1JCKB

T-cell receptor beta chain complexed with sec3 superantigen
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
239
structure length
239
Chain Sequence
ESQPDPMPDDLHKSSEFTGTMGNMKYLYDDHYVSATKVKSVDKFLAHDLIYNINDKKLNNYDKVKTELLNEDLANKYKDEVVDVYGSNYYVNCYFSSKDNVGKVTSGKTCMYGGITKHEGNHFDNGNLQNVLIRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIESNGNTFWYDMMPAPGDKFDQSKYLMIYKDNKMVDSKSVKIEVHLTTKNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 14.3.D T CELL ANTIGEN RECEPTOR
publication title Crystal structure of a T-cell receptor beta-chain complexed with a superantigen.
pubmed doi rcsb
source organism Mus musculus
molecule tags Complex (toxin/receptor)
total genus 63
structure length 239
sequence length 239
chains with identical sequence D
ec nomenclature
pdb deposition date 1996-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
B PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1jckB01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1jckB02
4L6TB 1SE2A 1S5BD 1V1OA 3DWQA 1F77A 2XNAC 4RGNA 1BCPB 5TSSA 1AW7A 2G9HD 1D5MC 5FKAC 1SE3A 1PTOF 1I4HA 1TS2A 1PTOD 2AQ1B 3V05A 4RGMA 2CHBD 1YN5A 1EEID 3MFGA 1RCVD 3EA6A 4Z9CB 1I4PA 1B44D 2R61A 1TY2A 4RGOS 4TSSA 1STEA 5D3IB 5I4DA 4NZLB 2RDGA 1JR0D 3SEBA 1CHQD 1SJED 1EU3A 1DYQA 1B1ZA 1HQRD 2WV6D 3GP7A 5FK9C 2IPKD 1LTBD 4RFBA 1YN4A 3BYYB 4K6LA 1D5XC 1UNSA 1KTKA 1JWSD 2QILA 1D5ZC 3BVMA 3O13A 1G8ZD 5ELFA 1LTID 1EEFD 2IJ0A 2AQ2B 1D6EC 1ENFA 4RHSA 2XN9C 3BZDB 2XRQD 4L63B 2ICIA 3DWPA 1TS3A 2Z8LA 1S5DD 3CHBD 1AN8A 1EU4A 1SE4A 5D3DA 1PTOH 1TS5A 1HXYD 1ET9A 1HTLD 1PZID 1ESFA 4RHRA 1MD2D 1S5FD 1CQVA 2J4XA 1JCKB 1I4GA 1XXGA 1BXTA 3R8BA 3R2TA 1FNUA 1QILA 3BYTB 1CHPD 1DJRD 1CK1A 1TY0A 2O2LD 1SBBB 2SEBD 1TS4A 4RCOA 1UUPA 2XRSD 3MC0B 1PTOC 1EWCA 4RGTA 2QEJC 3TSSA 1GOZA 1FD7D 3DWAA 4BWGB 1LT3D 1PTOB 1BCPF 1ET6A 1V1PA 2NTSA 1PZJD 4RH6A 1L0XB 3URYA 4UDUC 5ELCA 3R2IA 2AQ3B 1KLGD 3EFXD 1LTRD 1PRTF 3BVZA 1PRTD 1M4VA 1FNWA 1V1PB 2TSSA 3OWEB 2NTTA 1I4RA 1FGBD 1S5ED 1LTTD 1L0YB 1RF2D 1SXTA 1I4XA 1JWMD 1RD9D 1S5CD 3BVGA 3KLSX 4OHJA 4DXGA 4DXFA 4ZYSA 1PRTC 1SJHD 1LO5D 1T5XD 1BCPD 1HA5A 1PYWD 1RDPD 1XTCD 1LT6D 1LT4D 1PRTB 5ELEA 1CT1D 1LT5D 1KLUD 1LTSD 2RDHA 1I4QA 1LLRD 1FNVA 1PZKD 5ELBA 5ELDA 1YN3A 1EFID 1SEBD 1LTAD 1LTGD 1JWUD 1JQYD 4O1NA 3W2DA 1BCPC 4C56C
chains in the Genus database with same CATH superfamily
2ZM6Q 2DYOA 3V3XA 1KNEA 1T0QC 1D8LA 3A8KE 4WWNA 1YBYA 3GV3A 4BXXG 1OXVA 4OEMB 2KT7A 2OWOA 4LF9L 4KI0A 4BY7B 4IOIE 1SROA 2R6GA 4URKA 1TY2A 4LF8Q 3EGRA 2QDLA 4GU2A 2RF4A 1A62A 1TIFA 2MQJA 2KQSA 3AULA 1B1ZA 2NN6G 3GP7A 3M63B 2WACA 1VQ5A 5CV9A 3S1QB 2O5JC 3UF8A 4RFBA 4C3IB 4OL7A 5EDSA 2WXLA 2WXOA 3E6ZX 1PQSA 2XBBC 4DDID 2M2LA 2ZPYA 2E2JH 4P7IA 1ZYRC 3CRLC 2MW5A 1K53A 3H7SA 3O13A 3LYYA 1NENB 2OF1A 3VAWA 1VDZA 5EBDA 3Q8FA 1A6XA 2QCPX 3AEFB 3NUHB 3ZRFA 1ROEA 2L8JA 2RDBC 4IWPA 3TUOA 1ENCA 1V9PA 1VF7A 5IYCG 3N32A 3STBD 3CHBD 3Q3OC 2YTYA 2ZNVC 3R93A 1MPEA 2FCSA 3D6WA 4MGZE 4N6EB 3AE9B 4IDIA 2NN6H 3UIOB 4EZJA 1I35A 2OHFA 3E3XA 4BY1G 2ZNVB 1C9FA 3RLFA 1WH3A 1FNUA 3BYTB 4DUZQ 2M0XA 1UEBA 2ZW0A 1CK1A 3UI2A 3T56B 5C5MA 1F9RA 1VQAA 3G48A 1SNMA 1EL0A 2J7QB 1D2BA 1XD3B 4LTUA 4NNJB 1GC7A 3VFKA 1PZJD 3PO3H 3T51B 3S16H 2UXCL 3MAQA 2BCOA 4C2MB 1WZ3A 5IYCH 4KHPL 1P7FA 2Y3AA 5JH5C 2QA4A 1GUNA 1VQJA 2IYDB 1K8AC 1IUEA 4LF9Q 4A93B 5CHFA 3DWGC 2BDOA 2FXQA 2D3GA 5HG2A 2NPTB 4APVA 4BY1H 3APCA 3HUIA 2KTFA 4XXEA 3GDEA 4AJYB 2VZKD 2OQKA 1DOKA 4JC0A 1P16A 3GTQB 2INCC 1A0IA 2AWOA 1N60A 4LNQA 1H4RA 4JWSC 2D3AA 1YJIA 2F03A 1NNXA 1HZAA 1IZ6A 3PV0A 2GBMA 3HOZG 2XGTA 2IZVB 1WGGA 5EAYA 4G3XB 4M0WA 1WR6E 1LT4D 4XQNA 2MH7A 4OVZA 1C48A 1KLUD 2LASA 1IHZA 4ZQ3A 2Y5PA 1RM6C 2UYZB 1LTLA 4JCVE 4AQYL 1C0AA 3DBLB 1I6VC 3CRKC 3N3KB 3ZXRA 2PNHA 5ELDA 2B39A 4IPDA 2K8CA 3HOZB 1QE6A 4TRDA 5C3XA 1JWUD 4IWQA 2MA9B 5IGGA 1D4BA 2CR5A 2F3VA 3PSIA 5C0XG 3PUXA 2MPMA 4I7ZC 1VZ7A 1DOXA 1EZ8A 3KOJA 3G6EA 1JJCB 1SE3A 1OTRB 3W9CB 1L5PA 1K8OA 5C4XB 4BVUC 4HEA1 3M85A 2HTME 3ZKJC 4TSSA 4RGOS 2XVSA 2B2WC 2UXCQ 4PG3A 2L05A 3DVNV 3NY5A 3WIMA 4X3UA 5DNFA 4L2YA 2ALYB 2HDMA 2JA8G 1LYLA 4XDCA 3K9OB 1YN4A 4EGVA 3QWZB 4IW0A 3ZJTA 2KA7A 1D3ZA 1CQFA 4FJYA 3FPPA 1YIJA 4XC2A 3NP8A 3I9V1 5C0XH 3CCJA 1TKWB 4DR5L 4JI7L 1CZWA 2JZPA 2X8XX 3K5NA 1YQBA 2XSCA 2F0TA 4KX6B 1EEFD 1FL0A 4R9WA 4G7ZC 2XRQD 3PSEB 1Q1BA 3DXJC 2JA8B 2RPVA 5FLXc 1S5DD 5M5YH 4KTAA 1AN8A 2KACA 4XGAB 3IT4B 1HXYD 2I46A 4X62L 4A3LG 3ALBA 3FRPB 1MD2D 2J4XA 1X1MA 2I07B 4K6DA 4RF0A 3EFCA 3CQZH 4DAYB 2D5DA 4L5QA 1LGRA 4AQYQ 2FCQA 1HUNA 1C8CA 4IPHA 2A8VA 4QAYA 5KNCA 3DEPA 1TWCB 1ZDVA 1O78A 4LJPB 4HCNB 3F8TA 1VMPA 4K8IA 1SF0A 4OVUA 3A7AB 3PQIA 1SYEA 1CKOA 1C4AA 4AJWA 2DJFC 3JSVA 3ZYYX 3IAYA 3T13A 3A9KB 4EZLA 3BVZA 2D0PA 2MX2A 2FCNA 4L5RC 2QC8A 4A3LH 2P5ZX 3PF4A 2BKRB 1BO0A 2LRWA 1FD6A 1ML0D 2PW5A 1B50A 4OWTB 2WXJA 4FF3A 4B08A 2F0SA 3TL5A 1WXMA 2LHDA 4LNKA 3M3YH 1QQRA 2BB5A 4DXGA 4RCNA 3BZKA 1PH4A 1JJ2A 1Q0WB 4W9DA 4LCDE 1WM2A 5FLMG 1AZQA 1WRIA 3KUCB 3EBEA 3I4LA 2V4IB 1EY6A 1WGYA 1PDQA 1PRTC 2F0JA 2EXDA 2AUJD 2E3TA 4P73A 4UP9A 4FYDA 3AB9A 4DR5Q 1PRTB 2FMCA 4DA2A 4JI7Q 2RA4A 