1KLGD

Crystal structure of hla-dr1/tpi(23-37, thr28-->ile mutant) complexed with staphylococcal enterotoxin c3 variant 3b2 (sec3-3b2)
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
239
structure length
231
Chain Sequence
ESQPDPMPDDLHKSSEFTGTMGNMKYLYDDHYVSATKVKSVDSFFKWDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKGKTCMYGGITKHEGNHFDNGNLQNVLVRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA CLASS II HISTOCOMPATIBILITY ANTIGEN, DR ALPHA CHAIN
publication title Minor structural changes in a mutated human melanoma antigen correspond to dramatically enhanced stimulation of a CD4+ tumor-infiltrating lymphocyte line.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/toxin
total genus 67
structure length 231
sequence length 239
ec nomenclature
pdb deposition date 2001-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
D PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1klgD01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1klgD02
1CQVA 1CT1D 3MC0B 1LTSD 3EFXD 1ET9A 3KLSX 3R2IA 5ELCA 2WV6D 2R61A 1D5ZC 1PTOD 3DWPA 2O2LD 3CHBD 1M4VA 4RHRA 1V1PB 4RGOS 1QILA 3TSSA 1PZJD 1LT4D 1TY2A 3BVZA 4DXFA 1LO5D 1LTTD 5FKAC 1D5MC 1S5FD 5ELFA 5ELEA 1EU4A 1BCPB 1PTOF 3OWEB 4UDUC 3DWAA 4K6LA 2QILA 2SEBD 4ZYSA 1FNUA 4RGMA 1ET6A 1PRTC 5ELBA 1FNVA 1LT3D 1ESFA 1B44D 1SEBD 5ELDA 3GP7A 1PTOC 1PRTD 1JWUD 4OHJA 1S5DD 3BYTB 1LTRD 3BYYB 1JWMD 1RD9D 2CHBD 1EU3A 3O13A 4L63B 1D5XC 3DWQA 2TSSA 4RFBA 1V1OA 2QEJC 1KLUD 1PRTF 1TS2A 4RCOA 1EFID 1S5CD 1I4GA 1PYWD 3URYA 4C56C 1YN5A 3R2TA 1RDPD 4RGNA 1KTKA 1XTCD 3BVGA 1EWCA 3BZDB 1RCVD 3BVMA 4RGTA 2RDHA 1JCKB 1PTOH 1RF2D 3MFGA 1BXTA 5FK9C 4NZLB 4TSSA 1DJRD 5I4DA 4L6TB 1LT6D 4Z9CB 2AQ2B 1TY0A 1JWSD 1PZID 1I4XA 1AN8A 1CHPD 1SE3A 1JQYD 1ENFA 1PTOB 1SE4A 1JR0D 3R8BA 1B1ZA 1XXGA 1TS5A 2XN9C 2G9HD 1L0YB 1DYQA 1SE2A 2AQ3B 1YN4A 1D6EC 1CHQD 2NTSA 1PZKD 1FNWA 1LLRD 1EEID 1SXTA 1S5ED 2Z8LA 1SBBB 1T5XD 4RHSA 4DXGA 1S5BD 1I4PA 1V1PA 2XNAC 2XRQD 1AW7A 1LTID 1BCPF 1LTAD 1LTGD 1G8ZD 1KLGD 1UNSA 3V05A 1MD2D 1I4HA 1L0XB 1PRTB 1CK1A 2AQ1B 5TSSA 1TS3A 1I4QA 3EA6A 2ICIA 1EEFD 1GOZA 4BWGB 1LT5D 1HQRD 2IJ0A 1I4RA 2RDGA 1HTLD 1F77A 2NTTA 1SJHD 1TS4A 1YN3A 2J4XA 1SJED 1STEA 1BCPC 1UUPA 3SEBA 1LTBD 1BCPD 1HXYD 1FD7D 5D3IB 1FGBD 4O1NA 3W2DA 5D3DA 4RH6A 2IPKD 2XRSD 1HA5A
chains in the Genus database with same CATH superfamily
1O7ZA 4XQQA 1TWAH 1KABA 2CHXA 1YJWA 3AE1B 3QX1A 4MACA 2E5LL 1RIPA 4DR7Q 3AMZA 2R7FA 2D5GA 4IWPA 3T8MA 1D5ZC 4HIMA 3MP9A 4PS3A 2EYPA 3I7FA 4RGOS 4ZRPA 1JJCB 1N9WA 1FYCA 4PK1A 1GXDC 3L0WB 2AWTA 4FHJA 2HQEA 3FHWA 3L2PA 4A3BG 1UEAB 3AQQA 2KCMA 2B2YC 1UE6A 2LGDA 3P4PB 4EZLA 1UF0A 2KDFB 2BA1A 5C44B 1EWYC 1RWSA 4BKTA 3I57A 2K0PA 2QILA 3Q3OC 1QVCA 2INNE 1WTWA 5M3FB 2INCC 4KN7C 2JRIB 4DDGD 1FNUA 2L83A 5EE0A 2NBUA 3TREA 1IBKL 4I6NB 1HZ9A 4P71A 3KUZA 4JBKA 1MJCA 1Q3LA 3NBHB 3GP7A 3VR3A 3L13A 3ZRCA 2CCZA 5C4XG 3GDEA 1Z2MA 4DV6L 5T1GA 2WXFA 1TQOA 2ZJPA 2FHTA 3BINA 5IP4D 1PLFA 3A9JB 2HIXA 3OJ4B 3CKIB 1PH9A 1P7FA 4POGA 2R3ZA 4DF7A 3CC7A 1J19A 4YCUA 3TEYA 4LUZA 4J6IA 3PQIA 4A93G 3CMAA 3G7LA 4W9IA 2F0HA 1TJEA 3TEWA 1B8AA 4C3JG 3PUYA 1TWCH 2JYEA 3HVDA 2F0KA 2JSVX 2F0IA 5LNK1 3RZOB 5G55A 2A4ZA 1WF9A 1VDVA 5IYBG 4XDCA 3QK0A 1D8LA 1WVLA 2E2IH 4DV7Q 2F3WA 1WGRA 3M9BA 3CCJA 1WH3A 2KD0A 5CMDA 1YNJD 1E7VA 3DHGC 4MGZE 4MT5A 4LDTB 4FN2A 1DOIA 1SNDA 2K52A 2V3PA 2V1CC 3FILB 3M3YH 4HLEA 5CC4A 1MFWA 4FULA 3RMKC 2V3NA 5FJ8G 2JA6H 5IT9L 4JIOU 1YN4A 2IZVB 3JYUA 3I4NH 3QQ8B 2WS3B 2PTLA 3ERQA 1H9RA 4DK0A 1Y8NB 1V1PA 2EXDA 1HFGA 5IA7A 1TKYA 1A3UA 1BF4A 1I42A 4LFAQ 2XWBB 1WRDB 1UNSA 3CMMB 4PG3A 2F0EA 1AH9A 1WGGA 3VVWB 3H8HA 1SMYC 1TS3A 3IHPC 1NYRA 5C44H 1I4RA 4F8MA 1N63A 4HJ9A 2ZTEA 1M1KC 1I50H 2B2UC 4GKJL 1EIGA 1STBA 2EKEC 1XT9B 1B9MA 3WAMA 2KFJA 1N8RC 2UUBL 1GUTA 4RAUC 4HCSA 5C3XA 5KNBA 2SAKA 3GTQH 2L8JA 3LDZE 4KSKC 1KNEA 3EROA 2ENBA 4YSZB 3VR8B 3U9SA 3QJYA 1UEBA 3PSIA 1HA5A 3AI5A 1Y1VH 1WR1A 4IO9A 3S2HH 1L0VB 4PYZA 3N20C 3QC8B 5BN5A 3W1SA 4DWFA 3PO3H 3MEHA 2B2VC 3EFCA 5HI1A 4C4VB 1TWFB 1PZJD 4LUVA 3K59A 2JN4A 3P63A 4DXFA 3TS0A 1QT9A 2NVXB 2D3GA 3DVGY 4BA2I 2YLMA 1EQRA 1WTRA 5KYIA 4HTHA 2V4IB 2WIIB 3NQIA 1M94A 2UYZB 3OW7A 2WXKA 4XYQA 1TWHB 2M2LA 3CCVA 5CV9A 1LACA 2HTME 1G6JA 3T13A 3FKYA 1OEYJ 1C79A 1ESFA 3KLRA 3IXSA 2BH2A 4DK5A 3ZO5B 4BY1B 3MTSA 2O2VA 3HOUH 2ZNVC 3L7ZC 3BWUD 3DVNV 3N52A 1Y1WB 1NR4A 4XWTA 4KGSA 4L63B 2DZMA 5AUIA 3MHSD 3S14B 3ML8A 1UZXB 3C0RB 5CHVC 3H15A 4OIKA 2BS4B 2ZCCA 4DV2L 1JORA 1PXUA 3HOXG 1SIFA 2QMTA 5IGEA 1U5KA 1H4RA 3R2TA 1DONA 2NZ1D 1C4PA 3BVGA 2A73B 4KTAA 1MKHA 1YJNA 2QGQA 3MFYA 3R7RA 1XNQL 3RMHA 4P7IA 3E3XA 4RGTA 2B63G 3W9CB 5C1ZA 3MFGA 4JV5L 3H7PA 5J22A 3HS0C 1GUOA 3ZLZA 4QUFA 2R2QA 3KUPA 3ZNGC 1BDOA 3AFPA 5CGKA 4USAA 2MJ8A 4C3IH 2ATWA 4G50A 4A3IB 2L5TA 1JQYD 2AL6A 4M0WA 2KCTA 1VQBA 4ARIA 4M02A 2F0PA 1QJOA 4DK6C 4DUYQ 1KRHA 2OJWA 2MNAA 1F9JA 2G9HD 1Z7TA 3TP5A 3NELA 2RA4A 2N9XA 4KMUC 3LJ3A 2I5HA 5E6PA 4YXDB 4XIGS 1C4QA 2D5DA 3CWIA 3U4EG 3U2SC 2JA5B 2M1MA 4PZ6A 1HPCA 3GTJB 1LM8B 2H88B 2DYMA 2Z8LA 3J7ZC 1J8CA 1V9PA 3B0AA 1T5XD 4WFN3 3HOWG 2KWVB 2IX3A 1TVXA 3K0YA 