2I2YA

Solution structure of the rrm of srp20 bound to the rna cauc
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
150
structure length
150
Chain Sequence
MQYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTEGSHHHHHHMHRDSCPLDCKVYVGNLGNNGNKTELERAFGYYGPLRSVWVARNPPGFAFVEFEDPRDAADAVRELDGRTLCGCRVRVELSNGEKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis of RNA recognition and TAP binding by the SR proteins SRp20 and 9G8.
pubmed doi rcsb
source organism Streptococcus sp. 'group g', homo sapiens
molecule tags Rna binding protein/chimera/rna
molecule keywords (5'-R(*CP*AP*UP*C)-3')
total genus 44
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2006-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2i2yA01
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2i2yA02
1URNA 2CPXA 2VOPA 3FILA 5DDQC 4ERDA 2MY8A 1M90T 2CPEA 1WHXA 2SXLA 3J7YU 2DHXA 2KXHA 1M5KC 2L9WA 2JVRA 3LPYA 1K50A 2CPIA 2ON8A 2CPZA 4QPTA 4Y00A 2RPVA 3PIPQ 1WHVA 1F9FA 3MUMP 1D4BA 2QFJA 3BO4A 2OJ3A 1G2EA 2XSFA 3CCQS 2CQ2A 2JWUA 2MPUA 5LXYA 3P6YC 1P7FA 3UCGA 2VONA 1MVKA 2EK6A 2KHCA 4U67Q 4PR6A 1VQOS 2MYFA 1FO1A 3K0JA 2HZCA 2DNGA 3VAHA 4C0OC 4WF9Q 2RT3A 2RNEA 2JVOA 3S01A 1WTBA 2DNQA 1WI6A 1Q81T 1HD1A 2DH8A 2I2YA 5DDRC 1PGZA 2K0PA 4LMZA 2MJUA 2PW9A 1FJEB 1R8PA 2LA6A 2FC8A 2MZSA 3R27A 4OZ0A 2DGQA 3TO8A 3CC2S 1U1RA 1F2RC 3V3XA 5HO4A 1X5OA 2ZJQQ 1VQPS 2PLPA 3GB1A 1N54B 2QA4S 2M70A 2RS8A 5CYJA 1YTYA 5DM6Q 2MZRA 5LJ3Y 2ADBA 3RW6A 1U1OA 2XNRA 2XS2A 4M5DB 2LXIA 1VQ6S 4WFBQ 3J7ZT 1S72S 1YMHE 2KI2A 3S6EA 3NS5A 2CPDA 1KOHA 4QQBA 3CCRS 2M2BA 5FJ4A 1QKZA 4WIIA 2RMMA 1WELA 4FXVA 3CUNA 3B4MA 5HFYA 2FHOB 2D9PA 5BJRA 1RKJA 3HHNB 4KGTA 1U6FA 5HHDG 2PEHA 2DGXA 1F2RI 2CQBA 2LEAA 4WKRA 1WEYA 1JJ4A 2XS7A 3G96A 3VAKA 2KU7A 3MI7X 2ERRA 5GADU 1FHTA 2MXYA 2NLWA 2X1GA 1X0FA 1K53A 3U1LA 4C4WA 4F26A 1RK8A 1UP1A 2BZ2A 1D9AA 1DZ5A 1VQ8S 2HGLA 1WF2A 1IQTA 4WCEQ 2DNKA 2FC9A 2DITA 1DBDA 3UCUP 3UI3A 1UFWA 2QEXS 1JJHA 1KH0A 1OWXA 2XB2D 2MGZA 3NS6A 2M52A 4KGSA 3BS9A 3CCVS 1SJQA 1R8HA 3VF0B 2OTLS 2ZJRQ 2ADCA 4ZKAA 4J5OA 1IBXB 2YWKA 1CVJA 1K9MT 3OW2R 2DNPA 2N9KA 1X4EA 2J76E 2LCWA 3FEYB 1X4AA 4CQ1A 1YJWS 3P49B 3EGZA 4MACA 2MZJA 3VAIA 5GAEU 1WG5A 2M8HA 1WG1A 2DH9A 3UE2A 1BY9A 2ONQA 1GB1A 3MUVP 2DIVA 2DIUA 3MDFA 1VBYA 1L3KA 1IGDA 1EM7A 5LSLA 2LYVA 3CCSS 3JB9k 1M5VC 2LUMA 1KOOA 5D78A 4QU7A 3ZZZA 4EGLA 1SJ4P 2RRAA 1H2TZ 1K8AT 3CCJS 1X4CA 2OSQA 5DDOC 2NZ4A 2CQ0A 5GMKa 5BMGA 5HI1A 4OZAA 4CIOA 2HGMA 5D77A 2HGNA 2MGZB 1JMLA 5IM0A 4YOEA 3R1HA 3N9UC 1Q82T 2CPJA 4WFNQ 5JXVA 2LQ5A 3MD3A 3H2VE 1VQ9S 2N7CA 1U1KA 3CXCR 1SJRA 1X4FA 1UWXA 2I38A 2DHGA 1X5SA 1YHQS 2KDMA 2LKZA 2LGIA 2CPYA 1VQMS 1Q7YT 2YTCA 5DDPC 5IM0B 2MQMA 2X1FA 2IGDA 2JX2A 2CQGA 1ZH5A 1YJNS 3TYTA 1VC5A 3V4MA 2LHEA 1XCQL 1FT8A 4YUDA 5LJ5Y 3SXLA 1ZZNA 2M8DB 5IFMA 2MKJA 2RRBA 3VAGA 1WG4A 2RUGA 2M7SA 1X4GA 2MKKA 1WEZA 3I56S 1FJCA 1UAWA 2M9KA 2MKIA 3DXBA 2MQPA 4D2KA 2MQNA 4WFAQ 1WF1A 3B4DA 4W92B 2FY1A 1FJ7A 2KQ4X 2L08A 2GO9A 2MMYA 2N3LA 2CQ4A 2MSSA 2KM8B 4OZBA 2EK1A 2E5IA 5BMHA 2J53A 2DNRA 1QM9A 2MKSA 4FXWA 4V19X 1XCTL 3S7RA 1PO6A 1JMTA 1NJIT 2G1DA 3CCLS 2N82B 5MLCV 1H2VZ 1PGXA 3CC7S 1FCCC 4BS2A 1WI8A 2HYIB 3NMRA 2CJKA 4LIRA 1M1KT 1NU4A 2L41A 4IOCQ 4ED5A 2DNZA 3US5A 4F02A 3MUTP 2ZJPQ 3CCMS 5HG2A 2X1BA 3HI9A 3UD4P 1HEZE 1K73T 4QU6A 2D3OR 1DHMA 1KC8T 2D9OA 2U1AA 5JVGQ 2EELA 1M5PC 1MHXA 1OO0B 2KXFA 4CH1A 1U6BA 3IWNC 3DLLQ 1N8RT 2E5JA 3H2UB 2CQIA 4RU2A 4PRFA 3ZZYA 2CQDA 2RS2A 1W2BR 1YNTE 2MQLA 2MKHA 2M0GB 2CPFA 2DISA 2CPHA 1IBXA 2XS5A 3EX7B 3Q2TC 1X5TA 3G8TA 5CA5A 2JWNA 1N88A 2DHAA 2JSVX 2J0QD 1A9NB 3CULA 2MZ1A 4TU8A 1JJ2R 5ITHA 2LECA 1H6KX 5JVHQ 5LSOA 3BEGB 1VQ4S 3UD3P 2EVZA 4LJMA 1X4HA 2PE8A 1HZ6A 2CQPA 2G4BA 1H2UX 1X4DA 3UWTA 4UQTA 1X4BA 2A3JA 2KYXA 4GLSC 2JRSA 1NO8A 2CQCA 1VC0A 1HA1A 1VQNS 2JU6X 1P7EA 2IGGA 4IKGA 2OIHA 1QVGR 3G6ES 1P27B 1U1LA 1WF0A 2YKAA 5EN1A 2DNYA 1KD1T 2MJNA 1U1MA 3CPWR 2N3OA 4W90B 3G71S 1U2FA 2F9JA 4Y0FA 4IOIE 3NNAA 2DGSA 3EGNA 2J8AA 2GI9A 2E5GA 1N52B 1VQ5S 2DHSA 4WH4A 2KFYA 2JZPA 1IGCA 1A7GE 3TP2A 4TU7A 2LXUA 3CF5Q 5IQQA 2KRBA 4IO9Q 1MPEA 2AYBA 2AYMA 2KN4A 2MHNA 1ZXHA 5GAGU 3UCZP 2LHDA 4TU9A 3VAFA 1WHWA 1WWHA 3MD1A 3S8SA 1VQ7S 1YIJS 4OZ1A 2K8GA 1MI0A 2HVZA 2MQOA 2XNQA 5HL7Q 2E44A 3BO3A 2KT5A 1M5OC 2DGVA 2N7JA 4A8XA 1UW4A 3G4SS 2DO4A 2CQHA 2WBRA 3THTA 2DNOA 2DGOA 2KRRA 1DRZA 3BO2A 1SXLA 2DGTA 1OPIA 3RW7A 1B7FA 2KXNB 4IUFA 1GB4A 1WHYA 2YH1A 2QSDA 2MKCA 2KACA 4OZCA 1FXLA 1VBXA 1Q86T 1VQKS 1XN9A 2JXTA 2E5HA 2X1AA 1AUDA 5LXRA 1HD0A 3VALA 3CC4S 2PTLA 1YJ9S 1SJ3P 2AYEA 1P1TA 3G8SA 3CTRA 2VOOA 1K52A 4F25A 2DNMA 1MHHE 2FPHX 3P3DA 3P5TL 2KH9A 1XF5L 2GHPA 5BMIA 2MZTA 4TLQA 4PKDB 3I55S 3CMAS 2KWDA 2DO0A 2RQ4A 2AD9A 2DH7A 2M4MA 2LA4A 2OTJS 3THPA 4CH0S 2DNLA 2MSTA 3MURP 3VAJA 2F9DA 2NMQA 2KG1A 4UY8T 2RU3A 1SJFA 3R1LA 2DNNA 2KG0A 2OSRA 1VQLS 2AYGA 4YB1P 1O0PA 2U2FA 2MY7A 3NNCA 3SDEA 3G9CA 2ZW0A 4P6QA 1OIAA 1FCLA 1U1NA 1D8ZA 2RQCA 2CQ3A 3NNHA 1FD6A 1S79A 3MOJB 2RVJA 4HKZE 3ULHA 1Q10A 4IOAQ 3SDEB 3CMES 3SMZA 1PGAA 2GB1A 2UP1A 3MXHP 2MZQA 2QMTA 2KM8C 5H1SV 1HZ5A 2O3DA 3L3CA 1VBZA 1YITS 1PGBA 3LQVA 2B0GA 3PIOQ 2K3KA 5DM7Q 3MP9A 2KVIA 3VAMA 1FNXH 2DNHA 2DK2A 2DGWA 5DETA 3U1MA 1X5PA 2Q79A 1U1QA 2YH0A 2IGHA 5GAHU 2M88A 4C7QA 1QVFR 2F3JA 1YWXA 3CD6S 3CCES 1WEXA 2G0CA 3FEXB 2LEBA 1VC6A 2DGUA 4HJGE 1K51A 2MQQA 2VODA 2MB0B 3D2WA 3CCUS 3Q2SC 5CXTA 3FILB 2LMIA 4Z2XA 2OEDA 2CQ1A 2N9LA 2ZW1A 1U1PA 2J52A 1HL6A 1C9FA 4KGRA 1YI2S 3IRWP 1ZZFA 2BOPA 5GVQA 2V94A 2DB1A 2J0SD 1KQSR
