2I2YA

Solution structure of the rrm of srp20 bound to the rna cauc
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
150
structure length
150
Chain Sequence
MQYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTEGSHHHHHHMHRDSCPLDCKVYVGNLGNNGNKTELERAFGYYGPLRSVWVARNPPGFAFVEFEDPRDAADAVRELDGRTLCGCRVRVELSNGEKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis of RNA recognition and TAP binding by the SR proteins SRp20 and 9G8.
pubmed doi rcsb
source organism Streptococcus sp. 'group g', homo sapiens
molecule tags Rna binding protein/chimera/rna
molecule keywords (5'-R(*CP*AP*UP*C)-3')
total genus 44
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2006-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2i2yA01
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2i2yA02
1NO8A 3ULHA 3CCJS 2K3KA 2MQQA 1Q82T 2MQPA 1K9MT 4CH1A 1DZ5A 2MJNA 2LXIA 1WHYA 3UCUP 1URNA 2N3OA 4IOAQ 1UAWA 2FC9A 5DDPC 2GHPA 1N8RT 1JMLA 3VAJA 4CQ1A 2ZJQQ 1D4BA 3OW2R 2J52A 2MQOA 3V4MA 5DDOC 1JJHA 2DHXA 2MZ1A 4WFAQ 5GADU 1Q7YT 3J7ZT 1FO1A 2DNKA 1H2UX 1U1LA 3MXHP 1FCLA 2ONQA 4YUDA 2CPZA 3TO8A 2EELA 4OZ0A 4OZAA 2N9KA 1VBZA 1MVKA 2M2BA 2X1BA 2L9WA 1YTYA 2MY7A 2MGZB 3CXCR 2CQ4A 2O3DA 1VQ6S 2ZJPQ 1X4CA 1VC5A 4P6QA 2X1GA 3G4SS 1X4DA 1H6KX 2NMQA 2CPFA 3CF5Q 1WHVA 3U1MA 1KC8T 2A3JA 2HZCA 1K53A 2HGMA 2DGSA 1XCTL 2KDMA 5D77A 2MZJA 2KHCA 3BO3A 3NNHA 2LEBA 2DNOA 2LUMA 1SXLA 1U1PA 2Q79A 2OJ3A 1FD6A 4UQTA 5JXVA 2DGVA 4TU9A 3UCZP 1A7GE 2CQIA 2CPIA 3CD6S 3BO2A 1KH0A 2E5GA 2N7CA 1HD0A 2CPJA 2QMTA 2I2YA 2RNEA 1FXLA 2DIVA 2J8AA 2KI2A 3LPYA 2KACA 2KT5A 1K73T 4Y00A 1OWXA 3CTRA 1IGCA 2CQ2A 1KOHA 1O0PA 5HHDG 2JU6X 5BMIA 5GAHU 2KG0A 1FT8A 1YI2S 2PLPA 3ZZZA 3SXLA 1KD1T 2DHAA 1M90T 3LQVA 2MZTA 1UWXA 2LECA 1OPIA 1JJ4A 1IBXA 5DDRC 1H2TZ 2MKKA 2IGDA 1N54B 1DHMA 1WI6A 2D9OA 2RUGA 5LXYA 3CULA 1Q10A 4LMZA 2PE8A 2JVOA 2LGIA 2OSRA 1WHWA 5JVHQ 2OSQA 1U1RA 5H1SV 2JWNA 2LHEA 2EK6A 3VALA 4CH0S 2AD9A 2EK1A 2DIUA 3DLLQ 3MUTP 1P1TA 1KOOA 2DGOA 2DNZA 2DITA 3I55S 3JB9k 2QEXS 5DETA 2FC8A 4QPTA 3BEGB 4V19X 2U1AA 3R27A 4GLSC 2ZW0A 2DGWA 2MXYA 2OTJS 2MPUA 2MQMA 1WEZA 3THPA 2KWDA 3PIOQ 4WKRA 2XNQA 2CQGA 1YNTE 1X0FA 1YMHE 2MKHA 1NJIT 3CC4S 1CVJA 3G9CA 4FXVA 2RPVA 5IQQA 2GB1A 2E5IA 1SJFA 2CQ3A 2N82B 1BY9A 1U1NA 2YWKA 4WCEQ 3BS9A 2PEHA 5D78A 1HZ6A 2LMIA 3P3DA 1MHXA 2DNMA 4CIOA 3CPWR 4IOCQ 5BMGA 3VAGA 1N88A 1X4GA 2DNRA 2XNRA 1RK8A 3P5TL 3TYTA 3DXBA 2DNQA 1SJ3P 3S8SA 3HI9A 4WFNQ 2JZPA 4HJGE 2YTCA 1GB4A 3CCMS 4U67Q 5IM0B 1ZZFA 3PIPQ 4IKGA 2I38A 2MQNA 1WEXA 5FJ4A 2MZRA 1HL6A 2BZ2A 5MLCV 4W90B 1Q86T 2QSDA 2GO9A 1MI0A 2YH0A 2YKAA 1VQOS 2MJUA 2F9JA 4F26A 5JVGQ 1WI8A 4F25A 2HGLA 1R8PA 3G71S 1X4AA 2KXHA 2L08A 1PGAA 1N52B 1X4FA 2MQLA 2F3JA 3Q2TC 2KFYA 2LA6A 3CUNA 2HYIB 2N7JA 1PO6A 1K8AT 4QU6A 5LXRA 3CMES 1WWHA 5HI1A 2M9KA 2XS7A 2N3LA 1PGXA 2B0GA 4ZKAA 4F02A 2ON8A 1MHHE 3VAMA 3N9UC 2K0PA 3BO4A 4PR6A 1HA1A 2IGGA 3GB1A 1WF2A 2MY8A 1SJQA 2AYBA 3NNCA 1IQTA 3FILA 1JMTA 1QVFR 1XCQL 1R8HA 1WEYA 1IGDA 2MKSA 1YITS 1WG5A 2VODA 3P6YC 1NU4A 2LXUA 1KQSR 1P7FA 1GB1A 2DNNA 1S72S 3EGZA 1D9AA 1X4BA 1AUDA 3MUVP 4IUFA 2RQCA 2G0CA 1VQ7S 1Q81T 2M88A 4YOEA 1U1MA 3CCLS 2MHNA 1JJ2R 2V94A 2KU7A 3S6EA 2MSSA 2G4BA 1IBXB 2JX2A 2RT3A 1X5OA 1ZXHA 2M52A 1DRZA 1RKJA 3UCGA 1OO0B 5BMHA 1VBXA 1ZZNA 5CXTA 2ADBA 2KQ4X 2CQBA 3CCVS 3J7YU 1K51A 1D8ZA 1WELA 1VQPS 1U1QA 4PRFA 1VQNS 4QU7A 1XF5L 4LJMA 2YH1A 2DK2A 1P27B 3MD3A 2M7SA 3SDEB 2CPDA 2MB0B 1OIAA 2J0SD 3H2VE 3HHNB 2MSTA 4OZ1A 3EX7B 2KN4A 2OEDA 2JRSA 1FJCA 4KGSA 2MMYA 1VQ4S 1VQKS 5HL7Q 3UWTA 2DGUA 2J76E 2UP1A 2CQCA 5CA5A 5LJ5Y 4KGTA 3US5A 3CMAS 4W92B 1PGZA 2DB1A 1U1OA 1X5SA 2MKCA 2AYGA 2LA4A 3CCES 3FEYB 1X5TA 2OTLS 2DO4A 1K50A 2DHGA 2KH9A 5IFMA 1VC6A 5CYJA 1K52A 3CCRS 3G8SA 2PW9A 3B4DA 3CC2S 3S7RA 1SJ4P 2K8GA 3NMRA 2CQDA 1F2RI 3MOJB 3NS6A 3RW6A 4PKDB 2VOPA 3VAIA 2L41A 1WG4A 3UD3P 4TU7A 2E44A 1FNXH 2MZSA 2DNLA 3UE2A 3IWNC 4WF9Q 2VONA 1VQ5S 2CPHA 1FJEB 1QVGR 2ZW1A 2XS5A 2KRRA 2KG1A 4RU2A 1B7FA 3G8TA 3MI7X 1M5PC 4ERDA 2D9PA 4C0OC 2OIHA 3SDEA 2BOPA 1VBYA 2DH7A 1U1KA 2RS8A 2DNGA 2RQ4A 3R1HA 2LQ5A 1UP1A 1VQMS 1M5VC 2RU3A 5GMKa 5EN1A 5DDQC 2M4MA 1L3KA 5DM6Q 1QKZA 1WG1A 4ED5A 5HFYA 2DGXA 1WHXA 3MURP 3D2WA 2U2FA 2NZ4A 2X1FA 2AYEA 4WFBQ 2XB2D 3FILB 4Z2XA 3B4MA 2MKJA 2LHDA 2DHSA 2XSFA 1G2EA 3VAKA 4OZBA 2F9DA 3I56S 2KYXA 2D3OR 2FY1A 2LKZA 2HGNA 2DNPA 1WF0A 2E5HA 4A8XA 2DNHA 1WF1A 3U1LA 1X5PA 2DH8A 2WBRA 4TLQA 2SXLA 2DO0A 1YIJS 2GI9A 2MZQA 3CC7S 5ITHA 1PGBA 2JXTA 2KM8B 1YJ9S 4WH4A 5GAGU 4WIIA 2CJKA 4TU8A 1QM9A 5HG2A 2PTLA 2DISA 2LCWA 3TP2A 1FHTA 2CQ0A 1VQLS 1VC0A 1DBDA 4BS2A 5DM7Q 4IO9Q 5LSOA 3RW7A 2RMMA 2LYVA 1F9FA 2DGTA 3H2UB 3VF0B 4EGLA 2MKIA 2EVZA 2E5JA 4J5OA 2QFJA 5GAEU 2LEAA 5LJ3Y 3G6ES 2RS2A 1YJNS 2KVIA 4FXWA 2KM8C 4C7QA 1UW4A 2G1DA 2JSVX 3V3XA 4M5DB 2JWUA 1SJRA 1ZH5A 2IGHA 2CQPA 1X4HA 3UD4P 4OZCA 2AYMA 2RRAA 2ADCA 5HO4A 3FEXB 5GVQA 2KXNB 1YWXA 1X4EA 3MP9A 2CPYA 3CCUS 1H2VZ 2XS2A 2ZJRQ 2NLWA 1C9FA 2DH9A 1WTBA 1M5OC 1A9NB 2KRBA 2J0QD 2FPHX 2M70A 1W2BR 3ZZYA 3NS5A 3MUMP 3P49B 2KXFA 2M0GB 4MACA 2CQ1A 2CQHA 3IRWP 3VAHA 3CCSS 3VAFA 4QQBA 2JVRA 2X1AA 3SMZA 4KGRA 1YHQS 3MD1A 2VOOA 5BJRA 3UI3A 4IOIE 3CCQS 1U6BA 1P7EA 4YB1P 2M8HA 3S01A 3K0JA 1HZ5A 1HD1A 2CPEA 3L3CA 3THTA 3NNAA 1VQ8S 1F2RC 4HKZE 2ERRA 3EGNA 2RVJA 4Y0FA 2MGZA 1HEZE 2FHOB 1FJ7A 1M1KT 1EM7A 2J53A 1VQ9S 2N9LA 3G96A 2M8DB 3MDFA 1M5KC 2HVZA 2DGQA 1S79A 1U2FA 4D2KA 1XN9A 1MPEA 2MYFA 4C4WA 1U6FA 2RRBA 2CPXA 1FCCC 1UFWA 1YJWS 5LSLA 2QA4S 4UY8T 3R1LA 4LIRA 5IM0A 3Q2SC 2DNYA
