2I2YA

Solution structure of the rrm of srp20 bound to the rna cauc
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
150
structure length
150
Chain Sequence
b'MQYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTEGSHHHHHHMHRDSCPLDCKVYVGNLGNNGNKTELERAFGYYGPLRSVWVARNPPGFAFVEFEDPRDAADAVRELDGRTLCGCRVRVELSNGEKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords (5'-R(*CP*AP*UP*C)-3')
publication title Molecular basis of RNA recognition and TAP binding by the SR proteins SRp20 and 9G8.
pubmed doi rcsb
source organism Streptococcus sp. 'group g', homo sapiens
molecule tags Rna binding protein/chimera/rna
total genus 44
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2006-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2i2yA01
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2i2yA02
1UAWA 1DZ5A 2CQCA 4LMZA 1VC0A 2DGQA 1FD6A 4HKZE 2RT3A 2DGOA 1KD1T 2JWUA 1W2BR 2AYGA 4WFBQ 5BMGA 1NU4A 5D77A 1M5OC 2DHSA 2JSVX 2RMMA 1WF1A 1VQPS 2NZ4A 2CPDA 2DGSA 5GAGU 2J0QD 1ZZNA 3GB1A 2CQ1A 3HI9A 1OPIA 1X4CA 1PGBA 2DNOA 1X4EA 2KU7A 2ZJQQ 1U6FA 2DO4A 3R1HA 3FEXB 2KI2A 2DNZA 1X5SA 2DHXA 2VOOA 1HA1A 2N3LA 5D78A 3NNCA 2KQ4X 3MXHP 2O3DA 2VOPA 1X5PA 4ZKAA 2KRRA 2DNYA 2KT5A 1WHXA 3TO8A 2ERRA 1G2EA 1PGXA 2MQLA 1YIJS 2MKIA 1K51A 2X1BA 3CUNA 2LHEA 3MOJB 3UCUP 1MHHE 2N7JA 1BY9A 1N52B 1XCQL 2SXLA 1MHXA 4ERDA 2N9KA 1QKZA 3OW2R 2CQ0A 2PEHA 3G8TA 3G8SA 5H1SV 2MGZB 2ADBA 2KN4A 2LEAA 2LHDA 1JMLA 1A7GE 2JVOA 4Y00A 2LGIA 2DNHA 5CYJA 2CQBA 2LQ5A 3EGNA 2ZJPQ 2MY7A 3S8SA 2MKHA 1YITS 5HFYA 2CQ2A 2HGMA 2KG0A 2MKKA 2KHCA 1DHMA 3VAHA 2AD9A 2VONA 4LJMA 1VQMS 1F2RI 3G6ES 1FNXH 4YOEA 2Q79A 2MQPA 2BOPA 5FJ4A 1WEYA 1DBDA 2CPHA 1X4DA 2LEBA 2KACA 3SXLA 1YJNS 1VBXA 2MKSA 2HVZA 1Q81T 1NO8A 2JRSA 4KGSA 5CXTA 2LMIA 1P27B 1UFWA 1WI6A 1IBXA 1RK8A 5LXRA 2RUGA 1ZXHA 1U6BA 1Q7YT 2DHAA 2FHOB 1K8AT 2M88A 3U1LA 5EN1A 2KM8C 2J52A 1U1RA 1OO0B 3H2VE 3CF5Q 2QFJA 2MZTA 2MZQA 2F9DA 2IGDA 4RU2A 2XSFA 3NMRA 1X5OA 2KWDA 4F26A 1H2VZ 1H6KX 1VQOS 1KQSR 3EGZA 1YWXA 4TU7A 4IOCQ 2GO9A 4OZBA 3CCJS 5GVQA 2JX2A 3I56S 2DNNA 5BMHA 2E44A 2CJKA 1WG4A 4F25A 3K0JA 2J0SD 1VBYA 2L08A 2XB2D 1R8HA 1JJHA 3FILB 3V4MA 5IFMA 1XCTL 1VC5A 3NS6A 5LSLA 1NJIT 2OIHA 3U1MA 4ED5A 4KGTA 3V3XA 2KXHA 1U2FA 1WHVA 2MZ1A 3VAKA 2CPEA 2DGWA 3RW7A 2M9KA 3VAFA 4KGRA 3Q2TC 3CD6S 2RQ4A 2HGLA 3Q2SC 3UWTA 2XS5A 1X5TA 2MSTA 2MSSA 3ULHA 5ITHA 3CPWR 2EK6A 3P6YC 4WFAQ 1WG1A 2V94A 3CTRA 2ZW0A 2NLWA 2RPVA 2JU6X 4QU6A 3B4MA 2ADCA 2ONQA 2E5IA 2KVIA 3CCVS 2JVRA 2MPUA 2KYXA 1N8RT 2MYFA 4CH0S 2MGZA 2KG1A 2U2FA 2X1AA 1U1KA 4CH1A 1WF2A 2GI9A 2RRBA 1X0FA 2E5GA 4CQ1A 1HD0A 3US5A 4U67Q 3NNHA 2GHPA 2MQOA 3UD4P 1VQ5S 3CMES 4FXVA 1SJQA 2ZJRQ 2MMYA 1Q86T 5HI1A 3JB9k 1H2UX 2M4MA 2RNEA 4TLQA 5HO4A 1R8PA 2M52A 3BEGB 2LKZA 4QQBA 2KDMA 4OZAA 1U1NA 4UY8T 2LCWA 3UD3P 1Q10A 3PIOQ 3THTA 2KH9A 1VQKS 4MACA 4BS2A 1DRZA 5DDPC 2E5JA 2OTLS 5JVGQ 1YI2S 1X4AA 2FPHX 2KXNB 2KM8B 1MVKA 2UP1A 3I55S 2CPIA 4J5OA 3VF0B 1QM9A 1KC8T 5DDRC 2N7CA 1K52A 1S72S 2CQDA 4IUFA 2LUMA 2G0CA 2KXFA 2LECA 4YUDA 3H2UB 1U1OA 2OTJS 2PLPA 2DITA 4CIOA 4OZ1A 2EK1A 2U1AA 1OWXA 5GAEU 2CPZA 1YHQS 1SJ4P 2MZJA 5GADU 3FILA 2RS8A 1FO1A 5DM7Q 2AYMA 1M1KT 3CC7S 2N82B 3MP9A 1VQ4S 2QEXS 2J8AA 2KFYA 2M0GB 1FJ7A 3R1LA 2HYIB 1VC6A 4OZ0A 2DISA 3CMAS 1HEZE 4WH4A 4IOAQ 3S6EA 3MUVP 1K9MT 1F9FA 3J7ZT 2CQPA 1S79A 1X4GA 2MZSA 3NS5A 4P6QA 2M8DB 5MLCV 2I2YA 1URNA 4TU9A 1SJFA 1MI0A 1HZ5A 4Z2XA 2RVJA 1WEXA 5BJRA 3EX7B 2QMTA 2DK2A 1PO6A 1SJRA 1WHYA 1AUDA 2ON8A 1FCCC 2DIUA 2M8HA 1PGAA 2K0PA 3S01A 3SDEA 2ZW1A 4C7QA 5GAHU 1P1TA 2MB0B 2CQIA 1D8ZA 3CC2S 2M70A 1YTYA 2A3JA 1U1LA 3UI3A 2GB1A 1UW4A 2DGUA 2LYVA 3VAIA 2MJUA 2D9OA 2B0GA 3BO4A 5BMIA 1P7EA 3DLLQ 5DDQC 2HGNA 2DNLA 1M5KC 3MD1A 2YKAA 2JWNA 2QSDA 2XNRA 1QVGR 3P3DA 3G71S 1MPEA 3N9UC 5IM0B 4IOIE 2N9LA 4EGLA 1X4FA 1JMTA 2DH9A 3CCES 3TP2A 1PGZA 4WCEQ 2J53A 3LPYA 2FC9A 1GB1A 1ZH5A 2MQNA 3CCUS 5GMKa 5LSOA 1VQNS 3RW6A 4OZCA 2MZRA 3P5TL 1OIAA 2QA4S 2YTCA 3MUMP 2MQMA 1D9AA 2FC8A 2MJNA 5DM6Q 3CC4S 3D2WA 1X4HA 3THPA 3MURP 1X4BA 1XN9A 1FHTA 2DNKA 2X1GA 3TYTA 3SDEB 1ZZFA 5CA5A 3B4DA 1A9NB 1B7FA 1YNTE 2JZPA 2RU3A 1M5PC 1F2RC 3UCZP 2LA4A 2RS2A 3P49B 2G4BA 2L9WA 2D9PA 2DB1A 4IO9Q 2DH7A 1M5VC 3UCGA 2VODA 2CPXA 1YJWS 2OSQA 1O0PA 1FXLA 3MDFA 3R27A 3ZZYA 1KH0A 5HHDG 2OSRA 5DETA 5LJ3Y 2CPFA 3PIPQ 1UWXA 2OEDA 3J7YU 2DGVA 2K8GA 1VQ8S 4WIIA 4Y0FA 1H2TZ 3CCRS 1GB4A 1WHWA 2G1DA 2XNQA 2J76E 1VQLS 1FT8A 4PKDB 1QVFR 2CQHA 5IQQA 3VAGA 3HHNB 1FCLA 5LXYA 4M5DB 4QU7A 2XS2A 2PTLA 4V19X 2CPJA 4WKRA 3LQVA 4IKGA 1JJ2R 1D4BA 2K3KA 3CXCR 2NMQA 1VQ9S 1IQTA 1HZ6A 2E5HA 3DXBA 3MI7X 1HL6A 3IRWP 1YMHE 2MHNA 4LIRA 3CULA 2DIVA 2PE8A 2CQ3A 1WELA 2MKCA 2IGHA 1SXLA 2MQQA 5IM0A 2MKJA 1IGDA 3VAJA 1WG5A 2DNQA 4PR6A 4FXWA 2DNPA 3BO2A 2F9JA 2JXTA 2F3JA 2YWKA 1K73T 3VAMA 5JXVA 3CCQS 3IWNC 2RQCA 4QPTA 1HD1A 5LJ5Y 2CQGA 1KOHA 2IGGA 2DHGA 1UP1A 2FY1A 1M90T 2DGXA 4GLSC 5HL7Q 1WWHA 2DNRA 2YH0A 1VQ6S 1FJCA 4YB1P 1SJ3P 4HJGE 3UE2A 1N54B 3NNAA 1WEZA 4TU8A 2OJ3A 3BS9A 1VQ7S 2CQ4A 3G96A 2MXYA 1FJEB 2PW9A 1L3KA 1KOOA 3FEYB 3G4SS 3VALA 1Q82T 2DO0A 2LXUA 2LXIA 2DNGA 2BZ2A 1K53A 1U1MA 4W90B 2AYBA 5JVHQ 3SMZA 3G9CA 3S7RA 1WI8A 2M7SA 2X1FA 1N88A 4UQTA 4WF9Q 3MD3A 1YJ9S 4D2KA 3BO3A 4C4WA 3ZZZA 3CCSS 1U1PA 2AYEA 1XF5L 1P7FA 2DNMA 4A8XA 1RKJA 4F02A 3MUTP 2DGTA 1EM7A 2CPYA 2MY8A 4C0OC 5HG2A 2DH8A 1CVJA 3CCLS 2I38A 2EVZA 5DDOC 1IBXB 4PRFA 2N3OA 2EELA 3CCMS 1U1QA 1WF0A 2KRBA 1C9FA 2WBRA 1VBZA 1WTBA 4WFNQ 1JJ4A 2XS7A 2HZCA 2YH1A 3L3CA 2RRAA 2LA6A 1IGCA 1K50A 4W92B 2D3OR 2L41A 2M2BA
