1KLGD

Crystal structure of hla-dr1/tpi(23-37, thr28-->ile mutant) complexed with staphylococcal enterotoxin c3 variant 3b2 (sec3-3b2)
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
239
structure length
231
Chain Sequence
ESQPDPMPDDLHKSSEFTGTMGNMKYLYDDHYVSATKVKSVDSFFKWDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKGKTCMYGGITKHEGNHFDNGNLQNVLVRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Minor structural changes in a mutated human melanoma antigen correspond to dramatically enhanced stimulation of a CD4+ tumor-infiltrating lymphocyte line.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/toxin
molecule keywords HLA CLASS II HISTOCOMPATIBILITY ANTIGEN, DR ALPHA CHAIN
total genus 67
structure length 231
sequence length 239
ec nomenclature
pdb deposition date 2001-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
D PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1klgD01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1klgD02
2R61A 1TY0A 1UNSA 1CQVA 5ELCA 1JCKB 2G9HD 1I4RA 1TS5A 2WV6D 1S5ED 4RGNA 1FNWA 1UUPA 2O2LD 1V1OA 5FKAC 3BVZA 1SBBB 1BCPF 1I4HA 4O1NA 2XRSD 1PTOB 1LTBD 3EA6A 1PRTF 1SJHD 1S5BD 1I4GA 1PRTC 1LTGD 4RGMA 4RHSA 1STEA 1QILA 4RGOS 1LTRD 4C56C 2SEBD 1HTLD 1AW7A 1PZID 1MD2D 2IJ0A 1GOZA 3V05A 1LT3D 1ESFA 1ET9A 1XTCD 1F77A 2Z8LA 1FD7D 1EEID 3O13A 2TSSA 1FGBD 1ET6A 1S5FD 4Z9CB 1PTOH 1EWCA 1I4XA 4OHJA 1EFID 1PTOC 1D5MC 5FK9C 1TS3A 4L63B 1BCPB 3R2IA 1PTOF 1PYWD 3BYTB 1V1PA 1YN5A 1PRTB 1JWUD 2AQ1B 1PZJD 3MC0B 1FNUA 2NTSA 3BYYB 1RDPD 2QEJC 2XRQD 3BZDB 1DJRD 4RFBA 1CHQD 1CK1A 5D3IB 4NZLB 1HQRD 1TS2A 4RCOA 1TS4A 3TSSA 3MFGA 3W2DA 3R8BA 1JQYD 1LTTD 3SEBA 2IPKD 2QILA 4RHRA 1L0XB 2RDGA 3EFXD 2XN9C 1EU4A 4RGTA 1I4PA 3DWPA 1L0YB 1ENFA 1SJED 1I4QA 1LTID 1B44D 1EEFD 1LLRD 1RCVD 5ELEA 1AN8A 1PRTD 5TSSA 1RF2D 1SEBD 2AQ3B 5ELDA 2NTTA 1BCPD 1JWSD 4ZYSA 1LT6D 1PTOD 3R2TA 1S5DD 1LO5D 1LT4D 1TY2A 1JR0D 1EU3A 1HXYD 3KLSX 2ICIA 1YN4A 4L6TB 1D5ZC 4TSSA 1SE3A 4DXFA 1KLGD 1RD9D 1T5XD 1KTKA 4RH6A 5D3DA 1S5CD 1CHPD 3DWAA 1D6EC 1D5XC 1LTAD 3DWQA 1DYQA 5ELFA 1SE4A 2J4XA 1G8ZD 1BXTA 3BVGA 2XNAC 3OWEB 1FNVA 1SXTA 5I4DA 1XXGA 1YN3A 2AQ2B 1SE2A 1B1ZA 4K6LA 2RDHA 3BVMA 3URYA 1KLUD 3CHBD 1BCPC 1LTSD 3GP7A 4UDUC 4BWGB 1PZKD 2CHBD 4DXGA 1CT1D 1M4VA 1HA5A 1V1PB 5ELBA 1LT5D 1JWMD
chains in the Genus database with same CATH superfamily
3EQLC 1U0LA 3UE0A 4Y7NB 4WJOA 1K3RA 2MPMA 3K57A 3Q69A 3KLSA 1CSQA 3NE5B 1HTOA 3ZTDA 1Q1BA 5IP4D 1K9MC 4GKJQ 4WORA 2MBQA 3QB3A 4OVUA 1I4HA 3K5LA 1CMXB 2BCOA 3AULA 5FR3A 3N30A 4YWGG 1IBKL 1WSPA 3GTMB 2JXTA 2LGSA 4G3XB 2ZM6L 1S72A 2WX1A 1XMQQ 4IALA 2KLCA 1P7FA 2ZXOA 4GDLA 2UUCL 3AE2B 1SYGA 2HJ8A 1FR3A 2ZJDA 2HE7A 4DR1Q 1Q5WB 3T56B 1HEZE 1WM2A 2JQRB 2UUAL 3MHSD 2CQAA 3PGZA 3O13A 1YJNA 5LMUL 4JI4Q 1R7SA 1BOSA 1EQRA 1GXDC 1VQMA 4K5VA 2IX0A 1WZ0A 3FPPA 1TWCB 1UE6A 4DNTB 3RR5A 1OXTA 1YNNC 4L63B 2N7JA 4IFDJ 3DOWA 4USAA 1PGXA 3X0WA 3I57A 1PRTB 2F3IA 4BA2I 1K0SA 4M02A 4GLVB 4C7ZA 3OLMD 3RZDH 3T9LA 4RFBA 2M8SA 3S16B 5C3XA 3VR8B 4BKGA 4X66L 3CF5A 5C0XH 3L2PA 1SMYD 1Y8PB 2EOTA 4K2KA 5C3EG 1C78A 3L10B 3I91A 1RAXA 5D94A 4ULLA 2B63B 2QILA 3GV3A 2WFWA 1B3QA 3X3MA 3E0EA 4JWSC 3FKIG 4AQ7A 3QOJA 3UDXA 3PT2B 4M0WA 4A3BB 2YEPB 3IXSA 1EEFD 5ELEA 4LK0M 4J3OD 1PRTD 2B8GA 3D4RA 4IN3A 2NVQH 3N1ZC 4IM3A 1D4BA 1ZXTA 4O0AA 4A3JG 4DR2L 1AFPA 4A3KG 1SFOH 3FEWX 1TWAB 1PH1A 3KUPA 2GRIA 5IY0A 5IP9G 2EY5A 2QW7A 1C48A 5IYDH 2FNJB 2G4DB 4XIGS 4BBRH 1V5OA 2L5TA 2B2YC 4FULA 2L52A 4M0WB 4F7ZA 4DV6L 3AYHB 3WOFA 4F1SA 2JA6G 1XMQL 4JQWC 2HCCA 1HNXQ 1GUOA 1ZE3D 3Q3MC 1SDFA 5IIFA 2KWVB 3HZXA 3L13A 1KTKA 1E0BA 2D07B 3H0GB 1HFGA 3FPUB 3AU5A 2RCFA 4BY1B 2N88A 4IOAA 3I2ZA 1J8CA 4JI7L 2B76B 4YWLA 1EOVA 5KNBA 2UU7A 1R9TB 1F9SA 3E9IA 1FIQA 4DV0L 4B3TQ 3SGIA 1FNVA 4GOPC 2L83A 3SFDB 4FJVB 4WJQA 4B3SQ 4KHZA 4K6LA 1ZUD2 1QZGA 3M63B 4A20A 1EWYC 4FXGC 2XEWA 4W9GA 3PSEB 3A8IE 3AH7A 2CHBD 2WB1B 4DXGA 3GTKH 2R6GA 1OFFA 1M4VA 4ZRZA 2B2VA 4BY7B 2W3RA 1VQBA 4G7HC 5LMNQ 2JA7B 2E76C 2KAJA 2Z59B 4WWPA 4A3CH 1WWTA 2OJWA 2IHFA 4DNIA 1MG8A 1A2UA 4LJOB 3VUXA 5HHDG 4I7ZC 4DR5L 1D8LA 3BVZA 3CQZH 2WINB 4AYBE 3QCAA 4K7WA 2BTEA 4BKSA 1EY9A 3BK1A 4ZDVA 1HTQA 4PZ7A 4HEDA 3J7A5 2RMMA 1TXYA 4IFDH 4KHVA 1N6ZA 4TUUA 1GB1A 2QDLA 1K8MA 2VQFL 3ULPA 1PLFA 1KIXA 4GOPB 1VQ6A 2MQHA 1Q8KA 1TQOA 1XLOA 2EYPA 1VQ7A 2BYFA 1L4DB 4N58A 4JI8Q 2MJ3A 4II3B 1V8QA 1DXMA 4MTNA 4C2MB 4HMJA 4EQNA 3I72A 1WJUA 1FCCC 2DENB 2AMCB 2QDBA 3JVZX 1R4QB 3ONAB 1HUNA 1ZW7A 3DHIC 4FBJB 3M3YB 3S2HH 3ZKJC 3CCQA 1A3UA 1J5EL 3RI7C 4KIKA 4HPPA 4W9JA 2IO1B 4R9WA 1WZ3A 3I73A 1MSGA 5JJLA 1VQNA 4LUVA 2DNEA 1G2TA 4JI1L 2RSUA 2D5GA 4HJ8A 2YYZA 2LVOA 3RNEC 4EE2A 2ZXPA 4FF1A 2N1VA 4GMVA 1VQFA 2GOWA 1TS2A 2BKFA 2JA5H 5AJ3Q 3LX0A 1QUQB 3TSSA 2DYBA 1OXUA 1UE7A 2CCZA 5FO8B 4HLEA 4WJPA 3L0WB 2B2TC 2WB1E 1I4PA 3DWPA 4DNRB 4BBSG 5C0XJ 1ACCA 2D0PA 1Y1WH 1BDOA 2KEDA 2IWHA 1E8XA 3DPDA 1YNXA 4DK3C 5DM63 2D9UA 3H0GH 4GSWA 1HA6A 1Q3LA 1PH3A 4D2KA 1FD6A 1QWYA 4X65Q 1WJ6A 3L7ZC 1I35A 2DZMA 4MDKE 1PTOD 1VQHA 3AE5B 3L3OC 3TREA 4YSZB 2WNMA 4C3IH 1F1HA 1TKGA 3CCUA 3P4PB 4GNXC 1E7VA 1VF5C 4QGUA 3J80L 