1C3TA

Rotamer strain as a determinant of protein structural specificity
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
76
structure length
76
Chain Sequence
MQLFVKTLTGKTLTVELEPSDTVENLKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNLQKESTIHLVLRLRGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (1D8 UBIQUITIN)
publication title Rotamer strain as a determinant of protein structural specificity.
pubmed rcsb
source organism Homo sapiens
molecule tags De novo protein
total genus 16
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 1999-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1c3tA00
4ANUA 2KDBA 3ALBA 4BKGA 4EKUA 2CHZA 2JUOA 4XC2A 3L08A 3KUZA 4ZRIA 2LWPA 3RZWC 4E3CA 3ZRFA 4NY0A 1WJNA 2KVRA 2EMSA 4ANVA 4ICVA 2BGFA 4E71A 2L00B 3QK0A 1WR1A 1KM7A 2GBJA 2D10A 3TL5A 2NBVB 4PS8A 3W1YA 1OTRB 2A4ZA 1WGDA 2MLBA 4NJ6A 4HPMB 1J8CA 3N30A 1F9JA 2CHWA 4KSKC 4BVUC 1Y8RC 2ZVNA 3ZKJC 3PHWB 5G55A 1WGRA 3VDZA 3L10B 4KDLB 2IYDB 3A1QB 2DZIA 3R66C 4WJNA 2O2VA 3WA0A 3N32A 3APDA 3OJ3A 2MA9B 2LRWA 3DCGA 3V60A 4GIVA 1HE8A 2KFKA 3OJ4B 1J0GA 5D94A 4ZDVA 5AZGA 1WGHA 4FHJA 2B3AA 4J6IA 3UINB 2FAZA 4DK5A 3B0AA 4IWQA 1L7YA 3PRPB 3QQ8B 1KJTA 1Q1OA 3O65B 3W1SA 2PE6B 4BKSA 4KZ0A 3V62A 3LJ3A 2DYBA 3MJWA 2PEAA 3AU4A 2W9NA 2J0MA 2MRPA 2G4SA 2O6VD 1S1QB 3KVFB 2Z0DB 4GGQA 4CYEA 1V81A 1V2YA 2D3GA 3JYUA 2GMIC 3R7RA 4A3OA 1E8YA 2BWFA 3I3TB 3QARA 4P7IA 1RAXA 1V80A 2DAFA 2Z0EB 4E74A 2NPTA 2UYZB 3RULA 4EUTA 2IBIB 1EO6A 4RMAA 5CTRC 1L2NA 2EKEC 2MP2A 1V9JA 3H1UA 2KDEB 4KZCA 4FJVB 1RFAA 3DOWA 2KMAA 3VTVA 3VVWB 4DDGD 2FCNA 5JZEB 4MGKE 2GOWA 1WJ4A 1WX8A 1SGHA 1D3ZA 1ZKHA 2DZKA 2Y5BB 5CHVC 5J2RA 2OJRA 3VFKA 3VH3B 1Z5SB 4GMVA 2KDIA 1Q0WB 2ZNVC 3VH4B 2N1WA 4BFRA 4HJKA 1WM3A 2CR5A 4W9CA 5E6NA 2A5UA 5D7GA 1WXAA 2ZEQA 4JIOU 4K1RB 2M4NA 3CSFA 2KQSA 3IHPC 3VTUA 4KIKA 4PS3A 4DHZE 1ZGUB 2RPQA 4CHKA 2IY1B 2KC2A 2RGFA 5KHOA 1TGZB 2JZ3B 2WDTB 3VQIA 4OVUA 3ENEA 4HDQA 4XZ4A 1WJUA 3V61A 3H7PB 4N9F4 4AWJA 5TR5A 3VXWA 2L0FA 3IG3A 3VTWA 2KJRA 3Q3JA 4G3XB 5CX3A 2LD9A 3ZRCA 1WH3A 1WGGA 4HVBA 2AEHA 1E90A 1XT9B 2C7MB 2MSED 3PLUA 2PJHA 2C60A 3L54A 2DZJA 3PGEA 4W9GA 5LLIA 3WANA 4DDID 2RD0A 1RLFA 4KVGB 3IVFA 4II2B 2G45B 3ZLZA 4EOYA 1J19A 2AL3A 3LDZE 4MM3A 1WZ0A 4CO7A 1YX5B 4TQ1A 1V49A 4IW0A 3OLMD 3TBLD 4AJYB 4ANWA 2KMCA 2O6VB 4MEMA 3JW0X 1TZ1A 2L7RA 5L83A 4BBNF 2NR2A 1WYWB 2N7DA 2C7NB 4IG7B 2MBEA 1E7VA 4FLHA 1UZXB 3PZDA 5J18A 4EZLA 4RM8A 3ONSA 4GB9A 4HPLB 1EF1A 4NPNA 2D2QA 1WGYA 3ZNHB 2K6QA 3OAWA 3DBSA 3UQAA 2XK5A 1V5OA 2GBKA 1WF9A 2DAJA 2J7QB 2N1VA 2JXXA 1NI2A 2KQ7A 2N9EB 2L0TA 3IBEA 4WWOA 3RCZA 3WIMA 2JRIB 1V6EA 1WX9A 4GN1A 2DZMA 3PHXB 2BWES 4WJOA 2MCNB 3AULA 5E6OA 3RT3B 1R4NI 3TCAA 2J0JA 4FHKA 2PPHA 5LXHA 4K7UA 1M94A 5J17A 3H6NA 2FUHB 1WJ6A 2O2VB 1GJZA 4GDLA 2CKHB 4AUQC 3ECIA 2LGDA 3IFWB 2KFKB 3WAMA 3QC8B 3WALA 1K8RB 4GSWA 3TJPA 2LXAA 2K1FA 1WX7A 2K8BA 2MW5A 2EMTA 4MELA 1VD2A 2KN5A 3A4SC 3EHVA 3L17A 4NJ7A 4MGZE 2NBWB 2MBHA 1E5WA 1P3QU 4EEWA 4EZJA 2YLMA 2K8HA 1LM8B 5JH5C 2LZ6A 2FCSA 2GBRA 2RSUA 4M8MA 2LRUA 2LVOA 3PRMB 3ML8A 1LXDA 3K9PB 2BYEA 4B95A 5L95C 4AOFA 2L3ZA 1ISNA 1EF5A 1WR6E 1GNUA 1V86A 4K7SA 3R7QA 3PT2B 4I6PA 2LI5A 4B9KA 2MP2B 4HWIB 3ZNGC 3APFA 3PLVA 3A1QA 3BINA 4KDIC 4B6WA 5HKHA 1WMHA 3PRZA 1WFYA 3VUXA 1E8XA 1IYFA 1SE9A 2XBBC 2HD5B 2KTRA 2QHOA 2ZPYA 1MG8A 3A9JA 4NAWB 3Q3FA 5C1ZA 3U30A 1IP9A 4LJPB 1LFDA 1WIAA 3HHMA 4DWFA 1U4AA 4HCNB 1I35A 2KDFB 4RM9A 3NOBA 2MBQA 3BY4B 4EFOA 4FA6A 2BKFA 2NVUI 4FJZA 5DCNA 5DPTA 2LUEA 2BYVE 2KC1A 3HM6X 2KTFA 1JRUA 3HK0A 3KUCB 3KYDD 2K25A 3DBHI 3T8MA 4MGYE 4F1SA 5AZFA 3QWZB 5DPRA 1SIFA 1TBEA 4XX5A 3ZTDA 1LQBA 3DQVA 5FR6A 4MJSB 3AI5A 5CHWA 4K7WA 4M8NA 1WE6A 1CMXB 3A9KA 4MSMB 1Q5WB 1YD8U 1VCBA 1YX6B 2RR9A 5C23A 4BKSD 4MSQB 4DHJD 4KV2A 3JSVB 2L05A 1S3SG 4OVVA 4IM0A 4FJYA 4A3PA 1FXTB 1PQSA 2JPHA 1XD3B 3NZUA 2N9PC 2CHXA 2KZRA 2V3SA 3V6EB 2LASA 4URKA 3RUIB 2CS4A 2N4FA 2MBOA 2UWQA 2LGYA 3AXCA 4G11A 3L0WB 4GOCA 3PSEB 3ZW3A 4JLCA 2N7EA 5G2NA 1H8CA 2ASQA 1X1MA 4TKNA 3ZVVA 2KK8A 1WXVA 3ZNID 3UGBB 3JVZX 2R2QA 4W9JA 5IAAC 2I1JA 4HLEA 2GBNA 3DBLI 2R2OA 2G3QB 1A5RA 2WWZA 2NBUA 4W9EA 1P1AA 2OOBB 2BPSA 4GDKB 4WJQA 3VHTC 1GUAB 4ICUA 4TQ0A 2IO0B 1IPGA 2VRRB 1NDDA 4AJWA 4DBGA 3N3KB 1QZEA 3ZO5B 1WY8A 4FADA 4PYUA 2PE9A 2XK5B 2ZCBA 4W9KA 3EC8A 1WM2A 3AU5A 3DDCB 2IO1B 3KW5B 2KWCA 3T9LA 1I42A 3SU8X 3P2BA 4IWPA 4JL9A 4KSLC 3CF6E 3RYTA 1WZ3A 3DVNU 2DENB 2YVCA 2K6DB 2FCQA 2KX0A 4LJOB 5GMVA 5DPWA 1GC6A 1ZW7A 4IC7B 4EZKA 4ASWC 2WYQA 3QAQA 3ZTCA 5JHAA 2KJ6A 4F8CB 5EDSA 1P9DU 5AEKB 2JY6A 4HDOA 2LGXA 4NQKE 4IUMB 4W9FA 3DPDA 3QHTA 2AL6A 2DYOA 2NCNA 4IM3A 1OEYJ 3QCAA 4WWPA 2IY0B 2MBBB 3KH0A 3NHEB 4MGIE 2M1MA 3CSTA 2K39A 3DVNV 3U8ZA 2JVCA 3WAPA 2BKRB 2KFJA 4LDTD 3M95A 5D6JB 2GBMA 2KWVB 1C3TA 1EUVB 1WI0A 2REXA 2HE7A 3KYCD 2MWSB 3PTFC 1WXSA 4BKTA 5JHBA 3HM3A 4DHJB 4YL8A 3UIPB 1KOTA 2KD0A 3C0RB 4TV3A 4W9DA 2D07B 3L16A 4BOZB 2JWZA 3QJZA 4AP4C 1YIWA 3QX1A 4JQWC 2M8SA 4HK2A 3ZDTA 3M3JA 3UIOB 1KLVA 3NS8A 5AZHA 2FNJB 2CU1A 2D11A 3MTNB 5KHQA 2NPTB 2I1KA 2LVQA 3UF8A 3X23A 3SD5A 1WMHB 2LVPA 4TUUA 2K8CA 3QA8A 2KTRB 4IM2A 2WX0A 5BO4B 3A9JB 4X57B 2WX1A 3D32A 4IWOA 2KLGA 4WWNA 2DX5B 2AYOB 2JZZA 2KANA 1NBFC 2MQJA 2XEWA 1P0RA 3DVGY 3S2AA 2KNBA 4WAAA 1BT0A 3PVLA 4NQLB 3UQBA 3GZNI 2G4DB 2DYMA 3H7SA 1WE7A 4FN2A 4M0WB 1GC7A 2LJ5A 1AARA 3L13A 3SDLC 1GG3A 3TMPB 3DVGX 3R3MA 3VUWA 2C7HA 2N9XA 1E7UA 2ZCCA 3VAWA 3X0WA 4HXDA 3A4RA 2JRHA 4W9LA 2KLCA 1UGMA 3PS6A 2DHZA 1OEYA 3A9KB 4KIKB 2KKCA 2C9WB 2ZPNA 2IZVB 1UD7A 2AWTA 4WJPA 1OGWA 2FCMA 2Z59B 4NNJB 3MHSD 4PYZA 1WXMA 2KWUB 5IA7A 3PV1A 1YQBA 1T0YA 2L8JA 2ZJDA 4NAWA 2ZZPB 1E8WA 2KJHB 2KXJA 3K9OB 4WQOB 5E6PA 1R4MI 2JT4B 2V1YA 4GU2A 4DXAB 1TTNA 4K81A 4LDTB 1G6JA 2LXCA 4MDKE 3M63B 4FULA 3H9DA 3NY5A 1P98A 3KUDB 3NZSA 5CHFA 1UELA 2KX3A 3HIZA 3RD2A 1V5TA 4MJSA 1UH6A 2M0XA 4W9HA 3ZUNA 1Z2MA 3WAOA 3ZNZB 2BYFA 2JF5A 1YJ1A 3EECA 3PPAA 4G0NB 4FBJB 2IO2B 1WRDB 4W9IA 1H4RA 3QIJA 4DHZB 3H7PA 3JSVA 2IO3B 4BOSC 2NS5A 3W1SC 3A33B 1UBIA 4MH0E 3B08A 4LCDE 1C1YB 4II3B 3CMMB 4GXBA 1OQYA 2BF8B 3U7DA 3DBRI 3M62B 4HCPB 2V4LA 4ZRJA 2L76A 3TIXA 3SHQA 2ZVOA 5D2MB 2MX2A 3ZDMC 3V6CB 1E8ZA 2FIFA 1UBQA 3VUYA 3ZIMA 3GOEA 1XQQA 2HTHA 2M17A 2ZNVB 3EFUA 2HJ8A 3APCA 2FIDA 4G50A 5LXIB 4ANXA 4PS7A 3ML9A 3RZFA 3PREA 5DPSA 4A20A 2KO3A 2O6VA 4I6LB 4GDLB 4ZYNA 4GDKA 4ZRKA 3B1LX 4F7ZA 2KOXA 4I6NB 2C5LC 2KHWB 4BBNC 2J0KA 1RRBA 4JGHB
chains in the Genus database with same CATH superfamily
