2I2YA

Solution structure of the rrm of srp20 bound to the rna cauc
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
150
structure length
150
Chain Sequence
MQYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTEGSHHHHHHMHRDSCPLDCKVYVGNLGNNGNKTELERAFGYYGPLRSVWVARNPPGFAFVEFEDPRDAADAVRELDGRTLCGCRVRVELSNGEKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords (5'-R(*CP*AP*UP*C)-3')
publication title Molecular basis of RNA recognition and TAP binding by the SR proteins SRp20 and 9G8.
pubmed doi rcsb
source organism Streptococcus sp. 'group g', homo sapiens
molecule tags Rna binding protein/chimera/rna
total genus 44
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2006-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2i2yA01
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2i2yA02
5LXRA 2XSFA 2M2BA 1URNA 1IGDA 5HG2A 2K3KA 1YIJS 2M0GB 1VQ4S 1FJ7A 3THTA 1KH0A 3MP9A 2M4MA 2RS2A 3CD6S 2LMIA 4V19X 3NMRA 1D8ZA 1H2TZ 3UI3A 3PIOQ 2X1FA 4RU2A 4C7QA 3CMES 4CH1A 2QMTA 1JJHA 3I55S 2I2YA 4TU8A 4YOEA 3J7YU 1OWXA 5MLCV 4PR6A 1M90T 2KI2A 3GB1A 3U1MA 1VQKS 2LCWA 2U1AA 4WIIA 3CF5Q 1FJEB 4IOIE 1WEXA 1FXLA 2N82B 5IM0A 1N52B 2MQPA 2G0CA 3U1LA 1EM7A 2MKHA 2KXFA 3VALA 2OTJS 2DNRA 2MXYA 4FXWA 2DIUA 3P5TL 1VBXA 2CQIA 2ZJRQ 2JZPA 1VQ7S 2QEXS 3MUMP 2CPZA 4Z2XA 2DGTA 3MD1A 2HGLA 2DIVA 1WHXA 4UQTA 1U1OA 2OJ3A 1OPIA 5IQQA 2DNMA 1RKJA 1H2VZ 2LECA 1U1RA 3MURP 3UD3P 2HZCA 3UCGA 2ZJPQ 2E5GA 1ZXHA 5IM0B 3CCES 4D2KA 2E44A 2MZ1A 2M52A 2DGXA 2MB0B 4TLQA 1JJ2R 2OEDA 1X4DA 2IGGA 5HFYA 2DGOA 3H2UB 1KC8T 2DGVA 4ED5A 3NS5A 1KQSR 3MI7X 3VAHA 3MUTP 3BS9A 2ADBA 2LYVA 2MKCA 1OO0B 4GLSC 1WI8A 3G96A 1WEZA 1VQ8S 4ERDA 2PEHA 2DH9A 3HI9A 2MJNA 1UFWA 2DNZA 2VONA 3SDEA 2J52A 1VQ9S 1WTBA 2OIHA 2J76E 2NZ4A 2CPEA 5DETA 2AYGA 2LEBA 2VOPA 1U1KA 2KFYA 3CMAS 1PGZA 1K53A 2MYFA 3UCUP 1XCTL 2MQMA 4FXVA 1WF1A 1X5TA 2AYEA 1ZZNA 2PE8A 1SJ3P 2DHSA 1X4HA 1MI0A 2DGSA 4WH4A 1X5SA 5BMGA 4LJMA 4WFBQ 1M5OC 1H2UX 4IOCQ 2RNEA 5D77A 5GADU 2KQ4X 3SDEB 5DDPC 2RT3A 2ZJQQ 2MKJA 3NNCA 3CCLS 2RMMA 1DRZA 2JVRA 2ERRA 3EX7B 1HD1A 3IWNC 2MMYA 1QM9A 2DNKA 2X1BA 5BMIA 3S01A 3MXHP 3BO3A 4UY8T 4Y0FA 2MZRA 1VQPS 2KXHA 2XS5A 1FJCA 1FCCC 1U6FA 2FC9A 5EN1A 2J0QD 2RRAA 2MQQA 2QSDA 2DO4A 5BMHA 2DNGA 3Q2TC 1YWXA 3PIPQ 2G4BA 1R8PA 3TP2A 2N9LA 5D78A 3I56S 2FY1A 3RW6A 2DK2A 1HD0A 2XNRA 2AD9A 4BS2A 1SJFA 5LSOA 3BO2A 5DDQC 1QVFR 2LA6A 1F2RI 2M9KA 3ULHA 3CXCR 2SXLA 2AYMA 2CPHA 4F25A 2MGZB 3CCSS 2KM8B 2OSRA 2KT5A 2YKAA 3SMZA 1N54B 2N3LA 3NNHA 2PW9A 2KU7A 3EGNA 4A8XA 2K0PA 1GB1A 1HZ5A 1K51A 3IRWP 2VODA 2MZSA 2ZW0A 2AYBA 1MHHE 5HI1A 3SXLA 2DB1A 1WWHA 3S6EA 5GMKa 3UCZP 1X4CA 3CC7S 1UW4A 1FT8A 2L08A 3L3CA 5HL7Q 3CCQS 1PGXA 1JMLA 2N9KA 4HJGE 4YB1P 4TU7A 2D3OR 2KDMA 2DHAA 2HVZA 2RQ4A 1YJWS 2CPDA 2MJUA 5BJRA 2MKIA 3R27A 1YHQS 1DBDA 3THPA 3FEYB 1YJ9S 2NMQA 1X5OA 1WI6A 3CCUS 1U1PA 5LJ5Y 3VAMA 2RVJA 2DH8A 5ITHA 1WG4A 2CQDA 3VAKA 2DNHA 2CQ3A 1DHMA 1X4AA 5DDOC 3CCMS 2N7JA 5DM6Q 2LQ5A 1Q86T 2DNYA 3VAGA 2CQ1A 2CQ2A 2DHXA 3CTRA 1AUDA 1QVGR 1FD6A 2DH7A 2X1GA 3DLLQ 4OZ0A 3MUVP 1YJNS 2DNLA 2KG0A 1Q7YT 3CCRS 1VQMS 1A7GE 1P7EA 2PLPA 1S72S 2BOPA 2MY8A 3N9UC 2MKKA 1KD1T 1WF2A 1VBZA 2JWUA 2FPHX 2XB2D 1N88A 1PGAA 2KWDA 3TO8A 4QU6A 1X4FA 2YWKA 3S8SA 4WKRA 2RS8A 2PTLA 2V94A 1U1NA 4IKGA 2J8AA 1XF5L 1VC6A 3B4DA 1YMHE 1BY9A 1N8RT 3VAJA 3R1HA 5CA5A 1W2BR 4PRFA 2LHEA 4MACA 1PGBA 2U2FA 5IFMA 2KVIA 3J7ZT 5GAHU 3V3XA 2L41A 5JXVA 1VQNS 2IGHA 3ZZZA 3LPYA 2LUMA 2D9OA 1A9NB 2MHNA 5HO4A 3MDFA 4U67Q 1U2FA 3Q2SC 5JVHQ 4CQ1A 1ZZFA 2MQOA 2GHPA 4J5OA 1UWXA 1KOHA 1VQLS 2CQCA 3BEGB 1M5KC 1VC5A 1U1MA 2M8HA 2UP1A 1WG1A 1H6KX 4M5DB 3G8SA 1WHYA 2BZ2A 2MGZA 3P3DA 2WBRA 1SJQA 2ONQA 3NS6A 2RQCA 2CQPA 4CIOA 1K50A 1Q81T 2KYXA 2I38A 1X4BA 2HYIB 3S7RA 3VF0B 4QU7A 4QPTA 1U1LA 2KRRA 5DM7Q 3FEXB 2CPXA 3CC2S 2F3JA 3LQVA 2MSSA 1IGCA 2K8GA 2JX2A 1C9FA 2A3JA 2GB1A 1F9FA 3UWTA 1U6BA 1VQOS 5HHDG 5CYJA 3VAIA 3CC4S 2KACA 1X4EA 2JU6X 1OIAA 1FNXH 2OTLS 2M8DB 5H1SV 2N7CA 1S79A 2EVZA 4LIRA 1SXLA 2XNQA 2OSQA 2JSVX 2DITA 2F9DA 1K9MT 5LJ3Y 5FJ4A 1K73T 1JMTA 2CPJA 1P1TA 4ZKAA 4WFAQ 4WF9Q 4OZAA 1NU4A 2DO0A 2LEAA 1MVKA 2DISA 1M1KT 1WF0A 2LHDA 3K0JA 2LKZA 1YNTE 3EGZA 4F26A 4HKZE 2KRBA 3ZZYA 3CCVS 2LXUA 2JXTA 2J53A 1HL6A 1KOOA 4OZCA 2GO9A 3BO4A 1D9AA 1VQ6S 3MOJB 1MPEA 1HZ6A 4OZBA 1UP1A 4OZ1A 3G6ES 2E5HA 2HGMA 2MKSA 2J0SD 4F02A 2LGIA 3FILA 1VBYA 2M88A 1NJIT 1K8AT 3OW2R 2MPUA 1QKZA 2RPVA 1RK8A 2GI9A 1CVJA 3B4MA 1MHXA 5LSLA 5JVGQ 4IO9Q 1VC0A 1VQ5S 2XS2A 4KGTA 1O0PA 2ADCA 4WFNQ 2XS7A 2E5JA 2CPFA 1YI2S 4LMZA 1U1QA 4TU9A 4PKDB 1X5PA 2B0GA 1WHVA 4C0OC 1D4BA 1FCLA 2HGNA 2EK6A 2X1AA 1K52A 2KHCA 2G1DA 2CPIA 1HEZE 1IQTA 5GAEU 2LA4A 1Q82T 3RW7A 1P27B 2M7SA 3FILB 4WCEQ 1DZ5A 2JWNA 1XCQL 1B7FA 1Q10A 2N3OA 1YTYA 2KH9A 3P6YC 2Q79A 3DXBA 2DNNA 1IBXA 2RRBA 1JJ4A 1NO8A 1G2EA 2DGWA 5DDRC 2MQLA 2KM8C 2YH1A 4YUDA 4IUFA 4CH0S 2DNQA 1SJ4P 1SJRA 2JRSA 1HA1A 3CCJS 2DNOA 3UD4P 3G71S 1PO6A 2M70A 2KN4A 4KGRA 5GVQA 2KXNB 2MSTA 4C4WA 2KG1A 3R1LA 2MZJA 3CUNA 1L3KA 1UAWA 2DHGA 2JVOA 2RUGA 2MQNA 2DNPA 2QFJA 3G4SS 4IOAQ 2L9WA 1XN9A 2CJKA 2EK1A 4Y00A 4W92B 2MZTA 1ZH5A 1P7FA 1IBXB 1WELA 3NNAA 2MY7A 1M5PC 2VOOA 2CQ0A 2QA4S 5LXYA 1YITS 2EELA 3US5A 1R8HA 3CULA 2E5IA 2IGDA 4KGSA 4EGLA 2DGQA 3G8TA 2D9PA 3H2VE 1WG5A 3MD3A 2NLWA 1WEYA 2ZW1A 4W90B 3HHNB 1WHWA 3D2WA 2MZQA 1X4GA 1GB4A 2CQBA 1F2RC 1X0FA 2F9JA 2CQHA 5GAGU 3TYTA 2YH0A 2YTCA 2O3DA 2CQ4A 3V4MA 1M5VC 4P6QA 1FHTA 2ON8A 3CPWR 2CQGA 3UE2A 2CPYA 4QQBA 3P49B 3VAFA 2FHOB 3G9CA 2FC8A 2RU3A 2DGUA 5CXTA 2LXIA 1FO1A 3JB9k
