1JCKB

T-cell receptor beta chain complexed with sec3 superantigen
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
239
structure length
239
Chain Sequence
ESQPDPMPDDLHKSSEFTGTMGNMKYLYDDHYVSATKVKSVDKFLAHDLIYNINDKKLNNYDKVKTELLNEDLANKYKDEVVDVYGSNYYVNCYFSSKDNVGKVTSGKTCMYGGITKHEGNHFDNGNLQNVLIRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIESNGNTFWYDMMPAPGDKFDQSKYLMIYKDNKMVDSKSVKIEVHLTTKNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Complex (toxin/receptor)
molecule keywords 14.3.D T CELL ANTIGEN RECEPTOR
publication title Crystal structure of a T-cell receptor beta-chain complexed with a superantigen.
pubmed doi rcsb
source organism Mus musculus
total genus 63
structure length 239
sequence length 239
chains with identical sequence D
ec nomenclature
pdb deposition date 1996-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
B PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1jckB01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1jckB02
1LTTD 2XN9C 1D5MC 4O1NA 3BZDB 1CQVA 1KLGD 1LTID 5ELEA 2AQ1B 3BYTB 1L0YB 1RF2D 1JWSD 1D5ZC 2J4XA 1ET9A 1TS5A 1FD7D 3DWPA 1FNVA 1EWCA 1LT4D 1QILA 4K6LA 1I4QA 2CHBD 1AN8A 1HXYD 1LTSD 1BCPF 1T5XD 3TSSA 1EEID 5I4DA 1HA5A 1I4GA 2G9HD 1LT5D 2Z8LA 1UUPA 1V1OA 1V1PA 4RGTA 1I4RA 1JR0D 1ENFA 1SBBB 3R8BA 4ZYSA 2QILA 1B1ZA 1ESFA 2WV6D 4L63B 2NTTA 1PZID 3SEBA 1MD2D 1I4HA 1PTOB 1LTAD 1PYWD 1BCPB 1CHQD 1L0XB 1CK1A 3EFXD 4RHRA 1PZKD 1YN4A 2XNAC 1PRTC 1CT1D 4Z9CB 1EEFD 1FNUA 2IPKD 4DXGA 1I4PA 2XRSD 1LTBD 1EU4A 1RDPD 2IJ0A 1SE3A 1TS3A 3BYYB 1S5CD 3V05A 1PTOF 1PRTD 1JCKB 5ELDA 1S5FD 1EU3A 1JWMD 1TY0A 1KTKA 1SXTA 1EFID 4UDUC 3GP7A 1I4XA 2R61A 1JWUD 2QEJC 1HTLD 2AQ3B 1DJRD 3BVZA 2ICIA 5ELBA 3DWQA 5FK9C 1FGBD 3KLSX 3R2IA 4RGNA 1V1PB 3URYA 5FKAC 3MFGA 4TSSA 1ET6A 1B44D 2NTSA 1LTRD 3O13A 4RH6A 1LT6D 1XTCD 2RDGA 4RCOA 1YN5A 1PTOH 5D3IB 1BXTA 1JQYD 3EA6A 1HQRD 1RD9D 1BCPC 1SEBD 1SE2A 1SJED 1S5ED 3MC0B 4RGMA 3DWAA 3W2DA 2TSSA 1YN3A 1CHPD 1F77A 1LTGD 1S5DD 2AQ2B 1DYQA 3R2TA 1GOZA 1UNSA 3OWEB 1XXGA 1PRTF 4C56C 4BWGB 1M4VA 1AW7A 1PTOD 1RCVD 4RGOS 1BCPD 4NZLB 1S5BD 1SE4A 1SJHD 4DXFA 1PZJD 2XRQD 1LO5D 5ELFA 1D6EC 5D3DA 3CHBD 2SEBD 4RHSA 2RDHA 5TSSA 5ELCA 1KLUD 1G8ZD 1PRTB 1TS4A 3BVMA 3BVGA 1FNWA 1D5XC 1LLRD 1TY2A 2O2LD 4L6TB 1LT3D 1TS2A 4RFBA 1PTOC 1STEA 4OHJA
chains in the Genus database with same CATH superfamily
1L0VB 5EPKA 1K8MA 2AWNA 1F2LA 3WAPA 3AM9A 3A4RA 2WAQG 3VR5A 2K5PA 3DBHI 4J15A 3WOEA 4DR3L 2VW9A 2F0VA 2Z4IA 3AFQA 2F0LA 4EQ5A 1Q1BA 4OIKA 1TKYA 1ZE3D 2DYOA 1FXIA 3P1MA 4FLHA 3E5SA 2K8HA 3CPFA 3J7AV 3WWVA 2KC2A 2J4XA 1MIUA 3CW2C 1I3QB 4EVOA 4I7AA 4HJAA 1PDXA 2NMQA 4L5QA 4BA1I 1FD7D 4X6AH 3HOWB 2LUEA 3EN2A 5T1IA 5H1SE 2KWCA 3AE9B 5IYDG 3S1QB 2ZXRA 1KDBA 1LQBA 3NVVA 3OAWA 2FCMA 4M8MA 5J1ZA 5CHVC 3KYHC 4MNOA 2HQLA 1JMCA 1LT5D 3RD2A 1AP0A 2HTHA 2KC1A 2E2DC 3QOLA 2PQAA 2Y5PA 1GHKA 3NG0A 2W9NA 4LNOA 2I38A 4KHPQ 4LUOA 1NJIC 1GUSA 4LDTD 3TCAA 1T9HA 2FIDA 1JW9D 3ZRCA 4KIKB 2VB2X 1R7SA 3DVNV 1CT1D 2PCFB 1V80A 1A3UA 1FM0D 1WXQA 3UQAA 2BOSA 2CWAA 2RPVA 1L4ZB 3M3YB 1PH2A 1AZPA 2WWZA 3RLFA 1UELA 1HFGA 1WI0A 4H7BA 3FDTA 1IYVA 4IM0A 2VY3A 2E2JB 4WJQA 4KI0A 4AUQC 1I7HA 4B0MA 2IGHA 1PMRA 2L0FA 2L76A 4IFDI 4JI0Q 1NVID 2HD5B 2JF5A 4W9FA 4F8CB 1WOCA 1CQFA 3HOZG 4DR6L 1C4PA 1EWIA 3JVZX 1NEKB 3APFA 2B2TC 4LW1A 2NYZD 1ZEQX 3MXPA 5DLQE 4MTKA 4R9WA 1TXYA 4ICUA 2NVQH 4MEMA 1KRHA 3MEHA 1J0GA 1GC6A 2RSUA 1TWCH 2ZW1A 2IY5B 4EKUA 1GPXA 4IUNA 1H4RA 2K8CA 4C1NI 5I2YA 5IYBG 4BY7G 1AYFA 3O13A 5M3MB 2Z6KA 4EQNA 3S14H 1IXRA 1PTOH 1YN5A 2N1VA 4BY1B 4RG1A 2KTRA 4V0BA 3GZNI 3ERQA 2HJ8A 1BXTA 2K75A 1SE2A 4RGMA 2G4SA 1STBA 5LMUL 3I91A 3PF4A 3Q14C 3V2TA 1WGDA 2R3ZA 5FLMG 4G57A 1LTGD 3IKJA 2AUKA 4K5WA 4DAVA 2W3RA 4KDLB 3K58A 4OELB 3A1QA 4C2MH 3SFEB 4II3B 1BR9A 4ZKCB 1TTNA 4LWCA 4IC7B 5C23A 2QIEB 3JSVA 4TQ1A 4GKKQ 1BVSA 3TEHB 5LNK1 4OO1H 2FINB 4R4OA 2M56B 5ELFA 4G7ZC 1FMAD 1JT8A 1RM6C 4X65L 2BBCA 1TIFA 2PVOD 2SEBD 3KWLA 1DGJA 5IWAL 2XEWA 1QOFA 1TS4A 1QJOA 1SR3A 3SGIA 5C5MA 4E6IA 2N9XA 4IM3A 3PSEB 1IBXA 1TY2A 2PZTA 1FRRA 5KHQA 3CC7A 2R7DA 4XQJA 4JIOU 3A9KB 3VTWA 1S4ZA 2IX0A 5KYIA 3Q69A 1EYGA 2FXQA 1OXSC 4Y7NH 4LAAA 1PQSA 1EWHA 1VQBA 2DNEA 2G5DA 2P5ZX 2F0OA 3PSIA 4QJFA 3L2PA 1H95A 3IT6B 4GN4B 1CSPA 4ODGA 4A93B 5D94A 1R4QB 4O0AA 2JX5A 2LGYA 1TKGA 1PH4A 3J80L 1K83H 4HIOA 2Q5WD 4IZ8A 2J52A 3T1YL 5JH5C 2N9KA 2O6VD 4N9PA 2PTLA 3TRZA 2XGTA 1NYQA 1M90C 4A3BH 2REXA 4JX1C 5CV7A 3SU8X 4G3XB 1YJJA 4A3IH 5GMVA 4I65A 4HCSA 1TZ1A 3W9CB 4B0EA 3E0EA 5CYUA 4YSYB 2G1EA 1IYJB 2R7ZH 2VQEL 5IGDA 5FJ8G 2WV6D 3Q8FA 1P8LA 4MGIE 1VQNA 1R4NI 4K3BA 4UPAA 4DUYQ 5JEAG 3AEAB 5CX3A 1WTPA 4BKTA 3DWGC 3IFTA 1UH6A 3HP3A 3DBHB 3KF8B 3P1HA 2NZOA 2DY7A 1K8RB 4CDDC 3ECIA 3M3JA 2KMAA 3HOXB 1DONA 2MBHA 2LGSA 2B76B 1JMLA 3ITPA 1NCVA 3R7QA 2IJ0A 1TS3A 3A5ZB 4RMAA 1S5CD 4KX6B 3GTQB 2Z6KC 2RR9A 2N88A 4NJ7A 2CCZA 1QZHA 2NR2A 3U58A 3OW7A 2UU7A 1Q82C 1R9TB 3OIPA 4NXNL 5E6OA 5HGQA 1RJTA 1N5WA 4BVUC 1EY9A 2WXJA 2CHXA 3UGBB 3VQIA 4C4VA 2YV5A 2ICIA 4AYBG 5CBAE 1IGDA 4WAFA 3ZO5B 1N36Q 3SE0A 1YIWA 4MACA 4P71A 1M94A 3OJ3A 4JI1Q 3VYTA 4XDXA 1I6VC 