1C3TA

Rotamer strain as a determinant of protein structural specificity
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
76
structure length
76
Chain Sequence
MQLFVKTLTGKTLTVELEPSDTVENLKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNLQKESTIHLVLRLRGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Rotamer strain as a determinant of protein structural specificity.
pubmed rcsb
source organism Homo sapiens
molecule tags De novo protein
molecule keywords PROTEIN (1D8 UBIQUITIN)
total genus 16
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 1999-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1c3tA00
2AL6A 4EEWA 1YD8U 3IVFA 5E6PA 1WYWB 2EMTA 3D32A 3QA8A 3VUYA 5D6JB 1E5WA 1GUAB 4II3B 4KV2A 3M62B 3OJ4B 4DHJD 5DPTA 2IYDB 2KDIA 4A3PA 2ZJDA 4MM3A 4JLCA 3ZTCA 3L54A 5L95C 5EDSA 3WAMA 1GC6A 2O2VA 1S3SG 2DAJA 2HD5B 2KQ7A 3A33B 1SIFA 4MGZE 3A9KB 2XEWA 5E6OA 2NBUA 3HM6X 1IP9A 4XC2A 3SU8X 2EKEC 3ZDMC 4BKGA 1C3TA 1WMHA 3DVNU 2J0JA 2PE6B 2XK5B 2KWUB 2LZ6A 4LJPB 1EUVB 4BOSC 1V49A 1WM3A 1Z2MA 4G11A 4GXBA 5AZHA 3ZNID 3UQAA 4CHKA 3BINA 1Q1OA 5DPSA 1P1AA 4HPMB 4G3XB 2NR2A 3AU4A 4NJ6A 2ZZPB 3KH0A 3PS6A 3DVNV 4LDTD 2M1MA 3QWZB 4LJOB 2D3GA 5J18A 1GG3A 1RAXA 2KDEB 2M17A 4GMVA 3ZNGC 2KFKA 4MH0E 4N9F4 2QHOA 2BYEA 3KUCB 2LUEA 3NS8A 4K81A 5CX3A 2DZMA 1WJNA 4TV3A 1E8ZA 3H7PB 4XX5A 4K7SA 3ZDTA 5HKHA 4DBGA 2KX0A 2PEAA 2IZVB 1SE9A 1I35A 3KVFB 2L76A 4II2B 4DK5A 2CR5A 3LDZE 3ZUNA 4EKUA 1UBQA 2N9XA 2ZNVC 4IM3A 4I6PA 4ZRIA 2K8CA 1NBFC 2BKRB 2N1VA 4AWJA 3MTNB 2A4ZA 2RD0A 1R4MI 2GBKA 1VCBA 2ZPYA 1ZGUB 3PVLA 2BWFA 4FHKA 3W1SA 1Y8RC 4ZRJA 1V5TA 3L16A 1E90A 3AI5A 1LM8B 1D3ZA 4G0NB 4W9EA 2DZKA 3QQ8B 1OTRB 2BWES 2IY1B 3C0RB 3DPDA 3QHTA 4MJSA 1KOTA 3O65B 2JF5A 2KMAA 3EFUA 3DVGY 4GDKB 4ANXA 4IWOA 4PS8A 3RUIB 1WXMA 2KKCA 4GOCA 4ANUA 1I42A 2NBWB 1WFYA 2DZJA 4KDIC 2C60A 2REXA 1YX5B 5BO4B 1EF5A 3LJ3A 1LXDA 2IO0B 3W1YA 1V2YA 3AU5A 3JSVB 4I6NB 4MDKE 2VRRB 4PS3A 4WJNA 4JQWC 4W9GA 3CF6E 3DBLI 4FN2A 3ZW3A 1H8CA 2R2QA 2K25A 4NQLB 3ZTDA 1UD7A 4JL9A 4B6WA 3L0WB 3KUZA 4FLHA 4EZKA 1X1MA 3IG3A 3SD5A 1WGYA 2G3QB 2M8SA 3WANA 4HXDA 4J6IA 4NAWA 4AJYB 2L7RA 2OJRA 3VQIA 5DPRA 3TL5A 4HWIB 5KHOA 3N30A 3T9LA 2LGDA 1J19A 2RR9A 2G45B 4WWNA 4BOZB 4TUUA 3OJ3A 5E6NA 4YL8A 3ZO5B 1C1YB 1WGDA 2V4LA 4ICVA 5D2MB 1OQYA 2ASQA 4E74A 3W1SC 1WGHA 3ZKJC 2FIDA 2GBMA 3JYUA 2MQJA 4IUMB 4NQKE 1P98A 2NVUI 3EHVA 3KW5B 3RCZA 2LXAA 4W9CA 2Y5BB 2K8HA 3TCAA 4PS7A 2I1KA 1AARA 2C9WB 1V5OA 1V80A 2LVQA 4F7ZA 2NS5A 5TR5A 2KJHB 3PT2B 3T8MA 3GOEA 2HTHA 3UGBB 4F8CB 4ZRKA 1A5RA 4FJZA 1OEYJ 4NJ7A 4DHZE 4MGYE 2JZZA 3I3TB 4LCDE 2KANA 3ML8A 3MHSD 4MSQB 5AEKB 1WR1A 3PPAA 2CHZA 4W9IA 3K9PB 4FULA 2V3SA 4NPNA 1XD3B 1K8RB 4KSLC 4EUTA 2XK5A 2KO3A 4GSWA 4NY0A 1UH6A 2A5UA 2J0MA 2MLBA 1MG8A 1RLFA 4P7IA 4B9KA 4ZYNA 1IYFA 2UYZB 2FAZA 3RULA 3DBHI 3ZNHB 2DAFA 4W9FA 1FXTB 2JT4B 2PPHA 3APDA 2KOXA 3PZDA 2ZVOA 3VH4B 1XQQA 5G2NA 2L8JA 1WXAA 4HCNB 1UBIA 4MSMB 4WAAA 2YLMA 3HHMA 3L13A 2HJ8A 4NAWB 4AUQC 4TQ0A 1CMXB 3ENEA 4KDLB 3DCGA 4WWOA 2LGXA 2JWZA 5DCNA 5IAAC 3PGEA 1R4NI 1WZ3A 3M95A 1WXVA 2WWZA 3EECA 2KTRA 2PJHA 4ZDVA 2B3AA 2JVCA 2G4SA 2LASA 3VFKA 1ZKHA 5C23A 3VTWA 4MELA 2KC1A 1P0RA 2G4DB 4NNJB 2KMCA 1HE8A 2IY0B 2DZIA 3PHWB 2WX0A 3KUDB 3KYDD 4DDID 3AXCA 4IM0A 1WJ4A 2LD9A 5D7GA 3PREA 4IM2A 3A1QA 1BT0A 3EC8A 2MX2A 2FUHB 2IO2B 2MBEA 2KHWB 2MRPA 4RM9A 3M3JA 2FCMA 3VTVA 4BKSD 2ZPNA 3UQBA 3X0WA 2R2OA 1NI2A 2ZNVB 2PE9A 3NZUA 1RRBA 1WX7A 2MSED 4M8MA 2CHWA 2FIFA 3A9JA 3RYTA 3NY5A 5JH5C 1P3QU 1OGWA 3JSVA 4OVUA 2AWTA 1WI0A 2O2VB 1WY8A 2BGFA 3PTFC 1J0GA 2D10A 3IHPC 4IG7B 4DHJB 1PQSA 4FJVB 2K8BA 4HDOA 3R66C 2AEHA 2KC2A 4IWPA 4DWFA 4MEMA 1Q0WB 2ZVNA 3P2BA 3VTUA 5CHVC 4FHJA 2N9PC 3R3MA 5D94A 2KFKB 4GN1A 2JRIB 2UWQA 4HK2A 1WXSA 5AZGA 4WQOB 1T0YA 2GOWA 3VXWA 5JHBA 3L17A 5J17A 4KIKA 2ZCCA 2LRWA 4FJYA 2EMSA 1GNUA 4PYZA 1G6JA 2MBOA 2RSUA 4ICUA 3K9OB 3M63B 1WGGA 2J7QB 4I6LB 3TJPA 2IO3B 2K39A 2MA9B 2RGFA 3U30A 3WA0A 1E8YA 5FR6A 2KX3A 2LWPA 2KWCA 3H7PA 3QC8B 4KSKC 4XZ4A 4GDLA 3A4SC 4IC7B 4GGQA 5C1ZA 1JRUA 4W9KA 4BBNF 4RMAA 3PSEB 4DXAB 2DHZA 2KK8A 3V61A 1VD2A 2ZCBA 2KXJA 2KDBA 3PLUA 4IWQA 1QZEA 2DYMA 2KWVB 1NDDA 3A4RA 3A1QB 3VAWA 3ALBA 3DQVA 2WYQA 4HPLB 2MP2B 3B08A 4A20A 1WJUA 1P9DU 4BBNC 2DX5B 1Z5SB 4BKSA 3VHTC 3AULA 3RZWC 4E71A 4EZLA 3L08A 1RFAA 3CMMB 3V6EB 2L0TA 1WIAA 1WF9A 4W9LA 4W9HA 2NPTB 1UZXB 2LVPA 2O6VD 2O6VB 4KZCA 3A9KA 3QK0A 1WZ0A 4KVGB 3GZNI 3B0AA 4ANVA 2CHXA 2KLCA 2NCNA 3VUXA 4DDGD 5IA7A 3VUWA 2KTFA 4BVUC 2DYOA 2KD0A 2V1YA 1J8CA 1WMHB 1V86A 3DBRI 2ZEQA 4AOFA 4X57B 2WDTB 1M94A 2CKHB 4FBJB 3U7DA 2K6DB 2N4FA 3ZVVA 5KHQA 2D2QA 3X23A 2M0XA 2MBBB 5AZFA 4ANWA 3BY4B 1E8XA 2JUOA 2KDFB 1YQBA 1TTNA 2KN5A 2LXCA 3PRZA 3Q3JA 3QIJA 4G50A 4HDQA 4RM8A 3MJWA 3IBEA 2AYOB 2KJ6A 3OAWA 2DYBA 4JGHB 3TBLD 4GU2A 4GIVA 2KVRA 2BYFA 4JIOU 5LXIB 2OOBB 4K1RB 1YIWA 4KZ0A 3V60A 2D07B 3WALA 1Q5WB 2JZ3B 3SHQA 3Q3FA 2KLGA 3CSTA 4MJSB 2KFJA 5CTRC 2AL3A 2GMIC 2JPHA 1L2NA 4M8NA 2K6QA 3IFWB 3QARA 1WX9A 5JHAA 3DBSA 4HLEA 3N32A 3H9DA 2L05A 5LLIA 3JVZX 4WJPA 4W9DA 1V6EA 3PLVA 1YJ1A 2KQSA 3VVWB 4K7WA 4AJWA 3B1LX 4EFOA 1YX6B 3HK0A 1WRDB 3QAQA 4MGIE 4WJQA 3H6NA 2O6VA 1WM2A 4E3CA 1EO6A 3PHXB 1KLVA 4HJKA 3ZNZB 3UF8A 3TMPB 2BF8B 2MCNB 1KM7A 4EOYA 3RT3B 4FA6A 4URKA 2GBRA 3QJZA 5J2RA 1V81A 3VH3B 1V9JA 5CHWA 2FCSA 2LJ5A 2KTRB 5G55A 2N9EB 3R7QA 2Z0EB 3KYCD 3QX1A 2JY6A 4GB9A 1UGMA 2IBIB 2L0FA 3A9JB 4A3OA 5CHFA 3SDLC 2JRHA 2YVCA 2MBHA 2RPQA 3ZIMA 3NZSA 3WIMA 5LXHA 4W9JA 3TIXA 1EF1A 2N1WA 3RZFA 3ZRFA 1WE7A 3ZLZA 3V62A 3WAPA 2HE7A 4FADA 5JZEB 1ISNA 4TKNA 3NHEB 2MP2A 1H4RA 1OEYA 2LVOA 3ECIA 4IW0A 3L10B 4ASWC 3ML9A 2L00B 3DDCB 3UINB 2JXXA 1WE6A 1WGRA 3U8ZA 3APCA 1ZW7A 2BKFA 2Z0DB 2FCNA 1UELA 5DPWA 3ONSA 4GDKA 1LQBA 4DHZB 3PRPB 2LRUA 1L7YA 1E7VA 2W9NA 1KJTA 3UIOB 5L83A 2MW5A 2BYVE 3OLMD 4WJOA 4TQ1A 4LDTB 3R7RA 3H7SA 2CS4A 2KNBA 2M4NA 2GBNA 2K1FA 3HIZA 2N7EA 4PYUA 1WR6E 2C7NB 2KJRA 4K7UA 4F1SA 1XT9B 3H1UA 2C5LC 3DVGX 1LFDA 1TBEA 1TZ1A 2C7HA 2NBVB 2WX1A 2MBQA 4GDLB 1E7UA 3HM3A 5GMVA 2FCQA 1WX8A 4AP4C 4EZJA 2KZRA 4KIKB 3PRMB 1S1QB 3V6CB 1IPGA 1F9JA 1E8WA 2DENB 2MWSB 1TGZB 2D11A 3QCAA 4CYEA 3APFA 1SGHA 4MGKE 2C7MB 4M0WB 3UIPB 1WJ6A 4HCPB 4CO7A 3VDZA 2L3ZA 3CSFA 3JW0X 4BKTA 1WH3A 2J0KA 3S2AA 2LI5A 2XBBC 2LGYA 3N3KB 3NOBA 2GBJA 2IO1B 2BPSA 2NPTA 2CU1A 4WWPA 1GC7A 3WAOA 3ZRCA 4HVBA 3RD2A 1U4AA 3DOWA 4BFRA 2Z59B 2FNJB 2N7DA 1GJZA 4OVVA 3PV1A 4B95A 2I1JA
chains in the Genus database with same CATH superfamily