chains in the Genus database with same CATH superfamily
1AUSL 4BKSA 3APCA 4I1TA 5CCLA 4B3OA 2GBNA 2LMIA 3JW0X 4KKOB 5C23A 1YBTA 4RU2A 3MMBB 4C3KA 5GMVA 1DOIA 1JJHA 3CJ5A 3AJ1A 3OVBA 4X4NA 1NSPA 5CYMA 2WXPA 2YWGA 1WE6A 3DRRA 3LF0A 3B78A 1OY8A 4KGMA 2N82B 3B9JA 1OJ4A 2HHPA 4YY3J 1EM7A 3UNGC 2WLBA 4NAWB 5J1EB 1QSSA 2DPIA 1ROFA 4ILRA 3BYPA 3AEDB 2W9CA 1LFWA 2RDIA 3CJ0A 3TCAA 4WBFA 2DGTA 2XK5B 3RNBC 2OJ3A 1YRUA 3P96A 1SKUB 1Y56A 3MURP 2FHKA 4QWBA 3LO3A 2Q5WD 4UOCA 4J37A 2MB0B 2QEJC 3B82A 2IM3A 1HR0J 4XAKA 4HDOA 5KFKA 1R0BG 3QJPA 2HFNA 4ERDA 3ZJUA 2UVVA 3HI9A 2MJNA 2V2QA 2HNZA 1S1VA 2DNZA 3SDEA 3MZIA 2AL3A 1FF2A 4USUA 1K53A 2ABYA 5HLFA 4ICVA 5KFVA 4FPIA 3QQCD 2ASLA 4BC9A 2YKPA 2OHFA 5A6WA 2HMIB 4CLSA 2F4VJ 1LXJA 3T5JA 3FBFA 1GC7A 4QIVA 3TR5A 3UIOB 3EX7B 3GLJA 4A3PA 1TL3B 1E8XA 2J0QD 3HVTB 2RRAA 4DQOC 3E2EA 2DO4A 2HWTA 4DG1A 3W7BA 2G4BA 3NVVA 2N9LA 1S57A 2F8HA 2LXFA 2AD9A 1SJFA 3HHKA 5E7OB 4DX6A 4WIPA 1B0VA 2R4FA 1OGWA 1PYTA 4MMOA 4BLGA 3IBCB 2CVIA 5GMDA 3AOCA 4DR4J 3EXYA 4FDFA 1HIYA 4XPEA 3MM7B 2OHDA 3W1YA 1IKWA 1YOVB 2PIAA 1N0VC 3FZBA 3VHQA 3MFGA 3U02A 1STEA 3IG1B 1N6ZA 3PKYA 4G65A 2UUCJ 4IH5A 4DPXA 2V69A 2I1JA 4KGZB 1DHMA 3P2BA 4RMAA 4ZVEA 4B3RF 2DHXA 2BKPA 1UETA 2YQ3A 5H9FJ 1TFYA 4C8OA 3KH0A 2BRKA 3N28A 3MAAA 3HVRA 1OMSA 4DUZF 1T9YA 4LF9J 4I2PB 3AQOA 1RWVB 4KHPF 2QA1A 5A2QU 1ZKHA 3VR8B 4MFBA 4WXOA 4CNYA 1SCJB 5ETVA 3TZYA 1C0UA 1Q8BA 3DBRI 2N7YA 3LOUA 4LR7A 3VAJA 5CA5A 1FWLA 2JC1A 3AOAA 3J7ZT 2AX0A 2GIFA 4ZHRB 1JLCA 3PW5A 1E7VA 1VOMA 1FMAD 4RUHA 2MP2A 1FI4A 3QO9A 2M4NA 4UZBA 5HO4A 3MDFA 1RABB 3ZXRA 3POTA 3UW1A 4B3MJ 4FVMA 1RTIA 4Q5VA 1U1MA 1WRDB 5ETLA 3ZXWA 1HNWJ 1D3WA 1CULA 4M5DB 3AFGA 3MM8A 4C00A 2ONQA 2A2DA 4ZOSA 5EE3A 1UGMA 1XLNA 2XWXA 4BHQA 1VCBA 1T05B 3ZXVA 2WRMA 1U1LA 2VL1A 4ANDA 2Y3AA 4MSQB 2GB1A 4KIKB 1X8DA 3ZJVA 3VTWA 3PJXA 1KR4A 2VBYA 4DV7F 2DITA 2PIIA 2ZH8A 2ZUGA 3U52E 4EI2A 1Z1ZA 2DISA 4A9AA 1GFWB 3ZZYA 1HWIA 4DXLA 3TQ1A 1RT2B 3MEEA 4WYLA 2BJ7A 1VD2A 4OZ1A 1ZDXA 4A47A 2E5HA 3A8KA 1L4ZB 2L05A 5KFNA 5G0RB 4PXBA 4BBNC 2FIFA 2RB7A 1CBKA 2RPVA 1X0PA 1WR6E 1YLXA 3ZZPA 1SIJA 1XEEA 4HJKA 2LEPA 1WHVA 2HSEB 1TKDA 1IWAA 4X4PA 3HHLC 4ZDVA 3GE8C 2V9KA 3DXBA 4QWAA 2HQDA 1PJ7A 4DPTA 2B9XA 5D6GA 2AEFA 4F36A 1FIQA 2B9EA 1HTQA 4ZCKA 3N6LA 1TUGB 5AXMA 4MKYA 4DR1F 4PG5A 4LFBJ 1L3UA 4ED8A 1NDPA 1KEKA 3OUYB 2A4ZA 1N5YA 4URSA 4EGLA 1WMHB 3W9CB 1U02A 3RAMA 5KHQA 1NSKL 4NOHA 1JWUD 2ZW1A 3PJWA 3KLSX 3ZUNA 3D2WA 2VFTA 1SE4A 3DRYA 1F2RC 3I4HX 3WAOA 2WXHA 4GKJF 3EECA 4QQBA 1EWYC 1WIAA 4A8FA 2LASA 2VG7B 5I3QA 2DGUA 4AQYJ 1E9MA 2XSFA 1LWCA 2XZWA 1AN8A 2XYGB 2UVWA 2D11A 3DXSX 4RCOA 2GBJA 1TZ0A 4ZVRB 5H9EJ 4RGNA 2DR7A 4QR2A 2KD0A 2EPIA 2QMTA 3I55S 4A8SA 1U0HB 1OQRA 3RGIA 2XHWA 1E6VA 4KYZA 3F56A 1IKXB 4K4WA 3GB1A 3ZRCA 2I1RA 4W9LA 4KZCA 4ZK7M 4J9NA 2C2RA 3AH6A 1D5XC 2O1PA 2G0CA 2CKHB 1NKCA 3L17A 3N20C 3OTDA 4CT9A 3EGVA 4ZYSA 4ICUA 2XULA 1XQQA 2H48B 4ZRQA 2VU5A 5E3RA 1WYGA 3TRGA 1IBLF 4P1BC 2HZCA 4RW7B 2RU9A 4Y2CA 2MBOA 1A0OB 4ECZA 4ED5A 3A4TA 1RLCL 5HVFA 1G4CA 4LVNP 5L1KA 1KFYB 2NZ4A 1RTJB 1YJUA 1JCKB 1NEEA 2LDYA 2JVCA 2DHSA 2VHGA 2IY1B 3BVMA 3HHEA 1QUVA 3I87A 2B4UA 4IOCQ 4MTPA 1C76A 4IR9A 1RT6B 2KZRA 4DQSA 3GCXP 2NCNA 2L83A 1ZTTA 3I3TB 2RMMA 3N32A 1TK5A 2KKCA 4ZP6A 4AQ7A 5LMNJ 5F0UA 2R7WA 1FFVA 3BH6B 4TYBA 3MM5A 4Y0FA 1RADB 4J9KA 2POKA 2C1EB 1B70B 4IH6A 4GC7A 4WZQA 2HAIA 3L4PA 3DYAB 2L48A 3SEBA 3Q8VA 1QOBA 5KFLA 4BBYA 3TEHB 2CA9A 4BS2A 1WGHA 2DBBA 4IW0A 2DD8S 2ATCB 3D67A 1ZM4A 5KFMA 2KM8B 2OSRA 3SMZA 2N3LA 4CM0A 3M2UA 4NE9C 2XCAA 2DB1A 1WWHA 4F3QA 4NJ6A 1KP6A 4H4MB 4NCGA 2L08A 4A8MP 4HJGE 2HVZA 3H90A 3OVAA 2IM0A 4JI7F 1MROB 2QJLA 1AROP 3K58A 1WXVA 2H89B 2R7OA 3I63C 3LANA 4IH7A 1FTRA 4JV5J 1FDDA 3IWLA 3OHAA 3VAGA 3THVA 1TL4A 3GIJA 2AEHA 2AGQA 3M6XA 2V3PA 2IY0B 2CG8A 3D3CJ 2SEBD 4NMXA 2BYTA 1OFFA 2BKRB 4ELVA 3N9UC 2D5GA 1JRPA 2YWKA 2D69A 4MH8A 4LF6J 1WR1A 1BY9A 4JB8B 3V4IB 4DUTA 2GMLA 4K1RB 5HBMB 4PAAA 4DV3J 2WHIA 4KV8B 3Q0AA 4MKAA 2QYGA 4ER8A 4YMEA 4J90A 1N48A 1F0XA 1RCXB 2WBMA 2C2MB 4B3TF 4ZCIA 1YGYA 3K5MA 4UDUC 3TAMA 4ZLNA 1ZZFA 3DRPB 3QJLA 1V6EA 5M2PA 3EE3A 3U7ZA 4YR2A 1X7VA 4RLEA 2V1YA 1WHYA 1NB2A 3H4BA 3NS6A 2RQCA 2XSJB 4QU7A 4FF3A 2F7VA 2GZOA 4M0WA 1JB0C 3H42A 2CNKB 1IGCA 4F4AA 2E1AA 4ZVHA 2C42A 4RW4B 1RJJA 2XMKA 3P63A 3HULA 2ZE2B 2GOWA 1KFDA 2IC3A 2YWWA 1V3ZA 4B9KA 3MGJA 3BQ1A 3FCWA 2AJFE 1RUSA 5K8OA 1KOOA 3TAPA 1WKLA 2GJIA 3S2AA 1OTRB 1HBNA 2CVEA 1S9GB 2Y9HA 4F02A 5IKCM 5J1NA 1K8AT 1SQGA 3GQCA 1NKBA 3UO0A 2WNMA 1JLAB 2W9BB 2EKNA 1N5XA 5AXNA 2IDEA 4NZ6A 3Q69A 2XQCA 3V6JA 5BYRA 4K0KJ 4I6WA 1NDLA 4WP8A 4LF4J 4OVZA 3RW7A 2JRIB 5G4DA 3AE6B 2G4SA 5J2QB 2B9YA 4PS3A 3ITHB 2K3UA 