1JCKB

T-cell receptor beta chain complexed with sec3 superantigen
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
239
structure length
239
Chain Sequence
b'ESQPDPMPDDLHKSSEFTGTMGNMKYLYDDHYVSATKVKSVDKFLAHDLIYNINDKKLNNYDKVKTELLNEDLANKYKDEVVDVYGSNYYVNCYFSSKDNVGKVTSGKTCMYGGITKHEGNHFDNGNLQNVLIRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIESNGNTFWYDMMPAPGDKFDQSKYLMIYKDNKMVDSKSVKIEVHLTTKNG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 14.3.D T CELL ANTIGEN RECEPTOR
publication title Crystal structure of a T-cell receptor beta-chain complexed with a superantigen.
pubmed doi rcsb
source organism Mus musculus
molecule tags Complex (toxin/receptor)
total genus 63
structure length 239
sequence length 239
chains with identical sequence D
ec nomenclature
pdb deposition date 1996-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
B PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1jckB01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1jckB02
1EEFD 1FNUA 2J4XA 1HA5A 1S5FD 1RD9D 4DXFA 5TSSA 1SE4A 3EFXD 1STEA 1XXGA 1TY0A 3URYA 1SBBB 1KTKA 1LTRD 1EFID 1V1OA 1BCPB 1LTSD 1PYWD 1L0XB 1SE2A 3EA6A 4ZYSA 1LTTD 1S5DD 1XTCD 1QILA 4Z9CB 4RHSA 1I4HA 4K6LA 1FNVA 3KLSX 1D6EC 3MFGA 3V05A 1B44D 1SE3A 1CK1A 1JWUD 1RCVD 1TY2A 4RHRA 5I4DA 1BXTA 4RGNA 1LTBD 1I4XA 3O13A 4RCOA 1HXYD 1KLUD 3R2IA 1HTLD 1TS2A 2IJ0A 2QEJC 1JR0D 1PZJD 1S5ED 3BYYB 1LT3D 3BZDB 5D3DA 5ELEA 1LT6D 1PTOD 4RFBA 4RGOS 1KLGD 1PRTB 2SEBD 1BCPD 1HQRD 2AQ1B 1T5XD 1PTOF 2XN9C 2ICIA 5D3IB 1BCPF 1PTOH 1UUPA 1FD7D 1M4VA 1GOZA 1CHPD 1DYQA 2QILA 1I4GA 3DWQA 1TS3A 1PTOC 4L6TB 3MC0B 1I4PA 1PZID 1RDPD 3BVGA 1LLRD 1EWCA 1AW7A 1UNSA 4RGMA 3BVZA 1SJED 1V1PB 1PRTD 1EU3A 4BWGB 1SEBD 2CHBD 1V1PA 5ELDA 1PRTF 1JWSD 1I4RA 1S5CD 1PZKD 4DXGA 1CT1D 3W2DA 2G9HD 2WV6D 1EEID 1LO5D 2AQ2B 3DWAA 1G8ZD 3SEBA 1TS5A 1YN4A 2IPKD 2TSSA 1CQVA 1D5XC 1MD2D 1TS4A 4C56C 5FKAC 1BCPC 1LT5D 5ELFA 1EU4A 1RF2D 5ELCA 3CHBD 1ESFA 1D5ZC 2RDGA 3DWPA 1YN3A 1JQYD 1LTGD 1FGBD 2RDHA 2NTSA 3BVMA 1JCKB 4UDUC 4OHJA 1FNWA 1D5MC 2XNAC 4O1NA 3OWEB 1YN5A 1ET6A 1LT4D 3BYTB 1DJRD 1PRTC 1I4QA 1LTID 1SXTA 1AN8A 3TSSA 1LTAD 1SJHD 2AQ3B 4L63B 1CHQD 1PTOB 4RH6A 4NZLB 3R2TA 1S5BD 1L0YB 2O2LD 1ENFA 2NTTA 3R8BA 5ELBA 2R61A 1F77A 2Z8LA 1ET9A 4RGTA 3GP7A 4TSSA 1B1ZA 2XRQD 2XRSD 5FK9C 1JWMD
chains in the Genus database with same CATH superfamily
3N20C 2XTIA 1G51A 3PGZA 4CBVA 1NI3A 3ND8A 4KKIA 1UWMA 1TWGB 5JJZA 1JORA 5DPRA 4C7YA 2SAKA 5KNDA 1L6VA 4YY3Q 2K5QA 1Z6HA 4ZYNA 1R4NB 3N9YC 3HIZA 2N7JA 1EQVA 4R8NA 2RHQB 3NPPA 1HFGA 3NWSA 2JSOA 2PVOD 3W5VB 1D6EC 2E8GA 1UE6A 2LXJA 4QL5A 2EJGC 1XNRL 2BTEA 4FJZA 3M95A 1VQGA 1ICWA 4YHHQ 1ZOYB 5M5XH 1IL8A 2RF4A 4OWTB 3RZDB 4JI4Q 4OGQC 5G2NA 4A3KH 5GAEC 2VQEQ 3S14B 1CI3M 1SNDA 1STYA 5NUCA 1PFSA 3HGBA 4OO1G 3E9SA 1NTGA 1EYCA 2DY8A 1QVGA 3D32A 3DHIC 4EZKA 5IE8A 3NVWA 1CHPD 1FXAA 3VVWB 2FHTA 4GS3A 3CC7A 1EIGA 2QMTA 1KDBA 3CP0A 4DV4Q 2B2TA 1VQ4A 3HOVH 2BH2A 1QUQB 1XPRA 2WXMA 3ZYYX 3HOYH 1O7LA 4A8XC 3P42A 3OW7A 2PI2A 4CKEA 1UNSA 4MTNA 4P71A 4B08A 5GAGC 3V60A 1GUSA 1IBXA 4LJPB 1TZ1A 1K8RB 3VAWA 1JICA 2JUOA 3W1SC 2KQ7A 4R9WA 3AU5A 5M5XB 1L6UA 3QQ8B 4EOYA 3P1MA 4DNTB 1SIJA 2Y0SG 2Y0SB 3PO2H 1TKWB 1EZ6A 1FMAD 1OQQA 1ZE3D 5C3JB 3OG5A 2C35B 3GTOB 1L0WA 3GTPB 3S1MB 4GB9A 4IOIE 1RFAA 1K83H 4QIWE 3M3YH 4NXNQ 2LHEA 2Q2UA 2F0SA 2B2UA 3FKYA 4JV5Q 2DN8A 1EF1A 4HAEA 3HOVB 4C56C 2DJGC 2PNHA 5MPOA 1U4AA 3HOYB 2KFKB 5ISRA 3RULA 2R7ZG 2R7ZB 5CBEE 2NWGA 2HD5B 3AE2B 4ZKCB 3SD5A 3MC9A 2K6QA 3U4VA 5IYDH 1RKNA 4MHEA 3TEYA 4G4KA 1WTXA 3A5UA 2NTSA 1YD8U 5IYBH 1E8WA 2H89B 3AB5A 4OHJA 3BWUD 3RI7C 4F8CB 1SYBA 3UIOB 2G5DA 1AWDA 1Z7TA 1YJNA 4DV5L 1J8IA 1ZW7A 3IG3A 3AFPA 3PO2B 1FPYA 2WXFA 4CDDC 4NXML 3HOWH 3QAQA 4FN2A 5E1FA 3JAML 4MELA 5JZEB 2WKDA 2ONQA 2B76B 1U4LA 1A2UA 1LQBA 2B2WC 1F2YA 1B50A 1K83B 2WHIA 5I6YA 3SK5A 1I6HH 3J80E 4IPHA 1M94A 5FLXE 5BN4A 1X3PA 2PLPA 4MGZE 3H09A 3R8BA 2BB6A 3QOLA 3ZXRA 5IGGA 5LXHA 3NWTA 3TZUA 4UP7A 3X23A 4M0WB 2JE6I 3PCOB 3U4ZA 5EKIA 3KFUA 3M4OH 2HJ1A 2K8HA 4UAIA 1JMLA 3J81E 3MJ5A 3BZCA 4X3TA 4LFAL 1XNRQ 3VR6A 5KNCA 2HQEA 4A3JH 5TSSA 5BYSA 4L5QA 2VNUD 5C4JB 4K5WA 4KGRA 4XDXA 4HIMA 2IO1B 3CSFA 5IT9E 3KJOA 4BKTA 3URYA 4IUUA 2ZM6L 1FJGL 5CV4A 2A19A 3GTLH 1A3VA 3K81C 5HGQA 2E2JB 2Z0DB 5IA7A 3UE1A 4ZDVA 1C48A 4MIUA 1V1OA 3GS2A 2ZJPA 2M19A 2WDVB 4LLGM 4P1BC 5CV6A 3TQYA 1VMCA 3PUZA 4TMAB 1WTHA 2AWTA 3ZIMA 2BF8B 5J22A 3RFZB 1EY6A 3RD4A 3KJPA 4RHRA 2AHOB 1RJTA 2NN6H 5I4DA 4NJ6A 1IYVA 4LFBQ 5TR5A 1TT5B 2A6HC 3Q8FA 4DUZL 3CIRB 1C4QA 1TWAH 2QCPX 3OIQA 1QF6A 4CQNA 4K2KA 2B63G 1GVPA 3CXCA 3K5LA 4BKGA 4HEA1 1NI2A 2PZWA 2LRUA 2NB0A 1YQ3B 4OONA 1NVID 1X3FA 2V3PA 3IFDA 2K8CA 4ZHPA 5T1IA 3PLUA 1QZHA 1DGJA 4TVAB 1M90C 3QK0A 2N7EA 2QGQA 1N8RC 3M9BA 4F7ZA 1EWCA 1K0RA 5E6JA 3U50C 5GMVA 1FO4A 1Q10A 5DM73 1I3QB 2PVGC 4RM8A 5IOIA 1V43A 1J19A 1GG3A 4JIOU 1RTNA 4US8A 1HEZE 4MNOA 1B9NA 1GC6A 4RM9A 4S0RA 3GZNB 1SYEA 1TWAB 5LLIA 2JXXA 2F0WA 2I5HA 5IP9G 3GTGH 1Y1WH 2OCEA 1S3SG 3OTOL 3MJWA 2J7QB 1G6JA 2FFKB 3I4MH 2A1AA 3CKIB 4C2MB 3KF6B 4GKKL 3HKZE 3IKJA 4KSKC 4MACA 2PIAA 3EECA 1X65A 4DV5Q 