chains in the Genus database with same CATH superfamily
3BF4A 3ZDMC 1VC0A 1YRUA 4GSWA 1TVRA 3W1YA 2DNFA 3CDBA 4PS7A 2ZWPA 2KTQA 3LAKA 2BT6A 3HO1A 4NJCA 2GVDA 3IA0A 3N28A 4ZRIA 1WMHA 4J90A 4OHVA 1CS4A 1XNRJ 1JLEB 1S4FA 5HROB 1SI9A 5CD4H 2HBRB 1KKHA 1PQSA 3VRBB 4P7TA 2GQ2A 4DV1J 2INPE 5AUKA 2WW8A 5C1ZA 1F2GA 2XSJA 3PVLA 2X1BA 2KDIA 1S1XB 3MTNB 1KQFB 4XAKA 4E3CA 3C46A 3Q3NC 2ADBA 4F2RA 3T1AA 2JVOA 3C14B 1SCJB 4Y00A 2K22A 2MKHA 5HFYA 4KX6B 2B5JA 4C2MA 3VAHA 5F8JA 2AJ0A 3G6ES 1K0TA 4WK3A 4FYYB 3Q8VA 2B8PA 4RNFA 1RISA 3T6BA 2HVZA 2IRUA 5D7GA 2LVOA 4LBPA 4LF8F 1KEKA 4M5GA 5LXRA 2VKRA 1LGRA 3MM5B 2LI5A 1E6YB 3RNBC 5EWGA 2IGDA 2ZNYA 1X5OA 3FAHA 1Y11A 4HK2A 3EGZA 3ZTCA 1G1XA 4RPFA 4PXCA 1JLQB 3N4WA 5A8KB 5ETKA 3QHTA 2XB2D 1HNVB 5LMUJ 1XCTL 3J81Y 1RTIB 1KHVA 4IDKA 3K5PA 1KVIA 4KH0B 3QPIA 2DGWA 4KPYA 2C2RA 4ZPBA 2XK5B 4II3B 4ES2A 4OHZA 2C9WB 4DS4A 5KAKA 2FHJD 1X0FA 4AOFA 2Z0EB 4A46A 2JLEA 3UD4P 4ECVA 2PO4A 3RNCC 1SJQA 1AYFA 5G55A 1VD2A 3NBPB 4CO2A 1UMJA 2Y8YA 4TLQA 4PWWA 2J0WA 3BSNA 2LASA 2IAJB 5L1LA 2WDTB 4TVAB 3THTA 1OQ3A 4Y2KA 1KHWA 1X4AA 4ELVA 1SC4B 1EQ0A 4RMAA 2G0CA 2KT3A 3DC2A 4ZHRB 5IC6B 4ZLLA 4B9NA 1RB0A 3BGRB 5IT9Y 3QZ8A 1BC6A 4Q44A 3CT9A 3L09A 2G2OA 1NKCA 1BMLC 1FXIA 3AQPA 3SCLE 4ECQA 3GV8B 2DAFA 3I6PA 1HTQA 2V2VA 4IFVA 2OJRA 5EX3A 1BLUA 1NB2A 1D3ZA 4DQRA 2EFOA 1PGAA 2HMIA 3TX8A 1C77A 3WAPA 4C7QA 3IP0A 1V5IB 1T8EA 3CC2S 3MM8A 1NJWA 3HVRA 1RBLA 4IO1A 1JRPA 4NLPA 4R3DA 4DR5F 1P7EA 2GGPB 2IC3A 3NS7B 2DNLA 1S6PA 2ZZTA 4A48A 3EGVA 3UN2A 4W98A 4CLLA 3QO9B 2D3BA 5EE1A 1DQAA 2I1KA 1JMTA 4NJ7A 1Q0NA 4MIWA 2G1EA 2AX0A 2BM0A 3BH6B 3MM7A 2O01C 4A55A 3PYFA 3MECA 2RU9A 4DUZJ 3BV8A 4I6NB 1ZXIA 4J3OD 1IBKF 1C79A 2XNAC 5M2UA 2TSSA 3WAOA 4MMOA 3M6VA 4DL6A 4W9HA 2YY3A 4AJYB 1CC7A 1O0PA 3PIPQ 1VQSA 5KFQA 1XEZA 4ER8A 4ECXA 3J7YU 3P4QB 4WZMA 1B70B 1JALA 4GN1A 2EMSA 1M1GA 5KFBA 3E9SA 2DR7A 4M1KA 5I4DA 4ALZA 1WDDA 2K3KA 2AEFA 3L95X 3HT0A 5IAAC 3VTUA 1BXNA 2JZZA 1JLFB 4LF7J 1JROA 4RGTA 5KFRA 2ZH4A 4NRUA 3PKMA 4B6WA 4AWJA 4C8MA 2JF5A 5IQ6A 5CHCB 1OTRB 1LK5A 4LF5F 4X62F 3GYXB 4TY9A 1RGVA 4CZCA 1OY9A 2G3QB 1T3NA 3MMBB 4RNNA 3G96A 2BJ8A 3L4PA 5I42A 1HYSA 4EK2A 3ILJA 4AUQC 3UVJA 1N88A 3IXSA 2XMJA 1S9GB 3KNGA 3SU8X 3DLEB 2CVIA 5LXHA 2V6AA 2W25A 4KR0B 1AFJA 1WSRA 3ALBA 1TKEA 3CCLS 1IBXB 2EELA 4DHZB 2JNJA 3AOBA 1QSSA 2F65A 4O3NA 2XS7A 2VDIA 2J6UA 1XBWA 2GIRA 2LA6A 2Z57B 4L74A 4XYCA 1NPPA 2DGQA 2CDQA 3Q8PB 3R6GB 4HKZE 3W63A 2D69A 2KDFB 1ROEA 2MBOA 4TY8A 3FBFA 1LKZA 3JYTA 1MMLA 1N63A 3PV8A 2V2QA 1YK9A 3DRSB 1I94J 4MGKE 1U6FA 2DO4A 2CJ9A 3JSBA 4LFCF 3ITHB 3PJWA 4HVBA 1YX5B 2QLJB 2W8KA 3MHYA 2IO0B 5F3ZA 4PWDA 3Q8QB 4CT9A 2KT5A 3DI6A 2NCNA 2BB6A 3QRPA 2MQLA 1R27B 1WR1A 1TUWA 2V4LA 4JI7J 2CA9A 2YXLA 4M5MA 2MGZB 4CQNA 1KLMA 2C3PA 2WX0A 1WSPA 2LHDA 4LR9A 2DNHA 2LQ5A 3AE1B 3BY4B 3QIPB 1SUQB 3RB0A 2UUCF 4DL4A 3AU4A 4N9F4 1DHMA 3MCMA 2AD9A 2KVQE 1CJKB 4R0EA 1T94A 4USHA 2MKSA 2AZ1A 3OUYB 3KWVA 3WHIA 9RUBA 4BDPA 3AEDB 3GLJA 3PREA 4OX9J 3P96A 5T14A 1UH6A 3BN7A 3PVXA 4F26A 4JPSA 1H2VZ 4DZDA 2I5JA 5A8WA 4X65J 1SVDA 3F44A 2CUYA 2CJKA 2OELA 5L1IA 1PUTA 2ZOMA 4NJ6A 2QZ8A 1RLDA 3O2IA 5KFAA 2YVCA 3SZ2A 1EF1A 4DG1A 2FDNA 3PW0A 2QIFA 3QCAA 4J6IA 3R5JB 2YNGA 3C15A 4WXOA 3MR2A 2JYEA 2ZH6A 3CTRA 3W66A 2ADCA 4NLYA 1GOZA 2E5IA 4AXJA 1FM0D 1RZMA 1XLQA 4HYKA 4ZVRB 4C8OA 1CJUA 2LU1A 2NPTB 2N7EA 4U67Q 2GHPA 2Z8LA 3VTVA 4KT0C 2QLXA 4TLRA 3M6UA 4DR3F 2BACA 4RW7B 3OTOJ 2J0MA 1W25A 4Q0BB 4UY8T 3CJKA 3R5DA 1DY3A 2XULA 2FD2A 4LK0M 3OR2A 4DDFA 3WIVA 1RA7A 1DTQB 1FNVA 2CPIA 4J9PA 5J2NA 1N48A 1ELOA 3MHZA 2LDYA 2F8HA 1JNRB 2LECA 3H2UB 4EBCA 2GW8A 2EK1A 1XO3A 4O4GB 2P9CA 1FJGJ 2RS8A 1NZAA 3QSIA 5DM7Q 3LP2B 2BE2B 3PY8A 3PCOB 5CYQB 3GU0A 4DXGA 1KFYB 3N32A 5C24A 1NMEB 2WZ1A 3AOAA 1MI0A 4QIWD 2BRLA 4WAFA 2K1RA 2HHUA 2M8SA 4NL5A 4OL8A 3FMWA 4DXFA 4B3TJ 4JI6F 4HEA1 4MIBA 3AEEB 2QLWA 1OMSA 3GE9A 2ZVIA 3N5BA 4OV6A 2ZCBA 1V5TA 4N8OA 4N76A 3EMTA 4MKVA 3BGOP 4OZCA 2MZRA 2YTCA 3TUJC 1C0TA 4ELTA 1HXYD 1TT5B 3CWIA 4ES3A 1X4BA 2D10A 4OVVA 4N56A 3G87A 1RCXB 4DFMA 2ASQA 3ML8A 3FUYA 3DGPB 5E3CA 1LXJA 2BW2A 4WJOA 2G4BA 2QMXA 1JLBB 4ZYSA 3QX1A 2CPXA 5B0FA 1DJ0A 4AL5A 3U8ZA 2AQ3B 4YHHF 5J1EA 4B9SA 3KFWX 4FJZA 4LFBJ 1QT9A 1GB4A 4S17A 3N30A 2PKOA 3A9KA 3DCGA 5KFPA 3U4EG 2OLWA 5K5MA 2KQ7A 1FRLA 3P2BA 2LU2A 4ZIWA 4F8RA 4TKTA 3EC8A 2CPJA 1RT3A 4LRBA 2W1BA 1JJ2R 1F0XA 4R5PB 1CPZA 1V9OA 3DXBA 3RR8A 4W9GA 3BYPA 1QLBB 3IRWP 1FRKA 4WFYA 4W9KA 2R3VA 2R61A 2Y9HA 5KG6A 4JV5J 3BO2A 3MEDB 2WU2B 3O65B 2PMZD 2UU9F 2QIEB 2DD8S 3VAMA 2RQCA 3OQ2A 4NCGB 3KJFB 4JI0F 3R5BA 3RNFC 4LF6F 4UF4A 4DWIA 3DOLB 1AFIA 4EFAC 1H38A 1V1OA 1QOFA 4LRDA 2OJ3A 3TCAA 3Q8CA 3NCRA 3BK1A 