1RYJA 4CH0S 4ECYA 4BCAA 3V81A 2J4XA 1IJEB 1HI8A 5FKAC 2H1YA 1RT3A 4PXDA 1WC1A 1LM8B 4DQPA 2WXMA 4NXMF 1V3RA 3QAUA 1XN9A 1FJGJ 2WYQA 5JJBA 4Y3CA 2QDFA 2G1HA 1V5VA 2XBBC 2EW9A 1WE7A 2GX8A 4IO1A 2EFPA 1S76D 2UUAJ 2OI2A 4CLUA 5HMZA 4OX9J 1P0RA 1NHKL 5L9XA 4GDKB 1Q5YA 4A3OA 1C4PA 3RU0A 3ZC4A 3AAWB 1NI3A 3DWMA 1XNQJ 3IBWA 2G2ZA 2N1WA 5M2UA 4W9HA 3QGGA 3W8PA 1HQEB 5LSRA 3OT9A 3VH4B 3NOBA 4MDKE 4GVBA 4NLXA 4H4OB 2D74B 3G87A 3M8WA 5FLXY 3H5XA 4DS4A 4RNAA 3NVWA 3AU4A 1QQRA 5IS2A 2LMCA 4KVGB 2NCKL 3VDZA 1BE4A 3UDLA 3HHLB 2KAJA 2EMTA 4XGAB 1U09A 2YVCA 1TZ1A 2HD5B 3DBLB 1XERA 2C5LC 3VQTA 3OLMD 5DLFA 3GYNA 1WUUA 3K9OB 3U7JA 2CWXA 2PEBA 3CDBA 5F8NA 3N1XC 2HFUA 3LW5C 1RSCA 1TUVA 4BAXA 2C9WB 2V67A 3UNYA 2P5VA 4DL5A 4RW8B 3R9LA 4FF1A 2DNMA 3LTOA 4WYWA 1UVKA 1S3SG 4DF4A 4D2KA 4ZPAA 4USAA 3RNEC 4FBTA 1JJ2R 2OEDA 3KHHA 1DAXA 4ELTA 3QGIA 4IR1A 4C9DA 3NS5A 3ET6B 2I0XA 1EIYB 3PW0A 3JQMA 3A8IA 2GBRA 2KDBA 3MMAA 4GU2A 2YNHB 4NPNA 5A2QY 1SL0A 2MWSB 4M5NA 2GGPB 3GV7B 2E1RA 1BD6A 3Q8QB 5GAEI 3ILOA 2FUHB 2VC0A 3PR4A 1F0ZA 3SQGA 1SJ3P 1YJJA 1X4HA 4RX6A 2UUWA 4E71A 2IVFB 1JWBD 4OJHA 3ZKJC 4BZAA 2BQUA 4H4KA 3K8VA 2FE8A 3NNCA 2K1FA 3ZFVA 3M62B 4OJ1A 2IA6A 1NLKL 3W62A 1LWFA 5HP1A 3MOZA 2LGXA 4HR2A 3HSDA 3IG3A 3KJQB 1TAQA 3BBFA 2B9WA 1UWBA 1EF1A 4ZN3A 1RHMB 2Z30B 2ZHBA 4F4KA 3PIPQ 1MMDA 3QCAA 2O2VA 4ZJOA 1KN6A 1XD3B 2W2QP 5L95C 3KHLA 3PEHA 1WGYA 2LA6A 3ULHA 2PT0A 4ES2A 4G0NB 4KDLB 4F25A 1JWAD 1WOOA 5D15A 1RWXB 4RF0A 4I7FA 2C3MA 3V61A 3EGNA 1GB1A 1T0SC 1H98A 3QFWA 3UCZP 5AXKA 2ZWPA 4GIVA 1Y7PA 1ISNA 2FJXA 4G3IA 4GVLA 1RWSA 1TK0A 3W61A 1GX6A 2COLA 3MM9A 4QYRA 2ZBQA 2BT6A 4PG7A 4OVUA 3J7YI 2DH8A 1L4DB 3Q3JA 3UVJB 1PC4A 4DL6A 4KBIA 3MR6A 2C7MB 5B09A 1U45A 4DN9A 4TMAB 3TQEA 4RPFA 2X1GA 3DLLQ 3KLFA 1R3NA 3MUVP 4MJKA 3MAHA 3QWUA 1S6PB 4CO2A 2FCNA 4I69A 4XPCA 1Q95G 3PRMB 4K7QA 1VK8A 1C0TB 2WTFA 2RS8A 2BX6A 2CUYA 1V5TA 2V94A 5KFIA 5KFOA 1JLQA 4Q2LA 3M2VA 3D32A 5AJ3J 2UUBF 1JXVA 2LHEA 4PRFA 1TKEA 4OHVA 3H0PA 4K4VA 3SV4A 5AUIA 1VQNS 3PV1A 1V8CA 1F60B 5FIIA 1JLEA 2NPFA 1LFDA 1TYGB 3TEWA 2ZDOA 2GHPA 2GO8A 4NXNJ 4I68A 1RT5B 4LDTD 2LI5A 1R8AA 2CQCA 3W9IA 1VQLS 4ENOA 3ABVB 1VC5A 1WG1A 3G8SA 1O5JA 7FDRA 2QFIA 1HNIA 4X2BA 3D0GE 3C6TB 4US8A 4M5KA 1N36J 2R2QA 4PS7A 3DM2B 3HT3A 2RE1A 3FEXB 2ZCBA 3QT6A 4AL7A 2K8BA 2XZDB 3FDSA 3UWTA 4B95A 3JAMY 3ZRFA 1CJTB 4YB5A 3D9BA 2KACA 4YHHJ 2B43A 4O0IA 1T03B 4FXCA 5H1SV 2N4CA 3M4XA 3DHHC 3AN1A 2GFFA 2RUSA 1HBMA 3R7BB 1JMTA 4ZKAA 1N32F 4W98A 1LEOA 2LKZA 3QLHB 2OEJA 3TOQA 1SC1B 2J53A 4M63A 3AE8B 3W5VB 1D9AA 3OAWA 1S9EB 3U1NA 3QT7A 2V0NA 1UMJA 3A9JA 3NXZA 3AA8A 4P7IA 2GI9A 1F5CA 2ASYA 4ZCMA 3PEJA 4X66F 2C2DA 1NYQA 2CZ9A 2AIRB 2V8HA 2HHHJ 1UCNA 1AYFA 3OFHA 1GXLA 2C2KB 2W7AA 5D4PA 2ZNZA 4LFCF 3P6YC 1VDVA 4ICLA 4OX7A 3MMCB 4WJOA 2JRSA 4RW9A 4K5SA 2W2MP 3G71S 2UU9J 3BGFA 4O3NA 4D3GA 2KYZA 1U2RA 2AQ1B 1VJQA 3NZSA 3RRHA 4KR0B 4NNJB 3O5TB 2Q1LA 2E9RX 4ZVSB 1NPRA 2VOOA 3LGNA 3PRZA 2DAFA 3DBLI 2PA3A 2D3BA 4KAIA 3US5A 2QMXA 4PWUA 2QZ8A 5I3UB 3MD3A 1PIEA 4EUVA 4W90B 3EDRB 2GIQA 3HHNB 2Z0EB 1X4GA 1WM3A 4J9OA 5T41A 2F9JA 4P71A 3FSXA 2YEPF 4DL3A 4XDDA 1HHSA 3RAXA 2FJBB 2BE2A 2OJRA 2Z58B 3KK2B 2E5LJ 1HI0P 1Q8KA 1M1HA 1TELA 5HG2A 4NL5A 3KUZA 4MJSA 4PUOA 1TVRB 3SV3A 1SGHA 3T1YJ 1C1CB 2ZH9A 1K8RB 1C1BB 3T9NA 1WJ6A 4C7QA 3CMES 4KFBB 1J5OB 2BKNA 1HNVB 4YOEA 4ATNA 2BTEA 3BH7B 1FRHA 4GOCA 1WWTA 4HH0A 1FK9A 4DSFA 4B3OB 2MQPA 3UN2A 1Q8IA 3PYEA 2MXYA 2UXCF 2KL8A 2DIUA 5E3QA 2C60A 3BB5A 1F9JA 3U27A 5CYMB 1WF9A 1M5HA 3KG4A 1GJZA 3IMQJ 4MT5A 3DRRB 4A8YA 3GE9A 3IR5B 2HFOA 5MPOA 4F3MA 1EETB 5LM7E 1WGGA 2HBRB 4DDGD 5ETOA 1KQSR 4KH1B 3W64A 4JX1C 4O0NA 3AB5A 1ACMB 2VUGA 1G1XA 1YRXA 4B17A 2VONA 3T5HA 2W55A 2VC1A 4ZRIA 1XR7A 5B0FA 4IG3A 5LMUF 1U1KA 1JXLA 1T9TA 4NA3A 3HJVA 2MQMA 3IT6B 5AE1A 2XY6A 4OL8A 2QSFA 3IAM9 1ZM3A 4WFXA 3FFIA 2HNZB 1S1VB 3MM6A 2OEMA 4FN5A 3SDEB 1NDKA 1V6HA 2H9ZA 1EARA 1RWPB 2KKHA 1HD1A 2JT4B 5KFUA 2ZC4A 4C8LA 1AWDA 1FCCC 4P2XA 4FYVB 2W9AA 3M30B 4EZ6A 2REXA 4CWBA 5FR6A 1DY3A 5FDLA 1R8PA 4DSIA 3CDUA 2CYYA 2DK2A 2XI3A 1RLFA 3EC8A 3DI6B 2WU2B 4QIGA 3E8OA 2IO3B 3OL8A 1WJ4A 1OY6A 2RF2B 5AZHA 4DG1B 1VHFA 3D1OA 1L7YA 2VODA 2EKYA 3PHXB 2R2SA 1IBMJ 2ZW0A 3AD8C 2ZNVC 3W5XA 2H5JB 2N4DA 2XEWA 3EXCX 1HBUA 3TVKA 3DNCA 2HQ3A 3CC7S 1DQ9A 1TJEA 2MJUA 1MJDA 1UJ4A 4KPCA 5KFRA 3THPA 1KS2A 2RDBC 3M63B 4I2QA 2CQDA 5K14B 1OYEA 1S4EA 1V81A 4OI0A 1F9HA 5IP4D 3I9V1 1IKWB 2DKOB 1AUDA 1WC4A 3RNCC 2ZVOA 4LJPB 4YTPB 3X23A 3NJTA 1ZOYB 3JTNA 3V6DB 1WXAA 5KFDA 1WF2A 1X9MA 4Y65A 4YY3F 2DXFA 4WZMA 1BQMA 3OLBA 1NHUA 2R2RA 4NLYA 3ECIA 1VBKA 1VC6A 2E3TA 3AHPA 3MAAB 2P9CA 4MACA 3T6JA 2KFKB 2JY6A 1JNZB 3KUDB 3Q3FA 2F5GA 4FYXB 1A70A 4K4UA 3BKUA 2ALYB 2IGHA 4MFBB 5D4OA 3HSZA 4CHKA 1C0UB 5JVHQ 4CQ1A 2BJ9A 1JRUA 2QIFA 3FUYA 3DBSA 1UWXA 2Q6BA 2W4DA 4N47A 1LW2B 1HR0F 2GA7A 1APSA 3C6UA 2DNFA 2B6AA 2LLZA 4UOFA 2WXKA 4L74A 3APDA 4IKAA 4C0BA 2C2EA 1FRDA 4HRSA 3VVUA 2BWFA 2IM1A 1I3OB 2FTRA 3POTB 4NRTA 2MSSA 2JH3A 1F6TA 3E01A 1RTIB 4B9NA 3PV8A 4DJBA 2HHVA 2ZKTA 1S0NA 3MM8B 3DRXA 2CNNB 2OSQA 4KB7A 5AXLA 5JZEB 4OLOA 1NZ8A 4NLUA 3IVFA 4KSKC 1Y5IB 