1C79A

Staphylokinase (sak) dimer
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
130
structure length
130
Chain Sequence
GKYKKGDDASYFEPTGPYLMVNVTGVDGKGNELLSPHYVEFPIKPGTTLTKEKIEYYVEWALDATAYKEFRVVELDPSAKIEVTYYDKNKKKEETKSFPITEKGFVVPDLSEHIKNPGFNLITKVVIEKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords STAPHYLOKINASE
publication title Crystal structure of a staphylokinase: variant a model for reduced antigenicity.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 22
structure length 130
sequence length 130
chains with identical sequence B
ec nomenclature ec 3.4.24.29: Aureolysin.
pdb deposition date 2000-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02821 Staphylokinase Staphylokinase/Streptokinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.130 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1c79A00
1C79A 1BUIC 1C76A 1C77A 1C78A 1SSNA 2SAKA
chains in the Genus database with same CATH superfamily
3VR8B 1WIAA 4B0MA 2J4XA 3ZNHB 4KSKC 3U52E 2G9HD 1ROEA 2L83A 4AOFA 1GOZA 2MSED 2Z8LA 3MC8A 5BYSA 2ZZPB 3QQ8B 1YJIA 2YEPB 3HM3A 2K0PA 1YX5B 3TCAA 3HK0A 2PW9A 4REZA 2WXMA 3JVZX 1SIFA 1QILA 1VDVA 4YTPB 1N5WA 4NY0A 2MJDA 1H8CA 3NUHB 4LNOA 1I4HA 1YQ4B 3TIXA 4IWOA 4M0WA 3A4SC 3PLVA 5HI1A 3ZNZB 1YNTE 4JIOU 1N60A 3JSVB 3TEZA 4W9KA 3VVWB 3IFWB 2G4SA 3AE5B 2AQ1B 4AUQC 4XC2A 1D5MC 1FNVA 4DK5A 1UBQA 2DENB 2MWSB 3TSSA 3ZNID 4B0EA 2D3CA 1LGRA 1PUTA 1NI2A 3V60A 1L4ZB 3PREA 4MJSA 1C4CA 2L7RA 3LYYA 2HTHA 2LRWA 2FIFA 3RZFA 3GP7A 1QOAA 4IKGA 1IUEA 4M02A 4P1CC 3R2IA 1KLUD 4W9LA 1WXVA 5E6PA 3AEEB 3APDA 4FULA 1LFDA 2KYWA 1WX7A 3M62B 2WHIA 1ZP0B 2PPHA 2JQRB 4S17A 3ZKJC 4PS3A 3RPFC 2UWQA 3CF6E 4EFOA 2ZVOA 5AUKA 1KLVA 2JU6X 2C60A 3DBLB 3TUOA 2MX2A 1ZKHA 2VH1A 1WGDA 2G1EA 2PE6B 1XF5L 2Z59B 1V1PB 3U4EG 2MBHA 2D11A 3Q8BA 3W5VB 3A4RA 3KUZA 3VH4B 5BMGA 4YTNB 4GOCA 3PGEA 2GBMA 4MJSB 3Q3FA 3QCAA 5IN7A 2QILA 2C7HA 4OZCA 1IP9A 4TMAB 3P4SB 1P9DU 2K8CA 1JALA 3D32A 1V80A 2CR5A 4GN1A 3UINB 4JE3B 5E6NA 2KNBA 1FXTB 4CO7A 4YSXB 1IPGA 3RMKC 3WAOA 4CHKA 4HVBA 1KF6B 2LUEA 1SEBD 4ZRKA 3PLUA 2EKEC 3APFA 3M95A 1NI3A 2HJ1A 1RFKA 3FILA 1E8ZA 4NJ7A 2WXJA 4O1NA 3PV1A 1PGAA 1RFAA 2AQ2B 4YSZB 3NZUA 3Q2AC 1QT9A 4HWIB 1E9MA 1P3QU 3O13A 1OQYA 1J0GA 1TT5B 5GMVA 2ACZB 2EKIA 3APCA 3ZO5B 2GLSA 1SE9A 4BOZB 4OVVA 3A1QB 3V6EB 2CJOA 3KVFB 1TZOA 3AECB 3AXCA 2WYQA 2KHWB 2FBWB 4TKNA 2K22A 1MG4A 3I3TB 5KHOA 4AS1A 4KX6B 2KO3A 2M1MA 3EGRA 2AYOB 3WCQA 2V9HA 3I5JC 1XLOA 1YQBA 2DZKA 2IPKD 1V2YA 3ALBA 4BKTA 4ZRPA 4JQWC 4RFBA 3CMMB 3L54A 1I4XA 1TYGB 3FILB 2KQ7A 2BWES 4LDTB 1WXMA 3U7ZA 1V5TA 2MA9B 3Q3NC 4I6NB 2BQQA 2OOBB 3AE4B 1L6VA 4IWQA 4MH0E 4GLSC 1K8RB 1FNUA 4RF1A 4US9A 4RGMA 1EUVB 2KANA 1LM8B 2OHFA 4N58A 2V3NA 4FHJA 1XLQA 2M17A 3P4PB 1SGHA 2MHJA 2WU2B 2O6VA 2OJWA 1VD2A 1UWXA 2DZMA 1T6BX 2WQYB 2I2YA 1E0ZA 2QCZA 4YWGG 3AEDB 4XZ4A 1NYQA 3VTVA 1I7HA 5T8IA 1WGKA 4XE0A 4ZRJA 4W9JA 4A8XC 2DZJA 1YD8U 5CHFA 5BYQA 5EE1A 1T0YA 2W82A 3OJ3A 3Q14C 3RD2A 1JRUA 2QDFA 3MC0B 2CHXA 3SR6A 3LXFA 2BT6A 2K5PA 2NVUI 2BTEA 1WGRA 3W2DA 3NS8A 1STEA 1C1YB 4JWSC 3R8BA 2BB6A 1V81A 2KDIA 1OGWA 3E9SA 1YQ3B 2LJ5A 2MEKA 3C0RB 4N59A 3RNCC 1IBXA 3ML8A 3BK1A 2O6VB 2LMCA 2O2VA 4W9HA 2ZEQA 2VRRB 1EWCA 1AW7A 4GU2A 3DHIC 2L1AA 1V1OA 3NRZA 4K7WA 4N9F4 4RM9A 5J18A 4HLEA 3KH0A 2WX1A 1V97A 2NPTA 3LJ3A 4KIKB 1T0QC 2RDGA 4D2KA 1JCKB 1DOIA 4OZBA 3BVZA 3ONSA 2WDTB 3ZW3A 5JHAA 2J7QB 3N32A 3H6NA 3CSFA 3A9KB 2KWDA 1RLFA 4ARCA 2PVGC 1P7FA 3P4RB 1VZ8A 2IY1B 2FCQA 2ZJDA 1RWSA 4EZJA 5DPTA 2B76B 2BS2B 3FKYA 4WAAA 1TGZB 4A9AA 4HCNB 1D5XC 3N9YC 2M4NA 1D5ZC 2LEKA 2MRPA 3W1SA 2KWCA 3L08A 2O2VB 1EU3A 2IO0B 3B1LX 4NQKE 4US8A 2XN9C 4PT5A 4EOYA 3UQBA 4KKIA 3VTUA 3DVGY 1OFFA 4HEA1 2RGFA 2AL3A 2XK5B 2NPTB 3AEBB 1S1QB 3C19A 1ZOYB 4LTUA 3VRBB 1P1AA 1YIWA 1JQ4A 3AE6B 2BGFA 1HZ5A 4AP4C 3ZQ4A 2FUHB 4UDUC 1QOGA 1WY8A 1B1ZA 2KVZA 2L3ZA 3RNAC 1XXGA 4TQ1A 2M8SA 2FCNA 2I1KA 1UBIA 2M0AA 1QLBB 1WSPA 3VQIA 3AB5A 4HJKA 3VUWA 3GE3C 1R4NB 2AQ3B 1TTNA 3A9JA 4CQNA 1N5XA 1ET6A 1KFYB 3ZUNA 1BXTA 3KLSX 1EO6A 2LRUA 1K52A 1OEYA 3NVWA 2LD9A 4F1SA 3ZXRA 2WXGA 4GIVA 3N30A 4M8MA 2W9NA 3NS1A 4K3CA 3KYCD 1N6ZA 5I4DA 4ANWA 2LASA 3VDZA 2Z0EB 3QJZA 3EFCA 2WS3B 3BY4B 1DYQA 3DPDA 4FADA 2WU5B 4K1RB 4EE2A 4AWJA 1T0RC 2E3TA 4DHZE 1NDDA 3PS6A 2D07B 4M00A 2OEDA 3PZDA 1ZPSA 2WXHA 1FRRA 1P0RA 2AX5A 5BMIA 4GDKA 2KVRA 4MELA 2R61A 1TJEA 3BWUD 1BT0A 2IO2B 3ZXVA 3NHEB 3R2TA 1T3QA 4KKJA 1E8YA 1V5OA 2BWFA 4BBNF 1DOYA 2GBRA 3OWEB 2IDYA 3A9JB 1TY0A 2JXTA 5D6JB 2INDC 4P6VF 4LJOB 2ICIA 4HPLB 4IOIE 1YN3A 2NMQA 4L2YA 2PEAA 3TEXA 4JGHB 3MP9A 4IM0A 2KMCA 3SDLC 4PYUA 3J9CA 2J0JA 3O65B 4AJWA 2N9LA 1RRBA 3Q8FA 2BYFA 2PVOD 4XX5A 4ZHOA 1VR9A 2KJRA 4PK1A 2GRIA 4K7SA 1WXSA 4AJYB 1WJNA 5JXVA 2FUG1 3Q69A 4HK2A 4EKUA 2BKRB 2GBKA 3L0WB 3GZNI 3UGBB 5BMHA 3HVDA 2PLPA 3NY5A 2G3QB 1KOTA 4ANVA 5HKHA 1V1PA 4ICVA 1QQRA 4GDKB 3N1YC 3VFKA 2EELA 1WRDB 4LCDE 1SE4A 3AMZA 3T8MA 3AEFB 5J2RA 2K8HA 1YN5A 2QEJC 3NZSA 4GDLA 4II2B 3I57A 4C80A 1WR6E 3PPAA 3KWLA 3FAHA 2H88B 1WF9A 4MEMA 4BBNC 2G4DB 5EE0A 2N7JA 4QAYA 3ZIMA 3DVGX 1WX9A 1CMXB 