1C79A

Staphylokinase (sak) dimer
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
130
structure length
130
Chain Sequence
GKYKKGDDASYFEPTGPYLMVNVTGVDGKGNELLSPHYVEFPIKPGTTLTKEKIEYYVEWALDATAYKEFRVVELDPSAKIEVTYYDKNKKKEETKSFPITEKGFVVPDLSEHIKNPGFNLITKVVIEKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STAPHYLOKINASE
publication title Crystal structure of a staphylokinase: variant a model for reduced antigenicity.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 22
structure length 130
sequence length 130
chains with identical sequence B
ec nomenclature ec 3.4.24.29: Aureolysin.
pdb deposition date 2000-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02821 Staphylokinase Staphylokinase/Streptokinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.130 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1c79A00
1C76A 1BUIC 1SSNA 2SAKA 1C79A 1C77A 1C78A
chains in the Genus database with same CATH superfamily
3NVZA 1GC7A 1EWYC 1SIJA 2PE9A 2LGYA 2K39A 3DVNU 5CTRC 2BWFA 2MX2A 3VH4B 4RCOA 4HVBA 2KTFA 4GOCA 2KAJA 4IM0A 1PYWD 4XDCA 1E8YA 2WXPA 1GUAB 3H6NA 2NVUI 2XN9C 5IA7A 2M0AA 3VUYA 4DQOC 4M0WB 4P7IA 4ZHPA 4W9CA 1VRAB 3AXCA 3RFZB 1GOZA 3GZNI 2XK5A 1UNSA 3MFGA 2ZCCA 2Y5PA 3JW0X 1GC6A 1VZ7A 1SJHD 4W9KA 1EU4A 2KJ6A 2XBBC 3NZUA 2PTLA 3NG0A 3NY5A 4EFOA 4ARIA 3RNCC 5EE1A 3B08A 5LNK1 2V3PA 1WGDA 2JX5A 2N9XA 2HTME 2LRWA 2C7MB 1TT5B 3ZXVA 3AE2B 3AMZA 1L0XB 4JPSA 1K53A 4W9JA 2LHEA 4MELA 1GAQB 2H88B 3TBLD 1D5ZC 3Q2AC 3A33B 2LVPA 3PZDA 1LM8B 3ZRCA 4MGIE 2XEWA 1ZE3D 3Q8CA 3QAQA 4A3PA 5AZHA 3RMKC 3ZXRA 3IVFA 4LJOB 4NJCA 2IY1B 2MJDA 4WJOA 1OQYA 1PGAA 2LGSA 5DPTA 4MH8A 4ITKA 3L54A 3DOWA 3Q8BA 3I3TB 5J18A 1SXTA 5EE3A 3AEBB 3C19A 4BFRA 3ZQ4A 2KQ7A 3Q6BA 2WXOA 3NVVA 5D2MB 4GLSC 4TSSA 1N6ZA 3SFEB 1WRIA 4E71A 5D3IB 2OEDA 4DK5A 1E8WA 4EKUA 3MP9A 4A3OA 2FCSA 1I4QA 1I7HA 1F9JA 3U52E 5LLIA 1LXDA 2IBIB 4PYUA 5JZEB 2D07B 1F52A 1UWXA 1A5RA 2Z0DB 1V5OA 3RT3B 5C3JB 2ON8A 1V1PA 3AV8A 2LGIA 3Q14C 3TL5A 1QOBA 4UDUC 5HHDG 3OG5A 1IGDA 1HZ5A 2V4IB 1WGGA 4W9HA 4C4VB 2W55A 1YJJA 2QC8A 1OEYA 1UGJA 3WAMA 2N9PC 1R4NB 3L16A 2ZEQA 1KLVA 4MSQB 4LLGM 2MEKA 1E5WA 4NY0A 4NJ7A 3N9YC 3FILA 1PFDA 3ZO5B 3KUDB 3ZNID 4GDKB 2PVOD 2R2OA 5L83A 3PLVA 1XEEA 2BBCA 1TGZB 5G55A 2N1VA 2W82A 3BVMA 1ZUD2 3EGRA 3BIID 4X57B 3A4RA 1V9JA 4XE0A 4YTNB 1IBXA 1WMHB 2WDVB 3BYTB 4LNKA 3A9KA 2DZIA 3LXFA 3HIZA 1UF0A 4JIOU 3RNAC 2DZJA 1N62A 1SGHA 2NCNA 3IFWB 2KXJA 1LO5D 2J0KA 4K81A 1UELA 3VHTC 4B9KA 4HKQA 4DHZB 4BKSA 1H8CA 2BTEA 3KYDD 3MTNB 2DLBA 1JRPA 3P4QB 2IO1B 5CHVC 4LCDE 4OZBA 2KLGA 1I4RA 2LWPA 3BINA 4FJVB 3PHWB 3L08A 1WH3A 1EWCA 1FD6A 1KOTA 4R3DA 2PEAA 2BPSA 2JWZA 3B1LX 4RGNA 4P6VF 2O2VB 3O13A 4JLCA 3I9V1 2KDEB 2KJRA 5IKCM 4AJYB 3X23A 2KDMA 4LNIA 3A9JA 3DPDA 2GBNA 5FK9C 4FA6A 5JHAA 3EHVA 1ZW7A 1JWBD 2IGGA 2AQ3B 4G3XB 3VRBB 2MBQA 2OHFA 3L13A 2G4SA 3D32A 3QJZA 4EZLA 2K8CA 3RN9C 2MLBA 1MFWA 3OLMD 1I4XA 2DNFA 3HVZA 5AZFA 4W9IA 4W9LA 1I4HA 1ZDXA 4S17A 5FR6A 2A5UA 5DCNA 2FCMA 2M19A 1LGRA 3PT2B 5EE9A 2KN5A 1JCKB 1V1PB 2VZKB 1V81A 3Q3FA 2LUMA 3AE8B 2RMMA 2D11A 1MI0A 1AWDA 1D5XC 1VD2A 2GBKA 1MG8A 1KTKA 3AE6B 3NZ3A 4W9GA 4GN1A 1FFVA 2D2QA 3UIOB 3VTWA 2KC1A 1D3ZA 2WGSA 2VRRB 2DYMA 5D7GA 1MPEA 5CHWA 4GDLA 2D3AA 4D2KA 3VFKA 2LMCA 2D3BA 2UYZB 3AU4A 3APDA 4Q2JA 2QMTA 3TEZA 4M8NA 4BKTA 1KRHA 2SEBD 4XZ4A 4FHJA 1E7PB 4A6QA 4RNAA 4KX6B 2J7QB 4MSMB 4PYZA 2K9XA 2FUHB 2V1YA 2LVOA 2JRIB 3P4PB 2L7RA 3VQIA 3ZJVA 4XWWA 3AI5A 1JRUA 2WWZA 4A55A 3R2IA 3DBHI 2YLMA 4IWPA 3RD2A 4HRSA 1KLGD 3DVGY 3PREA 1E7UA 1UUPA 2RDGA 1FXAA 2GBJA 2NPTA 2RDBC 3APCA 2IO3B 2CR5A 4YTMB 1MHXA 4EE2A 1TY2A 2WX1A 2AL6A 3QIJA 4I6NB 1A70A 1ZP0B 2Y5CA 1YN3A 2L3ZA 4LDTD 2K1FA 3B0AA 1C1YB 3QARA 2DAJA 1PGXA 1C77A 3CSTA 3AEDB 4M8MA 3ML9A 2HDEA 1I4GA 3GP7A 1XCQL 1L5PA 4MH0E 1F2RI 1ZGUB 2FAZA 2V4LA 3SD5A 2MP2A 1WX9A 3DHIC 3IT6B 4NQLB 4NJ6A 4MJSA 1YNTE 3W5UB 1C79A 2LZ6A 4HDQA 2R61A 4NAWB 1XLOA 4FN2A 4B6WA 4DDGD 2N4FA 4OW0A 4BAXA 1YN5A 1WXVA 1TY0A 1Q10A 2QJLA 2RPQA 2BKFA 2LHDA 3KWLA 4GMVA 1ISNA 2D5GA 4ZYNA 2MQJA 1OTRB 4GIVA 4MT5A 4NNJB 3SFDB 1ACCA 4TV3A 2UU7A 1I35A 4BBNC 1SJED 2KFKA 3PRMB 5BO4B 4KIKA 4N6EB 2PMVA 4BOSC 1MHHE 2AQ2B 1AW7A 2MBEA 3GB1A 3OJ4B 2BS4B 1V86A 2W3SA 1QLBB 4ZRIA 1VLBA 3IBEA 2ZPNA 3NVYA 3H7SA 4HXDA 2N1WA 1BMLC 4PK1A 1M4VA 3AEEB 1WXAA 2X38A 2MWSB 3ETRA 1S1QB 4HPLB 2GI9A 3CF6E 4BKGA 1JROA 2EKEC 1QZEA 1WF9A 1YJ1A 1WYGA 3BK1A 1L0YB 4CQNA 1QOAA 4KDIC 1F1HA 2K6DB 2KACA 2ZCBA 3EFUA 1FRDA 3RUIB 1CQVA 2MHJA 3JVZX 1L6VA 1GG3A 3ECIA 1WGKA 3TEWA 2WXIA 3VRAB 4ANXA 3ZUNA 5BMHA 1JW9D 5J17A 2L0TA 3NZSA 1NYQA 2R2QA 4P16A 1WGYA 2PJHA 1WJ4A 3GZNB 2ASQA 4FXCA 1EUVB 2V3NA 1TS3A 1C78A 3VR8B 2G45B 3K9PB 1YOVB 1E9MA 1JWUD 1E10A 1VJKA 2WXRA 4K7WA 3QA8A 1JWSD 4P1BC 3W5VB 2BW2A 2ZVNA 4WWMA 4FHKA 1V1OA 5KHQA 2MA9B 2QEJC 3EUB2 4KVGB 2AWTA 2GRIA 1IP9A 3B2GA 2FBWB 3TJPA 2JT4B 5G5GA 2FIDA 2GBMA 2WYQA 2BT6A 1MVKA 3CSFA 3UGBB 5LXIB 3VVWB 2LXCA 3DHHC 3WAOA 2PLPA 3N30A 2G3QB 4KZCA 2DBYA 3A1QB 2HJ1A 1TS4A 1EM7A 1T5XD 2C5LC 4KSKC 4NZLB 3AN1A 2K3UA 4MACA 2MBBB 1FEHA 5KHOA 2DWQA 5J2RA 