chains in the Genus database with same CATH superfamily
2NYHA 1VIOA 5KHQA 5DS7A 2YVCA 1BE4A 4F4AA 4NMLA 1TZ0A 2NBWB 1F9FA 1I4RA 3UDCA 1HMVB 4K7SA 2MPUA 4O3SA 3PW2A 1SEBD 5C23A 4CYUB 1J2VA 2FE8A 1FO1A 1VQYA 1FJGJ 1RHRB 4GDKA 2VIHA 4USAA 1ULRA 3TJPA 3SR6A 1YSJA 2XK5A 3ENQA 4LSLA 1NB7A 2N0SB 1RT6B 1OQRA 2PC6A 2I2YA 3JAMU 1R8PA 3AY0A 3I0SB 3CC2S 2DGQA 3PDNA 3RUIB 4E8UA 5KG7A 2QA4S 4BFRA 3I4HX 3RW6A 5DJBA 3RB6A 1L0XB 3CSTA 5I4DA 2KMCA 1IQZA 5FJ4A 2AZ3A 1U6FA 2ZVIA 2BJ9A 3UDEA 1F2RI 1C79A 4GVBA 4PG7A 5G4DA 2LEAA 4OYXA 3IXQA 3MEDB 4K4WA 3F56A 1APSA 1RLCL 4V19J 1C2PA 2F4FA 3FRZA 3AQPA 4K0KJ 3H25A 2AEMA 1XNQJ 2ZOMA 1P8GA 2DITA 3TA1A 1CJTB 4KHPJ 5SUHA 3S1TA 4X64J 2QG9B 4R25A 4ETXA 4AE5A 4EEYA 2M1MA 2N9PC 4PK1A 4DPYA 1KN6A 3O1LA 3KK3A 2E29A 1N5SA 3V81A 3AE7B 2L3ZA 2ZE2B 3M8WA 1EU4A 4LQ9A 4R3DA 3BYPA 4F4ZA 2DH9A 4A3PA 3WAOA 1NPKA 4W9FA 5KFGA 2WVEA 2DIUA 3BB5A 3N1XC 4P2XA 1RTDB 4NLWA 5LSLA 2NXCA 3W63A 3QAUA 3Q86A 1KOOA 5AT1B 3DXSX 3TANA 2AP6A 2D07B 2HGMA 4UOHA 2MGZB 3BN4A 5I3PA 4CCHA 2RPQA 2M3DA 3IC1A 1WC4A 2Z58B 2HQ3A 5GAEI 3IM9A 3M6VA 3DYAB 1KVKA 3E9SA 3B2FA 3ZFVA 1AROP 4U9RA 3V4MA 2RSQA 4K50A 3IG1A 4ECYA 1RI7A 1W2IA 3NZ3A 1LW2A 5LT5A 1FE0A 2QHOA 1NYRA 1DOYA 3SSRA 2FHKA 4G6VB 1TFWA 2GO9A 1K44A 3DRRB 4WYLA 5HMXA 2EK1A 3M4XA 4RW7A 4HI2A 4KBIA 3T1HJ 2ZC4A 1UFLA 4ELTA 1GC6A 4B3OA 4A90A 1M4VA 1WR6E 2NTSA 1E6VA 1F0ZA 1HQUA 3ZNGC 4JE3B 2HDEA 3MUTP 3HI9A 2L05A 5K14A 4L6V3 3EXYA 4MM3B 1TKDA 2IY5B 3O3LA 1VRUB 3AB4B 2JWZA 2VBZA 2HMIA 1SPBP 2WXOA 4IM3A 2MKHA 2K8CA 3HZEA 2DISA 3P5BP 4OYBA 3GG1A 2W4CA 3VTUA 3BGRB 9ATCB 4A3OA 1N5XA 2FHMA 2YQ3A 4WWMA 4P1BC 4FVMA 2RE1A 5G0RA 3ZKJC 2R2UA 1NBFC 4UQTA 4O3NA 4AJYB 2M56B 4EWTA 2CQCA 4WAAA 1P27B 1SKUB 2VPWB 4NOHA 2PIIA 3VRAB 1YJUA 2IJFA 1U1MA 2RSUA 4ANVA 2RRNA 4K59A 4YFUA 3SHQA 3EGNA 1BXTA 4U7UD 2H54B 2XCPA 3KJVA 2DHSA 5KOWA 1K47A 1VFJA 2AQ4A 2JZPA 4NXMJ 2A5UA 1NRKA 5IKCM 2AYBA 5HKHA 1V1OA 4YL8A 3HF5A 5GAGU 1WHWA 3AE8B 4NCAA 3A3PB 1HMVA 1TL7B 3N4WA 1F1HA 4CYUA 2KYZA 5B0FA 2KO1A 4EI2A 3OR2A 3BDEA 1HYSA 3KLSX 5BO4B 2NXUA 2ZZMA 1DRZA 2GQ2A 3RW7A 2CJOA 2VF3A 2ZC3A 2ZD1A 2QSDA 3J80U 4MK9A 1RFKA 1VCTA 3U7DA 1YD8U 2PEAA 2E5HA 2HHXA 3DLKA 4DF8A 4NLDA 2R7RA 1GC7A 2Y0SD 3CTRA 4KAIA 3IRXA 3PLUA 3IG1B 1S0VA 3CJ3A 3DLEB 4B08A 2QLJB 2XLIA 5BMIA 1D5MC 2XWYA 2AD9A 2W82A 2G4SA 1VHIA 2AMCB 1FX4A 1V2YA 1JLAB 4ZDNA 4NJCA 1SC3B 5K14B 4DV3F 1UA1A 3MAHA 3C6TA 3NCPA 1M5HA 2V69A 1FWKA 1UUPA 1S1XB 1AN8A 5CZVA 1WKKA 3EHVA 1FM0D 1FD6A 3MOJB 1HQ2A 1N60A 3QGGA 3HT3A 1MG4A 2JZ5A 1UTAA 2WCXA 2KWVB 1SH2A 1MWQA 1SBRA 2HRTA 3Q3NC 3N0VA 1HZ5A 4JWUC 3V6DB 4ICUA 1RT4A 4ECUA 4F3MA 4JV2A 3Q22A 2RKIB 2GMIC 3C2PA 4UZCA 2FUHB 5A8WA 1I3OB 4TXSA 2Q3PA 1IKVB 3UN5A 3TUPA 4JI1F 5I4MA 2VICA 3LF0A 4USJC 4F1SA 3MMAA 3R3MA 4NLSA 2YWEA 4JI6J 1WX7A 4A47A 2YNHA 4FKXA 1QSYA 3PJWA 2PMWA 1Y56A 3C0RB 1FTCA 4AOFA 3RRGA 5AZGA 3VTIA 2QLFB 3LPYA 4K0KF 4J9RA 1KBRA 5DZ7A 4JI5F 1JK9B 1WYWB 3OTOF 3RNCC 3UQAA 1RTZA 5LXHA 1STEA 1CBKA 2Z56B 4IG0A 1JALA 1S99A 3QGIA 2YX7A 1DURA 4TY8B 2IM0A 4TYBA 2HFUA 2BM1A 1RADB 2BJDA 3V3XA 1FRHA 2GIFA 5HO4A 2PLPA 1N54B 2E3TA 2KFKA 2E66A 3AT1B 3R3TA 4ZIWA 5K20B 1IN0A 4NCGA 4J91A 4CLKA 4P2MA 1S6PB 3KG4A 1E7PB 5E2QA 1CLFA 1UKUA 4WIIA 1UJ4A 4DZDA 3HHNB 2C3UA 3R5CA 1PFDA 2PEHA 2WHOA 5IA7A 3DM2A 2RDGA 3PX6A 3VHTC 5E6OA 3GTYX 1T3NA 4OV6A 2A4ZA 3ZTSA 4JI2J 5CX3A 4JP8A 5J2MA 2I1RA 2P2CB 1I5OB 4YB6A 1EQ0A 2CJ9A 4FLHA 4PZVA 3MAAA 4MGYE 1RHJB 1XC9A 1CJVB 4CH7A 1FKOB 4DLGA 3NG0A 4DUYF 1D5ZC 3VZHA 5KG4A 3D67A 3LWLA 1K9MT 4F0HA 2DNPA 1L3TA 2Y3YA 1REVA 3VAIA 1WG5A 4ZOSA 3LUYA 5D94A 3KWVA 4ZPDA 2O01C 1XMOF 3AXKA 2FQQB 2HNDB 1S7HA 3CJ8A 3PRVA 4KDIC 3OXFA 3ZZZA 1Q95G 2FVSA 3O65B 3OVAA 4B3OB 4XZ4A 4F4YA 2DD8S 3SU8X 3ZC4A 4MYTA 4A8YA 4L3KA 3K7RA 2C3OA 1QAJA 1IKYA 4F0MA 1UWAA 2JEJA 1VC5A 1WC1A 5LMUJ 2AIRB 4RPFA 4M1KA 1RAXA 4FVCA 1KLNA 3DXBA 2CJQA 1WF1A 3K5PA 2B76B 4C4VB 2CVEA 2JLFA 2WQYB 3BJYA 2E5IA 2KJ6A 4K5RA 3NAIA 2MKSA 4H4MA 2QL9B 3KUHA 1OQ6A 2ZHBA 4DR6J 2JYTA 3OHBA 4DR3J 1B7YB 4Q0BA 2K8HA 3Q89A 5LMNF 4KPYA 2Y5PA 4B9VA 5DLGA 4EUTA 2XMVA 3C6UA 4WE1B 5ETPA 3PVLA 4IOCQ 3HLUA 1RTHB 2X1BA 3UD4P 1F5BA 3VQIA 2D3OR 2KLGA 4BDPA 3IWNC 1RYRA 1GNKA 1XD3B 2BE2B 4DV7F 1W2BR 3D32A 1C1CA 4HT5A 4KGVB 2CFXA 3V60A 4LNKA 4HT7A 4NE9C 3ZJVA 2WRMA 2BTEA 1TS3A 4FF3A 1ZM9A 3VUXA 3DI6B 1T05A 1UNSA 5JVHQ 3H90A 4HDHA 1V1PA 2EVZA 2XBBC 2RGFA 3EMTA 1EJ7L 2W2OP 2HQFA 4HDQA 2G0IA 2AZ1A 1VQNS 3TUOA 2OIHA 4NRTA 4R0EA 2H5IB 4K4VA 2HAFA 4IFVA 3NNAA 1FFVA 3AE2B 2QX0A 1P1LA 3GR1A 1VQ5S 4WWSA 2KRBA 1WC0A 4O3RA 1R31A 5L46A 2NR0A 3FBEA 3V6CB 3MTNB 4LBHA 2ZEQA 5CABA 4RBUA 3KNGA 2VQFF 1KEKA 4KIKB 1GPXA 4ES3A 2OMLA 2EFOA 2K39A 4NAMA 3T1HF 2INDC 