2YEPB 2LMCA 1WYWB 2EMTA 3D32A 3J9CA 4J3OD 3VUYA 5D6JB 2RDBC 4DHJD 2SAKA 4A3PA 2ZJDA 4MM3A 3L54A 2O2VA 4LNFA 4KGTA 1N5XA 1F52A 4CQNA 2AQ1B 1K50A 4LJPB 3AE6B 1EUVB 5AZHA 4CHKA 1MVKA 2BB5A 5DPSA 1C4AA 1JWAD 1QLBB 3P4PB 4NJ6A 3DVNV 4LJOB 2M17A 4MH0E 1SJED 2QHOA 2JYTA 3KUCB 4TV3A 1E8ZA 3U52E 3ZDTA 4K7SA 5I4DA 2L76A 4OHJA 2J4XA 3ZUNA 2N9XA 2ZNVC 3GS2A 4ZRIA 2N1VA 3BVZA 2RD0A 1KH0A 2GBKA 1ZGUB 1JWBD 3W9CB 1V5TA 2JU6X 3MP9A 1TKGA 1B1ZA 2JZPA 3O65B 2JF5A 4EE2A 3ZJVA 4PS8A 1I42A 2C60A 1GB1A 1EF5A 3U7ZA 2WHIA 1QOBA 1LXDA 4PS3A 2PTLA 3DBLI 3DWMA 4US8A 4NQLB 1UD7A 3L0WB 1V1OA 3IG3A 1IGDA 4HXDA 4HWIB 5KHOA 1SE4A 3SFEB 2E3TA 5TSSA 1J19A 2RR9A 1FNUA 3AE9B 4TUUA 5IP4D 1C1YB 2ASQA 1FD6A 3W1SC 2FIDA 2MQJA 4NQKE 1ZOYB 3RCZA 4WAFA 4UDUC 1WRIA 4F7ZA 2KJHB 3PT2B 2DLBA 3UGBB 1QOAA 2QDFA 4ZRKA 1A5RA 1OEYJ 4NJ7A 1TS5A 4M0WA 3I3TB 3PPAA 4M01A 4W9IA 2LGIA 2SEBD 4P1CC 4KSLC 3W2DA 1VRAB 1UH6A 1VZ8A 2A5UA 5H8YE 1MG8A 4S0RA 4LK0M 4HKQA 4ZYNA 1YN4A 3AN1A 1C79A 3VH4B 1HTQA 4XE0A 5G2NA 2HJ8A 3DCGA 2LGXA 2LHEA 1R4NI 1WZ3A 1JCKB 1F77A 2JVCA 1XLNA 1ZKHA 1TIFA 2KC1A 3NRZA 1HE8A 3P4SB 2DZIA 3PHWB 2WX0A 3KUDB 1FM0D 4D2KA 3EC8A 2FUHB 2MBEA 2IO2B 3NZUA 2MSED 4M8MA 3RYTA 2FIFA 3IAM1 4S17A 3NY5A 3I9V1 4C80A 1P3QU 3JSVA 2AWTA 4ZOHC 4DHJB 1PQSA 4FJVB 2KC2A 3Q3OC 4DWFA 4MEMA 1XCQL 1J7CA 3P2BA 3TEWA 4GN1A 2DWQA 3IT4B 4A8XC 3ZJUA 2WDQB 1R4MB 3BVMA 2BVCA 2PW9A 5J17A 4FJYA 1T3QA 2M56B 1I4RA 1CK1A 2MBOA 2RSUA 4ICUA 3M63B 3HVZA 2J7QB 4I6LB 2IO3B 5IOIA 1ESFA 2RGFA 2J53A 2KWCA 4ARCA 4XZ4A 4IC7B 4W9KA 2QC8A 3AE2B 3PSEB 2Y3AA 3V61A 2WNMA 4IWQA 2DYMA 1NDDA 3A4RA 3A1QB 1PGXA 1FRRA 4HPLB 2MP2B 4A20A 2DX5B 2VZKD 2LGSA 1RFAA 4WQMA 1WIAA 2O6VD 1L0YB 3ZJTA 4ANVA 3VUXA 4DDGD 1M4VA 2V1YA 3KLSX 4DQOC 4AOFA 2RMMA 4B0MA 4AS1A 2NMQA 3NVWA 3X23A 4ANWA 3Q3JA 3MJWA 1N6ZA 1EU3A 4GU2A 2N9LA 1OFFA 2WXJA 4K1RB 3WALA 1Q5WB 2JZ3B 2KWDA 1L2NA 2PVGC 4M8NA 3AECB 3IFWB 3QARA 4HLEA 2WXRA 2WXNA 2L05A 3BWUD 3JVZX 4WJPA 4W9DA 1JWUD 3B1LX 3N9YC 1WRDB 3QAQA 4MGIE 1WM2A 4RCOA 3PHXB 1KLVA 2KACA 4HJKA 1UF0A 1JMLA 3OG5A 4LTUA 4FA6A 5BYQA 5G5GA 3Q8BA 2M0AA 5J2RA 1YMHE 2WXFA 5G55A 4C7YA 3QX1A 1UGMA 4A3OA 5CHFA 1MHXA 1Q10A 2JRHA 2WLBA 2MBHA 4LLGM 2RPQA 3NZSA 3WIMA 5LXHA 1EF1A 1N60A 2N1WA 4L1BA 1WE7A 3ZRFA 3ZLZA 1J7BA 3WAPA 4ASWC 1OEYA 3ML9A 1SXTA 2Z0DB 1UELA 5DPWA 3Q8EA 4DHZB 2LRUA 1E7VA 1T0SC 3UIOB 5L83A 4BZAA 3AE3B 1I4HA 4LDTB 3KWVA 2EKIA 2G1EA 2H89B 3U2SC 2M4NA 2GBNA 2N7EA 4PYUA 3DWGC 2AQ2B 2W82A 1T6BX 2RPVA 2C7HA 3GE3C 3HM3A 5GMVA 2KZRA 1F9JA 1E8WA 2KYWA 2V4IB 3AH7A 3NVZA 2C7MB 2PKOA 3P1MA 3JW0X 1GPXA 4DXGA 2IO1B 4WWPA 2W3SA 3RD2A 3DOWA 3IT6B 1KFYB 2Z59B 4C56C 3PV1A 1OQQA 2I1JA 4EEWA 3P63A 1FXIA 2INNE 4AQ7A 3M62B 5DPTA 1AW7A 3ZTCA 1GC6A 4GLSC 2MJ3A 3A33B 5E6OA 4ZRPA 2NBUA 3AE1B 3SU8X 4BKGA 1C3TA 2Y5PA 3R2IA 4GXBA 1L5PA 3UQAA 3HVDA 3ZGZA 2KVZA 1D5ZC 2WXLA 2NR2A 2ZZPB 2IDYA 3ETRA 4LDTD 2D3GA 3OWEB 3NS8A 2DZMA 1DOXA 3H7PB 3V05A 2R61A 2PEAA 1I35A 3TSSA 3KVFB 4DK5A 2CR5A 2PVOD 1UNSA 2A4ZA 3NVVA 1R4MI 2ZPYA 3W1SA 1ENFA 4ZRJA 3L16A 5EE9A 1XLPA 1D3ZA 2DBYA 4NZLB 3QQ8B 1OTRB 2BWES 3C0RB 1KOTA 3EFUA 4IWOA 3RMKC 5BYRA 3RUIB 1WFYA 1JROA 2MJEA 2JX5A 3LJ3A 2E6XA 2FE8A 2WGSA 3W1YA 4LNIA 1V2YA 4I6NB 2D3BA 2VRRB 4WJNA 4JQWC 4W9GA 3CF6E 1E10A 4XYCA 3MFGA 2K25A 3ZTDA 4P6VF 2BW2A 2M8SA 1VZ6A 4J6IA 4AJYB 2V3NA 3TL5A 4NJCA 1WXQA 3T9LA 2OEDA 1JWSD 2LGDA 2G45B 1SE2A 2J52A 3N1XC 1WGDA 2V4LA 4ICVA 4WH4A 3EA6A 5EE3A 2GBMA 1FXAA 1YJIA 4IUMB 4OZBA 3DBHB 1P98A 3EHVA 3TCAA 1T0RC 2MEKA 5G5HA 2I1KA 3RNCC 2C9WB 2NS5A 4C4VA 3GOEA 1SEBD 4FJZA 4MGYE 5AEKB 4MSQB 4DXFA 2LUMA 4FULA 2V3SA 2J42A 1C77A 1K8RB 4GSWA 2J0MA 4P7IA 2FAZA 3RULA 3EFCA 3ZNHB 5T8IA 2LHDA 2DAFA 4W9FA 2JT4B 3E9SA 4PK1A 2KOXA 3PZDA 2ZVOA 3BZDB 2L8JA 1WXAA 3RN9C 4TQ0A 2WU2B 4WWOA 5IAAC 3PGEA 2VH2A 3EECA 3WCQA 1SF0A 2B3AA 2G4SA 5C23A 4MELA 1P0RA 1T5XD 2IY0B 2W55A 3DBLB 4IM0A 1WJ4A 4RGOS 2D3AA 3VTVA 3RNGC 3UQBA 2R2OA 2ZNVB 1RRBA 1WX7A 3ZXVA 2CHWA 1YOVB 3A9JA 5JH5C 3LYYA 1PYWD 4OVUA 1WI0A 3IHPC 2JWUA 3VRBB 2ZVNA 2K5PA 4OZAA 3IXSA 5D94A 3RNEC 4HK2A 2K3UA 2GOWA 3VXWA 5JHBA 5AUIA 5JXVA 3V3XA 3VRAB 3FILB 4PYZA 2QILA 3K9OB 1DYQA 3AEDB 2K39A 3AEBB 1NI3A 1KLGD 1P7EA 4IKGA 5FR6A 3H7PA 1HZ6A 3QC8B 3A4SC 5C1ZA 2MH7A 3CIRB 2DHZA 2JXTA 3VR9B 2ZCBA 1XCTL 2KXJA 2KDBA 2KWVB 2D5GA 1WJUA 1DGJA 2I2YA 3NJTA 3AULA 3RZWC 3VHTC 2LFIA 4E71A 4RH6A 3L08A 4W9HA 3BIID 2NPTB 2LVPA 2W54A 4HEA1 2JQRB 2XNAC 4ACFA 3A9KA 3QK0A 1WZ0A 1EWCA 4YTPB 2QSDA 4BVUC 1J8CA 3DBRI 2ZEQA 3NZ3A 4RNAA 4YSYB 4FBJB 1K51A 3EUB2 2KN4A 3ZVVA 5KHQA 2D2QA 2M0XA 3FILA 5AZFA 2JUOA 2KDFB 4RM8A 2WXHA 3QIJA 4HDQA 4LNKA 5C2TB 3BK1A 1TS4A 2KJ6A 1PFDA 4YSXB 4GIVA 2BYFA 4JIOU 5HI1A 4C4VB 3KQ4A 1HTOA 1L0VB 2M19A 3Q3FA 2KLGA 3CSTA 2KFJA 2K6QA 1WX9A 3MC9A 3Q3MC 3FC4A 1WYGA 3N32A 4TSSA 1C9FA 2TSSA 3BK2A 3B2GA 5LLIA 1L6VA 4EFOA 3VVWB 4KGSA 4RGTA 4WJQA 1IGCA 1XXGA 3MC0B 1EO6A 1EWYC 3UI3A 4YWGG 2GRIA 2WU5B 3AEGB 1I4QA 3RT3B 3VH3B 5AUKA 2JY6A 4OZCA 1I4GA 2IBIB 4N6EB 3BYTB 2YVCA 1E0ZA 1VDVA 2ONQA 3RZFA 3IAS1 4FADA 2N7JA 1JALA 3NHEB 1ET6A 4IW0A 3L10B 2L1AA 5H92C 1RWSA 2FCNA 1MJDA 4RFBA 4FXCA 1ZDVA 2MW5A 1AN8A 4N59A 3Q8CA 4TQ1A 3H7SA 3ZQ4A 1FCCC 2AQ3B 2K1FA 3RI7C 4K7UA 1TBEA 2NBVB 2WX1A 3GB1A 5BMIA 2FCQA 4K3CA 4AP4C 4EZJA 1I4XA 3BVGA 4KIKB 4ZYSA 2DENB 2K22A 4MH8A 1VZ7A 4RF0A 4CO7A 3VDZA 1FMAD 3CSFA 1WH3A 4NAMA 4L23A 4A55A 2ZW1A 5LNK1 3WAOA 3ZRCA 1FPYA 1F2RC 2FNJB 4B95A 1E7PB 3DBRB 2AL6A 3B9JA 5E6PA 3QA8A 1PGBA 2KQ4X 1GUAB 2LJIA 2IYDB 2KDIA 5L95C 3N1YC 1SJHD 1S3SG 3AE5B 1FRDA 2KQ7A 1SIFA 3A9KB 2XEWA 4P1BC 3HM6X 2EKEC 3ZDMC 1NENB 1VJKA 2QMTA 3DVNU 2J0JA 2KWUB 2L32A 2LZ6A 1N61A 4BOSC 1WM3A 3RNBC 3ZNID 1ZXHA 1Q1OA 1QQRA 2WDRB 2KMMA 2QCZA 4HPMB 4G3XB 2Q5WD 4C00A 3KH0A 4BAXA 2CU3A 2M1MA 3H8HA 1GG3A 1RAXA 3ZNGC 4N9F4 2PMVA 4M02A 2BYEA 1HXYD 5CX3A 3MJ5A 4C7ZA 5HKHA 2KX0A 1FCLA 1SE9A 1WSPA 3LDZE 3Q69A 1UBQA 2MJDA 4IM3A 2K8CA 1NBFC 2BKRB 3MTNB 1VCBA 1FNVA 2BWFA 4ZRQA 1Y8RC 1C4PA 3AI5A 1LM8B 4OVZA 2IJ0A 4G0NB 4W9EA 2DZKA 2IY1B 3DPDA 2BYTA 1ROEA 2KMAA 4GDKB 3DVGY 4ANXA 1GB4A 2IGHA 3NG0A 2KKCA 4GOCA 4ANUA 2NBWB 1YN3A 2IO0B 1LO5D 3AU5A 3JSVB 4USAA 4RGMA 4FN2A 2R2QA 2KDMA 4JL9A 4B6WA 1VLBA 3KUZA 1D5XC 4EZKA 1WGYA 2G3QB 2L7RA 2OJRA 3VQIA 3N30A 1TY0A 1ET9A 4WWNA 5HG2A 3OJ3A 5E6NA 1XLOA 4YL8A 2Y5CA 2NTSA 5D2MB 1GOZA 1OQYA 4KGRA 2JYEA 2D3CA 2GLSA 2MHJA 2NVUI 3AM9A 3KW5B 4W9CA 2Y5BB 4PS7A 1V5OA 1V80A 2WDVB 1KTKA 2LVQA 1RYJA 5TR5A 2VZKB 1K52A 1ZUD2 2JSVX 4DHZE 2JZZA 3N1ZC 1LGRA 1QOGA 2KANA 1QT9A 1SBBB 1WR1A 3PO0A 1SIJA 3L4PA 1XD3B 4ITKA 1FNWA 4EUTA 1FFVA 2XK5A 2KO3A 4NY0A 3HRDD 2MLBA 1IUEA 1RLFA 4WURA 3I63C 4HCNB 1UBIA 4MSMB 4WAAA 3HHMA 3L13A 1RFKA 1CMXB 2ACZB 3ENEA 4KDLB 2JWZA 5DCNA 1CQVA 4PT5A 2PJHA 4ZDVA 4R3DA 3VFKA 4NNJB 3B2FA 3KYDD 3AXCA 1AWDA 5D7GA 4IM2A 2XN9C 1BT0A 3A1QA 3AEAB 4RM9A 1TYGB 2FCMA 3M3JA 4BKSD 3X0WA 1NI2A 5EE0A 1J0GA 3PTFC 1WY8A 2BGFA 2X8XX 2D10A 4YTNB 4JWUC 1C4CA 2K8BA 2AEHA 4IWPA 4TMAB 1HQRD 1Q0WB 3VTUA 4XWTA 5CHVC 2KFKB 2JRIB 1T0YA 1KRHA 1L4DB 2GI9A 2L52A 3L17A 4KIKA 2EMSA 3MC8A 1GNUA 1WGGA 3TJPA 4KX6B 2MA9B 3WA0A 1E8YA 5FK9C 4GGQA 2HTME 1V97A 2KK8A 1TY2A 4US9A 3RFZB 3VAWA 1MHHE 3CMMB 3V6EB 5E6JA 1WF9A 3AMZA 2O6VB 3W5UB 1QKZA 2BB6A 5HFYA 4KVGB 3GZNI 2CHXA 2KLCA 2NCNA 1YNTE 5IA7A 1YQ3B 3TEZA 3Q14C 2DNFA 1TKEA 1WMHB 1V86A 4X57B 1M94A 2CKHB 2HDEA 3C8YA 2IGDA 2K6DB 1K53A 3DHHC 4N58A 2WXMA 2MBBB 3BY4B 1E8XA 4G50A 1YQBA 1MI0A 3OAWA 4JGHB 2OOBB 4KZ0A 2IGGA 1TZOA 3BYYB 1OQRA 3T3OA 1N62A 3R2TA 2JPHA 2GMIC 1TJEA 4WIPA 2ZW0A 4ZHOA 3P4RB 1HZ5A 5JHAA 3DBSA 4YT0B 3PZ7A 3I57A 1AYFA 4YTMB 1VR9A 1V1PB 3PLVA 1R7SA 4RF1A 1YX6B 1TS2A 3H6NA 2O6VA 1HEZE 3TMPB 1GAQB 3I5JC 1KM7A 4REZA 2BS4B 4URKA 3MHZA 4MM3B 3NS1A 3R7QA 3GP7A 4GB9A 3Q8FA 2L0FA 3A9JB 4YXDB 3SDLC 1J7AA 5JZEB 4TKNA 2MP2A 1H4RA 3URYA 4HJGE 2JXXA 2K9XA 1STEA 1WE6A 1TKYA 1WGRA 3APCA 3U8ZA 1ZW7A 4YSZB 2BT6A 3ONSA 4GDKA 4HKZE 1CJEA 2EELA 2I38A 3OLMD 4WJOA 