2IJ0A

Structural basis of t cell specificity and activation by the bacterial superantigen toxic shock syndrome toxin-1
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
191
structure length
191
Chain Sequence
DNIKDLLDWYSSGSDTFTNSEVLDNSLGSMRIKNTDGSISLIIFPSPYYSPAFTKGEKVDLNTKRTKKSQHTSEGTYIHFQISGVTNTEKLPTPIELPLKVKVHGKDSPLKYWPKFDKKQLAISTLDFEIRHQLTQIHGLYRSSDKTGGYWKITMNDGSTYQSDLSKKFEYNTEKPPINIDEIKTIEAEIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Toxic shock syndrome toxin-1
publication title Structural basis of T-cell specificity and activation by the bacterial superantigen TSST-1.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 47
structure length 191
sequence length 191
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2ij0A02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2ij0A01
1RCVD 2TSSA 3V05A 1RD9D 1V1OA 1PTOH 1XTCD 5TSSA 2O2LD 4L6TB 1YN5A 1I4HA 1S5BD 1QILA 1PYWD 1LTGD 1LT3D 1S5DD 1TS3A 1JCKB 1JWUD 5I4DA 5FKAC 3SEBA 1TY0A 3EA6A 5ELEA 1FD7D 3MFGA 1S5FD 4C56C 1HTLD 1DYQA 1EU4A 3BVZA 4RHSA 1JWSD 1SBBB 2Z8LA 1I4RA 1RF2D 1LLRD 4RFBA 1YN3A 1LTAD 1I4GA 2QEJC 1CT1D 1CQVA 1PTOB 1D6EC 1PRTB 4L63B 1D5XC 2AQ1B 3R2TA 3OWEB 4RGOS 1LTSD 1TS2A 3EFXD 3GP7A 1ENFA 2WV6D 1TS5A 4ZYSA 2CHBD 1F77A 2R61A 1RDPD 2XN9C 4DXFA 2NTTA 1XXGA 1KLGD 1L0XB 2QILA 1I4QA 2G9HD 4K6LA 1ESFA 1ET9A 4TSSA 1BCPC 4RGNA 1EFID 4RHRA 1STEA 5ELFA 3DWAA 1KLUD 2XRSD 4UDUC 1V1PA 5FK9C 4DXGA 1EEFD 2J4XA 1FNVA 5ELCA 5ELDA 1FNWA 2RDGA 1L0YB 1V1PB 1LTRD 4RH6A 1BXTA 3MC0B 3BVMA 3BZDB 2NTSA 1SXTA 1LTID 1CHPD 1B1ZA 1JQYD 1JWMD 1AW7A 1MD2D 3CHBD 1B44D 1LT6D 3O13A 3BYYB 1LTTD 1BCPD 3R8BA 2XRQD 1KTKA 1SE3A 1EWCA 1HXYD 1LT5D 4OHJA 1S5CD 4RGMA 1BCPF 1PZID 1PTOC 1PRTC 1SJED 4O1NA 5D3IB 1JR0D 4RGTA 1S5ED 4RCOA 1CHQD 3TSSA 1I4XA 1SE2A 1D5MC 2RDHA 5ELBA 2ICIA 1LTBD 1T5XD 2AQ3B 3R2IA 2IPKD 3BVGA 1M4VA 1FNUA 4Z9CB 5D3DA 4BWGB 1YN4A 1GOZA 1UUPA 3W2DA 1HQRD 1SE4A 1DJRD 1HA5A 1ET6A 4NZLB 1TS4A 2SEBD 1EEID 1LO5D 1PZJD 1UNSA 1PTOD 2XNAC 1PRTD 1TY2A 3DWPA 1LT4D 1SJHD 1CK1A 2AQ2B 3DWQA 1EU3A 1PZKD 2IJ0A 1I4PA 3BYTB 1AN8A 1PTOF 1FGBD 1BCPB 1PRTF 3URYA 1D5ZC 1G8ZD 3KLSX 1SEBD
chains in the Genus database with same CATH superfamily
1RODA 1FCCC 4ZRPA 4R8NA 2A6ED 3MZ5A 2JF5A 4HIOA 3I4NB 1PQSA 4RF0A 1MVKA 1LV9A 1E3PA 1X3FA 1VQKA 3L08A 2F3IA 3K0XA 3HOWH 4IWOA 3RNAC 4PYZA 3Q69A 1LTGD 5KEEA 2IO3B 1F9JA 4LCDE 3T53B 1WJNA 3TZDA 2VH1A 3L3OC 1R9TB 1STGA 4KY7A 3CCEA 1ILPA 3U7DA 1FD7D 1MHWC 1X6OA 2D3GA 2KA7A 2MO0A 3WDNA 1HFGA 3GTOB 2VH2A 2VB2X 1KNEA 3LB8C 4R4TA 3HIZA 1A63A 4JI6L 2SDFA 2GA4B 2KECA 3NTIA 4QIWE 1PXUA 4BY1G 1WTWA 2O5IC 1WGYA 1WXQA 2N55A 3FKIG 3B08A 4KKIA 4RFBA 2J7ZA 3A8IE 1J5EQ 1HUNA 1LTAD 4GOCA 1RYJA 1VQMA 4IUUA 3PRPB 1GXDC 5HGTA 4ITKA 1DCZA 2JN4A 1K8AC 1RWSA 3B0AA 4OX9L 1HR0W 3HOXG 4GDLA 1EY9A 1O7LA 2PZUA 3QC8B 1YITA 4HIKA 3BIID 1H9KA 1N8RC 1M8AA 3I57A 3U9OA 4K5VA 4WJOA 1WXSA 2ON8A 2QKIC 4MACA 3RT3B 1SF0A 1I4QA 2BE5C 4LW1A 4GMVA 1U4MA 5BMIA 2E2IH 3HOYH 4B0EA 2E5LQ 4W9EA 4B9KA 2NVQB 1H9SA 4BBSB 5M3FB 2EELA 1BCPC 2JRIB 2UXBQ 2KDIA 3M4OB 4BXXH 4GOPB 4C4VB 1IL8A 4DHJB 1Z7TA 4P1BC 4ARIA 2VRRB 1K52A 1YJJA 5C44G 3V6EB 5ELCA 2UU7A 4MH8A 1BNZA 4OVVA 4LTUA 2RHSB 1L6UA 1LTRD 1N61A 4MT5A 4FJYA 3BVMA 2L3ZA 5EKLA 1NI3A 1X55A 1PFDA 4R9WA 4CHKA 5DPWA 4AJYB 3K80C 3J7ZC 5IP4D 4IFDI 3AXCA 2DYMA 3E56A 3AMUA 3WOEA 1FFUA 4M00A 2WX1A 1WI5A 4JBMA 1CSPA 4TV3A 3M4PA 2OXPA 3D4WA 2C5CA 2MQHA 1XPUA 2J42A 4X64Q 4OHJA 4A9AA 2HCIA 3J81j 2BTEA 1IKLA 2LKVA 3VH4B 1PTOC 2WINB 1HPCA 3T4AC 2B63B 2M19A 2LVPA 3V62A 2PO4A 1TU2B 2DBYA 1GHJA 1YJ9A 3MP9A 1EWYC 1JJCB 5EPJA 4A3IH 3S2DH 5IGFA 1O7IA 2LGSA 1FNUA 4A3KB 1HR0L 1SMXA 2A19A 2WB1G 4JLCA 4CYEA 1W6KA 1GM5A 1F52A 4WH4A 1QLBB 1FD6A 4JQWC 1EFWA 2J53A 2QDLA 5FLXc 5G55A 2PMZB 3S1MH 4MELA 4A3PA 2ZTCA 2WU2B 1WD0A 2LFNA 3GTKH 1OTCA 3HOUB 5J39A 2SEBD 4CO7A 4DV4L 3CPFA 3DWPA 3S1NH 4G4KA 3P2BA 4US8A 4DV6L 3RZWC 1ZYRC 4P75A 1EU3A 5T1GA 1YNXA 3S14B 3I9V1 2K1FA 1EYAA 2F0OA 2LXKA 4DK0A 2GBKA 2ZVNA 4KGSA 3HZXA 1AARA 3L10B 3SHQA 1QOAA 1DGJA 3K5OA 5L95C 3M7GA 1A5RA 5EQ0A 2ASBA 1OO9B 3QAQA 2Z4IA 1RFKA 2VQEL 3LJ3A 1SE8A 4BFRA 4TKOB 1EYCA 1N32L 3L13A 1LM8B 2RD0A 1I50B 1C4PA 1T0YA 3VR5A 4JBWA 1N36L 1HJPA 3Q8AA 3GV6A 3I4MG 2PW7A 4X3UA 2FCSA 4M02A 4LJOB 3ZRFA 3NELA 1NBFC 3VR4A 1E8XA 1SYGA 1VQCA 3BU2A 1IYJB 1I94L 2CHWA 4HTHA 2K39A 3BZCA 4A3BH 5JXVA 3ND9A 3QA8A 2GVBA 4DAYB 1F1HA 4X3KA 3M9BA 2WLBA 3M95A 2AWOA 4MTKA 4P6VF 1P0RA 1CT1D 2C9WB 3C0RB 3G48A 2WXOA 5JH5C 4FHJA 4JE3B 3TUOA 1K3BC 4YY3Q 4ZCKA 2D3AA 4DV0L 1F2LA 2BBCA 2FAZA 2O4XA 3S17H 1HRJA 2MLBA 4PK1A 1NR4A 4DXFA 3VFKA 3EROA 3MXPA 4JL9A 4Y7NH 3A7LA 3VR9B 1QOFA 1IW7C 2UXDL 3P4PB 2R2QA 4GOPA 4C4VA 4CKBA 3K59A 2ZXRA 2KHJA 3E9SA 2KDMA 1F2MA 3CIRB 4O0AA 3U50C 1XMOL 2G1EA 3HRDD 4KIKB 3NG0A 4OWWB 4IM0A 1F2RC 4NY0A 4A55A 2E2DC 3Q8BA 1EIHA 4DV7Q 1O80A 3W5UB 2KHWB 4JI2Q 5IGGA 1V1PB 4IKGA 1JE4A 4WWNA 1GUTA 1Y1WG 1PVOA 3AEGB 1EY0A 3VYRA 2FIFA 1K8GA 3RNGC 1PA6A 2NVUI 1JWMD 3BINA 3PUZA 1NYQA 4KD3A 5NUCA 2OQKA 1MGSA 1SMYD 5CX3A 3JAMi 3C2PA 2EY1A 2YV5A 3APFA 4K3CA 1LYLA 3UI2A 3VHTC 1X3PA 