1J7AA

Structure of the anabaena ferredoxin d68k mutant
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
98
structure length
98
Chain Sequence
ATFKVTLINEAEGTKHEIEVPDDEYILDAAEEQGYDLPFSCRAGACSTCAGKLVSGTVDQSDQSFLDKDQIEAGYVLTCVAYPTSDVVIQTHKEEDLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords FERREDOXIN I
publication title Structure-function relationships in Anabaena ferredoxin: correlations between X-ray crystal structures, reduction potentials, and rate constants of electron transfer to ferredoxin:NADP+ reductase for site-specific ferredoxin mutants.
pubmed doi rcsb
source organism Nostoc sp. pcc
total genus 25
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2001-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1j7aA00
3L4PA 3CIRB 1N5XA 1RFKA 1N62A 5H92C 4P6VF 3ETRA 4C80A 3HVZA 2H89B 4ZHPA 1J7BA 3LXFA 1E10A 3VR8B 1NYRA 3P63A 1FFUA 1A70A 2EKIA 4ITKA 1L6UA 4WQMA 1FRRA 3AH7A 1V97A 1XO3A 4LTUA 4YXDB 3SFDB 4JX1C 1SIJA 1PUTA 1GAQB 1QOGA 3LB8C 3AEDB 1N61A 2E3TA 1CZPA 1WWTA 3DWMA 3SFEB 1ZP0B 1XLOA 3P4RB 1DGJA 1N60A 1ZXIA 2PVGC 3AB5A 3HUIA 5AUKA 3ZYYX 3AN1A 1WYGA 2N0SB 4N59A 2G1EA 3AECB 5EE1A 2WDRB 1SB3C 2ACZB 3B2FA 4YSYB 5GXGB 3W5UB 1QLBB 2PIAA 5C2TB 4YSZB 1N63A 3AE4B 2WDVB 1V8CA 5MPOA 1KF6B 3BIID 3FAHA 1VLBA 1JWBD 2AX5A 3AV8A 4YT0B 1JALA 3AE8B 1YJJA 3NVZA 1PFDA 1ZUD2 3AE5B 5H8YE 3ABVB 1IUEA 1FRDA 1J7AA 2QJLA 1L0VB 2DBYA 1KFYB 1EWYC 5EE3A 1SF0A 1JRPA 2K9XA 2W3RA 2WDQB 2B76B 5EE0A 4FXCA 1QF6A 3P4PB 3VR9B 1L6VA 3VRBB 2OHFA 1FM0D 3HRDD 3P1MA 5G5HA 3FC4A 3NRZA 4USAA 1NI3A 2HTME 2Q5WD 3AEBB 3KWLA 3DWGC 2M56B 1KRHA 2MJ3A 2WLBA 3NVVA 4ZOHC 3PO0A 1FMAD 2FBWB 2CU3A 4US8A 2K22A 1GPXA 1E7PB 1YQ3B 3RPFC 4KX6B 2QIEB 1NENB 1T3QA 3P4SB 1FIQA 2K5PA 3AE7B 5EE9A 3AEGB 2W3SA 3B2GA 2PVOD 2L52A 1WRIA 2M19A 1NVID 2WS3B 1FFVA 3AEAB 2BS3B 4WWMA 4C7ZA 3NVWA 1J7CA 1VDVA 3EUB2 1L5PA 3B9JA 5G5GA 2MJDA 3W9CB 2BS2B 4ZHOA 2CJOA 4HROA 4JWSC 3WCQA 4YTPB 1JWAD 1QOFA 1TKGA 4YTMB 1XLQA 2WQYB 2KMMA 1TKYA 2LEKA 1FO4A 1JW9D 1NYQA 1PDXA 2PKOA 3SR6A 1RYJA 2BS4B 2W54A 1UWMA 2MH7A 1OQQA 2DWQA 3AMZA 3AEEB 1TKEA 2Y5CA 3AE2B 4C7YA 2WP9B 2WU5B 3AE9B 1TJEA 2L83A 3CWIA 1XLPA 2MJEA 3NVYA 1N5WA 5AUIA 1RM6C 1DOYA 2JX5A 4YSXB 1FXAA 1QOBA 1OFFA 1WXQA 3W5VB 3AE3B 1YQ4B 3AE1B 4YTNB 2W55A 1E0ZA 1YJIA 1E9MA 1OQRA 3AEFB 2WU2B 1B9RA 4IDIA 2H88B 3AE6B 1F0ZA 4HRSA 1DOXA 4N6EB 1AWDA 3VRAB 1ROEA 2JQRB 1ZOYB 4N58A 1CJEA 1E6EB 1FXIA 1I7HA 1JQ4A 1JROA 5C3JB 3P4QB 1WGKA 2KAJA 1AYFA 1TYGB 2BT6A 3AM9A 1VJKA 4US9A 1QT9A 4A9AA 3NS1A 4JWUC 1RWSA 1XLNA 1R7SA 1NEKB 2CJNA 1DOIA 1QOAA
chains in the Genus database with same CATH superfamily
1S3SG 2FCSA 3IXSA 1C4AA 1WM2A 4FJYA 3O65B 4OZAA 4BVUC 2LGDA 3ZW3A 5D2MB 1PQSA 1PUTA 2WX1A 2KC1A 3AEDB 4ZRQA 4S17A 3Q2AC 5D94A 4DHZB 3SFEB 2PVGC 1F2RC 1D5XC 3AN1A 2AL6A 3IT4B 4MGYE 5HHDG 3H7SA 2WXLA 3AV8A 4OVUA 2J0JA 3ABVB 4KSLC 1ZGUB 4KGRA 2V9HA 4KVGB 2LJ5A 1RRBA 2D11A 4A3OA 2D07B 2RSUA 3EC8A 1P98A 4MH0E 2EELA 4LDTD 2JZZA 5D6JB 3R7RA 1Q10A 3VUXA 4CQNA 2ZNVB 3VTUA 1F1HA 2RPVA 3JW0X 1C79A 3R66C 2V3PA 2CJOA 3DBLB 4HROA 4K7WA 1ZXHA 4MJSB 1LM8B 4BZAA 3RULA 1P7EA 1Z5SB 2WXRA 3Q3MC 3M3JA 2IO3B 3CWIA 2L83A 3R2IA 5IOIA 1I4HA 1WYWB 2W55A 3HM3A 4JQWC 4CHKA 2YEPB 2KYWA 2LVPA 4X57B 3DBRI 1EWCA 1JQ4A 3P4QB 1I42A 3L10B 1AYFA 2Y5BB 2YVCA 3M95A 3MTNB 4JWUC 3ZIMA 1RFKA 4LLGM 5G2NA 2H89B 1S1QB 3NY5A 1L0YB 3PZ8A 2KWDA 1L6UA 4KDIC 2G4DB 4ZRIA 1GAQB 1WZ0A 2C7NB 4AJWA 5LXHA 1WYGA 2XK5B 2FUHB 2WDVB 1HZ5A 3U8ZA 2O2VA 4ZRPA 2J42A 3IBEA 3TCAA 4RM8A 2RGFA 3FC4A 1UELA 2JWUA 1TS2A 2MBBB 4CYEA 1I4GA 1V1OA 1HA5A 4GMVA 5HFYA 1E7PB 3PZ7A 3ZQ4A 2K5PA 4NJCA 2DZMA 5IA7A 1V80A 3L16A 2ZEQA 3LYYA 2KC2A 2MEKA 2LGIA 2BGFA 1M94A 2JUOA 1UWMA 2DWQA 4HPPA 1YOVB 2JY6A 2GRIA 3D32A 3JYUA 3Q8FA 1AW7A 4M8MA 1E7VA 3W2DA 4YSXB 5JHAA 4W9FA 1UD7A 3R8BA 3GZNI 2NBVB 1QQRA 2N1VA 2RDHA 4EOYA 4HRSA 5BO4B 4M00A 2BWES 4KSKC 1LXDA 2K8CA 1GC6A 1HEZE 4KIKB 4ZYNA 5D3DA 3APCA 4MSQB 3HVZA 1BXTA 3Q8CA 2IZVB 4ARIA 3L13A 2BYEA 2Z0EB 2MW5A 1MPEA 4BKGA 2NTSA 2UU7A 4AWJA 2V3NA 4W9DA 3LB8C 1F9JA 1N61A 3QWZB 2ZJDA 5DPSA 3P4RB 5IAAC 1WM3A 2D10A 4GN1A 1SB3C 2ACZB 2KX3A 3UIOB 4DDGD 3BIID 1MHHE 4YWGG 2HDEA 4DXFA 1YJJA 1XQQA 2MBHA 1NI2A 2ZCCA 2YLMA 1FNWA 3NG0A 1UGJA 1QF6A 3T9LA 2NMQA 3P1MA 4DDID 4REZA 3KUCB 2N7EA 2VRRB 3T8MA 4KV2A 2LUMA 3Q3NC 1XD3B 4DXAB 1NENB 4IKGA 2KXJA 4NY0A 1E8ZA 1PGAA 1E90A 2QSDA 3U2SC 2M19A 2LZ6A 4NQKE 4C4VB 1Q0WB 4HK2A 4YTPB 2JYTA 4IM3A 4JPSA 2WQYB 2LEKA 5DPTA 3RYTA 4ICUA 1FCLA 3SD5A 1EU4A 2IBIB 3MC9A 2IGDA 3RN9C 1TKEA 4AS1A 1OGWA 3ZRCA 4PYUA 2M17A 5HG2A 3JSVB 4I6NB 1C76A 3AE3B 1YX5B 2CHWA 4RGMA 5C23A 1I4QA 5D7GA 1B9RA 4M0WB 2BKRB 1AWDA 4HCNB 3BVMA 4DHJB 3DBHI 3EFCA 3R2TA 4GXBA 5J18A 2JRHA 3W1SA 4BOSC 2N9EB 3I3TB 3TIXA 4WH4A 4P6VF 1E10A 2ZW1A 1PGBA 2JPHA 3E9SA 1Z2MA 4R3DA 2JRIB 1SIJA 2C7HA 4XGAB 5J17A 1CMXB 3AXCA 2KT7A 3DHIC 1WE6A 4WJPA 3PSEB 5EE1A 2LHDA 4FHKA 2NBUA 2ICIA 2INDC 1ZUD2 3H7PB 4W9EA 5H8YE 1KH0A 5EE3A 1JRPA 3P4PB 4B95A 3KYCD 1FM0D 1FD6A 4DXGA 2MSED 3ZTDA 1KOTA 4DQOC 1FEHA 4PYZA 2JZPA 4JLCA 4ASWC 2R2OA 4HDOA 2KLGA 1ZKHA 4LK0M 1TBEA 1WE7A 2E6XA 2XNAC 2IPKD 2MQJA 1T0YA 1PDXA 1WR6E 3A9JA 4XE0A 2DYBA 3AMZA 4G3XB 4FXCA 3VRBB 1TJEA 3WAMA 1FNVA 2WNMA 1YIWA 4BOZB 4KDLB 3AEFB 2WU2B 1OEYA 1WF9A 1C4PA 1ROEA 2KWCA 3ENEA 4B9KA 1E6EB 3U7ZA 3V3XA 4KZCA 2DAFA 3GE8C 3PRMB 4US9A 3TUOA 1FPYA 1ZDXA 3DCGA 3TJPA 2WYQA 2RD0A 4J3OD 3SHQA 1V6EA 1JCKB 3V05A 4G0NB 2KWUB 3A4RA 4YXDB 2C5LC 1TZOA 1WFYA 4GLSC 4MEMA 1HQRD 1Y56A 3Q8AA 1V5TA 2WXFA 3ZXVA 3PRPB 4KKIA 5AZGA 2BTEA 1ZXIA 2HTHA 4N59A 2G1EA 1FCCC 2LFIA 1YN4A 4AQ7A 2KWVB 1WGGA 2RDGA 4WURA 