2I2YA

Solution structure of the rrm of srp20 bound to the rna cauc
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
150
structure length
150
Chain Sequence
MQYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTEGSHHHHHHMHRDSCPLDCKVYVGNLGNNGNKTELERAFGYYGPLRSVWVARNPPGFAFVEFEDPRDAADAVRELDGRTLCGCRVRVELSNGEKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein/chimera/rna
molecule keywords (5'-R(*CP*AP*UP*C)-3')
publication title Molecular basis of RNA recognition and TAP binding by the SR proteins SRp20 and 9G8.
pubmed doi rcsb
source organism Streptococcus sp. 'group g', homo sapiens
total genus 44
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2006-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2i2yA01
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2i2yA02
1N54B 1X4FA 3MURP 2KRBA 4PR6A 1F2RI 1H2VZ 2OIHA 1K50A 5ITHA 1Q82T 1UAWA 2DK2A 4LJMA 3G9CA 5DDRC 1G2EA 3EGZA 5H1SV 2MQOA 1YNTE 4WH4A 5BMGA 2KQ4X 1C9FA 2DGVA 5HI1A 2JWNA 4PKDB 2XS2A 1WEYA 2M0GB 1VQ7S 3K0JA 2MKSA 3FILA 5MLCV 2GHPA 3PIOQ 4MACA 3IRWP 1QM9A 2LHEA 5DETA 2JVOA 1GB1A 2GO9A 2DISA 1BY9A 2CQCA 1W2BR 2MGZB 3U1LA 1WF1A 5GMKa 2MGZA 1RK8A 3HHNB 2EK1A 2AYBA 1U2FA 1DBDA 2JRSA 2KH9A 3NS6A 2MKKA 1S72S 2AYGA 1WHWA 3S8SA 1CVJA 4KGSA 4WFNQ 3CMAS 2DGWA 3UWTA 3ZZZA 3TYTA 1U6FA 1X4GA 4LIRA 3OW2R 1HD1A 1ZH5A 4ZKAA 3NNAA 2DGXA 1K52A 2HZCA 2DNNA 5IM0B 2MJUA 2MZRA 1EM7A 2M4MA 3VAGA 2XSFA 2RRBA 2JZPA 2EK6A 2NLWA 1XCTL 1X5OA 1U1QA 3THPA 2DO0A 2MKCA 3MUTP 2E44A 1KQSR 1NU4A 1SJ4P 2LEAA 1YIJS 2MZSA 2M8DB 3FEYB 3CPWR 2X1FA 1OIAA 1H2TZ 1M5VC 2JWUA 2RQ4A 2JU6X 2MQQA 2DNGA 2GB1A 3CCJS 3UI3A 2DGUA 1D8ZA 3TP2A 1QVFR 3LPYA 1WF2A 1IBXA 1VBZA 2KHCA 2DHAA 2VODA 3MUVP 2RT3A 2FY1A 2O3DA 3CF5Q 2U2FA 4QPTA 2RQCA 1FHTA 1K53A 1XF5L 5GADU 2PW9A 2KRRA 2KT5A 2J0QD 1DHMA 1FT8A 2YH1A 2LCWA 1PGAA 1N52B 5JVGQ 4WCEQ 2D9OA 2OTJS 4WIIA 5GAGU 1VQKS 2VOOA 2CQ4A 4TU8A 3MD3A 2OTLS 2KI2A 3Q2TC 1ZZFA 3RW6A 2HYIB 3B4MA 1XCQL 2HGMA 2LKZA 1VQNS 2KWDA 2DH8A 1NJIT 2CPJA 2KXHA 1P1TA 3VAKA 3S01A 2QA4S 2CPFA 2DIVA 1P7FA 4OZAA 1MHHE 2RUGA 2MKIA 3P5TL 1VQOS 2CQ2A 2J0SD 2KG0A 2M88A 4P6QA 4UQTA 3CCMS 2J8AA 1YI2S 2VOPA 3CCVS 1PGBA 2X1GA 5LSOA 3SMZA 4M5DB 4OZ1A 1U1KA 1N88A 1WI6A 1FCCC 2A3JA 1IGDA 3SXLA 2DITA 2F3JA 4UY8T 2MQPA 1SJ3P 2RPVA 5CXTA 2M8HA 1PGXA 4FXWA 2MY8A 2YH0A 2L41A 4QU7A 2DNRA 1ZXHA 1JJ2R 1DRZA 4OZ0A 4IO9Q 2CPHA 2N3OA 4ED5A 2E5IA 3J7YU 2L9WA 3G96A 3EX7B 1OWXA 4GLSC 3BO2A 2N7CA 2DNZA 5FJ4A 3CULA 2KU7A 1P27B 4TU9A 1VBYA 1K9MT 1QVGR 4ERDA 1VC6A 2F9DA 1WEZA 2LGIA 5BMHA 3CCLS 1K73T 2Q79A 2M7SA 5BJRA 1WEXA 2BZ2A 4CH1A 3CCSS 4PRFA 2CPDA 2DH9A 1JJHA 1FNXH 2N82B 4QQBA 1H6KX 1P7EA 2MZJA 3CC7S 2ADCA 3G4SS 2K8GA 3DLLQ 2LXUA 3R1LA 3CCES 2LHDA 3P3DA 1YMHE 4EGLA 3MXHP 1VQ4S 2M9KA 3CCQS 1HL6A 2G1DA 4TLQA 1A9NB 2D3OR 1FJEB 2K0PA 2DNKA 2YTCA 2EELA 2D9PA 1YJNS 5IM0A 2KXNB 2CJKA 3IWNC 1HEZE 1SJQA 2RS2A 2N7JA 4OZBA 1M5KC 2KVIA 1HA1A 2EVZA 1U1NA 2XS5A 1Q86T 2IGGA 1N8RT 2KYXA 4RU2A 2M2BA 3BEGB 3TO8A 4IOCQ 3SDEB 3S7RA 2CPIA 1RKJA 4YOEA 1KC8T 2JXTA 2BOPA 5D77A 3MUMP 3V4MA 1HZ5A 3MDFA 5HL7Q 3B4DA 2DGTA 1UW4A 3CMES 2FC8A 3G6ES 3UD4P 1VQ5S 2QFJA 1X0FA 3VAIA 1PO6A 4D2KA 2E5HA 1NO8A 1WF0A 2QEXS 2GI9A 4V19X 2DGOA 1H2UX 2G4BA 5HG2A 4F26A 1MVKA 1F9FA 1X4HA 2MKHA 5DDQC 1D9AA 2UP1A 2E5GA 4WKRA 1YITS 1VC5A 4C4WA 2QSDA 5GVQA 2OSRA 3PIPQ 1FCLA 2V94A 1JJ4A 4IKGA 1JMLA 1WELA 2PEHA 3UCGA 2MSTA 5DM7Q 3NS5A 1UWXA 3CCUS 5EN1A 2LXIA 2E5JA 2HGLA 5GAHU 3NNCA 2ZJQQ 5JXVA 2KACA 2JX2A 2QMTA 4HJGE 2CQ3A 4FXVA 2M70A 1D4BA 4YUDA 2AD9A 2IGDA 1MHXA 4CQ1A 3H2VE 4Z2XA 4WFBQ 2RU3A 1WG4A 1X4EA 2KDMA 1KH0A 1URNA 3VAHA 1X4CA 1VQPS 1YJWS 2ZW1A 2ZW0A 2DHSA 2G0CA 3MI7X 1DZ5A 1VQLS 2MB0B 3N9UC 3RW7A 2PE8A 2KM8B 2DNYA 1U1MA 2CQBA 2J53A 2LMIA 4CH0S 2DNHA 5CYJA 1A7GE 4F02A 2CQHA 3UE2A 3CCRS 1JMTA 3R27A 2XNRA 3NNHA 2KXFA 1X4AA 1X5PA 2MQNA 2MMYA 1R8HA 1SXLA 1UP1A 2FHOB 4WFAQ 2KFYA 2MKJA 1KOOA 3I56S 2ON8A 2MZQA 3US5A 1F2RC 2MZ1A 3HI9A 2DNQA 2RS8A 1WG1A 1SJFA 4Y0FA 1X4DA 3CC4S 1FD6A 1PGZA 3ZZYA 2MXYA 2RRAA 3CTRA 4CIOA 2L08A 4J5OA 2ERRA 3G8TA 1Q7YT 1WHYA 2WBRA 3Q2SC 3FILB 4KGRA 3ULHA 1ZZNA 2I38A 2DNOA 1MPEA 2SXLA 5HFYA 1S79A 2N9LA 5DM6Q 2DHGA 2F9JA 1K51A 2DIUA 2CQ1A 3S6EA 3P6YC 2FC9A 1VQ9S 1OO0B 2RMMA 2X1AA 4U67Q 1YHQS 2MQMA 2DB1A 2RNEA 1M1KT 5BMIA 2CQ0A 3MD1A 2I2YA 3G71S 2CQIA 2PLPA 1GB4A 1WI8A 2CQDA 1VQMS 3UCUP 3H2UB 2ONQA 2HGNA 4C0OC 3VAFA 1WTBA 1VQ6S 2CPEA 1O0PA 1XN9A 3NMRA 4IOAQ 4C7QA 4A8XA 1B7FA 2X1BA 2MY7A 1X5SA 5LJ3Y 2ZJPQ 2MYFA 1U6BA 1M90T 2FPHX 5GAEU 2U1AA 1U1RA 3JB9k 2DNMA 2KM8C 2JVRA 1U1OA 3MOJB 4KGTA 2B0GA 2XNQA 1VQ8S 1SJRA 1AUDA 2ZJRQ 5D78A 3SDEA 1L3KA 2YKAA 2MSSA 1X4BA 3P49B 4WF9Q 4IOIE 2LEBA 4BS2A 3VAMA 1WG5A 1R8PA 2DHXA 3U1MA 4IUFA 3CXCR 2XS7A 2AYEA 5IFMA 2IGHA 3VALA 2NZ4A 2DNPA 1HZ6A 4HKZE 2VONA 4W90B 2DGQA 2MPUA 4F25A 2JSVX 2OJ3A 5HO4A 4OZCA 2MZTA 2M52A 2LECA 5DDOC 5DDPC 1M5OC 2ADBA 2DGSA 1WHVA 2MQLA 1IGCA 3V3XA 1IBXB 2J52A 3R1HA 1HD0A 1FO1A 2K3KA 4YB1P 2MHNA 2N3LA 5LXYA 1FJ7A 1MI0A 1WWHA 5LXRA 1U1PA 5LJ5Y 2CPYA 5CA5A 2KG1A 1VBXA 2NMQA 3THTA 3J7ZT 3MP9A 4TU7A 3DXBA 3EGNA 2AYMA 2OEDA 2J76E 1X5TA 2LYVA 5IQQA 1IQTA 1YJ9S 2CQGA 2DNLA 1VC0A 5LSLA 3UD3P 1U1LA 3UCZP 2LQ5A 1OPIA 3BO4A 1QKZA 3L3CA 2MJNA 3G8SA 4W92B 2DO4A 4LMZA 1WHXA 2PTLA 2DH7A 3I55S 4QU6A 2N9KA 1FJCA 2XB2D 2CPZA 2LA6A 2HVZA 3LQVA 1UFWA 2YWKA 4Y00A 1Q10A 1K8AT 1KOHA 2RVJA 5JVHQ 3CD6S 1YWXA 1KD1T 1M5PC 2OSQA 3D2WA 3BO3A 2CPXA 3CC2S 3BS9A 2KN4A 3GB1A 5HHDG 3CUNA 2LUMA 1YTYA 1FXLA 3VAJA 3FEXB 1Q81T 2LA4A 2CQPA 3VF0B
