2DZIA

2dzi/solution structure of the n-terminal ubiquitin-like domain in human ubiquitin-like protein 4a (gdx)
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
81
structure length
81
Chain Sequence
GSSGSSGMQLTVKALQGRECSLQVPEDELVSTLKQLVSEKLNVPVRQQRLLFKGKALADGKRLSDYSIGPNSKLNLVVKPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Ubiquitin-like protein 4A
publication title 2DZI/Solution Structure of the N-terminal Ubiquitin-like Domain in Human Ubiquitin-like Protein 4A (GDX)
rcsb
source organism Homo sapiens
total genus 12
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2006-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2dziA00
2A5UA 2DYBA 2KTRB 3UQAA 3QARA 1OEYA 3UIPB 4ANWA 3QCAA 1UH6A 1P3QU 2MQJA 2ZCBA 5IA7A 2CKHB 2PE9A 1IPGA 4DDID 4RM8A 2LGXA 3M62B 4J6IA 4MJSB 1U4AA 2IYDB 2KJHB 1NDDA 1TZ1A 2Z0DB 4RMAA 1EUVB 4TKNA 2N7DA 1WX7A 3RCZA 3N30A 4KZ0A 3X0WA 3VTWA 4TUUA 3A1QB 2BWFA 1M94A 3RZWC 3WANA 1V80A 5JHBA 2D3GA 5D2MB 2MA9B 3PREA 1Q0WB 5CX3A 1E7UA 2V4LA 2BKRB 4WJOA 3TMPB 1WJUA 5DPRA 1YX5B 2BYEA 4GN1A 2ZPYA 3ZNZB 3KUZA 2DHZA 3APDA 3QX1A 3ZLZA 2KD0A 3PRPB 2FIFA 1J19A 5KHOA 3APFA 4W9GA 2WX1A 1WRDB 4N9F4 2FCQA 1OTRB 2K25A 4CO7A 4A20A 1H8CA 1EF5A 2BGFA 1EO6A 1V81A 3B08A 1WMHB 4AWJA 1Z2MA 1ZW7A 3OLMD 2M1MA 1V2YA 2HE7A 2KMCA 2DYMA 2MSED 4I6PA 3KYDD 4ASWC 3SD5A 4II2B 2V3SA 1I35A 4WJPA 2GBRA 3PGEA 1EF1A 3PHXB 4KDLB 1E8XA 2CR5A 2J0JA 2DZJA 1WGGA 1IP9A 1WXAA 4HVBA 5JH5C 2EKEC 4IM3A 2M8SA 2C7HA 2NVUI 3L08A 4FN2A 1GJZA 2LRWA 2L00B 2D10A 3NZUA 4E3CA 2N1VA 4JQWC 4WWNA 2BPSA 3WIMA 2MBHA 3MHSD 4HLEA 3HM6X 2N9EB 2RGFA 3VTUA 2O2VA 4P7IA 2KFKB 1WJNA 1UBQA 1WGYA 2PPHA 3ZNGC 3W1SC 3HK0A 4W9JA 4W9KA 3R7QA 2UYZB 3X23A 3NS8A 2PEAA 2MCNB 3ZVVA 4EZLA 4BBNC 3L17A 4DWFA 5LXIB 4ICUA 3TIXA 2LI5A 2IO1B 4FHKA 4GDLA 3LDZE 1V6EA 2KLCA 4IM2A 2KMAA 4BKTA 1WM3A 2LXAA 3W1YA 1BT0A 5E6NA 3TL5A 1JRUA 2CHZA 2LRUA 2KQ7A 2JF5A 4HDOA 4NAWA 4MGIE 3B1LX 4W9EA 3ZKJC 3ZNHB 2L8JA 3N32A 4ZRKA 3U8ZA 5J2RA 1Z5SB 1KJTA 4NQLB 3ML9A 4CYEA 3DBSA 2MX2A 2W9NA 2JPHA 2KDFB 2BWES 3T9LA 4BOZB 3WAOA 3NHEB 1HE8A 2VRRB 3ML8A 3DVNV 3VH3B 3L54A 2ZJDA 4GU2A 2EMSA 1P1AA 5DPTA 1OQYA 2DAFA 2KWVB 2ZPNA 2K8BA 4G50A 1WGDA 2MBBB 2KC2A 2LWPA 2DAJA 2JT4B 4TV3A 3PRZA 1QZEA 2LASA 4LCDE 3A9KB 3TJPA 2KKCA 4GSWA 2C9WB 3SDLC 5BO4B 2A4ZA 1XT9B 2XK5A 3V6EB 2G3QB 3DPDA 3BY4B 4I6LB 3ENEA 4HDQA 4GXBA 4IG7B 2WDTB 4KVGB 2L05A 5FR6A 2CHXA 4GDKB 4LJPB 2KNBA 4F8CB 5G2NA 1NBFC 2K1FA 4ZRJA 1X1MA 3SU8X 3MJWA 4JLCA 2KDEB 3A9JB 4FJZA 1WX9A 4XX5A 2FCSA 2GBNA 1E8WA 4PS7A 1Q5WB 3V6CB 3PLVA 4WJQA 4BFRA 1L2NA 1WF9A 5AZFA 3JSVA 2MP2A 1ZKHA 3HHMA 2M17A 1TBEA 2NBWB 1WX8A 2DYOA 3L10B 4W9FA 1UZXB 4ANVA 4E71A 3ZIMA 2RD0A 1KOTA 4PYUA 3QIJA 2LGDA 4ICVA 4KSLC 3HM3A 4FJVB 3Q3JA 1YIWA 1RRBA 3HIZA 1KM7A 2ZVOA 2JY6A 2LGYA 2KFJA 2D07B 3R3MA 4W9HA 4ANUA 4MEMA 4W9CA 4B95A 1WFYA 2V1YA 3K9PB 3Q3FA 2JWZA 3P2BA 3ZRFA 2NPTB 1MG8A 3KW5B 4EKUA 4FJYA 1Y8RC 1WY8A 2CU1A 2IY0B 1UBIA 3TCAA 1IYFA 1GG3A 1WE6A 4XZ4A 4IW0A 1WR1A 4M8MA 4M0WB 3UINB 3H9DA 3QC8B 2IBIB 4KIKB 3VHTC 2DZIA 5AZHA 3ALBA 5AZGA 2B3AA 4X57B 2N1WA 2CHWA 3EFUA 1SE9A 2NBVB 2IO3B 4MSQB 1WE7A 2I1KA 2DZMA 3VUXA 2PE6B 4E74A 4EOYA 5IAAC 3CSFA 4IC7B 2D11A 2LUEA 2DX5B 5JZEB 1LXDA 4B9KA 5G55A 3RT3B 3KUCB 4KSKC 2WX0A 2JXXA 4ZRIA 1K8RB 3IG3A 3RZFA 2GBJA 4MELA 2KXJA 5E6OA 3VUWA 4AOFA 3JSVB 4DBGA 1J8CA 2KO3A 2NR2A 2O6VA 4FADA 2MBOA 2Z59B 4EUTA 2N9XA 1F9JA 3VAWA 5KHQA 4FHJA 2FCMA 3MTNB 3ZDMC 1LFDA 3AU4A 2G4SA 4AUQC 2JUOA 2LJ5A 4NPNA 2GBMA 3VVWB 2ZEQA 1E7VA 3H7PA 3VXWA 2N7EA 2MLBA 3RULA 5LLIA 4JIOU 1Q1OA 3ZDTA 3APCA 3L13A 2JRHA 3CSTA 3IFWB 4W9LA 4XC2A 2K8HA 2WYQA 2KWUB 3OAWA 4IWPA 2KC1A 2KVRA 4BKSA 5AEKB 2HD5B 3QA8A 4BOSC 1D3ZA 3UGBB 2JZ3B 4F1SA 1LM8B 2L7RA 2KLGA 4HWIB 3JVZX 5J17A 4HJKA 4PYZA 5TR5A 5DCNA 2M0XA 3EC8A 4LDTD 1G6JA 2C60A 4NNJB 2BF8B 4AP4C 3BINA 2KHWB 2KTFA 4LDTB 1WXSA 2N9PC 3PV1A 4PS8A 2GBKA 3R7RA 2KDIA 1TTNA 2MWSB 3A33B 1RLFA 2AWTA 2LZ6A 4JGHB 3PSEB 2ZNVB 1LQBA 1E5WA 3ONSA 4EEWA 3GOEA 3K9OB 4IWQA 4FULA 4MJSA 2IO0B 3VQIA 3T8MA 5LXHA 3RUIB 3O65B 2L0TA 2PJHA 1V5OA 1RAXA 4DXAB 2L76A 2KQSA 1S1QB 4I6NB 2O2VB 3DBHI 3A1QA 2BKFA 3W1SA 4GOCA 2DENB 4MDKE 5JHAA 5CHVC 2JZZA 3H6NA 3H7PB 1YJ1A 3IBEA 2KWCA 2L0FA 3NZSA 2K6DB 3DQVA 3ZTDA 1VCBA 4KV2A 1PQSA 2R2OA 3QK0A 1VD2A 4GDLB 4WWOA 3QJZA 4K81A 3PS6A 4MSMB 2IY1B 3V62A 5J18A 4HXDA 1R4MI 3CMMB 3H7SA 4KDIC 4MM3A 4NAWB 2KANA 2KJRA 4IUMB 2OJRA 1WMHA 4NJ7A 4NJ6A 4DHJB 2XBBC 4M8NA 1R4NI 2HTHA 5GMVA 1C3TA 3AULA 1GNUA 2CS4A 2KX3A 1WI0A 3KH0A 4DHZB 2YLMA 4KZCA 2L3ZA 1T0YA 3ECIA 2Z0EB 1A5RA 1KLVA 2Y5BB 3PHWB 2AL3A 3M95A 2K39A 3V60A 2ZNVC 2DZKA 5L83A 2AL6A 4MGZE 1XD3B 3C0RB 4MGYE 2G4DB 2J0KA 3PPAA 3RYTA 3JW0X 2NBUA 4BBNF 2KOXA 3AU5A 4YL8A 4HCNB 3VUYA 2ZCCA 3ZTCA 2XK5B 4ZDVA 3WAMA 1FXTB 4G0NB 3R66C 1E8YA 4ZYNA 1WYWB 2KFKA 4HPMB 2ZVNA 2K6QA 3DVGX 4WWPA 1YQBA 1UD7A 4OVVA 3N3KB 4K7SA 3VH4B 5EDSA 1E90A 2LVPA 2LXCA 1H4RA 1V49A 2EMTA 4FBJB 3LJ3A 4PS3A 2RPQA 3U30A 3EECA 2BYFA 4DDGD 2HJ8A 5C23A 4G3XB 4AJYB 2ASQA 1UGMA 1P9DU 2GMIC 2MBQA 3B0AA 3SHQA 2MP2B 3A4SC 4AJWA 1OEYJ 4NY0A 3RD2A 1S3SG 3ZUNA 3A4RA 1V9JA 3QQ8B 2FUHB 3KUDB 1NI2A 1WM2A 1WGHA 4EZKA 3TBLD 4HK2A 1GC6A 4FA6A 1L7YA 3VTVA 2J0MA 4B6WA 1WZ0A 2LD9A 3U7DA 1GUAB 4F7ZA 4HPLB 4JL9A 4K1RB 1C1YB 3AI5A 4MGKE 4GIVA 1WJ4A 2WWZA 3PTFC 2KJ6A 2KK8A 4BKGA 2BYVE 1SIFA 4TQ0A 3WA0A 3A9KA 2G45B 4WAAA 1P98A 1YX6B 2AYOB 3ZO5B 3PVLA 2NS5A 3QHTA 4A3PA 2FIDA 3VFKA 3IHPC 3KVFB 2KN5A 5D6JB 3I3TB 1WJ6A 4GGQA 4GDKA 4WQOB 2REXA 5D7GA 4OVUA 2LVQA 1ZGUB 1YD8U 2RR9A 3A9JA 3PT2B 2QHOA 3WAPA 2KTRA 1CMXB 2C7MB 3GZNI 5D94A 2KZRA 3OJ4B 4W9IA 1SGHA 3H1UA 1WXVA 2YVCA 3IVFA 3M63B 3PZDA 1E8ZA 4K7WA 4FLHA 3PRMB 1GC7A 3QAQA 2NCNA 3QWZB 2GOWA 2C5LC 2KDBA 3VDZA 2O6VD 5CHFA 2I1JA 1WXMA 3AXCA 3JYUA 4EZJA 4A3OA 1UELA 2FAZA 2O6VB 4LJOB 1WGRA 3NY5A 1AARA 4ANXA 2ZZPB 3DVNU 3PLUA 3DOWA 3WALA 2FNJB 1J0GA 1ISNA 3CF6E 4NQKE 2MBEA 2IZVB 3OJ3A 1WIAA 4HCPB 3DDCB 3V61A 4GB9A 3ZW3A 5L95C 5DPSA 3ZRCA 4IM0A 1I42A 5HKHA 1V5TA 2J7QB 3M3JA 4WJNA 1TGZB 5CHWA 2JVCA 2AEHA 1WH3A 4W9DA 5E6PA 2K8CA 4IWOA 2KX0A 3EHVA 5C1ZA 3L16A 4GMVA 2NPTA 3UF8A 1P0RA 3ZNID 4BKSD 5DPWA 2N4FA 4URKA 2XEWA 4DK5A 2IO2B 2UWQA 3D32A 3S2AA 3NOBA 3L0WB 2RSUA 4DHZE 3DVGY 3UIOB 3DBLI 4CHKA 2M4NA 2FCNA 3DCGA 1OGWA 5CTRC 4DHJD 2JRIB 1WZ3A 2C7NB 4MH0E 4KIKA 2MW5A 4TQ1A 4RM9A 1WR6E 1XQQA 3DBRI 1RFAA 4II3B 2OOBB 4BVUC 4EFOA 2MRPA 2R2QA 3KYCD 4K7UA 2LVOA 1V86A 2D2QA 3UQBA 4G11A
chains in the Genus database with same CATH superfamily