4ANUA 2YEPF 3U2SC 2CHZA 4XC2A 3B2GA 3RZWC 2EMSA 4ANVA 4ICVA 1D6EC 2GBJA 3AH7A 1BUIC 3AE9B 2A4ZA 4NJ6A 1J8CA 2CHWA 4BVUC 2ZVNA 3EGRA 1C78A 1TYGB 3FAHA 5D94A 5AZGA 2J53A 3RMKC 3U4EG 1KJTA 1Q1OA 3O65B 3W1SA 4KZ0A 3MJWA 1R7SA 1WGKA 2MRPA 4CYEA 1V81A 1SF0A 2D3GA 3BIID 2GMIC 1E8YA 3I3TB 3FILA 1QOGA 1EWCA 3IXSA 3DBLB 1TS2A 3RI7C 2GB1A 3DOWA 3VVWB 4H2AA 1AWDA 3FC4A 4MGKE 1SGHA 2KACA 2V0GA 1ZKHA 3DBRB 4D2KA 4XYCA 1PGAA 5CHVC 2ZNVC 2W82A 4LNIA 3VH4B 2W3SA 5E6NA 5D7GA 3SR6A 1WXAA 2ZEQA 1IGDA 1F2RC 2RPQA 2KC2A 5KHOA 2WXOA 3VQIA 1WJUA 1MI0A 4AWJA 5TR5A 2KJRA 3BZDB 1SEBD 2INNE 3L54A 4M00A 3OWEB 2WDVB 2LMCA 4DDID 2K5PA 1RLFA 4II2B 2G45B 3ZLZA 1J19A 4RFBA 1YN4A 2AX5A 4USAA 2NTSA 4IW0A 3OLMD 4ANWA 2O6VB 3JW0X 1TZ1A 2L7RA 5L83A 1N63A 1T6BX 1JWSD 4FLHA 1YN3A 3ONSA 4GB9A 3KQ4A 1C76A 3DBSA 3UQAA 1V5OA 3ZQ4A 1E0ZA 2KN4A 3ABVB 3PHXB 3AE3B 1IBXA 2MCNB 1I4HA 2JZPA 2J0JA 4FHKA 2PPHA 2ICIA 2LFIA 5LXHA 4K7UA 5J17A 3H6NA 2FUHB 2CKHB 5GXGB 2LGDA 5BMIA 2KFKB 3WAMA 2K9XA 2LXAA 1WX7A 4OZCA 3EHVA 2KN5A 4MGZE 1E5WA 1P3QU 3RNFC 2LZ6A 3ML8A 3K9PB 3Q8EA 3V3XA 4B95A 4N59A 3J9CA 1ACCA 1L0YB 1GNUA 5G5HA 4WAFA 2LI5A 2MP2B 4HWIB 3APFA 4KDIC 1WMHA 3AEGB 1JMLA 3TEXA 2XBBC 1KLUD 2QHOA 3A9JA 4NAWB 2DNFA 4WURA 1LFDA 2KDFB 4FA6A 2L52A 2NVUI 4FJZA 2LEKA 1M4VA 3HK0A 4YTPB 4MGYE 5DPRA 2YEPB 1TBEA 2N7JA 4XX5A 5FR6A 2CJOA 3HUIA 4KGSA 4K7WA 1FIQA 1CMXB 2DWQA 2GRIA 1YX6B 5C23A 4BKSD 4MSQB 3IAS1 1V1PA 4FJYA 1FXTB 1PQSA 4URKA 3V6EB 3UQBA 2N4FA 3AXCA 5BMHA 5BYRA 1H8CA 2KQ4X 1X1MA 2IDYA 2KK8A 2D3CA 4US9A 5BYQA 3ZNID 5C3JB 3UGBB 2R2QA 2WXMA 5IAAC 2PLPA 4W9EA 2OOBB 2IO0B 2J52A 2VRRB 5AUKA 3N3KB 3NZ3A 3R2TA 4PYUA 3AU5A 2IO1B 4IWPA 4KSLC 1NYRA 1I4XA 2FCQA 5GMVA 5DPWA 3QAQA 5JHAA 3TSSA 2LGXA 2W54A 3DHHC 3N9YC 3DPDA 2AL6A 3N1ZC 3SFEB 1QLBB 2K39A 2BS4B 3DVNV 3AB5A 4ITKA 3MHZA 3M95A 4HEA1 4KKIA 3TUOA 1F77A 1K51A 2WXJA 4JWUC 1YOVB 4P1CC 5HI1A 4YL8A 2CJNA 4TV3A 1VZ6A 2D07B 3L16A 2JWZA 4AP4C 1E7PB 2M8SA 1C9FA 3M3JA 5AZHA 1HTQA 1FNUA 2DBYA 1JWMD 3QA8A 4MT5A 4IM2A 1ZDXA 4X57B 2QJLA 2JZZA 2ACZB 2AYOB 1YJIA 2KNBA 1QT9A 1BT0A 4LK0M 2WXQA 2OEDA 3L13A 2MH7A 3DWGC 3SDLC 2LJIA 2ZCCA 3PZ8A 3A4RA 2KLCA 1UGMA 1JALA 1OEYA 3BVZA 2C9WB 3BWUD 1N5XA 3RNCC 1C4AA 4NNJB 4PK1A 1VZ7A 2SEBD 1WXMA 2KWUB 1T0YA 2L8JA 3AV8A 1E8WA 3Q69A 4BAXA 3K9OB 4NJCA 1V97A 4GU2A 3Q8AA 4WIPA 3NJTA 3NVVA 3M63B 1WWTA 3NVZA 3KUDB 1NYQA 5EE1A 3NZSA 5CHFA 3P63A 4MJSA 1Z2MA 2Z8LA 1R4NB 2JF5A 3EECA 4G0NB 3PPAA 3QIJA 1VZ8A 2LHDA 1FFVA 1C1YB 4II3B 2BF8B 3GE3C 3U7DA 2SAKA 3Q3OC 3M62B 4HCPB 3KLSX 3TIXA 2ZW1A 4L2YA 4P6VF 1P7FA 1IBXB 3V6CB 2WHIA 2FIFA 4K3CA 3ZIMA 1V1OA 1VJKA 2ZNVB 3APCA 4G50A 1C4PA 3AMZA 4ANXA 1VDVA 3PREA 2KO3A 2O6VA 4ZYNA 4GDKA 4ZRKA 2HDEA 3BVGA 2KMMA 4F7ZA 2C5LC 1MVKA 1XEEA 2KDBA 3ALBA 1CQVA 4BKGA 4LNNA 1JWAD 3KUZA 4ZRIA 4E3CA 2WS3B 2BGFA 4E71A 3QK0A 1WR1A 1KM7A 1FO4A 3GP7A 3TL5A 2AQ1B 3URYA 4YSZB 1WGDA 1ZPSA 3Q8BA 3N30A 1F9JA 1LGRA 1D5ZC 5G55A 1WGRA 2QMTA 1D4BA 2XN9C 2DZIA 3WA0A 3DCGA 4ARCA 4HROA 4M01A 4GIVA 1UWMA 2KFKA 4ZDVA 2M0AA 4J6IA 5FK9C 3UINB 4DK5A 3PRPB 3AN1A 1P7EA 3V62A 4RGMA 2JQRB 2PEAA 2W9NA 1QKZA 2J0MA 2G4SA 2O6VD 1S1QB 1TY0A 3Q2AC 5EE0A 3JYUA 3R7RA 4A3OA 4KKJA 2BWFA 3GE8C 1XLPA 2JWUA 2RDGA 4ZOHC 1RAXA 1V80A 3RULA 4RMAA 5CTRC 2MP2A 1SSNA 1V9JA 3H1UA 2KDEB 1TT5B 4FJVB 1RFAA 1RFKA 3U52E 2FCNA 5JZEB 2GOWA 1QF6A 3RPFC 2Y5BB 4GMVA 2KDIA 1Q0WB 4KX6B 3RFZB 2J42A 4HJKA 4W9CA 2A5UA 5IOIA 4K1RB 4JIOU 3IHPC 4PS3A 1ZGUB 2XNAC 5HHDG 2RGFA 2JX5A 4HDQA 3V61A 3H7PB 4N9F4 3VXWA 2L0FA 3IG3A 3VTWA 1ESFA 1UWXA 4RGOS 4OVZA 3BVMA 4HVBA 2I2YA 2AEHA 2MSED 1MFWA 5LLIA 3WANA 1I4GA 1XCQL 1FCLA 4KVGB 4OHJA 4EOYA 1SXTA 1K52A 1YX5B 3H8HA 2BB5A 4AJYB 4RGNA 1MHHE 4FXCA 1PFDA 2WDRB 2MBEA 1E7VA 1UZXB 4TMAB 4HPLB 3ZNHB 3OAWA 5T8IA 4OW0A 2GBKA 4ACFA 2DAJA 3TBLD 3IBEA 3CIRB 2L0TA 3RCZA 3WIMA 4BZAA 4GN1A 4WJOA 4YWGG 3AULA 1AW7A 3TCAA 1F1HA 1WJ6A 4GDLA 4AUQC 1YJJA 3WALA 4GSWA 3I57A 2EMTA 4MELA 3A4SC 3Q8FA 2NBWB 4EEWA 2N9KA 4C7YA 2WGSA 2YLMA 3AM9A 2K8HA 3C19A 1R4MB 5JH5C 2FCSA 1E6EB 2LVOA 3PRMB 2LGIA 1LXDA 2RDHA 1EF5A 1WR6E 1PGXA 4K7SA 1XXGA 4I6PA 3ZNGC 5MPOA 3PLVA 3BINA 3IT6B 2PIAA 3LB8C 3U30A 1QOFA 2L1AA 4DWFA 3L4PA 2MBQA 4EFOA 1L5PA 3HM6X 1JRUA 3KUCB 3T8MA 1GB4A 5AZFA 1SIFA 4L23A 1WXQA 4MJSB 5CHWA 2VZKB 1Q5WB 3HVZA 4MH8A 1EWYC 4KV2A 4A3PA 1GPXA 2JPHA 1RWSA 2N9PC 2V3SA 2LASA 2JSVX 4GOCA 2MBOA 4G11A 3ZW3A 4JLCA 2QDFA 4ZRPA 4XWWA 4W9JA 4HLEA 5AUIA 5D3IB 2WWZA 2NBUA 1ZE3D 1P1AA 2BPSA 4GDKB 4IKGA 4AJWA 4DBGA 1QZEA 1ZDVA 3E9SA 4JWSC 2PE9A 2XK5B 2ZCBA 2GLSA 2WXHA 3KW5B 2KWCA 2PKOA 3SU8X 4JL9A 3CF6E 1WZ3A 3RN9C 2DENB 2YVCA 3ZGZA 1E9MA 2KYWA 2QSDA 4IC7B 2Y5PA 2NMQA 2PVGC 4ASWC 3U7ZA 5EDSA 4W9FA 1OQRA 2DYOA 1HTOA 3P1MA 2BW2A 1TY2A 2IGHA 2IY0B 3KH0A 2WXFA 2BTEA 2M1MA 1FEHA 3WAPA 2M19A 1IUEA 2GBMA 2KWVB 1EUVB 4WWMA 2HE7A 1WXSA 4BKTA 3HM3A 4C00A 1VRAB 2WU5B 3AEDB 1KOTA 2KD0A 4W9DA 3QJZA 3ZDTA 4RH6A 5IO9A 1FFUA 3NS8A 2OJWA 2CU1A 1L4ZB 2H89B 3X23A 3SD5A 2LVPA 4TUUA 2K8CA 2WX0A 2KVZA 2KLGA 4WWNA 2KANA 1NVID 2MQJA 4RF0A 3DVGY 3R8BA 1DOYA 2GI9A 4JPSA 4XDDA 3GZNI 3VR9B 2DYMA 3HRDD 3I9V1 3RNGC 4FN2A 4EE2A 2LJ5A 2LUMA 4MACA 2VH2A 2H88B 1DOXA 3PZ7A 1FRRA 3X0WA 2QCZA 2JRHA 1TKYA 3PS6A 2KKCA 2PTLA 2ZPNA 1OGWA 5IA7A 3PV1A 1YQBA 3NVYA 1TS3A 1V8CA 2ZJDA 1F52A 2KXJA 4YSYB 4WQOB 4DXAB 2RDBC 1G6JA 2LXCA 1RM6C 3NY5A 3O13A 1P98A 2VH1A 1TKEA 4YXDB 1YNTE 1UH6A 2M0XA 3ZUNA 3WAOA 2KWDA 2G1EA 2IO2B 4W9IA 1PDXA 3H7PA 3JSVA 2IO3B 4BOSC 2NS5A 4MH0E 3B08A 5C2TB 4IOIE 4LCDE 3CMMB 4GXBA 1ET9A 2W55A 1MHXA 2MJEA 4ZRJA 1FRDA 3ZJVA 3SHQA 2ZVOA 4C7ZA 1TZOA 3VRBB 3ETRA 1E8ZA 3GOEA 2M17A 4YSXB 2HJ8A 2FIDA 5LXIB 2FBWB 4PS7A 3RZFA 5DPSA 4A20A 4I6LB 4GDLB 3T3OA 4IDIA 3B1LX 2BYTA 5LNK1 2V3PA 1RRBA 5G5GA 4EKUA 1JCKB 2INPE 2Q5WD 2L32A 4NY0A 1WJNA 4YT0B 3LYYA 3BK1A 4PS8A 1OTRB 2MLBA 4HPMB 1Y8RC 1QQRA 3PHWB 2X8XX 3C8YA 4KDLB 2IYDB 3R66C 4WJNA 3N32A 3OJ3A 2MA9B 2LRWA 3V60A 1HE8A 3OJ4B 2ZW0A 1J0GA 4FHJA 2B3AA 2FAZA 1EM7A 4IWQA 1L7YA 2PE6B 1XLOA 2I38A 4ZRQA 1UF0A 3P4RB 4GGQA 4LNOA 2Z0DB 1I4RA 1V2YA 5HG2A 4P7IA 1B1ZA 1FM0D 1AYFA 2DAFA 2Z0EB 2WXLA 3ZXRA 4E74A 1EO6A 1PYWD 2EKEC 4XWTA 3P42A 1QOAA 4KZCA 3GS2A 3NS1A 4OZAA 4TSSA 1XLNA 3VTVA 4DDGD 3AEEB 4P16A 3Q8CA 2PMVA 1WX8A 1YMHE 1D3ZA 2DZKA 4N6EB 3Q6BA 2OJRA 3VFKA 1L0VB 1Z5SB 4HJGE 1FPYA 4A8XC 4BFRA 1WM3A 2CR5A 2BT6A 2DLBA 2M4NA 3CSFA 1FMAD 3VTUA 2WP9B 3IAM1 2WXIA 3B9JA 2IY1B 1TGZB 2JZ3B 2E3TA 4XZ4A 1L6VA 1J7CA 3Q3JA 3ZRCA 2LD9A 4N58A 1WGGA 2C60A 1SE2A 2AL3A 1ZXHA 3LDZE 4CO7A 1WZ0A 2NTTA 4P1BC 2KMCA 4MEMA 2L83A 3AE4B 1CZPA 4NPNA 2K6QA 2XK5A 2TSSA 4RGTA 1N6ZA 1WF9A 2J7QB 2N1VA 2JXXA 3NRZA 2KQ7A 2N9EB 4WWOA 4C4VA 3NVWA 1VR9A 1WX9A 2DZMA 1MPEA 5E6OA 3RT3B 3GB1A 1HXYD 2O2VB 1GJZA 5FR3A 3SFDB 1TS4A 3BYTB 1K50A 1EU4A 2N0SB 3QC8B 2EELA 1TJEA 3TJPA 2K1FA 2K8BA 2MEKA 1VD2A 3L17A 4EZJA 2MBHA 1BMLC 2AQ3B 4DXGA 4M8MA 2BYEA 1D5XC 4AOFA 2L3ZA 4J3OD 1V86A 4LTUA 3R7QA 4B9KA 2BS2B 1DGJA 3A1QA 2WXRA 4B6WA 3P4PB 3PRZA 1WFYA 3VUXA 3BK2A 1SE9A 2HD5B 1MG8A 1RYJA 2QIEB 5C1ZA 1IP9A 4LJPB 1JQ4A 3HHMA 2WLBA 1I35A 3NOBA 1BXTA 5DPTA 2BYVE 2KC1A 3N20C 2KTFA 2QILA 3W2DA 5EE9A 3QWZB 1LQBA 1WYGA 3DQVA 3AI5A 1SB3C 2D3AA 1XLQA 4M02A 4MSMB 3P4SB 2RR9A 1KTKA 3ZYYX 1STEA 3JSVB 2L05A 4XGAB 4R3DA 4OVVA 3AE6B 1KLGD 2OHFA 2CHXA 2KZRA 2CS4A 3L0WB 5G2NA 3SEBA 1CJEA 4S17A 1NENB 4TKNA 4ARIA 1WXVA 4A9AA 1SBBB 4UDUC 2ON8A 2GBNA 3DBLI 2ONQA 4XE0A 3EUB2 1TKGA 3VHTC 1GUAB 4ICUA 1T0SC 3EA6A 1WY8A 4FADA 3OG5A 4NAMA 2D3BA 1I42A 3T9LA 4JX1C 2M56B 3RYTA 1JWBD 1HA5A 4LJOB 1LO5D 3DHIC 1GC6A 1ZW7A 2V9HA 2RMMA 3ZTCA 5JXVA 1I4PA 1P9DU 2JY6A 4HDOA 3BYYB 2N9LA 2NCNA 4WWPA 2MBBB 1NI3A 1FCCC 1SJHD 4HKQA 2JVCA 1J7AA 1C3TA 2MHJA 4US8A 1WI0A 1ZUD2 4KGTA 3PTFC 3KYCD 2REXA 5JHBA 1GAQB 1JROA 4DHJB 2WDQB 3UIPB 1YQ3B 4CQNA 3DWMA 4BOZB 1YIWA 3QX1A 4WH4A 4JQWC 4HK2A 1FNVA 2PVOD 3N1YC 4B0MA 3R2IA 2KTRB 2WX1A 3D32A 3HVDA 4IWOA 3VAWA 1Q10A 3TEZA 1NBFC 2WXGA 1ZXIA 4NQLB 2G4DB 