3M1VB 1VK3A 3MR5A 3VGSA 2XZDB 2DNOA 3Q83A 2DGTA 1YJJA 2VASA 4KY3A 1R8CA 3L54A 4TN2A 4WQOB 3MZIA 1F3VA 3PHTA 1UVKA 4DPOA 4ANXA 1YJ9S 1KKHA 1SJ3P 2R7UA 3L10B 5J2PB 2LU1A 4OX7A 2DNMA 1QD1A 2BR0A 1KTQA 2HAIA 2NYIA 1CJKA 3CMAS 2R8JA 4FXCA 4GMKA 4DSIA 1N33F 2OKQA 2KDBA 3MURP 3VH4B 3M8PB 3KLEA 2VL1A 2KG0A 3CIRB 1VRTB 3QYYA 1FJGF 2MJDA 2U2FA 2K3UA 3ENEA 3H2LA 1E7UA 4NYOA 2IYDB 2J9EA 5T41A 3BBCA 4DWIA 4DL6A 1UELA 3ISZA 3EPIA 3GFYA 3QSYB 3W5VB 4DHZB 4QJVA 4US9A 3OJSA 2N7YA 5HQLA 1S9GB 4LSNB 4F36A 2M4NA 4X4NA 1N5VA 1RAHB 2KVRA 3PIOQ 1XMBA 4KHMA 1J8CA 3PNIA 2ZKTA 3FC9A 4DG1B 3MEEA 4RO0A 2HFSA 2ZH4A 4DV6F 3O5TB 4CLZA 1WEXA 5J1PA 4ZJLA 4DK5A 4HJGE 2MQQA 4KX6B 3D2WA 3QZ7A 3BZDB 1NHVA 2IBIB 2V50A 2HJ1A 3CDAA 4FYVB 4JI0J 1ZKHA 2L0FA 1URNA 3N20C 2F8EX 1JIHA 1HLWA 2MY8A 1SIJA 1K0VA 2D41A 3CIMA 4IDKA 2IHR1 5KTQA 1NK8A 4OJGA 2NPFA 3APCA 4IM2A 1P7FA 1HHSA 3L9ZA 2NREA 2EK6A 1RCXB 4A8QA 2VH7A 1XERA 1SH3A 3HX9A 4DBQA 1T6BX 2HFNA 4WF9Q 3W61A 1DTQA 4CRJA 3OTEA 3RRKA 1WI6A 3QRRA 2R2RA 5FLXU 3B54A 4FYDA 1PAUB 1YLXA 1RWPB 2MLYA 4LR9A 3BBFA 3M9NB 3LW5C 4G1QA 1U1OA 2IVMA 4MJKA 1YBUA 4YR2A 1N5YB 4IRKA 3ZZPA 4I64A 1CZPA 2PE6B 4A8OA 2X8XX 1RTJA 3OTCA 3T1YF 1QE1B 4JV5F 4NLGA 1S1UB 2H4WB 4KTQA 3VR9B 3GE3C 1EETB 4HVZA 3P4RB 5SZTA 4OI0A 2AEFA 3EPGA 1HBMB 4TLRA 1K53A 3GJQB 1GH8A 1R0AB 4DR5J 3L13A 2DCLA 3OSNA 1UVMA 4EU0A 1RAOA 1GMUA 3RULA 3UI3A 3CT9A 3AV8A 3PRBA 4E74A 2LRUA 3TVKA 2OD4A 3FK4A 2MH7A 4CLUA 3HHLC 2Z30B 3IFEA 2WDTB 3CJ0A 2HLUA 1FRJA 1XNRJ 4FPIA 3ZNID 2LASA 5J17A 2V9KA 3T6BA 5HVHA 3MEDA 1HBOA 1HBNB 4FF2A 2BXJA 3PXGa 4PQUA 4AQ7A 2BS2B 1SE9A 2UXDJ 4BOSC 1S49A 2C2OB 4XGAB 2CXEA 4YWGG 1DOXA 4DSJA 2KX3A 5IQ6A 2BOAA 2HGNA 3TI0A 1I4QA 1N33J 5IM0A 3C15A 2GBNA 4MFBB 2EKIA 3DHWC 2DJWA 1FKPB 3PW5A 4WKYA 4ZPAA 2YWHA 1VQMS 2UUAF 4FYYB 3H9DA 2CADA 2L0TA 3V81B 3BPSP 2KK8A 2IJNA 3OV7A 2IO1B 1IM4A 4G65A 2MQPA 2OP5A 2VFRA 3X0WA 4OHYA 4LQ3A 3J7YI 5EGYA 4F3OA 2MSSA 2ROEA 5HLFA 4TYAA 1WGYA 2J53A 3NEKA 4MKBA 1CS4A 1NKBA 2GIRA 3SEOA 2DBBA 2M0AA 2GZOA 1AUSL 4IYQA 1PAEX 3Q8EA 1NU4A 3OL9A 2GNKA 4F50A 1IBMJ 1KC8T 1M5PC 2DYOA 4DR4J 1JXEA 6FDRA 1LWCB 3EXCX 1N8RT 3JSYA 3TEYA 3H2UB 1IUEA 3KKFA 2CQDA 2BJ7A 2JF5A 2V67A 3MPYA 2BS3B 3V5RA 2J4XA 4FJZA 4LFCJ 3HHLA 1SVDA 3I0SA 3EX7B 3DBLI 5AZFA 4HWIB 1M0SA 2YKMB 4X84A 1IBLF 4RW8B 3ISNC 4RGOS 4WIQA 1UVNA 1NJXA 4CDIA 5G55A 2WXGA 3MFGA 1ZA2B 4WJQA 3UVJA 3B1LX 4NA1A 1QVGR 2L3MA 2OD6A 1N6QA 2MJNA 1RBOB 2MTLA 3G71S 3KG0A 2W4PA 2KFKB 4Y0FA 4YHHF 2HSEB 5GXGB 2IA0A 4DV4F 3IT4B 2BJEA 4B3MJ 3QNWB 4RU9A 3U2SC 2OLWA 2NUHA 1CK1A 4OZ1A 1N36F 3HFZB 4URSA 4MGKE 4XIUA 4TQRA 3R5AA 3OT9A 3HSJA 1D3ZA 5L38A 1T11A 2P9EA 2DAJA 3AEGB 4LLGM 1L2NA 1NYQA 2QMUB 5J1EA 4IWPA 2VBXA 3PEHA 1PJ7A 2HHSA 3CC4S 1V6EA 3A4RA 1OMSA 5IT9U 3QGHA 5CZXA 5DZ6A 3UNGC 1E90A 3SFDB 2VG5B 3QPIA 2JC0A 2O67A 4RNAA 2PKOA 5L9NA 2DNLA 2KG1A 4UY8T 2BKFA 3JTNA 3DBRI 5KG6A 1IKVA 1WSVA 4BBNC 3MM5B 5AXMA 1U1NA 2GLSA 2X51A 2RQCA 4HXDA 4A55A 2L7RA 3L08A 3SCLE 3B78A 3I31A 3ZO7A 3ZTQA 3BREA 3VXWA 3FRYA 3CMES 2JFDA 1EUVB 4JUZA 2MBHA 2UXDF 3TRGA 5G2NA 1D3WA 2ZBRA 5GMDA 5K8MA 5HJXA 1PBAA 1HI1A 3W9JA 4F7ZA 2AWZA 1J5OA 1QVFR 2F3JA 3QK0A 1PCAA 1HWKA 4P73A 1FE4A 2F8MA 3ZZOA 1VLYA 3UD5A 3TJ8A 3BINA 5THWA 4IWQA 1YI2S 5TR5A 1BXNA 1S6OA 4AL5A 3GV8B 2L32A 4DSEA 1WF9A 2PT0A 2PFDA 1TL1B 4Q0BB 1NH7A 1EETA 3GJRB 3BR9A 1FIQA 4KIAA 3JW0X 4K3BA 3PREA 1FDBA 1ESFA 5B0CA 3JSBA 1Q0NA 4U7UK 2V4IB 3VAHA 2AJ0A 4OYWA 2RDBC 1FA0A 2V4LA 1HD1A 5A8KA 5D0GA 1BWVA 2QA1A 2LA6A 2MZSA 3M2RB 1WOSA 4CNZA 3TAQA 4I68A 5DM6Q 4DUZJ 2ADBA 3RAMA 4J9NA 1ZM4A 4AUKA 1RYSA 1YMHE 4IWOA 1IBKJ 1WX9A 1P6TA 4PWUA 3V4IB 4FXVA 1R0CB 2KVZA 5KFNA 1ENFA 1RKJA 1HNZJ 2NR2A 5C25A 2LJ5A 1XK8A 4BWMA 2W2QP 2K9XA 2P9CA 4GB9A 3ET6A 3ZXRA 4KGMA 3I6PA 1DTTB 5ETVA 1XLOA 4AQYF 3A9JA 4N77A 2A6OA 1C4AA 4QIFA 1X0FA 1RK8A 3VR8B 1D9AA 3ZO5B 1VRAB 4ILLA 1RSCA 3KLGA 3VUWA 1WFYA 1S6QA 1YQBA 5JH5C 1UFWA 1JJHA 2DY1A 2JXXA 4TSSA 4X4UA 1OGWA 4F2RA 3KDOA 1IYFA 4XX5A 5IT9Y 2KN5A 4YY3J 1X4AA 2RAQA 5A6WA 2DR7A 5J2NB 3BN7A 3GR0A 4USTA 1Q1KA 3P63A 1B1ZA 5AEKB 2VB6A 1T3QA 4UY85 2LD9A 3MDFA 1JJCB 5J2MB 1E8ZA 2RHSB 2P9GA 1G7CB 3TX0A 3CDWA 2XMUA 3PO0A 3H5YA 3WDOA 2RRAA 1JNRB 2DENB 5DDOC 5GMKa 2AL3A 4LFCF 3EVWA 4F4WA 2HNYB 3PKYA 4GMVA 1RTDA 1JMLA 1S6UA 2QSWA 4Y2CA 1Q82T 4K4XA 2LQ5A 4B95A 1U1KA 2G4DB 2FUG9 4HHHA 1YHQS 4Y2MA 3I32A 2N7EA 3DI6A 3MAQA 2ZBIA 4C8KA 2CHWA 1FTRA 1JKHB 5KFPA 3ZZTA 1WEZA 1UVJA 4L2YA 3QX1A 1H4RA 1WC5A 2CQ4A 4LIWA 4DR1F 4BC7A 3K57A 5EWEA 4K7UA 4A4JA 1B64A 4H4OA 1VJWA 2XC9A 4C7ZA 3TX8A 3HKWA 3M2RA 3HXMA 5G5HA 4LF4J 1FMAD 2BKNA 3CVKA 2WZ1A 3AU5A 4F2SA 3W62A 4I1TA 2CZ9A 1R0BG 3KLGB 2BQRA 2AWTA 5D8HB 1UVIA 4KQZA 4PRFA 5EWGA 1S76D 1OQQA 2ATCB 2WX1A 2CS4A 2W54A 2ZEJA 1IBXA 1DAXA 4J7CA 2WK4A 3AI5A 4C8NA 1YVFA 1IKYB 2JOQA 2M8SA 3UD3P 2BKPA 3KWMA 4ED6A 3UWTA 1BUXA 4OI2A 1NEKB 1JLEA 4DX5A 4C56C 1LFWA 2OPPA 4LF7J 2GQQA 2ZOFA 1P9YA 3D68A 1HQEA 2HZVA 1MLAA 2R42A 2YKAA 4HACB 2DNYA 1Y7PA 2KDIA 3MHSD 1F2GA 3RNFC 4C8MA 3CCZA 1URRA 4UQGA 3FSYA 3TZWA 4L75A 1CJKB 2HS0A 3MD1A 2YKOA 2XK5B 3TEXA 2HVZA 3GE9A 4DR5F 2AQ1B 3ISND 4EMDA 