1J7AA

Structure of the anabaena ferredoxin d68k mutant
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
98
structure length
98
Chain Sequence
ATFKVTLINEAEGTKHEIEVPDDEYILDAAEEQGYDLPFSCRAGACSTCAGKLVSGTVDQSDQSFLDKDQIEAGYVLTCVAYPTSDVVIQTHKEEDLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERREDOXIN I
publication title Structure-function relationships in Anabaena ferredoxin: correlations between X-ray crystal structures, reduction potentials, and rate constants of electron transfer to ferredoxin:NADP+ reductase for site-specific ferredoxin mutants.
pubmed doi rcsb
source organism Nostoc sp. pcc
molecule tags Electron transport
total genus 25
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2001-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1j7aA00
1JWBD 1YQ3B 3NS1A 1FRRA 2WDVB 3AEBB 3AE7B 3AB5A 1GPXA 2B76B 3AEDB 1AYFA 3ETRA 1TYGB 2BT6A 3CWIA 4ZHPA 5H8YE 1GAQB 3AE5B 1NVID 1KFYB 1JQ4A 4P6VF 3AEGB 3VRBB 1QOFA 2CJOA 3W9CB 5EE9A 4N6EB 3AN1A 3B2GA 1XO3A 4YSYB 5AUKA 5G5HA 1JALA 1FO4A 1RWSA 3NVYA 4YT0B 2ACZB 2M19A 5GXGB 3AEAB 1TKYA 2L52A 1N60A 1N62A 2PVOD 3AE2B 3DWMA 2KMMA 2WQYB 2W3RA 2WDQB 4C80A 1E10A 4N58A 2LEKA 3BIID 5AUIA 1J7CA 2EKIA 1TKGA 2MJEA 4IDIA 2MH7A 5C2TB 4US9A 4A9AA 1NEKB 2G1EA 1IUEA 2W3SA 4LTUA 3DWGC 3B9JA 3P63A 1PDXA 5EE1A 3AECB 3VR9B 4KX6B 2K9XA 1WGKA 2JX5A 1FFVA 2CU3A 3P4RB 4YSXB 1SB3C 5MPOA 2H88B 1RFKA 4C7YA 1WYGA 3B2FA 4US8A 1A70A 2PIAA 2W54A 1FXIA 3CIRB 4YSZB 1KRHA 3NVZA 3P1MA 3ABVB 3AEFB 1L6VA 2WP9B 3L4PA 4N59A 2QJLA 1T3QA 1ROEA 3AM9A 2DBYA 1FXAA 1WRIA 4YTPB 1N63A 1SF0A 1WWTA 3P4PB 2OHFA 1WXQA 1FRDA 1YJJA 1TKEA 2BS4B 3AEEB 4JWUC 1NENB 3HUIA 4HRSA 3SR6A 1AWDA 1QT9A 2BS3B 2HTME 1V8CA 5EE0A 1ZP0B 4FXCA 3LXFA 1YQ4B 1FM0D 1E6EB 1JRPA 2FBWB 1CZPA 1QF6A 1NYQA 3VRAB 3AH7A 1XLOA 2WU5B 1FFUA 2WS3B 3NRZA 2L83A 1J7BA 3AE8B 2E3TA 1VDVA 2K5PA 1R7SA 3WCQA 1L0VB 1OQQA 1FMAD 3AE3B 1ZOYB 1VJKA 3AE6B 3AE1B 3SFDB 1E0ZA 1DOIA 1ZXIA 3VR8B 1RM6C 2MJ3A 2M56B 3EUB2 5C3JB 3FAHA 1B9RA 4YXDB 1QOAA 4ZHOA 1F0ZA 1TJEA 3P4SB 1N5XA 1FIQA 2CJNA 3SFEB 2KAJA 1J7AA 2H89B 4C7ZA 4ZOHC 3W5VB 1JW9D 1E9MA 1KF6B 1XLQA 3FC4A 1JROA 3P4QB 5EE3A 1N61A 4HROA 3ZYYX 5G5GA 4JWSC 1ZUD2 2BS2B 1QLBB 1XLPA 2PKOA 1DOXA 3AE9B 3HVZA 1L6UA 2DWQA 1L5PA 2MJDA 1OQRA 2Q5WD 3AE4B 4YTNB 5H92C 3KWLA 2JQRB 2PVGC 2K22A 3NVWA 2WU2B 1E7PB 1VLBA 1PFDA 2QIEB 1OFFA 2N0SB 3PO0A 4WQMA 1SIJA 4USAA 2W55A 3RPFC 1N5WA 3HRDD 1EWYC 1JWAD 1CJEA 2Y5CA 3AMZA 1QOGA 3AV8A 3LB8C 3NVVA 4JX1C 1UWMA 3W5UB 4YTMB 1DOYA 1QOBA 1XLNA 1YJIA 1PUTA 2WLBA 1NI3A 1NYRA 1I7HA 4WWMA 1V97A 4ITKA 1RYJA 2AX5A 2WDRB 1DGJA
chains in the Genus database with same CATH superfamily
2WHIA 3UQBA 1FRRA 4DHJB 3RD2A 2PEAA 5G2NA 2KK8A 4XDCA 2N9EB 3VUWA 1V81A 2QC8A 2PMVA 5H8YE 4BAXA 4BVUC 4HJKA 1VZ6A 2IJ0A 4HCNB 3VH4B 4ANXA 1OQYA 4PK1A 3ZTDA 4ZRKA 1E10A 2KLCA 4P1BC 2INPE 5D7GA 4RCOA 4MEMA 4KGTA 4GU2A 4YSXB 3TEWA 3ML9A 2I1JA 3KH0A 3IG3A 2LWPA 2PJHA 3GP7A 3PRPB 3RMKC 3TEYA 2J7QB 5KHOA 1XF5L 1GB1A 4HRSA 4GLSC 1GUAB 3DHIC 3FILA 2WXPA 2O6VA 2XNAC 3RNAC 4K7UA 2I38A 1FD6A 1WMHB 4PT5A 2ZW0A 2KHWB 1ET6A 4URKA 1ZXIA 4W9IA 2AQ3B 4LDTD 4GXBA 1QOAA 2OOBB 2MP2A 5BYQA 4CYEA 3Q3OC 1UUPA 1LFDA 5AEKB 1C79A 3RNFC 1WXAA 3ZKJC 3PV1A 1MHXA 4MGKE 3ZIMA 3AU5A 1TS4A 2LGIA 3W1SA 3QQ8B 2R61A 2Y5CA 4FADA 3NVVA 4A55A 4BBNF 4AUQC 3M95A 1V97A 1D6EC 1Q0WB 1J19A 2N9LA 3Q8AA 2EMTA 5JZEB 2BT6A 2NVUI 1KH0A 3X0WA 3Q14C 5HI1A 5T8IA 4BBNC 2KX0A 3ZQ4A 4XGAB 1HEZE 3U7ZA 2WGSA 1Q10A 2ACZB 2JWUA 1N60A 4EZLA 2OJRA 1WIAA 3MHSD 4A9AA 3DWGC 2EELA 3AECB 4ANWA 4IM2A 2ASQA 3N20C 4KV2A 3EECA 1WR1A 3ONSA 1E8YA 4M00A 2KFKB 1SJHD 2N7DA 1Z5SB 4E3CA 4DDID 1FCLA 4YTPB 3PPAA 3IVFA 2QCZA 2MW5A 2OHFA 4ARCA 1I4HA 1PYWD 3W2DA 1WZ0A 2KC1A 3TEXA 3KYDD 5AZHA 3ZDTA 1AARA 2KQ7A 1FFUA 2WS3B 2K8BA 3AE3B 1EWCA 3C0RB 4XWTA 4M01A 5DPRA 4YXDB 2KDMA 4LNIA 2Y5BB 3Q2AC 3EGRA 2D3BA 3A9JB 2BPSA 4ZOHC 3PRMB 4IKGA 4HROA 1TZ1A 4DXFA 1KTKA 3B08A 2KC2A 2JXTA 2CU1A 1E7VA 2JQRB 2K25A 5TSSA 4XWWA 2LXCA 4JX1C 2KTRB 3I9V1 1DOYA 2W9NA 1M4VA 1C77A 4BOSC 2DYOA 1PUTA 3PTFC 2KT7A 4B6WA 2Y3AA 1TTNA 4M8NA 1JWBD 4I6PA 3RNEC 2RR9A 2MEKA 2B76B 1AW7A 1ET9A 1TYGB 3DVGX 1WE7A 3QWZB 4DWFA 4B0MA 4FN2A 1M94A 4JPSA 3QC8B 3R7RA 3TMPB 4P16A 4OZBA 1SE2A 5IN7A 3HIZA 2PE6B 4JL9A 1T0RC 3APCA 3MC8A 3QCAA 1K51A 4LLGM 1J7CA 2KWUB 3T8MA 3B9JA 2XN9C 2WXNA 2JT4B 2BB5A 2O6VD 1TBEA 3IAS1 3B2FA 3DOWA 1T0QC 4NNJB 2Z0DB 4TKNA 3MTNB 2GBJA 4IC7B 3MC9A 1WRIA 2N7JA 3P4PB 2LUEA 4GB9A 1QT9A 3AI5A 4XC2A 3KUDB 1I4PA 2WWZA 4L23A 2NTTA 2V1YA 1V9JA 1RM6C 3V05A 1A5RA 3NUHB 2H89B 1HE8A 3DVNU 3D32A 2L32A 4KGSA 1XLPA 4JE3B 3V6EB 4F7ZA 2V3PA 3JSVB 2PVGC 3A1QA 1JMLA 4KZCA 2KQSA 1E7PB 3BWUD 3M3JA 2WXLA 4B95A 1UWMA 1SSNA 1YJIA 1HTQA 2KVRA 1YN4A 3JW0X 1RYJA 2NPTB 3AEBB 2V3NA 3E9SA 3UIPB 4ANUA 2M17A 4IWPA 3H6NA 3E56A 2V3SA 1L4ZB 1IBXB 4RGTA 1IYFA 1CQVA 3RNGC 2WX0A 3O65B 5EE9A 2KFJA 2WX1A 4N6EB 1LGRA 1WM3A 1RFAA 2Y5PA 4WWNA 3TJPA 4AWJA 2J0JA 1C4CA 2SEBD 2QSDA 3P63A 2K9XA 5C23A 2WXOA 4J3OD 4IOIE 4KKJA 3U30A 2L05A 2LHEA 3WAPA 4DDGD 5DPTA 1WRDB 2DHZA 3DBRI 3ABVB 1L6VA 1XD3B 1UD7A 2WNMA 2Z0EB 2RDBC 2MRPA 1SE9A 3AULA 2KO3A 2WXHA 1VD2A 2HTME 4HVBA 1V1PA 3H7SA 2ZNVB 3AH7A 4J6IA 2LXAA 1P7FA 2CHXA 5BO4B 2KDEB 4TV3A 1YNTE 1DOIA 4MGIE 4W9LA 2BB6A 2DZJA 2MJ3A 4RFBA 3RULA 2IY0B 2AQ1B 2BWES 4A3PA 3KYCD 2MBBB 2KD0A 1BXTA 2L00B 4C7ZA 1JW9D 3P4QB 4GDKB 1MG8A 2K8CA 1DOXA 1TY2A 2ZVNA 1SIFA 3AXCA 4DXAB 2KZRA 3OWEB 3ALBA 3AMZA 3AV8A 1Z2MA 2JXXA 2LVOA 4FBJB 1WJ4A 2N4FA 5FK9C 3WAMA 4GDLA 1N6ZA 4RM8A 4LNNA 1JRUA 1XCTL 4W9FA 4K3BA 5DPWA 1QOFA 3NZ3A 4YSYB 3ZRFA 3BY4B 2KLGA 4MM3B 1GNUA 2KKCA 3DWMA 