1Y56A 2BW2A 2NBVB 3SD5A 2B3AA 2N4FA 4MT5A 1ISNA 1JWAD 1L5PA 2TSSA 1WJ6A 3P42A 2V0GA 4GXBA 1SJED 5DPWA 3IVFA 1QF6A 4MH8A 4P1BC 2WDQB 4KDLB 5AEKB 1G6JA 2K39A 4DHJD 4NAWB 2LGIA 4II3B 2DX5B 1E7UA 2N7EA 4BKSA 1QOFA 4WQMA 4F7ZA 2PMVA 4YSYB 3ZJTA 2WDRB 3AE8B 1FCCC 3AE2B 2BVCA 2WXIA 3UIOB 2JWUA 4B95A 2HTME 1MPEA 1QOBA 3V6CB 1F1HA 2ZCCA 1WE6A 5HHDG 1HEZE 4ZDVA 2REXA 3VR9B 1HE8A 4RM8A 1TIFA 3VRAB 2JSVX 4GDLB 2JZZA 5H92C 1WGHA 2UYZB 1FPYA 1XT9B 2KT7A 4DXAB 2L76A 4WH4A 1KJTA 5MPOA 1WWTA 4W9IA 4W9FA 2HE7A 4MM3A 3W1SC 2N9XA 4WJPA 2J0MA 1UGJA 2AWTA 3A1QA 2FCSA 2YEPF 4KSLC 4LJPB 4B9KA 5IP4D 2KMMA 5E6JA 3R3MA 4FN2A 2K6QA 3PHXB 2LGSA 1C78A 3PRMB 3B2GA 3DDCB 3R7QA 2YLMA 3V05A 2WLBA 1YJ1A 1WM2A 1E5WA 4DXGA 2MBOA 3WALA 2ZNVC 1ZW7A 2VZKD 1BMLC 3SEBA 4MSMB 4DDID 3GOEA 3PSEB 4OVZA 2MQJA 2NTSA 2W3RA 1WGGA 2LXCA 3HRDD 3DBHI 4URKA 1GC7A 3RNGC 1BUIC 3AE3B 3PRPB 1MHHE 4L1BA 1VZ6A 1SE3A 2QMTA 1YOVB 4RGTA 2KDFB 2PTLA 4MM3B 2CS4A 1HXYD 3L16A 2PIAA 4P16A 3OJ4B 3RULA 1C9FA 2LXAA 1ZDVA 2D3BA 4PS7A 4LNNA 2VH2A 2JF5A 1I4RA 2KJHB 3TMPB 3RNFC 1FMAD 3H1UA 3I63C 2I38A 2KC1A 4W9CA 2C5LC 2KXJA 5LXIB 1F9JA 3EUB2 3RZWC 5LLIA 2N9PC 3BVMA 3B9JA 1I42A 2IY0B 2L8JA 3ZJUA 2MBEA 5IO9A 3H7PA 2INPE 3MFGA 2JYTA 3NVVA 1M4VA 4C00A 4XGAB 1WM3A 2DYOA 1A70A 1TZ1A 1FEHA 3LDZE 1NEKB 3TBLD 1GG3A 2M19A 1L0XB 2R2QA 3RNEC 1MFWA 3Q3MC 3TEYA 4IG7B 1JRPA 1L2NA 1SB3C 2KZRA 3BINA 2D3AA 1LQBA 1L7YA 1WYWB 3SHQA 3TEWA 1K50A 4FXCA 4ZRIA 3MJ5A 2V4IB 1D3ZA 1FCLA 4KGRA 2QSDA 4WWNA 1GUAB 1KRHA 1XCTL 2GB1A 2WXOA 2FNJB 1DOXA 3UQAA 3QHTA 2J53A 3JYUA 1T0SC 1F2RC 4DHZB 1MVKA 3H7PB 2LHEA 4LNIA 4KIKA 1UH6A 4WJQA 2KX3A 2IBIB 2RD0A 1TKYA 4RMAA 4ASWC 3CWIA 3BIID 1YN4A 4DWFA 3A9KA 4WWPA 5D94A 4GB9A 1NYRA 1IGCA 1WMHA 2ONQA 2Q5WD 2SAKA 1WYGA 4OW0A 2L00B 2L52A 3Q3JA 1VRAB 4K7UA 3WIMA 3N20C 2KTFA 1F77A 2A4ZA 4C4VA 2BS4B 2NTTA 4KDIC 1B9RA 1VZ7A 3K9PB 5G5HA 1J8CA 3V3XA 2CU3A 4FHKA 4BOSC 1GAQB 2KLCA 1UELA 3IAS1 3DCGA 3PRZA 2WNMA 4P7IA 3KW5B 2ZPYA 1V9JA 3ETRA 2FCMA 1TS5A 4HPPA 1ZGUB 2JVCA 5FKAC 2BYEA 4ZYNA 2IGHA 2XK5A 1C4AA 3QIJA 2UU7A 4TSSA 1JW9D 3AEAB 2GMIC 2RSUA 4DQOC 4XWTA 2IZVB 3R66C 3NG0A 3AEGB 3ZJVA 5IOIA 2FIDA 3DHGC 2RPQA 3JW0X 3UI3A 4DXFA 1RM6C 5EDSA 1WMHB 5CHVC 3OLMD 1TKEA 2YVCA 4XYCA 5CX3A 4ZHPA 4A3OA 3PHWB 1UZXB 3V61A 2L0FA 4PYZA 3MJWA 2BF8B 3EC8A 4LNKA 1PGBA 1PYWD 2LI5A 1MI0A 1T5XD 1N63A 5BO4B 4C4VB 2JRHA 1F0ZA 4IUMB 3ZRFA 3DOWA 4HPMB 4HDOA 1VJKA 4M8NA 4R3DA 3B08A 4MGKE 4LLGM 1R4MI 2WWZA 2K25A 2Y3AA 5IA7A 2W55A 2SEBD 3I9V1 4RCOA 5H8YE 5G2NA 2INNE 5D2MB 2JRIB 2KDEB 4YL8A 1YMHE 4AQ7A 5DPRA 1OEYJ 5GXGB 1WRIA 2MH7A 4DBGA 1S3SG 2ZCBA 4ZYSA 4WWOA 3MHSD 4FBJB 3N1ZC 1ET9A 1PFDA 2K9XA 1FRDA 1Q0WB 3P2BA 5TSSA 1SF0A 2R2OA 2DZIA 3VUXA 2JYEA 1H4RA 1WJ4A 2DNFA 1J7CA 1I4QA 2D2QA 2LGXA 2WGSA 1XLNA 2KN5A 3L10B 3IT4B 4HKQA 4XDCA 2M0XA 2D3GA 1K53A 3Q8EA 4X57B 2HD5B 3ECIA 3T9LA 1AWDA 1NENB 2A5UA 2LZ6A 2C7MB 2IGDA 3R7RA 3DBRI 2L0TA 2JX5A 1PGXA 2CU1A 2KTRA 3ABVB 2WXRA 5FR6A 4G11A 2KD0A 3NVYA 2H89B 3UF8A 4NZLB 4JX1C 4G50A 2MBQA 5C2TB 1KM7A 2BYTA 1OQRA 4ARIA 1FD6A 2JWZA 2KK8A 3PZ7A 3W9CB 2LVPA 5C3JB 3Q3OC 1JWUD 4YXDB 2EMSA 4OVUA 3DBRB 2JUOA 3EHVA 3ZRCA 2D5GA 3AE7B 3E56A 4TUUA 5HFYA 1EF5A 4MACA 3V62A 3NVZA 3DVNU 1GNUA 3Q8CA 2BS3B 2RR9A 2V1YA 2BYVE 2K3UA 2Y5CA 4NQLB 2GBNA 3T3NA 1FO4A 2HJ8A 2X8XX 1J7AA 5L95C 4DHJB 2MLBA 1X1MA 3IT6B 1N61A 2NCNA 4BKGA 1ZXIA 2ZPNA 4J6IA 1FXIA 2KTRB 4NNJB 2J52A 4WWMA 2BPSA 2IO3B 3T3OA 1ZE3D 2Y5BB 4NAWA 4MGYE 4KVGB 4BVUC 4IDIA 1GJZA 3DHHC 1C79A 3B0AA 2CHZA 1C3TA 4K81A 1UNSA 3GS2A 1TS2A 3WAMA 5FK9C 3IG3A 1ZUD2 4JWUC 3PT2B 1TY2A 3CIRB 3BYTB 4EZLA 2DWQA 2MBBB 1LO5D 1J19A 3ZNGC 1KH0A 3RT3B 3WA0A 2CHWA 1JWMD 1Z2MA 1C4PA 1V86A 1L0YB 3EECA 1F52A 5TR5A 2ASQA 4F8CB 1XCQL 3QC8B 1P98A 3GZNB 2DAJA 4WAFA 2LWPA 3IXSA 1Q5WB 4BZAA 3L13A 2GBJA 5JHBA 4WURA 2JZPA 4HXDA 1WZ0A 1MJDA 1WGYA 3AH7A 3HUIA 3MTNB 1PQSA 2WDVB 4WJOA 3B2FA 4W9DA 4FA6A 1F2RI 2WXQA 1GC6A 2VZKB 2XEWA 2LHDA 2ZW1A 4JLCA 4J3OD 3DBLI 2KAJA 3FC4A 3EFUA 4I6PA 3AV8A 3HHMA 1WX8A 2KACA 1K51A 1M94A 3GE8C 1RYJA 1TKGA 2K8BA 3S2AA 5AZHA 1XQQA 4A20A 4KV2A 1E7VA 2DYMA 1EF1A 3HIZA 1WJUA 1TS3A 4C7YA 2PJHA 2JT4B 4HROA 2L05A 4OHJA 2KQ4X 1HZ6A 4M0WB 2BKFA 1UD7A 4KZ0A 4W9EA 4LNFA 2DAFA 4EUTA 1HTOA 1I35A 1FNWA 1SJHD 4B6WA 1L4DB 1FFVA 2KC2A 3GB1A 2ZW0A 3DWMA 3BVGA 1CK1A 2KFKA 4E74A 2WXPA 5EE9A 2L32A 4WJNA 3SU8X 1I4PA 4I6LB 1UWMA 3QWZB 2N9KA 2G45B 2NBUA 2LGYA 5JZEB 2LJIA 2MW5A 3RUIB 4OZAA 2KLGA 3IAM1 3VAWA 5G55A 3M63B 2K6DB 2N9EB 3AI5A 3L4PA 4JL9A 4RGNA 4ZOHC 2MP2A 4N6EB 1AYFA 4ANUA 5KHQA 2N7DA 4FLHA 3RFZB 1CJEA 4A55A 2HDEA 3VXWA 3H8HA 4YT0B 5EE3A 2KN4A 3N1XC 1UGMA 1HQRD 1GB4A 3H7SA 4G0NB 3Q6BA 2J0KA 3U30A 1Z5SB 3RN9C 2KQSA 3TL5A 3QARA 3VUYA 3ZYYX 2KFKB 3BZDB 5HG2A 2I1JA 2LFIA 3ZTDA 5D3IB 1E8XA 3DBHB 4S0RA 2N1WA 1L6UA 4TQ0A 1MHXA 2IO1B 3RI7C 4L23A 5CTRC 2Y5PA 1I4GA 3VHTC 1Q10A 2IGGA 3ZDMC 2KWVB 1SBBB 3URYA 3X0WA 1MG8A 1NVID 2X38A 1JMLA 4E71A 3ENEA 2LUMA 4PS8A 1U4AA 4YTMB 4HJGE 2NS5A 4NJ6A 1TBEA 3IBEA 4IWPA 2Z0DB 1FXAA 2MP2B 3SFDB 3Q8AA 5DCNA 2QJLA 2PE9A 5L83A 1TS4A 4IW0A 1ACCA 1YX6B 2XBBC 4NAMA 