1JCKB

T-cell receptor beta chain complexed with sec3 superantigen
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
239
structure length
239
Chain Sequence
ESQPDPMPDDLHKSSEFTGTMGNMKYLYDDHYVSATKVKSVDKFLAHDLIYNINDKKLNNYDKVKTELLNEDLANKYKDEVVDVYGSNYYVNCYFSSKDNVGKVTSGKTCMYGGITKHEGNHFDNGNLQNVLIRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIESNGNTFWYDMMPAPGDKFDQSKYLMIYKDNKMVDSKSVKIEVHLTTKNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a T-cell receptor beta-chain complexed with a superantigen.
pubmed doi rcsb
source organism Mus musculus
molecule tags Complex (toxin/receptor)
molecule keywords 14.3.D T CELL ANTIGEN RECEPTOR
total genus 63
structure length 239
sequence length 239
chains with identical sequence D
ec nomenclature
pdb deposition date 1996-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
B PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1jckB01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1jckB02
3MC0B 1TS3A 5D3IB 1DJRD 1CHQD 1CHPD 5FK9C 1ESFA 2WV6D 1BCPD 1GOZA 3EFXD 3R2IA 1BCPC 3R8BA 1HA5A 1EFID 1LTID 3DWQA 2G9HD 1YN4A 2J4XA 4UDUC 1FNVA 1LT3D 1MD2D 4L63B 1TY0A 4OHJA 3DWAA 2R61A 4RGTA 1SEBD 1XXGA 3O13A 1PZJD 2QILA 1CT1D 5ELEA 1PTOH 2IJ0A 1V1PA 5D3DA 3GP7A 1D5ZC 1F77A 2RDHA 4RHSA 2RDGA 1EU4A 1HTLD 2AQ3B 1PZID 1M4VA 1EEID 1TS2A 5I4DA 1YN3A 1RD9D 1L0YB 2NTTA 1PZKD 1SE2A 1PRTC 1PTOB 1S5BD 1TS5A 4C56C 1PRTF 1YN5A 1XTCD 1G8ZD 1LT5D 1CQVA 1ET9A 1I4GA 2QEJC 1SBBB 1FNWA 1S5CD 1PTOD 1T5XD 1I4HA 2NTSA 2O2LD 4RCOA 1BCPB 4RGOS 1UUPA 4RGNA 5ELBA 4NZLB 1L0XB 2XN9C 4RHRA 1LTBD 1HXYD 2AQ1B 1LTAD 1SE4A 3EA6A 4Z9CB 4L6TB 4RGMA 1JR0D 1LTSD 1LTTD 1FD7D 5TSSA 1PYWD 4DXFA 1UNSA 3BZDB 1QILA 2AQ2B 2Z8LA 4TSSA 1BXTA 1D5MC 1STEA 1BCPF 1LLRD 2SEBD 3V05A 3DWPA 1LTGD 1PTOC 1PRTB 4DXGA 1KLGD 1LTRD 3KLSX 1FGBD 1JCKB 1ENFA 1SJHD 1JWSD 3CHBD 1AN8A 1V1PB 4O1NA 1JWMD 1HQRD 4RH6A 1S5FD 1KLUD 3BVGA 5FKAC 1EWCA 4K6LA 1B1ZA 1S5ED 2XRQD 5ELDA 2ICIA 1DYQA 1CK1A 3BVMA 3SEBA 3BYTB 1I4PA 1SJED 1LT4D 1I4QA 1RF2D 1EEFD 1LT6D 1SXTA 1PRTD 1I4RA 1I4XA 2CHBD 1KTKA 1SE3A 4RFBA 1LO5D 1JQYD 1S5DD 1FNUA 5ELFA 3MFGA 4BWGB 1D6EC 3BVZA 3OWEB 1PTOF 2XNAC 2IPKD 5ELCA 3TSSA 1ET6A 4ZYSA 2XRSD 1V1OA 1B44D 1AW7A 3BYYB 1D5XC 1RDPD 1TY2A 3W2DA 3URYA 2TSSA 1EU3A 1RCVD 1JWUD 1TS4A 3R2TA
chains in the Genus database with same CATH superfamily
3U52E 2NVTH 2D0PA 1DJRD 2JSVX 1CHQD 3TP8A 3VYTA 3VDZA 4DQOC 2N7JA 5IP9G 1C4CA 3R8BA 2G4SA 4LCDE 2J42A 4EQNA 1IPGA 4GLAC 1BO0A 3HRZC 1UGJA 2L05A 2GVBA 4XTCS 1LGRA 4JYAL 2BKRB 3HUIA 4OHJA 3HIZA 3AM9A 3BS1A 1GUAB 4B08A 2LKVA 1PMRA 3FMCA 1K3BC 2RBMA 5IGGA 5J2RA 1CT1D 2WNMA 5BN3A 2AWTA 3T9LA 3AQQA 5IGDA 4NPSA 3V6EB 5E6PA 3NVZA 1WH3A 3H6MA 4GB9A 3GP7A 5LMUQ 2Q5WD 4ARIA 2K8HA 3WA0A 1KOTA 5L37A 3HOWG 1KRHA 4J8QA 2A69D 3LWUA 1BOSA 4LAAA 1N34Q 4LDTD 4ZUIA 1GNUA 4C4VA 4RMFA 2Z6BA 1Y1WH 3T3OA 1XCTL 3P7JA 5IOCA 1SE2A 5JEAJ 2BKFA 3VXWA 2GN5A 2XBBC 4KIKA 1RWSA 1B70B 1E10A 5GQOA 1WCMB 4HAEA 4FJZA 2NBVB 2DZJA 2KHJA 1A63A 1FD6A 3KDFB 2NVQH 3QHTA 4IW0A 1I3QB 4KGTA 4MGIE 4BFRA 1L6UA 2CHXA 2KVZA 4P73A 4RGOS 2HHHQ 1M8AA 1L0XB 4LFAQ 3QJYA 2WX0A 3NWSA 1XLOA 3VR6A 3DHHC 3MXGA 1UE7A 3U2SC 4LF4L 3RPFC 4HRSA 4PT5A 1JORA 1XQQA 3W5VB 4B3RL 1P0RA 4YSZB 5NUCA 5EPKA 3PHXB 1WVLA 3IG3A 2VH2A 3ZVVA 2BGFA 2RDFA 3NBHA 1MJCA 2I07B 4KHZA 2JPHA 4JV5L 2K05A 2L15A 3GV6A 4IURA 5IYDG 2YU9B 2D0OA 1GKHA 1E8XA 2JXXA 2WU5B 3AECB 2JXTA 2M8SA 4GGQA 2FINB 3I4NB 2HE7A 2LXKA 2F0SA 3J9CA 1PDQA 5H8YE 1V49A 3P4PB 2NZ1D 4XDXA 1OXSC 1WCMG 1LTLA 4OEMB 1WD0A 1GHKA 3AFQA 4B3MQ 2NBWB 3RZOB 5AUIA 4MACA 3IT4B 3KJOA 1ENAA 1WMHA 3BYTB 1E2VA 2K39A 1G6ZA 1BQQT 1C77A 3DBLB 1C3TA 1Q82C 1I35A 4OVUA 1DOXA 2B2VC 3K9PB 3TIXA 4A4IA 4JI7L 2MPMA 1SNPA 2J7QB 2JK8A 1WY8A 2FIFA 3LGJA 3EHVA 2KCCA 1DOIA 3JSVA 2C60A 1N5WA 2Z0SA 3HOYH 5ELOA 2DZMA 1U4LA 1Y8NB 5C4ZA 3BVZA 1NSNS 3FILB 1N34L 3ZJTA 1Y1WG 5A35A 4ZRQA 4EGVA 1JE5A 5HFYA 1JICA 5LXHA 2LXJA 1NY4A 1EYCA 2DYOA 4M0WA 1CTMA 2KVMA 1K8AC 1FXIA 1WE7A 2EQSA 4C3IH 1RDPD 1AZPA 3IBEA 3GTLB 4A93G 4IUVA 1NNXA 3K0XA 4A75A 4JBWA 5JH5C 2F0FA 1YJNA 3L7ZC 3NBIA 2XWJB 4ASWC 3D31A 4P16A 2I5MX 1Z5SB 1WE6A 3GO5A 1J8CA 3GTMH 1AE2A 1AZQA 2CH4A 4S0RA 3ZW3A 1PVOA 1A3UA 2HDMA 2K7VA 4X65Q 1MHHE 5M5YH 4ANUA 5C3EG 3A33B 1TQOA 3U58A 1BMLC 1H9JA 1FNVA 3H91A 1KXLA 3K7UC 1QB5D 5I9OA 1F9QA 2JA9A 2PW5A 1XXGA 4NXMQ 3MC8A 4X62Q 1KF6B 3VAWA 5GAGC 1PTOH 4ME3A 3K5MA 2YTXA 1B50A 4HIDA 2MWSB 4MN3A 3TP5A 4C1NK 4YT0B 4A20A 4EOYA 1A2UA 2MO0A 4G0NB 1YN3A 3Q8EA 4HSPA 1R4MI 2DBYA 2MW5A 4WJNA 2LXAA 4DUYL 1EIFA 4MTKA 4ALPA 5M5XH 2ACZB 1DD2A 1E90A 4DU9A 3NZUA 5K36H 3WAPA 5D14A 1EF5A 5G55A 1CI3M 1Q3LA 1YN5A 3AI5A 2R6GA 3Q3FA 4KDLB 3K6OA 1F2LA 4LF9L 5LLIA 4AQYQ 1YBYA 4AH6A 1I4GA 3J7AF 2LHDA 1Z9FA 2NTSA 4XWWA 3CP0A 1D1KA 2LHEA 2NS5A 2WXOA 5IGFA 2JYOA 4HIMA 3QX1A 1TU2B 4MEMA 2F3IA 3ECIA 1K83B 2QCPX 4QF4A 4FHJA 3NUCA 5DM63 2MBEA 3NS8A 1FO4A 1UF0A 3OJ4B 1I5FA 1WTVA 2BTEA 3T16A 4DNTB 2L11A 1XNRQ 1PYWD 3DVNU 1UELA 4K0KL 4IM3A 1GO3E 4LUZA 2M0XA 4P1BC 4IC7B 4TVAB 1VZ7A 2B76B 4IUQA 4HJAA 3M4OH 1MG8A 5JJLA 1AWDA 1HNWL 5COYA 3D3RA 3QOJA 3TN2A 2LGYA 1GHJA 2C9WB 