1C3TA

Rotamer strain as a determinant of protein structural specificity
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
76
structure length
76
Chain Sequence
b'MQLFVKTLTGKTLTVELEPSDTVENLKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNLQKESTIHLVLRLRGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (1D8 UBIQUITIN)
molecule tags De novo protein
source organism Homo sapiens
publication title Rotamer strain as a determinant of protein structural specificity.
pubmed rcsb
total genus 16
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 1999-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1c3tA00
1WIAA 3WAOA 2GOWA 2MBHA 5DPRA 1ZW7A 2XK5B 1V5TA 1U4AA 3N32A 3AU4A 3QCAA 2HJ8A 4XC2A 3CMMB 5L95C 2MBBB 2K8BA 3K9OB 4GDKA 4HDQA 4JGHB 2V3SA 2L05A 3PREA 2D2QA 4TQ1A 3ZTDA 5J18A 1V9JA 3ENEA 2PPHA 3QIJA 1IPGA 5D2MB 4HK2A 1WMHA 1WGGA 2LUEA 4WJPA 3VTUA 4FN2A 4DK5A 3IG3A 3KUDB 3VTVA 3PVLA 5AEKB 2K8CA 5CHVC 1P9DU 3RD2A 1QZEA 3PHXB 4NQLB 4DHJD 2BGFA 4EOYA 3HHMA 1GC7A 1T0YA 2HD5B 4RM9A 4K7UA 4WQOB 1AARA 3QQ8B 2LXAA 1V5OA 3AXCA 3O65B 4DBGA 2DZJA 3DVNU 2BKFA 2BF8B 2GBMA 4ANXA 1LQBA 2O6VB 4IUMB 5L83A 4NNJB 3V61A 2FIFA 2NCNA 2WYQA 3PRPB 3ZW3A 5D6JB 2CKHB 3ONSA 4G0NB 3TMPB 3V62A 4BKGA 2JT4B 4BFRA 4ZRJA 2RD0A 4HCNB 2N4FA 1WXMA 3R66C 3GOEA 1X1MA 4OVUA 2KO3A 3IFWB 3PRZA 3JSVB 3RZFA 2R2QA 4HCPB 2JPHA 2KTRA 2ASQA 2CHXA 3KYCD 1WJ6A 3LJ3A 1NDDA 3VQIA 3L16A 2QHOA 2Y5BB 4JLCA 1WZ3A 3ALBA 2ZPYA 4II3B 4K1RB 1PQSA 5G2NA 3D32A 4W9JA 3TL5A 3PZDA 1RAXA 4GOCA 2GBRA 5E6PA 2N9PC 2J0JA 3SHQA 2RPQA 1WXAA 1H8CA 2D10A 2YVCA 3OAWA 4ZYNA 2ZVOA 4KDIC 4EEWA 4EZLA 2MCNB 2NS5A 3TCAA 4IWOA 3PS6A 4KIKA 2N9XA 2C9WB 4WJOA 5AZHA 2FAZA 1E7VA 4FHKA 2DYBA 5E6OA 3B0AA 3AI5A 3APFA 3B08A 1KJTA 3A33B 3V6CB 2BKRB 4BVUC 2RR9A 4IW0A 2O2VB 4AJYB 5LXHA 3H7PB 4MGYE 3AULA 5FR6A 2BYVE 4TV3A 5IA7A 2JWZA 3NHEB 2ZZPB 4FLHA 4PYZA 3APCA 4W9LA 4WWOA 1IP9A 4WJQA 1IYFA 4W9CA 1UD7A 4KZCA 3OJ3A 3KUCB 5CTRC 2M1MA 2DAJA 4E3CA 4GDLA 3PPAA 3HM6X 5DPTA 4GDKB 4GMVA 2IO2B 3NS8A 4I6LB 3H7SA 2RGFA 2LVPA 4JQWC 2K6DB 2DAFA 4EZKA 2FUHB 4LDTD 3TJPA 2K8HA 3CF6E 4JIOU 1KOTA 2ZCBA 2KFJA 2ZJDA 4MGKE 3ZO5B 1HE8A 5HKHA 1EF5A 4HJKA 1S1QB 3NZUA 3ZIMA 2KTFA 4MH0E 1WXVA 2M17A 2JZ3B 3ZDMC 3M63B 2C7MB 4MEMA 2KDBA 3RYTA 1E8YA 3V6EB 1YX5B 4HVBA 3WALA 3P2BA 4MELA 1EUVB 1Q5WB 2JRIB 3U8ZA 5EDSA 2CU1A 4ICUA 1YX6B 3L54A 2L7RA 2MW5A 3ZNZB 2K39A 3MTNB 2G3QB 4ZRKA 4MGZE 2BPSA 1GNUA 1WY8A 1WGYA 4KZ0A 4TKNA 1XD3B 5JHBA 1GUAB 3K9PB 4IWPA 2KJHB 1WXSA 2C5LC 4F8CB 1XT9B 2XBBC 3VXWA 1WGRA 2KKCA 2NPTA 3CSFA 1OGWA 4X57B 2G4SA 2LD9A 3A9JB 1SE9A 4BOZB 2M4NA 3DPDA 1BT0A 3DVGY 4PS7A 3X0WA 4LCDE 4MJSB 4WWNA 3VHTC 5CHWA 3ZTCA 4IC7B 2BYEA 2KX3A 1WX9A 2WDTB 3ZLZA 2KN5A 4XZ4A 3VUYA 2NR2A 1TTNA 3L10B 1Z2MA 4N9F4 1VCBA 2JF5A 3CSTA 3GZNI 1V86A 1KM7A 4NPNA 3ZVVA 1WGHA 3OLMD 2DX5B 2AWTA 3EECA 4I6NB 2DYOA 4MDKE 4BBNF 4DWFA 1M94A 2KMCA 1P0RA 2EMTA 4PS3A 3U30A 1SIFA 2J0KA 2LRWA 1V6EA 2CS4A 3UIOB 1G6JA 4AP4C 2LGDA 3OJ4B 4PYUA 4AUQC 2IO0B 4TQ0A 2KX0A 4MSMB 3JYUA 4K7WA 1H4RA 1FXTB 3DBHI 3PRMB 1TZ1A 1NI2A 4EZJA 1UBIA 3ECIA 4JL9A 2KLCA 3PTFC 2KWUB 3R7RA 2IBIB 4CHKA 4HPMB 1ISNA 2CHWA 2M8SA 5BO4B 3DBRI 3JW0X 3N30A 5C23A 4M8NA 1WM2A 2BWFA 2PEAA 3HM3A 3VH4B 3A1QB 2PE6B 1WZ0A 2AL3A 3DDCB 2DYMA 4PS8A 4HXDA 4KVGB 3W1SA 4NAWA 1GG3A 2G4DB 2MWSB 2IZVB 2OOBB 2MP2B 3EFUA 5KHQA 1LM8B 1L2NA 2MQJA 2Z59B 3TIXA 2UYZB 3VDZA 2KHWB 2K1FA 3VFKA 3VTWA 1XQQA 4NJ7A 3SD5A 3ZRCA 3ZRFA 1GC6A 2N1WA 1R4MI 4M0WB 2AEHA 2A5UA 2KMAA 4M8MA 2O6VA 4FADA 5D7GA 3JVZX 4W9IA 4W9GA 4IG7B 3UQBA 2CR5A 4LJOB 1E90A 2GBJA 3ZKJC 2MBQA 2C60A 3DBLI 3QA8A 3IVFA 2C7HA 3A9KA 3R7QA 4DDGD 3H6NA 4BBNC 1EF1A 1LXDA 2KFKA 2Z0DB 3KH0A 2O6VD 2KC1A 1V49A 2MBEA 2FCQA 4MM3A 4OVVA 3QHTA 2LZ6A 1I35A 3JSVA 4DHZE 2L3ZA 2NBWB 3DCGA 4XX5A 3NOBA 3DBSA 1V81A 3ZUNA 4AOFA 4AJWA 2LRUA 2JZZA 3BINA 1RFAA 1WJNA 2KC2A 1UGMA 4G50A 2BYFA 2FCMA 1R4NI 1UELA 2JRHA 2JY6A 2LGYA 2N9EB 3HK0A 2M0XA 4ZRIA 3UQAA 2EMSA 3AU5A 2MLBA 1A5RA 1YQBA 4KDLB 3DVGX 4ANWA 1GJZA 2ZEQA 4W9HA 1I42A 2NBUA 2LVOA 4EKUA 3H9DA 3V60A 2CHZA 2J0MA 4RM8A 4BKTA 4NY0A 4GGQA 4GU2A 2XK5A 4FULA 5JZEB 2XEWA 3WIMA 4HWIB 2MRPA 2KD0A 3PGEA 3RULA 2JXXA 3IHPC 1SGHA 3BY4B 2JVCA 2O2VA 1L7YA 3H7PA 5GMVA 5IAAC 2K25A 4BOSC 3PLVA 3KYDD 2IY0B 4DHJB 3S2AA 1WE6A 1YJ1A 2DZKA 2L8JA 3A4SC 1V2YA 4ASWC 3VH3B 4FHJA 2KJ6A 2LVQA 2LASA 2REXA 3DVNV 3M95A 3Q3JA 4W9DA 1NBFC 3VVWB 1P98A 1WX8A 3X23A 4BKSD 1Y8RC 3ZNGC 2I1JA 2WWZA 1E8XA 5LLIA 2C7NB 4J6IA 1RRBA 2AYOB 2GBKA 3DOWA 2J7QB 3KUZA 4IM3A 2KDFB 3DQVA 2KQSA 2KK8A 4DHZB 4K7SA 1TGZB 1E8ZA 3PLUA 1WR1A 2I1KA 2N1VA 4ANVA 4URKA 4KSKC 3T8MA 2VRRB 3ML9A 4RMAA 1F9JA 1WE7A 2PJHA 1YD8U 4FBJB 3UF8A 3ZNID 5CX3A 4FA6A 1P1AA 3L17A 5E6NA 4NQKE 4F7ZA 3QAQA 2KVRA 4IWQA 1UBQA 1WYWB 2KTRB 2GMIC 3KW5B 4FJVB 3A9KB 2AL6A 3APDA 2MBOA 4F1SA 5J2RA 1Q1OA 4HDOA 2V4LA 2NVUI 5AZFA 2OJRA 1J19A 2DZMA 4WWPA 3RCZA 4DXAB 4GN1A 3QARA 1WM3A 4MJSA 2G45B 2MA9B 4A3OA 4W9FA 1ZKHA 4G3XB 1K8RB 4MSQB 3WANA 4EUTA 5LXIB 3MHSD 4II2B 3EHVA 5D94A 3U7DA 1WRDB 2WX0A 2BWES 3WAMA 4HLEA 2EKEC 1C3TA 5C1ZA 3A4RA 2D3GA 2LJ5A 2B3AA 1WFYA 3TBLD 2L00B 3C0RB 3LDZE 4IM2A 1C1YB 4W9KA 1P3QU 4LJPB 5JHAA 3QC8B 2HE7A 2FCNA 1D3ZA 3NZSA 2ZNVB 3QK0A 4A3PA 1E7UA 1WGDA 1WJUA 3R3MA 2IYDB 2ZPNA 4WJNA 2YLMA 1WMHB 2L76A 3B1LX 3L13A 4GDLB 2FNJB 4EFOA 2DHZA 3QWZB 1UH6A 4KV2A 4AWJA 2KOXA 2D11A 2KZRA 2PE9A 3UIPB 1V80A 1VD2A 2A4ZA 1ZGUB 4B6WA 4CYEA 4ANUA 3QJZA 2IO1B 4E71A 3W1YA 2W9NA 3Q3FA 3M62B 4KSLC 3EC8A 2MSED 3VUXA 3RUIB 2RSUA 2D07B 2DZIA 4E74A 4K81A 3A1QA 3N3KB 4BKSA 4WAAA 2KANA 3WA0A 1TBEA 4B95A 2V1YA 4NAWB 4IM0A 1KLVA 1S3SG 2MP2A 3ML8A 2HTHA 3L08A 2LI5A 4FJZA 2FIDA 2KWVB 1E8WA 2LXCA 4A20A 1CMXB 1UZXB 3SDLC 3PV1A 3QX1A 1LFDA 4DDID 2KXJA 2UWQA 1J0GA 1EO6A 4GB9A 1OEYA 5G55A 2ZCCA 2ZNVC 1MG8A 4TUUA 3M3JA 3VUWA 1JRUA 2LWPA 1OQYA 4GSWA 2NPTB 3RT3B 2N7DA 2KDEB 3I3TB 3L0WB 3PT2B 3RZWC 2KFKB 3A9JA 1RLFA 5DPSA 3UINB 1WJ4A 1WI0A 4I6PA 4W9EA 2IO3B 1J8CA 1Q0WB 3VAWA 2ZVNA 2L0FA 3SU8X 4MGIE 3HIZA 2MX2A 2N7EA 2LGXA 2KDIA 3PHWB 4ICVA 4P7IA 5KHOA 2FCSA 3NY5A 1WR6E 1WF9A 1OEYJ 4B9KA 4GIVA 2KWCA 4GXBA 1Z5SB 2DENB 1YIWA 3WAPA 4G11A 2KQ7A 5AZGA 4FJYA 2IY1B 5J17A 2KNBA 3UGBB 5DPWA 2K6QA 2KJRA 2Z0EB 4KIKB 4YL8A 3W1SC 4NJ6A 4LDTB 3ZNHB 2R2OA 3KVFB 4HPLB 4ZDVA 3IBEA 4CO7A 3MJWA 5CHFA 3T9LA 2L0TA 1WH3A 1WX7A 2NBVB 5TR5A 2GBNA 1E5WA 2KLGA 5DCNA 2JUOA 1OTRB 5JH5C 3ZDTA 2WX1A 3PSEB 3H1UA
chains in the Genus database with same CATH superfamily
