2IJ0A

Structural basis of t cell specificity and activation by the bacterial superantigen toxic shock syndrome toxin-1
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
191
structure length
191
Chain Sequence
DNIKDLLDWYSSGSDTFTNSEVLDNSLGSMRIKNTDGSISLIIFPSPYYSPAFTKGEKVDLNTKRTKKSQHTSEGTYIHFQISGVTNTEKLPTPIELPLKVKVHGKDSPLKYWPKFDKKQLAISTLDFEIRHQLTQIHGLYRSSDKTGGYWKITMNDGSTYQSDLSKKFEYNTEKPPINIDEIKTIEAEIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of T-cell specificity and activation by the bacterial superantigen TSST-1.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Protein binding
molecule keywords Toxic shock syndrome toxin-1
total genus 47
structure length 191
sequence length 191
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2ij0A02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2ij0A01
3BYTB 4Z9CB 1B1ZA 4RFBA 2CHBD 2ICIA 1JWSD 2AQ1B 1DJRD 1CQVA 3DWAA 3GP7A 1BCPC 5TSSA 1CK1A 2J4XA 1PTOH 4C56C 1FD7D 1JQYD 1PTOF 1LTTD 3V05A 1CT1D 4RGTA 4TSSA 3OWEB 1PRTF 1BXTA 1DYQA 1D5MC 1SE2A 1JCKB 1LO5D 4BWGB 1ET6A 1UUPA 1L0XB 4RCOA 1XTCD 3CHBD 1F77A 3BZDB 3EA6A 1MD2D 1QILA 3BVMA 3URYA 1AW7A 1PTOD 1JR0D 1RF2D 1I4XA 2SEBD 1ESFA 2AQ3B 5D3DA 1LT5D 1PZID 3MFGA 2Z8LA 1BCPF 4DXFA 2XRSD 1FNVA 4UDUC 1V1OA 4RGOS 1FGBD 1G8ZD 1SE3A 1D5XC 4RH6A 1PTOC 3KLSX 1LTSD 1EU3A 2AQ2B 5ELEA 1PRTC 1EEID 4RGMA 1TS5A 3O13A 5ELCA 3SEBA 1GOZA 1SJHD 4L63B 1AN8A 1PRTB 1TS4A 1ENFA 1SE4A 3BYYB 1BCPB 1TS2A 1EU4A 1T5XD 1RCVD 5I4DA 1LTBD 1HXYD 4RGNA 5FKAC 1S5CD 1I4HA 3DWPA 4K6LA 2R61A 1RDPD 4O1NA 4NZLB 1HA5A 1D6EC 1I4QA 1LTRD 2RDHA 1TY2A 1LT4D 1M4VA 2QILA 2QEJC 2WV6D 1LT3D 3EFXD 1L0YB 2IJ0A 4RHRA 1FNUA 1S5BD 2TSSA 1LTAD 2NTSA 1JWMD 1CHQD 1EFID 2G9HD 1EWCA 3MC0B 5ELFA 1PTOB 1YN5A 2NTTA 4DXGA 1PYWD 1ET9A 1PZJD 1CHPD 1KLUD 2XRQD 1D5ZC 5FK9C 4RHSA 1I4GA 1HTLD 1STEA 3TSSA 1XXGA 4OHJA 1HQRD 1FNWA 1V1PA 5ELDA 1S5FD 1UNSA 3R2IA 3R8BA 2IPKD 1SEBD 1LT6D 1PZKD 2O2LD 2XN9C 3R2TA 1I4RA 1TS3A 3BVGA 5D3IB 1RD9D 2XNAC 4ZYSA 1V1PB 1S5DD 3BVZA 1S5ED 3DWQA 4L6TB 1B44D 1LTID 3W2DA 5ELBA 1BCPD 1SJED 1I4PA 1KTKA 1YN3A 1TY0A 1YN4A 1SXTA 2RDGA 1SBBB 1JWUD 1PRTD 1KLGD 1LLRD 1EEFD 1LTGD
chains in the Genus database with same CATH superfamily
1X55A 1IZ6A 4X6AH 2NVYH 2WX1A 5KHOA 3Q24A 2JA8H 3NENA 1TWGB 4XDXA 2MJ3A 4ANVA 2N9KA 2EYJA 1OXVA 1ILPA 1RM6C 1Z47A 4EUTA 4A3PA 3H0GB 1N5XA 2NBFA 3CMEA 5DPWA 3SK8A 1HE8A 4F8MA 4LF4Q 4P7IA 5EE9A 1HUMA 2KMMA 4HAEA 1SNPA 5I2YA 3I4MG 2H4OA 4A3KG 4JBWA 3BIID 4K5VA 2EYFA 4IURA 5EPKA 1XLQA 5IODA 1YJJA 4HJ7A 3RT3B 3UGBB 3I73A 3N1YC 3PIPA 3IT4B 3S1RB 2GBJA 1C4QA 1E10A 1XNQL 3V62A 2ZM6Q 3T1YQ 5IWAL 3RZFA 5CR3A 5T1GA 1R4QB 4NXML 4XYQA 3BJUA 4AYBG 3KBXA 4DR3L 2MJ8A 1I6HH 1CQFA 3QCAA 5AZGA 1V1OA 3WCQA 2KHSA 2ZVNA 2NVTB 2HT1A 1BBUA 1SE3A 3B2GA 3I5JC 3OG5A 4IWQA 5M3MB 4POFA 2QJLA 4PG3A 5COYA 1VCBA 1TS5A 4KSKC 5FLXE 1L5PA 4AS1A 2B63B 2LHEA 5IYCH 2R2QA 4RKBA 4C00A 3P7JA 1PRTB 1Y1VH 1FVIA 1YVCA 2DX5B 2MW5A 1V43A 4OXPA 1EIGA 4XQQA 4NNJB 4US9A 3ZJUA 4KV6A 2F0HA 1VZ6A 3S2AA 3NG0A 1K8OA 5M5WH 1N62A 2KQ7A 4GDLB 2WINB 2L00B 1GUTA 1M4VA 2LVOA 5CV9A 1PFSA 2JYTA 4PZ8A 2F0NA 4JOIC 5CBEE 2L0TA 2J52A 1WTOA 3D0FA 4HIMA 2IBIB 3OAWA 1TIFA 4RM9A 1KL9A 3UINB 3U7DA 1S5BD 3BINA 5IGGA 1KFYB 4PMWA 1LTAD 1XWEA 1WTWA 3CMMB 3MJWA 1XT9B 5DLQE 2JRHA 5M5YB 2KN4A 4LFAQ 3LXFA 4A8XC 4K7UA 2ZJPA 3OLMD 1VQGA 3PHXB 1EQVA 1EQRA 2KCNA 2OJRA 4N8FA 4PQXA 5C0XJ 4K8IA 2A69C 2L55A 1D5ZC 3A7AB 5LMUL 1HR0L 3DDCB 2BYFA 2QSDA 5KGUA 4LNQA 4CGYB 4LFCL 3KFUA 5EKKA 2ZNVB 3BDCA 3S14H 4K2LA 3VH4B 3X3NA 3GB1A 1E2ZA 5K36H 3G6EA 2IHEA 2KQ4X 4C3JG 4BY7H 3S2DB 3I3TB 1LT6D 2XN9C 1TWFH 3AEGB 2CQOA 1V80A 2LMCA 4YCVA 3W2DA 1V86A 4K5WA 1R4MI 3RD4A 4ME5A 2UU9Q 2MBEA 3KUDB 4GOCA 4HWIB 2RSOA 4AQ7A 5C5MA 5FLXL 2LUMA 1TVXA 4GN1A 1WY8A 3E5SA 4E71A 1WTRA 1DJRD 3NHEB 1GUAB 5TSSA 1FXTB 2KDFB 2F0FA 1PGBA 3BY4B 4I6LB 4C4VA 3TBIB 1IL8A 2WIIB 4LNOA 3QHTA 4NPNA 2JXMB 2NUCA 3FDTA 1V5TA 2NR2A 2M00A 1SE2A 2K25A 1X56A 2QHOA 3VRBB 3PSEB 4BKTA 4A4IA 4JG2A 4BWGB 2BKFA 1Z2MA 2B8GA 4OEMB 2IGGA 1G2SA 3W5OA 4JI1L 3KWVA 1EUJA 1WVLA 3I55A 5LMNQ 1XTDA 2RSNA 1MSGA 3LWUA 4A3MG 2PEAA 3P75A 3AEAB 3ZJTA 5JPMC 3U2SC 1SRUA 3VR5A 3C1FA 4LMQD 4P71A 5D3DA 5AUKA 1YNJD 2PZWA 4P2CB 1AE3A 5CORA 4W9IA 2A6HD 4H13C 3ONSA 1SDFA 2EOTA 2N88A 1KRHA 3QARA 3Q3FA 1GB1A 1TJEA 1GJZA 3O65B 3IVFA 1B9NA 4L2YA 4A3FB 2WXGA 3L4PA 4EZKA 3CC4A 4YTPB 1T0QC 1EEID 1TWGH 2KC1A 5T1IA 2E3TA 1VQOA 2NWGA 3TN2A 5CMDA 1RYJA 1SNDA 3NZ3A 1Y1VG 3T1HL 1Q86C 1WZ0A 3NWTA 4BA2I 4IOCA 3MEHA 3PMFA 2CR5A 4G11A 2Y5PA 2M56B 2L8JA 4GB9A 4BBRG 2NZ1D 5FKAC 2PIAA 5IKCM 2EYPA 4ALPA 2INDC 4BXXH 1P98A 2F0WA 3AU4A 2OF1A 3A7LA 1MHWC 1BKBA 4X65L 3ULLA 5C44G 1IYVA 4AOFA 3RNEC 4UHVA 2F4VL 2QILA 4DV7Q 2M19A 2LMCB 4DDGD 4US8A 5MPOA 5C23A 1JMLA 1J5EQ 3H7PA 2A68C 3TMPB 5L83A 1FJGL 4DN4M 2WQYB 4JYAQ 3DBSA 3RLOA 3RZOH 4RCNA 2Q5WD 2R2OA 4HPMB 3LYYA 5LLIA 3W5UB 4DV5Q 2G9HD 1C4PA 1EWCA 4A3JG 1ET9A 1ROEA 2WXMA 1J8CA 4XTCS 1A2UA 4M02A 4URKA 2K6DB 1CSQA 4WFN3 3TEXA 3Q2AC 2MA9B 4RHSA 3LWEA 3APFA 1K51A 2F4IA 4DR1L 2BYTA 1CMXB 2ZM6L 1OQRA 3HKZB 1SROA 2N7EA 1GKHA 4JI0Q 