2PW9A 2ZBRA 1CULB 1RHMB 1IWAA 2FJWA 4B3SF 1TS5A 3SMZA 1LWCA 4M0WB 4H2AA 5H8YE 1XR7A 1CBKA 2HWIA 4RNAA 4DR2J 1SSNA 3KDNA 3IBEA 1VZ7A 1CJVB 3W5ZA 1OY6A 4YB7A 3LP0A 5KFWA 1T9XA 4C0OC 4UTGA 2I38A 1UVMA 3OL7A 2KJWA 1A70A 3M05A 1AARA 3PX4A 1S99A 1UGJA 1HWIA 1UELA 2RDBC 5J2PA 4KO0A 2LQBA 4LREA 2AT1B 1CLFA 4BKSA 2GV1A 3TNVA 1MN7A 4A8KA 3K58A 2JSVX 3M2VB 2NZ4A 1B1ZA 4LBIA 1TR0A 3HI9A 4NI2B 4KC5A 3J80Y 4CHKA 4RGOS 1WGRA 1LFWA 4IG3B 3KLHA 4O0NA 3TAMB 1WM2A 4EI2A 2KRRA 2ERRA 5D3DA 2CJYB 2B9YA 3B1LX 1TTHB 1YIJS 4P6VF 4WPAA 3NGSA 2C7MB 2JRIB 4FZVA 3ZXWA 3CCWA 2HD5B 2AGOA 3HZEA 2H48B 3KUCB 4ZVPB 3ONQA 3H5SA 4DV5J 3CIRB 3ZJVA 1F5AA 1S1UB 1SH3A 5DJBA 2X38A 1XMBA 2LVQA 2ZZPB 4H4MA 1FE0A 4URQU 1LWFA 4CO1A 2BOPA 4NASA 1Q81T 2ZH5A 3J81U 1G6JA 5K20B 4KY3A 4A6QA 3JSMB 3QT6A 3UO0A 4ZVUB 2MZTA 1S9FA 4FULA 3JAMU 4MH8A 4JI8F 1NBFC 4DJBA 3DVGY 4GC7A 1H6KX 1VQOS 3ZRCA 5KFYA 5C7PA 4QYRA 3SEOA 4RW8B 3CCJS 1GEHA 5BMHA 4IM2A 2XCAA 3DOMB 3O8WA 2Z58B 2BGFA 3CJ0A 4K4VA 2KXHA 3MTKA 3VAKA 4OVUA 1TKTB 2J6SA 5E6PA 4ECZA 5SUHA 2KDBA 4QWCA 3M2RA 2NLWA 3QJLA 3DBRI 4YXDB 2A6MA 2UXDJ 3B4MA 5KT4A 2AEMA 2KXJA 1E7UA 3G82B 1HI0P 2IO3B 4XE0A 2E5GA 3N6NA 3OJ3A 2GZOA 2XI3A 1VZ8A 1WF9A 3ILLA 2M0AA 3GILA 2GC8A 3A9JB 3MAQA 2WCXA 2VH2A 5LSRA 2BBCA 2BYEA 5IT9U 4OZAA 4OMFG 1TL5A 1HE8A 2FAZA 3ZNZB 3AXCA 3LO3A 3VGVA 1B64A 1B0PA 3UD3P 2E9RX 4NLXA 1I4XA 3ZXVA 4FNIA 4BS2A 3J7AN 2KXNB 1YLXA 5LNK1 4OJHA 5D3GB 3CDAA 3M4XA 4DQQA 4LSLB 1E7VA 4J5OA 5D15A 1KC8T 1W7WA 5DDRC 2RSUA 2ASDA 2V3PA 4P1CC 1KM7A 5J18A 1JLGA 1JLCA 2EFPA 4DLGA 2MBHA 3QA8A 1UETA 4WJQA 3HVAA 4MJSA 1XLNA 1M1KT 2KWUB 3DMJA 2B4UA 2VHGA 1FJ7A 5BO4B 2EPIA 2KX0A 2DBYA 2HQIA 3T5KA 2HHPA 1IR1A 3W65A 4NAWB 4ZCIA 1Y7PA 4NX9A 2XMUA 4NXNJ 1WI0A 6FD1A 2KKCA 4QIEA 4RUAA 4FVCA 1HBNB 1KS2A 3PR5B 3POTB 3R8YA 1P6TA 3AE2B 4P7IA 2H89B 2KKHA 3KUGA 1FPYA 2A3JA 2V3NA 3PW2A 2VBZA 4MKYA 1N5VA 5E3RA 4USIA 2HHHF 5J2RA 4KV2A 2GJ2A 1MROB 3P3DA 2W24A 3GIKA 4UT4A 3H5UA 2J53A 4PT5A 2CZ4A 1AROP 2CJNA 1BQXA 3HK2A 4DV2F 4KE5A 1WKKA 3PZPA 2BOAA 5AXNA 3MM9B 2VQEJ 2X1GA 4JI1J 4USVA 4DPUA 2WXNA 5ETSA 1N5TA 4DPYA 1RT4A 2RU3A 1SC1B 3JQMA 2LA4A 3GIIA 1NYQA 2ZUGA 4ECRA 4DFJA 2D9PA 4RUCA 2B4OA 4P74A 5HHDG 1RBAA 1XQIA 5D4NA 2CHXA 3LDZE 4WIIA 1YN3A 4PYZA 2XNQA 4K7QA 3N20C 3C16A 4PKDB 3ET6A 5E41A 3OJSA 3KK1B 2ZM6J 2UZAA 3HHKA 5ETRA 3DWGC 4A47A 1QAJA 2PTLA 1IXKA 4RU9A 5KHQA 1VI7A 1GX6A 1ACCA 5BR8J 3JSVA 1XWLA 4Q8FA 3OXGA 4LIRA 3MGJA 2GFFA 2IGHA 1HBUA 4GXBA 1J8CA 2IJNA 3OLBA 4IYQA 4ANDA 2F9JA 2IHR1 1RTJA 2ZDOA 3CCQS 4PZVA 4AYBD 4OZ2A 1C1YB 2XC9A 1S4EA 1TKXB 2OMLA 2LZ6A 4K4UA 1T0SC 1KLUD 2Z59B 1EQMA 2YH0A 1SJ3P 1HFEL 4WWSA 1X31C 2B51A 2XYHB 1OS5A 1FK9A 3A1YG 3G6XA 3FJ2A 3BZQA 4ECTA 3UGBB 2VH7A 2V9KA 4HDGA 3KUDB 3Q83A 2G2ZA 2MLYA 1T03B 4CNZA 5CZXA 1RT1B 4KGZB 1UJ4A 2QJ3A 4A8SA 3GJQB 4PS8A 1NDLA 3PPAA 2QA2A 3MD3A 5AXKA 1HI8A 1PFDA 2DZKA 4PG6A 2LEKA 4BWJA 1PJ5A 1JLEA 1L6UA 2AYEA 2L9DA 1QSYA 4YN3B 4A8XA 2MJEA 4RL1A 2ZJDA 3ZDTA 3GR1A 3IRXB 2H5EA 4WFXA 2MEKA 5KHOA 4ED8A 1KFDA 1VBZA 2GAGC 1WX8A 2HFUA 4DUTA 2JQRB 1VLYA 3L3CA 4YTMB 1UW9A 4F7VA 4F2SA 2V8VA 1FNOA 3TAQA 4B9MA 4O3SA 1UTAA 3D1QA 2DGSA 2ZH3A 3X1LB 3PEJA 2DNOA 3M6WA 1VJWA 5D8HB 4W9DA 4I0WA 2BS4B 2C2DA 3GZ7A 4RUBA 4Y28C 5LT5A 3NG8A 2VOPA 3NGUA 3H40A 3T3FA 4A8FA 4I1TA 3MM5A 2ZVSA 2IMOA 5AE1A 5K14B 2B9XA 1N60A 1Y00A 2N9KA 1S6OA 2W3SA 4ZHPA 1YG0A 5KFEA 1IUEA 2W3RA 2FZCB 1MNEA 2CQBA 4RBVA 5GXGB 3S8SA 1GT8A 2HRUA 2WVFA 3OR1A 4ZRJA 2HGMA 3AE4B 3AMZA 5IXUA 1HNVA 3H5XA 1RTIA 2Y1LB 1BT0A 2E66A 2RSQA 3ZC4A 5M2PA 2IJ0A 2LEBA 1HW8A 2QYCA 1H8CA 3A12A 4KGVB 2XK5A 5A6PA 4LIWA 3GJRB 4ANCA 1XLOA 2FJVA 5HKHA 5C25B 3HHLC 3CD0A 2DHAA 1D9FA 2J52A 3H2VE 5AE2A 4HH1A 3Q2AC 4M63A 1EETB 2Z2MA 4Z37A 3B9JA 1JQ4A 1KLGD 1R8CA 2FJAB 1OQ6A 1IBCB 4K3BA 3NBPA 1JJHA 1VC5A 3V3XA 2IAJA 3OLAA 1Y9OA 3DHXA 3VAFA 2VG5A 1RAEB 1WG1A 2ZHAA 5GAEI 4MTPA 2ACMA 2KYXA 3VDZA 1WR6E 4CH1A 2V50A 2IYIA 3ZZRA 3WX8A 3WC2A 1N62A 3NNHA 1VLBA 4RGMA 2VZKD 1D1UA 1ZETA 1RBOB 1PC5A 2DRDA 2CHWA 1F0ZA 3CB4A 1DARA 4M8MA 3KJQB 3PX6A 3PO4A 3PJXA 2KDMA 2WX1A 4EKUA 1FDNA 5KT5A 1B4SA 4C00A 4C80A 1REGX 2DXDA 2RKIB 3VCDA 5KFJA 2E5JA 2KM8B 2YVSA 3LUYA 3CO0P 1RAJA 5D4PA 3AQOA 4H54A 4GOCA 4BC9A 3HD1A 3AEBB 4CLFA 4JV2A 3DKDA 2HS4A 3M7VA 1FXRA 4P7VA 5C42A 1GMWD 2C42A 3LTOA 1N56A 1G3OA 1FO1A 2ZVNA 2GGPA 1S59A 4C11B 1GG3A 2HWTA 1VQ4S 2QEXS 1WJ9A 1S57A 1JXEA 1Q1KA 3GCXP 1E6EB 2WXOA 1C3TA 3C66A 4DF4A 4QR0A 4P6QA 1ZUD2 3GIMA 3IT6B 3SBMA 4RF0A 4Z2XA 4P71A 2Y8WA 2UXCJ 2ZC4A 1REVB 3UN3A 4DR1J 4U8VA 1SE9A 3WALA 2KMCA 2NBWB 4AQ7A 3I5BA 1T3OA 2LYVA 1AW7A 5AJ3F 3TARA 2EBGA 4EUVA 1ZAXA 4ECWA 1ZOYB 2Q3PA 3U30A 2XNRA 4M02A 4FS1A 1IKXB 4K59A 3BGFA 5KFTA 3Q3OC 3OJUA 1AB8A 2GOWA 4HACA 4G0NB 1VHIA 3D2WA 1NZ8A 1H73A 4JYAF 3R2DJ 4WWPA 1MWYA 4HR2A 4FBJB 2IY0B 3B4DA 4KQZA 4N41A 4PUOB 2VRRB 5IP4D 4BOSC 4ITSA 1M5PC 4NQKE 1P98A 2YKNA 1JLFA 4L76A 3GR0A 4CM0A 5KFSA 2FLNA 1B9RA 2CPFA 5KT7A 4AE5A 2DGVA 5KFNA 1NYRA 4NOHA 1F6TA 1DOIA 2G1DA 1JKHB 1FT8A 3KUHA 3LALA 3H9DA 2V8GA 3NGRA 4C3LA 3HSJA 4HKQA 4I6YA 2C2EA 1NK5A 2VFUA 2H5IB 4IKGA 3MCOA 1HQ2A 2E6XA 4JI3F 3T3OA 2QX0A 