1C3TA

Rotamer strain as a determinant of protein structural specificity
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
76
structure length
76
Chain Sequence
MQLFVKTLTGKTLTVELEPSDTVENLKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNLQKESTIHLVLRLRGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags De novo protein
molecule keywords PROTEIN (1D8 UBIQUITIN)
publication title Rotamer strain as a determinant of protein structural specificity.
pubmed rcsb
source organism Homo sapiens
total genus 16
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 1999-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1c3tA00
1PQSA 2I1KA 5AEKB 4FJZA 5KHQA 2KTRA 2VRRB 1NDDA 2JF5A 2KANA 3AU5A 3UGBB 3RUIB 4PS8A 1KJTA 2MA9B 5CX3A 3ZO5B 3HM6X 3ML9A 4IC7B 2KC2A 1E90A 3Q3JA 1E8WA 4IM3A 1T0YA 1WY8A 3O65B 4HPLB 3UF8A 1WXAA 4KDLB 2KKCA 3PZDA 1BT0A 2UWQA 2BKRB 3A1QB 3Q3FA 3VQIA 3S2AA 2WWZA 4TV3A 2KHWB 2JUOA 2KZRA 1R4NI 2IY0B 3U7DA 3VUXA 2IO2B 1Z2MA 4AOFA 2A5UA 2M1MA 4M8NA 1VD2A 3C0RB 3K9OB 4MELA 3CMMB 2LVQA 1WXMA 3EC8A 3L10B 3TJPA 4G3XB 4MM3A 3TL5A 3T9LA 3M62B 4HLEA 3DCGA 2L76A 2DYMA 3TBLD 5JHAA 2N9PC 2LGYA 2BYFA 2R2OA 5JH5C 2NPTA 4OVVA 1P1AA 3L08A 3VAWA 3X0WA 3R66C 2XK5A 2MRPA 2Z59B 2KFKA 3WAPA 4BKGA 2WX1A 2PE6B 2ZCBA 2O6VA 4EKUA 2Y5BB 4LJPB 4W9JA 1WJ6A 3QAQA 4ZRKA 1RRBA 1NBFC 1FXTB 5CTRC 1P3QU 3PRPB 4E71A 3ZLZA 3OJ3A 2V1YA 2DYBA 3HIZA 2FCMA 4RMAA 5J2RA 2BWFA 4FADA 2G45B 4EZKA 2AEHA 3V62A 2D11A 4GSWA 3RULA 2BF8B 5KHOA 1LXDA 3UQAA 2KOXA 5L83A 3UIPB 2AL3A 2YLMA 1ZKHA 4EZLA 1WH3A 3R7QA 2K8HA 4K7UA 1A5RA 4DK5A 1LFDA 1WX9A 2ZZPB 3A9JA 1EUVB 2I1JA 2MP2B 3ZRCA 4G50A 1C3TA 3DOWA 4I6NB 3N32A 5E6NA 1G6JA 4WQOB 4HXDA 3A4RA 1V49A 2DENB 2HTHA 4PYUA 4WWPA 2RSUA 4ANVA 1Q5WB 3NY5A 2KVRA 1SE9A 3RZWC 3DPDA 4FA6A 3UINB 1Y8RC 2LASA 4GN1A 5LXIB 4IWOA 3UQBA 3K9PB 3L0WB 4F7ZA 4DHJD 2L0FA 1GC6A 4ANXA 2KXJA 2Z0EB 1RAXA 4HK2A 1SGHA 3PGEA 3QCAA 2C5LC 1VCBA 3H7PB 4EUTA 3JYUA 1WJNA 4IG7B 1WX8A 5J18A 1WE6A 4E3CA 1WX7A 3QK0A 3ZRFA 2N9EB 2DZKA 1UD7A 2NBWB 3EFUA 2ZVNA 3ZNGC 4EEWA 2DX5B 2L8JA 2L0TA 2GBMA 4W9LA 3GOEA 2HD5B 3X23A 5D7GA 2C7HA 5BO4B 3A4SC 2LUEA 4KIKA 2LD9A 4GIVA 3ZTDA 4HCPB 2BWES 2ZCCA 3EECA 4PS3A 2ZNVB 3JSVB 4PYZA 2N7EA 1P9DU 3B08A 4I6PA 1V9JA 2GMIC 3VUWA 5HKHA 5LXHA 1UZXB 2D07B 2DAJA 3H9DA 3LDZE 3ZW3A 2MX2A 2BYVE 3KYDD 1UELA 2KDFB 2KTFA 4J6IA 2KDIA 4GXBA 2CHXA 3DBSA 3ZKJC 3GZNI 2IZVB 3CF6E 4WAAA 1OEYA 2DZJA 4FHJA 3A33B 1Z5SB 3MJWA 4ZRJA 4X57B 2AYOB 1GG3A 2MLBA 2KFJA 3A9KA 3KYCD 4B9KA 1P0RA 1U4AA 4TKNA 3NZUA 2DYOA 4E74A 2N7DA 4AWJA 2JPHA 3IFWB 2K8BA 4W9DA 1WF9A 1UGMA 4NQKE 2ASQA 1CMXB 2V4LA 1WFYA 4BKTA 2M4NA 2IYDB 1IYFA 1NI2A 2RD0A 2J0KA 1YQBA 2OJRA 4WJQA 4MJSA 1WMHB 3WALA 4NJ7A 4IW0A 2FCNA 2FUHB 3H7SA 2YVCA 1OQYA 1Q1OA 2L00B 5D6JB 5L95C 3M3JA 3AU4A 2KC1A 2MBQA 2N9XA 2EMTA 4G11A 1WZ0A 3IVFA 2JY6A 2NBVB 4KV2A 4K7WA 3DBLI 5IA7A 3KUCB 4IWQA 5TR5A 2KK8A 4DHZB 2G3QB 4W9IA 4GDLA 2EMSA 3P2BA 3ALBA 1L7YA 4KZ0A 2CKHB 2MBEA 4W9CA 3B1LX 3MHSD 5IAAC 2RR9A 4FLHA 5AZFA 2ZPNA 3VXWA 1WZ3A 4NAWA 2BPSA 4MGKE 5E6PA 3L16A 4HCNB 3PVLA 1WGHA 3LJ3A 5AZHA 3SD5A 3ZTCA 3NZSA 2ZEQA 4BVUC 4NNJB 2K25A 2QHOA 3PHWB 2FCQA 3D32A 4PS7A 4HDOA 2O2VB 2N1WA 2GBJA 5E6OA 2FIDA 2IY1B 2JZZA 2PPHA 3AULA 3APFA 3DBRI 3RD2A 3V6EB 4CO7A 1OTRB 4K7SA 1TZ1A 1WIAA 1YX6B 2KX3A 1L2NA 3VDZA 3DVGY 5FR6A 4W9HA 1XT9B 2NR2A 3DVNV 1GUAB 4BBNC 4BKSD 4N9F4 3V6CB 3KH0A 4EFOA 3N30A 1V5TA 2BGFA 2LRUA 3L13A 3PT2B 2JRHA 3PRMB 4IWPA 5G2NA 1ZW7A 2CR5A 5CHVC 2KTRB 1WXSA 3DDCB 1V6EA 2J7QB 4I6LB 4ICUA 4W9GA 1RFAA 2KDEB 2NCNA 3L17A 4HDQA 1WYWB 5D94A 4LDTB 4IM2A 3AI5A 4KSLC 5GMVA 4KVGB 2FAZA 4KSKC 2JXXA 4F8CB 1E8ZA 1E8XA 1WJUA 2FIFA 3ECIA 3A1QA 3IBEA 2MQJA 2G4SA 2J0MA 3VUYA 4RM9A 2LGDA 2PJHA 2KDBA 1XQQA 4GMVA 2KLCA 3ZVVA 2V3SA 3OAWA 2UYZB 4WWNA 3KVFB 3ZIMA 2JT4B 3PPAA 5LLIA 3CSFA 1JRUA 1GC7A 2KD0A 1E8YA 2RPQA 2LXAA 2NVUI 3ZNZB 4ZYNA 1X1MA 2LVOA 4NY0A 4WJPA 1M94A 1YIWA 1IPGA 4TQ0A 4JQWC 4MSMB 4XC2A 3R7RA 3VFKA 2CHWA 2EKEC 3NHEB 2C7NB 2KQ7A 1YD8U 3ZDTA 1HE8A 1R4MI 1V2YA 2D10A 1P98A 4GDKB 4GOCA 3KUDB 2NPTB 4EOYA 1KM7A 3HK0A 3QARA 1J8CA 3TIXA 2KWUB 2XK5B 2R2QA 3PV1A 5DPSA 3VH4B 3WAOA 4MGYE 3JW0X 2MBBB 3AXCA 4LJOB 3ZDMC 2O6VB 1UH6A 4A20A 2ZVOA 4BOZB 5CHFA 3IHPC 3QHTA 3ENEA 3VTUA 3PSEB 2LGXA 3IG3A 3QQ8B 1EO6A 2BYEA 1LQBA 3U30A 4BBNF 2KWCA 2K6QA 1WJ4A 4FN2A 1TBEA 3VTVA 1EF5A 2CU1A 2DHZA 2M17A 2NS5A 4ZRIA 1F9JA 1KOTA 3W1YA 3APCA 4W9EA 4CYEA 2FNJB 2GBKA 5DPRA 3WIMA 4DDID 1S1QB 4HPMB 3UIOB 2KWVB 4A3PA 1S3SG 4AP4C 3V61A 1WXVA 1H4RA 4G0NB 3DBHI 1TTNA 1YX5B 3OLMD 3PTFC 4HWIB 2MP2A 3A9JB 4FULA 1H8CA 5JZEB 4EZJA 1ZGUB 2REXA 3ML8A 4IM0A 4BFRA 1EF1A 2J0JA 2MBHA 1QZEA 4BOSC 1RLFA 1C1YB 1UBQA 1MG8A 3U8ZA 5DPWA 2GBRA 4NQLB 4AJYB 2AL6A 1E7VA 3TMPB 4BKSA 2KX0A 1WR1A 1V5OA 4AJWA 2PEAA 1V80A 2C7MB 3ZNID 3WA0A 2PE9A 4DWFA 4MH0E 2DZIA 3H7PA 4P7IA 2CS4A 2L7RA 5CHWA 4XX5A 2LZ6A 4TQ1A 5J17A 1GNUA 4F1SA 2WX0A 2G4DB 1ISNA 2KJRA 3H6NA 2C9WB 4DDGD 1J0GA 2D2QA 2L05A 3QWZB 3VH3B 2JZ3B 2KJ6A 1WGRA 2KJHB 3SDLC 4HVBA 2HE7A 4DHZE 2CHZA 1WM2A 2WDTB 4W9KA 1I35A 3QA8A 3RZFA 2KMAA 2M8SA 4KIKB 3PLUA 2XEWA 4W9FA 3M95A 1KLVA 2KMCA 5EDSA 4GDKA 3JSVA 2IO3B 2JWZA 3L54A 4OVUA 4LDTD 2AWTA 2LXCA 2LVPA 2IO0B 3JVZX 5JHBA 4MSQB 4CHKA 3CSTA 1E7UA 3RT3B 2HJ8A 4B6WA 4URKA 3PHXB 3NOBA 2GBNA 3QC8B 1WM3A 1WGDA 2LI5A 4FBJB 3VTWA 3ZUNA 5G55A 1LM8B 3PLVA 5C23A 2L3ZA 4HJKA 2KQSA 5C1ZA 1E5WA 1WGGA 2LJ5A 3MTNB 1YJ1A 2LRWA 2LWPA 3B0AA 3NS8A 4LCDE 3A9KB 4GB9A 2NBUA 4ANUA 4GU2A 4K81A 3QX1A 4MEMA 3N3KB 2K1FA 2ZNVC 2D3GA 3V60A 4DBGA 2K39A 4ANWA 4IUMB 1V86A 2FCSA 2N1VA 3SHQA 1WRDB 2W9NA 3WAMA 3VHTC 4WJNA 3RCZA 2BKFA 2MBOA 1GJZA 3PS6A 4DXAB 4MGZE 2GOWA 4II2B 4MDKE 3DVGX 3RYTA 2XBBC 3TCAA 4WWOA 3HM3A 1WMHA 4ASWC 1V81A 2JRIB 4MJSB 2DAFA 4B95A 3OJ4B 1OGWA 4M8MA 4NJ6A 3T8MA 3ONSA 4JLCA 1UBIA 3KW5B 4RM8A 3ZNHB 1J19A 1WGYA 2O6VD 2ZJDA 4GGQA 2Z0DB 1AARA 2KN5A 2C60A 5DPTA 2DZMA 2N4FA 4XZ4A 2OOBB 5DCNA 3M63B 3SU8X 4NPNA 3I3TB 4GDLB 2KO3A 3BINA 4ICVA 5D2MB 3VVWB 1I42A 1WR6E 2MSED 1OEYJ 2MWSB 3PRZA 3QIJA 4JIOU 3BY4B 4TUUA 3W1SA 2KFKB 4NAWB 3WANA 1WI0A 2IO1B 4JL9A 3KUZA 1Q0WB 1D3ZA 3HHMA 1TGZB 2JVCA 2MW5A 1SIFA 4II3B 4M0WB 4MGIE 2MCNB 4JGHB 2O2VA 4DHJB 3QJZA 3EHVA 4KZCA 4FHKA 2IBIB 2KLGA 2K8CA 3APDA 4WJOA 3DQVA 3R3MA 4YL8A 5AZGA 1IP9A 3PREA 4KDIC 1K8RB 2K6DB 2ZPYA 2RGFA 4FJYA 4K1RB 2M0XA 2WYQA 4A3OA 2KNBA 4FJVB 3DVNU 3W1SC 4AUQC 1WE7A 2B3AA 1XD3B 3H1UA 4ZDVA 2A4ZA
chains in the Genus database with same CATH superfamily
