1JCKB

T-cell receptor beta chain complexed with sec3 superantigen
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
239
structure length
239
Chain Sequence
ESQPDPMPDDLHKSSEFTGTMGNMKYLYDDHYVSATKVKSVDKFLAHDLIYNINDKKLNNYDKVKTELLNEDLANKYKDEVVDVYGSNYYVNCYFSSKDNVGKVTSGKTCMYGGITKHEGNHFDNGNLQNVLIRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIESNGNTFWYDMMPAPGDKFDQSKYLMIYKDNKMVDSKSVKIEVHLTTKNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a T-cell receptor beta-chain complexed with a superantigen.
pubmed doi rcsb
source organism Mus musculus
molecule tags Complex (toxin/receptor)
molecule keywords 14.3.D T CELL ANTIGEN RECEPTOR
total genus 63
structure length 239
sequence length 239
chains with identical sequence D
ec nomenclature
pdb deposition date 1996-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
B PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1jckB01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1jckB02
4RHRA 1FNUA 1BCPF 2RDHA 1PTOC 2AQ1B 1SE3A 1EEID 1ENFA 2J4XA 1XTCD 1PTOF 3GP7A 3DWPA 2R61A 1ET6A 1MD2D 3V05A 3W2DA 2XRQD 2QILA 1S5CD 4RH6A 1S5BD 1FNWA 1STEA 5ELCA 1BCPC 1V1PA 2WV6D 4OHJA 4RGMA 1YN3A 1GOZA 1HTLD 1LTID 1ESFA 1LTRD 1EWCA 1LTGD 2XNAC 5D3IB 1EU3A 3O13A 2ICIA 1I4RA 2G9HD 5I4DA 3OWEB 1HQRD 1I4QA 1D5MC 1PTOD 1YN4A 1EFID 2IPKD 1I4XA 1B44D 1S5FD 4BWGB 1G8ZD 1KTKA 2CHBD 1D6EC 4UDUC 1HA5A 1UNSA 2SEBD 1JWMD 2RDGA 1PZID 4TSSA 4RHSA 1LLRD 5TSSA 1CQVA 1PZJD 1YN5A 1BXTA 3URYA 1V1PB 1SE4A 1BCPD 1RD9D 1DYQA 2TSSA 1TY0A 4DXGA 1FGBD 2AQ3B 3EFXD 3DWQA 1TY2A 4RCOA 3BVZA 1SJED 1D5ZC 5ELFA 1KLUD 1LT5D 1PRTC 1DJRD 1I4PA 1ET9A 1RCVD 5ELDA 1FD7D 1LT3D 3MFGA 1LT4D 3BYTB 5FK9C 4K6LA 2QEJC 4RGTA 3TSSA 3R8BA 1B1ZA 3EA6A 1JQYD 1JCKB 4L6TB 1S5DD 1SBBB 1PTOH 1KLGD 1PTOB 3R2TA 1V1OA 3MC0B 1PRTF 2Z8LA 1CHQD 1LO5D 1D5XC 1AN8A 1L0XB 1M4VA 3BZDB 3BVGA 3BVMA 1JR0D 5D3DA 3SEBA 1LTBD 1UUPA 1BCPB 1SJHD 1S5ED 5ELEA 4O1NA 1XXGA 2XN9C 1EEFD 1SXTA 1SE2A 4RFBA 5FKAC 1T5XD 2NTTA 1JWSD 1TS5A 4DXFA 1PZKD 3DWAA 4RGNA 1L0YB 3BYYB 1I4HA 2AQ2B 1JWUD 1TS4A 1FNVA 1HXYD 1QILA 1PRTB 1AW7A 1TS3A 4RGOS 2O2LD 4NZLB 1RF2D 2XRSD 2IJ0A 3R2IA 4C56C 1LTSD 1F77A 1CT1D 4ZYSA 1LT6D 5ELBA 4L63B 1TS2A 2NTSA 4Z9CB 3KLSX 1PYWD 1LTAD 1PRTD 1EU4A 1RDPD 3CHBD 1CHPD 1LTTD 1I4GA 1SEBD 1CK1A
chains in the Genus database with same CATH superfamily
1SYGA 1PTOC 3LX0A 1SE3A 4X62L 2VQFQ 4PMCA 1XTCD 4NAMA 1TKWB 5KHOA 2F0GA 2I2YA 1I6VC 3S2HH 3S2HB 4JBKA 1N62A 1ASZA 4JI8L 1V5TA 4K3BA 3HS0C 3AB5A 1TIID 4YCVA 3M7NA 1SAPA 4DR3L 3U4VA 4ZRKA 2PMVA 5FO7B 2BQQA 3CCVA 2WXFA 2QDFA 4WJOA 3QR8A 2KT7A 2DY7A 2HDLA 1NMFA 5D3IB 1EU3A 1U4RA 2I07B 2WAQE 1C77A 1S72A 2MX2A 4IFDH 3OPOA 2KUMA 5M3FB 4LNFA 5EPLA 3K80C 3N52A 2O5IC 2WXQA 3NQTA 5L83A 2NB0A 2QKIC 1OTCA 1AWDA 1YNNC 1MKHA 1DXMA 1B70B 3O65B 2NUCA 4PMWA 1Z7TA 3K58A 2AUKA 3FEWX 3HOZG 5G5GA 1LXDA 3RZOH 2R92B 3HUIA 4DV0Q 3M4OH 5JJIA 2KD0A 3TRZA 3S9WA 4DR4L 1LLRD 4K6DA 5TSSA 3UE0A 4X3SA 1L0WA 1AYFA 4HRSA 1VD2A 5JZEB 1V1QA 3R93A 4DR5L 3NWTA 1FMAD 3PHWB 3OIQA 1XMOQ 1MI0A 4M02A 2HT1A 3WDNA 4LF5Q 2A6HC 3U4EG 4WRDA 2Y5PA 3QOJA 2R2QA 4C7YA 4ZRIA 4YY3L 1K53A 2QSDA 5DM63 5G3LF 1BMLC 2F0JA 1JOKA 5IYDH 1V43A 2MJ8A 2ZM6Q 1DOYA 4C3IG 2DLBA 2HDEA 2LZ6A 3HKSA 3R8BA 2LXAA 1SSNA 2LUMA 2CW0D 2HCIA 1KRHA 2JA8H 3EIVA 4GN3B 4A93B 1IGCA 3PSEB 4JPSA 2EY2A 1V1OA 3U30A 1PRTF 4J15A 4F7XA 4PZ6A 4KHPQ 2FUHB 5IAAC 2KMAA 3ML9A 2GRIA 3QQ8B 3ND9A 4NJCA 1U4MA 5CHWA 4TUUA 1RODA 5LL6S 5LHY1 1I5FA 4LF6Q 1K8AC 3BWUD 3PQIA 4N9TA 5KEEA 2KZRA 4ZDVA 2W3SA 2WHIA 4W9FA 2MCNB 1A3UA 1TR5A 3TEXA 1L2NA 4V0BA 3M4PA 1H9MA 2UU9Q 1NNXA 2LRWA 3C2PA 4PMBA 1E1TA 1MBYA 5M3FG 2F3VA 2KMMA 2ONQA 1GXDC 1QOHA 2JE6I 1NYRA 1RLFA 3NHHA 5D14A 2IGDA 3G6JB 1TZOA 1G6PA 2AWOA 3AE6B 3PRMB 2MGSA 2VS1A 3MEFA 1WXQA 5JHAA 2GBKA 3C1FA 2PZWA 2F4VL 2PQEA 3PUZA 3FILB 1G6JA 2R92G 2GN5A 4L2YA 5EE0A 4H7BA 4DR3Q 1LT6D 3AEGB 1V6EA 2CKZB 4LF8Q 2C9WB 1GAQB 3KLSX 2WXOA 4NJ7A 2PVGC 2JEAI 4FP5D 2A4ZA 1RDPD 1PXUA 2HTME 3C19A 3L17A 5C2TB 4A55A 1NI2A 2MFIA 1I6HB 3B2GA 3BINA 2MP2A 1HZ9A 1BCPF 3PCOB 4KV6A 2M00A 5KGUA 4A3KH 1DONA 2J4XA 1N33Q 1XPRA 1XYIA 3AE4B 1PTOF 1CA6A 1LGRA 1VQHA 1SNCA 5CHVC 4DF7A 1KF6B 4G11A 2R7ZH 2R6GA 2BS3B 4DAYA 2FXQA 4GLXA 4D2KA 3GTPH 1S5BD 3A5ZB 1V1PA 1N9WA 1FGUA 4CJ2C 4POFA 2D62A 1YN3A 3GTGB 4C3JB 4HJKA 4KN4C 2AX5A 2G4SA 1EY9A 4GB9A 1GB4A 4X57B 1NENB 4LF5L 4FXCA 5GAGC 4L8JA 1WE6A 4IPCA 2UXCQ 1V86A 1C9FA 3K6OA 1N34Q 2J0MA 3A8JE 3HGBA 2DNEA 1DGSA 1PFBA 3Q8BA 3ZUNA 2NR2A 1QCBD 2HD5B 3D6WA 3ONSA 2BDNA 2JU6X 5IOIA 3DOWA 5IP9H 2ZNVC 4X3UA 2DAJA 5CHFA 2UUAQ 4RHSA 1C9OA 5C3WA 1LABA 3A1QB 4FA6A 3JAML 1V1PB 2KC1A 1ZPSA 4XYQA 4OGQC 1DYQA 2DZJA 3UQAA 5I2YA 3TDQA 1FGBD 2LD9A 3NBHA 3IXSA 1TY2A 1WJ4A 3RN9C 3NS1A 3IL8A 1P0RA 4ME5A 2BTEA 1Z6HA 3FPUB 2WDQB 3D32A 3E6ZX 2QEJC 3LWEA 3TSSA 4NXNL 1Z9FA 1YX6B 1J9OA 1WCMG 3TEYA 4FXGC 1PVOA 3MTSA 2GB1A 1PTOB 4DHJD 2PO4A 3P75A 1LO5D 4IN3A 3J7A5 2MBHA 1PFSA 3AFPA 1SFOB 1QF6A 3TJPA 1KAWA 4G57A 5D2MB 1RTNA 4QCLA 1UE5A 3CPFA 3CD6A 4EVOA 4YHHQ 5EE3A 5ISRA 4JI0L 1ILPA 5EKLA 4JE3B 3NTHA 4BKGA 5DNFA 5C4JH 4DR6L 3QCAA 3DBLB 5FKAC 2KVRA 