2DZIA

2dzi/solution structure of the n-terminal ubiquitin-like domain in human ubiquitin-like protein 4a (gdx)
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
81
structure length
81
Chain Sequence
GSSGSSGMQLTVKALQGRECSLQVPEDELVSTLKQLVSEKLNVPVRQQRLLFKGKALADGKRLSDYSIGPNSKLNLVVKPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 2DZI/Solution Structure of the N-terminal Ubiquitin-like Domain in Human Ubiquitin-like Protein 4A (GDX)
rcsb
source organism Homo sapiens
molecule tags Structural genomics, unknown function
molecule keywords Ubiquitin-like protein 4A
total genus 12
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2006-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2dziA00
3DBHI 3L13A 4MM3A 1G6JA 4NAWB 2KNBA 5D6JB 3NHEB 1E90A 2MCNB 2BYVE 3O65B 4N9F4 2KFJA 2ZNVB 4NJ7A 2NS5A 3A4RA 2JXXA 2EKEC 2I1JA 2L0FA 1WM2A 2Z59B 2C60A 3ZLZA 1GG3A 2DYOA 4BVUC 4HDOA 3CMMB 4KSKC 2BF8B 3UGBB 3L17A 3ZIMA 4WAAA 5HKHA 2LVOA 1KOTA 4KDIC 1WX9A 4FJZA 2C7HA 1WR1A 1WGDA 5D2MB 5DPRA 3M62B 4TQ0A 3W1SA 1E8WA 1VCBA 2LGXA 4WWOA 2MQJA 4FHKA 3WANA 3L0WB 4BFRA 3H7PA 3DOWA 4I6NB 3A1QA 1WXMA 1GUAB 1Q1OA 4CHKA 2N9XA 2HJ8A 1YQBA 3K9OB 2BKRB 3JSVA 3NZSA 4WJNA 4AWJA 2O2VA 3PSEB 2FUHB 4DWFA 1EO6A 3PLUA 5KHOA 2RSUA 4A20A 3ZNID 4MJSA 3ZUNA 1WXAA 3QA8A 1WE7A 2YLMA 2IO0B 1L7YA 2ZVNA 3CSTA 2BYEA 3MTNB 3PTFC 4ICUA 1QZEA 2JT4B 2LGYA 2KHWB 4G3XB 1WXVA 4AJYB 1V81A 4PS7A 4BOZB 1OGWA 4GU2A 1WGRA 2C7MB 2N1VA 2NBVB 4I6LB 1P9DU 4ANXA 1SIFA 2DENB 3ZDMC 1TTNA 2KC1A 2M8SA 3CF6E 3PRMB 3VTVA 4IW0A 2DYMA 1GC7A 3V60A 3V61A 1JRUA 2LI5A 1LM8B 5JZEB 2K8BA 4DHJD 2JZZA 1C3TA 2D10A 3VTUA 1SE9A 1UELA 2A5UA 4BKTA 2QHOA 5J2RA 4XX5A 4IM3A 3DBRI 2KX3A 5E6PA 2NBWB 2ZJDA 3WAOA 3QX1A 1UBQA 4FHJA 4JL9A 3VHTC 3SDLC 4DBGA 1IYFA 4GDLA 1E8XA 2KO3A 4NY0A 4CYEA 4JIOU 5CHVC 3OJ3A 2WX1A 1R4MI 5GMVA 2DZIA 1V80A 1ZW7A 1WYWB 5TR5A 2FNJB 4NJ6A 2L8JA 1WJ4A 3L54A 2PE9A 3N30A 3S2AA 3ZTDA 2JZ3B 2FCQA 3W1YA 3T8MA 4EEWA 2CHWA 2LWPA 3A9JB 3ZTCA 2JPHA 4B6WA 2RR9A 1VD2A 4GDLB 4GSWA 3QARA 3PRPB 3KH0A 3NY5A 4ZRKA 2GBJA 1RLFA 2KANA 1WJUA 4KVGB 4W9JA 3T9LA 2BGFA 2LXAA 3PZDA 1MG8A 1UGMA 2KMAA 4FN2A 5JH5C 1LQBA 3P2BA 1OTRB 2KD0A 3MHSD 2KDIA 1S1QB 2G4SA 3EFUA 4BKGA 4HPMB 2ZVOA 4OVUA 4MGIE 2RPQA 3JVZX 4AOFA 4EKUA 1OQYA 3K9PB 3IVFA 2ZCCA 4TV3A 4BOSC 5LLIA 3UF8A 4LDTB 2N4FA 3NOBA 4KV2A 2D07B 3H9DA 1WX7A 1NDDA 3L16A 1P3QU 2LGDA 1V5TA 4RMAA 2BYFA 2O6VA 1PQSA 2VRRB 1WX8A 3SD5A 2LD9A 3A33B 3NS8A 4FJVB 1V49A 2IBIB 2J0JA 2K8HA 3VUYA 3A9KA 2C7NB 3VUXA 2MX2A 2PPHA 2UYZB 2MA9B 1RRBA 2ZZPB 4HDQA 3ZRCA 4WWPA 4DXAB 1H8CA 2LRWA 4BBNC 3A1QB 2HTHA 1YIWA 2C5LC 5AEKB 3M95A 1NI2A 3PHXB 4GOCA 2FIDA 4K7SA 2IYDB 5D94A 4F7ZA 3R7RA 4URKA 1V86A 3AU5A 5DPSA 3SU8X 4EFOA 5G2NA 1LXDA 2L7RA 5L83A 1TBEA 4BKSD 3SHQA 2KDBA 4WJPA 3QIJA 1A5RA 3H6NA 3V6EB 5CTRC 1TGZB 3NZUA 1E8YA 3VQIA 4KIKA 2WWZA 4W9LA 2KLCA 5IA7A 2OJRA 1KLVA 3TIXA 2MSED 3QAQA 5E6NA 4AUQC 5LXHA 1WI0A 1WXSA 3RCZA 2KLGA 3RULA 2A4ZA 2I1KA 3WAPA 1WZ0A 2NR2A 3QJZA 1V9JA 1CMXB 4MGZE 4KZ0A 1XD3B 1XQQA 1ZKHA 2KTRA 4XC2A 1WIAA 3HK0A 3GZNI 3W1SC 4II3B 3VXWA 2NBUA 4WQOB 4PS8A 4HJKA 2AYOB 4NQLB 5E6OA 5DPTA 2KQSA 4M0WB 5C23A 4W9EA 2ZEQA 2CU1A 2GBNA 3PPAA 1E7UA 5J17A 2Y5BB 2XEWA 2AL3A 5L95C 4BKSA 3H7SA 1T0YA 4MSMB 2FAZA 2ZCBA 2D11A 4OVVA 3RUIB 2XK5A 4FLHA 3R7QA 2UWQA 2NPTA 1L2NA 4GXBA 2WDTB 1WMHB 3TCAA 4GIVA 3EC8A 4HVBA 5CX3A 1UH6A 3AI5A 4LDTD 2KFKA 5FR6A 4TKNA 4DHZB 2N7EA 1Q5WB 4GMVA 5BO4B 1S3SG 1ZGUB 3D32A 3KVFB 4IM0A 2KDEB 3DBLI 4IWQA 4J6IA 4GDKA 1WMHA 4E3CA 1WGGA 3Q3FA 4HCNB 2L00B 3TMPB 3JW0X 3ONSA 4W9GA 3VFKA 4ANUA 1EUVB 2KFKB 1WJ6A 4W9DA 2M1MA 1UZXB 2GBKA 2KZRA 2V4LA 3ML8A 2IY1B 1LFDA 2AL6A 4JGHB 1WGHA 4B95A 2EMSA 1I35A 2Z0EB 3N3KB 3PRZA 4IM2A 3DBSA 4FADA 1C1YB 4GDKB 4JLCA 1SGHA 3UIOB 2V3SA 3WA0A 3B1LX 2JY6A 2MP2A 1WJNA 2G3QB 2PEAA 2REXA 4YL8A 3PT2B 4ZDVA 1D3ZA 1J0GA 3TBLD 3U8ZA 4XZ4A 1GNUA 1BT0A 3C0RB 2CR5A 2JUOA 3DVNV 4MJSB 4EOYA 2GBRA 3APCA 4MGKE 3QK0A 2J7QB 2JF5A 1WR6E 2KX0A 3PVLA 4A3PA 4NAWA 2JRHA 3KUZA 2PE6B 2ASQA 2L3ZA 1WE6A 4CO7A 3VVWB 1EF1A 4GB9A 3VTWA 1WRDB 2BKFA 3KW5B 1P0RA 2AWTA 1EF5A 5AZFA 2K6DB 5C1ZA 1WFYA 4DHJB 5DPWA 2HD5B 3LJ3A 1P1AA 2MBQA 1Y8RC 2HE7A 2LRUA 3QC8B 4K7WA 3U7DA 2D3GA 4MEMA 3RD2A 3V62A 2G4DB 4MDKE 3DCGA 2KXJA 3AU4A 3QCAA 3DPDA 1U4AA 1P98A 3VAWA 3KYDD 4GGQA 3L10B 4TQ1A 4LCDE 3R3MA 2CKHB 2DYBA 2MLBA 3HIZA 4FBJB 2NVUI 2B3AA 3H7PB 2KKCA 4M8MA 4ZRJA 3M3JA 4AP4C 2M4NA 3DQVA 4IUMB 4G11A 2D2QA 2KVRA 2V1YA 4E71A 2ZPYA 2RGFA 3ZO5B 2BPSA 4MH0E 2K6QA 3HM3A 2K39A 2LZ6A 3X0WA 1J8CA 3ZKJC 1OEYJ 3KYCD 2IO3B 3CSFA 2KTRB 3BY4B 4DDGD 4KSLC 3VUWA 3ZNGC 1YJ1A 2FCSA 2KC2A 3X23A 3RZFA 2KN5A 3B0AA 2KOXA 3PS6A 4ANWA 4F8CB 3HM6X 3JSVB 4K7UA 4PYZA 4EZJA 2WYQA 3VH3B 2LUEA 3DDCB 3AXCA 2GBMA 4ASWC 3IFWB 2KDFB 2K25A 4AJWA 2KWUB 2WX0A 3Q3JA 4F1SA 3JYUA 3PGEA 3DVNU 2ZNVC 2AEHA 2IO2B 1FXTB 3ZNZB 1UD7A 1WH3A 3ML9A 2GOWA 4LJPB 3PLVA 5CHWA 4EZLA 3EHVA 2RD0A 4M8NA 4FJYA 4K81A 1V2YA 3BINA 3VDZA 1ISNA 3ZNHB 4DDID 2XBBC 2EMTA 4A3OA 1TZ1A 2GMIC 4GN1A 1WY8A 2DAJA 5J18A 4KIKB 1XT9B 2ZPNA 4G50A 3UQAA 4IWOA 3KUDB 4B9KA 2OOBB 4W9KA 3WAMA 4P7IA 4HCPB 4JQWC 4PS3A 4K1RB 4RM8A 1YX5B 4ANVA 3TL5A 3V6CB 2KJRA 2G45B 3GOEA 4LJOB 5JHBA 2MRPA 1F9JA 3ECIA 3OAWA 3UIPB 1KJTA 3OJ4B 2MP2B 4ZRIA 4ICVA 2R2QA 4E74A 2J0KA 1GJZA 2IY0B 4IG7B 1YD8U 1IP9A 2LVQA 3R66C 5JHAA 3UINB 1I42A 1E8ZA 2LJ5A 1E5WA 2N9EB 3ALBA 2NCNA 2KMCA 2IO1B 2PJHA 4MSQB 2MBOA 3IBEA 4DHZE 2DX5B 3RT3B 2Z0DB 4FULA 2KJHB 3QWZB 4RM9A 2LASA 3DVGX 2DZMA 3ZVVA 2YVCA 2IZVB 2DHZA 3I3TB 4W9IA 2MW5A 1Z2MA 3ENEA 5AZGA 1J19A 3ZW3A 1H4RA 3APFA 2FIFA 4I6PA 4WJQA 1OEYA 1YX6B 1V5OA 2JVCA 2LXCA 3WALA 2C9WB 1KM7A 3H1UA 2O6VD 1WM3A 3ZDTA 3A9JA 3B08A 3PV1A 2CHZA 2L0TA 2R2OA 3N32A 2XK5B 2MBBB 3VH4B 3L08A 4EZKA 3QQ8B 3A4SC 4KZCA 4BBNF 1WZ3A 1NBFC 4G0NB 3OLMD 2O2VB 3RYTA 2N1WA 2N7DA 4W9HA 4WJOA 1M94A 4HK2A 1X1MA 3U30A 4DK5A 3HHMA 1R4NI 1AARA 1GC6A 4W9FA 1RAXA 4ZYNA 1Q0WB 2FCNA 2L76A 4TUUA 2O6VB 2CS4A 2NPTB 1IPGA 1UBIA 4MELA 2KK8A 5IAAC 2L05A 5DCNA 2KTFA 3A9KB 3AULA 4MGYE 3ZRFA 2FCMA 4FA6A 4HXDA 3EECA 5CHFA 4HPLB 3LDZE 5KHQA 4NPNA 5G55A 2KJ6A 2M17A 2KWCA 4II2B 4EUTA 4NNJB 3M63B 4W9CA 2CHXA 1WGYA 1K8RB 2BWES 1E7VA 2DAFA 2M0XA 3MJWA 3UQBA 2J0MA 2DZJA 3RZWC 3WIMA 3IHPC 3PHWB 5EDSA 2K1FA 3KUCB 3APDA 3QHTA 4X57B 2KQ7A 3DVGY 2DZKA 4WWNA 1Z5SB 2MBHA 5AZHA 2K8CA 2BWFA 2W9NA 2N9PC 1WF9A 1RFAA 2LVPA 1V6EA 2JWZA 5LXIB 4KDLB 4IWPA 2JRIB 4HLEA 2MBEA 2MWSB 3IG3A 4HWIB 4IC7B 1HE8A 2KWVB 3TJPA 5D7GA 3PREA 4NQKE 4PYUA
chains in the Genus database with same CATH superfamily