4FJZA 2VRRB 4US8A 2KANA 2VH2A 3RUIB 2VZKB 2MA9B 3ML9A 3Q3JA 5IA7A 1E8WA 3UF8A 1WXAA 4BAXA 1BT0A 2UWQA 3FILB 1FCCC 3S2AA 2UU7A 1KF6B 2KAJA 3O13A 1R4NI 4YWGG 4Q2JA 1IBXA 1VZ8A 1XEEA 4M8NA 1VD2A 4TMAB 3C0RB 3CMMB 1WXMA 3EC8A 4DXFA 4G3XB 3T9LA 3B9JA 2QC8A 4OVZA 2IGGA 3DCGA 1T0QC 5JHAA 1IGCA 1PGAA 1JWUD 2G1EA 1P1AA 1E6EB 3X0WA 2MRPA 1WWTA 3BK2A 2PE6B 1JWSD 2ZCBA 4YXDB 4LJPB 3QAQA 4E71A 1NBFC 1FXTB 2AX5A 3Q8CA 4AS1A 3ZLZA 3OJ3A 4RMAA 1WSPA 2JQRB 2FBWB 5L83A 4RGTA 3UIPB 2AL3A 1CK1A 3U2SC 1WH3A 2K8HA 1A5RA 4DK5A 1WX9A 4D2KA 3A9JA 4XE0A 2L1AA 4RF0A 1EUVB 5E6JA 3DOWA 4I6NB 3A4RA 3ZJVA 4HKQA 1SE9A 4JPSA 3DPDA 5C2TB 3UINB 4GN1A 3UQBA 4F7ZA 4C4VB 5EE3A 2KXJA 1UWXA 1SGHA 2C5LC 1Q10A 1VCBA 1C78A 1QILA 4M01A 4NZLB 3P63A 1RFKA 3TEZA 1WX8A 5J18A 3DHGC 3OG5A 4XYCA 2IDYA 1K53A 2WDRB 1JW9D 2L0TA 3A4SC 4GIVA 2W3SA 2BWES 2CJOA 2VZKD 1SE2A 4PS3A 3ZYYX 4C7YA 4PYZA 2SEBD 3KQ4A 5HKHA 3DWMA 2DAJA 2RDBC 3Q14C 2MX2A 1UELA 4GXBA 3BYTB 3DBSA 2LJIA 3P4QB 2IZVB 4FHJA 3A33B 4WQMA 4ZRJA 2AYOB 1GG3A 3BVGA 2WNMA 3E56A 4TKNA 2BS4B 3NZUA 2N7DA 2FUG1 2JYEA 2JPHA 2K8BA 2ASQA 3RFZB 2WXOA 2RD0A 4WJQA 4MJSA 1E10A 3FC4A 2FCNA 5L95C 1MJDA 1MI0A 2OJWA 1WZ0A 3IVFA 2NBVB 4CQNA 4IWQA 2MEKA 4DHZB 3ALBA 4W9CA 3FAHA 4YTNB 2RR9A 2ZPNA 4JE3B 3PVLA 3LJ3A 3RNEC 3SD5A 3NZSA 4RF1A 2QEJC 3PHWB 3GS2A 2FCQA 3D32A 4PS7A 2FIDA 3AULA 2JSVX 2PPHA 3APFA 3DBRI 3RD2A 3V6EB 4JX1C 4K7SA 1NYRA 3Q3OC 3DVNV 1GUAB 4BBNC 1XLQA 2WXPA 3C19A 3AN1A 3N30A 1V5TA 3L13A 1NVID 3AE2B 1F1HA 1HTQA 1RFAA 5IOIA 1WYWB 1SJHD 5D94A 5GMVA 2QCZA 4KVGB 2GRIA 3TEXA 4OZBA 3FILA 2MQJA 3VUYA 4RM9A 1F77A 4S17A 4US9A 5BMIA 2V3SA 2JT4B 2ONQA 1GC7A 1FFVA 2H88B 4BZAA 1CZPA 2NVUI 1EM7A 2LVOA 1FRDA 4MM3B 4WJPA 1YIWA 4XC2A 2BS3B 2CHWA 1PGXA 3W2DA 3ZDTA 4GOCA 1R4MI 1P98A 3KUDB 2NPTB 3HK0A 1JWAD 2XK5B 5DPSA 3N9YC 4LJOB 3ZDMC 2O6VB 3IHPC 1EO6A 1QT9A 2M17A 2Q5WD 1KOTA 4L23A 4HPMB 2PTLA 2KWVB 3U52E 3V61A 1H4RA 2WDQB 1TTNA 3OLMD 1L4DB 2XNAC 3GE3C 3EGRA 4HWIB 4LNOA 4OZAA 4EZJA 1ZGUB 2MBHA 1FCLA 1RLFA 1UBQA 2GBRA 3AE6B 1E7VA 4WWMA 3RNAC 3TMPB 2WQYB 4C4VA 3RNGC 2Y5PA 1C9FA 2DZIA 2CS4A 5J17A 2V3PA 2D3CA 3Q8FA 1ISNA 5HHDG 2C9WB 3I9V1 2JZ3B 3BWUD 2IPKD 4WH4A 2KJHB 3SDLC 4HVBA 4W9KA 2MH7A 3QA8A 1I35A 2M8SA 4KIKB 4W9FA 4GDKA 2WXJA 1B9RA 2IO0B 4GLSC 4ITKA 1WM3A 1WGDA 4LNNA 3VRBB 4FBJB 2NTSA 1LM8B 4HJKA 2WXNA 1E5WA 2LJ5A 3MTNB 3U4EG 3MJ5A 1YJ1A 1JALA 3B0AA 3V60A 2D3GA 4ANWA 2BBCA 3P42A 2FCSA 2JWUA 1M4VA 1PGBA 1KLUD 1WRDB 3KWVA 4WJNA 3RCZA 2MBOA 4DXAB 4MGZE 2XBBC 3TCAA 1V81A 2JRIB 4JLCA 3KW5B 1XO3A 1MFWA 2O6VD 3PZ8A 3BIID 1AARA 2OOBB 3M63B 4YT0B 4NPNA 4GDLB 5D2MB 1I42A 2MSED 3PRZA 1OEYJ 3QIJA 1D6EC 2B76B 2INPE 1MG4A 1WI0A 3E9SA 1Q0WB 1D3ZA 1DGJA 1TGZB 3FKYA 4DHJB 4A9AA 3WCQA 2K8CA 3APDA 4WJOA 3U7ZA 3PREA 4KDIC 2GB1A 4A3OA 4FJVB 1VZ7A 1KRHA 2D3BA 2N0SB 2PIAA 3NUHB 1SE4A 4RGNA 3NVZA 4ZDVA 2ZVNA 2A4ZA 2WXFA 2I1KA 4C56C 3SR6A 5AEKB 5KHQA 1MHXA 1NDDA 2X8XX 1SF0A 1GPXA 3HM6X 4IC7B 1NENB 1E90A 3AE5B 4LNFA 4J3OD 1TY0A 1SE3A 5EE0A 1FNVA 1A70A 1HEZE 1E9MA 1BUIC 3Q3FA 4TV3A 2KHWB 2IY0B 1C79A 5TSSA 3K9OB 1TKGA 2LVQA 3TJPA 4EE2A 3I57A 4WAFA 3V3XA 4MM3A 4N6EB 3AM9A 2L76A 4HRSA 4HEA1 2BYFA 2LGYA 1MPEA 2NPTA 4WURA 1NYQA 2XK5A 1BMLC 4BKGA 1V97A 3HVDA 2O6VA 4FXCA 1C4PA 4LK0M 2V1YA 2HDEA 2AEHA 3V62A 3DHIC 1TT5B 5KHOA 4MH8A 3SFDB 2YLMA 1N5WA 4EZLA 1ZXIA 1FO4A 2X38A 1LFDA 2KACA 2V3NA 1L4ZB 5HI1A 4G50A 4WQOB 4HXDA 3AEAB 1V49A 1ACCA 1OFFA 2RSUA 1Q5WB 2KVRA 3RZWC 4ARCA 3AE9B 4IWOA 5LXIB 3C8YA 3Q8BA 1LO5D 4DHJD 4ANXA 2Z0EB 2WGSA 2WXRA 1N6ZA 3PGEA 4EUTA 3H7PB 5EE1A 1N61A 3JYUA 3RNCC 1N62A 1WE6A 2K9XA 4E3CA 3QK0A 3N20C 1UD7A 2NBWB 2L8JA 1I4HA 4W9LA 2HD5B 1V1OA 5BO4B 3MC0B 4KIKA 1KTKA 4HCPB 2KQ4X 2Y5CA 3JSVB 4I6PA 1P9DU 1V9JA 2YEPF 1QOFA 2AQ1B 2D07B 4OZCA 2BYVE 3KYDD 2KDFB 2KTFA 2CHXA 4YTPB 4RNAA 2E3TA 1Z5SB 2MLBA 1SJED 3KYCD 1P0RA 5I4DA 4P16A 3IFWB 4AWJA 1CMXB 4LTUA 3AV8A 2WDVB 3P1MA 2M4NA 1XXGA 2J0KA 1YQBA 2OJRA 2GI9A 4NJ7A 3H7SA 2JZPA 1T5XD 2HTME 5D6JB 3Q2AC 3Q3NC 4B0MA 2JY6A 3CIRB 4RCOA 2KK8A 3TUOA 2G3QB 1YN4A 3P4RB 4GDLA 3P2BA 1L7YA 4KZ0A 2MBEA 3B1LX 4YSXB 5AZFA 2BPSA 4MGKE 4H2AA 5H92C 3ZJTA 2WS3B 1WGHA 4BVUC 1V8CA 4NNJB 4WIPA 1PUTA 2O2VB 1JWBD 5LNK1 2GBJA 5E6OA 2JZZA 4XDDA 1TZ1A 1WIAA 3VDZA 3DVGY 3NJTA 2LGSA 2M0AA 3V6CB 4EFOA 3W5VB 2QJLA 2PVGC 4IWPA 2PKOA 5CHVC 2KTRB 1D5ZC 5IKCM 1WXSA 3DDCB 3MFGA 5HFYA 5JXVA 2ZW0A 2LHDA 2KDEB 1TYGB 4XWWA 3L17A 2AQ3B 3AI5A 4KSLC 2FAZA 4KSKC 2D3AA 2FIFA 1E8XA 4ZHOA 1XCTL 2L52A 3IBEA 5IP4D 2G4SA 2J0MA 2LGDA 2PJHA 2V0GA 1XQQA 2RPVA 1HZ6A 3ZVVA 3KVFB 1B1ZA 4LNKA 3ZIMA 3CSFA 1JRUA 1E8YA 2RPQA 1VDVA 1X1MA 1M94A 4TQ0A 4JQWC 3ZJUA 3R7RA 2EKEC 2L32A 3AEGB 2C7NB 2KQ7A 1YD8U 2D10A 1MVKA 4GDKB 4PT5A 4EOYA 1J8CA 3TIXA 2R2QA 4MGYE 1I7HA 3DBLB 2ZVOA 3QHTA 4RH6A 3PSEB 1T0SC 2IGHA 2KWCA 1WJ4A 3RNBC 3VTVA 1VZ6A 2CU1A 4ZRIA 1F9JA 3NZ3A 4N58A 4CYEA 3APCA 2NMQA 2FNJB 1S1QB 1F52A 4HJGE 3DWGC 3EFCA 4RGMA 5G5HA 2REXA 4IM0A 4BFRA 2QDFA 2J0JA 1DOXA 1C1YB 2W55A 2XN9C 1EWYC 4DXGA 2INDC 1V5OA 2PLPA 1HZ5A 2C7MB 3H7PA 5CHWA 4XX5A 2LZ6A 4TQ1A 1VLBA 4F1SA 2WX0A 3H6NA 2KYWA 2VH1A 1HXYD 1XF5L 3VH3B 1WGRA 2K0PA 1TS5A 1WM2A 1TIFA 1T3QA 3PLUA 3M95A 3JSVA 3L54A 5FR3A 1AYFA 2HJ8A 3PHXB 4XGAB 3NOBA 2GBNA 3UI3A 3QC8B 3Q8EA 3B2FA 5G55A 1HQRD 2L3ZA 1WGGA 2LRWA 2LWPA 3A9KB 4GB9A 2N1VA 2W9NA 1GJZA 4MDKE 4WWOA 1K50A 3BK1A 4KGSA 4ASWC 3RMKC 4C7ZA 4M8MA 1J19A 1WGYA 3ZGZA 2K3UA 2KN5A 2HJ1A 1AN8A 5DPTA 4XZ4A 3T8MA 3BINA 2INCC 4ICVA 3VVWB 2MWSB 3IAM1 3W1SA 2MHJA 1ZXHA 4JL9A 2IO1B 3KUZA 1STEA 4M0WB 2MCNB 1N5XA 4JGHB 2O2VA 1DOYA 3EHVA 1EWCA 2PW9A 4FHKA 2JXTA 4ZRQA 3DQVA 3I63C 4A90A 1K8RB 2K6DB 2ZPYA 2M0XA 2KNBA 3DVNU 3L4PA 4NJCA 3W1SC 1DOIA 1ET6A 2B3AA 4AUQC 1XD3B 2DLBA 1IGDA 4C00A 2KTRA 3Q3MC 3AU5A 3UGBB 1WYGA 4PS8A 2J42A 1KJTA 3IT6B 3ZO5B 2W54A 3W9CB 2KC2A 1T0YA 1WY8A 2INNE 4HPLB 4M00A 2KKCA 2DNFA 3PZDA 1WXQA 1RYJA 1RM6C 1R7SA 3U7DA 3VUXA 2IO2B 3HVZA 4AOFA 2A5UA 2M1MA 1L0VB 4MELA 3TL5A 1QKZA 3GE8C 4HLEA 1ZPSA 2N9PC 2R2OA 2WXHA 4OVVA 2SAKA 3L08A 3VAWA 1UWMA 2WU2B 3WAPA 2Z59B 2KFKA 1MHHE 4IOIE 2Y5BB 4ZRKA 1RRBA 2BQQA 2DYBA 1EU3A 2BWFA 4FADA 2D11A 3RULA 1N63A 1LXDA 2OHFA 2KOXA 2BYTA 4OHJA 3R7QA 4HKZE 2KT7A 2GLSA 2I1JA 2FE8A 2MP2B 2MJ3A 3AE4B 3ZRCA 1C3TA 3MHZA 5E6NA 1G6JA 1SXTA 2I38A 4PYUA 3VR8B 4ANVA 4MT5A 3T3OA 4FA6A 1Y8RC 2LASA 3K9PB 1GC6A 3OWEB 1SBBB 2BT6A 5BYQA 4IG7B 2KWDA 1WX7A 3ZRFA 2N9EB 2DZKA 1FXAA 2GBMA 1J7BA 3X23A 2M56B 5D7GA 2E6XA 3LB8C 3CWIA 2ZNVB 2N7EA 3B08A 4KGTA 2GMIC 2ON8A 3H9DA 3LDZE 1J7CA 1ZE3D 2KDIA 3ZKJC 3GZNI 3BYYB 4WAAA 1I4PA 2DZJA 3RN9C 1YN5A 1SSNA 3MJWA 4X57B 2KFJA 3A9KA 5FKAC 4B9KA 1UGJA 1QQRA 1FRRA 1U4AA 3EA6A 4W9DA 4ZOHC 1WF9A 3IXSA 5C3JB 4KKIA 4R3DA 2WXMA 2M19A 4IW0A 2L00B 3M3JA 3SFEB 3NVVA 2N9XA 4KV2A 4K7WA 3DBLI 2EKIA 1L5PA 5TR5A 2LHEA 4W9IA 2CKHB 3MHSD 5IAAC 3NVWA 5E6PA 3L16A 4HCNB 5AZHA 4ZYSA 3ZTCA 2KN4A 4M0WA 3GP7A 5FK9C 2N1WA 2IY1B 3AE7B 3AH7A 1L2NA 3B2GA 5FR6A 3AEEB 1C77A 4W9HA 1XT9B 4PK1A 1F0ZA 2R61A 3I5JC 3KH0A 2BGFA 2LRUA 3MC8A 2JRHA 3PRMB 1ET9A 1ZW7A 1I4QA 1V6EA 2J7QB 4I6LB 4HDQA 2PMVA 3ABVB 1TS3A 2JXXA 1WJUA 3ECIA 2K5PA 1UNSA 1L0YB 2W82A 2KDBA 2KLCA 1NEKB 1GAQB 2UYZB 1K52A 4JWSC 3PPAA 5LLIA 5AUKA 2KD0A 1XCQL 3ZNZB 4NY0A 2N7JA 2I2YA 1YJIA 4P1CC 3NHEB 1D4BA 1HE8A 3VRAB 3AE8B 2WXIA 2AQ2B 2KWUB 3VH4B 3WAOA 3JW0X 3KLSX 2MBBB 3AXCA 4A20A 4BOZB 1KLGD 3VTUA 3U30A 2BYEA 4BBNF 4FN2A 1EF5A 3AEFB 4W9EA 1QLBB 4DDID 1V1PB 3UIOB 4A3PA 4AP4C 1S3SG 1WXVA 4A8XC 2MP2A 2QSDA 4FULA 5JZEB 3ML8A 1EF1A 1K51A 1QZEA 2WHIA 4BOSC 1YMHE 2OEDA 1QOAA 3U8ZA 5DPWA 3RNFC 1VJKA 2AL6A 2KX0A 4AJWA 2DWQA 3WA0A 1I4RA 4MH0E 4P7IA 1PFDA 2L7RA 1GNUA 2G4DB 3AEDB 4DDGD 3RPFC 2L05A 1CJEA 2N9LA 1TS4A 1FNUA 2HE7A 4DHZE 5IN7A 2LFIA 3RZFA 3LYYA 2KMAA 2N9KA 1KLVA 5EDSA 3HUIA 2IO3B 4OVUA 1QOBA 3LXFA 2LVPA 5JHBA 4MSQB 1E7UA 3AB5A 3AE3B 3RT3B 3R2IA 1Y56A 2WU5B 2LI5A 2RDHA 1JROA 3ZUNA 4XDCA 3PLVA 5C23A 2KQSA 5C1ZA 4S0RA 4L1BA 