1C79A

Staphylokinase (sak) dimer
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
130
structure length
130
Chain Sequence
GKYKKGDDASYFEPTGPYLMVNVTGVDGKGNELLSPHYVEFPIKPGTTLTKEKIEYYVEWALDATAYKEFRVVELDPSAKIEVTYYDKNKKKEETKSFPITEKGFVVPDLSEHIKNPGFNLITKVVIEKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STAPHYLOKINASE
publication title Crystal structure of a staphylokinase: variant a model for reduced antigenicity.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 22
structure length 130
sequence length 130
chains with identical sequence B
ec nomenclature ec 3.4.24.29: Aureolysin.
pdb deposition date 2000-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02821 Staphylokinase Staphylokinase/Streptokinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.130 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1c79A00
1BUIC 1C77A 1SSNA 2SAKA 1C76A 1C78A 1C79A
chains in the Genus database with same CATH superfamily
4A3OA 1WMHB 2GBRA 5HHDG 1ROEA 4ZRJA 2PE6B 2XNAC 2YEPF 2O6VB 2A4ZA 2MSED 3RFZB 2Y5PA 2IO1B 4A6QA 3LB8C 2EELA 1FXAA 2JF5A 4W9KA 3HVZA 1STEA 1A70A 2NTSA 4AWJA 2I2YA 2LEKA 3K9OB 1ISNA 4LCDE 2VH1A 2KVRA 2GI9A 2AWTA 5BMGA 4FBJB 2MP2B 2HE7A 1C76A 2CHXA 2KXJA 2J7QB 1E7PB 1WJNA 5J2RA 4RGNA 2EKEC 1PYWD 3QA8A 2WDVB 1WH3A 2KQ4X 2IO0B 2IO3B 3LYYA 1R4MI 3C19A 4G50A 4DHZE 2G3QB 3L17A 5G2NA 3AH7A 2J0MA 4ANVA 2RSUA 1UBQA 2DYMA 2IGHA 2ZVNA 4YL8A 2IY1B 1DOYA 2L0TA 3E9SA 5IO9A 1JW9D 2GRIA 4DHJB 2LFIA 1Q10A 2JX5A 4C4VA 3U7DA 1F52A 1JRPA 4MH8A 5H8YE 3N32A 3RI7C 2V0GA 2IPKD 2CHZA 4KKIA 3DVNU 4XGAB 5D2MB 1QZEA 5G55A 2J53A 3IG3A 5HFYA 3NZUA 4EEWA 3HRDD 2KWUB 1V97A 3N9YC 2BWFA 3V05A 3Q3JA 4EOYA 2FCQA 1RLFA 5EE0A 3PVLA 3PPAA 1IUEA 4E3CA 4DWFA 5E6JA 3RNGC 2N9XA 1MPEA 1L6UA 4L1BA 1HA5A 1IGDA 1JQ4A 5JZEB 4A9AA 2N1WA 2KWCA 2ASQA 4TSSA 2DBYA 2JPHA 1OFFA 4J6IA 4M01A 1SGHA 2ZW0A 3A4RA 1I35A 4F1SA 4IOIE 1DGJA 3NG0A 2WXFA 5IP4D 4LJPB 4N9F4 2JZPA 3TEWA 2OJRA 1UBIA 5LXHA 3CWIA 1KM7A 2FUHB 2W82A 1T0SC 4II3B 5FR3A 3VFKA 2PVGC 3HHMA 1JRUA 4G0NB 2C60A 2D5GA 1OGWA 1PQSA 5I4DA 1U4AA 2NPTA 4L23A 3RD2A 3I9V1 2J52A 4M0WB 1EM7A 3BYYB 3VAWA 3V6EB 4M02A 5BYSA 5GMVA 2L52A 3VH4B 1S3SG 2LGSA 2NS5A 4JLCA 2BYEA 5JXVA 4GU2A 2DYBA 1KLVA 2D11A 2KX0A 1FM0D 4ACFA 2BYFA 4HKZE 1AW7A 4N59A 2FCNA 2KN5A 1K52A 1E8XA 2WXJA 5EE1A 4WWOA 4EE2A 2H89B 5AUIA 1I4RA 3FILB 1WR1A 2WXKA 4ZHPA 3K9PB 3NVWA 2FUG1 4MEMA 2J0JA 3NHEB 1WE7A 1AN8A 2R2OA 4P7IA 1YOVB 1NENB 3WALA 5CTRC 3W5UB 3KVFB 1E6EB 1GG3A 5C23A 3ZTCA 2ZW1A 1C4PA 3IT4B 2DZJA 2N7EA 3DHHC 3SD5A 2J4XA 2FBWB 2KMAA 2WLBA 4HJGE 4US9A 4TUUA 2KYWA 1CK1A 4YTPB 4NNJB 3TUOA 3BY4B 4EZJA 4HPPA 4EFOA 3ENEA 2KJRA 5EE3A 3PGEA 3KWLA 3PV1A 1QOBA 1IBXB 4DDID 2KQ7A 1OEYA 3DBLB 4US8A 2GB1A 4FA6A 2HJ8A 2MWSB 2HDEA 4A90A 5AZHA 1C79A 3RNFC 1QT9A 4USAA 3A9KA 3WA0A 4TMAB 1K50A 1F1HA 3QCAA 2KWDA 2K6QA 5BYQA 3P4SB 1YQ4B 3RNEC 3LJ3A 2WX1A 2O2VB 1B9RA 1ZPSA 4N6EB 1M4VA 1L0XB 1OQRA 4RMAA 4MGYE 4HPLB 1TBEA 2XK5A 4GDLA 1AYFA 4MGKE 4WQOB 3BWUD 3CSTA 3DHGC 1AWDA 2GBKA 3ZO5B 4B95A 1SB3C 3APCA 1VR9A 4XYCA 5LXIB 2A5UA 2EMSA 4RM9A 4I6NB 1JCKB 2PTLA 1XLOA 4HXDA 1TTNA 2K6DB 3J9CA 2J0KA 1YJJA 3ZLZA 2DZIA 5J18A 3RULA 5D7GA 3W5VB 1CJEA 2G4SA 3H7PB 3ALBA 2AQ3B 2IBIB 4AQ7A 4LLGM 3ML8A 4ANWA 4LNKA 1CZPA 4IWOA 2LD9A 3W2DA 2EMTA 2RDGA 2B76B 3M62B 2Y5BB 1C9FA 4IM3A 1VRAB 2B3AA 2LXAA 3CIRB 3AI5A 2N7DA 1FIQA 3DBLI 2C5LC 3Q3NC 2QHOA 3V6CB 1YMHE 2KO3A 3W1SA 3R2TA 1T5XD 3T3OA 2W54A 3JVZX 4BOZB 1Q1OA 4NJ7A 1V81A 1XCQL 1L4DB 2WXHA 4IM0A 2D3CA 1WGKA 2BKRB 2BKFA 4IKGA 1SIFA 2LUEA 3CSFA 3NZ3A 1PFDA 1MJDA 2K25A 3NVYA 1OTRB 2L00B 3AE2B 1Z5SB 2D3AA 2MRPA 1T0RC 2V3NA 4BKTA 1DOIA 4ZRIA 1YQ3B 3IT6B 3KUDB 1SE3A 3OLMD 3P4QB 4W9EA 3BINA 3UF8A 3AEGB 1PGXA 3VR9B 2FNJB 3NS1A 1E7UA 1YX6B 1YIWA 2JXTA 2KMMA 4YWGG 5FR6A 4OZAA 4L2YA 4OZCA 3L08A 2TSSA 3MC9A 4AP4C 3ZXVA 3KH0A 4ICUA 2WU2B 4CO7A 4W9LA 3TSSA 4GMVA 1XEEA 4W9JA 1ZUD2 3P1MA 2DWQA 2K0PA 4URKA 4C7ZA 1L0VB 3IVFA 1P3QU 1WGGA 4HEA1 2JQRB 2RPVA 4DQOC 1JWAD 3R7RA 4MM3B 3VTVA 2BVCA 5DPWA 3CMMB 2CJOA 4WJOA 4XX5A 2CU1A 2MEKA 4IDIA 3TIXA 1RM6C 3AE6B 1MHHE 1BXTA 2V4LA 2KFJA 4WAFA 1OEYJ 4KZ0A 1SEBD 1J19A 1WSPA 3SFEB 1UGMA 2WWZA 4MJSB 1TYGB 2KC1A 2Z0DB 2CS4A 1L7YA 1MG8A 2K5PA 1IPGA 2KWVB 4XDDA 1WE6A 4NAWA 2AQ2B 2FIDA 1T6BX 2AYOB 4ASWC 1IYFA 2C9WB 3S2AA 1PDXA 4ARCA 2KLGA 4YXDB 5D3DA 3A1QB 3Q6BA 4GDKB 5LNK1 1IP9A 1V80A 3AEBB 3RNBC 1MHXA 1PGAA 3I63C 2RGFA 3Q3MC 3ONSA 1NYRA 4TV3A 1GUAB 1L5PA 3KYDD 1JWUD 5MPOA 1XLQA 4ZOHC 1WXVA 4MSMB 4NAMA 3JSVB 3UI3A 2JYEA 1TS3A 4W9IA 4BVUC 3DBRB 3WCQA 5AZFA 4X57B 3Q69A 4KGTA 3WIMA 3PZ8A 1UNSA 2DAJA 4EZKA 3SHQA 4A20A 2IGGA 5IAAC 1YD8U 1ZXHA 4B0MA 4ZYNA 1N61A 2QMTA 2QIEB 1FNUA 1J7AA 5DPSA 4NJCA 1ZE3D 4HROA 2ON8A 3MHZA 3U7ZA 2WHIA 1D3ZA 2KTRA 2MJDA 3AMZA 3GP7A 3OJ3A 1J0GA 2WDQB 3TEXA 4P1CC 1V6EA 2INPE 1ZOYB 4WJPA 1LXDA 3KUCB 2CHWA 2JWZA 3H9DA 5C2TB 1FXTB 1E9MA 1RYJA 1YN5A 1XF5L 4EUTA 3NOBA 3AEEB 3BVZA 4KIKB 2M56B 3ZNGC 2UWQA 5AZGA 4E74A 3BVMA 4R3DA 1LFDA 4DXFA 5IN7A 2QJLA 2UU7A 1B1ZA 1H4RA 2VZKD 3V62A 1L6VA 1ZDXA 1IGCA 3HUIA 2L0FA 4JPSA 2V3PA 