chains in the Genus database with same CATH superfamily
1EP4A 3D28A 5D0EA 3TUIC 1KF6B 3V6DB 4LJMA 3BSAA 2MBBB 3ITHB 1HFEL 3M2VB 2DGVA 1C9FA 1LXNA 2PI5A 3QAEA 3M2VA 4DU8A 2BKOA 2M0GB 4AXIA 3KVFB 3WCQA 2MLBA 3MF5A 2KDOA 3GE8C 3PO4A 3IAS9 3T19A 3AA9A 4DL3A 4NPNA 2R9LA 1B70B 4LLGM 5ETSA 5KOXA 4ZIVA 4V19J 1RK8A 4O3SA 2AYBA 3W9CB 2V8DA 2L1AA 4DHZE 2NUHA 2AYGA 1EZZB 3JAMU 4KGSA 3OUYA 4LREA 4F4YA 4LNNA 2KVRA 2WXQA 2ZNYA 4DV3J 4N59A 1S0MA 2D3ZA 2Z4PA 1FWPA 2JNJA 2UXCJ 2ZH5A 1FWLA 5CD4A 1WMHA 2G4DB 2WDTB 4HTIA 5IWAJ 2VICA 3RR7A 4KPYA 4KVGB 2D5GA 2JEJA 2RDDA 1SUQB 2LI5A 2L76A 3ZNGC 4NE9C 4NA3A 2K39A 4NJCA 2HWIA 2RD5C 1M5VC 3MR5A 3WC0A 1CQMA 3D0HE 3UI3A 3TP2A 4AFFA 4A20A 1WF2A 3M6WA 4AXJA 2RT3A 3FDSA 2KVZA 2JJ4D 3ZZRA 4ZPAA 4L6V3 1WC3A 2KT5A 2YKNB 3HSDA 2HNYB 1V1PA 3OFFA 2YQ3A 3HVAA 4QW8A 1FXDA 3OL6A 3R5BA 2KXHA 4OZAA 3W60A 1OQYA 4B3TJ 2RRNA 4GVBA 3PTFC 5B0CA 2M5YA 3JSVB 5B0FA 2Z30B 2YWHA 3TW0A 1T9YA 2R2OA 3DLGB 3PO5A 4NNJB 3MWBA 1TAUA 3R9LA 3DLGA 3CJRA 1RT6B 4RBVA 4OJGA 4JI3F 1I4PA 2MBHA 1RT6A 1S7IA 3OLBA 1SJED 4DXLA 3J7YU 1U4AA 1VISA 2JC0A 4K4XA 1TL5A 2B9EA 2OEMA 4FKXA 2HHPA 1FEHA 3KJQB 4FF4A 1JLCB 4LF9J 3VR9B 3CSKA 1R4MI 4WXOA 4OLPA 1X9MA 5I4MA 1H73A 5GADI 3DCGA 1S0VA 4Y2MA 1G6BA 4RBTA 4I68A 5D3DA 2G1DA 4CLUA 4ELVA 3ONQA 4EZJA 1YQ3B 4CO5A 4CNZA 2KXNB 3DBLB 4HRSA 3R3MA 1HEZE 1J0GA 1KDNA 1F77A 4ZVRB 1Q86T 3TVKA 2M2BA 1NHKL 3TO8A 1FEEA 3HD1A 3BZDB 3MM8A 1RACB 2IJFA 1BMQB 1NB7A 2BOPA 4ICVA 1UW4A 4J9NA 3UD4P 2H5IB 2YPYA 3AOBA 1CS4B 1NJXA 1CS4A 3L54A 1PBUA 2YWGA 2IJNA 1LWFA 1F9FA 2MLZA 2AEJA 3FAHA 2QILA 1K0VA 5CCMA 2VG7B 3AN1A 3IP0A 4ECZA 3VTVA 2YVSA 1JJ4A 2EBEA 3DGVA 2WTFA 2PEHA 2VG7A 1I4RA 3D1OA 4MH8A 2MDAA 2E5LJ 3QT6A 4L75A 5L38A 2IGDA 4PEOA 3T5KA 4CQ1A 1RAOA 3I3TB 2LGYA 3MI7X 5D94A 4M5DA 2A2DA 2JX5A 1UVIA 2DNYA 1EWYC 2RDHA 3D0IE 1RXOB 1RWPB 4JQWC 3I96A 4ZN1A 1NBFC 2MBQA 2I8EA 1S1QB 1R8HA 1SXLA 2ON8A 2HFOA 4DF4A 1JLEB 3L4PA 4DS5A 3L7OA 5D15A 1JLEA 1PGZA 3OXLA 2ERRA 4YL8A 1WHYA 3T9ZA 2A18A 1GT8A 2AJFE 1T7PA 3KYDD 2SXLA 3IAM9 2Y0SD 4EYHB 3S6EA 3UR3C 3JVZX 3M1VA 1T6BX 1J7BA 2JRHA 2WSCC 2KJHB 3SCJE 1UMJA 3GYNA 3FKYA 2RSUA 2YQ1A 4RF0A 3HVRA 3DLJA 4DSJA 3QRRA 1X1MA 3JSMA 3EDRB 1XO3A 4O4GB 1R7SA 1KBRA 2MYFA 2IRYA 1U6BA 3R7BB 4OYZA 1HR0J 1HNZJ 2WXLA 4DBQA 1NNDA 4QAYA 2K1FA 3BQ1A 4OJ1A 3E3XA 3ZDTA 4DV0J 1AFIA 3KHLA 1EQ0A 2O1PA 3I57A 1N5SA 3MMBB 1MLAA 4ZVHA 3VXWA 2DNPA 3MMBA 4W90B 3LGNA 3PYDA 4B9TA 2M52A 3A4SC 2CG8A 2NUUG 2RHQB 3U1NA 1WTFA 1ESFA 2WB1D 3NGKA 3QSIA 2N3LA 4LBHA 5CYMB 4OMFG 1FCAA 2XWXA 3NOGA 1B4SA 2VPWB 3H5UA 2WONA 2J0JA 3GILA 3H40A 2VJVA 2FJWA 1RBLA 2W55A 4DS4A 3EGWB 4PG7A 2MKYA 2Z59B 1KTKA 3GYGA 3N1XC 3EMTA 4OZNA 4II2B 4KQZA 1GC6A 5KFCA 2B76B 3FQKA 4B3RF 2H51B 2C60A 2OEJA 3GFHA 2ATCB 3AE3B 2G3QB 1UVNA 2R7SA 4N6EB 1Y0HA 4QR2A 2BKRB 2UYZB 2CADA 2MTLA 3EWGA 3H90A 1Q7LB 3TIXA 4CH7A 3EGZA 2IVMA 1N32F 3PW5A 3SV4A 2W9BA 1F3VA 3IC1A 1ZOYB 1LGRA 3SSSA 4KO0B 5EE1A 5KFUA 3OFHA 4ICUA 1SB6A 2BPSA 1E7VA 3A1QA 3HD2A 2QHOA 2CQCA 3Q8PB 2CJAA 7FDRA 4E98A 1CJTB 5IN7A 3GV7B 2C1EB 4ZA1A 2O5DA 2Y3AA 4OI6A 1RAJA 4WWOA 1SH2A 3TYTA 4MGKE 1X4GA 4X4VA 2XY7A 3QT5A 2AQ2B 4M95A 1VIOA 2VG6B 3NNAA 2DEIA 2R8IA 5D4PA 3TEXA 5GAGI 1KTQA 2VG6A 1B99A 3VAGA 1HWKA 3H7SA 1XCTL 2B5JB 3THPA 3N28A 1C4CA 3NGSA 5KFAA 3DI6B 1G7CB 2B5JA 3QYYA 4YR0A 2Q3PA 1HXYD 3FC4A 4ANVA 4C7YA 2DGUA 2IY0B 3WAPA 4RUBA 5IS2A 2O3DA 2IMWP 1UVJA 2J7KA 1FVQA 3FZ2A 3JTNA 3I5CA 1JWSD 1UWAA 2G1HA 4RW8B 1L4DB 2XI2A 3DM2B 2EFVA 2WVEA 4PXBA 4EBDA 3VGUA 2PKOA 3DM2A 5AT1B 1FD2A 2K3IA 2R8HA 3SBMA 4XE0A 1P1TA 1XNQJ 4LTUA 1C77A 2ASLA 4K4VA 1YD8U 5G4DA 3Q3MC 4LNOA 3ZDMC 1RU2A 5ETLA 4CRJA 2ZOGA 1D3ZA 1ULRA 2WU2B 3ZQ4A 3I82A 4W9FA 1RWKB 1BUXA 1VJWA 2L41A 5IO9A 4ZCKA 4UOGA 4IWPA 1OWXA 4NXMF 1IM4A 1QE1B 3ZZTA 1KN6A 3U8ZA 3KK2B 3C15B 2ASQA 3QWZB 3QQCD 1WJNA 3Q0AA 2HFZA 4IH7A 2X51A 3LYYA 3VTWA 4KSEB 1KHWA 1IQZA 1CC8A 4ARIA 3VCDA 4UOCA 2KWUB 3V5RA 3ZZUA 2YKMB 4ASWC 3KFWX 2YKMA 1HL6A 5H9FJ 4DL6A 2UU7A 2V2VA 1FJEB 2K0PA 1VYAA 2V6AA 2E66A 2ZUGA 1QY7A 3K5NA 1XD3B 3AH7A 1EARA 5DQIA 4IKAA 5DZ7A 3IT6B 5HMWA 5D4NA 2FC8A 3MMJA 2VZKB 1PYSB 4FHJA 4K4ZA 2E5HA 1UJ4A 4NLYA 3M6XA 4W9JA 3NY5A 3CE8A 3PEJA 3TUZC 2J7UA 3PHTA 3CIMA 2E5GA 4C4WA 3O6QA 5A2QY 3MJ5A 5AUKA 2XYGB 4C8KA 1OTRB 5DM7Q 4RNAA 3GJSB 1HHQA 2OUGA 4F3MA 4DV2J 4KHPF 4CT9A 1Q5VA 3ETRA 5C3JB 2KACA 3TOQA 3LWMA 9RUBA 1YK9A 3QZ7A 2AD9A 3NMAA 3GE3C 3ZXRA 2F63A 2AT1B 2KDMA 3VAHA 1HNXJ 3G86A 1FE0A 4F4WA 2ZW0A 3PYFA 3KG0A 4LR9A 2JY6A 4ZCMA 4HXDA 2CQBA 3DOWA 1OJ4A 5CH7B 5E33A 4GSWA 1S4FA 3KUZA 6FDRA 1X5PA 2V8PA 1UP1A 1F5AA 3MPDA 1ZETA 5GAEI 2YXLA 3PX4A 2HHSA 4J7CA 1WM3A 4HPPA 2KMMA 3CJ4A 1PFDA 5IA7A 1J19A 1NYRA 5D7GA 2UV8G 