1L4ZB 2KWDA 1O7YA 1D5ZC 1KNAA 3SK8A 1PUTA 1CSPA 2A69C 3RUZA 3RZFA 4DXFA 2LRUA 4JOIA 4GS3A 2NZ1D 1IKMA 4KSLC 2EJGC 3CKIB 2BQQA 3BU2A 4AYBB 2FE8A 1S5CD 1WGYA 2IO0B 3CF6E 3GE8C 3R66C 4DR7Q 4MN3A 1D5XC 1EIGA 1QCBD 1DYQA 3QOLA 3TS2A 1XEEA 3I3TB 4K81A 5C1ZA 2H1EA 4IPCA 5D65A 4RMAA 4ZLTF 2FIDA 3OSOA 1RFAA 4GB9A 4LDTB 1F9RA 4A3KH 2F0KA 1SE9A 2R93G 3CPWA 2LVPA 4WURA 5FLMH 3CRKC 3NRZA 3ND8A 1WJ4A 4FP5D 1T0YA 1PZKD 2XBBC 2B3GA 3BDLA 1HFNA 1V5TA 4R4CA 3QC8B 2PKOA 2CVRA 3I55A 2D3AA 4M1UB 4A3DH 3BY4B 1E3PA 2E2JH 1QVCA 3GB1A 4ZAIA 4POFA 4ZK9B 1DOLA 2QEXA 2K5PA 2K5NA 3OW2A 4KK7A 5KEEA 5C44G 3DQVA 5GADC 2GI9A 3ZW3A 5M3MB 1BF4A 3B6YA 2JQOA 1K52A 3I3CA 2BA0A 2VH1A 4PMBA 4XX5A 1TWGH 5G3LD 3M3JA 2L1BA 1PRTF 1AARA 4DHJD 4C00A 2G3QB 4BBSH 3MHZA 4WWNA 4MNOA 1SSOA 4B3RL 1FEHA 2UU9Q 2O2VA 1EOTA 3J81L 2AL3A 3JAML 1EYCA 1HR0W 5EQ0A 2J53A 2JX5A 4C3HH 3A33B 2SEBD 1HTLD 3A8KE 1TT5B 3Q8FA 4E71A 2HJ1A 4HPMB 5JEAJ 2FCNA 3GTJB 4KN4C 1JWBD 2HCIA 3LWUA 2K8HA 1RIPA 3GV6A 4RKLA 3B08A 3RD2A 2OTLA 1A70A 2I38A 4IZ8A 1ZEQX 1M1KC 3CSFA 3QA8A 4BA1I 1EL0A 2ZZPB 2Y5CA 4US8A 3Q3JA 2TMPA 1I4XA 2LMCA 2PO4A 3HOVB 2N8NA 5CV4A 2OHFA 2NS5A 1OQQA 1D1IA 4L23A 1ICWA 1WOCA 4XDCA 5GMVA 5IN7A 1O7ZA 1LGRA 4DDID 4NXML 3KW5B 3NY5A 2MHVA 4GDKA 5D3IB 2DY7A 2VUMH 3HOWG 2EYFA 1GHKA 3QIJA 4NQKE 5D7GA 2RD0A 3TEHB 4H44C 1Z5SB 1FM0D 2L0TA 1A3VA 2LGXA 1STGA 3MEHA 1X3QA 2MH7A 2PPHA 2M00A 5CV7A 2A69D 3KLWA 1LM8B 2LRWA 3U58A 4RGTA 1L0YB 3AE6B 3BDOA 4CYEA 4ZKCB 1GUTA 1WTPA 1J5EQ 1TWHH 2EYMA 1JORA 1HRJA 2BWFA 2JWZA 4GDKB 3VTWA 1AN8A 4W9FA 2AEHA 1RF2D 1SEBD 1U4AA 2PIAA 4UP9A 4YY3Q 2R92B 1GAQB 2GBNA 3K59A 4OO1I 2ES2A 3PO2G 4PYUA 1FJGL 3MJ5A 1KAWA 1BNZA 2WDTB 1JC7A 2ASBA 2A4ZA 1QQRA 1HUMA 4L1BA 3AM9A 2V4IB 4S3SA 5HG2A 4O2DA 2KDFB 3W1YA 1I6VC 3HUIA 3D32A 3AE1B 3T51B 1RLFA 1OQRA 1YQ3B 1E24A 1MVKA 4IW0A 3NOBA 1C77A 1CHPD 1PH6A 2H5XA 3P42A 1KDAA 1NI3A 2J4XA 1KJTA 1WVLA 4A3GB 2E2JB 3NG0A 5IGGA 1PA6A 2MX2A 1X3FA 5LL6X 1BR9A 1VJKA 4KLKA 1IYVA 2Y3AA 5I9PA 1DM0B 2JZ3B 3L4PA 3T1YQ 2CW0C 2K1FA 4ITKA 4Q5VA 4GNXA 4YCVA 1VS0A 3B2GA 2WKCA 2E8GA 2IO2B 2Y0SE 2ZTEA 2NPTB 3AE4B 2WXHA 2X8XX 4KKTA 3UE1A 2RA4A 4ZUJA 3CWIA 2UUBL 3L17A 2K75A 3PF5A 1TYGB 1PFSA 3S14B 4LF7L 3KBXA 2JYOA 3GTGB 1E2WA 2HDEA 5FLXL 1Y8OB 2LXKA 3NUHB 1IP9A 5C5MA 4YTPB 3EA6A 2IL8A 4YCWA 3PUXA 1KM7A 1PFNA 1EIYB 2J52A 4RM9A 2KHWB 4R8NA 2V0GA 3NWSA 3HHMA 3W1BA 1R4NB 3NTHA 1YOVB 3LDZE 4DR6Q 2V9HA 4A3PA 1ET9A 2LXCA 2YTVA 2K0PA 1XD3B 4R4IA 1C4PA 1NE3A 1FD7D 1F2LA 1SE8A 1WTWA 2ACZB 1HPCA 1FXTB 1C0AA 1SN8A 4A3FG 3QX1A 4GN3B 5IT9c 4HJKA 3ONSA 4ZRPA 1BQQT 2N3SA 3G6EA 3I4NH 4FJZA 2C9OA 3RN5A 2PVOD 4DU9A 1RFKA 3WAOA 1GJZA 2CH4A 1YBYA 2L9HA 3J80i 1MI2A 1F9PA 1UZXB 3OJ3A 3NP8A 1XPUA 3WAPA 3SD5A 3HP3A 4ANXA 4DBGA 5JOBA 3ENEA 1XLPA 5KHQA 4BBRG 1Q82C 3L54A 4GLXA 4OEMB 3L16A 4DHZB 2FBWB 2YVCA 1XWEA 4XDXA 4MSQB 1V8CA 4RHRA 1SIFA 1KFYB 5CGKA 1I4QA 3BZCA 2MSED 4QJFA 1H9SB 3UF8A 1C79A 1SNPA 1PDQA 4OIKA 2KJHB 5HGQA 5I2YA 2Y5BB 3G6JB 1YQ4B 2YU9B 2OTJA 3ML8A 4R3DA 2F3WA 2JK8A 2RKSA 1ILPA 5DCNA 4LF6L 2MJEA 2DBYA 2IGDA 1IBXB 4QAYA 1JR0D 4G7OC 1EQQA 2WDQB 3VYRA 5M5XB 3ZNGC 4BBNF 1HZBA 1QT9A 1NR4A 1YJJA 2BS3B 2KQ4X 1EY8A 1J0GA 4JC0A 4AQYL 5H8YE 3ITPA 3HOUH 3CCJA 2L1AA 1EFWA 3MXNA 4C1NK 3PMFA 3IFWB 4JI3L 3NZSA 3ULLA 2PI2A 3P20A 1I50B 1W6KA 4GKKQ 2N7DA 3PZ7A 4MIUA 2KTFA 3HOXH 3BVGA 5GQOA 1SXTA 3DEOA 2ZJRA 3S1NH 1A6XA 2A5UA 4IO9A 1XLQA 1FMAD 4F8MA 3KF6A 3HGBA 5E4XA 5JJKA 1NI2A 3PO2H 2KX0A 3MXNB 1VQEA 1Q8IA 1VQAA 1P0RA 1LTSD 2EYLA 3CMAA 1R4MI 2K8BA 5F2DA 3A8JE 3KOJA 1Z2MA 3KK7A 2ZPYA 3IG3A 1QOGA 4NPNA 4XZ4A 1BT0A 4MZ9A 1E6EB 3TP6A 5C4JB 2R61A 2WWZA 2M2LA 1JB3A 2GB1A 3A5UA 1HH2P 1GM5A 5GROA 1I4RA 3R3OA 3U4VA 2EKEC 2WV6D 4RKBA 4UAIA 3GTLH 2B2UA 1HZ9A 2O2LD 1OTRB 5FKAC 1WXAA 1MJCA 4JI7Q 3FMCA 1CJEA 3LXFA 2AHOB 4MJSB 3PRZA 4TMAB 4DDGD 4A3KB 1KXLA 1LM0A 3CW2C 4KDLB 1RTNA 3DBSA 2MUYA 2Z6KA 4I65A 2HDMA 2KKCA 3PZ8A 1B9NA 4LJPB 4A3BG 2D3CA 4WWMA 1NEKB 4J6IA 2EDGA 2JEBI 4DV5L 3ZRFA 2IJ0A 3NTIA 1XNQQ 1JRPA 4A3FH 1ASYA 1T0SC 4LUZA 5A2QE 4B0EA 3NBIA 2IGHA 1P16A 2Z8LA 5LMUQ 3BK2A 3RN9C 2K05A 2JZPA 2IYDB 4DR2Q 1ET6A 1WGRA 4AYBG 2RQXA 1BUIC 4B95A 2JP1A 1HR0Q 3S2HB 5G5GA 2MP2B 3DHHC 3VQIA 1IW7C 1WH3A 1E8ZA 3SK6A 1JJGA 4JCVE 4RNAA 2BBCA 3VH4B 3DHQA 4K6DA 1UE5A 4NJCA 3BWUD 3S15H 1OO9B 2KEEA 4K1RB 4LF5Q 2L4NA 4W9IA 1TWAH 3X3NA 4P2CB 4MHEA 3FKIB 2QKIC 1PGBA 4GN1A 4MGKE 2DJGC 3S1QB 2YU9H 3SR6A 4EGVA 4IUVA 3N20C 3S1MH 3P1MA 2LI5A 3VAWA 2K01A 3VTUA 2ZNVB 5IGEA 4JYAQ 4JI6Q 2N9PC 4M8AA 4AP4C 1PFMA 1X6OA 4G50A 1VQ8A 3LWEA 4IDIA 1I94L 2RR9A 1MHXA 4XQJA 3GOEA 3RUIB 3HOVH 4OWTB 2F0JA 2WXLA 3Q8CA 1Q1EA 5M3MG 4WAAA 2ZW0A 2KJ6A 5BR8L 5KNDA 3HVZA 5CMDA 1T9HA 3JW0X 1C76A 4LF4Q 2MBOA 4YXDB 1K83B 2I46A 4FNFA 1L2NA 2DYMA 1V86A 2WXIA 1PV4A 5NUCA 2WACA 2ICIA 3U8ZA 1IBLL 4PZ8A 1K50A 4A3EG 3VR3A 4A3EH 1DOXA 1I5FA 2BS2B 1NTGA 2VS1A 4AJYB 3VR5A 1HNXL 4F7XA 4K0KL 2PE6B 4LLGM 4JBJA 4N9PA 4IUMB 4IJLA 5IGCA 3HOZH 2JEAI 1C8CA 3PZDA 3QO2A 1TIID 5JAVA 5IWAQ 1HZ6A 4RMFA 2XNAC 5I4DA 3M7NA 1VLBA 5IAAC 3NK9A 3TP7A 1B1ZA 1YZ6A 3HKZB 3PUYA 4MGIE 2RDHA 4LF8L 1FL0A 4AH6A 5H92C 3T3OA 3C19A 3KWVA 1BCPC 