3DBHI 3I9V1 4MM3A 5D6JB 1E90A 3P42A 1QT9A 1NYQA 1C4AA 1P7EA 3IXSA 2MCNB 2ZNVB 1JW9D 4A6QA 2NS5A 2JXXA 4FXCA 4GLSC 2IDYA 2DYOA 4USAA 3UGBB 3ZIMA 4WAAA 4FJZA 2C7HA 1WGDA 3AEFB 1FXAA 5DPRA 4LNIA 4R3DA 4WURA 3W1SA 1TKEA 1Q1OA 2N9XA 4C80A 2DBYA 2O2VA 3PSEB 4LK0M 3VR8B 4A20A 4MJSA 1FCCC 1JWAD 4HROA 3AE6B 3AH7A 3PTFC 2JT4B 1WXVA 1FPYA 4A90A 3CF6E 3FILB 4NZLB 3VTVA 1YN4A 1YQ4B 3V60A 5JZEB 3AE7B 2I2YA 1TT5B 1KLGD 5J2RA 5E6PA 1L5PA 4JL9A 3VHTC 3SDLC 3DHHC 4DBGA 1ET9A 1IYFA 1AYFA 4CYEA 5CHVC 3AEDB 5TR5A 2L8JA 3N30A 1K50A 4O1NA 1VLBA 2PTLA 4EEWA 2LWPA 3ZTCA 1VD2A 1IUEA 2DNFA 2DLBA 2Y5PA 3KH0A 1YJIA 3NY5A 2EKIA 2D3AA 4KVGB 5JH5C 1UGMA 2KMAA 4FN2A 3CIRB 3NJTA 5E6JA 1LQBA 3P2BA 1OTRB 1UUPA 2UU7A 2KDIA 1S1QB 1VRAB 2G4SA 1SJHD 2GLSA 2ZVOA 1OQYA 1V97A 4JE3B 2LHEA 5LLIA 4LDTB 3NOBA 3TUOA 1Y56A 1QILA 5AUIA 1SSNA 4HKQA 3L16A 4RMAA 4RGTA 2O6VA 3NS8A 2MX2A 3C8YA 1CZPA 2J42A 2LRWA 3A1QB 1K51A 4KGTA 1D5ZC 1YIWA 1C4CA 1NI2A 4GOCA 2FIDA 1E7PB 3SU8X 2L7RA 5L83A 1V1PA 1KFYB 4WJPA 3AMZA 1MPEA 3H6NA 1YNTE 4TSSA 1KLVA 3NRZA 2MSED 1GPXA 2WU2B 5E6NA 3RULA 3GE8C 1V9JA 4MGZE 4KZ0A 3IT4B 1XD3B 1XQQA 1ZKHA 1YQ3B 1KRHA 4XC2A 3W1SC 4ZRPA 2H88B 4JPSA 4XGAB 2XNAC 2KN4A 5DPTA 2ON8A 4W9EA 2ZEQA 1FD6A 1RWSA 5J17A 1E7UA 1GAQB 1VJKA 2PLPA 1YMHE 5EE0A 2XK5A 2UWQA 4B0EA 1RFKA 1WMHB 3TCAA 5CX3A 3N1YC 1ZPSA 2WXOA 5BO4B 1SXTA 1S3SG 3D32A 1I7HA 3RNCC 3DBLI 4IWQA 1B9RA 3TMPB 1LGRA 1WJ6A 2KFKB 1PDXA 4JGHB 3N3KB 1C4PA 1JRPA 5JXVA 3Q8CA 1ZDVA 1SGHA 1C79A 2MP2A 2REXA 1T0RC 1D3ZA 3U2SC 3I63C 1J0GA 4ZYSA 1CQVA 1C77A 1AN8A 4MJSB 3DVNV 1MJDA 1WR6E 3PVLA 3KUZA 2L3ZA 3VVWB 1WGKA 2MHJA 1B1ZA 1OFFA 1WRDB 2W82A 3W9CB 1P0RA 2AWTA 4N6EB 5LNK1 2HD5B 3Q8AA 2K22A 2LRUA 3V62A 4MDKE 3DCGA 2KXJA 2WXHA 1P98A 3VAWA 3KYDD 4GGQA 4OW0A 3BK1A 3Q69A 2CKHB 4M02A 5AUKA 2E6XA 1FFVA 2MJEA 2B3AA 4ZRJA 2AQ3B 4M8MA 3M3JA 3BVMA 4IUMB 2V4IB 2BPSA 3DBLB 4C56C 1XXGA 3Q3OC 2KTRB 2JX5A 2KC2A 2RPVA 3X23A 2BB6A 4M0WA 4OVZA 3RNBC 3VH3B 3DDCB 3AXCA 3IFWB 2WLBA 1PFDA 2K25A 2KWUB 3Q3JA 5EE1A 3PGEA 2ZNVC 1FXTB 4M00A 1JMLA 3DHIC 1UD7A 1WH3A 3ML9A 1SEBD 4LJPB 3J9CA 3EHVA 5IOIA 4M8NA 4K81A 1QOAA 2E3TA 3NUHB 4DDID 4A3OA 3PZ7A 5J18A 4G50A 3KUDB 4MACA 4P7IA 4JQWC 4JWUC 4C4VA 1HTOA 4RM8A 4DQOC 3TL5A 5JHBA 2MRPA 3ECIA 3UIPB 3DWGC 1I4RA 2AQ1B 3AN1A 4IG7B 4A9AA 2RMMA 1ZUD2 2LJ5A 2NCNA 3URYA 1MHHE 4FULA 2KJHB 3DVGX 3MC8A 2IZVB 3AEEB 2MW5A 4WQMA 1Z2MA 3C19A 3APFA 2L1AA 2FIFA 4I6PA 4PK1A 2JVCA 2LXCA 2JXTA 3WALA 3ZJTA 1ROEA 3RMKC 2N0SB 1TS2A 3AEGB 3QQ8B 2CU3A 3OLMD 1Q10A 1FXIA 2V3NA 1CK1A 5MPOA 4ZYNA 5BYSA 2CJNA 2NPTB 3AE3B 3P4PB 3ZRFA 2KTFA 3A9KB 1SBBB 4FA6A 3EECA 4YT0B 4HPLB 2G9HD 3LDZE 2WU5B 5G55A 4II2B 3Q6BA 2GRIA 1WGYA 2DAFA 2M0XA 3MJWA 3BYYB 2DZJA 4A8XC 3IHPC 5EDSA 2DZKA 5AZHA 1ZE3D 2K8CA 2BWFA 2N9PC 1WF9A 1I4PA 4RFBA 1R4MB 5LXIB 3VRAB 2MBEA 2MWSB 2KWVB 4OZAA 3L13A 2BYVE 2KFJA 2QSDA 4NJ7A 3A4RA 1K53A 4MT5A 4C7YA 2KVZA 3ZLZA 1GG3A 4BVUC 4HDOA 3L17A 2H89B 2LVOA 1KOTA 1WX9A 1MI0A 1NI3A 1ENFA 2LEKA 1FMAD 4TQ0A 2J52A 3HRDD 2W54A 1E10A 2WNMA 4FHKA 3W5UB 3L0WB 3H7PA 2QC8A 3DOWA 3A1QA 4L2YA 1WXMA 1GUAB 4YTMB 2KACA 1QOBA 1F2RI 1WXAA 3QA8A 1WE7A 2YLMA 2IO0B 2ZVNA 4RGMA 3MTNB 3I57A 1QZEA 4AJYB 1V81A 4GU2A 2X8XX 2N1VA 2NBVB 1JALA 1TY0A 4YWGG 4ANXA 3NVZA 2WP9B 1TY2A 1JRUA 2LI5A 1LM8B 4DHJD 3KQ4A 1C3TA 2A5UA 4XX5A 3DBRI 3KWVA 3PZ8A 1UBQA 1XLNA 1E6EB 2L32A 3OJ3A 2DZIA 1V80A 2VZKD 3L54A 1L0XB 2FCQA 2QJLA 3U4EG 2BYTA 3QARA 2KANA 5IKCM 1T6BX 3AE4B 3MHSD 3MC9A 4BKGA 5FK9C 4MGIE 3JVZX 4RF0A 4TV3A 2ZCCA 4BOSC 2Y5CA 4KV2A 1XCTL 1JWMD 2IGDA 1EU4A 2JU6X 2SEBD 3H9DA 3T3OA 4XYCA 1C78A 1TS3A 2NMQA 1WX7A 3EA6A 4WH4A 3FKYA 1V5TA 2BYFA 1PQSA 1WX8A 3A33B 4N58A 3A9KA 2C7NB 2PPHA 1ESFA 1H8CA 4XWWA 4ZHOA 1KTKA 3PHXB 4K7SA 4F7ZA 4URKA 4EFOA 3AU5A 3NZ3A 1VZ6A 4ZOHC 3SHQA 2XN9C 2KDBA 1FRRA 1J7BA 3QIJA 3HVDA 1A5RA 3ZJVA 1TGZB 3NZUA 4KIKA 2OHFA 2LGIA 2ACZB 1WWTA 1NEKB 1PGAA 3RCZA 1V8CA 2I1KA 1WZ0A 2NR2A 3KLSX 2KTRA 1TKYA 5H8YE 2KT7A 1N61A 4II3B 3VXWA 1XCQL 4HJKA 2AYOB 5E6OA 1XLOA 2KQSA 1FFUA 1QQRA 3T3NA 2Y5BB 2BBCA 2XEWA 4BKSA 1T0YA 4MSMB 1QF6A 3E9SA 1C76A 4FLHA 2LJIA 2NPTA 4GXBA 4GIVA 3AI5A 4L23A 3TEZA 1Q5WB 3KVFB 4IM0A 4GDKA 1WGGA 4YTPB 1T0QC 3AE5B 2V0GA 2BS4B 2KZRA 4IDIA 4B95A 1I35A 2Z0EB 3PRZA 3AE8B 4KKJA 4GDKB 2JY6A 2N9KA 1WJNA 2G3QB 2PEAA 1BUIC 2SAKA 3U8ZA 1GNUA 2INNE 4EOYA 1EWCA 3ZXRA 4A3PA 2PE6B 3AECB 1LO5D 3DBRB 1PYWD 2M56B 1EF1A 4ARIA 2BKFA 3NVWA 1EF5A 1V1OA 2K6DB 1NVID 5DPWA 1JWSD 4LNNA 4K7WA 2D3GA 5BYQA 1N60A 1NYRA 3DPDA 4KX6B 4LNOA 3BVZA 4XWTA 1L4ZB 4TQ1A 1SE2A 1F52A 3R3MA 3TEXA 3AE9B 3HIZA 1T3QA 2ZW0A 2KKCA 3DQVA 2PVOD 2D2QA 1GOZA 2KVRA 2J4XA 2RGFA 2ZPYA 3ZO5B 4MH0E 2K6QA 4EE2A 2N7JA 2LZ6A 3X0WA 1E9MA 3KYCD 3P4RB 1UF0A 2WXRA 3RZFA 1BMLC 3PS6A 4S17A 3HM6X 3JSVB 4PYZA 1MFWA 3NS1A 4F1SA 3ZNZB 2PVGC 4XE0A 2WXMA 1YOVB 1HTQA 2GOWA 1J7AA 3PLVA 2RD0A 2RDBC 1V2YA 2WGSA 4WWMA 3VDZA 3ZNHB 2JQRB 1TZ1A 1FIQA 2GMIC 4GN1A 2DAJA 4KIKB 2KWDA 2KYWA 1XT9B 3UQAA 4B9KA 1XLQA 3WAMA 1I4GA 2JYEA 4PS3A 2KMMA 1YX5B 2BW2A 3FAHA 4ANVA 1TJEA 2KJRA 3AB5A 3RNGC 2QILA 1XO3A 1F9JA 3OAWA 3OJ4B 2N9LA 2MP2B 4ICVA 2R2QA 4E74A 2J0KA 3MC0B 4P6VF 1RYJA 1I42A 1E8ZA 4N59A 4DHZE 2LGSA 3B9JA 4RGNA 3I3TB 1DOIA 3P63A 3ENEA 1DGJA 4WJQA 1YX6B 1V5OA 4Q2JA 2WS3B 2VH1A 2C9WB 3H1UA 1VDVA 2O6VD 1WM3A 2CHZA 2R2OA 2XK5B 4KZCA 1WZ3A 4G0NB 4XDDA 2N1WA 2N7DA 4W9HA 1M94A 2HDEA 4WIPA 4AS1A 2O6VB 2WDQB 4MELA 2KK8A 3AULA 4JX1C 4MGYE 1ZDXA 5EE3A 3VRBB 4HXDA 2M17A 4NNJB 2OEDA 1K8RB 3I5JC 1E7VA 2J0MA 3IT6B 3RZWC 3WIMA 1WRIA 2AQ2B 2MJDA 3PHWB 2KAJA 3QHTA 2BTEA 1Z5SB 4OZBA 2LVPA 1YN3A 2JWZA 4HWIB 4IC7B 1HE8A 1TS5A 4IOIE 1N5XA 3TJPA 2G1EA 2KNBA 3NHEB 1ZOYB 4N9F4 3AEBB 3MJ5A 1WM2A 2Z59B 2C60A 3CMMB 1R4NB 4KSKC 2BF8B 3ZYYX 5HKHA 3AE1B 2DWQA 1WR1A 3M62B 4AQ7A 1VCBA 3WANA 1SF0A 4I6NB 5I4DA 1YQBA 3K9OB 3JSVA 3NZSA 4WJNA 1EO6A 1MG4A 2RSUA 3ZNID 1L7YA 3CSTA 1E0ZA 3GP7A 2BYEA 2BS3B 1FO4A 2KHWB 1PGBA 3ETRA 4BOZB 1OGWA 2C7MB 4KGRA 1SIFA 2DENB 3ZDMC 1TTNA 1N62A 1HXYD 1UGJA 1IBXB 4K3BA 5BMIA 1GC7A 2JZZA 2D10A 3VTUA 1SE9A 1UELA 2IGHA 2CJOA 1PGXA 1EM7A 2ICIA 2NTTA 2NBWB 3WAOA 3QX1A 3AV8A 2KO3A 4NY0A 2MH7A 4JIOU 5GMVA 2FNJB 1WJ4A 3S2AA 2PE9A 3ZTDA 3N20C 2JZ3B 3W1YA 3SFEB 3T8MA 2CHWA 3Q3NC 4MH8A 4B6WA 2RR9A 4GDLB 4GSWA 1D5XC 3PRPB 3CWIA 1DOYA 1N6ZA 3Q8BA 1RLFA 4IKGA 1FM0D 3T9LA 2BGFA 3PZDA 2KD0A 4ZRQA 1FNVA 5HHDG 3P4SB 3E56A 2RPQA 4AOFA 3LYYA 3IVFA 3UF8A 2N4FA 2D07B 2INCC 3W5VB 5BMGA 4D2KA 2VRRB 3SD5A 1CJEA 2PMVA 1L6VA 2IBIB 1VR9A 2UYZB 3FC4A 3P4QB 4RGOS 4HKZE 4UDUC 2HTHA 5AEKB 3M95A 5D94A 1KF6B 3R7RA 2Y3AA 5DPSA 1UWMA 1LXDA 5G2NA 4C4VB 2BVCA 4BKSD 3W2DA 4A55A 3VQIA 4MM3B 2WWZA 4W9LA 5IA7A 3QAQA 4L1BA 4AUQC 4CQNA 2KLGA 2A4ZA 3QJZA 1CMXB 1RM6C 1XEEA 3GZNI 4LNKA 1KH0A 3ABVB 2QCZA 4PS8A 1L4DB 3SFDB 4M0WB 4KKIA 1F1HA 2GBNA 3PPAA 3PO0A 2AL3A 5L95C 3H7SA 4OVVA 2D11A 1HEZE 2INDC 1WSPA 1L2NA 2WXIA 2WQYB 3P1MA 3EC8A 2WXQA 1MVKA 3TEWA 2KFKA 5FR6A 4DHZB 2N7EA 4GMVA 2WXNA 2BT6A 3L4PA 4E3CA 1WMHA 3JW0X 3ONSA 4W9GA 3VFKA 3N1XC 4ANUA 2D3CA 1AWDA 1WXQA 4BAXA 2EMSA 1TKGA 5EE9A 4DXFA 4JLCA 3UIOB 2V3SA 2QIEB 3BIID 2NTSA 4YL8A 3PT2B 4XZ4A 2JUOA 2GBRA 2IJ0A 2KX0A 4NAWA 2JRHA 2ASQA 4CO7A 4LLGM 1GB4A 5C1ZA 1WFYA 4DHJB 3LJ3A 2YEPB 2MBQA 1Y8RC 2HE7A 3U7DA 3QC8B 4C7ZA 4MEMA 2G4DB 2LUMA 1HZ6A 1U4AA 3RNFC 3EUB2 4LCDE 2DYBA 2NVUI 4ITKA 4AP4C 2K5PA 2KDMA 3HM3A 2K39A 4P16A 1J8CA 3ZKJC 1OEYJ 2IO3B 3CSFA 2WDRB 2WXGA 3BY4B 2K3UA 4KSLC 3VUWA 1ZP0B 3ZNGC 2W3RA 3B0AA 2KOXA 4ANWA 4P1CC 3B2GA 4K7UA 2YEPF 2WYQA 4ASWC 4AJWA 3JYUA 5T8IA 3DVNU 4RNAA 4EZLA 1FRDA 3BINA 1ISNA 2EMTA 2WXFA 4YXDB 2BB5A 2B76B 2ZPNA 5H92C 1EWYC 2OOBB 3ZGZA 2M0AA 3O13A 4HCPB 2FUG1 3ZXVA 2IGGA 3V6CB 1I4HA 2HTME 4LJOB 2PKOA 4J3OD 4ZRIA 2BQQA 1D5MC 5BMHA 1YD8U 3R66C 3ALBA 4MSQB 2IO1B 2PJHA 3IBEA 2Q5WD 2DX5B 1SE4A 4KGSA 2Z0DB 3Q14C 3RT3B 3QWZB 4P1BC 2DHZA 2JYTA 2FBWB 3GB1A 3SR6A 