4IC7B 2N1VA 3A33B 2RDBC 2KOXA 4WQOB 3NZ3A 3AU5A 3LB8C 4BKSD 3QK0A 1SE2A 2QHOA 1C77A 4HKZE 2KJ6A 1KTKA 2V4LA 4USAA 5FR3A 3AE1B 3KUDB 3ML9A 4LK0M 1EU4A 2GOWA 1D6EC 3KQ4A 4A90A 3WAPA 2D10A 1P7EA 2WP9B 1E10A 1JROA 3DQVA 3VTWA 4ZRQA 4CYEA 1V49A 2WXNA 5AZGA 3IHPC 1D4BA 2FAZA 1WZ3A 2M56B 3SFEB 5AZFA 5AUIA 2V3PA 5E6OA 3OG5A 2RMMA 4TV3A 1V8CA 2WX0A 1KLGD 1HTQA 2ON8A 1ZDXA 1QKZA 4K3BA 3AU4A 3U2SC 2LVQA 1WXQA 2KMAA 5C1ZA 1XD3B 4HCPB 3ZGZA 1E6EB 2KKCA 5C23A 3TJPA 2PKOA 3RNBC 1N62A 1E7PB 1YJJA 3N3KB 1WR1A 2IYDB 5DPSA 3BK2A 2E6XA 3UIPB 4LDTD 4EZKA 2NR2A 2DLBA 2RDHA 3MHZA 1EM7A 2BBCA 1JWSD 2K1FA 1E90A 2ZVNA 3PO0A 1WFYA 2V3SA 1WH3A 4MSQB 5D7GA 4A6QA 4KGTA 3ZVVA 1CQVA 5CHWA 2W3SA 1ESFA 4NJCA 1XO3A 1E8WA 4WIPA 1HA5A 1UF0A 4FJZA 3C8YA 3AE9B 3KYDD 5G5GA 5D3DA 4XWWA 1Y8RC 4XDDA 1J7BA 3BYYB 2WXKA 4RNAA 4NPNA 2XNAC 1ENFA 2GI9A 4ICUA 4IM3A 4MDKE 1FM0D 3KUCB 4FJYA 2QC8A 1SIJA 2JZ3B 2JXXA 1UUPA 2DHZA 1Q1OA 3KWVA 1OQQA 2WXFA 3W1YA 4JPSA 4C7ZA 2QIEB 2C7NB 4KGSA 3ZDTA 2CJNA 3PZ8A 1OTRB 1VLBA 3AULA 2WXLA 2NBWB 2MJEA 1RAXA 4GSWA 4BFRA 1VCBA 3VH3B 4C56C 5IKCM 3M3JA 3EA6A 2EMTA 1IYFA 4G3XB 1R7SA 1SSNA 1SXTA 1XEEA 1IBXB 1FIQA 3QX1A 2KDMA 3WANA 4MGIE 2MCNB 1AARA 3QAQA 4Q2JA 1R4MB 5J17A 2O6VD 2AEHA 4RF0A 3HM6X 1WI0A 2IJ0A 3P4QB 1R4NI 3H9DA 4HRSA 3P63A 3DBSA 1L0VB 4BAXA 3W5UB 1WXAA 1EWYC 3CSTA 3U7DA 1WE7A 5LNK1 3P1MA 2KX0A 4M01A 4HDQA 2J42A 1NBFC 3NJTA 4FJVB 1JWBD 1C76A 2KDBA 4DDGD 1PDXA 4GMVA 3ZTCA 1A5RA 4RGOS 5LXHA 4EEWA 3L17A 3RYTA 2FE8A 2JY6A 2JPHA 4ACFA 1CZPA 3AN1A 4H2AA 5BYRA 1ZXHA 3PTFC 2MJ3A 4RH6A 5JH5C 2W54A 3DWGC 3X23A 4GGQA 2N0SB 2LVOA 3NOBA 2DYBA 5IAAC 3OAWA 1QZEA 4ANXA 4W9GA 4KZCA 4MGZE 1DGJA 2BB5A 3DVNV 3HVZA 3RCZA 4E3CA 3PVLA 4A3PA 3QA8A 2C9WB 1AN8A 2INCC 2RPVA 2KFJA 1IGDA 4ITKA 2ZNVB 2KWUB 1GPXA 2AL6A 2OJRA 1XLPA 3MC9A 2DBYA 3JSVA 4IM2A 3ZLZA 2CKHB 1V6EA 1FFUA 3AM9A 1LXDA 3K9OB 1GB1A 3U8ZA 2LGDA
chains in the Genus database with same CATH topology
2WXPA 3VR8B 3TEWA 5EE9A 1D5ZC 1K50A 4FXCA 4B0MA 2J4XA 2L32A 3MJ5A 2LEKA 2V4IB 3U52E 1FCLA 2G9HD 2QSDA 4KGRA 1ROEA 3W1SA 1I4PA 2L83A 1GOZA 1KRHA 1XCTL 1UWMA 1EU3A 2N9KA 2GB1A 2WXOA 2Z8LA 1DOXA 2LJIA 5BYSA 1YJIA 4OZAA 2J53A 2YEPB 2XN9C 4PT5A 4US8A 3IAM1 1F2RC 2K0PA 4KKIA 1OFFA 4HEA1 1MVKA 2LHEA 3L4PA 4RGNA 2PW9A 3AEBB 4REZA 2WXMA 1TKYA 4ZOHC 1ZOYB 1QILA 4LTUA 1VDVA 3CWIA 3BIID 1N5WA 1YN4A 4N6EB 1AYFA 4YTPB 3VRBB 1JQ4A 3AE6B 2MJDA 3NUHB 1HZ5A 1I4HA 1NYRA 1IGCA 1YQ4B 3ZQ4A 4M0WA 3RFZB 1CJEA 2ONQA 2Q5WD 4A55A 2SAKA 4UDUC 5HI1A 2HDEA 3H8HA 1QOGA 1YNTE 1WYGA 1B1ZA 1XXGA 4YT0B 4TQ1A 5EE3A 4OW0A 1N60A 2KN4A 2L52A 1VRAB 2M0AA 3TEZA 1QLBB 1HQRD 3AE5B 1WSPA 3VQIA 1GB4A 1F77A 2AQ1B 3AB5A 1D5MC 1FNVA 2BS4B 2NTTA 2AQ3B 3TSSA 3ZYYX 4CQNA 3BZDB 1B9RA 1N5XA 1VZ7A 5G5HA 5HG2A 4B0EA 1ET6A 1KFYB 1PUTA 1BXTA 1L4ZB 2LFIA 5D3IB 3KLSX 2CU3A 3V3XA 1K52A 3NVWA 1C4CA 1L6UA 2WXGA 4TQ0A 1MHXA 3LYYA 4L23A 1GAQB 3IAS1 2Y5PA 1I4GA 2WNMA 3NS1A 3GP7A 1Q10A 1QOAA 2IGGA 4IKGA 1IUEA 5I4DA 3ETRA 1SBBB 3URYA 3R2IA 1KLUD 3AEEB 1TS5A 5FKAC 1NVID 2WS3B 2X38A 2IGHA 1JMLA 1ZP0B 1C4AA 1DYQA 2JQRB 4TSSA 1JW9D 2LUMA 3AEAB 4YTMB 4HJGE 2WU5B 4DQOC 4XWTA 3RPFC 4EE2A 1FXAA 3SFDB 3Q8AA 3AEGB 2QJLA 5AUKA 3ZJVA 2E3TA 2JU6X 1TS4A 3TUOA 3UI3A 4DXFA 2OEDA 1ACCA 1RM6C 4NAMA 1ZPSA 1TKEA 2G1EA 1XF5L 2WXHA 4ZHPA 3NZ3A 1FRRA 2AX5A 5BMIA 1V1PB 3LB8C 2R61A 1TJEA 3BWUD 3U4EG 1SE2A 3R2TA 1T3QA 1C77A 1PGBA 1PYWD 4KKJA 4HKZE 3Q8BA 3W5VB 1MI0A 1T5XD 1DOYA 1KTKA 4USAA 5FR3A 1N63A 3AE1B 1F0ZA 3OWEB 2IDYA 4LK0M 1TY0A 1EU4A 2JXTA 5BMGA 1D6EC 3KQ4A 4YTNB 4A90A 4P6VF 1VJKA 4R3DA 1P7EA 2WP9B 1E10A 2ICIA 4LLGM 1JROA 4IOIE 1YN3A 2QILA 2NMQA 4L2YA 4ZRQA 4OZCA 3TEXA 3MP9A 4TMAB 2Y3AA 3P4SB 2WXNA 2W55A 2SEBD 3I9V1 3J9CA 4RCOA 1JALA 5H8YE 1D4BA 2INNE 2N9LA 2M56B 4JE3B 3SFEB 3Q8FA 2PVOD 1YMHE 4AQ7A 5AUIA 2V3PA 5GXGB 1WRIA 2MH7A 2RMMA 4ZHOA 1V8CA 4YSXB 1VR9A 1KLGD 3ZJTA 2GRIA 2ON8A 4ZYSA 1KF6B 1ZDXA 2FUG1 3Q69A 5JXVA 1QKZA 1SEBD 3U2SC 1ET9A 1PFDA 1WXQA 2K9XA 1FRDA 5TSSA 1NI3A 5BMHA 3HVDA 2PLPA 1SF0A 1RFKA 3FILA 2WXJA 4O1NA 1V1PA 1QQRA 1PGAA 2JYEA 4GDKB 2EELA 2AQ2B 4YSZB 1SE4A 3AMZA 3AEFB 1J7CA 1QT9A 1E9MA 1I4QA 1E6EB 3ZGZA 1XLNA 1YN5A 2QEJC 3I57A 3IT4B 3O13A 4HKQA 4XDCA 4C80A 2PKOA 2ACZB 2EKIA 1N62A 3KWLA 1K53A 3FAHA 3Q8EA 1E7PB 1YJJA 2H88B 5EE0A 3BK2A 2E6XA 2N7JA 2DLBA 2RDHA 1Y56A 1AWDA 2BW2A 1NENB 3MHZA 1EM7A 2BBCA 1JWSD 4MT5A 1JWAD 2IGDA 1L5PA 2TSSA 3PO0A 2JX5A 3P42A 5D7GA 1PGXA 2V0GA 3ABVB 2WXRA 4A6QA 2CJOA 4KGTA 1TZOA 1CQVA 1SJED 2H89B 3AECB 2W3SA 3NVYA 1QF6A 4MH8A 4NZLB 4JX1C 2WDQB 1ESFA 2FBWB 4NJCA 1XO3A 5C2TB 2K22A 4WIPA 4NAWB 2BYTA 1OQRA 2LGIA 4AS1A 4ARIA 1FD6A 4KX6B 3PZ7A 3W9CB 1HA5A 1QOFA 3EGRA 4WQMA 3WCQA 2PMVA 5C3JB 4YSYB 1JWUD 3C8YA 3AE9B 1XLOA 2WDRB 3AE8B 5D3DA 1FCCC 3AE2B 4XDDA 5G5GA 1J7BA 2WXIA 4YXDB 4XWWA 2JWUA 3BYYB 2WXKA 4RNAA 2IPKD 2HTME 2XNAC 1ENFA 1MPEA 1QOBA 4ZRPA 2GI9A 4RFBA 5HHDG 1FM0D 1I4XA 1HEZE 1TYGB 3FILB 2D5GA 3AE7B 1SIJA 3E56A 3VR9B 5HFYA 1UUPA 3KWVA 1OQQA 4MACA 3NVZA 2WXFA 3Q8CA 4JPSA 3U7ZA 4C7ZA 2QIEB 3VRAB 2JSVX 2BS3B 4GDLB 4KGSA 3AE4B 1L6VA 2K3UA 2Y5CA 5H92C 2CJNA 3T3NA 