1HTQA 1E1OA 4YWLA 5JVH3 1C79A 2NTSA 5KNBA 1VQ6A 3NVYA 3M4OB 4YHHQ 1WXMA 1QVCA 4KGTA 3GTKH 1I6HH 4YY3Q 1E5WA 2Y0SE 5C5LA 2F4VL 2FCQA 2GOWA 2JRIB 2GVBA 2Q2IA 4C3HH 2DBYA 5C3EH 2MBOA 3IG3A 1SN8A 3J81i 4A3JG 3UI2A 3CPWA 2EZVA 2WAQE 3D3RA 1TZOA 1DYQA 4OGQC 3TS0A 3OWEB 4IN3A 3CC4A 3EIVA 1NMFA 4LJZC 1H9SB 3DVNU 4NJCA 2CJNA 3RNAC 4DK5A 3I4NG 3WA0A 3L9AX 1PZJD 5EKIA 3ZNID 1G2SA 4P7IA 2O5IC 5D3DA 1WZ3A 4RHSA 5TSSA 2R6GA 1HFNA 2D0OA 2B63G 3W1BA 1FNWA 3PIPA 3SFDB 1J19A 5AZFA 1ASZA 4A55A 1L1OB 1JE4A 4W9DA 1OEYJ 4J8QA 1CMXB 1P7EA 2F03A 1I94L 1EUVB 2R92B 4RM9A 4RNAA 2E3TA 1XO3A 4IUUA 1S72A 5HG2A 4C3JG 3ZXRA 3CSTA 5AUKA 4B08A 4K6DA 5DPSA 1C48A 3NENA 1XPOA 1OQQA 1XLPA 1SYEA 1B4OA 2KN5A 3ZIMA 4IFDG 4ZCKA 4WWNA 2VH1A 5ELNA 4IPGA 5KRUA 4US8A 2EYPA 3L0OA 5AFWA 1HNZL 2L4NA 4LNIA 3SDZA 2L7RA 4HPPA 4IWOA 3M85A 1BCPF 1T5XD 4PZ8A 2J7QB 1VQEA 2QMTA 1WM2A 3NY5A 2UUAQ 3P75A 5L83A 4WQOB 1WH3A 4EQOA 3A74A 5CGKA 1FPYA 2CQAA 1K9MC 2KN4A 4DHJB 1UWMA 2B2VC 2O6VA 4EZKA 4C7YA 4OXPA 1WCMG 2DHZA 2JXTA 4OW0A 2M2LA 3I4MB 1K8AC 3UIPB 1UZXB 2I46A 2C9WB 2EDGA 2H1EA 4X62Q 2V4DA 3LWEA 4LF8L 2UXBQ 2XNAC 1GKHA 2AL6A 2FIFA 3FMCA 4MSMB 4P2CB 4DA2A 3GTGH 2LVQA 3X23A 1WX7A 4FF3A 1LTBD 2PNRC 1SNQA 1XMQQ 1UBIA 3MC8A 4O42A 1MVKA 4XWWA 2KDFB 2NVXH 1CKNA 3V60A 2EY2A 1PRTD 2OJRA 5ELDA 1HUNA 4JV5L 3S2HH 4N9F4 5E6NA 1JWMD 5FO9B 3VTUA 2LKVA 3RZOB 4NNJB 1HCZA 4I6LB 5IO9A 3P4PB 5JJZA 3B9JA 3CCEA 2HIXA 1UD7A 1BT0A 2IY1B 4ZLTF 2M1MA 3M4PA 2C35B 5C4JB 2YEPB 1QNKA 1TWAH 4DKAC 4GDKB 4DAPA 4GS3A 3NTIA 4O2DA 3KLSA 3PCOB 2KWUB 2DN8A 2ZXOA 2NS5A 2WDTB 1IW7D 2X38A 4KY6A 3QQ8B 4CHKA 2JA7H 4WIPA 2BGFA 4UP8A 1BF4A 1WTVA 2ASBA 1YQ3B 1GXDC 4JBKA 2DZMA 4LFBQ 4AIMA 2E5LL 2JWUA 2I0QA 2EY6A 1IBKL 1GUGA 2AUJD 1DOYA 3DWMA 3CU7A 2SNMA 1HNXQ 2K6QA 1VCIA 1BQQT 4UAIA 3NOBA 2F0HA 1VS0A 5KEEA 2RPQA 2GB1A 1S5DD 2AQ2B 2ZM6L 1IBLL 4LF6L 1RFAA 3HRZC 3TMEA 1YHQA 3U8ZA 4KKIA 4DV1L 4X64Q 5IE8A 4DR5Q 1PTOD 1FEHA 2KMMA 3PO2G 4K8JA 4F7ZA 3RYTA 2A6ED 4BBRG 1WXSA 3MJ5A 4BKSD 1X3FA 3X3NA 4WFN3 2UXDQ 2MCNB 2JA6H 5IP9H 4K0KL 1DOKA 2KDEB 4JPSA 2Z59B 4L8JA 1J5EL 5C0XJ 1O7IA 2K5NA 1D5XC 5BR8Q 2QA4A 2Z0DB 1LLRD 4MIUA 2VZKD 1P16A 2C9OA 4ID6A 4PMBA 1E0ZA 3OG5A 3J80c 3MEFA 1WD1A 2KXJA 3HOYB 3RPFC 4A3BB 3PT2B 1Q5WB 2HHHQ 1KLGD 2QGQA 4A4IA 5I9PA 2LXCA 1DXMA 4XYOA 5C1ZA 5CV8A 3VYRA 3HKZG 3T1HL 3ICEA 2QJLA 2JA8G 1SGHA 1Y56A 4NXMQ 3TJPA 1B70B 1B50A 1WTXA 1FNVA 1XT9B 1K53A 1FJGL 3HOUH 2CHBD 2KJXA 2WFWA 3DMUA 3VDYA 3KVFB 1P98A 5JZEB 3AE3B 2EKIA 1K3RA 3JW0X 3WIMA 3K0XA 1JALA 3I55A 4FVMA 1B9NA 3PIP3 4G4KA 2BS3B 3H8HA 1UUPA 2OT2A 4QL5A 5GROA 1PH1A 1J7BA 1E8WA 1WZ0A 4M00A 1JR0D 3PVLA 4MM3A 5IYDH 4LNFA 2RHSB 1H9JA 4BOSC 1IL2A 3Q3NC 1JE5A 2IBIB 4WJOA 4A3FH 2G3QB 1FCCC 2K4KA 3PUYA 2R93B 2MH7A 2RMMA 4XGAB 1VQ7A 2XWJB 1V6EA 1HE8A 2VH2A 3EUB2 2GBKA 3CF6E 5C4ZA 1YNXA 5A35A 4QQBX 4JI6L 2VRRB 4FULA 4A3OA 3G6EA 1WTHA 3CCSA 3A9JB 4KSKC 5G5HA 2LHEA 1UE1A 1K28A 1P3QU 1S5FD 1IL8A 2L11A 1ZYRD 1AARA 1E7ZA 2VUMG 4JYAL 2EYLA 3J80i 1KTKA 2N9PC 4DAMA 1S3SG 4TMAB 3ALBA 5BYSA 3GP7A 3E0JA 2K52A 3HIZA 1LM0A 4LF5Q 4TQ0A 1W3SA 3H91A 3S1QH 2DWQA 3KJOA 3RUIB 3GTKB 4DR7Q 3TBIB 4GKJL 4F87A 1BUVT 2YTYA 1JOKA 4C1NK 4GGQA 4C3HB 4HVBA 5C3EB 2QCPX 4HIDA 2I5LX 2FBWB 2B2UA 4B3TQ 2EYHA 4DV2Q 2WLBA 4XC2A 1DOMA 2BA0A 1YQ4B 2JA5B 1EFWA 3NEMA 4KHZA 2BWFA 2RDGA 4RCOA 3DM1A 3ND9A 3IHPC 2NN6H 1Q8IA 3OYYA 4JI7Q 2N1WA 1F9SA 3C8YA 1RD9D 1V86A 2KWVB 3E9IA 3D4RA 5M3FG 1HZBA 2KOLA 3Q2AC 4M8NA 1EY6A 4HAEA 2EIFA 3OMCA 2PZWA 4K2KA 3H6MA 3IFDA 1LFDA 1TYGB 3RR5A 1SNDA 2MBQA 1O80A 3LB8C 3PPAA 2D3CA 2JUOA 1A0IA 4LK0M 2XBBC 4S0RA 1RAXA 3NWTA 4HPLB 3M7NA 1S5BD 4P73A 4R3DA 3TREA 2E2JH 3AU4A 3GS2A 3QK0A 3PO0A 2DENB 4HXDA 5BMIA 1SAPA 2D9UA 5CV6A 4A3KG 1VQ5A 1E9MA 2LSSA 2DLBA 3AE8B 2KFJA 4ALPA 3HRDD 1VQ9A 3PV0A 3VR8B 2K6AA 1N8RC 3MXNB 2UU9Q 2NPTB 1H8CA 4ZUIA 5BN3A 3ZTCA 2IGDA 2F0DA 1J8IA 5ELEA 5COYA 2AX5A 2IDYA 4H2AA 4BKSA 4LF4L 2KX3A 3I63C 2BCOA 3A56A 4WWMA 4KLKA 4O1NA 4JI4Q 4OX9L 1EO6A 1TT5B 3N1XC 2MP2A 3Q3MC 4M1UB 2DNFA 5C44B 2B2WA 2QF7A 3UE0A 1OGWA 1JB7A 5IT9E 3FILB 4DAYB 1Q10A 4CO7A 1WFYA 3AU5A 4AP4C 3H7PB 2K7VA 1AE2A 1EY0A 4JGHB 3VR9B 4DR4L 1UGMA 3DWPA 4A3MG 3H0GG 4L1BA 4EEWA 1SMXA 2HDMA 3T16A 1Y8RC 3S2AA 3RI7C 1WMHA 1JB3A 1X54A 1Y1WG 4BBNC 4POGA 1ACCA 3Q8BA 3CCMA 3RMHA 3IAYA 1WI5A 1XYIA 3GTGB 3NTHA 4JBMA 4DK6C 1V5TA 3GB1A 5AJ3L 5CV9A 4IOCA 2Z0SA 1PZID 4A9AA 1HH2P 3MAQA 2A1AA 2K01A 2WINB 2WB1G 3S2HB 1YN4A 3J7YW 1X55A 3OHXC 5J3BA 1PRTC 4CQNA 4Z9CB 4IM2A 2F0MA 1LUZA 5FJ8H 2Q2HA 4DXGA 3J7ZC 4DNRB 4BBSG 2IO0B 3SK8A 5JEAH 4AQYQ 2AHOB 1JWBD 3CAMA 3VA5A 5IA7A 4B3SQ 3BYYB 4P1CC 1TWAB 2RDFA 2X6GA 4YIJA 4LFAQ 4A93H 4DV6L 3R7RA 3RUZA 3CIRB 2IO2B 4OHJA 1FGUA 2KZRA 2MSED 2KDIA 2B39A 1E2WA 1Z47A 1IW7C 4A3GB 4P16A 2OOBB 1GC7A 3NPPA 4XQNA 1XCTL 1CA5A 4ZOHC 1YJNA 4DV4L 4WH4A 3K9OB 4KSLC 4RGNA 4RAUC 4DUZQ 1Q7YC 2MPMA 3CRKC 3IRBA 4DV5Q 4HIMA 1XMOQ 3SHLA 2M17A 4MH8A 2ZXPA 2J0TD 1Q46A 1Q86C 1ZXTA 3D6WA 4H0LC 1XJVA 4HIKA 3I4OA 4JI5Q 2LVOA 1D1KA 1X56A 3QC8B 3IAS1 1NI2A 4W9HA 4KV6A 1N60A 1TKWB 3SD5A 2HCIA 4CKEA 3MHSD 2A6EC 2BDNA 2VB3X 2GN5A 4ZHOA 3S2DH 3ZGZA 3T51B 1GOZA 3HOXH 3CCQA 