4JI2Q 1D5XC 1T9HA 1CZPA 2K04A 2NVXH 1T0QC 4DR2L 2L05A 3Q24A 2OHFA 1P98A 5HURA 1L5PA 1BCPC 2MJ8A 3JW0X 1H8CA 2UUCQ 2L0FA 4MSMB 2C9OA 2NVQB 3Q22A 3HOZG 3HOZB 2XNAC 4O1NA 1VDZA 1Y1WG 1Y1WB 3GTGB 4IKGA 2WAQE 2Y5BB 2EZVA 2YLMA 4F1SA 3OW2A 1B3AA 1VDVA 4FJYA 4LFAQ 1K73C 3EUB2 2XVSA 2BB5A 1L4DB 2J42A 1YEZA 3L7ZC 3ZDMC 3HOXH 2NVXB 2WXRA 2MHJA 2ZM6Q 1FJGQ 2KOLA 3IBEA 1H95A 1C77A 1ET9A 1VQEA 4RGTA 3V62A 1JJGA 2IY0B 2IW3A 4DV0L 4OX9Q 3RZWC 1E8XA 5BYQA 1KDCA 3PZDA 4MZ9A 4ZRPA 2PMVA 4LMQD 1KOTA 2X6GA 1EQTA 5FO9B 4UP8A 1OTCA 4C00A 1HA5A 2JXTA 4DWFA 4DUZQ 3AEGB 1JE5A 4XWWA 2B3AA 3MTNB 1SBBB 1C76A 1LM8B 2WKCA 3CCVA 1PXUA 3L4PA 3QWNA 2F4VL 4KIKB 2KJXA 3I90A 2AL6A 3CCJA 3VTWA 2LVQA 1IHZA 4XQNA 3HOXB 4LF5L 1SE2A 1WMHB 2BWES 4LNIA 3WOFA 2DWQA 1J6QA 3MFGA 1I35A 2GBMA 4M8AA 2WQYB 4RGNA 5E6OA 5BYRA 1I4XA 3S24A 3PPAA 2GBKA 1KLUD 1P16A 2ZT9C 5LMNL 1SYFA 1L7YA 1QG7A 1NSNS 1DOXA 2WP8J 2HIVA 1ZDXA 1KLGD 1PRTB 2SEBD 1ENCA 2FMCA 2B39A 4N8FA 1GJZA 3CMAA 3SU8X 2DYOA 2SNSA 4BBSH 4GMVA 4IPGA 4Q0FA 3OTOQ 3NG0A 4MGKE 5CYUA 3UGBB 4GKKQ 3AU4A 4FXDA 4EUTA 1F2ZA 1LYLA 1A62A 2L1BA 2JSVX 3J7YW 4A4IA 2RPQA 4DK5A 2LFNA 1WRIA 3Q0AA 4IWPA 3L10B 1TWFB 4DR2Q 3T51B 3BK2A 4A6QA 2PO4A 1F2LA 1WTQA 5IAAC 1SROA 1SN8A 4R4IA 1ZYRC 4F88A 1QZGA 2QC8A 4RMFA 1S5CD 2YYZA 2IGHA 4B6WA 4FHKA 3NOBA 3MA2B 2JA6G 3KLRA 4WWNA 4ZCKA 2UUAQ 4JBKA 1EWYC 2R93H 4IUTA 1EFWA 2K9XA 1UE1A 3F2UA 3S16H 5J39A 4FF1A 2A73B 3I4OA 4APVA 2HDMA 1WGGA 4B0EA 3J81j 2C7NB 1SYCA 4W9DA 2B2VC 1MD2D 2KLCA 3N6RA 4RG1A 1KAAA 2M0AA 3DBRB 2E75C 3EGRA 3L0WB 4J6HA 4M00A 5FKAC 2FCMA 1LT5D 2KJRA 2WFWA 4QUCA 1STNA 3VA7A 2WXIA 4P74A 3KLWA 1KABA 3CHBD 1ESRA 1HFNA 4KVGB 2RGFA 2F1MA 2ON8A 1JRUA 2PI2E 1I50B 2MP1A 2J0MA 1YJ1A 4JC0A 3A5ZB 2K3UA 2F0OA 3RT3B 3E5SA 5IGDA 5IGFA 3TP8A 4U68A 4G7OC 1FEHA 2F3VA 4JGHB 2CWAA 1LT4D 1DJRD 1VS0A 1N34L 1RYJA 3AU7A 2CW0C 1ZKOA 3CPFA 2A5HA 3TSSA 3PO3G 3PO3B 2KVRA 2PZUA 3OYYA 1VZ7A 2H5XA 4WIPA 2X69A 1A3TA 2EJFC 4WAFA 1L0YB 2MQHA 2KC2A 3GTQB 2F4VQ 3H0GH 3FPUB 4XXEA 1VJKA 2R61A 1BF4A 1GXDC 2GRIA 3U2SC 3AE4B 2A74C 4NW2A 4IUPA 1GUTA 4LF5Q 3S1NB 2LXAA 4JE3B 1MI0A 2KN5A 4IFDG 2XK5A 1CFMA 2ZVOA 3Q8AA 3D4DA 1P9DU 1FR3A 2KEEA 4QIWB 3K7UC 1WX9A 1N5WA 5IOCA 3K9OB 1C8CA 2BVCA 2DX5B 5LMNQ 3MVVA 3I56A 1VQ7A 2N9PC 3QARA 1CKNA 2JA9A 3KUCB 4DK0A 4JI7L 1GAQB 2RHSB 2J0KA 2XBBC 1LGRA 1WXVA 5LHY1 3RYTA 2MEKA 4ZYSA 4HMIA 1EIYB 1OFFA 5EGTA 1GUGA 1LTTD 1MKHA 2DY7A 3H0GG 3H0GB 4Z9CB 2F0JA 2M0XA 3FEWX 4HXDA 4S17A 1F9JA 1V9JA 1B53A 2PQAB 4DNRB 2MUYA 2K1FA 4JQWC 4I6LB 5C0XH 1F2RC 2OOBB 5HKHA 2OF1A 3NXWA 1I42A 4ME3A 1IUEA 3AE6B 1HXYD 2QDLA 1A3UA 4DA2A 2BYFA 2INCC 1F52A 2NPTA 3IT4B 4DV1L 2O2VA 3ITPA 4F8MA 3OJ4B 3V96A 2RSUA 3DVNV 2D9UA 5LMNW 3HG9A 2JRIB 3I4LA 3KYHC 1YBYA 1G291 4R1JA 1GUAB 2ZW0A 4OVUA 2L7RA 2KBNA 2EJMA 1WJUA 2KCTA 1HRJA 3Q3JA 3VYUA 2EY6A 4HEDA 1HZ5A 4M8MA 3SHLA 2GA4B 4JOIC 1O7YA 3NHHA 4C3IH 3DPDA 5J18A 4OELB 2VB2X 2AWOA 1WYWB 1Q0WB 4NNJB 1LUZA 3W5UB 1AW7A 5IN7A 1V81A 1TIFA 2GMIC 5EE1A 2K5NA 4KKSA 2BE5D 2KMAA 3PUYA 4QB4A 2G1EA 4B3RL 1IW7C 4K7SA 1HR0L 1WH3A 1PRTF 5DCNA 1I4RA 3J80i 4LF8L 3A8IE 1YX6B 3HRDD 3LGJA 1A5RA 5C2TB 2C5CA 2WV6D 3NELA 4CDFC 3L08A 2CJOA 1YNND 3A7LA 2OTJA 3L16A 1WWTA 2IO0B 4DR7Q 1MIUA 2HCCA 1A63A 1H9KA 1OQRA 2LRWA 4GDLB 1FFVA 2DZJA 1WVLA 4MEMA 2MSED 1U4MA 4J15A 4KV6A 1WCMG 1WCMB 1XPOA 2CHXA 3APDA 1N34Q 1G6PA 1U4RA 4YCUA 1ASZA 4ZRKA 3MWYW 1UEAB 2K7VA 5BR8L 4C3IG 4C3IB 2DNFA 2G4SA 4P2CB 5I2XA 4I6NB 2R2QA 2RSNA 1HZCA 4PV1C 5JVG3 4B3SL 2EKIA 4HROA 4WJWA 1XTDA 2ALYB 3NSWA 3NVYA 3T53B 4A3IH 1WJNA 2J52A 3DBHI 3RZOH 4DK1A 4IURA 5BMIA 4FF3A 2KJ6A 3PRPB 1Y8NB 5I9PA 1JOOA 1N9WA 3C3LA 5EE3A 2XWJB 2PW9A 3H91A 3GDEA 4P7IA 1SJHD 4C3JH 1EY0A 1OXXK 2K05A 4DK3C 2K1BA 5JJIA 1WJ4A 4S3SA 2Z6BA 4PMCA 4R3DA 3APFA 1NDDA 4JI8Q 1ENFA 2N55A 4NKLA 3Q8CA 3GTKH 1E90A 3DBLB 4XC2A 5GAHC 3I55A 2Q8IB 2XRSD 4LUZA 3NBHB 5KNBA 5BO4B 5JHAA 5IP7H 1F1HA 3RZOB 1X3EA 3L17A 3KUPA 1F9PA 1SRUA 2WXNA 3RMHA 3U9OA 3P7JA 4DV1Q 1S72A 1UELA 5CORA 2K4KA 3TBIB 3GTMH 2L00B 5DPTA 4AQ7A 3BDOA 3KDFA 4C3JG 4C3JB 2OT2A 1EFID 4WQOB 3MHSD 2K75A 2HD3A 1LTSD 1PYWD 1T0SC 1WTPA 1H9SB 4HIOA 1IYJB 3AN1A 4XDCA 2H88B 1CM9A 2PNRC 2FJ2A 3VTVA 4BVUC 5GROA 4A3EH 2L52A 4IUNA 1FNVA 3V05A 1QCBD 1B44D 3J7AV 1RCVD 2WXJA 2WINB 1YNJC 4BA2I 1V9PA 3AEFB 3S9WA 1PFNA 3ML9A 2KENA 2W54A 2J0TD 3ZJYC 4ANWA 2SDFA 4K0KQ 4OXPA 2ZTCA 3KW5B 1TVXA 1HNWQ 3RNBC 4B3RQ 1A8VA 1HR0Q 4EVOA 4LF8Q 2AQ1B 5C0XJ 1PTOF 4NY0A 4QF4A 4GLAC 1IPGA 2X8XX 4N9PA 2LJIA 2QILA 4ILWA 3GTMB 2VY3A 5FJ8H 4L5RC 3RNFC 3N1ZC 4L6TB 4DHZE 3ZVVA 3BG3A 4KZ0A 1J7BA 1E9MA 4XT3B 2ZTDA 3CCSA 4KDIC 1KC8C 4PQXA 3ULPA 2HTME 3S1RH 2D3BA 1QVCA 4HJGE 5BR8Q 3OWFA 4W9KA 2M9VA 3F8TA 1BBXC 5AFWA 2FUHB 4DR1L 4R8IA 3L0OA 4B3SQ 2H1EA 3JSVA 2GBJA 3PZ7A 4OVZA 1TWCB 3H7PA 1U0LA 3OJ3A 3NS1A 3E56A 1YHQA 4F87A 2YEPB 1TKEA 1HR0W 4KHPQ 4B3ML 2CS4A 4YSXB 4DAYA 3NUHB 3G48A 2IPKD 2DJFC 1CQVA 5FJ8G 5IGEA 1WF9A 4LNNA 3RD2A 3UDIA 4LK0M 3A1QA 1R4MB 3KWLA 4POGA 4W9JA 1QNUA 2JA5G 2KHSA 2JA5B 2KXJA 2PKOA 1EU4A 1N63A 3U4EG 4P1CC 5ELCA 2CH4A 2D5DA 2ZJQA 4A93H 4N8X1 5EJWA 3S1RB 1WGDA 2Q5WD 4E74A 2KD0A 2N1WA 1EY8A 5BN5A 