2FCQA 2LGXA 2L32A 2QJLA 2NBWB 2ONQA 3VR9B 4LNFA 2DNFA 4WIPA 3GS2A 2N9KA 2M0AA 3VH4B 4TSSA 5DPWA 4HKQA 1GPXA 3ZGZA 1E8YA 2SEBD 1STEA 4TQ0A 3PVLA 2D3GA 2KMCA 1YQBA 1SJHD 4WWOA 1T0RC 2PMVA 3QJZA 4O1NA 3VAWA 2W9NA 2BKFA 1RLFA 3SDLC 1WIAA 2BS2B 4RM9A 4JWSC 2QHOA 1JWAD 3MJ5A 1TIFA 2GI9A 1FO4A 2OOBB 1JW9D 2PKOA 2GLSA 3V62A 2DHZA 1T5XD 4C7YA 1QILA 2KN4A 5D3IB 1F52A 1R4NI 3URYA 2DX5B 3QA8A 2ZZPB 3DVGX 2N7JA 5JZEB 2WXGA 4MELA 2D3AA 2O6VD 1UBQA 4I6PA 3RCZA 1YX6B 3ONSA 1VRAB 1WGKA 2BT6A 1WGHA 3BK1A 4IUMB 2KVRA 1IBXA 1ACCA 2CJNA 5G5GA 3CIRB 4FBJB 1NBFC 4K1RB 3IAM1 1NYRA 4EFOA 1A70A 2JVCA 1D6EC 3N9YC 1XO3A 1KTKA 1K52A 4PS7A 3V6EB 2DYOA 1EO6A 3WAPA 3TMPB 3R7QA 2B3AA 2J0MA 4RGNA 4YSZB 5C2TB 3ZNID 2KJHB 1V8CA 1NDDA 1TTNA 2MX2A 4P1CC 1RFAA 1PFDA 3I9V1 4EZJA 3KWVA 4Q2JA 1L2NA 3DDCB 2B76B 2SAKA 1E8WA 1L6VA 3P42A 1TS4A 4HPMB 3KWLA 2OEDA 3PT2B 1ET9A 4E3CA 2KDFB 3Q8BA 2K6QA 4K81A 4JGHB 2L8JA 2N9PC 4OVVA 2LXCA 4GGQA 1D3ZA 5AZHA 2LASA 2BS3B 4C7ZA 2D3BA 5EDSA 3Q3FA 3RZWC 3WCQA 2L76A 2QEJC 2AYOB 3Q3OC 2IJ0A 3DQVA 3L0WB 2FE8A 2KJRA 2W54A 2MH7A 1WZ3A 3FILB 4RFBA 3SU8X 1WGDA 2KHWB 4WAAA 3Q3JA 1JRUA 1E9MA 1TY0A 2FIDA 2H88B 3AE6B 3IFWB 2DZKA 2K8HA 2MA9B 4TMAB 2BYFA 1ZOYB 2KFKA 4S0RA 4FJZA 1JROA 4B0EA 4RCOA 3KYDD 1R7SA 2IYDB 1K8RB 3ZRFA 3Q8EA 2DENB 4N9F4 3DHGC 3NUHB 1UUPA 3C8YA 4OZBA 5J2RA 1N60A 2O6VA 2JF5A 3B1LX 5E6NA 1C9FA 1WGRA 5CHWA 4MDKE 1N63A 4PS3A 1CQVA 3MHZA 3AE8B 2KLCA 3UINB 5LXIB 3ZJTA 1I35A 2L05A 2KD0A 2KK8A 2WDQB 4YL8A 4IC7B 2OHFA 1ESFA 5C1ZA 2REXA 1UBIA 2CU1A 2IO0B 4US8A 2CU3A 2N9XA 4TQ1A 2QILA 4HCPB 4PS8A 1EF5A 3AE7B 4IM2A 3RD2A 2D2QA 1SE4A 4NAWA 4HJGE 1M4VA 2Y5PA 1P9DU 2MP2A 4ZHOA 2MJDA 2L1AA 3UI3A 2J52A 3PRZA 3PZDA 4F8CB 1RYJA 4WQOB 3QIJA 1L4ZB 4EZLA 5KHOA 1ENFA 2IGHA 4WJQA 5FKAC 4JL9A 4ACFA 2NVUI 3AU4A 1R4MB 3IG3A 1UH6A 5HI1A 1PGXA 1VJKA 3RNEC 1NEKB 2PJHA 4KGSA 4P16A 3NZUA 4P7IA 3U30A 1J7BA 2LWPA 4LNIA 3M63B 4ITKA 3C0RB 1FRRA 2AQ3B 1JWSD 2KN5A 3A9JB 1WJ4A 3QAQA 2K1FA 2E3TA 3BY4B 1CZPA 1ZP0B 3AB5A 5AUKA 5IKCM 4LCDE 1J0GA 3W5UB 1ZDVA 4YSYB 2KANA 3J9CA 3AE5B 3ZXRA 1IUEA 1J7AA 2KDIA 1L0VB 2N7DA 2FAZA 3BYYB 3KVFB 5IO9A 2VH2A 3HRDD 5TR5A 1KJTA 3H9DA 2K25A 3HVDA 2VZKD 3A1QA 2MLBA 2M56B 4GDKA 1KRHA 1IGCA 4ZOHC 1L0XB 2FBWB 2ZNVC 3OJ3A 3IHPC 2NPTA 1XEEA 1YQ3B 1YMHE 4HEA1 3RT3B 2FCMA 2XBBC 1VDVA 2WWZA 1TS3A 4ZYSA 2KDBA 5BMIA 3FILA 3ZVVA 1MG4A 1GJZA 3PHWB 2A5UA 2PEAA 3SR6A 2LMCA 3T3NA 1G6JA 2J4XA 2G9HD 3QK0A 1XT9B 1EU3A 2RPQA 2KMAA 4LNOA 3DBRB 1WXQA 3OLMD 2NR2A 2X38A 2LI5A 4IDIA 1DOXA 1K53A 3NS1A 1N5XA 3MC0B 3IT6B 5H92C 2FUG1 1WX7A 3ETRA 4BKTA 3RNCC 1OQYA 2KO3A 1OTRB 3SFDB 4RMAA 1Q5WB 1ZW7A 3RUIB 2N0SB 2PE9A 1BUIC 2LRWA 2WXPA 3UIPB 2AX5A 3M62B 4WWNA 3K9PB 2BBCA 1WI0A 2MBEA 1I4XA 2LJIA 2K9XA 1IBXB 1WR1A 4K7UA 3HIZA 1XCTL 3DVNV 5G5HA 2BVCA 1WXSA 1SSNA 3PHXB 2INCC 3N30A 1MG8A 1WJNA 1C3TA 1PYWD 4URKA 4W9JA 3Q14C 1EF1A 1N6ZA 2W3SA 4DK5A 2EKEC 5BYQA 2MRPA 3ZUNA 3HK0A 1QOFA 2ASQA 2K0PA 1WXAA 2LUEA 2GBKA 3GZNB 3PV1A 2BYVE 2VH1A 4WAFA 3AE2B 4AP4C 2OJRA 3NVYA 1BMLC 4KGTA 5JHBA 3N1YC 3ZKJC 3CMMB 2NS5A 2V4IB 1H8CA 1K51A 3ZNHB 3WALA 1XF5L 4NZLB 1YN3A 5BYRA 1I4PA 2L7RA 3PLVA 1MHXA 1P0RA 3PS6A 4C00A 2INPE 1VZ6A 1V1PA 1TS5A 1E5WA 3AM9A 3I57A 1P1AA 4B6WA 3L08A 3L4PA 4ANXA 3KH0A 1ZE3D 2N1WA 4ARCA 2CHXA 3BINA 2AL3A 1I4RA 2RMMA 5JXVA 1UGMA 1V86A 4LTUA 2K6DB 1QOGA 3CF6E 4NJ7A 1XLOA 3WA0A 1B1ZA 3A9KA 1JMLA 2KQ7A 1SJED 1QLBB 2D5GA 2MBOA 2KX0A 3NVZA 4MGKE 2KFKB 2DBYA 4M01A 1EWYC 3DVNU 3NZ3A 4OVZA 1EUVB 3H8HA 3I63C 2WXQA 2Q5WD 1XXGA 2V0GA 2MJ3A 1R4MI 2WXJA 2DZIA 5FK9C 3ZLZA 5EE9A 1JWUD 2CHZA 1WXMA 1WXVA 4LJOB 2GBMA 4IWPA 1TZ1A 2WXIA 2O6VB 2CS4A 3Q69A 1SBBB 4J6IA 2G45B 3QC8B 2DZJA 2L0TA 1C77A 4C56C 2C7MB 1AARA 4OHJA 4W9GA 1K50A 5I4DA 4GIVA 3DBLI 5JH5C 5CHFA 5L95C 2GBNA 1RM6C 4CO7A 2JX5A 3OAWA 3MFGA 2K39A 3AI5A 3RNGC 3DBHB 1YJIA 2GMIC 4JIOU 4HDQA 3EHVA 4L2YA 1TY2A 2LHEA 3S2AA 4NAWB 4L23A 4L1BA 4P1BC 3O13A 4OZCA 1DOIA 2MP2B 2AQ2B 1N62A 2BW2A 3B0AA 1SXTA 2L0FA 1SEBD 3TEYA 4W9HA 3U7DA 4OW0A 4XWWA 1WWTA 1MJDA 3DWMA 3KQ4A 1UNSA 1T6BX 4LJPB 2R2QA 2BB5A 1WSPA 2MCNB 1VLBA 1JWBD 2I1KA 1SE2A 3RI7C 1YN5A 3OG5A 2J7QB 4W9IA 1Y8RC 3ZNZB 2W82A 1D5MC 1P7FA 3QCAA 4W9LA 2ZW0A 3A33B 3K9OB 4LDTB 2WLBA 4EUTA 3ZNGC 1FMAD 4IM0A 2K22A 5IP4D 4II2B 4NJ6A 1J19A 3EECA 3AULA 5E6OA 3ECIA 2L52A 4RGOS 1L4DB 2WGSA 1GB4A 1FXTB 3RFZB 2Z0DB 4YTMB 4F1SA 3B08A 2K8BA 4PT5A 2HJ1A 4NAMA 4MGZE 4TUUA 2IY0B 2BYTA 1N5WA 2DYMA 4A3PA 1V49A 1A5RA 2PE6B 3VHTC 3A1QB 1WX9A 4GDKB 3RNAC 3IVFA 4FA6A 2NPTB 4N58A 2KTRA 1I7HA 4KKJA 1GNUA 2KAJA 2WXOA 3VFKA 2HD5B 1RWSA 2M8SA 1UWXA 2WX0A 4II3B 1QOAA 5TSSA 2XN9C 4RGTA 3VR8B 2EKIA 1WH3A 2DLBA 4G50A 3NOBA 4IWQA 4NQLB 5CHVC 4KZ0A 3C19A 2Z8LA 2LVOA 3LDZE 2QCZA 3PREA 4JE3B 1LQBA 3ZYYX 4MH8A 2IDYA 1IP9A 5AZFA 2WDRB 5GXGB 1V5OA 3AE4B 5AEKB 2EMTA 3BWUD 4MM3A 2ZCBA 3PPAA 2WXKA 3KUZA 4ANUA 2KOXA 4RF1A 3KW5B 2KVZA 2HE7A 3DWGC 4HXDA 4HJKA 3V61A 1HTQA 3APDA 3RPFC 2QIEB 2CKHB 4AJYB 2PVOD 2WS3B 3AEAB 3MP9A 1UZXB 4E71A 2D3CA 2BQQA 2DAJA 3RZFA 3TL5A 1XLQA 2KMMA 3N20C 1R4NB 4XYCA 5GMVA 3I5JC 3P2BA 1T0QC 2JT4B 2OJWA 2LXAA 2V1YA 2KJ6A 3PGEA 2KQ4X 3DOWA 2MJEA 5AUIA 2AWTA 4GDLA 4A20A 2EMSA 2KFJA 1FXAA 3APFA 4FULA 3MC8A 1UF0A 3DHHC 2GB1A 4GB9A 1F0ZA 3GOEA 1F77A 4GU2A 4LNKA 2MHJA 1TYGB 3VQIA 2L3ZA 1QT9A 2R61A 3VTWA 2LRUA 3NJTA 3WAOA 2KKCA 4AOFA 3VUWA 1C4CA 2BF8B 5BMHA 2QMTA 2ZVOA 1FFUA 4WJNA 1YJ1A 2JXTA 3TBLD 3AH7A 3H6NA 2VZKB 2J53A 4FN2A 2C9WB 3N3KB 5DPRA 2J0KA 2HJ8A 3W1YA 2PIAA 3NHEB 1C78A 3N1ZC 3FAHA 4YT0B 2QC8A 2MBQA 2FCNA 1FRDA 1V1PB 3EA6A 1TGZB 1H4RA 2ON8A 1KM7A 4D2KA 5BMGA 2LVQA 3U52E 2I1JA 1XCQL 1NI3A 3AEBB 4GOCA 4HVBA 1CK1A 