3WAOA 2MBHA 3GS2A 1K52A 1ZW7A 3N32A 3QCAA 1OFFA 3P4RB 5L95C 2K8BA 3K9OB 5GXGB 5HG2A 4WIPA 2L05A 2D2QA 2PPHA 1N5XA 4LNFA 5D2MB 4HK2A 1WGGA 3VTVA 5EE9A 2BT6A 1QZEA 2PW9A 4LLGM 3PHXB 4NQLB 4HPPA 4WQOB 1AARA 4DBGA 1V5OA 3CIRB 3O65B 3U4EG 4M0WA 2BF8B 4NNJB 3V61A 1DYQA 2CKHB 2GB1A 3ONSA 4G0NB 4ZYSA 4L1BA 2WNMA 1IGCA 4DXFA 4HCNB 1WXMA 3R66C 3GOEA 1X1MA 3IFWB 2R2QA 2JPHA 2KTRA 3IT6B 1KLUD 2N0SB 1NDDA 1PGBA 2ZPYA 4N6EB 5E6PA 3SHQA 2RPQA 1WXAA 4ZYNA 2MCNB 3TCAA 3Q3MC 4IWOA 1FNVA 4KIKA 2N9XA 3DHGC 4FHKA 1XLPA 1PYWD 3Q2AC 2L1AA 2BKRB 2RR9A 3AULA 5FR6A 5IA7A 2JWZA 3NHEB 2QEJC 3APCA 4WWOA 2XN9C 4WJQA 4W9CA 4KZCA 4AS1A 5CTRC 3PPAA 5DPTA 1JCKB 3AE1B 3NS8A 3HVZA 3H7SA 4US8A 1D5MC 4EZKA 3TJPA 1F2RC 1P7FA 2EELA 2WDVB 1JRPA 3R2IA 1WXVA 2JX5A 3M63B 4OZAA 1ZXHA 3RN9C 1ET6A 3V6EB 1Q5WB 3PO0A 2JRIB 5EDSA 3L54A 3ZNZB 2K39A 2BPSA 2QSDA 2WHIA 5JHBA 2C5LC 4BAXA 1XT9B 1UGJA 4H2AA 3B9JA 2X8XX 1OGWA 3RNCC 1FXAA 4PS7A 3DVGY 1F1HA 3DHHC 5CHWA 3ZXRA 1E10A 2KN5A 4N9F4 1Z2MA 2RDGA 3OLMD 2XNAC 2KT7A 2AWTA 1B1ZA 4DWFA 2AX5A 2EMTA 4PS3A 1SIFA 1V6EA 4AP4C 4S17A 3DBLB 1ZUD2 4K7WA 1H4RA 4YSZB 1SJED 1B9RA 2OEDA 3BK1A 1VZ6A 1UBIA 3ECIA 2KLCA 3R7RA 4CHKA 1ISNA 1T6BX 2M8SA 4MH8A 5BO4B 3EGRA 3RNAC 5C23A 4LNOA 4KGTA 2BWFA 2PEAA 3VH4B 2BB5A 2DYMA 4PS8A 4HXDA 4KVGB 1MHHE 4NAWA 1L2NA 2MP2B 1LM8B 2MQJA 3VR9B 2UYZB 2K1FA 4NJ7A 3ZRFA 1T5XD 1R4MI 4M0WB 3Q8BA 3JVZX 4UDUC 3UQBA 3DBHB 1E90A 3ZKJC 2MBQA 4KKIA 3P4SB 4DDGD 2Z0DB 3AE8B 3GP7A 4NJCA 3R8BA 2LZ6A 4XX5A 3NOBA 1V81A 1VR9A 1PGAA 1ENFA 4JPSA 4G50A 3PZ7A 2KC2A 2WGSA 2FCMA 1R4NI 3HK0A 2N9EB 3NRZA 2MLBA 1A5RA 4HROA 1NYQA 2MHJA 3DHIC 1FIQA 2BQQA 4P16A 3H9DA 3HUIA 1R4MB 2J0MA 4OZBA 5JZEB 2MRPA 1IGDA 3PGEA 1SGHA 1L7YA 4LNNA 2K25A 2ZW1A 3IAS1 3S2AA 4DHJB 1SE4A 2HJ1A 3BYTB 3ZGZA 4KX6B 2LASA 2VZKD 1JWSD 1WX8A 3GE8C 2JYTA 2I1JA 3Q8FA 1RWSA 5LLIA 2C7NB 1DOXA 3TSSA 2K0PA 3ZJTA 1L6UA 3AMZA 2KK8A 1C77A 2I1KA 1PGXA 1L0VB 4KSKC 2VRRB 3ML9A 2BYTA 3AE2B 4RMAA 1WE7A 1HQRD 2ONQA 1P1AA 3L17A 3MC9A 2FBWB 2LEKA 3QAQA 1WYWB 2K3UA 2AL6A 3APDA 4F1SA 4HDOA 1Q1OA 2BVCA 2NVUI 3W9CB 2OJRA 1J19A 4WWPA 2JQRB 4MJSA 3KWLA 2MA9B 4W9FA 4G3XB 4N59A 1K8RB 4EUTA 3WANA 3TEYA 4II2B 4M00A 4HLEA 1C3TA 1IUEA 2L00B 4IM2A 1C1YB 2V9HA 4W9KA 1P3QU 3QC8B 2FCNA 1E7UA 1EWYC 3R3MA 2YLMA 2MJEA 1J7CA 3B1LX 4GDLB 1UH6A 3AE3B 5BMHA 3RNBC 1ZGUB 4CYEA 4ANUA 3W1YA 3GZNB 3M62B 4KSLC 3EC8A 1T3QA 2EKIA 3RUIB 2DZIA 3H8HA 1TBEA 4B95A 4NZLB 3CWIA 1KLVA 2HTHA 1QT9A 2KWVB 1LFDA 3HRDD 4DDID 2UWQA 1J0GA 1EO6A 1OEYA 5G55A 1MG8A 1QOBA 3AEFB 2WXNA 1HZ5A 4IKGA 1OQYA 1N61A 3L0WB 1XLQA 3I3TB 3PT2B 3AEDB 4I6PA 4W9EA 2IO3B 1Q0WB 2N7EA 3NY5A 2ICIA 2VH1A 1WR6E 1SXTA 1WF9A 1DOYA 3AE9B 1YIWA 4MACA 4G11A 3BWUD 2IY1B 4C4VB 2KJRA 4EE2A 4YSYB 1MVKA 4LDTB 4K3CA 1TJEA 2WXLA 3KVFB 1ESFA 3T9LA 1PDXA 2D3AA 2L0TA 4XWTA 5FR3A 5TR5A 1E5WA 4XE0A 1OTRB 5JH5C 3Q8CA 3H1UA 5DPRA 1FMAD 3T3NA 2XK5B 4OVZA 4IOIE 3AU4A 4ARIA 2HJ8A 4XC2A 3CMMB 4HJGE 1YN4A 3PREA 3MFGA 4TQ1A 3QIJA 2LGSA 1KH0A 1XLOA 2LUEA 4WJPA 4YXDB 4FN2A 3ZYYX 3PVLA 1FM0D 2QJLA 3NVWA 5CHVC 1P9DU 3RD2A 2KQ4X 2WXQA 1GC7A 1BMLC 1EM7A 4XDDA 2DZJA 3DVNU 4ANXA 1LQBA 2NCNA 3ZW3A 5D6JB 3PZ8A 3TMPB 2IJ0A 4ZRJA 2RD0A 2JSVX 2N4FA 5T8IA 2OJWA 3GB1A 2LHDA 4HCPB 1XO3A 3KYCD 3LJ3A 1MJDA 5D3IB 1YNTE 1PQSA 5G2NA 3D32A 1JW9D 1H8CA 1L0YB 3OAWA 4C7ZA 1F2RI 3GE3C 4EEWA 4ARCA 2WXIA 2FAZA 3NZ3A 4IW0A 1OQQA 1FNUA 1V1OA 2R61A 4W9LA 2WLBA 4PYZA 1IYFA 3U2SC 3I63C 4E3CA 4A8XC 4JWSC 2JWUA 3RNGC 4I6LB 2AQ1B 5IOIA 2DAFA 2K8HA 3CF6E 1TKGA 4JIOU 2KFJA 5E6JA 3AM9A 3NZUA 1AYFA 2DBYA 4YTNB 1E8YA 1EUVB 3FILA 4ZRQA 2GI9A 2PKOA 3U52E 2Y3AA 1ZDXA 1GNUA 4TKNA 2IGDA 5G5GA 4A6QA 3IAM1 1WGRA 3CSFA 5BYRA 1N63A 1T0RC 4NAMA 3A9JB 3P4PB 4BOZB 2M4NA 3DPDA 3B2FA 3X0WA 1I4XA 3VHTC 4KKJA 3ZLZA 3VUYA 2NR2A 1TKEA 2BB6A 2J4XA 3BYYB 2JF5A 3CSTA 3GZNI 1K53A 2BS4B 3J9CA 4XYCA 2WXJA 3AE5B 1FO4A 2LGDA 3P63A 1SF0A 3OJ4B 4PYUA 2INCC 2IO0B 1WSPA 4TQ0A 5IKCM 1YN3A 1GPXA 2INDC 3PRMB 1BUIC 1I4GA 3Q3OC 2WXGA 3PTFC 2KWUB 1CJEA 1UWMA 3DBRI 4REZA 1JALA 1Y56A 3JW0X 2BW2A 3ZQ4A 1HZ6A 2WU5B 2PE6B 2KMMA 2JYEA 2KWDA 2H89B 4TSSA 5D7GA 5BMIA 1XCQL 4IG7B 2CR5A 3HVDA 2GBJA 3DBLI 3IVFA 3R7QA 3AV8A 2KFKA 1V49A 2MBEA 3JSVA 2L3ZA 2NBWB 3ZUNA 4AJWA 2WXOA 4XWWA 1NEKB 3Q3NC 3UQAA 1L4DB 2NBUA 1BXTA 2WXRA 4BKTA 1TY0A 1E6EB 3WIMA 1STEA 2KD0A 3Q6BA 2JXXA 3IHPC 2JVCA 2O2VA 4BOSC 3KYDD 2IY0B 1WE6A 2L8JA 3A4SC 3MC8A 4ACFA 4ASWC 3VH3B 2KJ6A 3M95A 2REXA 3P42A 2YEPF 1P98A 3X23A 1XEEA 1Y8RC 3ZNGC 3OWEB 3AECB 3EA6A 4YTPB 2WS3B 2KDMA 4M01A 2AQ2B 1RRBA 1JQ4A 2AYOB 2WQYB 2GBKA 3AE6B 3KUZA 4IM3A 3DQVA 2W55A 2ON8A 4K7SA 2N1VA 1TS4A 4LK0M 2BS2B 4FBJB 1JWAD 3UF8A 5JXVA 2MEKA 4FA6A 3C8YA 2IGHA 2N9KA 2KTRB 1GAQB 2GMIC 3V05A 3MP9A 4FJVB 3FC4A 2MBOA 1D5XC 2WU2B 5AZFA 2DZMA 3RCZA 4DXAB 1VDVA 4A3OA 5LXIB 2G1EA 5D94A 3EHVA 2EKEC 5C1ZA 2D3GA 2B3AA 1FPYA 1WFYA 4C56C 2KN4A 1CZPA 2CJNA 5C3JB 2IPKD 4PK1A 3AEEB 2ZPNA 4WJNA 1VZ7A 2L76A 2LJIA 2D11A 3WCQA 4B6WA 1F52A 4ZRPA 3QJZA 4E71A 1V97A 2J42A 4WWMA 3O13A 2MSED 3MHZA 3VUXA 1KRHA 2D07B 4K81A 3A1QA 4BKSA 2ZW0A 3ABVB 4ZHOA 2KANA 1FRRA 3WA0A 2DNFA 1TY2A 4NAWB 4LNKA 3ML8A 3LYYA 3L08A 3OG5A 4FJZA 1E8WA 4A20A 1K50A 1IBXB 4HEA1 1FD6A 5EE3A 3SR6A 4AQ7A 3VUWA 1C4CA 2LWPA 1C79A 4GSWA 3RT3B 2KDEB 4J3OD 2KFKB 5DPSA 1ZPSA 3UINB 2WDRB 1WI0A 1J8CA 3VAWA 2Y5PA 3DBRB 2L32A 4JX1C 4MGIE 2LGXA 3KQ4A 1JWMD 4GIVA 2KWCA 4GXBA 1Z5SB 2PLPA 1CK1A 3UGBB 5DPWA 2K6QA 3ZJVA 4NJ6A 3IBEA 3NVVA 4CO7A 4DQOC 1WX7A 5DCNA 4M02A 3ZDTA 3PSEB 4ICUA 2INNE 1U4AA 2D3CA 2MBBB 4GDKA 4HDQA 1YMHE 4JGHB 2V3SA 2RDHA 3ZTDA 1V9JA 1E0ZA 2KACA 5FK9C 1WMHA 2QDFA 4LTUA 3T3OA 4DHJD 2BGFA 2BS3B 2HD5B 4RM9A 2HDEA 4KGSA 3QQ8B 3AXCA 1TIFA 1SE3A 2GBMA 4YSXB 2O6VB 5L83A 1D5ZC 2WYQA 3PRPB 1MG4A 1XCTL 3V62A 4BFRA 4USAA 4RGMA 1FFVA 4RGOS 3Q8AA 3Q69A 4WAFA 1LO5D 2ASQA 4WURA 1ROEA 3NVYA 1QQRA 1WJ6A 1QLBB 3VQIA 2QHOA 2Y5BB 4JLCA 1WZ3A 3ALBA 3TEZA 4II3B 4ITKA 4W9JA 3TL5A 4GOCA 2GBRA 2YVCA 4KDIC 2V0GA 5IO9A 3KWVA 2C9WB 2MH7A 2DYBA 2PVOD 3B0AA 4HKZE 2QILA 2BBCA 3A33B 4BVUC 4AJYB 2O2VB 1IP9A 1UD7A 2MJ3A 3KUCB 2M1MA 4GDLA 3HM6X 4OW0A 4GDKB 4JQWC 2LVPA 2K6DB 1JWBD 4LDTD 4GLSC 3VRBB 1KOTA 3U7ZA 1JMLA 2ZJDA 4MGKE 3ZO5B 2NTTA 1F77A 1WWTA 1DOIA 3NUHB 1SB3C 1ZDVA 2C7MB 4HVBA 3WALA 4MELA 3U8ZA 1YX6B 2DLBA 3MTNB 2YEPB 5IN7A 4ZRKA 4MGZE 1WY8A 1GUAB 3BK2A 5EE1A 1JWUD 1TKYA 4PT5A 2KKCA 2NPTA 4X57B 1MHXA 1SE9A 1YQ4B 1BT0A 1QOFA 4MJSB 4WWNA 2LGIA 4RNAA 4WH4A 2BYEA 2KX3A 1WX9A 2UU7A 1TTNA 3L10B 3I5JC 1C76A 1VCBA 4RF1A 3AB5A 1KM7A 4NPNA 1N6ZA 3ZVVA 1WGHA 3RI7C 2DX5B 3EECA 1M94A 1TT5B 1P0RA 3U30A 2W3SA 2LRWA 1E7PB 4US9A 3UIOB 1G6JA 4A90A 3DWMA 1XF5L 1EWCA 4L2YA 4AUQC 1TS3A 4MSMB 2W54A 1FXTB 1TZ1A 4EZJA 1EU3A 4JL9A 4FXCA 1AW7A 2RMMA 4N58A 1HEZE 3E9SA 1QOAA 4ZOHC 4M8NA 4A55A 4R3DA 3A1QB 2AL3A 3DDCB 3V3XA 3W1SA 2KVZA 1KLGD 2QCZA 1GG3A 2G4DB 2MWSB 1N5WA 3EFUA 2Z59B 3TIXA 2KHWB 1ACCA 4RFBA 3VTWA 3L4PA 3SD5A 1YOVB 1I4RA 3ZRCA 1GC6A 3AH7A 1JROA 2AEHA 2A5UA 2KMAA 4FADA 4W9IA 3RNEC 2LMCA 2WDQB 3IXSA 1GB4A 4RH6A 3QA8A 1ET9A 1WXQA 3H6NA 4BBNC 1LXDA 2K9XA 3KH0A 1R4NB 2FCQA 3W5UB 4OVVA 4DHZE 3DCGA 1P7EA 2LRUA 1RFAA 2WXHA 3Q8EA 1UELA 2LGYA 2JY6A 2M0XA 1GB1A 2EMSA 4XGAB 4KDLB 3DVGX 1GJZA 1ZOYB 2ZEQA 2CHZA 4RM8A 4NY0A 4GGQA 4GU2A 2XK5A 4FULA 2JZPA 4HWIB 1VZ8A 1FCLA 3BY4B 3H7PA 1ZXIA 5IAAC 3W2DA 2TSSA 4K3BA 1YJ1A 2DZKA 2E3TA 5AUKA 2LVQA 3VVWB 3DVNV 3Q3JA 4W9DA 1NBFC 3AEBB 5MPOA 1EU4A 2W82A 4C7YA 3B2GA 4J6IA 1L6VA 4P6VF 5AUIA 2J7QB 2KDFB 2V4IB 2W3RA 2OHFA 1V1PB 1UF0A 4URKA 3FAHA 3AEGB 1F9JA 4QAYA 2PJHA 2Q5WD 3ZNID 5CX3A 2J52A 4F7ZA 4IWQA 1UBQA 2V3PA 1KFYB 3N9YC 1OQRA 2CJOA 3ZJUA 2V4LA 3MJ5A 2DWQA 3EUB2 3TEXA 3R2TA 1WM3A 2LHEA 4MSQB 1NYRA 2N9LA 1VRAB 3U7DA 3WAMA 1WRDB 2BWES 4C80A 2LJ5A 1J7BA 3TBLD 3C0RB 4LJPB 3LB8C 2KYWA 3N1XC 2DHZA 3QWZB 2PE9A 3UIPB 2A4ZA 4MT5A 3W5VB 1WGKA 3N1YC 2W9NA 5HHDG 1HTOA 4E74A 1AN8A 2V1YA 2K5PA 2I38A 4IM0A 2MP2A 2LI5A 2LXCA 3FILB 1UZXB 1ZE3D 