chains in the Genus database with same CATH superfamily
2HIQA 4KO0B 3PX4A 4WWPA 4LQ9A 2LXIA 3C15B 3KDOA 3QLHB 3OV7A 2N3OA 2QDFA 3CSTA 4P2XA 4MIBA 3KLFB 1EQMA 3JYTA 1SSNA 2KAJA 5CHCB 2DHXA 2HURA 2KZZA 1JXVA 5B0AA 1F5AA 4Q7AA 2AEMA 2VU5A 1KWMA 3LO3A 4C48A 4LQ3A 2B9WA 4LFCF 3M4XA 4OZ0A 2J0MA 1F1BB 3R5CA 3T1HF 4OFZA 2ZH5A 4FN5A 2ILZA 3Q8UA 4AJWA 3ILLA 2A3JA 4D3HA 4DDFA 2R8IA 1SH2A 1JW9D 2JWZA 2MBEA 4UT4A 2IVFB 1VS3A 1AFJA 8AT1B 4B0MA 2W2MP 2K8HA 1BQNB 2MTLA 4IM3A 4HH0A 5AT1B 4B3RF 2I8EA 2IIHA 3QJJA 2MRPA 1I4QA 2HEKA 3UIPB 1T3OA 3J80U 3ETOA 2W9BB 1V80A 1GT8A 4AXIA 5F9LA 1V5IB 2BPSA 3DBRB 4HYKA 2L9DA 2PMVA 2VA3A 2JVOA 5AUIA 3EYZA 1TFWA 4DN0A 1WSPA 3KWVA 2B6AB 1T0SC 3GCXP 3F44A 1TL1B 3KYCD 4QIWD 1NK5A 3K9PB 4WU2A 4B95A 4PPDA 3PR4A 2HQDA 3B2GA 2XNQA 1SH0A 3KXDA 3H8HA 1OEYA 3NS8A 2JEJA 2Y3AA 4HH1A 4LSLA 4AL7A 4E0DA 1TKYA 4X84A 2XO7A 3J80Y 4KGKA 3VAWA 2E29A 4DUZJ 4KPYA 3QQCD 1Q16B 3TYTA 5FDLA 1EZZB 3Q8RB 2NXUA 1TQLA 3LGHA 2XI2A 2VZKB 4PYUA 3TQEA 5ETKA 1E8WA 2RMLA 5H9EJ 3KTQA 1ZAXA 1KF6B 3IO1A 4C7YA 1J5EJ 4CTAA 4USUA 2XS7A 2LXCA 2GNKA 3CJ2A 4FJYA 1QAIA 3MECA 3AE1B 1HI8A 2V4LA 1Z4UA 4K5SA 2HWIA 2MKSA 4JI7F 3GS2A 2KQ7A 1KEKA 3HHEA 2HBQB 5HMZA 2YNHB 3CDBA 2I1KA 3JXOA 2J7KA 1FFGB 3H7PB 1X4BA 2IDLA 4C9DA 2BF8B 3GFHA 4WIQA 2MEWA 3S6EA 1ZGUB 1HNXJ 3J9CA 1S76D 4U8YA 4ID8A 4MAKA 3B08A 2J8SA 3H42A 2DYMA 1ZM3A 1WY8A 1JQGA 1FK9B 4ECQA 2WB1D 1H38A 2W7PA 3UDVA 2V69A 3MAAB 3HSJA 4JB8B 1TL1A 4KYZA 3KK2A 3CCTA 4CLKA 2B56A 2KT2A 4LR8A 3SDEB 4G11A 2HBYB 2BBEA 3KWLA 1FX4A 4DCPB 2O6VD 3CMAS 3KUGA 3QC8B 4N47A 3DLJA 3HM6X 2W55A 1X5TA 4X4QA 4RH6A 2AQ4A 1CULA 2DHGA 5HP1A 4IO1A 4ZHOA 3UVJA 2JHEA 2G3QB 3PDNA 1B70B 3T19A 1S9GA 3CC2S 3S7RA 4BKTA 1WG4A 3UD3P 3QJZA 1S0VA 1FXTB 5AZFA 2ROPA 1OMSA 2W7AA 2KRRA 3M9NB 2XS5A 1CMXB 3MI7X 2UYZB 1T03B 3OTOJ 1NSKL 4ZYNA 3OLBA 4P71A 4OV6A 4ED3A 5KFMA 3RG6A 1FKOB 3R6GB 2E7WA 1TJEA 4NLUA 5B0BA 1EO6A 2KYXA 3HHKA 3OVAA 1MMDA 1YJIA 1V97A 3KHRA 4RW6B 1YIJS 3R3TA 3FDSA 3EVOA 2JXTA 5DZ7A 2L3MA 2QA1A 4FBTA 1FNVA 1VQLS 3NGSA 1DBDA 4BS2A 4QYZJ 4X4RA 4AXJA 3ZJVA 5J2RA 4CDIA 1RDRA 1X8DA 3MAAA 2I0XA 2HS0A 2XY7A 4YY3F 3NY5A 4HT7A 3AEDB 2W9AA 3WIMA 2BYCA 1SKWA 2OPPB 2RS2A 2QA4G 2FCQA 1OQYA 3RB6A 4USJC 2WXRA 2CIMA 4RUCA 2AP6A 5J18A 4GRSA 1Z2MA 4MIAA 2FBWB 1IUJA 4KKOB 2HQFA 4NQKE 2HFNA 4RUBA 3PRZA 2HRTA 3EZ5A 3GR0A 4DV2J 5ETMA 4WP9A 1J19A 1QQRA 2CQ1A 1NEEA 1ZPVA 4GC6A 1DQAA 1VJQA 3H4BA 3I9ZA 1U6BA 3HHLC 4YHHF 1HZ5A 2WONA 2N7EA 1VQ8S 1DQ9A 1LW2A 3KLEA 1F2RC 2ERRA 2A2CA 3X1LB 1Q95G 1HEZE 2DXEA 1N34J 1WC5A 1HPZB 1L3SA 2R2TA 3G96A 2DGQA 1IUEA 1SVDA 3IAS1 4ZLPA 5LSLA 2N4FA 3DHIC 1RT3B 5KFEA 1HNVA 2NYHA 2XMVA 3OL8A 4KIKA 1VCTA 2V5HG 5EGYA 4TNOA 4OZLA 3TEZA 1BC6A 2L76A 1GUAB 1YJTA 4ZVQB 1VRTB 2XMJA 4RJVA 4FYDA 2OPQB 2C5LC 1R0BG 4UW2A 4JWUC 1JKHB 2MW5A 2ZJPQ 3RPFC 3W60A 1XK8A 4EK2A 2P6TA 3P45B 4TYBA 2WP9B 1E8XA 2R2SA 5HLFB 1S1WB 2DTJA 2VC1A 4FYXB 3W2WB 3GCWP 2E9RX 1JQ4A 3A9JA 5AE3A 2RNEA 5EE0A 2ZDPA 3WZ0A 4JV2A 1Q0NA 3Q22A 2CHZA 3ET6A 3RBEA 1U4BA 1FT8A 1WMHA 3HO1A 2PLPA 2XZDB 3TUOA 4DUTA 4U7UK 1IBXA 2JLEA 1RAXA 1TTNA 4KHPF 4PXDA 1ZAWA 4M0WB 1WZ3A 1VMBA 5LXYA 2BXJA 4B9VA 4JV5J 4URSA 1H7WA 2UUAJ 2XLJA 5FLXU 4ZYSA 1IN0A 2RPQA 2GS8A 3HULA 3DDNA 1FRLA 2YX4A 3CEDA 4QPTA 3DDCB 2XC9A 2QX0A 2DGWA 2HVDA 4BBYA 4ILLA 3SQGA 3T6BA 2XYPB 4BBNC 3AXCA 2P8IA 3ONQA 2UXCF 1NPKA 4MK8A 2EG1A 4PYDA 2YWKA 1I4XA 3ICLA 4C3KA 1CJKB 2DT9A 1RAAB 2ZC4A 4YS2A 5I3QA 1HE8A 5IT4A 3APDA 3BIID 1TKTA 3M9OB 2I38A 1HL6A 2XI3A 5HKHA 1Q86T 1UGJA 3U1NA 4PUOA 4Q0BA 2W2PP 3O3LA 4OHWA 4XTTA 2LZ6A 1QUVA 1E6YA 2ZWOA 3OSPA 3TMPB 2D7SA 2HMIA 4IRDA 4RW8A 2CWXA 4TQRA 5LXRA 4DK5A 2M9KA 3GYNA 4GMKA 2KO1A 4F3OA 3OSNA 2FVCA 3MR6A 3R2CJ 3UN3A 1Q1OA 3A4TA 1R8HA 3HX9A 2UUBF 4Z7YA 3T3NA 3IS9A 3R5AA 3FFIB 3GIMA 1NU4A 1HHQA 2AGQA 4ZRPA 4QWDA 1OTRB 2IBKA 4GKJF 2DYOA 1HI1A 1Q81T 3M2UB 4B3TJ 1NENB 3OPKA 1I3OB 4TMAB 3HZEA 1FXRA 1YJUA 1BLUA 4IDKB 2JEFA 2HFUA 3FCVA 5HQ8A 1XR5A 3IFEA 1X9MA 4JI4F 4I6PA 1WJ6A 4WBFA 4HT5A 2N1WA 3ADAC 5D4NA 3DOWA 1FNOA 1K51A 1WELA 4RW9A 4B3SJ 2V6AA 1RP5A 1VQNS 2XY6A 3M30B 3AE5B 1R43A 4NZ7A 4NAMA 4WAAA 1VQ4S 2J76E 1UFKA 3RNFC 2OHDA 5CA5A 1QF6A 3AECB 1IBCB 3C6UB 3RR7A 5KG4A 3MC0B 1X5SA 4MK9A 4WU3A 4XWTA 1CS4B 3GFXA 3NBPA 1TUGB 2KMCA 2YPZA 3KUHA 5IFMA 1KONA 3O44A 3TBLD 4DF4A 5I3UA 2PW9A 5TSSA 5JH5C 2YXLA 3OT9A 3BY4B 3RW6A 2JRHA 1ET9A 3V5RA 1U47A 4TKNA 1FJEB 1ET6A 2ROGA 4RU2A 4IG3A 1T05B 2Y3YA 2K1RB 2R8HA 5LXHA 4WFXA 3NAIA 1JLQB 1M1GA 3BKFA 2V4RA 3EDQB 4CT9A 2ZWPA 4C8YA 3NCPA 5DDQC 4XGAB 2M4MA 4DV1J 2MJEA 1AUSL 3V81A 3I4HX 2MKJA 4X62F 2QMXA 4YWGG 4RM9A 2GJ2A 1WRIA 4ZPWR 3M2UA 4I6WA 1S6PA 3VHQA 4RLEA 2SXLA 1LXDA 3BGUA 3P63A 1QSYA 2P9CA 