3TUOA 4EKUA 3WALA 3GB1A 4N9F4 3MJWA 1EF1A 1WJ6A 2JX5A 3ZRCA 2TSSA 4HCPB 5MPOA 1RFKA 3GS2A 2FE8A 4B0EA 1RAXA 4HK2A 2K6QA 4W9HA 3ZVVA 4FJVB 1YJ1A 4E71A 3R2TA 2CS4A 3NJTA 3LDZE 4LNFA 4WJQA 3NRZA 3H7PA 2RD0A 3DHGC 1L0YB 2M8SA 3SHQA 2DAJA 4ZHOA 4M0WA 2LD9A 1F77A 2CHWA 1ZW7A 2D07B 2BKFA 3ZYYX 1XQQA 3Q8CA 4KVGB 2AQ2B 4C4VB 1NDDA 5JXVA 4K7SA 1PFDA 3KQ4A 2W55A 2FIFA 1CK1A 3RUIB 1FXTB 4NAWB 1YN3A 5IO9A 4ZYNA 3VUYA 1DGJA 5BMHA 2WXRA 3W1YA 4B9KA 3LJ3A 4EOYA 2I2YA 4FA6A 2D11A 2O2VA 2HD5B 3QIJA 5AUKA 2PW9A 4G11A 1HTOA 1N62A 3ZNZB 4LNOA 4WAAA 1C9FA 4HPMB 3I5JC 1MI0A 1JCKB 2G45B 4WQOB 3IAM1 4KX6B 1FNUA 2EMSA 2WXJA 4G50A 1FFVA 1QQRA 3R3MA 4TSSA 2DZMA 3UINB 4RF1A 2N9KA 3L4PA 4AJYB 1FXAA 4BKGA 3KW5B 2LJ5A 4BKSA 3OLMD 4K1RB 1UWXA 3WANA 4JWUC 2AL3A 1C3TA 3WIMA 4ZRIA 2BS3B 4M02A 1RRBA 1EM7A 1ZP0B 2AL6A 1CZPA 5FR3A 3DPDA 3L16A 3M62B 1J7BA 2CHZA 1ZPSA 1EUVB 5LNK1 2ZJDA 5TR5A 1HXYD 2C7HA 5J18A 2LGSA 3W5VB 1KF6B 1UGMA 2GMIC 3VH3B 1JWSD 1ZKHA 2KJHB 3L0WB 1H4RA 3I57A 1OFFA 4LK0M 4USAA 1D5ZC 3Q3JA 2OEDA 1QKZA 1QOBA 3HHMA 1XXGA 3AE7B 4BKTA 2MA9B 1XCQL 3TBLD 1I35A 1YX6B 3KUZA 4TMAB 4MELA 1NVID 3UIOB 4XDDA 2E6XA 1WM2A 3B2GA 4OVUA 3ZDMC 3ZTCA 5AZGA 2L52A 3LYYA 4C80A 4GMVA 3ZJUA 3EHVA 4LTUA 2FUHB 1HZ6A 2IO3B 1Y8RC 3TL5A 4KIKA 2JU6X 2BYTA 2YLMA 4WJPA 2LRWA 2GI9A 3A4RA 1HQRD 3VTWA 2IO1B 3DBRB 3P42A 4RGMA 2AEHA 1S3SG 1SF0A 3ZNHB 1YJJA 5L83A 2KDFB 4PYUA 1V8CA 1AN8A 2C5LC 1D3ZA 3VRAB 2IGGA 4XYCA 1ZDVA 4GN1A 3VR8B 2M4NA 4A8XC 1TT5B 2EKEC 5D6JB 1J7AA 1GG3A 4NQKE 4KSKC 2SAKA 3SDLC 1WGYA 5EE3A 2BS2B 2AYOB 4F1SA 1OQRA 1V1OA 3ECIA 5IAAC 3J9CA 3BK2A 3U2SC 4REZA 2N0SB 2IO2B 3EFCA 1JWAD 1QOGA 2K0PA 1L7YA 2JZZA 4ZRJA 5D94A 4ICVA 1YD8U 3RT3B 2BBCA 3APDA 1WR6E 2WXGA 2JZ3B 1WF9A 4LDTB 1IP9A 3L10B 2KNBA 3VRBB 2QHOA 2GBMA 4IG7B 2RMMA 4XE0A 5LLIA 2YEPF 2C60A 1F9JA 4BKSD 3K9PB 1TKGA 2INDC 2MH7A 3PVLA 3NS8A 2DX5B 1FNVA 4KDIC 1IPGA 1EU3A 5EE1A 3VR9B 1GOZA 2RPVA 1E8WA 3PRZA 3SD5A 2IZVB 1FCCC 1A70A 1E7UA 3RZFA 4KDLB 2UYZB 3P1MA 3VQIA 2RDGA 3CSTA 4NJ6A 1F2RI 1P0RA 1V2YA 1TGZB 2IO0B 1TKEA 1NENB 3VHTC 4A90A 1C4AA 1VR9A 2XK5A 5EE0A 3V3XA 1V5OA 3BVMA 3LXFA 1OGWA 4MJSA 2NTSA 3V62A 1XEEA 2VRRB 1ZOYB 3H9DA 4LJPB 3H8HA 1N5XA 4WWPA 2WDTB 1UBQA 3Q69A 4DXGA 2L7RA 1JROA 3U8ZA 1WJUA 2PKOA 2D10A 3WA0A 1TS5A 5L95C 4KKIA 2MBOA 2QDFA 3HRDD 5BYRA 2FAZA 5HFYA 3VTUA 3GE3C 1D4BA 2KDIA 4MH8A 4EFOA 1NYRA 1I7HA 2G3QB 2RDHA 2M19A 2AX5A 3SEBA 1WXSA 4RGNA 1GPXA 3NHEB 2RPQA 1LQBA 4IW0A 4G3XB 3ZO5B 4P6VF 2CJOA 3TEZA 2CR5A 5G5HA 4YT0B 3NZSA 3W1SC 2YEPB 5AUIA 2BGFA 1V49A 4NZLB 1IGDA 5BMIA 2I1KA 3PZDA 3P4RB 1D5MC 3PGEA 1UH6A 2DNFA 2BYFA 2KOXA 4LCDE 1KRHA 3AEFB 4P1CC 1FEHA 1FPYA 4AOFA 1OEYJ 2QEJC 2DBYA 2DAFA 2REXA 1C76A 4HXDA 1WMHA 2N1WA 2UWQA 1MVKA 1UGJA 5IA7A 2QMTA 4E74A 1AWDA 5D3IB 3PT2B 2FBWB 1E6EB 1JRPA 1ZGUB 3VUXA 2NR2A 2VH1A 3AE8B 1OQQA 3AE1B 2KN5A 4P7IA 5IOIA 2KWCA 4ZYSA 2MX2A 2JVCA 2KAJA 2O6VB 2ZCCA 3CMMB 4WAFA 3DHHC 3BK1A 1MFWA 5JHAA 1PGXA 4WWOA 1WX7A 2XEWA 5CTRC 3HVZA 1VZ7A 2L76A 2VZKD 2MP2B 4NJ7A 2K22A 3A4SC 1V80A 3GOEA 1WGHA 1SJED 4EZJA 3MHZA 4ITKA 2DYMA 2WDRB 2M0XA 2C7NB 3NS1A 3BVGA 2IGHA 3ZJTA 2D3GA 3QHTA 3IT4B 4W9JA 2LJIA 4A3OA 2KQ4X 5E6NA 4ZHPA 2WXQA 4F8CB 3JVZX 2IYDB 1E5WA 2LI5A 1Q1OA 3NVYA 4NY0A 2PVOD 4MSMB 3HM3A 1VRAB 2KFKA 4HDQA 4JQWC 4ZRPA 5C2TB 3I3TB 2W3SA 1GC6A 2HDEA 1WX9A 1P98A 2NMQA 4O1NA 3RI7C 2G4SA 1SB3C 4II2B 1OEYA 1TY0A 4R3DA 4W9KA 1EF5A 1FXIA 2BYEA 3RFZB 3BYYB 2NBVB 1ROEA 3OJ4B 2WXMA 1ENFA 3UQAA 3UF8A 2QILA 4MGZE 1YOVB 4AS1A 2C7MB 4GSWA 5J17A 3A9JA 4DHJD 1VDVA 1F2RC 2JY6A 3N9YC 1B9RA 1E8ZA 1TJEA 1UF0A 3RNCC 1P9DU 1WYWB 2KTRA 4TQ1A 3V61A 1N61A 2KWVB 2G4DB 1P7EA 1ZUD2 2JSVX 5LXHA 3PS6A 1V86A 1QZEA 3OAWA 3ZUNA 4YTMB 4JGHB 1Y56A 2BWFA 3I63C 3R7QA 2W82A 1LXDA 2N9XA 5CHFA 1YQ3B 1R4NI 2WDVB 1WJNA 2CKHB 3FKYA 4JIOU 3BVZA 3QJZA 1TS2A 2PPHA 2BW2A 4WIPA 3AN1A 3U7DA 1XO3A 1YMHE 1V5TA 1I4XA 4LJOB 2KMCA 4TUUA 3ENEA 2W3RA 2WDQB 1KOTA 1E90A 2YVCA 2R2OA 3PZ8A 1WGGA 2BVCA 1WGKA 1WGDA 4ACFA 4GIVA 3PSEB 3A33B 5HKHA 3ML8A 2KJ6A 4M8MA 3NG0A 2D3CA 4NQLB 4OW0A 1VZ8A 3SR6A 4FLHA 1YN5A 4MT5A 1P3QU 1FM0D 2JUOA 2LVPA 2MQJA 3M63B 3Q3MC 3QARA 3OG5A 1IGCA 2K5PA 1L0VB 1FMAD 1SBBB 5IKCM 1SXTA 2M56B 2ZW1A 5C3JB 3JSVA 2CJNA 5E6OA 3L08A 2K3UA 5D2MB 4NJCA 3Q3FA 4KGRA 2J4XA 2NS5A 4L1BA 3ZJVA 4Q2JA 4EZKA 4YTNB 3K9OB 2INCC 2FCMA 3IT6B 2NPTA 4YWGG 3GE8C 2HJ1A 2IY1B 1JWMD 1UELA 2JRIB 2MSED 3L17A 1KLUD 1IBXA 3VFKA 3T3NA 3A1QB 2LVQA 3DVGY 2VH2A 1C1YB 1MJDA 3AEDB 4YL8A 1OTRB 3KUCB 1BUIC 3UGBB 3U4EG 4HKQA 3AE5B 3ZXVA 3AEGB 3ZW3A 4G0NB 1JALA 3IHPC 1RWSA 2N7EA 4UDUC 5IP4D 3AEAB 1T0SC 4NPNA 3DDCB 2DZKA 4K3CA 2DENB 2HJ8A 2EKIA 3ZXRA 1D5XC 3BINA 2G1EA 2KTFA 1PDXA 3CSFA 1WE6A 5E6JA 2UU7A 3CIRB 4K81A 4OZCA 3EA6A 4IWQA 1T3QA 1VCBA 2GBRA 3MC0B 1N63A 2KDBA 5E6PA 2JWZA 2ZCBA 1I4RA 2N9PC 3VTVA 2FUG1 2L3ZA 2ZPNA 4HJGE 4FXCA 1NYQA 1C78A 1K8RB 5FR6A 2DZIA 1R7SA 3N1ZC 4GDKA 1R4MI 2FIDA 3Q6BA 4S0RA 1E8XA 4WJNA 1JWUD 3C19A 4WURA 4OHJA 1ISNA 1V1PB 3T9LA 1YIWA 4JWSC 1WFYA 3AE9B 1L5PA 4RF0A 3Q8FA 4C56C 3QA8A 2JF5A 4CQNA 1N5WA 2ONQA 3BYTB 4RNAA 2V0GA 2C9WB 2LHDA 5D3DA 2KXJA 2IBIB 1H8CA 1K53A 3EC8A 4RGOS 1HA5A 3PLVA 3AB5A 4MM3A 4CO7A 2NCNA 3ETRA 1WI0A 4AQ7A 3CWIA 1I4QA 3VXWA 2J0KA 3N1XC 2X8XX 3RNBC 4GDLB 1FO4A 3IBEA 4MDKE 2KMMA 1T0YA 2WQYB 3DQVA 4N58A 2LEKA 3BIID 2IDYA 1KLVA 2G9HD 3L54A 3O13A 2WYQA 2MBQA 3PLUA 2HTHA 3IFWB 4XX5A 4KZ0A 5HG2A 2KJRA 3GZNB 4D2KA 2FCQA 4HLEA 4US8A 3VAWA 5BYSA 4I6LB 1YQBA 2WP9B 4PS8A 4WJOA 3A9KB 3R2IA 2GLSA 1EO6A 1RLFA 1UBIA 1GC7A 2V4LA 5EDSA 4NAMA 4HPLB 1LM8B 1CMXB 4S17A 4II3B 4HWIB 3Q8BA 3MJ5A 1WZ3A 2L83A 3WCQA 2L1AA 4IM3A 4RM9A 3AE6B 3CF6E 4C4VA 