4KN4C 2IX1A 1VF5C 3RLNA 2BA1A 3BK2A 3RMKC 1TR5A 2OTJA 4AWJA 1Y1WB 2K5NA 4X62Q 3PIP3 3DHIC 4I6NB 1SYDA 3EVQA 2UWQA 1YHAA 2MCNB 1KD1C 2KD0A 2A5HA 1IPGA 2QIEB 3MTSA 2JX5A 1V1OA 1V81A 3M95A 2XK5B 4NPNA 3J7AF 4FJVB 2BE5D 3PV1A 4CJ1B 4A3MB 1B8AA 2I0QA 4DXAB 3K57A 4MNOA 1K0SA 2AQ1B 1E2WA 1OXTA 4K5VA 1NYQA 2Z59B 1Y8RC 3WANA 2KN4A 5D3IB 4BOSC 1L2NA 2VY3A 4NP5A 4W9FA 1BNZA 4R8NA 5IWAL 3KWLA 2Y0SB 1WSPA 5E6PA 3VH3B 1L0WA 1M94A 4R8IA 1DYQA 2A73B 3S2HH 1A70A 3ZTDA 2KJ6A 4A3EG 2WLBA 2K6DB 4KGTA 1D1IA 1P1AA 1GB4A 4P74A 2GOWA 3SFDB 4P71A 4X65L 3HOVB 4ZK9B 2C9OA 3AI5A 1EY5A 1EYDA 2H1EA 1X9NA 4LFAL 3OG5A 4F7XA 2A5UA 4B0EA 3RT3B 3N52A 4BBRG 3ICEA 4TKNA 4F8MA 2K05A 3R66C 2NYZD 2G4DB 1HTOA 3U4ZA 1XPOA 2Z0EB 1EY7A 2PLPA 4L63B 1B2TA 1GHKA 4O0AA 4JI3L 3DBHB 2K6AA 3I72A 4RM8A 4FNFA 2B63H 1NBWA 3DMUA 4X3TA 1RLFA 1MSGA 2BDNA 4QIWB 5KIXA 3DBSA 4YIJA 3KQ4A 1HTPA 2WX1A 2K1FA 2CW0C 4JIOU 5H8YE 3OW2A 2WAQE 4A3EH 3R8BA 4KIKA 5EE1A 1Q1OA 1WJ4A 1AFPA 2D2CC 1TT2A 3NSWA 4NQLB 4ITKA 2NZOA 4K7WA 3AE7B 1D7QA 3A4SC 4JL9A 3AMUA 4PYUA 1SDFA 2VNUD 2KANA 5E6JA 3ZLZA 1YNNC 4BBRH 1E7ZA 2V4LA 1W6JA 3A8JE 1LT3D 1UE6A 1HTQA 2N1WA 4OVVA 1V1QA 5J3BA 4XQQA 2LGYA 1VQ8A 4ICVA 2D10A 3A4RA 4JK1C 4A20A 4B3SQ 3CCLA 4PS3A 2F0LA 1F9JA 4K14A 4C1NK 3I3CA 5EBCA 1WTWA 1E2ZA 4S3SA 2ONQA 3GZNI 1F9PA 3FC4A 4IJLA 3Q3JA 4ANXA 3M3JA 5GAEC 3L9AX 2MFIA 3BU2A 2F0MA 5IGBA 3OWEB 3Q24A 2ZJRA 4WJ3M 2KFJA 2V0GA 5IWAQ 1O80A 3C0RB 3EUB2 4K3BA 2UUBL 4B3RL 1IYVA 1T6BX 1WGHA 3JYUA 1JWBD 2EKIA 2CWPA 3A8IE 5JJZA 2JXXA 1E7VA 1R7SA 2JYEA 2R7FA 3BIID 3AFPA 2WXKA 1RHPA 5BR8L 1KNAA 5FO9B 4X65Q 1VCIA 4OO1G 2GB1A 4JE3B 4LFAQ 3ITPA 2WAQG 4EQOA 4LFCL 2VRRB 4W9HA 4KN7C 1SJHD 3J81i 3MA2B 3S14H 1Q81C 1RAXA 3R3MA 1L2FA 4II3B 4P1CC 4Q0FA 4QUCA 5GXGB 2FJ2A 3ER0A 3TDQA 1SNPA 2JQOA 1Z6HA 3L10B 4A3JG 3GTPB 3VTVA 1VQEA 3GTKH 3A9JA 3SK6A 5C4JB 4HKZE 2E75C 1V8QA 4TMAB 1PZKD 3PMFA 2WHIA 3J81c 2BYVE 2QEXA 4JI3Q 4WJPA 4LF4L 4XDXA 3HS0C 3FKIG 1WE7A 1TT5B 1DOMA 5M3MG 4DN4M 5C44H 4FF1A 4KMUC 1GHJA 2JA5H 4GN3B 1OQYA 2DZMA 5C0XJ 1PYSB 2ASQA 3WDNA 3VA7A 2PMVA 4W9EA 1QOFA 5FKAC 2IO0B 2L76A 3BDLA 4AYBG 5NUCA 4F87A 2NMQA 3QQ8B 4O42A 2RCFA 1V5TA 4OO1H 1GD7A 4EX5A 1AW7A 4WFN3 4FDBA 5ISRA 2QF7A 1WTPA 1KF6B 3K9PB 3DVNU 1TS2A 1PTOD 1GUGA 2GBKA 2MBBB 4A55A 1BUVT 3V62A 3K0YA 3FKIB 3EA6A 4FXKC 5M3MB 4I6LB 4A3JH 4BKGA 3MJ5A 3OJ4B 4KGSA 1JR0D 2EYLA 3SEBA 4DNTB 4JYAL 2MJEA 2LRUA 1VRAB 2KVMA 3L13A 2KEEA 2X6LA 1U5KA 4DPGA 2WV6D 5I9OA 3MWYW 4AYBB 1K50A 3LJ3A 1MHXA 1EWHA 1STNA 2BYFA 4DR6Q 2ZVOA 2K5PA 4IM0A 3EQLC 1A2TA 4A3IH 3GTJB 2F0PA 4DV7L 1QZHA 3K5MA 2UUBQ 1P8LA 4B3RQ 4OWXB 1XLPA 2A4ZA 4GSWA 4B9KA 3ND9A 2LJ5A 3ZXVA 1BR9A 2IWHA 3GTJH 5BR8Q 3CPWA 3BZDB 2KHWB 3PUZA 1A2UA 4LFCQ 3M4PA 1X3FA 1EU4A 2L7RA 4DQOC 4PK1A 1TS5A 1NDDA 1HTLD 4ABNA 1CJEA 5K36G 2E2HH 1U4LA 1PUTA 5GQOA 1ZXTA 1SYGA 1YZ6A 1A5RA 1DONA 3KLRA 3ZNHB 1AE2A 2R93G 3PCOB 4LUOA 2MBEA 2KKCA 1QILA 3GTGB 2W9NA 2AKWB 1ZGUB 4CYEA 3WOFA 1WX7A 1D1KA 2K25A 3H09A 1QNUA 4J8QA 5AJ3L 1WXSA 4LF4Q 2WU5B 4IPGA 2F4IA 3I4MG 5JHAA 1C9OA 2EYFA 3X3NA 1WI0A 2MBHA 5KGUA 3AXCA 3VXWA 1J8CA 3BJUA 5JZEB 5L83A 1XO3A 2GBJA 1FR3A 1BQQT 3WWVA 2N9LA 4ULLA 1UWMA 2R93B 5D65A 4IFDG 3IHPC 1LTRD 1DOYA 5D94A 3UDXA 3PZDA 1TWFH 1V2YA 3LWUA 1V1PB 3I4MB 3H3VH 3H9DA 2A6HC 4FO2A 4IUPA 1H95A 4Q2JA 1IL8A 3QX1A 3HM6X 4IUQA 1MI2A 3L17A 4YTNB 4RM9A 4JYAQ 4KDIC 3ZDTA 1Z7TA 1OTCA 4KV2A 4GS3A 1Y8PB 1VQDA 2DYBA 5D2MB 1YNXA 4DK0A 5HKHA 3RNAC 4UP7A 3J7ZC 3HKZG 4DV7Q 5I6YA 2M00A 2JRIB 2N8NA 2X38A 3IT6B 3PLVA 4LNIA 1S3OA 5E6NA 3DHQA 2WXMA 2I38A 3A56A 1N33L 1XLOA 1SYCA 1LLRD 3VR6A 3S1NB 2WKCA 4U673 3CP0A 2CCZA 3NUCA 1GUSA 4PNYA 1J7CA 3RN9C 4CQNA 4HIKA 3VYUA 1U4PA 3NHEB 4NJCA 2IT1A 3NENA 2KWVB 1YN3A 2N7JA 3FAHA 3NTIA 1X6OA 5ELOA 1WTXA 1HFNA 3CWIA 3JSVB 1B53A 1IW7D 1LTGD 2A6EC 2HDLA 3CKIB 4OIJA 2AEHA 4O1NA 3TS2A 2ZJDA 5IN7A 4C56C 1WVLA 2PTLA 3P4QB 1KM7A 3RMHA 4LWCA 4RGNA 2KVZA 4KJOA 4BFRA 1VQBA 5AJ3Q 3FEWX 4UAIA 1D5MC 1U0LA 5IYBH 3SU8X 3V61A 4WAAA 2E2IH 1C7YA 3D31A 1KRHA 3RZFA 1VQ4A 1YN5A 1WYDA 3APFA 1WFYA 5T8IA 3KW5B 2ZXRA 1EIGA 2PNRC 2R61A 1E8YA 5IP4D 3Q8BA 1Z2MA 2A69C 3AECB 4DDGD 5A35A 2NVQB 2PO4A 2MRPA 1J5EL 3FILB 3PTFC 1DM0B 2K28A 5BN5A 4CJ2C 3CF5A 1KLVA 1XTDA 2J7ZA 5DM73 3U58A 1E24A 5D7GA 2Z6BA 4JI0L 1TWAH 4WQOB 1OO9B 1AE3A 4HTHA 1J19A 4TV3A 3MXNA 4W9JA 2KXJA 4ARIA 4ZRPA 2C5CA 3M4QA 2AX5A 4ANVA 3S1MB 3LDZE 1B9RA 3RD4A 3KLSA 2BT6A 5AEKB 1N6ZA 3O65B 2F0WA 3I55A 3PO2H 3H6NA 3HKSA 5BN3A 2D0OA 3CPFA 2SAKA 3MC9A 2LVQA 2L3ZA 1NE3A 2ICIA 3DWPA 1EY9A 4HMIA 2HQLA 4MHEA 2F4VL 2IGDA 5A2QL 4A75A 2B2YC 2WXGA 3S2DH 3HM3A 4IG7B 3C1FA 2N1VA 4ID6A 3UIPB 4MZ9A 4DU9A 2LXAA 4ZUJA 2WS3B 4HAEA 2PMZE 2RHSB 2E76C 3MC8A 2BQQA 4CDFC 4P16A 1Q82C 1HNXL 1NVID 1RFAA 3B2GA 2WYQA 5IGEA 2WFWA 1P98A 5IE8A 1BOSA 5DEHA 2UUCL 4JLCA 4RGTA 4V0BA 3TEYA 2Z4IA 2WP9B 4H44C 2K5DA 3A9KA 3KUPA 4LUZA 3U7DA 3D6CA 2WU2B 1SE8A 3MXPA 4JOIA 5M3FB 3UI3A 1H9JA 3K7AB 3IFTA 4IZ8A 2Z9HA 3SXHA 3L3OC 5LXHA 1V9JA 1VMCA 3RN5A 1R4QB 2JY6A 4TKOB 2L52A 1L7YA 4HLEA 5K5PA 3M9BA 1J5EQ 3DHHC 3QJZA 3GB1A 3TP5A 2KJHB 5JVG3 2D3BA 1Y8NB 1I50H 3AYHB 4IWOA 1HUMA 4PQXA 5AZHA 1ISNA 3J80i 