3ZTDA 1RLFA 5DM63 3DUZA 1CKMA 2WAQB 1VQ7A 1YJ1A 1FR3A 2IPKD 4TKOB 1V49A 1E90A 3OJ4B 5CHVC 2K50A 4ZYSA 4GKJQ 1RD9D 1Q46A 4OELB 1CZWA 1TWHB 4JI8Q 1NMFA 1WTXA 3NS1A 5CBAE 1N36Q 2X69A 5C4XH 1IGCA 5ELBA 1FXIA 5M5WB 1WRIA 4HIOA 2JYOA 1B4OA 4ICVA 1KDCA 2BA1A 4HK2A 1LLRD 3HOYB 3AB5A 1MKHA 2HCIA 2V9HA 3CPWA 4CHKA 3Q8FA 4MGIE 1DM0B 4C3HG 4HSPA 3GZNB 3ZLZA 3EIVA 3NE5B 5E4XA 1VQ4A 2JYEA 2PW9A 3CWIA 2PI2A 3P2BA 5M3MH 5CV4A 2OCEA 1KIXA 3S9WA 2WXIA 2KJRA 2Z0EB 5FJ8G 4A3KB 3HOWG 3D4DA 1JORA 2GRIA 2AMCB 3Q6BA 3GE8C 4TSSA 5KYLA 3UDFA 3HOWH 1I7HA 3QWNA 4FULA 3QJYA 3RMHA 2O5JC 2FE8A 4KD4A 3AV8A 4LLGM 2UXDQ 4JPSA 4MH0E 1Q8KA 1L0XB 2E2DC 1LM8B 2XBBC 4C1NK 1LGRA 2EYOA 2KD0A 3E56A 4EZJA 2PPBC 2RDBC 1QILA 1HPCA 3L7ZC 2AKWB 1PTOD 2M4NA 4AYBB 3GTGB 2K5DA 5C3WA 4CKCA 4DV4Q 3N32A 1TWFB 2D0PA 1LUZA 1F0ZA 2K28A 1G51A 2B8FA 4IOAA 2CU1A 2CWAA 2K4KA 4A55A 5M3MG 4HSVA 2KOLA 2VL6A 1UEBA 2K05A 3K0YA 1ML0D 4UDUC 5LL6X 4RGOS 3G71A 4K0KQ 4Y7NH 4KHPQ 4KMUC 1Q12A 1VQHA 4DUZL 1S3SG 4IM2A 1UAPA 5AUIA 2G9DA 5CC4A 1TGZB 4ASWC 4DNIA 4DV2L 1P9DU 2F0KA 3I7FA 2IY5B 3EGRA 2Z1CA 5FOBB 5C4JH 3K0XA 1KDBA 4I7AA 3ERQA 1B3AA 2LS01 3MP9A 1D8LA 3GTQB 4RGNA 3J81j 1F52A 1SFOB 1J5EL 2XTIA 3DWPA 2IZVB 2BH2A 3PO0A 2DJFC 4GLSC 4A3DB 1DOXA 5KNCA 3PO3H 2DWQA 3KUZA 1D1IA 4HMIA 3TZDA 4ZLTF 2KN5A 3V61A 4MT5A 2MP1A 4WQMA 1H95A 2B2VA 2H1EA 5M5XB 2L52A 4GMVA 1B9RA 3NY5A 3T51B 3SU8X 1WGRA 4NDXA 5D94A 1JJGA 2B3AA 5E6JA 1DGSA 2MBHA 1WXSA 1L1OC 4A20A 2RQXA 2G4SA 1UE1A 3W5VB 2KMCA 1SNQA 2NTTA 3MAQA 5IN7A 2CQAA 2NYZD 3A0JA 3ZGZA 2VQFQ 1H9SA 4GLVB 4XYCA 2Q8IB 4HJ9A 1KJTA 3NVZA 2HIVA 2ZXPA 1NI2A 4ZCKA 3HOUB 2LFIA 2WXHA 3TSSA 2B2VC 5HURA 1HQRD 2AEHA 1PGAA 4YTMB 3JSVA 5AJ3L 3PV1A 5C44H 1R4PB 2I46A 1ZXIA 3EROA 1Z7TA 3TQYA 3AE3B 1VQAA 1HZ9A 2YTYA 4REZA 2UUAQ 2I5HA 3DEPA 3Q23A 1WGHA 2KCTA 2A4ZA 2EMSA 2OJWA 3KWLA 3NTIA 3S1RH 3IT6B 3Q69A 2KYWA 1FYCA 2KVMA 2Y0SE 4I7ZC 4I6PA 3H3VC 4FBJB 3AE4B 4DAVA 4JI7L 3D8GA 3PQIA 2K3UA 4XDDA 3BU2A 1TWCB 2BTEA 4PT5A 4ANXA 1EYAA 1JRUA 2OXPA 4L8JA 1JMCA 1YNTE 4ZOHC 2L9HA 4NY0A 4W9LA 4Z9CB 1XNQQ 1IBXA 2ICIA 3G4SA 1JWSD 3A9KB 2A74C 1ZXTA 2M2LA 3DCGA 3AE2B 4CDCC 5BMGA 4OL7A 4JI0L 2IDYA 5AEKB 2C7NB 3K5NA 1IBXB 2KX0A 3A9JB 2PE9A 3AEBB 5H1SE 1ACCA 1FRDA 1I94L 3AE9B 3F8TA 4A3MB 4NAWA 2KMAA 4TRDA 3NWSA 4G0NB 2BB6A 2YEPF 2JF5A 2OTJA 1FFVA 3LNNA 3WWVA 1MHXA 2KKCA 3EC8A 3JAMi 5KNDA 5D65A 3BVMA 2Z9HA 2BWES 1EY8A 1O78A 1STBA 2DGYA 1VQBA 2L0FA 4K8JA 1WI5A 4BBRH 1N9WA 1JT8A 1K73C 2QCPX 2KUMA 1HH2P 3NSWA 1KRTA 1IYUA 4A3CG 1C78A 1SIFA 1VR9A 1WGYA 3QOJA 2GVAA 5KYIA 1Y1WG 1Y8PB 4DV2Q 3VTVA 5M5XH 2VXWA 2NS5A 4GDKA 2BDNA 2B63H 4WWNA 1N34L 1YBYA 2A19A 3P4RB 4ZRIA 2R7DA 3A55A 4G50A 3Q3JA 1AZQA 3M3YB 1UBQA 1ZKHA 4RM8A 2EKEC 3T1YL 3AEFB 1H9SB 5ELCA 4A3LG 4X57B 2J53A 2WHIA 3CCQA 4JBKA 4X66L 3ERSX 3I4MH 4EEWA 1SSOA 2WDRB 4N6EB 1T0SC 4IM3A 4B9KA 1EY9A 1RCVD 3VR3A 1HR0Q 2PJHA 4BY1H 3HEJA 4A3JH 2M1MA 3LB8C 3FRPB 3T56B 3H7PB 4GKKL 3S1MB 3CD6A 2EY2A 4TV3A 4GSWA 2KACA 2PMZE 2NN6G 3E9IA 3GTLB 1G2TA 4DV0Q 2MX2A 3VFKA 1F9QA 3A5ZB 2PVOD 3RZDB 3HGBA 2YYZA 1L0YB 4O42A 2A69D 1KABA 1STGA 5EGTA 2HD3A 4DUZQ 4JVZA 5E3FA 1DXMA 1YNNC 3VR9B 5C0XH 3RUZA 4F88A 2LGXA 1E24A 3PGEA 3ZNHB 2SAKA 2E8GA 1PFNA 3R93A 5FLMG 3U4ZA 2JRIB 1QUQA 1FJGQ 4JX1C 3E9HA 3ZYYX 2ATWA 3PIO3 4LNNA 5IP9H 3CCMA 1S72A 1J7BA 2BQQA 5D7GA 5BO4B 2K5QA 1ICWA 1E8XA 1FL0A 2D07B 4WWMA 3K7UC 3OIQA 3OSOA 1LM0A 4LF7L 1UE5A 2ZVOA 1PZKD 3OMCA 3DOWA 2MJDA 3BVGA 4ANWA 1Y8RC 1YMHE 2G4DB 5NUCA 2JA8B 3AEEB 3T53B 4ILWA 1B44D 5JJIA 1XPRA 3NELA 2E74C 2P5ZX 3KDFB 5IYCG 2FIFA 4OZBA 1K83B 3J7ZC 1WZ3A 2WXQA 4ZYNA 2J0TD 1QWYA 1XMQQ 4B3MQ 4DK5A 5E6NA 3W1GA 4AQYL 1GO3E 3NP8A 2HDLA 4OZCA 1HQMC 1WTVA 3EHVA 1RTOA 1EUVB 4DV6L 1HNZQ 2LJIA 5C5LA 1LABA 5IT9c 5BYRA 3UIPB 4FF1A 1P16A 3W9CB 2ALYB 1YEZA 4A3FG 2E5LL 4JI5L 3RNBC 3QIAA 3ECIA 1YNND 1W6JA 5C3XA 3RNGC 4DBGA 1JJ2A 5CV6A 2IWHA 5E6PA 2RF4A 2ENBA 2UUAL 2Z6KC 4Q0FA 2CJOA 1VLBA 1VDZA 3WOEA 3WALA 5C1ZA 4K5XA 2GVBA 3KLWA 1L1OB 4P74A 5BN3A 1WD0A 1C0AA 1AP0A 1C79A 3GTPB 2LZ6A 4TVAB 3WDNA 5BR8Q 4PS3A 3EA6A 1R9TB 2BWFA 3MXNB 2NVTH 3PO3B 4I6NB 4IFDG 4QJFA 1LQBA 4HCEA 2GLSA 4XWWA 2A5UA 4LDTB 4GNXC 3OTOQ 1LT5D 2UXBL 5IO9A 3TEWA 3CRKC 1H9JA 1W3SA 4A3FH 3ZUNA 2FMMA 5AJ3Q 4MGZE 2CHWA 3AN1A 1C9FA 1CKNB 2K8BA 3HOZH 1G8ZD 4A3GG 1EY6A 3SR6A 4JYAL 2JEBI 4JI3L 4B3SL 3GTOB 3KBGA 2JZ3B 4BBSG 3N30A 3K5OA 2R93H 5C6AA 2CHXA 1AN8A 3ALBA 1KQSA 3PZDA 5EKIA 5K5PA 3S1NH 2R93G 4XQJA 3I4NH 1NI3A 1U4AA 2JWZA 3ZIMA 4GIVA 1P8LA 3KLRA 1GG3A 4ZK9B 4S17A 1HR0W 4BKSD 1TU2B 2ICEC 1I4QA 2WKCA 2GBMA 2N1VA 2RDHA 1KNAA 2EYHA 4ME3A 1AARA 1P7FA 2LFNA 3S1QH 4JPBW 4UY8C 1V1QA 3BDLA 4FP5D 1F9RA 2KDIA 2DZJA 1JROA 2UXCQ 3PUVA 2Z6KA 2OEDA 1WE6A 1PDQA 1U4LA 1KRSA 1EF1A 3I70A 3MTSA 3ABVB 5FO9B 1K0SA 2EPBA 2CKHB 1EF5A 2KTRA 2HDMA 4XGAB 5CX3A 4JBMA 4CHTB 1G291 2V4LA 2KEEA 4RNAA 5CV8A 4H44C 1K0RA 2KVRA 1CM9A 3RPFC 2KWCA 2ACZB 5D14A 2Y0SG 2K6AA 4GS3A 2GOWA 2KWUB 4AUQC 2F52A 1L6UA 3J81E 5G3LF 3HS0C 3SXHA 1XNRQ 3IHPC 1EIFA 3AQQA 1X1MA 1NTGA 4XT3B 3TL5A 4JCVE 3F2DA 4NW2A 3R8BA 1QNUA 1YD8U 5D6JB 1KDAA 1IHZA 2KDBA 3P1HA 3NQTA 1I4RA 1NYRA 