1KLGD

Crystal structure of hla-dr1/tpi(23-37, thr28-->ile mutant) complexed with staphylococcal enterotoxin c3 variant 3b2 (sec3-3b2)
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
239
structure length
231
Chain Sequence
ESQPDPMPDDLHKSSEFTGTMGNMKYLYDDHYVSATKVKSVDSFFKWDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKGKTCMYGGITKHEGNHFDNGNLQNVLVRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system/toxin
molecule keywords HLA CLASS II HISTOCOMPATIBILITY ANTIGEN, DR ALPHA CHAIN
publication title Minor structural changes in a mutated human melanoma antigen correspond to dramatically enhanced stimulation of a CD4+ tumor-infiltrating lymphocyte line.
pubmed doi rcsb
source organism Homo sapiens
total genus 67
structure length 231
sequence length 239
ec nomenclature
pdb deposition date 2001-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
D PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1klgD01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1klgD02
1PYWD 1LTBD 1CK1A 2NTSA 2XN9C 1LTSD 3BVGA 4K6LA 1I4PA 1LO5D 1LT3D 4RH6A 4L63B 3BYTB 1FGBD 1TS4A 1KLUD 1ET9A 1D5XC 1LLRD 1LT5D 5ELFA 1TY2A 1KTKA 1JR0D 1PRTD 3BVMA 1EU4A 1SXTA 1XXGA 1I4QA 5ELDA 2R61A 1PRTB 1V1PB 1AW7A 1SE4A 3GP7A 1BCPC 3CHBD 5FKAC 1D5MC 1BXTA 1TS2A 3V05A 1S5BD 2XNAC 1JWSD 1I4HA 1JCKB 4RHRA 4TSSA 3W2DA 1FD7D 1M4VA 1TS5A 5ELCA 1LTTD 1YN4A 1YN3A 5ELBA 4C56C 2AQ1B 1V1PA 1JQYD 1BCPF 2SEBD 5D3IB 1LTGD 4NZLB 1ENFA 1LTAD 1EEID 4DXFA 1YN5A 1LTRD 3KLSX 4RGMA 3MC0B 3BYYB 2G9HD 1D5ZC 1CHQD 1CHPD 5ELEA 1ET6A 2J4XA 1FNUA 2RDHA 1PZJD 3URYA 4RGNA 2WV6D 1PTOD 1LT6D 1SE2A 2XRQD 1EFID 3DWQA 1UUPA 1PTOB 5I4DA 1GOZA 1HXYD 1KLGD 1S5ED 1SBBB 1I4XA 1D6EC 3R2IA 5D3DA 4Z9CB 3TSSA 2TSSA 1HTLD 1PRTC 1RDPD 3EA6A 2QILA 1PTOH 1V1OA 1DJRD 3R2TA 1LTID 1I4GA 1HQRD 2IPKD 1S5FD 1G8ZD 1PZKD 1TY0A 1S5CD 4UDUC 2RDGA 1PTOC 1EU3A 1S5DD 1T5XD 3O13A 3EFXD 1PRTF 2XRSD 1EWCA 5FK9C 3R8BA 3DWPA 4RFBA 4BWGB 1ESFA 1STEA 4L6TB 1SE3A 1RD9D 1FNVA 2O2LD 1B44D 2Z8LA 1JWMD 1PTOF 3BZDB 3MFGA 2AQ3B 5TSSA 1CT1D 1FNWA 1F77A 2ICIA 4RGTA 1SEBD 1SJHD 1EEFD 2NTTA 1L0YB 1TS3A 4RGOS 1B1ZA 3SEBA 2IJ0A 1MD2D 1QILA 1RCVD 1LT4D 1RF2D 4ZYSA 4RHSA 1CQVA 1SJED 1UNSA 1L0XB 1AN8A 2CHBD 1JWUD 2QEJC 2AQ2B 3OWEB 4RCOA 1PZID 1DYQA 3BVZA 4DXGA 1BCPD 4OHJA 1XTCD 1HA5A 4O1NA 1I4RA 3DWAA 1BCPB
chains in the Genus database with same CATH superfamily
3N3KB 4LFBQ 1L6UA 3K5LA 2KANA 1IBLQ 3HIZA 1VD2A 1K53A 4X3UA 2H4OA 5CBAE 5I2XA 3S17H 1WFYA 3FILB 2I5MX 2EELA 4YTPB 3R93A 4PS7A 4PZ7A 5KYLA 4CDFC 1GB1A 2CHZA 4LAAA 3RLFA 1PH7A 3HOYB 4KKSA 3V3XA 4JQWC 3FKYA 1FCCC 1SIJA 3PTFC 1MG4A 4J3OD 4MSQB 4DK1A 1MPEA 3N30A 1OTCA 2E2HH 1CI3M 4KI0A 4ABNA 4ANXA 1J7BA 1D5MC 2ZTDA 1M8AA 1TS2A 3TZDA 5DM63 5GAHC 1Q82C 1PH5A 1ZEQX 4A3GH 1JWBD 4W9HA 3HOZH 3NVYA 4OIJA 3HOVB 2L05A 3FILA 2L9HA 4G7OC 1P7EA 3ULLA 4JYAL 1LM8B 3AE2B 4NY0A 1NAPA 3NBIA 1S40A 1M4VA 1SF0A 4B08A 1TS5A 1BQQT 3OW2A 4ZLTF 2DYBA 3NVWA 2E74C 1ZXTA 2B2UA 4OWTB 1HH2P 2MCNB 1WJUA 1STAA 2K5WA 2IY0B 2QDFA 2YTYA 3L9AX 1FXIA 2JXMB 1B8AA 1SMYD 3NBHB 1TR5A 2N49A 3UI3A 1TZ1A 5I6YA 4LNIA 3L3OC 2AMCB 2N7DA 2GBKA 2B2TC 3RZDB 5JJZA 2MX2A 2CU1A 1OEYJ 2GA4B 2LVOA 1A15A 2IWHA 3W5VB 1KDBA 4EKUA 1KNEA 1G6ZA 1L7YA 4Y7NH 1E8WA 1Q1BA 2JEAI 3NBHA 2KX0A 1D4BA 4K5WA 4NXNL 1HZ5A 3E5SA 4TRDA 2PW9A 1YBYA 5IIFA 1WTXA 4MT5A 2KC1A 4XWTA 2LWPA 2IGGA 3BDCA 5FR3A 1OXVA 1P98A 1ISNA 2AL6A 1YZ6A 4YL8A 4C3IB 5IYDH 2CKHB 2A6HC 2RPQA 4M8AA 5EGTA 4BBNC 2HQLA 2M56B 5IP7H 3VR9B 4WWMA 4ZQ3A 1RHPA 2A4ZA 2X8XX 5KNBA 2FXQA 3MXNB 3J9CA 4ME5A 1GM5A 2ZCCA 5AEKB 3W1GA 4DQOC 2QA4A 3CSFA 1CKMA 2ZXRA 4JG2A 3IAYA 4DUZL 2DGYA 4C1NI 3ZO5B 4NXML 5GROA 2AWOA 4V190 1DZ1A 3KK7A 4L2YA 2ACZB 2JYEA 1Q8KA 1GUGA 1XMOQ 2KWVB 2C7MB 1SE3A 4MELA 4BBNF 2R93G 2Q2IA 3MFGA 2E2JH 1I3QB 3LYYA 1HZAA 2EYPA 1SEBD 4LLGM 3MXNA 4OO1G 4A3EB 3KLWA 2B63H 1S1QB 4B3TQ 5HURA 2MBEA 1LABA 4RA8A 2DAJA 4WFN3 2N1WA 3MTNB 2DYOA 3QX1A 1PHJA 3J7AV 4DAYB 1S4ZA 1VQ4A 1OO9B 2K04A 5C0XI 2YLMA 4AS1A 2CWPA 3GTMB 4MZ9A 3MZ5A 2K5DA 1V9JA 2REXA 3NOBA 2KK8A 2IO2B 5HGQA 4FXDA 2C9WB 3DBLB 3P4QB 3FRPB 4W9DA 3RCZA 4KZCA 1X3QA 2M8SA 3PZ7A 1QZHA 3BVGA 1NSNS 2N1VA 4RH6A 4REZA 4US9A 1NUCA 4DAYA 1IBKL 3U9OA 2JXTA 1LLRD 1Y8NB 4HCSA 2E5LL 4LFCL 3CCSA 4EVOA 2GI9A 3CIRB 4OVUA 1F1HA 4KN7C 3T56B 2B2TA 4K2LA 1XXGA 4CDDC 4CJ2C 2PMZE 2NBUA 4YIJA 2IX0A 3B9JA 3IAM1 3H0GB 2WXHA 4URKA 4HRSA 2K3UA 4DF7A 4W9CA 3KYCD 2ZXPA 2BBCA 4BBRH 1WD0A 2OJRA 1CA5A 3S1QB 4ZRKA 1R4NI 2EYLA 4IOIE 5DPSA 2EY5A 2LGDA 5FO7B 1F2RI 2YV5A 1W2BA 3V6EB 2CHWA 3BK1A 4WAAA 4R4IA 1WYGA 3OIPA 3MA2B 2AUJD 1VQDA 4KSKC 2TMPA 3VQIA 1HTOA 2KWUB 1XNRQ 1VQAA 2KC2A 1MSHA 1LTGD 1A0IA 3UDXA 4CHTB 1A3UA 4OZBA 3MC0B 4HCNB 3EBEA 1V5TA 5C4HA 2KNBA 2HT1A 2KQ4X 1D5ZC 4LTUA 1WGRA 2ZM6Q 4A3FG 4PYZA 2J4XA 4FDBA 3SXHA 3HOWH 1TWFH 2J42A 3I5JC 1TTNA 1RWSA 1MKHA 1CM9A 1RKNA 4ILWA 3K9PB 3L10B 3B2GA 5C3JB 3QAQA 1JE4A 2F0WA 1EL0A 1D6EC 2E76C 1IPGA 5I9PA 3RNEC 2ZTEA 1VQ8A 2KFJA 3ULJA 1XLOA 4W9KA 4C1NK 4DNRB 2N7JA 2V4DA 5F2DA 1E0ZA 2E3TA 3RLNA 5AJ3L 4A3BG 2WB1G 2F3WA 1K28A 1HNWQ 4KHPQ 1V9PA 5AUIA 4HJKA 2KECA 3I63C 3CWIA 2NBFA 