2WXKA 2JP1A 4A3LH 4HJKA 5EAYA 1VQLA 3KBGA 4LF9Q 2XK5A 2E76C 1X65A 2H5XA 3C1FA 2F0WA 4DPGA 4A3JH 2B2WC 3HKZE 1GM5A 3GTQH 1N5XA 1N32L 4A3DB 1CUKA 5IGCA 1D6EC 1X3QA 4TVAB 1B3QA 3VR2A 2VS1A 3QG1A 4DK0A 3BIID 2VQFL 1CJEA 2K03A 1QVGA 2JQOA 3GTLH 2ZTDA 1C9FA 1XCQL 2N7EA 3GD7A 1AEXA 3I4NH 1ZOYB 2PEAA 4IW0A 1RHPA 1KOTA 4DR1Q 3D0FA 2EQSA 1E7UA 1ZW7A 2PW5A 1SNCA 2WAQB 4Q5VA 2JY6A 1EYAA 3MTNB 4ARIA 3DVGY 1WGHA 3UIOB 1BBUA 1E2ZA 3WOFA 3M4OH 1Y69U 5BYRA 3L3OC 2B8GA 2DAFA 3GV6A 5HI1A 1K8GA 1C4QA 3PRPB 4MTNA 1LABA 3AE6B 2LGIA 4KHVA 1DCZA 4B9KA 3OMGA 3AECB 3NQTA 3UQBA 1N34Q 1EWCA 4BZAA 5HKHA 3UF8A 2EXDA 4IFDH 2MBEA 3PLVA 1QF6A 4ITKA 3K81C 2EMSA 4C80A 5D65A 1BBXC 2DAJA 5AUIA 2KHJA 2PO4A 2HDLA 2E75C 1MJCA 4GOPA 2WKDA 4K14A 4LF7L 1VDZA 3Q8CA 5C0XI 4MELA 3WAOA 5IYCH 4YSXB 4GLXA 1L2FA 1QB5D 3SEBA 4KHPL 2NBUA 1LTAD 2QC8A 4I6PA 4MDKE 2A6HD 2ZJRA 2L55A 4KGSA 3I4LA 2MNAA 5I6YA 3MP9A 1ZYRC 4FP5D 2XRSD 2R92H 3ND8A 2BB6A 2L05A 1SE3A 1ICWA 4LJOB 3ZXVA 3KF6B 4GLSC 4W9IA 2RHQB 4FJYA 2A8VA 3NZUA 1YD8U 1IZ6A 1TY0A 2J7ZA 2K5DA 3HOZB 1N61A 3ONSA 3S1NB 3BK1A 1WFQA 3HUIA 4KVGB 5ISRA 4JI2Q 5E4WC 3B2FA 2CS4A 2JE6I 3DDCB 2JQRB 1SROA 2MLBA 1OQYA 4BY7B 4R1JA 2C7MB 1ZDXA 2DZJA 1QE6A 1U4LA 1VQHA 2KCMA 3IVFA 3U2SC 1MHWC 2K5WA 1MSHA 5D7GA 1V2YA 3Q6SA 1QWYA 3CC2A 4A8XC 2PPBC 2KT7A 4IO9A 3T8MA 1YNND 5DM63 3I4MH 5BO4B 3RNBC 3ZTDA 1BKBA 4J6HA 2ICEC 2PJHA 4HKZE 5BMGA 1SJED 1SEBD 3UE1A 2E6XA 5CHWA 2Z1CA 3I90A 3E3XA 3NS1A 2TSSA 2F0EA 3Q8EA 3APDA 5FLXE 3TIXA 2Z6BA 3BDLA 4DR3Q 2ATWA 2CH4A 1B53A 3PHXB 2N49A 4M0WB 3NK9A 4BWGB 1MG4A 3AE1B 2G9DA 2N4FA 1P7FA 1WTOA 2CW0D 1EQVA 4CYEA 4MGKE 1PYSB 3RZOH 4DQOC 1QOBA 3GV3A 3KH0A 1PH6A 1S1QB 3DHHC 4AQ7A 1AWDA 1SYBA 2EY5A 2R2OA 1QUQA 4IQZA 3P63A 5C4JH 1KAWA 1TWFB 4AH6A 3OPOA 1XD3B 2QDLA 4A3CH 2KJRA 3QWZB 4P1BC 5CTRC 4YTMB 1GAQB 1RLFA 2OXPA 4ZRKA 2KQ3A 5IOIA 4Y52H 3DBSA 3M63B 4GOPC 3D31A 5C4XG 1HTOA 1L2NA 2NZ1D 2AQ1B 2WB1E 2L1AA 4XX5A 4KD4A 1V9PA 2A73B 4C3IG 4HMIA 3JAML 3ETRA 2F4IA 1IP9A 1K73C 3RZDB 2KFKA 4QAYA 1LGRA 3EC8A 3L4PA 3T13A 1YHAA 4X66Q 2KMCA 5JJIA 3GTPH 2OEDA 1PXUA 5NUCA 4K6LA 5CMDA 1H9KA 2OF1A 3LX0A 2FUHB 3Q8AA 4DV0L 4WURA 1EEID 1I4GA 3U7ZA 2MO0A 3I5JC 3I8ZA 4HMJA 5HY6A 4JI3Q 1YJ1A 2JA9A 4DDGD 3VTVA 1W6KA 1ENFA 4DR6Q 4YWGG 2N9LA 4HJ7A 4NW2A 4C00A 1ESFA 3WALA 2NTTA 2MHVA 4B9XA 4IG7B 2BKRB 1J7AA 3ZDMC 3RD4A 4DUYL 3K5MA 2ZEQA 3PO3G 3CQZB 5C3JB 4QY7A 1FXTB 1SYFA 1WR1A 5GAGC 1NENB 3DBRI 4BFRA 4I7ZC 4AJWA 1VD2A 3HOVG 2CVRA 4X3SA 2PNHA 1D8LA 3QHTA 2CQOA 4OZCA 1G6JA 2K14A 2MO1A 3HOYH 2WGSA 4JOIA 2C7HA 3FKYA 1WGGA 1BO0A 4KK7A 1EYDA 3DM3A 4AWJA 4L5RC 3U9SA 5IT9L 1SDFA 4Q2JA 4FJVB 4DV7Q 4WAAA 3ZRFA 5FR3A 4JPBW 3KDFB 4AYBB 2HJ1A 1JWUD 1S3OA 2EKEC 4MJSA 1PLFA 3J81c 1WIAA 3BVZA 2OQKA 3Q22A 2XIWA 2VUMH 4URKA 2ZW0A 1NBFC 4S3SA 4ME3A 1ZKOA 4HCEA 3V96A 4U673 1YI2A 2WP8J 1BUIC 3PIOA 1F2ZA 3AFPA 4JI1L 2FNJB 3G4SA 2K1FA 5G55A 3U50C 2ZNVB 3HEJA 3ZDTA 3S2DB 1ET6A 1JWAD 4C7ZA 3H09A 4DFAA 4BBNF 1SNOA 3S15B 2BKFA 4M8AA 4YHHL 2IW3A 4GN3B 4DGZA 3KYCD 2WDQB 3K6OA 2C60A 4KY5A 4LUZA 5DEHA 2R93H 4A3JB 2L9HA 4YY3L 4RF1A 1ZXHA 3C1EA 5LMNL 3QA8A 3Q0AA 1OEYA 1FIQA 1E1TA 2PW7A 5GAHC 1OTCA 1QLBB 2J0MA 2EYMA 3R93A 3BINA 3W1SA 3GTLB 3FRPB 4YT0B 2I2YA 1PRTF 4C56C 2DGYA 4K2LA 3I4NB 1EM7A 3MC9A 3PZ7A 4RGOS 1V97A 4G7OC 3DVGX 3E9SA 4LNNA 3G7LA 3L10B 1L6UA 4ASWC 3FEWX 3T1YQ 5C0XG 1R4MI 3TEZA 3EGRA 4XTCS 3M95A 2AL3A 5KHOA 1GJZA 2B63B 3CHBD 3TZUA 3QCAA 4IOAA 2OWOA 4NQLB 1EOVA 1A8VA 1CKOA 1E8XA 1G8ZD 2L00B 3E9HA 4V190 4BXXG 1TWGB 2B29A 4IALA 1ICFB 2LMCB 3T4AC 3L7ZC 4A3KH 4KIKA 4JW0A 3O65B 1IHZA 5JJLA 4C3JB 2KYWA 3RNUA 2KWDA 3ZLZA 2JA5H 2V0GA 1LTID 4FXKC 1TKEA 3KWVA 5J17A 2O2VB 4PT5A 1MGSA 2JZ3B 1RF2D 2D0PA 4DU9A 2INCC 4HROA 2SAKA 1D5ZC 3SK6A 1NAPA 4LTUA 3HHMA 2RDBC 2K6DB 3NHEB 1PVOA 5C2TB 4NQKE 4BKGA 3U4ZA 5IP7G 3AI5A 1OFFA 1A5RA 1H9MA 1LTSD 1O7YA 1Q1EA 1T5EA 1X6OA 4KKSA 2LXAA 3CWIA 3EECA 4JOIC 2CWPA 4FHKA 2BT6A 1VQGA 3P4SB 3VUYA 3CSFA 2A6HC 3H0GH 1WCMB 1V8QA 4CKBA 3KQ4A 3GZNB 1XNRQ 1O7LA 4RKLA 1ZPSA 4HCNB 2HUGA 1FO4A 1C4AA 2JYTA 1WYGA 2KX0A 1VQMA 1L0XB 4BAXA 4JE3B 3KK7A 4BOZB 2IZVB 2HT1A 2ZJDA 2WXIA 2PI2A 4X62L 1PGAA 2UXBL 4L23A 4NY0A 4ACFA 3DHQA 2IPKD 3I70A 2OTJA 2F0GA 4CDCC 1PDQA 1I4PA 1XMQL 4AJYB 3VDZA 1ASYA 1JC7A 1YX5B 2QCZA 3A0JA 1GNUA 3D4DA 5C44H 4N8X1 3A8IE 2KNBA 1Y1VG 1NR4A 2BWES 1VCBA 3GE3C 3NRZA 2LUMA 3S1RB 1ML0D 4ILWA 1I4XA 2WXQA 3NJTA 2VL6A 4W9CA 3ZNHB 4HWIB 1F9PA 4UY8C 1T0SC 3FKIG 2H4OA 3DEPA 1FGBD 4GN5A 3GTMH 2WXNA 1YNNC 3W1SC 2L0TA 1PGBA 3HGBA 2GBRA 1XLOA 2LFIA 5H92C 3DEOA 1LXDA 1WSPA 1TBEA 3A9KA 4KGRA 1MHXA 3B1LX 1E22A 3RCZA 1RRBA 3M9BA 1B3AA 1LT6D 2EYFA 3HK0A 2NUCA 2WS3B 3ZUNA 5C3XA 4K5VA 4PS7A 4LFBL 3A54A 4W9LA 1ZP0B 2L5TA 3KUPA 2INNE 4KKUA 3BZCA 2KEDA 1SRUA 2CW0C 1HNXL 3TBLD 3AEDB 4IOIE 3K59A 2K05A 2D07B 4DHJD 2LZ6A 3AEGB 3OTOQ 4PYZA 4DXAB 3KUZA 3PO2B 4BBRB 4NAWB 4R4QA 4DR5L 3QX1A 1R4NB 3N1ZC 1E2VA 4IUMB 5G2NA 4DXFA 3RNCC 1B9RA 2ZTEA 2XRQD 3H7SA 1VQOA 2BH8A 3PIO3 5H8YE 1CI3M 4QGUA 1EYCA 3MVVA 1RIPA 3CD6A 2NVTB 1Q3LA 2CH4W 2VNUD 1WJUA 2AEHA 4GB9A 1UE7A 4A3GH 2QDBA 4KJNA 5BR8L 1YJWA 2Y5CA 3AN1A 4X3UA 2JXXA 3GTJB 1FR3A 