1VQPA 2A69D 5IWAQ 3KVFB 4NJ7A 4Q2JA 1NR4A 3BVMA 3OPOA 4UDUC 4DV2L 2D62A 2HE7A 3DBSA 4HTHA 1XLQA 2CJNA 4BFRA 1W6JA 3RMKC 4B0MA 1WIAA 3DUZA 3OLMD 2D0PA 4DAMA 3P4RB 4LFCL 1X54A 4AIMA 1PGAA 2I38A 4JPBW 1VR9A 1RLFA 3U9SA 5KIXA 2LMCB 2B2TC 2ZVNA 3P63A 4OW0A 3ALBA 4PT5A 4AJWA 1RIPA 2KDEB 4XQQA 5D7GA 2K5HA 4DU9A 2I46A 1SMYC 3K7AB 3K5OA 3RN5A 2UWQA 2L32A 3CWIA 5D65A 2LUEA 1E0BA 4GNXB 2AUKA 1UWVA 3EFXD 3NP8A 5C44G 5C44B 1UF0A 3B2FA 2VL6A 1G91A 3HS0C 4A3FH 4W9LA 1LTRD 4RAUC 3A8KE 3M4YA 2MP2B 2PYKA 1STAA 1Y8OB 2B2UC 2HQLA 2OEOA 4KD4A 4JYAL 2F0QA 2KT7A 3QX1A 5LMUL 3AEDB 4L5SA 2Z4HA 1AE3A 2L5TA 4BXXH 2WXGA 1GUNA 4RHSA 5CV7A 1WYDA 1NE3A 4A3DG 4A3DB 1L4ZB 1HNXL 3DCGA 2M56B 1ILQA 4JBWA 2XSCA 4MJSB 3BJUA 4DUYL 4LNOA 2IT1A 1FD6A 3I57A 3MEFA 2W3SA 5C4ZA 4DK6C 2CCZA 4QAYA 1B70B 2F52A 4NDXA 1HTLD 1PH3A 3FDTA 4L5TA 1VQ8A 1BUVT 4H02A 1JJCB 1YQ4B 3K59A 3ZW3A 1EWIA 1QQRA 2BDOA 4A90A 1DOMA 1JQ4A 3SR6A 5EBDA 4A3FG 1OXSC 4IJLA 1MSHA 2KVMA 1GOZA 4QGUA 4XT1B 4A3FB 1YMHE 3RUZA 4PG3A 2IY5B 2BQQA 2ZPYA 4URKA 3HZXA 1GHKA 4B3MQ 2JWZA 1C3TA 4Y52H 1GUWA 2NBUA 5JJLA 1MHHE 2KMCA 2KDBA 3Q3OC 1FXIA 4BXXG 1JWBD 2ZJDA 2D3GA 1HPCA 4LNQA 1Y8RC 5JEAH 2K39A 3QCAA 3P4SB 3PV1A 2FXQA 3DMUA 4TKOB 3DWMA 2O5IC 4KX6B 1MJDA 2I1KA 2MBBB 2Q2HA 4DGZA 1RL2A 2L3ZA 3A4SC 4TUUA 1VQ6A 2JWUA 3AEAB 3TDQA 2MO1A 3PSIA 2AQ2B 1JW9D 1E2ZA 1G8ZD 2MBOA 4DV2Q 4X66L 4Y7NH 3UI2A 1CMXB 2EKEC 3R66C 4AOFA 2VZAA 1TIID 4PYZA 1U5KA 4IC7B 4K5VA 3QIAA 1SNQA 4X3SA 2LXKA 3K6OA 4LFCQ 4IWQA 3TZDA 3QJZA 4H0LC 3CC4A 2BPSA 1CKOA 3ULJA 4FHJA 1C4CA 4B3TQ 1BT0A 1ESFA 3S2DH 1C7YA 2RDGA 4REZA 4EQOA 1I94Q 2NVTH 3J7A5 4OZBA 3WAPA 4BY1H 1E3PA 1KNEA 2RKSA 1XLOA 2J0JA 2RDHA 2YEPF 4IQZA 3E0JA 2LFIA 2K5VA 1FNWA 3SDZA 4A3KG 4A3KB 4QY7A 1GC7A 4B9XA 1KQSA 4C4VA 4TQ0A 1IBKL 1LTID 2A69C 1CJEA 3T1YL 1JWAD 2BS3B 3L13A 1NCVA 1FIQA 3A9JA 2A68D 3H94A 2KUMA 2F4IA 3Q6SA 2MA9B 3HOVG 3ZNID 2L8JA 1RFKA 4XWTA 1D2BA 2Z8LA 3HOYG 4ANVA 4JWSC 5IP4D 1R4NI 4GDKB 5L95C 1XWEA 3S2DB 5KGUA 3KH0A 2Q2TA 2O6VA 1NUCA 1HNXQ 5HI1A 5C3WA 1AP0A 2BKRB 3HVDA 1S3OA 3EQLC 4DUYQ 2D3CA 2IY1B 2GLSA 1HUNA 1RD9D 1F9SA 2AEHA 3F2DA 5DPSA 3PO2G 3EFCA 4NQLB 3NZUA 2Z59B 1E8ZA 2WXLA 3NRZA 1SDFA 1QLBB 2VZKB 1JE4A 4I65A 4AYBE 5AUKA 3M3YB 1E7UA 4CGYB 3EA6A 1L0XB 3AEBB 4OO1I 3DM3A 5F2DA 1J7AA 1HZBA 2F0IA 5EBCA 2ZW1A 3SK4A 4LDTD 3A0JA 3TP7A 4PMBA 3ZTCA 1SB3C 4EZLA 1TY2A 5JVH3 3EIVA 1BXTA 1P3QU 1Q12A 1LTBD 1TYGB 3IVFA 5IYDG 3NQIA 3R2IA 5C4HA 5EPLA 1PZJD 3BYYB 3UDFA 2IX0A 5IYBG 2VH1A 4EKUA 3VDYA 1MFWA 2RCNA 3J9CA 3LWUA 2EYOA 3ML8A 4EGVA 2VW9A 3HOWG 3HOWB 1C4AA 1OTRB 1PH8A 3RLNA 2XEWA 1E24A 5JXVA 3Q3FA 3SE0A 2BOSA 4FULA 4X66Q 3NE5B 4DR5L 1I6HB 2YU9H 3H6MA 1QUQA 1X3QA 2JZZA 5GXGB 2MJ3A 4GSWA 3MXNB 3L54A 3SFDB 1V1PB 1IBLL 1PRTD 2F0TA 2J7ZA 3A56A 3W3AA 3M7NA 2I2YA 2QF7A 3AE5B 1JWSD 1NAPA 4PZ7A 4BOZB 1WTRA 2M4NA 3M4OB 2I07B 3ECIA 5JEAJ 2F0GA 4A76A 1F9RA 1K8MA 1WI5A 2F3IA 1V49A 2K01A 4A3JG 3JAMi 4A3JB 1PA6A 3EC8A 2EXDA 2KQ4X 3RLOA 1BUIC 3M85A 4WJNA 1YNTE 4ZUIA 1QT9A 5A2QL 2D11A 3GTLB 1SYGA 2WXHA 3Q69A 1DOIA 1Z5SB 1IBKQ 3QA8A 4PK1A 3ZUNA 3U52E 3T1YQ 2KK8A 3I5JC 1KD1C 2YU9B 1QE6A 1V2YA 3DVGX 3HM3A 3SK8A 4ABNA 2X38A 1PFMA 2KFKA 4KI0A 1GJXA 4HJKA 5EQ0A 2LD9A 2N7DA 4OEMB 2R3ZA 4LF7L 3W1SA 3ZKJC 1DZ1A 4RWSC 2NN6G 1X32A 1SFOH 3V61A 1X6OA 4WRDA 4FP5D 3B6YA 4FLHA 3QR8A 2VQFL 2ZPNA 4E3CA 1UGMA 3RNCC 2LGSA 2QCZA 3VUXA 1ET6A 3LXFA 2B29A 5EKKA 2P5ZX 5CHVC 4ANUA 2BYVE 1PDXA 1AN8A 2WNMA 1WM2A 1SR3A 5KHQA 2DNEA 1BQQT 4XE0A 3RNEC 4JI5L 5T1GA 3C2PA 1XNQL 4NXMQ 1RRBA 3AMZA 1S5BD 3MXPA 2O2LD 4EEWA 4FADA 3C46A 2EYMA 1Z9FA 3JAMc 3S17H 4JI0L 1JT8A 2N1VA 2NCNA 3AEEB 1EY7A 2KVZA 2MFIA 3BK1A 2RBMA 4ACFA 3G6JB 4JI1L 4CKBA 3K5MA 1PH1A 3VRBB 1IXRA 4IOCA 4WJPA 2KECA 1SFOB 3K57A 4X6AH 1D3ZA 3UF8A 3N1XC 1FNUA 2J4XA 1V80A 2HTHA 3AE3B 4KGSA 5C4XH 1YJWA 2WACA 3IFTA 1HNZL 3I4MG 3I4MB 2BW2A 1QVFA 1VQDA 3T3NA 2ES2A 3TJPA 5CMDA 4BS9A 2KDMA 3EVQA 1BCPB 1WOCA 2QKIC 4B9KA 1I4HA 4HCEA 4IUVA 3KLSX 1WR6E 4DR5Q 5JOBA 4NJCA 4DNIA 4HKZE 3NTIA 1WE6A 1UWXA 3A54A 3M4QA 4R4TA 4FA6A 2Q2IA 3CAMA 1KXLA 4K14A 1RWSA 1WGKA 5ELEA 4BBRH 1A70A 1WZ3A 1AFPA 1EO6A 1O7ZA 1PTOD 2MJDA 4YT0B 5C4XG 5C4XB 1YHBA 3TP6A 4DHJB 2K5PA 1T0RC 2LJ5A 1B2TA 2JQOA 4LUVA 3GZNI 3UINB 4A9AA 2YTYA 1N5XA 2DZIA 1TS3A 4JW0A 1N33L 2V1CC 3M4PA 4R4OA 3HOXG 1HCZA 4V190 1QB5D 2K5DA 2FUG1 4ZOHC 2EY1A 2F0HA 3T4AC 1MSGA 2F0VA 2JN4A 3EROA 1SEBD 3P4QB 4MM3B 3LNNA 4DXGA 1RAXA 3MP9A 5EE0A 3W2DA 2KCNA 3Q3NC 1Q7YC 4NAMA 4MGIE 5K36H 1S1QB 1SGHA 2PW5A 1G2TA 2KA7A 1JALA 2BYEA 2JU6X 2V0GA 3PT2B 3RLFA 3RUIB 2LUMA 1E0ZA 1XT9B 1N62A 2CR5A 3E0EA 3AXCA 3H6NA 3D8GA 4K5XA 4ZHOA 4DN4M 2MBHA 1WGRA 4JI5Q 3IRBA 3PUVA 1XNQQ 4H44C 5CV9A 4NAWB 4GOPC 1PV4A 2B2YA 4JI0Q 1IKLA 4K7UA 3KYCD 5E6PA 4AWJA 3UI3A 4BBNC 1IP9A 4JI1Q 3A7AB 5D14A 1DXMA 1C79A 3TUOA 5CX3A 3FMCA 3D4WA 1PH7A 1KJTA 3BYTB 3NS8A 2DHZA 4HDQA 2PJHA 1N6ZA 1Y1VH 4FDBA 4BBSG 4BBSB 3BDLA 2OJRA 5A35A 1MJEA 1HNZQ 3S2HH 4W9GA 2LVOA 4OL7A 2N3SA 1VF7A 2DBYA 2JX5A 2RVLA 1NYQA 1UGJA 4GOPB 4CJ0B 3GE3C 2INPE 1P7EA 2Z6KA 4DFAA 3G6EA 3HRZC 2K6DB 2GVAA 4G11A 3L9AX 3AI5A 5C23A 4ZRQA 1XEEA 2DNCA 1BKBA 3ZJUA 4USAA 3TRZA 