3DBHB 2A5UA 4JX1C 2L83A 3UIPB 4ANWA 3QCAA 1P3QU 3R2IA 1FD6A 5IA7A 1YMHE 3M62B 4J6IA 4MJSB 2JWUA 2KJHB 2XNAC 2PTLA 2Z0DB 3SR6A 3N30A 1E10A 3Q3NC 2BWFA 1P7FA 1M94A 3WANA 5JHBA 1L6VA 2LGIA 5CX3A 2V4LA 4WJOA 3TMPB 2K5PA 2WU2B 5DPRA 2BYEA 1XLOA 1K53A 2DHZA 3APDA 3QX1A 1C76A 2KD0A 3PRPB 2FIFA 1J19A 2QCZA 4W9GA 1WRDB 1Q10A 2FCQA 2K25A 2INCC 1EO6A 1WMHB 2Y5CA 3OLMD 1V2YA 2HE7A 2MSED 2DYMA 3KYDD 4MT5A 3LB8C 4LNIA 4IKGA 1I4PA 4WJPA 1WGGA 5BYQA 2DWQA 1I7HA 5JH5C 4ZHPA 1SE4A 2GLSA 2UU7A 1K52A 1EWYC 2LRWA 2D10A 4A9AA 3NZUA 4JQWC 2BPSA 2ACZB 2N9EB 2RGFA 4KGRA 1VZ8A 4RFBA 1WJNA 3IT6B 3ZNGC 3HK0A 1SB3C 2PEAA 2LHDA 1MVKA 4BBNC 4DWFA 2LI5A 2L1AA 2KLCA 1UNSA 4J3OD 2KMAA 1GB4A 4BKTA 1WM3A 1SIJA 2WXIA 1JRUA 2CHZA 3NG0A 2KQ7A 1GPXA 4HDOA 1NI3A 4W9EA 3ZKJC 2L8JA 3N32A 3U8ZA 5J2RA 3Q14C 4MACA 1CJEA 1JCKB 5JXVA 3T9LA 1T0RC 1HE8A 3RPFC 2VZKD 1SSNA 3CIRB 3FAHA 1PYWD 3P4PB 1OQYA 2ZPNA 3SFEB 2K8BA 1WGDA 1T5XD 2JT4B 3BK2A 4TV3A 3PRZA 4LCDE 4PT5A 3SDLC 4HPPA 3BWUD 4OW0A 3TUOA 1N5WA 3V6EB 4I6LB 3BY4B 2KVZA 4HKZE 4IG7B 4KVGB 5FR6A 4GDKB 4LJPB 3MJWA 2KDEB 4FJZA 2GBNA 1ZP0B 3I5JC 3T3NA 2H89B 3PLVA 5AZFA 1F52A 4ZHOA 1ET6A 1WX8A 3L10B 3AEBB 4PYUA 2LGDA 1ET9A 4KSLC 5GXGB 4FJVB 2WXHA 2W54A 3B2GA 2KQ4X 4HRSA 4C4VA 2Y5PA 2D07B 2WXNA 3C19A 3Q3FA 3OWEB 2BS3B 2JWZA 1IYFA 4NZLB 1ROEA 3UINB 3QC8B 2QSDA 2IBIB 3ALBA 3W9CB 3KWVA 3TEWA 4MSQB 2IO3B 1WE7A 3ZJVA 4C00A 4QAYA 4IC7B 2D11A 3EA6A 1K51A 2WDQB 5G55A 3KUCB 4KSKC 1JWBD 4RGNA 3VUWA 4DBGA 1J8CA 2KO3A 2NR2A 1ZDXA 1F2RI 2Z59B 1HEZE 2N9XA 4FHJA 2FCMA 3MTNB 1CK1A 2LJ5A 5EE1A 1GOZA 4R3DA 3VVWB 3AE5B 3H7PA 2N7EA 3RULA 5I4DA 3IT4B 1EU3A 5HI1A 4IWPA 1V97A 3VRAB 3QA8A 1VZ7A 3ZJTA 2JZ3B 4IDIA 4F1SA 2KLGA 4N58A 3JVZX 4PYZA 5TR5A 2M0XA 1CZPA 2BF8B 2KTFA 4PS8A 3A33B 3BYTB 2LZ6A 1LO5D 4JGHB 1VZ6A 1LQBA 2WGSA 3GOEA 3Q69A 3VQIA 3AEAB 4DXAB 2IJ0A 5FR3A 5H8YE 1S1QB 4I6NB 4B0EA 4HKQA 1XLNA 2BBCA 3DBHI 3AM9A 3W1SA 2X38A 2JZZA 1YJ1A 3IBEA 2W3RA 3I9V1 2W82A 1PQSA 3NVZA 3QJZA 3U4EG 4MSMB 3U2SC 3H7SA 4KDIC 2KJRA 1JQ4A 1QT9A 1BUIC 5TSSA 2M56B 4KZCA 2AL3A 1BMLC 2G4DB 1DYQA 2J0KA 3PPAA 2WXGA 1FXTB 4YXDB 1SXTA 2CJOA 1YN5A 1YQBA 5EDSA 1UWMA 3N3KB 1E90A 2LXCA 1MFWA 2EELA 2EMTA 3LJ3A 1BXTA 2RPQA 5G5GA 4DDGD 1MHHE 5C23A 4AJYB 3N1YC 2GMIC 3B0AA 3SHQA 3A4SC 1JROA 4NY0A 3ZUNA 1N6ZA 2QDFA 3FKYA 3R8BA 3KUDB 3N20C 1P7EA 4EZKA 1GC6A 4F7ZA 4HPLB 2QC8A 5D3DA 4XGAB 1N5XA 1YJJA 3AI5A 2KJ6A 4TQ0A 3A9KA 2TSSA 1WGKA 3P42A 1P98A 1YX6B 3ZO5B 5BYRA 4A3PA 3ZYYX 1PGAA 1UF0A 4GGQA 4WQOB 3P63A 3V05A 5D7GA 3H8HA 1YD8U 3WAPA 2C7MB 1ENFA 5D94A 1PGXA 4CQNA 1WXVA 3PZDA 3PRMB 2O6VD 2I1JA 1WXMA 3AXCA 3AEDB 4A3OA 1UELA 3BIID 4LTUA 1L0VB 5G5HA 4ARIA 4GB9A 3ZRCA 1I42A 3M3JA 2AEHA 1WH3A 4W9DA 5E6PA 4IWOA 2KX0A 1VRAB 2NPTA 5DPWA 1P0RA 2XEWA 2IO2B 2UWQA 1FRRA 3S2AA 1STEA 2RSUA 4CHKA 2FCNA 4DHJD 1SF0A 2C7NB 4US9A 1D4BA 4YSZB 2OOBB 4P6VF 1QLBB 2HTME 2PIAA 2D2QA 2KTRB 4HROA 2MQJA 3TSSA 4A55A 2LGXA 2OHFA 2QILA 4TKNA 2N7DA 1WX7A 1YQ4B 3RCZA 2JZPA 3GP7A 1R4MB 3ZXVA 2H88B 2ON8A 3J9CA 4N59A 3PREA 3NJTA 1E7UA 1QKZA 1GB1A 2BKRB 4GN1A 3RI7C 1QOFA 2BS2B 1TKYA 5KHOA 3APFA 2R61A 1OTRB 4CO7A 4JWUC 2WXQA 2BGFA 3RMKC 4AWJA 1XO3A 2M1MA 2KMCA 2BW2A 3SD5A 4TMAB 1J7AA 2GBRA 3PGEA 3PHXB 3TEXA 2CR5A 2J0JA 2DZJA 1WXAA 2EKEC 1SEBD 2WXRA 4YSXB 1IUEA 1NVID 3AEEB 2L00B 2K22A 3E9SA 1SJED 1ZDVA 2L32A 2SEBD 4WWNA 2LGSA 1FFUA 1WWTA 1UBQA 2G1EA 1AYFA 2PPHA 3ZJUA 3W1SC 2W55A 1XLPA 3ZVVA 3L17A 2RDGA 2IO1B 4FHKA 3LDZE 1V6EA 2LJIA 4IM2A 4OZBA 3Q8CA 2KN4A 4KKJA 2LRUA 1F1HA 4MGIE 4O1NA 3ZNHB 1LGRA 4ZRKA 2I2YA 1KJTA 4YT0B 2JPHA 3GE8C 2BWES 1FNVA 4BOZB 4OHJA 3DVNV 3L54A 2ZJDA 4AS1A 1D5XC 5DPTA 2RDBC 5HG2A 2MBBB 4WH4A 1QZEA 3A9KB 3N1XC 2KKCA 2C9WB 3VRBB 1XT9B 4JPSA 2G3QB 3ENEA 3R2TA 1D5MC 5HFYA 2XN9C 2L52A 2DBYA 1F2RC 3Q8FA 3ETRA 3SU8X 1T0QC 1E8WA 1Q5WB 5BMIA 4WJQA 4UDUC 3RNAC 1MG4A 2MP2A 2HJ1A 2AX5A 4W9FA 1UZXB 3QIJA 2BS4B 1F0ZA 3Q3MC 1RRBA 1KM7A 2ZVOA 2LGYA 3B9JA 3R3MA 4B95A 1WFYA 2V1YA 4US8A 1IGCA 3ZRFA 2NPTB 4M02A 1Y8RC 2IY0B 1GG3A 5C3JB 5FKAC 1WR1A 3RNEC 3H9DA 2E6XA 5AZGA 2B3AA 2WQYB 1DOYA 1RWSA 2I1KA 2DZMA 4E74A 4EOYA 5IAAC 3P4SB 2PVOD 5JZEB 3LXFA 3ZQ4A 2WDVB 3IG3A 4MELA 2KXJA 4XYCA 4AOFA 3JSVB 3BYYB 2AQ2B 1JALA 4B0MA 3VAWA 1HA5A 1TKEA 1FRDA 2G4SA 1YNTE 3BVGA 4KGTA 2V3PA 4LK0M 4NPNA 2ZEQA 3VXWA 1QILA 2MLBA 3P4RB 5C2TB 2WXKA 1MJDA 4DXFA 3CSTA 3IFWB 2WP9B 2WYQA 4BKSA 1UGJA 2HD5B 2N9KA 3UGBB 3FILA 4L2YA 1LM8B 2L7RA 1VDVA 3IAM1 5DCNA 2FUG1 4FXCA 3EC8A 5EE3A 1L5PA 1KH0A 1RYJA 4AP4C 2IPKD 1TJEA 1WXSA 3PV1A 4LDTB 2GBKA 2KDIA 2MWSB 3RN9C 3ONSA 4EEWA 4IWQA 3DWGC 2Z8LA 4JE3B 3T8MA 2L0TA 1C9FA 2KQSA 2KACA 4XE0A 2BKFA 3AE7B 1WXQA 2DENB 3E56A 3H6NA 3L4PA 4KV2A 3QK0A 1VD2A 3NUHB 4K81A 1TY2A 1FM0D 3V62A 4HXDA 1R4MI 3CMMB 2KANA 1FXAA 4IUMB 1C4AA 1VJKA 4DHJB 2LMCA 2HTHA 1WI0A 3IXSA 4C7YA 1T0YA 4KX6B 3M95A 3V60A 2AL6A 3I63C 4MGZE 1XD3B 3C0RB 1TT5B 1ZUD2 1JWAD 5BMHA 3P1MA 4HCNB 3VUYA 3ZTCA 2PVGC 4ZDVA 4G0NB 1E8YA 4HPMB 2ZVNA 2MEKA 4WWPA 3DHHC 3VH4B 3LYYA 2MJDA 4M01A 2LVPA 1H4RA 2BB6A 1V49A 3NVWA 4DXGA 2MJ3A 1UGMA 1HQRD 1YOVB 2MP2B 4AJWA 3RD2A 3AMZA 1JW9D 2V4IB 2FUHB 4HK2A 5BMGA 3P4QB 1NYRA 4B6WA 1ZE3D 1WZ0A 4OZCA 3U7DA 2B76B 1C1YB 2FE8A 1C4PA 1UUPA 1FXIA 2WXPA 4N6EB 3Q8AA 4WAAA 2NS5A 2D5GA 1XF5L 3VFKA 4WAFA 4LNNA 3VR9B 1DOXA 1WJ6A 2AQ1B 5IKCM 1TS4A 2IGDA 3PT2B 2KTRA 2Y3AA 4W9IA 1SGHA 2K0PA 4LNFA 4L1BA 4YTPB 1D5ZC 2W3SA 2KDBA 4KGSA 3SFDB 3JYUA 1PDXA 2ZZPB 3PLUA 2FNJB 4L23A 4HCPB 3DDCB 2G9HD 1ESFA 5L95C 2J52A 1V5TA 2Q5WD 4WJNA 5CHWA 1FO4A 1QOBA 3B2FA 3L16A 4DK5A 3NOBA 4DHZE 3DVGY 4XWTA 5CTRC 3FILB 4M0WA 4ACFA 4KIKA 2MW5A 4KKIA 1WR6E 4BVUC 2YEPF 4EFOA 3KYCD 4YSYB 1V86A 2BQQA 2DYBA 1OEYA 1UH6A 2CKHB 2PE9A 1IPGA 4DDID 4RM8A 2IYDB 1NDDA 1T0SC 5T8IA 1EUVB 3X0WA 1JWUD 3TEYA 1VLBA 3VTWA 4Q2JA 1I4GA 4TUUA 3U7ZA 1HTQA 1V80A 2D3GA 2JU6X 5D2MB 2GRIA 1R4NB 1JMLA 3RNGC 3ZNZB 3KUZA 1KFYB 3DWMA 1EM7A 4USAA 2V9HA 4N9F4 1V81A 3IAS1 3B08A 1Z2MA 1ZW7A 4I6PA 2JYTA 1KLUD 2V3SA 2BB5A 1EF1A 1ZXHA 1E8XA 1IP9A 4HVBA 2M8SA 5AUKA 2NVUI 4FN2A 3HUIA 1GJZA 1B1ZA 4P1BC 3MHSD 4HLEA 4WWMA 4RCOA 4W9JA 3R7QA 3X23A 3NS8A 1ZXIA 4OVZA 5LXIB 3TIXA 3SEBA 3MC8A 1N61A 2PMVA 2LXAA 3RNBC 5E6NA 2D3BA 2JF5A 4NAWA 3V3XA 3B1LX 1XXGA 1Z5SB 3DBSA 2W9NA 5BYSA 3ML8A 2EMSA 2VZKB 3GB1A 3Q8EA 2V3NA 1SE3A 3TJPA 2A4ZA 2XK5A 1XLQA 2MJEA 4HJGE 3DPDA 4HDQA 4GXBA 1AN8A 2WDTB 2IGGA 5LNK1 2KNBA 5H92C 2INNE 1TS5A 4XX5A 2FCSA 3RNFC 1L2NA 3V6CB 4BFRA 2WNMA 3JSVA 1T3QA 1ZKHA 3HHMA 2M17A 2NBWB 4E71A 3ZIMA 2RD0A 3DBLB 1QOAA 1YIWA 3HIZA 2JY6A 2KFJA 2EKIA 1PUTA 4ANUA 4MEMA 1D6EC 3K9PB 3P2BA 1MG8A 3KW5B 4YTNB 4C56C 4EKUA 4FJYA 3TCAA 1UBIA 1YN3A 1WE6A 1AW7A 1AWDA 4M8MA 4M0WB 4KIKB 3VHTC 3ABVB 4X57B 2N1WA 2CHWA 3EFUA 1SE9A 2M0AA 4M00A 3VUXA 1QQRA 2LUEA 4B9KA 3RT3B 1XCTL 2WX0A 2JXXA 3RZFA 5HHDG 5E6OA 2O6VA 4LNKA 1F9JA 1ZPSA 1TZOA 5KHQA 1RFKA 3AU4A 4A6QA 1YQ3B 2RMMA 2WHIA 1QOGA 3ZDTA 3O13A 3APCA 2JRHA 3T3OA 1E9MA 2M19A 3NZ3A 2K8HA 2KWUB 3OAWA 2KC1A 1FCCC 1SE2A 5AEKB 3AECB 1TIFA 1WSPA 4BOSC 1D3ZA 3C8YA 3W5VB 4D2KA 3BK1A 3AN1A 2D3CA 1XCQL 4P1CC 2QEJC 2ONQA 3AEFB 3R7RA 1TTNA 4ZRQA 1RLFA 2AWTA 3PSEB 2ZNVB 4BZAA 1FNUA 1E5WA 3K9OB 2GB1A 2WXFA 1TS3A 3CWIA 1HXYD 5LXHA 1TS2A 3RUIB 3O65B 2PJHA 4A90A 1KTKA 1NENB 1V5OA 5FK9C 3MHZA 3A1QA 4GOCA 5JHAA 3AV8A 4RGMA 2L0FA 2K6DB 1J7BA 3DQVA 2BTEA 2N0SB 1VCBA 1I4QA 2R2OA 4WWOA 1IGDA 1I4RA 2ZW1A 3HVZA 5J18A 4MH8A 2INPE 4NAWB 2XBBC 1R4NI 3AULA 4NJCA 1GNUA 2N7JA 2KX3A 4DHZB 2YLMA 2SAKA 3Q3OC 2NTSA 3PHWB 3AEGB 4YWGG 2ZNVC 2DZKA 5L83A 4BAXA 2NBUA 4BBNF 3DHIC 4YL8A 2V0GA 3HRDD 1FMAD 2XK5B 3WAMA 3RNCC 3R66C 4ZYNA 2KFKA 1T6BX 2K6QA 2LHEA 1KLGD 4K7SA 4FBJB 4PS3A 3U30A 2DLBA 3EECA 1MI0A 2RPVA 2HJ8A 1C77A 1P9DU 2MBQA 2WU5B 4MM3B 2KDMA 1OEYJ 1PFDA 3AE6B 3N1ZC 2QMTA 3A4RA 1V9JA 5MPOA 3AB5A 1WM2A 3MP9A 2D3AA 1L7YA 2J0MA 2LEKA 2J4XA 2LD9A 1WJ4A 3AE8B 4BKGA 5IN7A 1SIFA 2WXOA 3AE2B 1JWMD 3WA0A 4P16A 2AYOB 3PVLA 