3BO3A 2KMMA 3LWMA 4ECQA 2WDVB 5B0BA 1RE1B 3G4SS 1RT3B 2V9WA 3A4TA 1PYTA 5AZHA 1NK4A 1XR5A 1SI9A 1EF5A 2YKQA 3CEDA 3D54A 1B7FA 3MFHA 3KMQA 1JW9D 4Q5VA 1RWKB 3FUYA 1VBXA 4M5JA 1AUDA 4FF1A 2GIQA 2BM0A 4ZHOA 3C3LA 3ECIA 4OI1A 1LWEB 1P1TA 2VBYA 3G8SA 4M5DA 2A1BA 3QFWA 2BA9A 4LF7F 3POTA 2VZKD 4OX9F 1ZPWX 3Q8CA 3PRDA 3QCAA 2K6QA 2V4RA 1TS2A 3TZYA 4Q44A 2F9DA 3DOKA 2ZDOA 2OH2A 3SCIE 1FF2A 4M5NA 4HR2A 1R4MB 3B0AA 3MM6A 3OJ3A 2JSXA 2RQMA 3SSQA 1FK9B 3V6JA 3B82A 4PG5A 3CO0P 3MECB 4PG8A 3NVZA 4K4UA 4W9GA 2IM2A 2WOMB 4IM0A 2R9LA 3TJAA 3NS1A 4A20A 4BBYA 2KM8C 1YITS 2VFSA 4NPOA 1LGRA 1T7PA 2DNHA 3I57A 1YJRA 1Z2MA 2YH0A 4YTPB 2B43A 4CO4A 3HM3A 4DL3A 5KFDA 4ZN1A 1PSDA 4KH0B 1NHKL 2LEBA 1TAQA 1Q53A 2MRPA 1QY7A 1RTJB 3CCUS 3Q2SC 4XPCA 1CEZA 4OMFG 1N32J 2ZW1A 1JLAA 2CUYA 1VDHA 1NEEA 2GQCA 4MGIE 1ZZFA 5DDQC 4QPXA 2UV8A 3I5AA 2UV8G 4I69A 4F7VA 1KLMB 2RPVA 1D4BA 3GZNI 3MMBB 3IO1A 4X66J 1YBAA 4ITSA 5DO2A 1MVKA 2H65B 2WONA 2DEIA 2GBRA 2AGOA 4MH8A 2ACZB 3QARA 1DJ0A 2JVOA 4OZ5A 3J81Y 3W5UB 4DFPA 4KV8B 1KP6A 3R8BA 2E9RX 1VI7A 1WH3A 2FC8A 2HIQA 1W26A 1ZBTA 3QWUA 4MKYA 2LDIA 4DOZA 1KRPA 2E1CA 3W8GA 2L48A 4CLFA 2QLXA 3R5BA 4YN3B 2GBJA 4I7FB 1G6JA 2KJHB 1I35A 3S6EA 1KQKA 2IY1B 3NS5A 1V3ZA 3DLEA 3CJKA 4DSLA 3NRZA 2ZHOA 5HFYA 3AEBB 3TIXA 1SIFA 5B08A 4MFBA 2J6TA 3ILJA 2FLPA 3EVMA 4KPCA 2CYYA 3CB4A 1S1XA 4OX6A 1B3TA 2PN6A 1NK9A 3D4JA 1VQ8S 3DPDA 3PYGA 2WXIA 5L95C 2LFVA 4ZPVR 1V5IB 2XHWA 1HHTP 3R7SB 4CT8A 1OWXA 4CLTA 2XB2D 3W8PA 1I7HA 4JI6F 1SKSA 4ZLNA 1LNQA 4J5OA 3OW2R 2LZ6A 2N9XA 1T3OA 3AOAA 3QIPB 2FVPA 3Q6BA 2JFKA 2PSZA 3L0WB 3KJVB 1S3SG 3ZXVA 3OLAA 3T5KA 2BJ3A 1XO3A 2W3SA 2BX6A 1T9UA 3CO9A 4PG6A 1VBYA 2XNAC 3JS9A 3AEEB 3KFWX 4K7WA 2JPHA 1YIWA 1K8AT 3OR2B 4DQSA 1S0NA 3A1QA 2NZ4A 2DAFA 3NGTA 5D77A 1KDNA 1N48A 2HBQB 1JLGA 4CNYA 5B7WA 3NG8A 5KFVA 4NYPA 3KH0A 2IYGA 3GYXB 2IGDA 3D6FB 2EBEA 4PYZA 4KRWA 5CCLA 2PVGC 2HPUA 3CGIA 4DR4F 3GYGA 5IFMA 3RB3A 3IT6B 2RRBA 3MMBA 2DBYA 1HBNA 3AD8C 2MQNA 4WFAQ 1WKLA 1FJ7A 3BIID 2CWKA 2L08A 3M62B 5HANA 1IUJA 4AL7A 2BGFA 1LXDA 5IV3A 1AA1B 3W65A 1XJWB 1HXYD 2V4JB 3KWLA 4OYZA 4NL5A 2COLA 3D6TB 3LJ3A 3NVWA 1GXUA 2QIFA 4FJYA 2QC3A 4X64F 5JUMA 4F02A 4X62J 1HEZE 3K5LA 4QCLA 3CJKB 3ZNJ1 2QTWA 2REXA 1PUTA 3U8ZA 4AUQC 2IO0B 2JJ4D 4ZVTB 4KZCA 2RS2A 1KOTA 3QRPA 2IM3A 1JLBA 3QJJA 1S4EA 1U8WA 3KK3B 2VJVA 2JSVX 5C24B 2YWFA 4X4TA 4K5SA 4GKJF 2UUWA 2RB7A 4DXAB 2ZE2A 4B3RF 5EDWA 2J8SA 4K4TA 4A6QA 3N6MA 2JHEA 2K1RB 4LF4F 3KLIA 1XLPA 2EEYA 4DQQA 5J1EB 2BYTA 1PIEA 2J9DA 3R5DA 5J2RA 4BAXA 5EN1A 1TMJA 1WSPA 4YT0B 2GS8A 1U2FA 4HLEA 4KFBA 3OFEA 4WH4A 2WYQA 5C2CA 3IBFB 3GFZA 2GVDA 4AWJA 4MYUA 2EBGA 2XM3A 2Q5WD 1QUPA 1WWHA 3S8SA 2IFXA 4EYHB 2WXRA 3IBWA 1FRXA 2IPOB 3AOCA 3T9ZA 3W64A 3DLBA 3D1HA 3BM7A 2ZH1A 1RA7A 3K5NA 4IKAA 1T0SC 2CQHA 1WJ4A 3THTA 4B02A 3IG3A 2DGOA 4YR3A 4KJIA 3LGMA 3AB2B 2IJRA 4YEAA 1V6HA 1LK7A 2C3YA 5TSSA 4B17A 3AB5A 3ZRFA 2Y1LB 1FVQA 3KK2A 4PQUB 5L1JA 4F25A 2YKNB 1D0EA 2FPHX 2YPZA 3P3DA 1KONA 1T9TA 4ECZA 5BR8F 2KWDA 5F3ZA 2WDQB 2BKRB 5LLIA 3UINB 2WBMA 4DV7J 1JRUA 4ZPBA 3ITHA 2ZCCA 5KFYA 2UUBF 4PS7A 1GTHA 5A0YA 1L0VB 3K58A 3G9CA 3TEHB 5CHWA 4LF8J 2ZKUA 3SSSA 1D8ZA 4US8A 2NPTB 4NI2A 4RLEA 1R4MI 2VFUA 3KHLA 4DUZF 2VH1A 1Q10A 4Q43A 1E6VB 1RT7B 3DHXA 3TVYA 2FDNA 2MBQA 4M8NA 1TUWA 3DRXA 4MAKA 2A18A 2ASLA 3MAAB 3EDQB 1X8DA 2JLEA 2HS3A 4IC7B 5DETA 2V8HA 3M2UB 1ICEB 1N0VC 4L73A 1MMNA 4OI3A 2CG4A 2V2VA 2IYIA 4R5PA 4DL0C 1YX2A 4USHA 3WANA 2BUNA 4P71A 2MKYA 4B3TJ 5K8NA 4JQWC 3HJVA 4JB8B 3AAWB 4KDLB 4HHJA 2LMIA 2QO3A 1C9FA 4I7FA 1E6EB 2BOPA 4K7QA 3PX4A 3T5LA 2G2OA 3PX0A 4ICLB 4WXWA 5D3IB 3N5BA 2K8BA 3KUZA 3NY0A 2ON8A 2GAGC 5CQGA 1HNIB 2XSFA 1N5WA 3UCGA 4NZ7A 3DKDA 3FEZA 2HS4A 1B99A 1AFJA 5JHBA 5KFXA 1UJ5A 1SV5B 1UEUA 1NSKL 4MELA 1KRHA 4XTTA 4FS1A 3IXSA 3R27A 3HVWA 1HYSB 1XLQA 5C3JB 3UIPB 4J9OA 2IAJB 2W7AA 2KJWA 2D2QA 4LJPB 2MZRA 4MTPA 1SCJB 4URKA 4WFBQ 4J90A 1Q5VA 2ZZNA 2KHDA 4B9SA 3CCRS 4OI4A 4PWDB 5J2NA 3JYTA 4ZPTR 5FLXY 1FCAA 4CLSA 1WEYA 4I4BA 2BVZA 3T6JA 1FFGB 1ZETA 3VAKA 5GADU 4CP5A 1QE1A 3JSVB 2V0GA 3MM8B 4WFZA 3H1UA 4QW9A 3L7OA 2Y1JA 3MR6A 1J7CA 2V34A 1RT5A 3IS9B 1NDDA 2ROPA 1EB0A 2A6MA 3T1YJ 1FFSB 4CQ1A 4N7TA 1O51A 2RDJA 2NQPA 1YJTA 3I5JC 1KF6B 1DLOB 1BY9A 1S0MA 2FJDB 1RT4B 2ZUAA 1V8CA 4DSFA 4AXIA 4J9KA 1Q7LB 4USIA 1IGDA 1GK8A 4EFOA 2M17A 1LWFA 4YXDB 4HJKA 5DQGA 4IOBA 4M8MA 3ETMA 4IH6A 4KGZB 1TL4A 3EGRA 3UDVA 1D8YA 1SJRA 4GDLA 3W7BA 2HHVA 2L9DA 1ET6A 2XSJB 2LGIA 4CI0B 3OLMD 3EZUA 4QZVB 3GIKA 2CR5A 5HK4A 1YX6B 3O6QA 4DSKA 1XXGA 3ZNUA 3CJRA 2UZAA 2E9TA 4JI1J 1HTQA 9RUBA 3M1VA 3AEDB 1X4GA 3BGUA 4B3MF 3PGEA 2V8VA 1V5OA 3GWCA 4YHHJ 3WALA 4G11A 3IP0A 1BQNA 2H51B 3OTBA 3A8EA 4G3XB 1AB8A 5DG8A 4WYWA 3AXMA 4V19X 4C11A 3S7RA 2B8PA 3M7VA 2G1DA 1FWLA 2C2ZB 4C9DA 4N47A 1PILA 3KLVA 4RNNA 4ED5A 2GVZA 1IWAA 1S5ZA 1TY2A 3JSVA 4AD6A 2FAZA 4CTAB 2OPRA 2E6XA 3DLGA 1HNWF 1C4CA 5D3GA 2KKCA 2HTHA 1T9XA 3DVGY 3MC0B 1RAEB 3FQLA 2K7KA 1QOGA 2C2RA 4NLRA 1HPZA 3VV2B 1HR0J 2PFFB 1N88A 2D3AA 4MKAA 3HFKA 2RR9A 4A48A 3LP1A 4F8RA 3W2DA 2RILA 2HNZA 4ID8A 2CQPA 3BKFA 1I4PA 4W98A 2NCKL 3E01A 1SB3C 3IGVA 2W7OA 