1KLGD

Crystal structure of hla-dr1/tpi(23-37, thr28-->ile mutant) complexed with staphylococcal enterotoxin c3 variant 3b2 (sec3-3b2)
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
239
structure length
231
Chain Sequence
b'ESQPDPMPDDLHKSSEFTGTMGNMKYLYDDHYVSATKVKSVDSFFKWDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKGKTCMYGGITKHEGNHFDNGNLQNVLVRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA CLASS II HISTOCOMPATIBILITY ANTIGEN, DR ALPHA CHAIN
publication title Minor structural changes in a mutated human melanoma antigen correspond to dramatically enhanced stimulation of a CD4+ tumor-infiltrating lymphocyte line.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/toxin
total genus 67
structure length 231
sequence length 239
ec nomenclature
pdb deposition date 2001-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
D PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1klgD01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1klgD02
3BYYB 1S5ED 1SE3A 1CHQD 4Z9CB 1S5BD 2XNAC 1EU3A 1CT1D 1PTOC 4RGTA 1V1PA 1I4XA 1CK1A 1CQVA 1FNUA 1PYWD 1RDPD 1SEBD 1SE2A 5D3IB 1KLGD 1DJRD 2AQ2B 4RFBA 4RH6A 1LT6D 3EA6A 2XRQD 1UUPA 1SE4A 4RCOA 4C56C 1FD7D 1PTOF 1RF2D 3SEBA 5TSSA 4ZYSA 1I4HA 1D6EC 2NTSA 4RGMA 1KLUD 3W2DA 3DWQA 1CHPD 3KLSX 4OHJA 1L0YB 1SJED 1I4QA 2NTTA 1JCKB 1SBBB 3GP7A 1B1ZA 2QEJC 2RDGA 3BYTB 2XN9C 1PRTC 1FNVA 2G9HD 1JQYD 1GOZA 1D5XC 1LTGD 1LTID 5FKAC 1D5MC 1TS4A 4DXGA 1QILA 1ET6A 1I4RA 1XXGA 5ELCA 1PRTF 1KTKA 1STEA 4RHRA 3O13A 4BWGB 1F77A 1LLRD 1LTSD 1LTBD 3BVMA 4DXFA 1PTOD 2RDHA 1HA5A 3BVGA 3CHBD 4L6TB 4TSSA 1HXYD 2CHBD 1TY2A 1HTLD 1LT4D 1S5CD 1LO5D 1AW7A 1PTOH 1L0XB 2IPKD 3DWPA 4RGNA 3R8BA 1I4PA 1JWUD 1LTAD 2IJ0A 1LTRD 1UNSA 2O2LD 1XTCD 4NZLB 1BCPB 1BXTA 1JR0D 1ENFA 1PRTD 1PZID 1YN3A 1JWSD 3MC0B 1FNWA 1BCPC 1M4VA 5ELFA 1EEID 1PZKD 1RD9D 1DYQA 1EEFD 3BZDB 4K6LA 1G8ZD 1TS2A 2R61A 3EFXD 1TS5A 1B44D 1BCPF 5ELBA 2QILA 3OWEB 5ELDA 3R2TA 1TY0A 5FK9C 1RCVD 2ICIA 2WV6D 5I4DA 1SJHD 1S5FD 2AQ3B 1EWCA 1T5XD 2J4XA 3URYA 3DWAA 1SXTA 4O1NA 1AN8A 1ET9A 1V1OA 2SEBD 3MFGA 4L63B 2Z8LA 1EU4A 3V05A 1FGBD 1YN4A 1ESFA 5D3DA 1I4GA 1PRTB 1D5ZC 1HQRD 2AQ1B 1V1PB 1LTTD 1S5DD 3BVZA 4RGOS 1MD2D 2XRSD 1LT3D 4UDUC 1EFID 1BCPD 1PTOB 4RHSA 1PZJD 2TSSA 1YN5A 1TS3A 3TSSA 1JWMD 5ELEA 3R2IA 1LT5D
chains in the Genus database with same CATH superfamily
2B3GA 2QGQA 4Q5VA 1NENB 1D4BA 3RNUA 3TP6A 1SNPA 1MJEA 4R9WA 4K3CA 5EE9A 4RFBA 1TT5B 4A20A 4LUVA 2RF4A 4I7AA 3S16B 4LK1C 1PFNA 2WHIA 1N34L 4M8NA 2KVZA 2NTTA 1F2YA 2F0FA 3A7LA 5T1GA 4ID6A 5EAYA 3AV8A 4P2CB 1H9SA 1JQYD 1JMLA 1LM8B 3PZDA 4IW0A 4NNJB 2NYZD 1HFGA 5FKAC 5FLMH 2HTME 3DEOA 2JK8A 4Y7NH 2XSCA 3QIAA 1SNQA 1EY4A 1SMYD 4RAUC 1BR9A 4KY5A 1RAXA 2XEWA 4ULLA 2K25A 3MXUA 4W9KA 2K0PA 3BVMA 3RULA 3SHLA 3RZOB 1HR0Q 2QCZA 4G7HC 2D2QA 3BDOA 3Q3FA 1RTOA 3ZJVA 1LT4D 3IT4B 2JF5A 4FJVB 1AARA 3LX0A 5IP7G 1LO5D 5JHBA 1CKNA 1U0LA 1OXUA 3K57A 1AFPA 2WDTB 4K7UA 2PI2A 1I5FA 1T9HA 1U4RA 2R92H 4TQ0A 2EJFC 1H4RA 3CAMA 1VMPA 1WJ6A 4PYUA 4BBNC 5BMIA 2DGYA 2B2VA 5KEEA 1AWDA 1V80A 2JT4B 3EJIA 2O4XA 5J39A 2Q8RE 2F1MA 1CSPA 1T0RC 4AQYL 3OWFA 3VAWA 2ALYB 2JA6G 2NPTB 1SN8A 2GVAA 1LYLA 1X32A 4JV5Q 2HIXA 4NJCA 4GN4B 1FRRA 4H2AA 5ELFA 1JE5A 2JQOA 1IKMA 1ZEQX 2Q2UA 2E2DC 4B3RQ 5AJ3L 4BBSH 2Z6KA 5EPLA 1EFWA 2CQAA 3PSEB 5M5YH 1W3SA 1LM0A 1NDDA 3QR8A 3KF8A 3SFDB 2JQRB 2L0FA 3I90A 1B53A 4A75A 4B9KA 3PV1A 3WOEA 4R4QA 4AQ7A 2D10A 4LF8L 4QCLA 2I38A 4HIDA 1A2UA 4A3JG 1FCCC 2DHZA 3I57A 4HPPA 4BY7G 5CORA 2VUMB 4EFOA 1HEZE 3HOVH 4IM3A 1KAAA 4JI4L 3NQTA 1GUTA 2NVQB 1HE8A 1WXSA 2HTHA 5AZHA 1H9SB 5C4XG 2F3IA 5EPKA 2L0CA 2BYFA 4TKOB 1VQKA 2I07B 3Q6BA 4CKBA 4R3DA 3CP0A 1YBYA 3MEHA 1CZWA 1PUTA 4UP8A 3MC8A 2YU9B 2JZ3B 1PV4A 4CJ0B 1TWCH 1SMYC 2KHIA 4KD3A 1PH3A 1VQHA 1XJVA 3HOYG 3EQLC 5C4ZA 3J7AF 1N32Q 2R93H 1ZDXA 1SE3A 1HNZL 3L0WB 3L9AX 1VRAB 3KK7A 2DNEA 2AWTA 1CKNB 2LZ6A 1J7CA 3IG3A 4XX5A 4G4KA 1YIWA 3VYUA 5D14A 1WR1A 5BN4A 3PLUA 1C4AA 3WAPA 1CZPA 4RM8A 2ASBA 3KLWA 1I50H 2WDQB 2BKFA 2I5MX 1BT0A 2EPBA 4A3GG 1WZ3A 4AP4C 2K04A 2RBMA 2IX3A 2ZPNA 4C3IH 1VQAA 1YQBA 1KLVA 2R7ZH 3RI7C 2PE6B 1YI2A 2DX5B 2I5HA 2JN4A 2XN9C 2M1MA 1C3TA 4YWKA 1WYDA 3GTQH 4NAWA 1YHQA 2JU6X 4KY6A 4C3JG 1WJNA 4KDLB 3A4RA 1B7YB 3CIRB 4OO1H 3Q69A 2EY1A 2NB0A 1I4RA 4L5RC 1JMCA 4ZK9B 4A93B 1WSPA 1E24A 1XEEA 1F9SA 1WGDA 3KF8B 3GOEA 5E4WC 1CKOA 3AEGB 4JI7Q 1KRSA 4QIWB 3CCJA 3DBRI 3MVVA 1U9RA 2LMCA 3E5SA 3OAWA 1A8VA 2KTRA 2A1AA 5BN3A 1J5EQ 3KLRA 4EQNA 3T3NA 2AWOA 2L7RA 3HKSA 2RPQA 4KHZA 1DD2A 1F2RC 3D8GA 5C4JB 2EYOA 2M2LA 2W9NA 4QL5A 5HURA 4AH6A 2ZM6L 1STHA 2DZJA 4OXPA 4G0NB 4M01A 1Y1WB 3CCQA 3Q6SA 1V9PA 4CDDC 3FKIG 2OEDA 1I3QB 3DBRB 3H09A 3UI2A 2CW0D 4M02A 4XZ4A 1Q8IA 3HOXB 1B8AA 1TYGB 1WXQA 4IM2A 3KH0A 4EE2A 1F2ZA 5JHAA 2FJ2A 1RD9D 1VQ4A 2LVOA 3PMFA 2KX0A 3FHWA 4A3KH 1LXDA 3CRKC 5JJLA 4HKZE 5C44H 5LMNQ 4L5TA 1TS5A 1HZ5A 2WXIA 3AH7A 3AULA 3PZ8A 5I6WA 2L4NA 5CTRC 3A9KA 1TWFB 3F2BA 3OTOQ 2J0MA 3EN2A 1GUWA 2K01A 4W9EA 1TY0A 4DV3Q 2B2TC 2F03A 4QQBX 2CS4A 5FLMG 4B3TQ 5C3WA 1VQGA 2KX3A 4KKIA 1K9MC 4K2LA 4PG3A 2NR2A 1R7SA 2JPHA 3AEVA 3URYA 