1C79A

Staphylokinase (sak) dimer
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
130
structure length
130
Chain Sequence
b'GKYKKGDDASYFEPTGPYLMVNVTGVDGKGNELLSPHYVEFPIKPGTTLTKEKIEYYVEWALDATAYKEFRVVELDPSAKIEVTYYDKNKKKEETKSFPITEKGFVVPDLSEHIKNPGFNLITKVVIEKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STAPHYLOKINASE
molecule tags Hydrolase
source organism Staphylococcus aureus
publication title Crystal structure of a staphylokinase: variant a model for reduced antigenicity.
pubmed doi rcsb
total genus 22
structure length 130
sequence length 130
chains with identical sequence B
ec nomenclature ec 3.4.24.29: Aureolysin.
pdb deposition date 2000-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02821 Staphylokinase Staphylokinase/Streptokinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.130 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1c79A00
1C78A 1BUIC 1C77A 2SAKA 1C79A 1C76A 1SSNA
chains in the Genus database with same CATH superfamily
1XLNA 2ICIA 3QWZB 2PE9A 3KYCD 1C1YB 3PVLA 3HIZA 1XQQA 1LM8B 1V86A 2G4SA 3U52E 2WHIA 2WNMA 2HDEA 4NAMA 3APCA 4WAFA 2DYOA 1ZP0B 5BMGA 3BYYB 3PRZA 1XCTL 1HQRD 1I4GA 4DBGA 3GE3C 2MBQA 4J6IA 3L10B 4ZRKA 3RNCC 4C7ZA 2D3AA 3OAWA 1ZDXA 1WRDB 5KHOA 2W3SA 1ZUD2 3WANA 3N1YC 1YJIA 2PLPA 1MJDA 1BT0A 4JGHB 2JVCA 1T0QC 3AM9A 1GC7A 2D5GA 3U8ZA 1V1OA 2KWVB 4MJSA 2WXFA 4M0WB 3NJTA 3UQAA 4MJSB 2EKIA 5JHAA 4IDIA 1F0ZA 4ITKA 3K9PB 2Z0EB 4R3DA 2FIDA 2RPQA 1IPGA 2MJDA 2BS4B 3CIRB 1WGGA 4C00A 4A3PA 2A5UA 2MBBB 4WWOA 2LVQA 3EGRA 3GB1A 2WXKA 4IM3A 4NJ6A 4EEWA 3KW5B 4EFOA 2ON8A 2KFKA 1F2RC 5TSSA 3VR8B 1UNSA 2NTTA 3RN9C 2CJNA 4BOZB 4OZCA 3JSVB 2KX0A 3BK1A 3H6NA 4KGRA 3QQ8B 4AUQC 1QT9A 2YEPB 3LJ3A 3MC9A 2KMMA 5G5GA 2J0KA 3ZLZA 4CO7A 1FO4A 1I42A 5IO9A 4HVBA 4GIVA 2CS4A 2N7DA 4PT5A 5DCNA 2B3AA 2X38A 3I63C 5AUIA 2WXOA 1XXGA 3RFZB 2BYVE 2KHWB 4DK5A 3P4RB 1PUTA 4WURA 2R2QA 1WE7A 1N62A 1E7VA 1JROA 2NCNA 5D3DA 1L2NA 2ZW1A 3QIJA 3IXSA 4KIKB 3PS6A 3N9YC 4USAA 3PRMB 4MH8A 4KIKA 3NZSA 2N7EA 2XN9C 1VR9A 2BF8B 3UIOB 1ZXIA 2G1EA 2WXMA 5BMIA 1XLQA 4DHJB 4MGZE 3NRZA 4LK0M 1WJUA 1L6VA 4F8CB 4GOCA 4A55A 2QEJC 4W9DA 2KN4A 1WX9A 2XBBC 3UGBB 2MSED 4QAYA 5FR3A 2KFJA 2L83A 3VTUA 1HE8A 1HZ6A 2W82A 3L0WB 1TTNA 1IYFA 1SE2A 3KUZA 3ECIA 3MJWA 2LGDA 3QAQA 4RH6A 4DXAB 3PHWB 1OQRA 3CSFA 1YJ1A 2I1JA 1GB4A 1F77A 1BXTA 3AMZA 3PLUA 3RI7C 2N4FA 3NS1A 2W55A 1CMXB 3T3OA 1TBEA 2DZMA 2WU2B 3M62B 5LXHA 3A4RA 1AWDA 1XCQL 5D3IB 2DZKA 1QOAA 2WXLA 3DCGA 1XEEA 2J53A 3UINB 1M4VA 2DLBA 2DYBA 1T3QA 1UUPA 2ZVOA 4KVGB 2O6VD 4WWPA 2JRIB 1E7PB 4HCNB 3BVMA 1E90A 4OW0A 3DQVA 1K53A 2ZPNA 4CQNA 1YN5A 2D07B 2LRUA 4JWUC 1P9DU 4YT0B 1OGWA 1L7YA 2D3BA 1VRAB 3Q3NC 1GJZA 1I4PA 1JRUA 4K7WA 3RYTA 1VZ8A 3EUB2 2SAKA 3NG0A 4ARIA 4HCPB 3Q3OC 2KMCA 1NENB 3RNFC 5EE1A 2BB6A 2ZVNA 2IO1B 3VHTC 1E0ZA 4W9FA 1HTQA 2RDGA 1ENFA 4ZRQA 2KMAA 4GN1A 3ZDTA 1QOGA 1YD8U 3V6EB 1Y56A 1EU3A 3NY5A 1YX6B 4KZCA 1STEA 1E5WA 5LLIA 5DPRA 4KKJA 1BMLC 5AZGA 2E3TA 2TSSA 2WYQA 3PTFC 4AS1A 3A9KA 4OZBA 1NBFC 1F1HA 3GZNI 3M95A 1ROEA 3H8HA 4M8MA 4DHZE 1WM3A 2BB5A 2BS2B 1GC6A 1XLPA 2KT7A 2NMQA 2K9XA 2KAJA 2BW2A 3L4PA 1RRBA 2AYOB 1YQ4B 2KWDA 4DDID 3Q69A 4JWSC 3KUCB 2D3CA 2RD0A 1UBIA 3MTNB 2OEDA 2V3PA 4NQLB 1VCBA 1VLBA 3WA0A 4W9JA 5CHVC 2LGXA 2Y5PA 3AE5B 2OOBB 2D3GA 1WF9A 2JPHA 3RMKC 4I6LB 1VD2A 1ISNA 2M0XA 2MA9B 4ZRPA 2IY1B 1B1ZA 3X23A 3NZ3A 3BK2A 1XLOA 2CU3A 1D5MC 1XD3B 2PEAA 3TL5A 4EZLA 3A1QA 3L08A 4S0RA 3L13A 4KGTA 3GZNB 2INDC 4ZDVA 5E6JA 3ZW3A 1IUEA 3QJZA 4EKUA 3ZRCA 1JWSD 3UQBA 3MP9A 1SIJA 2BQQA 5IN7A 3WIMA 1P98A 3FAHA 1CK1A 4MEMA 1V1PA 4P6VF 4XZ4A 2N0SB 3KLSX 3HVZA 1RFKA 3U4EG 2WX1A 2KDEB 2WXGA 2LXAA 3Q8AA 5HKHA 1WMHA 3H7PA 4MGIE 1WJ4A 2V3NA 2ZEQA 3ML9A 1SIFA 1V9JA 1C4AA 4YTMB 4LNOA 1L4ZB 2CHZA 2MP2A 4F1SA 1SGHA 4WWNA 2ZZPB 2QIEB 2M4NA 1QOFA 3PZ8A 1MI0A 5IAAC 5CTRC 1WGHA 1CQVA 2J4XA 1V2YA 4L2YA 2BT6A 1WZ0A 2KZRA 2Z0DB 2UYZB 4KSKC 4ANXA 3IAS1 1WRIA 2BPSA 3ZGZA 2AQ1B 3SU8X 1Y8RC 3ZRFA 1QOBA 2G9HD 1T0SC 1TS4A 3U7ZA 1OEYA 2MCNB 1E7UA 4FBJB 2KK8A 2MBHA 4A3OA 4FLHA 1V49A 4DQOC 3CMMB 2BS3B 3DVGY 3KWLA 4K81A 1MG8A 2MW5A 4FN2A 3JW0X 3IG3A 2NPTB 4RGMA 2CHXA 3BVZA 1C4PA 5HI1A 2M19A 4W9IA 4B95A 3P4QB 2JZPA 2LFIA 2IZVB 4M8NA 4ASWC 4MDKE 4IUMB 2BBCA 3VFKA 1PYWD 4ANVA 1Q0WB 3A9JA 2GBJA 1DOXA 3A9JB 5L95C 1C9FA 3VXWA 1E8XA 4HRSA 4LNKA 1YNTE 1ZDVA 3DBRI 4J3OD 2BKRB 3DBHI 1JQ4A 2K22A 2R61A 3B2FA 2KDFB 4MELA 2LASA 2KVRA 2W9NA 3U7DA 1JCKB 1WE6A 1FRDA 3A4SC 2K8BA 3ZTCA 3W9CB 3TEWA 1J7BA 5EDSA 3SHQA 3KUDB 2ZPYA 2C7NB 4AOFA 3P42A 3EECA 2KO3A 2L1AA 4FA6A 2LHEA 3ZXRA 3NOBA 3TEXA 3VAWA 5G2NA 3ENEA 5DPTA 4E3CA 1LXDA 3AXCA 1UWMA 1WYWB 1HA5A 3R8BA 2V1YA 4ZRJA 1JMLA 1RFAA 3DVNU 4Q2JA 1F52A 2IDYA 5CX3A 3RUIB 3ZNZB 2K0PA 2KTRB 1YN4A 4P1CC 5HG2A 3NVVA 1TS5A 4MSQB 1E8YA 2VH1A 2LGYA 2FUHB 4HJGE 4AP4C 2WLBA 1WY8A 3C8YA 4L1BA 3T9LA 4WH4A 2NBWB 1IBXA 2PW9A 1XO3A 3CSTA 3VUXA 4MACA 3VUYA 3NS8A 1SSNA 4LNIA 2JQRB 2WU5B 4P1BC 3RD2A 3A1QB 2ZNVC 1WGKA 2M8SA 2EMTA 4EE2A 1MHHE 2UU7A 2KJRA 1TYGB 3HUIA 3JVZX 1S3SG 4HXDA 3U30A 1UELA 3R2TA 4RGTA 2LHDA 1GAQB 4XWWA 