4KTAA 2GN5A 1YIWA 1Q1EA 2EVBA 2O2VB 1CA6A 1LABA 4DV0Q 4N6EB 1S5FD 3X3MA 2L4NA 1I7HA 4MH0E 1STEA 2R93G 2R93B 3APCA 4HWIB 1V86A 4IALA 2WXKA 1MBYA 4I6PA 3VRAB 1Y1VG 1Y1VB 5J3BA 3H3VI 3S16B 2KCMA 4I7ZC 4KIKA 2N9XA 5HFYA 3S2HB 2YV5A 4FXCA 1YOVB 3TCAA 2PMZE 3RR5A 4K3BA 1N33Q 1JJ2A 3OMCA 3T9LA 1AE2A 1MG8A 1WSPA 4KY6A 5KRUA 2K0PA 3E9IA 2ZCCA 3NZSA 2MNAA 3R7RA 5C5MA 1PGBA 1SF0A 1ZXTA 3PIPA 1SNCA 3UDGA 2E2HH 1V5TA 2MX2A 3EHVA 3JC66 4ALPA 1S5ED 4E6IA 1E8YA 2CU1A 3WIMA 3ZNGC 3N1YC 2RDFA 2PE6B 1JOKA 5M5YH 1PVOA 5JAVA 3GOEA 1PFDA 2A4ZA 1BCPF 1PTOH 3EJIA 1FD7D 3LWEA 3PSEB 3HEJA 3VYRA 3DWQA 3AEVA 4OWXB 5JJKA 1PTOC 2ZJRA 2NVYH 2L9HA 4K8IA 2C5LC 2WP9B 1PZID 2ZCBA 3PZ8A 3BY4B 2DLBA 5H92C 4AS1A 2EQSA 2Y5CA 4GOCA 3AFQA 2W82A 1LLRD 1DM0B 5CGKA 1SJED 3GV6A 2JY6A 3ZLZA 1EY9A 5IGCA 5I2YA 2KWUB 4XIGS 3DBRI 3ZO5B 2K22A 3J80L 3ZJVA 5FLXL 5EE9A 2L15A 2E2HB 5IYCH 3SHQA 4AYBG 2VB3X 2G9HD 3BZKA 3W5OA 4AYBB 5L37A 4MH8A 1OXTA 3CRKC 1LO5D 3P4PB 4LNFA 3ZNZB 1Q90A 4A20A 3MHBA 4DDID 3J81L 2A6ED 3QWZB 1KLVA 5KEEA 4ZAIA 1U9RA 2DENB 3CU7A 1J9OA 3FPPA 4X3KA 3ZXVA 5IT9L 2Q8TA 2UXCL 1STHA 1WJ6A 5HG2A 1HZ6A 1Q1OA 5C0XG 3HKSA 3W1YA 5CHFA 2GBRA 2N8NA 4QMGA 5HHDG 3UE0A 2VUMH 1XO3A 1OEYA 4HJ9A 2KTRA 2HT1A 1EY5A 4IFDI 3KDFB 3STBD 2HCIA 3V2TA 3Q8EA 4TV3A 4KV2A 3U7DA 1CHQD 2NZOA 1V8QA 1ONLA 1PH5A 2NR2A 2B2VA 3DVGY 1GD7A 2C7HA 3ICEA 1K3BC 1PUTA 4DV7L 2NTTA 2M1MA 2E6XA 2QDFA 2KOXA 1VRAB 3KUDB 4BZAA 3NTHA 4RKBA 3SXHA 4EQNA 3I91A 2DAFA 3C1EA 4RF1A 1UE5A 2QSDA 4GN5A 1KFYB 3IXSA 1L0VB 2JPHA 4J6IA 1HJPA 1E7ZA 4IN3A 1K8GA 2K33A 2WB1E 1VD2A 4JX1C 4L2YA 2KAJA 1E22A 1SE4A 4KMUC 1E5WA 3VH4B 3DXJC 1XXGA 3PF4A 1AARA 3QHTA 1TY0A 4CDCC 4BKSA 1VQBA 4LCDE 3MEHA 4LF6L 1XLPA 2AX5A 5C1ZA 4YTMB 2L76A 5C3EH 2DAJA 4M1UB 3X3NA 2FNJB 3SR1A 3QOJA 3N52A 5DM63 2R92H 2I5MX 5M3FH 4W9FA 1V5OA 2F0UA 1XX8A 2EPBA 4JI7Q 4PS8A 5AZGA 4K6LA 4RKLA 1IKMA 2IGGA 3WAMA 1N32L 2D0OA 2VXWA 2IWHA 1SE3A 3JAME 3C19A 3UDXA 1OXUA 1VZ8A 2PQAA 4P73A 1B9MA 1VQ9A 2KN4A 3HKZG 3HKZB 2BBCA 4A3IG 2V4DA 2Q8RE 4A3IB 1KIXA 1V97A 3S15H 1T6BX 3DHGC 3VFKA 1RTOA 5DNFA 2MRPA 1H9MA 1QNKA 4K3CA 4M8NA 3IAM1 1GB4A 2ICIA 3F1ZA 2DZKA 4II2B 3TMEA 2WDQB 3A9KB 1FCLA 1PDQA 1M4VA 1UUPA 2UU7A 3N30A 1GM5A 3HFZB 2OJWA 1L1OA 5C3EG 5C3EB 1Y69U 5FLMH 3GQBA 2WU5B 5FR3A 1WXSA 1B3QA 3QG1A 5EPKA 4ICVA 2R92B 1UEBA 3WWVA 2O6VD 4LF4L 2D2CC 2EDGA 5M3FB 2JZPA 1Q81C 1K0SA 2KLGA 3H9DA 4LJOB 4GN4B 3GTKB 3PREA 3DQVA 4G3XB 4IM2A 3JYUA 4IOAA 2QW7A 3FP9A 2F0DA 4JCVE 2WAQG 2WAQB 1WTVA 5D94A 4DV3L 3T8MA 5ELOA 4PYUA 4YSZB 2PW7A 1IBML 1XPUA 5HY6A 4HR7B 5IP7G 2UXCQ 2RSOA 1EIFA 2F03A 1FCCC 1WX7A 2A5UA 2LASA 4K1RB 3VHTC 3QJYA 3VQIA 3JVZX 1R9TH 4B95A 2ATWA 1JOQA 2G3QB 3FAHA 1KNAA 3ABVB 2KMMA 2D07B 4L1BA 1YHAA 3ZRFA 5BN3A 1KRHA 2NZHA 1IYFA 3FKIH 4P6VF 2TSSA 4RMAA 3GE8C 4FO2A 2KKCA 2KNBA 4GDLA 3VR3A 3FRPB 4DR3L 3HM6X 3OIPA 4YWGG 1GNUA 5HGTA 2ENBA 3K58A 1QOBA 2RMMA 4A3CH 4FXGC 1E2WA 4DV7Q 2BA1A 4A3EG 4A3EB 1VCBA 2CKHB 2EOTA 2W9NA 2O5JC 3HOUH 1YN3A 3GTJH 1A2TA 2C7MB 4JI6L 4HCNB 2IBIB 3I63C 4KD3A 4RNAA 5KHOA 3K5NA 5LXIB 2JA7H 2MJEA 3A55A 5GQOA 3FILA 4OVVA 2NVUI 1WD0A 1DOLA 1ZXIA 1R9TB 1QZEA 3CPWA 3PTFC 5AUIA 2WXOA 1H9JA 2BE5C 4O2DA 5CV5A 3RN2A 1P1AA 1UBQA 1N36L 1LTAD 5I9OA 3M63B 1WTWA 3FKIG 2R7DA 3FKIB 2UXDL 2PE9A 4BY7H 1NY4A 5ELBA 2X6LA 1YNNC 4QJFA 4JI3L 5ELNA 3SVMA 4A3CG 1DD2A 3UQAA 2QHOA 2GI9A 4WAAA 2UUBL 4CO7A 2DZMA 3L3OC 4PS7A 4TRDA 3GTJB 4WFN3 3NBHA 1N32Q 1IL2A 3IT6B 3ER0A 1OXVA 4IZ8A 3AYHB 3TREA 2JA7G 1QWYA 2JA7B 2FIFA 4C3HH 3ZTDA 1E1TA 5H8YE 1B7YB 2MW5A 4I7AA 4PNYA 1KF6B 2AWNA 4ZLTF 1E2VA 4HJ7A 4II3B 1TWHH 2F0KA 3OMGA 2IL8A 5DLQE 5IGBA 1WXMA 1WFYA 2IGDA 4EE2A 2E2IH 4N58A 1MI2A 4BY7G 4BY7B 1EL0A 4IJHA 4TQ1A 4WH4A 2JRHA 1N60A 4YHHL 1H9SA 1R4QB 3HP3A 4RCNA 3NJTA 2JF5A 3TP5A 3WOEA 4LF4Q 4KJOA 3RN9C 2O4XA 4A93G 4A93B 3DHQA 2MHVA 1RODA 2D5GA 2OXPA 2FCQA 1JR0D 5D3DA 3BZDB 4KKTA 3HHMA 4DV3Q 2KWVB 2EYHA 4IPDA 3NTKA 1Q8IA 2K5WA 1VQIA 4EX5A 1XF5L 4CKCA 2C60A 2MQJA 4XX5A 5DPWA 3LJ3A 3DVNU 3LYYA 1TWHB 4X57B 1J8CA 4HVBA 2CQAA 3CF5A 2M8SA 4AP4C 4KKJA 2F0LA 1EQRA 2WIIB 3CF6E 1DCZA 3CCEA 4DR4L 2MBEA 2RCFA 2LGYA 1WTOA 4LTUA 1IBXB 4MGYE 3RNGC 4FXKC 1X56A 1BOSA 1D8LA 2ID0A 4A3MH 1ILPA 4RGMA 4DR3Q 2PPBC 1TJEA 2KC1A 3V6EB 3PIOA 2G9DA 3TEZA 2E74C 2L1AA 1R4MI 2PEAA 1NR2A 1PYBA 3B0AA 1TWGH 3W9CB 4C4VB 4JI6Q 1TTNA 4B9WA 5M9OA 4QQBX 5E4WC 4JV5L 1P0RA 2K50A 4LJZC 4DR1Q 3SEBA 2A8VA 3C1FA 2PMZB 1IGCA 3ZNHB 4DDGD 4ICUA 1F0ZA 1WD1A 4HMJA 1UZXB 5CHWA 2IHFA 4JK1C 1M1KC 1HTQA 3TEXA 5FO8B 4WWMA 4ARIA 1MPEA 3KOJA 2V3SA 2E3TA 3E6ZX 1N36Q 3S1QH 2JXMB 3NEMA 2NBWB 5CV8A 1YJ9A 2JZ3B 5L83A 4EFOA 1QJOA 4RA8A 4A3MB 1K8OA 2LWPA 2F0FA 3FC4A 4JI3Q 2M00A 4IPCA 3RZDH 1EOVA 4CDEC 2J53A 2NS5A 2GBNA 3TS0A 4N59A 2UUBQ 1D5MC 1FVIA 1EQQA 3S14H 1V8CA 2ZNVC 4OO1H 4ITKA 2ASQA 4ZUJA 3Q14C 1LFDA 4ME5A 3KF8A 2KQ3A 5C6AA 5IY0A 1UH6A 2HDEA 4K7WA 4H7BA 1GKHA 2YTVA 3CSTA 2A6HD 3I73A 5COYA 3PS6A 3I2ZA 2VH2A 3AECB 3S1QB 2LMCA 2LVPA 2REXA 1ML0D 2L55A 2Z0SA 3GP7A 4HSPA 1QOFA 3AMUA 3GB1A 2BH8A 1MHWC 5JEAG 1JB7A 2QIEB 3Q8DA 5AZFA 4LUOA 1Q5WB 2WDTB 2ZNVB 4XYCA 4WJ4A 1VF5C 1C1YB 2SNMA 3R3MA 1HQMC 1C9FA 2KCCA 