1KLGD

Crystal structure of hla-dr1/tpi(23-37, thr28-->ile mutant) complexed with staphylococcal enterotoxin c3 variant 3b2 (sec3-3b2)
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
239
structure length
231
Chain Sequence
b'ESQPDPMPDDLHKSSEFTGTMGNMKYLYDDHYVSATKVKSVDSFFKWDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKGKTCMYGGITKHEGNHFDNGNLQNVLVRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA CLASS II HISTOCOMPATIBILITY ANTIGEN, DR ALPHA CHAIN
publication title Minor structural changes in a mutated human melanoma antigen correspond to dramatically enhanced stimulation of a CD4+ tumor-infiltrating lymphocyte line.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/toxin
total genus 67
structure length 231
sequence length 239
ec nomenclature
pdb deposition date 2001-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
D PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1klgD01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1klgD02
1EU3A 2ICIA 1UUPA 1AN8A 2SEBD 1B1ZA 2XNAC 1FGBD 2R61A 4Z9CB 1S5BD 1T5XD 1RF2D 1D5XC 1I4RA 1PYWD 4RGNA 1S5FD 1D5MC 2QEJC 1ET6A 1B44D 3EA6A 1ET9A 1LTID 2AQ2B 4DXGA 1FNUA 2XRSD 1PTOB 1PZKD 1KLGD 3DWAA 1L0YB 4RFBA 2XRQD 1LTAD 1PRTC 5I4DA 3KLSX 1TS4A 4RCOA 1S5CD 1JWUD 1BXTA 1I4XA 1LT6D 1PZID 3BVZA 4L63B 1DJRD 1PTOD 2XN9C 4ZYSA 3BYYB 3R2TA 1EEID 1I4GA 5ELBA 1LLRD 4RGMA 1SE4A 2Z8LA 3TSSA 5FK9C 4RGOS 1JCKB 1I4QA 1CK1A 3URYA 1UNSA 1SE3A 1JWMD 4K6LA 2AQ1B 4RHSA 1PRTF 3CHBD 1L0XB 1EFID 1TY2A 1LT4D 1TS2A 1BCPC 1SBBB 1TS5A 1TY0A 3V05A 1TS3A 3DWQA 3MFGA 1FNVA 2WV6D 3O13A 2RDHA 5FKAC 1FNWA 1EU4A 1RCVD 1I4HA 1LTRD 1LTGD 1HXYD 4OHJA 2IPKD 1D6EC 1XTCD 1FD7D 1PRTB 1F77A 1LTSD 5ELDA 4RH6A 1LO5D 2QILA 1HA5A 1CHQD 1V1PB 3SEBA 3R8BA 2NTTA 1BCPF 1S5DD 3BVMA 1S5ED 4BWGB 1GOZA 2AQ3B 1KLUD 1PRTD 1YN5A 1LTBD 4O1NA 1V1OA 1HTLD 1SJHD 5ELFA 1CHPD 1G8ZD 2O2LD 1SJED 1JQYD 1SXTA 2NTSA 1MD2D 3BZDB 3MC0B 3BYTB 1BCPB 3OWEB 3BVGA 1YN3A 5D3DA 4UDUC 2G9HD 1EWCA 2IJ0A 1HQRD 1SEBD 3R2IA 2RDGA 5D3IB 1JR0D 4C56C 1PTOC 1BCPD 1RD9D 5ELCA 1AW7A 2TSSA 1LT3D 1LTTD 1QILA 1STEA 4NZLB 3DWPA 1ESFA 1SE2A 1M4VA 1I4PA 4RHRA 1RDPD 1CT1D 1EEFD 5TSSA 3GP7A 1CQVA 2J4XA 1JWSD 1KTKA 1YN4A 2CHBD 1PZJD 1ENFA 3EFXD 3W2DA 1PTOF 1D5ZC 1V1PA 5ELEA 1DYQA 1LT5D 1PTOH 1XXGA 4DXFA 4L6TB 4RGTA 4TSSA
chains in the Genus database with same CATH superfamily
2PW7A 1PDXA 1WD1A 3I7FA 2N7JA 3OAWA 4QUCA 1KOTA 4XYOA 4BS9A 1VZ6A 5C3JB 2XRSD 3G4SA 4A3JB 3JVZX 3UDGA 1I6HH 2GBKA 3C0RB 4A3BG 5I4DA 4JV5Q 1S5CD 5IKCM 2WDQB 4C7YA 3PCOB 1DOXA 3U9OA 4MDKE 1VQJA 3UDIA 1GUGA 1K73C 1ASZA 5IYDG 2N3SA 1PTOD 5C3EB 3CCMA 1YHBA 4LF7Q 4IPHA 4LUVA 3V2TA 5DCNA 1VCBA 4B3TL 2Y0SG 1SE4A 3A5UA 4X3KA 1XMOQ 3S2DB 5C44B 1R7SA 2EYLA 1KDAA 2IX3A 3P4SB 4LNKA 1FXTB 2CFMA 1OXTA 3I57A 1UNSA 1XNRL 3DHIC 2W3RA 2FCMA 1I3QB 2MUYA 1QVCA 1TY2A 3K7AH 4MGKE 4ANVA 1UWXA 1IP9A 1CKOA 1GD7A 2A6HC 5EBCA 4DPGA 4FXDA 4MM3A 1RIPA 3AI5A 1P7FA 3HOVG 3Q8FA 5G3LD 2V4LA 4XC2A 4BA2I 2F0PA 4KD3A 2LXJA 4LK0M 4XDCA 2JYEA 1UH6A 1D6EC 1QWYA 3A8KE 5FLXL 2JA6G 2MW5A 1EM7A 4DR7Q 1X1MA 1WWTA 3ZIMA 3KF8A 4YWMA 1VJKA 1WCMH 2JA8H 2N7EA 2HTME 3DVNU 3I91A 3S2AA 2LRUA 1S5ED 1FGUA 1C4QA 3CP0A 3OW7A 2CKZB 4WIPA 2AQ3B 1IW7D 1YQBA 5CBEE 1G6PA 3VA7A 2MHJA 2BCOA 3IAS1 4CBVA 2RA4A 1HTLD 3M63B 4IM0A 5F2DA 2JSOA 3HS0C 5I6YA 5IGGA 1V86A 2HDMA 2Y5CA 2XK5A 4KD4A 4RM8A 5HG2A 3RNUA 1MJCA 3FKYA 1GKHA 3M4OB 2FJ2A 2E74C 5GAHC 1EF1A 3CIRB 4HPLB 3P7JA 3FPPA 1E1OA 4IUQA 2Q2IA 5IIFA 2YTVA 1K28A 1MG4A 3HM3A 1VQFA 5C1ZA 4YTMB 3Q3NC 5C0XI 1E2ZA 4QUFA 4JI8Q 3T13A 4DV0Q 3DBHB 3AU7A 4LFAL 2KEEA 2VQEL 4A3KH 1BOSA 1WGKA 2V1YA 4CO7A 1A0IA 2K01A 3NQTA 2NUCA 1SYEA 1N8RC 2BYEA 3A1QB 3VH3B 2N8NA 5DM63 3J7A5 3SHLA 4DF7A 4KJNA 3PIOA 1EYAA 1SMYD 5IT9E 1FIQA 2CHZA 1SE9A 4NMZA 4GKJQ 4FNFA 4JI5L 3ZJTA 1MJDA 2ENBA 2F0IA 4YSZB 2ZZPB 2F3VA 4BFRA 4RF0A 3ULJA 2DZJA 2ZEQA 3PRPB 5IGFA 2K5PA 3TEYA 3T51B 3H94A 4JI7L 3VR9B 2FCQA 3GTJB 4KV6A 2L83A 1B50A 5C4XG 1XT9B 5ISRA 3CXCA 1HNWQ 1Y8RC 4I65A 1P0RA 1L0WA 4M1UB 3SFEB 1X3FA 1V8CA 2L0TA 1JMLA 1GUWA 1LUZA 1TWFH 2V4IB 4NJ6A 1X3QA 5DAUA 4IN3A 4DR1Q 2M8SA 5AUKA 4IALA 3T8MA 1ZOYB 2JA5B 2PE9A 4NB3A 2N7DA 1O80A 2XVSA 2DAJA 2NS5A 4LJZC 3Q6SA 1N33L 2JXTA 4QAYA 1R4MI 1F9JA 1LTAD 3IL8A 5AZFA 4K1RB 2L9HA 1OTRB 3APFA 1HNZQ 4IOCA 