5FO7B 5FO9B 5K5PA 5D94A 2JE6I 5CV7A 1J6QA 3RR5A 3S1RB 3J9CA 1GPXA 2GRIA 2CH4W 4A3BH 1I4QA 4IALA 3VYTA 2NVXH 3KF6A 2E2JH 1VRAB 1L4DB 2KZRA 5I9PA 2ZVNA 4J3OD 5HG2A 3X0WA 3VAWA 4DNRB 2WDVB 3J80i 5BMHA 1A15A 2K32A 1SJED 1STEA 2SDFA 2KFKA 2LD9A 3R93A 1UUPA 3E6ZX 2RPVA 3PO0A 3TIXA 4BOZB 4ILWA 3PT2B 2BBCA 2TMPA 4ODGA 2IBIB 2LVOA 2B2WA 1XWEA 4DR3Q 5JEAJ 2I5LX 3UI3A 3PUWA 4V0BA 1QF6A 4O1NA 4JI1Q 1KAAA 2WDQB 4ZCKA 3VXWA 3K8AA 2L11A 1SAPA 4DKAC 2IPKD 3LXFA 5C4XH 4DV3L 5HGTA 4GLVB 3CQZB 4DA2A 5KHOA 4A3JB 4MTNA 1KNAA 2WP9B 2C5CA 2F0SA 2GBRA 1UWMA 4NQKE 1KDCA 4EFOA 5G3LF 4K7SA 4C00A 4DV5Q 4WIPA 3E9HA 3T1HL 1A8VA 4GNXA 1NEKB 4B95A 3ZRFA 2I2YA 1TY2A 3EHVA 1HNZL 1Q86C 4P2CB 4C3JH 1ZOYB 3HHMA 4LNIA 2KOXA 3KLSA 3TCAA 4XGAB 2JEAI 2WNMA 2JXTA 4DPGA 4IOAA 4LF6Q 2ID0A 2H1EA 1K8GA 3NUCA 4ZYSA 1OXVA 1FCLA 1SIJA 3I91A 2VB3X 2KECA 2WP8J 2R7DA 4MJSA 3R7QA 3DBLI 1B44D 3J81c 3OWFA 1XMOQ 1HNWL 2N1WA 3ZNID 1HZCA 3OIPA 5FJ8H 2F3VA 3AEFB 4V190 3CSTA 2WXHA 1A0IA 4EQNA 3GD7A 4K5VA 1NMFA 1WGDA 4LJPB 3PUZA 4K2LA 1E8ZA 3NVYA 4XDXA 2Q5WD 2W82A 4HJ8A 2V0GA 1GVPA 4ZUJA 3VR2A 1YMHE 4RCNA 3UIPB 1NMGA 2X69A 3IRBA 3HOVB 5AZHA 2AHOB 3GTOH 2K3UA 1VQMA 3OLMD 4W9FA 2YEPB 1XJVA 2X6LA 2Q2TA 1ASYA 3LGJA 3OMCA 5IWAL 2QCZA 3NTHA 3PZ7A 1BXTA 1R4MI 5C3JB 1WCMG 4A3CG 4L6TB 3PO2B 2BB6A 3CPWA 5GAEC 3PSEB 1HHVA 3FPUB 1GAQB 5IYDH 2AL3A 2MBBB 3PGEA 5IO9A 2GB1A 3JSVA 2WQYB 4F7ZA 3ZXRA 2D3AA 1V43A 3SDZA 1DOMA 1Y56A 5C3EG 1MJEA 1AZQA 3N9YC 4PMCA 2NVUI 5A2QE 2FIFA 1RL2A 1XEEA 3APDA 3PRPB 1VQHA 2A6HD 2N7JA 3PHXB 2EY1A 2I07B 1X1MA 1XQQA 1AP0A 2F4VL 2A1AA 2IO1B 1AARA 1QOGA 3AU4A 2VQEL 3HOZH 1UWXA 4KDLB 4UP8A 2RSUA 1CSPA 1PFMA 2GLSA 3JW0X 2WXGA 3VH3B 2N3SA 5BR8L 5AUKA 1F9PA 1SROA 3Q24A 4GZYC 3T3NA 2IY5B 2KACA 3CCEA 3TZUA 1WTQA 1HRJA 3SFDB 3EA6A 3HOYH 1EEFD 3QWNA 4L5QA 1ZXHA 3SDLC 4MN3A 4PNYA 3T9LA 2H89B 3DHIC 3H7SA 2IW3A 1R9TH 3DPDA 4OX9Q 4NPNA 1TZ1A 4X3TA 2NN6G 2F4IA 2OCEA 1YQ4B 2BKFA 3W1SC 1QE6A 4A3DG 5IGCA 4TKOB 1O7IA 5LMUQ 2DZKA 2J53A 1GHKA 2RPQA 4K0KQ 3ONAB 2ONQA 2KENA 1XO3A 1WXVA 2LI5A 3ZJVA 4LTUA 4LNNA 3KF8A 2KANA 1L6UA 4RA8A 2RDBC 2F0GA 3H9DA 2G3QB 5HGQA 3K81C 2KMAA 5M3MG 4XX5A 4OVUA 2KWUB 3A7LA 2WX1A 5BYQA 2BVCA 3PF4A 4ZRQA 1IYFA 1X3QA 5GAGC 3S2DB 2NPTA 5J1ZA 2DZIA 1LQBA 2B63H 2E75C 3P7JA 4GN4B 5HKHA 4TRDA 2KTRA 1EY5A 4HPPA 4CHKA 3NZ3A 4QAYA 2EMTA 2HIVA 4NY0A 2WXMA 3RCZA 4I7ZC 3KWVA 2PE6B 4A90A 3CSFA 2FMMA 1EQTA 2RKSA 4IURA 4OXPA 3CXCA 2K03A 4US8A 1CTMA 3C19A 2K8BA 5C2TB 2DY7A 1N34Q 1LTRD 1C78A 1BR9A 1EWHA 2DNCA 3FEWX 3AEGB 3DUZA 1QOAA 2ZXRA 1F2ZA 2LMCB 3D6WA 4N8FA 3TEHB 1KM7A 5JPNC 3Q23A 4II3B 5M9OA 2WB1G 4AQYL 3HOWH 4FBJB 2K75A 4C56C 1YHQA 3H94A 1BQQT 1IBXA 2K5WA 2D2QA 1RDPD 1IBML 4NPSA 4BY7G 1V8CA 3KUDB 4QUCA 4APVA 1X54A 3OSOA 3KQ4A 3RNFC 4LCDE 4C3HB 3U58A 3GE3C 5EDSA 1WI5A 2RDHA 1RF2D 3S16B 2XK5B 2Q2UA 4KHPQ 2KA7A 1QKZA 5J18A 5I4DA 3DBRB 2NWGA 2K9XA 4YT0B 4DHZB 3RT3B 3GTKH 3QIJA 3MA2B 3AE4B 4TQ1A 1F2RC 3UIOB 3K7UC 3R8BA 5JHBA 2ZNVB 3RNBC 4WQMA 3ERSX 4A3GG 3OTOQ 4FYDA 2DJFC 1EY7A 4BBRB 4ANXA 1EIFA 3NY5A 2EIFA 1FO4A 3BDOA 2HD3A 1ILPA 2PQAA 1BNZA 2Q8IB 2L7RA 3DQVA 3F2UA 5AJ3Q 4A3EB 3KH0A 3ML9A 3PZ8A 1GM5A 1BT0A 2HT1A 2KHIA 2DHZA 1VS0A 2WX0A 1V81A 4P1CC 2KJRA 1K3RA 4K6DA 3L9AX 4X3UA 2BA0A 3W3AA 3L0OA 4NMZA 1E7PB 4JI5Q 1KLGD 4HXDA 2JA8G 3S2DH 1ZPSA 1CK1A 1STAA 1FEHA 1NI3A 2MP2A 4ZHOA 5LMNQ 1SNMA 5FLXc 1JWBD 2C5LC 5CORA 5M5XH 2IJ0A 4H7BA 3QARA 4FJVB 2Q8TA 1TS4A 2UXBL 4XC2A 1BCPC 1RYJA 2M8SA 3FPPA 2K39A 4WAFA 3ZQ4A 4M8AA 3RNCC 4BKSD 2A6ED 3F8TA 5K36H 4I6PA 3I8ZA 1K8MA 1VZ8A 2NS5A 3KBGA 2N8NA 3DM1A 3L17A 4FO2A 1VLBA 1PH7A 3LB8C 1UH6A 1ESRA 1QUQB 2F0JA 1EL0A 1K52A 2D62A 3A9KB 4DAYB 4LF7L 3H0GG 4ZK9B 3SVMA 4DR2Q 1PYBA 3H6NA 4OZCA 1YZ6A 4GKKL 2W3SA 2ASQA 4CJ1B 4G7HC 4ITKA 3EBEA 2LXKA 2EYHA 3QB3A 2K1FA 2EMSA 1EYAA 4ZKBB 1VF7A 1D3ZA 4GLSC 3V2TA 3UE1A 1JMCA 2BS3B 1LTTD 3RUZA 2I1KA 2KAJA 4DV3Q 2KVRA 2O6VA 1C3TA 1QWYA 4DR4L 2N4FA 3OWEB 2R92B 3DWAA 4CDFC 4EQOA 1WCMH 2PNRC 4A3CH 5DNFA 3Q6SA 1CKNB 3HRDD 5C4JH 2ZCBA 4ICUA 5FLMG 2JA7B 1IHZA 2OTJA 1IGCA 3T1HQ 2KVZA 2X6GA 1T9HA 1YNND 4LWCA 4REZA 1SN8A 5KNDA 3ZIMA 4MM3B 1A2TA 1S5DD 1NSNS 3BYTB 5C3EH 3BYYB 2Z4IA 3DM3A 4FJYA 4A3EH 3A5UA 1K51A 4LDTD 1GO3E 4O0AA 5H92C 1KC8C 1EYDA 2M0AA 3JAML 1C1YB 4X64Q 4LF4Q 1SMXA 4A3FH 2ZJDA 4OO1H 5C44G 1WD0A 5GADC 1L7YA 1GB1A 1K9MC 1TBEA 4GN1A 2FXQA 1BUVT 5C23A 5JH5C 1WI0A 5EAYA 5EE9A 1DXMA 1WFYA 1J7BA 3U4ZA 2LWPA 3P1HA 1SSNA 1TU2B 1PTOH 4FXDA 2N9KA 1IP9A 4PZ8A 1GD7A 1EUVB 1GUGA 2AUJD 1DZ1A 2EYLA 3AH7A 2BB5A 1RM6C 4WWNA 5IAAC 1WIAA 2KN4A 1B9RA 1CJEA 1F9RA 1H9MA 2NN6H 1VQIA 4A3DH 4DR5L 2PVGC 4LNFA 4N9PA 4QL5A 1VQOA 4HKZE 2Y5PA 2AQ3B 5LL6S 3OOCA 1CHQD 5IWAQ 1WYGA 3N3KB 1DGJA 3HRZC 3NTIA 3PO3G 4C1NI 4B0MA 1QOBA 4AYBE 2IO3B 2RCFA 4JVZA 5BN3A 3B2FA 3GTGH 4MNOA 1R4NB 1S5BD 1I4PA 4HDQA 4BBNF 2YTXA 5M3MH 3E0EA 4DUZQ 3T4AC 1Q5WB 3ALBA 3AFQA 4ZKCB 4OVVA 4HRSA 4JYAQ 1IYJB 5CV6A 4ZQ3A 4B3MQ 2BYVE 1Q1EA 2CW0D 2F3IA 1EM7A 1LT5D 5M5WB 3I9V1 4XXEA 1WTPA 1UGMA 4IZ8A 3HFZB 5CBAE 4JI0L 1WJUA 2KQSA 5DLQE 3QJZA 2VNUD 2KLGA 4FHKA 1BO0A 2KJ6A 1AYFA 1E2VA 3DOWA 1NYQA 1MG4A 3NK9A 1LTBD 4QJFA 1WTOA 4FXKC 