2WZ1A 4JYAF 2HK3A 2PTLA 4A8YA 4I2PB 5GMVA 4R3DA 4LF9F 1BXNA 2UUAF 5IN7A 4WQOB 2RILA 1UD7A 5E33A 3M9MB 3T5JA 2DVIA 2IGHA 1IVZA 1BWVA 4DOZA 2KXNB 2CPYA 3MP9A 1S1XA 1W2IA 1F77A 2ZITA 3FKBA 2VUGA 4URKA 2KX0A 1BMQB 3DKDA 4G1QB 2N4CA 4LSZB 1TAUA 2ZDOA 5T41A 3R2DJ 2QCZA 2EEYA 2L0FA 1UL3A 5T7LB 1T7PA 4MYUA 5BJRA 5IWAF 3U8ZA 1HD1A 3QGGA 3DBHB 1I1GA 4UDUC 2F7VA 2BS4B 5FR3A 3ZXRA 1PJ5A 2FHOB 3E51A 1K1QA 1NPPA 2OEMA 4J9NA 2N9LA 2IDYA 5IP4D 4D2KA 1RYRA 3D0IE 1F2GA 4GIVA 1MWYA 4GB9A 4C56C 2HHVA 3PFEA 3VGTA 1T3NA 2UUWA 4CH1A 4DV3J 2CRLA 1DZ5A 2IY0B 2UVVA 3KUEA 4CLZA 4B9NA 2EW9A 3RNAC 3ZIMA 3RUBL 2DLBA 5IOLA 1FDBA 1SIZA 2E1CA 5K8MA 1SJ1A 4DU7A 1FNWA 3NVZA 3V4MA 5J1EB 3ZJTA 3UDLA 4QWBA 3I0RA 3WC2A 5L39A 3SQOP 3TUJC 2VA2A 3TEYA 4NXNF 4LR7A 4HJKA 4DR5F 1EIYB 3F0NA 5EUHA 1M5HA 2LFVA 2Y5CA 2FJWA 2MDAA 2YBVA 5HMWA 3AEEB 5DGAA 2HNYB 4ED2A 4RU9A 5DCNA 3QNWB 3G4SS 1HMVB 2EBGA 3UNYA 3BVMA 2HBRB 1OQ3A 2DGSA 4OYIA 5E3AA 1R4MB 3GE3C 2HTME 1WORA 1V1PA 3T5HA 4K4ZA 3E56A 1L0VB 3DVGY 2DEIA 3A1YG 4EBEA 2BKFA 2E5GA 5G5HA 1C77A 4HDQA 2OKQA 3HPOA 4WE1B 2QL5B 1RADB 1RTDB 3QWUA 3C2PA 4DV3F 2K8BA 4ZN1A 1N32J 1ICEB 2HS4A 2PKOA 3I5BA 3OD2A 5C7PA 2D10A 4XPCA 2AIRB 2MEKA 3DRYA 1TIFA 1YX5B 4X4PA 2NSBA 3DBLI 2PE8A 1CJUB 3VCDA 2W4CA 5F8IA 2POKA 3THVA 3IMQJ 4M5JA 2DIUA 5K5MA 1DLOA 4LF8J 2ZZPB 1P1TA 3DLBA 4K2JA 3M32B 3ZXWA 1GNKA 1S59A 2MXYA 1AYFA 2KWDA 1G6BA 2LP4A 2LDYA 2I1RA 3CJTA 3DXSX 3G9CA 3LGMA 3I32A 4WCEQ 4KKOA 1KS2A 4TY8A 1ZS6A 4OJ3A 3DXBA 4EEWA 1OGWA 3HI9A 3ZZ0A 4AOFA 4K4SA 2YTCA 2K3UA 5F8JA 1Y4ZB 3FCHA 3BPDA 2R7QA 3PG9A 4QYZK 1E6EB 3KMSA 2J7QB 3ZNID 2W8LA 5IAAC 3HVTA 5JVGQ 4ALZA 3G71S 4M00A 2Y1IA 3KLEB 3DU5A 1WM2A 2NXJA 2N7JA 4B3TF 5AJ3F 2Y9HA 3DC2A 1HNWF 3JW0X 4JV1A 1HBOB 2J9DE 2O66A 4ZP9A 1TV6B 2QIEB 3C16B 4WE1A 1HNVB 2ZNYA 1L6VA 1V1OA 4CO4A 2BRKA 1TVRA 2HHUA 2XMMA 5KG3A 3RZFA 1GB1A 3TR5A 2DNNA 4H4MA 4ICLA 4LVNP 4RO0A 3GV5B 1UPMB 1ESFA 5BO4B 2CZVC 4CZCA 2XMTA 1L3VA 4LSLB 1R3NA 4LRAA 1TS3A 1U49A 2VC0A 4CYUB 2VRRB 4JIOU 3M1VB 3V6HA 2KQ4X 3Q8FA 4EBDA 4M5NA 3IM8A 3JTOA 4PRFA 1WGRA 1CPZA 3QPIA 2CPDA 2J0SD 1VRAB 4AQYJ 2SEBD 3AXMA 2JRSA 2QYCA 2C3YA 1YKWA 1FCAA 1RU1A 3I0SA 5KG5A 3ALBA 1JWAD 1VCBA 1WFYA 1VC6A 2WU2B 3R5GA 1D6EC 2K8GA 4DV1F 3LYYA 1S6QB 2Y1RI 5HROB 3H4DA 2FE8A 3VAIA 2EMTA 1DAXA 2Z8LA 2E44A 3CW2C 4JI0F 1FWKA 5KT5A 2VONA 4EMDA 4IH6A 1V3ZA 2VJUA 2D9PA 2G9HD 1VDHA 4JYAJ 1XR6A 2GX8A 2KANA 4FF2A 1KBRA 2OMOA 4I2QB 2JQRB 4AL6A 2ZH6A 1K47A 4NCBA 1QKZA 4DCJB 4ZVRB 1VBKA 2F63A 2NZ4A 3IRXA 1L0XB 4MSQB 4ZVEA 3AB4B 3VAKA 2Y0BB 2HGNA 4A8XA 2E5HA 1NK6A 3BYPA 3U1LA 3V6DB 5B0EA 2HTHA 3GV8B 5KT3A 3JSRA 1HYSB 4A20A 2DR7A 3KNAA 2CQ0A 4B08A 1MG8A 1NJYA 2KT7A 4M5IA 4JP8A 2XBBC 3MR3A 2EVZA 1JLAA 1JLBA 4X4SA 3KLGB 3VQIA 3G6ES 1TKDA 3Q8EA 2GW8A 1RTZA 4Q0BB 2B4UA 1WJ9A 2K9XA 1JLGB 3H1UA 3OWEB 2WOMA 1TZOA 1RUSA 5IO9A 5L1IA 2HMIB 3UD4P 4K59A 1IBMF 2IVYA 1FDNA 5DPTA 4ANEA 2LLZA 2ZJRQ 5KFPA 4DZDA 2DXFA 2FPHX 4FJZA 8ATCB 4L74A 3HD2A 2K6DB 2M0GB 5J1EA 2EMSA 2AZ3A 2NUHA 2GVDA 3VAFA 1JK9B 2UXBF 2G9OA 2PFFB 1S7HA 4USHA 1T9TA 2PGCA 3OUYB 1RWMB 3BZDB 1E90A 2NCKL 5EDSA 4II2B 1TY0A 2LMCA 2DCLA 2XNAC 4I6YA 2GOWA 4ZITA 3G6VA 4TY9A 3BVGA 2CXEA 4WJQA 3MDFA 1WR1A 2J0WA 1C78A 2RRBA 2BYEA 1VDVA 1FESA 4DR4J 1LWEB 1SL2A 3M30A 3N4WA 5L83A 1F2HA 3DBSA 3TWZA 5F3ZA 5HMYA 2DAJA 1WGDA 1V6EA 3QK0A 4J9UE 3L95X 1ITPA 4DHJB 2C3OA 3FBFA 3FBCA 2DNKA 4A8SA 2FVSA 1YQ4B 1WC4A 4X4TA 4CO3A 4NA1A 2N9KA 1AZSA 1NLKL 1M5SA 3PY8A 3EXCX 2AU0A 2MY7A 3NG8A 2EWHA 1QE1A 5C42B 2WONB 3ILJA 2K2PA 4FS2A 1QLNA 1RT6A 3QRQA 2KDMA 3TZWA 2MZJA 3KLHA 2YNFA 1WX9A 1SPBP 1U1PA 1IM6A 1TAQA 4C3MA 1UA1A 3ETMA 3I5AA 3A8KA 2ZHOA 2XMAA 4XAKA 2D11A 2NUUG 4O0NA 4QAYA 3TEXA 1KOHA 4NMLA 4J9RA 2JU6X 3A9JB 3RNBC 3TJAA 2HFSA 3A3PB 3CDEA 1IM4A 2J0JA 2YQ1A 5L46A 3QBCA 4OI2A 1IKYA 2EG2A 4KFBB 2Q6CA 1G3OA 1JWWA 2MSED 3N3KB 4NZ6A 1ZBTA 2AJ4A 3N1ZC 3Q8YA 4YT0B 1F3VA 2KC2A 5EE9A 1KQFB 1RM6C 2LHEA 4DPUA 2E9TA 2D3UA 4KHMA 1T05A 4GDKA 5KG1A 2VPXB 1TU0B 3PIOQ 3UN2A 4DN9A 1CVJA 3PW7A 2IO2B 2NYIA 2HFVA 3NOCA 2JDJA 3TX8A 2ZPYA 4V19J 1G4CA 5EHHA 3J7Z5 3VV2B 4E98A 1SC1B 1F9JA 1V3SA 5AJ3J 3HVRA 1S6UA 3RJMB 1HHTP 2FY8A 1E10A 2XEXA 2FZCB 1MROB 3K8WA 4QW8A 4Y6IA 1V3RA 2VV5A 4RW7A 4F7ZA 2FJXA 1X4AA 1IR1A 2L08A 2PPHA 2ATCB 3RRHA 1Q53A 3L9ZA 2KFYA 2EFGA 4HLEA 4DHZB 4K8RA 2HHXA 2RHQB 4Q8EA 2B0GA 5LSRA 2PVOD 4LFBF 3VAMA 4HPLB 1S1UB 1ULRA 4M5HA 1CSJA 2KJVA 3CNQP 2P9GA 2XGPA 4CO5A 7FD1A 3PREA 3G6YA 5EWEA 2FCNA 3JSMA 3I82A 3HUIA 4OI6A 3MEDA 1ZPWX 3G2XA 2CADA 1L7YA 2ZZNA 4NCAA 1SQFA 4ZRKA 1U1MA 3AB5A 4K4YA 4WQMA 1IBXB 4A3OA 1ZXHA 4W4MA 2BB6A 3DQVA 5FKAC 4EO6A 5T7LA 1MW7A 1T9YA 3O5TB 1Q0WB 2BKPA 5KG2A 1YX6B 2KVQE 4PAAA 4DR1J 3K5NA 2DPIA 4DV7J 3QGHA 4W9LA 5DLGA 3AU5A 4ZPTR 2N9XA 2M7SA 4F8RA 3RYTA 2NS1B 4LDTD 1PBUA 3FNNA 2COLA 4LF1A 4DWIA 2G2YA 4A8FA 1E7UA 3RBZA 3U02A 2K5PA 5BYQA 2AYGA 1RAFB 1AWDA 5KHOA 4E2FB 2OTLS 1JALA 2F8MA 5B0CA 1E5WA 4DV0J 4FADA 4LREA 3MOZA 3ZTSA 4JPSA 1WDTA 2GVZA 3NMRA 1CS4A 3NBPB 1F52A 5FLXY 1KFYB 2OFGX 3T9LA 3AEBB 2WVFA 2MZSA 4H4OA 5HN0A 2DENB 4ZP6A 2IC3B 3KLGA 4M5GA 3G8TA 2LU1A 2L32A 1V9OA 4RW8B 