1UZXB 3ULHA 3NGUA 1LWCA 1E6VA 5HFYA 1KNZA 1TKTA 1XEZA 2DIUA 1VMBA 1U2CA 1WSRA 1T0TV 3CIRB 3ET6A 2CQ0A 1RAIB 2BEFA 2SAKA 3IXSA 3EVOA 3H2UB 3ZXVA 2BGFA 3HRDD 3GP9A 3KUEA 1OMSA 3JS9A 2BB5A 3NCQA 4OYMA 2UXDJ 2R8GA 3QNWB 5L46A 3DWMA 3K9PB 3M2UB 1NHVA 2KM8C 1X60A 4DI6A 3DBSA 4R0EA 3M2UA 3FNNA 3KH0A 3NZSA 2MBOA 4WJOA 4ZP8A 2ZDPA 4NEYA 2AZ1A 1ROEA 3D1HA 1JWBD 3IBCB 3RPFC 3MMAB 2IGHA 3MCNA 2J0XA 2FZCB 4M63A 2J8SA 4LBPA 3QGHA 5DDPC 1IGCA 3AU5A 3VH3B 1NK4A 4I69A 2K3KA 5JHAA 4NL5A 2HK3A 4C3KA 2HSEB 1UGJA 2L3ZA 4MFBA 2BE2B 1TKEA 4DDID 3CJ2A 4XPCA 1VD2A 2BE2A 2VV5A 2V2KA 2DHZA 2Z0GA 4JI6J 2N9KA 4DXFA 4ID5B 3Q3FA 2EWHA 4TQ0A 5D4OA 1SKWA 3UIPB 2X3DA 1YBAA 1YX6B 3Q24A 1RTHA 4TN2A 2ZBRA 1MMNA 2GIFA 4PXDA 4NLUA 3V60A 1OSCA 2ZH8A 1YNTE 5BMGA 2C2NA 5L39A 3D6MB 2EW9A 4G6VB 4BC9A 2W7OA 1WJ6A 4FXDA 3MEEB 1QSSA 1CK1A 1IYFA 1AA1B 4OYPA 3W5ZA 3R5JB 3OSPA 4MGYE 4LR8A 4I0WA 3ZTCA 1JRPA 5K20B 2F40A 1S6QA 3TA0A 2V2ZA 1WHWA 1NI2A 5JMNA 4JI2J 3ZZZA 4DL4A 2AGOA 4NX9A 1MW7A 2Z0EB 2ZOFA 1FM0D 1HW8A 2C3PA 1TK5A 2YPZA 1HBUB 1ZW7A 4K0KF 1EUVB 1TIFA 4P1CC 8ATCB 2RRBA 1GC7A 1FTCA 3GB0A 4RL1A 4US9A 1DQ9A 3H6NA 1RWUA 4KZCA 4DSLA 1UJ5A 1OIAA 3BM7A 4B08A 5MAOA 1VHFA 2HZAA 4FA6A 5J17A 3IFEA 2V9WA 2QV6A 4R5PA 3BK1A 5E2QA 3Q8UA 4P74A 2KL8A 3Q8VA 3JAMY 2VODA 2R7WA 1WC0A 4ANDA 1SEBD 1T9VA 5KT7A 3O44A 3DHIC 2HWTA 3R2DJ 4TLRA 2WLBA 5IQ6A 2BDPA 4WCEQ 2D9OA 3ZXWA 3ENVA 2BM1A 1XLNA 3H5XA 2F65A 4XIUA 2KO1A 5FDLA 3AULA 3WIMA 1UETA 1XCQL 3FCVA 1F52A 4C4VA 1AWDA 1LK5A 4DV4F 2MKIA 3MPYA 5DQHA 5EWGA 4DR2J 5HVFA 1AW7A 3POTA 2HIYA 2HMIA 4H54A 2XMMA 2E1AA 1QAYA 5AE3A 4B3MF 1NK5A 3QCAA 3KLGA 2HS3A 1GXLA 2DZKA 5CXTA 2HTHA 2DXEA 2XSJB 5CTRC 1IJFB 2B7BB 3AI5A 4OZ0A 2BMBA 4JB8B 4X2BA 5DRKA 1AUSL 4N58A 1N33F 1HBMA 1XNQF 2J7WA 1FJGJ 4Q2JA 1WKJA 1ZM3A 2BS3B 1K9MT 5B08A 5KFRA 1M0SA 1XLOA 1R43A 4FHKA 5JZEB 3IWXA 3W5XA 1F60B 2LVQA 4CNYA 3NHEB 3HVTA 4XO0A 3P3DA 2N1VA 3HP6A 1TL1B 3CCQS 4ZYNA 3IG1B 1NK8A 4C9DA 3CD5A 4USJC 2OPQB 4OZBA 2LXCA 2TSSA 3IBFB 4QPXA 2VKRA 3FRYA 4IOCQ 1B0PA 3M8RA 2KQSA 2YNFA 3U7JA 2LVOA 2AJ1A 3SU8X 4RWWA 5KFTA 3V4MA 5HL7Q 2WHOA 3AQPA 4DV5J 2DGTA 1UA0A 2HHTA 4PG4A 2BACA 5LOQA 2BWFA 3GOEA 2N0SB 1FDNA 4P7VA 4C8NA 4PQUB 1OEYJ 2B8QA 1V5TA 3LP2B 3DQVA 3M8WA 1VC5A 3JW0X 3SIPB 3BYTB 2CDQA 1CMXB 2GMIC 4H4KC 1QSLA 3ZUNA 3ZJVA 3QJZA 1T9WA 1SCJB 2CXEA 3NGDA 2ICIA 1D4BA 4P52A 4G3IA 4CO1A 4HPLB 4HLEA 1R0CB 2MB0B 4XZ4A 1HYSB 2ZM6J 1X31C 5IP4D 3D7SB 2O01C 2LMIA 5KFSA 4OVVA 2MH7A 2E1RA 1A7GE 1Z2MA 1D3WA 3UE2A 1UA1A 2GJIA 5HAOA 2ABYA 2MJDA 2KFYA 1MJDA 2W3RA 1F2RC 2ZEQA 5CCLA 1TKZB 1IWAA 4CCHA 2P9EA 2L32A 1TKZA 2C42A 4DCJB 2J6TA 3OLMD 2IM3A 1MPEA 1HNXF 5LNK1 4KV2A 4NCBA 1FKAF 1T3QA 1OO0B 3GLJA 1WGYA 5CABA 1JALA 1ZA1B 3M6VA 3A3PB 3NBPB 4C3MA 1VQ6S 2IO3B 1U7LA 1YJIA 5AXKA 2BBEA 3K57A 1SSNA 3ADAC 1D9FA 2O6VD 4IDKB 1WKLA 1U45A 4DK5A 4IDKA 2YKQA 4QR1A 3TVYA 1K8RB 2IRXA 2LEBA 3DMJA 1R8PA 3U1MA 2IA0A 3PVLA 4ZK7M 5D8HB 3VQIA 2JT4B 5H92C 3UIOB 4MKYA 1CZPA 3DYAB 4ECVA 2BJ3A 1BWEA 3DYAA 1R89A 1WY8A 2X7IA 1EQMA 2ZH1A 2ZKUA 2OAUA 3OHAA 4EU0A 4ILMA 4J90A 4ZLJA 4OYOA 4HCPB 1F9EB 2PT0A 2JEGA 1OSDA 4YY3J 3RAMA 4RUAA 2PTLA 3M30B 3RRGA 2CZ9A 2XB2D 2R2RA 1F9JA 4BWJA 2O6VA 4LF4J 2A6MA 2K8BA 1IKVA 3VAWA 3G82B 2EMSA 1T05A 2MHJA 3NZ3A 2KHDA 4DV1F 3TUJC 4K7SA 1Q78A 1Q81T 3PNIA 3DHHC 4LF5J 2D2QA 5HN0A 3ZFVA 1N34J 1NK0A 4E74A 2VJUA 3KJFB 2HKEA 5K14B 5ETQA 2KAJA 5K14A 3P2BA 3LWLA 5MLCV 2K8HA 2OFHX 2W4CA 3CJSA 2KLGA 3LA0A 4F3QA 4DL2A 2XY5A 5J1EA 4WURA 2BANA 2WNMA 5AXMA 2MKKA 3H4DA 4WFNQ 1Z5SB 1IKWB 1GK8A 2HBQB 4MJSB 3FFIA 5I3PA 2V4RA 2QO3A 1IKWA 4EI2A 3DHWC 4Q2LA 1NDPA 2ZVOA 3MHZA 1RABB 1X5OA 4L76A 2UUBJ 4TYBA 3BPSP 1PKUA 4A8QA 1H7WA 2FDNA 2W9AA 4EFOA 2MQ8A 1NAQA 2GB1A 4USVA 1GNKA 4JI2F 2DNFA 1MMDA 2XI3A 4WIPA 3EVWA 4QPTA 3CGIA 1VQSA 3TAPA 2N9EB 5JVGQ 1S48A 2J4XA 4IM2A 5GAGU 4PT5A 2ROGA 4DR1J 2HW3A 3W1SC 1ZZFA 4CLTA 3B4MA 4Y2AA 1RZMA 2VASA 4RNOA 5B0EA 2OGUA 1BT0A 3P5TL 3OSNA 3JYTB 2ZKTA 2LRUA 4WK3A 3I0RB 5J2PB 2Q66A 2J9CA 2XN9C 2P2CB 4FF2A 5J2PA 2A3JA 4Y65A 1U26A 1TAQA 3BH7B 1HBNA 3P96A 1V2YA 2BVCA 4E71A 3T8MA 4RW9B 1CBKA 1S7HA 4ZCLA 3QARA 2FIUA 1WDDA 1FDDA 4U8VA 3WALA 1LXJA 1SL2A 2N7CA 4NAWB 1U6ZA 1UCNA 2CJQA 4NAWA 1WYWB 4A3OA 3I0SB 2YQ0A 4NYOA 1K73T 2AQ3B 1YDLA 2Q79A 3I0SA 4XK8C 4DBGA 3S2AA 2BZ2A 4P73A 2ZUAA 4DCOB 2ADCA 1A0OB 3BGRB 4CQNA 4TLQA 4LF7F 2D3OR 2YTCA 1YJNS 1T94A 3GSDA 4C8LA 1MG4A 2BE9B 3MAQA 2C5LC 1RKJA 3V2UC 3Q8SB 1J7AA 3VQSA 2MW5A 3AEBB 3PYEA 4DMZA 1VQ5S 1X0FA 1BXNA 2QA2A 4D2KA 4FBUA 2GI9A 4A9AA 1U0SA 2KO3A 4C6AA 4NQLB 3TNVA 5FKAC 1N5YB 3MECB 3RB0A 3OPKA 2BKNA 1N5YA 3MECA 4K1RB 5BO4B 3E56A 1RLFA 4USWA 2OKQA 2QYGA 2IBIB 2LWPA 2VF3A 5HATA 4HEA1 2FLOA 4KT0C 2F4VJ 2VA3A 5HJYA 2E5JA 4HACB 5G55A 5KHQA 4YHHF 4NEZA 3CJ0A 1TT5B 3OT9A 4Q8FA 4HACA 4IRKA 5CHWA 4ZP7A 4A47A 5E3RA 2KTQA 4QJVA 1URNA 2B51A 1TZ0A 2Q6BA 3W61A 2DHSA 4OX6A 2X8XX 2DXFA 2BT6A 1BD6A 4M5NA 1ZAVA 4HVBA 2B4VA 3HXMA 2JQRB 3GZ7A 3SI8A 3DXSX 2WBMA 1ZM2A 2MXYA 2R61A 3PYGA 1E8XA 4KBIA 2XG8A 5G5HA 4EEWA 4KZ0A 5ETMA 2GBKA 1IBKJ 2FNJB 3MM6B 4PYZA 3N5FA 3U52E 3MM6A 4FPRA 1XLPA 5E6PA 2DB1A 3G71S 