2KOLA 3LWUA 4R8IA 3D4WA 1AFPA 1G2TA 1SB3C 5BR8Q 4NAMA 4B08A 2JZ3B 5D3IB 3WOEA 1XCTL 3RNAC 4BZAA 1CI3M 3RLOA 4ME3A 3S1NH 1J7CA 4N58A 1I94L 4S17A 1GUSA 1O7YA 1AEXA 1QNUA 3NENA 1E9MA 2KC1A 3B2GA 3G6JB 3KLWA 4ID6A 4ULLA 5NUCA 1N33L 4EQPA 3AYHB 1QZEA 3ZJUA 1CSQA 2F0FA 2MO0A 1KRTA 4RHRA 4JBMA 2J7ZA 3H3VH 2QJLA 1KHIA 4NXML 4L5RC 4LJOB 2OHFA 5ELEA 5C3WA 3K5LA 2BE5C 1WXMA 4TUUA 1FL0A 1L6VA 3X3NA 1RJTA 3HG9A 2RCNA 4CDEC 1PHJA 1E7ZA 5KIXA 1MVKA 2BWES 2LJIA 2QF7A 2J0TD 2AX5A 2QIEB 2Z59B 2KWCA 4YY3L 2C7HA 4K3CA 1EZ8A 5I6WA 1EYCA 3STBD 2EY2A 5BN4A 1K50A 2ICEC 3FMCA 2R93B 4A3GH 5ELDA 1TTNA 4AH6A 2C9WB 1G2SA 4OZAA 4CHTB 3GZNB 2HD5B 3UQBA 2CHBD 2N7DA 2A74C 4HMJA 5GXGB 4JI2L 2Y5CA 3GO5A 3P42A 3IT4B 1L0WA 2Y0SE 4XT1B 1PRTF 1TS2A 1EFID 4BKGA 4I65A 2LGIA 1H9SA 2KX0A 2KCNA 4IUPA 1O7LA 2FUHB 1BBWA 1C0AA 1XTCD 5HY6A 1NVID 5JJZA 1RTNA 5IGDA 2JA8H 3CU7A 2MA9B 3BZDB 3GOEA 1FIQA 3LX0A 1JCKB 3D6CA 3U4VA 5BYRA 4TSSA 1I7HA 3TBLD 1VCIA 4WAAA 3PHWB 4YCWA 5EJWA 3V62A 4E6IA 4AQYQ 2NVTB 1SYCA 2NUCA 4BY1G 5LL6X 4LF5L 3I4OA 2G9DA 1F2YA 5A2QL 1Y1WG 1TS5A 1IBMQ 3OG5A 1L5PA 2JVCA 3H7PB 2NZHA 3BJUA 4M1UB 3VHTC 4IUNA 1YD8U 3G6EA 3J80c 2OWOA 2PYKA 5LMNW 2I38A 3QCAA 1STYA 4IM2A 3H0GH 2AMCB 1S4ZA 1XTDA 2MQHA 3RPFC 3DEOA 4XZ4A 1TR5A 3CCSA 2BWFA 3RZFA 2WINB 1VQDA 2QW7A 3GS2A 4AWJA 4MH0E 1LTID 4YTMB 2MUYA 1WFQA 4YTPB 4OL7A 5E1FA 2ZTCA 4DGZA 1P98A 5JZEB 3AMUA 1Q10A 5T8IA 3PS6A 4W9EA 2K05A 1UELA 2F0DA 3QOLA 2KUMA 3NQTA 4PMWA 2WGSA 3AULA 4YHHL 1HQRD 2ES2A 2PZWA 4IW0A 5IOCA 1S40A 2NYZD 2VQFL 2J7QB 1SFOB 2BT6A 4A3LG 3MJ5A 2UUAL 5FLMH 2K5HA 2LUMA 4ZOHC 2JA5G 5H8YE 4CJ2C 3J7AF 5G5GA 3UQAA 1HXYD 2R93H 1NJIC 3I70A 1JRUA 1FGBD 5EPKA 4MSMB 5EGTA 1N32L 2R2OA 3DBHI 2GBNA 2PI2A 3JVZX 1X65A 1E6EB 2LASA 2KFKB 1GJXA 1ILQA 1ZYRD 4ZHPA 2PPHA 3OHXC 1Q90A 2W55A 3ABVB 4LFCL 3TDQA 2UXBQ 4WWOA 3KLSX 1B7YB 2MJ3A 4IKGA 2Z6KA 3SK5A 1HUMA 3VDYA 2PVOD 5D2MB 1G91A 1HFNA 3KOJA 2CJNA 4BBSB 2RD0A 2GOWA 1K8AC 3A1QB 4WJQA 2MWSB 1NI2A 1T5EA 4ZRIA 1LT4D 3WWVA 2JA9A 4JI3Q 2DYBA 3MJWA 5M3FH 5IYDG 1I5FA 1PTOF 1BCPB 4I7AA 4X62L 2KJHB 1OGWA 2K1BA 1WJNA 1G6PA 1MHWC 4R4OA 3BDCA 5M5YB 3AE8B 3GTLB 1KFYB 1FJGL 2E76C 2VL6A 3W1GA 3VR6A 1A3TA 1SRUA 1B3AA 1U4RA 2BDNA 3QWZB 2A19A 1CA6A 4AQ7A 1SNQA 3H6MA 1ET6A 4X66L 4FNFA 5DPWA 1PRTC 1LTLA 2DNEA 4A3JG 2LEKA 1AE2A 1Z47A 1JOQA 2KC2A 1SEBD 2WXOA 1T0YA 3R66C 2QDFA 1VQGA 2WAQB 3ULLA 4UHVA 2LFNA 2JX5A 2YV5A 2KO3A 2L76A 4IC7B 4DV0Q 3HOZG 1EF1A 2WXPA 4R4CA 2KK8A 1F2MA 2IGHA 4G7OC 4HJAA 4HPLB 3T53B 1KLUD 1X9NA 2N1VA 4MJSB 4S0RA 5HURA 3SHQA 2C35B 4DHZE 1C48A 5JJKA 5GAHC 2E3TA 3UDIA 4HIOA 1LABA 1NNXA 1PYWD 3HOYG 2BYEA 2LHEA 1L1OA 3RZOH 4O2DA 2O5IC 3TJPA 3VR9B 4M00A 4TQUS 5D65A 1EWCA 1SE9A 4MSQB 2VUMB 1PGAA 4XTCS 5EKIA 1DGSA 1K83B 2MBOA 4A75A 1YNTE 4HCEA 4YWGG 1IW7C 3I4MB 3FDTA 1LGRA 5EBCA 1CA5A 2VZKD 4A3OA 2K5NA 2V3SA 2IHEA 4IJHA 2YU9B 1P0RA 1PA6A 4A3MB 3Q8AA 4IG7B 3DLLA 2L0FA 4FF2A 1WZ3A 3K0XA 4G3XB 1K28A 1TXYA 4LFBQ 4CDCC 5CV5A 4IWQA 3U52E 1RODA 4ABNA 4MGIE 3I56A 4HIDA 2K22A 3E9SA 3JAMc 1EEID 3JSVB 3CRKC 1LYLA 1EY0A 2L15A 1WMHB 1IL8A 3NS1A 4DXGA 3Q8FA 4JBWA 2RVLA 2FIDA 2O5JC 4BBSH 4DR5Q 2VB2X 3C3LA 2OF1A 3PO2G 2KHWB 4LNOA 4F1SA 4B9XA 1G291 1SE8A 1VQ4A 2F0WA 3VYSA 1M90C 3PRZA 1D1IA 4KV6A 2WXNA 3OPOA 3IFTA 2RDGA 2YTVA 4FXCA 1SMYD 1W6KA 3ZNZB 4C7YA 1P16A 4DR6Q 4HCPB 2HDLA 2RGFA 1OQRA 2Z0EB 5IY0A 4MELA 1Y8RC 3NBHA 4A93B 2IO2B 2JT4B 2BPSA 3BU2A 3I4LA 4W9JA 2VY3A 1AZPA 4YSYB 1P1AA 3PCOB 4LW1A 1WXQA 3NP8A 4OO1I 3A5ZB 4IPHA 4DV4Q 3U50C 1K0SA 3A9JA 2NVQB 1SR3A 1HTQA 4HR7B 4D2KA 1GG3A 1TWFH 3WOFA 5ELCA 4KIKB 4FDBA 2YYZA 2J42A 3AEBB 2O2LD 3CHBD 3WAPA 1HCZA 1ACCA 4QGUA 1YJ9A 1JE4A 4QY7A 4AYBB 4YCVA 2GI9A 2EY6A 3M4OB 2CQOA 3K7AB 1UWVA 4X65L 1FXAA 2NN6I 2RDFA 4LF8L 4A20A 4LUOA 5AFWA 3TBIB 2A5UA 1TWHH 1SGHA 1ZXIA 1W2BA 1YQ3B 3RYTA 1XNRL 2MSED 4K8JA 3ITPA 4WJOA 4Q2JA 4A9AA 4G0NB 2DYOA 2VRRB 3FILA 4BY1H 4DR1Q 1N36L 2MQJA 2F0MA 3S17B 1Y1WH 1A63A 5J17A 4MTKA 3SR1A 4OEMB 3S14H 4N8X1 1JWUD 3Q8BA 1C9FA 2BYFA 2DZJA 1J0GA 2EZVA 1MBYA 2NBWB 1ZKHA 2KDBA 2KDIA 5FR3A 4DU9A 1PFDA 4RFBA 3T51B 1UGJA 4KSLC 3A54A 2W3RA 4IPGA 3KJOA 1KAWA 4DV1L 1T6BX 3WA0A 5FO8B 2EYFA 4Q0FA 5CYUA 4YY3Q 4JQWC 3URYA 3WAOA 1XMQQ 1OQYA 2A69C 2QCPX 1YN5A 1MGSA 1QCBD 4ALPA 4EQ5A 5EE3A 2BTEA 2AUKA 2ZTDA 3H91A 2E5LQ 2F52A 1HTOA 1CM9A 4AIMA 4KY6A 1MJDA 2ON8A 1SNPA 4RF0A 1WYDA 4A3IH 4GB9A 4UPAA 3CF6E 4GS3A 2V1YA 1DJRD 4NXNL 3IBEA 5K36G 4JI2Q 1B3QA 1ENAA 2DGYA 3NUHB 3AXCA 4HPMB 1IBXB 3N32A 1HR0L 4C2MB 1I4XA 5KNCA 1VQPA 4A3LH 1WWTA 1NENB 2JA5H 2M00A 3GTJH 3ENEA 5IODA 5IE8A 2LSSA 3H3VC 2B29A 3HKZB 3H3VI 3S15B 1T0SC 1IBKQ 1YQBA 1HNXL 2Z6BA 3RN5A 1U0LA 3S1RH 2VH1A 4C4VA 2LKVA 2A68C 4DBGA 2BDOA 1GNUA 4DV6Q 1LTAD 3ZJYC 3P75A 2LGYA 3SHLA 5AEKB 4GDKB 2F0VA 1EIHA 2Z0SA 2Y0SB 3ZGZA 3MXNB 5I6YA 3J81E 1E7UA 3K6OA 3MC8A 1C9OA 3ZUNA 1DOXA 3V3XA 2K5VA 2AWOA 5DCNA 2ACZB 4L2YA 4FXGC 2Q2HA 3EQLC 5KRUA 1EF5A 4BBRG 3E56A 2XBBC 4JI8L 3HOXB 3M3JA 4XE0A 4KVGB 1HE8A 1JOOA 4H0LC 2CKZB 4KKTA 5ELOA 2ZW0A 2PZTA 1D7QA 4PS8A 3J7YW 3VTVA 4A3EG 3CQZH 3OYYA 1E10A 4A3JH 5GMVA 1Q46A 1YEZA 4H13C 4RMAA 3D4RA 2VH2A 3VDZA 4A3FG 4YHHQ 4R4QA 