2A19A 2KJHB 1QG7A 2F0MA 1VF5C 3OG5A 4X64L 2WWZA 2XN9C 4L5SA 2DNEA 1EL0A 5TR5A 5JEAH 1BVSA 3A7AB 1KL9A 3GD7A 4DK6C 4DR5Q 2CU1A 4ZAIA 2BKRB 1YNJD 2R7FA 3CD6A 1I6HB 1WI0A 2K05A 3KJPA 2WDTB 4FJZA 3PSEB 1X3PA 3Q3MC 3FRPB 3SGIA 3PGEA 1S3SG 4N8FA 3A8JE 4G4KA 2IX0A 3N20C 1F2ZA 4OIKA 3TQYA 4JI6L 5GAEC 2F0HA 2NPTA 1JOOA 1VQPA 2J7QB 1WTPA 4LNIA 3T3OA 1LTRD 3ZLZA 1RFKA 2H1EA 3DVGX 3M7GA 5C6AA 1BBUA 1U4LA 4M01A 1E6EB 4ODGA 5KNCA 2WXRA 1TKGA 1EQTA 4S0RA 1F77A 3K7AB 4K0KL 1GUTA 3I8ZA 2LRWA 4DR2L 1LFDA 4OVZA 3KDFA 2R93H 4C4VA 2LUMA 1LM0A 1PH4A 4C3IG 2MO0A 1SGHA 5C4HA 3ZNHB 4LFBL 2N1WA 2KUMA 4IC7B 2BB6A 3O65B 3TMEA 1LTBD 4LCDE 4B0MA 5JHBA 1PFNA 3T4AC 1AP0A 3X3MA 3GTMH 4K8IA 3T1YL 1RTOA 1SIFA 2BS2B 1E8XA 1Q8IA 2JZPA 4JPSA 1WCMB 4R4TA 2JA8B 3M4QA 4R4CA 3MC0B 2KKCA 3RMKC 4QGUA 2M0AA 4PQXA 1F9PA 1B9MA 3NK9A 2ALYB 1QOHA 3UI2A 1N32Q 1PFDA 3CKIB 4BBNC 3RZDH 4XYQA 3TRZA 5CV8A 2GI9A 1MPEA 4DUYQ 2DBYA 4J15A 1GAQB 2NBVB 3U7DA 5C2TB 3DEOA 3DOWA 1X6OA 1QQRA 4PZ7A 3HZXA 4JV5L 2Q8IB 2J7ZA 1DOYA 1RODA 2BDNA 4GLAC 1YD8U 2FIDA 5LMUL 4HN7A 2HUGA 4LF4L 4LF7L 1SYBA 3JC66 1M4VA 2NR2A 4P71A 4X65Q 2OCEA 1GC7A 3BK1A 4MGYE 1ZYRC 4MGIE 1PYSB 5JAVA 2GVBA 3ND9A 4NKLA 3MWYW 3NXWA 4ULLA 2BB5A 3FMCA 1CMXB 5I2YA 4A3KB 1P7EA 2ZW1A 2KC1A 4C3HB 3CMMB 1CKNA 2CHXA 4KK7A 3CC4A 1ZP0B 3DXJC 3K5LA 4A3GG 2WAQB 4XQNA 1QZHA 2KJRA 2RSNA 3H09A 1WTWA 1JICA 4TSSA 1PGXA 3ZDTA 1PH8A 1WGDA 2JK8A 2K6DB 5IYDH 3TIXA 1E2WA 3CCQA 2B29A 2JZZA 3BU2A 2WXNA 4C1NK 5FLXE 4XWTA 2NVYH 3DWMA 4JIOU 1K52A 1YEZA 4P1CC 3G6JB 2TMPA 3AEDB 1QZEA 3U52E 4N8X1 3VRBB 2KNBA 4GLVB 2XRQD 4DR7L 3FAHA 2IGHA 1XO3A 4WJPA 4PMCA 1VMPA 1JWUD 1BXTA 1I4XA 3VH4B 1IYUA 1LT6D 1N60A 4KDLB 1TWFB 2OJRA 5M3FH 4XZ4A 3TUOA 2IYDB 3E5SA 3H9DA 2L1BA 4XQQA 5C5LA 4BY7H 3Q8EA 2HCCA 5BR8L 4URKA 4HSPA 1QNKA 4G50A 3G48A 3HOVH 1I4GA 1AH9A 1CJEA 1SNDA 4PMBA 1VLBA 3A9JB 2MP1A 1UEBA 4ABNA 2GMIC 3PRMB 4AYBE 1IZ6A 3JW0X 3VDZA 4QB4A 1I4QA 3AU5A 3RNAC 2JA6H 2F0JA 3PF5A 1E90A 3TEHB 1ZKHA 3RFZB 4RHSA 2Y5PA 2OQKA 1L0XB 2IY5B 2I07B 1TY0A 2HIXA 2LUEA 3PRZA 1N6ZA 3GO5A 4A93H 4TQ1A 2R7ZG 2JYOA 2WV6D 4ZRJA 3FILB 4ASWC 2RDHA 3CW2C 1VQMA 2PQAA 3DBRB 5LL6S 2K75A 4A3JG 2KTRA 5CX3A 2F0VA 1WXMA 3VYSA 1CTMA 4OHJA 1VQ9A 1O78A 1UE1A 3I63C 3ZO5B 4GN4B 4FA6A 3Q3OC 5C3EG 2OTJA 4YCVA 3IFWB 3GDEA 2NYZD 5IGDA 4BWGB 3MA2B 1MI2A 5I6WA 4ID6A 5K5PA 2MNAA 2IT1A 3HGBA 4ICVA 2O2VB 2EYPA 5M5YH 1Q1OA 2LEKA 2CH4W 4GNXB 5C44G 3S1RH 1ICFB 4N9PA 5M3MH 4DV6Q 1OTCA 2K39A 4GMVA 3WAOA 1YJNA 2NCNA 2FIFA 4IWQA 3RCZA 2A69D 1T0RC 1K50A 3UF8A 2R93B 2NTSA 1HZAA 3N6RA 5M5XH 2DWQA 3BZDB 1KDBA 4IWOA 3QQ8B 3H6NA 3ZQ4A 1Q1EA 4X62Q 4A3LG 1U0LA 3M85A 1E1TA 3OWEB 2RKSA 4KKTA 4DR1L 3C2PA 4Y52H 1GB4A 3ZYYX 4II3B 2G9HD 3J80c 1XQQA 2JT4B 4IM3A 4OW0A 2HD3A 5HFYA 4H02A 1JR0D 1RLFA 1EY5A 3VRAB 1WD0A 4K2KA 1BCPD 1YNND 3CCJA 2LGDA 3HUIA 4A3CG 3T9LA 1HNZL 4B0EA 2VZAA 3DWGC 5C4XH 3RZDB 1EWYC 4DAPA 3M3YH 2KLCA 4HXDA 2WXOA 4C00A 1NE3A 4DUZQ 3ZNID 3N1XC 3K5OA 3H3VC 4DU9A 2A68D 1H95A 2MLBA 4MNOA 2DY7A 5IOCA 3HVDA 4LJOB 3D8GA 2MHVA 1L0VB 3S24A 1MVKA 2BA0A 4FADA 1I6VC 3W2DA 4ZK9B 2KJ6A 5ELEA 3ZW3A 3BS1A 2FCNA 2JA7H 1DOMA 3SU8X 3W1YA 1II3A 2RDFA 2N9KA 4OVVA 3H3VI 4JLCA 4W9KA 3K59A 2EYHA 1TR5A 3EN2A 1EUVB 4BOSC 1AN8A 2NVUI 2LHEA 4MELA 4NDXA 1VDZA 1UEAB 4B3MQ 5C0XH 1Z5SB 3JSVB 4FF1A 3MC8A 4GSWA 4HKZE 4XX5A 5IWAL 3VYTA 1N34Q 3GTOH 5LLIA 1FJGL 1VZ7A 4M00A 1H4RA 2FBWB 1J9OA 2GBMA 4U68A 3V3XA 4FJYA 2XSCA 3E3XA 3DHQA 4RCOA 3VR5A 4M8NA 2MJDA 3CF5A 3E6ZX 3BVZA 4L63B 2G45B 2LHDA 3E0EA 2PI2A 4H13C 4JPBW 4G0NB 4KY6A 3LNNA 3A1QA 1KXLA 1FCCC 4K2LA 2MWSB 3LYYA 4A3OA 3NOBA 4B3RL 1GXDC 3U58A 4FVMA 4YCWA 3EFUA 1A2TA 4IPCA 3OHXC 1IXRA 3WOFA 2WKCA 1VQEA 5M3FB 1NR4A 2G1EA 2JX5A 1WJUA 2JXXA 4BY7B 3J81j 2QJLA 5JOBA 3V05A 3Q8DA 2ZT9C 3KQ4A 4IO9A 2EY5A 4C3IH 3ZJYC 3QAQA 1Y56A 4NP5A 2JA5G 3AULA 2A8VA 1RCVD 2PZUA 4PNYA 1VQOA 1YJWA 4A6QA 1I4HA 4CJ1B 5FO9B 3K0YA 3I4OA 4QL5A 4HJ9A 3EFCA 1HZ9A 4A3DH 3ZKJC 2RHQB 1D2BA 2Z1CA 1FD7D 2EQSA 4JI2L 2L12A 1U4MA 1DOIA 2PPHA 3SD5A 4GZYC 3U8ZA 4A93B 2L3ZA 3OIQA 3CCLA 4KY7A 1CA6A 1WGYA 1G2SA 2L5TA 4FDBA 2KENA 3N1YC 4B6WA 3BIID 1FD6A 1CSPA 4P6VF 4CQNA 1KLUD 5IYBH 4LNNA 2HT1A 3I3TB 3A9KB 1YNTE 4N6EB 2D0PA 3UIPB 4O1NA 2IHFA 3TS2A 3VFKA 4B3SL 1IBXB 2O2LD 5FJ8H 1WGHA 3KWVA 3S14B 1VZ8A 1MD2D 4X3TA 2CKHB 3LB8C 3CPWA 