3QX1A 2KXJA 4KGRA 2ZCCA 2ZNVC 4TUUA 3M3JA 1NENB 1JRUA 1DGJA 2QIEB 2N7DA 3TUOA 1R7SA 3A9JA 1RLFA 1WJ4A 4MM3B 2ZVNA 2L0FA 4RCOA 3SU8X 3PHWB 2FCSA 2WXMA 1D6EC 3WAPA 5J17A 4FJYA 2KNBA 4KIKB 4YL8A 1QKZA 3W1SC 2R2OA 4HPLB 1HTQA 5CHFA 1WH3A 3RFZB 2NBVB 2GBNA 2JUOA 2KAJA 5TSSA 2WX1A 2LUMA 3V60A 1WIAA 2GOWA 1V5TA 3MC0B 2RDBC 1NI3A 2MJDA 5J18A 3ENEA 1IPGA 2WXPA 5EE0A 1A70A 1SEBD 3IT4B 3VTUA 4DK5A 3IG3A 3KUDB 5AEKB 2K8CA 1RYJA 2FE8A 2E6XA 5H92C 3HHMA 4EOYA 2IGGA 4D2KA 1T0YA 4K7UA 3AE4B 2LXAA 2QC8A 2BKFA 4LNIA 4IUMB 2FIFA 4B0MA 1V1PA 1SIJA 4BKGA 2JT4B 4HKQA 1T0QC 3I9V1 4B0EA 4OVUA 2KO3A 3PRZA 2PVGC 3JSVB 3RZFA 2CHXA 1NVID 5LNK1 2FUG1 3ETRA 3L16A 4BZAA 4K1RB 1FFUA 3PZDA 1RAXA 2M56B 2N9PC 2J0JA 2D10A 3P1MA 4JWUC 2ZVOA 1L5PA 4EZLA 2NS5A 3PS6A 4C4VA 4C00A 1FXIA 2WXFA 4WJOA 5AZHA 1E7VA 2IDYA 5E6OA 2GLSA 3AI5A 3APFA 2CU3A 3B08A 1KJTA 3V6CB 3AEAB 5G5HA 4RGTA 4RGNA 3NG0A 5LXHA 3H7PB 4MGYE 2BYVE 4TV3A 2Y5CA 4FLHA 2ZZPB 2J53A 1XXGA 3OJ3A 1D4BA 2DAJA 2N7JA 3BVGA 5BMGA 3BZDB 4DXGA 1TS2A 2IO2B 4GMVA 4JE3B 4YWGG 4P1CC 2RGFA 2FUHB 2ZCBA 2NTSA 1HE8A 5HKHA 3EFCA 1EF5A 3NJTA 4HJKA 1S1QB 4O1NA 3ZIMA 2I2YA 2KTFA 4MH0E 2AQ3B 2M17A 2JZ3B 3ZDMC 4MEMA 2KDBA 3RYTA 1YX5B 3P2BA 1VJKA 4XDCA 2CU1A 2WXKA 2L7RA 2MW5A 2G3QB 3KLSX 1K51A 1WGYA 3N1ZC 4KZ0A 1XD3B 4IWPA 3K9PB 2KJHB 3P4QB 1WXSA 4YT0B 4F8CB 2XBBC 3VXWA 4A9AA 2G4SA 2QMTA 1YJJA 2VH2A 2LD9A 5BYQA 5HI1A 3NS1A 4LCDE 3ZTCA 4IC7B 2PMVA 2WDTB 4XZ4A 1LGRA 3Q14C 1TYGB 1V86A 3ZXVA 4I6NB 4MDKE 2DYOA 2SAKA 4BBNF 2KMCA 1YJIA 4ZHPA 2SEBD 2J0KA 2CS4A 1M4VA 1WYGA 2ACZB 2KX0A 3JYUA 1F0ZA 3BIID 2M19A 3DBHI 1TZOA 1NI2A 1SE2A 1I4HA 1C9FA 2IBIB 4HPMB 2CHWA 3N30A 1FEHA 1WM2A 3HM3A 2VZKB 1WZ0A 2PIAA 5D3DA 4S0RA 2OOBB 2IZVB 1YQ3B 5KHQA 1UUPA 2INPE 3VDZA 2K22A 1RM6C 4OZCA 3VFKA 1XQQA 2NMQA 1IBXA 2N1WA 4M8MA 2O6VA 1E9MA 4W9GA 1N62A 1UNSA 1MPEA 4LJOB 1HA5A 2C60A 2C7HA 3A9KA 2L83A 3FKYA 2M0AA 1EF1A 2O6VD 2KC1A 1HXYD 4MM3A 1SBBB 3QHTA 1I35A 1PFDA 3DBSA 4AOFA 4CQNA 2JZZA 3BINA 1WJNA 1UGMA 1KF6B 3C19A 4WQMA 2BYFA 1ZP0B 3I57A 2JRHA 4ZRIA 3AU5A 1YQBA 4YTMB 4ANWA 4W9HA 1I42A 2LVOA 4EKUA 2XEWA 3URYA 3RULA 1KTKA 3BVZA 5GMVA 1FNWA 3PLVA 5BYSA 5H8YE 1C4PA 1SJHD 1T0SC 2BTEA 1L4ZB 1V2YA 1TS5A 4FHJA 1C78A 1MFWA 4BKSD 1UWXA 5HFYA 4IDIA 3RPFC 3E56A 1FCCC 1FRDA 2WWZA 1E8XA 1QILA 2X38A 3DOWA 4TMAB 2KQSA 4DHZB 1TGZB 2JXTA 5IP4D 1E8ZA 3PLUA 1WR1A 4ANVA 2Z8LA 3T8MA 3VR8B 5I4DA 2HTME 1I4PA 1YD8U 5E6NA 1N60A 4NQKE 2KVRA 3AE7B 4L23A 3BVMA 3KW5B 4P1BC 2G9HD 3A9KB 5J2RA 4HRSA 2D3BA 3UI3A 4GN1A 4OHJA 3QARA 2G45B 1ZKHA 3MHSD 2WX0A 1AWDA 3A4RA 3AN1A 3VRAB 3LDZE 1C4AA 5JHAA 1V8CA 1RFKA 2D5GA 2HE7A 1D3ZA 3NZSA 2ZNVB 3QK0A 1WRIA 4A3PA 2B76B 1WGDA 1WJUA 2L52A 2IYDB 1WMHB 3L13A 2FNJB 4EFOA 4KV2A 4AWJA 3RMKC 2KOXA 3NVZA 2KZRA 1V80A 1VD2A 1YN5A 1MI0A 3SFEB 4RF0A 1QOGA 2IO1B 3DWGC 4Q2JA 1CQVA 3SEBA 1J7AA 3Q3FA 3SFDB 3TEWA 2RSUA 3N3KB 4WAAA 3RNFC 2GRIA 1S3SG 3N20C 2FIDA 5C2TB 1CMXB 3SDLC 3PV1A 4GB9A 1QF6A 1PUTA 1XLNA 2NPTB 2V3NA 3RZWC 2RPVA 1I4QA 1Q10A 2JU6X 3HIZA 2MX2A 2WP9B 2KDIA 4ICVA 4P7IA 5KHOA 4B9KA 1OEYJ 3LXFA 2DENB 1I7HA 5AZGA 2KQ7A 5FKAC 2LFIA 2PTLA 2Z0EB 1L0XB 2H88B 3ZNHB 4ZDVA 3MJWA 1GOZA 1VLBA 2KLGA 1SSNA
chains in the Genus database with same CATH topology
1WIAA 3WAOA 2GOWA 2MBHA 5DPRA 1ZW7A 2XK5B 1V5TA 1U4AA 3N32A 3AU4A 3QCAA 2HJ8A 4XC2A 3CMMB 5L95C 2MBBB 2K8BA 3K9OB 4GDKA 4HDQA 4JGHB 2V3SA 2L05A 3PREA 2D2QA 4TQ1A 3ZTDA 5J18A 1V9JA 3ENEA 2PPHA 3QIJA 1IPGA 5D2MB 4HK2A 1WMHA 1WGGA 2LUEA 4WJPA 3VTUA 4FN2A 4DK5A 3IG3A 3KUDB 3VTVA 3PVLA 5AEKB 2K8CA 5CHVC 1P9DU 3RD2A 1QZEA 3PHXB 4NQLB 4DHJD 2BGFA 4EOYA 3HHMA 1GC7A 1T0YA 2HD5B 4RM9A 4K7UA 4WQOB 1AARA 3QQ8B 2LXAA 1V5OA 3AXCA 3O65B 4DBGA 2DZJA 3DVNU 2BKFA 2BF8B 2GBMA 4ANXA 1LQBA 2O6VB 4IUMB 5L83A 4NNJB 3V61A 2FIFA 2NCNA 2WYQA 3PRPB 3ZW3A 5D6JB 2CKHB 3ONSA 4G0NB 3TMPB 3V62A 4BKGA 2JT4B 4BFRA 4ZRJA 2RD0A 4HCNB 2N4FA 1WXMA 3R66C 3GOEA 1X1MA 4OVUA 2KO3A 3IFWB 3PRZA 3JSVB 3RZFA 2R2QA 4HCPB 2JPHA 2KTRA 2ASQA 2CHXA 3KYCD 1WJ6A 3LJ3A 1NDDA 3VQIA 3L16A 2QHOA 2Y5BB 4JLCA 1WZ3A 3ALBA 2ZPYA 4II3B 4K1RB 1PQSA 5G2NA 3D32A 4W9JA 3TL5A 3PZDA 1RAXA 4GOCA 2GBRA 5E6PA 2N9PC 2J0JA 3SHQA 2RPQA 1WXAA 1H8CA 2D10A 2YVCA 3OAWA 4ZYNA 2ZVOA 4KDIC 4EEWA 4EZLA 2MCNB 2NS5A 3TCAA 4IWOA 3PS6A 4KIKA 2N9XA 2C9WB 4WJOA 5AZHA 2FAZA 1E7VA 4FHKA 2DYBA 5E6OA 3B0AA 3AI5A 3APFA 3B08A 1KJTA 3A33B 3V6CB 2BKRB 4BVUC 2RR9A 4IW0A 2O2VB 4AJYB 5LXHA 3H7PB 4MGYE 3AULA 5FR6A 2BYVE 4TV3A 5IA7A 2JWZA 3NHEB 2ZZPB 4FLHA 4PYZA 3APCA 4W9LA 4WWOA 1IP9A 4WJQA 1IYFA 4W9CA 1UD7A 4KZCA 3OJ3A 3KUCB 5CTRC 2M1MA 2DAJA 4E3CA 4GDLA 3PPAA 3HM6X 5DPTA 4GDKB 4GMVA 2IO2B 3NS8A 4I6LB 3H7SA 2RGFA 2LVPA 4JQWC 2K6DB 2DAFA 4EZKA 2FUHB 4LDTD 3TJPA 2K8HA 3CF6E 4JIOU 1KOTA 2ZCBA 2KFJA 2ZJDA 4MGKE 3ZO5B 1HE8A 5HKHA 1EF5A 4HJKA 1S1QB 3NZUA 3ZIMA 2KTFA 4MH0E 1WXVA 2M17A 2JZ3B 3ZDMC 3M63B 2C7MB 4MEMA 2KDBA 3RYTA 1E8YA 3V6EB 1YX5B 4HVBA 3WALA 3P2BA 4MELA 1EUVB 1Q5WB 2JRIB 3U8ZA 5EDSA 2CU1A 4ICUA 1YX6B 3L54A 2L7RA 2MW5A 3ZNZB 2K39A 3MTNB 2G3QB 4ZRKA 4MGZE 2BPSA 1GNUA 1WY8A 1WGYA 4KZ0A 4TKNA 1XD3B 5JHBA 1GUAB 3K9PB 4IWPA 2KJHB 1WXSA 2C5LC 4F8CB 1XT9B 2XBBC 3VXWA 1WGRA 2KKCA 2NPTA 3CSFA 1OGWA 4X57B 2G4SA 2LD9A 3A9JB 1SE9A 4BOZB 2M4NA 3DPDA 1BT0A 3DVGY 4PS7A 3X0WA 4LCDE 4MJSB 4WWNA 3VHTC 5CHWA 3ZTCA 4IC7B 2BYEA 2KX3A 1WX9A 2WDTB 3ZLZA 2KN5A 4XZ4A 3VUYA 2NR2A 1TTNA 3L10B 1Z2MA 4N9F4 1VCBA 2JF5A 3CSTA 3GZNI 1V86A 1KM7A 4NPNA 3ZVVA 1WGHA 3OLMD 2DX5B 2AWTA 3EECA 4I6NB 2DYOA 4MDKE 4BBNF 4DWFA 1M94A 2KMCA 1P0RA 2EMTA 4PS3A 3U30A 1SIFA 2J0KA 2LRWA 1V6EA 2CS4A 3UIOB 1G6JA 4AP4C 2LGDA 3OJ4B 4PYUA 4AUQC 2IO0B 4TQ0A 2KX0A 4MSMB 3JYUA 4K7WA 1H4RA 1FXTB 3DBHI 3PRMB 1TZ1A 1NI2A 4EZJA 1UBIA 3ECIA 4JL9A 2KLCA 3PTFC 2KWUB 3R7RA 2IBIB 4CHKA 4HPMB 1ISNA 2CHWA 2M8SA 5BO4B 3DBRI 3JW0X 3N30A 5C23A 4M8NA 1WM2A 2BWFA 2PEAA 3HM3A 3VH4B 3A1QB 2PE6B 1WZ0A 2AL3A 3DDCB 2DYMA 4PS8A 4HXDA 4KVGB 3W1SA 4NAWA 1GG3A 2G4DB 2MWSB 2IZVB 2OOBB 2MP2B 3EFUA 5KHQA 1LM8B 1L2NA 2MQJA 2Z59B 3TIXA 2UYZB 3VDZA 2KHWB 2K1FA 3VFKA 3VTWA 1XQQA 4NJ7A 3SD5A 3ZRCA 3ZRFA 1GC6A 2N1WA 1R4MI 4M0WB 2AEHA 2A5UA 2KMAA 4M8MA 2O6VA 4FADA 5D7GA 3JVZX 4W9IA 4W9GA 4IG7B 3UQBA 2CR5A 4LJOB 1E90A 2GBJA 3ZKJC 2MBQA 2C60A 3DBLI 3QA8A 3IVFA 2C7HA 3A9KA 3R7QA 4DDGD 3H6NA 4BBNC 1EF1A 1LXDA 2KFKA 2Z0DB 3KH0A 2O6VD 2KC1A 1V49A 2MBEA 2FCQA 4MM3A 4OVVA 3QHTA 2LZ6A 1I35A 3JSVA 4DHZE 2L3ZA 2NBWB 3DCGA 4XX5A 3NOBA 3DBSA 1V81A 3ZUNA 4AOFA 4AJWA 2LRUA 2JZZA 3BINA 1RFAA 1WJNA 2KC2A 1UGMA 4G50A 2BYFA 2FCMA 1R4NI 1UELA 2JRHA 2JY6A 2LGYA 2N9EB 3HK0A 2M0XA 4ZRIA 3UQAA 2EMSA 3AU5A 2MLBA 1A5RA 1YQBA 4KDLB 3DVGX 4ANWA 1GJZA 2ZEQA 4W9HA 1I42A 2NBUA 2LVOA 4EKUA 3H9DA 3V60A 2CHZA 2J0MA 4RM8A 4BKTA 4NY0A 4GGQA 4GU2A 2XK5A 4FULA 5JZEB 2XEWA 3WIMA 4HWIB 2MRPA 2KD0A 3PGEA 3RULA 2JXXA 3IHPC 1SGHA 3BY4B 2JVCA 2O2VA 1L7YA 3H7PA 5GMVA 5IAAC 2K25A 4BOSC 3PLVA 3KYDD 2IY0B 4DHJB 3S2AA 1WE6A 1YJ1A 2DZKA 2L8JA 3A4SC 1V2YA 4ASWC 3VH3B 4FHJA 2KJ6A 2LVQA 2LASA 2REXA 3DVNV 3M95A 3Q3JA 4W9DA 1NBFC 3VVWB 1P98A 1WX8A 3X23A 4BKSD 1Y8RC 3ZNGC 2I1JA 2WWZA 1E8XA 5LLIA 2C7NB 4J6IA 1RRBA 2AYOB 2GBKA 3DOWA 2J7QB 3KUZA 4IM3A 2KDFB 3DQVA 2KQSA 2KK8A 4DHZB 4K7SA 1TGZB 1E8ZA 3PLUA 1WR1A 2I1KA 