1V5TA 4OO1G 1N60A 5IP9G 2HCIA 3P4RB 2VQFQ 1VQKA 2DWQA 2N9PC 4PT5A 2VZKB 2MBEA 1OXSC 3SE0A 3R2IA 3CCLA 3CRLC 3OAWA 1OXUA 2M0XA 1IBLL 4WQOB 2PLPA 1V97A 3RD4A 3S1QB 1SSOA 5HHDG 1C77A 1X3EA 3GTPB 4RNAA 3FRPB 3B9JA 1VQ9A 2R7ZB 5ISRA 5FOBB 3KYHC 3TMPB 4K2KA 3SK6A 1GC7A 4HVBA 1YHAA 3JAMi 4Y7NB 5IT9c 1XLPA 2JYTA 3K5MA 4FA6A 1WYWB 3MHZA 4NAWB 2PMZE 2UXCL 1A5RA 2DJGC 1NY4A 1L1OC 3P20A 1Q8IA 1PYSB 1PDXA 2O6VB 2OJRA 4HSVA 4ZAIA 2M56B 3K58A 1QOHA 1V9JA 4GKJQ 1JICA 2E6XA 4MEMA 4X3KA 1SYDA 5C4ZA 1STNA 1RD9D 3O13A 4RMFA 1UBQA 2K50A 3T1YL 2KMMA 4LF9L 3PIOA 3HOVH 4DFAA 1FJGQ 2JQRB 3RN9C 3A8JE 1EQVA 4YWMA 2UUBQ 1FPYA 2LJ5A 3A4SC 3V61A 4CQNA 2WYQA 4YWKA 2WDTB 3I72A 4R1JA 1VMCA 4OWTB 4YIJA 4YTNB 1B9NA 4ICVA 3PO2H 1VQLA 1HJPA 2MEKA 1EFWA 1K0RA 3CC4A 2SNSA 1CKMA 3K5OA 4P73A 4HIKA 3Q3NC 4CKEA 3TS2A 1B50A 3MXPA 1CMXB 3DVGX 2NVYB 1IZ6A 4HJ5A 1JC7A 2PPBC 4B3TL 4II2B 3OJ3A 1V86A 4R9WA 4JWSC 1V49A 3APCA 1DCZA 1PZID 2ZM6L 2PKOA 1D1KA 4B3SL 1IPGA 1ENFA 1GUNA 1C4CA 1P7EA 3PF5A 2XN9C 3KYDD 1KXLA 5KGUA 3F2CA 2JXMB 2HJ8A 1CQFA 1SE2A 2I46A 4XQJA 4HWIB 5DPSA 4FLHA 1FNWA 3U7ZA 1I3QB 1U4LA 2OEDA 2CWPA 4KJOA 3M4YA 1ZGUB 2N78A 1JOKA 2IO0B 4TMAB 2KEEA 3QO2A 4HJGE 1WGYA 2Z9HA 4OWXB 4E3CA 2K6DB 1V1QA 1HEZE 2ZEQA 2E2HB 4K5XA 3SD5A 1V8QA 3V05A 1RFAA 2NMQA 4DV2Q 2MFIA 4OONA 2WXQA 2ICIA 3E5SA 2JEBI 3QOJA 4LJZC 4E71A 1YNXA 1K53A 3F2BA 1MSGA 1YN3A 2FUG1 3LNNA 4KD4A 2WU5B 3L10B 1XNQQ 1BUIC 3Q3JA 1S3OA 3IKJA 4DAMA 4JV5Q 1GUWA 4QCLA 4A3PA 5G3LD 4S3SA 4J15A 2JZPA 2B76B 4IWOA 3OW2A 1IL2A 3ZKJC 3FKIB 2MH7A 1F52A 3M85A 2DBYA 4MGYE 2B2WC 1ZW7A 3M95A 1U4AA 2D2CC 1CFMA 1TWGB 3PIPA 3IFDA 1A70A 2PE9A 4DV7L 4GDLB 2KQ3A 1Q1OA 2G4DB 2MBQA 5D14A 1Q12A 4OELB 1FD6A 2K7VA 3VUXA 1OTRB 3NEMA 2JXXA 2WAQE 1T0QC 4GXBA 4TQ0A 1NUCA 2Y3AA 4GMVA 2JRHA 4GNXC 2EDGA 3BZKA 5DM73 4IUTA 4OGQC 1AWDA 3RZWC 3NXWA 2CS4A 1Q82C 1C7YA 2VZAA 4B9KA 1X3FA 1KH0A 1Y69U 1I6HB 4FADA 2EJMA 3NHEB 4X65Q 4GSWA 5I2YA 4JI6L 1JE5A 4LF8Q 2JY6A 3KDFB 5EPJA 3DMUA 2IWHA 5FLXE 2L1AA 5T1IA 1SYEA 3L08A 4F87A 1IXRA 2UU7A 4KI0A 4UP9A 4AJYB 3ZXVA 2WKCA 2Y5BB 2BQQA 3SK8A 2CH4A 3V6EB 4RCOA 1S5CD 1N36Q 4C3HH 2ZVOA 4NNJB 3A4RA 3A56A 3S16H 4FF1A 4GOPA 2BS2B 5IGFA 1TKGA 4EOYA 2CHZA 5C5LA 1O78A 1X55A 1WR6E 1F1HA 5BYSA 3G4SA 2RF4A 4ACFA 2PZUA 5FK9C 3VQIA 2CHWA 2UWQA 3Q8EA 2RBMA 4H2AA 2R93G 1STGA 1HUNA 2ZJQA 3GV6A 4BBRH 2J0JA 4JCVE 1HNZQ 3Q69A 4GLAC 5G2NA 1AN8A 2WDRB 4WWPA 2DN8A 3TP6A 1KQSA 2L05A 1JR0D 2INDC 3S2AA 2RHQB 3I3CA 1L0YB 2KLCA 3M7GA 2FFKB 1FM0D 1HZ6A 5EBDA 4POFA 2Z1CA 2NTSA 2DLBA 4NXNQ 1SLJA 2BCOA 5L95C 1P3QU 1HQMC 2HQLA 2GVBA 5IP9H 3HM6X 2WKDA 1MHHE 1HR0Q 5JXVA 1HNWQ 3GE8C 3U9OA 4OIJA 1RAXA 5DM63 5M3FG 4BVUC 3K80C 3MWYW 2MJEA 2B3GA 4PQXA 2GA4B 4FP5D 3ICEA 5MPOA 2MO1A 3AE7B 2HJ1A 1FXIA 3DBLB 1I4HA 1FCCC 3TUOA 2K33A 2F03A 5A35A 4A76A 3AE5B 1QZHA 1WJ6A 1A2UA 2IDYA 4A4IA 4PV1C 2IY1B 3GZNI 1RFKA 1F77A 2KHSA 2NTTA 3VUWA 4B6WA 1SJHD 2ZXPA 4K3BA 3GTMB 2KBNA 2X38A 4ANUA 1YIWA 3HEJA 4BY7B 1BCPD 3S1MB 3SGIA 4P75A 4IPCA 2LMCA 5EQ0A 3CCUA 2NZOA 1R4MB 3S9WA 4P6VF 2K14A 1HZBA 3MC0B 4FVMA 4JOIA 4A3KB 2V4LA 1FMAD 2MJDA 4UAIA 2YEPF 4EX5A 2FE8A 1LV9A 5I9OA 2KDEB 2F0TA 1QG7A 3H09A 1TWAB 2MHVA 1M4VA 3D4DA 3NWSA 1V1PB 3K9OB 2R92H 4LNKA 2MP1A 3VA7A 1JB7A 2IGGA 2D3BA 3HK0A 2G45B 1E1TA 2XK5A 2RQXA 1LO5D 2F4VQ 3S24A 2LFIA 1D5MC 1YI2A 1BBUA 2VQEQ 2JA7H 4KZ0A 4DUYL 1E0ZA 4UY8C 1CKOA 1W3SA 1X32A 1PH3A 2VXWA 2BF8B 3NG0A 1M8AA 4KLKA 2PIAA 4G11A 5IOIA 1QZGA 1FXTB 4JC0A 4RGMA 4KJNA 3NVWA 3NHHA 2MLBA 1OQQA 1X6OA 2F0UA 3KK7A 1WJ4A 1ZDXA 2E2DC 4GGQA 4KY5A 1SYFA 2FMCA 4EGVA 1FRDA 1PH5A 3AEDB 3WANA 3CP0A 1EIYB 2FCNA 3QA8A 4RKLA 1LUZA 1PFSA 4BBSG 1GUAB 4TVAB 4MZ9A 1RHPA 1V1OA 1DOKA 1WXSA 5JVH3 2J0KA 2DENB 2UXCQ 4NP5A 5BO4B 2ZPYA 3F2DA 1JJ2A 2I0QA 4NJCA 1L4ZB 2E74C 2D3CA 2LHDA 2ASBA 4JI7L 2K8HA 2XTIA 4JX1C 2EXZA 3WDNA 3J7AV 1KDAA 5IGGA 1BBXC 2JU6X 2OQ0A 3NJTA 2FJ2A 4LF9Q 3HKZE 1BMLC 3KFUA 1YNJC 4LAAA 4ZRZA 3A8IE 1WXAA 1TWCB 3MXUA 1JWSD 4JI1L 2GBKA 3Q14C 5E6OA 1IYUA 4PMBA 1SNOA 2WAQG 1XCQL 1IGDA 2K6QA 3RUIB 3C1FA 2KWDA 5GQOA 3QIAA 1E8YA 1SE4A 3NTKA 2CJOA 3I73A 2Z4HA 1WX7A 1XPRA 2E2IB 3MZ5A 3AEEB 3SK4A 1QUQA 2GBMA 3VUYA 3ULJA 2N9EB 4ANWA 2M19A 3A9KA 4DAYA 3WALA 4DV5L 4KV2A 2PMZB 3U8ZA 5HFYA 2KX3A 1WSPA 4B3TQ 2JF5A 3M3YB 2O2VB 2REXA 5JEAH 4DAPA 1SBBB 2ZM6Q 3Q8DA 2JA6B 4KY7A 2JSOA 2EE1A 2K04A 4B3SQ 3J81L 2VUMG 1E5WA 1TKEA 2EKIA 3I4NB 5CX3A 4GN3B 2EJGC 2JQOA 1XLQA 1NBFC 1S72A 4GLXA 3Q8CA 3MXGA 4BFRA 2KEDA 5M5WH 2M9VA 1EQQA 1PH4A 1G8ZD 2CVRA 2UUCL 4LF6L 3I4MG 3PUVA 3HKSA 1WJJA 4WJPA 2BGFA 3T56B 3KWLA 3RFZB 3QAQA 2CFMA 2K01A 4A3MG 4JW0A 4AOFA 2RR9A 1CKNA 4CO7A 4HSPA 1Z9FA 1ROEA 2N55A 1Q1BA 2LGSA 4X6AH 4MIUA 4BBNC 4XWWA 1XMOL 4RKBA 3MC9A 4HK2A 1JQ4A 4IFDG 4WJNA 2J4XA 2QC8A 1VQNA 1VR9A 2G1EA 4F7XA 2YTYA 4MM3A 5JJIA 4M0WB 5F2DA 3H1UA 1I50B 1F9SA 1TKWB 2LZ6A 4HAEA 3HVZA 3VTUA 3DDCB 4WWMA 2XRSD 2C7NB 2FCSA 3TP8A 5BMIA 1E2WA 4HROA 2HCCA 3A8KE 3GTQB 4JI4L 3ULPA 4IUQA 1YHBA 3W5OA 3AE2B 4OVZA 1A3VA 1PGBA 1WTHA 2MPMA 2WV6D 2QKIC 4K81A 4GIVA 4A3IG 3UINB 4EZJA 1UE5A 4KKJA 1X3GA 1Y1VB 1JW9D 4NKLA 3S2HB 1NDDA 4WH4A 3G48A 1SF0A 3WCQA 1EWIA 1T0RC 3J80E 5KEEA 