2KCNA 3S2AA 2EYLA 1HTPA 4OIKA 2GI9A 1E22A 2JYTA 3DBLI 3DQVA 3PO3H 3R3MA 3RNAC 3MFGA 4DV2Q 3NTKA 3ZJUA 4NAWB 4G50A 1IZ6A 3AEAB 2K5HA 3LGJA 1X9NA 2ZEQA 2F0OA 2H4OA 2LRWA 5IYDH 2J53A 3O65B 1LTTD 3QWNA 2XRSD 3U7DA 3GTKB 3WAMA 1EOTA 2X6GA 4ASWC 3KFUA 4GKJL 2CHWA 2IGDA 1GB4A 2Q2TA 2R92G 2LMCB 3S1MB 3NHEB 3UI3A 1QB5D 3PUYA 2KTRB 3WWVA 4OELB 4RG1A 4X62Q 1TZ1A 1LV9A 2P5ZX 3Q3OC 4X64L 1S1QB 3GTJH 3SFEB 1JJCB 2C9WB 2K1BA 2ONQA 1A5RA 1CQVA 1DXMA 3Q24A 1ACCA 5FR6A 3N52A 3PIPA 2EVBA 4BBRH 5LMUL 4DV6Q 2MQHA 2Y0SE 3TMEA 2MA9B 3MXNA 3K5LA 2WQYB 2E8GA 3ER0A 3I70A 3HOZB 4HWIB 3J81E 4BBSG 1EQTA 1STYA 2PYKA 3B6YA 1Y8OB 1TVXA 1SBBB 3A8KE 3VR3A 2X8XX 4ZRQA 1BF4A 4ITKA 2EY6A 2NVYH 2XIWA 3HKZE 3VYSA 3CC4A 1P0RA 3P1HA 2CKHB 1EYCA 1GOZA 1RTNA 2CW0C 4LF6L 1XYIA 3DDCB 3SK4A 1GPXA 4PZ8A 2CCZA 5JJIA 2RD0A 1V2YA 2Y5CA 1NY4A 4WFN3 1QJOA 4YHHL 2PZTA 4YY3L 1SFOH 3A9KB 4HIKA 3HOVG 3JAML 1IBXA 3S1QB 1MJDA 3KDFA 2AKWB 3EBEA 3ZYYX 3X3NA 4R8NA 1K83B 5EE1A 1QWYA 5MPOA 3M7NA 3ETRA 4QGUA 5D2MB 2G1EA 1ZDVA 5CBEE 1PHJA 4GOPA 3FPPA 2J0JA 2ZJPA 4WJWA 4DFAA 4FHKA 3TP7A 1Z9FA 1A70A 1I4PA 4U673 3SDZA 3OYYA 1AEXA 4LDTB 2K03A 3VR4A 3APCA 4CKCA 1JJGA 1QT9A 2M00A 5LL6X 4ZUIA 2KWUB 3DWMA 2L12A 4L5SA 2CKZB 4M1UB 5C1ZA 5GXGB 4K6DA 4LJZC 2EELA 3ML9A 3VUWA 1Q12A 1G2TA 1FNWA 2VXWA 5CHFA 4IWPA 2PI2E 2MSED 4V0BA 2CU1A 4FP5D 2K5WA 4A3MB 3P4PB 1K3BC 1IW7D 4R4IA 4YTPB 3TRZA 2EIFA 3AQQA 3KOJA 4AIMA 1NJIC 1B50A 4FHJA 1C48A 5K5PA 4A3PA 3PUXA 3A4SC 4XXEA 1WTQA 1Q82C 2KACA 3MXNB 4RF0A 1TWHB 3VH4B 1X56A 2NVTB 1WTRA 3J7ZC 1ENAA 1GUGA 4JI3L 2UWQA 4OO1G 5CV9A 1YHBA 4AYBG 4DUZQ 2L1AA 2W54A 2EMTA 3VA7A 4DHZB 5GAEC 3I8ZA 2DYOA 3WDNA 3M4YA 5M3FB 1M1KC 1EU4A 5CV6A 1K8AC 2E2JH 3HP3A 5FR3A 4ANUA 3QOLA 4B9WA 3VHTC 3OPOA 1UWXA 3UE1A 1WX8A 2G4DB 4LNIA 3RZWC 3IKJA 4YCWA 1IXRA 2MJ8A 3GTLB 5BYQA 3JW0X 3BDLA 3PUWA 2KA7A 1RL2A 2LXKA 3T4AC 1A62A 2PMVA 1IBXB 4PMCA 3KDFB 3MFYA 2MLBA 3EFCA 3DM1A 2BQQA 1PQSA 2PLPA 2PVGC 4KVGB 4P6VF 1CHQD 3J81j 4ACFA 3W1YA 1N34Q 3AN1A 2L55A 3AYHB 2B2TA 4B3RL 5CHWA 2PZUA 3ZXVA 5M5WH 1DJRD 4JI0Q 5JVG3 2D5GA 1FD7D 4OZBA 3DMUA 1DOIA 2WAQE 4A3DB 1SSNA 1K0RA 3V62A 4R4TA 1L2FA 3H0GH 4A3KG 2K28A 4X66Q 1F2RI 5HG2A 2N9KA 3W2DA 4QY7A 2AUKA 4EZJA 2ZT9C 4UY8C 1VQLA 3F2UA 1P1AA 5KHOA 1VQDA 4FF2A 5FLXc 2YV5A 5HY6A 3I55A 4NXMQ 2N7DA 3L10B 3L54A 3V6EB 3I4LA 1MG4A 1QF6A 3PIP3 1RWSA 1IBMQ 4F8MA 1WE6A 1ONLA 3ZDMC 1E90A 1PGBA 3PF5A 1UE6A 1XXGA 5COYA 1IW7C 3K6OA 1B9NA 1OQRA 1GG3A 2F0WA 3W1GA 3PO3G 3SK6A 1YOVB 2KEEA 2DENB 1F9QA 1TKGA 1XD3B 4USAA 1FGUA 1TR5A 1PLFA 2ZXPA 5IYDG 1N32L 2WKDA 3ZTCA 3DBHI 2A4ZA 4MDKE 4EQ5A 1D1KA 1KHIA 3N9YC 4MELA 1EL0A 1L0XB 1Z47A 2MRPA 1KDAA 1XNRL 3JVZX 3HOWH 4DV0L 3A9JA 1NUCA 1Y8RC 5GROA 2KDFB 1VQBA 3NPPA 1SNDA 2VQEQ 4ZKCB 2FE8A 4A3BB 5CX3A 3TQYA 2F0JA 2IT1A 3T56B 4IALA 5J3BA 1TKYA 2C5CA 3TUOA 3W5UB 2MQJA 3ML8A 4HN7A 2K6AA 3AMZA 2EXDA 3EFUA 1YNND 3CMEA 4LF8Q 2NVXB 2ASQA 4RM9A 5E6OA 4CHKA 3Q3JA 2IO3B 4IC7B 4RNAA 2JZZA 1MHWC 2WXQA 4S17A 4XE0A 3BK1A 4YCUA 3CMMB 2E3TA 1SRUA 3K5MA 4JI4Q 2LXAA 5ELBA 2KWDA 3OWEB 4EX5A 3TJPA 3MTSA 1FJGQ 3H6MA 2INNE 2F3WA 1FYCA 5JPNC 5IGGA 4B0MA 1Q1OA 4FLHA 5K36H 3I91A 2BDNA 4MTKA 1EWCA 1T5XD 5IGBA 3BK2A 1AH9A 3P42A 3ERQA 3W1SC 4M0WA 3I4MB 1YN4A 4HPMB 1ZW7A 3CF6E 2HQEA 1I4GA 4PZ6A 4AOFA 1BVSA 4XQJA 3S2HB 4C80A 4WWMA 3ZJTA 1S5DD 1I6VC 1PH4A 2PVOD 3PCOB 4G11A 4CYEA 2K33A 1CMXB 3AMUA 3DUZA 3VR5A 2HJ8A 3ZKJC 3K7UC 3M4PA 1SIFA 3AU4A 4HJ7A 1EIYB 1K8OA 2NZHA 2D62A 4IUMB 3BYYB 3VH3B 4LJOB 5J18A 3U58A 4ODGA 4A93G 4ZKBB 4PZ7A 3R7RA 1FNUA 4BKSD 2QDBA 4HJ9A 1WYGA 4RH6A 2DYBA 2B8GA 2WU2B 1PTOF 2HDMA 3OTOL 3JSVA 1VZ7A 3W3AA 1ZUD2 3A9JB 3M7GA 2KWVB 1VQ9A 2UXBQ 1HRJA 1KLUD 1R9TH 2KECA 4ZRIA 4B3TL 3MTNB 4HCPB 4JCVE 2WDVB 2IDYA 3E0EA 4KX6B 2N49A 2QEJC 2INDC 4WJPA 2OF1A 2BCOA 4A9AA 2L8JA 5AUKA 3TEZA 4LFCQ 3STBD 1R4NI 2PMZE 4EOYA 1EWIA 3I72A 1YNNC 4DF7A 1DM0B 2B2YA 4NB3A 4LF9L 1ET6A 4QUCA 4ME3A 2Q5WD 2KFJA 1ILPA 1CZGA 3HOXG 3PS6A 2D07B 4PT5A 1EY8A 3NVYA 1OXTA 3I4NH 1EY6A 2PZWA 3NWTA 5IGFA 1LTBD 3X3MA 3QARA 2G5DA 3K5NA 3AE4B 3DVGY 5C23A 3UGBB 1Q86C 5J17A 1FPYA 2ZM6Q 1H8CA 2PQAA 3QG1A 3M3YB 2HCIA 4X3KA 4W9IA 4X62L 2REXA 2XWJB 1PH2A 4N8FA 4NJ6A 2V9HA 1JOQA 5L37A 2MJ3A 2KEDA 3EIVA 4PS3A 2PCFB 4ARCA 1K3RA 2B2VC 4HJ5A 4M0WB 4KD4A 2BWFA 1NVID 2KMMA 4DDGD 2EYFA 5HGTA 4L1BA 3IAYA 3AU5A 1SIJA 3NG0A 1CUKA 3D4RA 4WJ4A 1G91A 1B9RA 2D3BA 2E2IH 1BBWA 2KVMA 1WJJA 2CWAA 3M4OH 4I65A 4KK7A 3MC0B 1Q3LA 1TWAB 3UDXA 1GUOA 4C2MB 4DR7L 2AX5A 1VQFA 3GZNI 3D4DA 3E9HA 1H9RA 2KN5A 2L76A 3QC8B 3H0GG 3UQBA 1SSOA 2MP1A 1E9MA 4K8IA 1JORA 3A55A 1VS0A 2G3QB 1BCPF 3C1EA 4OZAA 1VQCA 3JSVB 4W9JA 3F2DA 1N36L 3OMCA 1RCVD 4JBJA 3LDZE 1X55A 3UE0A 1P3QU 1IL8A 4FVMA 1H9JA 1WRDB 2KDEB 1KNAA 5I6YA 3ULPA 1U5KA 3GTMH 2KCTA 2DBYA 2MP2A 5KNDA 1SXTA 3A7AB 4WORA 2IBIB 2K14A 4KKSA 5E1FA 1ET9A 2IO2B 3NTHA 3ONSA 4DR4Q 1GUAB 5D3DA 1K8RB 1NBFC 3L17A 4JPSA 1NR4A 2YTXA 3U30A 1WFQA 4CQNA 3STBC 1UELA 2K50A 3BVZA 1VQMA 3RYTA 2F0EA 4RHSA 2F0IA 2K4KA 1VD2A 2VY3A 5LMUQ 3PV0A 1TWGH 3S14B 2K8CA 2WXPA 3TIXA 1JRPA 4QB4A 3HOWG 2PQAB 2HDEA 1KDCA 2A5HA 2D0OA 2F4VQ 1S5BD 2JA5B 2F0PA 3H15A 4C3JH 3ENEA 1V1PA 