1V49A 4FDFA 4EYIB 1DLOB 3B2FA 3AD8C 2KTQA 3K5MA 4FKXA 2WHOA 1WHXA 5C25A 4BHQA 4OX9F 1KM7A 3MEDB 2LHDA 2LI5A 1R8BA 2HPUA 3CJQA 4HDOA 3SBMA 4M5DA 1JRUA 4RNAA 1MG7A 4YEAA 2DNHA 2D3ZA 3B0AA 5DS7A 4LVOP 3OJSA 2DO0A 2GVDB 1KQGB 3K5OA 1YJ9S 3E3XA 5A8KA 4WH4A 3D66A 4DHZE 4A9AA 4UOCA 4NYZA 3HFZB 5D3GB 1RHQB 5GXGB 1UBQA 3PHXB 1HFEL 1O51A 3CIMA 2BVCA 1BXTA 3HVTB 2QILA 1HLWA 4PWDA 2CUYA 4DSEA 5BR8J 2G1DA 1HQUB 1KVJA 2Z0GA 1RT1A 5EE3A 2LJ5A 4OZCA 2ZFHA 4ZVUB 4Y2MA 1VIOA 2IA0A 1J7CA 3TUIC 1VQSA 2VH1A 2OELA 3K7RA 3TAMB 4N9F4 4LJOB 4ED7A 4G3XB 1I6JA 3P49B 2KWCA 3ZNGC 4JUZA 3JAMU 5JZEB 2PI5A 4LF2A 5IXUA 1KVIA 5DPRA 5HJYA 2DYBA 4PABA 4B9UA 2LRWA 1OYDA 4OYWA 2FUHB 1EM7A 3N6LA 3ENWA 1B1ZA 4C4WA 1UWAA 1LWCA 4OJ1A 4LIRA 4DPWA 3Q2SC 1HQEB 1FJGF 3ULHA 3V6KA 3DU6A 4F0HA 2RDGA 4CHKA 4Y65A 4W9DA 1WHYA 4IOAQ 1IPGA 3RB0A 4X64J 1XD3B 4F0KA 5K9FA 1TV6A 5FK9C 2ZBPA 3C16A 3RGIA 3OW2R 1C76A 4QOTA 1FFUA 4OJHA 3DOMA 1Q7YT 2ZUAA 1Q79A 2VFSA 1LFWA 2KZMA 3M8YA 5KT4A 3D1QA 4YUDA 5M2RA 4RMAA 2RR9A 5KFHA 2D74B 2HAIA 3N30A 2G1EA 1TZ0A 1CLFA 4ATNA 3URYA 2VZKD 3CF6E 2OMLA 4O3QA 2VICA 1SKUB 2OP5A 2RDJA 3MR5A 1V8CA 2CPFA 3MCNA 5F9NA 2R7TA 3IM9A 3IN5A 5DPSA 2V8PA 1WXAA 1K0TA 4C97A 2Q79A 2V9WA 1K0VA 1J5OA 2RDDA 4FA6A 1I51B 2HVHA 4EI2A 3MAHA 2M3DA 3VVWB 2J8AA 4ZS6A 2GIRA 1ZDVA 1SE3A 4USKA 5JHAA 1OWXA 1OS5A 4CT8A 4LRBA 4MKAA 1EETA 5BMIA 4RUHA 2KG0A 1YI2S 4WJBA 1S77D 2WGSA 1FVQA 1M90T 4PQUA 4LDTB 1JWUD 2NPIA 3N9YC 3HD1A 3GQCA 5CH7B 3RD2A 3KK3A 2JX5A 1C79A 3ZZPA 3KLVA 2RH3A 1TMJA 3Q14C 2QMWA 3TW0A 4RPFA 2OOBB 4O1NA 1OSDA 4EZ6A 1JLGA 1PSDA 2HVIA 3KG4A 3THPA 4WKRA 1KLVA 2HQCA 1JXLA 3EE3A 4JLCA 4DPYA 3N20C 1U1NA 4JI2J 1T0RC 2WDTB 4TV3A 3DOMB 2DNMA 2KN5A 1F0ZA 4KKJA 5BMGA 3W61A 2DX5B 5J1NA 2LGSA 4IKGA 5J2PA 4RBTA 2IA6A 3M8WA 4OZ2A 5MLCV 4NEZA 3RAXA 1S0OA 4M8MA 3FSIA 1R0AA 4DR7F 3PKMA 3ZTOA 1R8PA 4A8OA 2V67A 2KVRA 2F4VF 3JYUA 3HXMA 4TLRA 2MQLA 3E8OA 2ACYA 1D3WA 3BSNA 2BA9A 1PO6A 3HJFA 2AL3A 2BKNA 3N32A 3PHTA 2N3LA 4HPMB 2V4JB 4XZ4A 1LQ9A 1Q8LA 2JFKA 1TL4A 4C8LA 2K0PA 2KDEB 4F4KA 3PHEA 1RAIB 2HHQA 3D4JA 3N5BA 1QVFR 1XWLA 1RACB 1IGDA 3BSOA 3TQ1A 4KY3A 5IQ6A 1J7BA 1KQSR 2ZOFA 1S72S 1NJXA 2VD3A 4GO7X 2O1PA 3OTDA 2R7WA 2UV8G 1EJ7L 3BZQA 2JX2A 3CDAA 1FM0D 1JB0C 1Y10A 3TRGA 4X66J 4ZIVA 4M8NA 3V6JA 2FVQA 2IPKD 3OUYA 1REGX 1LKZA 2MBHA 2WNMA 4I6NB 3M7VA 3W1SC 4NLTA 3CE8A 1QAXA 3Q8SB 3JSVB 2MB0B 3SHQA 2HNZA 1E7PB 4NI2B 4K3BA 2BM1A 2F40A 1XEZA 2CVIA 3M05A 3OJ4B 1NDDA 3AQOA 3OFEA 1WC6A 2O2VB 2QG9B 2XHCA 3C15A 1NEKB 3NHEB 2BJ3A 4DFKA 3NUHB 1BT0A 4C4VA 2C1EB 2UU9J 2CVEA 1TBEA 2R4FA 3GSIA 3K5PA 4DQQA 5EDWA 3B4DA 6FDRA 1R7SA 5A0YA 1NVID 2QLBB 1EB0A 3I57A 1UEUA 5IOIA 3QGIA 4WF9Q 4AD6A 4NEYA 3ENQA 2ASLA 2BJ8A 3R7BB 2IO0B 4ZVPB 1NNDA 4RF1A 4K0KF 1ZOYB 4JQWC 3HHLD 2FLPA 2E7XA 1FPYA 2AWZA 1RT6B 1MMLA 3P4RB 4NLOA 4FULA 1B7YB 2YWWA 3IBCB 4ZDNA 2A5UA 3BGLA 1Q8KA 3B4MA 1D9DA 2J7WA 4RCOA 2ZJDA 4JI5J 3KVFB 1UETA 1XO3A 2WU5B 2GGPA 1FWPA 4FYWB 1NZ8A 2HAFA 5SZTA 4NJ6A 3TUZC 1N0UA 3OG5A 3CD0A 2LEPA 4FBUA 1QM9A 2CJXB 4C11B 2LCWA 3CJSA 4HCNB 3J7A1 4ECTA 2ZKUA 1EWCA 5D0HA 4ZK7M 1PCAA 1UUPA 3RW7A 1F9FA 3KDNA 5KFUA 1QLBB 4WWNA 4A8XC 1MJDA 2ZC3A 2DZJA 2ZBRA 2HHHJ 3W2VB 1NYRA 4LF5F 1RT2A 3X3UA 4PG7A 3K9OB 2KTRA 3GR1A 3TOQA 5DG9A 1ACCA 3D6TB 5T8IA 2QN6B 1N5YA 3I5CA 2LWPA 1C9FA 5HQMA 3OFGA 1WGKA 2XQCA 5CZVA 1UBIA 2G2OA 3RZWC 4FYVB 3PJWA 3MTNB 3AJ2A 1YHQS 4MELA 1UPPA 5D3DA 1RT5B 4IG0B 2L48A 4BWMA 2CPEA 2V3SA 2NZCA 3Q24A 4ZPBA 3V6DA 1PYWD 5HROA 1RABB 1KLMA 2H1YA 2HVEA 4I1TA 4DR1F 2VL1A 4LRCA 1L2NA 3ZXVA 1TS5A 2ZNVB 4MDKE 2V8DA 2J6SA 4MH0E 1KVKA 4EOYA 3DOLB 3RAQA 5IM0A 2ZNVC 1RT4B 1NO8A 4DXLA 2JLGA 1Z2LA 2O5DA 2E1RA 1N8RT 2N9EB 4ED1A 1VRQC 3I63C 2RRNA 3TZXA 4AFFA 3KJVA 2RKIA 5DDOC 4PXEA 3PVLA 4OLPA 4JI1J 1N62A 3LGNA 3QX1A 1NCLA 5DZ6A 3SDLC 3TIXA 2XWXA 4HTJA 5CYMA 4QZVB 1A70A 4O23A 4L3KA 1FEHA 3JTNA 1R27B 2MGZB 1RHJB 1M4VA 2X1GA 3B78A 2BQUA 2ZBQA 1YOVB 1G6JA 4DL4A 1XCTL 5D77A 3TEGA 2DNOA 3JQKA 3L4BC 3TX0A 1DGJA 4GKJJ 1WC3A 4NLVA 3ZVVA 2QMTA 3DI6B 3VR9B 1NDPA 3QCAA 1K73T 2JPHA 1WC1A 2VG7B 4Y00A 5J2NB 2DY9A 2M19A 2FHKA 2XMUA 3MF5A 4AP4C 4I69A 1NK8A 3UVJB 2LUEA 4W9KA 5IT0A 2QSWA 3GZNI 4B6WA 4JI2F 4J9KA 4NX9A 3PPAA 2N4DA 2QRRA 3HVZA 3DCGA 2IC3A 4V19X 2U1AA 1UVMA 4WK1A 2HS3A 2AGPA 2KO3A 1C3TA 1S1TA 4ES1A 3EICA 4FLHA 3IGNA 2YPYA 3OTBA 5KFXA 2LVWA 2KLGA 1U24A 2UXDJ 4NJ7A 3D68A 4OYPA 3QLHA 2LGXA 4HJGE 2GFFA 3FAHA 1HBMA 4I6AA 3P1MA 3DBRI 3AB2B 2C2EA 3PVXA 2QSDA 2YH0A 4ED6A 4B9TA 2WVEA 1RWUA 1ZPSA 3IR7B 5K20B 2KXHA 2XWYA 3CT9A 4IQXA 5HQLA 2ILYA 3VGVA 5ETLA 3W64A 3VTWA 1K8AT 3JSVA 3BGRA 1WWHA 1IJFB 5HI1A 2OPPA 1MMNA 1P1LA 1D3ZA 3CJ8A 2CJ9A 1F9HA 5A6WA 2BACA 3BKTA 4HEA9 1WF2A 1S4EA 3DRRB 1B0PA 1IBLF 1IQTA 1JMTA 4M02A 5C5JA 1K8RB 1WG5A 1UWBA 3P5BP 3OTEA 2Y5PA 4ZVOB 3EGZA 2ABYA 1H72C 2TSSA 1BHNA 3KYLA 5G0RA 1YSJA 3Q23A 2KXJA 3N6NA 1Y5IB 3ITHA 3NVVA 4J3OD 3DNCA 1UVNA 3WQPA 4OYBA 2VG6A 2HHWA 2XK5B 3T5LA 1BUXA 5AXKA 3TAQA 2QO3A 2R61A 2K39A 2ZKTA 2YH1A 4DR2J 3MJ5A 2D3BA 1UCNA 3SV3A 5KFVA 4B17A 2DGUA 3CMQA 1CZPA 3TEWA 4KV2A 1B9RA 3BK1A 4Q2LA 5IWAJ 1LNQA 2JRIB 2K7JA 2DO4A 1WGYA 