2N1VA 4ANVA 4URKA 4KSKC 3T8MA 2VRRB 3ML9A 4RMAA 1F9JA 1WE7A 2PJHA 1YD8U 4FBJB 3UF8A 3ZNID 5CX3A 4FA6A 1P1AA 3L17A 5E6NA 4NQKE 4F7ZA 3QAQA 2KVRA 4IWQA 1UBQA 1WYWB 2KTRB 2GMIC 3KW5B 4FJVB 3A9KB 2AL6A 3APDA 2MBOA 4F1SA 5J2RA 1Q1OA 4HDOA 2V4LA 2NVUI 5AZFA 2OJRA 1J19A 2DZMA 4WWPA 3RCZA 4DXAB 4GN1A 3QARA 1WM3A 4MJSA 2G45B 2MA9B 4A3OA 4W9FA 1ZKHA 4G3XB 1K8RB 4MSQB 3WANA 4EUTA 5LXIB 3MHSD 4II2B 3EHVA 5D94A 3U7DA 1WRDB 2WX0A 2BWES 3WAMA 4HLEA 2EKEC 1C3TA 5C1ZA 3A4RA 2D3GA 2LJ5A 2B3AA 1WFYA 3TBLD 2L00B 3C0RB 3LDZE 4IM2A 1C1YB 4W9KA 1P3QU 4LJPB 5JHAA 3QC8B 2HE7A 2FCNA 1D3ZA 3NZSA 2ZNVB 3QK0A 4A3PA 1E7UA 1WGDA 1WJUA 3R3MA 2IYDB 2ZPNA 4WJNA 2YLMA 1WMHB 2L76A 3B1LX 3L13A 4GDLB 2FNJB 4EFOA 2DHZA 3QWZB 1UH6A 4KV2A 4AWJA 2KOXA 2D11A 2KZRA 2PE9A 3UIPB 1V80A 1VD2A 2A4ZA 1ZGUB 4B6WA 4CYEA 4ANUA 3QJZA 2IO1B 4E71A 3W1YA 2W9NA 3Q3FA 3M62B 4KSLC 3EC8A 2MSED 3VUXA 3RUIB 2RSUA 2D07B 2DZIA 4E74A 4K81A 3A1QA 3N3KB 4BKSA 4WAAA 2KANA 3WA0A 1TBEA 4B95A 2V1YA 4NAWB 4IM0A 1KLVA 1S3SG 2MP2A 3ML8A 2HTHA 3L08A 2LI5A 4FJZA 2FIDA 2KWVB 1E8WA 2LXCA 4A20A 1CMXB 1UZXB 3SDLC 3PV1A 3QX1A 1LFDA 4DDID 2KXJA 2UWQA 1J0GA 1EO6A 4GB9A 1OEYA 5G55A 2ZCCA 2ZNVC 1MG8A 4TUUA 3M3JA 3VUWA 1JRUA 2LWPA 1OQYA 4GSWA 2NPTB 3RT3B 2N7DA 2KDEB 3I3TB 3L0WB 3PT2B 3RZWC 2KFKB 3A9JA 1RLFA 5DPSA 3UINB 1WJ4A 1WI0A 4I6PA 4W9EA 2IO3B 1J8CA 1Q0WB 3VAWA 2ZVNA 2L0FA 3SU8X 4MGIE 3HIZA 2MX2A 2N7EA 2LGXA 2KDIA 3PHWB 4ICVA 4P7IA 5KHOA 2FCSA 3NY5A 1WR6E 1WF9A 1OEYJ 4B9KA 4GIVA 2KWCA 4GXBA 1Z5SB 2DENB 1YIWA 3WAPA 4G11A 2KQ7A 5AZGA 4FJYA 2IY1B 5J17A 2KNBA 3UGBB 5DPWA 2K6QA 2KJRA 2Z0EB 4KIKB 4YL8A 3W1SC 4NJ6A 4LDTB 3ZNHB 2R2OA 3KVFB 4HPLB 4ZDVA 3IBEA 4CO7A 3MJWA 5CHFA 3T9LA 2L0TA 1WH3A 1WX7A 2NBVB 5TR5A 2GBNA 1E5WA 2KLGA 5DCNA 2JUOA 1OTRB 5JH5C 3ZDTA 2WX1A 3PSEB 3H1UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WIA A;  3WAO A;  2GOW A;  2MBH A;  5DPR A;  1ZW7 A;  2XK5 B;  1V5T A;  1U4A A;  3N32 A;  3AU4 A;  3QCA A;  2HJ8 A;  4XC2 A;  3CMM B;  5L95 C;  2MBB B;  2K8B A;  3K9O B;  4GDK A;  4HDQ A;  4JGH B;  2V3S A;  2L05 A;  3PRE A;  2D2Q A;  4TQ1 A;  3ZTD A;  5J18 A;  1V9J A;  3ENE A;  2PPH A;  3QIJ A;  1IPG A;  5D2M B;  4HK2 A;  1WMH A;  1WGG A;  2LUE A;  4WJP A;  3VTU A;  4FN2 A;  4DK5 A;  3IG3 A;  3KUD B;  3VTV A;  3PVL A;  5AEK B;  2K8C A;  5CHV C;  1P9D U;  3RD2 A;  1QZE A;  3PHX B;  4NQL B;  4DHJ D;  2BGF A;  4EOY A;  3HHM A;  1GC7 A;  1T0Y A;  2HD5 B;  4RM9 A;  4K7U A;  4WQO B;  1AAR A;  3QQ8 B;  2LXA A;  1V5O A;  3AXC A;  3O65 B;  4DBG A;  2DZJ A;  3DVN U;  2BKF A;  2BF8 B;  2GBM A;  4ANX A;  1LQB A;  2O6V B;  4IUM B;  5L83 A;  4NNJ B;  3V61 A;  2FIF A;  2NCN A;  2WYQ A;  3PRP B;  3ZW3 A;  5D6J B;  2CKH B;  3ONS A;  4G0N B;  3TMP B;  3V62 A;  4BKG A;  2JT4 B;  4BFR A;  4ZRJ A;  2RD0 A;  4HCN B;  2N4F A;  1WXM A;  3R66 C;  3GOE A;  1X1M A;  4OVU A;  2KO3 A;  3IFW B;  3PRZ A;  3JSV B;  3RZF A;  2R2Q A;  4HCP B;  2JPH A;  2KTR A;  2ASQ A;  2CHX A;  3KYC D;  1WJ6 A;  3LJ3 A;  1NDD A;  3VQI A;  3L16 A;  2QHO A;  2Y5B B;  4JLC A;  1WZ3 A;  3ALB A;  2ZPY A;  4II3 B;  4K1R B;  1PQS A;  5G2N A;  3D32 A;  4W9J A;  3TL5 A;  3PZD A;  1RAX A;  4GOC A;  2GBR A;  5E6P A;  2N9P C;  2J0J A;  3SHQ A;  2RPQ A;  1WXA A;  1H8C A;  2D10 A;  2YVC A;  3OAW A;  4ZYN A;  2ZVO A;  4KDI C;  4EEW A;  4EZL A;  2MCN B;  2NS5 A;  3TCA A;  4IWO A;  3PS6 A;  4KIK A;  2N9X A;  2C9W B;  4WJO A;  5AZH A;  2FAZ A;  1E7V A;  4FHK A;  2DYB A;  5E6O A;  3B0A A;  3AI5 A;  3APF A;  3B08 A;  1KJT A;  3A33 B;  3V6C B;  2BKR B;  4BVU C;  2RR9 A;  4IW0 A;  2O2V B;  4AJY B;  5LXH A;  3H7P B;  4MGY E;  3AUL A;  5FR6 A;  2BYV E;  4TV3 A;  5IA7 A;  2JWZ A;  3NHE B;  2ZZP B;  4FLH A;  4PYZ A;  3APC A;  4W9L A;  4WWO A;  1IP9 A;  4WJQ A;  1IYF A;  4W9C A;  1UD7 A;  4KZC A;  3OJ3 A;  3KUC B;  5CTR C;  2M1M A;  2DAJ A;  4E3C A;  4GDL A;  3PPA A;  3HM6 X;  5DPT A;  4GDK B;  4GMV A;  2IO2 B;  3NS8 A;  4I6L B;  3H7S A;  2RGF A;  2LVP A;  4JQW C;  2K6D B;  2DAF A;  4EZK A;  2FUH B;  4LDT D;  3TJP A;  2K8H A;  3CF6 E;  4JIO U;  1KOT A;  2ZCB A;  2KFJ A;  2ZJD A;  4MGK E;  3ZO5 B;  1HE8 A;  5HKH A;  1EF5 A;  4HJK A;  1S1Q B;  3NZU A;  3ZIM A;  2KTF A;  4MH0 E;  1WXV A;  2M17 A;  2JZ3 B;  3ZDM C;  3M63 B;  2C7M B;  4MEM A;  2KDB A;  3RYT A;  1E8Y A;  3V6E B;  1YX5 B;  4HVB A;  3WAL A;  3P2B A;  4MEL A;  1EUV B;  1Q5W B;  2JRI B;  3U8Z A;  5EDS A;  2CU1 A;  4ICU A;  1YX6 B;  3L54 A;  2L7R A;  2MW5 A;  3ZNZ B;  2K39 A;  3MTN B;  2G3Q B;  4ZRK A;  4MGZ E;  2BPS A;  1GNU A;  1WY8 A;  1WGY A;  4KZ0 A;  4TKN A;  1XD3 B;  5JHB A;  1GUA B;  3K9P B;  4IWP A;  2KJH B;  1WXS A;  2C5L C;  4F8C B;  1XT9 B;  2XBB C;  3VXW A;  1WGR A;  2KKC A;  2NPT A;  3CSF A;  1OGW A;  4X57 B;  2G4S A;  2LD9 A;  3A9J B;  1SE9 A;  4BOZ B;  2M4N A;  3DPD A;  1BT0 A;  3DVG Y;  4PS7 A;  3X0W A;  4LCD E;  4MJS B;  4WWN A;  3VHT C;  5CHW A;  3ZTC A;  4IC7 B;  2BYE A;  2KX3 A;  1WX9 A;  2WDT B;  3ZLZ A;  2KN5 A;  4XZ4 A;  3VUY A;  2NR2 A;  1TTN A;  3L10 B;  1Z2M A;  4N9F 4;  1VCB A;  2JF5 A;  3CST A;  3GZN I;  1V86 A;  1KM7 A;  4NPN A;  3ZVV A;  1WGH A;  3OLM D;  2DX5 B;  2AWT A;  3EEC A;  4I6N B;  2DYO A;  4MDK E;  4BBN F;  4DWF A;  1M94 A;  2KMC A;  1P0R A;  2EMT A;  4PS3 A;  3U30 A;  1SIF A;  2J0K A;  2LRW A;  1V6E A;  2CS4 A;  3UIO B;  1G6J A;  4AP4 C;  2LGD A;  3OJ4 B;  4PYU A;  4AUQ C;  2IO0 B;  4TQ0 A;  2KX0 A;  4MSM B;  3JYU A;  4K7W A;  1H4R A;  1FXT B;  3DBH I;  3PRM B;  1TZ1 A;  1NI2 A;  4EZJ A;  1UBI A;  3ECI A;  4JL9 A;  2KLC A;  3PTF C;  2KWU B;  3R7R A;  2IBI B;  4CHK A;  4HPM B;  1ISN A;  2CHW A;  2M8S A;  5BO4 B;  3DBR I;  3JW0 X;  3N30 A;  5C23 A;  4M8N A;  1WM2 A;  2BWF A;  2PEA A;  3HM3 A;  3VH4 B;  3A1Q B;  2PE6 B;  1WZ0 A;  2AL3 A;  3DDC B;  2DYM A;  4PS8 A;  4HXD A;  4KVG B;  3W1S A;  4NAW A;  1GG3 A;  2G4D B;  2MWS B;  2IZV B;  2OOB B;  2MP2 B;  3EFU A;  5KHQ A;  1LM8 B;  1L2N A;  2MQJ A;  2Z59 B;  3TIX A;  2UYZ B;  3VDZ A;  2KHW B;  2K1F A;  3VFK A;  3VTW A;  1XQQ A;  4NJ7 A;  3SD5 A;  3ZRC A;  3ZRF A;  1GC6 A;  2N1W A;  1R4M I;  4M0W B;  2AEH A;  2A5U A;  2KMA A;  4M8M A;  2O6V A;  4FAD A;  5D7G A;  3JVZ X;  4W9I A;  4W9G A;  4IG7 B;  3UQB A;  2CR5 A;  4LJO B;  1E90 A;  2GBJ A;  3ZKJ C;  2MBQ A;  2C60 A;  3DBL I;  3QA8 A;  3IVF A;  2C7H A;  3A9K A;  3R7Q A;  4DDG D;  3H6N A;  4BBN C;  1EF1 A;  1LXD A;  2KFK A;  2Z0D B;  3KH0 A;  2O6V D;  2KC1 A;  1V49 A;  2MBE A;  2FCQ A;  4MM3 A;  4OVV A;  3QHT A;  2LZ6 A;  1I35 A;  3JSV A;  4DHZ E;  2L3Z A;  2NBW B;  3DCG A;  4XX5 A;  3NOB A;  3DBS A;  1V81 A;  3ZUN A;  4AOF A;  4AJW A;  2LRU A;  2JZZ A;  3BIN A;  1RFA A;  1WJN A;  2KC2 A;  1UGM A;  4G50 A;  2BYF A;  2FCM A;  1R4N I;  1UEL A;  2JRH A;  2JY6 A;  2LGY A;  2N9E B;  3HK0 A;  2M0X A;  4ZRI A;  3UQA A;  2EMS A;  3AU5 A;  2MLB A;  1A5R A;  1YQB A;  4KDL B;  3DVG X;  4ANW A;  1GJZ A;  2ZEQ A;  4W9H A;  1I42 A;  2NBU A;  2LVO A;  4EKU A;  3H9D A;  3V60 A;  2CHZ A;  2J0M A;  4RM8 A;  4BKT A;  4NY0 A;  4GGQ A;  4GU2 A;  2XK5 A;  4FUL A;  5JZE B;  2XEW A;  3WIM A;  4HWI B;  2MRP A;  2KD0 A;  3PGE A;  3RUL A;  2JXX A;  3IHP C;  1SGH A;  