1GB4A 1J8CA 3F8TA 3Q24A 2M00A 2K50A 1IYUA 3KF8A 3GTPB 3N32A 3PS6A 3QIJA 4HDQA 5EKLA 2WX1A 2K5QA 3EVQA 2KBNA 3Q8DA 2UUCL 2MJ8A 3UINB 5E1FA 1W6JA 1CQVA 2HHHL 3PRZA 3HKZB 4LF8Q 1XNQQ 3B08A 2JA8B 1C77A 2UUBQ 1YX6B 2K5VA 1F52A 5JEAJ 2BDOA 3DHIC 3R3MA 3ERSX 1MJDA 2WNMA 1HUMA 2JEBI 3MXGA 2FMMA 4ME5A 3R66C 2EYOA 1GUWA 3DBLI 1P9DU 4NXML 3V62A 4PG3A 5FLXL 1RFKA 3AB5A 5K36H 2F3IA 4IUVA 2MX2A 5ELOA 1HXYD 1KDCA 1G91A 3A4SC 5M5YH 3NTKA 1JJCB 3H9DA 1PFSA 1CZGA 1NUCA 3VYSA 1D2BA 3NHHA 1A62A 3HG9A 5CORA 1WGYA 1X3GA 4YTNB 4HSPA 1AFPA 3OLMD 4A3DH 1BNZA 1HRJA 1GUTA 2D5DA 2JPHA 5LXHA 5KGUA 3QIAA 1BCPB 3T56B 1LV9A 4HJ9A 2F52A 3EFXD 3RN5A 4B3ML 1PZKD 1ZXIA 2RBMA 3N52A 2PPHA 1KABA 2KLGA 2LEKA 2PMZB 3SXHA 1WTQA 4K81A 2FUG1 1RDPD 1F9JA 3F2UA 3NUHB 2VUMB 2N78A 3CKIB 3ONAB 1WJ6A 4EOYA 3EBEA 4JI8Q 4X57B 1H9SA 2SNSA 2RD0A 4YXDB 1VMCA 3GE8C 2YTXA 5JAVA 4H02A 4GNXB 1KM7A 3I73A 2ZM6Q 1YIJA 1IBLQ 3QJYA 4LF6Q 1F1HA 4DV1Q 3ML8A 5LL6S 3W5UB 4AYBE 3LXFA 3R2IA 3RN9C 4DR7L 2MW5A 1V1PB 4WORA 1WWTA 5EE3A 4ZQ3A 1L1OA 1HQMC 1GHJA 1YEZA 3MFGA 1WGRA 3VRAB 3IL8A 4N59A 2WX0A 4B3TL 4DV2L 1ZKHA 2FE8A 4DHZE 4RH6A 1XTCD 1PFNA 5E4XA 1GO3E 1VQFA 3NBHB 5M3FB 1YHBA 1FFUA 4P72A 2RSNA 1EZ6A 4X3KA 2DYMA 3BDCA 2CR5A 2LRUA 2X6LA 1CKMA 2OCEA 4FF1A 1FCLA 2K28A 1MI0A 1PH8A 1YNTE 3U4VA 4WQMA 4KJOA 3ZJTA 2IL8A 1HEZE 1FXAA 3X3MA 3Q3FA 3I72A 4EZJA 2Q8IB 3TP8A 2IO1B 2WXLA 3T1HQ 1LACA 5EE0A 1NR2A 4A3KB 3HVZA 4ZKBB 4KTAA 2W55A 3BU2A 4A3IG 1HR0W 2GBNA 4MHEA 3HOZH 1SNPA 3S1NH 4II2B 1FJGQ 2SOBA 3QJZA 2JK8A 3NWSA 4IFDJ 2LHDA 2R7ZG 1CZWA 1I5FA 3BVMA 3L08A 4XE0A 3TP7A 4D2KA 4HR7B 2UU9L 3AE5B 4N9TA 1CA6A 1VZ6A 1KDAA 2KEEA 1LT3D 3JAME 1U4MA 3OSOA 4CDEC 3V6CB 5IYBH 2Z4HA 4BY7H 4EUTA 1KL9A 4OVVA 5LHY1 2Q2UA 2JEAI 4WWPA 1MPEA 4TQUS 1KC8C 4JI4L 3Q23A 2F0PA 5IY0A 1BBWA 3AEEB 3RFZB 1I42A 2RF4A 3BYTB 1NMGA 1TWHB 5MPOA 3H3VH 1HA6A 5FLMH 4A3MB 3H0GB 4DV3L 2AYOB 4P6VF 3SR6A 1QZEA 3DUZA 2LRWA 1Y1WB 1Q1OA 4N58A 3CCJA 2CU3A 3AMZA 5EPJA 3U52E 3LNNA 1P0RA 2J0KA 1AN8A 1TR5A 1YOVB 2RCNA 3HM3A 4L2YA 3F2CA 1QOGA 2KVRA 5IAAC 1E24A 4KZCA 1XTDA 1KD1C 4GDKA 3VUXA 5EBCA 4GDLB 1SFOB 2BVCA 5DPWA 1UE5A 1K0RA 3ZW3A 2D5GA 1E0BA 2QILA 2EE1A 2EJMA 4ZRPA 2MP1A 2EPBA 2WB1B 3LJ3A 3U9OA 1TGZB 1CHQD 4B3RL 1VDVA 1AZQA 4GKJQ 4I6NB 2PVGC 2BE5D 4BBSB 2GLSA 2WXFA 2F0FA 1K50A 2MGSA 1NBWA 1TWFH 1JORA 1N33Q 3QOJA 2X69A 2YYZA 3STBD 3VH3B 2MWSB 1Z6HA 3S16H 1L1OC 4ZK9B 4APVA 5I6WA 4AQYL 1EQQA 1KLVA 1OXUA 3PMFA 4B3SL 3PO3H 5AZGA 2WHIA 2LXJA 1VQ4A 2AWOA 3TP5A 3UDXA 3GTMB 1DZ1A 2CU1A 4BA2I 4LFAL 4AS1A 3HOVH 1EU3A 4FNFA 4CBVA 3S9WA 3SK5A 1YJIA 1ZUD2 3N3KB 1QOHA 4GU2A 1TU2B 1HNWQ 1IYFA 3FHWA 3RZDH 2BTEA 3AQQA 1VQKA 1F2YA 1WYWB 4ANXA 2V3NA 2LY7A 2CHWA 2GVAA 3DCGA 2LFNA 2GBMA 1Y8PB 4KMUC 3DWQA 4MN3A 1VQ8A 3DOWA 1E10A 4DF7A 3ZJUA 4DUZL 1WGKA 2MHJA 1J7CA 2PQAB 1WX9A 1EIFA 1WR6E 1NDDA 2PYKA 1EIYB 5DAUA 1XMOL 4TSSA 3U4EG 3PZDA 1EY4A 1B44D 1SYDA 3TEWA 4ZYNA 2MQJA 4QB4A 2WP9B 4FADA 2B2UC 1SE9A 3K5LA 1UEAB 2JXMB 3AU7A 3C2PA 3IBEA 1IPGA 3W1YA 4JI5L 1QT9A 1D3ZA 1HQRD 3CQZH 2EJGC 2R2QA 3RULA 3I3CA 3N30A 4S17A 2UWQA 4CDFC 2NN6I 1GJXA 4JG2A 4IJHA 2DZIA 4A20A 3D6CA 3R2TA 4FN2A 3KUDB 3RNEC 4FDBA 2W3SA 2YVCA 1F2RC 2QKIC 3OIQA 4FXGC 5G3LD 4DR2Q 2DJGC 3L0WB 3KW5B 1QQRA 5EGTA 2Q8TA 4G0NB 2KHSA 3MHBA 2QEXA 3AE4B 1TQOA 5E7NA 3I9V1 3L54A 1TT2A 4G50A 1K0SA 4A90A 1ZDVA 4ANVA 1UWXA 3MXUA 4A3EG 1OTRB 2PLPA 2TMPA 2PW9A 1B9MA 2O5JC 2HTME 5IGBA 1NSNS 4GXBA 2CKHB 4RFBA 3ZYYX 2XVSA 4HEDA 1PTOC 4DR1L 3S1MB 4J1MA 4POFA 2Y3AA 2BW2A 3PTFC 1WYDA 1ESRA 1STAA 4IUPA 1E8YA 4XWTA 4LFCL 3WAMA 4ZRJA 5J39A 1Z9FA 3S15H 2KTRB 3ZVVA 3WANA 3A9JA 5M5YB 4IUQA 1Y8NB 2E2IH 5K5PA 2JRHA 1WD0A 3BS1A 4K1RB 5LXIB 1MI2A 1GB1A 4G7HC 1PA6A 3N1YC 4FHJA 2J0JA 4IURA 5F2DA 3A1QB 1ET9A 3HZXA 3PUZA 5CV4A 2JN4A 5JHAA 2UXCL 5KNCA 3BY4B 5M5WB 2GRIA 1N34L 3P42A 2INDC 4IWPA 5EE9A 2XTIA 2FFKB 4PMWA 1C3TA 3JSVB 3RZFA 3W3AA 1WJNA 2K33A 3KYDD 4JK1C 4XT1B 3NP8A 2ZVOA 3AULA 1HR0Q 2B63H 2LASA 2JA7G 1ILQA 5E6PA 2A68D 2BPSA 4DV4Q 2A69D 2DNCA 1XEEA 5AZHA 2F0KA 1HZ5A 1CK1A 1WRDB 4USAA 5CHFA 1IBXB 1TWGH 1PH5A 2A5UA 2E8GA 2KCNA 1VQPA 2KACA 3K8AA 3PGZA 3MTSA 1EZ8A 5D14A 4HJ8A 1G291 2PIAA 2WU2B 3BWUD 4C3JH 1T3QA 3TDQA 3V3XA 1XPRA 2WU5B 4PS8A 3V05A 2GA4B 2NWGA 2PMZE 1XLNA 4F8MA 2ON8A 2MUYA 3OWFA 3A5UA 4FJZA 5FR6A 3L17A 4JWSC 2BH2A 3P2BA 3TEXA 2B2TA 4UDUC 1I35A 3VHTC 2BB5A 1OXVA 3K80C 1X3EA 1IBMQ 4K7WA 4JI2L 3S17B 1DOXA 2IX1A 1X1MA 2JA6G 1U4PA 1Y1VH 5FK9C 2F0NA 5JOBA 3MXNA 2HE7A 3I2ZA 2NPTA 2I1JA 1MJEA 2IHFA 5M5XH 1SSOA 1YNJD 2OJWA 5BYQA 2KLCA 1M8AA 1WCMH 5GQOA 4LUVA 2H89B 3EHVA 1WM3A 3ER0A 1X9NA 3J7A5 1F0ZA 3PGEA 3M4YA 2WDRB 3CRLC 2Y0SG 2G4DB 4OVUA 3RNGC 2H88B 3FILA 3EA6A 3NVWA 3RT3B 5I9OA 4DAYA 1L7YA 4PZ6A 1EUJA 1RYJA 2EMTA 4YTPB 3H7PA 1U4RA 1CHPD 4U68A 1A3TA 4E74A 1FD6A 4QIWB 4JI0L 4DDID 1UNSA 1ILPA 1NE3A 1JRUA 4LDTB 1Q12A 3HFZB 3GTOB 4TRDA 3HOUG 2KAJA 3T3OA 1Q8KA 1RCVD 2IGGA 3AMUA 2M4NA 2MEKA 5CBEE 3VA7A 3ENEA 2LGXA 1LO5D 4JBWA 4K8IA 2RCFA 3UDFA 1ISNA 3D8GA 3EFCA 3K0YA 3P7JA 4CKCA 3S1RH 4C4VB 3IT4B 2NBWB 2KHIA 4DK1A 3N6RA 3TEYA 1F2MA 1XLQA 3RLOA 1SYGA 4A3FG 2MRPA 2LJ5A 1QG7A 3F2DA 1VMPA 2EELA 