1D8LA 2LGSA 2PE9A 1X3GA 4AIMA 5C3JB 1AN8A 5FO8B 1PH3A 2EYOA 2W55A 1JOKA 3Q8FA 1G51A 3BVGA 2MHJA 2Z4IA 5AZHA 1TKEA 3HOZB 1IW7C 4ZRZA 1YJ9A 4DDGD 1SNDA 4RKLA 1T5EA 5E6JA 2KMCA 2PZTA 5HGQA 4A3FB 3W1SC 3FDTA 2EZVA 2NBUA 1LT4D 4JI8L 4YWMA 4A3BH 3IAM1 3L17A 5IY0A 2LASA 1LT6D 2E2DC 2F0MA 1KQSA 3OMGA 4BBRB 4NAMA 1IGCA 4A3PA 1YJWA 1JB3A 2EXZA 4AQ7A 1UEAB 1K51A 3SFDB 3VTWA 5C0XI 5CHFA 5K5PA 2VQFQ 3NG0A 3F2DA 3Q8CA 4A55A 2IBIB 2INCC 2R7ZB 4YWLA 2LJIA 4UP7A 2ZM6L 3L9AX 1M90C 5M3FB 1VQHA 5JOBA 2WIIB 3TCAA 3BDCA 2NBFA 2O5JC 1DOLA 3B2GA 3PGZA 2B29A 4IPGA 4DV4L 4N9PA 2TSSA 1MSGA 4P74A 2K0PA 2K8CA 2N55A 4G3XB 4ZRKA 1JQ4A 5FJ8G 4A3FH 3U7DA 2EJFC 2A5UA 3ZNZB 5D3IB 2CU3A 2F3VA 2CFMA 5JHBA 1E7VA 1D1IA 1ZYRD 4DR3L 1F9JA 4DV0L 2M19A 3K5OA 1EZ6A 1VQOA 1E7ZA 4FXDA 4E3CA 2C9OA 4YY3Q 2MBBB 4HMJA 5HI1A 1MD2D 2CHZA 4BY1B 4II3B 3WAOA 5EDSA 3E9IA 4G7HC 5AZFA 4EZLA 2G3QB 2WAQE 1YJ1A 4GOCA 1WZ3A 2K25A 3AE9B 3NUHB 3KH0A 1ILPA 4MELA 5ELEA 4GLVB 3PIPA 4KV6A 1J19A 2I1JA 1OQRA 3ZIMA 4RHSA 4DR3Q 3TMPB 1P8LA 4CHTB 1IXRA 5C3EB 3BZKA 2FUG1 1Q90A 4K1RB 1RD9D 1STYA 4OL7A 3C19A 4IWOA 4LFBQ 3RLNA 4H44C 4TV3A 3FVQA 2JA7H 1PRTC 2F4IA 4GKJQ 4C56C 2N1WA 3AN1A 1HNXL 3LXFA 4HSVA 5C3WA 4ICUA 1ICFB 2L5TA 4ZYNA 1NBFC 2K9XA 4F7ZA 2Q2IA 3RZOH 1CQVA 1C4QA 4FNFA 1LV9A 3FEWX 4CGYB 4DR2Q 2KTRB 3JAMc 2Z59B 1BCPB 4EX5A 1R9TB 5ELBA 1NTGA 2AUJD 1K0RA 1X3PA 1LM8B 2HCCA 3D4DA 2Q8TA 1IBLQ 2I0QA 3K80C 3ER0A 3A54A 1R4NB 2LS01 1SE4A 4PZ6A 4FADA 4KSLC 2OJRA 3KLRA 5FR6A 5GROA 1JB7A 1FD7D 4H0LC 5TSSA 4EUTA 2PNHA 1WI5A 2BA0A 3OAWA 2O6VA 4J6HA 4BBRH 2DX5B 3VVWB 2HQEA 3ABVB 2WLBA 3BDLA 1OFFA 3PIP3 4DAMA 2Y5CA 3FKYA 4C4VB 2K5WA 4K2LA 3EBEA 5JVH3 5LL6S 3S1MB 1WOCA 4GSWA 4PK1A 2PEAA 1KAWA 4OONA 1O78A 1H4RA 2KFJA 2ZEQA 2A8VA 3N32A 4KKJA 1KLUD 2E76C 2L8JA 1IHZA 4K6LA 2EY1A 1B1ZA 4A3GB 4K2KA 3ICEA 1QZEA 2KXJA 5EE1A 4F88A 1ENCA 2ICEC 2NWGA 2X6GA 3D4WA 2MP2A 4JI3Q 1IL2A 2XGTA 2UYZB 3DHIC 1T0YA 2MFIA 1YX5B 3VR9B 1IL8A 2JY6A 3QO2A 1WSPA 1Z2MA 1KRSA 4KJNA 3HM6X 4IJLA 1W3SA 4A93H 3AE2B 3GV3A 3AE3B 3P4RB 3D6WA 2RSUA 1IYUA 2F0OA 1JQYD 2XSCA 5CV6A 2B63H 3GTLH 2BW2A 3HRDD 3GTOB 4B3TQ 4A3FG 3KYDD 2XNAC 4DAYB 3NBHB 2ASQA 1A6XA 1PA6A 3NTKA 3SHLA 3X23A 5ELCA 1WF9A 1ASYA 2BBCA 3N52A 3RZDB 3I63C 4CJ1B 1TIFA 2ZCBA 1D5XC 3P75A 2FUHB 4OIKA 2J53A 5E1FA 2M0AA 2RDBC 1QQRA 5BYSA 3E9HA 3RMHA 4CYEA 4C3JB 5C23A 3M63B 4NW2A 3N1YC 1EYDA 1DOYA 3PT2B 3NRZA 3ZJVA 2JRIB 2V0GA 4X65L 3L13A 4C7ZA 4RG1A 2KD0A 3KF8A 1SNQA 3DBLI 1G6JA 1BNZA 2B2UC 4LF8Q 3FHWA 3UE1A 1YN4A 3K9OB 3TP6A 4HJ7A 3VYUA 3OTOQ 1YNNC 1PDXA 2AYOB 4M8MA 3LNNA 2JWZA 4ZCKA 3P63A 3O13A 1PFMA 1PZJD 3GTGB 4MH0E 2I46A 2SNMA 4E71A 4A3EB 1NCVA 2BH2A 5C0XG 2C5LC 4REZA 5CHWA 2IJ0A 4MGZE 2K50A 3M4PA 3KF6B 4DV0Q 4BXXG 2H88B 4ANVA 2UUCL 4BKTA 4GLXA 2YV5A 1E22A 1RODA 1WGDA 3GS2A 1XD3B 1GUWA 4A3LH 2IDYA 1LABA 4WFN3 4DN4M 1TTNA 3RNCC 3AE6B 1TKWB 3VFKA 4BY1G 2B8GA 1B9MA 5C5LA 2CVRA 3LB8C 1NUCA 1TS5A 3EIVA 1P9DU 2YU9H 4QCLA 3S16H 2NVUI 2BQQA 4A3MH 1M94A 2IZVB 1WRIA 1F1HA 5IN7A 3L2PA 4BBSH 4DHJB 2ZM6Q 1IZ6A 2K1BA 3P4SB 5EKLA 3CD6A 3KFUA 1Y8PB 4LNIA 1YQ4B 1N33Q 2F0HA 1II3A 3DHGC 4NZLB 4WWNA 4A3GH 2L0CA 1UE5A 4Y7NH 2LY7A 4FN2A 2CQAA 2JA5B 4FJVB 1H8CA 1P7FA 3X3MA 4Z9CB 2BS4B 4TQ1A 5HGTA 4JI7Q 3KJPA 4P6VF 3A9JA 1CQFA 4AJYB 2R2OA 4DR5L 2V4DA 3EROA 3J81L 1L4DB 4TSSA 3ULJA 1S3SG 4UAIA 1A15A 1KDAA 1XMQQ 1HNXQ 1NYQA 2IO2B 3JW0X 3MHSD 4G50A 2VUMB 3OOCA 4LK1C 4J3OD 3QWZB 3H7SA 4E6IA 1N9WA 2TMPA 4IUMB 3AEFB 1C7YA 3ZNID 1V1PB 2V4IB 4GOPA 1WXQA 2YVCA 4PZ7A 3I9V1 3PLVA 4X64L 2OTJA 4PMWA 2E2JH 5ELDA 2XTIA 2VL6A 2RMMA 3Q14C 1PH4A 3HOVB 1HA6A 5EPLA 1T0QC 1Q81C 2O2VB 4FULA 4OVZA 3S1NH 3NE5B 3SEBA 4GDLB 1IBKL 1CFMA 3MJ5A 4AUQC 3J81j 1WJ6A 3GTMB 1I4QA 3PV1A 3TEZA 4TKOB 3NQTA 1JWAD 1HUMA 1PFDA 5C0XH 3A9KA 3V61A 4KZ0A 3C2PA 2V1CC 1MIUA 3V6CB 4KTAA 2JZZA 2JZ3B 2VQEL 2UUBL 4DR6L 1DZ1A 2K32A 5FLXc 3OSOA 4FF4A 3R7QA 4NB3A 3W5UB 2A19A 1C48A 1VQMA 4CDCC 1WGKA 4IKGA 4R3DA 4WQOB 2NPTB 2NZOA 3V62A 3OW2A 4LUVA 2LWPA 3CPFA 2ZJDA 1R4QB 1UEBA 4GNXB 2ZVOA 1N62A 3IHPC 2HJ1A 3EN2A 2F0JA 2WXKA 4EFOA 2NN6I 3H0GB 3UI2A 4AYBB 4W9IA 4A90A 4IFDI 1U0LA 3NTIA 2R93B 1ESFA 3M7NA 4A3MB 3AU5A 2MUYA 3DWMA 4BVUC 3E3XA 3H8HA 1CKNA 1HA5A 1SE8A 1EY5A 3I4MG 1K50A 2C7NB 4HROA 2VRRB 2RGFA 3DVGY 3EGRA 2R92B 1KLVA 2WDRB 3GTJH 3V60A 2R61A 4MTNA 3I3CA 2JQRB 1G291 2DY7A 4I6LB 3U50C 4HJ8A 2K6QA 1TKGA 4FF2A 2GBNA 2LEKA 1ACCA 2WDVB 2Y5BB 4MNOA 1C9OA 1YNND 1Q86C 3RUIB 1KAAA 3BK1A 2L0FA 1SSOA 4XGAB 1TKYA 5JJKA 3KF6A 4JI5Q 1PZKD 3MXPA 1S5BD 4JI2Q 4YCUA 3IAYA 3RCZA 1F2RI 2WP9B 5EKKA 2F0DA 3QG1A 1D2BA 2J52A 3DM1A 3BU2A 2Y0SG 4XX5A 3PV0A 1V81A 2FAZA 3ENEA 2BYTA 1F9SA 5D94A 2DENB 3KDFA 1GC7A 3CC2A 4JWUC 4C2MB 4N58A 4ZQ3A 1LYLA 4KKTA 2HDEA 4W9FA 5CHVC 4LUOA 2PIAA 2I38A 4NQKE 2EIFA 4PZ8A 3FKIH 1JR0D 1TXYA 2H1EA 5IT9L 3SR6A 3QIJA 2AQ2B 2EPBA 1QOBA 1Q10A 4K7WA 2INPE 4IM2A 4YCWA 2ONQA 4JC0A 5IO9A 2AUKA 2L1AA 1LLRD 4A93B 2L32A 4FBJB 1Y1VG 3T1HL 4M1UB 1KLGD 4KY6A 3AFPA 5I6WA 3S14H 1ENFA 1STNA 4DAPA 5M3FH 1OXUA 4FF1A 2O2VA 4DV5L 5IYBH 1W6JA 1S5FD 2PZUA 3M95A 2VY3A 1CKNB 1KFYB 4EKUA 4AS1A 1JJGA 4A3IG 2XRQD 3KVFB 3N1ZC 1E8ZA 1Y56A 