3BY4 B;  2JVC A;  2O2V A;  1L7Y A;  3H7P A;  5GMV A;  5IAA C;  2K25 A;  4BOS C;  3PLV A;  3KYD D;  2IY0 B;  4DHJ B;  3S2A A;  1WE6 A;  1YJ1 A;  2DZK A;  2L8J A;  3A4S C;  1V2Y A;  4ASW C;  3VH3 B;  4FHJ A;  2KJ6 A;  2LVQ A;  2LAS A;  2REX A;  3DVN V;  3M95 A;  3Q3J A;  4W9D A;  1NBF C;  3VVW B;  1P98 A;  1WX8 A;  3X23 A;  4BKS D;  1Y8R C;  3ZNG C;  2I1J A;  2WWZ A;  1E8X A;  5LLI A;  2C7N B;  4J6I A;  1RRB A;  2AYO B;  2GBK A;  3DOW A;  2J7Q B;  3KUZ A;  4IM3 A;  2KDF B;  3DQV A;  2KQS A;  2KK8 A;  4DHZ B;  4K7S A;  1TGZ B;  1E8Z A;  3PLU A;  1WR1 A;  2I1K A;  2N1V A;  4ANV A;  4URK A;  4KSK C;  3T8M A;  2VRR B;  3ML9 A;  4RMA A;  1F9J A;  1WE7 A;  2PJH A;  1YD8 U;  4FBJ B;  3UF8 A;  3ZNI D;  5CX3 A;  4FA6 A;  1P1A A;  3L17 A;  5E6N A;  4NQK E;  4F7Z A;  3QAQ A;  2KVR A;  4IWQ A;  1UBQ A;  1WYW B;  2KTR B;  2GMI C;  3KW5 B;  4FJV B;  3A9K B;  2AL6 A;  3APD A;  2MBO A;  4F1S A;  5J2R A;  1Q1O A;  4HDO A;  2V4L A;  2NVU I;  5AZF A;  2OJR A;  1J19 A;  2DZM A;  4WWP A;  3RCZ A;  4DXA B;  4GN1 A;  3QAR A;  1WM3 A;  4MJS A;  2G45 B;  2MA9 B;  4A3O A;  4W9F A;  1ZKH A;  4G3X B;  1K8R B;  4MSQ B;  3WAN A;  4EUT A;  5LXI B;  3MHS D;  4II2 B;  3EHV A;  5D94 A;  3U7D A;  1WRD B;  2WX0 A;  2BWE S;  3WAM A;  4HLE A;  2EKE C;  1C3T A;  5C1Z A;  3A4R A;  2D3G A;  2LJ5 A;  2B3A A;  1WFY A;  3TBL D;  2L00 B;  3C0R B;  3LDZ E;  4IM2 A;  1C1Y B;  4W9K A;  1P3Q U;  4LJP B;  5JHA A;  3QC8 B;  2HE7 A;  2FCN A;  1D3Z A;  3NZS A;  2ZNV B;  3QK0 A;  4A3P A;  1E7U A;  1WGD A;  1WJU A;  3R3M A;  2IYD B;  2ZPN A;  4WJN A;  2YLM A;  1WMH B;  2L76 A;  3B1L X;  3L13 A;  4GDL B;  2FNJ B;  4EFO A;  2DHZ A;  3QWZ B;  1UH6 A;  4KV2 A;  4AWJ A;  2KOX A;  2D11 A;  2KZR A;  2PE9 A;  3UIP B;  1V80 A;  1VD2 A;  2A4Z A;  1ZGU B;  4B6W A;  4CYE A;  4ANU A;  3QJZ A;  2IO1 B;  4E71 A;  3W1Y A;  2W9N A;  3Q3F A;  3M62 B;  4KSL C;  3EC8 A;  2MSE D;  3VUX A;  3RUI B;  2RSU A;  2D07 B;  2DZI A;  4E74 A;  4K81 A;  3A1Q A;  3N3K B;  4BKS A;  4WAA A;  2KAN A;  3WA0 A;  1TBE A;  4B95 A;  2V1Y A;  4NAW B;  4IM0 A;  1KLV A;  1S3S G;  2MP2 A;  3ML8 A;  2HTH A;  3L08 A;  2LI5 A;  4FJZ A;  2FID A;  2KWV B;  1E8W A;  2LXC A;  4A20 A;  1CMX B;  1UZX B;  3SDL C;  3PV1 A;  3QX1 A;  1LFD A;  4DDI D;  2KXJ A;  2UWQ A;  1J0G A;  1EO6 A;  4GB9 A;  1OEY A;  5G55 A;  2ZCC A;  2ZNV C;  1MG8 A;  4TUU A;  3M3J A;  3VUW A;  1JRU A;  2LWP A;  1OQY A;  4GSW A;  2NPT B;  3RT3 B;  2N7D A;  2KDE B;  3I3T B;  3L0W B;  3PT2 B;  3RZW C;  2KFK B;  3A9J A;  1RLF A;  5DPS A;  3UIN B;  1WJ4 A;  1WI0 A;  4I6P A;  4W9E A;  2IO3 B;  1J8C A;  1Q0W B;  3VAW A;  2ZVN A;  2L0F A;  3SU8 X;  4MGI E;  3HIZ A;  2MX2 A;  2N7E A;  2LGX A;  2KDI A;  3PHW B;  4ICV A;  4P7I A;  5KHO A;  2FCS A;  3NY5 A;  1WR6 E;  1WF9 A;  1OEY J;  4B9K A;  4GIV A;  2KWC A;  4GXB A;  1Z5S B;  2DEN B;  1YIW A;  3WAP A;  4G11 A;  2KQ7 A;  5AZG A;  4FJY A;  2IY1 B;  5J17 A;  2KNB A;  3UGB B;  5DPW A;  2K6Q A;  2KJR A;  2Z0E B;  4KIK B;  4YL8 A;  3W1S C;  4NJ6 A;  4LDT B;  3ZNH B;  2R2O A;  3KVF B;  4HPL B;  4ZDV A;  3IBE A;  4CO7 A;  3MJW A;  5CHF A;  3T9L A;  2L0T A;  1WH3 A;  1WX7 A;  2NBV B;  5TR5 A;  2GBN A;  1E5W A;  2KLG A;  5DCN A;  2JUO A;  1OTR B;  5JH5 C;  3ZDT A;  2WX1 A;  3PSE B;  3H1U A; 
#chains in the Genus database with same CATH topology
 3WAO A;  2MBH A;  3GS2 A;  1K52 A;  1ZW7 A;  3N32 A;  3QCA A;  1OFF A;  3P4R B;  5L95 C;  2K8B A;  3K9O B;  5GXG B;  5HG2 A;  4WIP A;  2L05 A;  2D2Q A;  2PPH A;  1N5X A;  4LNF A;  5D2M B;  4HK2 A;  1WGG A;  3VTV A;  5EE9 A;  2BT6 A;  1QZE A;  2PW9 A;  4LLG M;  3PHX B;  4NQL B;  4HPP A;  4WQO B;  1AAR A;  4DBG A;  1V5O A;  3CIR B;  3O65 B;  3U4E G;  4M0W A;  2BF8 B;  4NNJ B;  3V61 A;  1DYQ A;  2CKH B;  2GB1 A;  3ONS A;  4G0N B;  4ZYS A;  4L1B A;  2WNM A;  1IGC A;  4DXF A;  4HCN B;  1WXM A;  3R66 C;  3GOE A;  1X1M A;  3IFW B;  2R2Q A;  2JPH A;  2KTR A;  3IT6 B;  1KLU D;  2N0S B;  1NDD A;  1PGB A;  2ZPY A;  4N6E B;  5E6P A;  3SHQ A;  2RPQ A;  1WXA A;  4ZYN A;  2MCN B;  3TCA A;  3Q3M C;  4IWO A;  1FNV A;  4KIK A;  2N9X A;  3DHG C;  4FHK A;  1XLP A;  1PYW D;  3Q2A C;  2L1A A;  2BKR B;  2RR9 A;  3AUL A;  5FR6 A;  5IA7 A;  2JWZ A;  3NHE B;  2QEJ C;  3APC A;  4WWO A;  2XN9 C;  4WJQ A;  4W9C A;  4KZC A;  4AS1 A;  5CTR C;  3PPA A;  5DPT A;  1JCK B;  3AE1 B;  3NS8 A;  3HVZ A;  3H7S A;  4US8 A;  1D5M C;  4EZK A;  3TJP A;  1F2R C;  1P7F A;  2EEL A;  2WDV B;  1JRP A;  3R2I A;  1WXV A;  2JX5 A;  3M63 B;  4OZA A;  1ZXH A;  3RN9 C;  1ET6 A;  3V6E B;  1Q5W B;  3PO0 A;  2JRI B;  5EDS A;  3L54 A;  3ZNZ B;  2K39 A;  2BPS A;  2QSD A;  2WHI A;  5JHB A;  2C5L C;  4BAX A;  1XT9 B;  1UGJ A;  4H2A A;  3B9J A;  2X8X X;  1OGW A;  3RNC C;  1FXA A;  4PS7 A;  3DVG Y;  1F1H A;  3DHH C;  5CHW A;  3ZXR A;  1E10 A;  2KN5 A;  4N9F 4;  1Z2M A;  2RDG A;  3OLM D;  2XNA C;  2KT7 A;  2AWT A;  1B1Z A;  4DWF A;  2AX5 A;  2EMT A;  4PS3 A;  1SIF A;  1V6E A;  4AP4 C;  4S17 A;  3DBL B;  1ZUD 2;  4K7W A;  1H4R A;  4YSZ B;  1SJE D;  1B9R A;  2OED A;  3BK1 A;  1VZ6 A;  1UBI A;  3ECI A;  2KLC A;  3R7R A;  4CHK A;  1ISN A;  1T6B X;  2M8S A;  4MH8 A;  5BO4 B;  3EGR A;  3RNA C;  5C23 A;  4LNO A;  4KGT A;  2BWF A;  2PEA A;  3VH4 B;  2BB5 A;  2DYM A;  4PS8 A;  4HXD A;  4KVG B;  1MHH E;  4NAW A;  1L2N A;  2MP2 B;  1LM8 B;  2MQJ A;  3VR9 B;  2UYZ B;  2K1F A;  4NJ7 A;  3ZRF A;  1T5X D;  1R4M I;  4M0W B;  3Q8B A;  3JVZ X;  4UDU C;  3UQB A;  3DBH B;  1E90 A;  3ZKJ C;  2MBQ A;  4KKI A;  3P4S B;  4DDG D;  2Z0D B;  3AE8 B;  3GP7 A;  4NJC A;  3R8B A;  2LZ6 A;  4XX5 A;  3NOB A;  1V81 A;  1VR9 A;  1PGA A;  1ENF A;  4JPS A;  4G50 A;  3PZ7 A;  2KC2 A;  2WGS A;  2FCM A;  1R4N I;  3HK0 A;  2N9E B;  3NRZ A;  2MLB A;  1A5R A;  4HRO A;  1NYQ A;  2MHJ A;  3DHI C;  1FIQ A;  2BQQ A;  4P16 A;  3H9D A;  3HUI A;  1R4M B;  2J0M A;  4OZB A;  5JZE B;  2MRP A;  1IGD A;  3PGE A;  1SGH A;  1L7Y A;  4LNN A;  2K25 A;  2ZW1 A;  3IAS 1;  3S2A A;  4DHJ B;  1SE4 A;  2HJ1 A;  3BYT B;  3ZGZ A;  4KX6 B;  2LAS A;  2VZK D;  1JWS D;  1WX8 A;  3GE8 C;  2JYT A;  2I1J A;  3Q8F A;  1RWS A;  5LLI A;  2C7N B;  1DOX A;  3TSS A;  2K0P A;  3ZJT A;  1L6U A;  3AMZ A;  2KK8 A;  1C77 A;  2I1K A;  1PGX A;  1L0V B;  4KSK C;  2VRR B;  3ML9 A;  2BYT A;  3AE2 B;  4RMA A;  1WE7 A;  1HQR D;  2ONQ A;  1P1A A;  3L17 A;  3MC9 A;  2FBW B;  2LEK A;  3QAQ A;  1WYW B;  2K3U A;  2AL6 A;  3APD A;  4F1S A;  4HDO A;  1Q1O A;  2BVC A;  2NVU I;  3W9C B;  2OJR A;  1J19 A;  4WWP A;  2JQR B;  4MJS A;  3KWL A;  2MA9 B;  4W9F A;  4G3X B;  4N59 A;  1K8R B;  4EUT A;  3WAN A;  3TEY A;  4II2 B;  4M00 A;  4HLE A;  1C3T A;  1IUE A;  2L00 B;  4IM2 A;  1C1Y B;  2V9H A;  4W9K A;  1P3Q U;  3QC8 B;  2FCN A;  1E7U A;  1EWY C;  3R3M A;  2YLM A;  2MJE A;  1J7C A;  3B1L X;  4GDL B;  1UH6 A;  3AE3 B;  5BMH A;  3RNB C;  1ZGU B;  4CYE A;  4ANU A;  3W1Y A;  3GZN B;  3M62 B;  4KSL C;  3EC8 A;  1T3Q A;  2EKI A;  3RUI B;  2DZI A;  3H8H A;  1TBE A;  4B95 A;  4NZL B;  3CWI A;  1KLV A;  2HTH A;  1QT9 A;  2KWV B;  1LFD A;  3HRD D;  4DDI D;  2UWQ A;  1J0G A;  1EO6 A;  1OEY A;  5G55 A;  1MG8 A;  1QOB A;  3AEF B;  2WXN