2Z8LA 1T6BX 4KSLC 2MWSB 1F0ZA 1ACCA 3IXSA 1FIQA 5FKAC 2ZVOA 1V6EA 4A20A 4MACA 3JYUA 4OVVA 3H7PB 1XLQA 3FC4A 3N3KB 2DYBA 4NAWA 4HDOA 1WX8A 3AE4B 3AU4A 2X38A 3KWLA 4M0WB 2WU2B 2QIEB 1GJZA 4CHKA 4AJWA 5CHWA 2RGFA 1F1HA 3DBHB 2JPHA 1XLNA 2WLBA 4XZ4A 1NI3A 2M0AA 4WWMA 2LRUA 3VDZA 3BZDB 2J52A 3MP9A 4FJZA 1R4NB 3NZUA 1EU4A 1SE3A 1ZDXA 3DBLB 3ZGZA 2NBWB 1GAQB 2BYVE 3PREA 2FCSA 2FNJB 1WY8A 4PYZA 2LMCA 2LZ6A 1TKYA 1T5XD 4MSQB 2PE9A 3AE2B 3T3OA 3QX1A 2GB1A 2KMAA 2MJEA 2O2VB 2JRHA 4DBGA 1NEKB 3HM6X 3RCZA 3H1UA 4W9EA 2PIAA 5JH5C 3C8YA 4DHZB 4ASWC 2LGXA 2KANA 4N59A 1U4AA 2BTEA 2A4ZA 2KACA 3AM9A 2ZNVC 1WWTA 1ZE3D 2MBEA 1WXQA 1FRDA 2ZZPB 1X1MA 4RH6A 1TZOA 4GGQA 1YQ4B 3QAQA 2WU5B 3VVWB 4HEA1 2FCNA 1VJKA 1E0ZA 1KLGD 2PLPA 2J42A 3P4SB 4IM0A 3KVFB 2MLBA 4W9CA 1E9MA 2GRIA 2JZPA 3R66C 2ZPYA 3HVDA 3RN9C 3OJ3A 1ZXHA 5H92C 1PQSA 3NY5A 1VLBA 1Q5WB 4AP4C 3LB8C 2MHJA 3N30A 2J53A 3PZ7A 3SU8X 4BOZB 3ZNID 4ZRQA 3FILB 1BMLC 1TS3A 2LUMA 1WXMA 3RYTA 3UI3A 4DQOC 3P2BA 1DYQA 3V60A 1AYFA 4ICUA 2D2QA 3HK0A 2JYEA 1JQ4A 3TIXA 3W9CB 3DCGA 1MPEA 5LXIB 1BT0A 2WXIA 1I42A 2A5UA 4JLCA 2IPKD 4HKZE 1LO5D 2DLBA 2M1MA 4BFRA 4BZAA 5BMGA 2MCNB 3RZWC 3URYA 4EEWA 4GOCA 4IDIA 4US9A 2KYWA 1UZXB 2LGYA 3PHWB 2Z59B 3NOBA 4HPPA 2K8HA 1K50A 1WH3A 2L0TA 4K7WA 3QK0A 2IGDA 2J0MA 4YSZB 3NVZA 3TCAA 2MBHA 1B1ZA 2QJLA 4OVZA 2XBBC 1WGRA 2LFIA 2INNE 3AEEB 4KIKB 4EUTA 2BKRB 3HUIA 3WAOA 3KLSX 3TSSA 4FHJA 4MGYE 1QF6A 1L2NA 3GZNI 2K39A 1MG4A 2ZEQA 3SFDB 4W9GA 4C00A 2B3AA 3DVNV 1R4MB 2PTLA 1UNSA 3EUB2 1XT9B 2JYTA 3SFEB 1WSPA 2GOWA 1NBFC 2L0FA 1SEBD 4FHKA 2LASA 5CHVC 5G5GA 4H2AA 1QLBB 4TQ0A 4QAYA 4I6NB 5G55A 1J0GA 2DWQA 2WXKA 4EE2A 4FJYA 3R8BA 3NVWA 1MHHE 3PO0A 5GMVA 4WQMA 1PGAA 3RPFC 1C4PA 1CJEA 4RMAA 3W5UB 4DHZE 4A6QA 5CX3A 4DK5A 3KWVA 2N1VA 3V6CB 2AWTA 3A9KA 4OZAA 2GBKA 3Q8EA 2V9HA 5AZFA 4PS3A 5J2RA 5C1ZA 3EFUA 4IWOA 3U52E 1KFYB 2WXFA 1SGHA 1J8CA 3DBHI 2R2QA 4MH0E 5GXGB 3X23A 1F52A 1I4GA 3Q3NC 1L4DB 3B1LX 3ZLZA 2VZKB 3L13A 2L8JA 1S1QB 3MFGA 3N32A 1QILA 1IUEA 1WXVA 2KVZA 3DBLI 4IUMB 2CU3A 3N1YC 2ICIA 2H88B 2K6DB 2KX3A 1NI2A 4L2YA 1WYGA 4C7YA 2W54A 3DBSA 1KJTA 3S2AA 2BQQA 2ON8A 1ESFA 1HZ5A 4X57B 4LNKA 1P1AA 1KM7A 2BS4B 3ZNGC 1YX5B 2V4IB 3B0AA 1SE4A 1GB4A 1L0XB 1K52A 1TIFA 2HE7A 4ZDVA 1G6JA 1XLOA 2NBUA 2OJWA 5HHDG 2BF8B 2E3TA 2KN4A 1PGBA 3PHXB 1STEA 2D3AA 2KWDA 3FAHA 2XK5B 2LGDA 4PS7A 2GBNA 4MJSB 5KHQA 4ARIA 1FNWA 2K1FA 4W9DA 4ANVA 5DPSA 1L6UA 2MJDA 4WH4A 5JHBA 2Q5WD 5DCNA 1SIJA 4FULA 1EWYC 2RSUA 3APFA 5I4DA 2D5GA
chains in the Genus database with same CATH topology
1FRRA 1K53A 4RGOS 5FK9C 1HA5A 4XDCA 3SEBA 3AB5A 4RGNA 1GPXA 3ETRA 2PMVA 4AQ7A 3CWIA 1XCTL 5H8YE 1I4QA 4P6VF 1QOFA 2CJOA 3TEZA 3NZ3A 1VZ6A 2IJ0A 4YSYB 5G5HA 1FO4A 4GDLB 4YT0B 4MM3B 3DWMA 3TUOA 2KMMA 2WQYB 2YEPB 1E10A 4N58A 2LEKA 3BIID 5AUIA 3GB1A 2IDYA 2INPE 4NZLB 2G9HD 1IGDA 3O13A 5D7GA 5BMIA 4RCOA 4KGTA 2JX5A 2TSSA 3P4RB 4YSXB 5MPOA 5HG2A 1RFKA 4D2KA 1D5MC 3GS2A 3TEWA 4US8A 5BYSA 2FE8A 4B0EA 1KRHA 3AEFB 2WP9B 1FEHA 3R2IA 2QEJC 2DBYA 1C76A 3GP7A 3TEYA 1XF5L 1MVKA 4NAMA 1UGJA 1GB1A 2QMTA 4HRSA 1AWDA 4GLSC 5D3IB 3FILA 3R2TA 2WXPA 2FBWB 1E6EB 1JRPA 2XNAC 3U2SC 2I38A 1FD6A 3Q8BA 3MJ5A 3NRZA 2L83A 3AE8B 3WCQA 4PT5A 1OQQA 2L1AA 2ZW0A 3AE6B 1ET6A 1L0YB 3AE1B 1ZXIA 2AQ3B 1T6BX 2Z8LA 1F0ZA 4ZYSA 1ACCA 1QOAA 4ZHOA 3IXSA 1FIQA 4M0WA 5FKAC 2KAJA 5BYQA 1F77A 4WAFA 1UUPA 4MACA 3BK1A 1C79A 1XLQA 3FC4A 3ZYYX 3Q8CA 1PGXA 1MHXA 2AQ2B 3HVZA 5JXVA 3AE4B 1VZ7A 2X38A 2VZKD 3KWLA 1TS4A 2K22A 2WU2B 2LGIA 2QIEB 1PFDA 3W1SA 3KQ4A 2R61A 2W55A 2Y5CA 3NVVA 1CK1A 1SJED 1XLNA 4NAWB 1YN3A 2WLBA 4A55A 1NI3A 2M0AA 4WWMA 1V97A 3MHZA 4ITKA 2DYMA 1D6EC 2WDRB 3BZDB 1DGJA 3NS1A 3BVGA 2J52A 5BMHA 2IGHA 2WXRA 3MP9A 2N9LA 3Q8AA 3ZJTA 2I2YA 3IT4B 2LJIA 2BT6A 1EU4A 1KH0A 1SE3A 2KQ4X 1ZDXA 3ZGZA 5HI1A 4ZHPA 5T8IA 1GAQB 2WXQA 3ZQ4A 5AUKA 1HEZE 2PW9A 3U7ZA 1Q10A 3NVYA 2ACZB 2LMCA 1TKYA 2JWUA 1T5XD 1N60A 1N62A 2PVOD 3AE2B 3T3OA 1C9FA 2GB1A 1MI0A 1VRAB 2MJEA 4A9AA 4ZRPA 5C2TB 1NEKB 2W3SA 3DWGC 1JCKB 2HDEA 2EELA 3AECB 2NMQA 3IAM1 4KX6B 1FNUA 2WXJA 4O1NA 1FFVA 1QQRA 1SB3C 4TSSA 1TY0A 4R3DA 2PIAA 4RF1A 1FXIA 3C8YA 1SJHD 3RFZB 2N9KA 3L4PA 4N59A 2BTEA 3BYYB 1ROEA 2KACA 3AM9A 1FCLA 1FXAA 4YTPB 1WWTA 2WXMA 1ZE3D 2OHFA 1WXQA 1FRDA 1ENFA 4RH6A 4ARCA 1UWXA 1I4HA 1PYWD 4JWUC 2QILA 3W2DA 1TZOA 2BS3B 3TEXA 1EM7A 1ZP0B 1YQ4B 4AS1A 1CZPA 5FR3A 2WU5B 1FFUA 2WS3B 1J7BA 4HEA1 1VDVA 1F2RC 1ZPSA 3AE3B 1VJKA 1E0ZA 1KLGD 5LNK1 2PLPA 1EWCA 3N9YC 4XWTA 1B9RA 4YXDB 2J42A 2KDMA 1TJEA 3P4SB 1HXYD 3EGRA 4ZOHC 3W5VB 1E9MA 1KF6B 4IKGA 4TQ1A 1N61A 4HROA 1P7EA 1ZUD2 2GRIA 1KTKA 4DXFA 2JSVX 2JZPA 3HVDA 1JWSD 1ZXHA 2JXTA 5H92C 5TSSA 2JQRB 3I57A 4XWWA 1VLBA 1OFFA 4LK0M 4USAA 1D5ZC 4JX1C 2OEDA 3LB8C 3I9V1 3PZ7A 2J53A 4YTMB 1DOYA 1M4VA 1QKZA 1C77A 1QOBA 1Y56A 2DYOA 1PUTA 4ZRQA 3FILB 2W82A 1BMLC 1TS3A 2LUMA 2Y3AA 1JWBD 1YQ3B 2WDVB 3UI3A 1XXGA 4DQOC 1DYQA 3AE7B 2MEKA 2B76B 1AW7A 1AYFA 1ET9A 3BVZA 1XCQL 1TYGB 1TS2A 4B0MA 4TMAB 4JPSA 1NVID 2BW2A 4WIPA 2JYEA 1JQ4A 3W9CB 4XDDA 2E6XA 3AN1A 3B2GA 1XO3A 4P16A 1MPEA 1YMHE 4OZBA 1SE2A 2WXIA 1I4XA 2IPKD 4HKZE 1LO5D 2L52A 2DLBA 3LYYA 5BMGA 3URYA 4C80A 2W3RA 2WDQB 1K51A 4LLGM 1J7CA 4IDIA 4US9A 3ZJUA 4LTUA 3B9JA 3PZ8A 2XN9C 2WXNA 1HZ6A 1WGKA 2BB5A 1K50A 2JU6X 3IAS1 2BYTA 3B2FA 2IGDA 4YSZB 2GI9A 3NVZA 1HQRD 1B1ZA 2QJLA 3P42A 4OVZA 4RGMA 1WRIA 1SF0A 2N7JA 2LFIA 3P4PB 1YJJA 2INNE 3AEEB 4OW0A 1VZ8A 3HUIA 3SR6A 1QT9A 1V8CA 1YN5A 3KLSX 3TSSA 4MT5A 1AN8A 1FM0D 1I4PA 1QF6A 3VRAB 4L23A 2NTTA 1IGCA 2K5PA 1L0VB 2IGGA 1FMAD 3SFDB 1ZDVA 1SBBB 3VR8B 1SXTA 1RM6C 2PTLA 4A8XC 2M56B 1UNSA 2ZW1A 3EUB2 3V05A 2JYTA 5C3JB 3SFEB 