2RHQB 2R93G 1K8RB 2C7NB 2FBWB 1JE4A 4JI5L 1I94L 1SMYC 2A73B 4RGNA 3RMHA 2HJ1A 3OAWA 2AQ2B 3TIXA 5EBCA 1Q82C 4HIDA 1Q46A 1C8CA 4MH0E 4X65L 4OVUA 5GXGB 2V3NA 4A20A 1Y1VH 1GUWA 3T8MA 4AWJA 2G3QB 2E2JB 3CQZB 1K0SA 5HURA 4DUZL 3S1NH 5LMNQ 2BS2B 4ALPA 4NJ6A 3A5UA 5IE8A 2D10A 3FAHA 2PW9A 1FVIA 4NY0A 4J3OD 4EEWA 1UWXA 1H95A 5BYQA 4HJ9A 1IXRA 4OVVA 4OWTB 4ID6A 2IX3A 2FE8A 1C4PA 3IBEA 4KKIA 3CCLA 4B0EA 5IP4D 1A15A 2IW3A 4IWQA 1PYSB 1Z5SB 4HJGE 4BOSC 3VFKA 4IJHA 2L5TA 5J1ZA 1XNQL 2KCTA 3NE5B 3H6NA 3GV3A 4JQWC 5BMIA 4K0KL 2KCMA 3TS2A 4UP8A 4OVZA 4CO7A 2NVTH 2F3IA 4B3MQ 3GOEA 1S5CD 1MJDA 2YU9H 5E6OA 2G4DB 3A55A 2L00B 1R4NB 4MDKE 1BCPC 2ZTCA 2V9HA 2FCQA 4BBRB 1JW9D 1EY4A 4ANXA 2IL8A 4B3RQ 2L32A 3B2FA 1E8YA 2MPMA 4MHEA 1MI2A 1ESFA 3ZJTA 4DAPA 2KDMA 2LS01 4ZLTF 2R2OA 5D94A 2B2WA 1EYDA 3OWEB 2WS3B 4JK1C 3G6EA 4RM8A 5C1ZA 2CS4A 3TP6A 4CKBA 2J53A 1D6EC 1MVKA 4DR2L 2ASQA 4JI1L 3QG1A 1VR9A 3SK5A 2L1AA 1TXYA 2GA4B 1ZEQX 4G50A 3DVNV 1GNUA 4BXXG 4W9LA 3L9AX 3AM9A 4GIVA 3KF8B 4TSSA 2H5XA 4XWTA 1N34L 4GNXB 4YTPB 1VF7A 1RRBA 1F2RC 4XQNA 2RQXA 1V8QA 2D5GA 1OQYA 4JI1Q 2VUMH 3VVWB 4RCOA 3TP5A 3A7AB 4S3SA 1YNJC 3I56A 1PRTC 1UWVA 3KLSA 1WCMH 1X55A 1EZ8A 4LF4L 1KNEA 3RUIB 3ZJUA 2ES2A 2QMTA 4K5WA 2PKOA 2KQSA 3WCQA 2L0TA 3M9BA 4JC0A 2C5CA 2LVQA 5DM73 4DAVA 4II3B 1IP9A 3E0EA 1FM0D 1IL8A 4DR4Q 2MA9B 1TT5B 3HOYH 1L0XB 4HDOA 3FRPB 3G4SA 4KN7C 4A3BG 2WXNA 3ENEA 3BVGA 3AI5A 5IYBH 4XXEA 4BY1G 5D3DA 2IO3B 1PFNA 3MJ5A 4WWOA 3AQQA 1K8GA 2PW5A 4W9KA 4KVGB 5NUCA 4K3CA 1NCVA 1VQMA 4BBNF 1LTLA 2WKCA 3CMEA 4JI3L 1O7LA 3K0XA 1YIJA 2EYFA 5IY0A 3NSWA 2PTLA 5IGFA 5C0XG 1NE3A 2PI2A 1Q0WB 1WGGA 4A3DB 2KCCA 3GE3C 2PQAA 3M4YA 1IBKQ 4F1SA 2QIEB 3VDYA 3AE5B 1WTWA 2RPVA 1PH1A 4JV5L 4DK1A 1EY6A 3M4OB 2NZOA 3BU2A 2VB2X 3HRZC 3ZNGC 5A35A 3AEBB 2N0SB 2WIIB 1EO6A 4LUOA 3J81i 3T1HQ 3S1MB 1HZAA 4O0AA 5BN5A 1VMPA 5A2QL 2BCOA 3UI2A 2Z0SA 3FC4A 1C79A 1P3QU 2K5QA 2RDBC 2KOLA 4K7UA 4YWMA 4K5XA 3GTOH 1VQJA 2EXZA 1XMQL 1RIPA 4R9WA 2F0QA 2MBQA 2N7JA 4NNJB 1TWAH 1LFDA 3GP7A 2KTRB 2EYMA 3EROA 5IP7H 3HVZA 1MD2D 3KK7A 1VQ7A 2MJ3A 4AH6A 5C3EB 1CZWA 3W2DA 1K50A 1E10A 3I5JC 3X0WA 3I9V1 2L4NA 2QJLA 1UGJA 4DPGA 1F9SA 2PE9A 2V4LA 3R66C 4PG3A 2W55A 3GTJB 4REZA 3NBHB 3ETRA 4F7ZA 1EQVA 1C4QA 2I0QA 3ERQA 5CV9A 3QOLA 3RMKC 1N6ZA 4DV0L 2CVRA 1EQTA 4B08A 2ZCCA 5FLXc 3TCAA 2E2DC 2KTRA 3NWSA 4C3HH 2EIFA 2KQ7A 5CMDA 3DVGY 1STAA 2A74C 3PZ7A 1J7AA 2L7RA 1N8RC 3RNGC 1E8WA 3DM3A 3ZO5B 1FYCA 5BYRA 3T1YQ 2LGDA 4BY1B 1LYLA 3K5MA 5L95C 4A8XC 2B2YC 3JC66 2K6DB 1B9RA 1I35A 4NXNQ 2JA7G 1NBFC 2M19A 3NVZA 3UIOB 4YTMB 1UNSA 1EQRA 2MO1A 3I4OA 3S15B 1P9DU 5FR6A 2ZW0A 4FF2A 4WWMA 1JJCB 3PV0A 3AMUA 3TL5A 1Q8IA 1VJKA 1BXTA 1YNND 4XTCS 3STBC 3M3YB 1JB3A 2KWUB 2Q8TA 3K7UC 1HJPA 3TEHB 3FP9A 5CORA 4FJZA 2MBEA 1RYJA 4QQBX 3BVZA 3Q2AC 1E8XA 3Q3NC 4UY8C 5CBAE 3TZUA 3A0JA 2X8XX 3H0GB 1GUNA 2K5NA 1HTQA 1LT3D 4A3MH 1CMXB 1YHQA 3CPWA 2HIVA 4YHHL 1QOBA 3SDZA 2W3RA 3W1YA 1J8CA 5IYDG 3M7GA 2UU9L 2JZZA 1FCCC 2F1MA 4R4QA 4DR7L 5CBEE 3MC0B 4WORA 3PIO3 4JV5Q 4QJFA 1D2BA 3OG5A 4A3EB 1DCZA 1STYA 3PIOA 2M1MA 3DHQA 1JALA 5AUIA 3BZDB 4R4OA 1IYVA 1WFQA 2C9OA 4II2B 3PLUA 3ZVVA 4PZ8A 4XC2A 5T8IA 3WIMA 4TVAB 1SE9A 4C3HB 3IAS1 3SR1A 1EYCA 5IGDA 5M9OA 2NPTB 4P1BC 4AYBG 5LMNL 2KBNA 1I6HH 3UIPB 1KAAA 1A3VA 1JWSD 2N9XA 2OXPA 3QK0A 4PS8A 4YIJA 1I4HA 1TS4A 3Q22A 3G48A 2KXJA 1HXYD 2E5LQ 1YD8U 4AP4C 3PS6A 1AW7A 1AH9A 2HE7A 4YSYB 3A1QA 4LFAQ 4NZLB 1RF2D 5E4WC 3Q8EA 5M3MG 5EPKA 4ZYSA 3LDZE 2NZ1D 4LF7Q 5ELBA 2MLBA 2K05A 4IFDJ 1JJGA 5FJ8G 1V5OA 1HNXQ 1PRTD 2MWSB 2K33A 4IM2A 3TP7A 2K32A 5EE9A 3IRBA 5CR3A 1II3A 5CV4A 3ZJYC 3EFUA 1KQSA 2PLPA 4AOFA 3NY5A 2DNCA 4DV4Q 1P7FA 4HDQA 1KLVA 1MPEA 2EJGC 4FXKC 3PVLA 4JI5Q 2SOBA 2D2CC 4HSVA 4LLGM 5ELOA 2DGYA 1WVLA 3N3KB 3M3JA 5DPSA 1T9HA 4DN4M 3MJWA 1WY8A 2XWJB 4A76A 1F2LA 4TQUS 4LW1A 3VUYA 4GNXC 4FF3A 1EWHA 2JA6G 2UXBQ 4GZYC 2RHSB 4G7HC 1VQKA 4XIGS 5C4ZA 1JWAD 2WNMA 1K83H 1RTOA 4IM3A 2D2QA 3A9KA 1CKNB 5HI1A 2XVSA 1WI5A 3VR9B 4ZYNA 3PO0A 1EL0A 1CUKA 3PUWA 2BB5A 2XNAC 4A3MG 2DYMA 4OELB 1L0VB 5LMUL 4HPMB 4M0WA 4H44C 3I57A 2DN8A 1XNQQ 5T1GA 2RA4A 2Y5BB 1WM2A 3H7SA 4I6PA 4MTNA 3W1BA 1QB5D 1VLBA 1I42A 2JA5G 3KDFA 3N6RA 4ZOHC 4MGKE 3JAMi 5C5MA 3UDGA 3ULPA 4HMJA 4UHVA 4APVA 4A3EG 3PO2B 1F52A 1P98A 2MBOA 4QIWB 5KYLA 3CSTA 4HKZE 3E9HA 2IWHA 2Z6KA 1MJEA 2UXCL 1CQVA 1VQGA 2F0DA 1E8ZA 1MSHA 1YHBA 2KAJA 4DHJB 1SE4A 4MTKA 4NPSA 4XYOA 1QNKA 3ABVB 4J6HA 2YYZA 3A8IE 3EJIA 4AYBB 3S2DB 1UE1A 2ENBA 4O2DA 2P5ZX 4GOPC 1C1YB 5C0XI 1WFYA 3L3OC 5EDSA 4DR2Q 5H8YE 4RGTA 2EYOA 1B1ZA 2RVLA 1E6EB 1WZ3A 1RHPA 3UF8A 1GUOA 1EQQA 4F8MA 2QEXA 4A3KG 4JI3Q 2VW9A 1BVSA 2JY6A 3RZFA 4B3TQ 2Z8LA 3NTIA 4BBRH 2IGHA 2VY3A 2INDC 3BVMA 1U0LA 3SFEB 2Z6KC 1R4QB 2NN6H 4PV1C 4KGRA 1Y1WG 3JAMc 4MIUA 3N1ZC 1BCPB 1VZ8A 1SYCA 2FJ2A 3D4DA 1IYFA 1V9PA 2J7QB 2Z1CA 3MC8A 2KWCA 2M9VA 3P1HA 3S17B 5GAEC 1R7SA 2XWBB 4A3OA 3BIID 3NTKA 4HLEA 1VMCA 4K8JA 3CSFA 4MSQB 2R7DA 4CDEC 4JI4L 2O6VA 2ASBA 2IO1B 1A5RA 2MQHA 1FFVA 4EE2A 3JAME 4DR6Q 1WX7A 1TQOA 3AE9B 1VZ6A 4FHJA 1L1OB 1B8AA 3S16H 1SYEA 4IZ8A 4ZK9B 1VCIA 4DGZA 3I72A 2KOXA 2FMCA 2Y0SE 4P72A 4QGUA 2VL6A 5KIXA 