4JI0Q 4ME5A 3DPDA 4QUFA 3QG1A 4KIKB 1FO4A 3RR5A 4YSXB 3AQQA 1ILQA 3SFEB 4BZAA 2Z6KA 2K3UA 4JVZA 4XYCA 1HNZL 2L32A 2BH2A 2NUCA 2R7ZB 2PW7A 2KYWA 4W9GA 4RKLA 2VS1A 2EJMA 4WORA 2Q8TA 4II2B 2ACZB 2F4VQ 4WJOA 4LAAA 2B2UC 5IYDG 4I7AA 1L0VB 2E8GA 1C3TA 1A15A 3G7LA 4EQPA 2JEAI 4L23A 2EIFA 4MACA 4GDKA 2F0NA 4A8XC 2GA4B 2NVTH 1SB3C 2K8BA 2KFKB 4PMBA 5IY0A 3AV8A 1S5BD 2VL6A 3DWQA 5GADC 2BS2B 2L4NA 1Q12A 1HNXQ 3MHZA 2DAJA 2O4XA 2PVGC 3N1XC 2E2DC 2UUCQ 1PH8A 2EVBA 1G2SA 1FYCA 4S0RA 3A0JA 1EOVA 3JW0X 3NS1A 4DV5Q 1TIID 3ZNID 4LNFA 3ZQ4A 1SYFA 4ZRIA 2RDGA 4QGUA 2MO1A 1PVOA 2CHZA 4A3DG 3GTLB 2VQFQ 3DQVA 4W9IA 1FM0D 2JA5B 4YL8A 4CHTB 2K9XA 4LFBL 2REXA 2MJ8A 3Q6BA 4WJQA 4DV0L 1PFMA 1K83H 1X65A 1MJCA 4YXDB 5CBAE 2K5HA 3CCVA 4HJAA 4M01A 3RUIB 4A3DB 4DHJD 4JPBW 3EN2A 1SMYD 5CHVC 1KDAA 3CCEA 1D6EC 1K3BC 2CKZB 1IXRA 2MEKA 1Q8KA 2V1CC 3SR6A 4KZ0A 2C7HA 3AE3B 2QDBA 4HN7A 4DK3C 1Q10A 3P4SB 4MH0E 4DWFA 1MJEA 1K9MC 2LFNA 1YNJD 4A3DH 2E2JB 3PPAA 3S1RH 1HFGA 1HNZQ 5M5WB 2HIXA 1MG4A 1GVPA 1K8MA 2G5DA 2JK8A 3VYTA 2N9XA 5CV6A 4HROA 1GM5A 3JAMi 3BY4B 1TYGB 5HGTA 1EWCA 2K33A 3HFZB 4JI8L 5M5WH 1QKZA 4FHKA 3SK4A 3TSSA 1VZ8A 1FD7D 1UELA 2I1KA 2MHJA 3STBC 1WRDB 3TEHB 1VD2A 4IFDJ 3H94A 3AU5A 1CMXB 2KHIA 3DBRB 2K14A 2PCFB 4FA6A 2C9WB 2B8GA 4AOFA 1B4OA 4DV1L 3PO3G 3JAMc 1HZCA 4YCUA 4NY0A 4NXML 3P20A 1E6EB 3EFXD 4K8JA 1M4VA 1KXLA 4KY5A 4JI2L 3P75A 2B29A 3TEXA 2G4SA 3J7YW 1OXSC 5IT9L 5JJIA 4BAXA 1S1QB 2B2VC 3HGBA 1U4AA 3P4PB 2M4NA 2PEAA 3TCAA 1NCVA 1PA6A 2FUHB 1JWMD 2C35B 2OT2A 3PO3B 2W3SA 3M62B 3S16B 2GVAA 4LFBQ 4P2CB 4MH8A 4ZLTF 1YX6B 5CV4A 4DV0Q 1IBML 5HHDG 1ZYRD 1WX9A 1RWSA 2L15A 1GJZA 3QC8B 2LXCA 1K3RA 2XIWA 4KJNA 2PE9A 5BMGA 1QZEA 4BY1B 1C4QA 1DGSA 1A3UA 2K52A 4MSQB 2V3SA 1VZ6A 5CMDA 1JROA 2NS5A 4K2KA 4POFA 4KK7A 4DV3L 4IM2A 1W3SA 1MFWA 1YVCA 1PH3A 3C8YA 1EYGA 1FFUA 2L00B 3L16A 1B3QA 2INPE 1JQYD 1HZ5A 2NN6I 1TZOA 3AMZA 1UWVA 3MEHA 5LL6X 3AU7A 4OXPA 5TSSA 3J80L 4C4VB 1XNRL 3KFUA 1MVKA 4K5XA 1I4HA 5HY6A 4JI8Q 2LUEA 3GS2A 4WAFA 2N88A 4Q5VA 1BF4A 5JEAG 1R9TH 1STHA 2EY5A 1SNQA 4G4KA 4JX1C 3MXGA 4JW0A 3HOXG 4QCLA 2I2YA 2CHWA 4QY7A 1LACA 1WY8A 4DV1Q 2KLGA 4GDLA 5EE3A 3SHQA 3A54A 2LXJA 4NXMQ 2JQRB 4BBNC 1E1OA 2Z0DB 4DR1L 2WDVB 4BKSD 3H8HA 2R2QA 1QB5D 5LXIB 4JI2Q 5EPLA 3HHMA 2ZJPA 1BVSA 1E7PB 1IBLL 1KFYB 1UNSA 4A3FH 1VQOA 3A33B 1ZKOA 2QILA 2LFIA 3EC8A 2BA0A 4I65A 1G6PA 2LUMA 3V96A 1G8ZD 1G291 1Q3LA 3HOXB 4EQ5A 2HD5B 4HJKA 2TMPA 4X64L 1O7YA 3SR1A 1F9QA 4HRSA 1EY8A 4RHSA 3NRZA 1EM7A 3I4OA 2L0FA 1IBMQ 1PFDA 1B7YB 5JEAH 4X3SA 4FN2A 4E74A 4K1RB 3TREA 1T5EA 5BN4A 3HOXH 4W9LA 5IP9H 2M0AA 3B1LX 3ERSX 2J0TD 4L1BA 2B3AA 1ICFB 2F3IA 4KHPQ 1VQGA 3S17H 2KUMA 3UINB 4DK5A 3PVLA 3KJOA 1SMXA 3Q2AC 2O2LD 3J81j 3BS1A 4NXNL 5IGDA 4DV3Q 2K5QA 4DKAC 2JUOA 4GLSC 1N63A 4OELB 3RYTA 3WCQA 2F0UA 3U4EG 5M5YB 4TQ0A 5CBEE 5C5LA 1OEYJ 1V1PA 3PHWB 1EQQA 1L4ZB 1NI3A 3AEDB 1P3QU 3SD5A 2F0QA 3KUZA 2R3ZA 1UH6A 2I5LX 1MG8A 2K8HA 3DBLI 2FINB 4JI5L 3CQZB 1XNRQ 4FHJA 3MXNB 2ZCBA 1NBFC 2RVLA 4PMWA 3PLUA 4YCVA 3FHWA 1X56A 1S3SG 4ILWA 1EYAA 3OOCA 3ENEA 4CKCA 5HGQA 3J7AV 3RNBC 2KCMA 2A74C 4IALA 1JE4A 4A3KG 3UQAA 2J0MA 1CKNA 1V97A 4EE2A 1H9SA 2JP1A 3NELA 5LHY1 1WFQA 4X6AH 2BW2A 4BBNF 3TEWA 3L4PA 3TEZA 1FXTB 4DR1Q 1N8RC 1E9MA 2LS01 4IUNA 4KSLC 1E10A 4AQ7A 2NBFA 2CU1A 5DPTA 4ZYSA 2DY8A 1IBLQ 4N9TA 1HQMC 4A3GH 2JA7G 1PYWD 1GC6A 1ZP0B 4NMZA 2YTXA 1X3GA 4KD4A 1ZOYB 5FJ8G 4JV5L 3L54A 5C0XI 2V3PA 2DAFA 4X64Q 1WMHB 3VRBB 2XWJB 3PREA 2OTLA 2PI2A 3D0FA 1AARA 1I3QH 2HQEA 2EY1A 4J1MA 4R4CA 1FNVA 5A2QE 3I56A 3M3YB 1MHHE 5IGFA 3OYYA 2F3WA 4IOCA 4JOIC 4A3KH 4ICUA 3QWNA 1YHQA 2KMAA 1J6QA 4J6IA 3IL8A 3WAPA 2EZVA 1SFOB 3X0WA 1R4NB 1JB3A 2BYEA 1WTHA 1STBA 3DM3A 4YTMB 4NXNQ 3GTOH 2C5LC 3CIRB 5BMIA 5IAAC 3RZDH 3CCRA 2HJ1A 3IXSA 3DVGX 3KF8B 2JA7H 3KLWA 3TZDA 2FIFA 4Z9CB 2RSUA 3HEJA 5FO7B 4RKBA 3H15A 1SFOH 5FJ8H 2BPSA 4FXGC 1NTGA 3U9SA 3QCAA 2CH4A 4CHKA 2ZTDA 1QVCA 4E6IA 3FMCA 2Z6KC 3D3RA 1HH2P 5C3EG 4JI5Q 1YOVB 2IL8A 1WGKA 3RZOB 4ASWC 2LJIA 3BYYB 4X57B 2BE5C 4CKEA 3I63C 3W1YA 1VQCA 3PUWA 2NR2A 1XYIA 1IKLA 3RUZA 2QKIC 4M02A 3AEEB 5CYUA 5C1ZA 3HK0A 4X66L 2XTIA 2WNMA 3RZOH 1V5OA 2R7DA 3ZNGC 2B2YA 3KK7A 1E7UA 2EJGC 4PS8A 2ICEC 2N49A 3S2HB 2HTHA 2VB3X 4GDKB 2W55A 4C1NI 2N3SA 3HRZC 3VDYA 4WWMA 3E0JA 5BYSA 5D3DA 2M1MA 1SE4A 2B63G 4ZYNA 3U7ZA 3PGZA 5I2XA 2DNCA 5DCNA 3OIPA 3OMGA 2WDQB 4JV5Q 5C3EH 3CCUA 1R4NI 1I4GA 2WXFA 1BXTA 1CTMA 3AE1B 3I90A 5KRUA 3PS6A 2KCCA 1N34L 1ESRA 2PQAA 4LJOB 2WDRB 1E0BA 3JVZX 2MNAA 2O2VA 3MFYA 3ZTCA 1PV4A 4V190 3DWAA 1SLJA 4FF4A 2B63B 4EZKA 1NUCA 2ATWA 2L0TA 1VQLA 1TKYA 2DHZA 2ZW1A 1ZDXA 4K2LA 3ZJUA 4A3EB 3H7PA 2KOLA 2CJNA 2O6VD 4RNAA 1PRTF 2VQEL 1IBXA 5C2TB 3K81C 1GB1A 1R4PB 1ZUD2 1FNWA 2EXZA 1Y69U 1OEYA 2HJ8A 2ON8A 3DEOA 3TJPA 3N1ZC 4XWTA 1HZBA 1SNCA 1FGBD 4BBRB 1F52A 3K8AA 3AH7A 1LTTD 1Z47A 3T1YL 1RF2D 1QG7A 2E6XA 4XT3B 3KLSX 3BVGA 2D9UA 4Y52H 4DHZE 2JA9A 3L7ZC 4US9A 5FLXL 2CFMA 1LM0A 4IUMB 3WA0A 1M1KC 3ML9A 3B2FA 1RFKA 1YNTE 2DNEA 3PRZA 3W5VB 1BCPD 4X66Q 1WTVA 2IY0B 3IAS1 3N6RA 2F0VA 3FP9A 2B2UA 3P1HA 5KEEA 4JBJA 2FCMA 4GNXA 2KFKA 1TVXA 1I42A 1N5XA 5ELBA 5L37A 4KKTA 5AUKA 