1C3TA

Rotamer strain as a determinant of protein structural specificity
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
76
structure length
76
Chain Sequence
MQLFVKTLTGKTLTVELEPSDTVENLKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNLQKESTIHLVLRLRGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Rotamer strain as a determinant of protein structural specificity.
pubmed rcsb
source organism Homo sapiens
molecule tags De novo protein
molecule keywords PROTEIN (1D8 UBIQUITIN)
total genus 16
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 1999-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1c3tA00
3KW5B 3TCAA 2L0FA 2KTRA 3EFUA 2FIDA 4PS8A 2CU1A 3RZFA 1OEYA 3C0RB 2DYBA 3PS6A 4NY0A 5KHQA 4AOFA 1WF9A 2YVCA 2KNBA 3P2BA 4W9IA 2K8BA 5AZGA 1GG3A 3VTWA 1Q0WB 5DPSA 4EZKA 3KUZA 2DZKA 4FJVB 3PSEB 2NBWB 2DHZA 3JYUA 2EMSA 4GXBA 1WYWB 2KTRB 3GZNI 3JW0X 1WGHA 3U30A 3ONSA 3APCA 3UQAA 4K7SA 3X23A 3PREA 4IM2A 5C23A 4W9LA 4TKNA 4ICVA 1XQQA 5C1ZA 5JHBA 2GBRA 5LXHA 1T0YA 2K6DB 4CYEA 4DHJB 4GDKA 4X57B 3TJPA 2MLBA 2XK5A 3QARA 2V4LA 3VAWA 1WGGA 4MELA 2ZJDA 5DPWA 4LDTB 4W9CA 1J19A 2BYVE 4ASWC 1WH3A 4NAWB 1TZ1A 4BKSA 2N9EB 2R2OA 3EECA 1F9JA 5FR6A 4OVVA 3RUIB 3UIPB 2Z0DB 1KM7A 2KFKA 3PTFC 2FCMA 4EKUA 4BFRA 5D6JB 2D2QA 4LJPB 5CTRC 3V62A 1KLVA 4I6PA 5E6PA 5CHVC 1WJNA 1UH6A 1OTRB 2LVPA 4URKA 2GBJA 3CSTA 4LCDE 4BBNF 1G6JA 2KJHB 1OQYA 2KMCA 1I35A 4IWOA 3TBLD 1OEYJ 1WX9A 2IY1B 3N32A 3PRPB 3N30A 1Y8RC 2PE6B 4LDTD 2NR2A 3TIXA 1SIFA 2LJ5A 4WJOA 1QZEA 2NS5A 1YJ1A 3UIOB 4M0WB 5IA7A 3W1SC 3PT2B 2VRRB 2KC1A 3QA8A 4GB9A 3VHTC 2LVQA 2NPTA 1WR1A 2KWCA 5E6OA 2ZVOA 3ZNHB 2LXCA 2O2VB 4GDKB 1WIAA 2A4ZA 3A9JA 2MA9B 2N1VA 2BWFA 5CX3A 2V1YA 4ZDVA 5JHAA 3V6EB 3KVFB 3QAQA 4BKGA 1WM2A 4GGQA 2HJ8A 3ZIMA 2LWPA 2MW5A 4FLHA 3V61A 4JIOU 3ZO5B 3JSVB 4MGYE 3L13A 3DPDA 4GDLB 1WGDA 3ZUNA 3H1UA 3VUWA 5L95C 1WFYA 4KSKC 1YQBA 4FHKA 3HM6X 3HHMA 5JH5C 4HK2A 2O6VA 3RULA 3H7SA 4TQ1A 4MDKE 2ZZPB 2JXXA 4E74A 2N4FA 1OGWA 4ANWA 3Q3FA 3K9PB 1P1AA 2LRUA 2LRWA 2KANA 2LGYA 3VUYA 1TGZB 1IYFA 2M1MA 4XX5A 4F8CB 3CSFA 4MJSA 4LJOB 4K81A 2J0KA 2N9PC 1NDDA 3DVNV 1WMHA 1V49A 2KN5A 2LZ6A 3DVGX 2N9XA 2KOXA 2K1FA 2Z59B 2WDTB 3IBEA 4WJPA 2KTFA 2MBBB 2BF8B 4MEMA 2FNJB 2L3ZA 3L0WB 2LUEA 1S3SG 3CF6E 5DPRA 1I42A 4A3PA 4FULA 3WAOA 4CHKA 2GBKA 5AEKB 4G50A 5D94A 3ZNID 2BYEA 2LASA 1UBQA 4W9FA 4DHZE 5J17A 2JUOA 2I1JA 1WJUA 4ANUA 4WWPA 2LD9A 1Q1OA 2HE7A 1E8ZA 3NZSA 2MBEA 2BYFA 4KDIC 4EFOA 2M17A 2C9WB 1SE9A 1WM3A 4WJNA 4K7WA 2JPHA 1RFAA 1YIWA 3PPAA 4BOSC 3ML9A 3O65B 4HJKA 2DENB 3A1QA 4FA6A 4M8MA 3AXCA 2MP2B 4GOCA 4XZ4A 1WZ3A 3R7QA 2ZPNA 2AL3A 3SU8X 3VDZA 2KX3A 4HVBA 2D07B 1GNUA 2DAFA 4GMVA 3QWZB 2GBNA 2RPQA 3RZWC 2KQSA 4HDOA 4B95A 1XT9B 3PRZA 4GDLA 3WA0A 2G4DB 5J18A 3KYCD 4AJWA 1M94A 3KYDD 3H7PA 3OLMD 4FBJB 3KH0A 2WWZA 1SGHA 2FCQA 1P9DU 3H9DA 2PPHA 2B3AA 2N7EA 2L0TA 1V80A 2CR5A 2DYMA 4PYZA 1YX6B 2ZVNA 2CHWA 4KIKA 2G45B 2KK8A 3S2AA 2IO3B 2OJRA 5EDSA 2KWUB 1IP9A 4BKSD 3H7PB 2ZNVB 4PYUA 2HD5B 1RAXA 4MSMB 4RMAA 4W9EA 2IO1B 4WWOA 3TMPB 1BT0A 1ZGUB 1TTNA 5LXIB 3PGEA 2MBOA 2QHOA 2UWQA 3X0WA 3QX1A 1V5OA 1LM8B 1TBEA 2NBUA 3L17A 3I3TB 1WXAA 3LDZE 3ZNZB 1H4RA 4IG7B 3NOBA 3H6NA 3WALA 2IZVB 4G11A 3TL5A 4P7IA 3M62B 2EMTA 3M95A 4G3XB 4KSLC 3W1YA 2KJ6A 3PZDA 3SD5A 4K7UA 4N9F4 1WGYA 4K1RB 2BGFA 2R2QA 2FCNA 1LXDA 3ML8A 4TQ0A 1P98A 5DCNA 1WRDB 3OAWA 2O6VD 5E6NA 2FCSA 2UYZB 3GOEA 3RCZA 2K8HA 2LXAA 2O2VA 3QHTA 1Q5WB 1GC6A 4J6IA 2MP2A 2DZJA 2FIFA 4W9JA 3LJ3A 4EUTA 1WR6E 4WWNA 3IFWB 4FJYA 3ZVVA 3ZNGC 1KJTA 1P0RA 3AU5A 3PVLA 3NY5A 3ZDTA 3DBHI 3JSVA 2L05A 2DZIA 1GJZA 3VQIA 2FAZA 4NQKE 3ZDMC 1R4NI 2AWTA 2KLGA 1WXVA 2DYOA 2REXA 3U8ZA 4IW0A 2OOBB 4HPMB 2KKCA 2NCNA 3UGBB 4BKTA 2HTHA 1UGMA 4AUQC 3DVGY 4MGZE 2IO0B 2JWZA 2LGDA 4RM9A 1U4AA 4BOZB 1XD3B 2G3QB 4KZCA 2Z0EB 2JF5A 2D10A 2C7HA 1KOTA 2JZ3B 2KMAA 2WX1A 2ZNVC 2GBMA 3D32A 4IM3A 2CS4A 2K8CA 1VCBA 2KLCA 3RT3B 3IVFA 4FJZA 3V60A 2CHZA 4DDID 1WMHB 3T8MA 1J0GA 3PHXB 3VTUA 3A9JB 3AI5A 1Z5SB 3M63B 1V81A 2O6VB 3DBLI 4A3OA 4HPLB 5AZFA 5D2MB 4HWIB 4E71A 2BPSA 1WE6A 3A33B 4TUUA 3T9LA 5L83A 4DXAB 3VUXA 1UBIA 2RR9A 2XEWA 4JGHB 4AP4C 2M8SA 2XBBC 2RGFA 4NNJB 3ZKJC 1UZXB 1NBFC 2ZCBA 4HCPB 4KZ0A 2KQ7A 2CKHB 3N3KB 5G55A 4AJYB 4HDQA 2D3GA 1E8YA 4NJ7A 2KJRA 3HK0A 1V5TA 4G0NB 4WJQA 4WAAA 1WZ0A 3UQBA 2M0XA 3B1LX 4ZRKA 1MG8A 4JLCA 1RRBA 5J2RA 1E8WA 1S1QB 2JY6A 4MSQB 4GN1A 2KDIA 3APFA 2RSUA 4ANVA 3MHSD 3W1SA 1WE7A 2KD0A 2KFKB 4HLEA 3BY4B 3SHQA 2NVUI 3VVWB 4BVUC 2ZPYA 2C60A 4EOYA 3B08A 2L76A 4TV3A 2WYQA 3ZTDA 1HE8A 4I6LB 2A5UA 4W9HA 4AWJA 5HKHA 4HCNB 2DX5B 4YL8A 3PV1A 3V6CB 2PE9A 3VH3B 1C1YB 3MTNB 2XK5B 3EC8A 1AARA 2ZEQA 5KHOA 2AL6A 3R66C 3ZLZA 2JVCA 4MGKE 1RLFA 2IY0B 1P3QU 3A4SC 3ZTCA 1D3ZA 1GUAB 4KIKB 3CMMB 3ZW3A 4II2B 2N7DA 2K39A 4NPNA 4NAWA 1WJ4A 5JZEB 2DAJA 3IHPC 2JRHA 1UD7A 2YLMA 4KV2A 4GSWA 5AZHA 5BO4B 2EKEC 2DZMA 1FXTB 3IG3A 1L2NA 1LFDA 2KZRA 1EF5A 2L00B 4IWPA 2PJHA 5GMVA 3AU4A 4XC2A 2C5LC 2MCNB 4ZRJA 2V3SA 3APDA 3RD2A 3QC8B 4E3CA 1YX5B 3L54A 4WQOB 3L16A 1E8XA 2JZZA 3U7DA 2J0MA 1YD8U 2PEAA 1PQSA 3ZRFA 1V6EA 2KX0A 1L7YA 4ANXA 3A4RA 3RYTA 3ECIA 3L10B 3WAMA 1GC7A 4EZLA 3ALBA 3UF8A 3K9OB 4IUMB 4ZRIA 3PLUA 4ZYNA 1WI0A 3KUCB 1E90A 2IO2B 4GU2A 4MH0E 1VD2A 4GIVA 4I6NB 1A5RA 3A9KB 4EZJA 2MWSB 2G4SA 3QCAA 2K6QA 2NBVB 2LGXA 3ZRCA 1V2YA 4FADA 2MSED 2W9NA 1E7VA 2ASQA 2KDBA 2BKRB 2LI5A 5LLIA 3UINB 3VH4B 3DBSA 1JRUA 2BKFA 3DCGA 2CHXA 2KFJA 3DBRI 2ZCCA 4RM8A 1NI2A 2Y5BB 4PS7A 3PHWB 4PS3A 3NS8A 4BBNC 3ENEA 1E7UA 2I1KA 3B0AA 5CHWA 3Q3JA 3OJ3A 3DDCB 2KDFB 2K25A 2IYDB 3EHVA 2KHWB 4FN2A 1ZW7A 3NZUA 4HXDA 2D11A 4MJSB 2NPTB 3A1QB 3WAPA 2GOWA 4OVUA 1R4MI 3AULA 1WX8A 2L7RA 3L08A 1C3TA 1UELA 4MM3A 4CO7A 3QQ8B 4DHZB 3VXWA 4W9GA 4II3B 2KWVB 1EUVB 4IM0A 2MBQA 4DBGA 4B6WA 4M8NA 4FHJA 5CHFA 4A20A 2MBHA 2RD0A 1H8CA 2KC2A 2M4NA 1X1MA 5G2NA 3WIMA 2MQJA 2KVRA 2J7QB 3OJ4B 1WGRA 3KUDB 4ICUA 5D7GA 1J8CA 4IC7B 1EO6A 5DPTA 1IPGA 2KDEB 1Z2MA 2AYOB 3A9KA 3DQVA 2MX2A 3PRMB 4W9KA 1WJ6A 4F7ZA 3HM3A 2C7NB 2AEHA 4KVGB 2N1WA 2KO3A 3DVNU 3WANA 3QK0A 2GMIC 1LQBA 1K8RB 2LVOA 1E5WA 1WY8A 3M3JA 4W9DA 4DK5A 1V86A 4JQWC 2BWES 2FUHB 2MRPA 4DHJD 4B9KA 2KXJA 3VTVA 1ISNA 3NHEB 4KDLB 3SDLC 4EEWA 5IAAC 2JRIB 3BINA 4JL9A 3DOWA 4NQLB 1CMXB 2C7MB 2WX0A 3R7RA 3QIJA 4DWFA 4NJ6A 2IBIB 1V9JA 1WXMA 1EF1A 4MGIE 3QJZA 2J0JA 2JT4B 3JVZX 3MJWA 4IWQA 1ZKHA 1WXSA 5TR5A 3R3MA 4DDGD 4F1SA 3PLVA 1WX7A 3HIZA 3VFKA 2L8JA
chains in the Genus database with same CATH superfamily
