2IJ0A

Structural basis of t cell specificity and activation by the bacterial superantigen toxic shock syndrome toxin-1
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
191
structure length
191
Chain Sequence
DNIKDLLDWYSSGSDTFTNSEVLDNSLGSMRIKNTDGSISLIIFPSPYYSPAFTKGEKVDLNTKRTKKSQHTSEGTYIHFQISGVTNTEKLPTPIELPLKVKVHGKDSPLKYWPKFDKKQLAISTLDFEIRHQLTQIHGLYRSSDKTGGYWKITMNDGSTYQSDLSKKFEYNTEKPPINIDEIKTIEAEIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Toxic shock syndrome toxin-1
publication title Structural basis of T-cell specificity and activation by the bacterial superantigen TSST-1.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Protein binding
total genus 47
structure length 191
sequence length 191
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2ij0A02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2ij0A01
1V1OA 1S5DD 2RDGA 2AQ3B 4RH6A 3O13A 1TS2A 1FGBD 1B44D 1SEBD 1I4PA 1SE4A 3R2IA 4K6LA 1EEFD 3MFGA 5D3DA 3CHBD 4UDUC 1EU3A 1KLUD 1FD7D 1JWMD 1SBBB 1YN4A 1FNUA 1S5BD 1FNVA 5ELFA 1PZID 4BWGB 1XXGA 1TS4A 1UNSA 1HA5A 1YN3A 2G9HD 1JQYD 2IPKD 2QEJC 1BCPD 1CHQD 1BCPC 1BCPB 3TSSA 1RCVD 4C56C 1D5MC 3R2TA 1GOZA 1HXYD 4RGOS 1RD9D 4NZLB 3KLSX 2XN9C 1CT1D 1LT6D 3EA6A 4RGMA 1LTRD 1L0YB 3MC0B 1EU4A 1PZKD 1MD2D 1L0XB 1PTOD 2XNAC 3URYA 1YN5A 2ICIA 4OHJA 1BXTA 1DJRD 1JWUD 1D6EC 1TY0A 2AQ2B 1V1PA 4RCOA 1BCPF 2Z8LA 1LTSD 4ZYSA 1DYQA 1RF2D 1TS3A 1ENFA 1RDPD 2CHBD 5I4DA 1LLRD 1G8ZD 4RHRA 1JR0D 1PZJD 1LO5D 2AQ1B 1S5ED 2J4XA 1ESFA 1I4QA 1I4XA 3OWEB 2RDHA 1KTKA 1LTBD 1EWCA 5ELDA 1PRTD 2XRSD 1PTOC 1S5FD 1PRTB 1M4VA 4Z9CB 3W2DA 3BYYB 5D3IB 1CHPD 1ET9A 1PTOB 5FK9C 3V05A 1D5XC 1XTCD 2NTSA 2XRQD 1EFID 3BVMA 4DXGA 1D5ZC 1CQVA 1LTGD 2IJ0A 1TY2A 4TSSA 3BVGA 4RGNA 2O2LD 1QILA 5ELCA 1ET6A 4O1NA 1T5XD 1LT3D 1JWSD 1PRTF 1JCKB 1LTTD 1B1ZA 1UUPA 1PTOH 1SE3A 1PTOF 1AN8A 3DWPA 1LTAD 1LTID 3BZDB 1AW7A 4L63B 5FKAC 2NTTA 4RGTA 1KLGD 4RFBA 1V1PB 1FNWA 5ELEA 1HQRD 2QILA 1EEID 1HTLD 1PRTC 1S5CD 1SE2A 4DXFA 3BYTB 1SJHD 1F77A 3R8BA 1CK1A 1TS5A 3DWAA 1STEA 1SJED 2TSSA 1I4RA 1LT5D 1SXTA 1I4GA 4RHSA 2R61A 3EFXD 3GP7A 1PYWD 5TSSA 1I4HA 1LT4D 3DWQA 2WV6D 3BVZA 5ELBA 3SEBA 4L6TB 2SEBD
chains in the Genus database with same CATH superfamily
2BYTA 1MG8A 2MBBB 2PVOD 1XLPA 1GKHA 1B44D 2XBBC 2MQJA 1TWCB 4BA2I 1C4AA 2D07B 2N1VA 2JA5G 4BY7H 1EEFD 3A7AB 4NXMQ 2J53A 5C3EG 4ZHPA 3P4PB 3A9JA 1EIGA 2JYEA 3V3XA 2FHTA 4JI8Q 4B0EA 1FNUA 1C7YA 1S5BD 1BUIC 1HR0L 4CYEA 2Z1CA 4M01A 4XDXA 1HZCA 1N34L 4IOAA 4MJSB 3VHTC 3I73A 4NDXA 4OELB 1Y1WH 2REXA 2RSUA 4JX1C 1J5EQ 4LF5L 1FXAA 2PI2E 1SNQA 1YMHE 3Q69A 4OWXB 1EF5A 1FVIA 4DF7A 4JQWC 3CCQA 4KVGB 3VUXA 4GIVA 4EOYA 3B6YA 1XCQL 1E9MA 4NZLB 3GV3A 1L6UA 1EU4A 1HH2P 1GAQB 2N7JA 4IPCA 2G45B 4WJ3M 2SNMA 3S14H 2E2JH 3A1QA 3APFA 4CQNA 4II3B 3CAMA 4BS9A 1PDQA 3NTKA 1L2NA 3VR9B 2F1MA 2KWVB 5KEEA 4ZLTF 1VQPA 2KMMA 1OXXK 1DYQA 5LMUQ 2NCNA 3ALBA 2W3SA 5LMNL 2Z4HA 1OTRB 3NUCA 1SYCA 4DV4L 1XMQL 1QOGA 4B08A 1FL0A 3OPOA 1Q90A 2MBQA 1TYGB 2WGSA 2OOBB 2RSOA 4MH0E 3W1SA 4QUCA 4IPGA 2AQ1B 4P75A 2JUOA 3KUPA 1OEYJ 2JY6A 3HRZC 1MHXA 2E76C 4KHPL 1BT0A 2R2QA 4KKJA 2RDHA 3W1GA 5HGQA 5A35A 3AEBB 4JC0A 2N88A 2BCOA 4A76A 3I57A 1MKHA 4G4KA 2JA8G 4C80A 4PS8A 3A56A 4M8AA 5IGDA 1S5FD 2BKRB 2GRIA 1Q46A 2Y0SG 3T4AC 2I5MX 5IYDG 4B6WA 1RRBA 3MHSD 1SNPA 4IWQA 4KLKA 1CSQA 1XCTL 1HNZL 4DUYL 2K1BA 2C7HA 5FLXc 2GBJA 1XX8A 4JE3B 1A2UA 2K5HA 2PMZB 4X66L 1CKNA 3U58A 1N36L 2IGHA 3QIJA 1ZKOA 4O1NA 1UD7A 1GHJA 1HZ9A 2EYPA 3STBD 3W3AA 2BE5D 1FYCA 1VDVA 2KDIA 1U4MA 2ZXRA 5IWAQ 2O2VB 1AN8A 3H0GB 2KQ3A 5CYUA 5C4ZA 4GNXC 5EE3A 1XF5L 2NTTA 1IBKQ 4RGTA 4DV1Q 1KFYB 1WE7A 1XQQA 2VW9A 3AEDB 3S1NH 1WXAA 2QILA 1QWYA 1IP9A 1GNUA 2F0QA 4ZYNA 2A74C 3F2DA 4GDKB 5BYRA 4H44C 2B2UA 2UXCL 3S9WA 4IN3A 2UWQA 1G2SA 3BK1A 3M4OH 1MI0A 2FCQA 1A5RA 2R92H 1AYFA 5AUIA 1QOHA 1CSPA 4KMUC 1CZPA 3PT2B 1HFNA 3ZQ4A 2Q2IA 1HTOA 3VH3B 2EJMA 2JK8A 3PO3G 4GSWA 3PQIA 3LWUA 2ZT9C 2HTME 4N6EB 1AE3A 3N30A 4CDFC 2LXKA 1X3QA 2BE5C 3STBC 1HUMA 4X65L 1UEAB 5D65A 2LY7A 1GM5A 2KOXA 4MGZE 4MHEA 1IBLQ 1RTNA 3GTLH 4A3BH 4A3CG 3SFDB 4RH6A 3AMZA 3Q8EA 3SR6A 4BKGA 2MO1A 1MVKA 3ULJA 2L0CA 4RM8A 5C3EB 2MHJA 3I72A 1Q10A 2F0FA 2GBNA 3PLUA 3PTFC 4H2AA 1Z47A 2KLGA 4FN2A 2PTLA 3PIPA 3UDFA 2ENBA 2ACZB 1VQLA 2AL3A 5M5WB 5EKKA 2D3BA 3IXSA 2M0XA 5AJ3L 3IG3A 3QWNA 1UE7A 5BN4A 4DR1Q 3GTPB 3A9KB 1MIUA 4JBMA 1SIFA 1A6XA 4EZLA 1G6ZA 1C3TA 1BCPC 4WQOB 3NVYA 3TS2A 4JW0A 1FCLA 5FLXL 3V6EB 1YVCA 2XTIA 3RLOA 1RCVD 1YHBA 4JI6L 2GI9A 3ZDTA 1GOZA 5EPKA 5BN5A 1WTWA 4LFBL 4JLCA 5EQ0A 3AU7A 4KHVA 5AZGA 3UQAA 3EA6A 4GB9A 1KABA 4BXXH 5CV8A 2WP9B 3DUZA 3K6OA 3E0JA 5I6YA 2K52A 1BXTA 3J7ZC 2G3QB 2DNEA 3M9BA 1FRDA 4JG2A 1I7HA 2IO2B 2K1FA 3EFCA 4B3MQ 4JI2Q 3J7YW 3L0OA 2Z8LA 3QB3A 1TKYA 1GUSA 2KCTA 1F9RA 1Y69U 1NVID 1JALA 1RDPD 1GVPA 2PW5A 2IT1A 4O2DA 5KYLA 5H1SE 4XQJA 4B9WA 5C44H 3EECA 3RUZA 4LDTD 1XT9B 3QJYA 2C5CA 4GLXA 1TR5A 1QUQA 4FO2A 2YTYA 4IUTA 3KW5B 2NUCA 4PG3A 2J4XA 2ES2A 3S17B 4PQXA 4F8MA 3ZO5B 2ZCBA 1O7LA 2PCFB 5JOBA 1L1OC 2CU3A 4EQ5A 1S72A 3A9JB 3DHIC 3W5VB 1FJGQ 1Z2MA 4JOIC 5C0XG 3ZJYC 4I65A 2KQ7A 