2MP1A 1EQTA 1KDBA 4B3RQ 5LXIB 1EFWA 2IY0B 4EE2A 4DR5Q 1GUTA 4DFAA 3IKJA 1WTHA 2R93H 3ZO5B 3OIPA 2KDMA 3AEBB 1SXTA 4HCEA 3VYSA 3SFEB 1AARA 4HPLB 2L4NA 2WB1G 4EQ5A 2IL8A 2BYFA 2W3SA 3RZDH 5BMIA 3ZTCA 3HGBA 4RFBA 4G7ZC 4YHHL 2ZJQA 1EIHA 1A5RA 3NJTA 2I5HA 2WAQG 2LJ5A 4WORA 3J81E 1MFWA 2DLBA 1JOOA 2V4LA 3QARA 1QOHA 2C7HA 2GOWA 4A3EH 3AV8A 4ZAIA 2E2IB 2EXDA 3TSSA 2DGYA 4KKSA 4TRDA 4ZYSA 5C6AA 3EFUA 1NVID 1Y1VB 1E8WA 5E3FA 1K0SA 1GXDC 1XMQL 3K5LA 3URYA 1PH5A 2SAKA 2V3PA 3MHZA 3S16B 5EE0A 4G4KA 5M5YB 3Q3MC 3HKZE 2HD3A 2E74C 3M4QA 4IJHA 2DZKA 1KH0A 2N1VA 2BB5A 2UUBQ 4DR6Q 2VW9A 4OIJA 2WQYB 2OEOA 5KEEA 5DAUA 2L7RA 3X0WA 4O0AA 4LK0M 4GNXC 1CZWA 4X66Q 3A8IE 3UQAA 2WV6D 4K5VA 4EQPA 5M3MB 5LMUL 4LF5L 3C1FA 2HCIA 1CKOA 4HXDA 5LMNL 1K28A 4DV2Q 4FF3A 2KECA 3A55A 4DV3Q 2IGDA 5L83A 3TJPA 4RGTA 5C0XJ 1SYCA 2CS4A 2LZ6A 1A2TA 2K5VA 5C3XA 2RHQB 4J6IA 3PPAA 2PMVA 4ZHOA 1TWHB 2INDC 4O42A 1YQBA 2ZJPA 1YHBA 3P1MA 1UH6A 4A6QA 2ZVNA 1M4VA 1C4AA 1O80A 4M8AA 5I4DA 1X3FA 4HCPB 1IYJB 1GD7A 4K6DA 1AE3A 2N3SA 2N7DA 3PZ8A 4CDEC 2RVLA 3PRZA 4PYUA 2BE5C 3B6YA 2X6LA 2ZXPA 2UUCQ 1MBYA 3AE4B 4N9F4 4YTNB 3EFCA 3RR5A 1QNUA 2IX3A 4IFDJ 3H94A 4WJWA 1X9NA 3CCEA 1C78A 2R2QA 3VUWA 1UWMA 2SNSA 3I2ZA 4L5TA 3K58A 3GTKH 1QVFA 1EOTA 2WXJA 3OTOL 4LF4Q 3S1NB 3NPPA 3PCOB 3NVYA 3RZFA 4ACFA 4A3DH 2KN4A 1NI3A 2FCSA 4WAFA 1LTAD 2PI2E 1ZGUB 1ZPSA 1PLFA 5T1GA 3ULPA 4HEA1 1IKLA 4DAYA 4HJKA 3VA7A 3ULLA 1HZBA 4S3SA 2KDEB 5IYBG 1SRUA 5FR3A 1H9RA 5C44B 1EO6A 2DJFC 1XMOL 3AB5A 4AJWA 2RQXA 4A3IH 2ZNVC 4NPNA 5KIXA 3RZWC 2BH8A 2X69A 3OYYA 4JI2L 4II2B 4USAA 2LSSA 1NI2A 2PMZE 2OHFA 2SOBA 3KLSX 5CYUA 3S2DB 4UP9A 3RNBC 4L2YA 3DLLA 5M5XB 1Y8RC 4E74A 4HLEA 3VR5A 4O1NA 2BWES 1VQKA 2B2YC 3RULA 5LMNW 1EM7A 1Q1BA 3ZRCA 1MI2A 3HKSA 3MA2B 1XO3A 4OXPA 2A73B 5KNCA 1WMHB 4XWTA 4JQWC 3E0EA 1B7YB 1WGGA 3K5NA 3LJ3A 2HTME 2FJ2A 4DWFA 4CKCA 5EJWA 3U4VA 2CKZB 1K83H 1VDZA 3S1QB 2WDQB 3L3OC 1G91A 1EY7A 1F2ZA 4A8XC 3A9KB 1SF0A 2UXCL 3F2UA 1R7SA 2K14A 1X6OA 3S1RH 3L0OA 4DR2L 5DCNA 3QR8A 4JE3B 2KQ3A 5E6NA 2NN6G 1ET6A 3CMEA 2JUOA 4H02A 4DV7L 4DNIA 2JA7B 1YNJC 4IG7B 1SNCA 4PV1C 1PUTA 3N3KB 4P71A 1VQ5A 4PNYA 4M01A 4P75A 1VF7A 2B2WC 2Y0SE 4HEDA 3SK4A 1WJNA 4DDID 1HHVA 3SE0A 2E2HH 3TP7A 2AL6A 3CQZB 2CJOA 3KWLA 3J7A5 3C8YA 1YJJA 1WGRA 1ZYRC 2AHOB 3VR3A 5EE3A 1EFID 5IYDH 3UDFA 4DHZE 1TJEA 3N9YC 4LNFA 4R4IA 2D2QA 3DM3A 3WOFA 4YWKA 4R1JA 5FO9B 3HEJA 1P1AA 1X56A 4MM3A 4G11A 4XQQA 2WB1E 4RKBA 4JK1C 3CCUA 3CSTA 5KHOA 4WJOA 4QL5A 2QCZA 1NJIC 1ILQA 1Q12A 4C3IG 4W9KA 2IWHA 3DEOA 5C4XB 1WYWB 1WYGA 2F1MA 2JA6B 2EY2A 1EEID 3T8MA 5CC4A 5LHY1 3S1MH 4US8A 5IODA 1M1KC 2QDLA 2JA7G 2CW0D 4TQUS 3AE7B 1Z7TA 4HWIB 1NAPA 4N9TA 4NAWB 2ZXOA 4KVGB 4APVA 3P1HA 4DV6Q 4DR1L 1VQ9A 1N6ZA 2BE5D 3SR1A 3ZNGC 1EWIA 1I4HA 2KX3A 3L4PA 3UIPB 2K5NA 4HIKA 2Z6KA 4JG2A 4YY3L 3NOBA 1LTBD 1TZ1A 3PQIA 1HXYD 3AE5B 2KWUB 3P2BA 2WWZA 1EQRA 4LNKA 4M8NA 1E0ZA 3DEPA 3WWVA 2LUEA 2RCFA 2KC2A 3S2AA 4BZAA 2K4KA 1N33L 4PYZA 4MZ9A 4H7BA 2EYFA 2JVCA 1ML0D 2JEBI 4JI8Q 4DK6C 3R7RA 3H3VH 1HH2P 5BMHA 1XX8A 1UWXA 1JWBD 1Y1WB 1T3QA 5KRUA 4MSMB 4NQLB 3SHQA 4CO7A 4POGA 2I2YA 3DQVA 1CMXB 1V5OA 4GKJL 1LTGD 1EL0A 1PTOC 5G5HA 4NJ7A 2X38A 4XZ4A 2FNJB 1YD8U 4CBVA 1E24A 4ZDVA 4ZLTF 3CHBD 4W9CA 4DR7L 2HTHA 4NJ6A 3EJIA 2KYWA 2VH1A 1CA5A 4YHHQ 4HMIA 1NE3A 1H9SB 2DZIA 3I7FA 1FJGL 5KGUA 1E9MA 4NAWA 4KZCA 1Q8IA 3RD2A 2IGHA 2PO4A 5IYCH 2UXBQ 2XEWA 2ZPYA 2DNCA 3L10B 1R9TH 2MLBA 1F2MA 1DOKA 1PGXA 1UGMA 2MRPA 1XNRL 3MEFA 3HOXG 4DV6L 4DR1Q 4A3JB 2OEDA 4WAAA 1VZ8A 4GS3A 1VMPA 2CWPA 2BT6A 1IW7D 4LF8L 1EOVA 1UAPA 1QVGA 2FCQA 2J0MA 2M4NA 1SE3A 1ZP0B 1QOFA 2F0KA 3E6ZX 3S17B 4X3UA 3T13A 3GTJB 1D6EC 2IX0A 4WWOA 1D7QA 4DV4Q 4AQYL 3VR8B 2WB1B 4XYCA 3SK5A 2DWQA 5D65A 2OXPA 3R3OA 3ZTDA 3W9CB 3K7AH 3X3NA 1V6EA 1V80A 2AX5A 2DYBA 2A68C 2UXDL 2Z0EB 3CPWA 4HKZE 1J8IA 5GAEC 4BBNF 2HJ8A 3Q2AC 1AEXA 4DUYQ 1X54A 2EJMA 4F7XA 1ZDVA 5EE9A 2VQFL 1XYIA 1BDOA 5G2NA 2B2WA 4K3CA 3BK2A 2JRHA 4A3BB 1QF6A 1Q46A 1GOZA 4GN3B 1TYGB 2B2TC 3R2IA 1JRUA 2J0JA 3GTPH 1B3QA 4GMVA 2Y3AA 4C3JH 2B63G 2J4XA 4NXML 3H3VC 1SYBA 5M5WH 3HOXH 1TY0A 1MHWC 4ABNA 1ZKOA 1K73C 3CCVA 1UD7A 2KWCA 2A68D 3UGBB 1V9JA 3PRPB 4ZKCB 2OQKA 2HQLA 4LW1A 2HD5B 2OWOA 1GJZA 2QJLA 3C1EA 3HVZA 2H5XA 5FOBB 1ZXIA 1D5ZC 5IP7G 3L08A 1SNOA 5JXVA 1K8OA 4I6NB 1HE8A 3FKIG 4A3CH 4K7UA 2IX1A 2MSED 4BBSB 1YIWA 5KYLA 2BYEA 2L83A 3EC8A 4K3BA 2NTTA 3PIOA 1HR0W 3PUVA 1W2BA 4FXKC 2ZCCA 4HK2A 3PZDA 1WZ0A 2IW3A 4A3KH 3OLMD 1PRTF 2NR2A 4IZ8A 4ZKBB 3AMUA 4GN4B 1VQFA 2FE8A 4MGKE 2KENA 3HOVH 1L7YA 1IYFA 1WJJA 2EOTA 2MGSA 2WXFA 4IM0A 3MXNB 3QC8B 4LNOA 3STBC 1SNMA 1EY8A 4AYBE 1A3VA 1O7IA 2F4VL 3B9JA 3N6RA 3GB1A 1VQJA 1HTOA 2KLCA 4U68A 1YQ3B 3H3VI 2PMZB 2PLPA 1R4PB 2VUMH 2N0SB 4OELB 3I56A 2VZAA 4KV2A 2EYHA 3W5OA 4ZRPA 2F0QA 2KJ6A 4XT1B 1EWYC 1HZ5A 2M56B 1JC7A 4ZHPA 1JT8A 3AULA 3DBRB 4GOPC 3KBGA 1Q1OA 2PJHA 5DLQE 2KX0A 4OO1I 4HJGE 2IT1A 4BKSA 4WWMA 1EUJA 1CJEA 1A70A 1VQ4A 1EZ8A 1C8CA 2UU9Q 1NENB 1UZXB 1SJHD 5KNBA 3T53B 2K6AA 3OPOA 4FP5D 4OWTB 3G6EA 4K81A 2KEEA 1EYAA 1S5ED 2EJGC 1LACA 2ZXRA 1N8RC 2LGXA 5DPTA 2B2UA 3S2HH 4X62L 5I2XA 3H1UA 1VMCA 5AJ3L 2R92G 