2WIIB 4JI0Q 1KTKA 1QB5D 3TMPB 4I7AA 4XDDA 4DR1Q 5A35A 2FNJB 2QCPX 2L55A 3NTHA 5IP9H 1XNQQ 3DHHC 2KYWA 3D4RA 3TP6A 5JJIA 4M8NA 1GJZA 4X3TA 4JBJA 2MW5A 3N1XC 1OXSC 1EZ6A 1S1QB 1MIUA 4CHTB 1GUAB 2PNHA 2E8GA 4RCOA 4IOAA 3N1YC 1SE2A 4ALPA 1VMPA 1Q81C 3S2HB 1RAXA 1IZ6A 2N8NA 3DHQA 4OIJA 4ZRKA 3A9KB 3QJZA 5JJKA 4LFAL 3EFUA 3WA0A 1AZPA 2EKEC 4MM3B 3CWIA 1R4NI 4GLSC 2GBMA 1SE4A 1GC7A 1IBKL 1A70A 1GUNA 2WP9B 2HQLA 4LNKA 2CCZA 4AOFA 3K7AH 1EYGA 3QOLA 3S16B 1SFOB 3P1HA 4PMBA 1RM6C 2IBIB 2WXMA 3KUDB 2JA9A 3N20C 5LL6X 2EMTA 5AZHA 2MHJA 4MEMA 1IYVA 1PRTF 2NN6G 2B2YA 3KLSX 4DA2A 1W2BA 4PNYA 3CMEA 1JJGA 5IA7A 2FUG1 2E75C 1X32A 1I3QH 4GN5A 4KZ0A 1PDQA 1E8WA 1UF0A 4F8CB 2UUCQ 2R92G 3NS1A 2Q2IA 4DBGA 2EZVA 3EGRA 2YU9B 3J7AF 4DAYA 1WR6E 1N62A 5ELEA 2G3QB 1C4QA 4U68A 1HNXL 4TVAB 4KJNA 3I55A 4C3HG 1CUKA 1P98A 1JOOA 3APDA 1VF7A 1ZKOA 3CPWA 1VQOA 1IL2A 5IOCA 3AB9A 1VQNA 1UD7A 1VD2A 1Y14B 4B08A 1SBBB 2V4IB 1XMQQ 1HHVA 1I4RA 1PMRA 4QL5A 4DV2Q 4HXDA 3H0GH 3UIOB 1CZPA 4L63B 3JAME 4HDOA 5E4XA 2PPBC 2V4LA 4ANWA 1WXVA 4C3IH 1ZDXA 3TL5A 4W9KA 2PE6B 4HVBA 1ENFA 3DVGY 3AFPA 4R4CA 2JRHA 3ZDMC 3FP9A 1UAPA 5A2QE 2NBFA 3VA7A 3DWMA 1WJUA 5J3BA 3CC2A 1YMHE 5E6JA 1Q7YC 4D2KA 2M2LA 4LF8Q 3DBLI 4X66Q 3S15H 4PMWA 2K8BA 2JZ3B 2KTFA 1UGJA 4KIKA 2EPBA 3PIOA 4PG3A 3PLVA 3TBIB 2FCQA 4ZRQA 4RHRA 3ICEA 2J0TD 3AEBB 1V1PA 2K1BA 2YTXA 1K53A 3CMAA 4JIOU 3RYTA 1Z6HA 4APVA 2OWOA 1NUCA 1VMCA 4L5SA 5D14A 1TWAH 3CW2C 2RDGA 1KM7A 3PRMB 3QHTA 1G291 5IWAL 2IYDB 2K5PA 2LRWA 2R3ZA 3PGEA 3I91A 4HKQA 1JICA 2ZTDA 2PPHA 2F0KA 3CHBD 2CW0D 4IJLA 3JW0X 1B44D 1MG8A 4DKAC 2F0LA 3WOFA 2XRQD 2Z59B 2WDVB 4QIWB 1WCMG 2PNRC 2BH8A 1C76A 2BW2A 1EWCA 4OELB 4GZYC 2MJDA 4PQXA 4IPGA 1TWFB 3PO3B 4HPLB 4WURA 1WJJA 1GVPA 2LY7A 4A93H 4A4IA 4S17A 5D3IB 4HJ9A 4LJZC 3HP3A 3A9KA 4LFCQ 5GQOA 2Y5PA 2NBVB 2NVXH 3H3VH 3KFUA 3AB5A 3DHIC 4QUFA 4NXML 4B3TL 2N78A 5D3DA 4MM3A 2EYOA 3KDFB 1TKEA 1F2ZA 2HJ8A 1B9NA 1WGGA 2F0UA 4WQOB 2D3BA 1Y8RC 3K5NA 1C7YA 1UEBA 2V1CC 5COYA 1PFBA 1G6ZA 4NXNQ 5CHWA 3H09A 1PZKD 1XX8A 4XXEA 1EM7A 5G5GA 3R93A 4HJ5A 1JWAD 4N6EB 3SR6A 4DV7L 3S1RH 2ZTEA 4OONA 1QCBD 4OWTB 4RMFA 4JBKA 4FBJB 3ZNID 2M1MA 1H9MA 2JA8G 1T6BX 2X38A 4YCWA 4CJ0B 4A3IG 1S72A 5M3MG 1M1KC 3G6JB 4ME5A 4O2DA 1XTDA 4I65A 4GNXB 1ESRA 2K14A 2K5NA 1CM9A 2KX3A 1B53A 1OGWA 2INPE 4ME3A 3STBD 4CDEC 4LF7Q 1ISNA 1E90A 1GB1A 3HOVG 1Q5WB 1PH4A 4POFA 4JCVE 1OEYJ 3VUYA 4FXKC 3DBHI 2N4FA 1RIPA 4FLHA 3SDZA 2DUDA 2VUMH 3OTOQ 1YN3A 4LNNA 2H5XA 4AYBE 2I38A 1I4GA 1K0SA 2BYFA 1E7PB 5JZEB 1M90C 3VAWA 3CU7A 1HTOA 1I6HB 5LLIA 1EY5A 4IN3A 2D0PA 2LMCB 2RHQB 1YJWA 3I73A 3MFYA 2LD9A 4NJCA 2LRUA 3KF6B 1TS5A 4PZ7A 2KDBA 2M0AA 1C78A 1Q8IA 2EJMA 1G6JA 3FEWX 4FXDA 1KLGD 4JOIC 4A3DB 2QILA 4DHJD 1IHZA 1RL2A 2LXJA 3K7AB 1QVGA 3PO2B 1EF5A 4K8IA 2NS5A 3KWLA 1ET9A 3A5UA 1XO3A 4A3EG 4LF6Q 1TIID 1B50A 4URKA 2K6DB 4A3BG 1OXXK 1KLUD 2GLSA 1IBLL 5M5XH 1K9MC 3ONAB 5BO4B 1E0ZA 3HUIA 2F0DA 2MQJA 4GDKA 1VZ7A 5LXHA 4R1JA 1FPYA 1UELA 1WRDB 4X65Q 3ZO5B 1FVIA 1HTQA 2PI2E 2MFIA 1Y69U 2NVTH 3BZDB 3O65B 4MZ9A 1V81A 3DMUA 3VH3B 2LHEA 3LX0A 4K14A 1EY6A 3J81i 2K9XA 3DEOA 5IT9L 5EKIA 3Q6BA 4A3JB 3NXWA 1YJNA 4HKZE 3T3NA 1NNXA 1RFAA 1VCBA 4N59A 5H8YE 3Q8EA 4FNFA 4BA2I 2PMVA 4FHKA 3UQBA 1Z47A 5FLMG 4HSPA 3M62B 5C3JB 1CSQA 1LTLA 1Y8PB 1PZID 2F4VQ 2O2VB 4IFDH 1X1MA 1TKGA 4JI1L 4DV2L 1OQYA 4RGTA 2K0PA 4K5WA 1ZP0B 2Q2TA 3ML8A 1CHQD 4A3FB 2AWTA 2A6HD 3KDFA 4FYDA 2Y5BB 3ZQ4A 2JA5H 2B8FA 4LFBQ 1CKOA 4KKJA 1K83H 3GE3C 3SFEB 4ZRZA 4X3SA 3I4NH 3CCVA 2FBWB 2ZM6L 3X0WA 1ZOYB 3I72A 1UWMA 1GOZA 5LMNQ 1B3QA 1TWGB 4WRDA 2VQFQ 4BY7B 4RKBA 1NMGA 3CD6A 2MEKA 4MH0E 4OW0A 4ACFA 2V1YA 2GVAA 2CKZB 2Z0DB 1EWIA 1PH3A 1SJHD 2D3CA 1E2WA 1FXAA 3I63C 4K81A 3GTOH 3R66C 2R93G 2N1WA 4ZKCB 1HA6A 1FGBD 3CF6E 3C19A 4IUQA 5JJZA 5CHFA 2REXA 1MJEA 3FMCA 3K8AA 4BOZB 2BQQA 3ZW3A 4DHZE 4XQJA 3EFCA 4GNXA 4HCSA 3GTQB 5AFWA 1IBXB 1D1KA 2A5HA 1HNWL 3EC8A 1S5BD 3LWEA 3IT4B 4QAYA 2IX1A 2AL3A 4KV2A 3P42A 4NQKE 5D6JB 4ILWA 5FKAC 3NSWA 3FC4A 2VB3X 3F1ZA 4XQNA 1JW9D 2LJIA 3C1EA 3PREA 3K57A 1PYSB 4HPPA 4ZYNA 4QQBX 4UAIA 1YVCA 1J19A 2NVQH 3UE0A 4BBSH 4IZ8A 5M3FH 4A93B 4DDGD 3J80E 1JWSD 3M4OH 3PUYA 2L12A 4GLAC 1CQVA 1EQQA 2LMCA 2JYEA 4Y52H 3W3AA 3KF6A 3S9WA 3DCGA 3Q3FA 1H95A 1CA5A 3R2TA 1N33Q 5H1SE 5CTRC 3HKZE 5IYCG 3GP7A 2QC8A 2MUYA 3K7UC 4QF4A 1K50A 2F0WA 1L0VB 1PGBA 2CS4A 1K3RA 4CDCC 3A4SC 1LM0A 5I9OA 1F2RI 4KD4A 3H7SA 3KH0A 2B2WA 5TR5A 3RUZA 4NXNL 5JJLA 4A3CG 4V0BA 3SVMA 1J8CA 2E76C 5KNCA 3ZTDA 1B3AA 4RG1A 4POGA 4LF5L 2XRSD 2OTJA 4C7ZA 3W5OA 4WORA 1WXMA 2NUCA 1VQDA 3DUZA 1VCIA 1YD8U 3TQYA 2LUMA 5BYQA 2B63H 3UI3A 2R7DA 2KWCA 3X23A 5EPKA 2JA7G 2JVCA 2EKIA 1BUIC 2JX5A 5KRUA 1CHPD 3U52E 2FIDA 4YT0B 2K28A 1Z5SB 1STNA 4A3KH 4G7HC 2IL8A 4IPCA 4W9IA 3LGJA 4LUVA 3PT2B 4LF7L 2MA9B 2D11A 1HZCA 4JI4L 2BS4B 2O2VA 2AWNA 5IAAC 1DD2A 1WVLA 2LI5A 4EEWA 3HOUH 4GKKQ 4RGMA 1L1OC 1JQ4A 3IVFA 2DYOA 3U4ZA 3NE5B 1ZXHA 3K9OB 4GGQA 3NY5A 1H9SB 1KL9A 3KUCB 4NQLB 3S14H 4H02A 4FF1A 4DFAA 5CMDA 3QK0A 1SNOA 1CKNB 3P63A 3A8KE 4P2CB 1FRRA 4FA6A 4REZA 3KLSA 5JVG3 2HHHL 1Q12A 2WHIA 3MHZA 1HUMA 3BJUA 3Q22A 2B2TA 4B3MQ 