2WX1A 3RN9C 3NENA 2NMQA 2L9HA 2B2TA 1PH6A 1XTDA 1YNND 2WDRB 4DR4Q 3DPDA 3AE7B 4HSPA 2YYZA 2LD9A 3HOWG 4L5TA 3AQQA 1KHIA 4X64Q 4RGNA 1VQ9A 2H88B 2NBWB 4C7ZA 1QZGA 1K0SA 3B08A 3EGRA 2WKDA 1Y1VB 5G3LF 1PYSB 1KC8C 1FO4A 5IGCA 4DNIA 3MJWA 2DX5B 3CF6E 2DBYA 1XJVA 3NY5A 5IT9c 2IHFA 1SF0A 3GTKH 4KX6B 3TBIB 1SYGA 5M5YB 1UBQA 4C2MB 1WR6E 3DHGC 3A1QB 3L08A 3TEXA 2BA0A 2RCNA 1Q1OA 3K80C 4KKSA 4OO1I 3Q6SA 2F03A 2K25A 2E8GA 3EVQA 3U9SA 4GN3B 2PPHA 2I46A 2EYMA 1WVLA 3ZTCA 4F8CB 3X0WA 3J81j 4GOPA 1IZ6A 1YNNC 4FF4A 3CCJA 2H1EA 3TP7A 4CJ2C 1WGRA 2FFKB 1WRDB 1CK1A 1E2VA 3GOEA 1TS5A 1C8CA 2OWOA 2L32A 3M7NA 3P4SB 1KF6B 3TMPB 4C7YA 3JAMc 1WGKA 2INDC 4OWWB 3PO3B 1TWCH 2B39A 3Q8FA 3S24A 2EVBA 2M9VA 1XLNA 1YNTE 2WB1G 2R61A 1EOTA 1PYWD 5E6NA 3TEHB 4D2KA 5L95C 1IBMQ 1WTXA 3V61A 2YEPB 1Q12A 1S1QB 3PSIA 1PUTA 2ZM6Q 4XT3B 4C00A 3AB9A 1CKNB 1XEEA 2LRWA 4MM3A 3ZW3A 3FMCA 4KY7A 1XWEA 4A93B 3L3OC 5G5HA 4WJWA 2K3UA 5ELFA 3CCEA 4K81A 4X3KA 1H4RA 2RHQB 1VQDA 2R7ZH 2VH1A 4DV3L 4AQYL 3IBEA 5L37A 2KAJA 4ZUJA 2LASA 4JI0Q 4DV5L 3TSSA 2ZVOA 1HZBA 1T9HA 2HDMA 1VQBA 4KV6A 4YHHL 4JPSA 1HZAA 2NS5A 4CHKA 4IOCA 1ZGUB 5KGUA 2N1WA 5CBAE 5IGGA 3C0RB 1F9JA 1L7YA 3VR3A 3AN1A 1PTOD 4HAEA 4KKTA 3T13A 1XPRA 3Q22A 2LHEA 3F1ZA 2DENB 2JP1A 1L5PA 5J18A 2A68D 4FF2A 2KMCA 2L12A 2L52A 4W9HA 1IXRA 4ZYSA 5IT9E 4R8IA 5EBCA 2VQFL 1CA5A 4BY1G 1TZOA 3GB1A 1LV9A 5I9PA 1EWIA 2WINB 1RHPA 2CHWA 3U8ZA 1TWFH 2PKOA 4GDLA 4HPLB 3VA5A 4C3JB 4C3HH 1S5ED 3WWVA 5C3WA 2PIAA 1AFPA 2WXQA 4DV2L 2IY0B 5DM73 2BT6A 4PMCA 5HI1A 4BFRA 4Q5VA 4ZDVA 5FR3A 3KLWA 3P20A 1VQKA 3C3LA 2NZOA 2Z6KC 2LJIA 3VA7A 1N60A 3PV0A 1SFOB 4YWKA 3TP8A 5CC4A 2UYZB 1UWMA 2UUBQ 1PTOC 3RCZA 5IP7H 4A3EG 1N9WA 1VQOA 3V05A 2KBNA 4HJ9A 4ZRQA 4BBNF 3JAME 3Q3JA 1D5ZC 2ID0A 2PQEA 1IW7D 4BZAA 4YSXB 5C3JB 3T3NA 1P1AA 2A68C 4IPHA 5IYCH 4DR2Q 3E6ZX 1WD1A 1QKZA 3RNFC 3DMUA 4EVOA 3VYRA 5BMGA 2OJWA 3T1YL 2D62A 3UDIA 1C4QA 2NBVB 1SYDA 5JPMC 3F2CA 1T5XD 1LT3D 3I4MH 4ICVA 1JWSD 1PRTF 1JCKB 1QOAA 2JPHA 5IN7A 2BQQA 1EQTA 3N20C 4JWSC 1L4DB 1ML0D 2IY1B 4FDBA 1KXLA 1J7AA 4KJOA 3A5UA 3QG1A 2LXJA 1M94A 4HN7A 3Q3OC 1BOSA 4WH4A 3ZKJC 1S5CD 2A5HA 3TEWA 3K57A 1PH7A 4QMGA 4S3SA 1I3QB 1FGUA 2RPQA 2EOTA 4S17A 1QUQB 1IW7C 1S4ZA 1AEXA 2LUEA 3PV1A 2JSVX 3AE1B 4WWMA 2Z4IA 4A3JH 2MP2A 3VYSA 1OTCA 3BDOA 2TSSA 4CJ1B 5GAGC 1SSOA 1EQVA 2L00B 4P16A 2WB1B 3ZNHB 2Y3AA 3S16H 1BR9A 3I4NH 1QG7A 4ZHOA 1YNJD 5ELBA 5T1IA 4K2KA 4BOSC 3I5JC 5CX3A 5J39A 3GV6A 1QVCA 1N8RC 1HRJA 5COYA 3NJTA 1JWBD 3ENEA 1TS2A 2CQOA 1QT9A 4LW1A 5E4WC 4IWOA 4RF1A 4B3TL 2VXWA 2F4VQ 4A3MB 5D7GA 4L8JA 2I1KA 3H15A 1TTNA 4FP5D 1E8XA 4FLHA 1WTQA 3NBHA 1J19A 2KVMA 2KJRA 1SBBB 1Y14B 1YN4A 4BBSB 1K28A 4JL9A 3RMHA 3OG5A 2Q5WD 1XXGA 3RULA 4PS7A 4QGUA 5AZHA 3T51B 4GKKQ 3GDEA 1VQCA 1I50B 1H9SA 4ZK9B 1XLQA 4P1CC 3BINA 3SXHA 3M63B 1GUOA 4KHZA 3B2FA 4DK5A 4PZ6A 2D3GA 1YNJC 4HR7B 2EY6A 1JJ2A 4GOPB 1L0YB 1PZKD 1BDOA 2D5GA 1L0XB 1P16A 2Z0SA 1B70B 2RQXA 4DGZA 4IFDJ 2DAJA 2FCMA 2KO3A 4TMAB 3FKIH 1EM7A 1W6JA 4WJ4A 2LGIA 1EYCA 4GNXA 5EE9A 1D6EC 1BUVT 2FXQA 2E2IH 1SIJA 3S1RB 3ML9A 1K8AC 3QWZB 2KT7A 4MT5A 4WJPA 3CRKC 1IL8A 1A8VA 4UAIA 4DAMA 3OW2A 1E90A 2B8FA 2FCNA 4L1BA 4DR3L 1F2MA 4APVA 3P42A 4UPAA 1YITA 2LGYA 4TKOB 2FIFA 4WJNA 3CF5A 5JVG3 1STBA 2JZ3B 4NJCA 5GROA 1IGDA 2WHIA 4DV0L 1Q8IA 2R92G 4J3OD 3RLNA 1PGXA 2BKFA 4N58A 4IUUA 1EWYC 2WNMA 1ENAA 2DWQA 2D3CA 2B2UC 4MM3B 4HJ5A 2D2CC 4WAFA 4YTMB 3H91A 4RWSC 2ICEC 3AV8A 1KH0A 1E2WA 4JIOU 5D3IB 1T0QC 3A4SC 2WU5B 4K3BA 2XRQD 3BVMA 5IE8A 3I56A 3NZSA 1E7PB 5D6JB 3NEMA 2PVGC 4Q2JA 4CJ0B 1AZPA 3N1YC 2NVYB 2IY5B 4OXPA 2CCZA 4A3LH 1A15A 5ELCA 1XYIA 1TU2B 4U673 1KLVA 2EY5A 2LXCA 5I2XA 2EQSA 2E2HB 1YQ4B 5G5GA 1KDCA 4ZQ3A 1UUPA 2WXNA 1B1ZA 2HUGA 1YJ9A 1X65A 3UIOB 2EPBA 2IW3A 3OTOQ 3BZDB 4J1MA 1F2ZA 1ENCA 2FE8A 4XWWA 2GMIC 1KDAA 3Q23A 4TQ0A 4DPGA 1F2RC 3ZGZA 1JQ4A 3ULPA 5IP9G 1W3SA 3BYTB 4C3IH 1VZ8A 2KMAA 3R7RA 2VL6A 2DZIA 1ONLA 1KQSA 3KQ4A 1ZXTA 1STNA 4GDLB 2IDYA 5FOBB 4GZYC 3RFZB 1UZXB 4L5QA 3CCRA 4GKJQ 1D8LA 2ZZPB 1I4RA 1WXQA 2DZKA 3J80c 2KFKA 1X3GA 2B76B 3N32A 3KH0A 1SXTA 3DEOA 4RHSA 2J0MA 1JW9D 3AE9B 3LX0A 1I4HA 3L9AX 2YU9B 3SEBA 4A93H 2EZVA 1HFGA 2IHEA 2A6ED 4KKUA 5FO9B 3CCSA 4DV6Q 1PH2A 3RZOH 3L54A 1U5KA 3J81E 1IGCA 4YCVA 1JWAD 2Q8RE 3HKSA 5J22A 2VZKD 4U68A 1NBFC 2K0PA 3RLFA 5JEAH 3DDCB 2BB5A 1H8CA 3NTIA 5IA7A 1XNQQ 1L1OA 3QARA 1V2YA 2UUCQ 2DUDA 1AE2A 4V0BA 5CV6A 1IUEA 5C23A 3RNBC 4JOIA 4XYOA 2NPTA 2MJDA 1JQYD 3U50C 5T8IA 1Y8PB 2Y5CA 1KNEA 2JX5A 3VDYA 2OXPA 1E7VA 1YOVB 1CTMA 4P71A 3U4VA 1HXYD 1WM2A 4NAMA 3G71A 2D10A 2B2TC 4QCLA 2KC2A 2QA4A 1V9JA 2A6EC 2HIXA 4GN4B 2LJ5A 2WXFA 3CW2C 2R93G 2MP2B 2Q2UA 3VTWA 5NUCA 4HROA 1YIWA 1RFKA 1YJWA 2K01A 2LGDA 2LFIA 4JI5Q 3RUIB 3QX1A 3A8JE 2V4LA 1MG4A 4XDCA 2WAQG 3LNNA 2N55A 1F9PA 4LF4Q 2NVTH 3PO2B 2MCNB 1HR0Q 4QIWB 4X62L 3GTJH 1N34Q 1UELA 2KANA 2KN5A 3PZDA 2KK8A 4AWJA 3K8AA 3QA8A 2WWZA 3P1HA 2CH4W 4GOPC 1EWCA 2LWPA 2WDTB 1C79A 4ILWA 3NBHB 3HOUB 3PREA 3C8YA 2PW7A 1CZWA 2F4IA 4ZRJA 3FDTA 4LUOA 4YWGG 3ZUNA 2HD5B 3Q0AA 1EFID 3CMEA 4A9AA 5C4XG 1F2YA 1TY2A 3RR5A 3J80E 5JJIA 3DWGC 1H9SB 3E9SA 3B0AA 2N49A 1E6EB 