5LL6X 1Y69U 3B08A 2D5DA 2PPBC 3E0JA 1SMXA 4JI0Q 2KK8A 3PLUA 2J7ZA 3AB9A 1RM6C 4JX1C 4QUFA 1E7UA 3W1YA 2EVBA 2DNFA 1VQ7A 1V43A 4OZCA 3IRBA 3HZXA 3WANA 1I4XA 4HPMB 3DHQA 4HN7A 2PI2A 1FNUA 2MO1A 3ETRA 1O7LA 4QIWE 4QGUA 2D3GA 1WRDB 4H2AA 1I50H 4N8FA 3CCMA 4JIOU 4CJ2C 1B9NA 1RRBA 2XK5B 4TQ0A 4JOIC 4CKEA 4WWPA 3JYUA 4LF7L 1TY2A 1C0AA 4B9WA 1C4PA 4X6AH 1YOVB 2K5PA 1VZ6A 1RFAA 1N36Q 1TS3A 3Q3JA 1VQBA 3MFYA 5FK9C 2B3GA 4PG3A 3NENA 2DUDA 3RLFA 2KTRA 3G7LA 4GKKL 1SAPA 3Q6BA 4JWSC 1JALA 2NYZD 4FVMA 3ZLZA 4PMBA 1N36L 3W1GA 3KUPA 3QOLA 4KGRA 2LVPA 3Q8DA 4A3DB 4IPHA 5FJ8H 3CCRA 4GDKB 1Z47A 1GB1A 3VTUA 1QG7A 4LJOB 5JJZA 1PYSB 1T6BX 2KZRA 2KLGA 1H9MA 1I6HB 3AE8B 3QIAA 4KD3A 3HS0C 3MC9A 2KCNA 3BIID 4JL9A 3KLSA 2RHSB 3AEDB 5ISRA 1A3TA 1RLFA 1GPXA 4IOIE 2N78A 2AKWB 4IN3A 1XCQL 1R4MB 2PVGC 1XLQA 1QUQB 2FCMA 2KACA 2JA8B 4IALA 4NDXA 4OWWB 5JJIA 2PCFB 5C2TB 1E3PA 3RUZA 2MBHA 1KNEA 5GADC 3TDQA 1FNWA 1OXXK 2NVYB 1FPYA 4L5RC 2YEPF 5AJ3Q 3IT6B 3AYHB 1SYDA 4JOIA 3S2HB 1STHA 3I4LA 4KIKB 2BVCA 2GBMA 1RL2A 1BF4A 1DOMA 1KNAA 3RFZB 4XQNA 4IUNA 2UU9L 4KHPL 2F0LA 2G1EA 1BXTA 1XPUA 1DXMA 5ELNA 4KSKC 4RNAA 1BCPF 2F0TA 3G71A 3J80L 2KAJA 2BWFA 3DDCB 1TWAH 3H9DA 3WCQA 1NEKB 2KA7A 2C5CA 2OTLA 1FGBD 5HY6A 1I50B 1BBUA 1J7AA 2KQ7A 2G45B 3GTQB 3ZKJC 3I4OA 2B2VA 5CV8A 1HZCA 2CCZA 2BCOA 2EY6A 1CUKA 2WXIA 1JWMD 3M7GA 4KN4C 3RT3B 3U8ZA 3SGIA 1I94Q 2NN6H 3NZSA 4R4OA 1J9OA 4LNQA 2PTLA 4P7IA 3TS0A 3UF8A 2ICIA 4DF7A 1VQ6A 4BA2I 2XK5A 4JI6L 1VLBA 1PH6A 2D2CC 5HHDG 3S15B 4WIPA 1PH7A 5DEHA 1OO9B 1SJED 3T1YQ 3MWYW 2CHWA 2KCMA 4KHVA 1GUGA 1P7EA 3TBIB 3DVNV 2KMMA 2YEPB 2ZZPB 4JPSA 3WALA 4JI4L 4LLGM 1LO5D 1TWHH 3PIO3 3QK0A 2D9UA 2VS1A 5M5WB 3HOXB 4IOAA 2LGDA 4DR7Q 3PZ7A 5EQ0A 4XC2A 2L3ZA 2L00B 5KNDA 3A9JB 1CA6A 3MP9A 5CV9A 2PZWA 4ILWA 1S40A 4XIGS 3PS6A 2KBNA 3M3YB 3P4QB 2NVXB 3MEHA 4IDIA 2JP1A 3LX0A 5A2QE 1MJEA 1WYDA 2KDFB 2E2JB 5G3LF 4JBMA 1IBMQ 4W9GA 4WURA 4K8JA 5FLXE 1WX8A 2N9PC 3OG5A 4FLHA 1JJ2A 1TIID 2CWAA 2ZTCA 4DK0A 3ALBA 3GDEA 4ID6A 1WIAA 3ZJUA 3J80E 3EFXD 2QC8A 2DJGC 3PSIA 1TWGH 3UDXA 1FGUA 4EQOA 5BYRA 2JT4B 2NUCA 3F1ZA 4O2DA 2BDNA 1HZ9A 1L0WA 4L63B 2LD9A 1TGZB 2D5GA 1D4BA 4DNRB 3AU7A 1OTRB 4XT3B 3L0WB 1GJXA 1PHJA 1PXUA 2PQAA 4OWXB 1SYGA 2IGGA 3KW5B 4DK1A 4DHJD 1BKBA 2AL3A 3DMUA 1KL9A 2NZHA 2OF1A 1E6EB 1E2ZA 3PO2H 4XQJA 2GRIA 1PZID 4ULLA 3IAS1 3ZRFA 1NMGA 2E5LQ 4HTHA 1VRAB 4UHVA 1WR6E 3S24A 3H0GH 3AU4A 3LDZE 4ZRIA 1XNQQ 3N20C 4DUZQ 3G4SA 1S1QB 5DM73 2EY5A 1HFNA 3RNFC 1BUIC 4X3KA 4GOPB 3AE1B 1MI0A 1S5CD 2GBJA 3NTHA 1L1OB 1QT9A 5C4JH 4W9HA 4HKQA 1K52A 2M1MA 3VH4B 3CF6E 2L12A 4QQBX 3KYCD 1ESRA 1KM7A 3NEMA 1HZ6A 4RGMA 3EVQA 2A6ED 2JA8G 4C1NI 3JAML 1K8MA 1BVSA 4YTPB 2DNEA 2KTFA 2ATWA 4HDQA 3ZQ4A 1F52A 1QILA 2F0IA 1KIXA 4JI0L 4JPBW 2WDTB 3D8GA 5BN5A 1WGYA 1SGHA 1G2SA 1D5MC 1PH8A 1WTXA 4YCVA 4DV7Q 4KJOA 3ZYYX 3J7YW 3I4MH 4J15A 1HCZA 4ZOHC 3AEVA 3ONSA 3DPDA 1VCIA 4B3TL 2MP2B 2KHIA 3H0GG 4NP5A 1EQQA 2A69C 4WJQA 4OVVA 5IKCM 4QAYA 2D3CA 1L0VB 1S3OA 4Y7NB 2KVRA 3NHHA 2WXNA 3QAQA 5J18A 2F4VQ 3VYRA 2M00A 1LFDA 2D3AA 4PS3A 3K8AA 1WX9A 3CRKC 2KHWB 4JYAQ 4A76A 4LF6L 2ZTEA 1YITA 4D2KA 1RF2D 1EEFD 3G48A 3NZ3A 3RLOA 3RNEC 3E9SA 2CHBD 2D07B 1KTKA 4RM8A 3WDNA 3ZUNA 1JRPA 3D0FA 2IO0B 1CZGA 1MJDA 1QNKA 2IY5B 4IQZA 1EIYB 1IBXA 3ND8A 3VDYA 4BBRG 2Q8RE 3TQYA 1WX7A 3NVWA 2IPKD 3APCA 5A2QL 1V1OA 3TZDA 5JPNC 2CU1A 2KOLA 2AEHA 5IIFA 5AFWA 3FC4A 4ANWA 2R7ZG 1IGDA 4X3TA 3UDIA 1VCBA 5E6OA 1L0YB 5CR3A 1FM0D 1EIGA 4M0WB 4LFCQ 1E1TA 1FR3A 4GN1A 1CHPD 4I7ZC 4V0BA 4HJ9A 1SLJA 2Z1CA 3TEHB 3RN5A 2JWUA 4GU2A 1AP0A 3T51B 1LTID 3BZCA 1RIPA 1MSHA 1XWEA 3NQIA 1NYRA 4M02A 5KYIA 2KQSA 1I6HH 2FMCA 3BG3A 2ZW0A 1LT3D 1U4PA 2YTYA 1WM3A 4DKAC 4DR4L 2Z4HA 5H92C 2UXDQ 1T0RC 4KI0A 1N32Q 1H95A 3HHMA 1UBIA 1CZPA 3VRAB 4EEWA 2A74C 2NMQA 1EU4A 1U4AA 2BS2B 2UXCQ 1HPCA 3EUB2 5D2MB 1E5WA 2MJEA 2GA4B 2WHIA 4XE0A 3U4EG 2MJDA 5BN4A 2EKIA 2KMAA 3ZXRA 1VQ8A 2JA6H 2W82A 3RNAC 2A6HC 4WJ4A 2A6HD 1VQLA 2O2LD 4B3SL 1PTOD 4IPCA 4JI3L 3CW2C 2EKEC 4WQMA 1UUPA 1SROA 3KWVA 1STAA 1PFSA 4LF5Q 2L9HA 2N9LA 3APFA 3ZGZA 4A3MG 1WXAA 3AEAB 1VD2A 1XLNA 5FLMH 3W1SA 2L1BA 4LF6Q 4DXFA 4G7OC 3CF5A 3A5ZB 4BKSD 3VUXA 3DOWA 2JU6X 3HOZG 1B4OA 1TWCH 2DY8A 4R9WA 2ZPNA 1B9RA 3TMEA 4MHEA 3F8TA 4C80A 3M3YH 2MBOA 1LTRD 3E5SA 2WXRA 2F0GA 5EGTA 1J0GA 2R7ZH 2ID0A 1YJIA 3DBHI 3RMKC 3VTVA 1JJCB 1LUZA 3U4ZA 4A3BG 4DK5A 5KHQA 1YZ6A 1PFNA 4AP4C 2KDIA 3GZNI 1JMCA 3U30A 3BJUA 3MJWA 1SYFA 2M9VA 1VQGA 4W9JA 1GUSA 2B2TA 4K7SA 5GAHC 5HKHA 4YWGG 1EY6A 1ZXHA 4WRDA 3HOYB 2CH4W 2XIWA 4YTMB 1SE9A 3R66C 3GD7A 4C7YA 2Z9HA 5M3FG 1PH9A 3HG9A 3NP8A 2D62A 2ZT9C 3A74A 2RSNA 3CCQA 1V86A 1PRTD 5C44H 1GAQB 3OJ3A 3FKIB 2ZJRA 5IP9H 2NVXH 2MEKA 1ISNA 1S5DD 4BWGB 4N6EB 4DV5Q 1P3QU 2K1FA 2KDBA 1GUNA 3FILA 3IXSA 5DPRA 3GTGH 4RAUC 2WACA 1VF5C 1ZUD2 2K3UA 2KC1A 2N88A 2JSOA 1RFKA 2XRSD 3W3AA 2WYQA 1AW7A 1RKNA 4DUZL 1E7PB 2A6EC 3HVDA 3ML8A 2BOSA 2PE6B 5D6JB 5IYCG 3KLWA 4JI1Q 1EU3A 3GTPB 2G4DB 3J7AV 2NPTA 1YNJD 3U9OA 5IGCA 1Q7YC 1AH9A 2CKHB 3H09A 2GVAA 1C76A 1WTRA 1F2RC 3AEEB 2KANA 2BF8B 4LTUA 1GG3A 2KOXA 3PO3H 3C3LA 3ONAB 1RAXA 1XPOA 2I5LX 1SFOB 4NKLA 1BT0A 2HT1A 5CORA 