3PO3B 1V5OA 5AZGA 4AS1A 3IFWB 2LXAA 2HDMA 3KF6B 3HIZA 2BE5D 4TV3A 4HKQA 3V6CB 4WRDA 1OTCA 1JB3A 1KOTA 2N7EA 4JLCA 5ELBA 1FNVA 3PGZA 3ZYYX 3U30A 4GOPC 5CR3A 2EY5A 4U673 1WE7A 4DK3C 2LRUA 3P4SB 4J1MA 2PQEA 2GMIC 3FAHA 5D7GA 1KDBA 1I35A 3TRZA 2LXCA 3DHHC 2IX1A 3V96A 4QB4A 5E3FA 3DWQA 2K28A 2TSSA 3CF5A 3AE3B 4AYBG 4YSXB 5DPTA 4N9F4 3NVVA 3HOUB 3B6YA 4LK1C 1PMRA 4WJWA 3EVQA 3E0JA 1B2TA 4PS7A 2L52A 4LF7Q 2JJQA 4RGNA 1ENCA 1WTVA 3P4QB 3IG3A 3E9IA 4JI6Q 3SXHA 5C0XG 1VZ7A 2D10A 4BXXH 3D31A 2AYOB 4W9HA 4OX9L 4GKKQ 4GNXB 2NVTH 1D2BA 2V9HA 2L12A 1ASZA 4KZCA 1PFNA 5LMUL 1J5EL 5L83A 2FINB 4QIWE 1YOVB 3APFA 3I55A 4DNIA 3TP7A 4CBVA 4K0KL 1HR0W 3KJPA 2O4XA 4KK7A 1QQRA 4KD3A 1V80A 2PW9A 3A7AB 1VMPA 2ZXOA 2M4NA 4DR4Q 1QVGA 3MTNB 4C3IB 3J7A5 4A8XC 5JPMC 2RMMA 2E8GA 3RLNA 1WTXA 3IVFA 2DY8A 3UDXA 3HGBA 2XVSA 3AE6B 5DEHA 1WY8A 4RM8A 5KYLA 4KKUA 2JWZA 2QA4A 1YIJA 1TT2A 3O65B 4L8JA 3NZSA 3UE0A 1IUEA 4IM0A 4C7ZA 2CKHB 3W1YA 3PRMB 4DXAB 1SFOH 1EOVA 1WOCA 2KKCA 3W5VB 3MEFA 1YJJA 3ZDTA 3J81j 1JRPA 4JOIC 2SOBA 1GHJA 1N34L 4A3BB 4HN7A 2WXLA 2E2JB 4IM3A 3UGBB 1PH2A 2LUEA 3HKZG 3V60A 3AECB 4HJ7A 1FD7D 4P74A 3HOVG 3SU8X 5H1SE 1VJKA 2J52A 1EOTA 5KHQA 2PNHA 4B3RL 3DBRI 3DVNU 5IYCG 1UE1A 4ANVA 2W54A 1PH8A 4KGRA 2GVAA 1H9JA 3NSWA 2O6VD 1H8CA 1ICWA 2Y0SG 3EFXD 5ELNA 3LYYA 4X57B 1WRIA 4BKSA 2DUDA 5C4XB 2JZZA 4ZRKA 2R61A 4X3SA 3AEVA 3IAM1 3DWPA 4US9A 4ARCA 2Q2IA 4KHPL 1WX8A 1EZ6A 2JUOA 4NB3A 1SYGA 1QILA 4CKBA 1OXXK 5CHWA 5M5YH 3FVQA 2H4OA 3GTLH 1IKMA 2CU3A 2WXIA 4R4TA 1S5FD 5ELFA 1ICFB 3BY4B 3L16A 1TIID 1TYGB 4F88A 4IJLA 3OTOL 1PV4A 1T3QA 3JAME 4C3JB 1V6EA 2F0LA 3RNEC 4DHJB 2CWAA 3UDGA 3D0FA 1EYGA 5AJ3L 3BK1A 3AN1A 3NE5B 4LMQD 1G51A 3PUXA 5FLXL 3M7NA 1N5XA 1WGHA 3ZW3A 3VYRA 4XQNA 4JI0Q 1PTOC 1PRTD 1U9RA 2C9OA 4J8QA 4A55A 4QQBX 2AEHA 1N62A 2I1JA 1PUTA 5EKKA 3RNUA 3BK2A 4JG2A 1MIUA 4CKCA 2JP1A 4JI5L 4MHEA 1MHXA 1WGKA 4HDOA 1Q7YC 2LXJA 3VRBB 3ZTDA 3PLUA 2EJFC 2OEOA 4H02A 5DAUA 5EE1A 2K6AA 2IL8A 2F1MA 3L3OC 5LMNL 3KF8B 2VUMH 2R7ZG 3RULA 3CPFA 1I94Q 1K83H 1E8WA 2OQKA 1VQCA 1J8IA 3Q6BA 3N6RA 1J9OA 1HH2P 4L23A 1IKLA 3I4MH 1FGUA 4ZUIA 4I6LB 2QDLA 1N33Q 2BOSA 3BVMA 2YU9H 3CIRB 1K8OA 2NPTB 4A3MH 2DNFA 3GTOB 1GKHA 4Z9CB 4DAVA 1WZ0A 3FP9A 1B4OA 3QG1A 1NCVA 3AE9B 2KTRB 4IFDH 4NXMQ 3VR4A 1IW7D 3GV3A 2D07B 2MHJA 3EGRA 3MVVA 1PH6A 4DR2L 4J6HA 3IL8A 5C4HA 3K5NA 1VQFA 3IAYA 4JI7Q 2FNJB 1DD2A 1HZAA 4O42A 3A33B 4H44C 1W6JA 2A6HC 5LLIA 1CZWA 1L2FA 2EOTA 2BH8A 4AP4C 1SXTA 4ASWC 4RHSA 4G4KA 2WB1E 4WJ3M 3A1QA 2N49A 3BG3A 3IAS1 3VRAB 2JWUA 1G6ZA 2QEXA 3VYUA 1UD7A 1J7AA 4BOSC 3NOBA 5D6JB 2YVCA 1RKNA 1XLOA 3HOZB 3EJIA 1GOZA 4JL9A 1PH1A 4A93H 4L5TA 3RNGC 3N30A 3VTWA 1RRBA 4CYEA 5IP7G 1MSHA 1VD2A 3C46A 2WACA 3HOYB 2ZJRA 3SEBA 4PYUA 2LY7A 2NVQH 5IYBH 4NJ7A 2UUCQ 1Y14B 3HM3A 1R9TB 2PI2E 5IIFA 3Q0AA 2KQ4X 4M8NA 4R8NA 3K57A 4MH8A 3NWTA 4AUQC 4EZKA 4X64L 4LF4L 3I3TB 1JMLA 4LF5Q 2K8CA 4C3HG 2DAJA 3PREA 2MCNB 1NE3A 1MG8A 2MW5A 4RM9A 2PQAB 1E90A 1TGZB 3QHTA 3M4OH 5JJLA 1ET9A 1K3BC 3K7AH 2A8VA 1E22A 1PTOD 1PFBA 4IN3A 4P16A 3AV8A 4CJ0B 2XGTA 2GN5A 3P1MA 2FAZA 5C0XH 3I90A 1SNCA 2IGDA 3ONSA 4GU2A 1YX5B 3RN2A 1X3PA 2Z6KC 1EU4A 4JE3B 4IQZA 4UDUC 5L37A 2MP2B 3S17H 2KTFA 4JI4Q 3ZTCA 2KNBA 1R4NI 3M62B 2SEBD 4XT3B 1VZ6A 4K5WA 2LVPA 4YWLA 4PZ7A 5LXHA 2B63B 1ZDVA 3TL5A 4EVOA 2EYMA 3FKIG 1PVOA 1JALA 1FFVA 2B3AA 4IOIE 2N9LA 4JPSA 2A5HA 3VR5A 3FC4A 4KHVA 4KX6B 1A62A 1VQJA 3DWGC 2GBJA 4YL8A 2UUAQ 3RLFA 4DUZL 2UXDL 1WMHA 4KN4C 1EU3A 3KW5B 4OZBA 2NB0A 3Q22A 4JYAL 2PW7A 1FRRA 3SFEB 3PPAA 3Q3FA 4B3ML 1JROA 1N32Q 2EELA 3VFKA 3W5UB 4IOCA 3AEAB 2IX0A 2LGXA 4JK1C 5I2XA 2A69D 4LFCQ 3HOWB 3ND9A 1Y8PB 4C2MH 3CMEA 4RWSC 1NBWA 2KVMA 2B8GA 3DBHB 4NZLB 1TZOA 2F0OA 2AQ2B 1BOSA 2MBHA 2RHSB 1XYIA 2D11A 4GOPB 3T3OA 2QHOA 3AB9A 1Q8KA 2I5MX 3EN2A 2X8XX 3KYCD 3KBXA 1U4PA 5COYA 2HE7A 4X62Q 3S15H 2IHFA 1PQSA 3GB1A 2C60A 1VF5C 1DYQA 3GTKB 4IUMB 3RI7C 3R3MA 2KT7A 1JWAD 1KD1C 4GOCA 3TZDA 4BS9A 1R7SA 5DPRA 1XPUA 3UF8A 1H9KA 3DBSA 3SR6A 1NR2A 1J5EQ 4X66Q 1EUJA 2HDEA 4R4IA 3C2PA 3L54A 4KIKA 4EKUA 2R92G 5IYCH 2HHHL 3EUB2 1HTPA 5IT9E 2ZZPB 4F8CB 3PTFC 3L4PA 2EYOA 2IT1A 1KIXA 1BVSA 1VQAA 2JA7G 3A55A 1BCPF 1EY9A 1NTGA 1UAPA 5J3BA 1GC6A 4W9DA 1OFFA 3M63B 1NAPA 2A68D 3X3MA 1CUKA 1PRTB 2QDBA 2L3ZA 3HOXH 1JJGA 2ALYB 2UU9L 2WXRA 2B2TA 3DEPA 3ECIA 4EUTA 1JT8A 1LM0A 1KRSA 1QB5D 1SDFA 1C76A 2KDMA 2XIWA 2OOBB 5BMGA 1ZEQX 4N6EB 5FR6A 1AE3A 2L55A 2A6EC 4DR7L 5M5XB 1ZUD2 3DXJC 3HUIA 4QMGA 1CZPA 1TT5B 4QIWB 3TQYA 2IYDB 3K9PB 4K7WA 2D0OA 4MGKE 3TEXA 2HTHA 5JOBA 1F0ZA 1E1OA 3F1ZA 4RF1A 2BW2A 1RLFA 1ZKOA 4TKNA 1XLNA 2JK8A 1CT1D 1Q81C 3S1QH 3P2BA 3PV1A 1F9QA 3GTPH 2EQSA 3VA5A 4Q5VA 2VW9A 3CCQA 1K8RB 1GB4A 2R7ZH 1YJ1A 2K25A 1EY8A 3J80L 2LRWA 2BYTA 1LXDA 2L9HA 4HMIA 5CV4A 2OT2A 3ND8A 3TSSA 4WURA 4Y7NH 4K1RB 3W1BA 3BVZA 4IUUA 5GROA 1XX8A 1EY4A 5FKAC 1VQ8A 2NBVB 5EPLA 4OW0A 1E2ZA 4W9LA 3CC2A 4R3DA 2AWNA 4B3RQ 1L2NA 3M4QA 4K6LA 5E4WC 4MDKE 2L0TA 2XSCA 4JPBW 1VQ6A 3WIMA 3I2ZA 2CU1A 1D4BA 3KVFB 3AU5A 2VS1A 3GQBA 1YNNC 1C4AA 3PVLA 1N6ZA 3HP3A 4W9CA 3LWEA 1WCMB 1LT3D 1R4QB 2PMVA 5JEAG 5C4JB 2WHIA 4A3KG 1V2YA 4P1BC 2B2YA 4K8IA 4DK1A 