3QHTA 2BYTA 3KVFB 4XDCA 2KN5A 3NVYA 2REXA 1V8CA 4OVUA 2WDRB 1ZGUB 2RR9A 3A9JA 3GZNI 4ZOHC 3OJ4B 2KT7A 2RDHA 3H1UA 4K7WA 3IVFA 3M63B 1E7PB 1E8ZA 3UI3A 3BVZA 1GC7A 1JRPA 2GOWA 2J42A 3VDZA 1DGJA 4EZJA 2O6VB 1WGRA 4ANXA 3WALA 2NTTA 3DOWA 2MH7A 1ISNA 4NQKE 4NAMA 2IZVB 3OJ3A 1WIAA 5DPSA 2J7QB 1TGZB 3AE3B 5C1ZA 2OJWA 4GMVA 4RH6A 3ZNID 2J53A 2N4FA 4RNAA 4URKA 3D32A 1VR9A 1YJIA 3L0WB 3DBLI 2OEDA 2JRIB 3EFCA 4TQ1A 3DBRI 1RFAA 4II3B 2R2QA 4ARCA 2LVOA 4G11A 3EGRA 3UQAA 3QARA 1N63A 1IBXB 1B9RA 4ZYSA 2ZCBA 3KLSX 4A8XC 4JWSC 1U4AA 3MC9A 1TZ1A 4C7ZA 4RMAA 1R7SA 4KZ0A 3A1QB 3RZWC 2MA9B 2FBWB 1Q0WB 1SJHD 5D3IB 1WJUA 1YX5B 2ZPYA 5E6JA 5IOIA 3ZLZA 2WX1A 2INDC 1H8CA 4A20A 1EF5A 1XEEA 4EE2A 3DHGC 1JWSD 4ASWC 4II2B 1I35A 4IOIE 2WXJA 4KDLB 1WYGA 2VH2A 4IM3A 1E6EB 2C7HA 3L08A 2HDEA 3BZDB 4E3CA 2N1VA 3WIMA 2MBHA 3HM6X 2PLPA 3VTUA 2O2VA 2K9XA 4P7IA 2KFKB 4XDDA 1WGYA 3WCQA 4K3BA 4W9KA 2UYZB 1Y56A 2MCNB 1I4XA 1FNWA 1KRHA 4EZLA 4TSSA 4ICUA 4GDLA 4K3CA 3W1YA 1BT0A 3TL5A 5AUIA 3KQ4A 2WXLA 3KWLA 4NQLB 3ML9A 4CYEA 2MX2A 2KAJA 2KDFB 2WLBA 1J7CA 1ZOYB 3WAOA 3NHEB 2VRRB 1L4ZB 1L0YB 3VH3B 4GU2A 1P1AA 2KWVB 2DAFA 4G50A 1F77A 2K3UA 2KC2A 2LWPA 2JXTA 2DAJA 1L0XB 4YTMB 2LASA 4GSWA 1L6UA 3GS2A 1C4CA 5BO4B 1N62A 1ACCA 3FC4A 1V1PA 2L05A 2CHXA 4WURA 4F8CB 5G2NA 1NBFC 2K1FA 4ZRJA 1X1MA 4JLCA 4OZAA 3A9JB 1WX9A 2JX5A 2WS3B 4PS7A 4XWWA 1WF9A 2YEPB 1TBEA 1FIQA 2DYOA 4ANVA 1KOTA 4ICVA 2LUMA 3HM3A 1TYGB 3Q8BA 3Q3JA 4WIPA 2LFIA 2JQRB 4W9HA 1YN4A 4W9CA 3N9YC 1UWXA 2WXMA 1WY8A 2CU1A 4XZ4A 4IW0A 3GE3C 2QIEB 1HZ5A 1K50A 2DZIA 5AZHA 2IGHA 4RF1A 2NBVB 2PE6B 3AH7A 2VH1A 3CSFA 2DX5B 1LXDA 1EU4A 2CJNA 3HVDA 3W2DA 4AQ7A 4ZRIA 2KWDA 1K8RB 2GBJA 1EWCA 4PK1A 1TKGA 3U52E 4FADA 2MBOA 3MJ5A 4EUTA 5IP4D 4AUQC 3ZDMC 1LFDA 2JUOA 3W5UB 2PW9A 2GBMA 1E7VA 1DOIA 5LLIA 4JIOU 1Q1OA 4C4VB 1C79A 3L13A 4W9LA 4XC2A 2DNFA 2KVRA 1MPEA 1OFFA 3RFZB 4HWIB 5J17A 2MHJA 4HJKA 4LDTD 1G6JA 2C60A 2N9LA 4HEA1 2NMQA 3AE9B 4NNJB 5EE9A 1FFVA 3BINA 2KHWB 3NS1A 2N9PC 1WRIA 1HZ6A 2IDYA 4FULA 4MJSA 4DQOC 1C78A 2IO0B 1M4VA 3GZNB 1RAXA 3ZGZA 2L76A 1CQVA 2JYEA 1OQRA 1FEHA 2O2VB 3I57A 4H2AA 2KYWA 4MDKE 5CHVC 3H7PB 2KWCA 3NZSA 3NRZA 3ZTDA 5IO9A 3PZ8A 4GDLB 2I38A 3PS6A 2BVCA 4S0RA 2IY1B 1N60A 1TY0A 2X8XX 4MM3A 4LLGM 2OJRA 1WMHA 4NJ7A 4NJ6A 3Q2AC 4M8NA 3OG5A 2GI9A 4WQMA 5GMVA 1C3TA 2CS4A 3KH0A 1SBBB 1HTOA 3URYA 2L3ZA 3ECIA 3MFGA 2Z0EB 1A5RA 1E0ZA 2Y5BB 1KLVA 2K39A 4GLSC 3DBRB 1FCLA 4MGYE 3RYTA 3VR8B 3JW0X 4RGOS 2KOXA 3AU5A 1L4DB 2ZCCA 1WYWB 3AE4B 1V1PB 1V1OA 3DVGX 1MHXA 2PKOA 1UD7A 4OVVA 2ZW0A 2BYFA 4G3XB 2ASQA 1OQQA 3NVVA 1A70A 1S3SG 3EUB2 4LNOA 4C80A 3QQ8B 2QJLA 4ZRPA 1NI2A 1NYQA 1WGHA 3PZ7A 3TBLD 4FA6A 2AQ3B 3VTVA 2KMMA 1GUAB 4JL9A 4K1RB 2CU3A 4MGKE 4GIVA 2WWZA 3PTFC 1I4HA 2KK8A 5EE0A 2BYVE 2G45B 2FIDA 3IHPC 3MC0B 3ZXRA 5D6JB 1PGBA 3I3TB 4GDKA 1NEKB 2LVQA 3BVMA 2QHOA 1CMXB 4REZA 3Q6BA 1IBXA 3PO0A 2KZRA 3AE1B 2YVCA 4RGTA 4FLHA 3QAQA 2NCNA 3QWZB 2C5LC 5CHFA 2E3TA 3TEZA 2FAZA 4LJOB 4RF0A 3NY5A 1AARA 2JSVX 3DVNU 1GAQB 1J0GA 3CF6E 2MBEA 3V61A 3ZW3A 4IM0A 5HKHA 2JVCA 2BT6A 1KF6B 2K8CA 3EHVA 3UF8A 4BKSD 4S17A 3UIOB 2M4NA 3DCGA 1OGWA 1RM6C 1WZ3A 4MH0E 4ITKA 4RM9A 1XQQA 2ICIA 1FPYA 1QF6A 2MRPA 4K7UA 3UQBA
chains in the Genus database with same CATH topology
2A5UA 2DYBA 2KTRB 3UQAA 3QARA 1OEYA 3UIPB 4ANWA 3QCAA 1UH6A 1P3QU 2MQJA 2ZCBA 5IA7A 2CKHB 2PE9A 1IPGA 4DDID 4RM8A 2LGXA 3M62B 4J6IA 4MJSB 1U4AA 2IYDB 2KJHB 1NDDA 1TZ1A 2Z0DB 4RMAA 1EUVB 4TKNA 2N7DA 1WX7A 3RCZA 3N30A 4KZ0A 3X0WA 3VTWA 4TUUA 3A1QB 2BWFA 1M94A 3RZWC 3WANA 1V80A 5JHBA 2D3GA 5D2MB 2MA9B 3PREA 1Q0WB 5CX3A 1E7UA 2V4LA 2BKRB 4WJOA 3TMPB 1WJUA 5DPRA 1YX5B 2BYEA 4GN1A 2ZPYA 3ZNZB 3KUZA 2DHZA 3APDA 3QX1A 3ZLZA 2KD0A 3PRPB 2FIFA 1J19A 5KHOA 3APFA 4W9GA 2WX1A 1WRDB 4N9F4 2FCQA 1OTRB 2K25A 4CO7A 4A20A 1H8CA 1EF5A 2BGFA 1EO6A 1V81A 3B08A 1WMHB 4AWJA 1Z2MA 1ZW7A 3OLMD 2M1MA 1V2YA 2HE7A 2KMCA 2DYMA 2MSED 4I6PA 3KYDD 4ASWC 3SD5A 4II2B 2V3SA 1I35A 4WJPA 2GBRA 3PGEA 1EF1A 3PHXB 4KDLB 1E8XA 2CR5A 2J0JA 2DZJA 1WGGA 1IP9A 1WXAA 4HVBA 5JH5C 2EKEC 4IM3A 2M8SA 2C7HA 2NVUI 3L08A 4FN2A 1GJZA 2LRWA 2L00B 2D10A 3NZUA 4E3CA 2N1VA 4JQWC 4WWNA 2BPSA 3WIMA 2MBHA 3MHSD 4HLEA 3HM6X 2N9EB 2RGFA 3VTUA 2O2VA 4P7IA 2KFKB 1WJNA 1UBQA 1WGYA 2PPHA 3ZNGC 3W1SC 3HK0A 4W9JA 4W9KA 3R7QA 2UYZB 3X23A 3NS8A 2PEAA 2MCNB 3ZVVA 4EZLA 4BBNC 3L17A 4DWFA 5LXIB 4ICUA 3TIXA 2LI5A 2IO1B 4FHKA 4GDLA 3LDZE 1V6EA 2KLCA 4IM2A 2KMAA 4BKTA 1WM3A 2LXAA 3W1YA 1BT0A 5E6NA 3TL5A 1JRUA 2CHZA 2LRUA 2KQ7A 2JF5A 4HDOA 4NAWA 4MGIE 3B1LX 4W9EA 3ZKJC 3ZNHB 2L8JA 3N32A 4ZRKA 3U8ZA 5J2RA 1Z5SB 1KJTA 4NQLB 3ML9A 4CYEA 3DBSA 2MX2A 2W9NA 2JPHA 2KDFB 2BWES 3T9LA 4BOZB 3WAOA 3NHEB 1HE8A 2VRRB 3ML8A 3DVNV 3VH3B 3L54A 2ZJDA 4GU2A 2EMSA 1P1AA 5DPTA 1OQYA 2DAFA 2KWVB 2ZPNA 2K8BA 4G50A 1WGDA 2MBBB 2KC2A 2LWPA 2DAJA 2JT4B 4TV3A 3PRZA 1QZEA 2LASA 4LCDE 3A9KB 3TJPA 2KKCA 4GSWA 2C9WB 3SDLC 5BO4B 2A4ZA 1XT9B 2XK5A 3V6EB 2G3QB 3DPDA 3BY4B 4I6LB 3ENEA 4HDQA 4GXBA 4IG7B 2WDTB 4KVGB 2L05A 5FR6A 2CHXA 4GDKB 4LJPB 2KNBA 4F8CB 5G2NA 1NBFC 2K1FA 4ZRJA 1X1MA 3SU8X 3MJWA 4JLCA 2KDEB 3A9JB 4FJZA 1WX9A 4XX5A 2FCSA 2GBNA 1E8WA 4PS7A 1Q5WB 3V6CB 3PLVA 4WJQA 4BFRA 1L2NA 1WF9A 5AZFA 3JSVA 2MP2A 1ZKHA 3HHMA 2M17A 1TBEA 2NBWB 1WX8A 2DYOA 3L10B 4W9FA 1UZXB 4ANVA 4E71A 3ZIMA 2RD0A 1KOTA 4PYUA 3QIJA 2LGDA 4ICVA 4KSLC 3HM3A 4FJVB 3Q3JA 1YIWA 1RRBA 3HIZA 1KM7A 2ZVOA 2JY6A 2LGYA 2KFJA 2D07B 3R3MA 4W9HA 4ANUA 4MEMA 4W9CA 4B95A 1WFYA 2V1YA 3K9PB 3Q3FA 2JWZA 3P2BA 3ZRFA 2NPTB 1MG8A 3KW5B 4EKUA 4FJYA 1Y8RC 1WY8A 2CU1A 2IY0B 1UBIA 3TCAA 1IYFA 1GG3A 1WE6A 4XZ4A 4IW0A 1WR1A 4M8MA 4M0WB 3UINB 3H9DA 3QC8B 2IBIB 4KIKB 3VHTC 2DZIA 5AZHA 3ALBA 5AZGA 2B3AA 4X57B 2N1WA 2CHWA 3EFUA 1SE9A 2NBVB 2IO3B 4MSQB 1WE7A 2I1KA 2DZMA 3VUXA 2PE6B 4E74A 4EOYA 5IAAC 3CSFA 4IC7B 2D11A 2LUEA 2DX5B 5JZEB 1LXDA 4B9KA 5G55A 3RT3B 3KUCB 4KSKC 2WX0A 2JXXA 4ZRIA 1K8RB 3IG3A 3RZFA 2GBJA 4MELA 2KXJA 5E6OA 3VUWA 4AOFA 3JSVB 4DBGA 1J8CA 2KO3A 2NR2A 2O6VA 4FADA 2MBOA 2Z59B 4EUTA 2N9XA 1F9JA 3VAWA 5KHQA 4FHJA 2FCMA 3MTNB 3ZDMC 1LFDA 3AU4A 2G4SA 4AUQC 2JUOA 2LJ5A 4NPNA 2GBMA 3VVWB 2ZEQA 1E7VA 3H7PA 3VXWA 2N7EA 2MLBA 3RULA 5LLIA 4JIOU 1Q1OA 3ZDTA 3APCA 3L13A 2JRHA 3CSTA 3IFWB 4W9LA 4XC2A 2K8HA 2WYQA 2KWUB 3OAWA 4IWPA 2KC1A 2KVRA 4BKSA 5AEKB 2HD5B 3QA8A 4BOSC 1D3ZA 3UGBB 2JZ3B 4F1SA 1LM8B 2L7RA 2KLGA 4HWIB 3JVZX 5J17A 4HJKA 4PYZA 5TR5A 5DCNA 2M0XA 3EC8A 4LDTD 1G6JA 2C60A 4NNJB 2BF8B 4AP4C 3BINA 2KHWB 2KTFA 4LDTB 1WXSA 2N9PC 3PV1A 4PS8A 2GBKA 3R7RA 2KDIA 1TTNA 2MWSB 3A33B 1RLFA 2AWTA 2LZ6A 4JGHB 3PSEB 2ZNVB 1LQBA 1E5WA 3ONSA 4EEWA 3GOEA 3K9OB 4IWQA 4FULA 4MJSA 2IO0B 3VQIA 3T8MA 5LXHA 3RUIB 3O65B 2L0TA 2PJHA 1V5OA 1RAXA 4DXAB 2L76A 2KQSA 1S1QB 4I6NB 2O2VB 3DBHI 3A1QA 2BKFA 3W1SA 4GOCA 2DENB 4MDKE 5JHAA 5CHVC 2JZZA 3H6NA 3H7PB 1YJ1A 3IBEA 2KWCA 2L0FA 3NZSA 2K6DB 3DQVA 3ZTDA 1VCBA 4KV2A 1PQSA 2R2OA 3QK0A 1VD2A 4GDLB 4WWOA 3QJZA 4K81A 3PS6A 4MSMB 2IY1B 3V62A 5J18A 4HXDA 1R4MI 3CMMB 3H7SA 4KDIC 4MM3A 4NAWB 2KANA 2KJRA 4IUMB 2OJRA 1WMHA 4NJ7A 4NJ6A 4DHJB 2XBBC 4M8NA 1R4NI 2HTHA 5GMVA 1C3TA 3AULA 1GNUA 2CS4A 2KX3A 1WI0A 3KH0A 4DHZB 2YLMA 4KZCA 2L3ZA 1T0YA 3ECIA 2Z0EB 1A5RA 1KLVA 2Y5BB 3PHWB 2AL3A 3M95A 