3R7RA 1D4BA 2ON8A 4B0EA 4F1SA 3H1UA 1XT9B 2NTTA 3DVGX 1LFDA 4KKIA 3Q8AA 2N0SB 1WX8A 2IPKD 3V6CB 1TGZB 4CYEA 2CJOA 1C76A 1SGHA 1TT5B 4MGKE 3U4EG 3GE8C 1NYRA 1WJ6A 4HCPB 3LXFA 2L3ZA 1PGAA 3S2AA 2XBBC 3TUOA 1E6EB 2LGYA 2NPTA 2CU1A 4HVBA 1FO4A 1WWTA 4XDDA 1GJZA 4OVVA 2QIEB 1CZPA 1YD8U 3IVFA 1E5WA 4WWMA 4II3B 4KV2A 3OJ4B 4JLCA 3GZNB 5EDSA 5GXGB 2V9HA 3WAMA 2DAJA 5FR3A 2HD5B 3Q6BA 1C78A 4MGZE 3W5VB 3SEBA 3NUHB 1IP9A 4XC2A 1WMHA 3LB8C 2PE6B 2XK5B 1JW9D 2CJNA 3VR8B 1V49A 1Z2MA 4G11A 5D3IB 3BINA 2HJ1A 1P1AA 2X38A 3AU4A 3PS6A 2WS3B 3QWZB 5J18A 2KDEB 4GMVA 2KFKA 2BS2B 2LUEA 4K81A 5FKAC 1WJNA 4XX5A 4DBGA 3SFDB 2IZVB 1B9RA 1EM7A 4II2B 1D6EC 2V3PA 4A90A 4EKUA 4I6PA 4AWJA 3ABVB 3PVLA 3AB5A 4FHKA 4M00A 1E90A 4MJSA 1ZXIA 3QHTA 2WXIA 1UWMA 1WXMA 1ZPSA 1V8CA 2DZJA 4KDIC 4HROA 2REXA 1YX5B 5BO4B 2H88B 3Q2AC 4MDKE 2OHFA 3ZW3A 1H8CA 3RNAC 1ZDXA 4FLHA 1X1MA 3SD5A 3WANA 4NAWA 3CWIA 1R4NB 3DHGC 5DPRA 1BMLC 2GB1A 4JWSC 4BOZB 1MG4A 4MACA 1I7HA 4OW0A 3ZO5B 4E74A 2PLPA 1WGHA 3ZKJC 4KKJA 3JYUA 3T3NA 3RPFC 3DHIC 2WXKA 4L2YA 2LXAA 2K8HA 4ZHPA 4K3BA 1AARA 1F0ZA 3T8MA 2HTHA 1V1PA 4F8CB 1YJJA 4LCDE 1JWMD 1WGKA 3ML8A 3ZYYX 3MHSD 2CHZA 3K9PB 3AE4B 5HHDG 4NPNA 4B9KA 1IYFA 4QAYA 2UYZB 3DBHI 3P4QB 1UUPA 1FXTB 3APDA 2PPHA 1XQQA 5BMGA 1MPEA 1NVID 1XO3A 4P16A 2YLMA 4NAWB 1ZP0B 4AUQC 1XLQA 1ZE3D 5D3DA 3M95A 1WXVA 2WWZA 2KTRA 2INCC 2QEJC 5IKCM 2WP9B 2LASA 3VTWA 2G4DB 3E56A 2KMCA 3AE8B 4DDID 2LD9A 3PREA 2MX2A 2MRPA 2KHWB 2ZPNA 4H2AA 2PE9A 1JQ4A 2YEPF 2BQQA 5BYSA 1PDXA 1OGWA 2O2VB 1XEEA 1DOYA 3ZXRA 5EE1A 4HDOA 3R66C 2WXOA 2G9HD 4FHJA 2N9PC 1D5MC 3R3MA 2V0GA 4MT5A 2UWQA 1WXSA 5AZGA 4WQOB 4A6QA 2KT7A 5BMHA 3SR6A 2ZCCA 2LRWA 1F2RI 3R8BA 5IO9A 3AE7B 3C19A 1KF6B 2INDC 4JE3B 3TEYA 1EU4A 1G6JA 1T0QC 4IOIE 1PUTA 3NVYA 4A9AA 1BXTA 1QILA 3U30A 2KX3A 2LWPA 1YN5A 4KSKC 2WQYB 4GDLA 1JRUA 3TEXA 4BBNF 1FFUA 4RMAA 2BTEA 4DXAB 4JPSA 1VD2A 4Q2JA 1QOFA 3PLUA 1QZEA 3ALBA 3DQVA 2WYQA 3Q3NC 3B08A 4BBNC 1P9DU 5IN7A 1Z5SB 4BKSA 5MPOA 3KWLA 2UU7A 1HA5A 4EZLA 1BUIC 2L0TA 4W9LA 1UZXB 3PZ8A 4KZCA 1FEHA 1F1HA 2L83A 3AEFB 3B0AA 1SE3A 3VUWA 2KTFA 2DYOA 2KD0A 4O1NA 2BBCA 3FAHA 2WDTB 4HRSA 1A70A 3U7DA 2N4FA 1XF5L 2VH1A 3EGRA 4IDIA 2PIAA 1ACCA 4IG7B 2LXCA 1TTNA 2KN5A 3PRZA 1N5WA 3IBEA 1E9MA 1UGJA 2AYOB 2LEKA 2DYBA 3TBLD 2RDGA 2KVRA 5LXIB 1YIWA 3V60A 2D07B 3SHQA 1UWXA 2WXGA 4MJSB 5CTRC 2AL3A 1SSNA 2FUG1 2B76B 3H9DA 2KAJA 1V6EA 1YJ1A 2KQSA 4AJWA 4K7WA 1L0XB 1RM6C 3N20C 2INPE 3HK0A 2RDHA 1MFWA 4HPPA 1JRPA 3HUIA 4E3CA 1QF6A 3ZNZB 3UF8A 2BF8B 2ICIA 2MCNB 4EOYA 1KLUD 1L6UA 2GBRA 3QJZA 1L4ZB 1V81A 2BS3B 1V9JA 5CHWA 2FCSA 2LJ5A 2KTRB 2N9EB 2Z0EB 3KYCD 2W3RA 2FBWB 1FIQA 3ZIMA 2AX5A 2WXPA 4LNNA 4W9JA 3TIXA 1P7FA 3V62A 2HE7A 3FKYA 1Y56A 1ISNA 2LVOA 3ECIA 3O13A 3RNFC 2L00B 3P42A 4ARIA 3DDCB 3UINB 1SB3C 2Z8LA 2BKFA 1DOIA 1LQBA 3PRPB 2OJWA 1L7YA 1NYQA 2W9NA 1KJTA 4XDCA 2BYVE 4XGAB 1YQ4B 5C3JB 2CS4A 2KNBA 3HIZA 1WR6E 2C7NB 2KJRA 1IBXA 2C5LC 1N63A 1TZ1A 2MBQA 4GDLB 1E7UA 4JX1C 3PRMB 1S1QB 1IPGA 2MWSB 2D11A 3QCAA 1NEKB 3APFA 4M0WB 3UIPB 2WXQA 4BKTA 1IBXB 2J0KA 4LNOA 1TS3A 2LI5A 3AEEB 3N3KB 1I4PA 2GBJA 3NOBA 2BPSA 4XWWA 2K0PA 1GC7A 1U4AA 4RGNA 4BFRA 2N9KA 2N7DA 3AV8A 2QJLA
chains in the Genus database with same CATH topology
2AL6A 4EEWA 1YD8U 3IVFA 5E6PA 1WYWB 2EMTA 3D32A 3QA8A 3VUYA 5D6JB 1E5WA 1GUAB 4II3B 4KV2A 3M62B 3OJ4B 4DHJD 5DPTA 2IYDB 2KDIA 4A3PA 2ZJDA 4MM3A 4JLCA 3ZTCA 3L54A 5L95C 5EDSA 3WAMA 1GC6A 2O2VA 1S3SG 2DAJA 2HD5B 2KQ7A 3A33B 1SIFA 4MGZE 3A9KB 2XEWA 5E6OA 2NBUA 3HM6X 1IP9A 4XC2A 3SU8X 2EKEC 3ZDMC 4BKGA 1C3TA 1WMHA 3DVNU 2J0JA 2PE6B 2XK5B 2KWUB 2LZ6A 4LJPB 1EUVB 4BOSC 1V49A 1WM3A 1Z2MA 4G11A 4GXBA 5AZHA 3ZNID 3UQAA 4CHKA 3BINA 1Q1OA 5DPSA 1P1AA 4HPMB 4G3XB 2NR2A 3AU4A 4NJ6A 2ZZPB 3KH0A 3PS6A 3DVNV 4LDTD 2M1MA 3QWZB 4LJOB 2D3GA 5J18A 1GG3A 1RAXA 2KDEB 2M17A 4GMVA 3ZNGC 2KFKA 4MH0E 4N9F4 2QHOA 2BYEA 3KUCB 2LUEA 3NS8A 4K81A 5CX3A 2DZMA 1WJNA 4TV3A 1E8ZA 3H7PB 4XX5A 4K7SA 3ZDTA 5HKHA 4DBGA 2KX0A 2PEAA 2IZVB 1SE9A 1I35A 3KVFB 2L76A 4II2B 4DK5A 2CR5A 3LDZE 3ZUNA 4EKUA 1UBQA 2N9XA 2ZNVC 4IM3A 4I6PA 4ZRIA 2K8CA 1NBFC 2BKRB 2N1VA 4AWJA 3MTNB 2A4ZA 2RD0A 1R4MI 2GBKA 1VCBA 2ZPYA 1ZGUB 3PVLA 2BWFA 4FHKA 3W1SA 1Y8RC 4ZRJA 1V5TA 3L16A 1E90A 3AI5A 1LM8B 1D3ZA 4G0NB 4W9EA 2DZKA 3QQ8B 1OTRB 2BWES 2IY1B 3C0RB 3DPDA 3QHTA 4MJSA 1KOTA 3O65B 2JF5A 2KMAA 3EFUA 3DVGY 4GDKB 4ANXA 4IWOA 4PS8A 3RUIB 1WXMA 2KKCA 4GOCA 4ANUA 1I42A 2NBWB 1WFYA 2DZJA 4KDIC 2C60A 2REXA 1YX5B 5BO4B 1EF5A 3LJ3A 1LXDA 2IO0B 3W1YA 1V2YA 3AU5A 3JSVB 4I6NB 4MDKE 2VRRB 4PS3A 4WJNA 4JQWC 4W9GA 3CF6E 3DBLI 4FN2A 3ZW3A 1H8CA 2R2QA 2K25A 4NQLB 3ZTDA 1UD7A 4JL9A 4B6WA 3L0WB 3KUZA 4FLHA 4EZKA 1X1MA 3IG3A 3SD5A 1WGYA 2G3QB 2M8SA 3WANA 4HXDA 4J6IA 4NAWA 4AJYB 2L7RA 2OJRA 3VQIA 5DPRA 3TL5A 4HWIB 5KHOA 3N30A 3T9LA 2LGDA 1J19A 2RR9A 2G45B 4WWNA 4BOZB 4TUUA 3OJ3A 5E6NA 4YL8A 3ZO5B 1C1YB 1WGDA 2V4LA 4ICVA 5D2MB 1OQYA 2ASQA 4E74A 3W1SC 1WGHA 3ZKJC 2FIDA 2GBMA 3JYUA 2MQJA 4IUMB 4NQKE 1P98A 2NVUI 3EHVA 3KW5B 3RCZA 2LXAA 4W9CA 2Y5BB 2K8HA 3TCAA 4PS7A 2I1KA 1AARA 2C9WB 1V5OA 1V80A 2LVQA 4F7ZA 2NS5A 5TR5A 2KJHB 3PT2B 3T8MA 3GOEA 2HTHA 3UGBB 4F8CB 4ZRKA 1A5RA 4FJZA 1OEYJ 4NJ7A 4DHZE 4MGYE 2JZZA 3I3TB 4LCDE 2KANA 3ML8A 3MHSD 4MSQB 5AEKB 1WR1A 3PPAA 2CHZA 4W9IA 3K9PB 4FULA 2V3SA 4NPNA 1XD3B 1K8RB 4KSLC 4EUTA 2XK5A 2KO3A 4GSWA 4NY0A 1UH6A 2A5UA 2J0MA 2MLBA 1MG8A 1RLFA 4P7IA 4B9KA 4ZYNA 1IYFA 2UYZB 2FAZA 3RULA 3DBHI 3ZNHB 2DAFA 4W9FA 1FXTB 2JT4B 2PPHA 3APDA 2KOXA 3PZDA 2ZVOA 3VH4B 1XQQA 5G2NA 2L8JA 1WXAA 4HCNB 1UBIA 4MSMB 4WAAA 2YLMA 3HHMA 3L13A 2HJ8A 4NAWB 4AUQC 4TQ0A 1CMXB 3ENEA 4KDLB 3DCGA 4WWOA 2LGXA 2JWZA 5DCNA 5IAAC 3PGEA 1R4NI 1WZ3A 3M95A 1WXVA 2WWZA 3EECA 2KTRA 2PJHA 4ZDVA 2B3AA 2JVCA 2G4SA 2LASA 3VFKA 1ZKHA 5C23A 3VTWA 4MELA 2KC1A 1P0RA 2G4DB 4NNJB 2KMCA 1HE8A 2IY0B 2DZIA 3PHWB 2WX0A 3KUDB 3KYDD 4DDID 3AXCA 4IM0A 1WJ4A 2LD9A 5D7GA 3PREA 4IM2A 3A1QA 1BT0A 3EC8A 2MX2A 2FUHB 2IO2B 2MBEA 2KHWB 2MRPA 4RM9A 3M3JA 2FCMA 3VTVA 4BKSD 2ZPNA 3UQBA 3X0WA 2R2OA 1NI2A 2ZNVB 2PE9A 3NZUA 1RRBA 1WX7A 2MSED 4M8MA 2CHWA 2FIFA 3A9JA 3RYTA 3NY5A 5JH5C 1P3QU 1OGWA 3JSVA 4OVUA 2AWTA 1WI0A 2O2VB 1WY8A 2BGFA 3PTFC 1J0GA 2D10A 3IHPC 4IG7B 4DHJB 1PQSA 4FJVB 2K8BA 4HDOA 3R66C 2AEHA 2KC2A 4IWPA 4DWFA 4MEMA 1Q0WB 2ZVNA 3P2BA 3VTUA 5CHVC 4FHJA 2N9PC 3R3MA 5D94A 2KFKB 4GN1A 2JRIB 2UWQA 4HK2A 1WXSA 5AZGA 4WQOB 1T0YA 2GOWA 3VXWA 5JHBA 3L17A 5J17A 4KIKA 2ZCCA 2LRWA 4FJYA 2EMSA 1GNUA 4PYZA 1G6JA 2MBOA 2RSUA 4ICUA 3K9OB 3M63B 1WGGA 2J7QB 4I6LB 3TJPA 2IO3B 2K39A 2MA9B 2RGFA 3U30A 3WA0A 1E8YA 5FR6A 2KX3A 2LWPA 2KWCA 3H7PA 3QC8B 4KSKC 4XZ4A 4GDLA 3A4SC 4IC7B 4GGQA 5C1ZA 1JRUA 4W9KA 4BBNF 4RMAA 3PSEB 4DXAB 2DHZA 2KK8A 3V61A 1VD2A 2ZCBA 2KXJA 2KDBA 3PLUA 4IWQA 1QZEA 2DYMA 2KWVB 1NDDA 3A4RA 3A1QB 3VAWA 3ALBA 3DQVA 2WYQA 4HPLB 2MP2B 3B08A 4A20A 1WJUA 1P9DU 4BBNC 2DX5B 1Z5SB 4BKSA 3VHTC 3AULA 3RZWC 4E71A 4EZLA 3L08A 1RFAA 3CMMB 3V6EB 2L0TA 1WIAA 1WF9A 4W9LA 4W9HA 2NPTB 1UZXB 2LVPA 2O6VD 2O6VB 4KZCA 3A9KA 3QK0A 1WZ0A 4KVGB 3GZNI 3B0AA 4ANVA 2CHXA 2KLCA 2NCNA 3VUXA 4DDGD 5IA7A 3VUWA 2KTFA 4BVUC 2DYOA 2KD0A 2V1YA 1J8CA 1WMHB 1V86A 3DBRI 2ZEQA 4AOFA 4X57B 2WDTB 1M94A 2CKHB 4FBJB 3U7DA 2K6DB 