1J19A 2LHDA 1H4RA 1JWBD 2R61A 1KM7A 3ZDTA 3A9JA 3BYTB 4B0MA 2L0TA 3N32A 2QMTA 3DWMA 4OZCA 3L08A 2QDFA 3A4SC 4US9A 1NBFC 2PW9A 3RYTA 2O2VB 4WJOA 2Z8LA 4HK2A 1X1MA 3U30A 3HHMA 2JWUA 4W9FA 1SB3C 2L76A 1IPGA 1T5XD 1UBIA 5C2TB 4ARCA 1V1PB 2L05A 2FCMA 3BZDB 5FR3A 2WXKA 5IN7A 1ACCA 2KJ6A 1EU3A 2KWCA 3AE2B 4EUTA 3M63B 4W9CA 2BWES 5IP4D 3UQBA 4ACFA 2K0PA 2RDHA 2WXJA 3KUCB 3APDA 3IAM1 2MBHA 2W9NA 3FILA 1TIFA 1F0ZA 1V6EA 1K52A 1QOGA 4KDLB 3IG3A 5D7GA 1ET6A 2VH2A 1IGDA 3RI7C 1ZXHA 1G6JA 4NAWB 2WDVB 2WXPA 3O65B 1HA5A 2OJWA 1FNWA 2EKEC 2INPE 2I1JA 2L0FA 2LMCA 2LFIA 1HQRD 1UNSA 1TYGB 2IPKD 1GB1A 1T0SC 2D5GA 5BYRA 4KDIC 3GE3C 3IAS1 4S0RA 5D2MB 1E8WA 4JWSC 2LGXA 4WWOA 2MQJA 2PIAA 4BFRA 4LNFA 4CHKA 2HJ8A 2BKRB 3MHZA 4AWJA 1TZOA 2FUHB 4DWFA 3PLUA 3ZQ4A 5KHOA 3KWLA 1I4XA 3ZUNA 3EFCA 4RF1A 2ZW1A 4ICUA 2LGYA 3BVGA 4G3XB 1IBXA 4PS7A 1WGRA 3BK2A 1P7FA 4I6LB 1P9DU 2I38A 1WYGA 2KC1A 2M8SA 3PRMB 4IW0A 2DYMA 3V61A 2VZKB 3H8HA 2K8BA 3ZJUA 4BKTA 2QHOA 5D3IB 1L0YB 4IM3A 2KX3A 2ZJDA 4FHJA 3R2TA 3SEBA 4GDLA 1E8XA 2X38A 2WX1A 1R4MI 1ZW7A 1WYWB 4NJ6A 4HJGE 1HZ5A 3Q8FA 3A9JB 2JPHA 5HI1A 2GB1A 1UWXA 3DBHB 4ZRKA 2GBJA 1WJUA 2W3SA 4W9JA 2LXAA 1MG8A 1QLBB 3EFUA 4HPMB 1D4BA 4OVUA 4EKUA 3K9PB 2MJ3A 4H2AA 2J53A 4YTNB 1SIJA 1NDDA 5TSSA 1P3QU 2LGDA 4US8A 2LD9A 4FJVB 4K3CA 1V49A 2J0JA 3MP9A 2K8HA 3VUYA 3VUXA 4M01A 2ZZPB 2MA9B 1RRBA 3EGRA 4HDQA 3ZRCA 2L83A 4WWPA 4DXAB 4BBNC 2EELA 2C5LC 5G5GA 2IYDB 3N9YC 1V86A 1TBEA 3V05A 1ZXIA 2AX5A 1NENB 1FCLA 3V6EB 5CTRC 1E8YA 2KLCA 2OJRA 3TIXA 2K9XA 3DHGC 5LXHA 2D3BA 1WI0A 1WXSA 1JWUD 3WAPA 3BWUD 1AW7A 1WIAA 3HK0A 2W55A 5C3JB 1OQQA 1I4QA 1R7SA 2NBUA 4WQOB 3OG5A 4NQLB 5C23A 4HPPA 2CU1A 3U7ZA 2FAZA 2ZCBA 3RUIB 3R7QA 1SJED 2WDTB 1IGCA 3NG0A 3R2IA 5IO9A 4HVBA 4REZA 1UH6A 4LDTD 4TKNA 3U52E 2WHIA 1ZGUB 4LTUA 2RDGA 2KDEB 4HEA1 4J6IA 3AM9A 2BS2B 3Q3FA 2L00B 4HCNB 2V3PA 1D6EC 1EUVB 4W9DA 2M1MA 1UZXB 2GBKA 2V4LA 3ML8A 2IY1B 1LFDA 2AL6A 1WGHA 3HVZA 4IM2A 3DBSA 1JQ4A 1BXTA 4FADA 3VR9B 1C1YB 4RCOA 3WA0A 3B1LX 4ZDVA 4PT5A 3TBLD 4OHJA 1BT0A 3C0RB 2CR5A 3GS2A 3APCA 4MGKE 3QK0A 2J7QB 3Q2AC 2JF5A 3GZNB 1N5WA 1FNUA 1WE6A 2HJ1A 3V3XA 4GB9A 3VTWA 3KW5B 3OWEB 2V9HA 5AZFA 1DYQA 1YJJA 1PUTA 1XLPA 1P1AA 4HRSA 1L6UA 4YSZB 3WCQA 1YN5A 2TSSA 3RPFC 3RD2A 3AU4A 3QCAA 3L10B 1VZ8A 2MLBA 4FBJB 3H7PB 2M4NA 4G11A 2V1YA 4E71A 2M19A 3NVVA 3UI3A 4DDGD 4NJCA 1YJ1A 2FCSA 2KN5A 2GI9A 4F8CB 3Q3MC 1XF5L 4EZJA 2LUEA 2GBMA 4QAYA 5HG2A 1SE3A 2JZPA 5D3DA 2KDFB 2WX0A 3R8BA 2AEHA 2IO2B 2FE8A 5CHWA 4YSXB 4FJYA 1MHXA 2XBBC 1QKZA 1WY8A 3TSSA 2JSVX 4IWOA 1M4VA 3LXFA 4W9KA 1F77A 3NVYA 5GXGB 1C9FA 3Q8EA 4K1RB 1VZ7A 3GOEA 2G45B 2MEKA 1KJTA 3AEAB 5FKAC 1GJZA 2IY0B 1IP9A 2LVQA 3TEYA 5JHAA 3UINB 1E5WA 2N9EB 2KMCA 1JROA 2MBOA 2L52A 4RM9A 2LASA 4XDCA 2DZMA 3ZVVA 2ONQA 2YVCA 4W9IA 1QOFA 5AZGA 3ZW3A 1JCKB 1F2RC 1OEYA 1DOXA 3MFGA 4BZAA 3HUIA 3B08A 3PV1A 1N63A 4YSYB 1OQRA 4WAFA 3RNEC 2MBBB 5G5HA 3VH4B 4EZKA 4BBNF 3RFZB 3LB8C 4DK5A 1R4NI 1AARA 1GC6A 1RAXA 1Q0WB 1KLUD 2FCNA 4TUUA 2CS4A 5IAAC 1L0VB 5DCNA 5CHFA 5KHQA 4NPNA 3B2FA 1STEA 2CHXA 4RH6A 2QEJC 5HFYA 4NAMA 1J7CA 2K1FA 4X57B 2KQ7A 3DVGY 3N1ZC 4WWNA 4DXGA 4ZHPA 1RFAA 3RNAC 1FEHA 2WXLA 4IWPA 2KQ4X 2JRIB 4HLEA 1A70A 3RN9C 4C00A 4TMAB 1TS4A 3PREA 4NQKE 4PYUA
chains in the Genus database with same CATH topology
3DBHI 3L13A 4MM3A 1G6JA 4NAWB 2KNBA 5D6JB 3NHEB 1E90A 2MCNB 2BYVE 3O65B 4N9F4 2KFJA 2ZNVB 4NJ7A 2NS5A 3A4RA 2JXXA 2EKEC 2I1JA 2L0FA 1WM2A 2Z59B 2C60A 3ZLZA 1GG3A 2DYOA 4BVUC 4HDOA 3CMMB 4KSKC 2BF8B 3UGBB 3L17A 3ZIMA 4WAAA 5HKHA 2LVOA 1KOTA 4KDIC 1WX9A 4FJZA 2C7HA 1WR1A 1WGDA 5D2MB 5DPRA 3M62B 4TQ0A 3W1SA 1E8WA 1VCBA 2LGXA 4WWOA 2MQJA 4FHKA 3WANA 3L0WB 4BFRA 3H7PA 3DOWA 4I6NB 3A1QA 1WXMA 1GUAB 1Q1OA 4CHKA 2N9XA 2HJ8A 1YQBA 3K9OB 2BKRB 3JSVA 3NZSA 4WJNA 4AWJA 2O2VA 3PSEB 2FUHB 4DWFA 1EO6A 3PLUA 5KHOA 2RSUA 4A20A 3ZNID 4MJSA 3ZUNA 1WXAA 3QA8A 1WE7A 2YLMA 2IO0B 1L7YA 2ZVNA 3CSTA 2BYEA 3MTNB 3PTFC 4ICUA 1QZEA 2JT4B 2LGYA 2KHWB 4G3XB 1WXVA 4AJYB 1V81A 4PS7A 4BOZB 1OGWA 4GU2A 1WGRA 2C7MB 2N1VA 2NBVB 4I6LB 1P9DU 4ANXA 1SIFA 2DENB 3ZDMC 1TTNA 2KC1A 2M8SA 3CF6E 3PRMB 3VTVA 4IW0A 2DYMA 1GC7A 3V60A 3V61A 1JRUA 2LI5A 1LM8B 5JZEB 2K8BA 4DHJD 2JZZA 1C3TA 2D10A 3VTUA 1SE9A 1UELA 2A5UA 4BKTA 2QHOA 5J2RA 4XX5A 4IM3A 3DBRI 2KX3A 5E6PA 2NBWB 2ZJDA 3WAOA 3QX1A 1UBQA 4FHJA 4JL9A 3VHTC 3SDLC 4DBGA 1IYFA 4GDLA 1E8XA 2KO3A 4NY0A 4CYEA 4JIOU 5CHVC 3OJ3A 2WX1A 1R4MI 5GMVA 2DZIA 1V80A 1ZW7A 1WYWB 5TR5A 2FNJB 4NJ6A 2L8JA 1WJ4A 3L54A 2PE9A 3N30A 3S2AA 3ZTDA 2JZ3B 2FCQA 3W1YA 3T8MA 4EEWA 2CHWA 2LWPA 3A9JB 3ZTCA 2JPHA 4B6WA 2RR9A 1VD2A 4GDLB 4GSWA 3QARA 3PRPB 3KH0A 3NY5A 4ZRKA 2GBJA 1RLFA 2KANA 1WJUA 4KVGB 4W9JA 3T9LA 2BGFA 2LXAA 3PZDA 1MG8A 1UGMA 2KMAA 4FN2A 5JH5C 1LQBA 3P2BA 1OTRB 2KD0A 3MHSD 2KDIA 1S1QB 2G4SA 3EFUA 4BKGA 4HPMB 2ZVOA 4OVUA 4MGIE 2RPQA 3JVZX 4AOFA 4EKUA 1OQYA 3K9PB 3IVFA 2ZCCA 4TV3A 4BOSC 5LLIA 3UF8A 4LDTB 2N4FA 3NOBA 4KV2A 2D07B 3H9DA 1WX7A 1NDDA 3L16A 1P3QU 2LGDA 1V5TA 4RMAA 2BYFA 2O6VA 1PQSA 2VRRB 1WX8A 3SD5A 2LD9A 3A33B 3NS8A 4FJVB 1V49A 2IBIB 2J0JA 2K8HA 3VUYA 3A9KA 2C7NB 3VUXA 2MX2A 2PPHA 2UYZB 2MA9B 1RRBA 2ZZPB 4HDQA 3ZRCA 4WWPA 4DXAB 1H8CA 2LRWA 4BBNC 3A1QB 2HTHA 1YIWA 2C5LC 5AEKB 3M95A 1NI2A 3PHXB 4GOCA 2FIDA 4K7SA 2IYDB 5D94A 4F7ZA 3R7RA 4URKA 1V86A 3AU5A 5DPSA 3SU8X 4EFOA 5G2NA 1LXDA 2L7RA 5L83A 1TBEA 4BKSD 3SHQA 2KDBA 4WJPA 3QIJA 1A5RA 3H6NA 3V6EB 5CTRC 1TGZB 3NZUA 1E8YA 3VQIA 4KIKA 2WWZA 4W9LA 2KLCA 5IA7A 2OJRA 1KLVA 3TIXA 2MSED 3QAQA 5E6NA 4AUQC 5LXHA 1WI0A 1WXSA 3RCZA 2KLGA 3RULA 2A4ZA 2I1KA 3WAPA 1WZ0A 2NR2A 3QJZA 1V9JA 1CMXB 4MGZE 4KZ0A 1XD3B 1XQQA 1ZKHA 2KTRA 4XC2A 1WIAA 3HK0A 3GZNI 3W1SC 4II3B 3VXWA 2NBUA 4WQOB 4PS8A 4HJKA 2AYOB 4NQLB 5E6OA 5DPTA 2KQSA 4M0WB 5C23A 4W9EA 2ZEQA 2CU1A 2GBNA 3PPAA 1E7UA 5J17A 2Y5BB 2XEWA 2AL3A 5L95C 4BKSA 3H7SA 1T0YA 4MSMB 2FAZA 2ZCBA 2D11A 4OVVA 3RUIB 2XK5A 4FLHA 3R7QA 2UWQA 2NPTA 1L2NA 4GXBA 2WDTB 1WMHB 3TCAA 4GIVA 3EC8A 4HVBA 5CX3A 1UH6A 3AI5A 4LDTD 2KFKA 5FR6A 4TKNA 4DHZB 2N7EA 1Q5WB 4GMVA 5BO4B 1S3SG 1ZGUB 3D32A 3KVFB 4IM0A 2KDEB 3DBLI 4IWQA 4J6IA 4GDKA 1WMHA 4E3CA 1WGGA 3Q3FA 4HCNB 2L00B 3TMPB 3JW0X 3ONSA 4W9GA 3VFKA 4ANUA 1EUVB 2KFKB 1WJ6A 4W9DA 2M1MA 1UZXB 2GBKA 2KZRA 2V4LA 3ML8A 2IY1B 1LFDA 2AL6A 4JGHB 1WGHA 4B95A 2EMSA 1I35A 2Z0EB 3N3KB 3PRZA 4IM2A 3DBSA 4FADA 1C1YB 4GDKB 4JLCA 1SGHA 3UIOB 2V3SA 3WA0A 3B1LX 2JY6A 2MP2A 1WJNA 2G3QB 2PEAA 2REXA 4YL8A 3PT2B 4ZDVA 1D3ZA 1J0GA 3TBLD 3U8ZA 4XZ4A 1GNUA 1BT0A 3C0RB 2CR5A 2JUOA 3DVNV 4MJSB 4EOYA 2GBRA 3APCA 4MGKE 3QK0A 2J7QB 2JF5A 1WR6E 2KX0A 3PVLA 4A3PA 4NAWA 2JRHA 3KUZA 2PE6B 2ASQA 2L3ZA 1WE6A 4CO7A 3VVWB 1EF1A 4GB9A 3VTWA 1WRDB 2BKFA 3KW5B 1P0RA 2AWTA 1EF5A 5AZFA 2K6DB 5C1ZA 1WFYA 4DHJB 5DPWA 2HD5B 3LJ3A 1P1AA 2MBQA 1Y8RC 2HE7A 2LRUA 3QC8B 4K7WA 3U7DA 2D3GA 4MEMA 3RD2A 3V62A 2G4DB 4MDKE 3DCGA 2KXJA 3AU4A 3QCAA 3DPDA 1U4AA 1P98A 3VAWA 3KYDD 4GGQA 3L10B 4TQ1A 4LCDE 3R3MA 2CKHB 2DYBA 2MLBA 3HIZA 4FBJB 2NVUI 2B3AA 3H7PB 2KKCA 4M8MA 4ZRJA 3M3JA 4AP4C 2M4NA 3DQVA 4IUMB 4G11A 2D2QA 2KVRA 2V1YA 4E71A 2ZPYA 2RGFA 3ZO5B 2BPSA 4MH0E 2K6QA 3HM3A 2K39A 2LZ6A 3X0WA 1J8CA 3ZKJC 1OEYJ 3KYCD 2IO3B 3CSFA 2KTRB 3BY4B 4DDGD 4KSLC 3VUWA 3ZNGC 1YJ1A 2FCSA 