3VTVA 1KRTA 3U58A 1NAPA 1K8OA 2B2WC 1CKMA 1U9RA 2XSCA 4EQOA 1MG8A 3K57A 3PO2G 3VR8B 4EOYA 5IIFA 2RPQA 1S4ZA 1EEID 4L5TA 2OHFA 1WIAA 2LVOA 2OJWA 2L9HA 2B63H 1Q1OA 4XE0A 1ET6A 2JF5A 2BE5C 1NR4A 4WJ4A 1SNDA 3GTLH 1LQBA 1XO3A 2F0KA 1T3QA 1FEHA 4RH6A 2SAKA 5ELNA 1BT0A 1JT8A 3A9KB 1NEKB 3NK9A 2KN4A 4MZ9A 3MZ5A 3ML8A 5BN4A 4OWXB 3R7QA 1EY7A 3EFCA 2CH4A 4DK3C 5GROA 1WTHA 3PHXB 3GO5A 3NJTA 3ZLZA 2A6HD 2ICIA 1RWSA 1YVCA 5FLMH 1HZCA 2EQSA 1VZ7A 2MJDA 1T6BX 1W6KA 2UUCL 1DOKA 1OXVA 3SD5A 5IKCM 2CFMA 3RLNA 2X38A 1GVPA 4CKEA 4WWNA 3LB8C 2I5HA 2F3WA 4NXML 1K3RA 5CV7A 2L52A 3CMAA 3Q8CA 2F03A 3H3VC 1P7EA 3Q14C 3TP8A 4GLAC 3R3MA 2JA8B 1PA6A 5M3MH 1PH2A 1BDOA 4HAEA 4YWGG 2A69D 3APCA 5HGQA 1H8CA 2MUYA 1WRIA 1DOLA 1QZGA 2K22A 3GTGH 4ASWC 5JPNC 2FCSA 5EQ0A 1QWYA 3KWLA 4RWSC 4DV5L 4G7ZC 3RD4A 2M17A 3CCUA 2JA9A 4IUNA 1XCTL 2N1VA 2Z0EB 4KTAA 5C4HA 3VYSA 3DCGA 3GV6A 1JB7A 1ACCA 1XF5L 1TVXA 4GN4B 3W5VB 2QDLA 1KDBA 1IHZA 2BBCA 2YLMA 1XLQA 4P75A 2PW7A 3EN2A 2JZ3B 2LMCB 2CH4W 4DFAA 3KLWA 3NHEB 3M95A 4Q2JA 3EA6A 4GDLA 1JCKB 1VDZA 2JSOA 2IDYA 4KK7A 2HQEA 4JI4Q 2PCFB 3DQVA 2V1YA 3J81L 1AARA 3GD7A 2GI9A 1FR3A 1TT2A 2H1EA 4LMQD 4CBVA 1KJTA 3H7PA 3SR6A 1AN8A 3MXUA 3AE1B 3PLVA 1YZ6A 2VXWA 2FNJB 2JYTA 1VQ8A 3AU5A 3MTNB 4LF8L 4N9F4 1HPCA 3IVFA 3ND8A 3D8GA 3GTKB 3QX1A 1Y69U 1ASYA 4M1UB 5AZFA 2QF7A 3CRLC 4Y7NB 2NMQA 3Q3MC 2K75A 3HG9A 1Y8NB 4GOPA 1UWMA 3ZNZB 1F9QA 4HCEA 3H7PB 2RF4A 4KY6A 4C3JG 4A3JH 2GBJA 2C7MB 2ZXOA 3ULJA 2JA6B 4DV4L 1FXIA 4A3FG 2KWDA 2WX1A 2PIAA 4LFCQ 3S15H 5J22A 2INPE 1Y1VG 1LTSD 3AEFB 3EQLC 1ZYRC 4N58A 3RR5A 2JA7H 4Z9CB 5J3BA 3L4PA 3OIPA 2EJMA 1F2YA 1QUQB 2K7VA 4CHTB 5IT9c 2AEHA 4QB4A 1B4OA 2IX0A 2M2LA 3CCRA 1WMHA 1E1OA 3L54A 4OZCA 1ZGUB 2NVQB 2WXHA 2A68C 1GC6A 2F0MA 1K52A 4A90A 4JLCA 4W9IA 2F0UA 3BZKA 4JWUC 4DR1Q 2O4XA 3NELA 3DWPA 4N59A 4R8IA 2JYOA 2HIXA 2NZHA 3V05A 4ICUA 4ICVA 4TQ0A 2LGSA 2RKSA 4OL7A 1DM0B 3LWUA 2D0OA 2LFNA 1N61A 1ZYRD 1Q7YC 3KQ4A 1STGA 2XIWA 4KSKC 2AYOB 3SFDB 1J0GA 5IYCG 4KY5A 4NAWB 3UI3A 4JYAL 1FJGL 4TRDA 5J18A 4XQJA 3B6YA 2YTYA 3KYHC 3Q8AA 1L6UA 2D07B 2KCNA 4EQ5A 1WH3A 1XNRL 1D5MC 4L23A 3OLMD 4TKOB 4IUQA 4IDIA 1HZ6A 1GO3E 3NZ3A 4EZKA 3P42A 1F9JA 1UH6A 4G7OC 2BYFA 4B3SQ 1KXLA 3ZNID 1CA5A 2A5UA 3KBGA 2FAZA 1X54A 3ZTCA 1N32L 2RDGA 5C0XJ 3RT3B 1PZID 5T1IA 5IP9G 4AQYL 5M5WH 4B3TL 2QHOA 1YNJD 2D0PA 4TKNA 1XT9B 3RNCC 3AE8B 3RNEC 1YJ9A 2ZXRA 2OWOA 4BAXA 1WXAA 4ANWA 2WYQA 4OONA 4DWFA 1L4DB 1MFWA 1CKOA 1ISNA 1NDDA 3KVFB 4GKJQ 3PIP3 2BYEA 4JI0Q 3KFUA 3G71A 2VUMB 3BG3A 3N20C 2EMSA 1TIFA 1VQNA 3N32A 4AYBE 4ULLA 2EY1A 2KJRA 2B29A 5ELDA 3UQBA 2BW2A 2OEOA 2LHEA 3I4NG 4Y52H 3LJ3A 1UBQA 2WDRB 5IYBG 1JWBD 2MSED 2QC8A 4AIMA 1L6VA 3HOXG 4K7SA 2KDEB 4QY7A 3HOYG 4GXBA 4OW0A 4NKLA 3IHPC 4HPPA 3VRBB 2J0TD 3CC2A 2ZVOA 4WWPA 3TMPB 3QAQA 4YCWA 3W1SC 4K2KA 1HR0L 3DWGC 3J7ZC 2JXMB 2R7ZG 2Z6BA 4NQLB 1YJJA 1UUPA 2KJXA 4MNOA 3W1GA 1JC7A 1SYDA 5I6WA 1WX8A 2N7DA 1SJHD 2B76B 5CC4A 1ZP0B 2GMIC 2HHHL 4G0NB 2GLSA 4JL9A 5F2DA 1HNWQ 4MELA 2B3AA 2JWUA 1B9MA 3DPDA 3DWAA 4ZKCB 3I4NB 1EZ6A 1HNXL 4KD3A 1GHJA 2YU9B 4GNXA 3DBLI 1J7BA 5C4XB 3QJYA 2V1CC 5H1SE 1U4AA 4PYZA 5IO9A 2XRSD 1STBA 1G51A 4RMFA 2KFKA 3NZUA 3A7LA 3R2IA 3S1QB 4WJQA 4BVUC 4GOCA 2A68D 4PNYA 1F0ZA 3HHMA 3D6CA 4L63B 3KJOA 2QCZA 4G3XB 2L83A 4HVBA 2DZIA 3SXHA 5IN7A 4ITKA 2IO0B 3N1YC 3PRZA 3OW2A 2KQ3A 2JXTA 5M3FH 2Q8IB 3TEWA 1XWEA 3TREA 4C1NK 3HOXH 3J81c 2V3SA 3HOVG 3SVMA 1FD6A 4FF4A 1VDVA 1R4PB 4B9WA 3S14H 1Y56A 1STNA 4A3DH 3I63C 4HEA1 4EQNA 3S14B 5C23A 3QWNA 4UPAA 1VQLA 1WZ0A 3I8ZA 4GGQA 3PO3H 2IZVB 3OJ3A 2E74C 1WX9A 3NENA 3ZDTA 4FULA 1YJWA 3NP8A 5EKIA 2KQ4X 2WAQB 4JI7L 2DNFA 5E7NA 4ZCKA 2DENB 3U4ZA 2SNMA 2BOSA 2PPBC 3ZRFA 5JH5C 5JHBA 1NUCA 3SK6A 2KMCA 3MC9A 1VRAB 2L15A 3CF5A 1QKZA 2ID0A 2E6XA 4B9XA 2K4KA 3K9OB 3MP9A 1HQRD 4ABNA 1J7CA 3GZNB 3M63B 1PDQA 4C1NI 2KDBA 5FO9B 5C3EG 2LGIA 3S17H 4K2LA 3SK4A 2YVCA 3P4SB 3PZ8A 3TBLD 3Q24A 5C44H 2MP1A 1B44D 3J81j 4BWGB 1XEEA 3GZNI 3CRKC 1FIQA 1C4AA 3NUHB 3J7AF 1K8MA 3LNNA 4K1RB 4A93H 1JE5A 3MAQA 2CHWA 3MHZA 1QOAA 2MEKA 4J8QA 1M8AA 2JJQA 2PZTA 4EZLA 1JQ4A 2ZVNA 4LF6L 2PVOD 1WR6E 2L12A 1HFNA 2N78A 2BF8B 4CKCA 1W3SA 1I7HA 3I4MB 4BBRG 5I6YA 3EFXD 1WJNA 1F2ZA 2AWTA 4MH8A 1SMYD 4ZRPA 1J5EL 4DUYL 5C4XG 3AEVA 4IJLA 3EUB2 3WOFA 4A6QA 1EUJA 5K36G 1F2MA 1DJRD 1QLBB 3WA0A 3V61A 3RUZA 4OO1H 1WJUA 1LT4D 1YIWA 3A9JA 1CSPA 2WP8J 4P74A 2K3UA 2F0FA 4POGA 1IGDA 1R9TB 4YSZB 1S5DD 1IW7D 1OQQA 1D8LA 1Y8PB 3RZOB 1SRUA 3AECB 4C7ZA 4JBJA 5JEAH 4GS3A 3H91A 1BBXC 1NTGA 3QHTA 5E6PA 1IKLA 3S16B 4PT5A 2A1AA 2GBNA 2Y0SG 2WINB 4DK6C 2NBWB 4L5SA 1IYJB 4DBGA 3LXFA 3AU7A 2X6GA 3QB3A 1N60A 3PMFA 4O1NA 2AWNA 4JI6Q 2OTLA 2WWZA 1PH9A 4HCSA 4RFBA 4DR7Q 1WGYA 3DHHC 4KD4A 2INNE 4XGAB 4HXDA 3ZTDA 1QT9A 4TQ1A 2B2TA 2XGTA 4FBJB 4E74A 2NVXH 2B63B 4GLSC 1OXTA 1ROEA 2WU5B 1X32A 5D6JB 5EE1A 1QILA 4N8X1 3RZWC 1A3TA 3P63A 1N36Q 3HOUG 3QIAA 1EWYC 5M3MB 3OHXC 2RR9A 2PI2E 4LNQA 2FINB 1W6JA 4CDDC 3K5NA 3S1QH 1X3GA 2ZZPB 3Q8FA 2K28A 2RDFA 3BDCA 3H94A 1TS2A 1VQAA 2NTSA 4YTNB 2Z0DB 2JVCA 4J1MA 3ICEA 3H09A 1TWCB 2YTXA 3CHBD 2AL3A 4QF4A 2Q8RE 3CCSA 4ZQ3A 2YEPF 3NVVA 4FADA 3ZW3A 