1WFYA 3OYYA 4UP9A 2WXMA 2L5TA 4TKNA 2V4DA 4LJOB 1WRIA 2DAFA 2AX5A 2B2WC 1B53A 3AEFB 3GTQH 2CHZA 4NNJB 1ILPA 3NWTA 3BG3A 5IY0A 5J1ZA 2WDVB 2K5NA 2VS1A 1NE3A 2I07B 4HJ7A 3TMEA 4JWUC 4C4VA 3K7AH 4NW2A 4GLVB 2W54A 2AUKA 4OX9L 2MNAA 4GNXB 1XMQQ 4KDLB 4AQ7A 3P4RB 5JEAJ 3HOZH 1Q86C 1EF1A 4A3OA 1OXTA 2EYJA 2MW5A 2SOBA 1V9PA 1HTLD 3OJ3A 3CQZH 4JVZA 2WIIB 2V4IB 3HOYG 4KHPQ 1VQNA 1JRPA 3AEAB 1TWAB 4N59A 3VYTA 5E1FA 3D4DA 4CHTB 1STAA 2IGGA 3T16A 1V80A 4HKZE 3KF8A 1DOKA 5D2MB 2JXXA 4NAWA 3RYTA 4Y7NH 4DUYQ 1RAXA 1SNCA 1I4GA 4X66Q 3TEZA 2N9EB 2LEKA 1VQJA 3U4ZA 3FP9A 2L05A 4BWGB 3E9IA 3P63A 3MXPA 3L7ZC 2LMCA 3OAWA 5CTRC 1J8IA 2BB6A 2WKCA 4ANVA 2DGYA 1K83B 4FXKC 5A2QL 3KK7A 4C3HG 1UWXA 2KYWA 4CKCA 2GBKA 4P7IA 1TWHB 3MHBA 5D3DA 3CHBD 1N61A 1UH6A 4DDID 1LACA 2WXOA 3WAPA 4N8FA 3Q3FA 1JWMD 2Z6KA 2HDEA 3LJ3A 3KOJA 2J7ZA 2FUG1 4IM0A 1YI2A 4PYUA 5IP7G 4HJAA 2IGDA 4DR7L 3GTGH 1QQRA 1BCPB 3BJUA 4LF9L 4C56C 3WCQA 2LGSA 2HHHL 4X3TA 2XN9C 2K22A 1RODA 3ZNZB 4G57A 1J7BA 2HE7A 4A3DG 1H9RA 3I4MG 2C7MB 3PUWA 2WXGA 2ZJDA 1J0GA 2I5HA 1V5OA 1CZGA 2HQEA 2QGQA 2R93B 4OL7A 3J7AV 2CR5A 2D3AA 2K5PA 3PIOA 3Q8AA 3VVWB 2PO4A 2HJ8A 3H3VH 2FIDA 1ZXHA 3S15H 1O7ZA 1FEHA 2XIWA 3AH7A 4O42A 4YY3L 2BA1A 3X3MA 2UXDQ 5EPLA 1LLRD 3PO0A 1KRTA 2E2DC 4OVVA 2EYFA 1PZJD 2GBMA 1DOYA 3T3OA 4WORA 4A3FH 2VUMH 4P1BC 1TVXA 2F0HA 4A3JG 1KTKA 1LTBD 3HEJA 5IYBG 5DNFA 5C4JB 4J6HA 2ZW1A 5ELDA 1L1OB 4B3RL 2M2LA 1WZ3A 4I6LB 2J0TD 2H4OA 4XTCS 3AE3B 1A2TA 4R9WA 4FF1A 1JICA 1EFWA 3I4NG 1NI2A 2NPTB 1D5XC 4XXEA 4LWCA 4A3KB 3I2ZA 5C4XB 1VZ6A 3R66C 2ZW0A 1R4QB 3CC2A 4YTPB 2N3SA 1Q1EA 2D0PA 4AJYB 2MPMA 1PH5A 2K6QA 4LJPB 4A8XC 1B8AA 4A6QA 3A33B 4LDTB 3DWPA 3M3YB 4MSQB 1GPXA 3ND9A 1N6ZA 2EYHA 5FKAC 3LGJA 4KZ0A 2RDFA 3JW0X 3OWFA 4R1JA 5ELEA 4YCUA 2I5LX 2I2YA 2IX0A 4HDQA 1ZUD2 1GB4A 3HOYB 2MO0A 2PMZE 2KCMA 3VUWA 3K58A 4W9CA 1M1KC 1QNUA 1Z6HA 3IFDA 3UI2A 1WYWB 4FF3A 3R8BA 5IKCM 1CUKA 5H92C 3MTSA 2B63B 3AEVA 2WX0A 2WXPA 2K5DA 3FKIG 4JI3Q 2KENA 2KC1A 3SU8X 3UF8A 1WCMB 4AJWA 1T0SC 1MSHA 2VQEL 4IDIA 4JPBW 2OQ0A 4KY6A 3S2HH 2VH2A 2W82A 3A4RA 5M3MH 4ICUA 3F8TA 3ER0A 1QOFA 3C46A 1R4PB 2HCCA 4JYAL 3EROA 3S1QH 1N32Q 3HKZE 1AH9A 3X23A 1ZPSA 4L2YA 1VQHA 3ONAB 3L4PA 1MHWC 4X3SA 1PH8A 2NWGA 4RKLA 4XZ4A 2HD3A 3N52A 3PCOB 2IWHA 3HKZB 4ZRZA 1MJDA 3RNCC 2ZTDA 2F0GA 3KWLA 2M8SA 5E6PA 1K52A 3TCAA 3BU2A 2JA6H 3NHEB 2XSCA 1PQSA 2WXJA 1F0ZA 4C4VB 1A3VA 3S2AA 4EZJA 1BCPD 4HIMA 3HP3A 1HZ6A 1K8OA 4JV5L 4NJ6A 4L5SA 1XNRL 5F2DA 5LNK1 4OZBA 4CDEC 2IO1B 1BBUA 2V1YA 1OXSC 2ASQA 1HEZE 4MGKE 5J3BA 4A3DB 3N3KB 2D5DA 4XIGS 3UDXA 3URYA 2ICIA 3OHXC 4OHJA 3OIQA 3IAYA 2KDEB 5GAEC 1DOLA 1KAAA 2JA5B 3Q8BA 4JI1Q 3KF8B 3H9DA 1I6HB 4NAWB 1C4PA 1HJPA 2C35B 1QE6A 1AWDA 1DXMA 2JE6I 2KHJA 3K0XA 3W5UB 5C6AA 4II2B 3PUZA 4C3IG 3K5LA 2LMCB 2M56B 1CI3M 1HE8A 3WAOA 1PLFA 3BZCA 2J52A 3GTMH 4NXML 1P9DU 1I4XA 1X3FA 3OSOA 2L7RA 1B9MA 1YBYA 3RNUA 4AQYQ 2PMVA 4JI8L 2F0MA 3KYDD 4IUQA 1T5EA 5LHY1 4LF7L 4MACA 1G6JA 4BBRH 1CA6A 3MVVA 4N9F4 2L55A 3U7DA 3GQBA 4YHHQ 1KJTA 5FLXE 2R7FA 1KAWA 5FJ8G 4I6PA 1PTOB 3WDNA 3PLVA 2J0JA 1PYBA 1J5EL 1WX9A 1YJIA 2A4ZA 3KVFB 3NVWA 2QF7A 4KDIC 1E22A 2IJ0A 3EN2A 2DY7A 4LK0M 1Q0WB 4JCVE 4AYBG 2CJOA 3P1MA 2EKEC 5KYIA 1TQOA 2MA9B 3HOVH 2EELA 3ZVVA 1EY4A 4G0NB 1RWSA 3MC9A 2VQFQ 1X1MA 2Y0SE 1E8ZA 1BKBA 3IFTA 3DCGA 1NBWA 1JMCA 2EXZA 4KIKA 4LNKA 1O80A 2JA8B 3NVVA 4NPNA 3NSWA 1EY7A 4X6AH 2K4KA 2Y0SB 1GUTA 5CV4A 3OMCA 5KHOA 3PIP3 4E6IA 4KV2A 1VCIA 2PNRC 1VQFA 3MA2B 3B9JA 4ZRPA 4FBJB 2V0GA 4AOFA 3MEFA 1WGGA 4C1NI 5C0XI 4P72A 3BK2A 2KX0A 3NK9A 1F2RI 5M5XB 4QY7A 1EQRA 2MGSA 2PW9A 3HIZA 4K2LA 1HZ5A 5E6OA 2QMTA 2C9WB 1GC6A 2PEAA 4DK3C 3CMAA 2CQAA 3BVZA 3T1YQ 5JHBA 3ITPA 4MEMA 3OMGA 2KECA 3U7ZA 2DJGC 1VMPA 2RDGA 3PMFA 4MDKE 3KF6A 2NVXH 1JOQA 4LK1C 3PZ8A 3Q8CA 1OGWA 4R4QA 4A3GH 4K14A 2QJLA 2JT4B 3EHVA 4OEMB 5KHQA 2O5JC 3H94A 1FD7D 5IWAL 1EUVB 1PFDA 4WQMA 4DK6C 1PZID 2KHIA 4P74A 3RD2A 4J8QA 3DQVA 1XLOA 2DNFA 4JBJA 4G11A 3HOXG 4DV1L 2OTLA 2K75A 2CKHB 2QCZA 3D3RA 2BH8A 2PLPA 3ZRCA 3CWIA 2Z9HA 1EWHA 1OEYA 5FLMG 2KN4A 2V9HA 4OVZA 5CHFA 2XVSA 3R2TA 3ZIMA 1L4ZB 1F1HA 3I90A 4ZAIA 3G48A 4LFCL 1HR0W 3VR5A 4YSZB 5H8YE 4IM2A 2B2WA 3P75A 2BDNA 5I2YA 3Q14C 2L1BA 4HTHA 4ZOHC 5FO7B 2VZAA 3MEHA 1EO6A 2N9LA 3RN2A 5LL6X 2W9NA 4O0AA 4JI7Q 5CV5A 1RTOA 3WAMA 4YSYB 5DPWA 2KJXA 5I9OA 2O5IC 4MN3A 2EY1A 4GLAC 1E1OA 1IBLL 1CQFA 2YV5A 1I94L 4ODGA 2UU9L 1ZDXA 3C19A 1TWGB 2JU6X 1E8YA 4S0RA 2BYEA 1SAPA 3DHQA 4ASWC 5CORA 1LO5D 4EE2A 2Q8IB 3ZRFA 2K6AA 3OW7A 3E56A 4XQNA 3AE8B 3J9CA 2MHVA 2JA7G 5GMVA 4LF8L 2VB3X 4ZKBB 1EZ6A 3R93A 4P6VF 2MLBA 3CXCA 1JRUA 1ZXIA 5GADC 3JYUA 2R7DA 4DR1L 3G6EA 2C9OA 3ZJTA 2K50A 2RA4A 4DXGA 4IALA 1QB5D 5M3FG 4AYBB 1X54A 1NENB 2NVQB 2E5LQ 2D9UA 1BQQT 1E2ZA 1K9MC 5CGKA 3SVMA 4NXNQ 3EBEA 3KUZA 1ZYRD 4W9EA 4QF4A 3U4EG 3ZXRA 3MC0B 5I6WA 4RF0A 4TRDA 1E10A 4P73A 4USAA 4YWMA 4B3ML 4L63B 2G4DB 1LGRA 2KDFB 3NQIA 3RZDB 1T6BX 3DBSA 1C48A 4NB3A 2CWAA 2F0SA 1VS0A 3BDCA 5IGBA 4A3IG 3LYYA 2E6XA 3RT3B 1V6EA 1Z5SB 2BBCA 4IG7B 5KRUA 2NN6H 1GD7A 3MXNA 4DXFA 4LF6L 1STHA 1Q3LA 1WMHA 4XYQA 1RFAA 2LRUA 1JROA 1UGMA 4IFDH 5KIXA 