3V61A 3M62B 3HS0C 4LF7Q 4GSWA 1P1AA 3Q3JA 5C4XB 2CHZA 1A2TA 4CJ0B 2LS01 2N7JA 4DBGA 1SLJA 1HZ9A 2FAZA 4RKBA 4C3IB 3BG3A 1Q0WB 2WIIB 4QUFA 5LMNW 2K9XA 4FA6A 3T9LA 4KZ0A 4OWTB 2D2CC 5DCNA 1CTMA 1D1IA 1Z7TA 4GLVB 5D2MB 4GKKL 2F0IA 3MZ5A 4FF4A 3PUWA 4X66L 2RKSA 3ULPA 2ALYB 4ICVA 3IXSA 1R4PB 5IGGA 3VUWA 4PNYA 3PO2H 4GN1A 3HOWG 4BBRH 4A3PA 1HA5A 4WJWA 4PZ7A 2BE5C 3N20C 4JI3L 5BN5A 1WJJA 3ZJYC 3LYYA 2HD3A 1SBBB 3S16B 4QMGA 3STBC 2PQEA 3I3TB 1U4AA 1MD2D 4AOFA 1I4HA 4EQPA 1ENCA 2NVTH 3PO3B 1PYWD 2X8XX 1Z5SB 2MJ3A 2O4XA 1KF6B 3HOVB 3H94A 1V49A 4YCUA 2NN6G 3C19A 3NXWA 3KJPA 1RKNA 3GTJH 3F1ZA 4K7UA 3P4RB 4KKJA 2I5MX 2D3GA 2AMCB 4UP9A 4CHTB 3FPUB 1JCKB 3G6JB 4JVZA 1K52A 4GIVA 2JA8H 4N8FA 3CMAA 1Y14B 5T1GA 3FVQA 4DV7L 1E6EB 4NAMA 4JWUC 1L4DB 2K04A 2JZPA 2K25A 4F1SA 2Y5BB 1DM0B 3K5OA 2OHFA 2OQ0A 2ZVNA 2ZJPA 3PV1A 5HHDG 1V5OA 2N55A 3URYA 4ZRIA 5FKAC 1HJPA 4WJPA 1YVCA 4CJ1B 2O6VB 3PREA 1MSGA 4KD3A 3TS2A 2JZZA 3ML9A 1PH9A 4ANUA 1C76A 3MHZA 4R8NA 2WKCA 1KJTA 1K3BC 3GQBA 2ZPNA 1EY7A 5M3MG 1IKLA 2MQHA 5EBDA 2L3ZA 4FBJB 2I1KA 1SYCA 2IWHA 5FOBB 5LMUQ 4OZAA 4BY1G 1FYCA 2KQ7A 3W2DA 5DM73 2BYEA 2JU6X 1F77A 2E74C 1A63A 1STHA 3QAQA 4N6EB 1CKNB 2PMVA 1HZ6A 1I50B 2SDFA 3GO5A 1G6ZA 1VQJA 1GUAB 3C0RB 2LWPA 4R4CA 1F2RI 1C78A 1WE7A 2NVYB 5JPNC 5JPMC 1N36L 1SJHD 4QCLA 2QDFA 2F1MA 3CCUA 1B8AA 2V9HA 5D6JB 1IGCA 4DHZB 3CMMB 4X65Q 2KANA 1JOOA 3NSWA 5IWAQ 2KJHB 1F9QA 4IWQA 1BMLC 4IUTA 2KJ6A 3FAHA 5CC4A 4DV0Q 2IT1A 2KA7A 2E2IB 2MJDA 3UI3A 1WJ4A 1B2TA 2YU9H 5BMHA 4L6TB 5HFYA 1YITA 1TS2A 2EY1A 1WX8A 4XT3B 3DPDA 3VVWB 2KECA 2B2YA 4RA8A 3AB9A 1KAAA 3K7AH 3AE7B 3I56A 4H13C 5AEKB 4ZRQA 2A19A 3WCQA 4OEMB 4XZ4A 3I7FA 5G5GA 2K1BA 4WJ3M 1L0YB 3KF6A 3W1GA 5M3FH 2Z0EB 3A8JE 2IX3A 4WJ4A 4A93G 2WACA 1JWSD 5EPLA 4IPCA 4TUUA 2BS2B 1BOSA 2DYBA 4R8IA 4Q0FA 2B3AA 1I4QA 4OO1I 3G48A 3KLWA 1GUOA 2E2HB 2A68C 2Q8RE 2A69C 1QVFA 3APCA 2L0CA 1D4BA 4DNTB 2B2VA 3E6ZX 1C9OA 3ZKJC 5CR3A 4MGZE 4YCWA 2VQEQ 3KBXA 4MT5A 1XNRL 2F0QA 1B1ZA 3ZNZB 4L63B 1VF7A 2B8FA 2L12A 3PQIA 3PHWB 3R3OA 2JYOA 3VXWA 2QW7A 2NB0A 2D10A 1EEFD 1MKHA 1OO9B 2FMCA 1CFMA 4ABNA 4YWMA 3JYUA 1II3A 4HJ5A 5DPTA 3HOXG 1L0WA 1Y1VB 1QOAA 1OXXK 4KN4C 5E3FA 2YEPF 1PTOF 1STGA 1XWEA 4A3LG 4GMVA 4M0WA 3K5NA 5LMNQ 2FHTA 5M5XB 3H15A 4FYDA 2KQ4X 4XDCA 1TWHH 4J6IA 2EVBA 2UUAL 4NXNQ 4A3MH 2UYZB 2WXHA 4LNQA 1HZAA 3M7GA 1MBYA 1YNJC 2IYDB 3FKIB 3VR4A 4WRDA 1SF0A 5JJKA 2I5HA 1Y1WH 4HEA1 4OVZA 2ZT9C 1HTLD 1SE8A 2AQ3B 5J2RA 4B95A 1UGJA 3KLSX 3AEVA 4DNIA 1UF0A 2K32A 1KIXA 3OW2A 1C1YB 3X0WA 2KTFA 1STNA 2KDMA 3CCRA 4MM3B 1V8CA 3CP0A 1SFOH 2J53A 2WXOA 4XYCA 2N7DA 1PFBA 2EXZA 2HDEA 3ULJA 3DLLA 4LMQD 1PH3A 3ABVB 5IP4D 2ZJQA 4XIGS 1PHJA 2F3WA 2VXWA 2F4VQ 1JQYD 5A2QE 4BBSH 1QKZA 4M02A 4LJPB 4QUCA 1EOTA 3K9PB 4PS3A 3LWUA 2I07B 4NJ6A 5J22A 2M8SA 2ES2A 4HTHA 3OTOL 1UEBA 2B2YC 4FXDA 3KUCB 1J6QA 2OEOA 4QIWE 1VRAB 1M4VA 2INPE 4JQWC 2M19A 2K3UA 5EKKA 2N8NA 2IY0B 1NTGA 2ASQA 3N9YC 4KV2A 3SHQA 1SMYD 3C3LA 4MGYE 5DNFA 1V9JA 2L8JA 5ELCA 2CKZB 2F0TA 3A55A 4JBJA 2QSDA 1PRTB 5IYCG 3BVGA 3DBRB 5EQ0A 3PZ8A 4EFOA 1JRPA 2LJIA 4X3TA 2FCNA 1RL2A 3J81E 1I94Q 1STEA 1KNEA 4A3EH 1XX8A 1Q90A 4PK1A 1D5MC 1VQAA 2KVZA 2YLMA 3BZDB 3GOEA 5E6JA 5GADC 4L5TA 2R92G 4E3CA 3BK2A 2JT4B 1EY5A 1C4CA 4W9JA 3PRMB 2KUMA 3KLRA 3T3NA 3FC4A 1XNQL 4HKQA 2JJQA 4X64L 2L1BA 2UUBL 3J7AF 4EZLA 1PH7A 1E7PB 5IGFA 1HNZQ 4EGVA 1HHVA 1RTOA 2JSVX 2PE6B 2B3GA 3H3VC 1VQCA 3KDFA 1WF9A 2D11A 4NPNA 2UXDL 2V4LA 4ARCA 4K7SA 4ULLA 1SIJA 3H6NA 3CCVA 2NVQB 1E90A 5I4DA 1TWCB 2MBBB 2MJEA 5HURA 3NUCA 1JROA 1I4RA 3R8BA 4ZYSA 4W9GA 3JAMc 1JICA 1H9RA 3S14B 4GZYC 1PTOB 3W5VB 2C5CA 3TZDA 1TJEA 1EWYC 4R4TA 3I4MG 3A7AB 4XYQA 1K51A 1PGXA 4YWKA 1FNUA 1UAPA 1ONLA 3S1MH 5IKCM 1UWVA 1JJGA 2MP2B 1SNMA 4C2MB 5EDSA 1R4MB 3TMPB 1MFWA 1V43A 1EF5A 2VZKB 5GXGB 2ACZB 3V6EB 3EQLC 4JV5Q 1O7ZA 1M1KC 2CJOA 4B9WA 2PI2E 4JI8L 2DX5B 1V81A 2BYVE 3RMKC 1SXTA 4LLGM 2A4ZA 3FPPA 4ZAIA 5KIXA 1BDOA 1L5PA 2MA9B 3RN2A 1WMHB 4XDDA 2DUDA 5KNDA 1PYBA 2ID0A 1HTPA 5M5WH 1NYRA 3ZNGC 1L6VA 2J42A 1UE6A 4DN4M 2K8BA 2LMCA 2MFIA 1A70A 1WRIA 4A3CG 2A5HA 1E3PA 2KENA 2RQXA 4Y7NB 1C7YA 3T53B 5C4HA 4P75A 3CXCA 5IT9c 1U5KA 3UDIA 2KK8A 5EE1A 3UDGA 4A6QA 3S24A 2C5LC 4REZA 3MFYA 2E5LQ 3C46A 3HVDA 5D3IB 5IN7A 1IBKQ 3EFUA 3M4QA 4HSVA 1K83B 2N0SB 5IOCA 1S5ED 5M9OA 2O2VA 1EF1A 3JAMi 3DWAA 1EL0A 1WXAA 1YN3A 2UUCQ 1XF5L 1QCBD 1LTLA 4F7XA 3NQIA 4OO1G 1KXLA 3U7DA 3D32A 2D62A 4LF5L 2JVCA 1AW7A 1B7YB 4KY7A 4A3IB 1BCPD 1HZCA 1WTWA 2YU9B 2BYFA 3I57A 4HDOA 4NZLB 3BJUA 1FFVA 2R7ZB 1J9OA 1CSQA 1X3PA 2PZUA 1ROEA 3K7AB 3L13A 1GUNA 2D2QA 3QWNA 5T8IA 4K0KQ 1MG8A 1J5EQ 4OONA 3CMEA 3S17H 3AXCA 3OJ4B 4DWFA 3RNFC 4LCDE 4K3CA 3TN2A 5J18A 4JI7L 4KN7C 2ONQA 4RMFA 1LTTD 2XN9C 3NZSA 1UBQA 1JQ4A 2W54A 1FRDA 1WVLA 1F9RA 2ZNVC 4RWSC 2VZAA 4B3MQ 4IKGA 2GI9A 3LDZE 3PUVA 3HOYG 4HLEA 1EQTA 4A3BG 2L52A 4HCPB 3JC66 2M9VA 1YQBA 2NVUI 1KH0A 2ZCCA 1ENAA 1E8ZA 1Q81C 3GDEA 4PMCA 4OWXB 2ZCBA 2AKWB 2K0PA 2QHOA 2AWTA 2ZZPB 1N6ZA 5GAEC 3VRBB 1LT4D 1T0QC 2XK5B 5G3LF 4B6WA 3VR6A 2Z9HA 3SR1A 4HPMB 1WTRA 5FO8B 5CV5A 3GTOH 5KYLA 3AH7A 3QARA 2Z8LA 3Q6BA 2NBFA 1V1OA 5C6AA 4A76A 4RM8A 4LK1C 