1KLGD

Crystal structure of hla-dr1/tpi(23-37, thr28-->ile mutant) complexed with staphylococcal enterotoxin c3 variant 3b2 (sec3-3b2)
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
239
structure length
231
Chain Sequence
ESQPDPMPDDLHKSSEFTGTMGNMKYLYDDHYVSATKVKSVDSFFKWDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKGKTCMYGGITKHEGNHFDNGNLQNVLVRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Minor structural changes in a mutated human melanoma antigen correspond to dramatically enhanced stimulation of a CD4+ tumor-infiltrating lymphocyte line.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/toxin
molecule keywords HLA CLASS II HISTOCOMPATIBILITY ANTIGEN, DR ALPHA CHAIN
total genus 67
structure length 231
sequence length 239
ec nomenclature
pdb deposition date 2001-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
D PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1klgD01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1klgD02
1UUPA 1RD9D 1PTOH 1LTTD 1PZKD 1KLUD 4UDUC 3MC0B 1BXTA 5D3DA 2CHBD 1LO5D 1FNVA 4TSSA 1B44D 1FD7D 1F77A 1JCKB 1CHPD 1BCPB 3KLSX 1TS2A 1YN5A 1TY2A 1DYQA 4RFBA 1LTSD 1CQVA 1UNSA 1DJRD 4OHJA 1I4RA 1MD2D 1EWCA 1TS4A 1SEBD 3W2DA 1TS3A 1TY0A 1S5DD 2G9HD 1AN8A 4O1NA 4RHSA 4RGNA 3URYA 4C56C 3EFXD 2ICIA 3MFGA 4DXFA 3BVGA 1YN3A 1V1OA 5ELEA 1KLGD 1ET9A 3BYYB 1I4GA 2TSSA 4RGTA 2XRSD 5FKAC 4RGOS 5ELFA 1JR0D 1L0YB 2QILA 5I4DA 1LTID 1LTRD 1B1ZA 3OWEB 1TS5A 1FNWA 1HQRD 2XN9C 3DWAA 1EEID 1FGBD 1I4PA 1D6EC 1RF2D 1XTCD 5TSSA 1BCPD 1D5XC 2IJ0A 1I4HA 1SXTA 4BWGB 4L63B 4DXGA 1PYWD 3R8BA 1SJED 1RDPD 3GP7A 1PZID 1LTGD 1RCVD 2NTTA 1AW7A 1HA5A 2RDGA 1T5XD 3BZDB 1ESFA 3DWQA 1HTLD 1HXYD 5FK9C 1CHQD 3R2IA 4RH6A 2XRQD 1EU4A 2SEBD 1PRTB 1PTOB 1JQYD 1QILA 1LT4D 2O2LD 4RGMA 4NZLB 3BVZA 3SEBA 4RCOA 4L6TB 2XNAC 1GOZA 1JWUD 1S5ED 3DWPA 1I4XA 1JWMD 1SE3A 2J4XA 1EEFD 1SBBB 1XXGA 1LLRD 1ET6A 1ENFA 2NTSA 1LT6D 1S5BD 4K6LA 2WV6D 1PRTC 1PTOC 1S5FD 1EFID 1EU3A 3R2TA 1FNUA 5ELCA 1S5CD 1SE4A 4Z9CB 1PRTD 1PTOD 1D5MC 1BCPF 1I4QA 1KTKA 5D3IB 3BVMA 1V1PA 2AQ2B 3TSSA 1LT3D 1G8ZD 2R61A 5ELBA 1JWSD 1LT5D 3EA6A 2AQ3B 2Z8LA 1SE2A 1LTAD 1LTBD 4ZYSA 3CHBD 1CT1D 5ELDA 1PRTF 1PTOF 3O13A 1M4VA 1PZJD 1STEA 4RHRA 1BCPC 1L0XB 1V1PB 3V05A 1D5ZC 2QEJC 1YN4A 2RDHA 2AQ1B 1CK1A 1SJHD 2IPKD 3BYTB
chains in the Genus database with same CATH superfamily
1GUTA 3V62A 1U4RA 2KJXA 2EYLA 2L8JA 3FAHA 1KLUD 3MXNA 2WNMA 2JA6H 2B8FA 1E24A 2DLBA 4KX6B 2NVTB 1F0ZA 3VR9B 1LO5D 2ZT9C 4TSSA 2ES2A 1B44D 4X6AH 2B2VC 1JWBD 1UGMA 2BWES 3LX0A 4IFDI 2UXDQ 3TEZA 1CHPD 2KWDA 2LVOA 1SR3A 4DAMA 1YN5A 4JE3B 2GOWA 1K8AC 5CV4A 2F0QA 2EY2A 1DJRD 2Z6KC 5JJLA 1Z5SB 4MH0E 4P1CC 2K04A 2K8HA 5GXGB 1VZ8A 4ARCA 1ONLA 1F2LA 2EELA 3L13A 2INPE 2WDRB 1VQPA 3WANA 3BVGA 3FRPB 2M56B 1MJCA 4ZOHC 2KD0A 2HQLA 3QWNA 1MFWA 1KM7A 2Q8RE 2TSSA 2ZCBA 2DYBA 4XZ4A 4R4CA 2LUEA 1C3TA 1TBEA 2QKIC 4LF4Q 4H2AA 3ZQ4A 1EY7A 2N9EB 5IP9G 3JW0X 1HQRD 4PG3A 1IBML 3Q8BA 4GDKA 4LNFA 4EZJA 4CHKA 5GQOA 4DR4L 1FGBD 4A3MB 3MEFA 1BOSA 5DEHA 3TS2A 1V6EA 1VS0A 1GB4A 3L2PA 1VMPA 1PGAA 3ZRCA 2GLSA 3J7AF 2WKCA 4L63B 4K5XA 3U8ZA 3R8BA 4K3BA 1IBMQ 3AECB 2K1BA 5BN4A 4MZ9A 1Q82C 3AE1B 3TRZA 4XXEA 1ESFA 1L6VA 1WYDA 2JXXA 2KJ6A 2E74C 4IUQA 1SGHA 1OTCA 4YTPB 4DAPA 1KXLA 3U52E 1CSPA 3FDTA 2J0JA 1E10A 3FC4A 1K9MC 4GLSC 5LLIA 3RD4A 3CAMA 1TKGA 3QJZA 3OLMD 1O7IA 2DNFA 2A6HD 1A2TA 4HR7B 4NY0A 2BYVE 4BBNF 4PZ7A 1HTOA 4R4QA 3TCAA 2BA1A 5AUKA 4E74A 1XMOL 2JF5A 2I0QA 3Q8DA 5KEEA 3TQYA 3VYTA 1TTNA 1GAQB 1EU3A 5IGDA 2HDEA 3EC8A 4C7ZA 3RCZA 1YJWA 4HPMB 4LAAA 1IL2A 2CKHB 1J5EL 3WAOA 2HIVA 3PGZA 2KN4A 2ZM6L 4DV6Q 2EIFA 1X32A 4KKTA 3AEAB 2R93H 2GA4B 2Z8LA 4KTAA 5LMNQ 4ZRZA 1BNZA 4B0EA 4A3MH 3RI7C 1CT1D 4A3EH 3OIPA 1J5EQ 3U9SA 2F52A 2JN4A 4KD4A 4K7SA 1HR0W 3S2DB 1PZJD 3B6YA 5C2TB 1K8OA 4WJPA 1X55A 2QEJC 1OXUA 1Q7YC 2D3CA 3AEFB 3PIOA 2VS1A 4ZLTF 4II3B 4K8JA 5I6YA 1SIFA 1BQQT 1YITA 3NZUA 1L4DB 4DV7L 2D3GA 2PPHA 2BYTA 1RD9D 5IGCA 1D7QA 3M85A 2V4IB 3I72A 3KF8A 2A74C 1SYFA 4USAA 1YJ1A 4GOCA 1NNXA 4ULLA 1SMYC 4XQQA 2V3NA 4JC0A 5EE1A 1HE8A 1R4NI 4JOIA 3NS8A 1TS2A 1EIFA 3IHPC 1TY2A 4X62Q 4GKKQ 3PUWA 2L3ZA 5M5XH 3I5JC 4HMJA 4OELB 4OHJA 4LFCL 1CZPA 1SF0A 2I07B 3P7JA 4E71A 1AZPA 4BZAA 2QIEB 4U673 4A3IB 3I2ZA 1VQBA 1KIXA 2DY7A 1EF5A 2A4ZA 2N78A 1LACA 3CMAA 4B3TL 4BAXA 1EIHA 1UE6A 4BY1B 3GS2A 3BYYB 1I4GA 3AE9B 3TL5A 5JHAA 4IPHA 1MBYA 2IGGA 3H6MA 2LHDA 1MSGA 2JE6I 3HOWH 4JYAL 3HOVG 4DKAC 4B3RL 3NTKA 5JHBA 2NVQB 1TQOA 4MTNA 3TEXA 4IDIA 4JV5L 5J17A 5FLXL 2MJ8A 3UE0A 3H3VH 2UXBQ 2KVMA 3AEEB 4BFRA 3HP3A 2MP2A 4DV4L 1TYGB 4LFBL 4EX5A 1QVGA 2CHXA 4EQOA 1AH9A 4TMAB 3A4SC 2NTTA 4A76A 3A33B 4W9KA 1C79A 2KFKA 5E6JA 2WHIA 1IYJB 1YMHE 2YYZA 3PIPA 4NJ6A 1WJJA 2UWQA 3TDQA 3CQZB 5KNBA 1EWYC 3LYYA 5FK9C 4I7AA 1GC6A 3TP7A 3GTOB 4RF0A 2KEDA 1F9JA 1BT0A 2RHSB 4BY1G 4RGMA 1EUJA 3Q0AA 2L0TA 1A8VA 4DV0L 4ITKA 1RL2A 1CKNA 3WWVA 2CJNA 5BYSA 1A62A 1K83H 3RNUA 4LLGM 1S5ED 4DV2L 1NUCA 3MXNB 1NE3A 1B8AA 1WCMB 3S2AA 2N7DA 4RM9A 1K53A 4FA6A 2R92G 1WI5A 1XPOA 2Z6BA 1QF6A 1QOBA 1F1HA 4R1JA 5EQ0A 1WMHB 1EY8A 4K0KQ 3T8MA 3R2TA 1V9PA 3S15B 2JWZA 