1XPRA 3VTVA 1EQVA 1WTXA 2KXJA 4EZKA 4KLKA 4K7SA 5IYCH 5D3IB 3ND8A 1JQ4A 1N63A 4WQOB 3SK5A 1WF9A 4RMAA 2DY7A 5TSSA 2Z6BA 4POGA 1BUVT 1A3TA 2KWCA 2UXDQ 3A1QA 4N9F4 2EJGC 3W1SA 1Y1VH 1Q81C 4TQUS 1CHPD 3DPDA 1EY0A 2LS01 3G71A 1JWBD 4N8X1 1ZYRD 1RHPA 4GZYC 4NP5A 5FLXL 4BA2I 4TVAB 3RN5A 4DUZL 3S17H 4OW0A 2KBNA 2BPSA 1DOXA 1YX5B 3DHIC 3N6RA 4DK0A 4BKGA 3ZRCA 3A33B 4TV3A 3G6EA 3R3OA 3D3RA 2OCEA 4DV7L 3CQZB 5K36G 1ZPSA 2O5JC 1MSGA 5ELCA 1NMGA 1JB3A 4RHRA 3TDQA 3U4VA 3FKIH 2KC2A 2M8SA 1X3GA 2O6VD 3GS2A 2N9LA 2I46A 1LLRD 1LTSD 1TKEA 1PTOD 4IWOA 3VUYA 4B08A 1HXYD 1IKLA 1YD8U 3TREA 4AS1A 2EDGA 3DLLA 1JB7A 4JL9A 2LUEA 2BT6A 2FNJB 3W5VB 4MH8A 5FO8B 3AFQA 1YJNA 1PDXA 2MP2B 3TS0A 1BBXC 3MJWA 1KOTA 5C3EB 2EJMA 3N3KB 4JWUC 1LTAD 1WGRA 4JI0L 1HZBA 3KBXA 1ML0D 3KUPA 4GGQA 5D94A 3UINB 3M63B 4B6WA 1FVIA 1XTCD 4S3SA 4DN4M 2WINB 2DZIA 2KQ4X 1NI3A 1U4LA 1QKZA 4H7BA 4X66L 4DNIA 2ENBA 1JOKA 1YJWA 2BW2A 3RD2A 5M3FG 2IX0A 3P63A 4IUTA 1RYJA 1TIFA 2ZVNA 3ITPA 2A74C 5G55A 2K39A 2JX5A 1L4ZB 3PSIA 5E4XA 3JAMc 3P4RB 4TMAB 2PPBC 2BWES 4NXML 2M0XA 5EJWA 1HZ9A 1WGYA 4JI3Q 2R61A 1HJPA 1QNUA 2A8VA 3DEPA 2JA8H 1IBML 4MACA 5C5MA 2K22A 3IBEA 4BFRA 4JBKA 1FEHA 4KKJA 4W9GA 2YLMA 4KSKC 2LGSA 5KHQA 5KGUA 2MCNB 5ISRA 3K8AA 2KOLA 4MEMA 4ZOHC 5E3FA 4XTCS 1V49A 1PFSA 1VDVA 3K7AH 3V3XA 3ZLZA 4YTNB 3CCSA 3A1QB 4PK1A 2WV6D 2H5XA 1IYJB 5I4DA 4A3IB 2I1KA 1MG8A 4GSWA 3I9V1 4HLEA 3U2SC 2Y0SB 2LJIA 5EQ0A 3I4NG 2ZCBA 5DPRA 1ZYRC 2F0KA 4RMFA 2E74C 3Q8AA 1PMRA 1PH9A 3OJ4B 1LTLA 2WXKA 2B29A 1PRTB 1C0AA 1D5ZC 2HUGA 3U9OA 3H94A 3J7YW 2VQEL 3N20C 1BCPD 3HKZB 4HIOA 3PREA 1C8CA 1YN5A 1CA6A 2DAJA 3V61A 3ZIMA 1E3PA 4Z9CB 3PF4A 1T0QC 2KQ3A 1PTOC 4QF4A 3M4QA 1C4QA 4BKSA 3VRBB 4PS8A 1UWMA 2LD9A 1Q5WB 4KIKA 4IWQA 1Z2MA 4GMVA 1E8XA 1FJGL 2ZZPB 2JEBI 2MUYA 2NN6G 2NTSA 3CCMA 4JI5Q 1YEZA 3K5OA 2IL8A 4RGMA 1WVLA 1EZ6A 3NUCA 4DR3Q 4HKQA 1MPEA 1VQ5A 3A8IE 3P2BA 4DWFA 3UDFA 5H1SE 5EDSA 1LUZA 1VCIA 3QAQA 2GBJA 2RDGA 1I6HB 1E8WA 2KFKA 3AEFB 1HUMA 2PW9A 2KJXA 1L6VA 2N78A 3M9BA 3RLNA 4RWSC 4DK3C 4IFDJ 2DZKA 1WX9A 4WIPA 4IJHA 3B9JA 4PYZA 4FYDA 5KNBA 4A3EB 4NXNQ 1SR3A 1HNXL 2KANA 2NBUA 2C9OA 1SF0A 1WH3A 4A55A 1DOMA 1C79A 4WWOA 3A8JE 4JK1C 4F87A 1YITA 1ZP0B 4IUPA 2AWNA 3IAS1 1XNRQ 3MXGA 1BNZA 4LLGM 1JJ2A 5JJZA 3I4OA 2KUMA 4DV0Q 1EOVA 2M9VA 4GOPC 3SK8A 2CHBD 2DNFA 4P7IA 2IY1B 2WX1A 2NZOA 2R7FA 1VR9A 4C3HH 4WAAA 1EIGA 4BY1H 5BO4B 4POFA 1QNKA 4EQOA 3DHHC 4AUQC 2MNAA 1XLQA 1PH1A 2V1CC 1CA5A 2IY0B 1MHHE 4LFBQ 3C8YA 3IFWB 4K2KA 5CMDA 1S4ZA 1ZXIA 2K5PA 4MTNA 1NBWA 5IKCM 2IHEA 5IYBH 2FCNA 1HNWL 2VRRB 2E5LQ 2UXBL 2UYZB 2I0QA 3P20A 5IYCG 3I4MG 5CYUA 1KXLA 1PFMA 2HHHL 4OZCA 4BZAA 3MA2B 1BCPC 1PYBA 4C1NK 4XWWA 4KSLC 2QSDA 4QMGA 2A69D 3W1BA 4N9TA 4LFCL 3T8MA 3S16H 1Y1VG 3CC7A 1WTOA 1MVKA 4JPBW 3ZUNA 3CMAA 2XTIA 2ZVOA 4KIKB 2FMCA 4KI0A 2QILA 1Q7YC 1M8AA 1C78A 4B3SL 2YYZA 3E9IA 3RFZB 1R4MB 1IBKQ 3NE5B 1MFWA 3G4SA 2HIVA 1GXDC 3NHHA 3P75A 2BH8A 2ICIA 3ZNZB 4UAIA 4MSMB 1G51A 3P4QB 5M5XB 4KHVA 2JSOA 1V97A 2Y5PA 4N58A 2KFKB 2FUG1 2MHVA 4IFDI 2WAQB 1VCBA 5DM63 3L2PA 3RZOH 4GKKL 2R2QA 1STGA 2N3SA 1LQBA 3J9CA 3A56A 2MWSB 1XT9B 2RQXA 1J19A 2EQSA 1Q1BA 3AE3B 1T0YA 3AM9A 1A63A 1HTQA 3VR6A 1DGSA 4HVBA 2K5DA 1U4MA 4JI6L 4J6HA 5IP9H 4YSYB 2ATWA 3W9CB 3TSSA 3Q8EA 4UP7A 2LSSA 3FPUB 1P9DU 2XNAC 3M62B 2N9PC 5AEKB 1FIQA 4XIGS 1B3QA 2VNUD 2JYEA 5E6PA 4HCEA 1KLGD 4Q0FA 4R4CA 4AYBE 1SE4A 3I56A 4LTUA 3SEBA 1D7QA 4DV1Q 2L05A 2RDBC 3RUIB 2JP1A 2G4SA 1F9RA 3OIQA 2UU9Q 3PO0A 4LF9Q 2N9EB 1V8CA 4OONA 2JA8G 2F0VA 3NOBA 1XQQA 3UDIA 1IP9A 2HJ1A 3CPWA 2ZTCA 2L15A 3OW2A 3ZQ4A 5T8IA 4URKA 5GAHC 2C60A 3AE9B 2RPVA 2K5NA 3D32A 3Q22A 5BYRA 1MGSA 3KF6A 2BDOA 1SDFA 1X65A 4DR4L 1DONA 1RRBA 1WGKA 1QILA 3OHXC 3B2GA 3SE0A 2A69C 2VUMH 2O6VA 3K0XA 4A8XC 4C00A 1PRTF 1YZ6A 1STEA 3WA0A 3Q3MC 2FAZA 2NVQH 2GBMA 2WACA 4GOCA 3EECA 3PO2B 4KTAA 1VQ6A 3S1NB 3AECB 1OGWA 5M3MB 4EUTA 3PT2B 2BKRB 4HEDA 3VFKA 3ECIA 2YU9H 4MIUA 1K8MA 3IAM1 4FXDA 3GTOB 1LACA 3J80E 2F4VL 3HEJA 4HMJA 3WANA 1OEYJ 4Q2JA 2RCNA 3SVMA 1EQRA 4DR7Q 2JA7B 4EEWA 2LFIA 2OQ0A 2B8FA 5IT9E 4K7WA 1Q0WB 4GLVB 4RKBA 2ZW1A 3FAHA 3X0WA 2O2LD 5JAVA 3CCRA 4KZCA 4WQMA 5DCNA 3PGEA 4A3FB 4O0AA 2PE9A 1LFDA 3KJPA 3Q8BA 2ZW0A 4DR2Q 2UXDL 1WCMB 3CCUA 3A0JA 1Q1EA 4JW0A 4FF3A 1JWSD 5AZGA 1PGXA 2JRIB 2KN4A 1N36Q 1M4VA 3HUIA 1OEYA 4X3UA 2GRIA 4P16A 3IT6B 1L6UA 3OW7A 2IHFA 2WB1G 5E6JA 1UD7A 1WTVA 4MGZE 1IHZA 3HVZA 3NBHA 4IOCA 3GTGB 4NY0A 2EY2A 1BO0A 4KN7C 3TBIB 4US9A 3GTPB 1AZQA 1K52A 2KK8A 3CSTA 2JA5G 4KV6A 2SAKA 4S0RA 5L83A 1EIHA 4N9PA 2FIFA 3MP9A 3L3OC 4E74A 1OXXK 3TP8A 4A93H 5HFYA 3F2CA 3T53B 2MX2A 3DWAA 3HFZB 2HDLA 3NS1A 4L63B 3BDCA 3VR2A 4G57A 4C1NI 1FXTB 3KF6B 4ZRJA 4YSXB 2LXJA 3FDTA 4JOIC 4C3HG 4BY1G 5IWAQ 3K0YA 1LGRA 1GUNA 1RFAA 2AL6A 2O6VB 3B1LX 3TEYA 4DK5A 4LUZA 5C4JH 4WRDA 2NBVB 1NNXA 5LMNW 2L32A 1PTOB 3WCQA 4B0EA 1WM3A 1FCLA 2IX1A 3HOUB 1WMHA 1WGHA 3PTFC 1V6EA 1VQEA 2AHOB 2PMZB 2ZNVC 1RM6C 3LXFA 1MI2A 4JVZA 2WS3B 4XWTA 1Y69U 3M85A 3ZTDA 5IYBG 1Y1WH 1SYFA 5JOBA 4NMZA 3R93A 3HM3A 4MN3A 3HZXA 1I4XA 4YWLA 4JBMA 1I3QH 1NE3A 4OGQC 1FFUA 2RVLA 1GB1A 4IURA 3AEEB 1FRDA 3HOXH 4IKGA 1UUPA 4FO2A 