4GLSC

Crystal structure of chemically synthesized heterochiral {d-protein antagonist plus vegf-a} protein complex in space group p21
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
56
structure length
56
Chain Sequence
TYKLILNGKTLKGETTTEAVDVFDAFDVFFVYAASNFSDFDDWTYDDATKTFTVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Growth factor/inhibitor
molecule keywords D- Vascular endothelial growth factor-A
publication title Chemical synthesis and X-ray structure of a heterochiral {D-protein antagonist plus vascular endothelial growth factor} protein complex by racemic crystallography.
pubmed doi rcsb
total genus 16
structure length 56
sequence length 56
chains with identical sequence G
ec nomenclature
pdb deposition date 2012-08-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4glsC00
4WH4A 2LHEA 1C9FA 2ZW1A 4GLSC 1YMHE 1FD6A 1K51A 1MHXA 5HHDG 1KH0A 1K50A 2N9KA 1PGXA 1GB4A 2KWDA 2JWUA 3FILA 2LUMA 2I38A 4KGRA 1JMLA 2QMTA 1FCLA 1MHHE 4OZBA 2GI9A 4KGTA 2KN4A 2OEDA 1EM7A 1K52A 2JSVX 1K53A 1ZXHA 3GB1A 2IGDA 2QSDA 1Q10A 2RPVA 5BMIA 2NMQA 3UI3A 2ON8A 1D4BA 2LHDA 2JU6X 2KACA 2PTLA 1XF5L 2JXTA 1HEZE 1IBXB 1IGCA 1HZ6A 2K0PA 2I2YA 2ONQA 1P7FA 2IGGA 1PGAA 5BMGA 1XCQL 3V3XA 2J53A 1MVKA 3MP9A 3FILB 5BMHA 1FCCC 1MI0A 2RMMA 1P7EA 1MPEA 1UWXA 1IBXA 1YNTE 5HG2A 4KGSA 2J52A 2ZW0A 4IKGA 1IGDA 1XCTL 5HFYA 4D2KA 1F2RI 1HZ5A 4OZAA 4IOIE 1QKZA 4HJGE 2EELA 4MACA 4OZCA 2KDMA 2N7JA 2LGIA 2JZPA 1PGBA 2KQ4X 5JXVA 1F2RC 4HKZE 2N9LA 2PLPA 2IGHA 2PW9A 1GB1A 2GB1A 5HI1A
chains in the Genus database with same CATH superfamily
4ICUA 5FKAC 4ACFA 2GRIA 3MC8A 3ZKJC 1FEHA 2PMVA 2M56B 3VR9B 2HD5B 4ANWA 2A5UA 3KUDB 4MM3B 2UYZB 3N30A 1WZ0A 3EECA 2GBNA 3OAWA 4RF1A 2KTRB 4M0WB 3DBSA 2EMSA 4ARIA 4DXAB 2KMCA 3UIPB 3Q8EA 4WAFA 5D7GA 3RZWC 3AECB 2FUHB 3BK2A 3Q3MC 4GU2A 5J18A 3LYYA 3AE1B 1WIAA 3QHTA 2WWZA 4Q2JA 2D11A 1IGCA 2BYEA 5LXIB 2PKOA 4FHJA 4L23A 1Q0WB 1RAXA 3Q8CA 3DVGX 4JQWC 3MC9A 1P7FA 3RT3B 4ICVA 3ML8A 3EA6A 1AYFA 1H8CA 3A4RA 2VH1A 3IG3A 3OJ3A 1UWMA 5TSSA 1PYWD 3ZGZA 2LVPA 1JRPA 1WFYA 1UF0A 4GIVA 3UINB 4DQOC 4A55A 1PDXA 4CQNA 3H1UA 3MJWA 1P7EA 3ZJVA 1MPEA 2D10A 2KN5A 3DPDA 5D6JB 1FNUA 3DBLI 1QOGA 4HPPA 1WWTA 3JW0X 1RWSA 2K1FA 2KK8A 4EZJA 2BW2A 2MWSB 4MACA 4M8MA 3KUCB 3U30A 1WI0A 1UZXB 4ANVA 5JXVA 2KQ4X 2V3NA 1C79A 4P1BC 3UF8A 5BYSA 1J8CA 2VRRB 2IDYA 2J0MA 4WWNA 1WXAA 2ZPYA 3PZ8A 4MGYE 3RPFC 1D5ZC 3PHXB 3PLVA 2L0FA 2MSED 1AWDA 2AYOB 4N6EB 2KWUB 3Q6BA 2DWQA 4URKA 5FR6A 3FILA 4A8XC 4WJPA 2G1EA 3TEWA 3V05A 1FXIA 2GBRA 3HM3A 1E0ZA 1EM7A 3SEBA 1G6JA 1TTNA 5IAAC 3KWVA 3AEEB 4XC2A 3MFGA 4CYEA 2GMIC 4ASWC 3RNEC 2Q5WD 2L76A 4JLCA 2WYQA 3UI3A 4GMVA 2DZMA 4KVGB 4C4VA 2MQJA 1TGZB 1I4QA 4AJYB 1F77A 3A9JA 4HLEA 2CS4A 3EFUA 3TCAA 2KJRA 2NVUI 2IGGA 3NVYA 1I4XA 1XXGA 4AP4C 3AE3B 1GG3A 3ZW3A 2GBJA 2IO3B 1MG8A 4NNJB 1PFDA 2D5GA 2J53A 2KWCA 3W5UB 4W9FA 1T0QC 3FILB 1UUPA 2KJ6A 2LI5A 3RYTA 5BMHA 2FCSA 2WXRA 5AUIA 3IBEA 4WJOA 1QOBA 4KSKC 3IHPC 3AM9A 5E6JA 4KIKA 2JX5A 1D3ZA 4XZ4A 3M95A 4OZAA 1WGGA 3T3NA 3V62A 3B08A 3AV8A 4K7SA 2AWTA 4WQOB 2Z59B 4DDID 1TIFA 2ZVNA 2JUOA 4C4VB 2DLBA 5H8YE 5C2TB 2N9PC 2IO1B 2JY6A 1YN4A 4L2YA 3Q2AC 1RLFA 2JYTA 2MP2A 5I4DA 1L7YA 2V4LA 5TR5A 1WGKA 2K25A 4HKQA 5HKHA 2RGFA 1H4RA 2IPKD 2MW5A 1KH0A 2IY1B 1ZP0B 4ANXA 2LRUA 4MH0E 3CIRB 3BIID 3BWUD 3R2IA 2CJOA 5T8IA 4E74A 4L1BA 1J7BA 1KM7A 2H88B 4LK0M 4G0NB 4XYCA 1GNUA 4HK2A 4KIKB 3A4SC 1P0RA 3WAOA 1FIQA 4LLGM 4AJWA 3N1YC 1CJEA 1F9JA 3V60A 3HHMA 1XF5L 1YOVB 3R7RA 1JW9D 2MP2B 1N63A 2INPE 1YN3A 3L13A 3DVNU 2RDBC 2XK5A 1NI2A 3QIJA 2ZNVC 3APFA 2D3BA 2K8BA 2JYEA 1ZE3D 4FJVB 4GSWA 4II3B 4ZRIA 1XCTL 4S17A 5CX3A 2EKIA 1P98A 4IW0A 1QKZA 1FFVA 1C4CA 2BQQA 3QAQA 4RCOA 2K6QA 4ZRQA 3ENEA 2CR5A 3HUIA 1VDVA 2WXFA 1E8YA 3GOEA 2XNAC 2MBBB 2PVOD 1B1ZA 3R66C 1OQRA 2IGHA 2BB5A 4IWPA 2KFKA 2KYWA 3OJ4B 4TUUA 3BVMA 2XK5B 4DHZB 1ET9A 3BY4B 2KJHB 1WX9A 4JWSC 4A9AA 2IY0B 1KFYB 2KX0A 3KW5B 2PE9A 2JPHA 4NJCA 2LXCA 4HEA1 1HTOA 4EE2A 2KDBA 2RPVA 2MJDA 1V5OA 1OFFA 1UD7A 3AEBB 3A33B 3I9V1 3NS1A 3ZUNA 2NMQA 2GBMA 3MJ5A 2W3SA 3C0RB 4W9JA 4OHJA 1HEZE 4TMAB 2LGSA 1IBXB 3NZ3A 1V8CA 2K0PA 4RGTA 2JF5A 1ACCA 2KVZA 1C1YB 3N1ZC 1D5MC 3HK0A 4J6IA 2KFKB 3FC4A 3EC8A 2LASA 2KVRA 5BMGA 1YJIA 5C1ZA 3PTFC 3C8YA 5JH5C 1WXMA 1V6EA 2LJIA 4GDKB 1VLBA 4P7IA 1KTKA 3MP9A 1WR1A 3AE2B 2L00B 2CU3A 1E10A 1E5WA 3L4PA 3BVZA 5AEKB 3KWLA 4NY0A 3VTUA 2EKEC 5D3DA 2QEJC 1WXVA 2M19A 3ZJUA 2V4IB 5JZEB 3DQVA 2WXJA 1XLNA 1Q5WB 4OVUA 1T0SC 5D2MB 3R8BA 4IWOA 4IWQA 3BK1A 1SSNA 1SF0A 3RZFA 2MH7A 5DPRA 1WGDA 1TS2A 2A4ZA 3KYCD 1TKYA 4O1NA 4XWWA 3Q3FA 1ZW7A 2DZJA 2YEPB 3DHHC 4KX6B 2NS5A 1KLGD 3Q8FA 4EEWA 4W9EA 2JWUA 3RI7C 4TSSA 3TL5A 4KGRA 1JMLA 4TKNA 4A3OA 3IAM1 4KGTA 2OEDA 1L2NA 1K8RB 1E7PB 2HE7A 3AU4A 3X23A 4LNNA 4DBGA 5IKCM 4GDLA 1D5XC 3NJTA 3L54A 5FR3A 2H89B 4B6WA 2N1VA 2L1AA 3Q3OC 3U4EG 2MLBA 2M1MA 3RULA 2PVGC 2JXTA 2KT7A 1VCBA 1CK1A 3BYTB 1WMHA 3AU5A 2KTFA 4FBJB 1YQ3B 2OJRA 1NBFC 1E7VA 3NZSA 1XCQL 2MBEA 3MHZA 1JWSD 4HPLB 2HJ8A 4US9A 2KX3A 4FXCA 4F7ZA 2FIDA 4M01A 2KQ7A 2DBYA 4W9KA 1WE7A 4YSYB 4MELA 3DBHB 3V6EB 3KUZA 4NJ7A 3H7SA 4YWGG 1IGDA 3I63C 4DXFA 2VH2A 3ZJTA 4IOIE 2AX5A 4GDLB 2EELA 2LZ6A 3TSSA 4MEMA 3B2GA 2WXQA 1GAQB 4JGHB 3ZRCA 5CHWA 2PIAA 3VUYA 1WMHB 4WIPA 1C4AA 1FFUA 1HE8A 