1E8XA 2LS01 3C8YA 2L32A 4LLGM 1F2RI 1XD3B 1D5XC 3A74A 2F0QA 4B0EA 2EVBA 4IDIA 1WM2A 2KXJA 4JWUC 1OXTA 1SYBA 5C3EB 2NCNA 2K5PA 2MGSA 3N1YC 4GDKA 4JGHB 3PIO3 1ZE3D 2V4DA 3MXNA 2DAFA 4KKIA 2JPHA 3RZDB 2NVYH 3NRZA 2KN5A 1KTKA 2F0NA 2NR2A 3ZVVA 4A3FB 3CCRA 3AB5A 4OWWB 2D0PA 1WD1A 1QNKA 3J81i 3NVZA 1KLVA 3AM9A 3I63C 4ZLTF 2HUGA 4IFDJ 3MAQA 3TN2A 5IP7H 3TEZA 2RSNA 5LXIB 1ML0D 1SE3A 1PTOB 2G5DA 3BIID 3OIQA 3Q3MC 2L1BA 2EPBA 1I3QH 4G7ZC 4LFAL 1XNRQ 2KCCA 4DNTB 4RG1A 2JYOA 1VQ5A 2C7MB 3NBIA 4XDDA 2ZT9C 2MRPA 1FVIA 4A3DB 1QLBB 1E3PA 1LLRD 4W9GA 2E2HH 1FFUA 1S5ED 4ZYNA 4JI3L 2KHJA 4URKA 5JVG3 3UI2A 2RSOA 2XNAC 2XRQD 5CTRC 3BZCA 3EIVA 5C5MA 1YITA 4WJ4A 1I6VC 3T16A 1LTGD 1KJTA 4BAXA 4P72A 2CW0C 3GTGB 1YBYA 1H9SB 2H5XA 1F2LA 3AU7A 1L0XB 5TSSA 4NDXA 1DOLA 3TMEA 4CGYB 1VQEA 4DV1Q 5M3MB 1VQ7A 4K7UA 3ZNHB 1Y8OB 1PGXA 2OTLA 4EE2A 4L1BA 1WX9A 1HA6A 4NAWA 3NPPA 1C8CA 4KHZA 1Q0WB 2J0MA 1S1QB 4N9TA 3PZDA 2KQ7A 4DV0L 2AKWB 3X23A 4N59A 2B8FA 3ETRA 3FKIH 2JA6G 5D3DA 4ME5A 2PJHA 3I4NG 3A0JA 4DDID 1KL9A 1FR3A 1TWGH 5J2RA 3EFUA 4G57A 1CQVA 4QF4A 4GN5A 1O80A 2LVQA 1LTSD 4E74A 2B2UA 2N88A 4BXXG 3S1NB 4M8MA 1EO6A 3CAMA 2OXPA 1IYVA 1H95A 1MI0A 5C6AA 2FBWB 1U4MA 1B70B 1R4PB 2DX5B 2ZPNA 3RZDH 3CD6A 2W9NA 3Q2AC 3M4PA 3PMFA 2PCFB 1II3A 5C0XJ 1HNXQ 4IFDI 1VDZA 2D9UA 1TIFA 4HEA1 5E6JA 2WB1B 3ER0A 3PIP3 1QVFA 1ZXTA 1X56A 3U7DA 1PDQA 5IKCM 2PEAA 1YX6B 1OO9B 4L5SA 1P9DU 2CQAA 4LFBL 1I6HH 1ISNA 1HZ5A 2QSDA 2EYJA 4LK0M 3STBC 4W9KA 4KDIC 1Z6HA 3EC8A 2B2VA 3PLVA 2K4KA 2Q8RE 2L00B 4KKSA 1MPEA 2N0SB 4HCNB 4ZRJA 3VH4B 3D32A 1E0BA 1E24A 4KGTA 2WFWA 2SNMA 4OHJA 4JI8Q 4JBJA 3EECA 1JWMD 4C1NK 3JC66 2L4NA 3HZXA 1Y1VG 4U68A 2KYWA 3DHQA 4A3GB 3BDLA 3NZUA 4XYOA 2QEJC 2R6GA 4BA1I 2CR5A 5LHY1 4NQLB 1N61A 1I4GA 2B39A 3MHBA 1MI2A 2PO4A 1STHA 1S3SG 1BKBA 5E7NA 2KMCA 4DQOC 2WU2B 4DR6L 2KJXA 3B08A 5J39A 2FCQA 1K73C 2WWZA 1DOYA 3D3RA 3N1ZC 4AJWA 1RCVD 3DCGA 1IBLQ 4FF3A 2XWJB 3CCMA 4FF4A 2UXDQ 5CHFA 2K5QA 3RD2A 2NBFA 1LT6D 3QR8A 1TY0A 5E4XA 2BKRB 2JA8B 4C80A 3OMGA 4B9WA 4DV4L 1CHPD 1A6XA 5JHAA 4NW2A 2M17A 2L0CA 1B1ZA 4WORA 1XXGA 2G4SA 4M01A 4K14A 5TR5A 1UBIA 4DN4M 1LFDA 5CV8A 3ZJTA 1YJIA 3C1EA 1YVCA 1N5WA 1P8LA 4HEDA 1XPOA 3HOUG 3DWMA 2B2TC 1D6EC 1DM0B 2WLBA 1PZKD 1EY6A 2INPE 1KF6B 4EEWA 2K5DA 5C0XI 1ZP0B 5CBEE 3KUCB 3ZDMC 5IN7A 4HJKA 4CDDC 1AW7A 3D8GA 3UDFA 4GDLA 4Y52H 3BS1A 1QOFA 1Z5SB 3H0GB 2XEWA 5AZFA 1WE6A 3T1YQ 1ONLA 4DR3L 4ZDVA 1MD2D 1L1OB 2AQ1B 4LNQA 3I5JC 1GJZA 5IGBA 3GTMH 1XF5L 4DR1L 5JAVA 1UE7A 3N1XC 4BWGB 4NJ6A 4FJZA 2PW5A 3IT6B 4XYCA 1HTLD 1CZGA 5EKLA 4BY7H 2MX2A 2HHHQ 3NS8A 2P5ZX 4C3IG 2Z0DB 3R3OA 4UP7A 1WM3A 3S1MH 5E6NA 2ZW1A 5G5HA 1RTOA 3B1LX 1B53A 2FCMA 3G71A 3KDFA 3PV0A 2WXJA 4A6QA 3W2DA 1VCBA 2UU9Q 4IPDA 4IUVA 4A3KH 1ZYRC 3CW2C 4RH6A 2IY0B 1OEYA 1XMQL 4DHJD
chains in the Genus database with same CATH topology
1O7ZA 4XQQA 1KABA 3AE1B 4MACA 3AMZA 2D5GA 1D5ZC 3MP9A 2EYPA 4RGOS 4ZRPA 1FYCA 1GXDC 2HQEA 1UEAB 2B2YC 3P4PB 2BA1A 5C44B 1EWYC 1RWSA 3I57A 2K0PA 2QILA 2INNE 1WTWA 5M3FB 4KN7C 1FNUA 2L83A 5EE0A 1Q3LA 3GP7A 3VR3A 5T1GA 2WXFA 1TQOA 2FHTA 1PLFA 3CKIB 1P7FA 2R3ZA 4DF7A 3TEYA 3G7LA 2F0HA 1TJEA 3TEWA 2JYEA 4C3JG 3PUYA 3HVDA 2F0KA 2JSVX 2F0IA 5LNK1 3RZOB 1VDVA 4XDCA 1WVLA 2F3WA 5CMDA 1YNJD 4MT5A 1DOIA 1SNDA 2V3PA 3FILB 5CC4A 2V3NA 5IT9L 1YN4A 2WS3B 2PTLA 3ERQA 1H9RA 4DK0A 1Y8NB 1V1PA 1HFGA 1TKYA 1A3UA 1BF4A 2XWBB 1UNSA 2F0EA 3H8HA 1SMYC 1TS3A 1NYRA 1I4RA 4F8MA 1N63A 2B2UC 1EIGA 1STBA 1B9MA 1GUTA 4RAUC 4HCSA 5C3XA 5KNBA 2SAKA 1KNEA 3EROA 2ENBA 4YSZB 3VR8B 3U9SA 3QJYA 1HA5A 1L0VB 5BN5A 3W1SA 3MEHA 2B2VC 5HI1A 1TWFB 1PZJD 3K59A 3P63A 4DXFA 1QT9A 2NVXB 4BA2I 1WTRA 5KYIA 4HTHA 2V4IB 2WIIB 3NQIA 2WXKA 3OW7A 4XYQA 1TWHB 2M2LA 5CV9A 1LACA 2HTME 3T13A 1C79A 1ESFA 3KLRA 3IXSA 4BY1B 3MTSA 3BWUD 3L7ZC 3N52A 1Y1WB 1NR4A 4XWTA 4KGSA 4L63B 5AUIA 3S14B 4OIKA 2BS4B 1JORA 1PXUA 2QMTA 5IGEA 3R2TA 1DONA 2NZ1D 1C4PA 3BVGA 2A73B 4KTAA 3MFYA 3RMHA 3W9CB 4RGTA 3MFGA 5J22A 3HS0C 1GUOA 4QUFA 3KUPA 1BDOA 5CGKA 4USAA 2MJ8A 4A3IB 2L5TA 1JQYD 4M0WA 4ARIA 2F0PA 1QJOA 1KRHA 2G9HD 1Z7TA 3TP5A 2RA4A 4KMUC 4YXDB 4XIGS 1C4QA 2D5DA 3CWIA 3U4EG 3U2SC 2JA5B 1HPCA 3GTJB 2H88B 2DYMA 2Z8LA 1T5XD 4WFN3 2IX3A 1TVXA 3K0YA 5FO7B 5FO9B 5K5PA 2JE6I 5CV7A 3S1RB 3J9CA 1GPXA 2GRIA 1I4QA 4IALA 3VYTA 4J3OD 1VRAB 1L4DB 5I9PA 5HG2A 4DNRB 2WDVB 5BMHA 1A15A 2K32A 1SJED 1STEA 2SDFA 3R93A 1UUPA 3E6ZX 2RPVA 3PO0A 4ILWA 2BBCA 2TMPA 4ODGA 2B2WA 1XWEA 5JEAJ 3UI3A 3PUWA 4V0BA 1QF6A 4O1NA 1KAAA 2WDQB 2L11A 1SAPA 2IPKD 3LXFA 5HGTA 3CQZB 4DA2A 4A3JB 1KNAA 2WP9B 2C5CA 2F0SA 1UWMA 1KDCA 5G3LF 4WIPA 1NEKB 2I2YA 1TY2A 4P2CB 1ZOYB 3KLSA 2JEAI 2WNMA 2JXTA 2ID0A 2H1EA 3NUCA 4ZYSA 1OXVA 1FCLA 1SIJA 3I91A 2VB3X 2KECA 2WP8J 1B44D 3OWFA 3OIPA 3AEFB 2F3VA 4V190 2WXHA 4EQNA 3GD7A 4K5VA 3PUZA 4K2LA 3NVYA 4XDXA 2Q5WD 2W82A 2V0GA 4ZUJA 3VR2A 1YMHE 4RCNA 2X69A 3HOVB 2K3UA 2YEPB 3PZ7A 2X6LA 5C3JB 3OMCA 3NTHA 1BXTA 4L6TB 3PO2B 2BB6A 1HHVA 3FPUB 1GAQB 2GB1A 2WQYB 1V43A 3SDZA 1DOMA 1Y56A 1AZQA 3N9YC 4PMCA 5A2QE 1XEEA 2A6HD 2N7JA 2EY1A 2I07B 1AP0A 1QOGA 1UWXA 1PFMA 2WXGA 5AUKA 1F9PA 3Q24A 4GZYC 3T3NA 2KACA 1WTQA 3TZUA 