2VPZB 4MYTA 1R7IA 4B3RJ 2DY9A 3K8WA 3LAMA 2F4VF 5DS7A 1RKIA 4B08A 3UDEA 1RAXA 4R0JA 3PX4A 2E29A 1VRQC 4DUZJ 2GO9A 1U4AA 2QC8A 3VRAB 1MPEA 4WE1A 3TUOA 3FKBA 2IRXA 2HGMA 2MKSA 2NYIA 3RTVA 3FILA 4DV4J 4WTYA 2BRLA 1LOUA 4JP8A 1WXSA 5LSLA 2BA9A 4ZPDA 1KLUD 3C19A 3MEEB 4DSEA 4IRDA 1QT9A 3LDZE 5IA7A 4RZRA 1D4BA 2HGNA 1V1OA 3BINA 3RBDA 3PYDA 3QX1A 1Z2MA 2WVCA 2XC9A 4J9RA 3ISND 5EWEA 4DR4F 5KAKA 2VBWA 3HD1A 2G9HD 4IFYB 1MU2B 4ITSA 1Y00A 3GWCA 4AD6A 3CUNA 3F44A 2YVSA 4ZPVR 1U8SA 1GMUA 5K8MA 3T9ZA 3AJDA 2UUCF 3TZZA 2LGDA 3HUIA 4ZOHC 5L1LA 3Q3MC 4P75A 4RH6A 1ZE3D 2BABA 3ZZTA 3NP5A 4G1QA 4DV7J 4JV0A 1ZW7A 3PM9A 3CCZA 4RGMA 4DK5A 3JTPA 3PRVA 4LBHA 3W60A 2MZQA 4LF9F 2VPXB 3IS9B 3HXMA 3K5PA 2FGCA 3R5JB 2FCSA 1FNMA 2A2CA 2PI5A 2WONB 3CWIA 4DPUA 1RHJB 1TV6A 1EHWA 3L54A 4NPOA 1E90A 3LYYA 1S7HA 2BDPA 2YNIA 2H65B 1N5YB 1P3QU 2OFHX 3AA9A 4FKXA 5KFXA 2VRRB 2LU2A 5IC4B 4ZPTR 3CIRB 4DN0A 3T5LA 1URNA 3MFIA 4K5RA 4OW0A 2VD3A 3H59A 4EU0A 1UPPA 3EFCA 2JF5A 2X1FA 4FJZA 2MX2A 3NMAA 3M9OB 2PE6B 4B3MF 1JWSD 4JUZA 2VG6B 2OEKA 1LWCB 1PBAA 1CQVA 5D3IB 1L2NA 1RISA 4OYIA 1YJRA 3RCZA 4P7TA 2HAFA 1N6QB 1SV5A 3U1LA 1H72C 1MW7A 4H2AA 4X62J 3HHDA 3QYYA 4ZPCA 1TTHB 2ZBCA 1E6VB 4DR1J 1E8ZA 1OPIA 3GONA 4YEAA 3GE3C 2J7UA 5DZ7A 2GBKA 3UR0A 2LECA 3U4EG 1XLQA 3CCES 2DGXA 1KTVA 2DEIA 4LSLB 1LKZA 2MDAA 2I9SA 3EM1A 2CADA 1FD8A 1CPZA 3VAHA 2NBVB 1GC6A 1SQFA 2PEHA 1H8CA 1YJVA 1Q0WB 2XLJA 4MM3A 2OPPA 5KFJA 2WK4A 4F4XA 2R7SA 4K4SA 2QT7A 5IT9Y 3RD2A 1DTQA 4FYWB 4TQ1A 4FXVA 5KFBA 2C2ZB 2LU1A 1DOXA 2W8LA 3FC4A 5BMGA 2ZD1B 1V5IB 3TNVA 1H2UX 4GN1A 2NBUA 1T8EA 2RNEA 4HLBA 5GADU 3P42A 3CCLS 1UJ5A 4BKSD 3RNFC 2KVZA 3PS6A 3J80U 2RJZA 3GILA 1QM9A 1PYSB 1S1XA 1SUQB 1FE4A 3T41A 3IHPC 4NASA 4ECTA 3Q8SB 3DWGC 1GAQB 3FMBA 2D3CA 3TEZA 2ROEA 1YRTA 3NBPB 3Q2TC 1YWXA 4WAAA 4LFBF 2G0JA 1S1QB 3B2GA 2IAJA 1FRKA 4JE3B 1YZ6A 4ZP8A 3ZZOA 4X4OA 4DR3J 1RDRA 2YKAA 2K0PA 1HZ5A 2MZSA 2NXCA 4QCLA 1UWAA 5KG7A 4NYZA 3S6EA 1X4CA 2O01C 2ZBPA 1T9VA 4ES3A 1LW0A 3RPFC 3LALA 3BK2A 2MKIA 2YBVA 4WU3A 4ZIVA 3N9YC 4OX8A 4JBCA 4QWEA 4NQLB 4AQYF 3I0RA 1VRUB 3VAKA 2CQ3A 3AE3B 1FKOB 5D2MB 4FHKA 5DM6Q 3IA0A 2OPRA 3I5BA 2CQ2A 4NY0A 4WJBA 1CK1A 3OXGA 2KFZA 2ZPNA 4O4GA 3KLGA 5B0GA 3DDKA 3BGRA 1FX2A 2BOPA 2KLCA 3PG9A 2MY8A 1KVIA 3PZDA 1KD1T 1NJXA 1F1HA 4QU6A 3DOLA 1GXTA 5B0EA 1MWQA 3DCAA 1SIFA 5B0BA 4FYYB 1YJTA 2HHSA 4RM9A 3M05A 1IJFB 1N62A 4LBPA 3R7NB 5IN7A 1KLGD 3R2TA 4NCAA 4IDKB 2GBMA 1OQ6A 2OH2A 2PMZD 2LVPA 4OYXA 1T0YA 1N61A 1TS4A 2BF8B 2D2QA 2VZKD 3CNQP 4WU2A 3P3DA 2VQEJ 3PY8A 4ZVPB 4P2MA 3J81j 1KRPA 1UA0A 4A55A 3KWVA 3ETMA 3RRGA 5HHDG 1RT4A 2RD5C 3VAIA 3CC4S 2HS4A 2HIYA 1HYSA 2JSVX 1H3DA 2PMWA 2Z0GA 2LXAA 5LJ3Y 2J42A 3FQLA 4KPYA 3VFKA 2LEKA 5HQLA 2XN9C 4M0WB 2AWTA 2HDEA 1QILA 2HRYA 4L23A 3PSEB 4YXDB 3P8BB 5LMNF 3W8GA 3MOJB 3BO4A 1NPPA 5J18A 2HVHA 1Z4UA 2XLKA 5CYQA 3HFKA 2ZOGA 1A5RA 4WTOB 4YB6A 2IC3B 2QCZA 1P6TA 2ZKUA 3DRSA 5KG2A 2BMBA 3NS8A 1VQ5S 2CPFA 4PQUA 2PSZA 1EO6A 3PT2B 5C2GA 3I0SA 1K52A 3TAQA 1TIFA 1ZAVA 3AE1B 1Y3KA 1RYRA 3FBEA 2DNNA 2BJEA 2LRUA 3R5GA 3CCJS 1KM7A 4CP5A 4IFVB 5IOIA 2KJVA 4HLEA 2QV6A 2MJDA 1PAEX 1HQ2A 3N1YC 2ATLA 1W25A 2KMAA 3J9CA 4P16A 3MTKA 1DQAA 5J2PA 4JV5F 3OR1A 1GAOA 2WXOA 3V81B 3A3OB 1XR5A 3RZWC 1NI2A 4X4QA 4B0EA 4FADA 1TR0A 3M8SA 2DGQA 1TKTB 2Z2YB 1LQ9A 2FAZA 2Y1JA 3FKYA 1U4BA 3VXWA 4U9RA 3OFGA 1VJKA 2YTCA 4ED3A 2D1CA 3BR8A 4R25A 4M00A 4PPZA 2R8GA 1PUTA 2CQGA 3I57A 4L75A 1B4SA 5KOXA 3OR2B 2FC8A 4P73A 3R3MA 3ZVVA 1S49A 3QRRA 4DPOA 4RL1A 1REGX 4DMZA 2CJYB 4B9SA 3GFHA 4DV3F 3ZZ0A 2VFSA 3B2FA 2AJ0A 4M5GA 1DJ0A 4B9TA 4TNOA 4N76A 2KXJA 3VH3B 1V80A 5F8GA 3EYZA 4U7UK 1LGRA 4XC2A 1WKKA 5DLGA 1R0AA 3CJKA 4N6EB 4B3SJ 4JOUA 1VQKS 3CSTA 3PRDA 4LQ9A 2B4OA 1DTTA 1AW7A 5B0DA 2I8EA 3D5MA 3HD2A 5B7WA 3EPIA 2HGLA 4DLEA 4X65J 1NK4A 3CCTA 3PZPA 4GB9A 1N63A 2ZJPQ 3GJQB 2R42A 1UELA 2KVRA 5KFQA 1X4DA 4AUKA 1LXDA 3MUTP 2LYVA 1OO0B 2IYDB 4IG7B 4MEMA 1CQNA 3SI8A 2CZVC 3PO5A 2CPEA 4LF5J 2PGCA 3EGWB 1BWEA 3CDEA 3VTVA 3MMAB 1JXEA 3VQSA 3JSYA 2HHQA 4HACA 2YQ1A 2HFVA 3FRYA 3JSMA 4K0KF 4LF4F 3GU0A 1IKYA 3SQGB 2JOQA 4IM0A 5BMIA 1CJUB 3OPKA 4KHMA 4DV5F 5D8HB 2V2VA 3QIPB 4S0RA 1TUWA 3R7RA 2MQQA 3RI7C 3DLGA 3T19A 4MK7A 4YP3A 1GT8A 1ELOA 2X7IA 1LWFB 1SC4B 5HP1B 1FJGF 2MSED 4XO0A 2HQGA 4ED7A 4ANCA 3Q8PB 3CB4A 2JPHA 2AYMA 4NI2A 4QAYA 1GX5A 4YDDB 2UUAF 2K22A 1UWBB 2KT5A 3KVFB 4OX9F 1JLGA 2KZMA 2MEKA 3GCWP 1K51A 4CLKA 3MCSA 2F40A 3EHVA 1HI1A 3PXGa 2PKOA 3PW4A 2L9DA 4XDCA 4ZVOB 1XNQF 1T94A 2JRHA 4Q2MA 2PMHA 1OQ3A 2KDMA 2BYEA 4RWWA 1V9OA 4EBEA 1YJ9S 4I7FB 4RFBA 4YWGG 5LXIB 1FXTB 1S1WA 3KLIA 2JC0A 2DNHA 4ECUA 3CCMS 1IR2A 1Y4ZB 3SFGA 2B3TB 4O3OA 4IG0A 1TY0A 3AE7B 3Q8RB 3I82A 3TMPB 3EGRA 1UEKA 3J7AN 1VIOA 4QR0A 4ZJQA 2FZGB 2QMUB 2C28A 4GKKJ 2INDC 4N56A 4CO5A 1X4FA 2MBEA 3NUHB 3MPYA 3BQ2A 2PTLA 2NUHA 1NK9A 1RA7A 4K7WA 3KLFB 3QAQA 2R9LA 3MC8A 2KNBA 3A1YG 3DVNV 2V2ZA 5IC6B 3CEDA 1J2VA 2ASQA 1RWNB 1JLQB 2G0IA 1CC7A 1Q5VA 4YSYB 1ICEB 3M2VB 4HPLB 3LP1A 1WGKA 2HS3A 2MGZA 4S17A 3ZNHB 4CYUA 4AS1A 1K50A 1VRTA 1Q81T 2AP6A 4CNZA 5HVGA 2Q3PA 2MW5A 1JLEB 1J7AA 2L3MA 2JX2A 4CZCA 3CWJA 2HLUA 