1TIFA 3R7QA 1I42A 1SE2A 2LGXA 2ZPNA 4WH4A 3IXSA 3UQAA 3KQ4A 3DHIC 3C0RB 1JROA 4ANUA 3ZQ4A 3PRPB 3VQIA 4A55A 1YNTE 2KFKA 5EE9A 4YSXB 2BWES 4GN1A 4RM8A 2LVQA 2CU3A 4XE0A 2ZVOA 3DBRI 3Q8CA 2FCMA 3RPFC 2D2QA 2KDBA 2KAJA 2L8JA 1Y56A 2PW9A 1D5MC 4GIVA 4W9CA 2MX2A 4M00A 4A3PA 3Q3OC 2RDHA 3NS8A 5CHFA 4FHJA 1ESFA 2MCNB 1V1PA 1EWCA 4W9FA 2N9KA 4NPNA 1VD2A 3A4SC 1WGHA 2BYTA 4YT0B 4WWPA 4FHKA 2PJHA 3KLSX 2WNMA 4G3XB 3ZJVA 4MDKE 2N7JA 1E7VA 3P63A 5IKCM 3QJZA 3AE3B 2KC2A 1FNWA 3DVNV 2K8CA 2WXGA 1K51A 1DYQA 3SEBA 4YSYB 1OQQA 2N9LA 3L16A 1GB1A 2WXIA 3SDLC 2V9HA 1WGDA 2JUOA 2K8HA 2R61A 4GLSC 3UINB 1H8CA 1EF1A 3BVGA 1LGRA 3VTUA 5BMIA 3WAPA 2KLCA 3ZIMA 4HRSA 3R3MA 3PRMB 3RUIB 1I4GA 2AL6A 2L83A 1S1QB 3TBLD 3AE9B 3AU5A 2ACZB 5KHOA 3A9JA 3UIOB 2DZMA 2GMIC 2V4IB 1E8YA 3MC0B 1WX8A 2HTHA 3N30A 1XLNA 2BB5A 1JMLA 3MHSD 2DLBA 1WM2A 3VHTC 3RT3B 1YJ1A 2PMVA 3GE3C 1E5WA 1C77A 2INCC 4KX6B 4KV2A 1D6EC 3DQVA 5G5GA 3VXWA 4LDTD 4XWWA 3N1ZC 3NZSA 3WANA 1QF6A 4B6WA 1J8CA 3V61A 2BQQA 5L83A 3B0AA 4GXBA 1RRBA 4C4VB 3VTWA 1V5OA 3Q3FA 1KF6B 4AOFA 3ZTDA 2C7MB 1SJHD 2JT4B 3AE4B 3ZVVA 4LJOB 1HTOA 2M17A 3Q8EA 2OHFA 2AQ1B 3MFGA 4II2B 1TJEA 1V1OA 2ZCBA 3CF6E 1F0ZA 5T8IA 1WGRA 2K22A 1K8RB 1WRDB 5KHQA 4OZBA 3D32A 4RGOS 1TGZB 1MVKA 1KRHA 3PLUA 4DBGA 1GC6A 1WGYA 3X0WA 3AXCA 4RF1A 4ZYSA 2WYQA 1C4CA 2XEWA 2RD0A 2FIFA 4RGMA 2W55A 2QC8A 3JYUA 2IJ0A 1PGBA 3EGRA 2KMCA 5BYRA 3ABVB 1MG4A 2MA9B 4OHJA 3DWGC 3EUB2 2BT6A 2LHDA 3U8ZA 4RF0A 3UGBB 2PPHA 1XQQA 4PS3A 3NY5A 3RZWC 3KWVA 5IA7A 2QCZA 2Z59B 4B9KA 1YN4A 4C7YA 1SXTA 3ZRCA 1TKEA 4HCNB 3PHXB 3QQ8B 2JRIB 2NPTB 1GJZA 1WIAA 4ARIA 4EZLA 3W9CB 1ET6A 3T3NA 2NMQA 2NBUA 2KD0A 2I1KA 2QILA 4ZHOA 3FAHA 3L10B 1V2YA 1WM3A 2WDTB 2WQYB 3NJTA 2M1MA 1TKYA 3JW0X 2Y3AA 2KDFB 3L54A 4LTUA 3PTFC 1N5WA 3AE7B 1KLUD 1NI3A 3RZFA 3L13A 2FAZA 4ANXA 3Q8FA 1I4QA 3ZXRA 4CHKA 1WRIA 1WFYA 4MSQB 3Q2AC 1T0YA 4K81A 1VDVA 4JE3B 4JWUC 4JWSC 3ZNID 1JWSD 2W3RA 3MC8A 1FCLA 3RNAC 2RMMA 2KKCA 3AE8B 1KH0A 2IY0B 5IOIA 1HQRD 4IWPA 4HJKA 3ZNZB 4TQ1A 3APFA 2BBCA 5E6NA 1XD3B 2K8BA 3GZNB 3IBEA 1GB4A 3AEAB 3M3JA 3MJWA 4PYUA 2MW5A 2JZZA 1EU3A 1WX9A 3QAQA 4WWMA 5HI1A 2N1VA 1XLPA 2ZNVB 3RMKC 3TMPB 2KX3A 4WJQA 1Q5WB 1JWMD 2BTEA 2YLMA 4KSKC 2RR9A 1RFAA 3OG5A 3P4RB 3TEYA 2WS3B 4HDQA 1WMHA 3P42A 1WZ0A 1BT0A 2PLPA 1WJ6A 2O6VA 1GC7A 4AUQC 3A9KB 1TT5B 4BKGA 4YSZB 3KUZA 1VZ7A 5HG2A 5TR5A 1NI2A 1UD7A 3RYTA 4BZAA 5L95C 3A33B 3VRBB 1FPYA 4HLEA 2BF8B 1HE8A 2LUMA 4NJ6A 1C3TA 1KLGD 2MP2A 1SF0A 4GDLB 2XK5B 1FRDA 2ZEQA 2E3TA 2W9NA 3APDA 3HM3A 2WXOA 2LJ5A 2MBQA 2Z0EB 1AARA 2WXMA 1WZ3A 4W9HA 3TJPA 2JXXA 3B2FA 1UWXA 3GOEA 4M8MA 4DDGD 2WGSA 3PRZA 4WQMA 1P98A 4C80A 1PUTA 2ONQA 4K7SA 4GB9A 4LNNA 1JALA 2G9HD 4DK5A 3O65B 2GLSA 1F2RC 3ZJTA 1TS2A 2WDRB 3U52E 4N58A 4HCPB 3AM9A 2JSVX 2G4DB 2O6VD 3DOWA 1HZ6A 3OJ4B 3B08A 2WXQA 2OEDA 4FJZA 1T3QA 2CJNA 1P1AA 2X8XX 3BK2A 1NDDA 2KJ6A 1LO5D 4FADA 1I4HA 3I3TB 3MJ5A 1R4MB 3GB1A 1QOGA 3AN1A 1BMLC 5BO4B 4QAYA 2M4NA 1Y8RC 4XWTA 3BK1A 1YN3A 2LRWA 3DCGA 2ICIA 1OQYA 4FULA 2HD5B 4PYZA 3DBSA 3M63B 4AS1A 3T9LA 5CHVC 1LM8B 1WXQA 2VRRB 1V5TA 3LDZE 3NUHB 3OAWA 1EU4A 2IDYA 4KGSA 3L0WB 1I7HA 1N63A 3X23A 3EC8A 2W3SA 2YVCA 3HVDA 5FKAC 2LMCA 1KJTA 3UQBA 3ZGZA 4FN2A 4S0RA 3U4EG 4PS7A 2G45B 1C78A 3NRZA 1KOTA 3AECB 4KDIC 1NVID 2ZNVC 1BUIC 3EFCA 4EKUA 2PVOD 2BYVE 3B1LX 1WXSA 4UDUC 4DHJD 4KDLB 2YEPB 1WY8A 2MJ3A 3ML9A 3IHPC 4WAAA 3AV8A 2BPSA 3I57A 4FXCA 4MACA 5CX3A 2BS3B 2XN9C 3PREA 4BAXA 3PHWB 3BZDB 4OVUA 4M0WA 1XT9B 1FNVA 2ZJDA 4XDCA 3W1YA 1FCCC 3PO0A 2V3SA 3TL5A 3PSEB 2UYZB 3VR8B 1N5XA 1I4XA 1L0YB 3GS2A 1QILA 3NVVA 1KTKA 2AX5A 2KANA 1GAQB 1HEZE 4MT5A 1P9DU 2LRUA 1WYWB 1RFKA 2DYOA 2J42A 4FJYA 4RCOA 5AEKB 2PKOA 1V49A 2DNFA 3FILA 4HWIB 2LASA 3QWZB 2L76A 1QOAA 2LGIA 2D07B 2M0XA 1GPXA 2LVOA 1E90A 4NAWB 1E0ZA 1SE9A 2KACA 1D5XC 1WWTA 1UUPA 2WXNA 2WU5B 3VRAB 2NBVB 2ZCCA 2GBNA 2KN4A 4C00A 2NR2A 2JWUA 2D3BA 1TY0A 1E10A 3N1YC 3V60A 4MELA 4RNAA 2NVUI 2MQJA 3R66C 1VZ6A 2KVZA 3RCZA 1ZP0B 1WYGA 3SR6A 2VZKB 1FFUA 5JHAA 1IBXA 4BBNC 3EECA 3TEZA 5HKHA 1NBFC 4MGIE 4PS8A 3KW5B 3EFUA 3T8MA 3W1SC 3E56A 2K1FA 5EDSA 3ETRA 2EKIA 4FLHA 4C56C 3QX1A 4BKSA 4GSWA 3O13A 1NYQA 1YQBA 3IAM1 4JGHB 1N60A 4IG7B 2O2VA 1F9JA 4K1RB 2LI5A 3LXFA 1WI0A 2KTRB 4NQLB 1ZDVA 2JU6X 1CMXB 3VUWA 1HTQA 1TS4A 3U30A 1EWYC 2D3GA 2FCSA 4K7WA 4YTNB 4W9GA 2KDMA 2SAKA 3ZKJC 3HIZA 4TQ0A 1WF9A 3AU4A 1N62A 5E6PA 2X38A 2KT7A 2DAFA 3ZNHB 2LJIA 2BGFA 5C1ZA 2HJ1A 1MFWA 3V3XA 1EF5A 4MH0E 4IW0A 3AB5A 1TZOA 3U2SC 4KVGB 3AE5B 2MLBA 3BIID 4DHZB 4RGTA 1EO6A 2NTTA 4XZ4A 3WAOA 1K53A 3H7PA 1TS5A 3HM6X 2IZVB 5D94A 5JH5C 3AULA 2H88B 2DX5B 1FRRA 2M0AA 2L3ZA 1YJIA 4HKQA 3MTNB 1XXGA 2GOWA 3ZUNA 2KDIA 3H8HA 1XCTL 4ICVA 3B9JA 1CQVA 3H7SA 4JX1C 3PZDA 2PE9A 4AJYB 3VH3B 4B0EA 4BKSD 2KJHB 2KFKB 2JZ3B 1G6JA 3FKYA 4HPMB 2L05A 4H2AA 5LLIA 3DWMA 3ZYYX 1P7EA 3RNCC 2QDFA 4CQNA 4PK1A 3RN9C 1D4BA 4M8NA 3IAS1 4JIOU 1N6ZA 4WWNA 1DOXA 1VZ8A 1ACCA 1L4ZB 4IC7B 4D2KA 3NVZA 1FD6A 1VLBA 2FE8A 2L7RA 1V1PB 2AL3A 4O1NA 5TSSA 4CYEA 3OWEB 1V86A 2KQSA 3VUXA 2QSDA 4LDTB 3VDZA 1R4NB 2LHEA 1VCBA 4I6LB 1WX7A 4JL9A 5FK9C 