3FQLA 2PLPA 2D3UA 1VJKA 2RDGA 2B7CB 2ZBQA 1WTBA 1RT1A 2ZOMA 2N9XA 1IBMF 3Q83A 1H7XA 4R3DA 4DEZA 1NMEB 4ECWA 1Q8IA 4G1QB 3GU0A 3TX0A 1N36F 1M90T 2CVIA 5GAEU 3GIMA 4G1QA 1S9FA 4L74A 1NK9A 1AUDA 4JI0J 1RRBA 3RZWC 4EUVA 4JWUC 1RHUB 4C97A 3PSEB 4QIVA 4F8RA 2V50A 5B0AA 4M5KA 4NLXA 3EZ5A 5KFXA 3UDCA 1IR2A 1UD7A 4CYEA 4LF2A 2H4YB 3H4BA 1FI4A 2FGOA 3RNGC 2XTJP 1RTJB 3C16B 3EICA 1JLQB 1MI0A 1Y5IB 2IPOB 3RBXA 3C16A 4KYZA 1JLQA 2HZVA 4C8OA 2V0NA 2XEWA 5HMZA 2ZVIA 5L1IA 1YJ9S 3UCZP 4DUYF 3BR9A 1Z1ZA 3K58A 2OPSA 1NK7A 3R7SB 2DH7A 1R6YA 3LQVA 4PG5A 5E7OB 2QC8A 1KQFB 4IG0A 1JXLA 3BO3A 2CPXA 5DPSA 1I94J 4YB7A 1Q0WB 5E6NA 3KLSX 4WWMA 3VF0B 3H59A 3BDPA 1N54B 3A4TA 1RT5A 1F1BB 4PPDA 3KJVA 4OYAA 3HVZA 2AEFA 2ZE2B 4N76A 3CMQA 1UBIA 4WH4A 5LL6d 2WW8A 1WZ0A 2L83A 1P1LA 4A90A 2QT7A 2HJ8A 4KFBA 1MN9A 2N7EA 4CLWA 4M8LA 4NYPA 1W2BR 2PFFB 3QZ8A 4N8OA 2B4UA 3CJKA 1RTZA 5CD4H 4YMEA 1S72S 3RD2A 4Y6IA 3D32A 4IO1A 2LP4A 2DGWA 4N77A 2W25A 3U7ZA 3UVJA 4B0MA 1P98A 1N63A 2KZZA 2KLCA 4IDIA 3I31A 1YJJA 1NCLA 3AE9B 3BV8A 5FD1A 4X4SA 2JZPA 2EK6A 2BM0A 2DO0A 3GTYX 2F1FA 3C6TB 5IT0A 5GXGB 3C6TA 2Y1RI 2AKWB 2R42A 2MQQA 2CVEA 2HAIA 1XK8A 5DPRA 2W7PA 4KGXB 4Q0BA 3DHXA 1XMQF 2D3CA 2QLJB 4NI2B 2HRTA 3MFIA 1D5ZC 3PR4A 4C11A 2J0QD 1UW9A 3PVXA 1ZUD2 3EXYA 1JWAD 3F44A 2HQDA 3MC0B 4WFYA 3IR5B 2DWQA 2EMTA 2CHWA 2H9ZA 2LFIA 2KWDA 5IV4A 2V8GA 4N8NA 2FD2A 1FFUA 1GTHA 2IJRA 5FLXY 1RHKB 3KLVA 2I9SA 5HP1A 1VQOS 3CCMS 5CX3A 4ARCA 2H89B 3AODA 3TQ1A 3KHHA 2PMZD 5CYQB 4DSIA 3KYLA 8RUCA 5CYQA 3SXLA 5C7PA 2XMWA 2FJXA 4O0IA 3NVVA 4IH5A 4DR1F 2CHZA 1WWTA 3HF5A 2GAGC 4J9RA 3FSIA 3EX7B 4DUTA 1TY0A 2HBZB 1ZOTA 4MMOA 2KDIA 5JJBA 1QVGR 2L52A 5BMHA 1YG0A 4ZOHC 2GV1A 4OX9F 3LALA 3Q8BA 1HPZA 2ZD1B 2IVYA 1YSJA 3HHLD 4QQBA 5A8KB 2OPPB 1C1YB 2ZD1A 4F1SA 5A8KA 2R7TA 3CCES 2DZJA 2L7RA 4X4QA 2OHDA 1VQ4S 1A5RA 3M8QB 2D11A 1RHRB 4LSZB 4W9IA 4Z37A 1IXKA 1WXVA 2PVOD 2CJKA 2QMUB 4YTPB 1FRHA 4LSLA 2LDYA 3N1YC 5KG2A 1QTNB 3E01B 1IM6A 4A55A 4RU2A 2CWKA 1WJ4A 1SC4B 1TR0A 1C1CA 3T9LA 5D77A 2Z8QA 2IBOA 3UDVA 2VPXB 3PRVA 3VAIA 2H88B 4B02A 4H4MB 3EPIA 1R0BG 1WGDA 2NS1B 2DTJA 4DV6F 4FJZA 2VC1A 4H4MA 3DLKA 2J5AA 3RAXA 1TQLA 2PSZA 3PACA 1SE3A 2AYOB 2WOMB 2ZVSA 4LFBJ 1JMLA 2KDEB 5KFDA 3HO1A 1R8BA 1RKIA 1T03A 1NKEA 3RGIA 3DLEA 4LJPB 2FUG9 2E7WA 3ECIA 4Z2XA 1NXIA 3PRDA 3T3FA 4WP3A 1KLVA 2FB0A 2VQFJ 1I4QA 4WJNA 4DR7J 4IC7B 3DRRA 3R6GB 2BQUA 2NVUI 2XZWA 4LNFA 2J53A 1TFYA 4JV0A 1GJZA 3BPDA 1RYSA 4O1NA 2QL7B 2W9CB 2XNRA 4GIVA 4NZ6A 4NYZA 3E2EA 4HI1A 2W3SA 4NLSA 1E6EB 2UWQA 3I56S 2MZQA 3GFZA 4BFRA 4KC5A 4X4NA 1UEVA 4Y0FA 2RD0A 3TEWA 1FTRA 4LRBA 3G8TA 4GO7X 5HMYA 5HLFB 2CJ9A 3FILB 2QSFA 4UDUC 2I38A 1GXTA 3ILLA 4L1BA 5HLFA 3RB6A 1S79A 4ELUA 3N32A 4NZLB 2H1YA 3W7BA 2ZNVB 2WP9B 4UUWA 1YX5B 5DGBA 2V9KA 1O8BA 4DSKA 1KWMA 2LQJA 3P5BP 1KLGD 1ACMB 1C4PA 1J8CA 2GJ2A 4LFAF 2KX3A 1MG8A 4QIGA 1FNMA 5BYQA 1RT3B 4ZRPA 1LW2A 1UL3A 1VZ7A 2DY1A 1Y9OA 2EKNA 3VTUA 1SC6A 1WJ9A 1R8AA 3A9JA 2CNOB 1YRTA 4TKTA 3HHDA 3P4SB 4WF9Q 1BUIC 3W1YC 2JZZA 3TA1A 1BMLC 2BWES 1ZTWA 2DGQA 4K4WA 4OVZA 5FIIA 3PZ7A 1TY2A 3K5MA 3WBZA 2I5JB 2JLFA 2VBWA 2I5JA 2G2YA 5KG1A 1NEKB 1D1UA 2WWZA 4KKIA 1OQRA 4AJYB 3Q8FA 3J7ZT 2DT9A 1MWZA 3ZNID 4JI0F 1IQTA 2CQGA 4Y3CA 3UD3P 3AD8C 3DHGC 2X3GA 4JI8J 3B0AA 2CJXB 3JQKA 3T3NA 3HSGA 5T7LB 4HKQA 2FLPA 2FHKA 2NYHA 3AE5B 2ROPA 1RWNB 4C0HA 3QX1A 3N6NA 2K1RB 4DN0A 4ZIWA 3H1UA 1M5PC 2QSWA 4K5RA 5ETVA 1FWKA 2KFZA 4GN1A 2BYFA 3TUPA 4WP9A 3W5YA 5BR8F 3J81j 1AXQA 3NAHA 2JEFA 4CLFA 3ZJUA 1H2VZ 1SV5A 3BYYB 4OI3A 3PW4A 1Z4UA 3NLCA 2CS4A 3MCMA 4PKDB 3BF4A 1DGJA 1CJUA 3MR2A 2X38A 3PIOQ 2QLFB 3ZO7A 4TY8A 1NSQA 1CJKB 4J9SA 2OMOA 3UNYA 1CJKA 1WGHA 5L1LA 3AOCA 4I6PA 1RBOB 3ENAA 3KK1B 2KTFA 2RF2B 1E8YA 2HVEA 5CQGA 4GDKB 4ANXA 1BQMB 3LANA 1Z2ZA 4ZRKA 2E1MC 1U1QA 2E44A 1IKXA 2MZSA 2RR9A 4JI4F 1K47A 3KUDB 4P10A 1MROA 2JOQA 2OLWA 3GSIA 1HNVB 5D3GB 3QWPA 1JCKB 4Q5VA 2B43A 3KJNB 1ZAWA 5FK9C 2U2FA 4I2PB 2BKPA 4JI7J 2QTWA 1N52B 1NUEA 4J9MA 3RN9C 3UO0A 2HNZB 3MPVA 2QJLA 3T5LA 3M8PB 3X0WA 3BGFA 1NSKL 2ZDOA 3M8PA 1NDDA 4MYTA 5J2NA 2EG2A 3V81A 2NBWB 2RUGA 1NYQA 1WX9A 3LTOA 3SSRA 4US8A 2X1GA 1QOGA 4KAIA 2APOA 3EUNA 2NCKL 3K59A 3MM7B 4ECQA 3AD7C 1MG7A 2CWXA 1CEZA 5L95C 2MQPA 3UN5A 4J9KA 2D1CA 5B0BA 1ZXHA 1NH7A 2QL9B 3BYRA 4UZBA 3APCA 2CIMA 4LVOP 3HK2A 4GLSC 3BO2A 4FVMA 4TU9A 5G2NA 4XPEA 2KT7A 4JI5J 1S4EA 3CCLS 3RUIB 3B8HA 1RT4B 1GMWA 1RFAA 3CD7A 3L10B 3NJTA 4AUQC 1EB0A 4YT0B 1FRMA 2YWWA 2EFGA 1CLFA 4USMA 3TBLD 1YJTA 2GVZB 2IDYA 4PWDB 2N7JA 2GCFA 2OH2A 3TAMA 2UVVA 3QIPA 1SQEA 1KC8T 1XR5A 1VS3A 4F4AA 3MDFA 4J9UE 5ETTA 4WK1A 4HCNB 4DOZA 2QC3A 2QFJA 2REXA 2ILZA 4F2SA 2V34A 5C5JA 2FCSA 3P4RB 3DGPB 1F5BA 3PV8A 4FN5A 3ZYYX 4RGNA 3PHXB 5M2RA 1T9XA 2KQ7A 2OSRA 3A33B 2NPFA 2VH1A 3CCWA 3C6UA 1REVA 3LAMA 1UWXA 2HQIA 2QIFA 1S0OA 5HBMB 3NNCA 4PYUA 2CQ3A 1RISA 1S1XB 2M70A 5HBMA 2MLYA 4I1TA 1PJ6A 4JV5F 4JOUA 2ACMA 1JLFB 3C66A 2W2QP 4W9DA 4X84A 2WXJA 1WSVA 1I4HA 1JXVA 2PDAA 1VQPS 4C0BA 3LF0A 4HVZA 2QLBB 4ED4A 1JLAB 3SYZA 1C0TB 3VVTA 2V3NA 3D3CJ 3D5MA 2DENB 1S9EB 1C0TA 1VI7A 2DPJA 2G9HD 4XYCA 4WFAQ 3OTOF 1S9EA 1X7VA 