5BYSA 1DYQA 2WXLA 3R2TA 4GU2A 4K81A 3QX1A 3N3KB 2K1FA 2ZNVC 4DBGA 1WGKA 1V86A 3EUB2 2G9HD 1ZP0B 2L83A 3WAMA 2Y3AA 3VHTC 2KVZA 2RMMA 3GZNB 2BKFA 3PS6A 4II2B 1SEBD 2CU3A 3HM3A 1GB1A 2DAFA 3Q69A 3OJ4B 1OGWA 3ONSA 3ZNHB 2WP9B 3Q6BA 2ZJDA 4GGQA 2KMMA 3DBHB 2Z0DB 2C60A 1ESFA 2K22A 2DZMA 2KO3A 1KH0A 1WR6E 4JIOU 3N1ZC 2H89B 4TUUA 2KFKB 4NAWB 4LLGM 3WANA 3HHMA 3NRZA 2JVCA 2MW5A 4II3B 4MGIE 3QJZA 1SIJA 2LEKA 2IBIB 3NVYA 2DBYA 1T0RC 2WYQA 1P7EA 3URYA 2BTEA 1WE7A 1D5MC 4P1BC 1PQSA 1AWDA 2BB5A 2JF5A 1AW7A 3DHHC 3GB1A 3P4SB 3T3NA 5CX3A 2QIEB 5BMGA 4IM3A 3O65B 1CQVA 4KDLB 1YN3A 1GOZA 2BKRB 3A1QB 3BZDB 3VQIA 3AECB 2WWZA 2JUOA 2KZRA 1Z2MA 3L10B 5BMHA 5GXGB 3J9CA 3M62B 4B0EA 4RFBA 2MJDA 2DYMA 1F2RC 2RDGA 3TBLD 1QF6A 1C4CA 5JH5C 3R66C 2WX1A 4EKUA 4W9JA 1E0ZA 1WJ6A 5CTRC 1P3QU 3PRPB 4USAA 1HA5A 3HRDD 3BVMA 3HIZA 4ARIA 2FCMA 5J2RA 1J7AA 2G45B 4EZKA 4GSWA 1C76A 5T8IA 2BF8B 3UQAA 1IUEA 2D5GA 1EU4A 1ZKHA 1V1PA 2BW2A 4K7UA 2ZZPB 4QAYA 1XLPA 2V4IB 2V9HA 4ZHPA 4P6VF 3N32A 2DENB 4WWPA 2HTHA 3NY5A 1JCKB 1VRAB 3PZ7A 2CJNA 3BVZA 3L0WB 2L0FA 1N60A 4M02A 1RAXA 4HK2A 3QCAA 1I4GA 1TY2A 3TSSA 1ZDXA 1WJNA 4L2YA 3NG0A 1P7FA 5D3IB 1TZOA 3KWLA 3EFUA 3IAS1 3ZNGC 4EEWA 2DX5B 3GOEA 2KDMA 3W5UB 2C7HA 1L0XB 2LMCA 2LUEA 2LD9A 3MP9A 3ZTDA 2ZCCA 3EECA 1R4NB 2JX5A 5BYRA 3VUWA 3ZXVA 5LXHA 1UZXB 4ZRPA 3ZW3A 2NTTA 4J6IA 1F2RI 1T6BX 3CF6E 1OEYA 2BVCA 1C4AA 1LGRA 3Q8AA 2WXGA 4IDIA 2DYOA 4E74A 4JWUC 1UGMA 4KGRA 4NQKE 3IT4B 1FD6A 2V4LA 1WFYA 4BKTA 3NS1A 2ACZB 2IYDB 1IYFA 1NI2A 2QILA 1WMHB 2ZW1A 3WALA 2FUHB 2J52A 2YVCA 1OQYA 1Q1OA 2Z8LA 3AU4A 1BXTA 2KC1A 2MBQA 2BS2B 2EMTA 4G11A 3AE1B 1YOVB 3KUCB 5AUIA 2EMSA 1TS2A 1FMAD 3TEWA 4FLHA 3N1YC 3VXWA 1WZ3A 4NAWA 3R8BA 1D5XC 3P4PB 1FM0D 2ZEQA 2TSSA 2K25A 2QHOA 1FPYA 2WXKA 4HDOA 2IGDA 3RI7C 4NAMA 4CO7A 3MC9A 1OTRB 3V05A 2KX3A 1YX6B 1I4XA 2NR2A 1E7PB 1XLOA 4DQOC 2BB6A 4BKSD 4N9F4 1ZOYB 1TKYA 1FEHA 3PT2B 5G2NA 2CR5A 1JRPA 4ICUA 4W9GA 3N1XC 4OW0A 2NCNA 1YJJA 5IO9A 4LDTB 1FIQA 1JQ4A 4IM2A 2WLBA 1SB3C 4F8CB 1E8ZA 3A1QA 5D3DA 1FXIA 1VR9A 1ROEA 4GMVA 1IBXB 3OAWA 4WWNA 1L6VA 2LXAA 4ZYNA 2J4XA 3ETRA 1IPGA 1TKEA 4MSMB 3VFKA 4YSYB 2QMTA 1L6UA 1V2YA 1KM7A 3QARA 4KKJA 3PV1A 4K3CA 4O1NA 1ZUD2 1UH6A 4MACA 5CHFA 3ENEA 2LGXA 3IG3A 3QQ8B 1LQBA 1FFUA 2K6QA 1TBEA 1PDXA 2DHZA 2NS5A 1OQQA 3W1YA 2GBKA 2JYTA 5DPRA 4TSSA 1JMLA 3WIMA 4G0NB 3DBHI 1YX5B 3PTFC 4LNIA 3A9JB 1H8CA 3AEBB 1GB4A 3DBRB 1TJEA 1MG8A 4NQLB 4AJYB 4BKSA 4KX6B 1WR1A 2PEAA 1V80A 5G5GA 3ZNID 2PE9A 4DWFA 1FNWA 4A6QA 2KJRA 3ZXRA 1J0GA 2D2QA 4K3BA 3QWZB 4REZA 2KJ6A 1HTOA 2CHZA 2WDTB 4RGOS 2XEWA 2KMCA 2JWZA 4LDTD 2AWTA 2LXCA 1ZDVA 3JVZX 1UUPA 3TEYA 4CHKA 3CSTA 2IJ0A 1UF0A 4URKA 4B6WA 5EE9A 4XWTA 1YQ3B 3VTWA 2JU6X 2EELA 4C80A 1R4MB 4LCDE 3NS8A 2MJEA 1ENFA 2NBUA 4ANUA 3AMZA 4MEMA 1PYWD 1OQRA 1QOGA 4N59A 2K39A 2ICIA 4IUMB 4A55A 4ACFA 3SHQA 2LGIA 2LUMA 4HPPA 3SEBA 2GOWA 3DVGX 3RYTA 3ZQ4A 1WMHA 1YNTE 4MJSB 4B95A 4NJ6A 4IKGA 1UBIA 4RM8A 1KFYB 2YEPB 2J53A 1XLNA 2N4FA 5DCNA 3SU8X 3I3TB 4UDUC 1YQ4B 2WXQA 3BY4B 4AQ7A 1WRIA 1SIFA 3H8HA 5MPOA 2W3RA 1RWSA 4KZCA 4YSZB 5HG2A 4YTMB 4HROA 1JWMD 2KLGA 3VR9B 4YL8A 3R3MA 5AZGA 1IP9A 2RGFA 2PVOD 4K1RB 4FJYA 1NI3A 3PO0A 3H1UA 5H8YE
chains in the Genus database with same CATH topology
1PQSA 2I1KA 5AEKB 4FJZA 5KHQA 2KTRA 2VRRB 1NDDA 2JF5A 2KANA 3AU5A 3UGBB 3RUIB 4PS8A 1KJTA 2MA9B 5CX3A 3ZO5B 3HM6X 3ML9A 4IC7B 2KC2A 1E90A 3Q3JA 1E8WA 4IM3A 1T0YA 1WY8A 3O65B 4HPLB 3UF8A 1WXAA 4KDLB 2KKCA 3PZDA 1BT0A 2UWQA 2BKRB 3A1QB 3Q3FA 3VQIA 3S2AA 2WWZA 4TV3A 2KHWB 2JUOA 2KZRA 1R4NI 2IY0B 3U7DA 3VUXA 2IO2B 1Z2MA 4AOFA 2A5UA 2M1MA 4M8NA 1VD2A 3C0RB 3K9OB 4MELA 3CMMB 2LVQA 1WXMA 3EC8A 3L10B 3TJPA 4G3XB 4MM3A 3TL5A 3T9LA 3M62B 4HLEA 3DCGA 2L76A 2DYMA 3TBLD 5JHAA 2N9PC 2LGYA 2BYFA 2R2OA 5JH5C 2NPTA 4OVVA 1P1AA 3L08A 3VAWA 3X0WA 3R66C 2XK5A 2MRPA 2Z59B 2KFKA 3WAPA 4BKGA 2WX1A 2PE6B 2ZCBA 2O6VA 4EKUA 2Y5BB 4LJPB 4W9JA 1WJ6A 3QAQA 4ZRKA 1RRBA 1NBFC 1FXTB 5CTRC 1P3QU 3PRPB 4E71A 3ZLZA 3OJ3A 2V1YA 2DYBA 3HIZA 2FCMA 4RMAA 5J2RA 2BWFA 4FADA 2G45B 4EZKA 2AEHA 3V62A 2D11A 4GSWA 3RULA 2BF8B 5KHOA 1LXDA 3UQAA 2KOXA 5L83A 3UIPB 2AL3A 2YLMA 1ZKHA 4EZLA 1WH3A 3R7QA 2K8HA 4K7UA 1A5RA 4DK5A 1LFDA 1WX9A 2ZZPB 3A9JA 1EUVB 2I1JA 2MP2B 3ZRCA 4G50A 1C3TA 3DOWA 4I6NB 3N32A 5E6NA 1G6JA 4WQOB 4HXDA 3A4RA 1V49A 2DENB 2HTHA 4PYUA 4WWPA 2RSUA 4ANVA 1Q5WB 3NY5A 2KVRA 1SE9A 3RZWC 3DPDA 4FA6A 3UINB 1Y8RC 2LASA 4GN1A 5LXIB 4IWOA 3UQBA 3K9PB 3L0WB 4F7ZA 4DHJD 2L0FA 1GC6A 4ANXA 2KXJA 2Z0EB 1RAXA 4HK2A 1SGHA 3PGEA 3QCAA 2C5LC 1VCBA 3H7PB 4EUTA 3JYUA 1WJNA 4IG7B 1WX8A 5J18A 1WE6A 4E3CA 1WX7A 3QK0A 3ZRFA 2N9EB 2DZKA 1UD7A 2NBWB 3EFUA 2ZVNA 3ZNGC 4EEWA 2DX5B 2L8JA 2L0TA 2GBMA 4W9LA 3GOEA 2HD5B 3X23A 5D7GA 2C7HA 5BO4B 3A4SC 2LUEA 4KIKA 2LD9A 4GIVA 3ZTDA 4HCPB 2BWES 2ZCCA 3EECA 4PS3A 2ZNVB 3JSVB 4PYZA 2N7EA 1P9DU 3B08A 4I6PA 1V9JA 2GMIC 3VUWA 5HKHA 5LXHA 1UZXB 2D07B 2DAJA 3H9DA 3LDZE 3ZW3A 2MX2A 2BYVE 3KYDD 1UELA 2KDFB 2KTFA 4J6IA 2KDIA 4GXBA 2CHXA 3DBSA 3ZKJC 3GZNI 2IZVB 3CF6E 4WAAA 1OEYA 2DZJA 4FHJA 3A33B 1Z5SB 3MJWA 4ZRJA 4X57B 2AYOB 1GG3A 2MLBA 2KFJA 3A9KA 3KYCD 4B9KA 1P0RA 1U4AA 4TKNA 3NZUA 2DYOA 4E74A 2N7DA 4AWJA 2JPHA 3IFWB 2K8BA 4W9DA 1WF9A 1UGMA 4NQKE 2ASQA 1CMXB 2V4LA 1WFYA 4BKTA 2M4NA 2IYDB 1IYFA 1NI2A 2RD0A 2J0KA 1YQBA 2OJRA 4WJQA 4MJSA 1WMHB 3WALA 4NJ7A 4IW0A 2FCNA 2FUHB 3H7SA 2YVCA 1OQYA 1Q1OA 2L00B 5D6JB 5L95C 3M3JA 3AU4A 2KC1A 2MBQA 2N9XA 2EMTA 4G11A 1WZ0A 3IVFA 2JY6A 2NBVB 4KV2A 4K7WA 3DBLI 5IA7A 3KUCB 4IWQA 5TR5A 2KK8A 4DHZB 2G3QB 4W9IA 4GDLA 2EMSA 3P2BA 3ALBA 1L7YA 4KZ0A 2CKHB 2MBEA 4W9CA 3B1LX 3MHSD 5IAAC 2RR9A 4FLHA 5AZFA 2ZPNA 3VXWA 1WZ3A 4NAWA 2BPSA 4MGKE 5E6PA 3L16A 4HCNB 3PVLA 1WGHA 3LJ3A 5AZHA 3SD5A 3ZTCA 3NZSA 2ZEQA 4BVUC 4NNJB 2K25A 2QHOA 3PHWB 2FCQA 3D32A 4PS7A 4HDOA 2O2VB 2N1WA 2GBJA 5E6OA 2FIDA 2IY1B 2JZZA 2PPHA 3AULA 3APFA 3DBRI 3RD2A 3V6EB 4CO7A 1OTRB 4K7SA 1TZ1A 1WIAA 1YX6B 2KX3A 1L2NA 3VDZA 3DVGY 5FR6A 4W9HA 1XT9B 2NR2A 3DVNV 1GUAB 4BBNC 4BKSD 4N9F4 3V6CB 3KH0A 4EFOA 3N30A 1V5TA 2BGFA 2LRUA 3L13A 3PT2B 2JRHA 3PRMB 4IWPA 5G2NA 1ZW7A 2CR5A 5CHVC 2KTRB 1WXSA 3DDCB 1V6EA 2J7QB 4I6LB 4ICUA 4W9GA 1RFAA 2KDEB 2NCNA 3L17A 4HDQA 1WYWB 5D94A 4LDTB 4IM2A 3AI5A 4KSLC 5GMVA 4KVGB 2FAZA 4KSKC 2JXXA 4F8CB 1E8ZA 1E8XA 1WJUA 2FIFA 3ECIA 3A1QA 3IBEA 2MQJA 2G4SA 2J0MA 3VUYA 4RM9A 2LGDA 2PJHA 2KDBA 1XQQA 4GMVA 2KLCA 3ZVVA 2V3SA 3OAWA 2UYZB 4WWNA 3KVFB 3ZIMA 2JT4B 3PPAA 5LLIA 3CSFA 1JRUA 1GC7A 2KD0A 1E8YA 2RPQA 2LXAA 2NVUI 3ZNZB 4ZYNA 1X1MA 2LVOA 4NY0A 4WJPA 1M94A 1YIWA 1IPGA 4TQ0A 4JQWC 4MSMB 4XC2A 3R7RA 3VFKA 2CHWA 2EKEC 3NHEB 2C7NB 2KQ7A 1YD8U 3ZDTA 1HE8A 1R4MI 1V2YA 2D10A 1P98A 4GDKB 4GOCA 3KUDB 2NPTB 4EOYA 1KM7A 3HK0A 3QARA 1J8CA 3TIXA 2KWUB 2XK5B 2R2QA 3PV1A 5DPSA 3VH4B 3WAOA 4MGYE 3JW0X 2MBBB 3AXCA 4LJOB 3ZDMC 2O6VB 1UH6A 4A20A 2ZVOA 4BOZB 5CHFA 3IHPC 3QHTA 3ENEA 3VTUA 3PSEB 2LGXA 3IG3A 3QQ8B 1EO6A 2BYEA 1LQBA 3U30A 4BBNF 2KWCA 2K6QA 1WJ4A 4FN2A 1TBEA 3VTVA 1EF5A 2CU1A 2DHZA 2M17A 2NS5A 4ZRIA 1F9JA 1KOTA 3W1YA 3APCA 4W9EA 4CYEA 2FNJB 2GBKA 5DPRA 3WIMA 4DDID 1S1QB 4HPMB 3UIOB 2KWVB 4A3PA 1S3SG 4AP4C 3V61A 1WXVA 1H4RA 4G0NB 3DBHI 1TTNA 1YX5B 3OLMD 3PTFC 4HWIB 2MP2A 3A9JB 4FULA 1H8CA 