1AN8A 1GB1A 1P1AA 4RMAA 3ZVVA 2LEKA 4BKSD 5AUKA 4HLEA 2WXQA 1R4MB 3N3KB 2B76B 4A20A 2NVUI 3BZDB 4W9LA 4G3XB 3NZUA 2L3ZA 4TSSA 2LRWA 1WYGA 1WH3A 3V60A 4DXGA 2XEWA 2FCSA 3KVFB 2VH2A 1TIFA 1WGDA 1WX7A 2HE7A 4HDOA 1WR1A 2IO0B 3V61A 1UWXA 2K6QA 3TIXA 1PQSA 3PRPB 1L5PA 1SBBB 1LGRA 1SEBD 3WAOA 3APDA 2EELA 2KJ6A 4XE0A 5H8YE 4C4VA 3AEAB 1R4MI 1YQBA 2MWSB 4JX1C 2WXHA 2GRIA 1V6EA 1D4BA 4WJPA 3VQIA 1KM7A 2YVCA 2WDVB 1YMHE 1I4HA 1V8CA 1I4QA 4WJNA 1BUIC 3Q3FA 2Y5BB 1N5WA 5BYRA 4B0EA 1QKZA 3M3JA 3WALA 2X8XX 2GB1A 2QMTA 4ICUA 3O65B 4C80A 3W1YA 3TUOA 4RM8A 4DXFA 3H9DA 2K39A 4IWPA 4E71A 4YSYB 2SEBD 1NEKB 1WFYA 4RGOS 2KJHB 1ET9A 1MVKA 3W1SA 4FJZA 3Q8FA 1WGYA 1MPEA 2MLBA 3I3TB 2RMMA 4XC2A 4BKTA 2FNJB 3IT4B 1C3TA 4W9HA 4F7ZA 1ZKHA 1M94A 5HFYA 1EWCA 3R66C 2QSDA 3V3XA 3URYA 4II3B 1TJEA 2O2VB 2JZZA 4K3CA 1FXAA 3VH4B 3DBRB 2NPTA 5L83A 1YQ3B 4FADA 4G0NB 2JYTA 2GI9A 2KTFA 2JZ3B 5J2RA 2FE8A 1WI0A 4BBNC 4HDQA 4MM3B 2LXCA 2K1FA 4K7UA 3EFCA 3LYYA 2WX0A 4HROA 3SDLC 2BGFA 2NR2A 1K50A 3B9JA 2ZCBA 4LDTD 3R3MA 2D11A 2Q5WD 4XWTA 2JXTA 2MJ3A 4N59A 1I7HA 1SB3C 1FRRA 3EA6A 3AULA 2ACZB 4N6EB 4GB9A 2REXA 5CHFA 1C78A 1FXIA 2V4LA 1J19A 4HJKA 1GNUA 3KYDD 3P4PB 3Q6BA 4URKA 1Q5WB 4YL8A 2WWZA 2KVZA 4JE3B 1FXTB 4GDLB 5DPWA 1C76A 2PJHA 2GBRA 1UH6A 1S1QB 1YIWA 4A8XC 3HK0A 4JIOU 1WMHB 2IBIB 3SFDB 5JZEB 2PE6B 3DVNV 4ACFA 5LXIB 3AE1B 2LI5A 1WSPA 1TKGA 3N20C 3OWEB 2LUMA 1FEHA 4RNAA 1SJHD 5D2MB 2DAFA 1KJTA 2YEPF 1NI3A 1FCCC 4GMVA 4B0MA 2NS5A 3I9V1 1T0RC 3BYTB 3TSSA 2RSUA 4GXBA 4KDLB 1TS2A 2I1KA 1FMAD 4NNJB 1JWMD 4ZHPA 4GDKB 2IO2B 2L00B 3O13A 1GPXA 4BBNF 4BZAA 4US8A 1PGAA 2WDTB 1TT5B 1KOTA 3RNEC 1E10A 1JWBD 3RNGC 1EF5A 1Q10A 4IC7B 4BKSA 3ZXVA 2KTRA 1WGRA 3FILB 3W2DA 1EU4A 2I38A 1J7AA 1F2RI 2KWCA 3PSEB 3PZDA 3AE4B 5AZHA 2GOWA 3DPDA 1WWTA 4NAWB 4WQMA 1ESFA 4DWFA 2I2YA 1OQYA 1C77A 2FCQA 2MP2B 1N6ZA 1X1MA 3B08A 4OVVA 2RGFA 3E56A 4M00A 3ETRA 1WX8A 1RWSA 2INCC 1VZ7A 3DBLI 4W9EA 2WP9B 1E8ZA 2JWUA 2LVOA 5C2TB 5J17A 2AQ3B 1R7SA 4HKQA 3AE2B 3WAPA 3S2AA 2NTSA 2J52A 1PGXA 2MX2A 1T6BX 3RULA 3TCAA 4IG7B 2NBUA 1AYFA 1P3QU 2OHFA 3RNAC 4TQ1A 3I57A 2L0FA 2KDBA 4FJVB 1N61A 2DBYA 1A70A 4KKIA 4B6WA 2QJLA 1DGJA 1JWUD 2KQ4X 3PPAA 1SE4A 3AV8A 4IOIE 1WXQA 4N9F4 3SFEB 2MRPA 3RT3B 1TS3A 2N1WA 4MGKE 1JALA 4LLGM 2N9XA 4C7YA 1R4NI 4RGNA 2N9KA 2LZ6A 2DX5B 2JX5A 4ZRIA 3ZYYX 4NZLB 4YWGG 2K8CA 2V3SA 3E9SA 1ZXHA 1QILA 1H8CA 2WDRB 4WIPA 4A90A 3ZO5B 1XF5L 4YXDB 5HHDG 4ZHOA 2JWZA 4HPMB 1R4NB 4AQ7A 1I4RA 1L4DB 2ZNVB 4A6QA 4FJYA 2FBWB 4AJWA 2BYTA 3RZWC 2GBKA 2KANA 2KLCA 2M1MA 3AH7A 3NVZA 2MHJA 1KRHA 5G55A 4HWIB 3GP7A 1G6JA 1UF0A 3T8MA 2LUEA 2IJ0A 2QILA 2ZJDA 3SEBA 3FC4A 2QHOA 3IBEA 1HEZE 1C79A 1WXMA 1U4AA 3D32A 4I6NB 2GLSA 4GU2A 2LVPA 4PYUA 2N1VA 1WJNA 1FCLA 3PT2B 2MJEA 1HXYD 2HJ8A 4YSZB 4C56C 5CHWA 1I35A 4ANWA 3OLMD 2INNE 1KFYB 1Z2MA 3IVFA 1EWYC 2L76A 4KDIC 5FKAC 4YTNB 3MC0B 3BVGA 4LNNA 1NDDA 3OJ3A 4K1RB 3ZDMC 1V1PB 2Z59B 1V81A 3M63B 4C4VB 2K25A 4MT5A 3C0RB 3AE8B 4WQOB 1D6EC 5MPOA 4W9KA 3VTWA 3N1XC 4OZAA 2FCNA 1TZ1A 1WJ6A 1PGBA 1T0YA 1UBQA 4M02A 4W9GA 1P0RA 1JW9D 4LDTB 2L05A 1H4RA 3BY4B 1NVID 4MSMB 3AEEB 1ZGUB 4WAAA 1WZ3A 1L0XB 1OQQA 2PVGC 1J0GA 3ZKJC 1CZPA 3QCAA 3B2GA 3AU4A 1RYJA 3N32A 3ZIMA 2ONQA 1IBXB 1ZW7A 2J42A 1FD6A 3QA8A 2O6VB 2M17A 3WAMA 2PTLA 1AW7A 4PS8A 4HEA1 2C9WB 2KQSA 4II2B 1A5RA 4NAWA 3VRAB 4RF1A 1C4CA 4DHZB 3AEFB 3OJ4B 1MG4A 3AE7B 3TJPA 1FNUA 3ZNID 3KWVA 4ARCA 2FUG1 4FXCA 1FPYA 2AL3A 2MBOA 3AB5A 3AI5A 1PDXA 4A9AA 4IWQA 4RCOA 1UZXB 1WM2A 3T3NA 4HPPA 1E9MA 1P7FA 2JRHA 5IA7A 4IM2A 4LCDE 1DYQA 1NYQA 1RAXA 4X57B 3LXFA 3UIPB 1N63A 1SF0A 3ZTDA 3V6CB 5T8IA 3IAM1 4IKGA 2GBNA 3R2IA 2EMSA 4ICVA 2JSVX 5EE9A 1HTOA 2AQ2B 2BVCA 2EKEC 2MEKA 4EOYA 3P2BA 3CF6E 2QC8A 3BWUD 1EO6A 3IHPC 4LNFA 3PLVA 2QDFA 3GE8C 5KHQA 1YX5B 2KWUB 3HM6X 3ONSA 3WCQA 2L7RA 1T5XD 2C5LC 1WXAA 2L52A 2WXPA 5H92C 1FNVA 1P7EA 3ZJUA 1YJJA 3W1SC 3J9CA 1K51A 5D6JB 5AEKB 3VVWB 2J0JA 2JU6X 3DVGX 4CHKA 2WXRA 2HD5B 2R2OA 1TGZB 2KACA 3U2SC 3NUHB 4HK2A 1EUVB 2DENB 2BWFA 3VDZA 4PK1A 2CKHB 2UWQA 1L0VB 2C7HA 3MFGA 2V4IB 1GUAB 4BOSC 4GGQA 2KQ7A 4G11A 2IPKD 3RZFA 3QHTA 1LO5D 1ZPSA 2M0AA 5IKCM 1JWAD 3OG5A 2O2VA 3AEBB 3ZJVA 1IP9A 4GDKA 3DDCB 2PVOD 5BYQA 5D7GA 1QQRA 3AE9B 3EFUA 1K52A 1ZOYB 5E6OA 2JYEA 2KDMA 4BVUC 4NJ7A 2OJWA 2IO3B 3LDZE 1FIQA 2IY0B 4UDUC 1UGMA 3GS2A 2CJOA 4S17A 3Q8BA 4BAXA 3ABVB 3KH0A 1L6UA 2VZKD 2DWQA 4OHJA 3ZUNA 1MHXA 4XX5A 2HTME 3ML8A 4LTUA 2VZKB 3BINA 1PFDA 1J8CA 3P4SB 3VRBB 3Q3MC 1E6EB 1OEYJ 4NY0A 2JF5A 4PS3A 4BFRA 1JRPA 4ZYSA 2DZJA 5BO4B 4IW0A 2N9PC 3H7PB 2K3UA 4YTPB 3VUWA 2DHZA 2W3RA 3MHSD 4AJYB 3FKYA 3GOEA 4EZJA 2L8JA 4LJOB 3N30A 2V9HA 3MJ5A 4K7SA 3KQ4A 2C60A 2PIAA 1N60A 5C1ZA 2CU1A 4L23A 1KH0A 2H89B 4KX6B 3EC8A 2W54A 3IT6B 2HJ1A 4O1NA 5GMVA 3AN1A 1ACCA 1IGDA 4RF0A 5D94A 4I6PA 3RCZA 5JXVA 5FR6A 3VTVA 2N9LA 4AWJA 3AECB 4MH0E 1F9JA 4JLCA 2MBEA 3Q14C 4JQWC 4FULA 3PO0A 4NJCA 4WJOA 2OJRA 4E74A 1UGJA 1EF1A 3SR6A 3TMPB 3I5JC 3L16A 3BIID 4EZKA 3C19A 4MM3A 1OFFA 3V62A 4HPLB 2RPVA 1KTKA 1J7CA 4DHJD 3HRDD 2KLGA 4KSLC 4US9A 2BWES 2LGSA 4PYZA 2C7MB 4FHKA 3HHMA 2N7JA 2AX5A 4WWMA 