1JCKB

T-cell receptor beta chain complexed with sec3 superantigen
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
239
structure length
239
Chain Sequence
ESQPDPMPDDLHKSSEFTGTMGNMKYLYDDHYVSATKVKSVDKFLAHDLIYNINDKKLNNYDKVKTELLNEDLANKYKDEVVDVYGSNYYVNCYFSSKDNVGKVTSGKTCMYGGITKHEGNHFDNGNLQNVLIRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIESNGNTFWYDMMPAPGDKFDQSKYLMIYKDNKMVDSKSVKIEVHLTTKNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 14.3.D T CELL ANTIGEN RECEPTOR
publication title Crystal structure of a T-cell receptor beta-chain complexed with a superantigen.
pubmed doi rcsb
source organism Mus musculus
molecule tags Complex (toxin/receptor)
total genus 63
structure length 239
sequence length 239
chains with identical sequence D
ec nomenclature
pdb deposition date 1996-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
B PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1jckB01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1jckB02
1SJHD 1JWSD 2Z8LA 1B44D 1RF2D 1LT4D 1EEFD 1PZKD 4RGTA 1PTOC 4Z9CB 2RDHA 3BYYB 1ENFA 2AQ3B 1HTLD 1CT1D 1L0YB 2QILA 5ELBA 1PRTC 3DWPA 2R61A 3BZDB 1SE3A 3OWEB 1D6EC 4K6LA 1JQYD 1M4VA 1D5XC 1TS5A 4OHJA 4DXFA 1LTRD 1GOZA 1TS4A 2G9HD 1LTAD 1SEBD 1AN8A 1TS3A 1I4QA 3GP7A 4RHRA 1I4XA 1S5FD 5I4DA 4RCOA 1YN4A 1DJRD 1DYQA 1AW7A 1EWCA 1D5MC 1S5ED 2QEJC 1JR0D 4NZLB 1UUPA 1FNUA 1UNSA 3BVZA 1S5BD 3V05A 2XRSD 5D3IB 3MFGA 3R2TA 1FNVA 4DXGA 1QILA 1JCKB 1B1ZA 5D3DA 1BCPD 3SEBA 1CHQD 4O1NA 4RFBA 1JWUD 1G8ZD 2ICIA 2XRQD 3TSSA 1BXTA 1SBBB 2WV6D 2J4XA 1SJED 1I4GA 1YN5A 4RGNA 1RDPD 1BCPF 1MD2D 1SXTA 3EA6A 1LTSD 1HXYD 4TSSA 1LT5D 5FK9C 1PRTD 1PTOF 1V1PB 2SEBD 1PTOH 1EFID 2IPKD 1T5XD 3KLSX 1LO5D 1F77A 1RCVD 1HA5A 4L63B 1PRTF 1SE2A 4RGOS 2XNAC 2NTTA 1L0XB 5ELEA 1STEA 1BCPB 1CQVA 1FNWA 1LT6D 1TY2A 1PYWD 2IJ0A 1FD7D 3BVGA 3W2DA 1HQRD 3O13A 1ESFA 2O2LD 2CHBD 2XN9C 1V1OA 1ET9A 3URYA 1V1PA 1PTOD 1RD9D 1ET6A 1CHPD 3MC0B 1JWMD 1LLRD 1KLGD 4UDUC 1S5DD 1EU4A 3CHBD 3DWAA 1I4RA 1PRTB 1PZID 1LTBD 2RDGA 1XXGA 1FGBD 1PZJD 1KLUD 4BWGB 3R8BA 2NTSA 3BVMA 1CK1A 1S5CD 1TY0A 4L6TB 4RH6A 1LTID 1LTTD 1EU3A 2AQ2B 3BYTB 1XTCD 1I4HA 1LT3D 1D5ZC 3R2IA 4C56C 4ZYSA 3EFXD 1I4PA 5ELFA 3DWQA 2AQ1B 5FKAC 2TSSA 1EEID 1LTGD 4RGMA 5ELDA 4RHSA 5TSSA 1TS2A 1BCPC 1PTOB 1SE4A 5ELCA 1YN3A 1KTKA
chains in the Genus database with same CATH superfamily
4LF4Q 2MSED 4FF4A 2ALYB 5A35A 2AMCB 2PZUA 3MVVA 1E9MA 2KQ3A 4LF6Q 4L5SA 2JA5B 3ZO5B 1X1MA 2AQ3B 4JBWA 2CHZA 1VZ8A 3ZQ4A 1YNJC 4YWLA 2EZVA 1Y8PB 3DM1A 2JA7G 2E3TA 1BF4A 1I94L 1E7VA 1OFFA 2FCMA 3A7LA 2WHIA 1QOFA 3M3JA 2PMZB 2UUAL 3PHWB 4UP7A 1E6EB 3MHSD 2VUMG 4DXFA 1L1OA 1LTRD 3I9V1 3PRZA 3KOJA 1ZKOA 1UE7A 2N9XA 3J80E 4AYBG 2E5LQ 4CKCA 3D4DA 4A93H 2M8SA 2B8GA 2WS3B 4DV6L 3AU5A 2IY5B 4LF8L 1AW7A 2CHWA 1WCMG 4J3OD 4A3KB 5IAAC 2C9OA 3FRPB 3HKZB 5FLMG 1R4MB 2JU6X 2KVRA 3E9SA 2JUOA 2ZCCA 3KF6A 1FR3A 2BPSA 3NHHA 4B9KA 3TEHB 4GDKB 5IWAQ 4LNQA 5HFYA 3E9IA 1Q8KA 3HGBA 3NUCA 4PNYA 2UXBL 4E74A 1B1ZA 2D0OA 1PH4A 1B3AA 3PO2B 2X8XX 1PH9A 2IX0A 5E6JA 4WAAA 1JWUD 4KV6A 2N55A 3NP8A 2UU9L 1SBBB 3IFTA 1X6OA 4YSYB 4NXNL 3HOZG 2K1FA 1D8LA 1A70A 3DPDA 3U4EG 1K83H 2NVXB 3FILB 1LM0A 2F0UA 3J81E 1Z47A 2KNBA 1Q3LA 2IW3A 3NVYA 4W9IA 4GNXA 2LGIA 3I8ZA 4K3CA 4NKLA 3GTPH 4BS9A 4HVBA 3NZ3A 3A9JA 3PO0A 2WQYB 4N9TA 1I5FA 1WXVA 1J8IA 2UXDL 3GS2A 3RN2A 3NPPA 5C3EB 2SOBA 2CQOA 5ELEA 2NN6H 3CU7A 1BNZA 4IZ8A 3OW7A 2B63G 2ZW1A 3T4AC 2D3BA 4X3UA 1N34Q 1OTCA 4BFRA 2EY6A 1GNUA 1OEYJ 1HTPA 2L12A 2O2LD 5CV9A 1JMCA 3URYA 3CSFA 1NJIC 4J6HA 3U9SA 3S14H 2F0DA 4UP8A 1XTDA 1C4QA 4JI1L 1XMOL 1XNRQ 1IYVA 1FXIA 1A3TA 1UZXB 4APVA 2K8BA 3VTUA 5C0XH 2XVSA 3GB1A 1SNCA 1I4RA 4ANUA 2PQAB 2H5XA 5EKKA 3MP9A 4I7AA 3RN5A 4RMFA 1FCCC 4S0RA 3CD6A 1AP0A 1LFDA 3S17H 4C3IB 4FADA 1F9JA 2K9XA 3U4ZA 2LXCA 2O5IC 3PO3B 2MQHA 2WAQE 2IO1B 4W9JA 4RH6A 3HEJA 1KOTA 3MHBA 1LT3D 1SLJA 4IOAA 3PF4A 1U4AA 3AE4B 2VQFL 4DUYL 4N59A 5K36G 1DOMA 3I90A 3HM3A 1NAPA 4ZYNA 5IT9c 5EPKA 3MXPA 4GKKQ 2A68D 2DN8A 3SDZA 2EY5A 1FJGL 2ZEQA 3TP8A 2B3GA 1LT4D 1WJ4A 5EJWA 1E8YA 2L52A 1MSHA 3P63A 3C0RB 4HEA1 3I57A 4G3XB 4LK1C 3M63B 1T9HA 3H3VC 5EE0A 1Y69U 1W6JA 5H92C 2BF8B 1WTHA 2F0TA 1KAAA 2KCCA 2R61A 3DWPA 1PXUA 3PCOB 4BA2I 2QA4A 4DV1Q 4TRDA 3BZDB 3EQLC 2Y0SE 1N61A 1YX5B 3GTJH 4NJCA 5M5YH 1WMHA 3NBHB 3GE8C 2RHQB 3L0WB 3CAMA 4KD4A 4DNRB 1N6ZA 4R4IA 4GKJL 3ML9A 2FCSA 3KUZA 5JOBA 1GPXA 2HIXA 1I3QB 2KHSA 1HTOA 2EOTA 1EY0A 2KFKB 1TZ1A 2NYZD 4HROA 3Q8FA 3KUCB 3A8IE 3VDYA 1C9OA 3S2DB 5JJLA 2DHZA 3VYSA 2CW0D 3S1RB 1VQJA 3HOVH 4JYAL 2AL6A 2D11A 1TWFH 1SRUA 2FJ2A 1XPUA 1LV9A 1QZHA 1AFPA 1H4RA 2J42A 1RTNA 2WU2B 3M62B 1EUJA 1FNVA 1BO0A 4J6IA 2D3GA 4KHZA 2DAFA 2IDYA 2MUYA 1CKMA 2LWPA 3MC9A 2OQ0A 4A93B 2GA4B 1D4BA 2QGQA 3HKZG 4OIKA 4A3GB 5IYDH 5EPLA 2F3VA 2F4VQ 3JAMi 2KWUB 3NY5A 4EEWA 2KX0A 1BCPF 3IT6B 2CKHB 2IHFA 3Q8EA 4Y7NB 4X65Q 2JF5A 4PK1A 2BA0A 5M3MG 1KD1C 5CV4A 1LT5D 4B3SL 3D6CA 3QJYA 3HOXB 3JVZX 4JV5L 2BE5C 2HQLA 1B8AA 2V4DA 1VQOA 1PFBA 1N8RC 1E2VA 3K58A 2EMSA 5D14A 2H4OA 4DR4L 4YHHQ 4L63B 5IY0A 1SE9A 2JSVX 4HIDA 4LFAQ 4G50A 2Q2IA 3P20A 1NDDA 2K03A 2RCFA 