1C1YB 4OVZA 2LZ6A 3R8BA 4GGQA 1QKZA 5CHWA 1E8ZA 3FC4A 1P0RA 1T0QC 3B2GA 2IO2B 4IUMB 2JY6A 4K3BA 3SFDB 3URYA 2GBJA 1EUVB 1FEHA 2KOXA 4J3OD 1WR6E 3ZDMC 4P16A 4GOCA 2VH2A 1R7SA 2BB6A 1A5RA 2OOBB 5DCNA 2ZZPB 4RFBA 1TY2A 2BS2B 1SJED 4WJNA 2WP9B 5D6JB 3AEFB 4AJWA 2GBMA 2SEBD 2MBBB 4ZRQA 1QLBB 3DPDA 3P4PB 1ZKHA 2MJEA 3AEDB 3KYCD 4MM3A 3N3KB 4F7ZA 1HZ5A 2Q5WD 1ZXIA 4OW0A 4OVVA 3R2IA 4XC2A 2MBHA 1UWMA 3A9JB 1E8WA 1ENFA 4NZLB 2M19A 1HXYD 1UGJA 2LVPA 2Y5CA 4W9DA 3GE8C 2OJWA 4HK2A 3PZ7A 2IYDB 2KZRA 2QEJC 4MJSA 2WX0A 2K39A 3ZJUA 1KFYB 2DHZA 3VUYA 2D10A 1GNUA 1UELA 5H92C 2KNBA 4REZA 1RWSA 3PT2B 2HTME 2WXRA 3A1QA 4I6PA 3AE1B 2JVCA 4PT5A 1NEKB 2DZKA 4GDKA 2G1EA 3N20C 1FMAD 1J7BA 1UF0A 2LWPA 1R4NI 1UZXB 1XO3A 2LGDA 2WXPA 2ZPYA 3HK0A 2I1JA 4P6VF 1J7CA 2PIAA 1VJKA 1QQRA 3JSVA 3MP9A 4BFRA 3DVGX 2K9XA 1L2NA 1ZGUB 3N1XC 4HVBA 2BW2A 2MHJA 2E6XA 1F2RI 3C8YA 2NBWB 1SBBB 5DPTA 1LQBA 4P1BC 4RH6A 3UIPB 2KTFA 1GOZA 2RDBC 4A8XC 4JQWC 1QOFA 4DXAB 1I4PA 3DBHB 1P7FA 2DENB 4YTMB 5JHBA 3DDCB 3Q8BA 2MH7A 4HDOA 4G11A 2KK8A 4K7UA 3PLVA 2LXCA 4IM2A 4NY0A 5AUKA 5J17A 4TKNA 3QK0A 2PEAA 2R2QA 2KDEB 2NCNA 1ET9A 3P2BA 2L32A 2AEHA 2IGDA 3ECIA 4LNOA 1FFVA 4K3CA 2RPQA 4KIKA 4ZRKA 4LNFA 3M95A 5GXGB 3IFWB 4FJVB 4ITKA 3L4PA 1WXAA 1M94A 3EA6A 2JYTA 4KKJA 1ZW7A 3Q14C 1TZ1A 5G5HA 2REXA 1JWBD 2INNE 2N9EB 4NQKE 3DVGY 4ZRPA 2CKHB 5E6OA 4KZCA 3GZNI 1TKGA 1WJ4A 3ZDTA 4LNIA 1SE4A 3BYTB 2KHWB 4DXGA 2N9PC 2BS4B 3VVWB 4IWQA 4ZDVA 3H1UA 3QARA 4BBNF 1RAXA 1F77A 2C7NB 1UH6A 1WXMA 5C3JB 2N4FA 2MBEA 2N0SB 4S17A 1FO4A 1SSNA 1V8CA 5DPRA 2Z8LA 3I5JC 2XBBC 4WURA 4F8CB 4Q2JA 4KGRA 3PS6A 1YX5B 1FXIA 1C4AA 2CR5A 1MI0A 4WIPA 1Q0WB 3QIJA 1Z2MA 3Q8AA 2C7HA 3ZRFA 5BMHA 3QC8B 2V1YA 3SU8X 5D3IB 2L1AA 1V9JA 4KSLC 2MBOA 2M8SA 1X1MA 4BOSC 4MGZE 3WAMA 2I38A 2WXLA 2INDC 2LGYA 1D5ZC 1SIJA 3H6NA 3DBHI 4LK0M 3ZW3A 4E71A 2K3UA 1WJUA 3QHTA 3EHVA 3TCAA 2JRHA
chains in the Genus database with same CATH topology
3AE2B 3EGRA 5BYRA 5HHDG 2V3NA 1ROEA 3ABVB 1DOIA 1YQ3B 2XNAC 3IT6B 1SE3A 3P4QB 3E56A 3AEGB 2YEPF 4OHJA 1PGXA 3VR9B 3RFZB 3DWGC 2Y5PA 3EUB2 2BT6A 3NS1A 3ETRA 2EKIA 4A6QA 2LHDA 3LB8C 4C56C 4RF0A 2EELA 3O13A 1FXAA 1NYQA 2JXTA 2KMMA 3HVZA 4YWGG 1STEA 3IAM1 1A70A 1N60A 2NTSA 3KWVA 2I2YA 2LEKA 4OZAA 3LXFA 4L2YA 1YN4A 4OZCA 4C7YA 2TSSA 1SXTA 2GI9A 5BMGA 2WU2B 1ZDVA 2JU6X 3TSSA 1XEEA 1TKEA 1ZUD2 1TS4A 3P1MA 2DWQA 1C76A 1EWYC 4YTNB 2K0PA 4C7ZA 1E7PB 1L0VB 2KDMA 2SAKA 4RGNA 4TQ0A 4ARIA 4HEA1 2JQRB 2RPVA 1N62A 1PYWD 1ET6A 1JWAD 3W9CB 4DQOC 3T3NA 2X38A 2NMQA 4MM3B 2QILA 2WDVB 4ZHOA 3FAHA 2CJOA 2LJIA 2WQYB 2KQ4X 3V3XA 1TKYA 2MEKA 3AB5A 4IDIA 1TZOA 3U2SC 3AE5B 3LYYA 1RM6C 3AE6B 1MHHE 3BIID 2Y3AA 1BXTA 4RGTA 4LTUA 2NTTA 4WAFA 3AH7A 1N5WA 3AE7B 1K53A 1KLUD 1NI3A 2DYMA 1TS5A 2IGHA 1SEBD 1WSPA 2H88B 3SFEB 1FRRA 3Q8FA 1I4QA 2M0AA 1DOYA 1TYGB 3E9SA 1YJIA 1WRIA 1JW9D 4HKQA 2K5PA 2GRIA 1XXGA 2LFIA 1Q10A 1VDVA 1XCTL 2JX5A 3H8HA 4XDDA 3B9JA 2AQ2B 1CQVA 4JE3B 4JX1C 1T6BX 4JWUC 4JWSC 1JRPA 1JWSD 2W3RA 4B0EA 4MH8A 5H8YE 1FCLA 2V0GA 1PDXA 2IPKD 2RMMA 3AE8B 4ARCA 4YXDB 1KH0A 4H2AA 4KKIA 5D3DA 1HQRD 3DWMA 3ZYYX 1P7EA 4GDKB 5LNK1 4TQ1A 4CQNA 2BBCA 1GB4A 3AEAB 3AEBB 1D4BA 1MHXA 1PGAA 2J53A 3IAS1 5HFYA 1EU3A 3HRDD 1V97A 3N9YC 4WWMA 5HI1A 1DOXA 3V05A 1VZ8A 1NYRA 1XLPA 1ACCA 5EE0A 1L4ZB 1L5PA 1JWUD 4D2KA 1IUEA 3NVZA 1JWMD 5MPOA 2BTEA 5E6JA 1FD6A 1XLQA 4ZOHC 1MPEA 1VLBA 2FE8A 1L6UA 4L1BA 4NAMA 3UI3A 2JYEA 1V1PB 1HA5A 1TS3A 4O1NA 5TSSA 1IGDA 3P4RB 1JQ4A 4A9AA 3TEYA 3OWEB 2WS3B 3WCQA 2QSDA 3P42A 3Q69A 4KGTA 3PZ8A 1UNSA 4TSSA 2DBYA 2LHEA 1OFFA 2IGGA 2ZW0A 2PLPA 1ZXHA 4IOIE 1DGJA 5FK9C 4B0MA 4OVZA 3R8BA 1N61A 2WXFA 2QMTA 1QKZA 4YSZB 2QIEB 1FNUA 1VZ7A 5HG2A 2JZPA 3FC4A 3TEWA 1J7AA 3B2GA 3SFDB 3URYA 1FEHA 4NJCA 1ZE3D 4J3OD 4HROA 3VRBB 3CWIA 2ON8A 4P16A 3MHZA 3U7ZA 2W82A 1R7SA 2BB6A 5FR3A 2MJDA 3AMZA 2LUMA 3GP7A 2PVGC 1KLGD 4RFBA 2WDQB 3TEXA 1SF0A 4GDLB 2INPE 1FRDA 1ZOYB 2E3TA 1TY2A 2BS2B 1SJED 2D5GA 2WP9B 5I4DA 3AEFB 4L23A 2WXOA 5C2TB 3I9V1 2J52A 1E9MA 1EM7A 2SEBD 1RYJA 1YN5A 1XF5L 3BYYB 1QLBB 4ZRQA 3P4PB 2WXMA 2MJEA 3AEDB 3B2FA 1UWXA 5BYSA 3AEEB 3BVZA 2M56B 1HZ5A 2L52A 2Q5WD 1ZXIA 4OW0A 4WQMA 3R2IA 5JXVA 4C80A 1PUTA 2ONQA 1UWMA 3BVMA 4R3DA 1FM0D 4DXFA 1ENFA 2QJLA 4NZLB 2M19A 1B1ZA 1HXYD 1UGJA 2VZKD 4HKZE 1JALA 1L6VA 1ZDXA 2G9HD 1IGCA 1AW7A 4N59A 3HUIA 1K52A 2Y5CA 1F2RC 2V3PA 3PZ7A 4JPSA 2WXJA 5EE1A 2QEJC 3ZJTA 1TS2A 4EE2A 2H89B 5AUIA 1I4RA 2WDRB 3FILB 3U52E 3ZJUA 1KFYB 2WXKA 4N58A 4ZHPA 1SE2A 3AM9A 2FUG1 3NVWA 3IXSA 4WH4A 3KQ4A 1AN8A 2JSVX 1HZ6A 1JROA 2WXQA 2OEDA 5H92C 1T3QA 1NENB 2CJNA 3ZQ4A 3VQIA 4A55A 3W5UB 1YNTE 3BK2A 4REZA 1E6EB 4YSXB 1LO5D 1RWSA 5EE9A 1I4HA 2ZW1A 1C4PA 3MJ5A 2HTME 2WXRA 3GB1A 3IT4B 3AE1B 1QOGA 3AN1A 4PT5A 1NEKB 1BMLC 2CU3A 4XE0A 2G1EA 2J4XA 3Q8CA 1FMAD 2FBWB 2WLBA 1J7BA 4HJGE 4US9A 3RPFC 2KAJA 1Y56A 2PW9A 4XWTA 3BK1A 1YN3A 1D5MC 1XO3A 1CK1A 4YTPB 2ICIA 2WXPA 3TUOA 4P6VF 4AS1A 1J7CA 2PIAA 2RDHA 1VJKA 1WXQA 1QQRA 5EE3A 1ESFA 3KWLA 3MP9A 1V1PA 1EWCA 3NUHB 1QOBA 1IBXB 1EU4A 2N9KA 2IDYA 4KGSA 4US8A 1I7HA 1N63A 2K9XA 2W3SA 2GB1A 2BYTA 3HVDA 2BW2A 