3DHGC 3L54A 4XDCA 3AEGB 1V5TA 2LMCA 2ZW0A 1DOIA 2K8HA 2INPE 4WJQA 4EUTA 5LNK1 3ZJTA 5E6NA 2PKOA 4D2KA 3H7SA 2O6VA 2LJIA 2KC1A 2M56B 3P1MA 1V5OA 3NVYA 1ZE3D 1VDVA 3V05A 3DOWA 3PZ7A 3Q8CA 4JL9A 2RR9A 4GLSC 3ZNHB 1D5ZC 2PMVA 1YOVB 3A33B 2WS3B 1SXTA 5C23A 2BYEA 3EHVA 2WQYB 3RNBC 2NBVB 2A4ZA 2MQJA 3SD5A 4TKNA 3RPFC 5J18A 3PREA 3MC8A 2N9EB 1KLGD 1MFWA 1D5XC 3NHEB 5BYSA 2V0GA 4N58A 4IWOA 3W5UB 2GBMA 1I4XA 3DHHC 5BMHA 2BYFA 3ALBA 1TY2A 2DYMA 4B9KA 2JXXA 5GXGB 1TKEA 3TEZA 1LQBA 5IOIA 5EE0A 1L0YB 3AE3B 3QK0A 2H88B 2WDQB 2XK5B 2IGHA 3H1UA 3DHIC 1QF6A 2WGSA 3IFWB 4CYEA 1LFDA 1E8WA 2D10A 3Q3JA 2DAJA 3HVDA 4GDLA 2GMIC 3QX1A 1ET6A 4RM9A 2AEHA 2J7QB 3NVWA 2AWTA 2JT4B 5JH5C 2DNFA 2IGGA 1TY0A 2PPHA 4XGAB 4KZ0A 4XYCA 4PS7A 3DWGC 4FHJA 1WR6E 2KNBA 1EM7A 2Y5CA 2Y3AA 1XT9B 3FILA 2ZCCA 5E6PA 5AZFA 2KX3A 4TMAB 3P63A 2CHWA 4BKGA 2KXJA 4TQ0A 4P16A 3JYUA 4K3BA 2E6XA 3PHXB 2L0TA 1RM6C 1OTRB 5EE3A 1GG3A 2YLMA 1WIAA 1WXVA 2BTEA 3ZNGC 3X0WA 1SJED 1FFUA 2D2QA 3R7QA 2BKFA 1WXSA 3B1LX 2LJ5A 4NQKE 1V97A 3R7RA 1FFVA 2WXIA 1D3ZA 3DWMA 1QLBB 2KYWA 5DPSA 1KLVA 1N5XA 2G4DB 2XK5A 4ANUA 1CJEA 2K5PA 3AU5A 2DZIA 1KLUD 2RDBC 2L32A 4IM0A 1IGCA 1Q1OA 2K6DB 3MHZA 1V80A 2KDIA 2CR5A 1SE9A 4OVZA 3DBHB 2IGDA 2J0MA 2KOXA 1VZ6A 2KN5A 3DBLB 3W5VB 3JSVA 3AEDB 2ASQA 3PV1A 1DOYA 3CWIA 2WXJA 1AARA 3VR9B 3APFA 4KGSA 3TBLD 2WXNA 2JUOA 5TR5A 1VJKA 4RFBA 1B9RA 4GSWA 4REZA 3LB8C 2QCZA 3AE6B 4KV2A 1UD7A 4HKZE 2AL6A 4G50A 4XDDA 3N1ZC 3Q2AC 1GOZA 3VH3B 3K9OB 4YSXB 2JY6A 3QC8B 2G45B 4ZOHC 4M01A 1TZOA 2KFKB 3UI3A 2IYDB 4MGYE 5I4DA 4ZYNA 1TKYA 1HZ5A 3UF8A 2HTHA 5JHBA 5C3JB 4M0WA 2KKCA 4H2AA 3A9KB 4OVUA 2G3QB 1FNWA 2LWPA 3DBSA 3TEYA 2LGIA 2KC2A 2VRRB 5FK9C 1RLFA 1KF6B 2FCMA 1K8RB 3B0AA 4TV3A 2RDHA 1QZEA 1NYRA 1NI2A 4TUUA 2FAZA 2KD0A 3PGEA 4P7IA 4JPSA 3QARA 2XNAC 2Z8LA 3Q8EA 1FM0D 5G5HA 4LJPB 1Z5SB 3ZQ4A 5IP4D 1SE3A 2MH7A 3L17A 2FIFA 3HM3A 4NPNA 1YN3A 2LD9A 4DDGD 4W9CA
chains in the Genus database with same CATH topology
1XLNA 2ICIA 3Q8BA 1JWMD 4ZHPA 3ABVB 1L6UA 4GDKB 1QOFA 2VZKD 3O13A 3PZ8A 1MI0A 1GPXA 2DWQA 4OHJA 1CQVA 2J4XA 4L2YA 1MHXA 4US8A 2BT6A 2HTME 3U52E 4LTUA 1PGAA 2VZKB 2WNMA 2HDEA 4NAMA 3IAS1 1WRIA 4WAFA 1E10A 3ZGZA 2AQ1B 2DYOA 1PFDA 1JWBD 1QOBA 1ZP0B 1TS4A 2G9HD 3P4SB 5BMGA 3BYYB 3U7ZA 3VRBB 1Q10A 1XCTL 1E6EB 1HQRD 1I4GA 3FILB 3W2DA 1EU4A 1JRPA 4ZYSA 2I38A 1J7AA 4DQOC 4C7ZA 1F2RI 2BS3B 2K3UA 3KWLA 4YTPB 2W3RA 3AE4B 1ZDXA 4RGMA 2W3SA 3BVZA 1ZUD2 1C4PA 1WWTA 1YJIA 4NAWB 5HI1A 2M19A 2PLPA 3MJ5A 4WQMA 3P4QB 1ESFA 2JZPA 2LFIA 3KQ4A 2PIAA 2I2YA 3AM9A 1N60A 2BBCA 2D5GA 1PYWD 1V1OA 1C77A 4L23A 1KH0A 2H89B 4KX6B 1DOXA 2W54A 2WXFA 3IT6B 1C9FA 2EKIA 3E56A 4O1NA 3ETRA 3AN1A 4HRSA 1RWSA 4IDIA 1YNTE 1ACCA 1F0ZA 1ZDVA 4J3OD 4ITKA 1VZ7A 1IGDA 4RF0A 1JQ4A 5JXVA 2K22A 2WP9B 2R61A 3B2FA 2N9LA 4R3DA 3AECB 2JWUA 2MJDA 2BS4B 3CIRB 5C2TB 1JCKB 3PO0A 2AQ3B 1R7SA 4HKQA 3AE2B 4NJCA 1FRDA 2NTSA 1UGJA 2J52A 3EGRA 3GB1A 3W9CB 3SR6A 3TEWA 1PGXA 1T6BX 3BIID 1J7BA 2WXKA 2ON8A 1OFFA 3P42A 1F2RC 1AYFA 2OHFA 2RPVA 1KTKA 5TSSA 1J7CA 3VR8B 4TQ1A 1UNSA 2L1AA 3I57A 2NTTA 2CJNA 2LHEA 3HRDD 4OZCA 1N61A 4US9A 2DBYA 3BK1A 3TEXA 4KGRA 1QT9A 1A70A 4KKIA 2YEPB 2QJLA 1DGJA 2KMMA 1JWUD 2KQ4X 5G5GA 1SE4A 1UWMA 1FO4A 3AV8A 4IOIE 2N7JA 1HA5A 1WXQA 3R8BA 2AX5A 4PT5A 1JMLA 4WWMA 3SFEB 4XDCA 2X38A 4Q2JA 1TS3A 5AUIA 1JALA 3AEGB 2WXOA 2IDYA 1XXGA 4LLGM 3RFZB 3P4RB 2K0PA 1PUTA 4WURA 2LMCA 4C7YA 1N62A 2ZW0A 1DOIA 4RGNA 2INPE 1JROA 2N9KA 1YN4A 5LNK1 5HG2A 3ZJTA 5D3DA 2ZW1A 3NVVA 1TS5A 2JX5A 2PKOA 3IXSA 4D2KA 3ZYYX 4NZLB 4YWGG 3E9SA 4HJGE 1ZXHA 2LJIA 3N9YC 1QILA 2WLBA 4USAA 4MH8A 2M56B 3P1MA 2WDRB 3NVYA 4WIPA 3C8YA 4L1BA 1ZE3D 1VDVA 4WH4A 2XN9C 1VR9A 4A90A 3V05A 1IBXA 3PZ7A 1XF5L 2PW9A 1XO3A 1ZXIA 2G1EA 2WXMA 3Q8CA 5HHDG 4YXDB 4MACA 1XLQA 4ZHOA 5BMIA 3NRZA 4LK0M 4GLSC 1SSNA 4AQ7A 1D5ZC 1I4RA 1L6VA 2PMVA 2WS3B 1SXTA 1L4DB 2JQRB 4A6QA 4A55A 2QEJC 2WU5B 2FBWB 2WQYB 2KN4A 2BYTA 1WGKA 3AH7A 3NVZA 5FR3A 3RPFC 4EE2A 1KRHA 1MHHE 1KLGD 3GP7A 2L83A 2IJ0A 2W82A 1D5XC 1HZ6A 5BYSA 2V0GA 4N58A 2QILA 3SEBA 1TYGB 3HUIA 3W5UB 3FC4A 1I4XA 1HEZE 1SE2A 3R2TA 5BMHA 1TY2A 2DYMA 4RGTA 1C79A 2LHDA 5GXGB 1TKEA 1GAQB 3TEZA 4XWWA 1AN8A 1GB1A 2LEKA 4RH6A 5AUKA 5EE0A 1L0YB 1OQRA 3AE3B 1FCLA 2H88B 2WDQB 2IGHA 2MJEA 1HXYD 1GB4A 2WXQA 2B76B 1F77A 1BXTA 4YSZB 4C56C 1QF6A 3AMZA 3BZDB 2INNE 1KFYB 1EWYC 5FKAC 4TSSA 4YTNB 3NS1A 3MC0B 3BVGA 3HVDA 1WYGA 4DXGA 2W55A 1ET6A 3T3OA 1V1PB 2WU2B 3NVWA 4MT5A 2IGGA 1TY0A 3AE8B 1AWDA 1D6EC 1XCQL 5MPOA 5D3IB 1UWXA 1QOAA 2WXLA 4OZAA 1XEEA 1L5PA 2J53A 1SBBB 1M4VA 2DLBA 1SEBD 1T3QA 1UUPA 3DWGC 1PGBA 2EELA 1E7PB 1EM7A 4XE0A 5H8YE 3BVMA 2Y5CA 2Y3AA 3FILA 1JW9D 4OW0A 3AEAB 4TMAB 1NVID 3P63A 3AEEB 1K53A 4JX1C 2WXHA 2GRIA 4TQ0A 4CQNA 4P16A 1D4BA 3VQIA 1YN5A 1L0XB 2E6XA 1OQQA 2WDVB 1YMHE 1RM6C 2PVGC 1I4HA 1CZPA 1V8CA 4JWUC 1I4QA 4YT0B 1BUIC 5EE3A 1N5WA 5BYRA 2BTEA 4B0EA 1QKZA 1VRAB 1SJED 3B2GA 1FFUA 2GB1A 1I4PA 1RYJA 2QMTA 2ONQA 1IBXB 2J42A 1V97A 1FD6A 4C80A 1FFVA 3TUOA 1VZ8A 3EUB2 2WXIA 2PTLA 1AW7A 2SAKA 4ARIA 4DXFA 3DWMA 4HEA1 4YSYB 1QLBB 2SEBD 1NEKB 1NENB 5EE1A 4RGOS 