5AUKA 2DY1A 3M6XA 4FYYB 3KLSX 2W3RA 2KKHA 2HIYA 3UE2A 1C1BB 1UELA 1QVGR 2JEIA 2VB6A 3PYDA 2R7SA 1NHKL 3BGRB 1M5PC 4ERDA 2HZAA 3NZSA 2D3AA 1RHKB 1UJ6A 1VBYA 2IMOA 2AJ1A 3OBIA 2ZZMA 1SIFA 1MLAA 2VQFJ 2EKYA 1Y3KA 2HLUA 3MMBB 1JRPA 1G1XA 2EPIA 3RTVA 4WPAA 2VHGA 3CJRA 3MURP 3EFCA 2GQ2A 2AYOB 3MFGA 4HACB 4OZBA 2F9DA 2QV6A 2Z2MA 4KHRA 2DRDA 2XZWA 4ZOHC 4CQNA 4L76A 4JX1C 4OI0A 3PXGa 2R7RA 3P8BB 3EECA 3OFHA 3JS9A 7FDRA 1AARA 3PEJA 4MKBA 3HHLA 2Y5BB 4A8WA 2MA9B 1Y56A 2CNLB 2C3UA 1GTHA 1WX7A 4X4OA 3NMAA 4TKTA 5IKCM 3EVMA 3M8PA 3KK3B 2UWQA 2A6MA 4DQIA 4XDCA 4ICVA 1Q78A 1RT4A 2RRAA 4PWDB 4HK2A 1ZM4A 5D8HB 2I9SA 3R7SB 3ML9A 4CLLA 4UZCA 3NS5A 4EUVA 1I94J 1CK1A 1J27A 4HHUA 4FHJA 2UXDF 2HRYA 2WXHA 3MM5B 3JQMA 1QZEA 2B4OA 1C1CA 3FRZA 2BTEA 3TZZA 4V1Ak 2GV1A 2MGZA 5KFWA 4Q5VA 1WRDB 2K22A 3EM1A 1M1HA 4PUOB 3W5ZA 2HVZA 1U2FA 3R2IA 1U6FA 3LUYA 3R1LA 1SKRA 4LUBA 3AE9B 1Q5YA 2MQPA 1K9MT 1TGZB 3ABVB 2REXA 4YHHJ 1HBNA 1UAWA 5C25B 1RT1B 1S4FA 3SQGB 1H4RA 1LW0B 3IG1A 3V6EB 2YVCA 3C6TB 2C7NB 1S1VA 1BWEA 1JXEA 2AQ3B 4I64A 3PKYA 5IC4B 4M63A 4X4VA 1ZA1B 3T9ZA 2QLJB 4DQRA 3AE2B 1L5PA 2EELA 1T02A 4OVVA 3R8YA 2FQQB 3PJ9A 2BYFA 3KJQB 1O8BA 3D6HB 4TYAA 2CQ4A 2KDBA 1X4CA 3RNGC 4WWOA 3NRZA 3R5JB 2HZCA 2FB0A 3ZNUA 1GMUA 1AXQA 4Y2IA 1X31C 3Q8CA 1Y7PA 3QYYA 4UTGA 4NLSA 1WUUA 4HVZA 5JXVA 1A7GE 3VR8B 4DG1A 1QOAA 2UUTA 2VFTA 4C0BA 4ID5B 2DIVA 1XMOJ 4IG3B 3WCQA 5AEKB 4JI5F 2Q3PA 4ACFA 2ZHBA 4C8NA 2BS3B 3K17A 1QD1A 2UZAA 4M94A 4JWSC 1SQEA 5DDRC 3K5LA 5A8WA 3B6BA 2M0AA 2D9OA 1Q10A 1HW8A 3BH7B 3D0GE 4ZVTB 4LMZA 4JGHB 5LMUF 1HW9A 5H1SV 1MSWD 2AJFE 2G2ZA 2INCC 3R5DA 2EK6A 5EWFA 2PEAA 3I96A 4DSFA 3BB5A 4BAXA 2CAJA 3JB9k 1X60A 4XIUA 3VTIA 1JLCA 4XC2A 1GNUA 2ZE2B 1YMHE 1EARA 1FRHA 1JIHA 5KG6A 5KFTA 3I9V9 2H5JB 3C6TA 4WK3A 4CTAB 1BY9A 1HNZF 1J5OB 2LMIA 4C7ZA 4ANUA 3CPWR 1RBLA 2H48B 5CD4H 2GJFA 4DBQA 1N88A 2Z2ZA 3PV8A 3PS6A 3GTYX 2INNE 3HP6A 1D0EA 3JSBA 3A3OB 2Z0EB 3PTFC 3CCMS 1IKVB 4DV5J 4C00A 2J0XA 3R66C 1XMQF 5ADZA 3KMQA 3CJ0A 5MPOA 2AEFA 2GAGC 2YKQA 4RM8A 2F9JA 2HGLA 2HG4A 1S49A 4L72B 1LFDA 3NXZA 4RWXA 2V4QA 4M5LA 1T94A 5KFZA 4WTYA 4TQSA 2ASJA 1FTCA 4ZKAA 1C0TB 1E9MA 1TELA 4K4VA 5GAHI 3M62B 1P1AA 4R5PB 3RU0A 1WJNA 4F3QA 1HWKA 4ZP7A 3W2WA 1TUWA 2I5JB 1IQZA 4LRDA 3V81B 5D0GA 2JLFA 1AUDA 4ECYA 1XNRF 1NI2A 1R4NB 2V94A 2KU7A 5K8PA 2MSSA 1X5OA 3AN1A 1DRZA 1OO0B 4MT5A 1VBXA 1LXJA 4PYAA 4ANXA 3PT2B 3NGTA 5I42B 5CXTA 2W2OP 3MM6A 2V3PA 4IM0A 1VQPS 1VYAA 4QU7A 5JXSA 1YQ3B 3D6FB 2C2ZB 1SC4B 4YFUA 3SU8X 1EP4B 1RE1B 3EX7B 1RI7A 2OEDA 5KFYA 4BFRA 5I4MA 1VQKS 2V9KA 3PRPB 4FVMA 1JWMD 3UW1A 5LJ5Y 2JUOA 4QPXA 1ZOTA 4KBIA 4ECUA 3AU4A 5J2NA 5HSPA 2V0NA 5CYJA 4TSSA 2I6WA 1XC9A 3O2IA 2HRUA 3MOJB 3MGJA 2A6OA 1SJED 4PKDB 1XNRJ 3MR7A 1S3SG 4RNHA 2MQ8A 2WVDA 5KT6A 4KZCA 1ZETA 2KG1A 5KFIA 3RR8A 2IM0A 3Q0AA 2FLOA 4B9KA 1TUVA 5D15A 2VZ9A 2PMHA 1VLOA 5A76A 1WG1A 2G0IA 3H5YA 2B5JA 2OPRA 1RTIB 2INDC 3OL9A 3TEHB 2IDEA 4CH7A 4WFBQ 1AN8A 4NI2A 3AJ1A 3R3MA 4ZVHA 2RD5C 2K1FA 1G2EA 2VPYB 3A3NB 5BR8F 3MEEA 2GBRA 4ELTA 3HMJG 1U8WA 3CC7S 2MZQA 3DHWC 2XLKA 1I4GA 3D9BA 2CJKA 3PW4A 3Q3FA 3IS9B 2FHJA 3M8QA 2E6XA 3CCWA 1TL3A 2JL9A 3B1LX 3MM9A 2RMMA 1FI4A 2J9DA 4J5OA 4DL5A 5LJ3Y 1SIJA 1QTNB 4JI3J 3AJDA 2CHWA 2XBPA 5HO4A 1VHIA 2PA3A 1OY9A 1N5TA 4O3OA 2V8GA 3VH3B 3W2VA 3HVDA 1XERA 4N58A 4ARCA 3MUMP 3DRRA 2OUGA 1VJKA 2HD5B 3IBFB 2VFVA 3TA0A 3VAHA 1Q5VA 2ZH8A 2X1AA 3SMZA 1L4DB 4ARIA 1XR7A 3S01A 1EAYC 4PYZA 4AT1B 4FZVA 3T1YF 3EZOA 2RDBC 2IO1B 4K7WA 5I3UB 1UEVA 2KL8A 1VQ9S 1PJ6A 4B3OB 1N36F 1Q1KA 2GIFA 2RQ4A 3QT8A 3ELHA 2NBVB 1Y8RC 4IR9A 4ITKA 1JKHA 1GOZA 1QE1B 4I7FB 4ZLJA 1HBOA 2H65B 1KDNA 2A10A 1NUEA 1D4BA 4KGMA 2J52A 4E8UA 1JJHA 2YWEA 2JYTA 2XM3A 5DLFA 4JV5F 2GLSA 2RGFA 1NK9A 4LF6F 1ZUD2 1U26A 1E8ZA 2A1BA 1B0VA 1GC6A 3KW5B 1CJVB 1T11A 4LCDE 3IR5B 2WXIA 4F7VA 4HPPA 1C0UB 2ZM6F 4CLSA 1SC6A 4Q2JA 3I0SB 5KHQA 4P2SA 3GJTB 2H51B 1VQ6S 5GAEI 4W9GA 3N6MA 3K89A 1HR0J 3CF5Q 3U1MA 1KC8T 1PYOB 1V6HA 2YNGA 3BO3A 3DM2A 3FC4A 2OJ3A 3UCZP 2J0KA 3CD6S 4ETXA 1X9WA 1N36J 3I87A 3S2AA 1D9FA 5D0EA 4X65J 2CPJA 3DLGB 2ZEQA 2I2YA 1URRA 3SFUA 4NPOA 1DOXA 3CVKA 1RWWB 4IRCA 3Q8QB 4A3PA 4DR6J 3CTRA 4NLDA 3UR3C 3SR6A 1HQRD 5GAHU 3SXLA 3NOBA 4LF7F 2LECA 1PUTA 2JJ4D 4ZHRA 2XCAA 2WXPA 3OR1A 4RX6A 3DRSA 3PSEB 3Q8BA 3B8HA 3M8SA 2FIFA 3CULA 2HNDA 4FPIA 3AOBA 2MBBB 4P73A 4LF6J 1WXVA 2RDIA 1Q8BA 2MBOA 1WDDA 2AD9A 3IXSA 5KFOA 5LMNJ 4M1KA 2MP2B 3IA0A 3I55S 2FC8A 4U8VA 4OMFG 3ZJUA 2FDNA 2YLMA 2ZW0A 2OPSA 2C2NA 3T41A 1XXGA 1WEZA 1F6TA 3NLCA 2UUCF 3IAM1 2B6AA 1Y00A 2M0XA 1SJFA 2AJ2A 1QOBA 4IFVB 1QAJA 1WM3A 4FHKA 1TKZB 3VAGA 5IA7A 3SZ2A 3DI6A 4LFAJ 1TS4A 4HACA 4TXSA 3GJSB 2JZPA 4NASA 2BBCA 3MPDA 1CJVA 2FJAB 3GB0A 4RKUC 1GMVA 2J7UA 1E0ZA 1FO4A 3HT3A 4F26A 1F1HA 3KLIB 2J6TA 4H54A 3OHAA 1YK9A 1EU4A 1N52B 1X4FA 2F3JA 2QTWA 5CYQA 2BB5A 1PC4A 2IPOB 2BJ1A 1IBKJ 2P9EA 3DWMA 1MHHE 3AOAA 1XT9B 4US8A 4NCGB 2BT6A 2YQ0A 3JQJA 4X57B 3AE7B 3ZRFA 4RW9B 4XWWA 2L83A 2CNKB 1FMAD 1NSAA 1NSQA 4PWWA 4FJVB 1WE7A 5L95C 4OX7A 3DBLB 1M0SA 3CCLS 3DRSB 3FJ2A 2G4BA 2RT3A 1RKJA 2MCNB 3L08A 3RMKC 2QA2A 2KFNA 4LLGM 1HARA 4YXDB 4KKIA 