2FIDA 3RZFA 2WGSA 5KHQA 2YVCA 3P2BA 4W9IA 1Q0WB 1L6UA 2NBWB 2RPVA 3JYUA 1RM6C 2D3CA 1D4BA 3GZNI 1I4RA 4K7SA 2QCZA 4LNOA 4WIPA 1L0YB 1SEBD 5C23A 5IN7A 1MVKA 5C1ZA 2FE8A 2GBRA 4MH8A 2ACZB 1V1PB 4GDKA 4USAA 3TJPA 2MLBA 3SR6A 2XK5A 3QARA 2N0SB 3VAWA 2CU3A 1OQRA 3W5UB 2I2YA 3R8BA 3DBLB 4ASWC 1WXQA 1WH3A 4NAWB 2N9EB 3RUIB 3PTFC 1CQVA 4BFRA 5CTRC 1L0XB 2GBJA 2WXHA 3CSTA 1G6JA 5I4DA 2KJHB 2KMCA 1I35A 2IY1B 3N30A 2RMMA 3NRZA 5HFYA 3AEBB 3TIXA 1SIFA 1DGJA 1F2RI 1C79A 4M0WB 1N61A 2KC1A 3QA8A 3P1MA 1TKYA 2LVQA 2KWCA 4DXGA 3ZNHB 1WIAA 4ZDVA 1WM2A 1QF6A 2MW5A 4JIOU 1PYWD 3DPDA 3ZUNA 2WXIA 3IAM1 5L95C 4HK2A 5FK9C 2ZZPB 3HRDD 4M00A 1I7HA 3K9PB 2LRWA 2LGYA 2M1MA 2N9PC 1VZ8A 4PK1A 2LZ6A 4J3OD 2N9XA 3CWIA 3IBEA 2KTFA 3Q6BA 4MACA 3AE7B 2L3ZA 3L0WB 1EU4A 1QT9A 1S3SG 3BVMA 4R3DA 3ZXVA 4A3PA 3WAOA 1XO3A 2W3SA 1UBQA 2ONQA 4O1NA 4W9FA 5LNK1 1LO5D 1YOVB 2XNAC 3N1XC 3AEEB 5FR3A 2C9WB 3RFZB 4WJNA 4K7WA 2JPHA 1YIWA 3PPAA 2LGSA 3A1QA 3AXCA 3PZ7A 2D07B 5HI1A 1GNUA 2DAFA 2RPQA 3TEWA 3HUIA 4HDOA 3NUHB 2I38A 2KDMA 4FBJB 3KH0A 1SGHA 3RNBC 1P9DU 3E9SA 2B3AA 2IGDA 1V80A 3B2FA 4PYZA 2PVGC 2G45B 1QLBB 2IO3B 2OJRA 3IT6B 3NZ3A 2DBYA 4RFBA 2QIEB 2MBOA 2QHOA 2W3RA 1NYRA 3HVZA 4IG7B 1DOYA 3BIID 3M62B 4YSXB 2BGFA 1LXDA 4TQ0A 3MJ5A 1WRDB 5E6NA 1HXYD 3GOEA 3RCZA 3KWLA 2LXAA 1FCCC 4AS1A 1GC6A 4J6IA 3OG5A 4A90A 1M4VA 3LJ3A 1WR6E 2NTSA 3NVWA 3IFWB 4FJYA 1F0ZA 3ZNGC 4JE3B 2HDEA 3DBHI 1HEZE 2L05A 3ZDMC 4MM3B 2REXA 1PUTA 3U8ZA 1QQRA 3UGBB 1UGMA 4AUQC 2IO0B 2JWZA 1L4DB 2G3QB 3L4PA 4KZCA 1KOTA 2WXOA 2Y3AA 4IM3A 2K8CA 3RT3B 1YN5A 3T8MA 1J0GA 3VTUA 2L52A 4A3OA 4P16A 1KLGD 2JSVX 3T3NA 1N5XA 2BPSA 4DXAB 4N6EB 4ITKA 2XEWA 4WWMA 4P1BC 4A6QA 2PIAA 3ZKJC 1NBFC 1XLPA 3EFCA 4AJYB 2QILA 2D3GA 2M56B 2K5PA 4GLSC 1V5TA 2BYTA 4WAAA 1JWBD 1RRBA 5J2RA 4BAXA 4MSQB 1WSPA 3VRAB 4YT0B 2RSUA 4ANVA 1SBBB 4IDIA 4HLEA 3SHQA 1BXTA 3VVWB 4BVUC 2C60A 4WH4A 3P42A 3Q14C 2JZPA 2WYQA 1HE8A 4I6LB 2A5UA 5IKCM 4AWJA 2KN4A 5HKHA 4HCNB 1V1OA 4YL8A 1F77A 2LHDA 2Q5WD 2PE9A 3AE8B 3ZLZA 2WXRA 3R66C 1UGJA 1F1HA 2IY0B 3GE8C 1T0SC 1WJ4A 2L83A 5JZEB 3KLSX 4GSWA 1BMLC 5BO4B 3IG3A 1LFDA 2KZRA 5GMVA 2MCNB 4XWWA 2CJOA 1NVID 4E3CA 2QSDA 2SEBD 1RFKA 5TSSA 3U7DA 1YD8U 2PEAA 3AB5A 3ZRFA 1GC7A 2LJIA 3UF8A 1K52A 2AX5A 1ZDXA 4IUMB 4ZRIA 3PLUA 4JWSC 1WI0A 4I6NB 1A5RA 3P4SB 3A9KB 1D5MC 5BMIA 2KWDA 2W82A 2G4SA 3DWGC 3BVZA 2WDQB 1V2YA 1FPYA 1E7VA 2BKRB 4NJCA 5LLIA 3UINB 1C4PA 1JRUA 2ZCCA 1NI2A 4PS7A 1UUPA 1L0VB 1AN8A 2YEPF 2I1KA 5CHWA 2ZW0A 3DDCB 3EHVA 2KHWB 4FN2A 1FM0D 4US8A 3NZUA 4MJSB 1FD6A 2NPTB 3WAPA 1N60A 1GOZA 4RGTA 1R4MI 4HKZE 2VH1A 1Q10A 1MG4A 3N9YC 4II3B 2KWVB 1QOAA 2MBQA 4M8NA 5CHFA 3Q3NC 1HZ5A 4JWUC 1PGBA 4REZA 2MQJA 1A70A 2J7QB 3OJ4B 1QILA 3KUDB 4ICUA 4IC7B 2AYOB 1WJ6A 2IGHA 3I63C 1UWMA 3WANA 2GMIC 2V3PA 1E5WA 3M3JA 1V86A 4JQWC 2LEKA 2FUHB 4KDLB 2J42A 3Q8FA 4JL9A 1L6VA 2OEDA 4DWFA 2N9LA 2XN9C 1C9FA 1WXMA 1E6EB 4F1SA 3R3MA 1WX7A 1YQ3B 2VZKB 2CU1A 1Y56A 3C0RB 5D3IB 4AOFA 2K8BA 5AZGA 2BB5A 3KUZA 3PSEB 2ON8A 1JRPA 2EMSA 4GXBA 1WYWB 1WGHA 4TMAB 3RNCC 3UQAA 1N5WA 4W9LA 1XQQA 5JHBA 5LXHA 1STEA 4ZYSA 1JALA 1WGGA 4MELA 3B2GA 1KRHA 1DYQA 4LDTB 3IXSA 1XLQA 5C3JB 3V3XA 2R2OA 1F9JA 3UIPB 1R7SA 2PLPA 2E3TA 1KM7A 2KFKA 4EKUA 5D6JB 2D2QA 4LJPB 5E6PA 5CHVC 1UH6A 4LNFA 4URKA 4LCDE 1OQYA 1E7PB 1Y8RC 3NVYA 5HHDG 1PFDA 5IA7A 2RDGA 3W1SC 3Q69A 3AE3B 2VRRB 3VHTC 2NPTA 2WU5B 5E6OA 2ZVOA 2A4ZA 5CX3A 2K22A 1D6EC 1JWMD 4FLHA 3JSVB 2V0GA 4MGYE 3H1UA 3HM6X 1J7CA 3H7SA 1P1AA 3NG0A 1TGZB 1JWSD 1D5ZC 4MJSA 4LJOB 3T3OA 1NDDA 1WMHA 2KOXA 2MBBB 2FNJB 3I5JC 1KF6B 4G50A 5D94A 3KWVA 2BYEA 4DHZE 4P1CC 5T8IA 1Q1OA 1V8CA 3NZSA 3RI7C 1IGDA 1EM7A 1FO4A 4KDIC 4EFOA 2M17A 1WM3A 3EUB2 4YXDB 3ML9A 3O65B 4HJKA 4M8MA 4XZ4A 4GOCA 3SU8X 3VDZA 5H92C 3RZWC 4ZRQA 2KQSA 1XT9B 3EGRA 3PRZA 4GDLA 4M01A 5J18A 1ET6A 2WS3B 3KYDD 2LGIA 3OLMD 2FCQA 3Q2AC 3MC8A 2CR5A 2DYMA 1YX6B 1XXGA 4KIKA 1HTQA 2ZNVB 1RAXA 3AEDB 4MSMB 4W9EA 1AW7A 5EE1A 3PGEA 4D2KA 1V5OA 1LM8B 1WXAA 1SSNA 3ZNZB 3NOBA 3H6NA 3WALA 2IZVB 2B76B 4G11A 2KQ4X 4P7IA 4C4VB 5H8YE 2WQYB 4G3XB 4M02A 2KJ6A 3SD5A 4N9F4 1XCTL 1E10A 3RN9C 2JYTA 3OAWA 2O6VD 2UYZB 2K8HA 5MPOA 4DQOC 3QHTA 1B9RA 2Y5PA 4EUTA 1YN4A 1KJTA 3PVLA 4ARCA 3NY5A 1TY2A 3JSVA 2DZIA 3VQIA 2FAZA 4NQKE 2CJNA 2KLGA 2E6XA 1C4CA 3MHZA 2KKCA 4BKTA 2HTHA 3DVGY 4BOZB 3MC0B 1XD3B 2JZ3B 2KMAA 3D32A 2GBMA 1VCBA 3V60A 4LNKA 1WMHB 1VLBA 1V97A 3ZJVA 1QOGA 2BTEA 1TS3A 2D3AA 1WE6A 3VUXA 2RR9A 1UNSA 2WDRB 3FKYA 3W2DA 1V1PA 2XBBC 2RGFA 1I4PA 3N3KB 4HDQA 1SB3C 2JU6X 3UQBA 2Y5CA 2M0XA 3TUOA 4JLCA 1HQRD 1S1QB 2H89B 1WE7A 1FFVA 3AE2B 3B08A 2L76A 4TV3A 4XE0A 1EU3A 1MPEA 1R4NB 3PV1A 1SF0A 3V6CB 3VH3B 4B0EA 1C1YB 3MTNB 3EC8A 2ZEQA 1MI0A 3U52E 1RLFA 3J9CA 1P3QU 3ZTCA 3I9V1 3Q3MC 1GAQB 4KIKB 3CMMB 1GPXA 2N7JA 3AN1A 2N7DA 4ACFA 2K39A 4NAMA 2ICIA 2INDC 3IHPC 4KV2A 2EKEC 2DZMA 2WNMA 2PJHA 1YJJA 3RD2A 2V3SA 1YX5B 3L54A 2FBWB 4WQOB 3L16A 4OZCA 4NZLB 1E8XA 2J0MA 2JXTA 4ANXA 3RNGC 5IO9A 4HPPA 3L10B 3WAMA 4EZLA 3K9OB 4GIVA 2W55A 2MWSB 4FXCA 1JWAD 2QC8A 2NBVB 2LGXA 4FADA 2BW2A 2KDBA 3VH4B 3DBSA 3GS2A 3DWMA 3CIRB 1L4ZB 2MJDA 4LNIA 3NS8A 2K3UA 3ENEA 1E7UA 2KDFB 2D5GA 2IYDB 1KLUD 1SE3A 3A1QB 3AULA 1WX8A 1UELA 4CO7A 3W5VB 4DHZB 3U4EG 4US9A 3AM9A 4DBGA 4FHJA 1ZE3D 2HTME 1RWSA 2KC2A 2M4NA 1X1MA 2KVRA 3ZYYX 4YTNB 1WGRA 1RYJA 1J8CA 2WP9B 1SJED 2KDEB 4RGMA 2N1WA 1LQBA 1K8RB 4DK5A 3BVGA 4HJGE 2KXJA 4XYCA 3VTVA 4KX6B 3NHEB 1TJEA 3KQ4A 3BZDB 2JRIB 2WXLA 1CMXB 2C7MB 4EE2A 2IBIB 1WRIA 1EF1A 2HJ1A 4KGRA 3JVZX 2JT4B 3MJWA 1ZKHA 2L8JA 3KW5B 2C7NB 2L0FA 3N20C 2R61A 5G5GA 1SIJA 1OEYA 1TY0A 2DYBA 2KYWA 4NY0A 2OHFA 2KNBA 1GG3A 2DZKA 1JCKB 1VDVA 2DHZA 2KTRB 3U30A 3ONSA 3APCA 2JWUA 4IM2A 1P7FA 2AQ3B 4ICVA 2WXQA 1F52A 2K6DB 1WGKA 4CYEA 4DHJB 1T6BX 4X57B 5EE9A 3OWEB 2ZJDA 2BQQA 1KFYB 5DPWA 4W9CA 2BYVE 1TZ1A 3BYTB 3EECA 5FR6A 4OVVA 2WXJA 1WJNA 4RGNA 4BBNF 1WWTA 3TBLD 1OEYJ 1ZUD2 3NJTA 1QKZA 1CZPA 2PE6B 2X8XX 4LDTD 4KGTA 3UIOB 4K3CA 3VR9B 3GE3C 5E6JA 3P4RB 5IOIA 4GDKB 2MA9B 4DXFA 2BWFA 2V1YA 2MJ3A 5JHAA 1K53A 4BKGA 4GGQA 2HJ8A 3V61A 2TSSA 3L13A 4ARIA 4GDLB 1WGDA 3RULA 3UI3A 3VRBB 3AV8A 2WHIA 4E74A 2N4FA 4ANWA 3AEAB 2LRUA 4KGSA 1FNWA 2KANA 4LTUA 2MH7A 1FRDA 3DVNV 2JYEA 3AH7A 2WDTB 4LK0M 4WJPA 2BF8B 1XEEA 4MEMA 3Q8AA 3N1ZC 2WXPA 5DPRA 1I42A 2OJWA 4FULA 4CHKA 2GBKA 3ZNID 2KAJA 2LASA 5J17A 4C4VA 2I1JA 4ANUA 1OFFA 3RNAC 2INPE 3TEZA 2MBEA 2BYFA 4AQ7A 2BS2B 1SE9A 2LUMA 4OW0A 1VZ6A 2L1AA 4BOSC 2BVCA 3AE6B 4XGAB 3R7QA 1QOFA 2BS4B 4YWGG 1DOXA 2KX3A 5BMGA 3QWZB 3RNEC 1I4QA 3R2TA 2GBNA 1AYFA 2EKIA 1E0ZA 4M0WA 1YJIA 4AJWA 4XDDA 2WWZA 3H9DA 2L0TA 2LHEA 2KK8A 1IP9A 3H7PB 4PYUA 3TMPB 4RMAA 4WWOA 2IO1B 1BT0A 1ZGUB 4JX1C 1EWYC 5LXIB 3X0WA 2UWQA 1TBEA 3L17A 3I3TB 3TL5A 1EWCA 2EMTA 3M95A 4OZBA 4KSLC 5BMHA 3RMKC 1WGYA 2J53A 4K1RB 2R2QA 2FCNA 5DCNA 1C78A 1PGXA 1Q5WB 1SXTA 2MP2A 2M0AA 3ZVVA 1T0QC 3Q8EA 4BZAA 3ZDTA 5HG2A 3IAS1 1YQ4B 1R4NI 1MHXA 2QDFA 2DYOA 3C19A 4IW0A 2OOBB 4H2AA 2NCNA 3DHGC 3TEYA 1IUEA 4MGZE 2LGDA 1U4AA 1SJHD 2JF5A 2ZNVC 2BS3B 4RCOA 2J4XA 2KLCA 4DDID 4FJZA 2CHZA 1T0RC 1L5PA 3PHXB 4OHJA 3M63B 1Z5SB 3AECB 3DBLI 2O6VB 3LB8C 5AZFA 4HWIB 4E71A 3A33B 3T9LA 4AP4C 1DOIA 4HROA 3O13A 4RH6A 4RGOS 3N1YC 4HCPB 4KZ0A 5G55A 1E8YA 2WXGA 3HK0A 3MFGA 4G0NB 4WJQA 3HVDA 2X38A 2IGGA 3B1LX 4ZRKA 1MG8A 2JQRB 4GN1A 3APFA 2KFKB 4IOIE 5GXGB 2ZPYA 1XLNA 3IT4B 1IGCA 2WXMA 4W9HA 3AEFB 4WQMA 3U2SC 1ZXHA 3AE9B 1CK1A 5KHOA 4YSYB 2AL6A 2JVCA 4MGKE 2WXFA 3AE1B 1FXAA 3A4SC 1TS4A 1D3ZA 1GUAB 3ZW3A 4II2B 4S0RA 4NPNA 2DAJA 3AEGB 4LLGM 1L2NA 1NYQA 2L00B 4IWPA 3AU4A 5FKAC 1N62A 3APDA 4ZRJA 2WU2B 2QJLA 1GB4A 2KACA 1FEHA 1V6EA 1VR9A 1L7YA 2KX0A 2PTLA 3A4RA 3LYYA 5EE0A 3RYTA 1ZDVA 2PMVA 3ALBA 1ZOYB 1MHHE 3DBHB 4ZYNA 1E90A 2IO2B 4P6VF 4UDUC 1VD2A 3SFDB 4EZJA 3DHHC 1TKGA 1I4GA 4RNAA 2PKOA 3ZRCA 2ASQA 2LI5A 2NMQA 2NTTA 3ZGZA 2BKFA 3DBRI 4ZRPA 2Y5BB 1AWDA 1UF0A 3SEBA 4BBNC 4PT5A 3BWUD 2GLSA 1ZW7A 4HXDA 2GOWA 