3S1MH 3HKZE 3RD2A 1LV9A 1PFMA 3HHMA 4IUTA 1A6XA 5M5YB 2K1FA 1IL8A 2O5JC 4DV2L 3S1RB 1LACA 5M3MB 2UU9L 1SMXA 4II2B 4DV1Q 1HRJA 2WXQA 3BY4B 3LWEA 3IXSA 2K8BA 1Y1VG 1JC7A 4K5XA 2LI5A 3S2HB 5LL6X 3N3KB 2PMVA 3L2PA 3IAM1 1QILA 3RYTA 4TKNA 2EY1A 4KLKA 2Q2TA 1IYJB 5EKIA 5TSSA 1XLNA 1RFAA 2L15A 2K4KA 3ONSA 4A4IA 4DV7L 1H9RA 4FULA 2YU9H 3N32A 3ULLA 4JWSC 1WXAA 5CV9A 4GXBA 1WCMG 2V1CC 1MSGA 1PTOF 3T16A 2HHHL 2UUCQ 2JA8G 3M3YB 2G5DA 3EJIA 4HIMA 3C19A 4DHJD 2CU3A 2F0DA 2CHWA 4FO2A 2KDBA 1S4ZA 3WANA 3CMAA 3SDZA 2NBUA 1QOAA 3P2BA 5JH5C 4L5TA 1UBIA 1PQSA 2RR9A 4O2DA 2J0MA 1S5BD 2D11A 2JVCA 1NENB 3KVFB 4TVAB 2I1KA 1EYCA 4WWNA 4NXNL 2JA7B 3UGBB 3W5UB 1E7ZA 3G7LA 1E7VA 3FEWX 3N9YC 1AE2A 4PV1C 3MEFA 1NDDA 4DK1A 2BBCA 1V97A 5G3LF 2DJFC 2V0GA 3Q22A 2Y5BB 4PS8A 1K8AC 3HKSA 1H9MA 4H7BA 2GVAA 1EZ8A 2R7ZH 2OWOA 4HCSA 4DV6L 1A5RA 1N9WA 2WINB 4C3HG 4A75A 1IBML 2F03A 3GTOB 4A3JH 1JW9D 3PZ7A 5DPTA 3GTGH 2WIIB 3EHVA 2M00A 3B2FA 1VQ4A 2WAQG 2K8HA 3ZNGC 1C9OA 1JOKA 1V9PA 1K3BC 3ZDMC 4IKGA 1R4NI 2I5MX 2SDFA 4IURA 1QOFA 2HQLA 1BNZA 3S1NH 2E5LL 5G5HA 2B2WA 3AE2B 4GDKB 2KCMA 2WS3B 2KN4A 4WWPA 4HROA 4DR6Q 1JT8A 2LGYA 2N9LA 2BPSA 2CS4A 2F1MA 1MHXA 2NZHA 5C44H 2RQXA 2E2JB 3ZXRA 4BKGA 4YT0B 2XGTA 3JYUA 1HXYD 1EYDA 1R9TH 2DENB 2GA4B 1CI3M 4LDTB 2KX0A 3GV3A 1JJGA 3LX0A 1TTNA 2EELA 1UE7A 4JW0A 2CW0D 5EBDA 4S3SA 4CDDC 1ASYA 2QDBA 4C3IB 4IG7B 4ZKBB 4KI0A 1PV4A 4W9LA 2PTLA 2XEWA 5IP4D 2B76B 4G7HC 3T1HQ 3WAPA 4A3DB 4EE2A 2C5CA 2QGQA 1R4MB 1V1OA 5ELFA 4RA8A 1V43A 1RRBA 3F2DA 2GBNA 4A3CH 1VQNA 4YY3L 5EPKA 1U9RA 3NPPA 5IA7A 3TP6A 2VB3X 3NVYA 4JGHB 3PLVA 1L1OB 1O7ZA 1Z47A 1L2FA 3A9JA 3BYTB 2KCCA 2LGIA 4B3ML 4CDFC 4KSKC 1I7HA 1JWAD 4GKKQ 1RTNA 2I0QA 3NTIA 1J8IA 1N34L 2BT6A 1S40A 3H1UA 2VL6A 4ALPA 4PYZA 2PCFB 5C5MA 3PHXB 4C56C 1IYFA 1BDOA 4K8JA 5KRUA 3S15B 2K28A 3S1MB 5ELNA 1AW7A 2TSSA 4IJLA 2RSUA 3FILA 1IKMA 4WJNA 2SNMA 4E6IA 5C3XA 2BH8A 3TEZA 4IFDI 1V5OA 1X3GA 3B0AA 4RMAA 1JQ4A 1CQVA 3OIPA 4EQOA 3FKIH 4A3IH 1BUIC 3LJ3A 4W9DA 4HEA1 3CC2A 2KO3A 4KGTA 4LTUA 4LF8Q 3VTVA 2MJ8A 2R93G 5AFWA 1JALA 4LUOA 1OXVA 1VQIA 4LFCQ 2UXDQ 1LT5D 3CCVA 2PVOD 3J81c 1E7PB 1PTOH 4LW1A 1ZXHA 2O2VA 3R7RA 2R6GA 4RGTA 4GNXA 1C8CA 4OX9Q 5DNFA 1MI0A 1VRAB 1UGJA 3DDCB 2VB2X 4FXCA 3F1ZA 3W3AA 1BF4A 2YU9B 1B1ZA 4YWKA 4X6AH 1BMLC 2GRIA 1SR3A 2R61A 2YVCA 4DHZE 4MIUA 5EE3A 3ML9A 3ERQA 3RR5A 2QEJC 2ZM6Q 2KVZA 1YNNC 2AQ2B 1BBXC 1HTQA 1NBWA 3W1BA 5IE8A 4A76A 1LXDA 5DEHA 3BZKA 3G71A 4RFBA 1Z7TA 4BY1H 4ZRZA 2KAJA 1U5KA 1EUJA 3FDTA 2KWCA 2Z4IA 4DR3L 1VQBA 5FLMG 5GXGB 3WAMA 4R8NA 3AB5A 2L52A 1MBYA 4DK3C 1J5EQ 1GNUA 3UI3A 2JA5H 1BR9A 1GVPA 2D9UA 1STYA 3S1QH 2B3GA 2IW3A 5NUCA 2LMCB 4LF9Q 1IGDA 4JI3L 4FYDA 2HJ1A 3K80C 3TSSA 2OT2A 4DNTB 5CBAE 3IT4B 2ZJDA 1FO4A 1J8CA 5GAGC 2J0TD 1XEEA 3HP3A 1A3VA 4M8MA 1SYFA 2B8FA 5JXVA 1FL0A 2R92G 3Q8CA 2R7ZB 4OZAA 1EFID 3L7ZC 2KECA 3H3VH 1VQAA 4IFDG 1UE6A 2I5LX 3KF6B 2X6GA 3PQIA 4CHTB 3GTGB 2INNE 2JWUA 2WP9B 1FNVA 1IBKQ 3F2UA 4DV1L 4UHVA 3PIP3 3EROA 2WU5B 3AEFB 4EZKA 3QJYA 4R4IA 3AB9A 1SSNA 3P63A 4HJAA 2GBJA 1G2TA 3SR6A 1WTOA 2IY0B 4ARCA 4X66Q 3LGJA 3S1NB 3ECIA 1XTCD 3A74A 2CH4A 1NI3A 2IY1B 4B9XA 4GS3A 2QCPX 3JSVA 4NJCA 3OLMD 4EQNA 4A3FG 1HA5A 3VR8B 1CHQD 5JPMC 3ZXVA 4ME3A 2VQFL 2IGGA 2BYTA 2MP2A 4P74A 3DLLA 1EQVA 3I56A 1WFYA 1PRTD 5CMDA 1SRUA 2DJGC 1R9TB 2IO1B 4ANUA 1SNQA 4ZOHC 4DK0A 1Y1VH 1SJHD 4WJ4A 4BKTA 5M3FG 4WAFA 4LAAA 4PZ6A 1XNQL 4BY7G 2I1JA 3K57A 3AEGB 5CV7A 2F0OA 1P16A 3TREA 3HOZB 2YTYA 1Y1WH 3BVGA 5HY6A 4DDID 4XDDA 4WJQA 1YJJA 4BBRH 3RMHA 3RT3B 5JJLA 4IOIE 2BF8B 4E71A 3NEMA 4AS1A 4NAWB 4TQ0A 4A93G 3PUZA 1N62A 3PF4A 4G7ZC 2NVTH 3V60A 4FF4A 1O7IA 1T9HA 1QVFA 3QHTA 5E1FA 4XT3B 2F0GA 1KJTA 3APDA 3U2SC 3AE5B 4I7AA 3FPUB 4C3JH 3ZGZA 1ZXTA 4LF5Q 2ATWA 5C4JB 1EY0A 3DHGC 1I94Q 3HM6X 3P4QB 2B39A 5E3FA 4AH6A 3ZJVA 2Y3AA 2F0FA 2LSSA 3L9AX 2EMSA 2Z0DB 2PNHA 4OGQC 1DYQA 3NUCA 1PH6A 2NVXH 3ONAB 5EKLA 3VYRA 2KLGA 2VZKD 4G3XB 1HHVA 1BQQT 4DR6L 2BYFA 5CHVC 1J7AA 4A9AA 5M3MG 4N9TA 3A9KA 2BKFA 2RSOA 3FKIB 4A3IB 4JBWA 3VYUA 1A3TA 5FR3A 2B2UC 4L1BA 2ZCCA 3VQIA 2NN6I 1IBXA 3NG0A 4C3HH 4OL7A 2WX1A 2IHEA 2EE1A 3VAWA 4QMGA 3SK8A 4DXGA 2KT7A 1PTOB 4R3DA 4P1BC 2ZXRA 1JORA 1WJNA 3GE3C 4P75A 1KD1C 5IN7A 2HCIA 2B2TC 5CHFA 1C4AA 1HQMC 4LMQD 3T1HL 3EUB2 5BN3A 4J6IA 4FHKA 3M95A 5EGTA 3AYHB 3Q0AA 4DV3Q 1VQ7A 