2BB6A 1E0ZA 1ET9A 1N5XA 3VRAB 1MVKA 3W1SA 3Q8FA 4RF1A 1CJEA 2K5PA 2RDGA 1C4CA 1MPEA 1ENFA 3AEFB 4ZRQA 2RMMA 1KLUD 2L32A 1QOGA 3IT4B 1IGCA 1EU3A 1Y56A 1STEA 3AE7B 5HFYA 1EWCA 2QSDA 4KKJA 3V3XA 1FNUA 3MHZA 1BMLC 3KWVA 4ARCA 2FUG1 2E3TA 4FXCA 4OVZA 3URYA 2TSSA 4AS1A 2IGDA 1TJEA 1VZ6A 4OZBA 3AB5A 1FXAA 3W5VB 3AEDB 1PDXA 4A9AA 4RCOA 1ROEA 3H8HA 1YQ3B 1DOYA 3CWIA 2JYTA 2GI9A 2WXJA 3VR9B 4KGSA 2BB5A 1E9MA 1P7FA 2BS2B 3T3NA 1XLPA 2FE8A 2WXNA 2NMQA 1DYQA 4MM3B 1NYQA 2K9XA 3LXFA 2KAJA 2BW2A 3L4PA 1VJKA 4RFBA 1N63A 1B9RA 1SF0A 4REZA 1YQ4B 3LB8C 5T8IA 2KWDA 3AE6B 3IAM1 3Q69A 4IKGA 3LYYA 4HROA 3R2IA 4JWSC 1K50A 2JSVX 5EE9A 3B9JA 4HKZE 2AQ2B 2MEKA 2Q5WD 3BWUD 4XDDA 2OEDA 1GOZA 2V3PA 4XWTA 2JXTA 4YSXB 2MJ3A 4N59A 1I7HA 1VLBA 1SB3C 1FRRA 3EA6A 4ZOHC 2ACZB 1TZOA 4N6EB 2Y5PA 3AE5B 3UI3A 3WCQA 1T5XD 2L52A 2WXPA 5I4DA 5H92C 1TKYA 1HZ5A 1C78A 1FNVA 1FXIA 1P7EA 5C3JB 4M0WA 3ZJUA 4ZRPA 1YJJA 3J9CA 4H2AA 1K51A 1B1ZA 3P4PB 2JU6X 3NZ3A 1FNWA 3BK2A 1XLOA 4JE3B 3TEYA 2CU3A 1D5MC 4GDLB 2WXRA 1C76A 2LGIA 2KACA 5FK9C 3U2SC 3NUHB 4KGTA 1KF6B 2RDHA 5E6JA 1NYRA 1IUEA 4A8XC 1L0VB 3MFGA 3SFDB 1JWSD 2V4IB 4JPSA 3AE1B 2XNAC 3MP9A 2IPKD 1WSPA 2Z8LA 1SIJA 3Q8EA 1FM0D 1TKGA 1LO5D 1ZPSA 2M0AA 3OWEB 2LUMA 1FEHA 3FAHA 1JWAD 1CK1A 4RNAA 1SJHD 1V1PA 4P6VF 5G5HA 2N0SB 3KLSX 3HVZA 1RFKA 3AEBB 3U4EG 3ZJVA 2YEPF 1NI3A 1FCCC 2PVOD 3ZQ4A 5BYQA 2WXGA 3Q8AA 5D7GA 4B0MA 1QQRA 1SE3A 2MH7A 3AE9B 3I9V1 2V3NA 1K52A 1ZOYB 2JYEA 1C4AA 2KDMA 3BYTB 4YTMB 1YN3A 3TSSA 1L4ZB 1FIQA 4UDUC 1TS2A 3GS2A 2CJOA 2QIEB 1FMAD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1C78 A;  1BUI C;  1C77 A;  2SAK A;  1C79 A;  1C76 A;  1SSN A; 
#chains in the Genus database with same CATH topology
 1XLN A;  2ICI A;  3QWZ B;  2PE9 A;  3KYC D;  1C1Y B;  3PVL A;  3HIZ A;  1XQQ A;  1LM8 B;  1V86 A;  2G4S A;  3U52 E;  2WHI A;  2WNM A;  2HDE A;  4NAM A;  3APC A;  4WAF A;  2DYO A;  1ZP0 B;  5BMG A;  3BYY B;  3PRZ A;  1XCT L;  1HQR D;  1I4G A;  4DBG A;  3GE3 C;  2MBQ A;  4J6I A;  3L10 B;  4ZRK A;  3RNC C;  4C7Z A;  2D3A A;  3OAW A;  1ZDX A;  1WRD B;  5KHO A;  2W3S A;  1ZUD 2;  3WAN A;  3N1Y C;  1YJI A;  2PLP A;  1MJD A;  1BT0 A;  4JGH B;  2JVC A;  1T0Q C;  3AM9 A;  1GC7 A;  2D5G A;  3U8Z A;  1V1O A;  2KWV B;  4MJS A;  2WXF A;  4M0W B;  3NJT A;  3UQA A;  4MJS B;  2EKI A;  5JHA A;  4IDI A;  1F0Z A;  4ITK A;  3K9P B;  2Z0E B;  4R3D A;  2FID A;  2RPQ A;  1IPG A;  2MJD A;  2BS4 B;  3CIR B;  1WGG A;  4C00 A;  4A3P A;  2A5U A;  2MBB B;  4WWO A;  2LVQ A;  3EGR A;  3GB1 A;  2WXK A;  4IM3 A;  4NJ6 A;  4EEW A;  3KW5 B;  4EFO A;  2ON8 A;  2KFK A;  1F2R C;  5TSS A;  3VR8 B;  1UNS A;  2NTT A;  3RN9 C;  2CJN A;  4BOZ B;  4OZC A;  3JSV B;  2KX0 A;  3BK1 A;  3H6N A;  4KGR A;  3QQ8 B;  4AUQ C;  1QT9 A;  2YEP B;  3LJ3 A;  3MC9 A;  2KMM A;  5G5G A;  2J0K A;  3ZLZ A;  4CO7 A;  1FO4 A;  1I42 A;  5IO9 A;  4HVB A;  4GIV A;  2CS4 A;  2N7D A;  4PT5 A;  5DCN A;  2B3A A;  2X38 A;  3I63 C;  5AUI A;  2WXO A;  1XXG A;  3RFZ B;  2BYV E;  2KHW B;  4DK5 A;  3P4R B;  1PUT A;  4WUR A;  2R2Q A;  1WE7 A;  1N62 A;  1E7V A;  1JRO A;  2NCN A;  5D3D A;  1L2N A;  2ZW1 A;  3QIJ A;  3IXS A;  4KIK B;  3PS6 A;  3N9Y C;  4USA A;  3PRM B;  4MH8 A;  4KIK A;  3NZS A;  2N7E A;  2XN9 C;  1VR9 A;  2BF8 B;  3UIO B;  1ZXI A;  2G1E A;  2WXM A;  5BMI A;  1XLQ A;  4DHJ B;  4MGZ E;  3NRZ A;  4LK0 M;  1WJU A;  1L6V A;  4F8C B;  4GOC A;  4A55 A;  2QEJ C;  4W9D A;  2KN4 A;  1WX9 A;  2XBB C;  3UGB B;  2MSE D;  4QAY A;  5FR3 A;  2KFJ A;  2L83 A;  3VTU A;  1HE8 A;  1HZ6 A;  2W82 A;  3L0W B;  1TTN A;  1IYF A;  1SE2 A;  3KUZ A;  3ECI A;  3MJW A;  2LGD A;  3QAQ A;  4RH6 A;  4DXA B;  3PHW B;  1OQR A;  3CSF A;  1YJ1 A;  2I1J A;  1GB4 A;  1F77 A;  1BXT A;  3AMZ A;  3PLU A;  3RI7 C;  2N4F A;  3NS1 A;  2W55 A;  1CMX B;  3T3O A;  1TBE A;  2DZM A;  2WU2 B;  3M62 B;  5LXH A;  3A4R A;  1AWD A;  1XCQ L;  5D3I B;  2DZK A;  1QOA A;  2WXL A;  3DCG A;  1XEE A;  2J53 A;  3UIN B;  1M4V A;  2DLB A;  2DYB A;  1T3Q A;  1UUP A;  2ZVO A;  4KVG B;  2O6V D;  4WWP A;  2JRI B;  1E7P B;  4HCN B;  3BVM A;  1E90 A;  4OW0 A;  3DQV A;  1K53 A;  2ZPN A;  4CQN A;  1YN5 A;  2D07 B;  2LRU A;  4JWU C;  1P9D U;  4YT0 B;  1OGW A;  1L7Y A;  2D3B A;  1VRA B;  3Q3N C;  1GJZ A;  1I4P A;  1JRU A;  4K7W A;  3RYT A;  1VZ8 A;  3EUB 2;  2SAK A;  3NG0 A;  4ARI A;  4HCP B;  3Q3O C;  2KMC A;  1NEN B;  3RNF C;  5EE1 A;  2BB6 A;  2ZVN A;  2IO1 B;  3VHT C;  1E0Z A;  4W9F A;  1HTQ A;  2RDG A;  1ENF A;  4ZRQ A;  2KMA A;  4GN1 A;  3ZDT A;  1QOG A;  1YD8 U;  3V6E B;  1Y56 A;  1EU3 A;  3NY5 A;  1YX6 B;  4KZC A;  1STE A;  1E5W A;  5LLI A;  5DPR A;  4KKJ A;  1BML C;  5AZG A;  2E3T A;  2TSS A;  2WYQ A;  3PTF C;  4AS1 A;  3A9K A;  4OZB A;  1NBF C;  1F1H A;  3GZN I;  3M95 A;  1ROE A;  3H8H A;  4M8M A;  4DHZ E;  1WM3 A;  2BB5 A;  2BS2 B;  1GC6 A;  1XLP A;  2KT7 A;  2NMQ A;  2K9X A;  2KAJ A;  2BW2 A;  3L4P A;  1RRB A;  2AYO B;  1YQ4 B;  2KWD A;  4DDI D;  3Q69 A;  4JWS C;  3KUC B;  2D3C A;  2RD0 A;  1UBI A;  3MTN B;  2OED A;  2V3P A;  4NQL B;  1VCB A;  1VLB A;  3WA0 