3SCIE 3M30B 1YMHE 1XMOF 4LFCJ 2Y1RI 4ACFA 4K4TA 4QJVA 4BZAA 4B3RF 2J6TA 1YQHA 5F0WA 1R4MB 2DNPA 1S9GA 3RT3B 2LXAA 4LF4F 2D7SA 2GVDB 4PYUA 3B54A 1UP1A 1WMHB 1PDXA 4ZRKA 2HLUA 2A2DA 3QT8A 1W26A 2D3UA 4PYAA 4OZ3A 2UUCJ 4FXCA 1AXQA 1HHQA 3HHMA 4OV1A 3KXDA 3HM9A 5D94A 2R2OA 4LNFA 3BN4A 1N32F 2B43A 4GGQA 3ENVA 3DBLB 4WXWA 3DHWC 2LXUA 3O3LA 4WIQA 2B3TB 3R2TA 2ZPYA 3DU6A 2UUBJ 2M7SA 4DSIA 1RP5A 3EXYA 3HCXA 3DRSA 3ITHA 4WTOB 2PIAA 2RJZA 2GMHA 3NZUA 4OVZA 1PIEA 3W9IA 1QOBA 1NEKB 4ELUA 2BW7A 5KFCA 2MLBA 2RRAA 3H0PA 1RHRB 1PSDA 4YTNB 3N6MA 2W9BB 1XNRF 4LSNA 4I7FB 1FD6A 2RT3A 3VVUA 1OEYA 2YNFB 2VICA 3TUZC 4DV1F 4LNKA 1TY0A 3BQ1A 2I1JA 5F0UA 1N6QB 1R6YA 2CQ1A 2IJFA 1CJKA 2ZEQA 2NS1B 3E2EA 1VR6A 4ZP8A 3DBSA 3FEXB 3R1HA 2LQJA 1HA1A 3VZIA 4HLBA 3OUYA 1Y4ZB 4OQJA 2MKIA 2P9GA 1HWLA 5K8MA 3OW2R 5H1SV 2VA3A 1E8ZA 2HFVA 4Q2LA 4FXDA 4ZDVA 3F56A 2HK3A 4ZRPA 3OTDA 3RU0A 1QOGA 4WBFA 2BS2B 5FJ4A 3B6BA 5IOIA 2JRSA 4BKSD 3GYNA 2IM0A 1RAAB 2AX1A 4PEOA 5I3PA 2ZPNA 1UJ6A 1ZXHA 1Q7YT 3RYLA 3U7JA 2LVWA 1OO0B 3ZTDA 4O44A 2OPQA 5LMUF 2V68A 4KPCA 2XSFA 2NPTA 4BKTA 5D4OA 1PAEX 3HVDA 2JWZA 4ED0A 3ISND 4W9FA 4OLPA 5GVQA 1R0BG 3DM2A 2MP2A 1RKIA 2GQCA 4RW7A 1R8HA 3PX0A 2CJQA 3CJ5A 5L46A 3SV4A 2XS5A 3A33B 4JI6J 5ITHA 2BUNA 3SSSA 2H4WB 1HIYA 4DF8A 2FCMA 2WWZA 4IFVB 1NPKA 4WKYA 3RRHA 4QW8A 1UVIA 3AD7C 1YJUA 1RAOA 2XYGB 2J9DE 2OI2A 1T9VA 2MJ3A 4F0KA 3MEEB 4A20A 3MM8B 4ZVHA 2WDRB 2DKOB 2GJIA 2QFIA 2BE2A 5FR6A 2DY9A 5CYQA 1N33J 4IRDA 1S6PB 2HFSA 1ZM2A 4DDID 2VG7B 1S77D 1JRUA 4A4JA 4Q7AA 2CNKB 3OSPA 3AE9B 4I64A 5JVGQ 3E8OA 1HNXF 4J9OA 2XMVA 4RNMA 1U49A 1GX5A 3MECB 4PPZA 4USMA 1MVKA 1SC6A 3L7UA 2UP1A 3KUEA 1CJTA 4MGZE 4YWGG 2YNIA 2Y3YA 5RUBA 4LVNP 5DPTA 3W5XA 5EE9A 1FDAA 2W2NP 1J27A 5KFFA 2U1AA 2P9EA 5JZEB 3KWLA 5I3UA 1IKWB 3HVZA 5DQIA 4PWUA 3R66C 3QC8B 3APFA 4K7WA 2VASA 3KVFB 2QC3A 2COLA 1NPRA 1U0HB 1F9FA 3HVWA 1YIWA 1C1CA 5E3AA 5IS2A 2FLPA 2FHKA 3U52E 3I31A 3DRXA 5KT6A 1VQYA 3EZOA 1AUDA 2ON8A 4OX7A 4UUXA 3PRZA 5DPRA 2CQIA 2VJUA 1YTYA 3QK0A 2DGUA 3ADAC 1UW4A 1JWMD 3DDKA 4ZVOB 2MJUA 1M0SA 1T5XD 4IWQA 1YZ7A 4DUZF 3Q86A 2QLFB 4ZVSB 1NI3A 4JE3B 3PNIA 4PYDA 1Q78A 1RXOB 3IMQJ 3U7DA 4F36A 4LF9J 3EDQB 3DRPA 1Z2LA 3ZZ0A 4OZNA 3R7QA 4QWDA 2HNDA 3THPA 4KHMA 4P2XA 2CJOA 1Q8IA 1ZZFA 1FX2A 3GSIA 4H4KC 5HP1A 1RHKB 2V69A 5HN0A 4R5PA 2Y0SD 2M1MA 2ZH2A 4S0RA 4U7CA 4USUA 2QC8A 2K39A 3LP1A 3MCNA 4OJ1A 4M5IA 3N01A 3AB2B 1D0EA 5KG1A 5I42B 4C48A 1FVQA 3M32A 1KONA 2MSED 2RDIA 3DDNA 5G0RA 4Y2IA 3UVJB 2N9PC 4NCGA 3BYTB 1LQBA 5D0RA 4L73A 4LF7F 3P4SB 3M6XA 3D0IE 3CO9A 2ZCCA 3BZDB 1Y0HA 3HF5A 1M94A 2KJHB 4FKXA 3RAMA 2E5HA 3MI7X 1YD8U 4X4QA 1IM4A 5K8PA 5H92C 2RILA 1YRXA 4M0WA 3GZNI 2ZOGA 3D3CJ 4TY8B 1RE1B 4OHYA 3RGIA 1X0PA 1KR4A 2FHJA 4B9LA 1CJVA 3KHHA 1RWVB 2D2QA 2R7RA 3QAEA 4JOUA 2HEKA 3D66A 5T7LB 2IVFB 1EIYB 4HJGE 4LF1A 3DI6B 1RSCA 3NRBA 3MFIA 1WACA 2YWEA 3HULA 3RBEA 2WXQA 1HNZF 3BKTA 4OHWA 3GG0A 5GMEA 1C4CA 1KLMB 4USKA 1TL7B 3PFEA 3NVYA 3M8YA 2X1FA 2HTHA 4CLKA 1TZ0A 1FI4A 4D2KA 3O6QA 2MHJA 1RT6A 3I5AA 1FRMA 2QSFA 4JI8J 4KB7A 3IWXA 4IG3A 3G86A 4K4XA 1NKEA 2VZKB 3GWCA 2CS4A 3TBLD 5D0HA 4BKGA 1U25A 3SQGB 1JJ4A 3WANA 4KRWA 1Y3KA 3BREA 3FNNA 4YY3J 1TL3B 2D3OR 1TAQA 2L41A 3R6LB 4WJPA 1NU4A 3VFKA 3A8EA 1S1UA 3CJQA 3ZGZA 2R8IA 3TVZA 2A4ZA 1OPIA 2KU7A 3GMGA 1I5OB 3QMQA 1TL1A 4J9KA 3GPAA 5D78A 2C3MA 4V19J 2FJEB 3BKFA 3KKFA 2YNGB 2ZOFA 3VR8B 3CUNA 2PSZA 3G8QA 4NQLB 3N79A 4URSA 5U47A 2AJ4A 1Z2ZA 5B0EA 1CJUB 1SH2A 1CJEA 1URRA 1UWMA 1STEA 4IM0A 2K3IA 2JOQA 2VDHA 4RW8A 1UNSA 1NJYA 3OVBA 1IQZA 3DOMA 3ZW3A 1VS3A 5A8RA 1AT1B 4KBIA 2XCPA 3QJPA 4OX9F 5JH5C 2MQPA 4WP8A 1TKTA 3F73A 2KACA 1RDRA 2F7VA 3WX4A 4EZLA 1HWJA 4X4PA 4YR0A 3R7RA 2XYPB 1NLKL 3VUWA 5CYMA 3G82A 4JI4F 3W2DA 4K8RA 3AECB 2MBEA 5J2NB 3AH7A 2MQ8A 4IOCQ 3H8YA 4GKJJ 2JC0A 2RDGA 1FNMA 3A9JA 1YJVA 1VJKA 3D1OA 1Z4UA 5IFMA 2OIHA 3AE7B 1VBKA 1L5UA 1U2FA 2MZ1A 4DV0F 4NLGA 1I7HA 1EO6A 4ZPWR 4ICUA 2RQ4A 1N5QA 1ZOTA 2DTJA 2MSSA 3DQVA 4ZPDA 3ULHA 1L4ZB 4WFAQ 1J7CA 2ZW0A 2RPVA 2Z0GA 4AQYF 1HLWA 5D3GA 3OTOF 3P4UB 4LSLA 1N8RT 2HHHJ 1N0VC 4CH0S 2RRBA 4US8A 3OTBA 3L7PA 3GFYA 4A8WA 4W9JA 3NZ3A 2JZ5A 1XXGA 3CE8A 4O0IA 5T41A 1H2UX 3DHIC 3M8WA 4K3CA 2WW4A 3QGGA 1BE4A 3NXZA 4DUYJ 4ED6A 3BEGB 4FF1A 2DAJA 3EM1A 2LCWA 3DDCB 1H7WA 3RI7C 4BBNF 2CZ9A 2BR0A 2R2UA 1VQKS 4OZLA 3TANA 1QQRA 4USWA 4NZ6A 3PLUA 3WIMA 1GMVA 2OP5A 1FJGF 4C8KA 4F4XA 5KG7A 3I55S 4TQSA 5E2QA 1QM9A 1O51A 1UEVA 4EZ9A 4HPLB 2R8HA 1NSAA 1K52A 4URKA 2YQ1A 3HX9A 2AQ4A 5D6JB 3TL5A 4BVUC 2V0GA 1VRUB 3BSOA 5C2GA 1MROA 1F5BA 4X4RA 1D8YA 3PZ7A 5FLXU 5J1EB 2BX6A 4B3TF 3PXGa 1GMUA 1CK1A 2OGUA 2M8DB 5KFVA 3AB5A 3A8IA 4J37A 3D6MB 2Z0DB 3A9KB 2B56A 2BVCA 1FERA 2DY1A 3I5CA 1NJZA 1KQKA 1TZOA 2D3ZA 2ZE2A 1SGHA 5L38A 2O6VA 1RT3B 2PI4A 4OFZA 4FADA 1UZDA 3BSAA 3HM6X 2F1FA 2NXCA 3IR5B 3RG6A 4Y3CA 2O2VB 4IOIE 2C3UA 4EO6A 3R7BB 4HTIA 4WCEQ 2XO6A 3V4IA 2OPRB 2WRMA 1LQ9A 3CJSA 1IKYB 1D9AA 2FC8A 5DM6Q 2CZVC 2V4IB 4CLWA 4FA6A 1TP7A 3DBHB 2MA9B 1V6HA 4LFBF 5HSPA 3CSKA 2E1MC 1ET9A 4XPEA 3PGEA 2OEJA 2YWHA 4ANEA 3CEDA 1DLOA 1SIFA 2VODA 5IWAJ 3GOEA 4MT5A 1DYQA 4X4OA 5DQHA 1TKZB 