2GBRA 3AFPA 1JC7A 1V1PB 5DAUA 4FF2A 2KC2A 3PO2B 3SR1A 1SYBA 4CO7A 2BVCA 2CS4A 2Q8RE 2L1BA 1QZGA 5IT9E 2RSUA 3S15B 4ID6A 4IW0A 2L11A 2FNJB 3A1QB 2FMCA 1YIJA 3HRDD 1BR9A 4YWKA 4DV4L 4GN4B 1EL0A 4II2B 1EEFD 2NVXH 4NJCA 2VW9A 2KWDA 3A9JA 2GA4B 5CGKA 3VRAB 5IA7A 1AEXA 2EY1A 2LSSA 1WTQA 1BMLC 4IPGA 4LF8L 1NBWA 4RMFA 1IBKQ 1FEHA 1Q0WB 4DK0A 4NAWB 3MJ5A 3P63A 2XGTA 4HCPB 1JQYD 3V05A 1CT1D 3GTQH 4RGTA 1WE7A 3HOZB 4KIKB 4LCDE 2L1AA 2KHIA 3J80L 4KHZA 2A5HA 2WNMA 3MTNB 3ITPA 5C4ZA 4HCNB 2IY1B 1BUVT 2IO3B 3RN5A 2KTFA 3RNFC 3J81L 5EPJA 4DR7L 2WXLA 4N9F4 1U4MA 3BZCA 2K14A 5C3EH 4LF6L 3ZXVA 2VQFL 1GUSA 4MSQB 4C2MH 5A2QE 2PI2E 2YLMA 4IWPA 3S2HH 2QDFA 5KHQA 4OONA 4DR5L 4B08A 1ZPSA 1TKEA 3BK1A 1NBFC 2OTLA 3ZW3A 2KFJA 5C0XI 1Q10A 2UUCL 3L17A 2K33A 2KANA 2L0CA 3SHLA 3MFYA 4E6IA 4JI5Q 1QG7A 3KLSX 2B2UA 3PLVA 2NVUI 3R66C 5JH5C 1E8YA 4U68A 3UDIA 3O13A 5E1FA 2RR9A 1FRRA 1T9HA 4JI7Q 4J6IA 3C19A 4P72A 3CQZB 2IGDA 1SE4A 4K0KL 1WRDB 4UAIA 1TS2A 3K9OB 2WXOA 3CCSA 1CKNA 4LNIA 4KKSA 1WH3A 1HXYD 1XYIA 2DZKA 4WORA 1FGUA 5KRUA 3HOXG 1M90C 2KHJA 4OZAA 4CKEA 2SDFA 3V3XA 3DXJC 1PH2A 1JE4A 2EJMA 4DV6Q 1PH1A 1HNZL 2W3RA 4B3RL 4LF5Q 2LY7A 4BBRB 3N1ZC 1PXUA 2KWVB 4YHHL 1N33L 1DOMA 3AXCA 2D5GA 3M62B 2C5CA 4CJ2C 3ZNGC 3VYSA 3LX0A 4ZRKA 1RKNA 1E1TA 2K1BA 4IUQA 4O2DA 2K03A 3PO2H 2I0QA 4R1JA 4KI0A 4K6DA 1NJIC 2E76C 5IGEA 3I90A 1EFID 3CF6E 1I50H 4FHKA 3OIPA 1SFOH 4P1CC 2ES2A 2RCNA 4B3TQ 2D2CC 2WXKA 1EY5A 4A9AA 1K8GA 5DEHA 1L7YA 3KJOA 1RTNA 2FHTA 5CV5A 2XRQD 5M3FH 4DUYL 1XJVA 3QIJA 2LXKA 1PH5A 1ENAA 2QIEB 1PDXA 5FLMH 3U4VA 1IKLA 2K5HA 2A6EC 1QB5D 4GOPA 3NS8A 4AWJA 2EXDA 3T13A 2JUOA 3OW2A 1HNXL 2J7ZA 2CKZB 4MH8A 1SYEA 3EBEA 4ABNA 1GUGA 1KM7A 4W9JA 4XZ4A 4GOPB 2M0XA 4OWTB 5BN5A 2PLPA 4P6VF 1TWCH 4QAYA 4YCWA 3CF5A 1E2WA 3GTLH 2XK5B 5JAVA 3UE1A 1V6EA 4KZ0A 2F0IA 4ZQ3A 3I91A 4W9GA 4HDOA 4X3KA 3Q22A 1BOSA 4KHVA 1IKMA 5G3LD 1T6BX 2JWUA 1TWAB 1SJED 2MGSA 1I4PA 5JEAJ 3K57A 2K9XA 2KOXA 1MHHE 2MBOA 1TY0A 5KNBA 5A2QL 1PRTD 1QOBA 2JQRB 5C3EB 1U0LA 2X38A 2CH4W 3QR8A 5EE3A 1XX8A 4LF9Q 1G6ZA 1B1ZA 2CHBD 2BT6A 1QZEA 3OHXC 2F0UA 2HTHA 1CQVA 3DWAA 5GAHC 2C7MB 1A15A 2K5PA 2M9VA 3QWZB 1L1OA 3U30A 5BR8L 3HOUG 4F87A 1WMHA 2XSCA 3J81c 4A3LH 1JOOA 1LTTD 4EQNA 2L7RA 3PS6A 4IKGA 2W82A 3ENEA 3VAWA 1BXTA 2BDOA 3QB3A 2E2JB 1KF6B 2JPHA 4WWOA 1XCTL 3ULJA 1VQPA 2RGFA 3AE1B 3RMKC 3M9BA 4C3IB 2B2TC 3FMCA 1PQSA 3U58A 1WXVA 4DR4L 1SF0A 2AWNA 2IHFA 1TYGB 5J2RA 1F77A 4NMZA 2GMIC 1L0VB 1JR0D 1PA6A 1EIHA 2A1AA 1E0BA 2HHHL 4UP7A 2SEBD 3S17H 3HK0A 1MI0A 1YNXA 2IX3A 4WJNA 2FCMA 4A6QA 4HRSA 1V97A 3GOEA 5IT9L 2LEKA 3L13A 4RF1A 2FCNA 1J0GA 1C3TA 1OO9B 3GDEA 3PUYA 3IFTA 1P7EA 1IBKL 2EJFC 3CC2A 4TUUA 5AZHA 3HOXH 2YU9H 4F8CB 3DQVA 1JE5A 1DGJA 2BB5A 2AQ2B 1QOFA 4JL9A 3SVMA 1PRTC 3MZ5A 3ML9A 2XIWA 4RGMA 4XDCA 1G6JA 5IGCA 2K52A 3OMGA 1YHBA 3I4OA 4IUUA 4JK1C 3NXWA 2INPE 2ZW1A 3IRBA 4GXBA 2B2YA 4BBSH 5FO8B 3H1UA 4LF5L 2UU9L 4L5RC 2UXCL 1RWSA 2OQ0A 3SK6A 3W1BA 2JZZA 2B2WA 2XVSA 2K8CA 5KEEA 2MEKA 4JI6Q 4WIPA 4TQ1A 2R61A 4O0AA 2KFKA 5BMIA 4HTHA 1WCMG 4HMJA 1QVFA 3KYCD 4ZRPA 4GNXB 1WCMH 4GN5A 2JA7B 1YIWA 1R4MB 5GAEC 2G3QB 1Y1WB 2WDTB 2KENA 3VUWA 1QVGA 3FKYA 5J18A 2RVLA 1GJXA 1CFMA 3FPUB 3EECA 1JWBD 2M8SA 3IAS1 5FO7B 3APCA 5ELFA 3HM6X 1TIID 3ZVVA 1WF9A 1BBWA 1IXRA 1WJ6A 2AYOB 3GO5A 2DZMA 1X3GA 2PVGC 1WR6E 3KLSA 4MJSB 1E7PB 1K9MC 4POGA 2KJXA 3V6EB 1Q90A 1STEA 1GB4A 2JSVX 4X64L 2VS1A 1FNWA 2MCNB 2BKRB 1LTLA 4ZHPA 1FCCC 1EOVA 1S5FD 3PO2G 1XLPA 3R2IA 4G7HC 1WIAA 3GS2A 3K5MA 2F0JA 1RFKA 3MXUA 5D3IB 3VYTA 1M8AA 1U5KA 2ZJQA 3S1QB 2RBMA 1ZKOA 1R4NB 2K04A 1UWXA 4OO1H 3BVZA 2J42A 3HOUH 2I1KA 1JB3A 2V3SA 3B1LX 1QJOA 1ASZA 4DKAC 3BG3A 2I38A 5IE8A 2ZCCA 2K5VA 4EQPA 3DHGC 4XYOA 1KTKA 1Z6HA 1VQCA 1YN3A 3SD5A 3P4SB 4A93B 1BT0A 2K22A 4K7WA 1NY4A 1ILQA 3BYTB 3VDYA 2I5LX 1KAWA 5M3FG 3M7GA 3M7NA 1NAPA 4DV1Q 4EKUA 2N55A 3NBHB 3U9SA 2O2VA 3G48A 4Q5VA 2DJGC 1VRAB 1C4AA 3CKIB 1KD1C 1X3PA 2BYEA 4C56C 4DR4Q 2JA6B 3OPOA 3L08A 5I9OA 3CCRA 4QQBX 1UWVA 3W1YA 4PZ6A 3G6JB 5G5GA 2VNUD 2NVQB 3D4RA 3CP0A 5C0XG 3F2BA 1A6XA 3RI7C 1FFUA 1EM7A 1XTCD 2VZAA 3CHBD 4F7XA 2JA8G 1B9MA 1HEZE 3R7RA 1B3QA 5G55A 1OEYJ 4QUFA 2QW7A 2BH8A 3DBHI 4RA8A 1RF2D 1F2MA 4QB4A 4RF0A 1U4PA 1ISNA 2M0AA 3FILB 1MIUA 2KXJA 2Z8LA 4AYBE 4G7OC 3B0AA 3RNUA 1FGBD 4JWUC 4DGZA 2C7HA 2JY6A 3DEOA 4C3JH 4BY7G 4DHJD 2UXBQ 1VQFA 2Q2HA 3A5UA 4J6HA 4CQNA 3SFDB 1GOZA 1LV9A 2GBNA 3V60A 1AZPA 1L2FA 2GN5A 1MG4A 2VRRB 3CCVA 1HZ6A 4PMBA 5I4DA 1MFWA 1L0WA 2DUDA 2N7JA 4FN2A 4FHJA 5EPLA 4AJWA 2MUYA 3KH0A 2Q8TA 2I07B 5LHY1 4FF4A 3D32A 2ZPNA 4NAMA 1C76A 3WA0A 2WDVB 1LT3D 2WP8J 2ZT9C 1QQRA 2BPSA 2VB3X 2C9WB 4C3IH 2VH1A 2R92B 5BN4A 1QE6A 1EZ8A 2IJ0A 4X62Q 2BW2A 3ZO5B 1VD2A 2V1YA 3MA2B 3IFDA 2NTSA 4BKSA 2IY0B 3CMAA 4I65A 4KVGB 4IUVA 4X65Q 1SB3C 3UQBA 3GTKH 3I4LA 3HOYH 4X64Q 2DN8A 1CSPA 3H8HA 3PV0A 1HNXQ 2H88B 4AIMA 3RNAC 1X9NA 2F0TA 4FNFA 1KLUD 4LFBL 3GTJH 1UH6A 3QK0A 1JOKA 2O6VA 3K7AH 3EN2A 3MC9A 3PHWB 4DF7A 5GXGB 4W9HA 4Y7NB 2DNEA 5F2DA 3D4WA 2A6ED 4FYDA 4B3TL 3J7YW 4K81A 3NRZA 3PUXA 1DOLA 3R2TA 4A3GH 4YY3L 1V9JA 1HTQA 2QGQA 3RN2A 1WX7A 3S2HB 4ITKA 2MNAA 3H6NA 