5JZEB 4EZJA 1ZGUB 2REXA 3ML8A 4IM0A 4BFRA 1EF1A 2J0JA 2MBHA 1QZEA 4BOSC 1RLFA 1C1YB 1UBQA 1MG8A 3U8ZA 5DPWA 2GBRA 4NQLB 4AJYB 2AL6A 1E7VA 3TMPB 4BKSA 2KX0A 1WR1A 1V5OA 4AJWA 2PEAA 1V80A 2C7MB 3ZNID 3WA0A 2PE9A 4DWFA 4MH0E 2DZIA 3H7PA 4P7IA 2CS4A 2L7RA 5CHWA 4XX5A 2LZ6A 4TQ1A 5J17A 1GNUA 4F1SA 2WX0A 2G4DB 1ISNA 2KJRA 3H6NA 2C9WB 4DDGD 1J0GA 2D2QA 2L05A 3QWZB 3VH3B 2JZ3B 2KJ6A 1WGRA 2KJHB 3SDLC 4HVBA 2HE7A 4DHZE 2CHZA 1WM2A 2WDTB 4W9KA 1I35A 3QA8A 3RZFA 2KMAA 2M8SA 4KIKB 3PLUA 2XEWA 4W9FA 3M95A 1KLVA 2KMCA 5EDSA 4GDKA 3JSVA 2IO3B 2JWZA 3L54A 4OVUA 4LDTD 2AWTA 2LXCA 2LVPA 2IO0B 3JVZX 5JHBA 4MSQB 4CHKA 3CSTA 1E7UA 3RT3B 2HJ8A 4B6WA 4URKA 3PHXB 3NOBA 2GBNA 3QC8B 1WM3A 1WGDA 2LI5A 4FBJB 3VTWA 3ZUNA 5G55A 1LM8B 3PLVA 5C23A 2L3ZA 4HJKA 2KQSA 5C1ZA 1E5WA 1WGGA 2LJ5A 3MTNB 1YJ1A 2LRWA 2LWPA 3B0AA 3NS8A 4LCDE 3A9KB 4GB9A 2NBUA 4ANUA 4GU2A 4K81A 3QX1A 4MEMA 3N3KB 2K1FA 2ZNVC 2D3GA 3V60A 4DBGA 2K39A 4ANWA 4IUMB 1V86A 2FCSA 2N1VA 3SHQA 1WRDB 2W9NA 3WAMA 3VHTC 4WJNA 3RCZA 2BKFA 2MBOA 1GJZA 3PS6A 4DXAB 4MGZE 2GOWA 4II2B 4MDKE 3DVGX 3RYTA 2XBBC 3TCAA 4WWOA 3HM3A 1WMHA 4ASWC 1V81A 2JRIB 4MJSB 2DAFA 4B95A 3OJ4B 1OGWA 4M8MA 4NJ6A 3T8MA 3ONSA 4JLCA 1UBIA 3KW5B 4RM8A 3ZNHB 1J19A 1WGYA 2O6VD 2ZJDA 4GGQA 2Z0DB 1AARA 2KN5A 2C60A 5DPTA 2DZMA 2N4FA 4XZ4A 2OOBB 5DCNA 3M63B 3SU8X 4NPNA 3I3TB 4GDLB 2KO3A 3BINA 4ICVA 5D2MB 3VVWB 1I42A 1WR6E 2MSED 1OEYJ 2MWSB 3PRZA 3QIJA 4JIOU 3BY4B 4TUUA 3W1SA 2KFKB 4NAWB 3WANA 1WI0A 2IO1B 4JL9A 3KUZA 1Q0WB 1D3ZA 3HHMA 1TGZB 2JVCA 2MW5A 1SIFA 4II3B 4M0WB 4MGIE 2MCNB 4JGHB 2O2VA 4DHJB 3QJZA 3EHVA 4KZCA 4FHKA 2IBIB 2KLGA 2K8CA 3APDA 4WJOA 3DQVA 3R3MA 4YL8A 5AZGA 1IP9A 3PREA 4KDIC 1K8RB 2K6DB 2ZPYA 2RGFA 4FJYA 4K1RB 2M0XA 2WYQA 4A3OA 2KNBA 4FJVB 3DVNU 3W1SC 4AUQC 1WE7A 2B3AA 1XD3B 3H1UA 4ZDVA 2A4ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PQS A;  2I1K A;  5AEK B;  4FJZ A;  5KHQ A;  2KTR A;  2VRR B;  1NDD A;  2JF5 A;  2KAN A;  3AU5 A;  3UGB B;  3RUI B;  4PS8 A;  1KJT A;  2MA9 B;  5CX3 A;  3ZO5 B;  3HM6 X;  3ML9 A;  4IC7 B;  2KC2 A;  1E90 A;  3Q3J A;  1E8W A;  4IM3 A;  1T0Y A;  1WY8 A;  3O65 B;  4HPL B;  3UF8 A;  1WXA A;  4KDL B;  2KKC A;  3PZD A;  1BT0 A;  2UWQ A;  2BKR B;  3A1Q B;  3Q3F A;  3VQI A;  3S2A A;  2WWZ A;  4TV3 A;  2KHW B;  2JUO A;  2KZR A;  1R4N I;  2IY0 B;  3U7D A;  3VUX A;  2IO2 B;  1Z2M A;  4AOF A;  2A5U A;  2M1M A;  4M8N A;  1VD2 A;  3C0R B;  3K9O B;  4MEL A;  3CMM B;  2LVQ A;  1WXM A;  3EC8 A;  3L10 B;  3TJP A;  4G3X B;  4MM3 A;  3TL5 A;  3T9L A;  3M62 B;  4HLE A;  3DCG A;  2L76 A;  2DYM A;  3TBL D;  5JHA A;  2N9P C;  2LGY A;  2BYF A;  2R2O A;  5JH5 C;  2NPT A;  4OVV A;  1P1A A;  3L08 A;  3VAW A;  3X0W A;  3R66 C;  2XK5 A;  2MRP A;  2Z59 B;  2KFK A;  3WAP A;  4BKG A;  2WX1 A;  2PE6 B;  2ZCB A;  2O6V A;  4EKU A;  2Y5B B;  4LJP B;  4W9J A;  1WJ6 A;  3QAQ A;  4ZRK A;  1RRB A;  1NBF C;  1FXT B;  5CTR C;  1P3Q U;  3PRP B;  4E71 A;  3ZLZ A;  3OJ3 A;  2V1Y A;  2DYB A;  3HIZ A;  2FCM A;  4RMA A;  5J2R A;  2BWF A;  4FAD A;  2G45 B;  4EZK A;  2AEH A;  3V62 A;  2D11 A;  4GSW A;  3RUL A;  2BF8 B;  5KHO A;  1LXD A;  3UQA A;  2KOX A;  5L83 A;  3UIP B;  2AL3 A;  2YLM A;  1ZKH A;  4EZL A;  1WH3 A;  3R7Q A;  2K8H A;  4K7U A;  1A5R A;  4DK5 A;  1LFD A;  1WX9 A;  2ZZP B;  3A9J A;  1EUV B;  2I1J A;  2MP2 B;  3ZRC A;  4G50 A;  1C3T A;  3DOW A;  4I6N B;  3N32 A;  5E6N A;  1G6J A;  4WQO B;  4HXD A;  3A4R A;  1V49 A;  2DEN B;  2HTH A;  4PYU A;  4WWP A;  2RSU A;  4ANV A;  1Q5W B;  3NY5 A;  2KVR A;  1SE9 A;  3RZW C;  3DPD A;  4FA6 A;  3UIN B;  1Y8R C;  2LAS A;  4GN1 A;  5LXI B;  4IWO A;  3UQB A;  3K9P B;  3L0W B;  4F7Z A;  4DHJ D;  2L0F A;  1GC6 A;  4ANX A;  2KXJ A;  2Z0E B;  1RAX A;  4HK2 A;  1SGH A;  3PGE A;  3QCA A;  2C5L C;  1VCB A;  3H7P B;  4EUT A;  3JYU A;  1WJN A;  4IG7 B;  1WX8 A;  5J18 A;  1WE6 A;  4E3C A;  1WX7 A;  3QK0 A;  3ZRF A;  2N9E B;  2DZK A;  1UD7 A;  2NBW B;  3EFU A;  2ZVN A;  3ZNG C;  4EEW A;  2DX5 B;  2L8J A;  2L0T A;  2GBM A;  4W9L A;  3GOE A;  2HD5 B;  3X23 A;  5D7G A;  2C7H A;  5BO4 B;  3A4S C;  2LUE A;  4KIK A;  2LD9 A;  4GIV A;  3ZTD A;  4HCP B;  2BWE S;  2ZCC A;  3EEC A;  4PS3 A;  2ZNV B;  3JSV B;  4PYZ A;  2N7E A;  1P9D U;  3B08 A;  4I6P A;  1V9J A;  2GMI C;  3VUW A;  5HKH A;  5LXH A;  1UZX B;  2D07 B;  2DAJ A;  3H9D A;  3LDZ E;  3ZW3 A;  2MX2 A;  2BYV E;  3KYD D;  1UEL A;  2KDF B;  2KTF A;  4J6I A;  2KDI A;  4GXB A;  2CHX A;  3DBS A;  3ZKJ C;  3GZN I;  2IZV B;  3CF6 E;  4WAA A;  1OEY A;  2DZJ A;  4FHJ A;  3A33 B;  1Z5S B;  3MJW A;  4ZRJ A;  4X57 B;  2AYO B;  1GG3 A;  2MLB A;  2KFJ A;  3A9K A;  3KYC D;  4B9K A;  1P0R A;  1U4A A;  4TKN A;  3NZU A;  2DYO A;  4E74 A;  2N7D A;  4AWJ A;  2JPH A;  3IFW B;  2K8B A;  4W9D A;  1WF9 A;  1UGM A;  4NQK E;  2ASQ A;  1CMX B;  2V4L A;  1WFY A;  4BKT A;  2M4N A;  2IYD B;  1IYF A;  1NI2 A;  2RD0 A;  2J0K A;  1YQB A;  2OJR A;  4WJQ A;  4MJS A;  1WMH B;  3WAL A;  4NJ7 A;  4IW0 A;  2FCN A;  2FUH B;  3H7S A;  2YVC A;  1OQY A;  1Q1O A;  2L00 B;  5D6J B;  5L95 C;  3M3J A;  3AU4 A;  2KC1 A;  2MBQ A;  2N9X A;  2EMT A;  4G11 A;  1WZ0 A;  3IVF A;  2JY6 A;  2NBV B;  4KV2 A;  4K7W A;  3DBL I;  5IA7 A;  3KUC B;  4IWQ A;  5TR5 A;  2KK8 A;  4DHZ B;  2G3Q B;  4W9I A;  4GDL A;  2EMS A;  3P2B A;  3ALB A;  1L7Y A;  4KZ0 A;  2CKH B;  2MBE A;  4W9C A;  3B1L X;  3MHS D;  5IAA C;  2RR9 A;  4FLH A;  5AZF A;  2ZPN A;  3VXW A;  1WZ3 A;  4NAW A;  2BPS A;  4MGK E;  5E6P A;  3L16 A;  4HCN B;  3PVL A;  1WGH A;  3LJ3 A;  5AZH A;  3SD5 A;  3ZTC A;  3NZS A;  2ZEQ A;  4BVU C;  4NNJ B;  2K25 A;  2QHO A;  3PHW B;  2FCQ A;  3D32 A;  4PS7 A;  4HDO A;  2O2V B;  2N1W A;  2GBJ A;  5E6O A;  2FID A;  2IY1 B;  2JZZ A;  2PPH A;  3AUL A;  3APF A;  3DBR I;  3RD2 A;  3V6E B;  4CO7 A;  1OTR B;  4K7S A;  1TZ1 A;  1WIA A;  1YX6 B;  2KX3 A;  1L2N A;  3VDZ A;  3DVG Y;  5FR6 A;  4W9H A;  1XT9 B;  2NR2 A;  3DVN V;  1GUA B;  4BBN C;  4BKS D;  4N9F 4;  3V6C B;  3KH0 A;  4EFO A;  3N30 A;  1V5T A;  2BGF A;  2LRU A;  3L13 A;  3PT2 B;  2JRH A;  3PRM B;  4IWP A;  5G2N A;  1ZW7 A;  2CR5 A;  5CHV C;  2KTR B;  1WXS A;  3DDC B;  1V6E A;  2J7Q B;  4I6L B;  4ICU A;  4W9G A;  1RFA A;  2KDE B;  2NCN A;  3L17 A;  4HDQ A;  1WYW B;  5D94 A;  4LDT B;  4IM2 A;  3AI5 A;  4KSL C;  5GMV A;  4KVG B;  2FAZ A;  4KSK C;  2JXX A;  4F8C B;  1E8Z A;  1E8X A;  1WJU A;  2FIF A;  3ECI A;  3A1Q A;  3IBE A;  2MQJ A;  2G4S A;  2J0M A;  3VUY A;  4RM9 A;  2LGD A;  2PJH A;  2KDB A;  1XQQ A;  4GMV A;  2KLC A;  3ZVV A;  2V3S A;  3OAW A;  2UYZ B;  4WWN A;  3KVF B;  3ZIM A;  2JT4 B;  3PPA A;  5LLI A;  3CSF A;  1JRU A;  1GC7 A;  2KD0 A;  1E8Y A;  2RPQ A;  2LXA A;  2NVU I;  3ZNZ B;  4ZYN A;  1X1M A;  2LVO A;  4NY0 A;  4WJP A;  1M94 A;  1YIW A;  1IPG A;  4TQ0 A;  4JQW C;  4MSM B;  4XC2 A;  3R7R A;  3VFK A;  2CHW A;  2EKE C;  3NHE B;  2C7N B;  2KQ7 A;  1YD8 U;  3ZDT A;  1HE8 A;  1R4M I;  1V2Y A;  2D10 A;  1P98 A;  4GDK B;  4GOC A;  3KUD B;  2NPT B;  4EOY A;  1KM7 A;  3HK0 A;  3QAR A;  1J8C A;  3TIX A;  2KWU B;  2XK5 B;  2R2Q A;  3PV1 A;  5DPS A;  3VH4 B;  3WAO A;  4MGY E;  3JW0 X;  2MBB B;  3AXC A;  4LJO B;  3ZDM C;  2O6V B;  1UH6 