4OVUA 4A55A 1ACCA 2L7RA 3L08A 3QQ8B 3VXWA 4A8XC 2KT7A 1EUVB 4B6WA 2MBHA 2RD0A 5G2NA 1T5XD 3C8YA 3MP9A 5D7GA 3DBRB 5DPTA 2LMCA 3A9KA 4W9KA 3BK1A 4F7ZA 4KVGB 3DVNU 2MEKA 3QK0A 2LVOA 4W9DA 1C77A 2BWES 4B9KA 1ISNA 5IAAC 4JPSA 3BINA 4NQLB 2WX0A 3R2IA 1V9JA 3QJZA 2J0JA 4IWQA 1JROA 5TR5A 3GZNB 3PLVA 1FNVA 3HIZA 4FA6A 3TCAA 2AQ2B 2KTRA 3EFUA 3FILA 4PS8A 2L32A 4YTMB 3PS6A 1WF9A 3VTWA 5DPSA 5BYQA 4EZKA 4FJVB 1K50A 1FIQA 3JW0X 5D3DA 2UU7A 4K3BA 3X23A 3P4QB 3PREA 2SAKA 1ESFA 4TKNA 3FC4A 1T0YA 2V4IB 4LNNA 5AUIA 2RDBC 2V4LA 3NVVA 2WXKA 3LXFA 1WYGA 1JWUD 2K0PA 4WURA 2MJEA 2MHJA 1J19A 2PW9A 1TKEA 4B0MA 4BKSA 4L1BA 1F2RC 1BUIC 2BBCA 2Z0DB 3GB1A 1NENB 2FCMA 3ZQ4A 2BT6A 1VZ7A 3V62A 1KLVA 4I6PA 1OTRB 2LVPA 2WLBA 1YMHE 4IWOA 3PZ8A 1WX9A 3U7ZA 3N32A 3AMZA 3PRPB 2KVZA 1ENFA 2NR2A 2LJ5A 4WJOA 2K9XA 1QZEA 3TSSA 2NS5A 1YJ1A 1KTKA 3PT2B 4GB9A 3ZXRA 2QEJC 3V05A 1WR1A 2PVOD 1FXIA 2LXCA 2O2VB 1XLOA 3A9JA 2N1VA 3EA6A 1C4AA 2DNFA 3V6EB 3KVFB 3QAQA 4ZHPA 3ZIMA 2LWPA 3VR8B 3ZO5B 3AE4B 1VRAB 4RF1A 3VUWA 1WFYA 4KSKC 1YQBA 4YSZB 4FHKA 3HHMA 4ZOHC 5JH5C 2O6VA 3H8HA 4TQ1A 4MDKE 1FNUA 1KH0A 2JXXA 4TSSA 1ROEA 1OGWA 3Q3FA 3VUYA 4QAYA 1IYFA 4XX5A 4F8CB 3CSFA 4K81A 2J0KA 1IBXB 1V49A 2KN5A 1QOBA 3DVGX 2N9KA 2K1FA 2Z59B 1N6ZA 2G1EA 2INNE 3SFEB 2LUEA 3CF6E 3P63A 1B1ZA 5AEKB 3DHIC 3ABVB 1GB1A 1T3QA 2JUOA 1WJUA 4WWPA 2LD9A 2HE7A 1E8ZA 1E9MA 3PO0A 1TIFA 1RFAA 1JQ4A 2DENB 2MP2B 1WZ3A 4HVBA 2ZPNA 1YN3A 2AL3A 4GMVA 4OZAA 1JMLA 5BYSA 5JXVA 4B95A 5C2TB 1FFUA 3WA0A 2G4DB 3KYCD 1MFWA 1UWXA 1M94A 4C7YA 3H7PA 4OVZA 2PPHA 2N7EA 3RPFC 2IPKD 2ZVNA 2CHWA 2BB6A 3S2AA 1XCQL 3GP7A 3E56A 2JX5A 5EDSA 2KWUB 2IDYA 4BKSD 2HD5B 2VH2A 4L2YA 1TTNA 3ETRA 1VJKA 3QX1A 1ZP0B 1J7BA 2NBUA 3LDZE 1H4RA 1HTOA 3W1YA 2YEPB 3PZDA 4K7UA 1SE2A 3ML8A 4XWTA 1P98A 4C7ZA 3FAHA 2FCSA 2O2VA 5G5HA 2DZJA 4W9JA 2FIFA 1FMAD 4WWNA 1TZOA 1P0RA 3AU5A 1ET9A 1GJZA 5EE3A 2EELA 2AWTA 1WXVA 3WCQA 3Q8BA 4HPMB 1MJDA 2LFIA 4RM9A 2Z0EB 1OQQA 2D10A 2C7HA 1YNTE 2Z8LA 2WX1A 2CS4A 2W54A 3IVFA 2G9HD 1IBXA 4S17A 3BK2A 3A9JB 3AI5A 1V81A 4KKJA 2IJ0A 4HPLB 1FRRA 1TT5B 5D2MB 2INCC 4TUUA 5L83A 1UBIA 4JGHB 2M8SA 3W9CB 1HZ6A 4NNJB 4KKIA 1UZXB 2ZCBA 2KQ7A 2CKHB 2V9HA 1NEKB 2WXNA 1CJEA 4NJ7A 2KJRA 4C56C 1P7EA 1WZ0A 2D3BA 2GRIA 4IKGA 1E8WA 5AUKA 2JY6A 2KDIA 4HEA1 1PDXA 3MHSD 3W1SA 2KD0A 3RNFC 3BY4B 5BYRA 2NVUI 2GI9A 1HA5A 4EOYA 4HRSA 3ZTDA 4RF0A 1ZPSA 2DX5B 3B9JA 3ZJUA 4N59A 4CQNA 4HKQA 2XK5B 1AARA 1TYGB 3TEXA 3URYA 2DLBA 2AQ1B 2KMMA 1SE4A 2WDVB 4NAWA 2JRHA 1UD7A 2YLMA 5AZHA 1FXTB 1TS5A 1EF5A 4XC2A 2C5LC 2M19A 3QC8B 4A9AA 1JW9D 2JZZA 4C80A 2DWQA 1PQSA 4ZHOA 3ECIA 1C76A 2RDHA 3KUCB 4GU2A 4XDCA 4MH0E 3ZJTA 2VZKD 1XF5L 3Q8CA 1I4XA 3QCAA 2K6QA 4N58A 1TS2A 2MSED 2W9NA 3DCGA 2CHXA 5IP4D 2KFJA 4RM8A 3P4PB 3PHWB 4PS3A 1R4MB 3B0AA 3Q3JA 3OJ3A 1D5XC 2K25A 1FCLA 2D11A 3AE5B 1C3TA 1NI3A 4MM3A 4Q2JA 4WAFA 3NVZA 2FUG1 1PGAA 4W9GA 2GB1A 1J7AA 4IM0A 2QMTA 3NS1A 4A20A 1H8CA 4L23A 3WIMA 1N63A 1LGRA 1ZXIA 3I57A 1EO6A 1IPGA 2H88B 4MT5A 3DQVA 1Z2MA 3PRMB 2MX2A 4YTPB 3HM3A 2AEHA 2KO3A 1I4HA 4C00A 3BYYB 1WY8A 3Q3OC 2MRPA 4DHJD 1K51A 3SDLC 4EEWA 3MC9A 3FILB 3DOWA 2V3NA 3R7RA 3QIJA 2ZW1A 4NJ6A 2J52A 4MGIE 1WXSA 4DDGD 3VFKA
chains in the Genus database with same CATH topology
3KW5B 3TCAA 2L0FA 2KTRA 3EFUA 2FIDA 4PS8A 2CU1A 3RZFA 1OEYA 3C0RB 2DYBA 3PS6A 4NY0A 5KHQA 4AOFA 1WF9A 2YVCA 2KNBA 3P2BA 4W9IA 2K8BA 5AZGA 1GG3A 3VTWA 1Q0WB 5DPSA 4EZKA 3KUZA 2DZKA 4FJVB 3PSEB 2NBWB 2DHZA 3JYUA 2EMSA 4GXBA 1WYWB 2KTRB 3GZNI 3JW0X 1WGHA 3U30A 3ONSA 3APCA 3UQAA 4K7SA 3X23A 3PREA 4IM2A 5C23A 4W9LA 4TKNA 4ICVA 1XQQA 5C1ZA 5JHBA 2GBRA 5LXHA 1T0YA 2K6DB 4CYEA 4DHJB 4GDKA 4X57B 3TJPA 2MLBA 2XK5A 3QARA 2V4LA 3VAWA 1WGGA 4MELA 2ZJDA 5DPWA 4LDTB 4W9CA 1J19A 2BYVE 4ASWC 1WH3A 4NAWB 1TZ1A 4BKSA 2N9EB 2R2OA 3EECA 1F9JA 5FR6A 4OVVA 3RUIB 3UIPB 2Z0DB 1KM7A 2KFKA 3PTFC 2FCMA 4EKUA 4BFRA 5D6JB 2D2QA 4LJPB 5CTRC 3V62A 1KLVA 4I6PA 5E6PA 5CHVC 1WJNA 1UH6A 1OTRB 2LVPA 4URKA 2GBJA 3CSTA 4LCDE 4BBNF 1G6JA 2KJHB 1OQYA 2KMCA 1I35A 4IWOA 3TBLD 1OEYJ 1WX9A 2IY1B 3N32A 3PRPB 3N30A 1Y8RC 2PE6B 4LDTD 2NR2A 3TIXA 1SIFA 2LJ5A 4WJOA 1QZEA 2NS5A 1YJ1A 3UIOB 4M0WB 5IA7A 3W1SC 3PT2B 2VRRB 2KC1A 3QA8A 4GB9A 3VHTC 2LVQA 2NPTA 1WR1A 2KWCA 5E6OA 2ZVOA 3ZNHB 2LXCA 2O2VB 4GDKB 1WIAA 2A4ZA 3A9JA 2MA9B 2N1VA 2BWFA 5CX3A 2V1YA 4ZDVA 5JHAA 3V6EB 3KVFB 3QAQA 4BKGA 1WM2A 4GGQA 2HJ8A 3ZIMA 2LWPA 2MW5A 4FLHA 3V61A 4JIOU 3ZO5B 3JSVB 4MGYE 3L13A 3DPDA 4GDLB 1WGDA 3ZUNA 3H1UA 3VUWA 5L95C 1WFYA 4KSKC 1YQBA 4FHKA 3HM6X 3HHMA 5JH5C 4HK2A 2O6VA 3RULA 3H7SA 4TQ1A 4MDKE 2ZZPB 2JXXA 4E74A 2N4FA 1OGWA 4ANWA 3Q3FA 3K9PB 1P1AA 2LRUA 2LRWA 2KANA 2LGYA 3VUYA 1TGZB 1IYFA 2M1MA 4XX5A 4F8CB 3CSFA 4MJSA 4LJOB 4K81A 2J0KA 2N9PC 1NDDA 3DVNV 1WMHA 1V49A 2KN5A 2LZ6A 3DVGX 2N9XA 2KOXA 2K1FA 2Z59B 2WDTB 3IBEA 4WJPA 2KTFA 2MBBB 2BF8B 4MEMA 2FNJB 2L3ZA 3L0WB 2LUEA 1S3SG 3CF6E 5DPRA 1I42A 4A3PA 4FULA 3WAOA 4CHKA 2GBKA 5AEKB 4G50A 5D94A 3ZNID 2BYEA 2LASA 1UBQA 4W9FA 4DHZE 5J17A 2JUOA 2I1JA 1WJUA 4ANUA 4WWPA 2LD9A 1Q1OA 2HE7A 1E8ZA 3NZSA 2MBEA 2BYFA 4KDIC 4EFOA 2M17A 2C9WB 1SE9A 1WM3A 4WJNA 4K7WA 2JPHA 1RFAA 1YIWA 3PPAA 4BOSC 3ML9A 3O65B 4HJKA 2DENB 3A1QA 4FA6A 4M8MA 3AXCA 2MP2B 4GOCA 4XZ4A 1WZ3A 3R7QA 2ZPNA 2AL3A 3SU8X 3VDZA 2KX3A 4HVBA 2D07B 1GNUA 2DAFA 4GMVA 3QWZB 2GBNA 2RPQA 3RZWC 2KQSA 4HDOA 4B95A 1XT9B 3PRZA 4GDLA 3WA0A 2G4DB 5J18A 3KYCD 4AJWA 1M94A 3KYDD 3H7PA 3OLMD 4FBJB 3KH0A 2WWZA 1SGHA 2FCQA 1P9DU 3H9DA 2PPHA 2B3AA 2N7EA 2L0TA 1V80A 2CR5A 2DYMA 4PYZA 1YX6B 2ZVNA 2CHWA 4KIKA 2G45B 2KK8A 3S2AA 2IO3B 2OJRA 5EDSA 2KWUB 1IP9A 4BKSD 3H7PB 2ZNVB 4PYUA 2HD5B 1RAXA 4MSMB 4RMAA 4W9EA 2IO1B 4WWOA 3TMPB 1BT0A 1ZGUB 1TTNA 5LXIB 3PGEA 2MBOA 2QHOA 2UWQA 3X0WA 3QX1A 1V5OA 1LM8B 1TBEA 2NBUA 3L17A 3I3TB 1WXAA 3LDZE 3ZNZB 1H4RA 4IG7B 3NOBA 3H6NA 3WALA 2IZVB 4G11A 3TL5A 4P7IA 3M62B 2EMTA 3M95A 4G3XB 4KSLC 3W1YA 2KJ6A 3PZDA 3SD5A 4K7UA 4N9F4 1WGYA 4K1RB 2BGFA 2R2QA 2FCNA 1LXDA 3ML8A 4TQ0A 1P98A 5DCNA 1WRDB 3OAWA 2O6VD 5E6NA 2FCSA 2UYZB 3GOEA 3RCZA 2K8HA 2LXAA 2O2VA 3QHTA 1Q5WB 1GC6A 4J6IA 2MP2A 2DZJA 2FIFA 4W9JA 3LJ3A 4EUTA 1WR6E 4WWNA 3IFWB 4FJYA 3ZVVA 3ZNGC 1KJTA 1P0RA 3AU5A 3PVLA 3NY5A 3ZDTA 3DBHI 3JSVA 2L05A 2DZIA 1GJZA 3VQIA 2FAZA 4NQKE 3ZDMC 1R4NI 2AWTA 2KLGA 1WXVA 2DYOA 2REXA 3U8ZA 4IW0A 2OOBB 4HPMB 2KKCA 2NCNA 3UGBB 4BKTA 2HTHA 1UGMA 4AUQC 3DVGY 4MGZE 2IO0B 2JWZA 2LGDA 4RM9A 1U4AA 4BOZB 1XD3B 2G3QB 4KZCA 2Z0EB 2JF5A 2D10A 2C7HA 1KOTA 2JZ3B 2KMAA 2WX1A 2ZNVC 2GBMA 3D32A 4IM3A 2CS4A 2K8CA 1VCBA 2KLCA 3RT3B 3IVFA 4FJZA 3V60A 2CHZA 4DDID 1WMHB 3T8MA 1J0GA 3PHXB 3VTUA 3A9JB 3AI5A 1Z5SB 3M63B 1V81A 2O6VB 3DBLI 4A3OA 4HPLB 5AZFA 5D2MB 4HWIB 4E71A 2BPSA 1WE6A 3A33B 4TUUA 3T9LA 5L83A 4DXAB 3VUXA 1UBIA 2RR9A 2XEWA 4JGHB 4AP4C 2M8SA 2XBBC 2RGFA 4NNJB 3ZKJC 1UZXB 1NBFC 2ZCBA 4HCPB 4KZ0A 2KQ7A 2CKHB 3N3KB 5G55A 4AJYB 4HDQA 2D3GA 1E8YA 4NJ7A 2KJRA 3HK0A 1V5TA 4G0NB 4WJQA 4WAAA 1WZ0A 3UQBA 2M0XA 3B1LX 4ZRKA 1MG8A 4JLCA 1RRBA 5J2RA 1E8WA 1S1QB 2JY6A 4MSQB 4GN1A 2KDIA 3APFA 2RSUA 4ANVA 3MHSD 3W1SA 1WE7A 2KD0A 2KFKB 4HLEA 3BY4B 3SHQA 2NVUI 3VVWB 4BVUC 2ZPYA 2C60A 4EOYA 3B08A 2L76A 4TV3A 2WYQA 3ZTDA 1HE8A 4I6LB 2A5UA 4W9HA 4AWJA 5HKHA 4HCNB 2DX5B 4YL8A 