5FKAC 4YT0B 2LMCA 2HDEA 4A90A 2E6XA 1F2RI 3C8YA 3ZGZA 1C79A 1SBBB 1QT9A 3U4EG 4USAA 3KLSX 2WNMA 1C78A 3NRZA 4RH6A 3ZJVA 3AECB 1NVID 4TMAB 1GOZA 2N7JA 1K50A 1BUIC 3P63A 4A8XC 1QOFA 2PVOD 3AE3B 2KWDA 1FNWA 1I4PA 1P7FA 5BYQA 4YTMB 3P4SB 4UDUC 2WXGA 1YQ4B 3Q8BA 2YEPB 1K51A 2MJ3A 1DYQA 1B9RA 1ZPSA 2MH7A 4N6EB 3SEBA 1M4VA 1L0XB 1OQRA 4YSYB 3AV8A 1OQQA 3I57A 4FXCA 2N9LA 4MACA 2BS3B 1GB1A 2WXIA 5AUKA 2XN9C 2R61A 1AYFA 3BWUD 4GLSC 1ET9A 3BVGA 2L32A 3BZDB 4M0WA 5BMIA 2IGDA 1AWDA 1FNVA 4HRSA 1FFVA 4XDCA 1FCCC 1SB3C 1VR9A 3PO0A 5GXGB 1I4GA 3VR8B 1N5XA 1JCKB 1I4XA 2L83A 1L0YB 3GS2A 1QILA 3AE9B 4ITKA 3L4PA 3NVVA 2ACZB 2PTLA 1KTKA 1XLOA 2JYTA 3EA6A 4KKJA 2V4IB 2AX5A 1GAQB 3MC0B 5G5HA 1HEZE 1XLNA 2BB5A 3J9CA 4MT5A 1JMLA 1JWBD 2INNE 1YJJA 4ZRPA 2DLBA 5D7GA 1RFKA 3W5VB 2DYOA 2J42A 1TKGA 4RCOA 2PMVA 1C77A 4KX6B 1SE4A 2PKOA 1CJEA 3BYTB 4DXGA 1D6EC 5G5GA 2BS4B 2AQ3B 3FILA 4XWWA 4AQ7A 1QF6A 4LLGM 1QOAA 2LGIA 1GPXA 1F77A 1CZPA 4NAWB 3W2DA 1E0ZA 1KF6B 2RDGA 5C3JB 1FO4A 2B76B 2N0SB 1SSNA 2KACA 1V8CA 2Z8LA 1SJHD 1C9FA 1D5XC 1WWTA 1UUPA 1VRAB 3AE4B 4WURA 4Q2JA 4KGRA 3Q8EA 2OHFA 2AQ1B 2WXNA 3MFGA 2WU5B 3CIRB 1FXIA 1C4AA 3VRAB 1FIQA 1TJEA 1MI0A 4WIPA 1V1OA 2KN4A 1YMHE 1F0ZA 3W1SA 3Q8AA 3R2TA 5T8IA 2JWUA 2K22A 5BMHA 1T5XD 4OZBA 2W54A 3T3OA 4RGOS 1TY0A 1E10A 5D3IB 2L1AA 1XCQL 1L4DB 2WXHA 1MVKA 1KRHA 4RNAA 1WGKA 1VZ6A 4RF1A 4ZYSA 2I38A 4IKGA 2WXLA 1ZP0B 1WYGA 3SR6A 2VZKB 1D5ZC 1C4CA 1FFUA 1IBXA 3NZ3A 1SIJA 1PFDA 4LK0M 4RGMA 3NVYA 2W55A 2K3UA 1PGBA 3TEZA 2IJ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BUI C;  1C77 A;  1SSN A;  2SAK A;  1C76 A;  1C78 A;  1C79 A; 
#chains in the Genus database with same CATH topology
 4A3O A;  1WMH B;  2GBR A;  5HHD G;  1ROE A;  4ZRJ A;  2PE6 B;  2XNA C;  2YEP F;  2O6V B;  2A4Z A;  2MSE D;  3RFZ B;  2Y5P A;  2IO1 B;  4A6Q A;  3LB8 C;  2EEL A;  1FXA A;  2JF5 A;  4W9K A;  3HVZ A;  1STE A;  1A70 A;  2NTS A;  4AWJ A;  2I2Y A;  2LEK A;  3K9O B;  1ISN A;  4LCD E;  2VH1 A;  2KVR A;  2GI9 A;  2AWT A;  5BMG A;  4FBJ B;  2MP2 B;  2HE7 A;  1C76 A;  2CHX A;  2KXJ A;  2J7Q B;  1E7P B;  1WJN A;  5J2R A;  4RGN A;  2EKE C;  1PYW D;  3QA8 A;  2WDV B;  1WH3 A;  2KQ4 X;  2IO0 B;  2IO3 B;  3LYY A;  1R4M I;  3C19 A;  4G50 A;  4DHZ E;  2G3Q B;  3L17 A;  5G2N A;  3AH7 A;  2J0M A;  4ANV A;  2RSU A;  1UBQ A;  2DYM A;  2IGH A;  2ZVN A;  4YL8 A;  2IY1 B;  1DOY A;  2L0T A;  3E9S A;  5IO9 A;  1JW9 D;  2GRI A;  4DHJ B;  2LFI A;  1Q10 A;  2JX5 A;  4C4V A;  3U7D A;  1F52 A;  1JRP A;  4MH8 A;  5H8Y E;  3N32 A;  3RI7 C;  2V0G A;  2IPK D;  2CHZ A;  4KKI A;  3DVN U;  4XGA B;  5D2M B;  1QZE A;  5G55 A;  2J53 A;  3IG3 A;  5HFY A;  3NZU A;  4EEW A;  3HRD D;  2KWU B;  1V97 A;  3N9Y C;  2BWF A;  3V05 A;  3Q3J A;  4EOY A;  2FCQ A;  1RLF A;  5EE0 A;  3PVL A;  3PPA A;  1IUE A;  4E3C A;  4DWF A;  5E6J A;  3RNG C;  2N9X A;  1MPE A;  1L6U A;  4L1B A;  1HA5 A;  1IGD A;  1JQ4 A;  5JZE B;  4A9A A;  2N1W A;  2KWC A;  2ASQ A;  4TSS A;  2DBY A;  2JPH A;  1OFF A;  4J6I A;  4M01 A;  1SGH A;  2ZW0 A;  3A4R A;  1I35 A;  4F1S A;  4IOI E;  1DGJ A;  3NG0 A;  2WXF A;  5IP4 D;  4LJP B;  4N9F 4;  2JZP A;  3TEW A;  2OJR A;  1UBI A;  5LXH A;  3CWI A;  1KM7 A;  2FUH B;  2W82 A;  1T0S C;  4II3 B;  5FR3 A;  3VFK A;  2PVG C;  3HHM A;  1JRU A;  4G0N B;  2C60 A;  2D5G A;  1OGW A;  1PQS A;  5I4D A;  1U4A A;  2NPT A;  4L23 A;  3RD2 A;  3I9V 1;  2J52 A;  4M0W B;  1EM7 A;  3BYY B;  3VAW A;  3V6E B;  4M02 A;  5BYS A;  5GMV A;  2L52 A;  3VH4 B;  1S3S G;  2LGS A;  2NS5 A;  4JLC A;  2BYE A;  5JXV A;  4GU2 A;  2DYB A;  1KLV A;  2D11 A;  2KX0 A;  1FM0 D;  4ACF A;  2BYF A;  4HKZ E;  1AW7 A;  4N59 A;  2FCN A;  2KN5 A;  1K52 A;  1E8X A;  2WXJ A;  5EE1 A;  4WWO A;  4EE2 A;  2H89 B;  5AUI A;  1I4R A;  3FIL B;  1WR1 A;  2WXK A;  4ZHP A;  3K9P B;  3NVW A;  2FUG 1;  4MEM A;  2J0J A;  3NHE B;  1WE7 A;  1AN8 A;  2R2O A;  4P7I A;  1YOV B;  1NEN B;  3WAL A;  5CTR C;  3W5U B;  3KVF B;  1E6E B;  1GG3 A;  5C23 A;  3ZTC A;  2ZW1 A;  1C4P A;  3IT4 B;  2DZJ A;  2N7E A;  3DHH C;  3SD5 A;  2J4X A;  2FBW B;  2KMA A;  2WLB A;  4HJG E;  4US9 A;  4TUU A;  2KYW A;  1CK1 A;  4YTP B;  4NNJ B;  3TUO A;  3BY4 B;  4EZJ A;  4HPP A;  4EFO A;  3ENE A;  2KJR A;  5EE3 A;  3PGE A;  3KWL A;  3PV1 A;  1QOB A;  1IBX B;  4DDI D;  2KQ7 A;  1OEY A;  3DBL B;  4US8 A;  2GB1 A;  4FA6 A;  2HJ8 A;  2MWS B;  2HDE A;  4A90 A;  5AZH A;  1C79 A;  3RNF C;  1QT9 A;  4USA A;  3A9K A;  3WA0 A;  4TMA B;  1K50 A;  1F1H A;  3QCA A;  2KWD A;  2K6Q A;  5BYQ A;  3P4S B;  1YQ4 B;  3RNE C;  3LJ3 A;  2WX1 A;  2O2V B;  1B9R A;  1ZPS A;  4N6E B;  1M4V A;  1L0X B;  1OQR A;  4RMA A;  4MGY E;  4HPL B;  1TBE A;  2XK5 A;  4GDL A;  1AYF A;  4MGK E;  4WQO B;  3BWU D;  3CST A;  3DHG C;  1AWD A;  2GBK A;  3ZO5 B;  4B95 A;  1SB3 C;  3APC A;  1VR9 A;  4XYC A;  5LXI B;  2A5U A;  2EMS A;  4RM9 A;  4I6N B;  1JCK B;  2PTL A;  1XLO A;  4HXD A;  1TTN A;  2K6D B;  3J9C A;  2J0K A;  1YJJ A;  3ZLZ A;  2DZI A;  5J18 A;  3RUL A;  5D7G A;  3W5V B;  1CJE A;  2G4S A;  3H7P B;  3ALB A;  2AQ3 B;  2IBI B;  