3QWZB 4E71A 1V1PA 4GLSC 1V2YA 3LB8C 2WDRB 4W9GA 1L0YB 2YVCA 3A9KA 1C3TA 1ESFA 2MEKA 3CSFA 1HQRD 3N32A 4HCPB 3WAMA 3GP7A 3P4PB 1ISNA 1K52A 4JPSA 2BYFA 4OVZA 4RMAA 3AE6B 4XDCA 2ZCBA 3ZDTA 3UGBB 4OVVA 2K3UA 2XEWA 4YL8A 1LGRA 2ON8A 4F1SA 1ET6A 1IPGA 2AQ1B 2WHIA 3PVLA 3V6CB 2B3AA 2WU5B 1WXQA 3L10B 3DCGA 1LM8B 4IM3A 1V1PB 2L83A 3H7PA 3UIOB 2CHZA 3KH0A 3V3XA 3NVVA 2L0TA 2KHWB 1FMAD 1KRHA 3L16A 4W9DA 2C60A 2RMMA 1YIWA 2KC1A 3NG0A 3PPAA 2WDQB 1YN5A 3AB5A 2L32A 1R4NB 4C56C 1T6BX 1UGJA 1WGHA 4D2KA 1R4MI 2WXNA 1I4HA 2FIFA 2SEBD 1SBBB 3U7DA 1QF6A 3BVGA 5EDSA 4MGKE 4GOCA 4RGOS 3HVDA 1Y8RC 2DENB 1E8WA 3QJZA 2PLPA 2BS3B 2EMTA 1HTQA 1YD8U 2RR9A 3H7PB 3GS2A 2LHEA 1E8ZA 1K51A 1YQ4B 4C7YA 4TQ0A 2XN9C 2N9KA 2LGDA 3W1YA 2KDFB 2LUEA 4I6LB 5FK9C 5JHAA 1L0XB 2LFIA 2BT6A 2GI9A 1Y56A 1T0RC 3ABVB 1P1AA 3RMKC 2JSVX 1K53A 2I1KA 4GGQA 4REZA 4C80A 2QC8A 5E6NA 3E9SA 3WAPA 4DWFA 1TYGB 4DHJD 2WXIA 5KHOA 4M8NA 1N5XA 4MSQB 1XLQA 3WALA 2KLGA 1S1QB 4KZCA 1WXSA 3VHTC 3VUWA 4N9F4 3Q8BA 4NAMA 2NBUA 2NBWB 1XLPA 3N9YC 2CHXA 2V3PA 3VDZA 3C19A 2C9WB 2D3CA 2W3RA 3RNGC 3VXWA 1XLOA 4WAAA 3EHVA 3N1XC 1FNWA 2UU7A 3OWEB 4HDQA 1JQ4A 2KWVB 1LXDA 2DAJA 2O6VD 2IZVB 1TKGA 1SIJA 4KSLC 3MTNB 1QLBB 5H92C 5BYRA 2CKHB 5L83A 2MJEA 1QZEA 1EU3A 1WJ6A 1JCKB 1N5WA 3PZ7A 2LXAA 1WF9A 2BWES 3GZNI 1WGRA 3K9OB 4YSXB 4YTNB 3W5VB 1KJTA 1MHXA 2G3QB 1WM2A 4XDDA 1EF1A 3ECIA 1F1HA 2K5PA 3OG5A 5LXHA 3PSEB 4LNFA 3IVFA 4FADA 1P9DU 4XX5A 2LMCA 5J17A 1YJ1A 3A9JB 3AEFB 1V80A 3U2SC 1E6EB 4ZYSA 1DOYA 2D3GA 2NCNA 3LJ3A 1UBQA 1IYFA 3RNFC 3ZQ4A 3SR6A 4WWMA 1TKEA 2WXPA 3QQ8B 3EFCA 2FNJB 2LHDA 1EWCA 2DZKA 1VZ7A 1MJDA 2JZZA 1ZDXA 1OEYA 3RUIB 2MX2A 3SFEB 2FUG1 4KDIC 4US8A 2AEHA 1WY8A 1DOIA 5E6PA 2KZRA 3W1SA 2CHWA 4JIOU 4W9CA 4NPNA 2L3ZA 4B95A 1BT0A 1V1OA 3APCA 3CMMB 2ZW0A 1J7AA 3L0WB 5DPSA 2K8HA 3TIXA 1KLUD 1N60A 3EGRA 3NZUA 4K3CA 2WNMA 1L6UA 4B0MA 2KQSA 4HJGE 4AWJA 5EE9A 3ZVVA 1TBEA 4HDOA 1UGMA 1JROA 3CF6E 2G9HD 1AN8A 2ZPNA 1Z5SB 4MJSA 2L7RA 2KLCA 3APDA 4E3CA 4GXBA 4XGAB 4W9IA 2OJWA 4HVBA 1ZPSA 2R61A 1E7UA 1TS3A 4FA6A 2REXA 1L4ZB 1ZKHA 4HWIB 2SAKA 3HVZA 3HIZA 1WRDB 1E8XA 2NPTA 2I38A 4RM8A 1C77A 1FCLA 2N9EB 1MHHE 3ZRFA 1CQVA 1WSPA 2J4XA 3I57A 1SJED 2BTEA 4UDUC 2B76B 3P1MA 2MA9B 4MGZE 1Q10A 2E3TA 2C7MB 2D3AA 2JRHA 2WXGA 3DBRB 5JHBA 1NI3A 1I42A 2LGXA 1XEEA 1WRIA 2PTLA 3KYDD 4MSMB 1YX5B 2DHZA 1T0YA 1V5TA 2RD0A 1IP9A 3ZYYX 1IUEA 3P4SB 1LQBA 1PQSA 1WYWB 1L6VA 2V9HA 3TEZA 1BUIC 1F52A 1I4GA 5G5HA 2KD0A 4LNIA 1CZPA 3PRZA 1I35A 2KOXA 3H9DA 1A5RA 2V3SA 3S2AA 1SE2A 4NZLB 4KGSA 4ZHPA 1S3SG 3V61A 2G4DB 3T3OA 1C4PA 2M4NA 1KOTA 1VZ6A 4IKGA 3U8ZA 4NJ6A 2E6XA 3B2FA 1WZ3A 2W55A 1FXTB 2KAJA 4BAXA 2J0JA 2KDMA 2NTSA 4JL9A 4G11A 1RYJA 4JX1C 4PYZA 5DPWA 2DX5B 2GBKA 2KO3A 2I1JA 4MGIE 1X1MA 2N9LA 1DGJA 2N7DA 2W9NA 2JZ3B 3Q69A 4BOZB 2GB1A 2BWFA 3QARA 2L05A 2VZKD 1OQYA 4QAYA 5HHDG 1FM0D 4ARCA 4GN1A 2K8CA 4A20A 3IT6B 3T9LA 1J19A 4PS7A 2BPSA 4OZBA 5DCNA 4BKSD 3ALBA 3VFKA 1CMXB 1R4MB 1L4DB 1L5PA 2M8SA 4RGNA 2BYVE 3O65B 4PS3A 2QSDA 3H8HA 5BMIA 4ZRPA 3UQAA 3P4RB 2JU6X 3T8MA 3MC0B 2BF8B 3AE4B 1WX7A 3DBLB 4AQ7A 1VRAB 1QOFA 1NEKB 3CSTA 2LWPA 3WANA 1PGAA 4LTUA 4YT0B 5AZFA 1WR6E 2N4FA 3HM6X 2X8XX 3PZDA 2KKCA 3PHWB 4MDKE 1FCCC 2Y5PA 4LJOB 4DK5A 3PLUA 3VRAB 3PT2B 2J0KA 1FRRA 1TY2A 3DVNV 4K3BA 2J52A 4LNOA 4WQMA 1STEA 3ZNZB 2BS4B 3I3TB 3BZDB 4FHKA 3J9CA 2FAZA 3URYA 1ZXIA 3WIMA 2N7JA 4C7ZA 1R7SA 1LO5D 5IN7A 1U4AA 1F2RC 3I5JC 1UH6A 1V9JA 2K6DB 1KF6B 5BO4B 2Z8LA 4ANUA 1ZUD2 2PW9A 1V97A 1TT5B 3RFZB 1C9FA 2PPHA 1FD6A 1XT9B 5AZGA 3VQIA 1K50A 2J7QB 3X0WA 3AULA 4RNAA 2WX1A 1F0ZA 2MCNB 4ZHOA 4TQ1A 1UBIA 1OGWA 1GJZA 1I4PA 3TBLD 1JRUA 5L95C 2O6VA 3VTWA 4DHJB 3O13A 3M62B 2INCC 3LXFA 4YTMB 4DHZE 2KACA 3IAS1 1NYQA 3Q14C 1XQQA 2KXJA 4KDLB 2KANA 2OOBB 2ZEQA 1WYGA 2KTRA 5CHVC 1HZ6A 3ZIMA 4PS8A 4HRSA 4RM9A 4KKIA 2BBCA 4JE3B 4S0RA 4EFOA 5AZHA 3PV1A 3DOWA 1NYRA 3AE9B 2BB6A 1OTRB 2CU1A 4IG7B 3SD5A 3PRMB 1EUVB 1P3QU 1UWXA 1BXTA 3UQBA 1TS4A 3AE8B 1F2RI 2O6VB 3N3KB 3OLMD 3SHQA 1RFAA 5D3IB 3NRZA 5IA7A 2AQ3B 3A9KB 4HROA 3ZTDA 4C00A 2INNE 4B0EA 4PT5A 4OW0A 3TEYA 2N9XA 4BKGA 1MFWA 5C3JB 1UELA 3ZTCA 5J2RA 2WP9B 5G55A 5EE1A 4DDGD 3NVWA 1SIFA 2PEAA 1EF5A 3RNBC 2KNBA 3R7QA 2LUMA 2FCQA 2FCMA 1FRDA 2RDHA 3E56A 3VUXA 3VH4B 5BYQA 5KHQA 2IBIB 4MH8A 1RFKA 5GXGB 1JWMD 1N61A 3QX1A 4RFBA 4LDTD 2WU2B 1TJEA 3RCZA 4IUMB 4ZRKA 2IJ0A 4RH6A 2NR2A 2WXOA 1B9RA 4IM0A 3RNAC 4YSZB 2YEPF 2I2YA 1QT9A 2IYDB 2ONQA 1V49A 2MRPA 3BYYB 1SJHD 4ITKA 2DAFA 2ZZPB 3W2DA 1T5XD 4W9HA 4GB9A 3SU8X 1EWYC 3JYUA 2ZCCA 1TY0A 2C5LC 3KQ4A 3SDLC 3SFDB 4I6PA 4F8CB 1XD3B 3B1LX 5G2NA 2WLBA 5DPTA 3DVGY 5AUKA 5HFYA 1BMLC 3AEGB 4G50A 3QCAA 2BYTA 2UWQA 1WJUA 3JSVA 2QJLA 1NENB 1SGHA 1D6EC 2J42A 4R3DA 5IP4D 1L0VB 1VR9A 1I7HA 3DBHI 1KLVA 3PS6A 3P2BA 1EU4A 2Y5BB 4AOFA 2WQYB 3DHGC 4BVUC 1YMHE 1RM6C 3NHEB 2YLMA 2INDC 2ICIA 2KC2A 4FLHA 2BKFA 1PGXA 1J7CA 4W9LA 1SXTA 3L08A 1AW7A 2GLSA 4II2B 4BZAA 4HPMB 2ZNVB 2QIEB 3P63A 2R2QA 2Z0EB 4PK1A 2ZJDA 1LFDA 3ONSA 1HA5A 1QILA 4CHKA 4FJZA 1GC7A 4NQKE 3AEDB 2K9XA 3JSVB 1WH3A 1I4RA 4WWPA 4CO7A 1SEBD 2N1WA 4N58A 1MG4A 4KV2A 1FO4A 3FAHA 2JT4B 5IOIA 4EZKA 4A6QA 2KDIA 4ZOHC 2FBWB 4N59A 2K22A 3VRBB 1MI0A 4H2AA 3TUOA 4G3XB 4M00A 4J3OD 4BKSA 1SE9A 3DHIC 2XBBC 2HTME 2MBOA 4ZRJA 1HZ5A 1J0GA 3P4QB 3FKYA 2KFJA 5D94A 2DYMA 