5C3EG 1A5RA 1BCPD 3ONAB 1DZ1A 4YWLA 3GTMH 4FJZA 2KECA 4CBVA 4IM0A 4MELA 3FPPA 3T8MA 2KT7A 4BKGA 1STHA 4BVUC 2NBWB 2FINB 3WAOA 4OX9L 4JI4L 1FD6A 4DV3L 2EKIA 5DNFA 1C4CA 2L4NA 2D3GA 4P16A 4RWSC 2OQKA 1IBLL 3GP7A 4S3SA 2UUCQ 4HN7A 3DVNV 2CHZA 3NJTA 3NQIA 3NPPA 1CA5A 4KX6B 2QC8A 2WFWA 4DR2L 4EE2A 4LF9L 2D62A 3B08A 1W6KA 2V1CC 4C3JB 3H0GG 1UZXB 2JT4B 2ZTCA 4LUOA 1E2VA 1X3EA 4QUCA 2B76B 1Q82C 2YTXA 3QQ8B 4HR7B 3EQLC 1PH8A 2L32A 3RZWC 2EJGC 3ZDMC 3GE3C 1PMRA 1OTCA 3CCLA 3M4QA 3ZQ4A 1L4DB 4UP8A 1K50A 3AULA 3CU7A 4KD3A 2VQEL 1XPOA 2F3VA 2AL3A 3HVZA 3STBD 2NN6H 3L0WB 4DV1L 5AZFA 4DDID 1UEAB 2XRSD 1FNVA 2IO0B 3NVYA 4FA6A 2E2IB 3FVQA 3PRMB 3ZNID 4JC0A 4BZAA 2KCMA 1D5XC 5JPNC 1VQ6A 4EQ5A 1C8CA 2KJHB 3RLFA 1GAQB 2ON8A 1JWAD 1GM5A 3B6YA 3Q3NC 4GKKQ 3RR5A 2D2QA 4ZKCB 4C7YA 2B2WC 4KGTA 2ZTEA 3Q6SA 3DBRI 3I63C 3VTUA 5LNK1 1TS4A 4PNYA 2BS3B 4DWFA 2E2IH 3NUHB 2F0DA 3CPFA 3C3LA 3PRZA 4DUYQ 3FP9A 3E9SA 2BYVE 3K58A 4G3XB 4DFAA 2MSED 2NPTA 3TCAA 2L12A 3Q8BA 4HPPA 4O1NA 4K6LA 5EE0A 4ZRZA 5GROA 1IYFA 1F2LA 4ARCA 3WOFA 3HIZA 5IYBH 1WM2A 1WGGA 2EYLA 3S17B 2QEJC 1GHKA 3H7SA 1N8RC 4LK0M 3ZKJC 1XO3A 2RMMA 1F2RC 1EWIA 2DNCA 5I9PA 3DBLB 1HFGA 4AH6A 3T3OA 1SYDA 4FXKC 1MG8A 4EX5A 4GU2A 4EVOA 2OWOA 1E7UA 2F3IA 1GVPA 5FR6A 3STBC 1VS0A 4X66Q 2E2JH 2YVCA 3E6ZX 4A3KH 1K83H 2R3ZA 4DXGA 2E2HH 1PZJD 1NMGA 3GD7A 3L3OC 5IYDH 1CZGA 4ARIA 5D2MB 5IOIA 2KCCA 5C4JB 5CHWA 3CCJA 4JWSC 2F1MA 5LL6S 1VDVA 3UQAA 3NTHA 1V9PA 5EAYA 2K39A 4LTUA 4DXAB 1VQ9A 3S15H 3H0GH 4MHEA 2N78A 1YQ4B 3RNCC 1ENCA 4C3IG 2WXPA 4JW0A 1G91A 3FC4A 3LGJA 2NBUA 1A62A 3VVWB 1K53A 3TJPA 4L5QA 1MBYA 3S1MH 4OVUA 1EQQA 3GTPH 2W3SA 1WWTA 1STNA 1YN4A 2AUJD 3K9PB 3ULPA 1JWUD 4BXXG 2A8VA 1MGSA 3A74A 2KLCA 2WXNA 1V8CA 1IL2A 2N8NA 4DR2Q 3KVFB 5IP4D 1WYDA 2F0EA 1EFWA 4DK3C 4LF4L 5L95C 1KNEA 3CW2C 3P1MA 1BCPC 4IPHA 2NZOA 1P0RA 2NMQA 2RPVA 4CDDC 3M3YH 5IGFA 5J1ZA 3GTKB 1OFFA 1RODA 2WXJA 3OWEB 2C60A 3CSFA 3TIXA 4TQ0A 4HLEA 4ODGA 2DY8A 2C9OA 2H5XA 2YV5A 2LUEA 2UYZB 2NPTB 3H09A 2BF8B 4YT0B 4BY1B 4GDLA 2YTVA 2L5TA 1HJPA 2B29A 4MTNA 5EJWA 2C5LC 2LHDA 2DNFA 4C3HH 1QVCA 4RG1A 2J0KA 3VR4A 2PQAB 4X3TA 4K7SA 2IT1A 2WGSA 1F1HA 2AQ3B 3N6RA 1Y69U 1PZID 3VR8B 3PF4A 3H94A 1WI0A 1UE6A 1BCPF 2K7VA 4K3BA 3IG3A 4MGKE 2RCFA 4ZKBB 3F2UA 2L3ZA 1E5WA 2MRPA 3RULA 2KQ3A 4YY3Q 1XF5L 3IFWB 2RDFA 4C7ZA 3Q8DA 4E74A 3GQBA 2EY5A 1J9OA 2FUG1 2WXFA 3J80i 2ZEQA 3K8AA 3HOVH 1XMOQ 2ZJRA 3S16B 4M8MA 5FR3A 1NENB 2F03A 2NVYB 3J7A5 3NTKA 1JB7A 4ZUJA 5DPTA 2K1FA 1X65A 2E2HB 1A2TA 4QMGA 2DYMA 5EE1A 3DWGC 4MZ9A 5KIXA 2B2YC 3KF6B 1Y1WH 3SFEB 3N52A 2X8XX 4HEA1 1E6EB 1JW9D 3SDZA 4OO1G 5H92C 2WV6D 4AP4C 1TT2A 4C1NI 1MI2A 2QEXA 1GUOA 4BA1I 4LNKA 4W9FA 3KF6A 3KJPA 3R3MA 1FNUA 2PO4A 2QA4A 1WXMA 2I2YA 1L6VA 3KYDD 4W9CA 4R3DA 2QF7A 5M9OA 2LRUA 2CH4A 3BK2A 1Q3LA 3QX1A 1CHQD 3C2PA 2EMTA 4A93G 4A3OA 3AECB 1SMYD 1JICA 1XNRL 2GB1A 1SMXA 2KQSA 2N9PC 3AE7B 2JA6H 1KH0A 2ZNVC 4OGQC 4LWCA 2PQEA 2WWZA 3A56A 3K6OA 5JZEB 1NYQA 4IALA 4KSLC 1V5OA 5HHDG 1WJ4A 3JW0X 4V190 2KZRA 3TEZA 3PCOB 1LFDA 4B6WA 3PREA 4LDTD 4QIWB 2R7FA 4A3JB 1SE9A 2JA5B 4TKNA 4NXNQ 2MLBA 4LJOB 5HKHA 5EBDA 1XMQL 1I94Q 3H15A 4NJ6A 1ASYA 4H7BA 4NP5A 3L16A 3U50C 1HNWL 4JI4Q 4MDKE 4N9PA 1WJNA 4DA2A 1S5ED 3DWQA 2JXXA 3M4OH 1UF0A 1IBLQ 1YHAA 1SYGA 5BYSA 4KDIC 2CW0C 4C3HB 5JJKA 1PHJA 1XQQA 2CU3A 2JVCA 1IW7D 2VH2A 1KHIA 1QNKA 3MVVA 4JI2L 2V3NA 3DBRB 1KLGD 4M0WA 4IWOA 5C3JB 1LTGD 1WFQA 2F0VA 3HG9A 2PKOA 2L83A 3DMUA 1HRJA 2WU2B 3VXWA 2D3CA 1QKZA 2LVQA 2AQ1B 1A8VA 4KZCA 3V6CB 4BS9A 5FJ8H 4NQKE 1E8ZA 1SAPA 1PTOH 2Z0SA 4HXDA 5FLXc 1X3FA 1HA6A 3N9YC 4FADA 3W3AA 4AQYQ 1DYQA 2VB2X 2AX5A 3ML8A 1D5MC 2WB1B 5JOBA 1ONLA 1SNMA 4LK1C 4JGHB 1K8MA 1NNXA 4OO1I 1QLBB 2D3BA 3WIMA 1LO5D 2ZTDA 3M4YA 2MFIA 4DR5Q 4DR6Q 1ZE3D 3QO2A 4PS8A 1WXAA 3DVGX 1EY4A 4DR3Q 1U9RA 1J7AA 3QOLA 4KY7A 1QOGA 3L10B 5E4WC 4LW1A 1RRBA 2EVBA 1I5FA 4PZ7A 1I4XA 1P3QU 3IAM1 3NEMA 1F2RI 4R4OA 2NB0A 1FXAA 3A4SC 3Q14C 4J8QA 4KN4C 4YTNB 3IXSA 2J0MA 2O4XA 3KK7A 4DK6C 3VUYA 1E7ZA 4R4TA 4ZDVA 1EYDA 1B70B 1S3OA 4BBSB 5DPSA 3HUIA 3TEHB 2E6XA 1GNUA 2V4IB 3AU7A 3L2PA 2K32A 1N61A 1OXTA 4QIWE 1EU3A 2BE5D 2LKVA 3J7AF 3ER0A 2LXJA 3OTOL 4YXDB 2PQAA 1WD1A 2NVQH 1GC7A 2JQOA 1K3BC 5IWAQ 3ZDTA 3ZXRA 1HHVA 3UI2A 4X3UA 2LASA 3M95A 2MHVA 2MO0A 3TEYA 3Q8CA 4WAAA 3NVWA 4DV7L 1SYCA 4KKIA 1B53A 1UE7A 3C1EA 3ZTCA 4PK1A 5CHFA 1K3RA 2OOBB 2FAZA 1E3PA 3GTMB 4L23A 2Q2IA 2WAQG 1ZUD2 3CCEA 1LT4D 2EQSA 4L1BA 1NEKB 1PFMA 1HZAA 4ZRJA 1WX8A 3MXPA 2HE7A 1EWHA 3HM3A 2O5IC 4KY5A 1VQNA 2VUMB 3K80C 2JA5H 2L76A 2FCQA 1E22A 1TWHH 2CCZA 1I42A 3T16A 4QF4A 4A3IB 3M4OB 4IFDJ 5J3BA 2NVXB 3M3JA 3QJZA 1SMYC 4APVA 1GHJA 3MC0B 1Q1OA 1YN5A 5JJLA 2F0LA 1O80A 1NUCA 2MQHA 1AYFA 4OX9Q 1OEYA 2ONQA 4J3OD 4N59A 2A68D 1TKWB 5AFWA 1D3ZA 2RA4A 3E3XA 3L9AX 1XD3B 1HTLD 3HHMA 3PUWA 3P4QB 1YOVB 4HJ5A 1N36L 3CAMA 1GPXA 3RZDH 3OW7A 4A90A 3BDOA 2R92H 1WJJA 2I5MX 2JN4A 2R6GA 4IN3A 4PMCA 3K5LA 1XLOA 1YJIA 1ZGUB 1EZ6A 4BAXA 2XNAC 2BS4B 3HKSA 3JSVB 1A70A 3Q3OC 4L6TB 1EQTA 1QT9A 1Y14B 4MSMB 4KLKA 4HEDA 3SGIA 1N63A 5C4XG 2X6LA 3AE5B 5HGTA 5IGBA 3GTJB 1WSPA 3MC8A 5LXHA 3PLUA 3I9V1 3A9KA 