3PV1A 3V6CB 2PE9A 3VH3B 1C1YB 3MTNB 2XK5B 3EC8A 1AARA 2ZEQA 5KHOA 2AL6A 3R66C 3ZLZA 2JVCA 4MGKE 1RLFA 2IY0B 1P3QU 3A4SC 3ZTCA 1D3ZA 1GUAB 4KIKB 3CMMB 3ZW3A 4II2B 2N7DA 2K39A 4NPNA 4NAWA 1WJ4A 5JZEB 2DAJA 3IHPC 2JRHA 1UD7A 2YLMA 4KV2A 4GSWA 5AZHA 5BO4B 2EKEC 2DZMA 1FXTB 3IG3A 1L2NA 1LFDA 2KZRA 1EF5A 2L00B 4IWPA 2PJHA 5GMVA 3AU4A 4XC2A 2C5LC 2MCNB 4ZRJA 2V3SA 3APDA 3RD2A 3QC8B 4E3CA 1YX5B 3L54A 4WQOB 3L16A 1E8XA 2JZZA 3U7DA 2J0MA 1YD8U 2PEAA 1PQSA 3ZRFA 1V6EA 2KX0A 1L7YA 4ANXA 3A4RA 3RYTA 3ECIA 3L10B 3WAMA 1GC7A 4EZLA 3ALBA 3UF8A 3K9OB 4IUMB 4ZRIA 3PLUA 4ZYNA 1WI0A 3KUCB 1E90A 2IO2B 4GU2A 4MH0E 1VD2A 4GIVA 4I6NB 1A5RA 3A9KB 4EZJA 2MWSB 2G4SA 3QCAA 2K6QA 2NBVB 2LGXA 3ZRCA 1V2YA 4FADA 2MSED 2W9NA 1E7VA 2ASQA 2KDBA 2BKRB 2LI5A 5LLIA 3UINB 3VH4B 3DBSA 1JRUA 2BKFA 3DCGA 2CHXA 2KFJA 3DBRI 2ZCCA 4RM8A 1NI2A 2Y5BB 4PS7A 3PHWB 4PS3A 3NS8A 4BBNC 3ENEA 1E7UA 2I1KA 3B0AA 5CHWA 3Q3JA 3OJ3A 3DDCB 2KDFB 2K25A 2IYDB 3EHVA 2KHWB 4FN2A 1ZW7A 3NZUA 4HXDA 2D11A 4MJSB 2NPTB 3A1QB 3WAPA 2GOWA 4OVUA 1R4MI 3AULA 1WX8A 2L7RA 3L08A 1C3TA 1UELA 4MM3A 4CO7A 3QQ8B 4DHZB 3VXWA 4W9GA 4II3B 2KWVB 1EUVB 4IM0A 2MBQA 4DBGA 4B6WA 4M8NA 4FHJA 5CHFA 4A20A 2MBHA 2RD0A 1H8CA 2KC2A 2M4NA 1X1MA 5G2NA 3WIMA 2MQJA 2KVRA 2J7QB 3OJ4B 1WGRA 3KUDB 4ICUA 5D7GA 1J8CA 4IC7B 1EO6A 5DPTA 1IPGA 2KDEB 1Z2MA 2AYOB 3A9KA 3DQVA 2MX2A 3PRMB 4W9KA 1WJ6A 4F7ZA 3HM3A 2C7NB 2AEHA 4KVGB 2N1WA 2KO3A 3DVNU 3WANA 3QK0A 2GMIC 1LQBA 1K8RB 2LVOA 1E5WA 1WY8A 3M3JA 4W9DA 4DK5A 1V86A 4JQWC 2BWES 2FUHB 2MRPA 4DHJD 4B9KA 2KXJA 3VTVA 1ISNA 3NHEB 4KDLB 3SDLC 4EEWA 5IAAC 2JRIB 3BINA 4JL9A 3DOWA 4NQLB 1CMXB 2C7MB 2WX0A 3R7RA 3QIJA 4DWFA 4NJ6A 2IBIB 1V9JA 1WXMA 1EF1A 4MGIE 3QJZA 2J0JA 2JT4B 3JVZX 3MJWA 4IWQA 1ZKHA 1WXSA 5TR5A 3R3MA 4DDGD 4F1SA 3PLVA 1WX7A 3HIZA 3VFKA 2L8JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KW5 B;  3TCA A;  2L0F A;  2KTR A;  3EFU A;  2FID A;  4PS8 A;  2CU1 A;  3RZF A;  1OEY A;  3C0R B;  2DYB A;  3PS6 A;  4NY0 A;  5KHQ A;  4AOF A;  1WF9 A;  2YVC A;  2KNB A;  3P2B A;  4W9I A;  2K8B A;  5AZG A;  1GG3 A;  3VTW A;  1Q0W B;  5DPS A;  4EZK A;  3KUZ A;  2DZK A;  4FJV B;  3PSE B;  2NBW B;  2DHZ A;  3JYU A;  2EMS A;  4GXB A;  1WYW B;  2KTR B;  3GZN I;  3JW0 X;  1WGH A;  3U30 A;  3ONS A;  3APC A;  3UQA A;  4K7S A;  3X23 A;  3PRE A;  4IM2 A;  5C23 A;  4W9L A;  4TKN A;  4ICV A;  1XQQ A;  5C1Z A;  5JHB A;  2GBR A;  5LXH A;  1T0Y A;  2K6D B;  4CYE A;  4DHJ B;  4GDK A;  4X57 B;  3TJP A;  2MLB A;  2XK5 A;  3QAR A;  2V4L A;  3VAW A;  1WGG A;  4MEL A;  2ZJD A;  5DPW A;  4LDT B;  4W9C A;  1J19 A;  2BYV E;  4ASW C;  1WH3 A;  4NAW B;  1TZ1 A;  4BKS A;  2N9E B;  2R2O A;  3EEC A;  1F9J A;  5FR6 A;  4OVV A;  3RUI B;  3UIP B;  2Z0D B;  1KM7 A;  2KFK A;  3PTF C;  2FCM A;  4EKU A;  4BFR A;  5D6J B;  2D2Q A;  4LJP B;  5CTR C;  3V62 A;  1KLV A;  4I6P A;  5E6P A;  5CHV C;  1WJN A;  1UH6 A;  1OTR B;  2LVP A;  4URK A;  2GBJ A;  3CST A;  4LCD E;  4BBN F;  1G6J A;  2KJH B;  1OQY A;  2KMC A;  1I35 A;  4IWO A;  3TBL D;  1OEY J;  1WX9 A;  2IY1 B;  3N32 A;  3PRP B;  3N30 A;  1Y8R C;  2PE6 B;  4LDT D;  2NR2 A;  3TIX A;  1SIF A;  2LJ5 A;  4WJO A;  1QZE A;  2NS5 A;  1YJ1 A;  3UIO B;  4M0W B;  5IA7 A;  3W1S C;  3PT2 B;  2VRR B;  2KC1 A;  3QA8 A;  4GB9 A;  3VHT C;  2LVQ A;  2NPT A;  1WR1 A;  2KWC A;  5E6O A;  2ZVO A;  3ZNH B;  2LXC A;  2O2V B;  4GDK B;  1WIA A;  2A4Z A;  3A9J A;  2MA9 B;  2N1V A;  2BWF A;  5CX3 A;  2V1Y A;  4ZDV A;  5JHA A;  3V6E B;  3KVF B;  3QAQ A;  4BKG A;  1WM2 A;  4GGQ A;  2HJ8 A;  3ZIM A;  2LWP A;  2MW5 A;  4FLH A;  3V61 A;  4JIO U;  3ZO5 B;  3JSV B;  4MGY E;  3L13 A;  3DPD A;  4GDL B;  1WGD A;  3ZUN A;  3H1U A;  3VUW A;  5L95 C;  1WFY A;  4KSK C;  1YQB A;  4FHK A;  3HM6 X;  3HHM A;  5JH5 C;  4HK2 A;  2O6V A;  3RUL A;  3H7S A;  4TQ1 A;  4MDK E;  2ZZP B;  2JXX A;  4E74 A;  2N4F A;  1OGW A;  4ANW A;  3Q3F A;  3K9P B;  1P1A A;  2LRU A;  2LRW A;  2KAN A;  2LGY A;  3VUY A;  1TGZ B;  1IYF A;  2M1M A;  4XX5 A;  4F8C B;  3CSF A;  4MJS A;  4LJO B;  4K81 A;  2J0K A;  2N9P C;  1NDD A;  3DVN V;  1WMH A;  1V49 A;  2KN5 A;  2LZ6 A;  3DVG X;  2N9X A;  2KOX A;  2K1F A;  2Z59 B;  2WDT B;  3IBE A;  4WJP A;  2KTF A;  2MBB B;  2BF8 B;  4MEM A;  2FNJ B;  2L3Z A;  3L0W B;  2LUE A;  1S3S G;  3CF6 E;  5DPR A;  1I42 A;  4A3P A;  4FUL A;  3WAO A;  4CHK A;  2GBK A;  5AEK B;  4G50 A;  5D94 A;  3ZNI D;  2BYE A;  2LAS A;  1UBQ A;  4W9F A;  4DHZ E;  5J17 A;  2JUO A;  2I1J A;  1WJU A;  4ANU A;  4WWP A;  2LD9 A;  1Q1O A;  2HE7 A;  1E8Z A;  3NZS A;  2MBE A;  2BYF A;  4KDI C;  4EFO A;  2M17 A;  2C9W B;  1SE9 A;  1WM3 A;  4WJN A;  4K7W A;  2JPH A;  1RFA A;  1YIW A;  3PPA A;  4BOS C;  3ML9 A;  3O65 B;  4HJK A;  2DEN B;  3A1Q A;  4FA6 A;  4M8M A;  3AXC A;  2MP2 B;  4GOC A;  4XZ4 A;  1WZ3 A;  3R7Q A;  2ZPN A;  2AL3 A;  3SU8 X;  3VDZ A;  2KX3 A;  4HVB A;  2D07 B;  1GNU A;  2DAF A;  4GMV A;  3QWZ B;  2GBN A;  2RPQ A;  3RZW C;  2KQS A;  4HDO A;  4B95 A;  1XT9 B;  3PRZ A;  4GDL A;  3WA0 A;  2G4D B;  5J18 A;  3KYC D;  4AJW A;  1M94 A;  3KYD D;  3H7P A;  3OLM D;  4FBJ B;  3KH0 A;  2WWZ A;  1SGH A;  2FCQ A;  1P9D U;  3H9D A;  2PPH A;  2B3A A;  2N7E A;  2L0T A;  1V80 A;  2CR5 A;  2DYM A;  4PYZ A;  1YX6 B;  2ZVN A;  2CHW A;  4KIK A;  2G45 B;  2KK8 A;  3S2A A;  2IO3 B;  2OJR A;  5EDS A;  2KWU B;  1IP9 A;  4BKS D;  3H7P B;  2ZNV B;  4PYU A;  2HD5 B;  1RAX A;  4MSM B;  4RMA A;  4W9E A;  2IO1 B;  4WWO A;  3TMP B;  1BT0 A;  1ZGU B;  1TTN A;  5LXI B;  3PGE A;  2MBO A;  2QHO A;  2UWQ A;  3X0W A;  3QX1 A;  1V5O A;  1LM8 B;  1TBE A;  2NBU A;  3L17 A;  3I3T B;  1WXA A;  3LDZ E;  3ZNZ B;  1H4R A;  4IG7 B;  3NOB A;  3H6N A;  3WAL A;  2IZV B;  4G11 A;  3TL5 A;  4P7I A;  3M62 B;  2EMT A;  3M95 A;  4G3X B;  4KSL C;  3W1Y A;  2KJ6 A;  3PZD A;  3SD5 A;  4K7U A;  4N9F 4;  1WGY A;  4K1R B;  2BGF A;  2R2Q A;  2FCN A;  1LXD A;  3ML8 A;  4TQ0 A;  1P98 A;  5DCN A;  1WRD B;  3OAW A;  2O6V D;  5E6N A;  2FCS A;  2UYZ B;  3GOE A;  3RCZ A;  2K8H A;  2LXA A;  2O2V A;  3QHT A;  1Q5W B;  1GC6 A;  4J6I A;  2MP2 A;  2DZJ A;  2FIF A;  4W9J A;  3LJ3 A;  4EUT A;  1WR6 E;  4WWN A;  3IFW B;  4FJY A;  3ZVV A;  3ZNG C;  1KJT A;  1P0R A;  3AU5 A;  3PVL A;  3NY5 A;  3ZDT A;  3DBH I;  3JSV A;  2L05 A;  2DZI A;  1GJZ A;  3VQI A;  2FAZ A;  4NQK E;  3ZDM C;  1R4N I;  2AWT A;  2KLG A;  1WXV A;  2DYO A;  2REX A;  3U8Z A;  4IW0 A;  2OOB B;  4HPM B;  2KKC A;  2NCN A;  3UGB B;  4BKT A;  2HTH A;  1UGM A;  4AUQ C;  3DVG Y;  4MGZ E;  2IO0 B;  2JWZ A;  2LGD A;  4RM9 A;  1U4A A;  4BOZ B;  1XD3 B;  2G3Q B;  4KZC A;  2Z0E B;  2JF5 A;  2D10 A;  2C7H A;  1KOT A;  2JZ3 B;  2KMA A;  2WX1 A;  2ZNV C;  2GBM A;  3D32 A;  4IM3 A;  2CS4 A;  2K8C A;  1VCB A;  2KLC A;  3RT3 B;  3IVF A;  4FJZ A;  3V60 A;  2CHZ A;  4DDI D;  1WMH B;  3T8M A;  1J0G A;  3PHX B;  3VTU A;  3A9J B;  3AI5 A;  1Z5S B;  3M63 B;  1V81 A;  2O6V B;  3DBL I;  4A3O A;  4HPL B;  5AZF A;  5D2M B;  4HWI B;  4E71 A;  2BPS A;  1WE6 A;  3A33 B;  4TUU A;  3T9L A;  5L83 A;  4DXA B;  3VUX A;  1UBI A;  2RR9 A;  2XEW A;  4JGH B;  4AP4 C;  2M8S A;  2XBB C;  2RGF A;  4NNJ B;  3ZKJ C;  1UZX B;  1NBF C;  2ZCB A;  4HCP B;  