4C2MB 5LNK1 4FJYA 2K14A 4RCNA 3VR5A 1IL2A 2CU3A 2NBUA 2KX0A 3E9SA 2KHJA 1O78A 2YV5A 1X3EA 1EIGA 1TWFB 2LKVA 5C3JB 4IG7B 1WYDA 2IBIB 1R9TH 1D7QA 1Y14B 3A4SC 3ZJVA 4RG1A 1Y1VB 1YJNA 4KSLC 1E0BA 2UUCQ 4EFOA 5IGBA 2WV6D 3HK0A 1HFGA 1JRPA 2M4NA 3I73A 3J80L 3M3YH 4R4CA 3L0WB 3D4RA 4K5VA 5L37A 4X64Q 1OXUA 4LJZC 2KFKB 4OO1G 2O2VA 2J52A 4CDCC 1HTPA 4JVZA 3T51B 1Q81C 1FO4A 4ODGA 1H4RA 3VUXA 1N32Q 3D31A 4LF9Q 4WURA 4IQZA 1WXVA 1OO9B 2G9DA 1YN4A 1UBIA 4US8A 3VH4B 3HKZE 2JA5B 3IT6B 1YNXA 2LY7A 5G3LD 2KVZA 1F1HA 3EECA 4A4IA 1G8ZD 1UAPA 2ZM6L 2W9NA 2OCEA 4P73A 4UDUC 1K28A 1DZ1A 3F2CA 3NVYA 3A74A 1HA5A 4C4VA 1LV9A 2KYWA 1NI3A 3FKIB 1J6QA 4A93G 1AEXA 2VRRB 5FLMG 3AEAB 2IYDB 1RL2A 3X3NA 1FJGQ 3QARA 1V49A 3Q0AA 4NXMQ 2OEDA 1XPOA 2TSSA 4W9GA 1TY0A 2GVBA 4DV3Q 2RMMA 2FCMA 2UUBL 2I5LX 4US9A 4C2MH 4GOPB 2L1BA 3I7FA 3S2DH 2WQYB 1WF9A 2KHWB 4LFBL 3RZDB 4JIOU 3T1YL 2E76C 5FK9C 5FO8B 2BVCA 1CTMA 4K6LA 2ZNVB 1A2TA 1JQYD 4KGSA 1SBBB 3K0YA 1TWGH 2PJHA 1B50A 2ATWA 3PO2H 1EYGA 5LXIB 2BA0A 4KIKB 4HCPB 2JA8G 2M56B 2INCC 2M0AA 2JA7B 1YNTE 1LTBD 3KF8A 4GN5A 2B2TC 2VH2A 5HHDG 1CFMA 1FXAA 1ZXIA 5G2NA 1SYBA 2E8GA 3N1XC 3RPFC 4I6NB 2LWPA 2Q2HA 3R7RA 4LFCL 2XN9C 3MHBA 1ILQA 2EVBA 1SE2A 4LNOA 2BH2A 1T5XD 5LL6X 2MJEA 4W9EA 4M8MA 1YX5B 1F9RA 1EOTA 4HN7A 1HZ5A 3QJZA 1IBLQ 2WXKA 1WGKA 4IUPA 2LFIA 3GTPB 3B9JA 3H0GG 4LWCA 1GUAB 2K5VA 3FKIH 4C3HG 2LI5A 2A5HA 4C56C 2WXIA 4JOIA 3ALBA 4IUVA 4OX9Q 4JG2A 5GADC 1XLNA 4C4VB 1ICWA 1NR2A 1ONLA 4B3RL 3APFA 2LJ5A 2N9EB 4NP5A 3Q23A 1T0SC 3NVWA 3RCZA 2F0PA 3AE7B 2J42A 1S3SG 4A3IG 4W9HA 2MW5A 2KLCA 1M1KC 1C7YA 5LMUQ 5HG2A 5CX3A 5I2XA 5JJLA 2CU1A 2LUEA 3N9YC 2IO2B 3FPPA 4DUZQ 3S1RH 3DVNU 1KOTA 1HNZL 1G91A 2R61A 4IALA 1V9JA 3J7AV 2JWZA 1Z47A 1IBXB 2CW0C 3E0JA 2QILA 3MEHA 5M5XB 2RGFA 3ZNHB 4KZCA 1XNRQ 1X6OA 2A19A 1BBUA 4WQMA 3V6CB 3WOEA 4J6IA 2N8NA 1C48A 3KUPA 2I38A 4YT0B 2HD3A 3FVQA 4N9PA 2Q2UA 1ZW7A 3V3XA 1LTID 3OMGA 4XT3B 5IA7A 4ZRJA 2K8BA 4LAAA 3CMMB 4A3GG 2EYJA 1KNAA 1WJ6A 4RF1A 3O13A 3U2SC 2G9HD 3P7JA 3ERSX 1R4MI 2OF1A 5I4DA 2UXDQ 4F88A 1K51A 1HCZA 1I4QA 3T3OA 1KD1C 1TBEA 1EFID 2RCNA 2IPKD 3ITPA 3DBHI 2JA5H 1UEAB 4FYDA 3RNBC 1VQ5A 4MEMA 3SHLA 5AZHA 5D65A 1TTNA 1J19A 2L76A 1XCQL 2D3AA 3KF6A 4UP7A 3PUYA 3F1ZA 4BBSB 4MACA 3BK2A 4I65A 2UXDL 1X3PA 2AKWB 1TZ1A 1SFOH 1YN5A 1PZJD 5E6NA 2LSSA 4MGIE 4XT1B 5AFWA 5MPOA 2K01A 4P2CB 4X3TA 3KLRA 1B53A 1WD0A 2Q5WD 4ARIA 3STBD 2BWES 2B2UC 2ZCBA 3CCQA 3QIJA 1NY4A 4KDIC 1HE8A 5E6JA 5HGTA 4DQOC 5ELFA 1BNZA 1LT5D 2E2IB 5KNDA 2VZKD 1IUEA 1GC7A 1TKYA 2WDTB 3M85A 4ZHOA 1ET9A 1ZKHA 1GKHA 1WTRA 1VCBA 1P8LA 3BYTB 1I50H 1UE6A 2XK5B 1QE6A 3FKYA 4LTUA 5IYCH 2DAFA 1O7YA 1SMXA 2WXMA 4W9JA 1VQDA 1Q5WB 2A6EC 1KLGD 3MXNA 1FRDA 2VQEL 3R2TA 2MO0A 2JYEA 3ZQ4A 3IFWB 1STHA 1VQBA 1PH8A 2N88A 2LMCA 2F0IA 1IYUA 3W5UB 2L0CA 1E7PB 4OWWB 2VUMG 3RULA 1PFMA 2FFKB 3D4WA 4ZHPA 2HTHA 2BKFA 3N30A 3SEBA 4GSWA 5KNCA 4HIOA 4LF4Q 3M62B 1DD2A 4S0RA 1WYGA 3OW7A 3RFZB 3HOVB 4BY7G 1K9MC 2AMCB 4BXXH 4A3KB 2PEAA 2B2UA 3GTOB 2WFWA 1G2TA 5AEKB 2J7ZA 4DXFA 3DXJC 1WOCA 1XMQQ 1OEYA 3V60A 3BS1A 3UDFA 4WFN3 2ON8A 2ZPNA 3DBRB 2PPHA 4DDGD 2BE5D 5EGTA 1OGWA 3CC4A 3VR2A 1TS3A 1YBYA 4LNKA 4MSMB 4X6AH 1PYBA 3PZDA 4CHKA 5J2RA 2EJFC 3SE0A 1NYQA 2WDVB 2B2VC 1M90C 1KIXA 2BA1A 3GTJH 2EOTA 1PGBA 1L1OC 1Q1BA 2KC2A 2RCFA 1TYGB 4JPBW 4WJ3M 2K8CA 5JJZA 1DOIA 1N5WA 1QJOA 3RN5A 1T0YA 2GBRA 4FLHA 1JMCA 3T13A 2H88B 2KECA 1WTVA 3ZGZA 2KHSA 2LRUA 2QGQA 3QC8B 4OX9L 3P20A 1HHVA 3JVZX 4YWLA 2X69A 1UGMA 1PHJA 1NMGA 1G2SA 4GKKL 2XRQD 3E3XA 3AEEB 1CZPA 2OT2A 1T5EA 4OIKA 3HVDA 4H02A 2H4OA 2XEWA 4RGMA 4MGYE 4X3KA 1AP0A 2HUGA 1UD7A 2JEBI 1Y8OB 2L0FA 3DBHB 5BYSA 3KUZA 1LTGD 2EDGA 3HOVH 1WM3A 1A6XA 5DPTA 3T4AC 2ZJDA 3H8HA 4WQOB 1OQRA 4HJAA 4DU9A 4RA8A 2V4IB 4M0WB 2K9XA 2LASA 4U673 1C3TA 4WJPA 5DAUA 2JT4B 2R93H 4KKJA 3W1SA 4R8NA 4A3CH 4KJOA 1E2WA 4HIMA 2PE6B 2V0GA 3U7DA 1GHKA 4IPDA 4DDID 1WMHB 5JEAJ 4EX5A 4M8NA 4A3LG 2WP9B 4R4TA 3TS0A 5AJ3L 2PMZE 4X64L 3PTFC 2IY5B 2ZW1A 1MGSA 2IHEA 4HTHA 3PIPA 1D4BA 2EMTA 2JPHA 2WAQG 2NVYH 3GQBA 3NRZA 1WXMA 2AQ3B 1EY8A 1OXXK 3H1UA 3VAWA 1WWTA 1IPGA 3T9LA 3VQIA 1PH6A 5KRUA 3GDEA 2ZJQA 2REXA 2F0TA 1I4PA 3C1EA 4Q5VA 4P6VF 3B1LX 2JRHA 2J0JA 2K03A 2CJNA 3RD2A 5IP7G 2AUJD 4H2AA 3U9SA 5E3FA 1NBWA 4RKLA 3NUCA 4F87A 4A3BB 3U7ZA 4BKSA 2FHTA 2Z9HA 1XLPA 5LLIA 1V8CA 2EE1A 2QA4A 2MH7A 3OOCA 3TEZA 1SNMA 2PNHA 1S3OA 3MXGA 5J39A 4PZ7A 3CC7A 4HSPA 4IO9A 1M4VA 2AHOB 1JR0D 1E7ZA 1H9KA 2A69C 2O6VD 2A8VA 3ZXVA 3HOZB 1BUIC 3DHGC 4WIPA 2DY8A 1CZGA 2E75C 1SGHA 2MP2B 2WB1G 1EM7A 1SDFA 3H9DA 3L16A 2VZKB 2Z4HA 1YQBA 2K5HA 4FVMA 3SU8X 1L2FA 1FRRA 4JX1C 5E4XA 5DPWA 2AL6A 1PZKD 4XX5A 5I9PA 1U5KA 3MA2B 4BKTA 1UE7A 3A56A 5AZGA 2FIDA 3H6MA 3ZYYX 1JOQA 1BO0A 5C0XH 4ACFA 3IAYA 4IUMB 1YI2A 1WGDA 2O2LD 1F9PA 2F0LA 2DZKA 1D3ZA 3C46A 3D0FA 3KBXA 3PUXA 3CKIB 1GUSA 5C5LA 4A3GH 4DV6L 3T3NA 1F2RI 2WACA 4A3GB 1JJ2A 2XBBC 1PYWD 1C76A 2KENA 3S24A 1E0ZA 1CJEA 1Q90A 2NN6I 2DZMA 4EGVA 1IZ6A 1SIFA 2E2HB 4QIWE 1RAXA 2DWQA 2WXGA 1HR0W 4LK0M 1NVID 1Z2MA 2AQ1B 1MHWC 5G55A 4IW0A 4BA2I 3VH3B 5GMVA 3C8YA 1VQ6A 3WALA 1Y1WH 1JOOA 4R3DA 2I46A 3IKJA 4JBWA 5JAVA 1PV4A 