4P7TA 3UQBA 2Y5CA 1HQRD 3M8QB 1LK5A 1S1QB 2RIJA 1DTTA 2V8GA 2GO8A 4YR0A 3WX8A 1JX4A 4LVOP 3B08A 2L76A 4FPRA 3KHGA 4TU7A 3ZZRA 4IO9Q 1MPEA 3MR2A 3PV1A 1LW0B 4FN5A 1MU2A 2CZVC 2MQOA 2HKEA 2E44A 4NLQA 4O3PA 2DGVA 1UW4A 2N7DA 1W25A 1X60A 5ADZA 3IHPC 1IKWB 4KV2A 2FJVA 2WNMA 1GAOA 2BABA 4JBCA 2RD5C 2FBWB 4P52A 1B0TA 4F3QA 4OZCA 4NZLB 2V0NA 1I94F 3N5FA 2J0MA 2JXTA 1GXTA 5JJBA 3SBMA 3RNGC 2ACMA 4HPPA 1OSCA 3T5JA 3WAMA 3W9HA 1RWVB 4EZLA 2VOOA 3L4BC 3K9OB 3RG6A 4ATNA 3HVRA 2AW0A 2XYPB 4GIVA 2W55A 2GFFA 2NSCA 4PKDB 3WC0A 1JWAD 1F6TA 1NDLA 3NRBA 1K1QA 1YBTA 5B09A 1HWIA 4LF1A 1RT3A 2D74B 2DNNA 4WTOB 1L4ZB 2OELA 5KFSA 4EO8A 3NNCA 5KFMA 4DCOB 1MWZA 4LF9F 4ZCLA 3NNHA 2JC1A 3AULA 4C3MA 3PYEA 1V9OA 3NCRA 4CO7A 5F0WA 5B0EA 2CNOB 1L5UA 3AM9A 3OUYB 1OPZA 3PJ9A 3O8WA 4R5PB 2YNGA 3LQVA 3ZYYX 4DV4J 3VAMA 4FS2A 5D6GA 2ZDPA 3D6MB 2C42A 4ELUA 4DU8A 1VC6A 3A8IA 4ZK7M 5KFFA 1RT6A 3VTVA 3NHEB 2GJ2A 2DCUB 3KQ4A 4FBTA 2C7MB 3BSCA 4QWBA 5GAGI 1NCLA 3SFGA 5J1NA 4KGRA 2EKYA 1TV6B 3KW5B 2R61A 4OHXA 4ZVGA 5G5GA 4DMZA 2DYBA 2OHFA 2KNBA 1UFKA 2CPEA 4R8UA 2DHXA 4LFAF 4M5IA 2BRLA 4I2PA 2DZKA 2DRAA 2XMJA 2CPIA 3TUJC 2IBKA 4WU2A 3HHLD 1EX8A 2PDAA 2KB2A 2WAQD 4KT0C 2K6DB 1WGKA 4CYEA 4DHJB 4X57B 3MR3A 3RB0A 2FGCA 3DRSB 2I0XA 1WTBA 3OWEB 3FMBA 2ZJDA 2BQQA 1KFYB 4RNHA 3IM8A 4W9CA 4UOFA 4UTGA 2BYVE 2Y9HA 3TO8A 4HACA 1U1RA 1SB6A 2ZJQQ 3W2VB 1HNXJ 4EYIB 3JYTB 3LP0A 2WXJA 3EWGA 1WJNA 3E8OA 3D66A 2PA3A 1D09B 3NJTA 3KLFB 2OAUA 2B8QA 4J9QA 4R0JA 2AV5A 3B4MA 2YQ1A 3NAHA 5DGBA 3ZTPA 3PFOA 2K2PA 4DXFA 2VU5A 2V1YA 2XYHB 2NLWA 2EFQA 5JHAA 1UA0A 1FKOA 1NSPA 1LQ9A 3HSDA 2XQCA 2TSSA 3MGJA 4ARIA 1WF2A 1WGDA 1PC5A 3VRBB 2MGZA 1IM6A 3NL0A 4KGSA 2KANA 5ETSA 1SJQA 2B5JA 1FRDA 1S97A 3DVNV 5C5JA 1MWYA 4CT9A 4RW7B 4Q8EA 4MEMA 4G3IA 5HATA 2R7QA 1I42A 4X65J 1KS2A 1RP5A 3FMWA 4ANUA 3Q0AA 1OFFA 4O23A 1RHMB 3GV7B 1M5VC 3GB0A 4IDKB 2IA6A 1T95A 1VZ6A 1RB0A 4A8FA 4JV0A 3R7BB 1FRLA 1C0UB 3R7QA 5BMGA 4EK2A 2HBZB 3RNEC 1XR6A 4D3HA 4B3RJ 1E0ZA 4GKJJ 4QR0A 5L1KA 4ZVEA 1LXJA 1HWJA 5GAHI 1YJIA 1S6QB 1X4FA 4AJWA 1UZHA 5H9FK 1J5EF 3C46A 2BE2A 4R8UB 4ETZA 2LHEA 1S9EA 4FYWB 1DQAA 1U8SA 4JX1C 4ED4A 4ILRA 1NK6A 4C98A 2Q6CA 3TA2A 1EWCA 2EMTA 2IC3B 4OZBA 3M9MB 4RUBA 2R2TA 2R2QA 5K5MA 4FXWA 2AJFE 3M8QA 4IO1A 4GKKJ 1Q8LA 3BQ0A 4H4KC 3RTVA 3NMRA 2KZZA 2F40A 5H9EJ 3ZVVA 2HHPA 3TUIC 4DS4A 5ETTA 2DNZA 3ZDTA 3MEGB 5HG2A 2H3EB 3KLFA 2GMJA 4KYZA 1R4NI 2QA4G 4IQMA 2GA7A 1BQMB 4IW0A 1FI4A 4H2AA 1U4AA 4ZHRB 4DDID 3KXDA 5B0GA 3LB8C 2DHAA 4O44A 3A33B 3DDIA 4AP4C 4JI0F 1T0TV 4HROA 1U26A 3DOLA 3O13A 2ZH8A 1C0TB 3EE3A 2W9BB 3G82A 2XLJA 2X38A 3TAPA 4N76A 4ZRKA 5JMNA 3CSKA 5KG0A 2JQRB 4GN1A 3TR5A 4W90B 3RB4A 3DCAA 4IOIE 4C97A 3LP2B 3BQ1A 1XLNA 1IGCA 2WXMA 5HMZA 4ECRA 4WQMA 4OLPA 1RQ0A 3AE9B 1BLUA 4MIBA 2ALZA 2X7IA 1ROFA 3B6BA 3G8QA 2PA8D 1TS4A 3ZW3A 2CJYB 3DRYA 1F9EB 4NPNA 4MK7A 2WBRA 4G1PA 1JB0C 2YWGA 2W9CB 4RUHA 4ZRJA 3MTKA 2QJLA 1WHYA 5KFUA 3SYZA 1FXLA 1IR0A 1NSQA 1FEHA 1XN9A 5C24A 4D3GA 1HD0A 1VR9A 2ZM6J 3LYYA 1RJJA 3QFHA 4LT6A 3ALBA 1VQSA 3DDKA 1ZOYB 5E3RA 1SQEA 4DQRA 1QDUB 1N5TA 5KG3A 4HL9A 3TJ9A 3I55S 3W3SA 1YGYA 3IGNA 4JYAF 4L74A 4H4OB 5IV4A 1TKZA 3NWGA 1HNZF 2LI5A 3ZGZA 3AODA 4ECVA 4ZRPA 2Y5BB 3DMJA 4JI7J 2YQ0A 4U8YA 1YG0A 3EDRB 2HHHF 3H5XA 3W9IA 1VBKA 1GXLA 2EPIA 4B9MA 2HHWA 2JEFA 3C8YA 1RT2A 5D7GA 2KVIA 1RAAB 3MECA 4PYAA 3THVA 2DGWA 1TKXA 3U1MA 5HP1B 1GMWD 3BK1A 1T9YA 3HP6A 2XMTA 1HHQA 2LVOA 2OFGX 4WFYA 1O8BA 2MB0B 1TV6A 2J6SA 2HWIA 4JI5J 3R2IA 1C0TA 2HVEA 2EFNA 1HR0F 3FILA 4ZMMA 3ADAC 3UNYA 2FZKB 4P2FA 5KFAA 3HDSA 2QFJA 2HBYB 2OJ3A 3X23A 2CQ2A 2SAKA 2O66A 1RTHA 4TKNA 2KHCA 4PR6A 4NA2A 3QSIA 3PW7A 3NGUA 4AFFA 3NVVA 3A8JA 1JWUD 2PW9A 4JOUA 1DARA 1JKHA 4K4YA 5C42A 4ZCIA 5M2RA 1F2RC 2ZH7A 5M2PA 2FCMA 2WB4A 2G1HA 3LGNA 5LJ3Y 4I6PA 4M5DB 1OTRB 2LVPA 2PO4A 3D3CJ 3U7ZA 2OEKA 3AMZA 3PRPB 1FDAA 3SV3A 3EICA 2N4CA 4WJOA 3TSSA 1QZEA 1KTKA 3N6NA 2QEJC 2PVOD 5C2GA 2O2VB 3G96A 3MI7X 2W2NP 2DNFA 2LWPA 1PYOB 2GV1A 3U02A 3CNQP 4RF1A 1U45A 4DV6J 2DNKA 1H74A 4YSZB 4FHKA 3HHMA 3T3FA 4ZOHC 3H8HA 4MDKE 1FNUA 1VIXA 2VFTA 5AXNA 4ES1A 3Q3FA 2M52A 4O0IA 4U95A 4PXCA 3QT5A 3CSFA 3F73A 2OTLS 2J0KA 4ZKAA 1V49A 1QOBA 2ZVSA 2G1EA 4J9SA 5CYMA 3SFEB 4DN9A 2J9DE 5KFZA 1MMLA 5D0EA 4DR7F 1HI8A 1E9MA 3T41A 1TAUA 5A2QU 2XO6A 5CHCB 4I0WA 4DL5A 4LFBJ 1YN3A 4QYZK 1UETA 5A8RA 3DM2B 1QTMA 2QFIA 5JXVA 3MD3A 5C2TB 2GJFA 1FFUA 3KYCD 1UWXA 2DHGA 3I5BA 1BQMA 3GFHA 2CPYA 3C6UB 5DRKA 2PPHA 2QMWA 1JLGB 1I94J 2EG1A 4U6PA 2BB6A 1RTIB 1FT8A 3GP7A 3E56A 3G6VA 2NXNA 2KWUB 2OHDA 2IDYA 4BKSD 1G4CA 2HD5B 2MKKA 3E01B 5IXUA 3GIRA 3ETRA 4KO0A 5CD4A 4W92B 3FGVA 3OFHA 2I6WA 3DOKB 3MCOA 3IR7B 1HTOA 3ONQA 1X9WA 2HW3A 3W1YA 2YEPB 3PZDA 4XWTA 1P98A 2CWXA 1JLFB 2AKWB 3FAHA 2ZHAA 2XTJP 4J37A 3CC7S 4RW6B 4W9JA 1Y5IB 4WWNA 3T9NA 1OY9A 3BGOP 1ET9A 1GJZA 1H73A 2D9OA 5EE3A 3Q23A 3FQKA 3Q8BA 4HPMB 1AXQA 3KYLA 3HFVA 3MCSA 2LEPA 1RAGB 3IVFA 3BK2A 3G8TA 5KFWA 2IJ0A 2XMAA 2HMIB 1ZS6A 1UBIA 2YXLA 3W9CB 4C3KA 3CMQA 2HHUA 1VGYA 2V63A 1P9QC 2CKHB 2V9HA 2WXNA 2KJRA 1WKJA 1VC0A 4CM2A 2GRIA 1S57A 4IRDA 1WF0A 2W7PA 1T02A 5AUKA 2N3OA 3W1SA 1QTNB 