2IJ0A

Structural basis of t cell specificity and activation by the bacterial superantigen toxic shock syndrome toxin-1
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
191
structure length
191
Chain Sequence
b'DNIKDLLDWYSSGSDTFTNSEVLDNSLGSMRIKNTDGSISLIIFPSPYYSPAFTKGEKVDLNTKRTKKSQHTSEGTYIHFQISGVTNTEKLPTPIELPLKVKVHGKDSPLKYWPKFDKKQLAISTLDFEIRHQLTQIHGLYRSSDKTGGYWKITMNDGSTYQSDLSKKFEYNTEKPPINIDEIKTIEAEIN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Toxic shock syndrome toxin-1
publication title Structural basis of T-cell specificity and activation by the bacterial superantigen TSST-1.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Protein binding
total genus 47
structure length 191
sequence length 191
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2ij0A02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2ij0A01
1SE4A 3R2TA 1BCPF 1S5CD 1PZKD 2IJ0A 1SE2A 1HTLD 1RF2D 1EU3A 1KLUD 1PTOF 1SJED 1PRTF 2AQ2B 2XRSD 3BYYB 1PTOC 1DYQA 1JQYD 1JWMD 1PTOD 5D3DA 1ET6A 1I4RA 1PRTD 1RDPD 1XXGA 3DWQA 1TS5A 1M4VA 1KLGD 4OHJA 1JCKB 5ELCA 1QILA 1SXTA 4RH6A 1LT4D 3URYA 1FNVA 1EEFD 1EWCA 1LT3D 1STEA 4K6LA 4C56C 1I4QA 4Z9CB 1V1OA 1D5XC 4TSSA 1GOZA 1YN3A 1LTRD 1ESFA 1HXYD 1UNSA 4L6TB 5FK9C 1LO5D 3V05A 1EU4A 1BCPC 1JR0D 4NZLB 1HA5A 1D6EC 1BCPD 1CT1D 1EEID 1SBBB 4RGOS 1UUPA 2QILA 3BVGA 4L63B 1BCPB 1PRTC 1PZJD 1LTAD 1KTKA 1F77A 1PTOB 3EFXD 1PRTB 4RGNA 4DXGA 2IPKD 1FD7D 1S5BD 1B1ZA 2RDHA 2XN9C 1AW7A 2NTTA 1LTID 1CHPD 1LTBD 1CHQD 2CHBD 2O2LD 1HQRD 2J4XA 4BWGB 1TS4A 2TSSA 3R2IA 1LT6D 1ET9A 2R61A 3DWAA 1I4HA 3MFGA 1XTCD 1YN5A 1TY2A 5D3IB 1BXTA 2WV6D 3W2DA 1JWSD 1MD2D 1EFID 1SEBD 3BVMA 3KLSX 1S5FD 1LTTD 1PTOH 1FNUA 3R8BA 2NTSA 1I4GA 4RFBA 5ELDA 1PYWD 1ENFA 3GP7A 1LT5D 1SJHD 5I4DA 2RDGA 5FKAC 1CK1A 1S5ED 1S5DD 2AQ3B 4UDUC 5ELBA 3DWPA 4RHRA 1SE3A 3BVZA 2QEJC 1AN8A 1TS3A 3OWEB 1CQVA 2XRQD 1JWUD 1TS2A 3O13A 1YN4A 1LTGD 1RD9D 1V1PA 4ZYSA 1LLRD 5ELFA 2XNAC 1L0YB 4RGMA 1T5XD 3BYTB 1DJRD 2G9HD 1I4XA 1I4PA 3EA6A 3TSSA 2SEBD 3CHBD 1D5MC 1LTSD 2AQ1B 3MC0B 2ICIA 4RHSA 4O1NA 5TSSA 1B44D 1FGBD 1L0XB 4RGTA 5ELEA 1TY0A 1V1PB 2Z8LA 1G8ZD 3BZDB 3SEBA 1RCVD 1FNWA 4RCOA 4DXFA 1PZID 1D5ZC
chains in the Genus database with same CATH superfamily
1WXQA 3KYCD 3HZXA 1U9RA 5AUKA 1W6KA 3GTGH 1RRBA 3KF8A 2D5GA 4B9KA 5ELNA 4X3SA 4YWLA 2VB2X 4RKLA 4X65Q 1JWMD 2F3VA 2JK8A 4K14A 4A3IB 1RTNA 3R3OA 1RDPD 2VW9A 5AEKB 1QCBD 5BMHA 2JP1A 2UU7A 2ZJDA 5EPJA 2KOLA 2KEDA 4YWKA 3AE5B 3W1SA 2WU2B 2DYBA 2W3SA 4B6WA 5AZFA 3PV0A 1E8ZA 3M9BA 1XX8A 2L12A 4DK3C 2WLBA 1X55A 1L6VA 2K6DB 3K57A 2ZCCA 2KN4A 3S17B 3RNGC 1WFQA 2V3SA 1LXDA 2NBVB 2Z0SA 1HXYD 1UGJA 4FXCA 1WI5A 1BCPC 4IUTA 1QG7A 3PUWA 1BCPD 1Z2MA 3CRKC 3PLVA 2QILA 2EXZA 3U4VA 1QVCA 4DFAA 1WM2A 2UXCL 2AL3A 1XPRA 3J7AF 3PTFC 4H2AA 5BO4B 3QCAA 3Q6BA 1STHA 2Q8TA 3FPPA 1Q3LA 1A62A 3CMAA 1WTOA 4GLAC 1FPYA 4K5VA 2N9EB 4AOFA 3ZNZB 3L7ZC 4A3OA 4NAMA 2B2WA 2KECA 4NB3A 1S5BD 4L8JA 1G51A 2WB1E 4CDEC 2L0TA 1LFDA 3ZNGC 3ZTCA 3L16A 5BMGA 2HCIA 3MFYA 4HAEA 3U4ZA 4CJ2C 3AQQA 4CYEA 2NCNA 1W6JA 3N1ZC 4KK7A 2PTLA 4WQOB 4ZRZA 1UEAB 1A5RA 1LT6D 2WFWA 3A7AB 4TV3A 3K5MA 1J7BA 5IWAL 2F0EA 2L0CA 3L0WB 3L2PA 2AX5A 3HIZA 1JWSD 1HNWQ 1V5TA 3I4MH 3A54A 4HJAA 4IWOA 4ILWA 1TWHH 2L4NA 1HNZL 1WJ4A 2ZXOA 1IBLL 1P1AA 3GOEA 3V62A 3TS0A 5IYDH 2RHSB 3M4YA 1D7QA 2XWJB 2K0PA 4B0MA 3UI3A 1XYIA 4NMZA 1H4RA 1KOTA 4FJVB 2AWOA 2Y3AA 3W5VB 4JI4Q 4XDXA 4OZCA 2EY1A 2JQOA 3DM3A 3KUCB 5M3MH 4OL7A 2NWGA 5H8YE 1XMQQ 2LXCA 4S3SA 1X3EA 5JHBA 1D1IA 4ID6A 1NMGA 1JWUD 4M00A 5CC4A 1TWCH 1JRPA 5IO9A 2R93G 4O0AA 3ZJYC 1ILQA 2SAKA 4ZRJA 4KD3A 4KY6A 3BJUA 1U4AA 2O2VA 4DAYA 4RMFA 1I3QB 5I9PA 3UF8A 1Q5WB 1ZGUB 4MELA 1GB4A 2NPTA 4TQ0A 1PXUA 1TWGB 1Y8PB 1FXTB 2ASQA 1J6QA 4S17A 3NWTA 1AYFA 2AQ1B 5EBCA 4O1NA 4LDTD 2RA4A 2H1EA 5TSSA 1YX5B 3HK0A 4FA6A 4YT0B 3CPFA 1JC7A 3W5OA 4KSKC 2B2UC 2UXDL 4RF1A 3DQVA 4U673 4HVBA 3LNNA 1VQHA 1IBML 4S0RA 3NY5A 4K0KQ 2LS01 4IO9A 1WGKA 2F0NA 3JAMc 4X57B 2W3RA 4KI0A 3IBEA 1EIFA 3AB9A 1HEZE 5HURA 3A8IE 1LTLA 3Q3NC 3JW0X 1PTOF 5D6JB 1WXAA 4B3SL 1JJCB 5EQ0A 5C4XH 1IKMA 2LFIA 2WXPA 2NUCA 5KHOA 5IA7A 2KEEA 4ANUA 4RM8A 3HVZA 2EOTA 4DDID 4A3IG 3SR1A 3OAWA 2FMMA 4JI1Q 3RULA 1GUGA 4KIKA 1EQQA 2KENA 3MXGA 1A6XA 5C4JH 3Q8AA 3SK5A 1CQFA 3ZNHB 1BR9A 2L1BA 2C5LC 1V6EA 1YIWA 5JHAA 1DGSA 3CCSA 4A3FB 1WD1A 3E6ZX 1D2BA 2K32A 2PPBC 1ZKOA 4DDGD 1VQ6A 2QCZA 1I4QA 4OO1G 1FRDA 1PH1A 2L05A 4LNFA 4DXAB 1YN3A 2F0JA 2K33A 4PG3A 2BH8A 1U4RA 2NN6H 3UIPB 5CHVC 5M5YH 2V4LA 4X64Q 3A7LA 2B29A 2MJEA 4HCEA 3M7NA 2NVQB 4NPNA 3AEGB 3UINB 4DUZL 1QZHA 1K0RA 2PQEA 2OTLA 1STYA 1CJEA 2HCCA 1TKYA 1WSPA 1MKHA 4EE2A 2L7RA 1BCPB 4HTHA 4C3JH 2WDQB 4JI8Q 4G3XB 4DHZB 3GTKH 3J81i 3QHTA 4KKSA 3BK2A 5C3XA 1GUTA 3JVZX 1QOHA 1CM9A 2XTIA 1B9NA 4DV7Q 1CHPD 3A74A 3KOJA 4DR4L 2EKIA 4KKTA 1MGSA 1C9FA 2AWTA 2KTRB 1VZ7A 4OX9Q 3N9YC 1YNJC 1C8CA 2SNMA 2D0PA 3P1HA 3K5OA 1YNJD 2I5MX 1VQOA 4A3GB 4XTCS 2EY2A 3OHXC 1ET9A 5C44B 1K8AC 2G4SA 3IAM1 3PHWB 4KKJA 3RCZA 4DWFA 2WV6D 3TEWA 2N55A 3K0XA 3H8HA 1EFID 2KFJA 3N6RA 1LQBA 1S5FD 4POFA 2DLBA 1OQYA 4PNYA 1IYFA 2VZAA 3S14H 2NVXB 2Q2UA 