1RTOA 4IQZA 3W1SA 5LXIB 4IPGA 2YEPF 1XJVA 4KJOA 2WP9B 4R4TA 4WFN3 3APFA 2BPSA 3DBRI 1KL9A 3AQQA 2DNCA 3Q3NC 4NY0A 4KV6A 5GAGC 1TY0A 4QQBX 1KLVA 1CKOA 1W6JA 4RM8A 4L5QA 5IGFA 1Y56A 4A8XC 3KFUA 3CCRA 3ZXVA 4K14A 1L1OB 1Z9FA 1FVIA 2I0QA 5C3WA 1LABA 4PS3A 4AUQC 1IYJB 1EY0A 5LHY1 4HJ7A 2E5LQ 1KH0A 2CU3A 2EMTA 4IUQA 1YVCA 4A93B 2M0XA 1LTLA 1SJHD 2KWCA 3W3AA 4B9XA 3TMPB 1UWXA 3WA0A 2OQ0A 3HM6X 1NR2A 3PO3G 5L95C 3OHXC 3GTOH 4A3LH 1JOOA 3KYHC 5DAUA 1Q86C 4X3UA 1MD2D 3J7YW 2JXXA 1F0ZA 3HKZE 1J8IA 1B8AA 3AEVA 4WWOA 3BIID 3EIVA 2DWQA 2AWNA 2WYQA 3MAQA 5TR5A 4LAAA 3SR1A 4KX6B 4GIVA 1I6HH 2FFKB 3N6RA 2A1AA 3MC9A 2JN4A 1K51A 1HNWL 2GMIC 4DV3Q 3DM3A 3CCVA 1BCPB 5IP7G 4OO1G 3ZJYC 1YNTE 5C0XG 3T4AC 2UWQA 1ZXHA 3U9OA 3PLUA 1CFMA 1FNUA 3W1GA 3W5UB 4HDQA 2KK8A 3Q6SA 3S17H 1GUAB 2NCNA 2A73B 1TT2A 2B2WC 1S3SG 2PMZE 3VYTA 2V3SA 1B9MA 5IT9E 2FCSA 4OVZA 5JEAG 3LYYA 3R8BA 3WDNA 3CMEA 1N32Q 1K83H 4C3JG 3SEBA 1X3GA 3DCGA 4JWUC 4EX5A 1IUEA 4WJNA 1JE4A 2FXQA 4ID6A 1G291 3TIXA 3VUYA 4FADA 4R4OA 5CORA 2C60A 2HQLA 2JSVX 2OJRA 2C5CA 1B70B 2NBUA 4A9AA 3TEZA 1H9JA 1CQFA 1CI3M 4G57A 4F87A 1WTOA 4X3TA 1SYBA 2KMMA 1PH9A 1LT6D 3A9JB 3R2TA 1K8GA 3DXJC 4A76A 1E8YA 1XF5L 2N9KA 2M0AA 1P8LA 2M17A 4IJHA 1BO0A 2WAQG 4YSXB 5L83A 1HXYD 3ER0A 1V80A 4DK6C 2NBWB 2XIWA 3NBHA 3JC66 4TSSA 3MXUA 5C3JB 1HTPA 2E75C 2L76A 3VTVA 4IM2A 1K8OA 2JRIB 5EKLA 2MJ8A 3A56A 5IT9L 2Z0DB 3EROA 1D1KA 4CDFC 1AYFA 4HK2A 1Q81C 2LEKA 5EE1A 4LF6Q 4A90A 1G8ZD 1U4RA 3K5NA 2VUMG 2VW9A 3OWEB 1X9NA 5M3MH 3FC4A 5ELOA 4BBNC 1WRIA 1O7LA 4DR4L 2HQEA 5I2XA 3GTQB 1CKMA 3SFEB 1SE2A 3PO0A 4MEMA 1MI0A 5EKKA 1P98A 2A6ED 2K25A 2AL6A 2CHWA 2G9DA 3PPAA 4EZLA 4ARIA 3NELA 4LK1C 2CJOA 2P5ZX 4J6HA 1CT1D 3CPFA 2DZJA 3NVYA 5D6JB 1VRAB 3AFPA 1U5KA 5EPKA 2EXZA 3TDQA 4H02A 4A3OA 1I50H 1YHBA 3M4OB 4WQOB 5AZHA 3HOWB 1FRDA 1KRTA 1S40A 3PIPA 1E5WA 4LFCL 2EYHA 5D14A 1YJ1A 1L6UA 2LFNA 5M5XH 1FXAA 2NMQA 1JE5A 2NVXH 2DZKA 2F0NA 4P73A 3ZO5B 1PRTC 4B3SL 1IPGA 4O42A 4OZCA 4JI6L 2JA8H 1EIHA 5LLIA 5FO9B 4CO7A 5LL6S 3DBLI 1OXXK 4DGZA 4B0MA 3ML9A 2J0MA 5KIXA 3UINB 3ZYYX 3HIZA 3AU4A 3SVMA 2GVBA 1F9JA 1L0VB 1MJDA 2DNFA 4GGQA 3HS0C 2K03A 1F2RC 3VUWA 3GTLB 3RULA 3IHPC 5AZFA 4CDCC 2B2WA 1XT9B 1EWCA 2E2IB 1UWMA 5CHFA 1D5MC 1QKZA 1QOAA 1WJJA 1TWHB 1TGZB 3BYTB 3UQAA 5K36G 1V1PA 2AWOA 2BDOA 3LJ3A 2G45B 5C4JH 2CHZA 2E2DC 3TJPA 1WJNA 2NTSA 4C3JH 2FAZA 4QMGA 2KFKB 1XCQL 1RDPD 4DV4Q 3OIPA 1EQVA 2I07B 1E1OA 1RRBA 4QL5A 1K28A 1O7IA 3I8ZA 3GS2A 1PYSB 2A19A 1B7YB 1WD1A 1CUKA 3FRPB 1DOIA 1H4RA 4UY8C 5LMNL 2CR5A 4OX9Q 3KWLA 2CW0D 1HQMC 3C2PA 1EY4A 1ZDVA 2R2QA 3KYDD 4HIKA 2JA6H 2KFKA 4A75A 4LMQD 1T0QC 5BMHA 1U4MA 1E9MA 2EIFA 4AOFA 2QSDA 2B2YA 4DA2A 3QHTA 2X6GA 4ZHPA 3GDEA 3JAMi 3U30A 3RNCC 2KVMA 3ETRA 2X69A 3PO3H 1TVXA 2I1KA 1V2YA 4L2YA 1S5DD 2PQAA 1LO5D 4DAVA 3JAMc 4L6TB 1TIFA 5J3BA 3ZUNA 2MGSA 3HOYH 1XMOL 5E6NA 2K1BA 5AJ3L 4V190 1UGMA 3PV0A 1T5XD 4N9F4 3DVNV 2O6VA 3D0FA 3E56A 5I6YA 2V3NA 3V2TA 3E3XA 1SMYC 4MGYE 2L11A 2LVQA 3D6CA 1HNZQ 3C8YA 2KJRA 2F0SA 4A3IB 5C2TB 2IZVB 4XWTA 2WXGA 1WXQA 4OZBA 1SSNA 1YHAA 2I5HA 2RHSB 1PH2A 4GKJL 3NENA 3CAMA 2PE9A 5IP7H 1ZYRD 3TZDA 3M4OH 2N49A 4KKSA 5G55A 3PHWB 1VQIA 5IYBH 3J7AF 2EY1A 1SAPA 3JSVB 3M95A 3CCSA 5J17A 4Y52H 1RYJA 2GN5A 2ZM6Q 2O6VB 4NAWA 3AI5A 3CP0A 1YX5B 2NVXB 4P74A 4CKBA 5HGTA 4XYCA 1IHZA 4W9HA 3NVZA 1LT5D 2MLBA 3I4MG 3HKSA 5IWAL 1WTVA 3I5JC 4KI0A 2RVLA 2G9HD 3P63A 1KNEA 1IGCA 5C44B 1GHJA 2WU2B 4C1NI 5GAHC 1YHQA 3A9KA 3M62B 1E7ZA 4JIOU 1TU2B 3OTOQ 1UH6A 4KDIC 3UGBB 1M8AA 5LNK1 3S1RH 3EJIA 1BCPF 1OXSC 3WCQA 3HEJA 3K9PB 2DUDA 2KOXA 1MPEA 5BO4B 3ABVB 4MH0E 3NXWA 1SRUA 3TZUA 3N52A 3IBEA 4JBWA 5LMNW 2A5HA 1C4CA 1MJEA 3DVGX 2XVSA 1Y14B 5J1ZA 4IWPA 1XX8A 4GZYC 3KUDB 3ZLZA 2MO0A 4KN7C 2RDBC 4X66Q 3QJYA 1YX6B 4I6NB 1YQBA 3T1HQ 3PVLA 2QIEB 5E4WC 1S1QB 4FJYA 5G2NA 5HFYA 1AZPA 3ZNZB 3LB8C 4JI8L 3IAYA 1X65A 3AFQA 4A3DG 2XK5B 4BFRA 3AMUA 4ANVA 3MTSA 2F0TA 3GD7A 1HE8A 4BXXH 3K81C 1A63A 3HOVG 2Y5PA 5EAYA 5FK9C 4HCNB 1VQGA 5HURA 2KN5A 3GZNB 2HD5B 2PZUA 2JF5A 4W9KA 3P4QB 2GBMA 1YN5A 1CTMA 3VH3B 2Q2IA 4X3KA 4HIMA 4MT5A 2R3ZA 3CCMA 3APCA 4OW0A 3W5OA 1WYWB 3KJPA 3B2FA 2K9XA 4X64Q 3S16H 1YNJD 3QR8A 2A6EC 2HDLA 4YCUA 3S1MB 3NVVA 1TS4A 1B9RA 2G5DA 1N5XA 3H1UA 3U9SA 2LFIA 1HNWQ 2QGQA 1TKEA 1RKNA 4TKOB 1A8VA 1AWDA 4DXAB 2KC1A 5IKCM 1VQ5A 2NB0A 1QZHA 2E2HH 1LTID 1B44D 2IT1A 4AIMA 3U52E 1KQSA 3NHEB 1CM9A 5JVH3 3TEWA 4K5WA 4AWJA 2PZTA 1YJIA 2CKZB 4BY1H 3KBGA 3MEFA 2BYEA 2VZKB 1SFOB 2C35B 4W9DA 4FF3A 1P1AA 1K8RB 3MC8A 4WQMA 3G48A 4XQQA 1VCBA 4TQ1A 4W9CA 1RL2A 2L15A 2Z4IA 2VL6A 4ACFA 1N62A 4L5RC 1DOYA 4YL8A 3IT6B 3HK0A 4AS1A 3A55A 1WXSA 4DAYB 5JZEB 4KZ0A 4UHVA 1STAA 2WAQB 2RSNA 2C7HA 3ZGZA 2OOBB 2GBKA 1S3OA 2R7ZG 5IYCH 2FUHB 4K8JA 2CKHB 2MA9B 1G6ZA 5CX3A 3HOXG 5AEKB 1R9TH 1HZCA 5T1IA 3HFZB 5BR8Q 4RF0A 3MXPA 4DAYA 2VB2X 4US9A 2B8FA 1TWCH 4EQ5A 4TKNA 4JLCA 3TEYA 2DAFA 2WXMA 5DPRA 4KKUA 1LQBA 1CKNA 1JWAD 3TQYA 2N0SB 1STYA 4OGQC 1NYRA 5ELCA 2NVUI 2YV5A 2E5LL 2C7NB 3DDCB 5AZGA 2PTLA 1KRHA 2H89B 4DK1A 4ABNA 5E6JA 2Z0SA 1T6BX 2ASQA 1TKWB 5KGUA 3H15A 3J7ZC 4LDTD 2K5DA 1V49A 4KMUC 2IW3A 2UXBL 2EJMA 2DGYA 4PMCA 