1EY8A 2OXPA 2PVGC 2IGDA 5C23A 1EU3A 1JE5A 3BU2A 3HRDD 3MC8A 4FJVB 3M4PA 1UBQA 1VQOA 4XQNA 3P42A 1OXTA 2F0LA 3IXSA 4HKZE 1DXMA 4FHKA 3U8ZA 4GDKB 5C4XH 2AL3A 5EKLA 5FK9C 2FINB 3MTSA 1Z47A 5CR3A 1TT5B 2D3CA 2F0MA 1B9RA 1VCBA 4OZAA 1FNVA 2X38A 1E7VA 1JORA 3B0AA 2AQ3B 1FNWA 4UP7A 3CMMB 1U4PA 1X55A 1N62A 4IUNA 2NTTA 2FFKB 3A74A 4R9WA 1L0YB 5HY6A 2Y5CA 2KVMA 3A4SC 2K22A 4QL5A 2BOSA 2WX0A 1K3RA 2VQEQ 3L54A 2ZTCA 5CV9A 4GDKA 3U7DA 2WFWA 4LUZA 3SGIA 2V4IB 2PI2A 5CC4A 3GQBA 1DD2A 4M02A 3OWFA 2Q8IB 4DUYL 3G6EA 2WDRB 1U5KA 1XTCD 4O1NA 3A54A 5DPTA 4KKUA 2EYJA 1FVIA 4A3KG 3QQ8B 4C3HG 3SR1A 3HOVH 2GRIA 3N1XC 3DHQA 4B0EA 3L08A 1A63A 1V1QA 2BB6A 3OAWA 2VL6A 4A3DB 1U4AA 3DHHC 4ZRPA 1J0GA 2GBRA 4DR6L 1KD1C 2WB1E 3C3LA 5IGCA 4OGQC 1UE6A 3AEGB 2KQ7A 1X6OA 1I4QA 1WYWB 2AHOB 5IGFA 5IAAC 1HA6A 4IM2A 4O0AA 4NAWB 4DR7L 1PH4A 5GQOA 4WJOA 3RZDH 2XWBB 2K1FA 1IXRA 2JA9A 3I90A 4LF5L 5M3FH 2K8CA 4XDCA 3RLOA 3S15B 1EWHA 1SN8A 5D65A 1SB3C 2L76A 4C56C 1HTPA 1XMQQ 1JWAD 1FCLA 2KYWA 1WX9A 2PNHA 2ZT9C 1Q86C 3ZNZB 1BMLC 4NAWA 3GOEA 4HPLB 1J7AA 4IM3A 4JV5L 3DBRB 1EIFA 4TVAB 4HROA 3A8KE 1Z5SB 1STYA 2WXGA 2MFIA 4CO7A 1WOCA 4PZ6A 2MNAA 3DLLA 3FDTA 1LGRA 4OVVA 4K3CA 4TUUA 2R7ZG 4EX5A 1L0VB 1WMHB 3F2UA 2B2VC 2F0GA 2K25A 4KGRA 1H4RA 2JU6X 1V8QA 5G5GA 3IL8A 2HDLA 3WAMA 2XRQD 2QCZA 5IN7A 2JX5A 1Q90A 1N5WA 2Q5WD 1N9WA 4M1UB 3EROA 2QHOA 2XEWA 2WU2B 1SBBB 3VR8B 1JB3A 1J5EL 2M0AA 2F0EA 3CRKC 1VDVA 3GDEA 1J8IA 3BG3A 2PE9A 1PTOH 1V1OA 2HDEA 1WMHA 3A9JB 1R4PB 3QCAA 2DZMA 1I3QH 2CS4A 4KD4A 3G71A 4AWJA 1G8ZD 4BBSB 1IYVA 2MJDA 1S5CD 3PSIA 3VRBB 4C2MB 3FMCA 2JZZA 4A3EH 1RL2A 4ZRZA 3Q6BA 1MIUA 2UWQA 4IPDA 1OQRA 4X6AH 4LNNA 3G4SA 3I72A 4XGAB 1Q5WB 3A9JA 2L0TA 1L4ZB 3GTMH 4RAUC 3HM6X 5LMNL 3GV3A 4QY7A 4RF0A 1VQIA 1EFWA 3TP5A 2W3SA 3WIMA 3C1FA 3DBLI 1N36Q 1MHHE 4LFAL 3JYUA 1AEXA 1UWMA 1YHAA 1I94L 5J2RA 3ND8A 2KD0A 1SLJA 4X64Q 3PO2G 4ZYSA 3AU4A 1G2SA 2HTHA 4E6IA 2EXDA 4JVZA 1YQ3B 2LUEA 5E6PA 1SGHA 3WALA 2OWOA 2JK8A 2F0KA 1WD1A 1KH0A 5M5XB 1WTOA 3CD6A 3BVZA 3IT4B 1SYBA 4KZ0A 2F0HA 5HI1A 1YITA 5LNK1 1HTQA 2KHIA 1LQBA 1MVKA 4DA2A 2FJ2A 4LF7Q 3OW7A 1PDQA 3IG3A 2J0MA 1IGDA 4N8X1 3S1QH 2M9VA 4K6LA 4W9LA 4KKTA 2O2VB 1NYRA 1GHKA 2B2WC 4ZYNA 3RUZA 4PT5A 3PVLA 1KNAA 2OJWA 2QSDA 4HMJA 4IFDG 1JW9D 1KM7A 4HLEA 1I5FA 4DR2Q 1SRUA 2EYOA 3CHBD 5CX3A 1Q8IA 4F87A 4TKOB 3M95A 4FNFA 2EPBA 3RD4A 2O2VA 3K6OA 1V81A 1XJVA 1TKEA 2X69A 3TP8A 4FF3A 3AQQA 3D0FA 4JOIA 1FD7D 1QZEA 1FJGQ 3E56A 4GU2A 3CC4A 4QGUA 3E9SA 4IFDI 4HMIA 4XYOA 3KWLA 2IO0B 3TL5A 4LW1A 3BK2A 1F9QA 2EE1A 2KOLA 4DR4Q 3PO0A 3TIXA 4A3LG 2NVUI 4YY3Q 4LJOB 5IYCH 1WWTA 5D3IB 1HHVA 1GKHA 4WH4A 1PH6A 4GKJL 5BR8Q 1GJZA 5L37A 3GTKB 2R3ZA 2JXXA 5CTRC 4X62Q 4P71A 1QT9A 4Y52H 5BYRA 2H1EA 5EJWA 3PO3B 1FNUA 3K5OA 3VR6A 2GB1A 1EOVA 2RMMA 1B50A 4XYQA 5EBCA 1QOGA 1BKBA 1RLFA 3P20A 5IP9G 1DOXA 4QUFA 3ZNHB 4C00A 4KKIA 1KABA 1FD6A 1CMXB 3PIOA 1GO3E 4DAPA 4LDTB 3UIPB 1IW7C 1D1IA 1WYDA 2UUAL 4FA6A 2DLBA 4ANUA 3TUOA 1ML0D 3HGBA 3NS1A 2N9XA 4JIOU 3ERSX 3K5MA 3W1YA 3Q14C 1FRDA 3M3YB 3H9DA 2R7FA 3ONSA 3I4OA 2L0CA 2NN6H 4JI5L 3NTHA 4AQYQ 3GE3C 2XVSA 2ZJRA 1JALA 2G3QB 1YD8U 2HHHQ 2NN6I 2LGSA 3P1MA 4LNFA 3CMEA 4IW0A 1WJ4A 4QQBX 5CV5A 3VR2A 2JT4B 4A3IG 1XX8A 4FXKC 1EWCA 1X3PA 4LF8Q 2WNMA 5BN4A 2KEEA 3G48A 1XYIA 3HOUH 5GADC 3QWZB 2MBHA 1ESFA 2NVQB 3PV1A 2NVYB 3Q8FA 3U7ZA 1IKLA 1CZGA 1VQHA 2F0DA 4LWCA 1K3BC 2DJGC 1JJ2A 3IHPC 5LMUL 3DWMA 4FLHA 2CHXA 1MI0A 5J1ZA 2WP9B 3DXJC 3SEBA 2IJ0A 3D8GA 4A3DH 1SDFA 3T1HQ 1LT4D 1JOKA 2VH1A 1T0QC 1SNCA 1WXMA 1N34Q 2C7HA 3DVNV 4DAMA 4P74A 1P3QU 4A20A 1EYDA 5EQ0A 4K6DA 2FCSA 4YTNB 4I7ZC 1R7SA 3APCA 3J80L 3NJTA 4MGKE 2CH4W 1QZGA 4B3SQ 3X23A 3ZTCA 1E9MA 1NNXA 5JPMC 1YI2A 2NZHA 3B1LX 5EKKA 1K9MC 2K52A 3Q23A 4ALPA 1CK1A 3A0JA 2KVRA 4LF6Q 2DZJA 3RNGC 1LO5D 4HN7A 4OWWB 4IUPA 1YVCA 4NJ6A 1CA6A 4DGZA 4RKBA 1AYFA 3AI5A 3S15H 3QC8B 3RYTA 1EQTA 3AE4B 2N3SA 5KRUA 4LF4L 2GVAA 1H9KA 1WTVA 3FPPA 1A70A 1PGAA 1BF4A 1C77A 2IX1A 2MRPA 2WHIA 5BYSA 3HS0C 2XK5B 3DBRI 1YNJD 1VDZA 3H3VI 3HKZG 3W2DA 1PVOA 1CZWA 4B3ML 4HPPA 3S24A 5D94A 2PO4A 1FRRA 2LHEA 5ELCA 2H5XA 3NRZA 2ZVOA 1JRUA 4LMQD 1H9RA 1E1OA 4IUUA 2FCQA 3HP3A 4DR1L 3R7QA 1E3PA 2ZNVB 1X65A 3VYRA 2MBOA 2SOBA 4RCNA 5C4ZA 4YCVA 5HGTA 1STNA 3S14B 4C3JG 2XK5A 3AYHB 1G6PA 5E3FA 2GBMA 2PPHA 3ZDMC 2R93B 3PIP3 1BUIC 1XTDA 4DXFA 3NG0A 2LEKA 3HUIA 1Q0WB 1YX5B 3OLMD 2QC8A 1SFOB 3A5ZB 1NBFC 4PV1C 2A6HD 1IBXB 1B3QA 2PZTA 4LF9L 4MJSB 4HDOA 5E1FA 2K50A 4NPSA 3MXUA 4J8QA 4P75A 4C2MH 5IWAL 2JWUA 2IO3B 4ANVA 1PXUA 2VZAA 4DV4Q 4J6HA 1V97A 2K8BA 2BE5D 1UF0A 5I4DA 3BWUD 3NZSA 3ENEA 4APVA 4KD3A 5D3DA 3LWUA 4JLCA 3AEAB 4IZ8A 1EY4A 2QILA 3R2TA 3AU5A 4ZHOA 1YJJA 1QOAA 4MJSA 1PQSA 5M5WB 1XEEA 1GC6A 3F2DA 5K36G 4AYBG 3WWVA 1SYDA 4JI6L 4MACA 3DVGX 2L4NA 2ZJPA 3D4WA 4A8XC 4BY7H 1QCBD 2JWZA 3E9HA 1CQFA 2JA6H 1AE2A 3MHSD 2FMCA 2D07B 2K5NA 4OX9L 3CCLA 3RMKC 5BMGA 3S2HB 5M5XH 3Q2AC 5EE3A 3L0WB 4EQOA 1LXDA 5I6WA 1D1KA 2KVZA 2Y0SE 4L6TB 1X1MA 4R8IA 1PFSA 1T9HA 1TWHB 2UXBQ 1B2TA 1V80A 1WRDB 1NR2A 3RMHA 1V8CA 3AU7A 4JX1C 2HIXA 2IL8A 1YJ9A 2CCZA 4P16A 3D31A 4JW0A 2KQSA 1C7YA 3AM9A 5AZFA 3ND9A 4YTMB 1SJED 4UP8A 4OL7A 