4QL5A 4OWXB 1O7IA 3JC66 1SBBB 5GAGC 3N20C 4OHJA 1D7QA 4C4VB 1NR4A 3I2ZA 5M5YH 2VQEQ 1UGMA 3W1SA 5HGQA 3OOCA 1DOIA 1NCVA 4DAYA 4N8X1 4KKUA 1IGDA 3EFUA 4BBNC 5ELNA 1EWYC 5G2NA 1IUEA 1MJDA 4BOSC 2MH7A 1YNJC 1PH6A 4DR7Q 1GD7A 2HJ1A 2N0SB 1PTOF 3G7LA 1H4RA 5LMNL 4HJKA 4ICUA 4XX5A 4D2KA 3S16H 4DAYB 2JX5A 1WTHA 2DYOA 4M0WB 4LJZC 1TXYA 4EOYA 3TREA 3BS1A 3RFZB 1N60A 2JA6G 3JAME 1OXSC 4LUZA 3HRZC 4DV5L 1TKYA 5J17A 2WXRA 4KN7C 3C46A 2QCZA 1H9KA 4IC7B 3BWUD 2INNE 3K81C 4JQWC 1VQDA 1Y56A 5IYDG 2E75C 4Y52H 1X6OA 1Q81C 2LRWA 1MJCA 2UUBQ 2BA0A 3KDFA 4IQZA 4A3MH 3PZ7A 2KDEB 1SLJA 3VDZA 1RL2A 1VQJA 3FHWA 3MFGA 1PUTA 2MHJA 2K75A 4QGUA 2IW3A 3D3RA 4DXFA 1H9RA 3JAML 2BS2B 3PRPB 3C0RB 4NJ7A 1E8WA 2AL6A 1Q7YC 2F0PA 2DENB 3JYUA 4KTAA 1H8CA 4RH6A 1PTOC 4K2KA 3TZUA 1V81A 3MEFA 3PPAA 2KLGA 4RMAA 4ZHOA 1DCZA 3U52E 1SR3A 4YSYB 2Z4HA 4GDKB 3TS0A 3W1SC 2CJNA 5IIFA 1YHQA 1SJHD 2FFKB 2KDMA 3KUCB 4MACA 4B0MA 4E3CA 5IY0A 3BYYB 4ANUA 3HOVG 1R9TH 3RCZA 2PZTA 1PH9A 1HCZA 1LTBD 1S5CD 4MIUA 1W2BA 2KTRB 1I6HB 3OWFA 4DPGA 3A4RA 2HHHQ 1M1KC 4LF8Q 1ZYRC 1XMOL 3CRLC 2WS3B 3SK5A 1UELA 2ZXOA 1CZPA 4N9TA 4FDBA 4EGVA 3EFXD 1J7CA 4P75A 1T5EA 1ZOYB 4RHRA 1UD7A 4A3BG 4KGRA 4MTKA 2H89B 2CW0D 1JALA 2UXDL 3I4NB 1D2BA 4DAPA 4H0LC 3SDLC 1Z9FA 1SE8A 1VMPA 5J39A 3DBHB 4A93H 2QMTA 2OHFA 1BO0A 1PYWD 2BCOA 2SOBA 3FKIB 4A3EH 2VZKD 1GUNA 3M63B 4IPDA 2IX0A 2Z4IA 1BQQT 5LMNW 2G1EA 1I4GA 3HVDA 3MHSD 2W55A 3P20A 2UU7A 5IP7H 3AYHB 4HCSA 1KXLA 4K1RB 3ZRFA 1B50A 3R7QA 2IO2B 4IFDI 2BGFA 4KHPL 1BUIC 1TS3A 3HKZG 2FJ2A 1VF5C 4A76A 2WLBA 3GV3A 2PCFB 5JHBA 1GUWA 1WXQA 4FVMA 1PV4A 4W9KA 2AWOA 3T1HQ 1JRPA 3DVGY 3UDGA 1YJNA 1Z5SB 1KAAA 2N3SA 4G7ZC 3IAYA 2IX1A 1ESRA 1N5WA 5IOCA 1PFBA 4RFBA 3RYTA 1H9MA 2KA7A 3J80c 1KLVA 5IYBG 2DLBA 1I6VC 4R4CA 1T3QA 4HJGE 1FD7D 2D0OA 3KW5B 1V8QA 2INCC 3TP7A 2PMVA 4YCUA 1E7VA 3TRZA 4JOIA 1AFPA 1JCKB 2UUBL 3NZSA 3UI3A 4M8AA 1F9PA 3I72A 1VQ5A 1ET6A 2M17A 2LXAA 2F0MA 2ZCBA 1YQBA 3A8JE 1Y8NB 1VZ7A 1ZYRD 2D11A 2IYDB 1NE3A 4FJVB 1B2TA 2GBKA 1C77A 2LD9A 1WYWB 2CWPA 3WAMA 4V0BA 1IBMQ 1TWAH 1ESFA 4S0RA 4DR6L 2WDQB 1AWDA 2VUMH 3PO3G 4B9WA 4NXNL 1CUKA 1N32Q 2K0PA 2O6VD 4G4KA 4JE3B 3S1NB 2MWSB 3VUXA 1YX5B 5GQOA 4LNFA 4K3CA 3J81i 2KHWB 3PZ8A 1VCIA 1Q1BA 4DNRB 2PW7A 2MP2B 3DPDA 1QUQB 1QCBD 2AUKA 4B0EA 2KAJA 1HUNA 3HZXA 3A8KE 3FKIH 4A3EB 4A3CH 4XC2A 1WX9A 4G57A 4BY1G 5I6YA 3HFZB 2EIFA 4X62L 2Q2TA 2MQJA 1RDPD 3RLNA 1OTRB 3DLLA 1VJKA 2KK8A 3APDA 1J8IA 3BZKA 2VUMG 2CVRA 3CXCA 1TQOA 2N7DA 1ZDVA 1CI3M 4FXGC 1A3UA 3UE0A 4MGYE 1RAXA 4M8NA 2K5WA 4GKJL 4YSXB 2PZUA 1MPEA 3Q0AA 1J6QA 3Q3MC 5DM73 3IBEA 5G5HA 4IPCA 2JSOA 4B3RQ 1LXDA 3KOJA 4MEMA 2N9XA 1K8AC 1JJCB 3VQIA 1PTOB 3A8IE 3V96A 1VQEA 2KBNA 4JI2Q 4DK1A 1DOKA 2MBQA 2WX0A 1WOCA 3DWMA 1CHPD 2LWPA 2B2TA 5FK9C 3GZNI 1J19A 1ZEQX 4USAA 2PMZB 3EJIA 3VR2A 4GLXA 4TQUS 4NKLA 1NSNS 1V1PA 3AI5A 4WURA 3GTGH 3U7ZA 3VH3B 5BMHA 3K7AB 3F2CA 4OW0A 1ZDXA 3Q8EA 2O2LD 3AEVA 3I4MB 4QY7A 1HFNA 3AB9A 2ZPYA 1QF6A 1CKOA 3MXNA 4A3BH 1XPUA 2AWTA 4WWPA 1LTID 4IUNA 4DHJB 3RZOB 5M3FB 4FXDA 1WMHB 5IP9G 4JLCA 1SXTA 4WRDA 2WKDA 4EZLA 2Y3AA 3TUOA 1HNWQ 1O7YA 1ZXHA 3KUPA 5CTRC 1SGHA 1O7LA 1UBIA 2L15A 5GADC 3HOZG 4IOIE 4LUVA 5TR5A 2WB1E 2BBCA 3C8YA 2B2UC 4RKLA 2MP2A 4WJPA 1FM0D 3AE8B 3LJ3A 4YWMA 4HPLB 2KNBA 4RAUC 2WAQE 2SNSA 4WH4A 5DCNA 2D5DA 1PRTF 1X32A 2B63G 4M1UB 1A63A 3OJ3A 3VYUA 4II3B 3VYRA 2F0QA 2R93B 2WYQA 2KX3A 1WGDA 1UUPA 4RCOA 2K8HA 4WJOA 3RN9C 5JJZA 2V3PA 3BZDB 4W9EA 2FUHB 2FIDA 2LGYA 3MXGA 4U673 1VQ8A 5GMVA 1QOAA 1I3QB 4P73A 3X23A 5CV7A 2DY7A 2ZXRA 2RHQB 2A73B 1WM3A 2VZKB 3EFCA 2AHOB 4IUTA 4B3SQ 4JI3Q 5H8YE 3NHHA 1A3TA 3AMZA 1S40A 3WAPA 1YJ9A 3NUCA 1LACA 1SYFA 1UWMA 1WFYA 2G45B 2DBYA 4R8NA 4HVBA 4GZYC 1EOTA 3D6WA 2B39A 2BE5C 2FCSA 5ELEA 4PYZA 4ZUIA 3DM1A 2YEPB 1G6PA 4OVVA 1MJEA 4DU9A 4M00A 4OVZA 3L54A 4HKQA 2CFMA 2IL8A 2Y0SB 4IG7B 3J9CA 3R3OA 1DD2A 3AH7A 4GLAC 1HZBA 4KY6A 1BCPB 4PV1C 3I3CA 1N34Q 1HTOA 3WANA 5JXVA 1T5XD 1QOHA 2L05A 1V2YA 1I4HA 2F0OA 4IFDH 1FPYA 2JU6X 2KVZA 4KJNA 1CTMA 4KK7A 1EY0A 3VTWA 1LTRD 2R92G 4BOZB 1DOYA 1TY2A 4B95A 4KV2A 2K6QA 1BVSA 3NK9A 3K59A 1R7SA 4OIKA 1OXXK 2X6GA 2E5LQ 1SN8A 1YITA 1TZ1A 2LGSA 3KF8B 1PH3A 4XXEA 1HZ5A 1HTPA 2N9LA 3UIOB 4JI6L 3QAQA 3FEWX 4A75A 1YJWA 3D6CA 3VA5A 3H3VI 3FKIG 1JWMD 3HP3A 4KKTA 4HIKA 5HI1A 1B8AA 4F7ZA 1YI2A 2MBBB 3ETRA 1D1KA 4JV5L 4AJYB 1RJTA 2XWBB 4IJLA 4XIGS 1YZ6A 2PYKA 3ND9A 5EBCA 1EIYB 2Y5CA 3NBIA 3T4AC 4XQNA 4WJ3M 4DQOC 3M85A 2MJEA 2LI5A 5EQ0A 4A3DH 4ACFA 4A3EG 2HQEA 1RHPA 2G5DA 1VMCA 4ZAIA 3QC8B 4MM3B 5T8IA 5HFYA 4FF3A 4HJAA 1KOTA 3PGZA 2XK5A 3GTOH 4CDFC 1RIPA 2KEDA 1EY7A 2K5NA 1CJEA 2Z0DB 1WCMB 4X3SA 1KC8C 2JA7H 2KFKB 2O6VB 3TP8A 4MM3A 3KYHC 1VQMA 3L0OA 1JOQA 4IUMB 1VQIA 4PYUA 1S5DD 2JA5G 1F9JA 4XE0A 3H3VH 3HOYG 2UWQA 4NPSA 1PH4A 1BF4A 4B9XA 1PH7A 4JIOU 4NQLB 1I3QH 2QDLA 2RDGA 4DNTB 4A3IG 1Q1EA 3DHHC 5JEAH 5ELOA 4HJ8A 4BFRA 1IP9A 3HOWB 1PYSB 3VA7A 1WTPA 3NVVA 2ZW0A 4C2MB 1EO6A 4MN3A 1SIJA 2J4XA 4UP9A 1TZOA 1IPGA 2Y5BB 1WGKA 2HDEA 2FXQA 4TMAB 1EYCA 4FLHA 4HDQA 3A54A 4WJWA 2DZIA 2W54A 1II3A 1Y1VB 1IBML 4H2AA 1L2NA 1L4ZB 3HOVB 4KDLB 2XWJB 2FBWB 1FO4A 1IYJB 