1TTNA 2N9EB 3QHTA 2WX0A 4IM2A 3AULA 2REXA 2M4NA 3KVFB 2DYOA 2KLCA 5JH5C 1AARA 5LXHA 3VAWA 4E3CA 3VTUA 4N58A 3Q3OC 2CHXA 4BVUC 3L0WB 4RFBA 1L2NA 2TSSA 1QKZA 4KKIA 1HE8A 3R8BA 4II2B 1FRRA 2L1AA 4TQ0A 5EDSA 1I42A 2NTSA 4ICUA 3V6EB 4PT5A 3W1SA 1IGCA 3RI7C 2EMSA 1FIQA 3SR6A 3QQ8B 4FULA 5C2TB 1HQRD 2UWQA 5AEKB 2Q5WD 2MBHA 2L05A 1OQQA 3S2AA 1XD3B 1S3SG 4OZAA 1P98A 2WU5B 1XF5L 4A8XC 1JWMD 4XYCA 3VTVA 2MJ3A 3CWIA 4LNFA 1FMAD 1XLPA 4GSWA 1Y8RC 4LNNA 1DOXA 3QX1A 2JXXA 1KM7A 4KGSA 1E90A 3AE9B 2MJEA 2BWES 3QK0A 1P3QU 2LGDA 3RCZA 4TKNA 1WJ6A 1QT9A 1YN4A 2QCZA 1DGJA 3KUCB 1Q1OA 1F77A 1KJTA 2IY0B 3ZTDA 4MM3A 1SE2A 1NVID 3N32A 2K0PA 2PKOA 1L0VB 4EZJA 2XK5B 2J0MA 2RPVA 3U2SC 2Y5BB 3DDCB 2L0FA 4RH6A 4HPPA 3N1XC 3HHMA 3V62A 1GB4A 3TCAA 2KTRA 2D10A 1HTQA 2KZRA 4KZ0A 3KW5B 2WXKA 1AYFA 3WAPA 1WWTA 2INCC 2WXLA 4LJPB 4PS7A 5FKAC 1WZ3A 3R3MA 1X1MA 3RPFC 1WE7A 4N59A 1C9FA 1WR6E 2BF8B 1C4PA 4DDID 2OOBB 1EF5A 3W2DA 3GS2A 1KH0A 1TBEA 1WXSA 2L32A 3P1MA 4M00A 4PS3A 4NPNA 1FO4A 1UBQA 2B3AA 3TIXA 3ZIMA 5JHBA 5AUKA 1WZ0A 2KK8A 1TJEA 1L6UA 1ENFA 1KF6B 2JYTA 2KD0A 4HJKA 5HFYA 2FIFA 3OWEB 4YT0B 5IO9A 3JYUA 1TKEA 1QOGA 1F0ZA 2AL3A 3NHEB 2NS5A 2O6VA 1E6EB 2KQ4X 4II3B 2IPKD 2MH7A 3OJ3A 2KVZA 2Z0EB 4JX1C 4JL9A 3UQBA 2LRUA 1PQSA 1QQRA 4YSXB 1LQBA 3KWVA 3DBRI 4ANVA 4F7ZA 5IP4D 2INNE 3PRZA 4IWQA 4I6PA 2WXHA 1C4AA 3W9CB 3FKYA 4HK2A 4ZRPA 2M1MA 4K7SA 1FNUA 3DVNV 1WRDB 2BYVE 1Y56A 2DYBA 4WJPA 4AP4C 1K50A 3ENEA 2JYEA 3PZ7A 4WURA 1T0SC 2N7DA 3SEBA 3SDLC 4LDTB 3AU5A 2BS2B 3MHSD 2KQSA 3P42A 2E3TA 4KV2A 2C7HA 4FJYA 4RM9A 3SHQA 2I2YA 4C00A 3CMMB 1N63A 2BKRB 2Z8LA 3VXWA 1XCTL 1H4RA 1SE3A 3PO0A 3X0WA 3RULA 3HM3A 1XQQA 4HEA1 3AE3B 1UD7A 1VDVA 1C3TA 3L10B 3U7DA 2J52A 2IJ0A 3AE4B 2KC2A 1YQ3B 4A20A 3FILB 1Z5SB 4MM3B 2IGHA 4NQKE 4DBGA 2WU2B 4M01A 3R66C 2J4XA 2M17A 3V6CB 4B95A 4NAMA 1YX6B 3PPAA 2NBUA 1UZXB 1GB1A 4C7ZA 3DQVA 1NDDA 3GOEA 2I1KA 3K9OB 2YEPF 5DPRA 3VDZA 4CYEA 3DBHB 2K25A 3AB5A 4FLHA 1J19A 2MCNB 1IBXB 1Q0WB 1SE4A 3DBLB 3A9KB 4GGQA 2IGDA 1N5WA 4EEWA 1RWSA 2JZ3B 3ZDMC 1XT9B 2LXAA 4WJQA 1WYWB 3AE5B 1VR9A 5AZGA 1WE6A 1WSPA 2JRHA 3MJ5A 2WDQB 2AQ1B 4HCPB 4HJGE 2ZW0A 1V2YA 1F2RC 4S0RA 2HD5B 3AM9A 2ONQA 4M0WA 3ZJTA 2KHWB 3C8YA 2V3SA 3L17A 1FM0D 3LDZE 1R4MB 2NTTA 1YJIA 2WNMA 2Y3AA 2KYWA 2BVCA 3H9DA 4L1BA 2LFIA 3T3NA 1TIFA 1WGHA 3AEAB 1L4DB 2IYDB 2YEPB 1OFFA 1TZOA 4PS8A 4DHZE 4TQ1A 1D6EC 2CU3A 3A9JB 3AH7A 4RGOS 3VUWA 4WQMA 3MC0B 5TR5A 3MC9A 3Q69A 2KX3A 3UINB 3ZRFA 1IYFA 4DXAB 4IC7B 3KH0A 1FNWA 3M95A 2KVRA 3APFA 2WXJA 3N1YC 2WDRB 4XX5A 4JQWC 4REZA 1V5TA 5HG2A 3RNBC 2N0SB 3N20C 4AWJA 4LTUA 5EE0A 1ZOYB 2ICIA 5G2NA 3V3XA 2JPHA 1XO3A 2GBRA 3DCGA 3M3JA 2ZNVC 3PS6A 4WWPA 2KDBA 2IZVB 2NBWB 2WS3B 2EMTA 4US9A 4DXFA 4QAYA 2N7EA 1MJDA 2PIAA 2G9HD 2H89B 5AUIA 3ZNGC 3MHZA 5TSSA 1RAXA 2ZNVB 3LJ3A 2L83A 2DZKA 1B1ZA 1BUIC 4G11A 3FC4A 4K7UA 1WM2A 2JQRB 3E9SA 4KGTA 4MEMA 4GDLB 5BYSA 1WJNA 3V60A 4BKSD 3PLUA 1CK1A 1WI0A 3R7QA 3AECB 2OJWA 4HDOA 2KMMA 1V8CA 4MGYE 4HKZE 4DHJD 1PGBA 4J3OD 1V6EA 2N9LA 4MGZE 4HROA 3BVZA 4L2YA 1NBFC 2KT7A 1Q5WB 1L4ZB 5DPWA 4E74A 2IDYA 2W3RA 4LK0M 1J8CA 1RYJA 1CJEA 2I1JA 4WWOA 1K8RB 3N3KB 3BWUD 3WALA 4C4VA 4IWOA 4USAA 2KO3A 2VH2A 3PV1A 2K22A 2KDIA 1P7FA 1N61A 3VUXA 2RSUA 2NPTB 2K8BA 2Z59B 4KGRA 2KJHB 1SF0A 4EZKA 1C76A 1EF1A 4FJZA 2RDHA 3PTFC 3HM6X 3ZLZA 2M8SA 3IAM1 4GB9A 4GDKA 3RZWC 5G5HA 4WWNA 4W9FA 5BYRA 5T8IA 2BYTA 4K3CA 1BXTA 2WXGA 3PVLA 4URKA 3HVDA 4ICVA 2V0GA 3SU8X 3RZFA 3EC8A 4IG7B 1P7EA 1U4AA 2JWUA 1BT0A 4WQOB 1ZXHA 2JZZA 5IAAC 4WAFA 1WMHA 5HKHA 2MP2B 1TS2A 4MJSB 1J7BA 2RR9A 4OZCA 3U4EG 1SEBD 3NRZA 1UH6A 4W9DA 1DOIA 3GE8C 4LNOA 2HE7A 1YQBA 4HLEA 2BYEA 2X8XX 3L4PA 1RRBA 1XLQA 4HCNB 2QDFA 2JY6A 4IM3A 1FCLA 1WXQA 1K52A 1NENB 3UIPB 3DBSA 4MDKE 4WAAA 2KX0A 3WIMA 1SB3C 2ZVOA 1C4CA 2ZW1A 2EKIA 2KDFB 3DWGC 2FE8A 2BGFA 2INDC 4KKJA 2KWCA 2KFKB 1IPGA 4RGTA 4KIKB 4AOFA 1E8ZA 3PRPB 1UWMA 1LFDA 3OAWA 3MC8A 3AE1B 3LYYA 2LUEA 1P1AA 2KWVB 3TUOA 2GLSA 2LJ5A 3RYTA 1RLFA 3IT4B 3AE7B 3PSEB 2O2VA 3QCAA 3T9LA 4EOYA 2C60A 2WXQA 1ET9A 2I38A 2B76B 1EU3A 2BS3B 1J0GA 1HTOA 1TS5A 5FR3A 5E6OA 2QILA 2G1EA 4N9F4 4JE3B 3IG3A 4P1CC 1RFKA 4B0MA 1JALA 2K5PA 2N9KA 3M63B 1HEZE 3E56A 2YVCA 1VZ8A 4IDIA 1FPYA 2PPHA 2GOWA 1NI2A 3RNFC 2J42A 3NUHB 4AS1A 3Q8AA 3BVGA 4F1SA 1WX8A 1D4BA 3FAHA 4JGHB 4C56C 2AX5A 4GXBA 4JWUC 2MW5A 3O65B 2L00B 3PGEA 4OVZA 3TEYA 2JVCA 3P4SB 1E8XA 5DPSA 1PUTA 3EFCA 1JWAD 3T8MA 2CS4A 3UI3A 1SIFA 4JWSC 2BB5A 3ABVB 2WXFA 2GB1A 1DYQA 2LVQA 4RF0A 3NS1A 4YXDB 2PVGC 3VR9B 2JXTA 1YQ4B 3AEGB 4RM8A 2VH1A 4ANWA 1STEA 5MPOA 4YWGG 2V9HA 4RMAA 3EA6A 5JXVA 3ZVVA 1ZDVA 2D3GA 4CHKA 1R4NI 3ZTCA 2GMIC 1GPXA 3U30A 5BMGA 2KNBA 2LI5A 3RNEC 3P4RB 3T3OA 1EO6A 4I6LB 3HK0A 4O1NA 4FADA 3NVWA 5HI1A 1T0QC 1FNVA 1WR1A 1B9RA 3N1ZC 3A4SC 4A90A 3V61A 3JSVA 4YL8A 1QOFA 4XC2A 1RFAA 3CIRB 2MRPA 4RF1A 4A9AA 1T3QA 3UF8A 4FBJB 3BZDB 4HPMB 2PE6B 1MG4A 5L95C 2KANA 3DBRB 2LJIA 2BB6A 1YMHE 5I4DA 3H7PA 4IW0A 2AEHA 2G4DB 1FFUA 4AJWA 4RGMA 4WH4A 1SBBB 2KMAA 2CJOA 2J0JA 1WGRA 2NMQA 4K3BA 4XWTA 1V97A 1I4PA 2E6XA 1KLUD 3W1SC 2C7NB 4OVUA 2WDTB 3QWZB 1PDXA 