4JBMA 2LHDA 4K81A 4F88A 2E75C 3Q8DA 2WXNA 4KGSA 2EVBA 4MM3B 2L52A 3Q8EA 1GG3A 3A56A 3IAS1 4RG1A 3J7AF 2R92G 4BOZB 2QCPX 3HEJA 1TXYA 1QVCA 4A3FB 4X66Q 4NB3A 3C19A 4U68A 2KN4A 1PDXA 2RD0A 4W9FA 2RCFA 2A6ED 3SK5A 2MJ3A 2JQOA 2WQYB 1C4QA 2V1CC 2J7ZA 3TMPB 2LFNA 1FEHA 3J81j 3KW5B 2JP1A 2WS3B 4S0RA 2HIVA 4MM3A 2YEPF 2OQKA 4WJ3M 2KX3A 3L4PA 2N9KA 3E6ZX 1SNMA 2RDFA 4JI4Q 3U4ZA 1HCZA 3S1NB 4A3BB 2WB1B 2XNAC 3DHGC 2N7EA 1I4HA 3GTKH 3DCGA 3ZLZA 1HNXQ 2Q8RE 1SAPA 2Z1CA 5CGKA 5IOCA 2LSSA 3MJ5A 3H7SA 1EWIA 5LXHA 4FF1A 2MPMA 3PO3H 3C2PA 3I3TB 1PGXA 3RZWC 1CSPA 4A3JG 1GXDC 2QJLA 4FN2A 4JBKA 2AQ1B 1NVID 5IO9A 3KF6B 4CGYB 4E74A 1X54A 3NEMA 2F4IA 1GNUA 2BQQA 2Z59B 4K0KQ 1YEZA 5BN5A 5AZHA 5IOIA 2MUYA 4BKSD 1Y1VG 4ARIA 1TKWB 2F1MA 3W1SC 1MI2A 3EUB2 4W9IA 3PUZA 4L5QA 2LZ6A 3C0RB 2K5QA 3QIAA 3EJIA 1YHQA 1WX8A 3KF6A 3A55A 3R66C 4H02A 4QUCA 1YIJA 2JF5A 1FL0A 2E2IB 2I5LX 2W9NA 3HOXG 2VNUD 1S5ED 3MWYW 1R9TB 1TWAH 4DK3C 3APFA 4ZRIA 4Q0FA 4A3MG 1OEYA 2INNE 3DOWA 4RWSC 2B2YC 4A3KB 3GV6A 2YU9H 3FP9A 4JI2L 1C79A 2HJ8A 1FGUA 4C3HB 1J6QA 3HM3A 2NVQH 3I57A 2NVYH 1Z6HA 5JAVA 2FUHB 1P16A 1TWGH 3HZXA 2M17A 2SAKA 3AE3B 3MHZA 1UE7A 3D4DA 4OONA 4B3TL 1LFDA 4PMCA 3C8YA 3W5UB 5BN3A 1UWXA 3PUYA 1PZKD 1TY0A 4ZKCB 1SSNA 2L12A 1YNJC 1XD3B 1PTOC 5LL6S 1PV4A 4B9XA 1WXSA 3DWGC 1V43A 4HK2A 1XPRA 1SNQA 2JA8G 4N6EB 3KFUA 1BDOA 1KRSA 3ICEA 2Q8TA 1ENAA 2WIIB 1XNQQ 2KQ3A 3E3XA 1IUEA 5KNCA 3DWPA 3PHXB 3PRZA 2LS01 2WAQG 3I3CA 2V4LA 3LWEA 2KDMA 1NMGA 3TBIB 3OG5A 3BJUA 4FJYA 1PTOF 4R1JA 1HNZL 2UUCQ 4AJYB 3T1YQ 3KVFB 1JT8A 2ASBA 2VQFL 1VMPA 4F1SA 3N1ZC 3NS8A 2GVBA 2D9UA 1EQRA 1AWDA 3M4YA 3H8HA 4OXPA 2OCEA 1RF2D 1CUKA 3OMGA 3RN2A 3M63B 4ARCA 1CQVA 1UE1A 1L0XB 2CHBD 4HCEA 4L8JA 2QEJC 4ZHPA 1PUTA 3CU7A 4QF4A 1PZID 2N78A 2LY7A 1PH1A 2BE5C 3H6MA 3VYUA 3AV8A 3UINB 4GN3B 2YYZA 2R7ZB 2MO0A 1YNTE 3DM1A 3SDZA 1QWYA 1BT0A 5A35A 5IP7G 3M9BA 2GBNA 2Z6KC 3LB8C 1LTSD 4LJZC 4J15A 3UGBB 1VF7A 5M5YH 1TVXA 2ZPYA 1SE9A 3F8TA 3T4AC 1XLPA 1E1TA 4HWIB 3S2AA 4RM9A 3WANA 3W1SA 3CCVA 1J9OA 4K1RB 4U673 5C0XH 1PH9A 5FKAC 2R93H 2J53A 1ZE3D 2ZJQA 3OPOA 4S3SA 1I7HA 2PE6B 2WXMA 1I6HB 3VR4A 4A3PA 3TQYA 2B8FA 2LGIA 2G1EA 1WCMG 4MGZE 2K01A 1SFOH 2I46A 2O6VD 2Q2TA 1JB7A 4JWUC 2WAQE 4OO1I 1FFVA 2OT2A 1QOBA 3U58A 2F0OA 5ELBA 5D2MB 3KYHC 1PH8A 2E8GA 4CKCA 1ICWA 2KJRA 2K0PA 3I4LA 3B6YA 2SEBD 5FR6A 3U9SA 2UUBL 3KJPA 1FIQA 4UY8C 3J80E 1HNWL 3PQIA 1Y69U 3UQBA 3GD7A 3W1BA 2G9HD 2V3NA 3HHMA 1AZQA 1UGMA 3PRMB 5M5WH 1SIFA 4KV2A 2BKFA 5C2TB 3AXCA 3PO2B 1YMHE 2D11A 2C5LC 5D6JB 4EZKA 3AECB 1YQBA 2L0FA 2K28A 3KF8B 4H44C 4NXNQ 1EFID 1NTGA 1VQEA 2KEDA 2BCOA 2F0PA 2V3PA 3VTVA 2WXRA 2A6EC 2DJFC 2KHJA 4WWOA 1Q1OA 1I4XA 3P2BA 3ULPA 3S2HH 4UPAA 4B6WA 4E3CA 4JI8L 5K5PA 2WP8J 3KUZA 4A9AA 3CCMA 2IPKD 1N33L 5C5LA 1WJNA 3KF8A 1MHXA 1WIAA 4UDUC 2R2QA 3BS1A 3VDZA 3KLSA 3EVQA 3I4MG 3UF8A 4WWPA 2UXCL 3CMAA 3BDLA 1F9PA 2F0QA 4JI1L 4DUZQ 1D2BA 1MG8A 4NXMQ 2KKCA 2Z0SA 2DNEA 2F03A 2BYEA 2ES2A 4KJNA 4AQ7A 2PW7A 4F7ZA 1FFUA 5HG2A 3EC8A 1B44D 3BZDB 1ZKHA 4A3FH 2BVCA 1K8AC 3VUWA 4DK6C 4BFRA 1T0SC 1E5WA 1WTWA 4LJPB 3L13A 3D3RA 3N1YC 1VQBA 2CW0C 2MQJA 4LNOA 1AP0A 1V5OA 2RR9A 3VUXA 3J80c 1XWEA 2PIAA 4BXXH 4DR3L 3J80i 1WF9A 3WAOA 1VJKA 2JA7H 4JWSC 1JOOA 3PLUA 3NZUA 3J7A5 4US8A 5KNDA 3ZYYX 1GUTA 2M00A 2NZ1D 3S1NH 1CSQA 3UDGA 1WXAA 3FC4A 3PSEB 5JZEB 1Y1WG 3BIID 4DNIA 3VRAB 1PMRA 3ZJYC 3P63A 1IBKQ 3BYTB 2KTRB 4P73A 2OHFA 1TS4A 1KLUD 2E5LQ 2UU9Q 2CR5A 1EY5A 4LFCQ 3RNCC 1XO3A 2OQ0A 4IDIA 1JR0D 1TU2B 3RFZB 1K8OA 3NE5B 4JL9A 1LV9A 4XT1B 1SE4A 3GP7A 4KVGB 4F8CB 1BXTA 2IBIB 2CQAA 2VB3X 3HOYH 2WGSA 1A5RA 4QIWE 2EQSA 4P7IA 2KTRA 2WXQA 3E0EA 1F52A 1EY0A 3OIQA 3FAHA 1JRPA 1WX7A 2KDBA 4GSWA 3ZUNA 5H92C 4R4QA 3GTGB 2F52A 1GUNA 2NYZD 1YOVB 2WDVB 4A3IB 1YJWA 4XC2A 2Z0EB 2VZKD 4O2DA 3S9WA 4N9TA 1QUQB 5IYBH 2BWES 1JC7A 1IW7D 3A8IE 3NTKA 1FPYA 1O80A 3SK4A 4I7AA 5CMDA 5KYIA 4KSLC 2LFIA 4A3KH 4IPHA 1K8GA 4OVZA 5IA7A 5IE8A 4C3HH 2O5JC 1WXQA 2MP2B 1XPUA 1RJTA 4YWMA 4DV6L 1G91A 1MBYA 1CHPD 3PV0A 2IO1B 2FCMA 3RD2A 2KZRA 3H15A 4DV0L 1Y8PB 1HRJA 2F4VL 2FNJB 3WOEA 4KV6A 5EKIA 3S2DB 1QUQA 1SE2A 1SNPA 2KHSA 1VQFA 4TQ1A 4OW0A 4GS3A 2VY3A 4DHZE 3MEFA 4IUQA 1KRHA 2Q2HA 4GNXC 1M1KC 1GOZA 1C78A 1KLGD 2BDOA 5DLQE 1CJEA 1HR0L 2BA0A 3EIVA 2INPE 3NP8A 1DCZA 1VMCA 1ZW7A 2MP2A 1ESRA 3SK6A 2L00B 1YX6B 1RDPD 1O7ZA 2WXKA 1D8LA 4QAYA 3L2PA 3DMUA 5JJKA 5AJ3Q 5BYQA 4EGVA 1ZKOA 5M3FG 1GC7A 2C60A 2CJOA 1QNKA 1IL8A 4XE0A 5KEEA 1SROA 2PZUA 2IY5B 2NVXB 1VS0A 4M01A 5JVG3 4C3IH 1X32A 3FKIG 4B9WA 1T3QA 1VQNA 3M3JA 4BKTA 5KIXA 2RHSB 3Q8BA 4X3KA 1G51A 3AMUA 2BKRB 3R8BA 4HJ8A 1VZ7A 1L2NA 1SYCA 1I50B 4IPGA 4MNOA 4MTNA 4JI3L 1VQPA 2FE8A 2R2OA 3HKZB 3MFYA 3SDLC 2PCFB 2R7ZH 3V60A 3GZNB 2ZEQA 2CQOA 1TWCB 2K6DB 4A55A 1U4LA 2EIFA 1Q7YC 5M3MG 5DEHA 5J17A 1HZBA 1A2UA 1RCVD 4KKJA 4UP9A 5BMIA 4HEDA 4ME3A 1AN8A 4C3JB 1P8LA 4PMBA 1T6BX 2EDGA 2P5ZX 4DUYQ 5G5HA 5HHDG 1BVSA 2R6GA 4KY7A 2K39A 3U52E 4HAEA 3H09A 4K5VA 2IX3A 5LMNW 2K33A 1JMCA 4MHEA 1FJGL 1RFKA 2DAFA 1I6HH 2VUMG 1Y8OB 3P4RB 2KHWB 4K3BA 1FO4A 3JAML 3JSVB 1LT3D 3AULA 5C6AA 4X65L 1E22A 1PFMA 1ZUD2 2E6XA 2KWCA 4DR4L 2M4NA 4MGYE 2Q2UA 