2MUYA 4ZRQA 3AXCA 3TEYA 2KXJA 3QQ8B 4KN4C 3VUWA 5C3WA 2HQEA 4TRDA 5IYDH 1WX9A 4FYDA 3PSEB 1JWSD 2AHOB 3STBC 2AL6A 5H92C 2VUMG 1WXSA 5C0XH 1KD1C 1PH9A 1IYFA 5A35A 2WXGA 3AE3B 5M5XB 5CV6A 3FKIH 1QVCA 4F1SA 3KFUA 1UF0A 1HFNA 1FXTB 1TJEA 4WAFA 4LF5L 4K1RB 4AJWA 1YHQA 4IPDA 5KRUA 5CHFA 3DHGC 1XO3A 4DQOC 2WINB 2F0IA 4BBNC 1E1TA 2IPKD 5EPLA 2R3ZA 4P73A 3Q3OC 2XVSA 1F9PA 3I9V1 3GQBA 2KK8A 2NPTB 4FHJA 1WFYA 2CKZB 1JT8A 4ZK9B 3M63B 4B95A 4JI0L 1QZGA 4EEWA 2B3GA 3A1QA 2OEOA 2K5VA 5GROA 2XBBC 1OXXK 4A4IA 1KRTA 4C3HH 1I50B 2PW9A 1JJ2A 2BS2B 2JZPA 2FIDA 2F0HA 3C0RB 2BDNA 1QE6A 1JJGA 1QUQB 1I7HA 1N5XA 3AB9A 5GAEC 2KCMA 3S1QB 4LTUA 1CA5A 1ZYRC 4DGZA 3B08A 3P4SB 1EYCA 1K8RB 2PE9A 1XLPA 2K05A 3NOBA 3WAMA 3HOYB 1UE5A 4C3IH 4HMIA 3DXJC 5IT9E 4GN4B 1TKEA 2L5TA 1TR5A 2KQSA 1TWHB 1MPEA 1Y8RC 1LTID 3S1RH 1OFFA 3DVGX 3PRMB 4L2YA 4P6VF 1UEBA 3OWEB 1FGUA 1TS5A 4C3JH 2MJ3A 3DWAA 1D3ZA 4B9XA 2YU9H 2FE8A 2MP2B 1VQ9A 2Y0SB 2UUAQ 2A6EC 3AFQA 5DNFA 1ASZA 5TR5A 1GUGA 3KBXA 2W55A 3HKSA 4NPSA 3K0YA 1VQEA 3A4RA 1SRUA 4K3CA 5FJ8H 5C4ZA 2R93G 5C4JH 5IWAQ 3VH4B 3PO3H 4GOPC 3MC8A 1VCBA 3WALA 1Q8KA 4DK1A 4AJYB 2B39A 1PH7A 4W9HA 1YQBA 4ZRIA 1FVIA 1MGSA 3ONAB 4JI2Q 3BK2A 1C78A 3I4LA 3GTGH 4MM3A 4MJSA 3EHVA 3K6OA 3NWSA 4LK1C 3T13A 3OHXC 2YTXA 2M2LA 4N8FA 1YJ9A 4OO1H 3QOLA 4A93H 2KWCA 3PV0A 3C2PA 4OZBA 2ASBA 3RYTA 2A73B 4C3IB 3ZNID 4DK0A 2HCCA 4JL9A 4S0RA 2PI2A 3GDEA 1UWVA 1XCTL 4A55A 2C5CA 3W1BA 3GTOH 1EEFD 1F2RI 1NENB 1LLRD 1VQDA 5IIFA 3UINB 2L0FA 3KF6B 1Q1OA 3UQBA 2CQAA 3ER0A 1JC7A 1P3QU 2N9KA 4URKA 2WXPA 2LXCA 2XGTA 1Y69U 1TWAB 3NK9A 3OW7A 2VRRB 2E2DC 2B76B 1ILPA 4W9DA 1F2MA 2R61A 4QY7A 3KVFB 3FILA 4AQYQ 1VF7A 1XLNA 5C44G 1WGKA 4QB4A 1N5WA 2UU9Q 4XGAB 4E3CA 1XCQL 1U4LA 1XX8A 3P63A 3T3OA 5IT9c 4FNFA 5G3LD 4B3TQ 5L95C 2CW0D 1XNRL 1V9JA 3SK4A 3S9WA 4DV6L 1BCPC 2B63G 4A3FG 2HTHA 4K0KL 3V05A 4ZYNA 2JYTA 2M1MA 1EY6A 3GO5A 2RHQB 2KMMA 4K2LA 1EOTA 3ZJUA 3EFCA 4FF4A 2RPVA 2MGSA 3PCOB 2NCNA 1R9TB 3GTKB 2FCNA 5BMGA 2XTIA 3BDOA 2FUG1 1EM7A 1WZ0A 5DPTA 4DV2Q 4RNAA 4AYBB 3HM3A 1BXTA 2X69A 1JOQA 3W5UB 4DU9A 1XMQQ 3CC4A 2CCZA 1FRDA 2CHWA 2JU6X 1KH0A 4DV0Q 1QKZA 2BOSA 2K7VA 2M9VA 1T0QC 3AULA 4MN3A 1Y56A 1X3FA 1LTSD 4XDXA 1PUTA 3JAML 1MD2D 3ZNHB 1AEXA 2LWPA 3UQAA 3W1SC 2IDYA 4RAUC 1TS3A 1IXRA 3H0GB 3T1YQ 4A3LG 2ZNVB 2WAQB 2F0MA 4KSLC 1GO3E 3MFGA 4DDID 1WYGA 3L08A 1F2YA 1YOVB 4YSYB 4POFA 1L1OA 4POGA 3U30A 1I6HB 3RULA 3UDFA 3M3YH 1EYDA 1FCCC 3DWMA 4NJ7A 1EZ8A 3GTMH 1DOKA 2L4NA 4AP4C 1J7CA 1EYGA 2F0SA 3ZYYX 1S72A 2VH1A 1U0LA 2N49A 1EEID 2DHZA 4JI7Q 2KX3A 3C19A 3DWGC 3EGRA 3H8HA 4C7YA 5TSSA 1Y1WG 4PYUA 1LABA 3A7AB 5E4WC 1M90C 2WX0A 4BY7B 3N20C 3TIXA 3SDLC 3T1HL 2C9OA 3AEGB 1YQ4B 2Q2UA 4B08A 1IBLQ 4LJPB 4LWCA 1CQFA 3G6JB 1C77A 2DJFC 1JRPA 2GBKA 2QSDA 2O6VB 3L10B 3GD7A 2I38A 5C4XH 4WWNA 3NBHB 3H94A 3IFWB 4PQXA 3A9JA 4FULA 1J0GA 4K2KA 5M3MH 3HOZG 5COYA 1PRTB 1Z9FA 3GTLB 2QMTA 3LB8C 3N9YC 4XYQA 3J7AV 2LFNA 5AUIA 1ILQA 3D6CA 4RCOA 3K0XA 2N1WA 5D65A 3KF6A 2IYDB 3DBRB 3LDZE 1L1OB 1Q46A 5LMUL 2HJ8A 1FFVA 1VQFA 3TZDA 1AYFA 1E9MA 4EQNA 4KHZA 4F88A 2PW5A 2JQRB 4K8IA 2VQEQ 4OWWB 4K6LA 3QWZB 1S5FD 5IYBH 2IX0A 1E7PB 3CF5A 4Z9CB 4PMBA 1N62A 4FF3A 1H9KA 1I4QA 3CCRA 1CJEA 1QNKA 2ZTCA 1PFDA 4LUOA 1VQ4A 1QQRA 2NN6I 3TSSA 1LUZA 3AE5B 3I4NG 3LWUA 2EKEC 5CGKA 4B0MA 1S3OA 4OZCA 4J15A 4ZYSA 1V49A 1RHPA 4HSVA 3LNNA 2OT2A 2NN6H 2L55A 3NWTA 4CO7A 3PO0A 2I2YA 1E8ZA 3RT3B 4TKNA 1BUIC 1L5PA 1M1KC 3T4AC 5JZEB 2FCSA 1WTPA 1G2TA 3DVGY 1GUNA 4GMVA 1KNAA 2V1CC 2R93B 3O65B 4PYZA 1PH4A 4BOSC 4PS3A 4C00A 2KFJA 1PTOH 4PT5A 1XMQL 5M9OA 3ZRFA 1Y1WB 1YNTE 3IL8A 2CHBD 3E0EA 4J6HA 2EY6A 3ICEA 3V2TA 3FKYA 1X9NA 4RCNA 4CDCC 3F1ZA 4DAYA 3D3RA 5CTRC 2WB1E 4JBJA 2X6LA 1TWFB 2G4SA 4IN3A 4W9GA 3U50C 4W9FA 1EOVA 3TZUA 4J3OD 1GJZA 2K22A 3KH0A 5FO8B 1IKMA 3R66C 4B6WA 4LF6Q 3PSIA 1P7EA 3EFXD 2EYJA 2O6VD 2JT4B 1Q10A 2KHWB 1FCLA 2EDGA 3MTNB 3MXPA 3J7YW 5G2NA 5HURA 5DCNA 2JVCA 2A8VA 2GMIC 2IZVB 2EVBA 3E0JA 2DWQA 4I6LB 1YJNA 3L0OA 3QR8A 2B2UC 2LEKA 5C3EB 4AH6A 2OHFA 4C3JB 2GI9A 1N32Q 4MT5A 3IKJA 4DR5Q 2NBVB 3HKZG 4IG7B 1VQGA 4XT1B 3IAS1 4HEA1 4CGYB 1FD6A 4IFDG 4QIWE 3MTSA 4X64L 4BWGB 4DR6Q 2MBOA 4BKSD 2LXJA 3HZXA 4YCVA 1WTOA 3ZW3A 1VQAA 3Q14C 2K28A 5I9OA 3CC7A 2SNMA 3TREA 2RDGA 4HDQA 3K57A 1UD7A 1X6OA 4FP5D 1SYDA 5E1FA 1P9DU 3B9JA 5HFYA 3DBLB 5I2YA 3RD2A 2KHIA 2OXPA 1GHJA 1CZWA 4XC2A 4DXAB 1SNCA 4X65L 3L54A 4XE0A 1FJGQ 5JJKA 4A3FH 1HUNA 4LNOA 3CRLC 2W54A 4N58A 2HDLA 3UF8A 1SN8A 4DPGA 3M4PA 2IWHA 5EPKA 2RKSA 2E5LL 1R4NB 3ABVB 3Q2AC 1EQTA 4BKTA 4HJ9A 5K36G 1KC8C 1T3QA 2WQYB 3DM3A 1SSNA 2ZXPA 3Q6SA 1I5FA 2Z9HA 3K59A 2VNUD 1IGCA 1R7SA 4KSKC 4M0WB 2FFKB 4KVGB 5IWAL 5JH5C 2JA5G 2DZJA 4ZCKA 4ICUA 1YNND 1E22A 1N9WA 3L7ZC 3HKZE 2XEWA 3DBRI 2PCFB 2QA4A 1WRIA 3IT6B 3FKIB 5FO7B 3I4MG 2WXRA 4J8QA 4JGHB 1D5MC 1WCMG 5KYLA 1BCPF 3P4QB 4LK0M 1II3A 5EKIA 1WX7A 2JRIB 3K58A 2E3TA 4BXXG 5D14A 2L7RA 5CHWA 3X0WA 2VQFL 2L9HA 3GE3C 2YLMA 2RVLA 4R4TA 4UP9A 2JY6A 3SK8A 1UWMA 1E0BA 1R4QB 4B3SQ 4JI4L 1TVXA 4NQKE 3A54A 2JZZA 3K8AA 1XPRA 4EQ5A 1ENCA 1VDZA 2WWZA 3RZWC 2WXFA 2Q8TA 3N3KB 2F4VL 1FIQA 3SHQA 1SYCA 1WZ3A 2MH7A 5F2DA 5M5YH 