2K39A 3V60A 2ZNVC 2DZKA 5L83A 2AL6A 4MGZE 1XD3B 3C0RB 4MGYE 2G4DB 2J0KA 3PPAA 3RYTA 3JW0X 2NBUA 4BBNF 2KOXA 3AU5A 4YL8A 4HCNB 3VUYA 2ZCCA 3ZTCA 2XK5B 4ZDVA 3WAMA 1FXTB 4G0NB 3R66C 1E8YA 4ZYNA 1WYWB 2KFKA 4HPMB 2ZVNA 2K6QA 3DVGX 4WWPA 1YQBA 1UD7A 4OVVA 3N3KB 4K7SA 3VH4B 5EDSA 1E90A 2LVPA 2LXCA 1H4RA 1V49A 2EMTA 4FBJB 3LJ3A 4PS3A 2RPQA 3U30A 3EECA 2BYFA 4DDGD 2HJ8A 5C23A 4G3XB 4AJYB 2ASQA 1UGMA 1P9DU 2GMIC 2MBQA 3B0AA 3SHQA 2MP2B 3A4SC 4AJWA 1OEYJ 4NY0A 3RD2A 1S3SG 3ZUNA 3A4RA 1V9JA 3QQ8B 2FUHB 3KUDB 1NI2A 1WM2A 1WGHA 4EZKA 3TBLD 4HK2A 1GC6A 4FA6A 1L7YA 3VTVA 2J0MA 4B6WA 1WZ0A 2LD9A 3U7DA 1GUAB 4F7ZA 4HPLB 4JL9A 4K1RB 1C1YB 3AI5A 4MGKE 4GIVA 1WJ4A 2WWZA 3PTFC 2KJ6A 2KK8A 4BKGA 2BYVE 1SIFA 4TQ0A 3WA0A 3A9KA 2G45B 4WAAA 1P98A 1YX6B 2AYOB 3ZO5B 3PVLA 2NS5A 3QHTA 4A3PA 2FIDA 3VFKA 3IHPC 3KVFB 2KN5A 5D6JB 3I3TB 1WJ6A 4GGQA 4GDKA 4WQOB 2REXA 5D7GA 4OVUA 2LVQA 1ZGUB 1YD8U 2RR9A 3A9JA 3PT2B 2QHOA 3WAPA 2KTRA 1CMXB 2C7MB 3GZNI 5D94A 2KZRA 3OJ4B 4W9IA 1SGHA 3H1UA 1WXVA 2YVCA 3IVFA 3M63B 3PZDA 1E8ZA 4K7WA 4FLHA 3PRMB 1GC7A 3QAQA 2NCNA 3QWZB 2GOWA 2C5LC 2KDBA 3VDZA 2O6VD 5CHFA 2I1JA 1WXMA 3AXCA 3JYUA 4EZJA 4A3OA 1UELA 2FAZA 2O6VB 4LJOB 1WGRA 3NY5A 1AARA 4ANXA 2ZZPB 3DVNU 3PLUA 3DOWA 3WALA 2FNJB 1J0GA 1ISNA 3CF6E 4NQKE 2MBEA 2IZVB 3OJ3A 1WIAA 4HCPB 3DDCB 3V61A 4GB9A 3ZW3A 5L95C 5DPSA 3ZRCA 4IM0A 1I42A 5HKHA 1V5TA 2J7QB 3M3JA 4WJNA 1TGZB 5CHWA 2JVCA 2AEHA 1WH3A 4W9DA 5E6PA 2K8CA 4IWOA 2KX0A 3EHVA 5C1ZA 3L16A 4GMVA 2NPTA 3UF8A 1P0RA 3ZNID 4BKSD 5DPWA 2N4FA 4URKA 2XEWA 4DK5A 2IO2B 2UWQA 3D32A 3S2AA 3NOBA 3L0WB 2RSUA 4DHZE 3DVGY 3UIOB 3DBLI 4CHKA 2M4NA 2FCNA 3DCGA 1OGWA 5CTRC 4DHJD 2JRIB 1WZ3A 2C7NB 4MH0E 4KIKA 2MW5A 4TQ1A 4RM9A 1WR6E 1XQQA 3DBRI 1RFAA 4II3B 2OOBB 4BVUC 4EFOA 2MRPA 2R2QA 3KYCD 4K7UA 2LVOA 1V86A 2D2QA 3UQBA 4G11A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A5U A;  2DYB A;  2KTR B;  3UQA A;  3QAR A;  1OEY A;  3UIP B;  4ANW A;  3QCA A;  1UH6 A;  1P3Q U;  2MQJ A;  2ZCB A;  5IA7 A;  2CKH B;  2PE9 A;  1IPG A;  4DDI D;  4RM8 A;  2LGX A;  3M62 B;  4J6I A;  4MJS B;  1U4A A;  2IYD B;  2KJH B;  1NDD A;  1TZ1 A;  2Z0D B;  4RMA A;  1EUV B;  4TKN A;  2N7D A;  1WX7 A;  3RCZ A;  3N30 A;  4KZ0 A;  3X0W A;  3VTW A;  4TUU A;  3A1Q B;  2BWF A;  1M94 A;  3RZW C;  3WAN A;  1V80 A;  5JHB A;  2D3G A;  5D2M B;  2MA9 B;  3PRE A;  1Q0W B;  5CX3 A;  1E7U A;  2V4L A;  2BKR B;  4WJO A;  3TMP B;  1WJU A;  5DPR A;  1YX5 B;  2BYE A;  4GN1 A;  2ZPY A;  3ZNZ B;  3KUZ A;  2DHZ A;  3APD A;  3QX1 A;  3ZLZ A;  2KD0 A;  3PRP B;  2FIF A;  1J19 A;  5KHO A;  3APF A;  4W9G A;  2WX1 A;  1WRD B;  4N9F 4;  2FCQ A;  1OTR B;  2K25 A;  4CO7 A;  4A20 A;  1H8C A;  1EF5 A;  2BGF A;  1EO6 A;  1V81 A;  3B08 A;  1WMH B;  4AWJ A;  1Z2M A;  1ZW7 A;  3OLM D;  2M1M A;  1V2Y A;  2HE7 A;  2KMC A;  2DYM A;  2MSE D;  4I6P A;  3KYD D;  4ASW C;  3SD5 A;  4II2 B;  2V3S A;  1I35 A;  4WJP A;  2GBR A;  3PGE A;  1EF1 A;  3PHX B;  4KDL B;  1E8X A;  2CR5 A;  2J0J A;  2DZJ A;  1WGG A;  1IP9 A;  1WXA A;  4HVB A;  5JH5 C;  2EKE C;  4IM3 A;  2M8S A;  2C7H A;  2NVU I;  3L08 A;  4FN2 A;  1GJZ A;  2LRW A;  2L00 B;  2D10 A;  3NZU A;  4E3C A;  2N1V A;  4JQW C;  4WWN A;  2BPS A;  3WIM A;  2MBH A;  3MHS D;  4HLE A;  3HM6 X;  2N9E B;  2RGF A;  3VTU A;  2O2V A;  4P7I A;  2KFK B;  1WJN A;  1UBQ A;  1WGY A;  2PPH A;  3ZNG C;  3W1S C;  3HK0 A;  4W9J A;  4W9K A;  3R7Q A;  2UYZ B;  3X23 A;  3NS8 A;  2PEA A;  2MCN B;  3ZVV A;  4EZL A;  4BBN C;  3L17 A;  4DWF A;  5LXI B;  4ICU A;  3TIX A;  2LI5 A;  2IO1 B;  4FHK A;  4GDL A;  3LDZ E;  1V6E A;  2KLC A;  4IM2 A;  2KMA A;  4BKT A;  1WM3 A;  2LXA A;  3W1Y A;  1BT0 A;  5E6N A;  3TL5 A;  1JRU A;  2CHZ A;  2LRU A;  2KQ7 A;  2JF5 A;  4HDO A;  4NAW A;  4MGI E;  3B1L X;  4W9E A;  3ZKJ C;  3ZNH B;  2L8J A;  3N32 A;  4ZRK A;  3U8Z A;  5J2R A;  1Z5S B;  1KJT A;  4NQL B;  3ML9 A;  4CYE A;  3DBS A;  2MX2 A;  2W9N A;  2JPH A;  2KDF B;  2BWE S;  3T9L A;  4BOZ B;  3WAO A;  3NHE B;  1HE8 A;  2VRR B;  3ML8 A;  3DVN V;  3VH3 B;  3L54 A;  2ZJD A;  4GU2 A;  2EMS A;  1P1A A;  5DPT A;  1OQY A;  2DAF A;  2KWV B;  2ZPN A;  2K8B A;  4G50 A;  1WGD A;  2MBB B;  2KC2 A;  2LWP A;  2DAJ A;  2JT4 B;  4TV3 A;  3PRZ A;  1QZE A;  2LAS A;  4LCD E;  3A9K B;  3TJP A;  2KKC A;  4GSW A;  2C9W B;  3SDL C;  5BO4 B;  2A4Z A;  1XT9 B;  2XK5 A;  3V6E B;  2G3Q B;  3DPD A;  3BY4 B;  4I6L B;  3ENE A;  4HDQ A;  4GXB A;  4IG7 B;  2WDT B;  4KVG B;  2L05 A;  5FR6 A;  2CHX A;  4GDK B;  4LJP B;  2KNB A;  4F8C B;  5G2N A;  1NBF C;  2K1F A;  4ZRJ A;  1X1M A;  3SU8 X;  3MJW A;  4JLC A;  2KDE B;  3A9J B;  4FJZ A;  1WX9 A;  4XX5 A;  2FCS A;  2GBN A;  1E8W A;  4PS7 A;  1Q5W B;  3V6C B;  3PLV A;  4WJQ A;  4BFR A;  1L2N A;  1WF9 A;  5AZF A;  3JSV A;  2MP2 A;  1ZKH A;  3HHM A;  2M17 A;  1TBE A;  2NBW B;  1WX8 A;  2DYO A;  3L10 B;  4W9F A;  1UZX B;  4ANV A;  4E71 A;  3ZIM A;  2RD0 A;  1KOT A;  4PYU A;  3QIJ A;  2LGD A;  4ICV A;  4KSL C;  3HM3 A;  4FJV B;  3Q3J A;  1YIW A;  1RRB A;  3HIZ A;  1KM7 A;  2ZVO A;  2JY6 A;  2LGY A;  2KFJ A;  2D07 B;  3R3M A;  4W9H A;  4ANU A;  4MEM A;  4W9C A;  4B95 A;  1WFY A;  2V1Y A;  3K9P B;  3Q3F A;  2JWZ A;  3P2B A;  3ZRF A;  2NPT B;  1MG8 A;  3KW5 B;  4EKU A;  4FJY A;  1Y8R C;  1WY8 A;  2CU1 A;  2IY0 B;  1UBI A;  3TCA A;  1IYF A;  1GG3 A;  1WE6 A;  4XZ4 A;  4IW0 A;  1WR1 A;  4M8M A;  4M0W B;  3UIN B;  3H9D A;  3QC8 B;  2IBI B;  4KIK B;  3VHT C;  2DZI A;  5AZH A;  3ALB A;  5AZG A;  2B3A A;  4X57 B;  2N1W A;  2CHW A;  3EFU A;  1SE9 A;  2NBV B;  2IO3 B;  4MSQ B;  1WE7 A;  2I1K A;  2DZM A;  3VUX A;  2PE6 B;  4E74 A;  4EOY A;  5IAA C;  3CSF A;  4IC7 B;  2D11 A;  2LUE A;  2DX5 B;  5JZE B;  1LXD A;  4B9K A;  5G55 A;  3RT3 B;  3KUC B;  4KSK C;  2WX0 A;  2JXX A;  4ZRI A;  1K8R B;  3IG3 A;  3RZF A;  2GBJ A;  4MEL A;  2KXJ A;  5E6O A;  3VUW A;  4AOF A;  3JSV B;  4DBG A;  1J8C A;  2KO3 A;  2NR2 A;  2O6V A;  4FAD A;  2MBO A;  2Z59 B;  4EUT A;  2N9X A;  1F9J A;  3VAW A;  5KHQ A;  4FHJ A;  2FCM A;  3MTN B;  3ZDM C;  1LFD A;  3AU4 A;  2G4S A;  4AUQ C;  2JUO A;  2LJ5 A;  4NPN A;  2GBM A;  3VVW B;  2ZEQ A;  1E7V A;  3H7P A;  3VXW A;  2N7E A;  2MLB A;  3RUL A;  5LLI A;  4JIO U;  1Q1O A;  3ZDT A;  3APC A;  3L13 A;  2JRH A;  3CST A;  3IFW B;  4W9L A;  4XC2 A;  2K8H A;  2WYQ A;  2KWU B;  3OAW A;  4IWP A;  2KC1 A;  2KVR A;  4BKS A;  5AEK B;  2HD5 B;  3QA8 A;  4BOS C;  1D3Z A;  3UGB B;  2JZ3 B;  4F1S A;  1LM8 B;  2L7R A;  2KLG A;  4HWI B;  3JVZ X;  5J17 A;  4HJK A;  4PYZ A;  5TR5 A;  5DCN A;  2M0X A;  3EC8 A;  4LDT D;  1G6J A;  2C60 A;  4NNJ B;  2BF8 B;  4AP4 C;  3BIN A;  2KHW B;  2KTF A;  4LDT B;  1WXS A;  2N9P C;  3PV1 A;  4PS8 A;  2GBK A;  3R7R A;  2KDI A;  1TTN A;  2MWS B;  3A33 B;  1RLF A;  2AWT A;  2LZ6 A;  4JGH B;  3PSE B;  2ZNV B;  1LQB A;  1E5W A;  3ONS A;  4EEW A;  3GOE A;  3K9O B;  4IWQ A;  4FUL A;  4MJS A;  2IO0 B;  3VQI A;  3T8M A;  5LXH A;  3RUI B;  3O65 B;  2L0T A;  2PJH A;  1V5O A;  1RAX A;  4DXA B;  2L76 A;  2KQS A;  1S1Q B;  4I6N B;  2O2V B;  3DBH I;  3A1Q A;  2BKF A;  3W1S A;  4GOC A;  2DEN B;  4MDK E;  5JHA A;  5CHV C;  2JZZ A;  3H6N A;  3H7P B;  1YJ1 A;  3IBE A;  2KWC