3PO2B 1WXSA 3Q8BA 3GTOH 4B0MA 4IWPA 2IY1B 2JA5H 5C44G 4QIWB 1CSPA 3NVVA 3PO0A 4FYDA 3S17H 5D3DA 1MGSA 2CW0C 3KYHC 3BY4B 4F8MA 3R93A 4IUTA 3I4MB 4LFCL 3CXCA 3PMFA 3HKZG 2K8BA 1N61A 4AOFA 2QDBA 3I5JC 1E1OA 3G6JB 1QOAA 4BOSC 5MPOA 2WAQB 2C35B 1A62A 1BBXC 4BY7G 2FIDA 2EMSA 3FAHA 2D10A 2OQ0A 1NR2A 1KC8C 2QF7A 1OQQA 4MJSA 3NWTA 1YHQA 3RN2A 4DHZB 4DXAB 4LWCA 2J0KA 2EYPA 2K75A 1TT5B 2L52A 1ET9A 3B2FA 1B2TA 4R4CA 1R4NI 1QVCA 2ALYB 4GNXA 3IFDA 1HQMC 5DPSA 3VUYA 3IFWB 3CU7A 4QMGA 2LXCA 1V97A 2AQ1B 3D4RA 2CR5A 3B0AA 5H1SE 1N63A 1FL0A 1EQVA 1F9PA 5G3LD 1WXVA 1TT2A 2MHVA 5JAVA 3KF8B 3DXJC 3F2BA 2RCNA 2VUMG 2H4OA 3Q3OC 1A8VA 1U9RA 3F2CA 4YSYB 2Z8LA 1TVXA 2JA5G 2QHOA 3HOUG 4S17A 4JI6Q 2LMCA 4WH4A 4XDDA 4FXGC 2SEBD 3QWNA 2KT7A 4CHKA 3I57A 1PRTB 4RA8A 5C1ZA 1WR1A 4QB4A 4K0KQ 1VS0A 3SDZA 3HOVG 2VXWA 2VQEQ 3KQ4A 1RHPA 3A4RA 5CTRC 4NXNQ 5FKAC 2A5HA 3FP9A 2AMCB 1V9PA 2KWVB 1HFGA 3Q8AA 4IFDH 4X3SA 2D3BA 3ZDTA 3H7PB 1HRJA 4FHKA 3PO3G 1XMOQ 1CK1A 3K0YA 5BMGA 3I8ZA 3BVMA 2QSDA 3CIRB 2Z0DB 2B2YA 2K22A 4BAXA 2KUMA 4CDFC 1JOQA 1LXDA 4HDOA 4ITKA 4LJPB 4HIOA 1SR3A 1MVKA 1KD1C 2BPSA 4OZAA 1SIJA 3ZJYC 3V96A 5G5GA 2E8GA 2WGSA 4F8CB 1VQDA 3S2DH 4TUUA 4YIJA 1H9SA 3UINB 5FO7B 1WTPA 2K04A 1T0SC 3PSEB 2CQOA 2GLSA 4HJ5A 4AYBG 2KEDA 2HIXA 3BYYB 1WTWA 1K8GA 1NMFA 2C7MB 3GZNB 1OXTA 4F87A 1OXVA 3AH7A 3MXUA 3KUCB 2FHTA 4NMZA 3MHBA 4BBNC 4ANXA 4XYOA 3SVMA 4R4TA 1V1QA 1U4RA 4XYQA 3ZXVA 1TR5A 1FCLA 4KGSA 2VB2X 2PPHA 1WGHA 5K36G 3HK0A 2PNRC 3A4SC 2GMIC 1XT9B 4DV1Q 2EDGA 2WP8J 2UUAL 1HTPA 3JVZX 2WS3B 4KLKA 2DAFA 5I6YA 1HTQA 3OMCA 2HHHL 2R7DA 1L6VA 2LI5A 3TBLD 4MJSB 1J7BA 4HVBA 4DV3L 3JAME 3S1RB 4Q0FA 3OW7A 4W9DA 1FIQA 4OO1G 1QCBD 5LNK1 4LF7Q 1Y8OB 4GKKQ 3OHXC 5IWAL 3D32A 4RF1A 2ASBA 1X1MA 2YYZA 1Y1VH 1MHXA 4X66L 1AYFA 2JA8H 2KJXA 2WXGA 1TS2A 2F03A 1DCZA 3Q69A 1UBQA 2BDOA 3K81C 3ZNHB 2F0PA 4A3GG 4KN7C 3STBD 3A1QB 2WX1A 2N9EB 3ML9A 3A5UA 3HFZB 5J17A 5GMVA 2IHFA 5CV4A 3WAMA 4TMAB 1D3ZA 2MX2A 1G8ZD 4L1BA 1LT5D 3S14B 5CX3A 1SDFA 5DPWA 1T5XD 5I2YA 5F2DA 1IBKQ 3T3NA 4RHRA 3Q3NC 2XWBB 3OWFA 3C0RB 4BY7B 4DV1L 1DONA 1EY0A 3I90A 3TRZA 4JBKA 3EA6A 3MTNB 4I6PA 4HR7B 4P72A 3VR4A 3Q24A 1DGSA 3WIMA 1VR9A 2N8NA 2K5DA 4XXEA 2XVSA 3BZDB 5JPMC 2ON8A 4K14A 3UE0A 1Q0WB 3FPPA 2N9XA 1FMAD 3ND9A 4C3JG 5IOIA 4DXGA 2LFIA 3W1BA 1FXTB 4C3IB 2E3TA 2F0EA 2QDFA 2RA4A 1L2FA 2ENBA 4K8IA 3HOWB 2OCEA 2ES2A 2Q8IB 1WD1A 2KWDA 2NCNA 2QMTA 4YSXB 4RH6A 3E56A 3GTKB 1WCMH 2JQOA 1PFBA 2W54A 3U7ZA 4YXDB 4V190 1TWAB 4KKIA 1JMLA 2JN4A 3GE8C 4J1MA 1K8RB 4RF0A 4ZUJA 1DYQA 4KY7A 4PQXA 3TEXA 1K3RA 2O4XA 3T4AC 2VB3X 2LVQA 1SN8A 4IOCA 1IKMA 1I4PA 2WFWA 2M17A 4K5XA 4KX6B 2EYJA 1GUOA 1YNXA 4OO1H 2A1AA 1X55A 3MZ5A 3MVVA 2RR9A 4C3HG 4GLSC 5EAYA 2F0NA 1U4MA 5CBAE 2GI9A 2EYLA 3HOYG 1QLBB 2O6VB 2NB0A 3MAQA 2SDFA 4G57A 4POFA 3MFGA 1VQCA 4JI5L 5J3BA 1PTOF 2UWQA 1IBML 5I9PA 2WXPA 3A56A 3ITPA 3SDLC 2WKCA 1FRRA 1J7CA 1IBXB 3DBHB 1B44D 2VZKD 4EZKA 3W2DA 3A7LA 2DHZA 3CRLC 2WKDA 3CCLA 4HPPA 1ONLA 3CMMB 1TS4A 2K52A 5T8IA 3MC0B 4GXBA 4L8JA 1AFPA 3RYTA 1C9FA 5C4HA 3GE3C 3CMAA 1UE1A 3I4NG 1KRTA 5CV5A 2L76A 4MDKE 4OX9Q 3DWQA 3GQBA 1WM2A 4A3LG 5CBEE 4UP8A 1QWYA 5JVG3 1E0BA 3TEYA 4R4QA 3M62B 5BR8L 2GBKA 3AXCA 1EY9A 1ZOYB 3NS1A 4DGZA 4PS8A 1B3AA 3SXHA 3DWAA 4IUPA 4BY7H 1SEBD 2WXMA 3TL5A 2LVOA 1YI2A 1L4ZB 2QILA 4P2CB 1C79A 1SIFA 4HCSA 1RTOA 4C3HH 1JW9D 4A3JG 3DCGA 2PW7A 4CJ0B 1TWFH 1WJ4A 3BDOA 3PO2G 3VR2A 3M9BA 1X32A 4TKNA 1IUEA 5FLMG 5JHAA 1HTLD 1FRDA 2L55A 1VQIA 4EZJA 4K5WA 1TWCB 3CC7A 2KJRA 3K7AB 1PTOB 4ODGA 2NVTB 4JW0A 2E2HB 1CKMA 4MM3B 4Y52H 1N60A 3TEWA 3HKZB 1SMYC 4M00A 5C4XG 3MXNA 4KHPQ 2OJWA 3A1QA 1SBBB 3I73A 4HCNB 2PW9A 4B9KA 4RCOA 2RD0A 3QQ8B 4PS7A 4C00A 1ZKHA 5EBDA 1K53A 3PF4A 1FJGQ 3A7AB 4JGHB 3KBXA 5BO4B 1PYBA 4L6TB 2IHEA 4LDTB 1LTTD 2X8XX 3TUOA 3I72A 3VH3B 2WXHA 4KMUC 2DYMA 1UNSA 2B8FA 5IP4D 1VQEA 1V8CA 1HNZQ 4A3EG 3Q0AA 2UXBL 1STEA 2KCTA 1OTCA 3GOEA 3V05A 3PUZA 4X64Q 4MSQB 1J5EQ 3V3XA 4IWQA 2W9NA 2JX5A 4Q5VA 1WFYA 5AUKA 3APDA 2BYVE 2REXA 3HOUB 2E2IH 4X57B 2R93G 3P20A 1E8YA 3PF5A 4IPDA 2PQAB 4JVZA 4MH8A 1EWCA 1V8QA 2NVYH 3L54A 1QE6A 3KK7A 1X65A 4B6WA 5IGEA 3CKIB 3QA8A 1IBLL 4ZRJA 3IL8A 3EECA 5EPJA 2D11A 1I6VC 2J0TD 4QJFA 1XF5L 2VZKB 2W3RA 3PUWA 1UWVA 5EKIA 4DAVA 3PHWB 2KNBA 5IT9c 2FFKB 3TS2A 4R8IA 1WJUA 4BY1H 5M3MH 2UUAQ 5IE8A 2G5DA 1E2WA 3PO3B 5E4XA 4Q2JA 2QEXA 1W6KA 2JYTA 1FCCC 2KJHB 1O7ZA 3Q6SA 1KDCA 2WINB 3BWUD 4LFBL 3DBSA 4IUUA 4GDKA 4L5QA 2QW7A 2R92H 1YMHE 3PTFC 3OWEB 4B3SQ 4UY8C 3CSFA 3PREA 5DNFA 1VQNA 1L2NA 1Q1EA 2B3AA 1HEZE 3PUXA 3GTQH 1ZW7A 2EYMA 1HR0Q 3NK9A 3HP3A 2LRUA 1QKZA 2Y0SB 1G2TA 4BXXH 2JE6I 3QCAA 2V1YA 4AWJA 2KFKA 3RN9C 5JZEB 5HG2A 5GXGB 2R7FA 3KUZA 1EY4A 3Q22A 2F52A 2OOBB 2KHSA 2EMTA 2H89B 4ARCA 3S15H 3B1LX 4RWSC 3U9SA 1XEEA 2INNE 5CGKA 1XTDA 1SSNA 4A3JH 3SK6A 3RNUA 4DBGA 4N8X1 4C2MH 1L1OC 1B53A 2G9HD 1OEYA 1OQYA 4KKUA 3SK8A 4LMQD 3NSWA 1F0ZA 2WXLA 3J81i 2KN5A 2MBQA 4BA1I 1FYCA 1BBWA 3A8KE 2N4FA 3CWIA 1KJTA 1QZHA 2DN8A 1STBA 5AZGA 4A3OA 1F2YA 2ZTDA 4NXNL 3I55A 1GC6A 1RTNA 4CQNA 1ZXTA 3UI3A 1PGBA 2FBWB 1HZAA 4A3IB 3N30A 4OW0A 1TZOA 4RMAA 3PUYA 4PMCA 3TREA 3CQZH 3VQIA 4CDDC 