2EKIA 3KFUA 3OJ3A 3H7SA 1VS0A 3R7QA 2UXCQ 3IAYA 4BY1B 2HDLA 5CV6A 5FK9C 4APVA 2DY8A 1GM5A 5E6PA 1WM3A 4X3SA 2F0SA 1JWMD 2F4VQ 4IUPA 2HIVA 4Q0FA 2H4OA 1L1OC 1JRUA 3STBD 3VDYA 5LNK1 3S1QB 3O13A 3V61A 1XJVA 1JB7A 1QNUA 2JA7G 1IKLA 3IRBA 4XTCS 4DR4Q 3CSTA 2OJWA 3D3RA 2BS4B 1WRDB 5BYSA 5CV4A 3NZUA 1K83H 1PMRA 2AUJD 2JRHA 4NAMA 2WACA 5C0XG 1A3UA 1C79A 1LO5D 2F4IA 4KV2A 2QILA 2H89B 4NPSA 3SEBA 1UD7A 1BCPF 2HTHA 3D4RA 4TQUS 2NN6G 4WQMA 4CYEA 2L11A 3CWIA 4M8AA 3DVNV 1IHZA 1NVID 3K9PB 4YHHQ 4LFCL 2F0QA 2UXDL 2OQ0A 1T6BX 3Q3FA 3CCEA 2IWHA 1CHPD 2F0KA 4KY5A 4KVGB 4XE0A 4RAUC 1V49A 1WFQA 1SXTA 2ZXOA 1EOTA 1I50H 4OX9L 4IUUA 2INPE 2WXMA 3P4PB 3A0JA 1N36Q 1DOKA 5A2QL 3J80L 3UQAA 3L16A 3RUIB 1V8QA 5D3DA 1WOCA 2F0WA 2ZM6L 1NCVA 1HQRD 1Y1VB 3T56B 3ER0A 4IPGA 1C7YA 5D65A 3PVLA 4XWWA 4L8JA 2UUAQ 3E0JA 4GDKA 3EIVA 2K25A 2ONQA 2K52A 3D4WA 5ELCA 2CW0C 2FCSA 2MQJA 2WXJA 1LT3D 2L0FA 1Y1WB 2WXPA 1J5EL 4BBRB 5BN5A 5K36H 4AJYB 3L54A 3N52A 2Z4HA 4JI4Q 4LF9L 4A3DG 4KZ0A 4LNOA 2MA9B 1JJCB 2PZTA 4N58A 3DEPA 4GLXA 1WR6E 3TJPA 2B2TA 3NS1A 3KLRA 5IY0A 3W5VB 1F2MA 4J6HA 1U4RA 1WH3A 2NVTB 1RM6C 2N0SB 1HZ5A 1XLPA 3PSIA 1R4QB 2C7MB 2QKIC 2KTFA 3I5JC 4C3JB 4P16A 3C1EA 5IYBG 1KQSA 4W9EA 5FLMH 2INDC 2O6VD 4O0AA 2ICIA 1M8AA 4IJHA 3CMEA 1HE8A 1B53A 1TBEA 1TYGB 4RMFA 4Z9CB 1T5XD 1OQQA 2ZVOA 3AEAB 5CGKA 1W6JA 5FJ8G 2SAKA 3DVGY 1D5MC 1O7YA 2L55A 1B44D 3MXUA 4X66L 1E8YA 1HPCA 1NYQA 1FNUA 1L1OA 2NVXB 4EZLA 2EYJA 5FOBB 2ZNVC 2IL8A 2E75C 3H8HA 5AJ3Q 3SK4A 2R92H 4Y7NH 3W1SC 2JEBI 1XMOL 3MZ5A 2BQQA 4RM9A 3TP8A 1WYGA 3E9SA 3IHPC 1G91A 1M1KC 4HCNB 4IFDH 3SFDB 5LXHA 4W9IA 4MSMB 2KK8A 1ZUD2 1YQ3B 4OWXB 2A1AA 1DM0B 4WFN3 5IO9A 1I35A 5L95C 1Q1BA 2UUBQ 1X54A 2B2VC 3HRDD 2GOWA 1H9SB 2J42A 1C4CA 1KAAA 2AQ1B 4RF1A 1C9FA 4EQPA 4HJ8A 3HOXB 2KMMA 4BKSA 1J19A 4A3FH 2JXMB 3BZCA 4PS3A 1C0AA 1TS3A 2JP1A 3EQLC 1JMCA 1WY8A 4HWIB 1FNWA 4HVBA 2EXZA 4GU2A 1YOVB 1IYVA 5EQ0A 1EIGA 4FLHA 2D5DA 1Y14B 4P7IA 2I5HA 4V0BA 2LGSA 4AIMA 3PUYA 4WAAA 2E2DC 2WYQA 4LF5L 2FMCA 3S16H 1A62A 2KDIA 1I94L 1OFFA 3TL5A 1QE6A 2Z6KC 5IOIA 4DN4M 3OW2A 3BDOA 4HIOA 4DNIA 2G4SA 3NUHB 4ZRQA 2NMQA 1K83B 2K5WA 2LJ5A 3I73A 1K9MC 2JF5A 3MEHA 4KHPQ 4YWGG 2K04A 4KN4C 1WE7A 2H88B 4F1SA 1KRHA 1MFWA 1MGSA 4JI8L 2QC8A 4DV0L 2LMCA 4AYBB 1D1KA 3ALBA 1X55A 2ZXPA 3AEBB 2E8GA 2Q8TA 5BYQA 3ZUNA 3AE4B 2BE5D 1FCLA 1QF6A 3VUWA 1R4NB 1AWDA 3NZ3A 3ABVB 3NHHA 4YIJA 1JJ2A 1PTOC 1I50B 3S14H 4GKJL 5JJKA 4IDIA 1WZ3A 4OZCA 3KF6A 4JE3B 2DGYA 1SDFA 2EY6A 2CQOA 2KHIA 4EQ5A 1JWBD 2ZVNA 2Z59B 1ESFA 3JAMc 3I90A 2JA9A 2F0UA 1YHAA 1ROEA 1P98A 4MT5A 1H9KA 1WGRA 1HNWL 1YIJA 2QDFA 3TN2A 3W1SA 2WXFA 3S2HH 2QHOA 1WR1A 4DWFA 1L4DB 4UP8A 1JRPA 5D6JB 4KSLC 1OXUA 1DOLA 1KRSA 2K5HA 1J7BA 3L10B 5GROA 2CCZA 3HOZG 3P75A 2NZOA 3DM1A 1XX8A 4ILWA 4H0LC 4KMUC 5A35A 3ULPA 1E9MA 3HOYB 2V4DA 1V81A 2DNFA 1E10A 5C4ZA 2B2VA 2X8XX 3WOEA 3D0FA 2K3UA 1NY4A 3CRLC 1V9JA 3EA6A 2HQEA 3BDLA 4LUZA 1L6VA 1WTHA 4DR5L 1KFYB 3J7AV 1IW7C 3EGRA 1SFOH 4YWLA 1TKYA 3P42A 3K7UC 3DM3A 3OTOQ 4LF6Q 2A6ED 2E6XA 2MQHA 4OXPA 1PH7A 1YVCA 5EE0A 4FHJA 4YHHL 1PLFA 4NAWA 3Q2AC 2F0NA 1WJJA 4PG3A 1HFNA 4JX1C 1OQYA 2R7DA 4DKAC 3PIPA 3KUZA 2PZWA 4H44C 2D3AA 5A2QE 1Q86C 2N78A 4Y7NB 1JCKB 1ENAA 2R92B 2AEHA 4IUNA 2B3AA 4KHZA 3MTNB 4K6LA 3C3LA 3FKIG 4A3IG 1YJ9A 1XYIA 2D5GA 5D2MB 4CDCC 4A3EG 4AWJA 1SBBB 4G57A 4XDXA 5D94A 3DWQA 4IOAA 1ESRA 2NN6H 4ZHOA 2UUAL 2K32A 3VR2A 2VH1A 2K6AA 4EX5A 1B3QA 5JEAJ 4DAYB 2A5HA 3CCSA 3AU4A 3GB1A 4KX6B 1SMYC 2KBNA 2PO4A 5IP7G 2WDVB 3A5ZB 4KHVA 4MHEA 2L76A 3L08A 4A3FB 3FVQA 4PT5A 1PA6A 1MSHA 4HJ7A 1SIJA 4JI4L 4L2YA 1VMCA 4RCNA 1TGZB 2MJ3A 5G5GA 2Y0SE 3WCQA 3E9IA 1NMGA 2NTTA 2B2YC 1EYGA 1ZDVA 3X0WA 3KYCD 2E2JH 4JI0Q 3RLNA 1PH2A 1SF0A 4BY1G 4HDQA 2PMZE 3NP8A 4RKLA 1N32L 2K1BA 3PUXA 1QUQB 4DUYL 2EJGC 2KZRA 2JE6I 3PGZA 4K7SA 1XCQL 1P9DU 3S16B 4QQBX 2WKDA 1PVOA 2A74C 1NI2A 3U9SA 2OTLA 2CQAA 1A2UA 1BCPB 4TRDA 2W3SA 2PQEA 4MM3B 4YTPB 4DK5A 1YN3A 1F2LA 3MXGA 1E0BA 1C76A 2KMCA 2AWTA 2AX5A 1OO9B 2Z6BA 1Q81C 2OEDA 1SEBD 4X65L 5HKHA 1YJ1A 5CR3A 2A6HD 5J3BA 2BWFA 3AM9A 4MEMA 1AZPA 1STEA 1JB3A 1STNA 1YNJC 2KCNA 4US9A 3H91A 1D3ZA 1TVXA 2NZ1D 5LMNQ 2BW2A 4JYAQ 1RDPD 4KGSA 1WXVA 1WE6A 4JBMA 5D7GA 1JWSD 1K0SA 1RYJA 1WX9A 3W9CB 1HH2P 1Q82C 1YN4A 3AFQA 5KNBA 1WM2A 3S15H 5HI1A 2K03A 1ENFA 2LS01 5COYA 1VD2A 1YIWA 