2N4FA 3ZVVA 5KHQA 2D2QA 3X23A 2M0XA 2MBBB 5AZFA 4ANWA 3BY4B 1E8XA 2JUOA 2KDFB 1YQBA 1TTNA 2KN5A 2LXCA 3PRZA 3Q3JA 3QIJA 4G50A 4HDQA 4RM8A 3MJWA 3IBEA 2AYOB 2KJ6A 3OAWA 2DYBA 4JGHB 3TBLD 4GU2A 4GIVA 2KVRA 2BYFA 4JIOU 5LXIB 2OOBB 4K1RB 1YIWA 4KZ0A 3V60A 2D07B 3WALA 1Q5WB 2JZ3B 3SHQA 3Q3FA 2KLGA 3CSTA 4MJSB 2KFJA 5CTRC 2AL3A 2GMIC 2JPHA 1L2NA 4M8NA 2K6QA 3IFWB 3QARA 1WX9A 5JHAA 3DBSA 4HLEA 3N32A 3H9DA 2L05A 5LLIA 3JVZX 4WJPA 4W9DA 1V6EA 3PLVA 1YJ1A 2KQSA 3VVWB 4K7WA 4AJWA 3B1LX 4EFOA 1YX6B 3HK0A 1WRDB 3QAQA 4MGIE 4WJQA 3H6NA 2O6VA 1WM2A 4E3CA 1EO6A 3PHXB 1KLVA 4HJKA 3ZNZB 3UF8A 3TMPB 2BF8B 2MCNB 1KM7A 4EOYA 3RT3B 4FA6A 4URKA 2GBRA 3QJZA 5J2RA 1V81A 3VH3B 1V9JA 5CHWA 2FCSA 2LJ5A 2KTRB 5G55A 2N9EB 3R7QA 2Z0EB 3KYCD 3QX1A 2JY6A 4GB9A 1UGMA 2IBIB 2L0FA 3A9JB 4A3OA 5CHFA 3SDLC 2JRHA 2YVCA 2MBHA 2RPQA 3ZIMA 3NZSA 3WIMA 5LXHA 4W9JA 3TIXA 1EF1A 2N1WA 3RZFA 3ZRFA 1WE7A 3ZLZA 3V62A 3WAPA 2HE7A 4FADA 5JZEB 1ISNA 4TKNA 3NHEB 2MP2A 1H4RA 1OEYA 2LVOA 3ECIA 4IW0A 3L10B 4ASWC 3ML9A 2L00B 3DDCB 3UINB 2JXXA 1WE6A 1WGRA 3U8ZA 3APCA 1ZW7A 2BKFA 2Z0DB 2FCNA 1UELA 5DPWA 3ONSA 4GDKA 1LQBA 4DHZB 3PRPB 2LRUA 1L7YA 1E7VA 2W9NA 1KJTA 3UIOB 5L83A 2MW5A 2BYVE 3OLMD 4WJOA 4TQ1A 4LDTB 3R7RA 3H7SA 2CS4A 2KNBA 2M4NA 2GBNA 2K1FA 3HIZA 2N7EA 4PYUA 1WR6E 2C7NB 2KJRA 4K7UA 4F1SA 1XT9B 3H1UA 2C5LC 3DVGX 1LFDA 1TBEA 1TZ1A 2C7HA 2NBVB 2WX1A 2MBQA 4GDLB 1E7UA 3HM3A 5GMVA 2FCQA 1WX8A 4AP4C 4EZJA 2KZRA 4KIKB 3PRMB 1S1QB 3V6CB 1IPGA 1F9JA 1E8WA 2DENB 2MWSB 1TGZB 2D11A 3QCAA 4CYEA 3APFA 1SGHA 4MGKE 2C7MB 4M0WB 3UIPB 1WJ6A 4HCPB 4CO7A 3VDZA 2L3ZA 3CSFA 3JW0X 4BKTA 1WH3A 2J0KA 3S2AA 2LI5A 2XBBC 2LGYA 3N3KB 3NOBA 2GBJA 2IO1B 2BPSA 2NPTA 2CU1A 4WWPA 1GC7A 3WAOA 3ZRCA 4HVBA 3RD2A 1U4AA 3DOWA 4BFRA 2Z59B 2FNJB 2N7DA 1GJZA 4OVVA 3PV1A 4B95A 2I1JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AL6 A;  4EEW A;  1YD8 U;  3IVF A;  5E6P A;  1WYW B;  2EMT A;  3D32 A;  3QA8 A;  3VUY A;  5D6J B;  1E5W A;  1GUA B;  4II3 B;  4KV2 A;  3M62 B;  3OJ4 B;  4DHJ D;  5DPT A;  2IYD B;  2KDI A;  4A3P A;  2ZJD A;  4MM3 A;  4JLC A;  3ZTC A;  3L54 A;  5L95 C;  5EDS A;  3WAM A;  1GC6 A;  2O2V A;  1S3S G;  2DAJ A;  2HD5 B;  2KQ7 A;  3A33 B;  1SIF A;  4MGZ E;  3A9K B;  2XEW A;  5E6O A;  2NBU A;  3HM6 X;  1IP9 A;  4XC2 A;  3SU8 X;  2EKE C;  3ZDM C;  4BKG A;  1C3T A;  1WMH A;  3DVN U;  2J0J A;  2PE6 B;  2XK5 B;  2KWU B;  2LZ6 A;  4LJP B;  1EUV B;  4BOS C;  1V49 A;  1WM3 A;  1Z2M A;  4G11 A;  4GXB A;  5AZH A;  3ZNI D;  3UQA A;  4CHK A;  3BIN A;  1Q1O A;  5DPS A;  1P1A A;  4HPM B;  4G3X B;  2NR2 A;  3AU4 A;  4NJ6 A;  2ZZP B;  3KH0 A;  3PS6 A;  3DVN V;  4LDT D;  2M1M A;  3QWZ B;  4LJO B;  2D3G A;  5J18 A;  1GG3 A;  1RAX A;  2KDE B;  2M17 A;  4GMV A;  3ZNG C;  2KFK A;  4MH0 E;  4N9F 4;  2QHO A;  2BYE A;  3KUC B;  2LUE A;  3NS8 A;  4K81 A;  5CX3 A;  2DZM A;  1WJN A;  4TV3 A;  1E8Z A;  3H7P B;  4XX5 A;  4K7S A;  3ZDT A;  5HKH A;  4DBG A;  2KX0 A;  2PEA A;  2IZV B;  1SE9 A;  1I35 A;  3KVF B;  2L76 A;  4II2 B;  4DK5 A;  2CR5 A;  3LDZ E;  3ZUN A;  4EKU A;  1UBQ A;  2N9X A;  2ZNV C;  4IM3 A;  4I6P A;  4ZRI A;  2K8C A;  1NBF C;  2BKR B;  2N1V A;  4AWJ A;  3MTN B;  2A4Z A;  2RD0 A;  1R4M I;  2GBK A;  1VCB A;  2ZPY A;  1ZGU B;  3PVL A;  2BWF A;  4FHK A;  3W1S A;  1Y8R C;  4ZRJ A;  1V5T A;  3L16 A;  1E90 A;  3AI5 A;  1LM8 B;  1D3Z A;  4G0N B;  4W9E A;  2DZK A;  3QQ8 B;  1OTR B;  2BWE S;  2IY1 B;  3C0R B;  3DPD A;  3QHT A;  4MJS A;  1KOT A;  3O65 B;  2JF5 A;  2KMA A;  3EFU A;  3DVG Y;  4GDK B;  4ANX A;  4IWO A;  4PS8 A;  3RUI B;  1WXM A;  2KKC A;  4GOC A;  4ANU A;  1I42 A;  2NBW B;  1WFY A;  2DZJ A;  4KDI C;  2C60 A;  2REX A;  1YX5 B;  5BO4 B;  1EF5 A;  3LJ3 A;  1LXD A;  2IO0 B;  3W1Y A;  1V2Y A;  3AU5 A;  3JSV B;  4I6N B;  4MDK E;  2VRR B;  4PS3 A;  4WJN A;  4JQW C;  4W9G A;  3CF6 E;  3DBL I;  4FN2 A;  3ZW3 A;  1H8C A;  2R2Q A;  2K25 A;  4NQL B;  3ZTD A;  1UD7 A;  4JL9 A;  4B6W A;  3L0W B;  3KUZ A;  4FLH A;  4EZK A;  1X1M A;  3IG3 A;  3SD5 A;  1WGY A;  2G3Q B;  2M8S A;  3WAN A;  4HXD A;  4J6I A;  4NAW A;  4AJY B;  2L7R A;  2OJR A;  3VQI A;  5DPR A;  3TL5 A;  4HWI B;  5KHO A;  3N30 A;  3T9L A;  2LGD A;  1J19 A;  2RR9 A;  2G45 B;  4WWN A;  4BOZ B;  4TUU A;  3OJ3 A;  5E6N A;  4YL8 A;  3ZO5 B;  1C1Y B;  1WGD A;  2V4L A;  4ICV A;  5D2M B;  1OQY A;  2ASQ A;  4E74 A;  3W1S C;  1WGH A;  3ZKJ C;  2FID A;  2GBM A;  3JYU A;  2MQJ A;  4IUM B;  4NQK E;  1P98 A;  2NVU I;  3EHV A;  3KW5 B;  3RCZ A;  2LXA A;  4W9C A;  2Y5B B;  2K8H A;  3TCA A;  4PS7 A;  2I1K A;  1AAR A;  2C9W B;  1V5O A;  1V80 A;  2LVQ A;  4F7Z A;  2NS5 A;  5TR5 A;  2KJH B;  3PT2 B;  3T8M A;  3GOE A;  2HTH A;  3UGB B;  4F8C B;  4ZRK A;  1A5R A;  4FJZ A;  1OEY J;  4NJ7 A;  4DHZ E;  4MGY E;  2JZZ A;  3I3T B;  4LCD E;  2KAN A;  3ML8 A;  3MHS D;  4MSQ B;  5AEK B;  1WR1 A;  3PPA A;  2CHZ A;  4W9I A;  3K9P B;  4FUL A;  2V3S A;  4NPN A;  1XD3 B;  1K8R B;  4KSL C;  4EUT A;  2XK5 A;  2KO3 A;  4GSW A;  4NY0 A;  1UH6 A;  2A5U A;  2J0M A;  2MLB A;  1MG8 A;  1RLF A;  4P7I A;  4B9K A;  4ZYN A;  1IYF A;  2UYZ B;  2FAZ A;  3RUL A;  3DBH I;  3ZNH B;  2DAF A;  4W9F A;  1FXT B;  2JT4 B;  2PPH A;  3APD A;  2KOX A;  3PZD A;  2ZVO A;  3VH4 B;  1XQQ A;  5G2N A;  2L8J A;  1WXA A;  4HCN B;  1UBI A;  4MSM B;  4WAA A;  2YLM A;  3HHM A;  3L13 A;  2HJ8 A;  4NAW B;  4AUQ C;  4TQ0 A;  1CMX B;  3ENE A;  4KDL B;  3DCG A;  4WWO A;  2LGX A;  2JWZ A;  5DCN A;  5IAA C;  3PGE A;  1R4N I;  1WZ3 A;  3M95 A;  1WXV A;  2WWZ A;  3EEC A;  2KTR A;  2PJH A;  4ZDV A;  2B3A A;  2JVC A;  2G4S A;  2LAS A;  3VFK A;  1ZKH A;  5C23 A;  3VTW A;  4MEL A;  2KC1 A;  1P0R A;  2G4D B;  4NNJ B;  2KMC A;  1HE8 A;  2IY0 B;  2DZI A;  3PHW B;  2WX0 A;  3KUD B;  3KYD D;  4DDI D;  3AXC A;  4IM0 A;  1WJ4 A;  2LD9 A;  5D7G A;  3PRE A;  4IM2 A;  3A1Q A;  1BT0 A;  3EC8 A;  2MX2 A;  2FUH B;  2IO2 B;  2MBE A;  2KHW B;  2MRP A;  4RM9 A;  3M3J A;  2FCM A;  3VTV A;  4BKS D;  2ZPN A;  3UQB A;  3X0W A;  2R2O A;  1NI2 A;  2ZNV B;  2PE9 A;  3NZU A;  1RRB A;  1WX7 A;  2MSE D;  4M8M A;  2CHW A;  2FIF A;  3A9J A;  3RYT A;  3NY5 A;  5JH5 C;  1P3Q U;  1OGW A;  3JSV A;  4OVU A;  2AWT A;  1WI0 A;  2O2V B;  1WY8 A;  2BGF A;  3PTF C;  1J0G A;  2D10 A;  3IHP C;  4IG7 B;  4DHJ B;  1PQS A;  4FJV B;  2K8B A;  4HDO A;  3R66 C;  2AEH A;  2KC2 A;  4IWP A;  4DWF A;  4MEM A;  1Q0W B;  2ZVN A;  3P2B A;  3VTU A;  5CHV C;  4FHJ A;  2N9P C;  3R3M A;  5D94 A;  2KFK B;  4GN1 A;  2JRI B;  2UWQ A;  4HK2 A;  1WXS A;  5AZG A;  4WQO B;  1T0Y A;  2GOW A;  3VXW A;  5JHB A;  3L17 A;  5J17 A;  4KIK A;  2ZCC A;  2LRW A;  4FJY A;  2EMS A;  1GNU A;  4PYZ A;  1G6J A;  2MBO A;  2RSU A;  4ICU A;  3K9O B;  3M63 B;  1WGG A;  2J7Q B;  4I6L B;  3TJP A;  2IO3 B;  2K39 A;  2MA9 B;  2RGF A;  3U30 A;  3WA0 A;  1E8Y A;  5FR6 A;  2KX3 A;  2LWP A;  2KWC A;  3H7P A;  3QC8 B;  4KSK C;  4XZ4 A;  4GDL A;  3A4S C;  4IC7 B;  4GGQ A;  5C1Z A;  1JRU A;  4W9K A;  4BBN F;  4RMA A;  3PSE B;  4DXA B;  2DHZ A;  2KK8 A;  3V61 A;  1VD2 A;  2ZCB A;  2KXJ A;  2KDB A;  3PLU A;  4IWQ A;  1QZE A;  2DYM A;  2KWV B;  1NDD A;  3A4R A;  3A1Q B;  3VAW A;  3ALB A;  3DQV A;  2WYQ A;  