A;  4W9J A;  5CHV C;  2LGX A;  2Y5P A;  3AE5 B;  2OOB B;  2D3G A;  1WF9 A;  2JPH A;  3RMK C;  4I6L B;  1VD2 A;  1ISN A;  2M0X A;  2MA9 B;  4ZRP A;  2IY1 B;  1B1Z A;  3X23 A;  3NZ3 A;  3BK2 A;  1XLO A;  2CU3 A;  1D5M C;  1XD3 B;  2PEA A;  3TL5 A;  4EZL A;  3A1Q A;  3L08 A;  4S0R A;  3L13 A;  4KGT A;  3GZN B;  2IND C;  4ZDV A;  5E6J A;  3ZW3 A;  1IUE A;  3QJZ A;  4EKU A;  3ZRC A;  1JWS D;  3UQB A;  3MP9 A;  1SIJ A;  2BQQ A;  5IN7 A;  3WIM A;  1P98 A;  3FAH A;  1CK1 A;  4MEM A;  1V1P A;  4P6V F;  4XZ4 A;  2N0S B;  3KLS X;  3HVZ A;  1RFK A;  3U4E G;  2WX1 A;  2KDE B;  2WXG A;  2LXA A;  3Q8A A;  5HKH A;  1WMH A;  3H7P A;  4MGI E;  1WJ4 A;  2V3N A;  2ZEQ A;  3ML9 A;  1SIF A;  1V9J A;  1C4A A;  4YTM B;  4LNO A;  1L4Z B;  2CHZ A;  2MP2 A;  4F1S A;  1SGH A;  4WWN A;  2ZZP B;  2QIE B;  2M4N A;  1QOF A;  3PZ8 A;  1MI0 A;  5IAA C;  5CTR C;  1WGH A;  1CQV A;  2J4X A;  1V2Y A;  4L2Y A;  2BT6 A;  1WZ0 A;  2KZR A;  2Z0D B;  2UYZ B;  4KSK C;  4ANX A;  3IAS 1;  1WRI A;  2BPS A;  3ZGZ A;  2AQ1 B;  3SU8 X;  1Y8R C;  3ZRF A;  1QOB A;  2G9H D;  1T0S C;  1TS4 A;  3U7Z A;  1OEY A;  2MCN B;  1E7U A;  4FBJ B;  2KK8 A;  2MBH A;  4A3O A;  4FLH A;  1V49 A;  4DQO C;  3CMM B;  2BS3 B;  3DVG Y;  3KWL A;  4K81 A;  1MG8 A;  2MW5 A;  4FN2 A;  3JW0 X;  3IG3 A;  2NPT B;  4RGM A;  2CHX A;  3BVZ A;  1C4P A;  5HI1 A;  2M19 A;  4W9I A;  4B95 A;  3P4Q B;  2JZP A;  2LFI A;  2IZV B;  4M8N A;  4ASW C;  4MDK E;  4IUM B;  2BBC A;  3VFK A;  1PYW D;  4ANV A;  1Q0W B;  3A9J A;  2GBJ A;  1DOX A;  3A9J B;  5L95 C;  1C9F A;  3VXW A;  1E8X A;  4HRS A;  4LNK A;  1YNT E;  1ZDV A;  3DBR I;  4J3O D;  2BKR B;  3DBH I;  1JQ4 A;  2K22 A;  2R61 A;  3B2F A;  2KDF B;  4MEL A;  2LAS A;  2KVR A;  2W9N A;  3U7D A;  1JCK B;  1WE6 A;  1FRD A;  3A4S C;  2K8B A;  3ZTC A;  3W9C B;  3TEW A;  1J7B A;  5EDS A;  3SHQ A;  3KUD B;  2ZPY A;  2C7N B;  4AOF A;  3P42 A;  3EEC A;  2KO3 A;  2L1A A;  4FA6 A;  2LHE A;  3ZXR A;  3NOB A;  3TEX A;  3VAW A;  5G2N A;  3ENE A;  5DPT A;  4E3C A;  1LXD A;  3AXC A;  1UWM A;  1WYW B;  1HA5 A;  3R8B A;  2V1Y A;  4ZRJ A;  1JML A;  1RFA A;  3DVN U;  4Q2J A;  1F52 A;  2IDY A;  5CX3 A;  3RUI B;  3ZNZ B;  2K0P A;  2KTR B;  1YN4 A;  4P1C C;  5HG2 A;  3NVV A;  1TS5 A;  4MSQ B;  1E8Y A;  2VH1 A;  2LGY A;  2FUH B;  4HJG E;  4AP4 C;  2WLB A;  1WY8 A;  3C8Y A;  4L1B A;  3T9L A;  4WH4 A;  2NBW B;  1IBX A;  2PW9 A;  1XO3 A;  3CST A;  3VUX A;  4MAC A;  3VUY A;  3NS8 A;  1SSN A;  4LNI A;  2JQR B;  2WU5 B;  4P1B C;  3RD2 A;  3A1Q B;  2ZNV C;  1WGK A;  2M8S A;  2EMT A;  4EE2 A;  1MHH E;  2UU7 A;  2KJR A;  1TYG B;  3HUI A;  3JVZ X;  1S3S G;  4HXD A;  3U30 A;  1UEL A;  3R2T A;  4RGT A;  2LHD A;  1GAQ B;  4XWW A;  1AN8 A;  1GB1 A;  1P1A A;  4RMA A;  3ZVV A;  2LEK A;  4BKS D;  5AUK A;  4HLE A;  2WXQ A;  1R4M B;  3N3K B;  2B76 B;  4A20 A;  2NVU I;  3BZD B;  4W9L A;  4G3X B;  3NZU A;  2L3Z A;  4TSS A;  2LRW A;  1WYG A;  1WH3 A;  3V60 A;  4DXG A;  2XEW A;  2FCS A;  3KVF B;  2VH2 A;  1TIF A;  1WGD A;  1WX7 A;  2HE7 A;  4HDO A;  1WR1 A;  2IO0 B;  3V61 A;  1UWX A;  2K6Q A;  3TIX A;  1PQS A;  3PRP B;  1L5P A;  1SBB B;  1LGR A;  1SEB D;  3WAO A;  3APD A;  2EEL A;  2KJ6 A;  4XE0 A;  5H8Y E;  4C4V A;  3AEA B;  1R4M I;  1YQB A;  2MWS B;  4JX1 C;  2WXH A;  2GRI A;  1V6E A;  1D4B A;  4WJP A;  3VQI A;  1KM7 A;  2YVC A;  2WDV B;  1YMH E;  1I4H A;  1V8C A;  1I4Q A;  4WJN A;  1BUI C;  3Q3F A;  2Y5B B;  1N5W A;  5BYR A;  4B0E A;  1QKZ A;  3M3J A;  3WAL A;  2X8X X;  2GB1 A;  2QMT A;  4ICU A;  3O65 B;  4C80 A;  3W1Y A;  3TUO A;  4RM8 A;  4DXF A;  3H9D A;  2K39 A;  4IWP A;  4E71 A;  4YSY B;  2SEB D;  1NEK B;  1WFY A;  4RGO S;  2KJH B;  1ET9 A;  1MVK A;  3W1S A;  4FJZ A;  3Q8F A;  1WGY A;  1MPE A;  2MLB A;  3I3T B;  2RMM A;  4XC2 A;  4BKT A;  2FNJ B;  3IT4 B;  1C3T A;  4W9H A;  4F7Z A;  1ZKH A;  1M94 A;  5HFY A;  1EWC A;  3R66 C;  2QSD A;  3V3X A;  3URY A;  4II3 B;  1TJE A;  2O2V B;  2JZZ A;  4K3C A;  1FXA A;  3VH4 B;  3DBR B;  2NPT A;  5L83 A;  1YQ3 B;  4FAD A;  4G0N B;  2JYT A;  2GI9 A;  2KTF A;  2JZ3 B;  5J2R A;  2FE8 A;  1WI0 A;  4BBN C;  4HDQ A;  4MM3 B;  2LXC A;  2K1F A;  4K7U A;  3EFC A;  3LYY A;  2WX0 A;  4HRO A;  3SDL C;  2BGF A;  2NR2 A;  1K50 A;  3B9J A;  2ZCB A;  4LDT D;  3R3M A;  2D11 A;  2Q5W D;  4XWT A;  2JXT A;  2MJ3 A;  4N59 A;  1I7H A;  1SB3 C;  1FRR A;  3EA6 A;  3AUL A;  2ACZ B;  4N6E B;  4GB9 A;  2REX A;  5CHF A;  1C78 A;  1FXI A;  2V4L A;  1J19 A;  4HJK A;  1GNU A;  3KYD D;  3P4P B;  3Q6B A;  4URK A;  1Q5W B;  4YL8 A;  2WWZ A;  2KVZ A;  4JE3 B;  1FXT B;  4GDL B;  5DPW A;  1C76 A;  2PJH A;  2GBR A;  1UH6 A;  1S1Q B;  1YIW A;  4A8X C;  3HK0 A;  4JIO U;  1WMH B;  2IBI B;  3SFD B;  5JZE B;  2PE6 B;  3DVN V;  4ACF A;  5LXI B;  3AE1 B;  2LI5 A;  1WSP A;  1TKG A;  3N20 C;  3OWE B;  2LUM A;  1FEH A;  4RNA A;  1SJH D;  5D2M B;  2DAF A;  1KJT A;  2YEP F;  1NI3 A;  1FCC C;  4GMV A;  4B0M A;  2NS5 A;  3I9V 1;  1T0R C;  3BYT B;  3TSS A;  2RSU A;  4GXB A;  4KDL B;  1TS2 A;  2I1K A;  1FMA D;  4NNJ B;  1JWM D;  4ZHP A;  4GDK B;  