4FXCA 4KK7A 5C3EH 5AEKB 1ZDXA 1L1OA 4QY7A 4A3CG 1GM5A 4I7AA 4MIUA 3HOWH 2K6DB 2L0TA 2MNAA 4DPGA 5FLXL 2K5QA 3D6CA 2KFKB 1T9HA 4RGNA 1VQPA 1DGJA 4KDIC 4GIVA 4R8NA 1MG4A 3CAMA 3RD4A 1NBWA 1PH1A 2WU2B 1I3QH 1LTSD 4I65A 2E6XA 2EE1A 5J1ZA 4WJ3M 1QUQA 5EBCA 3S9WA 4BOZB 3JSVB 4L5SA 1YVCA 2DAJA 3NHEB 2MJ8A 3CCSA 1SYEA 3I70A 4ZK9B 2LGIA 4P1CC 3DWPA 1IYVA 3PGEA 1P98A 3Q23A 4A3KB 1TBEA 3IVFA 1FVIA 3I3TB 1HR0L 3VA5A 4B0EA 3DBRI 3NY5A 4JLCA 4W9EA 5IA7A 1JCKB 2Z6KC 2PYKA 1Z6HA 2B39A 3ERSX 5M3MG 1HQRD 2K33A 1EUVB 3FPUB 1EWHA 5C4JB 2IO1B 1CSQA 2HIVA 3VHTC 1Y14B 2NVQB 1UE6A 2PQEA 3OIQA 2LFNA 1WTQA 3H7PA 4ME5A 4NNJB 2PKOA 1NR4A 3J81c 2KO3A 2YLMA 2G9DA 4B95A 1XPRA 3LYYA 3R3MA 2BS3B 2HDLA 3NELA 1EYGA 1I4RA 2JEAI 2V9HA 1QZGA 2LRWA 4U673 1ICWA 1MPEA 2Y5PA 2QIEB 4JCVE 1ZEQX 3VRBB 2JZPA 5T1IA 3JAMi 1EF1A 2MH7A 4JI1L 1GVPA 1V2YA 4C3HB 3I4NH 1IP9A 1S72A 1BUVT 1J5EL 4GZYC 1U5KA 1BR9A 2BB6A 2MQHA 5JEAH 4A3KG 2K28A 1F9RA 3CC4A 2GBRA 1RCVD 3O65B 1SFOH 3SD5A 3K59A 2IYDB 2O6VD 3M3JA 2FXQA 2Q2HA 5LMNQ 1S4ZA 4DV2L 2V3NA 2F0VA 1FFVA 1XJVA 3KUDB 1OGWA 1QJOA 1BCPD 3H6NA 3IFTA 2LUMA 1BCPC 5CV7A 2WXQA 1TWFB 2Q2TA 4LFAL 4OZBA 2R3ZA 4UDUC 5J22A 1LQBA 3WOEA 1PGAA 1Q5WB 2ZNVB 2RF4A 2K5HA 2AWNA 1B8AA 2UU7A 1KABA 2I1KA 2F0WA 4OGQC 1X3QA 1NDDA 1V1PA 1ASZA 2B63B 4NJCA 1XNQL 1F77A 2RDHA 1JROA 3HM3A 5HURA 1G6PA 2RDGA 3DUZA 2AQ3B 3EQLC 4LNNA 1FEHA 2EELA 2M2LA 3RNGC 1VDVA 4NY0A 4GN5A 4A3DG 3LWEA 1O7YA 2IO3B 4UPAA 2JXMB 4BS9A 5JEAG 3NXWA 3ZDMC 4US9A 3QJZA 4FA6A 5IWAQ 1XTCD 2JJQA 4KY5A 1CM9A 1TWGB 3MTSA 4RCNA 3J7ZC 4BBSG 3FRPB 1HNZL 1FFUA 1YNTE 4WJPA 3RI7C 2QEJC 4L23A 3T56B 3M4YA 1V5TA 1XLPA 1YX6B 4H13C 1WTOA 2FCNA 2XN9C 2YTVA 5M9OA 3H15A 1J6QA 4B9XA 3K57A 4B3ML 4JI4Q 2A4ZA 4OX9L 2VNUD 2MJ3A 4XDCA 5BYQA 4FJYA 5TR5A 1GB4A 3UIOB 1L5PA 5IAAC 3J80c 3JC66 1P16A 3N1XC 4IO9A 1I42A 2KQ4X 2K03A 4FDBA 1N5XA 1I7HA 2KKCA 3T1YL 2QA4A 1H9KA 5IGBA 2MA9B 2RPQA 3PRMB 2RPVA 3I91A 3V2TA 1PV4A 3HOUH 2F3WA 1WFQA 4JV5Q 3CCJA 1YIJA 1OEYJ 5E4WC 3ERQA 3AMZA 3SU8X 1WXMA 4MT5A 2JF5A 2OT2A 2N49A 2E5LL 1RYJA 4FO2A 4ICVA 1MKHA 3L16A 1JWSD 1JE4A 2QKIC 1WI0A 2GB1A 4RM9A 1HJPA 1YHAA 3T1HQ 1HNWQ 1ROEA 3DWGC 4DA2A 4KD4A 5J39A 3S1QH 1FXAA 4N59A 3M85A 4MGYE 1N32L 3UQBA 4IFDG 4DK3C 1X3EA 3UDGA 3PVLA 4GDLA 4W9LA 2Q2UA 4DR4Q 2V3SA 4JBJA 1DM0B 1YEZA 1A0IA 5BR8Q 3QB3A 4LF9Q 4QUCA 1WWTA 2MQJA 2F0UA 1Q8KA 3HOZH 2QGQA 4CKBA 1HUNA 3J80i 2P5ZX 4YL8A 2MCNB 5E7NA 2JA6G 2HUGA 2LMCB 4A9AA 5IP7H 3M4OB 2BA1A 5L95C 1C1YB 3KOJA 2E75C 1I94L 5ELFA 3BINA 4URKA 2PVOD 3C46A 2O5IC 5C4XH 1RJTA 4EVOA 5CMDA 5IT9E 1PQSA 2JYEA 2N9KA 4F1SA 2ZW1A 3TZUA 4BKGA 2RSOA 1PH2A 2CJNA 3P42A 1SMYD 1SB3C 1STGA 5D7GA 3AEGB 5C5MA 2AWOA 3DVGX 2N7EA 2FMMA 2K01A 1K9MC 2RKSA 1KHIA 1QOGA 1VJKA 4LJZC 3A0JA 1JWUD 1ZE3D 1VQAA 1LM0A 3R2TA 3A8JE
chains in the Genus database with same CATH topology
3U52E 1DJRD 2JSVX 1CHQD 3TP8A 3VYTA 4DQOC 2N7JA 1C4CA 3R8BA 2J42A 4EQNA 1BO0A 3HRZC 1UGJA 4XTCS 3HUIA 4OHJA 3AM9A 3BS1A 4B08A 2LKVA 1PMRA 3FMCA 2RBMA 5IGGA 1CT1D 2WNMA 5BN3A 5IGDA 3NVZA 3H6MA 3GP7A 4ARIA 2Q5WD 1KRHA 4J8QA 2A69D 3LWUA 1BOSA 4LAAA 4ZUIA 3T3OA 1XCTL 3P7JA 5IOCA 1SE2A 5JEAJ 1RWSA 1E10A 1WCMB 4HAEA 1FD6A 4KGTA 1I3QB 1L6UA 4RGOS 1M8AA 1L0XB 3QJYA 3NWSA 1XLOA 3VR6A 3MXGA 3U2SC 3RPFC 4HRSA 4PT5A 1JORA 3W5VB 4YSZB 5NUCA 5EPKA 1WVLA 2RDFA 3NBHA 2I07B 4KHZA 2K05A 4IURA 3GV6A 2YU9B 2WU5B 3AECB 2JXTA 2FINB 3I4NB 2F0SA 3J9CA 1PDQA 5H8YE 3P4PB 2NZ1D 4XDXA 1OXSC 1WD0A 1GHKA 3RZOB 5AUIA 4MACA 3IT4B 1ENAA 3BYTB 1E2VA 1G6ZA 1BQQT 1C77A 1DOXA 2B2VC 2MPMA 1SNPA 2KCCA 1DOIA 1N5WA 3FILB 1U4LA 1Y8NB 5C4ZA 3BVZA 1NSNS 3ZJTA 4ZRQA 5A35A 4EGVA 5HFYA 1JICA 2DYOA 4M0WA 1EYCA 1CTMA 2KVMA 1FXIA 1RDPD 1AZPA 3GTLB 4IUVA 4JBWA 2F0FA 3L7ZC 3NBIA 2XWJB 3D31A 4P16A 3GO5A 1AZQA 1A3UA 2HDMA 2K7VA 1MHHE 1TQOA 1BMLC 1H9JA 1FNVA 3H91A 1QB5D 5I9OA 1F9QA 2PW5A 1XXGA 1KF6B 1PTOH 3K5MA 1B50A 4YT0B 4MN3A 3TP5A 4C1NK 1A2UA 1YN3A 3Q8EA 4HSPA 2DBYA 2ACZB 1DD2A 4DU9A 5K36H 5D14A 1CI3M 1Q3LA 1YN5A 2R6GA 3K6OA 1F2LA 2LHDA 3J7AF 1I4GA 2NTSA 4XWWA 1D1KA 2LHEA 2WXOA 5IGFA 2JYOA 1TU2B 1K83B 2QCPX 4QF4A 3NUCA 5DM63 1FO4A 1WTVA 2BTEA 3T16A 4DNTB 2L11A 1PYWD 1VZ7A 2B76B 4IUQA 1AWDA 5COYA 3D3RA 3QOJA 3TN2A 1GHJA 5C3JB 1AN8A 5FO8B 2W55A 2EYOA 3Q8FA 1JOKA 3BVGA 2Z4IA 1TKEA 3HOZB 1IW7C 4ZRZA 1SNDA 4RKLA 1T5EA 5E6JA 2PZTA 4A3FB 3FDTA 2EZVA 1LT4D 3IAM1 1LT6D 2E2DC 2F0MA 3OMGA 4BBRB 4NAMA 1IGCA 4AQ7A 1JB3A 2EXZA 1UEAB 1K51A 3SFDB 5C0XI 5K5PA 4A55A 3Q8CA 2R7ZB 2LJIA 3L9AX 5M3FB 5JOBA 2WIIB 3BDCA 2NBFA 2O5JC 1DOLA 3B2GA 4N9PA 2TSSA 1MSGA 2K0PA 2N55A 1JQ4A 2EJFC 5D3IB 2CU3A 2F3VA 1D1IA 1ZYRD 2M19A 3K5OA 1EZ6A 4FXDA 2C9OA 4HMJA 5HI1A 1MD2D 4BY1B 4G7HC 3NUHB 3AE9B 1ILPA 5ELEA 4KV6A 1OQRA 4RHSA 4CHTB 5C3EB 2FUG1 1Q90A 1RD9D 1STYA 4OL7A 4H44C 3FVQA 1PRTC 2F4IA 4C56C 3AN1A 3LXFA 4HSVA 5C3WA 2L5TA 2K9XA 1CQVA 1C4QA 4FNFA 1LV9A 3FEWX 4CGYB 1BCPB 1R9TB 5ELBA 2AUJD 1X3PA 2HCCA 3D4DA 2Q8TA 3A54A 2LS01 1SE4A 3KLRA 1FD7D 4H0LC 5TSSA 2BA0A 4J6HA 2HQEA 3ABVB 2WLBA 3BDLA 1OFFA 3PIP3 2Y5CA 2K5WA 4K2LA 5JVH3 5LL6S 3S1MB 1O78A 4KKJA 1KLUD 2E76C 1IHZA 4K6LA 2EY1A 1B1ZA 4A3GB 4K2KA 5EE1A 4F88A 1ENCA 