2A5HA 4W9CA 4U68A 4US9A 3QARA 2EE1A 1UUPA 4DNRB 1RIPA 2JA7B 1E0ZA 2B2YC 4Q0FA 3F2UA 3MA2B 4RM8A 4P16A 4YWKA 3E5SA 5IGGA 1CKOA 2E5LQ 1F2RC 1FR3A 3APCA 3H7PA 3NQIA 3NQTA 4GDLA 4IOAA 4MSQB 4C80A 3MWYW 1JCKB 3MAQA 4FBJB 1WVLA 2KJRA 4FJYA 5JPMC 3U7DA 1Z47A 3S14B 2LGIA 3IAM1 1DONA 2J53A 2LASA 3RNAC 1XJVA 1ICWA 1A2UA 4GOPA 4HKQA 1CM9A 5IKCM 3J80i 5KGUA 3PGEA 4BY7H 3KUDB 1EY9A 2DNEA 3V60A 4YTMB 2L76A 2VXWA 1MG8A 3ECIA 3NTIA 3NRZA 4OXPA 5C0XJ 4PNYA 1PH6A 2CHZA 2PNHA 2Y3AA 1Y1VH 4IPGA 3CMMB 2NVYH 5LXHA 3CMEA 2LGXA 3X3NA 4QF4A 1C0AA 4JLCA 2K01A 1KLGD 4L5TA 4ANUA 3WDNA 2UUCQ 3AMUA 2WLBA 5KHOA 2F0GA 4WWMA 4LDTD 1Y8OB 4KZCA 4IJLA 4NDXA 2WDQB 2B2TC 2NUCA 5C5MA 4WFN3 2WXKA 3PUYA 3HM6X 3VR2A 3NE5B 2WP9B 1XEEA 1I4PA 2CWAA 1TWCH 5A2QE 2JA7H 3GZNB 1ZUD2 1E7VA 2AKWB 3Q69A 4YY3L 5J39A 2K6DB 2WDVB 3J7ZC 1RDPD 3GP7A 1STHA 3UI2A 1PV4A 4TV3A 4G0NB 4MGYE 3Q24A 4YCUA 1BKBA 1HA5A 5C0XG 4FF1A 3CCUA 2C60A 2Q5WD 4XT3B 3KUZA 3DWQA 4JI1Q 3PIO3 1S40A 2KTRA 2M4NA 3ND9A 3TP8A 2KMCA 3P4RB 4H0LC 2ZJPA 2B8GA 4NMZA 2FBWB 2LY7A 2WIIB 1WE7A 3OPOA 1E6EB 1ZKOA 4YL8A 5EKLA 4CDFC 4IURA 4L8JA 1PHJA 4R4IA 5FLXc 4NZLB 1FYCA 3CD6A 1DGJA 5J18A 1WD0A 1NTGA 1JRUA 1C1YB 2E2IH 3ZDMC 4IUNA 4KHVA 1I3QH 1V5OA 2RQXA 2O2VB 3K9PB 2J0KA 1I4XA 4DUYL 4F7XA 4GLAC 3CPWA 1WIAA 4IUTA 1H9RA 5M3MB 2IO1B 2XSCA 3A9KA 3PPAA 3V96A 3N30A 5LMNW 1ZPSA 3U9OA 3P75A 1WH3A 5AZHA 3KWLA 4FXKC 3ZNGC 4O0AA 1PRTC 1EYAA 2RSOA 2Q2IA 1LGRA 4R4OA 1Y14B 4LUZA 3DBHI 3KWVA 2PEAA 4YWLA 1GXDC 3SE0A 2L15A 4JV5Q 2HUGA 1O7LA 1G2SA 2EQSA 4XYOA 4H7BA 3M95A 2JP1A 4MACA 3N52A 1TT5B 4CYEA 2EYPA 1CI3M 4DUZL 3VR3A 2M8SA 2UXCL 3CPFA 1N34Q 4M0WA 1C4CA 2MNAA 1P7FA 3QC8B 3GTQH 1G6JA 3T1HQ 4C4VB 1EO6A 2FINB 2KVZA 2NS5A 2KDFB 4M8AA 3G7LA 1NVID 2WXOA 3T3NA 1L6UA 3AE6B 3RLNA 2MWSB 3IBEA 3OOCA 2N3SA 4YIJA 3VRBB 4G57A 2X6GA 2CW0C 4LFCQ 2K33A 3SHLA 1QNUA 2KJHB 3ZUNA 2F0LA 1BBXC 4A90A 1CMXB 1Z7TA 2HHHL 2IBIB 1CSQA 3WOEA 1N36Q 1LTTD 4K5VA 2F0VA 3RFZB 3VA5A 4DR3Q 2MHJA 1PH3A 2VZAA 5CV7A 2Z0EB 1A63A 1STAA 1UBQA 4E6IA 2RMMA 4KI0A 2R92H 3KUPA 3NVYA 4G3XB 4HPPA 2DAJA 4BA1I 4JBKA 2LSSA 1WTHA 2HHHQ 1T0YA 3G48A 1YVCA 4DR7Q 4LUVA 1WD1A 1UE1A 2ZJQA 3P4PB 1VCIA 1IBKL 3ETRA 4ANWA 1X56A 4S17A 3H1UA 1FRRA 1E7ZA 3AEBB 5FLXE 3HVDA 1UE7A 1SNPA 5EBDA 4JG2A 5LNK1 1S4ZA 4JI2L 2UUBQ 1FMAD 4OGQC 5GAGC 5IYCG 3B2GA 1OQYA 1NR4A 2MO1A 4MEMA 2BB6A 3GOEA 4IJHA 3D32A 3S1RB 3PTFC 5AJ3L 1TWHH 2KUMA 5T1IA 1SMYD 4II2B 3FKIG 3I4MB 1SAPA 5IGFA 2XN9C 4JI3L 3OJ3A 1QLBB 4YY3Q 3FVQA 2ZXRA 5FLMG 1XTCD 3PQIA 1D5XC 2I5HA 1A3UA 3U58A 3D4DA 3KLRA 3BG3A 1PYWD 5EAYA 4DAYB 1VQ6A 2I5LX 4K14A 5EE9A 1Y8PB 2WXQA 3T16A 3OTOQ 1K28A 4CHTB 4NPNA 3CSTA 2KBNA 3MHSD 4P75A 4DV3L 1OQRA 1IKLA 2JA8B 4HJ8A 1UEAB 1C9OA 4A3KH 4JQWC 4WWPA 1GM5A 5IP7G 4OX9L 4RG1A 3GTJH 4XWWA 2XWJB 4A3GH 2WACA 5BR8Q 1JORA 1MG4A 2AX5A 3QAQA 2DY8A 3QJYA 4PV1C 3AV8A 4X57B 4PK1A 2KLGA 1RODA 3OYYA 2HDMA 2PW7A 3UDIA 1FFUA 3Q6BA 2E2IB 3D4WA 3ZDTA 1VQKA 1ZGUB 3PRZA 3OWFA 1YQ3B 1MJDA 1HCZA 1N8RC 2K75A 2OF1A 1KDAA 3Q8AA 2EYFA 2MP1A 1JWMD 1PLFA 3GTPB 4BKGA 3L9AX 1F2ZA 1FXIA 4FJZA 2A69C 3DPDA 3MHBA 2XK5A 4WIPA 2JSOA 5JVH3 5FOBB 1S1QB 4JBMA 3T53B 2NTSA 4KKUA 3DVNV 5AFWA 1OEYA 4W9JA 1YNXA 2AWTA 2KCNA 2GVBA 5C3EG 2SOBA 5BYQA 2WDTB 1ISNA 2NBWB 1FO4A 2LMCB 2F0EA 3GV3A 1E7UA 1ZXIA 3Q22A 1G6PA 1V80A 5ELBA 1A3TA 4HCPB 4AQ7A 1IPGA 2G9DA 3I63C 4IM2A 4JCVE 5M5WB 1LTAD 4K6DA 3S16H 4R9WA 3NPPA 5T8IA 4A75A 5LXIB 1H9SB 1WGHA 1A6XA 5E7NA 3ZIMA 5C4XB 3L16A 1JMLA 2IY1B 2K39A 4HN7A 4QGUA 1NSNS 3PZ8A 2EMTA 1HRJA 5KNDA 2L83A 1GPXA 1YN4A 1W3SA 4CBVA 1Y1WH 1Y1VB 4ABNA 3A9JB 4BBRB 4GLVB 3MEHA 2KZRA 4HIMA 4C2MB 1E8XA 1Q3LA 3ULLA 4HSPA 2O6VA 1X65A 2UXDL 2Y5CA 5EE0A 1HNXL 4O2DA 3RZOH 3MFYA 3RZDH 2INDC 4A3MG 2IY0B 3CQZH 4P72A 1QZHA 5IT9L 3DVNU 5C4XG 3ZKJC 3HRDD 1SNDA 1EFWA 1PQSA 4NAWA 1T5EA 3S17B 3S2HB 2PVOD 1UNSA 1CQVA 2WAQG 5DAUA 4P2CB 1I4RA 1DZ1A 2BS3B 2KX0A 1XPUA 1L7YA 3AMZA 3ML9A 4A3JG 1JB3A 5LL6S 4WQMA 1SMXA 1EL0A 2D2CC 2DX5B 3CC2A 5M5YB 2QDLA 3HGBA 4IM3A 3BZKA 1HUMA 5GAHC 4DFAA 1HNZQ 1BMLC 4IQZA 2C9WB 4FN2A 4OVZA 1ET9A 3ITPA 5HHDG 1XLOA 2QW7A 1V43A 1VQ8A 3ZLZA 4HVBA 2E75C 3AE8B 3I70A 3CCJA 3P1HA 2VQFQ 2RSUA 3CW2C 4OL7A 3PREA 1GUWA 3DQVA 1Z6HA 2B63H 1KABA 1STBA 2K4KA 2C7MB 3R3OA 4HCEA 3X23A 3ERSX 2KQ4X 3VQIA 2MCNB 1V81A 4KLKA 5KHQA 3DOWA 1NBWA 2KNBA 4ZUIA 1NDDA 1WJUA 1VZ7A 2ZTDA 1RCVD 1P98A 1T5XD 3JSVB 4KV2A 4MH8A 2KC2A 4ZHOA 2BYEA 1X54A 3SK6A 2KOLA 3M7GA 4PMCA 1SB3C 2INNE 2FIFA 1SYEA 3S2HH 4JIOU 3KLWA 1N33L 2WAQE 3HOWG 2WU5B 4KIKB 4ARIA 3ND8A 3SU8X 3KDFB 2A6HC 2BCOA 3MZ5A 4B9KA 4EOYA 3L4PA 2OCEA 4W9EA 4HLEA 2GN5A 2XNAC 2FUHB 1NYQA 2R7ZB 1FXAA 1HFGA 3S17H 4Y7NH 3Q3FA 5ELOA 1QWYA 4DV1L 3JSVA 2YV5A 3S2DH 3AM9A 2D10A 5BN3A 3FILB 1C48A 2E2HH 1K73C 1FM0D 2VB3X 2D3BA 4TKOB 3GTMB 1V8CA 2WV6D 4DR6L 2OOBB 2ONQA 5ELCA 1FNUA 3IFDA 4YWMA 1IGDA 1DCZA 3Q3MC 2WXIA 2F3VA 1KTKA 4N9TA 1KAWA 4KMUC 4UY8C 1AARA 2LRUA 2RSNA 1B7YB 1QZEA 3EA6A 5IYCH 4RWSC 2CH4A 1G291 2TMPA 4ZKBB 1XTDA 4FXGC 5JVG3 1I94L 3A1QB 1WM2A 3I57A 4K81A 2F3WA 4ZDVA 2V1YA 4DV4Q 1YHBA 4IPCA 1XD3B 1QCBD 1IZ6A 1W6JA 1N61A 2BPSA 4NKLA 4RKLA 2LS01 2PLPA 2KT7A 4ILWA 1SE9A 