1LXDA 2R7ZH 1J6QA 1I50H 4K6DA 4TQUS 3I90A 5I9PA 4DR6L 4BY1B 3AU4A 4IWPA 1Q1EA 4HLEA 2A69D 2AX5A 4LF6L 2KWVB 1IKMA 1FIQA 5HY6A 2DWQA 3RZOB 2N3SA 2JYTA 1X3GA 1YNJD 4W9HA 3RN2A 1TZOA 2IJ0A 3PUWA 5FJ8H 4HJAA 3NBHA 2X6GA 2KT7A 2LHDA 4XDCA 5GXGB 3GE8C 3RMKC 4X65L 5C3EG 1G8ZD 5JHAA 2VZKD 2IT1A 2JZZA 2K5HA 1QE6A 2NB0A 4HEDA 2UUAL 2ZVOA 1IBXA 4HJGE 3N52A 4W9JA 1LFDA 2KMAA 2ONQA 3VYUA 5C4HA 3T1YL 4DUZL 3P7JA 5K36H 3PZ8A 1I4HA 4G7OC 2KQ4X 5D94A 4EZLA 1E7VA 5EBCA 2DZJA 1YHAA 2WKCA 4KKSA 4N8X1 4AH6A 5I2XA 4BOSC 3FKYA 3PVLA 4OO1H 3EA6A 4BKSD 1WYWB 1B9MA 2L8JA 2WXRA 4IURA 3Q3MC 1NDDA 1QZEA 5AEKB 2WS3B 2ZJPA 1X3EA 2K5VA 4KHPQ 1K83B 2RMMA 1GKHA 3Q23A 4CDFC 4GSWA 4GN1A 2WV6D 4DWFA 1UE1A 4ZYSA 5HKHA 1BQQT 4MDKE 3TREA 1YHQA 4YHHL 2PQAA 2K6QA 4K0KQ 1QG7A 1FJGL 1FFVA 4K2KA 2IY1B 5I6WA 3VR6A 2J52A 3ENEA 1XPOA 1ROEA 2C7NB 3APCA 3CF5A 4UP8A 3KLWA 4HJ8A 4WJPA 2K5QA 3QX1A 2J4XA 2Y0SE 4DR4L 1FNVA 1TXYA 3VTUA 2WB1B 3IRBA 1KXLA 4HN7A 4LF4Q 1E10A 3BDOA 1K73C 4KGRA 4OVZA 2OHFA 3B6YA 3MC0B 1N63A 3VRBB 1I7HA 3S2HH 3RN5A 1VQLA 2I46A 2KN5A 3AE4B 1O7ZA 2XTIA 3HVZA 3GOEA 3MTSA 2OEDA 1FYCA 2BE5D 3PGZA 2DENB 2CHXA 2N7JA 5LMUQ 5CYUA 3P20A 2BH2A 3NZSA 2LVQA 4PYUA 3IAS1 3SGIA 1BCPD 1ICWA 1JORA 3ML9A 3PUVA 3Q8DA 1S5CD 3KQ4A 4MN3A 5G3LD 4AYBB 1EUVB 2D9UA 3IL8A 2ZW0A 3ZNZB 1CKNA 3S16H 1SFOH 1TBEA 1PRTC 4IM3A 1EY8A 3QB3A 1EUJA 2AYOB 1NBWA 3BZKA 2M56B 3I4MB 2B2VA 2HCCA 1XLPA 5IO9A 5ELBA 2INNE 2AQ3B 1N33L 3KYDD 1A2TA 4AIMA 1P1AA 4AP4C 3NZUA 1FO4A 4AQYQ 4B3SQ 4KSLC 3PIPA 1YNNC 1OXVA 1VLBA 1P16A 2Q2HA 4HROA 1HQMC 3OHXC 3J81L 4TMAB 1XT9B 3L2PA 1MKHA 1TR5A 2EY2A 2LS01 1AWDA 4JW0A 3AE5B 3TZUA 2RVLA 2INCC 2L11A 2X69A 2HTHA 2YU9H 2BYTA 4DAMA 1PTOD 2LVOA 2B2UC 3BDLA 3KUZA 2I07B 1HE8A 2N7EA 4JWSC 4JI8Q 2DJGC 2LASA 2KAJA 2MJ8A 2KCTA 4DUYQ 2BYVE 1Q90A 1Y8NB 5I4DA 3NJTA 1PFNA 3V05A 5JEAG 4A76A 4JPSA 4JI5Q 5JVH3 3NZ3A 3KF8B 3AEFB 4IC7B 2R2OA 3U4VA 5DM63 1KDCA 3GTMB 4YSYB 3HOZB 1B2TA 1C48A 4YWKA 1OEYA 2N1VA 5AJ3Q 3QCAA 3W1YA 3T3OA 1S5DD 1Y8OB 2ZXPA 2Y3AA 3AYHB 4NNJB 2N9XA 4YSXB 2PW5A 4DXAB 3FPUB 1WYDA 3KW5B 5CV5A 1ZYRD 2FJ2A 2KJRA 4C00A 2XWJB 2FE8A 2JEAI 4NMZA 2IO2B 2YEPB 2BA0A 1BDOA 2B39A 1A2UA 3TCAA 4IUMB 3WAMA 1QUQB 2INDC 2KACA 1ML0D 3Q3JA 3TN2A 2M0XA 4M8MA 3ZJTA 3OOCA 5JAVA 3QG1A 1E24A 3ULJA 5IYBG 3CC7A 2D2QA 5AUKA 4DK6C 3HRZC 4GB9A 2R7ZB 2KOXA 3DBRB 4WQMA 3T9LA 3M3YB 4HPMB 4ZLTF 1Y1VG 1YJIA 2MO1A 1IBMQ 2CJNA 2I5MX 2H4OA 1DOXA 3RD4A 4HWIB 1UEAB 2KJXA 1PHJA 1YOVB 2Z6BA 4LF9L 2DZIA 2WDQB 1L0WA 1Y56A 2L32A 4BBNF 1HTPA 2OF1A 4TSSA 1G2SA 4RGNA 1EFID 1RLFA 1KABA 3D8GA 2KMMA 2WYQA 5E6OA 3DWAA 4UDUC 4MIUA 4JYAQ 1AP0A 2D5DA 4N9F4 1SRUA 1EEFD 1TWFH 5FO7B 3PO3H 1HZ9A 3PSIA 1JRPA 2XIWA 2UUBQ 2H88B 1PFSA 3JVZX 5IYDH 2R7FA 4DHZB 1N34Q 4LK0M 2WAQE 1R4NB 5C3XA 2UXCQ 1Q8KA 3B1LX 4HIDA 4PZ6A 1C1YB 4ZK9B 5DAUA 3G71A 4FF3A 4BKTA 4WJ3M 1HNZL 4M1UB 2I1JA 3PHXB 3L7ZC 1L4DB 3I56A 1IW7D 2EYHA 1L6VA 1K28A 2QF7A 4C3JH 2KHSA 2Z0SA 2JP1A 2C35B 5HGQA 1R4MI 1UH6A 2K8CA 2PEAA 3O13A 2KDFB 3NBIA 4QGUA 2BGFA 3KWVA 4W9CA 2ZEQA 4A3OA 3ZUNA 3MJ5A 3RNCC 4XTCS 2OEOA 3A54A 1HXYD 1XWEA 3B2FA 3PIO3 4GU2A 1V8CA 1A15A 2HIXA 2KD0A 1YX6B 4A75A 2F0VA 2YYZA 1P3QU 1V1QA 3NOBA 3L17A 3T56B 5T8IA 1EIYB 3HKZB 5EBDA 4K2LA 3CC4A 3B2GA 4P1CC 3M7NA 3BVGA 1M4VA 2K3UA 4C80A 1N6ZA 3IT6B 1B7YB 4BZAA 4TQ0A 4HJ7A 3U8ZA 3BS1A 4W9DA 4C3HB 3CXCA 1KFYB 2CU3A 1NR2A 4NP5A 5KHOA 4A3KG 1XQQA 2EDGA 3ULLA 4AWJA 2LWPA 3Q3NC 2HD3A 2PI2A 2F0GA 3D4DA 3ETRA 2MX2A 2NR2A 2C5LC 3HOUG 3DBRI 4GKJQ 4Q2JA 3IAM1 4LF4L 1J5EL 5C4JB 3KF8A 1J7CA 2KVZA 4L5RC 3DBLB 1R4PB 2YLMA 1A3UA 4L8JA 1J0GA 2CR5A 2MH7A 3QIAA 3C3LA 1C8CA 1UZXB 2O2LD 2IHFA 4L6TB 2QA4A 2PKOA 2A68C 3RNEC 3TEWA 1F2YA 1I6HH 1GB4A 2WQYB 4BKGA 1FRDA 1PYWD 1WGKA 1LT3D 2BDNA 3RLNA 2KC1A 4ANUA 1JWUD 3NQIA 3PTFC 3CCUA 2K5WA 3Q6SA 2E5LL 2JA6G 4A3DH 3E3XA 3V2TA 4DV5Q 2JXTA 2KKCA 3LXFA 3PO2H 1QUQA 5FLXL 2PLPA 4PS3A 2UXBL 2AHOB 2KMCA 4EKUA 5IT9E 3VR8B 4ZRJA 2RCNA 4FP5D 3RPFC 4LLGM 2UU9Q 2QEJC 1N60A 4MHEA 3DOWA 3MHSD 1NMFA 4ICVA 5DPRA 1YX5B 5KNBA 1IGCA 2EE1A 2F0JA 2NN6I 4B3SL 3AEAB 4OZBA 2N0SB 3N6RA 2Z4HA 3OWEB 4IJHA 1XF5L 2M4NA 3FDTA 4WJWA 3M4QA 1WCMB 1KQSA 1DOLA 2VZKB 4IPHA 4C7YA 1J9OA 1RDPD 1WTQA 4IM2A 3UINB 4A3JH 5M5YB 4XDXA 4A3LH 3D6CA 1J7AA 2ZW1A 3NRZA 1WRIA 1M94A 3QIJA 2WACA 4W9FA 2N9KA 3ZXVA 1J7BA 4X64L 1RJTA 3FAHA 3Q14C 3GTGH 5C0XG 2WXLA 3H3VC 3TRZA 2JA5B 2KO3A 1UE6A 1UBQA 1VDZA 3GS2A 4GXBA 5C0XI 1F9QA 3W1SA 2HDMA 4JI5L 2ACZB 1VQAA 4A3FH 2ZNVB 4BBRG 1F9RA 2NTSA 4MTNA 4CJ2C 4DGZA 1R7SA 3E5SA 4HMIA 5AJ3L 2IO0B 5CV6A 1SNMA 3AEEB 3N30A 2F0SA 3PZ7A 4P7IA 3DEPA 5IP7H 3C46A 3RCZA 1WF9A 1JE5A 5CV4A 2J0MA 1TWGH 1BVSA 3HOWG 4BY7H 4RA8A 2I0QA 1SYCA 3GQBA 4W9LA 4A3MB 5IIFA 1KJTA 4K7WA 1STHA 2PZWA 5C4XB 3KYHC 4QCLA 2A1AA 3IFWB 4EZKA 4RWSC 1GJXA 4PMCA 2KCNA 3NWSA 2JA8B 4ABNA 1JR0D 1BBXC 1TIFA 2GMIC 5HG2A 4WWMA 2SNSA 1XJVA 2H89B 5FOBB 3A33B 4GDKB 5I2YA 1ZKHA 4G0NB 4EQ5A 2MSED 1XCTL 1WIAA 4C2MB 4L5TA 3DBHB 3GTQH 3HOVB 1NI2A 3KJOA 1SYBA 5M9OA 2F3WA 3ND8A 4HIMA 2CFMA 3H15A 1SNDA 3NWTA 1N5XA 4J6IA 2E2HH 1FL0A 1TT2A 2K50A 4OZCA 1YEZA 4JV5Q 3OG5A 4F7ZA 2A73B 1O7YA 2Y0SB 