4DHVA 3HDSA 3VRAB 2BYTA 5FIIA 3VGUA 3A1QA 3CCVS 1FE4A 2CJQA 2M1MA 3MD3A 2DNFA 1OIAA 3DCAA 4OZ1A 1KJTA 2CJYB 2O67A 4PZVA 5AZHA 3TA2A 2BEFA 1SJHD 3U4EG 1W7WA 4CNZA 4DV4J 4NAWB 1S0NA 2DB1A 3FCWA 2BW2A 2L9NA 2AZ1A 3FEYB 4ICUA 1LGRA 4EU0A 3P96A 1T0YA 2YNFB 3PGEA 1SL1A 1K52A 4LNKA 1IKXA 2Q5WD 1WSRA 1B0TA 4ILMA 1NPRA 4NE9C 3SYZA 1WJUA 4E3CA 1TL3B 1SBBB 3JYTB 2BS2B 3WBZA 2W7OA 1FFWB 3IWNC 5ETRA 4NYOA 3QARA 3MEGA 2CU3A 3GWCA 4P1BC 2BOPA 3GZNB 3JTPA 1U0SA 2RS8A 2ZVNA 1IYFA 4C0HA 1PQSA 1EWYC 4KAIA 1L3KA 4GGQA 3AD9C 3FK4A 3LWMA 4YB5A 2U2FA 4XYCA 3KG1A 4NXMF 3CMMB 4Z2XA 3W9CB 3QWPA 3MMBA 3BK2A 1OYEA 5C2CA 2B76B 2RD0A 2IRXA 2LKZA 1KN6A 4JI3F 3D0HE 4LF5J 5LLIA 1X5PA 2GHWA 1F5CA 2DH8A 4B3MJ 3E9SA 4LF7J 5HVHA 4DV5F 2FJEB 3HK0A 1BQNA 1SF0A 4AL5A 3N0VA 3TP2A 3T3FA 1FHTA 4DFJA 2B7CB 4L1BA 1PFDA 3A1QB 4G1QA 3VF0B 1DOYA 1HWJA 4ASWC 1S7IA 3LTOA 4RW6A 3LDZE 1H98A 3APCA 3CWJA 1VK8A 1U09A 1J7AA 2R7UA 2KVIA 3KYDD 5CQGA 2KM8C 5CZXA 1RTJA 2NXEA 2QSFA 4F4ZA 3GG1A 5C42A 1HKAA 6FD1A 5F8HA 3PZPA 2B7BB 3VTVA 1WSVA 4NAWA 1R31A 4U6PA 5DPWA 2J0QD 5G55A 2CG4A 5D4PA 3MC8A 3IT4B 3DMJB 3DOKB 2VQEJ 2H5IB 3QT7A 3IRWP 3A9KB 2OGUA 4QQBA 2OJWA 3UI3A 2LD9A 2HJ8A 1RLFA 2LXFA 2YWGA 1RAJA 1WNEA 4RR5A 2WW8A 4MM3A 3EHVA 1YG0A 3R9LA 1MN7A 3W5VB 3VVTA 4CLFA 4IOBA 4HHHA 3LANA 2MX2A 3OVSA 2YNGB 3BYRA 4P74A 1STEA 3BJYA 5KTQA 1KQKA 5CCLA 5CHWA 1JMLA 2MQOA 5E2QA 3UQBA 5KFNA 2FVRA 2HHTA 3EUB2 3ZTCA 3UINB 2BX6A 4CLYA 3GJRB 2INPE 1RAOA 4P1CC 3Q69A 3IG1B 1FCLA 2KOXA 1NZAA 2QJ3A 4WIPA 5EX0A 4X62J 4K3CA 2DZIA 2KVZA 4HI2A 1IXKA 5D7GA 4LSNA 3DGPA 4DCOB 3LAMA 4W9EA 3ZRCA 3HKZD 4EZJA 2WAQD 3VZIA 1H6KX 1RHRB 1FNMA 3NG0A 1XNQF 4QIEA 2QMUB 2OPQA 2KHCA 4MIWA 2LEBA 4LF9J 2FZKB 3OR2A 4UQTA 1WYWB 1JLBB 2CPIA 3FKYA 5KFRA 2N7CA 4ED4A 2O6VA 1QY7A 1OFFA 2HE7A 3KHGA 2PIAA 4EE2A 3ZDMC 1S1WA 3RYLA 4A48A 3KOAA 3G8QA 3NVWA 1RBOB 3K2YA 1HBNB 1U2CA 3AH6A 4E71A 3PW5A 3ZYYX 4DMZA 4J37A 1N56A 1RWVB 2NBUA 1J5EF 4ER8A 2MH7A 1UTAA 1IR0A 1RWKB 1ZP0B 2B9XA 3DRPB 4LIWA 3FMWA 2R2OA 2GBKA 4WFYA 4LFAF 5A8KB 3Q2AC 4LJPB 4GLSC 5RUBA 2MPUA 2MQMA 4H4KC 3IHPC 4FF3A 2MKHA 1WKJA 4OYMA 1NJIT 4NPNA 1CEZA 1LEOA 1VZ7A 1JLCB 4L6V3 4WAFA 3U27A 4FNHA 3R2TA 2L1AA 4REZA 1HNXF 1GX5A 1RK8A 3MTKA 4XE0A 1MN9A 2M4NA 4WFNQ 1NDLA 2CKHB 1U02A 2R9LA 3RCZA 1HWLA 4WZQA 4KO0A 3K59A 2BZ2A 4NZ0A 1IBLJ 2GO9A 2UXCJ 4DL7A 1VQOS 5DRKA 2VDIA 5MAOA 3PZ7A 4RNFA 4H4MB 1RXOB 1UKUA 4YR2A 3BGFA 2AL6A 3MM9B 2WWZA 3N5FA 4LRFA 2W24A 2Z0DB 5G5GA 1AZSB 2QZ8A 3AODA 2ON8A 2P2CB 4B02A 2JOQA 2XGQA 3BO4A 4PR6A 4CYUA 3NGDA 3CD5A 3MJWA 4O3PA 1SJQA 3TAPA 1R7IA 2JSXA 1YITS 3LW5C 4K4WA 1U7LA 1SV5B 3K57A 3I31A 3GG0A 3TJPA 1TK5A 4IUFA 4QBUA 2G0CA 1DURA 5KOWA 2PA8D 2F4FA 2MHNA 3ZKJC 2DZKA 5CHFA 2QE5A 2O2VA 3R6LB 3TSSA 3CIZA 3NWGA 1AT1B 2Q43A 3VGSA 2ZM6J 1N32F 1LK7A 3VTUA 2DR6A 3OTOF 2KZRA 3C8YA 1DY3A 4CO2A 1VGYA 2WTFA 5A0YB 3LWLA 4Q43A 2PIIA 4ES2A 1S6QA 4I56A 2KDOA 5HVGA 1ZXIA 2ZE2A 1FFVA 1H73A 1V5TA 3I9V1 3GP9A 1Z5SB 2WDRB 1DTTB 1TT5B 3MC9A 2DAFA 4CLUA 3D28A 2CDQA 2V2KA 2MKCA 3TJ9A 3W5YA 2W3SA 3GPAA 3LALA 3U30A 3G87A 3HLUA 5D2MB 2ICIA 1J8CA 1QUPA 3PCOB 4R5PA 2ZUGA 1R8CA 2VOPA 1YZ7A 2L3ZA 4DFMA 4U7CA 4OYZA 1B4SA 1EKRA 3PW2A 1LV5A 2B51A 3CDWA 1VRTA 1GMWD 2OIHA 1B99A 4DJBA 3P42A 2AEJA 3WDOA 3HM9A 4K2XA 3FRYA 3R1HA 1SL0A 2GMJA 1VFJA 1LWCB 2WB4A 4FKYA 2LRUA 4OHJA 3BDPA 2UVWA 2UV8A 2LGDA 1NJZA 2WOMB 1WF0A 4HHJA 2IRUA 1UEKA 2VDHA 3R7RA 3FBEA 3H5SA 2PO4A 3MAQA 3QATA 4TU8A 2BWES 1IP9A 2FHMA 4Z37A 1VIXA 4P75A 5ETPA 1L5UA 1XLOA 1CQMA 1FXAA 1SEBD 4NLWA 5DJBA 1UW4A 3AOCA 4LF8F 2J9CA 1NMEB 3VVUA 1ZH5A 4DR6F 3BN7A 4QR1A 1YBAA 3LP0B 5GVQA 2EI5A 2PJHA 5F0WA 5JJBA 2QC8A 5E6NA 2HKEA 4XPEA 2L05A 1VD2A 3OXFA 2KXFA 2KHDA 4DUZF 3BQ0A 2AF6A 2DEJA 1GXTA 4ILRA 1NDCA 2IY5B 2ZZTA 4BKGA 4IR1A 3C14A 2K25A 2GQCA 2M8HA 3LF0A 3H25A 2FTRA 3AE4B 1SC3B 4XO0A 4KH1B 3SI8A 2PVGC 2GVZB 4B3SF 2J53A 2XEWA 4NRTA 1ACMB 4P52A 4IUMB 2DRAA 3A4RA 4PG6A 3QRPA 5F41A 2ZD1A 1RRBA 4CI0B 2B4PA 3T1HJ 2RE1A 1GEHA 2E1MC 2FC9A 3CJ3A 4K0KJ 5LNK1 4KHPJ 2MZ1A 3UR0A 5GADU 2IYGA 4GOCA 5E7OB 1U1LA 5F8NA 3H40A 3DHHC 3DLEB 2Z58B 3GJQB 2Y0SD 3RB4A 2JNJA 5T14A 4B3RJ 3H90A 2R2UA 1YTYA 3RNCC 3WALA 2IJRA 5E6JA 1VC5A 3DRPA 4P6QA 1X4DA 2BJ9A 3L13A 4IWQA 5J2MA 2HGMA 3NNHA 1N0VC 1FEEA 2EXUA 4K7QA 5D3GA 3T8MA 2DGVA 4ZVFA 2CQIA 4AQYF 2W9BA 1GXUA 4YR3A 2Z2YB 2ZH4A 1P3QU 4F8CB 3DHXA 2IBOA 3LPYA 2KACA 2V4JA 1FDDA 1LO5D 4OI4A 3IC1A 1JWSD 2XN9C 2V63A 3VZHA 5HHDG 3D67A 4ZVSB 3LQVA 4PEOA 1D5ZC 1WXQA 1WIAA 1VHFA 2JC0A 3W7BA 1DJ0A 4FNIA 3VRBB 4QWAA 2W8KA 2BDPA 1DHMA 4EO8A 2AX0A 1B3TA 4FVCA 2MKYA 5JVHQ 2IO3B 4F2SA 4P10A 2EK1A 4EKUA 1HBMB 1S9EB 3MUTP 4UF4A 3ETRA 4RWWA 2DNZA 2QEXS 3QAUA 1TY2A 1FRJA 2FYXA 5DQIA 4AJYB 2C22A 2FLNA 2PE9A 1FD2A 4H4KA 5AXLA 2E9ZA 1YNTE 1CC8A 3CB4A 4BOZB 4FXVA 2VFUA 2BWFA 5H92C 4RGTA 4ZPAA 3RT3B 2QEJC 3PO5A 2DNRA 3M6UA 1L3TA 1RT7B 1UJ5A 1TK8A 4EZKA 1GQEA 5K14B 3KUZA 3K58A 1VZ6A 1RWOB 1NB2A 2YKAA 3SV4A 2C2RA 1I35A 5AE2A 2GA7A 2HLTA 2G4SA 5KFFA 3Q2TC 2LA6A 4K4TA 4YTNB 1RHUB 4AUQC 1U45A 5D3IB 5C24A 1YJRA 2KFKA 4UOFA 4YB6A 4EWTA 1FVSA 3HK2A 2MP2A 4B3MF 3AH7A 2KTRB 4FPRA 4KRWA 