2I2YA 1WJUA 3NVVA 1VCBA 2G3QB 3PO0A 2IGGA 4EKUA 2IO2B 2A4ZA 1T3QA 1FIQA 2CR5A 1J7CA 3A9KB 1WMHA 2KTFA 2UYZB 1HTOA 3VXWA 2GBJA 3UGBB 2KZRA 1VR9A 4F7ZA 4BBNC 4M8NA 4A90A 3A4SC 1V2YA 3ML9A 3VUYA 3VVWB 4BFRA 3TEZA 3GE3C 3NZSA 4FHJA 4K3CA 1OEYJ 1OFFA 2AEHA 3V60A 1E0ZA 3DBSA 4TKNA 4BKSD 2INNE 1CJEA 4FLHA 1FXIA 4AUQC 4A8XC 4XX5A 2I38A 4HKZE 3UQAA 3R3MA 3X0WA 2M4NA 1U4AA 4XWTA 4C80A 2LGYA 3SEBA 1IGDA 1LO5D 4NPNA 1F2RI 5FR3A 3HM6X 4UDUC 4JX1C 2GOWA 4ANWA 5CX3A 1DGJA 3NS8A 1C1YB 4MT5A 4XC2A 1FNUA 5IN7A 1SGHA 2AQ1B 2LGSA 1LFDA 4MJSA 1JALA 1VZ8A 3W1SC 3VH3B 4H2AA 3DVGY 2WXMA 1QZEA 1P3QU 1KFYB 2JYEA 1ZPSA 1KLGD 3GB1A 4RF0A 3WANA 2W3RA 4E74A 3Q6BA 4DWFA 4XZ4A 4ICVA 3NRZA 3RNFC 3L54A 2TSSA 2ZPNA 4DBGA 2KNBA 5E6JA 3BVZA 3ALBA 3EUB2 3W9CB 4EE2A 3E56A 1HZ6A 1AN8A 1HE8A 5G55A 3OJ4B 2N9LA 2FIFA 1GC7A 1WX8A 4ZDVA 1MI0A 3VDZA 2KDMA 3AEEB 3LJ3A 1EM7A 2WP9B 3AE9B 2WXHA 4LNNA 1QKZA 4B0MA 2UWQA 3W5VB 4YTNB 2XK5A 4N6EB 5C3JB 4A6QA 4BAXA 4A9AA 2JSVX 4EZKA 2KQSA 4K7SA 2ZVNA 3LXFA 4FJVB 5CTRC 3P63A 4WQMA 3ZDMC 2WXNA 1WY8A 1V97A 3JVZX 4W9KA 3BYTB 3IAS1 2LD9A 1LGRA 1SE3A 1RAXA 2QDFA 4BKSA 2V3SA 2G4SA 1V81A 3AECB 4ZHPA 4DHJD 4BBNF 1KF6B 4IWOA 2L00B 3QX1A 2JXXA 1DYQA 4RH6A 4MACA 2KTRB 1X1MA 1GG3A 3L17A 2M0XA 4HPLB 4ANVA 3FKYA 1SF0A 1MVKA 3T3OA 2WHIA 1SIFA 4USAA 3WIMA 1V9JA 4TV3A 4WJOA 3TSSA 2Z59B 5HKHA 2M1MA 3UF8A 4EEWA 4I6LB 3UQBA 1IPGA 1T0SC 4KX6B 3RNBC 3P4SB 4IG7B 3AEGB 2ZPYA 4KIKA 3V6CB 5DCNA 3B9JA 1HXYD 1Q1OA 4FADA 2YEPF 4MM3B 3RMKC 1NYQA 4WWPA 5LNK1 3ZJUA 1OQQA 4ZRKA 2Y5CA 1KLVA 4GSWA 2WU5B 3X23A 4XDCA 1TT5B 1WRDB 1YQ4B 3KUDB 3QHTA 2K3UA 4MSMB 3VTVA 2KACA 3TEWA 3PTFC 4K3BA 2PLPA 3PLUA 5L83A 3BK2A 3ZDTA 2PPHA 3U4EG 1VZ7A 3MHSD 1ET6A 2KDEB 4IOIE 1XLNA 3KLSX 2X8XX 2BB6A 2PW9A 2BPSA 3MJWA 1E8XA 2RR9A 3GP7A 3H1UA 1BT0A 1J8CA 3AU5A 4NNJB 4HLEA 3QQ8B 3HHMA 4DHZE 4GDLB 3HUIA 4C4VA 4MGIE 3B2FA 5LLIA 2V4LA 3N32A 5MPOA 1JWMD 4M02A 3CSFA 4XDDA 3ZTCA 2C60A 5EE0A 2GBRA 3ZO5B 3JSVA 1VD2A 4G11A 2HTME 5KHQA 2WDTB 1YD8U 1WGYA 2O2VB 4M0WA 4A55A 2RDBC 2MWSB 4IW0A 4RNAA 3B2GA 1WRIA 1NVID 2JU6X 3DPDA 1FFVA 3ML8A 4WWMA 3BVGA 3NVWA 4QAYA 2N4FA 1E7UA 1L5PA 4HWIB 3BZDB 3EFUA 1TKGA 2FNJB 2JZ3B 1ISNA 2IO1B 2NTTA 1D5ZC 2Y3AA 3N1XC 1TKYA 1GUAB 1IYFA 1GOZA 1KLUD 5FR6A 2BS4B 3CSTA 5E6PA 1MFWA 2PTLA 1XLPA 1DOYA 1QOBA 1WJ6A 3ZJVA 2IY1B 3AE1B 1D4BA 1OQRA 3EGRA 1GB1A 3VRAB 3H7PA 3OWEB 3TEXA 2JQRB 4ZRJA 5T8IA 1SE9A 2JWZA 2BWFA 5BYSA 1L7YA 2NCNA 2XEWA 3QARA 4W9CA 4PK1A 1WMHB 1YNTE
chains in the Genus database with same CATH topology
1C4CA 1N5XA 3IXSA 3IT6B 3MC0B 1C4AA 5H92C 2FUG1 3ETRA 5BMHA 4J3OD 2QMTA 1FFUA 4OZAA 1JCKB 3V05A 2JXTA 3AH7A 4YXDB 3SFDB 1TZOA 2VZKB 2J53A 1PUTA 4GLSC 1HQRD 1Y56A 3Q8AA 3AEDB 2WXFA 4ZRQA 4KKIA 3SFEB 2BTEA 1ZXIA 1F2RC 2PVGC 1D5XC 3AN1A 2N0SB 4N59A 2G1EA 3IT4B 1FCCC 1BUIC 2LFIA 5HHDG 2PIAA 2WXPA 1YN4A 4AQ7A 1C78A 2RDGA 2WXLA 4YT0B 3FAHA 2AX5A 4WURA 3AV8A 3ABVB 2BBCA 1FRDA 2L32A 2QJLA 1V1PB 1I4XA 2LJIA 3EA6A 2ONQA 2ON8A 4KGRA 2K9XA 1IBXB 4D2KA 3VR9B 1XCTL 5BMGA 3U52E 5G5HA 1XCQL 4WIPA 1NI3A 3GS2A 3AEBB 2N9KA 2M0AA 2I2YA 1CK1A 1SSNA 4TSSA 3NVVA 4HKQA 2EELA 3PO0A 2IGGA 1GPXA 3ZGZA 2SEBD 1STEA 4TQ0A 1Q10A 4CQNA 1PYWD 1T3QA 1FIQA 2W3SA 5BYQA 1SJHD 2RPVA 2PMVA 4O1NA 1J7CA 1C79A 2V3PA 2BS2B 2CJOA 4HROA 4JWSC 1JWAD 1QOFA 2K0PA 3MJ5A 1VR9A 1ZXHA 4A90A 2GI9A 1FO4A 1JW9D 2PKOA 1P7EA 1T5XD 2WXRA 4WAFA 3AE2B 4C7YA 3TEZA 1QILA 2KN4A 3CWIA 2L83A 5D3IB 3NVYA 3R2IA 1BMLC 4KGTA 1I4HA 1OFFA 2V4IB 3URYA 1K51A 2W55A 1E0ZA 1XF5L 4NZLB 1YN3A 5BYRA 2N7JA 1I4PA 1MHXA 2WXGA 2YEPB 2INPE 1VZ6A 2INNE 1CJEA 1FXIA 1VRAB 1EWCA 1JQ4A 3P4QB 4A8XC 1V1PA 1TS5A 1WGKA 2I38A 1AYFA 2BT6A 3BK1A 3AM9A 1IBXA 4JWUC 4HKZE 1ACCA 2CJNA 5G5GA 3I57A 3L4PA 3CIRB 1RFKA 1ZE3D 4XWTA 4ARCA 4LLGM 4C80A 3IAM1 2H89B 1L0YB 3PZ8A 1NYRA 1A70A 2KWDA 1D6EC 3N9YC 1I4RA 1L6UA 3SEBA 1IGDA 1LO5D 2RMMA 5JXVA 1F2RI 1XO3A 4LTUA 1KTKA 5FR3A 1K52A 4UDUC 4JX1C 1GAQB 1QOGA 2DYOA 1XLOA 1DGJA 1B1ZA 1JMLA 4MT5A 1WYGA 4RGNA 1FNUA 1SJED 4YSZB 1QLBB 5C2TB 2D5GA 2AQ1B 2WDVB 1V8CA 1JALA 1HZ5A 1VZ8A 3NVZA 1PFDA 3I9V1 4H2AA 3KWVA 4Q2JA 2WXMA 2DBYA 3GB1A 1KFYB 1EWYC 1ZPSA 1KLGD 2JYEA 2J42A 3NZ3A 4RF0A 4ZRPA 2W3RA 2B76B 2SAKA 4OVZA 1L6VA 3H8HA 3P42A 1TS4A 3FC4A 3NRZA 2WXQA 2JWUA 2Q5WD 3KWLA 1TS2A 1I4GA 2OEDA 1XXGA 1V1OA 2V0GA 1HA5A 2MJ3A 1ET9A 3Q8BA 2TSSA 2WXJA 5HFYA 1E7PB 5E6JA 5FK9C 3PZ7A 3ZQ4A 2K5PA 3BVZA 1JWUD 4NJCA 5EE9A 2BS3B 2WXIA 4C7ZA 3EUB2 3W9CB 4EE2A 3E56A 1HZ6A 3Q69A 1SBBB 1AN8A 3WCQA 2QEJC 2N9LA 2IJ0A 1C77A 3LYYA 4C56C 4OHJA 2MEKA 2FE8A 2LGIA 1MI0A 2W54A 1UWMA 1K50A 2KDMA 2MH7A 2DWQA 5I4DA 3AEEB 1EM7A 2WP9B 2GRIA 3AE9B 3FILB 3Q8FA 1AW7A 2WXHA 4RFBA 1RM6C 2JX5A 3W2DA 4YSXB 1QKZA 4B0MA 3MFGA 3W5VB 4YTNB 3R8BA 1YJIA 1E9MA 1TY0A 1QQRA 2H88B 3AE6B 2RDHA 4TMAB 4HRSA 4N6EB 4L2YA 1ZOYB 1JROA 4B0EA 5C3JB 1TY2A 4RCOA 4A6QA 2LHEA 4A9AA 4NAWB 4L23A 4L1BA 1R7SA 1HEZE 3O13A 4OZCA 2JSVX 1DOIA 2AQ2B 1N62A 5D3DA 2BW2A 3HVZA 3LXFA 1BXTA 3P63A 3Q8CA 1SXTA 3Q8EA 1SEBD 4ARIA 4WQMA 2WXNA 3TEYA 1V97A 3NUHB 1MPEA 2NTSA 4OW0A 1UUPA 3BYTB 2V3NA 3C8YA 4OZBA 4XWWA 3IAS1 3LB8C 1N61A 1WWTA 1SE3A 3DWMA 3P4RB 3KQ4A 1N60A 1UNSA 1T6BX 1C9FA 3AECB 4ZHPA 1SB3C 2ACZB 1N63A 2BB5A 1KF6B 1CQVA 1WSPA 1MHHE 1JWBD 1VLBA 3BIID 4YWGG 1SE2A 1DYQA 2HDEA 3AE8B 3MHZA 4DXFA 1YJJA 1YN5A 4RH6A 4MACA 1FNWA 3ZJTA 1SF0A 1UGJA 2W82A 1MVKA 3T3OA 1QF6A 1D5MC 1P7FA 2WDQB 2OHFA 1ESFA 2NMQA 3P1MA 4USAA 2ZW0A 4REZA 3TSSA 2WLBA 1FMAD 4US8A 2CU3A 2K22A 2LUMA 4TQ1A 4KX6B 2QILA 1NENB 4IKGA 3P4SB 1PGAA 3AE7B 3AEGB 2QSDA 3U2SC 2L52A 2M19A 1SE4A 4HJGE 1M4VA 4RGOS 1L4DB 2Y5PA 1GB4A 3B9JA 4ZHOA 2MJDA 2L1AA 3UI3A 3RFZB 