1YJJA 3C3LA 1XLNA 4YTPB 1AE2A 1ZEQX 4USAA 3S15B 2LASA 2CHXA 1LT5D 4DGZA 1EYDA 3KLRA 1QOFA 4JE3B 2E5LQ 2BBCA 4B3MQ 4IUMB 1IGCA 3LX0A 1WIAA 3EFUA 4GNXB 4HSPA 1J5EQ 4OW0A 4L1BA 2QEJC 5J22A 3ALBA 4OVUA 4HIOA 2OJWA 4P2CB 5JPMC 2D3BA 2D0OA 4IM2A 1Q8IA 2PI2A 2DJGC 5EPLA 3AYHB 1Z7TA 3T53B 2IO2B 2DZKA 3BYTB 2KWCA 4MJSB 3TSSA 3EA6A 2IWHA 4R4OA 2X69A 1N60A 1WZ3A 2EYPA 1E7VA 1V8CA 3VR8B 3WALA 3DBHB 1E2WA 3E3XA 1F9RA 4IKGA 1XLQA 4C7YA 1L0XB 1CZWA 4KHZA 2LGDA 1G8ZD 1FXAA 2LRWA 1JROA 4OXPA 1NDDA 3MAQA 2JA7B 1PLFA 2YEPB 1SE4A 2CJOA 2O4XA 2EMSA 1S5CD 1V49A 4YCUA 1VR9A 4XT1B 1WMHA 2NMQA 3I5JC 4FADA 5CBEE 1CA5A 4AYBB 1HTLD 4OONA 4JBKA 3CP0A 3RZWC 1BBUA 3A4SC 1A70A 1CFMA 3DUZA 4BBRH 4EQPA 1WJUA 2GI9A 3BY4B 2PIAA 3F8TA 2KHSA 1Q8KA 1TS5A 4WJWA 4MH8A 2BYEA 1Y8RC 2MBOA 2K5DA 4RG1A 3VR5A 2LHDA 5ELCA 3RNEC 3RNCC 4DA2A 3NRZA 3GTLH 3A5UA 4NPSA 4OIKA 3QOLA 2M00A 4JI2L 1ML0D 2E8GA 2R93H 4A3FG 5T1IA 2D3CA 3ZRFA 2ZM6Q 1B70B 4AH6A 1O7LA 1F2LA 5LMUL 1VRAB 4NKLA 3VR4A 1HZ5A 1UUPA 4TRDA 4RWSC 1P7FA 1V80A 2KMAA 2KDBA 5KYLA 1J19A 1PZJD 2D2QA 2FBWB 1OEYA 1QWYA 2DY7A 3CRLC 4HIKA 1E9MA 4MZ9A 3PIP3 4DXGA 2IX1A 2MRPA 4JI6L 3HOVB 3V6EB 1R9TH 3VTWA 1AW7A 1K9MC 2NTTA 3HRZC 2MH7A 4OZAA 4KMUC 1L2FA 1A2UA 3A9JB 3UQAA 4WJ4A 3HOZB 3I72A 1WGGA 2C9OA 2M9VA 2J4XA 2B2WC 5EE9A 5C1ZA 2L3ZA 2K5NA 2MPMA 2UUAL 2LGYA 3UE0A 4YY3L 5EE3A 1VMCA 4K6DA 3MFGA 1WY8A 1YN5A 3I55A 4A3GG 2CJNA 4K7UA 5C44G 1BDOA 1Y14B 3AMUA 4B08A 3M4PA 3X3MA 2SNSA 1X3PA 1L2NA 2D62A 4KY5A 1PTOH 4J6IA 1FCCC 4ZK9B 2NTSA 2CQAA 3AMZA 4XXEA 2CKZB 2KFKA 1EM7A 2W55A 1IBXA 4RAUC 5D94A 3GTPB 4OO1H 2YV5A 1E5WA 3CCRA 3QIJA 3H15A 4HJ8A 4OVZA 2GRIA 2JVCA 2A8VA 2K1BA 1K3BC 2HHHL 1ILPA 2M0XA 4DAPA 2B3AA 1SR3A 2YU9B 4XIGS 1WGDA 2IY0B 4A76A 4HJGE 1HE8A 4HMJA 3BDOA 3I2ZA 3VDYA 1XLPA 2NYZD 4E71A 1F2ZA 1SYEA 2XNAC 2OT2A 4DV2Q 5AJ3Q 1FMAD 1UF0A 1VQCA 2NB0A 4YTNB 2VZKD 2XIWA 3MHSD 4G7HC 2FMCA 1CTMA 1ASYA 4ASWC 1OXVA 3TEHB 3CXCA 3NP8A 2NBFA 5JPNC 5MPOA 1VQJA 4DF7A 1V5OA 4TQ1A 2N3SA 5EJWA 4DNIA 1VQ5A 2BWFA 1X56A 5FLMG 2M0AA 2JA7G 4IG7B 4IURA 2CQOA 4IJHA 3TL5A 1PHJA 3KQ4A 4MH0E 3IVFA 3RD4A 4MGZE 4HPMB 1BVSA 5D3DA 4ZCKA 4II2B 3WOFA 2W54A 2DN8A 2H5XA 5K36G 3VRAB 3OIPA 3HS0C 2CCZA 2ICEC 3RFZB 3GDEA 4LCDE 1X3QA 4ME3A 2OCEA 1FO4A 3U50C 1MBYA 5GXGB 1ZOYB 2B2YA 1UEBA 3BU2A 1RLFA 1BO0A 4Z9CB 4X62Q 1E22A 3DVNV 3LJ3A 4HEDA 1V97A 1SLJA 3BDLA 3L13A 4HJKA 1S72A 2JA6H 1PH5A 2RKSA 2JXMB 1WXVA 1UBQA 2HDLA 2JZZA 2K39A 4NZLB 1H9RA 1BOSA 2A5HA 2K01A 4LF4L 3HM6X 3ZUNA 1OXSC 1CSPA 1SYFA 1FIQA 1XO3A 1JALA 1ZPSA 4JK1C 4KJNA 1ZP0B 4AQYL 2E75C 2EYHA 2JN4A 2BE5C 4QCLA 2GLSA 3D4WA 3Q6SA 3L10B 1A2TA 2BE5D 2AL6A 5FLXE 4JIOU 1PH2A 3LXFA 1K83H 5EBDA 2WYQA 3QJZA 3U7ZA 5KNCA 1F9JA 2KUMA 1VQ7A 1L0WA 3HOVG 4C1NI 3LYYA 3PMFA 1ZYRC 3PCOB 4W9LA 2BKRB 2WINB 3HOZG 4LF5Q 3L08A 2JU6X 5GQOA 2Q8IB 3V60A 1BXTA 2JT4B 5TR5A 4GGQA 1BKBA 2A1AA 1CI3M 1TWCB 1SEBD 3KLWA 2OQ0A 3BZCA 3K80C 3O65B 3A33B 1TIID 4IUUA 3R8BA 5IYBG 3Q69A 1MSHA 1I4GA 3ML9A 5EE0A 1RJTA 3CWIA 3W9CB 4X3UA 4FP5D 3M3JA 3QO2A 3G6EA 3IT4B 1UE6A 2AHOB 2F52A 4LK0M 1F0ZA 2KCNA 5E6JA 2A19A 4ALPA 5J18A 3ZDTA 1DONA 3CCMA 1SE3A 2C7NB 3A56A 1PDQA 1EQTA 3T1YQ 5C6AA 3OWEB 2O5IC 5KHQA 3SHQA 3D0FA 4OWTB 3VAWA 4EUTA 4LFCQ 1H9JA 1E2VA 1WTWA 4GKJL 2MSED 3CSFA 3Q2AC 4IFDJ 1RFKA 2XGTA 2DENB 2VL6A 3ZLZA 1U4MA 4DR5L 3I4LA 2F3WA 1EIYB 1FL0A 4XDCA 1WTPA 2R7DA 2D10A 1GJZA 1E2ZA 1B9MA 4EQOA 1KNAA 2ZXRA 2KNBA 1HJPA 4GN3B 1GHKA 2E2HH 4ABNA 2WDRB 4K8JA 2VZKB 1B44D 5C0XI 4M8MA 1V2YA 1WYGA 3OTOL 5C4JB 1ENAA 2WAQE 2ZJPA 2DWQA 4IN3A 4DXFA 4A3GH 4N59A 3ZJUA 3R2TA 1DD2A 4CJ0B 3NHHA 1O78A 2V1CC 4IPHA 5H1SE 1GHJA 2MFIA 1N32Q 1FGUA 2AQ2B 5C4HA 2N0SB 1P16A 1UH6A 4IFDG 2B8FA 5M5YB 2MO1A 2PKOA 2NVXH 1WTRA 4US9A 4X6AH 2BYFA 2HDMA 1HRJA 1K28A 3S15H 4IPGA 3UE1A 1GM5A 4C3JB 2KDEB 2L1AA 4IUVA 2YTVA 4DPGA 1SXTA 4R8IA 2EZVA 3H7SA 4K2KA 3PV1A 3PO2H 1N36L 1FJGQ 5IP7H 3J81E 3GV3A 2Z6BA 1V86A 3APDA 4IUNA 1E0BA 4C3HB 1UELA 1TZOA 1V1OA 1ZDVA 2WX0A 3J9CA 4HPLB 4TSSA 4ZKCB 2K6AA 4BFRA 1ESFA 1MJEA 3DEOA 2QGQA 1RM6C 2JPHA 3K7AH 3N52A 3U58A 1Q81C 2EJMA 1WZ0A 1SBBB 1YBYA 2D2CC 4O42A 3V96A 3ZRCA 3CF5A 3HFZB 5IE8A 3S1QH 4GLSC 1IKLA 1VMPA 3RNFC 2D5DA 3PPAA 4A9AA 3EUB2 4DR1Q 4LFAL 2WXIA 3AEFB 1NI2A 3TS2A 1G6ZA 5C2TB 3CCQA 5FLXc 3D8GA 3D4DA 2WXOA 1BT0A 3ULJA 4JI5L 2EXDA 4A4IA 1IBKL 5CYUA 4XQQA 4EOYA 1SNPA 4F8CB 1EYGA 1AP0A 1SAPA 1TS4A 5CV4A 3QX1A 2FCMA 3VR2A 3E9HA 4QUCA 1UBIA 5FO8B 3F1ZA 5A2QE 3ZW3A 5M3MG 4LF9Q 3ONAB 3UQBA 2LVQA 3T1HQ 1WFYA 4LNOA 1XWEA 1Q1BA 3QB3A 4KKUA 1LTTD 3NBHA 4A3EB 1JMLA 1TKEA 3B6YA 1WJNA 1WM3A 1ENCA 1VQFA 4XWTA 2GBJA 1HUMA 4DR7Q 3FILA 2RPQA 4DR3Q 4KIKB 3H6MA 2PNHA 2WXJA 2JJQA 3DVGX 4LWCA 1YQ3B 3M63B 1NYRA 1CKOA 1JICA 4P71A 1KL9A 1YJIA 2KYWA 4JI3Q 3GTJH 1WRIA 3DWPA 2KWDA 4Y7NH 4RHRA 4A3DB 4ZHPA 2WNMA 3HEJA 1MHHE 1OO9B 5CR3A 4M01A 2GB1A 1N33L 4GN1A 3AFQA 1XNQL 1TS3A 4HCSA 2KMCA 3OG5A 3KK7A 3SVMA 1XNRQ 3Q24A 1YN4A 4URKA 2BDNA 3HP3A 3GTQB 3TCAA 2KLGA 4ZYSA 1JORA 3MP9A 4MSQB 2BS2B 1JMCA 1PA6A 2JF5A 2XWBB 1V9JA 1PFSA 1X32A 2RHQB 4JX1C 3ZKJC 4BBRB 1C77A 5C4XG 1XMOL 2LGIA 1UE5A 1KRHA 4LF8Q 3ONSA 1XCTL 1GO3E 