A;  1HZ5 A;  4IKG A;  1OQY A;  1N61 A;  3L0W B;  1XLQ A;  3I3T B;  3PT2 B;  3AED B;  4I6P A;  4W9E A;  2IO3 B;  1Q0W B;  2N7E A;  3NY5 A;  2ICI A;  2VH1 A;  1WR6 E;  1SXT A;  1WF9 A;  1DOY A;  3AE9 B;  1YIW A;  4MAC A;  4G11 A;  3BWU D;  2IY1 B;  4C4V B;  2KJR A;  4EE2 A;  4YSY B;  1MVK A;  4LDT B;  4K3C A;  1TJE A;  2WXL A;  3KVF B;  1ESF A;  3T9L A;  1PDX A;  2D3A A;  2L0T A;  4XWT A;  5FR3 A;  5TR5 A;  1E5W A;  4XE0 A;  1OTR B;  5JH5 C;  3Q8C A;  3H1U A;  5DPR A;  1FMA D;  3T3N A;  2XK5 B;  4OVZ A;  4IOI E;  3AU4 A;  4ARI A;  2HJ8 A;  4XC2 A;  3CMM B;  4HJG E;  1YN4 A;  3PRE A;  3MFG A;  4TQ1 A;  3QIJ A;  2LGS A;  1KH0 A;  1XLO A;  2LUE A;  4WJP A;  4YXD B;  4FN2 A;  3ZYY X;  3PVL A;  1FM0 D;  2QJL A;  3NVW A;  5CHV C;  1P9D U;  3RD2 A;  2KQ4 X;  2WXQ A;  1GC7 A;  1BML C;  1EM7 A;  4XDD A;  2DZJ A;  3DVN U;  4ANX A;  1LQB A;  2NCN A;  3ZW3 A;  5D6J B;  3PZ8 A;  3TMP B;  2IJ0 A;  4ZRJ A;  2RD0 A;  2JSV X;  2N4F A;  5T8I A;  2OJW A;  3GB1 A;  2LHD A;  4HCP B;  1XO3 A;  3KYC D;  3LJ3 A;  1MJD A;  5D3I B;  1YNT E;  1PQS A;  5G2N A;  3D32 A;  1JW9 D;  1H8C A;  1L0Y B;  3OAW A;  4C7Z A;  1F2R I;  3GE3 C;  4EEW A;  4ARC A;  2WXI A;  2FAZ A;  3NZ3 A;  4IW0 A;  1OQQ A;  1FNU A;  1V1O A;  2R61 A;  4W9L A;  2WLB A;  4PYZ A;  1IYF A;  3U2S C;  3I63 C;  4E3C A;  4A8X C;  4JWS C;  2JWU A;  3RNG C;  4I6L B;  2AQ1 B;  5IOI A;  2DAF A;  2K8H A;  3CF6 E;  1TKG A;  4JIO U;  2KFJ A;  5E6J A;  3AM9 A;  3NZU A;  1AYF A;  2DBY A;  4YTN B;  1E8Y A;  1EUV B;  3FIL A;  4ZRQ A;  2GI9 A;  2PKO A;  3U52 E;  2Y3A A;  1ZDX A;  1GNU A;  4TKN A;  2IGD A;  5G5G A;  4A6Q A;  3IAM 1;  1WGR A;  3CSF A;  5BYR A;  1N63 A;  1T0R C;  4NAM A;  3A9J B;  3P4P B;  4BOZ B;  2M4N A;  3DPD A;  3B2F A;  3X0W A;  1I4X A;  3VHT C;  4KKJ A;  3ZLZ A;  3VUY A;  2NR2 A;  1TKE A;  2BB6 A;  2J4X A;  3BYY B;  2JF5 A;  3CST A;  3GZN I;  1K53 A;  2BS4 B;  3J9C A;  4XYC A;  2WXJ A;  3AE5 B;  1FO4 A;  2LGD A;  3P63 A;  1SF0 A;  3OJ4 B;  4PYU A;  2INC C;  2IO0 B;  1WSP A;  4TQ0 A;  5IKC M;  1YN3 A;  1GPX A;  2IND C;  3PRM B;  1BUI C;  1I4G A;  3Q3O C;  2WXG A;  3PTF C;  2KWU B;  1CJE A;  1UWM A;  3DBR I;  4REZ A;  1JAL A;  1Y56 A;  3JW0 X;  2BW2 A;  3ZQ4 A;  1HZ6 A;  2WU5 B;  2PE6 B;  2KMM A;  2JYE A;  2KWD A;  2H89 B;  4TSS A;  5D7G A;  5BMI A;  1XCQ L;  4IG7 B;  2CR5 A;  3HVD A;  2GBJ A;  3DBL I;  3IVF A;  3R7Q A;  3AV8 A;  2KFK A;  1V49 A;  2MBE A;  3JSV A;  2L3Z A;  2NBW B;  3ZUN A;  4AJW A;  2WXO A;  4XWW A;  1NEK B;  3Q3N C;  3UQA A;  1L4D B;  2NBU A;  1BXT A;  2WXR A;  4BKT A;  1TY0 A;  1E6E B;  3WIM A;  1STE A;  2KD0 A;  3Q6B A;  2JXX A;  3IHP C;  2JVC A;  2O2V A;  4BOS C;  3KYD D;  2IY0 B;  1WE6 A;  2L8J A;  3A4S C;  3MC8 A;  4ACF A;  4ASW C;  3VH3 B;  2KJ6 A;  3M95 A;  2REX A;  3P42 A;  2YEP F;  1P98 A;  3X23 A;  1XEE A;  1Y8R C;  3ZNG C;  3OWE B;  3AEC B;  3EA6 A;  4YTP B;  2WS3 B;  2KDM A;  4M01 A;  2AQ2 B;  1RRB A;  1JQ4 A;  2AYO B;  2WQY B;  2GBK A;  3AE6 B;  3KUZ A;  4IM3 A;  3DQV A;  2W55 A;  2ON8 A;  4K7S A;  2N1V A;  1TS4 A;  4LK0 M;  2BS2 B;  4FBJ B;  1JWA D;  3UF8 A;  5JXV A;  2MEK A;  4FA6 A;  3C8Y A;  2IGH A;  2N9K A;  2KTR B;  1GAQ B;  2GMI C;  3V05 A;  3MP9 A;  4FJV B;  3FC4 A;  2MBO A;  1D5X C;  2WU2 B;  5AZF A;  2DZM A;  3RCZ A;  4DXA B;  1VDV A;  4A3O A;  5LXI B;  2G1E A;  5D94 A;  3EHV A;  2EKE C;  5C1Z A;  2D3G A;  2B3A A;  1FPY A;  1WFY A;  4C56 C;  2KN4 A;  1CZP A;  2CJN A;  5C3J B;  2IPK D;  4PK1 A;  3AEE B;  2ZPN A;  4WJN A;  1VZ7 A;  2L76 A;  2LJI A;  2D11 A;  3WCQ A;  4B6W A;  1F52 A;  4ZRP A;  3QJZ A;  4E71 A;  1V97 A;  2J42 A;  4WWM A;  3O13 A;  2MSE D;  3MHZ A;  3VUX A;  1KRH A;  2D07 B;  4K81 A;  3A1Q A;  4BKS A;  2ZW0 A;  3ABV B;  4ZHO A;  2KAN A;  1FRR A;  3WA0 A;  2DNF A;  1TY2 A;  4NAW B;  4LNK A;  3ML8 A;  3LYY A;  3L08 A;  3OG5 A;  4FJZ A;  1E8W A;  4A20 A;  1K50 A;  1IBX B;  4HEA 1;  1FD6 A;  5EE3 A;  3SR6 A;  4AQ7 A;  3VUW A;  1C4C A;  2LWP A;  1C79 A;  4GSW A;  3RT3 B;  2KDE B;  4J3O D;  2KFK B;  5DPS A;  1ZPS A;  3UIN B;  2WDR B;  1WI0 A;  1J8C A;  3VAW A;  2Y5P A;  3DBR B;  2L32 A;  4JX1 C;  4MGI E;  2LGX A;  3KQ4 A;  1JWM D;  4GIV A;  2KWC A;  4GXB A;  1Z5S B;  2PLP A;  1CK1 A;  3UGB B;  5DPW A;  2K6Q A;  3ZJV A;  4NJ6 A;  3IBE A;  3NVV A;  4CO7 A;  4DQO C;  1WX7 A;  5DCN A;  4M02 A;  3ZDT A;  3PSE B;  4ICU A;  2INN E;  1U4A A;  2D3C A;  2MBB B;  4GDK A;  4HDQ A;  1YMH E;  4JGH B;  2V3S A;  2RDH A;  3ZTD A;  1V9J A;  1E0Z A;  2KAC A;  5FK9 C;  1WMH A;  2QDF A;  4LTU A;  3T3O A;  4DHJ D;  2BGF A;  2BS3 B;  2HD5 B;  4RM9 A;  2HDE A;  4KGS A;  3QQ8 B;  3AXC A;  1TIF A;  1SE3 A;  2GBM A;  4YSX B;  2O6V B;  5L83 A;  1D5Z C;  2WYQ A;  3PRP B;  1MG4 A;  1XCT L;  3V62 A;  4BFR A;  4USA A;  4RGM A;  1FFV A;  4RGO S;  3Q8A A;  3Q69 A;  4WAF A;  1LO5 D;  2ASQ A;  4WUR A;  1ROE A;  3NVY A;  1QQR A;  1WJ6 A;  1QLB B;  3VQI A;  2QHO A;  2Y5B B;  4JLC A;  1WZ3 A;  3ALB A;  3TEZ A;  4II3 B;  4ITK A;  4W9J A;  3TL5 A;  4GOC A;  2GBR A;  2YVC A;  4KDI C;  2V0G A;  5IO9 A;  3KWV A;  2C9W B;  2MH7 A;  2DYB A;  2PVO D;  3B0A A;  4HKZ E;  2QIL A;  2BBC A;  3A33 B;  4BVU C;  4AJY B;  2O2V B;  1IP9 A;  1UD7 A;  2MJ3 A;  3KUC B;  2M1M A;  4GDL A;  3HM6 X;  4OW0 A;  4GDK B;  4JQW C;  2LVP A;  2K6D B;  1JWB D;  4LDT D;  4GLS C;  3VRB B;  1KOT A;  3U7Z A;  1JML A;  2ZJD A;  4MGK E;  3ZO5 B;  2NTT A;  1F77 A;  1WWT A;  1DOI A;  3NUH B;  1SB3 C;  1ZDV A;  2C7M B;  4HVB A;  3WAL A;  4MEL A;  3U8Z A;  1YX6 B;  2DLB A;  3MTN B;  2YEP B;  5IN7 A;  4ZRK A;  4MGZ E;  1WY8 A;  1GUA B;  3BK2 A;  5EE1 A;  1JWU D;  1TKY A;  4PT5 A;  2KKC A;  2NPT A;  4X57 B;  1MHX A;  1SE9 A;  1YQ4 B;  1BT0 A;  1QOF A;  4MJS B;  4WWN A;  2LGI A;  4RNA A;  4WH4 A;  2BYE A;  2KX3 A;  1WX9 A;  2UU7 A;  1TTN A;  3L10 B;  3I5J C;  1C76 A;  1VCB A;  4RF1 A;  3AB5 A;  1KM7 A;  4NPN A;  1N6Z A;  3ZVV A;  1WGH A;  3RI7 C;  2DX5 B;  3EEC A;  1M94 A;  1TT5 B;  1P0R A;  3U30 A;  2W3S A;  2LRW A;  1E7P B;  4US9 A;  3UIO B;  1G6J A;  4A90 A;  3DWM A;  1XF5 L;  1EWC A;  4L2Y A;  4AUQ C;  1TS3 A;  4MSM B;  2W54 A;  1FXT B;  1TZ1 A;  4EZJ A;  1EU3 A;  4JL9 A;  4FXC A;  1AW7 A;  2RMM A;  4N58 A;  1HEZ E;  3E9S A;  1QOA A;  4ZOH C;  4M8N A;  4A55 A;  4R3D A;  3A1Q B;  2AL3 A;  3DDC B;  3V3X A;  3W1S A;  2KVZ A;  1KLG D;  2QCZ A;  1GG3 A;  2G4D B;  2MWS B;  1N5W A;  3EFU A;  2Z59 B;  3TIX A;  2KHW B;  1ACC A;  4RFB A;  3VTW A;  3L4P A;  3SD5 A;  1YOV B;  1I4R A;  3ZRC A;  1GC6 A;  3AH7 A;  1JRO A;  2AEH A;  2A5U A;  2KMA A;  4FAD A;  4W9I A;  3RNE C;  2LMC A;  2WDQ B;  3IXS A;  1GB4 A;  4RH6 A;  3QA8 A;  1ET9 A;  1WXQ A;  3H6N A;  4BBN C;  1LXD A;  2K9X A;  3KH0 A;  1R4N B;  2FCQ A;  3W5U B;  4OVV A;  4DHZ E;  3DCG A;  1P7E A;  2LRU A;  1RFA A;  2WXH A;  3Q8E A;  1UEL A;  2LGY A;  2JY6 A;  2M0X A;  1GB1 A;  2EMS A;  4XGA B;  4KDL B;  3DVG X;  1GJZ A;  1ZOY B;  2ZEQ A;  2CHZ A;  4RM8 A;  4NY0 A;  4GGQ A;  4GU2 A;  2XK5 A;  4FUL A;  2JZP A;  4HWI B;  1VZ8 A;  1FCL A;  3BY4 B;  3H7P A;  1ZXI A;  5IAA C;  3W2D A;  2TSS A;  4K3B A;  1YJ1 A;  2DZK A;  2E3T A;  5AUK A;  2LVQ A;  3VVW