4P6VF 4DXGA 4P1CC 2AQ2B 2RDGA 1R4NI 1GB1A 4IC7B 2VZKB 1M4VA 2LVOA 1E90A 4AS1A 3TMPB 4ZDVA 3D32A 2KWDA 3VVWB 2G45B 4P16A 2X38A 2M0XA 2CJNA 2M17A 3QC8B 5GMVA 2LD9A 2JWZA 2IGDA 2LGYA 2QHOA 3PRPB 4FN2A 4HCNB 2KMMA 5CHFA 4IM2A 3JVZX 1GC6A 3KLSX 3KVFB 3M3JA 5EE3A 4BBNC 3IXSA 2MJ3A 3WCQA 1TZOA 3IFWB 4A90A 1A70A 5IO9A 4WJQA 2LEKA 4X57B 4K7WA 1YX6B 3ZXRA 2JQRB 1WX8A 3L17A 3GE3C 5C23A 4IDIA 2LJ5A 3VR8B 1FXAA 1YNTE 1IBXA 2KDEB 3AN1A 4HXDA 2BVCA 3MHSD 1NVID 4MJSB 1YJJA 5E6OA 1AARA 4KZ0A 4HJKA 2W54A 2WDVB 3EUB2 2WGSA 2WXLA 4GDKA 2Y5CA 2DYOA 4K7UA 2WXKA 4BOSC 2LGIA 1V81A 2GOWA 4LCDE 2JXXA 2AL6A 4BKTA 3W9CB 2NPTB 2JZPA 3VH3B 1WM3A 3QA8A 3H6NA 1DOXA 3PGEA 3ZNGC 4EOYA 2HJ1A 4WURA 1SE4A 3TJPA 2DNFA 5HI1A 2HTHA 4WH4A 3VAWA 4RGMA 2NTTA 4K1RB 2BGFA 3PO0A 1ZDVA 2WDTB 2KMAA 3NOBA 2WXMA 4WWOA 1WGYA 3CWIA 5EE0A 4TV3A 1EO6A 2KN4A 2WS3B 3ZNID 4WJNA 4BBNF 4RF0A 1NDDA 3GB1A 2R2OA 3NVZA 3DWMA 3Q3NC 4M02A 5CTRC 2FE8A 2N7EA 4NQLB 1M94A 2W82A 3NUHB 3P42A 4YTPB 2HDEA 2C7NB 1Z2MA 1SE3A 2RPQA 4AUQC 3VTVA 3ZDMC 2BKRB 2BS2B 3ML9A 1JWAD 2L52A 3W1SC 2V1YA 3AI5A 1YQBA 3LDZE 1DYQA 2QCZA 3AMZA 1TZ1A 3RNCC 3R3MA 4XE0A 1N6ZA 4BFRA 1OEYJ 3K9PB 4ZYNA 1FPYA 1WJNA 1JWUD 3IT4B 4PYUA 3WA0A 3QK0A 4JWUC 5LLIA 2Y3AA 1E9MA 2FCNA 3AEAB 2DYBA 4KKJA 2O2VA 2IO0B 1ENFA 3ZLZA 3AH7A 4EKUA 3DDCB 4A3PA 1JWBD 4YXDB 2WXHA 2MHJA 4FULA 4HKZE 3ZO5B 3RN9C 3ETRA 1C78A 4EZLA 3ZNHB 4LJPB 4NAWA 3GE8C 2PE6B 3AE7B 2ZW1A 1UNSA 1VZ8A 1ROEA 2OHFA 1V86A 2M0AA 3TEXA 3A1QA 4USAA 1GB4A 3AE5B 5MPOA 4MT5A 1Q1OA 3Q3JA 4B9KA 1RRBA 1QQRA 2JRIB 2TSSA 2QMTA 1SB3C 1OQQA 3B0AA 2N0SB 2ZVOA 2JVCA 1TS5A 3NY5A 4LDTB 1ZXHA 4FJYA 2C7HA 4EUTA 2D07B 2ASQA 3BINA 5G5GA 2O2VB 3NS8A 3PREA 1XO3A 1D4BA 2D2QA 4XWTA 2LVQA 4LNKA 1GPXA 1N62A 2NBVB 3R2TA 2DZIA 3B9JA 5LNK1 2QDFA 4I6NB 4NAWB 1VJKA 2MBHA 2ACZB 1FNVA 1MVKA 3A1QB 1VD2A 3DBRI 3M63B 3ZXVA 4MM3A 4K81A 3N20C 1JALA 5HG2A 3RD2A 3HRDD 2RSUA 1WJ4A 4M0WA 3Q8AA 2G4SA 3GZNB 2L8JA 3DWGC 2V0GA 1ZOYB 1QOAA 3U7ZA 2AL3A 4OZCA 2Z0DB 1ZGUB 2MBQA 2LRWA 1GOZA 1C76A 1PGBA 1PUTA 1HXYD 3AXCA 1WE6A 3U52E 1T3QA 2PJHA 1GUAB 2QILA 2K39A 2IO2B 2WX0A
chains in the Genus database with same CATH topology
2WQYB 1YMHE 1RM6C 1ZPSA 2R61A 1TS3A 5FKAC 2ICIA 1TKYA 2GRIA 1FEHA 4O1NA 4XWWA 2PMVA 1L4ZB 2M56B 3VR9B 2YEPB 1PGXA 2SAKA 3HVZA 4KX6B 1KLGD 3Q8FA 1J7CA 2JWUA 4MM3B 1SXTA 2I38A 4TSSA 1AW7A 4RF1A 1C77A 4KGRA 1JMLA 1FCLA 1MHHE 4ARIA 3IAM1 2QIEB 1CQVA 4KGTA 1WSPA 2OEDA 3P63A 2J4XA 3Q8EA 4WAFA 5D7GA 3I57A 1E7PB 1SJED 3AECB 2BTEA 4UDUC 2B76B 3P1MA 1HA5A 1QILA 3BK2A 1Q10A 2E3TA 2WXGA 1NI3A 3AEDB 2K9XA 1D5XC 5FR3A 3LYYA 2H89B 1XEEA 3AE1B 1I4RA 1WRIA 2L1AA 3U4EG 2PTLA 1SEBD 2PVGC 2JXTA 4Q2JA 4N58A 1CK1A 1IGCA 3BYTB 2PKOA 4L23A 3ZYYX 3Q8CA 1P7FA 1YQ3B 1FO4A 3FAHA 1IUEA 3EA6A 1AYFA 3P4SB 1XCQL 1UWMA 5TSSA 1PYWD 3ZGZA 3MHZA 1JWSD 4A6QA 1L6VA 4US9A 3TEZA 1BUIC 1JRPA 4FXCA 4ZOHC 2FBWB 4N59A 1I4GA 5G5HA 2K22A 3VRBB 4DQOC 4A55A 1MI0A 1CZPA 1PDXA 4H2AA 4CQNA 3TUOA 1P7EA 3ZJVA 1MPEA 2DBYA 1SE2A 4J3OD 4NZLB 4YSYB 4KGSA 4ZHPA 1FNUA 1QOGA 3T3OA 1C4PA 1WWTA 1VZ6A 2HTME 4IKGA 1IGDA 4YWGG 1RWSA 4DXFA 2E6XA 3B2FA 1HZ5A 2BW2A 2W55A 3ZJTA 4IOIE 2KAJA 2AX5A 4GDLB 2EELA 4MACA 2KDMA 2NTSA 3TSSA 3B2GA 3P4QB 1RYJA 4JX1C 2WXQA 5JXVA 2KQ4X 1GAQB 2V3NA 1C79A 2PIAA 5BYSA 2N9LA 2DYMA 4WIPA 4P6VF 1C4AA 4DXGA 1DGJA 2IDYA 1FFUA 2AQ2B 2RDGA 3Q69A 1GB1A 2VZKB 3PZ8A 2GB1A 1V1PA 1M4VA 1D5ZC 3RPFC 4GLSC 2VZKD 3LB8C 4AS1A 2WDRB 5HHDG 1L0YB 1AWDA 1FM0D 4N6EB 2DWQA 4ARCA 1ESFA 2KWDA 2MEKA 3FILA 4A8XC 3IT6B 1HQRD 4P16A 2G1EA 3TEWA 3V05A 3GP7A 3P4PB 2X38A 1FXIA 4OZBA 1E0ZA 2CJNA 1EM7A 1K52A 4JPSA 1L4DB 4OVZA 3SEBA 3AE6B 1L5PA 4XDCA 4RGNA 2IGDA 2QSDA 3KWVA 3AEEB 2KMMA 3H8HA 3MFGA 5BMIA 3KLSX 5EE3A 2K3UA 4ZRPA 2Q5WD 3IXSA 3UI3A 2MJ3A 2ON8A 3WCQA 1TZOA 3P4RB 2JU6X 3MC0B 3AE4B 1ET6A 2AQ1B 1I4QA 4AQ7A 1F77A 2WU5B 1WXQA 1VRAB 4A90A 1A70A 1QOFA 2IGGA 1NEKB 3NVYA 2LEKA 1V1PB 1I4XA 1XXGA 3AE3B 2L83A 1PGAA 2JQRB 4LTUA 4YT0B 3V3XA 1PFDA 2D5GA 2J53A 3W5UB 3NVVA 1FMAD 3FILB 1KRHA 1UUPA 1FCCC 5BMHA 2Y5PA 4IDIA 2RMMA 3VRAB 3VR8B 1FXAA 1YNTE 1FRRA 1IBXA 2WXRA 3AN1A 1TY2A 2WDQB 5AUIA 1YN5A 2J52A 3AB5A 2L32A 1NVID 4WQMA 1STEA 1YJJA 4C56C 2BS4B 1QOBA 1T6BX 3BZDB 1UGJA 3AM9A 4D2KA 5E6JA 2W54A 2JX5A 3J9CA 2WDVB 2WXNA 3EUB2 1I4HA 2WXLA 4OZAA 3URYA 3T3NA 1ZXIA 2SEBD 2Y5CA 2DYOA 2N7JA 1SBBB 2WXKA 3AV8A 2LGIA 4C7ZA 1R7SA 1LO5D 1QF6A 3BVGA 3W9CB 2DLBA 5H8YE 2JZPA 5C2TB 4RGOS 1F2RC 1YN4A 4L2YA 2JYTA 3HVDA 1DOXA 1KF6B 5I4DA 2PLPA 2BS3B 2Z8LA 4WURA 1WGKA 1ZUD2 2PW9A 4HKQA 1SE4A 1V97A 3GS2A 5HI1A 4WH4A 2LHEA 3RFZB 1C9FA 4RGMA 1FD6A 1K51A 1YQ4B 2IPKD 4C7YA 4TQ0A 2XN9C 2NTTA 3VQIA 1KH0A 1K50A 2N9KA 1ZP0B 3PO0A 1ZDVA 3CIRB 2WXMA 3BIID 3BWUD 3R2IA 2CJOA 5FK9C 1L0XB 5T8IA 4L1BA 2LFIA 4RNAA 3CWIA 5EE0A 1J7BA 2H88B 4LK0M 2BT6A 1F0ZA 2GI9A 1Y56A 3ABVB 2KN4A 2WS3B 4ZHOA 4TQ1A 2JSVX 1K53A 4REZA 4RF0A 1I4PA 4C80A 3E9SA 3GB1A 3NVZA 3DWMA 1FIQA 1TYGB 4LLGM 1CJEA 3O13A 2FE8A 3LXFA 4YTMB 2WXIA 2W82A 3NUHB 1N5XA 3P42A 1XLQA 2KACA 3IAS1 4YTPB 1NYQA 2HDEA 1XF5L 1JW9D 1WYGA 1HZ6A 1SE3A 1N63A 2INPE 2BS2B 1YN3A 4HRSA 1JWAD 2L52A 4KKIA 3Q8BA 4NAMA 2BBCA 4JE3B 1XLPA 1DYQA 3N9YC 1NYRA 3AE9B 2BB6A 3AMZA 2V3PA 4XE0A 2W3RA 2JYEA 1UWXA 1JWUD 1ZE3D 3IT4B 1BXTA 4JWUC 1XLOA 1TS4A 2Y3AA 1FNWA 1XCTL 1E9MA 3AE8B 1F2RI 