2JYOA 2JXXA 3LB8C 1FL0A 1NTGA 2KDIA 4OL7A 2A73B 4I7ZC 4DV7Q 5EKKA 3H3VC 1D2BA 1F52A 1K50A 2CJOA 2B39A 4KY7A 2JUOA 3ICEA 4WJNA 4IUUA 4GDLA 4PNYA 4K0KQ 1WWTA 1JCKB 1TWFH 1WD1A 2KMAA 4KGRA 3T16A 1RFKA 3BYTB 1PDQA 5KIXA 2EYPA 2G9HD 3V96A 4OWTB 1J7BA 4K8JA 2JXTA 2B2YC 1R4PB 2MBOA 3B08A 1W6JA 2WKCA 4A3OA 2MJDA 1TQOA 4P74A 2LWPA 2FHTA 3PGZA 1ZKHA 4DBGA 2Z0DB 4BXXH 1MBYA 3T51B 3NBHB 4GOPB 2ID0A 3CRLC 2FFKB 2C5LC 1F1HA 3VR8B 2WXMA 4M8MA 3S1RB 4W9HA 2ON8A 1F77A 2WNMA 1CQFA 2LRUA 3MXPA 1HA5A 2IW3A 3CHBD 3DM3A 4ZUJA 3NSWA 4TSSA 3WOFA 3RNEC 3NXWA 3QB3A 3RCZA 1JWAD 1TIID 4XT3B 3GTKH 2KAJA 1S3SG 3G7LA 2NN6I 1V43A 3S1MH 2L11A 3IFTA 5IP9G 3HHMA 1L0WA 3HVDA 2FUHB 2G9DA 4X3TA 1N6ZA 2Y5BB 3J81L 4A3IG 2K52A 2KVRA 1M94A 1JT8A 1BCPB 2VQFQ 4JI5L 1PRTD 1Q90A 5M9OA 2Y0SG 4DR3L 1E8ZA 2JA6B 4M00A 2OTLA 4KHPQ 1WMHB 4RKLA 3CWIA 1VQOA 1PZKD 2N1WA 2EMSA 3HOZH 2ZXRA 1WYWB 3APFA 3BU2A 3EFXD 3S9WA 2KJ6A 3T3OA 4NXNL 4EGVA 4P73A 2JEAI 3HKZG 1OQYA 2KD0A 4GIVA 1B44D 5GAGC 1WX7A 5EKLA 4LJPB 4NAMA 4HEA1 2OT2A 3LNNA 3S2DB 5CV4A 1E7PB 3KUCB 5C2TB 2BYEA 1A6XA 4GDLB 1SROA 4A3JB 1QQRA 1Y56A 2BS4B 2VUMG 4BY7B 3GV6A 5LXHA 1IYFA 2INCC 1Y8NB 2KDBA 1B3AA 1UZXB 3S1QH 5C4XB 4NQLB 1SNMA 2IO1B 5HI1A 1K83H 1ESRA 4LFBL 5CHVC 3KW5B 1UF0A 2FINB 3CCLA 2QIEB 1E2VA 2BVCA 3PZ7A 4K14A 1FM0D 3RPFC 3ZXRA 1WZ0A 2FXQA 4IOIE 3EUB2 4HAEA 1F9PA 2E5LL 3KUDB 4GLAC 4YL8A 1O7ZA 1M90C 1VZ6A 4C4VA 1CKMA 4OWWB 3HOYB 4I6PA 2JWUA 2LVQA 4A3CH 5IOIA 3R2IA 2LY7A 2E2HB 1FMAD 4ZAIA 1NAPA 1JRUA 4IUNA 5C5LA 4CKEA 4GNXC 1E6EB 3HGBA 1XMOL 2GMIC 3I73A 1EYAA 2N88A 2N7EA 4IO9A 3N30A 1WD0A 2KHWB 5BMHA 2Z4HA 1NYQA 1V5OA 1V81A 2WDRB 2HD3A 1NR2A 2J0TD 1V1QA 5DNFA 2EKIA 4OX9Q 3QCAA 2KCMA 2QC8A 1A0IA 1RF2D 3S15B 1V5TA 3NY5A 2MJEA 4YSZB 1E10A 4A3MH 1HNXQ 4DDID 3RMHA 3RZDB 1IBKL 1HQMC 3IVFA 1ZOYB 2HCCA 4A3GB 3Q2AC 2Z0SA 1SJED 4W9CA 2MGSA 3K58A 1IYVA 5G5GA 3J7A5 4H0LC 4IN3A 1XCQL 4JOIA 4EVOA 4FULA 3ZDTA 1PRTC 2FCMA 3UQAA 1TWHH 4A76A 2NVTH 1Y14B 1EYGA 3AE8B 1EO6A 2XVSA 2GB1A 1B2TA 1QZHA 1KIXA 3E9SA 3RNGC 4FBJB 2W3SA 4X65Q 4BWGB 5M3FH 4JQWC 4ZCKA 3PIO3 1F2MA 2RSNA 4G7ZC 3PHXB 2KTFA 3VRAB 1HNWQ 1HTLD 5IA7A 2PIAA 3C1FA 4DV4Q 3BZCA 2HQLA 4DGZA 2ZPYA 4DUYQ 3GTLH 1C9FA 1AW7A 2CR5A 4LF4Q 2MHJA 2HHHQ 1BQQT 1G2SA 4O2DA 3DWPA 3BWUD 3R8BA 3GB1A 3K81C 2GBRA 4HJKA 1N8RC 2LUMA 2JY6A 4DR1Q 2EY5A 2XBBC 1GJZA 3ZO5B 1UNSA 1YQ4B 4DV1L 1Y1WG 2X69A 4HSPA 3OMGA 3NZ3A 5DPSA 1BXTA 2UU9L 1JR0D 2KZRA 1PZID 2LHDA 4P75A 4ICUA 4QJFA 4B3SQ 1UEAB 1BMLC 4C4VB 2WX0A 4RF1A 3WALA 1IUEA 3UDGA 4A3DH 5A2QL 3LWUA 3BZDB 3SR1A 1Z7TA 4WJOA 1KAWA 2PQEA 2PW7A 1DOKA 4R8IA 1TBEA 3QA8A 5BMGA 3PHWB 4H44C 4ANXA 3IL8A 4ZDVA 2C7MB 3LJ3A 4JI2Q 2VH2A 1RJTA 2F0GA 1GC6A 4WH4A 3R2TA 4MHEA 5C0XJ 4GKKQ 2ACZB 2ES2A 1YMHE 4EZLA 4XDXA 4L5QA 2RCFA 3ABVB 5D6JB 1JROA 2EXZA 3NRZA 1GO3E 4Y7NB 4IFDG 2G45B 5E7NA 3JAMi 4BXXG 1J0GA 1D3ZA 3MZ5A 1EY5A 2Z1CA 4BA1I 2MEKA 4HRSA 2ICEC 4JI6Q 5JVH3 4P1BC 5I2YA 2V4DA 1CJEA 1I7HA 3MEFA 3H3VI 1IGCA 3NWSA 4HMIA 5I9PA 2Z8LA 4H13C 2N7JA 4ME5A 1ESFA 2SOBA 3I3CA 1KRTA 1OFFA 2J42A 2DUDA 1RKNA 2J52A 4AJYB 3KLSA 2L5TA 1CI3M 2ZNVB 2NN6H 1NI2A 2WXOA 3U4EG 2X38A 1OTCA 4US8A 4DR2L 1UGJA 4MGIE 3VTUA 3WIMA 4LFAQ 1E8YA 4AJWA 2RDFA 4MGKE 2R92B 3ZVVA 4H02A 1KDBA 2WXLA 2J7ZA 1YHAA 2QDFA 3SGIA 3PVLA 4XDDA 1XPUA 2RGFA 3VDYA 4A3BH 3RNFC 1CK1A 1PYWD 2PEAA 4HCSA 2XK5A 1PA6A 1SLJA 2KDMA 2L00B 2AQ2B 1I94Q 1VQ8A 3RT3B 4KJNA 5LXIB 1K28A 5M3MG 5IIFA 2NVXH 2GOWA 2INPE 3IXSA 2AUJD 3PLVA 1RIPA 1D6EC 2N55A 4PQXA 3HOZG 1HPCA 1MJCA 3RZFA 4NQKE 4BBSB 3FP9A 1ENCA 4DU9A 3RNCC 4FJYA 1I35A 2RA4A 3BG3A 2UUCQ 5M5YB 1AYFA 2K6DB 3DVGX 1F9JA 1GD7A 4LW1A 1MI0A 2DWQA 1BUIC 3LYYA 3Q8FA 3H8HA 4YWGG 2JA9A 5DM73 3Q14C 3PRPB 4LNFA 4NPSA 4I6LB 3GD7A 3GQBA 2WXRA 3PPAA 2WYQA 4PMBA 5GMVA 1P7EA 2OQKA 3BY4B 1FO4A 2K6QA 1KH0A 3GDEA 5IWAL 1HCZA 5C0XI 4DNRB 2ZTDA 3HOVB 4GNXA 3I4MH 5J22A 1EQQA 1EWYC 2BH2A 4DR5Q 3ZNID 2GVBA 4L6TB 4PV1C 3S2HH 1SE8A 3H91A 1TY2A 1PGAA 1VF5C 4HTHA 1N60A 3KVFB 1BBUA 1IPGA 2L3ZA 2KHSA 4YT0B 2QHOA 1BOSA 2PNRC 2DJFC 2CFMA 3CF5A 3DCGA 3H9DA 1U4PA 4O42A 1TWCB 5BR8Q 3J7AV 1STNA 1WJ4A 3MHZA 4A3CG 1UWVA 3RN2A 1EM7A 1WXMA 2PTLA 2R93B 1WXVA 2O2VA 4KKUA 4V190 1VQ7A 3QWZB 2SNSA 4HJAA 2YEPF 4XYCA 4MSQB 4BAXA 2VS1A 3KUZA 4K0KL 2RSOA 2D0PA 1GVPA 1UE5A 3QO2A 2A68D 2KYWA 1IBLQ 4LCDE 4A90A 4LK0M 4A3MG 1EEFD 1I50B 4K6LA 5CGKA 1PH8A 1ZGUB 1TS2A 3Q8DA 1HUNA 1X3FA 3PUZA 3GE8C 2XK5B 4C3IB 1WFYA 4F8CB 1XTDA 1A2TA 3HOUG 2R7ZB 3VDZA 4UPAA 4XGAB 3P7JA 4BS9A 1PH6A 3GTQB 3H7PA 3U7ZA 3TEWA 1XLOA 3T1YL 2DAFA 2BS3B 4M8AA 4AYBB 1SYCA 4KKTA 2JSVX 4KGSA 5J1ZA 2V3NA 2OTJA 2SEBD 5AFWA 1PXUA 1UEBA 2IGHA 2ZJRA 1V86A 2FIDA 3M3YH 1T0SC 2CHZA 4YTMB 1J6QA 2UXCL 4IDIA 2Q8IB 3ZNHB 4R1JA 1WTPA 2B63B 2RHSB 1V1PB 1KL9A 3R66C 1STAA 1MD2D 2GN5A 4UDUC 3CKIB 1STBA 5CV8A 2VQFL 3QOJA 4GNXB 3C2PA 3D6WA 1A15A 1TXYA 1DZ1A 4KHPL 2BGFA 3M95A 4DK1A 2L0TA 3V60A 2WXFA 4MZ9A 4A6QA 2F0NA 2NUCA 2F3VA 2MBQA 4HROA 3RUZA 1L4DB 2BBCA 2F0MA 1D8LA 4Y52H 4GDKA 4LF5Q 1H9KA 2L52A 2WU5B 1QUQA 1TWAH 4C2MH 4FF4A 2UUAL 1XCTL 4YCVA 1X3EA 3EA6A 1FXIA 4RCOA 1OXSC 4LF7L 3ONAB 1U4AA 3AFPA 5EPJA 3N1XC 4A3DG 5HKHA 2O2VB 3MJ5A 