1UZXB 2NPTA 2ZPYA 3WAMA 3DDCB 4A75A 3ZDMC 1STEA 1MIUA 2QW7A 1I3QB 3VR3A 2CQOA 1IKMA 3MHSD 1FFUA 3HOUB 4KV2A 4O42A 4C00A 2F0OA 2F0NA 1IBXA 1L1OA 3U52E 1KHIA 5FR3A 4NDXA 1A62A 4DHZE 4GKJL 3IG3A 1FPYA 3RI7C 1E22A 3MVVA 1PTOD 3H0GH 2KDFB 1HNZQ 2WXJA 1TWHB 1TWHH 1TWAB 4IOIE 2ICEC 2D11A 4HJ8A 2CHBD 2I1JA 2NVTB 4NMZA 3AE3B 2R7ZB 2RBMA 3KYDD 3VR4A 3CWIA 3GE8C 1QVCA 2B8GA 4YL8A 2R93B 1WTPA 1C4CA 4A3PA 3H3VH 4DV2L 1JWMD 1WXSA 4KLKA 4A3EH 3LGJA 4BBSG 3L0OA 1KDAA 2K04A 3KDFB 1H9JA 3NBIA 4C3JH 2F0SA 3VR6A 3U9OA 5IWAQ 2N3SA 1ICFB 1OXSC 2EPBA 4A3JG 1X9NA 1PH4A 3HIZA 3RYTA 2MHVA 3I70A 1RD9D 1CQFA 3FDTA 1S40A 1UF0A 4KIKA 1ZDXA 4HIKA 4DXGA 2MRPA 4AQ7A 3HRDD 2NVYB 3DWQA 1WTXA 4XDDA 1WTOA 4A3FB 4GU2A 5A2QE 1SJED 3DM1A 2HQLA 1KABA 1X1MA 4HR7B 4RNAA 2CWAA 4DAYB 1OTRB 1FD7D 1VQIA 1RM6C 3OYYA 4E6IA 1OEYJ 1PFDA 1X3FA 4LNNA 2H89B 4ZRZA 4LK1C 3DEPA 3T53B 4C3IH 5FLXE 3WANA 1ML0D 2KA7A 4PYUA 4B95A 1JICA 3J7YW 2UU7A 3QA8A 3V62A 3HOWG 4XWWA 1XX8A 3DLLA 1Q10A 2JA6H 3WAPA 1HQMC 2N9LA 2F4VQ 1E3PA 3ULLA 1E2ZA 4BFRA 1D5XC 4DHZB 3NOBA 3I3CA 1RFAA 2ZTDA 3AMZA 3IT4B 1B2TA 3UGBB 3K5LA 3E5SA 4MGZE 3B0AA 1X3QA 2IHFA 2EZVA 1IW7C 2PZUA 1ZOYB 2KWVB 3AH7A 1XJVA 3I90A 2D9UA 1H9SB 4KI0A 1XXGA 4XQQA 4YY3Q 4NAWA 3H15A 4K7WA 2K6AA 4BBNC 1ZKOA 2KKCA 2NTTA 1AE3A 5C3XA 1LACA 1AZPA 3FMCA 1HTOA 2CR5A 1JWUD 4QAYA 4USAA 3J80E 2D3BA 4L1BA 5BR8L 2F0EA 4K14A 2LGXA 1TJEA 4IUTA 2IJ0A 3PGEA 1RKNA 4BY7H 1DGJA 3EVQA 3L13A 4RMAA 4B0MA 1CT1D 2O6VB 4K8IA 5BMHA 3P4PB 1U4PA 4HJ5A 2IX1A 1I94Q 2WKDA 1LTAD 1L7YA 3GTKH 1HUMA 3UINB 1IBLL 1TWCH 3U50C 1QZEA 2B2YA 3NZSA 1RFKA 4GDKA 5JXVA 4CQNA 1SEBD 1CK1A 5IODA 3V2TA 4AS1A 1DOMA 1UEBA 2QDBA 3S1RB 2K25A 2KTFA 4LJPB 3BK1A 1GM5A 2KLGA 3NS8A 3UDIA 5CV6A 2OTJA 1BF4A 3F2DA 2N49A 1KRSA 4PS7A 3F2BA 3BJUA 1M94A 5EJWA 1Q12A 1XTDA 3GTMH 1ZDVA 4OZAA 2GBMA 3DEOA 3HOWH 2UUAL 1GOZA 1SIJA 1Q8KA 2D3GA 5CV5A 5AJ3Q 3HEJA 2B63G 3HM6X 1XLOA 2RSOA 4DV5Q 2BYTA 4ME3A 1T0QC 4W9CA 4JOIC 3A54A 3A33B 2L11A 4IPGA 4MJSA 3I2ZA 2JQRB 1N63A 3KF6B 4H0LC 3GTQH 4MT5A 3MXNB 3GTQB 4GKKQ 5JVH3 4C80A 1BUVT 3IFDA 4L5QA 4DV1L 1L4ZB 4JI2Q 2DHZA 4BKSD 3ONAB 3VA5A 2DYOA 1VQPA 3W5OA 3IAM1 2KN5A 1BKBA 4HPLB 4UP9A 1BR9A 1X56A 4ZAIA 4HCNB 4X66L 3P4RB 2WLBA 2WXRA 2LGYA 2PMZB 2SNSA 1BBWA 4DKAC 2K5WA 2E3TA 2EY6A 2HDMA 4JI2L 1XD3B 4KMUC 1NSNS 4QL5A 3PRPB 1RCVD 3RZDH 3HKZG 3MFGA 2VZAA 3OJ4B 2LXCA 4XZ4A 2C7HA 1VQOA 3AN1A 3JYUA 4B9KA 2NS5A 5IGEA 1D1KA 4C3IB 3AYHB 1JMLA 2KNBA 5LMNW 4L6TB 1RJTA 5K36H 1HH2P 4DV3L 5BR8Q 3HFZB 1EY0A 1Q1EA 1EFWA 2HHHQ 3I91A 4LUZA 3WAOA 4OO1I 1CHQD 2N55A 4A3IH 3HM3A 5DLQE 4DR5Q 4LFBQ 5G5HA 1CM9A 5CYUA 1R4NI 3NG0A 1W2BA 4URKA 4DV7L 1MHHE 2KEDA 4FN2A 5I9OA 2EXDA 2F0HA 2BS4B 4RKBA 4NPNA 1K3BC 5ELEA 1KC8C 2B39A 2OQKA 1B3AA 1EEFD 2HCCA 3FKIG 2TMPA 3AV8A 3DBRI 1P16A 4UAIA 1TS5A 3KW5B 3K8AA 3WWVA 4FNFA 4B6WA 4LNIA 1TWFH 1Q86C 2JUOA 3M4QA 1FNVA 3PF5A 3SK8A 4I7AA 5C6AA 4K0KQ 2F52A 2K39A 1CKNA 2BH8A 1PGAA 3NEMA 1ZXTA 1WSPA 3TN2A 2BYVE 3OWFA 1WJJA 5HFYA 1K83B 4X62Q 3K59A 2VQFL 3E56A 3EGRA 2UYZB 1G6ZA 3VXWA 2PYKA 2ZTEA 3RN2A 1PH3A 2NWGA 3I4LA 1EUVB 2G1EA 4GMVA 3J80i 2HJ8A 2I1KA 4JWSC 4P16A 1SNQA 1KH0A 4AJYB 1BQQT 1CHPD 2B3GA 1E2VA 2EYLA 1IBKL 2Q2TA 1I4GA 2N9KA 2KJHB 4JI7Q 1FNUA 2RDHA 4H13C 1ENFA 1WGRA 5J17A 3HZXA 4X65Q 3BDOA 5DEHA 3T1HL 1PDXA 3HKZB 2L3ZA 4BY1H 2L55A 3J81E 1A70A 4A3BH 1TWGB 1QVFA 4ZUIA 2EYPA 3ZKJC 4BZAA 2RD0A 4FO2A 1YMHE 1X65A 4LJOB 2G5DA 1QVGA 2JP1A 1EY5A 3GTMB 2M8SA 4FJVB 4LF7L 4BOZB 4TV3A 2EYHA 1B7YB 4KGTA 3SHQA 4EZJA 5IWAL 1A0IA 4LUVA 1L5PA 5H92C 4CGYB 4NB3A 1SSOA 5IGCA 5HKHA 4FXDA 1GB1A 4NQKE 3B08A 2NVQH 3SDLC 3D3RA 3CW2C 4M8AA 2PQAB 4IURA 5COYA 5DPRA 3BZCA 1WTQA 5IOCA 2JN4A 5IT9L 3OTOQ 5FJ8H 4G4KA 3CCMA 2EKIA 3LYYA 2F0WA 4JYAQ 2ACZB 4EUTA 1GUTA 4ZUJA 1ZUD2 1SNPA 3K5OA 3KUDB 1PUTA 2WX0A 3KJPA 3RLFA 5M5YB 3VHTC 4KKSA 2CCZA 3CIRB 1TKEA 3DVGX 1VQ9A 2MQJA 1WRDB 4MM3B 5KHQA 1QG7A 1PH5A 5D7GA 3OTOL 3JSVB 2Y0SB 2NYZD 4IOAA 4HEDA 4WH4A 2WB1E 2Z4IA 2YEPB 2N7EA 4KZ0A 3KUCB 2CKHB 1SNOA 4KHPL 2G45B 1QUQA 3Q6BA 3APDA 1VQFA 1MHXA 1GUGA 2E2IH 1PGXA 2XK5A 3T56B 3PV1A 5BMGA 3R3OA 4DNTB 4KJNA 2K0PA 1R4MB 1XMOL 2EY5A 2BB6A 5JVG3 3AXCA 3NPPA 1PTOH 2B2VA 3Q3JA 3CQZH 2MHJA 3KOJA 5KYIA 3HOWB 2DYBA 2KK8A 2KO3A 4IM0A 5M5WB 4GDKB 2JRIB 4YXDB 4MM3A 4MN3A 1SN8A 1N36L 1GD7A 1KL9A 2KHIA 3CAMA 1YJIA 4ZRQA 4IFDI 1B3QA 2MNAA 4A3MB 1PMRA 4EKUA 1HRJA 4M00A 4KKUA 3H3VI 4QMGA 1GPXA 2LEKA 4WJNA 1PRTB 2B8FA 1GJZA 1A2UA 2C35B 5K5PA 4BBSH 2ZEQA 4KX6B 3PO3B 1ZXHA 5E1FA 3K9PB 1E5WA 2ALYB 2WB1B 3I4MG 4R4IA 1I3QH 1UELA 3AB9A 4KY7A 4AJWA 3VTWA 5JPMC 2V3PA 4HMIA 2BDOA 3FILA 2CJOA 3RNAC 3L2PA 2VNUD 2WXPA 2E5LL 2E2HH 2O5JC 3Q8DA 4KHZA 3JW0X 3KYCD 2LXKA 1DOXA 2KX3A 3NXWA 5JEAG 4GN1A 4EQPA 4RHRA 1QZHA 4LFAL 1AE2A 3PREA 2D5DA 3C3LA 4Y7NH 1YOVB 2SDFA 4DK0A 1YEZA 2BKRB 4DNIA 1T0RC 5LXHA 2KDIA 3RNFC 1YHAA 1QOGA 2OJRA 1GJXA 3PF4A 1V97A 1CSQA 1H9RA 4QUFA 4LDTB 5JOBA 5C4XH 5ELCA 2N4FA 1V2YA 2UWQA 1ZE3D 4GDLB 1K73C 5IT9E 1IBMQ 1AFPA 3ER0A 1HTLD 2YTVA 1EYAA 4X66Q 1YJ1A 1LTRD 1EWCA 3K81C 4JW0A 1VQCA 4BA1I 4LDTD 3I4MH 3J9CA 4CJ0B 2IGGA 2MBBB 3KH0A 2BT6A 3MWYW 1O7IA 2C5LC 2GVAA 3RLOA 4DR1L 