2HTHA 2KFJA 2JF5A 4ZRQA 4KDLB 2FCQA 2LD9A 1CMXB 2XNAC 3RNGC 1DOYA 3ZDTA 3ALBA 4ZHOA 3GE3C 3I57A 1OEYJ 5GMVA 2WHIA 2J53A 2WXMA 3R7RA 2FUG1 4AUQC 1V49A 1TKYA 4W9EA 3U8ZA 1HZ6A 1SSNA 3P63A 1NYRA 4ACFA 2JU6X 3P2BA 4ARCA 4B0EA 4NAWA 3DWMA 1OQRA 5D3DA 3WCQA 2RGFA 2CHWA 4OVVA 2JZPA 3Q3NC 4H2AA 1ZPSA 1WM3A 1M94A 4XDDA 1JQ4A 1UGMA 3URYA 2ACZB 2LASA 3BK2A 4K1RB 2KWUB 1XXGA 2PW9A 1OGWA 1YIWA 2W54A 1R7SA 1GJZA 2AYOB 2A4ZA 1T0YA 4WIPA 1P0RA 1E0ZA 5H8YE 1L7YA 2N7JA 2CU1A 4J6IA 4ZOHC 3UQAA 1TZ1A 4XGAB 3KLSX 4ZRKA 2INPE 3B2FA 1JMLA 3WANA 4GU2A 3KQ4A 2IO2B 2MSED 5E6PA 3BYYB 4YSZB 4DWFA 3I5JC 2RD0A 1GNUA 1SE9A 4BZAA 2IO0B 1V80A 3IAS1 2W9NA 2OJRA 1WIAA 2LEKA 3MJWA 2KTRB 1KFYB 4G0NB 1J7CA 2CKHB 4WJNA 2C9WB 4DXGA 4TUUA 3H8HA 3NS8A 1Z2MA 2L52A 3EECA 2M56B 1YX5B 4IUMB 5C1ZA 2JUOA 2KKCA 1N5XA 3WA0A 3H1UA 3B9JA 2CJNA 2WLBA 2KOXA 1ROEA 3JSVB 4C7YA 2KWDA 3PHXB 3HRDD 3HUIA 4DHJB 1VCBA 2NR2A 1N60A 3LB8C 3ZYYX 1WXMA 2QHOA 3IHPC 1NI3A 4C80A 2O6VB 1WJUA 2FNJB 3DBLI 3C0RB 3ZNZB 1AN8A 4G50A 4F8CB 3H7PB 2DENB 5CX3A 3V05A 3J9CA 1FXTB 4YTPB 3TEXA 1RM6C 1T6BX 5C23A 2ZZPB 3NOBA 3NJTA 2BYFA 1D5MC 2WQYB 2WP9B 4BBNF 3ZJUA 3W1YA 4YSYB 1HXYD 4BOZB 1QF6A 2VZKD 1R4MI 4CO7A 1YD8U 1WY8A 1TYGB 3A1QA 2QSDA 5GXGB 4ANUA 2DZMA 2WXNA 3R2TA 3KYCD 2FCNA 1FXIA 4EUTA 3IXSA 1ZKHA 1QILA 3Q8EA 2K8HA 1ESFA 4M02A 2L8JA 1K51A 3BY4B 2CHZA 3TSSA 3ZW3A 2BQQA 5CHFA 2KN4A 4ZRJA 4US8A 3AEFB 4TMAB 3DHGC 1P9DU 1HA5A 3ZKJC 2JSVX 2D3CA 1ET6A 3TMPB 2L76A 3DVGX 4KSLC 2QIEB 2M0XA 4L23A 5BYQA 2ZPYA 1ZXIA 1NEKB 4IKGA 3VH3B 1WX7A 1E7VA 3QC8B 2LGXA 5D6JB 5H92C 1G6JA 2DAFA 4HWIB 5IOIA 5E6NA 2SAKA 3Q3JA 1CZPA 2DHZA 1IUEA 3Q3MC 3U7ZA 2KMCA 5IN7A 1UBIA 3ONSA 2EELA 3ZGZA 4IOIE 2HJ8A 1WFYA 3KUZA 4OHJA 2DX5B 1TKGA 5E6JA 2ZJDA 2O6VD 2MBOA 4ZYSA 4AQ7A 4ZDVA 1XLNA 1T0RC 5D94A 3Q8FA 2NBVB 1J7AA 2K6QA 1FCCC 3ZNHB 3I63C 1VZ6A 4MGKE 5BMIA 3M62B 3PZ8A 3ML8A 4ASWC
chains in the Genus database with same CATH topology
3NVZA 1QQRA 1KLGD 1EWYC 1SIJA 4YSXB 3KWVA 4JE3B 1UUPA 2RDGA 1FXAA 1RFKA 2INNE 4B0MA 1JALA 2K5PA 2N9KA 1HEZE 4RCOA 4YTMB 1MHXA 4EE2A 3E56A 2KAJA 1TY2A 1PYWD 1VZ8A 4IDIA 4XDCA 2WXPA 2WXHA 1C4AA 3W9CB 2XN9C 1A70A 4ZRPA 2M0AA 4DQOC 2J42A 3NUHB 4AS1A 1ZP0B 2Y5CA 3BVGA 3Q8AA 1YN3A 1FNUA 1D4BA 3FAHA 4ZHPA 1Y56A 1VRAB 4C56C 1PGXA 1C77A 1K50A 3RFZB 2AX5A 4JWUC 1GOZA 3AEDB 2JYEA 3PZ7A 2HDEA 4OVZA 3TEYA 4WURA 1I4GA 3GP7A 3P4SB 1XCQL 1PUTA 1L5PA 1F2RI 1UNSA 3MFGA 1JWAD 3SEBA 2Y5PA 3UI3A 4JWSC 2BB5A 3ABVB 2WXFA 2BS2B 2GB1A 1DYQA 3P42A 2E3TA 3IT6B 4RF0A 1YNTE 3W5UB 2I2YA 3NS1A 1C79A 1VZ7A 4YXDB 2PVGC 1SJHD 1EU4A 1N63A 2R61A 2Z8LA 1XCTL 4NAWB 2PTLA 4ARIA 1SE3A 1XLOA 2JXTA 3PO0A 3VR9B 1YQ4B 3AEGB 5EE1A 5LNK1 5MPOA 1STEA 2V3PA 4OW0A 2JX5A 2HTME 4HEA1 1YN5A 4YWGG 3AE3B 1TY0A 1Q10A 1VDVA 2QJLA 3EA6A 5JXVA 1ZDVA 3AE2B 2LHDA 3AMZA 1L0XB 3KWLA 2J52A 4JPSA 1K53A 2IJ0A 3AE4B 2D5GA 2LHEA 1YQ3B 1GPXA 1GAQB 2H88B 4MT5A 5BMGA 1D5ZC 3SFDB 1ACCA 3FILB 4MM3B 2IGHA 2WU2B 3P4RB 1SJED 3T3OA 2J4XA 4N6EB 1ZE3D 2PMVA 1MHHE 4O1NA 2AQ2B 1AW7A 4NAMA 3Q8CA 3NVWA 3GB1A 5HI1A 2BS4B 1FNVA 1GB1A 2W3SA 4C7ZA 1QLBB 1B9RA 4NJCA 1VLBA 4A90A 2MJDA 1PGAA 3NVYA 2YEPF 1QOFA 4MH8A 1BMLC 4ITKA 3CIRB 3Q8BA 1M4VA 4RF1A 1T3QA 3AEEB 4A9AA 2X38A 3ETRA 3AB5A 1SXTA 5EE3A 3AEBB 3BZDB 1IBXB 2GI9A 1JROA 1SE4A 3ZQ4A 1WYGA 2WXOA 3BK1A 1L0YB 3NVVA 1QOAA 2LJIA 2BB6A 4GLSC 2IGDA 4TSSA 4CQNA 1N5WA 1YMHE 5I4DA 3SFEB 1RWSA 1WRIA 2KACA 1FRDA 5D3IB 2OEDA 3AE5B 1VR9A 1CQVA 1FFUA 4RGMA 1L6VA 3MP9A 4WH4A 1I4QA 1WGKA 1I7HA 1WSPA 1SBBB 3MJ5A 2WDQB 2AQ1B 4HJGE 2CJOA 3TEWA 2ZW0A 2WXIA 1F2RC 2NMQA 3VRAB 4XWTA 1V97A 1I4PA 2E6XA 1KLUD 3U52E 5BMHA 1JW9D 3AM9A 2ONQA 4M0WA 3ZJTA 1PDXA 3C8YA 1NYQA 4ZRQA 4P16A 1FM0D 2NTTA 2XNAC 4FXCA 1YJIA 2WNMA 1DOYA 2V3NA 1TS3A 4ZHOA 2Y3AA 1C78A 1UWXA 3VR8B 3I57A 4L1BA 1E9MA 1JWUD 1E10A 2LFIA 3T3NA 2J53A 2WXMA 1VJKA 2FUG1 2WXRA 5C3JB 1TKYA 2ON8A 1V1PA 3AV8A 2LGIA 1JWSD 1HZ6A 1SSNA 3AEAB 3P63A 3W5VB 1QOBA 4UDUC 1NYRA 5HHDG 2JU6X 1IGDA 2BW2A 1L4DB 1HZ5A 4ARCA 2YEPB 2V4IB 4WWMA 4B0EA 1OFFA 1TZOA 1OQRA 3DWMA 5D3DA 3WCQA 1V1OA 1YJJA 2W55A 4TQ1A 1D6EC 1UGJA 2CU3A 2QEJC 3EUB2 2JZPA 3AH7A 2GRIA 4H2AA 4RGOS 1ZPSA 4XDDA 1JQ4A 3B2GA 4WQMA 3MC0B 2FBWB 3URYA 2ACZB 3Q69A 5G5GA 4LLGM 3BK2A 2MEKA 2BT6A 1MVKA 3N9YC 1FNWA 1XXGA 2PW9A 3FILA 2WXJA 2W54A 1R7SA 2WDRB 1PFDA 4REZA 5HG2A 2N0SB 4WIPA 4GDKB 4LTUA 5EE0A 2PVOD 1XEEA 1ZOYB 2ICIA 2PLPA 2BBCA 3V3XA 2DBYA 1E0ZA 5H8YE 1XO3A 2N7JA 4ZOHC 3KLSX 1TS4A 1EM7A 1T5XD 2INPE 3B2FA 1JMLA 2WS3B 2W82A 3BVMA 4NZLB 4US9A 3KQ4A 3AN1A 1ZUD2 4DXFA 2K3UA 3EGRA 4MACA 3BIID 3BYYB 4YSZB 2PIAA 2G9HD 2H89B 1FEHA 5AUIA 2DWQA 4XE0A 4YTNB 1IBXA 3MHZA 2WDVB 5TSSA 3BYTB 3IAS1 2L83A 2LEKA 1KFYB 3LXFA 1BUIC 1B1ZA 3FC4A 1J7CA 1N62A 4DXGA 2JQRB 3E9SA 1LO5D 4KGTA 3H8HA 2L52A 4GDLB 2M56B 4HKQA 5BYSA 2DYOA 1CK1A 2BTEA 2DLBA 1JRPA 3AECB 2KMMA 1V8CA 3P4QB 4OZBA 4HKZE 4N58A 1N5XA 1I4RA 1PGBA 4J3OD 3B9JA 2CJNA 2N9LA 4RFBA 2WLBA 4HROA 2TSSA 1QKZA 4KKIA 3BVZA 1ROEA 4L2YA 1FRRA 1EWCA 2L1AA 3R8BA 4C7YA 2KWDA 2NTSA 4TQ0A 4PT5A 3W1SA 1IGCA 3HRDD 1FD6A 3HUIA 1N60A 1L4ZB 1FIQA 3SR6A 3LB8C 