3NVVA 4A3KB 1Q46A 1QCBD 4UHVA 3NTIA 4FNFA 3CCVA 1ISNA 5C44B 4OEMB 1WJUA 2A5UA 2K3UA 2F0DA 3I3TB 1TZOA 2WP9B 1VQJA 1A3UA 2J7QB 1FNVA 1SYBA 2CJNA 1ZKOA 4ANVA 4JI8Q 5D7GA 1LTGD 2JJQA 1HZ6A 3T13A 2A68C 2BB5A 4B3MQ 2LGIA 3NQIA 2RMMA 3H3VH 2VB2X 1KM7A 2FBWB 5EBCA 4A4IA 1KTKA 1O7IA 1WIAA 5IP4D 1HH2P 3K59A 4CO7A 1GHJA 2JE6I 2LVPA 4DXFA 3PO3B 1QVCA 4L8JA 2DZMA 3HS0C 3H7PB 1GUSA 3NJTA 3Q0AA 1ASYA 3Q3NC 1F0ZA 1C7YA 3QK0A 1VMCA 3VR9B 1YNXA 3ALBA 2LASA 3TS2A 1XF5L 4ZYNA 2WWZA 4EQPA 1VLBA 1XNQQ 1OXVA 5FO9B 1PVOA 4IPDA 2F0QA 2OEOA 4IJLA 4ILWA 4DAPA 3S14H 2IPKD 1WR6E 4CDFC 1QOBA 3VUXA 4B95A 4IPHA 1N33Q 1O78A 2D2CC 2MW5A 2WGSA 3OG5A 3MHBA 2CU3A 3SD5A 3HRZC 3A74A 2BA0A 2WIIB 4OX9L 4JE3B 2JA5H 3SHQA 2MO1A 1Z6HA 4UP9A 1B4OA 3HRDD 3CSFA 3GTJB 4A3BG 2BS2B 5EE0A 3RN9C 2OOBB 1K8GA 1ENFA 5FO7B 3QJYA 2IO0B 3TZUA 3NEMA 1HZAA 4A3LG 2GA4B 4BBRB 2FCQA 2V4LA 1DYQA 2KHJA 2MH7A 1VQIA 3E3XA 2K1FA 4GDKB 1C4PA 1H9MA 2EYMA 1QUQB 1VF7A 1KQSA 3CW2C 1K53A 1KF6B 3AE1B 2WXHA 1GHKA 3DOWA 2NVYB 2M56B 4X65L 2NCNA 1UE7A 2CH4W 1L1OC 4E6IA 3CQZH 5C0XH 3APDA 1R4MI 4LNQA 1ROEA 1TKWB 1T5EA 3NENA 3J80c 3J81c 4DV4L 2BB6A 3VXWA 1UE1A 3Q23A 1SFOB 4DUYL 4MH0E 1E2ZA 4GB9A 2KJRA 2IGGA 1OO9B 5IT9c 3GE3C 4LF4L 2PKOA 4J6IA 4FDBA 1K73C 3VTWA 2QW7A 3C19A 3NS8A 4DR1L 1G6PA 2EYJA 1XMOQ 1ZE3D 1HQRD 2PJHA 2AQ1B 1D1IA 4K5XA 1HR0W 2A6HD 4DK6C 1EWHA 4L2YA 2WB1E 3KBGA 2QDLA 5C3EH 1GM5A 1CSQA 4NKLA 4YWMA 3EROA 1TTNA 4MM3A 3JAME 4OIJA 1TS3A 2FCSA 1JWMD 3RMKC 4AWJA 3TMPB 3D4WA 4DR6Q 1C4CA 1NYRA 1GJXA 2KQ7A 1EY9A 5DLQE 1QOHA 3SXHA 5CBAE 1QOAA 4KN4C 3AE2B 4TRDA 4HSVA 4ICVA 2B2WC 3D6CA 2LGDA 4JX1C 3D0FA 5NUCA 4MJSA 5L95C 2I5LX 3L4PA 1J8IA 4JI2L 3ZNGC 4NPNA 4HR7B 2AEHA 3N1ZC 2LFNA 5JEAJ 4FF1A 2F0UA 2QF7A 4B9XA 3QJZA 2MBBB 3KJOA 3VA5A 1I4QA 1B1ZA 2EOTA 1JE4A 4JG2A 5CV5A 5FJ8G 2GBNA 3PUVA 5LL6S 2CQOA 4P72A 2H89B 2N8NA 4DV5Q 3FILA 1EIFA 2BYVE 5JXVA 1D5MC 5DPWA 2LJ5A 4GLXA 4A3IH 4HIMA 4II3B 5G3LF 5KYLA 2JWZA 1KNEA 2BOSA 2RKSA 3O13A 1QVFA 4PMWA 3K80C 1MSHA 2DNCA 2A6ED 4IZ8A 1YNJD 1B70B 4LFAL 3NZUA 1ICFB 4LAAA 2E2JB 2AYOB 2K9XA 4E3CA 1S5CD 4P71A 3KYDD 2JVCA 4DHJD 1J9OA 2Q2IA 3NK9A 1CM9A 4KMUC 3FVQA 1X54A 2V4IB 2K32A 4IUVA 3BS1A 2QJLA 3RR5A 1I94L 4WURA 4W9FA 1Y8PB 4MT5A 4DAMA 4BKTA 2F52A 2K5VA 2F4IA 5DPTA 5A35A 1JALA 3N1YC 5IN7A 5M5WB 2A6HC 4GN3B 2HT1A 4MM3B 2X6LA 1A3VA 5IGDA 2UUCL 3NZSA 2M0AA 3TBLD 3CXCA 1G6ZA 3FKYA 1YJ9A 1K0SA 3IRBA 1DGJA 1C1YB 1E0ZA 2B63H 1SB3C 1H95A 3H0GB 3KQ4A 4HDQA 1SYGA 2RR9A 4CHTB 2M19A 3RNBC 4DPGA 4LMQD 4ZQ3A 1I6HH 4J3OD 3EC8A 4MJSB 2KC1A 5ELDA 1S3OA 4ZRKA 1EUVB 2V3SA 2VZKD 1XLPA 1II3A 4F7ZA 4ZRPA 3TCAA 4DR5L 4A3EH 3B0AA 3T9LA 4KDIC 3AE7B 4EKUA 3ULLA 2B2UC 1WTWA 1VJKA 2BTEA 1SMXA 3MHSD 4JI1L 5D65A 4CGYB 1Z5SB 3DBLB 2AQ3B 1UBQA 1YX6B 2CVRA 1J8CA 4DAYA 2SNMA 4GU2A 1SE9A 4K81A 3X23A 5BR8L 1YVCA 4XT1B 1ASZA 1E7UA 3FILB 2CHXA 1E2WA 3CU7A 3T1HL 3VYTA 1O7LA 5EGTA 1LT3D 1FFVA 3TP5A 3I63C 3AE6B 3K9PB 1X3PA 1NSNS 3AXCA 2TSSA 4XC2A 2FMMA 2ZJQA 1E5WA 2UUBQ 4RCNA 3HOWB 2W55A 1S5ED 2A6EC 2OJRA 1IBLL 1YNJC 1TJEA 3QX1A 4IQZA 1MKHA 1L1OA 4X6AH 1RDPD 1XWEA 3DHQA 1WGGA 2KKCA 4C7YA 1SEBD 4DXAB 2L1BA 1SNOA 5CR3A 1LT6D 4ALPA 3L13A 1XMQL 2GLSA 4ABNA 3NVZA 3UIPB 2OHFA 5LNK1 4JYAQ 4BOZB 1HA6A 5C6AA 2C7HA 1DOLA 3KLSX 1BDOA 2YTYA 3GP7A 4GS3A 5IE8A 3TEHB 5GADC 2KENA 4HK2A 4XYQA 3U9SA 1PFDA 2GBKA 1D5XC 1X6OA 2R93G 4II2B 4BVUC 1KABA 5IGCA 5C0XG 1MHXA 3S24A 1SYDA 5LHY1 5M5XH 2C7NB 4WAFA 2Z4IA 1P16A 3QHTA 4X57B 3I5JC 1FXAA 2KQSA 3SU8X 3ULJA 2IY5B 2WXGA 2DYMA 4HXDA 4LNOA 3P4SB 2LKVA 4DKAC 2EE1A 4CDEC 2B2WA 3FEWX 2QCPX 3ZGZA 2Q2HA 4F1SA 2K8HA 1QE6A 5G5HA 3UIOB 4C3IG 5JPMC 3AB5A 2V3PA 2WFWA 2R7ZG 1UBIA 1PYSB 3QQ8B 4DAYB 4KV2A 5C3EG 3I7FA 4R4OA 3PIOA 4LF5L 4U68A 2K8BA 1KFYB 4HDOA 2IJ0A 4P1CC 1JICA 1LTRD 1HR0L 2OWOA 4NZLB 2LHEA 2CWPA 3W5OA 4F88A 2N1VA 3NUHB 4GLSC 5G3LD 4GN1A 1DOYA 4IFDH 4JIOU 2XWBB 4APVA 2MO0A 5IY0A 1YN3A 3EVQA 3E6ZX 3JYUA 2D3CA 3GV3A 5E6NA 4N6EB 2M17A 1C76A 3JC66 4QIWE 1EEID 2XGTA 1QVGA 1YJJA 2KNBA 1PH5A 2N4FA 2BE5D 3G48A 1G8ZD 3FMCA 3T1YQ 1QLBB 1AE3A 4JI8L 3AB9A 2ZTEA 1OQQA 2LGYA 1R9TB 1L1OB 1VQPA 3DVNU 2Z59B 4IG7B 2NZ1D 3ZJYC 4B3ML 1W6KA 3P1MA 3M3JA 2LI5A 5EE3A 4JV5L 5DEHA 2NS5A 2NMQA 1J7AA 2KOXA 2UXCQ 2L9HA 4TQ1A 2D11A 1GAQB 3J80L 1L5PA 2ZCCA 5C3JB 1YJIA 3E0JA 3FRPB 1SJHD 4I6NB 2LXCA 1S5FD 3TEXA 1E0BA 2H88B 2IWHA 2I1JA 1OTRB 5IT9L 3OSOA 3H7SA 1TU2B 3NP8A 4DA2A 4O1NA 1XNQL 3I4NB 3PO2H 3S1NH 3HK0A 1FGBD 5M3MH 2QEXA 1N33L 1UGMA 2E6XA 2W82A 3VYRA 5C44G 3AEDB 3AI5A 3GTOH 2W3RA 3EGRA 1RLFA 4JWSC 4OWXB 5DAUA 3ERSX 4RGOS 1JW9D 2C35B 1QOFA 2JA7H 2KJHB 3BINA 4YXDB 4ARIA 1PH7A 2UUAQ 2KLGA 1EFID 1LABA 1QZEA 3L08A 4LWCA 5G2NA 3TZDA 4LF7Q 3OLMD 3NELA 1ILQA 4JBWA 5ELEA 5A2QE 2I2YA 1I42A 1YNTE 3MWYW 2JRHA 5H92C 1CT1D 3PQIA 4A3FH 1X3QA 4MNOA 1TGZB 2ZJDA 2E2IB 1WCMH 4HJGE 1T3QA 4KGTA 1YJ1A 2DY8A 1SE2A 3M4OB 1XPOA 1BKBA 2B2UA 2R3ZA 4C56C 2XRQD 3AEBB 2PW5A 3K9OB 4FADA 1SYEA 1W2BA 4LUOA 1KD1C 5T1IA 4WJ3M 4ZYSA 1I4HA 3E56A 1EZ8A 4K5VA 2PO4A 2B63G 1VZ8A 4JGHB 3A54A 4AQYQ 4LNKA 4WWNA 1NCVA 1L0VB 5JEAH 2V1YA 1RODA 3L7ZC 3GTGH 1L7YA 3ZW3A 1AZPA 1GC7A 3GTPH 3SDLC 5BYSA 4GN5A 2EYHA 2R2OA 