4HPL B;  2MP2 B;  3B08 A;  4A20 A;  1WJU A;  1P9D U;  4BBN C;  2DX5 B;  1Z5S B;  4BKS A;  3VHT C;  3AUL A;  3RZW C;  4E71 A;  4EZL A;  3L08 A;  1RFA A;  3CMM B;  3V6E B;  2L0T A;  1WIA A;  1WF9 A;  4W9L A;  4W9H A;  2NPT B;  1UZX B;  2LVP A;  2O6V D;  2O6V B;  4KZC A;  3A9K A;  3QK0 A;  1WZ0 A;  4KVG B;  3GZN I;  3B0A A;  4ANV A;  2CHX A;  2KLC A;  2NCN A;  3VUX A;  4DDG D;  5IA7 A;  3VUW A;  2KTF A;  4BVU C;  2DYO A;  2KD0 A;  2V1Y A;  1J8C A;  1WMH B;  1V86 A;  3DBR I;  2ZEQ A;  4AOF A;  4X57 B;  2WDT B;  1M94 A;  2CKH B;  4FBJ B;  3U7D A;  2K6D B;  2N4F A;  3ZVV A;  5KHQ A;  2D2Q A;  3X23 A;  2M0X A;  2MBB B;  5AZF A;  4ANW A;  3BY4 B;  1E8X A;  2JUO A;  2KDF B;  1YQB A;  1TTN A;  2KN5 A;  2LXC A;  3PRZ A;  3Q3J A;  3QIJ A;  4G50 A;  4HDQ A;  4RM8 A;  3MJW A;  3IBE A;  2AYO B;  2KJ6 A;  3OAW A;  2DYB A;  4JGH B;  3TBL D;  4GU2 A;  4GIV A;  2KVR A;  2BYF A;  4JIO U;  5LXI B;  2OOB B;  4K1R B;  1YIW A;  4KZ0 A;  3V60 A;  2D07 B;  3WAL A;  1Q5W B;  2JZ3 B;  3SHQ A;  3Q3F A;  2KLG A;  3CST A;  4MJS B;  2KFJ A;  5CTR C;  2AL3 A;  2GMI C;  2JPH A;  1L2N A;  4M8N A;  2K6Q A;  3IFW B;  3QAR A;  1WX9 A;  5JHA A;  3DBS A;  4HLE A;  3N32 A;  3H9D A;  2L05 A;  5LLI A;  3JVZ X;  4WJP A;  4W9D A;  1V6E A;  3PLV A;  1YJ1 A;  2KQS A;  3VVW B;  4K7W A;  4AJW A;  3B1L X;  4EFO A;  1YX6 B;  3HK0 A;  1WRD B;  3QAQ A;  4MGI E;  4WJQ A;  3H6N A;  2O6V A;  1WM2 A;  4E3C A;  1EO6 A;  3PHX B;  1KLV A;  4HJK A;  3ZNZ B;  3UF8 A;  3TMP B;  2BF8 B;  2MCN B;  1KM7 A;  4EOY A;  3RT3 B;  4FA6 A;  4URK A;  2GBR A;  3QJZ A;  5J2R A;  1V81 A;  3VH3 B;  1V9J A;  5CHW A;  2FCS A;  2LJ5 A;  2KTR B;  5G55 A;  2N9E B;  3R7Q A;  2Z0E B;  3KYC D;  3QX1 A;  2JY6 A;  4GB9 A;  1UGM A;  2IBI B;  2L0F A;  3A9J B;  4A3O A;  5CHF A;  3SDL C;  2JRH A;  2YVC A;  2MBH A;  2RPQ A;  3ZIM A;  3NZS A;  3WIM A;  5LXH A;  4W9J A;  3TIX A;  1EF1 A;  2N1W A;  3RZF A;  3ZRF A;  1WE7 A;  3ZLZ A;  3V62 A;  3WAP A;  2HE7 A;  4FAD A;  5JZE B;  1ISN A;  4TKN A;  3NHE B;  2MP2 A;  1H4R A;  1OEY A;  2LVO A;  3ECI A;  4IW0 A;  3L10 B;  4ASW C;  3ML9 A;  2L00 B;  3DDC B;  3UIN B;  2JXX A;  1WE6 A;  1WGR A;  3U8Z A;  3APC A;  1ZW7 A;  2BKF A;  2Z0D B;  2FCN A;  1UEL A;  5DPW A;  3ONS A;  4GDK A;  1LQB A;  4DHZ B;  3PRP B;  2LRU A;  1L7Y A;  1E7V A;  2W9N A;  1KJT A;  3UIO B;  5L83 A;  2MW5 A;  2BYV E;  3OLM D;  4WJO A;  4TQ1 A;  4LDT B;  3R7R A;  3H7S A;  2CS4 A;  2KNB A;  2M4N A;  2GBN A;  2K1F A;  3HIZ A;  2N7E A;  4PYU A;  1WR6 E;  2C7N B;  2KJR A;  4K7U A;  4F1S A;  1XT9 B;  3H1U A;  2C5L C;  3DVG X;  1LFD A;  1TBE A;  1TZ1 A;  2C7H A;  2NBV B;  2WX1 A;  2MBQ A;  4GDL B;  1E7U A;  3HM3 A;  5GMV A;  2FCQ A;  1WX8 A;  4AP4 C;  4EZJ A;  2KZR A;  4KIK B;  3PRM B;  1S1Q B;  3V6C B;  1IPG A;  1F9J A;  1E8W A;  2DEN B;  2MWS B;  1TGZ B;  2D11 A;  3QCA A;  4CYE A;  3APF A;  1SGH A;  4MGK E;  2C7M B;  4M0W B;  3UIP B;  1WJ6 A;  4HCP B;  4CO7 A;  3VDZ A;  2L3Z A;  3CSF A;  3JW0 X;  4BKT A;  1WH3 A;  2J0K A;  3S2A A;  2LI5 A;  2XBB C;  2LGY A;  3N3K B;  3NOB A;  2GBJ A;  2IO1 B;  2BPS A;  2NPT A;  2CU1 A;  4WWP A;  1GC7 A;  3WAO A;  3ZRC A;  4HVB A;  3RD2 A;  1U4A A;  3DOW A;  4BFR A;  2Z59 B;  2FNJ B;  2N7D A;  1GJZ A;  4OVV A;  3PV1 A;  4B95 A;  2I1J A; 
#chains in the Genus database with same CATH topology
 2YEP B;  2LMC A;  1WYW B;  2EMT A;  3D32 A;  3J9C A;  4J3O D;  3VUY A;  5D6J B;  2RDB C;  4DHJ D;  2SAK A;  4A3P A;  2ZJD A;  4MM3 A;  3L54 A;  2O2V A;  4LNF A;  4KGT A;  1N5X A;  1F52 A;  4CQN A;  2AQ1 B;  1K50 A;  4LJP B;  3AE6 B;  1EUV B;  5AZH A;  4CHK A;  1MVK A;  2BB5 A;  5DPS A;  1C4A A;  1JWA D;  1QLB B;  3P4P B;  4NJ6 A;  3DVN V;  4LJO B;  2M17 A;  4MH0 E;  1SJE D;  2QHO A;  2JYT A;  3KUC B;  4TV3 A;  1E8Z A;  3U52 E;  3ZDT A;  4K7S A;  5I4D A;  2L76 A;  4OHJ A;  2J4X A;  3ZUN A;  2N9X A;  2ZNV C;  3GS2 A;  4ZRI A;  2N1V A;  3BVZ A;  2RD0 A;  1KH0 A;  2GBK A;  1ZGU B;  1JWB D;  3W9C B;  1V5T A;  2JU6 X;  3MP9 A;  1TKG A;  1B1Z A;  2JZP A;  3O65 B;  2JF5 A;  4EE2 A;  3ZJV A;  4PS8 A;  1I42 A;  2C60 A;  1GB1 A;  1EF5 A;  3U7Z A;  2WHI A;  1QOB A;  1LXD A;  4PS3 A;  2PTL A;  3DBL I;  3DWM A;  4US8 A;  4NQL B;  1UD7 A;  3L0W B;  1V1O A;  3IG3 A;  1IGD A;  4HXD A;  4HWI B;  5KHO A;  1SE4 A;  3SFE B;  2E3T A;  5TSS A;  1J19 A;  2RR9 A;  1FNU A;  3AE9 B;  4TUU A;  5IP4 D;  1C1Y B;  2ASQ A;  1FD6 A;  3W1S C;  2FID A;  2MQJ A;  4NQK E;  1ZOY B;  3RCZ A;  4WAF A;  4UDU C;  1WRI A;  4F7Z A;  2KJH B;  3PT2 B;  2DLB A;  3UGB B;  1QOA A;  2QDF A;  4ZRK A;  1A5R A;  1OEY J;  4NJ7 A;  1TS5 A;  4M0W A;  3I3T B;  3PPA A;  4M01 A;  4W9I A;  2LGI A;  2SEB D;  4P1C C;  4KSL C;  3W2D A;  1VRA B;  1UH6 A;  1VZ8 A;  2A5U A;  5H8Y E;  1MG8 A;  4S0R A;  4LK0 M;  4HKQ A;  4ZYN A;  1YN4 A;  3AN1 A;  1C79 A;  3VH4 B;  1HTQ A;  4XE0 A;  5G2N A;  2HJ8 A;  3DCG A;  2LGX A;  2LHE A;  1R4N I;  1WZ3 A;  1JCK B;  1F77 A;  2JVC A;  1XLN A;  1ZKH A;  1TIF A;  2KC1 A;  3NRZ A;  1HE8 A;  3P4S B;  2DZI A;  3PHW B;  2WX0 A;  3KUD B;  1FM0 D;  4D2K A;  3EC8 A;  2FUH B;  2MBE A;  2IO2 B;  3NZU A;  2MSE D;  4M8M A;  3RYT A;  2FIF A;  3IAM 1;  4S17 A;  3NY5 A;  3I9V 1;  4C80 A;  1P3Q U;  3JSV A;  2AWT A;  4ZOH C;  4DHJ B;  1PQS A;  4FJV B;  2KC2 A;  3Q3O C;  4DWF A;  4MEM A;  1XCQ L;  1J7C A;  3P2B A;  3TEW A;  4GN1 A;  2DWQ A;  3IT4 B;  4A8X C;  3ZJU A;  2WDQ B;  1R4M B;  3BVM A;  2BVC A;  2PW9 A;  5J17 A;  4FJY A;  1T3Q A;  2M56 B;  1I4R A;  1CK1 A;  2MBO A;  2RSU A;  4ICU A;  3M63 B;  3HVZ A;  2J7Q B;  4I6L B;  2IO3 B;  5IOI A;  1ESF A;  2RGF A;  2J53 A;  2KWC A;  4ARC A;  4XZ4 A;  4IC7 B;  4W9K A;  2QC8 A;  3AE2 B;  3PSE B;  2Y3A A;  3V61 A;  2WNM A;  4IWQ A;  2DYM A;  1NDD A;  3A4R A;  3A1Q B;  1PGX A;  1FRR A;  4HPL B;  2MP2 B;  4A20 A;  2DX5 B;  2VZK D;  2LGS A;  1RFA A;  4WQM A;  1WIA A;  2O6V D;  1L0Y B;  3ZJT A;  4ANV A;  3VUX A;  4DDG D;  1M4V A;  2V1Y A;  3KLS X;  4DQO C;  4AOF A;  2RMM A;  4B0M A;  4AS1 A;  2NMQ A;  3NVW A;  3X23 A;  4ANW A;  3Q3J A;  3MJW A;  1N6Z A;  1EU3 A;  4GU2 A;  2N9L A;  1OFF A;  2WXJ A;  4K1R B;  3WAL A;  1Q5W B;  2JZ3 B;  2KWD A;  1L2N A;  2PVG C;  4M8N A;  3AEC B;  3IFW B;  3QAR A;  4HLE A;  2WXR A;  2WXN A;  2L05 A;  3BWU D;  3JVZ X;  4WJP A;  4W9D A;  1JWU D;  3B1L X;  3N9Y C;  1WRD B;  3QAQ A;  4MGI E;  1WM2 A;  4RCO A;  3PHX B;  1KLV A;  2KAC A;  4HJK A;  1UF0 A;  1JML A;  3OG5 A;  4LTU A;  4FA6 A;  5BYQ A;  5G5G A;  3Q8B A;  2M0A A;  5J2R A;  1YMH E;  2WXF A;  5G55 A;  4C7Y A;  3QX1 A;  1UGM A;  4A3O A;  5CHF A;  1MHX A;  1Q10 A;  2JRH A;  2WLB A;  2MBH A;  4LLG M;  2RPQ A;  3NZS A;  3WIM A;  5LXH A;  1EF1 A;  1N60 A;  2N1W A;  4L1B A;  1WE7 A;  3ZRF A;  3ZLZ A;  1J7B A;  3WAP A;  4ASW C;  1OEY A;  3ML9 A;  1SXT A;  2Z0D B;  1UEL A;  5DPW A;  3Q8E A;  4DHZ B;  2LRU A;  1E7V A;  1T0S C;  3UIO B;  5L83 A;  4BZA A;  3AE3 B;  1I4H A;  4LDT B;  3KWV A;  2EKI A;  2G1E A;  2H89 B;  3U2S C;  2M4N A;  2GBN A;  2N7E A;  4PYU A;  3DWG C;  2AQ2 B;  2W82 A;  1T6B X;  2RPV A;  2C7H A;  3GE3 C;  3HM3 A;  5GMV A;  2KZR A;  1F9J A;  1E8W A;  2KYW A;  2V4I B;  3AH7 