3ZYYX 4R3DA 5C2TB 2IDYA 1HQRD 2Q5WD 2W3RA 4LK0M 1NI3A 1OQQA 4RGNA 1RYJA 4OZAA 1CJEA 4C80A 4P6VF 2WU5B 1XF5L 3O13A 4A8XC 1JWMD 1AN8A 3BWUD 3I9V1 2MJ3A 3CWIA 3V05A 2KDMA 4USAA 3J9CA 1FMAD 1XLPA 4YTPB 5FK9C 3TEXA 2K22A 1P7FA 1RM6C 1DOXA 1T6BX 1N61A 4KGSA 1JWBD 2IGGA 2AQ3B 3AE9B 2MJEA 4KGRA 3VRBB 1SF0A 1C76A 2OHFA 1D5MC 2WQYB 2RDHA 2WP9B 3ZJUA 1QT9A 1I4XA 3HVZA 4YSYB 1HXYD 3IAM1 1I4HA 1YN4A 5G5HA 1QF6A 2VZKD 1DGJA 1ZDXA 1F77A 5BYRA 1TYGB 5GXGB 2QSDA 5T8IA 2BYTA 1BXTA 2WXGA 1SE2A 1NVID 2M19A 3HVDA 2K0PA 5EE9A 2V0GA 2WXNA 1JCKB 1V1PB 2PKOA 2VZKB 1L0VB 3R2TA 1P7EA 2JWUA 2LUMA 3AE8B 2RMMA 1ZXHA 1FXIA 1MI0A 2RPVA 3IXSA 1AWDA 3U2SC 4WAFA 1D5XC 4RH6A 1QILA 3Q8EA 1KTKA 3AE6B 3NZ3A 1TS2A 1GB4A 1ESFA 1FFVA 1J7BA 4OZCA 1K51A 3TSSA 3U4EG 1SEBD 3NRZA 1DOIA 2KN4A 2WXKA 4US8A 1AYFA 3AEFB 1WWTA 4TMAB 2WXLA 2DYMA 5D7GA 5FKAC 1HA5A 1MPEA 3L4PA 2JSVX 1ET6A 1XLQA 4D2KA 2LMCA 3RPFC 4N59A 1WXQA 1K52A 1NENB 1C9FA 1FCLA 1C4PA 2QIEB 4Q2JA 3W2DA 2QMTA 3GS2A 3TEZA 4L23A 5BYQA 1KRHA 1KH0A 2SEBD 2L32A 3P1MA 1SB3C 1C4CA 2ZW1A 1FO4A 1E7PB 1ZXIA 4A6QA 2EKIA 4RNAA 4KX6B 3DWGC 2FE8A 4KKJA 1NEKB 4IKGA 5AUKA 1TJEA 1L6UA 4RGTA 2K9XA 1UWMA 1ENFA 5H92C 1KF6B 2JYTA 2SAKA 5HFYA 1CZPA 1IUEA 3AE1B 3U7ZA 3LYYA 2EELA 3OWEB 3TUOA 4YT0B 3ZGZA 4IOIE 3P4PB 1TKEA 1QOGA 3VQIA 1F0ZA 3ZJVA 3IT4B 4XWWA 3AE7B 4OHJA 5E6JA 1TKGA 1E6EB 2KQ4X 4ZYSA 2IPKD 2MH7A 4AQ7A 1XLNA 2WXQA 1ET9A 2I38A 4A55A 3Q8FA 2B76B 1EU3A 1J7AA 2BS3B 3R2IA 1FCCC 4JX1C 1TS5A 1VZ6A 5BMIA 5FR3A 2QILA 3PZ8A 4HRSA 2G1EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1C76 A;  1BUI C;  1SSN A;  2SAK A;  1C79 A;  1C77 A;  1C78 A; 
#chains in the Genus database with same CATH topology
 3NVZ A;  1GC7 A;  1EWY C;  1SIJ A;  2PE9 A;  2LGY A;  2K39 A;  3DVN U;  5CTR C;  2BWF A;  2MX2 A;  3VH4 B;  4RCO A;  4HVB A;  2KTF A;  4GOC A;  2KAJ A;  4IM0 A;  1PYW D;  4XDC A;  1E8Y A;  2WXP A;  1GUA B;  3H6N A;  2NVU I;  2XN9 C;  5IA7 A;  2M0A A;  3VUY A;  4DQO C;  4M0W B;  4P7I A;  4ZHP A;  4W9C A;  1VRA B;  3AXC A;  3RFZ B;  1GOZ A;  3GZN I;  2XK5 A;  1UNS A;  3MFG A;  2ZCC A;  2Y5P A;  3JW0 X;  1GC6 A;  1VZ7 A;  1SJH D;  4W9K A;  1EU4 A;  2KJ6 A;  2XBB C;  3NZU A;  2PTL A;  3NG0 A;  3NY5 A;  4EFO A;  4ARI A;  3RNC C;  5EE1 A;  3B08 A;  5LNK 1;  2V3P A;  1WGD A;  2JX5 A;  2N9X A;  2HTM E;  2LRW A;  2C7M B;  1TT5 B;  3ZXV A;  3AE2 B;  3AMZ A;  1L0X B;  4JPS A;  1K53 A;  4W9J A;  2LHE A;  4MEL A;  1GAQ B;  2H88 B;  3TBL D;  1D5Z C;  3Q2A C;  3A33 B;  2LVP A;  3PZD A;  1LM8 B;  3ZRC A;  4MGI E;  2XEW A;  1ZE3 D;  3Q8C A;  3QAQ A;  4A3P A;  5AZH A;  3RMK C;  3ZXR A;  3IVF A;  4LJO B;  4NJC A;  2IY1 B;  2MJD A;  4WJO A;  1OQY A;  1PGA A;  2LGS A;  5DPT A;  4MH8 A;  4ITK A;  3L54 A;  3DOW A;  3Q8B A;  3I3T B;  5J18 A;  1SXT A;  5EE3 A;  3AEB B;  3C19 A;  4BFR A;  3ZQ4 A;  2KQ7 A;  3Q6B A;  2WXO A;  3NVV A;  5D2M B;  4GLS C;  4TSS A;  1N6Z A;  3SFE B;  1WRI A;  4E71 A;  5D3I B;  2OED A;  4DK5 A;  1E8W A;  4EKU A;  3MP9 A;  4A3O A;  2FCS A;  1I4Q A;  1I7H A;  1F9J A;  3U52 E;  5LLI A;  1LXD A;  2IBI B;  4PYU A;  5JZE B;  2D07 B;  1F52 A;  1UWX A;  1A5R A;  2Z0D B;  1V5O A;  3RT3 B;  5C3J B;  2ON8 A;  1V1P A;  3AV8 A;  2LGI A;  3Q14 C;  3TL5 A;  1QOB A;  4UDU C;  5HHD G;  3OG5 A;  1IGD A;  1HZ5 A;  2V4I B;  1WGG A;  4W9H A;  4C4V B;  2W55 A;  1YJJ A;  2QC8 A;  1OEY A;  1UGJ A;  3WAM A;  2N9P C;  1R4N B;  3L16 A;  2ZEQ A;  1KLV A;  4MSQ B;  4LLG M;  2MEK A;  1E5W A;  4NY0 A;  4NJ7 A;  3N9Y C;  3FIL A;  1PFD A;  3ZO5 B;  3KUD B;  3ZNI D;  4GDK B;  2PVO D;  2R2O A;  5L83 A;  3PLV A;  1XEE A;  2BBC A;  1TGZ B;  5G55 A;  2N1V A;  2W82 A;  3BVM A;  1ZUD 2;  3EGR A;  3BII D;  4X57 B;  3A4R A;  1V9J A;  4XE0 A;  4YTN B;  1IBX A;  1WMH B;  2WDV B;  3BYT B;  4LNK A;  3A9K A;  2DZI A;  3LXF A;  3HIZ A;  1UF0 A;  4JIO U;  3RNA C;  2DZJ A;  1N62 A;  1SGH A;  2NCN A;  3IFW B;  2KXJ A;  1LO5 D;  2J0K A;  4K81 A;  1UEL A;  3VHT C;  4B9K A;  4HKQ A;  4DHZ B;  4BKS A;  1H8C A;  2BTE A;  3KYD D;  3MTN B;  2DLB A;  1JRP A;  3P4Q B;  2IO1 B;  5CHV C;  4LCD E;  4OZB A;  2KLG A;  1I4R A;  2LWP A;  3BIN A;  4FJV B;  3PHW B;  3L08 A;  1WH3 A;  1EWC A;  1FD6 A;  1KOT A;  4R3D A;  2PEA A;  2BPS A;  2JWZ A;  3B1L X;  4RGN A;  4P6V F;  2O2V B;  3O13 A;  4JLC A;  3I9V 1;  2KDE B;  2KJR A;  5IKC M;  4AJY B;  3X23 A;  2KDM A;  4LNI A;  3A9J A;  3DPD A;  2GBN A;  5FK9 C;  4FA6 A;  5JHA A;  3EHV A;  1ZW7 A;  1JWB D;  2IGG A;  2AQ3 B;  4G3X B;  3VRB B;  2MBQ A;  2OHF A;  3L13 A;  2G4S A;  3D32 A;  3QJZ A;  4EZL A;  2K8C A;  3RN9 C;  2MLB A;  1MFW A;  3OLM D;  1I4X A;  2DNF A;  3HVZ A;  5AZF A;  4W9I A;  4W9L A;  1I4H A;  1ZDX A;  4S17 A;  5FR6 A;  2A5U A;  5DCN A;  2FCM A;  2M19 A;  1LGR A;  3PT2 B;  5EE9 A;  2KN5 A;  1JCK B;  1V1P B;  2VZK B;  1V81 A;  3Q3F A;  2LUM A;  3AE8 B;  2RMM A;  2D11 A;  1MI0 A;  1AWD A;  1D5X C;  1VD2 A;  2GBK A;  1MG8 A;  1KTK A;  3AE6 B;  3NZ3 A;  4W9G A;  4GN1 A;  1FFV A;  2D2Q A;  3UIO B;  3VTW A;  2KC1 A;  1D3Z A;  2WGS A;  2VRR B;  2DYM A;  5D7G A;  1MPE A;  