4TY8A 1AZSA 3PLVA 1RAOA 4DQQA 3GIIA 3RJMB 4ANXA 1TAUA 3P45B 2IJRA 3DOKA 3W66A 4G6VB 4HHHA 2VZ9A 4WFAQ 2LEAA 2XCPA 1D5ZC 4LRDA 1FKAF 1YNTE 2H4WB 3ISZA 2GLSA 3TSSA 4XIUA 1EUVB 5F8LA 3IXSA 1WKJA 3KUEA 4EKUA 1HBMB 3G6ES 4OZLA 5A8WA 1RWKB 3DOMA 4NAMA 4LF1A 1YD8U 1GTEA 2DRAA 4F7ZA 4ED1A 1G3OA 2UUBJ 3PX0A 2E5JA 1YI2S 3PGEA 2RDGA 1IKVB 2FUG1 3I4PA 5DQHA 4IOBA 2KHCA 1HEZE 3ZZUA 1RAAB 2GRIA 1E8YA 4ZRPA 2HNYB 4ECWA 1I51B 2DYAA 2Q79A 1QOFA 2GV1A 1JJ4A 2ZEJA 4YTMB 3ZYYX 4X4RA 1HNXJ 3DHWC 3GPAA 3HHLD 2DLBA 1JLFB 2C3YA 4GDLA 1RLDA 4YS2A 1UAWA 2DYBA 1UVJA 4DR5J 1DYQA 4Q2JA 1CJKA 1P7FA 5GXGB 2CJ9A 4ANUA 3DGVA 4FZVA 1F9EB 3HX9A 4NJCA 3W1SC 2JQRB 2BUNA 2E5IA 1Q8LA 4KGSA 3OHBA 3W2VB 3C3LA 2RKIA 4O3RA 2JEJA 4DHJD 5EWGA 2AX5A 3GS2A 1TBEA 3TYTA 4NLRA 3GMGA 3IGNA 3GIRA 2BBCA 2NYHA 5AE2A 2CPYA 2YWFA 4DL0C 3RT3B 1SC6A 2LXIA 4FF4A 5AJ3F 2UXDJ 4HDGA 2K3KA 3T9LA 2J6UA 3L10B 4ECQA 2VFVA 1FJ7A 1HQUB 1N4LA 1IBCB 2W4PA 1YSJA 4GO5X 3HM6X 4AOFA 1OS5A 2BE2B 3VTIA 2B5JA 3IC1A 2MJEA 1EB0A 3VQIA 1BWVA 2OD6A 3RNAC 4NXNF 5MLCV 4A46A 2LJIA 4KGKA 4MAKA 3D7SB 3NOGA 4MJSB 4OYZA 1MLAA 4G1IA 2EBGA 2KXFA 4HTIA 2DNRA 2HFSA 1N36F 1TK8A 3CCWA 4KC5A 1BQXA 5ETQA 2ASDA 1AT1B 2KLGA 3MD1A 4QWCA 1WHXA 4UQTA 3VUXA 3T1HJ 4YHHF 3NAHA 3IRXB 1B0TA 2GC8A 2K39A 1FK9B 3QRQA 2BKOA 1HFEL 2AMCB 3GFXA 3NRZA 2PMVA 4LNFA 3ZTCA 4TLQA 2WSCC 2QL9B 1KJTA 1I6JA 4KJIA 4HVZA 2OPSA 3LXFA 4II2B 3ZTQA 3BQ0A 1WEZA 4L72B 2ZCCA 3VVTA 1UVMA 2CRLA 3CD0A 1W26A 3RFZB 4OV6A 5C24A 2ZHOA 2ZJDA 5DETA 5G5GA 2Z2LA 3K9PB 1U26A 1C4AA 4NZ0A 3SSQA 5D4NA 2M3DA 3N30A 4U8VA 1VS3A 1FEHA 4DXAB 2N7DA 3CIZA 2AF6A 1IXKA 1A6LA 5H9FK 5DDPC 2INNE 3W2WA 2HHHF 2EXUA 2Y1IA 2ZH7A 4TQSA 4P9SA 3WCQA 3H1UA 4KKOA 1QZEA 2BE9B 3MMBA 4UY8T 4ZIWA 2XS5A 1KHWA 2MH7A 3R5BA 2AGPA 3MM6B 3RZAA 2UU9F 2EKEC 2JEFA 3J7Z5 4XYCA 5E33A 2CHWA 3H7HB 1K47A 3RUIB 5J2MA 3FQKA 2W3SA 5D78A 5L39A 4WK1A 1HD0A 5J1EA 2XNRA 3W3SA 3CE8A 2CPHA 2Y0BB 4TYAA 2XK5A 2R7RA 3G6YA 1ZPWX 3VGSA 4LSNB 5HATA 1MG8A 3VR9B 3A12A 4HHJA 4FA6A 2Z56B 3EMTA 2FVQA 1HLWA 1RT1B 3C66A 5HKHA 4AP4C 3KUHA 3M8ZA 2G2YA 4G11A 1RWOB 3R27A 2XGQA 3P4SB 1JQGA 2J6TA 2E5LF 1FNUA 3PNIA 1IBKJ 1FD2A 3AE9B 3GZ7A 5BO4B 2AV5A 1B3TA 2LQBA 1KQFB 2AL6A 4FPRA 1PYOB 2DNYA 3T1YF 2L00B 1E8WA 2JYEA 1LWEB 2ZWOA 3GJTB 3N5FA 2HHXA 3L4BC 4I2QB 5KFFA 4MGYE 1P7EA 2VQFJ 2PLPA 4EEWA 2HMIA 1S72S 2C3OA 1N88A 2GVZA 3PREA 4K4YA 3MC9A 1T9UA 3ZNJ1 1W2BR 3C14B 1HPZB 2HQIA 2UZAA 3OTOJ 3B08A 2M5YA 5EHHA 4P2SA 4B02A 3RN9C 1BQMB 1R0CB 2XI2A 5CHWA 4PYAA 2WXQA 1I4RA 2VICA 1L0YB 1UTAA 4YR3A 1QSLA 1UBQA 1H6KX 2BZ2A 3FCVA 1M4VA 4E2FB 1WXMA 1NRKA 4NLSA 1XWLA 3CJTA 2JWZA 2DTJA 3QAEA 4DUYJ 2K8GA 1H38A 3MM7A 3C6UB 1X4EA 4G3XB 2B6AB 1MG7A 2AT1B 4K3CA 2KDIA 4Q7AA 3IG1A 1P8GA 1M5SA 1Q79A 4ILLA 4WF9Q 1REVB 2XHCA 4Z7CA 3V6HA 5D3GB 2Q66A 4OI4A 4RW6B 5MAOA 3T3NA 1VLOA 4F26A 5E3AA 3O13A 2YWHA 3X0WA 4H54A 1URRA 3AB2B 4IM3A 3NCQA 1L3SA 2VBZA 3L7OA 2QIEB 5DO2A 3BSNA 3NL0A 4ED4A 3DHGC 4LIWA 3CJ3A 1ZDVA 1R27B 1ZAWA 3B6BA 5JVGQ 1XMOJ 3KJFB 1SIZA 4WE1B 5H9EK 1L3VA 4N9F4 3SFUA 2X1AA 3ONQA 1D9DA 5L8RC 2LA4A 3VHTC 3M8RA 1P27B 2J9DA 3FILB 1DZ5A 2JWNA 1XCQL 3OLAA 3ML8A 1UA1A 2Z8LA 1IBMF 2B7BB 1C2PA 1HW9A 2FZCB 2WAQD 4Q8FA 2KM8C 3PKMA 3QGPA 3Q83A 3TJ8A 3WA0A 3PACA 2BVCA 5GVQA 1IR1A 1RU1A 4MKBA 3M6VA 1TY2A 1VYAA 2DNPA 4PABA 4PG4A 1YN4A 3VUWA 3M7VA 4EFOA 3CJQA 1ZH5A 4EE2A 1T05A 2AZ3A 4NMLA 4FKYA 1M5PC 3MPUB 1RZMA 2D7SA 2EFVA 1I1GA 4RUBA 4KIKA 1R8HA 3OL6A 3N0VA 2MHEA 3QT8A 3C2PA 5KFWA 1OY9A 2EFNA 3WHIA 4NLWA 1BMLC 5HVHA 1I42A 2CQHA 3RULA 4W9EA 5I42A 2YH0A 5CCMA 1GMWA 1M5VC 5HMXA 2DHHA 3NY0A 3UE2A 5KG4A 1VK3A 2K1RA 3IM9A 1RT2A 3WALA 1F2HA 2LFVA 2M2BA 3EWGA 1VQ4S 1H7XA 5FLXU 2P6SA 3GR1A 4KT0C 4RO0A 5G0RA 1H73A 1TV6B 3MEKA 2XLIA 5HANA 2FBWB 5CHFA 2YNIB 3T1AA 5DJBA 4M8NA 1K0TA 4OZ5A 1KSPA 3G2XA 1FRLA 2E1PA 2HZAA 3H8HA 2IPOB 5IM0A 2MLZA 1CJEA 3P4QB 5KFGA 1XR6A 1KQGB 4DV0F 2WXGA 1RXOB 3GIKA 3MPVA 4QR1A 4OFZA 2D07B 1RKJA 3RYTA 4OHXA 1SV5B 1D9FA 3V6CB 4ZPBA 4DS5A 1AYEA 2V8PA 2PA8D 1FVQA 2YQ0A 4C4VA 4JGHB 3NG8A 4L76A 2DGVA 2ADBA 3MF5A 4UT4A 3Q8AA 2EG1A 1FRJA 5TR5A 3R5DA 3G6VA 3EZ5A 3Q6BA 1OPZA 5KFYA 4W9KA 4E3CA 3CD7A 2HE7A 3UQBA 2BQ3A 3SFEB 2RDDA 4DV4F 2A18A 1ZZNA 2IVYA 4TSSA 1TL7B 3VRBB 3JSBA 3D1QA 4BKTA 1VMBA 1UEVA 2V5HG 2DR6A 3Q89A 1JQ4A 2ZOMA 4MM3B 2OPPB 3AXCA 5J1PA 2ZJQQ 2KWUB 3CD5A 4Q8EA 4ZLJA 3ZW3A 4LT6A 4WXWA 1FJCA 2IBKA 5C2TB 1YJIA 5HQMA 4YSZB 1IKXA 4J9MA 2QSDA 4DR2J 1FXIA 5KT6A 1Q4RA 1RI7A 2WVBA 5DPWA 1NVID 2KFJA 1AFIA 2JLFA 2RD0A 4QPXA 3ETOA 4KE5A 4WQMA 2JJ4D 1GK8A 3BSCA 3BO2A 1QVFR 4ETZA 2J0MA 1L3TA 2MQ8A 2KX3A 2H4YB 1NM2A 3GV5B 1KTQA 1F77A 4YSXB 4RW7A 2IJFA 2KX0A 4ITKA 3KYDD 1WFYA 3JYTA 2BKFA 2BQQA 3H5SA 4GMKA 3UN3A 1UW4A 2QLFB 3A3PB 3IP0A 4NYPA 4HH1A 1PYWD 1DBDA 2GVDB 4M8LA 5LJ5Y 2KC1A 3A1QA 1YN5A 2DXDA 1CJVA 2RSUA 3DLEB 4F67A 1RTJA 4KH0B 3I5JC 2V63A 5CABA 3TA0A 2OKQA 3TEGA 2WP9B 3AXMA 3MPDA 1O6XA 3WAPA 1EP4A 3OXLA 1RT6A 4JLCA 3CIMA 1JALA 3Q8FA 3I9V9 2O66A 2OPRB 2MEWA 3RB0A 5FD1A 1SBBB 4C98A 4X62F 2ZEQA 4DWFA 3Q14C 2V50A 3Q2AC 3G82B 1CS4A 4AYBD 3KLGB 4DSLA 3KHGA 1PGBA 1VI7A 2KVIA 3OSPA 2HPUA 3BGRB 3TI0A 