3M3YH 4HSVA 1TJEA 4M00A 1STEA 1LV9A 1ESRA 1LACA 4RGOS 1H95A 1JT8A 4IFDI 1GKHA 4YHHQ 1QF6A 2KCMA 3OW7A 3OPOA 4XYQA 5K5PA 1PZID 4PV1C 4HJAA 3BDCA 1V97A 2KYWA 4OVVA 1L7YA 1CA5A 3MJWA 3DMUA 3WOEA 3H7PA 3A9JA 4NXMQ 5AUIA 5BMIA 1EEID 1QB5D 1XLNA 2J7QB 2L3ZA 4B3TL 2K5WA 1WM3A 1I6HB 2W9NA 3JYUA 2K7VA 4X57B 3U2SC 3NSWA 3Q2AC 1I7HA 4CKCA 2RPQA 3AEBB 4ZRQA 4DR3Q 4HDOA 1HJPA 4C80A 3ZIMA 1J6QA 3KDFA 2KENA 3OAWA 2KANA 1VMCA 1D3ZA 1UEBA 2E2HB 1SF0A 3H7PB 3RNUA 1G6JA 1JWUD 1PZJD 4F8CB 2JA8B 4H13C 4FO2A 4N8X1 1GJXA 2VRRB 2DX5B 4KGSA 2I2YA 3BZDB 2ZXRA 1VQKA 1C4QA 5C4XH 4QIWB 1WD0A 3UI2A 3DEPA 1YEZA 2BS4B 2X38A 2F0OA 1PVOA 2L05A 4DR6L 2Q8TA 3SK4A 4AQYQ 2PW5A 1S4ZA 4HPLB 3W2DA 2C9WB 1V81A 4C3IB 3CC7A 4A3JB 1X1MA 1Q12A 2B2TA 1QE6A 2IPKD 1NMFA 1YMHE 4NB3A 2XWBB 3H3VH 1FXIA 4LFAQ 4P72A 4F88A 2JPHA 3W9CB 3QWNA 2GBJA 1ENFA 2Z6KC 1W2BA 3QARA 2UYZB 1NJIC 1IXRA 3A1QB 5C3EB 1IYFA 2F0WA 2NUCA 3CU7A 1PYBA 3I4OA 5DEHA 2JA7H 3ULJA 2ZCBA 4GXBA 4LUOA 3EBEA 3CC2A 3IVFA 3HG9A 4CJ1B 1FJGQ 4FN2A 1UWVA 1XYIA 1NNXA 2RHQB 1QG7A 3JAME 4Q2JA 4HCPB 4JI2Q 4HKQA 2KTRA 3RZOB 4TQ0A 1MHWC 3ZJVA 1IGDA 1IBLQ 1O80A 2F4VL 1WTRA 4KIKB 3GE3C 2BYTA 3K5MA 5D3DA 3AEGB 2A6HD 1IW7D 1VMPA 2RSOA 4DR4Q 4EUTA 1JMLA 4GDLB 4OZAA 1EM7A 3UI3A 2PQEA 3PQIA 5C4HA 2E3TA 1WRDB 2L0FA 4HN7A 2JYTA 1NBWA 4JI4L 4FXDA 2KTRB 4RCNA 1XXGA 3GTPB 3N1XC 3SK5A 1JOQA 5EBDA 4C2MH 2AQ2B 4PQXA 1ICFB 4U68A 4BY1G 2YLMA 3RNFC 5E6OA 1KLUD 3S2AA 1IL8A 2A68D 2AYOB 1JQ4A 1QNUA 2KDIA 1U4PA 4HWIB 4HEA1 2NZHA 3MA2B 4CJ0B 1V1PB 4TVAB 5IYDG 4EFOA 4E3CA 2NN6G 2NVQB 1RODA 3H3VC 3J7AV 4C3HB 1SMXA 5ISRA 1XNRQ 3TBLD 1HZ5A 4BKSD 3RYTA 3UIOB 2NVTB 3STBD 3PO3B 3OTOL 1VQOA 1HZAA 4MGZE 5C6AA 1J7CA 2RPVA 5M5YB 2R7ZH 1AE2A 2PCFB 1PTOB 4II2B 4LNFA 2OWOA 1C9OA 4S0RA 2INDC 4DQOC 1EYGA 4K7SA 2RCNA 1VDVA 4IC7B 1YNND 2NYZD 1WFYA 2Z0EB 1NAPA 3Q8AA 2NPTA 1N8RC 4FVMA 4EKUA 4LF4L 5JVG3 1J7BA 4QCLA 3PREA 4IUTA 1ASZA 2CU1A 2EE1A 4PK1A 2WU5B 1ENAA 2Q2UA 2G4SA 3Q24A 3OYYA 3OMCA 4JV5Q 3AECB 1Y1WG 4ME5A 3K80C 3W1SC 3MHBA 1I94Q 4BVUC 1N61A 1X56A 1SB3C 4HROA 1SYCA 3ZNID 3PRMB 4NJ6A 2F4VQ 1AP0A 3F2DA 1UEAB 2BWES 1EFID 1MKHA 1PTOC 2ZTDA 1UBIA 1TS3A 2KCTA 1X3EA 1K3BC 3HRDD 2W54A 4GU2A 4GN4B 1TKYA 2NBFA 4JG2A 4BY7H 4CHTB 2LHEA 2IO3B 4L5TA 1F2YA 2JXMB 2OCEA 2XSCA 1WF9A 3KUCB 3AE9B 4ZRKA 2DN8A 2R92H 3F8TA 4FYDA 3VR2A 2C7MB 3R3MA 2VUMB 2KDMA 3W5VB 2EELA 2K6DB 4MM3B 1QOBA 3PIP3 4NNJB 3OIQA 2MRPA 3JSVA 4PS7A 4W9EA 5CHWA 1ML0D 1CZGA 4LWCA 3C0RB 2PZWA 3I4MB 1WCMH 2KXJA 3STBC 3EN2A 2WQYB 4EOYA 4XYOA 3NQIA 1VQJA 1K73C 4JVZA 5KRUA 2CJNA 1C1YB 3I4NG 4OIJA 1IBKQ 2WXKA 3VYSA 1BVSA 5COYA 3A4RA 2M19A 4BKTA 2K8CA 4LF9L 3VR9B 1UGJA 3PIOA 2PW7A 5IODA 2I5LX 5ELDA 5FJ8G 2NTTA 4MM3A 4PNYA 3U50C 1NENB 2WGSA 2MBHA 2LASA 3GTQH 3GO5A 1Q10A 3AEEB 4RF1A 4KKJA 5E1FA 5M3FG 2IY0B 2VB3X 2WS3B 1YN4A 2IGGA 3H9DA 1RM6C 3LGJA 4PZ6A 2LMCB 4MELA 4EZJA 1EIFA 4ZUIA 2F0DA 1KLGD 2DY8A 3VYUA 3QIAA 4DKAC 4IOCA 3H7SA 2F0FA 4OX9L 4U673 2PVGC 3A7AB 5HY6A 2DJFC 5JEAH 2DZIA 4GOPA 4HJ9A 3NPPA 3H91A 4OWWB 1WX9A 4ICVA 1SNQA 1A5RA 1B3AA 4DF7A 1A3TA 2LGYA 1BXTA 3VRAB 5BYSA 2LKVA 4BBRB 1EUVB 2JA5B 2NVTH 1WR6E 3K7AB 1N33L 3I56A 2KQ7A 5DPWA 3L9AX 1AH9A 5ELNA 1E7UA 2R7ZB 4KY7A 3N3KB 4DV7Q 4IKGA 2KDEB 1F9QA 4RA8A 1NDDA 2LGDA 1EZ8A 3NTKA 1IYUA 2B2UC 4A3MG 4LNNA 3TBIB 4C3IG 1IBML 3Q8DA 2A6HC 3AE8B 4M8NA 3UQBA 1YD8U 3OWFA 4ODGA 4NXNL 1ZKOA 3KYCD 1TS5A 2KUMA 5FO7B 1QOFA 4RGNA 1EQTA 1FNWA 1DZ1A 1JROA 2FCQA 1V1OA 2O6VD 2QMTA 2F3VA 2ON8A 1QUQA 1OEYJ 3V3XA 2MO1A 2XRSD 2G1EA 2EYJA 2KHSA 1KOTA 2VQFQ 5A35A 1CZWA 1SYDA 2F4IA 4KTAA 5AUKA 1HR0L 2CS4A 2HT1A 4H7BA 3V61A 1LTGD 3AEDB 2ZT9C 4UP7A 5JPMC 1N36L 3CD6A 3AEAB 5FJ8H 1U9RA 3V05A 4X65L 2E6XA 1P9DU 2ZW1A 4LNQA 1EY7A 3R7RA 3CQZB 4RWSC 3RLOA 3E9HA 1D2BA 3Q23A 2WXFA 3Q14C 2TSSA 4I6PA 4C4VB 3BJUA 1UD7A 2BVCA 3EHVA 4A3IG 4G0NB 2J0KA 2R2OA 2Q2TA 4P75A 5KNCA 4OHJA 4L8JA 2JA6B 5BYQA 1TR5A 3BG3A 5GXGB 3R2IA 3K5OA 3TEXA 3VHTC 3EFCA 1Y8RC 3CIRB 2A8VA 3OMGA 1FFUA 4P1BC 4WAFA 1E10A 4LF8Q 2B63G 4DV4L 3DWMA 4FF2A 2QEJC 3VDYA 2BGFA 2SAKA 3J9CA 4A3GH 5DPTA 1YIJA 1CHQD 3VVWB 4DUZQ 3DVNU 2EYOA 2MHJA 4NZLB 2SNSA 1QJOA 3H6MA 2MP2A 2D3GA 2IX1A 2J42A 4LCDE 3B1LX 3CCLA 4E74A 5T1GA 1HCZA 2JA8G 1PQSA 2RDGA 2K14A 3HOUG 2ZPNA 4B3ML 2M56B 4BBSB 3KLRA 3K7UC 2WB1G 2V1YA 1V6EA 2BE5C 1LLRD 1SLJA 1OQYA 2MJDA 4IOIE 1CKNB 4IUUA 5DLQE 2IBIB 2IY5B 2MBEA 1N5WA 1VZ7A 4WJ4A 4ZRJA 2EJFC 2CQOA 2KLGA 4LFBL 1VDZA 3J80E 5EE3A 4EQOA 5JPNC 1LFDA 3RNGC 4A3LG 3C3LA 1G91A 4URKA 4JW0A 1XPOA 2V1CC 1N34L 2BKRB 3EFUA 5IA7A 1EU3A 5CV9A 1NVID 3DHGC 2R92G 3MP9A 1AE3A 3HOYG 1EY5A 1JOKA 3PO2B 4HRSA 2FCMA 2O2VB 5J22A 4RG1A 4IUPA 1TZOA 3ZXRA 4QUFA 3DWAA 1FPYA 3PS6A 3DM1A 3T13A 1XPRA 3D8GA 1GD7A 4JGHB 1M94A 1ZPSA 3ZRCA 5JJZA 4IPHA 2FIFA 3Q6BA 4KGRA 2O5JC 4JI3Q 3S1RB 1WE6A 4OL7A 1JMCA 1JW9D 2F0HA 3BVMA 3X23A 1P7EA 4JK1C 1MIUA 4DAMA 3WIMA 2F0GA 4BWGB 4EZKA 5M5WH 2JU6X 1X55A 1K53A 2BOSA 3F2BA 5M3FH 2I1JA 4P6VF 4J8QA 1H9SA 5C3EH 1RJTA 4FLHA 4IPDA 1VZ8A 1VF7A 2QCPX 2MEKA 1IZ6A 4K7UA 1CQVA 1I3QB 3I63C 2LUEA 2N4FA 4G7ZC 1NBFC 1WTXA 5IOIA 3G4SA 4DR7L 1DD2A 1AEXA 1V9JA 4ANUA 4DR5Q 2QA4A 1E2ZA 1R4MB 3IRBA 1PH7A 