2G5DA 5FLMH 3NBHA 4JYAQ 4IFDH 1F9RA 2EYMA 4KKSA 2KYWA 2MW5A 2F4IA 3S24A 3GTKH 2VQEL 1B53A 4A3BH 5J3BA 2YVCA 1ACCA 2VUMH 2AWOA 1JOKA 1K8GA 3NZ3A 3NUHB 4KGRA 4L5RC 4OEMB 5E6NA 1TT2A 2LKVA 3HOYG 3GTJB 3F8TA 1RAXA 3K9OB 4HJAA 4A3KB 2RCFA 4QMGA 2JA8H 1P1AA 3MC9A 4IUPA 4CKEA 4ID6A 2BT6A 2M17A 1PH1A 3J80L 3RR5A 1SEBD 1UBIA 4R8IA 3JAME 2GB1A 2ZEQA 5FR3A 4LFAQ 5HY6A 2ATWA 5D6JB 4WORA 1XWEA 1U4MA 2BH8A 2N55A 2ZW0A 3KQ4A 1V1OA 3PHWB 4KY6A 1I50H 2OQ0A 1R4MI 3HOUH 4X64Q 4A3KG 3HOUB 4M02A 5DPWA 3T56B 2MBEA 1VF5C 1ZXTA 5JPNC 2JSVX 2F03A 3IFTA 4GNXC 4KHPL 1D6EC 2JXMB 2PMVA 2HD3A 2D0OA 1BR9A 2V4DA 4DR1Q 2IJ0A 3ZXRA 3DMUA 3F2DA 4HRSA 2HJ1A 1J9OA 4LF7Q 2ZPYA 1YIJA 2N9PC 2DZKA 3AU5A 1EWIA 1Q90A 3DDCB 3CCVA 3L17A 1PZID 2K5QA 5LMNL 3RN5A 4G50A 4LF4L 1ZDXA 5CR3A 4C3IG 2GBMA 1HTLD 2WP8J 4MTKA 1HHVA 1C4PA 1J7AA 4JWUC 3EIVA 3NVZA 3VXWA 3PUXA 4ICVA 5IP9H 1WR1A 3W9CB 5C3EH 4A3BB 1PGXA 1SFOB 3P20A 2LVPA 1QILA 2O2LD 4JK1C 4MIUA 1IL8A 2PI2E 4M8NA 5BR8L 2A68C 4KIKA 4YWGG 1SNOA 1GNUA 2ZZPB 1ZE3D 3PF5A 2RPQA 3BU2A 5L37A 1ASYA 3EN2A 1TIFA 3KUCB 2AUJD 3S15H 4RMAA 1VMCA 1D1IA 3J81L 4OONA 2WX1A 2VZKD 1DOXA 1IW7D 4A3EG 2DBYA 2PQAB 2J4XA 2BDOA 2K52A 4XWTA 1SFOH 1WRDB 4AWJA 5EPJA 1V8QA 4DV5L 4OWXB 5H1SE 3OTOL 3DHIC 3M62B 1KF6B 3TUOA 4PZ6A 2A68D 4ASWC 3HVZA 2H1EA 5IODA 2PPBC 1OTRB 2V3SA 1VJKA 3BINA 3H7SA 2XWBB 2E76C 4WH4A 1U9RA 3GTQB 4A3CH 1V1PA 2AQ2B 4OO1G 4A3JH 4HAEA 2RDBC 1C76A 4RF1A 1F9QA 3D31A 4NNJB 1NI3A 2F0DA 1O80A 3NZSA 1SE2A 1J19A 1QG7A 3AYHB 2D11A 3D0FA 2FCMA 3CF6E 1TU2B 3KF8B 5BYRA 1WXAA 2GBJA 4GB9A 3PV1A 4AQYL 1D8LA 1M4VA 3M3YB 2LI5A 2WFWA 3T1YL 4HDOA 5GADC 3FPUB 1I6HH 4LNNA 1J8CA 3EJIA 1D5ZC 2R2OA 2JA7G 3QO2A 2VW9A 2EPBA 3FEWX 1SYBA 4A93G 3ML8A 1UAPA 1Q5WB 4DV5Q 3J80c 4IZ8A 1WWTA 2IHEA 3KYCD 1Q1BA 3DEOA 1LQBA 4K7WA 5EGTA 2KACA 1A5RA 4H02A 2F0PA 1N63A 1STYA 4X3KA 3OAWA 3NSWA 1PH8A 3PO2G 2NBFA 2IW3A 4MHEA 2M00A 4DR3L 2RR9A 4IWPA 2JYEA 3M4YA 2LGYA 4OVUA 5A2QL 1BVSA 3TEHB 5JEAH 2PKOA 1X3GA 1O78A 4GSWA 4YSXB 2MQHA 2JA9A 1U5KA 4RFBA 2EKIA 2ZVNA 1NY4A 1KRHA 4GN1A 1XQQA 3UIPB 2Z4HA 1N60A 3U2SC 4O1NA 3NHEB 3U4EG 1JOOA 4NAMA 3AH7A 2MQJA 2PTLA 3VAWA 3J7A5 4BBSG 1A70A 2SAKA 1CA6A 3SR6A 1E1OA 4FF2A 4LCDE 4EKUA 3GZNI 2BWFA 4JI6Q 2QILA 1WTXA 1VD2A 5D7GA 2MA9B 1KOTA 3VYUA 1LTRD 1HR0Q 1B1ZA 4KD3A 3VR6A 2EY5A 2EYOA 1QUQA 1VQOA 5JEAG 4DK5A 1TKWB 2JRHA 2BYFA 2NBUA 5BMIA 4WJWA 3RMHA 2YEPF 3HIZA 2DENB 2PJHA 1C9FA 2Z59B 1Q1EA 4L5SA 4XQJA 1H8CA 1EIYB 4DHJB 1I94Q 3LWEA 1WGYA 3AE4B 3BZDB 1WTRA 1JROA 3VRAB 2L1BA 1PFSA 2HTME 2PE6B 2QC8A 4TQ0A 1HNZL 4L23A 4JVZA 3P2BA 3CU7A 3BS1A 4IFDJ 4ZKCB 4MNOA 2R2QA 3N1ZC 1EU4A 2SEBD 1PDQA 4JW0A 3NHHA 3M4OH 2BS4B 2KHSA 2BBCA 1WJNA 1SSOA 3ZGZA 1C7YA 1QJOA 1B2TA 1Z2MA 4F8CB 2ZTEA 1GOZA 1LTLA 5LL6X 2R7ZH 5LHY1 3VHTC 4AS1A 3I73A 3PHXB 3KYDD 1GUAB 2RCNA 3HKZB 4IOCA 2D0PA 2F3IA 1OXVA 2Z4IA 4RA8A 3GTGB 2DNCA 3MP9A 3ZJTA 5G3LF 2IGHA 1XXGA 3CSFA 1WGRA 1HNXQ 3UDGA 5H8YE 2NZHA 3S16B 5E4XA 3WAPA 1MHWC 3AFPA 1HZ9A 4M1UB 1EWHA 4A3DB 4IWQA 4IKGA 3EUB2 4AYBG 1FJGL 3PS6A 5G55A 5JXVA 4BY1H 2EJGC 3HOXB 2NWGA 1GUSA 5NUCA 5J22A 1IUEA 3J81E 1Y8NB 1RRBA 1L1OC 3SFEB 2A6ED 1WTWA 3VDYA 1BBWA 1HTPA 2SNSA 3LJ3A 3JAMc 2RF4A 1NMGA 3K5OA 4GGQA 1KRSA 1LT5D 4BOZB 1QOFA 1HA6A 4XQNA 4V0BA 4MGIE 3RLOA 1GG3A 1LTBD 1HPCA 4JBWA 2UUCL 2IY5B 3CHBD 1RKNA 1PDXA 4AUQC 3SD5A 1R4MB 2L00B 2LMCA 2J0MA 3GTPH 4DNTB 4RHRA 1STEA 1L0XB 3A7LA 3HHMA 3ULPA 1LV9A 1XT9B 1EY0A 3PLVA 1YNJC 1RWSA 5JJZA 1VDVA 2KHJA 3QOJA 3M9BA 3WA0A 3ZO5B 3ZJVA 3IXSA 2QEXA 3UDXA 3SXHA 5IYDG 1PZKD 1ML0D 1PH2A 1SIJA 2W3SA 5CV8A 3C1EA 1V5TA 3QCAA 3M4QA 3B2FA 4I65A 3Q8EA 4JPSA 4JI0Q 4HCNB 1KDCA 3I3TB 2BKRB 4I6PA 3R3MA 2C5LC 1QOHA 1P16A 4P74A 2R7FA 1N33Q 3RZDB 3E9SA 2H4OA 2MJEA 2ID0A 1EWCA 5GMVA 4FDBA 2DZIA 2J42A 3URYA 2ZNVC 2FMCA 3NS1A 4DXFA 4BBRH 1H95A 2PIAA 5E6PA 2OJWA 2RD0A 3ULJA 2GVAA 3A56A 5C6AA 3S1MB 1MHHE 4YHHQ 4A9AA 5D2MB 5FKAC 3WOFA 3KJOA 2UYZB 3WIMA 3A74A 3H91A 4RGOS 1L0YB 2KEEA 2DUDA 4KN7C 2F0JA 4IW0A 5C5LA 3H09A 2N4FA 4L5QA 2UUAL 4I7ZC 1KDBA 3M3JA 3PZDA 3C46A 1G51A 4C3HG 1TGZB 1O7YA 2KQ3A 1PMRA 2K0PA 2JEAI 4HXDA 1VQNA 1QT9A 2D3AA 2KA7A 1BCPD 1ICFB 1PYBA 2CFMA 4UAIA 2UXBL 2AMCB 1I4HA 1QOAA 1YJIA 3UI3A 4DHZB 1PFNA 3RNFC 2Z0SA 3PMFA 4NP5A 3I55A 2B29A 4M01A 1WYWB 3BIID 4IM0A 4OIKA 1HZAA 1R4PB 4JI6L 4Y52H 4ZQ3A 2E2JH 1RYJA 2K25A 2C7NB 3VTVA 5I9PA 3J81i 1DOIA 3RLFA 5IOIA 2XRQD 2V4LA 1NBFC 1HZ5A 3OMCA 4G4KA 4OZAA 2J0TD 4JOIC 3P1MA 3VYSA 3SR1A 3BDCA 1TXYA 3T51B 1EY4A 2N7JA 1MJEA 3S1MH 3VDZA 3PUVA 1WX8A 2K5NA 2ZJDA 1RFAA 1UGJA 4I6NB 4A3OA 2A69D 3Q3NC 5EDSA 1JWUD 2UU7A 5C44H 3IAYA 4FXDA 5LMUQ 2K50A 1SE3A 5CMDA 1GB1A 4QIWB 4G11A 2L11A 1PH5A 2NVUI 1C4AA 1EQRA 4C3HB 1S5BD 3J9CA 4WJQA 3H15A 2K3UA 1EFID 2E6XA 1PFMA 1T0RC 1PRTD 1NJIC 1HJPA 4LJZC 4DR5L 1WSPA 1QOGA 1VRAB 2RDFA 5AZGA 4DV3Q 1WXMA 2LRWA 1ESRA 3G6EA 2ZPNA 1NI2A 2EMSA 1WFQA 1M8AA 4P71A 1A15A 3W3AA 3PO2H 4DHZE 3AU4A 4DNIA 2R7DA 1OXSC 1ZEQX 3NBIA 3Q8FA 2FAZA 4HJGE 4WWOA 4HEDA 4W9LA 2CWPA 2MEKA 2BH2A 3PVLA 2K9XA 4KKJA 4P1BC 1JMCA 4A3GG 5I6WA 4GOPB 4JI3Q 4PZ8A 4NB3A 1B50A 1FEHA 2VUMB 4IOIE 1AE3A 1JWAD 3I8ZA 4MDKE 4MGKE 3KYHC 4HTHA 1E8YA 