5JPNC 4DV2L 1AZPA 1MIUA 2JA6G 4YY3L 1JRUA 1SEBD 2LVPA 5C44G 2NB0A 3SGIA 1L6UA 3KWVA 4KY6A 1KL9A 3S14B 1EIYB 4R3DA 1JT8A 4PS7A 1WD1A 2K39A 1N34Q 1NMFA 2NCNA 3DBHI 4ZAIA 3GTKB 5HFYA 1YQ3B 4MELA 5JEAJ 4EEWA 3NVZA 1MKHA 2ASBA 4J3OD 4BOZB 2EYMA 1F2RC 5DPWA 2JA6B 1CZGA 4LW1A 5C44B 3VHTC 2D2QA 1SR3A 1FGUA 1SJED 3NVVA 2GVBA 4BBSG 3SDZA 1A3TA 2QJLA 1WZ0A 2V3NA 1Q1EA 2VQEQ 2Q2UA 1XCTL 3I7FA 3PIPA 5BO4B 5JHBA 2JA6H 1J9OA 1XF5L 4IM3A 1SRUA 2K4KA 2K0PA 4HDQA 4MEMA 1D5XC 2MP1A 2WAQB 2LHEA 4LF6L 1E3PA 4A3IG 4GOCA 3VR9B 1FIQA 1PFBA 4PZ7A 1TWHH 4OW0A 1D5ZC 1TQOA 4G7HC 4A3JB 1FCCC 4CDEC 2CVRA 1LTID 5H92C 2GLSA 1WOCA 3RNUA 4IKGA 1ENFA 1HPCA 4QMGA 3NG0A 2EYHA 2BS4B 1XMOL 3NBHB 2M19A 1PTOH 3VR3A 1ET9A 3NOBA 4A3IB 2LGDA 1WYGA 4RHRA 4BBSH 2I5MX 4KVGB 3E9IA 1VJKA 2BVCA 2WXIA 3OTOL 1ASZA 2A68C 2J0KA 1EUVB 1QJOA 4RMFA 3RNCC 2RHQB 2JE6I 1TY0A 5J22A 3ONAB 4DV2Q 2RSOA 3RFZB 2H88B 2XRSD 4YY3Q 3GD7A 2JWUA 3AEGB 2M8SA 1K73C 4GDLB 4A3OA 2JYOA 2KCNA 3C46A 3Q3NC 1B9MA 1PYBA 1KQSA 4MSMB 5CGKA 1WGDA 3WOEA 2ZTEA 3OIQA 2E2HB 3Q0AA 4L8JA 4OONA 1HNWL 1YITA 2FUG1 2MLBA 1AEXA 1ZXHA 2KECA 2L9HA 4GLAC 3HOWH 2EYJA 4ZUIA 3QIAA 5EE9A 1PGAA 2WB1E 1CFMA 1STAA 4B9XA 2B2VA 2WXPA 4WWOA 4K0KL 1BT0A 3PIO3 2NBUA 4YTPB 1YJWA 3HOYH 3DCGA 1X3EA 2F0HA 3NBIA 3CF6E 4IO9A 4KHZA 2RGFA 3UDIA 1S5CD 2Q2TA 3P42A 4B6WA 3R7RA 4NAWB 2L12A 3KDFA 2B2TA 3PZ7A 1T0SC 2WXQA 3NZSA 3PGEA 4C80A 3H3VC 1XPRA 3A5UA 1WCMH 1KHIA 1LO5D 1TWFB 2MQHA 2L0CA 3E5SA 4ZKBB 3G71A 1WXQA 2N9KA 1XTCD 2RSNA 1N62A 2KOXA 4BKTA 2IO2B 1LTSD 2DWQA 1ENAA 5E1FA 1I4QA 4C7YA 4NJ6A 2I1JA 3Q3FA 3M7NA 2JU6X 4PYZA 4XZ4A 1XMOQ 1QF6A 4KKIA 1F2MA 3RZWC 3A1QA 1KAAA 3K80C 5C23A 1JJGA 4UP8A 3D32A 3ZO5B 2PKOA 4C4VA 1UGJA 1Y56A 1LTAD 2BKFA 2ZEQA 2PE6B 3W2DA 2X6GA 3OTOQ 1TTNA 4AIMA 3I73A 4HJ5A 1FEHA 4IUTA 4WJWA 1GUTA 4ZHPA 2O5IC 3CXCA 2ZVNA 5IYBG 4F1SA 2NBWB 1CKNB 2AUKA 1H9SB 2CHBD 3FPUB 2IBIB 3CCSA 2PQEA 2Q8IB 1UAPA 2G3QB 5KYLA 3BG3A 1T0YA 4QL5A 4C3JG 2MWSB 1HNWQ 1IW7C 2JYTA 1XPUA 4H02A 4ZHOA 1TWGH 3MJWA 3NTHA 4LJZC 1N9WA 2NVXH 3GV6A 1LTBD 5G3LF 2CHXA 4U68A 3MHSD 4K0KQ 3C19A 2YVCA 3HKZB 1I94L 2L11A 3OWFA 3KF6A 2E2IB 1KTKA 3I3TB 1Y14B 3W3AA 5CV8A 1WXVA 3AM9A 2ZTCA 4LDTD 4MGYE 1QUQA 3J81L 3PO2G 2RCNA 2ZXOA 4JQWC 1HR0W 2K6QA 1PDXA 3K6OA 4A3CG 3EHVA 4JBKA 5J1ZA 1WTOA 2JWZA 1FRRA 1MGSA 4A3PA 5G5GA 4C3JH 1TWAB 3DWMA 3RNEC 1R4MB 2PPHA 1WI5A 2Q5WD 4IFDI 1XXGA 2PZTA 4E71A 1FJGL 1BBUA 1DJRD 3H1UA 5J17A 3VTWA 2UU7A 3PO2B 2J53A 1Q90A 2KHSA 4P1BC 4FXDA 2CQAA 3MTNB 4K3CA 4YSZB 1AP0A 1VQKA 1ZW7A 4NDXA 3LX0A 1HEZE 3S2DB 1WYWB 4EKUA 3B9JA 3ERQA 2LGXA 1LV9A 4YWKA 1WIAA 2KWCA 1WR1A 4OZAA 1XQQA 4OZCA 4A3CH 2L55A 3PIOA 3F2DA 1Y1VH 2F0FA 4ZCKA 2DENB 1JW9D 1CM9A 4KKSA 4N8FA 1WWTA 2VH1A 3GTMH 1SN8A 2MUYA 2MGSA 1N33Q 2A69D 3VR4A 3HVDA 2JSVX 3W5UB 4JGHB 2WQYB 3MXUA 4YWLA 5BYRA 4ZKCB 4WQMA 4GLXA 1FPYA 3CSTA 3IBEA 1MI0A 4WJNA 2SOBA 1WMHA 2N7EA 2KLCA 3IAM1 1I94Q 1OXXK 1SNDA 3W1BA 5IP7H 3CCMA 2WWZA 4IQZA 1H9MA 2BGFA 1T5XD 4KSKC 2PQAB 4GLVB 5IOIA 1J8IA 2YU9H 1RYJA 4NW2A 2R92H 1U9RA 4A9AA 1LT5D 2LWPA 2O2VB 5C4ZA 3T3OA 2F0GA 5IKCM 1XLNA 2AMCB 1XJVA 1QVGA 3ABVB 4DV6L 1H9KA 4M00A 5J18A 2KN5A 2EELA 2VH2A 1G6JA 1I50B 3BDOA 3D8GA 2K75A 4N9PA 1NY4A 1DGJA 1E2VA 3H7PB 3NHHA 3TP8A 3M4YA 5JVH3 3KF8A 3GE3C 1IBXB 2KX3A 2NZ1D 2YLMA 4C7ZA 1FJGQ 3QK0A 2KHJA 3I8ZA 2BBCA 1C77A 1F77A 2MHVA 2GMIC 4W9CA 2R2OA 2HCIA 1IYJB 1JMCA 1GUAB 3TZUA 3VUXA 1IP9A 1FXAA 3VH4B 4EUTA 1EQVA 2NVYH 1F2LA 2HCCA 4ZRZA 1J7BA 3BWUD 3QHTA 1HA6A 1I4PA 1B44D 1KJTA 4K7UA 2QCZA 1WJJA 1UBQA 3H0GG 1GG3A 5D6JB 3H91A 3M4OH 3DOWA 3A55A 4YWMA 2G45B 2MO0A 3ZVVA 2F52A 2NVTB 1QWYA 4HKQA 2IPKD 3HVZA 1S4ZA 4GKKL 1NEKB 2EMSA 3TN2A 4YWGG 5D14A 1K28A 2PMZB 3X3MA 4GNXC 2CS4A 2OJWA 1YEZA 3GE8C 4M8AA 4BS9A 2AL6A 2AHOB 2KDEB 3HOUG 4GNXB 2IW3A 3K7UC 3PO0A 3Q8DA 1F2YA 1HCZA 1KH0A 4NKLA 1QVFA 1V8CA 3I4NG 1EWYC 5FOBB 4G50A 1YJNA 2CKHB 1SNOA 1C4PA 4GOPC 3RLOA 2OXPA 2BTEA 3IRBA 5J39A 3CW2C 3VYSA 3H0GH 4GOPB 1L6VA 2JXTA 1KABA 3CD6A 1ESFA 1K83B 1O7ZA 1QLBB 3T53B 2RPQA 3U8ZA 3R2TA 2PIAA 4IUUA 4B95A 1H8CA 1SAPA 2FHTA 2JF5A 1SBBB 4DV6Q 1GNUA 1UUPA 1SMYC 1IKMA 1HR0L 3EFUA 3DM1A 4DHJB 3HOUH 2RKSA 1TKGA 4PT5A 4BWGB 3VRAB 4DFAA 1XEEA 3PT2B 4LNNA 4MT5A 1II3A 2F1MA 1VQIA 4HIOA 1YI2A 2BB6A 3I4NH 1CUKA 4RH6A 3S1RB 4C3HG 2C7MB 2PZWA 1FFVA 2AQ3B 4MGKE 3IFWB 2JJQA 4TQ1A 4HSVA 4MN3A 4OGQC 3NTKA 1XWEA 4PMCA 2EJFC 4J6HA 2GRIA 4DK1A 2SNMA 1LABA 2ID0A 3U2SC 2M17A 4KKJA 2BH8A 4DF7A 2IX3A 1UGMA 4LLGM 1DCZA 3VTUA 5EKIA 2D5GA 2QSDA 4D2KA 4C3HB 3KJPA 4GKKQ 5CV7A 4C3IG 1I6HB 2CH4W 2E5LL 2WP8J 2DY7A 4MIUA 2IHEA 1EQRA 4LF7L 4LUVA 1NYRA 2ZZPB 3U30A 3KYDD 2MP2B 1G2TA 4C3HH 4I6PA 3S24A 1XX8A 1C78A 5E6OA 2LD9A 2PPBC 5KHQA 1I6HH 4P75A 3CMAA 4GZYC 2KNBA 5IOCA 1JALA 1X54A 5JAVA 4WWPA 3LB8C 3QOLA 4BY7H 2W3RA 1M90C 3OHXC 2WXNA 3AN1A 3IG3A 1DD2A 5LLIA 4YSYB 3E0EA 5T1IA 3HIZA 1VDVA 3S1QH 1G51A 3NQIA 2XNAC 4JI1L 4C3IH 3F2UA 2EY6A 2X69A 3K5OA 3C1EA 2G9HD 4HIDA 2EOTA 5I9PA 1Q86C 1HR0Q 1EFWA 4BXXH 4ARCA 1WXAA 4L5TA 1P9DU 4TVAB 3I5JC 2H5XA 2C60A 2B2TC 4GXBA 1P7EA 4NZLB 3TBIB 4AH6A 3KDFB 3NWSA 1RTNA 1EIHA 1CSPA 1HZ9A 1T3QA 3KUDB 3PUYA 1LFDA 3NXWA 