3PCOB 1GUWA 2LXJA 4CDDC 2KT7A 2KD0A 1IKLA 2W3SA 3ZNHB 5EGTA 4O1NA 2L8JA 3PRPB 1IBXA 5DM73 1NCVA 1T0RC 3K6OA 3MXGA 3PGEA 5IOCA 1S5BD 2JJQA 4XGAB 1UELA 4DK0A 4CHKA 4RGMA 1GC7A 4HVBA 1QILA 4A3DB 1XQQA 3A1QA 3NZ3A 1VZ6A 5IYBG 1GOZA 2JA9A 2XGTA 2Q8IB 4CKEA 1L1OA 1LT3D 3GTJH 1IBMQ 5C4XG 2QDFA 3HRZC 3FILA 1XTCD 5DNFA 1F77A 1SYEA 2ZTCA 3IAM1 3VDZA 3IAS1 1PH4A 3SU8X 4YWKA 5FLXc 3FKIH 3PUVA 4OONA 1VQ9A 2M1MA 1QLBB 1V9PA 5C4ZA 1PTOH 2OT2A 1WMHA 2BA1A 2KNBA 4POGA 3Q3FA 3A4SC 3FILB 4DUYL 3GZNI 2D0OA 1K0RA 1DGJA 2L32A 3M4PA 2AQ1B 1FFVA 5EKIA 5IGBA 2A74C 4A6QA 5IGDA 1Y1VB 3EVQA 1DJRD 3P2BA 4KD4A 2K6AA 2WDRB 2I5MX 3K9OB 3NS8A 2UUCQ 3P75A 4RCOA 5HKHA 4CBVA 5M5YH 4MJSA 1V1QA 2EQSA 2EZVA 4LF5L 3GTGH 1LTTD 4FHKA 1T5EA 3KQ4A 2N78A 4ZYNA 2K22A 1EYAA 1ROEA 4OO1H 4KHPQ 2EPBA 2F0VA 4BOZB 2INCC 1JB7A 2BW2A 1RCVD 4FXCA 2BF8B 2OF1A 3SDLC 3VRBB 2K5VA 2AQ3B 3KF8B 3O65B 1XO3A 2UUBQ 1JWSD 1KD1C 3I70A 3QG1A 4JBMA 1XNQL 2K5QA 4DV2Q 1ZGUB 4EVOA 2QC8A 1STNA 1NSNS 4IFDG 4X3SA 1PDXA 2DHZA 2LUMA 2K32A 2ZNVC 1KDCA 5KHOA 2O4XA 3RZOH 1EF1A 3P4RB 1KABA 1TBEA 2NN6I 4J1MA 2JT4B 1YI2A 1SE3A 1VQLA 2QCZA 1RD9D 1PHJA 3KF8A 3T3NA 1YNJC 3AU7A 2X6LA 4RH6A 2KHJA 1PGAA 3BINA 2UXBQ 4LJZC 5M3FB 1VR9A 4ZKBB 2OEDA 2XTIA 2OXPA 3VR4A 2N7EA 5BYRA 4TRDA 2PLPA 3QWZB 1SIJA 3DBLB 1W3SA 3IFDA 4QUCA 1Z47A 3FDTA 3I4MH 1GUSA 1B4OA 3KJOA 3MFYA 4KD3A 2F1MA 3OG5A 1F52A 2VQEQ 4ANWA 4YTNB 4ZQ3A 1A15A 2GLSA 5FOBB 1JWMD 5FR6A 4N9TA 1TWFH 4NPSA 1G6PA 2KC2A 5D2MB 3C1FA 1E8WA 3F2UA 4HSPA 2HHHQ 3IKJA 3AE7B 2PJHA 3TL5A 4DV3L 4HMIA 3D31A 1NMGA 4P7IA 2ALYB 4NP5A 1P3QU 5E3FA 1N63A 4KY6A 3RNBC 1LXDA 1FO4A 4B08A 1BUVT 1EO6A 5EPLA 2D2CC 4MTKA 2W55A 2MBBB 2RGFA 4JI5Q 4H0LC 5C4XB 1UBQA 2RBMA 1NUCA 3A5ZB 1WI5A 2K33A 3S14H 1J19A 1MG4A 3S1NB 4KKIA 4KGTA 2MQJA 4GLSC 3GQBA 4A3JH 2ONQA 4DUYQ 1KHIA 1S5FD 1B50A 4Z9CB 3T8MA 3FAHA 1FGUA 3V6EB 4QF4A 4A3EB 4JYAL 4KSKC 3EC8A 1GB4A 1G51A 1R4PB 2B29A 2LJIA 4V0BA 4JI2L 4YT0B 3A54A 1CZPA 2F0MA 3EGRA 2KA7A 3PTFC 2AX5A 1DOKA 3H09A 4K5XA 3CCEA 5JJIA 5JH5C 3TP8A 3SHQA 2XWJB 1Q7YC 3UDIA 2WXNA 1SNDA 4KZCA 2L7RA 1QNKA 1D7QA 5EJWA 3HOZG 4FA6A 3MFGA 4FDBA 1DONA 2BB6A 3KF6B 4DWFA 1JQYD 4ARCA 5CYUA 4B3MQ 1WI0A 3P1HA 3A0JA 3I4NB 2K3UA 1MBYA 4LFAL 1VD2A 1XMOQ 4WH4A 3ZTCA 1N32L 1UE1A 1VQCA 2NWGA 2UUAQ 2L0CA 5TSSA 1ILQA 1Y8NB 2K50A 4DUZL 4XWWA 3Q0AA 1SNOA 2ZJPA 3RZDB 1IL2A 2ENBA 3AN1A 3R7QA 5FLXE 4DK5A 4JPBW 1MHHE 4XDDA 5CR3A 5IE8A 3PUWA 2CHXA 3DVGY 3N1YC 4P1CC 4K2LA 2WX0A 1F2ZA 5BN3A 1ONLA 4XE0A 4A93H 1FYCA 4A93G 3RCZA 4DV6Q 4HJ5A 2VZKD 3TCAA 1EY6A 2KVZA 4LF7Q 3RMHA 1H8CA 1H9MA 1WFQA 4J15A 2CFMA 3U4ZA 1WX7A 3H6NA 5E7NA 1JJCB 2V4DA 3HKZG 2GVAA 2N1WA 3NHHA 3N32A 1RWSA 3DWQA 1G2SA 3V6CB 3M4QA 1GO3E 3TS0A 1TWFB 3HOXB 4LFCQ 2OEOA 2WDVB 2HD3A 4GNXB 1N34Q 2KMAA 3PF4A 2MCNB 3S1QH 3ECIA 1B53A 3AMZA 4IM0A 4TV3A 1YN3A 1C3TA 3QJZA 3K7AH 4C4VA 2WKDA 4A4IA 4JI1Q 4IG7B 4XXEA 2CWPA 4C3HG 1E22A 1EYDA 3MWYW 2KZRA 1X3PA 3HOUB 3Q8EA 3SDZA 1U4LA 4UDUC 1A62A 5BN5A 3T1YL 1T3QA 1ZDXA 2W82A 4R8IA 5E6PA 4KHPL 3L0OA 5C23A 1L1OC 2PNRC 2Y0SG 4HR7B 1VQDA 2HHHL 1QOHA 2KCCA 2LJ5A 1JCKB 1XTDA 2KACA 4HCEA 2NZOA 4Y7NH 3D6WA 3AEFB 2FMCA 1MSHA 3D3RA 2WHIA 1S5ED 2J7ZA 5KYIA 4GKKL 4KY5A 4PG3A 4NAWB 1WX8A 3D4WA 3MTNB 5T8IA 2H88B 3WAMA 2EKIA 4BZAA 4DR3L 4JX1C 1PFDA 1HNZL 4YIJA 4RHSA 2F0IA 4YWMA 3NQTA 1WIAA 3ICEA 2HIVA 3G7LA 2JZZA 1LTRD 3DWGC 3P4SB 4EEWA 1AW7A 4JL9A 3H3VI 4A3FB 3SHLA 2WXPA 1OXVA 2KMCA 3E5SA 1PH8A 1E0ZA 4LNKA 4YHHL 4MH8A 4DAPA 2BYVE 1HHVA 3DBHI 3AE3B 3QQ8B 4GN5A 3V96A 3H0GG 4EQPA 4LW1A 5M9OA 1WCMB 4XT3B 1YJWA 1QVGA 1Q1OA 2V3PA 1VQPA 2AUJD 1E7PB 2N9LA 1ZYRC 3S2DH 3NEMA 4ASWC 2YTXA 1JJ2A 5M5WB 3PV1A 2UXCQ 3TP5A 4N8FA 1PTOF 1PYWD 3G71A 4BAXA 1SYFA 2JVCA 2A68C 2K39A 3S15B 1ZKHA 3R93A 2NR2A 2PMZB 3PIO3 3CSTA 1I3QH 1GC6A 3BYYB 1A2TA 4IWQA 4OELB 1RHPA 5CHVC 2GA4B 3NVWA 4JE3B 3AV8A 3HVDA 2ATWA 2WIIB 4IUNA 4R4QA 5CV6A 4JI5L 2ZJQA 2REXA 4A3MB 1DCZA 3UDGA 4JBKA 1WR1A 3HM3A 4NQLB 5JXVA 4L5SA 3RNAC 3RMKC 4NXNQ 4BXXG 4W9LA 1L0XB 3EFXD 2JA7G 1Q90A 2AWTA 2V4LA 4K3CA 1SR3A 5JHAA 3U4EG 2NVYB 1SJED 3PHXB 3RPFC 3S9WA 2BB5A 3MZ5A 2RF4A 4DV0Q 2K04A 2HIXA 4UPAA 2M4NA 3U7ZA 2LSSA 2R93H 1EF5A 1J9OA 2VH2A 3AXCA 3NWTA 1GVPA 3BZKA 2CWAA 4ZYSA 4A3CG 1YIWA 3DBRB 5GAEC 1KDBA 4HIOA 2Q8RE 1WTHA 2B39A 4MACA 4X6AH 4LTUA 4RAUC 2LS01 1TY2A 1GG3A 3KLSX 1EZ6A 1DOMA 3J81c 4R1JA 3TN2A 5LXHA 1FCLA 1GUGA 2JSOA 4NJ7A 5J18A 2VY3A 2EY2A 3VR6A 3VXWA 4AJWA 2NBVB 3TUOA 3M9BA 4X64L 2LWPA 4M01A 4ZRIA 1BMLC 1H9RA 3CC4A 4HTHA 4NW2A 2Z1CA 1Y1VG 1Y1VH 2FMMA 5IO9A 4A3GG 1LYLA 1II3A 1WE7A 2JWUA 3J80c 4DV5Q 4LFBQ 3IT4B 3SE0A 1OGWA 3F2CA 1PMRA 2LHDA 3AB9A 2N9XA 3EECA 2PYKA 2NN6H 2WLBA 2E74C 3GTMH 2KX3A 5EDSA 1WMHB 2UXCL 5HI1A 4NDXA 3LNNA 4CJ2C 1JALA 2KN4A 4XT1B 1GPXA 3GTKB 3HOZB 3NJTA 1WXVA 5DPSA 3CHBD 3GP7A 3ND9A 2K5HA 2SDFA 4C3JB 5IYCG 4FF4A 2UXDQ 3I7FA 2KBNA 1ISNA 1L5PA 1SGHA 1GUNA 2Q5WD 2QJLA 5J39A 3I4LA 3K0YA 4FXKC 4QIWE 2BT6A 4M8MA 4MSMB 4DR1L 3CRLC 4OWXB 5K36H 3Q8BA 2EMSA 2ZVOA 3I9V1 3ALBA 2PQAB 2INNE 3PUZA 3DLLA 5G5HA 1STBA 3OJ4B 1BBWA 1CA6A 4B3RQ 1I4GA 1H9KA 3RFZB 4DV1Q 3NUCA 5CC4A 4C56C 4H2AA 1I42A 1Q0WB 3VA5A 1TTNA 3H94A 