2CJNA 3NUHB 2K3UA 1J7AA 1WSPA 2H89B 4NJCA 2SAKA 4KGRA 2J4XA 1SEBD 4L1BA 5EE3A 2L32A 5G5GA 4H2AA 2BS2B 3ZJVA 4KGSA 1QLBB 4Q2JA 4TQ0A 1XLPA 4JE3B 2DWQA 1OQRA 1V1OA 2V3PA 2WXKA 4EE2A 4YTNB 3J9CA 2PVGC 3IT6B 3R8BA 1JMLA 3BK2A 3NVWA 1E7PB 1MHHE 3PO0A 4REZA 4YWGG 3BWUD 2N0SB 4WQMA 1PGAA 3RPFC 1C4PA 1JWMD 1JWAD 1CJEA 1QOGA 2WXLA 3W5UB 1UWMA 2K0PA 1SSNA 1YJIA 1KLUD 1IBXA 1YN4A 4A6QA 1RYJA 3T3NA 2BBCA 3KWVA 3AEBB 2V3NA 3E9SA 4OZAA 2WXGA 3AEDB 3Q8EA 1BUIC 3E56A 1L4ZB 3U4EG 4HKQA 3U52E 3AE5B 4RGTA 1IBXB 1KFYB 1CQVA 2WXFA 3AEGB 3VRBB 5EE9A 4N6EB 1JALA 1RWSA 4UDUC 2M19A 2Y5PA 5GXGB 3AEAB 1I4GA 1L4DB 2RMMA 4XE0A 2YEPF 2VZKB 2EKIA 1TKGA 3MFGA 2MH7A 1C4CA 1D5XC 1QILA 2SEBD 1FNVA 2G1EA 1IUEA 2QSDA 1EU3A 3P63A 1PDXA 5EE1A 3VR9B 1GOZA 2K9XA 2RPVA 2WXOA 4J3OD 2CU3A 4IOIE 2ICIA 4KKJA 2H88B 4L2YA 1WYGA 4C7YA 2LHEA 1FCCC 1A70A 2W54A 5E6JA 3CIRB 2ON8A 3P1MA 3VQIA 3ABVB 1L6VA 2RDGA 4OZCA 1ESFA 1HZ5A 3EA6A 1T3QA 1F2RI 2WNMA 3MC0B 1N63A 1I4RA 1TKEA 2BS4B 1NENB 2V4IB 2WXHA 1SE4A 2HTME 2FUG1 1C4AA 1VR9A 5EE0A 4A90A 1GB4A 4HJGE 4FXCA 1L0XB 3BVMA 3LXFA 3V3XA 1K52A 1V1PA 1NYQA 1C78A 3AH7A 2NTSA 1XLOA 1P7FA 5HHDG 1XEEA 2E3TA 1R7SA 2KN4A 1ZOYB 1PGBA 1YNTE 1DOIA 1STEA 2KWDA 1JWUD 2BB6A 2MJ3A 3FAHA 4WURA 4RFBA 4OHJA 3H8HA 1N5XA 2AQ1B 1V1PB 3Q69A 1BXTA 4C7ZA 4ARIA 1FNWA 4DXGA 1JW9D 3P4QB 1JROA 4GDKB 4JWSC 2PKOA 1DOXA 1TY2A 3AE9B 1L6UA 2MJDA 1L5PA 4RF0A 2Q5WD 4WH4A 1TS5A 3Q8FA 4KKIA 4C56C 3OWEB 1SIJA 4CQNA 1N5WA 3HRDD 1EWYC 5BYRA 3AMZA 5HFYA 3AV8A 2ONQA 1D4BA 3BYTB 4RNAA 5I4DA 4MH8A 2V0GA 1NYRA 1I7HA 2D5GA 2LHDA 2RDHA 5D3DA 2AX5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JWB D;  1YQ3 B;  3NS1 A;  1FRR A;  2WDV B;  3AEB B;  3AE7 B;  3AB5 A;  1GPX A;  2B76 B;  3AED B;  1AYF A;  3ETR A;  1TYG B;  2BT6 A;  3CWI A;  4ZHP A;  5H8Y E;  1GAQ B;  3AE5 B;  1NVI D;  1KFY B;  1JQ4 A;  4P6V F;  3AEG B;  3VRB B;  1QOF A;  2CJO A;  3W9C B;  5EE9 A;  4N6E B;  3AN1 A;  3B2G A;  1XO3 A;  4YSY B;  5AUK A;  5G5H A;  1JAL A;  1FO4 A;  1RWS A;  3NVY A;  4YT0 B;  2ACZ B;  2M19 A;  5GXG B;  3AEA B;  1TKY A;  2L52 A;  1N60 A;  1N62 A;  2PVO D;  3AE2 B;  3DWM A;  2KMM A;  2WQY B;  2W3R A;  2WDQ B;  4C80 A;  1E10 A;  4N58 A;  2LEK A;  3BII D;  5AUI A;  1J7C A;  2EKI A;  1TKG A;  2MJE A;  4IDI A;  2MH7 A;  5C2T B;  4US9 A;  4A9A A;  1NEK B;  2G1E A;  1IUE A;  2W3S A;  4LTU A;  3DWG C;  3B9J A;  3P63 A;  1PDX A;  5EE1 A;  3AEC B;  3VR9 B;  4KX6 B;  2K9X A;  1WGK A;  2JX5 A;  1FFV A;  2CU3 A;  3P4R B;  4YSX B;  1SB3 C;  5MPO A;  2H88 B;  1RFK A;  4C7Y A;  1WYG A;  3B2F A;  4US8 A;  1A70 A;  2PIA A;  2W54 A;  1FXI A;  3CIR B;  4YSZ B;  1KRH A;  3NVZ A;  3P1M A;  3ABV B;  3AEF B;  1L6V A;  2WP9 B;  3L4P A;  4N59 A;  2QJL A;  1T3Q A;  1ROE A;  3AM9 A;  2DBY A;  1FXA A;  1WRI A;  4YTP B;  1N63 A;  1SF0 A;  1WWT A;  3P4P B;  2OHF A;  1WXQ A;  1FRD A;  1YJJ A;  1TKE A;  2BS4 B;  3AEE B;  4JWU C;  1NEN B;  3HUI A;  4HRS A;  3SR6 A;  1AWD A;  1QT9 A;  2BS3 B;  2HTM E;  1V8C A;  5EE0 A;  1ZP0 B;  4FXC A;  3LXF A;  1YQ4 B;  1FM0 D;  1E6E B;  1JRP A;  2FBW B;  1CZP A;  1QF6 A;  1NYQ A;  3VRA B;  3AH7 A;  1XLO A;  2WU5 B;  1FFU A;  2WS3 B;  3NRZ A;  2L83 A;  1J7B A;  3AE8 B;  2E3T A;  1VDV A;  2K5P A;  1R7S A;  3WCQ A;  1L0V B;  1OQQ A;  1FMA D;  3AE3 B;  1ZOY B;  1VJK A;  3AE6 B;  3AE1 B;  3SFD B;  1E0Z A;  1DOI A;  1ZXI A;  3VR8 B;  1RM6 C;  2MJ3 A;  2M56 B;  3EUB 2;  5C3J B;  3FAH A;  1B9R A;  4YXD B;  1QOA A;  4ZHO A;  1F0Z A;  1TJE A;  3P4S B;  1N5X A;  1FIQ A;  2CJN A;  3SFE B;  2KAJ A;  1J7A A;  2H89 B;  4C7Z A;  4ZOH C;  3W5V B;  1JW9 D;  1E9M A;  1KF6 B;  1XLQ A;  3FC4 A;  1JRO A;  3P4Q B;  5EE3 A;  1N61 A;  4HRO A;  3ZYY X;  5G5G A;  4JWS C;  1ZUD 2;  2BS2 B;  1QLB B;  1XLP A;  2PKO A;  1DOX A;  3AE9 B;  3HVZ A;  1L6U A;  2DWQ A;  1L5P A;  2MJD A;  1OQR A;  2Q5W D;  3AE4 B;  4YTN B;  5H92 C;  3KWL A;  2JQR B;  2PVG C;  2K22 A;  3NVW A;  2WU2 B;  1E7P B;  1VLB A;  1PFD A;  2QIE B;  1OFF A;  2N0S B;  3PO0 A;  4WQM A;  1SIJ A;  4USA A;  2W55 A;  3RPF C;  1N5W A;  3HRD D;  1EWY C;  1JWA D;  1CJE A;  2Y5C A;  3AMZ A;  1QOG A;  3AV8 A;  3LB8 C;  3NVV A;  4JX1 C;  1UWM A;  3W5U B;  4YTM B;  1DOY A;  1QOB A;  1XLN A;  1YJI A;  1PUT A;  2WLB A;  1NI3 A;  1NYR A;  1I7H A;  4WWM A;  1V97 A;  4ITK A;  1RYJ A;  2AX5 A;  2WDR B;  1DGJ A; 
#chains in the Genus database with same CATH topology
 2WHI A;  3UQB A;  1FRR A;  4DHJ B;  3RD2 A;  2PEA A;  5G2N A;  2KK8 A;  4XDC A;  2N9E B;  3VUW A;  1V81 A;  2QC8 A;  2PMV A;  5H8Y E;  4BAX A;  4BVU C;  4HJK A;  1VZ6 A;  2IJ0 A;  4HCN B;  3VH4 B;  4ANX A;  1OQY A;  4PK1 A;  3ZTD A;  4ZRK A;  1E10 A;  2KLC A;  4P1B C;  2INP E;  5D7G A;  4RCO A;  4MEM A;  4KGT A;  4GU2 A;  4YSX B;  3TEW A;  3ML9 A;  2I1J A;  3KH0 A;  3IG3 A;  2LWP A;  2PJH A;  3GP7 A;  3PRP B;  3RMK C;  3TEY A;  2J7Q B;  5KHO A;  1XF5 L;  1GB1 A;  4HRS A;  4GLS C;  1GUA B;  3DHI C;  3FIL A;  2WXP A;  2O6V A;  2XNA C;  3RNA C;  4K7U A;  2I38 A;  1FD6 A;  1WMH B;  4PT5 A;  2ZW0 A;  2KHW B;  1ET6 A;  4URK A;  1ZXI A;  4W9I A;  2AQ3 B;  4LDT D;  4GXB A;  1QOA A;  2OOB B;  2MP2 A;  5BYQ A;  4CYE A;  3Q3O C;  1UUP A;  1LFD A;  5AEK B;  1C79 A;  3RNF C;  1WXA A;  3ZKJ C;  3PV1 A;  1MHX A;  4MGK E;  3ZIM A;  3AU5 A;  1TS4 A;  2LGI A;  3W1S A;  3QQ8 B;  2R61 A;  2Y5C A;  4FAD A;  3NVV A;  4A55 A;  4BBN F;  4AUQ C;  3M95 A;  1V97 A;  1D6E C;  1Q0W B;  1J19 A;  2N9L A;  3Q8A A;  2EMT A;  5JZE B;  2BT6 A;  2NVU I;  1KH0 A;  3X0W A;  3Q14 C;  5HI1 A;  5T8I A;  4BBN C;  2KX0 A;  3ZQ4 A;  4XGA B;  1HEZ E;  3U7Z A;  2WGS A;  1Q10 A;  