1UVNA 3D6HB 2UV8G 1SL2A 1S1TA 3DYAA 2LUMA 2KN5A 4DXFA 3KW5B 2DRDA 1QLBB 4CLZA 5L46A 2HQCA 5F9NA 3Q2SC 3L0WB 2KMCA 1SH3A 4XTTA 3NLCA 3QGHA 3E3XA 5KFPA 3Q3OC 2Y3YA 1B9RA 4P74A 3HKWA 2BJDA 3O6QA 1WH3A 1UD7A 1LWXA 3QFHA 2N0SB 3LGHA 5KFAA 4U7CA 4HXDA 5A6PA 4L6V3 1TS2A 1U6BA 4H4MA 3JAMU 1VQOS 4HPMB 2ZNYA 3M1VB 3QHTA 1MROA 1UL3A 5F9LA 3KDOA 4KRWA 2KT3A 1K73T 2CPJA 1ZPSA 3CJ4A 1TMJA 3BYYB 3H6NA 4NWBA 3HCXA 4CLTA 1RT4B 4USVA 2QA4G 2IYGA 1HYSB 2GS8A 1VQ6S 3K57A 3ZTOA 2CXEA 2Q43A 4JWUC 2I6WA 2AQ3B 4CO0A 5F0WA 1QE1A 1R43A 3OW2R 1QKZA 2HK3A 2YKNA 1Q1OA 4OYWA 4IO9Q 2YXLA 1O0PA 1XNRF 1S10A 1X5PA 4EZKA 2EK6A 2ILYA 5A8KA 4QYZJ 2QG9B 1VJWA 4DR3F 4KV8A 5EDWA 2BB6A 1Q10A 1VLBA 2N3OA 1P1AA 5LL6d 3DRSB 2KHDA 4PQAA 5EGYA 2E66A 4IUFA 5T7LB 2LVWA 4KIAA 2G9OA 3BM7A 2K3IA 2KO1A 4PQUB 2FVCA 4OV1A 4MH0E 4LNIA 2KQ7A 1T7PA 2MZJA 5C3JB 3W5UB 1E7PB 3HVZA 2MQNA 3OBIA 3NVYA 1FM0D 2H88B 1FE0A 1VLYA 3RBEA 4M02A 2XSJA 2DY1A 4RNOA 5IT0A 5LXYA 1J7CA 1YITS 3D3BJ 2IGDA 3PHWB 3G8TA 3L7PA 3AE4B 4RW4A 4LFAJ 2OMLA 4EFAC 2NLWA 3GFYA 4DCOB 2ZE2A 1RYSA 1YQ3B 5J2PB 2O6VD 4EYHB 1X0FA 4TN2A 5DPSA 4DV6F 2WXLA 4GO7X 4N41A 4ECVA 3G9CA 3PVLA 3HVDA 4CO7A 2GJ2A 2CIMA 4Y2KA 2VJUA 2H54B 3THTA 1S9GA 2Z57B 3O44A 2FQQB 2RHSB 1Z2ZA 4M5HA 2N4FA 2E1CA 3QC8B 2CR5A 1VDHA 5GAGI 2I2YA 1XJWB 2W9BA 3BGOP 4GC6A 1RWWB 1M90T 1FXLA 3OL7A 2VQEF 3VALA 2FZKB 1JX4A 3AEAB 5J2QA 4LDTB 3A4RA 2FYXA 3P5TL 3MR5A 1VQ7S 3CJKB 1R0AB 3ILLA 2BACA 2RAQA 3BN7A 2Z4PA 2OAUA 1U1OA 1SI9A 3TEXA 2Y8YA 2AX1A 1MMLA 3LUYA 4MGKE 1RBAA 2DYMA 1DTTB 3UCGA 4LF2A 4I6NB 3MEGB 5KT5A 2QLXA 4ZITA 3H2UB 1R8BA 4LF8F 3FK4A 2JUOA 2NS5A 3RYLA 2JFKA 5M2RA 3W9HA 1DOYA 2HURA 4FNIA 1RB0A 3OD2A 1D09B 1WGRA 4MGZE 4OYBA 1OYDA 2J7KA 4DPYA 1LK7A 3QZ7A 1FKPB 3HSGA 1T5XD 3WANA 3CMAS 3BBCA 3OWEB 1N5SA 1JW9D 2E7VA 1MI0A 4WH4A 1UEUA 3RR7A 3M9NB 3BBBA 1I94J 5D77A 3ZNID 4H4OA 2XO6A 3IXQA 1VZ7A 3JQJA 4W9IA 1AW0A 2DZJA 3K5LA 2AJ1A 2A5UA 3G8QA 2B7CB 3HVWA 1X60A 3IWNC 5CHCB 3HHLA 1XK8A 3DKDA 1D6EC 2KXHA 2IRYA 5KFCA 2V4RA 1UKUA 4BOZB 2UU7A 1YX6B 3HM3A 4A8QA 1UF0A 3HSJA 3SCIE 4IQMA 3L13A 2VH2A 2SXLA 1NDDA 2KJRA 2HBYB 4HPPA 3CCSS 2BJ1A 2AEMA 4GRSA 5DQIA 3H40A 5EE0A 3SDLC 3Q8UA 3IRWP 4J9VA 3ENAA 4KDIC 1X9SA 1WORA 2BEFA 4HHUA 1Q0NA 1Q16B 3I96A 3G6XA 1WDDA 3CCQS 2N9KA 5IO9A 1M0SA 2D3OR 3U30A 3D4JA 4WIQA 4RKUC 3W63A 2QLJB 3H7SA 1JLGB 2YNHA 2KC2A 2OPQA 2GGPA 2W24A 2ACZB 4C80A 2K2PA 2BS2B 2M0XA 1SKWA 4NLGA 3KYLA 2DH7A 2VDIA 4NJ7A 5AEKB 1NCLA 3TUJC 3FBCA 4US9A 4B3SF 1VQMS 2W8KA 2KVQE 2CG4A 5RUBA 2ROGA 1Y8RC 5CHVC 3S8SA 2R7TA 4DV5J 4IG0B 4C8YA 1QAXA 2AGOA 1YMHE 2P9EA 3L08A 3V05A 3R1HA 1C77A 3D28A 4RU9A 2L9NA 1SJ1A 3LB8C 4X65F 2NPTB 3AODA 3UDVA 4PXCA 1AXQA 1U2FA 2J0WA 3TIXA 3NOCA 4PWWA 4J5OA 1TKZB 1KRHA 4C7ZA 1WOPA 4HK2A 3OG5A 1FX4A 5F41A 2XYHB 2XWYA 3C0RB 1RBLA 4UUWA 1X4BA 1KTKA 1OSCA 4A8KA 2JHEA 4NX9A 2VA3A 3LQVA 1TKGA 4LF5F 1U49A 1JKHA 5LNK1 1HMVB 4Q44A 3CDWA 3LP1B 1FNXH 2JU6X 5F3TA 1BLUA 2OOBB 1OIAA 2YX4A 3A8JA 4F2SA 4ECSA 3NGDA 4AE5A 3W2DA 2Z2ZA 4CYUB 1VRTB 2WDTB 1P1TA 3CGIA 2HK2A 1SB3C 1MVKA 2ICIA 5LXHA 3TJAA 4FN2A 5T14A 1KLMB 2E9TA 2XY7A 5I4MA 2VBXA 1AZSB 1UH6A 2LXUA 4L73A 3QQ8B 4Z7YA 2I1KA 5HSPA 4YR0A 1V9JA 3HO1A 3CSKA 4OIXA 3PO0A 3DOKB 4CLPA 4NEZA 3P4PB 1VCTA 2XMVA 4ZP7A 3R7QA 3PTFC 4ID8A 2OO4A 4RR5A 4JI5J 4KGTA 1C0TA 1FNOA 1S1UA 2WB1D 2Z2MA 2EFOA 1L6VA 5CTRC 3RB4A 1AARA 1DFDA 1SE2A 2RRBA 1JLBA 3LP0A 3L09A 2KANA 1MMNA 1YK9A 2DNOA 5DG8A 1LNQA 2M70A 5B08A 3CMQA 4P52A 3KLHA 5D7GA 3AEFB 4DFJA 3K5OA 1ZYQA 1CG2A 4DDFA 1S0MA 1F52A 5CD4H 4WPAA 1T11A 2MBHA 1YIWA 1WX9A 1HHTP 1S9FA 1CJTA 3PFOA 4GDLB 1T03A 3H2VE 3V60A 1WEYA 3W1YC 3H7PA 1WHWA 3DGPB 5IXUA 3X3UA 4QWDA 1ET9A 2VG5B 5E2QA 4GKKF 4BWMA 1G7CB 3QPIA 4J9UE 3QLHA 1WC3A 1FHTA 2M0AA 3CJ8A 1LFPA 3LGMA 5HK4A 2K7JA 5CXTA 2J0SD 3BWUD 1KF6B 3KNGA 2IVMA 3MEDB 2YNGB 1S9EA 3ICLA 2RS2A 1QAIA 3NMRA 2IJNA 3NZ3A 3Q8CA 3U8ZA 2LD9A 3H2LA 3SSSA 1SJED 4P2FA 2L52A 4Z37A 5CZXA 2A1BA 3MR7A 2BE7D 3NGTA 5HJXA 1FESA 4TV3A 2B4PA 4ZRJA 5DGAA 3CF5Q 3LWMA 1N52B 1KVJA 1TKXA 2WSEC 2CFXA 2IBIB 3EUNA 9ATCB 1V86A 2B5JB 3WQPA 5EX3A 4ZCLA 2ZJRQ 4WQOB 5KHOA 2QEXS 3MMCA 1FRXA 2EC0A 1GQEA 3AXKA 1XMQJ 1KQKA 1H2VZ 1U1RA 3OFFA 5D3DA 4W9CA 4EYIB 2IMOA 4N8NA 1KC8T 5C42A 1XXGA 3CDAA 3M6UA 3NRBA 1J5EJ 3BS9A 2MKCA 4RWXA 1WI8A 3MECA 4DV2J 4DCJB 3BPSP 3R66C 3IAS1 1ESFA 5FR3A 5I3UA 1QJHA 2J52A 2OIHA 5E5NA 3OFEA 2FJDB 5KFEA 2AYGA 1XBWA 5IT9U 5IV4A 2VV5A 1QUPA 2NVUI 5DG7A 3KYCD 4I6LB 2N9PC 1VGYA 2BANB 5C24B 1TVRA 1DRZA 3JSVA 2J9EA 2MLYA 4ED2A 1XC9A 4ZP9A 5LT5A 3MXHP 1LK5A 2GQCA 2VKZG 1VQPS 1HNXF 4HDQA 4KFBA 2A0FB 1U6FA 2E1MC 5EN1A 1HNVA 1H4RA 2YX7A 3KK1A 1X1MA 5F8MA 2DEJA 3W2WB 4M01A 5BMHA 2QYCA 2QHOA 4KSLC 4DX7A 3Q24A 3N5BA 3I56S 4DR5F 2WWZA 3O1LA 5DDQC 4OLPA 2Y8WA 3FBBA 1HTOA 2KWVB 3IWXA 2IY5B 4N59A 2BYFA 3NNHA 3BYTB 3SBMA 4NEYA 4KHRA 4DPWA 5J2MB 1O51A 1JK9B 1EETA 1WACA 2FIUA 2IDYA 1NUEA 4BVUC 3X1LB 1MN7A 4TQRA 1F3FA 3ADAC 1QF6A 5JMNA 3ZTPA 2XO7A 4HTJA 3ENQA 1S6QB 3PZ8A 1TFWA 2KZZA 2UXDF 2INCC 1ULRA 3K59A 3GIMA 3AEBB 4C56C 2N7JA 2LQ5A 2KT2A 4MT1A 2GCFA 2DT9A 4KQZA 3FMWA 2ZVSA 3PYGA 3WZ0A 1RTHB 2QL5B 