1FO4A 3PZ8A 4WH4A 4GLSC 1J7AA 1FNUA 1VLBA 2WXLA 3N9YC 4RF1A 4US9A 5MPOA 1WWTA 2MJEA 4RGMA 4C56C 3IT6B 2OHFA 1N61A 3EA6A 1UGJA 1ZXIA 2YEPF 4N58A 2V3NA 1XLQA 1R7SA 2KMMA 1FXIA 2J52A 3P4PB 5E6JA 1SSNA 4WWMA 3T3OA 1ZE3D 2WU2B 1SXTA 1XEEA 1IBXB 1FIQA 2KDMA 1C78A 4IDIA 1UWXA 1T6BX 3B2GA 2WQYB 1C79A 2I2YA 1E0ZA 4Q2JA 4YWGG 1UNSA 3GS2A 1TS2A 3V05A 5FK9C 3AEDB 1ZUD2 2WLBA 4JWUC 1NYQA 1TY2A 3CIRB 3BYTB 4DXGA 2DWQA 4RF0A 1LO5D 1I7HA 5T8IA 1WGKA 1BMLC 2VZKD 2IJ0A 3SEBA 4OVZA 4XE0A 3P4QB 1KH0A 4A8XC 2NTSA 4HRSA 1JWMD 5BYQA 5EE1A 3P63A 1C4PA 2W82A 1L0VB 1L0YB 3W5UB 2W3RA 3HRDD 1EWYC 3MC0B 3SR6A 3LXFA 2BT6A 1BUIC 2K5PA 3AE3B 5LNK1 2BTEA 3P1MA 1XCQL 3W2DA 1MHHE 4L1BA 2J42A 4WAFA 1STEA 3IXSA 1VZ6A 1SE3A 2QMTA 1JWBD 1C76A 4RGTA 2PTLA 1PDXA 4MM3B 4JWSC 4WURA 3R8BA 4RGOS 2JZPA 2BB6A 1HXYD 2PIAA 4P16A 3E9SA 2FE8A 1YQ3B 2MEKA 4N59A 1C9FA 3AH7A 3HUIA 1CZPA 3AN1A 1ZDVA 2WDVB 4H2AA 3B2FA 1IBXA 5BYRA 1ZXHA 1I4RA 3BK1A 1F2RI 1FMAD 2WXQA 2I38A 2LMCA 2MJ3A 4RH6A 2VZKB 2W54A 2LHDA 3DWGC 2ZW1A 1EWCA 4J3OD 2KAJA 1AW7A 3EUB2 3FC4A 2L1AA 3AV8A 1V1OA 3NRZA 3BVMA 2KACA 2N0SB 3B9JA 1K51A 3ZJUA 1RYJA 1TKGA 1V97A 2RDGA 4D2KA 1JCKB 1DOIA 2INPE 3MFGA 1DGJA 2JYTA 2BB5A 4OZBA 3NVVA 1M4VA 3HVZA 3BVZA 2DYMA 2DYOA 2KWDA 1A70A 4ARCA 1TS3A 2PVGC 1FEHA 4C7YA 1AN8A 1P7FA 2RPVA 1IGDA 1NEKB 3P4RB 4HROA 1VZ8A 4ITKA 2M19A 1L0XB 4OHJA 1GPXA 2KQ4X 1HZ6A 1RWSA 1XLPA 1FNWA 1SJHD 2B76B 3TEYA 2BS2B 2DBYA 1L4DB 1JRPA 1FFUA 3AM9A 1FFVA 1SB3C 1GB1A 3GB1A 4A9AA 2ZW0A 3DWMA 3BVGA 1D5XC 1CK1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1C79 A;  1BUI C;  1C76 A;  1C77 A;  1C78 A;  1SSN A;  2SAK A; 
#chains in the Genus database with same CATH topology
 3VR8 B;  1WIA A;  4B0M A;  2J4X A;  3ZNH B;  4KSK C;  3U52 E;  2G9H D;  1ROE A;  2L83 A;  4AOF A;  1GOZ A;  2MSE D;  2Z8L A;  3MC8 A;  5BYS A;  2ZZP B;  3QQ8 B;  1YJI A;  2YEP B;  3HM3 A;  2K0P A;  1YX5 B;  3TCA A;  3HK0 A;  2PW9 A;  4REZ A;  2WXM A;  3JVZ X;  1SIF A;  1QIL A;  1VDV A;  4YTP B;  1N5W A;  4NY0 A;  2MJD A;  1H8C A;  3NUH B;  4LNO A;  1I4H A;  1YQ4 B;  3TIX A;  4IWO A;  4M0W A;  3A4S C;  3PLV A;  5HI1 A;  3ZNZ B;  1YNT E;  4JIO U;  1N60 A;  3JSV B;  3TEZ A;  4W9K A;  3VVW B;  3IFW B;  2G4S A;  3AE5 B;  2AQ1 B;  4AUQ C;  4XC2 A;  1D5M C;  1FNV A;  4DK5 A;  1UBQ A;  2DEN B;  2MWS B;  3TSS A;  3ZNI D;  4B0E A;  2D3C A;  1LGR A;  1PUT A;  1NI2 A;  3V60 A;  1L4Z B;  3PRE A;  4MJS A;  1C4C A;  2L7R A;  3LYY A;  2HTH A;  2LRW A;  2FIF A;  3RZF A;  3GP7 A;  1QOA A;  4IKG A;  1IUE A;  4M02 A;  4P1C C;  3R2I A;  1KLU D;  4W9L A;  1WXV A;  5E6P A;  3AEE B;  3APD A;  4FUL A;  1LFD A;  2KYW A;  1WX7 A;  3M62 B;  2WHI A;  1ZP0 B;  2PPH A;  2JQR B;  4S17 A;  3ZKJ C;  4PS3 A;  3RPF C;  2UWQ A;  3CF6 E;  4EFO A;  2ZVO A;  5AUK A;  1KLV A;  2JU6 X;  2C60 A;  3DBL B;  3TUO A;  2MX2 A;  1ZKH A;  2VH1 A;  1WGD A;  2G1E A;  2PE6 B;  1XF5 L;  2Z59 B;  1V1P B;  3U4E G;  2MBH A;  2D11 A;  3Q8B A;  3W5V B;  3A4R A;  3KUZ A;  3VH4 B;  5BMG A;  4YTN B;  4GOC A;  3PGE A;  2GBM A;  4MJS B;  3Q3F A;  3QCA A;  5IN7 A;  2QIL A;  2C7H A;  4OZC A;  1IP9 A;  4TMA B;  3P4S B;  1P9D U;  2K8C A;  1JAL A;  3D32 A;  1V80 A;  2CR5 A;  4GN1 A;  3UIN B;  4JE3 B;  5E6N A;  2KNB A;  1FXT B;  4CO7 A;  4YSX B;  1IPG A;  3RMK C;  3WAO A;  4CHK A;  4HVB A;  1KF6 B;  2LUE A;  1SEB D;  4ZRK A;  3PLU A;  2EKE C;  3APF A;  3M95 A;  1NI3 A;  2HJ1 A;  1RFK A;  3FIL A;  1E8Z A;  4NJ7 A;  2WXJ A;  4O1N A;  3PV1 A;  1PGA A;  1RFA A;  2AQ2 B;  4YSZ B;  3NZU A;  3Q2A C;  1QT9 A;  4HWI B;  1E9M A;  1P3Q U;  3O13 A;  1OQY A;  1J0G A;  1TT5 B;  5GMV A;  2ACZ B;  2EKI A;  3APC A;  3ZO5 B;  2GLS A;  1SE9 A;  4BOZ B;  4OVV A;  3A1Q B;  3V6E B;  2CJO A;  3KVF B;  1TZO A;  3AEC B;  3AXC A;  2WYQ A;  2KHW B;  2FBW B;  4TKN A;  2K22 A;  1MG4 A;  3I3T B;  5KHO A;  4AS1 A;  4KX6 B;  2KO3 A;  2M1M A;  3EGR A;  2AYO B;  3WCQ A;  2V9H A;  3I5J C;  1XLO A;  1YQB A;  2DZK A;  2IPK D;  1V2Y A;  3ALB A;  4BKT A;  4ZRP A;  4JQW C;  4RFB A;  3CMM B;  3L54 A;  1I4X A;  1TYG B;  3FIL B;  2KQ7 A;  2BWE S;  4LDT B;  1WXM A;  3U7Z A;  1V5T A;  2MA9 B;  3Q3N C;  4I6N B;  2BQQ A;  2OOB B;  3AE4 B;  1L6V A;  4IWQ A;  4MH0 E;  4GLS C;  1K8R B;  1FNU A;  4RF1 A;  4US9 A;  4RGM A;  1EUV B;  2KAN A;  1LM8 B;  2OHF A;  4N58 A;  2V3N A;  4FHJ A;  1XLQ A;  2M17 A;  3P4P B;  1SGH A;  2MHJ A;  2WU2 B;  2O6V A;  2OJW A;  1VD2 A;  1UWX A;  2DZM A;  1T6B X;  2WQY B;  2I2Y A;  1E0Z A;  2QCZ A;  4YWG G;  3AED B;  4XZ4 A;  1NYQ A;  3VTV A;  1I7H A;  5T8I A;  1WGK A;  4XE0 A;  4ZRJ A;  4W9J A;  4A8X C;  2DZJ A;  1YD8 U;  5CHF A;  5BYQ A;  5EE1 A;  1T0Y A;  2W82 A;  3OJ3 A;  3Q14 C;  3RD2 A;  1JRU A;  2QDF A;  3MC0 B;  2CHX A;  3SR6 A;  3LXF A;  2BT6 A;  2K5P A;  2NVU I;  2BTE A;  1WGR A;  3W2D A;  3NS8 A;  1STE A;  1C1Y B;  4JWS C;  3R8B A;  2BB6 A;  1V81 A;  2KDI A;  1OGW A;  3E9S A;  1YQ3 B;  2LJ5 A;  2MEK A;  3C0R B;  4N59 A;  3RNC C;  1IBX A;  3ML8 A;  3BK1 A;  2O6V B;  2LMC A;  2O2V A;  4W9H A;  2ZEQ A;  2VRR B;  1EWC A;  1AW7 A;  4GU2 