A;  4A20 A;  2ZVO A;  4BOZ B;  5CHF A;  3IHP C;  3QHT A;  3ENE A;  3VTU A;  3PSE B;  2LGX A;  3IG3 A;  3QQ8 B;  1EO6 A;  2BYE A;  1LQB A;  3U30 A;  4BBN F;  2KWC A;  2K6Q A;  1WJ4 A;  4FN2 A;  1TBE A;  3VTV A;  1EF5 A;  2CU1 A;  2DHZ A;  2M17 A;  2NS5 A;  4ZRI A;  1F9J A;  1KOT A;  3W1Y A;  3APC A;  4W9E A;  4CYE A;  2FNJ B;  2GBK A;  5DPR A;  3WIM A;  4DDI D;  1S1Q B;  4HPM B;  3UIO B;  2KWV B;  4A3P A;  1S3S G;  4AP4 C;  3V61 A;  1WXV A;  1H4R A;  4G0N B;  3DBH I;  1TTN A;  1YX5 B;  3OLM D;  3PTF C;  4HWI B;  2MP2 A;  3A9J B;  4FUL A;  1H8C A;  5JZE B;  4EZJ A;  1ZGU B;  2REX A;  3ML8 A;  4IM0 A;  4BFR A;  1EF1 A;  2J0J A;  2MBH A;  1QZE A;  4BOS C;  1RLF A;  1C1Y B;  1UBQ A;  1MG8 A;  3U8Z A;  5DPW A;  2GBR A;  4NQL B;  4AJY B;  2AL6 A;  1E7V A;  3TMP B;  4BKS A;  2KX0 A;  1WR1 A;  1V5O A;  4AJW A;  2PEA A;  1V80 A;  2C7M B;  3ZNI D;  3WA0 A;  2PE9 A;  4DWF A;  4MH0 E;  2DZI A;  3H7P A;  4P7I A;  2CS4 A;  2L7R A;  5CHW A;  4XX5 A;  2LZ6 A;  4TQ1 A;  5J17 A;  1GNU A;  4F1S A;  2WX0 A;  2G4D B;  1ISN A;  2KJR A;  3H6N A;  2C9W B;  4DDG D;  1J0G A;  2D2Q A;  2L05 A;  3QWZ B;  3VH3 B;  2JZ3 B;  2KJ6 A;  1WGR A;  2KJH B;  3SDL C;  4HVB A;  2HE7 A;  4DHZ E;  2CHZ A;  1WM2 A;  2WDT B;  4W9K A;  1I35 A;  3QA8 A;  3RZF A;  2KMA A;  2M8S A;  4KIK B;  3PLU A;  2XEW A;  4W9F A;  3M95 A;  1KLV A;  2KMC A;  5EDS A;  4GDK A;  3JSV A;  2IO3 B;  2JWZ A;  3L54 A;  4OVU A;  4LDT D;  2AWT A;  2LXC A;  2LVP A;  2IO0 B;  3JVZ X;  5JHB A;  4MSQ B;  4CHK A;  3CST A;  1E7U A;  3RT3 B;  2HJ8 A;  4B6W A;  4URK A;  3PHX B;  3NOB A;  2GBN A;  3QC8 B;  1WM3 A;  1WGD A;  2LI5 A;  4FBJ B;  3VTW A;  3ZUN A;  5G55 A;  1LM8 B;  3PLV A;  5C23 A;  2L3Z A;  4HJK A;  2KQS A;  5C1Z A;  1E5W A;  1WGG A;  2LJ5 A;  3MTN B;  1YJ1 A;  2LRW A;  2LWP A;  3B0A A;  3NS8 A;  4LCD E;  3A9K B;  4GB9 A;  2NBU A;  4ANU A;  4GU2 A;  4K81 A;  3QX1 A;  4MEM A;  3N3K B;  2K1F A;  2ZNV C;  2D3G A;  3V60 A;  4DBG A;  2K39 A;  4ANW A;  4IUM B;  1V86 A;  2FCS A;  2N1V A;  3SHQ A;  1WRD B;  2W9N A;  3WAM A;  3VHT C;  4WJN A;  3RCZ A;  2BKF A;  2MBO A;  1GJZ A;  3PS6 A;  4DXA B;  4MGZ E;  2GOW A;  4II2 B;  4MDK E;  3DVG X;  3RYT A;  2XBB C;  3TCA A;  4WWO A;  3HM3 A;  1WMH A;  4ASW C;  1V81 A;  2JRI B;  4MJS B;  2DAF A;  4B95 A;  3OJ4 B;  1OGW A;  4M8M A;  4NJ6 A;  3T8M A;  3ONS A;  4JLC A;  1UBI A;  3KW5 B;  4RM8 A;  3ZNH B;  1J19 A;  1WGY A;  2O6V D;  2ZJD A;  4GGQ A;  2Z0D B;  1AAR A;  2KN5 A;  2C60 A;  5DPT A;  2DZM A;  2N4F A;  4XZ4 A;  2OOB B;  5DCN A;  3M63 B;  3SU8 X;  4NPN A;  3I3T B;  4GDL B;  2KO3 A;  3BIN A;  4ICV A;  5D2M B;  3VVW B;  1I42 A;  1WR6 E;  2MSE D;  1OEY J;  2MWS B;  3PRZ A;  3QIJ A;  4JIO U;  3BY4 B;  4TUU A;  3W1S A;  2KFK B;  4NAW B;  3WAN A;  1WI0 A;  2IO1 B;  4JL9 A;  3KUZ A;  1Q0W B;  1D3Z A;  3HHM A;  1TGZ B;  2JVC A;  2MW5 A;  1SIF A;  4II3 B;  4M0W B;  4MGI E;  2MCN B;  4JGH B;  2O2V A;  4DHJ B;  3QJZ A;  3EHV A;  4KZC A;  4FHK A;  2IBI B;  2KLG A;  2K8C A;  3APD A;  4WJO A;  3DQV A;  3R3M A;  4YL8 A;  5AZG A;  1IP9 A;  3PRE A;  4KDI C;  1K8R B;  2K6D B;  2ZPY A;  2RGF A;  4FJY A;  4K1R B;  2M0X A;  2WYQ A;  4A3O A;  2KNB A;  4FJV B;  3DVN U;  3W1S C;  4AUQ C;  1WE7 A;  2B3A A;  1XD3 B;  3H1U A;  4ZDV A;  2A4Z A; 
#chains in the Genus database with same CATH topology
 4FJZ A;  2VRR B;  4US8 A;  2KAN A;  2VH2 A;  3RUI B;  2VZK B;  2MA9 B;  3ML9 A;  3Q3J A;  5IA7 A;  1E8W A;  3UF8 A;  1WXA A;  4BAX A;  1BT0 A;  2UWQ A;  3FIL B;  1FCC C;  3S2A A;  2UU7 A;  1KF6 B;  2KAJ A;  3O13 A;  1R4N I;  4YWG G;  4Q2J A;  1IBX A;  1VZ8 A;  1XEE A;  4M8N A;  1VD2 A;  4TMA B;  3C0R B;  3CMM B;  1WXM A;  3EC8 A;  4DXF A;  4G3X B;  3T9L A;  3B9J A;  2QC8 A;  4OVZ A;  2IGG A;  3DCG A;  1T0Q C;  5JHA A;  1IGC A;  1PGA A;  1JWU D;  2G1E A;  1P1A A;  1E6E B;  3X0W A;  2MRP A;  1WWT A;  3BK2 A;  2PE6 B;  1JWS D;  2ZCB A;  4YXD B;  4LJP B;  3QAQ A;  4E71 A;  1NBF C;  1FXT B;  2AX5 A;  3Q8C A;  4AS1 A;  3ZLZ A;  3OJ3 A;  4RMA A;  1WSP A;  2JQR B;  2FBW B;  5L83 A;  4RGT A;  3UIP B;  2AL3 A;  1CK1 A;  3U2S C;  1WH3 A;  2K8H A;  1A5R A;  4DK5 A;  1WX9 A;  4D2K A;  3A9J A;  4XE0 A;  2L1A A;  4RF0 A;  1EUV B;  5E6J A;  3DOW A;  4I6N B;  3A4R A;  3ZJV A;  4HKQ A;  1SE9 A;  4JPS A;  3DPD A;  5C2T B;  3UIN B;  4GN1 A;  3UQB A;  4F7Z A;  4C4V B;  5EE3 A;  2KXJ A;  1UWX A;  1SGH A;  2C5L C;  1Q10 A;  1VCB A;  1C78 A;  1QIL A;  4M01 A;  4NZL B;  3P63 A;  1RFK A;  3TEZ A;  1WX8 A;  5J18 A;  3DHG C;  3OG5 A;  4XYC A;  2IDY A;  1K53 A;  2WDR B;  1JW9 D;  2L0T A;  3A4S C;  4GIV A;  2W3S A;  2BWE S;  2CJO A;  2VZK D;  1SE2 A;  4PS3 A;  3ZYY X;  4C7Y A;  4PYZ A;  2SEB D;  3KQ4 A;  5HKH A;  3DWM A;  2DAJ A;  2RDB C;  3Q14 C;  2MX2 A;  1UEL A;  4GXB A;  3BYT B;  3DBS A;  2LJI A;  3P4Q B;  2IZV B;  4FHJ A;  3A33 B;  4WQM A;  4ZRJ A;  2AYO B;  1GG3 A;  3BVG A;  2WNM A;  3E56 A;  4TKN A;  2BS4 B;  3NZU A;  2N7D A;  2FUG 1;  2JYE A;  2JPH A;  2K8B A;  2ASQ A;  3RFZ B;  2WXO A;  2RD0 A;  4WJQ A;  4MJS A;  1E10 A;  3FC4 A;  2FCN A;  5L95 C;  1MJD A;  1MI0 A;  2OJW A;  1WZ0 A;  3IVF A;  2NBV B;  4CQN A;  4IWQ A;  2MEK A;  4DHZ B;  3ALB A;  4W9C A;  3FAH A;  4YTN B;  2RR9 A;  2ZPN A;  4JE3 B;  3PVL A;  3LJ3 A;  3RNE C;  3SD5 A;  3NZS A;  4RF1 A;  2QEJ C;  3PHW B;  3GS2 A;  2FCQ A;  3D32 A;  4PS7 A;  2FID A;  3AUL A;  2JSV X;  2PPH A;  3APF A;  3DBR I;  3RD2 A;  3V6E B;  4JX1 C;  4K7S A;  1NYR A;  3Q3O C;  3DVN V;  1GUA B;  4BBN C;  1XLQ A;  2WXP A;  3C19 A;  3AN1 A;  3N30 A;  1V5T A;  3L13 A;  1NVI D;  3AE2 B;  1F1H A;  1HTQ A;  1RFA A;  5IOI A;  1WYW B;  1SJH D;  5D94 A;  5GMV A;  2QCZ A;  4KVG B;  2GRI A;  3TEX A;  4OZB A;  3FIL A;  2MQJ A;  3VUY A;  4RM9 A;  1F77 A;  4S17 A;  4US9 A;  5BMI A;  2V3S A;  2JT4 B;  2ONQ A;  1GC7 A;  1FFV A;  2H88 B;  4BZA A;  1CZP A;  2NVU I;  1EM7 A;  2LVO A;  1FRD A;  4MM3 B;  4WJP A;  1YIW A;  4XC2 A;  2BS3 B;  2CHW A;  1PGX A;  3W2D A;  3ZDT A;  4GOC A;  1R4M I;  1P98 A;  3KUD B;  2NPT B;  3HK0 A;  1JWA D;  2XK5 B;  5DPS A;  3N9Y C;  4LJO B;  3ZDM C;  2O6V B;  3IHP C;  1EO6 A;  1QT9 A;  2M17 A;  2Q5W D;  1KOT A;  4L23 A;  4HPM B;  2PTL A;  2KWV B;  3U52 E;  3V61 A;  1H4R A;  2WDQ B;  1TTN A;  3OLM D;  1L4D B;  2XNA C;  3GE3 C;  3EGR A;  4HWI B;  4LNO A;  4OZA A;  4EZJ A;  1ZGU B;  2MBH A;  1FCL A;  1RLF A;  1UBQ A;  2GBR A;  3AE6 B;  1E7V A;  4WWM A;  3RNA C;  3TMP B;  2WQY B;  4C4V A;  3RNG C;  2Y5P A;  1C9F A;  2DZI A;  2CS4 A;  5J17 A;  2V3P A;  2D3C A;  3Q8F A;  1ISN A;  5HHD G;  2C9W B;  3I9V 1;  2JZ3 B;  3BWU D;  2IPK D;  4WH4 A;  2KJH B;  3SDL C;  4HVB A;  4W9K A;  2MH7 A;  3QA8 A;  1I35 A;  2M8S A;  4KIK B;  4W9F A;  4GDK A;  2WXJ A;  1B9R A;  2IO0 B;  4GLS C;  4ITK A;  1WM3 A;  1WGD A;  4LNN A;  3VRB B;  4FBJ B;  2NTS A;  1LM8 B;  4HJK A;  2WXN A;  1E5W A;  2LJ5 A;  3MTN B;  3U4E G;  3MJ5 A;  1YJ1 A;  1JAL A;  3B0A A;  3V60 A;  2D3G A;  4ANW A;  2BBC A;  3P42 A;  2FCS A;  2JWU A;  1M4V A;  1PGB A;  1KLU D;  1WRD B;  3KWV A;  4WJN A;  3RCZ A;  2MBO A;  4DXA B;  4MGZ E;  2XBB C;  3TCA A;  1V81 A;  2JRI B;  4JLC A;  3KW5 B;  