2ACZ B;  2JWU A;  1N60 A;  4EZL A;  2OJR A;  1WIA A;  3MHS D;  4A9A A;  3DWG C;  2EEL A;  3AEC B;  4ANW A;  4IM2 A;  2ASQ A;  3N20 C;  4KV2 A;  3EEC A;  1WR1 A;  3ONS A;  1E8Y A;  4M00 A;  2KFK B;  1SJH D;  2N7D A;  1Z5S B;  4E3C A;  4DDI D;  1FCL A;  4YTP B;  3PPA A;  3IVF A;  2QCZ A;  2MW5 A;  2OHF A;  4ARC A;  1I4H A;  1PYW D;  3W2D A;  1WZ0 A;  2KC1 A;  3TEX A;  3KYD D;  5AZH A;  3ZDT A;  1AAR A;  2KQ7 A;  1FFU A;  2WS3 B;  2K8B A;  3AE3 B;  1EWC A;  3C0R B;  4XWT A;  4M01 A;  5DPR A;  4YXD B;  2KDM A;  4LNI A;  2Y5B B;  3Q2A C;  3EGR A;  2D3B A;  3A9J B;  2BPS A;  4ZOH C;  3PRM B;  4IKG A;  4HRO A;  1TZ1 A;  4DXF A;  1KTK A;  3B08 A;  2KC2 A;  2JXT A;  2CU1 A;  1E7V A;  2JQR B;  2K25 A;  5TSS A;  4XWW A;  2LXC A;  4JX1 C;  2KTR B;  3I9V 1;  1DOY A;  2W9N A;  1M4V A;  1C77 A;  4BOS C;  2DYO A;  1PUT A;  3PTF C;  2KT7 A;  4B6W A;  2Y3A A;  1TTN A;  4M8N A;  1JWB D;  4I6P A;  3RNE C;  2RR9 A;  2MEK A;  2B76 B;  1AW7 A;  1ET9 A;  1TYG B;  3DVG X;  1WE7 A;  3QWZ B;  4DWF A;  4B0M A;  4FN2 A;  1M94 A;  4JPS A;  3QC8 B;  3R7R A;  3TMP B;  4P16 A;  4OZB A;  1SE2 A;  5IN7 A;  3HIZ A;  2PE6 B;  4JL9 A;  1T0R C;  3APC A;  3MC8 A;  3QCA A;  1K51 A;  4LLG M;  1J7C A;  2KWU B;  3T8M A;  3B9J A;  2XN9 C;  2WXN A;  2JT4 B;  2BB5 A;  2O6V D;  1TBE A;  3IAS 1;  3B2F A;  3DOW A;  1T0Q C;  4NNJ B;  2Z0D B;  4TKN A;  3MTN B;  2GBJ A;  4IC7 B;  3MC9 A;  1WRI A;  2N7J A;  3P4P B;  2LUE A;  4GB9 A;  1QT9 A;  3AI5 A;  4XC2 A;  3KUD B;  1I4P A;  2WWZ A;  4L23 A;  2NTT A;  2V1Y A;  1V9J A;  1RM6 C;  3V05 A;  1A5R A;  3NUH B;  2H89 B;  1HE8 A;  3DVN U;  3D32 A;  2L32 A;  4KGS A;  1XLP A;  4JE3 B;  3V6E B;  4F7Z A;  2V3P A;  3JSV B;  2PVG C;  3A1Q A;  1JML A;  4KZC A;  2KQS A;  1E7P B;  3BWU D;  3M3J A;  2WXL A;  4B95 A;  1UWM A;  1SSN A;  1YJI A;  1HTQ A;  2KVR A;  1YN4 A;  3JW0 X;  1RYJ A;  2NPT B;  3AEB B;  2V3N A;  3E9S A;  3UIP B;  4ANU A;  2M17 A;  4IWP A;  3H6N A;  3E56 A;  2V3S A;  1L4Z B;  1IBX B;  4RGT A;  1IYF A;  1CQV A;  3RNG C;  2WX0 A;  3O65 B;  5EE9 A;  2KFJ A;  2WX1 A;  4N6E B;  1LGR A;  1WM3 A;  1RFA A;  2Y5P A;  4WWN A;  3TJP A;  4AWJ A;  2J0J A;  1C4C A;  2SEB D;  2QSD A;  3P63 A;  2K9X A;  5C23 A;  2WXO A;  4J3O D;  4IOI E;  4KKJ A;  3U30 A;  2L05 A;  2LHE A;  3WAP A;  4DDG D;  5DPT A;  1WRD B;  2DHZ A;  3DBR I;  3ABV B;  1L6V A;  1XD3 B;  1UD7 A;  2WNM A;  2Z0E B;  2RDB C;  2MRP A;  1SE9 A;  3AUL A;  2KO3 A;  2WXH A;  1VD2 A;  2HTM E;  4HVB A;  1V1P A;  3H7S A;  2ZNV B;  3AH7 A;  4J6I A;  2LXA A;  1P7F A;  2CHX A;  5BO4 B;  2KDE B;  4TV3 A;  1YNT E;  1DOI A;  4MGI E;  4W9L A;  2BB6 A;  2DZJ A;  2MJ3 A;  4RFB A;  3RUL A;  2IY0 B;  2AQ1 B;  2BWE S;  4A3P A;  3KYC D;  2MBB B;  2KD0 A;  1BXT A;  2L00 B;  4C7Z A;  1JW9 D;  3P4Q B;  4GDK B;  1MG8 A;  2K8C A;  1DOX A;  1TY2 A;  2ZVN A;  1SIF A;  3AXC A;  4DXA B;  2KZR A;  3OWE B;  3ALB A;  3AMZ A;  3AV8 A;  1Z2M A;  2JXX A;  2LVO A;  4FBJ B;  1WJ4 A;  2N4F A;  5FK9 C;  3WAM A;  4GDL A;  1N6Z A;  4RM8 A;  4LNN A;  1JRU A;  1XCT L;  4W9F A;  4K3B A;  5DPW A;  1QOF A;  3NZ3 A;  4YSY B;  3ZRF A;  3BY4 B;  2KLG A;  4MM3 B;  1GNU A;  2KKC A;  3DWM A;  3TUO A;  4EKU A;  3WAL A;  3GB1 A;  4N9F 4;  3MJW A;  1EF1 A;  1WJ6 A;  2JX5 A;  3ZRC A;  2TSS A;  4HCP B;  5MPO A;  1RFK A;  3GS2 A;  2FE8 A;  4B0E A;  1RAX A;  4HK2 A;  2K6Q A;  4W9H A;  3ZVV A;  4FJV B;  1YJ1 A;  4E71 A;  3R2T A;  2CS4 A;  3NJT A;  3LDZ E;  4LNF A;  4WJQ A;  3NRZ A;  3H7P A;  2RD0 A;  3DHG C;  1L0Y B;  2M8S A;  3SHQ A;  2DAJ A;  4ZHO A;  4M0W A;  2LD9 A;  1F77 A;  2CHW A;  1ZW7 A;  2D07 B;  2BKF A;  3ZYY X;  1XQQ A;  3Q8C A;  4KVG B;  2AQ2 B;  4C4V B;  1NDD A;  5JXV A;  4K7S A;  1PFD A;  3KQ4 A;  2W55 A;  2FIF A;  1CK1 A;  3RUI B;  1FXT B;  4NAW B;  1YN3 A;  5IO9 A;  4ZYN A;  3VUY A;  1DGJ A;  5BMH A;  2WXR A;  3W1Y A;  4B9K A;  3LJ3 A;  4EOY A;  2I2Y A;  4FA6 A;  2D11 A;  2O2V A;  2HD5 B;  3QIJ A;  5AUK A;  2PW9 A;  4G11 A;  1HTO A;  1N62 A;  3ZNZ B;  4LNO A;  4WAA A;  1C9F A;  4HPM B;  3I5J C;  1MI0 A;  1JCK B;  2G45 B;  4WQO B;  3IAM 1;  4KX6 B;  1FNU A;  2EMS A;  2WXJ A;  4G50 A;  1FFV A;  1QQR A;  3R3M A;  4TSS A;  2DZM A;  3UIN B;  4RF1 A;  2N9K A;  3L4P A;  4AJY B;  1FXA A;  4BKG A;  3KW5 B;  2LJ5 A;  4BKS A;  3OLM D;  4K1R B;  1UWX A;  3WAN A;  4JWU C;  2AL3 A;  1C3T A;  3WIM A;  4ZRI A;  2BS3 B;  4M02 A;  1RRB A;  1EM7 A;  1ZP0 B;  2AL6 A;  1CZP A;  5FR3 A;  3DPD A;  3L16 A;  3M62 B;  1J7B A;  2CHZ A;  1ZPS A;  1EUV B;  5LNK 1;  2ZJD A;  5TR5 A;  1HXY D;  2C7H A;  5J18 A;  2LGS A;  3W5V B;  1KF6 B;  1UGM A;  2GMI C;  3VH3 B;  1JWS D;  1ZKH A;  2KJH B;  3L0W B;  1H4R A;  3I57 A;  1OFF A;  4LK0 M;  4USA A;  1D5Z C;  3Q3J A;  2OED A;  1QKZ A;  1QOB A;  3HHM A;  1XXG A;  3AE7 B;  4BKT A;  2MA9 B;  1XCQ L;  3TBL D;  1I35 A;  1YX6 B;  3KUZ A;  4TMA B;  4MEL A;  1NVI D;  3UIO B;  4XDD A;  2E6X A;  1WM2 A;  3B2G A;  4OVU A;  3ZDM C;  3ZTC A;  5AZG A;  2L52 A;  3LYY A;  4C80 A;  4GMV A;  3ZJU A;  3EHV A;  4LTU A;  2FUH B;  1HZ6 A;  2IO3 B;  1Y8R C;  3TL5 A;  4KIK A;  2JU6 X;  2BYT A;  2YLM A;  4WJP A;  2LRW A;  2GI9 A;  3A4R A;  1HQR D;  3VTW A;  2IO1 B;  3DBR B;  3P42 A;  4RGM A;  2AEH A;  1S3S G;  1SF0 A;  3ZNH B;  1YJJ A;  5L83 A;  2KDF B;  4PYU A;  1V8C A;  1AN8 A;  2C5L C;  1D3Z A;  3VRA B;  2IGG A;  4XYC A;  1ZDV A;  4GN1 A;  3VR8 B;  2M4N A;  4A8X C;  1TT5 B;  2EKE C;  5D6J B;  1J7A A;  1GG3 A;  4NQK E;  4KSK C;  2SAK A;  3SDL C;  1WGY A;  5EE3 A;  2BS2 B;  2AYO B;  4F1S A;  1OQR A;  1V1O A;  3ECI A;  5IAA C;  3J9C A;  3BK2 A;  3U2S C;  