3F2CA 1XLNA 2F0IA 3ZNGC 4UP7A 3HOYG 2AUKA 1Q86C 3E9HA 5BN5A 3PUXA 2L00B 1AN8A 1CQFA 2UWQA 1BCPB 4KMUC 3A7AB 4N58A 4R3DA 4GIVA 4BXXG 2EY6A 5HURA 4JI3Q 1WY8A 4EVOA 1WFQA 2BOSA 2N88A 4EQOA 3LYYA 2G45B 2VS1A 3KYCD 4YY3L 1RHPA 2E6XA 3IKJA 1B9RA 4QB4A 1WTOA 1ZDVA 3P4RB 2RA4A 4DNIA 4C3JB 1EQTA 2OQ0A 3HM3A 1V86A 3W9CB 1NSNS 5HHDG 4WAFA 5KIXA 3D31A 4NAMA 2L5TA 3HKSA 1SYFA 2JWUA 1NAPA 3EIVA 1PH5A 5CV7A 2IWHA 3Q2AC 4AS1A 2GB1A 2WX0A 2LJ5A 4K7UA 4DR3Q 1TYGB 3R3MA 4TUUA 3H9DA 4MJSB 4OIKA 1WTPA 1E8YA 4FF4A 4JI2L 1PTOB 1D6EC 5J17A 3KUPA 3S1QB 3GV3A 5CBEE 3SE0A 2M9VA 1WTVA 2W3RA 2HJ1A 4US9A 2WB1E 1QF6A 3R3OA 2Q8IB 2RDBC 4R4OA 4J6HA 2Z6KC 4KTAA 1DM0B 4JVZA 1AFPA 1E7UA 1FXIA 2Z0EB 1STAA 1GNUA 2XN9C 1XXGA 2V3SA 4BA1I 2CJOA 5KYIA 3TP5A 4JI0L 4K6LA 4UY8C 2B3AA 1SN8A 2BF8B 1MSGA 2JE6I 3SK6A 3VR2A 4DR1L 3ER0A 2WWZA 5DLQE 4XQQA 4BKSA 5J2RA 2MCNB 1XNQL 1TZ1A 2BWES 3WAOA 1NTGA 3RFZB 2CH4W 1BR9A 1JOKA 3CCSA 4JGHB 2NPTB 1JRUA 2W55A 1FNWA 5T1IA 1MHXA 4NPNA 1VQIA 3V3XA 1E9MA 3OMCA 4FXCA 2DZKA 5FR6A 1SROA 2CQAA 3L0OA 3PF5A 1WE7A 2QW7A 1YNTE 2DJFC 2OJWA 3GO5A 2NCNA 3MC8A 1MD2D 2D07B 2XWBB 3I8ZA 1Q0WB 2K01A 1WM2A 1QWYA 3OPOA 2EYFA 3EQLC 4A3GB 2R93B 2Q8TA 4FJZA 4LNIA 4DV5L 3OW2A 1JMCA 4TRDA 2QIEB 4BY1H 2ENBA 1GHKA 2QCZA 2ZCBA 2LGDA 5K5PA 3FKIH 2KQ7A 4RAUC 3A56A 1GUGA 3RZOH 3CCJA 2EQSA 1JALA 3Q8CA 2JYOA 1SJED 4O1NA 4I6NB 2ZPYA 1F9PA 2G5DA 4X57B 3FHWA 3E0EA 1S5ED 5JEAJ 3RLOA 5MPOA 3NHHA 2IGGA 1TQOA 2F0FA 2KTRA 3I70A 2IDYA 4XGAB 4YTPB 3RNFC 3U7ZA 1AYFA 2KEDA 1WJ6A 4AUQC 1N5WA 2XEWA 5BR8Q 1KRSA 3QWNA 3T1HQ 2UUCL 1TTNA 1YIWA 1UUPA 4S3SA 3UQAA 3CQZB 4PV1C 3HG9A 3I5JC 1JT8A 1DJRD 1OXUA 3PHWB 4GOPC 1JB7A 3GTGB 1D7QA 2EY5A 1CK1A 4GS3A 4R4IA 2XBBC 5EGTA 3Q0AA 2K32A 2WAQB 4DV3Q 1CJEA 1WWTA 2PTLA 4CQNA 5E6PA 1RTOA 3Q24A 1XMQL 1F9SA 2LUEA 5CORA 5ELNA 1SEBD 4YL8A 4GLXA 1C0AA 2KVMA 4XT3B 4CBVA 3U2SC 2K7VA 3GTJH 1JMLA 2FCMA 1SB3C 5JOBA 2XVSA 1ILQA 4F7XA 4DR5Q 5BYRA 2MP1A 4KJOA 4XT1B 1TS3A 2V0GA 3CCLA 4J3OD 1XNRQ 3J7YW 4LF8L 2L1AA 2DNCA 2EVBA 4KKUA 3RLFA 4X66L 1PH7A 2WXHA 3DVNV 4L23A 3AE3B 1OXTA 4WWOA 2C9OA 3R7QA 1E0BA 4MJSA 5GMVA 2V4DA 4KN4C 3KJPA 2G4DB 1Z9FA 2JA7B 4KVGB 4MSQB 3UIPB 2DX5B 5JPNC 1WX9A 2D0OA 3V96A 3VUXA 5GAGC 5IP9G 2WXPA 1L2NA 5HI1A 3QQ8B 3OIPA 3NBHB 1SLJA 2UYZB 2A6HC 4HMJA 5KYLA 1XPRA 4A8XC 2N9EB 5E1FA 4HEA1 3UGBB 3TDQA 3G4SA 1KF6B 1WGRA 4G3XB 4KI0A 2E2HB 3DBSA 1I42A 4GLVB 4XE0A 1XEEA 1QQRA 1PLFA 2HE7A 4EGVA 3RZDH 4FXGC 4JK1C 2NPTA 1STEA 2WNMA 4JI6Q 5BMHA 1EQRA 4HCNB 1BBWA 3J81E 2KX0A 3EN2A 3DM3A 2B2YC 1EL0A 2L76A 3RUIB 4PS8A 4LFCL 1FCLA 2D2CC 2KNBA 4LK1C 1QVFA 5CBAE 1T0SC 4K1RB 4OX9Q 3I4MH 1A6XA 4NPSA 1LTID 3A8JE 3CCQA 1WTRA 2A74C 1B1ZA 2C7HA 3EJIA 2F0HA 1JQYD 3FPPA 3TEYA 4IOCA 1WZ3A 4MGZE 4G57A 2XSCA 1E7ZA 2KFKA 2LXCA 1MJDA 2ASQA 2D10A 2RGFA 4DF7A 5C3EB 2RPQA 2MGSA 1MBYA 4KX6B 2PQAB 3OWFA 4DR3L 2IW3A 4IG7B 3EBEA 3CKIB 2E3TA 3E0JA 3IFTA 5E6NA 3P75A 4HJKA 2YVCA 4ZKBB 1BMLC 4WJ4A 1QT9A 1TWHB 2KBNA 3F2UA 3RULA 5DCNA 1UBIA 3H0GG 1VQ8A 2LXAA 5C4ZA 1NCVA 4X62Q 3M85A 1RRBA 1U5KA 2HD5B 2QHOA 4C3IG 1J8IA 2ZCCA 2KWUB 4QY7A 3GTMH 3ECIA 3HOZH 3V61A 3GZNI 3KVFB 1VQFA 3P4QB 2DAFA 3SD5A 3CAMA 4JC0A 2F3VA 5G2NA 2IY5B 2JSVX 2J7QB 1SNQA 3SU8X 3UDFA 4DV1Q 4NJ6A 2WXIA 1LGRA 3OTOL 2WXQA 5CHVC 4JI7Q 4IUVA 5GAEC 1BO0A 5F2DA 1WGHA 4ICUA 5EAYA 4WAAA 1HR0Q 5IY0A 5LMNW 1XD3B 3RD2A 2QJLA 2FHTA 1QOHA 2V3NA 3A1QB 3M3YH 1SR3A 3HEJA 5E7NA 1PUTA 1PH8A 4KN7C 1QZGA 1ENCA 2KXJA 1TY0A 4ZHOA 1VQ4A 3J7A5 2D62A 3FKIB 5C0XJ 4DV4Q 3C8YA 4BBNC 2KDEB 4V190 1DYQA 2BKFA 4IALA 3HFZB 5GAHC 5KGUA 1G2TA 3HOXB 4KV6A 1C4CA 5D65A 4NKLA 3J7AV 1OQQA 3L0WB 3ZDTA 1BBUA 1TKYA 4A93G 2GN5A 4DAPA 1DOIA 3J80c 1SSNA 4BAXA 1XLOA 4K8JA 5BR8L 1LTSD 2F0EA 1K0RA 2L9HA 2K33A 4PZ8A 1N36Q 2L05A 1Q46A 2KENA 2CHBD 4RM9A 2RBMA 1KAWA 1A0IA 1E6EB 1ASZA 5E3FA 4ID6A 3H3VI 1U0LA 1I94Q 2YTVA 1JB3A 1WE6A 1NYRA 3I4OA 3ERQA 5C44B 1PV4A 4DV3L 1EOTA 1BF4A 4K7SA 4MGIE 2F4VL 4IOIE 4B0MA 3K0YA 2HDEA 2NVYB 3RZFA 3TP8A 1YNJC 2QDBA 3A0JA 5JHBA 4B9WA 1GO3E 1K51A 4YWMA 4DN4M 3UE1A 2BPSA 3A4RA 1L0YB 3ABVB 3HM6X 3NVYA 5FR3A 1NE3A 3GTJB 3SFDB 4LFBL 1LACA 1OQRA 5LNK1 2FMCA 2R92H 5M5WB 1EYDA 4DV0Q 1PFMA 3SR1A 3AU5A 2N7DA 3VYTA 3RMHA 5LMNL 1E22A 2VQFL 4C1NK 2GOWA 3BG3A 3BYYB 3I3TB 4ZRIA 4C3HH 2UXDQ 2LGYA 1SSOA 3NEMA 4R8IA 1TT5B 2DNFA 2RR9A 1E5WA 5FO8B 4M0WB 2FCNA 1AZQA 5BN3A 1VQJA 1V5TA 1STYA 2TMPA 4K5XA 4ZUIA 4KHVA 2ZXOA 2KC2A 2K6AA 2CH4A 5IODA 4DK3C 3RR5A 2F03A 1JC7A 1MPEA 2MBQA 1V43A 1T3QA 2RDHA 4ZDVA 5C4JH 1EQVA 3R2IA 1LTBD 1YIJA 2VUMG 4J15A 5FLXE 1VJKA 2MBOA 2KQ3A 3HGBA 2Z9HA 4BWGB 3DWGC 4QMGA 1JWBD 1UE7A 2A6EC 3GTLB 2BKRB 3U30A 5J18A 4WWPA 4XYCA 4OGQC 2RSUA 3D0FA 3KK7A 1PH6A 1VS0A 1DXMA 1HQRD 3QO2A 3GTPH 4HSVA 1ZEQX 2YEPF 3EECA 3RZDB 2BDOA 1EEID 3FRPB 2DY7A 3QJYA 4KY5A 1PRTD 1W3SA 1YQ3B 4B3RQ 1D5XC 3ONSA 4OEMB 3T8MA 1AH9A 4KSKC 5BMGA 1RCVD 1Y1VB 1WD1A 2JEBI 1YNND 3DVNU 5LHY1 2B29A 2MWSB 5IOIA 2CWPA 1L5PA 4Q0FA 3A1QA 4KDLB 1XYIA 1T5EA 5DPSA 5AUIA 4BS9A 4LFAQ 2WGSA 3TIXA 1YBYA 4HCEA 4OVUA 3OW7A 5H92C 2VZAA 2A4ZA 2QMTA 1JCKB 1WCMH 3M4YA 1WX8A 1C4AA 1KLVA 3SEBA 3AE7B 1IBKQ 4B6WA 5M5YH 4BVUC 