4IUVA 3H0GH 3SFEB 1NMGA 4XQQA 3HOWB 1PGAA 4LNFA 4ABNA 4BY7G 2B3AA 1T3QA 1C1YB 4FXDA 1I35A 1FJGL 2DN8A 4DU9A 3L13A 3RPFC 1ZYRC 5TSSA 5C2TB 3VUYA 1HHVA 1V1QA 1SDFA 1A0IA 1B9NA 3D31A 4POGA 3RZWC 4ZKCB 3ECIA 2GN5A 4MGIE 3Q8DA 4JK1C 4LNQA 2BH2A 1Y1WG 2KQ4X 3KLSA 1I6VC 4HMIA 2V3PA 2KLCA 1X6OA 5JPNC 1B3AA 2EIFA 4A3FG 2VUMG 2LZ6A 2PPBC 1X9NA 1ESRA 1PFBA 4FHKA 4YTNB 5JXVA 1SLJA 3S1MB 3Q6BA 1FNVA 2WB1E 1PMRA 1WI5A 5IP4D 1OXUA 1TS4A 2YTXA 3AYHB 1YN3A 3HOXB 4RMAA 4KJNA 3BS1A 2YEPF 1PFSA 2RD0A 1W6KA 4KIKB 4DFAA 4AIMA 3A5ZB 4M02A 5C3EH 1D5MC 1GJZA 3M4YA 1RD9D 2V3SA 2K8CA 1FPYA 1E1TA 1MD2D 5M5WH 1U0LA 1ZKHA 5MPOA 1QF6A 3GTPH 4HIOA 1SGHA 1JOKA 2WXLA 2MBHA 1KNAA 2VZKB 3PSEB 3NG0A 5HGTA 2AHOB 1TZ1A 2NVUI 1FFVA 4B3SQ 3I63C 3NTHA 4BBNC 2KEDA 1WH3A 4W9JA 5LXIB 2CS4A 4US9A 4RHRA 2MSED 1PXUA 3D8GA 5DM63 1H9MA 1WJ4A 3NS1A 2XWBB 3KF6B 2ZM6L 1JT8A 1DD2A 1HQMC 2A6HD 3EC8A 1EY9A 4DR6Q 1JB3A 1P7EA 1XMOQ 1WD0A 2N4FA 3FKYA 3A74A 3NE5B 2LVPA 4US8A 1H9JA 3U2SC 1X3PA 2KHWB 2QKIC 3C1FA 1RJTA 2DJFC 5EAYA 2KHSA 2Z6BA 4G7OC 2EJFC 4EQOA 5EKLA 1B2TA 1DOIA 4W9DA 2LHDA 4GU2A 3RNGC 3SK8A 3ML8A 2NZHA 3JAMi 3SK6A 2MH7A 5M3FB 1OQQA 3U30A 4MTKA 2BPSA 3S17H 1FCCC 1KL9A 1HNXL 4XC2A 2ZCCA 2K32A 1Y56A 5JJLA 4BY1B 4FULA 2XGTA 4YWLA 3I4OA 3AECB 3BWUD 4UP8A 3GTOB 1DZ1A 2H89B 5IYDH 1B9RA 1CKMA 4K8IA 1BO0A 3IVFA 2LSSA 2JA6G 3VAWA 2A6HC 1E8WA 1MHHE 3E0EA 1R9TB 3CCUA 3PF4A 1TIFA 2JRIB 4A3IB 2M17A 2FMMA 2OEOA 3RD4A 4X62Q 2JF5A 1EEID 1Y1VH 3DVNU 3IT4B 4A3EB 1XO3A 1SRUA 1EYGA 2QC8A 2JYOA 2DHZA 4KN4C 3SK5A 1ZW7A 3OJ4B 3P7JA 4GS3A 4DDGD 2IO0B 3SK4A 4A75A 2B2YC 3T1HL 5EJWA 4LFAQ 5M5YH 4A3BG 4C2MH 3V62A 1KIXA 1Q1BA 2L83A 1STEA 1VQEA 2F0IA 3FPUB 3ND8A 1LYLA 1U4LA 4BY7B 2UU7A 4FXCA 1C9FA 2RVLA 2PE9A 3G7LA 4RAUC 2QDFA 1LT5D 1S3SG 3FILA 2UUBL 4IO9A 4IC7B 2ZVNA 1LT4D 1U9RA 5ELNA 3Q24A 4L6TB 4DA2A 2KNBA 3ULLA 4AP4C 1Y8OB 5HFYA 2GVBA 3CCVA 4DR2L 3KJOA 4JBKA 1WGYA 3TZDA 1EL0A 2WDQB 4WIPA 5EDSA 3FPPA 3VQIA 1F9QA 3OLMD 2ATWA 3C2PA 3ZDMC 3PO3H 4OX9Q 4KKIA 2OQKA 1N33L 1WTVA 1GG3A 3K5NA 1C0AA 1EIHA 2JYTA 3CCMA 1QZHA 2K04A 4EQNA 1UE5A 1VDZA 2J42A 4BBRG 4BXXG 3BDLA 4QJFA 5FO8B 3S14B 2E2JB 4BVUC 2IPKD 3NHHA 4W9GA 4IPDA 3FAHA 3NRZA 4ARIA 2JXMB 2W55A 3RN5A 1D3ZA 1V97A 1HNWQ 1QOBA 2Y5BB 5IODA 2JN4A 5C5MA 2HTHA 1YJ1A 1WJUA 3GO5A 4B9XA 2X6GA 3MXNB 5C44G 4NQLB 3NOBA 1UE6A 1F52A 1WMHB 3SE0A 4H02A 2HIVA 2JSOA 2XNAC 3R3OA 4IQZA 4K5VA 1YN5A 1SB3C 1TGZB 3ERSX 2K5WA 2GBRA 3PRMB 3U9OA 1V8CA 2L3ZA 1OXVA 2F52A 3P2BA 2BTEA 4RCOA 1SN8A 3M3JA 3M4PA 3N9YC 1AARA 2KWDA 1WTPA 2PYKA 4LNOA 4KN7C 4ACFA 5I4DA 5BR8Q 2CJNA 3I91A 2L1AA 3NQTA 4QB4A 1Q82C 3FC4A 3KDFA 1IYVA 1K8MA 1B3QA 2EDGA 1V5TA 2IO3B 3K5OA 2F4VL 2MP1A 5D14A 2AL6A 4IUMB 4OVUA 3PS6A 4C1NK 2B2VA 1SNOA 2HJ1A 4HMJA 4XYCA 5JZEB 3KYHC 2ASBA 4DR7Q 2F0NA 1LXDA 2I1JA 2A19A 2NVQH 4LF9Q 2F3WA 3DWMA 1WJJA 5BMHA 1FD6A 2RCFA 3I3TB 3EFUA 3W2DA 4H13C 4DXAB 4DAYA 2PI2A 4POFA 2IZVB 4GLSC 4OIJA 4PZ7A 1V43A 2UUAQ 4C3JH 1FM0D 1K50A 4Q0FA 1KM7A 2EMSA 3K9OB 5DPRA 4HWIB 1EY0A 1WX7A 2K28A 3S1NB 4HJGE 3PRPB 4QIWE 3K5MA 2CVRA 4RM9A 4A3GG 1D2BA 2DZJA 1ET6A 2ZTCA 3LXFA 5D94A 2F0WA 4NPSA 4TVAB 5C0XH 1SFOH 2FBWB 2W3RA 2BWFA 1ACCA 3F2BA 3M4OB 2R92B 4YY3Q 1M90C 1YZ6A 4BKTA 3ZTDA 2WYQA 4RA8A 1JB7A 2NBFA 1I5FA 1B4OA 2GB1A 1KLGD 4LF5Q 3QIAA 2Z0DB 4OO1H 4DHZB 5DAUA 3RNEC 3BZKA 1SE2A 3W5OA 3AE5B 2WP8J 1WJ6A 1SJHD 1TIID 3A8KE 4DUZL 1NNXA 5JAVA 4A3BB 3GTLB 4URKA 2EMTA 4YT0B 4N9PA 5C1ZA 4ME5A 1SYFA 4F1SA 4N8X1 1EOVA 2L8JA 4AS1A 2RHSB 1FIQA 3A8IE 3NZUA 2KJ6A 4K8JA 2ZNVC 5EE1A 1A63A 2NB0A 4HRSA 3GP7A 1P7FA 1YIJA 3TBLD 3MXGA 5LMNQ 4WWOA 1I3QH 4X3UA 3UE0A 1S5DD 4K7UA 4DV4Q 2R7ZG 1E0BA 3J81i 4JBWA 1I4PA 1SE4A 5HHDG 4K6LA 1G91A 2J7QB 3IAS1 3MFGA 3RI7C 1PH1A 3FEWX 1QZEA 4UDUC 3EJIA 1WF9A 4DR5L 4DNRB 1U4AA 4W9LA 3QHTA 2N78A 1E5WA 2DZMA 5DPTA 1CHQD 3H3VC 4K5XA 2EYOA 1HNZQ 3D6WA 4A3MH 4HIDA 5L83A 4IJHA 4OZAA 3EUB2 4B0MA 4WRDA 1N36Q 5G2NA 2AWOA 3TRZA 4DV7L 4KTAA 4CKBA 5C44B 2VQEQ 2BF8B 3DXJC 4RGMA 3MZ5A 4BBSH 4G3XB 1K53A 3DBHI 2I0QA 4DN4M 2A8VA 4FYDA 4RCNA 4GKJL 4TQ1A 1N5WA 1JWUD 2KDBA 4LUVA 2PZUA 1M8AA 5EGTA 3AU4A 1I50H 1V1PA 2AYOB 1JC7A 1WX8A 2FUHB 3HRDD 3ETRA 1RKNA 5C0XJ 1K3RA 3AEEB 3NBIA 3FILB 4IOIE 3T8MA 1L0VB 4CGYB 4R8NA 2HT1A 2NN6G 4YCWA 5A2QE 4F7ZA 1SYEA 2UXCQ 2QCPX 3ZNID 2C60A 3HS0C 4TUUA 3TIXA 1G291 2JQOA 2ZTEA 4IFDG 1K8GA 4PV1C 5KNBA 2UXBL 5IYCG 4HXDA 5CHWA 2NZ1D 3BY4B 1L2FA 3S1RH 1E7ZA 4QAYA 3TEYA 4JV5Q 1YQBA 2MJ3A 3V6CB 1XNRQ 1AP0A 4X65Q 1M4VA 1NAPA 3GTKB 1NMFA 3UI3A 2CU1A 4XGAB 1XTCD 1YJNA 1STYA 4YL8A 3RZFA 3J80i 5LL6S 4EQPA 1OQYA 1EZ8A 1R4MI 2KFKB 4BA1I 5AZFA 2MJEA 2V1CC 3W9CB 3VTVA 2F0LA 5IGFA 2WAQB 1IHZA 3K81C 4KSLC 4FNFA 1DM0B 2PZTA 4ME3A 4A3EH 5LXHA 1FR3A 3HVDA 3D4RA 1LTLA 4DQOC 4DAPA 2P5ZX 5AJ3Q 2JA9A 1RIPA 2PE6B 4M8NA 4RFBA 2ON8A 2NVYH 2F0UA 1K51A 2RGFA 4E74A 4JI6Q 2OTJA 4JI5L 3V2TA 1PGBA 3RNAC 1Y8NB 4LFBQ 1R4NI 1ZP0B 3A54A 2EY2A 2BVCA 4GMVA 2E2HH 4LF4L 1VF7A 1F77A 3OIPA 4LF7Q 3PUVA 3KDFB 2M0AA 1EY6A 2NBUA 1PH3A 3K0YA 3SD5A 1PVOA 3IT6B 3E5SA 4FXGC 1G51A 2IX3A 4OZCA 4KD4A 3NVZA 4ALPA 3DWQA 5AEKB 3WA0A 2L0FA 2SEBD 4DAYB 2Q2TA 2V3NA 3VR8B 2R7ZB 