2ICEC 2NWGA 2X6GA 3D4WA 3VR9B 1IL8A 3QO2A 1WSPA 4KJNA 3AE3B 3AE2B 3P4RB 3GV3A 3D6WA 1IYUA 2F0OA 1JQYD 2XSCA 5CV6A 2BW2A 3HRDD 3GTOB 2XNAC 1A6XA 3NTKA 3SHLA 5ELCA 2BBCA 3N52A 3RZDB 4CJ1B 1D5XC 3P75A 2J53A 4OIKA 5E1FA 2M0AA 1QQRA 5BYSA 3RMHA 4C3JB 4NW2A 1EYDA 1DOYA 3ZJVA 3NRZA 2V0GA 4C7ZA 3KF8A 1SNQA 1BNZA 2B2UC 1YN4A 3TP6A 3VYUA 1PDXA 1YNNC 3LNNA 3P63A 3O13A 1PFMA 1PZJD 3GTGB 2I46A 2SNMA 4A3EB 1NCVA 4REZA 5C0XG 2IJ0A 2H88B 1RODA 3GS2A 2IDYA 1GUWA 1LABA 4WFN3 4DN4M 3AE6B 1TKWB 2B8GA 1B9MA 5C5LA 2CVRA 3LB8C 1NUCA 1TS5A 4QCLA 1WRIA 2K1BA 3P4SB 5EKLA 1Y8PB 1YQ4B 2F0HA 1II3A 4NZLB 2L0CA 2LY7A 2CQAA 2JA5B 1P7FA 3X3MA 4Z9CB 2BS4B 4TQ1A 5HGTA 4P6VF 1CQFA 2V4DA 3EROA 3J81L 1L4DB 4TSSA 4UAIA 1A15A 1KDAA 1NYQA 2VUMB 3OOCA 4LK1C 4J3OD 4E6IA 2TMPA 3AEFB 1V1PB 2V4IB 1WXQA 3I9V1 4PMWA 2RMMA 5ELDA 3HOVB 1HA6A 5EPLA 4OVZA 4GDLB 3NE5B 3SEBA 1CFMA 3MJ5A 3GTMB 1I4QA 3TEZA 4TKOB 3NQTA 1JWAD 1HUMA 1PFDA 5C0XH 3C2PA 4KTAA 1DZ1A 2K32A 3OSOA 4FF4A 3W5UB 1C48A 1WGKA 4IKGA 4R3DA 1R4QB 1N62A 2F0JA 2WXKA 2NN6I 3H0GB 3UI2A 4AYBB 4A90A 4IFDI 3NTIA 2R93B 1ESFA 3M7NA 4A3MB 3DWMA 2MUYA 3H8HA 1HA5A 1EY5A 1K50A 4HROA 3EGRA 2R92B 2WDRB 2R61A 3I3CA 2JQRB 1G291 2DY7A 1TKGA 4FF2A 2LEKA 1ACCA 2WDVB 1YNND 1KAAA 3BK1A 1SSOA 1TKYA 1PZKD 3MXPA 1S5BD 3IAYA 1F2RI 2WP9B 5EKKA 2F0DA 3QG1A 1D2BA 2J52A 3DM1A 3PV0A 2BYTA 1F9SA 4JWUC 4C2MB 4N58A 4ZQ3A 4KKTA 2HDEA 2PIAA 2I38A 1JR0D 2H1EA 5IT9L 3SR6A 2AQ2B 2EPBA 1QOBA 1Q10A 2INPE 2ONQA 2AUKA 2L1AA 1LLRD 4A93B 2L32A 4M1UB 1KLGD 4KY6A 5I6WA 1ENFA 1STNA 4DAPA 4FF1A 1OXUA 1W6JA 1S5FD 2PZUA 1KFYB 4AS1A 2XRQD 1Y56A 2MP1A 1EQTA 1KDBA 4EE2A 1GUTA 4DFAA 3IKJA 3OIPA 2KDMA 3AEBB 1SXTA 4HCEA 3VYSA 3SFEB 2L4NA 2IL8A 2W3SA 5BMIA 3HGBA 4RFBA 4G7ZC 1EIHA 4WORA 3J81E 2DLBA 1JOOA 1QOHA 3AV8A 4ZAIA 2E2IB 3TSSA 4KKSA 4TRDA 4ZYSA 5C6AA 1NVID 1Y1VB 5E3FA 1GXDC 3K5LA 3URYA 2SAKA 2V3PA 3MHZA 3S16B 5EE0A 4G4KA 5M5YB 2E74C 1KH0A 2BB5A 2WQYB 4OIJA 2OEOA 5KEEA 5DAUA 4LK0M 1CZWA 3A8IE 2WV6D 4K5VA 4EQPA 5M3MB 3C1FA 2HCIA 4FF3A 2KECA 3A55A 2IGDA 4RGTA 5C0XJ 1SYCA 1A2TA 5C3XA 2PMVA 4ZHOA 1TWHB 4O42A 3P1MA 4A6QA 1M4VA 1C4AA 1O80A 4M8AA 5I4DA 4K6DA 3PZ8A 2RVLA 2BE5C 2X6LA 2ZXPA 3AE4B 1MBYA 4YTNB 1QNUA 2IX3A 4IFDJ 3H94A 4WJWA 1C78A 1UWMA 2SNSA 3K58A 2WXJA 1EOTA 3S1NB 3NPPA 3NVYA 2KN4A 1NI3A 4WAFA 1LTAD 1ZPSA 1PLFA 5T1GA 4HEA1 1IKLA 4DAYA 3VA7A 4S3SA 5FR3A 1H9RA 5C44B 3AB5A 2RQXA 5KIXA 2X69A 4USAA 2OHFA 2SOBA 3KLSX 5CYUA 3S2DB 4L2YA 5M5XB 3VR5A 4O1NA 2B2YC 1EM7A 1Q1BA 1MI2A 1XO3A 3MA2B 2A73B 5KNCA 4XWTA 3K5NA 2HTME 2FJ2A 4CKCA 5EJWA 1VDZA 3S1QB 2WDQB 3L3OC 1G91A 1EY7A 1F2ZA 4A8XC 1SF0A 3F2UA 1R7SA 4JE3B 2KQ3A 2NN6G 1ET6A 2JA7B 1YNJC 1SNCA 4PV1C 1PUTA 4PNYA 1VF7A 2B2WC 4HEDA 3SK4A 1HHVA 3SE0A 3TP7A 3KWLA 3CQZB 2CJOA 3C8YA 1YJJA 1ZYRC 3VR3A 5EE3A 1EFID 1TJEA 3N9YC 3WOFA 5FO9B 3HEJA 4XQQA 4RKBA 4JK1C 1ILQA 1Q12A 4C3IG 2IWHA 3DEOA 5C4XB 1WYGA 2F1MA 2JA6B 2EY2A 1EEID 5CC4A 5LHY1 4US8A 5IODA 2CW0D 4TQUS 3AE7B 1Z7TA 1NAPA 4N9TA 4NAWB 2ZXOA 3P1HA 2BE5D 3SR1A 1I4HA 3L4PA 1LTBD 3AE5B 1HXYD 1E0ZA 3DEPA 4H7BA 2EYFA 1ML0D 2JEBI 5BMHA 1XX8A 1UWXA 1JWBD 1Y1WB 1T3QA 5KRUA 2I2YA 1LTGD 1EL0A 1PTOC 5G5HA 2X38A 4CBVA 4ZLTF 3CHBD 3EJIA 1CA5A 4HMIA 1H9SB 1E9MA 5KGUA 1Q8IA 2IGHA 2PO4A 2DNCA 1F2MA 1DOKA 1PGXA 4A3JB 2OEDA 1VZ8A 1VMPA 2BT6A 1IW7D 1UAPA 1SE3A 1ZP0B 1QOFA 2F0KA 3E6ZX 3S17B 4X3UA 3T13A 3GTJB 1D6EC 2IX0A 3VR8B 2WB1B 3SK5A 2DWQA 5D65A 2OXPA 3R3OA 3W9CB 3X3NA 2AX5A 2A68C 4HKZE 1J8IA 1AEXA 2EJMA 4F7XA 1ZDVA 5EE9A 1XYIA 1BDOA 2B2WA 3BK2A 4A3BB 1QF6A 1GOZA 1TYGB 2B2TC 3R2IA 2Y3AA 2J4XA 3H3VC 1SYBA 1TY0A 4ABNA 1ZKOA 2A68D 4ZKCB 2QJLA 3C1EA 3HVZA 5FOBB 1ZXIA 1D5ZC 5JXVA 1SNOA 1K8OA 2IX1A 4BBSB 5KYLA 2L83A 2NTTA 3PUVA 4FXKC 2IW3A 1PRTF 4IZ8A 4ZKBB 3AMUA 2FE8A 2EOTA 2MGSA 2WXFA 1SNMA 1EY8A 1A3VA 3GB1A 3B9JA 3N6RA 4U68A 1YQ3B 2PMZB 2PLPA 1R4PB 2N0SB 2EYHA 4ZRPA 2F0QA 4XT1B 1EWYC 1HZ5A 2M56B 1JC7A 4ZHPA 3KBGA 4OO1I 4HJGE 2IT1A 4WWMA 1CJEA 1A70A 1EZ8A 1C8CA 1NENB 1SJHD 5KNBA 3T53B 2K6AA 3OPOA 4FP5D 2KEEA 1EYAA 1S5ED 2EJGC 1LACA 2ZXRA 2B2UA 5I2XA 1VMCA 5LL6X 1Y69U 2D5DA 2PPBC 3E0JA 2J7ZA 3AB9A 1RM6C 4JX1C 4QUFA 2EVBA 1V43A 4OZCA 3HZXA 1I4XA 3DHQA 4HN7A 1FNUA 3ETRA 1O7LA 4H2AA 4CJ2C 1B9NA 4TQ0A 4CKEA 1TY2A 4B9WA 1C4PA 2K5PA 1VZ6A 1TS3A 3MFYA 5FK9C 3RLFA 3G7LA 1SAPA 4JWSC 1JALA 2NYZD 4FVMA 4PMBA 3KUPA 3QOLA 4KGRA 4A3DB 4GDKB 1Z47A 1GB1A 1QG7A 5JJZA 1T6BX 1H9MA 1I6HB 3AE8B 3QIAA 4KD3A 3HS0C 2KCNA 3BIID 3KLSA 3AEDB 5ISRA 1A3TA 1GPXA 4IOIE 4IN3A 1XCQL 2PVGC 1XLQA 2KACA 2JA8B 4IALA 4NDXA 2PCFB 5C2TB 3RUZA 1KNEA 3TDQA 1FNWA 1OXXK 2NVYB 2YEPF 3IT6B 1SYDA 3S2HB 1STHA 3I4LA 1BF4A 1DOMA 1KNAA 3RFZB 4XQNA 4IUNA 2F0LA 2G1EA 1BXTA 1DXMA 4RNAA 1BCPF 2F0TA 3J80L 2KAJA 3WCQA 1NEKB 2KA7A 2C5CA 1FGBD 1I50B 1J7AA 3GTQB 5CV8A 2B2VA 2BCOA 2EY6A 2WXIA 1JWMD 3M7GA 4KN4C 2NN6H 1J9OA 2PTLA 2ICIA 4DF7A 4BA2I 1VLBA 5HHDG 2D2CC 3S15B 4WIPA 5DEHA 1OO9B 1SJED 3MWYW 1P7EA 4KHVA 1GUGA 3TBIB 2KMMA 2YEPB 4JPSA 4LLGM 1LO5D 3PIO3 2D9UA 5M5WB 3HOXB 3PZ7A 5EQ0A 5KNDA 1CA6A 3MP9A 5CV9A 2PZWA 4ILWA 4XIGS 3M3YB 3P4QB 2NVXB 3MEHA 4IDIA 2JP1A 3LX0A 5A2QE 2E2JB 5G3LF 4WURA 4K8JA 5FLXE 1TIID 