5CHW A;  4GDL A;  2D3A A;  4D2K A;  3VFK A;  2LMC A;  2D3B A;  2UYZ B;  3AU4 A;  3APD A;  4Q2J A;  2QMT A;  3TEZ A;  4M8N A;  4BKT A;  1KRH A;  2SEB D;  4XZ4 A;  4FHJ A;  1E7P B;  4A6Q A;  4RNA A;  4KX6 B;  2J7Q B;  4MSM B;  4PYZ A;  2K9X A;  2FUH B;  2V1Y A;  2LVO A;  2JRI B;  3P4P B;  2L7R A;  3VQI A;  3ZJV A;  4XWW A;  3AI5 A;  1JRU A;  2WWZ A;  4A55 A;  3R2I A;  3DBH I;  2YLM A;  4IWP A;  3RD2 A;  4HRS A;  1KLG D;  3DVG Y;  3PRE A;  1E7U A;  1UUP A;  2RDG A;  1FXA A;  2GBJ A;  2NPT A;  2RDB C;  3APC A;  2IO3 B;  2CR5 A;  4YTM B;  1MHX A;  4EE2 A;  1TY2 A;  2WX1 A;  2AL6 A;  3QIJ A;  4I6N B;  1A70 A;  1ZP0 B;  2Y5C A;  1YN3 A;  2L3Z A;  4LDT D;  2K1F A;  3B0A A;  1C1Y B;  3QAR A;  2DAJ A;  1PGX A;  1C77 A;  3CST A;  3AED B;  4M8M A;  3ML9 A;  2HDE A;  1I4G A;  3GP7 A;  1XCQ L;  1L5P A;  4MH0 E;  1F2R I;  1ZGU B;  2FAZ A;  2V4L A;  3SD5 A;  2MP2 A;  1WX9 A;  3DHI C;  3IT6 B;  4NQL B;  4NJ6 A;  4MJS A;  1YNT E;  3W5U B;  1C79 A;  2LZ6 A;  4HDQ A;  2R61 A;  4NAW B;  1XLO A;  4FN2 A;  4B6W A;  4DDG D;  2N4F A;  4OW0 A;  4BAX A;  1YN5 A;  1WXV A;  1TY0 A;  1Q10 A;  2QJL A;  2RPQ A;  2BKF A;  2LHD A;  3KWL A;  4GMV A;  1ISN A;  2D5G A;  4ZYN A;  2MQJ A;  1OTR B;  4GIV A;  4MT5 A;  4NNJ B;  3SFD B;  1ACC A;  4TV3 A;  2UU7 A;  1I35 A;  4BBN C;  1SJE D;  2KFK A;  3PRM B;  5BO4 B;  4KIK A;  4N6E B;  2PMV A;  4BOS C;  1MHH E;  2AQ2 B;  1AW7 A;  2MBE A;  3GB1 A;  3OJ4 B;  2BS4 B;  1V86 A;  2W3S A;  1QLB B;  4ZRI A;  1VLB A;  3IBE A;  2ZPN A;  3NVY A;  3H7S A;  4HXD A;  2N1W A;  1BML C;  4PK1 A;  1M4V A;  3AEE B;  1WXA A;  2X38 A;  2MWS B;  3ETR A;  1S1Q B;  4HPL B;  2GI9 A;  3CF6 E;  4BKG A;  1JRO A;  2EKE C;  1QZE A;  1WF9 A;  1YJ1 A;  1WYG A;  3BK1 A;  1L0Y B;  4CQN A;  1QOA A;  4KDI C;  1F1H A;  2K6D B;  2KAC A;  2ZCB A;  3EFU A;  1FRD A;  3RUI B;  1CQV A;  2MHJ A;  3JVZ X;  1L6V A;  1GG3 A;  3ECI A;  1WGK A;  3TEW A;  2WXI A;  3VRA B;  4ANX A;  3ZUN A;  5BMH A;  1JW9 D;  5J17 A;  2L0T A;  3NZS A;  1NYQ A;  2R2Q A;  4P16 A;  1WGY A;  2PJH A;  1WJ4 A;  3GZN B;  2ASQ A;  4FXC A;  1EUV B;  2V3N A;  1TS3 A;  1C78 A;  3VR8 B;  2G45 B;  3K9P B;  1YOV B;  1E9M A;  1JWU D;  1E10 A;  1VJK A;  2WXR A;  4K7W A;  3QA8 A;  1JWS D;  4P1B C;  3W5V B;  2BW2 A;  2ZVN A;  4WWM A;  4FHK A;  1V1O A;  5KHQ A;  2MA9 B;  2QEJ C;  3EUB 2;  4KVG B;  2AWT A;  2GRI A;  1IP9 A;  3B2G A;  2FBW B;  3TJP A;  2JT4 B;  5G5G A;  2FID A;  2GBM A;  2WYQ A;  2BT6 A;  1MVK A;  3CSF A;  3UGB B;  5LXI B;  3VVW B;  2LXC A;  3DHH C;  3WAO A;  2PLP A;  3N30 A;  2G3Q B;  4KZC A;  2DBY A;  3A1Q B;  2HJ1 A;  1TS4 A;  1EM7 A;  1T5X D;  2C5L C;  4KSK C;  4NZL B;  3AN1 A;  2K3U A;  4MAC A;  2MBB B;  1FEH A;  5KHO A;  2DWQ A;  5J2R A;  1TTN A;  2N9E B;  3QHT A;  2WX0 A;  4IM2 A;  3AUL A;  2REX A;  2M4N A;  3KVF B;  2DYO A;  2KLC A;  5JH5 C;  1AAR A;  5LXH A;  3VAW A;  4E3C A;  3VTU A;  4N58 A;  3Q3O C;  2CHX A;  4BVU C;  3L0W B;  4RFB A;  1L2N A;  2TSS A;  1QKZ A;  4KKI A;  1HE8 A;  3R8B A;  4II2 B;  1FRR A;  2L1A A;  4TQ0 A;  5EDS A;  1I42 A;  2NTS A;  4ICU A;  3V6E B;  4PT5 A;  3W1S A;  1IGC A;  3RI7 C;  2EMS A;  1FIQ A;  3SR6 A;  3QQ8 B;  4FUL A;  5C2T B;  1HQR D;  2UWQ A;  5AEK B;  2Q5W D;  2MBH A;  2L05 A;  1OQQ A;  3S2A A;  1XD3 B;  1S3S G;  4OZA A;  1P98 A;  2WU5 B;  1XF5 L;  4A8X C;  1JWM D;  4XYC A;  3VTV A;  2MJ3 A;  3CWI A;  4LNF A;  1FMA D;  1XLP A;  4GSW A;  1Y8R C;  4LNN A;  1DOX A;  3QX1 A;  2JXX A;  1KM7 A;  4KGS A;  1E90 A;  3AE9 B;  2MJE A;  2BWE S;  3QK0 A;  1P3Q U;  2LGD A;  3RCZ A;  4TKN A;  1WJ6 A;  1QT9 A;  1YN4 A;  2QCZ A;  1DGJ A;  3KUC B;  1Q1O A;  1F77 A;  1KJT A;  2IY0 B;  3ZTD A;  4MM3 A;  1SE2 A;  1NVI D;  3N32 A;  2K0P A;  2PKO A;  1L0V B;  4EZJ A;  2XK5 B;  2J0M A;  2RPV A;  3U2S C;  2Y5B B;  3DDC B;  2L0F A;  4RH6 A;  4HPP A;  3N1X C;  3HHM A;  3V62 A;  1GB4 A;  3TCA A;  2KTR A;  2D10 A;  1HTQ A;  2KZR A;  4KZ0 A;  3KW5 B;  2WXK A;  1AYF A;  3WAP A;  1WWT A;  2INC C;  2WXL A;  4LJP B;  4PS7 A;  5FKA C;  1WZ3 A;  3R3M A;  1X1M A;  3RPF C;  1WE7 A;  4N59 A;  1C9F A;  1WR6 E;  2BF8 B;  1C4P A;  4DDI D;  2OOB B;  1EF5 A;  3W2D A;  3GS2 A;  1KH0 A;  1TBE A;  1WXS A;  2L32 A;  3P1M A;  4M00 A;  4PS3 A;  4NPN A;  1FO4 A;  1UBQ A;  2B3A A;  3TIX A;  3ZIM A;  5JHB A;  5AUK A;  1WZ0 A;  2KK8 A;  1TJE A;  1L6U A;  1ENF A;  1KF6 B;  2JYT A;  2KD0 A;  4HJK A;  5HFY A;  2FIF A;  3OWE B;  4YT0 B;  5IO9 A;  3JYU A;  1TKE A;  1QOG A;  1F0Z A;  2AL3 A;  3NHE B;  2NS5 A;  2O6V A;  1E6E B;  2KQ4 X;  4II3 B;  2IPK D;  2MH7 A;  3OJ3 A;  2KVZ A;  2Z0E B;  4JX1 C;  4JL9 A;  3UQB A;  2LRU A;  1PQS A;  1QQR A;  4YSX B;  1LQB A;  3KWV A;  3DBR I;  4ANV A;  4F7Z A;  5IP4 D;  2INN E;  3PRZ A;  4IWQ A;  4I6P A;  2WXH A;  1C4A A;  3W9C B;  3FKY A;  4HK2 A;  4ZRP A;  2M1M A;  4K7S A;  1FNU A;  3DVN V;  1WRD B;  2BYV E;  1Y56 A;  2DYB A;  4WJP A;  4AP4 C;  1K50 A;  3ENE A;  2JYE A;  3PZ7 A;  4WUR A;  1T0S C;  2N7D A;  3SEB A;  3SDL C;  4LDT B;  3AU5 A;  2BS2 B;  3MHS D;  2KQS A;  3P42 A;  2E3T