4YTNB 4LAAA 1Y1WH 3C2PA 4WURA 1CFMA 3Q8DA 3K6OA 4I7ZC 4KI0A 3SU8X 2KJXA 3OOCA 5F2DA 2BS3B 2N1VA 3S1QH 5CBAE 1WX7A 1QOGA 3KWVA 1ET6A 4CDFC 4UDUC 2JA8H 2L00B 1EY6A 1A2UA 3PS6A 2BA1A 4CJ0B 4DNTB 1Q46A 4NPNA 4HCEA 2WXNA 4HJGE 1VQMA 1KLUD 1H95A 1D3ZA 2EJMA 3DDCB 3JW0X 2HT1A 3CSTA 1FMAD 1VD2A 4NNJB 2KDMA 2XGTA 4YXDB 4KJNA 1NNXA 3BYTB 1BT0A 2L83A 1V9JA 3P7JA 2R7ZH 3EFXD 1S3SG 3PPAA 1G2SA 2KBNA 4QUCA 2K25A 1BBWA 4ZK9B 3B9JA 4C3HB 2JZZA 2WXFA 4JBJA 3A1QA 2RKSA 4YCUA 1MJCA 4FJVB 3RNCC 1VQFA 4DK5A 1WOCA 2JYTA 1RF2D 3RNUA 1GG3A 1YVCA 2PQEA 2LD9A 2KA7A 4DV3L 2JZPA 2DJFC 2MP1A 1GUGA 5JAVA 3PIPA 4B3TL 2E2HH 1VQDA 4DV4L 1XYIA 4IPGA 3OWEB 3N9YC 2ZXPA 3SHQA 3ITPA 1H9MA 2WXMA 3SK5A 2KTRA 3GD7A 3P42A 3P1MA 1C4PA 3PF5A 2N0SB 3KF8B 1RJTA 3Q6BA 1SEBD 4X66L 1U4LA 4K5VA 3ZGZA 2RA4A 5M3FH 1NR4A 3NOBA 1NTGA 3A9KB 5IGGA 4KDLB 4N6EB 3VH4B 3VRAB 3ALBA 1VQBA 1T3QA 4LMQD 2A68C 2G5DA 2OHFA 2MFIA 4GS3A 1RWSA 4EFOA 1PMRA 1L7YA 2MJDA 3DWMA 4XYCA 3PQIA 3FMCA 1KHIA 4V190 2EE1A 5LHY1 5A2QL 4XE0A 4K8IA 1T0QC 3J81i 4FDBA 3WA0A 1Q1EA 2PEAA 2K5HA 4IUPA 4PZ6A 5CV7A 2K8CA 3PGEA 3HOWG 3RD2A 3V96A 3K57A 4GLAC 1C1YB 1YEZA 2PTLA 2K5VA 4K5WA 3APCA 3KLSA 2G4SA 2ZNVC 4K3BA 1ZDXA 1TWFB 1AARA 4DV5Q 4BKGA 4A8XC 4M1UB 1GJXA 1WGKA 3IVFA 4GDKA 2KLCA 1RFKA 1DD2A 3NZSA 1CJEA 2TMPA 2WB1E 4LNIA 1HZ6A 1YOVB 2EYPA 1T5XD 1CKOA 1QUQB 2CJNA 3L13A 3A54A 3E0JA 3E5SA 3PZ8A 1EY7A 1WTOA 3MEFA 4TKOB 3P2BA 3K5MA 2CWAA 4K14A 4LFCL 2NTTA 1L0XB 4NDXA 5CR3A 1JWBD 4DR6Q 3NS8A 1Y56A 3A8KE 1XT9B 2BH8A 5IGBA 2JEAI 2JYOA 4HJ7A 3M7NA 2YVCA 1J0GA 2RBMA 3STBC 4XWWA 3PLVA 2B29A 3K9PB 1XQQA 2KWVB 3UF8A 4AQYQ 2V1CC 1CHPD 2GI9A 1KLGD 4NXML 3OJ4B 4IPCA 1EU4A 2DNEA 1DOIA 3WCQA 3EIVA 1BBUA 1UGJA 4LF5Q 3DBRI 2AKWB 4YWKA 4OX9Q 2Z0EB 5KYLA 1JB3A 1Y1WB 1K53A 4A3EB 1KRSA 4IUUA 3V60A 5DNFA 1V8QA 2J53A 2NVYH 3RFZB 4EQNA 1E0BA 1SNDA 2A6EC 4G11A 5IP9H 4WIPA 2R2OA 1LTID 4BBNF 1LTTD 2L0FA 3AEDB 3BIID 2NN6G 3JAMc 2YEPB 2JA8B 2ZT9C 4TKNA 2LXAA 2PI2E 3NE5B 4QL5A 2VY3A 4FULA 4H44C 2EXDA 3G48A 1QNUA 2EVBA 2PQAA 1CA5A 3EHVA 1P8LA 2F0IA 5LL6S 3I4LA 4JI2L 3TN2A 2Q2HA 3FDTA 5IGDA 3S1NH 2BB6A 2KXJA 2PPBC 2KACA 1HPCA 1EF1A 4RKLA 2M19A 5C0XG 2F3WA 2WKDA 3BDOA 3QWNA 4ZRIA 1U0LA 2EY2A 2Z6BA 4MIUA 5JPMC 5AUKA 2R6GA 4JOIC 2ZXRA 1N5WA 2LEKA 5J3BA 5LMUL 4R4OA 5ELBA 1Q5WB 2A73B 3C8YA 1RIPA 5J17A 3DVNU 1R4MI 1JQYD 3NTHA 1N36L 2KJRA 3RZOB 4B3RL 2D07B 4I6NB 4WJQA 3C1EA 3E56A 3U7DA 3DVGY 2LJIA 1I4QA 2WAQG 2OJRA 1JC7A 5AJ3L 4RCOA 2M1MA 1S40A 2B8FA 3DEOA 4LUOA 3N52A 1NE3A 2JK8A 5IOIA 5E1FA 5D2MB 2JWZA 2DZIA 4NZLB 3IAYA 2DNCA 1UUPA 2I2YA 3OPOA 3V3XA 4AH6A 5E4WC 1SFOH 3K8AA 3T51B 3RNFC 1R4PB 2HDLA 3K5LA 3V05A 1P9DU 3ZTDA 4GOPB 1F1HA 2NS5A 1RM6C 4GOCA 4MT5A 1QILA 2RCNA 1GUOA 1SNOA 4GMVA 3RNBC 3AEGB 3SE0A 4JI5L 2NUCA 1UGMA 1OQYA 1WI0A 5M3FB 3HK0A 3R66C 3IG3A 3Q8AA 2KFKA 4XTCS 1J5EQ 1YN5A 2XWJB 1RDPD 4DKAC 4CJ2C 2KQSA 4M8NA 1KDCA 3GTGB 3N1ZC 4X3KA 3ULLA 4ZKCB 4RNAA 4KY5A 1EOVA 2Y0SG 5CORA 1HFNA 3VR5A 5FLXE 1SIFA 3U8ZA 2BTEA 4WRDA 2O6VB 1YNTE 3ABVB 4RKBA 4DK3C 2HDEA 1STBA 2XSCA 3ERQA 4EZKA 2SDFA 2NR2A 4LJOB 2YU9H 1ZOYB 3HOVG 1NUCA 3L0OA 1K9MC 3DBSA 5GXGB 3I4OA 2XNAC 1IBKL 4BBSH 1FNWA 3W2DA 2C60A 3AV8A 1T5EA 3KDFB 2B63H 1VQCA 4AS1A 1UEBA 4M0WB 1IYUA 3MA2B 2R92B 4AUQC 1H9KA 5IYDG 2ZJRA 4M8MA 4P73A 4P74A 1YJNA 1X32A 2N8NA 4KY7A 3UQBA 1V49A 2LXJA 4IM0A 1HQMC 3OHXC 1XD3B 2LS01 4BBRH 2C9WB 1K8OA 3V6CB 1OXTA 3GTLB 1KDBA 2RDGA 4DV0Q 4UHVA 1LQBA 3K5NA 4DR3Q 1K73C 1J8CA 1FGBD 4BY1B 3V62A 1SNPA 3VR3A 1EQQA 2CH4A 1NYRA 2B2UC 1MG4A 1YBYA 1RLFA 1SE8A 4ZUIA 3T1HL 1PH2A 5E3FA 4TQ1A 1HH2P 2D3AA 1EQTA 4JOIA 4ZYSA 2QSDA 2R7DA 3CCSA 1PFMA 4HWIB 3NSWA 2FCNA 3S9WA 1IGDA 1LTGD 3CCLA 1L6VA 1TQOA 1Y1VH 1TKWB 5C0XJ 1IBLQ 2F0GA 4PYZA 2JJQA 2WWZA 3DVNV 1GHJA 2WP8J 5C5MA 1N32L 3A5UA 4M01A 4RGTA 2O2VB 3P1HA 4JG2A 3FKYA 3Q3JA 4Z9CB 4JI6L 4DBGA 5BR8L 1ENFA 1A2TA 4KZCA 4H2AA 5C4JH 1CT1D 3W5UB 1VQNA 4KIKB 2QIEB 1EY9A 4JPBW 3NJTA 3IBEA 2OTJA 4DR5L 3FPPA 4XQJA 4DV7Q 1J19A 1V5TA 3TP6A 2V1YA 1NMGA 2NMQA 4Q0FA 1F52A 4YTPB 1TXYA 5KHQA 2R7ZG 3AN1A 3H15A 5CHFA 3AMZA 1HR0L 1WTQA 2VZKD 3J80L 1WTVA 3G71A 2N3SA 1LTAD 2JA7B 3KYDD 1N5XA 2WXKA 1YQBA 4HMJA 3C1FA 1SN8A 1P98A 2IO3B 3PRMB 4RF1A 1D5MC 1WVLA 2VUMB 3SD5A 5DPTA 1G6ZA 3PHXB 1MPEA 5FO7B 4B0EA 1Z7TA 4DK1A 2PMZE 1O78A 2XRSD 4HTHA 4FF2A 3KF8A 4AYBB 2D9UA 5AZHA 4A3BH 1GUAB 3RCZA 4ARCA 5IGEA 1UAPA 4FXKC 4A3PA 5TR5A 1WY8A 2VH1A 3GV6A 1T0SC 1WCMB 3A7AB 4HJ9A 1SJED 2N9EB 4WJ4A 2A6HD 1VLBA 4L5RC 1PDQA 2QCZA 3A9KA 3LJ3A 1SFOB 1HZCA 3ZNHB 2LVQA 1LABA 2E75C 5IODA 1ZKHA 2KC2A 4KMUC 5M3MH 2JRHA 2KWDA 4LDTB 3CC7A 1C78A 2AL3A 1PRTD 1CUKA 3OLMD 4K7WA 4W9GA 4DDID 2BDNA 1EFID 2L0CA 1XMQQ 4WWOA 2NVQB 2LRWA 3HOZB 4GXBA 2JQOA 3HS0C 2ZW0A 3FEWX 5CV8A 1KH0A 1STEA 4FXGC 1BCPB 1STNA 1YQ4B 4ZDVA 2KVZA 2EIFA 2QW7A 3O13A 3UIOB 5I9PA 4GOPC 4JI4Q 3EGRA 2IO0B 2CHBD 2XN9C 3H94A 2NVTH 3DCGA 1MJDA 3KFUA 1VQPA 1JJ2A 3DWGC 4DF7A 4R3DA 4X64Q 1JQ4A 1GJZA 2J0MA 2WDVB 1GD7A 1QUQA 3QG1A 2LZ6A 3HVZA 1EO6A 3A33B 1WM2A 1FYCA 3H09A 4XWTA 5KNBA 4QGUA 2B63B 5I6YA 1SYGA 1WWTA 2V3PA 3RZFA 4BZAA 4F8MA 3H0GG 2K5PA 3SDLC 3AEVA 2KYWA 3D3RA 3TZUA 2L05A 1JMLA 2AYOB 