3J81L 1N61A 2N55A 3T3NA 1KLVA 2KOXA 1GC6A 3AXCA 2PW5A 1A15A 2F3WA 1CKMA 2VW9A 1X32A 1H8CA 5G55A 2DYOA 1RAXA 1B9RA 2XNAC 2N9EB 1WIAA 1XPOA 5C3WA 4QIWE 1LGRA 2L32A 3UINB 2QF7A 1VQCA 2F0LA 3HKZB 3SK6A 4C2MH 5H92C 2WLBA 2L4NA 2OOBB 2K8CA 5EKKA 3VUXA 1Y1WG 2EYOA 4IFDJ 2K5VA 2WFWA 3MVVA 1BBWA 3RULA 1TS4A 1G6JA 4BBRG 2ZTDA 1Q12A 3B08A 2AWNA 4BVUC 3V96A 1YQ4B 1QJOA 4UP9A 1CA5A 3AE7B 1NSNS 3EVQA 5CTRC 1LQBA 4K5VA 1EZ6A 1K51A 4KHPL 1EEID 2EXDA 4OWWB 2ES2A 1KAWA 1PXUA 1SFOB 4IW0A 3NWSA 3IBEA 1HJPA 3TCAA 2D0OA 4C3JG 4WJWA 2B2YA 1YI2A 4EVOA 2CR5A 1PRTF 3NBHB 5M5WH 4B3TQ 5BO4B 3H15A 3RNCC 5BN4A 5E4WC 3T53B 3AH7A 4F88A 2YEPF 2ZJPA 1EWHA 2AHOB 4HMJA 1EF5A 2WXGA 3KWLA 3Q8AA 3MFGA 1HUMA 5J17A 3PUWA 3PV0A 1ILQA 2IO0B 1FXIA 4HJ5A 1XNRQ 5J18A 2AMCB 1J0GA 1EWIA 1TZOA 2K50A 4KKSA 4CDEC 2IPKD 1SNPA 3MC9A 3L3OC 4B08A 2KWUB 5KIXA 4X57B 3VTUA 4F7ZA 1NJIC 1VQDA 3KK7A 4HKQA 1IBLQ 1F9QA 4D2KA 3SE0A 5KYIA 1EY4A 1S5DD 5H1SE 1PH1A 2GLSA 5BMGA 3OOCA 3PUVA 4IUVA 1KF6B 2K0PA 4KDIC 3J7ZC 4X62L 2RBMA 4WQOB 4L5RC 1PUTA 3KJOA 1WTQA 3F8TA 4CGYB 2RPVA 2DX5B 3KOJA 4Q2JA 1B8AA 3HOXG 5J1ZA 2WB1E 2XWBB 4N59A 2WU2B 3HOUB 3VA5A 4MH8A 1F9SA 3I4MH 3Q23A 4L23A 1ONLA 1MHHE 2KQSA 3ETRA 1H9SA 1Y8NB 5J39A 4HTHA 1FRRA 2Z0EB 4DUZL 2I38A 3DBLI 3NVZA 3VTWA 3R3MA 3SVMA 3RN2A 2CJOA 5KGUA 1GUNA 4F87A 4HK2A 1DD2A 2VRRB 4WORA 2YTXA 4LF6L 2MBQA 4KIKB 3HOZH 2WNMA 4PYUA 3DHHC 2V3SA 3RI7C 4W9HA 3GP7A 3NJTA 4F8CB 4AOFA 3E9HA 2JWZA 3QA8A 2UYZB 1BO0A 1TKEA 1T0SC 2JPHA 4C80A 4BXXH 3E56A 1F0ZA 3EFXD 1FRDA 1UZXB 4JCVE 1ILPA 4I7ZC 4AP4C 4AYBG 3AE3B 4L6TB 1Y8PB 3CCUA 2KCTA 1K3RA 1LM8B 2FAZA 4WH4A 5C4JH 2Z0SA 2RVLA 3C46A 2BE5C 1VQ5A 1AZQA 1D5XC 1PYWD 4JI7Q 5EE1A 3DUZA 5FO7B 2K5NA 2SNSA 4XQJA 2MJEA 2A5UA 4X3UA 1E8WA 4MACA 2KEDA 1NBFC 5BMIA 3DWAA 1KLGD 1L0YB 4XT1B 2DAFA 3GTQB 2JQOA 4BA1I 3TDQA 3I4NG 5J22A 3RN9C 4R9WA 2RMMA 1E3PA 2D07B 2X38A 3C1FA 4IQZA 4A3EH 3MFYA 3HOWG 2MSED 2EYFA 3L0OA 4ZQ3A 3K5NA 4JI0L 1DGJA 3OWFA 5DPSA 2A69C 5ELOA 3U50C 4C2MB 1UF0A 3U4EG 1N33Q 3B1LX 2KXJA 3J80i 4YTNB 4K5WA 5ELBA 1WXSA 1WMHB 1CZPA 1UAPA 2EPBA 4OEMB 2D3GA 5C0XJ 2VS1A 5M9OA 1F9RA 1TXYA 1JOQA 1J6QA 1MG8A 3KH0A 2ID0A 5IP7H 5K36G 1ZYRD 4X64Q 2MGSA 3URYA 4FJVB 4HJKA 3OYYA 3Q69A 1UWVA 2YYZA 3HOYG 4GLSC 2EDGA 1IPGA 4J1MA 1X3EA 1BCPC 1TS5A 5E7NA 3BDCA 1T0YA 5FKAC 1M90C 4OO1I 1EY9A 1N63A 4GN3B 2VXWA 2KACA 2K5DA 1RKNA 4KKJA 4MH0E 3CQZH 4FXGC 5M5WB 4JG2A 2A68C 3CCRA 1KHIA 4DHZB 1TWHH 4JYAL 1YX5B 4KN7C 1PH5A 4NNJB 4RH6A 4A3PA 1T0QC 3PO2G 1VQLA 1SNCA 1E24A 3R8BA 1F2YA 3PTFC 1AEXA 1ZW7A 3HVZA 4C7ZA 1GOZA 4NQKE 1YZ6A 3I9V1 4EFOA 5KYLA 2YLMA 3OMCA 2KQ4X 2LXAA 3D6CA 4JC0A 1JQYD 4OONA 1BT0A 4HDOA 3A7LA 4LFBQ 3B9JA 4BBSH 1PHJA 4M0WB 2BWES 4J8QA 2PQAB 1Y8OB 1ZKOA 3SK5A 1SLJA 3CRKC 2ZNVB 1K8MA 2IJ0A 4O42A 3T1YQ 4JL9A 1UBQA 2RDGA 1PH9A 1VQKA 1E5WA 2V9HA 4JWUC 3V6CB 2LJIA 5KHOA 2F0TA 3DBSA 4POGA 1SB3C 4IUMB 5IYCG 3NE5B 4NZLB 3MJWA 2EVBA 1D8LA 4MTKA 3I4MB 3QOJA 3FP9A 2UUCL 3NBIA 4DAYA 1TZ1A 4HRSA 2WQYB 3HIZA 2K7VA 3M62B 2UXBQ 4NY0A 3WALA 4OO1G 1X9NA 2CHBD 1HUNA 4DAVA 5LMUQ 4FBJB 1DGSA 1X56A 4LF4Q 5HHDG 1WJ4A 4ANWA 2JYTA 1TQOA 3TEWA 4DGZA 5GMVA 4REZA 1ACCA 2IDYA 3AE1B 3QCAA 4R4OA 2JQRB 4P73A 1QUQA 2VY3A 1RF2D 1D7QA 4QF4A 3NVVA 1W2BA 1FFVA 2L7RA 3N1ZC 3HRZC 4ME5A 1JROA 3SDLC 2PE6B 1IBLL 3RZOH 4GDLB 4OELB 2NVQH 3BWUD 2MPMA 5JJIA 1I42A 1B4OA 1G291 2YV5A 4OVUA 3D32A 4ACFA 1PZID 1ZDXA 3K0XA 4JBKA 2KVRA 3B6YA 1C77A 3D6WA 4ZYSA 5HGQA 1KNEA 3AECB 1BUVT 1HR0W 3TEXA 2Z8LA 1E7UA 3QO2A 3ZTDA 2JZ3B 5IT9c 4A3EB 1PFBA 1SE3A 1WX8A 3GQBA 2J0KA 5DPRA 3WWVA 3RNFC 5BR8Q 4QCLA 3F2CA 1YITA 3I3CA 2EMTA 3Q14C 2PI2E 2IBIB 1CM9A 3P20A 3HKZG 5BMHA 4CJ0B 3RPFC 1QB5D 3AMZA 2LGXA 1QZGA 1PGAA 2FFKB 1MIUA 1UELA 3PS6A 2WDRB 4ZRPA 1YBYA 4QY7A 2C7HA 3RNEC 1TIFA 2KN5A 3HOXH 1PRTB 4MZ9A 1Q5WB 3H0GG 1Q90A 2YEPB 2MEKA 2ZPNA 3BVMA 3V62A 1V80A 2KD0A 5LMNW 3VXWA 3SR1A 4HIDA 5T8IA 1KC8C 3NWTA 3CQZB 1ZE3D 3Q6BA 1E22A 1KDCA 5JPNC 1TWHB 1QOGA 1GO3E 4GKKL 1IUEA 2XIWA 3HFZB 3KLSA 2KOLA 2ZJQA 1KRTA 1B2TA 1TT5B 2FHTA 3IFTA 2JEAI 5GADC 1T3QA 4GB9A 5BYRA 2M4NA 2B63B 1STBA 1SYGA 1YNXA 1IL2A 2ZTEA 1IGCA 2NBWB 2W9NA 3AE8B 3Q3JA 5AEKB 2O4XA 3IT6B 3A4SC 3AV8A 2R2QA 3NBHA 4TV3A 3MAQA 2P5ZX 3IVFA 2KC2A 3GTLH 1EQRA 1VQ6A 3U7ZA 4UY8C 1HZ6A 3RD4A 1NUCA 4BBSB 3JAML 3F2BA 3PHWB 2EJFC 2R2OA 3GZNI 