1HXYD 4YTPB 2J52A 2JYTA 4YTMB 2YEPF 4JPSA 2WQYB 4MM3B 2LEKA 4PT5A 1NYQA 1RYJA 1FCLA 5LNK1 3ZJUA 1EU4A 1OQQA 2IGDA 4NAMA 1TKEA 2Y5CA 4AS1A 1L4ZB 2WU5B 2BYTA 1N5WA 2DYMA 4XDCA 5HG2A 1ENFA 2IGHA 1C76A 3AE3B 1YQ4B 2K3UA 4RGMA 5FKAC 1I4QA 4GDKB 5D7GA 1B9RA 2KACA 3TEWA 1AWDA 2PLPA 4N58A 5HI1A 1I7HA 3BVMA 3BK2A 4KKJA 2KAJA 1PGXA 2WXOA 3U4EG 1VZ7A 3R2TA 1ET6A 1VJKA 3W1SA 4IOIE 1RWSA 1XLNA 1UWXA 3KLSX 1NEKB 4KGSA 4P16A 1QOAA 2BB6A 2PW9A 5TSSA 4WH4A 2XN9C 4P6VF 1J7BA 1E10A 2ZW1A 4RGTA 3VR8B 2EKIA 1PGBA 3GP7A 4ITKA 1FRRA 2DLBA 2AQ3B 1JWSD 3E9SA 4R3DA 1SIJA 2E3TA 1CZPA 2Z8LA 4GDLB 1ZP0B 3AB5A 4JE3B 3HUIA 5AUKA 3ZYYX 4MH8A 2IDYA 5EE1A 2LHDA 2WDRB 3W5UB 1ZDVA 3B2FA 4YSYB 5GXGB 3AE4B 5MPOA 3BWUD 2ICIA 1JWMD 3J9CA 1ZUD2 3AE5B 5H8YE 1IUEA 2WXKA 1KH0A 1J7AA 4XDDA 1L0VB 5EE3A 4RF1A 1JRPA 5EE0A 3BYYB 3P4PB 1FM0D 3HRDD 1FD6A 3HVDA 2HTME 2VZKD 4DXGA 3DWGC 2M56B 1KRHA 1IGCA 4ZOHC 4M0WA 1L0XB 2FBWB 4DQOC 4A55A 1FEHA 1XEEA 1YQ3B 1YMHE 4HEA1 2QIEB 2JZPA 3RPFC 4RNAA 3B2GA 2PVOD 1WRIA 1NVID 2JU6X 2WS3B 1FFVA 3AEAB 4WWMA 3BVGA 3MP9A 3NVWA 1VDVA 4LK0M 1TS3A 1L5PA 4ZYSA 3BZDB 2E6XA 5BMIA 3FILA 2XNAC 1TKGA 2NTTA 1D5ZC 2IPKD 2Y3AA 1XLQA 2KMMA 1TKYA 1PDXA 3SR6A 1GOZA 1KLUD 2BS4B 2LMCA 4XE0A 3T3NA 3AMZA 2J4XA 4FXCA 2PTLA 3VRBB 1TJEA 2KQ4X 1XLPA 2G9HD 2MJEA 5AUIA 1DOYA 1EU3A 1FNVA 1FXAA 1QOBA 2WNMA 1WXQA 3ZJVA 3AE1B 2X38A 1D4BA 1OQRA 3AEFB 2GB1A 2WU2B 4IDIA 1F0ZA 3EGRA 1DOXA 1GB1A 3VRAB 1C4PA 1F77A 1ROEA 2JQRB 3OWEB 3TEXA 1E6EB 1K53A 3U7ZA 5T8IA 3V3XA 1TYGB 3VQIA 2R61A 1QT9A 4US9A 5BYSA 3NS1A 3TUOA 1ZDXA 1YNTE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L4P A;  3CIR B;  1N5X A;  1RFK A;  1N62 A;  5H92 C;  4P6V F;  3ETR A;  4C80 A;  3HVZ A;  2H89 B;  4ZHP A;  1J7B A;  3LXF A;  1E10 A;  3VR8 B;  1NYR A;  3P63 A;  1FFU A;  1A70 A;  2EKI A;  4ITK A;  1L6U A;  4WQM A;  1FRR A;  3AH7 A;  1V97 A;  1XO3 A;  4LTU A;  4YXD B;  3SFD B;  4JX1 C;  1SIJ A;  1PUT A;  1GAQ B;  1QOG A;  3LB8 C;  3AED B;  1N61 A;  2E3T A;  1CZP A;  1WWT A;  3DWM A;  3SFE B;  1ZP0 B;  1XLO A;  3P4R B;  1DGJ A;  1N60 A;  1ZXI A;  2PVG C;  3AB5 A;  3HUI A;  5AUK A;  3ZYY X;  3AN1 A;  1WYG A;  2N0S B;  4N59 A;  2G1E A;  3AEC B;  5EE1 A;  2WDR B;  1SB3 C;  2ACZ B;  3B2F A;  4YSY B;  5GXG B;  3W5U B;  1QLB B;  2PIA A;  5C2T B;  4YSZ B;  1N63 A;  3AE4 B;  2WDV B;  1V8C A;  5MPO A;  1KF6 B;  3BII D;  3FAH A;  1VLB A;  1JWB D;  2AX5 A;  3AV8 A;  4YT0 B;  1JAL A;  3AE8 B;  1YJJ A;  3NVZ A;  1PFD A;  1ZUD 2;  3AE5 B;  5H8Y E;  3ABV B;  1IUE A;  1FRD A;  1J7A A;  2QJL A;  1L0V B;  2DBY A;  1KFY B;  1EWY C;  5EE3 A;  1SF0 A;  1JRP A;  2K9X A;  2W3R A;  2WDQ B;  2B76 B;  5EE0 A;  4FXC A;  1QF6 A;  3P4P B;  3VR9 B;  1L6V A;  3VRB B;  2OHF A;  1FM0 D;  3HRD D;  3P1M A;  5G5H A;  3FC4 A;  3NRZ A;  4USA A;  1NI3 A;  2HTM E;  2Q5W D;  3AEB B;  3KWL A;  3DWG C;  2M56 B;  1KRH A;  2MJ3 A;  2WLB A;  3NVV A;  4ZOH C;  3PO0 A;  1FMA D;  2FBW B;  2CU3 A;  4US8 A;  2K22 A;  1GPX A;  1E7P B;  1YQ3 B;  3RPF C;  4KX6 B;  2QIE B;  1NEN B;  1T3Q A;  3P4S B;  1FIQ A;  2K5P A;  3AE7 B;  5EE9 A;  3AEG B;  2W3S A;  3B2G A;  2PVO D;  2L52 A;  1WRI A;  2M19 A;  1NVI D;  2WS3 B;  1FFV A;  3AEA B;  2BS3 B;  4WWM A;  4C7Z A;  3NVW A;  1J7C A;  1VDV A;  3EUB 2;  1L5P A;  3B9J A;  5G5G A;  2MJD A;  3W9C B;  2BS2 B;  4ZHO A;  2CJO A;  4HRO A;  4JWS C;  3WCQ A;  4YTP B;  1JWA D;  1QOF A;  1TKG A;  4YTM B;  1XLQ A;  2WQY B;  2KMM A;  1TKY A;  2LEK A;  1FO4 A;  1JW9 D;  1NYQ A;  1PDX A;  2PKO A;  3SR6 A;  1RYJ A;  2BS4 B;  2W54 A;  1UWM A;  2MH7 A;  1OQQ A;  2DWQ A;  3AMZ A;  3AEE B;  1TKE A;  2Y5C A;  3AE2 B;  4C7Y A;  2WP9 B;  2WU5 B;  3AE9 B;  1TJE A;  2L83 A;  3CWI A;  1XLP A;  2MJE A;  3NVY A;  1N5W A;  5AUI A;  1RM6 C;  1DOY A;  2JX5 A;  4YSX B;  1FXA A;  1QOB A;  1OFF A;  1WXQ A;  3W5V B;  3AE3 B;  1YQ4 B;  3AE1 B;  4YTN B;  2W55 A;  1E0Z A;  1YJI A;  1E9M A;  1OQR A;  3AEF B;  2WU2 B;  1B9R A;  4IDI A;  2H88 B;  3AE6 B;  1F0Z A;  4HRS A;  1DOX A;  4N6E B;  1AWD A;  3VRA B;  1ROE A;  2JQR B;  1ZOY B;  4N58 A;  1CJE A;  1E6E B;  1FXI A;  1I7H A;  1JQ4 A;  1JRO A;  5C3J B;  3P4Q B;  1WGK A;  2KAJ A;  1AYF A;  1TYG B;  2BT6 A;  3AM9 A;  1VJK A;  4US9 A;  1QT9 A;  4A9A A;  3NS1 A;  4JWU C;  1RWS A;  1XLN A;  1R7S A;  1NEK B;  2CJN A;  1DOI A;  1QOA A; 
#chains in the Genus database with same CATH topology
 1S3S G;  2FCS A;  3IXS A;  1C4A A;  1WM2 A;  4FJY A;  3O65 B;  4OZA A;  4BVU C;  2LGD A;  3ZW3 A;  5D2M B;  1PQS A;  1PUT A;  2WX1 A;  2KC1 A;  3AED B;  4ZRQ A;  4S17 A;  3Q2A C;  5D94 A;  4DHZ B;  3SFE B;  2PVG C;  1F2R C;  1D5X C;  3AN1 A;  2AL6 A;  3IT4 B;  4MGY E;  5HHD G;  3H7S A;  2WXL A;  3AV8 A;  4OVU A;  2J0J A;  3ABV B;  4KSL C;  1ZGU B;  4KGR A;  2V9H A;  4KVG B;  2LJ5 A;  1RRB A;  2D11 A;  4A3O A;  2D07 B;  2RSU A;  3EC8 A;  1P98 A;  4MH0 E;  2EEL A;  4LDT D;  2JZZ A;  5D6J B;  3R7R A;  1Q10 A;  3VUX A;  4CQN A;  2ZNV B;  3VTU A;  1F1H A;  2RPV A;  3JW0 X;  1C79 A;  3R66 C;  2V3P A;  2CJO A;  3DBL B;  4HRO A;  4K7W A;  1ZXH A;  4MJS B;  1LM8 B;  4BZA A;  3RUL A;  1P7E A;  1Z5S B;  2WXR A;  3Q3M C;  3M3J A;  2IO3 B;  3CWI A;  2L83 A;  3R2I A;  5IOI A;  1I4H A;  1WYW B;  2W55 A;  3HM3 A;  4JQW C;  4CHK A;  2YEP B;  2KYW A;  2LVP A;  4X57 B;  3DBR I;  1EWC A;  1JQ4 A;  3P4Q B;  1I42 A;  3L10 B;  1AYF A;  2Y5B B;  2YVC A;  3M95 A;  3MTN B;  4JWU C;  3ZIM A;  1RFK A;  4LLG M;  5G2N A;  2H89 B;  1S1Q B;  3NY5 A;  1L0Y B;  3PZ8 A;  2KWD A;  1L6U A;  4KDI C;  2G4D B;  4ZRI A;  1GAQ B;  1WZ0 A;  2C7N B;  4AJW A;  5LXH A;  1WYG A;  2XK5 B;  2FUH