3OWEB 2EKIA 1JQ4A 3AEAB 4KKJA 1QKZA 1FFVA 1C4CA 1TKGA 5D3IB 1SIJA 3NRZA 1ENFA 2AQ3B 3AH7A 4HROA 4RCOA 4YXDB 1JWBD 1QLBB 2WXHA 2INNE 4ZRQA 5H92C 4PT5A 5BYRA 4B0EA 3HUIA 1VDVA 2WXFA 2MJEA 4HKZE 4OW0A 3TEYA 1EU3A 2XNAC 1JCKB 2PVOD 1B1ZA 3ETRA 5C3JB 1N5WA 1C78A 1OQRA 2IGHA 3PZ7A 2BB5A 4YSXB 2WP9B 3AE7B 2ZW1A 1UNSA 4YTNB 1VZ8A 1ROEA 5EE1A 3NVWA 2OHFA 3BVMA 3W5VB 1MHXA 2M0AA 3TEXA 1ET9A 4XDDA 4USAA 1GB4A 2K5PA 3AE5B 2LUMA 5MPOA 4JWSC 1FRDA 2RDHA 4MT5A 4A9AA 1KFYB 3E56A 1QQRA 2TSSA 5BYQA 2QMTA 1SB3C 2LMCA 3AEFB 4NJCA 3U2SC 1E6EB 1OQQA 4HEA1 2N0SB 4MH8A 1RFKA 4ZYSA 5GXGB 1JWMD 1TS5A 4EE2A 1DOYA 1N61A 1ZXHA 4RFBA 3ZQ4A 3SR6A 2RPVA 4WWMA 2MJDA 1TKEA 2WU2B 1OFFA 1TJEA 3AEBB 5G5GA 3I9V1 3NS1A 2WXPA 2NMQA 1XO3A 2IJ0A 4RH6A 1D4BA 2LHDA 2WXOA 3MJ5A 2W3SA 4XWTA 1B9RA 1GPXA 1N62A 4OHJA 1HEZE 4TMAB 1EWCA 3NZ3A 1IBXB 1VZ7A 3R2TA 1V8CA 2K0PA 4RGTA 4YSZB 2YEPF 2I2YA 1QT9A 3B9JA 1ZDXA 1ACCA 5LNK1 2ONQA 3SFEB 1D5MC 3FC4A 2FUG1 4NAWB 3BYYB 1SJHD 1VJKA 4ITKA 5BMGA 1YJIA 3W2DA 3C8YA 2ACZB 4US8A 4GDKB 2LJIA 1DOIA 1VLBA 1FNVA 1MVKA 3W1SA 1KTKA 1T5XD 3MP9A 1EWYC 3AE2B 1TY0A 3KQ4A 3SFDB 2CU3A 1E10A 1JALA 5HG2A 3L4PA 3BVZA 3HRDD 4M0WA 3Q8AA 3KWLA 1V1OA 2ZW0A 1J7AA 5D3DA 2WLBA 3DWGC 2QEJC 2M19A 3ZJUA 2V4IB 5AUKA 5HFYA 2V0GA 1BMLC 1KLUD 1N60A 3EGRA 1ZOYB 2WNMA 1L6UA 4B0MA 3AEGB 1QOAA 2WXJA 3U7ZA 1XLNA 2BYTA 4HJGE 4OZCA 5EE9A 2QJLA 3R8BA 1GOZA 1NENB 1C76A 1D6EC 1PGBA 2J42A 4R3DA 1L0VB 1VR9A 3BK1A 1SSNA 1JROA 1SF0A 2MH7A 1PUTA 1HXYD 1TS2A 2G9HD 1AN8A 1I7HA 3U52E 1T3QA 2QILA 1EU4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WH4 A;  2LHE A;  1C9F A;  2ZW1 A;  4GLS C;  1YMH E;  1FD6 A;  1K51 A;  1MHX A;  5HHD G;  1KH0 A;  1K50 A;  2N9K A;  1PGX A;  1GB4 A;  2KWD A;  2JWU A;  3FIL A;  2LUM A;  2I38 A;  4KGR A;  1JML A;  2QMT A;  1FCL A;  1MHH E;  4OZB A;  2GI9 A;  4KGT A;  2KN4 A;  2OED A;  1EM7 A;  1K52 A;  2JSV X;  1K53 A;  1ZXH A;  3GB1 A;  2IGD A;  2QSD A;  1Q10 A;  2RPV A;  5BMI A;  2NMQ A;  3UI3 A;  2ON8 A;  1D4B A;  2LHD A;  2JU6 X;  2KAC A;  2PTL A;  1XF5 L;  2JXT A;  1HEZ E;  1IBX B;  1IGC A;  1HZ6 A;  2K0P A;  2I2Y A;  2ONQ A;  1P7F A;  2IGG A;  1PGA A;  5BMG A;  1XCQ L;  3V3X A;  2J53 A;  1MVK A;  3MP9 A;  3FIL B;  5BMH A;  1FCC C;  1MI0 A;  2RMM A;  1P7E A;  1MPE A;  1UWX A;  1IBX A;  1YNT E;  5HG2 A;  4KGS A;  2J52 A;  2ZW0 A;  4IKG A;  1IGD A;  1XCT L;  5HFY A;  4D2K A;  1F2R I;  1HZ5 A;  4OZA A;  4IOI E;  1QKZ A;  4HJG E;  2EEL A;  4MAC A;  4OZC A;  2KDM A;  2N7J A;  2LGI A;  2JZP A;  1PGB A;  2KQ4 X;  5JXV A;  1F2R C;  4HKZ E;  2N9L A;  2PLP A;  2IGH A;  2PW9 A;  1GB1 A;  2GB1 A;  5HI1 A; 
#chains in the Genus database with same CATH topology
 4ICU A;  5FKA C;  4ACF A;  2GRI A;  3MC8 A;  3ZKJ C;  1FEH A;  2PMV A;  2M56 B;  3VR9 B;  2HD5 B;  4ANW A;  2A5U A;  3KUD B;  4MM3 B;  2UYZ B;  3N30 A;  1WZ0 A;  3EEC A;  2GBN A;  3OAW A;  4RF1 A;  2KTR B;  4M0W B;  3DBS A;  2EMS A;  4ARI A;  4DXA B;  2KMC A;  3UIP B;  3Q8E A;  4WAF A;  5D7G A;  3RZW C;  3AEC B;  2FUH B;  3BK2 A;  3Q3M C;  4GU2 A;  5J18 A;  3LYY A;  3AE1 B;  1WIA A;  3QHT A;  2WWZ A;  4Q2J A;  2D11 A;  1IGC A;  2BYE A;  5LXI B;  2PKO A;  4FHJ A;  4L23 A;  1Q0W B;  1RAX A;  3Q8C A;  3DVG X;  4JQW C;  3MC9 A;  1P7F A;  3RT3 B;  4ICV A;  3ML8 A;  3EA6 A;  1AYF A;  1H8C A;  3A4R A;  2VH1 A;  3IG3 A;  3OJ3 A;  1UWM A;  5TSS A;  1PYW D;  3ZGZ A;  2LVP A;  1JRP A;  1WFY A;  1UF0 A;  4GIV A;  3UIN B;  4DQO C;  4A55 A;  1PDX A;  4CQN A;  3H1U A;  3MJW A;  1P7E A;  3ZJV A;  1MPE A;  2D10 A;  2KN5 A;  3DPD A;  5D6J B;  1FNU A;  3DBL I;  1QOG A;  4HPP A;  1WWT A;  3JW0 X;  1RWS A;  2K1F A;  2KK8 A;  4EZJ A;  2BW2 A;  2MWS B;  4MAC A;  4M8M A;  3KUC B;  3U30 A;  1WI0 A;  1UZX B;  4ANV A;  5JXV A;  2KQ4 X;  2V3N A;  1C79 A;  4P1B C;  3UF8 A;  5BYS A;  1J8C A;  2VRR B;  2IDY A;  2J0M A;  4WWN A;  1WXA A;  2ZPY A;  3PZ8 A;  4MGY E;  3RPF C;  1D5Z C;  3PHX B;  3PLV A;  2L0F A;  2MSE D;  1AWD A;  2AYO B;  4N6E B;  2KWU B;  3Q6B A;  2DWQ A;  4URK A;  5FR6 A;  3FIL A;  4A8X C;  4WJP A;  2G1E A;  3TEW A;  3V05 A;  1FXI A;  2GBR A;  3HM3 A;  1E0Z A;  1EM7 A;  3SEB A;  1G6J A;  1TTN A;  5IAA C;  3KWV A;  3AEE B;  4XC2 A;  3MFG A;  4CYE A;  2GMI C;  4ASW C;  3RNE C;  2Q5W D;  2L76 A;  4JLC A;  2WYQ A;  3UI3 A;  4GMV A;  2DZM A;  4KVG B;  4C4V A;  2MQJ A;  1TGZ B;  1I4Q A;  4AJY B;  1F77 A;  3A9J A;  4HLE A;  2CS4 A;  3EFU A;  3TCA A;  2KJR A;  2NVU I;  2IGG A;  3NVY A;  1I4X A;  1XXG A;  4AP4 C;  3AE3 B;  1GG3 A;  3ZW3 A;  2GBJ A;  2IO3 B;  1MG8 A;  4NNJ B;  1PFD A;  2D5G A;  2J53 A;  2KWC A;  3W5U B;  4W9F A;  1T0Q C;  3FIL B;  1UUP A;  2KJ6 A;  2LI5 A;  3RYT A;  5BMH A;  2FCS A;  2WXR A;  5AUI A;  3IBE A;  4WJO A;  1QOB A;  4KSK C;  3IHP C;  3AM9 A;  5E6J A;  4KIK A;  2JX5 A;  1D3Z A;  4XZ4 A;  3M95 A;  4OZA A;  1WGG A;  3T3N A;  3V62 A;  3B08 A;  3AV8 A;  4K7S A;  2AWT A;  4WQO B;  2Z59 B;  4DDI D;  1TIF A;  2ZVN A;  2JUO A;  4C4V B;  2DLB A;  5H8Y E;  5C2T B;  2N9P C;  2IO1 B;  2JY6 A;  1YN4 A;  4L2Y A;  3Q2A C;  1RLF A;  2JYT A;  2MP2 A;  5I4D A;  1L7Y A;  2V4L A;  5TR5 A;  1WGK A;  2K25 A;  4HKQ A;  5HKH A;  2RGF A;  1H4R A;  2IPK D;  2MW5 A;  1KH0 A;  2IY1 B;  1ZP0 B;  4ANX A;  2LRU A;  4MH0 E;  3CIR B;  