4OYMA 5HMYA 3M95A 3BK2A 2QMWA 2G0JA 1RHQB 1RM6C 2H54B 1KNZA 2YLMA 2J76E 1LW0A 4ILRA 1TKXA 2GHWA 3NOBA 2FUHB 1WIAA 4JV5F 4DK5A 4L6V3 2V63A 1I4QA 1VQ9S 3BINA 5KFDA 2XBPA 1QLNA 4QIFA 4C4VB 3NCPA 1Q8LA 2PE8A 1MW7A 3PYGA 1WELA 4RBTA 3G6YA 1T03A 2IBKA 3MAHA 3PSEB 1E8YA 3OAWA 3EDRB 3IM9A 5IM0A 1RT1A 1G7CB 2KJ6A 2CG8A 3IWNC 2M19A 2NBUA 3PZ8A 2JEJA 2V8PA 3BDPA 5LXIB 2VD3A 1WKLA 4RZRA 5DG7A 1EUVB 3PHXB 3V5RA 3KLHB 3VUYA 1FJCA 4YB1P 3Q8AA 2AW0A 2LQ9A 4DR2F 4FF2A 1FFVA 2AKWB 3VALA 3DVGX 1K53A 4P16A 1TKGA 3W2WA 3AA8A 4F50A 1WX7A 2CVEA 2IMWP 4EZJA 3J7A1 1NBEB 1M5HA 4H4MB 3KNAA 2ZNVB 1E9MA 3ZVVA 4BWMA 5CH7B 1DOXA 3T5JA 2DGTA 3JTOA 3DYAA 4TQRA 4CRJA 3T1HJ 3SFEB 2I6WA 5K14A 3OHAA 2AEHA 1OEYJ 1ZYQA 4P73A 1RWXB 3IS9A 3MMCA 3JW0X 1R4NI 5BMGA 2FGOA 3ZLZA 3Q89A 5HI7A 3V6CB 3M1VB 3RB3A 3A3PB 3GV5B 3QGHA 5BYRA 2N0SB 3BYYB 1V80A 1S9EA 2ZFHA 3IG1B 2Y0BB 1C0UA 3C6UA 1WHXA 4KHRA 5C25A 4RBUA 4UOFA 1PGXA 4XO0A 2VBYA 4EE2A 5E6OA 3OTCA 3MOJB 3M2RB 4FYXB 1NNDA 2JLFA 4MKBA 3ZKJC 2V67A 2BWES 4QCLA 4RM9A 1PC4A 1BQMA 4HI1A 2ZJPQ 3UQBA 2WXFA 1YITS 1BGXT 3KWMA 4LT6A 2PC6A 2QDFA 2Z2ZA 4M8LA 3ZO5B 2UUAJ 4DL7A 3CMMB 3KUZA 3OLMD 3IWLA 3QWUA 4IWOA 3IR7B 4TQ1A 3SXLA 1VGYA 1F9JA 2PVGC 4ZP7A 1KRPA 4AUKA 1RWMB 2ZVOA 4KH1B 3D0GE 4WURA 3A4TA 3OT9A 1Y3JA 3AAWB 2HBYB 1FXAA 3JYUA 3H20A 1JLAB 5KFZA 2JEIA 2GO9A 4ED7A 4EYHB 1JLGB 2JX2A 1JLCB 2E44A 2DHHA 2W2OP 1MMNA 2BQ3A 2C22A 3MC0B 5A0YA 2UXDF 2BKFA 4F1SA 4O3OA 3KG4A 4KGRA 5KFMA 2RKIA 3FBEA 3P8BB 1X5TA 2LGDA 2W2QP 2Z2YB 2QRRA 3CD7A 2F8EX 5AJ3J 4OI2A 3NUHB 1IPGA 4YL8A 4ASWC 2DR8A 2U2FA 3MOZA 5AXLA 1IVZA 1OSDA 2ABYA 2DZMA 4ES1A 3CJ2A 2HSEB 3KQ4A 3R2IA 2YX4A 4X2BA 3V62A 3VGUA 1UVLA 1Y8RC 2Z56B 4M5LA 4X64F 3CSFA 3V05A 4P75A 1RTZA 3AODA 4P9SA 2DCUB 1U8SA 2OTLS 1RABB 1RHUB 2L0FA 5DCNA 3I4PA 3R8BA 2BEFA 2LFVA 3C0RB 1EKSA 1V3RA 2MLZA 3OJ4B 2CQDA 1ZDXA 3MMJA 5EUHA 2V8DA 1CEZA 4ZPTR 4NXNF 1UL3A 1N5WA 5GAEU 4GVBA 2CPZA 1YHQS 2XZTB 1DQ8A 2AV5A 4V1Ak 2IYGA 1Z2MA 3EGRA 1LOUA 1T05A 4RWXA 2KFYA 2M0GB 3TIXA 2KT2A 2DPIA 3JXOA 3RNAC 1S79A 2XY6A 1APSA 3NS5A 2NVUI 3H98A 3UQSA 4TU9A 3PR4A 1XMOJ 4MYTA 3DFEA 1JXLA 3V6JA 3BBBA 2M8HA 1HPZB 2NUHA 4J91A 3BVMA 2R8JA 1L0VB 4JV1A 3IG3A 4PUOA 2FLLA 1DTTA 2MB0B 5HMWA 2HHVA 3PACA 3PO0A 4LF4J 4JGHB 4YR2A 3DLHA 2B9EA 3KHGA 3HRDD 4FPRA 4OYIA 4AD6A 2DEJA 2HVIA 4GC6A 2VQEF 5JXSA 4JI1F 1HBUB 3I63C 3UF8A 2QJLA 4IDIA 5DLFA 4IOBA 1R3NA 1JKHA 1GB1A 2X3DA 2IO2B 1R31A 3R9LA 3CCUS 2GMJA 4ID8A 2N9XA 1I1GA 3D68A 4DCJB 2WSEC 2MJNA 4ZCKA 3GCWP 2R7TA 4DHZE 2FB0A 1FHTA 3M8QB 4RKUC 2V0NA 2M0XA 3SSRA 2VF3A 4WFZA 4PXEA 3SDEB 2ILZA 2C3OA 3QARA 2K5PA 1FK9B 4HXDA 2AHOB 4FKYA 4JIOU 1Q4RA 3P49B 3UDCA 1ICEB 4ZDNA 2ZM6F 1YJWS 4P72A 4DI6A 1GC7A 2OUGA 1CQMA 4Q43A 1VQ8S 3CCRS 4MDKE 3H8HA 4WK1A 2Q5WD 3JQKA 5BR8F 4B17A 2K6DB 5HLFB 1MMDA 1NDKA 5G4DA 4FBUA 2BTEA 4WKRA 4PXBA 4IH7A 2NMQA 1EU4A 1BUIC 1N36F 1S7HA 3ZNUA 2NSCA 2QT7A 4YFUA 2XM3A 4C0BA 1ZPSA 4Q5VA 2MQQA 3FCHA 3LYYA 5CZVA 4PR6A 1GQEA 2V4JB 4XX5A 3AFGA 2PEAA 4W9IA 1TFWA 3EVMA 3NOCA 4OYBA 2KB2A 1S10A 3I9ZA 2DNRA 1H72C 2KFNA 1M4VA 3QJJA 2PN6A 4QIVA 2PPHA 1HQRD 3CDUA 2ZBIA 4ZITA 1V9JA 1ZKHA 2WK4A 2KT7A 2OJWA 5AE3A 2CQ4A 1TAUA 5GAGI 1LW2A 1AUSL 2FUG9 2FYXA 2VZ9A 2W9BA 1YBUA 4I7FA 4REZA 3EPGA 3PFOA 2YNFA 3BDEA 3UIOB 2XLKA 2C28A 3KG1A 1KN6A 3UR3C 1FKOB 2R2SA 1N6QA 4WF9Q 1YJ9S 1TU0B 3OR1B 2H65B 5AZHA 1NK6A 1QSLA 1U2RA 1FEHA 1FXTB 1Y5LB 2W7OA 2AP6A 1EM7A 4HI2A 1VK8A 2DH8A 4B9VA 2EFNA 2DYBA 3O1LA 3UDVA 4DSFA 4AXIA 3JAMY 1C9FA 4WIPA 1IR0A 3KK2A 2G0IA 4B3MJ 3QLHB 1KD1T 3AV8A 5D77A 1F9EB 1I3OB 3NLCA 1ZZNA 3SI8A 1QJHA 1X4CA 2HHQA 3Q8RB 2KI2A 1EWCA 1QZEA 1X5SA 2VOOA 1IYFA 2B6AA 2N3LA 3NNCA 2KQ4X 4Z7YA 3MXHP 4MK9A 4H4KA 4JL9A 5H9FK 1YX6B 1FFUA 2VG5B 4A8OA 3GYGA 3TX0A 1Q0WB 4NE9C 4M5JA 2MRPA 4OI3A 2MBBB 4M8NA 7FD1A 4S0MA 2LVPA 3UQAA 4LRFA 1LWXA 1QKZA 4HHHA 2OEMA 3FDSA 4ZLNA 1FDDA 1V5OA 1UUPA 2UVRA 3DLJA 3EGNA 1S1VB 4LNOA 4NRTA 2VG6B 1HNXJ 2LEPA 3H25A 4QWEA 3HFZB 2J7QB 1OY8A 2CPHA 4HL9A 2R7SA 5CQGA 1FWKA 2WXKA 2LRUA 1I4HA 2WAQD 4K2JA 4LCDE 5KFXA 1EAYC 4ZOHC 1NM2A 2RDJA 1O6XA 3FSYA 4TU7A 2EXUA 4F8CB 4EWTA 3MEEA 5EDSA 1HQUB 1U4AA 3IBCB 4RW9A 5HANA 4F25A 3HKWA 3SCKE 5C42B 2J0SD 1VBYA 2AWTA 4OYWA 2M3DA 1H98A 1LNQA 2YKOA 2VG7A 3JSYA 5FD1A 2MJDA 3GV7B 1TY2A 4KVGB 2EC2A 2ONQA 3T8MA 2ACZB 3EFCA 2K8HA 2X1AA 2IY5B 2X3GA 4I2PB 5F8GA 3NY0A 3JTPA 1L3UA 2ZJRQ 4P2MA 4EYIB 3JB9k 1YJ7A 1IKWA 2HIQA 2AWZA 3RD2A 2DJWA 1U1NA 2QE5A 2CJXB 5T8IA 1Q16B 1U0HA 3SFGA 1CQNA 1LWEA 2CNLB 2UVWA 1I4GA 1AZSA 2AX5A 3AY0A 4HACB 3E3XA 4HEA9 1SF0A 2F8MA 1C2PA 5F41A 2JFDA 4ANUA 3HIZA 4DSEA 2DZJA 5MAOA 3FFIA 5H9FJ 4IW0A 3H7SA 1KTVA 1BQNA 4JWUC 1OWXA 3NAIA 3FILA 1EARA 3A3OB 3NOGA 2YKNB 2XO7A 4QR2A 3RNGC 2UXCF 2W9NA 1P9DU 1FMAD 1S97A 3OHBA 3MUVP 1TS4A 4DR1F 1O8BA 3ZZUA 1BMQB 4DL0C 3DRRA 4ZVGA 3MPVA 5MLCV 4A8QA 1HZ5A 5JMNA 2WXPA 3H7HB 2LQ8A 2KFKB 4GDKB 4R8UB 3C19A 1MJDA 4M01A 3KG0A 4NA2A 5GAHU 1ZE3D 2BKNA 4LQ3A 4LNNA 3B2FA 1F1HA 4MJKA 1RAIB 2B4PA 3W9JA 5BMIA 5DRKA 2ZKUA 3N9UC 3NG0A 5E6NA 2DH9A 4ZLPA 1PGZA 1RTDB 2NS5A 3AE5B 4RGNA 5H9EK 2IPOB 4OX8A 3RBXA 1HNZJ 4ETXA 4CTAB 2HS0A 2I1RA 