4MZ9A 4FO2A 2PKOA 1I3QH 3MJWA 3AE2B 3AYHB 3HOWH 2KKCA 2V3SA 3FP9A 1AE3A 1I6HB 3QB3A 2WQYB 1KHIA 1G51A 1PFMA 2JYEA 1XQQA 3NBIA 1EY8A 4JL9A 3VH4B 2FJ2A 2R93G 2R7FA 1N33L 4JI6Q 4HJGE 2KVMA 1Z2MA 3LGJA 2HQEA 4HRSA 2L83A 5C4XH 3CF5A 1T0YA 1VLBA 1YBYA 1C0AA 4G11A 4JC0A 4C3IH 4IJLA 1VQDA 5DPRA 2IO3B 4NAWA 1A2UA 3NE5B 4JYAQ 2LXKA 4W9EA 1XPUA 2Q2TA 4E71A 2KO3A 1VQIA 2K39A 5IODA 1HNWL 3M3YH 2RA4A 2L32A 1N62A 3NZ3A 4QF4A 3MA2B 1GD7A 3TP6A 4H44C 3D4WA 3L16A 2RVLA 4GLAC 2LGDA 1SB3C 4GOPB 2BQQA 1T6BX 1RODA 1YJ9A 1PV4A 3NVZA 1STYA 2HCCA 3HM6X 4ZDVA 3SVMA 1WE6A 1LTRD 4C3HG 3PF5A 5C3EG 1G2TA 4RF0A 2BS4B 2XWBB 3BZKA 3WDNA 2F3VA 3SK4A 3J80E 3DBLB 3QO2A 2JA5G 4NMZA 4RCNA 4NPSA 3P20A 4NKLA 1DOIA 2NBVB 2WXGA 1EQRA 1MHHE 5EJWA 4XXEA 1EIGA 4NP5A 1KFYB 3VR3A 1GG3A 1PUTA 2M0XA 1SMYC 1XXGA 3QR8A 4PV1C 4CJ2C 5M3MH 2ZPYA 1SIFA 2JWZA 1U9RA 4PQXA 4BY1H 3HKSA 4KKTA 4DR2L 2WXMA 1VJKA 3E56A 4DV3Q 1IKMA 1C8CA 1YMHE 4LNKA 1A3VA 5FO7B 3CCLA 2BYTA 5BN4A 3VAWA 2KDBA 4MSQB 3A33B 4A3EB 4DV5L 5C3WA 2BF8B 1KRSA 2RDHA 2V1CC 4DK3C 1KLUD 3A8KE 3AEFB 1G6PA 5L95C 3DQVA 1VF5C 1QZGA 2G45B 2N3SA 1W2BA 4LF4Q 1JJ2A 4OX9Q 3J9CA 4FXCA 3P4QB 2YTVA 4B3RQ 2NVXB 2FCSA 2ENBA 5L37A 3PLUA 5I2XA 2OTLA 1X32A 1OXTA 4TKOB 3RZWC 4P74A 4YCVA 4ZRZA 2XSCA 4LF9L 3H1UA 4HK2A 2RGFA 4EE2A 5C44G 3G71A 4W9KA 1KRTA 5A2QL 5IGEA 2DJFC 4DR4Q 3ULLA 4GNXA 1TS5A 5LL6X 1NY4A 2KOXA 3H3VI 3Q3OC 1QILA 3K7UC 3TUOA 4K5XA 1N9WA 3OOCA 2DY8A 2LI5A 2W82A 1I50H 3TSSA 2GMIC 4TV3A 1JOQA 5C0XH 2K5HA 2G9HD 2NVYH 4L5SA 2L15A 1V1PA 4RGTA 2JA7B 2BA1A 3J81j 3BDOA 2IHEA 4IPHA 3F2BA 1EIHA 3K57A 2RSOA 1LM8B 3NELA 4NB3A 5AJ3Q 1VR9A 2LD9A 4WWOA 4BXXH 3ZJVA 1QUQB 1HR0L 4UP7A 2F0SA 3TL5A 2M0AA 1KNAA 1PFDA 4RHRA 5HGTA 3RLNA 1KQSA 3NBHA 5JXVA 5FLXc 1QNUA 2EJFC 4FF2A 1TVXA 3PUXA 3J81L 4HN7A 4JLCA 1E7VA 1DOLA 3TQYA 1VZ8A 1EU4A 1LYLA 2K22A 3NS8A 4J3OD 4US9A 3ZQ4A 3KFUA 1U0LA 2WXRA 2NZHA 2F0JA 1O78A 3MWYW 1NNXA 4DV6Q 1RWSA 2KCCA 4YL8A 2KFKB 4CGYB 2D3BA 5JVG3 2F0UA 4MH0E 1EFID 3A7LA 4R4IA 2JA6B 1A15A 1K8OA 1GVPA 2R61A 5IP7H 1T0RC 1HPCA 1RTNA 2KCTA 3DXJC 1IBML 2QEJC 2GBJA 2LVPA 1DJRD 2EOTA 2WDVB 5ELBA 2V4IB 3VFKA 1OQRA 3AEBB 4A3GG 4NDXA 2E2HH 2CFMA 3B6YA 2PE9A 2A74C 4OZBA 5LLIA 1R9TH 3AV8A 1DGSA 2ZTCA 1NI3A 1CM9A 1S40A 3SDLC 4ANWA 2Y0SB 1FVIA 3KOJA 1SSNA 4F88A 1AH9A 4OL7A 4JCVE 4OWWB 4WJNA 5JHBA 1FL0A 4GOCA 4ZUJA 4BS9A 1N63A 3IAM1 2WYQA 4IPDA 1BCPC 3MC0B 3DHGC 1Y8OB 2D3AA 2JSOA 4LFCQ 3W5OA 1VZ7A 2WXPA 3EROA 2V3PA 3B2GA 3HOUB 4ZHPA 4M01A 4UHVA 4XQQA 3VYUA 4TKNA 2V1YA 4EX5A 1YZ6A 5K36G 1D7QA 2KD0A 2C7NB 5IP9G 4OIJA 1SE4A 2KHWB 3U30A 4A75A 1N32Q 1CZPA 2HIVA 2EYJA 1WY8A 4GDLA 2UXCQ 1A6XA 4MJSB 1DD2A 2NCNA 2DZKA 1V1QA 1TIID 2VQFQ 1WXVA 4A3FB 3FKIH 4A3DG 3B0AA 3IFWB 5IIFA 4GNXC 4YSZB 5TR5A 4KDIC 1ZGUB 2O2LD 2N9EB 4PYUA 4IDIA 1IUEA 2KQSA 3EJIA
chains in the Genus database with same CATH topology
1L0VB 5EPKA 1K8MA 2AWNA 1F2LA 3AM9A 3VR5A 2K5PA 3WOEA 2F0VA 2Z4IA 2F0LA 1Q1BA 4OIKA 1TKYA 1ZE3D 2DYOA 1FXIA 3P1MA 3E5SA 3J7AV 2J4XA 1PDXA 4EVOA 1I3QB 2NMQA 4BA1I 1FD7D 3HOWB 3AE9B 5T1IA 3S1QB 2ZXRA 1KDBA 3NVVA 5J1ZA 1LT5D 1AP0A 2E2DC 3QOLA 2Y5PA 1GHKA 2I38A 1GUSA 1JW9D 2VB2X 1R7SA 1CT1D 2PCFB 1A3UA 1FM0D 1WXQA 2BOSA 2RPVA 1L4ZB 3M3YB 1AZPA 3RLFA 1HFGA 4H7BA 3FDTA 1IYVA 2E2JB 4KI0A 1I7HA 4B0MA 2IGHA 1PMRA 4IFDI 1NVID 1CQFA 1C4PA 1NEKB 2B2TC 2NYZD 1ZEQX 3MXPA 4R9WA 1KRHA 3MEHA 2ZW1A 1GPXA 4IUNA 4C1NI 5I2YA 1AYFA 3O13A 5M3MB 4EQNA 1YN5A 1PTOH 4BY1B 4V0BA 3ERQA 1BXTA 1SE2A 4RGMA 1STBA 3I91A 3V2TA 2W3RA 2R3ZA 4G57A 1LTGD 3IKJA 2AUKA 4K5WA 4DAVA 3K58A 3SFEB 1BR9A 4ZKCB 2QIEB 4TQ1A 5LNK1 4OO1H 2FINB 2M56B 5ELFA 4G7ZC 1FMAD 1RM6C 2PVOD 2BBCA 3KWLA 2SEBD 1DGJA 1QOFA 1TS4A 1QJOA 4E6IA 5C5MA 1IBXA 1TY2A 2PZTA 1FRRA 4XQJA 1S4ZA 2IX0A 5KYIA 3Q69A 1OXSC 4LAAA 1EWHA 2DNEA 3IT6B 2F0OA 4ODGA 4A93B 1R4QB 2JX5A 1TKGA 3J80L 2Q5WD 4IZ8A 2J52A 2N9KA 4N9PA 2PTLA 1NYQA 4JX1C 5CV7A 1YJJA 4I65A 4HCSA 3W9CB 4B0EA 5CYUA 4YSYB 2G1EA 5IGDA 2WV6D 3Q8FA 5JEAG 3AEAB 1WTPA 3DWGC 3IFTA 3HP3A 3P1HA 2DY7A 3HOXB 1DONA 2B76B 1JMLA 3ITPA 1NCVA 2IJ0A 1TS3A 1S5CD 4KX6B 3GTQB 2N88A 3OW7A 1R9TB 3OIPA 1RJTA 1N5WA 1EY9A 2WXJA 3VQIA 2ICIA 1IGDA 5CBAE 4WAFA 3SE0A 4MACA 3VYTA 4XDXA 1I6VC 5JVH3 1C79A 2NTSA 5KNBA 3NVYA 3M4OB 4KGTA 5C5LA 2DBYA 3UI2A 2EZVA 3D3RA 1TZOA 1DYQA 4OGQC 3OWEB 4IN3A 4LJZC 1H9SB 4NJCA 2CJNA 3L9AX 1PZJD 5EKIA 1G2SA 2O5IC 5D3DA 4RHSA 5TSSA 2R6GA 1HFNA 1FNWA 3SFDB 4A55A 1JE4A 4J8QA 1P7EA 2F03A 2R92B 4RNAA 2E3TA 1XO3A 4IUUA 5HG2A 4C3JG 5AUKA 4B08A 4K6DA 1C48A 1OQQA 1XLPA 1SYEA 1B4OA 4IFDG 5KRUA 4US8A 2EYPA 5AFWA 2L4NA 3SDZA 3M85A 1BCPF 1T5XD 2QMTA 3P75A 4EQOA 5CGKA 2CQAA 2KN4A 1UWMA 2B2VC 4C7YA 4OW0A 2JXTA 2M2LA 3I4MB 2I46A 2EDGA 2H1EA 2V4DA 3LWEA 2XNAC 3FMCA 4P2CB 4DA2A 4FF3A 1LTBD 2PNRC 1SNQA 4O42A 1MVKA 4XWWA 2EY2A 1PRTD 5ELDA 1HUNA 1JWMD 5FO9B 3EJIA 2LKVA 3RZOB 1HCZA 3P4PB 5JJZA 3B9JA 4ZLTF 5C4JB 2YEPB 1QNKA 4GDKB 4DAPA 3NTIA 3KLSA 2DN8A 2ZXOA 1IW7D 2X38A 4KY6A 4WIPA 1BF4A 1WTVA 1YQ3B 1GXDC 2JWUA 2EY6A 1DOYA 1GUGA 2AUJD 3DWMA 3CU7A 2SNMA 1VCIA 1BQQT 4UAIA 2F0HA 5KEEA 2GB1A 1S5DD 2AQ2B 3HRZC 3TMEA 4KKIA 1FEHA 1PTOD 2KMMA 4K8JA 2A6ED 3MJ5A 3X3NA 