1WE7A 4M0WB 1T3QA 1AARA 4JE3B 3TMPB 3VUWA 2N9XA 1E7UA 2CU3A 4HXDA 4W9LA 4GLSC 4LNKA 2DHZA 4Q2JA 3A9KB 4WQMA 2IZVB 2PW9A 4KGRA 1F0ZA 2Y3AA 2ZZPB 1UGJA 2V1YA 2IJ0A 1TTNA 4K81A 4LDTB 4MDKE 3H9DA 1XO3A 3PO0A 2KX3A 3HIZA 4PT5A 3RD2A 3ZNZB 1TIFA 2BYFA 1WRDB 5H92C 3A33B 1OQYA 2QEJC 2V4LA 2L76A 4LNFA 3TEYA 3ZJTA 4C4VB 2MX2A 3ZDMC 3VUYA 1UBQA 2LHEA 1XQQA 3EFUA 1N60A 5HFYA 4I6NB 4BBNC 2J0KA 4RCOA 2JUOA 4K3BA 3L08A 2LWPA 3ZRFA 1GB1A 2KVRA 1N5WA 1WRIA 5EE3A 2JYEA 2L00B 2BS3B 2D10A 1K53A 1I7HA 2NBVB 3W1YA 3RNAC 4KSKC 1L6UA 3ZKJC 3VDZA 3L10B 3A1QB 2O2VA 3APDA 2W3RA 1PGBA 1WGHA 3AE7B 3CWIA 3B0AA 2FE8A 2V4IB 3QQ8B 3AEAB 4BKSA 3LJ3A 2DYBA 4HPPA 3AU4A 3B2FA 3KVFB 5E6JA 1E10A 2G9HD 3QARA 4A55A 2NPTA 2UYZB 1QILA 4EUTA 2IBIB 1L2NA 1T0RC 4XDCA 4REZA 4LLGM 2KMAA 5FKAC 1WJ4A 1SJED 4C80A 5J2RA 3AEFB 4ZHPA 3VH3B 1YQ4B 5IP4D 1FD6A 1HEZE 2N1WA 3V05A 1MG4A 1Y56A 3MFGA 2KQSA 1ROEA 4KIKA 2INCC 4DHZE 4CHKA 1ZP0B 2WDTB 4A90A 4OVUA 3ENEA 1JW9D 5IN7A 1QOBA 3T3NA 4AQ7A 4AS1A 1N62A 4G3XB 5CX3A 1WH3A 1KH0A 3PLUA 1E90A 1XT9B 2C7MB 2PJHA 2DZJA 3PGEA 2RPVA 4W9GA 1FNWA 2WXNA 2RD0A 3IVFA 4MM3A 4TQ1A 1V49A 2JYTA 4RF1A 4QAYA 4BBNF 1YN5A 2NR2A 1WYWB 2N7DA 2BB6A 2C7NB 4IG7B 3PZDA 5J18A 4EZLA 4RM8A 2HTME 1EF1A 3MC0B 2D2QA 1WGYA 3IT4B 1ZOYB 3VR8B 2FUG1 1NI2A 4ZHOA 3KWLA 2JRIB 3GZNB 3W5VB 1V6EA 3AECB 1FXAA 2BWES 2WQYB 2V3NA 1DYQA 1R4NI 1JWUD 1B9RA 1M94A 3ECIA 2QC8A 1WSPA 3IFWB 2K0PA 4RNAA 1K8RB 2MW5A 4NJ7A 3LXFA 1UNSA 3EFCA 1JRPA 1LM8B 2RSUA 2GBRA 2LRUA 5L95C 3FILB 2BVCA 1ISNA 3Q3NC 3W5UB 2J4XA 4O1NA 3PT2B 3TEWA 1T0QC 5HKHA 3FKYA 2R61A 1IGCA 1F2RI 1E8XA 1IYFA 1C4CA 2K3UA 2KTRA 3DHGC 2ZPYA 1T5XD 3Q3FA 1OQQA 1WIAA 1U4AA 4HCNB 4RM9A 3BY4B 3NUHB 2BKFA 5DCNA 2LUEA 4OZBA 4NZLB 4M0WA 3KYDD 2K25A 3DBHI 1ENFA 1L4DB 4F1SA 3ZTDA 3MC8A 1SE3A 4M8NA 3MJ5A 1WE6A 5BMGA 3A9KA 2IGDA 1YD8U 1VCBA 4DHJD 4YTMB 1S3SG 4S0RA 4IM0A 2WU2B 1D5MC 5I4DA 1KF6B 1NEKB 1XD3B 3NZUA 3AE8B 3RUIB 3MC9A 2UWQA 2LGYA 2WXPA 2BBCA 3PSEB 1ET6A 2N7EA 2ASQA 5D3DA 2IPKD 3WCQA 3ZVVA 1DOIA 3JVZX 1MJDA 2HJ1A 4HKZE 2I1JA 2WNMA 1L0XB 3I5JC 2R2OA 2G3QB 1A5RA 1EU3A 1OFFA 3RNEC 4WJQA 4TQ0A 1IPGA 1NDDA 1AN8A 3ZO5B 3MP9A 4DQOC 4W9KA 1J7BA 3EC8A 1WM2A 3DDCB 3P2BA 1KFYB 2EKIA 3Q14C 3DVNU 1I4QA 1HQRD 2K6DB 2KX0A 2KT7A 1FXIA 2KAJA 2B76B 2WYQA 4EZKA 2JU6X 2VZKD 2KJ6A 4F8CB 5AEKB 4NQKE 4IUMB 3QHTA 3E56A 4IM3A 1OEYJ 1XCTL 3QCAA 3ZXVA 3NHEB 4MGIE 1KRHA 3CSTA 3U8ZA 2BKRB 2KFJA 4LDTD 2KDMA 5D6JB 3ZJUA 2MWSB 2Y5CA 3C0RB 3NG0A 3DBHB 3UI3A 3AE5B 3W9CB 1KLVA 3UIOB 3VRAB 2FNJB 2D11A 3MTNB 5KHQA 2NPTB 2I1KA 2LVQA 3UF8A 1WMHB 2X38A 5BO4B 3A9JB 5IKCM 2DX5B 3S2AA 2XEWA 3P4QB 1P0RA 5TSSA 1SIJA 4WAAA 3PVLA 3H7SA 3KWVA 1GC7A 1GG3A 2K22A 3DVGX 3R3MA 2C7HA 2E6XA 4KIKB 2BQQA 1UD7A 2AWTA 4WJPA 2FCMA 2Z59B 1SE4A 3MHSD 1VLBA 4PYZA 1V1PB 2D5GA 4NAWA 1XF5L 2KJHB 2AQ2B 2LGSA 1UUPA 3AEBB 3RNBC 4L1BA 5E6PA 1R4MI 2JT4B 4DXFA 1GOZA 4HRSA 2UU7A 2IGGA 4FULA 1C79A 2MJ3A 1PUTA 1UELA 1V5TA 4MM3B 4W9HA 1YJ1A 4FBJB 1H4RA 4ZYSA 2WXKA 4DHZB 3Q3MC 3W1SC 1UBIA 3I63C 3DBRI 1HZ6A 4C56C 1A70A 2MJDA 4YTNB 1TS5A 5D2MB 1C77A 2JXTA 3AE1B 5H8YE 2INDC 1HZ5A 3N1XC 2HTHA 1N61A 3ML9A 4A6QA 1CK1A 5BYSA 3AE2B 2KOXA 2KHWB 4B0EA 4JGHB
chains in the Genus database with same CATH topology
4ANUA 2KDBA 3ALBA 4BKGA 4EKUA 2CHZA 2JUOA 4XC2A 3L08A 3KUZA 4ZRIA 2LWPA 3RZWC 4E3CA 3ZRFA 4NY0A 1WJNA 2KVRA 2EMSA 4ANVA 4ICVA 2BGFA 4E71A 2L00B 3QK0A 1WR1A 1KM7A 2GBJA 2D10A 3TL5A 2NBVB 4PS8A 3W1YA 1OTRB 2A4ZA 1WGDA 2MLBA 4NJ6A 4HPMB 1J8CA 3N30A 1F9JA 2CHWA 4KSKC 4BVUC 1Y8RC 2ZVNA 3ZKJC 3PHWB 5G55A 1WGRA 3VDZA 3L10B 4KDLB 2IYDB 3A1QB 2DZIA 3R66C 4WJNA 2O2VA 3WA0A 3N32A 3APDA 3OJ3A 2MA9B 2LRWA 3DCGA 3V60A 4GIVA 1HE8A 2KFKA 3OJ4B 1J0GA 5D94A 4ZDVA 5AZGA 1WGHA 4FHJA 2B3AA 4J6IA 3UINB 2FAZA 4DK5A 3B0AA 4IWQA 1L7YA 3PRPB 3QQ8B 1KJTA 1Q1OA 3O65B 3W1SA 2PE6B 4BKSA 4KZ0A 3V62A 3LJ3A 2DYBA 3MJWA 2PEAA 3AU4A 2W9NA 2J0MA 2MRPA 2G4SA 2O6VD 1S1QB 3KVFB 2Z0DB 4GGQA 4CYEA 1V81A 1V2YA 2D3GA 3JYUA 2GMIC 3R7RA 4A3OA 1E8YA 2BWFA 3I3TB 3QARA 4P7IA 1RAXA 1V80A 2DAFA 2Z0EB 4E74A 2NPTA 2UYZB 3RULA 4EUTA 2IBIB 1EO6A 4RMAA 5CTRC 1L2NA 2EKEC 2MP2A 1V9JA 3H1UA 2KDEB 4KZCA 4FJVB 1RFAA 3DOWA 2KMAA 3VTVA 3VVWB 4DDGD 2FCNA 5JZEB 4MGKE 2GOWA 1WJ4A 1WX8A 1SGHA 1D3ZA 1ZKHA 2DZKA 2Y5BB 5CHVC 5J2RA 2OJRA 3VFKA 3VH3B 1Z5SB 4GMVA 2KDIA 1Q0WB 2ZNVC 3VH4B 2N1WA 4BFRA 4HJKA 1WM3A 2CR5A 4W9CA 5E6NA 2A5UA 5D7GA 1WXAA 2ZEQA 4JIOU 4K1RB 2M4NA 3CSFA 2KQSA 3IHPC 3VTUA 4KIKA 4PS3A 4DHZE 1ZGUB 2RPQA 4CHKA 2IY1B 2KC2A 2RGFA 5KHOA 1TGZB 2JZ3B 2WDTB 3VQIA 4OVUA 3ENEA 4HDQA 4XZ4A 1WJUA 3V61A 3H7PB 4N9F4 4AWJA 5TR5A 3VXWA 2L0FA 3IG3A 3VTWA 2KJRA 3Q3JA 4G3XB 5CX3A 2LD9A 3ZRCA 1WH3A 1WGGA 4HVBA 2AEHA 1E90A 1XT9B 2C7MB 2MSED 3PLUA 2PJHA 2C60A 3L54A 2DZJA 3PGEA 4W9GA 5LLIA 3WANA 4DDID 2RD0A 1RLFA 4KVGB 3IVFA 4II2B 2G45B 3ZLZA 4EOYA 1J19A 2AL3A 3LDZE 4MM3A 1WZ0A 4CO7A 1YX5B 4TQ1A 1V49A 4IW0A 3OLMD 3TBLD 4AJYB 4ANWA 2KMCA 2O6VB 4MEMA 3JW0X 1TZ1A 2L7RA 5L83A 4BBNF 2NR2A 1WYWB 2N7DA 2C7NB 4IG7B 2MBEA 1E7VA 4FLHA 1UZXB 3PZDA 5J18A 4EZLA 4RM8A 3ONSA 4GB9A 4HPLB 1EF1A 4NPNA 2D2QA 1WGYA 3ZNHB 2K6QA 3OAWA 3DBSA 3UQAA 2XK5A 1V5OA 2GBKA 1WF9A 2DAJA 2J7QB 2N1VA 2JXXA 1NI2A 2KQ7A 2N9EB 2L0TA 3IBEA 4WWOA 3RCZA 3WIMA 2JRIB 1V6EA 1WX9A 4GN1A 2DZMA 3PHXB 2BWES 4WJOA 2MCNB 3AULA 5E6OA 3RT3B 1R4NI 3TCAA 2J0JA 4FHKA 2PPHA 5LXHA 4K7UA 1M94A 5J17A 3H6NA 2FUHB 1WJ6A 2O2VB 1GJZA 4GDLA 2CKHB 4AUQC 3ECIA 2LGDA 3IFWB 2KFKB 3WAMA 3QC8B 3WALA 1K8RB 4GSWA 3TJPA 2LXAA 2K1FA 1WX7A 2K8BA 2MW5A 2EMTA 4MELA 1VD2A 2KN5A 3A4SC 3EHVA 3L17A 4NJ7A 4MGZE 2NBWB 2MBHA 1E5WA 1P3QU 4EEWA 4EZJA 2YLMA 2K8HA 1LM8B 5JH5C 2LZ6A 2FCSA 2GBRA 2RSUA 4M8MA 2LRUA 2LVOA 3PRMB 3ML8A 1LXDA 3K9PB 2BYEA 4B95A 5L95C 4AOFA 2L3ZA 1ISNA 1EF5A 1WR6E 1GNUA 1V86A 4K7SA 3R7QA 3PT2B 4I6PA 2LI5A 4B9KA 2MP2B 4HWIB 3ZNGC 3APFA 3PLVA 3A1QA 3BINA 4KDIC 4B6WA 5HKHA 1WMHA 3PRZA 1WFYA 3VUXA 1E8XA 1IYFA 1SE9A 2XBBC 2HD5B 2KTRA 2QHOA 2ZPYA 1MG8A 3A9JA 4NAWB 3Q3FA 5C1ZA 3U30A 1IP9A 4LJPB 1LFDA 1WIAA 3HHMA 4DWFA 1U4AA 4HCNB 1I35A 2KDFB 4RM9A 3NOBA 2MBQA 3BY4B 4EFOA 4FA6A 2BKFA 2NVUI 4FJZA 5DCNA 5DPTA 2LUEA 2BYVE 2KC1A 3HM6X 2KTFA 1JRUA 3HK0A 3KUCB 3KYDD 2K25A 3DBHI 3T8MA 4MGYE 4F1SA 5AZFA 3QWZB 5DPRA 1SIFA 1TBEA 4XX5A 3ZTDA 1LQBA 3DQVA 5FR6A 4MJSB 3AI5A 5CHWA 4K7WA 4M8NA 1WE6A 1CMXB 3A9KA 4MSMB 1Q5WB 1YD8U 1VCBA 1YX6B 2RR9A 5C23A 4BKSD 4MSQB 4DHJD 4KV2A 3JSVB 2L05A 1S3SG 4OVVA 4IM0A 4FJYA 4A3PA 1FXTB 1PQSA 2JPHA 1XD3B 3NZUA 2N9PC 2CHXA 2KZRA 2V3SA 3V6EB 2LASA 4URKA 3RUIB 2CS4A 2N4FA 2MBOA 2UWQA 2LGYA 3AXCA 4G11A 3L0WB 4GOCA 3PSEB 3ZW3A 4JLCA 2N7EA 5G2NA 1H8CA 2ASQA 1X1MA 4TKNA 3ZVVA 2KK8A 1WXVA 3ZNID 3UGBB 3JVZX 2R2QA 4W9JA 5IAAC 2I1JA 4HLEA 2GBNA 3DBLI 2R2OA 2G3QB 1A5RA 2WWZA 2NBUA 4W9EA 1P1AA 2OOBB 2BPSA 4GDKB 4WJQA 3VHTC 1GUAB 4ICUA 4TQ0A 2IO0B 1IPGA 2VRRB 1NDDA 4AJWA 4DBGA 3N3KB 1QZEA 3ZO5B 1WY8A 4FADA 4PYUA 2PE9A 2XK5B 2ZCBA 4W9KA 3EC8A 1WM2A 3AU5A 3DDCB 2IO1B 3KW5B 2KWCA 3T9LA 1I42A 3SU8X 3P2BA 4IWPA 4JL9A 4KSLC 3CF6E 3RYTA 1WZ3A 3DVNU 2DENB 2YVCA 2K6DB 2FCQA 2KX0A 4LJOB 5GMVA 5DPWA 1GC6A 1ZW7A 4IC7B 4EZKA 4ASWC 2WYQA 3QAQA 3ZTCA 5JHAA 2KJ6A 4F8CB 5EDSA 1P9DU 5AEKB 2JY6A 4HDOA 2LGXA 4NQKE 4IUMB 4W9FA 3DPDA 