4WC 4QB4A 1EY5A 1XO3A 1C4PA 1CK1A 3K59A 2RPVA 2K9XA 2IWHA 2KA7A 2BDNA 2FINB 3HVZA 1S5BD 1TKWB 4I7ZC 1YNTE