3VXWA 4FF2A 4IDIA 2GBNA 4HCNB 2L0FA 4WWOA 2FUHB 4ZQ3A 4UY8C 5IGDA 2AUJD 2GVAA 3GTLB 1UWVA 1TWAB 4BXXG 4RNAA 2B8GA 1UWXA 4QQBX 2A68C 3V2TA 2A68D 3AV8A 4Y52H 1QB5D 5DPSA 4LF6L 2KMMA 4DR6Q 1WR6E 3AU5A 2WXFA 4C1NK 3QQ8B 3VR3A 3K6OA 4KGRA 1QOGA 2KC2A 1ZE3D 1IGDA 1BUVT 4DUYQ 1I4RA 2NN6G 2R3ZA 4TQUS 1Y1WH 2PQAA 3FEWX 4GU2A 1VQ4A 3RZDH 2BPSA 3DPDA 2OQKA 4MN3A 4C3JG 4LF7Q 1FEHA 3KJPA 1JB7A 4DV0L 1R9TB 1HZCA 2AMCB 2KJXA 3P7JA 2IYDB 4Q0FA 2KJ6A 2QC8A 3RI7C 3ZIMA 1GPXA 3UDXA 3APCA 3M4OB 2D3AA 3B0AA 3SD5A 1GOZA 2JE6I 4GN5A 5GAGC 3L0OA 1KHIA 4C3HG 3J81c 3QAQA 5J39A 3T51B 2B2YC 2GVBA 2LWPA 3KF6B 5C3EH 1QZGA 1EEID 3NEMA 2VXWA 3MTNB 1IP9A 2PZUA 4HJ5A 3Q3OC 1WCMH 4B3TL 4ZRKA 4YSZB 3ETRA 4HROA 4NQLB 2WP9B 2UUBQ 2K75A 2N88A 1R4MI 4GN4B 3NS8A 4MT5A 4DV6L 1QUQB 1PTOB 1PDXA 3AM9A 4FLHA 2HUGA 1NJIC 2KHWB 2ASBA 2IHFA 2L55A 3ZGZA 3M7GA 1CHQD 3HHMA 1EWYC 2L00B 3GZNI 2RSOA 4JPSA 4JWUC 1NCVA 4IFDH 3R2IA 2NVTH 4LFBL 1CUKA 2NBUA 4A6QA 4CQNA 5LMNL 2JXXA 3NS1A 2RQXA 4PS7A 3PQIA 3PUVA 2BS4B 4K3CA 3I90A 4JI7L 2B2TC 3F2CA 3DBLB 2N1WA 3KYDD 4A3EG 3MZ5A 1MHWC 2CS4A 1GD7A 3DHQA 4IZ8A 1I50B 1X6OA 2RDGA 4KJOA 2MHVA 4NJ6A 4AS1A 4R1JA 4JYAL 1UE1A 2HJ8A 2K3UA 1IW7D 4YTMB 4IUQA 4A3DG 1NEKB 2QA4A 3W3AA 1IBXB 5BR8Q 1G2TA 1U4PA 3EN2A 3I73A 4JI0L 3L9AX 2INNE 1DOMA 4K3BA 5BMIA 2ZPNA 5LNK1 3S9WA 1HTPA 2QDBA 4A3CG 4HR7B 1L0YB 4NXNL 2DX5B 4RGMA 1T5XD 3H3VI 1B50A 2K9XA 3H3VC 3KBXA 2LZ6A 2SEBD 3VYRA 1QVFA 4AP4C 4JGHB 4CJ1B 3PIPA 4FF4A 3N3KB 4GMVA 3RMKC 4J8QA 4BBRG 2OJRA 4KGSA 2LXJA 1CSQA 4DHZE 3SE0A 2K5PA 3GV6A 3EGRA 3JSVB 2J0TD 3RLFA 3S1NH 1TU2B 4NDXA 3AE3B 3B2GA 3LWEA 5E6OA 2FXQA 4WIPA 4LJPB 3VVWB 1QVGA 3EHVA 3NZUA 1VZ8A 4W9KA 1X9NA 1G91A 1SE2A 1STGA 1A0IA 4K7SA 2LMCB 2K8HA 3I91A 2L83A 2V3PA 1VF7A 3MXNB 1TWFH 2JA6B 2RGFA 4YSYB 4B0EA 4AIMA 4KHPL 2FNJB 2YLMA 5IN7A 4C00A 4B3RL 2MJDA 3J7A5 5G55A 2KCMA 1PFMA 1MG4A 4PMWA 3I4NH 5L37A 1QILA 4X66L 4I65A 1OQQA 1JE5A 2ZPYA 2CU1A 1K83B 1STEA 3DMUA 4C56C 1T0YA 2E74C 2RPVA 4P1BC 2BB6A 2DNCA 1KNEA 1FR3A 2R2OA 2B3GA 3PGEA 2ZXPA 2K5WA 3NZ3A 3GTOB 5DNFA 1N9WA 4YHHL 4L5SA 2NZOA 5KNDA 5ISRA 4HCPB 4MEMA 1L6UA 2UU9L 1C0AA 3L17A 1UZXB 4EZJA 4QL5A 4K1RB 3T4AC 1NNXA 1KTKA 1F77A 1F2MA 3K0YA 2DYOA 4RGNA 1FFVA 3TEXA 2IPKD 2KANA 1FD7D 4BXXH 2NVUI 5J2RA 3HKZB 4A3LH 5JXVA 5E7NA 1VQAA 4YCWA 2IW3A 2VY3A 5G5GA 3P4RB 3NVWA 2KX0A 4CHKA 1EWIA 1O7IA 4A3PA 1SYBA 1RHPA 3PIO3 1YOVB 2BYTA 3CF6E 4NAWA 3P4PB 4ZUJA 4LW1A 2CH4W 1C7YA 1EY4A 1JJ2A 2GBMA 2HQLA 1SNQA 3QWNA 1KABA 3AU4A 4G11A 3AXCA 2J53A 4BA2I 5C5LA 5BYQA 1HQMC 2K03A 4KZCA 4QIWE 3T8MA 1X3FA 2EYOA 3BZKA 2KK8A 2VQEL 3CU7A 3P2BA 4J3OD 1EY5A 2C60A 4C7ZA 2CW0C 2G5DA 2CW0D 3ERSX 1I42A 4C3HH 4PMCA 5ELBA 1Y1VH 2E2HB 1VD2A 2G1EA 2M8SA 3FKIH 3EJIA 4JV5L 3PVLA 1L0VB 3I7FA 1ZXIA 1D3ZA 2IT1A 2F4VQ 1L4DB 4NXMQ 1EUVB 2MBHA 4YWGG 3DDCB 2AEHA 4KDLB 1KDAA 4IPDA 1T0RC 2EJGC 2RVLA 1C76A 1V1PA 3RN2A 1HR0Q 4EFOA 4FN2A 2CKHB 2J0KA 4FHJA 4G50A 1RIPA 2F0SA 2PMZB 4MTNA 4CDFC 4DR2Q 5G5HA 3CCVA 2XK5A 1VQPA 3RT3B 1AH9A 5CBAE 4LNIA 1LTSD 4H44C 2O5JC 1K52A 1LV9A 4ZRIA 2C7HA 1P9DU 2F0KA 1E8WA 3AEVA 4JOIA 4H0LC 1WJ6A 4F87A 2QIEB 3EROA 4WQMA 3ZQ4A 3FHWA 4P73A 2UUCQ 2L11A 4N6EB 4P6VF 4J1MA 2X6LA 4BBSH 3PO2B 2KQSA 4HEA1 1E90A 3MWYW 1YEZA 4HJ7A 2PZTA 3CCJA 3NENA 2FAZA 4A90A 4A3EH 1H95A 3AE4B 1E0ZA 3K7AB 1JQYD 2DGYA 2WGSA 1ROEA 3GD7A 1NYQA 1PH8A 5JAVA 4QUFA 2JA6G 3OJ4B 4GOPA 5HGQA 1K8OA 3PUYA 3S1QB 2HD5B 5E6NA 1WGRA 1VQDA 3FDTA 4ODGA 1SYCA 3U9SA 3CMEA 4M0WA 1TKWB 2LXAA 1CKNA 5GAEC 4A3DH 4LDTB 2J52A 2IDYA 1EEFD 3JAML 4DV1Q 3GE8C 2NVYB 3B08A 1IL8A 4LK1C 4DV5Q 4ZDVA 1ZW7A 1D5XC 2Z4IA 1XPOA 4WURA 1TXYA 4GDKB 4OZBA 3DM1A 1LGRA 1L1OC 2VQFQ 4A3CH 2ZNVC 3IAYA 3TP7A 3FC4A 3TUOA 1JQ4A 3GTQH 1VDZA 3V05A 1EU4A 2IX0A 3MHBA 2Q2IA 3IFTA 1GUAB 3DHHC 4HKZE 5A35A 1WYDA 1D1KA 1I94Q 4YWMA 1Z9FA 1SFOH 3BG3A 1SGHA 5AZHA 2UWQA 1WE6A 5KNBA 3QR8A 2UXBQ 4FJYA 4ZUIA 2IHEA 4DN4M 1YHBA 1I6VC 1BNZA 4X65L 1AFPA 2C35B 4MM3A 5C0XH 1TWAH 1DOKA 3KWLA 3HKZG 3A9KB 1EWHA 2ZVOA 3W1SC 3GTJB 2FE8A 3K59A 3IFDA 3I63C 4Y7NB 3D31A 5BN5A 3DBRI 1GB1A 2L8JA 3FKYA 2KXJA 5BN4A 3U30A 1PGXA 4H7BA 4CHTB 3BVMA 3NQTA 3OPOA 1OTRB 3I9V1 3Q14C 2YTYA 4JL9A 3ND8A 4REZA 1VQGA 4FF1A 1KDBA 2M17A 4K5WA 1N34Q 1YNNC 1PYWD 1D8LA 1YNND 2EQSA 3K9OB 2SOBA 4IJLA 3NVYA 2JA9A 3P4SB 3KDFB 4XDDA 4U68A 4BVUC 1S5DD 3M4OH 3BK1A 2N9PC 2F0WA 4BS9A 2QW7A 1HTOA 3H7PB 3NBHB 2R7ZB 3CSTA 4DQOC 2L9HA 3JYUA 2I5LX 1EF1A 1NR2A 2F0IA 3M3YB 1KF6B 2WU5B 4GDLB 2AUKA 4MSMB 3V3XA 1RD9D 1VQEA 2N9LA 1MSGA 1WXSA 2JRIB 5T1GA 4GKKQ 3EECA 2N78A 3UDFA 1Q10A 1GC6A 2JY6A 2Z6KA 1QE6A 4W9DA 4FBJB 3PHXB 4CKEA 4LUZA 3G48A 1RYJA 3J7YW 3BINA 5JVG3 2DNFA 2VH1A 3PO3H 3A1QB 2EDGA 2PW5A 4B9WA 1Y1WB 4FXDA 1QT9A 1HNWL 5DAUA 4WJQA 4BA1I 5ELEA 4LNQA 1TKGA 1XPUA 3RZDB 3VRBB 1B7YB 1GNUA 3TRZA 1WGHA 4KZ0A 1PFBA 2IBIB 4XZ4A 2K8BA 3PO2G 3EC8A 4C4VB 5IP7G 1XQQA 3QK0A 3AFPA 2OWOA 2QHOA 1NMFA 2W9NA 4JI4L 2AYOB 3R66C 3VTVA 4DBGA 2L32A 2ZT9C 3VH4B 3CD6A 1QZEA 2MP2B 1LM0A 3DXJC 2KO3A 3KWVA 5C3EB 1XMQL 4UP9A 1PRTD 4LUOA 5IT9E 3N1XC 4G7ZC 4MNOA 3BIID 3G7LA 1WCMB 2EPBA 1YHAA 1V43A 4BY1H 2E2IB 1RTOA 2N9KA 1I50H 4KSLC 4DK5A 