3H7PA 1FFGB 1A9NB 2HQ3A 4G1QA 2DENB 5G5HA 2DYMA 4I2QA 2RS2A 1YJIA 4PAAA 2R7QA 3IM8A 2XMAA 2YKMB 4A9AA 3ISZA 1I6JA 4F3OA 2WGSA 3FMBA 3R5AA 3L4BC 5LJ3Y 2ZKTA 2YEPB 2FUG1 1HKAA 2JL9A 4K4SA 2O6VD 2WSCC 2IM3A 2DBBA 3QGIA 1QVFR 2BKOA 3KMQA 5T7LA 4CI0B 1KTKA 3KK3A 2XHWA 2CXEA 1YZ6A 3HHLD 1U48A 4C56C 1HL6A 3FEZA 3D54A 2CQ3A 1D6EC 3KLSX 4LSNB 2PD1A 1ZPWX 1TL7A 3MAAB 3UD5A 3CCTA 3D5MA 1GTHA 2R7VA 4N58A 1SJ1A 4DV4J 4W4MA 2IZVB 3BM7A 4K0KJ 5LJ5Y 2DXFA 3CVKA 2HVEA 1XR5A 3K57A 3CW2C 4AT1B 3C8YA 4YR3A 3IBFB 2H3EB 1VQ6S 1YKWA 1BD6A 2J9CA 4CO4A 3R2CJ 2NBVB 2UUBF 2WONA 1S12A 4NA1A 3HKZD 3SQGA 3ZNID 1LV5A 2EMTA 4DHJB 1TL3A 2L3MA 1F5CA 4CLSA 3D6FB 3OL8A 1PILA 3PW7A 2M56B 4WU2A 2BZ2A 4DV3J 1UVKA 2ALYB 3ZUNA 2CR5A 2FIUA 1WI8A 2SEBD 3PW4A 3TEYA 5F9NA 3T5HA 4OLOA 4J9MA 2AJFE 2NTSA 4GMKA 4JI4J 3PZDA 5KG3A 3QAQA 3PLVA 2ASLA 1UA1A 3DHHC 3AULA 2IA6A 1WC6A 2M5YA 2I9SA 1GMWA 2MBQA 3JS9A 1HHSA 4NZLB 4RM8A 3IGVA 1TIFA 3FC9A 5H9EJ 1TK5A 1VOMA 2W9CA 2D3O1 3SSQA 4E2FB 2D41A 4O44B 2OPQB 2M2BA 4NPOA 5IV3A 4DV0J 4G65A 3W1SA 5JJBA 3M9NB 3UDLA 3D28A 4O3PA 1E6VB 1NK9A 4NLQA 3DM2B 5CX3A 4AQYJ 2MP2B 4KHPF 4RR5A 3H90A 1X4EA 3DLKA 2VC0A 3P4PB 3LWMA 3CIMA 4FN2A 1X5PA 4TQ0A 2W55A 3TO8A 3TA2A 4KDIC 2HQDA 3TAPA 1FTRA 4QAYA 2WHIA 2JSXA 2M4NA 3OVSA 2SXLA 2BQUA 2GHVC 1AYEA 3MPYA 4AJWA 2R2QA 4KGKA 1K0VA 4G11A 4AL7A 5CYJA 1ZA1B 5HMZA 3NCQA 3DN9A 2D74B 2HHWA 2K9XA 2CQ2A 3NJTA 2HAIA 3D3BJ 4EU0A 2C7HA 1F2RI 5KT2A 2CIMA 1WUUA 1SXTA 1NSQA 5I3QA 3T5LA 2N1VA 1NO8A 2NUUG 1UFWA 1GJZA 4PQAA 2LUEA 1Q5YA 2V5HG 1WXMA 2JZ3B 3RUIB 1FE4A 3SFDB 2IDYA 5EN1A 1HR0F 1S0NA 1WC0A 2D1CA 3KJNB 1ULRA 1CJTB 2CU3A 4C8LA 2YNIB 2NR0A 4MK8A 3PV1A 4II2B 2OD4A 2FCQA 3E56A 1RACB 1NJXA 2QGFB 4HH0A 4JQWC 2OHDA 1MFWA 2QLBB 1SL0A 2L08A 2EKNA 4NZ0A 1SKUB 2C2OB 3RZWC 5I3UB 2H5JB 2BJDA 5BYSA 6AT1B 4IQXA 2KD0A 2HGLA 1Y56A 4DV6J 3B2GA 2FVCA 1BHNA 4KIAA 2EK6A 3BIID 1VDHA 3NRZA 4NMXA 1C1CB 4TKNA 2JU6X 3MEGB 4UY85 2G4DB 2KFZA 1XD3B 2HQGA 2KVIA 2RHQB 3DU5A 1N33F 3NS1A 3HXMA 4ITKA 2KG1A 3QT5A 2HK2A 1JK9B 2VBWA 2QA4G 4LJOB 4J9UE 1Q1OA 1VRUA 2FIFA 2XEWA 4ATNA 2Q66A 5EGYA 2LKZA 1B99A 1SC3B 3T9ZA 4B9KA 2KH9A 4TN2A 1I4RA 3Q8FA 4CO3A 4HVZA 1JWBD 2FPHX 4QWBA 4X4TA 2INCC 5B08A 3DRPB 3SD5A 3N3KB 4ED1A 5L1KA 2AGQA 4H4OB 3NY5A 4G1IA 2HNDB 2IY1B 3U1NA 1KTQA 4J9LA 2Z2LA 2YQ0A 1IBLJ 3DWMA 2OKQA 4ZN3A 5HP1B 1I4PA 4JB8B 3I82A 5D0EA 3WIUA 4CLYA 2G13A 3LP1B 4C97A 3R1LA 2XZWA 2O2VA 2HYIB 3CMAS 3AOCA 3S6EA 2OPRA 3M32B 5G0RB 3BSCA 2INDC 4C9DA 4MKAA 1IKYA 3LGNA 1KFSA 3NP5A 5KTQA 3NS8A 3N6LA 3O5TB 2KDEB 4X84A 4JUZA 2K0PA 2KZRA 2YKQA 3QNWB 2NPIA 5IN7A 1I42A 1NUEA 2XGQA 4LF9F 4KZ0A 2NXEA 3FGVA 1VHFA 2YKAA 1GXLA 4FNHA 2W7AA 1TKZA 2RDHA 3BVZA 1IJEB 2HQCA 3ILIA 3PYDA 5ETVA 1U7LA 2QA4S 5J1NA 4DSKA 4QOTA 1CQVA 1A5RA 4YSYB 1WE6A 1RCOB 4ZVEA 1V2YA 2UV8G 4K7SA 4C4VA 2L9WA 2OFHX 1M5VC 2OSQA 3DRYA 3UNGC 1J7BA 1UWXA 3NMAA 5G5GA 1SBBB 2KZMA 5CHWA 4LRCA 1K47A 1RT6B 1PBUA 3RZFA 4KTQA 2YPZA 4PQUB 2BPSA 3QZ7A 1RT2A 4JV0A 5F9LA 2XS2A 2HTME 4B95A 2DR5A 2HNZB 1PG5B 2ZZMA 2YX7A 3P5BP 4MFBA 4QR1A 3CXCR 1Y5IB 3HJFA 4ZYNA 4NLSA 2KC1A 2BJ9A 3ZTQA 2LP4A 1GFWB 1NHUA 5E6JA 2FIDA 2KOXA 4W9EA 2C60A 4NEYA 2WXGA 4RW4A 3GFHA 3KLIB 3RZAA 2VUGA 1QD1A 2RPQA 1QTNB 3B8HA 1SEBD 3GQCA 1EX8A 2DHGA 3QSYB 1M90T 1TL1B 4W9LA 3LGMA 2MKYA 2DEIA 1P0RA 1UKUA 3FQKA 4G50A 2Q6BA 3L08A 2EKEC 4DMZA 4ZVTB 2QYGA 2FJDB 3OL9A 1HA5A 2LXIA 2CJBA 2E1PA 1XMQJ 3L13A 1FESA 3EPIA 3M1VA 4KV8B 1SJHD 4BLGA 3BO3A 3W60A 3NGDA 3L0WB 4P2FA 4XK8C 4YY3F 5CAAA 1NHKL 5A8RB 2KTRA 1T0QC 1DOYA 5ETLA 3IG1A 1HNWJ 2K25A 4ZJQA 4RNHA 1E7PB 3HJVA 1A0OB 2DLBA 3PHWB 4M00A 4YTPB 1HNIB 5KG5A 3PYEA 5CYMB 2QO3A 3RR7A 3SDLC 4BHQA 1W2BR 2W8LA 3ZYYX 1IN0A 2RMMA 4I6LB 3G6VA 1VQPS 2CPDA 3T9NA 1FTCA 2J0QD 1AN8A 1XC9A 3GB1A 1WE7A 2UUTA 3TEWA 5F8HA 5EE3A 2WU5B 3I5JC 4EFOA 3ETRA 4YT0B 2BYTA 1EJ7L 4NLVA 3LANA 2IVMA 3BYRA 3PHEA 3VAWA 3NWRA 1CSJA 1YOVB 4FS2A 4UOCA 4ZKAA 2P5VA 1NENB 1WXVA 3TSSA 3TVYA 4N77A 2W4PA 1BY9A 3A1QA 1XCQL 1L4DB 1LFDA 3G8TA 4X64J 3N1XC 1JLAA 1YX2A 1U09A 4DL5A 1H3DA 2C3YA 2GVZA 3U27A 3E01B 4U7UD 3P42A 1P9YA 4X4SA 3F41A 3RYTA 2VONA 3D0HE 4BBYA 4NY0A 2Q79A 5ETPA 2MTLA 1WEYA 1WZ0A 1RLFA 4NPNA 1X4DA 1YJNS 2BANB 2DZIA 2NR2A 5DPWA 3EVWA 4KZCA 3K89A 5L1JA 4USJC 5IKCM 2Z30B 4GKJF 4RW6A 3GS2A 1QILA 4RU2A 3Q22A 4QBUA 2VFVA 2KO1A 3HLUA 4E8UA 2KWDA 2KYZA 1UEKA 4RO0A 2Y1IA 2XMKA 3FSIA 2DNNA 1WG4A 2POKA 2JT4B 1J5EJ 4I6AA 4DX7A 1U45A 4HLEA 4FYWB 2M9KA 3Q2TC 2C7NB 3Q2SC 4B0MA 3MPWA 1WYWB 4NEZA 1SE2A 2V9WA 3I0RA 5K8OA 1FRJA 2GAHC 2HHTA 1G4CA 2ZH1A 4DUYF 1F52A 4MM3A 1RT5A 2PA3A 4CLTA 1S1TA 2ASYA 3JSRA 4GKKJ 1GPXA 2MQOA 4MK7A 2ZE2B 2CWXA 4LUBA 1OFFA 1GK8A 2O6VB 1F2HA 4L3KA 4HTJA 3Q3MC 4DCPB 1FFWB 2GMLA 1S6UA 3EE3A 1HI1A 1RFAA 5HO4A 2CNOB 2JX5A 3SHQA 3PIOQ 2R4FA 5EX0A 1S3SG 4N7TA 4US9A 3V4IB 3A8JA 3HHLB 1YI2S 1JX4A 4CLPA 3KMSA 2L7RA 1ZDVA 2AJ1A 2J7UA 5L9NA 3PTFC 1HPZA 1MU2B 3GSDA 4YUDA 5KFIA 1CG2A 3KHRA 3LA0A 2HKEA 3PRBA 3T41A 1N5YB 2N82B 5HQLA 1DLOB 5L83A 2NPFA 2J8AA 2MEWA 4OYXA 2W2PP 5FDLB 1T3QA 4KFBB 4OZ0A 2DISA 4FLHA 3J7ZT 2CQPA 4B9UA 2MZSA 1JWUD 3K8VA 1N36J 1XQQA 1FNUA 3UN5A 