2KC2A 3X23A 3RZFA 2KN5A 3B0AA 2KOXA 3PS6A 4ANWA 4F8CB 3HM6X 3JSVB 4K7UA 4PYZA 4EZJA 2WYQA 3VH3B 2LUEA 3DDCB 3AXCA 2GBMA 4ASWC 3IFWB 2KDFB 2K25A 4AJWA 2KWUB 2WX0A 3Q3JA 4F1SA 3JYUA 3PGEA 3DVNU 2ZNVC 2AEHA 2IO2B 1FXTB 3ZNZB 1UD7A 1WH3A 3ML9A 2GOWA 4LJPB 3PLVA 5CHWA 4EZLA 3EHVA 2RD0A 4M8NA 4FJYA 4K81A 1V2YA 3BINA 3VDZA 1ISNA 3ZNHB 4DDID 2XBBC 2EMTA 4A3OA 1TZ1A 2GMIC 4GN1A 1WY8A 2DAJA 5J18A 4KIKB 1XT9B 2ZPNA 4G50A 3UQAA 4IWOA 3KUDB 4B9KA 2OOBB 4W9KA 3WAMA 4P7IA 4HCPB 4JQWC 4PS3A 4K1RB 4RM8A 1YX5B 4ANVA 3TL5A 3V6CB 2KJRA 2G45B 3GOEA 4LJOB 5JHBA 2MRPA 1F9JA 3ECIA 3OAWA 3UIPB 1KJTA 3OJ4B 2MP2B 4ZRIA 4ICVA 2R2QA 4E74A 2J0KA 1GJZA 2IY0B 4IG7B 1YD8U 1IP9A 2LVQA 3R66C 5JHAA 3UINB 1I42A 1E8ZA 2LJ5A 1E5WA 2N9EB 3ALBA 2NCNA 2KMCA 2IO1B 2PJHA 4MSQB 2MBOA 3IBEA 4DHZE 2DX5B 3RT3B 2Z0DB 4FULA 2KJHB 3QWZB 4RM9A 2LASA 3DVGX 2DZMA 3ZVVA 2YVCA 2IZVB 2DHZA 3I3TB 4W9IA 2MW5A 1Z2MA 3ENEA 5AZGA 1J19A 3ZW3A 1H4RA 3APFA 2FIFA 4I6PA 4WJQA 1OEYA 1YX6B 1V5OA 2JVCA 2LXCA 3WALA 2C9WB 1KM7A 3H1UA 2O6VD 1WM3A 3ZDTA 3A9JA 3B08A 3PV1A 2CHZA 2L0TA 2R2OA 3N32A 2XK5B 2MBBB 3VH4B 3L08A 4EZKA 3QQ8B 3A4SC 4KZCA 4BBNF 1WZ3A 1NBFC 4G0NB 3OLMD 2O2VB 3RYTA 2N1WA 2N7DA 4W9HA 4WJOA 1M94A 4HK2A 1X1MA 3U30A 4DK5A 3HHMA 1R4NI 1AARA 1GC6A 4W9FA 1RAXA 4ZYNA 1Q0WB 2FCNA 2L76A 4TUUA 2O6VB 2CS4A 2NPTB 1IPGA 1UBIA 4MELA 2KK8A 5IAAC 2L05A 5DCNA 2KTFA 3A9KB 3AULA 4MGYE 3ZRFA 2FCMA 4FA6A 4HXDA 3EECA 5CHFA 4HPLB 3LDZE 5KHQA 4NPNA 5G55A 2KJ6A 2M17A 2KWCA 4II2B 4EUTA 4NNJB 3M63B 4W9CA 2CHXA 1WGYA 1K8RB 2BWES 1E7VA 2DAFA 2M0XA 3MJWA 3UQBA 2J0MA 2DZJA 3RZWC 3WIMA 3IHPC 3PHWB 5EDSA 2K1FA 3KUCB 3APDA 3QHTA 4X57B 2KQ7A 3DVGY 2DZKA 4WWNA 1Z5SB 2MBHA 5AZHA 2K8CA 2BWFA 2W9NA 2N9PC 1WF9A 1RFAA 2LVPA 1V6EA 2JWZA 5LXIB 4KDLB 4IWPA 2JRIB 4HLEA 2MBEA 2MWSB 3IG3A 4HWIB 4IC7B 1HE8A 2KWVB 3TJPA 5D7GA 3PREA 4NQKE 4PYUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DBH I;  3L13 A;  4MM3 A;  1G6J A;  4NAW B;  2KNB A;  5D6J B;  3NHE B;  1E90 A;  2MCN B;  2BYV E;  3O65 B;  4N9F 4;  2KFJ A;  2ZNV B;  4NJ7 A;  2NS5 A;  3A4R A;  2JXX A;  2EKE C;  2I1J A;  2L0F A;  1WM2 A;  2Z59 B;  2C60 A;  3ZLZ A;  1GG3 A;  2DYO A;  4BVU C;  4HDO A;  3CMM B;  4KSK C;  2BF8 B;  3UGB B;  3L17 A;  3ZIM A;  4WAA A;  5HKH A;  2LVO A;  1KOT A;  4KDI C;  1WX9 A;  4FJZ A;  2C7H A;  1WR1 A;  1WGD A;  5D2M B;  5DPR A;  3M62 B;  4TQ0 A;  3W1S A;  1E8W A;  1VCB A;  2LGX A;  4WWO A;  2MQJ A;  4FHK A;  3WAN A;  3L0W B;  4BFR A;  3H7P A;  3DOW A;  4I6N B;  3A1Q A;  1WXM A;  1GUA B;  1Q1O A;  4CHK A;  2N9X A;  2HJ8 A;  1YQB A;  3K9O B;  2BKR B;  3JSV A;  3NZS A;  4WJN A;  4AWJ A;  2O2V A;  3PSE B;  2FUH B;  4DWF A;  1EO6 A;  3PLU A;  5KHO A;  2RSU A;  4A20 A;  3ZNI D;  4MJS A;  3ZUN A;  1WXA A;  3QA8 A;  1WE7 A;  2YLM A;  2IO0 B;  1L7Y A;  2ZVN A;  3CST A;  2BYE A;  3MTN B;  3PTF C;  4ICU A;  1QZE A;  2JT4 B;  2LGY A;  2KHW B;  4G3X B;  1WXV A;  4AJY B;  1V81 A;  4PS7 A;  4BOZ B;  1OGW A;  4GU2 A;  1WGR A;  2C7M B;  2N1V A;  2NBV B;  4I6L B;  1P9D U;  4ANX A;  1SIF A;  2DEN B;  3ZDM C;  1TTN A;  2KC1 A;  2M8S A;  3CF6 E;  3PRM B;  3VTV A;  4IW0 A;  2DYM A;  1GC7 A;  3V60 A;  3V61 A;  1JRU A;  2LI5 A;  1LM8 B;  5JZE B;  2K8B A;  4DHJ D;  2JZZ A;  1C3T A;  2D10 A;  3VTU A;  1SE9 A;  1UEL A;  2A5U A;  4BKT A;  2QHO A;  5J2R A;  4XX5 A;  4IM3 A;  3DBR I;  2KX3 A;  5E6P A;  2NBW B;  2ZJD A;  3WAO A;  3QX1 A;  1UBQ A;  4FHJ A;  4JL9 A;  3VHT C;  3SDL C;  4DBG A;  1IYF A;  4GDL A;  1E8X A;  2KO3 A;  4NY0 A;  4CYE A;  4JIO U;  5CHV C;  3OJ3 A;  2WX1 A;  1R4M I;  5GMV A;  2DZI A;  1V80 A;  1ZW7 A;  1WYW B;  5TR5 A;  2FNJ B;  4NJ6 A;  2L8J A;  1WJ4 A;  3L54 A;  2PE9 A;  3N30 A;  3S2A A;  3ZTD A;  2JZ3 B;  2FCQ A;  3W1Y A;  3T8M A;  4EEW A;  2CHW A;  2LWP A;  3A9J B;  3ZTC A;  2JPH A;  4B6W A;  2RR9 A;  1VD2 A;  4GDL B;  4GSW A;  3QAR A;  3PRP B;  3KH0 A;  3NY5 A;  4ZRK A;  2GBJ A;  1RLF A;  2KAN A;  1WJU A;  4KVG B;  4W9J A;  3T9L A;  2BGF A;  2LXA A;  3PZD A;  1MG8 A;  1UGM A;  2KMA A;  4FN2 A;  5JH5 C;  1LQB A;  3P2B A;  1OTR B;  2KD0 A;  3MHS D;  2KDI A;  1S1Q B;  2G4S A;  3EFU A;  4BKG A;  4HPM B;  2ZVO A;  4OVU A;  4MGI E;  2RPQ A;  3JVZ X;  4AOF A;  4EKU A;  1OQY A;  3K9P B;  3IVF A;  2ZCC A;  4TV3 A;  4BOS C;  5LLI A;  3UF8 A;  4LDT B;  2N4F A;  3NOB A;  4KV2 A;  2D07 B;  3H9D A;  1WX7 A;  1NDD A;  3L16 A;  1P3Q U;  2LGD A;  1V5T A;  4RMA A;  2BYF A;  2O6V A;  1PQS A;  2VRR B;  1WX8 A;  3SD5 A;  2LD9 A;  3A33 B;  3NS8 A;  4FJV B;  1V49 A;  2IBI B;  2J0J A;  2K8H A;  3VUY A;  3A9K A;  2C7N B;  3VUX A;  2MX2 A;  2PPH A;  2UYZ B;  2MA9 B;  1RRB A;  2ZZP B;  4HDQ A;  3ZRC A;  4WWP A;  4DXA B;  1H8C A;  2LRW A;  4BBN C;  3A1Q B;  2HTH A;  1YIW A;  2C5L C;  5AEK B;  3M95 A;  1NI2 A;  3PHX B;  4GOC A;  2FID A;  4K7S A;  2IYD B;  5D94 A;  4F7Z A;  3R7R A;  4URK A;  1V86 A;  3AU5 A;  5DPS A;  3SU8 X;  4EFO A;  5G2N A;  1LXD A;  2L7R A;  5L83 A;  1TBE A;  4BKS D;  3SHQ A;  2KDB A;  4WJP A;  3QIJ A;  1A5R A;  3H6N A;  3V6E B;  5CTR C;  1TGZ B;  3NZU A;  1E8Y A;  3VQI A;  4KIK A;  2WWZ A;  4W9L A;  2KLC A;  5IA7 A;  2OJR A;  1KLV A;  3TIX A;  2MSE D;  3QAQ A;  5E6N A;  4AUQ C;  5LXH A;  1WI0 A;  1WXS A;  3RCZ A;  2KLG A;  3RUL A;  2A4Z A;  2I1K A;  3WAP A;  1WZ0 A;  2NR2 A;  3QJZ A;  1V9J A;  1CMX B;  4MGZ E;  4KZ0 A;  1XD3 B;  1XQQ A;  1ZKH A;  2KTR A;  4XC2 A;  1WIA A;  3HK0 A;  3GZN I;  3W1S C;  4II3 B;  3VXW A;  2NBU A;  4WQO B;  4PS8 A;  4HJK A;  2AYO B;  4NQL B;  5E6O A;  5DPT A;  2KQS A;  4M0W B;  5C23 A;  4W9E A;  2ZEQ A;  2CU1 A;  2GBN A;  3PPA A;  1E7U A;  5J17 A;  2Y5B B;  2XEW A;  2AL3 A;  5L95 C;  4BKS A;  3H7S A;  1T0Y A;  4MSM B;  2FAZ A;  2ZCB A;  2D11 A;  4OVV A;  3RUI B;  2XK5 A;  4FLH A;  3R7Q A;  2UWQ A;  2NPT A;  1L2N A;  4GXB A;  2WDT B;  1WMH B;  3TCA A;  4GIV A;  3EC8 A;  4HVB A;  5CX3 A;  1UH6 A;  3AI5 A;  4LDT D;  2KFK A;  5FR6 A;  4TKN A;  4DHZ B;  2N7E A;  1Q5W B;  4GMV A;  5BO4 B;  1S3S G;  1ZGU B;  3D32 A;  3KVF B;  4IM0 A;  2KDE B;  3DBL I;  4IWQ A;  4J6I A;  4GDK A;  1WMH A;  4E3C A;  1WGG A;  3Q3F A;  4HCN B;  2L00 B;  3TMP B;  3JW0 X;  3ONS A;  4W9G A;  3VFK A;  4ANU A;  1EUV B;  2KFK B;  1WJ6 A;  4W9D A;  2M1M A;  1UZX B;  2GBK A;  2KZR A;  2V4L A;  3ML8 A;  2IY1 B;  1LFD A;  2AL6 A;  4JGH B;  1WGH A;  4B95 A;  2EMS A;  1I35 A;  2Z0E B;  3N3K B;  3PRZ A;  4IM2 A;  3DBS A;  4FAD A;  1C1Y B;  4GDK B;  4JLC A;  1SGH A;  3UIO B;  2V3S A;  3WA0 A;  3B1L X;  2JY6 A;  2MP2 A;  1WJN A;  2G3Q B;  2PEA A;  2REX A;  4YL8 A;  3PT2 B;  4ZDV A;  1D3Z A;  1J0G A;  3TBL D;  3U8Z A;  4XZ4 A;  1GNU A;  1BT0 A;  3C0R B;  2CR5 A;  2JUO A;  3DVN V;  4MJS B;  4EOY A;  2GBR A;  3APC A;  4MGK E;  3QK0 A;  2J7Q B;  2JF5 A;  1WR6 E;  2KX0 A;  3PVL A;  4A3P A;  4NAW A;  2JRH A;  3KUZ A;  2PE6 B;  2ASQ A;  2L3Z A;  1WE6 A;  4CO7 A;  3VVW B;  1EF1 A;  4GB9 A;  3VTW A;  1WRD B;  2BKF A;  3KW5 B;  1P0R A;  2AWT A;  1EF5 A;  5AZF A;  2K6D B;  5C1Z A;  1WFY A;  4DHJ B;  5DPW A;  2HD5 B;  3LJ3 A;  1P1A A;  2MBQ A;  1Y8R C;  2HE7 A;  2LRU A;  3QC8 B;  4K7W A;  3U7D A;  2D3G A;  4MEM A;  3RD2 A;  3V62 A;  2G4D B;  4MDK E;  3DCG