2IO2 B;  2L00 B;  3O13 A;  1GPX A;  4BBN F;  4BZA A;  4US8 A;  1PGA A;  2WDT B;  1TT5 B;  1KOT A;  3RNE C;  1E10 A;  1JWB D;  3RNG C;  1EF5 A;  1Q10 A;  4IC7 B;  4BKS A;  3ZXV A;  2KTR A;  1WGR A;  3FIL B;  3W2D A;  1EU4 A;  2I38 A;  1J7A A;  1F2R I;  2KWC A;  3PSE B;  3PZD A;  3AE4 B;  5AZH A;  2GOW A;  3DPD A;  1WWT A;  4NAW B;  4WQM A;  1ESF A;  4DWF A;  2I2Y A;  1OQY A;  1C77 A;  2FCQ A;  2MP2 B;  1N6Z A;  1X1M A;  3B08 A;  4OVV A;  2RGF A;  3E56 A;  4M00 A;  3ETR A;  1WX8 A;  1RWS A;  2INC C;  1VZ7 A;  3DBL I;  4W9E A;  2WP9 B;  1E8Z A;  2JWU A;  2LVO A;  5C2T B;  5J17 A;  2AQ3 B;  1R7S A;  4HKQ A;  3AE2 B;  3WAP A;  3S2A A;  2NTS A;  2J52 A;  1PGX A;  2MX2 A;  1T6B X;  3RUL A;  3TCA A;  4IG7 B;  2NBU A;  1AYF A;  1P3Q U;  2OHF A;  3RNA C;  4TQ1 A;  3I57 A;  2L0F A;  2KDB A;  4FJV B;  1N61 A;  2DBY A;  1A70 A;  4KKI A;  4B6W A;  2QJL A;  1DGJ A;  1JWU D;  2KQ4 X;  3PPA A;  1SE4 A;  3AV8 A;  4IOI E;  1WXQ A;  4N9F 4;  3SFE B;  2MRP A;  3RT3 B;  1TS3 A;  2N1W A;  4MGK E;  1JAL A;  4LLG M;  2N9X A;  4C7Y A;  1R4N I;  4RGN A;  2N9K A;  2LZ6 A;  2DX5 B;  2JX5 A;  4ZRI A;  3ZYY X;  4NZL B;  4YWG G;  2K8C A;  2V3S A;  3E9S A;  1ZXH A;  1QIL A;  1H8C A;  2WDR B;  4WIP A;  4A90 A;  3ZO5 B;  1XF5 L;  4YXD B;  5HHD G;  4ZHO A;  2JWZ A;  4HPM B;  1R4N B;  4AQ7 A;  1I4R A;  1L4D B;  2ZNV B;  4A6Q A;  4FJY A;  2FBW B;  4AJW A;  2BYT A;  3RZW C;  2GBK A;  2KAN A;  2KLC A;  2M1M A;  3AH7 A;  3NVZ A;  2MHJ A;  1KRH A;  5G55 A;  4HWI B;  3GP7 A;  1G6J A;  1UF0 A;  3T8M A;  2LUE A;  2IJ0 A;  2QIL A;  2ZJD A;  3SEB A;  3FC4 A;  2QHO A;  3IBE A;  1HEZ E;  1C79 A;  1WXM A;  1U4A A;  3D32 A;  4I6N B;  2GLS A;  4GU2 A;  2LVP A;  4PYU A;  2N1V A;  1WJN A;  1FCL A;  3PT2 B;  2MJE A;  1HXY D;  2HJ8 A;  4YSZ B;  4C56 C;  5CHW A;  1I35 A;  4ANW A;  3OLM D;  2INN E;  1KFY B;  1Z2M A;  3IVF A;  1EWY C;  2L76 A;  4KDI C;  5FKA C;  4YTN B;  3MC0 B;  3BVG A;  4LNN A;  1NDD A;  3OJ3 A;  4K1R B;  3ZDM C;  1V1P B;  2Z59 B;  1V81 A;  3M63 B;  4C4V B;  2K25 A;  4MT5 A;  3C0R B;  3AE8 B;  4WQO B;  1D6E C;  5MPO A;  4W9K A;  3VTW A;  3N1X C;  4OZA A;  2FCN A;  1TZ1 A;  1WJ6 A;  1PGB A;  1T0Y A;  1UBQ A;  4M02 A;  4W9G A;  1P0R A;  1JW9 D;  4LDT B;  2L05 A;  1H4R A;  3BY4 B;  1NVI D;  4MSM B;  3AEE B;  1ZGU B;  4WAA A;  1WZ3 A;  1L0X B;  1OQQ A;  2PVG C;  1J0G A;  3ZKJ C;  1CZP A;  3QCA A;  3B2G A;  3AU4 A;  1RYJ A;  3N32 A;  3ZIM A;  2ONQ A;  1IBX B;  1ZW7 A;  2J42 A;  1FD6 A;  3QA8 A;  2O6V B;  2M17 A;  3WAM A;  2PTL A;  1AW7 A;  4PS8 A;  4HEA 1;  2C9W B;  2KQS A;  4II2 B;  1A5R A;  4NAW A;  3VRA B;  4RF1 A;  1C4C A;  4DHZ B;  3AEF B;  3OJ4 B;  1MG4 A;  3AE7 B;  3TJP A;  1FNU A;  3ZNI D;  3KWV A;  4ARC A;  2FUG 1;  4FXC A;  1FPY A;  2AL3 A;  2MBO A;  3AB5 A;  3AI5 A;  1PDX A;  4A9A A;  4IWQ A;  4RCO A;  1UZX B;  1WM2 A;  3T3N A;  4HPP A;  1E9M A;  1P7F A;  2JRH A;  5IA7 A;  4IM2 A;  4LCD E;  1DYQ A;  1NYQ A;  1RAX A;  4X57 B;  3LXF A;  3UIP B;  1N63 A;  1SF0 A;  3ZTD A;  3V6C B;  5T8I A;  3IAM 1;  4IKG A;  2GBN A;  3R2I A;  2EMS A;  4ICV A;  2JSV X;  5EE9 A;  1HTO A;  2AQ2 B;  2BVC A;  2EKE C;  2MEK A;  4EOY A;  3P2B A;  3CF6 E;  2QC8 A;  3BWU D;  1EO6 A;  3IHP C;  4LNF A;  3PLV A;  2QDF A;  3GE8 C;  5KHQ A;  1YX5 B;  2KWU B;  3HM6 X;  3ONS A;  3WCQ A;  2L7R A;  1T5X D;  2C5L C;  1WXA A;  2L52 A;  2WXP A;  5H92 C;  1FNV A;  1P7E A;  3ZJU A;  1YJJ A;  3W1S C;  3J9C A;  1K51 A;  5D6J B;  5AEK B;  3VVW B;  2J0J A;  2JU6 X;  3DVG X;  4CHK A;  2WXR A;  2HD5 B;  2R2O A;  1TGZ B;  2KAC A;  3U2S C;  3NUH B;  4HK2 A;  1EUV B;  2DEN B;  2BWF A;  3VDZ A;  4PK1 A;  2CKH B;  2UWQ A;  1L0V B;  2C7H A;  3MFG A;  2V4I B;  1GUA B;  4BOS C;  4GGQ A;  2KQ7 A;  4G11 A;  2IPK D;  3RZF A;  3QHT A;  1LO5 D;  1ZPS A;  2M0A A;  5IKC M;  1JWA D;  3OG5 A;  2O2V A;  3AEB B;  3ZJV A;  1IP9 A;  4GDK A;  3DDC B;  2PVO D;  5BYQ A;  5D7G A;  1QQR A;  3AE9 B;  3EFU A;  1K52 A;  1ZOY B;  5E6O A;  2JYE A;  2KDM A;  4BVU C;  4NJ7 A;  2OJW A;  2IO3 B;  3LDZ E;  1FIQ A;  2IY0 B;  4UDU C;  1UGM A;  3GS2 A;  2CJO A;  4S17 A;  3Q8B A;  4BAX A;  3ABV B;  3KH0 A;  1L6U A;  2VZK D;  2DWQ A;  4OHJ A;  3ZUN A;  1MHX A;  4XX5 A;  2HTM E;  3ML8 A;  4LTU A;  2VZK B;  3BIN A;  1PFD A;  1J8C A;  3P4S B;  3VRB B;  3Q3M C;  1E6E B;  1OEY J;  4NY0 A;  2JF5 A;  4PS3 A;  4BFR A;  1JRP A;  4ZYS A;  2DZJ A;  5BO4 B;  4IW0 A;  2N9P C;  3H7P B;  2K3U A;  4YTP B;  3VUW A;  2DHZ A;  2W3R A;  3MHS D;  4AJY B;  3FKY A;  3GOE A;  4EZJ A;  2L8J A;  4LJO B;  3N30 A;  2V9H A;  3MJ5 A;  4K7S A;  3KQ4 A;  2C60 A;  2PIA A;  1N60 A;  5C1Z A;  2CU1 A;  4L23 A;  1KH0 A;  2H89 B;  4KX6 B;  3EC8 A;  2W54 A;  3IT6 B;  2HJ1 A;  4O1N A;  5GMV A;  3AN1 A;  1ACC A;  1IGD A;  4RF0 A;  5D94 A;  4I6P A;  3RCZ A;  5JXV A;  5FR6 A;  3VTV A;  2N9L A;  4AWJ A;  3AEC B;  4MH0 E;  1F9J A;  4JLC A;  2MBE A;  3Q14 C;  4JQW C;  4FUL A;  3PO0 A;  4NJC A;  4WJO A;  2OJR A;  4E74 A;  1UGJ A;  1EF1 A;  3SR6 A;  3TMP B;  3I5J C;  3L16 A;  3BII D;  4EZK A;  3C19 A;  4MM3 A;  1OFF