3BII D;  3BWU D;  3R2I A;  2CJO A;  5T8I A;  4E74 A;  4L1B A;  1J7B A;  1KM7 A;  2H88 B;  4LK0 M;  4G0N B;  4XYC A;  1GNU A;  4HK2 A;  4KIK B;  3A4S C;  1P0R A;  3WAO A;  1FIQ A;  4LLG M;  4AJW A;  3N1Y C;  1CJE A;  1F9J A;  3V60 A;  3HHM A;  1XF5 L;  1YOV B;  3R7R A;  1JW9 D;  2MP2 B;  1N63 A;  2INP E;  1YN3 A;  3L13 A;  3DVN U;  2RDB C;  2XK5 A;  1NI2 A;  3QIJ A;  2ZNV C;  3APF A;  2D3B A;  2K8B A;  2JYE A;  1ZE3 D;  4FJV B;  4GSW A;  4II3 B;  4ZRI A;  1XCT L;  4S17 A;  5CX3 A;  2EKI A;  1P98 A;  4IW0 A;  1QKZ A;  1FFV A;  1C4C A;  2BQQ A;  3QAQ A;  4RCO A;  2K6Q A;  4ZRQ A;  3ENE A;  2CR5 A;  3HUI A;  1VDV A;  2WXF A;  1E8Y A;  3GOE A;  2XNA C;  2MBB B;  2PVO D;  1B1Z A;  3R66 C;  1OQR A;  2IGH A;  2BB5 A;  4IWP A;  2KFK A;  2KYW A;  3OJ4 B;  4TUU A;  3BVM A;  2XK5 B;  4DHZ B;  1ET9 A;  3BY4 B;  2KJH B;  1WX9 A;  4JWS C;  4A9A A;  2IY0 B;  1KFY B;  2KX0 A;  3KW5 B;  2PE9 A;  2JPH A;  4NJC A;  2LXC A;  4HEA 1;  1HTO A;  4EE2 A;  2KDB A;  2RPV A;  2MJD A;  1V5O A;  1OFF A;  1UD7 A;  3AEB B;  3A33 B;  3I9V 1;  3NS1 A;  3ZUN A;  2NMQ A;  2GBM A;  3MJ5 A;  2W3S A;  3C0R B;  4W9J A;  4OHJ A;  1HEZ E;  4TMA B;  2LGS A;  1IBX B;  3NZ3 A;  1V8C A;  2K0P A;  4RGT A;  2JF5 A;  1ACC A;  2KVZ A;  1C1Y B;  3N1Z C;  1D5M C;  3HK0 A;  4J6I A;  2KFK B;  3FC4 A;  3EC8 A;  2LAS A;  2KVR A;  5BMG A;  1YJI A;  5C1Z A;  3PTF C;  3C8Y A;  5JH5 C;  1WXM A;  1V6E A;  2LJI A;  4GDK B;  1VLB A;  4P7I A;  1KTK A;  3MP9 A;  1WR1 A;  3AE2 B;  2L00 B;  2CU3 A;  1E10 A;  1E5W A;  3L4P A;  3BVZ A;  5AEK B;  3KWL A;  4NY0 A;  3VTU A;  2EKE C;  5D3D A;  2QEJ C;  1WXV A;  2M19 A;  3ZJU A;  2V4I B;  5JZE B;  3DQV A;  2WXJ A;  1XLN A;  1Q5W B;  4OVU A;  1T0S C;  5D2M B;  3R8B A;  4IWO A;  4IWQ A;  3BK1 A;  1SSN A;  1SF0 A;  3RZF A;  2MH7 A;  5DPR A;  1WGD A;  1TS2 A;  2A4Z A;  3KYC D;  1TKY A;  4O1N A;  4XWW A;  3Q3F A;  1ZW7 A;  2DZJ A;  2YEP B;  3DHH C;  4KX6 B;  2NS5 A;  1KLG D;  3Q8F A;  4EEW A;  4W9E A;  2JWU A;  3RI7 C;  4TSS A;  3TL5 A;  4KGR A;  1JML A;  4TKN A;  4A3O A;  3IAM 1;  4KGT A;  2OED A;  1L2N A;  1K8R B;  1E7P B;  2HE7 A;  3AU4 A;  3X23 A;  4LNN A;  4DBG A;  5IKC M;  4GDL A;  1D5X C;  3NJT A;  3L54 A;  5FR3 A;  2H89 B;  4B6W A;  2N1V A;  2L1A A;  3Q3O C;  3U4E G;  2MLB A;  2M1M A;  3RUL A;  2PVG C;  2JXT A;  2KT7 A;  1VCB A;  1CK1 A;  3BYT B;  1WMH A;  3AU5 A;  2KTF A;  4FBJ B;  1YQ3 B;  2OJR A;  1NBF C;  1E7V A;  3NZS A;  1XCQ L;  2MBE A;  3MHZ A;  1JWS D;  4HPL B;  2HJ8 A;  4US9 A;  2KX3 A;  4FXC A;  4F7Z A;  2FID A;  4M01 A;  2KQ7 A;  2DBY A;  4W9K A;  1WE7 A;  4YSY B;  4MEL A;  3DBH B;  3V6E B;  3KUZ A;  4NJ7 A;  3H7S A;  4YWG G;  1IGD A;  3I63 C;  4DXF A;  2VH2 A;  3ZJT A;  4IOI E;  2AX5 A;  4GDL B;  2EEL A;  2LZ6 A;  3TSS A;  4MEM A;  3B2G A;  2WXQ A;  1GAQ B;  4JGH B;  3ZRC A;  5CHW A;  2PIA A;  3VUY A;  1WMH B;  4WIP A;  1C4A A;  1FFU A;  1HE8 A;  3QWZ B;  4E71 A;  1V1P A;  4GLS C;  1V2Y A;  3LB8 C;  2WDR B;  4W9G A;  1L0Y B;  2YVC A;  3A9K A;  1C3T A;  1ESF A;  2MEK A;  3CSF A;  1HQR D;  3N32 A;  4HCP B;  3WAM A;  3GP7 A;  3P4P B;  1ISN A;  1K52 A;  4JPS A;  2BYF A;  4OVZ A;  4RMA A;  3AE6 B;  4XDC A;  2ZCB A;  3ZDT A;  3UGB B;  4OVV A;  2K3U A;  2XEW A;  4YL8 A;  1LGR A;  2ON8 A;  4F1S A;  1ET6 A;  1IPG A;  2AQ1 B;  2WHI A;  3PVL A;  3V6C B;  2B3A A;  2WU5 B;  1WXQ A;  3L10 B;  3DCG A;  1LM8 B;  4IM3 A;  1V1P B;  2L83 A;  3H7P A;  3UIO B;  2CHZ A;  3KH0 A;  3V3X A;  3NVV A;  2L0T A;  2KHW B;  1FMA D;  1KRH A;  3L16 A;  4W9D A;  2C60 A;  2RMM A;  1YIW A;  2KC1 A;  3NG0 A;  3PPA A;  2WDQ B;  1YN5 A;  3AB5 A;  2L32 A;  1R4N B;  4C56 C;  1T6B X;  1UGJ A;  1WGH A;  4D2K A;  1R4M I;  2WXN A;  1I4H A;  2FIF A;  2SEB D;  1SBB B;  3U7D A;  1QF6 A;  3BVG A;  5EDS A;  4MGK E;  4GOC A;  4RGO S;  3HVD A;  1Y8R C;  2DEN B;  1E8W A;  3QJZ A;  2PLP A;  2BS3 B;  2EMT A;  1HTQ A;  1YD8 U;  2RR9 A;  3H7P B;  3GS2 A;  2LHE A;  1E8Z A;  1K51 A;  1YQ4 B;  4C7Y A;  4TQ0 A;  2XN9 C;  2N9K A;  2LGD A;  3W1Y A;  2KDF B;  2LUE A;  4I6L B;  5FK9 C;  5JHA A;  1L0X B;  2LFI A;  2BT6 A;  2GI9 A;  1Y56 A;  1T0R C;  3ABV B;  1P1A A;  3RMK C;  2JSV X;  1K53 A;  2I1K A;  4GGQ A;  4REZ A;  4C80 A;  2QC8 A;  5E6N A;  3E9S A;  3WAP A;  4DWF A;  1TYG B;  4DHJ D;  2WXI A;  5KHO A;  4M8N A;  1N5X A;  4MSQ B;  1XLQ A;  3WAL A;  2KLG A;  1S1Q B;  4KZC A;  1WXS A;  3VHT C;  3VUW A;  4N9F 4;  3Q8B A;  4NAM A;  2NBU A;  2NBW B;  1XLP A;  3N9Y C;  2CHX A;  2V3P A;  3VDZ A;  3C19 A;  2C9W B;  2D3C A;  2W3R A;  3RNG C;  3VXW A;  1XLO A;  4WAA A;  3EHV A;  3N1X C;  1FNW A;  2UU7 A;  3OWE B;  4HDQ A;  1JQ4 A;  2KWV B;  1LXD A;  2DAJ A;  2O6V D;  2IZV B;  1TKG A;  1SIJ A;  4KSL C;  3MTN B;  1QLB B;  5H92 C;  5BYR A;  2CKH B;  5L83 A;  2MJE A;  1QZE A;  1EU3 A;  1WJ6 A;  1JCK B;  1N5W A;  3PZ7 A;  2LXA A;  1WF9 A;  2BWE S;  3GZN I;  1WGR A;  3K9O B;  4YSX B;  4YTN B;  3W5V B;  1KJT A;  1MHX A;  2G3Q B;  1WM2 A;  4XDD A;  1EF1 A;  3ECI A;  1F1H A;  2K5P A;  3OG5 A;  5LXH A;  3PSE B;  4LNF A;  3IVF A;  4FAD A;  1P9D U;  4XX5 A;  2LMC A;  5J17 A;  1YJ1 A;  3A9J B;  3AEF B;  1V80 A;  3U2S C;  1E6E B;  4ZYS A;  1DOY A;  2D3G A;  2NCN A;  3LJ3 A;  1UBQ A;  1IYF A;  3RNF C;  3ZQ4 A;  3SR6 A;  