3SDLC 5IAAC 4RH6A 3KUPA 1A3VA 2UYZB 2WXNA 1FRRA 1STNA 4R4CA 1Z5SB 4FXGC 1WX8A 3ZJTA 4H02A 3R93A 5CHWA 5L95C 4GS3A 2LJ5A 1WWTA 4RF0A 4HKQA 3HVDA 5DPRA 2M19A 1NY4A 1L1OB 1EF5A 1IYJB 2NVTB 1HNXQ 4RGOS 3VYTA 2LJIA 3RUZA 3BVGA 1HHVA 4AYBG 1KC8C 4K0KL 2JUOA 2AWNA 2WIIB 1JWBD 3NHEB 4DV3Q 5JVH3 2C7MB 4A3BB 2O6VA 1QF6A 2Y0SB 2RCNA 1RWSA 1CA6A 4HDQA 2F0DA 2D9UA 5BYSA 1WTVA 2C9WB 3HOYB 2WXQA 4GZYC 1LTID 3KF8B 1GJXA 2EKEC 1KH0A 4HXDA 1XEEA 2R2QA 1SROA 2JYOA 1OXUA 4JI1L 1HQRD 3AEDB 4JG2A 1O80A 4FYDA 2TSSA 1IPGA 1RFAA 3H1UA 1YNXA 3J7ZC 5FR3A 2R61A 4HDOA 4IOIE 2LVPA 4FF3A 2LHEA 4DAMA 3W2DA 2LD9A 4IM3A 1VS0A 2E2DC 4UAIA 1WVLA 2INPE 1S3SG 1UGMA 3Q23A 4W9CA 1E7PB 3B1LX 1YQ4B 5C4ZA 2FINB 4A93B 3RLNA 4RFBA 3SK8A 3QIAA 2WDTB 3ZXRA 4X64L 1DOXA 2KKCA 4L5TA 1EY9A 1RKNA 1SSOA 2FIDA 3RN9C 1JW9D 3OIQA 4ICUA 2D11A 4ZRPA 2V4DA 4JI8L 4WFN3 5HKHA 3GTOH 1MVKA 1Y69U 2QSDA 1FVIA 3S1NB 2R7ZG 4JVZA 2OTJA 1R4NI 2MCNB 1FD6A 4FULA 4XE0A 4DV7L 1P7EA 5LXHA 2ZCBA 2WKCA 3U8ZA 2EELA 3L4PA 3LGJA 2CVRA 3CQZH 5I6WA 3NOBA 5G3LD 4LNNA 4PYZA 2A6EC 5C3JB 1J7AA 1DM0B 1STBA 4OX9L 2A6ED 1VQLA 3IT6B 4G4KA 5IKCM 2K4KA 1TWFB 1G2SA 3RNUA 3CHBD 2MBBB 2DY8A 1H9SA 4RHSA 3Q8BA 3QOJA 3AE7B 3QJYA 4K5XA 2WXKA 5L83A 4PS8A 3G6JB 5CHFA 1A8VA 4GLVB 3G4SA 2FUG1 3GTMB 1Y1WG 4IWQA 3PUXA 3I4NB 3S16H 4EZKA 3SEBA 2EJFC 1J8IA 3GE3C 3R7RA 2UXCQ 2HE7A 3K7UC 4PZ6A 1P0RA 4JOIC 3IRBA 2FHTA 3NTKA 2QEXA 1HZAA 2LGXA 2ALYB 2E5LL 2JSOA 4B3ML 1WE7A 2DHZA 2OHFA 3TJPA 4E74A 4IQZA 1HFGA 1J5EL 1DZ1A 3ERQA 2B39A 3E9SA 2GMIC 2KTRA 3UIOB 1SIFA 2YYZA 1PYSB 2BOSA 2RDFA 4DNTB 5C3EG 1WI0A 2ZZPB 1M4VA 5IT9c 2OXPA 4KHVA 3S1RH 1MPEA 5E1FA 5EAYA 2WXMA 2ZEQA 1WCMG 2PW7A 2Z4HA 5F2DA 4YCVA 5IWAQ 1XLOA 3HOXB 3RNBC 2O2VB 5EGTA 3PZDA 4DAYB 5KRUA 3TDQA 3VH3B 5GADC 1Y8OB 1EQRA 4R4TA 3KJOA 1YI2A 1UWMA 4HWIB 4IM0A 4W9EA 3U4EG 1ZDXA 2NPTB 1LTRD 3KVFB 3EBEA 1HNZQ 2IZVB 1IBLQ 2HIVA 2M4NA 2WXLA 5FOBB 4IW0A 3I3CA 2JYEA 5AUIA 1DOYA 2KN5A 3EFCA 2PW9A 4GNXA 2BWES 1X3GA 4ITKA 2KCTA 5HFYA 1QNKA 1V81A 3RLOA 4EEWA 2BYVE 2JYTA 3H3VH 4LJZC 1GUSA 5CV7A 2EYJA 1SE9A 3DWMA 3H0GB 4RCNA 1PH7A 4A3BG 1CZGA 2Y0SG 4AJYB 1B8AA 1X65A 2F0FA 2QDLA 3HOYG 2V4IB 3QWZB 4MJSA 1C9OA 3ULLA 1XCQL 2C5CA 3TZDA 3HOWH 1J7CA 1Y1VB 4N8FA 3PREA 3DWGC 5AZGA 4BKSA 3FKIB 4I7AA 2DNEA 3TREA 1JWAD 1C4AA 3OLMD 4AQ7A 1KD1C 4JQWC 2QKIC 4DNRB 4RM9A 3S2HH 2NBWB 4GSWA 3VUYA 1SE8A 2ZTCA 1II3A 4TUUA 2A6HC 2UXDQ 4WJOA 2A6HD 2B2UA 1E1TA 3IKJA 2ZM6L 4F1SA 4K7WA 1BBWA 1TTNA 3EQLC 3WDNA 2PVGC 2K1FA 4GXBA 3WAOA 1ENFA 2BA1A 4YIJA 4CDCC 1YHQA 2MWSB 2ZVNA 1STAA 1HZ9A 2K50A 2QCPX 2MQJA 5I4DA 3NUHB 2NVYH 3ZTDA 4ARIA 1PUTA 1X54A 3T16A 2KJHB 2N4FA 1E3PA 4B3SQ 5D14A 1EUJA 2K5VA 1TR5A 2Z59B 4WJ3M 2CHWA 4R3DA 4W9FA 1I6HB 4EVOA 2HD3A 3SK6A 1ACCA 2E2JH 4BBSB 4WAFA 1NI3A 2F3IA 3D32A 2KAJA 4LJOB 1HH2P 1E8XA 5EKLA 4CO7A 4P1CC 3PGZA 4OO1I 2WX1A 3OW7A 4EQNA 5M3FH 5G2NA 3K9PB 4WRDA 3PSEB 3UGBB 3SHLA 1S3OA 2OEOA 2N7DA 2Z6KC 1SMYD 4BZAA 1OXXK 4JCVE 5CV8A 4ZRQA 1V1PB 3ZNID 5J1ZA 1QOAA 2Z8LA 4LUVA 3E0EA 4DUZQ 2X38A 4WWMA 3K8AA 3PRMB 2A69C 3PLUA 3I4NG 4UP8A 2A69D 3ENEA 1D5ZC 2BA0A 1A63A 4K8IA 2KC1A 3S2DB 3AEEB 5IOIA 3W1BA 1EL0A 3C1EA 3PIOA 3VR9B 5J3BA 1Q1OA 1K8MA 2ID0A 1PRTF 1YITA 3A9JA 4M1UB 2DZMA 4POGA 5AFWA 4DR4Q 1K73C 1T0SC 4WAAA 3R7QA 1AEXA 3DWQA 3AE2B 4W9JA 2M1MA 1LUZA 2PLPA 2DJFC 1SFOB 1WX9A 4OHJA 2WAQB 4DV2L 3APFA 2R7ZH 5AJ3L 1FNVA 5CV5A 3MC9A 1GKHA 3NTIA 2MQHA 3HOXG 3D6WA 1XD3B 2F0HA 3M3YH 4F8MA 4US8A 2B63H 4A3LG 1IZ6A 4OGQC 1TVXA 1XT9B 2MLBA 2R92B 3HUIA 2RMMA 4BBNF 2ATWA 5GMVA 1JR0D 2Y5BB 5CV9A 5IODA 3AB5A 1CT1D 1JOKA 2VB3X 1PH3A 2KWUB 2N7EA 2KQ7A 1L7YA 5M5XB 2F0VA 1RL2A 5LL6S 1H8CA 1LTAD 1KAWA 4WJNA 1KFYB 4C2MH 2RCFA 1ISNA 4KN7C 5J17A 3EFXD 1U4LA 3AE8B 4W9HA 2EYMA 1WMHB 4Q5VA 1EYCA 3MJWA 3VA7A 2KVRA 1IYUA 5JEAH 3OW2A 3H9DA 1DXMA 4A3MH 3H0GG 2H89B 2O6VD 2NZHA 1BBXC 3Q22A 2HQEA 4ULLA 1NBWA 1FFUA 4YSXB 3DBSA 2JSVX 1ESRA 1Y1VG 1UAPA 4QJFA 3FKIG 1HTQA 2JQRB 3RD2A 1TY2A 1QKZA 2AKWB 4G7OC 2ZW1A 3T9LA 3S1MH 4MM3B 3AE9B 4X62L 3N20C 3N30A 4ZLTF 1Q0WB 3NPPA 3AU7A 2N9XA 1IHZA 5DCNA 1P3QU 4XX5A 1HFNA 4EGVA 4CBVA 2B76B 1GVPA 1P8LA 2CWPA 4NW2A 3FP9A 5ELDA 5IYCG 1PGBA 2OOBB 2I46A 4YXDB 3M95A 2KX3A 1AE3A 4UHVA 1FYCA 1EY6A 2JA5H 2KTFA 3PSIA 1K0SA 3PO3B 1EO6A 1SMXA 1S5ED 3NVVA 4WWPA 2N49A 4FXKC 4NP5A 1A15A 4II3B 4GOCA 3GS2A 2PMVA 1AN8A 1VQ9A 4FHKA 1NENB 3QARA 2XRQD 3O13A 1O7YA 5IP9H 3NK9A 1LTGD 5G3LF 3A4RA 2REXA 1Q1EA 2YTXA 2F03A 4QY7A 2J7QB 1F9QA 4BBSG 2PNRC 1M90C 1FXIA 2GBKA 3NZSA 2X8XX 4A3BH 4JI2Q 1WH3A 1AARA 3DHIC 4LF5L 3KFUA 4CGYB 2YVCA 3HOYH 4FVMA 4BY1B 3DHGC 3AECB 4AJWA 5LMUQ 2ENBA 4RGTA 2FFKB 1YZ6A 1TY0A 3TP6A 4E6IA 2JWUA 3IAS1 4C3IH 1I35A 4NJ7A 5M9OA 3PRZA 3RMHA 5CGKA 3PS6A 3HKZE 3CW2C 3CAMA 1IW7C 4FNFA 5C0XJ 1C4QA 5JJKA 2K8CA 2I1JA 4FJZA 2IJ0A 2KFKB 2MNAA 1WD0A 4GIVA 1RF2D 1TJEA 4JI6Q 1SJED 4DV4Q 4FO2A 1SIJA 2MA9B 5CV6A 2ES2A 1KJTA 2ONQA 1WGYA 3RZOH 4A93H 1EOVA 2BQQA 3T1YL 3ML8A 4P72A 2MO0A 4E3CA 5M5WH 4LFCL 2DZIA 1JB3A 4A75A 4TKNA 1BQQT 2LI5A 1SF0A 2UUAQ 3UDGA 4YY3Q 4ACFA 4AWJA 1LT4D 2WAQG 3TEZA 3BS1A 2VS1A 4A8XC 1EY7A 4GB9A 4N58A 5IIFA 2FCSA 3JC66 3U52E 4KY7A 