1QZHA 3CC7A 3UDXA 1TKGA 4GOPC 1K8RB 2VY3A 3SE0A 1MD2D 2WB1G 2YU9B 3HKZE 3HOXB 1WJUA 2LVPA 3B2FA 1AW7A 3PIOA 1OGWA 4KIKA 3P4PB 2QDBA 1E9MA 3KF8A 2F0GA 3JVZX 3UF8A 1HZCA 3DHIC 3V2TA 4NB3A 2ASQA 4KGSA 4YIJA 1TR5A 5IP7G 4DV0L 2HUGA 4A3BB 1C1YB 4FJYA 1A3VA 2RHSB 3IL8A 4GN3B 3PF5A 4BBNF 4LF7Q 3CSTA 2Z59B 4M01A 3TDQA 2F3WA 4OWWB 4L5TA 4MNOA 2R7ZB 1Q8IA 1XCQL 2EYMA 2SNMA 3SEBA 4A3GB 4L63B 2EELA 2A6HC 2HD5B 1D4BA 4A3DG 4IJHA 1JQ4A 4B3ML 1S1QB 1OQYA 1EU4A 4XT1B 1GC6A 3B9JA 3DHQA 3I57A 1NVID 4W9DA 4YWGG 1NR2A 3OYYA 2PE6B 1HA5A 1D6EC 5JEAG 3EUB2 5JVG3 3AFQA 2PTLA 1VQLA 3U9OA 2NBVB 2JE6I 4ZRQA 1MVKA 4KKJA 2HQLA 3H6MA 3SK4A 2JJQA 1VZ8A 2DHZA 5IGDA 3PT2B 3A33B 1LYLA 2JA7G 3T9LA 4HKZE 2OT2A 2LGDA 3U8ZA 4YL8A 2C35B 2NZHA 5C4HA 4KJOA 4CJ0B 2ASBA 4EFOA 4C80A 1C7YA 1YX6B 3CCUA 4WJ4A 1K28A 4R4IA 2KJ6A 1I50B 2ID0A 2RD0A 4OIJA 1OXUA 3TP6A 1S4ZA 3M4PA 3MWYW 5A35A 4P1BC 4JI8L 4A3IH 2RKSA 1XEEA 1F2ZA 2PW5A 2JK8A 3J80E 4IDIA 2PNHA 5ELDA 1FCLA 2F4VQ 3VR6A 3N1XC 3ZJVA 4LFBQ 3QA8A 3TBLD 3MHZA 3A1QA 5LMUQ 2F0SA 2I1JA 2ZJDA 3DBLI 1TBEA 3DM3A 3TMEA 2EE1A 5E7NA 1N6ZA 2D9UA 1F2YA 3H9DA 4DHZB 2EY6A 3Q8AA 2HIXA 2GI9A 2J7QB 2QKIC 1ZW7A 1E0ZA 5BYQA 1PGXA 2TMPA 1ICFB 5C4XB 2XEWA 3KQ4A 2V4DA 3AEDB 1C9OA 3NOBA 1IW7C 3IKJA 2V0GA 2B3GA 3MHBA 1XLNA 4DR1Q 1N32L 1CK1A 2PPHA 1STYA 3ZJYC 3AM9A 4HIDA 3X0WA 2HCCA 4JI1Q 4YHHQ 1N33Q 1AH9A 2PNRC 4CJ1B 4DV3Q 1BDOA 4L5SA 5LXIB 3P42A 1PLFA 1SNOA 1B7YB 4LAAA 2R7ZH 1OQQA 4R4QA 3DVNU 4QCLA 2IGHA 1VF7A 4LFAL 1UGJA 3PSIA 3AE6B 3J7AV 3EVQA 1BNZA 4JBJA 1GXDC 4YSZB 1YQ3B 3X3MA 1A0IA 4DHZE 3URYA 2OEOA 1WYGA 4PS7A 2D3AA 3PTFC 2JZPA 4HROA 5JHAA 1U4RA 1ZP0B 2N4FA 5E6OA 2LJ5A 5I2XA 2N49A 2BOSA 5JVH3 2NN6I 1STAA 4J15A 4ULLA 2EXZA 4Q2JA 1CA6A 2HTME 2RPQA 5HG2A 2JP1A 5CYUA 1X54A 1LTSD 5C2TB 1DONA 3D31A 3ZNZB 4NXMQ 2J0JA 1TT5B 1M94A 1O7ZA 3TS2A 4WAFA 1ENFA 1PVOA 3T3NA 3S2DH 4BY7B 1MSHA 3E0EA 3S24A 1I35A 4IO9A 4CYEA 1T0YA 3TP5A 2N9EB 2WP9B 5EDSA 1E1OA 3U4EG 3GV6A 3PVLA 4J1MA 1SSNA 1BBXC 4NZLB 1PYBA 4CDEC 2MO1A 1RFAA 4XWTA 5I6WA 2Z6BA 3SHQA 3PIP3 5J22A 2DAJA 2TSSA 1EYGA 2WACA 2W9NA 3H91A 5C44B 5K36G 2LXCA 2EZVA 1Q5WB 2HJ8A 3AMUA 3NZUA 2JA9A 3AU5A 3E0JA 3JAMc 4R8IA 1R4NI 3LDZE 2MPMA 4R9WA 2R7ZG 2DYBA 5IAAC 3NBHA 1TTNA 4GNXA 2O2VB 4CKBA 1F9SA 5HY6A 5DPRA 5ISRA 4N58A 1WR1A 2N1WA 3I4NG 4F1SA 4WJQA 3CQZH 3PUZA 3ZRCA 1C48A 1K52A 1FMAD 2EDGA 4EQOA 3N3KB 4H02A 2JEAI 1XXGA 2K01A 1P1AA 3QG1A 3FAHA 3CIRB 1SNCA 2DAFA 1NDDA 4LJPB 3I56A 4FO2A 4FXCA 1UNSA 4JV5Q 1PFDA 2WU5B 4UPAA 3F1ZA 4IZ8A 1SEBD 1Y8OB 5EKLA 3ICEA 2IO1B 1FIQA 2KO3A 2REXA 2ZZPB 3RD2A 4LFCQ 4IUPA 4MJSA 5L37A 3VHTC 1T0RC 4K14A 4DAMA 2NCNA 1AE2A 1X3QA 3ND8A 4LF6Q 2D10A 3FILA 4GGQA 3I8ZA 3RUIB 2Q2UA 4WQOB 1VQKA 2LGIA 2JXTA 3S14B
chains in the Genus database with same CATH topology
3Q24A 2MJ3A 4XDXA 1TWGB 2N9KA 2EYJA 1OXVA 1ILPA 1RM6C 1Z47A 3H0GB 1N5XA 2NBFA 3SK8A 4F8MA 5EE9A 1HUMA 2KMMA 4HAEA 1SNPA 5I2YA 2H4OA 4JBWA 3BIID 4K5VA 2EYFA 4IURA 5EPKA 1XLQA 5IODA 1YJJA 3I73A 3IT4B 3S1RB 1C4QA 1E10A 5CR3A 5T1GA 1R4QB 4XYQA 3KBXA 2MJ8A 1CQFA 1V1OA 3WCQA 2KHSA 2NVTB 1SE3A 3B2GA 5M3MB 2QJLA 5COYA 1TS5A 5FLXE 1L5PA 4AS1A 2B63B 2LHEA 4RKBA 3P7JA 1PRTB 1V43A 1EIGA 4XQQA 4US9A 3ZJUA 4KV6A 2F0HA 1VZ6A 1K8OA 1N62A 4GDLB 2WINB 1GUTA 1M4VA 5CV9A 2JYTA 2F0NA 5CBEE 2J52A 1WTOA 1S5BD 5IGGA 1KFYB 4PMWA 1LTAD 1XWEA 1WTWA 5M5YB 2KN4A 3LXFA 4A8XC 1EQVA 2KCNA 4PQXA 5C0XJ 4K8IA 2A69C 2L55A 1D5ZC 3A7AB 2QSDA 5KGUA 4CGYB 5EKKA 3BDCA 4K2LA 3X3NA 3GB1A 1E2ZA 5K36H 2KQ4X 4C3JG 3S2DB 1LT6D 2XN9C 3AEGB 2LMCA 3W2DA 4K5WA 3RD4A 4ME5A 2RSOA 4AQ7A 5C5MA 5FLXL 2LUMA 1TVXA 3E5SA 1WTRA 1DJRD 5TSSA 2F0FA 1PGBA 3TBIB 1IL8A 2WIIB 2JXMB 2NUCA 3FDTA 2M00A 1SE2A 3VRBB 4BWGB 2B8GA 2IGGA 1G2SA 3KWVA 1WVLA 2RSNA 1MSGA 3LWUA 3P75A 3AEAB 3ZJTA 5JPMC 3U2SC 3VR5A 3C1FA 4LMQD 5D3DA 5AUKA 1YNJD 2PZWA 4P2CB 5CORA 2A6HD 4H13C 1SDFA 2EOTA 2N88A 1KRHA 1GB1A 1TJEA 1B9NA 4L2YA 4A3FB 2WXGA 3L4PA 4YTPB 1EEID 5T1IA 2E3TA 1RYJA 2NWGA 3TN2A 5CMDA 3NZ3A 1SNDA 3NWTA 4BA2I 3MEHA 3PMFA 2Y5PA 2M56B 2NZ1D 5FKAC 2PIAA 2EYPA 2F0WA 2OF1A 3A7LA 1IYVA 2QILA 2M19A 2LMCB 4US8A 5MPOA 1JMLA 2A68C 4DN4M 2WQYB 4RCNA 2Q5WD 3LYYA 3W5UB 2G9HD 1C4PA 1EWCA 1ROEA 1ET9A 2WXMA 4XTCS 1A2UA 3TEXA 4WFN3 4RHSA 3LWEA 1K51A 2F4IA 2BYTA 1OQRA 3HKZB 5DM63 3DUZA 2WAQB 1FR3A 2IPKD 4TKOB 4ZYSA 1RD9D 1CZWA 1TWHB 3NS1A 1WTXA 5CBAE 2X69A 1IGCA 5ELBA 1FXIA 5M5WB 1WRIA 2JYOA 1B4OA 1KDCA 2BA1A 1LLRD 3HOYB 3AB5A 2HCIA 3Q8FA 1DM0B 4C3HG 4HSPA 3NE5B 5E4XA 2JYEA 2PW9A 3CWIA 5CV4A 2WXIA 3S9WA 1JORA 4A3KB 3D4DA 2GRIA 4TSSA 5KYLA 1I7HA 3QWNA 3QJYA 3RMHA 2O5JC 2FE8A 4KD4A 3AV8A 4LLGM 4JPSA 1L0XB 2E2DC 4C1NK 2EYOA 3E56A 2PPBC 1QILA 1HPCA 3L7ZC 1PTOD 4AYBB 3GTGB 2K5DA 5C3WA 4CKCA 1TWFB 1F0ZA 2K28A 2B8FA 4A55A 4HSVA 2KOLA 2K05A 3K0YA 1ML0D 4UDUC 5LL6X 4RGOS 4KMUC 1Q12A 1UAPA 5AUIA 2G9DA 5CC4A 2F0KA 3EGRA 2Z1CA 5FOBB 1KDBA 3ERQA 1B3AA 2LS01 3MP9A 3GTQB 4RGNA 1SFOB 3DWPA 3PO0A 4GLSC 4A3DB 1DOXA 5KNCA 2DWQA 1D1IA 4HMIA 3TZDA 4ZLTF 4MT5A 2MP1A 4WQMA 2B2VA 2H1EA 5M5XB 2L52A 3T51B 4NDXA 5E6JA 2RQXA 3W5VB 1SNQA 2NTTA 3MAQA 2CQAA 2NYZD 3ZGZA 1H9SA 2Q8IB 3NVZA 2ZXPA 