2RSUA 5CV7A 2K6QA 3I7FA 3TRZA 5ELFA 1R4QB 1EYCA 1PFBA 3L7ZC 3KLRA 1STGA 2LUMA 3AE8B 1TT2A 3A5UA 2A5UA 2JN4A 2BT6A 4YSYB 3K7AB 4QCLA 1BCPC 1SSOA 2YTXA 3J7YW 2HJ1A 3CCRA 4K5XA 4DR7Q 4EZJA 5MPOA 2A1AA 1E10A 3JSVA 1JMLA 4DV5L 2L1AA 1X9NA 1KOTA 2KMMA 4RHRA 3K57A 2D2QA 4EOYA 4AYBB 2K03A 3LX0A 3H0GH 4L5TA 5EPKA 4LF5Q 2LXKA 4GGQA 2RCNA 1NCVA 1K8MA 4ODGA 2H89B 4IJHA 2H88B 3KH0A 4IG7B 2Z9HA 2A5HA 1BCPF 1WTRA 2KBNA 4NDXA 4RMAA 3TDQA 1KQSA 4KY5A 4JV5Q 2J0KA 2L7RA 1PH3A 1IYFA 5IP4D 2DYMA 2UU7A 2FIFA 1WE7A 1C4CA 5DM73 1EM7A 2W82A 1PH2A 2BA1A 1DONA 3M4OB 2WXPA 2WDQB 2NWGA 4UAIA 2RDHA 2B2VA 3R3MA 1EY7A 3RR5A 4MDKE 4GN5A 1H9SB 4LF8L 1XCTL 2QDBA 2K4KA 4IFDH 2B76B 4GN1A 3ZXRA 4YHHL 3T51B 3AN1A 1N8RC 4LK0M 1R4MB 1J5EQ 1L4DB 4XYCA 3OYYA 1H9JA 2N4FA 3DQVA 3NHHA 2ZW1A 2R92B 5DAUA 3EFUA 4WQMA 4KMUC 3STBC 1MGSA 1Q10A 4A93G 4JPSA 3NXWA 1F9RA 3SE0A 2C35B 3G7LA 4JI0L 4LCDE 4XDXA 4DV3L 1H9SA 3QO2A 2KAJA 5IT9L 3DM3A 1L1OC 1ILPA 4FHJA 4XXEA 2JZ3B 4C80A 2PQEA 3WOFA 1E0BA 1WGKA 1S5DD 4B3RL 2MGSA 2N8NA 2F0VA 5FO8B 4FO2A 3O13A 3HKSA 4NW2A 5IYCG 4A3LH 2I2YA 2V1YA 3OHXC 4KTAA 5NUCA 2K5PA 3GB1A 2BW2A 4IWOA 4HJ7A 2GBJA 2QEXA 2IZVB 1SYFA 1C4AA 1OXUA 1QOHA 1XQQA 2XBBC 4MSMB 3F2BA 4LF6L 2EY1A 5G3LF 2O2LD 3ZVVA 1J8CA 3SHQA 1F77A 2GMIC 1NE3A 5A2QL 1WRIA 4X57B 1VQLA 4A3JB 1N32Q 1I94Q 3AE7B 5IP9H 1PFNA 4GOPC 2DZKA 2RGFA 2YVCA 3VAWA 1Z7TA 3RI7C 1UNSA 1M90C 2OTJA 4FP5D 3QJZA 4YWGG 4GZYC 1Y1VB 1E7UA 2HCCA 1S3OA 3DPDA 3VXWA 3IKJA 3A4RA 4R4TA 5C44G 1YIWA 4DXGA 3AH7A 4W9JA 2MLBA 4USAA 1A8VA 1I6VC 2JE6I 2Z6BA 3QWNA 4IUTA 2FBWB 5IGBA 4AP4C 2LI5A 1DGSA 1YNND 1WXVA 2QKIC 2D3BA 4WQOB 2IYDB 3PPAA 2LXAA 1EQQA 2B2WA 4H2AA 3HOXB 1ZGUB 3GTGH 4ZCKA 1PGBA 3M85A 4ICVA 1QB5D 1TKGA 3RUIB 1O78A 5FLMH 1SXTA 1GD7A 1PYBA 4A3MB 3HOUG 1WGDA 1RYJA 2UXDL 3OTOQ 5FLXL 1V1PB 3Q3FA 5EDSA 1YJ1A 1OQYA 3KUPA 1IKMA 4FXCA 2LD9A 4IN3A 2EYMA 1KHIA 3Q3OC 3A7AB 1JCKB 1VCIA 1TYGB 3KUCB 4LNKA 3P4PB 3EECA 4DR5L 4DV1L 5E7NA 1IBML 3ERQA 3M7NA 2JA8B 2K8HA 3S2DH 3L17A 4KX6B 3Q24A 1KXLA 1V1PA 5CHFA 1DGJA 2O5IC 2UYZB 4XT3B 1NBWA 2I38A 2KN5A 4HEA1 5E6OA 5E4WC 2WAQB 1WSPA 1WTHA 2VZKB 2KTFA 4A6QA 2M0XA 2Z4IA 1DOMA 1EEID 2ZPNA 4ZDVA 3CAMA 4YCWA 1DOLA 4Y7NB 2JVCA 2KA7A 2G5DA 1XF5L 4XDDA 5IKCM 1C0AA 2PI2E 3QARA 3ER0A 3H3VH 1UE5A 5I2YA 1B4OA 1K83B 3GTJB 4IPCA 1FXTB 1PTOD 4FVMA 2NVXH 1NDDA 1WM3A 4N58A 5L83A 4BAXA 2PMZB 3X3NA 4FADA 4DV2Q 3WAPA 2MEKA 4LNQA 1HXYD 3T16A 1TBEA 3CSTA 4Z9CB 4CKEA 3TSSA 2UUAQ 4BKGA 2PLPA 2O6VB 1HTLD 2BH8A 3MVVA 3I56A 1F2RC 4PS8A 2Y0SG 4PZ8A 1QVFA 3U4EG 3EA6A 1KF6B 2PNRC 4IO9A 3A1QA 1KC8C 4LUVA 1TWCH 1WJ6A 4IC7B 1GPXA 2G45B 3LXFA 2RDGA 4XTCS 3GZNI 2CH4A 2SNMA 1TKYA 1RRBA 2MBBB 4NNJB 4P72A 3PZDA 2ZXOA 4IM0A 2BTEA 2QGQA 3GS2A 1T5XD 1WTPA 2O6VA 3BY4B 3H7PB 5FJ8H 4BBSH 1WM2A 4C3JH 4JI7Q 4IWQA 1YJIA 4FBJB 4BA1I 2JA5G 3RN9C 1NYQA 3KBXA 3ZW3A 1T5EA 2N9LA 5JHBA 4R4OA 2WACA 1WCMB 5H1SE 4TMAB 2EYHA 3PT2B 1GUOA 5E4XA 3KUDB 5LMUQ 2EJFC 2ASQA 2ICIA 2NCNA 4A75A 4POGA 1KJTA 2FIDA 5FO9B 3NUHB 4RGOS 1O7YA 3H7PA 4RNAA 1J19A 1OTRB 1DM0B 1IGCA 2EMTA 2KDFB 2OOBB 4JI4L 1RM6C 1C9OA 1KIXA 1WGHA 4N9F4 5CBEE 3M62B 4YCUA 3TBLD 2INDC 1OXSC 1VQGA 3E9IA 3K7AH 1KDCA 2D62A 2A69C 4PNYA 1QF6A 5K36H 4RKLA 1PYWD 3AFQA 3RULA 2JSVX 3AEBB 1KLVA 4BY7G 4LFBL 1E8YA 3TREA 1IBLL 4GKKQ 5EPJA 4FXGC 5C3WA 2JA6G 2K9XA 4ANWA 5JEAH 3NQIA 1VF5C 1O7IA 2F0TA 5C3EG 5C0XJ 2NR2A 3ONAB 4LF4Q 4JC0A 1LM0A 3ZKJC 1EYAA 2RBMA 3C1EA 2F0NA 3I2ZA 4BY1G 2PEAA 4H7BA 1P7FA 4G11A 3RZOB 3PF5A 1EWYC 2IW3A 1HZCA 4FJZA 3TP7A 5EPLA 1EY9A 1X3FA 4Q5VA 1S3SG 1KAWA 3LNNA 5IGEA 3DVGY 2FMMA 3I91A 4A3CG 4NQKE 4B3MQ 1U9RA 1TJEA 2N55A 1XLQA 2INCC 4IUMB 4B0MA 1B3AA 1ZYRC 3I4MB 1VQCA 1LTTD 2BGFA 2KDIA 4EQNA 4DR1Q 4QIWB 4KY6A 2B2UC 1JQYD 4KGTA 4OWXB 2PPBC 4K8IA 1Q1EA 5E6JA 4HKQA 4KHZA 5J3BA 2LGYA 4WJWA 1G2TA 2R92H 1R4MI 3K81C 1ZPSA 4AJWA 3NK9A 2JYTA 1LTRD 3HG9A 1B9NA 3N52A 1SYGA 3BYYB 1EUJA 3V62A 2J7QB 1ASYA 1V2YA 4LF9Q 3SFDB 5C4JB 3K0XA 1PZJD 5EBDA 1GB4A 3QK0A 3JAME 2MO1A 2EJMA 3NUCA 1LT6D 1YNNC 2WXFA 2NB0A 1XCQL 4R3DA 1OXXK 2SNSA 3BZCA 3U2SC 4M00A 3UIOB 1CKNB 1TQOA 5ISRA 2C7NB 1NJIC 3AEEB 3CPWA 5GMVA 2UUCL 2BB5A 3HVDA 4P1CC 2J52A 3LJ3A 4NMZA 1BBUA 4YSZB 3ZJVA 4M0WB 3K5NA 3OSOA 1UAPA 1P0RA 1Q3LA 2D2CC 1I4GA 4AH6A 1Y1WB 2KJXA 2HD5B 1WR1A 4N9PA 2DHZA 2LMCB 3QG1A 1QVGA 1XLNA 1Z2MA 3O65B 3NPPA 2KMCA 3I4NG 3AB5A 3VVWB 4JI6Q 4LUOA 4A3JH 2LVPA 2ALYB 3A8JE 5E6NA 1CKNA 2PZWA 3M3YH 2CW0D 1E90A 2AKWB 3DEPA 1EO6A 1MFWA 1A62A 2FCNA 4O42A 4KJOA 4M0WA 3ZXVA 4OX9Q 3DBHB 1YJNA 5C5MA 3Q69A 2MW5A 3A9KB 1WFQA 4RFBA 3PIO3 2LMCA 3N6RA 1VQ5A 1XMOL 2EJGC 1Y56A 4HSPA 5JVH3 4A3GG 2YEPB 3HOZG 3PCOB 4BVUC 4WRDA 2ZCBA 3TS2A 3PF4A 1YNXA 2AWTA 3HOXH 4G7ZC 4MH8A 4OELB 4L23A 1VQJA 3NHEB 1TIFA 3A9KA 5LXIB 4A3MH 3TP6A 4WJNA 4EQ5A 2AX5A 4DV7Q 2B8GA 3QHTA 3F2CA 1VQ9A 3R7RA 1I4RA 5JXVA 3JAMc 1BBXC 1WVLA 2K5HA 3JAMi 4R8NA 3ML8A 2Z0DB 3BINA 4HR7B 1MJCA 1HZ9A 3RNBC 2JY6A 2DENB 3IRBA 5IT9E 2JA8H 1E6EB 1Y14B 2D3AA 2MHJA 2M19A 1LT5D 2W55A 3DVNU 2ON8A 2XTIA 3BVMA 2I07B 3SHLA 4MGIE 4H0LC 4MTKA 4EZLA 1FR3A 1GVPA 5AZGA 1X3GA 4L1BA 1RFAA 4B95A 1F0ZA 1K50A 3Q0AA 5GXGB 2DN8A 4NP5A 4G3XB 4CBVA 2EZVA 