A;  3NVZ A;  2C7M B;  2PKO A;  3P1M A;  3JW0 X;  1GPX A;  4DXG A;  2IO1 B;  4WWP A;  2W3S A;  3RD2 A;  3DOW A;  3IT6 B;  1KFY B;  2Z59 B;  4C56 C;  3PV1 A;  1OQQ A;  2I1J A;  4EEW A;  3P63 A;  1FXI A;  2INN E;  4AQ7 A;  3M62 B;  5DPT A;  1AW7 A;  3ZTC A;  1GC6 A;  4GLS C;  2MJ3 A;  3A33 B;  5E6O A;  4ZRP A;  2NBU A;  3AE1 B;  3SU8 X;  4BKG A;  1C3T A;  2Y5P A;  3R2I A;  4GXB A;  1L5P A;  3UQA A;  3HVD A;  3ZGZ A;  2KVZ A;  1D5Z C;  2WXL A;  2NR2 A;  2ZZP B;  2IDY A;  3ETR A;  4LDT D;  2D3G A;  3OWE B;  3NS8 A;  2DZM A;  1DOX A;  3H7P B;  3V05 A;  2R61 A;  2PEA A;  1I35 A;  3TSS A;  3KVF B;  4DK5 A;  2CR5 A;  2PVO D;  1UNS A;  2A4Z A;  3NVV A;  1R4M I;  2ZPY A;  3W1S A;  1ENF A;  4ZRJ A;  3L16 A;  5EE9 A;  1XLP A;  1D3Z A;  2DBY A;  4NZL B;  3QQ8 B;  1OTR B;  2BWE S;  3C0R B;  1KOT A;  3EFU A;  4IWO A;  3RMK C;  5BYR A;  3RUI B;  1WFY A;  1JRO A;  2MJE A;  2JX5 A;  3LJ3 A;  2E6X A;  2FE8 A;  2WGS A;  3W1Y A;  4LNI A;  1V2Y A;  4I6N B;  2D3B A;  2VRR B;  4WJN A;  4JQW C;  4W9G A;  3CF6 E;  1E10 A;  4XYC A;  3MFG A;  2K25 A;  3ZTD A;  4P6V F;  2BW2 A;  2M8S A;  1VZ6 A;  4J6I A;  4AJY B;  2V3N A;  3TL5 A;  4NJC A;  1WXQ A;  3T9L A;  2OED A;  1JWS D;  2LGD A;  2G45 B;  1SE2 A;  2J52 A;  3N1X C;  1WGD A;  2V4L A;  4ICV A;  4WH4 A;  3EA6 A;  5EE3 A;  2GBM A;  1FXA A;  1YJI A;  4IUM B;  4OZB A;  3DBH B;  1P98 A;  3EHV A;  3TCA A;  1T0R C;  2MEK A;  5G5H A;  2I1K A;  3RNC C;  2C9W B;  2NS5 A;  4C4V A;  3GOE A;  1SEB D;  4FJZ A;  4MGY E;  5AEK B;  4MSQ B;  4DXF A;  2LUM A;  4FUL A;  2V3S A;  2J42 A;  1C77 A;  1K8R B;  4GSW A;  2J0M A;  4P7I A;  2FAZ A;  3RUL A;  3EFC A;  3ZNH B;  5T8I A;  2LHD A;  2DAF A;  4W9F A;  2JT4 B;  3E9S A;  4PK1 A;  2KOX A;  3PZD A;  2ZVO A;  3BZD B;  2L8J A;  1WXA A;  3RN9 C;  4TQ0 A;  2WU2 B;  4WWO A;  5IAA C;  3PGE A;  2VH2 A;  3EEC A;  3WCQ A;  1SF0 A;  2B3A A;  2G4S A;  5C23 A;  4MEL A;  1P0R A;  1T5X D;  2IY0 B;  2W55 A;  3DBL B;  4IM0 A;  1WJ4 A;  4RGO S;  2D3A A;  3VTV A;  3RNG C;  3UQB A;  2R2O A;  2ZNV B;  1RRB A;  1WX7 A;  3ZXV A;  2CHW A;  1YOV B;  3A9J A;  5JH5 C;  3LYY A;  1PYW D;  4OVU A;  1WI0 A;  3IHP C;  2JWU A;  3VRB B;  2ZVN A;  2K5P A;  4OZA A;  3IXS A;  5D94 A;  3RNE C;  4HK2 A;  2K3U A;  2GOW A;  3VXW A;  5JHB A;  5AUI A;  5JXV A;  3V3X A;  3VRA B;  3FIL B;  4PYZ A;  2QIL A;  3K9O B;  1DYQ A;  3AED B;  2K39 A;  3AEB B;  1NI3 A;  1KLG D;  1P7E A;  4IKG A;  5FR6 A;  3H7P A;  1HZ6 A;  3QC8 B;  3A4S C;  5C1Z A;  2MH7 A;  3CIR B;  2DHZ A;  2JXT A;  3VR9 B;  2ZCB A;  1XCT L;  2KXJ A;  2KDB A;  2KWV B;  2D5G A;  1WJU A;  1DGJ A;  2I2Y A;  3NJT A;  3AUL A;  3RZW C;  3VHT C;  2LFI A;  4E71 A;  4RH6 A;  3L08 A;  4W9H A;  3BII D;  2NPT B;  2LVP A;  2W54 A;  4HEA 1;  2JQR B;  2XNA C;  4ACF A;  3A9K A;  3QK0 A;  1WZ0 A;  1EWC A;  4YTP B;  2QSD A;  4BVU C;  1J8C A;  3DBR I;  2ZEQ A;  3NZ3 A;  4RNA A;  4YSY B;  4FBJ B;  1K51 A;  3EUB 2;  2KN4 A;  3ZVV A;  5KHQ A;  2D2Q A;  2M0X A;  3FIL A;  5AZF A;  2JUO A;  2KDF B;  4RM8 A;  2WXH A;  3QIJ A;  4HDQ A;  4LNK A;  5C2T B;  3BK1 A;  1TS4 A;  2KJ6 A;  1PFD A;  4YSX B;  4GIV A;  2BYF A;  4JIO U;  5HI1 A;  4C4V B;  3KQ4 A;  1HTO A;  1L0V B;  2M19 A;  3Q3F A;  2KLG A;  3CST A;  2KFJ A;  2K6Q A;  1WX9 A;  3MC9 A;  3Q3M C;  3FC4 A;  1WYG A;  3N32 A;  4TSS A;  1C9F A;  2TSS A;  3BK2 A;  3B2G A;  5LLI A;  1L6V A;  4EFO A;  3VVW B;  4KGS A;  4RGT A;  4WJQ A;  1IGC A;  1XXG A;  3MC0 B;  1EO6 A;  1EWY C;  3UI3 A;  4YWG G;  2GRI A;  2WU5 B;  3AEG B;  1I4Q A;  3RT3 B;  3VH3 B;  5AUK A;  2JY6 A;  4OZC A;  1I4G A;  2IBI B;  4N6E B;  3BYT B;  2YVC A;  1E0Z A;  1VDV A;  2ONQ A;  3RZF A;  3IAS 1;  4FAD A;  2N7J A;  1JAL A;  3NHE B;  1ET6 A;  4IW0 A;  3L10 B;  2L1A A;  5H92 C;  1RWS A;  2FCN A;  1MJD A;  4RFB A;  4FXC A;  1ZDV A;  2MW5 A;  1AN8 A;  4N59 A;  3Q8C A;  4TQ1 A;  3H7S A;  3ZQ4 A;  1FCC C;  2AQ3 B;  2K1F A;  3RI7 C;  4K7U A;  1TBE A;  2NBV B;  2WX1 A;  3GB1 A;  5BMI A;  2FCQ A;  4K3C A;  4AP4 C;  4EZJ A;  1I4X A;  3BVG A;  4KIK B;  4ZYS A;  2DEN B;  2K22 A;  4MH8 A;  1VZ7 A;  4RF0 A;  4CO7 A;  3VDZ A;  1FMA D;  3CSF A;  1WH3 A;  4NAM A;  4L23 A;  4A55 A;  2ZW1 A;  5LNK 1;  3WAO A;  3ZRC A;  1FPY A;  1F2R C;  2FNJ B;  4B95 A;  1E7P B;  3DBR B;  2AL6 A;  3B9J A;  5E6P A;  3QA8 A;  1PGB A;  2KQ4 X;  1GUA B;  2LJI A;  2IYD B;  2KDI A;  5L95 C;  3N1Y C;  1SJH D;  1S3S G;  3AE5 B;  1FRD A;  2KQ7 A;  1SIF A;  3A9K B;  2XEW A;  4P1B C;  3HM6 X;  2EKE C;  3ZDM C;  1NEN B;  1VJK A;  2QMT A;  3DVN U;  2J0J A;  2KWU B;  2L32 A;  2LZ6 A;  1N61 A;  4BOS C;  1WM3 A;  3RNB C;  3ZNI D;  1ZXH A;  1Q1O A;  1QQR A;  2WDR B;  2KMM A;  2QCZ A;  4HPM B;  4G3X B;  2Q5W D;  4C00 A;  3KH0 A;  4BAX A;  2CU3 A;  2M1M A;  3H8H A;  1GG3 A;  1RAX A;  3ZNG C;  4N9F 4;  2PMV A;  4M02 A;  2BYE A;  1HXY D;  5CX3 A;  3MJ5 A;  4C7Z A;  5HKH A;  2KX0 A;  1FCL A;  1SE9 A;  1WSP A;  3LDZ E;  3Q69 A;  1UBQ A;  2MJD A;  4IM3 A;  2K8C A;  1NBF C;  2BKR B;  3MTN B;  1VCB A;  1FNV A;  2BWF A;  4ZRQ A;  1Y8R C;  1C4P A;  3AI5 A;  1LM8 B;  4OVZ A;  2IJ0 A;  4G0N B;  4W9E A;  2DZK A;  2IY1 B;  3DPD A;  2BYT A;  1ROE A;  2KMA A;  4GDK B;  3DVG Y;  4ANX A;  1GB4 A;  2IGH A;  3NG0 A;  2KKC A;  4GOC A;  4ANU A;  2NBW B;  1YN3 A;  2IO0 B;  1LO5 D;  3AU5 A;  3JSV B;  4USA A;  4RGM A;  4FN2 A;  2R2Q A;  2KDM A;  4JL9 A;  4B6W A;  1VLB A;  3KUZ A;  1D5X C;  4EZK A;  1WGY A;  2G3Q B;  2L7R A;  2OJR A;  3VQI A;  3N30 A;  1TY0 A;  1ET9 A;  4WWN A;  5HG2 A;  3OJ3 A;  5E6N A;  1XLO A;  4YL8 A;  2Y5C A;  2NTS A;  5D2M B;  1GOZ A;  1OQY A;  4KGR A;  2JYE A;  2D3C A;  2GLS A;  2MHJ A;  2NVU I;  3AM9 A;  3KW5 B;  4W9C A;  2Y5B B;  4PS7 A;  1V5O A;  1V80 A;  2WDV B;  1KTK A;  2LVQ A;  1RYJ A;  5TR5 A;  2VZK B;  1K52 A;  1ZUD 2;  2JSV X;  4DHZ E;  2JZZ A;  3N1Z C;  1LGR A;  1QOG A;  2KAN A;  1QT9 A;  1SBB B;  1WR1 A;  3PO0 A;  1SIJ A;  3L4P A;  1XD3 B;  4ITK A;  1FNW A;  4EUT A;  1FFV A;  2XK5 A;  2KO3 A;  4NY0 A;  3HRD D;  2MLB A;  1IUE A;  1RLF A;  4WUR A;  3I63 C;  4HCN B;  1UBI A;  4MSM B;  4WAA A;  3HHM A;  3L13 A;  1RFK A;  1CMX B;  2ACZ B;  3ENE A;  4KDL B;  2JWZ A;  5DCN A;  1CQV A;  4PT5 A;  2PJH A;  4ZDV A;  4R3D A;  3VFK A;  4NNJ B;  3B2F A;  3KYD D;  3AXC A;  1AWD A;  5D7G A;  4IM2 A;  2XN9 C;  1BT0 A;  3A1Q A;  3AEA B;  4RM9 A;  1TYG B;  2FCM A;  3M3J A;  4BKS D;  3X0W A;  1NI2 A;  5EE0 A;  1J0G A;  3PTF C;  1WY8 A;  2BGF A;  2X8X X;  2D10 A;  4YTN B;  4JWU C;  1C4C A;  2K8B A;  2AEH A;  4IWP A;  4TMA B;  1HQR D;  1Q0W B;  3VTU A;  4XWT A;  5CHV C;  2KFK B;  2JRI B;  1T0Y A;  1KRH A;  1L4D B;  2GI9 A;  2L52 A;  3L17 A;  4KIK A;  2EMS A;  3MC8 A;  1GNU A;  1WGG A;  3TJP A;  4KX6 B;  2MA9 B;  3WA0 A;  1E8Y A;  5FK9 C;  4GGQ A;  2HTM E;  1V97 A;  2KK8 A;  1TY2 A;  4US9 A;  3RFZ B;  3VAW A;  1MHH E;  3CMM B;  3V6E B;  5E6J A;  1WF9 A;  3AMZ A;  2O6V B;  3W5U B;  1QKZ A;  2BB6 A;  5HFY A;  4KVG B;  3GZN I;  2CHX A;  2KLC A;  2NCN A;  1YNT E;  5IA7 A;  1YQ3 B;  3TEZ A;  3Q14 C;  2DNF A;  1TKE A;  1WMH B;  1V86 A;  4X57 B;  1M94 A;  2CKH B;  2HDE A;  3C8Y A;  2IGD A;  2K6D B;  1K53 A;  