3T1YQ 3NWTA 2F1MA 2MP2B 1QCBD 4F1SA 3CMEA 1VJKA 2QC8A 1C77A 4EQPA 2CU1A 2N9LA 3RMHA 1ASYA 3A4RA 1ZYRC 4DN4M 2K22A 1N34L 1SE4A 1XWEA 1KNAA 5LMNQ 2Z0DB 4ALPA 1EQVA 3L7ZC 3Q23A 2FMCA 2IX3A 2GBJA 4MZ9A 2W54A 1FL0A 1E2ZA 4IWQA 3NVZA 4U68A 3NBIA 3E9HA 4YL8A 1KM7A 3QK0A 2PVOD 1VQIA 1GB4A 3F2CA 5EE3A 1L0YB 3NENA 1F0ZA 2FCQA 4NAWB 3CQZH 1ROEA 4WFN3 2J52A 5IP9G 2WACA 4IUMB 1EFWA 4IM2A 1TS5A 4OHJA 4N9F4 1TS4A 2QCPX 3QOLA 5M5WH 3GTOB 2EY1A 2BWES 4MJSB 3MJ5A 4REZA 4QF4A 2KJ6A 4RHRA 4B3ML 4CHKA 5I4DA 2H88B 2Z0SA 1WJJA 4GKKL 2KC1A 3ZJUA 1FPYA 5JXVA 5CX3A 2FHTA 1HA6A 1EWIA 2V9HA 1WTXA 4YTMB 1IGCA 3RN9C 4CQNA 2UUCL 3ZKJC 4A9AA 1JOQA 3R2TA 2B2WA 1L5PA 1JRPA 2V4LA 2WDTB 1U4PA 3E6ZX 4R4TA 5D3DA 3ENEA 1MI0A 1O7ZA 2B2VA 1E0ZA 2QEXA 3HOWH 4O1NA 1FFUA 2ZM6Q 4DR2Q 1WE7A 2IZVB 2Q5WD 1BKBA 4PMBA 4BKSA 4KK7A 1B4OA 2K50A 4MGZE 4ITKA 1Z6HA 1SXTA 1MD2D 2B2TA 1FGUA 4C00A 3Q3NC 5GAGC 2ACZB 1HNXL 2EKEC 3DQVA 1DCZA 3FKIH 4IFDI 1B50A 1PTOF 1V1PB 4IUNA 1VQHA 4UP9A 3OTOL 3FHWA 1OQQA 2NBUA 2VH2A 2WXJA 1C4AA 4KKJA 1X3FA 1HJPA 1KNEA 3GTKH 2PVGC 1D7QA 1F77A 1CI3M 3W5OA 2BS4B 3NEMA 2L76A 1KDAA 4JBMA 3GTMH 2JT4B 4C7YA 1F2LA 2K28A 2ZTCA 3SFEB 1T6BX 3SFDB 3I4NH 4HN7A 4RM9A 2IJ0A 5M3MB 3PUVA 1HQRD 1M8AA 3C3LA 4YY3Q 1K51A 3NG0A 4LK0M 2O6VA 4BY7H 4DPGA 1U5KA 4LUVA 3S1MH 2N7EA 4JWUC 2BQQA 5L83A 4WQMA 4NQKE 1Q81C 2CU3A 2IY0B 5IYBH 2K01A 2N7DA 5KHOA 2JX5A 4MELA 4X65L 2O5JC 1E22A 4HPLB 3ZJYC 1G51A 5LNK1 4LFBL 1A3VA 5HY6A 4K7SA 2LXKA 3KDFA 3IT4B 2YTYA 3G4SA 4G57A 1E10A 4M0WA 2VQEQ 2D2QA 1EM7A 4W9FA 4FHJA 1CQFA 5KYIA 4A3DG 4YSXB 2KJHB 3I4MH 3IKJA 4YCVA 4BBSG 4EQ5A 3K81C 4R8NA 4DA2A 3SEBA 1UBIA 1TWCH 2L1BA 1BCPC 3HKSA 5E4XA 4AOFA 1TVXA 1TWAB 1LGRA 4WJ3M 1WRDB 1G6JA 1E7ZA 5HG2A 1WXMA 3CCMA 2BCOA 4BBRG 4XYOA 3G6JB 1S4ZA 4A3OA 1X3EA 1N60A 3LB8C 5IGFA 3H9DA 1TGZB 1KFYB 4ANXA 3RZDB 3W1YA 1I50H 5BMIA 3NWSA 2AEHA 2KOLA 1ISNA 1OXSC 3VTVA 2N49A 4JI8Q 2AWTA 1ILPA 2B3AA 1D5XC 4ULLA 2PE9A 2DBYA 3K7AH 2DJGC 1NEKB 3HOUG 1OTRB 3PUXA 2JXMB 2Y5BB 4WORA 2O2VA 4DAVA 2G9HD 3AQQA 3SR1A 1Y1VG 4MNOA 2KCMA 4KIKA 3VFKA 1WGYA 1MHWC 4AWJA 3UE0A 1XNQQ 4JI7Q 2ENBA 4IO9A 3GTQB 1QZGA 2HTHA 2MA9B 4RWSC 4IPHA 1STHA 1JORA 2BB5A 4A55A 4JI0L 1EY4A 1FNUA 3UDFA 3UDIA 1K50A 3WALA 2FINB 5C4XH 2XWBB 2F0SA 2J7QB 4GLVB 3CC4A 3I56A 2KWCA 2A19A 3KLRA 2C5CA 1IW7D 5DM73 2O4XA 4IN3A 4EVOA 2QDBA 1JCKB 3ND9A 4BXXH 3S2HB 2VNUD 2DZJA 2MEKA 3NTKA 2ZNVB 4DXAB 5IN7A 4ILWA 1HZAA 3A55A 1UELA 1IBXB 2Z9HA 2E74C 2XRQD 1BXTA 4QUFA 3TS0A 1EWYC 3LDZE 1FO4A 2MRPA 1DOLA 2BH2A 2MBOA 2JE6I 3QB3A 3L08A 3B08A 1WH3A 4O42A 3U4VA 2F0PA 3I3CA 4DV2Q 5M5XH 1I7HA 1LTSD 3Q69A 1V43A 3KLWA 1L0VB 3VH3B 1EYDA 1SNQA 3T3NA 4K0KL 4NMZA 2F0WA 3M7GA 1XCQL 5C2TB 1C3TA 1NCVA 3HOWB 4CJ1B 2BS2B 5IP4D 3RNEC 2K75A 4C3JH 1PRTF 4ZAIA 3J7AF 4OO1H 4KD3A 1H9SA 2OXPA 2ZJDA 3BVGA 4A3BG 2L0TA 1FD7D 2LHEA 3W5VB 1F2RI 4QB4A 2XTIA 5E6PA 1QE6A 3KBXA 4POFA 3GZNB 3BK1A 5JEAJ 2BBCA 3R93A 1PH7A 1V1OA 1MKHA 2L32A 4MGIE 2F0NA 4X3SA 2OWOA 3NZUA 2QDFA 1HZBA 2A8VA 4LF8Q 4TQ0A 5AZGA 1STAA 2ES2A 1N62A 4N58A 1BDOA 4KN7C 2RR9A 3FVQA 5HI1A 2L7RA 1NI2A 4QQBX 4LUZA 3AB5A 2ON8A 1IHZA 4CGYB 3AH7A 5DAUA 5FLXc 4K81A 3H6NA 1VQGA 3R8BA 3QHTA 3BVMA 2F0JA 3GOEA 2UU9Q 3DHIC 4MACA 5CHWA 1K83B 2AQ2B 3EVQA 1IL8A 5IT9L 4DR6L 3J9CA 2UYZB 1AZPA 2EYOA 1QB5D 3IFDA 4G7HC 3GTPB 2HIVA 3VUXA 4DR7Q 3GQBA 4WJOA 5ELCA 4B9XA 3ZRFA 4HKQA 3M3YH 4NY0A 1JWSD 2RMMA 4IURA 2E8GA 2MLBA 1PGXA 2UXDQ 3DHGC 1ICWA 3BYYB 4XQQA 2MP2A 1OXXK 4GGQA 3UIPB 1CTMA 1Y14B 2EJGC 2IX1A 3U9OA 1YMHE 2W82A 1TWCB 4ZHPA 2XBBC 4I6LB 2I0QA 1D6EC 3S14B 4KHPQ 4ZCKA 2K1BA 4XZ4A 1AE3A 5I9OA 1YHQA 2K5DA 1A15A 5EBDA 2IGGA 4LLGM 4JI1Q 1XMOQ 4S17A 4A75A 2ASQA 1MGSA 4ODGA 3CCUA 4AP4C 2UUBQ 1GB1A 4M8AA 3PIP3 1NSNS 1V5OA 1QQRA 2DYMA 1E1TA 2VW9A 3S17B 3U58A 3RLOA 3M95A 1UD7A 2HHHQ 2KX3A 2K3UA 3MTSA 5HKHA 1EZ6A 2EYLA 3KW5B 4HPMB 2L9HA 3K7AB 3KJOA 2VB2X 3TMPB 3LYYA 3MFGA 4NJ7A 1E90A 3RUIB 3TEZA 2WAQB 2HUGA 2VQFQ 4BBNC 4MJSA 1F9QA 1KABA 2F0OA 5C6AA 4MDKE 1VQ7A 1K52A 4ID6A 1PGAA 2G1EA 2FUG1 3T9LA 2DGYA 5J39A 3ONSA 3UINB 4CYEA 1P7FA 4H02A 1FJGQ 5LLIA 4EX5A 1SSOA 2HD5B 3PTFC 2Z1CA 2FBWB 3WIMA 1WIAA 3TEWA 1YHBA 3IAS1 1K8RB 2Q2TA 3AE7B 5FK9C 1UBQA 3PREA 1WJUA 5BMGA 4R9WA 1PQSA 1YIWA 4ZUJA 1EZ8A 3PV0A 1WFQA 4GZYC 4FHKA 2MWSB 2YTXA 1PTOH 2BDOA 3GTJB 4KY6A 2HCIA 5M5YB 2MJ3A 3CW2C 1PYSB 1QKZA 4L8JA 3BDLA 4IUTA 3CF6E 1LM8B 2LFIA 2KEEA 4ANVA 4KKTA 4EOYA 1M1KC 3ZLZA 1K8AC 3R7QA 2Y0SB 4GKJQ 2I46A 3EFCA 3NXWA 4L5QA 1NMFA 3WAPA 1IW7C 3LXFA 3I73A 2RVLA 3KYHC 4DFAA 2N9KA 3H7SA 1SNMA 3QAQA 1V1PA 1QZEA 1Q1BA 4IWPA 1EWHA 1W3SA 2UXCQ 2KN4A 3HOVB 1JWMD 1LLRD 4ASWC 3X0WA 3UQAA 1B9MA 5GAEC 1FXTB 1F2YA 3ZNZB 2KDEB 4JYAQ 2INDC 3N30A 4F87A 1PZID 3FKIG 3Q2AC 2JA6G 5BN4A 1DOYA 1LUZA 4C1NI 4HSVA 1HZ5A 2WXIA 3H0GH 3SK4A 1GC7A 4KDIC 1TTNA 1TWGH 3H3VI 1RTOA 1HNZL 3TRZA 5EE1A 2OTLA 5EDSA 1P1AA 1R7SA 2J0JA 5L37A 2CW0C 4BAXA 5ELNA 3I4NG 4II3B 1WI5A 2Z4IA 1I4PA 4FP5D 4ZQ3A 3PGZA 2HJ8A 3FILA 3TUOA 2AQ1B 1C8CA 4PZ8A 3AU7A 2BYTA 2R93H 1E5WA 4BY7G 1JT8A 4B3SQ 5JHBA 1DXMA 4X6AH 4CHTB 2WNMA 3IAM1 1TT2A 2F0FA 4JV5Q 1F2ZA 4PS8A 1YIJA 1OXVA 5H1SE 2WX1A 4A3FH 1QG7A 5IYBG 