3QHTA 2AL6A 2DYOA 2NCNA 4IM3A 1OEYJ 3QCAA 4WWPA 2IY0B 2MBBB 3KH0A 3NHEB 4MGIE 2M1MA 3CSTA 2K39A 3DVNV 3U8ZA 2JVCA 3WAPA 2BKRB 2KFJA 4LDTD 3M95A 5D6JB 2GBMA 2KWVB 1C3TA 1EUVB 1WI0A 2REXA 2HE7A 3KYCD 2MWSB 3PTFC 1WXSA 4BKTA 5JHBA 3HM3A 4DHJB 4YL8A 3UIPB 1KOTA 2KD0A 3C0RB 4TV3A 4W9DA 2D07B 3L16A 4BOZB 2JWZA 3QJZA 4AP4C 1YIWA 3QX1A 4JQWC 2M8SA 4HK2A 3ZDTA 3M3JA 3UIOB 1KLVA 3NS8A 5AZHA 2FNJB 2CU1A 2D11A 3MTNB 5KHQA 2NPTB 2I1KA 2LVQA 3UF8A 3X23A 3SD5A 1WMHB 2LVPA 4TUUA 2K8CA 3QA8A 2KTRB 4IM2A 2WX0A 5BO4B 3A9JB 4X57B 2WX1A 3D32A 4IWOA 2KLGA 4WWNA 2DX5B 2AYOB 2JZZA 2KANA 1NBFC 2MQJA 2XEWA 1P0RA 3DVGY 3S2AA 2KNBA 4WAAA 1BT0A 3PVLA 4NQLB 3UQBA 3GZNI 2G4DB 2DYMA 3H7SA 1WE7A 4FN2A 4M0WB 1GC7A 2LJ5A 1AARA 3L13A 3SDLC 1GG3A 3TMPB 3DVGX 3R3MA 3VUWA 2C7HA 2N9XA 1E7UA 2ZCCA 3VAWA 3X0WA 4HXDA 3A4RA 2JRHA 4W9LA 2KLCA 1UGMA 3PS6A 2DHZA 1OEYA 3A9KB 4KIKB 2KKCA 2C9WB 2ZPNA 2IZVB 1UD7A 2AWTA 4WJPA 1OGWA 2FCMA 2Z59B 4NNJB 3MHSD 4PYZA 1WXMA 2KWUB 5IA7A 3PV1A 1YQBA 1T0YA 2L8JA 2ZJDA 4NAWA 2ZZPB 1E8WA 2KJHB 2KXJA 3K9OB 4WQOB 5E6PA 1R4MI 2JT4B 2V1YA 4GU2A 4DXAB 1TTNA 4K81A 4LDTB 1G6JA 2LXCA 4MDKE 3M63B 4FULA 3H9DA 3NY5A 1P98A 3KUDB 3NZSA 5CHFA 1UELA 2KX3A 3HIZA 3RD2A 1V5TA 4MJSA 1UH6A 2M0XA 4W9HA 3ZUNA 1Z2MA 3WAOA 3ZNZB 2BYFA 2JF5A 1YJ1A 3EECA 3PPAA 4G0NB 4FBJB 2IO2B 1WRDB 4W9IA 1H4RA 3QIJA 4DHZB 3H7PA 3JSVA 2IO3B 4BOSC 2NS5A 3W1SC 3A33B 1UBIA 4MH0E 3B08A 4LCDE 1C1YB 4II3B 3CMMB 4GXBA 1OQYA 2BF8B 3U7DA 3DBRI 3M62B 4HCPB 2V4LA 4ZRJA 2L76A 3TIXA 3SHQA 2ZVOA 5D2MB 2MX2A 3ZDMC 3V6CB 1E8ZA 2FIFA 1UBQA 3VUYA 3ZIMA 3GOEA 1XQQA 2HTHA 2M17A 2ZNVB 3EFUA 2HJ8A 3APCA 2FIDA 4G50A 5LXIB 4ANXA 4PS7A 3ML9A 3RZFA 3PREA 5DPSA 4A20A 2KO3A 2O6VA 4I6LB 4GDLB 4ZYNA 4GDKA 4ZRKA 3B1LX 4F7ZA 2KOXA 4I6NB 2C5LC 2KHWB 4BBNC 2J0KA 1RRBA 4JGHB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ANU A;  2KDB A;  3ALB A;  4BKG A;  4EKU A;  2CHZ A;  2JUO A;  4XC2 A;  3L08 A;  3KUZ A;  4ZRI A;  2LWP A;  3RZW C;  4E3C A;  3ZRF A;  4NY0 A;  1WJN A;  2KVR A;  2EMS A;  4ANV A;  4ICV A;  2BGF A;  4E71 A;  2L00 B;  3QK0 A;  1WR1 A;  1KM7 A;  2GBJ A;  2D10 A;  3TL5 A;  2NBV B;  4PS8 A;  3W1Y A;  1OTR B;  2A4Z A;  1WGD A;  2MLB A;  4NJ6 A;  4HPM B;  1J8C A;  3N30 A;  1F9J A;  2CHW A;  4KSK C;  4BVU C;  1Y8R C;  2ZVN A;  3ZKJ C;  3PHW B;  5G55 A;  1WGR A;  3VDZ A;  3L10 B;  4KDL B;  2IYD B;  3A1Q B;  2DZI A;  3R66 C;  4WJN A;  2O2V A;  3WA0 A;  3N32 A;  3APD A;  3OJ3 A;  2MA9 B;  2LRW A;  3DCG A;  3V60 A;  4GIV A;  1HE8 A;  2KFK A;  3OJ4 B;  1J0G A;  5D94 A;  4ZDV A;  5AZG A;  1WGH A;  4FHJ A;  2B3A A;  4J6I A;  3UIN B;  2FAZ A;  4DK5 A;  3B0A A;  4IWQ A;  1L7Y A;  3PRP B;  3QQ8 B;  1KJT A;  1Q1O A;  3O65 B;  3W1S A;  2PE6 B;  4BKS A;  4KZ0 A;  3V62 A;  3LJ3 A;  2DYB A;  3MJW A;  2PEA A;  3AU4 A;  2W9N A;  2J0M A;  2MRP A;  2G4S A;  2O6V D;  1S1Q B;  3KVF B;  2Z0D B;  4GGQ A;  4CYE A;  1V81 A;  1V2Y A;  2D3G A;  3JYU A;  2GMI C;  3R7R A;  4A3O A;  1E8Y A;  2BWF A;  3I3T B;  3QAR A;  4P7I A;  1RAX A;  1V80 A;  2DAF A;  2Z0E B;  4E74 A;  2NPT A;  2UYZ B;  3RUL A;  4EUT A;  2IBI B;  1EO6 A;  4RMA A;  5CTR C;  1L2N A;  2EKE C;  2MP2 A;  1V9J A;  3H1U A;  2KDE B;  4KZC A;  4FJV B;  1RFA A;  3DOW A;  2KMA A;  3VTV A;  3VVW B;  4DDG D;  2FCN A;  5JZE B;  4MGK E;  2GOW A;  1WJ4 A;  1WX8 A;  1SGH A;  1D3Z A;  1ZKH A;  2DZK A;  2Y5B B;  5CHV C;  5J2R A;  2OJR A;  3VFK A;  3VH3 B;  1Z5S B;  4GMV A;  2KDI A;  1Q0W B;  2ZNV C;  3VH4 B;  2N1W A;  4BFR A;  4HJK A;  1WM3 A;  2CR5 A;  4W9C A;  5E6N A;  2A5U A;  5D7G A;  1WXA A;  2ZEQ A;  4JIO U;  4K1R B;  2M4N A;  3CSF A;  2KQS A;  3IHP C;  3VTU A;  4KIK A;  4PS3 A;  4DHZ E;  1ZGU B;  2RPQ A;  4CHK A;  2IY1 B;  2KC2 A;  2RGF A;  5KHO A;  1TGZ B;  2JZ3 B;  2WDT B;  3VQI A;  4OVU A;  3ENE A;  4HDQ A;  4XZ4 A;  1WJU A;  3V61 A;  3H7P B;  4N9F 4;  4AWJ A;  5TR5 A;  3VXW A;  2L0F A;  3IG3 A;  3VTW A;  2KJR A;  3Q3J A;  4G3X B;  5CX3 A;  2LD9 A;  3ZRC A;  1WH3 A;  1WGG A;  4HVB A;  2AEH A;  1E90 A;  1XT9 B;  2C7M B;  2MSE D;  3PLU A;  2PJH A;  2C60 A;  3L54 A;  2DZJ A;  3PGE A;  4W9G A;  5LLI A;  3WAN A;  4DDI D;  2RD0 A;  1RLF A;  4KVG B;  3IVF A;  4II2 B;  2G45 B;  3ZLZ A;  4EOY A;  1J19 A;  2AL3 A;  3LDZ E;  4MM3 A;  1WZ0 A;  4CO7 A;  1YX5 B;  4TQ1 A;  1V49 A;  4IW0 A;  3OLM D;  3TBL D;  4AJY B;  4ANW A;  2KMC A;  2O6V B;  4MEM A;  3JW0 X;  1TZ1 A;  2L7R A;  5L83 A;  4BBN F;  2NR2 A;  1WYW B;  2N7D A;  2C7N B;  4IG7 B;  2MBE A;  1E7V A;  4FLH A;  1UZX B;  3PZD A;  5J18 A;  4EZL A;  4RM8 A;  3ONS A;  4GB9 A;  4HPL B;  1EF1 A;  4NPN A;  2D2Q A;  1WGY A;  3ZNH B;  2K6Q A;  3OAW A;  3DBS A;  3UQA A;  2XK5 A;  1V5O A;  2GBK A;  1WF9 A;  2DAJ A;  2J7Q B;  2N1V A;  2JXX A;  1NI2 A;  2KQ7 A;  2N9E B;  2L0T A;  3IBE A;  4WWO A;  3RCZ A;  3WIM A;  2JRI B;  1V6E A;  1WX9 A;  4GN1 A;  2DZM A;  3PHX B;  2BWE S;  4WJO A;  2MCN B;  3AUL A;  5E6O A;  3RT3 B;  1R4N I;  3TCA A;  2J0J A;  4FHK A;  2PPH A;  5LXH A;  4K7U A;  1M94 A;  5J17 A;  3H6N A;  2FUH B;  1WJ6 A;  2O2V B;  1GJZ A;  4GDL A;  2CKH B;  4AUQ C;  3ECI A;  2LGD A;  3IFW B;  2KFK B;  3WAM A;  3QC8 B;  3WAL A;  1K8R B;  4GSW A;  3TJP A;  2LXA A;  2K1F A;  1WX7 A;  2K8B A;  2MW5 A;  2EMT A;  4MEL A;  1VD2 A;  2KN5 A;  3A4S C;  3EHV A;  3L17 A;  4NJ7 A;  4MGZ E;  2NBW B;  2MBH A;  1E5W A;  1P3Q U;  4EEW A;  4EZJ A;  2YLM A;  2K8H A;  1LM8 B;  5JH5 C;  2LZ6 A;  2FCS A;  2GBR A;  2RSU A;  4M8M A;  2LRU A;  2LVO A;  3PRM B;  3ML8 A;  1LXD A;  3K9P B;  2BYE A;  4B95 A;  5L95 C;  4AOF A;  2L3Z A;  1ISN A;  1EF5 A;  1WR6 E;  1GNU A;  1V86 A;  4K7S A;  3R7Q A;  3PT2 B;  4I6P A;  2LI5 A;  4B9K A;  2MP2 B;  4HWI B;  3ZNG C;  3APF A;  3PLV A;  3A1Q A;  3BIN A;  4KDI C;  4B6W A;  5HKH A;  1WMH A;  3PRZ A;  1WFY A;  3VUX A;  1E8X A;  1IYF A;  1SE9 A;  2XBB C;  2HD5 B;  2KTR A;  2QHO A;  2ZPY A;  1MG8 A;  3A9J A;  4NAW B;  3Q3F A;  5C1Z A;  3U30 A;  1IP9 A;  4LJP B;  1LFD A;  1WIA A;  3HHM A;  4DWF A;  1U4A A;  4HCN B;  1I35 A;  2KDF B;  4RM9 A;  3NOB A;  2MBQ A;  3BY4 B;  4EFO A;  4FA6 A;  2BKF A;  2NVU I;  4FJZ A;  5DCN A;  5DPT A;  2LUE A;  2BYV E;  2KC1 A;  3HM6 X;  2KTF A;  1JRU A;  3HK0 A;  3KUC B;  3KYD D;  2K25 A;  3DBH I;  3T8M A;  4MGY E;  4F1S A;  5AZF A;  3QWZ B;  5DPR A;  1SIF A;  1TBE A;  4XX5 A;  3ZTD A;  1LQB A;  3DQV A;  5FR6 A;  4MJS B;  3AI5 A;  5CHW A;  4K7W A;  4M8N A;  1WE6 A;  1CMX B;  3A9K A;  4MSM B;  1Q5W B;  1YD8 U;  1VCB A;  1YX6 B;  2RR9 A;  5C23 A;  4BKS D;  4MSQ B;  4DHJ D;  4KV2 A;  3JSV B;  2L05 A;  1S3S G;  4OVV A;  4IM0 A;  4FJY A;  4A3P A;  1FXT B;  1PQS A;  2JPH A;  1XD3 B;  3NZU A;  2N9P C;  2CHX A;  2KZR A;  2V3S A;  3V6E B;  2LAS A;  4URK A;  3RUI B;  2CS4 A;  2N4F A;  2MBO A;  2UWQ A;  2LGY A;  3AXC A;  4G11 A;  3L0W B;  4GOC A;  3PSE B;  3ZW3 A;  4JLC A;  2N7E A;  5G2N A;  1H8C A;  2ASQ A;  1X1M A;  4TKN A;  3ZVV A;  2KK8 A;  1WXV A;  3ZNI D;  3UGB B;  3JVZ X;  2R2Q A;  4W9J A;  5IAA C;  2I1J A;  4HLE A;  2GBN A;  3DBL I;  2R2O A;  2G3Q B;  1A5R A;  2WWZ A;  2NBU A;  4W9E A;  1P1A A;  2OOB B;  2BPS A;  4GDK B;  4WJQ A;  3VHT C;  1GUA B;  4ICU A;  4TQ0 A;  2IO0 