3UIPB 1LW0B 2A6OA 1RHJB 3M8QA 2FLOA 1UBQA 2DIUA 3SDEA 1WXAA 2ZW1A 4AP4C 1YGYA 3PEHA 1D8ZA 2GBMA 1ZS6A 1WGHA 2YNHB 3CF6E 2P6TA 3VAIA 3QYYA 3EJMA 3W9HA 7FDRA 3N1YC 1TELA 1M5KC 5J2QB 1S0OA 4L2YA 1ZGUB 2Y1JA 1QVGR 3FCWA 2WTFA 5IM0B 1I35A 3CCES 2UVVA 2VL1A 1PBAA 2JXXA 1T0RC 3W9CB 2L05A 2B7CB 1SL2A 4X66J 5AZFA 5IWAF 3AXMA 2WDQB 4TV3A 5HLFA 1N0UA 4ID5B 1UD7A 1IWGA 1DFDA 1B7FA 3IBWA 3I9V9 1F2RC 2KMAA 3FQLA 2DB1A 2RR9A 1GUAB 1RYJA 4KIKB 2GX8A 3FRYA 3QRRA 2ICIA 1EKRA 4RH6A 4XDCA 3RPFC 2V4JA 3W2WB 4IUMB 1UZXB 2K8BA 2WSFC 3BBFA 2E1CA 3CCZA 2R8GA 8AT1B 4KYZA 1TQLA 4ICVA 1WNEA 4WWNA 2L76A 2G1HA 1EZZB 2E3TA 1V3SA 3J7Z5 1FCLA 5IZHA 2RHSB 3DYAB 2W4DA 1Z5SB 1LO5D 5DG9A 5D4LA 2O66A 3VH3B 3KLGB 1IQTA 4WJNA 4N5SA 2MLXA 1QAIA 2DPJA 4P52A 2F40A 3IS9B 3MMCB 3CULA 3G2XA 1IGDA 3QWZB 4K81A 4M5HA 1O5JA 3OG5A 4XDDA 3D32A 1FKOA 2JXTA 3VHTC 2VH1A 3IO1A 1FFSB 2PGCA 2VIHA 2PFDA 2YEPF 1KOHA 3W61A 2EEYA 4DBQA 2FY1A 1S9EB 3DXSX 4RLEA 1VCTA 4A8XC 4CM2A 4NAMA 2XWXA 3RNEC 4XZ4A 1C0UB 4OJ3A 3C6UB 3UE2A 4OI1A 3RTVA 3W5UB 3L7OA 2NXJA 2FE8A 1FJEB 3ZNJ1 5ADZA 4OIXA 1L3KA 4Y34A 1UVJA 3QLHA 2DNGA 1H7XA 2NZCA 2F4VJ 3ZTPA 2O5DA 1D5MC 2L83A 1BQMB 1H4RA 3T1HF 2BB5A 4A90A 3IXQA 2PE6B 2OPSB 4ECSA 2J0XA 1R7SA 3TZYA 2WXLA 4NYOA 4C4WA 4M94A 1TJEA 4B3OB 2AU0A 3V2UC 1U1PA 2W2MP 3QIDA 2VFTA 4ILLA 4M5DA 4F02A 3ETOA 4UZBA 4ZN1A 3WA0A 4E98A 1J7AA 2EVZA 2WQYB 1PKUA 4PG7A 2L8JA 3FKYA 2AQ2B 1TZ1A 3ZNGC 1N5XA 4F4KA 2E29A 2CQCA 4LMZA 3GJSB 1WC5A 2J9EA 2DGOA 2LGXA 4K2XA 1S1VA 3R3TA 5CABA 3DBRB 2VG6A 2JHEA 1N34J 1WOPA 5GAGU 5A0YB 2C2MB 3QRQA 3B08A 3O13A 1S1WB 2VU5A 2J5AA 4F4ZA 3RMKC 3OXFA 5IOLA 3WAMA 1LFPA 4NLWA 3P4RB 2RMLA 2REXA 4ZP9A 5KG2A 1N52B 1C4PA 2UUAF 4NXMF 1XLPA 2WS3B 5ETNA 1A7GE 2WXIA 3H4BA 2RRNA 2ZDPA 3QQCD 7AT1B 1VLOA 4TYBA 2HE7A 1HQUA 3HSGA 1WZ3A 3L16A 1VRTB 1SQEA 2KHCA 4DR7F 2EFGA 4LJMA 4ANVA 1FNXH 4YOEA 2K2PA 1B7YB 1U26A 3CJ3A 3IVFA 4P10A 4ZJLA 4LRAA 1ACMB 5HVHA 5B0CA 2RUGA 4RNOA 1N6ZA 2FHOB 2ZH8A 4ECUA 3CF5Q 1C1BA 1H0HB 2MZQA 5IT0A 2JH3A 3CJ4A 3NMRA 1RWKB 4I2PA 1U47A 3OL6A 2EKIA 4DR4F 2H51B 3I0SA 4ZHOA 4Y2AA 5G2NA 1TK8A 4GVBB 4MYUA 2BKRB 4X4UA 4IQMA 4TSSA 5FLXY 1NJIT 4KGTA 1T05B 3KLFA 2ILYA 3VHQA 3UFCX 3NWGA 4Y2MA 3ZFVA 3CCVS 2CNNB 2MPUA 1FKAF 4QW9A 1WF2A 4CYUB 3US5A 1WGGA 1T6BX 1DTTB 5HJYA 3CMES 4R25A 4ILMA 1E0ZA 1RWNB 1S76D 4K4YA 2J8SA 1KP6A 1IKVA 4FHJA 2AF6A 1JXVA 1YQ4B 1HQEB 1DRZA 5DDPC 3BH7B 1LM8B 5HVFA 4A8MP 2KFKA 3VF0B 4G3IA 1JNZB 3ZZTA 4GDKA 1YDLA 4R8UA 2N7CA 3CDEA 4IFYB 3PT2B 2QMUB 5KOXA 1MG4A 2FVPA 4TXSA 5EWEA 3KLEB 1KLNA 1U8WA 1HBMA 4FP9A 1V97A 5HQ8A 3I9V1 4DX8H 1QTMA 1RRBA 4DXLA 2IA0A 4IOAQ 4HWIB 3VXWA 1RTDA 1VZ6A 1E10A 4WAAA 1DURA 5MPOA 1VFJA 1WGDA 1WEXA 2ZITA 4CTAA 3EX7B 3HD2A 3DLGB 4WP3A 1V1PA 1PO6A 1SJRA 2BDPA 1F1BB 5DS7A 4PS3A 3X0WA 3UW1A 4KKJA 3QJZA 4DPWA 3BO4A 3X23A 2HFOA 1WKJA 2YKMA 2JUOA 2W54A 2YPYA 4N59A 4B02A 1MPEA 2N9LA 4XC2A 4G6VB 4BC7A 4Q2MA 4ZP6A 1VQNS 3RW6A 2OOBB 2FVQA 1NK8A 2N4DA 3R3MA 1F9HA 2VC1A 2OPPA 3ZZPA 3VR9B 2IM1A 2BJEA 5E33A 5ETMA 1ITPA 5CA5A 5KG0A 3BJYA 3LAMA 2V9HA 5DZ6A 3KHLA 1NI2A 4JI2J 4GMVA 3BKUA 2RF2B 1LW2B 4PG4A 2KJRA 2DH7A 3JTNA 2RH3A 3ZNHB 1KH0A 3MAAA 2OSRA 2P6SA 3HK0A 1Y10A 2G45B 5DZ7A 3VRAB 3CGIA 1JWAD 4Y0FA 2HW3A 2GA7A 1VQLS 4DBGA 2D3GA 1KVJA 1ZTTA 2EKYA 4KAIA 4V19X 5D0GA 4WQMA 3OFFA 5TR5A 2V8HA 2NYIA 3GP7A 4KHPJ 2ALZA 3FCVA 2MHNA 3AJ1A 1OJ4A 2DIVA 1YJRA 3TZWA 3I57A 3KK2B 2J4XA 4J9RA 2KC2A 2GJFA 2DNQA 4FXWA 2NXNA 4LDTD 2SAKA 2IVYA 4KGMA 4FF4A 2J42A 1IR2A 1RI7A 4CO7A 1ZAWA 2ATCB 3TA0A 2CQGA 3EICA 2DRBA 4QYZK 2GIQA 2DGXA 2V4RA 4GLSC 4GO7X 2B6AB 2ZD1A 2P8IA 2KHDA 2ZBCA 1RAHB 1P3QU 2G4SA 4XTTA 3V60A 1RUSA 2HG4A 1VQ7S 2KWCA 1FWPA 1WRIA 5KFUA 2J9DA 3V81A 4EEYA 1SKWA 4Y65A 4F4YA 3TEGA 1BXTA 2HIYA 1E6VA 3URYA 1UPMB 1LK7A 1L7YA 1YJTA 1ESFA 5ETQA 1HR0J 2DYAA 2NREA 3GP9A 4URGA 4ETZA 5E3PA 1UCNA 3TJ9A 1XNQJ 2WXRA 1FRHA 3OPKA 3I4HX 4B3MF 3HFKA 5GMVA 3Q3JA 1CVJA 3LJ3A 3W5YA 2E7VA 1C76A 2YWFA 1X60A 2F5GA 1RAXA 4OYZA 4W92B 5GMDA 3PM9A 1UAWA 4KSKC 3K5OA 3S1TA 4WFBQ 5THWA 4DSLA 4L1BA 3DVNV 4RW9B 1PGBA 1YVFA 3LPEA 5F8MA 1L0YB 1IBMJ 4MIAA 2JJ4D 3B78A 3I32A 5LMNF 2E1RA 2W9AA 1FKPB 2IPKD 1FD2A 2EW9A 3KDOA 2H1YA 3Q8YA 2MWSB 3ZXRA 2V1YA 2KVZA 2D11A 2E9TA 5GAHI 4DV7F 1RTHB 3LF0A 3OV7A 2J0JA 4ERDA 2WNMA 2BABA 3B82A 1HARA 2WXHA 1UFKA 1D5XC 3IAM9 2VQFF 2KN4A 1FRRA 1UWBA 2H88B 2LRWA 5B0DA 1OQYA 5JUMA 4NCBA 2MKKA 3ZJTA 2R2TA 4UUWA 3DDIA 3AXKA 3N9YC 3OSNA 4ED3A 4GB9A 1D9DA 4PCQA 3HVTB 5CD4A 2HRYA 1LWEB 1HWUA 8RUCA 3MEGA 1K8RB 3U1LA 1AZSB 4OX6A 1EF5A 4QIGA 1F3VA 1YQ3B 2M17A 4ZCLA 4QYZJ 1VRAB 4K50A 2HBZB 2FNJB 1YWXA 3KJVB 3FFIB 4OZBA 2VA2A 3SFUA 1P1AA 3I56S 2RD0A 2DYOA 1V8CA 3THVA 3K0JA 1BQNB 2PVOD 1NDDA 4MSMB 3DVNU 1GAQB 3FILB 3T1YJ 1BWEA 2R2RA 3H2LA 3NS6A 3AI5A 1FF2A 1RWOB 1CC8A 3HHEA 4AS1A 2MSTA 3UDEA 4QU6A 3DRRB 1IP9A 1MWZA 4H4OA 2QG9B 3R97A 5GADI 2MYFA 3VTIA 2GI9A 4N8NA 2HJ1A 2AIRB 3WCQA 3FC4A 2R7WA 1EP4A 2LFIA 3PS6A 2JFKA 3MC8A 1QUVA 5AT1B 2A5UA 3RCZA 2XTJP 3RRGA 5B0BA 2HDEA 1GC6A 3H42A 2NSBA 1BUXA 5KFGA 2RE1A 5D3IB 1F3FA 3BQ2A 1KF6B 5TSSA 2BS3B 4FJYA 3AA9A 5HJXA 4KSLC 2GO8A 1QE1A 2IBOA 2NCKL 