A;  2L0F A;  3NZS A;  2K6D B;  3DQV A;  3ZTD A;  1VCB A;  4KV2 A;  1PQS A;  2R2O A;  3QK0 A;  1VD2 A;  4GDL B;  4WWO A;  3QJZ A;  4K81 A;  3PS6 A;  4MSM B;  2IY1 B;  3V62 A;  5J18 A;  4HXD A;  1R4M I;  3CMM B;  3H7S A;  4KDI C;  4MM3 A;  4NAW B;  2KAN A;  2KJR A;  4IUM B;  2OJR A;  1WMH A;  4NJ7 A;  4NJ6 A;  4DHJ B;  2XBB C;  4M8N A;  1R4N I;  2HTH A;  5GMV A;  1C3T A;  3AUL A;  1GNU A;  2CS4 A;  2KX3 A;  1WI0 A;  3KH0 A;  4DHZ B;  2YLM A;  4KZC A;  2L3Z A;  1T0Y A;  3ECI A;  2Z0E B;  1A5R A;  1KLV A;  2Y5B B;  3PHW B;  2AL3 A;  3M95 A;  2K39 A;  3V60 A;  2ZNV C;  2DZK A;  5L83 A;  2AL6 A;  4MGZ E;  1XD3 B;  3C0R B;  4MGY E;  2G4D B;  2J0K A;  3PPA A;  3RYT A;  3JW0 X;  2NBU A;  4BBN F;  2KOX A;  3AU5 A;  4YL8 A;  4HCN B;  3VUY A;  2ZCC A;  3ZTC A;  2XK5 B;  4ZDV A;  3WAM A;  1FXT B;  4G0N B;  3R66 C;  1E8Y A;  4ZYN A;  1WYW B;  2KFK A;  4HPM B;  2ZVN A;  2K6Q A;  3DVG X;  4WWP A;  1YQB A;  1UD7 A;  4OVV A;  3N3K B;  4K7S A;  3VH4 B;  5EDS A;  1E90 A;  2LVP A;  2LXC A;  1H4R A;  1V49 A;  2EMT A;  4FBJ B;  3LJ3 A;  4PS3 A;  2RPQ A;  3U30 A;  3EEC A;  2BYF A;  4DDG D;  2HJ8 A;  5C23 A;  4G3X B;  4AJY B;  2ASQ A;  1UGM A;  1P9D U;  2GMI C;  2MBQ A;  3B0A A;  3SHQ A;  2MP2 B;  3A4S C;  4AJW A;  1OEY J;  4NY0 A;  3RD2 A;  1S3S G;  3ZUN A;  3A4R A;  1V9J A;  3QQ8 B;  2FUH B;  3KUD B;  1NI2 A;  1WM2 A;  1WGH A;  4EZK A;  3TBL D;  4HK2 A;  1GC6 A;  4FA6 A;  1L7Y A;  3VTV A;  2J0M A;  4B6W A;  1WZ0 A;  2LD9 A;  3U7D A;  1GUA B;  4F7Z A;  4HPL B;  4JL9 A;  4K1R B;  1C1Y B;  3AI5 A;  4MGK E;  4GIV A;  1WJ4 A;  2WWZ A;  3PTF C;  2KJ6 A;  2KK8 A;  4BKG A;  2BYV E;  1SIF A;  4TQ0 A;  3WA0 A;  3A9K A;  2G45 B;  4WAA A;  1P98 A;  1YX6 B;  2AYO B;  3ZO5 B;  3PVL A;  2NS5 A;  3QHT A;  4A3P A;  2FID A;  3VFK A;  3IHP C;  3KVF B;  2KN5 A;  5D6J B;  3I3T B;  1WJ6 A;  4GGQ A;  4GDK A;  4WQO B;  2REX A;  5D7G A;  4OVU A;  2LVQ A;  1ZGU B;  1YD8 U;  2RR9 A;  3A9J A;  3PT2 B;  2QHO A;  3WAP A;  2KTR A;  1CMX B;  2C7M B;  3GZN I;  5D94 A;  2KZR A;  3OJ4 B;  4W9I A;  1SGH A;  3H1U A;  1WXV A;  2YVC A;  3IVF A;  3M63 B;  3PZD A;  1E8Z A;  4K7W A;  4FLH A;  3PRM B;  1GC7 A;  3QAQ A;  2NCN A;  3QWZ B;  2GOW A;  2C5L C;  2KDB A;  3VDZ A;  2O6V D;  5CHF A;  2I1J A;  1WXM A;  3AXC A;  3JYU A;  4EZJ A;  4A3O A;  1UEL A;  2FAZ A;  2O6V B;  4LJO B;  1WGR A;  3NY5 A;  1AAR A;  4ANX A;  2ZZP B;  3DVN U;  3PLU A;  3DOW A;  3WAL A;  2FNJ B;  1J0G A;  1ISN A;  3CF6 E;  4NQK E;  2MBE A;  2IZV B;  3OJ3 A;  1WIA A;  4HCP B;  3DDC B;  3V61 A;  4GB9 A;  3ZW3 A;  5L95 C;  5DPS A;  3ZRC A;  4IM0 A;  1I42 A;  5HKH A;  1V5T A;  2J7Q B;  3M3J A;  4WJN A;  1TGZ B;  5CHW A;  2JVC A;  2AEH A;  1WH3 A;  4W9D A;  5E6P A;  2K8C A;  4IWO A;  2KX0 A;  3EHV A;  5C1Z A;  3L16 A;  4GMV A;  2NPT A;  3UF8 A;  1P0R A;  3ZNI D;  4BKS D;  5DPW A;  2N4F A;  4URK A;  2XEW A;  4DK5 A;  2IO2 B;  2UWQ A;  3D32 A;  3S2A A;  3NOB A;  3L0W B;  2RSU A;  4DHZ E;  3DVG Y;  3UIO B;  3DBL I;  4CHK A;  2M4N A;  2FCN A;  3DCG A;  1OGW A;  5CTR C;  4DHJ D;  2JRI B;  1WZ3 A;  2C7N B;  4MH0 E;  4KIK A;  2MW5 A;  4TQ1 A;  4RM9 A;  1WR6 E;  1XQQ A;  3DBR I;  1RFA A;  4II3 B;  2OOB B;  4BVU C;  4EFO A;  2MRP A;  2R2Q A;  3KYC D;  4K7U A;  2LVO A;  1V86 A;  2D2Q A;  3UQB A;  4G11 A; 
#chains in the Genus database with same CATH topology
 3DBH B;  2A5U A;  4JX1 C;  2L83 A;  3UIP B;  4ANW A;  3QCA A;  1P3Q U;  3R2I A;  1FD6 A;  5IA7 A;  1YMH E;  3M62 B;  4J6I A;  4MJS B;  2JWU A;  2KJH B;  2XNA C;  2PTL A;  2Z0D B;  3SR6 A;  3N30 A;  1E10 A;  3Q3N C;  2BWF A;  1P7F A;  1M94 A;  3WAN A;  5JHB A;  1L6V A;  2LGI A;  5CX3 A;  2V4L A;  4WJO A;  3TMP B;  2K5P A;  2WU2 B;  5DPR A;  2BYE A;  1XLO A;  1K53 A;  2DHZ A;  3APD A;  3QX1 A;  1C76 A;  2KD0 A;  3PRP B;  2FIF A;  1J19 A;  2QCZ A;  4W9G A;  1WRD B;  1Q10 A;  2FCQ A;  2K25 A;  2INC C;  1EO6 A;  1WMH B;  2Y5C A;  3OLM D;  1V2Y A;  2HE7 A;  2MSE D;  2DYM A;  3KYD D;  4MT5 A;  3LB8 C;  4LNI A;  4IKG A;  1I4P A;  4WJP A;  1WGG A;  5BYQ A;  2DWQ A;  1I7H A;  5JH5 C;  4ZHP A;  1SE4 A;  2GLS A;  2UU7 A;  1K52 A;  1EWY C;  2LRW A;  2D10 A;  4A9A A;  3NZU A;  4JQW C;  2BPS A;  2ACZ B;  2N9E B;  2RGF A;  4KGR A;  1VZ8 A;  4RFB A;  1WJN A;  3IT6 B;  3ZNG C;  3HK0 A;  1SB3 C;  2PEA A;  2LHD A;  1MVK A;  4BBN C;  4DWF A;  2LI5 A;  2L1A A;  2KLC A;  1UNS A;  4J3O D;  2KMA A;  1GB4 A;  4BKT A;  1WM3 A;  1SIJ A;  2WXI A;  1JRU A;  2CHZ A;  3NG0 A;  2KQ7 A;  1GPX A;  4HDO A;  1NI3 A;  4W9E A;  3ZKJ C;  2L8J A;  3N32 A;  3U8Z A;  5J2R A;  3Q14 C;  4MAC A;  1CJE A;  1JCK B;  5JXV A;  3T9L A;  1T0R C;  1HE8 A;  3RPF C;  2VZK D;  1SSN A;  3CIR B;  3FAH A;  1PYW D;  3P4P B;  1OQY A;  2ZPN A;  3SFE B;  2K8B A;  1WGD A;  1T5X D;  2JT4 B;  3BK2 A;  4TV3 A;  3PRZ A;  4LCD E;  4PT5 A;  3SDL C;  4HPP A;  3BWU D;  4OW0 A;  3TUO A;  1N5W A;  3V6E B;  4I6L B;  3BY4 B;  2KVZ A;  4HKZ E;  4IG7 B;  4KVG B;  5FR6 A;  4GDK B;  4LJP B;  3MJW A;  2KDE B;  4FJZ A;  2GBN A;  1ZP0 B;  3I5J C;  3T3N A;  2H89 B;  3PLV A;  5AZF A;  1F52 A;  4ZHO A;  1ET6 A;  1WX8 A;  3L10 B;  3AEB B;  4PYU A;  2LGD A;  1ET9 A;  4KSL C;  5GXG B;  4FJV B;  2WXH A;  2W54 A;  3B2G A;  2KQ4 X;  4HRS A;  4C4V A;  2Y5P A;  2D07 B;  2WXN A;  3C19 A;  3Q3F A;  3OWE B;  2BS3 B;  2JWZ A;  1IYF A;  4NZL B;  1ROE A;  3UIN B;  3QC8 B;  2QSD A;  2IBI B;  3ALB A;  3W9C B;  3KWV A;  3TEW A;  4MSQ B;  2IO3 B;  1WE7 A;  3ZJV A;  4C00 A;  4QAY A;  4IC7 B;  2D11 A;  3EA6 A;  1K51 A;  2WDQ B;  5G55 A;  3KUC B;  4KSK C;  1JWB D;  4RGN A;  3VUW A;  4DBG A;  1J8C A;  2KO3 A;  2NR2 A;  1ZDX A;  1F2R I;  2Z59 B;  1HEZ E;  2N9X A;  4FHJ A;  2FCM A;  3MTN B;  1CK1 A;  2LJ5 A;  5EE1 A;  1GOZ A;  4R3D A;  3VVW B;  3AE5 B;  3H7P A;  2N7E A;  3RUL A;  5I4D A;  3IT4 B;  1EU3 A;  5HI1 A;  4IWP A;  1V97 A;  3VRA B;  3QA8 A;  1VZ7 A;  3ZJT A;  2JZ3 B;  4IDI A;  4F1S A;  2KLG A;  4N58 A;  3JVZ X;  4PYZ A;  5TR5 A;  2M0X A;  1CZP A;  2BF8 B;  2KTF A;  4PS8 A;  3A33 B;  3BYT B;  2LZ6 A;  1LO5 D;  4JGH B;  1VZ6 A;  1LQB A;  2WGS A;  3GOE A;  3Q69 A;  3VQI A;  3AEA B;  4DXA B;  2IJ0 A;  5FR3 A;  5H8Y E;  1S1Q B;  4I6N B;  4B0E A;  4HKQ A;  1XLN A;  2BBC A;  3DBH I;  3AM9 A;  3W1S A;  2X38 A;  2JZZ A;  1YJ1 A;  3IBE A;  2W3R A;  3I9V 1;  2W82 A;  1PQS A;  3NVZ A;  3QJZ A;  3U4E G;  4MSM B;  3U2S C;  3H7S A;  4KDI C;  2KJR A;  1JQ4 A;  1QT9 A;  1BUI C;  5TSS A;  2M56 B;  4KZC A;  2AL3 A;  1BML C;  2G4D B;  1DYQ A;  2J0K A;  3PPA A;  2WXG A;  1FXT B;  4YXD B;  1SXT A;  2CJO A;  1YN5 A;  1YQB A;  5EDS A;  1UWM A;  3N3K B;  1E90 A;  2LXC A;  1MFW A;  2EEL A;  2EMT A;  3LJ3 A;  1BXT A;  2RPQ A;  5G5G A;  4DDG D;  1MHH E;  5C23 A;  4AJY B;  3N1Y C;  2GMI C;  3B0A A;  3SHQ A;  3A4S C;  1JRO A;  4NY0 A;  3ZUN A;  1N6Z A;  2QDF A;  3FKY A;  3R8B A;  3KUD B;  3N20 C;  1P7E A;  4EZK A;  1GC6 A;  4F7Z A;  4HPL B;  2QC8 A;  5D3D A;  4XGA B;  1N5X A;  1YJJ A;  3AI5 A;  2KJ6 A;  4TQ0 A;  3A9K A;  2TSS A;  1WGK A;  3P42 A;  1P98 A;  1YX6 B;  3ZO5 B;  5BYR A;  4A3P A;  3ZYY X;  1PGA A;  1UF0 A;  4GGQ A;  4WQO B;  3P63 A;  3V05 A;  5D7G A;  3H8H A;  1YD8 