4AQ7 A;  4LLG M;  3ML8 A;  4ANW A;  4LNK A;  1CZP A;  4IWO A;  2LD9 A;  3W2D A;  2EMT A;  2RDG A;  2B76 B;  3M62 B;  2Y5B B;  1C9F A;  4IM3 A;  1VRA B;  2B3A A;  2LXA A;  3CIR B;  3AI5 A;  2N7D A;  1FIQ A;  3DBL I;  2C5L C;  3Q3N C;  2QHO A;  3V6C B;  1YMH E;  2KO3 A;  3W1S A;  3R2T A;  1T5X D;  3T3O A;  2W54 A;  3JVZ X;  4BOZ B;  1Q1O A;  4NJ7 A;  1V81 A;  1XCQ L;  1L4D B;  2WXH A;  4IM0 A;  2D3C A;  1WGK A;  2BKR B;  2BKF A;  4IKG A;  1SIF A;  2LUE A;  3CSF A;  3NZ3 A;  1PFD A;  1MJD A;  2K25 A;  3NVY A;  1OTR B;  2L00 B;  3AE2 B;  1Z5S B;  2D3A A;  2MRP A;  1T0R C;  2V3N A;  4BKT A;  1DOI A;  4ZRI A;  1YQ3 B;  3IT6 B;  3KUD B;  1SE3 A;  3OLM D;  3P4Q B;  4W9E A;  3BIN A;  3UF8 A;  3AEG B;  1PGX A;  3VR9 B;  2FNJ B;  3NS1 A;  1E7U A;  1YX6 B;  1YIW A;  2JXT A;  2KMM A;  4YWG G;  5FR6 A;  4OZA A;  4L2Y A;  4OZC A;  3L08 A;  2TSS A;  3MC9 A;  4AP4 C;  3ZXV A;  3KH0 A;  4ICU A;  2WU2 B;  4CO7 A;  4W9L A;  3TSS A;  4GMV A;  1XEE A;  4W9J A;  1ZUD 2;  3P1M A;  2DWQ A;  2K0P A;  4URK A;  4C7Z A;  1L0V B;  3IVF A;  1P3Q U;  1WGG A;  4HEA 1;  2JQR B;  2RPV A;  4DQO C;  1JWA D;  3R7R A;  4MM3 B;  3VTV A;  2BVC A;  5DPW A;  3CMM B;  2CJO A;  4WJO A;  4XX5 A;  2CU1 A;  2MEK A;  4IDI A;  3TIX A;  1RM6 C;  3AE6 B;  1MHH E;  1BXT A;  2V4L A;  2KFJ A;  4WAF A;  1OEY J;  4KZ0 A;  1SEB D;  1J19 A;  1WSP A;  3SFE B;  1UGM A;  2WWZ A;  4MJS B;  1TYG B;  2KC1 A;  2Z0D B;  2CS4 A;  1L7Y A;  1MG8 A;  2K5P A;  1IPG A;  2KWV B;  4XDD A;  1WE6 A;  4NAW A;  2AQ2 B;  2FID A;  1T6B X;  2AYO B;  4ASW C;  1IYF A;  2C9W B;  3S2A A;  1PDX A;  4ARC A;  2KLG A;  4YXD B;  5D3D A;  3A1Q B;  3Q6B A;  4GDK B;  5LNK 1;  1IP9 A;  1V80 A;  3AEB B;  3RNB C;  1MHX A;  1PGA A;  3I63 C;  2RGF A;  3Q3M C;  3ONS A;  1NYR A;  4TV3 A;  1GUA B;  1L5P A;  3KYD D;  1JWU D;  5MPO A;  1XLQ A;  4ZOH C;  1WXV A;  4MSM B;  4NAM A;  3JSV B;  3UI3 A;  2JYE A;  1TS3 A;  4W9I A;  4BVU C;  3DBR B;  3WCQ A;  5AZF A;  4X57 B;  3Q69 A;  4KGT A;  3WIM A;  3PZ8 A;  1UNS A;  2DAJ A;  4EZK A;  3SHQ A;  4A20 A;  2IGG A;  5IAA C;  1YD8 U;  1ZXH A;  4B0M A;  4ZYN A;  1N61 A;  2QMT A;  2QIE B;  1FNU A;  1J7A A;  5DPS A;  4NJC A;  1ZE3 D;  4HRO A;  2ON8 A;  3MHZ A;  3U7Z A;  2WHI A;  1D3Z A;  2KTR A;  2MJD A;  3AMZ A;  3GP7 A;  3OJ3 A;  1J0G A;  2WDQ B;  3TEX A;  4P1C C;  1V6E A;  2INP E;  1ZOY B;  4WJP A;  1LXD A;  3KUC B;  2CHW A;  2JWZ A;  3H9D A;  5C2T B;  1FXT B;  1E9M A;  1RYJ A;  1YN5 A;  1XF5 L;  4EUT A;  3NOB A;  3AEE B;  3BVZ A;  4KIK B;  2M56 B;  3ZNG C;  2UWQ A;  5AZG A;  4E74 A;  3BVM A;  4R3D A;  1LFD A;  4DXF A;  5IN7 A;  2QJL A;  2UU7 A;  1B1Z A;  1H4R A;  2VZK D;  3V62 A;  1L6V A;  1ZDX A;  1IGC A;  3HUI A;  2L0F A;  4JPS A;  2V3P A;  1TIF A;  3R7Q A;  1I42 A;  1SE2 A;  2LGX A;  2ZPN A;  4WH4 A;  3IXS A;  3UQA A;  3KQ4 A;  3DHI C;  3C0R B;  1JRO A;  4ANU A;  3ZQ4 A;  3PRP B;  3VQI A;  4A55 A;  1YNT E;  2KFK A;  5EE9 A;  4YSX B;  2BWE S;  4GN1 A;  4RM8 A;  2LVQ A;  2CU3 A;  4XE0 A;  2ZVO A;  3DBR I;  3Q8C A;  2FCM A;  3RPF C;  2D2Q A;  2KDB A;  2KAJ A;  2L8J A;  1Y56 A;  2PW9 A;  1D5M C;  4GIV A;  4W9C A;  2MX2 A;  4M00 A;  4A3P A;  3Q3O C;  2RDH A;  3NS8 A;  5CHF A;  4FHJ A;  1ESF A;  2MCN B;  1V1P A;  1EWC A;  4W9F A;  2N9K A;  4NPN A;  1VD2 A;  3A4S C;  1WGH A;  2BYT A;  4YT0 B;  4WWP A;  4FHK A;  2PJH A;  3KLS X;  2WNM A;  4G3X B;  3ZJV A;  4MDK E;  2N7J A;  1E7V A;  3P63 A;  5IKC M;  3QJZ A;  3AE3 B;  2KC2 A;  1FNW A;  3DVN V;  2K8C A;  2WXG A;  1K51 A;  1DYQ A;  3SEB A;  4YSY B;  1OQQ A;  2N9L A;  3L16 A;  1GB1 A;  2WXI A;  3SDL C;  2V9H A;  1WGD A;  2JUO A;  2K8H A;  2R61 A;  4GLS C;  3UIN B;  1H8C A;  1EF1 A;  3BVG A;  1LGR A;  3VTU A;  5BMI A;  3WAP A;  2KLC A;  3ZIM A;  4HRS A;  3R3M A;  3PRM B;  3RUI B;  1I4G A;  2AL6 A;  2L83 A;  1S1Q B;  3TBL D;  3AE9 B;  3AU5 A;  2ACZ B;  5KHO A;  3A9J A;  3UIO B;  2DZM A;  2GMI C;  2V4I B;  1E8Y A;  3MC0 B;  1WX8 A;  2HTH A;  3N30 A;  1XLN A;  2BB5 A;  1JML A;  3MHS D;  2DLB A;  1WM2 A;  3VHT C;  3RT3 B;  1YJ1 A;  2PMV A;  3GE3 C;  1E5W A;  1C77 A;  2INC C;  4KX6 B;  4KV2 A;  1D6E C;  3DQV A;  5G5G A;  3VXW A;  4LDT D;  4XWW A;  3N1Z C;  3NZS A;  3WAN A;  1QF6 A;  4B6W A;  1J8C A;  3V61 A;  2BQQ A;  5L83 A;  3B0A A;  4GXB A;  1RRB A;  4C4V B;  3VTW A;  1V5O A;  3Q3F A;  1KF6 B;  4AOF A;  3ZTD A;  2C7M B;  1SJH D;  2JT4 B;  3AE4 B;  3ZVV A;  4LJO B;  1HTO A;  2M17 A;  3Q8E A;  2OHF A;  2AQ1 B;  3MFG A;  4II2 B;  1TJE A;  1V1O A;  2ZCB A;  3CF6 E;  1F0Z A;  5T8I A;  1WGR A;  2K22 A;  1K8R B;  1WRD B;  5KHQ A;  4OZB A;  3D32 A;  4RGO S;  1TGZ B;  1MVK A;  1KRH A;  3PLU A;  4DBG A;  1GC6 A;  1WGY A;  3X0W A;  3AXC A;  4RF1 A;  4ZYS A;  2WYQ A;  1C4C A;  2XEW A;  2RD0 A;  2FIF A;  4RGM A;  2W55 A;  2QC8 A;  3JYU A;  2IJ0 A;  1PGB A;  3EGR A;  2KMC A;  5BYR A;  3ABV B;  1MG4 A;  2MA9 B;  4OHJ A;  3DWG C;  3EUB 2;  2BT6 A;  2LHD A;  3U8Z A;  4RF0 A;  3UGB B;  2PPH A;  1XQQ A;  4PS3 A;  3NY5 A;  3RZW C;  3KWV A;  5IA7 A;  2QCZ A;  2Z59 B;  4B9K A;  1YN4 