3V05A 5M3FB 2PQAB 1ZXHA 1JWSD 4G7HC 1OQQA 2K32A 3TEYA 4K7SA 1CFMA 3ECIA 3B2FA 2MHVA 4TSSA 4II2B 5ELNA 1HJPA 5IYDG 3N9YC 4ZKBB 5A2QE 2RSNA 3V96A 3NWSA 3FKIB 1K83H 3GTJH 1B70B 4GN4B 2A68C 3I8ZA 4GMVA 2WDTB 4ITKA 3E0JA 1XPOA 2OEOA 1KFYB 5LLIA 2GOWA 2I1KA 2PQAA 3D6CA 3NQTA 1XNRL 4A90A 3ZJUA 1VQ6A 2HTME 1NI2A 1MJDA 2VB2X 1YN5A 3K0YA 3KLSX 1WTQA 4ASWC 5M3MB 3S14H 2D5GA 2BYTA 3SD5A 3H1UA 1STBA 1II3A 3CC2A 2ZM6L 2HQEA 2X6LA 4DAVA 4RGNA 2WV6D 2BH2A 5G55A 3AE1B 2G4SA 2B63G 2BYFA 4OO1H 4JYAQ 1HFNA 3WA0A 2AUKA 2XGTA 4DKAC 3P75A 1PTOB 4IALA 2IT1A 2DY8A 5C0XG 4NJCA 5IGGA 2BPSA 5I9OA 2L15A 4JBWA 4A3OA 3GTOB 2B2YA 3QIJA 4JI2Q 4XX5A 5FLXE 1WE6A 2A74C 2VUMB 1DJRD 3UDFA 3J81L 4C7YA 4XWWA 5IT9c 1WCMH 2LVQA 1S5FD 2DBYA 2EMSA 1SR3A 3T3OA 1K51A 1HPCA 4AIMA 3GTQB 4KHPL 4M8NA 3CCJA 3KYDD 4UHVA 1E8ZA 4GLAC 3MJWA 2G4DB 4JCVE 2EOTA 2O4XA 1C76A 1DOIA 4HCPB 4M8MA 4JGHB 4ZRQA 2A73B 4DHJD 2N9EB 4JE3B 3VH4B 1RODA 3MHBA 3T13A 1HNZQ 3D32A 4I6NB 2QDLA 1EZ6A 2VQFQ 1LACA 4BBRG 2UU9L 5DPRA 3PGZA 5T8IA 4BS9A 1WR6E 2X6GA 1C1YB 3WDNA 1B1ZA 1H9MA 1QILA 2L1BA 3LDZE 2HUGA 2VQEL 3Q6SA 4RHSA 3VFKA 1TWHH 2JUOA 4EFOA 1WI5A 5J22A 3TN2A 4QJFA 4RCOA 2KFKB 2MH7A 4F8MA 2F0SA 2WKCA 3RZOH 1NMFA 1W6KA 1BCPD 1O7LA 1QOFA 5CV6A 1WGYA 1VZ8A 3C46A 2MJEA 2Z6KA 5AFWA 4HIDA 2Y5PA 2D0PA 2L55A 1I4PA 3Q8AA 1PYSB 4A4IA 3P1HA 3I4MH 2IHEA 4ZUJA 3DHIC 3HOWG 1EF1A 1D5XC 2KFKA 1N6ZA 5FLXc 1D3ZA 1BBWA 1PRTD 4XQJA 4WJ4A 1EU4A 2JJQA 1C9FA 3QB3A 2LRWA 3AFPA 2B29A 2R61A 4A93B 1A6XA 4CDEC 3S1RB 2LJ5A 2C5CA 1QJOA 1WGGA 4WAFA 3EGRA 5COYA 5CORA 5D14A 1VQMA 1WH3A 4ZOHC 1JJCB 3ZTDA 4YXDB 2I0QA 4LDTD 3ZIMA 3T8MA 5C4JH 2NBWB 2EY6A 4A3BH 1HUNA 1IP9A 4BXXG 1GHJA 1ILQA 3JVZX 3MXPA 1RAXA 4CYEA 4GLVB 3TEZA 1E2ZA 4TV3A 1XMQL 2JA7G 3NY5A 3RN5A 1SE8A 2K1BA 2PYKA 1F2YA 5J39A 3OJ3A 4PK1A 2UUBQ 2WLBA 5C4XG 4C4VB 1VLBA 2A19A 5C1ZA 1EIGA 1IHZA 3STBD 2QIEB 3NSWA 4I6PA 4KN4C 4KIKB 1Y1WH 1QLBB 2XWJB 3A33B 1LUZA 3M7GA 3PS6A 1EQVA 4QMGA 4IFDJ 1ET6A 2IGHA 2F0IA 4POFA 3VHTC 4EE2A 2JPHA 2LKVA 5G3LD 1N60A 4PS3A 2V3SA 4HVBA 3RPFC 2HD3A 1UUPA 3SK8A 4EQPA 4C4VA 1K52A 3H3VC 4NAMA 5T1GA 1SMYC 4DWFA 3T9LA 2K05A 5C44B 2L3ZA 1VR9A 4KIKA 3HOYG 2TSSA 2E2IH 2A8VA 4JI8Q 2E2DC 3DBSA 3CPFA 2KCNA 2VW9A 3DBHI 1QQRA 2QF7A 1R9TH 5JJIA 2ONQA 1N33Q 2WXOA 1UEAB 3FHWA 4K7WA 3L0OA 2Y5BB 4YWLA 1ENCA 3HOVG 3IVFA 5D7GA 4MH0E 4GB9A 3UQAA 4JPBW 4ZUIA 3HOUB 3F1ZA 5IYBG 2XIWA 3ZGZA 2UXCQ 2SDFA 4KDLB 4JI1Q 2XRSD 2L32A 3EN2A 2W3RA 3G6JB 3I9V1 1HR0W 3FEWX 4ICUA 4BWGB 4YSXB 1Z9FA 1C4PA 2D0OA 4R4CA 2M2LA 2Z8LA 4OEMB 1ROEA 3GTLB 4BKSA 2RVLA 3DEOA 4GLXA 5H8YE 2B39A 3JW0X 2BDNA 4K14A 1N36L 2KO3A 3B08A 3Q22A 1E24A 2AWNA 1NEKB 4X64L 1E7PB 2WXIA 1YQ4B 4F7XA 3CF5A 4DR3Q 4JK1C 1SNOA 2YTVA 5IGDA 2ATWA 2GLSA 2N9PC 3N32A 5EAYA 2AQ2B 3OWEB 3ETRA 3S16B 2NVTB 1L5PA 2WWZA 2J0JA 1KL9A 1T0RC 2JRHA 1EIYB 3N20C 3H91A 4KLKA 4EEWA 4XIGS 3DWAA 2R7DA 2MWSB 2W54A 3VTWA 4LF7L 1JROA 2NMQA 1QE6A 4DDID 5KHOA 3R3OA 3K58A 2KXJA 4PYUA 1H95A 5DNFA 4C3IG 1EY6A 1RTNA 4N8FA 3U30A 3PUWA 5KGUA 3FKIH 4IKGA 3AE9B 3VYTA 2CFMA 4ZAIA 3CW2C 2PVOD 2V9HA 4H13C 3CQZB 3ZDTA 1KTKA 2J0TD 4IUVA 3PIPA 3NENA 1G6JA 2OTLA 3ZRFA 4CKBA 1N5XA 2Y0SB 4GLSC 5ELDA 1H8CA 4DR2L 4ULLA 1AW7A 1Q81C 4N59A 2K5VA 1X56A 1EF5A 2KLCA 3APDA 3V6CB 1S5BD 1UELA 3S1MB 2ID0A 3TZUA 1C8CA 3DDCB 3RNFC 5M3MH 4GXBA 4ID6A 3X0WA 1S72A 1JQ4A 4JOIC 4C7ZA 5EE9A 2KUMA 3QA8A 4G50A 1P1AA 2BWFA 5ELOA 3U50C 2WX1A 4IWPA 4A3EG 5J18A 1JICA 1GJXA 4W9EA 4WURA 3CF6E 2JA5B 2RDBC 3PREA 2EY2A 1BUVT 1DOKA 4YY3L 1MSGA 4L5SA 3VUYA 4DR6Q 4NZLB 2I1JA 3NZ3A 3NVVA 4GNXB 3GTOH 1X3EA 3EQLC 3FPUB 4HJAA 1A2TA 5CHVC 4RGMA 5BR8L 2VUMH 4K2KA 2MJ8A 4QB4A 4DV6Q 1PLFA 3K7UC 2L8JA 4HXDA 3SVMA 4X62L 4DV0Q 1B53A 2F4VQ 2MP1A 1FXAA 2BF8B 3TEWA 4XZ4A 4G57A 3GTQH 3I73A 5EE0A 5GAEC 2D5DA 3DWQA 3OOCA 4KK7A 5C3XA 4BZAA 1I35A 4DFAA 1U0LA 3PO2H 2ENBA 4GNXA 2DX5B 1HR0Q 4KHVA 1XT9B 4K7UA 5LHY1 1PRTC 4MN3A 1EUVB 4DPGA 2LXCA 2OEDA 2JQRB 2XSCA 1N32L 2VS1A 3H6NA 3H0GG 4HSVA 4BY7B 2HE7A 2HDMA 2BS2B 4PQXA 2ZZPB 1K0SA 4AUQC 1ZOYB 2JA6B 5AUKA 4AQYL 1CZPA 2MSED 3VA7A 5C3EB 2HHHL 4DK0A 1MJEA 1CTMA 3CCUA 2JEBI 4HIMA 1LTLA 4BA2I 4BY1B 5HKHA 3EFXD 2NS5A 1PRTF 1EIHA 4HIKA 3TJPA 3X3MA 1SMXA 1UBIA 2BS4B 2PMVA 4FULA 4JI3Q 1PFDA 4HPMB 3OJ4B 5KHQA 4IJLA 2FHTA 1EZ8A 4RM8A 3SU8X 4DHJB 3CCQA 2A69D 2KOXA 1UWVA 4HIOA 4NQLB 4CJ1B 3VDYA 1C48A 1N61A 4IURA 1CT1D 4HJ5A 2AEHA 3JC66 2KCTA 1AFPA 5BMHA 1Q12A 1EEFD 1TS3A 4OZCA 2BYVE 3ITPA 3QOLA 1ACCA 1ZDXA 2DY7A 2JSOA 3K80C 3T1HL 3OTOL 3ZQ4A 2I5HA 1N34L 3MXGA 1IYJB 3KWVA 1HFGA 1U4MA 2B3GA 3SFEB 1F9JA 1NY4A 1DYQA 2ICEC 4A93H 4B3SL 1J7CA 2MBQA 3ML9A 3S1RH 2KT7A 1K73C 3FVQA 1HA5A 3GTPB 1L6VA 3TEXA 4BOSC 4WIPA 3J81E 1BCPB 1KAAA 5LMNQ 2F0FA 2L83A 1RIPA 1Y8RC 1KRTA 2JRIB 5JEAJ 4GDLB 2BS3B 3KOJA 3RZFA 5HFYA 4LK1C 4X65Q 3HRZC 2WYQA 5JH5C 4MIUA 4NKLA 1ZYRD 4K8JA 3D4RA 1FGBD 2K7VA 3GO5A 3QOJA 4L63B 4V0BA 4WORA 3AEVA 1GUWA 2KWDA 3PHWB 4J1MA 3WCQA 4LFAQ 1HQMC 3PUXA 2RPVA 3AEFB 1STHA 2FUG1 1OFFA 2NBVB 3AE5B 3UI2A 3ZNID 5CHWA 4G4KA 1AH9A 2K14A 2L5TA 1PRTB 1WZ0A 2JZPA 4II3B 1A3VA 1QG7A 1VQKA 5JJLA 1QNUA 1OGWA 2WXJA 2JYOA 4DV5Q 1GAQB 2EYFA 3H94A 1CKOA 4GDLA 