3ENAA 2UUCJ 2L00B 4G3IA 3HFVA 1RCOB 2LXUA 2E1PA 2NXNA 1N5YB 3DOLA 3H6NA 1RCXB 1LOUA 4RFBA 1RU2A 3MUVP 2LDIA 3OXGA 1RAGB 4IH7A 1JJ2R 3ONSA 1FRRA 4ZHRB 4UZBA 2WW4A 2LGYA 4UUXA 2BM0A 2Z8QA 1FRKA 4HCPB 2D1CA 3V4IB 3J7YU 1WKLA 4KT0C 1KNZA 5J17A 3CGIA 4DSIA 4ZRJA 2PD1A 1PDXA 2W54A 3PFOA 1L4ZB 3Q3MC 3H2VE 5DQHA 1PG5B 2OPSB 5HATA 1LXNA 4DX8H 5U47A 4ZPDA 4MGZE 1TKTB 4MGKE 2Q6BA 3US5A 2C28A 4HWIB 2KMMA 4OLOA 2D3GA 4PG8A 2WDQB 2LA4A 3C0RB 1RWXB 1MNEA 2H4YB 1R6YA 1V5OA 5H9FJ 4NCGA 2JC1A 3OFFA 4OJGA 1BD6A 4KVGB 2RDHA 4CM2A 5KOXA 2YKOA 2MHJA 1E6VB 5HMXA 2C9WB 2OEKA 1PBAA 3DLKA 3HRDD 4C98A 3PLUA 4GSWA 1RT5A 5LM7E 1HIYA 4ZCMA 1FDAA 1BGXT 3MPYA 2BKOA 1UVIA 5IT9U 3DGVA 2OH2A 4MT1A 3O65B 1U1KA 1NKCA 5SUHA 1T0QC 2DD8S 3GIKA 2V3NA 3D2WA 4M5KA 4IDKA 2H88B 2AYEA 1J2VA 3A8EA 2BW7A 4DR3F 1HQUA 4FS1A 1YJ1A 4G1IA 1WWTA 1FRDA 2RB7A 3HHMA 1PGBA 4LNIA 3V61A 1VOMA 4J9MA 1ZE3D 4KDIC 5D6GA 1N5XA 5GADI 3KNGA 2JFDA 3LAKA 2B8PA 4S0MA 3V4IA 4P6VF 4L75A 3PHWB 2RSUA 2E5JA 4RZRA 2QFJA 5GAEU 4URQU 3NZUA 3U52E 3MM5A 4MMOA 5G2NA 4ZN3A 2WSCC 2IJNA 4IYQA 4OW0A 4O3NA 4X64F 2CQPA 3FC9A 1ZDXA 1CJUA 2DHZA 3BF4A 2PFDA 3L7OA 4LNOA 3DYAB 1M5OC 4ZDVA 1VK3A 3DDIA 1JWBD 2C2DA 4BZAA 1F5BA 2JZ5A 1KRHA 2HHHF 1OSCA 4ZJLA 2H54B 3V62A 4AE5A 2VOOA 4IOIE 4DS5A 3K0JA 2WXKA 4GVBA 3DOKA 1OQRA 3R97A 2CKWA 2RVJA 4ENOA 3MFHA 1N48A 1KTKA 3H59A 5ETOA 2FGOA 1WX8A 1JLFA 1RFKA 5J2MB 4MH8A 4ANCA 1MPEA 1YJWS 3AE3B 2DNYA 3FQKA 2WBMA 2XSJB 4YDDB 2FUG1 4Q45A 3LXFA 1URNA 1FF2A 5DDPC 2GHPA 2LQ9A 5GAGI 3PM9A 1H0HB 4HKQA 1YJVA 1YJJA 4ZVGA 2ONQA 3AM9A 2DR5A 5HLFA 3TVZA 2NPTB 2WXJA 2LQBA 5IV4A 4IC7B 1MVKA 3E01B 4K4XA 2L9WA 3GIRA 3WAPA 1D5MC 2K3IA 2ZPNA 3RUIB 1RTJB 4YQWA 4I0WA 4O4GA 1AROP 1DTQB 3G82A 1SXLA 1OY8A 2BABA 4TU9A 2VPZB 2WXMA 4EFOA 1FXDA 5CHVC 1N63A 4YSYB 3C46A 3I6PA 4X4UA 2GMLA 2ZOGA 2R8GA 2CQ2A 1O0PA 2F65A 1JLEB 3IAS9 3DMJA 1YQBA 3QO9A 1UWXA 2CNOB 3SEBA 3O8WA 5BXIA 2QLWA 3LP1A 2YWHA 1I94F 3F56A 2RJZA 2OSRA 3QRRA 2I1JA 4IRKA 5EX3A 3SFGA 4E74A 3QAQA 4IWOA 2ZEJA 1L0YB 2FCSA 3BM7A 3D54A 1UVKA 1C1BA 5DETA 4DX6A 5E6OA 3IBEA 4ZRQA 3R27A 2NREA 3A8IA 4ZA1A 1HHSA 5C24B 3WHIA 4DHJD 4F1SA 2V9HA 4HRSA 2W2NP 1TTHB 3DVGX 5GMEA 4FN2A 3GLJA 3R7NB 3VQSA 2C2OB 3M1VA 4QJVA 1S57A 3OR2B 2Y1LB 5D78A 1F9EB 1WKKA 1S10A 1C0TA 3VUXA 2AJQA 1X4GA 3R8BA 2BJ7A 3TL5A 3P5TL 1FKPB 1FX2A 3NCQA 3I5JC 3MHZA 4B9SA 4B9MA 3NRBA 1GK8A 2NBWB 3APFA 1Z1ZA 4L73A 5KT2A 3NCRA 1KRPA 4JI6F 1FWLA 1FERA 4LSNB 2I5JA 1N61A 3C14B 4F25A 3FSYA 1NB7A 2V2QA 1EQ0A 5FD1A 1ZM9A 4IFYA 1RHMB 5KFBA 5F3TA 4PG4A 4BOSC 4DPOA 4K7UA 2WXGA 3MM6B 1SH3A 1HA1A 2MLXA 4MGYE 4W98A 3V2UC 4MK7A 1XLPA 2KTFA 1REVB 1AFIA 3RB3A 4BWJA 2J5AA 1D9AA 1YRTA 3AULA 2Z4PA 3PLVA 4DU8A 4I2QA 4CYEA 3AT1B 2RF2A 3RNEC 2NR2A 5DO2A 3A4SC 4AYBD 2HBZB 2KHWB 2ADBA 2XYHB 3MPWA 2QJLA 3DLKB 3LP2A 3OL7A 2DKOB 1D8ZA 3Q8AA 1GPXA 2KB2A 4EBCA 3VXWA 3NGRA 1P27B 5E41A 1WACA 1IWGA 1YJ7A 1HYSA 2ASQA 4K81A 3PJXA 4HLBA 3P4PB 4YN3B 4KGSA 3ZTDA 1LQBA 4HTIA 4HEA1 1U1OA 2SAKA 3EC8A 5HAOA 3ML8A 2DJWA 4ZHPA 1SXTA 3PZDA 1LWEA 3PX6A 1U0HA 1NSPA 3C3LA 2C2MB 2XG8A 2KJ6A 1OY6A 3IAM9 4NXNJ 2WS3B 5E3RA 2IHR1 4WKYA 1TL7A 1U4AA 3PEHA 4O3SA 1WOSA 4PXCA 1PKUA 2YEPF 3KKFA 1IBMJ 4C0OC 3ZNJ1 3MCOA 4W9CA 2X3DA 3U2SC 1N5SA 2QLXA 3MTJA 1BQMB 1VJWA 2E66A 2AHOB 1WTFA 4XX5A 4IM2A 2DGXA 2WSEC 3M2RA 2K8CA 2MLZA 4USTA 5G4DA 5KFLA 3KJFB 5BYRA 4ECVA 4IG7B 2HQIA 3QQ8B 4ANDA 2WRMA 1DTTA 2PC6A 4OV1A 3VUWA 2WXFA 3AFGA 2C3MA 3EZUA 5J1PA 3P4QB 2P5VA 5GAGU 4ECWA 1UWBB 4KC5A 4PG5A 2V4IB 2KQSA 1NKEA 4IO9Q 5LSOA 2HYIB 2OAUA 4F4WA 2DGTA 2MKIA 3LP2B 4C6AA 2KWVB 1XEEA 4DX7A 2FJVA 3SD5A 2HWHA 4NA2A 1JLFB 1ZAVA 4DBGA 3MHYA 2GZOA 1R89A 2JWUA 1SJRA 3QIPA 4WXWA 1X4HA 2NPFA 3FEXB 4P72A 3ZW3A 1YWXA 4F4YA 4A46A 3EUNA 3L09A 2NLWA 1YIWA 4KGZB 1PYSB 4DI6A 2M70A 1Y5NB 4OHYA 4IWPA 4MACA 4BDPA 3L7PA 4NA3A 4GDKB 2HK2A 2YKNB 3NGUA 4QCLA 3QA8A 5C3JB 3MR2A 4IQMA 1M1KT 2GAHC 2D07B 3D32A 1PAEX 5DG8A 1M5KC 1S79A 5E0OA 3AEAB 4UQGA 4UY8T 2OO4A 2N1VA 3CJ4A 4TQ0A 4OYOA 1Q82T 3ZQ4A 1RFAA 4LBHA 3POTA 3UDCA 3MZIA 2HSEB 2ZJQQ 3FQLA 3HFKA 4KV8B 3N1YC 5B09A 3RRGA 2BRLA 4HR2A 2IM3A 1BE4A 3MMJA 4GDLA 2EKIA 1GAQB 3VH4B 1YX2A 4EEYA 2A4ZA 2QGFB 3BKUA 2IMWP 4ZJQA 2HHPA 1RJJA 1MU2A 1YBTA 3TO8A 1T9VA 5GMDA 2VBZA 4QYRA 2ATLA 5IT9Y 5AE1A 1I42A 3IRXB 1T0TV 2BQ3A 5DG7A 1K53A 3I3TB 4F67A 3NJTA 1TKGA 4QWEA 1MROA 3UPFA 2EC0A 2AMCB 4R25A 3P4SB 3TARA 4C3LA 4RUAA 1KLGD 5KAKA 4I68A 2X7IA 1HD0A 1FXLA 2KI2A 4DS4A 3ISNC 3QSYB 4F4AA 4OZJA 5CAAA 4JI4J 3OL6A 1KD1T 2HDEA 3IWLA 4MTPA 3GMGA 1ZTWA 2AGOA 2G4DB 1NKBA 4YDXA 4DPXA 2OPRB 2MKKA 2IGDA 1HQ2A 3OXLA 1W26A 4ZCIA 1WJ4A 1WHWA 3AE6B 1U1RA 4P16A 2N7DA 1JROA 4PQUB 4CO7A 4USIA 3KK1A 4KH0B 2V34A 3M3JA 3ET6B 4DV4F 1C1CB 4DFPA 3DN9A 1RISA 4HROA 2OTJS 3KLFA 4TY8B 1F3FA 2CQGA 1EF1A 3CC4S 1KTQA 1S99A 4QIFA 4WTOB 1UGMA 5IQQA 1QDUB 1S9GB 3TANA 4CIOA 3TZYA 1RTIA 4MJSA 3DYAA 4BCAA 1K44A 3DBHI 3D5MA 1R4MI 3F73A 2WK4A 3WA0A 3S8SA 4QW9A 5LT5A 4JE3B 2W25A 4KSLC 3MEEB 2JZZA 1ZZFA 4RF0A 1YVFA 2JT4B 4O44B 2FLLA 4FXCA 3UN5A 4JI1F 3LOUA 4QWCA 4KIAA 4DF8A 1PGAA 4KSEB 4WJOA 4QU6A 1SE2A 2WVCA 1CJKA 3EA6A 1WF9A 2JF5A 