2VV5A 4YB5A 4CH7A 4CCHA 3H7PB 1V5VA 2FGCA 4G1QB 4I2QB 1SJ4P 2MZJA 3EA6A 1VCBA 2OEKA 2EWHA 2BXJA 4NYZA 1U2CA 2EG2A 4OJGA 5IV4A 1VC6A 2DWQA 4DU8A 5DGAA 1X4GA 4Z7CA 4NYPA 1U4BA 1VRQC 1WFYA 4X4NA 2DCLA 3GG1A 4FBTA 2DK2A 2UU7A 2BWFA 2AL6A 4DR6J 3ECIA 1P1TA 2ZWOA 3KK3B 3Q69A 1NK4A 3ELHA 1U1LA 1WH3A 2HWHA 1J5OA 4F4AA 1RT7B 4L3NA 3W7BA 4GDLA 3ZZOA 4EGLA 3H6NA 1X4FA 5L95C 4HHJA 4J9VA 2C2KB 2MQNA 1T0TV 1HMVB 3D7SB 3MUMP 3RFZB 4PQUA 3CC4S 1X4HA 2KDOA 3AE8B 2AJQA 2HNZA 3NAHA 2WHOA 3PRVA 4ZOSA 1YQBA 2A1BA 2WONB 2HQFA 1UVNA 1L3SA 4IO9Q 3QFWA 4JI5J 1XERA 3QAUA 3R27A 2OEDA 2BV3A 1PAUB 1WSVA 3KLIA 2VBXA 2K8GA 4A3PA 1S5ZA 1EB0A 3FRZA 2N7YA 1IUJA 5AEKB 4C8YA 4ED4A 4DX6A 3IR6B 5M2RA 1KQGB 2XQCA 1ZM9A 2WVEA 5C3JB 2IFXA 1TMMA 1D4BA 4DV4F 2V2KA 1HZ6A 2R42A 4K0KF 2UV8A 2W9CB 5DLGA 4IG0A 3GIRA 5I4MA 2MKCA 3DOKB 4P2SA 3VAJA 4KV8A 2HLTA 2QL5B 5BXIA 2F3JA 2ROEA 1WX9A 3VQIA 4Q2JA 3M9MB 3A3NB 4QPTA 2IBIB 3HT3A 4UOHA 2JPHA 1QDUB 3DLKB 1Q79A 5HL7Q 4CWBA 4DV3F 3RAXA 3H1UA 3EZ5A 1WD6A 2W82A 3AEAB 5HBMA 1HHTP 2LWPA 1HNIA 1TL4A 1WOOA 2MX2A 1PYOB 4F67A 2AEJA 4WE1A 3G4SS 2XGPA 4LFAF 1Q82T 5FR3A 1WRDB 4MELA 4W90B 2UVUA 1YN4A 1ET6A 5KG4A 4UQTA 3L9ZA 3CJ8A 3IAM1 3MHSD 2RDDA 4DS5A 4C6AA 3Q8BA 4X57B 2DX5B 4HCNB 4GIVA 1T7PA 4ARIA 2BKPA 2PFFB 4FF3A 2LJ5A 1HBOA 1FD8A 4IG7B 1MLAA 2ZHBA 2E5LF 3PTWA 5KFKA 3MR7A 1GXTA 1K50A 5JHBA 1E90A 1SPBP 3ENAA 1J19A 1WXSA 3E01A 4O3QA 1M5OC 1PJ7A 2IIHA 4MH0E 1L0XB 2VPZB 2OD6A 3AJDA 2HZAA 3WZ0A 2C2ZB 1RYSA 3R7SB 4TNOA 2DNZA 2BANA 4O1NA 4HRSA 4L23A 2V34A 3OTEA 2MH7A 1R4MI 1K51A 1TS2A 2LHEA 3UCUP 4KKIA 3UR0A 1FO4A 2MW5A 1YBAA 4DEZA 1P9QC 2PEHA 3VWSA 2H4YB 5EWFA 3A13A 3VGTA 2WB4A 2Z4PA 3TEXA 3M8PA 2PT0A 4CYEA 2KG0A 4EO8A 1SQGA 3AEFB 4NCAA 1N4LA 3PO5A 3DBLI 5B7WA 2KLCA 2QCZA 4NLOA 5ETOA 1WI6A 2D5GA 4DHVA 1S6QB 1ZW7A 4XWWA 2L3ZA 2E7WA 3TI0A 3M9OB 3EGWB 2XZDB 4NLTA 3M3JA 2WOMA 4QPXA 2AGPA 1KQSR 3M2UB 4LF8J 4DV6F 1FDBA 3HSDA 3AE3B 4DXAB 1QAXA 5CHVC 2LJIA 2JVCA 2R9LA 3V6HA 1MG7A 2MHEA 4AFFA 3U1MA 4LVOP 5HROA 2HPUA 4E74A 1SV5B 4RWWA 2XLIA 3CD6S 1K1SA 3JVZX 3ABVB 2GCFA 3EUB2 3HHLA 3P6YC 1Q7LB 2BYVE 1R0AB 2BF8B 3SQOP 2FVSA 1S1XA 3CD5A 1MU2A 4ANWA 3C14A 1HTOA 1B0VA 2B9WA 2HNYB 5C5JA 4E0DA 5DPSA 1OQQA 4DX5A 5HI1A 1N5YA 5DGBA 2BYCA 4XGAB 4F7ZA 1NB7A 1ZM3A 1R8PA 4HT5A 5FDLA 4QQBA 1Q95G 4DPTA 2KO3A 4KFBA 3APDA 4BAXA 4HT7A 3VR1A 3ENWA 3WC0A 4O3RA 1D3WA 1MN9A 1IBLF 2FBWB 3BPDA 1WC3A 1E6YA 5DQGA 4WYLA 5DO2A 3JQJA 2VPXB 2N9EB 3MMAB 4U95A 2XWYA 3KW5B 4LDTB 1G6BA 2UUWA 4OYPA 3C6TB 1JLQA 2KXFA 2YNHA 5A8KA 1TKYA 3KYLA 4CIOA 3DPDA 2BJ3A 3D4JA 2UXBF 3F0NA 1OYEA 3EXCX 5J2QA 4RFBA 3MR5A 1FVSA 2B3AA 4UQGA 3A4RA 4WH4A 4LQ9A 4GRSA 4PABA 2A2CA 1QOAA 4WZQA 1WJUA 2XHCA 1DGJA 5HK4A 3QATA 1URNA 1SJFA 2QMTA 2I8EA 4ID5A 3GZNB 4LR7A 1DAXA 1U6ZA 1RT2B 4DQSA 3DGVA 2BJ7A 4MFBB 3UI3A 4U6PA 1RWWB 2ACYA 4I4BA 2HGNA 2D07B 3MC9A 4KIKA 4AL6A 2W01A 3V6DB 1S0VA 3TJ8A 2AJ2A 2QEJC 2CKHB 1SIJA 3H4DA 3TP2A 1FRIA 3AHPA 4DDGD 4RW4B 2BYFA 2FC9A 1X9MA 4O4RA 3M63B 1VJQA 5DG8A 1SQFA 5GMKa 5J2MB 3OXLA 4IRCA 3BGUA 4DR5J 2NYHA 1S0MA 2GNKA 2BM1A 2VPWB 3TYTA 4ZHRA 1VR9A 3D9BA 2Y3AA 3EHVA 2MCNB 2PMHA 3KLGA 3BGRA 3K9OB 2BE7D 3TR5A 3UCZP 3TJAA 1M5SA 1ZPVA 2RQKA 1S1QB 3IT4B 4OI4A 1UWAA 5DETA 4MT1A 4M5NA 3ONSA 4LLGM 3ZRFA 1IBKJ 1LXNA 4C3KA 5J1PA 1OGWA 2G2YA 3LB8C 4WU3A 3VZHA 1K44A 2CQHA 3QFHA 3ML9A 2DT9A 2KTRB 4OZJA 3CMQA 1T9WA 1TV6B 3VTWA 3VVWB 2APOA 1R43A 4OHJA 2FQQB 4ZIVA 2Y5BB 4XPCA 3LH2S 3QO9A 5F3TA 1UGMA 5AUIA 1Y5NB 2KAJA 2R7OA 3MPUB 2XI2A 2YWKA 4N47A 2OPSA 1TKDA 3QT7A 4B3OA 3TUPA 4QWAA 3W8PA 3QWPA 3C2PA 4NXMJ 4EUTA 4M95A 3ETMA 4BOZB 3J81j 4IH6A 1XMQF 2K7JA 2XMTA 3LWLA 4HROA 2C2NA 1WEZA 3V6EB 4YQWA 4DR7J 2H9ZA 3A1QB 2A10A 3DHGC 1KOTA 3SCJE 3MEKA 4KKOB 4LF5J 2X8XX 4X62J 2G9HD 4R0JA 4ARCA 1FX4A 1ZBTA 1HNWF 2CG4A 3G9CA 2W4CA 2GVZB 2AYOB 4PK1A 3SEBA 3W2VB 3KTQA 3P1MA 3AT1B 1S1WA 1P7FA 2DNMA 1RKJA 4F3QA 1FWLA 1ZA2B 2CPYA 1YJ1A 3ILOA 2QA1A 4CLUA 5HG2A 4DR4J 2R8KA 2BQQA 2YX1A 4ZVQB 2KRBA 1SBRA 4RW6B 4TMAB 2IRXA 2R7XA 2ZH7A 4ZPVR 4ICLB 3TA1A 3MM6B 1IGCA 5CCMA 3MR6A 2WYQA 4U9RA 1DZ5A 2AYGA 3TZXA 4FYDA 1XK8A 2QL7B 1VRTA 3HDSA 3NZSA 2GIFA 2BRKA 3MPDA 4BBNC 4NLUA 1PYWD 4K1RB 2ATLA 1BWVA 3K17A 1ZTWA 3ZTSA 3BB5A 3AEGB 3MMBA 4HDQA 1ROFA 1G2EA 3EECA 1NSPA 3I0RB 3H5YA 4BCAA 3BGLA 4TUUA 3MJWA 1TUVA 2KZZA 4MM3B 1RT5B 3AH6A 1N61A 1S1TB 1XTZA 3CWJA 1YN5A 1TVRB 2ZBQA 2HAFA 3PDNA 1R8BA 3Q0AA 2CKWA 1WDTA 4B9TA 3DLEA 4EBEA 5HMXA 5F8NA 4NNJB 5A76A 1CS4B 5E7OB 2EFQA 2LMIA 1P27B 1IBXA 1JCKB 3W5VB 3OD2A 2GLSA 3ENEA 3OBIA 1U6BA 3W3SA 2IYDB 2XSJB 2KM8C 2KQSA 2WB1D 1J5EF 4Q45A 2QFJA 5LOQA 2AMCB 2WVBA 4CYUA 3NL0A 2D3AA 2BJ1A 3AJ2A 3SIPB 3KYDD 4NMLA 5D6GA 1WJ4A 3TOQA 3T6JA 4USTA 2B5JB 2JRHA 1Q8BA 1RU1A 3V4MA 2C1EB 3PJ9A 2BMBA 4ED5A 4JLCA 1J0GA 2LDIA 1WHVA 2QV6A 1WC1A 3VQTA 3RW7A 5CHFA 4RX6A 3J80U 2QL9B 3FBBA 4O23A 4GKKF 1HQEA 4FVMA 2JLGA 1T9UA 2V94A 3W8GA 4CDIA 3CSTA 1GXUA 3SYZA 4ZRQA 3HP6A 2MGZA 1GNKA 1U1KA 3GIJA 4B08A 2ZHOA 2MQJA 4IFYA 3QIPA 1SUQA 1JIHA 2JEFA 4BFRA 1P1LA 4EOYA 2W7PA 2IDLA 5KOWA 3KLEA 3V61A 4RCOA 5B09A 2NQPA 2M4MA 2FY8A 2RNEA 2FVRA 3OFGA 2F63A 2N4CA