2JK8A 4N9PA 3D6WA 1KRHA 1P9DU 4HK2A 3WWVA 5L37A 4M01A 1EU4A 1U4AA 3WCQA 2A8VA 1R4MB 2F0PA 2B8GA 1QNKA 3H6NA 2L7RA 4IFDG 3ERSX 3NENA 1UGMA 2K75A 4X62L 2F0NA 1NEKB 3FILA 2PCFB 4CDDC 5J1ZA 4DU9A 5LL6S 4CGYB 2KCCA 3J80L 2FMMA 2JA5G 5LXIB 3PLUA 1GPXA 3IHPC 1F77A 3NHEB 2W3SA 4EZJA 1L0XB 3I4NG 2BWFA 3IG3A 3L54A 3VXWA 3H94A 5KNDA 2ZT9C 1ZPSA 1X65A 4F88A 3AE2B 1HNXQ 2RKSA 3ITPA 2IX3A 1ZW7A 4DV1L 1SIJA 2CVRA 4LUZA 4GKKL 2QDFA 4FULA 4A3MH 1SNPA 4ARCA 1MJCA 2IHEA 2JU6X 1S40A 4YCUA 2BB6A 4HRSA 5C4XH 1Y1WB 3SXHA 5DPTA 4JI7L 1PGXA 2KQSA 5GROA 1G51A 2JA8H 3EHVA 1MI2A 2WDTB 5M3MH 1HZAA 1V9PA 4JX1C 1TKWB 1SXTA 2Z1CA 2PE9A 2AUJD 2Z6KA 3NTKA 4FDBA 4GNXC 1IUEA 2YTYA 4B3ML 3VYSA 3PQIA 1FEHA 1Q82C 3UDGA 2QEXA 3OIQA 1FGUA 4DQOC 3W1GA 4C2MH 2E74C 3K6OA 3HOVH 1U4PA 4M0WA 3RNBC 3E9IA 3QARA 5ISRA 4C1NI 3MVVA 2NZOA 4CKCA 1WYGA 2IGHA 1PGAA 4GN3B 2NMQA 4WJNA 1MHHE 5I6YA 1E1OA 1WGDA 3ZJVA 1IYFA 2VW9A 1CA6A 1T0RC 3AN1A 4BBSG 3B9JA 3TSSA 3VR3A 5M3FG 4AYBG 2PYKA 2FINB 2EMSA 2MJEA 1E2ZA 3OSOA 2K8HA 1S3OA 3VRAB 5EDSA 2HDLA 5IWAQ 4LNOA 4EFOA 4E6IA 4ASWC 5AZGA 2JA6B 1GUOA 3U58A 2F0MA 2JQOA 2L15A 4JOIA 4A6QA 5C6AA 4A3EH 5IN7A 4P73A 4OXPA 2SOBA 2CQOA 2B76B 2B2WC 1QKZA 3PV0A 4KLKA 1F0ZA 2F52A 1P7EA 1HCZA 2J0JA 4PS7A 4YXDB 2FUHB 4H44C 1I4PA 2W82A 3LDZE 4QJFA 1H4RA 1WH3A 2HTME 3DQVA 3OJ4B 3I7FA 1GUWA 2IY0B 2J0KA 2M17A 3JSVB 5GADC 4F87A 2N9LA 4KHPL 3DM1A 3T51B 2G9DA 4EUTA 1RD9D 1V1OA 1PTOH 1EWHA 2R92B 4NXMQ 2B63G 2Q8RE 4B3TQ 5IGEA 3S1QH 1L7YA 1MI0A 2GRIA 2RPVA 4IUPA 3IAYA 2PQEA 2NWGA 4P74A 1EF1A 1SYDA 2L52A 2N49A 2E2JB 5FLMH 4K0KL 2NZHA 3HOZG 2QGQA 1ICFB 2F0QA 3F8TA 1JJ2A 3P4SB 3MFGA 3WAPA 4RM8A 3G6EA 3QWZB 2RSNA 2MBEA 2PZTA 4C56C 2V9HA 1B8AA 3TEXA 3BVZA 4RHSA 4BBRB 1VQ9A 1OTRB 1V80A 3SK5A 2EYMA 2H1EA 1U4LA 1QOBA 2JSOA 1L1OB 2PJHA 2AEHA 2I1KA 3AMZA 4L2YA 5EE3A 2KLCA 2B3GA 4H7BA 3NVZA 4FADA 3NQTA 1ZUD2 2A68D 1KNAA 1TGZB 1K8RB 3NUHB 4DR2Q 4IUNA 5HFYA 2F1MA 3L9AX 3HOWB 4X6AH 3AE9B 2VXWA 4RNAA 2B2TC 2I5LX 2X6LA 1JROA 4J1MA 2GI9A 1SYEA 1KAAA 3GTPB 5LMUL 1V9JA 2MRPA 1JOQA 2R7ZG 2KANA 2VNUD 2A5UA 1VZ8A 3MXNB 4KY6A 1SMYC 1X54A 4FF2A 4HR7B 1SGHA 2R93H 4A3GH 3NVVA 1BOSA 1II3A 2RF4A 3FVQA 3OMGA 4LNFA 4XYOA 1D1IA 4B3RL 1KOTA 5FK9C 3PF4A 1Q1BA 4KKTA 2MNAA 1K8OA 5FJ8G 2AMCB 3V60A 4ULLA 2K03A 2P5ZX 4RH6A 1WMHB 1V97A 4PT5A 4DR7Q 1CKMA 4M8AA 1SIFA 3TEHB 3ZJYC 4AQYL 2X8XX 2NYZD 3DHGC 1UE5A 4TKNA 1X3QA 2OOBB 1NJIC 3M63B 3SK8A 2O6VD 1HZ6A 4YWLA 1WFYA 3I4LA 1TWCH 5K36G 1ZGUB 2E2IB 3HOYB 2GBRA 3IXSA 3N1ZC 4IW0A 1IP9A 1WX7A 3R8BA 3AULA 1RTNA 4H13C 3CQZH 1VQHA 4R4QA 3Q3OC 3H7PB 2WDRB 1LT5D 2WKDA 3MJWA 1BCPF 4OO1G 2KVRA 2AKWB 1A3VA 5CGKA 5JPMC 3U4EG 1E1TA 1WI0A 1O78A 4JI8L 1IBLQ 4NAWB 3ALBA 1UWVA 2WXGA 4DK1A 3NUCA 4DUYL 4OO1I 5G3LF 2ES2A 2NBWB 2BB5A 1EY7A 2V3PA 3L16A 3TJPA 2PVOD 5IYCH 3KBXA 1T5XD 5EE9A 3U9SA 2IPKD 4Z9CB 1QNUA 2Y5CA 2JZPA 2IZVB 3NS8A 3CSTA 3HKZG 4K3BA 3MAQA 1DZ1A 1ZE3D 4N8FA 4J8QA 1WR1A 3PV1A 5EKKA 2PW9A 4A3CH 2RSOA 2EYLA 1CFMA 3MXUA 3HK0A 1HA5A 2DGYA 3HHMA 4USAA 2XK5B 3AV8A 4JG2A 1LT4D 3H8HA 1WTXA 1WTHA 3JSVA 2IGDA 1G6PA 2NZ1D 3BYTB 1PTOF 1IGDA 3UDXA 4EQNA 5C3WA 4JI1Q 3H91A 4H0LC 4UPAA 2JA7H 1K8MA 1KHIA 3S24A 4A3IB 3S2DB 3PCOB 4MSMB 5M3MB 1YJ1A 4XIGS 4Q5VA 3PMFA 4YWGG 1GG3A 3DDCB 1XTCD 1YHBA 5TSSA 1EO6A 3ZYYX 1VR9A 4ZAIA 1WOCA 1A62A 2ZM6Q 2KTRB 1QILA 2M00A 3AFQA 3S1MB 3CCRA 1IBML 3ZGZA 1ZXIA 2PIAA 3GTKB 3C1FA 4UHVA 4XYQA 1X9NA 2DLBA 1D8LA 1KC8C 3S1NB 4OZAA 3WIMA 1I6VC 1OFFA 3M3JA 1R4QB 1S5FD 1U4RA 1PH2A 2BVCA 4KHZA 5C23A 5G5HA 1L1OA 2FXQA 4DNTB 1U9RA 4JYAL 1C9OA 3GDEA 2UUBL 4KGTA 4IO9A 1N34L 1HEZE 2UXCL 1PRTB 5EE1A 1CZWA 1Z2MA 5IT9c 2WXNA 2B2VC 3ZKJC 2LEKA 4I6PA 3BK1A 3MEHA 4IPDA 1BKBA 1C77A 4RGOS 4IDIA 4P16A 3CRKC 2XGTA 5BN4A 1HNWQ 3MWYW 3MXNA 4IQZA 4A3EB 3EUB2 3OJ3A 4N9TA 1QZHA 1N9WA 1VDVA 2EXZA 2I5HA 3A55A 1FM0D 4A3BB 2CW0C 2EOTA 2Q2UA 2WXKA 3PS6A 4NDXA 1SE9A 1Q10A 5C3EH 2AL6A 1KRTA 3ZTCA 1NY4A 1WMHA 4I6LB 2DZMA 4LDTD 3TS0A 1V6EA 2OT2A 2KUMA 3W1BA 4LMQD 1WJ4A 1HZ5A 4OWXB 2BT6A 1P7FA 2NBUA 4FN2A 3S17B 1P8LA 2BYEA 1TWHH 1IYUA 3J9CA 2EYPA 3BWUD 2DHZA 3H1UA 4AQ7A 3CCMA 4Y7NB 3JAMc 3MA2B 1LT6D 3H7PA 3Q8FA 1LABA 1SDFA 3ZRCA 3DXJC 1SAPA 2DY8A 4LNQA 3I3CA 1B4OA 3HS0C 4WJQA 1YQBA 4NAWA 5BYSA 2FFKB 4XC2A 4XWTA 1ZXTA 2ICEC 1H9RA 2MBBB 2EYJA 4LF5Q 1H9JA 2WP8J 2K25A 1A8VA 4GKJL 4A3MG 3G7LA 2R6GA 4RCNA 4HAEA 5C4XG 3K5MA 2I2YA 2WXJA 1D3ZA 3MTNB 4DR2L 5ELOA 3DVGX 2RDFA 3MC9A 1V49A 2KEEA 1ONLA 5EPLA 1VQ6A 3RNUA 2OJRA 2XK5A 4B95A 1WSPA 2ZJDA 5C1ZA 4DNRB 3K58A 1ET6A 4NZLB 1TS4A 4JI4Q 1YQ4B 2WFWA 1BUVT 2KFKB 1FMAD 4HCPB 2VL6A 4NB3A 2CHZA 3STBC 3S2AA 1DGSA 4LWCA 4HDQA 2HIVA 2EXDA 3D32A 2JQRB 2Y0SG 3URYA 1D5ZC 4IFDJ 2UU9L 2BA1A 3CMMB 4S0RA 1H8CA 3HOXH 4DR7L 2K22A 3K81C 3PO3G 4KK7A 5IYDG 1WXAA 3OAWA 4FVMA 4IWQA 4KZCA 2HHHQ 3TS2A 3NK9A 5CC4A 4CKEA 3VTWA 2KCMA 2HQEA 1DONA 2ZJQA 1L4ZB 1YN5A 3AE1B 1TWCB 3KBGA 1PDXA 4II2B 3VDYA 1YI2A 4DR6Q 1BT0A 4C3JG 3AI5A 5E4WC 4LAAA 3PPAA 4JWUC 1A3TA 1HTLD 2K4KA 3AEVA 4YIJA 1QOGA 5C44H 2BS3B 2C60A 2ID0A 3W5VB 2Z8LA 4O42A 2LFIA 2NVYH 1L2FA 2ZPNA 4RMAA 5CR3A 1T0QC 4LUOA 2MHVA 1KH0A 1LQBA 1I3QB 2UUAQ 4NW2A 