B;  1IPG A;  2VRR B;  1NDD A;  4AJW A;  4DBG A;  3N3K B;  1QZE A;  3ZO5 B;  1WY8 A;  4FAD A;  4PYU A;  2PE9 A;  2XK5 B;  2ZCB A;  4W9K A;  3EC8 A;  1WM2 A;  3AU5 A;  3DDC B;  2IO1 B;  3KW5 B;  2KWC A;  3T9L A;  1I42 A;  3SU8 X;  3P2B A;  4IWP A;  4JL9 A;  4KSL C;  3CF6 E;  3RYT A;  1WZ3 A;  3DVN U;  2DEN B;  2YVC A;  2K6D B;  2FCQ A;  2KX0 A;  4LJO B;  5GMV A;  5DPW A;  1GC6 A;  1ZW7 A;  4IC7 B;  4EZK A;  4ASW C;  2WYQ A;  3QAQ A;  3ZTC A;  5JHA A;  2KJ6 A;  4F8C B;  5EDS A;  1P9D U;  5AEK B;  2JY6 A;  4HDO A;  2LGX A;  4NQK E;  4IUM B;  4W9F A;  3DPD A;  3QHT A;  2AL6 A;  2DYO A;  2NCN A;  4IM3 A;  1OEY J;  3QCA A;  4WWP A;  2IY0 B;  2MBB B;  3KH0 A;  3NHE B;  4MGI E;  2M1M A;  3CST A;  2K39 A;  3DVN V;  3U8Z A;  2JVC A;  3WAP A;  2BKR B;  2KFJ A;  4LDT D;  3M95 A;  5D6J B;  2GBM A;  2KWV B;  1C3T A;  1EUV B;  1WI0 A;  2REX A;  2HE7 A;  3KYC D;  2MWS B;  3PTF C;  1WXS A;  4BKT A;  5JHB A;  3HM3 A;  4DHJ B;  4YL8 A;  3UIP B;  1KOT A;  2KD0 A;  3C0R B;  4TV3 A;  4W9D A;  2D07 B;  3L16 A;  4BOZ B;  2JWZ A;  3QJZ A;  4AP4 C;  1YIW A;  3QX1 A;  4JQW C;  2M8S A;  4HK2 A;  3ZDT A;  3M3J A;  3UIO B;  1KLV A;  3NS8 A;  5AZH A;  2FNJ B;  2CU1 A;  2D11 A;  3MTN B;  5KHQ A;  2NPT B;  2I1K A;  2LVQ A;  3UF8 A;  3X23 A;  3SD5 A;  1WMH B;  2LVP A;  4TUU A;  2K8C A;  3QA8 A;  2KTR B;  4IM2 A;  2WX0 A;  5BO4 B;  3A9J B;  4X57 B;  2WX1 A;  3D32 A;  4IWO A;  2KLG A;  4WWN A;  2DX5 B;  2AYO B;  2JZZ A;  2KAN A;  1NBF C;  2MQJ A;  2XEW A;  1P0R A;  3DVG Y;  3S2A A;  2KNB A;  4WAA A;  1BT0 A;  3PVL A;  4NQL B;  3UQB A;  3GZN I;  2G4D B;  2DYM A;  3H7S A;  1WE7 A;  4FN2 A;  4M0W B;  1GC7 A;  2LJ5 A;  1AAR A;  3L13 A;  3SDL C;  1GG3 A;  3TMP B;  3DVG X;  3R3M A;  3VUW A;  2C7H A;  2N9X A;  1E7U A;  2ZCC A;  3VAW A;  3X0W A;  4HXD A;  3A4R A;  2JRH A;  4W9L A;  2KLC A;  1UGM A;  3PS6 A;  2DHZ A;  1OEY A;  3A9K B;  4KIK B;  2KKC A;  2C9W B;  2ZPN A;  2IZV B;  1UD7 A;  2AWT A;  4WJP A;  1OGW A;  2FCM A;  2Z59 B;  4NNJ B;  3MHS D;  4PYZ A;  1WXM A;  2KWU B;  5IA7 A;  3PV1 A;  1YQB A;  1T0Y A;  2L8J A;  2ZJD A;  4NAW A;  2ZZP B;  1E8W A;  2KJH B;  2KXJ A;  3K9O B;  4WQO B;  5E6P A;  1R4M I;  2JT4 B;  2V1Y A;  4GU2 A;  4DXA B;  1TTN A;  4K81 A;  4LDT B;  1G6J A;  2LXC A;  4MDK E;  3M63 B;  4FUL A;  3H9D A;  3NY5 A;  1P98 A;  3KUD B;  3NZS A;  5CHF A;  1UEL A;  2KX3 A;  3HIZ A;  3RD2 A;  1V5T A;  4MJS A;  1UH6 A;  2M0X A;  4W9H A;  3ZUN A;  1Z2M A;  3WAO A;  3ZNZ B;  2BYF A;  2JF5 A;  1YJ1 A;  3EEC A;  3PPA A;  4G0N B;  4FBJ B;  2IO2 B;  1WRD B;  4W9I A;  1H4R A;  3QIJ A;  4DHZ B;  3H7P A;  3JSV A;  2IO3 B;  4BOS C;  2NS5 A;  3W1S C;  3A33 B;  1UBI A;  4MH0 E;  3B08 A;  4LCD E;  1C1Y B;  4II3 B;  3CMM B;  4GXB A;  1OQY A;  2BF8 B;  3U7D A;  3DBR I;  3M62 B;  4HCP B;  2V4L A;  4ZRJ A;  2L76 A;  3TIX A;  3SHQ A;  2ZVO A;  5D2M B;  2MX2 A;  3ZDM C;  3V6C B;  1E8Z A;  2FIF A;  1UBQ A;  3VUY A;  3ZIM A;  3GOE A;  1XQQ A;  2HTH A;  2M17 A;  2ZNV B;  3EFU A;  2HJ8 A;  3APC A;  2FID A;  4G50 A;  5LXI B;  4ANX A;  4PS7 A;  3ML9 A;  3RZF A;  3PRE A;  5DPS A;  4A20 A;  2KO3 A;  2O6V A;  4I6L B;  4GDL B;  4ZYN A;  4GDK A;  4ZRK A;  3B1L X;  4F7Z A;  2KOX A;  4I6N B;  2C5L C;  2KHW B;  4BBN C;  2J0K A;  1RRB A;  4JGH B; 
#chains in the Genus database with same CATH topology
 4ANU A;  2YEP F;  3U2S C;  2CHZ A;  4XC2 A;  3B2G A;  3RZW C;  2EMS A;  4ANV A;  4ICV A;  1D6E C;  2GBJ A;  3AH7 A;  1BUI C;  3AE9 B;  2A4Z A;  4NJ6 A;  1J8C A;  2CHW A;  4BVU C;  2ZVN A;  3EGR A;  1C78 A;  1TYG B;  3FAH A;  5D94 A;  5AZG A;  2J53 A;  3RMK C;  3U4E G;  1KJT A;  1Q1O A;  3O65 B;  3W1S A;  4KZ0 A;  3MJW A;  1R7S A;  1WGK A;  2MRP A;  4CYE A;  1V81 A;  1SF0 A;  2D3G A;  3BII D;  2GMI C;  1E8Y A;  3I3T B;  3FIL A;  1QOG A;  1EWC A;  3IXS A;  3DBL B;  1TS2 A;  3RI7 C;  2GB1 A;  3DOW A;  3VVW B;  4H2A A;  1AWD A;  3FC4 A;  4MGK E;  1SGH A;  2KAC A;  2V0G A;  1ZKH A;  3DBR B;  4D2K A;  4XYC A;  1PGA A;  5CHV C;  2ZNV C;  2W82 A;  4LNI A;  3VH4 B;  2W3S A;  5E6N A;  5D7G A;  3SR6 A;  1WXA A;  2ZEQ A;  1IGD A;  1F2R C;  2RPQ A;  2KC2 A;  5KHO A;  2WXO A;  3VQI A;  1WJU A;  1MI0 A;  4AWJ A;  5TR5 A;  2KJR A;  3BZD B;  1SEB D;  2INN E;  3L54 A;  4M00 A;  3OWE B;  2WDV B;  2LMC A;  4DDI D;  2K5P A;  1RLF A;  4II2 B;  2G45 B;  3ZLZ A;  1J19 A;  4RFB A;  1YN4 A;  2AX5 A;  4USA A;  2NTS A;  4IW0 A;  3OLM D;  4ANW A;  2O6V B;  3JW0 X;  1TZ1 A;  2L7R A;  5L83 A;  1N63 A;  1T6B X;  1JWS D;  4FLH A;  1YN3 A;  3ONS A;  4GB9 A;  3KQ4 A;  1C76 A;  3DBS A;  3UQA A;  1V5O A;  3ZQ4 A;  1E0Z A;  2KN4 A;  3ABV B;  3PHX B;  3AE3 B;  1IBX A;  2MCN B;  1I4H A;  2JZP A;  2J0J A;  4FHK A;  2PPH A;  2ICI A;  2LFI A;  5LXH A;  4K7U A;  5J17 A;  3H6N A;  2FUH B;  2CKH B;  5GXG B;  2LGD A;  5BMI A;  2KFK B;  3WAM A;  2K9X A;  2LXA A;  1WX7 A;  4OZC A;  3EHV A;  2KN5 A;  4MGZ E;  1E5W A;  1P3Q U;  3RNF C;  2LZ6 A;  3ML8 A;  3K9P B;  3Q8E A;  3V3X A;  4B95 A;  4N59 A;  3J9C A;  1ACC A;  1L0Y B;  1GNU A;  5G5H A;  4WAF A;  2LI5 A;  2MP2 B;  4HWI B;  3APF A;  4KDI C;  1WMH A;  3AEG B;  1JML A;  3TEX A;  2XBB C;  1KLU D;  2QHO A;  3A9J A;  4NAW B;  2DNF A;  4WUR A;  1LFD A;  2KDF B;  4FA6 A;  2L52 A;  2NVU I;  4FJZ A;  2LEK A;  1M4V A;  3HK0 A;  4YTP B;  4MGY E;  5DPR A;  2YEP B;  1TBE A;  2N7J A;  4XX5 A;  5FR6 A;  2CJO A;  3HUI A;  4KGS A;  4K7W A;  1FIQ A;  1CMX B;  2DWQ A;  2GRI A;  1YX6 B;  5C23 A;  4BKS D;  4MSQ B;  3IAS 1;  1V1P A;  4FJY A;  1FXT B;  1PQS A;  4URK A;  3V6E B;  3UQB A;  2N4F A;  3AXC A;  5BMH A;  5BYR A;  1H8C A;  2KQ4 X;  1X1M A;  2IDY A;  2KK8 A;  2D3C A;  4US9 A;  5BYQ A;  3ZNI D;  5C3J B;  3UGB B;  2R2Q A;  2WXM A;  5IAA C;  2PLP A;  4W9E A;  2OOB B;  2IO0 B;  2J52 A;  2VRR B;  5AUK A;  3N3K B;  3NZ3 A;  3R2T A;  4PYU A;  3AU5 A;  2IO1 B;  4IWP A;  4KSL C;  1NYR A;  1I4X A;  2FCQ A;  5GMV A;  5DPW A;  3QAQ A;  5JHA A;  3TSS A;  2LGX A;  2W54 A;  3DHH C;  3N9Y C;  3DPD A;  2AL6 A;  3N1Z C;  3SFE B;  1QLB B;  2K39 A;  2BS4 B;  3DVN V;  3AB5 A;  4ITK A;  3MHZ A;  3M95 A;  4HEA 1;  4KKI A;  3TUO A;  1F77 A;  1K51 A;  2WXJ A;  4JWU C;  1YOV B;  4P1C C;  5HI1 A;  4YL8 A;  2CJN A;  4TV3 A;  1VZ6 A;  2D07 B;  3L16 A;  2JWZ A;  4AP4 C;  1E7P B;  2M8S A;  1C9F A;  3M3J A;  5AZH A;  1HTQ A;  1FNU A;  2DBY A;  1JWM D;  3QA8 A;  4MT5 A;  4IM2 A;  1ZDX A;  4X57 B;  2QJL A;  2JZZ A;  2ACZ B;  2AYO B;  1YJI A;  2KNB A;  1QT9 A;  1BT0 A;  4LK0 M;  2WXQ A;  2OED A;  3L13 A;  2MH7 A;  3DWG C;  3SDL C;  2LJI A;  2ZCC A;  3PZ8 A;  3A4R A;  2KLC A;  1UGM A;  1JAL A;  1OEY A;  3BVZ A;  2C9W B;  3BWU D;  1N5X A;  3RNC C;  1C4A A;  4NNJ B;  4PK1 A;  1VZ7 A;  2SEB D;  1WXM A;  2KWU B;  1T0Y A;  2L8J A;  3AV8 A;  1E8W A;  3Q69 A;  4BAX A;  3K9O B;  4NJC A;  1V97 A;  4GU2 A;  3Q8A A;  4WIP A;  3NJT A;  3NVV A;  3M63 B;  1WWT A;  3NVZ A;  3KUD B;  1NYQ A;  5EE1 A;  3NZS A;  5CHF A;  3P63 A;  4MJS A;  1Z2M A;  2Z8L A;  1R4N B;  2JF5 A;  3EEC A;  4G0N B;  3PPA A;  3QIJ A;  1VZ8 A;  2LHD A;  1FFV A;  1C1Y B;  4II3 B;  2BF8 B;  3GE3 C;  3U7D A;  2SAK A;  3Q3O C;  3M62 B;  4HCP B;  3KLS X;  