2MZ1A 3UINB 4O4RA 4DDFA 5CHVC 4OIXA 2KOXA 1FD6A 4UW2A 4GXBA 1HNWF 3I9V9 3Q2SC 4RZRA 5I42A 4HHJA 4KE5A 4AE5A 2MSED 3IG3A 2IO0B 4ETZA 1HQUA 4RJVA 4DJBA 1FXRA 1UVKA 3BY4B 3BSCA 1E5WA 1WI8A 1JIHA 2FLNA 2L0TA 2CPEA 4K3BA 1NVID 2E9RX 2B9XA 3O2IA 2MY7A 3B08A 1GX6A 1EU4A 3G2XA 4OHWA 3HM9A 3NL0A 3PT2B 3VQTA 3TVZA 5G5GA 2WXFA 1VQ8S 2IZVB 3DDIA 4FS2A 1FKOA 4K7UA 3W2VB 3JSRA 4H4OB 1GTEA 3VALA 4OZLA 1HZ6A 3AMZA 3FBCA 2Y8YA 2QIEB 1U0HB 4EO6A 4CHKA 5MPOA 2LECA 1M5OC 2DR7A 2DAFA 1WHVA 5C23A 1U0HA 3MAAA 4FXCA 1FO1A 2RMLA 2MEWA 5KG3A 1FJ7A 1HKAA 2DKOB 1VRUA 1HWJA 1CG2A 1YQHA 4TU7A 3DXBA 2ZWOA 3G8QA 5HVGA 3OWEB 5F8HA 3BGLA 1X5TA 4FYYB 5IOLA 4JI3J 3M05A 3NZUA 2DR5A 4WQMA 3J80U 2QMWA 4RW4A 1PYWD 1JK9B 5AJ3F 3TEHB 1ZPWX 4OHYA 1YIWA 4NJ7A 5G0RA 4LT6A 3R6LB 2BQQA 3RCZA 4OW0A 1V3RA 2IAJA 1YWXA 1KD1T 4IH6A 1YX2A 2RDBC 2VG5A 2A5UA 4NLTA 4BVUC 4ENOA 4XC2A 3FEXB 3MM9A 1RHQB 2GQQA 3CSFA 4ZMMA 1BQXA 2G2ZA 1TVRB 3Q2AC 1SJ1A 2DZIA 2MQOA 4IWQA 2R7XA 3AB5A 3BGOP 1MU2A 2AJ0A 4I6YA 5LMNF 2C7NB 3RG6A 1E10A 3EZOA 3OXFA 2MGZB 1B0VA 3BWUD 4DFJA 2MGZA 1TTNA 3WDOA 4KGZB 4BHQA 1VRTA 1WC4A 2R2SA 2H5JB 1N0VC 2G13A 4RCOA 5LXHA 1TFWA 1QOAA 2WB4A 2DGXA 4DR5F 1ZDXA 3OVAA 1P0RA 2IVFB 1EM7A 4DR3F 2AZ3A 1D0EA 3PX0A 4JGHB 1RT2B 4ED0A 2LXAA 2JWUA 1RT2A 2XQCA 4ES2A 5ETNA 1WOPA 3PLUA 1QVFR 2GVDA 1Y11A 2EKYA 6AT1B 1RLDA 3D4JA 4URKA 2QJ3A 4LRCA 2FY1A 2RDJA 4IR1A 1VRAB 1N60A 1XF5L 2PW9A 2DJWA 2EKIA 4DG1B 2J6UA 4O3OA 1IBLF 3FBFA 3MTNB 4WZMA 2ZH2A 3A8EA 2OTJS 1LFWA 4ALZA 3GR0A 2OTLS 4LRDA 3MHSD 2KFKA 3CW2C 1SKUB 2ATLA 4XWTA 4A8MP 4QWEA 3I6PA 1L3VA 3HZEA 1RTDB 4MDKE 2KB2A 4B9VA 2WRMA 2Q6CA 2QA4S 3VWSA 1OEYA 4USAA 1S49A 1PGBA 2KK8A 2LQ8A 2V4LA 4DX5A 3M9OB 3KLIB 1N88A 1FCCC 3OTBA 5C25A 1AROP 4LF8J 1BQNA 1LXDA 1RTIA 1KOTA 2MBEA 2V4IB 3BR8A 1WD6A 1YJRA 4FXWA 2MY8A 3QAQA 5T8IA 3A3OB 2MCNB 2OO4A 1C78A 3BZQA 2BJ9A 4W9CA 2W1BA 2K25A 1UWBB 1F2GA 4ERDA 1UWBA 3W3SA 1ZE3D 4K4TA 4F67A 1YJVA 2M7SA 4BDPA 2INNE 1VLOA 1A6LA 4PRFA 2CPDA 4DR6J 2PFDA 4WBFA 4GMVA 4F3OA 5LT5A 2JVCA 2PPHA 1VDHA 1P9DU 1YMHE 1HQ2A 4USHA 1FIQA 4QIFA 2A2CA 1A9NB 4WJBA 1XQQA 4M1KA 1S1VB 3AB2B 1J5OB 2EFPA 3MCOA 5IM0A 4N9F4 1J5OA 1I42A 4JBCA 3W8PA 2INCC 4I6LB 2RQKA 2KYXA 1DQAA 2FVQA 1VJQA 2B9WA 1N5QA 2LFVA 1S99A 4P71A 1HLWA 3G6ES 1WM2A 4P9SA 1T02A 4WAFA 4GU2A 4LSNB 3CCTA 1NLKL 1N6ZA 5D6JB 2XCPA 3NG0A 1SIWB 4W9LA 4WKRA 1YITS 4B3RJ 1S1UA 5L1KA 3M6UA 4G65A 1REGX 1WELA 3M9NB 3CCUS 4QIWD 1HIYA 2HBRB 4ZOSA 4OZJA 1STEA 1YBTA 3SHQA 3BIID 5DZ6A 1MHXA 4RUHA 1WRDB 1VOMA 3ZNJ1 3HJFA 3KK3A 1YN4A 4NXNF 2G0CA 2R2QA 4HJKA 5D0GA 4E8UA 3MEGA 1Z2LA 1S97A 2XZTB 1TUVA 3KWMA 1V3SA 3VH4B 1OFFA 1YKWA 2WXNA 2KXFA 1C3TA 3DRPA 1GMVA 3DBHB 1EP4B 1RHMB 4UQGA 4DXAB 2MJ3A 1EKSA 2ZBCA 1E7PB 3HI9A 4NLQA 1SL1A 3HKZD 3L95X 5C2GA 2FTRA 2INPE 3MZIA 2JZ3B 2DNOA 4Q44A 4ZP6A 2P9CA 1LQ9A 3UD5A 4F0HA 4O23A 2FC9A 3PDNA 2ZZMA 4CO3A 2IJ0A 4H4KA 4F4ZA 3NVYA 5RUBA 3MEKA 3UCUP 3FCHA 2BJEA 2ONQA 4NLOA 1KVJA 4C0OC 3EC8A 3OUYB 3EYZA 2AIRB 2W2OP 3KXDA 3PHWB 2U1AA 3IA0A 1HMVA 1HARA 4BC7A 2AWZA 3AEFB 1WMHB 4CYUB 1NDCA 3OR1A 4KGTA 2FYXA 4D3GA 4CYUA 1QOBA 3SDEA 4MAKA 4QOTA 1X4BA 4IG7B 1QUVA 4K7QA 1SGHA 1GOZA 2CZ4A 1LEOA 4OI1A 2VONA 4A6QA 3GIIA 3FEZA 3GG0A 4PS8A 4K50A 1WOSA 4X57B 1KR4A 2HVDA 4TKNA 3NOBA 1I51B 3PW7A 1WGRA 2G0JA 1KRPA 2NMQA 3AB4B 4KKOA 1V1PB 2Y1LB 2W9NA 2OEDA 1LWEA 5IQQA 5DG9A 3R2IA 2V2QA 1U1LA 4FYVB 3JSBA 3K2YA 2WXRA 4KY3A 5B0GA 2AQ1B 5K5MA 2Z2YB 3G8SA 2N1WA 1D6EC 1XEEA 1RA6A 4NXMJ 2KKCA 1ZM9A 4IW0A 3OV7A 4GVBB 2OSQA 5JH5C 1U8WA 3L13A 1J27A 3DBRB 2M17A 2KRBA 3RRHA 1Q82T 2DK2A 3G9CA 5DDRC 1XWLA 5LXIB 3OL8A 4NJ6A 1WX8A 3BVGA 3AHPA 4K2XA 1ZXIA 2JXXA 4P16A 4C80A 1PIEA 1QM9A 3AJ1A 4ZJQA 2BV3A 1BY9A 4DZ6A 5H8YE 1SC3B 2NPIA 4BCAA 3SZ2A 4F7VA 3N4WA 3N3KB 3W5VB 1R31A 1H0HB 2LU1A 1LM8B 3HHNB 1U2FA 1DTQA 4ZVOB 4FBJB 3HHLC 4UTGA 2KH9A 1PUTA 1TMJA 3CMAS 2VKZG 2NXUA 2NTTA 1GG3A 1D8YA 2XULA 1KVKA 2MJUA 2DR9A 1S3SG 2M4MA 1N5VA 3BREA 3O8WA 4M0WA 3MM8B 1XC9A 3HT3A 4YR3A 2DRDA 2FLLA 4UY85 3L7PA 1WC1A 4KHPJ 2VPZB 2GO8A 3TR5A 2DNGA 5AXLA 3M32B 1VDVA 2CKHB 3L9ZA 2RB7A 3NRBA 3M32A 2BRLA 5J2RA 4F2RA 3PFEA 2KHCA 2D7SA 5E0OA 3G6YA 2RDIA 1RWSA 2FCMA 3PCOB 1LWFB 1RCXB 4TQSA 4AT1B 5K8PA 1W2IA 1RDRA 2EC0A 3QPIA 2PC6A 2JYTA 3FC9A 2KI2A 2GMHA 4ZPTR 3UDLA 2DH8A 3O1LA 4CO2A 1XXGA 2DX5B 2P6TA 4ZJOA 3EVMA 5F8NA 2AL6A 1SF0A 2HE7A 4ER8A 2BYTA 4QWCA 3TJ8A 2VPYB 4X64F 1S1TA 2Z58B 3KG4A 3KYCD 4OZ1A 2D3GA 2NR2A 1URRA 4OZ5A 3L17A 4M5DB 1U1KA 2AW0A 1Y7PA 4KX6B 4RGTA 1XJWB 2HQFA 4W9KA 1D5MC 1T0SC 1SJ3P 3QHTA 4C00A 3Q8QB 4W9EA 3SFEB 1ET9A 2K06A 3P8BB 4ED5A 4DQIA 4DQSA 5H9EJ 1KLUD 1KS2A 2RAQA 1UBQA 5FJ4A 3LDZE 1P27B 2B3TB 1RWXB 3EZUA 2PA3A 3VGVA 1TBEA 3C14B 1VZ6A 3C14A 3U30A 4Y28C 3W1SA 3M1VB 2W54A 1K1SA 2BBCA 2BS2B 4LF8F 4GKJJ 3NAIA 4IOBA 2MZJA 3DOLA 2HNDA 3FMWA 5KFPA 3UFCX 2AX5A 2GJFA 1SI9A 4BBNF 2HJ1A 1ZP0B 4PWUA 4M01A 3JSMB 3PX6A 5A8RA 4A8YA 3GFYA 1UNSA 3EECA 2BA9A 5EWFA 2HQ3A 3R5DA 3DBRI 1VR6A 3OR2B 1QD1A 1YJUA 3BEGB 3C46A 1UKUA 4F50A 3C0RB 2RPQA 1LO5D 5IAAC 3OR2A 1FKPA 5DCNA 3MFHA 3RBDA 3I5AA 4RW6B 4DR6F 5M2UA 3NUHB 4RW6A 1DY3A 4P6VF 5EE3A 4LQ9A 