A;  3DHI C;  2L1A A;  1V1O A;  3NRZ A;  4K7W A;  4N9F 4;  4RM9 A;  5J18 A;  4HLE A;  3KH0 A;  2WX1 A;  1V97 A;  2NPT A;  3LJ3 A;  4KIK B;  1T0Q C;  2RDG A;  4D2K A;  1JCK B;  1DOI A;  4OZB A;  3BVZ A;  3ONS A;  2WDT B;  3ZW3 A;  5JHA A;  2J7Q B;  3N32 A;  3H6N A;  3CSF A;  3A9K B;  2KWD A;  1RLF A;  4ARC A;  2PVG C;  1P7F A;  3P4R B;  1VZ8 A;  2IY1 B;  2FCQ A;  2ZJD A;  1RWS A;  4EZJ A;  5DPT A;  2B76 B;  2BS2 B;  3FKY A;  4WAA A;  1TGZ B;  4A9A A;  4HCN B;  1D5X C;  3N9Y C;  2M4N A;  1D5Z C;  2LEK A;  2MRP A;  3W1S A;  2KWC A;  3L08 A;  2O2V B;  1EU3 A;  2IO0 B;  3B1L X;  4NQK E;  4US8 A;  2XN9 C;  4PT5 A;  4EOY A;  3UQB A;  4KKI A;  3VTU A;  3DVG Y;  1OFF A;  4HEA 1;  2RGF A;  2AL3 A;  2XK5 B;  2NPT B;  3AEB B;  1S1Q B;  3C19 A;  1ZOY B;  4LTU A;  3VRB B;  1P1A A;  1YIW A;  1JQ4 A;  3AE6 B;  2BGF A;  1HZ5 A;  4AP4 C;  3ZQ4 A;  2FUH B;  4UDU C;  1QOG A;  1WY8 A;  1B1Z A;  2KVZ A;  2L3Z A;  3RNA C;  1XXG A;  4TQ1 A;  2M8S A;  2FCN A;  2I1K A;  1UBI A;  2M0A A;  1QLB B;  1WSP A;  3VQI A;  3AB5 A;  4HJK A;  3VUW A;  3GE3 C;  1R4N B;  2AQ3 B;  1TTN A;  3A9J A;  4CQN A;  1N5X A;  1ET6 A;  1KFY B;  3ZUN A;  1BXT A;  3KLS X;  1EO6 A;  2LRU A;  1K52 A;  1OEY A;  3NVW A;  2LD9 A;  4F1S A;  3ZXR A;  2WXG A;  4GIV A;  3N30 A;  4M8M A;  2W9N A;  3NS1 A;  4K3C A;  3KYC D;  1N6Z A;  5I4D A;  4ANW A;  2LAS A;  3VDZ A;  2Z0E B;  3QJZ A;  3EFC A;  2WS3 B;  3BY4 B;  1DYQ A;  3DPD A;  4FAD A;  2WU5 B;  4K1R B;  4EE2 A;  4AWJ A;  1T0R C;  2E3T A;  4DHZ E;  1NDD A;  3PS6 A;  2D07 B;  4M00 A;  2OED A;  3PZD A;  1ZPS A;  2WXH A;  1FRR A;  1P0R A;  2AX5 A;  5BMI A;  4GDK A;  2KVR A;  4MEL A;  2R61 A;  1TJE A;  3BWU D;  1BT0 A;  2IO2 B;  3ZXV A;  3NHE B;  3R2T A;  1T3Q A;  4KKJ A;  1E8Y A;  1V5O A;  2BWF A;  4BBN F;  1DOY A;  2GBR A;  3OWE B;  2IDY A;  3A9J B;  1TY0 A;  2JXT A;  5D6J B;  2IND C;  4P6V F;  4LJO B;  2ICI A;  4HPL B;  4IOI E;  1YN3 A;  2NMQ A;  4L2Y A;  2PEA A;  3TEX A;  4JGH B;  3MP9 A;  4IM0 A;  2KMC A;  3SDL C;  4PYU A;  3J9C A;  2J0J A;  3O65 B;  4AJW A;  2N9L A;  1RRB A;  3Q8F A;  2BYF A;  2PVO D;  4XX5 A;  4ZHO A;  1VR9 A;  2KJR A;  4PK1 A;  2GRI A;  4K7S A;  1WXS A;  4AJY B;  1WJN A;  5JXV A;  2FUG 1;  3Q69 A;  4HK2 A;  4EKU A;  2BKR B;  2GBK A;  3L0W B;  3GZN I;  3UGB B;  5BMH A;  3HVD A;  2PLP A;  3NY5 A;  2G3Q B;  1KOT A;  4ANV A;  5HKH A;  1V1P A;  4ICV A;  1QQR A;  4GDK B;  3N1Y C;  3VFK A;  2EEL A;  1WRD B;  4LCD E;  1SE4 A;  3AMZ A;  3T8M A;  3AEF B;  5J2R A;  2K8H A;  1YN5 A;  2QEJ C;  3NZS A;  4GDL A;  4II2 B;  3I57 A;  4C80 A;  1WR6 E;  3PPA A;  3KWL A;  3FAH A;  2H88 B;  1WF9 A;  4MEM A;  4BBN C;  2G4D B;  5EE0 A;  2N7J A;  4QAY A;  3ZIM A;  3DVG X;  1WX9 A;  1CMX B;  1Y56 A;  2BW2 A;  2NBV B;  3SD5 A;  2B3A A;  2N4F A;  4MT5 A;  1ISN A;  1JWA D;  1L5P A;  2TSS A;  1WJ6 A;  3P42 A;  2V0G A;  4GXB A;  1SJE D;  5DPW A;  3IVF A;  1QF6 A;  4MH8 A;  4P1B C;  2WDQ B;  4KDL B;  5AEK B;  1G6J A;  2K39 A;  4DHJ D;  4NAW B;  2LGI A;  4II3 B;  2DX5 B;  1E7U A;  2N7E A;  4BKS A;  1QOF A;  4WQM A;  4F7Z A;  2PMV A;  4YSY B;  3ZJT A;  2WDR B;  3AE8 B;  1FCC C;  3AE2 B;  2BVC A;  2WXI A;  3UIO B;  2JWU A;  4B95 A;  2HTM E;  1MPE A;  1QOB A;  3V6C B;  1F1H A;  2ZCC A;  1WE6 A;  5HHD G;  1HEZ E;  4ZDV A;  2REX A;  3VR9 B;  1HE8 A;  4RM8 A;  1TIF A;  3VRA B;  2JSV X;  4GDL B;  2JZZ A;  5H92 C;  1WGH A;  2UYZ B;  1FPY A;  1XT9 B;  2KT7 A;  4DXA B;  2L76 A;  4WH4 A;  1KJT A;  5MPO A;  1WWT A;  4W9I A;  4W9F A;  2HE7 A;  4MM3 A;  3W1S C;  2N9X A;  4WJP A;  2J0M A;  1UGJ A;  2AWT A;  3A1Q A;  2FCS A;  2YEP F;  4KSL C;  4LJP B;  4B9K A;  5IP4 D;  2KMM A;  5E6J A;  3R3M A;  4FN2 A;  2K6Q A;  3PHX B;  2LGS A;  1C78 A;  3PRM B;  3B2G A;  3DDC B;  3R7Q A;  2YLM A;  3V05 A;  2WLB A;  1YJ1 A;  1WM2 A;  1E5W A;  4DXG A;  2MBO A;  3WAL A;  2ZNV C;  1ZW7 A;  2VZK D;  1BML C;  3SEB A;  4MSM B;  4DDI D;  3GOE A;  3PSE B;  4OVZ A;  2MQJ A;  2NTS A;  2W3R A;  1WGG A;  2LXC A;  3HRD D;  3DBH I;  4URK A;  1GC7 A;  3RNG C;  1BUI C;  3AE3 B;  3PRP B;  1MHH E;  4L1B A;  1VZ6 A;  1SE3 A;  2QMT A;  1YOV B;  4RGT A;  2KDF B;  2PTL A;  4MM3 B;  2CS4 A;  1HXY D;  3L16 A;  2PIA A;  4P16 A;  3OJ4 B;  3RUL A;  1C9F A;  2LXA A;  1ZDV A;  2D3B A;  4PS7 A;  4LNN A;  2VH2 A;  2JF5 A;  1I4R A;  2KJH B;  3TMP B;  3RNF C;  1FMA D;  3H1U A;  3I63 C;  2I38 A;  2KC1 A;  4W9C A;  2C5L C;  2KXJ A;  5LXI B;  1F9J A;  3EUB 2;  3RZW C;  5LLI A;  2N9P C;  3BVM A;  3B9J A;  1I42 A;  2IY0 B;  2L8J A;  3ZJU A;  2MBE A;  5IO9 A;  3H7P A;  2INP E;  3MFG A;  2JYT A;  3NVV A;  1M4V A;  4C00 A;  4XGA B;  1WM3 A;  2DYO A;  1A70 A;  1TZ1 A;  1FEH A;  3LDZ E;  1NEK B;  3TBL D;  1GG3 A;  2M19 A;  1L0X B;  2R2Q A;  3RNE C;  1MFW A;  3Q3M C;  3TEY A;  4IG7 B;  1JRP A;  1L2N A;  1SB3 C;  2KZR A;  3BIN A;  2D3A A;  1LQB A;  1L7Y A;  1WYW B;  3SHQ A;  3TEW A;  1K50 A;  4FXC A;  4ZRI A;  3MJ5 A;  2V4I B;  1D3Z A;  1FCL A;  4KGR A;  2QSD A;  4WWN A;  1GUA B;  1KRH A;  1XCT L;  2GB1 A;  2WXO A;  2FNJ B;  1DOX A;  3UQA