1E2VA 1ESFA 1SROA 4K3BA 4YSYB 3C46A 3SXHA 1EWIA 5BMGA 2VZAA 4E6IA 4N6EB 4A3MH 1E90A 1QVFA 1PFBA 4WJ3M 2YTYA 4LF9Q 2BDNA 1ZXIA 4C7YA 2JRHA 1O78A 2FHTA 4JI0Q 4DV1L 3GTOB 1UAPA 3FP9A 1BBXC 4A3BH 2ZEQA 2K6QA 2KDBA 5EE9A 4DFAA 3MVVA 1PH5A 1UF0A 3B9JA 3M7GA 2K52A 3BS1A 1DGSA 2PW9A 2D11A 2F0QA 1WGGA 3KVFB 3A9KB 4GOCA 2KQ3A 2F0PA 3VFKA 4IURA 4HCSA 2N55A 1N9WA 3ZQ4A 2FJ2A 1XNRL 2L12A 4XQNA 4JI0L 3KDFB 4ALPA 5JHBA 5FLMG 5EPJA 4I6LB 1KF6B 2XN9C 2Q2HA 1NYQA 4B6WA 3RT3B 4WIPA 4P16A 2Z9HA 2F0UA 1KRSA 2Z6BA 1WYGA 1A0IA 1VCIA 2L55A 1GNUA 3FHWA 3M85A 2MWSB 3UIPB 3S17B 1BCPD 1N33Q 1X54A 3C1EA 2KCNA 1KC8C 5C44H 2F0EA 4CDEC 1B2TA 2PEAA 2UU9L 2LD9A 2XK5A 2D10A 1LT4D 2DAJA 4KV2A 2QHOA 4N59A 1JICA 3APDA 2WP8J 2VQEL 1Q46A 4ICUA 2Z4HA 2ZVNA 1E1TA 3PSIA 5KYLA 2FINB 2DYOA 2VNUD 4NKLA 4G11A 3D4DA 3P7JA 3T53B 4HJGE 2PMVA 1L6VA 2LXAA 5I9OA 4KVGB 3ZVVA 2AUKA 1MGSA 5ELFA 4HAEA 5I6WA 2PI2E 2J0JA 1X32A 3KH0A 4DPGA 4UP8A 2HTME 2JUOA 2EY6A 2MFIA 5L37A 4WJWA 2ICEC 2INPE 2JY6A 4REZA 2OQKA 3K0XA 2R7DA 4K8IA 3V62A 5C0XI 4QY7A 1WY8A 2K4KA 2QF7A 2EVBA 3ERQA 4BY7G 3L08A 2D5DA 2RDFA 2LY7A 4G4KA 3UDFA 3T16A 4BS9A 4JOIC 4HXDA 3ZDTA 1C4AA 2B3AA 1LUZA 1QZEA 3J81i 1WGHA 3RD4A 3E6ZX 3Q3OC 4XTCS 2R7FA 1HA5A 2IHEA 3F1ZA 4I7AA 4ME3A 3RLNA 5ELBA 1TZ1A 4LNIA 1HQRD 4PT5A 5CV5A 1UNSA 2L00B 2KHIA 2WXRA 3WALA 4PMWA 3HOWH 1L0WA 2KFJA 1L2FA 4NAMA 4HIDA 3U7DA 2KECA 1STHA 1UUPA 3A74A 4S17A 4ILWA 1XCTL 1SBBB 1BBUA 3J81E 1JRUA 2J0TD 2Y0SB 4YTMB 2BH8A 1LTBD 1YJ9A 4ZHOA 1WGDA 3M4YA 3EUB2 3ERSX 1OTCA 4OXPA 2D2QA 2M9VA 2D62A 2WXJA 5IP9H 3QK0A 1SNCA 2KVRA 4JPSA 1BKBA 1MFWA 4P71A 2PNHA 1C7YA 4PYZA 4DV7L 5CBEE 2JYEA 2DLBA 3ZJTA 4Q0FA 1ENCA 5AFWA 4DHJB 1F2RI 2VXWA 4JV5L 2KOLA 2KQSA 2ID0A 2MNAA 3DBHB 3CXCA 3WWVA 1FGBD 3ZJUA 4A55A 2E2IH 3Q22A 1PXUA 3TRZA 4XC2A 1WTQA 2GBRA 1WYDA 2LGIA 4X62L 1Y1WB 5A2QL 3FVQA 3RLFA 4GLAC 4LNOA 2LZ6A 3S24A 3MC0B 2AKWB 2BH2A 3H8HA 3NZUA 4APVA 2XRQD 2KWUB 1R4NI 1CK1A 2ZCCA 2WAQE 3PLVA 1YITA 1SNMA 1AZQA 3N9YC 3IL8A 4CGYB 1EUJA 2WXQA 3RZWC 2K28A 1ZP0B 2C5LC 1EU4A 2F0LA 4IWOA 4QB4A 2IX3A 5BN4A 3CMMB 3J81j 4NMZA 2IDYA 3FKYA 1EWHA 1Z7TA 3NBHB 4BOSC 3I90A 5H1SE 4WRDA 1WXMA 3QAQA 2HTHA 1J7AA 2WXOA 3E0JA 2O5IC 5G3LF 1N60A 3KUZA 2F52A 4DV2L 1Y69U 2SNMA 1N36Q 3AB5A 3WANA 1M90C 3A7LA 2UXDL 2B63H 1C9FA 2N9EB 4YY3L 4K0KQ 2B2VC 1WCMG 3GTPH 2KO3A 1TWGB 2F03A 3HOYB 3TMEA 2MP1A 3DUZA 4ZCKA 3S2DB 5CTRC 1KAAA 4B9KA 4B9WA 3E9SA 1ZOYB 3NS1A 2MW5A 3B0AA 3RN2A 2H4OA 2CH4W 2NVYH 2IY1B 5CBAE 4DHZE 2PPBC 1Z6HA 1V43A 2BE5D 4A3IH 1NY4A 1D6EC 2FUG1 3IFTA 1K8AC 2R93B 1LTAD 5EBCA 1F2MA 3VA7A 1SE4A 2EXDA 4DN4M 3T1HL 1FRRA 3K58A 1WGKA 5EE0A 1OEYA 3OOCA 2D3BA 2KJXA 5J2RA 5C5LA 4FHJA 3ZDMC 4PS8A 3V60A 4TQUS 3K8AA 3URYA 4X62Q 4HKZE 4ZOHC 2HUGA 2SOBA 4KJNA 5MPOA 4CQNA 2JA5G 2JE6I 1VQ4A 5CV8A
chains in the Genus database with same CATH topology
3EQLC 4Y7NB 2MPMA 3Q69A 3K57A 3KLSA 3NE5B 1Q1BA 4WORA 3QB3A 1I4HA 3K5LA 2BCOA 5FR3A 4YWGG 1WSPA 3GTMB 2JXTA 4IALA 1P7FA 2ZXOA 3AE2B 1SYGA 1FR3A 3T56B 1HEZE 2JQRB 2CQAA 3O13A 1R7SA 1BOSA 1GXDC 4K5VA 2IX0A 3FPPA 1TWCB 4DNTB 1OXTA 1YNNC 4L63B 2N7JA 4IFDJ 4USAA 1PGXA 3I57A 1PRTB 4BA2I 4C7ZA 4RFBA 3S16B 5C3XA 5C0XH 1SMYD 1Y8PB 2EOTA 4K2KA 1C78A 3I91A 4ULLA 2B63B 2QILA 3GV3A 3X3MA 4JWSC 4AQ7A 3QOJA 4M0WA 4A3BB 2YEPB 3IXSA 1EEFD 5ELEA 4LK0M 4J3OD 1PRTD 2B8GA 3D4RA 4IN3A 1D4BA 1ZXTA 1AFPA 3FEWX 1TWAB 3KUPA 2GRIA 2EY5A 1C48A 4XIGS 2L5TA 2B2YC 2L52A 3WOFA 2HCCA 1GUOA 1ZE3D 1SDFA 5IIFA 3HZXA 1KTKA 1E0BA 3H0GB 1HFGA 3FPUB 4BY1B 2N88A 2B76B 5KNBA 1R9TB 1F9SA 1FIQA 1FNVA 2L83A 3SFDB 4KHZA 4K6LA 1ZUD2 1EWYC 4FXGC 3A8IE 3AH7A 2CHBD 2WB1B 4DXGA 2R6GA 1OFFA 1M4VA 4ZRZA 2B2VA 4BY7B 2W3RA 4G7HC 2JA7B 2E76C 2KAJA 1WWTA 1A2UA 5HHDG 4I7ZC 3BVZA 2WINB 2BTEA 1EY9A 3BK1A 4HEDA 2RMMA 4IFDH 4KHVA 1GB1A 1K8MA 1PLFA 1TQOA 1XLOA 2EYPA 1L4DB 4N58A 2MJ3A 1V8QA 1DXMA 4C2MB 4HMJA 4EQNA 3I72A 1FCCC 2QDBA 1R4QB 3ONAB 1HUNA 3M3YB 1A3UA 4R9WA 3I73A 1MSGA 2DNEA 1G2TA 2D5GA 2YYZA 4EE2A 2ZXPA 4FF1A 1TS2A 3LX0A 3TSSA 1OXUA 5FO8B 2B2TC 4DNRB 1I4PA 3DWPA 5C0XJ 1ACCA 1BDOA 2KEDA 2IWHA 5DM63 2D9UA 1HA6A 1Q3LA 4D2KA 1FD6A 1QWYA 3L7ZC 1PTOD 3AE5B 3L3OC 4YSZB 2WNMA 1TKGA 3P4PB 1VF5C 3J80L 1L4ZB 2KWDA 1O7YA 1D5ZC 1KNAA 3SK8A 1PUTA 2A69C 3RUZA 4DXFA 2NZ1D 1IKMA 2EJGC 3CKIB 4AYBB 2FE8A 1S5CD 4MN3A 1D5XC 1EIGA 1QCBD 1DYQA 3QOLA 1XEEA 2H1EA 5D65A 4ZLTF 3OSOA 1F9RA 2F0KA 4WURA 3CRKC 3NRZA 3ND8A 4FP5D 1PZKD 3BDLA 1HFNA 2PKOA 2CVRA 4M1UB 3GB1A 4ZAIA 4ZK9B 1DOLA 2K5PA 4KK7A 5KEEA 2GI9A 5M3MB 1BF4A 1K52A 3I3CA 2BA0A 4PMBA 5G3LD 2L1BA 1PRTF 3MHZA 1SSOA 1FEHA 3TUOA 1EOTA 3J81L 3JAML 1EYCA 5EQ0A 2J53A 2JX5A 2SEBD 1HTLD 3A8KE 3Q8FA 5JEAJ 3GTJB 4KN4C 1JWBD 2HCIA 3LWUA 3GV6A 4RKLA 1A70A 2I38A 4IZ8A 1ZEQX 4BA1I 1EL0A 2Y5CA 4US8A 2TMPA 1I4XA 2LMCA 2PO4A 3HOVB 5CV4A 2OHFA 1OQQA 1D1IA 4L23A 1ICWA 4XDCA 1O7ZA 2MHVA 5D3IB 2DY7A 1GHKA 2EYFA 5D7GA 4H44C 1FM0D 1A3VA 1STGA 3MEHA 1X3QA 2MH7A 2M00A 5CV7A 2A69D 4RGTA 1L0YB 3AE6B 3BDOA 4ZKCB 1GUTA 1WTPA 2EYMA 1JORA 1HRJA 4GDKB 1AN8A 1RF2D 1SEBD 2PIAA 2R92B 1GAQB 3K59A 4OO1I 3MJ5A 1BNZA 1JC7A 1QQRA 1HUMA 4L1BA 2V4IB 4S3SA 1I6VC 3HUIA 3AE1B 3T51B 1YQ3B 1OQRA 