U;  3WAP A;  2C7M B;  1ENF A;  5D94 A;  1PGX A;  4CQN A;  1WXV A;  3PZD A;  3PRM B;  2O6V D;  2I1J A;  1WXM A;  3AXC A;  3AED B;  4A3O A;  1UEL A;  3BII D;  4LTU A;  1L0V B;  5G5H A;  4ARI A;  4GB9 A;  3ZRC A;  1I42 A;  3M3J A;  2AEH A;  1WH3 A;  4W9D A;  5E6P A;  4IWO A;  2KX0 A;  1VRA B;  2NPT A;  5DPW A;  1P0R A;  2XEW A;  2IO2 B;  2UWQ A;  1FRR A;  3S2A A;  1STE A;  2RSU A;  4CHK A;  2FCN A;  4DHJ D;  1SF0 A;  2C7N B;  4US9 A;  1D4B A;  4YSZ B;  2OOB B;  4P6V F;  1QLB B;  2HTM E;  2PIA A;  2D2Q A;  2KTR B;  4HRO A;  2MQJ A;  3TSS A;  4A55 A;  2LGX A;  2OHF A;  2QIL A;  4TKN A;  2N7D A;  1WX7 A;  1YQ4 B;  3RCZ A;  2JZP A;  3GP7 A;  1R4M B;  3ZXV A;  2H88 B;  2ON8 A;  3J9C A;  4N59 A;  3PRE A;  3NJT A;  1E7U A;  1QKZ A;  1GB1 A;  2BKR B;  4GN1 A;  3RI7 C;  1QOF A;  2BS2 B;  1TKY A;  5KHO A;  3APF A;  2R61 A;  1OTR B;  4CO7 A;  4JWU C;  2WXQ A;  2BGF A;  3RMK C;  4AWJ A;  1XO3 A;  2M1M A;  2KMC A;  2BW2 A;  3SD5 A;  4TMA B;  1J7A A;  2GBR A;  3PGE A;  3PHX B;  3TEX A;  2CR5 A;  2J0J A;  2DZJ A;  1WXA A;  2EKE C;  1SEB D;  2WXR A;  4YSX B;  1IUE A;  1NVI D;  3AEE B;  2L00 B;  2K22 A;  3E9S A;  1SJE D;  1ZDV A;  2L32 A;  2SEB D;  4WWN A;  2LGS A;  1FFU A;  1WWT A;  1UBQ A;  2G1E A;  1AYF A;  2PPH A;  3ZJU A;  3W1S C;  2W55 A;  1XLP A;  3ZVV A;  3L17 A;  2RDG A;  2IO1 B;  4FHK A;  3LDZ E;  1V6E A;  2LJI A;  4IM2 A;  4OZB A;  3Q8C A;  2KN4 A;  4KKJ A;  2LRU A;  1F1H A;  4MGI E;  4O1N A;  3ZNH B;  1LGR A;  4ZRK A;  2I2Y A;  1KJT A;  4YT0 B;  2JPH A;  3GE8 C;  2BWE S;  1FNV A;  4BOZ B;  4OHJ A;  3DVN V;  3L54 A;  2ZJD A;  4AS1 A;  1D5X C;  5DPT A;  2RDB C;  5HG2 A;  2MBB B;  4WH4 A;  1QZE A;  3A9K B;  3N1X C;  2KKC A;  2C9W B;  3VRB B;  1XT9 B;  4JPS A;  2G3Q B;  3ENE A;  3R2T A;  1D5M C;  5HFY A;  2XN9 C;  2L52 A;  2DBY A;  1F2R C;  3Q8F A;  3ETR A;  3SU8 X;  1T0Q C;  1E8W A;  1Q5W B;  5BMI A;  4WJQ A;  4UDU C;  3RNA C;  1MG4 A;  2MP2 A;  2HJ1 A;  2AX5 A;  4W9F A;  1UZX B;  3QIJ A;  2BS4 B;  1F0Z A;  3Q3M C;  1RRB A;  1KM7 A;  2ZVO A;  2LGY A;  3B9J A;  3R3M A;  4B95 A;  1WFY A;  2V1Y A;  4US8 A;  1IGC A;  3ZRF A;  2NPT B;  4M02 A;  1Y8R C;  2IY0 B;  1GG3 A;  5C3J B;  5FKA C;  1WR1 A;  3RNE C;  3H9D A;  2E6X A;  5AZG A;  2B3A A;  2WQY B;  1DOY A;  1RWS A;  2I1K A;  2DZM A;  4E74 A;  4EOY A;  5IAA C;  3P4S B;  2PVO D;  5JZE B;  3LXF A;  3ZQ4 A;  2WDV B;  3IG3 A;  4MEL A;  2KXJ A;  4XYC A;  4AOF A;  3JSV B;  3BYY B;  2AQ2 B;  1JAL A;  4B0M A;  3VAW A;  1HA5 A;  1TKE A;  1FRD A;  2G4S A;  1YNT E;  3BVG A;  4KGT A;  2V3P A;  4LK0 M;  4NPN A;  2ZEQ A;  3VXW A;  1QIL A;  2MLB A;  3P4R B;  5C2T B;  2WXK A;  1MJD A;  4DXF A;  3CST A;  3IFW B;  2WP9 B;  2WYQ A;  4BKS A;  1UGJ A;  2HD5 B;  2N9K A;  3UGB B;  3FIL A;  4L2Y A;  1LM8 B;  2L7R A;  1VDV A;  3IAM 1;  5DCN A;  2FUG 1;  4FXC A;  3EC8 A;  5EE3 A;  1L5P A;  1KH0 A;  1RYJ A;  4AP4 C;  2IPK D;  1TJE A;  1WXS A;  3PV1 A;  4LDT B;  2GBK A;  2KDI A;  2MWS B;  3RN9 C;  3ONS A;  4EEW A;  4IWQ A;  3DWG C;  2Z8L A;  4JE3 B;  3T8M A;  2L0T A;  1C9F A;  2KQS A;  2KAC A;  4XE0 A;  2BKF A;  3AE7 B;  1WXQ A;  2DEN B;  3E56 A;  3H6N A;  3L4P A;  4KV2 A;  3QK0 A;  1VD2 A;  3NUH B;  4K81 A;  1TY2 A;  1FM0 D;  3V62 A;  4HXD A;  1R4M I;  3CMM B;  2KAN A;  1FXA A;  4IUM B;  1C4A A;  1VJK A;  4DHJ B;  2LMC A;  2HTH A;  1WI0 A;  3IXS A;  4C7Y A;  1T0Y A;  4KX6 B;  3M95 A;  3V60 A;  2AL6 A;  3I63 C;  4MGZ E;  1XD3 B;  3C0R B;  1TT5 B;  1ZUD 2;  1JWA D;  5BMH A;  3P1M A;  4HCN B;  3VUY A;  3ZTC A;  2PVG C;  4ZDV A;  4G0N B;  1E8Y A;  4HPM B;  2ZVN A;  2MEK A;  4WWP A;  3DHH C;  3VH4 B;  3LYY A;  2MJD A;  4M01 A;  2LVP A;  1H4R A;  2BB6 A;  1V49 A;  3NVW A;  4DXG A;  2MJ3 A;  1UGM A;  1HQR D;  1YOV B;  2MP2 B;  4AJW A;  3RD2 A;  3AMZ A;  1JW9 D;  2V4I B;  2FUH B;  4HK2 A;  5BMG A;  3P4Q B;  1NYR A;  4B6W A;  1ZE3 D;  1WZ0 A;  4OZC A;  3U7D A;  2B76 B;  1C1Y B;  2FE8 A;  1C4P A;  1UUP A;  1FXI A;  2WXP A;  4N6E B;  3Q8A A;  4WAA A;  2NS5 A;  2D5G A;  1XF5 L;  3VFK A;  4WAF A;  4LNN A;  3VR9 B;  1DOX A;  1WJ6 A;  2AQ1 B;  5IKC M;  1TS4 A;  2IGD A;  3PT2 B;  2KTR A;  2Y3A A;  4W9I A;  1SGH A;  2K0P A;  4LNF A;  4L1B A;  4YTP B;  1D5Z C;  2W3S A;  2KDB A;  4KGS A;  3SFD B;  3JYU A;  1PDX A;  2ZZP B;  3PLU A;  2FNJ B;  4L23 A;  4HCP B;  3DDC B;  2G9H D;  1ESF A;  5L95 C;  2J52 A;  1V5T A;  2Q5W D;  4WJN A;  5CHW A;  1FO4 A;  1QOB A;  3B2F A;  3L16 A;  4DK5 A;  3NOB A;  4DHZ E;  3DVG Y;  4XWT A;  5CTR C;  3FIL B;  4M0W A;  4ACF A;  4KIK A;  2MW5 A;  4KKI A;  1WR6 E;  4BVU C;  2YEP F;  4EFO A;  3KYC D;  4YSY B;  1V86 A;  2BQQ A;  2DYB A;  1OEY A;  1UH6 A;  2CKH B;  2PE9 A;  1IPG A;  4DDI D;  4RM8 A;  2IYD B;  1NDD A;  1T0S C;  5T8I A;  1EUV B;  3X0W A;  1JWU D;  3TEY A;  1VLB A;  3VTW A;  4Q2J A;  1I4G A;  4TUU A;  3U7Z A;  1HTQ A;  1V80 A;  2D3G A;  2JU6 X;  5D2M B;  2GRI A;  1R4N B;  1JML A;  3RNG C;  3ZNZ B;  3KUZ A;  1KFY B;  3DWM A;  1EM7 A;  4USA A;  2V9H A;  4N9F 4;  1V81 A;  3IAS 1;  3B08 A;  1Z2M A;  1ZW7 A;  4I6P A;  2JYT A;  1KLU D;  2V3S A;  2BB5 A;  1EF1 A;  1ZXH A;  1E8X A;  1IP9 A;  4HVB A;  2M8S A;  5AUK A;  2NVU I;  4FN2 A;  3HUI A;  1GJZ A;  1B1Z A;  4P1B C;  3MHS D;  4HLE A;  4WWM A;  4RCO A;  4W9J A;  3R7Q A;  3X23 A;  3NS8 A;  1ZXI A;  4OVZ A;  5LXI B;  3TIX A;  3SEB A;  3MC8 A;  1N61 A;  2PMV A;  2LXA A;  3RNB C;  5E6N A;  2D3B A;  2JF5 A;  4NAW A;  3V3X A;  3B1L X;  1XXG A;  1Z5S B;  3DBS A;  2W9N A;  5BYS A;  3ML8 A;  2EMS A;  2VZK B;  3GB1 A;  3Q8E A;  2V3N A;  1SE3 A;  3TJP A;  2A4Z A;  2XK5 A;  1XLQ A;  2MJE A;  4HJG E;  3DPD A;  4HDQ A;  4GXB A;  1AN8 A;  2WDT B;  2IGG A;  5LNK 1;  2KNB A;  5H92 C;  2INN E;  1TS5 A;  4XX5 A;  2FCS A;  3RNF C;  1L2N A;  3V6C B;  4BFR A;  2WNM A;  3JSV A;  1T3Q A;  1ZKH A;  3HHM A;  2M17 A;  2NBW B;  4E71 A;  3ZIM A;  2RD0 A;  3DBL B;  1QOA A;  1YIW A;  3HIZ A;  2JY6 A;  2KFJ A;  2EKI A;  1PUT A;  4ANU A;  4MEM A;  1D6E C;  3K9P B;  3P2B A;  1MG8 A;  3KW5 B;  4YTN B;  4C56 C;  4EKU A;  4FJY A;  3TCA A;  1UBI A;  1YN3 A;  1WE6 A;  1AW7 A;  1AWD A;  4M8M A;  4M0W B;  4KIK B;  3VHT C;  3ABV B;  4X57 B;  2N1W A;  2CHW A;  3EFU A;  1SE9 A;  2M0A A;  4M00 A;  3VUX A;  1QQR A;  2LUE A;  4B9K A;  3RT3 B;  1XCT L;  2WX0 A;  2JXX A;  3RZF A;  5HHD G;  5E6O A;  2O6V A;  4LNK A;  1F9J A;  1ZPS A;  1TZO A;  5KHQ A;  1RFK A;  3AU4 A;  4A6Q A;  1YQ3 B;  2RMM A;  2WHI A;  1QOG A;  3ZDT A;  3O13 A;  3APC A;  2JRH A;  3T3O A;  1E9M A;  2M19 A;  3NZ3 A;  2K8H A;  2KWU B;  3OAW A;  2KC1 A;  1FCC C;  1SE2 A;  5AEK B;  3AEC B;  1TIF A;  1WSP A;  4BOS C;  1D3Z A;  3C8Y A;  3W5V B;  4D2K A;  3BK1 A;  3AN1 A;  2D3C A;  1XCQ L;  4P1C C;  2QEJ C;  2ONQ A;  3AEF B;  3R7R A;  1TTN A;  4ZRQ A;  1RLF A;  2AWT A;  3PSE B;  2ZNV B;  4BZA A;  1FNU A;  1E5W A;  3K9O B;  2GB1 A;  2WXF A;  1TS3 A;  3CWI A;  1HXY D;  5LXH A;  1TS2 A;  3RUI B;  3O65 B;  2PJH A;  4A90 A;  1KTK A;  1NEN B;  1V5O A;  5FK9 C;  3MHZ A;  3A1Q A;  4GOC A;  5JHA A;  3AV8 A;  4RGM A;  2L0F A;  2K6D B;  1J7B A;  3DQV A;  2BTE A;  2N0S B;  1VCB A;  1I4Q A;  2R2O A;  4WWO A;  1IGD A;  1I4R