A;  2KXJ A;  3AU4 A;  3QCA A;  3DPD A;  1U4A A;  1P98 A;  3VAW A;  3KYD D;  4GGQ A;  3L10 B;  4TQ1 A;  4LCD E;  3R3M A;  2CKH B;  2DYB A;  2MLB A;  3HIZ A;  4FBJ B;  2NVU I;  2B3A A;  3H7P B;  2KKC A;  4M8M A;  4ZRJ A;  3M3J A;  4AP4 C;  2M4N A;  3DQV A;  4IUM B;  4G11 A;  2D2Q A;  2KVR A;  2V1Y A;  4E71 A;  2ZPY A;  2RGF A;  3ZO5 B;  2BPS A;  4MH0 E;  2K6Q A;  3HM3 A;  2K39 A;  2LZ6 A;  3X0W A;  1J8C A;  3ZKJ C;  1OEY J;  3KYC D;  2IO3 B;  3CSF A;  2KTR B;  3BY4 B;  4DDG D;  4KSL C;  3VUW A;  3ZNG C;  1YJ1 A;  2FCS A;  2KC2 A;  3X23 A;  3RZF A;  2KN5 A;  3B0A A;  2KOX A;  3PS6 A;  4ANW A;  4F8C B;  3HM6 X;  3JSV B;  4K7U A;  4PYZ A;  4EZJ A;  2WYQ A;  3VH3 B;  2LUE A;  3DDC B;  3AXC A;  2GBM A;  4ASW C;  3IFW B;  2KDF B;  2K25 A;  4AJW A;  2KWU B;  2WX0 A;  3Q3J A;  4F1S A;  3JYU A;  3PGE A;  3DVN U;  2ZNV C;  2AEH A;  2IO2 B;  1FXT B;  3ZNZ B;  1UD7 A;  1WH3 A;  3ML9 A;  2GOW A;  4LJP B;  3PLV A;  5CHW A;  4EZL A;  3EHV A;  2RD0 A;  4M8N A;  4FJY A;  4K81 A;  1V2Y A;  3BIN A;  3VDZ A;  1ISN A;  3ZNH B;  4DDI D;  2XBB C;  2EMT A;  4A3O A;  1TZ1 A;  2GMI C;  4GN1 A;  1WY8 A;  2DAJ A;  5J18 A;  4KIK B;  1XT9 B;  2ZPN A;  4G50 A;  3UQA A;  4IWO A;  3KUD B;  4B9K A;  2OOB B;  4W9K A;  3WAM A;  4P7I A;  4HCP B;  4JQW C;  4PS3 A;  4K1R B;  4RM8 A;  1YX5 B;  4ANV A;  3TL5 A;  3V6C B;  2KJR A;  2G45 B;  3GOE A;  4LJO B;  5JHB A;  2MRP A;  1F9J A;  3ECI A;  3OAW A;  3UIP B;  1KJT A;  3OJ4 B;  2MP2 B;  4ZRI A;  4ICV A;  2R2Q A;  4E74 A;  2J0K A;  1GJZ A;  2IY0 B;  4IG7 B;  1YD8 U;  1IP9 A;  2LVQ A;  3R66 C;  5JHA A;  3UIN B;  1I42 A;  1E8Z A;  2LJ5 A;  1E5W A;  2N9E B;  3ALB A;  2NCN A;  2KMC A;  2IO1 B;  2PJH A;  4MSQ B;  2MBO A;  3IBE A;  4DHZ E;  2DX5 B;  3RT3 B;  2Z0D B;  4FUL A;  2KJH B;  3QWZ B;  4RM9 A;  2LAS A;  3DVG X;  2DZM A;  3ZVV A;  2YVC A;  2IZV B;  2DHZ A;  3I3T B;  4W9I A;  2MW5 A;  1Z2M A;  3ENE A;  5AZG A;  1J19 A;  3ZW3 A;  1H4R A;  3APF A;  2FIF A;  4I6P A;  4WJQ A;  1OEY A;  1YX6 B;  1V5O A;  2JVC A;  2LXC A;  3WAL A;  2C9W B;  1KM7 A;  3H1U A;  2O6V D;  1WM3 A;  3ZDT A;  3A9J A;  3B08 A;  3PV1 A;  2CHZ A;  2L0T A;  2R2O A;  3N32 A;  2XK5 B;  2MBB B;  3VH4 B;  3L08 A;  4EZK A;  3QQ8 B;  3A4S C;  4KZC A;  4BBN F;  1WZ3 A;  1NBF C;  4G0N B;  3OLM D;  2O2V B;  3RYT A;  2N1W A;  2N7D A;  4W9H A;  4WJO A;  1M94 A;  4HK2 A;  1X1M A;  3U30 A;  4DK5 A;  3HHM A;  1R4N I;  1AAR A;  1GC6 A;  4W9F A;  1RAX A;  4ZYN A;  1Q0W B;  2FCN A;  2L76 A;  4TUU A;  2O6V B;  2CS4 A;  2NPT B;  1IPG A;  1UBI A;  4MEL A;  2KK8 A;  5IAA C;  2L05 A;  5DCN A;  2KTF A;  3A9K B;  3AUL A;  4MGY E;  3ZRF A;  2FCM A;  4FA6 A;  4HXD A;  3EEC A;  5CHF A;  4HPL B;  3LDZ E;  5KHQ A;  4NPN A;  5G55 A;  2KJ6 A;  2M17 A;  2KWC A;  4II2 B;  4EUT A;  4NNJ B;  3M63 B;  4W9C A;  2CHX A;  1WGY A;  1K8R B;  2BWE S;  1E7V A;  2DAF A;  2M0X A;  3MJW A;  3UQB A;  2J0M A;  2DZJ A;  3RZW C;  3WIM A;  3IHP C;  3PHW B;  5EDS A;  2K1F A;  3KUC B;  3APD A;  3QHT A;  4X57 B;  2KQ7 A;  3DVG Y;  2DZK A;  4WWN A;  1Z5S B;  2MBH A;  5AZH A;  2K8C A;  2BWF A;  2W9N A;  2N9P C;  1WF9 A;  1RFA A;  2LVP A;  1V6E A;  2JWZ A;  5LXI B;  4KDL B;  4IWP A;  2JRI B;  4HLE A;  2MBE A;  2MWS B;  3IG3 A;  4HWI B;  4IC7 B;  1HE8 A;  2KWV B;  3TJP A;  5D7G A;  3PRE A;  4NQK E;  4PYU A; 
#chains in the Genus database with same CATH topology
 3DBH I;  3I9V 1;  4MM3 A;  5D6J B;  1E90 A;  3P42 A;  1QT9 A;  1NYQ A;  1C4A A;  1P7E A;  3IXS A;  2MCN B;  2ZNV B;  1JW9 D;  4A6Q A;  2NS5 A;  2JXX A;  4FXC A;  4GLS C;  2IDY A;  2DYO A;  4USA A;  3UGB B;  3ZIM A;  4WAA A;  4FJZ A;  2C7H A;  1WGD A;  3AEF B;  1FXA A;  5DPR A;  4LNI A;  4R3D A;  4WUR A;  3W1S A;  1TKE A;  1Q1O A;  2N9X A;  4C80 A;  2DBY A;  2O2V A;  3PSE B;  4LK0 M;  3VR8 B;  4A20 A;  4MJS A;  1FCC C;  1JWA D;  4HRO A;  3AE6 B;  3AH7 A;  3PTF C;  2JT4 B;  1WXV A;  1FPY A;  4A90 A;  3CF6 E;  3FIL B;  4NZL B;  3VTV A;  1YN4 A;  1YQ4 B;  3V60 A;  5JZE B;  3AE7 B;  2I2Y A;  1TT5 B;  1KLG D;  5J2R A;  5E6P A;  1L5P A;  4JL9 A;  3VHT C;  3SDL C;  3DHH C;  4DBG A;  1ET9 A;  1IYF A;  1AYF A;  4CYE A;  5CHV C;  3AED B;  5TR5 A;  2L8J A;  3N30 A;  1K50 A;  4O1N A;  1VLB A;  2PTL A;  4EEW A;  2LWP A;  3ZTC A;  1VD2 A;  1IUE A;  2DNF A;  2DLB A;  2Y5P A;  3KH0 A;  1YJI A;  3NY5 A;  2EKI A;  2D3A A;  4KVG B;  5JH5 C;  1UGM A;  2KMA A;  4FN2 A;  3CIR B;  3NJT A;  5E6J A;  1LQB A;  3P2B A;  1OTR B;  1UUP A;  2UU7 A;  2KDI A;  1S1Q B;  1VRA B;  2G4S A;  1SJH D;  2GLS A;  2ZVO A;  1OQY A;  1V97 A;  4JE3 B;  2LHE A;  5LLI A;  4LDT B;  3NOB A;  3TUO A;  1Y56 A;  1QIL A;  5AUI A;  1SSN A;  4HKQ A;  3L16 A;  4RMA A;  4RGT A;  2O6V A;  3NS8 A;  2MX2 A;  3C8Y A;  1CZP A;  2J42 A;  2LRW A;  3A1Q B;  1K51 A;  4KGT A;  1D5Z C;  1YIW A;  1C4C A;  1NI2 A;  4GOC A;  2FID A;  1E7P B;  3SU8 X;  2L7R A;  5L83 A;  1V1P A;  1KFY B;  4WJP A;  3AMZ A;  1MPE A;  3H6N A;  1YNT E;  4TSS A;  1KLV A;  3NRZ A;  2MSE D;  1GPX A;  2WU2 B;  5E6N A;  3RUL A;  3GE8 C;  1V9J A;  4MGZ E;  4KZ0 A;  3IT4 B;  1XD3 B;  1XQQ A;  1ZKH A;  1YQ3 B;  1KRH A;  4XC2 A;  3W1S C;  4ZRP A;  2H88 B;  4JPS A;  4XGA B;  2XNA C;  2KN4 A;  5DPT A;  2ON8 A;  4W9E A;  2ZEQ A;  1FD6 A;  1RWS A;  5J17 A;  1E7U A;  1GAQ B;  1VJK A;  2PLP A;  1YMH E;  5EE0 A;  2XK5 A;  2UWQ A;  4B0E A;  1RFK A;  1WMH B;  3TCA A;  5CX3 A;  3N1Y C;  1ZPS A;  2WXO A;  5BO4 B;  1SXT A;  1S3S G;  3D32 A;  1I7H A;  3RNC C;  3DBL I;  4IWQ A;  1B9R A;  3TMP B;  1LGR A;  1WJ6 A;  2KFK B;  1PDX A;  4JGH B;  3N3K B;  1C4P A;  1JRP A;  5JXV A;  3Q8C A;  1ZDV A;  1SGH A;  1C79 A;  2MP2 A;  2REX A;  1T0R C;  1D3Z A;  3U2S C;  3I63 C;  1J0G A;  4ZYS A;  1CQV A;  1C77 A;  1AN8 A;  4MJS B;  3DVN V;  1MJD A;  1WR6 E;  3PVL A;  3KUZ A;  2L3Z A;  3VVW B;  1WGK A;  2MHJ A;  1B1Z A;  1OFF A;  1WRD B;  2W82 A;  3W9C B;  1P0R A;  2AWT A;  4N6E B;  5LNK 1;  2HD5 B;  3Q8A A;  2K22 A;  2LRU A;  3V62 A;  4MDK E;  3DCG A;  2KXJ A;  2WXH A;  1P98 A;  3VAW A;  3KYD D;  4GGQ A;  4OW0 A;  3BK1 A;  3Q69 A;  2CKH B;  4M02 A;  5AUK A;  2E6X A;  1FFV A;  2MJE A;  2B3A A;  4ZRJ A;  2AQ3 B;  4M8M A;  3M3J A;  3BVM A;  4IUM B;  2V4I B;  2BPS A;  3DBL B;  4C56 C;  1XXG A;  3Q3O C;  2KTR B;  2JX5 A;  2KC2 A;  2RPV A;  3X23 A;  2BB6 A;  4M0W A;  4OVZ A;  3RNB C;  3VH3 B;  3DDC B;  3AXC A;  3IFW B;  2WLB A;  1PFD A;  2K25 A;  2KWU B;  3Q3J A;  5EE1 A;  3PGE A;  2ZNV C;  1FXT B;  4M00 A;  1JML A;  3DHI C;  1UD7 A;  1WH3 A;  3ML9 A;  1SEB D;  4LJP B;  3J9C A;  3EHV A;  5IOI A;  4M8N A;  4K81 A;  1QOA A;  2E3T A;  3NUH B;  4DDI D;  4A3O A;  3PZ7 A;  5J18 A;  4G50 A;  3KUD B;  4MAC A;  4P7I A;  4JQW C;  4JWU C;  4C4V A;  1HTO A;  4RM8 A;  4DQO C;  3TL5 A;  5JHB A;  2MRP A;  3ECI A;  3UIP B;  3DWG C;  1I4R A;  2AQ1 B;  3AN1 A;  4IG7 B;  4A9A A;  2RMM A;  1ZUD 2;  2LJ5 A;  2NCN A;  3URY A;  1MHH E;  4FUL A;  2KJH B;  3DVG X;  3MC8 A;  2IZV B;  3AEE B;  2MW5 A;  4WQM A;  1Z2M A;  3C19 A;  3APF A;  2L1A A;  2FIF A;  4I6P A;  4PK1 A;  2JVC A;  2LXC A;  2JXT A;  3WAL A;  3ZJT A;  1ROE A;  3RMK C;  2N0S B;  1TS2 A;  3AEG B;  3QQ8 B;  2CU3 A;  3OLM D;  