1XO3 A;  1MFW A;  2O6V D;  3PZ8 A;  3BII D;  1AAR A;  2OOB B;  3M63 B;  4YT0 B;  4NPN A;  4GDL B;  5D2M B;  1I42 A;  2MSE D;  3PRZ A;  1OEY J;  3QIJ A;  1D6E C;  2B76 B;  2INP E;  1MG4 A;  1WI0 A;  3E9S A;  1Q0W B;  1D3Z A;  1DGJ A;  1TGZ B;  3FKY A;  4DHJ B;  4A9A A;  3WCQ A;  2K8C A;  3APD A;  4WJO A;  3U7Z A;  3PRE A;  4KDI C;  2GB1 A;  4A3O A;  4FJV B;  1VZ7 A;  1KRH A;  2D3B A;  2N0S B;  2PIA A;  3NUH B;  1SE4 A;  4RGN A;  3NVZ A;  4ZDV A;  2ZVN A;  2A4Z A;  2WXF A;  2I1K A;  4C56 C;  3SR6 A;  5AEK B;  5KHQ A;  1MHX A;  1NDD A;  2X8X X;  1SF0 A;  1GPX A;  3HM6 X;  4IC7 B;  1NEN B;  1E90 A;  3AE5 B;  4LNF A;  4J3O D;  1TY0 A;  1SE3 A;  5EE0 A;  1FNV A;  1A70 A;  1HEZ E;  1E9M A;  1BUI C;  3Q3F A;  4TV3 A;  2KHW B;  2IY0 B;  1C79 A;  5TSS A;  3K9O B;  1TKG A;  2LVQ A;  3TJP A;  4EE2 A;  3I57 A;  4WAF A;  3V3X A;  4MM3 A;  4N6E B;  3AM9 A;  2L76 A;  4HRS A;  4HEA 1;  2BYF A;  2LGY A;  1MPE A;  2NPT A;  4WUR A;  1NYQ A;  2XK5 A;  1BML C;  4BKG A;  1V97 A;  3HVD A;  2O6V A;  4FXC A;  1C4P A;  4LK0 M;  2V1Y A;  2HDE A;  2AEH A;  3V62 A;  3DHI C;  1TT5 B;  5KHO A;  4MH8 A;  3SFD B;  2YLM A;  1N5W A;  4EZL A;  1ZXI A;  1FO4 A;  2X38 A;  1LFD A;  2KAC A;  2V3N A;  1L4Z B;  5HI1 A;  4G50 A;  4WQO B;  4HXD A;  3AEA B;  1V49 A;  1ACC A;  1OFF A;  2RSU A;  1Q5W B;  2KVR A;  3RZW C;  4ARC A;  3AE9 B;  4IWO A;  5LXI B;  3C8Y A;  3Q8B A;  1LO5 D;  4DHJ D;  4ANX A;  2Z0E B;  2WGS A;  2WXR A;  1N6Z A;  3PGE A;  4EUT A;  3H7P B;  5EE1 A;  1N61 A;  3JYU A;  3RNC C;  1N62 A;  1WE6 A;  2K9X A;  4E3C A;  3QK0 A;  3N20 C;  1UD7 A;  2NBW B;  2L8J A;  1I4H A;  4W9L A;  2HD5 B;  1V1O A;  5BO4 B;  3MC0 B;  4KIK A;  1KTK A;  4HCP B;  2KQ4 X;  2Y5C A;  3JSV B;  4I6P A;  1P9D U;  1V9J A;  2YEP F;  1QOF A;  2AQ1 B;  2D07 B;  4OZC A;  2BYV E;  3KYD D;  2KDF B;  2KTF A;  2CHX A;  4YTP B;  4RNA A;  2E3T A;  1Z5S B;  2MLB A;  1SJE D;  3KYC D;  1P0R A;  5I4D A;  4P16 A;  3IFW B;  4AWJ A;  1CMX B;  4LTU A;  3AV8 A;  2WDV B;  3P1M A;  2M4N A;  1XXG A;  2J0K A;  1YQB A;  2OJR A;  2GI9 A;  4NJ7 A;  3H7S A;  2JZP A;  1T5X D;  2HTM E;  5D6J B;  3Q2A C;  3Q3N C;  4B0M A;  2JY6 A;  3CIR B;  4RCO A;  2KK8 A;  3TUO A;  2G3Q B;  1YN4 A;  3P4R B;  4GDL A;  3P2B A;  1L7Y A;  4KZ0 A;  2MBE A;  3B1L X;  4YSX B;  5AZF A;  2BPS A;  4MGK E;  4H2A A;  5H92 C;  3ZJT A;  2WS3 B;  1WGH A;  4BVU C;  1V8C A;  4NNJ B;  4WIP A;  1PUT A;  2O2V B;  1JWB D;  5LNK 1;  2GBJ A;  5E6O A;  2JZZ A;  4XDD A;  1TZ1 A;  1WIA A;  3VDZ A;  3DVG Y;  3NJT A;  2LGS A;  2M0A A;  3V6C B;  4EFO A;  3W5V B;  2QJL A;  2PVG C;  4IWP A;  2PKO A;  5CHV C;  2KTR B;  1D5Z C;  5IKC M;  1WXS A;  3DDC B;  3MFG A;  5HFY A;  5JXV A;  2ZW0 A;  2LHD A;  2KDE B;  1TYG B;  4XWW A;  3L17 A;  2AQ3 B;  3AI5 A;  4KSL C;  2FAZ A;  4KSK C;  2D3A A;  2FIF A;  1E8X A;  4ZHO A;  1XCT L;  2L52 A;  3IBE A;  5IP4 D;  2G4S A;  2J0M A;  2LGD A;  2PJH A;  2V0G A;  1XQQ A;  2RPV A;  1HZ6 A;  3ZVV A;  3KVF B;  1B1Z A;  4LNK A;  3ZIM A;  3CSF A;  1JRU A;  1E8Y A;  2RPQ A;  1VDV A;  1X1M A;  1M94 A;  4TQ0 A;  4JQW C;  3ZJU A;  3R7R A;  2EKE C;  2L32 A;  3AEG B;  2C7N B;  2KQ7 A;  1YD8 U;  2D10 A;  1MVK A;  4GDK B;  4PT5 A;  4EOY A;  1J8C A;  3TIX A;  2R2Q A;  4MGY E;  1I7H A;  3DBL B;  2ZVO A;  3QHT A;  4RH6 A;  3PSE B;  1T0S C;  2IGH A;  2KWC A;  1WJ4 A;  3RNB C;  3VTV A;  1VZ6 A;  2CU1 A;  4ZRI A;  1F9J A;  3NZ3 A;  4N58 A;  4CYE A;  3APC A;  2NMQ A;  2FNJ B;  1S1Q B;  1F52 A;  4HJG E;  3DWG C;  3EFC A;  4RGM A;  5G5H A;  2REX A;  4IM0 A;  4BFR A;  2QDF A;  2J0J A;  1DOX A;  1C1Y B;  2W55 A;  2XN9 C;  1EWY C;  4DXG A;  2IND C;  1V5O A;  2PLP A;  1HZ5 A;  2C7M B;  3H7P A;  5CHW A;  4XX5 A;  2LZ6 A;  4TQ1 A;  1VLB A;  4F1S A;  2WX0 A;  3H6N A;  2KYW A;  2VH1 A;  1HXY D;  1XF5 L;  3VH3 B;  1WGR A;  2K0P A;  1TS5 A;  1WM2 A;  1TIF A;  1T3Q A;  3PLU A;  3M95 A;  3JSV A;  3L54 A;  5FR3 A;  1AYF A;  2HJ8 A;  3PHX B;  4XGA B;  3NOB A;  2GBN A;  3UI3 A;  3QC8 B;  3Q8E A;  3B2F A;  5G55 A;  1HQR D;  2L3Z A;  1WGG A;  2LRW A;  2LWP A;  3A9K B;  4GB9 A;  2N1V A;  2W9N A;  1GJZ A;  4MDK E;  4WWO A;  1K50 A;  3BK1 A;  4KGS A;  4ASW C;  3RMK C;  4C7Z A;  4M8M A;  1J19 A;  1WGY A;  3ZGZ A;  2K3U A;  2KN5 A;  2HJ1 A;  1AN8 A;  5DPT A;  4XZ4 A;  3T8M A;  3BIN A;  2INC C;  4ICV A;  3VVW B;  2MWS B;  3IAM 1;  3W1S A;  2MHJ A;  1ZXH A;  4JL9 A;  2IO1 B;  3KUZ A;  1STE A;  4M0W B;  2MCN B;  1N5X A;  4JGH B;  2O2V A;  1DOY A;  3EHV A;  1EWC A;  2PW9 A;  4FHK A;  2JXT A;  4ZRQ A;  3DQV A;  3I63 C;  4A90 A;  1K8R B;  2K6D B;  2ZPY A;  2M0X A;  2KNB A;  3DVN U;  3L4P A;  4NJC A;  3W1S C;  1DOI A;  1ET6 A;  2B3A A;  4AUQ C;  1XD3 B;  2DLB A;  1IGD A;  4C00 A;  2KTR A;  3Q3M C;  3AU5 A;  3UGB B;  1WYG A;  4PS8 A;  2J42 A;  1KJT A;  3IT6 B;  3ZO5 B;  2W54 A;  3W9C B;  2KC2 A;  1T0Y A;  1WY8 A;  2INN E;  4HPL B;  4M00 A;  2KKC A;  2DNF A;  3PZD A;  1WXQ A;  1RYJ A;  1RM6 C;  1R7S A;  3U7D A;  3VUX A;  2IO2 B;  3HVZ A;  4AOF A;  2A5U A;  2M1M A;  1L0V B;  4MEL A;  3TL5 A;  1QKZ A;  3GE8 C;  4HLE A;  1ZPS A;  2N9P C;  2R2O A;  2WXH A;  4OVV A;  2SAK A;  3L08 A;  3VAW A;  1UWM A;  2WU2 B;  3WAP A;  2Z59 B;  2KFK A;  1MHH E;  4IOI E;  2Y5B B;  4ZRK A;  1RRB A;  2BQQ A;  2DYB A;  1EU3 A;  2BWF A;  4FAD A;  2D11 A;  3RUL A;  1N63 A;  1LXD A;  2OHF A;  2KOX A;  2BYT A;  4OHJ A;  3R7Q A;  4HKZ E;  2KT7 A;  2GLS A;  2I1J A;  2FE8 A;  2MP2 B;  2MJ3 A;  3AE4 B;  3ZRC A;  1C3T A;  3MHZ A;  5E6N A;  1G6J A;  1SXT A;  2I38 A;  4PYU A;  3VR8 B;  4ANV A;  4MT5 A;  3T3O A;  4FA6 A;  1Y8R C;  2LAS A;  3K9P B;  1GC6 A;  3OWE B;  1SBB B;  2BT6 A;  5BYQ A;  4IG7 B;  2KWD A;  1WX7 A;  3ZRF A;  2N9E B;  2DZK A;  1FXA A;  2GBM A;  1J7B A;  3X23 A;  2M56 B;  5D7G A;  2E6X A;  3LB8 C;  3CWI A;  2ZNV B;  2N7E A;  3B08 A;  4KGT A;  2GMI C;  2ON8 A;  3H9D A;  3LDZ E;  1J7C A;  1ZE3 D;  2KDI A;  3ZKJ C;  3GZN I;  3BYY B;  4WAA A;  1I4P A;  2DZJ A;  3RN9 C;  1YN5 A;  1SSN A;  3MJW A;  4X57 B;  2KFJ A;  3A9K A;  5FKA C;  4B9K A;  1UGJ A;  1QQR A;  1FRR A;  1U4A A;  3EA6 A;  4W9D A;  4ZOH C;  1WF9 A;  3IXS A;  5C3J B;  4KKI A;  4R3D A;  2WXM A;  2M19 A;  4IW0 A;  2L00 B;  3M3J A;  3SFE B;  3NVV A;  2N9X A;  4KV2 A;  4K7W A;  3DBL I;  2EKI A;  1L5P A;  5TR5 A;  2LHE A;  4W9I A;  2CKH B;  3MHS D;  5IAA C;  3NVW A;  5E6P A;  3L16 A;  4HCN B;  5AZH A;  4ZYS A;  3ZTC A;  2KN4 A;  4M0W A;  3GP7 A;  5FK9 C;  2N1W A;  2IY1 B;  3AE7 B;  3AH7 A;  1L2N A;  3B2G A;  5FR6 A;  3AEE B;  1C77 A;  4W9H A;  1XT9 B;  4PK1 A;  1F0Z A;  2R61 A;  3I5J C;  3KH0 A;  2BGF A;  2LRU A;  3MC8 A;  2JRH A;  3PRM B;  1ET9 A;  1ZW7 A;  1I4Q A;  1V6E A;  2J7Q B;  4I6L B;  4HDQ A;  2PMV A;  3ABV B;  1TS3 A;  2JXX A;  1WJU A;  3ECI A;  2K5P A;  1UNS A;  1L0Y B;  2W82 A;  2KDB A;  2KLC A;  1NEK B;  1GAQ B;  2UYZ B;  1K52 A;  4JWS C;  3PPA A;  5LLI A;  5AUK A;  2KD0 A;  1XCQ L;  3ZNZ B;  4NY0 A;  2N7J A;  2I2Y A;  1YJI A;  4P1C C;  3NHE B;  1D4B A;  1HE8 A;  3VRA B;  3AE8 B;  2WXI A;  2AQ2 B;  2KWU B;  3VH4 B;  3WAO A;  3JW0 X;  3KLS X;  2MBB B;  3AXC A;  4A20 A;  4BOZ B;  1KLG D;  3VTU A;  3U30 A;  