1MVKA 1C77A 1CHPD 3P42A 1KDAA 1NI3A 2J4XA 1WVLA 4A3GB 2E2JB 5IGGA 5LL6X 1BR9A 1VJKA 1IYVA 2Y3AA 5I9PA 1DM0B 3L4PA 2CW0C 4ITKA 4Q5VA 3B2GA 2WKCA 3AE4B 2WXHA 4KKTA 2RA4A 4ZUJA 3CWIA 1TYGB 3S14B 2JYOA 3KBXA 3GTGB 1E2WA 2HDEA 5FLXL 1Y8OB 3NUHB 5C5MA 4YTPB 3EA6A 2IL8A 3PUXA 1PFNA 2J52A 4R8NA 2V0GA 3NWSA 3NTHA 1ET9A 2K0PA 1C4PA 1FD7D 1F2LA 1WTWA 2ACZB 1HPCA 4ZRPA 1BQQT 2C9OA 2PVOD 4DU9A 1RFKA 2L9HA 1MI2A 1F9PA 3NP8A 3HP3A 5JOBA 1XLPA 2FBWB 1XWEA 4XDXA 1V8CA 4RHRA 1KFYB 5CGKA 1I4QA 1H9SB 1C79A 1SNPA 1PDQA 4OIKA 5I2YA 3G6JB 1YQ4B 2YU9B 4R3DA 2F3WA 2RKSA 1ILPA 2MJEA 2DBYA 2IGDA 1IBXB 1JR0D 4G7OC 2WDQB 3VYRA 5M5XB 1YJJA 1QT9A 1NR4A 2BS3B 2KQ4X 1EY8A 5H8YE 3ITPA 2L1AA 3MXNA 4C1NK 3PMFA 3P20A 1I50B 1W6KA 3PZ7A 4MIUA 3BVGA 1SXTA 3DEOA 1A6XA 1XLQA 1FMAD 4F8MA 3HGBA 5E4XA 1Q8IA 1LTSD 2EYLA 5F2DA 3A8JE 3KK7A 1QOGA 1E6EB 5C4JB 3TP6A 2R61A 2M2LA 1JB3A 2GB1A 1I4RA 3R3OA 2WV6D 4RKBA 4UAIA 2B2UA 2O2LD 5FKAC 1CJEA 3FMCA 3LXFA 4TMAB 4A3KB 1RTNA 2MUYA 4I65A 2HDMA 3PZ8A 1B9NA 4WWMA 1NEKB 2EDGA 2JEBI 2IJ0A 3NTIA 1JRPA 5A2QE 4B0EA 3NBIA 2IGHA 2Z8LA 3BK2A 2K05A 2JZPA 1ET6A 1BUIC 2RQXA 2JP1A 3S2HB 5G5GA 3VQIA 1IW7C 3SK6A 4RNAA 2BBCA 3DHQA 4K6DA 4NJCA 3BWUD 1OO9B 2KEEA 2L4NA 3X3NA 4P2CB 4MHEA 3FKIB 2QKIC 1PGBA 3S1QB 3SR6A 4EGVA 4IUVA 3P1MA 2K01A 5IGEA 4M8AA 1PFMA 3LWEA 4IDIA 1MHXA 4XQJA 2F0JA 2WXLA 3Q8CA 1Q1EA 2ZW0A 5KNDA 3HVZA 5CMDA 1C76A 4YXDB 1K83B 2I46A 4FNFA 2DYMA 2WXIA 5NUCA 2WACA 2ICIA 1K50A 3VR3A 1DOXA 2BS2B 3VR5A 4LLGM 4F7XA 4N9PA 5IGCA 2JEAI 1C8CA 3QO2A 1TIID 5JAVA 1HZ6A 2XNAC 5I4DA 3M7NA 1VLBA 3NK9A 3TP7A 1B1ZA 3HKZB 3PUYA 2RDHA 5H92C 3T3OA 3KWVA 1BCPC 1RTOA 4IQZA 3W1SA 2YEPF 4KJOA 2WP9B 4WFN3 2DNCA 4KV6A 1TY0A 1W6JA 5IGFA 1Y56A 4A8XC 4K14A 5C3WA 1LABA 1EY0A 5LHY1 1KH0A 2CU3A 5HG2A 4IUQA 4A93B 1SJHD 3W3AA 4B9XA 1UWXA 1NR2A 3OHXC 1JOOA 5DAUA 4X3UA 1MD2D 3J7YW 1F0ZA 1J8IA 3BIID 2DWQA 2AWNA 3MAQA 4LAAA 3SR1A 4KX6B 2FFKB 3N6RA 1K51A 1BCPB 4OO1G 1YNTE 5C0XG 3T4AC 1ZXHA 3U9OA 1CFMA 1FNUA 3Q6SA 2A73B 1TT2A 2B2WC 3VYTA 1B9MA 5IT9E 4OVZA 5JEAG 3LYYA 3R8BA 3WDNA 4JWUC 4C3JG 3SEBA 1IUEA 1JE4A 4ID6A 1G291 5CORA 2JSVX 2C5CA 4A9AA 3TEZA 1H9JA 1CQFA 1CI3M 4G57A 4F87A 1WTOA 4X3TA 1SYBA 2KMMA 1LT6D 3R2TA 3DXJC 2N9KA 1XF5L 2M0AA 1BO0A 4YSXB 1HXYD 2XIWA 3NBHA 4TSSA 3MXUA 5C3JB 1HTPA 2E75C 1K8OA 5EKLA 2MJ8A 3A56A 5IT9L 3EROA 1D1KA 1AYFA 5EE1A 2LEKA 4A90A 1G8ZD 1U4RA 3K5NA 3OWEB 3FC4A 1WRIA 1O7LA 3SFEB 2HQEA 5I2XA 3GTQB 1SE2A 3PO0A 1MI0A 5EKKA 2A6ED 2G9DA 4ARIA 4LK1C 2CJOA 4J6HA 1CT1D 3NVYA 1VRAB 5EPKA 2EXZA 3TDQA 3M4OB 3HOWB 1FRDA 2EYHA 5D14A 1L6UA 2LFNA 1FXAA 2NMQA 2F0NA 1PRTC 4O42A 1EIHA 5FO9B 5LL6S 1OXXK 4DGZA 4B0MA 5KIXA 3ZYYX 3SVMA 1L0VB 3HS0C 2K03A 1F2RC 3GTLB 2B2WA 1EWCA 2E2IB 1UWMA 1D5MC 1QKZA 1QOAA 1TWHB 3BYTB 5K36G 1V1PA 2AWOA 2BDOA 2E2DC 2NTSA 4QMGA 1XCQL 1RDPD 3OIPA 1EQVA 2I07B 3I8ZA 3GS2A 1WD1A 3FRPB 1DOIA 3KWLA 2CW0D 1HQMC 3C2PA 1EY4A 1ZDVA 4LMQD 5BMHA 1U4MA 1E9MA 2QSDA 2B2YA 4DA2A 2X6GA 4ZHPA 2KVMA 3ETRA 2X69A 1TVXA 4L2YA 1S5DD 1LO5D 4DAVA 4L6TB 2MGSA 2K1BA 4V190 3PV0A 1T5XD 3E56A 5I6YA 2V3NA 3V2TA 1SMYC 2L11A 3C8YA 3D6CA 2F0SA 4A3IB 5C2TB 4XWTA 2WXGA 1WXQA 4OZBA 1SSNA 1ZYRD 3TZDA 4KKSA 3J7AF 2EY1A 1SAPA 1RYJA 2NVXB 4CKBA 5HGTA 1IHZA 3NVZA 1LT5D 1WTVA 4KI0A 2RVLA 2G9HD 3P63A 1KNEA 1IGCA 5C44B 1GHJA 2WU2B 4C1NI 1TU2B 1M8AA 5LNK1 1BCPF 1OXSC 3EJIA 3WCQA 3HEJA 1MPEA 3ABVB 3NXWA 3TZUA 3N52A 4JBWA 2A5HA 1C4CA 2XVSA 5J1ZA 1XX8A 4GZYC 4KN7C 3QJYA 2QIEB 5E4WC 5HFYA 1AZPA 3LB8C 3IAYA 3AMUA 3MTSA 2F0TA 3GD7A 2Y5PA 5FK9C 5HURA 2PZUA 3P4QB 1YN5A 1CTMA 4X3KA 2R3ZA 4OW0A 3B2FA 2K9XA 1YNJD 3S1MB 2A6EC 2HDLA 3NVVA 1TS4A 1B9RA 1N5XA 3U9SA 2LFIA 1TKEA 1RKNA 4TKOB 1AWDA 2NB0A 1LTID 1B44D 2IT1A 3U52E 1CM9A 5JVH3 3TEWA 4K5WA 2PZTA 1YJIA 3KBGA 2VZKB 1SFOB 4FF3A 4WQMA 4XQQA 4TQ1A 2Z4IA 1N62A 3IT6B 4AS1A 3A55A 1STAA 2WAQB 2RSNA 3ZGZA 4K8JA 1G6ZA 5T1IA 4RF0A 3MXPA 4DAYA 2VB2X 4US9A 2B8FA 3TEYA 2WXMA 4KKUA 1JWAD 2N0SB 1STYA 4OGQC 1NYRA 5ELCA 2PTLA 1KRHA 2H89B 4DK1A 4ABNA 5E6JA 1T6BX 1TKWB 5KGUA 2K5DA 4KMUC 2IW3A 2EJMA 4PMCA 4HSVA 1TJEA 1STEA 1LV9A 1ESRA 1LACA 4RGOS 4IFDI 1QF6A 3OW7A 3OPOA 4XYQA 5K5PA 1PZID 4PV1C 1V97A 3BDCA 1CA5A 3DMUA 3WOEA 5AUIA 5BMIA 1EEID 1QB5D 1XLNA 2K5WA 1I6HB 2K7VA 3U2SC 3NSWA 1I7HA 4CKCA 3AEBB 4ZRQA 4C80A 1VMCA 2E2HB 1SF0A 1JWUD 1PZJD 2JA8B 4H13C 4FO2A 1GJXA 4KGSA 2I2YA 3BZDB 2ZXRA 3VR8B 1C4QA 4QIWB 1WD0A 3UI2A 3DEPA 2BS4B 2X38A 2F0OA 2Q8TA 3SK4A 2PW5A 1S4ZA 3W2DA 4C3IB 4A3JB 1YMHE 1Q12A 2B2TA 1QE6A 2IPKD 3W9CB 2XWBB 1FXIA 4F88A 3QWNA 1ENFA 5C3EB 2F0WA 2NUCA 3CU7A 5DEHA 3HG9A 4CJ1B 1XYIA 1QG7A 3JAME 4Q2JA 4HKQA 3RZOB 4TQ0A 3ZJVA 1IGDA 1O80A 1WTRA 2BYTA 3K5MA 5D3DA 3AEGB 2A6HD 1IW7D 1VMPA 2RSOA 1JMLA 4GDLB 4OZAA 1EM7A 3UI3A 2PQEA 5C4HA 2E3TA 4HN7A 2JYTA 4FXDA 4RCNA 1XXGA 3GTPB 3SK5A 1JOQA 5EBDA 2AQ2B 4PQXA 4U68A 1KLUD 1IL8A 2A68D 1JQ4A 1QNUA 1U4PA 4HEA1 3MA2B 4CJ0B 1V1PB 2NN6G 2NVQB 1RODA 3H3VC 3J7AV 4C3HB 5ISRA 1HZ5A 2NVTB 3PO3B 5C6AA 1J7CA 2RPVA 5M5YB 2PCFB 1PTOB 4DQOC 1VDVA 1YNND 2NYZD 1NAPA 3Q8AA 4FVMA 5JVG3 1J7BA 4QCLA 4IUTA 2EE1A 2WU5B 1ENAA 3Q24A 3OMCA 3AECB 4ME5A 3MHBA 1N61A 1SB3C 4HROA 1SYCA 1AP0A 