3DHH C;  4N58 A;  2WXM A;  2MBB B;  3BY4 B;  1E8X A;  4G50 A;  1YQB A;  1MI0 A;  3OAW A;  4JGH B;  2OOB B;  4KZ0 A;  2IGG A;  1TZO A;  3BYY B;  1OQR A;  3T3O A;  1N62 A;  3R2T A;  2JPH A;  2GMI C;  1TJE A;  4WIP A;  2ZW0 A;  4ZHO A;  3P4R B;  1HZ5 A;  5JHA A;  3DBS A;  4YT0 B;  3PZ7 A;  3I57 A;  1AYF A;  4YTM B;  1VR9 A;  1V1P B;  3PLV A;  1R7S A;  4RF1 A;  1YX6 B;  1TS2 A;  3H6N A;  2O6V A;  1HEZ E;  3TMP B;  1GAQ B;  3I5J C;  1KM7 A;  4REZ A;  2BS4 B;  4URK A;  3MHZ A;  4MM3 B;  3NS1 A;  3R7Q A;  3GP7 A;  4GB9 A;  3Q8F A;  2L0F A;  3A9J B;  4YXD B;  3SDL C;  1J7A A;  5JZE B;  4TKN A;  2MP2 A;  1H4R A;  3URY A;  4HJG E;  2JXX A;  2K9X A;  1STE A;  1WE6 A;  1TKY A;  1WGR A;  3APC A;  3U8Z A;  1ZW7 A;  4YSZ B;  2BT6 A;  3ONS A;  4GDK A;  4HKZ E;  1CJE A;  2EEL A;  2I38 A;  3OLM D;  4WJO A;  3R7R A;  1D4B A;  2ON8 A;  4B0E A;  4F1S A;  3H1U A;  1XT9 B;  2NTT A;  3DVG X;  1LFD A;  4KKI A;  3Q8A A;  2N0S B;  1WX8 A;  2IPK D;  3V6C B;  1TGZ B;  4CYE A;  2CJO A;  1C76 A;  1SGH A;  1TT5 B;  4MGK E;  3U4E G;  3GE8 C;  1NYR A;  1WJ6 A;  4HCP B;  3LXF A;  2L3Z A;  1PGA A;  3S2A A;  2XBB C;  3TUO A;  1E6E B;  2LGY A;  2NPT A;  2CU1 A;  4HVB A;  1FO4 A;  1WWT A;  4XDD A;  1GJZ A;  4OVV A;  2QIE B;  1CZP A;  1YD8 U;  3IVF A;  1E5W A;  4WWM A;  4II3 B;  4KV2 A;  3OJ4 B;  4JLC A;  3GZN B;  5EDS A;  5GXG B;  2V9H A;  3WAM A;  2DAJ A;  5FR3 A;  2HD5 B;  3Q6B A;  1C78 A;  4MGZ E;  3W5V B;  3SEB A;  3NUH B;  1IP9 A;  4XC2 A;  1WMH A;  3LB8 C;  2PE6 B;  2XK5 B;  1JW9 D;  2CJN A;  3VR8 B;  1V49 A;  1Z2M A;  4G11 A;  5D3I B;  3BIN A;  2HJ1 A;  1P1A A;  2X38 A;  3AU4 A;  3PS6 A;  2WS3 B;  3QWZ B;  5J18 A;  2KDE B;  4GMV A;  2KFK A;  2BS2 B;  2LUE A;  4K81 A;  5FKA C;  1WJN A;  4XX5 A;  4DBG A;  3SFD B;  2IZV B;  1B9R A;  1EM7 A;  4II2 B;  1D6E C;  2V3P A;  4A90 A;  4EKU A;  4I6P A;  4AWJ A;  3ABV B;  3PVL A;  3AB5 A;  4FHK A;  4M00 A;  1E90 A;  4MJS A;  1ZXI A;  3QHT A;  2WXI A;  1UWM A;  1WXM A;  1ZPS A;  1V8C A;  2DZJ A;  4KDI C;  4HRO A;  2REX A;  1YX5 B;  5BO4 B;  2H88 B;  3Q2A C;  4MDK E;  2OHF A;  3ZW3 A;  1H8C A;  3RNA C;  1ZDX A;  4FLH A;  1X1M A;  3SD5 A;  3WAN A;  4NAW A;  3CWI A;  1R4N B;  3DHG C;  5DPR A;  1BML C;  2GB1 A;  4JWS C;  4BOZ B;  1MG4 A;  4MAC A;  1I7H A;  4OW0 A;  3ZO5 B;  4E74 A;  2PLP A;  1WGH A;  3ZKJ C;  4KKJ A;  3JYU A;  3T3N A;  3RPF C;  3DHI C;  2WXK A;  4L2Y A;  2LXA A;  2K8H A;  4ZHP A;  4K3B A;  1AAR A;  1F0Z A;  3T8M A;  2HTH A;  1V1P A;  4F8C B;  1YJJ A;  4LCD E;  1JWM D;  1WGK A;  3ML8 A;  3ZYY X;  3MHS D;  2CHZ A;  3K9P B;  3AE4 B;  5HHD G;  4NPN A;  4B9K A;  1IYF A;  4QAY A;  2UYZ B;  3DBH I;  3P4Q B;  1UUP A;  1FXT B;  3APD A;  2PPH A;  1XQQ A;  5BMG A;  1MPE A;  1NVI D;  1XO3 A;  4P16 A;  2YLM A;  4NAW B;  1ZP0 B;  4AUQ C;  1XLQ A;  1ZE3 D;  5D3D A;  3M95 A;  1WXV A;  2WWZ A;  2KTR A;  2INC C;  2QEJ C;  5IKC M;  2WP9 B;  2LAS A;  3VTW A;  2G4D B;  3E56 A;  2KMC A;  3AE8 B;  4DDI D;  2LD9 A;  3PRE A;  2MX2 A;  2MRP A;  2KHW B;  2ZPN A;  4H2A A;  2PE9 A;  1JQ4 A;  2YEP F;  2BQQ A;  5BYS A;  1PDX A;  1OGW A;  2O2V B;  1XEE A;  1DOY A;  3ZXR A;  5EE1 A;  4HDO A;  3R66 C;  2WXO A;  2G9H D;  4FHJ A;  2N9P C;  1D5M C;  3R3M A;  2V0G A;  4MT5 A;  2UWQ A;  1WXS A;  5AZG A;  4WQO B;  4A6Q A;  2KT7 A;  5BMH A;  3SR6 A;  2ZCC A;  2LRW A;  1F2R I;  3R8B A;  5IO9 A;  3AE7 B;  3C19 A;  1KF6 B;  2IND C;  4JE3 B;  3TEY A;  1EU4 A;  1G6J A;  1T0Q C;  4IOI E;  1PUT A;  3NVY A;  4A9A A;  1BXT A;  1QIL A;  3U30 A;  2KX3 A;  2LWP A;  1YN5 A;  4KSK C;  2WQY B;  4GDL A;  1JRU A;  3TEX A;  4BBN F;  1FFU A;  4RMA A;  2BTE A;  4DXA B;  4JPS A;  1VD2 A;  4Q2J A;  1QOF A;  3PLU A;  1QZE A;  3ALB A;  3DQV A;  2WYQ A;  3Q3N C;  3B08 A;  4BBN C;  1P9D U;  5IN7 A;  1Z5S B;  4BKS A;  5MPO A;  3KWL A;  2UU7 A;  1HA5 A;  4EZL A;  1BUI C;  2L0T A;  4W9L A;  1UZX B;  3PZ8 A;  4KZC A;  1FEH A;  1F1H A;  2L83 A;  3AEF B;  3B0A A;  1SE3 A;  3VUW A;  2KTF A;  2DYO A;  2KD0 A;  4O1N A;  2BBC A;  3FAH A;  2WDT B;  4HRS A;  1A70 A;  3U7D A;  2N4F A;  1XF5 L;  2VH1 A;  3EGR A;  4IDI A;  2PIA A;  1ACC A;  4IG7 B;  2LXC A;  1TTN A;  2KN5 A;  3PRZ A;  1N5W A;  3IBE A;  1E9M A;  1UGJ A;  2AYO B;  2LEK A;  2DYB A;  3TBL D;  2RDG A;  2KVR A;  5LXI B;  1YIW A;  3V60 A;  2D07 B;  3SHQ A;  1UWX A;  2WXG A;  4MJS B;  5CTR C;  2AL3 A;  1SSN A;  2FUG 1;  2B76 B;  3H9D A;  2KAJ A;  1V6E A;  1YJ1 A;  2KQS A;  4AJW A;  4K7W A;  1L0X B;  1RM6 C;  3N20 C;  2INP E;  3HK0 A;  2RDH A;  1MFW A;  4HPP A;  1JRP A;  3HUI A;  4E3C A;  1QF6 A;  3ZNZ B;  3UF8 A;  2BF8 B;  2ICI A;  2MCN B;  4EOY A;  1KLU D;  1L6U A;  2GBR A;  3QJZ A;  1L4Z B;  1V81 A;  2BS3 B;  1V9J A;  5CHW A;  2FCS A;  2LJ5 A;  2KTR B;  2N9E B;  2Z0E B;  3KYC D;  2W3R A;  2FBW B;  1FIQ A;  3ZIM A;  2AX5 A;  2WXP A;  4LNN A;  4W9J A;  3TIX A;  1P7F A;  3V62 A;  2HE7 A;  3FKY A;  1Y56 A;  1ISN A;  2LVO A;  3ECI A;  3O13 A;  3RNF C;  2L00 B;  3P42 A;  4ARI A;  3DDC B;  3UIN B;  1SB3 C;  2Z8L A;  2BKF A;  1DOI A;  1LQB A;  3PRP B;  2OJW A;  1L7Y A;  1NYQ A;  2W9N A;  1KJT A;  4XDC A;  2BYV E;  4XGA B;  1YQ4 B;  5C3J B;  2CS4 A;  2KNB A;  3HIZ A;  1WR6 E;  2C7N B;  2KJR A;  1IBX A;  2C5L C;  1N63 A;  1TZ1 A;  2MBQ A;  4GDL B;  1E7U A;  4JX1 C;  3PRM B;  1S1Q B;  1IPG A;  2MWS B;  2D11 A;  3QCA A;  1NEK B;  3APF A;  4M0W B;  3UIP B;  2WXQ A;  4BKT A;  1IBX B;  2J0K A;  4LNO A;  1TS3 A;  2LI5 A;  3AEE B;  3N3K B;  1I4P A;  2GBJ A;  3NOB A;  2BPS A;  4XWW A;  2K0P A;  1GC7 A;  1U4A A;  4RGN A;  4BFR A;  2N9K A;  2N7D A;  3AV8 A;  2QJL A; 
#chains in the Genus database with same CATH homology
 2AL6 A;  4EEW A;  1YD8 U;  3IVF A;  5E6P A;  1WYW B;  2EMT A;  3D32 A;  3QA8 A;  3VUY A;  5D6J B;  1E5W A;  1GUA B;  4II3 B;  4KV2 A;  3M62 B;  3OJ4 B;  4DHJ D;  5DPT A;  2IYD B;  2KDI A;  4A3P A;  2ZJD A;  4MM3 A;  4JLC A;  3ZTC A;  3L54 A;  5L95 C;  5EDS A;  3WAM A;  1GC6 A;  2O2V A;  1S3S G;  2DAJ A;  2HD5 B;  2KQ7 A;  3A33 B;  1SIF A;  4MGZ E;  3A9K B;  2XEW A;  5E6O A;  2NBU A;  3HM6 X;  1IP9 A;  4XC2 A;  3SU8 X;  2EKE C;  3ZDM C;  4BKG A;  1C3T A;  1WMH A;  3DVN U;  2J0J A;  2PE6 B;  2XK5 B;  2KWU B;  2LZ6 A;  4LJP B;  1EUV B;  4BOS C;  1V49 A;  1WM3 A;  1Z2M A;  4G11 A;  4GXB A;  5AZH A;  3ZNI D;  3UQA A;  4CHK A;  3BIN A;  1Q1O A;  5DPS A;  1P1A A;  4HPM B;  4G3X B;  2NR2 A;  3AU4 A;  4NJ6 A;  2ZZP B;  3KH0 A;  3PS6 A;  3DVN V;  4LDT D;  2M1M A;  3QWZ B;  4LJO B;  2D3G A;  5J18 A;  1GG3 A;  1RAX A;  2KDE B;  2M17 A;  4GMV A;  3ZNG C;  2KFK A;  4MH0 E;  4N9F 4;  2QHO A;  2BYE A;  3KUC B;  2LUE A;  3NS8 A;  4K81 A;  5CX3 A;  2DZM A;  1WJN A;  4TV3 A;  1E8Z A;  3H7P B;  4XX5 A;  4K7S A;  3ZDT A;  5HKH A;  4DBG A;  2KX0 A;  2PEA A;  2IZV B;  1SE9 A;  1I35 A;  3KVF B;  2L76 A;  4II2 B;  4DK5 A;  2CR5 A;  3LDZ E;  3ZUN A;  4EKU A;  1UBQ A;  2N9X A;  2ZNV C;  4IM3 A;  4I6P A;  4ZRI A;  2K8C A;  1NBF C;  2BKR B;  2N1V A;  4AWJ A;  3MTN B;  2A4Z A;  2RD0 A;  1R4M I;  2GBK A;  1VCB A;  2ZPY A;  1ZGU B;  3PVL A;  2BWF A;  4FHK A;  3W1S A;  1Y8R C;  4ZRJ A;  1V5T A;  3L16 A;  1E90 A;  3AI5 A;  1LM8 B;  