3TIX A;  2ZW1 A;  4L2Y A;  4P6V F;  1P7F A;  1IBX B;  3V6C B;  2WHI A;  2FIF A;  4K3C A;  3ZIM A;  1V1O A;  1VJK A;  2ZNV B;  3APC A;  4G50 A;  1C4P A;  3AMZ A;  4ANX A;  1VDV A;  3PRE A;  2KO3 A;  2O6V A;  4ZYN A;  4GDK A;  4ZRK A;  2HDE A;  3BVG A;  2KMM A;  4F7Z A;  2C5L C;  1MVK A;  1XEE A;  2KDB A;  3ALB A;  1CQV A;  4BKG A;  4LNN A;  1JWA D;  3KUZ A;  4ZRI A;  4E3C A;  2WS3 B;  2BGF A;  4E71 A;  3QK0 A;  1WR1 A;  1KM7 A;  1FO4 A;  3GP7 A;  3TL5 A;  2AQ1 B;  3URY A;  4YSZ B;  1WGD A;  1ZPS A;  3Q8B A;  3N30 A;  1F9J A;  1LGR A;  1D5Z C;  5G55 A;  1WGR A;  2QMT A;  1D4B A;  2XN9 C;  2DZI A;  3WA0 A;  3DCG A;  4ARC A;  4HRO A;  4M01 A;  4GIV A;  1UWM A;  2KFK A;  4ZDV A;  2M0A A;  4J6I A;  5FK9 C;  3UIN B;  4DK5 A;  3PRP B;  3AN1 A;  1P7E A;  3V62 A;  4RGM A;  2JQR B;  2PEA A;  2W9N A;  1QKZ A;  2J0M A;  2G4S A;  2O6V D;  1S1Q B;  1TY0 A;  3Q2A C;  5EE0 A;  3JYU A;  3R7R A;  4A3O A;  4KKJ A;  2BWF A;  3GE8 C;  1XLP A;  2JWU A;  2RDG A;  4ZOH C;  1RAX A;  1V80 A;  3RUL A;  4RMA A;  5CTR C;  2MP2 A;  1SSN A;  1V9J A;  3H1U A;  2KDE B;  1TT5 B;  4FJV B;  1RFA A;  1RFK A;  3U52 E;  2FCN A;  5JZE B;  2GOW A;  1QF6 A;  3RPF C;  2Y5B B;  4GMV A;  2KDI A;  1Q0W B;  4KX6 B;  3RFZ B;  2J42 A;  4HJK A;  4W9C A;  2A5U A;  5IOI A;  4K1R B;  4JIO U;  3IHP C;  4PS3 A;  1ZGU B;  2XNA C;  5HHD G;  2RGF A;  2JX5 A;  4HDQ A;  3V61 A;  3H7P B;  4N9F 4;  3VXW A;  2L0F A;  3IG3 A;  3VTW A;  1ESF A;  1UWX A;  4RGO S;  4OVZ A;  3BVM A;  4HVB A;  2I2Y A;  2AEH A;  2MSE D;  1MFW A;  5LLI A;  3WAN A;  1I4G A;  1XCQ L;  1FCL A;  4KVG B;  4OHJ A;  4EOY A;  1SXT A;  1K52 A;  1YX5 B;  3H8H A;  2BB5 A;  4AJY B;  4RGN A;  1MHH E;  4FXC A;  1PFD A;  2WDR B;  2MBE A;  1E7V A;  1UZX B;  4TMA B;  4HPL B;  3ZNH B;  3OAW A;  5T8I A;  4OW0 A;  2GBK A;  4ACF A;  2DAJ A;  3TBL D;  3IBE A;  3CIR B;  2L0T A;  3RCZ A;  3WIM A;  4BZA A;  4GN1 A;  4WJO A;  4YWG G;  3AUL A;  1AW7 A;  3TCA A;  1F1H A;  1WJ6 A;  4GDL A;  4AUQ C;  1YJJ A;  3WAL A;  4GSW A;  3I57 A;  2EMT A;  4MEL A;  3A4S C;  3Q8F A;  2NBW B;  4EEW A;  2N9K A;  4C7Y A;  2WGS A;  2YLM A;  3AM9 A;  2K8H A;  3C19 A;  1R4M B;  5JH5 C;  2FCS A;  1E6E B;  2LVO A;  3PRM B;  2LGI A;  1LXD A;  2RDH A;  1EF5 A;  1WR6 E;  1PGX A;  4K7S A;  1XXG A;  4I6P A;  3ZNG C;  5MPO A;  3PLV A;  3BIN A;  3IT6 B;  2PIA A;  3LB8 C;  3U30 A;  1QOF A;  2L1A A;  4DWF A;  3L4P A;  2MBQ A;  4EFO A;  1L5P A;  3HM6 X;  1JRU A;  3KUC B;  3T8M A;  1GB4 A;  5AZF A;  1SIF A;  4L23 A;  1WXQ A;  4MJS B;  5CHW A;  2VZK B;  1Q5W B;  3HVZ A;  4MH8 A;  1EWY C;  4KV2 A;  4A3P A;  1GPX A;  2JPH A;  1RWS A;  2N9P C;  2V3S A;  2LAS A;  2JSV X;  4GOC A;  2MBO A;  4G11 A;  3ZW3 A;  4JLC A;  2QDF A;  4ZRP A;  4XWW A;  4W9J A;  4HLE A;  5AUI A;  5D3I B;  2WWZ A;  2NBU A;  1ZE3 D;  1P1A A;  2BPS A;  4GDK B;  4IKG A;  4AJW A;  4DBG A;  1QZE A;  1ZDV A;  3E9S A;  4JWS C;  2PE9 A;  2XK5 B;  2ZCB A;  2GLS A;  2WXH A;  3KW5 B;  2KWC A;  2PKO A;  3SU8 X;  4JL9 A;  3CF6 E;  1WZ3 A;  3RN9 C;  2DEN B;  2YVC A;  3ZGZ A;  1E9M A;  2KYW A;  2QSD A;  4IC7 B;  2Y5P A;  2NMQ A;  2PVG C;  4ASW C;  3U7Z A;  5EDS A;  4W9F A;  1OQR A;  2DYO A;  1HTO A;  3P1M A;  2BW2 A;  1TY2 A;  2IGH A;  2IY0 B;  3KH0 A;  2WXF A;  2BTE A;  2M1M A;  1FEH A;  3WAP A;  2M19 A;  1IUE A;  2GBM A;  2KWV B;  1EUV B;  4WWM A;  2HE7 A;  1WXS A;  4BKT A;  3HM3 A;  4C00 A;  1VRA B;  2WU5 B;  3AED B;  1KOT A;  2KD0 A;  4W9D A;  3QJZ A;  3ZDT A;  4RH6 A;  5IO9 A;  1FFU A;  3NS8 A;  2OJW A;  2CU1 A;  1L4Z B;  2H89 B;  3X23 A;  3SD5 A;  2LVP A;  4TUU A;  2K8C A;  2WX0 A;  2KVZ A;  2KLG A;  4WWN A;  2KAN A;  1NVI D;  2MQJ A;  4RF0 A;  3DVG Y;  3R8B A;  1DOY A;  2GI9 A;  4JPS A;  4XDD A;  3GZN I;  3VR9 B;  2DYM A;  3HRD D;  3I9V 1;  3RNG C;  4FN2 A;  4EE2 A;  2LJ5 A;  2LUM A;  4MAC A;  2VH2 A;  2H88 B;  1DOX A;  3PZ7 A;  1FRR A;  3X0W A;  2QCZ A;  2JRH A;  1TKY A;  3PS6 A;  2KKC A;  2PTL A;  2ZPN A;  1OGW A;  5IA7 A;  3PV1 A;  1YQB A;  3NVY A;  1TS3 A;  1V8C A;  2ZJD A;  1F52 A;  2KXJ A;  4YSY B;  4WQO B;  4DXA B;  2RDB C;  1G6J A;  2LXC A;  1RM6 C;  3NY5 A;  3O13 A;  1P98 A;  2VH1 A;  1TKE A;  4YXD B;  1YNT E;  1UH6 A;  2M0X A;  3ZUN A;  3WAO A;  2KWD A;  2G1E A;  2IO2 B;  4W9I A;  1PDX A;  3H7P A;  3JSV A;  2IO3 B;  4BOS C;  2NS5 A;  4MH0 E;  3B08 A;  5C2T B;  4IOI E;  4LCD E;  3CMM B;  4GXB A;  1ET9 A;  2W55 A;  1MHX A;  2MJE A;  4ZRJ A;  1FRD A;  3ZJV A;  3SHQ A;  2ZVO A;  4C7Z A;  1TZO A;  3VRB B;  3ETR A;  1E8Z A;  3GOE A;  2M17 A;  4YSX B;  2HJ8 A;  2FID A;  5LXI B;  2FBW B;  4PS7 A;  3RZF A;  5DPS A;  4A20 A;  4I6L B;  4GDL B;  3T3O A;  4IDI A;  3B1L X;  2BYT A;  5LNK 1;  2V3P A;  1RRB A;  5G5G A;  4EKU A;  1JCK B;  2INP E;  2Q5W D;  2L32 A;  4NY0 A;  1WJN A;  4YT0 B;  3LYY A;  3BK1 A;  4PS8 A;  1OTR B;  2MLB A;  4HPM B;  1Y8R C;  1QQR A;  3PHW B;  2X8X X;  3C8Y A;  4KDL B;  2IYD B;  3R66 C;  4WJN A;  3N32 A;  3OJ3 A;  2MA9 B;  2LRW A;  3V60 A;  1HE8 A;  3OJ4 B;  2ZW0 A;  1J0G A;  4FHJ A;  2B3A A;  2FAZ A;  1EM7 A;  4IWQ A;  1L7Y A;  2PE6 B;  1XLO A;  2I38 A;  4ZRQ A;  1UF0 A;  3P4R B;  4GGQ A;  4LNO A;  2Z0D B;  1I4R A;  1V2Y A;  5HG2 A;  4P7I A;  1B1Z A;  1FM0 D;  1AYF A;  2DAF A;  2Z0E B;  2WXL A;  3ZXR A;  4E74 A;  1EO6 A;  1PYW D;  2EKE C;  4XWT A;  3P42 A;  1QOA A;  4KZC A;  3GS2 A;  3NS1 A;  4OZA A;  4TSS A;  1XLN A;  3VTV A;  4DDG D;  3AEE B;  4P16 A;  3Q8C A;  2PMV A;  1WX8 A;  1YMH E;  1D3Z A;  2DZK A;  4N6E B;  3Q6B A;  2OJR A;  3VFK A;  1L0V B;  1Z5S B;  4HJG E;  1FPY A;  4A8X C;  4BFR A;  1WM3 A;  2CR5 A;  2BT6 A;  2DLB A;  2M4N A;  3CSF A;  1FMA D;  3VTU A;  2WP9 B;  3IAM 1;  2WXI A;  3B9J A;  2IY1 B;  1TGZ B;  2JZ3 B;  2E3T A;  4XZ4 A;  1L6V A;  1J7C A;  3Q3J A;  3ZRC A;  2LD9 A;  4N58 A;  1WGG A;  2C60 A;  1SE2 A;  2AL3 A;  1ZXH A;  3LDZ E;  4CO7 A;  1WZ0 A;  2NTT A;  4P1B C;  2KMC A;  4MEM A;  2L83 A;  3AE4 B;  1CZP A;  4NPN A;  2K6Q A;  2XK5 A;  2TSS A;  4RGT A;  1N6Z A;  1WF9 A;  2J7Q B;  2N1V A;  2JXX A;  3NRZ A;  2KQ7 A;  2N9E B;  4WWO A;  4C4V A;  3NVW A;  1VR9 A;  1WX9 A;  2DZM A;  1MPE A;  5E6O A;  3RT3 B;  3GB1 A;  1HXY D;  2O2V B;  1GJZ A;  5FR3 A;  3SFD B;  1TS4 A;  3BYT B;  1K50 A;  1EU4 A;  2N0S B;  3QC8 B;  2EEL A;  1TJE A;  3TJP A;  2K1F A;  2K8B A;  2MEK A;  1VD2 A;  3L17 A;  4EZJ A;  2MBH A;  1BML C;  2AQ3 B;  4DXG A;  4M8M A;  2BYE A;  1D5X C;  4AOF A;  2L3Z A;  4J3O D;  1V86 A;  4LTU A;  3R7Q A;  4B9K A;  2BS2 B;  1DGJ A;  3A1Q A;  2WXR A;  4B6W A;  3P4P B;  3PRZ A;  1WFY A;  3VUX A;  3BK2 A;  1SE9 A;  2HD5 B;  1MG8 A;  1RYJ A;  2QIE B;  5C1Z A;  1IP9 A;  4LJP B;  1JQ4 A;  3HHM A;  2WLB A;  1I35 A;  3NOB A;  1BXT A;  5DPT A;  2BYV E;  2KC1 A;  3N20 C;  2KTF A;  2QIL A;  3W2D A;  5EE9 A;  3QWZ B;  1LQB A;  1WYG A;  3DQV A;  3AI5 A;  1SB3 C;  2D3A A;  1XLQ A;  4M02 A;  4MSM B;  3P4S B;  2RR9 A;  1KTK A;  3ZYY X;  1STE A;  3JSV B;  2L05 A;  4XGA B;  4R3D A;  4OVV A;  3AE6 B;  1KLG D;  2OHF A;  2CHX A;  2KZR A;  2CS4 A;  3L0W B;  5G2N A;  3SEB A;  1CJE A;  4S17 A;  1NEN B;  4TKN A;  4ARI A;  1WXV A;  4A9A A;  1SBB B;  4UDU C;  2ON8 