4KV6A 1E5WA 1HZCA 3K7UC 4HJ5A 3Q3JA 4WQOB 1GUOA 4S3SA 4JI5Q 4BBSH 2GBNA 2I1JA 4GDLB 4ANVA 5IN7A 2HT1A 4KGSA 1WGDA 2Y5BB 3MJWA 2CVRA 2B63B 4B9WA 2JQOA 1B9NA 3E9IA 3ERQA 1FD7D 4CDEC 4A3DH 4TQUS 4NXMQ 4V190 2V9HA 3VUYA 2I5MX 1IYUA 3C1FA 1MKHA 2MSED 2JK8A 3HFZB 3A5UA 1WJ6A 2K14A 1WCMH 2J52A 2K6QA 2X38A 3IG3A 4XTCS 1SLJA 4ME5A 3CCSA 4NXML 3TBLD 1KQSA 2PMZB 4RGNA 2JYOA 1HNWQ 3NG0A 4GN3B 2KANA 1D2BA 1K83B 1V86A 3K7AB 5ELEA 1SROA 3SK5A 4RGTA 4REZA 2EY1A 1YBYA 4IALA 4FADA 2MO0A 4IO9A 5JJIA 2ZM6Q 3AB5A 5M3FB 2NR2A 4A20A 3Q8CA 3E9HA 1I6VC 3DBHB 3NVVA 1L0WA 1ZKHA 3SFDB 1HR0L 1VR9A 1YHAA 1XNRQ 3RUZA 2G4DB 4QAYA 1GC7A 5DPRA 5EBCA 4A3JB 2J7ZA 1RJTA 1SJED 2F0OA 3TMEA 1YX6B 3F2CA 1N34L 2LGDA 2UUBL 3H0GH 5EJWA 1LXDA 2PVGC 4GS3A 2JEBI 4DUZQ 3JYUA 3S1NB 1J6QA 1RM6C 1HXYD 4CQNA 4FXCA 4EZLA 3D8GA 5IA7A 1AWDA 3NELA 3R2IA 2MJDA 2B2VA 2SDFA 3CCMA 3JAMi 3PZ7A 2JUOA 3GE8C 2QDFA 1JQYD 1YX5B 1YI2A 1C4QA 5C23A 2JJQA 2OQKA 3SEBA 3L3OC 2FMMA 5IGEA 1B3QA 2DZMA 3B0AA 5CHVC 1K0SA 2MBQA 3LXFA 4K7UA 1B9RA 3KK7A 4LDTB 3H7PB 1Y1VG 1OQQA 2HE7A 1HQMC 1NEKB 3I7FA 1OXTA 3K5NA 4IUMB 3VR8B 1CZGA 1SBBB 3E6ZX 3U4ZA 4MELA 4AYBE 2C7HA 1E2VA 5G5HA 2NN6G 2HIXA 2K5WA 1YNJD 3HRZC 4DHJD 2GBRA 5E6OA 4LF7L 1HTQA 1YJJA 4HWIB 4HIDA 2H5XA 3ZJYC 1S5CD 2NB0A 1VQCA 5IOCA 3MJ5A 1PTOD 4JWSC 1ZOYB 1L2NA 1SDFA 4GKJQ 1K3BC 1NMFA 1G8ZD 1WXVA 4N9PA 4ODGA 2BE5C 3V6EB 2WB1G 1RLFA 2KCCA 4BBRG 4EZKA 5ELNA 1ZYRD 4D2KA 4B3SL 4JI4Q 2OEDA 3DHQA 2KAJA 1YEZA 1LFDA 3H3VC 2N0SB 2IGDA 2CQOA 4US8A 2KVRA 3IRBA 4X3TA 3QX1A 5HI1A 1X3EA 4LFAL 3BJUA 1DM0B 1V1PB 2LHEA 2RDHA 3TN2A 4XYCA 1JICA 2MPMA 2AL3A 1BO0A 3HG9A 2NVYB 3RNBC 4MM3B 1Q86C 3A9KB 1STNA 1EY5A 2LGSA 1NYRA 4C2MH 3WCQA 3I4NH 2A5UA 4GNXB 3NUCA 2FNJB 3OW2A 3CRKC 4A3FB 3W1SA 2QDBA 4A93B 2JXTA 1Q0WB 4WURA 2XIWA 4APVA 1UH6A 1PYSB 1F77A 2EYHA 3S14H 4C3JG 2WXNA 2BB5A 4NJCA 5FO9B 1DYQA 2AWNA 2QCPX 2JA6B 2V3PA 4KDIC 2B2YA 3RNEC 1YNNC 2EOTA 3VVWB 4CJ1B 2KTFA 2N9XA 3CCQA 1TS4A 2RA4A 3W2DA 2G9HD 4LNQA 2K8BA 2KOXA 2WYQA 3CIRB 1TKYA 2ICEC 4C56C 2OTLA 1ZDVA 3A8KE 1C8CA 2IO2B 3PO3G 1K0RA 3X3MA 3PRPB 4TVAB 3K5MA 2K5PA 1JR0D 2FXQA 2AUKA 3EQLC 1WY8A 3PF4A 2JX5A 4DR1L 2L0CA 3JC66 5C4JB 1YIWA 5HGQA 3ALBA 2N88A 3DLLA 2F4VQ 3APFA 3HUIA 3A55A 4LF5Q 4BA2I 4ZRPA 2LJ5A 4RKBA 4DXGA 2NVXH 2L52A 4MSMB 5CX3A 3RPFC 4KY7A 1GVPA 5DM73 4NQLB 3NXWA 2YU9B 1M94A 5MPOA 4A3BG 1SYGA 5T1GA 1OGWA 3QB3A 2JA6G 1VQIA 3SVMA 3S1QH 2JA5H 3RZFA 1WR6E 2VZKB 2M0AA 4HPLB 4DDGD 1AFPA 4KY5A 3C8YA 1BF4A 1L4ZB 2B3AA 5C3JB 1FL0A 2GRIA 3KOJA 4QUCA 4YXDB 2B2WA 1JJCB 1PTOB 2K32A 3G4SA 1D4BA 4EE2A 4L6TB 1IW7C 5C3XA 1BDOA 2YTVA 3CCLA 1HZBA 1G6ZA 4DWFA 2EJMA 1DOMA 3DBLI 3OMGA 1QVFA 2G3QB 2Y0SG 3MXGA 2MBHA 4XIGS 3EECA 3ZVVA 3QIAA 3HOXG 3HOVB 1KAAA 1A3VA 1IBXA 3HOUG 3QA8A 2N8NA 1ET6A 4A3DG 5KNCA 2FJ2A 2IHFA 2BW2A 4LNKA 3VYRA 3J81j 3FPPA 1PTOC 2JA5B 5BMHA 2FHTA 1O7ZA 2IL8A 3K5LA 1E8WA 3AQQA 3VFKA 2WXMA 1L2FA 3EFUA 3V3XA 4TQ1A 4WJOA 3RMKC 4ANXA 1XNQQ 1WMHA 2INCC 2DJGC 1H4RA 4YSZB 1IYVA 4FJVB 4GZYC 1WGGA 3ZXVA 2AQ3B 1VLBA 5K36H 2HCIA 4X3UA 3L0WB 2A1AA 4LF8L 3GB1A 3HOXH 4DA2A 2ZJRA 1XNQL 2VL6A 1PRTF 1T9HA 2K5DA 4ZUJA 1MSHA 4ZRKA 4KZ0A 2B2TA 1IHZA 2KDMA 1Q81C 5AZFA 4YCWA 2PZWA 5CBAE 2K6AA 1F9SA 1N32L 1PGBA 1MIUA 1CTMA 4BY7G 1PFBA 2OJRA 4JPBW 1A0IA 3VR4A 2PYKA 2AQ1B 1CK1A 4HKZE 3VTWA 5IGBA 1I35A 4F8MA 3V61A 3DUZA 3VUXA 4Q2JA 2REXA 3NTHA 2XK5B 1V2YA 2RBMA 5D3DA 1FNVA 1LYLA 1AZQA 4N8X1 4LF6L 1VZ6A 3QHTA 2ON8A 3H3VI 1I42A 2KECA 4OVVA 1TWGH 3D6WA 1YD8U 1E2ZA 5E3FA 4ZHPA 5M3MG 3HOZH 1MI0A 2J7QB 1CFMA 4LW1A 5CC4A 1AP0A 5EE3A 2O5IC 4X65Q 2WS3B 4AOFA 4DK3C 3A5ZB 1V1QA 3A8JE 2E8GA 1B3AA 1KJTA 2ZCCA 5KYIA 2WU2B 2ICIA 3PLUA 3ZNZB 3H0GG 3P42A 4LNIA 2MFIA 3BK1A 4N6EB 3G71A 2I1KA 1TWGB 3U4VA 2XRSD 4K5WA 5M3FG 5ELFA 4DV7Q 4F7ZA 3TP6A 3E3XA 4JX1C 3BZCA 4HCSA 1SNQA 1X1MA 1MVKA 5M5WH 5C0XI 1TZOA 1DXMA 3PT2B 4UP8A 2LVQA 2KWVB 2L32A 2ENBA 4XDCA 4LMQD 1I3QB 4PS7A 4HIOA 5CBEE 5IP4D 2NVQH 4GU2A 3AE7B 3QG1A 5HKHA 4IWOA 1LTGD 2L05A 1AW7A 2PZTA 2F0TA 2Z6KA 2N7EA 4RMFA 3BY4B 3N1XC 4A3PA 3NENA 4G7OC 3RN9C 5C4HA 1CKMA 1H9JA 4CJ0B 3PIP3 1W2BA 2IX3A 3SDZA 3ZTCA 1CHQD 2JWUA 5IYBG 1CKNB 3K81C 3W5VB 1EQQA 4WJ4A 1LT4D 4O42A 2VH2A 4A3IH 3UIOB 1CUKA 4C1NI 1XMOQ 1ZW7A 1F52A 2MBBB 2WGSA 4OW0A 4NXNL 3AN1A 5J2RA 5DM63 2PNRC 2CH4W 1WI0A 2NZOA 1PA6A 2JZ3B 1KLVA 3R7RA 4L1BA 1WTVA 4X66L 4A3GB 2PMZE 4UP7A 2KFKB 2F0NA 3GTLH 2G1EA 3QK0A 4MGZE 2QGQA 3LGJA 5L83A 3ZTDA 4A8XC 1IP9A 3N1YC 1ENFA 4FLHA 4PS8A 4CKCA 3S1NH 1UWXA 4IUUA 2WKDA 4PMWA 1SE4A 1K8MA 1D1KA 2B2UA 5BO4B 1U4AA 1DGSA 1STGA 4WAAA 2BQQA 5D3IB 4A3EB 3FHWA 1TWAH 2Y5PA 3CWIA 4B3RQ 1LT3D 1K50A 1QB5D 4GLXA 5AJ3Q 3W1YA 4LJOB 1IBLL 2PZUA 1FPYA 4DBGA 3RNGC 2KQ7A 1EIGA 2UU9L 2KMAA 3HS0C 4GKJL 3HOZB 1PTOF 5ISRA 4W9IA 3TMPB 1JW9D 1L0VB 2D62A 4B3ML 1AE2A 3K80C 4X3SA 1IBKQ 2KN5A 2A19A 3K7AH 1VQMA 4DR7L 1G91A 1EUVB 1MI2A 1H9MA 2L12A 4X62L 4GN5A 1EQVA 3BYTB 1WTQA 4GKKL 3EBEA 1DD2A 2HD5B 2ZVOA 1B70B 5IY0A 4IC7B 2LZ6A 5EKKA 4UDUC 2F0WA 3MC0B 2OWOA 3OSOA 4CJ2C 1B9MA 1NAPA 2D5DA 1HNWL 3TJPA 4DUYQ 1HZ6A 2YEPB 3KLSX 4H44C 3PO3B 4ZAIA 4DF7A 1PVOA 4KGTA 1EF1A 4MJSB 4FO2A 2D2QA 1WE6A 2LXKA 