4LNIA 1ICFB 2PNHA 3O13A 4G7ZC 5FR6A 3UQBA 2PZWA 2F0OA 2FJ2A 1JE4A 2OF1A 4TQUS 5CMDA 1SSNA 4RG1A 1T0RC 1TJEA 3PIO3 3T9LA 5KNCA 1DONA 3HUIA 1E7UA 3FVQA 1Z9FA 2IX1A 3MP9A 4ANWA 4P2CB 1H95A 1KLUD 5M9OA 4DBGA 2KUMA 3TREA 1UAPA 2CWPA 2YU9H 1CMXB 4M0WA 1D1IA 4WJQA 2WLBA 4CBVA 1GJXA 1G6PA 3PVLA 5BMIA 1TKWB 2NYZD 5J17A 3RMKC 3M95A 2M4NA 3DBHB 3T53B 2KWCA 5C5LA 4BAXA 1OO9B 4MH8A 2GVAA 1YX5B 2INNE 4L23A 3MXUA 1AZQA 4HSVA 5JVH3 2D11A 3DVNV 3ERQA 3PF5A 5LLIA 5IAAC 1ILQA 1TWFB 3A7LA 5EBDA 2JQRB 2LXAA 2K8BA 4C3HB 1P8LA 1DJRD 1UBIA 3VR4A 1GC7A 4OONA 1BCPF 1BNZA 1WJNA 3DEPA 4G7HC 5GAHC 2KFJA 1N63A 1Y1VG 4KGTA 1CJEA 3TN2A 3NUHB 5TR5A 2A73B 4NMZA 1G8ZD 1ASYA 2INCC 1WE6A 1QCBD 3CRLC 5EKIA 4FJYA 3HHMA 2B2YA 1X32A 4WWPA 1C77A 1PFNA 3MC8A 1Q5WB 1VQAA 4REZA 1D4BA 2O4XA 1CM9A 4PS3A 4A3LG 1OQRA 4H7BA 2NR2A 3I55A 1R4MB 2MBEA 2ONQA 4FHJA 4JI4L 1J6QA 4K0KL 4YXDB 5BYSA 3VYUA 3I4MB 3Q3NC 2A5UA 1DGSA 1A70A 1L6VA 4LFCQ 3K59A 1CHPD 3UE1A 3VRBB 2WQYB 2NTSA 3TP5A 3SDLC 1FXIA 2F0JA 3W1BA 3PO2H 2ZPYA 3BVGA 3CSTA 4HJKA 2O2LD 1Q8KA 3N6RA 1YNXA 4HCNB 2A1AA 5C4HA 2KA7A 1NTGA 3HOUH 2OJRA 2YVCA 3O65B 4KZCA 2VRRB 1LTTD 1R4NB 5IO9A 3CP0A 4EKUA 2UU9Q 1W2BA 1I94Q 1EIYB 1X55A 4A3JB 3DOWA 1G2TA 2FMCA 3CC4A 3KJPA 2KD0A 2WU2B 4EFOA 4DV3Q 3CD6A 4RNAA 1V1PB 4DV5Q 4IKGA 3SGIA 3S16B 1WYGA 2K39A 2N7DA 2UXDL 4DAVA 3FHWA 3I4NB 1S40A 4DK1A 4KGRA 1YHQA 4LF8Q 4WFN3 4A93G 2BS2B 4Y52H 3CU7A 3DWAA 2KWUB 2K5VA 3CSFA 1R7SA 2F0EA 1XD3B 2I38A 5EE0A 4LTUA 4HCEA 2RDBC 1I42A 5JEAG 1KOTA 3KWVA 3PUYA 2D2QA 5IP9H 3FRPB 2ZPNA 3TL5A 3TZUA 1N62A 2N9XA 1YEZA 3PHWB 2N9KA 2BYVE 1KD1C 2Y5PA 1TWAH 4A20A 4DK0A 2CW0D 2AWNA 4R4CA 3AB5A 4HLEA 1PH4A 3X3NA 1FGBD 3W1YA 3HM6X 1NR2A 3V60A 4OIKA 4YIJA 3R2IA 1O7IA 2K03A 5LMUL 1BMLC 4MTNA 3IL8A 5GQOA 4ZUIA 3PRZA 1HTPA 3HG9A 1PV4A 2LGXA 4HK2A 4DV2Q 4XWTA 2JEAI 3GZNI 2K6DB 3I4LA 4E71A 2IL8A 1JORA 5DEHA 4KGSA 4LF6Q 2B2VC 1TXYA 2CH4A 2G9HD 3FKIB 1LQBA 2CFMA 2F0KA 1RLFA 2WXIA 4FJZA 2QEJC 4K7SA 3TUOA 2D0OA 1K83H 2M00A 3WANA 4C3JG 2E2IB 1VQGA 2K05A 1TWHH 1VF5C 3E3XA 2KDMA 3KLSX 4HJ8A 3N1XC 2QDLA 1ASZA 1RL2A 1PFMA 1NEKB 3ZJUA 4KD3A 4MNOA 1SNDA 3SR1A 2CW0C 1MJEA 4K1RB 2WXHA 4JI3L 4X57B 3IHPC 3SHQA 3PUXA 1UEBA 3PGZA 1TY0A 1X56A 4R4IA 5E7NA 1NCVA 3PHXB 4PMWA 1RF2D 1DGJA 1EYDA 4FJVB 3AE6B 4OO1G 1ENFA 1WFQA 2L11A 3QC8B 1ICWA 2FINB 3C1EA 2L0TA 2K5QA 1N32L 1FMAD 1P3QU 1IBKL 3I9V1 2M19A 2KVRA 1WGHA 3ZLZA 2EKIA 2VB2X 2R93H 2O6VA 2G5DA 1SE9A 4EUTA 3HK0A 1LUZA 5G3LD 1WSPA 3KUCB 2SNSA 5CR3A 3KLRA 1BVSA 4EGVA 1QJOA 1WXMA 2N0SB 4JGHB 3CCLA 1V8QA 1MI2A 2RR9A 2N9PC 1IKLA 5ISRA 3AE2B 3DVGX 3ZNGC 1PRTB 3AI5A 3BYYB 3G4SA 3HM3A 4ITKA 4M0WB 3CPFA 1TKGA 1A62A 1EQQA 1LM8B 2EJGC 1QNKA 2G4SA 3PGEA 4J15A 3VRAB 4FVMA 4A90A 4GXBA 1Q81C 4UY8C 3HOZG 1SE8A 1CKOA 4B3TQ 1ZDVA 1Z7TA 1FRRA 1JE5A 3JC66 2AWTA 5C4JH 3VFKA 3VH4B 4C3IB 3DM3A 1C4CA 3QR8A 2FCSA 3H7PA 1K8RB 4MSMB 1KRSA 3J7A5 1YJJA 4HIKA 1PTOF 3PZ7A 3R7QA 1E0ZA 3SHLA 4JI1L 4A3KH 1WXVA 5C4XH 3WIMA 1VQ6A 5LMNW 2INPE 2LVQA 4A3MG 4AYBE 1IBXA 4ZCKA 4IUPA 3M4QA 1F9SA 4M1UB 2X8XX 3QOJA 3NZ3A 2YLMA 3IAM1 4BBSG 3MFYA 4FADA 3M3YH 4NP5A 3RZOB 3CKIB 1VD2A 4DKAC 3QOLA 4MGYE 1SNMA 3QO2A 3D32A 3QK0A 1GB1A 2OT2A 2JZZA 4BKSD 2KKCA 1EYAA 4PZ8A 1HNXQ 3HOYH 3EFXD 4W9KA 1IYFA 4N9TA 2PJHA 2M1MA 1MBYA 2WV6D 2MRPA 2RMMA 3KUDB 4HKQA 3WALA 4DR3Q 3H7SA 1XPOA 3GZNB 3AFPA 1V1OA 4HEDA 5IT9L 3UDGA 4JI2L 2B63H 1EUJA 1V86A 1SEBD 4WAAA 1P0RA 3CMMB 1E3PA 1EY8A 1O7YA 1WCMH 3HFZB 4DV0Q 5JJKA 2HDLA 1VQ5A 4ID6A 4LMQD 1GUAB 3QAQA 1UNSA 2B29A 2KQSA 3AM9A 1WM3A 2EXDA 1ZEQX 4DHJB 1P98A 1N5XA 3LWEA 3QCAA 5K36H 3T1HQ 1ZOYB 3P4QB 1DOMA 5CV7A 1D7QA 4QL5A 3JAML 1U4PA 2JVCA 4ANUA 2GA4B 2JZPA 1MFWA 3AU5A 1CT1D 1II3A 4OWTB 1LTRD 4DR4L 1DOXA 1NR4A 2H5XA 2NVTB 5EPJA 4AH6A 4X64L 3ONSA 3H3VI 4LCDE 3GTJB 3MWYW 1T0YA 4IWPA 2KZRA 2TMPA 2AQ2B 3JVZX 2RF4A 2J0KA 3Q2AC 4QUFA 4V190 1WTHA 1MGSA 4HPPA 1N33Q 2AEHA 2IYDB 3ICEA 4A3DH 3NPPA 1QVFA 1JR0D 2R6GA 5AUKA 4MELA 2BWES 1HA6A 3GS2A 5JHAA 1C9OA 1PH9A 4PMBA 2JA5H 1JJGA 3TDQA 1I4QA 3OWEB 4A3PA 2RKSA 1I6HH 2KXJA 3M7GA 5IIFA 3AEGB 4A55A 3ZJVA 3GTQB 1PRTD 2KX3A 3CPWA 2WS3B 4Z9CB 1ET9A 5FK9C 3K7AB 4W9IA 3H1UA 2DY8A 1VQ8A 2ZEQA 3HOZB 1SR3A 2HCIA 2QDBA 1VCBA 5IYBH 3CQZB 1NDDA 2K9XA 1IBML 2VY3A 4LUZA 1PA6A 4IURA 1MPEA 3D0FA 4K7WA 4FA6A 1ISNA 5J2RA 5GXGB 5CV9A 1SMYD 1PTOH 1SE3A 1LTAD 4UP7A 4DWFA 4JI7L 1YHAA 3UIPB 1V49A 1BBXC 2JA7B 1WY8A 2WXKA 1LFDA 4XX5A 4WJOA 4Y7NB 3AMUA 2N8NA 2QHOA 1PRTC 2PQAA 2F3VA 4PYZA 1DCZA 5M3MG 1QLBB 2XK5A 2OCEA 2A69D 2KTRA 3W1SC 1QVGA 4JI0L 3M62B 5CBEE 4LJZC 2O6VB 5DLQE 3GE8C 1FXTB 2MUYA 4F87A 4W9FA 1OFFA 3I7FA 2K14A 2JA8H 3H6NA 3KBXA 4GN1A 1VQ4A 4RMFA 2MWSB 1CFMA 3VR6A 5KNDA 3I8ZA 2ZNVB 4XE0A 3IFWB 4AUQC 1UGJA 2FNJB 3JSVA 1SMYC 3MTNB 4WWNA 4PNYA 3SDZA 3J7AF 3E9HA 3S2DB 3APCA 1HTQA 5HKHA 1A3TA 4LNNA 3GTGB 2E5LL 4I7ZC 1Y8RC 1K3BC 5M5XH 2WXRA 3HVZA 2KEEA 5BN3A 4OGQC 2SDFA 3J81c 1EU3A 4NXNL 1EY5A 1EIFA 1UE1A 3I70A 3K7UC 2BYFA 3M85A 3I3CA 3H7PB 2A69C 3A55A 3QQ8B 3KFUA 2GLSA 1HA5A 4DHJD 4TV3A 4EEWA 4LAAA 4DUZQ 2B8GA 4F7XA 2LVOA 3A0JA 4DNTB 1C78A 1V81A 4CDDC 4HDOA 3PO2G 2HQLA 1WGDA 2F0TA 1GHKA 4HPMB 