2TMPA 1QOGA 4WJQA 1L2NA 1HHVA 5AJ3Q 2H1EA 5IODA 4OVUA 1TS4A 4A3EG 4DXGA 5BN5A 3V6CB 2VZAA 2PNHA 1WI5A 3I2ZA 2BE5C 3GTMB 4XDCA 2K75A 4DAVA 3RLOA 4W9LA 4BBRG 4IUQA 2D3AA 2D3GA 1E1OA 3IHPC 2AL3A 2Q8TA 4FXGC 3C46A 1QG7A 3DBHB 3A5ZB 2YEPB 4F7XA 2KLCA 2PPHA 1C77A 4G7OC 1HTOA 1XO3A 4C7ZA 2R6GA 4DR6L 1QZGA 1N5XA 1PTOH 2B76B 3HOUH 2D5DA 2YTVA 3KWVA 5H8YE 1TWGB 4J15A 5C3XA 4JI7L 2AMCB 2F0HA 4TKNA 2K05A 4ZHOA 1P8LA 4X3SA 1NEKB 1J5EL 3DBSA 4JLCA 3U52E 4C3JB 3ZRFA 1XX8A 3HM6X 3HIZA 4NW2A 2A19A 4IPCA 4J1MA 4CJ2C 1JOOA 4GXBA 5JH5C 4RA8A 5CC4A 3BIID 4N59A 1UH6A 4BBNF 1WI0A 3F8TA 5IOCA 3C0RB 2N0SB 1HNZQ 4XYOA 1O7YA 2N9XA 4PS7A 4WWPA 3MAQA 2BA1A 2NBFA 3AU7A 4DV5L 3CC2A 4FN2A 1Y1VB 5JJKA 1EF5A 1DCZA 4OVVA 2K5QA 5HGQA 2V0GA 1GNUA 4TUUA 3S17B 1SAPA 1EYDA 4FA6A 5EKIA 4QUFA 1F2LA 2VL6A 3ND9A 4ZHPA 1CFMA 5KRUA 2HE7A 5AZFA 5LMNL 1JC7A 1GKHA 1E7VA 3MC9A 3LWEA 4E71A 1NMFA 2M4NA 4ANWA 3S1RH 3FKIB 3RD4A 2WAQG 4JC0A 5FLXE 3R7QA 4K3BA 1G6JA 1AN8A 3V05A 2BYTA 4MGYE 2NBWB 2Z0EB 3BJUA 4DV3L 1P7FA 4CDCC 4ZRZA 5C4HA 2VH1A 2KMCA 5IP7H 3Q8CA 5AUIA 2MFIA 2WXNA 1YQ3B 2E76C 2R7DA 3KYCD 1WTHA 4L23A 3L16A 4FXKC 1YIJA 1K51A 1LT5D 4DV2L 1V8QA 2WP8J 1WXAA 4CBVA 5LLIA 1EU3A 1G291 4DHJB 4RGTA 3BZKA 2EZVA 5J2RA 4IM0A 4HCNB 2B3AA 5TR5A 3GO5A 2JA6H 1T6BX 5IO9A 2MBHA 1Q8KA 1PFBA 5KYIA 2Y3AA 1HZCA 4DHZE 4KZ0A 3QIJA 2QMTA 1C9OA 3TN2A 3V2TA 4D2KA 2SDFA 3KYHC 3CPFA 4XQQA 3DWQA 4OHJA 1R4QB 3PRZA 1L0YB 4NDXA 3RLFA 2JA8B 4IPGA 2WLBA 2OJWA 5ELNA 2LGXA 1R4NB 3OJ3A 3F1ZA 4DNTB 2OXPA 3OOCA 3NBIA 2UU7A 2JXMB 1Q10A 3DVNV 3SR6A 4YIJA 3S2DH 4DV6L 4K5WA 1LTID 3K7AB 4XQNA 2F0LA 4A3JH 3PRMB 3NVWA 1IL2A 4BY7H 3C3LA 4K1RB 3CCEA 5HHDG 1ICWA 2HD5B 2VZKB 3FC4A 2CH4A 3U8ZA 2YVCA 3PO2G 2F0SA 1SNCA 2DN8A 2Z6KC 5C4XH 2O5IC 2D9UA 4A3LH 1N5WA 2RDHA 3BVGA 1IGDA 1P98A 2IYDB 3H1UA 1EUJA 5I9OA 1HFNA 3N32A 3AE5B 2UUBL 3KWLA 1AE2A 2Z9HA 1VQNA 1S40A 4ZLTF 2JA7G 3UF8A 1EF1A 1WOCA 4BOSC 4KJOA 1VDZA 3HOYH 4RGNA 4FXCA 2ZXOA 1JWUD 1EY7A 3OIPA 1CTMA 2NWGA 1MIUA 2QKIC 4NJ7A 3IFDA 2E2HH 3VQIA 4DQOC 3HG9A 4A3FG 4IOAA 1IYUA 1ZXHA 2VB3X 2MPMA 5F2DA 4JYAL 3GZNB 3L0OA 1E1TA 1WCMG 2MBEA 4GKJQ 5IAAC 3CD6A 5EBDA 3EHVA 2JZPA 1N61A 3S15H 2DLBA 4X64Q 1XLNA 3B2FA 5IGEA 3U4ZA 2VW9A 3RZDH 3DWGC 1N9WA 1O80A 3WAOA 1E7ZA 4JI1Q 1WM2A 2WB1B 4A3GH 1X1MA 4G3XB 4FJZA 5JEAG 1AP0A 2BF8B 1KC8C 1FD6A 2KO3A 1ZXTA 1KJTA 2LEKA 1SGHA 5GQOA 1KRHA 4QAYA 1WE7A 5FK9C 3DXJC 3T1HQ 1S72A 1B9MA 5ELOA 2RSUA 3H6NA 4W9DA 5JZEB 2J0KA 2J4XA 3VVWB 1N62A 4HPLB 2RHQB 2WXJA 2DJGC 2QA4A 4LF6Q 1V1OA 5FOBB 3G6JB 4OO1I 1FR3A 2KCCA 3U50C 2IZVB 2L83A 4LNNA 1V9JA 2F0TA 4REZA 4J8QA 2K7VA 4LDTD 3A5UA 4YHHQ 2NVUI 4YY3Q 1UAPA 4C3HB 1TT2A 4BY1B 3DHGC 2EKEC 2E75C 2NPTA 5FJ8H 3D31A 3J80i 1PZJD 5KNCA 4CJ1B 3J81i 1WRIA 1XMQQ 3TL5A 2KT7A 5I2XA 4OVZA 1WY8A 4HJ8A 5CV7A
chains in the Genus database with same CATH topology
4Q5VA 1NENB 1D4BA 3TP6A 1SNPA 5EE9A 4R9WA 4RFBA 3S16B 4LK1C 1PFNA 2NTTA 1F2YA 2F0FA 3A7LA 5T1GA 4ID6A 3AV8A 4P2CB 1H9SA 1JQYD 1JMLA 2NYZD 1HFGA 5FKAC 2HTME 3DEOA 2XSCA 3QIAA 1SNQA 1EY4A 1SMYD 4RAUC 1BR9A 4KY5A 4ULLA 3MXUA 2K0PA 3BVMA 3SHLA 3RZOB 4G7HC 3BDOA 3ZJVA 1RTOA 1LT4D 3IT4B 3LX0A 1LO5D 1OXUA 3K57A 1AFPA 1U4RA 4TQ0A 2EJFC 5BMIA 1VMPA 2B2VA 5KEEA 1AWDA 3EJIA 2O4XA 5J39A 2Q8RE 2F1MA 3OWFA 1X32A 4NJCA 1FRRA 4H2AA 5ELFA 1IKMA 1ZEQX 2E2DC 5EPLA 2CQAA 3KF8A 3SFDB 2JQRB 3I90A 1B53A 3WOEA 4AQ7A 4QCLA 2I38A 1A2UA 1FCCC 3I57A 5CORA 2VUMB 1HEZE 1KAAA 2NVQB 3NQTA 1GUTA 1H9SB 5EPKA 2L0CA 4TKOB 2I07B 4CKBA 4R3DA 1PUTA 3MEHA 1CZWA 2YU9B 4CJ0B 1SMYC 4KD3A 3EQLC 5C4ZA 3J7AF 1ZDXA 1SE3A 3L9AX 1VRAB 3KK7A 2DNEA 1J7CA 4G4KA 3VYUA 5D14A 5BN4A 1C4AA 1CZPA 2WDQB 2EPBA 2K04A 2RBMA 2IX3A 2XN9C 2JU6X 4KY6A 4C3JG 3CIRB 4OO1H 3Q69A 2EY1A 2NB0A 1I4RA 4A93B 1WSPA 4ZK9B 1XEEA 1F9SA 5E4WC 3AEGB 4QIWB 3MVVA 1U9RA 2LMCA 3E5SA 5BN3A 3KLRA 4EQNA 3T3NA 2AWOA 4KHZA 1DD2A 1F2RC 3D8GA 5C4JB 2EYOA 2M2LA 5HURA 1STHA 1Y1WB 3Q6SA 2OEDA 1I3QB 3H09A 3UI2A 2CW0D 1Q8IA 3HOXB 1TYGB 1WXQA 4EE2A 1F2ZA 2FJ2A 1RD9D 3PMFA 3CRKC 4HKZE 1HZ5A 2WXIA 3AH7A 1TS5A 3PZ8A 5I6WA 2L4NA 1TWFB 1GUWA 2K01A 1TY0A 2B2TC 2F03A 5C3WA 4KKIA 4K2LA 1R7SA 3URYA 2KCNA 2EYLA 1HTPA 4OIKA 2GI9A 2JYTA 3MFGA 3NTKA 3ZJUA 4NAWB 3AEAB 2F0OA 2H4OA 2J53A 1LTTD 3QWNA 2XRSD 3GTKB 1EOTA 2X6GA 2IGDA 1GB4A 3S1MB 2LMCB 3UI3A 1QB5D 3PUYA 1LV9A 3SFEB 2ONQA 2K1BA 1CQVA 1DXMA 3Q24A 1ACCA 3N52A 2EVBA 3TMEA 3MXNA 3K5LA 2WQYB 3HOZB 3I70A 3J81E 1EQTA 1STYA 2PYKA 1Y8OB 1TVXA 1SBBB 3A8KE 3VR3A 4ZRQA 1BF4A 4ITKA 2EY6A 2XIWA 3VYSA 3P1HA 1EYCA 1GOZA 1RTNA 2CW0C 1XYIA 3SK4A 1GPXA 2Y5CA 4WFN3 1QJOA 2PZTA 3JAML 1IBXA 3S1QB 3ZYYX 3X3NA 4R8NA 1K83B 5EE1A 1QWYA 5MPOA 3M7NA 3ETRA 2G1EA 1ZDVA 5CBEE 3FPPA 4WJWA 4DFAA 3TP7A 1A70A 1I4PA 4U673 3SDZA 1AEXA 2K03A 3VR4A 4CKCA 1QT9A 2M00A 5LL6X 4ZUIA 3DWMA 2L12A 4M1UB 5GXGB 4K6DA 4LJZC 2EELA 1Q12A 1G2TA 1FNWA 2VXWA 4V0BA 4FP5D 2K5WA 4A3MB 3P4PB 1IW7D 4YTPB 1B50A 1C48A 5K5PA 3PUXA 4XXEA 1WTQA 2KACA 4RF0A 1TWHB 2NVTB 1WTRA 1ENAA 1GUGA 4OO1G 5CV9A 2L1AA 2W54A 3VA7A 2DYOA 3I8ZA 3WDNA 3M4YA 5M3FB 1EU4A 5CV6A 3HP3A 5FR3A 3QOLA 4B9WA 3OPOA 1UWXA 3IKJA 2MJ8A 3GTLB 5BYQA 3BDLA 3PUWA 2KA7A 3T4AC 