1ZXHA 3JSVB 5CBEE 3KBGA 4DR4Q 1S3OA 5FR6A 3QO2A 2QILA 1VZ6A 4DR3L 3N3KB 1VQLA 4WWNA 3DBHB 2I5LX 2PZWA 4OIJA 3S1QB 1YJIA 2K6QA 1SE3A 1RYJA 2NBWB 1UWXA 4OZBA 4KN4C 2E2JH 4XC2A 4ICVA 3I4MG 5H8YE 1K3RA 1AWDA 3AXCA 3RNAC 1JWAD 3RNGC 1P0RA 3KUDB 2X6GA 4LW1A 5ELOA 5IOCA 3ZJVA 4B08A 5GAHC 4A3JG 2LVOA 5AEKB 1SF0A 1QNKA 3MEHA 1I4XA 1S5FD 3OW2A 2KENA 1L2FA 3DMUA 1ONLA 1VCBA 4P16A 2JVCA 2KTFA 3CKIB 3IL8A 1JR0D 5C4ZA 3ND8A 2KN5A 4KHVA 3HIZA 3X3NA 3SR6A 2R7ZB 3Q3FA 1GUSA 2MW5A 1NBWA 1EUVB 3V6EB 2AUKA 3ZNID 2NBVB 4DHJD 2BOSA 3P4RB 3VUYA 3VVWB 1Y8OB 3RPFC 2F0VA 1CHQD 4CDCC 4DV7L 1YJ1A 3NTIA 3N32A 4GU2A 1IKLA 1I6VC 3MTNB 2RGFA 5CGKA 4HAEA 3T8MA 2R3ZA 2OT2A 2M0AA 5K5PA 2MJ8A 4OEMB 4WQOB 2A69D 2IO2B 1YJJA 2E2HB 3I5JC 4H7BA 4J15A 4OL7A 5GADC 1ZXTA 1KF6B 4ZLTF 4B3TQ 2G4DB 4DV4Q 2IBIB 4WWPA 2JA9A 4IOCA 4X57B 1Y8NB 2E2DC 2GBNA 1RCVD 1WD1A 1C0AA 1HA5A 3NBHA 4AYBE 3Q0AA 5C4XG 2MH7A 2R2QA 4WWMA 3ZXRA 1IBXA 1XLQA 4JIOU 3MC8A 5D6JB 3KK7A 1LT6D 1CQVA 5G3LF 5FOBB 4BXXG 3L4PA 1CM9A 4P7IA 4HJ5A 1EIHA 3AYHB 4P2CB 4X66Q 5JPNC 3VA7A 2L3ZA 3OJ3A 3CF5A 2N9PC 1EYGA 1PVOA 4JVZA 4ZKBB 1PTOD 2Q8TA 5JEAH 1I6HH 1EY8A 4W9KA 1WYWB 3MC0B 4S3SA 2V3SA 5IA7A 4E6IA 2RSNA 4MN3A 1KJTA 4IUQA 4C80A 3K59A 3EBEA 2PNRC 3AFQA 3N1XC 3DVGX 3KQ4A 4W9EA 2I38A 3JAML 4W9LA 2K5NA 1RRBA 2WFWA 4LJZC 1X56A 2LMCB 2BKFA 4HDQA 3AE1B 1XMQL 2WXOA 2NTSA 1JICA 2LUEA 4C2MH 4C3JG 4A3DH 4GSWA 4OO1G 3J7YW 1T0YA 2KANA 2A5UA 1TWHH 1C76A 2JQRB 4A3MH 3WDNA 4X62Q 5JJIA 3NRZA 2VRRB 4ZRPA 5BMHA 1FCLA 3DWQA 3UI2A 4QIWE 4EUTA 1PA6A 1TS2A 2A1AA 4AIMA 3PIO3 2XK5B 3AE6B 3H0GB 5JHAA 4A3IG 3C46A 3SVMA 3NELA 2KK8A 2H1EA 4X64L 2W9NA 1Q82C 3X23A 5JZEB 1EEFD 1MG8A 4W9CA 1FRDA 2IWHA 2K0PA 3CIRB 4DHZE 4DU9A 3KJPA 2WB1B 5JJZA 3RZWC 1VQAA 2AHOB 4LFCQ 1QWYA 3NVVA 4J8QA 1JOOA 4A90A 5G55A 5A2QE 1VMCA 2ICEC 1ZE3D 4LWCA 4H13C 1R9TH 4K6LA 4TV3A 2KDBA 4PMWA 3TEYA 1HNWL 3FPUB 2INPE 3CWIA 3HOUH 1GXDC 4C7ZA 5BN3A 4LF9Q 4NXMQ 2VB3X 2MHJA 4HR7B 3E0EA 2CS4A 2V0GA 2QHOA 4IW0A 4GLSC 3OMGA 1AE2A 1RL2A 2NVYB 4HJ8A 5LMNL 1NYQA 2WU5B 2X69A 2GLSA 2M17A 4DR1L 4RMAA 5C3WA 1CA6A 1F2MA 4A6QA 5KIXA 2D2CC 5BYSA 2E2JB 3HUIA 4AQ7A 5C44H 3ML8A 4LF7Q 2M56B 4JK1C 3QQ8B 1A5RA 5D3IB 4UY8C 2JY6A 4JLCA 1GHKA 5E6OA 2MCNB 1TT5B 3HVDA 1RODA 3M4OH 1XPOA 4BOSC 3S1NB 1YNND 3B0AA 1G8ZD 4JI2Q 2LKVA 1LXDA 4FXDA 2VZKB 1IPGA 2INNE 2GVBA 2CH4W 3K9OB 2RF4A 4FJYA 1YNJD 2B2YC 3W9CB 1G2TA 1SMYD 4QMGA 2KHJA 3GZNI 1I42A 4DGZA 3AU4A 3L16A 3NS1A 4LF4L 2LRUA 1B7YB 1C48A 3FP9A 5KEEA 4LF6L 3PZDA 2UU7A 1WZ0A 2WLBA 4KGTA 4KGSA 1EYCA 1WXSA 1N36Q 4U673 3KVFB 2JA5H 1ML0D 3T53B 4CDDC 2I1KA 4B3RQ 1PV4A 3TEXA 4XDCA 3U50C 4N8X1 1QT9A 4YIJA 1PFSA 4IG7B 3W1BA 1VF7A 5AJ3Q 4HJKA 2EDGA 5NUCA 2M00A 2DWQA 4FYDA 1P7EA 1UE5A 3P4PB 4H0LC 3J81L 1Q7YC 4EE2A 3V2TA 1WR6E 4F7ZA 4US9A 3CHBD 2E5LL 3IHPC 3DWAA 4OZCA 1PRTB 4ARIA 2NZOA 3UDXA 3HKZE 2BYEA 1LTBD 1FIQA 1WD0A 2N88A 2GVAA 4YSZB 2FAZA 3K0YA 4JX1C 3AEAB 4JI5Q 3IRBA 2G45B 4PT5A 3EJIA 1PYBA 5E7NA 2V3NA 4A3KH 2FXQA 4PV1C 5IWAL 4LNKA 4KSLC 1A62A 2NN6I 3K7UC 4C56C 2BYVE 3WAOA 5C3XA 3BWUD 5BO4B 3KWLA 5HURA 2QMTA 4RGMA 4RHSA 3R3OA 3VR4A 4YY3L 2B2UA 3V61A 4B9WA 4K5XA 3S24A 3PO2H 4EZJA 3A8JE 2YU9B 2ATWA 4V0BA 4A3DB 4ABNA 5C0XI 3CRLC 3Q24A 4A76A 1PTOC 1SAPA 4WJWA 4A4IA 4BBSB 1TWHB 5CC4A 1L1OC 2NVXH 1TZOA 4YT0B 2AWNA 4GN3B 3ZIMA 1E7UA 3EROA 1IBKQ 1RAXA 2LUMA 3AEEB 1EYAA 3VA5A 4UAIA 1UE1A 1XEEA 1LTLA 3AB9A 2GN5A 1VF5C 1WR1A 3WAMA 3EN2A 1H8CA 5T1IA 2VQEL 1GM5A 1Q10A 3MXGA 2JN4A 1TKEA 1VQ4A 1M4VA 4MTNA 2I07B 1ZPSA 4M00A 2WB1G 2X6LA 4BBRB 5C3EH 1PH1A 4L2YA 3ICEA 4NAMA 1GOZA 5GMVA 4TMAB 3U52E 2I5MX 5AUIA 1XLOA 1V1QA 1H9RA 2L5TA 4IFDJ 4KGRA 1AN8A 2R93G 1JOKA 1FM0D 1NENB 4GN5A 3VQIA 3CXCA 4B0MA 5FJ8H 1BUIC 1WSPA 1DYQA 4HIMA 5EPJA 1ICFB 1PFNA 5CMDA 1XNRL 4MH8A 1EWCA 4A3FG 2KDIA 1D1IA 4JGHB 4L1BA 3ONAB 1FFVA 2G3QB 4NJ6A 3ZNGC 4B6WA 1GC6A 2F03A 4P72A 1UNSA 3BG3A 4DNIA 2QF7A 2D5DA 3HOUB 3T13A 2LI5A 3UGBB 1STYA 4ZRZA 5C3JB 5C4HA 2DENB 2OQKA 2ZJQA 1Y1VB 4C3IH 1XF5L 2P5ZX 1H9JA 4ZRJA 1TJEA 5J1ZA 3PO3H 2V4IB 2BGFA 2W3RA 3LNNA 2YEPF 1N32Q 3I91A 2D10A 2WXPA 5C4JB 4JI3Q 3DOWA 1F9PA 2IT1A 1G291 2K5WA 4JI6Q 2PW9A 5BR8Q 2WDQB 5IP7H 1WYGA 5J2RA 1VDZA 4IDIA 2PNHA 2SEBD 4JI7L 1Q0WB 2WX0A 3EUB2 1LO5D 3G7LA 2KMMA 4BVUC 4RGOS 2GBRA 1IBMQ 4WJPA 3VR6A 1X55A 4P71A 3J7ZC 2PE6B 2GOWA 3C19A 3R3MA 4JPSA 3VHTC 1HTQA 1GVPA 4DV1L 1Z2MA 1SROA 4PS3A 2Q8IB 4IALA 4I6PA 1TYGB 2EYFA 3CPWA 1ESRA 4CKEA 3CCEA 4DUZQ 3BDCA 2JP1A 1PLFA 3S15H 2E2IH 3CCVA 4DV2L 4HCSA 1A6XA 3HG9A 3PT2B 4CKBA 2JA6H 3O65B 1XXGA 4A3BB 4KVGB 4DK6C 1BUVT 4GOPA 1I3QH 2LSSA 1EOTA 4IM3A 1AEXA 1SMYC 5M9OA 1VQ6A 2M0XA 2PKOA 3DBLB 2KD0A 4C4VB 1S5CD 4FF1A 3S2DH 4ACFA 3WOFA 1Q12A 3S1RH 3R2IA 1D5ZC 2BKRB 1QLBB 4XGAB 4KJOA 3DBHI 2CQAA 4KKIA 2IHEA 2OF1A 1WZ3A 1QJOA 1OXUA 2CWPA 2BE5D 4MTKA 4FO2A 1PH6A 2F4VL 4LNNA 5JEAG 4MGYE 1NY4A 2JWUA 4A3GH 4YWGG 1TKGA 1MHXA 2LMCA 4MM3B 4IWOA 1X3QA 2A6HC 4MGKE 4IKGA 4PS7A 4DDGD 3TBLD 3U2SC 1ZUD2 3BZCA 4Y7NH 2F0QA 1SYDA 1ENCA 3PZ7A 1K28A 2CHXA 3QA8A 3HOYG 1PRTC 1ZW7A 2IGHA 2PMVA 3PV1A 3HOXH 2NVTB 3PLUA 1M94A 2PIAA 4G7ZC 4YHHL 4XX5A 4NQLB 2HE7A 4RM8A 1SYCA 2D5GA 4LFAL 