4DA2A 4JVZA 4LF8L 1R4PB 2DUDA 5DPWA 5HURA 1NMFA 2IX1A 3PO3G 2BOSA 1KNAA 2E76C 5JVH3 2VZKB 2OF1A 2EIFA 1SE8A 3GTPH 4A55A 1C3TA 2G4DB 5E4XA 1HEZE 4K3CA 3I70A 2KHSA 2NBFA 2WHIA 4HJGE 1U4AA 3TBLD 5HGTA 3R3OA 3I4NH 4EOYA 2ASQA 3K5MA 4DXFA 4GOPB 5EPLA 3GTKH 3HOUG 3AE9B 3HOWH 3QWZB 3SXHA 5E6JA 2CVRA 1U4PA 1FGBD 4BZAA 1V2YA 3APCA 2G9DA 2B2UA 3EBEA 3KYHC 2MBBB 1HNXQ 2PW9A 3BINA 2RD0A 2WB1G 3WDNA 4RWSC 4NJ7A 2KX3A 1SYCA 1HTOA 1EY7A 3UDFA 1WSPA 3C8YA 4IWPA 2QMTA 2F52A 3M9BA 1PDQA 2I46A 3HOYH 3GS2A 4DDGD 2VUMH 1O7LA 1XD3B 4Q5VA 2KVMA 3NHEB 1DJRD 5CV5A 5IWAQ 2RF4A 2DHZA 2AKWB 3ZJUA 1FJGQ 2ZJRA 2DN8A 5LXIB 1WYWB 2REXA 2IZVB 4KIKA 4RGMA 2EOTA 2QEXA 3RZOB 2M1MA 3MXNB 2NVQB 1OEYA 1IBKL 3GOEA 4RNAA 1D4BA 1Q46A 1G6ZA 3QK0A 2WXKA 4S17A 1EIHA 3TMPB 4W9JA 4J3OD 2PVGC 3K8AA 3SHQA 4I6LB 3OPOA 4RG1A 1FM0D 4YCUA 3PV1A 3PO2H 4KZCA 1NTGA 3D4DA 1B70B 4EGVA 1EY6A 1HZCA 3M4YA 4KTAA 2KFKB 1QCBD 2O5IC 2QSDA 4ZRIA 2QDLA 4B3RQ 2WXHA 3ML8A 2BVCA 1WI5A 3BJUA 4MTNA 2LWPA 1CSQA 4V190 4IPDA 3ICEA 3UQBA 2OEOA 4TKOB 1XWEA 2IO3B 1A63A 4PS7A 3J81i 1LTSD 4GN1A 5FLXc 1QKZA 4LNQA 4MJSB 4CKEA 4N9F4 2RCFA 4PZ8A 2UXBL 1V1PB 3NRZA 4NW2A 2FXQA 1K8RB 2AL3A 2LD9A 5T1GA 1XPRA 2WAQE 2D62A 3HK0A 4JI2Q 1ISNA 2XWJB 2E2HH 1F2RC 2FNJB 1CFMA 2L1AA 4BOZB 1FPYA 1PGBA 4A3MG 3QR8A 5IYCH 4G7OC 1GB1A 3L0WB 4ZHPA 1FR3A 4DFAA 1WMHA 2N9PC 4WURA 2LVOA 4FN2A 4AJWA 5IODA 1XMQQ 4USAA 1QOBA 3K9OB 1B7YB 4B3SQ 4A3BH 3BK2A 3QJZA 4EZJA 1P3QU 1ZGUB 2AUKA 4OO1H 1F2RI 2C5LC 2ZCBA 2KHJA 4QJFA 1DONA 3QX1A 1FFUA 2K22A 1L4ZB 3TP5A 4DV2Q 3QARA 2W54A 2UU9Q 1L7YA 1KH0A 4HCEA 1GJXA 2MX2A 4YXDB 3MXPA 2J4XA 1KTKA 1T5EA 2M2LA 1OGWA 1XCTL 4I6NB 3GTLB 1L6UA 1PZJD 3I2ZA 2O6VB 3RZFA 5IGBA 4BAXA 3P4RB 2HJ8A 5AZGA 4FP5D 3Q24A 1TWAH 4AQ7A 3AQQA 2E3TA 4XIGS 2DYBA 4P2CB 4ZKCB 2JU6X 4DV7Q 4LNFA 5IGCA 3ZNZB 1F1HA 4EKUA 3W1GA 1WVLA 4DAMA 3GTPB 2MRPA 1S3OA 5EAYA 2HHHQ 2JRIB 3CAMA 1S5FD 1VR9A 1RJTA 4ZUJA 3IKJA 1ET6A 2LASA 2W82A 1ET9A 3DPDA 5JHAA 3I4NB 2LY7A 1PZKD 4K6DA 1FXAA 3GTKB 1GUAB 2INCC 5I2XA 2KWVB 1A70A 4M0WA 5CC4A 1DCZA 3QIAA 4DV3L 3I4MG 3HOWB 1C4PA 1KM7A 1PRTC 1NEKB 1V5TA 2IGDA 2WGSA 2K33A 1W6KA 2UXCL 4I6PA 1XLOA 1SROA 2KJXA 1Q0WB 2N88A 1AARA 3K58A 2WX0A 4MSQB 4AQYQ 2F4VL 3DBLB 2QA4A 4NXNQ 4POFA 3R66C 2NWGA 4LLGM 4CHKA 3BYYB 3LWUA 5KEEA 2J52A 2CWPA 4DV4Q 1K8OA 2CWAA 5E6OA 2SOBA 3QC8B 1G51A 3DBHI 2VUMB 4DR4L 1W3SA 1RL2A 1LABA 5IP9G 2AYOB 2QIEB 4DQOC 3H0GH 1IBMQ 3CHBD 4ZDVA 2PEAA 2DNCA 1LT4D 2M0XA 2LFNA 4BXXG 1J7CA 1CQFA 4UPAA 4EUTA 4HLEA 2PNRC 3RN5A 4HEDA 2L05A 2KANA 2ON8A 4F8MA 3JAME 3H7PB 1LTGD 4GOCA 5MPOA 4ICUA 2E5LQ 4LJPB 1A8VA 4WWOA 3KW5B 4E74A 5I9OA 1PYBA 2RGFA 3CSFA 3I4LA 2QCZA 3PO2B 3KUCB 2K5QA 3GTMB 3RZWC 2BA1A 5ELDA 4PMWA 3UE1A 2C60A 5CHWA 4KKUA 2BYVE 4B9KA 5EPJA 1GG3A 1V1QA 4JBJA 1L5PA 2K14A 2UU7A 4C1NI 1EIFA 3J80E 1N36L 1D1IA 3VR4A 4GDLA 4B9WA 1VQHA 4NXMQ 2MBEA 2Z6KA 1ZEQX 1HA6A 3VHTC 1WTRA 2Q2UA 2R3ZA 1OXSC 1WYDA 3AE6B 4HSVA 3DMUA 3RLFA 3PREA 2C9OA 4UP7A 1CZWA 1SJED 1ZXIA 5L37A 3KYDD 2DLBA 4GOPC 1YX6B 2LXCA 4JK1C 2JN4A 3QIJA 3D31A 2M17A 2Q8RE 1I5FA 4P72A 4R8IA 2BH2A 4JOIC 1JE4A 1UE5A 1VQGA 2RCNA 1HNXL 3PO3H 1GJZA 3MTSA 1L2NA 4ITKA 1LTLA 4ZRKA 2E2HB 1RWSA 4YY3Q 2FMMA 1NNXA 1K8GA 4NPNA 1V6EA 4PK1A 2MBOA 2UWQA 2KYWA 3ZRCA 5CYUA 1STGA 2C35B 1HR0Q 3QB3A 5FR6A 1Q7YC 2PJHA 3HOUH 4K81A 3DWPA 4DV5Q 1SE2A 2JJQA 4A3BB 1UWMA 1TWGH 2MP2B 2BGFA 2PYKA 1WX7A 2ACZB 4BBNF 4JI1Q 4M02A 5LHY1 4YSXB 2ZPYA 2N49A 3ND8A 4YSYB 1C48A 2B8GA 2MFIA 3STBC 2NVYB 2JY6A 4G11A 2Y0SB 3IG3A 1QLBB 2LVPA 5IGEA 2B63G 3U30A 2PMZB 2GB1A 3PIO3 1KABA 3UDXA 4FF3A 2G3QB 1TKWB 3QWNA 1RHPA 3X3NA 4DBGA 1EU3A 1YJIA 1TIID 1ENCA 1UUPA 4CKCA 5AJ3L 4GIVA 4E3CA 3CPFA 4ANXA 1BKBA 1STHA 1VCIA 1DXMA 3ENEA 1I4RA 2I2YA 4RGNA 2AL6A 2OXPA 4KJOA 5GQOA 1TWAB 3TP7A 3KF8B 1VF7A 4OZBA 5KHQA 5EJWA 2D3BA 3HOVB 4BBSG 5EE9A 4HR7B 4MN3A 1S1QB 2L8JA 3N30A 2A73B 1GUSA 3K81C 1VQ8A 3S17H 5D14A 4HMIA 3AEVA 1M94A 3MJ5A 1ML0D 3AN1A 1K0RA 2JA6B 2UUBL 2DYMA 4A20A 1NR2A 3WA0A 1SAPA 2GN5A 2XK5B 1EQQA 2DZKA 2VH2A 3B2GA 3ERSX 2ZTCA 5L83A 4XYCA 4LK1C 4TMAB 1LLRD 2E2IH 3GTQH 4DR3Q 3ZTCA 2KWDA 4RGOS 2OHFA 1WTXA 2KA7A 1CK1A 4B95A 2MO1A 4MGZE 1MHWC 5AUIA 2B2WC 1EFWA 2EJMA 4FF2A 2DZIA 4CKBA 4OWTB 1FMAD 4A90A 1XMQL 1EO6A 4H2AA 1WTVA 4FXKC 3VUYA 2RDBC 1TS2A 3M7NA 4JI3Q 1HZBA 1ICWA 4ZUIA 2N1VA 3FC4A 