1NH8A 1FFSB 3CJQA 3DPDA 1SBBB 1V80A 3IFWB 5EUHA 2IY1B 4QWDA 4ED6A 2YLMA 2DPIA 1WIAA 2AWTA 4NMXA 3OAWA 4J3OD 2W8KA 3R8YA 4HH0A 2GIQA 4RF1A 2KC2A 3IR7B 3VGSA 2WONB 5CZVA 2BXJA 4Y2CA 2NBVB 2Y5BB 4NCGA 4F4KA 3GE9A 3UDEA 4KJIA 4CT8A 1SQGA 4AQYF 5KFYA 1DZ5A 3TZYA 3DBLI 5KFJA 4JE3B 1JNRB 4OX7A 3NXZA 4F02A 3EHVA 3RNAC 5F8JA 1NKBA 4TV3A 4QW9A 4B3SF 1HWIA 2W8LA 2YBVA 4IYQA 4KGMA 5HSPA 3X3UA 3M8YA 2W9BB 5KFLA 4RLEA 3N30A 3T1HF 1Q7YT 1IJEB 2BYEA 1KJTA 2ZPNA 2BRKA 3A1QB 4K0KJ 1SB3C 2KDBA 1R6VA 2N9LA 2DHGA 4ZVGA 4MGIE 3AEDB 1L7YA 2RMMA 3AH6A 2WXGA 1EU3A 2CQIA 4EUTA 1GEHA 1ZGUB 3SEOA 2EFOA 3V4IA 2B9YA 4RKUC 3PG9A 4CP5A 3ELHA 3K5PA 4C7QA 2NS5A 4TXSA 3VR1A 1YRUA 2N7YA 3KW5B 5F8GA 2KWCA 5KHOA 4IQMA 2E9ZA 1WGGA 3P49B 3VAMA 4JPSA 4KGVB 1CULB 1AZSA 3RU0A 2LDIA 3E51A 1IN0A 1SC1B 4F25A 1CULA 4HWIB 3CWIA 5HO4A 2QA4G 2MZTA 2V69A 4DV4J 2MQLA 3UN2A 3VV2B 3C19A 5DPWA 3C2PA 4KV8A 4EOYA 4A8KA 3FMBA 4FYXB 4UOHA 5THWA 4B3MJ 2MQJA 2XZDB 4B9LA 2ILYA 4D3HA 1T5XD 4LVNP 2DLBA 2LQ5A 4K3CA 2ZBIA 4CWBA 4LMZA 5EGYA 1V97A 1WC5A 4RW7A 4ZPVR 5CHFA 4KB7A 1N33J 2HHVA 4YQWA 1RLCL 4MKVA 3A8IA 3CD6S 3WAOA 4U7UK 2K8CA 2HWHA 4IFYB 1EKRA 4NRUA 3MAHA 2RE1A 4ZPWR 3VZIA 1D09B 3SR6A 1ROFA 4IFYA 2LA4A 3O65B 1VQYA 2GHVC 2V5HG 3RB3A 3UF8A 1NRKA 1KRHA 2DYAA 5ITHA 1UAWA 1C1BB 1C1BA 2N4DA 1SVDA 1JLBB 2VZ9A 4USTA 2XS2A 2KHWB 3J80Y 1Q16B 3Q69A 4GOCA 4XTTA 1VQ7S 1JLBA 1AW0A 4WTOB 4WP8A 4LDTD 5DETA 3BVMA 2GO9A 3EGVA 2P8IA 3U1LA 4ZVEA 4IFVA 3KMQA 2K6QA 1J2VA 1DBDA 3DRXA 1RAAB 4USKA 4X4PA 2Q43A 4QR0A 4R8UA 4ZJLA 3TWZA 3VUXA 3UWTA 2Q1LA 4LIRA 4JWSC 2FJAB 2O2VA 3Q8RB 4MYUA 4XGAB 1MFWA 4OYIA 1K52A 4B3OA 5AE2A 2NPTB 1DLOA 2HHHJ 3W2DA 4O3QA 2XSFA 2NPTA 3BINA 2AX1A 3MR3A 2LEAA 2CJBA 5AZFA 2ZH7A 3SV3A 3IM8A 5GMDA 2RQ4A 4HROA 1Q5WB 1N0UA 2XNAC 4I6WA 5KFBA 2CU3A 1CPZA 5KFKA 4DLGA 3OJUA 1R0AB 1FHTA 1RHJB 2RQCA 3SQOP 1HW9A 1Q95G 4OJHA 1DHMA 1R0AA 1B9RA 2V9HA 2WHIA 5T41A 1UFKA 4II3B 4GC7A 1PILA 3L4BC 1NSPA 4EYIB 3Q2TC 3RW6A 3P45B 4DPOA 3AE1B 1NJIT 2R7OA 4L3NA 4OQJA 1RWVB 3S01A 2C28A 1SIJA 2VFSA 2HAFA 3N6MA 2GBMA 3AM9A 2VB6A 2E1PA 5LSOA 2HURA 1N5WA 4U8YA 1YN3A 2I0XA 3M8ZA 2R4FA 1WI6A 2C2DA 1V6HA 3KWVA 3UQBA 1Y56A 1KQGB 2HFVA 3TMPB 2M56B 2CU1A 2YNHA 3RNFC 1MSWD 1A70A 1AARA 3ZNUA 2ASYA 2CPHA 3G96A 3DOKA 4DR4J 2KANA 2DNZA 2DRBA 3CULA 4B9MA 1VBYA 2DRAA 1TZ1A 2F9DA 3TSSA 4F0MA 1LWCB 5DGAA 1E6VB 3PLVA 1L6VA 4YB5A 1TKTB 2I1JA 1SKRA 3OXGA 4M8MA 3ET6B 4ANCA 3CC7S 3IVFA 1QAJA 1NI3A 3NP5A 5I3QA 4JP8A 4EGLA 3L08A 1VRQC 1F6TA 5C42A 2RS2A 4RM8A 1DOXA 4M8NA 4PUOA 3KTQA 1C0UA 3WC2A 3R5AA 4YS2A 1CJVA 3PRBA 4GKJF 3DRSB 1ZAXA 4N7TA 2XM3A 4MM3A 3DRSA 3RZFA 3EM1A 2SEBD 2FIFA 1TZOA 2JWZA 2DYBA 3TZZA 4X65F 1V3ZA 4DV1J 2NXJA 2YX1A 2WXIA 2LMCA 4IR9A 3D54A 3P1MA 2A4ZA 2E3TA 4MFBB 2XWYA 5GMVA 4RBUA 4G3XB 2G4SA 1L3TA 2AMCB 3M95A 3BQ2A 2DEJA 1HBOB 1P6TA 3BSNA 1V9JA 4ZLNA 2QMTA 3EGRA 2Z8LA 1HBOA 4MEMA 2M3DA 5AUIA 5KFNA 1TKGA 3AJ2A 3B82A 2AJQA 1QQRA 1WG4A 2J0WA 4J9VA 3CWJA 3KQ4A 1GAQB 1VCTA 1VQLS 2IYDB 4YXDB 2KKHA 2QN6B 2PE8A 4K59A 4ETXA 1RTHB 2PVGC 2CQHA 4QCLA 3R27A 5L83A 3R5CA 3LH2S 1IKYA 3IXQA 4NLWA 2KC1A 3RNEC 1RAGB 1G6JA 1SJFA 3M9MB 2EI5A 1RM6C 3CSTA 4GO5X 3PZDA 3EFCA 2RJZA 2D41A 4DN9A 2V1YA 3BBBA 4EZ9A 1K51A 2Y1JA 1TL3A 4ITKA 2MQMA 1I6JA 5BMIA 3MOZA 5H9EK 1JQ4A 4JI1F 4DQOC 4EKUA 1S6QB 1NDKA 2HDEA 3GIRA 3Q3NC 1HWUA 2HD5B 3VHTC 3LP0A 3Q3JA 4FNHA 2XC9A 1X5SA 4J9QA 5KFEA 5A8WA 4S0MA 1Y5NB 1SKSA 3SCLE 3JB9k 2G2OA 2JVRA 2XNQA 3QIJA 2XLIA 1XNRF 2VFRA 4O3NA 4BKSD 2BTEA 4ZVQB 5HROA 5T14A 2XMJA 2XMKA 2UUAF 4K81A 5DO2A 3KDNA 5FLXU 4G1IA 3WHIA 2MPUA 3PREA 3IAS1 2OJ3A 1CQNA 3R66C 4R5PB 2DGSA 4CLPA 2OMLA 3DC2A 4XDDA 3W63A 1N48A 2W2NP 2ZZNA 2UZAA 5IT9U 3PKYA 2HEKA 2YVCA 1X0PA 1IR1A 4OI4A 2G9OA 4DV7F 5FDLB 4YN3B 4M5IA 2C3OA 3L3CA 2DY9A 2Z2MA 1Q8BA 4HR2A 4NAMA 4PWWA 1FJCA 4C4VB 2CNLB 5HANA 3QO9B 4Y00A 1U09A 3ZLZA 1L5PA 3QO9A 3POTB 4DQPA 2HMIB 4HYKA 5KG5A 4KSKC 2C7MB 3IR6B 1YTYA 1U02A 4HT7A 3TZXA 1GNUA 1K1QA 1ZA2B 3KLGB 3W1YA 2FIDA 3HLUA 1X8DA 3PZPA 1ZYQA 1TS3A 1ZTTA 1HBMB 4AD6A 4LF7J 1HNIA 3K0JA 5D0HA 2AGQA 2MKSA 4C8ZA 2L8JA 1O51A 2VBYA 3PW0A 3JQJA 4I7FB 1IPGA 1LQBA 4GRSA 2PD1A 2LD9A 3OFGA 4I7FA 2CJOA 2L9NA 2VUGA 5GMKa 3V05A 3TJPA 4BKGA 3GYXB 3NS6A 3B2FA 2BX6A 1CVJA 2D10A 3HVTB 4DWFA 1DOIA 4I2QB 1HD1A 3DOMA 1T0QC 2WDVB 4ZKAA 2OEKA 4I2QA 2IMOA 1XQIA 3TANA 4W98A 4O3PA 1ICEB 1KQSR 2HQGA 2MA9B 1YIJS 3ISND 1PC4A 2QE5A 2YNFB 2M8DB 2JEIA 3CPWR 3SFGA 3QGPA 4DFMA 2WW4A 2VL1A 1GX5A 4LUBA 4YHHJ 2Y0BB 1SE9A 4EE2A 2N4CA 3JTPA 1IBXA 4PG6A 2CRLA 2OHFA 4GDLB 2ZC3A 2WYQA 1MMLA 5GADU 3FCWA 3DKDA 1OY9A 4GDLA 3PJXA 1S6PA 2HHHF 4EWTA 4LJOB 4FP9A 4RH6A 4DWIA 1R4NB 2H48B 3G6VA 2ZNZA 3VAKA 2DBYA 2F8EX 1EETA 3H5SA 4P72A 2CPFA 2GGPB 3ENEA 2KMCA 2GGPA 1MN7A 4MK8A 2W4DA 2DR8A 2XK5A 1TKXA 1F2HA 2LVPA 3SMZA 2GX8A 3HSZA 3AY0A 4DQRA 3PEHA 4X66F 2XLKA 2ZVNA 1Q79A 2WXHA 2UUWA 4MTPA 3V6DA 2FVPA 1PGXA 4RX6A 2YH0A 3ITHA 4P2SA 3HIZA 1ET6A 1DRZA 3Q89A 5KT4A 3SCKE 2Y5PA 3K8WA 2BQ3A 1U47A 1QLBB 2L9WA 4DX6A 1L3SA 4FNIA 3Q8YA 1IBMJ 2BYCA 1FK9B 3TJAA 1N36J 3I87A 5E5NA 1FK9A 4KH1B 2JRIB 5D4LA 5IKCM 5E3CA 1ZM4A 4LNKA 3ILOA 