B;  2WDV B;  1HZ5 A;  3U8Z A;  2O2V A;  4ZRP A;  2J42 A;  3IBE A;  3TCA A;  4RM8 A;  2RGF A;  3FC4 A;  1UEL A;  2JWU A;  1TS2 A;  2MBB B;  4CYE A;  1I4G A;  1V1O A;  1HA5 A;  4GMV A;  5HFY A;  1E7P B;  3PZ7 A;  3ZQ4 A;  2K5P A;  4NJC A;  2DZM A;  5IA7 A;  1V80 A;  3L16 A;  2ZEQ A;  3LYY A;  2KC2 A;  2MEK A;  2LGI A;  2BGF A;  1M94 A;  2JUO A;  1UWM A;  2DWQ A;  4HPP A;  1YOV B;  2JY6 A;  2GRI A;  3D32 A;  3JYU A;  3Q8F A;  1AW7 A;  4M8M A;  1E7V A;  3W2D A;  4YSX B;  5JHA A;  4W9F A;  1UD7 A;  3R8B A;  3GZN I;  2NBV B;  1QQR A;  2N1V A;  2RDH A;  4EOY A;  4HRS A;  5BO4 B;  4M00 A;  2BWE S;  4KSK C;  1LXD A;  2K8C A;  1GC6 A;  1HEZ E;  4KIK B;  4ZYN A;  5D3D A;  3APC A;  4MSQ B;  3HVZ A;  1BXT A;  3Q8C A;  2IZV B;  4ARI A;  3L13 A;  2BYE A;  2Z0E B;  2MW5 A;  1MPE A;  4BKG A;  2NTS A;  2UU7 A;  4AWJ A;  2V3N A;  4W9D A;  3LB8 C;  1F9J A;  1N61 A;  3QWZ B;  2ZJD A;  5DPS A;  3P4R B;  5IAA C;  1WM3 A;  2D10 A;  4GN1 A;  1SB3 C;  2ACZ B;  2KX3 A;  3UIO B;  4DDG D;  3BII D;  1MHH E;  4YWG G;  2HDE A;  4DXF A;  1YJJ A;  1XQQ A;  2MBH A;  1NI2 A;  2ZCC A;  2YLM A;  1FNW A;  3NG0 A;  1UGJ A;  1QF6 A;  3T9L A;  2NMQ A;  3P1M A;  4DDI D;  4REZ A;  3KUC B;  2N7E A;  2VRR B;  3T8M A;  4KV2 A;  2LUM A;  3Q3N C;  1XD3 B;  4DXA B;  1NEN B;  4IKG A;  2KXJ A;  4NY0 A;  1E8Z A;  1PGA A;  1E90 A;  2QSD A;  3U2S C;  2M19 A;  2LZ6 A;  4NQK E;  4C4V B;  1Q0W B;  4HK2 A;  4YTP B;  2JYT A;  4IM3 A;  4JPS A;  2WQY B;  2LEK A;  5DPT A;  3RYT A;  4ICU A;  1FCL A;  3SD5 A;  1EU4 A;  2IBI B;  3MC9 A;  2IGD A;  3RN9 C;  1TKE A;  4AS1 A;  1OGW A;  3ZRC A;  4PYU A;  2M17 A;  5HG2 A;  3JSV B;  4I6N B;  1C76 A;  3AE3 B;  1YX5 B;  2CHW A;  4RGM A;  5C23 A;  1I4Q A;  5D7G A;  1B9R A;  4M0W B;  2BKR B;  1AWD A;  4HCN B;  3BVM A;  4DHJ B;  3DBH I;  3EFC A;  3R2T A;  4GXB A;  5J18 A;  2JRH A;  3W1S A;  4BOS C;  2N9E B;  3I3T B;  3TIX A;  4WH4 A;  4P6V F;  1E10 A;  2ZW1 A;  1PGB A;  2JPH A;  3E9S A;  1Z2M A;  4R3D A;  2JRI B;  1SIJ A;  2C7H A;  4XGA B;  5J17 A;  1CMX B;  3AXC A;  2KT7 A;  3DHI C;  1WE6 A;  4WJP A;  3PSE B;  5EE1 A;  2LHD A;  4FHK A;  2NBU A;  2ICI A;  2IND C;  1ZUD 2;  3H7P B;  4W9E A;  5H8Y E;  1KH0 A;  5EE3 A;  1JRP A;  3P4P B;  4B95 A;  3KYC D;  1FM0 D;  1FD6 A;  4DXG A;  2MSE D;  3ZTD A;  1KOT A;  4DQO C;  1FEH A;  4PYZ A;  2JZP A;  4JLC A;  4ASW C;  2R2O A;  4HDO A;  2KLG A;  1ZKH A;  4LK0 M;  1TBE A;  1WE7 A;  2E6X A;  2XNA C;  2IPK D;  2MQJ A;  1T0Y A;  1PDX A;  1WR6 E;  3A9J A;  4XE0 A;  2DYB A;  3AMZ A;  4G3X B;  4FXC A;  3VRB B;  1TJE A;  3WAM A;  1FNV A;  2WNM A;  1YIW A;  4BOZ B;  4KDL B;  3AEF B;  2WU2 B;  1OEY A;  1WF9 A;  1C4P A;  1ROE A;  2KWC A;  3ENE A;  4B9K A;  1E6E B;  3U7Z A;  3V3X A;  4KZC A;  2DAF A;  3GE8 C;  3PRM B;  4US9 A;  3TUO A;  1FPY A;  1ZDX A;  3DCG A;  3TJP A;  2WYQ A;  2RD0 A;  4J3O D;  3SHQ A;  1V6E A;  1JCK B;  3V05 A;  4G0N B;  2KWU B;  3A4R A;  4YXD B;  2C5L C;  1TZO A;  1WFY A;  4GLS C;  4MEM A;  1HQR D;  1Y56 A;  3Q8A A;  1V5T A;  2WXF A;  3ZXV A;  3PRP B;  4KKI A;  5AZG A;  2BTE A;  1ZXI A;  2HTH A;  4N59 A;  2G1E A;  1FCC C;  2LFI A;  1YN4 A;  4AQ7 A;  2KWV B;  1WGG A;  2RDG A;  4WUR A;  2FCQ A;  2LGX A;  2L32 A;  2QJL A;  2NBW B;  2ONQ A;  3VR9 B;  4LNF A;  2DNF A;  4WIP A;  3GS2 A;  2N9K A;  2M0A A;  3VH4 B;  4TSS A;  5DPW A;  4HKQ A;  1GPX A;  3ZGZ A;  1E8Y A;  2SEB D;  1STE A;  4TQ0 A;  3PVL A;  2D3G A;  2KMC A;  1YQB A;  1SJH D;  4WWO A;  1T0R C;  2PMV A;  3QJZ A;  4O1N A;  3VAW A;  2W9N A;  2BKF A;  1RLF A;  3SDL C;  1WIA A;  2BS2 B;  4RM9 A;  4JWS C;  2QHO A;  1JWA D;  3MJ5 A;  1TIF A;  2GI9 A;  1FO4 A;  2OOB B;  1JW9 D;  2PKO A;  2GLS A;  3V62 A;  2DHZ A;  1T5X D;  4C7Y A;  1QIL A;  2KN4 A;  5D3I B;  1F52 A;  1R4N I;  3URY A;  2DX5 B;  3QA8 A;  2ZZP B;  3DVG X;  2N7J A;  5JZE B;  2WXG A;  4MEL A;  2D3A A;  2O6V D;  1UBQ A;  4I6P A;  3RCZ A;  1YX6 B;  3ONS A;  1VRA B;  1WGK A;  2BT6 A;  1WGH A;  3BK1 A;  4IUM B;  2KVR A;  1IBX A;  1ACC A;  2CJN A;  5G5G A;  3CIR B;  4FBJ B;  1NBF C;  4K1R B;  3IAM 1;  1NYR A;  4EFO A;  1A70 A;  2JVC A;  1D6E C;  3N9Y C;  1XO3 A;  1KTK A;  1K52 A;  4PS7 A;  3V6E B;  2DYO A;  1EO6 A;  3WAP A;  3TMP B;  3R7Q A;  2B3A A;  2J0M A;  4RGN A;  4YSZ B;  5C2T B;  3ZNI D;  2KJH B;  1V8C A;  1NDD A;  1TTN A;  2MX2 A;  4P1C C;  1RFA A;  1PFD A;  3I9V 1;  4EZJ A;  3KWV A;  4Q2J A;  1L2N A;  3DDC B;  2B76 B;  2SAK A;  1E8W A;  1L6V A;  3P42 A;  1TS4 A;  4HPM B;  3KWL A;  2OED A;  3PT2 B;  1ET9 A;  4E3C A;  2KDF B;  3Q8B A;  2K6Q A;  4K81 A;  4JGH B;  2L8J A;  2N9P C;  4OVV A;  2LXC A;  4GGQ A;  1D3Z A;  5AZH A;  2LAS A;  2BS3 B;  4C7Z A;  2D3B A;  5EDS A;  3Q3F A;  3RZW C;  3WCQ A;  2L76 A;  2QEJ C;  2AYO B;  3Q3O C;  2IJ0 A;  3DQV A;  3L0W B;  2FE8 A;  2KJR A;  2W54 A;  2MH7 A;  1WZ3 A;  3FIL B;  4RFB A;  3SU8 X;  1WGD A;  2KHW B;  4WAA A;  3Q3J A;  1JRU A;  1E9M A;  1TY0 A;  2FID A;  2H88 B;  3AE6 B;  3IFW B;  2DZK A;  2K8H A;  2MA9 B;  4TMA B;  2BYF A;  1ZOY B;  2KFK A;  4S0R A;  4FJZ A;  1JRO A;  4B0E A;  4RCO A;  3KYD D;  1R7S A;  2IYD B;  1K8R B;  3ZRF A;  3Q8E A;  2DEN B;  4N9F 4;  3DHG C;  3NUH B;  1UUP A;  3C8Y A;  4OZB A;  5J2R A;  1N60 A;  2O6V A;  2JF5 A;  3B1L X;  5E6N A;  1C9F A;  1WGR A;  5CHW A;  4MDK E;  1N63 A;  4PS3 A;  1CQV A;  3MHZ A;  3AE8 B;  2KLC A;  3UIN B;  5LXI B;  3ZJT A;  1I35 A;  2L05 A;  2KD0 A;  2KK8 A;  2WDQ B;  4YL8 A;  4IC7 B;  2OHF A;  1ESF A;  5C1Z A;  2REX A;  1UBI A;  2CU1 A;  2IO0 B;  4US8 A;  2CU3 A;  2N9X A;  4TQ1 A;  2QIL A;  4HCP B;  4PS8 A;  1EF5 A;  