A;  2GBN A;  3DBL I;  2ONQ A;  4XE0 A;  3EUB 2;  1TKG A;  3VHT C;  1GUA B;  4ICU A;  1T0S C;  3EA6 A;  1WY8 A;  4FAD A;  3OG5 A;  4NAM A;  2D3B A;  1I42 A;  3T9L A;  4JX1 C;  2M56 B;  3RYT A;  1JWB D;  1HA5 A;  4LJO B;  1LO5 D;  3DHI C;  1GC6 A;  1ZW7 A;  2V9H A;  2RMM A;  3ZTC A;  5JXV A;  1I4P A;  1P9D U;  2JY6 A;  4HDO A;  3BYY B;  2N9L A;  2NCN A;  4WWP A;  2MBB B;  1NI3 A;  1FCC C;  1SJH D;  4HKQ A;  2JVC A;  1J7A A;  1C3T A;  2MHJ A;  4US8 A;  1WI0 A;  1ZUD 2;  4KGT A;  3PTF C;  3KYC D;  2REX A;  5JHB A;  1GAQ B;  1JRO A;  4DHJ B;  2WDQ B;  3UIP B;  1YQ3 B;  4CQN A;  3DWM A;  4BOZ B;  1YIW A;  3QX1 A;  4WH4 A;  4JQW C;  4HK2 A;  1FNV A;  2PVO D;  3N1Y C;  4B0M A;  3R2I A;  2KTR B;  2WX1 A;  3D32 A;  3HVD A;  4IWO A;  3VAW A;  1Q10 A;  3TEZ A;  1NBF C;  2WXG A;  1ZXI A;  4NQL B;  2G4D B;  1WE7 A;  4M0W B;  1T3Q A;  1AAR A;  4JE3 B;  3TMP B;  3VUW A;  2N9X A;  1E7U A;  2CU3 A;  4HXD A;  4W9L A;  4GLS C;  4LNK A;  2DHZ A;  4Q2J A;  3A9K B;  4WQM A;  2IZV B;  2PW9 A;  4KGR A;  1F0Z A;  2Y3A A;  2ZZP B;  1UGJ A;  2V1Y A;  2IJ0 A;  1TTN A;  4K81 A;  4LDT B;  4MDK E;  3H9D A;  1XO3 A;  3PO0 A;  2KX3 A;  3HIZ A;  4PT5 A;  3RD2 A;  3ZNZ B;  1TIF A;  2BYF A;  1WRD B;  5H92 C;  3A33 B;  1OQY A;  2QEJ C;  2V4L A;  2L76 A;  4LNF A;  3TEY A;  3ZJT A;  4C4V B;  2MX2 A;  3ZDM C;  3VUY A;  1UBQ A;  2LHE A;  1XQQ A;  3EFU A;  1N60 A;  5HFY A;  4I6N B;  4BBN C;  2J0K A;  4RCO A;  2JUO A;  4K3B A;  3L08 A;  2LWP A;  3ZRF A;  1GB1 A;  2KVR A;  1N5W A;  1WRI A;  5EE3 A;  2JYE A;  2L00 B;  2BS3 B;  2D10 A;  1K53 A;  1I7H A;  2NBV B;  3W1Y A;  3RNA C;  4KSK C;  1L6U A;  3ZKJ C;  3VDZ A;  3L10 B;  3A1Q B;  2O2V A;  3APD A;  2W3R A;  1PGB A;  1WGH A;  3AE7 B;  3CWI A;  3B0A A;  2FE8 A;  2V4I B;  3QQ8 B;  3AEA B;  4BKS A;  3LJ3 A;  2DYB A;  4HPP A;  3AU4 A;  3B2F A;  3KVF B;  5E6J A;  1E10 A;  2G9H D;  3QAR A;  4A55 A;  2NPT A;  2UYZ B;  1QIL A;  4EUT A;  2IBI B;  1L2N A;  1T0R C;  4XDC A;  4REZ A;  4LLG M;  2KMA A;  5FKA C;  1WJ4 A;  1SJE D;  4C80 A;  5J2R A;  3AEF B;  4ZHP A;  3VH3 B;  1YQ4 B;  5IP4 D;  1FD6 A;  1HEZ E;  2N1W A;  3V05 A;  1MG4 A;  1Y56 A;  3MFG A;  2KQS A;  1ROE A;  4KIK A;  2INC C;  4DHZ E;  4CHK A;  1ZP0 B;  2WDT B;  4A90 A;  4OVU A;  3ENE A;  1JW9 D;  5IN7 A;  1QOB A;  3T3N A;  4AQ7 A;  4AS1 A;  1N62 A;  4G3X B;  5CX3 A;  1WH3 A;  1KH0 A;  3PLU A;  1E90 A;  1XT9 B;  2C7M B;  2PJH A;  2DZJ A;  3PGE A;  2RPV A;  4W9G A;  1FNW A;  2WXN A;  2RD0 A;  3IVF A;  4MM3 A;  4TQ1 A;  1V49 A;  2JYT A;  4RF1 A;  4QAY A;  4BBN F;  1YN5 A;  2NR2 A;  1WYW B;  2N7D A;  2BB6 A;  2C7N B;  4IG7 B;  3PZD A;  5J18 A;  4EZL A;  4RM8 A;  2HTM E;  1EF1 A;  3MC0 B;  2D2Q A;  1WGY A;  3IT4 B;  1ZOY B;  3VR8 B;  2FUG 1;  1NI2 A;  4ZHO A;  3KWL A;  2JRI B;  3GZN B;  3W5V B;  1V6E A;  3AEC B;  1FXA A;  2BWE S;  2WQY B;  2V3N A;  1DYQ A;  1R4N I;  1JWU D;  1B9R A;  1M94 A;  3ECI A;  2QC8 A;  1WSP A;  3IFW B;  2K0P A;  4RNA A;  1K8R B;  2MW5 A;  4NJ7 A;  3LXF A;  1UNS A;  3EFC A;  1JRP A;  1LM8 B;  2RSU A;  2GBR A;  2LRU A;  5L95 C;  3FIL B;  2BVC A;  1ISN A;  3Q3N C;  3W5U B;  2J4X A;  4O1N A;  3PT2 B;  3TEW A;  1T0Q C;  5HKH A;  3FKY A;  2R61 A;  1IGC A;  1F2R I;  1E8X A;  1IYF A;  1C4C A;  2K3U A;  2KTR A;  3DHG C;  2ZPY A;  1T5X D;  3Q3F A;  1OQQ A;  1WIA A;  1U4A A;  4HCN B;  4RM9 A;  3BY4 B;  3NUH B;  2BKF A;  5DCN A;  2LUE A;  4OZB A;  4NZL B;  4M0W A;  3KYD D;  2K25 A;  3DBH I;  1ENF A;  1L4D B;  4F1S A;  3ZTD A;  3MC8 A;  1SE3 A;  4M8N A;  3MJ5 A;  1WE6 A;  5BMG A;  3A9K A;  2IGD A;  1YD8 U;  1VCB A;  4DHJ D;  4YTM B;  1S3S G;  4S0R A;  4IM0 A;  2WU2 B;  1D5M C;  5I4D A;  1KF6 B;  1NEK B;  1XD3 B;  3NZU A;  3AE8 B;  3RUI B;  3MC9 A;  2UWQ A;  2LGY A;  2WXP A;  2BBC A;  3PSE B;  1ET6 A;  2N7E A;  2ASQ A;  5D3D A;  2IPK D;  3WCQ A;  3ZVV A;  1DOI A;  3JVZ X;  1MJD A;  2HJ1 A;  4HKZ E;  2I1J A;  2WNM A;  1L0X B;  3I5J C;  2R2O A;  2G3Q B;  1A5R A;  1EU3 A;  1OFF A;  3RNE C;  4WJQ A;  4TQ0 A;  1IPG A;  1NDD A;  1AN8 A;  3ZO5 B;  3MP9 A;  4DQO C;  4W9K A;  1J7B A;  3EC8 A;  1WM2 A;  3DDC B;  3P2B A;  1KFY B;  2EKI A;  3Q14 C;  3DVN U;  1I4Q A;  1HQR D;  2K6D B;  2KX0 A;  2KT7 A;  1FXI A;  2KAJ A;  2B76 B;  2WYQ A;  4EZK A;  2JU6 X;  2VZK D;  2KJ6 A;  4F8C B;  5AEK B;  4NQK E;  4IUM B;  3QHT A;  3E56 A;  4IM3 A;  1OEY J;  1XCT L;  3QCA A;  3ZXV A;  3NHE B;  4MGI E;  1KRH A;  3CST A;  3U8Z A;  2BKR B;  2KFJ A;  4LDT D;  2KDM A;  5D6J B;  3ZJU A;  2MWS B;  2Y5C A;  3C0R B;  3NG0 A;  3DBH B;  3UI3 A;  3AE5 B;  3W9C B;  1KLV A;  3UIO B;  3VRA B;  2FNJ B;  2D11 A;  3MTN B;  5KHQ A;  2NPT B;  2I1K A;  2LVQ A;  3UF8 A;  1WMH B;  2X38 A;  5BO4 B;  3A9J B;  5IKC M;  2DX5 B;  3S2A A;  2XEW A;  3P4Q B;  1P0R A;  5TSS A;  1SIJ A;  4WAA A;  3PVL A;  3H7S A;  3KWV A;  1GC7 A;  1GG3 A;  2K22 A;  3DVG X;  3R3M A;  2C7H A;  2E6X A;  4KIK B;  2BQQ A;  1UD7 A;  2AWT A;  4WJP A;  2FCM A;  2Z59 B;  1SE4 A;  3MHS D;  1VLB A;  4PYZ A;  1V1P B;  2D5G A;  4NAW A;  1XF5 L;  2KJH B;  2AQ2 B;  2LGS A;  1UUP A;  3AEB B;  3RNB C;  4L1B A;  5E6P A;  1R4M I;  2JT4 B;  4DXF A;  1GOZ A;  4HRS A;  2UU7 A;  2IGG A;  4FUL A;  1C79 A;  2MJ3 A;  1PUT A;  1UEL A;  1V5T A;  4MM3 B;  4W9H A;  1YJ1 A;  4FBJ B;  1H4R A;  4ZYS A;  2WXK A;  4DHZ B;  3Q3M C;  3W1S C;  1UBI A;  3I63 C;  3DBR I;  1HZ6 A;  4C56 C;  1A70 A;  2MJD A;  4YTN B;  1TS5 A;  5D2M B;  1C77 A;  2JXT A;  3AE1 B;  5H8Y E;  2IND C;  1HZ5 A;  3N1X C;  2HTH A;  1N61 A;  3ML9 A;  4A6Q A;  1CK1 A;  5BYS A;  3AE2 B;  2KOX A;  2KHW B;  4B0E A;  4JGH B; 
#chains in the Genus database with same CATH homology
 4ANU A;  2KDB A;  3ALB A;  4BKG A;  4EKU A;  2CHZ A;  2JUO A;  4XC2 A;  3L08 A;  3KUZ A;  4ZRI A;  2LWP A;  3RZW C;  4E3C A;  3ZRF A;  4NY0 A;  1WJN A;  2KVR A;  2EMS A;  4ANV A;  4ICV A;  2BGF A;  4E71 A;  2L00 B;  3QK0 A;  1WR1 A;  1KM7 A;  2GBJ A;  2D10 A;  3TL5 A;  2NBV B;  4PS8 A;  3W1Y A;  1OTR B;  2A4Z A;  1WGD A;  2MLB A;  4NJ6 A;  4HPM B;  1J8C A;  3N30 A;  1F9J A;  2CHW A;  4KSK C;  4BVU C;  1Y8R C;  2ZVN A;  3ZKJ C;  3PHW B;  5G55 A;  1WGR A;  3VDZ A;  3L10 B;  4KDL B;  2IYD B;  3A1Q B;  2DZI A;  3R66 C;  4WJN A;  2O2V A;  3WA0 A;  3N32 A;  3APD A;  3OJ3 A;  2MA9 B;  2LRW A;  3DCG A;  3V60 A;  4GIV A;  1HE8 A;  2KFK A;  3OJ4 B;  1J0G A;  5D94 A;  4ZDV A;  5AZG A;  1WGH A;  4FHJ A;  2B3A A;  4J6I A;  3UIN B;  2FAZ A;  4DK5 A;  3B0A A;  4IWQ A;  1L7Y A;  3PRP B;  3QQ8 B;  1KJT A;  1Q1O A;  3O65 B;  3W1S A;  2PE6 B;  4BKS A;  4KZ0 A;  3V62 A;  3LJ3 A;  2DYB A;  3MJW A;  2PEA A;  3AU4 A;  2W9N A;  2J0M A;  2MRP A;  2G4S A;  2O6V D;  1S1Q B;  3KVF B;  2Z0D B;  4GGQ A;  4CYE A;  1V81 A;  1V2Y A;  2D3G A;  3JYU A;  2GMI C;  3R7R A;  4A3O A;  1E8Y A;  2BWF A;  3I3T B;  3QAR A;  4P7I A;  1RAX A;  1V80 A;  2DAF A;  2Z0E B;  4E74 A;  2NPT A;  2UYZ B;  3RUL A;  4EUT A;  2IBI B;  1EO6 A;  4RMA A;  5CTR C;  1L2N A;  2EKE C;  2MP2 A;  1V9J A;  3H1U A;  2KDE B;  4KZC A;  4FJV B;  1RFA A;  3DOW A;  2KMA A;  3VTV A;  3VVW B;  4DDG D;  2FCN A;  5JZE B;  4MGK E;  2GOW A;  1WJ4 A;  1WX8 A;  1SGH A;  1D3Z A;  