4DK0A 4ID6A 3ZJUA 3J80E 3EFXD 4EQOA 5BYRA 2NUCA 2BDNA 4L63B 2D5GA 1D4BA 4DNRB 3AU7A 4XT3B 1GJXA 1PXUA 1SYGA 2IGGA 4DK1A 3DMUA 2OF1A 1E6EB 1E2ZA 2GRIA 4XQJA 1PZID 4ULLA 3IAS1 4HTHA 1VRAB 5DM73 2EY5A 1HFNA 1BUIC 4X3KA 3AE1B 1MI0A 1S5CD 3NTHA 1QT9A 4HKQA 1K52A 2L12A 1ESRA 1HZ6A 4RGMA 3EVQA 2A6ED 4C1NI 3JAML 1K8MA 4YTPB 2DNEA 3ZQ4A 1QILA 2F0IA 3D8GA 5BN5A 1G2SA 1D5MC 1WTXA 4KJOA 3ZYYX 3J7YW 4ZOHC 1HCZA 1VCIA 4NP5A 2A69C 1L0VB 4Y7NB 2WXNA 3NHHA 3VYRA 2M00A 3CRKC 4D2KA 1RF2D 1EEFD 3NZ3A 3E9SA 2CHBD 1KTKA 3WDNA 1JRPA 1CZGA 1QNKA 4IQZA 1IBXA 3ND8A 2Q8RE 3NVWA 2IPKD 5A2QL 1V1OA 3TZDA 5JPNC 2KOLA 5IIFA 5AFWA 3FC4A 1IGDA 4X3TA 1L0YB 5CR3A 1FM0D 1EIGA 1FR3A 1CHPD 4I7ZC 4V0BA 2Z1CA 2JWUA 1AP0A 3T51B 1LTID 3NQIA 1MSHA 1XWEA 1NYRA 5KYIA 2FMCA 3BG3A 2ZW0A 1LT3D 1U4PA 2Z4HA 5H92C 4KI0A 1CZPA 3VRAB 2A74C 2NMQA 1EU4A 2BS2B 1HPCA 3EUB2 2MJEA 2GA4B 4XE0A 3U4EG 2MJDA 5BN4A 2EKIA 2W82A 2A6HC 2A6HD 2O2LD 1PTOD 4WQMA 1UUPA 3KWVA 1STAA 2L9HA 2N9LA 3ZGZA 3AEAB 1XLNA 3W1SA 2L1BA 4DXFA 4G7OC 2JU6X 1B4OA 4R9WA 2DY8A 1B9RA 3TMEA 4MHEA 4C80A 1LTRD 3E5SA 2WXRA 2F0GA 5EGTA 2ID0A 1YJIA 1PFNA 1SYFA 2M9VA 1GUSA 2B2TA 4YWGG 1EY6A 1ZXHA 4WRDA 3HOYB 2XIWA 4YTMB 3GD7A 4C7YA 3HG9A 3NP8A 2D62A 2ZT9C 2RSNA 1PRTD 1GAQB 3FKIB 2MEKA 1S5DD 4BWGB 4N6EB 3IXSA 1GUNA 3FILA 4RAUC 2WACA 1VF5C 1ZUD2 2K3UA 2N88A 2JSOA 1RFKA 2XRSD 3W3AA 1AW7A 1RKNA 1E7PB 3HVDA 2A6EC 2BOSA 3GTPB 1EU3A 3J7AV 1YNJD 3U9OA 5IGCA 3H09A 1C76A 1WTRA 1F2RC 3AEEB 4LTUA 3C3LA 3ONAB 1SFOB 4NKLA 5CORA 3PO2B 3Q8BA 4B0MA 4QIWB 3NVVA 3PO0A 4FYDA 5D3DA 1MGSA 2CW0C 4F8MA 3R93A 4IUTA 3I4MB 3PMFA 5MPOA 1N61A 2QDBA 3G6JB 1QOAA 2WAQB 1BBXC 3FAHA 1NR2A 2QF7A 1OQQA 3NWTA 2EYPA 2L52A 1ET9A 3B2FA 1B2TA 3IFDA 1HQMC 3CU7A 4QMGA 1V97A 2AQ1B 3D4RA 1N63A 1EQVA 1F9PA 5G3LD 1TT2A 2MHVA 5JAVA 3DXJC 2H4OA 1U9RA 4YSYB 2Z8LA 1TVXA 2LMCA 4WH4A 4XDDA 4FXGC 2SEBD 3QWNA 3I57A 1PRTB 4RA8A 4QB4A 3SDZA 2VXWA 3KQ4A 1RHPA 5FKAC 2A5HA 1HFGA 3Q8AA 4IFDH 4X3SA 1HRJA 1CK1A 3K0YA 5BMGA 3I8ZA 3BVMA 2QSDA 3CIRB 2B2YA 2K22A 2KUMA 1JOQA 4ITKA 1MVKA 4OZAA 1SIJA 5G5GA 3V96A 4YIJA 1H9SA 5FO7B 1WTPA 2K04A 2KEDA 3BYYB 1WTWA 1OXTA 4F87A 1OXVA 3AH7A 3MXUA 2FHTA 4NMZA 3MHBA 3SVMA 4XYOA 1U4RA 4XYQA 1FCLA 1TR5A 4KGSA 2VB2X 5K36G 2PNRC 2EDGA 2WP8J 1HTPA 2WS3B 5I6YA 3OMCA 1L6VA 1J7BA 3JAME 3S1RB 4Q0FA 3OW7A 1FIQA 4OO1G 1QCBD 5LNK1 1Y8OB 3OHXC 4RF1A 2YYZA 1MHXA 1AYFA 2KJXA 2WXGA 1TS2A 2F03A 1DCZA 3Q69A 2BDOA 2F0PA 4KN7C 5CV4A 4TMAB 4L1BA 1G8ZD 1LT5D 3S14B 1SDFA 1T5XD 5I2YA 5F2DA 3T3NA 4RHRA 2XWBB 3OWFA 4BY7B 1DONA 1EY0A 3I90A 3EA6A 4HR7B 3VR4A 3Q24A 1VR9A 2K5DA 4XXEA 2XVSA 3BZDB 5JPMC 2ON8A 4K14A 3FPPA 1FMAD 3ND9A 4C3JG 4DXGA 2LFIA 2E3TA 4C3IB 2F0EA 2RA4A 2ENBA 4K8IA 3HOWB 2KWDA 2Q8IB 1WD1A 2QMTA 4YSXB 4RH6A 3E56A 3GTKB 1PFBA 2W54A 3U7ZA 4YXDB 4V190 1TWAB 4KKIA 1JMLA 4J1MA 4RF0A 4ZUJA 1DYQA 4KY7A 4PQXA 3TEXA 2O4XA 3T4AC 2VB3X 1IKMA 1I4PA 4K5XA 4KX6B 2EYJA 1GUOA 4OO1H 3MZ5A 3MVVA 4GLSC 4C3HG 2F0NA 1U4MA 5CBAE 2GI9A 2EYLA 1QLBB 2NB0A 3MAQA 2SDFA 4G57A 3MFGA 1PTOF 5I9PA 2WXPA 3A56A 3ITPA 2WKCA 1FRRA 1J7CA 1IBXB 1B44D 2VZKD 3W2DA 3A7LA 3CRLC 2WKDA 1ONLA 1TS4A 5T8IA 3MC0B 1C9FA 4L8JA 1AFPA 5C4HA 5CV5A 3DWQA 3GQBA 5CBEE 5JVG3 1QWYA 1E0BA 3TEYA 1EY9A 1ZOYB 3NS1A 4DGZA 1B3AA 3SXHA 3DWAA 4IUPA 2WXMA 1SEBD 1L4ZB 2QILA 4P2CB 1C79A 4HCSA 1RTOA 1JW9D 2PW7A 4CJ0B 3BDOA 3VR2A 1X32A 1IUEA 1HTLD 1FRDA 2L55A 4K5WA 1TWCB 3K7AB 1PTOB 4ODGA 2NVTB 2E2HB 4MM3B 1N60A 3TEWA 3HKZB 1SMYC 3MXNA 1SBBB 3I73A 2PW9A 4RCOA 5EBDA 1K53A 3A7AB 3KBXA 4L6TB 1LTTD 3TUOA 3I72A 2WXHA 4KMUC 2DYMA 1UNSA 2B8FA 1V8CA 3Q0AA 1STEA 3V05A 3PUZA 3V3XA 5AUKA 4Q5VA 3HOUB 3P20A 4MH8A 1EWCA 1V8QA 1QE6A 3KK7A 5IGEA 3CKIB 3IL8A 5EPJA 2VZKB 1I6VC 2J0TD 1XF5L 2W3RA 3PUWA 5EKIA 4DAVA 2FFKB 4R8IA 1E2WA 3PO3B 5E4XA 4Q2JA 1W6KA 2JYTA 1FCCC 1O7ZA 3Q6SA 1KDCA 2WINB 3BWUD 4IUUA 1YMHE 3OWEB 5DNFA 1Q1EA 1HEZE 3PUXA 2EYMA 3NK9A 3HP3A 1QKZA 2Y0SB 1G2TA 2JE6I 5HG2A 5GXGB 1EY4A 3Q22A 2KHSA 2H89B 4ARCA 4RWSC 3U9SA 1XEEA 2INNE 5CGKA 1SSNA 3SK6A 1B53A 2G9HD 4KKUA 3SK8A 4LMQD 3NSWA 1F0ZA 2WXLA 4BA1I 1FYCA 3A8KE 3CWIA 2DN8A 1STBA 1F2YA 1RTNA 4CQNA 1ZXTA 3UI3A 1PGBA 2FBWB 4A3IB 4OW0A 1TZOA 3PUYA 4PMCA 3VQIA 4FXCA 4KK7A 1ZDXA 4MIUA 5FLXL 2K5QA 3D6CA 4RGNA 1DGJA 4R8NA 3RD4A 2WU2B 1LTSD 4I65A 2E6XA 2EE1A 5J1ZA 5EBCA 3S9WA 2MJ8A 1SYEA 3I70A 4ZK9B 2LGIA 3DWPA 1IYVA 3Q23A 4A3KB 3VA5A 4B0EA 1JCKB 2PYKA 1Z6HA 2B39A 1HQRD 2K33A 3FPUB 1EWHA 5C4JB 2NVQB 2PQEA 3OIQA 2LFNA 1WTQA 4ME5A 2PKOA 1NR4A 2G9DA 3LYYA 2BS3B 2HDLA 1I4RA 2JEAI 4U673 1ICWA 1MPEA 2Y5PA 2QIEB 1ZEQX 3VRBB 2JZPA 5T1IA 2MH7A 4C3HB 1BUVT 4GZYC 2BB6A 1BR9A 5JEAH 2K28A 1F9RA 1RCVD 3K59A 2V3NA 1S4ZA 2F0VA 1FFVA 1QJOA 1BCPD 3IFTA 2LUMA 1BCPC 5CV7A 2WXQA 1TWFB 4OZBA 2R3ZA 4UDUC 5J22A 3WOEA 1PGAA 2AWNA 1KABA 2F0WA 4OGQC 1X3QA 1V1PA 2B63B 4NJCA 1F77A 2RDHA 1JROA 5HURA 2RDGA 3DUZA 2AQ3B 3EQLC 1FEHA 2EELA 2M2LA 1VDVA 3LWEA 1O7YA 5JEAG 2JXMB 4BS9A 3NXWA 4US9A 1XTCD 4KY5A 4RCNA 1CM9A 1TWGB 3MTSA 2JX5A 1FFUA 3FRPB 1YNTE 2QEJC 4L23A 3T56B 3M4YA 1XLPA 4H13C 1WTOA 2XN9C 5M9OA 4B9XA 4XDCA 3K57A 5BYQA 2VNUD 2MJ3A 1GB4A 1L5PA 2KQ4X 2K03A 1N5XA 1I7HA 1H9KA </