3AE7 B;  4IM2 A;  3RD2 A;  2D2Q A;  1SE4 A;  4NAW A;  4HJG E;  1M4V A;  2Y5P A;  1P9D U;  2MP2 A;  4ZHO A;  2MJD A;  2L1A A;  3UI3 A;  2J52 A;  3PRZ A;  3PZD A;  4F8C B;  1RYJ A;  4WQO B;  3QIJ A;  1L4Z B;  4EZL A;  5KHO A;  1ENF A;  2IGH A;  4WJQ A;  5FKA C;  4JL9 A;  4ACF A;  2NVU I;  3AU4 A;  1R4M B;  3IG3 A;  1UH6 A;  5HI1 A;  1PGX A;  1VJK A;  3RNE C;  1NEK B;  2PJH A;  4KGS A;  4P16 A;  3NZU A;  4P7I A;  3U30 A;  1J7B A;  2LWP A;  4LNI A;  3M63 B;  4ITK A;  3C0R B;  1FRR A;  2AQ3 B;  1JWS D;  2KN5 A;  3A9J B;  1WJ4 A;  3QAQ A;  2K1F A;  2E3T A;  3BY4 B;  1CZP A;  1ZP0 B;  3AB5 A;  5AUK A;  5IKC M;  4LCD E;  1J0G A;  3W5U B;  1ZDV A;  4YSY B;  2KAN A;  3J9C A;  3AE5 B;  3ZXR A;  1IUE A;  1J7A A;  2KDI A;  1L0V B;  2N7D A;  2FAZ A;  3BYY B;  3KVF B;  5IO9 A;  2VH2 A;  3HRD D;  5TR5 A;  1KJT A;  3H9D A;  2K25 A;  3HVD A;  2VZK D;  3A1Q A;  2MLB A;  2M56 B;  4GDK A;  1KRH A;  1IGC A;  4ZOH C;  1L0X B;  2FBW B;  2ZNV C;  3OJ3 A;  3IHP C;  2NPT A;  1XEE A;  1YQ3 B;  1YMH E;  4HEA 1;  3RT3 B;  2FCM A;  2XBB C;  1VDV A;  2WWZ A;  1TS3 A;  4ZYS A;  2KDB A;  5BMI A;  3FIL A;  3ZVV A;  1MG4 A;  1GJZ A;  3PHW B;  2A5U A;  2PEA A;  3SR6 A;  2LMC A;  3T3N A;  1G6J A;  2J4X A;  2G9H D;  3QK0 A;  1XT9 B;  1EU3 A;  2RPQ A;  2KMA A;  4LNO A;  3DBR B;  1WXQ A;  3OLM D;  2NR2 A;  2X38 A;  2LI5 A;  4IDI A;  1DOX A;  1K53 A;  3NS1 A;  1N5X A;  3MC0 B;  3IT6 B;  5H92 C;  2FUG 1;  1WX7 A;  3ETR A;  4BKT A;  3RNC C;  1OQY A;  2KO3 A;  1OTR B;  3SFD B;  4RMA A;  1Q5W B;  1ZW7 A;  3RUI B;  2N0S B;  2PE9 A;  1BUI C;  2LRW A;  2WXP A;  3UIP B;  2AX5 A;  3M62 B;  4WWN A;  3K9P B;  2BBC A;  1WI0 A;  2MBE A;  1I4X A;  2LJI A;  2K9X A;  1IBX B;  1WR1 A;  4K7U A;  3HIZ A;  1XCT L;  3DVN V;  5G5H A;  2BVC A;  1WXS A;  1SSN A;  3PHX B;  2INC C;  3N30 A;  1MG8 A;  1WJN A;  1C3T A;  1PYW D;  4URK A;  4W9J A;  3Q14 C;  1EF1 A;  1N6Z A;  2W3S A;  4DK5 A;  2EKE C;  5BYQ A;  2MRP A;  3ZUN A;  3HK0 A;  1QOF A;  2ASQ A;  2K0P A;  1WXA A;  2LUE A;  2GBK A;  3GZN B;  3PV1 A;  2BYV E;  2VH1 A;  4WAF A;  3AE2 B;  4AP4 C;  2OJR A;  3NVY A;  1BML C;  4KGT A;  5JHB A;  3N1Y C;  3ZKJ C;  3CMM B;  2NS5 A;  2V4I B;  1H8C A;  1K51 A;  3ZNH B;  3WAL A;  1XF5 L;  4NZL B;  1YN3 A;  5BYR A;  1I4P A;  2L7R A;  3PLV A;  1MHX A;  1P0R A;  3PS6 A;  4C00 A;  2INP E;  1VZ6 A;  1V1P A;  1TS5 A;  1E5W A;  3AM9 A;  3I57 A;  1P1A A;  4B6W A;  3L08 A;  3L4P A;  4ANX A;  3KH0 A;  1ZE3 D;  2N1W A;  4ARC A;  2CHX A;  3BIN A;  2AL3 A;  1I4R A;  2RMM A;  5JXV A;  1UGM A;  1V86 A;  4LTU A;  2K6D B;  1QOG A;  3CF6 E;  4NJ7 A;  1XLO A;  3WA0 A;  1B1Z A;  3A9K A;  1JML A;  2KQ7 A;  1SJE D;  1QLB B;  2D5G A;  2MBO A;  2KX0 A;  3NVZ A;  4MGK E;  2KFK B;  2DBY A;  4M01 A;  1EWY C;  3DVN U;  3NZ3 A;  4OVZ A;  1EUV B;  3H8H A;  3I63 C;  2WXQ A;  2Q5W D;  1XXG A;  2V0G A;  2MJ3 A;  1R4M I;  2WXJ A;  2DZI A;  5FK9 C;  3ZLZ A;  5EE9 A;  1JWU D;  2CHZ A;  1WXM A;  1WXV A;  4LJO B;  2GBM A;  4IWP A;  1TZ1 A;  2WXI A;  2O6V B;  2CS4 A;  3Q69 A;  1SBB B;  4J6I A;  2G45 B;  3QC8 B;  2DZJ A;  2L0T A;  1C77 A;  4C56 C;  2C7M B;  1AAR A;  4OHJ A;  4W9G A;  1K50 A;  5I4D A;  4GIV A;  3DBL I;  5JH5 C;  5CHF A;  5L95 C;  2GBN A;  1RM6 C;  4CO7 A;  2JX5 A;  3OAW A;  3MFG A;  2K39 A;  3AI5 A;  3RNG C;  3DBH B;  1YJI A;  2GMI C;  4JIO U;  4HDQ A;  3EHV A;  4L2Y A;  1TY2 A;  2LHE A;  3S2A A;  4NAW B;  4L23 A;  4L1B A;  4P1B C;  3O13 A;  4OZC A;  1DOI A;  2MP2 B;  2AQ2 B;  1N62 A;  2BW2 A;  3B0A A;  1SXT A;  2L0F A;  1SEB D;  3TEY A;  4W9H A;  3U7D A;  4OW0 A;  4XWW A;  1WWT A;  1MJD A;  3DWM A;  3KQ4 A;  1UNS A;  1T6B X;  4LJP B;  2R2Q A;  2BB5 A;  1WSP A;  2MCN B;  1VLB A;  1JWB D;  2I1K A;  1SE2 A;  3RI7 C;  1YN5 A;  3OG5 A;  2J7Q B;  4W9I A;  1Y8R C;  3ZNZ B;  2W82 A;  1D5M C;  1P7F A;  3QCA A;  4W9L A;  2ZW0 A;  3A33 B;  3K9O B;  4LDT B;  2WLB A;  4EUT A;  3ZNG C;  1FMA D;  4IM0 A;  2K22 A;  5IP4 D;  4II2 B;  4NJ6 A;  1J19 A;  3EEC A;  3AUL A;  5E6O A;  3ECI A;  2L52 A;  4RGO S;  1L4D B;  2WGS A;  1GB4 A;  1FXT B;  3RFZ B;  2Z0D B;  4YTM B;  4F1S A;  3B08 A;  2K8B A;  4PT5 A;  2HJ1 A;  4NAM A;  4MGZ E;  4TUU A;  2IY0 B;  2BYT A;  1N5W A;  2DYM A;  4A3P A;  1V49 A;  1A5R A;  2PE6 B;  3VHT C;  3A1Q B;  1WX9 A;  4GDK B;  3RNA C;  3IVF A;  4FA6 A;  2NPT B;  4N58 A;  2KTR A;  1I7H A;  4KKJ A;  1GNU A;  2KAJ A;  2WXO A;  3VFK A;  2HD5 B;  1RWS A;  2M8S A;  1UWX A;  2WX0 A;  4II3 B;  1QOA A;  5TSS A;  2XN9 C;  4RGT A;  3VR8 B;  2EKI A;  1WH3 A;  2DLB A;  4G50 A;  3NOB A;  4IWQ A;  4NQL B;  5CHV C;  4KZ0 A;  3C19 A;  2Z8L A;  2LVO A;  3LDZ E;  2QCZ A;  3PRE A;  4JE3 B;  1LQB A;  3ZYY X;  4MH8 A;  2IDY A;  1IP9 A;  5AZF A;  2WDR B;  5GXG B;  1V5O A;  3AE4 B;  5AEK B;  2EMT A;  3BWU D;  4MM3 A;  2ZCB A;  3PPA A;  2WXK A;  3KUZ A;  4ANU A;  2KOX A;  4RF1 A;  3KW5 B;  2KVZ A;  2HE7 A;  3DWG C;  4HXD A;  4HJK A;  3V61 A;  1HTQ A;  3APD A;  3RPF C;  2QIE B;  2CKH B;  4AJY B;  2PVO D;  2WS3 B;  3AEA B;  3MP9 A;  1UZX B;  4E71 A;  2D3C A;  2BQQ A;  2DAJ A;  3RZF A;  3TL5 A;  1XLQ A;  2KMM A;  3N20 C;  1R4N B;  4XYC A;  5GMV A;  3I5J C;  3P2B A;  1T0Q C;  2JT4 B;  2OJW A;  2LXA A;  2V1Y A;  2KJ6 A;  3PGE A;  2KQ4 X;  3DOW A;  2MJE A;  5AUI A;  2AWT A;  4GDL A;  4A20 A;  2EMS A;  2KFJ A;  1FXA A;  3APF A;  4FUL A;  3MC8 A;  1UF0 A;  3DHH C;  2GB1 A;  4GB9 A;  1F0Z A;  3GOE A;  1F77 A;  4GU2 A;  4LNK A;  2MHJ A;  1TYG B;  3VQI A;  2L3Z A;  1QT9 A;  2R61 A;  3VTW A;  2LRU A;  3NJT A;  3WAO A;  2KKC A;  4AOF A;  3VUW A;  1C4C A;  2BF8 B;  5BMH A;  2QMT