4NPSA 3F2CA 4DXFA 4ID6A 2N78A 1XMQL 2IDYA 3N32A 4PS3A 1W6KA 1AZQA 2OEDA 3GTOH 4Q5VA 3GTPH 4GNXA 3S1MH 5D2MB 3WAOA 2VS1A 5EPJA 3DEPA 4Y7NB 3G4SA 4JPSA 1DGSA 1T5EA 1E6EB 4XTCS 1WGHA 2MP2A 1KH0A 3CCRA 2R7ZH 3TMPB 4ANXA 4LFBL 1HHVA 1HUMA 4J3OD 4JYAQ 4OIJA 1CK1A 4MJSA 1AZPA 1YIJA 5LMUQ 3CCLA 4DR4Q 3D4RA 1EIHA 1NNXA 1K28A 1ZPSA 2NVTB 1RHPA 2XWBB 4BY1G 4BY1B 2I1JA 2BS2B 4K81A 4KK7A 5G3LF 2QEJC 4ZRZA 3ZQ4A 4DF7A 2ZXPA 5E7NA 2JEAI 4TQUS 4DAPA 1BCPD 1HQRD 2INDC 2LI5A 1EWHA 1S40A 5G55A 5EDSA 1V1QA 2Y5PA 4ZRJA 1R4PB 1I4GA 1WE7A 1A15A 4US9A 4D2KA 3AV8A 1EF5A 1JC7A 3AM9A 2JJQA 4ZQ3A 4FF2A 3W1BA 2OWOA 1B4OA 3I9V1 3FHWA 4KZCA 2WB1G 2WB1B 2WX0A 1VZ6A 3BVZA 4QUFA 1G2SA 3PRMB 4BWGB 3U58A 4RF0A 1I6VC 1E10A 1XCQL 1G6ZA 3DOWA 4DHJD 3MHZA 1NENB 3ND9A 5C4JH 5EKLA 4JI2L 3VR5A 4WJOA 4DPGA 2I5LX 2E2JH 1PH6A 5IIFA 2D10A 1ROEA 2RD0A 1EY4A 4HN7A 3M3JA 4N9F4 4JWUC 4AQYL 3KUZA 1ICFB 2UUCL 1WXQA 3NBIA 3WCQA 4WORA 3AE7B 3QIJA 2CWPA 2M2LA 3VXWA 4YWLA 2F0NA 1L2NA 4G50A 1D5ZC 2L12A 3M62B 4WJQA 2L83A 1L2FA 4GLXA 1Q86C 5BMGA 1LTGD 2B63H 4KY5A 1TQOA 3CRLC 5I6WA 4X64L 1IZ6A 1P7FA 1ZP0B 3B2GA 2N4FA 3I70A 1YNXA 4V0BA 3ERQA 1HZ9A 3ZJTA 1SXTA 2JK8A 1X9NA 2AQ3B 1XMQQ 1K51A 1U4PA 4DKAC 4GLSC 4NZLB 5AZHA 4O42A 5J2RA 4M01A 4CYEA 3TEHB 5H1SE 1H4RA 4NB3A 2BGFA 5BMHA 4P75A 2Z1CA 3P20A 4XYOA 4OX9L 3LB8C 1JB3A 3G7LA 5AJ3L 2FAZA 4KJNA 2V3NA 4L8JA 1I3QH 3Q8BA 2HDLA 4HSVA 3CCUA 3GD7A 4K6DA 3PV0A 2OQ0A 4GDKA 3WDNA 4IO9A 3K0XA 1W2BA 4KKUA 1VQLA 2JYEA 5IP9H 4YSYB 2B63B 4AUQC 4K8JA 5J1ZA 3IHPC 4HCSA 2NBFA 3O65B 3Q3MC 2CVRA 4C2MH 2LGXA 3VUWA 2WLBA 1ZEQX 2N49A 3PUWA 4N9TA 3D0FA 1ASYA 4DHZB 2BYTA 2LKVA 4YL8A 4FF4A 4JLCA 2RPVA 4EQPA 3BIID 1YJIA 1ZYRD 1EYAA 3MXUA 2W3RA 3A4RA 1C4PA 1FGUA 1TKYA 4ASWC 1AEXA 3DHHC 2RDBC 2W55A 2XGTA 4JBMA 4HPPA 4KLKA 3H1UA 3HUIA 2LHDA 2EIFA 1TKGA 1J5EL 1JWUD 3T3OA 1ACCA 2B2YC 1UE7A 4LK1C 2A68C 2NVQH 3HOZH 1GB1A 1TS2A 1YZ6A 4M0WA 5DAUA 1KL9A 2V9HA 1BDOA 1LT6D 2EY2A 3U8ZA 1C78A 1YITA 1E7VA 2B2WA 2CHZA 1EUJA 3PVLA 4IUMB 3KWVA 4HIKA 1LM0A 1IGDA 2RA4A 1EZ8A 3PHWB 2IHEA 2DUDA 3E9HA 1MGSA 4A3BH 2F0EA 3SK6A 3S17B 3VDZA 2Z6KC 1SNPA 4AQYQ 4C1NI 4HCPB 1BR9A 2CKZB 3K80C 1FM0D 4GXBA 4NQKE 2CW0D 3MXNA 2UUAL 1UBIA 4G0NB 4BKSD 1V1PA 5ELDA 1FYCA 3AE9B 4J8QA 4IUQA 3G71A 4W9CA 1CZGA 5JH5C 3D6CA 1IBLQ 1XD3B 3NY5A 1VQ5A 2KHWB 3PGEA 1NBWA 3DWAA 1FL0A 4X64Q 2FCNA 2KWCA 3J7ZC 4MSQB 2NN6I 2N9KA 3PO0A 5E4XA 1CSQA 4C1NK 5IO9A 1VQMA 2QEXA 1C0AA 1PGXA 2K52A 5JPMC 4FJVB 4H13C 4A3BG 4A3BB 2E2DC 2Z4IA 3CW2C 2QJLA 2AMCB 2CQOA 5AJ3Q 1CQFA 1K53A 2AYOB 2B8GA 3BS1A 3H3VH 4LDTB 1MVKA 4X3UA 2NUCA 2WX1A 3OAWA 3S2AA 3QB3A 1IYUA 2MH7A 4MDKE 4YXDB 4BBRG 4BBRB 4LF7Q 3H3VC 2DYBA 3NZ3A 4C80A 4LNKA 4R4QA 4HRSA 4AJYB 2HUGA 1PRTC 3R7QA 4ZK9B 3TIXA 2VQFQ 4L63B 4CJ1B 4RH6A 1UAPA 4U673 3KF6A 5G5GA 3R2TA 1BBWA 1ENAA 4HJAA 4LW1A 1Q82C 3PUXA 2EMSA 4KHZA 1PH4A 4A3GH 3WALA 3KLSA 1TWFH 2N0SB 4JL9A 3ZDTA 4YWKA 4HPMB 3R3OA 4IW0A 4L23A 1VQHA 3CCMA 2XK5B 4M02A 4GU2A 3RZFA 1JWMD 2IYDB 5AEKB 3AB9A 2AKWB 3D6WA 5KYIA 3P75A 1J5EQ 2TMPA 2JA6H 3VH3B 3ZRCA 3CMEA 3IAYA 5CR3A 1CKNB 3KK7A 1LACA 2K25A 2R6GA 4IG7B 4KSLC 2F0PA 5K36G 2E76C 2ZZPB 3W1GA 3TS2A 4G7HC 1SE9A 1WYGA 3HVZA 1IW7D 2DGYA 2UXBL 1O78A 1K9MC 3V3XA 1D4BA 1PYSB 1S5DD 5FR6A 4A3GG 4A3GB 4F7XA 3P2BA 1P8LA 4XQJA 1QOAA 2KO3A 3J7AF 1O7IA 1I50H 3VA5A 4JVZA 4HKQA 4RCOA 2KHJA 2NPTB 4WWOA 3B08A 1TU2B 1I5FA 4IWOA 1NJIC 2JA6B 1DOKA 4UPAA 3ETRA 2JT4B 2HJ8A 3F2BA 2KTFA 4HK2A 2MBQA 2LEKA 3PO3H 4P72A 1YX5B 3CQZH 1DYQA 5IODA 1BBUA 1ZDVA 4OZCA 2FIDA 2Y3AA 2EE1A 1EYDA 2B8FA 1HH2P 3M7GA 4AH6A 1K8AC 3GTQH 1SSOA 1I4PA 2JQRB 4GGQA 4A3PA 2RR9A 1C9OA 1WY8A 3VR8B 3NVVA 1WM3A 1NMGA 3S1NH 3ENEA 3K0YA 4GKJL 1HE8A 2LY7A 1WMHA 4IFDH 4P16A 2KDFB 4C7ZA 1OO9B 2MO0A 2CHBD 2E5LL 2KTRB 4DR7L 3VR4A 1Y8PB 2MGSA 1HTOA 4MM3A 3R93A 2FCSA 2HHHL 1VQCA 4PZ8A 1ZUD2 4YCVA 1BO0A 4HPLB 4ULLA 3PIP3 1ZXHA 1KDAA 2KANA 3SDLC 1TS5A 2KDIA 3RCZA 3CQZB 4PMWA 1AH9A 1X55A 2K6AA 2PTLA 1VQKA 3BINA 2N88A 1W3SA 2YTXA 4IM0A 4EZJA 3PQIA 3MFYA 2JEBI 1YQBA 4HJ8A 4GIVA 2KHIA 1B8AA 4DAVA 1A6XA 4ZKBB 1F2MA 4O0AA 4NAWA 1Q46A 4JG2A 4H2AA 1PLFA 2PZTA 3FVQA 4BOSC 2BS4B 3KYDD 3ONSA 2IX1A 3SFEB 3I72A 1ZGUB 1J7CA 3OWEB 5D6JB 2K14A 1TR5A 3AE8B 4A3OA 2YVCA 3I7FA 3I8ZA 4XGAB 4G7ZC 4JI8L 5M5YB 3NK9A 5FOBB 4YTNB 1PTOB 1RM6C 3BDCA 1L1OC 1YNJD 2V4LA 1KM7A 2MLBA 1VQNA 1VQJA 4GN1A 4CHKA 2KJHB 2NVYB 3DBHB 3ZGZA 4NMZA 2JYOA 4GOPA 2UXBQ 4TSSA 1PH9A 1WRDB 3UIPB 1JMCA 5FK9C 1MG4A 1KHIA 4KGTA 2V4IB 2FBWB 1Z2MA 3TL5A 1EEFD 4FVMA 5K5PA 3GV3A 2AL3A 1SNMA 2BWFA 3BU2A 3VR9B 5IYCG 2EELA 2EYFA 4KN4C 4A3LH 2ICEC 3OHXC 1SMXA 2MWSB 1L1OB 1PHJA 2B3GA 4DXAB 2INNE 4DQOC 4CJ2C 3NQTA 3TN2A 1WCMH 5M3MH 3NUCA 2NYZD 1BNZA 2Y0SE 1WX8A 1XYIA 2KWDA 2WXQA 2ZEQA 2WWZA 4HJ5A 4GZYC 2N9EB 1XTCD 1QILA 4ODGA 2K32A 4WJ3M 3EBEA 2NMQA 3VR2A 3IFWB 1JROA 4K0KL 4W9EA 4MN3A 4UY8C 1HNWL 1EM7A 2BT6A 5C3XA 1SSNA 3O13A 2M17A 3U30A 2PQEA 5G3LD 4GKJQ 1STGA 2WDRB 4BAXA 5JHBA 5G5HA 5IKCM 3K8AA 4TKNA 1VQAA 4NP5A 2KYWA 1GO3E 2RQXA 4GLVB 4RGOS 2PCFB 2VUMG 2VUMB 1FXTB 2E5LQ 1CZWA 1A0IA 5M5WH 4A3LG 4DR6L 2SOBA 2XN9C 3CMMB 2JYTA 1E1OA 1Z47A 2HIXA 1DONA 1EOTA 1OEYJ 