2PLPA 1XF5L 2EKEC 4K14A 4K3BA 1P8LA 3G6EA 3Q8BA 3PLUA 4GOPA 2WP8J 3KLWA 3A33B 5AZHA 4HCPB 4JOIA 3A55A 2WXIA 3H0GB 3NELA 3DQVA 3MHBA 4QIWB 4A3MH 4YL8A 3PMFA 4XGAB 1PH3A 2M56B 2C9WB 2C7NB 4DXAB 5M5XB 1GHJA 3NSWA 1N5WA 1X65A 1YMHE 4A3GH 2N9XA 4HIKA 2JUOA 3OMGA 3RUZA 1Z9FA 3KUPA 3FHWA 3PO0A 4LDTD 2D10A 2M19A 1YN5A 3P1MA 3TBIB 3VR3A 4KGRA 1K53A 5G2NA 1STAA 1LYLA 5JJZA 2W55A 2LXKA 3V6EB 3I72A 3RNBC 1G8ZD 5EDSA 2HD5B 2VQFQ 3TZUA 4LWCA 3X23A 3A8IE 3HEJA 4XXEA 2ZW0A 3LDZE 4TUUA 4ZLTF 5JVG3 5KNDA 3TZDA 5C4XB 3MXNA 4W9CA 3J9CA 4UDUC 3A4RA 3MHSD 1XNQQ 1JE5A 1C78A 1HTPA 3GV6A 5D3IB 1AYFA 3S9WA 4EEWA 1RD9D 2K9XA 4R4QA 1TWCH 2KFKA 1E0ZA 1PFSA 3L17A 2RHSB 4UAIA 1QVGA 2MCNB 3CF6E 1LTTD 4JQWC 3NVWA 1HFGA 4AQYL 3PO3B 2QW7A 1TJEA 2KDEB 4RHRA 1CT1D 1EEFD 2CJNA 2MH7A 1GUOA 3VVWB 2FINB 2HDEA 3NQIA 4DV4L 2Q5WD 3HG9A 3AFPA 3MHZA 1DZ1A 1TU2B 3QG1A 1WXQA 3DBRI 2L0CA 4MJSA 3WIMA 1C1YB 1E8ZA 4A3KG 1V1PA 1D5ZC 2M9VA 3DCGA 4ARIA 2NPTB 1WRIA 1TWGB 1XXGA 4GNXC 1SNOA 1Z2MA 4K7WA 4BKSD 1NAPA 2KMAA 1XPUA 1H9JA 2SEBD 2VNUD 1FYCA 2X6LA 3K6OA 2WB1B 1MJEA 3OTOL 5C3EH 1B3AA 3J7AF 1UGMA 2EY2A 3KDFB 2PIAA 5CORA 3AEEB 1LTID 4C4VB 4AUQC 3PZ8A 2LFIA 1E2VA 2AWOA 1TT2A 3W5OA 3S2DH 4LFAQ 3KLSX 1SN8A 2VQEQ 5IP9H 4DHJB 3ZVVA 2D2CC 2NB0A 1AFPA 3I55A 3NS8A 4W9GA 4NXML 1I3QH 5T1IA 2Q2HA 2EYMA 3AMUA 4WJ3M 3R2TA 3KUDB 2BTEA 3OSOA 2BDOA 4A3LH 2ICEC 1CUKA 1GPXA 4OIJA 4JI5Q 3S17B 3L13A 5IT9L 1N5XA 2D2QA 3RNGC 3A56A 1YHQA 1MKHA 4HAEA 3A54A 1OQRA 3GZNB 3NENA 1QT9A 1CZGA 4GN5A 2PKOA 3CC7A 3EC8A 4HPMB 2O6VA 3JAMi 5I9PA 2V3NA 2WXLA 2XTIA 3IFDA 3H6MA 2KDFB 5H8YE 4R1JA 5JEAG 2RPQA 2E2IB 3ZRFA 2DZMA 1EU4A 1EY8A 1OXXK 1Q3LA 2LKVA 1SYDA 3P1HA 1GHKA 1WF9A 2A4ZA 2BS3B 3PPAA 1SNMA 1HR0L 2F3IA 2K6QA 3PZDA 3NTKA 2J53A 4W9FA 4IZ8A 1FEHA 2J0JA 4DV5L 1KIXA 3EECA 2X69A 4L5QA 3U4ZA 1P1AA 2EZVA 1CKNB 4RKBA 3CU7A 1S72A 2MBHA 4HPPA 1Y69U 3J7YW 4JI1L 2KQ7A 4WWMA 3M4OH 1VDVA 2FE8A 2FUHB 2PPBC 3UIOB 4IM2A 1Q8KA 1EIYB 3KBXA 2LZ6A 5JZEB 2D3CA 2XBBC 1EOVA 1Z6HA 4A3MB 2KDMA 2JSVX 2VUMG 4F7XA 4CJ2C 2V3PA 3M3JA 3OJ4B 5DLQE 2ASBA 3R93A 1HCZA 2KHWB 4A3GB 1NYRA 4ZYNA 2N4FA 3RLOA 3NTHA 1WJ6A 4WJOA 3KBGA 3M4PA 4K7UA 3LXFA 1XTDA 1EWCA 2KFJA 5LMNL 3R2IA 4JI6Q 2Z9HA 1AE3A 5DM73 4ZCKA 2A6EC 5C23A 2KQ3A 2LVQA 3U4VA 2H5XA 3MP9A 5FO8B 1ZPSA 3TS0A 3NY5A 3J81E 3BG3A 3NZSA 2B63H 1WZ0A 1Q10A 4WRDA 4NQLB 3GE8C 3UE0A 3QOLA 2HE7A 4GGQA 5IAAC 2FUG1 1F52A 1I4PA 1XLQA 3GTJH 3H7PA 3L4PA 4K0KQ 4DR2Q 4US8A 4DNRB 2IO2B 2GBRA 4A8XC 1WGGA 1TWCB 3PT2B 3ITPA 1OEYJ 2F0EA 5E6NA 1SSOA 1B9NA 2L00B 3VR6A 2KTRB 4KKIA 5J2RA 4U673 1FVIA
chains in the Genus database with same CATH topology
2PW7A 1PDXA 1WD1A 2N7JA 4QUCA 4XYOA 4BS9A 1VZ6A 5C3JB 2XRSD 4A3JB 5I4DA 1S5CD 2WDQB 4C7YA 1DOXA 3U9OA 1GUGA 1PTOD 5C3EB 3V2TA 1SE4A 4X3KA 3S2DB 5C44B 1R7SA 2EYLA 1KDAA 2IX3A 3P4SB 1OXTA 3I57A 1UNSA 2W3RA 1I3QB 2MUYA 1TY2A 1UWXA 2A6HC 5EBCA 4FXDA 1P7FA 3Q8FA 5G3LD 4BA2I 2F0PA 4KD3A 4LK0M 4XDCA 2JYEA 1D6EC 1QWYA 3A8KE 5FLXL 1EM7A 1WWTA 3KF8A 1VJKA 2HTME 3I91A 1S5ED 3OW7A 1C4QA 4WIPA 2AQ3B 1IW7D 5CBEE 3VA7A 3IAS1 2BCOA 4CBVA 2RA4A 1HTLD 5F2DA 2JSOA 3HS0C 5I6YA 5IGGA 2Y5CA 2HDMA 4KD4A 5HG2A 3M4OB 2FJ2A 2E74C 3CIRB 3P7JA 3FPPA 5IIFA 4IUQA 4YTMB 5C0XI 1E2ZA 4QUFA 3T13A 3AU7A 2KEEA 1WGKA 1BOSA 2K01A 3NQTA 2NUCA 1SYEA 5DM63 3SHLA 4DF7A 4KJNA 1FIQA 1EYAA 1SMYD 5IT9E 4NMZA 4FNFA 3ZJTA 2ENBA 2F0IA 4YSZB 2F3VA 4RF0A 5IGFA 2K5PA 3TEYA 3T51B 3H94A 3VR9B 3GTJB 4KV6A 2L83A 1B50A 5ISRA 4I65A 4M1UB 3SFEB 1V8CA 1JMLA 1GUWA 2V4IB 1X3QA 5DAUA 4IN3A 4IALA 1ZOYB 2JA5B 1O80A 2XVSA 4LJZC 3Q6SA 2JXTA 1LTAD 3IL8A 2L9HA 1QG7A 2F0MA 1VF5C 2XN9C 2DNEA 1EL0A 5JEAH 3A7AB 3GD7A 4ZAIA 1YNJD 1I6HB 2K05A 1X3PA 3FRPB 3A8JE 4G4KA 2IX0A 1F2ZA 4OIKA 2F0HA 1JOOA 1WTPA 3T3OA 1LTRD 1RFKA 2H1EA 3M7GA 5C6AA 1U4LA 1E6EB 4ODGA 5KNCA 2WXRA 1TKGA 1EQTA 1F77A 3K7AB 1GUTA 3I8ZA 4OVZA 2LUMA 4C3IG 5C4HA 2KUMA 2BB6A 3TMEA 1LTBD 4B0MA 1PFNA 3T4AC 1AP0A 3X3MA 4K8IA 1RTOA 4JPSA 2BS2B 1Q8IA 2JZPA 1WCMB 2JA8B 3MC0B 2M0AA 4PQXA 1F9PA 1B9MA 3NK9A 1PFDA 1QOHA 3UI2A 3CKIB 4XYQA 5CV8A 2GI9A 1MPEA 2DBYA 1GAQB 5C2TB 3DEOA 1QQRA 3HZXA 2Q8IB 2J7ZA 1DOYA 1RODA 2BDNA 4HN7A 2HUGA 1SYBA 1M4VA 3BK1A 1ZYRC 5JAVA 3ND9A 4NKLA 3MWYW 3NXWA 4ULLA 2BB5A 3FMCA 5I2YA 4A3KB 1P7EA 2ZW1A 4C3HB 4KK7A 1ZP0B 3DXJC 3K5LA 2WAQB 4XQNA 2RSNA 3H09A 1WTWA 