1VK3A 1P7EA 1P1AA 2NXCA 5L9NA 1PAEX 3Q86A 2FJDB 2LHDA 2VDHA 2JF5A 1YQBA 4IG3B 2H3EB 4HPMB 4IG3A 4F0KA 1J5EF 4DR4F 4ACFA 1HA1A 4DPXA 2EC2A 2IGGA 1XMOF 1SUQA 4J91A 2JZ5A 3BYPA 2CPIA 4AP4C 2WX0A 3DMJB 2R8KA 4C8YA 3GIKA 4M5LA 2OOBB 1RWWB 2CFXA 4DUYJ 3CDUA 1L3UA 2R7QA 4M94A 1WF0A 3IAM1 2QEXS 2DCUB 1NK6A 4F26A 1W25A 3SFUA 2YKNA 3OLAA 2HNYA 1B0TA 1KTVA 5BYSA 2WK4A 4BLGA 2LGSA 2LXIA 1R7IA 4AWJA 3T1YF 4ILRA 2AJ2A 2EPIA 3DU6A 4ZVPB 2UVRA 4A8XC 4KGKA 1I4XA 1X4EA 1KH0A 1L0VB 2O6VB 2KZMA 3JSVA 1IKVB 1T05B 1S10A 5CHCB 1FO4A 1D9DA 4CH0S 3U2SC 1JMTA 3K89A 2CJYB 3CDBA 2MQNA 2FHOB 2JFKA 2UU9F 2K22A 2RS8A 5F8LA 3ZGZA 4J6IA 1UEUA 3M63B 2WXOA 3EDQB 5ETRA 2WBRA 1VCBA 1OPZA 2RILA 2GBJA 1DYQA 5DM6Q 1JLCA 3W64A 3GS2A 2AJ4A 1R4NI 5J1EB 2DAJA 2BANB 2V4QA 1UTAA 4N56A 1VK8A 5LMUF 4B95A 1JNZB 4KSLC 3FFIB 2X1BA 3N79A 3PHEA 1XMQJ 2FPHX 2K9XA 3MOJB 3LO3A 3PRPB 1SJRA 4BS2A 4NWBA 3PS6A 1NSAA 3H7PB 1Y3JA 1VGYA 2NZ4A 3AEAB 3HPOA 3H7PA 5C2TB 4BZAA 1ZBTA 5KG4A 4OZCA 3ILIA 5B09A 2RIJA 2ADBA 1H38A 4X4RA 2J52A 1GQEA 1SIFA 3HFZB 3ENQA 5LXRA 1M5HA 1Y4ZB 2ZNVC 2CNKB 2J76E 2IM0A 4M5GA 4LBIA 3WANA 1FMAD 1WE7A 2MJNA 3L0WB 1YBUA 4R0JA 4QU6A 4P2XA 1S6UA 3HK0A 1U24A 3T5HA 4NLRA 2IM1A 1S0NA 4FADA 4CLLA 5AEKB 2UVUA 6FD1A 2GFFA 1LV5A 1KVIA 1NJWA 4OX9J 2OFGX 1V49A 5DG8A 4MT5A 2OIHA 1K50A 2GS8A 3N5BA 1HBNB 4V1Ak 1E0ZA 4ANUA 4EZLA 2KNBA 1XT9B 3CO9A 5HI1A 2GQ2A 1WR1A 3Q6BA 2C2KB 4AQ7A 4YP3A 2GHPA 3IN5A 4OI2A 1UGMA 2B6AB 3A4RA 3OQ2A 2B4PA 4ED1A 2B6AA 2AL3A 5LLIA 1YJ1A 1CSJA 4ZHRB 2O67A 4GKKF 1E7UA 2E6XA 4BOSC 4F8CB 3T9NA 4PS3A 4ZHRA 2E9TA 4MJKA 3RT3B 2N9PC 2W2MP 4O4GA 1U6FA 3FBBA 3KKFA 4CO0A 1RB0A 4RUCA 4DV6J 4NASA 3MMCB 4CI0B 3H0PA 2HG4A 1WI0A 5I3UB 3ZJTA 5EE9A 4LQ3A 3MMCA 5I3UA 4RGMA 3DLBA 4YTNB 5EWEA 4G50A 1SJ4P 2XMUA 4U7UD 1X9SA 2X1FA 1QUPA 8AT1B 1H72C 5KG6A 1D8ZA 1TKDA 4M5MA 3LPYA 3GP7A 3CF5Q 1L2NA 5CYMA 2A1BA 2YNGB 2BE7D 4DCPB 2VH2A 1F0XA 3K8VA 2YNGA 1OQ3A 4GB9A 2VOOA 2IO2B 2PIAA 4FYDA 4P7IA 3HULA 3HFVA 1T0YA 4DUZF 2ALYB 3PKMA 2P5VA 4M00A 4NLGA 2C2ZB 2JPHA 3AE6B 3OJ4B 4ECRA 3FRZA 3ETOA 2JFDA 3NEKA 4YSYB 4LF1A 5F8MA 2Y5CA 2J9DE 1LKZA 1I3OB 1PDXA 2F4FA 2K7KA 2HBYB 2CG4A 5EE0A 5IC6B 4KO0A 4AL7A 1OQQA 4LFAJ 1OQ6A 1Q5YA 3DVNU 1NB2A 3GG1A 1XR7A 4LK0M 4YDXA 3VGTA 2C3YA 3VTIA 1UZDA 2W7AA 4NPOA 5BJRA 1CJTA 3W8GA 2V8VA 1H6KX 4FLHA 3RI7C 3ZC4A 4ZPBA 3CJ8A 2K8GA 3VFKA 3R1LA 2KT3A 3OJSA 2ZZPB 1FRKA 1WFYA 3W5UB 3KG1A 1RT1B 4G0NB 2PI4A 5D2MB 1PSDA 2XHWA 3T41A 5KT6A 3AXMA 3IBEA 5GAHI 4GC6A 2QCZA 3AA8A 3DI6A 3X1LB 1WR6E 2HFSA 5KT2A 3FGVA 2VQEJ 3PR5B 4DV3F 3GPAA 2DR6A 3TJ9A 1PO6A 1KONA 3VZHA 2UXCF 2WAQD 2IFXA 3HZGA 3RUBL 1WJUA 1X4HA 3B9JA 5IWAF 4FN2A 1XBWA 4RW8A 3A12A 2LEPA 5F0WA 1V1OA 4Z7YA 2R7VA 2V94A 3GCXP 4WTYA 4WWSA 5BR8J 4IKGA 2A6OA 3H25A 4MELA 1NJYA 3NS5A 3RNBC 5KFVA 5EX0A 3QRPA 5D3IB 3U27A 3FKBA 2OPSB 4OVUA 3MEDB 2RU3A 5EDWA 2WXMA 3H9DA 3MEDA 3AE8B 5JUMA 4IG0B 3RW7A 3A1YG 4ATNA 3ZTDA 2DNHA 2OD6A 2Z57B 1OYDA 3P4UB 3IRXB 2MMYA 1R27B 1X9WA 1RT5B 3US5A 3KJVB 4WU3A 3IRXA 3JYUA 2ZBPA 2DNQA 2FVCA 2HK2A 4Q45A 1T3NA 1QE1A 3ZZYA 2NQPA 2VZKD 1EHWA 4B9UA 4B3TF 3HJVA 3KK2A 3C15A 4KFBB 3OG5A 1ZZNA 1APSA 2LLZA 2XYPB 2KDFB 3PZ8A 3OD2A 2CQ1A 3M2RB 4RO0A 1M1KT 4TUUA 2A10A 1PG5B 3M2RA 3J7AN 3L16A 3D68A 4JI4J 1RT7B 4CDIA 3CJKB 4ECYA 4E0DA 4WKYA 1RT7A 1GAOA 2BOAA 4OJ3A 4HEA9 2FE8A 4ZDNA 4C98A 3IM9A 1FXAA 3UVJB 3AAWB 2ZJPQ 2WXPA 5I4DA 1RI7A 1PBAA 3NRZA 1KKHA 1P3QU 2NZCA 3MJWA 4LF9F 2VIHA 1PYTA 3ZIMA 3AU4A 1WG5A 1HTOA 2IRUA 2XS7A 3QIDA 2V3PA 1H3DA 3VHQA 1UELA 2XYHB 4HKZE 3AV8A 3QFHA 4CLZA 2LEKA 1FRLA 4U96A 3URYA 3J9CA 4B9NA 1UH6A 1Q8LA 4Q0BB 1S1WB 3ZZPA 4OHVA 4UUXA 2PIIA 2MHNA 1S1WA 3ZVVA 1UF0A 3MC9A 4C11B 3MP9A 3CJTA 4L73A 3AJDA 2GOWA 4ZS6A 2J0KA 2LYVA 2Z2LA 1FNUA 4OV6A 1WXQA 2VC0A 3V6HA 3ABVB 3OVBA 2M19A 4LRAA 2HVZA 4P7TA 1JKHB 5HP1B 3CDWA 1JKHA 3VDZA 3V62A 1ENFA 1RP5A 3AECB 3PRZA 4PZVA 3T3OA 2W82A 1Q0NA 3AQOA 3CUNA 2LUMA 1FXLA 2MSSA 5HKHA 3LP1B 2UXBJ 5IT9Y 1X4FA 2YX7A 4KTQA 3MURP 2CZVC 3N01A 3LP1A 2E5LF 1G2EA 4ED7A 3ZNZB 4C7ZA 3UQSA 4OHXA 5BXIA 3W9JA 2W2PP 4IM3A 4NLPA 2D69A 4M5JA 1WYGA 1HE8A 4MACA 3IRWP 2Z2ZA 1OYEA 2XMTA 2PMHA 2RU9A 4Y2KA 2J6SA 4HHHA 1TMMA 3HM6X 2HTME 1HPZB 3OL7A 2R3VA 2JRSA 4WFZA 1ISNA 3IT4B 2JH3A 1GFWB 2IY5B 1Q4RA 2MRPA 3T6JA 3J81U 1AYEA 2FQQB 4NMLA 2Q5WD 2MZRA 4MKBA 4LSLB 2NLWA 5J1PA 2M4NA 3O3LA 3L7UA 2YX4A 1WXMA 3DVGX 5AZGA 2AEHA 1C1CB 3OBIA 1KEKA 3MMAA 1H2TZ 1G4CA 1W7WA 2BJDA 1FFWB 4JV5J 1WSPA 2PE6B 1DJ0A 5J2MB 2DHAA 3DLKB 3Q23A 5J2MA 3K17A 3DVNV 1ZPVA 3EPGA 1HNZF 1HR0F 2KRRA 1FT8A 2LCWA 1HI0P 1FDBA 3PGEA 2BUNA 3HHLB 4DV0F 4FF1A 1U49A 2CQ4A 1RAEB 3ML9A 5KG7A 3HHLA 4ID8A 1PJ7A 5A76A 2HYIB 4C2MA 1T03B 3OTOJ 1KP6A 2Y1IA 2BQRA 4W4MA 3DLEB 1QF6A 3ZZOA 4DFKA 4NA1A 4ID5A 2XO7A 1MHHE 2FY8A 2CQ2A 3FK4A 4WXWA 2KG0A 4DHZB 1HNWJ 4U95A 1I4GA 1JX4A 3I4PA 4GGQA 5J1NA 3V6EB 3DRRB 4ZLPA 3QWUA 3I9ZA 3CO0P 1DARA 2ZITA 1I5OB 3UGBB 2RH3A 3TEZA 1XIQA 4WFXA 5DQGA 1NJZA 4BWMA 1FRJA 3MM5B 2KU7A 4C48A 3MM5A 3MEEA 2E29A 5ADZA 1U8SA 3QK0A 4ZHPA 4LIWA 4OLOA 2H5EA 2LGIA 5IT4A 3QLHB 1NZ8A 4QWBA 1EX8A 3AE7B 3QLHA 3OVSA 4LFCJ 3DDKA 4C3LA 2LXUA 1FNWA 