A;  2ZVO A;  1FFU A;  4WJN A;  1YJ1 A;  2JXT A;  3TBL D;  3AH7 A;  3H6N A;  2VZK B;  2J53 A;  4FN2 A;  2C9W B;  3N3K B;  5DPR A;  2J0K A;  2HJ8 A;  3W1Y A;  2PIA A;  3NHE B;  1C78 A;  3N1Z C;  3FAH A;  4YT0 B;  2QC8 A;  2MBQ A;  2FCN A;  1FRD A;  1V1P B;  3EA6 A;  1TGZ B;  1H4R A;  2ON8 A;  1KM7 A;  4D2K A;  5BMG A;  2LVQ A;  3U52 E;  2I1J A;  1XCQ L;  1NI3 A;  3AEB B;  4GOC A;  4HVB A;  1CK1 A;  2I2Y A;  1WJU A;  3NVV A;  1VCB A;  2G3Q B;  3PO0 A;  2IGG A;  4EKU A;  2IO2 B;  2A4Z A;  1T3Q A;  1FIQ A;  2CR5 A;  1J7C A;  3A9K B;  1WMH A;  2KTF A;  2UYZ B;  1HTO A;  3VXW A;  2GBJ A;  3UGB B;  2KZR A;  1VR9 A;  4F7Z A;  4BBN C;  4M8N A;  4A90 A;  3A4S C;  1V2Y A;  3ML9 A;  3VUY A;  3VVW B;  4BFR A;  3TEZ A;  3GE3 C;  3NZS A;  4FHJ A;  4K3C A;  1OEY J;  1OFF A;  2AEH A;  3V60 A;  1E0Z A;  3DBS A;  4TKN A;  4BKS D;  2INN E;  1CJE A;  4FLH A;  1FXI A;  4AUQ C;  4A8X C;  4XX5 A;  2I38 A;  4HKZ E;  3UQA A;  3R3M A;  3X0W A;  2M4N A;  1U4A A;  4XWT A;  4C80 A;  2LGY A;  3SEB A;  1IGD A;  1LO5 D;  4NPN A;  1F2R I;  5FR3 A;  3HM6 X;  4UDU C;  4JX1 C;  2GOW A;  4ANW A;  5CX3 A;  1DGJ A;  3NS8 A;  1C1Y B;  4MT5 A;  4XC2 A;  1FNU A;  5IN7 A;  1SGH A;  2AQ1 B;  2LGS A;  1LFD A;  4MJS A;  1JAL A;  1VZ8 A;  3W1S C;  3VH3 B;  4H2A A;  3DVG Y;  2WXM A;  1QZE A;  1P3Q U;  1KFY B;  2JYE A;  1ZPS A;  1KLG D;  3GB1 A;  4RF0 A;  3WAN A;  2W3R A;  4E74 A;  3Q6B A;  4DWF A;  4XZ4 A;  4ICV A;  3NRZ A;  3RNF C;  3L54 A;  2TSS A;  2ZPN A;  4DBG A;  2KNB A;  5E6J A;  3BVZ A;  3ALB A;  3EUB 2;  3W9C B;  4EE2 A;  3E56 A;  1HZ6 A;  1AN8 A;  1HE8 A;  5G55 A;  3OJ4 B;  2N9L A;  2FIF A;  1GC7 A;  1WX8 A;  4ZDV A;  1MI0 A;  3VDZ A;  2KDM A;  3AEE B;  3LJ3 A;  1EM7 A;  2WP9 B;  3AE9 B;  2WXH A;  4LNN A;  1QKZ A;  4B0M A;  2UWQ A;  3W5V B;  4YTN B;  2XK5 A;  4N6E B;  5C3J B;  4A6Q A;  4BAX A;  4A9A A;  2JSV X;  4EZK A;  2KQS A;  4K7S A;  2ZVN A;  3LXF A;  4FJV B;  5CTR C;  3P63 A;  4WQM A;  3ZDM C;  2WXN A;  1WY8 A;  1V97 A;  3JVZ X;  4W9K A;  3BYT B;  3IAS 1;  2LD9 A;  1LGR A;  1SE3 A;  1RAX A;  2QDF A;  4BKS A;  2V3S A;  2G4S A;  1V81 A;  3AEC B;  4ZHP A;  4DHJ D;  4BBN F;  1KF6 B;  4IWO A;  2L00 B;  3QX1 A;  2JXX A;  1DYQ A;  4RH6 A;  4MAC A;  2KTR B;  1X1M A;  1GG3 A;  3L17 A;  2M0X A;  4HPL B;  4ANV A;  3FKY A;  1SF0 A;  1MVK A;  3T3O A;  2WHI A;  1SIF A;  4USA A;  3WIM A;  1V9J A;  4TV3 A;  4WJO A;  3TSS A;  2Z59 B;  5HKH A;  2M1M A;  3UF8 A;  4EEW A;  4I6L B;  3UQB A;  1IPG A;  1T0S C;  4KX6 B;  3RNB C;  3P4S B;  4IG7 B;  3AEG B;  2ZPY A;  4KIK A;  3V6C B;  5DCN A;  3B9J A;  1HXY D;  1Q1O A;  4FAD A;  2YEP F;  4MM3 B;  3RMK C;  1NYQ A;  4WWP A;  5LNK 1;  3ZJU A;  1OQQ A;  4ZRK A;  2Y5C A;  1KLV A;  4GSW A;  2WU5 B;  3X23 A;  4XDC A;  1TT5 B;  1WRD B;  1YQ4 B;  3KUD B;  3QHT A;  2K3U A;  4MSM B;  3VTV A;  2KAC A;  3TEW A;  3PTF C;  4K3B A;  2PLP A;  3PLU A;  5L83 A;  3BK2 A;  3ZDT A;  2PPH A;  3U4E G;  1VZ7 A;  3MHS D;  1ET6 A;  2KDE B;  4IOI E;  1XLN A;  3KLS X;  2X8X X;  2BB6 A;  2PW9 A;  2BPS A;  3MJW A;  1E8X A;  2RR9 A;  3GP7 A;  3H1U A;  1BT0 A;  1J8C A;  3AU5 A;  4NNJ B;  4HLE A;  3QQ8 B;  3HHM A;  4DHZ E;  4GDL B;  3HUI A;  4C4V A;  4MGI E;  3B2F A;  5LLI A;  2V4L A;  3N32 A;  5MPO A;  1JWM D;  4M02 A;  3CSF A;  4XDD A;  3ZTC A;  2C60 A;  5EE0 A;  2GBR A;  3ZO5 B;  3JSV A;  1VD2 A;  4G11 A;  2HTM E;  5KHQ A;  2WDT B;  1YD8 U;  1WGY A;  2O2V B;  4M0W A;  4A55 A;  2RDB C;  2MWS B;  4IW0 A;  4RNA A;  3B2G A;  1WRI A;  1NVI D;  2JU6 X;  3DPD A;  1FFV A;  3ML8 A;  4WWM A;  3BVG A;  3NVW A;  4QAY A;  2N4F A;  1E7U A;  1L5P A;  4HWI B;  3BZD B;  3EFU A;  1TKG A;  2FNJ B;  2JZ3 B;  1ISN A;  2IO1 B;  2NTT A;  1D5Z C;  2Y3A A;  3N1X C;  1TKY A;  1GUA B;  1IYF A;  1GOZ A;  1KLU D;  5FR6 A;  2BS4 B;  3CST A;  5E6P A;  1MFW A;  2PTL A;  1XLP A;  1DOY A;  1QOB A;  1WJ6 A;  3ZJV A;  2IY1 B;  3AE1 B;  1D4B A;  1OQR A;  3EGR A;  1GB1 A;  3VRA B;  3H7P A;  3OWE B;  3TEX A;  2JQR B;  4ZRJ A;  5T8I A;  1SE9 A;  2JWZ A;  2BWF A;  5BYS A;  1L7Y A;  2NCN A;  2XEW A;  3QAR A;  4W9C A;  4PK1 A;  1WMH B;  1YNT E; 
#chains in the Genus database with same CATH homology
 1C4C A;  1N5X A;  3IXS A;  3IT6 B;  3MC0 B;  1C4A A;  5H92 C;  2FUG 1;  3ETR A;  5BMH A;  4J3O D;  2QMT A;  1FFU A;  4OZA A;  1JCK B;  3V05 A;  2JXT A;  3AH7 A;  4YXD B;  3SFD B;  1TZO A;  2VZK B;  2J53 A;  1PUT A;  4GLS C;  1HQR D;  1Y56 A;  3Q8A A;  3AED B;  2WXF A;  4ZRQ A;  4KKI A;  3SFE B;  2BTE A;  1ZXI A;  1F2R C;  2PVG C;  1D5X C;  3AN1 A;  2N0S B;  4N59 A;  2G1E A;  3IT4 B;  1FCC C;  1BUI C;  2LFI A;  5HHD G;  2PIA A;  2WXP A;  1YN4 A;  4AQ7 A;  1C78 A;  2RDG A;  2WXL A;  4YT0 B;  3FAH A;  2AX5 A;  4WUR A;  3AV8 A;  3ABV B;  2BBC A;  1FRD A;  2L32 A;  2QJL A;  1V1P B;  1I4X A;  2LJI A;  3EA6 A;  2ONQ A;  2ON8 A;  4KGR A;  2K9X A;  1IBX B;  4D2K A;  3VR9 B;  1XCT L;  5BMG A;  3U52 E;  5G5H A;  1XCQ L;  4WIP A;  1NI3 A;  3GS2 A;  3AEB B;  2N9K A;  2M0A A;  2I2Y A;  1CK1 A;  1SSN A;  4TSS A;  3NVV A;  4HKQ A;  2EEL A;  3PO0 A;  2IGG A;  1GPX A;  3ZGZ A;  2SEB D;  1STE A;  4TQ0 A;  1Q10 A;  4CQN A;  1PYW D;  1T3Q A;  1FIQ A;  2W3S A;  5BYQ A;  1SJH D;  2RPV A;  2PMV A;  4O1N A;  1J7C A;  1C79 A;  2V3P A;  2BS2 B;  2CJO A;  4HRO A;  4JWS C;  1JWA D;  1QOF A;  2K0P A;  3MJ5 A;  1VR9 A;  1ZXH A;  4A90 A;  2GI9 A;  1FO4 A;  1JW9 D;  2PKO A;  1P7E A;  1T5X D;  2WXR A;  4WAF A;  3AE2 B;  4C7Y A;  3TEZ A;  1QIL A;  2KN4 A;  3CWI A;  2L83 A;  5D3I B;  3NVY A;  3R2I A;  1BML C;  4KGT A;  1I4H A;  1OFF A;  2V4I B;  3URY A;  1K51 A;  