4WFN3 1DOKA 4JPSA 4L8JA 5C0XJ 1D5XC 1LLRD 4MIUA 2VZKD 2C9OA 4ID6A 4PMBA 1E0ZA 1WD1A 3HOYB 3RPFC 4A3BB 1KLGD 5I9PA 1DXMA 4XYOA 5CV8A 3VYRA 2QJLA 1Y56A 1B50A 1WTXA 1FNVA 1K53A 2CHBD 2KJXA 3DMUA 3AE3B 2EKIA 1JALA 1B9NA 4FVMA 3PIP3 4G4KA 2BS3B 3H8HA 1UUPA 2OT2A 1J7BA 1JR0D 1H9JA 1FCCC 3PUYA 2R93B 2MH7A 2RMMA 2XWJB 3EUB2 5C4ZA 5A35A 5G5HA 2LHEA 1S5FD 1IL8A 2L11A 1ZYRD 2EYLA 1KTKA 4TMAB 5BYSA 3GP7A 3E0JA 4TQ0A 3H91A 2DWQA 3GTKB 3TBIB 4F87A 1BUVT 4C1NK 1JOKA 4C3HB 5C3EB 2QCPX 2FBWB 2B2UA 2EYHA 2WLBA 1DOMA 2BA0A 1YQ4B 2JA5B 4KHZA 2RDGA 4RCOA 3DM1A 3ND9A 2NN6H 1Q8IA 3C8YA 1F9SA 1RD9D 3D4RA 2KOLA 1EY6A 4HAEA 3OMCA 2PZWA 4K2KA 3H6MA 3IFDA 1TYGB 3LB8C 1SNDA 1O80A 4LK0M 3NWTA 3M7NA 1S5BD 4R3DA 3GS2A 5BMIA 3PO0A 1SAPA 2D9UA 5CV6A 1E9MA 2DLBA 3AE8B 3HRDD 3PV0A 3VR8B 2K6AA 4ZUIA 5BN3A 2IGDA 2F0DA 1J8IA 5ELEA 5COYA 2AX5A 2IDYA 4H2AA 2BCOA 3A56A 4WWMA 4O1NA 4M1UB 5C44B 2B2WA 2QF7A 3FILB 5IT9E 1Q10A 2K7VA 1EY0A 3VR9B 3DWPA 4L1BA 3T16A 2HDMA 1JB3A 1ACCA 3Q8BA 3IAYA 3RMHA 3GTGB 1XYIA 3NTHA 3GB1A 5CV9A 4A9AA 1PZID 3MAQA 2K01A 2WINB 3S2HB 1YN4A 3J7YW 3OHXC 4CQNA 1PRTC 4Z9CB 2F0MA 4DXGA 4DNRB 3SK8A 5JEAH 1JWBD 3VA5A 3BYYB 1TWAB 2RDFA 2X6GA 4YIJA 3RUZA 3CIRB 2B39A 1E2WA 1Z47A 1IW7C 4A3GB 4P16A 3NPPA 4XQNA 1XCTL 1CA5A 4ZOHC 4WH4A 4RGNA 4RAUC 2MPMA 3CRKC 3SHLA 4MH8A 2ZXPA 2J0TD 1ZXTA 3D6WA 4H0LC 1D1KA 3IAS1 4KV6A 1N60A 1TKWB 2HCIA 4CKEA 2A6EC 2BDNA 2VB3X 4ZHOA 3ZGZA 3T51B 1GOZA 2WXKA 2JP1A 3KBGA 2E76C 3C1FA 2F0WA 2B2WC 1N5XA 4A3DB 5IGCA 1D6EC 1X3QA 3VR2A 4DK0A 3QG1A 3BIID 1CJEA 2K03A 1C9FA 1XCQL 3GD7A 1AEXA 1ZOYB 1RHPA 2PW5A 1SNCA 2WAQB 4Q5VA 4ARIA 1EYAA 1E2ZA 3WOFA 1Y69U 5BYRA 3L3OC 2B8GA 3GV6A 5HI1A 1C4QA 1LABA 3AE6B 2LGIA 4KHVA 1DCZA 3OMGA 3AECB 3NQTA 1EWCA 4IFDH 1QF6A 4ITKA 4C80A 5D65A 1BBXC 5AUIA 2PO4A 2HDLA 2E75C 2WKDA 4K14A 1VDZA 3Q8CA 5C0XI 4YSXB 1QB5D 3SEBA 1LTAD 2A6HD 2L55A 4KGSA 3I4LA 5I6YA 3MP9A 1ZYRC 4FP5D 2XRSD 3ND8A 2BB6A 1SE3A 1ICWA 4GLSC 1TY0A 2J7ZA 2K5DA 3HOZB 1N61A 3S1NB 3BK1A 3HUIA 5ISRA 3B2FA 5E4WC 2JE6I 2JQRB 4BY7B 1ZDXA 1QE6A 1U4LA 3U2SC 2K5WA 1MSHA 5D7GA 3Q6SA 1QWYA 4A8XC 2PPBC 1YNND 5DM63 4J6HA 2ICEC 4HKZE 5BMGA 1SJED 1SEBD 2E6XA 2Z1CA 3I90A 3NS1A 2TSSA 2F0EA 3Q8EA 5FLXE 3BDLA 1B53A 3NK9A 4BWGB 3AE1B 2G9DA 1P7FA 1WTOA 2CW0D 1EQVA 4DQOC 1QOBA 3GV3A 4AQ7A 1AWDA 1SYBA 2EY5A 4IQZA 3P63A 1TWFB 3OPOA 4YTMB 1GAQB 2OXPA 2KQ3A 3D31A 2NZ1D 2AQ1B 2L1AA 4KD4A 4C3IG 2A73B 4HMIA 3JAML 3ETRA 2F4IA 3RZDB 3L4PA 3T13A 2OEDA 1PXUA 5NUCA 4K6LA 5CMDA 1H9KA 2OF1A 3LX0A 3Q8AA 4WURA 1EEID 1I4GA 3U7ZA 3I8ZA 4HMJA 1W6KA 1ENFA 4YWGG 2N9LA 4NW2A 1ESFA 2NTTA 2MHVA 4B9XA 1J7AA 3RD4A 3K5MA 3CQZB 5C3JB 1SYFA 1NENB 4I7ZC 2CVRA 4X3SA 4OZCA 1BO0A 4KK7A 1EYDA 3U9SA 5IT9L 1SDFA 4Q2JA 5FR3A 4AYBB 1JWUD 1PLFA 3BVZA 3Q22A 2XIWA 2ZW0A 4S3SA 1ZKOA 4HCEA 3V96A 4U673 2WP8J 1BUIC 1F2ZA 3HEJA 3S2DB 1ET6A 1JWAD 4C7ZA 3H09A 4DFAA 1SNOA 3S15B 4M8AA 2IW3A 4DGZA 2WDQB 3K6OA 5DEHA 4KY5A 4RF1A 4A3JB 2L9HA 1ZXHA 3C1EA 3Q0AA 1FIQA 2PW7A 1QLBB 2EYMA 3R93A 3W1SA 3GTLB 3FRPB 4YT0B 2I2YA 1PRTF 4C56C 4K2LA 3I4NB 1EM7A 3PZ7A 4RGOS 1V97A 4G7OC 3E9SA 3G7LA 1L6UA 3FEWX 3TEZA 5C0XG 3EGRA 4XTCS 2B63B 3CHBD 3TZUA 1G8ZD 4V190 1TWGB 4IALA 2LMCB 3T4AC 3L7ZC 1IHZA 4C3JB 2KWDA 2V0GA 1LTID 4FXKC 1TKEA 3KWVA 4PT5A 1MGSA 1RF2D 4DU9A 4HROA 2SAKA 1D5ZC 3SK6A 1NAPA 4LTUA 5C2TB 1OFFA 1H9MA 1LTSD 1O7YA 1Q1EA 1T5EA 3CWIA 4KKSA 2BT6A 3P4SB 2A6HC 1WCMB 1V8QA 4CKBA 3KQ4A 1O7LA 4RKLA 1ZPSA 2HUGA 1FO4A 1C4AA 2JYTA 1WYGA 1L0XB 4JE3B 3KK7A 2WXIA 1PGAA 4L23A 3DHQA 2IPKD 3I70A 2F0GA 1PDQA 1I4PA 1JC7A 3D4DA 3A8IE 1NR4A 3NRZA 2LUMA 3S1RB 1ML0D 4ILWA 1I4XA 2WXQA 1F9PA 2H4OA 3DEPA 1FGBD 2WXNA 1YNNC 1PGBA 3HGBA 1XLOA 2LFIA 5H92C 3DEOA 1WSPA 4KGRA 1MHXA 1B3AA 1LT6D 2EYFA 2NUCA 2WS3B 5C3XA 4K5VA 3A54A 1ZP0B 2L5TA 3KUPA 2INNE 4KKUA 2KEDA 2CW0C 3AEDB 4IOIE 3K59A 2K05A 3AEGB 3PO2B 4BBRB 4NAWB 1E2VA 4DXFA 1B9RA 2XRQD 3PIO3 5H8YE 1CI3M 1EYCA 3MVVA 2NVTB 1Q3LA 2VNUD 2QDBA 4KJNA 2Y5CA 3AN1A 4X3UA 3GTJB 1FR3A 1GB4A 3Q24A 2M00A 3KF8A 1IYUA 3GTPB 5EKLA 2K5QA 3EVQA 2MJ8A 5E1FA 1W6JA 1CQVA 3HKZB 2JA8B 1C77A 5JEAJ 2BDOA 2WNMA 1HUMA 2JEBI 3MXGA 2FMMA 4ME5A 2EYOA 1GUWA 5FLXL 1RFKA 3AB5A 5K36H 4IUVA 4RF0A 1G91A 1HXYD 1KDCA 3NTKA 3VYSA 1CZGA 1NUCA 1D2BA 3NHHA 3HG9A 5CORA 4YTNB 4HSPA 1AFPA 1BNZA 1HRJA 1GUTA 2D5DA 5KGUA 3QIAA 1BCPB 3T56B 1LV9A 3EFXD 1ZXIA 1PZKD 2RBMA 3N52A 1KABA 2LEKA 2PMZB 3SXHA 1WTQA 2FUG1 1RDPD 3F2UA 3NUHB 2VUMB 3CKIB 3ONAB 1H9SA 2SNSA 4YXDB 1VMCA 5JAVA 3I73A 3QJYA 5LL6S 3W5UB 3LXFA 3R2IA 1V1PB 4WORA 1WWTA 5EE3A 4ZQ3A 1HQMC 1GHJA 3MFGA 3VRAB 3IL8A 4N59A 2FE8A 4RH6A 1XTCD 1PFNA 5E4XA 5M3FB 1FFUA 2RSNA 1EZ6A 4X3KA 2DYMA 3BDCA 2X6LA 4FF1A 1FCLA 2K28A 1MI0A 1YNTE 4WQMA 4KJOA 3ZJTA 2IL8A 1HEZE 1FXAA 3X3MA 3I72A 2Q8IB 3TP8A 2WXLA 1LACA 5EE0A 1NR2A 4A3KB 3HVZA 4ZKBB 4KTAA 2W55A 4MHEA 1SNPA 2SOBA 3NWSA 4IFDJ 2LHDA 4D2KA 1CZWA 3BVMA 4XE0A 3TP7A 4HR7B 3AE5B 4N9TA 1CA6A 1VZ6A 1KDAA 2KEEA 1LT3D 3JAME 1U4MA 3OSOA 2Z4HA 5LHY1 2JEAI 1MPEA 4TQUS 3Q23A 2F0PA 3AEEB 3RFZB 3BYTB 1TWHB 5MPOA 1HA6A 4A3MB 4P6VF 3H0GB 3SR6A 3DUZA 1Y1WB 4N58A 2CU3A 3AMZA 5EPJA 3U52E 3LNNA 1AN8A 1TR5A 4L2YA 1QOGA 5EBCA 