3I4NB 3LGJA 3W9CB 2DUDA 2FAZA 5CYUA 1TZOA 5G2NA 2F3VA 4FF2A 3S17B 1M94A 3KDFB 1HE8A 4DV2L 2NN6G 1IYUA 4XQQA 3NELA 4IOAA 4YWKA 2MQHA 2KMAA 3VA5A 2K75A 1UD7A 2CJNA 3HVZA 1E7ZA 2OF1A 5C44H 2E2HB 4NJ7A 4A3IH 1ENFA 1BO0A 2DNFA 4A3GB 5JOBA 3HOZB 1F9SA 2NUCA 1E2VA 3KDFA 1L0WA 4WJQA 3CP0A 2QW7A 2DWQA 1AARA 3EFCA 1DOYA 4G0NB 1V6EA 3T3NA 1TWAB 4TQUS 3URYA 4JI7L 2ZNVC 4P1BC 4WWNA 1HEZE 5EE1A 5FLMG 5LL6X 1VRAB 4S17A 2YU9B 2V0GA 4YHHQ 1L1OB 4A3DG 2EKEC 3ALBA 3P4SB 4DV4L 4FF4A 3RNAC 4TQ0A 1TWGB 3J81c 1D7QA 4DXAB 3V61A 1B7YB 4PG3A 4ZK9B 2K6AA 5CV8A 3J81i 4DN4M 1IZ6A 3RT3B 1F2MA 1EOTA 3U4VA 3VR5A 2G9DA 2DZIA 4NPNA 2D10A 1E2WA 1HQRD 4JI0Q 2NPTB 4IOCA 2WXLA 3Q8CA 4DV3Q 3KBGA 3GTLH 4B9KA 4GKJQ 3I55A 2KJ6A 1L1OA 1Q46A 2AYOB 4CJ0B 4WJPA 3CC7A 4B3RQ 3IFDA 1WJJA 3DUZA 1WY8A 3W3AA 3A1QB 4RMFA 3PMFA 4GOPB 1ASZA 2F3IA 4ACFA 4DBGA 1KDAA 3S16H 2NVTH 2Z4HA 2KENA 2NPTA 3IFTA 4DU9A 4HDQA 3PLVA 1SYEA 5GAGC 3UDIA 3A7LA 4GKKL 5DPWA 1JWMD 4I6LB 5TSSA 3MAQA 3K9OB 2VH2A 2UXBL 4I65A 1I50H 1VZ6A 4DNTB 1JOQA 4GOPA 2LASA 2PKOA 4E71A 1MD2D 4JI5Q 1QKZA 3L16A 5M9OA 1N63A 5TR5A 1FMAD 3CQZH 3V2TA 2L11A 3KJOA 4JBJA 3AEDB 1V86A 5JPNC 3KQ4A 3QR8A 2M1MA 2RSOA 3VYSA 2RF4A 2DNCA 4PMWA 1UEBA 3TCAA 2KCMA 2PTLA 1IL2A 2C9OA 2E2JB 5M5YB 3S1MH 2PW5A 1NI3A 2ZJDA 3PUVA 4X66L 3P7JA 1LTBD 2NTSA 2XN9C 2RKSA 2B63B 1A3TA 1L2FA 1B9MA 4CQNA 5FJ8G 4BBSG 1P9DU 1ET9A 2A68D 3Q3MC 3CXCA 2WKDA 1TY2A 2ZW0A 3PGEA 2JA5H 3I70A 2N88A 2UXDQ 3IT6B 4YT0B 1BOSA 1RTOA 1BNZA 1ONLA 3Q3JA 2B3AA 5IY0A 5JHAA 1U4RA 2KJHB 2D3GA 3GE8C 1AZPA 3EHVA 1ZXIA 2CKZB 2KCCA 2GN5A 4DR5Q 1HNXL 5FOBB 4DV1Q 1FM0D 2EKIA 1IBMQ 3TMEA 3K59A 5CV4A 2N0SB 3ABVB 3J7ZC 3CCEA 4J6IA 1YN4A 2VXWA 1YN3A 4HJGE 5T1IA 4MEMA 3QJYA 3ZJTA 3PZ8A 1IBXA 1F2ZA 3UE0A 5L95C 1F2LA 3TS0A 2CWAA 2EXZA 4D2KA 3UE1A 4K0KL 1TGZB 1UGJA 1UZXB 3MP9A 3NWTA 2IY1B 1LTAD 1ICFB 2RQXA 3IBEA 1R4NB 2ZVNA 4OIKA 3K8AA 4BBRB 2LJIA 4X3TA 4FYDA 2LRUA 1CHQD 3IFWB 3NTIA 3HKZE 5ELEA 1G291 2CU3A 4DK5A 5JEAG 1WZ3A 4DDGD 3W5OA 1WI0A 4CHKA 1C3TA 1VQ7A 1YHBA 5C3EH 1SNDA 1TIID 3M4OH 4EUTA 3Q3NC 1W3SA 1GUAB 2CVRA 2RHQB 4BY1H 4HJ9A 2VRRB 3R2IA 1ZDVA 5IODA 2QMTA 3D6WA 2WINB 2KDEB 2KLGA 3BDOA 3T53B 4KDIC 4A3CH 3AMZA 1LTID 3NVZA 5BO4B 3ZRCA 4P2CB 4W9GA 3ZNGC 3VH3B 3CRLC 3RNUA 1K8RB 4GIVA 3TEHB 4GOCA 2IHFA 3HOWB 1TWFB 2NZOA 2F0UA 2WU5B 1AE3A 1I42A 4TKNA 4DV7L 2KACA 3HK0A 1HUMA 1T0YA 5IWAQ 1NR4A 1K0RA 3M4QA 3VR3A 1XNQL 1NENB 3MEHA 2Y3AA 2LGXA 3MC9A 1UH6A 1STEA 3OMCA 4X3SA 3GTPH 1RD9D 4AOFA 3SR6A 5DCNA 1W6JA 3BZKA 4CDCC 4RGTA 3T1YL 1MHWC 1FYCA 1SJHD 2RA4A 1EYGA 1V49A 2MA9B 4DHZB 4A76A 3HFZB 3AE6B 4AYBE 1E8XA 3PO3G 2JA7B 1HZ6A 1BR9A 2PJHA 4RF1A 3VTUA 1JWUD 5C4XB 4IQZA 3PRPB 4L5RC 3CKIB 2IDYA 1LYLA 1GUSA 4OHJA 4Q2JA 1JJGA 2F0JA 3AB9A 4HTHA 1PA6A 1ZP0B 4ZRJA 4P6VF 1Y1VH 2LXJA 2HCIA 3I4NH
chains in the Genus database with same CATH topology
1L6UA 3K5LA 1K53A 4X3UA 2H4OA 5CBAE 5I2XA 3FILB 2EELA 4YTPB 3R93A 5KYLA 1GB1A 4LAAA 3RLFA 3HOYB 4KKSA 3V3XA 1FCCC 1SIJA 4J3OD 4DK1A 1MPEA 1CI3M 4KI0A 4ABNA 1J7BA 1D5MC 3TZDA 1M8AA 1TS2A 1JWBD 5DM63 1ZEQX 3NVYA 4OIJA 3HOVB 3FILA 2L9HA 4G7OC 1P7EA 3AE2B 1NAPA 3NBIA 1SF0A 1M4VA 4B08A 1TS5A 1BQQT 4ZLTF 3NVWA 2E74C 1ZXTA 2B2UA 1STAA 2K5WA 1FXIA 3L9AX 2JXMB 1SMYD 1TR5A 3UI3A 5I6YA 3L3OC 2B2TC 3RZDB 5JJZA 2GA4B 1A15A 2IWHA 3W5VB 1KDBA 1KNEA 1G6ZA 1D4BA 1Q1BA 2JEAI 3NBHA 4K5WA 1HZ5A 3E5SA 4TRDA 2PW9A 5IIFA 1WTXA 4MT5A 4XWTA 2IGGA 3BDCA 5FR3A 1OXVA 4C3IB 2A6HC 4M8AA 5EGTA 2M56B 3VR9B 4WWMA 4ZQ3A 1RHPA 5KNBA 3J9CA 4ME5A 4DQOC 2ZXRA 3IAYA 4C1NI 1DZ1A 4V190 2AWOA 4L2YA 3KK7A 2ACZB 2JYEA 1GUGA 1SE3A 3MFGA 1I3QB 3LYYA 2EYPA 1SEBD 4LLGM 3MXNA 4OO1G 4A3EB 5HURA 1LABA 4RA8A 4WFN3 2DYOA 3J7AV 1S4ZA 1OO9B 2K04A 5C0XI 4AS1A 3GTMB 3MZ5A 2K5DA 4FXDA 3P4QB 3FRPB 1X3QA 3PZ7A 3BVGA 1NSNS 4REZA 4RH6A 4US9A 1NUCA 4DAYA 3U9OA 2JXTA 1LLRD 1Y8NB 4HCSA 2GI9A 4EVOA 3CIRB 4KN7C 3T56B 2B2TA 4K2LA 1XXGA 4CJ2C 4YIJA 2IX0A 3B9JA 3IAM1 3H0GB 2WXHA 4HRSA 2K3UA 4DF7A 2ZXPA 2BBCA 1WD0A 1CA5A 3S1QB 2EYLA 4IOIE 2EY5A 5FO7B 1F2RI 3BK1A 1WYGA 3OIPA 3MA2B 2AUJD 2TMPA 3VQIA 1MSHA 1LTGD 4CHTB 1A3UA 4OZBA 3MC0B 5C4HA 2KQ4X 1D5ZC 4LTUA 2J4XA 3SXHA 2J42A 1RWSA 1CM9A 1RKNA 4ILWA 3B2GA 5C3JB 1JE4A 2F0WA 1EL0A 1D6EC 2E76C 5I9PA 1XLOA 4C1NK 4DNRB 2N7JA 2V4DA 5F2DA 1E0ZA 2E3TA 2F3WA 5AUIA 2KECA 3CWIA 2NBFA 1EY8A 2OXPA 2PVGC 2IGDA 1EU3A 3HRDD 4XQNA 3P42A 1OXTA 2F0LA 3IXSA 4HKZE 1DXMA 4GDKB 5EKLA 5FK9C 2FINB 3MTSA 1Z47A 5CR3A 2F0MA 1B9RA 4OZAA 1FNVA 2X38A 1JORA 2AQ3B 1FNWA 1U4PA 1N62A 4IUNA 2NTTA 2FFKB 4R9WA 2Y5CA 1L0YB 2KVMA 2K22A 2BOSA 5CV9A 2V4IB 5CC4A 3GQBA 1DD2A 3OWFA 2Q8IB 2WDRB 1XTCD 4O1NA 3A54A 4KKUA 2EYJA 4C3HG 3SR1A 2GRIA 3DHQA 4B0EA 2BB6A 4A3DB 4ZRPA 3C3LA 5IGCA 4OGQC 3AEGB 1I4QA 5IGFA 1HA6A 4NAWB 2XWBB 3I90A 4XDCA 1SB3C 3S15B 1EWHA 5D65A 4C56C 1HTPA 1JWAD 1FCLA 2ZT9C 1BMLC 1J7AA 4HROA 3A8KE 1STYA 2WXGA 3FDTA 1L0VB 3F2UA 2B2VC 2F0GA 4KGRA 2JU6X 1V8QA 5G5GA 3IL8A 2HDLA 2XRQD 2JX5A 1Q90A 1N5WA 2Q5WD 4M1UB 3EROA 2WU2B 1SBBB 3VR8B 1JB3A 2M0AA 2F0EA 3CRKC 1VDVA 1J8IA 3BG3A 1PTOH 1V1OA 2HDEA 1R4PB 4KD4A 1G8ZD 4BBSB 1IYVA 2MJDA 1S5CD 3VRBB 4C2MB 3FMCA 4ZRZA 1OQRA 3I72A 