5FR6A 3CC4A 2K7VA 1ASZA 2HJ1A 4P16A 4EZLA 4L6TB 2D3GA 4KV2A 1LO5D 5C0XG 1SNOA 2K14A 2HT1A 4IOCA 5IGBA 3J80L 2F0TA 3P20A 2R92G 2L15A 4A3JH 2BT6A 5HI1A 4MGKE 2HHHQ 3WANA 2PMZE 4H13C 4OEMB 4N9PA 5KYIA 3PF4A 4OELB 1N32L 5JJIA 4GNXC 1U0LA 4QF4A 5DPTA 2OEDA 3GTMH 1MIUA 2J0JA 1GC7A 1LM8B 1KDCA 3J81L 3CCLA 4W9IA 3PZ8A 1LTBD 1EIGA 1S40A 2I0QA 1NAPA 2NS5A 4G57A 1SYGA 2CH4A 4P7IA 5D7GA 1VQKA 3PZ7A 4L5RC 2O6VB 2N8NA 5DPWA 3L3OC 2JX5A 1OEYJ 2DYMA 2KCCA 3Q8EA 2NR2A 1FJGL 4BAXA 3QC8B 3I70A 3NXWA 3Q3FA 4R4QA 3T13A 1KM7A 2HTHA 4X3KA 1I7HA 3DBHI 4BKSD 1FNUA 4ANXA 2KQ4X 3CQZB 3UDIA 1KRTA 4KLKA 4ZHOA 5IGEA 5KGUA 4PMBA 1YJ9A 3GP7A 1ZKHA 2ZTDA 3HOXH 1KIXA 5FKAC 5D2MB 1R4MB 1SSNA 2MBEA 1VF5C 4L2YA 3AH7A 5E4XA 2J42A 4R9WA 3PO3G 1SNMA 1ZXTA 2JA8B 1CZPA 3X0WA 3Q8CA 3S16B 1EIHA 4XYCA 4DR1L 1Z47A 2Z1CA 1O7ZA 1UD7A 5FO9B 2DAFA 4XGAB 2ZTEA 5I2XA 5A2QL 3PT2B 4EKUA 4TMAB 2I07B 4IOAA 3LB8C 4M02A 3GZNB 1E10A 3MXPA 3RR5A 1LLRD 5ELFA 2V3NA 3RUIB 2JXTA 5LXIB 2F0PA 1DGJA 3RPFC 3NE5B 4AYBE 3C46A 5HHDG 1DJRD 2BDOA 4RA8A 3M85A 1D5MC 3H0GH 3B2FA 2J0MA 2WB1B 2RDBC 4LF9L 2K04A 3T1HL 3HRDD 3S1RB 2LEKA 1KRSA 2MEKA 5IY0A 4BY1G 1C1YB 4LF4Q 3P4QB 1RCVD 2ZJRA 2G45B 3TZUA 2LUMA 4DR7L 1PZID 2QMTA 5FJ8H 3H94A 4DR3L 3J80i 3CIRB 5CTRC 1H9SB 3H09A 2EE1A 3MXUA 2LXKA 1PZKD 4KV6A 4AQYQ 4JBJA 2MX2A 4I6LB 3CMMB 1E24A 1NTGA 2SDFA 3ZDMC 1KLUD 2R6GA 4JI3L 5GAHC 4UP7A 4A3KH 2BS3B 4QAYA 5IYCH 5IGCA 1NVID 2FJ2A 1XXGA 4P74A 3A55A 2E3TA 3G71A 1NR4A 1XNRL 5K5PA 1Y56A 1HPCA 2EYFA 2RBMA 5DLQE 3K5LA 4WJPA 1E6EB 3N32A 3J7AV 2F0OA 2VUMH 4A20A 2HDEA 3HKSA 1WTQA 1JRUA 1VJKA 3Q3MC 1YVCA 1LT3D 3ECIA 3SR6A 4CKCA 1SN8A 3VR6A 2G9DA 1IYVA 4GLXA 1I6HH 5EDSA 4HPPA 4BKTA 3TQYA 2F0QA 1EZ6A 3GQBA 4LF8L 5FK9C 3HOWB 4XWWA 3DLLA 3HGBA 1LYLA 1N62A 1NSNS 2RR9A 1YJWA 3AULA 3KH0A 2WHIA 1HZBA 5LL6X 3S2HB 1PYBA 1G6PA 1WTHA 2P5ZX 3STBC 3A5ZB 2DUDA 3STBD 1IUEA 1TYGB 2IGHA 3ZO5B 4DR6L 1TGZB 4PYUA 4HIDA 3WWVA 2KD0A 4XT3B 5LHY1 4V190 4WWNA 2L52A 2GN5A 4GKJQ 1QOBA 3Q8DA 5EKIA 1PFDA 5LMNW 4DUYL 1P98A 4ZAIA 2BH2A 3QA8A 3AN1A 1C78A 4DR5Q 3S2DH 2PE6B 4BOZB 4R8NA 2KOXA 5JZEB 5IP4D 5D65A 3E56A 4XQJA 2MJ8A 2PE9A 4LF7L 4DHJD 3DWAA 4A55A 3SFDB 4OVVA 2E2JB 1MD2D 1WF9A 2I5HA 1B53A 4FDBA 2KZRA 3OTOQ 1Q82C 1MFWA 3VDZA 1GXDC 2WXHA 2GBRA 3OYYA 3F2UA 2XSCA 3AI5A 5ELOA 5C3WA 1FCLA 1DOLA 3NUCA 5HGTA 1S4ZA 3LDZE 5M3FB 1SDFA 4N9F4 3NVZA 1CK1A 2GA4B 4NY0A 3K5NA 4F7ZA 4IFDI 2UUBL 3RZFA 4PK1A 2LSSA 3PO0A 1VQNA 1Z6HA 3RN5A 5CX3A 5JOBA 1L4ZB 4WH4A 2R92H 2JA8G 3PF5A 3I56A 1LACA 2ACZB 2L76A 1PVOA 3S24A 1VZ6A 3S2AA 4QIWB 5M5XH 2FCQA 1C4CA 3WIMA 1GG3A 3V61A 3V6CB 1B3AA 1N36Q 4KGTA 3TP5A 5JJLA 3X23A 2G9HD 3KUZA 3P63A 1I4XA 1F9PA 1N61A 1KLVA 3W1YA 3K81C 3PRPB 1YIJA 3KF6A 4PT5A 2XBBC 1J9OA 2WB1G 3MA2B 1E7UA 3UI2A 2Y0SE 3SK4A 2K22A 1EZ8A 4YL8A 2V0GA 1XJVA 1X1MA 1QNUA 4RCOA 1FM0D 2WWZA 2RF4A 1QUQA 1B2TA 3AE6B 3C19A 1BCPF 3EIVA 3ABVB 5LLIA 3CC7A 1VQMA 2I1KA 3FILB 4IC7B 1EYAA 2B63B 2KACA 2XRSD 4LFAQ 3OWFA 2E76C 2LGSA 3T3NA 4JWSC 1ET6A 2F4IA 2BTEA 4JI5Q 3TMPB 2FCNA 2A73B 4TKOB 5CMDA 1IBKQ 5BR8L 1YQBA 3F2DA 2E6XA 4XC2A 3DEPA 2HIXA 4DV4L 3JAMi 3A8JE 4C2MB 3HOUB 4KKIA 1JT8A 1KQSA 1Q46A 3Q0AA 3KYHC 4A3MB 4BY7B 2MHJA 2XVSA 5HY6A 3R3MA 5KEEA 4G0NB 3CCEA 2M2LA 4A3IH 1SB3C 1I5FA 3NELA 1F9SA 4PV1C 4XYQA 1K53A 2KJRA 4PS3A 1PFNA 3PUZA 1PH9A 1TBEA 5DM63 3E5SA 1F2YA 1NE3A 3HOWG 1MI0A 1MG8A 2G3QB 2B2VA 4L63B 5GROA 1PRTC 1VCIA 4HJ9A 3ND9A 5DEHA 2K6QA 3DVNU 1TQOA 1E1OA 5KIXA 5EE1A 3S1MB 2LFNA 3TBIB 1N33Q 3A8KE 1WTXA 2CFMA 1XNQQ 1WR1A 2KHIA 2CWAA 2PVOD 4UPAA 2K28A 3Q8FA 4DKAC 3S17H 3E0JA 1QLBB 2K25A 2W82A 1JOOA 2INDC 1ONLA 2KA7A 2JZPA 2JA5B 4X3TA 2JWZA 2IGDA 4P75A 3MC8A 4O2DA 3E9IA 1MJDA 2PQAB 2DBYA 1R7SA 1W2BA 1I4HA 1XMOQ 1YD8U 1XTCD 3EVQA 2BW2A 2PPHA 3JSVA 5D3IB 4NNJB 3F2BA 4L5QA 4APVA 1SNDA 1G291 1ZUD2 3FAHA 3GTGB 4BBNC 4DHJB 1MHXA 2ZNVB 5IGFA 1GUWA 1PH6A 3RYTA 4M8AA 1H9KA 4ICVA 4C80A 3SGIA 1CMXB 2KT7A 3HG9A 2QJLA 2INCC 2WXRA 1T5EA 1VQIA 3GB1A 4ANVA 4LMQD 5I9OA 2EY6A 2LMCA 2YEPF 1RAXA 2WS3B 4MHEA 2K5QA 3MXNA 5IOCA 4LF6Q 5IGGA 1TZ1A 2CR5A 3ZJVA 4JBMA 1HA6A 2AQ3B 4UDUC 1AWDA 5M3FG 1A3TA 2BF8B 4HN7A 2H88B 3W5UB 4K2LA 3DOWA 1A3UA 4ME5A 2NN6I 3P75A 4D2KA 3ZYYX 4C3IB 4JC0A 2I2YA 3SU8X 1CQVA 1EFWA 3K58A 1BMLC 4MGIE 1ICFB 1K8RB 1T9HA 3KLSA 4XQNA 3NTHA 5H92C 4DV0Q 3C2PA 2MW5A 3DBRB 2Z0EB 2CU3A 4W9GA 3Q3JA 3L54A 2QF7A 2GOWA 2IY1B 3RZOB 1F52A 3MC0B 1OTCA 1YJ1A 3BWUD 5COYA 1FGBD 4LTUA 5M5WB 4I6PA 4DK1A 1Q90A 4N8X1 2MBQA 1Q12A 2F1MA 3X3NA 3ULPA 1HCZA 3SDZA 2H4OA 3IXSA 1YJNA 3QG1A 1EY0A 4HIMA 4B3TQ 5JEAJ 2IO0B 1U5KA 3OJ3A 1C4PA 1C48A 2LKVA 4DV6Q 4OIJA 1Y8NB 1I3QH 4LLGM 2KBNA 4QB4A 3BYYB 2KLCA 1DYQA 1TWGH 3U2SC 2LY7A 5BN3A 1DOIA 2B63G 3VUXA 3TBLD 3SXHA 4RKBA 3I4MB 2F4VL 1SNCA 2OF1A 2BCOA 1BF4A 4NXML 1TWHB 2DAJA 2L5TA 2WP8J 3NWSA 4A3JB 4DK0A 1MI2A 5JJZA 1VCBA 1VQBA 1HR0L 4LFBQ 3VQIA 3LWUA 5E3FA 4DR2L 3URYA 3VYUA 4F88A 1MJCA 4M8NA 4K6LA 5LMNQ 1EWCA 2JA8H 1ZYRD 3HOUG 2PO4A 2PZWA 4ZOHC 5M3MB 5JEAG 4JI7Q 1UNSA 2B2TA 4A3MG 3IG3A 3C1FA 1IL2A 4BY7G 1NBFC 1PH4A 1D6EC 3D6CA 4HRSA 4TVAB 1WJJA 2UUCL 2Z0DB 1F2RI 1XF5L 1F2RC 1V9PA 1YNTE 4JYAQ 3P1MA 