1QNKA 2DZJA 2VZKB 3E9SA 4H13C 3Q22A 1A63A 4AUQC 4XIGS 4A93G 1VQ9A 5LMUL 3FDTA 1UZXB 2J52A 3DBRI 3P4RB 3VVWB 5JPMC 3NBHA 2N0SB 4R4IA 4A3FG 1R9TB 4FF2A 3BVMA 5MPOA 3A1QB 5HI1A 3Q8CA 2Z4HA 1ZKHA 1WJUA 2OOBB 2EPBA 2E5LQ 2EKEC 2Z8LA 3C2PA 3RPFC 1JE5A 4DNIA 4LF7Q 3T1HL 1TXYA 3PF5A 2KQ3A 2BF8B 3ZNZB 4EVOA 5IP9G 2EE1A 2KVRA 4A3FB 3G6JB 4FADA 3CMEA 4C2MH 2PW9A 3RULA 3ZRCA 3VUYA 4HK2A 2EMTA 4MM3B 4A93H 3SHLA 1SGHA 3ZJYC 1QT9A 2KCTA 2QEJC 2N9EB 1GOZA 2RMMA 1L4DB 2E74C 1WJ6A 3W5OA 4M1UB 2L5TA 1DOLA 3Q8EA 3GTQH 4N58A 2SNSA 3VR2A 1DOIA 3KVFB 1UE7A 1V6EA 5JXVA 4JI1Q 5ELCA 5KNBA 2D07B 2MBOA 2PVOD 3KF6B 2GI9A 1KLGD 5DPRA 3CU7A 1RJTA 4K5WA 1VQNA 3S17B 1TGZB 1CKMA 1XMQL 3OLMD 2OQ0A 3ML8A 2ENBA 2QGQA 5C4XG 4NAWA 2JN4A 3S9WA 1WM3A 3NS8A 4IUVA 3PUVA 2H4OA 2NTTA 1BBXC 1QUQB 2JZ3B 3UDFA 3K0XA 1B70B 2KQ7A 2WKDA 1B3AA 2D11A 2GBRA 4ZRJA 4ODGA 1YIWA 1RD9D 1XLQA 1VS0A 1OQQA 1NMGA 2WX0A 1JICA 2PYKA 3JC66 5LMUQ 3HOZH 3SE0A 4HPLB 4RAUC 1HA5A 1RDPD 5AZFA 4A3GG 1FMAD 3J81E 2CQOA 3S2AA 2LZ6A 1CT1D 5DLQE 1KOTA 3AE8B 4HWIB 2RDHA 1OQRA 1XT9B 3PHXB 3T4AC 5C4XH 4NAMA 3W1SC 3ULLA 1QOAA 2CU3A 2IGGA 2KJXA 3CSFA 3T1HQ 2WDTB 4LF5L 4CDCC 1OFFA 5FR6A 5IGCA 3V2TA 4ALPA 2KQ4X 2RD0A 1K8GA 4GN5A 2BWFA 1H9RA 4F7ZA 4A3GB 4HR7B 3JAML 4L6TB 3AE2B 2KZRA 1YJ9A 5M5XB 2HE7A 2KMMA 3B08A 4H0LC 4HMJA 5JJLA 4XT1B 1I3QB 3Q14C 4FULA 2K50A 1GXDC 3NWTA 1WTRA 4DAMA 4DBGA 1UE1A 3ZDMC 3UE0A 4A3KB 1ACCA 4DR7L 2IY1B 2V4DA 4HPMB 1CA5A 5M5XH 3MEFA 3QIJA 1CA6A 1FXIA 2MBQA 2INDC 2KDBA 3N9YC 4MJSB 1EU3A 2MSED 2EYPA 1HQRD 2HUGA 2HD3A 4KZCA 2JXMB 2JA8H 1ZEQX 3P7JA 1E0ZA 1XMQQ 2QDFA 4NB3A 2HHHL 4KD3A 3GTOB 1TKEA 4HJ8A 3H6MA 1V43A 3D4WA 3RZDB 1P0RA 3VR8B 4C00A 2EDGA 2JA7B 2B8FA 3AFQA 1JB7A 4PZ6A 4LMQD 2JT4B 5ELFA 2W54A 1NSNS 2A19A 3T3NA 2IHFA 3Q23A 4KV6A 4K81A 4HXDA 1DXMA 3ECIA 1S40A 2Y0SE 4LK1C 5EJWA 4JI6L 1TS3A 3UDGA 1TWCH 2ES2A 2W82A 4K7SA 2N55A 1YX5B 1KDBA 4R4QA 2RQXA 3BDCA 2K7VA 4L5SA 4IN3A 3R7QA 4GKJL 5HURA 2WINB 3F1ZA 4HJGE 1EO6A 1BUIC 1TS4A 2F0OA 1RIPA 4RCOA 5CC4A 1EZ6A 3LGJA 1C4CA 2KC1A 3NVWA 1Q46A 4US8A 2EYOA 5F2DA 4LF5Q 2Q2HA 4JI4L 1Y1WG 1FRDA 2OJRA 1ET6A 1X3QA 1SIJA 3IFDA 3T16A 2K04A 1W6KA 4OWWB 5C3EB 4N9F4 5T1GA 1YD8U 5AZGA 4QIWE 2LY7A 2A1AA 4A3MG 3IVFA 3P63A 3Q3MC 1PRTD 3A5ZB 1KC8C 2ZCCA 3N30A 3CCQA 2D3CA 4FBJB 1WD0A 4DR7Q 4RA8A 3ONSA 3P1MA 4HCEA 2WGSA 2EQSA 4ZRKA 2KTRB 5GROA 1MHWC 1JMLA 3DHGC 2Y0SG 3RCZA 1IGDA 1RTOA 1UBIA 2Q2IA 1IYFA 1I4XA 4OHJA 3APDA 1SIFA 1Y8OB 1SE9A 4B3SL 5FLMH 2HHHQ 1XNQL 1AYFA 3SDLC 1Y1WH 2YTVA 4FP5D 3HOVG 2KC2A 2PZUA 2L83A 2D62A 5COYA 2O6VB 1GAQB 4Y7NB 5IODA 3AE4B 1LT6D 1RKNA 4PZ8A 1LQBA 2N7DA 3AU4A 1ZPSA 3LWEA 2K03A 4BA2I 4A3MH 1AH9A 2JZZA 1GKHA 1SSNA 2KBNA 4JI6Q 3QOJA 1HE8A 4Y7NH 3MHBA 4WJ4A 5EQ0A 2FAZA 1TU2B 1EFID 1ONLA 4P72A 3UE1A 4DK6C 3GZNB 4IJHA 4GKJQ 2BYTA 3ETRA 1S72A 1CZPA 1BCPC 3BZCA 2JEBI 5BYQA 2DUDA 1PFNA 2KDMA 3LXFA 1BCPB 4EFOA 3HOVH 4E3CA 2N78A 4QF4A 5FR3A 2GN5A 3VUWA 2J42A 4JI4Q 1JWAD 4FXCA 1RCVD 3U50C 2QMTA 2OEDA 4KHVA 2VB2X 4KDLB 2IDYA 1MJDA 4B9WA 3NE5B 1V80A 3L0WB 3ULJA 1U4RA 1C1YB 1C79A 4ZOHC 5KHOA 5TR5A 4XWWA 2DGYA 5JOBA 2MJ3A 4G11A 2V1YA 1EYCA 2NZHA 3QARA 1G91A 1GUOA 3E56A 1MSHA 2DN8A 4MDKE 4YT0B 4H7BA 1NI2A 3KBXA 3CC7A 4XQJA 2AL3A 4B3ML 3WAOA 2INNE 4KGRA 2CW0D 2RDFA 3V6CB 4EOYA 1E90A 2IY5B 3VYRA 4WH4A 2Y5CA 2VXWA 3Q6SA 3QR8A 4NPSA 5EKKA 4GOPA 3RN2A 1PH6A 1K52A 5AUIA 4R4TA 2DLBA 1NR4A 1SYBA 1NR2A 3CC2A 1AWDA 3PZ8A 2LGIA 1A8VA 4R1JA 2L1AA 4UPAA 1HRJA 2G9DA 2XN9C 1XNQQ 2JPHA 3DDCB 4OZBA 1YNND 3KYHC 4XE0A 3DLLA 4DR6L 2LMCA 2N4FA 4GN1A 4AYBE 5KNDA 4M8MA 3EJIA 4H2AA 1PH5A 1ZXIA 1RRBA 3RNGC 3BINA 1S5FD 3EROA 4AS1A 1CQVA 2C7NB 5C3WA 1TWHB 2GBNA 1JOQA 3TMEA 1HJPA 4MTNA 4YCWA 3B0AA 1CHPD 4XDDA 1BBWA 1Z5SB 1JOKA 5IT9E 2FMMA 2ZT9C 3NEMA 3N1YC 4AP4C 1WF9A 1LXDA 3AEBB 1PTOC 1EWIA 1E22A 5C6AA 4DGZA 4YHHL 4USAA 5E3FA 1YJ1A 3HG9A 3GOEA 3T1YQ 4ANWA 4DHZB 1PTOB 1BCPF 4XX5A 2KAJA 2NTSA 1BMLC 2IO1B 3BK1A 4TUUA 3CAMA 2F0EA 4BBSB 3AB5A 2IX0A 3I2ZA 3E9HA 2L1BA 1L1OA 3TP7A 1UE5A 3W1GA 4ME3A 1XCQL 1F0ZA 3HOWG 1E5WA 4CDDC 2JRHA 2NBVB 5CV5A 1F1HA 5G5HA 1PXUA 1DZ1A 1CI3M 1I5FA 2K5VA 3IKJA 3HOYG 4GIVA 3VA5A 4N59A 3OAWA 3GTPH 4CKBA 1C76A 2HDEA 2YEPB 3V60A 3VDZA 1VQMA 1EY4A 5C4JH 3P2BA 2MP2A 3I91A 1WE6A 2LXKA 4XYOA 2UUAL 1W2BA 4O2DA 4KKUA 3HOWB 1UEAB 1MBYA 1VQHA 2YYZA 4G57A 1VQ7A 4B3MQ 3QA8A 2LGSA 4KY7A 1F2RI 2G1EA 5I6WA 3J80E 1WCMG 3FVQA 5E7NA 4DAVA 5IA7A 1F9SA 3HOYB 1O7IA 4KLKA 1E8WA 5DM63 5E4XA 2KWDA 2NWGA 4XTCS 4OO1I 2K01A 4HPPA 4ANUA 2IO3B 3FKIH 4M0WB 5M3MH 4A76A 2ZJQA 5GAHC 1GJXA 4GB9A 2Y5BB 3EIVA 1WCMB 2VW9A 4A3BG 2K5WA 2VZAA 2A68D 5M9OA 4DV4L 1SE2A 4DR4L 1J0GA 1IYUA 3B6YA 4HJ9A 1ICWA 4LF6Q 1FVIA 1PLFA 1PTOF 2CWAA 1STGA 4G0NB 3I57A 4RGMA 4DR3L 3HZXA 3ND8A 4YHHQ 1N32L 3MFGA 2ZXPA 5LMNW 5I4DA 3F2CA 1QOHA 1STEA 2RBMA 3QO2A 1GPXA 1VQ6A 1CHQD 3NK9A 2LSSA 5E4WC 3ZW3A 1WTQA 1N5WA 4MGIE 1VQFA 4A3BB 5FK9C 3HKZE 5C4HA 2JSOA 5LNK1 3N20C 4RG1A 2PI2E 4K6LA 5G3LD 1IGCA 2YEPF 4JBMA 4HIMA 3G4SA 3TIXA 5H1SE 1STYA 2I5HA 4A4IA 1E1TA 1JWSD 4A3BH 2WB1G 1I7HA 2AWNA 3GTGH 2VUMG 1X32A 2DZKA 1YHBA 2K22A 4BKSA 3DUZA 2UUAQ 2LEKA 2H89B 1BDOA 2AQ2B 3J7A5 