3DLGB 3LO3A 2NVUI 3OL7A 2B4PA 3OQ2A 5DLFA 1HW8A 2POKA 4J9VA 2R7WA 3PFEA 3ZTDA 3RAXA 1S77D 4RF0A 1CJUB 1ZPSA 1M5SA 2DX5B 3D1QA 4HKQA 1TYGB 3QGPA 2HBRB 2DLBA 4PXDA 5HL7Q 1QSLA 3HHKA 5AE1A 4DCPB 1VYAA 3A12A 2P8IA 3KUEA 1FXTB 4URGA 4XC2A 1OPIA 2C5LC 1Y11A 4UW2A 3QC8B 3UR0A 5I3UA 4RL1A 1IBCB 4ZJOA 2DWQA 3MR7A 3KK1A 3ELHA 1X0PA 1RTIA 3BQ2A 4ECXA 2ATLA 2RDHA 3ICLA 1FXDA 4GU2A 2Q1LA 3DLKB 2F4VF 3SQOP 2GHPA 4TLQA 4DU7A 1D9FA 2DO0A 1BQXA 1I4XA 2HG4A 1MU2B 3W66A 1SIZA 2MSED 2W9NA 4H4KA 2RMLA 3Q8UA 2VG7B 4DR7J 2RU3A 2CHXA 1H0HB 4RM8A 4J9PA 3OFGA 4RBTA 3PHWB 1N5QA 4PS3A 3CDEA 1T8EA 4ZIVA 1HNXF 2QT7A 2D11A 5K8PA 2C2KB 3AE5B 3NGSA 1GMWA 3OVSA 3FCWA 4XAKA 4WAFA 2FUG1 5KFRA 2GB1A 1J7AA 1YZ7A 5L1LA 5H1SV 1H8CA 1IWGA 2ACYA 1ZXIA 2ILYA 1FNXH 1BQNB 4M5LA 1EO6A 2OFHX 3TAMA 2H88B 3PRMB 4UOCA 3H40A 1R8BA 4DJBA 2AEHA 2KO3A 4H4MB 4NLOA 5KFJA 5HJYA 4DHJD 1SC1B 1PJ5A 3SDLC 4EEWA 3MC9A 5CXTA 3FILB 3DOWA 3R7RA 4DI6A 3D0HE 5KG1A 3O2IA 1RLDA 1S1UA 3FCHA 1U1PA 2HHQA 3KLHB 2MLZA 4OLOA 4DDGD 1EARA 3VFKA 2CPXA 5D4OA 2L9NA 1EIYB 1R8AA 3P2BA 4FP9A 4W9IA 5KT4A 1Q0WB 1L6UA 4KSEB 2FHJD 3PIPQ 2RQKA 3JYUA 1RM6C 4FYXB 2C28A 2JDJA 3P6YC 2QCZA 4LNOA 4WIPA 1L0YB 4Y2AA 3Q24A 5C1ZA 1S7IA 2HZCA 1V1PB 2V68A 4C0OC 5KT3A 2MLBA 3VAWA 4O4GB 1Q81T 5F8IA 5F3TA 3LH2S 4ASWC 1WXQA 4L72B 5B0AA 2N9EB 3UPFA 1TK0A 1UWBA 1X5OA 4K2XA 4OZ2A 4WZMA 3PTFC 2M70A 1WDTA 5CYJA 5CTRC 2BE7D 1L3VA 1JQGA 2RDIA 1NZ8A 1S72S 2XCAA 2V6AA 1IJFB 4LRFA 3D9BA 2M2BA 3G82B 4CLYA 2RMMA 4DFMA 3TNVA 5BJRA 5FD1A 1DGJA 2G13A 4M0WB 1N61A 3QA8A 1TKYA 2LVQA 2V4JA 2KWCA 1JLBB 3ZNHB 4I6AA 3IWLA 1G3OA 3RBXA 3DN9A 1WM2A 2HLTA 4JIOU 1PYWD 3NOGA 3FBBA 3ZUNA 3IAM1 1SV5A 4Y2KA 5B0DA 3UCUP 1N34F 4MIWA 2XWXA 3HRDD 3SFUA 3K9PB 2LGYA 4URQU 2B6AB 4LR7A 1BD6A 4J3OD 3CWIA 3IBEA 3MOZA 3LANA 1IBKF 4JI7F 4NWBA 2MZJA 4UT4A 2G9OA 3FCVA 3TUZC 1OYEA 4EFAC 1PBUA 2XMMA 1UBQA 2ONQA 4O1NA 2FIUA 3TAMB 5LNK1 2DRBA 3M8PA 1YOVB 3CE8A 5J2QA 5FR3A 5A8RB 2C9WB 3RFZB 3UO0A 2GC8A 4AL6A 3AXCA 3LGHA 1Q78A 4PEOA 4DV1F 3PZ7A 1F9HA 4CIOA 1F1BB 2YWWA 1XNQF 4YOEA 3TEWA 5BR8J 3HUIA 5DQHA 4HDOA 3DFEA 2N7CA 1XIQA 2ZD1B 3MM8A 5MAOA 3U27A 3NUHB 1X5SA 2KDMA 5KG2A 4FBJB 4EZ9A 5DDPC 1SGHA 3RNBC 2MHEA 3VR1A 4WK3A 4RW8A 4USMA 2VHGA 3IMQJ 2G45B 1QLBB 5LJ5Y 2OJRA 2CDRB 4J9MA 4G1IA 3AA8A 2ZWPA 4RFBA 2QIEB 4ZPWR 2MBOA 2W3RA 4NMXA 1FDDA 4HYKA 3HVZA 4IG7B 4UF4A 2MMYA 4PPZA 1YJVA 2PI5A 4DPUA 3GP9A 3LP2A 1ZTTA 4YSXB 4TQ0A 4RW4B 4ZVQB 1WRDB 1H7XA 1O6XA 3GOEA 3RCZA 2LXAA 1Y4ZB 3GCXP 4J6IA 2LQBA 4Q45A 1VRQC 3HHEA 2Q66A 3DBHI 2UXCF 3V6KA 2FVQA 4B9UA 2XSJA 1L4DB 2G3QB 3L4PA 1TL1A 4DEZA 5E3PA 2Y3AA 1LFPA 2CPFA 3RT3B 1YN5A 1J0GA 1NPPA 4P16A 1FNOA 1KLGD 1A9NB 1JLEB 1TK8A 1TK5A 2BPSA 5F8HA 4ITKA 1VQ4S 2AJ1A 2PE8A 2V5HG 4ZVUB 3EFCA 3MMAB 1VS3A 2D3GA 4JI3F 4AYBD 1JWBD 4DV0J 4BC9A 3MMCB 5C42B 5F9LA 3ETOA 4IDIA 3HT0A 2C60A 4QW8A 3P42A 3Q14C 4I6LB 1A7GE 5IQQA 2AYMA 2KN4A 5A2QY 3V4IA 4HCNB 2XY5A 2OPRB 2V2QA 3OXLA 2PE9A 1NKEA 1WD6A 1NXIA 5T7LB 3ZLZA 3R66C 2K8GA 1UGJA 2VDIA 1HWLA 1JXVA 1FNMA 2IY0B 2KT5A 3GE8C 2FD2A 4A8XA 4ILMA 2L83A 2UUCF 1YDLA 1OY8A 1LFDA 2KZRA 5GMVA 4XWWA 5KFBA 1NVID 2UUAJ 2Y8YA 2YH1A 1VQKS 5IS2A 1UWBB 5AE2A 3VALA 4HI1A 2AYEA 3GIJA 2LJIA 1K52A 1ZDXA 4OYPA 4IUMB 4ZRIA 1JXLA 4JI2F 4JWSC 2OGUA 3FVYA 1HNVA 5I42B 4B3SF 3A9KB 2Z2YB 3DWGC 1RXOB 2AJQA 3THPA 1FPYA 4CH0S 1E7VA 3OHAA 1C4PA 1NPRA 4RWWA 2OSRA 1VQLS 5HBMB 2G2ZA 3CIZA 2I1KA 2ZW0A 2CNLB 3DDCB 4O0NA 4P6QA 4FN2A 3RGIA 3WAPA 1GOZA 4HKZE 4LRBA 2R7XA 4IOAQ 4USKA 1QOAA 2XI3A 1IBMF 2B0GA 2MQJA 2J7QB 3OJ4B 2DR5A 3KUDB 1UEKA 3PACA 1RUSA 4KHPF 2AYOB 5GAHU 2CAJA 4LSNA 3ILLA 1UWMA 3CD6S 2G0CA 1E5WA 1UJ6A 1V86A 3W1YC 2LEKA 3SIPB 2BKOA 2H9ZA 3ENVA 2DXFA 1L6VA 2OEDA 2CQ1A 4DWFA 2N9LA 2XN9C 1WXMA 1DLOA 4Q2MA 3BSNA 2J0SD 3EZOA 1M90T 1KFDA 1M5KC 3BPDA 3FJ2A 3PSEB 1EZZB 1VHFA 4GXBA 4B3TF 3QT7A 3G87A 5C25B 1Z1ZA 2UU9F 3AQOA 2GVDB 1S1TB 2RT3A 1WGGA 1LW2B 2ZNZA 2UXBF 4M5GA 3KK2B 5HAOA 2MJUA 4X4RA 1NK0A 2VV5A 3PO5A 1X31C 4LFAJ 2R3VA 1JWWA 5HP1A 1KM7A 5KFIA 1RA6A 4EUVA 2XNRA 2XS2A 3AD7C 3MCMA 4LCDE 2NZCA 2UUTA 1GTEA 1OQYA 2UUBJ 1KOHA 4DV3J 1Y8RC 3NVYA 2HQCA 1U24A 4QYRA 2E1RA 3FFIB 5JXSA 4GC7A 3AE3B 1C1CB 1HNVB 2C3PA 2IRXA 7FDRA 3U1LA 3G2XA 4W4MA 2K22A 2WSCC 1D6EC 2HK2A 1UP1A 2BZ2A 4NLVA 3HM6X 1DBDA 1Y10A 3C14B 3H7SA 1HBMA 2QEXS 4ZN3A 4N41A 1ZPVA 1P1AA 2B7BB 1TGZB 3MPDA 1R8HA 2V2KA 4IH7A 4MJSA 4LJOB 1FKAF 2ADCA 1WMHA 3TOQA 2HHTA 3W2VA 3EGZA 2MBBB 4DV2F 3W5ZA 4LF6J 1KWMA 2PI4A 4J9UE 3NLCA 4G50A 2AX1A 2BYEA 1XMQF 4DHZE 4P1CC 4JI4J 3E3XA 5T8IA 1Q1OA 3NZSA 2VKZG 3AH6A 3J80Y 4NCBA 4QU7A 3EUB2 3M6WA 1H2TZ 1X4CA 5A8WB 2FJXA 2R7OA 3OFFA 1T9WA 1F0XA 3VDZA 2XO7A 2FVCA 2HQGA 5H92C 4X4QA 1QAYA 1R0AA 1RWNB 1XT9B 4PUOB 1Q5YA 2WVFA 5KFLA 3HM9A 4M01A 5J18A 4RUCA 2WS3B 3KYDD 5CAAA 2OO4A 5E3AA 3WZ0A 2FCQA 3MC8A 1ACMB 1WC3A 3SZ2A 3GQCA 2CQGA 2DYMA 2XBPA 2PMZD 1NDKA 3GJTB 1ZZNA 2M8DB 2ZNVB 3I56S 1AW7A 5D0RA 3MM9B 1SUQB 3CDBA 4D2KA 3H8YA 4IR1A 4F4XA 1S6PA 1NH8A 3H6NA 2IZVB 2VPZB 2KQ4X 3LAKA 5H8YE 5AE3A 4M02A 3P4UB 2RU9A 1FVSA 2B9EA 3DOMB 3PV8A 3CCLS 2O6VD 2LXFA 2UYZB 5MPOA 4QIGA 4DQOC 4USUA 3QHTA 2FLNA 