A;  3QHT A;  2J53 A;  3JYU A;  1T0S C;  1F2R C;  4DHZ B;  1MVK A;  3H7P B;  2LHE A;  4LNI A;  4KIK A;  1UH6 A;  4WJQ A;  2KX3 A;  2IBI B;  2RD0 A;  1TKY A;  4RMA A;  4ASW C;  3CWI A;  3BII D;  1YN4 A;  4DWF A;  3A9K A;  4WWP A;  5D94 A;  4GB9 A;  1NYR A;  1IGC A;  1WMH A;  2ONQ A;  2Q5W D;  2SAK A;  1WYG A;  4OW0 A;  2L00 B;  2L52 A;  3Q3J A;  1VRA B;  4K7U A;  3WIM A;  3N20 C;  2KTF A;  1F77 A;  2A4Z A;  4C4V A;  2BS4 B;  2NTT A;  4KDI C;  1B9R A;  1VZ7 A;  3K9P B;  5G5H A;  1J8C A;  3V3X A;  2CU3 A;  4FHK A;  4BOS C;  1GAQ B;  2KLC A;  1UEL A;  3IAS 1;  3DCG A;  3PRZ A;  2WNM A;  4P7I A;  3KW5 B;  2ZPY A;  1V9J A;  3ETR A;  2FCM A;  1TS5 A;  4HPP A;  1ZGU B;  2JVC A;  5FKA C;  2BYE A;  4ZYN A;  2IGH A;  2XK5 A;  1C4A A;  3QIJ A;  2UU7 A;  4TSS A;  1JW9 D;  3AEA B;  2GMI C;  2RSU A;  4DQO C;  4XWT A;  2IZV B;  3R66 C;  3NG0 A;  3AEG B;  3ZJV A;  5IOI A;  2FID A;  3DHG C;  2RPQ A;  3JW0 X;  3UI3 A;  4DXF A;  1RM6 C;  5EDS A;  1WMH B;  5CHV C;  3OLM D;  1TKE A;  2YVC A;  4XYC A;  5CX3 A;  4ZHP A;  4A3O A;  3PHW B;  1UZX B;  3V61 A;  2L0F A;  4PYZ A;  3MJW A;  2BF8 B;  3EC8 A;  4LNK A;  1PGB A;  1PYW D;  2LI5 A;  1MI0 A;  1T5X D;  1N63 A;  5BO4 B;  4C4V B;  2JRH A;  1F0Z A;  4IUM B;  3ZRF A;  3DOW A;  4HPM B;  4HDO A;  1VJK A;  4M8N A;  4R3D A;  3B08 A;  4MGK E;  4LLG M;  1R4M I;  2WWZ A;  2K25 A;  2Y3A A;  5IA7 A;  2W55 A;  2SEB D;  3I9V 1;  4RCO A;  5H8Y E;  5G2N A;  2INN E;  5D2M B;  2JRI B;  2KDE B;  4YL8 A;  1YMH E;  4AQ7 A;  5DPR A;  1OEY J;  5GXG B;  1WRI A;  2MH7 A;  4DBG A;  1S3S G;  2ZCB A;  4ZYS A;  4WWO A;  3MHS D;  4FBJ B;  3N1Z C;  1ET9 A;  1PFD A;  2K9X A;  1FRD A;  1Q0W B;  3P2B A;  5TSS A;  1SF0 A;  2R2O A;  2DZI A;  3VUX A;  2JYE A;  1H4R A;  1WJ4 A;  2DNF A;  1J7C A;  1I4Q A;  2D2Q A;  2LGX A;  2WGS A;  1XLN A;  2KN5 A;  3L10 B;  3IT4 B;  4HKQ A;  4XDC A;  2M0X A;  2D3G A;  1K53 A;  3Q8E A;  4X57 B;  2HD5 B;  3ECI A;  3T9L A;  1AWD A;  1NEN B;  2A5U A;  2LZ6 A;  2C7M B;  2IGD A;  3R7R A;  3DBR I;  2L0T A;  2JX5 A;  1PGX A;  2CU1 A;  2KTR A;  3ABV B;  2WXR A;  5FR6 A;  4G11 A;  2KD0 A;  3NVY A;  2H89 B;  3UF8 A;  4NZL B;  4JX1 C;  4G50 A;  2MBQ A;  5C2T B;  1KM7 A;  2BYT A;  1OQR A;  4ARI A;  1FD6 A;  2JWZ A;  2KK8 A;  3PZ7 A;  3W9C B;  2LVP A;  5C3J B;  3Q3O C;  1JWU D;  4YXD B;  2EMS A;  4OVU A;  3DBR B;  2JUO A;  3EHV A;  3ZRC A;  2D5G A;  3AE7 B;  3E56 A;  4TUU A;  5HFY A;  1EF5 A;  4MAC A;  3V62 A;  3NVZ A;  3DVN U;  1GNU A;  3Q8C A;  2BS3 B;  2RR9 A;  2V1Y A;  2BYV E;  2K3U A;  2Y5C A;  4NQL B;  2GBN A;  3T3N A;  1FO4 A;  2HJ8 A;  2X8X X;  1J7A A;  5L95 C;  4DHJ B;  2MLB A;  1X1M A;  3IT6 B;  1N61 A;  2NCN A;  4BKG A;  1ZXI A;  2ZPN A;  4J6I A;  1FXI A;  2KTR B;  4NNJ B;  2J52 A;  4WWM A;  2BPS A;  2IO3 B;  3T3O A;  1ZE3 D;  2Y5B B;  4NAW A;  4MGY E;  4KVG B;  4BVU C;  4IDI A;  1GJZ A;  3DHH C;  1C79 A;  3B0A A;  2CHZ A;  1C3T A;  4K81 A;  1UNS A;  3GS2 A;  1TS2 A;  3WAM A;  5FK9 C;  3IG3 A;  1ZUD 2;  4JWU C;  3PT2 B;  1TY2 A;  3CIR B;  3BYT B;  4EZL A;  2DWQ A;  2MBB B;  1LO5 D;  1J19 A;  3ZNG C;  1KH0 A;  3RT3 B;  3WA0 A;  2CHW A;  1JWM D;  1Z2M A;  1C4P A;  1V86 A;  1L0Y B;  3EEC A;  1F52 A;  5TR5 A;  2ASQ A;  4F8C B;  1XCQ L;  3QC8 B;  1P98 A;  3GZN B;  2DAJ A;  4WAF A;  2LWP A;  3IXS A;  1Q5W B;  4BZA A;  3L13 A;  2GBJ A;  5JHB A;  4WUR A;  2JZP A;  4HXD A;  1WZ0 A;  1MJD A;  1WGY A;  3AH7 A;  3HUI A;  3MTN B;  1PQS A;  2WDV B;  4WJO A;  3B2F A;  4W9D A;  4FA6 A;  1F2R I;  2WXQ A;  1GC6 A;  2VZK B;  2XEW A;  2LHD A;  2ZW1 A;  4JLC A;  4J3O D;  3DBL I;  2KAJ A;  3FC4 A;  3EFU A;  4I6P A;  3AV8 A;  3HHM A;  1WX8 A;  2KAC A;  1K51 A;  1M94 A;  3GE8 C;  1RYJ A;  1TKG A;  2K8B A;  3S2A A;  5AZH A;  1XQQ A;  4A20 A;  4KV2 A;  1E7V A;  2DYM A;  1EF1 A;  3HIZ A;  1WJU A;  1TS3 A;  4C7Y A;  2PJH A;  2JT4 B;  4HRO A;  2L05 A;  4OHJ A;  2KQ4 X;  1HZ6 A;  4M0W B;  2BKF A;  1UD7 A;  4KZ0 A;  4W9E A;  4LNF A;  2DAF A;  4EUT A;  1HTO A;  1I35 A;  1FNW A;  1SJH D;  4B6W A;  1L4D B;  1FFV A;  2KC2 A;  3GB1 A;  2ZW0 A;  3DWM A;  3BVG A;  1CK1 A;  2KFK A;  4E74 A;  2WXP A;  5EE9 A;  2L32 A;  4WJN A;  3SU8 X;  1I4P A;  4I6L B;  1UWM A;  3QWZ B;  2N9K A;  2G45 B;  2NBU A;  2LGY A;  5JZE B;  2LJI A;  2MW5 A;  3RUI B;  4OZA A;  2KLG A;  3IAM 1;  3VAW A;  5G55 A;  3M63 B;  2K6D B;  2N9E B;  3AI5 A;  3L4P A;  4JL9 A;  4RGN A;  4ZOH C;  2MP2 A;  4N6E B;  1AYF A;  4ANU A;  5KHQ A;  2N7D A;  4FLH A;  3RFZ B;  1CJE A;  4A55 A;  2HDE A;  3VXW A;  3H8H A;  4YT0 B;  5EE3 A;  2KN4 A;  3N1X C;  1UGM A;  1HQR D;  1GB4 A;  3H7S A;  4G0N B;  3Q6B A;  2J0K A;  3U30 A;  1Z5S B;  3RN9 C;  2KQS A;  3TL5 A;  3QAR A;  3VUY A;  3ZYY X;  2KFK B;  3BZD B;  5HG2 A;  2I1J A;  2LFI A;  3ZTD A;  5D3I B;  1E8X A;  3DBH B;  4S0R A;  2N1W A;  1L6U A;  4TQ0 A;  1MHX A;  2IO1 B;  3RI7 C;  4L23 A;  5CTR C;  2Y5P A;  1I4G A;  3VHT C;  1Q10 A;  2IGG A;  3ZDM C;  2KWV B;  1SBB B;  3URY A;  3X0W A;  1MG8 A;  1NVI D;  2X38 A;  1JML A;  4E71 A;  3ENE A;  2LUM A;  4PS8 A;  