1Q10 A;  1FXI A;  2V3N A;  1CK1 A;  5MPO A;  4ZYN A;  5BYS A;  2CJN A;  2NPT B;  3AE3 B;  3P4P B;  3ZRF A;  2KTF A;  3A9K B;  1SBB B;  4FA6 A;  3EEC A;  4YT0 B;  4HPL B;  2G9H D;  3LDZ E;  2WU5 B;  5G55 A;  4II2 B;  3Q6B A;  2GRI A;  1WGY A;  2DAF A;  2M0X A;  3MJW A;  3BYY B;  2DZJ A;  4A8X C;  3IHP C;  5EDS A;  2DZK A;  5AZH A;  1ZE3 D;  2K8C A;  2BWF A;  2N9P C;  1WF9 A;  1I4P A;  4RFB A;  1R4M B;  5LXI B;  3VRA B;  2MBE A;  2MWS B;  2KWV B;  4OZA A;  3L13 A;  2BYV E;  2KFJ A;  2QSD A;  4NJ7 A;  3A4R A;  1K53 A;  4MT5 A;  4C7Y A;  2KVZ A;  3ZLZ A;  1GG3 A;  4BVU C;  4HDO A;  3L17 A;  2H89 B;  2LVO A;  1KOT A;  1WX9 A;  1MI0 A;  1NI3 A;  1ENF A;  2LEK A;  1FMA D;  4TQ0 A;  2J52 A;  3HRD D;  2W54 A;  1E10 A;  2WNM A;  4FHK A;  3W5U B;  3L0W B;  3H7P A;  2QC8 A;  3DOW A;  3A1Q A;  4L2Y A;  1WXM A;  1GUA B;  4YTM B;  2KAC A;  1QOB A;  1F2R I;  1WXA A;  3QA8 A;  1WE7 A;  2YLM A;  2IO0 B;  2ZVN A;  4RGM A;  3MTN B;  3I57 A;  1QZE A;  4AJY B;  1V81 A;  4GU2 A;  2X8X X;  2N1V A;  2NBV B;  1JAL A;  1TY0 A;  4YWG G;  4ANX A;  3NVZ A;  2WP9 B;  1TY2 A;  1JRU A;  2LI5 A;  1LM8 B;  4DHJ D;  3KQ4 A;  1C3T A;  2A5U A;  4XX5 A;  3DBR I;  3KWV A;  3PZ8 A;  1UBQ A;  1XLN A;  1E6E B;  2L32 A;  3OJ3 A;  2DZI A;  1V80 A;  2VZK D;  3L54 A;  1L0X B;  2FCQ A;  2QJL A;  3U4E G;  2BYT A;  3QAR A;  2KAN A;  5IKC M;  1T6B X;  3AE4 B;  3MHS D;  3MC9 A;  4BKG A;  5FK9 C;  4MGI E;  3JVZ X;  4RF0 A;  4TV3 A;  2ZCC A;  4BOS C;  2Y5C A;  4KV2 A;  1XCT L;  1JWM D;  2IGD A;  1EU4 A;  2JU6 X;  2SEB D;  3H9D A;  3T3O A;  4XYC A;  1C78 A;  1TS3 A;  2NMQ A;  1WX7 A;  3EA6 A;  4WH4 A;  3FKY A;  1V5T A;  2BYF A;  1PQS A;  1WX8 A;  3A33 B;  4N58 A;  3A9K A;  2C7N B;  2PPH A;  1ESF A;  1H8C A;  4XWW A;  4ZHO A;  1KTK A;  3PHX B;  4K7S A;  4F7Z A;  4URK A;  4EFO A;  3AU5 A;  3NZ3 A;  1VZ6 A;  4ZOH C;  3SHQ A;  2XN9 C;  2KDB A;  1FRR A;  1J7B A;  3QIJ A;  3HVD A;  1A5R A;  3ZJV A;  1TGZ B;  3NZU A;  4KIK A;  2OHF A;  2LGI A;  2ACZ B;  1WWT A;  1NEK B;  1PGA A;  3RCZ A;  1V8C A;  2I1K A;  1WZ0 A;  2NR2 A;  3KLS X;  2KTR A;  1TKY A;  5H8Y E;  2KT7 A;  1N61 A;  4II3 B;  3VXW A;  1XCQ L;  4HJK A;  2AYO B;  5E6O A;  1XLO A;  2KQS A;  1FFU A;  1QQR A;  3T3N A;  2Y5B B;  2BBC A;  2XEW A;  4BKS A;  1T0Y A;  4MSM B;  1QF6 A;  3E9S A;  1C76 A;  4FLH A;  2LJI A;  2NPT A;  4GXB A;  4GIV A;  3AI5 A;  4L23 A;  3TEZ A;  1Q5W B;  3KVF B;  4IM0 A;  4GDK A;  1WGG A;  4YTP B;  1T0Q C;  3AE5 B;  2V0G A;  2BS4 B;  2KZR A;  4IDI A;  4B95 A;  1I35 A;  2Z0E B;  3PRZ A;  3AE8 B;  4KKJ A;  4GDK B;  2JY6 A;  2N9K A;  1WJN A;  2G3Q B;  2PEA A;  1BUI C;  2SAK A;  3U8Z A;  1GNU A;  2INN E;  4EOY A;  1EWC A;  3ZXR A;  4A3P A;  2PE6 B;  3AEC B;  1LO5 D;  3DBR B;  1PYW D;  2M56 B;  1EF1 A;  4ARI A;  2BKF A;  3NVW A;  1EF5 A;  1V1O A;  2K6D B;  1NVI D;  5DPW A;  1JWS D;  4LNN A;  4K7W A;  2D3G A;  5BYQ A;  1N60 A;  1NYR A;  3DPD A;  4KX6 B;  4LNO A;  3BVZ A;  4XWT A;  1L4Z B;  4TQ1 A;  1SE2 A;  1F52 A;  3R3M A;  3TEX A;  3AE9 B;  3HIZ A;  1T3Q A;  2ZW0 A;  2KKC A;  3DQV A;  2PVO D;  2D2Q A;  1GOZ A;  2KVR A;  2J4X A;  2RGF A;  2ZPY A;  3ZO5 B;  4MH0 E;  2K6Q A;  4EE2 A;  2N7J A;  2LZ6 A;  3X0W A;  1E9M A;  3KYC D;  3P4R B;  1UF0 A;  2WXR A;  3RZF A;  1BML C;  3PS6 A;  4S17 A;  3HM6 X;  3JSV B;  4PYZ A;  1MFW A;  3NS1 A;  4F1S A;  3ZNZ B;  2PVG C;  4XE0 A;  2WXM A;  1YOV B;  1HTQ A;  2GOW A;  1J7A A;  3PLV A;  2RD0 A;  2RDB C;  1V2Y A;  2WGS A;  4WWM A;  3VDZ A;  3ZNH B;  2JQR B;  1TZ1 A;  1FIQ A;  2GMI C;  4GN1 A;  2DAJ A;  4KIK B;  2KWD A;  2KYW A;  1XT9 B;  3UQA A;  4B9K A;  1XLQ A;  3WAM A;  1I4G A;  2JYE A;  4PS3 A;  2KMM A;  1YX5 B;  2BW2 A;  3FAH A;  4ANV A;  1TJE A;  2KJR A;  3AB5 A;  3RNG C;  2QIL A;  1XO3 A;  1F9J A;  3OAW A;  3OJ4 B;  2N9L A;  2MP2 B;  4ICV A;  2R2Q A;  4E74 A;  2J0K A;  3MC0 B;  4P6V F;  1RYJ A;  1I42 A;  1E8Z A;  4N59 A;  4DHZ E;  2LGS A;  3B9J A;  4RGN A;  3I3T B;  1DOI A;  3P63 A;  3ENE A;  1DGJ A;  4WJQ A;  1YX6 B;  1V5O A;  4Q2J A;  2WS3 B;  2VH1 A;  2C9W B;  3H1U A;  1VDV A;  2O6V D;  1WM3 A;  2CHZ A;  2R2O A;  2XK5 B;  4KZC A;  1WZ3 A;  4G0N B;  4XDD A;  2N1W A;  2N7D A;  4W9H A;  1M94 A;  2HDE A;  4WIP A;  4AS1 A;  2O6V B;  2WDQ B;  4MEL A;  2KK8 A;  3AUL A;  4JX1 C;  4MGY E;  1ZDX A;  5EE3 A;  3VRB B;  4HXD A;  2M17 A;  4NNJ B;  2OED A;  1K8R B;  3I5J C;  1E7V A;  2J0M A;  3IT6 B;  3RZW C;  3WIM A;  1WRI A;  2AQ2 B;  2MJD A;  3PHW B;  2KAJ A;  3QHT A;  2BTE A;  1Z5S B;  4OZB A;  2LVP A;  1YN3 A;  2JWZ A;  4HWI B;  4IC7 B;  1HE8 A;  1TS5 A;  4IOI E;  1N5X A;  3TJP A;  2G1E A;  2KNB A;  3NHE B;  1ZOY B;  4N9F 4;  3AEB B;  3MJ5 A;  1WM2 A;  2Z59 B;  2C60 A;  3CMM B;  1R4N B;  4KSK C;  2BF8 B;  3ZYY X;  5HKH A;  3AE1 B;  2DWQ A;  1WR1 A;  3M62 B;  4AQ7 A;  1VCB A;  3WAN A;  1SF0 A;  4I6N B;  5I4D A;  1YQB A;  3K9O B;  3JSV A;  3NZS A;  4WJN A;  1EO6 A;  1MG4 A;  2RSU A;  3ZNI D;  1L7Y A;  3CST A;  1E0Z A;  3GP7 A;  2BYE A;  2BS3 B;  1FO4 A;  2KHW B;  1PGB A;  3ETR A;  4BOZ B;  1OGW A;  2C7M B;  4KGR A;  1SIF A;  2DEN B;  3ZDM C;  1TTN A;  1N62 A;  1HXY D;  1UGJ A;  1IBX B;  4K3B A;  5BMI A;  1GC7 A;  2JZZ A;  2D10 A;  3VTU A;  1SE9 A;  1UEL A;  2IGH A;  2CJO A;  1PGX A;  1EM7 A;  2ICI A;  2NTT A;  2NBW B;  3WAO A;  3QX1 A;  3AV8 A;  2KO3 A;  4NY0 A;  2MH7 A;  4JIO U;  5GMV A;  2FNJ B;  1WJ4 A;  3S2A A;  2PE9 A;  3ZTD A;  3N20 C;  2JZ3 B;  3W1Y A;  3SFE B;  3T8M A;  2CHW A;  3Q3N C;  4MH8 A;  4B6W A;  2RR9 A;  4GDL B;  4GSW A;  1D5X C;  3PRP B;  3CWI A;  1DOY A;  1N6Z A;  3Q8B A;  1RLF A;  4IKG A;  1FM0 D;  3T9L A;  2BGF A;  3PZD A;  2KD0 A;  4ZRQ A;  1FNV A;  5HHD G;  3P4S B;  3E56 A;  2RPQ A;  4AOF A;  3LYY A;  3IVF A;  3UF8 A;  2N4F A;  2D07 B;  2INC C;  3W5V B;  5BMG A;  4D2K A;  2VRR B;  3SD5 A;  1CJE A;  2PMV A;  1L6V A;  2IBI B;  1VR9 A;  2UYZ B;  3FC4 A;  3P4Q B;  4RGO S;  4HKZ E;  4UDU C;  2HTH A;  5AEK B;  3M95 A;  5D94 A;  1KF6 B;  3R7R A;  2Y3A A;  5DPS A;  1UWM A;  1LXD A;  5G2N A;  4C4V B;  2BVC A;  4BKS D;  3W2D A;  4A55 A;  3VQI A;  4MM3 B;  2WWZ A;  4W9L A;  5IA7 A;  3QAQ A;  4L1B A;  4AUQ C;  4CQN A;  2KLG A;  2A4Z A;  3QJZ A;  1CMX B;  1RM6 C;  1XEE A;  3GZN I;  4LNK A;  1KH0 A;  3ABV B;  2QCZ A;  4PS8 A;  1L4D B;  3SFD B;  4M0W B;  4KKI A;  1F1H A;  2GBN A;  3PPA A;  3PO0 A;  2AL3 A;  5L95 C;  3H7S A;  4OVV A;  2D11 A;  1HEZ E;  2IND C;  1WSP A;  1L2N A;  2WXI A;  2WQY B;  3P1M A;  3EC8 A;  2WXQ A;  1MVK A;  3TEW A;  2KFK A;  5FR6 A;  4DHZ B;  2N7E A;  4GMV A;  2WXN A;  2BT6 A;  3L4P A;  4E3C A;  1WMH A;  3JW0 X;  3ONS A;  4W9G A;  3VFK A;  3N1X C;  4ANU A;  2D3C A;  1AWD A;  1WXQ A;  4BAX A;  2EMS A;  1TKG A;  5EE9 A;  4DXF A;  4JLC A;  3UIO B;  2V3S A;  2QIE B;  3BII D;  2NTS A;  4YL8 A;  3PT2 B;  4XZ4 A;  2JUO A;  2GBR A;  2IJ0 A;  2KX0 A;  4NAW A;  2JRH A;  2ASQ A;  4CO7 A;  4LLG M;  1GB4 A;  5C1Z A;  1WFY A;  4DHJ B;  3LJ3 A;  2YEP B;  2MBQ A;  1Y8R C;  2HE7 A;  3U7D A;  3QC8 B;  4C7Z A;  4MEM A;  2G4D B;  2LUM A;  1HZ6 A;  1U4A A;  3RNF C;  3EUB 2;  4LCD E;  2DYB A;  2NVU I;  4ITK A;  4AP4 C;  2K5P A;  2KDM A;  3HM3 A;  