2PNRC 2Z59B 1I50B 4IOCA 1TKGA 3SGIA 2VB3X 1KTKA 4R1JA 3I3TB 2ZXPA 5C44G 1KDCA 3DWMA 2M0XA 1VS0A 2KJ6A 3Q3FA 1TGZB 4IWPA 4OZBA 4HKQA 5C3EH 4S17A 4CJ1B 2SEBD 1PQSA 4FF1A 1QNUA 3HOYB 4KHVA 1MSGA 3A8KE 3URYA 3ZXRA 1FCLA 4OEMB 1G291 2KACA 1E24A 1H9SA 3EHVA 1SYFA 1E9MA 2R3ZA 3DMUA 2KEEA 5BN3A 5KNBA 3J80c 3CCEA 1VQ4A 2LJIA 3Q3OC 4P7IA 1PH7A 4DV2Q 1KLUD 3PO3G 1P1AA 2NBVB 2CQAA 3OMCA 1D1IA 4A3DG 4W9DA 1Q3LA 1JROA 2NVXB 4A3JB 2DBYA 4DV1Q 3OSOA 1EOVA 1HA6A 4U68A 2BGFA 2KANA 2RSNA 3MFYA 3U8ZA 2DUDA 3Q6SA 3CCJA 2ZT9C 3CU7A 4DUYQ 1WGHA 2FCNA 3AU4A 3C0RB 1C78A 3JSVA 3EBEA 2K52A 3S1MH 3E9IA 3F2UA 3TMEA 3PSIA 1J8IA 1E7VA 4DK5A 3W3AA 3V6EB 3I55A 1K0RA 1SXTA 2OOBB 1OFFA 2N9PC 3TBIB 3P4QB 4AUQC 1KM7A 4KKTA 4HK2A 4P1CC 1N33L 4ANVA 2WU2B 4P71A 4JGHB 1L0YB 1LM0A 3BYYB 3DHIC 3ECIA 2V4DA 4OIJA 2LHDA 2WGSA 4A3LH 5CTRC 2BWFA 2VQEQ 3GTLB 2FUG1 4RGOS 2IY0B 2WXLA 3TUOA 2R92H 4FDBA 4BY7B 2KFJA 2L8JA 4A3CG 2UXBL 1F77A 4E71A 4OXPA 3PUVA 1IBML 2LVPA 2CHXA 2W54A 1HUNA 2ZJRA 4WAAA 3CP0A 1WYWB 4KDLB 1EU4A 2JK8A 4JI8Q 4B3ML 2K5DA 4PS3A 1PLFA 4HWIB 5EKKA 1EF1A 1C0AA 1WE7A 2LXJA 3A9JB 4F8CB 4XDCA 4WAFA 4GLVB 1LUZA 1V80A 1ESRA 2K1BA 2XTIA 1A8VA 2KVMA 4DAMA 2R7FA 5FLXL 5C44B 3IFTA 4RF0A 2IY1B 3I4NH 3AULA 3FHWA 1GG3A 2K6QA 3UDXA 3V96A 1SLJA 4IWOA 1QOFA 1FNWA 3DUZA 2I5MX 3S1NB 3QWZB 5FOBB 1SF0A 4OHJA 4V190 4YCUA 3BDLA 3GS2A 3VYTA 1AZQA 1N5XA 4TMAB 3W9CB 1S1QB 3PPAA 2NVUI 1YQ3B 4B3SL 3F8TA 5C4JB 4YSXB 1XQQA 1B9NA 1I4RA 1O7ZA 4PQXA 1ENCA 3AE2B 3VYUA 2Y3AA 3ZIMA 4I7ZC 3ZRCA 2RSUA 3L7ZC 1J5EQ 2CHZA 4LCDE 1HZBA 1LM8B 3GB1A 2K5PA 1I4XA 2A6ED 1EF5A 1S5FD 2BPSA 2NBFA 3X3MA 3Q69A 2JXXA 1O80A 5EPJA 4Q0FA 3G7LA 4ARCA 2E2JH 3EC8A 4IUUA 3DBSA 4FHKA 3VDZA 3TQYA 4LF9L 2NCNA 2JZPA 2F4IA 3HP3A 3KWVA 4A3IB 4CDFC 4YWKA 1KFYB 3A4RA 3BY4B 1MJCA 1BCPD 1EIHA 3HOZH 4N6EB 3AFQA 3PT2B 1YQ4B 2NN6G 3VA7A 4MJSB 3VTUA 1JORA 3K7AB 2EELA 1SR3A 3K7AH 4DNRB 1HR0Q 1D5ZC 2QCPX 4QUCA 4IC7B 2F0VA 4IFDG 2O2VB 1CI3M 3CXCA 3TZDA 4IPHA 1SE8A 1Y1WB 1E7UA 4JBMA 1FXTB 2K50A 1WD1A 3VUWA 1EWIA 2OQ0A 2VH1A 1V81A 5TR5A 1BOSA 3RNUA 1WI0A 3L10B 4IKGA 2EKEC 2DJGC 4AQYQ 4ANUA 2UUBQ 4BS9A 1HEZE 2JX5A 1HNWL 2K8HA 4N8FA 3PGZA 2JSVX 4HROA 5BO4B 1FL0A 2J0KA 5EAYA 2K1FA 2ZJPA 5EBDA 5CV8A 4DV6Q 4HJ7A 1XPUA 3L08A 2JQOA 2D3CA 4K81A 4E3CA 4RAUC 4ZKBB 2C60A 2DX5B 3CF6E 4RM9A 3VRAB 1S5ED 4DXAB 2CWPA 4PK1A 5HY6A 4A3FH 3HOXB 4I6LB 1WCMB 3NQIA 4XDXA 1JRUA 4A9AA 4JCVE 1YITA 5CGKA 1NJIC 4ILWA 1A63A 3VYRA 1EIYB 4M01A 2L05A 4DV7Q 4NW2A 4L5RC 1SROA 1VF5C 3T16A 3QO2A 1MG4A 2GOWA 4CYEA 1TU2B 1ENAA 1U4LA 2FMMA 1EIFA 3UE1A 2Q2IA 5M5XH 5M5YH 1QQRA 3P1MA 2Y5CA 5GQOA 5GAHC 4WJWA 3AEDB 3HOUH 5IGGA 5DCNA 2DJFC 3X23A 3P2BA 1VQEA 4XYCA 3MXPA 2X6LA 4DA2A 5JJKA 1Y8RC 2N1WA 2W82A 1WR1A 2FIFA 2IT1A 4JI6L 1E90A 1LTTD 1SB3C 5AUKA 3S2AA
chains in the Genus database with same CATH topology
1SYGA 1PTOC 3LX0A 1SE3A 4PMCA 1XTCD 4NAMA 1TKWB 2F0GA 2I2YA 1I6VC 3S2HB 1N62A 3HS0C 3AB5A 1TIID 3M7NA 1SAPA 2PMVA 5FO7B 2WXFA 2DY7A 2HDLA 5D3IB 1EU3A 1U4RA 2I07B 1C77A 4IFDH 3OPOA 2KUMA 5M3FB 5EPLA 3N52A 2O5IC 2WXQA 3NQTA 2NB0A 2QKIC 1AWDA 1YNNC 1DXMA 2NUCA 4PMWA 1Z7TA 3K58A 2AUKA 3FEWX 5G5GA 2R92B 3HUIA 3S9WA 3U4EG 1LLRD 4K6DA 5TSSA 1AYFA 4X3SA 4HRSA 3R93A 3NWTA 1FMAD 3OIQA 1MI0A 3WDNA 2A6HC 4WRDA 2Y5PA 3QOJA 4C7YA 1K53A 2QSDA 5DM63 5G3LF 1BMLC 2F0JA 1JOKA 1DOYA 1V43A 2MJ8A 4C3IG 2DLBA 2HDEA 3R8BA 1SSNA 2LUMA 2CW0D 2HCIA 1KRHA 4A93B 1IGCA 4JPSA 2EY2A 1V1OA 1PRTF 4F7XA 2GRIA 3ND9A 4NJCA 1U4MA 1RODA 5LL6S 5LHY1 3BWUD 4N9TA 5KEEA 2W3SA 1A3UA 1TR5A 3TEXA 4V0BA 1H9MA 3C2PA 4PMBA 1MBYA 2F3VA 2KMMA 2ONQA 1GXDC 1QOHA 2JE6I 1NYRA 2IGDA 3NHHA 5D14A 3G6JB 1TZOA 2AWOA 3AE6B 2MGSA 1WXQA 3C1FA 2PZWA 2PQEA 3PUZA 3FILB 4L2YA 5EE0A 4H7BA 3AEGB 1LT6D 1GAQB 3KLSX 2WXOA 2PVGC 2JEAI 4FP5D 1RDPD 1PXUA 2HTME 5C2TB 4A55A 1I6HB 3B2GA 1BCPF 4KV6A 2M00A 5KGUA 1DONA 2J4XA 1XYIA 3AE4B 1PTOF 1CA6A 1SNCA 4DF7A 1KF6B 2R6GA 2BS3B 4DAYA 4D2KA 1S5BD 1V1PA 4CJ2C 2D62A 1YN3A 3GTGB 4C3JB 4KN4C 2AX5A 1GB4A 1EY9A 1NENB 4FXCA 4L8JA 1C9FA 3K6OA 3A8JE 3HGBA 2DNEA 1PFBA 3Q8BA 1QCBD 3D6WA 2BDNA 2JU6X 4X3UA 4RHSA 5C3WA 1LABA 3JAML 1V1PB 1ZPSA 4XYQA 4OGQC 1DYQA 5I2YA 3TDQA 1FGBD 3NBHA 1TY2A 3NS1A 3IL8A 4ME5A 2BTEA 1Z6HA 3FPUB 2WDQB 3E6ZX 2QEJC 3LWEA 3TSSA 1J9OA 3TEYA 4FXGC 3MTSA 2GB1A 1PTOB 2PO4A 3P75A 1LO5D 4IN3A 1SFOB 1QF6A 4G57A 1RTNA 4QCLA 4EVOA 5EE3A 5ISRA 4JE3B 1ILPA 5EKLA 3NTHA 5DNFA 5FKAC 2FBWB 1JE4A 1SMYC 2A73B 4RGNA 3RMHA 2AQ2B 5EBCA 5GXGB 1C8CA 2V3NA 1GUWA 2E2JB 3CQZB 5HURA 2BS2B 3FAHA 2PW9A 4J3OD 1UWXA 5BYQA 4ID6A 2IX3A 2FE8A 1C4PA 4KKIA 4B0EA 1A15A 2IW3A 4HJGE 2L5TA 5J1ZA 3NE5B 5BMIA 3GV3A 4OVZA 1S5CD 3A55A 1BCPC 4BBRB 1JW9D 1EY4A 2IL8A 2L32A 3B2FA 2MPMA 4MHEA 1MI2A 1ESFA 3ZJTA 4DAPA 2KDMA 2LS01 4ZLTF 2B2WA 1EYDA 3OWEB 2WS3B 4JK1C 3TP6A 4CKBA 2J53A 1D6EC 1MVKA 3QG1A 1VR9A 3SK5A 2L1AA 2GA4B 1ZEQX 3L9AX 3AM9A 4TSSA 4XWTA 4YTPB 1VF7A 1F2RC 4XQNA 2RQXA 1V8QA 2D5GA 4RCOA 3TP5A 3A7AB 4S3SA 1YNJC 1PRTC 3KLSA 1EZ8A 1KNEA 3ZJUA 2QMTA 4K5WA 2PKOA 3WCQA 2C5CA 5DM73 4DAVA 1FM0D 1IL8A 1L0XB 3FRPB 2WXNA 4KN7C 3P63A 3BVGA 3MJ5A 4XXEA 5D3DA 1PFNA 2PW5A 5NUCA 1NCVA 2WKCA 1O7LA 