3TS0A 3D6CA 4IW0A 2JWZA 3S15B 1IBXB 1WTOA 2KVZA 1BF4A 3DLLA 3HOUG 1K73C 2QIEB 4ARCA 1Y1WB 2KCNA 3ABVB 2KJHB 1VZ7A 2ALYB 2F0VA 3LB8C 2G9DA 3VR2A 4A3FB 2VUMB 3QJZA 4EZKA 3NWSA 3CIRB 4M00A 4HCPB 5BO4B 1J9OA 2KCCA 1TS3A 4GGQA 3OOCA 2CHBD 4A4IA 3MAQA 3DBRI 2MQHA 4IZ8A 1VMCA 4XDDA 4A3CH 1JMLA 2LUMA 2DNCA 2JJQA 4DR5Q 3DVGY 1J7CA 5ELOA 2Z0EB 4B9KA 1KRHA 2GOWA 5C3XA 1NYQA 5HG2A 1IKMA 1HCZA 2MFIA 5K5PA 3HOVG 2XRSD 4CDCC 1FFUA 4QQBX 4IM3A 2CHXA 3AULA 3ZXVA 2F3IA 1TWGH 3EIVA 4DV7Q 1LM0A 3Q3MC 2LFNA 1LTGD 2X69A 4XT1B 3LDZE 2Z59B 2KACA 4ZRKA 3J81L 1SROA 1RM6C 2LS01 3MHZA 5FJ8H 1WWTA 4MJSA 2DLBA 4ZRIA 2MBOA 2OEDA 1LTID 1C76A 1SMXA 4HVBA 2RBMA 3IRBA 1VLBA 2F0DA 1RYJA 2CKZB 1FNWA 3KBGA 1TBEA 2KOLA 1HQRD 4B3SL 3S2HB 4KSKC 1VQIA 3B2GA 4PK1A 1TKEA 2UXBQ 1YQ3B 1ZE3D 5M3MB 3NS8A 2QEXA 4I6NB 4K6DA 2HHHQ 1XPUA 2MJ8A 2E75C 4BOZB 3D4WA 4MIUA 1S3OA 3S1QB 4GKKL 5JJZA 4NKLA 2O6VD 5IOCA 1Q7YC 2ZJQA 1MJCA 4DR6L 1SJED 1NI3A 1XMOL 3RZDH 1H9KA 1SYBA 2IBIB 4ULLA 2MX2A 3DBLI 2E74C 3F2UA 2XWJB 5HY6A 1B50A 5JH5C 1YD8U 1B7YB 3TQYA 3L0WB 2BGFA 2G1EA 1O78A 4G50A 4DHZE 1GUGA 4ANXA 2BS3B 4K5WA 2JA6B 3AE4B 2JEBI 1HUNA 1NY4A 2AQ3B 1PDXA 2C5LC 3HOWH 1JOOA 1NSNS 3MJ5A 1IYUA 4MZ9A 4R4TA 1D1KA 1WZ0A 1VR9A 2BDOA 2FAZA 2E3TA 1K0RA 1GXDC 1KDBA 1WYDA 1IYJB 5T1GA 3UINB 4B3RQ 1UF0A 1J8CA 4OW0A 1GUWA 2ZXOA 2Q2HA 2R3ZA 2DYMA 2MEKA 5E6JA 1A3UA 1GUNA 2ZXPA 4UHVA 4GN5A 1U4RA 2C7NB 5HURA 3H09A 2YTVA 3G6JB 1PHJA 4NJ7A 4RGOS 2RSNA 3GD7A 5E4XA 2PQAB 1NJIC 3EQLC 1VRAB 2JXTA 2L15A 1WTRA 3J80L 3DM1A 1BBWA 1LT6D 4NQKE 3S1MH 3AFQA 2ZJRA 4LFAL 1WOCA 1L0WA 2XK5B 2K8HA 4I7AA 2KTRB 2QW7A 2O2VA 3DHHC 3DBRB 3HOXH 4CO7A 3L2PA 3GTMB 5E3FA 1TT2A 4A3KG 4IJLA 3V96A 5FLMH 3UGBB 2SAKA 1LTSD 3IKJA 1TT5B 1WR1A 2ZJPA 1F2LA 2DYBA 4IUNA 3T56B 4BBRB 4GDKA 3OTOL 3JSVB 4LLGM 5IOIA 2WACA 4WURA 2L76A 1GO3E 5G55A 4J6IA 2DYOA 4RKBA 1NUCA 1HPCA 4KI0A 2B3GA 4NY0A 1UWVA 2BOSA 3WOFA 1IPGA 2JWUA 1ESFA 3BIID 2K7VA 5DCNA 4EX5A 4R4OA 3K9PB 4M8MA 1JJCB 4R3DA 3L10B 1NYRA 3HOVB 2X38A 1VJKA 4F88A 3R3MA 3ZYYX 5CHVC 5AFWA 3NXWA 2BS4B 2L4NA 1WI0A 3GE3C 1WIAA 1X3EA 2LI5A 2XEWA 3L16A 4JYAQ 1CQVA 3H6MA 1HNWL 2B63G 3NELA 4TSSA 2JA7H 1QILA 1WCMG 4K3CA 4DV6L 3APDA 3L17A 1LABA 1VQMA 2WFWA 3VTUA 2KTFA 3B1LX 2JRHA 1YX6B 3CC7A 3A9KA 4GOCA 2AKWB 3H0GG 1AW7A 3TJPA 5M3FH 2OHFA 3HZXA 1XNQL 3VDZA 2EYLA 2NN6I 2AUJD 2F0PA 2UUCL 4H0LC 5K36G 2BW2A 4BY1H 1WXSA 3DBLB 5BR8L 4BKSA 2EE1A 4E3CA 4IFDI 2K33A 5BYQA 4CKEA 3GTOH 3HKZG 2R2OA 3KYCD 2WAQE 4HCSA 4JI4Q 4K0KQ 3AXCA 3PPAA 3VXWA 2X6LA 2NVXB 3N1ZC 1MSGA 3S2DH 3H8HA 1ROEA 1STGA 5IGEA 1R9TH 4B95A 4A3GB 2QSDA 4A3IH 4L5RC 3WOEA 4PT5A 1IL2A 2Q8TA 1E24A 2VNUD 4KY5A 2N7EA 2RPVA 2AMCB 1VQ7A 4HEA1 4KK7A 5DPSA 3TP6A 3U52E 2LKVA 3HGBA 3NP8A 2UUAL
chains in the Genus database with same CATH topology
2BYTA 2PVOD 1XLPA 1B44D 1TWCB 4BA2I 1C4AA 1EEFD 3A7AB 2J53A 4ZHPA 3P4PB 1EIGA 2JYEA 3V3XA 2FHTA 4B0EA 1FNUA 1S5BD 1BUIC 2Z1CA 4XDXA 3I73A 4NDXA 4JX1C 1FXAA 1SNQA 1YMHE 3Q69A 4DF7A 1XCQL 1E9MA 4NZLB 3GV3A 1L6UA 1EU4A 1GAQB 2N7JA 2SNMA 4CQNA 4BS9A 1PDQA 3NTKA 3VR9B 2F1MA 5KEEA 4ZLTF 2KMMA 1OXXK 1DYQA 2W3SA 2Z4HA 3NUCA 1SYCA 1QOGA 4B08A 3OPOA 1Q90A 1TYGB 2RSOA 3W1SA 4QUCA 2AQ1B 3KUPA 3HRZC 1MHXA 2E76C 4KKJA 2RDHA 5A35A 3AEBB 2N88A 2BCOA 3I57A 4G4KA 4C80A 3A56A 4M8AA 5IGDA 1S5FD 2GRIA 3T4AC 1SNPA 1XCTL 2K1BA 1XX8A 4JE3B 1A2UA 2PMZB 2IGHA 1ZKOA 4O1NA 1GHJA 2EYPA 3W3AA 2BE5D 1FYCA 1VDVA 1U4MA 2ZXRA 1AN8A 3H0GB 2KQ3A 5CYUA 5C4ZA 5EE3A 1XF5L 2NTTA 1KFYB 4RGTA 3AEDB 2QILA 1QWYA 2F0QA 2A74C 4GDKB 5BYRA 4H44C 2B2UA 3S9WA 4IN3A 1G2SA 3BK1A 1MI0A 1AYFA 5AUIA 1QOHA 4KMUC 1CZPA 3ZQ4A 1HFNA 2EJMA 3LWUA 2ZT9C 2HTME 4N6EB 1X3QA 2BE5C 1HUMA 1UEAB 5D65A 2LY7A 4MHEA 1RTNA 3SFDB 4RH6A 3AMZA 3Q8EA 3SR6A 1MVKA 2L0CA 5C3EB 3I72A 1Q10A 2F0FA 4H2AA 1Z47A 2PTLA 2ENBA 2ACZB 5M5WB 5EKKA 3IXSA 3QWNA 5BN4A 3GTPB 1A6XA 1G6ZA 1BCPC 3NVYA 5FLXL 2GI9A 1RCVD 1GOZA 5EPKA 5BN5A 1WTWA 5EQ0A 3AU7A 4KHVA 3EA6A 1KABA 5CV8A 2WP9B 3DUZA 3K6OA 3E0JA 5I6YA 1BXTA 2DNEA 1FRDA 1I7HA 3J7YW 2Z8LA 3QB3A 1TKYA 1GUSA 1F9RA 1Y69U 1NVID 1JALA 1RDPD 2PW5A 2IT1A 5KYLA 4XQJA 4B9WA 3RUZA 3QJYA 2C5CA 1TR5A 4FO2A 4IUTA 2NUCA 3S17B 2J4XA 4PQXA 4F8MA 1O7LA 2PCFB 5JOBA 2CU3A 3W5VB 5C0XG 4I65A 2NMQA 2L9HA 2B2TA 1YNND 2WDRB 3AE7B 4HSPA 2YYZA 4C7ZA 1FCLA 4RGNA 2H88B 3EGRA 2WKDA 1Y1VB 5G3LF 1FO4A 5IGCA 2DBYA 1SF0A 4KX6B 3TBIB 1SYGA 5M5YB 4C2MB 3TEXA 2BA0A 4KKSA 4OO1I 3Q6SA 2F03A 3EVQA 3U9SA 2I46A 2EYMA 1WVLA 1YNNC 4FF4A 2H1EA 3TP7A 4CJ2C 2FFKB 1CK1A 1E2VA 1TS5A 1C8CA 2L32A 3M7NA 3P4SB 1KF6B 4C7YA 1WGKA 3PO3B 2B39A 3Q8FA 2EVBA 2M9VA 1XLNA 1YNTE 2R61A 1EOTA 1PYWD 4D2KA 1WTXA 2YEPB 1Q12A 1PUTA 4XT3B 3AB9A 1XEEA 3FMCA 4KY7A 1XWEA 4A93B 3L3OC 5G5HA 4WJWA 2K3UA 5ELFA 4X3KA 2KAJA 4ZUJA 3TSSA 2HDMA 4KV6A 4JPSA 5KGUA 5CBAE 5IGGA 3AN1A 3VR3A 1PTOD 4HAEA 4KKTA 3T13A 3Q22A 2LHEA 2JP1A 1L5PA 2A68D 4FF2A 2L12A 2L52A 4ZYSA 5IT9E 4R8IA 5EBCA 1CA5A 1TZOA 3GB1A 1LV9A 5I9PA 2WINB 1RHPA 2PKOA 3VA5A 4C3JB 1S5ED 5C3WA 2PIAA 1AFPA 2WXQA 5HI1A 5DM73 2BT6A 4PMCA 5FR3A 4Q5VA 3P20A 2LJIA 3C3LA 3VA7A 1N60A 3PV0A 1SFOB 3TP8A 5CC4A 1UWMA 1PTOC 3V05A 4ZRQA 3JAME 