2W55 A;  1E0Z A;  1XF5 L;  4NZL B;  1YN3 A;  5BYR A;  2N7J A;  1I4P A;  1MHX A;  2WXG A;  2YEP B;  2INP E;  1VZ6 A;  2INN E;  1CJE A;  1FXI A;  1VRA B;  1EWC A;  1JQ4 A;  3P4Q B;  4A8X C;  1V1P A;  1TS5 A;  1WGK A;  2I38 A;  1AYF A;  2BT6 A;  3BK1 A;  3AM9 A;  1IBX A;  4JWU C;  4HKZ E;  1ACC A;  2CJN A;  5G5G A;  3I57 A;  3L4P A;  3CIR B;  1RFK A;  1ZE3 D;  4XWT A;  4ARC A;  4LLG M;  4C80 A;  3IAM 1;  2H89 B;  1L0Y B;  3PZ8 A;  1NYR A;  1A70 A;  2KWD A;  1D6E C;  3N9Y C;  1I4R A;  1L6U A;  3SEB A;  1IGD A;  1LO5 D;  2RMM A;  5JXV A;  1F2R I;  1XO3 A;  4LTU A;  1KTK A;  5FR3 A;  1K52 A;  4UDU C;  4JX1 C;  1GAQ B;  1QOG A;  2DYO A;  1XLO A;  1DGJ A;  1B1Z A;  1JML A;  4MT5 A;  1WYG A;  4RGN A;  1FNU A;  1SJE D;  4YSZ B;  1QLB B;  5C2T B;  2D5G A;  2AQ1 B;  2WDV B;  1V8C A;  1JAL A;  1HZ5 A;  1VZ8 A;  3NVZ A;  1PFD A;  3I9V 1;  4H2A A;  3KWV A;  4Q2J A;  2WXM A;  2DBY A;  3GB1 A;  1KFY B;  1EWY C;  1ZPS A;  1KLG D;  2JYE A;  2J42 A;  3NZ3 A;  4RF0 A;  4ZRP A;  2W3R A;  2B76 B;  2SAK A;  4OVZ A;  1L6V A;  3H8H A;  3P42 A;  1TS4 A;  3FC4 A;  3NRZ A;  2WXQ A;  2JWU A;  2Q5W D;  3KWL A;  1TS2 A;  1I4G A;  2OED A;  1XXG A;  1V1O A;  2V0G A;  1HA5 A;  2MJ3 A;  1ET9 A;  3Q8B A;  2TSS A;  2WXJ A;  5HFY A;  1E7P B;  5E6J A;  5FK9 C;  3PZ7 A;  3ZQ4 A;  2K5P A;  3BVZ A;  1JWU D;  4NJC A;  5EE9 A;  2BS3 B;  2WXI A;  4C7Z A;  3EUB 2;  3W9C B;  4EE2 A;  3E56 A;  1HZ6 A;  3Q69 A;  1SBB B;  1AN8 A;  3WCQ A;  2QEJ C;  2N9L A;  2IJ0 A;  1C77 A;  3LYY A;  4C56 C;  4OHJ A;  2MEK A;  2FE8 A;  2LGI A;  1MI0 A;  2W54 A;  1UWM A;  1K50 A;  2KDM A;  2MH7 A;  2DWQ A;  5I4D A;  3AEE B;  1EM7 A;  2WP9 B;  2GRI A;  3AE9 B;  3FIL B;  3Q8F A;  1AW7 A;  2WXH A;  4RFB A;  1RM6 C;  2JX5 A;  3W2D A;  4YSX B;  1QKZ A;  4B0M A;  3MFG A;  3W5V B;  4YTN B;  3R8B A;  1YJI A;  1E9M A;  1TY0 A;  1QQR A;  2H88 B;  3AE6 B;  2RDH A;  4TMA B;  4HRS A;  4N6E B;  4L2Y A;  1ZOY B;  1JRO A;  4B0E A;  5C3J B;  1TY2 A;  4RCO A;  4A6Q A;  2LHE A;  4A9A A;  4NAW B;  4L23 A;  4L1B A;  1R7S A;  1HEZ E;  3O13 A;  4OZC A;  2JSV X;  1DOI A;  2AQ2 B;  1N62 A;  5D3D A;  2BW2 A;  3HVZ A;  3LXF A;  1BXT A;  3P63 A;  3Q8C A;  1SXT A;  3Q8E A;  1SEB D;  4ARI A;  4WQM A;  2WXN A;  3TEY A;  1V97 A;  3NUH B;  1MPE A;  2NTS A;  4OW0 A;  1UUP A;  3BYT B;  2V3N A;  3C8Y A;  4OZB A;  4XWW A;  3IAS 1;  3LB8 C;  1N61 A;  1WWT A;  1SE3 A;  3DWM A;  3P4R B;  3KQ4 A;  1N60 A;  1UNS A;  1T6B X;  1C9F A;  3AEC B;  4ZHP A;  1SB3 C;  2ACZ B;  1N63 A;  2BB5 A;  1KF6 B;  1CQV A;  1WSP A;  1MHH E;  1JWB D;  1VLB A;  3BII D;  4YWG G;  1SE2 A;  1DYQ A;  2HDE A;  3AE8 B;  3MHZ A;  4DXF A;  1YJJ A;  1YN5 A;  4RH6 A;  4MAC A;  1FNW A;  3ZJT A;  1SF0 A;  1UGJ A;  2W82 A;  1MVK A;  3T3O A;  1QF6 A;  1D5M C;  1P7F A;  2WDQ B;  2OHF A;  1ESF A;  2NMQ A;  3P1M A;  4USA A;  2ZW0 A;  4REZ A;  3TSS A;  2WLB A;  1FMA D;  4US8 A;  2CU3 A;  2K22 A;  2LUM A;  4TQ1 A;  4KX6 B;  2QIL A;  1NEN B;  4IKG A;  3P4S B;  1PGA A;  3AE7 B;  3AEG B;  2QSD A;  3U2S C;  2L52 A;  2M19 A;  1SE4 A;  4HJG E;  1M4V A;  4RGO S;  1L4D B;  2Y5P A;  1GB4 A;  3B9J A;  4ZHO A;  2MJD A;  2L1A A;  3UI3 A;  3RFZ B;  1HXY D;  4YTP B;  2J52 A;  2JYT A;  4YTM B;  2YEP F;  4JPS A;  2WQY B;  4MM3 B;  2LEK A;  4PT5 A;  1NYQ A;  1RYJ A;  1FCL A;  5LNK 1;  3ZJU A;  1EU4 A;  1OQQ A;  2IGD A;  4NAM A;  1TKE A;  2Y5C A;  4AS1 A;  1L4Z B;  2WU5 B;  2BYT A;  1N5W A;  2DYM A;  4XDC A;  5HG2 A;  1ENF A;  2IGH A;  1C76 A;  3AE3 B;  1YQ4 B;  2K3U A;  4RGM A;  5FKA C;  1I4Q A;  4GDK B;  5D7G A;  1B9R A;  2KAC A;  3TEW A;  1AWD A;  2PLP A;  4N58 A;  5HI1 A;  1I7H A;  3BVM A;  3BK2 A;  4KKJ A;  2KAJ A;  1PGX A;  2WXO A;  3U4E G;  1VZ7 A;  3R2T A;  1ET6 A;  1VJK A;  3W1S A;  4IOI E;  1RWS A;  1XLN A;  1UWX A;  3KLS X;  1NEK B;  4KGS A;  4P16 A;  1QOA A;  2BB6 A;  2PW9 A;  5TSS A;  4WH4 A;  2XN9 C;  4P6V F;  1J7B A;  1E10 A;  2ZW1 A;  4RGT A;  3VR8 B;  2EKI A;  1PGB A;  3GP7 A;  4ITK A;  1FRR A;  2DLB A;  2AQ3 B;  1JWS D;  3E9S A;  4R3D A;  1SIJ A;  2E3T A;  1CZP A;  2Z8L A;  4GDL B;  1ZP0 B;  3AB5 A;  4JE3 B;  3HUI A;  5AUK A;  3ZYY X;  4MH8 A;  2IDY A;  5EE1 A;  2LHD A;  2WDR B;  3W5U B;  1ZDV A;  3B2F A;  4YSY B;  5GXG B;  3AE4 B;  5MPO A;  3BWU D;  2ICI A;  1JWM D;  3J9C A;  1ZUD 2;  3AE5 B;  5H8Y E;  1IUE A;  2WXK A;  1KH0 A;  1J7A A;  4XDD A;  1L0V B;  5EE3 A;  4RF1 A;  1JRP A;  5EE0 A;  3BYY B;  3P4P B;  1FM0 D;  3HRD D;  1FD6 A;  3HVD A;  2HTM E;  2VZK D;  4DXG A;  3DWG C;  2M56 B;  1KRH A;  1IGC A;  4ZOH C;  4M0W A;  1L0X B;  2FBW B;  4DQO C;  4A55 A;  1FEH A;  1XEE A;  1YQ3 B;  1YMH E;  4HEA 1;  2QIE B;  2JZP A;  3RPF C;  4RNA A;  3B2G A;  2PVO D;  1WRI A;  1NVI D;  2JU6 X;  2WS3 B;  1FFV A;  3AEA B;  4WWM A;  3BVG A;  3MP9 A;  3NVW A;  1VDV A;  4LK0 M;  1TS3 A;  1L5P A;  4ZYS A;  3BZD B;  2E6X A;  5BMI A;  3FIL A;  2XNA C;  1TKG A;  2NTT A;  1D5Z C;  2IPK D;  2Y3A A;  1XLQ A;  2KMM A;  1TKY A;  1PDX A;  3SR6 A;  1GOZ A;  1KLU D;  2BS4 B;  2LMC A;  4XE0 A;  3T3N A;  3AMZ A;  2J4X A;  4FXC A;  2PTL A;  3VRB B;  1TJE A;  2KQ4 X;  1XLP A;  2G9H D;  2MJE A;  5AUI A;  1DOY A;  1EU3 A;  1FNV A;  1FXA A;  1QOB A;  2WNM A;  1WXQ A;  3ZJV A;  3AE1 B;  2X38 A;  1D4B A;  1OQR A;  3AEF B;  2GB1 A;  2WU2 B;  4IDI A;  1F0Z A;  3EGR A;  1DOX A;  1GB1 A;  3VRA B;  1C4P A;  1F77 A;  1ROE A;  2JQR B;  3OWE B;  3TEX A;  1E6E B;  1K53 A;  3U7Z A;  5T8I A;  3V3X A;  1TYG B;  3VQI A;  2R61 A;  1QT9 A;  4US9 A;  5BYS A;  3NS1 A;  3TUO A;  1ZDX A;  1YNT E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...