1F1HA 1YMHE 2X6GA 3ER0A 2JEBI 1PRTB 4A3FH 3DVGY 1SRUA 2F0MA 2RSNA 2RDHA 2XN9C 4WORA 4JI0Q 2CHZA 2WDVB 3WA0A 1HUNA 4GOPC 4DK6C 5CORA 1B3QA 2FIFA 4NXNQ 2PEAA 3VUWA 1OXTA 2JA5G 2IY5B 3IHPC 2NVQH 3BDCA 3FMCA 2PJHA 3VFKA 1DCZA 3VTUA 3ICEA 4DV1L 2G4DB 3KLSX 2IO1B 1TT5B 4DV5L 1V1QA 2IL8A 3NBIA 3VA5A 4JBWA 1SYDA 5C4XB 3MEFA 2K5HA 4IPCA 5NUCA 3T56B 4KTAA 5IP9G 5I6YA 2VQFL 4MGYE 3T3OA 3FRPB 4EX5A 3CKIB 4MACA 2A5UA 2KWVB 4OWXB 5E4WC 4LAAA 1I94L 1L5PA 3D3RA 3OMCA 3W1GA 1M1KC 2E2IH 1T0QC 2UXBL 5C44H 2XEWA 4KD4A 1M94A 3BVZA 4KHPQ 4JLCA 2PI2E 1PV4A 5C23A 2LRUA 1TS2A 1WOCA 4IUPA 3MTSA 4B3RQ 3WAMA 1AZQA 4C3IG 2IX3A 1K50A 4HK2A 4X66Q 5C5MA 3J80E 2Q8RE 3TIXA 4GDKA 4A3KB 4BOSC 4ZKBB 5I2YA 1VLBA 4K81A 4ZYNA 3NQIA 1IBMQ 2ICIA 3MVVA 4DU9A 5T8IA 4BKGA 3GTKB 2F0UA 5JH5C 3NSWA 3TN2A 3A0JA 4QMGA 4YHHQ 4A93G 1N5WA 3AE1B 3C0RB 4NAWB 3IL8A 5DM73 1VDVA 2VUMB 4AUQC 3BZDB 5BYRA 1H9MA 4MIUA 1R4QB 2MP1A 2UU9Q 1OFFA 2D07B 1ICWA 4PZ7A 1N34L 3MEHA 2Z9HA 1J8CA 3P42A 2KDIA 2RD0A 4RMAA 4XYOA 1BUIC 4JPBW 1EU3A 4R4IA 1PTOC 1IXRA 1GUOA 4L23A 3B9JA 1PTOD 3H91A 3A9KA 1D4BA 2RSUA 1R4NB 1K8GA 1NUCA 2WKDA 1JOQA 1GAQB 2A74C 5EPKA 1S1QB 3M4QA 1CKMA 2WQYB 3I4MG 3S14B 1EOTA 1EY8A 1JCKB 1KLGD 4JW0A 2A4ZA 3I57A 4NJCA 4Q2JA 1B9RA 1SMYC 4A3JG 4GKKL 5FLMH 1PQSA 1C79A 3SFEB 2JA7H 2QDFA 3VYSA 2WACA 5IYDG 3CPWA 1WRDB 2EMTA 2KVZA 4KX6B 3OOCA 3CCUA 1K51A 1N5XA 1M8AA 4J6HA 4DAVA 1VQ8A 1T6BX 2Y5PA 4KDIC 2XK5B 4PQXA 2R7FA 4ARCA 2K52A 3RNAC 1OQRA 3VHTC 5K36H 2VQEQ 3KDFA 1UE7A 4B9XA 3DBLI 5HG2A 4MDKE 1HA5A 2LUEA 2IO3B 3H7PA 5EKKA 5IT9L 2Q2TA 2Q5WD 1K3RA 3U9OA 4HLEA 2ZJQA 1JE4A 1XTDA 3C8YA 2Q2HA 4JV5Q 3H6NA 3TMEA 2KDMA 2LVOA 2M56B 1R4PB 2ZW0A 1E8YA 4KN4C 2VH2A 4J15A 4GDLA 2KDFB 4B95A 3CC2A 4F7XA 3AEAB 2B2VC 3IFWB 2BB5A 1B1ZA 4CDDC 3U7DA 3I4OA 3OSOA 1AZPA 3N1YC 4N9TA 2CHBD 1N8RC 1KXLA 3WOEA 3D4RA 2O2LD 2JEAI 1N6ZA 4BWGB 3WCQA 1OGWA 1PGAA 4NQKE 2MUYA 1WYWB 3MHZA 1J0GA 3A1QA 4GOPB 3MJ5A 2JRHA 4I7ZC 1QQRA 2EVBA 2EYLA 4M0WB 5E6PA 2VRRB 1W3SA 1CKNB 1B4OA 2KQ3A 3KBGA 2BVCA 3OMGA 1WXMA 2KVMA 4KVGB 4ANWA 3FPUB 2JZ3B 3TP8A 2PCFB 3HOVH 2DZJA 1Q7YC 2V9HA 4IWPA 3HM3A 4LNKA 2PYKA 3ZVVA 4C4VA 3HOUH 2K05A 4HMIA 1Q86C 3DCGA 3KUDB 3WAPA 2I38A 1SJHD 4CKBA 1HNXL 2WXGA 2Y5CA 4MTKA 3HOZH 2MP2A 3NG0A 2VNUD 2MJ3A 4IALA 4DV3L 4BY7H 2F0LA 3J81j 2N7JA 1G6JA 2MGSA 1PMRA 2R93B 1E7ZA 3I3TB 1JJGA 2J7ZA 4PZ8A 2KHJA 5IYBH 2N1VA 1HR0W 4HSVA 4OWWB 1TT2A 2IGGA 2TMPA 1EQVA 1N63A 5FJ8G 5FO7B 2BKFA 2EY5A 2ON8A 1KAAA 3GTPH 3J80c 3ZXVA 1I4PA 2HTME 1C3TA 1QJOA 1TIFA 3TEYA 5FLXL 1RODA 4A3KG 3I8ZA 3ITPA 4V0BA 2F0GA 3KW5B 1WX7A 1L1OA 4I6NB 3AEBB 1HZ6A 2EIFA 3GO5A 1V8QA 1ZXHA 1T3QA 1YX6B 2V1YA 2BGFA 4EQ5A 3FVQA 2YU9H 4QGUA 3NJTA 1GUNA 1FNWA 3JAME 2VUMG 2NZ1D 1LABA 3M62B
chains in the Genus database with same CATH topology
1WXQA 3HZXA 1U9RA 5AUKA 1W6KA 3KF8A 2D5GA 4X3SA 4A3IB 2VB2X 4RKLA 1JWMD 2F3VA 4K14A 1RTNA 3R3OA 1RDPD 1QCBD 5BMHA 2JP1A 5EPJA 2KOLA 2KEDA 3AE5B 3W1SA 2WU2B 2W3SA 3PV0A 1XX8A 2L12A 2WLBA 1L6VA 3K57A 2KN4A 3S17B 1HXYD 1UGJA 4FXCA 1BCPC 4IUTA 1QG7A 3PUWA 1BCPD 3CRKC 2QILA 2EXZA 3Q8AA 4DFAA 3J7AF 4H2AA 1STHA 2Q8TA 3FPPA 1Q3LA 1WTOA 4K5VA 3L7ZC 4NAMA 2B2WA 2KECA 1S5BD 4L8JA 5BMGA 2HCIA 3MFYA 4HAEA 4CJ2C 1W6JA 4KK7A 2PTLA 4ZRZA 1UEAB 1LT6D 3A7AB 3K5MA 1J7BA 2F0EA 2L0CA 2AX5A 1JWSD 3A54A 4ILWA 2L4NA 2ZXOA 3M4YA 2K0PA 2XWJB 4B0MA 3UI3A 1XYIA 4NMZA 2AWOA 2Y3AA 3W5VB 4XDXA 4OZCA 2EY1A 4OL7A 2NWGA 5H8YE 4S3SA 1D1IA 4ID6A 1JWUD 5CC4A 1JRPA 1ILQA 2SAKA 4KD3A 4KY6A 4DAYA 1I3QB 5I9PA 1GB4A 4TQ0A 1PXUA 1TWGB 1Y8PB 3NWTA 1AYFA 2AQ1B 5EBCA 4O1NA 2RA4A 2H1EA 5TSSA 4YT0B 1JC7A 2B2UC 4RF1A 4U673 3LNNA 2LS01 1WGKA 2F0NA 2W3RA 4KI0A 3AB9A 1HEZE 5HURA 3A8IE 1PTOF 5EQ0A 1IKMA 2LFIA 2WXPA 2NUCA 2KEEA 3HVZA 2EOTA 3SR1A 2FMMA 1GUGA 1A6XA 3MXGA 3SK5A 1CQFA 1BR9A 2L1BA 4A3FB 1D2BA 1WD1A 3E6ZX 2K32A 2PPBC 1ZKOA 1I4QA 4OO1G 1FRDA 1YN3A 2F0JA 2K33A 1U4RA 2NN6H 3A7LA 2MJEA 4HCEA 3M7NA 2NVQB 3AEGB 1WSPA 2PQEA 1TKYA 1CJEA 1STYA 2HCCA 4EE2A 1BCPB 4HTHA 2WDQB 4KKSA 3BK2A 5C3XA 1GUTA 1QOHA 1CM9A 1B9NA 1CHPD 2EKIA 4KKTA 1MGSA 1C9FA 1VZ7A 3N9YC 1YNJC 1C8CA 2SNMA 3P1HA 3K5OA 1YNJD 4A3GB 2E2IB 4XTCS 2EY2A 3OHXC 1ET9A 5C44B 4KKJA 3IAM1 2WV6D 3TEWA 2N55A 3H8HA 1EFID 3N6RA 1S5FD 2DLBA 4PNYA 2NVXB 1YJJA 3C3LA 1XLNA 4YTPB 1ZEQX 4USAA 3S15B 1LT5D 4DGZA 1EYDA 3KLRA 1QOFA 4JE3B 2BBCA 1IGCA 3LX0A 4HSPA 4OW0A 4L1BA 2QEJC 5J22A 4P2CB 5JPMC 1Q8IA 5EPLA 1Z7TA 3T53B 3BYTB 3TSSA 3EA6A 2IWHA 2X69A 1N60A 2EYPA 1V8CA 3VR8B 1E2WA 1F9RA 4IKGA 1XLQA 4C7YA 1L0XB 1CZWA 4KHZA 1G8ZD 1FXAA 1JROA 3MAQA 2JA7B 1PLFA 2YEPB 1SE4A 2CJOA 2O4XA 3T3NA 1S5CD 1VR9A 4XT1B 2NMQA 5CBEE 1CA5A 4AYBB 1HTLD 1A70A 1CFMA 3DUZA 4EQPA 2GI9A 2PIAA 2KHSA 1TS5A 4WJWA 4MH8A 2K5DA 3VR5A 2LHDA 5ELCA 4DA2A 3NRZA 4OIKA 3QOLA 2M00A 1ML0D 5T1IA 1O7LA 1F2LA 1VRAB 4NKLA 3VR4A 1HZ5A 1UUPA 4TRDA 4RWSC 1P7FA 5KYLA 1PZJD 2FBWB 1QWYA 2DY7A 3CRLC 1E9MA 3PIP3 4DXGA 2IX1A 3HOVB 1AW7A 2NTTA 3HRZC 2MH7A 4OZAA 4KMUC 1A2UA 3HOZB 3I72A 2C9OA 2M9VA 2J4XA 2B2WC 5EE9A 2MPMA 5EE3A 1VMCA 4K6DA 3MFGA 1YN5A 2CJNA 1BDOA 3AMUA 4B08A 3X3MA 2SNSA 1X3PA 2D62A 4KY5A 1PTOH 1FCCC 4ZK9B 