4KZ0 A;  2KQ7 A;  2CKH B;  3N3K B;  5G55 A;  4AJY B;  4HDQ A;  2D3G A;  1E8Y A;  4NJ7 A;  2KJR A;  3HK0 A;  1V5T A;  4G0N B;  4WJQ A;  4WAA A;  1WZ0 A;  3UQB A;  2M0X A;  3B1L X;  4ZRK A;  1MG8 A;  4JLC A;  1RRB A;  5J2R A;  1E8W A;  1S1Q B;  2JY6 A;  4MSQ B;  4GN1 A;  2KDI A;  3APF A;  2RSU A;  4ANV A;  3MHS D;  3W1S A;  1WE7 A;  2KD0 A;  2KFK B;  4HLE A;  3BY4 B;  3SHQ A;  2NVU I;  3VVW B;  4BVU C;  2ZPY A;  2C60 A;  4EOY A;  3B08 A;  2L76 A;  4TV3 A;  2WYQ A;  3ZTD A;  1HE8 A;  4I6L B;  2A5U A;  4W9H A;  4AWJ A;  5HKH A;  4HCN B;  2DX5 B;  4YL8 A;  3PV1 A;  3V6C B;  2PE9 A;  3VH3 B;  1C1Y B;  3MTN B;  2XK5 B;  3EC8 A;  1AAR A;  2ZEQ A;  5KHO A;  2AL6 A;  3R66 C;  3ZLZ A;  2JVC A;  4MGK E;  1RLF A;  2IY0 B;  1P3Q U;  3A4S C;  3ZTC A;  1D3Z A;  1GUA B;  4KIK B;  3CMM B;  3ZW3 A;  4II2 B;  2N7D A;  2K39 A;  4NPN A;  4NAW A;  1WJ4 A;  5JZE B;  2DAJ A;  3IHP C;  2JRH A;  1UD7 A;  2YLM A;  4KV2 A;  4GSW A;  5AZH A;  5BO4 B;  2EKE C;  2DZM A;  1FXT B;  3IG3 A;  1L2N A;  1LFD A;  2KZR A;  1EF5 A;  2L00 B;  4IWP A;  2PJH A;  5GMV A;  3AU4 A;  4XC2 A;  2C5L C;  2MCN B;  4ZRJ A;  2V3S A;  3APD A;  3RD2 A;  3QC8 B;  4E3C A;  1YX5 B;  3L54 A;  4WQO B;  3L16 A;  1E8X A;  2JZZ A;  3U7D A;  2J0M A;  1YD8 U;  2PEA A;  1PQS A;  3ZRF A;  1V6E A;  2KX0 A;  1L7Y A;  4ANX A;  3A4R A;  3RYT A;  3ECI A;  3L10 B;  3WAM A;  1GC7 A;  4EZL A;  3ALB A;  3UF8 A;  3K9O B;  4IUM B;  4ZRI A;  3PLU A;  4ZYN A;  1WI0 A;  3KUC B;  1E90 A;  2IO2 B;  4GU2 A;  4MH0 E;  1VD2 A;  4GIV A;  4I6N B;  1A5R A;  3A9K B;  4EZJ A;  2MWS B;  2G4S A;  3QCA A;  2K6Q A;  2NBV B;  2LGX A;  3ZRC A;  1V2Y A;  4FAD A;  2MSE D;  2W9N A;  1E7V A;  2ASQ A;  2KDB A;  2BKR B;  2LI5 A;  5LLI A;  3UIN B;  3VH4 B;  3DBS A;  1JRU A;  2BKF A;  3DCG A;  2CHX A;  2KFJ A;  3DBR I;  2ZCC A;  4RM8 A;  1NI2 A;  2Y5B B;  4PS7 A;  3PHW B;  4PS3 A;  3NS8 A;  4BBN C;  3ENE A;  1E7U A;  2I1K A;  3B0A A;  5CHW A;  3Q3J A;  3OJ3 A;  3DDC B;  2KDF B;  2K25 A;  2IYD B;  3EHV A;  2KHW B;  4FN2 A;  1ZW7 A;  3NZU A;  4HXD A;  2D11 A;  4MJS B;  2NPT B;  3A1Q B;  3WAP A;  2GOW A;  4OVU A;  1R4M I;  3AUL A;  1WX8 A;  2L7R A;  3L08 A;  1C3T A;  1UEL A;  4MM3 A;  4CO7 A;  3QQ8 B;  4DHZ B;  3VXW A;  4W9G A;  4II3 B;  2KWV B;  1EUV B;  4IM0 A;  2MBQ A;  4DBG A;  4B6W A;  4M8N A;  4FHJ A;  5CHF A;  4A20 A;  2MBH A;  2RD0 A;  1H8C A;  2KC2 A;  2M4N A;  1X1M A;  5G2N A;  3WIM A;  2MQJ A;  2KVR A;  2J7Q B;  3OJ4 B;  1WGR A;  3KUD B;  4ICU A;  5D7G A;  1J8C A;  4IC7 B;  1EO6 A;  5DPT A;  1IPG A;  2KDE B;  1Z2M A;  2AYO B;  3A9K A;  3DQV A;  2MX2 A;  3PRM B;  4W9K A;  1WJ6 A;  4F7Z A;  3HM3 A;  2C7N B;  2AEH A;  4KVG B;  2N1W A;  2KO3 A;  3DVN U;  3WAN A;  3QK0 A;  2GMI C;  1LQB A;  1K8R B;  2LVO A;  1E5W A;  1WY8 A;  3M3J A;  4W9D A;  4DK5 A;  1V86 A;  4JQW C;  2BWE S;  2FUH B;  2MRP A;  4DHJ D;  4B9K A;  2KXJ A;  3VTV A;  1ISN A;  3NHE B;  4KDL B;  3SDL C;  4EEW A;  5IAA C;  2JRI B;  3BIN A;  4JL9 A;  3DOW A;  4NQL B;  1CMX B;  2C7M B;  2WX0 A;  3R7R A;  3QIJ A;  4DWF A;  4NJ6 A;  2IBI B;  1V9J A;  1WXM A;  1EF1 A;  4MGI E;  3QJZ A;  2J0J A;  2JT4 B;  3JVZ X;  3MJW A;  4IWQ A;  1ZKH A;  1WXS A;  5TR5 A;  3R3M A;  4DDG D;  4F1S A;  3PLV A;  1WX7 A;  3HIZ A;  3VFK A;  2L8J A; 
#chains in the Genus database with same CATH topology
 2FID A;  3RZF A;  2WGS A;  5KHQ A;  2YVC A;  3P2B A;  4W9I A;  1Q0W B;  1L6U A;  2NBW B;  2RPV A;  3JYU A;  1RM6 C;  2D3C A;  1D4B A;  3GZN I;  1I4R A;  4K7S A;  2QCZ A;  4LNO A;  4WIP A;  1L0Y B;  1SEB D;  5C23 A;  5IN7 A;  1MVK A;  5C1Z A;  2FE8 A;  2GBR A;  4MH8 A;  2ACZ B;  1V1P B;  4GDK A;  4USA A;  3TJP A;  2MLB A;  3SR6 A;  2XK5 A;  3QAR A;  2N0S B;  3VAW A;  2CU3 A;  1OQR A;  3W5U B;  2I2Y A;  3R8B A;  3DBL B;  4ASW C;  1WXQ A;  1WH3 A;  4NAW B;  2N9E B;  3RUI B;  3PTF C;  1CQV A;  4BFR A;  5CTR C;  1L0X B;  2GBJ A;  2WXH A;  3CST A;  1G6J A;  5I4D A;  2KJH B;  2KMC A;  1I35 A;  2IY1 B;  3N30 A;  2RMM A;  3NRZ A;  5HFY A;  3AEB B;  3TIX A;  1SIF A;  1DGJ A;  1F2R I;  1C79 A;  4M0W B;  1N61 A;  2KC1 A;  3QA8 A;  3P1M A;  1TKY A;  2LVQ A;  2KWC A;  4DXG A;  3ZNH B;  1WIA A;  4ZDV A;  1WM2 A;  1QF6 A;  2MW5 A;  4JIO U;  1PYW D;  3DPD A;  3ZUN A;  2WXI A;  3IAM 1;  5L95 C;  4HK2 A;  5FK9 C;  2ZZP B;  3HRD D;  4M00 A;  1I7H A;  3K9P B;  2LRW A;  2LGY A;  2M1M A;  2N9P C;  1VZ8 A;  4PK1 A;  2LZ6 A;  4J3O D;  2N9X A;  3CWI A;  3IBE A;  2KTF A;  3Q6B A;  4MAC A;  3AE7 B;  2L3Z A;  3L0W B;  1EU4 A;  1QT9 A;  1S3S G;  3BVM A;  4R3D A;  3ZXV A;  4A3P A;  3WAO A;  1XO3 A;  2W3S A;  1UBQ A;  2ONQ A;  4O1N A;  4W9F A;  5LNK 1;  1LO5 D;  1YOV B;  2XNA C;  3N1X C;  3AEE B;  5FR3 A;  2C9W B;  3RFZ B;  4WJN A;  4K7W A;  2JPH A;  1YIW A;  3PPA A;  2LGS A;  3A1Q A;  3AXC A;  3PZ7 A;  2D07 B;  5HI1 A;  1GNU A;  2DAF A;  2RPQ A;  3TEW A;  3HUI A;  4HDO A;  3NUH B;  2I38 A;  2KDM A;  4FBJ B;  3KH0 A;  1SGH A;  3RNB C;  1P9D U;  3E9S A;  2B3A A;  2IGD A;  1V80 A;  3B2F A;  4PYZ A;  2PVG C;  2G45 B;  1QLB B;  2IO3 B;  2OJR A;  3IT6 B;  3NZ3 A;  2DBY A;  4RFB A;  2QIE B;  2MBO A;  2QHO A;  2W3R A;  1NYR A;  3HVZ A;  4IG7 B;  1DOY A;  3BII D;  3M62 B;  4YSX B;  2BGF A;  1LXD A;  4TQ0 A;  3MJ5 A;  1WRD B;  5E6N A;  1HXY D;  3GOE A;  3RCZ A;  3KWL A;  2LXA A;  1FCC C;  4AS1 A;  1GC6 A;  4J6I A;  3OG5 A;  4A90 A;  1M4V A;  3LJ3 A;  1WR6 E;  2NTS A;  3NVW A;  3IFW B;  4FJY A;  1F0Z A;  3ZNG C;  4JE3 B;  2HDE A;  3DBH I;  1HEZ E;  2L05 A;  3ZDM C;  4MM3 B;  2REX A;  1PUT A;  3U8Z A;  1QQR A;  3UGB B;  1UGM A;  4AUQ C;  2IO0 B;  2JWZ A;  1L4D B;  2G3Q B;  3L4P A;  4KZC A;  1KOT A;  2WXO A;  2Y3A A;  4IM3 A;  2K8C A;  3RT3 B;  1YN5 A;  3T8M A;  1J0G A;  3VTU A;  2L52 A;  4A3O A;  4P16 A;  1KLG D;  2JSV X;  3T3N A;  1N5X A;  2BPS A;  4DXA B;  4N6E B;  4ITK A;  2XEW A;  4WWM A;  4P1B C;  4A6Q A;  2PIA A;  3ZKJ C;  1NBF C;  1XLP A;  3EFC A;  4AJY B;  2QIL A;  2D3G A;  2M56 B;  2K5P A;  4GLS C;  1V5T A;  2BYT A;  4WAA A;  1JWB D;  1RRB A;  5J2R A;  4BAX A;  4MSQ B;  1WSP A;  3VRA B;  4YT0 B;  2RSU A;  4ANV A;  1SBB B;  4IDI A;  4HLE A;  3SHQ A;  1BXT A;  3VVW B;  4BVU C;  2C60 A;  4WH4 A;  3P42 A;  3Q14 C;  2JZP A;  2WYQ A;  1HE8 A;  4I6L B;  2A5U A;  5IKC M;  4AWJ A;  2KN4 A;  5HKH A;  4HCN B;  1V1O A;  4YL8 A;  1F77 A;  2LHD A;  2Q5W D;  2PE9 A;  3AE8 B;  3ZLZ A;  2WXR A;  3R66 C;  1UGJ A;  1F1H A;  2IY0 B;  3GE8 C;  1T0S C;  1WJ4 A;  2L83 A;  5JZE B;  3KLS X;  4GSW A;  1BML C;  5BO4 B;  3IG3 A;  1LFD A;  2KZR A;  5GMV A;  2MCN B;  4XWW A;  2CJO A;  1NVI D;  4E3C A;  2QSD A;  2SEB D;  1RFK A;  5TSS A;  3U7D A;  1YD8 U;  2PEA A;  3AB5 A;  3ZRF A;  1GC7 A;  2LJI A;  3UF8 A;  1K52 A;  2AX5 A;  1ZDX A;  4IUM B;  4ZRI A;  3PLU A;  4JWS C;  1WI0 A;  4I6N B;  1A5R A;  3P4S B;  3A9K B;  1D5M C;  5BMI A;  2KWD A;  2W82 A;  2G4S A;  3DWG C;  3BVZ A;  2WDQ B;  1V2Y A;  1FPY A;  1E7V A;  2BKR B;  4NJC A;  5LLI A;  3UIN B;  1C4P A;  1JRU A;  2ZCC A;  1NI2 A;  4PS7 A;  1UUP A;  1L0V B;  1AN8 A;  2YEP F;  2I1K A;  5CHW A;  2ZW0 A;  3DDC B;  3EHV A;  2KHW B;  4FN2 A;  1FM0 D;  4US8 A;  3NZU A;  4MJS