2KDIA 2NPTA 4ZDVA 1OGWA 3OJ3A 2WIIB 2DBYA 1TWGB 3OMCA 1YQ4B 1T9HA 3M7GA 2NVXB 4W9KA 5G55A 4MM3A 3UQBA 3J9CA 5K36H 2AYOB 2MJDA 4CJ0B 2KX0A 2R93H 2WB1B 4S17A 3RD2A 1JCKB 1PGBA 3NZ3A 4HEDA 2VUMB 1FCLA 2KWUB 3SK8A 1M8AA 5EKLA 4HSPA 2RR9A 5CTRC 4A6QA 1VLBA 3I4MH 2A6HD 1E8XA 5GAGC 1KDCA 4IURA 1PFSA 4IPCA 4PV1C 3H3VI 2QHOA 3AE5B 1PH2A 4LDTB 3JAME 4MTKA 2HIVA 2VUMH 1HZ6A 1JQ4A 2PJHA 1WGRA 2EY2A 1ZE3D 4C3JB 4DV4Q 4DR4Q 3CMMB 3DVGY 3OPOA 3MP9A 4HCSA 1L0XB 4REZA 3V6EB 3URYA 4IFDH 1EQTA 3NPPA 2KO3A 3Q69A 3PRPB 3R2IA 1OXUA 1PH9A 4LNOA 4M8NA 3ZGZA 2DYMA 2Q8RE 4B0MA 2F0KA 2KMCA 4BA1I 1IBKL 4DR3Q 1Y1VG 1HHVA 5L95C 1N32Q 1RL2A 1CSQA 4DUYL 2B76B 2DX5B 3OW7A 4ACFA 2TSSA 1YMHE 5EPJA 1J7AA 4F8CB 4GMVA 1I4RA 1S5ED 4A90A 4GN4B 4OX9L 1BKBA 5FO8B 4UHVA 1KIXA 3S1NH 1QZGA 4WURA 4FJZA 3GO5A 3LNNA 4QQBX 2V9HA 3X23A 3MZ5A 4DXFA 4JBWA 1WJNA 2DNFA 3FKYA 1Y1VB 2B2WA 2YV5A 1Q7YC 2A6ED 5IP7G 4POGA 5ELNA 2HT1A 5J2RA 3GTMB 3TQYA 1EOTA 3W1SA 1IL2A 2R92G 2UXDL 3U52E 1K8RB 2XEWA 2QW7A 1V49A 1X3PA 3L08A 3L0OA 1X55A 3D4DA 1T0RC 4HCPB 4HJ7A 2BWES 2KJRA 3ZJVA 2NVUI 1SSOA 2Z0SA 4XYQA 1N61A 2CJOA 3OSOA 2NVQH 2XWBB 1Z9FA 5CORA 2YU9B 2R92B 3GQBA 1U4MA 3D4RA 3U9OA 1O7LA 4MJSA 3S15B 4DAPA 1TZ1A 3V05A 2JVCA 3NJTA 5CHWA 3K5LA 1EEID 4DAYA 2FFKB 5KYIA 2LKVA 1R4MI 3S1MH 4P6VF 4DNRB 3MVVA 4CGYB 3TBLD 1VR9A 2UU9L 3S15H 4NJ7A 3KH0A 3T8MA 4G7OC 1E8ZA 1EF5A 4GGQA 3HRDD 3TS0A 5M3FG 1IBKQ 4DR2L 1QOGA 2N9PC 4NQKE 4DUYQ 2K1BA 3KBGA 2AWTA 2SDFA 3HP3A 5CR3A 1WX8A 2F0DA 4HDOA 5AFWA 3AEAB 1UF0A 5CX3A 3I70A 3F2BA 1QCBD 1PH1A 4QJFA 2NVYB 5LMNL 4OX9Q 1JRPA 5I2YA 1KAWA 3KYCD 5IT9c 4DV5L 3CC4A 4LK0M 1ILPA 2LVOA 4B3TL 5IIFA 2WXHA 3QAQA 4RWSC 4TQUS 4UY8C 4IC7B 2IJ0A 3AEVA 3M4OB 5DPSA 3ZUNA 1JOOA 2VQFL 3EECA 3NZUA 1N36L 1ASYA 4HVBA 1PHJA 1F2ZA 1JORA 1RODA 1K0RA 4WRDA 3TP6A 5G2NA 2WXRA 3WAMA 3ZIMA 2Z1CA 1EY0A 1PZID 4N8X1 3SK5A 3R3OA 5JJKA 3PRMB 4WIPA 1EUJA 4EQNA 2UXDQ 1TJEA 5LL6S 3TRZA 2UXBL 5EGTA 2ZM6L 5M3FH 2F0IA 4OIKA 4QB4A 3A74A 2R7ZG 1UD7A 2FNJB 5IO9A 2SEBD 4FVMA 3RNFC 3K7AH 3NQTA 2FBWB 5DAUA 2M56B 2FIDA 4ZRQA 3MC0B 3Q8AA 1G6ZA 3VQIA 1LM8B 2OCEA 2KENA 3H0GB 5BMHA 5FLXE 4LF8L 4RF1A 3AE6B 1Q8IA 4CBVA 1YJJA 2DZIA 4UDUC 2KTRA 2IGHA 3FILA 1JC7A 3K59A 1TBEA 3J80c 4JPSA 1NJIC 3SVMA 3ULPA 2FE8A 1B9NA 2B3GA 2XK5A 1EF1A 3HOUB 3K58A 2BOSA 3C3LA 3QJYA 1LUZA 1GO3E 3QB3A 5EPKA 2UU9Q 1L0YB 2K32A 2R7ZH 2O6VA 1NAPA 1QOBA 1SXTA 1UWXA 4IOAA 3I4NB 2LMCB 2JA5G 1K51A 4DR2Q 3TMPB 3L2PA 2DJGC 5C3JB 2KK8A 4X3KA 3UGBB 2BS3B 5LMNQ 4R4OA 1KRTA 1VQPA 2KEDA 1YNJC 5GMVA 5ELEA 3VR5A 4B3TQ 5EE0A 1PMRA 3A7LA 4J15A 1GUWA 4JG2A 1V86A 4F88A 4RMAA 3T9LA 4FLHA 2M9VA 2J0JA 4DUZL 1N36Q 1PGXA 2OEOA 1EIFA 4JWUC 1KRSA 1VCBA 5IYDH 1L1OC 4BY7G 3NVYA 1A3VA 2KDFB 3WALA 3U4VA 1L1OB 3GTLH 1Q5WB 3A9JB 4CO7A 2LI5A 1PH7A 2ZPNA 2UXBQ 3RI7C
chains in the Genus database with same CATH topology
2DYOA 3V3XA 1KNEA 3A8KE 3GV3A 1OXVA 4KI0A 4BY7B 4IOIE 2R6GA 1TY2A 3EGRA 1B1ZA 2NN6G 3GP7A 2WACA 5CV9A 3S1QB 2O5JC 4RFBA 4C3IB 4OL7A 2WXLA 2WXOA 3E6ZX 2M2LA 1ZYRC 3CRLC 1K53A 3O13A 3LYYA 1NENB 2OF1A 1VDZA 5EBDA 3Q8FA 1A6XA 2QCPX 3AEFB 3NUHB 1ROEA 3TUOA 1ENCA 1VF7A 3CHBD 3R93A 1MPEA 3D6WA 4N6EB 4IDIA 2NN6H 2OHFA 1C9FA 3RLFA 1FNUA 3BYTB 2ZW0A 1CK1A 3UI2A 3T56B 5C5MA 1F9RA 1SNMA 1D2BA 4LTUA 1PZJD 3T51B 3MAQA 2BCOA 4C2MB 2Y3AA 1P7FA 1GUNA 1IUEA 4A93B 3DWGC 2BDOA 5HG2A 3HUIA 4XXEA 2VZKD 1DOKA 3GTQB 2AWOA 1N60A 4JWSC 1YJIA 2F03A 3PV0A 4M0WA 1LT4D 4XQNA 2MH7A 4OVZA 1C48A 1KLUD 1IHZA 4ZQ3A 2Y5PA 1RM6C 1I6VC 3CRKC 5ELDA 2B39A 3HOZB 1QE6A 4TRDA 5C3XA 1JWUD 5IGGA 1D4BA 2F3VA 5C0XG 3PUXA 2MPMA 4I7ZC 1VZ7A 1DOXA 1EZ8A 1SE3A 3W9CB 1L5PA 1K8OA 5C4XB 4HEA1 3M85A 2HTME 4TSSA 4RGOS 2XVSA 2B2WC 4X3UA 5DNFA 4L2YA 2HDMA 4XDCA 1YN4A 4EGVA 3ZJTA 2KA7A 1CQFA 3FPPA 3NP8A 3I9V1 5C0XH 1TKWB 1CZWA 2JZPA 3K5NA 2XSCA 2F0TA 4KX6B 1EEFD 4R9WA 4G7ZC 2XRQD 1Q1BA 3DXJC 2JA8B 2RPVA 2KACA 1S5DD 4KTAA 1AN8A 3IT4B 1HXYD 2I46A 3FRPB 1MD2D 2J4XA 2I07B 4K6DA 4RF0A 2D5DA 1HUNA 1C8CA 5KNCA 3DEPA 1TWCB 1ZDVA 1O78A 4K8IA 1VMPA 1SF0A 3A7AB 1SYEA 1C4AA 3ZYYX 3IAYA 3T13A 3BVZA 1BO0A 1FD6A 1ML0D 2PW5A 1B50A 2WXJA 4FF3A 4B08A 2F0SA 2LHDA 1QQRA 2BB5A 4DXGA 4RCNA 1AZQA 1WRIA 3I4LA 2V4IB 1EY6A 1PDQA 1PRTC 2F0JA 2E3TA 2AUJD 4FYDA 3AB9A 1PRTB 2FMCA 4DA2A 2IX1A 2RA4A 4KN4C 1VF5C 2BA1A 3BK2A 1TR5A 1Y1WB 3PIP3 1SYDA 3EVQA 2A5HA 2QIEB 3MTSA 2JX5A 1V1OA 3J7AF 2BE5D 4CJ1B 4A3MB 3K57A 2AQ1B 1E2WA 1OXTA 4K5VA 1NYQA 2KN4A 5D3IB 4NP5A 1BNZA 4R8NA 3KWLA 2Y0SB 1WSPA 4R8IA 1DYQA 2A73B 1A70A 2WLBA 4KGTA 1D1IA 1GB4A 3SFDB 3HOVB 4ZK9B 2C9OA 1EY5A 1EYDA 2H1EA 4F7XA 4B0EA 3N52A 4F8MA 2K05A 2NYZD 1EY7A 2PLPA 4L63B 1B2TA 1GHKA 2K6AA 3I72A 4FNFA 3DMUA 4X3TA 1MSGA 2BDNA 4QIWB 5KIXA 4YIJA 3KQ4A 1HTPA 2CW0C 5H8YE 3R8BA 5EE1A 1AFPA 2D2CC 1TT2A 3NSWA 4ITKA 3AE7B 3AMUA 5E6JA 1SDFA 2VNUD 1YNNC 1W6JA 3A8JE 1LT3D 4XQQA 4JK1C 2F0LA 4K14A 4C1NK 3I3CA 5EBCA 1WTWA 4S3SA 1E2ZA 2ONQA 1F9PA 3FC4A 3L9AX 2F0MA 5IGBA 3OWEB 3Q24A 2V0GA 1O80A 3EUB2 1IYVA 1T6BX 1JWBD 2EKIA 3A8IE 5JJZA 1R7SA 2JYEA 3BIID 2WXKA 1RHPA 1KNAA 5FO9B 1VCIA 4OO1G 2GB1A 4JE3B 3ITPA 4EQOA 4KN7C 1SJHD 3MA2B 4Q0FA 4QUCA 5GXGB 2FJ2A 3TDQA 1SNPA 