3HOUB 2LFIA 2WXHA 3TSSA 2B2VC 5HURA 1HQRD 4YTMB 1PGAA 1R4PB 2I46A 1ZXIA 3EROA 1Z7TA 3AE3B 4REZA 3DEPA 3Q23A 3KWLA 3NTIA 3IT6B 3Q69A 1FYCA 2KVMA 4I7ZC 3H3VC 3AE4B 4DAVA 3D8GA 2K3UA 4XDDA 1TWCB 2BTEA 4PT5A 1EYAA 2OXPA 4L8JA 1YNTE 4ZOHC 2L9HA 4Z9CB 1IBXA 2ICIA 1JWSD 2A74C 1ZXTA 2M2LA 3AE2B 5BMGA 4OL7A 2IDYA 3K5NA 1IBXB 3AEBB 1ACCA 1FRDA 3AE9B 4A3MB 4TRDA 3NWSA 2BB6A 2YEPF 1FFVA 3LNNA 1MHXA 5KNDA 5D65A 3BVMA 1EY8A 1O78A 1STBA 4K8JA 2QCPX 2KUMA 3NSWA 1VR9A 1IYUA 1C78A 3QOJA 5KYIA 1Y8PB 2VXWA 2BDNA 3P4RB 3A55A 1AZQA 3M3YB 3AEFB 1H9SB 5ELCA 2J53A 1SSOA 2WDRB 4N6EB 1EY9A 1RCVD 3VR3A 3HEJA 3LB8C 3FRPB 3T56B 3S1MB 2EY2A 2KACA 2NN6G 3GTLB 1G2TA 1F9QA 2PVOD 3RZDB 3HGBA 2YYZA 1L0YB 4O42A 2A69D 1KABA 1STGA 5EGTA 5E3FA 1DXMA 1YNNC 3VR9B 5C0XH 3RUZA 4F88A 2SAKA 1PFNA 3R93A 4JX1C 3ZYYX 3PIO3 1J7BA 5D7GA 2K5QA 1ICWA 4WWMA 3OSOA 3OIQA 1PZKD 3OMCA 2MJDA 3BVGA 1YMHE 5NUCA 2JA8B 3AEEB 3T53B 4ILWA 1B44D 2E74C 4OZBA 1K83B 2WXQA 2J0TD 1QWYA 3NP8A 2HDLA 4OZCA 1HQMC 1WTVA 1RTOA 2LJIA 5C5LA 1LABA 5BYRA 3W9CB 4FF1A 3QIAA 1YNND 1W6JA 5C3XA 5CV6A 2IWHA 2ENBA 4Q0FA 2CJOA 1VLBA 1VDZA 3WOEA 4K5XA 1C79A 5BN3A 1WD0A 1AP0A 3GTPB 3WDNA 3EA6A 1R9TB 3PO3B 4IFDG 4HCEA 4XWWA 1LT5D 3TEWA 3CRKC 1H9JA 2FMMA 3AN1A 1C9FA 1G8ZD 1EY6A 3SR6A 2JEBI 3GTOB 3KBGA 3K5OA 5C6AA 1AN8A 5EKIA 5K5PA 4XQJA 1NI3A 3KLRA 4ZK9B 1TU2B 2ICEC 1I4QA 2WKCA 2RDHA 1KNAA 2EYHA 1P7FA 2LFNA 3BDLA 4FP5D 1F9RA 1JROA 3PUVA 2OEDA 1PDQA 1U4LA 3I70A 3MTSA 3ABVB 5FO9B 2EPBA 2HDMA 4CHTB 1G291 2KEEA 4RNAA 5CV8A 4H44C 1CM9A 3RPFC 2ACZB 5D14A 2K6AA 1L6UA 3J81E 5G3LF 3HS0C 3SXHA 4XT3B 4NW2A 3R8BA 1QNUA 1KDAA 1IHZA 3P1HA 3NQTA 1I4RA 1NYRA 1JC7A 1V1PB 5DAUA 4FF2A 3PO2B 3SR1A 1SYBA 2Q8RE 2L1BA 5IT9E 3S15B 4ID6A 2L11A 2FMCA 3HRDD 1BR9A 1EL0A 1EEFD 4NJCA 2KWDA 2GA4B 5CGKA 3VRAB 1AEXA 2EY1A 1WTQA 1BMLC 1FEHA 4NAWB 4DK0A 3MJ5A 3P63A 1JQYD 3V05A 1CT1D 4RGTA 3HOZB 2L1AA 3J80L 4KHZA 2A5HA 2WNMA 3ITPA 5C4ZA 1BUVT 3J81L 5EPJA 2WXLA 1U4MA 1GUSA 5A2QE 4B08A 1ZPSA 1TKEA 3BK1A 5C0XI 1Q10A 2K33A 2L0CA 3SHLA 3MFYA 4E6IA 1QG7A 3KLSX 2B2UA 4U68A 3O13A 5E1FA 1FRRA 3CQZB 2IGDA 1SE4A 4UAIA 1TS2A 2WXOA 4KKSA 1HXYD 1XYIA 4WORA 5KRUA 4OZAA 4CKEA 2SDFA 3V3XA 3DXJC 2W3RA 1JE4A 2EJMA 2LY7A 4BBRB 1PXUA 1DOMA 2D5GA 2C5CA 4CJ2C 3VYSA 3LX0A 1RKNA 2K1BA 4IUQA 2K03A 4KI0A 4K6DA 2E76C 5IGEA 3I90A 1EFID 3OIPA 2D2CC 2WXKA 1EY5A 4A9AA 5DEHA 1RTNA 2FHTA 5CV5A 2XRQD 1ENAA 2QIEB 1PDXA 1IKLA 2A6EC 1QB5D 3T13A 2J7ZA 4MH8A 1SYEA 4ABNA 1GUGA 2PLPA 5BN5A 4P6VF 1E2WA 5JAVA 2F0IA 4ZQ3A 3I91A 4X3KA 3Q22A 1BOSA 4KHVA 1IKMA 5G3LD 1T6BX 2JWUA 1TWAB 1SJED 2MGSA 1I4PA 5JEAJ 3K57A 2K9XA 1MHHE 1TY0A 5KNBA 5A2QL 1PRTD 1QOBA 2JQRB 5C3EB 2X38A 5EE3A 1XX8A 1G6ZA 1B1ZA 2CHBD 2BT6A 3OHXC 2F0UA 1CQVA 3DWAA 1A15A 2K5PA 2M9VA 4F87A 2XSCA 1JOOA 1LTTD 4EQNA 4IKGA 1BXTA 2BDOA 3QB3A 2E2JB 1KF6B 1XCTL 3AE1B 4C3IB 2B2TC 3FMCA 1SF0A 2AWNA 1TYGB 1F77A 4NMZA 1L0VB 1JR0D 1EIHA 1E0BA 2SEBD 1MI0A 2IX3A 4A6QA 4HRSA 1V97A 5IT9L 2LEKA 4RF1A 1OO9B 1P7EA 3PUYA 3IFTA 2EJFC 1DGJA 2BB5A 2AQ2B 1QOFA 3SVMA 1PRTC 3MZ5A 2XIWA 4RGMA 4XDCA 5IGCA 3OMGA 4IUUA 4JK1C 3NXWA 2INPE 2ZW1A 2B2YA 5FO8B 1RWSA 3SK6A 2B2WA 2XVSA 5KEEA 2MEKA 4WIPA 4TQ1A 2R61A 5BMIA 4HTHA 4HMJA 4ZRPA 2JA7B 1Y1WB 2RVLA 1GJXA 1CFMA 3FPUB 3IAS1 1JWBD 5FO7B 5ELFA 1TIID 3GO5A 2PVGC 3KLSA 1E7PB 2KJXA 1Q90A 1STEA 1GB4A 2JSVX 1FNWA 4ZHPA 1FCCC 1S5FD 1XLPA 3R2IA 4G7HC 3GS2A 3K5MA 2F0JA 1RFKA 3MXUA 5D3IB 3VYTA 1M8AA 3S1QB 2W82A 2RBMA 1ZKOA 1UWXA 2K04A 2JX5A 4OO1H 3BVZA 2J42A 1JB3A 1QJOA 3BG3A 2I38A 4EQPA 4XYOA 1KTKA 1Z6HA 1YN3A 3P4SB 4A93B 2K22A 1ILQA 3BYTB 3M7GA 3M7NA 1NAPA 2N55A 3U9SA 4Q5VA 1VRAB 1C4AA 3CKIB 1X3PA 4C56C 2JA6B 3OPOA 5I9OA 3G6JB 5G5GA 2VNUD 2NVQB 3D4RA 5C0XG 1A6XA 1FFUA 1EM7A 1XTCD 4F7XA 3CHBD 1B9MA 1HEZE 4QUFA 4RA8A 1RF2D 1F2MA 4QB4A 4RF0A 1U4PA 2M0AA 3FILB 2Z8LA 4G7OC 1FGBD 4JWUC 4DGZA 3DEOA 4J6HA 4CQNA 3SFDB 1GOZA 1LV9A 1AZPA 1HZ6A 4PMBA 5I4DA 2N7JA 5EPLA 2MUYA 2Q8TA 2I07B 5LHY1 4FF4A 4NAMA 1C76A 2WDVB 1LT3D 2WP8J 2ZT9C 1QQRA 2VB3X 2R92B 5BN4A 1QE6A 1EZ8A 2IJ0A 2BW2A 3MA2B 3IFDA 2NTSA 4I65A 4IUVA 1SB3C 3I4LA 2DN8A 3H8HA 3PV0A 2H88B 2F0TA 4FNFA 1KLUD 1JOKA 4DF7A 5GXGB 4Y7NB 2DNEA 5F2DA 3D4WA 2A6ED 4FYDA 3J7YW 3NRZA 3PUXA 1DOLA 3R2TA 3S2HB 4ITKA 1BCPD 3ONAB 1DZ1A 2KECA 4CBVA 3FPPA 1STHA 2FINB 1FD6A 2EKIA 5DNFA 1C4CA 2L4NA 4P16A 4RWSC 3GP7A 4S3SA 4HN7A 3NQIA 3NPPA 1CA5A 4KX6B 4EE2A 2D62A 1W6KA 4C3JB 4QUCA 1E2VA 2B76B 4HR7B 3EQLC 2L32A 2EJGC 1PMRA 3ZQ4A 1L4DB 1K50A 3CU7A 4KD3A 2F3VA 3HVZA 2NN6H 1UEAB 2XRSD 1FNVA 3NVYA 2E2IB 3FVQA 1D5XC 5JPNC 1C8CA 3RLFA 1GAQB 2ON8A 1JWAD 4ZKCB 4C7YA 2B2WC 4KGTA 3Q6SA 5LNK1 1TS4A 4PNYA 2BS3B 3NUHB 2F0DA 3C3LA 3E9SA 3K58A 4DFAA 2L12A 3Q8BA 4O1NA 4K6LA 5EE0A 4ZRZA 1F2LA 4ARCA 3WOFA 2EYLA 3S17B 2QEJC 1GHKA 4LK0M 1XO3A 2RMMA 1F2RC 2DNCA 5I9PA 3T3OA 1HFGA 1SYDA 4FXKC 4EVOA 3E6ZX 2R3ZA 4DXGA 1PZJD 3GD7A 3L3OC 1CZGA 4ARIA 2KCCA 5C4JB 4JWSC 2F1MA 5LL6S 1VDVA 3NTHA 4LTUA 4MHEA 1YQ4B 1ENCA 4C3IG 2WXPA 1G91A 3FC4A 1K53A 1MBYA 2W3SA 1WWTA 1STNA 1YN4A 2AUJD 1JWUD 1MGSA 2WXNA 1V8CA 2F0EA 1KNEA 3P1MA 1BCPC 2NMQA 2RPVA 5IGFA 5J1ZA 3GTKB 1OFFA 1RODA 2WXJA 