A;  3V62 A;  4HPL B;  2RPV A;  1KTK A;  1J7C A;  4DHJ D;  3HRD D;  2KLG A;  4KSL C;  4US9 A;  2BWE S;  2LGS A;  4PYZ A;  2C7M B;  4FHK A;  3HHM A;  2N7J A;  2AX5 A;  4WWM A;  3DHG C;  3L54 A;  4XDC A;  3AEG B;  1V5T A;  2LMC A;  2ZW0 A;  1DOI A;  2K8H A;  2INP E;  4WJQ A;  4EUT A;  5LNK 1;  3ZJT A;  5E6N A;  2PKO A;  4D2K A;  3H7S A;  2O6V A;  2LJI A;  2KC1 A;  2M56 B;  3P1M A;  1V5O A;  3NVY A;  1ZE3 D;  1VDV A;  3V05 A;  3DOW A;  3PZ7 A;  3Q8C A;  4JL9 A;  2RR9 A;  4GLS C;  3ZNH B;  1D5Z C;  2PMV A;  1YOV B;  3A33 B;  2WS3 B;  1SXT A;  5C23 A;  2BYE A;  3EHV A;  2WQY B;  3RNB C;  2NBV B;  2A4Z A;  2MQJ A;  3SD5 A;  4TKN A;  3RPF C;  5J18 A;  3PRE A;  3MC8 A;  2N9E B;  1KLG D;  1MFW A;  1D5X C;  3NHE B;  5BYS A;  2V0G A;  4N58 A;  4IWO A;  3W5U B;  2GBM A;  1I4X A;  3DHH C;  5BMH A;  2BYF A;  3ALB A;  1TY2 A;  2DYM A;  4B9K A;  2JXX A;  5GXG B;  1TKE A;  3TEZ A;  1LQB A;  5IOI A;  5EE0 A;  1L0Y B;  3AE3 B;  3QK0 A;  2H88 B;  2WDQ B;  2XK5 B;  2IGH A;  3H1U A;  3DHI C;  1QF6 A;  2WGS A;  3IFW B;  4CYE A;  1LFD A;  1E8W A;  2D10 A;  3Q3J A;  2DAJ A;  3HVD A;  4GDL A;  2GMI C;  3QX1 A;  1ET6 A;  4RM9 A;  2AEH A;  2J7Q B;  3NVW A;  2AWT A;  2JT4 B;  5JH5 C;  2DNF A;  2IGG A;  1TY0 A;  2PPH A;  4XGA B;  4KZ0 A;  4XYC A;  4PS7 A;  3DWG C;  4FHJ A;  1WR6 E;  2KNB A;  1EM7 A;  2Y5C A;  2Y3A A;  1XT9 B;  3FIL A;  2ZCC A;  5E6P A;  5AZF A;  2KX3 A;  4TMA B;  3P63 A;  2CHW A;  4BKG A;  2KXJ A;  4TQ0 A;  4P16 A;  3JYU A;  4K3B A;  2E6X A;  3PHX B;  2L0T A;  1RM6 C;  1OTR B;  5EE3 A;  1GG3 A;  2YLM A;  1WIA A;  1WXV A;  2BTE A;  3ZNG C;  3X0W A;  1SJE D;  1FFU A;  2D2Q A;  3R7Q A;  2BKF A;  1WXS A;  3B1L X;  2LJ5 A;  4NQK E;  1V97 A;  3R7R A;  1FFV A;  2WXI A;  1D3Z A;  3DWM A;  1QLB B;  2KYW A;  5DPS A;  1KLV A;  1N5X A;  2G4D B;  2XK5 A;  4ANU A;  1CJE A;  2K5P A;  3AU5 A;  2DZI A;  1KLU D;  2RDB C;  2L32 A;  4IM0 A;  1IGC A;  1Q1O A;  2K6D B;  3MHZ A;  1V80 A;  2KDI A;  2CR5 A;  1SE9 A;  4OVZ A;  3DBH B;  2IGD A;  2J0M A;  2KOX A;  1VZ6 A;  2KN5 A;  3DBL B;  3W5V B;  3JSV A;  3AED B;  2ASQ A;  3PV1 A;  1DOY A;  3CWI A;  2WXJ A;  1AAR A;  3VR9 B;  3APF A;  4KGS A;  3TBL D;  2WXN A;  2JUO A;  5TR5 A;  1VJK A;  4RFB A;  1B9R A;  4GSW A;  4REZ A;  3LB8 C;  2QCZ A;  3AE6 B;  4KV2 A;  1UD7 A;  4HKZ E;  2AL6 A;  4G50 A;  4XDD A;  3N1Z C;  3Q2A C;  1GOZ A;  3VH3 B;  3K9O B;  4YSX B;  2JY6 A;  3QC8 B;  2G45 B;  4ZOH C;  4M01 A;  1TZO A;  2KFK B;  3UI3 A;  2IYD B;  4MGY E;  5I4D A;  4ZYN A;  1TKY A;  1HZ5 A;  3UF8 A;  2HTH A;  5JHB A;  5C3J B;  4M0W A;  2KKC A;  4H2A A;  3A9K B;  4OVU A;  2G3Q B;  1FNW A;  2LWP A;  3DBS A;  3TEY A;  2LGI A;  2KC2 A;  2VRR B;  5FK9 C;  1RLF A;  1KF6 B;  2FCM A;  1K8R B;  3B0A A;  4TV3 A;  2RDH A;  1QZE A;  1NYR A;  1NI2 A;  4TUU A;  2FAZ A;  2KD0 A;  3PGE A;  4P7I A;  4JPS A;  3QAR A;  2XNA C;  2Z8L A;  3Q8E A;  1FM0 D;  5G5H A;  4LJP B;  1Z5S B;  3ZQ4 A;  5IP4 D;  1SE3 A;  2MH7 A;  3L17 A;  2FIF A;  3HM3 A;  4NPN A;  1YN3 A;  2LD9 A;  4DDG D;  4W9C A; 
#chains in the Genus database with same CATH homology
 1XLN A;  2ICI A;  3Q8B A;  1JWM D;  4ZHP A;  3ABV B;  1L6U A;  4GDK B;  1QOF A;  2VZK D;  3O13 A;  3PZ8 A;  1MI0 A;  1GPX A;  2DWQ A;  4OHJ A;  1CQV A;  2J4X A;  4L2Y A;  1MHX A;  4US8 A;  2BT6 A;  2HTM E;  3U52 E;  4LTU A;  1PGA A;  2VZK B;  2WNM A;  2HDE A;  4NAM A;  3IAS 1;  1WRI A;  4WAF A;  1E10 A;  3ZGZ A;  2AQ1 B;  2DYO A;  1PFD A;  1JWB D;  1QOB A;  1ZP0 B;  1TS4 A;  2G9H D;  3P4S B;  5BMG A;  3BYY B;  3U7Z A;  3VRB B;  1Q10 A;  1XCT L;  1E6E B;  1HQR D;  1I4G A;  3FIL B;  3W2D A;  1EU4 A;  1JRP A;  4ZYS A;  2I38 A;  1J7A A;  4DQO C;  4C7Z A;  1F2R I;  2BS3 B;  2K3U A;  3KWL A;  4YTP B;  2W3R A;  3AE4 B;  1ZDX A;  4RGM A;  2W3S A;  3BVZ A;  1ZUD 2;  1C4P A;  1WWT A;  1YJI A;  4NAW B;  5HI1 A;  2M19 A;  2PLP A;  3MJ5 A;  4WQM A;  3P4Q B;  1ESF A;  2JZP A;  2LFI A;  3KQ4 A;  2PIA A;  2I2Y A;  3AM9 A;  1N60 A;  2BBC A;  2D5G A;  1PYW D;  1V1O A;  1C77 A;  4L23 A;  1KH0 A;  2H89 B;  4KX6 B;  1DOX A;  2W54 A;  2WXF A;  3IT6 B;  1C9F A;  2EKI A;  3E56 A;  4O1N A;  3ETR A;  3AN1 A;  4HRS A;  1RWS A;  4IDI A;  1YNT E;  1ACC A;  1F0Z A;  1ZDV A;  4J3O D;  4ITK A;  1VZ7 A;  1IGD A;  4RF0 A;  1JQ4 A;  5JXV A;  2K22 A;  2WP9 B;  2R61 A;  3B2F A;  2N9L A;  4R3D A;  3AEC B;  2JWU A;  2MJD A;  2BS4 B;  3CIR B;  5C2T B;  1JCK B;  3PO0 A;  2AQ3 B;  1R7S A;  4HKQ A;  3AE2 B;  4NJC A;  1FRD A;  2NTS A;  1UGJ A;  2J52 A;  3EGR A;  3GB1 A;  3W9C B;  3SR6 A;  3TEW A;  1PGX A;  1T6B X;  3BII D;  1J7B A;  2WXK A;  2ON8 A;  1OFF A;  3P42 A;  1F2R C;  1AYF A;  2OHF A;  2RPV A;  1KTK A;  5TSS A;  1J7C A;  3VR8 B;  4TQ1 A;  1UNS A;  2L1A A;  3I57 A;  2NTT A;  2CJN A;  2LHE A;  3HRD D;  4OZC A;  1N61 A;  4US9 A;  2DBY A;  3BK1 A;  3TEX A;  4KGR A;  1QT9 A;  1A70 A;  4KKI A;  2YEP B;  2QJL A;  1DGJ A;  2KMM A;  1JWU D;  2KQ4 X;  5G5G A;  1SE4 A;  1UWM A;  1FO4 A;  3AV8 A;  4IOI E;  2N7J A;  1HA5 A;  1WXQ A;  3R8B A;  2AX5 A;  4PT5 A;  1JML A;  4WWM