2XK5A 3Q8CA 4FBJB 2L4NA 4A3MG 1E24A 2K7VA 3AM9A 2EKIA 5J18A 3MZ5A 1N63A 4F88A 2ZPYA 3TJPA 4A3JH 1TS3A 1QOHA 4ANWA 4FJZA 4DR7L 2N7JA 4KKSA 4ME5A 5D7GA 2FIDA 3ULPA 1NVID 3AEBB 2K6DB 3I55A 4XT3B 5KNDA 4ME3A 4W9DA 3TCAA 2C7NB 3ZDTA 1OEYA 2Z6KC 1N33Q 4QJFA 2C35B 1QVCA 1VRAB 4JQWC 3OYYA 2J0TD 4HCPB 5JJKA 1RHPA 4CBVA 2K39A 4RF0A 4NPSA 3P75A 4FLHA 2ZCBA 1BR9A 1TIFA 4KHPL 2KT7A 4DAPA 2WV6D 1PH8A 2LGXA 4II2B 1VR9A 1VS0A 3BU2A 4OW0A 2M9VA 4G7OC 2K04A 4OWWB 3APFA 3L3OC 2UUBL 4MHEA 3QARA 4HXDA 1KQSA 1VQEA 2KHIA 4XYQA 1GUNA 1VQKA 4OVUA 1HXYD 3CQZB 3VR8B 3AE5B 3I63C 2LY7A 4Q5VA 4KKUA 2HHHL 1MHHE 3RMKC 4C3HH 5G2NA 2E76C 1V81A 4AJWA 1WGDA 5C44G 3AFPA 2LJ5A 3PUWA 3IXSA 2A4ZA 3QWZB 2PI2A 1WXQA 5M5WB 4US8A 1BMLC 1U4MA 3TZDA 1TY2A 2ZPNA 3B1LX 2VS1A 1Q8IA 3I2ZA 1KIXA 1JRUA 4B3MQ 3OSOA 3ECIA 4G0NB 4HCNB 2VL6A 4C1NK 3S16H 4KLKA 1QVFA 3ZW3A 3Q3MC 2HJ1A 4N8FA 2WGSA 3A56A 1PH3A 2L1AA 3F2DA 2AWOA 4DAMA 3P4QB 5DPRA 3J81j 1G6PA 5EKLA 1DONA 5ISRA 2UUCQ 1AH9A 2ZVOA 2OOBB 1WE6A 2MNAA 1I94Q 5EQ0A 3HFZB 2KUMA 3AE9B 5G3LD 1SIJA 4OXPA 1CSPA 2UUAQ 1V8CA 4GN1A 2IY1B 3D0FA 1CK1A 4L6TB 2SNSA 4OELB 2PLPA 2JA5G 1WM3A 1STGA 3S15B 1A8VA 1PDXA 2E2IB 1C79A 2F52A 3W1GA 2ASBA 1QOBA 2DX5B 2WYQA 3JYUA 3FKIB 3LWEA 1Z5SB 2JA6B 3UI3A 4J1MA 5FO8B 1YI2A 4LNFA 3A5ZB 1HNXQ 1JROA 2CJOA 4DV6Q 4A3IH 3GTKB 1YN3A 3OTOQ 1O80A 2FMMA 5HGTA 2UXCL 3UDGA 5LXIB 2JPHA 3BK2A 1B3QA 3RD4A 4DV5L 3GTMB 2LGSA 2LHDA 4JWSC 3I4NB 4HMIA 1G91A 3PVLA 4CDEC 1SSNA 3STBD 2UXBQ 3H1UA 2VZAA 5T8IA 4BY7B 1FXAA 3S1MB 3M4YA 4A3KG 2GBMA 2EJFC 1IL2A 4TQUS 1EIYB 4NXNQ 3A4SC 2D0PA 3U30A 3DEPA 2Z6KA 2N1WA 1R4QB 2K33A 2ZTDA 2ZTEA 3A0JA 4CO7A 3D4RA 3CRKC 2ZZPB 1E8WA 1J9OA 3AI5A 3E3XA 2YTVA 2MO0A 2FIFA 4L5TA 3PO2G 1ZDVA 4IFDH 4LFBQ 4AQYL 1EL0A 1GUTA 3T56B 2A6ED 2BWFA 1QF6A 2MBEA 4A3LH 2LGYA 1V97A 3I4MB 2B39A 4Q2JA 2UWQA 4LF5L 2DNFA 1CKNB 1HUMA 1CSQA 1EIFA 4OX9L 4FF3A 1HE8A 1AZQA 4K2LA 4KZ0A 4UPAA 3L17A 4A3JB 3W3AA 4P6VF 2MBQA 3VUWA 2K32A 1WJ6A 2X38A 1JE5A 3HZXA 4A3EH 1R4NB 4O0AA 4POGA 1E8ZA 1MFWA 3OMCA 3TSSA 3WANA 2L11A 2J4XA 5C3EG 1I4GA 4K8JA 3BS1A 1TU2B 4HRSA 5D65A 4EQOA 3FC4A 4IJHA 4USAA 5C23A 2ZXOA 2LVPA 1K8MA 2PYKA 4IQZA 5FJ8G 1VQ5A 5DCNA 1I50B 2NPTB 2ZVNA 2FFKB 4K6DA 1EF5A 4NAWA 3KUPA 4ZRKA 1WXAA 1HUNA 3KLSX 1K8GA 1SYEA 5T1GA 3VDZA 2JXTA 2EELA 4URKA 1SYFA 3OIQA 5CYUA 2NWGA 3R7RA 1OGWA 3QX1A 4WJNA 4JW0A 2CCZA 4DWFA 1PYWD 4DUYQ 1ENAA 4C3IG 5I6WA 4RA8A 2MQJA 2NB0A 3QOJA 2ONQA 1RFAA 2WXGA 3AULA 3VR9B 3PO3G 2JRIB 3Q22A 1J7AA 1B70B 1BOSA 1RD9D 2DY8A 3MXNB 1JJGA 1WX9A 2C7MB 2EXZA 5FLXL 3AMUA 3RZOH 5C4XB 1YD8U 1J7BA 2KQ4X 5KRUA 5EBCA 4JI0Q 2C5LC 2MO1A 2ID0A 1CZGA 2MGSA 1K0SA 1XCTL 2K4KA 5IP7G 1ASZA 3D4WA 3SK8A 1L4DB 1X65A 2KAJA 4HK2A 3J80i 3EFUA 1X3GA 3QC8B 5KGUA 1XJVA 2FNJB 2EYMA 1YZ6A 4PQXA 1DOKA 3S16B 2GBKA 3G6EA 1UF0A 1Q86C 4XDXA 3ZTCA 1JJCB 5M5XB 1B53A 1J6QA 1WF9A 3CP0A 5ELFA 5IKCM 1EEID 3UE1A 3OWFA 5LXHA 5EGTA 1DOXA 2YV5A 1A63A 3WWVA 1DGSA 2BVCA 1V86A 1J5EL 3BZKA 2RSUA 1FVIA 4JCVE 4K0KQ 1WJNA 3I3TB 1YHAA 1SJHD 5AFWA 2F4IA 2Z8LA 4C3JB 1CMXB 2HTME 2HDMA 3H6MA 2Z4HA 3GE3C 3M85A 3CMAA 3VTWA 2WXLA 3SK6A 1KLVA 4C4VA 4N9PA 1D1KA 1Q90A 5IYCH 3GTGH 1HHVA 1VQ8A 2J7ZA 2DY7A 1HZ9A 2AX5A 2IGDA 4OONA 3TBIB 3FAHA 1E7PB 1WFYA 1OQRA 3P4SB 1IUEA 1UWVA 2E6XA 1U9RA 4A3IB 3LWUA 5I2YA 2G9DA 3M4PA 3PUYA 3AE8B 2DYOA 4MM3A 2XEWA 4X62L 1QVGA 4WH4A 2R7FA 3I70A 4A3CH 2PJHA 4EZLA 1PUTA 3ZDMC 2MBHA 4FN2A 1I35A 2D62A 3F2UA 1JALA 5CTRC 2M2LA 4A93G 2R92H 4GDLB 3TIXA 4A3GG 4YCWA 1W6KA 2QEJC 1S5ED 2XIWA 4DAYB 1BVSA 2DZKA 1II3A 3MFYA 1SB3C 3HHMA 2JSOA 3N1YC 2Y3AA 3OIPA 3F2BA 1X54A 3PSIA 1S5BD 4DV0L 1NI3A 3TP5A 4D2KA 1D2BA 3D8GA 4X3TA 1QOAA 3GTLH 4LJPB 4HSPA 4MSQB 3B2FA 4O2DA 3HOXG 4I65A 1U4RA 4OZAA 2ZJPA 1S1QB 4BY1H 1FEHA 2ICIA 1F9SA 3M3YB 1FD6A 3MXUA 2WXRA 3QIAA 1KC8C 1XLPA 3DHHC 1PHJA 3MHZA 4AJYB 5BYQA 1WTPA 1J7CA 2L15A 2OEDA 4LF9L 1XPRA 3X3MA 3EA6A 2MHVA 3I7FA 3DXJC 1WYDA 4TVAB 3MWYW 2RDBC 4JE3B 1IBLL 3ERSX 1HCZA 1E8XA 4JC0A 3CMMB 4HEDA 4FVMA 1V6EA 2PZTA 1NR2A 1C9FA 1SYBA 3SXHA 2WINB 5I2XA 4LF7L 3TREA 5BN5A 5HHDG 4QAYA 1EIGA 4DHJB 3L2PA 4FXCA 3GO5A 2WDRB 1IZ6A 4RG1A 3RULA 3BY4B 1V9PA 3NK9A 5IT9E 2I1JA 2KVMA 1GUWA 2NZHA 3B2GA 2KEDA 3A74A 2PW5A 1O7LA 1ILQA 2MBBB 3DBLI 1ET9A 5CV5A 5BYRA 1DM0B 1SR3A 3PUZA 4PZ7A 2C7HA 3F1ZA 3QR8A 3LX0A 1S5DD 3H7PB 2BYFA 3MJWA 1SMXA 4BA1I 4DV3Q 1C4CA 4KSKC 3NVWA 1ZEQX 2DZMA 3CCQA 1VZ7A 2BW2A 1L0WA 2JA7H 1SGHA 4C3HG 3B6YA 2LASA 3QIJA 1B9NA 2LFNA 4K1RB 4BWGB 4K7UA 2M4NA 4PG3A 1KXLA 1TY0A 2A74C 2CFMA 2N78A 1FRRA 1L2NA 2VUMH 5CHVC 3ZYYX 3BJUA 2RQXA 2D3CA 4G4KA 2KQ7A 4KX6B 2TSSA 5JH5C 1X3PA 3N20C 5DPWA 1WTRA 1PTOB 2MX2A 1WRIA 3K80C 3PRPB 1L1OB 1BBXC 1GAQB 1MVKA 1UE6A 4HIKA 3BINA 3L9AX 1L6UA 1WX8A 4BKSD 1WCMH 5FLMH 1XLNA 2OJWA 1HRJA 4IC7B 2NZ1D 3QCAA 2PPHA 2HCCA 2RHSB 3DUZA 3JC66 1C7YA 4EGVA 3HOYH 1P16A 2INCC 1IP9A 4GLXA 3DM3A 2CR5A 1A0IA 1SDFA 2K6AA 4F7XA 4F8CB 2FE8A 3MAQA 3KF6B 1MIUA 2SNMA 5KNCA 3TDQA 2NVQH 3Q3OC 5AZFA 3HOZH 2WXHA 3K0XA 4ZHOA 3QJZA 4GIVA 4OGQC 4LCDE 1JW9D 1P3QU 1PH5A 2WKCA 4QY7A 1WGGA 1YITA 4JI4L 1HEZE 5MPOA 3HP3A 3VXWA 1YN4A 2F0KA 1YNXA 1Z9FA 2K52A 2PCFB 1K0RA 2O6VD 