B;  3DVN V;  3Q3J A;  4W9D A;  1NBF C;  3AEB B;  5MPO A;  1EU4 A;  2W82 A;  4C7Y A;  3B2G A;  4J6I A;  1L6V A;  4P6V F;  5AUI A;  2J7Q B;  2KDF B;  2V4I B;  2W3R A;  2OHF A;  1V1P B;  1UF0 A;  4URK A;  3FAH A;  3AEG B;  1F9J A;  4QAY A;  2PJH A;  2Q5W D;  3ZNI D;  5CX3 A;  2J52 A;  4F7Z A;  4IWQ A;  1UBQ A;  2V3P A;  1KFY B;  3N9Y C;  1OQR A;  2CJO A;  3ZJU A;  2V4L A;  3MJ5 A;  2DWQ A;  3EUB 2;  3TEX A;  3R2T A;  1WM3 A;  2LHE A;  4MSQ B;  1NYR A;  2N9L A;  1VRA B;  3U7D A;  3WAM A;  1WRD B;  2BWE S;  4C80 A;  2LJ5 A;  1J7B A;  3TBL D;  3C0R B;  4LJP B;  3LB8 C;  2KYW A;  3N1X C;  2DHZ A;  3QWZ B;  2PE9 A;  3UIP B;  2A4Z A;  4MT5 A;  3W5V B;  1WGK A;  3N1Y C;  2W9N A;  5HHD G;  1HTO A;  4E74 A;  1AN8 A;  2V1Y A;  2K5P A;  2I38 A;  4IM0 A;  2MP2 A;  2LI5 A;  2LXC A;  3FIL B;  1UZX B;  1ZE3 D;  3QX1 A;  2KXJ A;  4KGR A;  2ZCC A;  2ZNV C;  4TUU A;  3M3J A;  1NEN B;  1JRU A;  1DGJ A;  2QIE B;  2N7D A;  3TUO A;  1R7S A;  3A9J A;  1RLF A;  1WJ4 A;  4MM3 B;  2ZVN A;  2L0F A;  4RCO A;  3SU8 X;  3PHW B;  2FCS A;  2WXM A;  1D6E C;  3WAP A;  5J17 A;  4FJY A;  2KNB A;  4KIK B;  4YL8 A;  1QKZ A;  3W1S C;  2R2O A;  4HPL B;  1HTQ A;  5CHF A;  1WH3 A;  3RFZ B;  2NBV B;  2GBN A;  2JUO A;  2KAJ A;  5TSS A;  2WX1 A;  2LUM A;  3V60 A;  1WIA A;  2GOW A;  1V5T A;  3MC0 B;  2RDB C;  1NI3 A;  2MJD A;  5J18 A;  3ENE A;  1IPG A;  2WXP A;  5EE0 A;  1A70 A;  1SEB D;  3IT4 B;  3VTU A;  4DK5 A;  3IG3 A;  3KUD B;  5AEK B;  2K8C A;  1RYJ A;  2FE8 A;  2E6X A;  5H92 C;  3HHM A;  4EOY A;  2IGG A;  4D2K A;  1T0Y A;  4K7U A;  3AE4 B;  2LXA A;  2QC8 A;  2BKF A;  4LNI A;  4IUM B;  2FIF A;  4B0M A;  1V1P A;  1SIJ A;  4BKG A;  2JT4 B;  4HKQ A;  1T0Q C;  3I9V 1;  4B0E A;  4OVU A;  2KO3 A;  3PRZ A;  2PVG C;  3JSV B;  3RZF A;  2CHX A;  1NVI D;  5LNK 1;  2FUG 1;  3ETR A;  3L16 A;  4BZA A;  4K1R B;  1FFU A;  3PZD A;  1RAX A;  2M56 B;  2N9P C;  2J0J A;  2D10 A;  3P1M A;  4JWU C;  2ZVO A;  1L5P A;  4EZL A;  2NS5 A;  3PS6 A;  4C4V A;  4C00 A;  1FXI A;  2WXF A;  4WJO A;  5AZH A;  1E7V A;  2IDY A;  5E6O A;  2GLS A;  3AI5 A;  3APF A;  2CU3 A;  3B08 A;  1KJT A;  3V6C B;  3AEA B;  5G5H A;  4RGT A;  4RGN A;  3NG0 A;  5LXH A;  3H7P B;  4MGY E;  2BYV E;  4TV3 A;  2Y5C A;  4FLH A;  2ZZP B;  2J53 A;  1XXG A;  3OJ3 A;  1D4B A;  2DAJ A;  2N7J A;  3BVG A;  5BMG A;  3BZD B;  4DXG A;  1TS2 A;  2IO2 B;  4GMV A;  4JE3 B;  4YWG G;  4P1C C;  2RGF A;  2FUH B;  2ZCB A;  2NTS A;  1HE8 A;  5HKH A;  3EFC A;  1EF5 A;  3NJT A;  4HJK A;  1S1Q B;  4O1N A;  3ZIM A;  2I2Y A;  2KTF A;  4MH0 E;  2AQ3 B;  2M17 A;  2JZ3 B;  3ZDM C;  4MEM A;  2KDB A;  3RYT A;  1YX5 B;  3P2B A;  1VJK A;  4XDC A;  2CU1 A;  2WXK A;  2L7R A;  2MW5 A;  2G3Q B;  3KLS X;  1K51 A;  1WGY A;  3N1Z C;  4KZ0 A;  1XD3 B;  4IWP A;  3K9P B;  2KJH B;  3P4Q B;  1WXS A;  4YT0 B;  4F8C B;  2XBB C;  3VXW A;  4A9A A;  2G4S A;  2QMT A;  1YJJ A;  2VH2 A;  2LD9 A;  5BYQ A;  5HI1 A;  3NS1 A;  4LCD E;  3ZTC A;  4IC7 B;  2PMV A;  2WDT B;  4XZ4 A;  1LGR A;  3Q14 C;  1TYG B;  1V86 A;  3ZXV A;  4I6N B;  4MDK E;  2DYO A;  2SAK A;  4BBN F;  2KMC A;  1YJI A;  4ZHP A;  2SEB D;  2J0K A;  2CS4 A;  1M4V A;  1WYG A;  2ACZ B;  2KX0 A;  3JYU A;  1F0Z A;  3BII D;  2M19 A;  3DBH I;  1TZO A;  1NI2 A;  1SE2 A;  1I4H A;  1C9F A;  2IBI B;  4HPM B;  2CHW A;  3N30 A;  1FEH A;  1WM2 A;  3HM3 A;  2VZK B;  1WZ0 A;  2PIA A;  5D3D A;  4S0R A;  2OOB B;  2IZV B;  1YQ3 B;  5KHQ A;  1UUP A;  2INP E;  3VDZ A;  2K22 A;  1RM6 C;  4OZC A;  3VFK A;  1XQQ A;  2NMQ A;  1IBX A;  2N1W A;  4M8M A;  2O6V A;  1E9M A;  4W9G A;  1N62 A;  1UNS A;  1MPE A;  4LJO B;  1HA5 A;  2C60 A;  2C7H A;  3A9K A;  2L83 A;  3FKY A;  2M0A A;  1EF1 A;  2O6V D;  2KC1 A;  1HXY D;  4MM3 A;  1SBB B;  3QHT A;  1I35 A;  1PFD A;  3DBS A;  4AOF A;  4CQN A;  2JZZ A;  3BIN A;  1WJN A;  1UGM A;  1KF6 B;  3C19 A;  4WQM A;  2BYF A;  1ZP0 B;  3I57 A;  2JRH A;  4ZRI A;  3AU5 A;  1YQB A;  4YTM B;  4ANW A;  4W9H A;  1I42 A;  2LVO A;  4EKU A;  2XEW A;  3URY A;  3RUL A;  1KTK A;  3BVZ A;  5GMV A;  1FNW A;  3PLV A;  5BYS A;  5H8Y E;  1C4P A;  1SJH D;  1T0S C;  2BTE A;  1L4Z B;  1V2Y A;  1TS5 A;  4FHJ A;  1C78 A;  1MFW A;  4BKS D;  1UWX A;  5HFY A;  4IDI A;  3RPF C;  3E56 A;  1FCC C;  1FRD A;  2WWZ A;  1E8X A;  1QIL A;  2X38 A;  3DOW A;  4TMA B;  2KQS A;  4DHZ B;  1TGZ B;  2JXT A;  5IP4 D;  1E8Z A;  3PLU A;  1WR1 A;  4ANV A;  2Z8L A;  3T8M A;  3VR8 B;  5I4D A;  2HTM E;  1I4P A;  1YD8 U;  5E6N A;  1N60 A;  4NQK E;  2KVR A;  3AE7 B;  4L23 A;  3BVM A;  3KW5 B;  4P1B C;  2G9H D;  3A9K B;  5J2R A;  4HRS A;  2D3B A;  3UI3 A;  4GN1 A;  4OHJ A;  3QAR A;  2G45 B;  1ZKH A;  3MHS D;  2WX0 A;  1AWD A;  3A4R A;  3AN1 A;  3VRA B;  3LDZ E;  1C4A A;  5JHA A;  1V8C A;  1RFK A;  2D5G A;  2HE7 A;  1D3Z A;  3NZS A;  2ZNV B;  3QK0 A;  1WRI A;  4A3P A;  2B76 B;  1WGD A;  1WJU A;  2L52 A;  2IYD B;  1WMH B;  3L13 A;  2FNJ B;  4EFO A;  4KV2 A;  4AWJ A;  3RMK C;  2KOX A;  3NVZ A;  2KZR A;  1V80 A;  1VD2 A;  1YN5 A;  1MI0 A;  3SFE B;  4RF0 A;  1QOG A;  2IO1 B;  3DWG C;  4Q2J A;  1CQV A;  3SEB A;  1J7A A;  3Q3F A;  3SFD B;  3TEW A;  2RSU A;  3N3K B;  4WAA A;  3RNF C;  2GRI A;  1S3S G;  3N20 C;  2FID A;  5C2T B;  1CMX B;  3SDL C;  3PV1 A;  4GB9 A;  1QF6 A;  1PUT A;  1XLN A;  2NPT B;  2V3N A;  3RZW C;  2RPV A;  1I4Q A;  1Q10 A;  2JU6 X;  3HIZ A;  2MX2 A;  2WP9 B;  2KDI A;  4ICV A;  4P7I A;  5KHO A;  4B9K A;  1OEY J;  3LXF A;  2DEN B;  1I7H A;  5AZG A;  2KQ7 A;  5FKA C;  2LFI A;  2PTL A;  2Z0E B;  1L0X B;  2H88 B;  3ZNH B;  4ZDV A;  3MJW A;  1GOZ A;  1VLB A;  2KLG A;  1SSN A; 
#chains in the Genus database with same CATH homology
 1WIA A;  3WAO A;  2GOW A;  2MBH A;  5DPR A;  1ZW7 A;  2XK5 B;  1V5T A;  1U4A A;  3N32 A;  3AU4 A;  3QCA A;  2HJ8 A;  4XC2 A;  3CMM B;  5L95 C;  2MBB B;  2K8B A;  3K9O B;  4GDK A;  4HDQ A;  4JGH B;  2V3S A;  2L05 A;  3PRE A;  2D2Q A;  4TQ1 A;  3ZTD A;  5J18 A;  1V9J A;  3ENE A;  2PPH A;  3QIJ A;  1IPG A;  5D2M B;  4HK2 A;  1WMH A;  1WGG A;  2LUE A;  4WJP A;  3VTU A;  4FN2 A;  4DK5 A;  3IG3 A;  3KUD B;  3VTV A;  3PVL A;  5AEK B;  2K8C A;  5CHV C;  1P9D U;  3RD2 A;  1QZE A;  3PHX B;  4NQL B;  4DHJ D;  2BGF A;  4EOY A;  3HHM A;  1GC7 A;  1T0Y A;  2HD5 B;  4RM9 A;  4K7U A;  4WQO B;  1AAR A;  3QQ8 B;  2LXA A;  1V5O A;  3AXC A;  3O65 B;  4DBG A;  2DZJ A;  3DVN U;  2BKF A;  2BF8 B;  2GBM A;  4ANX A;  1LQB A;  2O6V B;  4IUM B;  5L83 A;  4NNJ B;  3V61 A;  2FIF A;  2NCN A;  2WYQ A;  3PRP B;  3ZW3 A;  5D6J B;  2CKH B;  3ONS A;  4G0N B;  3TMP B;  3V62 A;  4BKG A;  2JT4 B;  4BFR A;  4ZRJ A;  2RD0 A;  4HCN B;  2N4F A;  1WXM A;  3R66 C;  3GOE A;  1X1M A;  4OVU A;  2KO3 A;  3IFW B;  3PRZ A;  3JSV B;  3RZF A;  2R2Q A;  4HCP B;  2JPH A;  2KTR A;  2ASQ A;  2CHX A;  3KYC D;  1WJ6 A;  3LJ3 A;  1NDD A;  3VQI A;  3L16 A;  2QHO A;  2Y5B B;  4JLC A;  1WZ3 A;  3ALB A;  2ZPY A;  4II3 B;  4K1R B;  1PQS A;  5G2N A;  3D32 A;  4W9J A;  3TL5 A;  3PZD A;  1RAX A;  4GOC A;  2GBR A;  5E6P A;  2N9P C;  2J0J A;  3SHQ A;  2RPQ A;  1WXA A;  1H8C A;  2D10 A;  2YVC A;  3OAW A;  4ZYN A;  2ZVO A;  4KDI C;  4EEW A;  4EZL A;  2MCN B;  2NS5 A;  