2K39 A;  4P16 A;  1J8C A;  3ZKJ C;  1OEY J;  2IO3 B;  3CSF A;  2WDR B;  2WXG A;  3BY4 B;  2K3U A;  4KSL C;  3VUW A;  1ZP0 B;  3ZNG C;  2W3R A;  3B0A A;  2KOX A;  4ANW A;  4P1C C;  3B2G A;  4K7U A;  2YEP F;  2WYQ A;  4ASW C;  4AJW A;  3JYU A;  5T8I A;  3DVN U;  4RNA A;  4EZL A;  1FRD A;  3BIN A;  1ISN A;  2EMT A;  2WXF A;  4YXD B;  2BB5 A;  2B76 B;  2ZPN A;  5H92 C;  1EWY C;  2OOB B;  3ZGZ A;  2M0A A;  3O13 A;  4HCP B;  2FUG 1;  3ZXV A;  2IGG A;  3V6C B;  1I4H A;  2HTM E;  4LJO B;  2PKO A;  4J3O D;  4ZRI A;  2BQQ A;  1D5M C;  5BMH A;  1YD8 U;  3R66 C;  3ALB A;  4MSQ B;  2IO1 B;  2PJH A;  3IBE A;  2Q5W D;  2DX5 B;  1SE4 A;  4KGS A;  2Z0D B;  3Q14 C;  3RT3 B;  3QWZ B;  4P1B C;  2DHZ A;  2JYT A;  2FBW B;  3GB1 A;  3SR6 A;  1J19 A;  2LHD A;  1H4R A;  1JWB D;  2R61 A;  1KM7 A;  3ZDT A;  3A9J A;  3BYT B;  4B0M A;  2L0T A;  3N32 A;  2QMT A;  3DWM A;  4OZC A;  3L08 A;  2QDF A;  3A4S C;  4US9 A;  1NBF C;  2PW9 A;  3RYT A;  2O2V B;  4WJO A;  2Z8L A;  4HK2 A;  1X1M A;  3U30 A;  3HHM A;  2JWU A;  4W9F A;  1SB3 C;  2L76 A;  1IPG A;  1T5X D;  1UBI A;  5C2T B;  4ARC A;  1V1P B;  2L05 A;  2FCM A;  3BZD B;  5FR3 A;  2WXK A;  5IN7 A;  1ACC A;  2KJ6 A;  1EU3 A;  2KWC A;  3AE2 B;  4EUT A;  3M63 B;  4W9C A;  2BWE S;  5IP4 D;  3UQB A;  4ACF A;  2K0P A;  2RDH A;  2WXJ A;  3KUC B;  3APD A;  3IAM 1;  2MBH A;  2W9N A;  3FIL A;  1TIF A;  1F0Z A;  1V6E A;  1K52 A;  1QOG A;  4KDL B;  3IG3 A;  5D7G A;  1ET6 A;  2VH2 A;  1IGD A;  3RI7 C;  1ZXH A;  1G6J A;  4NAW B;  2WDV B;  2WXP A;  3O65 B;  1HA5 A;  2OJW A;  1FNW A;  2EKE C;  2INP E;  2I1J A;  2L0F A;  2LMC A;  2LFI A;  1HQR D;  1UNS A;  1TYG B;  2IPK D;  1GB1 A;  1T0S C;  2D5G A;  5BYR A;  4KDI C;  3GE3 C;  3IAS 1;  4S0R A;  5D2M B;  1E8W A;  4JWS C;  2LGX A;  4WWO A;  2MQJ A;  2PIA A;  4BFR A;  4LNF A;  4CHK A;  2HJ8 A;  2BKR B;  3MHZ A;  4AWJ A;  1TZO A;  2FUH B;  4DWF A;  3PLU A;  3ZQ4 A;  5KHO A;  3KWL A;  1I4X A;  3ZUN A;  3EFC A;  4RF1 A;  2ZW1 A;  4ICU A;  2LGY A;  3BVG A;  4G3X B;  1IBX A;  4PS7 A;  1WGR A;  3BK2 A;  1P7F A;  4I6L B;  1P9D U;  2I38 A;  1WYG A;  2KC1 A;  2M8S A;  3PRM B;  4IW0 A;  2DYM A;  3V61 A;  2VZK B;  3H8H A;  2K8B A;  3ZJU A;  4BKT A;  2QHO A;  5D3I B;  1L0Y B;  4IM3 A;  2KX3 A;  2ZJD A;  4FHJ A;  3R2T A;  3SEB A;  4GDL A;  1E8X A;  2X38 A;  2WX1 A;  1R4M I;  1ZW7 A;  1WYW B;  4NJ6 A;  4HJG E;  1HZ5 A;  3Q8F A;  3A9J B;  2JPH A;  5HI1 A;  2GB1 A;  1UWX A;  3DBH B;  4ZRK A;  2GBJ A;  1WJU A;  2W3S A;  4W9J A;  2LXA A;  1MG8 A;  1QLB B;  3EFU A;  4HPM B;  1D4B A;  4OVU A;  4EKU A;  3K9P B;  2MJ3 A;  4H2A A;  2J53 A;  4YTN B;  1SIJ A;  1NDD A;  5TSS A;  1P3Q U;  2LGD A;  4US8 A;  2LD9 A;  4FJV B;  4K3C A;  1V49 A;  2J0J A;  3MP9 A;  2K8H A;  3VUY A;  3VUX A;  4M01 A;  2ZZP B;  2MA9 B;  1RRB A;  3EGR A;  4HDQ A;  3ZRC A;  2L83 A;  4WWP A;  4DXA B;  4BBN C;  2EEL A;  2C5L C;  5G5G A;  2IYD B;  3N9Y C;  1V86 A;  1TBE A;  3V05 A;  1ZXI A;  2AX5 A;  1NEN B;  1FCL A;  3V6E B;  5CTR C;  1E8Y A;  2KLC A;  2OJR A;  3TIX A;  2K9X A;  3DHG C;  5LXH A;  2D3B A;  1WI0 A;  1WXS A;  1JWU D;  3WAP A;  3BWU D;  1AW7 A;  1WIA A;  3HK0 A;  2W55 A;  5C3J B;  1OQQ A;  1I4Q A;  1R7S A;  2NBU A;  4WQO B;  3OG5 A;  4NQL B;  5C23 A;  4HPP A;  2CU1 A;  3U7Z A;  2FAZ A;  2ZCB A;  3RUI B;  3R7Q A;  1SJE D;  2WDT B;  1IGC A;  3NG0 A;  3R2I A;  5IO9 A;  4HVB A;  4REZ A;  1UH6 A;  4LDT D;  4TKN A;  3U52 E;  2WHI A;  1ZGU B;  4LTU A;  2RDG A;  2KDE B;  4HEA 1;  4J6I A;  3AM9 A;  2BS2 B;  3Q3F A;  2L00 B;  4HCN B;  2V3P A;  1D6E C;  1EUV B;  4W9D A;  2M1M A;  1UZX B;  2GBK A;  2V4L A;  3ML8 A;  2IY1 B;  1LFD A;  2AL6 A;  1WGH A;  3HVZ A;  4IM2 A;  3DBS A;  1JQ4 A;  1BXT A;  4FAD A;  3VR9 B;  1C1Y B;  4RCO A;  3WA0 A;  3B1L X;  4ZDV A;  4PT5 A;  3TBL D;  4OHJ A;  1BT0 A;  3C0R B;  2CR5 A;  3GS2 A;  3APC A;  4MGK E;  3QK0 A;  2J7Q B;  3Q2A C;  2JF5 A;  3GZN B;  1N5W A;  1FNU A;  1WE6 A;  2HJ1 A;  3V3X A;  4GB9 A;  3VTW A;  3KW5 B;  3OWE B;  2V9H A;  5AZF A;  1DYQ A;  1YJJ A;  1PUT A;  1XLP A;  1P1A A;  4HRS A;  1L6U A;  4YSZ B;  3WCQ A;  1YN5 A;  2TSS A;  3RPF C;  3RD2 A;  3AU4 A;  3QCA A;  3L10 B;  1VZ8 A;  2MLB A;  4FBJ B;  3H7P B;  2M4N A;  4G11 A;  2V1Y A;  4E71 A;  2M19 A;  3NVV A;  3UI3 A;  4DDG D;  4NJC A;  1YJ1 A;  2FCS A;  2KN5 A;  2GI9 A;  4F8C B;  3Q3M C;  1XF5 L;  4EZJ A;  2LUE A;  2GBM A;  4QAY A;  5HG2 A;  1SE3 A;  2JZP A;  5D3D A;  2KDF B;  2WX0 A;  3R8B A;  2AEH A;  2IO2 B;  2FE8 A;  5CHW A;  4YSX B;  4FJY A;  1MHX A;  2XBB C;  1QKZ A;  1WY8 A;  3TSS A;  2JSV X;  4IWO A;  1M4V A;  3LXF A;  4W9K A;  1F77 A;  3NVY A;  5GXG B;  1C9F A;  3Q8E A;  4K1R B;  1VZ7 A;  3GOE A;  2G45 B;  2MEK A;  1KJT A;  3AEA B;  5FKA C;  1GJZ A;  2IY0 B;  1IP9 A;  2LVQ A;  3TEY A;  5JHA A;  3UIN B;  1E5W A;  2N9E B;  2KMC A;  1JRO A;  2MBO A;  2L52 A;  4RM9 A;  2LAS A;  4XDC A;  2DZM A;  3ZVV A;  2ONQ A;  2YVC A;  4W9I A;  1QOF A;  5AZG A;  3ZW3 A;  1JCK B;  1F2R C;  1OEY A;  1DOX A;  3MFG A;  4BZA A;  3HUI A;  3B08 A;  3PV1 A;  1N63 A;  4YSY B;  1OQR A;  4WAF A;  3RNE C;  2MBB B;  5G5H A;  3VH4 B;  4EZK A;  4BBN F;  3RFZ B;  3LB8 C;  4DK5 A;  1R4N I;  1AAR A;  1GC6 A;  1RAX A;  1Q0W B;  1KLU D;  2FCN A;  4TUU A;  2CS4 A;  5IAA C;  1L0V B;  5DCN A;  5CHF A;  5KHQ A;  4NPN A;  3B2F A;  1STE A;  2CHX A;  4RH6 A;  2QEJ C;  5HFY A;  4NAM A;  1J7C A;  2K1F A;  4X57 B;  2KQ7 A;  3DVG Y;  3N1Z C;  4WWN A;  4DXG A;  4ZHP A;  1RFA A;  3RNA C;  1FEH A;  2WXL A;  4IWP A;  2KQ4 X;  2JRI B;  4HLE A;  1A70 A;  3RN9 C;  4C00 A;  4TMA B;  1TS4 A;  3PRE A;  4NQK E;  4PYU A; 
#chains in the Genus database with same CATH homology
 3DBH I;  3L13 A;  4MM3 A;  1G6J A;  4NAW B;  2KNB A;  5D6J B;  3NHE B;  1E90 A;  2MCN B;  2BYV E;  3O65 B;  4N9F 4;  2KFJ A;  2ZNV B;  4NJ7 A;  2NS5 A;  3A4R A;  2JXX A;  2EKE C;  2I1J A;  2L0F A;  1WM2 A;  2Z59 B;  2C60 A;  3ZLZ A;  1GG3 A;  2DYO A;  4BVU C;  4HDO A;  3CMM B;  4KSK C;  2BF8 B;  3UGB B;  3L17 A;  3ZIM A;  4WAA A;  5HKH A;  2LVO A;  1KOT A;  4KDI C;  1WX9 A;  4FJZ A;  2C7H A;  1WR1 A;  1WGD A;  5D2M B;  5DPR A;  3M62 B;  4TQ0 A;  3W1S A;  1E8W A;  1VCB A;  2LGX A;  4WWO A;  2MQJ A;  4FHK A;  3WAN A;  3L0W B;  4BFR A;  3H7P A;  3DOW A;  4I6N B;  3A1Q A;  1WXM A;  1GUA B;  1Q1O A;  4CHK A;  2N9X A;  2HJ8 A;  1YQB A;  3K9O B;  2BKR B;  3JSV A;  3NZS A;  4WJN A;  4AWJ A;  2O2V A;  3PSE B;  2FUH B;  4DWF A;  1EO6 A;  3PLU A;  5KHO A;  2RSU A;  4A20 A;  3ZNI D;  4MJS A;  3ZUN A;  1WXA A;  3QA8 A;  1WE7 A;  2YLM A;  2IO0 B;  1L7Y A;  2ZVN A;  3CST A;  2BYE A;  3MTN B;  3PTF C;  4ICU A;  1QZE A;  2JT4 B;  2LGY A;  2KHW B;  4G3X B;  1WXV A;  4AJY B;  1V81 A;  4PS7 A;  4BOZ B;  1OGW A;  4GU2 A;  1WGR A;  2C7M B;  2N1V A;  2NBV B;  4I6L B;  1P9D U;  4ANX A;  1SIF A;  2DEN B;  3ZDM C;  1TTN A;  2KC1 A;  2M8S A;  3CF6 E;  3PRM B;  3VTV A;  4IW0 A;  2DYM A;  1GC7 A;  3V60 A;  3V61 A;  1JRU A;  2LI5 A;  1LM8 B;  5JZE B;  2K8B A;  4DHJ D;  2JZZ A;  1C3T A;  2D10 A;  3VTU A;  1SE9 A;  1UEL A;  2A5U A;  4BKT A;  2QHO A;  5J2R A;  4XX5 A;  4IM3 A;  3DBR I;  2KX3 A;  5E6P A;  2NBW B;  2ZJD A;  