1UEAB 1EFID 1PTOC 1TS3A 3HRDD 2W54A 1TKYA 2NBFA 4CHTB 2LHEA 1F2YA 2JXMB 2XSCA 3AE9B 2DN8A 4FYDA 3VR2A 2VUMB 2KDMA 3W5VB 2EELA 4MM3B 1QOBA 3PIP3 3OIQA 1ML0D 1CZGA 2PZWA 3I4MB 2WQYB 4XYOA 3NQIA 2CJNA 5KRUA 4OIJA 2WXKA 3VYSA 5COYA 2M19A 3VR9B 1UGJA 2PW7A 5IODA 5ELDA 2NTTA 4PNYA 1NENB 3GO5A 1Q10A 3AEEB 4RF1A 4KKJA 5E1FA 2VB3X 2WS3B 1YN4A 2IGGA 1RM6C 2LMCB 4ZUIA 2F0DA 1KLGD 2DY8A 3VYUA 3QIAA 2F0FA 4U673 2PVGC 3A7AB 5JEAH 3NPPA 3H91A 1SNQA 1B3AA 4DF7A 1A3TA 1BXTA 3VRAB 5BYSA 2LKVA 4BBRB 2JA5B 3K7AB 3L9AX 2R7ZB 4KY7A 4IKGA 1F9QA 4RA8A 1EZ8A 3NTKA 1IYUA 2B2UC 3TBIB 4C3IG 2A6HC 3AE8B 3OWFA 4ODGA 1ZKOA 1TS5A 2KUMA 5FO7B 1QOFA 4RGNA 1EQTA 1FNWA 1DZ1A 1JROA 3V3XA 1V1OA 2QMTA 2F3VA 2ON8A 2G1EA 2XRSD 2EYJA 2KHSA 5A35A 1CZWA 1SYDA 2F4IA 4KTAA 5AUKA 4H7BA 1LTGD 3AEDB 2ZT9C 5JPMC 3AEAB 1U9RA 3V05A 2E6XA 2ZW1A 1EY7A 3CQZB 4RWSC 1D2BA 2WXFA 3Q23A 2TSSA 5KNCA 4OHJA 4L8JA 2JA6B 5BYQA 1TR5A 3BG3A 5GXGB 3R2IA 3K5OA 3TEXA 3CIRB 4WAFA 3OMGA 1FFUA 1E10A 3DWMA 4FF2A 2QEJC 2SAKA 3J9CA 1CHQD 2EYOA 4NZLB 2SNSA 1QJOA 3H6MA 2IX1A 2J42A 5T1GA 1HCZA 2RDGA 2M56B 4BBSB 3KLRA 2BE5C 1LLRD 4IOIE 2MJDA 4IUUA 1N5WA 1VZ7A 2EJFC 1VDZA 3J80E 5EE3A 4EQOA 5JPNC 3C3LA 1G91A 1EU3A 5CV9A 1NVID 3MP9A 1EY5A 1JOKA 3PO2B 4HRSA 5J22A 4IUPA 1TZOA 4QUFA 3DWAA 3DM1A 3T13A 3D8GA 1ZPSA 5JJZA 4KGRA 2O5JC 3S1RB 4OL7A 1JW9D 2F0HA 3BVMA 1P7EA 4JK1C 2F0GA 4BWGB 2JU6X 1K53A 2BOSA 4P6VF 4J8QA 1H9SA 1RJTA 1VZ8A 2MEKA 1VF7A 2QCPX 1CQVA 1I3QB 4G7ZC 1WTXA 1DD2A 1AEXA 1E2ZA 4OZCA 1GUWA 1DOYA 1IKLA 2W3SA 1IBXA 5EGTA 4O1NA 5DM73 1NCVA 3K6OA 3MXGA 5IOCA 1S5BD 4DK0A 4RGMA 1QILA 4A3DB 3NZ3A 1VZ6A 1GOZA 2Q8IB 4CKEA 3FILA 3W5UB 1LT3D 4PT5A 3HRZC 1XTCD 5DNFA 1F77A 1SYEA 3IAM1 3IAS1 3PUVA 1QLBB 5C4ZA 1PTOH 2OT2A 2BA1A 3FILB 1DGJA 2L32A 2AQ1B 1FFVA 5EKIA 5IGBA 2A74C 4A6QA 5IGDA 1Y1VB 3EVQA 1DJRD 4KD4A 2K6AA 2WDRB 3P75A 4RCOA 4CBVA 2EZVA 1LTTD 1T5EA 3KQ4A 2K22A 1EYAA 1ROEA 4OO1H 2EPBA 2F0VA 2BW2A 1RCVD 4FXCA 2OF1A 3VRBB 2AQ3B 1XO3A 1JWSD 3I70A 3QG1A 2K5QA 4EVOA 1STNA 1NSNS 4IFDG 4X3SA 1PDXA 2LUMA 2K32A 1KDCA 2O4XA 3P4RB 1KABA 2NN6I 4J1MA 1SE3A 1RD9D 3KF8A 3T3NA 1YNJC 3AU7A 2X6LA 4RH6A 1PGAA 4LJZC 5M3FB 1VR9A 4ZKBB 2OEDA 2OXPA 3VR4A 5BYRA 4TRDA 2PLPA 1SIJA 3IFDA 4QUCA 1Z47A 3FDTA 1GUSA 1B4OA 3MFYA 4KD3A 2F1MA 4YTNB 4ZQ3A 1A15A 5FOBB 1JWMD 4N9TA 3C1FA 3F2UA 4HSPA 3IKJA 3AE7B 4HMIA 3D31A 4NP5A 5E3FA 1N63A 4KY6A 1FO4A 4B08A 1BUVT 5EPLA 2D2CC 2W55A 4H0LC 5C4XB 2RBMA 1NUCA 2K33A 3S1NB 4KKIA 4KGTA 4GLSC 3GQBA 2ONQA 1S5FD 1B50A 4Z9CB 3FAHA 4QF4A 4A3EB 1GB4A 1R4PB 2LJIA 4V0BA 4YT0B 3A54A 1CZPA 2F0MA 3EGRA 2KA7A 2AX5A 1DOKA 3H09A 4K5XA 3TP8A 2XWJB 2WXNA 1SNDA 1QNKA 5EJWA 3MFGA 1DONA 2BB6A 1JQYD 4ARCA 5CYUA 3P1HA 3I4NB 2K3UA 1MBYA 4WH4A 2NWGA 2L0CA 5TSSA 1ILQA 1Y8NB 4XWWA 3Q0AA 1SNOA 3RZDB 2ENBA 3AN1A 5FLXE 1MHHE 4XDDA 5CR3A 3PUWA 4K2LA 1F2ZA 5BN3A 1ONLA 4XE0A 1FYCA 2VZKD 1EY6A 3RMHA 1H9MA 2V4DA 3NHHA 1RWSA 3DWQA 1G2SA 1TWFB 3HOXB 2WDVB 2OEOA 1B53A 3AMZA 1YN3A 2WKDA 4XXEA 4C3HG 1EYDA 3MWYW 1X3PA 3HOUB 3Q8EA 3SDZA 1U4LA 4UDUC 5BN5A 1ZDXA 1T3QA 2W82A 4R8IA 2PNRC 4HR7B 1QOHA 2KCCA 1JCKB 2KACA 4HCEA 3D6WA 3AEFB 2FMCA 1MSHA 3D3RA 1S5ED 2J7ZA 5KYIA 4KY5A 4NAWB 3D4WA 5T8IA 2H88B 2EKIA 4JX1C 1PFDA 4YIJA 4RHSA 2F0IA 3AM9A 3NQTA 3G7LA 3P4SB 1LTRD 3DWGC 1AW7A 4A3FB 3SHLA 2WXPA 1OXVA 3E5SA 1E0ZA 4MH8A 4DAPA 1HHVA 3AE3B 3V96A 4EQPA 5M9OA 2LGIA 2V3PA 1WCMB 4XT3B 2AUJD 1E7PB 2N9LA 1ZYRC 5M5WB 3TP5A 1PTOF 1PYWD 1SYFA 2A68C 3S15B 3R93A 2PMZB 3PIO3 3BYYB 1A2TA 1RHPA 2GA4B 3NVWA 4JE3B 3AV8A 3HVDA 2WIIB 4IUNA 5CV6A 4A3MB 1DCZA 5JXVA 1L0XB 3EFXD 1Q90A 3U4EG 2NVYB 1SJED 3RPFC 3S9WA 2BB5A 3MZ5A 2K04A 3U7ZA 1J9OA 3NWTA 4ZYSA 1KDBA 2Q8RE 2B39A 4MACA 4LTUA 4RAUC 2LS01 1TY2A 3KLSX 1EZ6A 1DOMA 3TN2A 1FCLA 1GUGA 2JSOA 2EY2A 3VR6A 1BMLC 1H9RA 4HTHA 4NW2A 2Z1CA 2FMMA 1II3A 2JWUA 3IT4B 3SE0A 1PMRA 2LHDA 3AB9A 2PYKA 2NN6H 2WLBA 2E74C 5HI1A 4NDXA 3LNNA 4CJ2C 1JALA 2KN4A 4XT1B 1GPXA 3GTKB 3HOZB 3CHBD 3GP7A 3ND9A 2SDFA 4C3JB 4FF4A 1L5PA 1GUNA 2Q5WD 2QJLA 5J39A 3I4LA 3K0YA 4FXKC 2BT6A 3CRLC 5K36H 3Q8BA 3I9V1 2INNE 3PUZA 5G5HA 1STBA 1CA6A 1I4GA 1H9KA 3RFZB 3NUCA 5CC4A 4C56C 4H2AA 3VA5A 3H94A 1E2VA 1ESFA 4YSYB 3C46A 3SXHA 5BMGA 4E6IA 4N6EB 1PFBA 4C7YA 1ZXIA 2BDNA 1O78A 2FHTA 3GTOB 1UAPA 1BBXC 5EE9A 4DFAA 3MVVA 3B9JA 3M7GA 3BS1A 2PW9A 2F0QA 2KQ3A 2F0PA 4IURA 4HCSA 2N55A 3ZQ4A 2FJ2A 2L12A 4XQNA 5EPJA 1KF6B 2XN9C 1NYQA 4WIPA 4P16A 2F0UA 1WYGA 1VCIA 2L55A 3M85A 3S17B 1BCPD 3C1EA 2KCNA 2F0EA 1B2TA 1LT4D 4N59A 1JICA 2WP8J 2Z4HA 5KYLA 2FINB 2DYOA 2VNUD 4NKLA 3D4DA 3P7JA 3T53B 4HJGE 2PMVA 1L6VA 5I9OA 2AUKA 1MGSA 5ELFA 4HAEA 5I6WA 1X32A 2HTME 2EY6A 4WJWA 2ICEC 2INPE 4REZA 4K8IA 5C0XI 2QF7A 2EVBA 3ERQA 2D5DA 2RDFA 2LY7A 4G4KA 3T16A 4BS9A 1C4AA 3RD4A 3E6ZX 4XTCS 1HA5A 5ELBA 1HQRD 5CV5A 1UNSA 2WXRA 4PMWA 4NAMA 2KECA 1STHA 1UUPA 4ILWA 1XCTL 1SBBB 3J81E 4YTMB 2J0TD 2Y0SB 1LTBD 4ZHOA 3M4YA 3EUB2 2M9VA 2D62A 2WXJA 1SNCA 4JPSA 5CBEE 2JYEA 2DLBA 3ZJTA 4Q0FA 1ENCA 5AFWA 1F2RI 2VXWA 2KOLA 3ZJUA 2ID0A 1FGBD 4A55A 3Q22A 1PXUA 1WTQA 1Y1WB 5A2QL 3FVQA 3RLFA 3MC0B 3H8HA 2XRQD 1CK1A 1SNMA 1AZQA 3N9YC 3IL8A 4CGYB 2WXQA 2K28A 1ZP0B 1EU4A 2F0L