2NTSA 2CQAA 3AMZA 4XXEA 2W55A 1EM7A 1IBXA 4RAUC 3GTPB 4OO1H 4OVZA 2GRIA 2K1BA 1ILPA 4DAPA 2YU9B 4XIGS 4HJGE 4HMJA 3BDOA 1XLPA 2NYZD 1F2ZA 1SYEA 2XNAC 2OT2A 1FMAD 2NB0A 4YTNB 2VZKD 2XIWA 4G7HC 2FMCA 1CTMA 1OXVA 3NP8A 2NBFA 5JPNC 5MPOA 4DF7A 4TQ1A 5EJWA 2M0AA 4IURA 3KQ4A 3RD4A 5D3DA 3WOFA 2W54A 2DN8A 5K36G 3VRAB 3OIPA 3HS0C 3RFZB 2ICEC 1X3QA 1FO4A 1MBYA 5GXGB 1ZOYB 2B2YA 1BO0A 4Z9CB 4HEDA 1V97A 3BDLA 2RKSA 2JXMB 2HDLA 4NZLB 1H9RA 1BOSA 2A5HA 2K01A 1OXSC 1SYFA 1FIQA 1XO3A 1JALA 1ZPSA 4JK1C 4KJNA 1ZP0B 2E75C 2EYHA 2BE5C 4QCLA 3D4WA 3Q6SA 1A2TA 2BE5D 5FLXE 3LXFA 5EBDA 3U7ZA 5KNCA 2KUMA 4C1NI 3LYYA 3PMFA 1ZYRC 2WINB 2JU6X 2Q8IB 1BXTA 1CI3M 1TWCB 1SEBD 1TIID 4IUUA 3R8BA 3Q69A 1MSHA 1I4GA 5EE0A 1RJTA 3CWIA 3W9CB 4X3UA 4FP5D 3QO2A 3IT4B 1F0ZA 4LK0M 2KCNA 5E6JA 1DONA 1SE3A 3A56A 1PDQA 1EQTA 5C6AA 3OWEB 2O5IC 1H9JA 1E2VA 1WTWA 4IFDJ 1RFKA 1U4MA 3I4LA 2F3WA 4XDCA 1WTPA 1E2ZA 1B9MA 4EQOA 1KNAA 2ZXRA 1GHKA 4ABNA 2WDRB 4K8JA 2VZKB 1B44D 5C0XI 1WYGA 5C4JB 1ENAA 2DWQA 4DXFA 4IN3A 4N59A 3ZJUA 3R2TA 1DD2A 4CJ0B 3NHHA 1O78A 1GHJA 2AQ2B 5C4HA 2N0SB 4IFDG 2B8FA 5M5YB 2PKOA 1WTRA 4US9A 2HDMA 1HRJA 4C3JB 2L1AA 4IUVA 1SXTA 4R8IA 2EZVA 4K2KA 3J81E 3GV3A 4IUNA 1E0BA 4C3HB 1TZOA 1V1OA 1ZDVA 3J9CA 4TSSA 4ZKCB 2K6AA 1ESFA 3DEOA 1RM6C 3N52A 2EJMA 1SBBB 2D2CC 4O42A 3V96A 4GLSC 1IKLA 1VMPA 2D5DA 4A9AA 3EUB2 2WXIA 3AEFB 5C2TB 1G6ZA 3D8GA 3D4DA 2WXOA 5CYUA 4XQQA 1SNPA 1AP0A 1SAPA 1TS4A 5CV4A 3VR2A 4QUCA 5FO8B 5A2QE 3ONAB 1XWEA 1Q1BA 3QB3A 4KKUA 1LTTD 3NBHA 4A3EB 1JMLA 1TKEA 1ENCA 4XWTA 1HUMA 3FILA 3H6MA 2WXJA 1YQ3B 1NYRA 1JICA 1YJIA 1WRIA 3DWPA 2KWDA 4RHRA 4A3DB 4ZHPA 2WNMA 3HEJA 1MHHE 1OO9B 5CR3A 2GB1A 1TS3A 4HCSA 3KK7A 3SVMA 3Q24A 1YN4A 2BDNA 3HP3A 3GTQB 4ZYSA 1JORA 3MP9A 2BS2B 2XWBB 1X32A 4JX1C 4BBRB 1C77A 2LGIA 1KRHA 1XCTL 4FF2A 4IDIA 4ZQ3A 4RNAA 5IGDA 2AUJD 3GTLB 1TWAB 2B8GA 1UWXA 2A68C 3V2TA 2A68D 3AV8A 1QB5D 2KMMA 2WXFA 4C1NK 3VR3A 3K6OA 4KGRA 1QOGA 1ZE3D 1IGDA 1BUVT 1I4RA 2NN6G 2R3ZA 4TQUS 3FEWX 4MN3A 4C3JG 1FEHA 1R9TB 2KJXA 3P7JA 4Q0FA 1GPXA 3M4OB 1GOZA 2JE6I 4C3HG 5J39A 3T51B 2B2YC 1EEID 2VXWA 2PZUA 4YSZB 3ETRA 4HROA 2WP9B 2N88A 1PDXA 1PTOB 3AM9A 2HUGA 2L55A 3ZGZA 3M7GA 1CHQD 1EWYC 2RSOA 4JPSA 4JWUC 1NCVA 4IFDH 3R2IA 4A6QA 4CQNA 3NS1A 2RQXA 3PUVA 2BS4B 3I90A 2B2TC 3MZ5A 3DHQA 4IZ8A 1I50B 4KJOA 2RDGA 2MHVA 4AS1A 2K3UA 1IW7D 4YTMB 4IUQA 1NEKB 3W3AA 1IBXB 1G2TA 1U4PA 3I73A 2INNE 3L9AX 5LNK1 1DOMA 5BMIA 3S9WA 1HTPA 2QDBA 4HR7B 1L0YB 4RGMA 1T5XD 1B50A 2K9XA 3H3VC 3KBXA 2SEBD 3VYRA 4CJ1B 4FF4A 4J8QA 4KGSA 3SE0A 2K5PA 3GV6A 3EGRA 2J0TD 3RLFA 3B2GA 1TU2B 4NDXA 3AE3B 3LWEA 4WIPA 1VZ8A 1G91A 1SE2A 1STGA 2LMCB 2L83A 3I91A 2V3PA 1VF7A 2JA6B 4YSYB 4B0EA 2MJDA 1PFMA 4PMWA 1QILA 4I65A 1OQQA 1K83B 1STEA 3DMUA 4C56C 2E74C 2RPVA 2BB6A 2DNCA 1KNEA 1FR3A 2ZXPA 2K5WA 3NZ3A 3GTOB 5DNFA 5KNDA 5ISRA 1L6UA 3T4AC 1KTKA 1F77A 1F2MA 3K0YA 2DYOA 4RGNA 1FFVA 3TEXA 2IPKD 1FD7D 3HKZB 5JXVA 2IW3A 5G5GA 3P4RB 3NVWA 1SYBA 1RHPA 3PIO3 2BYTA 3P4PB 4ZUJA 1EY4A 1SNQA 3QWNA 1KABA 2J53A 4BA2I 5C5LA 5BYQA 1HQMC 2K03A 2EYOA 3CU7A 4J3OD 1EY5A 4C7ZA 2CW0C 2CW0D 4PMCA 5ELBA 2E2HB 2G1EA 3EJIA 1L0VB 1ZXIA 2IT1A 1L4DB 4YWGG 1KDAA 2EJGC 2RVLA 1C76A 1V1PA 2PMZB 2F0SA 5G5HA 5CBAE 1LTSD 4H44C 2O5JC 1K52A 1LV9A 2F0KA 4WQMA 3ZQ4A 4H0LC 2QIEB 4F87A 3EROA 2L11A 4N6EB 4P6VF 4J1MA 2X6LA 3PO2B 4HEA1 3MWYW 2PZTA 4A90A 3AE4B 1E0ZA 3K7AB 1JQYD 1ROEA 3GD7A 1NYQA 5JAVA 4QUFA 1K8OA 3PUYA 3S1QB 4ODGA 3FDTA 3U9SA 1SYCA 4M0WA 1TKWB 2J52A 2IDYA 1EEFD 3JAML 2NVYB 1IL8A 4LK1C 1D5XC 2Z4IA 4WURA 4GDKB 4OZBA 3DM1A 3FC4A 3IAYA 3TP7A 3TUOA 1JQ4A 1VDZA 3V05A 1EU4A 2IX0A 3MHBA 3IFTA 4HKZE 5A35A 1D1KA 3BG3A 5KNBA 4ZUIA 4DN4M 1I6VC 1BNZA 1AFPA 5C0XH 1DOKA 3KWLA 1EWHA 3GTJB 2FE8A 3K59A 3IFDA 4Y7NB 3D31A 5BN5A 1GB1A 5BN4A 1PGXA 4H7BA 4CHTB 3BVMA 3NQTA 3OPOA 3I9V1 4REZA 3ND8A 4FF1A 1KDBA 4K5WA 1YNNC 1PYWD 1YNND 2SOBA 3NVYA 3P4SB 4XDDA 4U68A 1S5DD 3BK1A 2F0WA 4BS9A 2R7ZB 4DQOC 2L9HA 1NR2A 2F0IA 3M3YB 1KF6B 2WU5B 4GDLB 2AUKA 3V3XA 1RD9D 2N9LA 1MSGA 5T1GA 1Q10A 1QE6A 4CKEA 1RYJA 3J7YW 5JVG3 2EDGA 2PW5A 4B9WA 1Y1WB 4FXDA 1QT9A 5DAUA 4BA1I 5ELEA 1TKGA 3RZDB 3VRBB 1PFBA 2L32A 2ZT9C 3DXJC 3KWVA 5C3EB 1PRTD 5IT9E 4G7ZC 3BIID 3G7LA 1WCMB 2EPBA 2N9KA 1V43A 4MT5A 1RTOA 4RH6A 3KUPA 1A3VA 2WXNA 1FRRA 1STNA 4FXGC 3ZJTA 3R93A 4HKQA 1WWTA 4RF0A 3HVDA 2M19A 2NVTB 2LJIA 4RGOS 3VYTA 3RUZA 3BVGA 1HHVA 2AWNA 2WIIB 1JWBD 5JVH3 4A3BB 1QF6A 2Y0SB 1RWSA 1CA6A 2F0DA 2D9UA 5BYSA 1WTVA 3HOYB 2WXQA 4GZYC 1LTID 1GJXA 1KH0A 1XEEA 2JYOA 1OXUA 1HQRD 3AEDB 1O80A 4FYDA 2TSSA 5FR3A 2R61A 4IOIE 4FF3A 2LHEA 3W2DA 2E2DC 4UAIA 1WVLA 2INPE 3Q23A 1E7PB 1YQ4B 5C4ZA 2FINB 4A93B 3SK8A 4RFBA 3QIAA 1DOXA 1EY9A 1RKNA 1SSOA 1JW9D 3OIQA 4ZRPA 2V4DA 4WFN3 1MVKA 1Y69U 2QSDA 3S1NB 1FD6A 4XE0A 1P7EA 2WKCA 2EELA 3L4PA 2CVRA 5I6WA 5G3LD 5C3JB 2A6EC 1J7AA 1DM0B 1STBA 2A6ED 3IT6B 4G4KA 1TWFB 1G2SA 3CHBD 2DY8A 1H9SA 4RHSA 3Q8BA 3QOJA 3AE7B 3QJYA 4K5XA 2WXKA 3G6JB 2FUG1 3GTMB 3PUXA 3I4NB 3SEBA 2EJFC 1J8IA 2FHTA 3NTKA 2JSOA 2OHFA 4IQZA 1HFGA 1DZ1A 3ERQA 2B39A 3E9SA 2YYZA 2BOSA 2RDFA 4DNTB 1M4VA 2OXPA 4KHVA 1MPEA 5E1FA 2WXMA 2PW7A 2Z4HA 