1ZKH A;  2DZK A;  2Y5B B;  5CHV C;  5J2R A;  2OJR A;  3VFK A;  3VH3 B;  1Z5S B;  4GMV A;  2KDI A;  1Q0W B;  2ZNV C;  3VH4 B;  2N1W A;  4BFR A;  4HJK A;  1WM3 A;  2CR5 A;  4W9C A;  5E6N A;  2A5U A;  5D7G A;  1WXA A;  2ZEQ A;  4JIO U;  4K1R B;  2M4N A;  3CSF A;  2KQS A;  3IHP C;  3VTU A;  4KIK A;  4PS3 A;  4DHZ E;  1ZGU B;  2RPQ A;  4CHK A;  2IY1 B;  2KC2 A;  2RGF A;  5KHO A;  1TGZ B;  2JZ3 B;  2WDT B;  3VQI A;  4OVU A;  3ENE A;  4HDQ A;  4XZ4 A;  1WJU A;  3V61 A;  3H7P B;  4N9F 4;  4AWJ A;  5TR5 A;  3VXW A;  2L0F A;  3IG3 A;  3VTW A;  2KJR A;  3Q3J A;  4G3X B;  5CX3 A;  2LD9 A;  3ZRC A;  1WH3 A;  1WGG A;  4HVB A;  2AEH A;  1E90 A;  1XT9 B;  2C7M B;  2MSE D;  3PLU A;  2PJH A;  2C60 A;  3L54 A;  2DZJ A;  3PGE A;  4W9G A;  5LLI A;  3WAN A;  4DDI D;  2RD0 A;  1RLF A;  4KVG B;  3IVF A;  4II2 B;  2G45 B;  3ZLZ A;  4EOY A;  1J19 A;  2AL3 A;  3LDZ E;  4MM3 A;  1WZ0 A;  4CO7 A;  1YX5 B;  4TQ1 A;  1V49 A;  4IW0 A;  3OLM D;  3TBL D;  4AJY B;  4ANW A;  2KMC A;  2O6V B;  4MEM A;  3JW0 X;  1TZ1 A;  2L7R A;  5L83 A;  4BBN F;  2NR2 A;  1WYW B;  2N7D A;  2C7N B;  4IG7 B;  2MBE A;  1E7V A;  4FLH A;  1UZX B;  3PZD A;  5J18 A;  4EZL A;  4RM8 A;  3ONS A;  4GB9 A;  4HPL B;  1EF1 A;  4NPN A;  2D2Q A;  1WGY A;  3ZNH B;  2K6Q A;  3OAW A;  3DBS A;  3UQA A;  2XK5 A;  1V5O A;  2GBK A;  1WF9 A;  2DAJ A;  2J7Q B;  2N1V A;  2JXX A;  1NI2 A;  2KQ7 A;  2N9E B;  2L0T A;  3IBE A;  4WWO A;  3RCZ A;  3WIM A;  2JRI B;  1V6E A;  1WX9 A;  4GN1 A;  2DZM A;  3PHX B;  2BWE S;  4WJO A;  2MCN B;  3AUL A;  5E6O A;  3RT3 B;  1R4N I;  3TCA A;  2J0J A;  4FHK A;  2PPH A;  5LXH A;  4K7U A;  1M94 A;  5J17 A;  3H6N A;  2FUH B;  1WJ6 A;  2O2V B;  1GJZ A;  4GDL A;  2CKH B;  4AUQ C;  3ECI A;  2LGD A;  3IFW B;  2KFK B;  3WAM A;  3QC8 B;  3WAL A;  1K8R B;  4GSW A;  3TJP A;  2LXA A;  2K1F A;  1WX7 A;  2K8B A;  2MW5 A;  2EMT A;  4MEL A;  1VD2 A;  2KN5 A;  3A4S C;  3EHV A;  3L17 A;  4NJ7 A;  4MGZ E;  2NBW B;  2MBH A;  1E5W A;  1P3Q U;  4EEW A;  4EZJ A;  2YLM A;  2K8H A;  1LM8 B;  5JH5 C;  2LZ6 A;  2FCS A;  2GBR A;  2RSU A;  4M8M A;  2LRU A;  2LVO A;  3PRM B;  3ML8 A;  1LXD A;  3K9P B;  2BYE A;  4B95 A;  5L95 C;  4AOF A;  2L3Z A;  1ISN A;  1EF5 A;  1WR6 E;  1GNU A;  1V86 A;  4K7S A;  3R7Q A;  3PT2 B;  4I6P A;  2LI5 A;  4B9K A;  2MP2 B;  4HWI B;  3ZNG C;  3APF A;  3PLV A;  3A1Q A;  3BIN A;  4KDI C;  4B6W A;  5HKH A;  1WMH A;  3PRZ A;  1WFY A;  3VUX A;  1E8X A;  1IYF A;  1SE9 A;  2XBB C;  2HD5 B;  2KTR A;  2QHO A;  2ZPY A;  1MG8 A;  3A9J A;  4NAW B;  3Q3F A;  5C1Z A;  3U30 A;  1IP9 A;  4LJP B;  1LFD A;  1WIA A;  3HHM A;  4DWF A;  1U4A A;  4HCN B;  1I35 A;  2KDF B;  4RM9 A;  3NOB A;  2MBQ A;  3BY4 B;  4EFO A;  4FA6 A;  2BKF A;  2NVU I;  4FJZ A;  5DCN A;  5DPT A;  2LUE A;  2BYV E;  2KC1 A;  3HM6 X;  2KTF A;  1JRU A;  3HK0 A;  3KUC B;  3KYD D;  2K25 A;  3DBH I;  3T8M A;  4MGY E;  4F1S A;  5AZF A;  3QWZ B;  5DPR A;  1SIF A;  1TBE A;  4XX5 A;  3ZTD A;  1LQB A;  3DQV A;  5FR6 A;  4MJS B;  3AI5 A;  5CHW A;  4K7W A;  4M8N A;  1WE6 A;  1CMX B;  3A9K A;  4MSM B;  1Q5W B;  1YD8 U;  1VCB A;  1YX6 B;  2RR9 A;  5C23 A;  4BKS D;  4MSQ B;  4DHJ D;  4KV2 A;  3JSV B;  2L05 A;  1S3S G;  4OVV A;  4IM0 A;  4FJY A;  4A3P A;  1FXT B;  1PQS A;  2JPH A;  1XD3 B;  3NZU A;  2N9P C;  2CHX A;  2KZR A;  2V3S A;  3V6E B;  2LAS A;  4URK A;  3RUI B;  2CS4 A;  2N4F A;  2MBO A;  2UWQ A;  2LGY A;  3AXC A;  4G11 A;  3L0W B;  4GOC A;  3PSE B;  3ZW3 A;  4JLC A;  2N7E A;  5G2N A;  1H8C A;  2ASQ A;  1X1M A;  4TKN A;  3ZVV A;  2KK8 A;  1WXV A;  3ZNI D;  3UGB B;  3JVZ X;  2R2Q A;  4W9J A;  5IAA C;  2I1J A;  4HLE A;  2GBN A;  3DBL I;  2R2O A;  2G3Q B;  1A5R A;  2WWZ A;  2NBU A;  4W9E A;  1P1A A;  2OOB B;  2BPS A;  4GDK B;  4WJQ A;  3VHT C;  1GUA B;  4ICU A;  4TQ0 A;  2IO0 B;  1IPG A;  2VRR B;  1NDD A;  4AJW A;  4DBG A;  3N3K B;  1QZE A;  3ZO5 B;  1WY8 A;  4FAD A;  4PYU A;  2PE9 A;  2XK5 B;  2ZCB A;  4W9K A;  3EC8 A;  1WM2 A;  3AU5 A;  3DDC B;  2IO1 B;  3KW5 B;  2KWC A;  3T9L A;  1I42 A;  3SU8 X;  3P2B A;  4IWP A;  4JL9 A;  4KSL C;  3CF6 E;  3RYT A;  1WZ3 A;  3DVN U;  2DEN B;  2YVC A;  2K6D B;  2FCQ A;  2KX0 A;  4LJO B;  5GMV A;  5DPW A;  1GC6 A;  1ZW7 A;  4IC7 B;  4EZK A;  4ASW C;  2WYQ A;  3QAQ A;  3ZTC A;  5JHA A;  2KJ6 A;  4F8C B;  5EDS A;  1P9D U;  5AEK B;  2JY6 A;  4HDO A;  2LGX A;  4NQK E;  4IUM B;  4W9F A;  3DPD A;  3QHT A;  2AL6 A;  2DYO A;  2NCN A;  4IM3 A;  1OEY J;  3QCA A;  4WWP A;  2IY0 B;  2MBB B;  3KH0 A;  3NHE B;  4MGI E;  2M1M A;  3CST A;  2K39 A;  3DVN V;  3U8Z A;  2JVC A;  3WAP A;  2BKR B;  2KFJ A;  4LDT D;  3M95 A;  5D6J B;  2GBM A;  2KWV B;  1C3T A;  1EUV B;  1WI0 A;  2REX A;  2HE7 A;  3KYC D;  2MWS B;  3PTF C;  1WXS A;  4BKT A;  5JHB A;  3HM3 A;  4DHJ B;  4YL8 A;  3UIP B;  1KOT A;  2KD0 A;  3C0R B;  4TV3 A;  4W9D A;  2D07 B;  3L16 A;  4BOZ B;  2JWZ A;  3QJZ A;  4AP4 C;  1YIW A;  3QX1 A;  4JQW C;  2M8S A;  4HK2 A;  3ZDT A;  3M3J A;  3UIO B;  1KLV A;  3NS8 A;  5AZH A;  2FNJ B;  2CU1 A;  2D11 A;  3MTN B;  5KHQ A;  2NPT B;  2I1K A;  2LVQ A;  3UF8 A;  3X23 A;  3SD5 A;  1WMH B;  2LVP A;  4TUU A;  2K8C A;  3QA8 A;  2KTR B;  4IM2 A;  2WX0 A;  5BO4 B;  3A9J B;  4X57 B;  2WX1 A;  3D32 A;  4IWO A;  2KLG A;  4WWN A;  2DX5 B;  2AYO B;  2JZZ A;  2KAN A;  1NBF C;  2MQJ A;  2XEW A;  1P0R A;  3DVG Y;  3S2A A;  2KNB A;  4WAA A;  1BT0 A;  3PVL A;  4NQL B;  3UQB A;  3GZN I;  2G4D B;  2DYM A;  3H7S A;  1WE7 A;  4FN2 A;  4M0W B;  1GC7 A;  2LJ5 A;  1AAR A;  3L13 A;  3SDL C;  1GG3 A;  3TMP B;  3DVG X;  3R3M A;  3VUW A;  2C7H A;  2N9X A;  1E7U A;  2ZCC A;  3VAW A;  3X0W A;  4HXD A;  3A4R A;  2JRH A;  4W9L A;  2KLC A;  1UGM A;  3PS6 A;  2DHZ A;  1OEY A;  3A9K B;  4KIK B;  2KKC A;  2C9W B;  2ZPN A;  2IZV B;  1UD7 A;  2AWT A;  4WJP A;  1OGW A;  2FCM A;  2Z59 B;  4NNJ B;  3MHS D;  4PYZ A;  1WXM A;  2KWU B;  5IA7 A;  3PV1 A;  1YQB A;  1T0Y A;  2L8J A;  2ZJD A;  4NAW A;  2ZZP B;  1E8W A;  2KJH B;  2KXJ A;  3K9O B;  4WQO B;  5E6P A;  1R4M I;  2JT4 B;  2V1Y A;  4GU2 A;  4DXA B;  1TTN A;  4K81 A;  4LDT B;  1G6J A;  2LXC A;  4MDK E;  3M63 B;  4FUL A;  3H9D A;  3NY5 A;  1P98 A;  3KUD B;  3NZS A;  5CHF A;  1UEL A;  2KX3 A;  3HIZ A;  3RD2 A;  1V5T A;  4MJS A;  1UH6 A;  2M0X A;  4W9H A;  3ZUN A;  1Z2M A;  3WAO A;  3ZNZ B;  2BYF A;  2JF5 A;  1YJ1 A;  3EEC A;  3PPA A;  4G0N B;  4FBJ B;  2IO2 B;  1WRD B;  4W9I A;  1H4R A;  3QIJ A;  4DHZ B;  3H7P A;  3JSV A;  2IO3 B;  4BOS C;  2NS5 A;  3W1S C;  3A33 B;  1UBI A;  4MH0 E;  3B08 A;  4LCD E;  1C1Y B;  4II3 B;  3CMM B;  4GXB A;  1OQY A;  2BF8 B;  3U7D A;  3DBR I;  3M62 B;  4HCP B;  2V4L A;  4ZRJ A;  2L76 A;  3TIX A;  3SHQ A;  2ZVO A;  5D2M B;  2MX2 A;  3ZDM C;  3V6C B;  1E8Z A;  2FIF A;  1UBQ A;  3VUY A;  3ZIM A;  3GOE A;  1XQQ A;  2HTH A;  2M17 A;  2ZNV B;  3EFU A;  2HJ8 A;  3APC A;  2FID A;  4G50 A;  5LXI B;  4ANX A;  4PS7 A;  3ML9 A;  3RZF A;  3PRE A;  5DPS A;  4A20 A;  2KO3 A;  2O6V A;  4I6L B;  4GDL B;  4ZYN A;  4GDK A;  4ZRK A;  3B1L X;  4F7Z A;  2KOX A;  4I6N B;  2C5L C;  2KHW B;  4BBN C;  2J0K A;  1RRB A;  4JGH B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...