1K3RA 1MJCA 4OWWB 2GB1A 4WQMA 3J81i 2HHHQ 1VQFA 5M3MG 5M3MB 3VYTA 1R7SA 1OGWA 2G45B 3PLVA 2V1YA 3VUYA 1RDPD 3BVGA 1XJVA 1X1MA 4BBNF 1TZOA 1STBA 1WI0A 2KQSA 2MPMA 3NENA 2IX3A 3AULA 4E71A 1Y56A 4HDOA 4X62L 5LNK1 3D3RA 1EU3A 3JSVB 2LZ6A 4XDDA 2ZXOA 4YWMA 3H7PB 3FILB 4KHPL 1PZKD 3ULLA 1SE8A 1XLNA 1GPXA 3H7SA 1Q1BA 3DDCB 1F2RI 4IFDJ 1GUOA 4DAYB 1CKMA 1EEID 4WWPA 5M5WB 5CC4A 5C0XI 4HLEA 4OIKA 3J80c 2IZVB 5FLXc 1CUKA 1VMPA 3A1QB 1HZAA 3IAS1 4J1MA 3MZ5A 2EYJA 3P1HA 1YJJA 1SMYD 2R92G 1QOHA 1BMLC 2ASBA 2K8BA 5ELFA 4MTKA 5M3FG 1K52A 4FBJB 1TBEA 5IWAL 2UU9L 2VRRB 1M8AA 4A75A 1AYFA 3J81c 4LF9L 4UP9A 2IO2B 3DWPA 4W9IA 1TGZB 1K50A 1TXYA 4X65L 3MC8A 4OZAA 3T13A 4JBJA 5IT9c 3LDZE 2C9WB 1WJJA 3OSOA 3K9PB 4ZRIA 3S15B 1D7QA 2BA0A 3E3XA 4DV6L 1WR1A 1YN5A 3KBXA 5LL6S 1LV9A 3NVZA 2EMTA 3H8HA 1I4QA 3KQ4A 1F9QA 5JPNC 2KFJA 4R4CA 5GADC 1ISNA 2N9LA 4A55A 3U7ZA 1TT2A 1GHJA 3PF5A 4MT5A 3H15A 1KRSA 2ZTEA 5FLMG 2EYPA 2EXZA 2BCOA 4JOIA 2I0QA 1ZKHA 3KBGA 1J0GA 1F77A 4KDLB 3VYSA 4XYQA 1D1KA 3PHXB 5J17A 2Z0EB 4W9HA 3DEOA 1FRRA 1FRDA 3L2PA 1OQYA 3MTSA 2K03A 2A6EC 2LSSA 2WXPA 1QKZA 2D2QA 1Y14B 2XIWA 2BKFA 1TWCH 5A2QE 3C8YA 3T1HL 2EYLA 4POFA 5LL6X 3DBLI 1XMOL 3DLLA 3A8JE 3TBLD 1II3A 4DBGA 1SYDA 1O80A 4KHVA 1BVSA 2H4OA 4LAAA 3CD6A 1PFBA 1KTKA 3PMFA 3RNUA 4LWCA 3QC8B 1D1IA 4DR6Q 1SIFA 3HK0A 3Q2AC 3T56B 1PH2A 2JA5H 3DM1A 1H9RA 3T16A 2LGDA 4LF6Q 3I4NH 4YTPB 2IO3B 3STBC 3VTUA 1UD7A 3PRZA 1PMRA 1SNOA 2PPHA 3NHEB 1NMFA 2R7FA 1XCTL 1VLBA 3UQBA 1EUVB 3HOUG 3HOUB 2LS01 1FFUA 2KX3A 3B1LX 2MCNB 2IJ0A 4UHVA 4YY3L 1HA6A 4X62Q 5CTRC 1LT3D 4RFBA 4HIDA 5DEHA 1T5XD 3A74A 3WANA 1WGYA 5D3IB 2QA4A 3AQQA 2UYZB 2LGIA 5E3FA 3EFUA 1NEKB 4PZ6A 2BDNA 1NBFC 3A9KA 3QO2A 3AE1B 4ARCA 1MHXA 1DOYA 2F3WA 5FO7B 2GOWA 3MC0B 3Q23A 2OTLA 2ACZB 2K28A 2CU3A 3RPFC 3N3KB 1KAWA 2JVCA 2R2OA 3I4NG 3I4NB 3SGIA 3D31A 2ZXRA 3Q6BA 2JP1A 4JI4L 3K7AH 3LX0A 2VQEL 1CSPA 2UU9Q 4WURA 2WGSA 4LF9Q 4G57A 3RNAC 1CT1D 1VQOA 2L0CA 5C44H 3KF8B 1T3QA 1WZ0A 2VZKD 1SLJA 1NYRA 4X65Q 2WS3B 2L0TA 3X0WA 4GNXC 1IBMQ 4C3HG 4C3HB 4DV4L 3AH7A 2CHWA 4IM3A 4NPNA 4KN7C 4IDIA 3WA0A 2F0MA 2NBVB 3ERSX 1S4ZA 2DYMA 1X3GA 1YN4A 3MXGA 3I3CA 3MAQA 1YVCA 4DV6Q 2JA8H 1Q3LA 4B3TL 4K2LA 4YCWA 1KRTA 1N61A 3B9JA 1TS4A 1I94L 2E2IB 1WXAA 1V6EA 4A3DH 2WU2B 2Z9HA 4EQ5A 3ONAB 2CH4W 1QOGA 1RF2D 1WFQA 2KEDA 5KYLA 3V6CB 4QCLA 2KACA 3CC2A 1VCIA 3CCQA 4XZ4A 1JQYD 2GVBA 1T0YA 1FGBD 5EAYA 1E7PB 3I3TB 2KZRA 2D3AA 1XQQA 1JCKB 4BA1I 3PIO3 4CHTB 1HTPA 4FNFA 4NXNL 2NZ1D 3TEWA 4YIJA 2OQKA 3T1HQ 1CA5A 2WYQA 2FINB 1XMOQ 4FYDA 3A9JB 3DWGC 1SAPA 1B9RA 5C5LA 4GN3B 5T8IA 1JRPA 5CBAE 1CTMA 3EN2A 2JA8G 2JA8B 2L11A 2FE8A 1YI2A 2LXCA 1Q8KA 2G4DB 2AUJD 3GO5A 1LXDA 1PQSA 1LTLA 2UXDQ 2FMMA 3OOCA 3C0RB 2QDBA 4KY7A 1EYGA 2O6VB 1B1ZA 2XRQD 4A3MG 2CFMA 3IL8A 3A33B 2EY5A 2KX0A 5E6NA
chains in the Genus database with same CATH topology
4CBVA 1NI3A 3ND8A 4KKIA 1UWMA 1TWGB 5JJZA 1JORA 4C7YA 2SAKA 5KNDA 1L6VA 2K5QA 1Z6HA 3N9YC 2N7JA 1EQVA 4R8NA 3NPPA 1HFGA 3NWSA 2JSOA 2PVOD 3W5VB 1D6EC 2EJGC 2BTEA 1ICWA 1ZOYB 1IL8A 3RZDB 4OGQC 3S14B 1SNDA 1CI3M 1STYA 5NUCA 3HGBA 4OO1G 3E9SA 1EYCA 2DY8A 3NVWA 1CHPD 1FXAA 2FHTA 2QMTA 1EIGA 1KDBA 2B2TA 2WXMA 3ZYYX 1O7LA 4A8XC 3P42A 3OW7A 4CKEA 1UNSA 4B08A 1GUSA 1IBXA 1JICA 4R9WA 5M5XB 1L6UA 3P1MA 4DNTB 1SIJA 1OQQA 2Y0SB 1FMAD 1TKWB 1EZ6A 1ZE3D 5C3JB 3GTOB 3GTPB 3S1MB 4IOIE 2LHEA 2F0SA 2B2UA 2DN8A 4HAEA 3HOVB 4C56C 5MPOA 3HOYB 5ISRA 2R7ZB 5CBEE 2NWGA 3AE2B 4ZKCB 3TEYA 1RKNA 4MHEA 4G4KA 1WTXA 2NTSA 2H89B 3BWUD 3AB5A 4OHJA 1SYBA 1AWDA 1Z7TA 1J8IA 3PO2B 2WXFA 5E1FA 3JAML 2WKDA 2ONQA 2B76B 1U4LA 1A2UA 2B2WC 1F2YA 1B50A 1K83B 5I6YA 3SK5A 3J80E 5FLXE 5BN4A 1X3PA 2PLPA 3H09A 3R8BA 2BB6A 3QOLA 5IGGA 3NWTA 3TZUA 2JE6I 5EKIA 4UAIA 1JMLA 3J81E 3MJ5A 4X3TA 3VR6A 5KNCA 2HQEA 5BYSA 5TSSA 2VNUD 5C4JB 4K5WA 4KGRA 4XDXA 5IT9E 3URYA 4IUUA 2E2JB 5CV4A 1A3VA 1C48A 4MIUA 1V1OA 3GS2A 2M19A 2WDVB 4LLGM 5CV6A 1VMCA 3PUZA 4TMAB 5J22A 3RFZB 1EY6A 3RD4A 4RHRA 5I4DA 1RJTA 2NN6H 1IYVA 2A6HC 3Q8FA 3CIRB 1C4QA 2QCPX 3OIQA 1QF6A 4CQNA 4K2KA 3K5LA 4HEA1 2PZWA 2NB0A 1YQ3B 1NVID 2V3PA 3IFDA 4ZHPA 5T1IA 1DGJA 1EWCA 5E6JA 1FO4A 1Q10A 5DM73 1I3QB 2PVGC 1V43A 1RTNA 4US8A 1HEZE 1B9NA 1SYEA 1TWAB 2F0WA 2FFKB 3CKIB 4C2MB 4MACA 3IKJA 2PIAA 1D5XC 1CZPA 2K04A 3Q24A 2OHFA 5HURA 1L5PA 1BCPC 2MJ8A 2C9OA 2NVQB 3Q22A 3HOZB 2XNAC 4O1NA 1VDZA 3GTGB 1Y1WB 4IKGA 2EZVA 1B3AA 1VDVA 3EUB2 2XVSA 2BB5A 1L4DB 2J42A 3L7ZC 2NVXB 2WXRA 2KOLA 1C77A 1ET9A 4RGTA 2IW3A 5BYQA 1KDCA 4ZRPA 2PMVA 4LMQD 2X6GA 1EQTA 5FO9B 1HA5A 2JXTA 3AEGB 4XWWA 1SBBB 1C76A 2WKCA 1PXUA 3L4PA 3QWNA 2KJXA 3I90A 1IHZA 4XQNA 3HOXB 1SE2A 3WOFA 2DWQA 3MFGA 4M8AA 2WQYB 4RGNA 5BYRA 1I4XA 1KLUD 2ZT9C 1SYFA 1QG7A 1NSNS 1DOXA 2WP8J 1ZDXA 1KLGD 1PRTB 2SEBD 1ENCA 2FMCA 2B39A 2DYOA 2SNSA 4Q0FA 5CYUA 4FXDA 1F2ZA 2L1BA 2JSVX 3J7YW 2LFNA 1WRIA 3Q0AA 1TWFB 3BK2A 3T51B 4A6QA 2PO4A 1F2LA 1WTQA 1ZYRC 4F88A 1S5CD 2YYZA 2IGHA 3MA2B 3KLRA 1EWYC 4IUTA 2K9XA 3F2UA 5J39A 4FF1A 2A73B 2HDMA 4B0EA 1SYCA 2B2VC 1MD2D 3N6RA 1KAAA 2M0AA 3EGRA 2E75C 4J6HA 5FKAC 1LT5D 4QUCA 3VA7A 1STNA 2WXIA 1KABA 3CHBD 1ESRA 1HFNA 2F1MA 2ON8A 1I50B 2MP1A 2K3UA 