A;  4C7Y A;  1SXT A;  3ZRC A;  1TKE A;  4HCN B;  3PHX B;  3QQ8 B;  2JRI B;  2NPT B;  1GJZ A;  1WIA A;  4ARI A;  4EZL A;  3W9C B;  1ET6 A;  3T3N A;  2NMQ A;  2NBU A;  2KD0 A;  2I1K A;  2QIL A;  4ZHO A;  3FAH A;  3L10 B;  1V2Y A;  1WM3 A;  2WDT B;  2WQY B;  3NJT A;  2M1M A;  1TKY A;  3JW0 X;  2Y3A A;  2KDF B;  3L54 A;  4LTU A;  3PTF C;  1N5W A;  3AE7 B;  1KLU D;  1NI3 A;  3RZF A;  3L13 A;  2FAZ A;  4ANX A;  3Q8F A;  1I4Q A;  3ZXR A;  4CHK A;  1WRI A;  1WFY A;  4MSQ B;  3Q2A C;  1T0Y A;  4K81 A;  1VDV A;  4JE3 B;  4JWU C;  4JWS C;  3ZNI D;  1JWS D;  2W3R A;  3MC8 A;  1FCL A;  3RNA C;  2RMM A;  2KKC A;  3AE8 B;  1KH0 A;  2IY0 B;  5IOI A;  1HQR D;  4IWP A;  4HJK A;  3ZNZ B;  4TQ1 A;  3APF A;  2BBC A;  5E6N A;  1XD3 B;  2K8B A;  3GZN B;  3IBE A;  1GB4 A;  3AEA B;  3M3J A;  3MJW A;  4PYU A;  2MW5 A;  2JZZ A;  1EU3 A;  1WX9 A;  3QAQ A;  4WWM A;  5HI1 A;  2N1V A;  1XLP A;  2ZNV B;  3RMK C;  3TMP B;  2KX3 A;  4WJQ A;  1Q5W B;  1JWM D;  2BTE A;  2YLM A;  4KSK C;  2RR9 A;  1RFA A;  3OG5 A;  3P4R B;  3TEY A;  2WS3 B;  4HDQ A;  1WMH A;  3P42 A;  1WZ0 A;  1BT0 A;  2PLP A;  1WJ6 A;  2O6V A;  1GC7 A;  4AUQ C;  3A9K B;  1TT5 B;  4BKG A;  4YSZ B;  3KUZ A;  1VZ7 A;  5HG2 A;  5TR5 A;  1NI2 A;  1UD7 A;  3RYT A;  4BZA A;  5L95 C;  3A33 B;  3VRB B;  1FPY A;  4HLE A;  2BF8 B;  1HE8 A;  2LUM A;  4NJ6 A;  1C3T A;  1KLG D;  2MP2 A;  1SF0 A;  4GDL B;  2XK5 B;  1FRD A;  2ZEQ A;  2E3T A;  2W9N A;  3APD A;  3HM3 A;  2WXO A;  2LJ5 A;  2MBQ A;  2Z0E B;  1AAR A;  2WXM A;  1WZ3 A;  4W9H A;  3TJP A;  2JXX A;  3B2F A;  1UWX A;  3GOE A;  4M8M A;  4DDG D;  2WGS A;  3PRZ A;  4WQM A;  1P98 A;  4C80 A;  1PUT A;  2ONQ A;  4K7S A;  4GB9 A;  4LNN A;  1JAL A;  2G9H D;  4DK5 A;  3O65 B;  2GLS A;  1F2R C;  3ZJT A;  1TS2 A;  2WDR B;  3U52 E;  4N58 A;  4HCP B;  3AM9 A;  2JSV X;  2G4D B;  2O6V D;  3DOW A;  1HZ6 A;  3OJ4 B;  3B08 A;  2WXQ A;  2OED A;  4FJZ A;  1T3Q A;  2CJN A;  1P1A A;  2X8X X;  3BK2 A;  1NDD A;  2KJ6 A;  1LO5 D;  4FAD A;  1I4H A;  3I3T B;  3MJ5 A;  1R4M B;  3GB1 A;  1QOG A;  3AN1 A;  1BML C;  5BO4 B;  4QAY A;  2M4N A;  1Y8R C;  4XWT A;  3BK1 A;  1YN3 A;  2LRW A;  3DCG A;  2ICI A;  1OQY A;  4FUL A;  2HD5 B;  4PYZ A;  3DBS A;  3M63 B;  4AS1 A;  3T9L A;  5CHV C;  1LM8 B;  1WXQ A;  2VRR B;  1V5T A;  3LDZ E;  3NUH B;  3OAW A;  1EU4 A;  2IDY A;  4KGS A;  3L0W B;  1I7H A;  1N63 A;  3X23 A;  3EC8 A;  2W3S A;  2YVC A;  3HVD A;  5FKA C;  2LMC A;  1KJT A;  3UQB A;  3ZGZ A;  4FN2 A;  4S0R A;  3U4E G;  4PS7 A;  2G45 B;  1C78 A;  3NRZ A;  1KOT A;  3AEC B;  4KDI C;  1NVI D;  2ZNV C;  1BUI C;  3EFC A;  4EKU A;  2PVO D;  2BYV E;  3B1L X;  1WXS A;  4UDU C;  4DHJ D;  4KDL B;  2YEP B;  1WY8 A;  2MJ3 A;  3ML9 A;  3IHP C;  4WAA A;  3AV8 A;  2BPS A;  3I57 A;  4FXC A;  4MAC A;  5CX3 A;  2BS3 B;  2XN9 C;  3PRE A;  4BAX A;  3PHW B;  3BZD B;  4OVU A;  4M0W A;  1XT9 B;  1FNV A;  2ZJD A;  4XDC A;  3W1Y A;  1FCC C;  3PO0 A;  2V3S A;  3TL5 A;  3PSE B;  2UYZ B;  3VR8 B;  1N5X A;  1I4X A;  1L0Y B;  3GS2 A;  1QIL A;  3NVV A;  1KTK A;  2AX5 A;  2KAN A;  1GAQ B;  1HEZ E;  4MT5 A;  1P9D U;  2LRU A;  1WYW B;  1RFK A;  2DYO A;  2J42 A;  4FJY A;  4RCO A;  5AEK B;  2PKO A;  1V49 A;  2DNF A;  3FIL A;  4HWI B;  2LAS A;  3QWZ B;  2L76 A;  1QOA A;  2LGI A;  2D07 B;  2M0X A;  1GPX A;  2LVO A;  1E90 A;  4NAW B;  1E0Z A;  1SE9 A;  2KAC A;  1D5X C;  1WWT A;  1UUP A;  2WXN A;  2WU5 B;  3VRA B;  2NBV B;  2ZCC A;  2GBN A;  2KN4 A;  4C00 A;  2NR2 A;  2JWU A;  2D3B A;  1TY0 A;  1E10 A;  3N1Y C;  3V60 A;  4MEL A;  4RNA A;  2NVU I;  2MQJ A;  3R66 C;  1VZ6 A;  2KVZ A;  3RCZ A;  1ZP0 B;  1WYG A;  3SR6 A;  2VZK B;  1FFU A;  5JHA A;  1IBX A;  4BBN C;  3EEC A;  3TEZ A;  5HKH A;  1NBF C;  4MGI E;  4PS8 A;  3KW5 B;  3EFU A;  3T8M A;  3W1S C;  3E56 A;  2K1F A;  5EDS A;  3ETR A;  2EKI A;  4FLH A;  4C56 C;  3QX1 A;  4BKS A;  4GSW A;  3O13 A;  1NYQ A;  1YQB A;  3IAM 1;  4JGH B;  1N60 A;  4IG7 B;  2O2V A;  1F9J A;  4K1R B;  2LI5 A;  3LXF A;  1WI0 A;  2KTR B;  4NQL B;  1ZDV A;  2JU6 X;  1CMX B;  3VUW A;  1HTQ A;  1TS4 A;  3U30 A;  1EWY C;  2D3G A;  2FCS A;  4K7W A;  4YTN B;  4W9G A;  2KDM A;  2SAK A;  3ZKJ C;  3HIZ A;  4TQ0 A;  1WF9 A;  3AU4 A;  1N62 A;  5E6P A;  2X38 A;  2KT7 A;  2DAF A;  3ZNH B;  2LJI A;  2BGF A;  5C1Z A;  2HJ1 A;  1MFW A;  3V3X A;  1EF5 A;  4MH0 E;  4IW0 A;  3AB5 A;  1TZO A;  3U2S C;  4KVG B;  3AE5 B;  2MLB A;  3BII D;  4DHZ B;  4RGT A;  1EO6 A;  2NTT A;  4XZ4 A;  3WAO A;  1K53 A;  3H7P A;  1TS5 A;  3HM6 X;  2IZV B;  5D94 A;  5JH5 C;  3AUL A;  2H88 B;  2DX5 B;  1FRR A;  2M0A A;  2L3Z A;  1YJI A;  4HKQ A;  3MTN B;  1XXG A;  2GOW A;  3ZUN A;  2KDI A;  3H8H A;  1XCT L;  4ICV A;  3B9J A;  1CQV A;  3H7S A;  4JX1 C;  3PZD A;  2PE9 A;  4AJY B;  3VH3 B;  4B0E A;  4BKS D;  2KJH B;  2KFK B;  2JZ3 B;  1G6J A;  3FKY A;  4HPM B;  2L05 A;  4H2A A;  5LLI A;  3DWM A;  3ZYY X;  1P7E A;  3RNC C;  2QDF A;  4CQN A;  4PK1 A;  3RN9 C;  1D4B A;  4M8N A;  3IAS 1;  4JIO U;  1N6Z A;  4WWN A;  1DOX A;  1VZ8 A;  1ACC A;  1L4Z B;  4IC7 B;  4D2K A;  