3FP9A 4RHSA 2W3RA 4H13C 5K5PA 1X3PA 2K03A 2PQAA 2W82A 2W9NA 5DPSA 5IO9A 1TWFH 3J80E 4JI5L 4QQBX 2KDBA 5JAVA 2UXCQ 1JE4A 2CS4A 2BA0A 4OO1I 2KDEB 4JI7L 3DM1A 2NZ1D 4FVMA 3HOYH 2F1MA 3SGIA 2C35B 3BWUD 2CJOA 3HEJA 4WJNA 3MVVA 3EVQA 1RF2D 3J81c 3PO2B 1NR2A 5IE8A 2EJFC 2D5GA 2DAFA 2Q2TA 3N32A 3KW5B 3DEPA 2EXZA 2P5ZX 4KJOA 1VQLA 2F0FA 2CR5A 2KO3A 2Q8IB 5HG2A 3R93A 4EGVA 3TBIB 4G7ZC 4BXXH 3KBGA 1J7BA 4KDLB 1K51A 1DOLA 3IT4B 5CYUA 1XF5L 1ZXHA 1VQ7A 4WJ3M 4EQPA 2BGFA 4EFOA 2KC1A 3UGBB 4YHHL 4P7IA 2WXLA 4KK7A 4TUUA 2V0GA 1TZ1A 3PUZA 4RH6A 3CCEA 4NXNQ 3I4MH 3R7QA 2H89B 2YTYA 2JA8G 3OIQA 3BVZA 1DOYA 4BKSA 2O5JC 4J1MA 1OO9B 2KDIA 2VY3A 1VQ5A 3RUIB 2VB2X 1RTOA 3H9DA 1HH2P 1B4OA 2KKCA 4DV1Q 3H6NA 3I3CA 5JOBA 3DWPA 1E3PA 2NVXB 2WXHA 1N36L 2LUMA 3OG5A 2MLBA 3NY5A 1KFYB 2K1FA 1Q8IA 2NPTA 2F0KA 4QUFA 1KHIA 1SE8A 3TS0A 2NVTH 1RFKA 3T9LA 3STBD 2CU3A 2BKFA 2BTEA 1LT6D 2QF7A 4DN4M 2ZXOA 1GKHA 4AIMA 5IP7H 2M19A 3CP0A 3KDFA 4B3MQ 2R92B 2PO4A 1GD7A 3APDA 2B2WC 1ROEA 5C1ZA 4UPAA 4CKBA 3F2BA 4KHPQ 4DR4Q 1LM8B 5BN5A 3AI5A 3HK0A 3DCGA 2Z1CA 2N1VA 2DYOA 1T0SC 1IBXB 2X8XX 4N9F4 5FJ8G 3JVZX 4C4VA 1PXUA 5DLQE 2ZW1A 1JB7A 1ENAA 3I4OA 1T6BX 2LFIA 2LD9A 2MX2A 4GNXA 2KLCA 3DBSA 3NVWA 4R3DA 5FR6A 1UELA 2KENA 5AEKB 4EUTA 3EROA 5D94A 1X3QA 4OWTB 4UHVA 2L1AA 3I90A 4DAVA 2E2HB 3E56A 4FHKA 2OTJA 2BE5D 2I46A 4KKIA 2O4XA 4A3CG 1LM0A 1KNEA 4QJFA 3I4NB 2EXDA 3UE1A 2KWUB 4A6QA 4Y7NB 3RN2A 4C1NK 2NYZD 4X66Q 4R8NA 4DK6C 3M4OB 1J8IA 2KCTA 1GJXA 4N59A 3NEMA 1JE5A 1HEZE 1WF9A 5M3FH 5IAAC 4HJKA 2O2VA 4HK2A 2ALYB 2IX1A 1BCPB 2R6GA 4BVUC 4YTNB 4JI8Q 3MHZA 2N9LA 4A3IG 1OEYJ 2ASQA 4NAWB 1GHKA 4DR2Q 2K8CA 2CU1A 1TY0A 1S5DD 1AN8A 4JI1L 2EZVA 1JALA 2H88B 1JQ4A 2BF8B 2WB1B 1YN3A 4CDDC 2DYMA 2NMQA 2Q2HA 1WJ4A 3V6CB 1EZ6A 3BDLA 4HROA 4Q5VA 1WXQA 3GV6A 2DGYA 5I4DA 4ZRJA 3KJPA 4M00A 1FNWA 3NJTA 2DN8A 3NP8A 4LFBQ 2ACZB 4ALPA 3AEDB 4GXBA 3W1GA 3I91A 3N6RA 4WRDA 4BBSB 1MHXA 1TIID 4F87A 1R9TH 1KL9A 1NCVA 1SXTA 3B1LX 4XDDA 1WOCA 2PQEA 4KJNA 1H9SA 3C3LA 1RTNA 1P0RA 5CV5A 1WM3A 3A8IE 3A0JA 4OIJA 3IVFA 1TWCB 3VTUA 4LF9L 1BBUA 5KIXA 3HOVH 1K52A 1UZXB 3Q23A 1SNMA 5JEAJ 2D9UA 1BUVT 2IT1A 2LJIA 2D07B 3VA7A 3ONSA 3AEVA 2MHVA 3CKIB 3M7NA 3QIJA 4A3LH 2IO3B 4QCLA 2FCQA 4EVOA 1VQJA 4LF9Q 3DHHC 5G5GA 1V97A 3VR5A 2QJLA 3ENEA 2K5HA 1XYIA 4XX5A 2QCZA 4ME3A 3OJ4B 2Z0DB 4GIVA 5J1ZA 1W6KA 2Y0SE 3RZOB 2IO0B 3CXCA 3KLSA 3TEWA 1E90A 5HGTA 2LXAA 5C44B 2JPHA 3AU7A 3D4RA 4OX9Q 4G7HC 4GDKB 1P8LA 3BVMA 4J6IA 3TP5A 2F0UA 3AE2B 5I2XA 3I56A 4IUVA 2G45B 5CV9A 4LF8Q 1XLQA 2R7ZG 2KTRB 5CORA 1N6ZA 4HJ7A 4QL5A 2RGFA 2WXJA 1S3SG 1YZ6A 4M8MA 4HIKA 1ZP0B 4ACFA 5ELDA 1E2WA 4YT0B 2E2JB 3O13A 3HOWB 3RNCC 2MRPA 1Q12A 2AYOB 2BVCA 4DR2L 3VH3B 1U4PA 1VQHA 3MXUA 4NW2A 2QHOA 3FMCA 3W5OA 4JI8L 4BS9A 3U7ZA 1SJHD 2AEHA 1K3RA 2M0XA
chains in the Genus database with same CATH topology
1GUTA 1U4RA 2KJXA 2EYLA 3FAHA 1KLUD 3MXNA 2WNMA 2B8FA 2DLBA 4KX6B 1F0ZA 2NVTB 3VR9B 1LO5D 2ZT9C 4TSSA 1JWBD 1B44D 2B2VC 3LX0A 4IFDI 3TEZA 1CHPD 2KWDA 4JE3B 1YN5A 5CV4A 2F0QA 2EY2A 1DJRD 2K04A 5GXGB 1VZ8A 4ARCA 1ONLA 1F2LA 2EELA 2INPE 2WDRB 3BVGA 3FRPB 2M56B 4ZOHC 3QWNA 2Q8RE 2TSSA 2QKIC 4H2AA 3ZQ4A 1EY7A 1HQRD 3Q8BA 1FGBD 4A3MB 1BOSA 5DEHA 1GB4A 1VMPA 1PGAA 3J7AF 2WKCA 4L63B 4K5XA 3R8BA 3AECB 2K1BA 5BN4A 3AE1B 4XXEA 1ESFA 1L6VA 2E74C 4IUQA 4YTPB 4DAPA 3U52E 3FDTA 1E10A 3FC4A 4GLSC 3RD4A 1TKGA 2A6HD 1A2TA 4HR7B 2BA1A 5AUKA 5KEEA 3VYTA 1GAQB 5IGDA 1EU3A 2HDEA 4C7ZA 4LAAA 2KN4A 1X32A 4KKTA 3AEAB 2GA4B 2Z8LA 4KTAA 1BNZA 4ZRZA 4B0EA 1CT1D 3OIPA 3U9SA 4KD4A 3S2DB 1PZJD 5C2TB 1K8OA 2QEJC 3AEFB 1OXUA 4ZLTF 4K8JA 5I6YA 1BQQT 1L4DB 2BYTA 1RD9D 5IGCA 2V4IB 3M85A 3I72A 3KF8A 2A74C 1SYFA 4USAA 4ULLA 1SMYC 4XQQA 2V3NA 5EE1A 1TS2A 1TY2A 3PUWA 4HMJA 1CZPA 4OHJA 1SF0A 2I07B 3P7JA 1AZPA 2QIEB 4U673 4A3IB 2DY7A 1LACA 1EIHA 4BY1B 3GS2A 3BYYB 1I4GA 3AE9B 1MBYA 2IGGA 3H6MA 2LHDA 1MSGA 2JE6I 3NTKA 2NVQB 1TQOA 3TEXA 4IDIA 5FLXL 2MJ8A 2KVMA 3AEEB 3HP3A 1TYGB 4EQOA 4TMAB 2NTTA 5E6JA 1C79A 1YMHE 2YYZA 3TDQA 3CQZB 5KNBA 1EWYC 3LYYA 5FK9C 3TP7A 3GTOB 4RF0A 2KEDA 4RGMA 3Q0AA 4ITKA 2CJNA 5BYSA 4LLGM 1S5ED 1NUCA 1WCMB 1K53A 1QF6A 1QOBA 5EQ0A 1EY8A 3R2TA 3S15B 2MUYA 4ZRQA 3TEYA 4KN4C 5C3WA 2HQEA 4TRDA 4FYDA 1JWSD 5H92C 5C0XH 5A35A 2WXGA 3AE3B 5M5XB 5CV6A 1HFNA 1TJEA 4WAFA 5KRUA 1XO3A 4DQOC 2WINB 2F0IA 2IPKD 5EPLA 2R3ZA 2XVSA 1F9PA 3I9V1 3GQBA 4ZK9B 2OEOA 1OXXK 2PW9A 1I50B 2BS2B 2JZPA 2F0HA 2BDNA 1QE6A 1I7HA 1N5XA 3AB9A 3S1QB 4LTUA 1CA5A 1ZYRC 4DGZA 3P4SB 1EYCA 1XLPA 2K05A 3HOYB 4HMIA 3DXJC 5IT9E 1TKEA 2L5TA 1TR5A 1TWHB 1MPEA 1LTID 1OFFA 4L2YA 4P6VF 3OWEB 1TS5A 2MJ3A 3DWAA 4B9XA 2FE8A 2Y0SB 2A6EC 5DNFA 1GUGA 3KBXA 2W55A 3K0YA 5C4ZA 4DK1A 2B39A 1MGSA 3ONAB 3BK2A 1C78A 3I4LA 3K6OA 3NWSA 4LK1C 3T13A 3OHXC 2M2LA 4OO1H 3QOLA 4OZBA 3PV0A 3C2PA 2A73B 4C3IB 4DK0A 2HCCA 4A55A 1XCTL 2C5CA 1EEFD 1F2RI 1NENB 1LLRD 5IIFA 2CQAA 1JC7A 2N9KA 2WXPA 1Y69U 1TWAB 3NK9A 3OW7A 2E2DC 2B76B 1ILPA 1F2MA 2R61A 3FILA 1VF7A 1XLNA 1WGKA 4QB4A 1N5WA 1XCQL 1U4LA 1XX8A 3P63A 3T3OA 4FNFA 5G3LD 2CW0D 3SK4A 3S9WA 1BCPC 3V05A 2JYTA 1EY6A 3GO5A 3ZJUA 2KMMA 4K2LA 1EOTA 4FF4A 2RPVA 2MGSA 1R9TB 3GTKB 