1D5ZC 2ID0A 2PQEA 1IW7D 4YSXB 3T3NA 5C3JB 2A68C 1WD1A 1QKZA 3E6ZX 3DMUA 4EVOA 3VYRA 5BMGA 2D62A 1C4QA 1SYDA 5JPMC 1T5XD 1LT3D 1JWSD 1PRTF 1JCKB 1QOAA 1EQTA 4JWSC 1L4DB 1ML0D 1J7AA 4KJOA 3QG1A 4HN7A 1BOSA 4WH4A 1S5CD 2A5HA 3TEWA 3K57A 4QMGA 4S3SA 1I3QB 2EOTA 1IW7C 1S4ZA 1AEXA 2JSVX 3AE1B 4WWMA 2Z4IA 3VYSA 3BDOA 2TSSA 4CJ1B 1SSOA 1EQVA 4P16A 2WB1B 2Y3AA 1BR9A 1QG7A 4ZHOA 1YNJD 5ELBA 5T1IA 4K2KA 5J39A 3GV6A 1HRJA 5COYA 1JWBD 1TS2A 1QT9A 5E4WC 4RF1A 2VXWA 4A3MB 5D7GA 4L8JA 4FP5D 1WTQA 3NBHA 2KVMA 1SBBB 1YN4A 4BBSB 3RMHA 2Q5WD 1XXGA 3T51B 1I50B 1H9SA 4ZK9B 1XLQA 3SXHA 1GUOA 4KHZA 3B2FA 1YNJC 4HR7B 2EY6A 1L0YB 1PZKD 1BDOA 2D5GA 1L0XB 4DGZA 2RQXA 4IFDJ 4TMAB 1EM7A 1W6JA 2LGIA 1EYCA 5EE9A 1D6EC 1BUVT 1SIJA 3S1RB 4MT5A 3CRKC 1IL8A 4UAIA 2B8FA 4L1BA 1F2MA 3P42A 4TKOB 5JVG3 1STBA 4NJCA 1IGDA 1Q8IA 4J3OD 1PGXA 4N58A 4IUUA 1EWYC 2WNMA 1ENAA 2DWQA 4MM3B 2B2UC 2D2CC 4WAFA 4YTMB 3H91A 4RWSC 2ICEC 3AV8A 1KH0A 1E2WA 5D3IB 2WU5B 2XRQD 3BVMA 1E7PB 2PVGC 4Q2JA 4CJ0B 1AZPA 2NVYB 1A15A 5ELCA 1XYIA 1TU2B 4U673 2EY5A 5I2XA 2E2HB 1YQ4B 5G5GA 1KDCA 4ZQ3A 1UUPA 2WXNA 1B1ZA 2HUGA 2EPBA 2IW3A 3BZDB 4J1MA 1F2ZA 1ENCA 2FE8A 4XWWA 1KDAA 3Q23A 4TQ0A 3ZGZA 1F2RC 1JQ4A 3BYTB 1VZ8A 1ONLA 3KQ4A 1ZXTA 1STNA 4GDLB 2IDYA 5FOBB 4GZYC 3RFZB 1I4RA 1WXQA 2B76B 1SXTA 3DEOA 4RHSA 1JW9D 3AE9B 3LX0A 1I4HA 3L9AX 2YU9B 3SEBA 2EZVA 1HFGA 2A6ED 4KKUA 5FO9B 3J81E 1IGCA 1JWAD 2Q8RE 5J22A 2VZKD 4U68A 2K0PA 3RLFA 5JEAH 2BB5A 3NTIA 4V0BA 5CV6A 1IUEA 4XYOA 2MJDA 1JQYD 5T8IA 1Y8PB 2Y5CA 1KNEA 2JX5A 2OXPA 1CTMA 1HXYD 4NAMA 2B2TC 4QCLA 2A6EC 2WXFA 5NUCA 4HROA 1RFKA 2K01A 2LFIA 4XDCA 3A8JE 3LNNA 2N55A 1F9PA 3PO2B 4QIWB 3P1HA 1EWCA 1C79A 4ILWA 3HOUB 3C8YA 2PW7A 1CZWA 2F4IA 3FDTA 4YWGG 3Q0AA 1EFID 4A9AA 1F2YA 1TY2A 3J80E 3DWGC 1H9SB 3E9SA 1E6EB 2WXMA 2L5TA 2V4DA 1WRIA 2AX5A 2B2WC 1B53A 3AEFB 1ILPA 3NWTA 3BG3A 5J1ZA 2WDVB 2I07B 4JWUC 3TMEA 4NW2A 2W54A 2AUKA 4AQ7A 3P4RB 5JEAJ 1OXTA 2EYJA 2SOBA 1HTLD 2WIIB 2V4IB 1JRPA 3AEAB 1TWAB 4N59A 3VYTA 5E1FA 3D4DA 4CHTB 1STAA 2IGGA 3T16A 4HKZE 3KF8A 1DOKA 1SNCA 1I4GA 3TEZA 2LEKA 4BWGB 3P63A 3MXPA 3L7ZC 2LMCA 1J8IA 2BB6A 2WKCA 1K83B 4FXKC 5A2QL 3KK7A 4C3HG 1UWXA 4CKCA 1TWHB 3MHBA 5D3DA 3CHBD 1N61A 1LACA 2WXOA 1JWMD 2HDEA 2J7ZA 2FUG1 2IGDA 1QQRA 1BCPB 4C56C 3WCQA 4X3TA 2XN9C 2K22A 1RODA 4G57A 1J7BA 1H9RA 2WXGA 3PUWA 1CZGA 2HQEA 2R93B 4OL7A 3J7AV 2K5PA 3Q8AA 2PO4A 1ZXHA 1O7ZA 1FEHA 2XIWA 3AH7A 4O42A 2BA1A 3X3MA 5EPLA 1LLRD 3PO0A 2E2DC 2EYFA 1PZJD 1DOYA 3T3OA 4WORA 1TVXA 2F0HA 1KTKA 1LTBD 3HEJA 5DNFA 5C4JB 4J6HA 2ZW1A 5ELDA 2M2LA 2J0TD 2H4OA 4XTCS 3AE3B 1A2TA 4R9WA 4FF1A 1JICA 1D5XC 4XXEA 4A3KB 5C4XB 1VZ6A 2ZW0A 1R4QB 4YTPB 1Q1EA 2MPMA 4A8XC 4A6QA 3DWPA 3M3YB 1GPXA 3ND9A 2EYHA 5FKAC 2RDFA 3OWFA 5ELEA 2I2YA 2IX0A 1ZUD2 1GB4A 3HOYB 3K58A 1QNUA 1Z6HA 3IFDA 3UI2A 4FF3A 3R8BA 5H92C 3MTSA 2B63B 2WXPA 2K5DA 1WCMB 1MSHA 4IDIA 2W82A 4KY6A 1QOFA 3C46A 1R4PB 2HCCA 3EROA 1ZPSA 4L2YA 3ONAB 3L4PA 4X3SA 2NWGA 4RKLA 3N52A 2IWHA 3HKZB 4ZRZA 2F0GA 3KWLA 1K52A 2XSCA 1F0ZA 2WXJA 1A3VA 1BCPD 3HP3A 1HZ6A 1K8OA 5F2DA 5LNK1 4OZBA 1OXSC 1HEZE 4A3DB 2D5DA 4XIGS 3URYA 2ICIA 3OHXC 4OHJA 3OIQA 3IAYA 1DOLA 1KAAA 2JA5B 3Q8BA 4NAWB 1I6HB 1C4PA 1QE6A 1AWDA 1DXMA 2JE6I 3W5UB 5C6AA 3PUZA 4C3IG 3K5LA 2LMCB 2M56B 1CI3M 1PLFA 2J52A 1I4XA 3OSOA 1B9MA 2PMVA 2F0MA 4IUQA 1T5EA 5LHY1 4MACA 1CA6A 3MVVA 2L55A 3GQBA 5FLXE 1PTOB 3WDNA 1YJIA 3NVWA 2QF7A 2IJ0A 2DY7A 4LK0M 2CJOA 3P1MA 5KYIA 1TQOA 2EELA 1EY4A 1RWSA 3IFTA 2EXZA 1O80A 2JA8B 3NVVA 3NSWA 1EY7A 2Y0SB 5CV4A 1GUTA 3OMCA 3PIP3 4E6IA 1VCIA 2PNRC 3MA2B 3B9JA 4ZRPA 2V0GA 4C1NI 5C0XI 3BK2A 3NK9A 1F2RI 5M5XB 2MGSA 2PW9A 4K2LA 1HZ5A 2QMTA 2CQAA 3BVZA 3ITPA 3OMGA 2KECA 3U7ZA 1VMPA 2RDGA 3PMFA 1JOQA 4LK1C 3PZ8A 3Q8CA 4K14A 2QJLA 2O5JC 3H94A 1FD7D 1PFDA 4WQMA 1PZID 4J8QA 1XLOA 3D3RA 2PLPA 3CWIA 1EWHA 2KN4A 4OVZA 2XVSA 3R2TA 1L4ZB 3I90A 4ZAIA 4YSZB 3VR5A 5H8YE 2B2WA 2BDNA 3P75A 5I2YA 2L1BA 4HTHA 4ZOHC 5FO7B 3MEHA 2N9LA 5LL6X 5CV5A 1RTOA 4YSYB 2KJXA 5I9OA 2O5IC 4MN3A 2EY1A 1CQFA 1ZDXA 4ODGA 1TWGB 2JU6X 1SAPA 3DHQA 5CORA 1LO5D 4EE2A 2Q8IB 2K6AA 3OW7A 3E56A 4XQNA 3AE8B 3J9CA 2MHVA 2VB3X 4ZKBB 1EZ6A 3R93A 4P6VF 1ZXIA 2C9OA 3ZJTA 2RA4A 4DXGA 4IALA 1QB5D 4AYBB 1NENB 2NVQB 2D9UA 1BQQT 1E2ZA 5CGKA 3SVMA 3U4EG 1ZYRD 4QF4A 3MC0B 5I6WA 4RF0A 4TRDA 1E10A 4USAA 4L63B 3NQIA 3RZDB 1T6BX 1C48A 2F0SA 3BDCA 5IGBA 3LYYA 2E6XA 2BBCA 5KRUA 2NN6H 4DXFA 3MXNA 1STHA 1Q3LA 4XYQA 1JROA 4IFDH 5KIXA 4IUVA 3SFEB 3HOWB 4XQQA 1PGAA 4ABNA 1T3QA 4FXDA 2DN8A 4DU9A 3RPFC 1ZYRC 5TSSA 5C2TB 1HHVA 1SDFA 1B9NA 3D31A 4ZKCB 4JK1C 2KQ4X 3KLSA 1I6VC 4HMIA 2V3PA 5JPNC 1B3AA 2PPBC 1ESRA 1PFBA 4YTNB 5JXVA 3S1MB 1FNVA 1PMRA 1OXUA 1TS4A 1YN3A 3HOXB 4KJNA 3BS1A 2YEPF 1W6KA 4DFAA 1D5MC 3M4YA 1RD9D 1MD2D 5MPOA 1QF6A 1JOKA 2WXLA 1KNAA 2VZKB 5HGTA 1FFVA 3NTHA 2KEDA 4US9A 4RHRA 1PXUA 3D8GA 5DM63 1H9MA 3NS1A 2XWBB 1DD2A 1HQMC 2A6HD 1EY9A 1JB3A 1P7EA 1WD0A 3NE5B 4US8A 1H9JA 3U2SC 1X3PA 2QKIC 3C1FA 1RJTA 2KHSA 4G7OC 1B2TA 2EJFC 4EQOA 5EKLA 1DOIA 2LHDA 3SK8A 2MH7A 3SK6A 5M3FB 1OQQA 1FCCC 2K32A 1Y56A 4BY1B 3AECB 3BWUD 3GTOB 1DZ1A 2H89B 1B9RA 4K8IA 1BO0A 