4CTAB 1CEZA 2RR9A 4HT5A 1SH2A 2CWKA 4CCHA 2OP5A 5E6NA 2JWUA 4KO0A 3EZOA 3TO8A 5ETMA 3D6MB 1MN9A 1U1NA 2J8AA 4M5JA 4C8MA 3P5BP 2A10A 4CO4A 3U7DA 2FD2A 3T1HF 1Y0HA 2FLLA 3M30A 3HK2A 1WSPA 4DL7A 2GVZB 4DFKA 1VIXA 2KHWB 3H98A 1SKRA 4F8RA 4OHYA 3DI6A 1E6YA 3AT1B 1V49A 4J7CA 2RF2A 5J2NA 2JEIA 1BHNA 2JYTA 2CQPA 4ZLPA 7AT1B 5BR8F 2I38A 3FRZA 4C0HA 3S7RA 5DM7Q 4RNMA 1F9FA 2YKMA 3PJ9A 5CYJA 3TL5A 3BYRA 4R5PB 2E9ZA 2OTLS 2YNFA 3I5AA 2B56A 5L38A 2DCLA 4PWDA 2F9DA 2AEJA 5A0YA 4CI0B 5K14A 1BC6A 3VV2B 5JXSA 3EGZA 2KRBA 2JXTA 4F0HA 5A8RB 3AM9A 1KDNA 2HVIA 4OZBA 2ZH6A 1N5TA 1SKSA 2DPJA 3GJRB 1TL1A 3RNGC 1HWKA 3E56A 2M88A 2FY8A 3V6DA 2HKEA 4P72A 4X64J 5EUHA 3K5NA 4HYKA 2GHVC 2XS2A 1L6UA 3DPDA 2HW3A 2FDNA 4LMZA 1U1QA 4NQKE 2ACMA 1RCOB 3FVYA 4NLPA 2ZDPA 1WZ0A 2P9GA 3KTQA 2KFKA 2CJXB 3RBZA 5CAAA 1H0HB 2LP4A 1YTYA 4J3OD 3EVWA 2J7QB 2W9CB 2KQSA 4TUUA 3MR3A 4YUDA 2YH1A 1MSWD 4PG8A 2FUG9 3H8YA 4MELA 3NCRA 3UD4P 1LW2A 2KN4A 2V68A 1IWGA 2KG1A 1WZ3A 2ZITA 2L9WA 3DLKA 1JIHA 1IBKF 4LNKA 3DC2A 2UVUA 4Q0BA 2MY7A 2ZBIA 4USJC 2C7NB 3MMJA 2NQPA 4M5IA 1FXAA 2HZVA 3U2SC 4X4VA 3Q8YA 3M9MB 3M8YA 2W25A 2HBZB 1R4NB 2BJ8A 3VCDA 1HE8A 3UD5A 2VQFF 2DENB 3HKZD 5HLFB 3MR2A 2CQ4A 1UVIA 4P6QA 2ON8A 4N8OA 1FEEA 3E51A 5IWAF 1WSRA 1F1BB 3DLBA 4IQXA 1FO1A 1S7IA 2MBQA 1IGDA 2AYOB 2BYVE 2WZ1A 2KTFA 5K20B 4O3QA 3OTOF 3CJ2A 2LWPA 4NLQA 5I42B 2WQYB 2L7RA 3UI3A 1NJZA 1SQEA 2VFRA 3CSFA 2EI5A 4CH1A 4OQJA 2K1RB 3CJSA 2CZ4A 2D10A 4HROA 3ZJTA 2J7WA 2LCWA 3EVOA 4F2RA 4XK8C 3PYFA 4TXSA 4ZYNA 3BREA 1NSAA 4OYMA 4DUYF 2VZKB 5ETTA 2CS4A 2NXUA 4IFYA 1MU2A 2PFDA 4LF7J 2QE5A 4P10A 3L16A 2KDEB 5IM0B 1EQMA 1MNEA 2E44A 2OFGX 4RBUA 3RR8A 1ZM2A 3PRBA 3A13A 3MI7X 5THWA 4MGIE 4CDIA 3QZ8A 3ML9A 4OHZA 2HBQB 1TTNA 2Z0DB 3SHQA 4BBNF 2RSQA 1RFKA 3HZEA 1U7LA 2IZVB 4PYZA 2LEBA 5HQ8A 1U24A 3RRKA 1U0SA 3IS9A 4C4VB 1FDNA 2WONA 4M95A 1I4PA 2INPE 1XTZA 4E8UA 2XMAA 1XMOF 3EVMA 3APFA 3V5RA 3KKFA 2DR5A 3VVWB 3HZGA 1PKUA 3WX8A 4ID5A 2VKRA 1DLOA 2DXEA 2ZZPB 3K89A 2X1BA 3IFWB 4UQGA 4A90A 2L3ZA 2FHMA 2LZ6A 4WWNA 4G50A 1JLCB 2VG6A 3BKFA 3DHXA 3NY5A 4J9SA 2MP2B 5BYQA 1FRIA 3QO9B 2WXJA 1ZM9A 3NAIA 1L5PA 1N6QA 2RMLA 3KMQA 4DV0J 3Q23A 2W2OP 4X57B 4URGA 4QBUA 5LSOA 4DCPB 1SXTA 4IM2A 2J9CA 1Q78A 3JTOA 1CULB 1I35A 1EX8A 4NLVA 4WWMA 3AQPA 5ETPA 1N34J 2O6VA 3UQAA 2HG4A 2BM0A 2BWES 1MHHE 2Y5BB 3OSNA 2QTWA 2NTSA 5GMKa 4FLHA 1FT8A 4LSLA 1PGXA 2DHAA 2R8KA 5E3PA 4O3PA 1PJ5A 2HHWA 4JI1F 1WI6A 2V6AA 5DQGA 4W9GA 4N77A 5I4DA 2W7OA 4DSJA 1X4AA 5DDOC 3WC2A 3JYTB 1YQBA 2C2OB 2KK8A 2VB6A 3K7RA 3N6MA 2WXIA 4FJVB 4OZ0A 2ZD1A 2B4VA 3AOBA 4LRCA 3F0NA 3A1QB 2HJ1A 1CJVB 4JI6J 4JWSC 4JYAJ 1R6VA 2OLWA 4C7YA 4ZVFA 2EKIA 1CLFA 1SUQA 3B4DA 3R2IA 3FEZA 3TEYA 4PEOA 1CMXB 3QSYB 3HDSA 2KO3A 1EP4B 5D6JB 4DX5A 4F3OA 1S59A 3T5KA 5AE3A 3NBPA 2W2PP 1VISA 1RAIB 4N7TA 3T6BA 3ZGZA 3NGSA 3ZNGC 3MCOA 4LUBA 4O23A 2AKWB 4I0WA 1CS4B 4ECXA 2GQQA 2ZH3A 2NR2A 3I9ZA 3A3NB 1RA6A 1SJQA 2JL9A 2MHJA 1S1TB 2FJWA 4XWTA 2KTQA 5KG3A 3VF0B 4B9VA 3BGUA 4C3MA 2LQJA 2MCNB 3W5ZA 4F7VA 1RTDA 6AT1B 3HF5A 2W1BA 1T9XA 3UR3C 1PJ6A 1Y10A 4J91A 1LO5D 1WJNA 3DOWA 1NU4A 5KFZA 4NLDA 3BIID 3ZNZB 1VRUA 2K9XA 2LHDA 1FKOA 1T3QA 2NXEA 4HKZE 3CCVS 1WI0A 2IMWP 3GP9A 2PD1A 3W9JA 2JLEA 4ZPWR 4DF8A 2QRRA 2KFNA 1IM6A 2FGOA 3NVZA 2YEPB 3J81U 4O44A 2ZM6J 3NGUA 4ZVQB 2J5AA 2KYWA 5ETSA 4DR2F 2PDAA 2GMIC 1RK8A 1RAFB 2CAJA 4H4KC 3K2YA 1NENB 4X4TA 3WIMA 4WFNQ 2J8SA 4DV1F 1QLNA 3HK0A 4PKDB 2SAKA 5EDSA 2RPQA 3B54A 1R4NI 4YL8A 5EE1A 4LNNA 3SYZA 1RHRB 1NB7A 4OMFG 1Q82T 3AV8A 1BGXT 1QE1B 5A76A 4MIWA 3KUCB 3V6KA 1FNWA 2YKNB 4Y28C 1NO8A 2DGWA 5KFTA 5DDRC 2MQLA 2AWZA 4IDKA 4K8RA 1XEZA 2IFXA 2KXNB 1EZZB 2ILZA 4LRFA 1JJCB 5A8KB 2JVOA 2LVOA 2QFJA 3GTYX 2QMWA 3TX8A 5KOWA 4Q43A 3DBHB 4F4YA 2MKYA 3KJNB 4CRJA 5E6PA 2QA4S 1HNZF 1M1GA 1SH0A 2EELA 3CULA 2GNKA 3KLEA 2R2OA 1WG5A 3P4UB 3ETRA 1FFGB 4CO1A 4K50A 3HP6A 1E5WA 4Q45A 2CQBA 1NBFC 2R3VA 1RWUA 4FNHA 4FXDA 1RHUB 2O3DA 2L0FA 5KFHA 4DDID 1U2CA 2C2NA 2X51A 1OQQA 1S99A 2IDLA 2RU3A 1SF0A 1WC6A 1NNDA 1N56A 4ZLLA 2M4MA 4DOZA 4JIOU 3A9KA 1XNRJ 3OJ4B 1D8ZA 2NREA 4EOYA 4F4ZA 3PIOQ 3V2UC 3L95X 3MM5B 2CJQA 5HMWA 4BKGA 1P9DU 2N9XA 3BY4B 4RGOS 4OVVA 1OWXA 4AXIA 2DWQA 2R7VA 1Y11A 3DMJA 4IOIE 1WEXA 2ZVNA 1F2GA 2MKHA 1MG4A 2DAJA 1U48A 4JI2J 4PZVA 1J27A 3QATA 1MWZA 3SCLE 1F5AA 4LCDE 1UWMA 3MUMP 2CPZA 1VR6A 4I67A 1F3VA 5B0CA 4IFVA 4IUMB 3UD3P 3M2UB 1SL1A 1ZXHA 4CLLA 3MC0B 2ZFHA 3EFUA 4A4JA 1NH8A 4NCGB 2EG2A 1SE9A 4AJYB 3QNWB 3QT5A 3D0IE 2WOMA 4FBJB 2M56B 5T8IA 2I5JA 4PYUA 4DI6A 3B8HA 1TKTA 3UN5A 1VQ9S 5H8YE 1YJ1A 2J76E 4DU8A 1NK7A 3ZQ4A 4LBIA 4ZVUB 4DV6J 5G55A 4DR7J 4YT0B 2R8HA 3N4WA 1WF1A 4HEA1 3M3JA 2PE8A 1C79A 1IR0A 2WU5B 2DGSA 1GMWD 3MCMA 1X5SA 2KTRA 2G1EA 1WM2A 1YX2A 3OR2A 3TA1A 1EKSA 2P2CB 2MKJA 2PJHA 8RUCA 1HWJA 3MCNA 5IQ6A 2ERRA 1FNVA 2W7PA 2C22A 1FERA 3I6PA 4JPSA 3S01A 3GYGA 3IT4B 1QY7A 1BT0A 4HL9A 2DNGA 2B8QA 4K7SA 5E0OA 3TAMB 2LGSA 4QIEA 4II3B 3RW6A 3BGLA 4K81A 4R3DA 4KV2A 1NSQA 4F0MA 3OL9A 4IWQA 3NEKA 3FSIA 1MFWA 2QJ3A 2QO3A 3URYA 3DLJA 3FJ2A 3AY0A 2PW9A 4LFAF 3P4RB 4EEYA 2DYOA 3C46A 3BF4A 2VH1A 3ENVA 1QOGA 4LF8J 1IUEA 