5F2DA 1XLOA 3HOXB 5EGTA 5KRUA 3TDQA 1Y8OB 1UWMA 3U4EG 1ZDXA 1LTRD 2WXLA 5FOBB 3I3CA 2JYEA 5AUIA 1DOYA 2PW9A 4ITKA 5HFYA 1QNKA 2JYTA 4LJZC 1GUSA 5CV7A 2EYJA 3DWMA 3H0GB 4RCNA 1CZGA 2F0FA 2V4IB 1XCQL 2C5CA 3TZDA 1J7CA 1Y1VB 3DWGC 3FKIB 2DNEA 1JWAD 1C4AA 4AQ7A 2QKIC 4DNRB 1II3A 2A6HC 2A6HD 2B2UA 3IKJA 2PVGC 3EQLC 3WDNA 1ENFA 2BA1A 4YIJA 1STAA 2QCPX 5I4DA 3NUHB 4ARIA 1PUTA 3T16A 5D14A 1TR5A 4R3DA 1I6HB 4EVOA 3SK6A 1ACCA 4BBSB 4WAFA 1NI3A 2KAJA 5EKLA 4OO1I 3OW7A 4EQNA 4WRDA 3SHLA 2OEOA 1SMYD 1OXXK 5CV8A 4ZRQA 1V1PB 5J1ZA 1QOAA 2Z8LA 2X38A 4WWMA 2A69C 2A69D 1D5ZC 2BA0A 4K8IA 3S2DB 3AEEB 1EL0A 3C1EA 3VR9B 1K8MA 2ID0A 1PRTF 4M1UB 5AFWA 1AEXA 3DWQA 3AE2B 2PLPA 1SFOB 4OHJA 2WAQB 1FNVA 5CV5A 3NTIA 3D6WA 2F0HA 4F8MA 4US8A 4OGQC 1TVXA 3HUIA 2R92B 2RMMA 1JR0D 5CV9A 5IODA 3AB5A 1CT1D 1JOKA 2VB3X 5M5XB 2F0VA 5LL6S 1LTAD 1KFYB 4KN7C 3EFXD 1U4LA 3AE8B 2EYMA 4Q5VA 1EYCA 3VA7A 1IYUA 5JEAH 1DXMA 2H89B 1BBXC 3Q22A 2HQEA 4ULLA 1FFUA 4YSXB 2JSVX 1ESRA 1UAPA 2JQRB 1TY2A 1QKZA 4G7OC 2ZW1A 4MM3B 3AE9B 4ZLTF 3NPPA 3AU7A 1IHZA 1HFNA 4EGVA 4CBVA 2B76B 4NW2A 5ELDA 1PGBA 2I46A 4YXDB 1FYCA 1EY6A 3PO3B 1S5ED 3NVVA 4FXKC 4NP5A 1A15A 3GS2A 2PMVA 1AN8A 1NENB 2XRQD 3O13A 1O7YA 3NK9A 1LTGD 5G3LF 1Q1EA 2F03A 1F9QA 2PNRC 1FXIA 4CGYB 4FVMA 4BY1B 3AECB 2ENBA 4RGTA 2FFKB 3TP6A 1TY0A 4E6IA 2JWUA 3IAS1 5M9OA 3RMHA 5CGKA 1IW7C 4FNFA 5C0XJ 1C4QA 2IJ0A 1WD0A 1RF2D 1TJEA 1SJED 1SIJA 4FO2A 2ONQA 5CV6A 1JB3A 1BQQT 1SF0A 1LT4D 3TEZA 3BS1A 4A8XC 1EY7A 4N58A 5IIFA 3U52E 4KY7A 2K7VA 4P16A 4L6TB 1LO5D 5C0XG 1SNOA 5IGBA 3J80L 2F0TA 3P20A 2BT6A 5HI1A 4H13C 4N9PA 5KYIA 4QF4A 2OEDA 1KDCA 3J81L 3PZ8A 1LTBD 1EIGA 1NAPA 4G57A 1SYGA 5D7GA 3PZ7A 3L3OC 2JX5A 2DYMA 2KCCA 3Q8EA 3I70A 3NXWA 3T13A 4X3KA 1I7HA 1FNUA 2KQ4X 3CQZB 4ZHOA 5IGEA 5KGUA 4PMBA 3GP7A 5FKAC 1SSNA 1VF5C 4L2YA 3AH7A 5E4XA 2J42A 4R9WA 1SNMA 1ZXTA 2JA8B 1CZPA 3Q8CA 3S16B 1EIHA 1Z47A 2Z1CA 1O7ZA 5FO9B 5I2XA 5A2QL 4TMAB 2I07B 3LB8C 1E10A 3MXPA 1LLRD 5ELFA 2V3NA 2JXTA 2F0PA 1DGJA 3RPFC 3NE5B 3C46A 5HHDG 1DJRD 2BDOA 4RA8A 3M85A 1D5MC 3B2FA 2WB1B 2K04A 3HRDD 3S1RB 2LEKA 2MEKA 3P4QB 1RCVD 3TZUA 2LUMA 1PZID 2QMTA 3CIRB 3H94A 1H9SB 3H09A 2EE1A 3MXUA 4KV6A 1PZKD 2SDFA 1KLUD 2R6GA 2BS3B 5IGCA 1NVID 2FJ2A 1XXGA 3A55A 2E3TA 1NR4A 1Y56A 5K5PA 1HPCA 2EYFA 2RBMA 3K5LA 1E6EB 3J7AV 2F0OA 2HDEA 1WTQA 1VJKA 1LT3D 3SR6A 4CKCA 3VR6A 2G9DA 1IYVA 2F0QA 1EZ6A 3GQBA 5FK9C 3HOWB 4XWWA 3HGBA 1N62A 1NSNS 5LL6X 3S2HB 1IUEA 1TYGB 2IGHA 4XT3B 5LHY1 4V190 2L52A 1QOBA 5EKIA 1PFDA 4ZAIA 3AN1A 1C78A 4R8NA 5D65A 3E56A 4XQJA 2MJ8A 3DWAA 4A55A 3SFDB 2E2JB 1MD2D 1B53A 1GXDC 2WXHA 3F2UA 2XSCA 5C3WA 1FCLA 1DOLA 3NUCA 5HGTA 1S4ZA 5M3FB 1SDFA 3NVZA 1CK1A 2GA4B 3K5NA 4IFDI 3PO0A 1Z6HA 5JOBA 1L4ZB 4WH4A 1LACA 2ACZB 1VZ6A 4QIWB 1C4CA 1B3AA 4KGTA 3TP5A 2G9HD 3P63A 1I4XA 1F9PA 1N61A 4PT5A 1J9OA 3MA2B 2K22A 3UI2A 3SK4A 1EZ8A 2V0GA 1QNUA 4RCOA 1FM0D 1B2TA 3AE6B 1BCPF 3ABVB 3FILB 1EYAA 2B63B 2KACA 2XRSD 3OWFA 2E76C 4JWSC 1ET6A 2F4IA 2BTEA 2A73B 4TKOB 5CMDA 2E6XA 3DEPA 3A8JE 4C2MB 3HOUB 4KKIA 3Q0AA 4A3MB 4BY7B 2XVSA 5KEEA 2M2LA 1SB3C 1F9SA 4PV1C 4XYQA 1K53A 1PFNA 3PUZA 5DM63 1F2YA 3E5SA 1MI0A 2B2VA 4L63B 1PRTC 1VCIA 3ND9A 5DEHA 1TQOA 5KIXA 5EE1A 3S1MB 2LFNA 3TBIB 3A8KE 1WTXA 2PVOD 2K28A 3Q8FA 3E0JA 1QLBB 2W82A 1JOOA 1ONLA 2KA7A 2JZPA 2JA5B 4X3TA 2IGDA 2DBYA 1R7SA 1I4HA 1XTCD 3EVQA 2BW2A 5D3IB 3FAHA 1SNDA 1G291 1ZUD2 3GTGB 1MHXA 5IGFA 1GUWA 4M8AA 1H9KA 4C80A 2QJLA 2WXRA 3HG9A 1T5EA 3GB1A 4LMQD 5I9OA 2EY6A 2LMCA 2YEPF 2WS3B 4MHEA 2K5QA 3MXNA 5IOCA 5IGGA 3ZJVA 1HA6A 2AQ3B 4UDUC 1AWDA 1A3TA 3W5UB 4HN7A 2H88B 4K2LA 1A3UA 4ME5A 2NN6I 3P75A 4D2KA 3ZYYX 4C3IB 2I2YA 1CQVA 3K58A 1BMLC 3KLSA 4XQNA 3NTHA 5H92C 3C2PA 2CU3A 2QF7A 3RZOB 3MC0B 3BWUD 5COYA 1FGBD 4LTUA 5M5WB 4DK1A 1Q90A 1Q12A 2F1MA 3X3NA 3IXSA 1HCZA 3SDZA 2H4OA 3QG1A 1EY0A 5JEAJ 1C4PA 1C48A 2LKVA 4OIJA 1Y8NB 4LLGM 4QB4A 3BYYB 1DYQA 3U2SC 2LY7A 5BN3A 1DOIA 3SXHA 4RKBA 3I4MB 1SNCA 2OF1A 2BCOA 1BF4A 1TWHB 2L5TA 2WP8J 3NWSA 4A3JB 4DK0A 1MI2A 5JJZA 3VQIA 3LWUA 5E3FA 3URYA 3VYUA 4F88A 4K6LA 1EWCA 1ZYRD 2PO4A 2PZWA 4ZOHC 5M3MB 5JEAG 1UNSA 2B2TA 3C1FA 1D6EC 3D6CA 4HRSA 1F2RI 1XF5L 1F2RC 1YNTE 3P1MA 1YMHE 2X6GA 2JEBI 1PRTB 2F0MA 2RSNA 2RDHA 2XN9C 4WORA 2WDVB 1HUNA 5CORA 1OXTA 3BDCA 3FMCA 1DCZA 3KLSX 3NBIA 2IL8A 5C4XB 3VA5A 4JBWA 1SYDA 5NUCA 3T3OA 3T56B 4KTAA 5I6YA 3FRPB 3CKIB 4MACA 5E4WC 4LAAA 1L5PA 3D3RA 3OMCA 4KD4A 3BVZA 1TS2A 4IUPA 3MTSA 1AZQA 4C3IG 2IX3A 1K50A 5C5MA 3J80E 2Q8RE 4A3KB 4ZKBB 5I2YA 1VLBA 3NQIA 2ICIA 3MVVA 4DU9A 5T8IA 3GTKB 2F0UA 3NSWA 3TN2A 3AE1B 4QMGA 1N5WA 4NAWB 3IL8A 5DM73 1VDVA 2VUMB 3BZDB 5BYRA 1H9MA 4MIUA 1R4QB 2MP1A 1OFFA 1ICWA 3MEHA 3P42A 4XYOA 1BUIC 1EU3A 1PTOC 1GUOA 4L23A 3B9JA 1PTOD 3H91A 1D4BA 1NUCA 2WKDA 1JOQA 1GAQB 2A74C 5EPKA 2WQYB 3S14B 3I57A 1EOTA 1EY8A 1JCKB 1KLGD 1B9RA 4NJCA 4Q2JA 1SMYC 1C79A 3SFEB 3VYSA 2WACA 4KX6B 3OOCA 1N5XA 1K51A 1M8AA 4J6HA 4DAVA 1T6BX 2Y5PA 4ARCA 4PQXA 1OQRA 5K36H 5HG2A 4B9XA 1HA5A 5EKKA 5IT9L 2Q5WD 3U9OA 1JE4A 3C8YA 3TMEA 2KDMA 2M56B 2ZW0A 1R4PB 4KN4C 4F7XA 3AEAB 2B2VC 2BB5A 1B1ZA 3OSOA 1AZPA 4N9TA 2CHBD 3WOEA 3D4RA 2O2LD