1JWUD 4UZCA 4TMAB 2LASA 2MWSB 3JTOA 2DBBA 4ZYSA 4YEAA 1ITPA 2CA9A 1LW2B 1HBUA 2QMXA 3IWNC 2OELA 1M1HA 2KYZA 4ZVFA 4MIWA 4O44B 4L3KA 3BJYA 1ZS6A 3A9JB 4O44A 3HSJA 4YFUA 4RM9A 2L9DA 3S7RA 3UN3A 4WWPA 3H98A 4U6PA 2PA8D 1RJJA 3M8SA 4RNHA 1JROA 2WU5B 2OJWA 5ETPA 5AJ3J 2HHWA 4V19X 3B1LX 5U47A 1H2UX 1RADB 3D0GE 2XO6A 4YSXB 5KFZA 5EDSA 4K4YA 1MVKA 2MKHA 3AXCA 4P1BC 2Y8WA 4F7ZA 3D6HB 4PABA 4ED2A 4CTAB 4EZKA 2GAHC 2NTSA 1BXTA 3EE3A 4CTAA 2NYIA 3LXFA 4HJGE 3TARA 4Q43A 2V8HA 3AE4B 1TKYA 2VQEF 5DPTA 1LW0B 4NCAA 5IC4B 3BQ0A 1V81A 1LW0A 2B3AA 1EJ7L 1TUWA 5E6OA 4ED8A 2KX0A 4JV2A 1K44A 5LMNJ 4ITSA 1KFYB 5CYJA 3ILJA 1HQRD 5C1ZA 3JQMA 3CCRS 2M0XA 1HA5A 3NNHA 2XSJA 2D07B 4QWAA 1IUEA 2OPRB 2C2EA 1SV5B 3OJ3A 4ZCIA 2OPRA 3KLHB 5K8OA 3A8JA 2EEYA 4ICLB 3KLHA 1WZ3A 3B54A 2VRRB 1CJUB 4ICLA 1XERA 4DR5J 4TQ1A 2H65B 3PXGa 2QFIA 4DR3J 2F9JA 3Q8AA 2B8PA 2N4FA 4X62J 4DL0C 1VQ9S 3MTKA 4TY8B 3HM3A 2RNEA 4QYZJ 3MD1A 3TUOA 2I2YA 1KSPA 4DFPA 3PJ9A 1VQMS 2HGNA 3VAFA 1LK7A 1TL1A 3I4HX 3SQGB 2QLXA 3IMQJ 3R7RA 2ZEJA 2NXEA 3SQGA 3IG1A 5LJ3Y 1WORA 5JHBA 4HDHA 5HQ8A 4LF6J 2OPQA 3DCAA 1IWGA 5E3PA 2FUHB 3FSYA 4BOZB 3F56A 5D78A 1IBLJ 1IKXB 3ISNC 2V63A 1HHSA 4PQAA 3BN4A 5IFMA 2EXUA 2W01A 3CT9A 4OFZA 4CM0A 3BN7A 1TK0A 3NVWA 3ZTPA 2K2PA 1MROB 3MPUB 2KVQE 1SPBP 5KAKA 4MIAA 1U2RA 3AEGB 1R3NA 2DXDA 4PQUA 3R1HA 3HMJG 3HUIA 3LP2A 3QGGA 5C2CA 2JLGA 1NPKA 5CZXA 3THTA 2AYMA 4Q2MA 1VC0A 2MP2B 2JC1A 2V4JB 4ES3A 2IA6A 4HK2A 1QT9A 1OPIA 3BO4A 1Q1OA 1SH3A 2MP2A 2V4JA 3NVZA 4EMDA 1E8WA 5J2NB 3V81B 2KMAA 3D67A 1HYSA 1UPMB 3HKWA 3AE2B 1F1HA 2FGCA 3CDEA 3DWGC 3Q8EA 1YRXA 2F8HA 1Y8RC 2MX2A 3VAJA 3KHGA 1IUJA 2CQPA 1BLUA 4DV2F 3UW1A 4URQU 5KT5A 3OTCA 1LFPA 1RYRA 4QZVB 2J9EA 3N0VA 2BR0A 1SBRA 3EJMA 3MFGA 1BGXT 2CAJA 3DFEA 3LGHA 2PN6A 2KJ6A 2JVOA 1GB1A 4OHJA 3GWCA 1S5ZA 3AXKA 3IWLA 2L05A 3R7NB 4OYXA 4AUKA 2UXBF 3NBPA 4CLSA 1FE4A 2NXNA 5L1JA 3CMMB 3OW2R 4K4SA 2NCNA 1ZH5A 4RU9A 3APFA 1LWXA 2FAZA 2HZCA 2XMAA 2LRWA 3FVYA 1UEKA 4PXCA 2LJ5A 3HFKA 3MUTP 3I5BA 2V0GA 3TAMB 4FULA 1DQ8A 5H9FK 1L4ZB 3MTJA 3QIPB 4B17A 2FZGB 2Y9HA 2FJVA 2JLEA 4KIAA 3Q8CA 1BHNA 3A9KB 1P8GA 3A9KA 3LOUA 2UXDF 4W9HA 4OZ2A 1WGKA 5IZHA 5GMEA 1RA7A 1V5IB 4B9SA 4NXNJ 3EA6A 1VHIA 3IO1A 1UVMA 2YH1A 1PGAA 2C3MA 1F3FA 4NLDA 4FPIA 3C6UB 1REVB 1LNQA 4Q7AA 4DL5A 1Q53A 2I1KA 1FX4A 2HGMA 2LKZA 2M0AA 5K8MA 3M30A 2N7DA 1FF2A 2XGQA 3GMGA 3QMQA 2DIVA 4YR2A 4KDIC 2WS3B 1NZAA 3O13A 1C79A 1UJ6A 3G82A 4P6QA 4UQTA 2J8AA 1RWMB 3AFGA 1YLXA 5LSRA 2VOPA 4ANEA 4F4XA 4ZPCA 2BKFA 2KFJA 1W26A 1IGDA 2DYOA 3QT8A 1ZDVA 3PY8A 3CD0A 2IBKA 3GCWP 4WU2A 2DNRA 1NBEB 1TYGB 2N3OA 5AE1A 4JI6F 3GJQB 2E5IA 3CF6E 3KDOA 1LFDA 1XTZA 1FRIA 3P63A 4E3CA 2ZHBA 3NS1A 2WGSA 2E7VA 4Z7CA 5I42B 4DF8A 1F0ZA 4B0EA 2VDIA 1WDTA 3QT7A 4CH1A 1HQUB 1JJHA 2FZKB 1HTQA 1S6OA 2GIRA 2N82B 3D1QA 4DZDA 3GR1A 4MH0E 3CJ5A 3RZAA 1RGVA 3G4SS 4EK2A 3DLLQ 3D66A 4MJSA 1FERA 3LPEA 3RB4A 5E6JA 3MPWA 4MIBA 4J9OA 2ALZA 3GZNB 2D9PA 3H7HB 3RFZB 2HQCA 3HT0A 3PPAA 1TL7B 4RGOS 4WJPA 3G6XA 4I56A 1TL7A 3WIUA 3KLFB 2JXTA 1FXTB 1FKOB 3KLFA 2KJVA 4LFCF 3VVUA 5F0UA 1S9GB 2F5GA 2MJEA 2J7QB 4FDFA 1S9GA 1TK8A 4M02A 5HMXA 2ZHOA 1YJ7A 2G4BA 4NOHA 1U25A 4TYAA 3MAAB 2L0FA 4MT1A 4WWNA 3CIZA 2QSDA 3HX9A 2QL5B 2H4WB 2AU0A 3GONA 1VRUB 4FYWB 5BYRA 3DN9A 1EF1A 2IO1B 5GAHU 3NGTA 4YUDA 4BBNC 4RW4B 3H2VE 3JYTA 4WFBQ 5G0RB 2Y3YA 1T8EA 1CC7A 3S1TA 3I0RA 1G1XA 3IGNA 3DU5A 2ZPYA 1WF9A 2IAJB 4CM2A 2KM8B 1BWVA 5F3ZA 2VG5B 3KLEB 4J9LA 4MK7A 3MM9B 1B3TA 4PCQA 3KLEA 2EBGA 2GLSA 1J7CA 2LXFA 1QAXA 2MKJA 1FVSA 1ZPSA 4RW9A 3HVDA 4NLVA 1QDUB 2KJRA 1X4DA 1N4LA 3U4EG 4DR2F 2L08A 2VBXA 1AFJA 1UFLA 4EFAC 5HI7A 2ZH6A 1MU2B 3FZBA 4N41A 1O6XA 4HDOA 3W65A 7FD1A 3PFOA 2AQ4A 2FCNA 1CQVA 3MCSA 2C7HA 1GB4A 2WVBA 1VRTB 1WKKA 3BGRA 2G0IA 1KM7A 1LOUA 1XN9A 3KOAA 1B7FA 3RBZA 3OHBA 1FJGF 2BJ8A 3OL9A 2UVWA 1U1RA 3QJLA 3F0NA 2DNMA 1RBAA 2LGDA 2IHR1 3F41A 1PAUB 3ZO5B 4ECSA 2YKAA 4X62F 2QX0A 2PO4A 4RNMA 1PJ5A 4WYLA 1JXEA 3B78A 3QFWA 1IP9A 1RAHB 3HCXA 2GVDB 2RGFA 3ENWA 1NPPA 3UQAA 2OP5A 3M62B 4X64J 1AYFA 4N47A 4YB1P 1C2PA 1H98A 5LXYA 3QA8A 2NBUA 3U7DA 1HQEB 4I6NB 4LF6F 1U1PA 3U02A 2KG1A 4RNNA 1HQEA 4DV5F 2DNLA 4EO8A 1B64A 2HLUA 3H42A 2KFKB 1Y3KA 3GZNI 2XY6A 2COLA 3MC8A 1B7YB 5TR5A 4DHVA 3SDLC 3F73A 5DLGA 2YKOA 3CC2S 2B56A 2HRUA 3BS9A 3LUYA 1BE4A 3GB1A 2D3O1 2AF6A 2C2MB 4B6WA 3BBCA 4URSA 3QJPA 3V6CB 5DJBA 5C25B 3TQEA 4DPUA 1BQNB 2QEJC 1RTIB 4DPWA 2NREA 1R8CA 2JUOA 2AP6A 3N20C 4ECXA 2JWNA 3WQPA 1NEEA 3BKUA 3RULA 1QOFA 3RRKA 2AX0A 5KFGA 1V9OA 2XBPA 2ZM6F 3BBFA 3RBEA 2WVCA 2DISA 4KHRA 3GFXA 3RMKC 4HHUA 4DU7A 1WF1A 2XMVA 4PYAA 2EK1A 3NS7B 4KIKB 2VD3A 2DYMA 3AEEB 4KIKA 4N5SA 3NKYA 4TVAB 1KLNA 5F9NA 5IM0B 4QYZK 3K7RA 1QJHA 1GPXA 1WX7A 3ZKJC 4YSZB 3QAUA 3W9IA 5FR6A 2C9WB 3C8YA 3QATA 3CCJS 3MR6A 3PW2A 2GHWA 1RU1A 3TEGA 4JL9A 1VBZA 1HWLA 4MKAA 4XWWA 1I1GA 3MUVP 4AQYJ 1RTJA 3DLHA 5KG0A 4TNOA 4USIA 3J81Y 3FBEA 1RAXA 1S1UB 1TS4A 1ZKHA 2MHEA 4WIIA 1FNVA 4S0RA 2QLWA 4DHJB 2QG9B 4B3SJ 1T9TA 2I1RA 2CYYA 1C4AA 3NWGA 2L3MA 4K7WA 2V3SA 2GQCA 2XBBC 2LZ6A 1FD8A 4QYRA 4WJQA 4DLEA 3KK3B 3T1HJ 2IYIA 4L2YA 3CCVS 4GVLA 4ZHOA 4ED3A