1U4A A;  4YTM B;  4HJG E;  2NS5 A;  4NJ6 A;  1TBE A;  3IBE A;  4IWP A;  2Z0D B;  1FXA A;  2MP2 B;  3SFD B;  3Q8A A;  5DCN A;  2QJL A;  2PE9 A;  5L83 A;  1TS4 A;  4IW0 A;  1ACC A;  1YX6 B;  2XBB C;  4NAM A;  4IC7 B;  2N1V A;  3A33 B;  2RDB C;  2KOX A;  4WQO B;  3NZ3 A;  3AU5 A;  3LB8 C;  4BKS D;  3QK0 A;  1SE2 A;  2QHO A;  1C77 A;  4HKZ E;  2KJ6 A;  1KTK A;  2V4L A;  4USA A;  5FR3 A;  3AE1 B;  3KUD B;  3ML9 A;  4LK0 M;  1EU4 A;  2GOW A;  1D6E C;  3KQ4 A;  4A90 A;  3WAP A;  2D10 A;  1P7E A;  2WP9 B;  1E10 A;  1JRO A;  3DQV A;  3VTW A;  4ZRQ A;  4CYE A;  1V49 A;  2WXN A;  5AZG A;  3IHP C;  1D4B A;  2FAZ A;  1WZ3 A;  2M56 B;  3SFE B;  5AZF A;  5AUI A;  2V3P A;  5E6O A;  3OG5 A;  2RMM A;  4TV3 A;  1V8C A;  2WX0 A;  1KLG D;  1HTQ A;  2ON8 A;  1ZDX A;  1QKZ A;  4K3B A;  3AU4 A;  3U2S C;  2LVQ A;  1WXQ A;  2KMA A;  5C1Z A;  1XD3 B;  4HCP B;  3ZGZ A;  1E6E B;  2KKC A;  5C23 A;  3TJP A;  2PKO A;  3RNB C;  1N62 A;  1E7P B;  1YJJ A;  3N3K B;  1WR1 A;  2IYD B;  5DPS A;  3BK2 A;  2E6X A;  3UIP B;  4LDT D;  4EZK A;  2NR2 A;  2DLB A;  2RDH A;  3MHZ A;  1EM7 A;  2BBC A;  1JWS D;  2K1F A;  1E90 A;  2ZVN A;  3PO0 A;  1WFY A;  2V3S A;  1WH3 A;  4MSQ B;  5D7G A;  4A6Q A;  4KGT A;  3ZVV A;  1CQV A;  5CHW A;  2W3S A;  1ESF A;  4NJC A;  1XO3 A;  1E8W A;  4WIP A;  1HA5 A;  1UF0 A;  4FJZ A;  3C8Y A;  3AE9 B;  3KYD D;  5G5G A;  5D3D A;  4XWW A;  1Y8R C;  4XDD A;  1J7B A;  3BYY B;  2WXK A;  4RNA A;  4NPN A;  2XNA C;  1ENF A;  2GI9 A;  4ICU A;  4IM3 A;  4MDK E;  1FM0 D;  3KUC B;  4FJY A;  2QC8 A;  1SIJ A;  2JZ3 B;  2JXX A;  1UUP A;  2DHZ A;  1Q1O A;  3KWV A;  1OQQ A;  2WXF A;  3W1Y A;  4JPS A;  4C7Z A;  2QIE B;  2C7N B;  4KGS A;  3ZDT A;  2CJN A;  3PZ8 A;  1OTR B;  1VLB A;  3AUL A;  2WXL A;  2NBW B;  2MJE A;  1RAX A;  4GSW A;  4BFR A;  1VCB A;  3VH3 B;  4C56 C;  5IKC M;  3M3J A;  3EA6 A;  2EMT A;  1IYF A;  4G3X B;  1R7S A;  1SSN A;  1SXT A;  1XEE A;  1IBX B;  1FIQ A;  3QX1 A;  2KDM A;  3WAN A;  4MGI E;  2MCN B;  1AAR A;  3QAQ A;  4Q2J A;  1R4M B;  5J17 A;  2O6V D;  2AEH A;  4RF0 A;  3HM6 X;  1WI0 A;  2IJ0 A;  3P4Q B;  1R4N I;  3H9D A;  4HRS A;  3P63 A;  3DBS A;  1L0V B;  4BAX A;  3W5U B;  1WXA A;  1EWY C;  3CST A;  3U7D A;  1WE7 A;  5LNK 1;  3P1M A;  2KX0 A;  4M01 A;  4HDQ A;  2J42 A;  1NBF C;  3NJT A;  4FJV B;  1JWB D;  1C76 A;  2KDB A;  4DDG D;  1PDX A;  4GMV A;  3ZTC A;  1A5R A;  4RGO S;  5LXH A;  4EEW A;  3L17 A;  3RYT A;  2FE8 A;  2JY6 A;  2JPH A;  4ACF A;  1CZP A;  3AN1 A;  4H2A A;  5BYR A;  1ZXH A;  3PTF C;  2MJ3 A;  4RH6 A;  5JH5 C;  2W54 A;  3DWG C;  3X23 A;  4GGQ A;  2N0S B;  2LVO A;  3NOB A;  2DYB A;  5IAA C;  3OAW A;  1QZE A;  4ANX A;  4W9G A;  4KZC A;  4MGZ E;  1DGJ A;  2BB5 A;  3DVN V;  3HVZ A;  3RCZ A;  4E3C A;  3PVL A;  4A3P A;  3QA8 A;  2C9W B;  1AN8 A;  2INC C;  2RPV A;  2KFJ A;  1IGD A;  4ITK A;  2ZNV B;  2KWU B;  1GPX A;  2AL6 A;  2OJR A;  1XLP A;  3MC9 A;  2DBY A;  3JSV A;  4IM2 A;  3ZLZ A;  2CKH B;  1V6E A;  1FFU A;  3AM9 A;  1LXD A;  3K9O B;  1GB1 A;  3U8Z A;  2LGD A; 
#chains in the Genus database with same CATH homology
 2WXP A;  3VR8 B;  3TEW A;  5EE9 A;  1D5Z C;  1K50 A;  4FXC A;  4B0M A;  2J4X A;  2L32 A;  3MJ5 A;  2LEK A;  2V4I B;  3U52 E;  1FCL A;  2G9H D;  2QSD A;  4KGR A;  1ROE A;  3W1S A;  1I4P A;  2L83 A;  1GOZ A;  1KRH A;  1XCT L;  1UWM A;  1EU3 A;  2N9K A;  2GB1 A;  2WXO A;  2Z8L A;  1DOX A;  2LJI A;  5BYS A;  1YJI A;  4OZA A;  2J53 A;  2YEP B;  2XN9 C;  4PT5 A;  4US8 A;  3IAM 1;  1F2R C;  2K0P A;  4KKI A;  1OFF A;  4HEA 1;  1MVK A;  2LHE A;  3L4P A;  4RGN A;  2PW9 A;  3AEB B;  4REZ A;  2WXM A;  1TKY A;  4ZOH C;  1ZOY B;  1QIL A;  4LTU A;  1VDV A;  3CWI A;  3BII D;  1N5W A;  1YN4 A;  4N6E B;  1AYF A;  4YTP B;  3VRB B;  1JQ4 A;  3AE6 B;  2MJD A;  3NUH B;  1HZ5 A;  1I4H A;  1NYR A;  1IGC A;  1YQ4 B;  3ZQ4 A;  4M0W A;  3RFZ B;  1CJE A;  2ONQ A;  2Q5W D;  4A55 A;  2SAK A;  4UDU C;  5HI1 A;  2HDE A;  3H8H A;  1QOG A;  1YNT E;  1WYG A;  1B1Z A;  1XXG A;  4YT0 B;  4TQ1 A;  5EE3 A;  4OW0 A;  1N60 A;  2KN4 A;  2L52 A;  1VRA B;  2M0A A;  3TEZ A;  1QLB B;  1HQR D;  3AE5 B;  1WSP A;  3VQI A;  1GB4 A;  1F77 A;  2AQ1 B;  3AB5 A;  1D5M C;  1FNV A;  2BS4 B;  2NTT A;  2AQ3 B;  3TSS A;  3ZYY X;  4CQN A;  3BZD B;  1B9R A;  1N5X A;  1VZ7 A;  5G5H A;  5HG2 A;  4B0E A;  1ET6 A;  1KFY B;  1PUT A;  1BXT A;  1L4Z B;  2LFI A;  5D3I B;  3KLS X;  2CU3 A;  3V3X A;  1K52 A;  3NVW A;  1C4C A;  1L6U A;  2WXG A;  4TQ0 A;  1MHX A;  3LYY A;  4L23 A;  1GAQ B;  3IAS 1;  2Y5P A;  1I4G A;  2WNM A;  3NS1 A;  3GP7 A;  1Q10 A;  1QOA A;  2IGG A;  4IKG A;  1IUE A;  5I4D A;  3ETR A;  1SBB B;  3URY A;  3R2I A;  1KLU D;  3AEE B;  1TS5 A;  5FKA C;  1NVI D;  2WS3 B;  2X38 A;  2IGH A;  1JML A;  1ZP0 B;  1C4A A;  1DYQ A;  2JQR B;  4TSS A;  1JW9 D;  2LUM A;  3AEA B;  4YTM B;  4HJG E;  2WU5 B;  4DQO C;  4XWT A;  3RPF C;  4EE2 A;  1FXA A;  3SFD B;  3Q8A A;  3AEG B;  2QJL A;  5AUK A;  3ZJV A;  2E3T A;  2JU6 X;  1TS4 A;  3TUO A;  3UI3 A;  4DXF A;  2OED A;  1ACC A;  1RM6 C;  4NAM A;  1ZPS A;  