1Z6HA 3GTPB 3SK6A 5C4JB 4HKZE 2E75C 1V8QA 4TMAB 1PZKD 3PMFA 4XDXA 3HS0C 1DOMA 4DN4M 4FF1A 4KMUC 1GHJA 5C0XJ 3WDNA 3VA7A 2PMVA 1QOFA 5FKAC 3BDLA 5NUCA 4F87A 2NMQA 4O42A 3AEAB 4OO1H 4WFN3 1AW7A 5ISRA 2QF7A 1WTPA 1KF6B 1TS2A 1PTOD 1GUGA 4A55A 1BUVT 3K0YA 3FKIB 3EA6A 4FXKC 5M3MB 3MJ5A 4KGSA 1JR0D 2EYLA 3SEBA 4DNTB 2MJEA 1VRAB 2KVMA 2KEEA 2X6LA 2WV6D 5I9OA 3MWYW 4AYBB 1K50A 1MHXA 1EWHA 1STNA 2K5PA 3EQLC 1A2TA 3GTJB 2F0PA 3K5MA 1XLPA 3ND9A 1BR9A 2IWHA 3BZDB 3PUZA 1A2UA 1EU4A 4DQOC 1TS5A 1HTLD 4ABNA 1CJEA 5K36G 1U4LA 1PUTA 1ZXTA 1SYGA 1DONA 3KLRA 1QILA 3GTGB 3WOFA 1D1KA 2WU5B 3H09A 1QNUA 4J8QA 2F4IA 2EYFA 3X3NA 5KGUA 1XO3A 1FR3A 1BQQT 2N9LA 4ULLA 1UWMA 2R93B 5D65A 4IFDG 1LTRD 1DOYA 3LWUA 1V1PB 3I4MB 2A6HC 4FO2A 4IUPA 4Q2JA 1IL8A 4IUQA 1MI2A 4YTNB 1Z7TA 1Y8PB 4DK0A 5I6YA 2M00A 2X38A 3IT6B 3DHQA 2WXMA 2I38A 3A56A 1XLOA 1SYCA 1LLRD 3VR6A 3S1NB 2WKCA 4U673 3NUCA 1GUSA 4PNYA 1J7CA 4CQNA 3VYUA 1U4PA 4NJCA 2IT1A 1YN3A 2N7JA 3FAHA 3NTIA 1HFNA 1WTXA 3CWIA 1B53A 1IW7D 1LTGD 2A6EC 2HDLA 3CKIB 4OIJA 4O1NA 4C56C 1WVLA 2PTLA 3P4QB 3RMHA 4RGNA 4KJOA 3FEWX 4UAIA 1D5MC 3D31A 1KRHA 1YN5A 5T8IA 2ZXRA 1EIGA 2PNRC 2R61A 3Q8BA 2A69C 3AECB 5A35A 2NVQB 2PO4A 3FILB 1DM0B 2K28A 5BN5A 4CJ2C 5DM73 2J7ZA 5D7GA 1OO9B 4HTHA 3MXNA 4ARIA 4ZRPA 2C5CA 2AX5A 3S1MB 1B9RA 3RD4A 3KLSA 2BT6A 2F0WA 5BN3A 2SAKA 2ICIA 3DWPA 1EY9A 4HMIA 2IGDA 4MHEA 2WXGA 5A2QL 2B2YC 3C1FA 4ID6A 4DU9A 4ZUJA 2WS3B 4HAEA 2E76C 4P16A 1NVID 3B2GA 5IGEA 1BOSA 5DEHA 4RGTA 4V0BA 3TEYA 2Z4IA 2WP9B 4H44C 2K5DA 3KUPA 3D6CA 2WU2B 3MXPA 5M3FB 3UI3A 1H9JA 3K7AB 3IFTA 4IZ8A 3SXHA 3L3OC 1VMCA 1R4QB 4TKOB 2L52A 5K5PA 3GB1A 3TP5A 5JVG3 1Y8NB 1HUMA 4PQXA 4ME5A 4QUFA 3QG1A 1FO4A 4YSXB 3SFEB 1ILQA 2K3UA 2L32A 2NUCA 2R7ZB 2PW7A 4RKLA 2EJMA 4WORA 2Q8TA 2ACZB 4LAAA 2B2UC 1L0VB 1A15A 3G7LA 4EQPA 2JEAI 4L23A 4MACA 2F0NA 4A8XC 2GA4B 1SB3C 4PMBA 3AV8A 1S5BD 3DWQA 2BS2B 2L4NA 1Q12A 3MHZA 2O4XA 2PVGC 2E2DC 2EVBA 1G2SA 1FYCA 3NS1A 1TIID 3ZQ4A 1SYFA 2RDGA 3GTLB 1FM0D 2JA5B 4CHTB 2K9XA 2MJ8A 1PFMA 4YXDB 5CBAE 4A3DB 1SMYD 1KDAA 1D6EC 2MEKA 3SR6A 3AE3B 2QDBA 4HN7A 1Q10A 3P4SB 2LFNA 1YNJD 2E2JB 1HFGA 5M5WB 1K8MA 3VYTA 5CV6A 4HROA 1TYGB 5HGTA 1EWCA 2K33A 1QKZA 3SK4A 3TSSA 1VZ8A 1FD7D 4IFDJ 3H94A 2PCFB 2B8GA 1B4OA 3P20A 1E6EB 3EFXD 4K8JA 1M4VA 4KY5A 3P75A 3TEXA 3J7YW 1OXSC 5IT9L 2B2VC 3HGBA 3P4PB 1NCVA 1JWMD 2OT2A 3PO3B 2W3SA 3S16B 4P2CB 4MH8A 4ZLTF 5CV4A 5HHDG 1ZYRD 1RWSA 5BMGA 2XIWA 4KJNA 4BY1B 1C4QA 1A3UA 1VZ6A 5CMDA 1JROA 4K2KA 4KK7A 3C8YA 1FFUA 2INPE 1JQYD 1HZ5A 2NN6I 1TZOA 3AMZA 3MEHA 5LL6X 3AU7A 5TSSA 3J80L 1MVKA 4K5XA 1I4HA 4WAFA 3GS2A 2N88A 4Q5VA 1BF4A 5JEAG 1STHA 2EY5A 1SNQA 4G4KA 4JX1C 3MXGA 4QCLA 2I2YA 1LACA 5EE3A 3A54A 2JQRB 2WDVB 3H8HA 1QB5D 5EPLA 1E7PB 1KFYB 1UNSA 1ZKOA 2QILA 2LFIA 2BA0A 4I65A 2LUMA 3V96A 1G8ZD 1G291 1Q3LA 3HOXB 2TMPA 1O7YA 3SR1A 1F9QA 4HRSA 1EY8A 4RHSA 3NRZA 1EM7A 1PFDA 5JEAH 4X3SA 1T5EA 5BN4A 2M0AA 2J0TD 4L1BA 2KUMA 2O2LD 3BS1A 5IGDA 2K5QA 4GLSC 1N63A 3WCQA 2F0UA 3U4EG 5M5YB 4TQ0A 5CBEE 5C5LA 1V1PA 1L4ZB 1NI3A 3AEDB 2F0QA 2R3ZA 2FINB 3CQZB 2RVLA 4PMWA 4ILWA 1EYAA 3OOCA 4CKCA 3J7AV 2A74C 4IALA 1JE4A 4EE2A 1V97A 1H9SA 2JP1A 5LHY1 2BW2A 3TEWA 3L4PA 3TEZA 1E9MA 2LS01 4IUNA 1E10A 4AQ7A 2NBFA 4ZYSA 2DY8A 4N9TA 1HQMC 1PYWD 1ZP0B 4NMZA 4KD4A 1ZOYB 5C0XI 2V3PA 3VRBB 2XWJB 2HQEA 4J1MA 2EY1A 5A2QE 1MHHE 1FNVA 3M3YB 5IGFA 2F3WA 3QWNA 3IL8A 2EZVA 1SFOB 1JB3A 1STBA 4YTMB 3CIRB 3IXSA 3FILA 3TZDA 4Z9CB 3HEJA 5FO7B 4RKBA 4FXGC 3U9SA 4E6IA 3FMCA 3D3RA 2IL8A 1WGKA 3RZOB 2LJIA 3BYYB 2BE5C 4CKEA 3PUWA 1XYIA 1IKLA 3RUZA 2QKIC 3AEEB 5CYUA 2WNMA 2B2YA 3KK7A 2EJGC 2ICEC 3S2HB 2VB3X 4GDKB 2W55A 4C1NI 3HRZC 4WWMA 3E0JA 5BYSA 5D3DA 1SE4A 3U7ZA 5I2XA 2DNCA 3OIPA 3OMGA 2WDQB 1I4GA 2WXFA 1BXTA 1CTMA 3AE1B 3I90A 5KRUA 2KCCA 1ESRA 2WDRB 1E0BA 3MFYA 4V190 3DWAA 4FF4A 2B63B 1NUCA 1TKYA 2ZW1A 1ZDXA 4K2LA 3ZJUA 4A3EB 2KOLA 2CJNA 4RNAA 1PRTF 1IBXA 5C2TB 1GB1A 1R4PB 1ZUD2 1FNWA 2EXZA 1Y69U 2ON8A 3DEOA 4XWTA 1SNCA 1FGBD 4BBRB 3AH7A 1LTTD 1Z47A 1RF2D 1QG7A 2E6XA 4XT3B 3KLSX 3BVGA 2D9UA 3L7ZC 4US9A 5FLXL 3B2FA 1RFKA 1YNTE 2DNEA 3W5VB 1BCPD 1WTVA 3IAS1 3N6RA 2F0VA 3P1HA 2B2UA 5KEEA 1TVXA 1N5XA 5ELBA 5AUKA 4KKTA 5JPNC 1AZPA 1SEBD 2NB0A 1L6UA 3KWVA 4KY6A 3S14B 4R3DA 1WD1A 4ZAIA 3GTKB 5HFYA 1YQ3B 5JEAJ 3NVZA 4J3OD 2EYMA 1F2RC 2JA6B 1CZGA 5C44B 1SJED 3NVVA 3SDZA 1A3TA 2QJLA 2V3NA 1Q1EA 1XCTL 1J9OA 1XF5L 2K0PA 1D5XC 2MP1A 2WAQB 2LHEA 3VR9B 1FIQA 1PFBA 4OW0A 1D5ZC 1TQOA 4G7HC 4A3JB 1FCCC 2CVRA 1LTID 5H92C 4IKGA 1ENFA 1HPCA 4QMGA 2EYHA 2BS4B 2M19A 1PTOH 3VR3A 1ET9A 4A3IB 1WYGA 4RHRA 1VJKA 2WXIA 2A68C 1QJOA 2JE6I 1TY0A 5J22A 3ONAB 2RSOA 3RFZB 2H88B 2XRSD 3GD7A 2JWUA 3AEGB 4GDLB 2JYOA 2KCNA 3C46A 1B9MA 5CGKA 3WOEA 3OIQA 2E2HB 3Q0AA 4L8JA 2FUG1 1AEXA 1ZXHA 2KECA 2L9HA 2EYJA 4ZUIA 3QIAA 5EE9A 1PGAA 1CFMA 1STAA 4B9XA 2B2VA 2WXPA 3PIO3 4YTPB 2F0HA 3NBIA 4KHZA 3P42A 1S5CD 4NAWB 2L12A 2B2TA 3PZ7A 2WXQA 4C80A 3H3VC 1LO5D 1TWFB 2N9KA 2L0CA 3E5SA 4ZKBB 1WXQA 1XTCD 2RSNA 1N62A 1LTSD 2DWQA 1ENAA 5E1FA 1I4QA 4C7YA 3M7NA 2JU6X 1QF6A 4KKIA 1F2MA 1KAAA 2PKOA 1UGJA 1Y56A 1LTAD 3W2DA 2X6GA 3I73A 1FEHA 4IUTA 4WJWA 1GUTA 4ZHPA 