A;  4KV2 A;  2C7H A;  4FJY A;  4RM9 A;  3SHQ A;  2I2Y A;  4C00 A;  3CMM B;  1N63 A;  2BKR B;  2Z8L A;  3VXW A;  1XCT L;  1H4R A;  1SE3 A;  3PO0 A;  3X0W A;  3RUL A;  3HM3 A;  1XQQ A;  4HEA 1;  3AE3 B;  1UD7 A;  1VDV A;  1C3T A;  3L10 B;  3U7D A;  2J52 A;  2IJ0 A;  3AE4 B;  2KC2 A;  1YQ3 B;  4A20 A;  3FIL B;  1Z5S B;  4MM3 B;  2IGH A;  4NQK E;  4DBG A;  2WU2 B;  4M01 A;  3R66 C;  2J4X A;  2M17 A;  3V6C B;  4B95 A;  4NAM A;  1YX6 B;  3PPA A;  2NBU A;  1UZX B;  1GB1 A;  4C7Z A;  3DQV A;  1NDD A;  3GOE A;  2I1K A;  3K9O B;  2YEP F;  5DPR A;  3VDZ A;  4CYE A;  3DBH B;  2K25 A;  3AB5 A;  4FLH A;  1J19 A;  2MCN B;  1IBX B;  1Q0W B;  1SE4 A;  3DBL B;  3A9K B;  4GGQ A;  2IGD A;  1N5W A;  4EEW A;  1RWS A;  2JZ3 B;  3ZDM C;  1XT9 B;  2LXA A;  4WJQ A;  1WYW B;  3AE5 B;  1VR9 A;  5AZG A;  1WE6 A;  1WSP A;  2JRH A;  3MJ5 A;  2WDQ B;  2AQ1 B;  4HCP B;  4HJG E;  2ZW0 A;  1V2Y A;  1F2R C;  4S0R A;  2HD5 B;  3AM9 A;  2ONQ A;  4M0W A;  3ZJT A;  2KHW B;  3C8Y A;  2V3S A;  3L17 A;  1FM0 D;  3LDZ E;  1R4M B;  2NTT A;  1YJI A;  2WNM A;  2Y3A A;  2KYW A;  2BVC A;  3H9D A;  4L1B A;  2LFI A;  3T3N A;  1TIF A;  1WGH A;  3AEA B;  1L4D B;  2IYD B;  2YEP B;  1OFF A;  1TZO A;  4PS8 A;  4DHZ E;  4TQ1 A;  1D6E C;  2CU3 A;  3A9J B;  3AH7 A;  4RGO S;  3VUW A;  4WQM A;  3MC0 B;  5TR5 A;  3MC9 A;  3Q69 A;  2KX3 A;  3UIN B;  3ZRF A;  1IYF A;  4DXA B;  4IC7 B;  3KH0 A;  1FNW A;  3M95 A;  2KVR A;  3APF A;  2WXJ A;  3N1Y C;  2WDR B;  4XX5 A;  4JQW C;  4REZ A;  1V5T A;  5HG2 A;  3RNB C;  2N0S B;  3N20 C;  4AWJ A;  4LTU A;  5EE0 A;  1ZOY B;  2ICI A;  5G2N A;  3V3X A;  2JPH A;  1XO3 A;  2GBR A;  3DCG A;  3M3J A;  2ZNV C;  3PS6 A;  4WWP A;  2KDB A;  2IZV B;  2NBW B;  2WS3 B;  2EMT A;  4US9 A;  4DXF A;  4QAY A;  2N7E A;  1MJD A;  2PIA A;  2G9H D;  2H89 B;  5AUI A;  3ZNG C;  3MHZ A;  5TSS A;  1RAX A;  2ZNV B;  3LJ3 A;  2L83 A;  2DZK A;  1B1Z A;  1BUI C;  4G11 A;  3FC4 A;  4K7U A;  1WM2 A;  2JQR B;  3E9S A;  4KGT A;  4MEM A;  4GDL B;  5BYS A;  1WJN A;  3V60 A;  4BKS D;  3PLU A;  1CK1 A;  1WI0 A;  3R7Q A;  3AEC B;  2OJW A;  4HDO A;  2KMM A;  1V8C A;  4MGY E;  4HKZ E;  4DHJ D;  1PGB A;  4J3O D;  1V6E A;  2N9L A;  4MGZ E;  4HRO A;  3BVZ A;  4L2Y A;  1NBF C;  2KT7 A;  1Q5W B;  1L4Z B;  5DPW A;  4E74 A;  2IDY A;  2W3R A;  4LK0 M;  1J8C A;  1RYJ A;  1CJE A;  2I1J A;  4WWO A;  1K8R B;  3N3K B;  3BWU D;  3WAL A;  4C4V A;  4IWO A;  4USA A;  2KO3 A;  2VH2 A;  3PV1 A;  2K22 A;  2KDI A;  1P7F A;  1N61 A;  3VUX A;  2RSU A;  2NPT B;  2K8B A;  2Z59 B;  4KGR A;  2KJH B;  1SF0 A;  4EZK A;  1C76 A;  1EF1 A;  4FJZ A;  2RDH A;  3PTF C;  3HM6 X;  3ZLZ A;  2M8S A;  3IAM 1;  4GB9 A;  4GDK A;  3RZW C;  5G5H A;  4WWN A;  4W9F A;  5BYR A;  5T8I A;  2BYT A;  4K3C A;  1BXT A;  2WXG A;  3PVL A;  4URK A;  3HVD A;  4ICV A;  2V0G A;  3SU8 X;  3RZF A;  3EC8 A;  4IG7 B;  1P7E A;  1U4A A;  2JWU A;  1BT0 A;  4WQO B;  1ZXH A;  2JZZ A;  5IAA C;  4WAF A;  1WMH A;  5HKH A;  2MP2 B;  1TS2 A;  4MJS B;  1J7B A;  2RR9 A;  4OZC A;  3U4E G;  1SEB D;  3NRZ A;  1UH6 A;  4W9D A;  1DOI A;  3GE8 C;  4LNO A;  2HE7 A;  1YQB A;  4HLE A;  2BYE A;  2X8X X;  3L4P A;  1RRB A;  1XLQ A;  4HCN B;  2QDF A;  2JY6 A;  4IM3 A;  1FCL A;  1WXQ A;  1K52 A;  1NEN B;  3UIP B;  3DBS A;  4MDK E;  4WAA A;  2KX0 A;  3WIM A;  1SB3 C;  2ZVO A;  1C4C A;  2ZW1 A;  2EKI A;  2KDF B;  3DWG C;  2FE8 A;  2BGF A;  2IND C;  4KKJ A;  2KWC A;  2KFK B;  1IPG A;  4RGT A;  4KIK B;  4AOF A;  1E8Z A;  3PRP B;  1UWM A;  1LFD A;  3OAW A;  3MC8 A;  3AE1 B;  3LYY A;  2LUE A;  1P1A A;  2KWV B;  3TUO A;  2GLS A;  2LJ5 A;  3RYT A;  1RLF A;  3IT4 B;  3AE7 B;  3PSE B;  2O2V A;  3QCA A;  3T9L A;  4EOY A;  2C60 A;  2WXQ A;  1ET9 A;  2I38 A;  2B76 B;  1EU3 A;  2BS3 B;  1J0G A;  1HTO A;  1TS5 A;  5FR3 A;  5E6O A;  2QIL A;  2G1E A;  4N9F 4;  4JE3 B;  3IG3 A;  4P1C C;  1RFK A;  4B0M A;  1JAL A;  2K5P A;  2N9K A;  3M63 B;  1HEZ E;  3E56 A;  2YVC A;  1VZ8 A;  4IDI A;  1FPY A;  2PPH A;  2GOW A;  1NI2 A;  3RNF C;  2J42 A;  3NUH B;  4AS1 A;  3Q8A A;  3BVG A;  4F1S A;  1WX8 A;  1D4B A;  3FAH A;  4JGH B;  4C56 C;  2AX5 A;  4GXB A;  4JWU C;  2MW5 A;  3O65 B;  2L00 B;  3PGE A;  4OVZ A;  3TEY A;  2JVC A;  3P4S B;  1E8X A;  5DPS A;  1PUT A;  3EFC A;  1JWA D;  3T8M A;  2CS4 A;  3UI3 A;  1SIF A;  4JWS C;  2BB5 A;  3ABV B;  2WXF A;  2GB1 A;  1DYQ A;  2LVQ A;  4RF0 A;  3NS1 A;  4YXD B;  2PVG C;  3VR9 B;  2JXT A;  1YQ4 B;  3AEG B;  4RM8 A;  2VH1 A;  4ANW A;  1STE A;  5MPO A;  4YWG G;  2V9H A;  4RMA A;  3EA6 A;  5JXV A;  3ZVV A;  1ZDV A;  2D3G A;  4CHK A;  1R4N I;  3ZTC A;  2GMI C;  1GPX A;  3U30 A;  5BMG A;  2KNB A;  2LI5 A;  3RNE C;  3P4R B;  3T3O A;  1EO6 A;  4I6L B;  3HK0 A;  4O1N A;  4FAD A;  3NVW A;  5HI1 A;  1T0Q C;  1FNV A;  1WR1 A;  1B9R A;  3N1Z C;  3A4S C;  4A90 A;  3V61 A;  3JSV A;  4YL8 A;  1QOF A;  4XC2 A;  1RFA A;  3CIR B;  2MRP A;  4RF1 A;  4A9A A;  1T3Q A;  3UF8 A;  4FBJ B;  3BZD B;  4HPM B;  2PE6 B;  1MG4 A;  5L95 C;  2KAN A;  3DBR B;  2LJI A;  2BB6 A;  1YMH E;  5I4D A;  3H7P A;  4IW0 A;  2AEH