A;  2ZW1 A;  3HVZ A;  5J18 A;  4MH8 A;  2INP E;  4NAW B;  2XBB C;  1R4N I;  3AUL A;  4NJC A;  1GNU A;  2N7J A;  2KX3 A;  4DHZ B;  2YLM A;  2SAK A;  3Q3O C;  2NTS A;  3PHW B;  3AEG B;  4YWG G;  2ZNV C;  2DZK A;  5L83 A;  4BAX A;  2NBU A;  4BBN F;  3DHI C;  4YL8 A;  2V0G A;  3HRD D;  1FMA D;  2XK5 B;  3WAM A;  3RNC C;  3R66 C;  4ZYN A;  2KFK A;  1T6B X;  2K6Q A;  2LHE A;  1KLG D;  4K7S A;  4FBJ B;  4PS3 A;  3U30 A;  2DLB A;  3EEC A;  1MI0 A;  2RPV A;  2HJ8 A;  1C77 A;  1P9D U;  2MBQ A;  2WU5 B;  4MM3 B;  2KDM A;  1OEY J;  1PFD A;  3AE6 B;  3N1Z C;  2QMT A;  3A4R A;  1V9J A;  5MPO A;  3AB5 A;  1WM2 A;  3MP9 A;  2D3A A;  1L7Y A;  2J0M A;  2LEK A;  2J4X A;  2LD9 A;  1WJ4 A;  3AE8 B;  4BKG A;  5IN7 A;  1SIF A;  2WXO A;  3AE2 B;  1JWM D;  3WA0 A;  4P16 A;  2AYO B;  3PVL A;  3QHT A;  2BYT A;  3KVF B;  4XDC A;  2KN5 A;  3NVY A;  2REX A;  1V8C A;  4OVU A;  2WDR B;  1ZGU B;  2RR9 A;  3A9J A;  3GZN I;  4ZOH C;  3OJ4 B;  2KT7 A;  2RDH A;  3H1U A;  4K7W A;  3IVF A;  3M63 B;  1E7P B;  1E8Z A;  3UI3 A;  3BVZ A;  1GC7 A;  1JRP A;  2GOW A;  2J42 A;  3VDZ A;  1DGJ A;  4EZJ A;  2O6V B;  1WGR A;  4ANX A;  3WAL A;  2NTT A;  3DOW A;  2MH7 A;  1ISN A;  4NQK E;  4NAM A;  2IZV B;  3OJ3 A;  1WIA A;  5DPS A;  2J7Q B;  1TGZ B;  3AE3 B;  5C1Z A;  2OJW A;  4GMV A;  4RH6 A;  3ZNI D;  2J53 A;  2N4F A;  4RNA A;  4URK A;  3D32 A;  1VR9 A;  1YJI A;  3L0W B;  3DBL I;  2OED A;  2JRI B;  3EFC A;  4TQ1 A;  3DBR I;  1RFA A;  4II3 B;  2R2Q A;  4ARC A;  2LVO A;  4G11 A;  3EGR A;  3UQA A;  3QAR A;  1N63 A;  1IBX B;  1B9R A;  4ZYS A;  2ZCB A;  3KLS X;  4A8X C;  4JWS C;  1U4A A;  3MC9 A;  1TZ1 A;  4C7Z A;  4RMA A;  1R7S A;  4KZ0 A;  3A1Q B;  3RZW C;  2MA9 B;  2FBW B;  1Q0W B;  1SJH D;  5D3I B;  1WJU A;  1YX5 B;  2ZPY A;  5E6J A;  5IOI A;  3ZLZ A;  2WX1 A;  2IND C;  1H8C A;  4A20 A;  1EF5 A;  1XEE A;  4EE2 A;  3DHG C;  1JWS D;  4ASW C;  4II2 B;  1I35 A;  4IOI E;  2WXJ A;  4KDL B;  1WYG A;  2VH2 A;  4IM3 A;  1E6E B;  2C7H A;  3L08 A;  2HDE A;  3BZD B;  4E3C A;  2N1V A;  3WIM A;  2MBH A;  3HM6 X;  2PLP A;  3VTU A;  2O2V A;  2K9X A;  4P7I A;  2KFK B;  4XDD A;  1WGY A;  3WCQ A;  4K3B A;  4W9K A;  2UYZ B;  1Y56 A;  2MCN B;  1I4X A;  1FNW A;  1KRH A;  4EZL A;  4TSS A;  4ICU A;  4GDL A;  4K3C A;  3W1Y A;  1BT0 A;  3TL5 A;  5AUI A;  3KQ4 A;  2WXL A;  3KWL A;  4NQL B;  3ML9 A;  4CYE A;  2MX2 A;  2KAJ A;  2KDF B;  2WLB A;  1J7C A;  1ZOY B;  3WAO A;  3NHE B;  2VRR B;  1L4Z B;  1L0Y B;  3VH3 B;  4GU2 A;  1P1A A;  2KWV B;  2DAF A;  4G50 A;  1F77 A;  2K3U A;  2KC2 A;  2LWP A;  2JXT A;  2DAJ A;  1L0X B;  4YTM B;  2LAS A;  4GSW A;  1L6U A;  3GS2 A;  1C4C A;  5BO4 B;  1N62 A;  1ACC A;  3FC4 A;  1V1P A;  2L05 A;  2CHX A;  4WUR A;  4F8C B;  5G2N A;  1NBF C;  2K1F A;  4ZRJ A;  1X1M A;  4JLC A;  4OZA A;  3A9J B;  1WX9 A;  2JX5 A;  2WS3 B;  4PS7 A;  4XWW A;  1WF9 A;  2YEP B;  1TBE A;  1FIQ A;  2DYO A;  4ANV A;  1KOT A;  4ICV A;  2LUM A;  3HM3 A;  1TYG B;  3Q8B A;  3Q3J A;  4WIP A;  2LFI A;  2JQR B;  4W9H A;  1YN4 A;  4W9C A;  3N9Y C;  1UWX A;  2WXM A;  1WY8 A;  2CU1 A;  4XZ4 A;  4IW0 A;  3GE3 C;  2QIE B;  1HZ5 A;  1K50 A;  2DZI A;  5AZH A;  2IGH A;  4RF1 A;  2NBV B;  2PE6 B;  3AH7 A;  2VH1 A;  3CSF A;  2DX5 B;  1LXD A;  1EU4 A;  2CJN A;  3HVD A;  3W2D A;  4AQ7 A;  4ZRI A;  2KWD A;  1K8R B;  2GBJ A;  1EWC A;  4PK1 A;  1TKG A;  3U52 E;  4FAD A;  2MBO A;  3MJ5 A;  4EUT A;  5IP4 D;  4AUQ C;  3ZDM C;  1LFD A;  2JUO A;  3W5U B;  2PW9 A;  2GBM A;  1E7V A;  1DOI A;  5LLI A;  4JIO U;  1Q1O A;  4C4V B;  1C79 A;  3L13 A;  4W9L A;  4XC2 A;  2DNF A;  2KVR A;  1MPE A;  1OFF A;  3RFZ B;  4HWI B;  5J17 A;  2MHJ A;  4HJK A;  4LDT D;  1G6J A;  2C60 A;  2N9L A;  4HEA 1;  2NMQ A;  3AE9 B;  4NNJ B;  5EE9 A;  1FFV A;  3BIN A;  2KHW B;  3NS1 A;  2N9P C;  1WRI A;  1HZ6 A;  2IDY A;  4FUL A;  4MJS A;  4DQO C;  1C78 A;  2IO0 B;  1M4V A;  3GZN B;  1RAX A;  3ZGZ A;  2L76 A;  1CQV A;  2JYE A;  1OQR A;  1FEH A;  2O2V B;  3I57 A;  4H2A A;  2KYW A;  4MDK E;  5CHV C;  3H7P B;  2KWC A;  3NZS A;  3NRZ A;  3ZTD A;  5IO9 A;  3PZ8 A;  4GDL B;  2I38 A;  3PS6 A;  2BVC A;  4S0R A;  2IY1 B;  1N60 A;  1TY0 A;  2X8X X;  4MM3 A;  4LLG M;  2OJR A;  1WMH A;  4NJ7 A;  4NJ6 A;  3Q2A C;  4M8N A;  3OG5 A;  2GI9 A;  4WQM A;  5GMV A;  1C3T A;  2CS4 A;  3KH0 A;  1SBB B;  1HTO A;  3URY A;  2L3Z A;  3ECI A;  3MFG A;  2Z0E B;  1A5R A;  1E0Z A;  2Y5B B;  1KLV A;  2K39 A;  4GLS C;  3DBR B;  1FCL A;  4MGY E;  3RYT A;  3VR8 B;  3JW0 X;  4RGO S;  2KOX A;  3AU5 A;  1L4D B;  2ZCC A;  1WYW B;  3AE4 B;  1V1P B;  1V1O A;  3DVG X;  1MHX A;  2PKO A;  1UD7 A;  4OVV A;  2ZW0 A;  2BYF A;  4G3X B;  2ASQ A;  1OQQ A;  3NVV A;  1A70 A;  1S3S G;  3EUB 2;  4LNO A;  4C80 A;  3QQ8 B;  2QJL A;  4ZRP A;  1NI2 A;  1NYQ A;  1WGH A;  3PZ7 A;  3TBL D;  4FA6 A;  2AQ3 B;  3VTV A;  2KMM A;  1GUA B;  4JL9 A;  4K1R B;  2CU3 A;  4MGK E;  4GIV A;  2WWZ A;  3PTF C;  1I4H A;  2KK8 A;  5EE0 A;  2BYV E;  2G45 B;  2FID A;  3IHP C;  3MC0 B;  3ZXR A;  5D6J B;  1PGB A;  3I3T B;  4GDK A;  1NEK B;  2LVQ A;  3BVM A;  2QHO A;  1CMX B;  4REZ A;  3Q6B A;  1IBX A;  3PO0 A;  2KZR A;  3AE1 B;  2YVC A;  4RGT A;  4FLH A;  3QAQ A;  2NCN A;  3QWZ B;  2C5L C;  5CHF A;  2E3T A;  3TEZ A;  2FAZ A;  4LJO B;  4RF0 A;  3NY5 A;  1AAR A;  2JSV X;  3DVN U;  1GAQ B;  1J0G A;  3CF6 E;  2MBE A;  3V61 A;  3ZW3 A;  4IM0 A;  5HKH A;  2JVC A;  2BT6 A;  1KF6 B;  2K8C A;  3EHV A;  3UF8 A;  4BKS D;  4S17 A;  3UIO B;  2M4N A;  3DCG A;  1OGW A;  1RM6 C;  1WZ3 A;  4MH0 E;  4ITK A;  4RM9 A;  1XQQ A;  2ICI A;  1FPY A;  1QF6 A;  2MRP A;  4K7U A;  3UQB A; 
#chains in the Genus database with same CATH homology
 2A5U A;  2DYB A;  2KTR B;  3UQA A;  3QAR A;  1OEY A;  3UIP B;  4ANW A;  3QCA A;  1UH6 A;  1P3Q U;  2MQJ A;  2ZCB A;  5IA7 A;  2CKH B;  2PE9 A;  1IPG A;  4DDI D;  4RM8 A;  2LGX A;  3M62 B;  4J6I A;  4MJS B;  1U4A A;  2IYD B;  2KJH B;  1NDD A;  1TZ1 A;  2Z0D B;  4RMA A;  1EUV B;  4TKN A;  2N7D A;  1WX7 A;  3RCZ A;  3N30 A;  4KZ0 A;  3X0W A;  3VTW A;  4TUU A;  3A1Q B;  2BWF A;  1M94 A;  3RZW C;  3WAN A;  1V80 A;  5JHB A;  2D3G A;  5D2M B;  2MA9 B;  3PRE A;  1Q0W B;  5CX3 A;  1E7U A;  2V4L A;  2BKR B;  4WJO A;  3TMP B;  1WJU A;  5DPR A;  1YX5 B;  2BYE A;  4GN1 A;  2ZPY A;  3ZNZ B;  3KUZ A;  2DHZ A;  3APD A;  3QX1 A;  3ZLZ A;  2KD0 A;  3PRP B;  2FIF A;  1J19 A;  5KHO A;  3APF A;  4W9G A;  2WX1 A;  1WRD B;  4N9F 4;  2FCQ A;  1OTR B;  2K25 A;  4CO7 A;  4A20 A;  1H8C A;  1EF5 A;  2BGF A;  1EO6 A;  1V81 A;  3B08 A;  1WMH B;  4AWJ A;  1Z2M A;  1ZW7 A;  3OLM D;  2M1M A;  1V2Y A;  2HE7 A;  2KMC A;  2DYM A;  2MSE D;  4I6P A;  3KYD D;  4ASW C;  3SD5 A;  4II2 B;  2V3S A;  1I35 A;  4WJP A;  2GBR A;  3PGE A;  1EF1 A;  3PHX B;  4KDL B;  1E8X A;  2CR5 A;  2J0J A;  2DZJ A;  1WGG A;  1IP9 A;  1WXA A;  4HVB A;  5JH5 C;  2EKE C;  4IM3 A;  2M8S A;  2C7H A;  2NVU I;  3L08 A;  4FN2 A;  1GJZ A;  2LRW A;  2L00 B;  2D10 A;  3NZU A;  4E3C A;  2N1V A;  4JQW C;  4WWN A;  2BPS A;  3WIM A;  2MBH A;  3MHS D;  4HLE A;  3HM6 X;  2N9E B;  2RGF A;  3VTU A;  2O2V A;  4P7I A;  2KFK B;  1WJN A;  1UBQ A;  1WGY A;  2PPH A;  3ZNG C;  3W1S