5BMGA 3BDOA 2FUG1 1EM7A 4RNAA 4AYBB 1BXTA 2X69A 1JOQA 3W5UB 4DU9A 1FRDA 2JU6X 1KH0A 1QKZA 2BOSA 2K7VA 2M9VA 4MN3A 1Y56A 1LTSD 4XDXA 1PUTA 3JAML 1MD2D 1AEXA 2IDYA 4RAUC 1TS3A 3H0GB 2WAQB 2F0MA 3MFGA 1WYGA 1F2YA 4YSYB 1I6HB 1FCCC 1EYDA 3DWMA 1EZ8A 1DOKA 2L4NA 1J7CA 2F0SA 3ZYYX 1EEID 3EGRA 3H8HA 4C7YA 5TSSA 1LABA 3A7AB 5E4WC 4BY7B 2C9OA 3AEGB 1YQ4B 4B08A 1C77A 1CQFA 3G6JB 1JRPA 2QSDA 3GD7A 2I38A 3H94A 4PQXA 4K2KA 2QMTA 3N9YC 5COYA 1PRTB 3GTLB 3LB8C 4XYQA 3J7AV 2LFNA 5AUIA 1ILQA 3D6CA 4RCOA 5D65A 1FFVA 3TZDA 1AYFA 1E9MA 4EQNA 4F88A 4KHZA 2PW5A 2JQRB 4K8IA 4K6LA 1S5FD 2IX0A 1E7PB 4Z9CB 4PMBA 1N62A 4FF3A 1H9KA 1I4QA 1CJEA 1PFDA 1QNKA 1QQRA 2NN6I 3TSSA 3AE5B 3LWUA 5CGKA 4B0MA 4OZCA 4ZYSA 1RHPA 4HSVA 3LNNA 2OT2A 2NN6H 2L55A 3NWTA 3PO0A 2I2YA 1BUIC 1L5PA 3T4AC 1WTPA 1G2TA 1GUNA 1KNAA 2R93B 1PTOH 4PT5A 5M9OA 1Y1WB 1YNTE 3IL8A 2CHBD 4J6HA 2EY6A 3V2TA 4RCNA 4DAYA 3D3RA 2X6LA 1TWFB 4IN3A 4J3OD 3TZUA 2K22A 5FO8B 1IKMA 1P7EA 3EFXD 2EYJA 1FCLA 1Q10A 2EDGA 3MXPA 3J7YW 5HURA 2EVBA 3E0JA 2DWQA 2B2UC 2LEKA 5C3EB 2OHFA 4C3JB 2GI9A 4MT5A 3IKJA 4HEA1 4XT1B 3IAS1 4CGYB 1FD6A 4IFDG 3MTSA 4BWGB 3HZXA 1WTOA 2K28A 5I9OA 2SNMA 2RDGA 3K57A 4FP5D 1SYDA 5E1FA 3B9JA 5HFYA 5I2YA 2OXPA 1GHJA 1CZWA 1SNCA 4XE0A 1HUNA 3CRLC 2W54A 4N58A 2HDLA 2IWHA 5EPKA 2RKSA 3ABVB 1EQTA 5K36G 1T3QA 2WQYB 1SSNA 2ZXPA 3Q6SA 3K59A 2VNUD 1IGCA 1R7SA 2FFKB 1YNND 3L7ZC 2PCFB 1WRIA 3IT6B 3FKIB 5FO7B 2WXRA 4J8QA 1D5MC 5KYLA 1BCPF 3P4QB 4LK0M 1II3A 5EKIA 3K58A 2E3TA 5D14A 2L9HA 2RVLA 3SK8A 1UWMA 1E0BA 1R4QB 1TVXA 3A54A 1ENCA 1VDZA 2WXFA 2Q8TA 1FIQA 1SYCA 2MH7A 5F2DA 2A5HA 4U68A 4US9A 2EE1A 1UUPA 4DNRB 2JA7B 1E0ZA 2B2YC 4Q0FA 3F2UA 3MA2B 4P16A 3E5SA 5IGGA 1F2RC 1FR3A 4C80A 3NQIA 3NQTA 3MWYW 1JCKB 3MAQA 1WVLA 5JPMC 1Z47A 3S14B 2LGIA 3IAM1 1DONA 2J53A 1ICWA 1A2UA 4HKQA 1CM9A 5KGUA 1EY9A 2DNEA 4YTMB 2VXWA 3NTIA 5C0XJ 4PNYA 2Y3AA 3X3NA 4QF4A 2K01A 1KLGD 3WDNA 3AMUA 2WLBA 2F0GA 4WWMA 1Y8OB 2WXKA 4NDXA 2WDQB 2B2TC 2NUCA 5C5MA 4WFN3 3PUYA 3VR2A 3NE5B 2WP9B 1XEEA 1I4PA 5A2QE 1ZUD2 3Q69A 5J39A 2WDVB 1RDPD 3GP7A 1STHA 3UI2A 3Q24A 2Q5WD 5C0XG 1HA5A 4FF1A 4XT3B 3DWQA 3PIO3 3P4RB 3ND9A 3TP8A 4H0LC 2B8GA 4NMZA 2FBWB 2LY7A 2WIIB 3OPOA 1E6EB 1ZKOA 5EKLA 4IURA 4L8JA 4NZLB 1FYCA 1DGJA 1WD0A 4IUNA 4KHVA 2RQXA 1I4XA 4F7XA 4IUTA 1H9RA 5M3MB 2XSCA 3V96A 1ZPSA 3U9OA 3P75A 3KWLA 4FXKC 1PRTC 1EYAA 2RSOA 3KWVA 1GXDC 3SE0A 2HUGA 1G2SA 1O7LA 4XYOA 4H7BA 2JP1A 4MACA 3N52A 2EYPA 1CI3M 3VR3A 4M0WA 1C4CA 1P7FA 2FINB 4M8AA 3G7LA 1NVID 2WXOA 3T3NA 1L6UA 3AE6B 3OOCA 4YIJA 3VRBB 4G57A 2X6GA 2CW0C 2K33A 3SHLA 1QNUA 2F0LA 1BBXC 4A90A 1Z7TA 3WOEA 1LTTD 4K5VA 2F0VA 3RFZB 3VA5A 5CV7A 1STAA 2RMMA 4E6IA 4KI0A 3KUPA 3NVYA 4BA1I 1WD1A 3P4PB 1VCIA 3ETRA 1FRRA 3AEBB 5FLXE 3HVDA 1SNPA 5EBDA 5LNK1 1S4ZA 1FMAD 4OGQC 3B2GA 1NR4A 2BB6A 3S1RB 2KUMA 5T1IA 1SMYD 3I4MB 1SAPA 5IGFA 2XN9C 1QLBB 3FVQA 2ZXRA 1XTCD 1D5XC 1A3UA 3D4DA 3KLRA 3BG3A 1PYWD 4K14A 5EE9A 1Y8PB 2WXQA 3T16A 4CHTB 1OQRA 1IKLA 2JA8B 1UEAB 4XWWA 2XWJB 2WACA 1JORA 2AX5A 2DY8A 3QJYA 4PV1C 3AV8A 1RODA 1FFUA 2HDMA 2PW7A 2E2IB 3D4WA 3OWFA 1YQ3B 1HCZA 2OF1A 1KDAA 3Q8AA 2EYFA 2MP1A 1JWMD 1PLFA 3GTPB 3L9AX 1F2ZA 1FXIA 2A69C 3MHBA 4WIPA 2JSOA 5JVH3 5FOBB 3T53B 2NTSA 4KKUA 5AFWA 2KCNA 2SOBA 5BYQA 1FO4A 2LMCB 2F0EA 3GV3A 1ZXIA 3Q22A 4AQ7A 5ELBA 1A3TA 2G9DA 5M5WB 1LTAD 4K6DA 4R9WA 3NPPA 5T8IA 1H9SB 1A6XA 5C4XB 1JMLA 4HN7A 1NSNS 3PZ8A 1HRJA 5KNDA 2L83A 1GPXA 1YN4A 4CBVA 1Y1VB 4ABNA 4BBRB 3MEHA 4C2MB 1Q3LA 4HSPA 2Y5CA 5EE0A 3MFYA 5IT9L 3HRDD 1SNDA 1T5EA 3S17B 3S2HB 2PVOD 1UNSA 1CQVA 2BS3B 5DAUA 4P2CB 1I4RA 1DZ1A 3AMZA 1JB3A 5LL6S 4WQMA 1EL0A 2D2CC 5M5YB 3HGBA 1HUMA 4DFAA 1BMLC 4IQZA 4OVZA 5HHDG 1ET9A 3ITPA 1XLOA 1V43A 2E75C 3AE8B 3I70A 3P1HA 4OL7A 1GUWA 1Z6HA 1KABA 1STBA 3R3OA 4HCEA 2KQ4X 3VQIA 4ZUIA 1VZ7A 1RCVD 1T5XD 4MH8A 4ZHOA 3SK6A 2KOLA 3M7GA 4PMCA 1SB3C 2INNE 1SYEA 4ARIA 2WU5B 3ND8A 2A6HC 2BCOA 3MZ5A 3L4PA 2XNAC 1NYQA 2R7ZB 1FXAA 1HFGA 1QWYA 3AM9A 5BN3A 3FILB 1C48A 1FM0D 2VB3X 4TKOB 3GTMB 1V8CA 2WV6D 2ONQA 5ELCA 1FNUA 3IFDA 1IGDA 1DCZA 2WXIA 2F3VA 1KTKA 4N9TA 4KMUC 2RSNA 3EA6A 4RWSC 1G291 2TMPA 4ZKBB 4FXGC 5JVG3 3I57A 2F3WA 1QCBD 1W6JA 1N61A 4NKLA 4RKLA 2LS01 2PLPA 4ILWA 3NBHA 4IFDH 1F9RA 2EYMA 4KKSA 2F4IA 1B53A 1ACCA 2AWOA 1JOKA 3NZ3A 3NUHB 4KGRA 1TT2A 2LKVA 3GTJB 4A3KB 4QMGA 4IUPA 4CKEA 4ID6A 2BT6A 3J80L 1SEBD 4R8IA 3JAME 2GB1A 5FR3A 4WORA 1XWEA 1U4MA 2N55A 2ZW0A 3KQ4A 1V1OA 4KY6A 3HOUB 3T56B 1VF5C 1ZXTA 5JPNC 2JSVX 2F03A 3IFTA 1D6EC 2JXMB 2PMVA 2V4DA 1BR9A 2IJ0A 3DMUA 4HRSA 1J9OA 1Q90A 1PZID 2K5QA 1ZDXA 5CR3A 4C3IG 1HTLD 2WP8J 1HHVA 1C4PA 1J7AA 4JWUC 3NVZA 3PUXA 3W9CB 1PGXA 4A3BB 1SFOB 3P20A 1QILA 2O2LD 4JK1C 4MIUA 1IL8A 2A68C 4YWGG 1SNOA 1ZE3D 2AUJD 1VMCA 1D1IA 3J81L 2VZKD 1DOXA 1IW7D 2DBYA 4XWTA 2J4XA 2BDOA 5EPJA 1V8QA 1KF6B 3TUOA 2A68D 3HVZA 2H1EA 5IODA 2PPBC 1VJKA 2XWBB 2E76C 4WH4A 1U9RA 3GTQB 1V1PA 2AQ2B 4OO1G 4HAEA 1C76A 4RF1A 1F9QA 3D31A 1NI3A 2F0DA 1O80A 1SE2A 1QG7A 1TU2B 5BYRA 1M4VA 3M3YB 3FPUB 3EJIA 1D5ZC 3QO2A 2EPBA 3FEWX 1SYBA 1UAPA 4IZ8A 1WWTA 1Q1BA 3DEOA 5EGTA 2KACA 2F0PA 1N63A 1STYA 4X3KA 3NSWA 2NBFA 2IW3A 4MHEA 2M00A 2JYEA 