3TCA A;  4IWO A;  3PS6 A;  4KIK A;  2N9X A;  2C9W B;  4WJO A;  5AZH A;  2FAZ A;  1E7V A;  4FHK A;  2DYB A;  5E6O A;  3B0A A;  3AI5 A;  3APF A;  3B08 A;  1KJT A;  3A33 B;  3V6C B;  2BKR B;  4BVU C;  2RR9 A;  4IW0 A;  2O2V B;  4AJY B;  5LXH A;  3H7P B;  4MGY E;  3AUL A;  5FR6 A;  2BYV E;  4TV3 A;  5IA7 A;  2JWZ A;  3NHE B;  2ZZP B;  4FLH A;  4PYZ A;  3APC A;  4W9L A;  4WWO A;  1IP9 A;  4WJQ A;  1IYF A;  4W9C A;  1UD7 A;  4KZC A;  3OJ3 A;  3KUC B;  5CTR C;  2M1M A;  2DAJ A;  4E3C A;  4GDL A;  3PPA A;  3HM6 X;  5DPT A;  4GDK B;  4GMV A;  2IO2 B;  3NS8 A;  4I6L B;  3H7S A;  2RGF A;  2LVP A;  4JQW C;  2K6D B;  2DAF A;  4EZK A;  2FUH B;  4LDT D;  3TJP A;  2K8H A;  3CF6 E;  4JIO U;  1KOT A;  2ZCB A;  2KFJ A;  2ZJD A;  4MGK E;  3ZO5 B;  1HE8 A;  5HKH A;  1EF5 A;  4HJK A;  1S1Q B;  3NZU A;  3ZIM A;  2KTF A;  4MH0 E;  1WXV A;  2M17 A;  2JZ3 B;  3ZDM C;  3M63 B;  2C7M B;  4MEM A;  2KDB A;  3RYT A;  1E8Y A;  3V6E B;  1YX5 B;  4HVB A;  3WAL A;  3P2B A;  4MEL A;  1EUV B;  1Q5W B;  2JRI B;  3U8Z A;  5EDS A;  2CU1 A;  4ICU A;  1YX6 B;  3L54 A;  2L7R A;  2MW5 A;  3ZNZ B;  2K39 A;  3MTN B;  2G3Q B;  4ZRK A;  4MGZ E;  2BPS A;  1GNU A;  1WY8 A;  1WGY A;  4KZ0 A;  4TKN A;  1XD3 B;  5JHB A;  1GUA B;  3K9P B;  4IWP A;  2KJH B;  1WXS A;  2C5L C;  4F8C B;  1XT9 B;  2XBB C;  3VXW A;  1WGR A;  2KKC A;  2NPT A;  3CSF A;  1OGW A;  4X57 B;  2G4S A;  2LD9 A;  3A9J B;  1SE9 A;  4BOZ B;  2M4N A;  3DPD A;  1BT0 A;  3DVG Y;  4PS7 A;  3X0W A;  4LCD E;  4MJS B;  4WWN A;  3VHT C;  5CHW A;  3ZTC A;  4IC7 B;  2BYE A;  2KX3 A;  1WX9 A;  2WDT B;  3ZLZ A;  2KN5 A;  4XZ4 A;  3VUY A;  2NR2 A;  1TTN A;  3L10 B;  1Z2M A;  4N9F 4;  1VCB A;  2JF5 A;  3CST A;  3GZN I;  1V86 A;  1KM7 A;  4NPN A;  3ZVV A;  1WGH A;  3OLM D;  2DX5 B;  2AWT A;  3EEC A;  4I6N B;  2DYO A;  4MDK E;  4BBN F;  4DWF A;  1M94 A;  2KMC A;  1P0R A;  2EMT A;  4PS3 A;  3U30 A;  1SIF A;  2J0K A;  2LRW A;  1V6E A;  2CS4 A;  3UIO B;  1G6J A;  4AP4 C;  2LGD A;  3OJ4 B;  4PYU A;  4AUQ C;  2IO0 B;  4TQ0 A;  2KX0 A;  4MSM B;  3JYU A;  4K7W A;  1H4R A;  1FXT B;  3DBH I;  3PRM B;  1TZ1 A;  1NI2 A;  4EZJ A;  1UBI A;  3ECI A;  4JL9 A;  2KLC A;  3PTF C;  2KWU B;  3R7R A;  2IBI B;  4CHK A;  4HPM B;  1ISN A;  2CHW A;  2M8S A;  5BO4 B;  3DBR I;  3JW0 X;  3N30 A;  5C23 A;  4M8N A;  1WM2 A;  2BWF A;  2PEA A;  3HM3 A;  3VH4 B;  3A1Q B;  2PE6 B;  1WZ0 A;  2AL3 A;  3DDC B;  2DYM A;  4PS8 A;  4HXD A;  4KVG B;  3W1S A;  4NAW A;  1GG3 A;  2G4D B;  2MWS B;  2IZV B;  2OOB B;  2MP2 B;  3EFU A;  5KHQ A;  1LM8 B;  1L2N A;  2MQJ A;  2Z59 B;  3TIX A;  2UYZ B;  3VDZ A;  2KHW B;  2K1F A;  3VFK A;  3VTW A;  1XQQ A;  4NJ7 A;  3SD5 A;  3ZRC A;  3ZRF A;  1GC6 A;  2N1W A;  1R4M I;  4M0W B;  2AEH A;  2A5U A;  2KMA A;  4M8M A;  2O6V A;  4FAD A;  5D7G A;  3JVZ X;  4W9I A;  4W9G A;  4IG7 B;  3UQB A;  2CR5 A;  4LJO B;  1E90 A;  2GBJ A;  3ZKJ C;  2MBQ A;  2C60 A;  3DBL I;  3QA8 A;  3IVF A;  2C7H A;  3A9K A;  3R7Q A;  4DDG D;  3H6N A;  4BBN C;  1EF1 A;  1LXD A;  2KFK A;  2Z0D B;  3KH0 A;  2O6V D;  2KC1 A;  1V49 A;  2MBE A;  2FCQ A;  4MM3 A;  4OVV A;  3QHT A;  2LZ6 A;  1I35 A;  3JSV A;  4DHZ E;  2L3Z A;  2NBW B;  3DCG A;  4XX5 A;  3NOB A;  3DBS A;  1V81 A;  3ZUN A;  4AOF A;  4AJW A;  2LRU A;  2JZZ A;  3BIN A;  1RFA A;  1WJN A;  2KC2 A;  1UGM A;  4G50 A;  2BYF A;  2FCM A;  1R4N I;  1UEL A;  2JRH A;  2JY6 A;  2LGY A;  2N9E B;  3HK0 A;  2M0X A;  4ZRI A;  3UQA A;  2EMS A;  3AU5 A;  2MLB A;  1A5R A;  1YQB A;  4KDL B;  3DVG X;  4ANW A;  1GJZ A;  2ZEQ A;  4W9H A;  1I42 A;  2NBU A;  2LVO A;  4EKU A;  3H9D A;  3V60 A;  2CHZ A;  2J0M A;  4RM8 A;  4BKT A;  4NY0 A;  4GGQ A;  4GU2 A;  2XK5 A;  4FUL A;  5JZE B;  2XEW A;  3WIM A;  4HWI B;  2MRP A;  2KD0 A;  3PGE A;  3RUL A;  2JXX A;  3IHP C;  1SGH A;  3BY4 B;  2JVC A;  2O2V A;  1L7Y A;  3H7P A;  5GMV A;  5IAA C;  2K25 A;  4BOS C;  3PLV A;  3KYD D;  2IY0 B;  4DHJ B;  3S2A A;  1WE6 A;  1YJ1 A;  2DZK A;  2L8J A;  3A4S C;  1V2Y A;  4ASW C;  3VH3 B;  4FHJ A;  2KJ6 A;  2LVQ A;  2LAS A;  2REX A;  3DVN V;  3M95 A;  3Q3J A;  4W9D A;  1NBF C;  3VVW B;  1P98 A;  1WX8 A;  3X23 A;  4BKS D;  1Y8R C;  3ZNG C;  2I1J A;  2WWZ A;  1E8X A;  5LLI A;  2C7N B;  4J6I A;  1RRB A;  2AYO B;  2GBK A;  3DOW A;  2J7Q B;  3KUZ A;  4IM3 A;  2KDF B;  3DQV A;  2KQS A;  2KK8 A;  4DHZ B;  4K7S A;  1TGZ B;  1E8Z A;  3PLU A;  1WR1 A;  2I1K A;  2N1V A;  4ANV A;  4URK A;  4KSK C;  3T8M A;  2VRR B;  3ML9 A;  4RMA A;  1F9J A;  1WE7 A;  2PJH A;  1YD8 U;  4FBJ B;  3UF8 A;  3ZNI D;  5CX3 A;  4FA6 A;  1P1A A;  3L17 A;  5E6N A;  4NQK E;  4F7Z A;  3QAQ A;  2KVR A;  4IWQ A;  1UBQ A;  1WYW B;  2KTR B;  2GMI C;  3KW5 B;  4FJV B;  3A9K B;  2AL6 A;  3APD A;  2MBO A;  4F1S A;  5J2R A;  1Q1O A;  4HDO A;  2V4L A;  2NVU I;  5AZF A;  2OJR A;  1J19 A;  2DZM A;  4WWP A;  3RCZ A;  4DXA B;  4GN1 A;  3QAR A;  1WM3 A;  4MJS A;  2G45 B;  2MA9 B;  4A3O A;  4W9F A;  1ZKH A;  4G3X B;  1K8R B;  4MSQ B;  3WAN A;  4EUT A;  5LXI B;  3MHS D;  4II2 B;  3EHV A;  5D94 A;  3U7D A;  1WRD B;  2WX0 A;  2BWE S;  3WAM A;  4HLE A;  2EKE C;  1C3T A;  5C1Z A;  3A4R A;  2D3G A;  2LJ5 A;  2B3A A;  1WFY A;  3TBL D;  2L00 B;  3C0R B;  3LDZ E;  4IM2 A;  1C1Y B;  4W9K A;  1P3Q U;  4LJP B;  5JHA A;  3QC8 B;  2HE7 A;  2FCN A;  1D3Z A;  3NZS A;  2ZNV B;  3QK0 A;  4A3P A;  1E7U A;  1WGD A;  1WJU A;  3R3M A;  2IYD B;  2ZPN A;  4WJN A;  2YLM A;  1WMH B;  2L76 A;  3B1L X;  3L13 A;  4GDL B;  2FNJ B;  4EFO A;  2DHZ A;  3QWZ B;  1UH6 A;  4KV2 A;  4AWJ A;  2KOX A;  2D11 A;  2KZR A;  2PE9 A;  3UIP B;  1V80 A;  1VD2 A;  2A4Z A;  1ZGU B;  4B6W A;  4CYE A;  4ANU A;  3QJZ A;  2IO1 B;  4E71 A;  3W1Y A;  2W9N A;  3Q3F A;  3M62 B;  4KSL C;  3EC8 A;  2MSE D;  3VUX A;  3RUI B;  2RSU A;  2D07 B;  2DZI A;  4E74 A;  4K81 A;  3A1Q A;  3N3K B;  4BKS A;  4WAA A;  2KAN A;  3WA0 A;  1TBE A;  4B95 A;  2V1Y A;  4NAW B;  4IM0 A;  1KLV A;  1S3S G;  2MP2 A;  3ML8 A;  2HTH A;  3L08 A;  2LI5 A;  4FJZ A;  2FID A;  2KWV B;  1E8W A;  2LXC A;  4A20 A;  1CMX B;  1UZX B;  3SDL C;  3PV1 A;  3QX1 A;  1LFD A;  4DDI D;  2KXJ A;  2UWQ A;  1J0G A;  1EO6 A;  4GB9 A;  1OEY A;  5G55 A;  2ZCC A;  2ZNV C;  1MG8 A;  4TUU A;  3M3J A;  3VUW A;  1JRU A;  2LWP A;  1OQY A;  4GSW A;  2NPT B;  3RT3 B;  2N7D A;  2KDE B;  3I3T B;  3L0W B;  3PT2 B;  3RZW C;  2KFK B;  3A9J A;  1RLF A;  5DPS A;  3UIN B;  1WJ4 A;  1WI0 A;  4I6P A;  4W9E A;  2IO3 B;  1J8C A;  1Q0W B;  3VAW A;  2ZVN A;  2L0F A;  3SU8 X;  4MGI E;  3HIZ A;  2MX2 A;  2N7E A;  2LGX A;  2KDI A;  3PHW B;  4ICV A;  4P7I A;  5KHO A;  2FCS A;  3NY5 A;  1WR6 E;  1WF9 A;  1OEY J;  4B9K A;  4GIV A;  2KWC A;  4GXB A;  1Z5S B;  2DEN B;  1YIW A;  3WAP A;  4G11 A;  2KQ7 A;  5AZG A;  4FJY A;  2IY1 B;  5J17 A;  2KNB A;  3UGB B;  5DPW A;  2K6Q A;  2KJR A;  2Z0E B;  4KIK B;  4YL8 A;  3W1S C;  4NJ6 A;  4LDT B;  3ZNH B;  2R2O A;  3KVF B;  4HPL B;  4ZDV A;  3IBE A;  4CO7 A;  3MJW A;  5CHF A;  3T9L A;  2L0T A;  1WH3 A;  1WX7 A;  2NBV B;  5TR5 A;  2GBN A;  1E5W A;  2KLG A;  5DCN A;  2JUO A;  1OTR B;  5JH5 C;  3ZDT A;  2WX1 A;  3PSE B;  3H1U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...