4WWM A;  1TKE A;  2WXP A;  3QQ8 B;  3EFC A;  2FNJ B;  2LHD A;  1EWC A;  2DZK A;  1VZ7 A;  1MJD A;  2JZZ A;  1ZDX A;  1OEY A;  3RUI B;  2MX2 A;  3SFE B;  2FUG 1;  4KDI C;  4US8 A;  2AEH A;  1WY8 A;  1DOI A;  5E6P A;  2KZR A;  3W1S A;  2CHW A;  4JIO U;  4W9C A;  4NPN A;  2L3Z A;  4B95 A;  1BT0 A;  1V1O A;  3APC A;  3CMM B;  2ZW0 A;  1J7A A;  3L0W B;  5DPS A;  2K8H A;  3TIX A;  1KLU D;  1N60 A;  3EGR A;  3NZU A;  4K3C A;  2WNM A;  1L6U A;  4B0M A;  2KQS A;  4HJG E;  4AWJ A;  5EE9 A;  3ZVV A;  1TBE A;  4HDO A;  1UGM A;  1JRO A;  3CF6 E;  2G9H D;  1AN8 A;  2ZPN A;  1Z5S B;  4MJS A;  2L7R A;  2KLC A;  3APD A;  4E3C A;  4GXB A;  4XGA B;  4W9I A;  2OJW A;  4HVB A;  1ZPS A;  2R61 A;  1E7U A;  1TS3 A;  4FA6 A;  2REX A;  1L4Z B;  1ZKH A;  4HWI B;  2SAK A;  3HVZ A;  3HIZ A;  1WRD B;  1E8X A;  2NPT A;  2I38 A;  4RM8 A;  1C77 A;  1FCL A;  2N9E B;  1MHH E;  3ZRF A;  1CQV A;  1WSP A;  2J4X A;  3I57 A;  1SJE D;  2BTE A;  4UDU C;  2B76 B;  3P1M A;  2MA9 B;  4MGZ E;  1Q10 A;  2E3T A;  2C7M B;  2D3A A;  2JRH A;  2WXG A;  3DBR B;  5JHB A;  1NI3 A;  1I42 A;  2LGX A;  1XEE A;  1WRI A;  2PTL A;  3KYD D;  4MSM B;  1YX5 B;  2DHZ A;  1T0Y A;  1V5T A;  2RD0 A;  1IP9 A;  3ZYY X;  1IUE A;  3P4S B;  1LQB A;  1PQS A;  1WYW B;  1L6V A;  2V9H A;  3TEZ A;  1BUI C;  1F52 A;  1I4G A;  5G5H A;  2KD0 A;  4LNI A;  1CZP A;  3PRZ A;  1I35 A;  2KOX A;  3H9D A;  1A5R A;  2V3S A;  3S2A A;  1SE2 A;  4NZL B;  4KGS A;  4ZHP A;  1S3S G;  3V61 A;  2G4D B;  3T3O A;  1C4P A;  2M4N A;  1KOT A;  1VZ6 A;  4IKG A;  3U8Z A;  4NJ6 A;  2E6X A;  3B2F A;  1WZ3 A;  2W55 A;  1FXT B;  2KAJ A;  4BAX A;  2J0J A;  2KDM A;  2NTS A;  4JL9 A;  4G11 A;  1RYJ A;  4JX1 C;  4PYZ A;  5DPW A;  2DX5 B;  2GBK A;  2KO3 A;  2I1J A;  4MGI E;  1X1M A;  2N9L A;  1DGJ A;  2N7D A;  2W9N A;  2JZ3 B;  3Q69 A;  4BOZ B;  2GB1 A;  2BWF A;  3QAR A;  2L05 A;  2VZK D;  1OQY A;  4QAY A;  5HHD G;  1FM0 D;  4ARC A;  4GN1 A;  2K8C A;  4A20 A;  3IT6 B;  3T9L A;  1J19 A;  4PS7 A;  2BPS A;  4OZB A;  5DCN A;  4BKS D;  3ALB A;  3VFK A;  1CMX B;  1R4M B;  1L4D B;  1L5P A;  2M8S A;  4RGN A;  2BYV E;  3O65 B;  4PS3 A;  2QSD A;  3H8H A;  5BMI A;  4ZRP A;  3UQA A;  3P4R B;  2JU6 X;  3T8M A;  3MC0 B;  2BF8 B;  3AE4 B;  1WX7 A;  3DBL B;  4AQ7 A;  1VRA B;  1QOF A;  1NEK B;  3CST A;  2LWP A;  3WAN A;  1PGA A;  4LTU A;  4YT0 B;  5AZF A;  1WR6 E;  2N4F A;  3HM6 X;  2X8X X;  3PZD A;  2KKC A;  3PHW B;  4MDK E;  1FCC C;  2Y5P A;  4LJO B;  4DK5 A;  3PLU A;  3VRA B;  3PT2 B;  2J0K A;  1FRR A;  1TY2 A;  3DVN V;  4K3B A;  2J52 A;  4LNO A;  4WQM A;  1STE A;  3ZNZ B;  2BS4 B;  3I3T B;  3BZD B;  4FHK A;  3J9C A;  2FAZ A;  3URY A;  1ZXI A;  3WIM A;  2N7J A;  4C7Z A;  1R7S A;  1LO5 D;  5IN7 A;  1U4A A;  1F2R C;  3I5J C;  1UH6 A;  1V9J A;  2K6D B;  1KF6 B;  5BO4 B;  2Z8L A;  4ANU A;  1ZUD 2;  2PW9 A;  1V97 A;  1TT5 B;  3RFZ B;  1C9F A;  2PPH A;  1FD6 A;  1XT9 B;  5AZG A;  3VQI A;  1K50 A;  2J7Q B;  3X0W A;  3AUL A;  4RNA A;  2WX1 A;  1F0Z A;  2MCN B;  4ZHO A;  4TQ1 A;  1UBI A;  1OGW A;  1GJZ A;  1I4P A;  3TBL D;  1JRU A;  5L95 C;  2O6V A;  3VTW A;  4DHJ B;  3O13 A;  3M62 B;  2INC C;  3LXF A;  4YTM B;  4DHZ E;  2KAC A;  3IAS 1;  1NYQ A;  3Q14 C;  1XQQ A;  2KXJ A;  4KDL B;  2KAN A;  2OOB B;  2ZEQ A;  1WYG A;  2KTR A;  5CHV C;  1HZ6 A;  3ZIM A;  4PS8 A;  4HRS A;  4RM9 A;  4KKI A;  2BBC A;  4JE3 B;  4S0R A;  4EFO A;  5AZH A;  3PV1 A;  3DOW A;  1NYR A;  3AE9 B;  2BB6 A;  1OTR B;  2CU1 A;  4IG7 B;  3SD5 A;  3PRM B;  1EUV B;  1P3Q U;  1UWX A;  1BXT A;  3UQB A;  1TS4 A;  3AE8 B;  1F2R I;  2O6V B;  3N3K B;  3OLM D;  3SHQ A;  1RFA A;  5D3I B;  3NRZ A;  5IA7 A;  2AQ3 B;  3A9K B;  4HRO A;  3ZTD A;  4C00 A;  2INN E;  4B0E A;  4PT5 A;  4OW0 A;  3TEY A;  2N9X A;  4BKG A;  1MFW A;  5C3J B;  1UEL A;  3ZTC A;  5J2R A;  2WP9 B;  5G55 A;  5EE1 A;  4DDG D;  3NVW A;  1SIF A;  2PEA A;  1EF5 A;  3RNB C;  2KNB A;  3R7Q A;  2LUM A;  2FCQ A;  2FCM A;  1FRD A;  2RDH A;  3E56 A;  3VUX A;  3VH4 B;  5BYQ A;  5KHQ A;  2IBI B;  4MH8 A;  1RFK A;  5GXG B;  1JWM D;  1N61 A;  3QX1 A;  4RFB A;  4LDT D;  2WU2 B;  1TJE A;  3RCZ A;  4IUM B;  4ZRK A;  2IJ0 A;  4RH6 A;  2NR2 A;  2WXO A;  1B9R A;  4IM0 A;  3RNA C;  4YSZ B;  2YEP F;  2I2Y A;  1QT9 A;  2IYD B;  2ONQ A;  1V49 A;  2MRP A;  3BYY B;  1SJH D;  4ITK A;  2DAF A;  2ZZP B;  3W2D A;  1T5X D;  4W9H A;  4GB9 A;  3SU8 X;  1EWY C;  3JYU A;  2ZCC A;  1TY0 A;  2C5L C;  3KQ4 A;  3SDL C;  3SFD B;  4I6P A;  4F8C B;  1XD3 B;  3B1L X;  5G2N A;  2WLB A;  5DPT A;  3DVG Y;  5AUK A;  5HFY A;  1BML C;  3AEG B;  4G50 A;  3QCA A;  2BYT A;  2UWQ A;  1WJU A;  3JSV A;  2QJL A;  1NEN B;  1SGH A;  1D6E C;  2J42 A;  4R3D A;  5IP4 D;  1L0V B;  1VR9 A;  1I7H A;  3DBH I;  1KLV A;  3PS6 A;  3P2B A;  1EU4 A;  2Y5B B;  4AOF A;  2WQY B;  3DHG C;  4BVU C;  1YMH E;  1RM6 C;  3NHE B;  2YLM A;  2IND C;  2ICI A;  2KC2 A;  4FLH A;  2BKF A;  1PGX A;  1J7C A;  4W9L A;  1SXT A;  3L08 A;  1AW7 A;  2GLS A;  4II2 B;  4BZA A;  4HPM B;  2ZNV B;  2QIE B;  3P63 A;  2R2Q A;  2Z0E B;  4PK1 A;  2ZJD A;  1LFD A;  3ONS A;  1HA5 A;  1QIL A;  4CHK A;  4FJZ A;  1GC7 A;  4NQK E;  3AED B;  2K9X A;  3JSV B;  1WH3 A;  1I4R A;  4WWP A;  4CO7 A;  1SEB D;  2N1W A;  4N58 A;  1MG4 A;  4KV2 A;  1FO4 A;  