1TWGB 3RYTA 1S72A 5IGCA 3J80c 1WTWA 2KDFB 5DPSA 3TP7A 1HNZQ 2GMIC 1IYJB 2YYZA 5LMNW 2JYEA 2YLMA 4GNXB 2QKIC 1CZPA 4OVZA 4PMCA 3HRDD 1ZYRD 1LYLA 3A9JB 1EQRA 2R93B 2Y5CA 3EC8A 3D6WA 5G5HA 1OO9B 1V80A 3ZJTA 1VQ9A 4RFBA 1E1OA 3T1YL 1KRTA 1DGJA 4NP5A 3DLLA 4XQNA 2F0LA 2F0MA 4A3FB 1ZXIA 1A3UA 4YWMA 4JBKA 4NB3A 4OWTB 5DLQE 3VYTA 1XO3A 4KTAA 2F3IA 3LGJA 3Q6SA 4XIGS 5DEHA 3SHLA 2KFJA 3AECB 3VAWA 1CKNA 5L95C 4TSSA 4IJLA 2WIIB 4IFDG 4RAUC 1HR0W 3VRBB 5C5LA 3KH0A 4MH0E 3W1SC 2EMTA 4BOZB 2IPKD 4A3LG 3J81c 3PIOA 2HD3A 1WGRA 3H3VH 1TKYA 1SE2A 2LGDA 5JVG3 3T16A 1YX6B 3IFWB 4RCNA 2KECA 3K5OA 4R8IA 4OWXB 4DK0A 1Y8RC 4ZRQA 4EKUA 5GQOA 1M90C 2FUHB 4ZOHC 2DAJA 1Y1WG 1DZ1A 4A3EG 3ZRCA 5K36H 1ESFA 1MSGA 2NCNA 1GKHA 2DYBA 2J0KA 4P1BC 2NPTA 4BKTA 1JE4A 2KCNA 2VXWA 3VYRA 3TS2A 4XDDA 3I72A 1YQ3B 5GROA 3D31A 3H91A 2JA8G 1E2WA 3RLFA 4JI3L 1UH6A 3GTOH 3U7ZA 1EY5A 5LMUQ 3NUHB 1O7YA 1YJ9A 3APDA 1VCIA 1IYFA 5CV6A 1KAWA 3N6RA 2KKCA 1TR5A 2F0HA 2K14A 2IYDB 3HM6X 3DHQA 1ZGUB 4HIOA 1KL9A 1UEAB 4K2KA 2RPQA 4OVVA 1IBML 2GB1A 4JL9A 4HKZE 1XTCD 5IO9A 2MPMA 3MXNA 2Z59B 3ER0A 2REXA 3D32A 5FR3A 5FKAC 2ZM6L 4DR2L 1HFGA 1WMHB 1AYFA 2KCTA 5JVH3 5G5GA 1KTKA 4DUZL 1XX8A 1B44D 2NBFA 3TL5A 2K05A 2PO4A 1PZKD 3SGIA 1W2BA 3CPFA 2H89B 3AE3B 4E71A 2HQEA 2RDHA 5FO9B 1UWMA 1PFDA 2SAKA 3PSEB 3CC2A 1HTLD 4HPPA 2A69C 4TUUA 3ZUNA 3EECA 3GV3A 3TMEA 2WXQA 5COYA 1N9WA 2KMAA 2QDLA 2KLGA 4MEMA 2MJEA 1K3BC 4HJAA 3T3OA 3H8HA 1I6HB 2KZRA 4ICUA 3OAWA 2GRIA 3ZVVA 3VYUA 5EKIA 3OG5A 1H9SB 3Q8BA 5HGQA 2DLBA 2W3SA 4LNOA 3RI7C 3NQIA 4IUVA 2RDFA 1VMPA 3RT3B 1V2YA 3Q14C 5EE9A 3GP7A 2B2WC 2EYJA 3L10B 3HOYB 5DM63 3NQTA 1DJRD 2EPBA 5M3FG 1R4NI 2IL8A 4LDTD 5EAYA 2L8JA 2B2VC 4C2MB 2RPVA 2JZ3B 3PMFA 5IE8A 4R1JA 5D94A 4B95A 3NHEB 3GDEA 5IYCG 2DUDA 1ZP0B 3TQYA 3BVZA 4A3MB 3J7A5 4W9HA 1MBYA 2B2TC 3RUZA 3CCJA 4DXGA 2BT6A 4KV2A 2JXXA 2Y5PA 1KRHA 1MI2A 1BCPD 1F9RA 1O7IA 4GN4B 3W1SA 4NW2A 1YJWA 3M9BA 1B9RA 2RD0A 4GDLA 2EQSA 4RGNA 1IKMA 4QIWB 4R4QA 4P75A 3ULJA 3WOEA 5LL6X 4DAYA 4A3CG 2NVUI 3JSVA 4PYUA 2A5HA 2EYHA 1RKNA 4IPDA 4L23A 3S2AA 2R92G 4R4CA 2F0EA 4Y52H 3RLNA 1WGHA 2N4FA 1T0RC 3F8TA 3AEFB 3RR5A 2W55A 1R9TB 4DHZB 1TWAH 4DQOC 3JAME 2KOXA 4XXEA 2OEOA 1TBEA 2AUJD 4XT1B 2KO3A 1ACCA 2Q2UA 4M02A 3T1HQ 1N33L 1GO3E 2B2YA 1MJEA 1HNWQ 2B76B 5J22A 3KYCD 3M4QA 5E6NA 4HDOA 1PGBA 2WP9B 2I5HA 2Q8RE 4GNXC 4QCLA 3RZDH 4BY1G 4JI8L 1VDVA 4WAFA 1B2TA 3L54A 1TIID 3CCRA 1JB7A 4DR1Q 5C44B 4IOIE 4A20A 3VR2A 4LTUA 2RSOA 1BQQT 1X9NA 3A1QB 1CZWA 1LACA 2CKZB 4E3CA 3M4OB 2PW7A 1NBFC 1XNQL 2K5QA 4P1CC 1IXRA 4DR5Q 1PZJD 3ETRA 2JEBI 4MSMB 4FA6A 1E3PA 2OCEA 3GTQH 2L55A 4OO1I 1F2RC 2KHWB 3HRZC 1EU3A 4FNFA 2K8HA 2KMCA 1I4HA 1HR0Q 1L4ZB 3DBRB 3H7PA 3ZXVA 3AE2B 4HLEA 5TSSA 5ELDA 1Q1OA 2QJLA 3S2HH 4GB9A 2KTRB 2CVRA 5C1ZA 1YNNC 5IIFA 3J7AV
chains in the Genus database with same CATH topology
4FF4A 5A35A 2PZUA 3MVVA 1E9MA 2KQ3A 2JA5B 2AQ3B 4JBWA 1VZ8A 3ZQ4A 1YNJC 2EZVA 1Y8PB 3DM1A 2E3TA 1BF4A 1OFFA 3A7LA 1QOFA 2PMZB 1E6EB 4DXFA 1LTRD 3I9V1 1ZKOA 3J80E 4CKCA 3D4DA 2B8GA 2WS3B 1AW7A 4J3OD 4A3KB 2C9OA 3FRPB 3HKZB 2JU6X 3E9SA 1FR3A 3NHHA 4GDKB 5HFYA 3HGBA 3NUCA 4PNYA 1B1ZA 1B3AA 3PO2B 2IX0A 5E6JA 1JWUD 4KV6A 2N55A 3NP8A 1SBBB 3IFTA 4YSYB 1A70A 3U4EG 2NVXB 3FILB 2F0UA 3J81E 1Z47A 1Q3LA 2IW3A 3NVYA 2LGIA 3I8ZA 4NKLA 4BS9A 3NZ3A 3PO0A 2WQYB 4N9TA 1J8IA 3GS2A 3NPPA 5C3EB 2SOBA 5ELEA 2NN6H 3CU7A 1BNZA 4IZ8A 3OW7A 2ZW1A 3T4AC 4X3UA 2EY6A 1HTPA 2L12A 2O2LD 5CV9A 3URYA 4J6HA 3U9SA 2F0DA 1IYVA 1C4QA 1FXIA 1A3TA 5C0XH 2XVSA 3GB1A 1SNCA 1I4RA 5EKKA 3MP9A 1FCCC 1AP0A 4C3IB 2K9XA 2O5IC 3PO3B 4RH6A 3HEJA 3MHBA 1LT3D 3AE4B 4N59A 5K36G 1DOMA 3I90A 1NAPA 5EPKA 3MXPA 3SDZA 2A68D 2DN8A 2EY5A 3TP8A 1LT4D 5EJWA 2L52A 1MSHA 3P63A 4HEA1 3I57A 4LK1C 3H3VC 5EE0A 1Y69U 1W6JA 5H92C 2KCCA 2F0TA 1KAAA 3DWPA 2R61A 4BA2I 1PXUA 1N61A 4TRDA 3BZDB 3EQLC 4NJCA 4KD4A 4DNRB 5JOBA 1GPXA 1I3QB 2KHSA 2EOTA 1EY0A 2NYZD 4HROA 3Q8FA 3A8IE 3S2DB 3VYSA 2CW0D 3S1RB 2FJ2A 1LV9A 1AFPA 2J42A 1RTNA 2WU2B 1FNVA 1BO0A 2IDYA 4KHZA 2MUYA 4A93B 2GA4B 1D4BA 4OIKA 4A3GB 5EPLA 2F3VA 1BCPF 3IT6B 3Q8EA 4Y7NB 2BA0A 5CV4A 1LT5D 3D6CA 3QJYA 3HOXB 2BE5C 2V4DA 1PFBA 1E2VA 3K58A 5D14A 2H4OA 4L63B 2JSVX 3P20A 2K03A 4YTNB 4LAAA 3C2PA 4WURA 1CFMA 3K6OA 4I7ZC 4KI0A 2KJXA 3OOCA 5F2DA 2BS3B 5CBAE 1QOGA 3KWVA 1ET6A 4UDUC 1EY6A 1A2UA 2BA1A 4CJ0B 4DNTB 4HCEA 2WXNA 4HJGE 1KLUD 2EJMA 1FMAD 2KDMA 4YXDB 4KJNA 3BYTB 2L83A 3P7JA 3EFXD 1G2SA 4QUCA 4ZK9B 3B9JA 4C3HB 2WXFA 2RKSA 2JYTA 1RF2D 2PQEA 2KA7A 2JZPA 2MP1A 1GUGA 5JAVA 1XYIA 3OWEB 3N9YC 2ZXPA 3ITPA 1H9MA 2WXMA 3SK5A 3GD7A 3P42A 3P1MA 1C4PA 2N0SB 1RJTA 1SEBD 1U4LA 4K5VA 3ZGZA 2RA4A 1NR4A 5IGGA 3VRAB 4N6EB 1T3QA 4LMQD 2A68C 2OHFA 1RWSA 1PMRA 2MJDA 3DWMA 3FMCA 4V190 2EE1A 5LHY1 5A2QL 4XE0A 4K8IA 1Q1EA 4IUPA 5CV7A 3V96A 3K57A 2PTLA 4K5WA 3KLSA 1ZDXA 1TWFB 4M1UB 1GJXA 1WGKA 1RFKA 1DD2A 1CJEA 2TMPA 1HZ6A 2EYPA 1T5XD 2CJNA 3PZ8A 3A54A 3E0JA 3E5SA 1EY7A 1WTOA 4TKOB 3K5MA 4K14A 1JWBD 2NTTA 1L0XB 4NDXA 5CR3A 1Y56A 3A8KE 5IGBA 2JEAI 2JYOA 3M7NA 2RBMA 4XWWA 1CHPD 2GI9A 1KLGD 1EU4A 2DNEA 1DOIA 3WCQA 1UGJA 5KYLA 1JB3A 1Y1WB 1K53A 4A3EB 4IUUA 5DNFA 