2F0OA 3E5SA 5IGDA 5IGFA 3TP8A 4U68A 4G7OC 1FEHA 2F3VA 3VQIA 1LT4D 1DJRD 1RYJA 3AU7A 2CW0C 1ZKOA 2A5HA 3TSSA 3PO3B 2PZUA 1VZ7A 4WIPA 2X69A 1A3TA 2EJFC 4WAFA 1L0YB 3GTQB 1VJKA 3FPUB 4XXEA 2R61A 1BF4A 1GXDC 2GRIA 3U2SC 3AE4B 2A74C 4NW2A 4IUPA 1GUTA 4JE3B 3S1NB 1MI0A 4IFDG 1CFMA 3Q8AA 3D4DA 1FR3A 2KEEA 4QIWB 1N5WA 5IOCA 1C8CA 3MVVA 4DK0A 1GAQB 5LHY1 2MEKA 4ZYSA 4HMIA 1OFFA 5EGTA 1GUGA 1LTTD 2DY7A 3H0GB 4Z9CB 2F0JA 3FEWX 1B53A 4DNRB 2MUYA 5C0XH 1F2RC 2OF1A 3NXWA 1IUEA 3AE6B 1HXYD 4DA2A 1A3UA 3IT4B 3ITPA 4F8MA 3V96A 2D9UA 3HG9A 3I4LA 1G291 2ZW0A 2EJMA 1HRJA 3VYUA 2EY6A 4HEDA 1HZ5A 3SHLA 2GA4B 1O7YA 3NHHA 2VB2X 2AWOA 3W5UB 1AW7A 5EE1A 4KKSA 2BE5D 3PUYA 4QB4A 2G1EA 1IW7C 1PRTF 1I4RA 3A8IE 3HRDD 5C2TB 2C5CA 2WV6D 2CJOA 1YNND 3A7LA 1WWTA 2HCCA 1H9KA 1OQRA 4GDLB 1FFVA 1WVLA 1U4MA 4KV6A 1WCMB 1U4RA 3MWYW 1UEAB 2K7VA 4C3IG 4C3IB 4P2CB 5I2XA 2RSNA 2EKIA 4PV1C 5JVG3 4HROA 4WJWA 3NSWA 3NVYA 3T53B 2J52A 4DK1A 4IURA 5BMIA 4FF3A 1Y8NB 5I9PA 1JOOA 3C3LA 5EE3A 2XWJB 2PW9A 3H91A 1SJHD 1EY0A 1OXXK 2K05A 2K1BA 4S3SA 4PMCA 4R3DA 1ENFA 2N55A 4NKLA 3Q8CA 2Q8IB 2XRSD 5KNBA 3RZOB 3KUPA 1F9PA 2WXNA 3RMHA 3U9OA 3P7JA 5CORA 3TBIB 3BDOA 4C3JG 4C3JB 2OT2A 1EFID 1LTSD 1PYWD 1WTPA 1H9SB 3AN1A 4XDCA 2H88B 1CM9A 2PNRC 2FJ2A 2L52A 4IUNA 1FNVA 3V05A 1QCBD 1B44D 3J7AV 1RCVD 2WXJA 2WINB 1YNJC 4BA2I 3AEFB 3S9WA 1PFNA 2W54A 2J0TD 2SDFA 1TVXA 4EVOA 2AQ1B 5C0XJ 1PTOF 4QF4A 4N9PA 2LJIA 2QILA 4ILWA 3GTMB 4L6TB 3BG3A 1J7BA 1E9MA 4XT3B 4PQXA 2HTME 4HJGE 3OWFA 2M9VA 1BBXC 5AFWA 4R8IA 4OVZA 2H1EA 3PZ7A 1TWCB 3NS1A 3E56A 4F87A 2YEPB 1TKEA 4YSXB 4DAYA 3NUHB 2IPKD 1CQVA 5IGEA 4LK0M 3KWLA 1QNUA 2JA5B 2KHSA 2PKOA 1EU4A 1N63A 3U4EG 5ELCA 2D5DA 2Q5WD 3S1RB 5EJWA 1EY8A 5BN5A 2A69D 4Q2JA 1NR4A 3BVMA 3OPOA 4UDUC 2D62A 4HTHA 1XLQA 2CJNA 1W6JA 4B0MA 3DUZA 3P4RB 1PGAA 2I38A 1VR9A 3U9SA 5KIXA 2LMCB 2B2TC 3P63A 4OW0A 4PT5A 4XQQA 5D7GA 4DU9A 2I46A 1SMYC 3K7AB 3K5OA 2L32A 3CWIA 5D65A 1E0BA 2AUKA 3EFXD 5C44B 3NP8A 3B2FA 1G91A 3HS0C 1LTRD 4RAUC 3A8KE 3M4YA 2PYKA 1STAA 1Y8OB 2B2UC 2OEOA 4KD4A 2F0QA 3AEDB 2Z4HA 2L5TA 2WXGA 1GUNA 4RHSA 5CV7A 1L4ZB 4A3DB 2M56B 1ILQA 4JBWA 2XSCA 1FD6A 2IT1A 3I57A 2W3SA 5C4ZA 4NDXA 1HTLD 3FDTA 1BUVT 1YQ4B 3K59A 1QQRA 2BDOA 4A90A 1DOMA 1JQ4A 5EBDA 1OXSC 4A3FB 1MSHA 2KVMA 1GOZA 1YMHE 4XT1B 3RUZA 3HZXA 1GHKA 1GUWA 1MHHE 1FXIA 1JWBD 1HPCA 5JEAH 3P4SB 3DMUA 4TKOB 3DWMA 2O5IC 4KX6B 4DGZA 2JWUA 3AEAB 3TDQA 2AQ2B 1JW9D 1E2ZA 1G8ZD 3UI2A 1TIID 4K5VA 3QIAA 1SNQA 4X3SA 3K6OA 3TZDA 4H0LC 1C4CA 4REZA 1ESFA 2RDGA 4EQOA 4OZBA 1KNEA 2RKSA 1XLOA 2RDHA 2YEPF 4IQZA 3E0JA 2LFIA 1FNWA 3SDZA 4A3KB 4B9XA 4TQ0A 1LTID 2A69C 1CJEA 1JWAD 2BS3B 1NCVA 1FIQA 2A68D 3H94A 2KUMA 2F4IA 3Q6SA 1RFKA 4XWTA 1D2BA 2Z8LA 4JWSC 4GDKB 1XWEA 3S2DB 5KGUA 1NUCA 5HI1A 5C3WA 1AP0A 3HVDA 3EQLC 1HUNA 1RD9D 1F9SA 2WXLA 3NRZA 1SDFA 1QLBB 2VZKB 1JE4A 4I65A 5AUKA 3M3YB 4CGYB 3EA6A 1L0XB 3AEBB 4OO1I 5F2DA 1J7AA 5EBCA 2F0IA 2ZW1A 3SK4A 3TP7A 4PMBA 1SB3C 1TY2A 5JVH3 1BXTA 1Q12A 1LTBD 1TYGB 3NQIA 3R2IA 5C4HA 5EPLA 1PZJD 3BYYB 2IX0A 3J9CA 3LWUA 2EYOA 4EGVA 3HOWB 1C4AA 5JXVA 3SE0A 2BOSA 3NE5B 1I6HB 3H6MA 1X3QA 5GXGB 2MJ3A 3SFDB 1V1PB 1PRTD 2F0TA 2J7ZA 3A56A 3W3AA 3M7NA 2I2YA 2QF7A 3AE5B 1JWSD 1NAPA 1WTRA 3M4OB 2I07B 5JEAJ 2F0GA 1F9RA 1K8MA 2K01A 4A3JB 2KQ4X 1BUIC 3M85A 1YNTE 4ZUIA 1QT9A 5A2QL 2WXHA 3GTLB 1SYGA 3Q69A 1DOIA 3U52E 2YU9B 1QE6A 3SK8A 4ABNA 2X38A 1PFMA 4KI0A 1GJXA 5EQ0A 2R3ZA 3W1SA 1DZ1A 4RWSC 2NN6G 1X32A 4WRDA 4FP5D 1ET6A 3LXFA 5EKKA 1PDXA 1AN8A 2WNMA 2DNEA 1BQQT 4XE0A 5T1GA 3C2PA 3AMZA 1S5BD 3MXPA 2O2LD 3C46A 2EYMA 3AEEB 1EY7A 3BK1A 2RBMA 3G6JB 4CKBA 3K5MA 3VRBB 2KECA 1SFOB 3K57A 1FNUA 2J4XA 4KGSA 3AE3B 2WACA 3IFTA 3I4MB 2BW2A 3T3NA 5CMDA 4BS9A 2KDMA 3EVQA 1BCPB 2QKIC 1I4HA 4HCEA 4IUVA 3KLSX 5JOBA 4NJCA 4HKZE 3NTIA 1UWXA 3A54A 1WGKA 4K14A 1RWSA 5ELEA 1A70A 1AFPA 1O7ZA 1PTOD 2MJDA 4YT0B 5C4XB 3TP6A 2K5PA 1B2TA 4A9AA 1N5XA 1TS3A 1HCZA 4V190 1QB5D 2K5DA 2FUG1 4ZOHC 2EY1A 2F0HA 3T4AC 1MSGA 2F0VA 3EROA 1SEBD 3P4QB 4MM3B 3LNNA 4DXGA 3MP9A 5EE0A 3W2DA 2KCNA 4NAMA 5K36H 2PW5A 1G2TA 2KA7A 1JALA 2JU6X 2V0GA 3RLFA 2LUMA 1E0ZA 1N62A 3D8GA 4K5XA 4ZHOA 4DN4M 3PUVA 4H44C 5CV9A 4NAWB 2B2YA 1IKLA 3UI3A 3A7AB 5D14A 1DXMA 1C79A 3TUOA 3FMCA 3D4WA 3BYTB 4BBSB 3BDLA 5A35A 4OL7A 2JX5A 1VF7A 2DBYA 2RVLA 1NYQA 1UGJA 4CJ0B 2INPE 1P7EA 4DFAA 3HRZC 3L9AX 4ZRQA 1XEEA 2DNCA 3ZJUA 4USAA 4KTAA 1Q1EA 2EVBA 1CA6A 1LABA 4N6EB 1S5FD 3X3MA 2L4NA 1I7HA 1STEA 2R93B 4IALA 2WXKA 1MBYA 3VRAB 3S16B 1Y1VB 4I7ZC 5HFYA 3S2HB 4FXCA 3OMCA 1WSPA 4KY6A 5KRUA 2K0PA 5C5MA 1PGBA 1SF0A 1ZXTA 1SNCA 1S5ED 4E6IA 2RDFA 1JOKA 5JAVA 1PFDA 1BCPF 1PTOH 3EJIA 1FD7D 3LWEA 3HEJA 3VYRA 3DWQA 1PTOC 3PZ8A 2L9HA 4K8IA 2WP9B 1PZID 2DLBA 5H92C 4AS1A 2Y5CA 2W82A 1LLRD 1DM0B 5CGKA 1SJED 3GV6A 1EY9A 5IGCA 5I2YA 4XIGS 2K22A 3J80L 3ZJVA 5FLXL 5EE9A 2E2HB 4MH8A 2VB3X 2G9HD 4AYBB 1OXTA 3CRKC 1LO5D 3P4PB 1Q90A 3MHBA 3J81L 2A6ED 5KEEA 4ZAIA 1U9RA 3CU7A 1J9OA 3FPPA 4X3KA 5IT9L 2Q8TA 1STHA 5HG2A 1HZ6A 5C0XG 4QMGA 5HHDG 1XO3A 1EY5A 4IFDI 3V2TA 2HCIA 3Q8EA 1CHQD 1V8QA 1ONLA 2B2VA 1PUTA 2NTTA 2E6XA 1VRAB 3NTHA 4RKBA 3SXHA 4EQNA 3I91A 3C1EA 4RF1A 2QSDA 