3FAH A;  2JT4 B;  5IOI A;  4EZK A;  4A6Q A;  2KDI A;  4ZOH C;  2FBW B;  4N59 A;  2K22 A;  3VRB B;  1MI0 A;  4H2A A;  3TUO A;  4G3X B;  4M00 A;  4J3O D;  4BKS A;  1SE9 A;  3DHI C;  2XBB C;  2HTM E;  2MBO A;  4ZRJ A;  1HZ5 A;  1J0G A;  3P4Q B;  3FKY A;  2KFJ A;  5D94 A;  2DYM A;  4P6V F;  4DXG A;  4P1C C;  2AQ2 B;  2RDG A;  1R4N I;  1GB1 A;  4IC7 B;  2VZK B;  1M4V A;  2LVO A;  1E90 A;  4AS1 A;  3TMP B;  4ZDV A;  3D32 A;  2KWD A;  3VVW B;  2G45 B;  4P16 A;  2X38 A;  2M0X A;  2CJN A;  2M17 A;  3QC8 B;  5GMV A;  2LD9 A;  2JWZ A;  2IGD A;  2LGY A;  2QHO A;  3PRP B;  4FN2 A;  4HCN B;  2KMM A;  5CHF A;  4IM2 A;  3JVZ X;  1GC6 A;  3KLS X;  3KVF B;  3M3J A;  5EE3 A;  4BBN C;  3IXS A;  2MJ3 A;  3WCQ A;  1TZO A;  3IFW B;  4A90 A;  1A70 A;  5IO9 A;  4WJQ A;  2LEK A;  4X57 B;  4K7W A;  1YX6 B;  3ZXR A;  2JQR B;  1WX8 A;  3L17 A;  3GE3 C;  5C23 A;  4IDI A;  2LJ5 A;  3VR8 B;  1FXA A;  1YNT E;  1IBX A;  2KDE B;  3AN1 A;  4HXD A;  2BVC A;  3MHS D;  1NVI D;  4MJS B;  1YJJ A;  5E6O A;  1AAR A;  4KZ0 A;  4HJK A;  2W54 A;  2WDV B;  3EUB 2;  2WGS A;  2WXL A;  4GDK A;  2Y5C A;  2DYO A;  4K7U A;  2WXK A;  4BOS C;  2LGI A;  1V81 A;  2GOW A;  4LCD E;  2JXX A;  2AL6 A;  4BKT A;  3W9C B;  2NPT B;  2JZP A;  3VH3 B;  1WM3 A;  3QA8 A;  3H6N A;  1DOX A;  3PGE A;  3ZNG C;  4EOY A;  2HJ1 A;  4WUR A;  1SE4 A;  3TJP A;  2DNF A;  5HI1 A;  2HTH A;  4WH4 A;  3VAW A;  4RGM A;  2NTT A;  4K1R B;  2BGF A;  3PO0 A;  1ZDV A;  2WDT B;  2KMA A;  3NOB A;  2WXM A;  4WWO A;  1WGY A;  3CWI A;  5EE0 A;  4TV3 A;  1EO6 A;  2KN4 A;  2WS3 B;  3ZNI D;  4WJN A;  4BBN F;  4RF0 A;  1NDD A;  3GB1 A;  2R2O A;  3NVZ A;  3DWM A;  3Q3N C;  4M02 A;  5CTR C;  2FE8 A;  2N7E A;  4NQL B;  1M94 A;  2W82 A;  3NUH B;  3P42 A;  4YTP B;  2HDE A;  2C7N B;  1Z2M A;  1SE3 A;  2RPQ A;  4AUQ C;  3VTV A;  3ZDM C;  2BKR B;  2BS2 B;  3ML9 A;  1JWA D;  2L52 A;  3W1S C;  2V1Y A;  3AI5 A;  1YQB A;  3LDZ E;  1DYQ A;  2QCZ A;  3AMZ A;  1TZ1 A;  3RNC C;  3R3M A;  4XE0 A;  1N6Z A;  4BFR A;  1OEY J;  3K9P B;  4ZYN A;  1FPY A;  1WJN A;  1JWU D;  3IT4 B;  4PYU A;  3WA0 A;  3QK0 A;  4JWU C;  5LLI A;  2Y3A A;  1E9M A;  2FCN A;  3AEA B;  2DYB A;  4KKJ A;  2O2V A;  2IO0 B;  1ENF A;  3ZLZ A;  3AH7 A;  4EKU A;  3DDC B;  4A3P A;  1JWB D;  4YXD B;  2WXH A;  2MHJ A;  4FUL A;  4HKZ E;  3ZO5 B;  3RN9 C;  3ETR A;  1C78 A;  4EZL A;  3ZNH B;  4LJP B;  4NAW A;  3GE8 C;  2PE6 B;  3AE7 B;  2ZW1 A;  1UNS A;  1VZ8 A;  1ROE A;  2OHF A;  1V86 A;  2M0A A;  3TEX A;  3A1Q A;  4USA A;  1GB4 A;  3AE5 B;  5MPO A;  4MT5 A;  1Q1O A;  3Q3J A;  4B9K A;  1RRB A;  1QQR A;  2JRI B;  2TSS A;  2QMT A;  1SB3 C;  1OQQ A;  3B0A A;  2N0S B;  2ZVO A;  2JVC A;  1TS5 A;  3NY5 A;  4LDT B;  1ZXH A;  4FJY A;  2C7H A;  4EUT A;  2D07 B;  2ASQ A;  3BIN A;  5G5G A;  2O2V B;  3NS8 A;  3PRE A;  1XO3 A;  1D4B A;  2D2Q A;  4XWT A;  2LVQ A;  4LNK A;  1GPX A;  1N62 A;  2NBV B;  3R2T A;  2DZI A;  3B9J A;  5LNK 1;  2QDF A;  4I6N B;  4NAW B;  1VJK A;  2MBH A;  2ACZ B;  1FNV A;  1MVK A;  3A1Q B;  1VD2 A;  3DBR I;  3M63 B;  3ZXV A;  4MM3 A;  4K81 A;  3N20 C;  1JAL A;  5HG2 A;  3RD2 A;  3HRD D;  2RSU A;  1WJ4 A;  4M0W A;  3Q8A A;  2G4S A;  3GZN B;  2L8J A;  3DWG C;  2V0G A;  1ZOY B;  1QOA A;  3U7Z A;  2AL3 A;  4OZC A;  2Z0D B;  1ZGU B;  2MBQ A;  2LRW A;  1GOZ A;  1C76 A;  1PGB A;  1PUT A;  1HXY D;  3AXC A;  1WE6 A;  3U52 E;  1T3Q A;  2PJH A;  1GUA B;  2QIL A;  2K39 A;  2IO2 B;  2WX0 A; 
#chains in the Genus database with same CATH homology
 2WQY B;  1YMH E;  1RM6 C;  1ZPS A;  2R61 A;  1TS3 A;  5FKA C;  2ICI A;  1TKY A;  2GRI A;  1FEH A;  4O1N A;  4XWW A;  2PMV A;  1L4Z B;  2M56 B;  3VR9 B;  2YEP B;  1PGX A;  2SAK A;  3HVZ A;  4KX6 B;  1KLG D;  3Q8F A;  1J7C A;  2JWU A;  4MM3 B;  1SXT A;  2I38 A;  4TSS A;  1AW7 A;  4RF1 A;  1C77 A;  4KGR A;  1JML A;  1FCL A;  1MHH E;  4ARI A;  3IAM 1;  2QIE B;  1CQV A;  4KGT A;  1WSP A;  2OED A;  3P63 A;  2J4X A;  3Q8E A;  4WAF A;  5D7G A;  3I57 A;  1E7P B;  1SJE D;  3AEC B;  2BTE A;  4UDU C;  2B76 B;  3P1M A;  1HA5 A;  1QIL A;  3BK2 A;  1Q10 A;  2E3T A;  2WXG A;  1NI3 A;  3AED B;  2K9X A;  1D5X C;  5FR3 A;  3LYY A;  2H89 B;  1XEE A;  3AE1 B;  1I4R A;  1WRI A;  2L1A A;  3U4E G;  2PTL A;  1SEB D;  2PVG C;  2JXT A;  4Q2J A;  4N58 A;  1CK1 A;  1IGC A;  3BYT B;  2PKO A;  4L23 A;  3ZYY X;  3Q8C A;  1P7F A;  1YQ3 B;  1FO4 A;  3FAH A;  1IUE A;  3EA6 A;  1AYF A;  3P4S B;  1XCQ L;  1UWM A;  5TSS A;  1PYW D;  3ZGZ A;  3MHZ A;  1JWS D;  4A6Q A;  1L6V A;  4US9 A;  3TEZ A;  1BUI C;  1JRP A;  4FXC A;  4ZOH C;  2FBW B;  4N59 A;  1I4G A;  5G5H A;  2K22 A;  3VRB B;  4DQO C;  4A55 A;  1MI0 A;  1CZP A;  1PDX A;  4H2A A;  4CQN A;  3TUO A;  1P7E A;  3ZJV A;  1MPE A;  2DBY A;  1SE2 A;  4J3O D;  4NZL B;  4YSY B;  4KGS A;  4ZHP A;  1FNU A;  1QOG A;  3T3O A;  1C4P A;  1WWT A;  1VZ6 A;  2HTM E;  4IKG A;  1IGD A;  4YWG G;  1RWS A;  4DXF A;  2E6X A;  3B2F A;  1HZ5 A;  2BW2 A;  2W55 A;  3ZJT A;  4IOI E;  2KAJ A;  2AX5 A;  4GDL B;  2EEL A;  4MAC A;  2KDM A;  2NTS A;  3TSS A;  3B2G A;  3P4Q B;  1RYJ A;  4JX1 C;  2WXQ A;  5JXV A;  2KQ4 X;  1GAQ B;  2V3N A;  1C79 A;  2PIA A;  5BYS A;  2N9L A;  2DYM A;  4WIP A;  4P6V F;  1C4A A;  4DXG A;  1DGJ A;  2IDY A;  1FFU A;  2AQ2 B;  2RDG