4GDLB 1SFOB 2D5GA 1E0BA 2QILA 2EE1A 2EJMA 4ZRPA 2MP1A 2EPBA 2WB1B 3U9OA 1VDVA 1CHQD 1AZQA 2PVGC 2BE5D 4BBSB 2WXFA 2F0FA 1K50A 2MGSA 1JORA 3QOJA 2X69A 2YYZA 1Z6HA 4ZK9B 5I6WA 1OXUA 3PMFA 3GTMB 2AWOA 3TP5A 1DZ1A 4BA2I 4AS1A 1YJIA 1EU3A 4FNFA 4CBVA 3S9WA 3SK5A 1ZUD2 1QOHA 1TU2B 2BTEA 1F2YA 2V3NA 2LY7A 2LFNA 1Y8PB 4KMUC 3DWQA 4MN3A 1E10A 4DF7A 3ZJUA 1WGKA 1J7CA 2PYKA 5DAUA 3U4EG 4TSSA 1EY4A 1B44D 1SYDA 3TEWA 4QB4A 2WP9B 2B2UC 3K5LA 1UEAB 2JXMB 3AU7A 3C2PA 1QT9A 1HQRD 2EJGC 3I3CA 2NN6I 1GJXA 3D6CA 3R2TA 2W3SA 1F2RC 2QKIC 3OIQA 4FXGC 5G3LD 1QQRA 5EGTA 2Q8TA 2KHSA 3MHBA 3AE4B 3I9V1 1TQOA 1TT2A 4A90A 1ZDVA 1UWXA 3MXUA 2PLPA 2TMPA 2PW9A 1B9MA 2O5JC 2HTME 5IGBA 1NSNS 4RFBA 3ZYYX 2XVSA 4HEDA 1PTOC 3S1MB 4J1MA 2Y3AA 2BW2A 1ESRA 1STAA 4IUPA 4XWTA 5J39A 5M5YB 4IUQA 1Y8NB 5K5PA 1WD0A 3BS1A 1MI2A 1GB1A 4G7HC 4IURA 5F2DA 1ET9A 3HZXA 3PUZA 5CV4A 5KNCA 3P42A 5M5WB 2GRIA 5EE9A 2FFKB 4PMWA 3W3AA 2K33A 4JK1C 4XT1B 3NP8A 1ILQA 2A68D 2A69D 2DNCA 1XEEA 1IBXB 2F0KA 1HZ5A 1CK1A 4USAA 2KCNA 2KACA 3MTSA 1EZ8A 5D14A 1G291 2PIAA 2WU2B 3BWUD 1T3QA 3TDQA 3V3XA 2WU5B 3V05A 2GA4B 2NWGA 1XLNA 4F8MA 2ON8A 2MUYA 3OWFA 4JWSC 3TEXA 2B2TA 4UDUC 2BB5A 1OXVA 3S17B 1DOXA 2IX1A 1U4PA 5FK9C 2F0NA 5JOBA 3MXNA 1SSOA 1YNJD 5BYQA 1M8AA 2H89B 1F0ZA 3M4YA 2WDRB 3CRLC 2H88B 3FILA 3EA6A 3NVWA 5I9OA 4DAYA 1RYJA 4YTPB 1U4RA 1CHPD 4U68A 1A3TA 1FD6A 4QIWB 1UNSA 1ILPA 1Q12A 3GTOB 4TRDA 2KAJA 3T3OA 1RCVD 2IGGA 3AMUA 2MEKA 5CBEE 3VA7A 1LO5D 4JBWA 4K8IA 3D8GA 3K0YA 3P7JA 4CKCA 3IT4B 4DK1A 3N6RA 3TEYA 1F2MA 1XLQA 1SYGA 1QG7A 2EELA 1VMPA 3HS0C 5C4XB 1A2TA 4CJ0B 2LS01 2N7JA 4RKBA 4C3IB 3BG3A 2WIIB 4QUFA 2K9XA 2D2CC 1CTMA 1D1IA 1Z7TA 2F0IA 3MZ5A 4FF4A 3PUWA 2RKSA 3IXSA 1R4PB 5IGGA 4PNYA 1HA5A 4WJWA 2BE5C 5BN5A 3LYYA 3S16B 1SBBB 4QMGA 2PQEA 1MD2D 1I4HA 4EQPA 1ENCA 3PO3B 1PYWD 2MJ3A 2O4XA 1KF6B 3HOVB 3H94A 2NN6G 3NXWA 1RKNA 3P4RB 4KKJA 4CHTB 3FPUB 1JCKB 3G6JB 1K52A 5T1GA 3FVQA 4NAMA 1E6EB 4JWUC 1L4DB 2K04A 2JZPA 1DM0B 3K5OA 2OHFA 5HHDG 2N55A 3URYA 5FKAC 4CJ1B 1MSGA 4KD3A 1C76A 3MHZA 4R8NA 2WKCA 3GQBA 1EY7A 1IKLA 5EBDA 2IWHA 5FOBB 1SYCA 4OZAA 1FYCA 3W2DA 5DM73 2JU6X 1F77A 2E74C 1STHA 4N6EB 2PMVA 1HZ6A 1I50B 2SDFA 3GO5A 1G6ZA 1F2RI 1C78A 2NVYB 5JPNC 5JPMC 4QCLA 1SJHD 2F1MA 1IGCA 1JOOA 3NSWA 1F9QA 1BMLC 4IUTA 3FAHA 5CC4A 2IT1A 2KA7A 2E2IB 2MJDA 3UI3A 1B2TA 5BMHA 4L6TB 5HFYA 1TS2A 2EY1A 4XT3B 2KECA 2B2YA 4RA8A 3AB9A 1KAAA 3AE7B 4H13C 4ZRQA 3WCQA 5G5GA 2K1BA 1L0YB 3A8JE 2IX3A 2WACA 1JWSD 5EPLA 2BS2B 1BOSA 4R8IA 4Q0FA 1I4QA 4OO1I 1GUOA 2E2HB 2A68C 2Q8RE 2A69C 1D4BA 2L0CA 4DNTB 2B2VA 3E6ZX 5CR3A 3KBXA 4MT5A 2F0QA 1B1ZA 4L63B 1VF7A 2B8FA 2L12A 3R3OA 2JYOA 2NB0A 1EEFD 1OO9B 2FMCA 1CFMA 4ABNA 1II3A 1Y1VB 1QOAA 1OXXK 5E3FA 4KN4C 2YEPF 1PTOF 1STGA 1XWEA 4M0WA 3K5NA 2FHTA 5M5XB 4FYDA 2KQ4X 4XDCA 2EVBA 2WXHA 3M7GA 1MBYA 1YNJC 3FKIB 3VR4A 4WRDA 1SF0A 4HEA1 4OVZA 2ZT9C 1HTLD 2AQ3B 1UGJA 3KLSX 2K32A 4MM3B 1STNA 2KDMA 1V8CA 2J53A 2WXOA 1PFBA 2EXZA 2HDEA 4LMQD 3ABVB 4XIGS 2F3WA 2VXWA 1JQYD 5A2QE 1QKZA 4QUCA 1EOTA 3LWUA 2I07B 5J22A 4HTHA 2B2YC 4FXDA 2OEOA 1VRAB 1M4VA 2INPE 2M19A 2K3UA 5EKKA 3N9YC 1SMYD 3C3LA 5DNFA 5ELCA 2F0TA 3A55A 2QSDA 1PRTB 3BVGA 5EQ0A 3PZ8A 1JRPA 2LJIA 4X3TA 3J81E 1STEA 1KNEA 1XX8A 1Q90A 1D5MC 3BZDB 5E6JA 3BK2A 1EY5A 1C4CA 2KUMA 3KLRA 3T3NA 3FC4A 4HKQA 2L1BA 3J7AF 1E7PB 5IGFA 4EGVA 1HHVA 1RTOA 2JSVX 3H3VC 4ARCA 4ULLA 1SIJA 2NVQB 5I4DA 1TWCB 2MJEA 5HURA 3NUCA 1JROA 1I4RA 3R8BA 4ZYSA 1JICA 1H9RA 3S14B 4GZYC 1PTOB 3W5VB 2C5CA 3TZDA 1TJEA 1EWYC 3A7AB 4XYQA 1K51A 1PGXA 1FNUA 1UAPA 1ONLA 1SNMA 4C2MB 1V43A 2VZKB 5GXGB 2ACZB 3EQLC 1O7ZA 2CJOA 4B9WA 1SXTA 4LLGM 3FPPA 4ZAIA 5KIXA 1BDOA 1L5PA 4XDDA 5KNDA 2ID0A 1NYRA 1HTPA 1L6VA 2J42A 4DN4M 2LMCA 1A70A 1WRIA 2A5HA 2RQXA 4Y7NB 3T53B 5C4HA 5EE1A 4A6QA 4REZA 3MFYA 3C46A 3HVDA 5D3IB 4HSVA 1K83B 2N0SB 5IOCA 1S5ED 5M9OA 1EL0A 3DWAA 1YN3A 1XF5L 1QCBD 4OO1G 4F7XA 3NQIA 2D62A 1AW7A 4KY7A 4A3IB 1WTWA 1BCPD 2YU9B 3I57A 4NZLB 1FFVA 2R7ZB 1J9OA 1X3PA 2PZUA 1ROEA 3K7AB 1GUNA 3QWNA 5T8IA 3TN2A 4KN7C 2ONQA 1LTTD 2XN9C 1JQ4A 2W54A 1FRDA 1WVLA 1F9RA 4IKGA 4RWSC 2GI9A 3PUVA 1EQTA 2L52A 2M9VA 1KH0A 1ENAA 4PMCA 2K0PA 3VRBB 1LT4D 5G3LF 3VR6A 3SR1A 1WTRA 5FO8B 5CV5A 3AH7A 5KYLA 2Z8LA 2NBFA 1V1OA 5C6AA 4LK1C 4FO2A 2PKOA 3AE2B 1I6HB 3QB3A 2WQYB 1PFMA 2JYEA 3NBIA 1EY8A 2FJ2A 4HJGE 2KVMA 2HQEA 4HRSA 2L83A 1VLBA 1A2UA 3NE5B 5IODA 2RA4A 2L32A 1N62A 3NZ3A 4QF4A 3MA2B 3TP6A 4H44C 3D4WA 2RVLA 1SB3C 1T6BX 1RODA 3NVZA 1STYA 2HCCA 3SVMA 1LTRD 4C3HG 1G2TA 2BS4B 2XWBB 3WDNA 2F3VA 3SK4A 3J80E 3QO2A 1DOIA 4NMZA 4RCNA 3P20A 4NKLA 2WXGA 1MHHE 5EJWA 4XXEA 1EIGA 4NP5A 1KFYB 3VR3A 1PUTA 1SMYC 1XXGA 4PV1C 4CJ2C 1U9RA 4PQXA 2WXMA 4KKTA 1VJKA 3E56A 1IKMA 1C8CA 1YMHE 1A3VA 5FO7B 2BYTA 5BN4A 4A3EB 5C3WA 2RDHA 1KLUD 3A8KE 3AEFB 1VF5C 3J9CA 4FXCA 3P4QB 2NVXB 2ENBA 5I2XA 1X32A 1OXTA 4TKOB 4ZRZA 2XSCA 4EE2A 5A2QL 5IGEA 1TS5A 5LL6X 3TUOA 1QILA 4K5XA 3OOCA 2DY8A 2W82A 3TSSA 1JOQA 5C0XH 2G9HD 1V1PA 4RGTA 2JA7B 2BA1A 3BDOA 1EIHA 3K57A 2RSOA 3ZJVA 1VR9A 2F0SA 2M0AA 1KNAA 1PFDA 4RHRA 5HGTA 3NBHA 5JXVA 1QNUA 2EJFC 4FF2A 1TVXA 3PUXA 3J81L 4HN7A 1DOLA 1VZ8A 1EU4A 2K22A