2O5IC 2AUKA 1H9SB 2CHBD 3FPUB 2PQEA 2Q8IB 1UAPA 5KYLA 3BG3A 4C3JG 1IW7C 2JYTA 4ZHOA 3NTHA 4LJZC 3GV6A 1LTBD 5G3LF 4U68A 3HKZB 2L11A 3OWFA 2E2IB 1KTKA 3W3AA 5CV8A 3AM9A 3J81L 2ZXOA 1PDXA 3K6OA 5J1ZA 1WTOA 1FRRA 1MGSA 5G5GA 1TWAB 3DWMA 2Q5WD 4IFDI 1XXGA 2PZTA 1DJRD 3PO2B 2J53A 1Q90A 2KHSA 4FXDA 2CQAA 4YSZB 1AP0A 4NDXA 3LX0A 1HEZE 3S2DB 3B9JA 3ERQA 1LV9A 4OZAA 4OZCA 2L55A 2F0FA 1JW9D 1CM9A 4KKSA 1WWTA 2MUYA 2MGSA 2A69D 3VR4A 3HVDA 2JSVX 3W5UB 2WQYB 3MXUA 5BYRA 4ZKCB 4WQMA 1MI0A 2SOBA 3IAM1 1OXXK 1SNDA 4IQZA 1H9MA 1T5XD 1J8IA 1RYJA 4NW2A 1U9RA 4A9AA 1LT5D 3T3OA 5C4ZA 2F0GA 1XLNA 3ABVB 1H9KA 2EELA 1I50B 3BDOA 3D8GA 4N9PA 1DGJA 1E2VA 3NHHA 3TP8A 3M4YA 5JVH3 3KF8A 1IBXB 2NZ1D 4C7ZA 3I8ZA 2BBCA 1C77A 1F77A 2MHVA 2HCIA 3TZUA 1FXAA 1EQVA 4ZRZA 1F2LA 2HCCA 1J7BA 3BWUD 1HA6A 1I4PA 1B44D 3H91A 3A55A 2NVTB 1QWYA 4HKQA 2IPKD 3HVZA 1S4ZA 1NEKB 3TN2A 4YWGG 5D14A 2PMZB 3X3MA 4M8AA 4BS9A 2IW3A 3PO0A 1F2YA 1HCZA 1KH0A 4NKLA 1V8CA 1EWYC 5FOBB 1SNOA 1C4PA 2OXPA 2BTEA 5J39A 3VYSA 1L6VA 2JXTA 1KABA 1ESFA 1K83B 1O7ZA 1QLBB 3T53B 3R2TA 2PIAA 4IUUA 1SAPA 2FHTA 1SBBB 1UUPA 1SMYC 1IKMA 3DM1A 1TKGA 2RKSA 4PT5A 4BWGB 3VRAB 4DFAA 1XEEA 4MT5A 1II3A 2F1MA 2BB6A 4RH6A 3S1RB 4C3HG 2PZWA 1FFVA 2AQ3B 4TQ1A 4HSVA 4MN3A 4OGQC 3NTKA 1XWEA 4PMCA 2EJFC 4J6HA 2GRIA 4DK1A 2SNMA 1LABA 2ID0A 3U2SC 4KKJA 4DF7A 2IX3A 4LLGM 1DCZA 5EKIA 2D5GA 2QSDA 4D2KA 4C3HB 5CV7A 4C3IG 1I6HB 2WP8J 2DY7A 4MIUA 1NYRA 1G2TA 1C78A 1XX8A 2PPBC 4GZYC 5IOCA 1JALA 5JAVA 3LB8C 3QOLA 2W3RA 3OHXC 2WXNA 3AN1A 1DD2A 4YSYB 5T1IA 1VDVA 3NQIA 2XNAC 2EY6A 3C1EA 2X69A 3F2UA 3K5OA 2G9HD 1EL0A 2EOTA 5I9PA 4ARCA 2B2TC 1P7EA 4NZLB 3TBIB 3NWSA 1RTNA 1EIHA 1T3QA 3PUYA 3NXWA 1QNKA 2VZKB 3E9SA 4H13C 3Q22A 4XIGS 2J52A 3FDTA 3P4RB 5JPMC 3NBHA 2N0SB 1R9TB 4FF2A 3BVMA 5MPOA 5HI1A 3Q8CA 2Z4HA 2EPBA 2Z8LA 3C2PA 3RPFC 2KQ3A 4EVOA 2EE1A 4A3FB 3G6JB 2PW9A 4MM3B 3SHLA 1QT9A 2QEJC 1GOZA 2RMMA 1L4DB 2E74C 4M1UB 2L5TA 1DOLA 3Q8EA 4N58A 2SNSA 3VR2A 1DOIA 5JXVA 5ELCA 5KNBA 2PVOD 2GI9A 1KLGD 3CU7A 1RJTA 4K5WA 3S17B 2ENBA 3S9WA 4IUVA 3PUVA 2H4OA 2NTTA 1BBXC 2WKDA 1B3AA 4ODGA 1RD9D 1XLQA 1OQQA 1JICA 2PYKA 3SE0A 4RAUC 1HA5A 1RDPD 1FMAD 3J81E 1CT1D 3AE8B 2RDHA 1OQRA 3T4AC 4NAMA 1QOAA 2CU3A 2IGGA 2KJXA 1OFFA 5IGCA 3V2TA 2KQ4X 1H9RA 4A3GB 4HR7B 3JAML 4L6TB 3AE2B 5M5XB 2KMMA 4H0LC 4HMJA 4XT1B 1I3QB 1GXDC 3NWTA 1WTRA 4A3KB 1ACCA 2V4DA 1CA5A 1CA6A 1FXIA 3N9YC 1EU3A 2EYPA 1HQRD 2HUGA 2JXMB 1E0ZA 1ZEQX 3P7JA 4KD3A 3GTOB 1TKEA 3H6MA 1V43A 3D4WA 3RZDB 3VR8B 2EDGA 2JA7B 2B8FA 4LMQD 5ELFA 2W54A 1NSNS 3T3NA 3Q23A 4KV6A 1DXMA 4LK1C 5EJWA 1TS3A 2W82A 2N55A 1KDBA 2RQXA 3BDCA 2K7VA 4IN3A 5HURA 2WINB 4HJGE 1BUIC 1TS4A 2F0OA 4RCOA 5CC4A 1C4CA 1EZ6A 3NVWA 4US8A 2EYOA 5F2DA 1FRDA 1ET6A 1X3QA 1SIJA 3IFDA 3T16A 2K04A 1W6KA 5C3EB 5T1GA 2LY7A 3P63A 1PRTD 1WD0A 4RA8A 3P1MA 4HCEA 1JMLA 1IGDA 1RTOA 1I4XA 4OHJA 1Y8OB 1AYFA 4FP5D 2PZUA 2L83A 2D62A 5COYA 3AE4B 1GAQB 4Y7NB 5IODA 1LT6D 1RKNA 1ZPSA 3LWEA 2K03A 4BA2I 1SSNA 3QOJA 3MHBA 5EQ0A 1TU2B 1EFID 1ONLA 2BYTA 3ETRA 1CZPA 1BCPC 2JEBI 5BYQA 1PFNA 2KDMA 3LXFA 1BCPB 4QF4A 5FR3A 2J42A 4FXCA 1JWAD 1RCVD 2QMTA 2OEDA 4KHVA 2VB2X 2IDYA 4B9WA 3NE5B 4ZOHC 4XWWA 1U4RA 1C79A 5JOBA 2MJ3A 1EYCA 1G91A 1GUOA 3E56A 1MSHA 2DN8A 4YT0B 4H7BA 3KBXA 4XQJA 2INNE 4KGRA 2CW0D 2RDFA 3VYRA 4WH4A 2Y5CA 2VXWA 3Q6SA 5EKKA 1K52A 5AUIA 2DLBA 1NR4A 1SYBA 1NR2A 1AWDA 3PZ8A 2LGIA 2L1AA 1HRJA 2G9DA 2XN9C 4OZBA 1YNND 4XE0A 2LMCA 5KNDA 3EJIA 4H2AA 1ZXIA 1S5FD 3EROA 4AS1A 1CQVA 5C3WA 1TWHB 1JOQA 3TMEA 1CHPD 4XDDA 1JOKA 5IT9E 2FMMA 2ZT9C 3AEBB 1PTOC 5C6AA 4DGZA 4USAA 5E3FA 3HG9A 1PTOB 1BCPF 2KAJA 2NTSA 1BMLC 3BK1A 2F0EA 4BBSB 3AB5A 2IX0A 2L1BA 3TP7A 1F0ZA 1XCQL 5CV5A 5G5HA 1PXUA 1DZ1A 1CI3M 3IKJA 3VA5A 4N59A 4CKBA 1C76A 2HDEA 2YEPB 1EY4A 3I91A 4XYOA 4KKUA 3HOWB 1UEAB 1MBYA 2YYZA 4G57A 4KY7A 1F2RI 2G1EA 5I6WA 3J80E 3FVQA 4DAVA 1F9SA 3HOYB 5DM63 5E4XA 2KWDA 2NWGA 4XTCS 4OO1I 2K01A 1GJXA 1WCMB 2K5WA 2A68D 5M9OA 1SE2A 1IYUA 1ICWA 1PLFA 1PTOF 1STGA 3I57A 4RGMA 3HZXA 3ND8A 3MFGA 2ZXPA 5I4DA 1QOHA 1STEA 2RBMA 3QO2A 1GPXA 1CHQD 3NK9A 5E4WC 1WTQA 1N5WA 4A3BB 5FK9C 5C4HA 2JSOA 5LNK1 4K6LA 5G3LD 1IGCA 2YEPF 1STYA 1JWSD 1I7HA 2AWNA 1X32A 2K22A 3DUZA 2LEKA 2H89B 1BDOA 2AQ2B 2WIIB 2DBYA 1TWGB 3OMCA 1YQ4B 2NVXB 3M7GA 3J9CA 5K36H 2MJDA 4CJ0B 2WB1B 1JCKB 1PGBA 3NZ3A 4HEDA 2VUMB 1FCLA 3SK8A 1M8AA 5EKLA 4HSPA 4A6QA 1VLBA 2A6HD 3AE9B 3AE5B 1KDCA 4IURA 4PV1C 3JAME 1JQ4A 1HZ6A 2EY2A 1ZE3D 4C3JB 3MP9A 4REZA 3OPOA 4HCSA 1L0XB 3URYA 4IFDH 1EQTA 3NPPA 3Q69A 3R2IA 1OXUA 3ZGZA 2DYMA 2Q8RE 4B0MA 2F0KA 4BA1I 1HHVA 2B76B 3OW7A 2TSSA 1YMHE 5EPJA 1J7AA 1I4RA 1S5ED 4A90A 5FO8B 4WURA 3GO5A 3LNNA 3MZ5A 4DXFA 4JBWA 1Y1VB 2B2WA 2A6ED 3GTMB 1EOTA 3W1SA 3U52E 1X3PA 3D4DA 3ZJVA 1SSOA 4XYQA 2CJOA 1N61A 3OSOA 2XWBB 5CORA 2YU9B 2R92B 3D4RA 1U4MA 3GQBA 3U9OA 1O7LA 3S15B 4DAPA 3V05A 3K5LA 1EEID 4DAYA 2FFKB 5KYIA 2LKVA 4P6VF 4DNRB 3MVVA 4CGYB 1VR9A 4G7OC 3HRDD 1QOGA 2K1BA 3KBGA 2SDFA 3HP3A 5CR3A 5BMIA 2F0DA 5AFWA 3I70A 1QCBD 2NVYB 1JRPA 5I2YA 4LK0M 1ILPA 5IIFA 2WXHA 4RWSC 4TQUS 2IJ0A 3M4OB 1JOOA 1F2ZA 1JORA 1RODA 4WRDA 3TP6A 2WXRA 2Z1CA 1EY0A 1PZID 3SK5