A;  3SFE B;  4XDC A;  2X38 A;  4Q2J A;  1TS3 A;  5AUI A;  1JAL A;  3AEG B;  2WXO A;  2IDY A;  1XXG A;  4LLG M;  3RFZ B;  3P4R B;  2K0P A;  1PUT A;  4WUR A;  2LMC A;  4C7Y A;  1N62 A;  2ZW0 A;  1DOI A;  4RGN A;  2INP E;  1JRO A;  2N9K A;  1YN4 A;  5LNK 1;  5HG2 A;  3ZJT A;  5D3D A;  2ZW1 A;  3NVV A;  1TS5 A;  2JX5 A;  2PKO A;  3IXS A;  4D2K A;  3ZYY X;  4NZL B;  4YWG G;  3E9S A;  4HJG E;  1ZXH A;  2LJI A;  3N9Y C;  1QIL A;  2WLB A;  4USA A;  4MH8 A;  2M56 B;  3P1M A;  2WDR B;  3NVY A;  4WIP A;  3C8Y A;  4L1B A;  1ZE3 D;  1VDV A;  4WH4 A;  2XN9 C;  1VR9 A;  4A90 A;  3V05 A;  1IBX A;  3PZ7 A;  1XF5 L;  2PW9 A;  1XO3 A;  1ZXI A;  2G1E A;  2WXM A;  3Q8C A;  5HHD G;  4YXD B;  4MAC A;  1XLQ A;  4ZHO A;  5BMI A;  3NRZ A;  4LK0 M;  4GLS C;  1SSN A;  4AQ7 A;  1D5Z C;  1I4R A;  1L6V A;  2PMV A;  2WS3 B;  1SXT A;  1L4D B;  2JQR B;  4A6Q A;  4A55 A;  2QEJ C;  2WU5 B;  2FBW B;  2WQY B;  2KN4 A;  2BYT A;  1WGK A;  3AH7 A;  3NVZ A;  5FR3 A;  3RPF C;  4EE2 A;  1KRH A;  1MHH E;  1KLG D;  3GP7 A;  2L83 A;  2IJ0 A;  2W82 A;  1D5X C;  1HZ6 A;  5BYS A;  2V0G A;  4N58 A;  2QIL A;  3SEB A;  1TYG B;  3HUI A;  3W5U B;  3FC4 A;  1I4X A;  1HEZ E;  1SE2 A;  3R2T A;  5BMH A;  1TY2 A;  2DYM A;  4RGT A;  1C79 A;  2LHD A;  5GXG B;  1TKE A;  1GAQ B;  3TEZ A;  4XWW A;  1AN8 A;  1GB1 A;  2LEK A;  4RH6 A;  5AUK A;  5EE0 A;  1L0Y B;  1OQR A;  3AE3 B;  1FCL A;  2H88 B;  2WDQ B;  2IGH A;  2MJE A;  1HXY D;  1GB4 A;  2WXQ A;  2B76 B;  1F77 A;  1BXT A;  4YSZ B;  4C56 C;  1QF6 A;  3AMZ A;  3BZD B;  2INN E;  1KFY B;  1EWY C;  5FKA C;  4TSS A;  4YTN B;  3NS1 A;  3MC0 B;  3BVG A;  3HVD A;  1WYG A;  4DXG A;  2W55 A;  1ET6 A;  3T3O A;  1V1P B;  2WU2 B;  3NVW A;  4MT5 A;  2IGG A;  1TY0 A;  3AE8 B;  1AWD A;  1D6E C;  1XCQ L;  5MPO A;  5D3I B;  1UWX A;  1QOA A;  2WXL A;  4OZA A;  1XEE A;  1L5P A;  2J53 A;  1SBB B;  1M4V A;  2DLB A;  1SEB D;  1T3Q A;  1UUP A;  3DWG C;  1PGB A;  2EEL A;  1E7P B;  1EM7 A;  4XE0 A;  5H8Y E;  3BVM A;  2Y5C A;  2Y3A A;  3FIL A;  1JW9 D;  4OW0 A;  3AEA B;  4TMA B;  1NVI D;  3P63 A;  3AEE B;  1K53 A;  4JX1 C;  2WXH A;  2GRI A;  4TQ0 A;  4CQN A;  4P16 A;  1D4B A;  3VQI A;  1YN5 A;  1L0X B;  2E6X A;  1OQQ A;  2WDV B;  1YMH E;  1RM6 C;  2PVG C;  1I4H A;  1CZP A;  1V8C A;  4JWU C;  1I4Q A;  4YT0 B;  1BUI C;  5EE3 A;  1N5W A;  5BYR A;  2BTE A;  4B0E A;  1QKZ A;  1VRA B;  1SJE D;  3B2G A;  1FFU A;  2GB1 A;  1I4P A;  1RYJ A;  2QMT A;  2ONQ A;  1IBX B;  2J42 A;  1V97 A;  1FD6 A;  4C80 A;  1FFV A;  3TUO A;  1VZ8 A;  3EUB 2;  2WXI A;  2PTL A;  1AW7 A;  2SAK A;  4ARI A;  4DXF A;  3DWM A;  4HEA 1;  4YSY B;  1QLB B;  2SEB D;  1NEK B;  1NEN B;  5EE1 A;  4RGO S;  2BB6 A;  1E0Z A;  1ET9 A;  1N5X A;  3VRA B;  1MVK A;  3W1S A;  3Q8F A;  4RF1 A;  1CJE A;  2K5P A;  2RDG A;  1C4C A;  1MPE A;  1ENF A;  3AEF B;  4ZRQ A;  2RMM A;  1KLU D;  2L32 A;  1QOG A;  3IT4 B;  1IGC A;  1EU3 A;  1Y56 A;  1STE A;  3AE7 B;  5HFY A;  1EWC A;  2QSD A;  4KKJ A;  3V3X A;  1FNU A;  3MHZ A;  1BML C;  3KWV A;  4ARC A;  2FUG 1;  2E3T A;  4FXC A;  4OVZ A;  3URY A;  2TSS A;  4AS1 A;  2IGD A;  1TJE A;  1VZ6 A;  4OZB A;  3AB5 A;  1FXA A;  3W5V B;  3AED B;  1PDX A;  4A9A A;  4RCO A;  1ROE A;  3H8H A;  1YQ3 B;  1DOY A;  3CWI A;  2JYT A;  2GI9 A;  2WXJ A;  3VR9 B;  4KGS A;  2BB5 A;  1E9M A;  1P7F A;  2BS2 B;  3T3N A;  1XLP A;  2FE8 A;  2WXN A;  2NMQ A;  1DYQ A;  4MM3 B;  1NYQ A;  2K9X A;  3LXF A;  2KAJ A;  2BW2 A;  3L4P A;  1VJK A;  4RFB A;  1N63 A;  1B9R A;  1SF0 A;  4REZ A;  1YQ4 B;  3LB8 C;  5T8I A;  2KWD A;  3AE6 B;  3IAM 1;  3Q69 A;  4IKG A;  3LYY A;  4HRO A;  3R2I A;  4JWS C;  1K50 A;  2JSV X;  5EE9 A;  3B9J A;  4HKZ E;  2AQ2 B;  2MEK A;  2Q5W D;  3BWU D;  4XDD A;  2OED A;  1GOZ A;  2V3P A;  4XWT A;  2JXT A;  4YSX B;  2MJ3 A;  4N59 A;  1I7H A;  1VLB A;  1SB3 C;  1FRR A;  3EA6 A;  4ZOH C;  2ACZ B;  1TZO A;  4N6E B;  2Y5P A;  3AE5 B;  3UI3 A;  3WCQ A;  1T5X D;  2L52 A;  2WXP A;  5I4D A;  5H92 C;  1TKY A;  1HZ5 A;  1C78 A;  1FNV A;  1FXI A;  1P7E A;  5C3J B;  4M0W A;  3ZJU A;  4ZRP A;  1YJJ A;  3J9C A;  4H2A A;  1K51 A;  1B1Z A;  3P4P B;  2JU6 X;  3NZ3 A;  1FNW A;  3BK2 A;  1XLO A;  4JE3 B;  3TEY A;  2CU3 A;  1D5M C;  4GDL B;  2WXR A;  1C76 A;  2LGI A;  2KAC A;  5FK9 C;  3U2S C;  3NUH B;  4KGT A;  1KF6 B;  2RDH A;  5E6J A;  1NYR A;  1IUE A;  4A8X C;  1L0V B;  3MFG A;  3SFD B;  1JWS D;  2V4I B;  4JPS A;  3AE1 B;  2XNA C;  3MP9 A;  2IPK D;  1WSP A;  2Z8L A;  1SIJ A;  3Q8E A;  1FM0 D;  1TKG A;  1LO5 D;  1ZPS A;  2M0A A;  3OWE B;  2LUM A;  1FEH A;  3FAH A;  1JWA D;  1CK1 A;  4RNA A;  1SJH D;  1V1P A;  4P6V F;  5G5H A;  2N0S B;  3KLS X;  3HVZ A;  1RFK A;  3AEB B;  3U4E G;  3ZJV A;  2YEP F;  1NI3 A;  1FCC C;  2PVO D;  3ZQ4 A;  5BYQ A;  2WXG A;  3Q8A A;  5D7G A;  4B0M A;  1QQR A;  1SE3 A;  2MH7 A;  3AE9 B;  3I9V 1;  2V3N A;  1K52 A;  1ZOY B;  2JYE A;  1C4A A;  2KDM A;  3BYT B;  4YTM B;  1YN3 A;  3TSS A;  1L4Z B;  1FIQ A;  4UDU C;  1TS2 A;  3GS2 A;  2CJO A;  2QIE B;  1FMA D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...