4REZ A;  2N0S B;  2IO2 B;  3EFC A;  1JWA D;  1QOG A;  2K0P A;  1L7Y A;  2JZZ A;  4ZRJ A;  5D94 A;  4ICV A;  1YD8 U;  3RT3 B;  2BBC A;  3APD A;  1WR6 E;  2WXG A;  2JZ3 B;  1WF9 A;  4LDT B;  1IP9 A;  3L10 B;  2KNB A;  3VRB B;  2QHO A;  2GBM A;  4IG7 B;  2RMM A;  4XE0 A;  5LLI A;  2YEP F;  2C60 A;  1F9J A;  4BKS D;  3K9P B;  1TKG A;  2IND C;  2MH7 A;  3PVL A;  3NS8 A;  2DX5 B;  1FNV A;  4KDI C;  1IPG A;  1EU3 A;  5EE1 A;  3VR9 B;  1GOZ A;  2RPV A;  1E8W A;  3PRZ A;  3SD5 A;  2IZV B;  1FCC C;  1A70 A;  1E7U A;  3RZF A;  4KDL B;  2UYZ B;  3P1M A;  3VQI A;  2RDG A;  3CST A;  4NJ6 A;  1F2R I;  1P0R A;  1V2Y A;  1TGZ B;  2IO0 B;  1TKE A;  1NEN B;  3VHT C;  4A90 A;  1C4A A;  1VR9 A;  2XK5 A;  5EE0 A;  3V3X A;  1V5O A;  3BVM A;  3LXF A;  1OGW A;  4MJS A;  2NTS A;  3V62 A;  1XEE A;  2VRR B;  1ZOY B;  3H9D A;  4LJP B;  3H8H A;  1N5X A;  4WWP A;  2WDT B;  1UBQ A;  3Q69 A;  4DXG A;  2L7R A;  1JRO A;  3U8Z A;  1WJU A;  2PKO A;  2D10 A;  3WA0 A;  1TS5 A;  5L95 C;  4KKI A;  2MBO A;  2QDF A;  3HRD D;  5BYR A;  2FAZ A;  5HFY A;  3VTU A;  3GE3 C;  1D4B A;  2KDI A;  4MH8 A;  4EFO A;  1NYR A;  1I7H A;  2G3Q B;  2RDH A;  2M19 A;  2AX5 A;  3SEB A;  1WXS A;  4RGN A;  1GPX A;  3NHE B;  2RPQ A;  1LQB A;  4IW0 A;  4G3X B;  3ZO5 B;  4P6V F;  2CJO A;  3TEZ A;  2CR5 A;  5G5H A;  4YT0 B;  3NZS A;  3W1S C;  2YEP B;  5AUI A;  2BGF A;  1V49 A;  4NZL B;  1IGD A;  5BMI A;  2I1K A;  3PZD A;  3P4R B;  1D5M C;  3PGE A;  1UH6 A;  2DNF A;  2BYF A;  2KOX A;  4LCD E;  1KRH A;  3AEF B;  4P1C C;  1FEH A;  1FPY A;  4AOF A;  1OEY J;  2QEJ C;  2DBY A;  2DAF A;  2REX A;  1C76 A;  4HXD A;  1WMH A;  2N1W A;  2UWQ A;  1MVK A;  1UGJ A;  5IA7 A;  2QMT A;  4E74 A;  1AWD A;  5D3I B;  3PT2 B;  2FBW B;  1E6E B;  1JRP A;  1ZGU B;  3VUX A;  2NR2 A;  2VH1 A;  3AE8 B;  1OQQ A;  3AE1 B;  2KN5 A;  4P7I A;  5IOI A;  2KWC A;  4ZYS A;  2MX2 A;  2JVC A;  2KAJ A;  2O6V B;  2ZCC A;  3CMM B;  4WAF A;  3DHH C;  3BK1 A;  1MFW A;  5JHA A;  1PGX A;  4WWO A;  1WX7 A;  2XEW A;  5CTR C;  3HVZ A;  1VZ7 A;  2L76 A;  2VZK D;  2MP2 B;  4NJ7 A;  2K22 A;  3A4S C;  1V80 A;  3GOE A;  1WGH A;  1SJE D;  4EZJ A;  3MHZ A;  4ITK A;  2DYM A;  2WDR B;  2M0X A;  2C7N B;  3NS1 A;  3BVG A;  2IGH A;  3ZJT A;  2D3G A;  3QHT A;  3IT4 B;  4W9J A;  2LJI A;  4A3O A;  2KQ4 X;  5E6N A;  4ZHP A;  2WXQ A;  4F8C B;  3JVZ X;  2IYD B;  1E5W A;  2LI5 A;  1Q1O A;  3NVY A;  4NY0 A;  2PVO D;  4MSM B;  3HM3 A;  1VRA B;  2KFK A;  4HDQ A;  4JQW C;  4ZRP A;  5C2T B;  3I3T B;  2W3S A;  1GC6 A;  2HDE A;  1WX9 A;  1P98 A;  2NMQ A;  4O1N A;  3RI7 C;  2G4S A;  1SB3 C;  4II2 B;  1OEY A;  1TY0 A;  4R3D A;  4W9K A;  1EF5 A;  1FXI A;  2BYE A;  3RFZ B;  3BYY B;  2NBV B;  1ROE A;  3OJ4 B;  2WXM A;  1ENF A;  3UQA A;  3UF8 A;  2QIL A;  4MGZ E;  1YOV B;  4AS1 A;  2C7M B;  4GSW A;  5J17 A;  3A9J A;  4DHJ D;  1VDV A;  1F2R C;  2JY6 A;  3N9Y C;  1B9R A;  1E8Z A;  1TJE A;  1UF0 A;  3RNC C;  1P9D U;  1WYW B;  2KTR A;  4TQ1 A;  3V61 A;  1N61 A;  2KWV B;  2G4D B;  1P7E A;  1ZUD 2;  2JSV X;  5LXH A;  3PS6 A;  1V86 A;  1QZE A;  3OAW A;  3ZUN A;  4YTM B;  4JGH B;  1Y56 A;  2BWF A;  3I63 C;  3R7Q A;  2W82 A;  1LXD A;  2N9X A;  5CHF A;  1YQ3 B;  1R4N I;  2WDV B;  1WJN A;  2CKH B;  3FKY A;  4JIO U;  3BVZ A;  3QJZ A;  1TS2 A;  2PPH A;  2BW2 A;  4WIP A;  3AN1 A;  3U7D A;  1XO3 A;  1YMH E;  1V5T A;  1I4X A;  4LJO B;  2KMC A;  4TUU A;  3ENE A;  2W3R A;  2WDQ B;  1KOT A;  1E90 A;  2YVC A;  2R2O A;  3PZ8 A;  1WGG A;  2BVC A;  1WGK A;  1WGD A;  4ACF A;  4GIV A;  3PSE B;  3A33 B;  5HKH A;  3ML8 A;  2KJ6 A;  4M8M A;  3NG0 A;  2D3C A;  4NQL B;  4OW0 A;  1VZ8 A;  3SR6 A;  4FLH A;  1YN5 A;  4MT5 A;  1P3Q U;  1FM0 D;  2JUO A;  2LVP A;  2MQJ A;  3M63 B;  3Q3M C;  3QAR A;  3OG5 A;  1IGC A;  2K5P A;  1L0V B;  1FMA D;  1SBB B;  5IKC M;  1SXT A;  2M56 B;  2ZW1 A;  5C3J B;  3JSV A;  2CJN A;  5E6O A;  3L08 A;  2K3U A;  5D2M B;  4NJC A;  3Q3F A;  4KGR A;  2J4X A;  2NS5 A;  4L1B A;  3ZJV A;  4Q2J A;  4EZK A;  4YTN B;  3K9O B;  2INC C;  2FCM A;  3IT6 B;  2NPT A;  4YWG G;  3GE8 C;  2HJ1 A;  2IY1 B;  1JWM D;  1UEL A;  2JRI B;  2MSE D;  3L17 A;  1KLU D;  1IBX A;  3VFK A;  3T3N A;  3A1Q B;  2LVQ A;  3DVG Y;  2VH2 A;  1C1Y B;  1MJD A;  3AED B;  4YL8 A;  1OTR B;  3KUC B;  1BUI C;  3UGB B;  3U4E G;  4HKQ A;  3AE5 B;  3ZXV A;  3AEG B;  3ZW3 A;  4G0N B;  1JAL A;  3IHP C;  1RWS A;  2N7E A;  4UDU C;  5IP4 D;  3AEA B;  1T0S C;  4NPN A;  3DDC B;  2DZK A;  4K3C A;  2DEN B;  2HJ8 A;  2EKI A;  3ZXR A;  1D5X C;  3BIN A;  2G1E A;  2KTF A;  1PDX A;  3CSF A;  1WE6 A;  5E6J A;  2UU7 A;  3CIR B;  4K81 A;  4OZC A;  3EA6 A;  4IWQ A;  1T3Q A;  1VCB A;  2GBR A;  3MC0 B;  1N63 A;  2KDB A;  5E6P A;  2JWZ A;  2ZCB A;  1I4R A;  2N9P C;  3VTV A;  2FUG 1;  2L3Z A;  2ZPN A;  4HJG E;  4FXC A;  1NYQ A;  1C78 A;  1K8R B;  5FR6 A;  2DZI A;  1R7S A;  3N1Z C;  4GDK A;  1R4M I;  2FID A;  3Q6B A;  4S0R A;  1E8X A;  4WJN A;  1JWU D;  3C19 A;  4WUR A;  4OHJ A;  1ISN A;  1V1P B;  3T9L A;  1YIW A;  4JWS C;  1WFY A;  3AE9 B;  1L5P A;  4RF0 A;  3Q8F A;  4C56 C;  3QA8 A;  2JF5 A;  4CQN A;  1N5W A;  2ONQ A;  3BYT B;  4RNA A;  2V0G A;  2C9W B;  2LHD A;  5D3D A;  2KXJ A;  2IBI B;  1H8C A;  1K53 A;  3EC8 A;  4RGO S;  1HA5 A;  3PLV A;  3AB5 A;  4MM3 A;  4CO7 A;  2NCN A;  3ETR A;  1WI0 A;  4AQ7 A;  3CWI A;  1I4Q A;  3VXW A;  2J0K A;  3N1X C;  2X8X X;  3RNB C;  4GDL B;  1FO4 A;  3IBE A;  4MDK E;  2KMM A;  1T0Y A;  2WQY B;  3DQV A;  4N58 A;  2LEK A;  3BII D;  2IDY A;  1KLV A;  2G9H D;  3L54 A;  3O13 A;  2WYQ A;  2MBQ A;  3PLU A;  2HTH A;  3IFW B;  4XX5 A;  4KZ0 A;  