3WAO A;  3QX1 A;  1UBQ A;  4FHJ A;  4JL9 A;  3VHT C;  3SDL C;  4DBG A;  1IYF A;  4GDL A;  1E8X A;  2KO3 A;  4NY0 A;  4CYE A;  4JIO U;  5CHV C;  3OJ3 A;  2WX1 A;  1R4M I;  5GMV A;  2DZI A;  1V80 A;  1ZW7 A;  1WYW B;  5TR5 A;  2FNJ B;  4NJ6 A;  2L8J A;  1WJ4 A;  3L54 A;  2PE9 A;  3N30 A;  3S2A A;  3ZTD A;  2JZ3 B;  2FCQ A;  3W1Y A;  3T8M A;  4EEW A;  2CHW A;  2LWP A;  3A9J B;  3ZTC A;  2JPH A;  4B6W A;  2RR9 A;  1VD2 A;  4GDL B;  4GSW A;  3QAR A;  3PRP B;  3KH0 A;  3NY5 A;  4ZRK A;  2GBJ A;  1RLF A;  2KAN A;  1WJU A;  4KVG B;  4W9J A;  3T9L A;  2BGF A;  2LXA A;  3PZD A;  1MG8 A;  1UGM A;  2KMA A;  4FN2 A;  5JH5 C;  1LQB A;  3P2B A;  1OTR B;  2KD0 A;  3MHS D;  2KDI A;  1S1Q B;  2G4S A;  3EFU A;  4BKG A;  4HPM B;  2ZVO A;  4OVU A;  4MGI E;  2RPQ A;  3JVZ X;  4AOF A;  4EKU A;  1OQY A;  3K9P B;  3IVF A;  2ZCC A;  4TV3 A;  4BOS C;  5LLI A;  3UF8 A;  4LDT B;  2N4F A;  3NOB A;  4KV2 A;  2D07 B;  3H9D A;  1WX7 A;  1NDD A;  3L16 A;  1P3Q U;  2LGD A;  1V5T A;  4RMA A;  2BYF A;  2O6V A;  1PQS A;  2VRR B;  1WX8 A;  3SD5 A;  2LD9 A;  3A33 B;  3NS8 A;  4FJV B;  1V49 A;  2IBI B;  2J0J A;  2K8H A;  3VUY A;  3A9K A;  2C7N B;  3VUX A;  2MX2 A;  2PPH A;  2UYZ B;  2MA9 B;  1RRB A;  2ZZP B;  4HDQ A;  3ZRC A;  4WWP A;  4DXA B;  1H8C A;  2LRW A;  4BBN C;  3A1Q B;  2HTH A;  1YIW A;  2C5L C;  5AEK B;  3M95 A;  1NI2 A;  3PHX B;  4GOC A;  2FID A;  4K7S A;  2IYD B;  5D94 A;  4F7Z A;  3R7R A;  4URK A;  1V86 A;  3AU5 A;  5DPS A;  3SU8 X;  4EFO A;  5G2N A;  1LXD A;  2L7R A;  5L83 A;  1TBE A;  4BKS D;  3SHQ A;  2KDB A;  4WJP A;  3QIJ A;  1A5R A;  3H6N A;  3V6E B;  5CTR C;  1TGZ B;  3NZU A;  1E8Y A;  3VQI A;  4KIK A;  2WWZ A;  4W9L A;  2KLC A;  5IA7 A;  2OJR A;  1KLV A;  3TIX A;  2MSE D;  3QAQ A;  5E6N A;  4AUQ C;  5LXH A;  1WI0 A;  1WXS A;  3RCZ A;  2KLG A;  3RUL A;  2A4Z A;  2I1K A;  3WAP A;  1WZ0 A;  2NR2 A;  3QJZ A;  1V9J A;  1CMX B;  4MGZ E;  4KZ0 A;  1XD3 B;  1XQQ A;  1ZKH A;  2KTR A;  4XC2 A;  1WIA A;  3HK0 A;  3GZN I;  3W1S C;  4II3 B;  3VXW A;  2NBU A;  4WQO B;  4PS8 A;  4HJK A;  2AYO B;  4NQL B;  5E6O A;  5DPT A;  2KQS A;  4M0W B;  5C23 A;  4W9E A;  2ZEQ A;  2CU1 A;  2GBN A;  3PPA A;  1E7U A;  5J17 A;  2Y5B B;  2XEW A;  2AL3 A;  5L95 C;  4BKS A;  3H7S A;  1T0Y A;  4MSM B;  2FAZ A;  2ZCB A;  2D11 A;  4OVV A;  3RUI B;  2XK5 A;  4FLH A;  3R7Q A;  2UWQ A;  2NPT A;  1L2N A;  4GXB A;  2WDT B;  1WMH B;  3TCA A;  4GIV A;  3EC8 A;  4HVB A;  5CX3 A;  1UH6 A;  3AI5 A;  4LDT D;  2KFK A;  5FR6 A;  4TKN A;  4DHZ B;  2N7E A;  1Q5W B;  4GMV A;  5BO4 B;  1S3S G;  1ZGU B;  3D32 A;  3KVF B;  4IM0 A;  2KDE B;  3DBL I;  4IWQ A;  4J6I A;  4GDK A;  1WMH A;  4E3C A;  1WGG A;  3Q3F A;  4HCN B;  2L00 B;  3TMP B;  3JW0 X;  3ONS A;  4W9G A;  3VFK A;  4ANU A;  1EUV B;  2KFK B;  1WJ6 A;  4W9D A;  2M1M A;  1UZX B;  2GBK A;  2KZR A;  2V4L A;  3ML8 A;  2IY1 B;  1LFD A;  2AL6 A;  4JGH B;  1WGH A;  4B95 A;  2EMS A;  1I35 A;  2Z0E B;  3N3K B;  3PRZ A;  4IM2 A;  3DBS A;  4FAD A;  1C1Y B;  4GDK B;  4JLC A;  1SGH A;  3UIO B;  2V3S A;  3WA0 A;  3B1L X;  2JY6 A;  2MP2 A;  1WJN A;  2G3Q B;  2PEA A;  2REX A;  4YL8 A;  3PT2 B;  4ZDV A;  1D3Z A;  1J0G A;  3TBL D;  3U8Z A;  4XZ4 A;  1GNU A;  1BT0 A;  3C0R B;  2CR5 A;  2JUO A;  3DVN V;  4MJS B;  4EOY A;  2GBR A;  3APC A;  4MGK E;  3QK0 A;  2J7Q B;  2JF5 A;  1WR6 E;  2KX0 A;  3PVL A;  4A3P A;  4NAW A;  2JRH A;  3KUZ A;  2PE6 B;  2ASQ A;  2L3Z A;  1WE6 A;  4CO7 A;  3VVW B;  1EF1 A;  4GB9 A;  3VTW A;  1WRD B;  2BKF A;  3KW5 B;  1P0R A;  2AWT A;  1EF5 A;  5AZF A;  2K6D B;  5C1Z A;  1WFY A;  4DHJ B;  5DPW A;  2HD5 B;  3LJ3 A;  1P1A A;  2MBQ A;  1Y8R C;  2HE7 A;  2LRU A;  3QC8 B;  4K7W A;  3U7D A;  2D3G A;  4MEM A;  3RD2 A;  3V62 A;  2G4D B;  4MDK E;  3DCG A;  2KXJ A;  3AU4 A;  3QCA A;  3DPD A;  1U4A A;  1P98 A;  3VAW A;  3KYD D;  4GGQ A;  3L10 B;  4TQ1 A;  4LCD E;  3R3M A;  2CKH B;  2DYB A;  2MLB A;  3HIZ A;  4FBJ B;  2NVU I;  2B3A A;  3H7P B;  2KKC A;  4M8M A;  4ZRJ A;  3M3J A;  4AP4 C;  2M4N A;  3DQV A;  4IUM B;  4G11 A;  2D2Q A;  2KVR A;  2V1Y A;  4E71 A;  2ZPY A;  2RGF A;  3ZO5 B;  2BPS A;  4MH0 E;  2K6Q A;  3HM3 A;  2K39 A;  2LZ6 A;  3X0W A;  1J8C A;  3ZKJ C;  1OEY J;  3KYC D;  2IO3 B;  3CSF A;  2KTR B;  3BY4 B;  4DDG D;  4KSL C;  3VUW A;  3ZNG C;  1YJ1 A;  2FCS A;  2KC2 A;  3X23 A;  3RZF A;  2KN5 A;  3B0A A;  2KOX A;  3PS6 A;  4ANW A;  4F8C B;  3HM6 X;  3JSV B;  4K7U A;  4PYZ A;  4EZJ A;  2WYQ A;  3VH3 B;  2LUE A;  3DDC B;  3AXC A;  2GBM A;  4ASW C;  3IFW B;  2KDF B;  2K25 A;  4AJW A;  2KWU B;  2WX0 A;  3Q3J A;  4F1S A;  3JYU A;  3PGE A;  3DVN U;  2ZNV C;  2AEH A;  2IO2 B;  1FXT B;  3ZNZ B;  1UD7 A;  1WH3 A;  3ML9 A;  2GOW A;  4LJP B;  3PLV A;  5CHW A;  4EZL A;  3EHV A;  2RD0 A;  4M8N A;  4FJY A;  4K81 A;  1V2Y A;  3BIN A;  3VDZ A;  1ISN A;  3ZNH B;  4DDI D;  2XBB C;  2EMT A;  4A3O A;  1TZ1 A;  2GMI C;  4GN1 A;  1WY8 A;  2DAJ A;  5J18 A;  4KIK B;  1XT9 B;  2ZPN A;  4G50 A;  3UQA A;  4IWO A;  3KUD B;  4B9K A;  2OOB B;  4W9K A;  3WAM A;  4P7I A;  4HCP B;  4JQW C;  4PS3 A;  4K1R B;  4RM8 A;  1YX5 B;  4ANV A;  3TL5 A;  3V6C B;  2KJR A;  2G45 B;  3GOE A;  4LJO B;  5JHB A;  2MRP A;  1F9J A;  3ECI A;  3OAW A;  3UIP B;  1KJT A;  3OJ4 B;  2MP2 B;  4ZRI A;  4ICV A;  2R2Q A;  4E74 A;  2J0K A;  1GJZ A;  2IY0 B;  4IG7 B;  1YD8 U;  1IP9 A;  2LVQ A;  3R66 C;  5JHA A;  3UIN B;  1I42 A;  1E8Z A;  2LJ5 A;  1E5W A;  2N9E B;  3ALB A;  2NCN A;  2KMC A;  2IO1 B;  2PJH A;  4MSQ B;  2MBO A;  3IBE A;  4DHZ E;  2DX5 B;  3RT3 B;  2Z0D B;  4FUL A;  2KJH B;  3QWZ B;  4RM9 A;  2LAS A;  3DVG X;  2DZM A;  3ZVV A;  2YVC A;  2IZV B;  2DHZ A;  3I3T B;  4W9I A;  2MW5 A;  1Z2M A;  3ENE A;  5AZG A;  1J19 A;  3ZW3 A;  1H4R A;  3APF A;  2FIF A;  4I6P A;  4WJQ A;  1OEY A;  1YX6 B;  1V5O A;  2JVC A;  2LXC A;  3WAL A;  2C9W B;  1KM7 A;  3H1U A;  2O6V D;  1WM3 A;  3ZDT A;  3A9J A;  3B08 A;  3PV1 A;  2CHZ A;  2L0T A;  2R2O A;  3N32 A;  2XK5 B;  2MBB B;  3VH4 B;  3L08 A;  4EZK A;  3QQ8 B;  3A4S C;  4KZC A;  4BBN F;  1WZ3 A;  1NBF C;  4G0N B;  3OLM D;  2O2V B;  3RYT A;  2N1W A;  2N7D A;  4W9H A;  4WJO A;  1M94 A;  4HK2 A;  1X1M A;  3U30 A;  4DK5 A;  3HHM A;  1R4N I;  1AAR A;  1GC6 A;  4W9F A;  1RAX A;  4ZYN A;  1Q0W B;  2FCN A;  2L76 A;  4TUU A;  2O6V B;  2CS4 A;  2NPT B;  1IPG A;  1UBI A;  4MEL A;  2KK8 A;  5IAA C;  2L05 A;  5DCN A;  2KTF A;  3A9K B;  3AUL A;  4MGY E;  3ZRF A;  2FCM A;  4FA6 A;  4HXD A;  3EEC A;  5CHF A;  4HPL B;  3LDZ E;  5KHQ A;  4NPN A;  5G55 A;  2KJ6 A;  2M17 A;  2KWC A;  4II2 B;  4EUT A;  4NNJ B;  3M63 B;  4W9C A;  2CHX A;  1WGY A;  1K8R B;  2BWE S;  1E7V A;  2DAF A;  2M0X A;  3MJW A;  3UQB A;  2J0M A;  2DZJ A;  3RZW C;  3WIM A;  3IHP C;  3PHW B;  5EDS A;  2K1F A;  3KUC B;  3APD A;  3QHT A;  4X57 B;  2KQ7 A;  3DVG Y;  2DZK A;  4WWN A;  1Z5S B;  2MBH A;  5AZH A;  2K8C A;  2BWF A;  2W9N A;  2N9P C;  1WF9 A;  1RFA A;  2LVP A;  1V6E A;  2JWZ A;  5LXI B;  4KDL B;  4IWP A;  2JRI B;  4HLE A;  2MBE A;  2MWS B;  3IG3 A;  4HWI B;  4IC7 B;  1HE8 A;  2KWV B;  3TJP A;  5D7G A;  3PRE A;  4NQK E;  4PYU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...