1L4ZB 4RAUC 3GV3A 4RF0A 3TP5A 2W3SA 3C1FA 1MHHE 1AEXA 1UWMA 3ND8A 4ZYSA 1G2SA 4E6IA 1YQ3B 2F0KA 1WD1A 1KH0A 5M5XB 1WTOA 3BVZA 3IT4B 1SYBA 5HI1A 2F0HA 5LNK1 1MVKA 4DA2A 2FJ2A 3OW7A 1PDQA 1IGDA 2M9VA 4K6LA 4KKTA 1NYRA 1GHKA 2B2WC 3RUZA 4PT5A 1KNAA 2QSDA 4HMJA 4IFDG 1JW9D 2EYOA 3CHBD 1Q8IA 4F87A 4TKOB 4FNFA 2EPBA 3RD4A 3K6OA 1TKEA 2X69A 3TP8A 4FF3A 3E56A 1FD7D 3E9SA 4IFDI 4HMIA 4XYOA 3KWLA 3BK2A 1F9QA 2EE1A 2KOLA 3PO0A 1WWTA 5D3IB 1HHVA 4WH4A 3GTKB 2R3ZA 1QT9A 5BYRA 2H1EA 5EJWA 3PO3B 1FNUA 3K5OA 3VR6A 2GB1A 2RMMA 1B50A 4XYQA 5EBCA 1QOGA 1DOXA 3P20A 4QUFA 1FD6A 4KKIA 1KABA 4DAPA 1IW7C 1D1IA 2DLBA 3TUOA 1ML0D 3HGBA 3NS1A 3K5MA 1FRDA 3M3YB 2L0CA 2NN6H 3NTHA 2XVSA 1JALA 2NN6I 3P1MA 5CV5A 3VR2A 1XX8A 4FXKC 1EWCA 1X3PA 2WNMA 5BN4A 2KEEA 1XYIA 1ESFA 2NVQB 2NVYB 3Q8FA 3U7ZA 1IKLA 1CZGA 2F0DA 3DWMA 1MI0A 5J1ZA 2WP9B 3SEBA 3DXJC 2IJ0A 3D8GA 1SDFA 1LT4D 1JOKA 1SNCA 1EYDA 5EQ0A 4K6DA 4YTNB 4I7ZC 1R7SA 3J80L 1E9MA 5JPMC 5EKKA 3Q23A 1CK1A 1LO5D 4HN7A 4IUPA 1CA6A 4DGZA 4RKBA 1AYFA 1EQTA 3AE4B 5KRUA 1H9KA 1WTVA 3FPPA 1A70A 1PGAA 1BF4A 1C77A 2IX1A 5BYSA 3HS0C 1YNJD 1VDZA 3W2DA 1CZWA 2PO4A 2LHEA 5ELCA 3NRZA 4LMQD 1H9RA 4IUUA 3HP3A 3VYRA 2SOBA 4RCNA 5C4ZA 5HGTA 1STNA 3S14B 4C3JG 5E3FA 2R93B 3PIP3 1BUIC 4DXFA 2LEKA 3HUIA 1SFOB 1IBXB 4PV1C 2A6HD 2PZTA 5E1FA 3MXUA 4J8QA 2JWUA 1PXUA 4J6HA 1V97A 2BE5D 5I4DA 3BWUD 4KD3A 5D3DA 3LWUA 3AEAB 4IZ8A 1EY4A 2QILA 3R2TA 4ZHOA 1YJJA 1QOAA 5M5WB 1XEEA 5K36G 1SYDA 4MACA 2L4NA 3D4WA 4A8XC 1QCBD 1CQFA 2FMCA 5BMGA 3S2HB 5EE3A 4EQOA 5I6WA 1D1KA 4L6TB 4R8IA 1TWHB 1B2TA 1NR2A 3RMHA 1V8CA 3AU7A 4JX1C 2IL8A 4P16A 3D31A 3AM9A 3ND9A 4YTMB 1SJED 2LHDA 4OL7A 4F88A 2E75C 2WXNA 4KGSA 2EVBA 4MM3B 2L52A 3Q8EA 3IAS1 3A56A 3J7AF 2QCPX 3HEJA 4A3FB 4U68A 2KN4A 1PDXA 2A6ED 3SK5A 2MJ3A 2WQYB 1C4QA 2J7ZA 2LFNA 1FEHA 2JP1A 2WS3B 2YEPF 3L4PA 2N9KA 3E6ZX 1SNMA 2RDFA 1HCZA 3S1NB 4A3BB 2WB1B 2XNAC 1I4HA 2Q8RE 1SAPA 2Z1CA 5CGKA 5IOCA 3MJ5A 4FF1A 2MPMA 3C2PA 1PGXA 1GXDC 2QJLA 2AQ1B 1NVID 4CGYB 2F4IA 5BN5A 2MUYA 4ARIA 1TKWB 2F1MA 1MI2A 3EUB2 3PUZA 2K5QA 3QIAA 3EJIA 3A55A 4QUCA 2E2IB 2VNUD 1S5ED 3MWYW 1R9TB 4Q0FA 2INNE 4RWSC 2B2YC 4A3KB 3GV6A 1C79A 4C3HB 3I57A 5JAVA 1Z6HA 3AE3B 2SAKA 3MHZA 3HZXA 3D4DA 3C8YA 3W5UB 4PMCA 5BN3A 1UWXA 3PUYA 1PZKD 1TY0A 4ZKCB 1SSNA 2L12A 1YNJC 1PTOC 5LL6S 4B9XA 3DWGC 1V43A 1SNQA 4N6EB 1BDOA 2Q8TA 1ENAA 2WIIB 2KQ3A 1IUEA 5KNCA 3DWPA 2LS01 3I3CA 3LWEA 2KDMA 3TBIB 1PTOF 1VMPA 2D9UA 1AWDA 3M4YA 3H8HA 1RF2D 3OMGA 4ARCA 1CQVA 1L0XB 2CHBD 4HCEA 4L8JA 2QEJC 4ZHPA 1PUTA 3CU7A 4QF4A 1PZID 2LY7A 2BE5C 3H6MA 3VYUA 3AV8A 2YYZA 2R7ZB 1YNTE 3DM1A 3SDZA 1QWYA 5A35A 3LB8C 1LTSD 4LJZC 1VF7A 1TVXA 3T4AC 1XLPA 3W1SA 1J9OA 4U673 5C0XH 5FKAC 2J53A 1ZE3D 3OPOA 4S3SA 1I7HA 2WXMA 1I6HB 3VR4A 2B8FA 2LGIA 2G1EA 2K01A 2I46A 4JWUC 4OO1I 1FFVA 2OT2A 1QOBA 2F0OA 5ELBA 4CKCA 1ICWA 2K0PA 3I4LA 2SEBD 3U9SA 1FIQA 3J80E 1Y69U 3GD7A 2G9HD 2V3NA 1AZQA 5C2TB 3PO2B 1YMHE 3AECB 2K28A 4H44C 1EFID 2KEDA 2V3PA 2BCOA 2F0PA 2WXRA 2A6EC 1I4XA 5K5PA 2WP8J 4A9AA 2IPKD 5C5LA 3KF8A 1MHXA 4UDUC 3BS1A 3KLSA 3EVQA 3BDLA 1F9PA 2F0QA 1D2BA 2DNEA 2F03A 4AQ7A 4KJNA 2PW7A 1FFUA 5HG2A 1B44D 3BZDB 1WTWA 3D3RA 2CW0C 1AP0A 1XWEA 2PIAA 1VJKA 4JWSC 1JOOA 4US8A 5KNDA 3ZYYX 1GUTA 2M00A 2NZ1D 3FC4A 3BIID 3VRAB 1PMRA 3P63A 2OHFA 3BYTB 1TS4A 1KLUD 1EY5A 1XO3A 4IDIA 1JR0D 1TU2B 3RFZB 1K8OA 3NE5B 1LV9A 4XT1B 1SE4A 3GP7A 1BXTA 2CQAA 2VB3X 2WXQA 1EY0A 3OIQA 3FAHA 1JRPA 5H92C 3GTGB 1GUNA 2NYZD 2WDVB 4A3IB 2VZKD 3S9WA 4N9TA 1JC7A 1IW7D 3A8IE 3NTKA 1O80A 3SK4A 5CMDA 5KYIA 2LFIA 4OVZA 2O5JC 1WXQA 1RJTA 1G91A 1MBYA 1CHPD 3PV0A 1HRJA 1Y8PB 3WOEA 4KV6A 5EKIA 3S2DB 1SE2A 2KHSA 4TQ1A 4OW0A 4IUQA 1KRHA 1CJEA 1FRRA 1GOZA 1C78A 1KLGD 2BDOA 2BA0A 2INPE 3NP8A 1DCZA 1VMCA 1ESRA 3SK6A 1RDPD 1O7ZA 2WXKA 3DMUA 5BYQA 4EGVA 1ZKOA 2CJOA 1QNKA 1IL8A 4XE0A 5KEEA 2PZUA 2NVXB 5JVG3 1X32A 4B9WA 1T3QA 5KIXA 3Q8BA 4X3KA 3AMUA 3R8BA 1VZ7A 1SYCA 1I50B 2FE8A 3HKZB 3MFYA 2PCFB 1TWCB 4A55A 1U4LA 5DEHA 1A2UA 1RCVD 4KKJA 5BMIA 4HEDA 1AN8A 4C3JB 4PMBA 1T6BX 2EDGA 5G5HA 5HHDG 2R6GA 4KY7A 3U52E 4HAEA 3H09A 4K5VA 2IX3A 2K33A 4MHEA 1RFKA 1Y8OB 3P4RB 1FO4A 3JAML 1LT3D 5C6AA 1ZUD2 1PFMA 2E6XA 5CV7A 5ELFA 1R4QB 1EYCA 1PFBA 3L7ZC 3KLRA 1STGA 2LUMA 3AE8B 1TT2A 2BT6A 4YSYB 3K7AB 4QCLA 1BCPC 1SSOA 3J7YW 4K5XA 5MPOA 1E10A 1JMLA 2L1AA 2KMMA 4RHRA 3K57A 4AYBB 2K03A 3LX0A 5EPKA 1K8MA 1NCVA 4ODGA 2H89B 2H88B 2A5HA 1BCPF 1WTRA 4NDXA 3TDQA 4KY5A 2DYMA 1C4CA 5DM73 1EM7A 2W82A 2BA1A 1DONA 3M4OB 2WXPA 2WDQB 2NWGA 4UAIA 2RDHA 2B2VA 1EY7A 1H9SB 1XCTL 2QDBA 2B76B 4IFDH 3T51B 3AN1A 4LK0M 1L4DB 1H9JA 3NHHA 2ZW1A 2R92B 5DAUA 4WQMA 4KMUC 1MGSA 1Q10A 4JPSA 3NXWA 1F9RA 3SE0A 3G7LA 4XDXA 1H9SA 3QO2A 2KAJA 5IT9L 1ILPA 4XXEA 4C80A 2PQEA 3WOFA 1E0BA 1WGKA 1S5DD 2MGSA 2F0VA 5FO8B 4FO2A 3O13A 4NW2A 2I2YA 3OHXC 4KTAA 5NUCA 2K5PA 3GB1A 2BW2A 1SYFA 1C4AA 1OXUA 1QOHA 2EY1A 5G3LF 2O2LD 1F77A 5A2QL 1WRIA 4A3JB 3AE7B 1PFNA 1Z7TA 1UNSA 4FP5D 4YWGG 4GZYC 1Y1VB 2HCCA 3IKJA 3AH7A 4USAA 4DXGA 3QWNA 1I6VC 2JE6I 4IUTA 2FBWB 5IGBA 1YNND 2QKIC 2B2WA 4H2AA 3HOXB 1PGBA 3M85A 1QB5D 1TKGA 1O78A 4A3MB 1SXTA 1RYJA 5FLXL 1V1PB 3KUPA 1IKMA 4FXCA 