1V8QA 2J53A 3RFZB 4EQNA 1E0BA 1SNDA 2A6EC 4WIPA 1LTID 1LTTD 3AEDB 3BIID 2NN6G 2YEPB 2JA8B 2ZT9C 3NE5B 4H44C 1CA5A 2EVBA 1QNUA 2F0IA 5LL6S 3I4LA 3TN2A 3FDTA 5IGDA 2BB6A 2PPBC 2KACA 1HPCA 4RKLA 2M19A 5C0XG 2F3WA 2WKDA 3BDOA 3QWNA 2EY2A 5JPMC 4MIUA 5AUKA 2R6GA 1N5WA 2ZXRA 2LEKA 5ELBA 2A73B 3C8YA 1JQYD 3NTHA 3RZOB 3C1EA 3E56A 2LJIA 1I4QA 1JC7A 4RCOA 2B8FA 3DEOA 3N52A 5E1FA 4NZLB 3IAYA 2DNCA 1UUPA 2I2YA 3OPOA 3V3XA 5E4WC 3T51B 1R4PB 2HDLA 3K5LA 3V05A 1RM6C 4MT5A 1QILA 1GUOA 1SNOA 3AEGB 3SE0A 2NUCA 5M3FB 3Q8AA 4XTCS 1YN5A 2XWJB 1RDPD 4CJ2C 1KDCA 3GTGB 4X3KA 4ZKCB 4RNAA 4KY5A 5CORA 1HFNA 2BTEA 3VR5A 5FLXE 4WRDA 1YNTE 3ABVB 4RKBA 2HDEA 1STBA 2XSCA 3ERQA 2SDFA 1ZOYB 1NUCA 5GXGB 2XNAC 1FNWA 3W2DA 3AV8A 1T5EA 4AS1A 1IYUA 3MA2B 2R92B 1H9KA 1X32A 4KY7A 1HQMC 3OHXC 2LS01 1K8OA 1OXTA 3GTLB 1KDBA 2RDGA 3K5NA 1FGBD 4BY1B 1SNPA 3VR3A 1NYRA 2B2UC 4ZUIA 5E3FA 4TQ1A 1EQTA 4ZYSA 2QSDA 1PFMA 3NSWA 3S9WA 1IGDA 1LTGD 1L6VA 1TQOA 1TKWB 5C0XJ 2F0GA 1GHJA 2WP8J 5C5MA 4RGTA 3P1HA 4Z9CB 1ENFA 1A2TA 4H2AA 1CT1D 3W5UB 2QIEB 1EY9A 3FPPA 4XQJA 3TP6A 2NMQA 4Q0FA 4YTPB 3AN1A 3AMZA 1WTQA 2VZKD 3J80L 1WTVA 1LTAD 2JA7B 1N5XA 2WXKA 4HMJA 3C1FA 4RF1A 1D5MC 1WVLA 2VUMB 1G6ZA 1MPEA 5FO7B 1Z7TA 4DK1A 1O78A 2XRSD 4HTHA 4FF2A 3KF8A 4AYBB 2D9UA 4ARCA 5IGEA 1UAPA 4FXKC 3GV6A 1WCMB 3A7AB 1SJED 2A6HD 1VLBA 1PDQA 1SFOB 1LABA 2E75C 5IODA 4KMUC 2KWDA 1C78A 1PRTD 2BDNA 1EFID 2L0CA 2NVQB 3HOZB 3HS0C 2ZW0A 3FEWX 5CV8A 1KH0A 1STEA 4FXGC 1BCPB 1STNA 1YQ4B 3O13A 5I9PA 3EGRA 2CHBD 2XN9C 3H94A 3DWGC 4R3DA 1JQ4A 4DF7A 2WDVB 3QG1A 3HVZA 1FYCA 3H09A 4XWTA 5KNBA 2B63B 5I6YA 1SYGA 1WWTA 2V3PA 4F8MA 2K5PA 3D3RA 3TZUA 1JMLA 3NWTA 2F1MA 1QCBD 1VJKA 1C77A 4EQPA 2N9LA 3RMHA 1ZYRC 4DN4M 2K22A 1SE4A 1XWEA 1KNAA 1EQVA 3L7ZC 3Q23A 2FMCA 2IX3A 2W54A 1E2ZA 3NVZA 4U68A 3NBIA 2PVOD 1GB4A 5EE3A 1L0YB 1F0ZA 4NAWB 1ROEA 4WFN3 2J52A 2WACA 1TS5A 4OHJA 1TS4A 2QCPX 3QOLA 3GTOB 2EY1A 3MJ5A 4REZA 4QF4A 4RHRA 5I4DA 2H88B 3ZJUA 5JXVA 2FHTA 1HA6A 1WTXA 4YTMB 1IGCA 4CQNA 4A9AA 1JOQA 3R2TA 2B2WA 1L5PA 1JRPA 1U4PA 3E6ZX 5D3DA 1MI0A 1O7ZA 2B2VA 1E0ZA 1FFUA 4O1NA 2Q5WD 4PMBA 4KK7A 1B4OA 4ITKA 1Z6HA 1SXTA 1MD2D 2B2TA 2ACZB 1DCZA 4IFDI 1B50A 1PTOF 1V1PB 4IUNA 1OQQA 4KKJA 2WXJA 1C4AA 1KNEA 2PVGC 1F77A 1CI3M 2BS4B 1KDAA 4C7YA 1F2LA 2K28A 3SFEB 1T6BX 3SFDB 4HN7A 2IJ0A 5M3MB 3PUVA 1HQRD 1M8AA 3C3LA 1K51A 4LK0M 4JWUC 4WQMA 2CU3A 2K01A 2JX5A 2O5JC 5LNK1 1A3VA 3IT4B 4G57A 1E10A 4M0WA 1EM7A 1CQFA 5KYIA 4YSXB 3IKJA 4R8NA 4DA2A 3SEBA 2L1BA 1BCPC 5E4XA 1TVXA 1TWAB 5HG2A 2BCOA 4XYOA 3G6JB 1S4ZA 1N60A 3LB8C 5IGFA 1KFYB 3RZDB 5BMIA 3NWSA 2KOLA 1OXSC 1ILPA 1D5XC 4ULLA 2DBYA 1NEKB 3PUXA 2JXMB 4WORA 4DAVA 2G9HD 3SR1A 2ENBA 3GTQB 4RWSC 2BB5A 1STHA 1JORA 4A55A 1EY4A 1FNUA 1K50A 2FINB 2XWBB 2F0SA 4A8XC 3KLRA 2C5CA 5DM73 1IW7D 2O4XA 4IN3A 4EVOA 2QDBA 1JCKB 3ND9A 3S2HB 2VNUD 2MEKA 3NTKA 4ILWA 3A55A 1IBXB 2E74C 2XRQD 1BXTA 4QUFA 1EWYC 1FO4A 1DOLA 2JE6I 3QB3A 4O42A 2F0PA 3I3CA 1I7HA 1LTSD 3Q69A 1V43A 1L0VB 1EYDA 1SNQA 3T3NA 4NMZA 2F0WA 3M7GA 1XCQL 5C2TB 1NCVA 3HOWB 4CJ1B 2BS2B 1PRTF 4ZAIA 3J7AF 4OO1H 4KD3A 1H9SA 2OXPA 3BVGA 2LHEA 3W5VB 1FD7D 1F2RI 4QB4A 1QE6A 3KBXA 3BK1A 5JEAJ 2BBCA 3R93A 1V1OA 2L32A 2F0NA 4X3SA 4TQ0A 1STAA 1N62A 4N58A 1BDOA 4KN7C 5HI1A 3FVQA 3AB5A 2ON8A 1IHZA 4CGYB 3AH7A 5DAUA 3R8BA 3BVMA 2F0JA 4MACA 1K83B 2AQ2B 3EVQA 1IL8A 5IT9L 3J9CA 1AZPA 2EYOA 1QB5D 3IFDA 4G7HC 3GTPB 3GQBA 5ELCA 4B9XA 4HKQA 1JWSD 2RMMA 4IURA 1PGXA 1ICWA 3BYYB 4XQQA 1OXXK 1CTMA 2EJGC 2IX1A 3U9OA 1YMHE 2W82A 1TWCB 4ZHPA 1D6EC 3S14B 2K1BA 5I9OA 2K5DA 1A15A 5EBDA 2IGGA 4LLGM 1MGSA 4ODGA 1GB1A 4M8AA 3PIP3 1NSNS 2DYMA 1QQRA 3S17B 2K3UA 3MTSA 1EZ6A 2EYLA 2L9HA 3K7AB 2VB2X 3LYYA 3MFGA 3TEZA 2WAQB 2HUGA 1F9QA 1KABA 2F0OA 5C6AA 1K52A 4ID6A 1PGAA 2G1EA 2FUG1 5J39A 1P7FA 1SSOA 2Z1CA 2FBWB 3TEWA 3IAS1 3AE7B 5FK9C 4B0EA 5BMGA 4R9WA 4ZUJA 1EZ8A 3PV0A 4GZYC 1PTOH 2BDOA 3GTJB 4KY6A 2HCIA 5M5YB 2MJ3A 1QKZA 4L8JA 3BDLA 4IUTA 2LFIA 2KEEA 4KKTA 2Y0SB 2I46A 3NXWA 1IW7C 3LXFA 3I73A 2RVLA 4DFAA 2N9KA 1SNMA 1V1PA 1Q1BA 1EWHA 2KN4A 3HOVB 1JWMD 1LLRD 1B9MA 1F2YA 4F87A 1PZID 5BN4A 1DOYA 4C1NI 4HSVA 1HZ5A 2WXIA 3SK4A 1RTOA 5EE1A 1R7SA 2CW0C 2Z4IA 1I4PA 4FP5D 4ZQ3A 3FILA 3TUOA 2AQ1B 1C8CA 3AU7A 2BYTA 1DXMA 2WNMA 4CHTB 3IAM1 1TT2A 2F0FA 1F2ZA 1OXVA 1QG7A 1ZXHA 5CBEE 3KBGA 3QO2A 2QILA 1VZ6A 2PZWA 4OIJA 3S1QB 1YJIA 1SE3A 1RYJA 1UWXA 4OZBA 4KN4C 5H8YE 1AWDA 1JWAD 2X6GA 3ZJVA 5IOCA 4B08A 1SF0A 1QNKA 3MEHA 1I4XA 1S5FD 3DMUA 1ONLA 4P16A 3CKIB 3IL8A 1JR0D 5C4ZA 3ND8A 4KHVA 3X3NA 3SR6A 2R7ZB 1GUSA 2AUKA 2BOSA 3P4RB 1Y8OB 3RPFC 2F0VA 1CHQD 3NTIA 1IKLA 1I6VC 5CGKA 4HAEA 2R3ZA 2OT2A 2M0AA 5K5PA 2MJ8A 2A69D 1YJJA 2E2HB 4H7BA 4OL7A 1ZXTA 1KF6B 4ZLTF 1Y8NB 2E2DC 1RCVD 1WD1A 1HA5A 3NBHA 3Q0AA 2MH7A 1IBXA 4WWMA 1XLQA 3KK7A 1LT6D 1CQVA 5G3LF 5FOBB 3L4PA 1CM9A 1EIHA 4P2CB 5JPNC 3VA7A 4ZKBB 1PTOD 2Q8TA 5JEAH 1EY8A 3MC0B 4S3SA 4E6IA 2RSNA 4MN3A 4IUQA 4C80A 3K59A 2PNRC 3KQ4A 2I38A 3JAML 4LJZC 2LMCB 3AE1B 2WXOA 2NTSA 1JICA 4C3JG 4OO1G 3J7YW 1C76A 2JQRB 3WDNA 5BMHA 3NRZA 4ZRPA 1FCLA 3DWQA 3UI2A 1TS2A 3PIO3 3AE6B 3H0GB 3C46A 3SVMA 2H1EA 1EEFD 1FRDA 2IWHA 2K0PA 3CIRB 4DU9A 