1HRJA 3SFDB 3EA6A 1EEFD 3QWNA 1ZXHA 4MN3A 4PNYA 2IW3A 4X3TA 2NN6G 2F4IA 1YQ4B 1QE6A 5IGCA 4TKOB 2J53A 1GHKA 3ONAB 2ONQA 1XO3A 3ZJVA 4LTUA 3KF8A 1L6UA 4RA8A 2F0GA 3A7LA 5BYQA 4ZRQA 1X3QA 3S2DB 5J1ZA 2E75C 3P7JA 4TRDA 1EY5A 3NZ3A 2WXMA 4I7ZC 3KWVA 2FMMA 1EQTA 2RKSA 4IURA 2K03A 4US8A 1CTMA 5C2TB 2DY7A 1LTRD 1C78A 1BR9A 1EWHA 2DNCA 3FEWX 3AEGB 3DUZA 1QOAA 2ZXRA 1F2ZA 2LMCB 3D6WA 5JPNC 3Q23A 5M9OA 4C56C 3H94A 1BQQT 1IBXA 2K5WA 1RDPD 1V8CA 4QUCA 3OSOA 3KQ4A 4C3HB 2RDHA 1RF2D 3S16B 2KA7A 1QKZA 5I4DA 2NWGA 2K9XA 4YT0B 3MA2B 3AE4B 4TQ1A 1F2RC 3R8BA 4WQMA 4FYDA 1EY7A 4BBRB 1FO4A 3BDOA 1ILPA 1BNZA 2Q8IB 3F2UA 3PZ8A 4A3EB 4K6DA 3L9AX 4X3UA 2BA0A 3W3AA 4NMZA 1E7PB 1KLGD 1ZPSA 1CK1A 1STAA 1FEHA 1NI3A 4ZHOA 1SNMA 1JWBD 5CORA 2IJ0A 4H7BA 2Q8TA 1TS4A 1BCPC 1RYJA 3FPPA 4WAFA 3ZQ4A 4M8AA 2A6ED 5K36H 3I8ZA 1K8MA 1VZ8A 3KBGA 3DM1A 4FO2A 1VLBA 3LB8C 1ESRA 1K52A 2F0JA 1EL0A 2D62A 4ZK9B 3SVMA 4OZCA 2W3SA 4CJ1B 4G7HC 4ITKA 2EYHA 3QB3A 1EYAA 4ZKBB 1VF7A 4GLSC 3V2TA 2BS3B 1LTTD 3RUZA 2KAJA 1QWYA 3OWEB 2R92B 3DWAA 4EQOA 2PNRC 5DNFA 3Q6SA 3HRDD 2JA7B 1IHZA 1IGCA 2X6GA 1YNND 4REZA 5KNDA 4MM3B 1A2TA 1S5DD 1NSNS 3BYTB 3BYYB 2Z4IA 1K51A 5H92C 1EYDA 2M0AA 3JAML 4OO1H 1WD0A 1GB1A 1BUVT 5EE9A 1DXMA 1J7BA 3P1HA 1SSNA 1TU2B 1PTOH 4FXDA 2N9KA 1GUGA 2AUJD 1DZ1A 2EYLA 3AH7A 2BB5A 1RM6C 1B9RA 2KN4A 1CJEA 1F9RA 1H9MA 2NN6H 2PVGC 4N9PA 4HKZE 2Y5PA 2AQ3B 5LL6S 3OOCA 1CHQD 1WYGA 1DGJA 3HRZC 3NTIA 4C1NI 4B0MA 1QOBA 5BN3A 3B2FA 1S5BD 1I4PA 3T4AC 4ZKCB 4HRSA 4ZQ3A 5CV6A 1Q1EA 2CW0D 1EM7A 1LT5D 5M5WB 3I9V1 4XXEA 1WTPA 4IZ8A 5CBAE 2VNUD 1BO0A 1AYFA 1E2VA 1NYQA 3NK9A 1LTBD 1WTOA 1D4BA 4FXKC 2KOLA 3LWUA 4R8IA 3D4WA 1AFPA 1G2TA 1SB3C 4NAMA 4A90A 4B08A 5D3IB 3WOEA 1XCTL 1CI3M 4N58A 1J7CA 1QNUA 1O7YA 1GUSA 1AEXA 1E9MA 3B2GA 3G6JB 4ID6A 4ULLA 5NUCA 4EQPA 3ZJUA 2F0FA 4RHRA 2QJLA 2J7ZA 2OHFA 5ELEA 5C3WA 3K5LA 2BE5C 1L6VA 3X3NA 1RJTA 3HG9A 1MVKA 5KIXA 2LJIA 2QIEB 2QF7A 2J0TD 2AX5A 1EZ8A 5I6WA 1EYCA 2EY2A 5BN4A 1K50A 2ICEC 3FMCA 2R93B 5ELDA 1G2SA 4OZAA 4CHTB 2CHBD 2A74C 4HMJA 5GXGB 2Y5CA 3GO5A 3P42A 3IT4B 4XT1B 1PRTF 1TS2A 1EFID 4I65A 2LGIA 1H9SA 2KCNA 4IUPA 1O7LA 1XTCD 1NVID 5JJZA 1RTNA 5IGDA 3CU7A 3BZDB 1FIQA 3LX0A 1JCKB 3D6CA 5BYRA 4TSSA 1I7HA 1VCIA 5EJWA 4E6IA 2NVTB 1SYCA 2NUCA 5LL6X 2G9DA 1F2YA 5A2QL 1TS5A 1L5PA 4M1UB 4IUNA 2PYKA 2I38A 1STYA 1S4ZA 3RPFC 3DEOA 1TR5A 2WINB 3GS2A 1LTID 4YTMB 2MUYA 4YTPB 4OL7A 5E1FA 4DGZA 3AMUA 1Q10A 5T8IA 2K05A 2F0DA 3QOLA 2KUMA 3NQTA 4PMWA 1HQRD 2PZWA 5IOCA 2NYZD 1SFOB 2BT6A 3MJ5A 2LUMA 4ZOHC 5H8YE 4CJ2C 3J7AF 5G5GA 1HXYD 3I70A 1FGBD 5EPKA 5EGTA 1E6EB 1GJXA 1ILQA 1ZYRD 4ZHPA 3OHXC 1Q90A 2W55A 3ABVB 3TDQA 3KLSX 2MJ3A 4IKGA 3SK5A 2PVOD 1HUMA 1G91A 1HFNA 2CJNA 4BBSB 1T5EA 1LT4D 1PTOF 1BCPB 2K1BA 3BDCA 5M5YB 3AE8B 3GTLB 1KFYB 2E76C 3VR6A 1A3TA 1B3AA 1U4RA 2BDNA 4AQ7A 1CA6A 1SNQA 3H6MA 1ET6A 4FNFA 1PRTC 2DNEA 2LEKA 1Z47A 1JOQA 1SEBD 2WXOA 2WAQB 2LFNA 2JX5A 2WXPA 1F2MA 4G7OC 3T53B 1KLUD 5HURA 1C48A 2E3TA 1LABA 1PYWD 2LHEA 2O5IC 3VR9B 4TQUS 5D65A 1EWCA 2VUMB 1PGAA 4XTCS 5EKIA 1K83B 1YNTE 4HCEA 4YWGG 1IW7C 3I4MB 3FDTA 5EBCA 1CA5A 2VZKD 2YU9B 4A3MB 3Q8AA 4FF2A 5CV5A 3U52E 1RODA 4ABNA 2K22A 3E9SA 1EEID 3CRKC 1EY0A 1IL8A 3NS1A 4DXGA 3Q8FA 4JBWA 2RVLA 2O5JC 2VB2X 3C3LA 2OF1A 4B9XA 1G291 2F0WA 3VYSA 1D1IA 4KV6A 2WXNA 3OPOA 3IFTA 2RDGA 4FXCA 1SMYD 1W6KA 4C7YA 2HDLA 1OQRA 3NBHA 4A93B 3I4LA 1AZPA 4YSYB 1WXQA 3NP8A 4OO1I 2NVQB 4HR7B 4D2KA 3WOFA 5ELCA 2YYZA 2J42A 3AEBB 2O2LD 3CHBD 1HCZA 1ACCA 1JE4A 4AYBB 2GI9A 2EY6A 3M4OB 1FXAA 3K7AB 2NN6I 2RDFA 5AFWA 3TBIB 1ZXIA 1YQ3B 4K8JA 3ITPA 4Q2JA 4A9AA 2DYOA 3FILA 2F0MA 3S17B 3SR1A 1JWUD 3Q8BA 1C9FA 2EZVA 1MBYA 5FR3A 4DU9A 1PFDA 4RFBA 3T51B 1UGJA 3A54A 2W3RA 1T6BX 5FO8B 2EYFA 4Q0FA 5CYUA 3URYA 2A69C 2QCPX 1YN5A 1MGSA 1QCBD 5EE3A 2BTEA 2AUKA 3H91A 1CM9A 4KY6A 2ON8A 1SNPA 4RF0A 1DJRD 5K36G 3NUHB 1ENAA 1IBXB 4C2MB 1I4XA 5KNCA 1WWTA 1NENB 2M00A 5IODA 3H3VC 3HKZB 3S15B 2LKVA 2A68C 2BDOA 1LTAD 3P75A 3SHLA 4GDKB 2F0VA 1EIHA 2Y0SB 3ZGZA 3J81E 5I6YA 3K6OA 1DOXA 3V3XA 2AWOA 2ACZB 4L2YA 4FXGC 3EQLC 5KRUA 4XE0A 3E56A 3HOXB 1JOOA 4H0LC 4KKTA 2ZW0A 2PZTA 3J7YW 1E10A 4H13C 3D4RA 4OO1G 1N60A 2HCIA 3P4RB 2DWQA 4PT5A 2VZKB 1OXSC 3SE0A 3R2IA 3CRLC 1OXUA 2PLPA 1V97A 3RD4A 3S1QB 1SSOA 5HHDG 1C77A 3GTPB 4RNAA 3FRPB 3B9JA 2R7ZB 5ISRA 5FOBB 4K2KA 3SK6A 4Y7NB 1XLPA 2JYTA 3K5MA 3MHZA 4NAWB 3P20A 1Q8IA 1PDXA 4HSVA 4ZAIA 2M56B 3K58A 1QOHA 1JICA 2E6XA 4X3KA 1SYDA 5C4ZA 1STNA 1RD9D 3O13A 2KMMA 4DFAA 2JQRB 3A8JE 1EQVA 4CQNA 3I72A 1VMCA 4YTNB 4YIJA 1B9NA 2MEKA 2SNSA 3K5OA 4CKEA 1B50A 3MXPA 2NVYB 2PPBC 1JC7A 4R9WA 4JWSC 1DCZA 1PZID 2PKOA 1D1KA 1ENFA 1GUNA 1C4CA 1P7EA 2XN9C 5KGUA 2JXMB 1CQFA 1SE2A 2I46A 4XQJA 1FNWA 3U7ZA 1I3QB 1U4LA 2OEDA 4KJOA 3M4YA 1JOKA 4TMAB 2KEEA 3QO2A 4HJGE 1HEZE 2E2HB 4K5XA 1V8QA 3V05A 2NMQA 2WXQA 2ICIA 3E5SA 2JEBI 3QOJA 4LJZC 1K53A 1MSGA 1YN3A 2FUG1 3LNNA 4KD4A 2WU5B 1BUIC 3IKJA 1GUWA 4QCLA 5G3LD 4S3SA 2JZPA 2B76B 3FKIB 2MH7A 3M85A 2DBYA 2B2WC 2D2CC 1CFMA 1TWGB 3IFDA 1A70A 4GDLB 2KQ3A 5D14A 1Q12A 1FD6A 2K7VA 4TQ0A 1NUCA 2Y3AA 2EDGA 5DM73 4IUTA 4OGQC 1AWDA 3NXWA 1KH0A 1Y69U 1I6HB 2EJMA 5I2YA 5EPJA 