4DK5A 4ODGA 4P72A 2AQ1B 3J80i 3EVQA 3T1YQ 4DUZQ 3X3NA 5CV8A 5M5WH 1CZGA 5KHQA 3AE6B 3D3RA 3A5ZB 1CI3M 2K5DA 2JJQA 4XZ4A 5C5MA 3ZXRA 2EJFC 5AZFA 4IUTA 3HVDA 1C9FA 1ENAA 5C5LA 4A20A 3KOJA 5D2MB 4P71A 5FO9B 5DEHA 2PMZE 3NP8A 2B2UA 5ELFA 2JT4B 3H0GB 5JEAH 4MGYE 1T9HA 2Q5WD 2OTLA 2SAKA 2WXFA 3GZNB 4C3IB 1HZBA 4L5QA 1C3TA 1AEXA 2W9NA 3SDLC 2F0TA 3P1MA 2IX0A 2JXXA 3A9JB 3AE8B 1KDAA 1HH2P 4ANVA 3BK2A 5C2TB 1EIFA 1AW7A 1HFNA 3CP0A 2MBHA 4KDIC 3S15B 3GTLH 3T13A 3BDCA 4YHHQ 2HUGA 3TBLD 4AJWA 1LTTD 1FJGQ 2IO1B 4A90A 3ZJUA 1EIGA 3JAML 4JV5L 2QSDA 1R9TH 1VF5C 3SHLA 1X56A 1IPGA 1CMXB 4MNOA 4EQPA 3BY4B 2KJ6A 4A3DG 4A3GG 4ZQ3A 1GUSA 3PO2G 3RN9C 1TWAB 5A2QL 2MPMA 3LNNA 4DR4Q 2BS2B 2KJHB 5IYBH 5IGCA 4JI3L 3OYYA 2KHIA 1I4XA 4H2AA 3AQQA 4L1BA 2DN8A 2ICIA 5DNFA 2LGIA 1EY4A 1Y1VH 3T16A 2MP2B 3AH7A 4DDID 2RQXA 3DLLA 1STBA 4QUCA 2L83A 4UP9A 3V6CB 4XWWA 4ZHPA 1V5OA 5IKCM 1G91A 3UF8A 3LWUA 1GD7A 1VQEA 5IGDA 5IGBA 1B70B 1LO5D 4A3JG 3NPPA 1UNSA 2JY6A 4A3LG 2O6VB 4G11A 3ZVVA 1FXTB 3DWQA 1WM3A 4II3B 4NJ7A 1S4ZA 1XCQL 1ACCA 2NVXB 3PSEB 4DXGA 4CJ1B 1UWXA 3W1SC 2WAQG 1Q1OA 1W6JA 2TSSA 3X3MA 3ZIMA 4G50A 2CWAA 1VQPA 4U673 1KIXA 4FJVB 4G7ZC 1DOKA 2KZRA 3WANA 1E2VA 4A3FG 4I7ZC 2KN4A 2KK8A 1TJEA 3TEZA 3N3KB 5EE0A 2CU1A 1AE3A 1NVID 1WZ0A 2L0FA 2L0CA 3DPDA 3ZLZA 3AEDB 2PVGC 1VQBA 1D2BA 2KWDA 1VZ6A 5IP7G 3VQIA 2D5GA 5DM73 3N9YC 3NVWA 1LUZA 1KDBA 3S1RB 4BY7G 4E3CA 2C7MB 1VQ7A 3IFDA 3RI7C 3H6MA 2JWZA 1EOVA 1MSHA 1QJOA 1RF2D 1C79A 1LLRD 3UDIA 4TQ1A 3F2DA 1Y1WH 2L0TA 3PRZA 1I5FA 3QOJA 4XX5A 4B9XA 2DAJA 1IXRA 1TS2A 3EFXD 4DPGA 1S3SG 3GD7A 1DOMA 3K9PB 2R61A 1AE2A 4WFN3 3I2ZA 2JPHA 4RKLA 3PIP3 2NTTA 3CSFA 4GDLB 5D7GA 2JXMB 5CV9A 4RF1A 3GB1A 2LSSA 4EE2A 1D4BA 2G9HD 1PH1A 1VRAB 2N9PC 1ESFA 4E74A 4W9GA 2O5JC 3K5LA 1RKNA 1QVCA 3CRLC 2GBNA 4F1SA 1EZ8A 3E6ZX 2VUMB 4ZUJA 1YZ6A 4DV6Q 2LZ6A 3MEFA 3TP7A 4MGKE 4DAVA 2KFJA 2RCFA 3WALA 4ANXA 2ZZPB 5ELDA 3A9JA 2MJ3A 3PO0A 3MXGA 2L1BA 1BXTA 1FR3A 2ZJRA 2K04A 3SK4A 1V8QA 1MFWA 3AU7A 2KLGA 2VQEQ 4EX5A 3AM9A 3J81c 3R7RA 3JC66 2L4NA 1GAQB 4YTMB 3MHBA 3QR8A 2F4IA 3T1HL 1N32Q 1DOYA 2OCEA 5J22A 4YSZB 2M8SA 2JA6H 4JPBW 1V2YA 3VA5A 3FILB 1NENB 3IBEA 1I35A 4LF9Q 2BCOA 2ATWA 1SE3A 2EJGC 5M5XB 2JUOA 4LJPB 3KLRA 1PH9A 2A69C 2NN6H 3ULPA 4E71A 3A74A 2ALYB 4F8MA 4YCVA 3L4PA 4WIPA 2G4SA 2NVTB 3N32A 2MP2A 1D5MC 3AECB 1VQ5A 1SNCA 2HT1A 1CTMA 2VY3A 1HNZQ 1GC6A 2DNEA 1VQGA 1MG4A 4FO2A 4LDTB 2K05A 4DR5L 4ZOHC 4GN4B 1YN4A 5EJWA 2SNMA 2LGXA 1XLQA 1ASYA 3W2DA 1XNRL 1E8ZA 3ZNHB 2O6VA 2DYBA 1KD1C 2E2JH 3VTVA 3VUWA 4OL7A 3JYUA 5C0XH 1TVXA 2KOLA 3PZDA 2XNAC 1PZJD 5L83A 1PYBA 1TY2A 3TMEA 2WU5B 4EOYA 2CKHB 3VVWB 2W54A 3VDZA 1Q3LA 1XMOQ 5IE8A 3F2BA 2GBJA 4YTNB 3OLMD 2ZNVC 4BBRH 2AQ2B 2K52A 2EIFA
chains in the Genus database with same CATH topology
1RODA 1FCCC 4ZRPA 4R8NA 2A6ED 3MZ5A 3I4NB 4RF0A 1MVKA 1LV9A 3Q69A 1LTGD 5KEEA 3T53B 3TZDA 3L3OC 1R9TB 1STGA 4KY7A 1ILPA 1FD7D 2KA7A 3WDNA 3GTOB 1HFGA 2VB2X 1KNEA 3LB8C 2SDFA 2GA4B 2KECA 3NTIA 1WTWA 1PXUA 1WXQA 2O5IC 2N55A 4KKIA 4RFBA 2J7ZA 3A8IE 1HUNA 1LTAD 1RYJA 4ITKA 4IUUA 1GXDC 5HGTA 1DCZA 1RWSA 1EY9A 1O7LA 2PZUA 3BIID 1H9KA 3I57A 1M8AA 3U9OA 4K5VA 2ON8A 2QKIC 4MACA 1SF0A 1I4QA 2BE5C 5BMIA 1U4MA 4B0EA 2NVQB 1H9SA 4BBSB 5M3FB 2EELA 1BCPC 3M4OB 1IL8A 1Z7TA 4ARIA 1K52A 1YJJA 5ELCA 4MH8A 1BNZA 4LTUA 4MT5A 1L6UA 1LTRD 1N61A 3BVMA 5EKLA 1NI3A 1PFDA 4R9WA 4IFDI 2DYMA 3E56A 3AMUA 3WOEA 1FFUA 2OXPA 3D4WA 2C5CA 2J42A 4OHJA 4A9AA 2HCIA 2BTEA 1IKLA 2LKVA 1PTOC 2WINB 1HPCA 3T4AC 2B63B 2M19A 2PO4A 1TU2B 2DBYA 1GHJA 3MP9A 1EWYC 5EPJA 5IGFA 1FNUA 4A3KB 1W6KA 4WH4A 1QLBB 1FD6A 2J53A 2PMZB 2WU2B 1WD0A 2LFNA 3HOUB 5J39A 2SEBD 3DWPA 4G4KA 4US8A 1ZYRC 1EU3A 5T1GA 3S14B 3I9V1 1EYAA 2F0OA 4DK0A 4KGSA 3HZXA 1QOAA 1DGJA 3K5OA 3M7GA 5EQ0A 1OO9B 2Z4IA 1RFKA 4TKOB 1EYCA 1I50B 1C4PA 3Q8AA 3VR5A 4JBWA 3GV6A 2PW7A 4X3UA 3VR4A 1SYGA 4HTHA 5JXVA 3ND9A 4X3KA 2WLBA 2AWOA 4P6VF 1CT1D 2WXOA 4JE3B 3TUOA 1F2LA 2BBCA 2O4XA 1HRJA 1NR4A 4DXFA 3EROA 3MXPA 3VR9B 3A7LA 1QOFA 1IW7C 3P4PB 4CKBA 3K59A 2ZXRA 3E9SA 2KDMA 1F2MA 3CIRB 2G1EA 3HRDD 1F2RC 4A55A 2E2DC 3Q8BA 1EIHA 1O80A 3W5UB 5IGGA 1V1PB 4IKGA 1JE4A 1GUTA 3AEGB 1EY0A 3VYRA 1JWMD 3PUZA 1NYQA 4KD3A 5NUCA 1MGSA 1SMYD 3C2PA 2EY1A 3UI2A 1X3PA 2WIIB 1KTKA 1QB5D 4XDDA 5A35A 2QCPX 2L55A 3NTHA 3D4RA 3TP6A 4X3TA 1OXSC 1EZ6A 4CHTB 4RCOA 1SE2A 1VMPA 3S2HB 4OIJA 3DHQA 1AZPA 4MM3B 3CWIA 4GLSC 1SE4A 1A70A 1GUNA 3QOLA 3S16B 1SFOB 3P1HA 4PMBA 1RM6C 2WXMA 5LL6X 1IYVA 1PRTF 2NN6G 2B2YA 3KLSX 4DA2A 4PNYA 2FUG1 2E75C 1X32A 1PDQA 3NS1A 2EZVA 3EGRA 2YU9B 3J7AF 4DAYA 1N62A 5ELEA 1C4QA 4U68A 4KJNA 4C3HG 1JOOA 1VF7A 1ZKOA 5IOCA 3AB9A 4B08A 1SBBB 2V4IB 1HHVA 1I4RA 1PMRA 1CZPA 4L63B 3JAME 5E4XA 2PPBC 1ZDXA 1ENFA 1UAPA 5A2QE 2NBFA 3VA7A 3DWMA 5E6JA 1YMHE 4D2KA 2M2LA 4PMWA 1UGJA 2EPBA 4ZRQA 3TBIB 4RHRA 2J0TD 3AEBB 1V1PA 2K1BA 1K53A 1Z6HA 1NUCA 1VMCA 5D14A 2RDGA 1G291 2K5PA 2R3ZA 3I91A 4HKQA 1JICA 2F0KA 3CHBD 2CW0D 1B44D 2F0LA 3WOFA 2XRQD 2WDVB 4QIWB 2PNRC 2BW2A 1C76A 1EWCA 4GZYC 2MJDA 4PQXA 1TWFB 3PO3B 4WURA 2LY7A 5D3IB 4LJZC 3HP3A 2Y5PA 3AB5A 4QUFA 5D3DA 2EYOA 1TKEA 1F2ZA 1B9NA 2F0UA 