4IN3A 2EYMA 3A7AB 1JCKB 1VCIA 1TYGB 3P4PB 3ERQA 3M7NA 2JA8B 4KX6B 3Q24A 1V1PA 1DGJA 2O5IC 4XT3B 4HEA1 2I38A 5E4WC 2WAQB 1WSPA 2VZKB 4A6QA 2Z4IA 1DOMA 1EEID 4Y7NB 1DOLA 2KA7A 4XDDA 1XF5L 5I2YA 1B4OA 1K83B 3GTJB 1PTOD 4FVMA 4N58A 2PMZB 3X3NA 2MEKA 1HXYD 3T16A 4Z9CB 4CKEA 3TSSA 2PLPA 1HTLD 3MVVA 1F2RC 3U4EG 3EA6A 1KF6B 2PNRC 1GPXA 3LXFA 2RDGA 4XTCS 2SNMA 1TKYA 2ZXOA 2BTEA 3GS2A 1T5XD 1WTPA 1YJIA 4BA1I 1NYQA 3KBXA 1T5EA 2N9LA 2WACA 1WCMB 4TMAB 2EYHA 1GUOA 5E4XA 2EJFC 2ICIA 5FO9B 3NUHB 4RGOS 1O7YA 4RNAA 1DM0B 1IGCA 1RM6C 5CBEE 1OXSC 1KDCA 2D62A 2A69C 4PNYA 1QF6A 5K36H 4RKLA 1PYWD 2JSVX 3AEBB 5EPJA 4FXGC 5C3WA 2K9XA 5JEAH 3NQIA 1VF5C 2F0TA 5C0XJ 3ONAB 1EYAA 2RBMA 3C1EA 2F0NA 4H7BA 1P7FA 3RZOB 1EWYC 2IW3A 3TP7A 5EPLA 1EY9A 4Q5VA 3LNNA 5IGEA 2FMMA 3I91A 1TJEA 1U9RA 2N55A 1XLQA 4B0MA 1B3AA 1ZYRC 3I4MB 1LTTD 4EQNA 4QIWB 4KY6A 2B2UC 1JQYD 4KGTA 2PPBC 4K8IA 1Q1EA 5E6JA 4HKQA 4KHZA 4WJWA 1G2TA 1ZPSA 3NK9A 2JYTA 1LTRD 3HG9A 1B9NA 3N52A 1SYGA 3BYYB 3SFDB 5C4JB 1PZJD 5EBDA 1GB4A 3JAME 2EJMA 3NUCA 1LT6D 1YNNC 2WXFA 2NB0A 1XCQL 4R3DA 1OXXK 2SNSA 3U2SC 1TQOA 5ISRA 3AEEB 4YSZB 2BB5A 3HVDA 3ZJVA 2J52A 4NMZA 3K5NA 3OSOA 1UAPA 1Q3LA 2D2CC 1I4GA 1Y1WB 2KJXA 4N9PA 2LMCB 3QG1A 1XLNA 3NPPA 3AB5A 3A8JE 2PZWA 2CW0D 3DEPA 4O42A 4KJOA 4M0WA 5C5MA 3Q69A 4RFBA 3PIO3 2LMCA 3N6RA 2EJGC 1Y56A 4HSPA 5JVH3 2YEPB 4WRDA 4G7ZC 4MH8A 4L23A 3TP6A 2AX5A 2B8GA 1I4RA 5JXVA 1BBXC 1WVLA 4R8NA 4HR7B 5IT9E 1E6EB 2M19A 1LT5D 2W55A 2ON8A 3BVMA 2I07B 3SHLA 4H0LC 1FR3A 4L1BA 1F0ZA 1K50A 3Q0AA 5GXGB 2DN8A 4NP5A 4CBVA 2EZVA 3V05A 5M3FB 1ZXHA 1JWSD 4G7HC 1OQQA 2K32A 3TEYA 1CFMA 3B2FA 2MHVA 4TSSA 3N9YC 4ZKBB 5A2QE 2RSNA 3V96A 3NWSA 3FKIB 2A68C 3I8ZA 4ITKA 3E0JA 2OEOA 1KFYB 3D6CA 3NQTA 3ZJUA 4A90A 2HTME 2VB2X 1YN5A 3K0YA 3KLSX 1WTQA 5M3MB 2D5GA 2BYTA 1STBA 1II3A 2HQEA 2X6LA 4DAVA 4RGNA 2WV6D 3AE1B 4OO1H 1HFNA 2AUKA 1PTOB 3P75A 4IALA 2IT1A 2DY8A 5C0XG 4NJCA 5IGGA 5I9OA 4JBWA 3GTOB 2B2YA 5FLXE 2A74C 2VUMB 1DJRD 3J81L 4C7YA 4XWWA 1S5FD 2DBYA 3T3OA 1K51A 1HPCA 3GTQB 2EOTA 2O4XA 1C76A 1DOIA 4ZRQA 2A73B 4JE3B 1RODA 3MHBA 3T13A 1EZ6A 1LACA 5T8IA 4BS9A 2X6GA 3WDNA 1B1ZA 1H9MA 1QILA 2L1BA 2HUGA 3Q6SA 4RHSA 5J22A 3TN2A 4RCOA 2MH7A 4F8MA 2F0SA 2WKCA 1W6KA 1BCPD 1O7LA 1QOFA 5CV6A 1VZ8A 3C46A 2MJEA 5AFWA 2Y5PA 2L55A 1I4PA 3Q8AA 3P1HA 4ZUJA 1D5XC 1PRTD 4XQJA 1EU4A 1C9FA 3QB3A 2R61A 4A93B 1A6XA 3S1RB 2C5CA 1QJOA 4WAFA 3EGRA 5COYA 5CORA 5D14A 4ZOHC 4YXDB 2EY6A 1HUNA 1GHJA 1ILQA 3MXPA 3TEZA 1E2ZA 2PYKA 2K1BA 1F2YA 5J39A 2WLBA 1VLBA 1EIGA 1IHZA 2QIEB 3NSWA 4KN4C 1QLBB 2XWJB 3M7GA 1EQVA 4QMGA 4IFDJ 1ET6A 2IGHA 2F0IA 4EE2A 2LKVA 5G3LD 1N60A 3RPFC 1UUPA 3SK8A 4EQPA 1K52A 3H3VC 4NAMA 5T1GA 1SMYC 2K05A 5C44B 1VR9A 2TSSA 2E2DC 2KCNA 1QQRA 2QF7A 2ONQA 2WXOA 1UEAB 5D7GA 1ENCA 4ZUIA 3HOUB 2XIWA 3ZGZA 2SDFA 2XRSD 2L32A 2W3RA 3G6JB 3I9V1 3FEWX 4BWGB 4YSXB 1C4PA 2M2LA 2Z8LA 1ROEA 3GTLB 2RVLA 3DEOA 5H8YE 2B39A 2BDNA 4K14A 3Q22A 1NEKB 2AWNA 1E7PB 2WXIA 1YQ4B 4F7XA 4JK1C 1SNOA 5IGDA 2AQ2B 3OWEB 3ETRA 3S16B 2NVTB 1L5PA 3H91A 4XIGS 3DWAA 2W54A 1JROA 2NMQA 1QE6A 3R3OA 3K58A 5DNFA 4C3IG 1EY6A 1RTNA 3PUWA 5KGUA 4IKGA 3AE9B 3VYTA 4ZAIA 2PVOD 4H13C 3CQZB 1KTKA 2J0TD 4IUVA 4CKBA 1N5XA 2Y0SB 4GLSC 5ELDA 4ULLA 1AW7A 4N59A 1S5BD 3S1MB 2ID0A 3TZUA 1C8CA 4ID6A 1JQ4A 4C7ZA 5EE9A 2KUMA 1JICA 1GJXA 4WURA 2JA5B 2EY2A 1BUVT 1DOKA 1MSGA 4NZLB 3NZ3A 3NVVA 3EQLC 3FPUB 1A2TA 4RGMA 4K2KA 2MJ8A 4QB4A 1PLFA 3SVMA 1B53A 1FXAA 2MP1A 3TEWA 4G57A 3I73A 5EE0A 2D5DA 3DWQA 3OOCA 4KK7A 5C3XA 4DFAA 2ENBA 4KHVA 5LHY1 1PRTC 4MN3A 2OEDA 2JQRB 2XSCA 4HSVA 4BY7B 2HDMA 2BS2B 4PQXA 1ZOYB 2JA6B 5AUKA 1CZPA 3VA7A 5C3EB 4DK0A 1CTMA 2JEBI 4BA2I 4BY1B 3EFXD 1PRTF 1EIHA 3X3MA 2BS4B 2PMVA 1PFDA 2FHTA 1EZ8A 2A69D 4CJ1B 1C48A 1N61A 4IURA 1CT1D 5BMHA 1AFPA 1Q12A 1EEFD 1TS3A 4OZCA 3ITPA 3QOLA 1ACCA 1ZDXA 2DY7A 2JSOA 3ZQ4A 3MXGA 3KWVA 1HFGA 1U4MA 3SFEB 1DYQA 2ICEC 1J7CA 1L6VA 3FVQA 1HA5A 3GTPB 3TEXA 4WIPA 3J81E 1BCPB 1KAAA 2L83A 2F0FA 5HFYA 5JEAJ 4GDLB 2BS3B 4LK1C 3HRZC 4MIUA 4NKLA 1ZYRD 4K8JA 3D4RA 1FGBD 2K7VA 3GO5A 3QOJA 4L63B 4WORA 4V0BA 1GUWA 2KWDA 3WCQA 4J1MA 1HQMC 3PUXA 2RPVA 3AEFB 1STHA 2FUG1 1OFFA 3AE5B 3UI2A 4G4KA 2L5TA 1PRTB 2JZPA 1A3VA 1QG7A 1QNUA 2WXJA 2JYOA 1GAQB 2EYFA 3H94A 3I4NB 3W9CB 5CYUA 1TZOA 2F3VA 4FF2A 3S17B 2NN6G 1IYUA 4XQQA 3VA5A 3HVZA 2CJNA 2OF1A 2E2HB 1ENFA 1BO0A 4A3GB 5JOBA 3HOZB 1F9SA 2NUCA 1E2VA 2DWQA 1DOYA 3T3NA 1TWAB 4TQUS 3URYA 5EE1A 1HEZE 5LL6X 1VRAB 2YU9B 2V0GA 3P4SB 4FF4A 4TQ0A 1TWGB 4ZK9B 2K6AA 5CV8A 4DN4M 3VR5A 1F2MA 1EOTA 2G9DA 1E2WA 1HQRD 2WXLA 3Q8CA 3KBGA 4CJ0B 3IFDA 3DUZA 3W3AA 3PMFA 1KDAA 2Z4HA 3IFTA 4DU9A 1SYEA 3A7LA 1JWMD 5TSSA 3MAQA 4I65A 1VZ6A 4DNTB 1JOQA 2PKOA 1MD2D 1QKZA 5M9OA 1N63A 1FMAD 3V2TA 2L11A 3AEDB 5JPNC 3KQ4A 2RSOA 3VYSA 2DNCA 4PMWA 2PTLA 5M5YB 2C9OA 2E2JB 2PW5A 1NI3A 3PUVA 3P7JA 1LTBD 2NTSA 2XN9C 2RKSA 2B63B 1A3TA 1B9MA 4CQNA 1ET9A 2A68D 2WKDA 1TY2A 2ZW0A 3I70A 2N88A 3IT6B 4YT0B 1BOSA 1RTOA 1BNZA 1ONLA 1U4RA 1AZPA 1ZXIA 2KCCA 5FOBB 1FM0D 2EKIA 3TMEA 3K59A 5CV4A 2N0SB 3ABVB 1YN4A 2VXWA 1YN3A 4HJGE 5T1IA 3QJYA 3ZJTA 3PZ8A 1IBXA 1F2ZA 1F2LA 2EXZA 4D2KA 1UGJA 3MP9A 3NWTA 1LTAD