1WI8A 5KG5A 1YN4A 1TKTB 4LIRA 1KJTA 3TQEA 1RWMB 3NY5A 2UVRA 4N56A 2YBVA 1U49A 1K73T 4WTYA 2DZIA 2CJNA 2R8IA 2WB1D 3MHZA 1U6BA 1RT7A 3DLLQ 3IBCB 3GILA 1SIWB 2JZ3B 2GBMA 2BEFA 1VCBA 1WMHB 1VLBA 2DPJA 2M5YA 2JWNA 1JJ2R 2HVIA 5E0OA 2WDRB 3FKYA 4CLLA 2A3JA 1RWWB 3ZTRA 1S1WB 4I6YA 5EHHA 2JU6X 2P6TA 3HSZA 2M0XA 3G86A 3QJPA 4JLCA 3GJSB 3QWPA 2YKNA 4NYZA 1KD1T 2H89B 2RDDA 2P6SA 4NASA 2D3UA 1WE7A 4WFXA 4M63A 1NJYA 2ZNYA 5HVFA 1TVRB 4TV3A 4HDGA 4C2MA 4XE0A 4PUOA 1XWLA 1EU3A 1R4NB 1IKXB 4E0DA 4DL2A 3EUNA 1N0UA 3UCZP 1NAQA 3VAFA 1SF0A 2E1AA 4B0EA 3CJ4A 2GJIA 3U52E 2XNQA 2ZH9A 1RLFA 4DUYJ 3I82A 1P3QU 3ZTCA 1M5OC 3Q3MC 1GAQB 2XHCA 2VQFJ 3AN1A 4I2PB 2ICIA 4JI8F 1LV5A 3VZIA 2DZMA 3IWXA 1UZDA 3R5JB 1T94A 3BO2A 2PJHA 3RD2A 1X9MA 1RT1A 3D5MA 2Y1RI 1E8XA 2IDEA 4KB7A 8RUCA 3H7HB 5IC4B 3E51A 4CM0A 3OSPA 2DR8A 2RF2A 3P5TL 4RX6A 1YRUA 2MWSB 3DRPB 2RQ4A 3M05A 1XBWA 1CC8A 2DH7A 2EFPA 2OPPB 2F7VA 3OXGA 2LGXA 4FADA 2BW2A 2MSTA 2DY9A 1KTVA 1N5YA 3NWRA 3DWMA 3FZBA 4GRSA 4P9SA 4LNIA 3NS8A 3SDEA 1MW7A 4QIWD 1KLUD 3A1QB 1WX8A 2QMXA 1SC4B 2FLLA 5KT5A 3TQ1A 4DBGA 1RWSA 2KC2A 4O3OA 1VBZA 1X1MA 1RBLA 4YTNB 1WGRA 2B9XA 3PM9A 2WP9B 2DTJA 4C0BA 3CD0A 1NLKL 1RHQB 3UW1A 2VUGA 4U8VA 1LQBA 1K8RB 2C2MB 1WNEA 1JLFA 3UFCX 1TFYA 4XYCA 4P74A 3D0IE 1TJEA 4GC6A 2WXLA 4ICLA 5ETRA 1CMXB 4RBVA 3K5MA 1S10A 5CCMA 1ZOTA 2UVWA 1EF1A 1KQSR 1IKXA 1TTHB 1F2HA 4L76A 2L8JA 2E1MC 3H5UA 4AXJA 2X3DA 4ERDA 2ZBQA 2NXEA 4PAAA 2RJZA 3FFIA 1WHXA 2J7WA 1RWOB 2I5JA 5ETNA 4QIEA 1CSJA 4MKVA 1JCKB 1VDVA 2DHZA 4DLEA 3BO4A 3KNAA 2H5JB 2HURA 3U30A 5LOQA 1TUVA 2JWUA 2KKHA 3WHIA 2F1FA 4ICVA 1L3UA 3MF5A 1F52A 1GQEA 1HBUA 4N8NA 3K0JA 2IBOA 2WVBA 5EE9A 4RW9B 4PYDA 1NZAA 3RBZA 4IQXA 3LA0A 1I1GA 3R9LA 3D3BJ 1TZ1A 2FZGB 2QJ3A 3EECA 4OVVA 1VQPS 2HVHA 4OYIA 3FNNA 3TBLD 1OEYJ 4QQBA 2FY8A 1NHUA 3CDUA 1QKZA 3KHRA 1R89A 4CWBA 4LDTD 5IT0A 2BE9B 2QSFA 2B7CB 2ZH2A 5E6JA 4OX9J 1GX5A 4GDKB 2MA9B 4F67A 2J5AA 4NA3A 2MJ3A 3VQSA 4BKGA 4GGQA 3RR7A 2ZUGA 2HJ8A 2QL7B 3ILOA 2CNNB 2FC9A 4O3QA 3AEAB 3VQTA 3BF4A 3GPAA 2D7SA 2Y0BB 3H59A 1CVJA 1JNZB 2AF6A 2IMWP 3AH7A 4LK0M 4WJPA 2CKWA 4ZP9A 4KV8A 3N1ZC 5GAEU 5DPRA 4PABA 2OJWA 4FULA 2KAJA 4C4VA 2I1JA 2QE5A 1S48A 1MROB 3OJUA 3TEZA 2MBEA 2BYFA 2LUMA 5D78A 4EGLA 4OW0A 2Z2LA 2KT3A 4DF4A 2OSQA 3CD7A 2BVCA 4IFYA 2BS4B 3R7NB 5ETLA 1AYFA 3ENAA 4M0WA 2CPJA 1U2RA 3D1OA 4YDXA 2RHQB 3BGRA 3G6YA 5KT2A 4XDDA 2HNYA 2HWHA 2HRYA 2VZ9A 3HULA 1YJNS 1RU1A 5KFCA 4PWWA 1H3DA 3PR4A 2DT9A 4JV5J 3QO9A 1WG4A 3QZ8A 1K1SA 1BT0A 2M9KA 2R2SA 2QYGA 1J27A 5LXIB 2UWQA 5F0UA 3V6DA 1TBEA 3PJXA 2HNZB 1TL3A 4IH5A 2HHHJ 4ZVRB 2A2DA 3M2UA 1D1UA 4KSLC 1N36J 3R6LB 3RMKC 4KO0B 4K1RB 2DNRA 3BR8A 1QM9A 3I87A 4M5KA 1JMTA 5DCNA 1C78A 5MLCV 1PGXA 2VG6A 3Q8YA 3PKMA 2J7KA 3GIMA 1T0QC 1QUVA 2ZJPQ 2WONB 3I4PA 1ZTWA 1U09A 5JVGQ 1MHXA 2QDFA 2QLWA 3C19A 4LBIA 2OOBB 3DHGC 2LGDA 1SJHD 3AFGA 1RAFB 1FRKA 3OVBA 1T0RC 1L5PA 3M63B 1Z5SB 3AECB 2J0QD 4RNFA 2CVIA 4TU8A 4E71A 5GMEA 3T9LA 5ITHA 3GMGA 3X3UA 2KFZA 2J6UA 1H2UX 3HSGA 4NEYA 3N1YC 4HCPB 1X4BA 1V3RA 2I8EA 3HK0A 3T5HA 1EQMA 1WOPA 1HQUB 5CYMB 3IN5A 1F3FA 3X1LB 5IZHA 3ITHB 1OYDA 2AX0A 4ID5A 4YMEA 3CF5Q 2HFVA 4BWJA 3AEFB 2GW8A 1VLOA 5IT4A 1ZAXA 1YIJS 5KT7A 1CJUA 4DV0F 4M94A 4S0RA 1S9EB 1NNDA 2P5VA 3APDA 1FKPA 2KXNB 4PXEA 2WU2B 4NXMF 1SKWA 1TL3B 2MKCA 2OUGA 2KL8A 3K8VA 2V8DA 2QLBB 2KX0A 1L7YA 2PTLA 3F44A 4LRDA 3R2DJ 1ZDVA 1F5AA 2H48B 1U4BA 2EKNA 1MHHE 3DBHB 1ZYQA 4ANCA 2IO2B 4UDUC 3DHHC 1FERA 2RKIA 2W25A 3R2CJ 5K9FA 2ASQA 1UVLA 1U2CA 3K5OA 2NTTA 1J5EJ 4HH1A 1UL3A 1RDRA 1AWDA 1UF0A 3SEBA 3BWUD 3WC2A 1OIAA 1ZW7A 5HMYA 1U0HA 1KVIA 2GOWA 2RVJA 3ULHA 3BBBA 2LQ9A 4A8XC 2KT7A 3MM7A 2MZQA 3H20A 2RD0A 3P96A 2R8KA 4M95A 3GONA 2K3KA 1HNIA 5DPTA 2LMCA 2Q79A 2ROGA 3A9KA 1U1QA 4W9KA 2V8PA 4P2SA 2UVUA 4C7QA 4Y3CA 3GV5B 2MEKA 3HD2A 1N6QB 3FEXB 4W9DA 2VJUA 1BWEA 4C8OA 2NXJA 3DNCA 3JXOA 3JQKA 4UZBA 3GIIA 5IAAC 4Z2XA 5A0YB 2WX0A 3DOLB 1V9JA 3QJZA 2ZZTA 3NS7B 1JROA 3GZNB 3PLVA 2IAJA 3HIZA 3ZZUA 4FA6A 2AQ2B 4ED3A 2KFNA 4YTMB 2B4UA 4V1Ak 1A6LA 3RAQA 4RWXA 2SXLA 2KXHA 3VTWA 2JVRA 5DPSA 5EWFA 4FJVB 1Q8BA 1Y3JA 4Y00A 1VK8A 1WHVA 5D3DA 1G2EA 4DS5A 2UU7A 2DYAA 2ZITA 4BCAA 4X4OA 3HZGA 4ZVSB 3PCOB 3FC4A 4DPXA 4L3NA 1SL1A 3M6UA 2VC1A 3QO9B 5AUIA 1MN7A 2WXKA 1PGZA 3LXFA 1WYGA 5DDRC 4E2FB 3VVUA 2KVQE 2R7TA 2MJEA 4DZ6A 3PW4A 3KUGA 1U48A 5M2UA 1BUIC 2BBCA 2MEWA 2CNKB 3GB1A 1NENB 2RS8A 1VZ7A 1KLVA 2X3GA 4KGXB 3KDNA 1NMEB 3C16B 3PZ8A 4F0KA 2DVIA 1OQ3A 3N32A 1TMMA 1YJ1A 3PT2B 4NLXA 1Z2LA 4Y6IA 1WR1A 1FXIA 2KU7A 3ZTOA 1FHTA 2N1VA 1KFSA 1LWCA 3PR5B 2X1GA 4KGKA 3V6EB 4ZHPA 1KNZA 1TVRA 3A3NB 2JH3A 2VQEF 3ZIMA 3AE4B 1DZ5A 1IQTA 4WCEQ 1SL0A 5F8NA 1NKCA 3EM1A 5DQIA 1ROEA 1UMJA 2FYXA 3VF0B 4F8CB 2HWTA 4K81A 3TA0A 3CWJA 1V5VA 2K1FA 2J76E 2KTQA 2Z59B 2DR9A 2O1PA 4A46A 1MNEA 2INNE 2Y1IA 3PY8A 2LUEA 4BHQA 1IJEB 3ABVB 3FSIA 2B51A 1GB1A 2GCFA 2F5GA 3MUVP 2EI5A 1WJUA 4WWPA 4QOTA 4EBEA 1RACB 3EYZA 1S9FA 4GO7X 3JB9k 2PMHA 1HARA 2RF2B 1JQ4A 2VG6B 4DFKA 2IRUA 1WZ3A 2CQ0A 2ZPNA 3RZAA 4HTIA 4OZAA 3TW0A 5BYSA 4ZLPA 4YQWA 1HWUA 4LBPA 3N9UC 1LXNA 2XG8A 2E7VA 1TQLA 1VRTA 4C7YA 2FLOA 4OVZA 