1IBXB 2PMVA 4PMCA 3MFYA 3DM1A 2PVGC 4P6VF 2PLPA 1CHQD 3AN1A 2L55A 2B2TA 2PZUA 1DJRD 5JVG3 2D5GA 1FD7D 4OZBA 3DMUA 1DOIA 4A3DB 1SSNA 1F2RI 5HG2A 2K28A 2N9KA 3W2DA 2AUKA 2ZT9C 3F2UA 4FF2A 3I4LA 1QF6A 3PIP3 4F8MA 1ONLA 1PGBA 1XXGA 5COYA 1IW7C 3K6OA 1B9NA 1OQRA 2F0WA 3SK6A 2KEEA 1F9QA 1TKGA 4USAA 1TR5A 1PLFA 2ZXPA 2WKDA 1D1KA 3N9YC 1EL0A 1L0XB 1Z47A 1KDAA 1NUCA 3NPPA 1SNDA 4ZKCB 2FE8A 4A3BB 2F0JA 2IT1A 3T56B 4IALA 1TKYA 2C5CA 3TUOA 3W5UB 4HN7A 2K6AA 3AMZA 1YNND 2NVXB 4RNAA 2WXQA 4XE0A 3BK1A 2E3TA 3K5MA 5ELBA 2KWDA 3OWEB 3MTSA 3H6MA 2INNE 2F3WA 1FYCA 5JPNC 5IGGA 5K36H 3I91A 2BDNA 5IGBA 1EWCA 1T5XD 3BK2A 3P42A 3ERQA 4M0WA 3I4MB 1YN4A 2HQEA 1I4GA 4XQJA 4C80A 3S2HB 4WWMA 3ZJTA 1S5DD 1I6VC 2PVOD 2K33A 3AMUA 3DUZA 3VR5A 1K8OA 2D62A 3BYYB 4ODGA 4ZKBB 1FNUA 2QDBA 1WYGA 4RH6A 2B8GA 2WU2B 1PTOF 2HDMA 1VZ7A 3W3AA 1ZUD2 3M7GA 1HRJA 1KLUD 2KECA 2WDVB 2IDYA 4KX6B 2QEJC 2OF1A 2BCOA 4A9AA 5AUKA 3TEZA 3I72A 1YNNC 4DF7A 1DM0B 2B2YA 2Q5WD 1ET6A 4QUCA 1ILPA 1CZGA 4PT5A 1EY8A 3NVYA 1OXTA 1EY6A 2PZWA 3NWTA 5IGFA 1LTBD 3X3MA 3K5NA 3AE4B 3M3YB 3QG1A 2HCIA 4X3KA 2XWJB 1JOQA 2MJ3A 2KEDA 2PCFB 4ARCA 2B2VC 4KD4A 1NVID 2KMMA 2EYFA 5HGTA 4L1BA 3IAYA 1SIJA 3D4RA 1B9RA 1G91A 2KVMA 4I65A 4KK7A 3MC0B 1Q3LA 1TWAB 4C2MB 1GUOA 2AX5A 3D4DA 1H9RA 1SSOA 2MP1A 1E9MA 4K8IA 1JORA 3A55A 1BCPF 3C1EA 4OZAA 3OMCA 1RCVD 1IL8A 4FVMA 1H9JA 1KNAA 5I6YA 2DBYA 5KNDA 1SXTA 3A7AB 4WORA 4KKSA 5E1FA 1ET9A 3NTHA 5D3DA 4JPSA 1NR4A 4CQNA 3BVZA 2F0EA 4RHSA 2F0IA 3S14B 3PV0A 2WXPA 1JRPA 4QB4A 2HDEA 1KDCA 2A5HA 1S5BD 2JA5B 2F0PA 1V1PA 1EQVA 1WTXA 5D3IB 3ND8A 1JQ4A 1N63A 3SK5A 2DY7A 5TSSA 1BUVT 1A3TA 3W1SA 2EJGC 4TQUS 1CHPD 1EY0A 2LS01 1JWBD 1ZYRD 1RHPA 4GZYC 4NP5A 5FLXL 4BA2I 4OW0A 1DOXA 3N6RA 4DK0A 3R3OA 3D3RA 3CQZB 5K36G 1ZPSA 2O5JC 1MSGA 5ELCA 1JB3A 4RHRA 3TDQA 3GS2A 2N9LA 2I46A 1LLRD 1LTSD 1TKEA 1PTOD 4B08A 1HXYD 1IKLA 4AS1A 2EDGA 2BT6A 3W5VB 4MH8A 5FO8B 1PDXA 1BBXC 5C3EB 2EJMA 4JWUC 1LTAD 3KBXA 3KUPA 1ML0D 1XTCD 4S3SA 4DN4M 2WINB 2KQ4X 1NI3A 1U4LA 1QKZA 4H7BA 2ENBA 1JOKA 2BW2A 2IX0A 3P63A 4IUTA 1RYJA 3ITPA 2A74C 2JX5A 1L4ZB 4TMAB 5E4XA 3P4RB 2PPBC 5EJWA 2R61A 1QNUA 4MACA 3DEPA 5C5MA 2K22A 1FEHA 4KKJA 5KGUA 5ISRA 2KOLA 4ZOHC 5E3FA 4XTCS 1VDVA 3V3XA 4YTNB 2WV6D 5I4DA 4A3IB 3I9V1 3U2SC 2Y0SB 2LJIA 5EQ0A 1ZYRC 2F0KA 2E74C 3Q8AA 1PMRA 2WXKA 1PRTB 1D5ZC 2HUGA 3U9OA 3H94A 3J7YW 1BCPD 3HKZB 1C8CA 1YN5A 1CA6A 4Z9CB 2KQ3A 1PTOC 4QF4A 1C4QA 3VRBB 1UWMA 2JEBI 2MUYA 2NN6G 2NTSA 2B63B 4RGMA 2IL8A 3K5OA 1WVLA 4HKQA 1EZ6A 3NUCA 1MPEA 3A8IE 1VCIA 2RDGA 1I6HB 3AEFB 1HUMA 2PW9A 2KJXA 1L6VA 4RWSC 4IFDJ 4WIPA 3B9JA 4FYDA 5KNBA 4A3EB 2C9OA 1SF0A 4A55A 1DOMA 1C79A 3A8JE 4JK1C 4F87A 1ZP0B 4IUPA 2AWNA 3IAS1 3MXGA 1BNZA 4LLGM 5JJZA 2KUMA 2M9VA 3SK8A 2CHBD 1VR9A 1EIGA 1QNKA 4EQOA 1XLQA 1CA5A 3C8YA 1MHHE 4K2KA 5CMDA 1S4ZA 1ZXIA 2K5PA 3P20A 5CYUA 1PFMA 4OZCA 3MA2B 1BCPC 4C1NK 4XWWA 2QSDA 4QMGA 2A69D 4N9TA 1WTOA 1MVKA 2FMCA 4KI0A 2QILA 1C78A 1M8AA 3RFZB 2YYZA 3NE5B 1GXDC 3NHHA 3P75A 2ICIA 4UAIA 3P4QB 5M5XB 4KHVA 2JSOA 1V97A 2Y5PA 4N58A 2FUG1 2MHVA 4IFDI 2WAQB 5DM63 3J9CA 1STGA 3A56A 2RQXA 1Q1BA 3AE3B 3AM9A 3VR6A 2K5DA 1U4MA 4J6HA 4YSYB 3W9CB 3TSSA 3Q8EA 3FPUB 2XNAC 1FIQA 4XIGS 2VNUD 2JYEA 4HCEA 1KLGD 4Q0FA 1SE4A 4LTUA 3SEBA 2JP1A 1F9RA 3OIQA 3PO0A 1V8CA 2F0VA 3ZQ4A 5T8IA 3AE9B 2RPVA 3Q22A 5BYRA 1MGSA 2BDOA 1SDFA 1DONA 1WGKA 1QILA 3OHXC 3B2GA 3SE0A 2A69C 4A8XC 1PRTF 1STEA 2WACA 3PO2B 4KTAA 3S1NB 3AECB 5M3MB 4HEDA 4MIUA 1K8MA 3IAM1 4FXDA 3GTOB 1LACA 3J80E 3HEJA 4HMJA 4Q2JA 3SVMA 2JA7B 2LFIA 2B8FA 5IT9E 4RKBA 2ZW1A 3FAHA 2O2LD 5JAVA 4WQMA 4A3FB 3Q8BA 2ZW0A 1WCMB 1Q1EA 4FF3A 1JWSD 1PGXA 2KN4A 1M4VA 3HUIA 4X3UA 2GRIA 4P16A 3IT6B 1L6UA 3OW7A 5E6JA 1WTVA 1IHZA 3HVZA 3NBHA 3GTGB 2EY2A 1BO0A 4KN7C 3TBIB 4US9A 3GTPB 1AZQA 1K52A 2SAKA 4KV6A 1EIHA 4N9PA 3MP9A 3L3OC 1OXXK 3TP8A 5HFYA 3T53B 3DWAA 2HDLA 3NS1A 4L63B 3BDCA 3VR2A 4G57A 4C1NI 4YSXB 1RWSA 3FDTA 4C3HG 3K0YA 1GUNA 3TEYA 3WCQA 4WRDA 1FCLA 2L32A 1PTOB 4B0EA 2IX1A 3HOUB 3LXFA 2PMZB 1RM6C 1MI2A 4XWTA 2WS3B 1Y69U 3M85A 1SYFA 5JOBA 4NMZA 3R93A 4MN3A 3HZXA 1I4XA 4OGQC 1FFUA 2RVLA 1GB1A 4IURA 3AEEB 1FRDA 4IKGA 1UUPA 4FO2A 2JYOA 3LB8C 4OL7A 2A73B 4I7ZC 1D2BA 5EKKA 3H3VC 1K50A 2CJOA 2B39A 4KY7A 4IUUA 4PNYA 1WWTA 1JCKB 1WD1A 4KGRA 3T16A 1RFKA 3BYTB 1PDQA 5KIXA 2EYPA 2G9HD 3V96A 1J7BA 4K8JA 2JXTA 2B2YC 1R4PB 1W6JA 2WKCA 2MJDA 1TQOA 2FHTA 3T51B 1MBYA 2ID0A 3CRLC 2FFKB 3VR8B 2WXMA 3S1RB 2ON8A 1F77A 2WNMA 1CQFA 3MXPA 1HA5A 2IW3A 3CHBD 4ZUJA 3NSWA 4TSSA 3WOFA 3NXWA 3QB3A 1JWAD 1TIID 4XT3B 2KAJA 3G7LA 2NN6I 1V43A 2L11A 3IFTA 3HVDA 2G9DA 4X3TA 3J81L 1BCPB 1PRTD 1Q90A 5M9OA 2JA6B 4RKLA 3CWIA 1PZKD 2ZXRA 3EFXD 3S9WA 3T3OA 4EGVA 2JEAI 1B44D 5EKLA 4NAMA 4HEA1 2OT2A 3LNNA 3S2DB 5CV4A 1E7PB 5C2TB 1A6XA 4GDLB 4A3JB 1QQRA 1Y56A 2BS4B 4BY7B 3GV6A 1Y8NB 1B3AA 5C4XB 1SNMA 5HI1A 1ESRA 2FINB 2QIEB 1E2VA 3PZ7A 4K14A 1FM0D 3RPFC 4IOIE 3EUB2 4HAEA 1F9PA 1O7ZA 1VZ6A 3HOYB 2JWUA 3R2IA 2LY7A 2E2HB 1FMAD 4ZAIA 1NAPA 4IUNA 5C5LA 4CKEA 1E6EB 3HGBA 3I73A 1EYAA 2N88A 5BMHA 1WD0A 2Z4HA 1NYQA 2WDRB 2J0TD 1NR2A 5DNFA 2EKIA 1RF2D 3S15B 2MJEA 4YSZB 1E10A 3RMHA 3RZDB 1HQMC 1ZOYB 