2A6HC 1MHHE 1R9TB 4A3IB 2FMMA 2OEOA 3RD4A 1EEID 3IT4B 4A3EB 1XO3A 2JYOA 4KN4C 3SK5A 3P7JA 2X38A 3SK4A 2B2YC 5EJWA 1Q1BA 2L83A 1STEA 2F0IA 3FPUB 3ND8A 1U4LA 4BY7B 4FXCA 1C9FA 2RVLA 3G7LA 4RAUC 1LT5D 3FILA 1LT4D 1U9RA 3Q24A 4L6TB 4DA2A 1Y8OB 5HFYA 3TZDA 1EL0A 2WDQB 4WIPA 3FPPA 3VQIA 1F9QA 3C2PA 4KKIA 1WTVA 3K5NA 1EIHA 2JYTA 2J42A 2K04A 4EQNA 1VDZA 3BDLA 5FO8B 3S14B 2E2JB 2IPKD 3NHHA 3FAHA 3NRZA 4ARIA 2JXMB 2W55A 1V97A 1QOBA 5IODA 5C5MA 3GO5A 4B9XA 2X6GA 3SE0A 2JSOA 2XNAC 1YN5A 3R3OA 4IQZA 4K5VA 1SB3C 2K5WA 3U9OA 1V8CA 1OXVA 2BTEA 4RCOA 3N9YC 2KWDA 1WTPA 2PYKA 4KN7C 5I4DA 2CJNA 3I91A 2L1AA 3NQTA 4QB4A 3FC4A 1IYVA 1K8MA 2EDGA 3K5OA 2MP1A 5D14A 4C1NK 2B2VA 1SNOA 4HMJA 2F0NA 2F3WA 3DWMA 5BMHA 1FD6A 3W2DA 4H13C 4DAYA 4GLSC 4OIJA 1FM0D 1V43A 1K50A 4Q0FA 1EY0A 2K28A 3S1NB 4HJGE 3K5MA 2CVRA 1D2BA 1ET6A 3LXFA 2F0WA 2FBWB 5C0XH 2W3RA 1ACCA 3M4OB 2R92B 4RA8A 2NBFA 1B4OA 2GB1A 1KLGD 3QIAA 4OO1H 5DAUA 3AE5B 1SE2A 2WP8J 1SJHD 1TIID 3A8KE 5JAVA 4A3BB 3GTLB 4YT0B 4N9PA 4ME5A 1SYFA 4AS1A 1FIQA 3A8IE 4K8JA 5EE1A 2NB0A 4HRSA 3GP7A 1P7FA 3MXGA 4X3UA 1S5DD 1E0BA 4JBWA 1I4PA 1SE4A 5HHDG 4K6LA 1G91A 3IAS1 3MFGA 3FEWX 4UDUC 3EJIA 4DNRB 1CHQD 3H3VC 4K5XA 2EYOA 3D6WA 4OZAA 3EUB2 4B0MA 4WRDA 2AWOA 4KTAA 4CKBA 5C44B 3DXJC 4RGMA 3MZ5A 1K53A 4DN4M 4FYDA 4RCNA 4TQ1A 1N5WA 1JWUD 2PZUA 1M8AA 5EGTA 1V1PA 1JC7A 3HRDD 3ETRA 1RKNA 5C0XJ 3AEEB 4IOIE 3NBIA 3FILB 1L0VB 4CGYB 4R8NA 2NN6G 5A2QE 1SYEA 2QCPX 3HS0C 1G291 4IFDG 4PV1C 5KNBA 2NZ1D 3TEYA 2MJ3A 1AP0A 3UI3A 1M4VA 1NAPA 3GTKB 1XTCD 1STYA 5LL6S 4EQPA 1EZ8A 4BA1I 2MJEA 3W9CB 2F0LA 5IGFA 2WAQB 1IHZA 4FNFA 1DM0B 2PZTA 1FR3A 3HVDA 3D4RA 4DQOC 4DAPA 4RFBA 2ON8A 2F0UA 1K51A 3V2TA 1PGBA 1Y8NB 1ZP0B 3A54A 2EY2A 1VF7A 1F77A 3OIPA 3PUVA 2M0AA 1EY6A 3K0YA 3IT6B 3E5SA 4FXGC 2IX3A 4OZCA 4KD4A 3NVZA 3DWQA 2SEBD 2V3NA 3VR8B 2R7ZB 3O13A 4G7ZC 5CMDA 4TQUS 2PZWA 2F0OA 1JE4A 2FJ2A 2OF1A 1SSNA 1TJEA 3ZJVA 3PIO3 5KNCA 1DONA 3HUIA 3FVQA 2IX1A 3MP9A 4P2CB 1KLUD 5M9OA 2KUMA 1UAPA 4M0WA 1D1IA 2WLBA 4CBVA 1GJXA 5BMIA 1TKWB 2NYZD 3T53B 5C5LA 1OO9B 4MH8A 4L23A 2INNE 3MXUA 1AZQA 4HSVA 5JVH3 3ERQA 1ILQA 1TWFB 3A7LA 5EBDA 2JQRB 4C3HB 1DJRD 3VR4A 1BCPF 1BNZA 3DEPA 4G7HC 1N63A 4KGTA 1CJEA 3TN2A 3NUHB 2A73B 4NMZA 1G8ZD 1QCBD 3CRLC 5EKIA 2B2YA 1X32A 1C77A 1PFNA 4REZA 1D4BA 2O4XA 1CM9A 1OQRA 4H7BA 2ONQA 4YXDB 5BYSA 3VYUA 3I4MB 1A70A 1L6VA 3K59A 1CHPD 3VRBB 2WQYB 2NTSA 3TP5A 1FXIA 2F0JA 3BVGA 2O2LD 3N6RA 5C4HA 2KA7A 1LTTD 4A3JB 1G2TA 2FMCA 2WU2B 4RNAA 1V1PB 4IKGA 3S16B 1WYGA 4KGRA 4DAVA 3I4NB 4DK1A 4WFN3 2BS2B 3CU7A 3DWAA 1R7SA 2F0EA 2I38A 5EE0A 4LTUA 4HCEA 5JEAG 3KWVA 3PUYA 3FRPB 3TZUA 1N62A 2N9KA 2Y5PA 4DK0A 2CW0D 2AWNA 3AB5A 3X3NA 1FGBD 1NR2A 4OIKA 4YIJA 3R2IA 1BMLC 2K03A 3IL8A 4ZUIA 1HTPA 3HG9A 4XWTA 2JEAI 3I4LA 2IL8A 1JORA 5DEHA 4KGSA 2B2VC 3FKIB 2G9HD 2WXIA 2F0KA 3TUOA 2QEJC 2M00A 4C3JG 2E2IB 2K05A 1VF5C 2KDMA 3KLSX 1PFMA 1NEKB 3ZJUA 4KD3A 3SR1A 1SNDA 2CW0C 2WXHA 3PUXA 1TY0A 1NCVA 4PMWA 1RF2D 1DGJA 1EYDA 3AE6B 4OO1G 1ENFA 2L11A 1ICWA 2FINB 3C1EA 2K5QA 1FMAD 3I9V1 2M19A 2EKIA 2VB2X 5G3LD 1WSPA 2SNSA 5CR3A 3KLRA 4EGVA 1QJOA 2N0SB 1V8QA 1MI2A 1IKLA 5ISRA 3AE2B 1PRTB 3BYYB 4ITKA 1TKGA 4A90A 2EJGC 1QNKA 3VRAB 4FVMA 1ZDVA 1Z7TA 1FRRA 4C3IB 1C4CA 1YJJA 1PTOF 3PZ7A 1E0ZA 3SHLA 2INPE 1IBXA 4IUPA 1F9SA 4M1UB 3NZ3A 3QOJA 3IAM1 3MFYA 4NP5A 3RZOB 3CKIB 3QOLA 1SNMA 3QO2A 1GB1A 2OT2A 1EYAA 3EFXD 4N9TA 1MBYA 2WV6D 4HKQA 2RMMA 1V1OA 4HEDA 5IT9L 1SEBD 1EY8A 1O7YA 2HDLA 4ID6A 4LMQD 1UNSA 3AM9A 1ZEQX 1N5XA 3LWEA 5K36H 1ZOYB 3P4QB 1DOMA 5CV7A 3JAML 1U4PA 2GA4B 2JZPA 1CT1D 1II3A 1LTRD 1DOXA 1NR4A 2NVTB 5EPJA 3GTJB 3MWYW 2TMPA 2AQ2B 4QUFA 4V190 1MGSA 5AUKA 3NPPA 1JR0D 2R6GA 1HA6A 3GS2A 4PMBA 3TDQA 1I4QA 3OWEB 2RKSA 3AEGB 3M7GA 5IIFA 4A55A 3GTQB 1PRTD 2WS3B 4Z9CB 1ET9A 5FK9C 3K7AB 2DY8A 3HOZB 2HCIA 2QDBA 3CQZB 2K9XA 4IURA 1MPEA 5GXGB 5CV9A 1SMYD 1PTOH 1SE3A 1LTAD 1BBXC 2JA7B 2WXKA 4Y7NB 3AMUA 1PRTC 2F3VA 1DCZA 1QLBB 2A69D 5CBEE 4LJZC 2MUYA 4F87A 1OFFA 3KBXA 1CFMA 3VR6A 5KNDA 3I8ZA 4XE0A 1UGJA 1SMYC 4PNYA 3SDZA 3J7AF 3S2DB 1A3TA 3GTGB 4I7ZC 2WXRA 3HVZA 2KEEA 5BN3A 4OGQC 2SDFA 1EU3A 1EY5A 3I70A 3M85A 3I3CA 2A69C 3A55A 1HA5A 4LAAA 2B8GA 4F7XA 4DNTB 1C78A 2F0TA 1GHKA 3D6CA 3S15B 1IBXB 1WTOA 1BF4A 2QIEB 4ARCA 1Y1WB 2KCNA 3ABVB 1VZ7A 2F0VA 3LB8C 2G9DA 3VR2A 4A3FB 2VUMB 3NWSA 3CIRB 1J9OA 2KCCA 1TS3A 3OOCA 2CHBD 3MAQA 4IZ8A 1VMCA 4XDDA 1JMLA 2LUMA 2DNCA 1J7CA 1KRHA 5C3XA 1NYQA 5HG2A 1IKMA 1HCZA 5K5PA 1FFUA 2XRSD 2LFNA 1LTGD 2X69A 4XT1B 2KACA 3J81L 1RM6C 2LS01 3MHZA 1WWTA 2DLBA 2OEDA 1LTID 1C76A 2RBMA 1VLBA 2F0DA 1RYJA 1FNWA 3KBGA 2KOLA 1HQRD 3S2HB 3B2GA 1TKEA 1YQ3B 1ZE3D 5M3MB 4K6DA 2MJ8A 2E75C 3D4WA 4MIUA 3S1QB 5JJZA 4NKLA 5IOCA 1SJED 1NI3A 1H9KA 1SYBA 4ULLA 2E74C 3F2UA 2XWJB 1B50A 2G1EA 1O78A 1GUGA 2BS3B 4K5WA 2JA6B 3AE4B 2JEBI 1HUNA 2AQ3B 1PDXA 1JOOA 1NSNS 3MJ5A 1IYUA 1D1KA 1VR9A 2BDOA 2E3TA 1KDBA 1GXDC 5T1GA 4OW0A 1GUWA 2ZXOA 2R3ZA 2DYMA 2MEKA 5E6JA 1A3UA 1GUNA 2ZXPA 1U4RA 5HURA 3H09A 3G6JB 4RGOS 2RSNA 3GD7A 5E4XA 3EQLC 1VRAB 2JXTA 1WTRA 3J80L 3DM1A 1LT6D 3GTMB 5E3FA 1TT2A 3V96A 2SAKA 1LTSD 3IKJA 1F2LA 4IUNA 3T56B