2EYFA 3NSWA 2PTLA 5IGFA 5C0XG 4A3DB 2KCCA 3M4YA 2QIEB 3AE5B 1WTWA 2RPVA 4DK1A 1EY6A 3M4OB 2VB2X 3HRZC 5A35A 3AEBB 2N0SB 2WIIB 3S1MB 5BN5A 1VMPA 5A2QL 2BCOA 3UI2A 3FC4A 1C79A 2K5QA 2KOLA 4K5XA 2EXZA 4R9WA 2F0QA 2N7JA 3GP7A 2EYMA 3EROA 3HVZA 1MD2D 3KK7A 2MJ3A 5C3EB 1CZWA 3W2DA 1K50A 1E10A 3I9V1 2L4NA 2QJLA 1UGJA 1F9SA 2W55A 3GTJB 4REZA 3ETRA 1EQVA 1C4QA 3ERQA 5CV9A 3QOLA 2CVRA 1EQTA 4B08A 2E2DC 3NWSA 5CMDA 1STAA 2A74C 3PZ7A 1J7AA 1FYCA 5BYRA 4BY1B 3K5MA 4A8XC 2B2YC 1B9RA 2M19A 3NVZA 4YTMB 1UNSA 3S15B 2ZW0A 4FF2A 4WWMA 3PV0A 3AMUA 1Q8IA 1VJKA 1BXTA 1YNND 4XTCS 3M3YB 1JB3A 2Q8TA 5CORA 1RYJA 3BVZA 5CBAE 3TZUA 3H0GB 1GUNA 1LT3D 1QOBA 2W3RA 3SDZA 3M7GA 1FCCC 2F1MA 5CBEE 3MC0B 4WORA 3PIO3 1D2BA 4A3EB 1DCZA 1STYA 5AUIA 3DHQA 1JALA 3BZDB 1IYVA 2C9OA 5T8IA 4C3HB 3IAS1 3SR1A 1EYCA 5IGDA 5M9OA 1KAAA 1A3VA 1JWSD 2OXPA 4YIJA 1I4HA 1TS4A 3Q22A 1HXYD 1AW7A 4YSYB 4NZLB 1RF2D 5E4WC 3Q8EA 5EPKA 4ZYSA 2NZ1D 5ELBA 2K05A 4IFDJ 1PRTD 2K33A 3TP7A 2K32A 5EE9A 5CV4A 5CR3A 1II3A 2PLPA 2DNCA 1P7FA 1MPEA 2EJGC 4FXKC 2SOBA 2D2CC 4HSVA 4LLGM 1WVLA 4DN4M 2XWJB 1F2LA 4TQUS 4FF3A 1EWHA 2WNMA 4GZYC 4G7HC 1JWAD 4XIGS 5C4ZA 1RTOA 5HI1A 2XVSA 3VR9B 3PO0A 1EL0A 2BB5A 3PUWA 2XNAC 2DYMA 1L0VB 4M0WA 4H44C 3I57A 2DN8A 5T1GA 2RA4A 1QB5D 1VLBA 3N6RA 4ZOHC 5C5MA 3PO2B 4HMJA 4HKZE 4QIWB 5KYLA 2IWHA 1CQVA 2F0DA 2KAJA 1MSHA 1SE4A 4XYOA 1QNKA 3ABVB 4J6HA 2YYZA 3A8IE 3EJIA 4AYBB 3S2DB 2ENBA 5C0XI 3L3OC 5H8YE 4RGTA 2EYOA 1B1ZA 2RVLA 1E6EB 1RHPA 1GUOA 4F8MA 2Z8LA 3NTIA 2IGHA 3SFEB 3BVMA 1R4QB 2NN6H 4PV1C 4KGRA 4MIUA 1BCPB 1VZ8A 1SYCA 2FJ2A 3D4DA 2Z1CA 2M9VA 3P1HA 3S17B 1R7SA 2XWBB 3BIID 3NTKA 1VMCA 4K8JA 1FFVA 4EE2A 3JAME 3AE9B 1TQOA 1VZ6A 1SYEA 4IZ8A 4ZK9B 1VCIA 4DGZA 3I72A 2FMCA 5KIXA 1NAPA 1K8OA 2B2WC 1U9RA 2XSCA 4EQOA 3K57A 3VR8B 5IIFA 1S4ZA 1EEID 2OHFA 2L9HA 4XE0A 1ET6A 2BE5C 1NR4A 1SNDA 1XO3A 2F0KA 1T3QA 1FEHA 4RH6A 2SAKA 1NEKB 3NK9A 2KN4A 3MZ5A 5BN4A 1EY7A 3GO5A 2A6HD 2ICIA 1RWSA 1VZ7A 2MJDA 1T6BX 1W6KA 1DOKA 1OXVA 2X38A 4CKEA 3LB8C 2F3WA 5CV7A 2L52A 3Q8CA 2F03A 3H3VC 1P7EA 3TP8A 2JA8B 4YWGG 1BDOA 4HAEA 2A69D 2MUYA 1WRIA 1DOLA 2K22A 5JPNC 5EQ0A 1QWYA 3KWLA 4RWSC 4G7ZC 3RD4A 1XCTL 4IUNA 4KTAA 5C4HA 3VYSA 3GV6A 1ACCA 1XF5L 1TVXA 3W5VB 1KDBA 1IHZA 2BBCA 1XLQA 2PW7A 2LMCB 4DFAA 4Q2JA 3EA6A 1JCKB 1VDZA 2JSOA 2IDYA 4KK7A 2HQEA 2PCFB 3J81L 2GI9A 3GD7A 1FR3A 1TT2A 2H1EA 4LMQD 4CBVA 3SR6A 1AN8A 3MXUA 3AE1B 2JYTA 2VXWA 1HPCA 3ND8A 3D8GA 3GTKB 1Y69U 4M1UB 2QF7A 3CRLC 4Y7NB 2NMQA 3HG9A 1Y8NB 1UWMA 1F9QA 4HCEA 4KY6A 4C3JG 2ZXOA 2JA6B 2KWDA 1FXIA 2PIAA 2INPE 5J22A 1LTSD 3AEFB 3EQLC 1ZYRC 4N58A 4Z9CB 3L4PA 3OIPA 2EJMA 1F2YA 4CHTB 2K7VA 3IXSA 4QB4A 1B4OA 2IX0A 2M2LA 4OZCA 2NVQB 2WXHA 2A68C 2F0MA 1K52A 4A90A 2F0UA 4JWUC 2O4XA 4N59A 3DWPA 4R8IA 2JYOA 3V05A 4TQ0A 2RKSA 4OL7A 1DM0B 3LWUA 2LFNA 1N61A 1ZYRD 3KQ4A 1STGA 2XIWA 3SFDB 4NAWB 4KY5A 3UI3A 4TRDA 4XQJA 3Q8AA 1L6UA 2KCNA 1D5MC 4L23A 4TKOB 4IUQA 4IDIA 1HZ6A 3NZ3A 3P42A 4G7OC 1CA5A 3KBGA 2RDGA 5C0XJ 1PZID 5T1IA 1YNJD 3AE8B 2ZXRA 1L4DB 3PIP3 2VUMB 3BG3A 4ULLA 2EY1A 5ELDA 2BW2A 2OEOA 2LHEA 2WDRB 1JWBD 1L6VA 4OW0A 4NKLA 3VRBB 2J0TD 4K2KA 3DWGC 2JXMB 1YJJA 1UUPA 2KJXA 1JC7A 1SYDA 5I6WA 1SJHD 2B76B 5CC4A 1ZP0B 5F2DA 2JWUA 1B9MA 3DWAA 4ZKCB 3I4NB 1EZ6A 4KD3A 1GHJA 2YU9B 1J7BA 5C4XB 3QJYA 2XRSD 1STBA 3A7LA 3R2IA 3S1QB 1F0ZA 2A68D 4PNYA 3D6CA 4L63B 2L83A 3SXHA 4ITKA 2KQ3A 2JXTA 2Q8IB 3TEWA 1XWEA 4C1NK 3SVMA 1FD6A 4FF4A 1VDVA 1R4PB 4B9WA 1Y56A 4HEA1 1STNA 4EQNA 3S14B 3QWNA 3I8ZA 2E74C 3NP8A 5EKIA 2KQ4X 2WAQB 2SNMA 2BOSA 2PPBC 1NUCA 3SK6A 1VRAB 1QKZA 2ID0A 2E6XA 4B9XA 3MP9A 1HQRD 4ABNA 1J7CA 1PDQA 4C1NI 5FO9B 2LGIA 3P4SB 3PZ8A 4K2LA 3SK4A 3Q24A 2MP1A 1B44D 4BWGB 1XEEA 3CRKC 1FIQA 1C4AA 3NUHB 3J7AF 1K8MA 3LNNA 3MAQA 3MHZA 1QOAA 2MEKA 1M8AA 2PZTA 4J8QA 1JQ4A 2PVOD 2L12A 1HFNA 4CKCA 1I7HA 3I4MB 4MH8A 5I6YA 3EFXD 1F2ZA 1SMYD 4ZRPA 3EUB2 3WOFA 4A6QA 5K36G 1F2MA 1DJRD 1QLBB 3RUZA 4OO1H 1LT4D 2WP8J 2K3UA 2F0FA 1IGDA 1R9TB 4YSZB 1S5DD 1IW7D 1OQQA 1Y8PB 3RZOB 3AECB 4C7ZA 5JEAH 3H91A 1BBXC 1IKLA 3S16B 4PT5A 2WINB 3LXFA 3AU7A 2X6GA 3QB3A 1N60A 3PMFA 4O1NA 2AWNA 4HCSA 4RFBA 4KD4A 2INNE 1QT9A 4TQ1A 2B2TA 2B63B 4GLSC 1OXTA 1ROEA 2WU5B 1X32A 5EE1A 1QILA 1A3TA 3QIAA 1EWYC 5M3MB 3OHXC 2FINB 1W6JA 3K5NA 3Q8FA 2K28A 2RDFA 3BDCA 3H94A 1TS2A 2NTSA 4YTNB 4J1MA 3H09A 1TWCB 3CHBD 4QF4A 2Q8RE 4ZQ3A 2YEPF 3NVVA 4C2MB 5LNK1 4RCNA 3VR5A 2CU3A 3E9SA 1O78A 1EIGA 1TWFB 2LKVA 5C3JB 3ZJVA 1Y1VB 1E0BA 5IGBA 2WV6D 1HFGA 1JRPA 3I73A 3J80L 3D4RA 4K5VA 1OXUA 4LJZC 4OO1G 2J52A 1HTPA 1FO4A 3T51B 4ODGA 3D31A 4WURA 4IQZA 1OO9B 2G9DA 1YN4A 4US8A 2JA5B 3IT6B 2LY7A 5G3LD 1G8ZD 1UAPA 4UDUC 1DZ1A 3NVYA 1HA5A 1LV9A 1NI3A 3FKIB 1AEXA 3AEAB 3X3NA 3Q0AA 2OEDA 2TSSA 1TY0A 2RMMA 4US9A 2WQYB 2L1BA 3RZDB 2E76C 5FK9C 5FO8B 1CTMA 4K6LA 1A2TA 1JQYD 4KGSA 1SBBB 3K0YA 1B50A 2BA0A 2M56B 2M0AA 2JA7B 1YNTE 1LTBD 3KF8A 2B2TC 5HHDG 1CFMA 1FXAA 1ZXIA 3RPFC 1SYBA 2XN9C 3MHBA 1ILQA 2EVBA 1SE2A 1T5XD 5LL6X 2MJEA 1F9RA 1EOTA 4HN7A 1HZ5A 2WXKA 1WGKA 4IUPA 2LFIA 3GTPB 3B9JA 4C3HG 2A5HA 4C56C 2WXIA 4IUVA 1XLNA 1ICWA 1NR2A 1ONLA 4NP5A 3Q23A 3NVWA 2F0PA 3AE7B 2J42A 5HG2A 5I2XA 