2HCCA 4A3GB 1SJED 2MGSA 3K58A 1IYVA 5G5GA 4H0LC 4IN3A 1XCQL 4EVOA 1PRTC 3AE8B 2XVSA 2GB1A 1B2TA 3E9SA 2W3SA 4BWGB 3PIO3 1F2MA 2RSNA 4G7ZC 3VRAB 1HTLD 2PIAA 3C1FA 4DGZA 1C9FA 1AW7A 3BWUD 3GB1A 1BQQT 1G2SA 3DWPA 3R8BA 2LUMA 2EY5A 1UNSA 1YQ4B 2X69A 4HSPA 3OMGA 3NZ3A 1BXTA 1JR0D 1PZID 2LHDA 1BMLC 1UEAB 4RF1A 1IUEA 5A2QL 3LWUA 3BZDB 3SR1A 1Z7TA 2PQEA 2PW7A 1DOKA 4R8IA 5BMGA 4H44C 3IL8A 1RJTA 2F0GA 4WH4A 3R2TA 4MHEA 5C0XJ 2ACZB 1YMHE 4XDXA 3ABVB 1JROA 2EXZA 3NRZA 4Y7NB 4IFDG 3MZ5A 1EY5A 2Z1CA 4BA1I 2MEKA 4HRSA 2ICEC 5JVH3 5I2YA 2V4DA 1CJEA 1I7HA 1IGCA 3NWSA 4HMIA 5I9PA 2Z8LA 4H13C 2N7JA 4ME5A 1ESFA 2SOBA 3I3CA 1OFFA 2J42A 1RKNA 2J52A 3KLSA 2L5TA 1CI3M 2NN6H 2WXOA 3U4EG 2X38A 4US8A 1UGJA 2RDFA 2R92B 1KDBA 2WXLA 2J7ZA 4XDDA 1CK1A 1PYWD 4HCSA 2KDMA 2AQ2B 4KJNA 5IIFA 3IXSA 2INPE 2AUJD 1D6EC 2N55A 4PQXA 1HPCA 4BBSB 1ENCA 4DU9A 2RA4A 3BG3A 5M5YB 1AYFA 1MI0A 2DWQA 3LYYA 1BUIC 3Q8FA 4YWGG 3H8HA 5DM73 3GD7A 3GQBA 2WXRA 4PMBA 1P7EA 1FO4A 1KH0A 1HCZA 5C0XI 4DNRB 3HOVB 5J22A 1EWYC 4L6TB 4PV1C 3H91A 1TY2A 1PGAA 1VF5C 4HTHA 1N60A 4YT0B 2KHSA 1BOSA 2PNRC 1U4PA 4O42A 1TWCB 3J7AV 1STNA 3MHZA 1EM7A 2PTLA 2R93B 4KKUA 4V190 2SNSA 2YEPF 2RSOA 3QO2A 2A68D 4A90A 4LK0M 1EEFD 5CGKA 1I50B 4K6LA 1TS2A 1HUNA 3PUZA 4C3IB 1A2TA 2R7ZB 3P7JA 4BS9A 3GTQB 3U7ZA 3TEWA 1XLOA 2BS3B 4M8AA 4AYBB 1SYCA 4KKTA 2JSVX 4KGSA 5J1ZA 2V3NA 2SEBD 5AFWA 1PXUA 2IGHA 4YTMB 4IDIA 2Q8IB 1WTPA 1V1PB 1STAA 1MD2D 4UDUC 3CKIB 1STBA 5CV8A 3QOJA 3C2PA 3D6WA 1A15A 1DZ1A 4DK1A 2WXFA 4A6QA 2F0NA 2NUCA 2F3VA 4HROA 3RUZA 1L4DB 2BBCA 2F0MA 1H9KA 2L52A 2WU5B 4FF4A 1XCTL 1FXIA 3EA6A 4RCOA 1OXSC 3ONAB 5EPJA 3MJ5A 3NVVA 4A3KB 1QCBD 2K3UA 3NTIA 4FNFA 5C44B 2F0DA 1TZOA 2WP9B 1A3UA 1FNVA 1SYBA 2CJNA 1ZKOA 5D7GA 1LTGD 1HZ6A 3T13A 2A68C 2BB5A 2LGIA 3NQIA 2RMMA 2VB2X 2FBWB 5EBCA 1KTKA 3K59A 1GHJA 2JE6I 4DXFA 3PO3B 4L8JA 3HS0C 1GUSA 3Q0AA 1F0ZA 3VR9B 1VMCA 1XF5L 4EQPA 1VLBA 1OXVA 5FO9B 2F0QA 2OEOA 4DAPA 4ILWA 2IPKD 1QOBA 1O78A 2D2CC 3MHBA 2CU3A 3HRZC 4JE3B 2BA0A 2WIIB 3HRDD 1Z6HA 1B4OA 3GTJB 2BS2B 5EE0A 1ENFA 5FO7B 3QJYA 3TZUA 2GA4B 4BBRB 1DYQA 2MH7A 4GDKB 1C4PA 1H9MA 2EYMA 1VF7A 1K53A 1KF6B 3AE1B 2WXHA 1GHKA 2NVYB 2M56B 4E6IA 5C0XH 1ROEA 1TKWB 1T5EA 2BB6A 3Q23A 1SFOB 1E2ZA 2IGGA 1OO9B 2PKOA 2EYJA 1ZE3D 1HQRD 2AQ1B 1D1IA 4K5XA 2A6HD 1EWHA 4L2YA 3KBGA 4NKLA 3EROA 3JAME 4OIJA 1TS3A 1JWMD 3D4WA 1C4CA 1NYRA 1GJXA 1EY9A 1QOHA 3SXHA 5CBAE 1QOAA 4KN4C 3AE2B 4TRDA 4HSVA 4JX1C 2B2WC 3D6CA 5NUCA 3L4PA 1J8IA 4HR7B 2LFNA 5JEAJ 4FF1A 2F0UA 2QF7A 4B9XA 3VA5A 1I4QA 1B1ZA 2EOTA 1JE4A 5CV5A 3PUVA 5LL6S 2H89B 3FILA 5JXVA 1D5MC 5G3LF 5KYLA 1KNEA 2BOSA 2RKSA 3O13A 4PMWA 1MSHA 4IZ8A 2A6ED 2DNCA 1YNJD 4LAAA 2E2JB 2K9XA 1S5CD 1J9OA 3NK9A 4KMUC 1CM9A 3FVQA 2V4IB 2K32A 4IUVA 3BS1A 2QJLA 4WURA 1Y8PB 4MT5A 2F4IA 5A35A 1JALA 5M5WB 2A6HC 4MM3B 2X6LA 1A3VA 5IGDA 2M0AA 1G6ZA 1DGJA 1E0ZA 1SB3C 3KQ4A 3H0GB 1SYGA 4CHTB 2M19A 4LMQD 4ZQ3A 4J3OD 5ELDA 2VZKD 1XLPA 1II3A 4ZRPA 3AE7B 2BTEA 2B2UC 1WTWA 1VJKA 4CGYB 5D65A 2AQ3B 2CVRA 4DAYA 2SNMA 4XT1B 3FILB 1E2WA 3CU7A 3VYTA 1O7LA 5EGTA 1LT3D 1FFVA 3TP5A 3AE6B 1X3PA 1NSNS 2TSSA 2FMMA 2W55A 4RCNA 3HOWB 1S5ED 2A6EC 1TJEA 1YNJC 4IQZA 1RDPD 1XWEA 3DHQA 4C7YA 1SEBD 2L1BA 1SNOA 5CR3A 1LT6D 4ABNA 3NVZA 2OHFA 5LNK1 1HA6A 5C6AA 1DOLA 3KLSX 1BDOA 3GP7A 4XYQA 3U9SA 1PFDA 1D5XC 1KABA 5IGCA 5C0XG 1MHXA 1SYDA 5LHY1 4WAFA 2Z4IA 1FXAA 2WXGA 2DYMA 3P4SB 2LKVA 2EE1A 2B2WA 3FEWX 2QCPX 3ZGZA 5G5HA 1QE6A 4C3IG 5JPMC 3AB5A 2V3PA 4U68A 1KFYB 2IJ0A 1JICA 1LTRD 4NZLB 2LHEA 3NUHB 4GLSC 4F88A 5G3LD 1DOYA 4IFDH 2XWBB 1YN3A 3EVQA 3E6ZX 3GV3A 4N6EB 1C76A 1EEID 1YJJA 2BE5D 1QLBB 1G8ZD 3FMCA 3AB9A 1OQQA 1R9TB 2NZ1D 1W6KA 3P1MA 5EE3A 5DEHA 2NMQA 1J7AA 2L9HA 4TQ1A 1GAQB 3J80L 1L5PA 5C3JB 1YJIA 3E0JA 3FRPB 1SJHD 3TEXA 1S5FD 1E0BA 2H88B 2IWHA 5IT9L 3OSOA 1TU2B 3NP8A 4DA2A 4O1NA 3I4NB 1FGBD 2E6XA 2W82A 3VYRA 3AEDB 3EGRA 4JWSC 2W3RA 5DAUA 1QOFA 4RGOS 1JW9D 4ARIA 4YXDB 1EFID 1LABA 3TZDA 1ILQA 4JBWA 5ELEA 5A2QE 2I2YA 1YNTE 3MWYW 5H92C 1CT1D 1X3QA 2E2IB 4HJGE 1T3QA 4KGTA 2DY8A 1SE2A 3M4OB 2B2UA 2R3ZA 4C56C 3AEBB 2XRQD 2PW5A 1SYEA 5T1IA 4ZYSA 1I4HA 3E56A 1EZ8A 4K5VA 2PO4A 1VZ8A 3A54A 1NCVA 1L0VB 5JEAH 1RODA 3L7ZC 1AZPA 5BYSA 2EYHA 2TMPA 1QOGA 1HHVA 2H1EA 5IODA 1TS4A 4DXGA 5BN5A 2BE5C 3GTMB 4XDCA 4DAVA 4IUQA 2Q8TA 4FXGC 3C46A 1QG7A 2YEPB 4F7XA 1C77A 4G7OC 1XO3A 4C7ZA 2R6GA 1N5XA 1PTOH 2B76B 2D5DA 3KWVA 5H8YE 1TWGB 5C3XA 2F0HA 2K05A 4ZHOA 4X3SA 1NEKB 3U52E 4C3JB 1XX8A 4NW2A 4CJ2C 4J1MA 1JOOA 4RA8A 5CC4A 3BIID 4N59A 5IOCA 2N0SB 4XYOA 1O7YA 3MAQA 2BA1A 2NBFA 3AU7A 1Y1VB 1DCZA 2K5QA 2V0GA 3S17B 1SAPA 1EYDA 5EKIA 4QUFA 1F2LA 3ND9A 4ZHPA 1CFMA 5KRUA 1JC7A 3LWEA 3FKIB 3RD4A 5FLXE 1AN8A 3V05A 2BYTA 1P7FA 4ZRZA 5C4HA 3Q8CA 5AUIA 2WXNA 1YQ3B 2E76C 4L23A 4FXKC 1K51A 1LT5D 1V8QA 2WP8J 4CBVA 1EU3A 1G291 4RGTA 2EZVA 3GO5A 1T6BX 5KYIA 1PFBA 2Y3AA 2QMTA 3TN2A 3V2TA 4D2KA 2SDFA 4XQQA 3DWQA 4OHJA 1R4QB 1L0YB 4NDXA 3RLFA 2JA8B 2WLBA 4DNTB 2OXPA 3OOCA 3NBIA 3SR6A 2JXMB 1Q10A 4YIJA 4K5WA 1LTID 3K7AB 4XQNA 2F0LA 3NVWA 3C3LA 5HHDG 1ICWA 2VZKB 3FC4A 2F0SA 1SNCA 2DN8A 2O5IC 1N5WA 2D9UA 4B0MA 2RDHA 3BVGA 1IGDA 5I9OA 1HFNA