5HG2 A;  2KJR A;  3GZN B;  4D2K A;  2FCQ A;  4HLE A;  4US8 A;  3VAW A;  5BYS A;  4I6L B;  1YQB A;  2WP9 B;  4PS8 A;  4WJO A;  3A9K B;  3R2I A;  2GLS A;  1EO6 A;  1RLF A;  1UBI A;  1GC7 A;  2V4L A;  5EDS A;  4NAM A;  4HPL B;  1LM8 B;  1CMX B;  4S17 A;  4II3 B;  4HWI B;  3Q8B A;  3MJ5 A;  1WZ3 A;  2L83 A;  3WCQ A;  2L1A A;  4IM3 A;  4RM9 A;  3AE6 B;  3CF6 E;  4C4V A;  2Z8L A;  1T6B X;  4KSL C;  2MWS B;  1F0Z A;  1ACC A;  3IXS A;  1FIQ A;  5FKA C;  2ZVO A;  1V6E A;  4A20 A;  4MAC A;  3JYU A;  4OVV A;  3H7P B;  1XLQ A;  3FC4 A;  3N3K B;  2DYB A;  4NAW A;  4HDO A;  1WX8 A;  3AE4 B;  3AU4 A;  2X38 A;  3KWL A;  4M0W B;  2WU2 B;  2QIE B;  1GJZ A;  4CHK A;  4AJW A;  5CHW A;  2RGF A;  1F1H A;  3DBH B;  2JPH A;  1XLN A;  2WLB A;  4XZ4 A;  1NI3 A;  2M0A A;  4WWM A;  2LRU A;  3VDZ A;  3BZD B;  2J52 A;  3MP9 A;  4FJZ A;  1R4N B;  3NZU A;  1EU4 A;  1SE3 A;  1ZDX A;  3DBL B;  3ZGZ A;  2NBW B;  1GAQ B;  2BYV E;  3PRE A;  2FCS A;  2FNJ B;  1WY8 A;  4PYZ A;  2LMC A;  2LZ6 A;  1TKY A;  1T5X D;  4MSQ B;  2PE9 A;  3AE2 B;  3T3O A;  3QX1 A;  2GB1 A;  2KMA A;  2MJE A;  2O2V B;  2JRH A;  4DBG A;  1NEK B;  3HM6 X;  3RCZ A;  3H1U A;  4W9E A;  2PIA A;  5JH5 C;  3C8Y A;  4DHZ B;  4ASW C;  2LGX A;  2KAN A;  4N59 A;  1U4A A;  2BTE A;  2A4Z A;  2KAC A;  3AM9 A;  2ZNV C;  1WWT A;  1ZE3 D;  2MBE A;  1WXQ A;  1FRD A;  2ZZP B;  1X1M A;  4RH6 A;  1TZO A;  4GGQ A;  1YQ4 B;  3QAQ A;  2WU5 B;  3VVW B;  4HEA 1;  2FCN A;  1VJK A;  1E0Z A;  1KLG D;  2PLP A;  2J42 A;  3P4S B;  4IM0 A;  3KVF B;  2MLB A;  4W9C A;  1E9M A;  2GRI A;  2JZP A;  3R66 C;  2ZPY A;  3HVD A;  3RN9 C;  3OJ3 A;  1ZXH A;  5H92 C;  1PQS A;  3NY5 A;  1VLB A;  1Q5W B;  4AP4 C;  3LB8 C;  2MHJ A;  3N30 A;  2J53 A;  3PZ7 A;  3SU8 X;  4BOZ B;  3ZNI D;  4ZRQ A;  3FIL B;  1BML C;  1TS3 A;  2LUM A;  1WXM A;  3RYT A;  3UI3 A;  4DQO C;  3P2B A;  1DYQ A;  3V60 A;  1AYF A;  4ICU A;  2D2Q A;  3HK0 A;  2JYE A;  1JQ4 A;  3TIX A;  3W9C B;  3DCG A;  1MPE A;  5LXI B;  1BT0 A;  2WXI A;  1I42 A;  2A5U A;  4JLC A;  2IPK D;  4HKZ E;  1LO5 D;  2DLB A;  2M1M A;  4BFR A;  4BZA A;  5BMG A;  2MCN B;  3RZW C;  3URY A;  4EEW A;  4GOC A;  4IDI A;  4US9 A;  2KYW A;  1UZX B;  2LGY A;  3PHW B;  2Z59 B;  3NOB A;  4HPP A;  2K8H A;  1K50 A;  1WH3 A;  2L0T A;  4K7W A;  3QK0 A;  2IGD A;  2J0M A;  4YSZ B;  3NVZ A;  3TCA A;  2MBH A;  1B1Z A;  2QJL A;  4OVZ A;  2XBB C;  1WGR A;  2LFI A;  2INN E;  3AEE B;  4KIK B;  4EUT A;  2BKR B;  3HUI A;  3WAO A;  3KLS X;  3TSS A;  4FHJ A;  4MGY E;  1QF6 A;  1L2N A;  3GZN I;  2K39 A;  1MG4 A;  2ZEQ A;  3SFD B;  4W9G A;  4C00 A;  2B3A A;  3DVN V;  1R4M B;  2PTL A;  1UNS A;  3EUB 2;  1XT9 B;  2JYT A;  3SFE B;  1WSP A;  2GOW A;  1NBF C;  2L0F A;  1SEB D;  4FHK A;  2LAS A;  5CHV C;  5G5G A;  4H2A A;  1QLB B;  4TQ0 A;  4QAY A;  4I6N B;  5G55 A;  1J0G A;  2DWQ A;  2WXK A;  4EE2 A;  4FJY A;  3R8B A;  3NVW A;  1MHH E;  3PO0 A;  5GMV A;  4WQM A;  1PGA A;  3RPF C;  1C4P A;  1CJE A;  4RMA A;  3W5U B;  4DHZ E;  4A6Q A;  5CX3 A;  4DK5 A;  3KWV A;  2N1V A;  3V6C B;  2AWT A;  3A9K A;  4OZA A;  2GBK A;  3Q8E A;  2V9H A;  5AZF A;  4PS3 A;  5J2R A;  5C1Z A;  3EFU A;  4IWO A;  3U52 E;  1KFY B;  2WXF A;  1SGH A;  1J8C A;  3DBH I;  2R2Q A;  4MH0 E;  5GXG B;  3X23 A;  1F52 A;  1I4G A;  3Q3N C;  1L4D B;  3B1L X;  3ZLZ A;  2VZK B;  3L13 A;  2L8J A;  1S1Q B;  3MFG A;  3N32 A;  1QIL A;  1IUE A;  1WXV A;  2KVZ A;  3DBL I;  4IUM B;  2CU3 A;  3N1Y C;  2ICI A;  2H88 B;  2K6D B;  2KX3 A;  1NI2 A;  4L2Y A;  1WYG A;  4C7Y A;  2W54 A;  3DBS A;  1KJT A;  3S2A A;  2BQQ A;  2ON8 A;  1ESF A;  1HZ5 A;  4X57 B;  4LNK A;  1P1A A;  1KM7 A;  2BS4 B;  3ZNG C;  1YX5 B;  2V4I B;  3B0A A;  1SE4 A;  1GB4 A;  1L0X B;  1K52 A;  1TIF A;  2HE7 A;  4ZDV A;  1G6J A;  1XLO A;  2NBU A;  2OJW A;  5HHD G;  2BF8 B;  2E3T A;  2KN4 A;  1PGB A;  3PHX B;  1STE A;  2D3A A;  2KWD A;  3FAH A;  2XK5 B;  2LGD A;  4PS7 A;  2GBN A;  4MJS B;  5KHQ A;  4ARI A;  1FNW A;  2K1F A;  4W9D A;  4ANV A;  5DPS A;  1L6U A;  2MJD A;  4WH4 A;  5JHB A;  2Q5W D;  5DCN A;  1SIJ A;  4FUL A;  1EWY C;  2RSU A;  3APF A;  5I4D A;  2D5G A; 
#chains in the Genus database with same CATH homology
 1FRR A;  1K53 A;  4RGO S;  5FK9 C;  1HA5 A;  4XDC A;  3SEB A;  3AB5 A;  4RGN A;  1GPX A;  3ETR A;  2PMV A;  4AQ7 A;  3CWI A;  1XCT L;  5H8Y E;  1I4Q A;  4P6V F;  1QOF A;  2CJO A;  3TEZ A;  3NZ3 A;  1VZ6 A;  2IJ0 A;  4YSY B;  5G5H A;  1FO4 A;  4GDL B;  4YT0 B;  4MM3 B;  3DWM A;  3TUO A;  2KMM A;  2WQY B;  2YEP B;  1E10 A;  4N58 A;  2LEK A;  3BII D;  5AUI A;  3GB1 A;  2IDY A;  2INP E;  4NZL B;  2G9H D;  1IGD A;  3O13 A;  5D7G A;  5BMI A;  4RCO A;  4KGT A;  2JX5 A;  2TSS A;  3P4R B;  4YSX B;  5MPO A;  5HG2 A;  1RFK A;  4D2K A;  1D5M C;  3GS2 A;  3TEW A;  4US8 A;  5BYS A;  2FE8 A;  4B0E A;  1KRH A;  3AEF B;  2WP9 B;  1FEH A;  3R2I A;  2QEJ C;  2DBY A;  1C76 A;  3GP7 A;  3TEY A;  1XF5 L;  1MVK A;  4NAM A;  1UGJ A;  1GB1 A;  2QMT A;  4HRS A;  1AWD A;  4GLS C;  5D3I B;  3FIL A;  3R2T A;  2WXP A;  2FBW B;  1E6E B;  1JRP A;  2XNA C;  3U2S C;  2I38 A;  1FD6 A;  3Q8B A;  3MJ5 A;  3NRZ A;  2L83 A;  3AE8 B;  3WCQ A;  4PT5 A;  1OQQ A;  2L1A A;  2ZW0 A;  3AE6 B;  1ET6 A;  1L0Y B;  3AE1 B;  1ZXI A;  2AQ3 B;  1T6B X;  2Z8L A;  1F0Z A;  4ZYS A;  1ACC A;  1QOA A;  4ZHO A;  3IXS A;  1FIQ A;  4M0W A;  5FKA C;  2KAJ A;  5BYQ A;  1F77 A;  4WAF A;  1UUP A;  4MAC A;  3BK1 A;  1C79 A;  1XLQ A;  3FC4 A;  3ZYY X;  3Q8C A;  1PGX A;  1MHX A;  2AQ2 B;  3HVZ A;  5JXV A;  3AE4 B;  1VZ7 A;  2X38 A;  2VZK D;  3KWL A;  1TS4 A;  2K22 A;  2WU2 B;  2LGI A;  2QIE