1D3Z A;  4G0N B;  4W9E A;  2DZK A;  3QQ8 B;  1OTR B;  2BWE S;  2IY1 B;  3C0R B;  3DPD A;  3QHT A;  4MJS A;  1KOT A;  3O65 B;  2JF5 A;  2KMA A;  3EFU A;  3DVG Y;  4GDK B;  4ANX A;  4IWO A;  4PS8 A;  3RUI B;  1WXM A;  2KKC A;  4GOC A;  4ANU A;  1I42 A;  2NBW B;  1WFY A;  2DZJ A;  4KDI C;  2C60 A;  2REX A;  1YX5 B;  5BO4 B;  1EF5 A;  3LJ3 A;  1LXD A;  2IO0 B;  3W1Y A;  1V2Y A;  3AU5 A;  3JSV B;  4I6N B;  4MDK E;  2VRR B;  4PS3 A;  4WJN A;  4JQW C;  4W9G A;  3CF6 E;  3DBL I;  4FN2 A;  3ZW3 A;  1H8C A;  2R2Q A;  2K25 A;  4NQL B;  3ZTD A;  1UD7 A;  4JL9 A;  4B6W A;  3L0W B;  3KUZ A;  4FLH A;  4EZK A;  1X1M A;  3IG3 A;  3SD5 A;  1WGY A;  2G3Q B;  2M8S A;  3WAN A;  4HXD A;  4J6I A;  4NAW A;  4AJY B;  2L7R A;  2OJR A;  3VQI A;  5DPR A;  3TL5 A;  4HWI B;  5KHO A;  3N30 A;  3T9L A;  2LGD A;  1J19 A;  2RR9 A;  2G45 B;  4WWN A;  4BOZ B;  4TUU A;  3OJ3 A;  5E6N A;  4YL8 A;  3ZO5 B;  1C1Y B;  1WGD A;  2V4L A;  4ICV A;  5D2M B;  1OQY A;  2ASQ A;  4E74 A;  3W1S C;  1WGH A;  3ZKJ C;  2FID A;  2GBM A;  3JYU A;  2MQJ A;  4IUM B;  4NQK E;  1P98 A;  2NVU I;  3EHV A;  3KW5 B;  3RCZ A;  2LXA A;  4W9C A;  2Y5B B;  2K8H A;  3TCA A;  4PS7 A;  2I1K A;  1AAR A;  2C9W B;  1V5O A;  1V80 A;  2LVQ A;  4F7Z A;  2NS5 A;  5TR5 A;  2KJH B;  3PT2 B;  3T8M A;  3GOE A;  2HTH A;  3UGB B;  4F8C B;  4ZRK A;  1A5R A;  4FJZ A;  1OEY J;  4NJ7 A;  4DHZ E;  4MGY E;  2JZZ A;  3I3T B;  4LCD E;  2KAN A;  3ML8 A;  3MHS D;  4MSQ B;  5AEK B;  1WR1 A;  3PPA A;  2CHZ A;  4W9I A;  3K9P B;  4FUL A;  2V3S A;  4NPN A;  1XD3 B;  1K8R B;  4KSL C;  4EUT A;  2XK5 A;  2KO3 A;  4GSW A;  4NY0 A;  1UH6 A;  2A5U A;  2J0M A;  2MLB A;  1MG8 A;  1RLF A;  4P7I A;  4B9K A;  4ZYN A;  1IYF A;  2UYZ B;  2FAZ A;  3RUL A;  3DBH I;  3ZNH B;  2DAF A;  4W9F A;  1FXT B;  2JT4 B;  2PPH A;  3APD A;  2KOX A;  3PZD A;  2ZVO A;  3VH4 B;  1XQQ A;  5G2N A;  2L8J A;  1WXA A;  4HCN B;  1UBI A;  4MSM B;  4WAA A;  2YLM A;  3HHM A;  3L13 A;  2HJ8 A;  4NAW B;  4AUQ C;  4TQ0 A;  1CMX B;  3ENE A;  4KDL B;  3DCG A;  4WWO A;  2LGX A;  2JWZ A;  5DCN A;  5IAA C;  3PGE A;  1R4N I;  1WZ3 A;  3M95 A;  1WXV A;  2WWZ A;  3EEC A;  2KTR A;  2PJH A;  4ZDV A;  2B3A A;  2JVC A;  2G4S A;  2LAS A;  3VFK A;  1ZKH A;  5C23 A;  3VTW A;  4MEL A;  2KC1 A;  1P0R A;  2G4D B;  4NNJ B;  2KMC A;  1HE8 A;  2IY0 B;  2DZI A;  3PHW B;  2WX0 A;  3KUD B;  3KYD D;  4DDI D;  3AXC A;  4IM0 A;  1WJ4 A;  2LD9 A;  5D7G A;  3PRE A;  4IM2 A;  3A1Q A;  1BT0 A;  3EC8 A;  2MX2 A;  2FUH B;  2IO2 B;  2MBE A;  2KHW B;  2MRP A;  4RM9 A;  3M3J A;  2FCM A;  3VTV A;  4BKS D;  2ZPN A;  3UQB A;  3X0W A;  2R2O A;  1NI2 A;  2ZNV B;  2PE9 A;  3NZU A;  1RRB A;  1WX7 A;  2MSE D;  4M8M A;  2CHW A;  2FIF A;  3A9J A;  3RYT A;  3NY5 A;  5JH5 C;  1P3Q U;  1OGW A;  3JSV A;  4OVU A;  2AWT A;  1WI0 A;  2O2V B;  1WY8 A;  2BGF A;  3PTF C;  1J0G A;  2D10 A;  3IHP C;  4IG7 B;  4DHJ B;  1PQS A;  4FJV B;  2K8B A;  4HDO A;  3R66 C;  2AEH A;  2KC2 A;  4IWP A;  4DWF A;  4MEM A;  1Q0W B;  2ZVN A;  3P2B A;  3VTU A;  5CHV C;  4FHJ A;  2N9P C;  3R3M A;  5D94 A;  2KFK B;  4GN1 A;  2JRI B;  2UWQ A;  4HK2 A;  1WXS A;  5AZG A;  4WQO B;  1T0Y A;  2GOW A;  3VXW A;  5JHB A;  3L17 A;  5J17 A;  4KIK A;  2ZCC A;  2LRW A;  4FJY A;  2EMS A;  1GNU A;  4PYZ A;  1G6J A;  2MBO A;  2RSU A;  4ICU A;  3K9O B;  3M63 B;  1WGG A;  2J7Q B;  4I6L B;  3TJP A;  2IO3 B;  2K39 A;  2MA9 B;  2RGF A;  3U30 A;  3WA0 A;  1E8Y A;  5FR6 A;  2KX3 A;  2LWP A;  2KWC A;  3H7P A;  3QC8 B;  4KSK C;  4XZ4 A;  4GDL A;  3A4S C;  4IC7 B;  4GGQ A;  5C1Z A;  1JRU A;  4W9K A;  4BBN F;  4RMA A;  3PSE B;  4DXA B;  2DHZ A;  2KK8 A;  3V61 A;  1VD2 A;  2ZCB A;  2KXJ A;  2KDB A;  3PLU A;  4IWQ A;  1QZE A;  2DYM A;  2KWV B;  1NDD A;  3A4R A;  3A1Q B;  3VAW A;  3ALB A;  3DQV A;  2WYQ A;  4HPL B;  2MP2 B;  3B08 A;  4A20 A;  1WJU A;  1P9D U;  4BBN C;  2DX5 B;  1Z5S B;  4BKS A;  3VHT C;  3AUL A;  3RZW C;  4E71 A;  4EZL A;  3L08 A;  1RFA A;  3CMM B;  3V6E B;  2L0T A;  1WIA A;  1WF9 A;  4W9L A;  4W9H A;  2NPT B;  1UZX B;  2LVP A;  2O6V D;  2O6V B;  4KZC A;  3A9K A;  3QK0 A;  1WZ0 A;  4KVG B;  3GZN I;  3B0A A;  4ANV A;  2CHX A;  2KLC A;  2NCN A;  3VUX A;  4DDG D;  5IA7 A;  3VUW A;  2KTF A;  4BVU C;  2DYO A;  2KD0 A;  2V1Y A;  1J8C A;  1WMH B;  1V86 A;  3DBR I;  2ZEQ A;  4AOF A;  4X57 B;  2WDT B;  1M94 A;  2CKH B;  4FBJ B;  3U7D A;  2K6D B;  2N4F A;  3ZVV A;  5KHQ A;  2D2Q A;  3X23 A;  2M0X A;  2MBB B;  5AZF A;  4ANW A;  3BY4 B;  1E8X A;  2JUO A;  2KDF B;  1YQB A;  1TTN A;  2KN5 A;  2LXC A;  3PRZ A;  3Q3J A;  3QIJ A;  4G50 A;  4HDQ A;  4RM8 A;  3MJW A;  3IBE A;  2AYO B;  2KJ6 A;  3OAW A;  2DYB A;  4JGH B;  3TBL D;  4GU2 A;  4GIV A;  2KVR A;  2BYF A;  4JIO U;  5LXI B;  2OOB B;  4K1R B;  1YIW A;  4KZ0 A;  3V60 A;  2D07 B;  3WAL A;  1Q5W B;  2JZ3 B;  3SHQ A;  3Q3F A;  2KLG A;  3CST A;  4MJS B;  2KFJ A;  5CTR C;  2AL3 A;  2GMI C;  2JPH A;  1L2N A;  4M8N A;  2K6Q A;  3IFW B;  3QAR A;  1WX9 A;  5JHA A;  3DBS A;  4HLE A;  3N32 A;  3H9D A;  2L05 A;  5LLI A;  3JVZ X;  4WJP A;  4W9D A;  1V6E A;  3PLV A;  1YJ1 A;  2KQS A;  3VVW B;  4K7W A;  4AJW A;  3B1L X;  4EFO A;  1YX6 B;  3HK0 A;  1WRD B;  3QAQ A;  4MGI E;  4WJQ A;  3H6N A;  2O6V A;  1WM2 A;  4E3C A;  1EO6 A;  3PHX B;  1KLV A;  4HJK A;  3ZNZ B;  3UF8 A;  3TMP B;  2BF8 B;  2MCN B;  1KM7 A;  4EOY A;  3RT3 B;  4FA6 A;  4URK A;  2GBR A;  3QJZ A;  5J2R A;  1V81 A;  3VH3 B;  1V9J A;  5CHW A;  2FCS A;  2LJ5 A;  2KTR B;  5G55 A;  2N9E B;  3R7Q A;  2Z0E B;  3KYC D;  3QX1 A;  2JY6 A;  4GB9 A;  1UGM A;  2IBI B;  2L0F A;  3A9J B;  4A3O A;  5CHF A;  3SDL C;  2JRH A;  2YVC A;  2MBH A;  2RPQ A;  3ZIM A;  3NZS A;  3WIM A;  5LXH A;  4W9J A;  3TIX A;  1EF1 A;  2N1W A;  3RZF A;  3ZRF A;  1WE7 A;  3ZLZ A;  3V62 A;  3WAP A;  2HE7 A;  4FAD A;  5JZE B;  1ISN A;  4TKN A;  3NHE B;  2MP2 A;  1H4R A;  1OEY A;  2LVO A;  3ECI A;  4IW0 A;  3L10 B;  4ASW C;  3ML9 A;  2L00 B;  3DDC B;  3UIN B;  2JXX A;  1WE6 A;  1WGR A;  3U8Z A;  3APC A;  1ZW7 A;  2BKF A;  2Z0D B;  2FCN A;  1UEL A;  5DPW A;  3ONS A;  4GDK A;  1LQB A;  4DHZ B;  3PRP B;  2LRU A;  1L7Y A;  1E7V A;  2W9N A;  1KJT A;  3UIO B;  5L83 A;  2MW5 A;  2BYV E;  3OLM D;  4WJO A;  4TQ1 A;  4LDT B;  3R7R A;  3H7S A;  2CS4 A;  2KNB A;  2M4N A;  2GBN A;  2K1F A;  3HIZ A;  2N7E A;  4PYU A;  1WR6 E;  2C7N B;  2KJR A;  4K7U A;  4F1S A;  1XT9 B;  3H1U A;  2C5L C;  3DVG X;  1LFD A;  1TBE A;  1TZ1 A;  2C7H A;  2NBV B;  2WX1 A;  2MBQ A;  4GDL B;  1E7U A;  3HM3 A;  5GMV A;  2FCQ A;  1WX8 A;  4AP4 C;  4EZJ A;  2KZR A;  4KIK B;  3PRM B;  1S1Q B;  3V6C B;  1IPG A;  1F9J A;  1E8W A;  2DEN B;  2MWS B;  1TGZ B;  2D11 A;  3QCA A;  4CYE A;  3APF A;  1SGH A;  4MGK E;  2C7M B;  4M0W B;  3UIP B;  1WJ6 A;  4HCP B;  4CO7 A;  3VDZ A;  2L3Z A;  3CSF A;  3JW0 X;  4BKT A;  1WH3 A;  2J0K A;  3S2A A;  2LI5 A;  2XBB C;  2LGY A;  3N3K B;  3NOB A;  2GBJ A;  2IO1 B;  2BPS A;  2NPT A;  2CU1 A;  4WWP A;  1GC7 A;  3WAO A;  3ZRC A;  4HVB A;  3RD2 A;  1U4A A;  3DOW A;  4BFR A;  2Z59 B;  2FNJ B;  2N7D A;  1GJZ A;  4OVV A;  3PV1 A;  4B95 A;  2I1J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...