A;  2G4D B;  1FFU A;  4AJW A;  4RGM A;  4WH4 A;  1SBB B;  2KMA A;  2CJO A;  2J0J A;  1WGR A;  2NMQ A;  4K3B A;  4XWT A;  1V97 A;  1I4P A;  2E6X A;  1KLU D;  3W1S C;  2C7N B;  4OVU A;  2WDT B;  3QWZ B;  1PDX A;  2HTH A;  2KFJ A;  2JF5 A;  4ZRQ A;  4KDL B;  2FCQ A;  2LD9 A;  1CMX B;  2XNA C;  3RNG C;  1DOY A;  3ZDT A;  3ALB A;  4ZHO A;  3GE3 C;  3I57 A;  1OEY J;  5GMV A;  2WHI A;  2J53 A;  2WXM A;  3R7R A;  2FUG 1;  4AUQ C;  1V49 A;  1TKY A;  4W9E A;  3U8Z A;  1HZ6 A;  1SSN A;  3P63 A;  1NYR A;  4ACF A;  2JU6 X;  3P2B A;  4ARC A;  4B0E A;  4NAW A;  3DWM A;  1OQR A;  5D3D A;  3WCQ A;  2RGF A;  2CHW A;  4OVV A;  2JZP A;  3Q3N C;  4H2A A;  1ZPS A;  1WM3 A;  1M94 A;  4XDD A;  1JQ4 A;  1UGM A;  3URY A;  2ACZ B;  2LAS A;  3BK2 A;  4K1R B;  2KWU B;  1XXG A;  2PW9 A;  1OGW A;  1YIW A;  2W54 A;  1R7S A;  1GJZ A;  2AYO B;  2A4Z A;  1T0Y A;  4WIP A;  1P0R A;  1E0Z A;  5H8Y E;  1L7Y A;  2N7J A;  2CU1 A;  4J6I A;  4ZOH C;  3UQA A;  1TZ1 A;  4XGA B;  3KLS X;  4ZRK A;  2INP E;  3B2F A;  1JML A;  3WAN A;  4GU2 A;  3KQ4 A;  2IO2 B;  2MSE D;  5E6P A;  3BYY B;  4YSZ B;  4DWF A;  3I5J C;  2RD0 A;  1GNU A;  1SE9 A;  4BZA A;  2IO0 B;  1V80 A;  3IAS 1;  2W9N A;  2OJR A;  1WIA A;  2LEK A;  3MJW A;  2KTR B;  1KFY B;  4G0N B;  1J7C A;  2CKH B;  4WJN A;  2C9W B;  4DXG A;  4TUU A;  3H8H A;  3NS8 A;  1Z2M A;  2L52 A;  3EEC A;  2M56 B;  1YX5 B;  4IUM B;  5C1Z A;  2JUO A;  2KKC A;  1N5X A;  3WA0 A;  3H1U A;  3B9J A;  2CJN A;  2WLB A;  2KOX A;  1ROE A;  3JSV B;  4C7Y A;  2KWD A;  3PHX B;  3HRD D;  3HUI A;  4DHJ B;  1VCB A;  2NR2 A;  1N60 A;  3LB8 C;  3ZYY X;  1WXM A;  2QHO A;  3IHP C;  1NI3 A;  4C80 A;  2O6V B;  1WJU A;  2FNJ B;  3DBL I;  3C0R B;  3ZNZ B;  1AN8 A;  4G50 A;  4F8C B;  3H7P B;  2DEN B;  5CX3 A;  3V05 A;  3J9C A;  1FXT B;  4YTP B;  3TEX A;  1RM6 C;  1T6B X;  5C23 A;  2ZZP B;  3NOB A;  3NJT A;  2BYF A;  1D5M C;  2WQY B;  2WP9 B;  4BBN F;  3ZJU A;  3W1Y A;  4YSY B;  1HXY D;  4BOZ B;  1QF6 A;  2VZK D;  1R4M I;  4CO7 A;  1YD8 U;  1WY8 A;  1TYG B;  3A1Q A;  2QSD A;  5GXG B;  4ANU A;  2DZM A;  2WXN A;  3R2T A;  3KYC D;  2FCN A;  1FXI A;  4EUT A;  3IXS A;  1ZKH A;  1QIL A;  3Q8E A;  2K8H A;  1ESF A;  4M02 A;  2L8J A;  1K51 A;  3BY4 B;  2CHZ A;  3TSS A;  3ZW3 A;  2BQQ A;  5CHF A;  2KN4 A;  4ZRJ A;  4US8 A;  3AEF B;  4TMA B;  3DHG C;  1P9D U;  1HA5 A;  3ZKJ C;  2JSV X;  2D3C A;  1ET6 A;  3TMP B;  2L76 A;  3DVG X;  4KSL C;  2QIE B;  2M0X A;  4L23 A;  5BYQ A;  2ZPY A;  1ZXI A;  1NEK B;  4IKG A;  3VH3 B;  1WX7 A;  1E7V A;  3QC8 B;  2LGX A;  5D6J B;  5H92 C;  1G6J A;  2DAF A;  4HWI B;  5IOI A;  5E6N A;  2SAK A;  3Q3J A;  1CZP A;  2DHZ A;  1IUE A;  3Q3M C;  3U7Z A;  2KMC A;  5IN7 A;  1UBI A;  3ONS A;  2EEL A;  3ZGZ A;  4IOI E;  2HJ8 A;  1WFY A;  3KUZ A;  4OHJ A;  2DX5 B;  1TKG A;  5E6J A;  2ZJD A;  2O6V D;  2MBO A;  4ZYS A;  4AQ7 A;  4ZDV A;  1XLN A;  1T0R C;  5D94 A;  3Q8F A;  2NBV B;  1J7A A;  2K6Q A;  1FCC C;  3ZNH B;  3I63 C;  1VZ6 A;  4MGK E;  5BMI A;  3M62 B;  3PZ8 A;  3ML8 A;  4ASW C; 
#chains in the Genus database with same CATH homology
 3NVZ A;  1QQR A;  1KLG D;  1EWY C;  1SIJ A;  4YSX B;  3KWV A;  4JE3 B;  1UUP A;  2RDG A;  1FXA A;  1RFK A;  2INN E;  4B0M A;  1JAL A;  2K5P A;  2N9K A;  1HEZ E;  4RCO A;  4YTM B;  1MHX A;  4EE2 A;  3E56 A;  2KAJ A;  1TY2 A;  1PYW D;  1VZ8 A;  4IDI A;  4XDC A;  2WXP A;  2WXH A;  1C4A A;  3W9C B;  2XN9 C;  1A70 A;  4ZRP A;  2M0A A;  4DQO C;  2J42 A;  3NUH B;  4AS1 A;  1ZP0 B;  2Y5C A;  3BVG A;  3Q8A A;  1YN3 A;  1FNU A;  1D4B A;  3FAH A;  4ZHP A;  1Y56 A;  1VRA B;  4C56 C;  1PGX A;  1C77 A;  1K50 A;  3RFZ B;  2AX5 A;  4JWU C;  1GOZ A;  3AED B;  2JYE A;  3PZ7 A;  2HDE A;  4OVZ A;  3TEY A;  4WUR A;  1I4G A;  3GP7 A;  3P4S B;  1XCQ L;  1PUT A;  1L5P A;  1F2R I;  1UNS A;  3MFG A;  1JWA D;  3SEB A;  2Y5P A;  3UI3 A;  4JWS C;  2BB5 A;  3ABV B;  2WXF A;  2BS2 B;  2GB1 A;  1DYQ A;  3P42 A;  2E3T A;  3IT6 B;  4RF0 A;  1YNT E;  3W5U B;  2I2Y A;  3NS1 A;  1C79 A;  1VZ7 A;  4YXD B;  2PVG C;  1SJH D;  1EU4 A;  1N63 A;  2R61 A;  2Z8L A;  1XCT L;  4NAW B;  2PTL A;  4ARI A;  1SE3 A;  1XLO A;  2JXT A;  3PO0 A;  3VR9 B;  1YQ4 B;  3AEG B;  5EE1 A;  5LNK 1;  5MPO A;  1STE A;  2V3P A;  4OW0 A;  2JX5 A;  2HTM E;  4HEA 1;  1YN5 A;  4YWG G;  3AE3 B;  1TY0 A;  1Q10 A;  1VDV A;  2QJL A;  3EA6 A;  5JXV A;  1ZDV A;  3AE2 B;  2LHD A;  3AMZ A;  1L0X B;  3KWL A;  2J52 A;  4JPS A;  1K53 A;  2IJ0 A;  3AE4 B;  2D5G A;  2LHE A;  1YQ3 B;  1GPX A;  1GAQ B;  2H88 B;  4MT5 A;  5BMG A;  1D5Z C;  3SFD B;  1ACC A;  3FIL B;  4MM3 B;  2IGH A;  2WU2 B;  3P4R B;  1SJE D;  3T3O A;  2J4X A;  4N6E B;  1ZE3 D;  2PMV A;  1MHH E;  4O1N A;  2AQ2 B;  1AW7 A;  4NAM A;  3Q8C A;  3NVW A;  3GB1 A;  5HI1 A;  2BS4 B;  1FNV A;  1GB1 A;  2W3S A;  4C7Z A;  1QLB B;  1B9R A;  4NJC A;  1VLB A;  4A90 A;  2MJD A;  1PGA A;  3NVY A;  2YEP F;  1QOF A;  4MH8 A;  1BML C;  4ITK A;  3CIR B;  3Q8B A;  1M4V A;  4RF1 A;  1T3Q A;  3AEE B;  4A9A A;  2X38 A;  3ETR A;  3AB5 A;  1SXT A;  5EE3 A;  3AEB B;  3BZD B;  