1JMLA 4XZ4A 1BUIC 1Q1KA 1WRIA 4DHJB 1WSVA 4I64A 3KK3A 4WJNA 3DN9A 2RQMA 4FJYA 2RVJA 1WG4A 3LJ3A 1UBIA 2RQKA 3AD9C 1J0GA 3QA8A 3JS9A 2IA0A 2AU0A 2WDQB 3PRPB 3D54A 4ASWC 1FD6A 5EX0A 3RAQA 1JNRB 1NDCA 4ED0A 2PE9A 2HFZA 3FAHA 1HBNB 2KG0A 2W9NA 4NZ7A 1YKWA 2OPQB 2GMHA 1HHQA 2ZZMA 2KWDA 4JI8F 4TY9A 3KOAA 3SSRA 5C25A 1R4MB 3SR6A 2FLPA 1TS5A 2D3AA 1CJUA 3TZWA 5ADZA 1T0TV 4WK3A 1NAQA 3PCOB 3QIPA 5IFMA 4EZLA 2KWCA 2L41A 1I7HA 5JXVA 1VZ8A 2V4QA 3ILJA 2QA2A 3HT0A 4F8CB 3ZZZA 2D9OA 1BQNA 4C2MA 1A9NB 3DLHA 3AULA 1WNEA 4CT8A 4ZA1A 2QILA 2MQOA 4A8XC 1IUJA 4HDHA 3NGRA 4QIFA 4JI4J 2YX1A 3HLUA 1RT3B 4FVCA 4LQ3A 4LK0M 4A20A 3BSAA 4EZJA 4EO6A 1QTMA 3PDNA 2XMWA 2KJWA 5HMYA 1VZ6A 1S77D 2KRRA 3C8YA 3OJSA 2CU1A 4C8ZA 3NS7B 2Y5PA 2A3JA 3EA6A 2BQRA 5E6OA 1XQIA 2FCQA 2N9EB 1FFSB 1R31A 1S79A 2E6XA 3UGBB 1SXLA 4FULA 1AFJA 1YVFA 3J7A1 1I94F 1T6BX 5FJ4A 1RRBA 3Q8EA 3BZDB 5HROA 1R8CA 2DO0A 3SU8X 1ZPVA 1M1KT 1WF0A 5J2RA 4IWOA 1JKHB 4C8KA 2QLBB 3CT9A 3GOEA 2AJ4A 2RRNA 2LGYA 1HL6A 3SIPB 4LR9A 3JVZX 4GVBB 2X3DA 2YPYA 3PR5B 3VWSA 1Z5SB 3DBHI 1HBOA 2LGIA 2ZZNA 7FD1A 1NJIT 2HHTA 3HFVA 2JLGA 1CVJA 1B0PA 2ADCA 2XS7A 4LLGM 4OYPA 2B0GA 1FCLA 1EF5A 1O8BA 2CPIA 1D5MC 4DL2A 5C5JA 2M7SA 1PAUB 1ZUD2 1BXNA 4JI0J 2Z8QA 5C2CA 4WWPA 2C7HA 1PC5A 4BFRA 1YN3A 4AUQC 1S1UB 1QSYA 2K5PA 1IN0A 1R89A 2G13A 5DCNA 1EAYC 4C8NA 3R1LA 4XE0A 2GMJA 2K25A 3W65A 2VFUA 2L76A 2JFDA 3T3FA 2MZTA 3LPEA 5K5MA 3AMZA 4USIA 1WELA 3S1TA 1JLBB 4UOHA 3LP0B 3ZO7A 3KJVA 5JHAA 3OJUA 4FS1A 3G86A 2UYZB 3KLHB 1SIWB 1N33J 3PHTA 3WC0A 4L2YA 3M32A 1LV5A 1S97A 5DG9A 3OTBA 2K06A 1WY8A 8AT1B 3AEEB 3BDPA 1E10A 3CPWR 2DZKA 1FXDA 3WX4A 1ITPA 1CSJA 4ES1A 5LXRA 4RF1A 5DZ6A 3H7PB 2KMMA 2CHXA 2V2KA 3MP9A 2L0TA 1YBUA 3VGVA 4O3SA 1S4FA 2CNLB 4V19X 1H2TZ 4DZ6A 4C11A 4GMVA 2ZUAA 3C16A 4PCQA 2NR0A 2W2NP 4UY85 2NBWB 3ELHA 2MQJA 4IYQA 1IKVA 1J7BA 3U1MA 3IR7B 2D3GA 1UJ6A 1XT9B 2ZBRA 3UINB 5J17A 2O2VB 1T0QC 1VQSA 2HEKA 2AJQA 4L3KA 1DQ8A 1B64A 2CDRB 1HXYD 2KDFB 2KJ6A 2HNYA 4DU7A 2QGFB 3HHMA 2JZPA 1RM6C 4Z2XA 3CJRA 4URKA 2BYCA 4ELUA 1JLFA 2PI4A 2M8SA 2H5IB 1NZAA 4CLYA 2LQ8A 1TKXB 3GR0A 4WWSA 5HFYA 2FHJD 2MLXA 4W9FA 3QBCA 1XMBA 3MM9B 1XLOA 3JYUA 4WURA 2CJNA 5CH7B 3GG0A 3W2VA 2E7WA 2NXJA 2XZTB 2WB4A 5E41A 4LSZB 3GB0A 2KFYA 2UXBF 1PGZA 2CJAA 1XCTL 1KVKA 1KBRA 2APOA 1X5TA 5C42B 5KG5A 1UGJA 4UUXA 2ZH1A 3N79A 1GUAB 4MK8A 4EBDA 3MECB 4JI5F 5TSSA 1PG5B 2DJWA 4OHWA 1T3OA 2KQ4X 8ATCB 3PPAA 4A48A 3D1HA 1RT7A 4ZVTB 1KFSA 4V1Ak 3LWLA 1HQUA 4GSWA 2R7QA 3ZDTA 2DNKA 1DURA 4JI3J 2ZZTA 4Y6IA 4DR6F 1VR9A 2WVDA 2EC2A 1Y3JA 2IBOA 2V9WA 4RJVA 1ZGUB 2WXNA 4DFMA 1RGVA 3JSVB 3SCKE 4DWIA 1YDLA 1YJ7A 1F2RI 2M9KA 1BUXA 4K4ZA 3BV8A 4TKNA 1I4QA 4J9LA 3KK1B 4USWA 4RNFA 2FNJB 3ENWA 1HNIB 3IRXA 4A8XA 3EZUA 2AZ1A 4NLTA 2J9DE 3M2RA 2AYBA 4Y34A 5HI1A 2ZH5A 1T0RC 4IC7B 4O1NA 1VRAB 2PEAA 2F63A 5IZHA 1R4MI 5AZGA 3V62A 2HWIA 5LOQA 3KQ4A 4QZVB 2VIHA 5CD4A 1YJWS 2NSCA 2CPDA 4CO3A 2F4FA 2W54A 1YHQS 4K3BA 3J81Y 3VZIA 3CCUS 1R7SA 1U1PA 4F4WA 1VHIA 1SB6A 3MPWA 3MTNB 1NKEA 1Q86T 4TQ0A 2NS1B 1HQRD 4K7UA 3VUYA 3MFHA 1ZAXA 2WVEA 5L1IA 1NMEB 5CZVA 4DEZA 3CCRS 1JROA 3BDEA 3TW0A 4ZVGA 1GXUA 3A9JB 2ROPA 2BVZA 1OQYA 2OUGA 1P1LA 2V8DA 2K8CA 3QIJA 1M94A 4D3HA 5BYSA 2LFIA 1RWMB 3R2CJ 3HFZB 4QIWD 3M8QA 5GAHU 1XMQF 1UFKA 2RIJA 2W01A 4KO0B 2F8MA 4ICLB 4PK1A 2HWHA 1S0OA 1BXTA 4RW9B 1WD6A 1XIQA 1FO4A 3BEGB 1M5KC 3VAWA 2V8GA 3F41A 1J5EF 3MHSD 4UTGA 4DV2F 2WBRA 1EU4A 2PN6A 4U96A 3JXOA 3GZNB 4USHA 1QAYA 3IBFB 1B1ZA 1B99A 1Q5WB 4QPTA 4LSNA 2K7KA 3LP2A 2K8HA 3M8PA 1C3TA 5KT2A 1E6YB 3WAMA 2WCXA 2OJWA 2QL7B 1P98A 1RT1A 3R6LB 1RE1B 5J2NB 2YKOA 2DR9A 1ZA2B 2JZ5A 4DBQA 2D41A 4B6WA 4ZHPA 2YKMB 2PVGC 4OZCA 2YNFB 1LWEA 4PWDB 1HZ6A 4PUOB 2BGFA 5A0YB 2WHOA 3RG6A 4W9DA 3GV8B 1VBYA 3C15A 3GFZA 2MPUA 4OHJA 3B4MA 4KX6B 2KOXA 1UZDA 2M1MA 2OELA 2R2TA 4C0OC 2GAGC 3NKYA 1X31C 2LVQA 3DVGY 3C14A 1HPZA 4NRUA 1D1UA 1TL1B 1TQLA 2O67A 2KH9A 2Q6CA 2HNDA 2H3EB 5DPTA 2EFQA 1TP7A 1C1YB 1IBXA 2YY3A 5L83A 2V4JA 2DNQA 1SJRA 1HA1A 3ZNUA 1NK5A 1V1PA 3TX0A 4YTNB 1EKRA 1GNUA 5BR8J 4XWWA 1L3KA 2QLWA 5G2NA 3G4SS 2EK1A 2UV8A 3H20A 4WFZA 3CF6E 1TU0B 3R5CA 4A8WA 1H7WA 3A33B 4DX8H 1FRRA 4MIAA 2H5EA 1N5VA 2B51A 2JNJA 3A4SC 1J8CA 3E9SA 5CQGA 4R8UA 3AEGB 3NWGA 2JZ3B 4N58A 2DHZA 3DLKB 4IG3B 1PILA 4F0KA 1LXNA 2MRPA 4OZ2A 4BWJA 4Q0BB 1GH8A 1REVA 5D3GA 5DPRA 3LAKA 4RW6A 2R61A 4M5MA 3Q86A 2PPHA 3FFIB 2AQ4A 3P49B 3JQKA 5I3PA 3WBZA 2JEGA 1IYFA 2M0GB 3BPDA 2EMSA 4F50A 2P6TA 2VDHA 1FRMA 4NAWA 1WTFA 4LJOB 1ZBTA 4J9QA 1EU3A 1QD1A 2HHUA 5KG1A 3AE5B 1QTNB 1DARA 4QOTA 5L9NA 2PVOD 2IO0B 2KI2A 4WJQA 4KHPJ 4M8MA 4J9PA 3W5YA 4DHZB 5FDLB 1FJEB 3WIVA 2ZH4A 1OEYJ 4RBTA 2OTJS 2WX1A 3AU5A 1G6JA 1PSDA 2X38A 4FXWA 5G5HA 4P1CC 1KWMA 1UPMB 4YB7A 1VBXA 3VZHA 4ARIA 1UW9A 1PCAA 4JV2A 4ARCA 4LRBA 4ANVA 4ZS6A 5KT7A 3PZ7A 5F3ZA 2WXFA 4BDPA 3DVNU 1HBUB 3B1LX 4V19J 3UDCA 4FBUA 1E6EB 3G96A 5D0RA 4NCBA 2DH9A 3FZ2A 1WTBA 3RB3A 1EWCA 4HI2A 2MJ3A 1NK0A 2OMOA 4DHVA 1FFWB 1UNSA 3UCUP 2AYEA 5IWAJ 1S6OA 4X64F 1PBUA 4L1BA 2ZPYA 3IAS9 1WJ9A 1TL3A 5D94A 1QDUB 2C3UA 4LJMA 3HVTA 1FCAA 3BZQA 4CM2A 4KKIA 2PFFB 2RHQB 3PFEA 1WOSA 1ET6