3DMUA 2IWHA 5FLXE 2L1AA 5T1IA 1SYEA 4F87A 4KI0A 2WKCA 3SK8A 4RCOA 1S5CD 3A56A 4FF1A 2BS2B 5IGFA 1TKGA 5C5LA 1O78A 5BYSA 2PZUA 5FK9C 3Q8EA 2RBMA 4H2AA 1HUNA 1STGA 3GV6A 3Q69A 1AN8A 2WDRB 2DN8A 3TP6A 1JR0D 3I3CA 1L0YB 3M7GA 2FFKB 1FM0D 1HZ6A 5EBDA 2Z1CA 2NTSA 2DLBA 2BCOA 1HQMC 5JXVA 2WKDA 1MHHE 3U9OA 4OIJA 5DM63 3MWYW 2MJEA 4PQXA 2GA4B 4FP5D 5MPOA 3AE7B 1FXIA 1I4HA 1FCCC 3TUOA 2K33A 2F03A 5A35A 3AE5B 1A2UA 2IDYA 4PV1C 1RFKA 1F77A 2KHSA 2NTTA 1SJHD 2ZXPA 3GTMB 2X38A 3HEJA 4BY7B 1BCPD 3S1MB 2LMCA 5EQ0A 4P6VF 3S9WA 3MC0B 4FVMA 4A3KB 1FMAD 2MJDA 4UAIA 2YEPF 2FE8A 1LV9A 5I9OA 2F0TA 1QG7A 3H09A 1TWAB 2MHVA 1M4VA 3D4DA 3NWSA 1V1PB 2MP1A 3VA7A 2IGGA 2RQXA 1LO5D 2LFIA 1D5MC 1E0ZA 1X32A 2VXWA 1M8AA 2PIAA 4RGMA 4KJNA 3NVWA 3NHHA 1OQQA 2F0UA 3KK7A 1ZDXA 2E2DC 4KY5A 1SYFA 2FMCA 4EGVA 1FRDA 3AEDB 4RKLA 1RHPA 1V1OA 1DOKA 5JVH3 4NP5A 4NJCA 1L4ZB 2E74C 2LHDA 4JX1C 2EXZA 3WDNA 3J7AV 1KDAA 5IGGA 1BBXC 2JU6X 2FJ2A 1BMLC 1YNJC 4LAAA 4ZRZA 3A8IE 1TWCB 3MXUA 1JWSD 1IYUA 4PMBA 1SNOA 1XCQL 1IGDA 3C1FA 2KWDA 3QIAA 1SE4A 3NTKA 2CJOA 3I73A 2Z4HA 2E2IB 3MZ5A 3AEEB 3SK4A 2M19A 4DAYA 2PMZB 5HFYA 1WSPA 3M3YB 5JEAH 4DAPA 1SBBB 2JA6B 3DWGC 1TKEA 4KY7A 2JSOA 2EE1A 2K04A 2EKIA 3J81L 2H89B 2IGHA 3I4NB 2EJGC 1XLQA 3Q8CA 3MXGA 2KEDA 2M9VA 1G8ZD 2CVRA 3PUVA 3T56B 3KWLA 3RFZB 2K01A 4HSPA 1ROEA 2N55A 1Q1BA 4MIUA 4XWWA 1JQ4A 4RKBA 4IFDG 2J4XA 1VR9A 2G1EA 4F7XA 5F2DA 1I50B 1F9SA 1TKWB 3HVZA 4HAEA 4WWMA 2XRSD 3TP8A 5BMIA 1E2WA 4HROA 2HCCA 3A8KE 3GTQB 4IUQA 3AE2B 4OVZA 1A3VA 1PGBA 2WV6D 2MPMA 2QKIC 4KKJA 1Y1VB 1JW9D 4NKLA 3S2HB 4WH4A 1SF0A 3WCQA 3J80E 5KEEA 3PO3B 4AS1A 2HDMA 2BE5D 4HKQA 4WRDA 1JB3A 5ELBA 1FNVA 3ZYYX 5CR3A 2EY5A 4U673 3P4SB 4J1MA 2PQEA 3FAHA 5D7GA 1KDBA 2IX1A 3V96A 5E3FA 4QB4A 3DWQA 2K28A 2TSSA 3AE3B 4YSXB 3NVVA 3HOUB 4LK1C 1PMRA 4WJWA 3EVQA 3E0JA 1B2TA 2L52A 3P4QB 4RGNA 1ENCA 1WTVA 3SXHA 5C0XG 1VZ7A 3D31A 1D2BA 2L12A 1PFNA 2FINB 3TP7A 4CBVA 2O4XA 4KK7A 1QQRA 4KD3A 2PW9A 3A7AB 1VMPA 2ZXOA 4C3IB 4A8XC 5JPMC 2RMMA 1WTXA 2DY8A 3HGBA 2XVSA 3AE6B 5DEHA 5KYLA 4KKUA 1TT2A 4L8JA 1IUEA 4C7ZA 3W5VB 1YJJA 1JRPA 2SOBA 1GHJA 4A3BB 4HN7A 2WXLA 2E2JB 3AECB 1FD7D 1VJKA 2J52A 1EOTA 2W54A 4KGRA 1H9JA 3NSWA 1ICWA 3EFXD 3LYYA 1WRIA 5C4XB 4ARCA 2R61A 4X3SA 3IAM1 3DWPA 4US9A 1EZ6A 1SYGA 1QILA 4CKBA 1OXXK 3FVQA 2H4OA 1IKMA 2CU3A 2WXIA 1S5FD 5ELFA 1TIID 1TYGB 4F88A 1T3QA 3JAME 4C3JB 2F0LA 3BK1A 3AN1A 3NE5B 4LMQD 3PUXA 5FLXL 3M7NA 1N5XA 3VYRA 4XQNA 1PTOC 1PRTD 1U9RA 2C9OA 4J8QA 4A55A 1N62A 1PUTA 5EKKA 3BK2A 4CKCA 1MHXA 2JP1A 3VRBB 4MHEA 1WGKA 2EJFC 2OEOA 5DAUA 5EE1A 2K6AA 2IL8A 2F1MA 3L3OC 1J8IA 3N6RA 1J9OA 4L23A 1IKLA 4ZUIA 2BOSA 3BVMA 3CIRB 1K8OA 3GTOB 4Z9CB 4DAVA 1B4OA 3QG1A 1NCVA 3AE9B 4IFDH 3VR4A 1IW7D 3GV3A 3EGRA 3MVVA 4J6HA 3IL8A 5C4HA 3K5NA 3IAYA 1DD2A 4O42A 4H44C 1W6JA 2A6HC 1CZWA 2EOTA 1SXTA 4RHSA 4G4KA 3VRAB 3BG3A 3IAS1 2JWUA 1G6ZA 3VYUA 1J7AA 1RKNA 1XLOA 3HOZB 3EJIA 1GOZA 1MSHA 3C46A 2WACA 3HOYB 3SEBA 2LY7A 1R9TB 5IIFA 3Q0AA 2KQ4X 4MH8A 4R8NA 3K57A 3NWTA 1JMLA 4C3HG 1ET9A 1PTOD 1PFBA 4IN3A 4P16A 3AV8A 4CJ0B 3P1MA 5C0XH 3I90A 1SNCA 2IGDA 1X3PA 1EU4A 4JE3B 4IQZA 4UDUC 2SEBD 4XT3B 1VZ6A 4K5WA 2B63B 1ZDVA 4EVOA 2EYMA 1JALA 1FFVA 4IOIE 2N9LA 4JPSA 2A5HA 3VR5A 3FC4A 4KHVA 4KX6B 3VQIA 3RLFA 4KN4C 1EU3A 4OZBA 2NB0A 3Q22A 3SFEB 2PW7A 1FRRA 1JROA 2EELA 3W5UB 3AEAB 2IX0A 4JK1C 5I2XA 2A69D 3HOWB 3ND9A 1Y8PB 4RWSC 2KVMA 2B8GA 4NZLB 1TZOA 2F0OA 2AQ2B 1BOSA 1XYIA 3T3OA 3AB9A 3KBXA 1U4PA 5COYA 3GB1A 1VF5C 1DYQA 3GTKB 1JWAD 3TZDA 4BS9A 1R7SA 1H9KA 3SR6A 1NR2A 2HDEA 3C2PA 3EUB2 1HTPA 5IT9E 3L4PA 2EYOA 2IT1A 3A55A 1BCPF 1EY9A 1UAPA 1OFFA 1NAPA 2A68D 3X3MA 2WXRA 1PRTB 2QDBA 2B2TA 3DEPA 1QB5D 2KDMA 1SDFA 1C76A 2XIWA 5BMGA 1ZEQX 4N6EB 2L55A 2A6EC 5M5XB 1ZUD2 3DXJC 3HUIA 4QMGA 1CZPA 4QIWB 3TEXA 5JOBA 1F0ZA 4RF1A 2BW2A 1ZKOA 1XLNA 1CT1D 1F9QA 3VA5A 4Q5VA 1GB4A 1EY8A 3J80L 2BYTA 2L9HA 4HMIA 5CV4A 2OT2A 3ND8A 3TSSA 4WURA 3BVZA 4IUUA 4OW0A 1XX8A 1EY4A 5FKAC 5EPLA 1E2ZA 4R3DA 2AWNA 4K6LA 5E4WC 2XSCA 3GQBA 1YNNC 1C4AA 3HP3A 3LWEA 1WCMB 1LT3D 1R4QB 2PMVA 5JEAG 5C4JB 2B2YA 4K8IA 4DK1A 3C8YA 2LS01 2L32A 4LLGM 1F2RI 1D5XC 2F0QA 4B0EA 2EVBA 4IDIA 4JWUC 1OXTA 1SYBA 5C3EB 2K5PA 2MGSA 3PIO3 1ZE3D 2V4DA 3MXNA 4KKIA 3RZDB 3NRZA 1KTKA 2F0NA 4A3FB 3AB5A 1WD1A 1QNKA 3NVZA 3AM9A 4ZLTF 2HUGA 4IFDJ 3MAQA 3TN2A 3TEZA 2RSNA 1ML0D 1SE3A 1PTOB 3BIID 3OIQA 2L1BA 2EPBA 4G7ZC 2KCCA 4DNTB 2JYOA 4XDDA 3NBIA 2ZT9C 4A3DB 1QLBB 1LLRD 1FFUA 1S5ED 5JVG3 3UI2A 2RSOA 2XNAC 2XRQD 5C5MA 1I6VC 3T16A 1LTGD 2CW0C 3GTGB 3AU7A 1H9SB 3TMEA 1F2LA 5TSSA 1L0XB 4NDXA 1DOLA 4CGYB 5M3MB 1Y8OB 1PGXA 4EE2A 4L1BA 1HA6A 3NPPA 1C8CA 4KHZA 4N9TA 4N59A 2B8FA 3ETRA 5D3DA 4ME5A 1FR3A 4G57A 1CQVA 4QF4A 1O80A 1LTSD 2B2UA 2N88A 3S1NB 2OXPA 1IYVA 1MI0A 5C6AA 2FBWB 1U4MA 1R4PB 3PMFA 2PCFB 1II3A 5C0XJ 4IFDI 4HEA1 1VDZA 2D9UA 5E6JA 2WB1B 3PIP3 1ZXTA 1PDQA 1OO9B 2CQAA 2QSDA 1HZ5A 2EYJA 4LK0M 1Z6HA 2B2VA 2Q8RE 2N0SB 4KKSA 1MPEA 1E0BA 4KGTA 4OHJA 2SNMA 1JWMD 4C1NK 2L4NA 3HZXA 4U68A 3DHQA 4A3GB 3BDLA 4XYOA 2QEJC 2R6GA 4BA1I 5LHY1 1N61A 1I4GA 2B39A 3MHBA 1MI2A 2PO4A 1STHA 4DQOC 2WU2B 2KJXA 5J39A 1DOYA 3D3RA 1RCVD 4FF3A