A;  3Q69 A;  1GB1 A;  2VZK B;  3PZ8 A;  2GB1 A;  1V1P A;  1M4V A;  1D5Z C;  3RPF C;  4GLS C;  2VZK D;  3LB8 C;  4AS1 A;  2WDR B;  5HHD G;  1L0Y B;  1AWD A;  1FM0 D;  4N6E B;  2DWQ A;  4ARC A;  1ESF A;  2KWD A;  2MEK A;  3FIL A;  4A8X C;  3IT6 B;  1HQR D;  4P16 A;  2G1E A;  3TEW A;  3V05 A;  3GP7 A;  3P4P B;  2X38 A;  1FXI A;  4OZB A;  1E0Z A;  2CJN A;  1EM7 A;  1K52 A;  4JPS A;  1L4D B;  4OVZ A;  3SEB A;  3AE6 B;  1L5P A;  4XDC A;  4RGN A;  2IGD A;  2QSD A;  3KWV A;  3AEE B;  2KMM A;  3H8H A;  3MFG A;  5BMI A;  3KLS X;  5EE3 A;  2K3U A;  4ZRP A;  2Q5W D;  3IXS A;  3UI3 A;  2MJ3 A;  2ON8 A;  3WCQ A;  1TZO A;  3P4R B;  2JU6 X;  3MC0 B;  3AE4 B;  1ET6 A;  2AQ1 B;  1I4Q A;  4AQ7 A;  1F77 A;  2WU5 B;  1WXQ A;  1VRA B;  4A90 A;  1A70 A;  1QOF A;  2IGG A;  1NEK B;  3NVY A;  2LEK A;  1V1P B;  1I4X A;  1XXG A;  3AE3 B;  2L83 A;  1PGA A;  2JQR B;  4LTU A;  4YT0 B;  3V3X A;  1PFD A;  2D5G A;  2J53 A;  3W5U B;  3NVV A;  1FMA D;  3FIL B;  1KRH A;  1UUP A;  1FCC C;  5BMH A;  2Y5P A;  4IDI A;  2RMM A;  3VRA B;  3VR8 B;  1FXA A;  1YNT E;  1FRR A;  1IBX A;  2WXR A;  3AN1 A;  1TY2 A;  2WDQ B;  5AUI A;  1YN5 A;  2J52 A;  3AB5 A;  2L32 A;  1NVI D;  4WQM A;  1STE A;  1YJJ A;  4C56 C;  2BS4 B;  1QOB A;  1T6B X;  3BZD B;  1UGJ A;  3AM9 A;  4D2K A;  5E6J A;  2W54 A;  2JX5 A;  3J9C A;  2WDV B;  2WXN A;  3EUB 2;  1I4H A;  2WXL A;  4OZA A;  3URY A;  3T3N A;  1ZXI A;  2SEB D;  2Y5C A;  2DYO A;  2N7J A;  1SBB B;  2WXK A;  3AV8 A;  2LGI A;  4C7Z A;  1R7S A;  1LO5 D;  1QF6 A;  3BVG A;  3W9C B;  2DLB A;  5H8Y E;  2JZP A;  5C2T B;  4RGO S;  1F2R C;  1YN4 A;  4L2Y A;  2JYT A;  3HVD A;  1DOX A;  1KF6 B;  5I4D A;  2PLP A;  2BS3 B;  2Z8L A;  4WUR A;  1WGK A;  1ZUD 2;  2PW9 A;  4HKQ A;  1SE4 A;  1V97 A;  3GS2 A;  5HI1 A;  4WH4 A;  2LHE A;  3RFZ B;  1C9F A;  4RGM A;  1FD6 A;  1K51 A;  1YQ4 B;  2IPK D;  4C7Y A;  4TQ0 A;  2XN9 C;  2NTT A;  3VQI A;  1KH0 A;  1K50 A;  2N9K A;  1ZP0 B;  3PO0 A;  1ZDV A;  3CIR B;  2WXM A;  3BII D;  3BWU D;  3R2I A;  2CJO A;  5FK9 C;  1L0X B;  5T8I A;  4L1B A;  2LFI A;  4RNA A;  3CWI A;  5EE0 A;  1J7B A;  2H88 B;  4LK0 M;  2BT6 A;  1F0Z A;  2GI9 A;  1Y56 A;  3ABV B;  2KN4 A;  2WS3 B;  4ZHO A;  4TQ1 A;  2JSV X;  1K53 A;  4REZ A;  4RF0 A;  1I4P A;  4C80 A;  3E9S A;  3GB1 A;  3NVZ A;  3DWM A;  1FIQ A;  1TYG B;  4LLG M;  1CJE A;  3O13 A;  2FE8 A;  3LXF A;  4YTM B;  2WXI A;  2W82 A;  3NUH B;  1N5X A;  3P42 A;  1XLQ A;  2KAC A;  3IAS 1;  4YTP B;  1NYQ A;  2HDE A;  1XF5 L;  1JW9 D;  1WYG A;  1HZ6 A;  1SE3 A;  1N63 A;  2INP E;  2BS2 B;  1YN3 A;  4HRS A;  1JWA D;  2L52 A;  4KKI A;  3Q8B A;  4NAM A;  2BBC A;  4JE3 B;  1XLP A;  1DYQ A;  3N9Y C;  1NYR A;  3AE9 B;  2BB6 A;  3AMZ A;  2V3P A;  4XE0 A;  2W3R A;  2JYE A;  1UWX A;  1JWU D;  1ZE3 D;  3IT4 B;  1BXT A;  4JWU C;  1XLO A;  1TS4 A;  2Y3A A;  1FNW A;  1XCT L;  1E9M A;  3AE8 B;  1F2R I;  3OWE B;  2EKI A;  1JQ4 A;  3AEA B;  4KKJ A;  1QKZ A;  1FFV A;  1C4C A;  1TKG A;  5D3I B;  1SIJ A;  3NRZ A;  1ENF A;  2AQ3 B;  3AH7 A;  4HRO A;  4RCO A;  4YXD B;  1JWB D;  1QLB B;  2WXH A;  2INN E;  4ZRQ A;  5H92 C;  4PT5 A;  5BYR A;  4B0E A;  3HUI A;  1VDV A;  2WXF A;  2MJE A;  4HKZ E;  4OW0 A;  3TEY A;  1EU3 A;  2XNA C;  1JCK B;  2PVO D;  1B1Z A;  3ETR A;  5C3J B;  1N5W A;  1C78 A;  1OQR A;  2IGH A;  3PZ7 A;  2BB5 A;  4YSX B;  2WP9 B;  3AE7 B;  2ZW1 A;  1UNS A;  4YTN B;  1VZ8 A;  1ROE A;  5EE1 A;  3NVW A;  2OHF A;  3BVM A;  3W5V B;  1MHX A;  2M0A A;  3TEX A;  1ET9 A;  4XDD A;  4USA A;  1GB4 A;  2K5P A;  3AE5 B;  2LUM A;  5MPO A;  4JWS C;  1FRD A;  2RDH A;  4MT5 A;  4A9A A;  1KFY B;  3E56 A;  1QQR A;  2TSS A;  5BYQ A;  2QMT A;  1SB3 C;  2LMC A;  3AEF B;  4NJC A;  3U2S C;  1E6E B;  1OQQ A;  4HEA 1;  2N0S B;  4MH8 A;  1RFK A;  4ZYS A;  5GXG B;  1JWM D;  1TS5 A;  4EE2 A;  1DOY A;  1N61 A;  1ZXH A;  4RFB A;  3ZQ4 A;  3SR6 A;  2RPV A;  4WWM A;  2MJD A;  1TKE A;  2WU2 B;  1OFF A;  1TJE A;  3AEB B;  5G5G A;  3I9V 1;  3NS1 A;  2WXP A;  2NMQ A;  1XO3 A;  2IJ0 A;  4RH6 A;  1D4B A;  2LHD A;  2WXO A;  3MJ5 A;  2W3S A;  4XWT A;  1B9R A;  1GPX A;  1N62 A;  4OHJ A;  1HEZ E;  4TMA B;  1EWC A;  3NZ3 A;  1IBX B;  1VZ7 A;  3R2T A;  1V8C A;  2K0P A;  4RGT A;  4YSZ B;  2YEP F;  2I2Y A;  1QT9 A;  3B9J A;  1ZDX A;  1ACC A;  5LNK 1;  2ONQ A;  3SFE B;  1D5M C;  3FC4 A;  2FUG 1;  4NAW B;  3BYY B;  1SJH D;  1VJK A;  4ITK A;  5BMG A;  1YJI A;  3W2D A;  3C8Y A;  2ACZ B;  4US8 A;  4GDK B;  2LJI A;  1DOI A;  1VLB A;  1FNV A;  1MVK A;  3W1S A;  1KTK A;  1T5X D;  3MP9 A;  1EWY C;  3AE2 B;  1TY0 A;  3KQ4 A;  3SFD B;  2CU3 A;  1E10 A;  1JAL A;  5HG2 A;  3L4P A;  3BVZ A;  3HRD D;  4M0W A;  3Q8A A;  3KWL A;  1V1O A;  2ZW0 A;  1J7A A;  5D3D A;  2WLB A;  3DWG C;  2QEJ C;  2M19 A;  3ZJU A;  2V4I B;  5AUK A;  5HFY A;  2V0G A;  1BML C;  1KLU D;  1N60 A;  3EGR A;  1ZOY B;  2WNM A;  1L6U A;  4B0M A;  3AEG B;  1QOA A;  2WXJ A;  3U7Z A;  1XLN A;  2BYT A;  4HJG E;  4OZC A;  5EE9 A;  2QJL A;  3R8B A;  1GOZ A;  1NEN B;  1C76 A;  1D6E C;  1PGB A;  2J42 A;  4R3D A;  1L0V B;  1VR9 A;  3BK1 A;  1SSN A;  1JRO A;  1SF0 A;  2MH7 A;  1PUT A;  1HXY D;  1TS2 A;  2G9H D;  1AN8 A;  1I7H A;  3U52 E;  1T3Q A;  2QIL A;  1EU4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...