3NVZ A;  1FD6 A;  1VLB A;  2FE8 A;  2L7R A;  1V1P B;  2AL3 A;  4O1N A;  5TSS A;  4CYE A;  3OWE B;  1V86 A;  2KQS A;  3VUX A;  2QSD A;  4LDT B;  3VDZ A;  1R4N B;  2LHE A;  1VCB A;  4I6L B;  1WX7 A;  4JL9 A;  5FK9 C;  1C1Y B;  4OVZ A;  2LZ6 A;  3R8B A;  4GGQ A;  1QKZ A;  5CHW A;  1E8Z A;  3FC4 A;  1P0R A;  1T0Q C;  3B2G A;  2IO2 B;  4IUM B;  2JY6 A;  4K3B A;  3SFD B;  3URY A;  2GBJ A;  1EUV B;  1FEH A;  2KOX A;  4J3O D;  1WR6 E;  3ZDM C;  4P16 A;  4GOC A;  2VH2 A;  1R7S A;  2BB6 A;  1A5R A;  2OOB B;  5DCN A;  2ZZP B;  4RFB A;  1TY2 A;  2BS2 B;  1SJE D;  4WJN A;  2WP9 B;  5D6J B;  3AEF B;  4AJW A;  2GBM A;  2SEB D;  2MBB B;  4ZRQ A;  1QLB B;  3DPD A;  3P4P B;  1ZKH A;  2MJE A;  3AED B;  3KYC D;  4MM3 A;  3N3K B;  4F7Z A;  1HZ5 A;  2Q5W D;  1ZXI A;  4OW0 A;  4OVV A;  3R2I A;  4XC2 A;  2MBH A;  1UWM A;  3A9J B;  1E8W A;  1ENF A;  4NZL B;  2M19 A;  1HXY D;  1UGJ A;  2LVP A;  2Y5C A;  4W9D A;  3GE8 C;  2OJW A;  4HK2 A;  3PZ7 A;  2IYD B;  2KZR A;  2QEJ C;  4MJS A;  2WX0 A;  2K39 A;  3ZJU A;  1KFY B;  2DHZ A;  3VUY A;  2D10 A;  1GNU A;  1UEL A;  5H92 C;  2KNB A;  4REZ A;  1RWS A;  3PT2 B;  2HTM E;  2WXR A;  3A1Q A;  4I6P A;  3AE1 B;  2JVC A;  4PT5 A;  1NEK B;  2DZK A;  4GDK A;  2G1E A;  3N20 C;  1FMA D;  1J7B A;  1UF0 A;  2LWP A;  1R4N I;  1UZX B;  1XO3 A;  2LGD A;  2WXP A;  2ZPY A;  3HK0 A;  2I1J A;  4P6V F;  1J7C A;  2PIA A;  1VJK A;  1QQR A;  3JSV A;  3MP9 A;  4BFR A;  3DVG X;  2K9X A;  1L2N A;  1ZGU B;  3N1X C;  4HVB A;  2BW2 A;  2MHJ A;  2E6X A;  1F2R I;  3C8Y A;  2NBW B;  1SBB B;  5DPT A;  1LQB A;  4P1B C;  4RH6 A;  3UIP B;  2KTF A;  1GOZ A;  2RDB C;  4A8X C;  4JQW C;  1QOF A;  4DXA B;  1I4P A;  3DBH B;  1P7F A;  2DEN B;  4YTM B;  5JHB A;  3DDC B;  3Q8B A;  2MH7 A;  4HDO A;  4G11 A;  2KK8 A;  4K7U A;  3PLV A;  2LXC A;  4IM2 A;  4NY0 A;  5AUK A;  5J17 A;  4TKN A;  3QK0 A;  2PEA A;  2R2Q A;  2KDE B;  2NCN A;  1ET9 A;  3P2B A;  2L32 A;  2AEH A;  2IGD A;  3ECI A;  4LNO A;  1FFV A;  4K3C A;  2RPQ A;  4KIK A;  4ZRK A;  4LNF A;  3M95 A;  5GXG B;  3IFW B;  4FJV B;  4ITK A;  3L4P A;  1WXA A;  1M94 A;  3EA6 A;  2JYT A;  4KKJ A;  1ZW7 A;  3Q14 C;  1TZ1 A;  5G5H A;  2REX A;  1JWB D;  2INN E;  2N9E B;  4NQK E;  3DVG Y;  4ZRP A;  2CKH B;  5E6O A;  4KZC A;  3GZN I;  1TKG A;  1WJ4 A;  3ZDT A;  4LNI A;  1SE4 A;  3BYT B;  2KHW B;  4DXG A;  2N9P C;  2BS4 B;  3VVW B;  4IWQ A;  4ZDV A;  3H1U A;  3QAR A;  4BBN F;  1RAX A;  1F77 A;  2C7N B;  1UH6 A;  1WXM A;  5C3J B;  2N4F A;  2MBE A;  2N0S B;  4S17 A;  1FO4 A;  1SSN A;  1V8C A;  5DPR A;  2Z8L A;  3I5J C;  2XBB C;  4WUR A;  4F8C B;  4Q2J A;  4KGR A;  3PS6 A;  1YX5 B;  1FXI A;  1C4A A;  2CR5 A;  1MI0 A;  4WIP A;  1Q0W B;  3QIJ A;  1Z2M A;  3Q8A A;  2C7H A;  3ZRF A;  5BMH A;  3QC8 B;  2V1Y A;  3SU8 X;  5D3I B;  2L1A A;  1V9J A;  4KSL C;  2MBO A;  2M8S A;  1X1M A;  4BOS C;  4MGZ E;  3WAM A;  2I38 A;  2WXL A;  2IND C;  2LGY A;  1D5Z C;  1SIJ A;  3H6N A;  3DBH I;  4LK0 M;  3ZW3 A;  4E71 A;  2K3U A;  1WJU A;  3QHT A;  3EHV A;  3TCA A;  2JRH A; 
#chains in the Genus database with same CATH homology
 3AE2 B;  3EGR A;  5BYR A;  5HHD G;  2V3N A;  1ROE A;  3ABV B;  1DOI A;  1YQ3 B;  2XNA C;  3IT6 B;  1SE3 A;  3P4Q B;  3E56 A;  3AEG B;  2YEP F;  4OHJ A;  1PGX A;  3VR9 B;  3RFZ B;  3DWG C;  2Y5P A;  3EUB 2;  2BT6 A;  3NS1 A;  3ETR A;  2EKI A;  4A6Q A;  2LHD A;  3LB8 C;  4C56 C;  4RF0 A;  2EEL A;  3O13 A;  1FXA A;  1NYQ A;  2JXT A;  2KMM A;  3HVZ A;  4YWG G;  1STE A;  3IAM 1;  1A70 A;  1N60 A;  2NTS A;  3KWV A;  2I2Y A;  2LEK A;  4OZA A;  3LXF A;  4L2Y A;  1YN4 A;  4OZC A;  4C7Y A;  2TSS A;  1SXT A;  2GI9 A;  5BMG A;  2WU2 B;  1ZDV A;  2JU6 X;  3TSS A;  1XEE A;  1TKE A;  1ZUD 2;  1TS4 A;  3P1M A;  2DWQ A;  1C76 A;  1EWY C;  4YTN B;  2K0P A;  4C7Z A;  1E7P B;  1L0V B;  2KDM A;  2SAK A;  4RGN A;  4TQ0 A;  4ARI A;  4HEA 1;  2JQR B;  2RPV A;  1N62 A;  1PYW D;  1ET6 A;  1JWA D;  3W9C B;  4DQO C;  3T3N A;  2X38 A;  2NMQ A;  4MM3 B;  2QIL A;  2WDV B;  4ZHO A;  3FAH A;  2CJO A;  2LJI A;  2WQY B;  2KQ4 X;  3V3X A;  1TKY A;  2MEK A;  3AB5 A;  4IDI A;  1TZO A;  3U2S C;  3AE5 B;  3LYY A;  1RM6 C;  3AE6 B;  1MHH E;  3BII D;  2Y3A A;  1BXT A;  4RGT A;  4LTU A;  2NTT A;  4WAF A;  3AH7 A;  1N5W A;  3AE7 B;  1K53 A;  1KLU D;  1NI3 A;  2DYM A;  1TS5 A;  2IGH A;  1SEB D;  1WSP A;  2H88 B;  3SFE B;  1FRR A;  3Q8F A;  1I4Q A;  2M0A A;  1DOY A;  1TYG B;  3E9S A;  1YJI A;  1WRI A;  1JW9 D;  4HKQ A;  2K5P A;  2GRI A;  1XXG A;  2LFI A;  1Q10 A;  1VDV A;  1XCT L;  2JX5 A;  3H8H A;  4XDD A;  3B9J A;  2AQ2 B;  1CQV A;  4JE3 B;  4JX1 C;  1T6B X;  4JWU C;  4JWS C;  1JRP A;  1JWS D;  2W3R A;  4B0E A;  4MH8 A;  5H8Y E;  1FCL A;  2V0G A;  1PDX A;  2IPK D;  2RMM A;  3AE8 B;  4ARC A;  4YXD B;  1KH0 A;  4H2A A;  4KKI A;  5D3D A;  1HQR D;  3DWM A;  3ZYY X;  1P7E A;  4GDK B;  5LNK 1;  4TQ1 A;  4CQN A;  2BBC A;  1GB4 A;  3AEA B;  3AEB B;  1D4B A;  1MHX A;  1PGA A;  2J53 A;  3IAS 1;  5HFY A;  1EU3 A;  3HRD D;  1V97 A;  3N9Y C;  4WWM A;  5HI1 A;  1DOX A;  3V05 A;  1VZ8 A;  