5KFAA 1VR9A 4GO5X 1GAOA 3PYFA 2XK5A 1KTVA 3M95A 1Y5LB 3B54A 4KJIA 4PS7A 2QLFB 3PACA 4J9VA 2CHXA 2CFXA 4YTMB 3P6YC 2HJ1A 1FRXA 1U6ZA 2F5GA 3RRKA 3U7ZA 2RQCA 1U0HB 1YGYA 1ZA2B 4YMEA 4C2MA 4NLPA 4I7FA 1V81A 2AJ0A 3CSFA 2M52A 1ISNA 3NKYA 4C8ZA 1NAQA 3LPEA 1R8AA 4J9OA 4A90A 4W9JA 1S9EA 4B0EA 3EGWB 1Z2ZA 8RUCA 4DR4F 3W66A 1PJ7A 1U48A 2R7OA 2PT0A 2CA9A 2CQCA 1XIQA 4W92B 5E3QA 2WXNA 2XSJA 4LFBJ 2ALZA 1V9JA 2ACZB 3Q6BA 4J9PA 4OI1A 2DWQA 3PO0A 1HTOA 1K50A 1PYTA 2UUBJ 2IAJB 3L16A 1SJ4P 4P7VA 6AT1B 4DPTA 3B82A 3EGRA 3NZ3A 4FXDA 1TP7A 4UY85 4U96A 4TU7A 4DL3A 1FNXH 5M2PA 3X23A 1UZXB 1QAYA 1SBRA 2C7MB 5HVFA 4M95A 2KMAA 1RA7A 2RUSA 2KYZA 1CC7A 4YP3A 3O6QA 3K8VA 3BN4A 3ISZA 3QWZB 2ZNZA 1GG3A 4NJCA 2H89B 3Q8PB 4ECXA 3DRXA 2G1HA 2HNDB 1M5VC 2RU3A 3ECIA 2A0FB 3H0PA 1H3DA 4O4GB 2EFVA 3W1SA 2B3AA 1WOPA 3W62A 5THWA 3M8PB 1EHWA 3W5XA 2W4DA 1U8SA 2KFZA 1DYQA 1QOFA 3OHBA 3AV8A 2VBWA 5FDLB 4F36A 4LFCJ 2IZVB 1AW7A 2FNJB 4TLQA 2K1RA 2Y8WA 5IV3A 2YKNA 1JLEA 1RTHB 5I4DA 4P7TA 3PR5B 5HG2A 5KFGA 1GC7A 1CQVA 3QT6A 3KK2B 1X1MA 3SCLE 2V0GA 4DV2F 3SSQA 4HXDA 2F8EX 1MWZA 2JSVX 3DWGC 3V3XA 3JSYA 5A6PA 3GE8C 2W9CA 5CD4A 1NK0A 2EKEC 1M94A 1P9DU 5IC6B 2MJDA 1OQQA 2JXXA 4C8OA 2YNIB 4ANVA 1AYEA 4Z7CA 1C2PA 4NLYA 1L6UA 5CYQB 2BR0A 3M8ZA 4IKAA 4J91A 4GDLB 2WXLA 3TCAA 2YKMB 4JI8J 2BUNA 2ZHAA 1F0XA 4NLXA 2JVRA 2VIHA 4KGRA 2MJ3A 1WE6A 1B64A 3GIIA 3IVFA 4WWMA 2IJ0A 4DXAB 2B9EA 4IW0A 1HBUB 2O01C 4GMVA 3NEKA 5TR5A 4BKSD 2LVQA 2D3CA 2ZCBA 3KJNB 2VBYA 2JYEA 2R7VA 4HVBA 3PX0A 4X2BA 4LTUA 3Q86A 3UQAA 1GTEA 3VAJA 2ZH3A 2CDRB 3MM7A 3W1YC 1DQ8A 3IR6B 4K7SA 2Z2LA 1GMWA 4CO1A 1YN5A 3EFUA 2J42A 2ZVSA 3FMBA 3EMTA 4DX5A 4PS8A 2DRBA 2CPZA 3GSDA 1SB3C 4JI8F 4OZAA 2M2BA 3CXCR 2O3DA 1J0GA 3BR8A 2NMQA 4GVBB 4WWSA 2L0TA 3E01A 1SE9A 5HANA 5A8WB 3ZLZA 2FJDB 4J9QA 1CULB 4P9SA 5HP1B 3A12A 3BQ2A 3OQ2A 4LR9A 4JBCA 2V8VA 3MWBA 3CSKA 2BQQA 1FJGJ 3MEGB 1YRXA 2KT5A 3Q89A 2BQRA 2HQ3A 1T3QA 3WANA 2LVPA 4S0RA 1YN4A 3Q83A 1NH8A 2DHAA 3SIPB 2ZH1A 2IYIA 4PK1A 4BKSA 3T9NA 3RI7C 3PNIA 2ROEA 4DEZA 1IKXB 3GIJA 1X9SA 1XLQA 2LGIA 4O44A 3C66A 3VUYA 4C4VB 3NAHA 4G1PA 1TKEA 3O13A 4DL2A 2DGOA 3IXQA 2BE2B 2LEKA 4EFAC 2M56B 2ZOMA 4P7IA 4KSKC 2DCUB 1NRKA 2WHIA 4RBUA 2GB1A 1EKSA 2CQ3A 2N82B 2MWSB 3J7AN 2WXOA 4OX9J 4YL8A 4R8UA 4JI0J 2E1AA 2XNRA 1TMMA 4N6EB 1I5OB 4CP5A 1SJ3P 4X66F 3HZGA 2KJWA 3M32A 4K5RA 1HQEA 1WZ0A 5FJ4A 4YSXB 2QL7B 1I7HA 3EWGA 2N0SB 4W90B 1FKPA 3WIVA 2NPTA 1HPZA 1FXIA 2C7HA 2CNNB 1HXYD 4GXBA 3BBCA 1EETB 3CMES 5HJXA 2WVBA 1CJEA 1PGXA 4NMXA 4F02A 3TVKA 3GFZA 5I42A 1WOOA 2VH7A 3D7SB 1S6PB 4J7CA 5A2QY 4RGOS 2IGGA 2MY8A 2EBEA 3FZBA 3POTB 2J6UA 1WEYA 2VODA 2V2VA 2BMBA 3WX4A 2KC1A 4O0IA 4Y28C 2ASYA 2M88A 3QO9B 2OHFA 4ES3A 5L8RC 1YQHA 3S1TA 2VASA 3KWMA 4JL9A 1APSA 5EE1A 3JAMY 1UWMA 1ZZNA 1AW0A 3L10B 2A18A 1GXLA 5AXMA 1JJCB 4H2AA 4JI6J 4QIGA 4II3B 1TVRB 9RUBA 2CZ4A 4LJMA 1RQ0A 1PAUB 2MSTA 3N28A 4KPCA 2KN4A 2IBIB 4C11A 2WXQA 2MMYA 4QR2A 3UWTA 5J2PB 1S1QB 2UP1A 5KFDA 2LQ8A 2FAZA 4R8UB 2C3PA 2BYVE 3H7SA 3ISND 2EKNA 4M0WA 3DDKA 5JUMA 5H9EK 5JHBA 1RYSA 3G8SA 4FBJB 1REVA 3HSGA 2BJDA 4IFVA 4MKYA 3CJ5A 3GZ7A 2EFPA 1QTMA 1W25A 1YD8U 1S6OA 2IVMA 2ASDA 2RKIB 3AI5A 2IRYA 4URGA 1TL7B 2VF3A 2XYGB 1T95A 2DH7A 2W4PA 5IZHA 4DDGD 1N33F 2W9CB 2DNGA 2JY6A 3KLIA 2YVSA 2DXDA 4PPZA 5GMKa 2DR8A 2V50A 1U25A 4ED5A 2EC2A 5C23A 1TK0A 2X1FA 2XB2D 1XMOF 2GBMA 4WJNA 2DHSA 2BJEA 4DLEA 3I56S 2FY1A 5AXNA 5J2QA 3X0WA 1WF1A 2ZVOA 2GIQA 2DBBA 2MQJA 4KGVB 3N1XC 2HFOA 4MJSB 5B0GA 4NLQA 2XLIA 1QSSA 4WFZA 2LVOA 2X3GA 4ZPVR 3ZTPA 2DISA 5D0RA 2BE7D 5CTRC 5LOQA 4C80A 4A4JA 1V1PB 2DBYA 4WYLA 3MM8B 1DARA 4G0NB 4LF4J 4BVUC 4FXWA 3U7JA 4C7QA 2NS5A 5L9XA 1IKWA 3GFYA 3FVYA 3QFWA 3MMAA 4USWA 4PS3A 4HDHA 1WTBA 4N8OA 5KFCA 1BQMA 4B3OA 3ZZYA 2GBNA 3QIJA 3Q8VA 2Z59B 3TVYA 2L52A 1FA0A 1ZW7A 4Y2KA 4U9RA 4FF4A 1ZTTA 4DQSA 5L1LA 3MD1A 2JEGA 1S9FA 1LWFB 2R3VA 4A8QA 3AMZA 2XO6A 3ZGZA 1HR0F 3THTA 4GC7A 4HKZE 1TFYA 2G13A 1KFSA 1WD6A 4Q44A 5FR6A 2B9YA 3PO4A 1UH6A 4BC7A 1T6BX 2BKRB 3NWRA 2KWUB 1XN9A 2MYFA 4LNNA 2N9PC 3UF8A 1FD8A 1WR6E 2QA4S 3NS7B 4DXGA 4LF4F 2K3KA 4NYPA 3C6UA 1L3UA 1C0UA 2CJOA 3M6WA 2MJNA 1RAEB 3UCUP 5EWGA 4QR0A 2KLCA 2X51A 2GJIA 4CQ1A 1N60A 1TR0A 2NSCA 1DOIA 4WFAQ 4OYXA 3MMCB 4PQAA 5ETTA 1LW2B 4WP3A 3DM2B 2KYWA 1QILA 1RBAA 3Q3JA 1TZ1A 4G6VB 4A8KA 3NOGA 2Z57B 3WX8A 4USMA 4OHXA 2L8JA 4XDDA 2IAJA 3JVZX 2B3TB 2LASA 3UO0A 2E7VA 1VBZA 2KJHB 3ZUNA 2UVRA 4CCHA 1IJEB 2X1BA 2DPJA 1IKWB 1WHVA 1Q5WB 2M17A 3AXKA 4JV0A 1KHWA 4NZLB 3OR1B 2HHSA 1SCJB 1VISA 4EZLA 2N7YA 3ZZTA 2KJRA 4MKVA 4IG0A 4CM0A 2MLYA 1IR2A 4MYTA 3QT5A 2V2ZA 1CBKA 1KP6A 2YEPB 3E2EA 4OVUA 4ECZA 2FD2A 1YDLA 2KKCA 2V8HA 2MZTA 1XNQJ 4KZ0A 1OPIA 4ID5A 5C2GA 2Z30B 1RT2B 2ZBCA 1A5RA 2YY3A 1H2TZ 3TI0A 1YN3A 1NM2A 3KLHB 4Y34A 1N54B 3FUYA 4O3RA 1RTHA 3BREA 1VRUA 1KR4A 1WXMA 3P4UB 3HHDA 2JWNA 4MJKA 1T9XA 1KOOA 4ZRIA 4DZ6A 2LQJA 4P2FA 1S12A 3BEGB 1UVLA 1N33J 1R4NI 4CO0A 1UVJA 1UZDA 5F8GA 3UDEA 5CYMB 1X0FA 1IKYB 1NK7A 3BBFA 2RPVA 1YBUA 1S5ZA 3I0RB 1QSLA 4I2PA 1HZ6A 1IWAA 4RBVA 3P3DA 1ENFA 3BSAA 3QMQA 2YNIA 1ROFA 2ZCCA 4FP9A 1RKIA 4CLPA 5KFSA 1VQYA 2RSQA