3K5NA 5COYA 1PFBA 1G6ZA 3H09A 1PZKD 1XX8A 4XXEA 1EM7A 5G5GA 3R93A 1JWAD 4N6EB 3SR6A 1QCBD 1H9MA 1T6BX 2X38A 4CJ0B 3G6JB 4ME5A 4I65A 1ESRA 1CM9A 1B53A 2INPE 1GB1A 4FXKC 3SDZA 1YN3A 2I38A 1I4GA 1E7PB 3CU7A 1I6HB 1EY5A 4IN3A 2LMCB 4NJCA 3I73A 3MFYA 1TS5A 2M0AA 1C78A 1Q8IA 2EJMA 3FEWX 4FXDA 1KLGD 4A3DB 2QILA 1IHZA 3KWLA 3K7AB 3PO2B 4K8IA 1ET9A 1XO3A 1B50A 1TIID 1OXXK 1KLUD 3ONAB 1E0ZA 3HUIA 2F0DA 1VZ7A 1Y69U 3BZDB 3DMUA 2LHEA 3LX0A 4K14A 1EY6A 2K9XA 3DEOA 5IT9L 5EKIA 4A3JB 3NXWA 4HKZE 3T3NA 4N59A 5H8YE 3Q8EA 4FNFA 4BA2I 2PMVA 1Z47A 4HSPA 5C3JB 1Y8PB 1PZID 4IFDH 1TKGA 2K0PA 4RGTA 4K5WA 1ZP0B 1CHQD 4A3FB 2A6HD 4FYDA 3ZQ4A 2B8FA 4KKJA 3SFEB 4ZRZA 4X3SA 2FBWB 1ZOYB 3I72A 1UWMA 1GOZA 1TWGB 4WRDA 4BY7B 4RKBA 2MEKA 4OW0A 1SJHD 1E2WA 1FXAA 4ZKCB 1HA6A 1FGBD 4IUQA 5JJZA 3FMCA 4XQJA 4HCSA 3GTQB 5AFWA 1IBXB 1D1KA 2A5HA 3IT4B 1S5BD 3LWEA 2IX1A 3P42A 4ILWA 5FKAC 3NSWA 3FC4A 2VB3X 4XQNA 1JW9D 2LJIA 3C1EA 3K57A 4UAIA 4IZ8A 4A93B 3J80E 1JWSD 3PUYA 2L12A 1CQVA 2LMCA 2JYEA 3W3AA 3S9WA 1CA5A 3R2TA 3GP7A 2MUYA 4QF4A 1K50A 2F0WA 1L0VB 1PGBA 5I9OA 1F2RI 4KD4A 2B2WA 3RUZA 4V0BA 3SVMA 2E76C 5KNCA 1B3AA 2XRSD 4C7ZA 4WORA 2NUCA 3DUZA 1VCIA 5BYQA 2LUMA 3UI3A 5EPKA 2EKIA 1BUIC 2JX5A 5KRUA 1CHPD 3U52E 4YT0B 2K28A 1STNA 4G7HC 2IL8A 2BS4B 2AWNA 1DD2A 1WVLA 4RGMA 1JQ4A 2DYOA 1ZXHA 3NE5B 1H9SB 4FF1A 4DFAA 5CMDA 1SNOA 3P63A 3A8KE 4P2CB 1FRRA 4REZA 3KLSA 5JVG3 1Q12A 3MHZA 1HUMA 3Q22A 2B2TA 4K6DA 4TQUS 3I90A 5I9PA 4BY1B 1Q1EA 2A69D 2AX5A 1IKMA 1FIQA 2DWQA 3RZOB 2JYTA 1YNJD 1TZOA 2IJ0A 3PUWA 2LHDA 4XDCA 3NBHA 2X6GA 5GXGB 1G8ZD 2VZKD 2IT1A 4HEDA 1QE6A 2NB0A 1IBXA 3N52A 2ONQA 3VYUA 5C4HA 5K36H 3PZ8A 3P7JA 1I4HA 4G7OC 2KQ4X 5EBCA 2WKCA 4KKSA 5I2XA 4OO1H 3EA6A 1B9MA 2WXRA 4IURA 2WS3B 1K83B 2RMMA 3Q23A 2WV6D 4ZYSA 1BQQT 1QG7A 1FFVA 4K2KA 5I6WA 3VR6A 2J52A 1ROEA 2K5QA 2J4XA 1FNVA 2WB1B 4HN7A 1E10A 3BDOA 4KGRA 4OVZA 2OHFA 3MC0B 1N63A 3VRBB 1I7HA 2I46A 3AE4B 1O7ZA 3HVZA 3MTSA 2OEDA 1FYCA 2BE5D 2N7JA 5CYUA 3P20A 3IAS1 1BCPD 1ICWA 1JORA 3PUVA 1S5CD 3KQ4A 4MN3A 4AYBB 5G3LD 2ZW0A 2D9UA 3IL8A 1PRTC 1EY8A 3QB3A 2M56B 3I4MB 2B2VA 2HCCA 1XLPA 5ELBA 2INNE 2AQ3B 1A2TA 1FO4A 1YNNC 1OXVA 1VLBA 4HROA 1HQMC 3OHXC 3J81L 4TMAB 1TR5A 2EY2A 2LS01 1AWDA 3AE5B 3TZUA 2RVLA 2L11A 2X69A 2BYTA 1PTOD 2B2UC 3BDLA 2I07B 4JWSC 2KAJA 2MJ8A 1Q90A 1Y8NB 5I4DA 1PFNA 3V05A 5JEAG 4JPSA 5JVH3 3NZ3A 3AEFB 5DM63 1KDCA 3GTMB 4YSYB 3HOZB 1B2TA 1C48A 3T3OA 1S5DD 1Y8OB 2ZXPA 2Y3AA 4YSXB 2PW5A 3FPUB 5CV5A 1ZYRD 2FJ2A 2XWJB 2FE8A 2JEAI 4NMZA 2YEPB 2BA0A 1BDOA 2B39A 1A2UA 2KACA 1ML0D 3TN2A 3ZJTA 3OOCA 5JAVA 3QG1A 5AUKA 3HRZC 2R7ZB 4WQMA 3M3YB 4ZLTF 1YJIA 2CJNA 2H4OA 1DOXA 3RD4A 1UEAB 2KJXA 2WDQB 1Y56A 2L32A 1HTPA 4TSSA 2OF1A 1G2SA 4RGNA 1EFID 1KABA 3D8GA 2KMMA 3DWAA 4UDUC 4MIUA 1AP0A 2D5DA 1EEFD 5FO7B 1JRPA 2H88B 2XIWA 4LK0M 5C3XA 4ZK9B 5DAUA 4FF3A 4M1UB 3L7ZC 1L4DB 1IW7D 2EYHA 1L6VA 2QF7A 2KHSA 2JP1A 3O13A 3NBIA 3KWVA 3MJ5A 4XTCS 2OEOA 3A54A 1HXYD 1XWEA 3B2FA 3PIO3 1V8CA 1A15A 2F0VA 2YYZA 3T56B 5T8IA 3HKZB 5EBDA 4K2LA 3B2GA 3M7NA 3BVGA 1M4VA 2K3UA 4C80A 3IT6B 4TQ0A 3BS1A 4C3HB 1KFYB 2CU3A 1NR2A 4NP5A 2EDGA 2F0GA 3D4DA 3ETRA 4Q2JA 3IAM1 5C4JB 3KF8A 1J7CA 1R4PB 1A3UA 4L8JA 2MH7A 3QIAA 3C3LA 1C8CA 2O2LD 4L6TB 2PKOA 2A68C 3TEWA 1F2YA 1GB4A 2WQYB 1FRDA 1PYWD 1WGKA 1LT3D 2BDNA 1JWUD 3NQIA 2K5WA 3Q6SA 3V2TA 2JXTA 3LXFA 5FLXL 2PLPA 5IT9E 3VR8B 4FP5D 3RPFC 4LLGM 2QEJC 1N60A 4MHEA 5KNBA 1IGCA 2EE1A 2F0JA 2NN6I 3AEAB 4OZBA 2N0SB 3N6RA 2Z4HA 3OWEB 1XF5L 3FDTA 4WJWA 1WCMB 2VZKB 1DOLA 4C7YA 1J9OA 1RDPD 1WTQA 5M5YB 4XDXA 3D6CA 1J7AA 2ZW1A 3NRZA 1WRIA 2WACA 2N9KA 1J7BA 1RJTA 3FAHA 5C0XG 2WXLA 3H3VC 1VDZA 3GS2A 5C0XI 1F9QA 3W1SA 2HDMA 2ACZB 4DGZA 1F9RA 2NTSA 4CJ2C 1R7SA 3E5SA 4HMIA 5CV6A 1SNMA 3AEEB 3PZ7A 2F0SA 3DEPA 3C46A 5CV4A 4RA8A 1SYCA 3GQBA 4A3MB 5IIFA 1STHA 2PZWA 5C4XB 4QCLA 4RWSC 1GJXA 4PMCA 2KCNA 3NWSA 2JA8B 4ABNA 1JR0D 1BBXC 5HG2A 4WWMA 2SNSA 2H89B 5FOBB 4GDKB 5I2YA 1XCTL 4C2MB 3HOVB 1SYBA 5M9OA 2F3WA 3ND8A 1SNDA 3NWTA 1N5XA 1TT2A 4OZCA 2A73B 1O7YA 2Y0SB 1XLNA 2F0IA 2AUKA 5BN5A 3PUXA 1AN8A 1CQFA 1BCPB 4KMUC 3A7AB 4N58A 4R3DA 2EY6A 5HURA 4EVOA 2BOSA 2N88A 4EQOA 3LYYA 2E6XA 1RHPA 3IKJA 1B9RA 4QB4A 1WTOA 1ZDVA 3P4RB 2RA4A 4C3JB 1EQTA 3W9CB 1NSNS 5HHDG 4WAFA 5KIXA 3D31A 4NAMA 2L5TA 1SYFA 2JWUA 1NAPA 5CV7A 2IWHA 4AS1A 2GB1A 1TYGB 4OIKA 1WTPA 4FF4A 1PTOB 1D6EC 3KUPA 3S1QB 3GV3A 5CBEE 3SE0A 2M9VA 1WTVA 2W3RA 4US9A 1QF6A 3R3OA 2Q8IB 4J6HA 4KTAA 1AFPA 1DM0B 1FXIA 1STAA 2XN9C 1XXGA 4BA1I 2CJOA 5KYIA 3TP5A 4K6LA 1MSGA 2JE6I 3SK6A 3VR2A 4XQQA 3RFZB 1BR9A 1JOKA 2W55A 1FNWA 5T1IA 1MHXA 3V3XA 1E9MA 3OMCA 4FXCA 2CQAA 1YNTE 3GO5A 1MD2D 2XWBB 3I8ZA 2K01A 1QWYA 3OPOA 2EYFA 3EQLC 4A3GB 2R93B 2Q8TA 4TRDA 2QIEB 1GHKA 2ENBA 5K5PA 4RAUC 3A56A 1GUGA 1JALA 3Q8CA 2JYOA 1SJED 4O1NA 1F9PA 1S5ED 5JEAJ 5MPOA 3NHHA 2IGGA 1TQOA 2F0FA 3U7ZA 3I70A 2IDYA 4YTPB 1AYFA 2KEDA 1N5WA 3QWNA 1UUPA 4S3SA 3CQZB 4PV1C 3HG9A 1DJRD 1OXUA 3GTGB 2EY5A 1CK1A 5EGTA 3Q0AA 2K32A 2WAQB 1CJEA 1WWTA 2PTLA 4CQNA 1RTOA 3Q24A 1F9SA 5CORA 1SEBD 2KVMA 4XT3B 4CBVA 3U2SC 2K7VA 1JMLA 1SB3C 5JOBA 2XVSA 1ILQA 4F7XA 5BYRA 2MP1A 