1NYR A;  1XLP A;  1ACC A;  5EE0 A;  1L4Z B;  1L5P A;  1JWU D;  4D2K A;  1IUE A;  3NVZ A;  1JWM D;  5MPO A;  2BTE A;  5E6J A;  1FD6 A;  1XLQ A;  4ZOH C;  1MPE A;  1VLB A;  2FE8 A;  1L6U A;  4L1B A;  4NAM A;  3UI3 A;  2JYE A;  1V1P B;  1HA5 A;  1TS3 A;  4O1N A;  5TSS A;  1IGD A;  3P4R B;  1JQ4 A;  4A9A A;  3TEY A;  3OWE B;  2WS3 B;  3WCQ A;  2QSD A;  3P42 A;  3Q69 A;  4KGT A;  3PZ8 A;  1UNS A;  4TSS A;  2DBY A;  2LHE A;  1OFF A;  2IGG A;  2ZW0 A;  2PLP A;  1ZXH A;  4IOI E;  1DGJ A;  5FK9 C;  4B0M A;  4OVZ A;  3R8B A;  1N61 A;  2WXF A;  2QMT A;  1QKZ A;  4YSZ B;  2QIE B;  1FNU A;  1VZ7 A;  5HG2 A;  2JZP A;  3FC4 A;  3TEW A;  1J7A A;  3B2G A;  3SFD B;  3URY A;  1FEH A;  4NJC A;  1ZE3 D;  4J3O D;  4HRO A;  3VRB B;  3CWI A;  2ON8 A;  4P16 A;  3MHZ A;  3U7Z A;  2W82 A;  1R7S A;  2BB6 A;  5FR3 A;  2MJD A;  3AMZ A;  2LUM A;  3GP7 A;  2PVG C;  1KLG D;  4RFB A;  2WDQ B;  3TEX A;  1SF0 A;  4GDL B;  2INP E;  1FRD A;  1ZOY B;  2E3T A;  1TY2 A;  2BS2 B;  1SJE D;  2D5G A;  2WP9 B;  5I4D A;  3AEF B;  4L23 A;  2WXO A;  5C2T B;  3I9V 1;  2J52 A;  1E9M A;  1EM7 A;  2SEB D;  1RYJ A;  1YN5 A;  1XF5 L;  3BYY B;  1QLB B;  4ZRQ A;  3P4P B;  2WXM A;  2MJE A;  3AED B;  3B2F A;  1UWX A;  5BYS A;  3AEE B;  3BVZ A;  2M56 B;  1HZ5 A;  2L52 A;  2Q5W D;  1ZXI A;  4OW0 A;  4WQM A;  3R2I A;  5JXV A;  4C80 A;  1PUT A;  2ONQ A;  1UWM A;  3BVM A;  4R3D A;  1FM0 D;  4DXF A;  1ENF A;  2QJL A;  4NZL B;  2M19 A;  1B1Z A;  1HXY D;  1UGJ A;  2VZK D;  4HKZ E;  1JAL A;  1L6V A;  1ZDX A;  2G9H D;  1IGC A;  1AW7 A;  4N59 A;  3HUI A;  1K52 A;  2Y5C A;  1F2R C;  2V3P A;  3PZ7 A;  4JPS A;  2WXJ A;  5EE1 A;  2QEJ C;  3ZJT A;  1TS2 A;  4EE2 A;  2H89 B;  5AUI A;  1I4R A;  2WDR B;  3FIL B;  3U52 E;  3ZJU A;  1KFY B;  2WXK A;  4N58 A;  4ZHP A;  1SE2 A;  3AM9 A;  2FUG 1;  3NVW A;  3IXS A;  4WH4 A;  3KQ4 A;  1AN8 A;  2JSV X;  1HZ6 A;  1JRO A;  2WXQ A;  2OED A;  5H92 C;  1T3Q A;  1NEN B;  2CJN A;  3ZQ4 A;  3VQI A;  4A55 A;  3W5U B;  1YNT E;  3BK2 A;  4REZ A;  1E6E B;  4YSX B;  1LO5 D;  1RWS A;  5EE9 A;  1I4H A;  2ZW1 A;  1C4P A;  3MJ5 A;  2HTM E;  2WXR A;  3GB1 A;  3IT4 B;  3AE1 B;  1QOG A;  3AN1 A;  4PT5 A;  1NEK B;  1BML C;  2CU3 A;  4XE0 A;  2G1E A;  2J4X A;  3Q8C A;  1FMA D;  2FBW B;  2WLB A;  1J7B A;  4HJG E;  4US9 A;  3RPF C;  2KAJ A;  1Y56 A;  2PW9 A;  4XWT A;  3BK1 A;  1YN3 A;  1D5M C;  1XO3 A;  1CK1 A;  4YTP B;  2ICI A;  2WXP A;  3TUO A;  4P6V F;  4AS1 A;  1J7C A;  2PIA A;  2RDH A;  1VJK A;  1WXQ A;  1QQR A;  5EE3 A;  1ESF A;  3KWL A;  3MP9 A;  1V1P A;  1EWC A;  3NUH B;  1QOB A;  1IBX B;  1EU4 A;  2N9K A;  2IDY A;  4KGS A;  4US8 A;  1I7H A;  1N63 A;  2K9X A;  2W3S A;  2GB1 A;  2BYT A;  3HVD A;  2BW2 A;  5FKA C;  4YT0 B;  2LMC A;  2HDE A;  4A90 A;  2E6X A;  1F2R I;  3C8Y A;  3ZGZ A;  1C79 A;  1SBB B;  1QT9 A;  3U4E G;  4USA A;  3KLS X;  2WNM A;  1C78 A;  3NRZ A;  4RH6 A;  3ZJV A;  3AEC B;  1NVI D;  4TMA B;  1GOZ A;  2N7J A;  1K50 A;  1BUI C;  3P63 A;  4A8X C;  1QOF A;  2PVO D;  3AE3 B;  2KWD A;  1FNW A;  1I4P A;  1P7F A;  5BYQ A;  4YTM B;  3P4S B;  4UDU C;  2WXG A;  1YQ4 B;  3Q8B A;  2YEP B;  1K51 A;  2MJ3 A;  1DYQ A;  1B9R A;  1ZPS A;  2MH7 A;  4N6E B;  3SEB A;  1M4V A;  1L0X B;  1OQR A;  4YSY B;  3AV8 A;  1OQQ A;  3I57 A;  4FXC A;  2N9L A;  4MAC A;  2BS3 B;  1GB1 A;  2WXI A;  5AUK A;  2XN9 C;  2R61 A;  1AYF A;  3BWU D;  4GLS C;  1ET9 A;  3BVG A;  2L32 A;  3BZD B;  4M0W A;  5BMI A;  2IGD A;  1AWD A;  1FNV A;  4HRS A;  1FFV A;  4XDC A;  1FCC C;  1SB3 C;  1VR9 A;  3PO0 A;  5GXG B;  1I4G A;  3VR8 B;  1N5X A;  1JCK B;  1I4X A;  2L83 A;  1L0Y B;  3GS2 A;  1QIL A;  3AE9 B;  4ITK A;  3L4P A;  3NVV A;  2ACZ B;  2PTL A;  1KTK A;  1XLO A;  2JYT A;  3EA6 A;  4KKJ A;  2V4I B;  2AX5 A;  1GAQ B;  3MC0 B;  5G5H A;  1HEZ E;  1XLN A;  2BB5 A;  3J9C A;  4MT5 A;  1JML A;  1JWB D;  2INN E;  1YJJ A;  4ZRP A;  2DLB A;  5D7G A;  1RFK A;  3W5V B;  2DYO A;  2J42 A;  1TKG A;  4RCO A;  2PMV A;  1C77 A;  4KX6 B;  1SE4 A;  2PKO A;  1CJE A;  3BYT B;  4DXG A;  1D6E C;  5G5G A;  2BS4 B;  2AQ3 B;  3FIL A;  4XWW A;  4AQ7 A;  1QF6 A;  4LLG M;  1QOA A;  2LGI A;  1GPX A;  1F77 A;  1CZP A;  4NAW B;  3W2D A;  1E0Z A;  1KF6 B;  2RDG A;  5C3J B;  1FO4 A;  2B76 B;  2N0S B;  1SSN A;  2KAC A;  1V8C A;  2Z8L A;  1SJH D;  1C9F A;  1D5X C;  1WWT A;  1UUP A;  1VRA B;  3AE4 B;  4WUR A;  4Q2J A;  4KGR A;  3Q8E A;  2OHF A;  2AQ1 B;  2WXN A;  3MFG A;  2WU5 B;  3CIR B;  1FXI A;  1C4A A;  3VRA B;  1FIQ A;  1TJE A;  1MI0 A;  4WIP A;  1V1O A;  2KN4 A;  1YMH E;  1F0Z A;  3W1S A;  3Q8A A;  3R2T A;  5T8I A;  2JWU A;  2K22 A;  5BMH A;  1T5X D;  4OZB A;  2W54 A;  3T3O A;  4RGO S;  1TY0 A;  1E10 A;  5D3I B;  2L1A A;  1XCQ L;  1L4D B;  2WXH A;  1MVK A;  1KRH A;  4RNA A;  1WGK A;  1VZ6 A;  4RF1 A;  4ZYS A;  2I38 A;  4IKG A;  2WXL A;  1ZP0 B;  1WYG A;  3SR6 A;  2VZK B;  1D5Z C;  1C4C A;  1FFU A;  1IBX A;  3NZ3 A;  1SIJ A;  1PFD A;  4LK0 M;  4RGM A;  3NVY A;  2W55 A;  2K3U A;  1PGB A;  3TEZ A;  2IJ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...