B;  1PFD A;  3W1S A;  3KQ4 A;  2R61 A;  2W55 A;  2Y5C A;  3NVV A;  1CK1 A;  1SJE D;  1XLN A;  4NAW B;  1YN3 A;  2WLB A;  4A55 A;  1NI3 A;  2M0A A;  4WWM A;  1V97 A;  3MHZ A;  4ITK A;  2DYM A;  1D6E C;  2WDR B;  3BZD B;  1DGJ A;  3NS1 A;  3BVG A;  2J52 A;  5BMH A;  2IGH A;  2WXR A;  3MP9 A;  2N9L A;  3Q8A A;  3ZJT A;  2I2Y A;  3IT4 B;  2LJI A;  2BT6 A;  1EU4 A;  1KH0 A;  1SE3 A;  2KQ4 X;  1ZDX A;  3ZGZ A;  5HI1 A;  4ZHP A;  5T8I A;  1GAQ B;  2WXQ A;  3ZQ4 A;  5AUK A;  1HEZ E;  2PW9 A;  3U7Z A;  1Q10 A;  3NVY A;  2ACZ B;  2LMC A;  1TKY A;  2JWU A;  1T5X D;  1N60 A;  1N62 A;  2PVO D;  3AE2 B;  3T3O A;  1C9F A;  2GB1 A;  1MI0 A;  1VRA B;  2MJE A;  4A9A A;  4ZRP A;  5C2T B;  1NEK B;  2W3S A;  3DWG C;  1JCK B;  2HDE A;  2EEL A;  3AEC B;  2NMQ A;  3IAM 1;  4KX6 B;  1FNU A;  2WXJ A;  4O1N A;  1FFV A;  1QQR A;  1SB3 C;  4TSS A;  1TY0 A;  4R3D A;  2PIA A;  4RF1 A;  1FXI A;  3C8Y A;  1SJH D;  3RFZ B;  2N9K A;  3L4P A;  4N59 A;  2BTE A;  3BYY B;  1ROE A;  2KAC A;  3AM9 A;  1FCL A;  1FXA A;  4YTP B;  1WWT A;  2WXM A;  1ZE3 D;  2OHF A;  1WXQ A;  1FRD A;  1ENF A;  4RH6 A;  4ARC A;  1UWX A;  1I4H A;  1PYW D;  4JWU C;  2QIL A;  3W2D A;  1TZO A;  2BS3 B;  3TEX A;  1EM7 A;  1ZP0 B;  1YQ4 B;  4AS1 A;  1CZP A;  5FR3 A;  2WU5 B;  1FFU A;  2WS3 B;  1J7B A;  4HEA 1;  1VDV A;  1F2R C;  1ZPS A;  3AE3 B;  1VJK A;  1E0Z A;  1KLG D;  5LNK 1;  2PLP A;  1EWC A;  3N9Y C;  4XWT A;  1B9R A;  4YXD B;  2J42 A;  2KDM A;  1TJE A;  3P4S B;  1HXY D;  3EGR A;  4ZOH C;  3W5V B;  1E9M A;  1KF6 B;  4IKG A;  4TQ1 A;  1N61 A;  4HRO A;  1P7E A;  1ZUD 2;  2GRI A;  1KTK A;  4DXF A;  2JSV X;  2JZP A;  3HVD A;  1JWS D;  1ZXH A;  2JXT A;  5H92 C;  5TSS A;  2JQR B;  3I57 A;  4XWW A;  1VLB A;  1OFF A;  4LK0 M;  4USA A;  1D5Z C;  4JX1 C;  2OED A;  3LB8 C;  3I9V 1;  3PZ7 A;  2J53 A;  4YTM B;  1DOY A;  1M4V A;  1QKZ A;  1C77 A;  1QOB A;  1Y56 A;  2DYO A;  1PUT A;  4ZRQ A;  3FIL B;  2W82 A;  1BML C;  1TS3 A;  2LUM A;  2Y3A A;  1JWB D;  1YQ3 B;  2WDV B;  3UI3 A;  1XXG A;  4DQO C;  1DYQ A;  3AE7 B;  2MEK A;  2B76 B;  1AW7 A;  1AYF A;  1ET9 A;  3BVZ A;  1XCQ L;  1TYG B;  1TS2 A;  4B0M A;  4TMA B;  4JPS A;  1NVI D;  2BW2 A;  4WIP A;  2JYE A;  1JQ4 A;  3W9C B;  4XDD A;  2E6X A;  3AN1 A;  3B2G A;  1XO3 A;  4P16 A;  1MPE A;  1YMH E;  4OZB A;  1SE2 A;  2WXI A;  1I4X A;  2IPK D;  4HKZ E;  1LO5 D;  2L52 A;  2DLB A;  3LYY A;  5BMG A;  3URY A;  4C80 A;  2W3R A;  2WDQ B;  1K51 A;  4LLG M;  1J7C A;  4IDI A;  4US9 A;  3ZJU A;  4LTU A;  3B9J A;  3PZ8 A;  2XN9 C;  2WXN A;  1HZ6 A;  1WGK A;  2BB5 A;  1K50 A;  2JU6 X;  3IAS 1;  2BYT A;  3B2F A;  2IGD A;  4YSZ B;  2GI9 A;  3NVZ A;  1HQR D;  1B1Z A;  2QJL A;  3P42 A;  4OVZ A;  4RGM A;  1WRI A;  1SF0 A;  2N7J A;  2LFI A;  3P4P B;  1YJJ A;  2INN E;  3AEE B;  4OW0 A;  1VZ8 A;  3HUI A;  3SR6 A;  1QT9 A;  1V8C A;  1YN5 A;  3KLS X;  3TSS A;  4MT5 A;  1AN8 A;  1FM0 D;  1I4P A;  1QF6 A;  3VRA B;  4L23 A;  2NTT A;  1IGC A;  2K5P A;  1L0V B;  2IGG A;  1FMA D;  3SFD B;  1ZDV A;  1SBB B;  3VR8 B;  1SXT A;  1RM6 C;  2PTL A;  4A8X C;  2M56 B;  1UNS A;  2ZW1 A;  3EUB 2;  3V05 A;  2JYT A;  5C3J B;  3SFE B;  2CJN A;  3NUH B;  2K3U A;  1J7A A;  1WSP A;  2H89 B;  4NJC A;  2SAK A;  4KGR A;  2J4X A;  1SEB D;  4L1B A;  5EE3 A;  2L32 A;  5G5G A;  4H2A A;  2BS2 B;  3ZJV A;  4KGS A;  1QLB B;  4Q2J A;  4TQ0 A;  1XLP A;  4JE3 B;  2DWQ A;  1OQR A;  1V1O A;  2V3P A;  2WXK A;  4EE2 A;  4YTN B;  3J9C A;  2PVG C;  3IT6 B;  3R8B A;  1JML A;  3BK2 A;  3NVW A;  1E7P B;  1MHH E;  3PO0 A;  4REZ A;  4YWG G;  3BWU D;  2N0S B;  4WQM A;  1PGA A;  3RPF C;  1C4P A;  1JWM D;  1JWA D;  1CJE A;  1QOG A;  2WXL A;  3W5U B;  1UWM A;  2K0P A;  1SSN A;  1YJI A;  1KLU D;  1IBX A;  1YN4 A;  4A6Q A;  1RYJ A;  3T3N A;  2BBC A;  3KWV A;  3AEB B;  2V3N A;  3E9S A;  4OZA A;  2WXG A;  3AED B;  3Q8E A;  1BUI C;  3E56 A;  1L4Z B;  3U4E G;  4HKQ A;  3U52 E;  3AE5 B;  4RGT A;  1IBX B;  1KFY B;  1CQV A;  2WXF A;  3AEG B;  3VRB B;  5EE9 A;  4N6E B;  1JAL A;  1RWS A;  4UDU C;  2M19 A;  2Y5P A;  5GXG B;  3AEA B;  1I4G A;  1L4D B;  2RMM A;  4XE0 A;  2YEP F;  2VZK B;  2EKI A;  1TKG A;  3MFG A;  2MH7 A;  1C4C A;  1D5X C;  1QIL A;  2SEB D;  1FNV A;  2G1E A;  1IUE A;  2QSD A;  1EU3 A;  3P63 A;  1PDX A;  5EE1 A;  3VR9 B;  1GOZ A;  2K9X A;  2RPV A;  2WXO A;  4J3O D;  2CU3 A;  4IOI E;  2ICI A;  4KKJ A;  2H88 B;  4L2Y A;  1WYG A;  4C7Y A;  2LHE A;  1FCC C;  1A70 A;  2W54 A;  5E6J A;  3CIR B;  2ON8 A;  3P1M A;  3VQI A;  3ABV B;  1L6V A;  2RDG A;  4OZC A;  1ESF A;  1HZ5 A;  3EA6 A;  1T3Q A;  1F2R I;  2WNM A;  3MC0 B;  1N63 A;  1I4R A;  1TKE A;  2BS4 B;  1NEN B;  2V4I B;  2WXH A;  1SE4 A;  2HTM E;  2FUG 1;  1C4A A;  1VR9 A;  5EE0 A;  4A90 A;  1GB4 A;  4HJG E;  4FXC A;  1L0X B;  3BVM A;  3LXF A;  3V3X A;  1K52 A;  1V1P A;  1NYQ A;  1C78 A;  3AH7 A;  2NTS A;  1XLO A;  1P7F A;  5HHD G;  1XEE A;  2E3T A;  1R7S A;  2KN4 A;  1ZOY B;  1PGB A;  1YNT E;  1DOI A;  1STE A;  2KWD A;  1JWU D;  2BB6 A;  2MJ3 A;  3FAH A;  4WUR A;  4RFB A;  4OHJ A;  3H8H A;  1N5X A;  2AQ1 B;  1V1P B;  3Q69 A;  1BXT A;  4C7Z A;  4ARI A;  1FNW A;  4DXG A;  1JW9 D;  3P4Q B;  1JRO A;  4GDK B;  4JWS C;  2PKO A;  1DOX A;  1TY2 A;  3AE9 B;  1L6U A;  2MJD A;  1L5P A;  4RF0 A;  2Q5W D;  4WH4 A;  1TS5 A;  3Q8F A;  4KKI A;  4C56 C;  3OWE B;  1SIJ A;  4CQN A;  1N5W A;  3HRD D;  1EWY C;  5BYR A;  3AMZ A;  5HFY A;  3AV8 A;  2ONQ A;  1D4B A;  3BYT B;  4RNA A;  5I4D A;  4MH8 A;  2V0G A;  1NYR A;  1I7H A;  2D5G A;  2LHD A;  2RDH A;  5D3D A;  2AX5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...