3N9YC 3FPPA 1G91A 2R61A 4IALA 3J7AV 1Z47A 2CW0C 3E0JA 2QILA 3MEHA 5M5XB 4WQMA 3WOEA 3KUPA 1C48A 2I38A 4YT0B 3FVQA 4N9PA 3V3XA 1LTID 3OMGA 4XT3B 4LAAA 2EYJA 1KNAA 4RF1A 3O13A 3U2SC 2G9HD 3P7JA 2OF1A 5I4DA 4F88A 1K51A 1HCZA 1I4QA 3T3OA 1EFID 2IPKD 3ITPA 4FYDA 1UEAB 3SHLA 5D65A 1XCQL 3PUYA 4BBSB 4MACA 3BK2A 4I65A 1X3PA 1YN5A 1PZJD 4XT1B 5AFWA 5MPOA 2K01A 4P2CB 4X3TA 1WD0A 3KLRA 1B53A 2Q5WD 4ARIA 2B2UC 5E6JA 4DQOC 5HGTA 5ELFA 1BNZA 1LT5D 2E2IB 5KNDA 2VZKD 1IUEA 1TKYA 3M85A 4ZHOA 1ET9A 1WTRA 3BYTB 4LTUA 1QE6A 1O7YA 2WXMA 2A6EC 1KLGD 3MXNA 1FRDA 3R2TA 3ZQ4A 2JYEA 1STHA 2N88A 2LMCA 2F0IA 1IYUA 3W5UB 2L0CA 1E7PB 1PFMA 2FFKB 3D4WA 4ZHPA 3SEBA 5KNCA 1DD2A 1WYGA 3OW7A 3RFZB 3HOVB 4A3KB 2B2UA 3GTOB 1G2TA 2J7ZA 4DXFA 3DXJC 3BS1A 4WFN3 2ON8A 2BE5D 5EGTA 3VR2A 1TS3A 2EJFC 3SE0A 1NYQA 2WDVB 2B2VC 2BA1A 2EOTA 1PGBA 1Q1BA 1TYGB 5JJZA 1DOIA 1N5WA 1QJOA 2H88B 3T13A 2KECA 1WTVA 3ZGZA 2KHSA 3P20A 1HHVA 2X69A 1G2SA 2XRQD 3AEEB 1CZPA 2OT2A 1T5EA 4OIKA 3HVDA 2H4OA 4RGMA 4X3KA 1AP0A 2HUGA 2JEBI 1Y8OB 5BYSA 1LTGD 2EDGA 1A6XA 3T4AC 3H8HA 1OQRA 4DU9A 4RA8A 2V4IB 2K9XA 4U673 5DAUA 4KKJA 3W1SA 4R8NA 4KJOA 1E2WA 2V0GA 1GHKA 5JEAJ 2WP9B 2ZW1A 1MGSA 4HTHA 1D4BA 3GQBA 3NRZA 2AQ3B 1EY8A 1OXXK 1WWTA 3VQIA 5KRUA 2F0TA 1I4PA 3C1EA 4Q5VA 4P6VF 2K03A 2CJNA 4H2AA 2AUJD 3U9SA 5E3FA 4RKLA 4F87A 3NUCA 4A3BB 3U7ZA 2FHTA 1XLPA 1V8CA 2EE1A 2MH7A 3TEZA 3OOCA 1SNMA 5J39A 3MXGA 4HSPA 1M4VA 1JR0D 1H9KA 2A69C 3HOZB 1BUIC 4WIPA 2DY8A 1CZGA 2E75C 1EM7A 1SDFA 2VZKB 2Z4HA 4FVMA 1FRRA 4JX1C 5E4XA 1PZKD 5I9PA 3MA2B 3A56A 3H6MA 3ZYYX 1JOQA 1BO0A 5C0XH 3IAYA 2O2LD 1F9PA 2F0LA 3C46A 3KBXA 3PUXA 3CKIB 1GUSA 5C5LA 3T3NA 1F2RI 2WACA 4A3GB 1PYWD 1C76A 1E0ZA 1CJEA 1Q90A 2NN6I 4EGVA 2E2HB 2DWQA 2WXGA 4LK0M 1NVID 2AQ1B 4BA2I 3C8YA 1JOOA 4R3DA 2I46A 3IKJA 4JBWA 5JAVA 1STEA 1I3QB 3VR3A 1IKMA 1FFUA 3HOUB 4O42A 2F0OA 2F0NA 1IBXA 3U52E 5FR3A 4NDXA 3MVVA 1PTOD 2WXJA 1TWHB 1TWAB 4IOIE 2ICEC 2CHBD 2NVTB 4NMZA 3AE3B 2R7ZB 2RBMA 3VR4A 3CWIA 2B8GA 2R93B 1WTPA 1C4CA 1JWMD 2K04A 1KDAA 3NBIA 1H9JA 2F0SA 3VR6A 3U9OA 1OXSC 2EPBA 2MHVA 3I70A 1RD9D 1CQFA 3FDTA 1ZDXA 4AQ7A 4DXGA 3HRDD 2NVYB 3DWQA 1WTXA 4XDDA 1WTOA 4A3FB 5A2QE 1SJED 3DM1A 1KABA 4HR7B 4RNAA 1FD7D 1RM6C 4E6IA 1PFDA 2H89B 4ZRZA 4LK1C 3DEPA 3T53B 5FLXE 1ML0D 2KA7A 1JICA 3J7YW 4XWWA 1XX8A 1Q10A 1HQMC 2N9LA 1E2ZA 1D5XC 3I3CA 3AMZA 3IT4B 1B2TA 3K5LA 3E5SA 1X3QA 2EZVA 1IW7C 2PZUA 1ZOYB 3AH7A 3I90A 2D9UA 1H9SB 4KI0A 1XXGA 4XQQA 2K6AA 1ZKOA 2NTTA 5C3XA 1LACA 1AZPA 3FMCA 1JWUD 4USAA 3J80E 4L1BA 2F0EA 4K14A 1TJEA 4IUTA 2IJ0A 1RKNA 1DGJA 3EVQA 4B0MA 1CT1D 4K8IA 5BMHA 3P4PB 1U4PA 2IX1A 2WKDA 1LTAD 1HUMA 2B2YA 1RFKA 5JXVA 4CQNA 1SEBD 1CK1A 5IODA 3V2TA 4AS1A 1DOMA 2QDBA 3S1RB 3BK1A 5CV6A 1BF4A 5EJWA 1Q12A 4OZAA 1ZDVA 3DEOA 1GOZA 1SIJA 5CV5A 3HEJA 1XLOA 2RSOA 2BYTA 3A54A 2L11A 2JQRB 1N63A 4H0LC 4MT5A 3GTQB 5JVH3 4C80A 1BUVT 3IFDA 1L4ZB 3ONAB 3VA5A 2DYOA 3IAM1 1BR9A 4ZAIA 3P4RB 2WLBA 2WXRA 2PMZB 2SNSA 2K5WA 2E3TA 2EY6A 2HDMA 4KMUC 1NSNS 1RCVD 3MFGA 3AN1A 5IGEA 1D1KA 4C3IB 1JMLA 4L6TB 1RJTA 5K36H 1EY0A 1Q1EA 3I91A 4OO1I 1CHQD 2N55A 5G5HA 1CM9A 5CYUA 1MHHE 2KEDA 5I9OA 2F0HA 2BS4B 4RKBA 5ELEA 2B39A 1EEFD 1B3AA 2HCCA 2TMPA 3AV8A 4UAIA 1TS5A 4FNFA 1FNVA 3SK8A 5C6AA 1WSPA 1PGAA 1ZXTA 3TN2A 3OWFA 5HFYA 1K83B 3K59A 3E56A 3EGRA 1G6ZA 2PYKA 2G1EA 2NWGA 3I4LA 4JWSC 4P16A 1SNQA 1KH0A 1BQQT 1CHPD 1E2VA 2EYLA 2N9KA 1I4GA 1FNUA 2RDHA 4H13C 1ENFA 3HZXA 3BDOA 5DEHA 1PDXA 3HKZB 2L55A 3J81E 1A70A 1TWGB 4ZUIA 2EYPA 4FO2A 1YMHE 3GTMB 2JP1A 1EY5A 2EYHA 4KGTA 5H92C 1L5PA 4CGYB 1SSOA 5IGCA 1GB1A 4FXDA 3D3RA 5COYA 4M8AA 4IURA 1WTQA 5IOCA 5IT9L 2EKIA 4G4KA 3LYYA 2F0WA 2ACZB 1GUTA 4ZUJA 1ZUD2 1SNPA 3K5OA 1PUTA 3RLFA 5M5YB 4KKSA 3CIRB 1TKEA 4MM3B 1QG7A 5D7GA 2Y0SB 2NYZD 4HEDA 4WH4A 2Z4IA 2YEPB 1SNOA 1MHXA 1GUGA 1PGXA 3T56B 5BMGA 3R3OA 4DNTB 4KJNA 2K0PA 2EY5A 2BB6A 5JVG3 3NPPA 1PTOH 2B2VA 5KYIA 3HOWB 5M5WB 4GDKB 4YXDB 4MN3A 1YJIA 4ZRQA 4IFDI 4A3MB 1PMRA 1HRJA 4KKUA 4QMGA 1GPXA 2LEKA 1PRTB 2B8FA 1A2UA 5K5PA 4KX6B 3PO3B 1ZXHA 5E1FA 2WB1B 3AB9A 4KY7A 5JPMC 2V3PA 4HMIA 2BDOA 3FILA 2CJOA 2VNUD 2WXPA 2O5JC 4KHZA 1DOXA 3NXWA 5JEAG 4EQPA 4RHRA 2D5DA 3C3LA 2SDFA 4DK0A 1QOGA 1GJXA 1V97A 1H9RA 4QUFA 5JOBA 5ELCA 1ZE3D 4GDLB 5IT9E 1AFPA 1HTLD 1EYAA 1LTRD 1EWCA 4BA1I 3J9CA 4CJ0B 2IGGA 2BT6A 3MWYW 2PNRC 1I50B 1TKGA 2VB3X 1KTKA 2ZXPA 3DWMA 1KDCA 4OZBA 4HKQA 4CJ1B 2SEBD 4FF1A 1QNUA 3HOYB 4KHVA 1MSGA 3A8KE 3URYA 1FCLA 1G291 2KACA 1H9SA 1SYFA 1E9MA 2R3ZA 3DMUA 2KEEA 5BN3A 5KNBA 2LJIA 1KLUD 2CQAA 3OMCA 1D1IA 1Q3LA 1JROA 2NVXB 4A3JB 2DBYA 3OSOA 1HA6A 4U68A 2RSNA 3MFYA 3Q6SA 2ZT9C 3CU7A 1C78A 3F2UA 3TMEA 1J8IA 3W3AA 1SXTA 1OFFA 3P4QB 3TBIB 4KKTA 2WU2B 1L0YB 3BYYB 2V4DA 4OIJA 2LHDA 2FUG1 3GTLB 4RGOS 2WXLA 3TUOA 4BY7B 1F77A 3PUVA 2W54A 1HUNA 1EU4A 2K5DA 1PLFA 5EKKA 4XDCA 4WAFA 1ESRA 2K1BA 2KVMA 5FLXL 5C44B 3IFTA 4RF0A 3V96A 1QOFA 1FNWA 3DUZA 3S1NB 5FOBB 1SF0A 4OHJA 4V190 3BDLA 3GS2A 3VYTA 1AZQA 1N5XA 4TMAB 3W9CB 1YQ3B 5C4JB 4YSXB 1B9NA 1I4RA 1O7ZA 4PQXA 1ENCA 3AE2B 3VYUA 2Y3AA 4I7ZC 3L7ZC 3GB1A 2K5PA 1I4XA 2A6ED 1S5FD 2NBFA 3X3MA 3Q69A 1O80A 5EPJA 4Q0FA 3G7LA 4ARCA </