1TKE A;  2G1E A;  1XF5 L;  2WXH A;  4ZHP A;  3NZ3 A;  1FRR A;  2AX5 A;  5BMI A;  1V1P B;  3LB8 C;  2R61 A;  1TJE A;  3BWU D;  3U4E G;  1SE2 A;  3R2T A;  1T3Q A;  1C77 A;  1PGB A;  1PYW D;  4KKJ A;  4HKZ E;  3Q8B A;  3W5V B;  1MI0 A;  1T5X D;  1DOY A;  1KTK A;  4USA A;  5FR3 A;  1N63 A;  3AE1 B;  1F0Z A;  3OWE B;  2IDY A;  4LK0 M;  1TY0 A;  1EU4 A;  2JXT A;  5BMG A;  1D6E C;  3KQ4 A;  4YTN B;  4A90 A;  4P6V F;  1VJK A;  4R3D A;  1P7E A;  2WP9 B;  1E10 A;  2ICI A;  4LLG M;  1JRO A;  4IOI E;  1YN3 A;  2QIL A;  2NMQ A;  4L2Y A;  4ZRQ A;  4OZC A;  3TEX A;  3MP9 A;  4TMA B;  2Y3A A;  3P4S B;  2WXN A;  2W55 A;  2SEB D;  3I9V 1;  3J9C A;  4RCO A;  1JAL A;  5H8Y E;  1D4B A;  2INN E;  2N9L A;  2M56 B;  4JE3 B;  3SFE B;  3Q8F A;  2PVO D;  1YMH E;  4AQ7 A;  5AUI A;  2V3P A;  5GXG B;  1WRI A;  2MH7 A;  2RMM A;  4ZHO A;  1V8C A;  4YSX B;  1VR9 A;  1KLG D;  3ZJT A;  2GRI A;  2ON8 A;  4ZYS A;  1KF6 B;  1ZDX A;  2FUG 1;  3Q69 A;  5JXV A;  1QKZ A;  1SEB D;  3U2S C;  1ET9 A;  1PFD A;  1WXQ A;  2K9X A;  1FRD A;  5TSS A;  1NI3 A;  5BMH A;  3HVD A;  2PLP A;  1SF0 A;  1RFK A;  3FIL A;  2WXJ A;  4O1N A;  1V1P A;  1QQR A;  1PGA A;  2JYE A;  4GDK B;  2EEL A;  2AQ2 B;  4YSZ B;  1SE4 A;  3AMZ A;  3AEF B;  1J7C A;  1QT9 A;  1E9M A;  1I4Q A;  1E6E B;  3ZGZ A;  1XLN A;  1YN5 A;  2QEJ C;  3I57 A;  3IT4 B;  3O13 A;  4HKQ A;  4XDC A;  4C80 A;  2PKO A;  2ACZ B;  2EKI A;  1N62 A;  3KWL A;  1K53 A;  3FAH A;  3Q8E A;  1E7P B;  1YJJ A;  2H88 B;  5EE0 A;  3BK2 A;  2E6X A;  2N7J A;  2DLB A;  2RDH A;  1Y56 A;  1AWD A;  2BW2 A;  1NEN B;  3MHZ A;  1EM7 A;  2BBC A;  1JWS D;  4MT5 A;  1JWA D;  2IGD A;  1L5P A;  2TSS A;  3PO0 A;  2JX5 A;  3P42 A;  5D7G A;  1PGX A;  2V0G A;  3ABV B;  2WXR A;  4A6Q A;  2CJO A;  4KGT A;  1TZO A;  1CQV A;  1SJE D;  2H89 B;  3AEC B;  2W3S A;  3NVY A;  1QF6 A;  4MH8 A;  4NZL B;  4JX1 C;  2WDQ B;  1ESF A;  2FBW B;  4NJC A;  1XO3 A;  5C2T B;  2K22 A;  4WIP A;  4NAW B;  2BYT A;  1OQR A;  2LGI A;  4AS1 A;  4ARI A;  1FD6 A;  4KX6 B;  3PZ7 A;  3W9C B;  1HA5 A;  1QOF A;  3EGR A;  4WQM A;  3WCQ A;  2PMV A;  5C3J B;  4YSY B;  1JWU D;  3C8Y A;  3AE9 B;  1XLO A;  2WDR B;  3AE8 B;  5D3D A;  1FCC C;  3AE2 B;  4XDD A;  5G5G A;  1J7B A;  2WXI A;  4YXD B;  4XWW A;  2JWU A;  3BYY B;  2WXK A;  4RNA A;  2IPK D;  2HTM E;  2XNA C;  1ENF A;  1MPE A;  1QOB A;  4ZRP A;  2GI9 A;  4RFB A;  5HHD G;  1FM0 D;  1I4X A;  1HEZ E;  1TYG B;  3FIL B;  2D5G A;  3AE7 B;  1SIJ A;  3E56 A;  3VR9 B;  5HFY A;  1UUP A;  3KWV A;  1OQQ A;  4MAC A;  3NVZ A;  2WXF A;  3Q8C A;  4JPS A;  3U7Z A;  4C7Z A;  2QIE B;  3VRA B;  2JSV X;  2BS3 B;  4GDL B;  4KGS A;  3AE4 B;  1L6V A;  2K3U A;  2Y5C A;  5H92 C;  2CJN A;  3T3N A;  1FO4 A;  3PZ8 A;  4WH4 A;  4GLS C;  1J7A A;  1FNU A;  1VLB A;  2WXL A;  3N9Y C;  4RF1 A;  4US9 A;  5MPO A;  1WWT A;  2MJE A;  4RGM A;  4C56 C;  3IT6 B;  2OHF A;  1N61 A;  3EA6 A;  1UGJ A;  1ZXI A;  2YEP F;  4N58 A;  2V3N A;  1XLQ A;  1R7S A;  2KMM A;  1FXI A;  2J52 A;  3P4P B;  5E6J A;  1SSN A;  4WWM A;  3T3O A;  1ZE3 D;  2WU2 B;  1SXT A;  1XEE A;  1IBX B;  1FIQ A;  2KDM A;  1C78 A;  4IDI A;  1UWX A;  1T6B X;  3B2G A;  2WQY B;  1C79 A;  2I2Y A;  1E0Z A;  4Q2J A;  4YWG G;  1UNS A;  3GS2 A;  1TS2 A;  3V05 A;  5FK9 C;  3AED B;  1ZUD 2;  2WLB A;  4JWU C;  1NYQ A;  1TY2 A;  3CIR B;  3BYT B;  4DXG A;  2DWQ A;  4RF0 A;  1LO5 D;  1I7H A;  5T8I A;  1WGK A;  1BML C;  2VZK D;  2IJ0 A;  3SEB A;  4OVZ A;  4XE0 A;  3P4Q B;  1KH0 A;  4A8X C;  2NTS A;  4HRS A;  1JWM D;  5BYQ A;  5EE1 A;  3P63 A;  1C4P A;  2W82 A;  1L0V B;  1L0Y B;  3W5U B;  2W3R A;  3HRD D;  1EWY C;  3MC0 B;  3SR6 A;  3LXF A;  2BT6 A;  1BUI C;  2K5P A;  3AE3 B;  5LNK 1;  2BTE A;  3P1M A;  1XCQ L;  3W2D A;  1MHH E;  4L1B A;  2J42 A;  4WAF A;  1STE A;  3IXS A;  1VZ6 A;  1SE3 A;  2QMT A;  1JWB D;  1C76 A;  4RGT A;  2PTL A;  1PDX A;  4MM3 B;  4JWS C;  4WUR A;  3R8B A;  4RGO S;  2JZP A;  2BB6 A;  1HXY D;  2PIA A;  4P16 A;  3E9S A;  2FE8 A;  1YQ3 B;  2MEK A;  4N59 A;  1C9F A;  3AH7 A;  3HUI A;  1CZP A;  3AN1 A;  1ZDV A;  2WDV B;  4H2A A;  3B2F A;  1IBX A;  5BYR A;  1ZXH A;  1I4R A;  3BK1 A;  1F2R I;  1FMA D;  2WXQ A;  2I38 A;  2LMC A;  2MJ3 A;  4RH6 A;  2VZK B;  2W54 A;  2LHD A;  3DWG C;  2ZW1 A;  1EWC A;  4J3O D;  2KAJ A;  1AW7 A;  3EUB 2;  3FC4 A;  2L1A A;  3AV8 A;  1V1O A;  3NRZ A;  3BVM A;  2KAC A;  2N0S B;  3B9J A;  1K51 A;  3ZJU A;  1RYJ A;  1TKG A;  1V97 A;  2RDG A;  4D2K A;  1JCK B;  1DOI A;  2INP E;  3MFG A;  1DGJ A;  2JYT A;  2BB5 A;  4OZB A;  3NVV A;  1M4V A;  3HVZ A;  3BVZ A;  2DYM A;  2DYO A;  2KWD A;  1A70 A;  4ARC A;  1TS3 A;  2PVG C;  1FEH A;  4C7Y A;  1AN8 A;  1P7F A;  2RPV A;  1IGD A;  1NEK B;  3P4R B;  4HRO A;  1VZ8 A;  4ITK A;  2M19 A;  1L0X B;  4OHJ A;  1GPX A;  2KQ4 X;  1HZ6 A;  1RWS A;  1XLP A;  1FNW A;  1SJH D;  2B76 B;  3TEY A;  2BS2 B;  2DBY A;  1L4D B;  1JRP A;  1FFU A;  3AM9 A;  1FFV A;  1SB3 C;  1GB1 A;  3GB1 A;  4A9A A;  2ZW0 A;  3DWM A;  3BVG A;  1D5X C;  1CK1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...