B;  1FD6 A;  2NPT B;  3WAP A;  1N60 A;  1GOZ A;  4RGT A;  1R4M I;  4HKZ E;  2VH1 A;  1Q10 A;  1MG4 A;  3N9Y C;  4II3 B;  2KWV B;  1QOA A;  2MBQ A;  4M8N A;  5CHF A;  3Q3N C;  1HZ5 A;  4JWU C;  1PGB A;  4REZ A;  2MQJ A;  1A70 A;  2J7Q B;  3OJ4 B;  1QIL A;  3KUD B;  4ICU A;  4IC7 B;  2AYO B;  1WJ6 A;  2IGH A;  3I63 C;  1UWM A;  3WAN A;  2GMI C;  2V3P A;  1E5W A;  3M3J A;  1V86 A;  4JQW C;  2LEK A;  2FUH B;  4KDL B;  2J42 A;  3Q8F A;  4JL9 A;  1L6V A;  2OED A;  4DWF A;  2N9L A;  2XN9 C;  1C9F A;  1WXM A;  1E6E B;  4F1S A;  3R3M A;  1WX7 A;  1YQ3 B;  2VZK B;  2CU1 A;  1Y56 A;  3C0R B;  5D3I B;  4AOF A;  2K8B A;  5AZG A;  2BB5 A;  3KUZ A;  3PSE B;  2ON8 A;  1JRP A;  2EMS A;  4GXB A;  1WYW B;  1WGH A;  4TMA B;  3RNC C;  3UQA A;  1N5W A;  4W9L A;  1XQQ A;  5JHB A;  5LXH A;  1STE A;  4ZYS A;  1JAL A;  1WGG A;  4MEL A;  3B2G A;  1KRH A;  1DYQ A;  4LDT B;  3IXS A;  1XLQ A;  5C3J B;  3V3X A;  2R2O A;  1F9J A;  3UIP B;  1R7S A;  2PLP A;  2E3T A;  1KM7 A;  2KFK A;  4EKU A;  5D6J B;  2D2Q A;  4LJP B;  5E6P A;  5CHV C;  1UH6 A;  4LNF A;  4URK A;  4LCD E;  1OQY A;  1E7P B;  1Y8R C;  3NVY A;  5HHD G;  1PFD A;  5IA7 A;  2RDG A;  3W1S C;  3Q69 A;  3AE3 B;  2VRR B;  3VHT C;  2NPT A;  2WU5 B;  5E6O A;  2ZVO A;  2A4Z A;  5CX3 A;  2K22 A;  1D6E C;  1JWM D;  4FLH A;  3JSV B;  2V0G A;  4MGY E;  3H1U A;  3HM6 X;  1J7C A;  3H7S A;  1P1A A;  3NG0 A;  1TGZ B;  1JWS D;  1D5Z C;  4MJS A;  4LJO B;  3T3O A;  1NDD A;  1WMH A;  2KOX A;  2MBB B;  2FNJ B;  3I5J C;  1KF6 B;  4G50 A;  5D94 A;  3KWV A;  2BYE A;  4DHZ E;  4P1C C;  5T8I A;  1Q1O A;  1V8C A;  3NZS A;  3RI7 C;  1IGD A;  1EM7 A;  1FO4 A;  4KDI C;  4EFO A;  2M17 A;  1WM3 A;  3EUB 2;  4YXD B;  3ML9 A;  3O65 B;  4HJK A;  4M8M A;  4XZ4 A;  4GOC A;  3SU8 X;  3VDZ A;  5H92 C;  3RZW C;  4ZRQ A;  2KQS A;  1XT9 B;  3EGR A;  3PRZ A;  4GDL A;  4M01 A;  5J18 A;  1ET6 A;  2WS3 B;  3KYD D;  2LGI A;  3OLM D;  2FCQ A;  3Q2A C;  3MC8 A;  2CR5 A;  2DYM A;  1YX6 B;  1XXG A;  4KIK A;  1HTQ A;  2ZNV B;  1RAX A;  3AED B;  4MSM B;  4W9E A;  1AW7 A;  5EE1 A;  3PGE A;  4D2K A;  1V5O A;  1LM8 B;  1WXA A;  1SSN A;  3ZNZ B;  3NOB A;  3H6N A;  3WAL A;  2IZV B;  2B76 B;  4G11 A;  2KQ4 X;  4P7I A;  4C4V B;  5H8Y E;  2WQY B;  4G3X B;  4M02 A;  2KJ6 A;  3SD5 A;  4N9F 4;  1XCT L;  1E10 A;  3RN9 C;  2JYT A;  3OAW A;  2O6V D;  2UYZ B;  2K8H A;  5MPO A;  4DQO C;  3QHT A;  1B9R A;  2Y5P A;  4EUT A;  1YN4 A;  1KJT A;  3PVL A;  4ARC A;  3NY5 A;  1TY2 A;  3JSV A;  2DZI A;  3VQI A;  2FAZ A;  4NQK E;  2CJN A;  2KLG A;  2E6X A;  1C4C A;  3MHZ A;  2KKC A;  4BKT A;  2HTH A;  3DVG Y;  4BOZ B;  3MC0 B;  1XD3 B;  2JZ3 B;  2KMA A;  3D32 A;  2GBM A;  1VCB A;  3V60 A;  4LNK A;  1WMH B;  1VLB A;  1V97 A;  3ZJV A;  1QOG A;  2BTE A;  1TS3 A;  2D3A A;  1WE6 A;  3VUX A;  2RR9 A;  1UNS A;  2WDR B;  3FKY A;  3W2D A;  1V1P A;  2XBB C;  2RGF A;  1I4P A;  3N3K B;  4HDQ A;  1SB3 C;  2JU6 X;  3UQB A;  2Y5C A;  2M0X A;  3TUO A;  4JLC A;  1HQR D;  1S1Q B;  2H89 B;  1WE7 A;  1FFV A;  3AE2 B;  3B08 A;  2L76 A;  4TV3 A;  4XE0 A;  1EU3 A;  1MPE A;  1R4N B;  3PV1 A;  1SF0 A;  3V6C B;  3VH3 B;  4B0E A;  1C1Y B;  3MTN B;  3EC8 A;  2ZEQ A;  1MI0 A;  3U52 E;  1RLF A;  3J9C A;  1P3Q U;  3ZTC A;  3I9V 1;  3Q3M C;  1GAQ B;  4KIK B;  3CMM B;  1GPX A;  2N7J A;  3AN1 A;  2N7D A;  4ACF A;  2K39 A;  4NAM A;  2ICI A;  2IND C;  3IHP C;  4KV2 A;  2EKE C;  2DZM A;  2WNM A;  2PJH A;  1YJJ A;  3RD2 A;  2V3S A;  1YX5 B;  3L54 A;  2FBW B;  4WQO B;  3L16 A;  4OZC A;  4NZL B;  1E8X A;  2J0M A;  2JXT A;  4ANX A;  3RNG C;  5IO9 A;  4HPP A;  3L10 B;  3WAM A;  4EZL A;  3K9O B;  4GIV A;  2W55 A;  2MWS B;  4FXC A;  1JWA D;  2QC8 A;  2NBV B;  2LGX A;  4FAD A;  2BW2 A;  2KDB A;  3VH4 B;  3DBS A;  3GS2 A;  3DWM A;  3CIR B;  1L4Z B;  2MJD A;  4LNI A;  3NS8 A;  2K3U A;  3ENE A;  1E7U A;  2KDF B;  2D5G A;  2IYD B;  1KLU D;  1SE3 A;  3A1Q B;  3AUL A;  1WX8 A;  1UEL A;  4CO7 A;  3W5V B;  4DHZ B;  3U4E G;  4US9 A;  3AM9 A;  4DBG A;  4FHJ A;  1ZE3 D;  2HTM E;  1RWS A;  2KC2 A;  2M4N A;  1X1M A;  2KVR A;  3ZYY X;  4YTN B;  1WGR A;  1RYJ A;  1J8C A;  2WP9 B;  1SJE D;  2KDE B;  4RGM A;  2N1W A;  1LQB A;  1K8R B;  4DK5 A;  3BVG A;  4HJG E;  2KXJ A;  4XYC A;  3VTV A;  4KX6 B;  3NHE B;  1TJE A;  3KQ4 A;  3BZD B;  2JRI B;  2WXL A;  1CMX B;  2C7M B;  4EE2 A;  2IBI B;  1WRI A;  1EF1 A;  2HJ1 A;  4KGR A;  3JVZ X;  2JT4 B;  3MJW A;  1ZKH A;  2L8J A;  3KW5 B;  2C7N B;  2L0F A;  3N20 C;  2R61 A;  5G5G A;  1SIJ A;  1OEY A;  1TY0 A;  2DYB A;  2KYW A;  4NY0 A;  2OHF A;  2KNB A;  1GG3 A;  2DZK A;  1JCK B;  1VDV A;  2DHZ A;  2KTR B;  3U30 A;  3ONS A;  3APC A;  2JWU A;  4IM2 A;  1P7F A;  2AQ3 B;  4ICV A;  2WXQ A;  1F52 A;  2K6D B;  1WGK A;  4CYE A;  4DHJ B;  1T6B X;  4X57 B;  5EE9 A;  3OWE B;  2ZJD A;  2BQQ A;  1KFY B;  5DPW A;  4W9C A;  2BYV E;  1TZ1 A;  3BYT B;  3EEC A;  5FR6 A;  4OVV A;  2WXJ A;  1WJN A;  4RGN A;  4BBN F;  1WWT A;  3TBL D;  1OEY J;  1ZUD 2;  3NJT A;  1QKZ A;  1CZP A;  2PE6 B;  2X8X X;  4LDT D;  4KGT A;  3UIO B;  4K3C A;  3VR9 B;  3GE3 C;  5E6J A;  3P4R B;  5IOI A;  4GDK B;  2MA9 B;  4DXF A;  2BWF A;  2V1Y A;  2MJ3 A;  5JHA A;  1K53 A;  4BKG A;  4GGQ A;  2HJ8 A;  3V61 A;  2TSS A;  3L13 A;  4ARI A;  4GDL B;  1WGD A;  3RUL A;  3UI3 A;  3VRB B;  3AV8 A;  2WHI A;  4E74 A;  2N4F A;  4ANW A;  3AEA B;  2LRU A;  4KGS A;  1FNW A;  2KAN A;  4LTU A;  2MH7 A;  1FRD A;  3DVN V;  2JYE A;  3AH7 A;  2WDT B;  4LK0 M;  4WJP A;  2BF8 B;  1XEE A;  4MEM A;  3Q8A A;  3N1Z C;  2WXP A;  5DPR A;  1I42 A;  2OJW A;  4FUL A;  4CHK A;  2GBK A;  3ZNI D;  2KAJ A;  2LAS A;  5J17 A;  4C4V A;  2I1J A;  4ANU A;  1OFF A;  3RNA C;  2INP E;  3TEZ A;  2MBE A;  2BYF A;  4AQ7 A;  2BS2 B;  1SE9 A;  2LUM A;  4OW0 A;  1VZ6 A;  2L1A A;  4BOS C;  2BVC A;  3AE6 B;  4XGA B;  3R7Q A;  1QOF A;  2BS4 B;  4YWG G;  1DOX A;  2KX3 A;  5BMG A;  3QWZ B;  3RNE C;  1I4Q A;  3R2T A;  2GBN A;  1AYF A;  2EKI A;  1E0Z A;  4M0W A;  1YJI A;  4AJW A;  4XDD A;  2WWZ A;  3H9D A;  2L0T A;  2LHE A;  2KK8 A;  1IP9 A;  3H7P B;  4PYU A;  3TMP B;  4RMA A;  4WWO A;  2IO1 B;  1BT0 A;  1ZGU B;  4JX1 C;  1EWY C;  5LXI B;  3X0W A;  2UWQ A;  1TBE A;  3L17 A;  3I3T B;  3TL5 A;  1EWC A;  2EMT A;  3M95 A;  4OZB A;  4KSL C;  5BMH A;  3RMK C;  1WGY A;  2J53 A;  4K1R B;  2R2Q A;  2FCN A;  5DCN A;  1C78 A;  1PGX A;  1Q5W B;  1SXT A;  2MP2 A;  2M0A A;  3ZVV A;  1T0Q C;  3Q8E A;  4BZA A;  3ZDT A;  5HG2 A;  3IAS 1;  1YQ4 B;  1R4N I;  1MHX A;  2QDF A;  2DYO A;  3C19 A;  4IW0 A;  2OOB B;  4H2A A;  2NCN A;  3DHG C;  3TEY A;  1IUE A;  4MGZ E;  2LGD A;  1U4A A;  1SJH D;  2JF5 A;  2ZNV C;  2BS3 B;  4RCO A;  2J4X A;  2KLC A;  4DDI D;  4FJZ A;  2CHZ A;  1T0R C;  1L5P A;  3PHX B;  4OHJ A;  3M63 B;  1Z5S B;  3AEC B;  3DBL I;  2O6V B;  3LB8 C;  5AZF A;  4HWI B;  4E71 A;  3A33 B;  3T9L A;  4AP4 C;  1DOI A;  4HRO A;  3O13 A;  4RH6 A;  4RGO S;  3N1Y C;  4HCP B;  4KZ0 A;  5G55 A;  1E8Y A;  2WXG A;  3HK0 A;  3MFG A;  4G0N B;  4WJQ A;  3HVD A;  2X38 A;  2IGG A;  3B1L X;  4ZRK A;  1MG8 A;  2JQR B;  4GN1 A;  3APF A;  2KFK B;  4IOI E;  5GXG B;  2ZPY A;  1XLN A;  3IT4 B;  1IGC A;  