3M4YA 5A2QL 5JEAH 2PKOA 1O78A 4YSXB 4RFBA 2EKIA 1KRHA 2Z4HA 1N60A 3U2SC 4O1NA 3U4EG 1JOOA 4NAMA 3AH7A 2PTLA 1A70A 2SAKA 3SR6A 1CA6A 4FF2A 2QILA 1WTXA 5D7GA 3VYUA 1LTRD 1B1ZA 3VR6A 4KD3A 2EY5A 2EYOA 5JEAG 1TKWB 5BMIA 4WJWA 3RMHA 2YEPF 1C9FA 1Q1EA 4XQJA 3LWEA 3AE4B 3BZDB 1WTRA 1JROA 3VRAB 2L1BA 4TQ0A 2HTME 4L23A 3CU7A 3BS1A 4IFDJ 4ZKCB 1EU4A 2SEBD 1PDQA 3NHHA 2BS4B 2KHSA 2BBCA 1SSOA 3ZGZA 1B2TA 1QJOA 1GOZA 5LL6X 5LHY1 4AS1A 3I73A 3HKZB 1OXVA 2Z4IA 4RA8A 3GTGB 2DNCA 3MP9A 3ZJTA 5G3LF 2IGHA 1XXGA 5H8YE 3S16B 5E4XA 4A3DB 4M1UB 1EWHA 4IKGA 3EUB2 5JXVA 3HOXB 2EJGC 2NWGA 1GUSA 5NUCA 5J22A 1IUEA 3J81E 1Y8NB 3SFEB 2A6ED 1WTWA 1HTPA 2SNSA 3K5OA 1LT5D 1QOFA 1HA6A 4XQNA 4V0BA 1LTBD 1HPCA 4JBWA 3CHBD 1RKNA 1PDXA 2LMCA 4DNTB 4RHRA 1STEA 1L0XB 3A7LA 1LV9A 1EY0A 1YNJC 1RWSA 5JJZA 1VDVA 3QOJA 3ZJVA 3IXSA 3SXHA 1PZKD 1ML0D 1SIJA 2W3SA 5CV8A 3C1EA 3B2FA 4I65A 3Q8EA 4JPSA 1KDCA 1QOHA 3RZDB 3E9SA 2H4OA 2MJEA 2ID0A 1EWCA 2J42A 3URYA 2FMCA 3NS1A 4DXFA 2PIAA 3S1MB 3A56A 5C6AA 1MHHE 4A9AA 5FKAC 3WOFA 3H91A 4RGOS 1L0YB 2KEEA 4KN7C 2F0JA 5C5LA 3H09A 4I7ZC 1KDBA 3C46A 4C3HG 1O7YA 2KQ3A 1PMRA 2K0PA 2JEAI 1QT9A 2KA7A 1BCPD 4UAIA 1YJIA 3UI3A 1I4HA 1QOAA 1PFNA 3PMFA 4NP5A 3BIID 4OIKA 1R4PB 4ZQ3A 1RYJA 5I9PA 1DOIA 3RLFA 2XRQD 1HZ5A 3OMCA 4G4KA 4OZAA 2J0TD 3P1MA 3VYSA 3T51B 3BDCA 3SR1A 1EY4A 2N7JA 3PUVA 1UGJA 2A69D 1JWUD 3IAYA 4FXDA 1SE3A 5CMDA 1GB1A 4QIWB 2L11A 1C4AA 4C3HB 3J9CA 1S5BD 2K3UA 1EFID 2E6XA 1PFMA 1PRTD 4LJZC 1WSPA 1QOGA 1VRAB 2RDFA 1ESRA 1M8AA 1A15A 3W3AA 3NBIA 1OXSC 1ZEQX 3Q8FA 4HJGE 4HEDA 2MEKA 2K9XA 4KKJA 5I6WA 1B50A 1FEHA 4IOIE 2VUMB 1JWAD 3I8ZA 4HTHA 4KV6A 1GUOA 4S3SA 4GDLB 4KGSA 2CVRA 2B63B 4B9WA 1B9NA 3ERQA 1FD7D 4TQUS 4V190 3C1FA 1IYUA 2J52A 2X38A 4XTCS 4ME5A 2PMZB 4RGNA 2JYOA 1D2BA 1K83B 3K7AB 5ELEA 3SK5A 4RGTA 4REZA 2EY1A 4IALA 3AB5A 5M3FB 3Q8CA 1I6VC 3NVVA 3SFDB 1VR9A 3RUZA 5EBCA 4A3JB 2J7ZA 1RJTA 1SJED 2F0OA 3TMEA 5EJWA 2PVGC 2JEBI 3S1NB 1RM6C 1HXYD 4CQNA 4FXCA 3D8GA 1AWDA 3R2IA 2MJDA 2B2VA 2SDFA 3PZ7A 1JQYD 1C4QA 3SEBA 3L3OC 2FMMA 5IGEA 3LXFA 1B9RA 3KK7A 1OQQA 1HQMC 1NEKB 1OXTA 3K5NA 3VR8B 1CZGA 1SBBB 3E6ZX 5G5HA 1E2VA 2NN6G 2K5WA 1YNJD 3HRZC 1YJJA 1S5CD 2NB0A 3MJ5A 5IOCA 4JWSC 1PTOD 1ZOYB 1SDFA 1G8ZD 4N9PA 4ODGA 2BE5C 2KCCA 1ZYRD 4D2KA 2OEDA 3DHQA 2KAJA 3H3VC 2N0SB 2IGDA 4US8A 4X3TA 5HI1A 1DM0B 1V1PB 2LHEA 2RDHA 3TN2A 1JICA 2MPMA 1BO0A 3HG9A 2NVYB 4MM3B 1STNA 1EY5A 1NYRA 3WCQA 3NUCA 3CRKC 4A3FB 3W1SA 2QDBA 4A93B 2JXTA 4WURA 2XIWA 1F77A 2EYHA 4C3JG 2WXNA 2BB5A 4NJCA 5FO9B 1DYQA 2AWNA 2QCPX 2JA6B 2V3PA 2B2YA 1YNNC 2EOTA 4CJ1B 3NRZA 1TS4A 2RA4A 3W2DA 2G9HD 3CIRB 1TKYA 2ICEC 4C56C 1ZDVA 3A8KE 1C8CA 3X3MA 3K5MA 2K5PA 1JR0D 2AUKA 3EQLC 2JX5A 2L0CA 5C4JB 2N88A 3HUIA 3A55A 4BA2I 4ZRPA 4RKBA 4DXGA 3RPFC 2L52A 4KY7A 5DM73 3NXWA 2YU9B 5MPOA 1SYGA 5T1GA 3QB3A 3SVMA 2VZKB 2M0AA 1AFPA 4KY5A 3C8YA 1BF4A 1L4ZB 5C3JB 2GRIA 4QUCA 4YXDB 2B2WA 1PTOB 2K32A 1D4BA 4EE2A 4L6TB 1IW7C 5C3XA 1BDOA 1G6ZA 2EJMA 1DOMA 3OMGA 3MXGA 4XIGS 3QIAA 3HOVB 1KAAA 1A3VA 1IBXA 1ET6A 2BW2A 5KNCA 2FJ2A 3VYRA 3FPPA 1PTOC 2JA5B 5BMHA 2FHTA 1O7ZA 2IL8A 3K5LA 2WXMA 3V3XA 4TQ1A 4YSZB 1IYVA 4GZYC 2AQ3B 1VLBA 5K36H 2HCIA 4X3UA 3GB1A 4DA2A 1PRTF 2K5DA 4ZUJA 1MSHA 2B2TA 1IHZA 2KDMA 2PZWA 5CBAE 2K6AA 1F9SA 1PGBA 1CTMA 1PFBA 3VR4A 2PYKA 2AQ1B 1CK1A 4HKZE 5IGBA 4F8MA 3DUZA 4Q2JA 3NTHA 2RBMA 5D3DA 1FNVA 1AZQA 1VZ6A 2ON8A 2KECA 3D6WA 1E2ZA 5E3FA 4ZHPA 1MI0A 1CFMA 5CC4A 5EE3A 1AP0A 2O5IC 2WS3B 3A8JE 1B3AA 5KYIA 2WU2B 2ICIA 3P42A 3BK1A 4N6EB 1TWGB 2XRSD 4K5WA 5ELFA 3TP6A 4JX1C 4HCSA 1SNQA 1MVKA 5C0XI 1TZOA 1DXMA 2L32A 2ENBA 4XDCA 4LMQD 1I3QB 5CBEE 3AE7B 3QG1A 1LTGD 1AW7A 2PZTA 2F0TA 4G7OC 5C4HA 4CJ0B 1H9JA 3PIP3 2IX3A 3SDZA 1CHQD 2JWUA 3W5VB 1LT4D 4O42A 4C1NI 4OW0A 3AN1A 5DM63 2PNRC 4L1BA 1WTVA 4A3GB 2F0NA 2G1EA 4A8XC 1ENFA 4CKCA 1UWXA 4IUUA 2WKDA 4PMWA 1SE4A 1K8MA 1D1KA 2B2UA 1STGA 4A3EB 5D3IB 2Y5PA 3CWIA 1LT3D 1K50A 1QB5D 2PZUA 1EIGA 3HS0C 3HOZB 1PTOF 5ISRA 1JW9D 1L0VB 2D62A 4X3SA 1G91A 1MI2A 1H9MA 2L12A 3DWGC 1EQVA 3BYTB 1WTQA 1DD2A 5EKKA 4UDUC 2F0WA 3MC0B 3OSOA 4CJ2C 1B9MA 1NAPA 2D5DA 1HZ6A 2YEPB 3KLSX 4H44C 3PO3B 4ZAIA 4DF7A 4KGTA 4FO2A 4RHSA 2W3RA 4H13C 5K5PA 1X3PA 2K03A 2W82A 3J80E 5JAVA 1JE4A 2BA0A 4OO1I 3DM1A 2NZ1D 4FVMA 2F1MA 3BWUD 2CJOA 3HEJA 3EVQA 3MVVA 1RF2D 3PO2B 1NR2A 2D5GA 2EJFC 2EXZA 3DEPA 4KJOA 2F0FA 2Q8IB 5HG2A 3R93A 4EGVA 3TBIB 4G7ZC 1J7BA 3KBGA 1K51A 1DOLA 3IT4B 5CYUA 1XF5L 1ZXHA 4EQPA 2WXLA 4KK7A 2V0GA 3PUZA 4RH6A 2H89B 3OIQA 3BVZA 1DOYA 2O5JC 4J1MA 1OO9B 2VB2X 1RTOA 1B4OA 3I3CA 5JOBA 3DWPA 2NVXB 2WXHA 2LUMA 1KFYB 1Q8IA 2F0KA 4QUFA 1RFKA 2CU3A 2BTEA 1LT6D 2QF7A 4DN4M 2ZXOA 2M19A 2R92B 2PO4A 2B2WC 1ROEA 4CKBA 5BN5A 2Z1CA 2DYOA 1IBXB 1PXUA 2ZW1A 1ENAA 1T6BX 2LFIA 3NVWA 4R3DA 3EROA 1X3QA 2L1AA 3I90A 4DAVA 2E2HB 3E56A 4KKIA 2BE5D 2I46A 2O4XA 1KNEA 3I4NB 4A6QA 4Y7NB 4C1NK 2NYZD 3M4OB 4R8NA 1J8IA 1GJXA 4N59A 1HEZE 2IX1A 1BCPB 2R6GA 4YTNB 3MHZA 2N9LA 4NAWB 1GHKA 1TY0A 1S5DD 1AN8A 2EZVA 1JALA 2H88B 1JQ4A 2WB1B 1YN3A 2DYMA 2NMQA 1EZ6A 3BDLA 4HROA 4Q5VA 1WXQA 3GV6A 5I4DA 1FNWA 2DN8A 3NP8A 2ACZB 3AEDB 3I91A 3N6RA 4WRDA 4BBSB 1MHXA 1TIID 4F87