2PEBA 1U7LA 1ZH5A 5H9FJ 2IPKD 2ZVNA 3KK1B 4OHWA 3ILIA 1XCQL 4YUDA 3SI8A 2JX5A 2J7UA 4EBDA 3VAGA 4LSLB 2VH2A 1QLNA 1B0VA 1UAWA 3SCKE 1RT5B 2MKIA 1AYEA 2FHJA 2WTFA 1VJKA 3K2YA 1ZP0B 2FY1A 3LDZE 1LWFB 4OFZA 4IFVB 4GVLA 1Y0HA 2APOA 3ML8A 3FZ2A 3KHHA 2FCSA 2O2VA 2DZJA 2NUUG 2YNFA 3DMJB 2KT2A 1FDNA 1P0RA 4QWCA 1VOMA 3US5A 4IRCA 4HLBA 4QIVA 2EELA 1WXVA 3WCQA 4B9LA 5ETMA 4RM9A 3BH7B 6AT1B 2I9SA 3PEJA 2M0GB 4S17A 4QYZJ 2G0JA 1OS5A 3A9JB 1E6YA 1V81A 4KKJA 1X5TA 2VD3A 4HPLB 1FRRA 1VRUA 1S0OA 1TT5B 2INCC 5L83A 3UVJB 3T19A 3RRHA 5AJ3F 4LJMA 1HZ6A 4NNJB 4KKIA 2Z2ZA 3NCQA 2KQ7A 4NJ7A 1NO8A 2W8LA 5IWAF 1TKTA 1P7EA 5KAKA 2XGPA 4YDDB 2Z4PA 1E8WA 1ZM2A 1PDXA 3HHDA 4OV1A 2DGSA 2J8AA 2GI9A 1RU2A 1HA5A 1TKZB 4HRSA 1M1HA 1IR2A 1RWXB 2MHNA 1YRXA 3B9JA 4TU9A 4Y34A 1O5JA 3ZJUA 1FD2A 1AARA 5IC6B 4DXLA 3URYA 1RHUB 1NDCA 1R6VA 4IR9A 8AT1B 4ZP6A 4FXDA 1UPMB 1SE4A 3TEGA 3OR1B 3H4BA 2YY3A 2JRHA 1UD7A 2YLMA 4DG1A 5LM7E 1AT1B 1TS5A 5DG7A 1NJWA 1YK9A 1SXLA 1CG2A 2DKOB 4QBUA 4M5MA 2W4DA 2F65A 2JZZA 4C80A 3W60A 1PQSA 2HNDA 1RGVA 1NK7A 3NMAA 2Z2MA 2IVFB 3QMQA 4XDCA 3ZJTA 3LAMA 2BBEA 5HQ8A 4N58A 1YJ7A 2HIYA 2R7SA 3GZ7A 3UN3A 4ES2A 4Q8FA 5DG9A 3OBIA 3UQSA 3DCGA 2KFJA 1HW9A 1IKWA 3P4PB 5K8OA 2JNJA 4J9LA 2BACA 4ED1A 1JLCB 2EWHA 2YPYA 1XMOJ 1FCLA 3GSDA 2CQ3A 4C8YA 1S79A 4RW6A 3AJ2A 3QT6A 4MM3A 2E5LJ 3HKZD 3FKBA 4RW9A 1PGAA 2QMTA 3L3CA 4L23A 2CIMA 4OZJA 3WIMA 2D3O1 1FRMA 1SH0A 4P7VA 5U47A 4DX7A 3DQVA 2MX2A 2OPQB 2DXDA 2LU2A 1I4HA 1YKWA 3BYYB 1WY8A 2DGUA 1OJ4A 2ASYA 5I42A 3KLEB 3I9ZA 4IG3B 4U7CA 1KHVA 2V3NA 3WIUA 3QIJA 2J52A 2W01A 2IC3A 2V94A 4MMOA 1EKSA 3JSMB 2FIDA 3RZFA 2WGSA 2J9CA 2ZFHA 3J81U 2D3CA 3M2VB 5D4LA 3ZXWA 5IN7A 3OL6A 2CU3A 4DV5J 1GFWB 4K8RA 3H0PA 3OUYA 4FDFA 5EUHA 4ENOA 2R7VA 3DBLB 3RBEA 4NAWB 3GG0A 3R6GB 2WVCA 2BQ3A 3R97A 4F04B 4NEZA 4NLTA 1CQVA 5I3UB 1VQ6S 2WXHA 2VDHA 4RNMA 3N30A 2E1PA 2C1EB 2DGXA 2KC1A 3P1MA 1R3NA 4DXGA 2FTRA 2ERRA 1WIAA 4ZPCA 4ZDVA 4O4RA 4C3LA 5HSPA 1RHKB 2N4DA 1WC6A 4CO0A 1QF6A 2MW5A 3ENWA 5I3QA 1R43A 4HK2A 3A1YG 5E33A 5FK9C 2ZZPB 1Q4RA 4M00A 3NS6A 3GSIA 2LRWA 4ZVHA 1W7WA 1VZ8A 1R7IA 2YNIA 3BYRA 4K2JA 1KR4A 3FEYB 1YJWS 2KTFA 4MACA 1QT9A 3BVMA 1WG1A 3DU5A 4JV1A 2OMOA 1LO5D 5L39A 1L3KA 3H42A 2LYVA 4WJNA 2XGQA 3PPAA 3QLHA 2LGSA 5HI1A 4B9TA 1GNUA 2HQIA 4QR1A 2ASJA 1DQ8A 4K4SA 3N01A 4LR8A 2ZH5A 2I38A 1NBEB 2LKZA 3BKUA 1Q7YT 1P9DU 2YKMA 2B3AA 1V80A 2JX2A 1NDPA 3TYTA 2HEKA 2IO3B 3SXLA 1CPZA 1I51B 2MKJA 1FJCA 3OTDA 5KOXA 4RR5A 4WXOA 2BRKA 3POTB 2N3LA 2KM8B 3SV4A 4KE5A 3MJ5A 4ID5B 5E6NA 3O44A 1FCCC 4AS1A 3BDPA 3OG5A 4DR3F 5ETOA 4ZCMA 3IFWB 2CJKA 2UUCJ 4C11B 3M9OB 2L41A 3L09A 1SQFA 2DXEA 1DHMA 3ZDMC 3C6TB 1WOOA 4CH1A 1QQRA 5HBMA 3UGBB 1UGMA 2JL9A 3C15B 1IBLJ 2BJ1A 2VFVA 2NSBA 4ANEA 6FD1A 4TVAB 3T8MA 3QQCD 4WJBA 3Q2TC 3TARA 2L52A 4M8LA 3VCDA 2Y8WA 2HVDA 3T3NA 3VGUA 4DPTA 3TZXA 4N6EB 5FDLB 2XEWA 2LECA 5D15A 3BEGB 2Q6BA 2PIAA 2VG5A 2QILA 2ILZA 4CO2A 2K5PA 4GLSC 1V5TA 2IMOA 1T05B 5C7PA 4EZ6A 3M8RA 4LF6F 3L7PA 1U1LA 3D0GE 1RRBA 3DOMA 4NXNJ 4NLUA 3JQMA 4MSQB 4QWEA 1SBBB 3SQGB 2W9AA 1UPPA 3VVWB 4BVUC 1Y5LB 4CO3A 4ED0A 1HE8A 4NLPA 4TQSA 2VG7A 4B9NA 1F77A 2LHDA 2AJ2A 1VQ7S 3DYAA 2F63A 5AXLA 2XY7A 3MEGA 3LPEA 5JZEB 2CDQA 4GSWA 1BMLC 2MCNB 5F8LA 4E3CA 4H54A 2AU0A 4IUFA 2SEBD 1S1TA 3R8YA 1Q86T 3RU0A 5KFKA 4S0MA 4HHUA 4E98A 2JEGA 4OYAA 3MPUB 3UF8A 2AX5A 1EP4A 1WI0A 5KT6A 4LREA 1Y5NB 4I6NB 1A5RA 3P4SB 1J5OB 2B3TB 3BVZA 2UXBJ 1JLCA 2JEIA 4XPEA 2VC0A 3DRRA 2UVVA 1NUEA 2EFGA 1NI2A 3J7AN 2AYGA 4YB1P 2EC2A 1HNWJ 2MY7A 2YEPF 4GKKF 2ZBCA 1G6BA 4GO5X 2KHWB 2ASDA 3NZUA 4MJSB 4RGTA 4UUWA 3QJLA 3N9YC 3SDEB 3SMZA 4II3B 2O5DA 5CHFA 1PGBA 5G0RB 4REZA 1A70A 1QILA 1KSPA 1VJQA 1HPZB 3MPVA 1LEOA 1B4SA 1Z2ZA 4ED8A 1WJ6A 2IGHA 3I63C 3LP1B 2V3PA 3M3JA 3OTOJ 1Q16B 1RAJA 2J42A 3Q8FA 4JL9A 3JSMA 1TUGB 3KTQA 1CULA 3HO1A 4A8KA 4F4KA 2LLZA 1U0SA 3FBFA 1NSAA 1YQ3B 3MHYA 4M5HA 4PG4A 3M2VA 2VZKB 2CU1A 3KJFB 1TELA 2FB0A 4GVBB 1LOUA 3AOBA 2BB5A 4PCQA 5FIIA 1JRPA 4QPTA 3T1AA 2EMSA 1PYSB 1KVJA 1WGHA 5HVGA 4TMAB 1GT8A 3CCQS 4ER8A 5LXYA 3WX4A 2VONA 4W9LA 3M6XA 3JTOA 4U67Q 1XQQA 2MYFA 2R8HA 4ECTA 4ZYSA 1TL7A 2ABYA 3I5CA 1H7WA 2DH8A 3B2GA 3LTOA 3IAS9 2WVDA 5HQMA 4LMZA 1DYQA 4LDTB 2K3IA 2V4QA 3BSOA 1BHNA 1FRIA 3RR8A 2FJWA 3DRSA 2R2OA 1F9JA 1R7SA 4EKUA 1RBAA 5D6JB 4CLWA 5J2PA 3EVOA 5E6PA 5CHVC 4EBCA 1UH6A 4LNFA 3BGFA 2E7WA 3CD5A 4CTAA 3CUNA 3U7JA 2XY6A 5HHDG 4FNHA 3AJ1A 1ZAWA 5IOLA 1EAYC 3M32A 5EX0A 3W1SC 3Q69A 2VRRB 3BV8A 5D4NA 4RUAA 4KH1B 2NPTA 2WU5B 1JJ4A 4MK8A 2ZVOA 2C2DA 3V2UC 2MXYA 3HVAA 1CJTA 1UEVA 3OLBA 4F26A 1JWMD 3AHPA 3GYNA 4LF2A 1BMQB 1NJZA 2XEXA 1WSRA 3BSAA 2J0WA 1TP7A 1JWSD 2CJXB 4DDFA 2ZJRQ 3T3OA 3DU6A 1U25A 4WZQA 2YWKA 3KLIB 5RUBA 1QAXA 2KOXA 2QN6B 1XEZA 4USVA 3MEEB 2FNJB 1N4LA 4G1QB 3UDLA 2M8HA 3CCTA 1WDDA 1KHWA 1Y3KA 2OPSA 3W2WA 4X4VA 1RAIB 1RZMA 1T03A 3RI7C 3L95X 1FO4A 1EM7A 1WM3A 2VPXB 1SJ4P 3AJDA 3ML9A 3CCJS 4Y2IA 2UU9J 4GOCA 1MROA 5T7LA 4NLYA 3RZWC 3K17A 2CA9A 2MDAA 4ZRQA 2KQSA 5KFOA 2W2PP 2J0XA 3H2VE 1VQ9S 3PRZA 3CXCR 5L1IA 4FZVA 4IG0B 1WJ9A 5IM0B 3Q2AC 5KFTA 5E5NA 1OSDA 4KIKA 1FK9A 3I0RA 1G1XA 3BKTA 1DTQB