3OWEB 4ODGA 2DY8A 2C9OA 3H09A 4YT0B 4BY1B 2L5TA 5EJWA 2LHDA 3VR4A 4X3TA 2IT1A 2AQ3B 3N6RA 1Y69U 1PZID 3VR8B 3H94A 1BCPF 2K7VA 4ZKBB 3F2UA 2KQ3A 1XF5L 2RDFA 4C7ZA 3GQBA 2EY5A 1J9OA 2FUG1 2WXFA 3S16B 5FR3A 1NENB 2F03A 2NVYB 3NTKA 4ZUJA 2E2HB 1A2TA 4QMGA 2DYMA 5EE1A 3DWGC 5KIXA 2B2YC 3SFEB 3N52A 4HEA1 1E6EB 1JW9D 3SDZA 4OO1G 5H92C 2WV6D 1TT2A 4C1NI 1MI2A 1GUOA 4BA1I 1FNUA 2PO4A 2I2YA 1L6VA 4R3DA 2QF7A 5M9OA 3BK2A 1Q3LA 1CHQD 3C2PA 3AECB 1SMYD 1JICA 2GB1A 3AE7B 1KH0A 4OGQC 2PQEA 3A56A 3K6OA 1NYQA 4IALA 5HHDG 4V190 3TEZA 4QIWB 4A3JB 2JA5B 5EBDA 4H7BA 4NP5A 4N9PA 4DA2A 1S5ED 3DWQA 1SYGA 5BYSA 2CW0C 4C3HB 2CU3A 1IW7D 1QNKA 3MVVA 2V3NA 4M0WA 5C3JB 1KLGD 1LTGD 2F0VA 3HG9A 2PKOA 2L83A 3DMUA 1HRJA 2WU2B 1QKZA 2AQ1B 4BS9A 1SAPA 1PTOH 1HA6A 3N9YC 3W3AA 1DYQA 2VB2X 2AX5A 1D5MC 2WB1B 5JOBA 1ONLA 1SNMA 4LK1C 1K8MA 4OO1I 1QLBB 1LO5D 3M4YA 1ZE3D 3QO2A 1EY4A 1U9RA 1J7AA 3QOLA 4KY7A 1QOGA 5E4WC 2EVBA 1I4XA 3IAM1 4YTNB 1F2RI 1FXAA 2NB0A 4TQ0A 4J8QA 4KN4C 3IXSA 2O4XA 3KK7A 1EYDA 4BBSB 3HUIA 2E6XA 2V4IB 3AU7A 1N61A 2K32A 1OXTA 1EU3A 2BE5D 2LKVA 3J7AF 4YXDB 1WD1A 1HHVA 3UI2A 4X3UA 2MHVA 3TEYA 3Q8CA 3NVWA 1SYCA 4KKIA 1B53A 3C1EA 4L23A 3GTMB 1ZUD2 1LT4D 4L1BA 1NEKB 1PFMA 3MXPA 1EWHA 2O5IC 4KY5A 2VUMB 3T16A 4QF4A 4A3IB 3M4OB 4IFDJ 2NVXB 1SMYC 1GHJA 3MC0B 1YN5A 2F0LA 1O80A 1NUCA 1AYFA 2ONQA 4J3OD 4N59A 2A68D 1TKWB 5AFWA 2RA4A 3L9AX 1HTLD 3PUWA 3P4QB 1GPXA 3OW7A 4A90A 3BDOA 4PMCA 4IN3A 2R6GA 3K5LA 1YJIA 1XLOA 1B9RA 1EZ6A 2XNAC 2BS4B 1A70A 4L6TB 1EQTA 1QT9A 4HEDA 1N63A 2X6LA 3AE5B 5HGTA 5IGBA 3GTJB 1WSPA 3I9V1 1SBBB 4OHJA 1NR4A 3W1SA 3OOCA 1DOIA 1NCVA 4DAYA 4KKUA 1IGDA 1EWYC 1IUEA 2MH7A 1YNJC 2N0SB 1PTOF 3G7LA 4D2KA 2DYOA 4LJZC 3BS1A 3RFZB 1N60A 3JAME 1OXSC 3HRZC 1TKYA 2WXRA 4KN7C 3C46A 1H9KA 3BWUD 2INNE 1Y56A 2E75C 2BA0A 4IQZA 3PZ7A 1PUTA 3MFGA 2IW3A 3D3RA 4DXFA 1H9RA 3JAML 2BS2B 2F0PA 4KTAA 4RH6A 1PTOC 4K2KA 3TZUA 4ZHOA 1DCZA 3U52E 4YSYB 2Z4HA 4GDKB 2CJNA 5IIFA 1SJHD 2FFKB 2KDMA 4MACA 4B0MA 3BYYB 2PZTA 1HCZA 1LTBD 1S5CD 4MIUA 1I6HB 3OWFA 1ZYRC 3CRLC 2WS3B 3SK5A 2ZXOA 1CZPA 4N9TA 4EGVA 3EFXD 1J7CA 1T5EA 1ZOYB 4RHRA 4KGRA 2H89B 2CW0D 1JALA 3I4NB 1D2BA 4DAPA 4H0LC 5J39A 1VMPA 2QMTA 2OHFA 1BO0A 1PYWD 2BCOA 2SOBA 3FKIB 2VZKD 1GUNA 2IX0A 2Z4IA 1BQQT 2G1EA 1I4GA 3HVDA 2W55A 3P20A 4HCSA 1B50A 4IFDI 1BUIC 1TS3A 2FJ2A 1VF5C 2WLBA 3GV3A 2PCFB 1GUWA 1WXQA 4FVMA 2AWOA 1JRPA 1KAAA 4G7ZC 3IAYA 2IX1A 1ESRA 1N5WA 5IOCA 1PFBA 4RFBA 1H9MA 2KA7A 2DLBA 1I6VC 1T3QA 4HJGE 1FD7D 1V8QA 3TP7A 2PMVA 1AFPA 1JCKB 3UI3A 4M8AA 1F9PA 3I72A 1ET6A 2F0MA 3A8JE 1Y8NB 1VZ7A 1ZYRD 1B2TA 1C77A 4V0BA 1ESFA 2WDQB 1AWDA 2K0PA 4B9WA 4G4KA 4JE3B 3S1NB 3PZ8A 1VCIA 1Q1BA 4DNRB 2PW7A 1QCBD 2AUKA 4B0EA 2KAJA 1HUNA 3HZXA 3A8KE 4A3EB 4G57A 5I6YA 1RDPD 1VJKA 1J8IA 2CVRA 1TQOA 1ZDVA 1CI3M 4FXGC 1A3UA 2K5WA 4YSXB 2PZUA 1MPEA 3Q0AA 5DM73 5G5HA 2JSOA 3VQIA 1PTOB 3A8IE 3V96A 4DK1A 1DOKA 3DWMA 1CHPD 2B2TA 5FK9C 1ZEQX 4USAA 2PMZB 3EJIA 3VR2A 4TQUS 4NKLA 1NSNS 1V1PA 4WURA 3U7ZA 5BMHA 3K7AB 4OW0A 1ZDXA 3Q8EA 2O2LD 1QF6A 3I4MB 1HFNA 3AB9A 3MXNA 1LTID 4IUNA 3RZOB 5M3FB 4FXDA 1SXTA 4WRDA 2WKDA 2Y3AA 3TUOA 1O7YA 1ZXHA 3KUPA 1O7LA 4IOIE 2BBCA 3C8YA 2B2UC 4RKLA 1FM0D 3AE8B 4RAUC 4WH4A 2SNSA 2D5DA 1PRTF 1X32A 4M1UB 3VYUA 3VYRA 2F0QA 2R93B 1UUPA 4RCOA 5JJZA 2V3PA 3BZDB 3MXGA 4U673 1QOAA 1I3QB 5CV7A 2DY7A 2ZXRA 2A73B 2VZKB 5H8YE 4IUTA 3NHHA 1A3TA 3AMZA 3NUCA 1LACA 1SYFA 1UWMA 2DBYA 4R8NA 4GZYC 1EOTA 3D6WA 2B39A 2BE5C 5ELEA 4ZUIA 3DM1A 2YEPB 4DU9A 4OVZA 4HKQA 2IL8A 2Y0SB 3J9CA 3R3OA 1DD2A 3AH7A 4KY6A 4PV1C 1BCPB 3I3CA 5JXVA 1T5XD 1QOHA 1I4HA 2F0OA 4IFDH 2JU6X 4KJNA 1CTMA 4KK7A 1EY0A 1DOYA 1LTRD 1TY2A 3NK9A 3K59A 1R7SA 4OIKA 1OXXK 2X6GA 1HZ5A 4XXEA 1HTPA 2N9LA 3FEWX 3D6CA 3VA5A 1JWMD 3HP3A 4KKTA 5HI1A 3ETRA 1D1KA 1RJTA 2XWBB 4XIGS 5EBCA 2PYKA 3ND9A 2Y5CA 3NBIA 3T4AC 4XQNA 4DQOC 3M85A 2MJEA 5EQ0A 2HQEA 1RHPA 4ZAIA 1VMCA 4MM3B 5T8IA 5HFYA 4FF3A 2KEDA 1EY7A 1CJEA 1WCMB 4X3SA 3TP8A 1JOQA 1S5DD 4XE0A 1BF4A 4B9XA 2RDGA 4DNTB 1Q1EA 5JEAH 3HOWB 3VA7A 1WTPA 3NVVA 2ZW0A 4C2MB 1SIJA 4MN3A 1TZOA 2J4XA 1WGKA 2HDEA 4TMAB 1EYCA 3A54A 4WJWA 2W54A 1II3A 1Y1VB 4H2AA 1L4ZB 3HOVB 2XWJB 2FBWB 1FO4A 1TKGA 3B2FA 3SE0A 1MD2D 2YU9B 3HOXB 1AW7A 3P4PB 2QDBA 1E9MA 3KF8A 2F0GA 3V2TA 4KGSA 4YIJA 1TR5A 4A3BB 2HUGA 2V0GA 1A3VA 3IL8A 3TDQA 2F3WA 2R7ZB 1Q8IA 1XCQL 2EYMA 2SNMA 3SEBA 4A3GB 4L63B 2EELA 2A6HC 1D4BA 1JQ4A 1EU4A 4XT1B 3I57A 3B9JA 3DHQA 4YWGG 1NVID 1NR2A 1HA5A 1D6EC 5JEAG 3EUB2 5JVG3 2PTLA 3U9OA 2JE6I 4ZRQA 1MVKA 4KKJA 3H6MA 3SK4A 1VZ8A 5IGDA 4HKZE 2OT2A 5C4HA 4CJ0B 4C80A 4KJOA 1I50B 2ID0A 1OXUA 4OIJA 3TP6A 1S4ZA 3MWYW 5A35A 2RKSA 1XEEA 1F2ZA 2PW5A 4IDIA 3J80E 1FCLA 5ELDA 3VR6A 3ZJVA 3MHZA 2F0SA 3TMEA 2EE1A 2D9UA 1F2YA 2EY6A 3Q8AA 2GI9A 2QKIC 1E0ZA 5BYQA 1PGXA 2TMPA 5C4XB 3KQ4A 2V4DA 3AEDB 1IW7C 3IKJA 3MHBA 1XLNA 1CK1A 1STYA 3AM9A 2HCCA 2PNRC 4CJ1B 1BDOA 3P42A 1PLFA 1SNOA 4LAAA 1OQQA 4QCLA 2IGHA 1VF7A 1UGJA 3AE6B 3J7AV 3EVQA 1BNZA 4YSZB 1GXDC 1YQ3B 3X3MA 3URYA 2OEOA 1WYGA 2JZPA 4HROA 1U4RA 1ZP0B 5I2XA 2BOSA 5JVH3 2NN6I 1STAA 4ULLA 4Q2JA 2EXZA 1CA6A 2HTME 5HG2A 2JP1A 5CYUA 1LTSD 5C2TB