2WXM A;  4W9H A;  3AEF B;  4WQM A;  3U2S C;  1ZXH A;  3AE9 B;  1CK1 A;  5KHO A;  4YSY B;  2AL6 A;  2JVC A;  4MGK E;  2WXF A;  3AE1 B;  1FXA A;  3A4S C;  1TS4 A;  1D3Z A;  1GUA B;  3ZW3 A;  4II2 B;  4S0R A;  4NPN A;  2DAJ A;  3AEG B;  4LLG M;  1L2N A;  1NYQ A;  2L00 B;  4IWP A;  3AU4 A;  5FKA C;  1N62 A;  3APD A;  4ZRJ A;  2WU2 B;  2QJL A;  1GB4 A;  2KAC A;  1FEH A;  1V6E A;  1VR9 A;  1L7Y A;  2KX0 A;  2PTL A;  3A4R A;  3LYY A;  5EE0 A;  3RYT A;  1ZDV A;  2PMV A;  3ALB A;  1ZOY B;  1MHH E;  3DBH B;  4ZYN A;  1E90 A;  2IO2 B;  4P6V F;  4UDU C;  1VD2 A;  3SFD B;  4EZJ A;  3DHH C;  1TKG A;  1I4G A;  4RNA A;  2PKO A;  3ZRC A;  2ASQ A;  2LI5 A;  2NMQ A;  2NTT A;  3ZGZ A;  2BKF A;  3DBR I;  4ZRP A;  2Y5B B;  1AWD A;  1UF0 A;  3SEB A;  4BBN C;  4PT5 A;  3BWU D;  2GLS A;  1ZW7 A;  4HXD A;  2GOW A;  4OVU A;  4A55 A;  1ACC A;  2L7R A;  3L08 A;  3QQ8 B;  3VXW A;  4A8X C;  2KT7 A;  1EUV B;  4B6W A;  2MBH A;  2RD0 A;  5G2N A;  1T5X D;  3C8Y A;  3MP9 A;  5D7G A;  3DBR B;  5DPT A;  2LMC A;  3A9K A;  4W9K A;  3BK1 A;  4F7Z A;  4KVG B;  3DVN U;  2MEK A;  3QK0 A;  2LVO A;  4W9D A;  1C77 A;  2BWE S;  4B9K A;  1ISN A;  5IAA C;  4JPS A;  3BIN A;  4NQL B;  2WX0 A;  3R2I A;  1V9J A;  3QJZ A;  2J0J A;  4IWQ A;  1JRO A;  5TR5 A;  3GZN B;  3PLV A;  1FNV A;  3HIZ A;  4FA6 A;  3TCA A;  2AQ2 B;  2KTR A;  3EFU A;  3FIL A;  4PS8 A;  2L32 A;  4YTM B;  3PS6 A;  1WF9 A;  3VTW A;  5DPS A;  5BYQ A;  4EZK A;  4FJV B;  1K50 A;  1FIQ A;  3JW0 X;  5D3D A;  2UU7 A;  4K3B A;  3X23 A;  3P4Q B;  3PRE A;  2SAK A;  1ESF A;  4TKN A;  3FC4 A;  1T0Y A;  2V4I B;  4LNN A;  5AUI A;  2RDB C;  2V4L A;  3NVV A;  2WXK A;  3LXF A;  1WYG A;  1JWU D;  2K0P A;  4WUR A;  2MJE A;  2MHJ A;  1J19 A;  2PW9 A;  1TKE A;  4B0M A;  4BKS A;  4L1B A;  1F2R C;  1BUI C;  2BBC A;  2Z0D B;  3GB1 A;  1NEN B;  2FCM A;  3ZQ4 A;  2BT6 A;  1VZ7 A;  3V62 A;  1KLV A;  4I6P A;  1OTR B;  2LVP A;  2WLB A;  1YMH E;  4IWO A;  3PZ8 A;  1WX9 A;  3U7Z A;  3N32 A;  3AMZ A;  3PRP B;  2KVZ A;  1ENF A;  2NR2 A;  2LJ5 A;  4WJO A;  2K9X A;  1QZE A;  3TSS A;  2NS5 A;  1YJ1 A;  1KTK A;  3PT2 B;  4GB9 A;  3ZXR A;  2QEJ C;  3V05 A;  1WR1 A;  2PVO D;  1FXI A;  2LXC A;  2O2V B;  1XLO A;  3A9J A;  2N1V A;  3EA6 A;  1C4A A;  2DNF A;  3V6E B;  3KVF B;  3QAQ A;  4ZHP A;  3ZIM A;  2LWP A;  3VR8 B;  3ZO5 B;  3AE4 B;  1VRA B;  4RF1 A;  3VUW A;  1WFY A;  4KSK C;  1YQB A;  4YSZ B;  4FHK A;  3HHM A;  4ZOH C;  5JH5 C;  2O6V A;  3H8H A;  4TQ1 A;  4MDK E;  1FNU A;  1KH0 A;  2JXX A;  4TSS A;  1ROE A;  1OGW A;  3Q3F A;  3VUY A;  4QAY A;  1IYF A;  4XX5 A;  4F8C B;  3CSF A;  4K81 A;  2J0K A;  1IBX B;  1V49 A;  2KN5 A;  1QOB A;  3DVG X;  2N9K A;  2K1F A;  2Z59 B;  1N6Z A;  2G1E A;  2INN E;  3SFE B;  2LUE A;  3CF6 E;  3P63 A;  1B1Z A;  5AEK B;  3DHI C;  3ABV B;  1GB1 A;  1T3Q A;  2JUO A;  1WJU A;  4WWP A;  2LD9 A;  2HE7 A;  1E8Z A;  1E9M A;  3PO0 A;  1TIF A;  1RFA A;  1JQ4 A;  2DEN B;  2MP2 B;  1WZ3 A;  4HVB A;  2ZPN A;  1YN3 A;  2AL3 A;  4GMV A;  4OZA A;  1JML A;  5BYS A;  5JXV A;  4B95 A;  5C2T B;  1FFU A;  3WA0 A;  2G4D B;  3KYC D;  1MFW A;  1UWX A;  1M94 A;  4C7Y A;  3H7P A;  4OVZ A;  2PPH A;  2N7E A;  3RPF C;  2IPK D;  2ZVN A;  2CHW A;  2BB6 A;  3S2A A;  1XCQ L;  3GP7 A;  3E56 A;  2JX5 A;  5EDS A;  2KWU B;  2IDY A;  4BKS D;  2HD5 B;  2VH2 A;  4L2Y A;  1TTN A;  3ETR A;  1VJK A;  3QX1 A;  1ZP0 B;  1J7B A;  2NBU A;  3LDZ E;  1H4R A;  1HTO A;  3W1Y A;  2YEP B;  3PZD A;  4K7U A;  1SE2 A;  3ML8 A;  4XWT A;  1P98 A;  4C7Z A;  3FAH A;  2FCS A;  2O2V A;  5G5H A;  2DZJ A;  4W9J A;  2FIF A;  1FMA D;  4WWN A;  1TZO A;  1P0R A;  3AU5 A;  1ET9 A;  1GJZ A;  5EE3 A;  2EEL A;  2AWT A;  1WXV A;  3WCQ A;  3Q8B A;  4HPM B;  1MJD A;  2LFI A;  4RM9 A;  2Z0E B;  1OQQ A;  2D10 A;  2C7H A;  1YNT E;  2Z8L A;  2WX1 A;  2CS4 A;  2W54 A;  3IVF A;  2G9H D;  1IBX A;  4S17 A;  3BK2 A;  3A9J B;  3AI5 A;  1V81 A;  4KKJ A;  2IJ0 A;  4HPL B;  1FRR A;  1TT5 B;  5D2M B;  2INC C;  4TUU A;  5L83 A;  1UBI A;  4JGH B;  2M8S A;  3W9C B;  1HZ6 A;  4NNJ B;  4KKI A;  1UZX B;  2ZCB A;  2KQ7 A;  2CKH B;  2V9H A;  1NEK B;  2WXN A;  1CJE A;  4NJ7 A;  2KJR A;  4C56 C;  1P7E A;  1WZ0 A;  2D3B A;  2GRI A;  4IKG A;  1E8W A;  5AUK A;  2JY6 A;  2KDI A;  4HEA 1;  1PDX A;  3MHS D;  3W1S A;  2KD0 A;  3RNF C;  3BY4 B;  5BYR A;  2NVU I;  2GI9 A;  1HA5 A;  4EOY A;  4HRS A;  3ZTD A;  4RF0 A;  1ZPS A;  2DX5 B;  3B9J A;  3ZJU A;  4N59 A;  4CQN A;  4HKQ A;  2XK5 B;  1AAR A;  1TYG B;  3TEX A;  3URY A;  2DLB A;  2AQ1 B;  2KMM A;  1SE4 A;  2WDV B;  4NAW A;  2JRH A;  1UD7 A;  2YLM A;  5AZH A;  1FXT B;  1TS5 A;  1EF5 A;  4XC2 A;  2C5L C;  2M19 A;  3QC8 B;  4A9A A;  1JW9 D;  2JZZ A;  4C80 A;  2DWQ A;  1PQS A;  4ZHO A;  3ECI A;  1C76 A;  2RDH A;  3KUC B;  4GU2 A;  4XDC A;  4MH0 E;  3ZJT A;  2VZK D;  1XF5 L;  3Q8C A;  1I4X A;  3QCA A;  2K6Q A;  4N58 A;  1TS2 A;  2MSE D;  2W9N A;  3DCG A;  2CHX A;  5IP4 D;  2KFJ A;  4RM8 A;  3P4P B;  3PHW B;  4PS3 A;  1R4M B;  3B0A A;  3Q3J A;  3OJ3 A;  1D5X C;  2K25 A;  1FCL A;  2D11 A;  3AE5 B;  1C3T A;  1NI3 A;  4MM3 A;  4Q2J A;  4WAF A;  3NVZ A;  2FUG 1;  1PGA A;  4W9G A;  2GB1 A;  1J7A A;  4IM0 A;  2QMT A;  3NS1 A;  4A20 A;  1H8C A;  4L23 A;  3WIM A;  1N63 A;  1LGR A;  1ZXI A;  3I57 A;  1EO6 A;  1IPG A;  2H88 B;  4MT5 A;  3DQV A;  1Z2M A;  3PRM B;  2MX2 A;  4YTP B;  3HM3 A;  2AEH A;  2KO3 A;  1I4H A;  4C00 A;  3BYY B;  1WY8 A;  3Q3O C;  2MRP A;  4DHJ D;  1K51 A;  3SDL C;  4EEW A;  3MC9 A;  3FIL B;  3DOW A;  2V3N A;  3R7R A;  3QIJ A;  2ZW1 A;  4NJ6 A;  2J52 A;  4MGI E;  1WXS A;  4DDG D;  3VFK A; 
#chains in the Genus database with same CATH homology
 3KW5 B;  3TCA A;  2L0F A;  2KTR A;  3EFU A;  2FID A;  4PS8 A;  2CU1 A;  3RZF A;  1OEY A;  3C0R B;  2DYB A;  3PS6 A;  4NY0 A;  5KHQ A;  4AOF A;  1WF9 A;  2YVC A;  2KNB A;  3P2B A;  4W9I A;  2K8B A;  5AZG A;  1GG3 A;  3VTW A;  1Q0W B;  5DPS A;  4EZK A;  3KUZ A;  2DZK A;  4FJV B;  3PSE B;  2NBW B;  2DHZ A;  3JYU A;  2EMS A;  4GXB A;  1WYW B;  2KTR B;  3GZN I;  3JW0 X;  1WGH A;  3U30 A;  3ONS A;  3APC A;  3UQA A;  4K7S A;  3X23 A;  3PRE A;  4IM2 A;  5C23 A;  4W9L A;  4TKN A;  4ICV A;  1XQQ A;  5C1Z A;  5JHB A;  2GBR A;  5LXH A;  1T0Y A;  2K6D B;  4CYE A;  4DHJ B;  4GDK A;  4X57 B;  3TJP A;  2MLB A;  2XK5 A;  3QAR A;  2V4L A;  3VAW A;  1WGG A;  4MEL A;  2ZJD A;  5DPW A;  4LDT B;  4W9C A;  1J19 A;  2BYV E;  4ASW C;  1WH3 A;  4NAW B;  1TZ1 A;  4BKS A;  2N9E B;  2R2O A;  3EEC A;  1F9J A;  5FR6 A;  4OVV A;  3RUI B;  3UIP B;  2Z0D B;  1KM7 A;  2KFK A;  3PTF C;  2FCM A;  4EKU A;  4BFR A;  5D6J B;  2D2Q A;  4LJP B;  5CTR C;  3V62 A;  1KLV A;  4I6P A;  5E6P A;  5CHV C;  1WJN A;  1UH6 A;  1OTR B;  2LVP A;  4URK A;  2GBJ A;  3CST A;  4LCD E;  4BBN F;  1G6J A;  2KJH B;  1OQY A;  2KMC A;  1I35 A;  4IWO A;  3TBL D;  1OEY J;  1WX9 A;  2IY1 B;  3N32 A;  3PRP B;  3N30 A;  1Y8R C;  2PE6 B;  4LDT D;  2NR2 A;  3TIX A;  1SIF A;  2LJ5 A;  4WJO A;  1QZE A;  2NS5 A;  1YJ1 A;  3UIO B;  4M0W B;  5IA7 A;  3W1S C;  3PT2 B;  2VRR B;  2KC1 A;  3QA8 A;  4GB9 A;  3VHT C;  2LVQ A;  2NPT A;  1WR1 A;  2KWC A;  5E6O A;  2ZVO A;  3ZNH B;  