2BYE A;  4BBN F;  4FN2 A;  1EF5 A;  3AEF B;  4W9E A;  1QLB B;  4DDI D;  1V1P B;  3UIO B;  4A3P A;  4AP4 C;  1S3S G;  1WXV A;  4A8X C;  2MP2 A;  2QSD A;  4FUL A;  5JZE B;  3ML8 A;  1EF1 A;  1K51 A;  1QZE A;  2WHI A;  4BOS C;  1YMH E;  2OED A;  1QOA A;  3U8Z A;  5DPW A;  3RNF C;  1VJK A;  2AL6 A;  2KX0 A;  4AJW A;  2DWQ A;  3WA0 A;  1I4R A;  4MH0 E;  4P7I A;  1PFD A;  2L7R A;  1GNU A;  2G4D B;  3AED B;  4DDG D;  3RPF C;  2L05 A;  1CJE A;  2N9L A;  1TS4 A;  1FNU A;  2HE7 A;  4DHZ E;  5IN7 A;  2LFI A;  3RZF A;  3LYY A;  2KMA A;  2N9K A;  1KLV A;  5EDS A;  3HUI A;  2IO3 B;  4OVU A;  1QOB A;  3LXF A;  2LVP A;  5JHB A;  4MSQ B;  1E7U A;  3AB5 A;  3AE3 B;  3RT3 B;  3R2I A;  1Y56 A;  2WU5 B;  2LI5 A;  2RDH A;  1JRO A;  3ZUN A;  4XDC A;  3PLV A;  5C23 A;  2KQS A;  5C1Z A;  4S0R A;  4L1B A;  5BYS A;  1DYQ A;  2WXL A;  3R2T A;  4GU2 A;  4K81 A;  3QX1 A;  3N3K B;  2K1F A;  2ZNV C;  4DBG A;  1WGK A;  1V86 A;  3EUB 2;  2G9H D;  1ZP0 B;  2L83 A;  3WAM A;  2Y3A A;  3VHT C;  2KVZ A;  2RMM A;  3GZN B;  2BKF A;  3PS6 A;  4II2 B;  1SEB D;  2CU3 A;  3HM3 A;  1GB1 A;  2DAF A;  3Q69 A;  3OJ4 B;  1OGW A;  3ONS A;  3ZNH B;  2WP9 B;  3Q6B A;  2ZJD A;  4GGQ A;  2KMM A;  3DBH B;  2Z0D B;  2C60 A;  1ESF A;  2K22 A;  2DZM A;  2KO3 A;  1KH0 A;  1WR6 E;  4JIO U;  3N1Z C;  2H89 B;  4TUU A;  2KFK B;  4NAW B;  4LLG M;  3WAN A;  3HHM A;  3NRZ A;  2JVC A;  2MW5 A;  4II3 B;  4MGI E;  3QJZ A;  1SIJ A;  2LEK A;  2IBI B;  3NVY A;  2DBY A;  1T0R C;  2WYQ A;  1P7E A;  3URY A;  2BTE A;  1WE7 A;  1D5M C;  4P1B C;  1PQS A;  1AWD A;  2BB5 A;  2JF5 A;  1AW7 A;  3DHH C;  3GB1 A;  3P4S B;  3T3N A;  5CX3 A;  2QIE B;  5BMG A;  4IM3 A;  3O65 B;  1CQV A;  4KDL B;  1YN3 A;  1GOZ A;  2BKR B;  3A1Q B;  3BZD B;  3VQI A;  3AEC B;  2WWZ A;  2JUO A;  2KZR A;  1Z2M A;  3L10 B;  5BMH A;  5GXG B;  3J9C A;  3M62 B;  4B0E A;  4RFB A;  2MJD A;  2DYM A;  1F2R C;  2RDG A;  3TBL D;  1QF6 A;  1C4C A;  5JH5 C;  3R66 C;  2WX1 A;  4EKU A;  4W9J A;  1E0Z A;  1WJ6 A;  5CTR C;  1P3Q U;  3PRP B;  4USA A;  1HA5 A;  3HRD D;  3BVM A;  3HIZ A;  4ARI A;  2FCM A;  5J2R A;  1J7A A;  2G45 B;  4EZK A;  4GSW A;  1C76 A;  5T8I A;  2BF8 B;  3UQA A;  1IUE A;  2D5G A;  1EU4 A;  1ZKH A;  1V1P A;  2BW2 A;  4K7U A;  2ZZP B;  4QAY A;  1XLP A;  2V4I B;  2V9H A;  4ZHP A;  4P6V F;  3N32 A;  2DEN B;  4WWP A;  2HTH A;  3NY5 A;  1JCK B;  1VRA B;  3PZ7 A;  2CJN A;  3BVZ A;  3L0W B;  2L0F A;  1N60 A;  4M02 A;  1RAX A;  4HK2 A;  3QCA A;  1I4G A;  1TY2 A;  3TSS A;  1ZDX A;  1WJN A;  4L2Y A;  3NG0 A;  1P7F A;  5D3I B;  1TZO A;  3KWL A;  3EFU A;  3IAS 1;  3ZNG C;  4EEW A;  2DX5 B;  3GOE A;  2KDM A;  3W5U B;  2C7H A;  1L0X B;  2LMC A;  2LUE A;  2LD9 A;  3MP9 A;  3ZTD A;  2ZCC A;  3EEC A;  1R4N B;  2JX5 A;  5BYR A;  3VUW A;  3ZXV A;  5LXH A;  1UZX B;  4ZRP A;  3ZW3 A;  2NTT A;  4J6I A;  1F2R I;  1T6B X;  3CF6 E;  1OEY A;  2BVC A;  1C4A A;  1LGR A;  3Q8A A;  2WXG A;  4IDI A;  2DYO A;  4E74 A;  4JWU C;  1UGM A;  4KGR A;  4NQK E;  3IT4 B;  1FD6 A;  2V4L A;  1WFY A;  4BKT A;  3NS1 A;  2ACZ B;  2IYD B;  1IYF A;  1NI2 A;  2QIL A;  1WMH B;  2ZW1 A;  3WAL A;  2FUH B;  2J52 A;  2YVC A;  1OQY A;  1Q1O A;  2Z8L A;  3AU4 A;  1BXT A;  2KC1 A;  2MBQ A;  2BS2 B;  2EMT A;  4G11 A;  3AE1 B;  1YOV B;  3KUC B;  5AUI A;  2EMS A;  1TS2 A;  1FMA D;  3TEW A;  4FLH A;  3N1Y C;  3VXW A;  1WZ3 A;  4NAW A;  3R8B A;  1D5X C;  3P4P B;  1FM0 D;  2ZEQ A;  2TSS A;  2K25 A;  2QHO A;  1FPY A;  2WXK A;  4HDO A;  2IGD A;  3RI7 C;  4NAM A;  4CO7 A;  3MC9 A;  1OTR B;  3V05 A;  2KX3 A;  1YX6 B;  1I4X A;  2NR2 A;  1E7P B;  1XLO A;  4DQO C;  2BB6 A;  4BKS D;  4N9F 4;  1ZOY B;  1TKY A;  1FEH A;  3PT2 B;  5G2N A;  2CR5 A;  1JRP A;  4ICU A;  4W9G A;  3N1X C;  4OW0 A;  2NCN A;  1YJJ A;  5IO9 A;  4LDT B;  1FIQ A;  1JQ4 A;  4IM2 A;  2WLB A;  1SB3 C;  4F8C B;  1E8Z A;  3A1Q A;  5D3D A;  1FXI A;  1VR9 A;  1ROE A;  4GMV A;  1IBX B;  3OAW A;  4WWN A;  1L6V A;  2LXA A;  4ZYN A;  2J4X A;  3ETR A;  1IPG A;  1TKE A;  4MSM B;  3VFK A;  4YSY B;  2QMT A;  1L6U A;  1V2Y A;  1KM7 A;  3QAR A;  4KKJ A;  3PV1 A;  4K3C A;  4O1N A;  1ZUD 2;  1UH6 A;  4MAC A;  5CHF A;  3ENE A;  2LGX A;  3IG3 A;  3QQ8 B;  1LQB A;  1FFU A;  2K6Q A;  1TBE A;  1PDX A;  2DHZ A;  2NS5 A;  1OQQ A;  3W1Y A;  2GBK A;  2JYT A;  5DPR A;  4TSS A;  1JML A;  3WIM A;  4G0N B;  3DBH I;  1YX5 B;  3PTF C;  4LNI A;  3A9J B;  1H8C A;  3AEB B;  1GB4 A;  3DBR B;  1TJE A;  1MG8 A;  4NQL B;  4AJY B;  4BKS A;  4KX6 B;  1WR1 A;  2PEA A;  1V80 A;  5G5G A;  3ZNI D;  2PE9 A;  4DWF A;  1FNW A;  4A6Q A;  2KJR A;  3ZXR A;  1J0G A;  2D2Q A;  4K3B A;  3QWZ B;  4REZ A;  2KJ6 A;  1HTO A;  2CHZ A;  2WDT B;  4RGO S;  2XEW A;  2KMC A;  2JWZ A;  4LDT D;  2AWT A;  2LXC A;  1ZDV A;  3JVZ X;  1UUP A;  3TEY A;  4CHK A;  3CST A;  2IJ0 A;  1UF0 A;  4URK A;  4B6W A;  5EE9 A;  4XWT A;  1YQ3 B;  3VTW A;  2JU6 X;  2EEL A;  4C80 A;  1R4M B;  4LCD E;  3NS8 A;  2MJE A;  1ENF A;  2NBU A;  4ANU A;  3AMZ A;  4MEM A;  1PYW D;  1OQR A;  1QOG A;  4N59 A;  2K39 A;  2ICI A;  4IUM B;  4A55 A;  4ACF A;  3SHQ A;  2LGI A;  2LUM A;  4HPP A;  3SEB A;  2GOW A;  3DVG X;  3RYT A;  3ZQ4 A;  1WMH A;  1YNT E;  4MJS B;  4B95 A;  4NJ6 A;  4IKG A;  1UBI A;  4RM8 A;  1KFY B;  2YEP B;  2J53 A;  1XLN A;  2N4F A;  5DCN A;  3SU8 X;  3I3T B;  4UDU C;  1YQ4 B;  2WXQ A;  3BY4 B;  4AQ7 A;  1WRI A;  1SIF A;  3H8H A;  5MPO A;  2W3R A;  1RWS A;  4KZC A;  4YSZ B;  5HG2 A;  4YTM B;  4HRO A;  1JWM D;  2KLG A;  3VR9 B;  4YL8 A;  3R3M A;  5AZG A;  1IP9 A;  2RGF A;  2PVO D;  4K1R B;  4FJY A;  1NI3 A;  3PO0 A;  3H1U A;  5H8Y E; 
#chains in the Genus database with same CATH homology
 1PQS A;  2I1K A;  5AEK B;  4FJZ A;  5KHQ A;  2KTR A;  2VRR B;  1NDD A;  2JF5 A;  2KAN A;  3AU5 A;  3UGB B;  3RUI B;  4PS8 A;  1KJT A;  2MA9 B;  5CX3 A;  3ZO5 B;  3HM6 X;  3ML9 A;  4IC7 B;  2KC2 A;  1E90 A;  3Q3J A;  1E8W A;  4IM3 A;  1T0Y A;  1WY8 A;  3O65 B;  4HPL B;  3UF8 A;  1WXA A;  4KDL B;  2KKC A;  3PZD A;  1BT0 A;  2UWQ A;  2BKR B;  3A1Q B;  3Q3F A;  3VQI A;  3S2A A;  2WWZ A;  4TV3 A;  2KHW B;  2JUO A;  2KZR A;  1R4N I;  2IY0 B;  3U7D A;  3VUX A;  2IO2 B;  1Z2M A;  4AOF A;  2A5U A;  2M1M A;  4M8N A;  1VD2 A;  3C0R B;  3K9O B;  4MEL A;  3CMM B;  2LVQ A;  1WXM A;  3EC8 A;  3L10 B;  3TJP A;  4G3X B;  4MM3 A;  3TL5 A;  3T9L A;  3M62 B;  4HLE A;  3DCG A;  2L76 A;  2DYM A;  3TBL D;  5JHA A;  2N9P C;  2LGY A;  2BYF A;  2R2O A;  5JH5 C;  2NPT A;  4OVV A;  1P1A A;  3L08 A;  3VAW A;  3X0W A;  3R66 C;  2XK5 A;  2MRP A;  2Z59 B;  2KFK A;  3WAP A;  4BKG A;  2WX1 A;  2PE6 B;  2ZCB A;  2O6V A;  4EKU A;  2Y5B B;  4LJP B;  4W9J A;  1WJ6 A;  3QAQ A;  4ZRK A;  1RRB A;  1NBF C;  1FXT B;  5CTR C;  1P3Q U;  3PRP B;  4E71 A;  3ZLZ A;  3OJ3 A;  2V1Y A;  2DYB A;  3HIZ A;  2FCM A;  4RMA A;  5J2R A;  2BWF A;  4FAD A;  2G45 B;  4EZK A;  2AEH A;  3V62 A;  2D11 A;  4GSW A;  3RUL A;  2BF8 B;  5KHO A;  1LXD A;  3UQA A;  2KOX A;  5L83 A;  3UIP B;  2AL3 A;  2YLM A;  1ZKH A;  4EZL A;  1WH3 A;  3R7Q A;  2K8H A;  4K7U A;  1A5R A;  4DK5 A;  1LFD A;  1WX9 A;  2ZZP B;  3A9J A;  1EUV B;  2I1J A;  2MP2 B;  3ZRC A;  4G50 A;  1C3T