2WB1B 5JJZA 1QWYA 3NVVA 4J8QA 1JOOA 4A90A 5A2QE 1VMCA 2ICEC 1ZE3D 4H13C 4K6LA 4PMWA 3TEYA 3FPUB 2INPE 3CWIA 1GXDC 4C7ZA 5BN3A 2VB3X 4HR7B 2V0GA 4GLSC 3OMGA 2NVYB 2WU5B 1NYQA 2X69A 5C3WA 1CA6A 1F2MA 4A6QA 5KIXA 2D2CC 5BYSA 2E2JB 3HUIA 4AQ7A 2M56B 4JK1C 5D3IB 1GHKA 3HVDA 1RODA 3S1NB 1YNND 1G8ZD 2LKVA 4FXDA 2VZKB 2INNE 1YNJD 2B2YC 3W9CB 1G2TA 1SMYD 4QMGA 4DGZA 3NS1A 1C48A 5KEEA 2WLBA 4KGTA 4KGSA 1EYCA 4U673 1ML0D 3T53B 3TEXA 4XDCA 1QT9A 4YIJA 1VF7A 2EDGA 5NUCA 2M00A 2DWQA 4FYDA 1P7EA 3P4PB 4H0LC 3J81L 4EE2A 3V2TA 4US9A 3CHBD 4ARIA 3DWAA 4OZCA 1PRTB 1LTBD 1FIQA 1WD0A 2N88A 4YSZB 3K0YA 4JX1C 3AEAB 4PT5A 3EJIA 2V3NA 4PV1C 2NN6I 4C56C 5C3XA 3BWUD 3KWLA 5HURA 2QMTA 4RGMA 4RHSA 3R3OA 3VR4A 2B2UA 4B9WA 4K5XA 3A8JE 2YU9B 4V0BA 4A3DB 4ABNA 5C0XI 3CRLC 3Q24A 1PTOC 1SAPA 4WJWA 4BBSB 1TWHB 5CC4A 1TZOA 4YT0B 2AWNA 2LUMA 3EROA 3AEEB 1EYAA 3VA5A 4UAIA 1XEEA 3AB9A 1VF5C 5T1IA 1Q10A 3MXGA 1TKEA 1M4VA 2I07B 1ZPSA 4BBRB 2X6LA 4L2YA 4NAMA 1GOZA 4TMAB 3U52E 5AUIA 1XLOA 2L5TA 1H9RA 4IFDJ 4KGRA 1AN8A 1FM0D 1JOKA 3VQIA 1NENB 4B0MA 1BUIC 1WSPA 1DYQA 5EPJA 1PFNA 5CMDA 4MH8A 1EWCA 4L1BA 1D1IA 3ONAB 1FFVA 2F03A 1UNSA 3BG3A 2QF7A 2D5DA 3HOUB 3T13A 1STYA 4ZRZA 5C3JB 5C4HA 1Y1VB 1XF5L 1H9JA 1TJEA 5J1ZA 2V4IB 2W3RA 3LNNA 2YEPF 3I91A 2WXPA 5C4JB 1F9PA 2IT1A 1G291 2K5WA 2PW9A 2WDQB 1WYGA 1VDZA 4IDIA 2SEBD 3EUB2 1LO5D 3G7LA 2KMMA 4RGOS 3VR6A 4JPSA 2Q8IB 4IALA 1TYGB 2EYFA 1ESRA 4CKEA 3BDCA 2JP1A 1PLFA 1A6XA 4HCSA 3HG9A 4CKBA 1XXGA 4A3BB 1BUVT 1EOTA 1AEXA 1SMYC 5M9OA 2PKOA 1S5CD 4FF1A 3WOFA 1Q12A 3R2IA 1D5ZC 1QLBB 4KJOA 2CQAA 4KKIA 2OF1A 1QJOA 1OXUA 2BE5D 4FO2A 5JEAG 2JWUA 4YWGG 1TKGA 1MHXA 2LMCA 4MM3B 1X3QA 2A6HC 4IKGA 3U2SC 1ZUD2 2F0QA 1SYDA 1ENCA 3PZ7A 1PRTC 2IGHA 2PMVA 2NVTB 2PIAA 4G7ZC 1SYCA 2D5GA 3Q8CA 2L4NA 2K7VA 3AM9A 2EKIA 3MZ5A 1N63A 4F88A 1TS3A 1QOHA 2N7JA 4KKSA 4ME5A 5D7GA 1NVID 3AEBB 4XT3B 5KNDA 1VRAB 2J0TD 1RHPA 4CBVA 4RF0A 3P75A 1BR9A 4DAPA 2WV6D 1VR9A 4OW0A 2M9VA 4G7OC 2K04A 3L3OC 4MHEA 4XYQA 1GUNA 1HXYD 3CQZB 3VR8B 3AE5B 2LY7A 4Q5VA 4KKUA 1MHHE 2E76C 3PUWA 3IXSA 1WXQA 5M5WB 4US8A 1BMLC 1U4MA 3TZDA 1TY2A 1Q8IA 3OSOA 4C1NK 3A56A 2L1AA 2AWOA 3P4QB 5EKLA 1DONA 5ISRA 3AE9B 5EQ0A 2KUMA 5G3LD 1SIJA 1V8CA 1CK1A 4L6TB 2SNSA 2PLPA 1STGA 3S15B 1PDXA 2E2IB 1C79A 1QOBA 3FKIB 3LWEA 3UI3A 2JA6B 4J1MA 5FO8B 1JROA 2CJOA 3GTKB 1YN3A 1O80A 2FMMA 5HGTA 3BK2A 3RD4A 3GTMB 2LHDA 4JWSC 3I4NB 4HMIA 1G91A 1SSNA 5T8IA 4BY7B 1FXAA 3S1MB 3M4YA 2EJFC 4TQUS 3DEPA 1R4QB 2K33A 3D4RA 3CRKC 1J9OA 1ZDVA 4IFDH 1EL0A 1GUTA 3T56B 2A6ED 1QF6A 1V97A 3I4MB 2B39A 4Q2JA 1HUMA 4FF3A 1AZQA 4K2LA 4A3JB 3W3AA 4P6VF 2K32A 2X38A 3HZXA 3OMCA 3TSSA 2L11A 2J4XA 1I4GA 4K8JA 3BS1A 1TU2B 4HRSA 5D65A 4EQOA 3FC4A 4USAA 2ZXOA 1K8MA 2PYKA 4IQZA 1I50B 2FFKB 4K6DA 3KUPA 1HUNA 3KLSX 1SYEA 5T1GA 2JXTA 2EELA 1SYFA 3OIQA 5CYUA 2NWGA 1PYWD 1ENAA 4C3IG 5I6WA 4RA8A 2NB0A 3QOJA 2ONQA 2WXGA 3VR9B 3Q22A 1J7AA 1RD9D 1BOSA 2DY8A 2EXZA 5FLXL 3AMUA 5C4XB 2KQ4X 1J7BA 5KRUA 5EBCA 2ID0A 1CZGA 2MGSA 1XCTL 1L4DB 3D4WA 3SK8A 2KAJA 5KGUA 2EYMA 4PQXA 1DOKA 3S16B 4XDXA 5M5XB 1B53A 5ELFA 1EEID 3OWFA 5EGTA 1DOXA 1SJHD 5AFWA 2F4IA 2Z8LA 4C3JB 2HTME 2HDMA 3H6MA 2Z4HA 3M85A 2WXLA 3SK6A 4N9PA 1D1KA 1Q90A 1HHVA 2J7ZA 2DY7A 2AX5A 2IGDA 3TBIB 3FAHA 1E7PB 1OQRA 3P4SB 1IUEA 2E6XA 1U9RA 4A3IB 3LWUA 5I2YA 2G9DA 3PUYA 3AE8B 2DYOA 4WH4A 3I70A 1PUTA 2D62A 3F2UA 1JALA 2M2LA 4GDLB 1W6KA 2QEJC 1S5ED 2XIWA 1II3A 3MFYA 1SB3C 2JSOA 2Y3AA 3OIPA 1NI3A 1S5BD 4D2KA 3TP5A 1D2BA 3D8GA 4X3TA 1QOAA 4HSPA 3B2FA 4I65A 1U4RA 4OZAA 1FEHA 2ICIA 1F9SA 3M3YB 1FD6A 3MXUA 2WXRA 3QIAA 1XLPA 3MHZA 5BYQA 1WTPA 1J7CA 2OEDA 3X3MA 3EA6A 2MHVA 3DXJC 3MWYW 4JE3B 1HCZA 4HEDA 4FVMA 2PZTA 1NR2A 1C9FA 1SYBA 3SXHA 2WINB 5I2XA 5HHDG 5BN5A 1EIGA 4FXCA 3GO5A 2WDRB 3NK9A 5IT9E 2KVMA 1GUWA 3B2GA 2KEDA 2PW5A 1O7LA 1ILQA 1ET9A 5CV5A 5BYRA 1DM0B 3PUZA 3LX0A 1S5DD 4BA1I 1C4CA 3NVWA 1ZEQX 1VZ7A 2BW2A 4C3HG 1B9NA 2LFNA 4BWGB 1TY0A 2A74C 1FRRA 3ZYYX 2RQXA 4G4KA 4KX6B 2TSSA 1X3PA 1WTRA 1PTOB 1WRIA 1BBXC 1GAQB 1MVKA 3L9AX 1L6UA 1XLNA 1HRJA 2NZ1D 2HCCA 3DUZA 4EGVA 4F7XA 1SDFA 2K6AA 2FE8A 3MAQA 2SNMA 5KNCA 3TDQA 2WXHA 4ZHOA 4OGQC 1JW9D 2WKCA 1HEZE 5MPOA 3HP3A 1YN4A 2F0KA 2PCFB 1TWGB 5IGCA 1WTWA 3TP7A 2YYZA 2JYEA 2QKIC 1CZPA 4OVZA 4PMCA 3HRDD 1ZYRD 2R93B 2Y5CA 3D6WA 5G5HA 1OO9B 3ZJTA 4RFBA 1DGJA 4NP5A 4XQNA 2F0LA 2F0MA 4A3FB 1ZXIA 1A3UA 3VYTA 1XO3A 4KTAA 3SHLA 3Q6SA 4XIGS 5DEHA 3AECB 4TSSA 2WIIB 4IFDG 4RAUC 3VRBB 5C5LA 2IPKD 1TKYA 1SE2A 5JVG3 3T16A 4RCNA 2KECA 3K5OA 4R8IA 4ZRQA 4DK0A 4ZOHC 1DZ1A 5K36H 1ESFA 1MSGA 1JE4A 2KCNA 2VXWA 3VYRA 4XDDA 3I72A 1YQ3B 3D31A 3H91A 1E2WA 3RLFA 3U7ZA 1EY5A 3NUHB 1O7YA 1VCIA 5CV6A 3N6RA 1TR5A 2F0HA 3DHQA 1UEAB 4K2KA 2GB1A 4HKZE 1XTCD 2MPMA 3MXNA 5FR3A 5FKAC 1HFGA 1AYFA 5JVH3 5G5GA 1KTKA 1XX8A 1B44D 2NBFA 2K05A 2PO4A 1PZKD 2H89B 3AE3B 2HQEA 2RDHA 5FO9B 1UWMA 1PFDA 2SAKA 1HTLD 2A69C 3GV3A 3TMEA 2WXQA 5COYA 2MJEA 3T3OA 3H8HA 1I6HB 2GRIA 3VYUA 5EKIA 3Q8BA 1H9SB 2DLBA 2W3SA 3NQIA 4IUVA 2RDFA 1VMPA 5EE9A 3GP7A 2B2WC 2EYJA 3HOYB 5DM63 3NQTA 1DJRD 2EPBA 2IL8A 2B2VC 4C2MB 2RPVA 3PMFA 1ZP0B 4A3MB 3BVZA 1MBYA 2B2TC 3RUZA 4DXGA 2BT6