2LXC A;  2O2V B;  4GDK B;  1WIA A;  2A4Z A;  3A9J A;  2MA9 B;  2N1V A;  2BWF A;  5CX3 A;  2V1Y A;  4ZDV A;  5JHA A;  3V6E B;  3KVF B;  3QAQ A;  4BKG A;  1WM2 A;  4GGQ A;  2HJ8 A;  3ZIM A;  2LWP A;  2MW5 A;  4FLH A;  3V61 A;  4JIO U;  3ZO5 B;  3JSV B;  4MGY E;  3L13 A;  3DPD A;  4GDL B;  1WGD A;  3ZUN A;  3H1U A;  3VUW A;  5L95 C;  1WFY A;  4KSK C;  1YQB A;  4FHK A;  3HM6 X;  3HHM A;  5JH5 C;  4HK2 A;  2O6V A;  3RUL A;  3H7S A;  4TQ1 A;  4MDK E;  2ZZP B;  2JXX A;  4E74 A;  2N4F A;  1OGW A;  4ANW A;  3Q3F A;  3K9P B;  1P1A A;  2LRU A;  2LRW A;  2KAN A;  2LGY A;  3VUY A;  1TGZ B;  1IYF A;  2M1M A;  4XX5 A;  4F8C B;  3CSF A;  4MJS A;  4LJO B;  4K81 A;  2J0K A;  2N9P C;  1NDD A;  3DVN V;  1WMH A;  1V49 A;  2KN5 A;  2LZ6 A;  3DVG X;  2N9X A;  2KOX A;  2K1F A;  2Z59 B;  2WDT B;  3IBE A;  4WJP A;  2KTF A;  2MBB B;  2BF8 B;  4MEM A;  2FNJ B;  2L3Z A;  3L0W B;  2LUE A;  1S3S G;  3CF6 E;  5DPR A;  1I42 A;  4A3P A;  4FUL A;  3WAO A;  4CHK A;  2GBK A;  5AEK B;  4G50 A;  5D94 A;  3ZNI D;  2BYE A;  2LAS A;  1UBQ A;  4W9F A;  4DHZ E;  5J17 A;  2JUO A;  2I1J A;  1WJU A;  4ANU A;  4WWP A;  2LD9 A;  1Q1O A;  2HE7 A;  1E8Z A;  3NZS A;  2MBE A;  2BYF A;  4KDI C;  4EFO A;  2M17 A;  2C9W B;  1SE9 A;  1WM3 A;  4WJN A;  4K7W A;  2JPH A;  1RFA A;  1YIW A;  3PPA A;  4BOS C;  3ML9 A;  3O65 B;  4HJK A;  2DEN B;  3A1Q A;  4FA6 A;  4M8M A;  3AXC A;  2MP2 B;  4GOC A;  4XZ4 A;  1WZ3 A;  3R7Q A;  2ZPN A;  2AL3 A;  3SU8 X;  3VDZ A;  2KX3 A;  4HVB A;  2D07 B;  1GNU A;  2DAF A;  4GMV A;  3QWZ B;  2GBN A;  2RPQ A;  3RZW C;  2KQS A;  4HDO A;  4B95 A;  1XT9 B;  3PRZ A;  4GDL A;  3WA0 A;  2G4D B;  5J18 A;  3KYC D;  4AJW A;  1M94 A;  3KYD D;  3H7P A;  3OLM D;  4FBJ B;  3KH0 A;  2WWZ A;  1SGH A;  2FCQ A;  1P9D U;  3H9D A;  2PPH A;  2B3A A;  2N7E A;  2L0T A;  1V80 A;  2CR5 A;  2DYM A;  4PYZ A;  1YX6 B;  2ZVN A;  2CHW A;  4KIK A;  2G45 B;  2KK8 A;  3S2A A;  2IO3 B;  2OJR A;  5EDS A;  2KWU B;  1IP9 A;  4BKS D;  3H7P B;  2ZNV B;  4PYU A;  2HD5 B;  1RAX A;  4MSM B;  4RMA A;  4W9E A;  2IO1 B;  4WWO A;  3TMP B;  1BT0 A;  1ZGU B;  1TTN A;  5LXI B;  3PGE A;  2MBO A;  2QHO A;  2UWQ A;  3X0W A;  3QX1 A;  1V5O A;  1LM8 B;  1TBE A;  2NBU A;  3L17 A;  3I3T B;  1WXA A;  3LDZ E;  3ZNZ B;  1H4R A;  4IG7 B;  3NOB A;  3H6N A;  3WAL A;  2IZV B;  4G11 A;  3TL5 A;  4P7I A;  3M62 B;  2EMT A;  3M95 A;  4G3X B;  4KSL C;  3W1Y A;  2KJ6 A;  3PZD A;  3SD5 A;  4K7U A;  4N9F 4;  1WGY A;  4K1R B;  2BGF A;  2R2Q A;  2FCN A;  1LXD A;  3ML8 A;  4TQ0 A;  1P98 A;  5DCN A;  1WRD B;  3OAW A;  2O6V D;  5E6N A;  2FCS A;  2UYZ B;  3GOE A;  3RCZ A;  2K8H A;  2LXA A;  2O2V A;  3QHT A;  1Q5W B;  1GC6 A;  4J6I A;  2MP2 A;  2DZJ A;  2FIF A;  4W9J A;  3LJ3 A;  4EUT A;  1WR6 E;  4WWN A;  3IFW B;  4FJY A;  3ZVV A;  3ZNG C;  1KJT A;  1P0R A;  3AU5 A;  3PVL A;  3NY5 A;  3ZDT A;  3DBH I;  3JSV A;  2L05 A;  2DZI A;  1GJZ A;  3VQI A;  2FAZ A;  4NQK E;  3ZDM C;  1R4N I;  2AWT A;  2KLG A;  1WXV A;  2DYO A;  2REX A;  3U8Z A;  4IW0 A;  2OOB B;  4HPM B;  2KKC A;  2NCN A;  3UGB B;  4BKT A;  2HTH A;  1UGM A;  4AUQ C;  3DVG Y;  4MGZ E;  2IO0 B;  2JWZ A;  2LGD A;  4RM9 A;  1U4A A;  4BOZ B;  1XD3 B;  2G3Q B;  4KZC A;  2Z0E B;  2JF5 A;  2D10 A;  2C7H A;  1KOT A;  2JZ3 B;  2KMA A;  2WX1 A;  2ZNV C;  2GBM A;  3D32 A;  4IM3 A;  2CS4 A;  2K8C A;  1VCB A;  2KLC A;  3RT3 B;  3IVF A;  4FJZ A;  3V60 A;  2CHZ A;  4DDI D;  1WMH B;  3T8M A;  1J0G A;  3PHX B;  3VTU A;  3A9J B;  3AI5 A;  1Z5S B;  3M63 B;  1V81 A;  2O6V B;  3DBL I;  4A3O A;  4HPL B;  5AZF A;  5D2M B;  4HWI B;  4E71 A;  2BPS A;  1WE6 A;  3A33 B;  4TUU A;  3T9L A;  5L83 A;  4DXA B;  3VUX A;  1UBI A;  2RR9 A;  2XEW A;  4JGH B;  4AP4 C;  2M8S A;  2XBB C;  2RGF A;  4NNJ B;  3ZKJ C;  1UZX B;  1NBF C;  2ZCB A;  4HCP B;  4KZ0 A;  2KQ7 A;  2CKH B;  3N3K B;  5G55 A;  4AJY B;  4HDQ A;  2D3G A;  1E8Y A;  4NJ7 A;  2KJR A;  3HK0 A;  1V5T A;  4G0N B;  4WJQ A;  4WAA A;  1WZ0 A;  3UQB A;  2M0X A;  3B1L X;  4ZRK A;  1MG8 A;  4JLC A;  1RRB A;  5J2R A;  1E8W A;  1S1Q B;  2JY6 A;  4MSQ B;  4GN1 A;  2KDI A;  3APF A;  2RSU A;  4ANV A;  3MHS D;  3W1S A;  1WE7 A;  2KD0 A;  2KFK B;  4HLE A;  3BY4 B;  3SHQ A;  2NVU I;  3VVW B;  4BVU C;  2ZPY A;  2C60 A;  4EOY A;  3B08 A;  2L76 A;  4TV3 A;  2WYQ A;  3ZTD A;  1HE8 A;  4I6L B;  2A5U A;  4W9H A;  4AWJ A;  5HKH A;  4HCN B;  2DX5 B;  4YL8 A;  3PV1 A;  3V6C B;  2PE9 A;  3VH3 B;  1C1Y B;  3MTN B;  2XK5 B;  3EC8 A;  1AAR A;  2ZEQ A;  5KHO A;  2AL6 A;  3R66 C;  3ZLZ A;  2JVC A;  4MGK E;  1RLF A;  2IY0 B;  1P3Q U;  3A4S C;  3ZTC A;  1D3Z A;  1GUA B;  4KIK B;  3CMM B;  3ZW3 A;  4II2 B;  2N7D A;  2K39 A;  4NPN A;  4NAW A;  1WJ4 A;  5JZE B;  2DAJ A;  3IHP C;  2JRH A;  1UD7 A;  2YLM A;  4KV2 A;  4GSW A;  5AZH A;  5BO4 B;  2EKE C;  2DZM A;  1FXT B;  3IG3 A;  1L2N A;  1LFD A;  2KZR A;  1EF5 A;  2L00 B;  4IWP A;  2PJH A;  5GMV A;  3AU4 A;  4XC2 A;  2C5L C;  2MCN B;  4ZRJ A;  2V3S A;  3APD A;  3RD2 A;  3QC8 B;  4E3C A;  1YX5 B;  3L54 A;  4WQO B;  3L16 A;  1E8X A;  2JZZ A;  3U7D A;  2J0M A;  1YD8 U;  2PEA A;  1PQS A;  3ZRF A;  1V6E A;  2KX0 A;  1L7Y A;  4ANX A;  3A4R A;  3RYT A;  3ECI A;  3L10 B;  3WAM A;  1GC7 A;  4EZL A;  3ALB A;  3UF8 A;  3K9O B;  4IUM B;  4ZRI A;  3PLU A;  4ZYN A;  1WI0 A;  3KUC B;  1E90 A;  2IO2 B;  4GU2 A;  4MH0 E;  1VD2 A;  4GIV A;  4I6N B;  1A5R A;  3A9K B;  4EZJ A;  2MWS B;  2G4S A;  3QCA A;  2K6Q A;  2NBV B;  2LGX A;  3ZRC A;  1V2Y A;  4FAD A;  2MSE D;  2W9N A;  1E7V A;  2ASQ A;  2KDB A;  2BKR B;  2LI5 A;  5LLI A;  3UIN B;  3VH4 B;  3DBS A;  1JRU A;  2BKF A;  3DCG A;  2CHX A;  2KFJ A;  3DBR I;  2ZCC A;  4RM8 A;  1NI2 A;  2Y5B B;  4PS7 A;  3PHW B;  4PS3 A;  3NS8 A;  4BBN C;  3ENE A;  1E7U A;  2I1K A;  3B0A A;  5CHW A;  3Q3J A;  3OJ3 A;  3DDC B;  2KDF B;  2K25 A;  2IYD B;  3EHV A;  2KHW B;  4FN2 A;  1ZW7 A;  3NZU A;  4HXD A;  2D11 A;  4MJS B;  2NPT B;  3A1Q B;  3WAP A;  2GOW A;  4OVU A;  1R4M I;  3AUL A;  1WX8 A;  2L7R A;  3L08 A;  1C3T A;  1UEL A;  4MM3 A;  4CO7 A;  3QQ8 B;  4DHZ B;  3VXW A;  4W9G A;  4II3 B;  2KWV B;  1EUV B;  4IM0 A;  2MBQ A;  4DBG A;  4B6W A;  4M8N A;  4FHJ A;  5CHF A;  4A20 A;  2MBH A;  2RD0 A;  1H8C A;  2KC2 A;  2M4N A;  1X1M A;  5G2N A;  3WIM A;  2MQJ A;  2KVR A;  2J7Q B;  3OJ4 B;  1WGR A;  3KUD B;  4ICU A;  5D7G A;  1J8C A;  4IC7 B;  1EO6 A;  5DPT A;  1IPG A;  2KDE B;  1Z2M A;  2AYO B;  3A9K A;  3DQV A;  2MX2 A;  3PRM B;  4W9K A;  1WJ6 A;  4F7Z A;  3HM3 A;  2C7N B;  2AEH A;  4KVG B;  2N1W A;  2KO3 A;  3DVN U;  3WAN A;  3QK0 A;  2GMI C;  1LQB A;  1K8R B;  2LVO A;  1E5W A;  1WY8 A;  3M3J A;  4W9D A;  4DK5 A;  1V86 A;  4JQW C;  2BWE S;  2FUH B;  2MRP A;  4DHJ D;  4B9K A;  2KXJ A;  3VTV A;  1ISN A;  3NHE B;  4KDL B;  3SDL C;  4EEW A;  5IAA C;  2JRI B;  3BIN A;  4JL9 A;  3DOW A;  4NQL B;  1CMX B;  2C7M B;  2WX0 A;  3R7R A;  3QIJ A;  4DWF A;  4NJ6 A;  2IBI B;  1V9J A;  1WXM A;  1EF1 A;  4MGI E;  3QJZ A;  2J0J A;  2JT4 B;  3JVZ X;  3MJW A;  4IWQ A;  1ZKH A;  1WXS A;  5TR5 A;  3R3M A;  4DDG D;  4F1S A;  3PLV A;  1WX7 A;  3HIZ A;  3VFK A;  2L8J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...