4KJOA 4XT1B 1TS3A 2V0GA 4J3OD 3J7YW 2L1AA 2DNCA 2EVBA 4KKUA 3RLFA 2WXHA 4L23A 3AE3B 1OXTA 2C9OA 1E0BA 2V4DA 4KN4C 2JA7B 5JPNC 3V96A 2WXPA 5HI1A 3OIPA 2A6HC 4HMJA 5KYLA 4A8XC 5E1FA 4HEA1 3TDQA 1KF6B 4KI0A 2E2HB 4XE0A 1XEEA 1QQRA 1PLFA 4EGVA 4FXGC 4JK1C 2WNMA 1STEA 5BMHA 3J81E 2B2YC 1EL0A 1FCLA 2D2CC 4LK1C 5CBAE 1A6XA 1WTRA 1LTID 3A8JE 2A74C 1B1ZA 3EJIA 2F0HA 1JQYD 3FPPA 3TEYA 2XSCA 4G57A 4DF7A 5C3EB 2MGSA 1MBYA 4KX6B 3OWFA 2IW3A 3CKIB 2E3TA 3E0JA 3IFTA 3P75A 4ZKBB 1BMLC 1QT9A 1TWHB 3F2UA 5C4ZA 1NCVA 3M85A 4C3IG 1J8IA 3P4QB 2F3VA 2JSVX 1SNQA 2WXIA 2WXQA 4IUVA 1BO0A 5F2DA 2QJLA 2FHTA 1QOHA 2V3NA 3HEJA 1PUTA 4KN7C 1ENCA 1TY0A 4ZHOA 2D62A 3FKIB 5C0XJ 3C8YA 4V190 1DYQA 4IALA 5KGUA 1G2TA 3HOXB 4KV6A 1C4CA 5D65A 4NKLA 3J7AV 1OQQA 1TKYA 4DAPA 1DOIA 1SSNA 1XLOA 4K8JA 1LTSD 2F0EA 2L9HA 2K33A 2CHBD 2RBMA 1E6EB 5E3FA 4ID6A 1JB3A 2WP9B 1NYRA 5C44B 3ERQA 1EOTA 1BF4A 4IOIE 4B0MA 3K0YA 2HDEA 2NVYB 3TP8A 1YNJC 2QDBA 4B9WA 1K51A 4DN4M 3ABVB 1L0YB 3NVYA 5FR3A 3GTJB 3SFDB 1LACA 1OQRA 5LNK1 2FMCA 5M5WB 1EYDA 1PFMA 3SR1A 3VYTA 3RMHA 4C1NK 3BG3A 3BYYB 1SSOA 4R8IA 5FO8B 1AZQA 5BN3A 1STYA 2TMPA 4K5XA 4ZUIA 4KHVA 2ZXOA 2K6AA 5IODA 2F03A 1JC7A 1MPEA 1V43A 1T3QA 2RDHA 1EQVA 3R2IA 1LTBD 5FLXE 1VJKA 3DWGC 2KQ3A 3HGBA 4BWGB 4QMGA 1JWBD 2A6EC 3GTLB 4OGQC 3KK7A 1DXMA 1HQRD 3QO2A 4HSVA 1ZEQX 2YEPF 3RZDB 2BDOA 1EEID 2DY7A 3FRPB 3QJYA 4KY5A 1PRTD 1YQ3B 1D5XC 5BMGA 1RCVD 1Y1VB 1WD1A 2JEBI 1YNND 5LHY1 1L5PA 4Q0FA 1XYIA 1T5EA 5AUIA 4BS9A 4HCEA 5H92C 3OW7A 2QMTA 1JCKB 3M4YA 1C4AA 3SEBA 3AE7B 4N9PA 3D6WA 1KRHA 1EU4A 3WCQA 2F0PA 2B8GA 1QNKA 4IFDG 2F0NA 1NEKB 3FILA 2PCFB 5J1ZA 4DU9A 5LL6S 4CGYB 2KCCA 3J80L 2FMMA 1GPXA 1F77A 2W3SA 1L0XB 3H94A 5KNDA 2ZT9C 1ZPSA 4F88A 3AE2B 2RKSA 3ITPA 2IX3A 1SIJA 2CVRA 1SNPA 4ARCA 2JU6X 2BB6A 4HRSA 1Y1WB 3SXHA 1PGXA 1MI2A 4JX1C 1TKWB 1SXTA 2Z1CA 2AUJD 3NTKA 1IUEA 3VYSA 1FEHA 3OIQA 4DQOC 2E74C 3K6OA 1U4PA 4M0WA 5ISRA 4C1NI 3MVVA 4CKCA 1WYGA 2IGHA 1PGAA 2NMQA 1MHHE 5I6YA 3ZJVA 1CA6A 3AN1A 4HJGE 3B9JA 3TSSA 3VR3A 2MJEA 3VRAB 2PYKA 2FINB 1E2ZA 3OSOA 2HDLA 4E6IA 2JA6B 1GUOA 2F0MA 4A6QA 5C6AA 2SOBA 2B76B 2B2WC 1QKZA 3PV0A 1F0ZA 1P7EA 1HCZA 4YXDB 4H44C 1I4PA 2W82A 2HTME 1GUWA 4F87A 2N9LA 3DM1A 3T51B 2G9DA 1RD9D 1V1OA 1PTOH 1EWHA 2R92B 2Q8RE 2GRIA 5IGEA 1MI0A 2RPVA 4IUPA 3IAYA 2PQEA 2NWGA 1SYDA 2L52A 2E2JB 2F0QA 3P4SB 3MFGA 2RSNA 2PZTA 4C56C 3TEXA 3BVZA 4RHSA 4BBRB 3SK5A 2EYMA 2H1EA 1U4LA 1QOBA 2JSOA 4L2YA 3AMZA 5EE3A 4H7BA 3NVZA 3NQTA 1ZUD2 2A68D 1KNAA 3NUHB 4IUNA 5HFYA 2F1MA 3L9AX 3HOWB 3AE9B 2VXWA 4RNAA 2B2TC 2X6LA 1JROA 4J1MA 2GI9A 1SYEA 1KAAA 3GTPB 1JOQA 2VNUD 1VZ8A 4KY6A 1SMYC 4FF2A 4HR7B 3NVVA 1BOSA 1II3A 3FVQA 3OMGA 4XYOA 1D1IA 5FK9C 1Q1BA 4KKTA 1K8OA 4ULLA 2K03A 4RH6A 1V97A 4PT5A 4M8AA 2NYZD 1X3QA 3SK8A 1HZ6A 3I4LA 5K36G 2E2IB 3HOYB 3IXSA 3R8BA 1RTNA 4H13C 2WDRB 1LT5D 2WKDA 1BCPF 4OO1G 1A3VA 5CGKA 5JPMC 3U4EG 1O78A 4NAWB 2WXGA 4DK1A 3NUCA 4OO1I 5G3LF 2BB5A 1EY7A 2V3PA 2PVOD 3KBXA 1T5XD 5EE9A 3U9SA 2IPKD 4Z9CB 1QNUA 2Y5CA 2JZPA 3MAQA 1DZ1A 1ZE3D 4J8QA 5EKKA 2PW9A 2RSOA 2EYLA 1CFMA 3MXUA 4USAA 1HA5A 3AV8A 1LT4D 3H8HA 1WTXA 2IGDA 2NZ1D 3BYTB 1PTOF 1IGDA 4EQNA 5C3WA 3H91A 4H0LC 1K8MA 4A3IB 3S2DB 5M3MB 4XIGS 4Q5VA 3PMFA 4YWGG 1XTCD 5TSSA 1VR9A 3ZYYX 4ZAIA 1QILA 2M00A 3S1MB 3ZGZA 1ZXIA 2PIAA 3GTKB 3C1FA 4XYQA 2DLBA 4OZAA 3S1NB 1I6VC 1OFFA 1R4QB 1S5FD 1U4RA 4KHZA 5G5HA 4DNTB 1U9RA 4KGTA 1HEZE 1PRTB 5EE1A 1CZWA 2WXNA 2B2VC 2LEKA 3BK1A 3MEHA 1C77A 4RGOS 4IDIA 4P16A 3CRKC 5BN4A 3MWYW 3MXNA 4IQZA 4A3EB 3EUB2 4N9TA 1VDVA 2EXZA 3A55A 1FM0D 4A3BB 2CW0C 2EOTA 2WXKA 4NDXA 1Q10A 2OT2A 2KUMA 4LMQD 1HZ5A 2BT6A 1P7FA 3S17B 1IYUA 3J9CA 2EYPA 3BWUD 4AQ7A 4Y7NB 3MA2B 1LT6D 3Q8FA 1LABA 1SDFA 3DXJC 1SAPA 2DY8A 3I3CA 1B4OA 3HS0C 5BYSA 2FFKB 4XWTA 1ZXTA 2ICEC 1H9RA 2EYJA 1H9JA 2WP8J 3G7LA 2R6GA 4RCNA 4HAEA 3K5MA 2I2YA 2WXJA 2RDFA 2KEEA 1ONLA 5EPLA 1WSPA 4DNRB 3K58A 1ET6A 4NZLB 1TS4A 1YQ4B 1BUVT 1FMAD 2JQRB 3URYA 1D5ZC 4IFDJ 2BA1A 2K22A 4KK7A 4FVMA 3NK9A 5CC4A 4CKEA 3AE1B 2HQEA 1DONA 1L4ZB 1YN5A 1TWCB 3KBGA 1PDXA 4C3JG 5E4WC 4LAAA 4JWUC 1A3TA 1HTLD 1QOGA 4YIJA 2BS3B 2ID0A 3W5VB 2Z8LA 4O42A 2LFIA 5CR3A 2MHVA 1KH0A 1I3QB 4NW2A 4ODGA 2AQ1B 3EVQA 3X3NA 5CV8A 1CZGA 3AE6B 3D3RA 1CI3M 2K5DA 5C5MA 2EJFC 4IUTA 3HVDA 1C9FA 1ENAA 5C5LA 5FO9B 5DEHA 3NP8A 2B2UA 5ELFA 3H0GB 5JEAH 2Q5WD 2SAKA 2WXFA 4C3IB 1AEXA 2F0TA 3P1MA 2IX0A 3AE8B 1KDAA 3BK2A 5C2TB 1AW7A 1HFNA 3S15B 3T13A 3BDCA 2HUGA 1LTTD 4A90A 3ZJUA 1EIGA 3JAML 2QSDA 1VF5C 3SHLA 4EQPA 4ZQ3A 1GUSA 1TWAB 5A2QL 2MPMA 3LNNA 2BS2B 5IGCA 1I4XA 4H2AA 4L1BA 2DN8A 2ICIA 5DNFA 2LGIA 1EY4A 3T16A 3AH7A 2RQXA 1STBA 4QUCA 2L83A 4XWWA 4ZHPA 1G91A 3LWUA 5IGDA 5IGBA 1LO5D 1UNSA 3NPPA 3DWQA 1S4ZA 1XCQL 1ACCA 2NVXB 4DXGA 4CJ1B 1UWXA 1W6JA 2TSSA 3X3MA 4U673 4G7ZC 1DOKA 1E2VA 4I7ZC 2KN4A 1TJEA 3TEZA 5EE0A 1NVID 2L0CA 3AEDB 2PVGC 1D2BA 2KWDA 1VZ6A 3VQIA 2D5GA 5DM73 3N9YC 3NVWA 1KDBA 3S1RB 3IFDA 3H6MA 1MSHA 1QJOA 1RF2D 1C79A 1LLRD 4TQ1A 3QOJA 4B9XA 1TS2A 3EFXD 3GD7A 1DOMA 2R61A 4WFN3 4RKLA 3PIP3 2NTTA 4GDLB 5D7GA 2JXMB 5CV9A 4RF1A 3GB1A 4EE2A 1D4BA 2G9HD 1VRAB 1ESFA 2O5JC 3K5LA 1RKNA