3IXSA 1KFYB 1L0VB 4IN3A 2K33A 4JX1C 4L2YA 2KAJA 1SE4A 4KMUC 3DXJC 1XXGA 1TY0A 3MEHA 1XLPA 2AX5A 4YTMB 4M1UB 3X3NA 3SR1A 3QOJA 3N52A 5DM63 2F0UA 1XX8A 2EPBA 4K6LA 4RKLA 1IKMA 2IGGA 2VXWA 2IWHA 1SE3A 3JAME 1OXUA 1VZ8A 1B9MA 2KN4A 3HKZB 2BBCA 1V97A 2V4DA 2Q8RE 4A3IB 1T6BX 1RTOA 5DNFA 1H9MA 1QNKA 3IAM1 1GB4A 2ICIA 3TMEA 2WDQB 1FCLA 1PDQA 1M4VA 1UUPA 2WU5B 1Y69U 5C3EB 3GQBA 5FR3A 3QG1A 5EPKA 2R92B 2D2CC 2EDGA 5M3FB 2JZPA 3GTKB 2F0DA 2WAQB 1WTVA 4YSZB 2PW7A 1FCCC 4HR7B 2RSOA 2F03A 3QJYA 1JOQA 3FAHA 1KNAA 3ABVB 2KMMA 4L1BA 5BN3A 1KRHA 4P6VF 2TSSA 4FO2A 3VR3A 3FRPB 3OIPA 4YWGG 5HGTA 2ENBA 3K58A 1QOBA 2RMMA 4FXGC 1E2WA 2BA1A 4A3EB 3SR6A 2EOTA 2O5JC 1YN3A 1A2TA 4KD3A 4RNAA 3K5NA 2MJEA 3A55A 3FILA 1WD0A 1DOLA 1ZXIA 1R9TB 5AUIA 2WXOA 1H9JA 2BE5C 5CV5A 1LTAD 5I9OA 1WTWA 3FKIB 5ELBA 2X6LA 1YNNC 3SVMA 1DD2A 2GI9A 3L3OC 4TRDA 3GTJB 4WFN3 3NBHA 3IT6B 1OXVA 4IZ8A 2JA7B 1QWYA 5H8YE 4PNYA 1KF6B 2AWNA 4ZLTF 1E2VA 2F0KA 5IGBA 2IL8A 3OMGA 4EE2A 2IGDA 4N58A 1MI2A 1EL0A 4BY7B 4WH4A 1N60A 1H9SA 1R4QB 3HP3A 4RCNA 3TP5A 3WOEA 4KJOA 2O4XA 4A93B 3DHQA 2MHVA 1RODA 2D5GA 2OXPA 1JR0D 5D3DA 3BZDB 4KKTA 2EYHA 3NTKA 1Q8IA 2K5WA 1XF5L 4CKCA 3LYYA 1TWHB 2CQAA 4KKJA 2F0LA 2WIIB 1DCZA 1WTOA 4LTUA 1IBXB 4FXKC 1BOSA 2ID0A 1TJEA 1ILPA 4RGMA 2PPBC 3TEZA 2G9DA 2E74C 2L1AA 1NR2A 3W9CB 4B9WA 5M9OA 5E4WC 4LJZC 3SEBA 3C1FA 2PMZB 1IGCA 1F0ZA 1WD1A 4HMJA 4JK1C 3TEXA 5FO8B 4WWMA 4ARIA 1MPEA 2E3TA 3E6ZX 2JXMB 5CV8A 1QJOA 4RA8A 4A3MB 1K8OA 2F0FA 3FC4A 2M00A 2J53A 4N59A 4TQ1A 1V8CA 1D5MC 4OO1H 4ITKA 4ZUJA 4ME5A 3KF8A 5C6AA 2KQ3A 2HDEA 4H7BA 2A6HD 3I73A 5COYA 3AECB 3S1QB 2LMCA 1ML0D 2L55A 3GP7A 4HSPA 1QOFA 3AMUA 3GB1A 4AQ7A 5JEAG 2QIEB 1VF5C 2SNMA 1HQMC 1C9FA 2KCCA 2IDYA 4DXFA 4ID6A 1W6KA 1AZQA 2OEDA 4Q5VA 5EPJA 3DEPA 4Y7NB 4JPSA 1T5EA 1E6EB 4XTCS 1KH0A 1HHVA 1HUMA 4J3OD 4OIJA 1CK1A 1AZPA 3D4RA 1EIHA 1ZPSA 2NVTB 1RHPA 2XWBB 4BY1B 2BS2B 4KK7A 5G3LF 2QEJC 4ZRZA 3ZQ4A 4DF7A 2ZXPA 2JEAI 4TQUS 4DAPA 1BCPD 1HQRD 1EWHA 2Y5PA 1R4PB 1I4GA 4D2KA 1A15A 4US9A 3AV8A 1JC7A 3AM9A 4ZQ3A 4FF2A 1B4OA 3I9V1 2WB1B 1VZ6A 3BVZA 4QUFA 1G2SA 4BWGB 4RF0A 1E10A 1I6VC 1XCQL 1G6ZA 3MHZA 1NENB 3ND9A 5EKLA 3VR5A 5IIFA 1ROEA 1EY4A 4HN7A 4JWUC 1WXQA 3NBIA 3WCQA 4WORA 3AE7B 2M2LA 2F0NA 1D5ZC 2L12A 2L83A 5BMGA 1LTGD 4KY5A 1TQOA 3CRLC 5I6WA 1P7FA 1ZP0B 3B2GA 3I70A 4V0BA 3ERQA 3ZJTA 1SXTA 2AQ3B 1K51A 4GLSC 1U4PA 4NZLB 4O42A 5BMHA 2Z1CA 3P20A 4XYOA 3LB8C 1JB3A 3G7LA 4KJNA 2V3NA 4L8JA 3Q8BA 2HDLA 4HSVA 3GD7A 4K6DA 3PV0A 3WDNA 4KKUA 2JYEA 4YSYB 2B63B 4K8JA 5J1ZA 4HCSA 2NBFA 2CVRA 2WLBA 1ZEQX 3PUWA 4N9TA 2BYTA 2LKVA 4FF4A 2RPVA 4EQPA 3BIID 1YJIA 1ZYRD 1EYAA 3MXUA 2W3RA 1C4PA 1TKYA 1AEXA 2W55A 3HUIA 2LHDA 1TKGA 1JWUD 3T3OA 1ACCA 2B2YC 4LK1C 2A68C 1GB1A 1TS2A 4M0WA 5DAUA 1BDOA 1LT6D 2EY2A 1C78A 2B2WA 3KWVA 1IGDA 2RA4A 1EZ8A 1MGSA 2F0EA 3SK6A 3S17B 1SNPA 4C1NI 1BR9A 1FM0D 2CW0D 3MXNA 1V1PA 5ELDA 1FYCA 3AE9B 4J8QA 4IUQA 1CZGA 3D6CA 3DWAA 2NN6I 2N9KA 3PO0A 5E4XA 4C1NK 1PGXA 5JPMC 4H13C 4A3BB 2E2DC 2Z4IA 2QJLA 1K53A 1CQFA 2B8GA 3BS1A 1MVKA 4X3UA 2NUCA 3QB3A 1IYUA 2MH7A 4YXDB 3NZ3A 4BBRB 3H3VC 4C80A 4HRSA 2HUGA 1PRTC 4ZK9B 4L63B 4CJ1B 4RH6A 1UAPA 4U673 5G5GA 3R2TA 1ENAA 3PUXA 4KHZA 3KLSA 2N0SB 3R3OA 4L23A 1JWMD 3AB9A 3D6WA 5KYIA 3P75A 2TMPA 3IAYA 5CR3A 3KK7A 1LACA 2R6GA 2F0PA 5K36G 2E76C 4G7HC 1WYGA 3HVZA 1IW7D 1O78A 3V3XA 1D4BA 1S5DD 4A3GB 4F7XA 4XQJA 1QOAA 3J7AF 3VA5A 4HKQA 4RCOA 1TU2B 2JA6B 1DOKA 3ETRA 2LEKA 1DYQA 5IODA 1ZDVA 4OZCA 2Y3AA 2EE1A 1EYDA 2B8FA 3M7GA 1SSOA 1I4PA 2JQRB 3VR8B 3NVVA 3K0YA 2LY7A 4IFDH 4P16A 4C7ZA 1OO9B 2CHBD 3VR4A 1Y8PB 2MGSA 3R93A 1ZUD2 1BO0A 4ULLA 3PIP3 1ZXHA 1KDAA 1TS5A 3CQZB 4PMWA 2K6AA 2PTLA 2N88A 3MFYA 2JEBI 4DAVA 1A6XA 4ZKBB 1F2MA 4H2AA 1PLFA 2PZTA 3FVQA 2BS4B 2IX1A 3SFEB 3I72A 1J7CA 3OWEB 1TR5A 3AE8B 3I8ZA 4G7ZC 5M5YB 3NK9A 5FOBB 4YTNB 1PTOB 1RM6C 3BDCA 1YNJD 2NVYB 3ZGZA 4NMZA 2JYOA 4TSSA 5FK9C 4KGTA 2V4IB 2FBWB 1EEFD 4FVMA 5K5PA 3GV3A 3VR9B 1SNMA 2EELA 2EYFA 4KN4C 2ICEC 3OHXC 2INNE 4DQOC 4CJ2C 3NQTA 3TN2A 3NUCA 2NYZD 1BNZA 2WXQA 1XYIA 2KWDA 4GZYC 1XTCD 1QILA 4ODGA 2K32A 2NMQA 3VR2A 1JROA 4MN3A 1EM7A 2BT6A 5C3XA 1SSNA 3O13A 2PQEA 5G3LD 1STGA 2WDRB 5G5HA 4NP5A 2RQXA 4RGOS 2PCFB 2VUMB 1CZWA 2SOBA 2XN9C 2JYTA 1Z47A 1DONA 1EOTA 2GB1A 4WQMA 5M3MB 3VYTA 1R7SA 1RDPD 3BVGA 1TZOA 1STBA 5LNK1 2MPMA 2IX3A 1Y56A 3D3RA 1EU3A 4XDDA 2ZXOA 3FILB 1PZKD 1XLNA 1GPXA 1Q1BA 1F2RI 4IFDJ 1GUOA 1EEID 5M5WB 5CC4A 5C0XI 4OIKA 1VMPA 3IAS1 4J1MA 3MZ5A 2EYJA 3P1HA 1YJJA 1SMYD 1BMLC 1QOHA 5ELFA 1K52A 1M8AA 1AYFA 3DWPA 1K50A 4OZAA 3T13A 3OSOA 3S15B 2BA0A 1YN5A 3KBXA 5LL6S 1LV9A 3NVZA 3H8HA 3KQ4A 1I4QA 1F9QA 5JPNC 2N9LA 4A55A 3U7ZA 1TT2A 1GHJA 4MT5A 2EYPA 2EXZA 2BCOA 3KBGA 1F77A 3VYSA 4XYQA 1D1KA 3DEOA 1FRRA 1FRDA 3MTSA 2K03A 2A6EC 2WXPA 1QKZA 2XIWA 5A2QE 3C8YA 2EYLA 5LL6X 3A8JE 1II3A 1SYDA 1O80A 4KHVA 2H4OA 4LAAA 1PFBA 1KTKA 3PMFA 1D1IA 3T56B 3DM1A 1H9RA 3T16A 4YTPB 1PMRA 1SNOA 1XCTL 1VLBA 3HOUB 2LS01 1FFUA 2IJ0A 1HA6A 1LT3D 4RFBA 5DEHA 1T5XD 5D3IB 2LGIA 5E3FA 1NEKB 2BDNA 3QO2A 3AE1B 4ARCA 1MHXA 1DOYA 2F3WA 5FO7B 3MC0B 3Q23A 2CU3A 2ACZB 2K28A 3RPFC 3I4NB 3D31A 2ZXRA 2JP1A 3LX0A