A;  3DOW A;  4I6N B;  3N32 A;  5E6N A;  1G6J A;  4WQO B;  4HXD A;  3A4R A;  1V49 A;  2DEN B;  2HTH A;  4PYU A;  4WWP A;  2RSU A;  4ANV A;  1Q5W B;  3NY5 A;  2KVR A;  1SE9 A;  3RZW C;  3DPD A;  4FA6 A;  3UIN B;  1Y8R C;  2LAS A;  4GN1 A;  5LXI B;  4IWO A;  3UQB A;  3K9P B;  3L0W B;  4F7Z A;  4DHJ D;  2L0F A;  1GC6 A;  4ANX A;  2KXJ A;  2Z0E B;  1RAX A;  4HK2 A;  1SGH A;  3PGE A;  3QCA A;  2C5L C;  1VCB A;  3H7P B;  4EUT A;  3JYU A;  1WJN A;  4IG7 B;  1WX8 A;  5J18 A;  1WE6 A;  4E3C A;  1WX7 A;  3QK0 A;  3ZRF A;  2N9E B;  2DZK A;  1UD7 A;  2NBW B;  3EFU A;  2ZVN A;  3ZNG C;  4EEW A;  2DX5 B;  2L8J A;  2L0T A;  2GBM A;  4W9L A;  3GOE A;  2HD5 B;  3X23 A;  5D7G A;  2C7H A;  5BO4 B;  3A4S C;  2LUE A;  4KIK A;  2LD9 A;  4GIV A;  3ZTD A;  4HCP B;  2BWE S;  2ZCC A;  3EEC A;  4PS3 A;  2ZNV B;  3JSV B;  4PYZ A;  2N7E A;  1P9D U;  3B08 A;  4I6P A;  1V9J A;  2GMI C;  3VUW A;  5HKH A;  5LXH A;  1UZX B;  2D07 B;  2DAJ A;  3H9D A;  3LDZ E;  3ZW3 A;  2MX2 A;  2BYV E;  3KYD D;  1UEL A;  2KDF B;  2KTF A;  4J6I A;  2KDI A;  4GXB A;  2CHX A;  3DBS A;  3ZKJ C;  3GZN I;  2IZV B;  3CF6 E;  4WAA A;  1OEY A;  2DZJ A;  4FHJ A;  3A33 B;  1Z5S B;  3MJW A;  4ZRJ A;  4X57 B;  2AYO B;  1GG3 A;  2MLB A;  2KFJ A;  3A9K A;  3KYC D;  4B9K A;  1P0R A;  1U4A A;  4TKN A;  3NZU A;  2DYO A;  4E74 A;  2N7D A;  4AWJ A;  2JPH A;  3IFW B;  2K8B A;  4W9D A;  1WF9 A;  1UGM A;  4NQK E;  2ASQ A;  1CMX B;  2V4L A;  1WFY A;  4BKT A;  2M4N A;  2IYD B;  1IYF A;  1NI2 A;  2RD0 A;  2J0K A;  1YQB A;  2OJR A;  4WJQ A;  4MJS A;  1WMH B;  3WAL A;  4NJ7 A;  4IW0 A;  2FCN A;  2FUH B;  3H7S A;  2YVC A;  1OQY A;  1Q1O A;  2L00 B;  5D6J B;  5L95 C;  3M3J A;  3AU4 A;  2KC1 A;  2MBQ A;  2N9X A;  2EMT A;  4G11 A;  1WZ0 A;  3IVF A;  2JY6 A;  2NBV B;  4KV2 A;  4K7W A;  3DBL I;  5IA7 A;  3KUC B;  4IWQ A;  5TR5 A;  2KK8 A;  4DHZ B;  2G3Q B;  4W9I A;  4GDL A;  2EMS A;  3P2B A;  3ALB A;  1L7Y A;  4KZ0 A;  2CKH B;  2MBE A;  4W9C A;  3B1L X;  3MHS D;  5IAA C;  2RR9 A;  4FLH A;  5AZF A;  2ZPN A;  3VXW A;  1WZ3 A;  4NAW A;  2BPS A;  4MGK E;  5E6P A;  3L16 A;  4HCN B;  3PVL A;  1WGH A;  3LJ3 A;  5AZH A;  3SD5 A;  3ZTC A;  3NZS A;  2ZEQ A;  4BVU C;  4NNJ B;  2K25 A;  2QHO A;  3PHW B;  2FCQ A;  3D32 A;  4PS7 A;  4HDO A;  2O2V B;  2N1W A;  2GBJ A;  5E6O A;  2FID A;  2IY1 B;  2JZZ A;  2PPH A;  3AUL A;  3APF A;  3DBR I;  3RD2 A;  3V6E B;  4CO7 A;  1OTR B;  4K7S A;  1TZ1 A;  1WIA A;  1YX6 B;  2KX3 A;  1L2N A;  3VDZ A;  3DVG Y;  5FR6 A;  4W9H A;  1XT9 B;  2NR2 A;  3DVN V;  1GUA B;  4BBN C;  4BKS D;  4N9F 4;  3V6C B;  3KH0 A;  4EFO A;  3N30 A;  1V5T A;  2BGF A;  2LRU A;  3L13 A;  3PT2 B;  2JRH A;  3PRM B;  4IWP A;  5G2N A;  1ZW7 A;  2CR5 A;  5CHV C;  2KTR B;  1WXS A;  3DDC B;  1V6E A;  2J7Q B;  4I6L B;  4ICU A;  4W9G A;  1RFA A;  2KDE B;  2NCN A;  3L17 A;  4HDQ A;  1WYW B;  5D94 A;  4LDT B;  4IM2 A;  3AI5 A;  4KSL C;  5GMV A;  4KVG B;  2FAZ A;  4KSK C;  2JXX A;  4F8C B;  1E8Z A;  1E8X A;  1WJU A;  2FIF A;  3ECI A;  3A1Q A;  3IBE A;  2MQJ A;  2G4S A;  2J0M A;  3VUY A;  4RM9 A;  2LGD A;  2PJH A;  2KDB A;  1XQQ A;  4GMV A;  2KLC A;  3ZVV A;  2V3S A;  3OAW A;  2UYZ B;  4WWN A;  3KVF B;  3ZIM A;  2JT4 B;  3PPA A;  5LLI A;  3CSF A;  1JRU A;  1GC7 A;  2KD0 A;  1E8Y A;  2RPQ A;  2LXA A;  2NVU I;  3ZNZ B;  4ZYN A;  1X1M A;  2LVO A;  4NY0 A;  4WJP A;  1M94 A;  1YIW A;  1IPG A;  4TQ0 A;  4JQW C;  4MSM B;  4XC2 A;  3R7R A;  3VFK A;  2CHW A;  2EKE C;  3NHE B;  2C7N B;  2KQ7 A;  1YD8 U;  3ZDT A;  1HE8 A;  1R4M I;  1V2Y A;  2D10 A;  1P98 A;  4GDK B;  4GOC A;  3KUD B;  2NPT B;  4EOY A;  1KM7 A;  3HK0 A;  3QAR A;  1J8C A;  3TIX A;  2KWU B;  2XK5 B;  2R2Q A;  3PV1 A;  5DPS A;  3VH4 B;  3WAO A;  4MGY E;  3JW0 X;  2MBB B;  3AXC A;  4LJO B;  3ZDM C;  2O6V B;  1UH6 A;  4A20 A;  2ZVO A;  4BOZ B;  5CHF A;  3IHP C;  3QHT A;  3ENE A;  3VTU A;  3PSE B;  2LGX A;  3IG3 A;  3QQ8 B;  1EO6 A;  2BYE A;  1LQB A;  3U30 A;  4BBN F;  2KWC A;  2K6Q A;  1WJ4 A;  4FN2 A;  1TBE A;  3VTV A;  1EF5 A;  2CU1 A;  2DHZ A;  2M17 A;  2NS5 A;  4ZRI A;  1F9J A;  1KOT A;  3W1Y A;  3APC A;  4W9E A;  4CYE A;  2FNJ B;  2GBK A;  5DPR A;  3WIM A;  4DDI D;  1S1Q B;  4HPM B;  3UIO B;  2KWV B;  4A3P A;  1S3S G;  4AP4 C;  3V61 A;  1WXV A;  1H4R A;  4G0N B;  3DBH I;  1TTN A;  1YX5 B;  3OLM D;  3PTF C;  4HWI B;  2MP2 A;  3A9J B;  4FUL A;  1H8C A;  5JZE B;  4EZJ A;  1ZGU B;  2REX A;  3ML8 A;  4IM0 A;  4BFR A;  1EF1 A;  2J0J A;  2MBH A;  1QZE A;  4BOS C;  1RLF A;  1C1Y B;  1UBQ A;  1MG8 A;  3U8Z A;  5DPW A;  2GBR A;  4NQL B;  4AJY B;  2AL6 A;  1E7V A;  3TMP B;  4BKS A;  2KX0 A;  1WR1 A;  1V5O A;  4AJW A;  2PEA A;  1V80 A;  2C7M B;  3ZNI D;  3WA0 A;  2PE9 A;  4DWF A;  4MH0 E;  2DZI A;  3H7P A;  4P7I A;  2CS4 A;  2L7R A;  5CHW A;  4XX5 A;  2LZ6 A;  4TQ1 A;  5J17 A;  1GNU A;  4F1S A;  2WX0 A;  2G4D B;  1ISN A;  2KJR A;  3H6N A;  2C9W B;  4DDG D;  1J0G A;  2D2Q A;  2L05 A;  3QWZ B;  3VH3 B;  2JZ3 B;  2KJ6 A;  1WGR A;  2KJH B;  3SDL C;  4HVB A;  2HE7 A;  4DHZ E;  2CHZ A;  1WM2 A;  2WDT B;  4W9K A;  1I35 A;  3QA8 A;  3RZF A;  2KMA A;  2M8S A;  4KIK B;  3PLU A;  2XEW A;  4W9F A;  3M95 A;  1KLV A;  2KMC A;  5EDS A;  4GDK A;  3JSV A;  2IO3 B;  2JWZ A;  3L54 A;  4OVU A;  4LDT D;  2AWT A;  2LXC A;  2LVP A;  2IO0 B;  3JVZ X;  5JHB A;  4MSQ B;  4CHK A;  3CST A;  1E7U A;  3RT3 B;  2HJ8 A;  4B6W A;  4URK A;  3PHX B;  3NOB A;  2GBN A;  3QC8 B;  1WM3 A;  1WGD A;  2LI5 A;  4FBJ B;  3VTW A;  3ZUN A;  5G55 A;  1LM8 B;  3PLV A;  5C23 A;  2L3Z A;  4HJK A;  2KQS A;  5C1Z A;  1E5W A;  1WGG A;  2LJ5 A;  3MTN B;  1YJ1 A;  2LRW A;  2LWP A;  3B0A A;  3NS8 A;  4LCD E;  3A9K B;  4GB9 A;  2NBU A;  4ANU A;  4GU2 A;  4K81 A;  3QX1 A;  4MEM A;  3N3K B;  2K1F A;  2ZNV C;  2D3G A;  3V60 A;  4DBG A;  2K39 A;  4ANW A;  4IUM B;  1V86 A;  2FCS A;  2N1V A;  3SHQ A;  1WRD B;  2W9N A;  3WAM A;  3VHT C;  4WJN A;  3RCZ A;  2BKF A;  2MBO A;  1GJZ A;  3PS6 A;  4DXA B;  4MGZ E;  2GOW A;  4II2 B;  4MDK E;  3DVG X;  3RYT A;  2XBB C;  3TCA A;  4WWO A;  3HM3 A;  1WMH A;  4ASW C;  1V81 A;  2JRI B;  4MJS B;  2DAF A;  4B95 A;  3OJ4 B;  1OGW A;  4M8M A;  4NJ6 A;  3T8M A;  3ONS A;  4JLC A;  1UBI A;  3KW5 B;  4RM8 A;  3ZNH B;  1J19 A;  1WGY A;  2O6V D;  2ZJD A;  4GGQ A;  2Z0D B;  1AAR A;  2KN5 A;  2C60 A;  5DPT A;  2DZM A;  2N4F A;  4XZ4 A;  2OOB B;  5DCN A;  3M63 B;  3SU8 X;  4NPN A;  3I3T B;  4GDL B;  2KO3 A;  3BIN A;  4ICV A;  5D2M B;  3VVW B;  1I42 A;  1WR6 E;  2MSE D;  1OEY J;  2MWS B;  3PRZ A;  3QIJ A;  4JIO U;  3BY4 B;  4TUU A;  3W1S A;  2KFK B;  4NAW B;  3WAN A;  1WI0 A;  2IO1 B;  4JL9 A;  3KUZ A;  1Q0W B;  1D3Z A;  3HHM A;  1TGZ B;  2JVC A;  2MW5 A;  1SIF A;  4II3 B;  4M0W B;  4MGI E;  2MCN B;  4JGH B;  2O2V A;  4DHJ B;  3QJZ A;  3EHV A;  4KZC A;  4FHK A;  2IBI B;  2KLG A;  2K8C A;  3APD A;  4WJO A;  3DQV A;  3R3M A;  4YL8 A;  5AZG A;  1IP9 A;  3PRE A;  4KDI C;  1K8R B;  2K6D B;  2ZPY A;  2RGF A;  4FJY A;  4K1R B;  2M0X A;  2WYQ A;  4A3O A;  2KNB A;  4FJV B;  3DVN U;  3W1S C;  4AUQ C;  1WE7 A;  2B3A A;  1XD3 B;  3H1U A;  4ZDV A;  2A4Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...