1IBX B;  2GI9 A;  1JRO A;  1SE4 A;  3ZQ4 A;  1WYG A;  2WXO A;  3BK1 A;  1L0Y B;  3NVV A;  1QOA A;  2LJI A;  2BB6 A;  4GLS C;  2IGD A;  4TSS A;  4CQN A;  1N5W A;  1YMH E;  5I4D A;  3SFE B;  1RWS A;  1WRI A;  2KAC A;  1FRD A;  5D3I B;  2OED A;  3AE5 B;  1VR9 A;  1CQV A;  1FFU A;  4RGM A;  1L6V A;  3MP9 A;  4WH4 A;  1I4Q A;  1WGK A;  1I7H A;  1WSP A;  1SBB B;  3MJ5 A;  2WDQ B;  2AQ1 B;  4HJG E;  2CJO A;  3TEW A;  2ZW0 A;  2WXI A;  1F2R C;  2NMQ A;  3VRA B;  4XWT A;  1V97 A;  1I4P A;  2E6X A;  1KLU D;  3U52 E;  5BMH A;  1JW9 D;  3AM9 A;  2ONQ A;  4M0W A;  3ZJT A;  1PDX A;  3C8Y A;  1NYQ A;  4ZRQ A;  4P16 A;  1FM0 D;  2NTT A;  2XNA C;  4FXC A;  1YJI A;  2WNM A;  1DOY A;  2V3N A;  1TS3 A;  4ZHO A;  2Y3A A;  1C78 A;  1UWX A;  3VR8 B;  3I57 A;  4L1B A;  1E9M A;  1JWU D;  1E10 A;  2LFI A;  3T3N A;  2J53 A;  2WXM A;  1VJK A;  2FUG 1;  2WXR A;  5C3J B;  1TKY A;  2ON8 A;  1V1P A;  3AV8 A;  2LGI A;  1JWS D;  1HZ6 A;  1SSN A;  3AEA B;  3P63 A;  3W5V B;  1QOB A;  4UDU C;  1NYR A;  5HHD G;  2JU6 X;  1IGD A;  2BW2 A;  1L4D B;  1HZ5 A;  4ARC A;  2YEP B;  2V4I B;  4WWM A;  4B0E A;  1OFF A;  1TZO A;  1OQR A;  3DWM A;  5D3D A;  3WCQ A;  1V1O A;  1YJJ A;  2W55 A;  4TQ1 A;  1D6E C;  1UGJ A;  2CU3 A;  2QEJ C;  3EUB 2;  2JZP A;  3AH7 A;  2GRI A;  4H2A A;  4RGO S;  1ZPS A;  4XDD A;  1JQ4 A;  3B2G A;  4WQM A;  3MC0 B;  2FBW B;  3URY A;  2ACZ B;  3Q69 A;  5G5G A;  4LLG M;  3BK2 A;  2MEK A;  2BT6 A;  1MVK A;  3N9Y C;  1FNW A;  1XXG A;  2PW9 A;  3FIL A;  2WXJ A;  2W54 A;  1R7S A;  2WDR B;  1PFD A;  4REZ A;  5HG2 A;  2N0S B;  4WIP A;  4GDK B;  4LTU A;  5EE0 A;  2PVO D;  1XEE A;  1ZOY B;  2ICI A;  2PLP A;  2BBC A;  3V3X A;  2DBY A;  1E0Z A;  5H8Y E;  1XO3 A;  2N7J A;  4ZOH C;  3KLS X;  1TS4 A;  1EM7 A;  1T5X D;  2INP E;  3B2F A;  1JML A;  2WS3 B;  2W82 A;  3BVM A;  4NZL B;  4US9 A;  3KQ4 A;  3AN1 A;  1ZUD 2;  4DXF A;  2K3U A;  3EGR A;  4MAC A;  3BII D;  3BYY B;  4YSZ B;  2PIA A;  2G9H D;  2H89 B;  1FEH A;  5AUI A;  2DWQ A;  4XE0 A;  4YTN B;  1IBX A;  3MHZ A;  2WDV B;  5TSS A;  3BYT B;  3IAS 1;  2L83 A;  2LEK A;  1KFY B;  3LXF A;  1BUI C;  1B1Z A;  3FC4 A;  1J7C A;  1N62 A;  4DXG A;  2JQR B;  3E9S A;  1LO5 D;  4KGT A;  3H8H A;  2L52 A;  4GDL B;  2M56 B;  4HKQ A;  5BYS A;  2DYO A;  1CK1 A;  2BTE A;  2DLB A;  1JRP A;  3AEC B;  2KMM A;  1V8C A;  3P4Q B;  4OZB A;  4HKZ E;  4N58 A;  1N5X A;  1I4R A;  1PGB A;  4J3O D;  3B9J A;  2CJN A;  2N9L A;  4RFB A;  2WLB A;  4HRO A;  2TSS A;  1QKZ A;  4KKI A;  3BVZ A;  1ROE A;  4L2Y A;  1FRR A;  1EWC A;  2L1A A;  3R8B A;  4C7Y A;  2KWD A;  2NTS A;  4TQ0 A;  4PT5 A;  3W1S A;  1IGC A;  3HRD D;  1FD6 A;  3HUI A;  1N60 A;  1L4Z B;  1FIQ A;  3SR6 A;  3LB8 C;  3ZYY X;  4R3D A;  5C2T B;  2IDY A;  1HQR D;  2Q5W D;  2W3R A;  4LK0 M;  1NI3 A;  1OQQ A;  4RGN A;  1RYJ A;  4OZA A;  1CJE A;  4C80 A;  4P6V F;  2WU5 B;  1XF5 L;  3O13 A;  4A8X C;  1JWM D;  1AN8 A;  3BWU D;  3I9V 1;  2MJ3 A;  3CWI A;  3V05 A;  2KDM A;  4USA A;  3J9C A;  1FMA D;  1XLP A;  4YTP B;  5FK9 C;  3TEX A;  2K22 A;  1P7F A;  1RM6 C;  1DOX A;  1T6B X;  1N61 A;  4KGS A;  1JWB D;  2IGG A;  2AQ3 B;  3AE9 B;  2MJE A;  4KGR A;  3VRB B;  1SF0 A;  1C76 A;  2OHF A;  1D5M C;  2WQY B;  2RDH A;  2WP9 B;  3ZJU A;  1QT9 A;  1I4X A;  3HVZ A;  4YSY B;  1HXY D;  3IAM 1;  1I4H A;  1YN4 A;  5G5H A;  1QF6 A;  2VZK D;  1DGJ A;  1ZDX A;  1F77 A;  5BYR A;  1TYG B;  5GXG B;  2QSD A;  5T8I A;  2BYT A;  1BXT A;  2WXG A;  1SE2 A;  1NVI D;  2M19 A;  3HVD A;  2K0P A;  5EE9 A;  2V0G A;  2WXN A;  1JCK B;  1V1P B;  2PKO A;  2VZK B;  1L0V B;  3R2T A;  1P7E A;  2JWU A;  2LUM A;  3AE8 B;  2RMM A;  1ZXH A;  1FXI A;  1MI0 A;  2RPV A;  3IXS A;  1AWD A;  3U2S C;  4WAF A;  1D5X C;  4RH6 A;  1QIL A;  3Q8E A;  1KTK A;  3AE6 B;  3NZ3 A;  1TS2 A;  1GB4 A;  1ESF A;  1FFV A;  1J7B A;  4OZC A;  1K51 A;  3TSS A;  3U4E G;  1SEB D;  3NRZ A;  1DOI A;  2KN4 A;  2WXK A;  4US8 A;  1AYF A;  3AEF B;  1WWT A;  4TMA B;  2WXL A;  2DYM A;  5D7G A;  5FKA C;  1HA5 A;  1MPE A;  3L4P A;  2JSV X;  1ET6 A;  1XLQ A;  4D2K A;  2LMC A;  3RPF C;  4N59 A;  1WXQ A;  1K52 A;  1NEN B;  1C9F A;  1FCL A;  1C4P A;  2QIE B;  4Q2J A;  3W2D A;  2QMT A;  3GS2 A;  3TEZ A;  4L23 A;  5BYQ A;  1KRH A;  1KH0 A;  2SEB D;  2L32 A;  3P1M A;  1SB3 C;  1C4C A;  2ZW1 A;  1FO4 A;  1E7P B;  1ZXI A;  4A6Q A;  2EKI A;  4RNA A;  4KX6 B;  3DWG C;  2FE8 A;  4KKJ A;  1NEK B;  4IKG A;  5AUK A;  1TJE A;  1L6U A;  4RGT A;  2K9X A;  1UWM A;  1ENF A;  5H92 C;  1KF6 B;  2JYT A;  2SAK A;  5HFY A;  1CZP A;  1IUE A;  3AE1 B;  3U7Z A;  3LYY A;  2EEL A;  3OWE B;  3TUO A;  4YT0 B;  3ZGZ A;  4IOI E;  3P4P B;  1TKE A;  1QOG A;  3VQI A;  1F0Z A;  3ZJV A;  3IT4 B;  4XWW A;  3AE7 B;  4OHJ A;  5E6J A;  1TKG A;  1E6E B;  2KQ4 X;  4ZYS A;  2IPK D;  2MH7 A;  4AQ7 A;  1XLN A;  2WXQ A;  1ET9 A;  2I38 A;  4A55 A;  3Q8F A;  2B76 B;  1EU3 A;  1J7A A;  2BS3 B;  3R2I A;  1FCC C;  4JX1 C;  1TS5 A;  1VZ6 A;  5BMI A;  5FR3 A;  2QIL A;  3PZ8 A;  4HRS A;  2G1E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...