C;  3HK0 A;  4W9J A;  4W9K A;  3R7Q A;  2UYZ B;  3X23 A;  3NS8 A;  2PEA A;  2MCN B;  3ZVV A;  4EZL A;  4BBN C;  3L17 A;  4DWF A;  5LXI B;  4ICU A;  3TIX A;  2LI5 A;  2IO1 B;  4FHK A;  4GDL A;  3LDZ E;  1V6E A;  2KLC A;  4IM2 A;  2KMA A;  4BKT A;  1WM3 A;  2LXA A;  3W1Y A;  1BT0 A;  5E6N A;  3TL5 A;  1JRU A;  2CHZ A;  2LRU A;  2KQ7 A;  2JF5 A;  4HDO A;  4NAW A;  4MGI E;  3B1L X;  4W9E A;  3ZKJ C;  3ZNH B;  2L8J A;  3N32 A;  4ZRK A;  3U8Z A;  5J2R A;  1Z5S B;  1KJT A;  4NQL B;  3ML9 A;  4CYE A;  3DBS A;  2MX2 A;  2W9N A;  2JPH A;  2KDF B;  2BWE S;  3T9L A;  4BOZ B;  3WAO A;  3NHE B;  1HE8 A;  2VRR B;  3ML8 A;  3DVN V;  3VH3 B;  3L54 A;  2ZJD A;  4GU2 A;  2EMS A;  1P1A A;  5DPT A;  1OQY A;  2DAF A;  2KWV B;  2ZPN A;  2K8B A;  4G50 A;  1WGD A;  2MBB B;  2KC2 A;  2LWP A;  2DAJ A;  2JT4 B;  4TV3 A;  3PRZ A;  1QZE A;  2LAS A;  4LCD E;  3A9K B;  3TJP A;  2KKC A;  4GSW A;  2C9W B;  3SDL C;  5BO4 B;  2A4Z A;  1XT9 B;  2XK5 A;  3V6E B;  2G3Q B;  3DPD A;  3BY4 B;  4I6L B;  3ENE A;  4HDQ A;  4GXB A;  4IG7 B;  2WDT B;  4KVG B;  2L05 A;  5FR6 A;  2CHX A;  4GDK B;  4LJP B;  2KNB A;  4F8C B;  5G2N A;  1NBF C;  2K1F A;  4ZRJ A;  1X1M A;  3SU8 X;  3MJW A;  4JLC A;  2KDE B;  3A9J B;  4FJZ A;  1WX9 A;  4XX5 A;  2FCS A;  2GBN A;  1E8W A;  4PS7 A;  1Q5W B;  3V6C B;  3PLV A;  4WJQ A;  4BFR A;  1L2N A;  1WF9 A;  5AZF A;  3JSV A;  2MP2 A;  1ZKH A;  3HHM A;  2M17 A;  1TBE A;  2NBW B;  1WX8 A;  2DYO A;  3L10 B;  4W9F A;  1UZX B;  4ANV A;  4E71 A;  3ZIM A;  2RD0 A;  1KOT A;  4PYU A;  3QIJ A;  2LGD A;  4ICV A;  4KSL C;  3HM3 A;  4FJV B;  3Q3J A;  1YIW A;  1RRB A;  3HIZ A;  1KM7 A;  2ZVO A;  2JY6 A;  2LGY A;  2KFJ A;  2D07 B;  3R3M A;  4W9H A;  4ANU A;  4MEM A;  4W9C A;  4B95 A;  1WFY A;  2V1Y A;  3K9P B;  3Q3F A;  2JWZ A;  3P2B A;  3ZRF A;  2NPT B;  1MG8 A;  3KW5 B;  4EKU A;  4FJY A;  1Y8R C;  1WY8 A;  2CU1 A;  2IY0 B;  1UBI A;  3TCA A;  1IYF A;  1GG3 A;  1WE6 A;  4XZ4 A;  4IW0 A;  1WR1 A;  4M8M A;  4M0W B;  3UIN B;  3H9D A;  3QC8 B;  2IBI B;  4KIK B;  3VHT C;  2DZI A;  5AZH A;  3ALB A;  5AZG A;  2B3A A;  4X57 B;  2N1W A;  2CHW A;  3EFU A;  1SE9 A;  2NBV B;  2IO3 B;  4MSQ B;  1WE7 A;  2I1K A;  2DZM A;  3VUX A;  2PE6 B;  4E74 A;  4EOY A;  5IAA C;  3CSF A;  4IC7 B;  2D11 A;  2LUE A;  2DX5 B;  5JZE B;  1LXD A;  4B9K A;  5G55 A;  3RT3 B;  3KUC B;  4KSK C;  2WX0 A;  2JXX A;  4ZRI A;  1K8R B;  3IG3 A;  3RZF A;  2GBJ A;  4MEL A;  2KXJ A;  5E6O A;  3VUW A;  4AOF A;  3JSV B;  4DBG A;  1J8C A;  2KO3 A;  2NR2 A;  2O6V A;  4FAD A;  2MBO A;  2Z59 B;  4EUT A;  2N9X A;  1F9J A;  3VAW A;  5KHQ A;  4FHJ A;  2FCM A;  3MTN B;  3ZDM C;  1LFD A;  3AU4 A;  2G4S A;  4AUQ C;  2JUO A;  2LJ5 A;  4NPN A;  2GBM A;  3VVW B;  2ZEQ A;  1E7V A;  3H7P A;  3VXW A;  2N7E A;  2MLB A;  3RUL A;  5LLI A;  4JIO U;  1Q1O A;  3ZDT A;  3APC A;  3L13 A;  2JRH A;  3CST A;  3IFW B;  4W9L A;  4XC2 A;  2K8H A;  2WYQ A;  2KWU B;  3OAW A;  4IWP A;  2KC1 A;  2KVR A;  4BKS A;  5AEK B;  2HD5 B;  3QA8 A;  4BOS C;  1D3Z A;  3UGB B;  2JZ3 B;  4F1S A;  1LM8 B;  2L7R A;  2KLG A;  4HWI B;  3JVZ X;  5J17 A;  4HJK A;  4PYZ A;  5TR5 A;  5DCN A;  2M0X A;  3EC8 A;  4LDT D;  1G6J A;  2C60 A;  4NNJ B;  2BF8 B;  4AP4 C;  3BIN A;  2KHW B;  2KTF A;  4LDT B;  1WXS A;  2N9P C;  3PV1 A;  4PS8 A;  2GBK A;  3R7R A;  2KDI A;  1TTN A;  2MWS B;  3A33 B;  1RLF A;  2AWT A;  2LZ6 A;  4JGH B;  3PSE B;  2ZNV B;  1LQB A;  1E5W A;  3ONS A;  4EEW A;  3GOE A;  3K9O B;  4IWQ A;  4FUL A;  4MJS A;  2IO0 B;  3VQI A;  3T8M A;  5LXH A;  3RUI B;  3O65 B;  2L0T A;  2PJH A;  1V5O A;  1RAX A;  4DXA B;  2L76 A;  2KQS A;  1S1Q B;  4I6N B;  2O2V B;  3DBH I;  3A1Q A;  2BKF A;  3W1S A;  4GOC A;  2DEN B;  4MDK E;  5JHA A;  5CHV C;  2JZZ A;  3H6N A;  3H7P B;  1YJ1 A;  3IBE A;  2KWC A;  2L0F A;  3NZS A;  2K6D B;  3DQV A;  3ZTD A;  1VCB A;  4KV2 A;  1PQS A;  2R2O A;  3QK0 A;  1VD2 A;  4GDL B;  4WWO A;  3QJZ A;  4K81 A;  3PS6 A;  4MSM B;  2IY1 B;  3V62 A;  5J18 A;  4HXD A;  1R4M I;  3CMM B;  3H7S A;  4KDI C;  4MM3 A;  4NAW B;  2KAN A;  2KJR A;  4IUM B;  2OJR A;  1WMH A;  4NJ7 A;  4NJ6 A;  4DHJ B;  2XBB C;  4M8N A;  1R4N I;  2HTH A;  5GMV A;  1C3T A;  3AUL A;  1GNU A;  2CS4 A;  2KX3 A;  1WI0 A;  3KH0 A;  4DHZ B;  2YLM A;  4KZC A;  2L3Z A;  1T0Y A;  3ECI A;  2Z0E B;  1A5R A;  1KLV A;  2Y5B B;  3PHW B;  2AL3 A;  3M95 A;  2K39 A;  3V60 A;  2ZNV C;  2DZK A;  5L83 A;  2AL6 A;  4MGZ E;  1XD3 B;  3C0R B;  4MGY E;  2G4D B;  2J0K A;  3PPA A;  3RYT A;  3JW0 X;  2NBU A;  4BBN F;  2KOX A;  3AU5 A;  4YL8 A;  4HCN B;  3VUY A;  2ZCC A;  3ZTC A;  2XK5 B;  4ZDV A;  3WAM A;  1FXT B;  4G0N B;  3R66 C;  1E8Y A;  4ZYN A;  1WYW B;  2KFK A;  4HPM B;  2ZVN A;  2K6Q A;  3DVG X;  4WWP A;  1YQB A;  1UD7 A;  4OVV A;  3N3K B;  4K7S A;  3VH4 B;  5EDS A;  1E90 A;  2LVP A;  2LXC A;  1H4R A;  1V49 A;  2EMT A;  4FBJ B;  3LJ3 A;  4PS3 A;  2RPQ A;  3U30 A;  3EEC A;  2BYF A;  4DDG D;  2HJ8 A;  5C23 A;  4G3X B;  4AJY B;  2ASQ A;  1UGM A;  1P9D U;  2GMI C;  2MBQ A;  3B0A A;  3SHQ A;  2MP2 B;  3A4S C;  4AJW A;  1OEY J;  4NY0 A;  3RD2 A;  1S3S G;  3ZUN A;  3A4R A;  1V9J A;  3QQ8 B;  2FUH B;  3KUD B;  1NI2 A;  1WM2 A;  1WGH A;  4EZK A;  3TBL D;  4HK2 A;  1GC6 A;  4FA6 A;  1L7Y A;  3VTV A;  2J0M A;  4B6W A;  1WZ0 A;  2LD9 A;  3U7D A;  1GUA B;  4F7Z A;  4HPL B;  4JL9 A;  4K1R B;  1C1Y B;  3AI5 A;  4MGK E;  4GIV A;  1WJ4 A;  2WWZ A;  3PTF C;  2KJ6 A;  2KK8 A;  4BKG A;  2BYV E;  1SIF A;  4TQ0 A;  3WA0 A;  3A9K A;  2G45 B;  4WAA A;  1P98 A;  1YX6 B;  2AYO B;  3ZO5 B;  3PVL A;  2NS5 A;  3QHT A;  4A3P A;  2FID A;  3VFK A;  3IHP C;  3KVF B;  2KN5 A;  5D6J B;  3I3T B;  1WJ6 A;  4GGQ A;  4GDK A;  4WQO B;  2REX A;  5D7G A;  4OVU A;  2LVQ A;  1ZGU B;  1YD8 U;  2RR9 A;  3A9J A;  3PT2 B;  2QHO A;  3WAP A;  2KTR A;  1CMX B;  2C7M B;  3GZN I;  5D94 A;  2KZR A;  3OJ4 B;  4W9I A;  1SGH A;  3H1U A;  1WXV A;  2YVC A;  3IVF A;  3M63 B;  3PZD A;  1E8Z A;  4K7W A;  4FLH A;  3PRM B;  1GC7 A;  3QAQ A;  2NCN A;  3QWZ B;  2GOW A;  2C5L C;  2KDB A;  3VDZ A;  2O6V D;  5CHF A;  2I1J A;  1WXM A;  3AXC A;  3JYU A;  4EZJ A;  4A3O A;  1UEL A;  2FAZ A;  2O6V B;  4LJO B;  1WGR A;  3NY5 A;  1AAR A;  4ANX A;  2ZZP B;  3DVN U;  3PLU A;  3DOW A;  3WAL A;  2FNJ B;  1J0G A;  1ISN A;  3CF6 E;  4NQK E;  2MBE A;  2IZV B;  3OJ3 A;  1WIA A;  4HCP B;  3DDC B;  3V61 A;  4GB9 A;  3ZW3 A;  5L95 C;  5DPS A;  3ZRC A;  4IM0 A;  1I42 A;  5HKH A;  1V5T A;  2J7Q B;  3M3J A;  4WJN A;  1TGZ B;  5CHW A;  2JVC A;  2AEH A;  1WH3 A;  4W9D A;  5E6P A;  2K8C A;  4IWO A;  2KX0 A;  3EHV A;  5C1Z A;  3L16 A;  4GMV A;  2NPT A;  3UF8 A;  1P0R A;  3ZNI D;  4BKS D;  5DPW A;  2N4F A;  4URK A;  2XEW A;  4DK5 A;  2IO2 B;  2UWQ A;  3D32 A;  3S2A A;  3NOB A;  3L0W B;  2RSU A;  4DHZ E;  3DVG Y;  3UIO B;  3DBL I;  4CHK A;  2M4N A;  2FCN A;  3DCG A;  1OGW A;  5CTR C;  4DHJ D;  2JRI B;  1WZ3 A;  2C7N B;  4MH0 E;  4KIK A;  2MW5 A;  4TQ1 A;  4RM9 A;  1WR6 E;  1XQQ A;  3DBR I;  1RFA A;  4II3 B;  2OOB B;  4BVU C;  4EFO A;  2MRP A;  2R2Q A;  3KYC D;  4K7U A;  2LVO A;  1V86 A;  2D2Q A;  3UQB A;  4G11 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...