1JICA 4TSSA 1PGXA 1E2WA 2WXNA 4C1NK 5FLXE 4XWTA 3DWMA 1K52A 3G6JB 2TMPA 3AEDB 3U52E 3VRBB 2XRQD 3FAHA 2IGHA 1XO3A 4PMCA 1VMPA 1JWUD 1BXTA 1I4XA 1IYUA 1LT6D 1N60A 1TWFB 3TUOA 3E5SA 2L1BA 4XQQA 5C5LA 3Q8EA 2HCCA 4HSPA 1QNKA 1VLBA 1I4GA 1CJEA 1SNDA 4PMBA 2MP1A 4ABNA 4QB4A 1I4QA 2F0JA 3RFZB 4RHSA 2Y5PA 1L0XB 2I07B 1TY0A 3GO5A 4TQ1A 2JYOA 2WV6D 3FILB 2RDHA 5LL6S 2F0VA 3VYSA 1CTMA 4OHJA 1O78A 2NYZD 5IGDA 4BWGB 3MA2B 1MI2A 5I6WA 4ID6A 5K5PA 2IT1A 3HGBA 2EYPA 2LEKA 4N9PA 2A69D 1K50A 2R93B 2NTSA 2DWQA 3N6RA 3BZDB 1KDBA 3ZQ4A 1Q1EA 3M85A 3OWEB 2RKSA 4KKTA 3C2PA 1GB4A 3ZYYX 2G9HD 4OW0A 5HFYA 1JR0D 1EY5A 3VRAB 1WD0A 4K2KA 1BCPD 1YNND 3HUIA 4B0EA 3DWGC 3RZDB 1EWYC 4DAPA 2WXOA 3K5OA 3H3VC 4DU9A 2A68D 3HVDA 2DY7A 5IOCA 3D8GA 2MHVA 1L0VB 1MVKA 2BA0A 1I6VC 3W2DA 4ZK9B 5ELEA 3BS1A 1DOMA 1II3A 2RDFA 2N9KA 3K59A 2EYHA 1TR5A 1AN8A 2LHEA 4NDXA 1VDZA 1UEAB 5C0XH 4FF1A 4HKZE 3VYTA 1VZ7A 3V3XA 2FBWB 1J9OA 4U68A 2XSCA 3DHQA 4RCOA 3VR5A 2MJDA 3E6ZX 3BVZA 4L63B 2LHDA 4H13C 4KY6A 3LNNA 1FCCC 4K2LA 3LYYA 1GXDC 4FVMA 1A2TA 5M3FB 3OHXC 3WOFA 2JX5A 2WKCA 2G1EA 1NR4A 4BY7B 2QJLA 5JOBA 3V05A 2ZT9C 3KQ4A 2EY5A 1Y56A 4NP5A 1RCVD 2PZUA 4PNYA 4A6QA 1I4HA 4CJ1B 5FO9B 3K0YA 1D2BA 2Z1CA 1FD7D 1DOIA 2L12A 1U4MA 4GZYC 4A93B 3OIQA 4KY7A 1CA6A 1G2SA 2L5TA 3BIID 1FD6A 4P6VF 4CQNA 1KLUD 1YNTE 4N6EB 4O1NA 1IBXB 2O2LD 3KWVA 3S14B 1VZ8A 1MD2D 4X3TA 3LB8C 1LV9A 1PFMA 4IUTA 1A6XA 5M5YB 1IL8A 2O5JC 3S1RB 1LACA 5M3MB 1HRJA 2WXQA 3LWEA 3IXSA 1JC7A 4K5XA 3S2HB 5LL6X 2PMVA 3IAM1 1QILA 2EY1A 5EKIA 5TSSA 1XLNA 1H9RA 4JWSC 5CV9A 3T16A 1MSGA 1PTOF 3M3YB 3EJIA 2CU3A 2F0DA 4FO2A 1S4ZA 3SDZA 1QOAA 1S5BD 1NENB 1EYCA 2JA7B 3W5UB 3G7LA 3FEWX 3N9YC 4PV1C 1V97A 4DK1A 2BBCA 5G3LF 2V0GA 3Q22A 1H9MA 4H7BA 1EZ8A 4HCSA 2WINB 2F03A 4C3HG 1JW9D 3PZ7A 3GTOB 2WIIB 2M00A 3B2FA 1JOKA 4IKGA 1QOFA 2SDFA 4IURA 1BNZA 5G5HA 2B2WA 3AE2B 4GDKB 2WS3B 2KN4A 4HROA 2N9LA 2F1MA 1MHXA 2RQXA 2E2JB 4YT0B 1HXYD 1EYDA 2GA4B 1CI3M 3GV3A 3LX0A 2EELA 5EBDA 2CW0D 4S3SA 2QDBA 4C3IB 4ZKBB 4KI0A 2PTLA 2B76B 4G7HC 4A3DB 4EE2A 2C5CA 1V1OA 5ELFA 4RA8A 1V43A 5EPKA 1U9RA 3NPPA 3TP6A 2VB3X 3NVYA 1O7ZA 1Z47A 3BYTB 2KCCA 2LGIA 1I7HA 1JWAD 1J8IA 1RTNA 2BT6A 3NTIA 2PCFB 5C5MA 4C56C 1BDOA 4K8JA 5KRUA 3S15B 2K28A 3S1MB 1AW7A 2TSSA 3FILA 1IKMA 2SNMA 4E6IA 5C3XA 3TEZA 4IFDI 1JQ4A 1CQVA 3OIPA 4EQOA 1BUIC 4HEA1 4KGTA 4LTUA 2MJ8A 5AFWA 1JALA 1OXVA 2PVOD 1LT5D 1E7PB 1ZXHA 1PTOH 2R6GA 4RGTA 1C8CA 1MI0A 1VRAB 5DNFA 4FXCA 1UGJA 2VB2X 3W3AA 1BF4A 2YU9B 1B1ZA 2GRIA 1BMLC 2R61A 4MIUA 5EE3A 3ERQA 2QEJC 1YNNC 2AQ2B 1BBXC 5DEHA 4RFBA 1Z7TA 4ZRZA 2KAJA 3FDTA 2Z4IA 5GXGB 4R8NA 3AB5A 2L52A 1MBYA 3UI3A 1BR9A 2D9UA 1STYA 1IGDA 2IW3A 2OHFA 5NUCA 2LMCB 3NVZA 4FYDA 3IT4B 1FO4A 3TSSA 2OT2A 4DNTB 5CBAE 2J0TD 1XEEA 3HP3A 1A3VA 1SYFA 2B8FA 5JXVA 3Q8CA 2R7ZB 4OZAA 1EFID 3L7ZC 2KECA 4IFDG 4CHTB 2JWUA 2X6GA 3GTGB 2INNE 2WP9B 2WU5B 1FNVA 3F2UA 3PIP3 3EROA 3AEFB 3QJYA 1SSNA 3AB9A 3P63A 1G2TA 3SR6A 1WTOA 4ARCA 3S1NB 1XTCD 1NI3A 4B9XA 2QCPX 4NJCA 4EQNA 1HA5A 3VR8B 1CHQD 5JPMC 2BYTA 2IGGA 1EQVA 1PRTD 5CMDA 1R9TB 1SNQA 4ZOHC 4DK0A 1SJHD 4WAFA 4LAAA 3K57A 3AEGB 5CV7A 2F0OA 3HOZB 3BVGA 4XDDA 1YJJA 3RMHA 4IOIE 4AS1A 4NAWB 4TQ0A 1N62A 3PUZA 4G7ZC 4FF4A 5E1FA 4XT3B 2F0GA 3U2SC 3AE5B 3FPUB 3ZGZA 1ZXTA 5C4JB 1EY0A 3P4QB 2B39A 5E3FA 3ZJVA 2Y3AA 2F0FA 3L9AX 4OGQC 1DYQA 3NUCA 3ONAB 5EKLA 3VYRA 2VZKD 1HHVA 1BQQT 4A9AA 1J7AA 4N9TA 2RSOA 3FKIB 4A3IB 4JBWA 3VYUA 1A3TA 5FR3A 2B2UC 4L1BA 1IBXA 3VQIA 2NN6I 4OL7A 2EE1A 4QMGA 3SK8A 4DXGA 1PTOB 4R3DA 2ZXRA 1JORA 2HCIA 2B2TC 1C4AA 1HQMC 4LMQD 3EUB2 5BN3A 5EGTA 3Q0AA 2EKIA 3IAYA 4BY1B 2HDLA 5CV6A 5FK9C 2DY8A 4X3SA 2F0SA 1JWMD 4IUPA 4Q0FA 2H4OA 5LNK1 3S1QB 3O13A 1QNUA 1IKLA 4XTCS 3D3RA 2BS4B 5BYSA 5CV4A 1PMRA 2AUJD 4NAMA 2WACA 5C0XG 1A3UA 1C79A 1LO5D 2F4IA 2QILA 2H89B 3SEBA 1BCPF 3D4RA 4TQUS 2NN6G 4WQMA 2L11A 3CWIA 4M8AA 1IHZA 1NVID 2F0QA 1T6BX 2IWHA 1CHPD 2F0KA 4KY5A 4XE0A 4RAUC 1SXTA 2ZXOA 1EOTA 2INPE 4IUUA 2WXMA 3P4PB 1DOKA 5A2QL 3J80L 1V8QA 5D3DA 2F0WA 1NCVA 1HQRD 1Y1VB 3T56B 4XWWA 5D65A 4L8JA 3E0JA 2ONQA 3D4WA 5ELCA 2CW0C 2WXJA 1LT3D 1Y1WB 2WXPA 4BBRB 5BN5A 5K36H 3N52A 2Z4HA 2PZTA 4N58A 3DEPA 2B2TA 3NS1A 3KLRA 3W5VB 1F2MA 4J6HA 1U4RA 2NVTB 1RM6C 2N0SB 1HZ5A 1XLPA 1R4QB 2QKIC 4C3JB 4P16A 3C1EA 2ICIA 1M8AA 1TYGB 1B53A 4Z9CB 1OQQA 1T5XD 3AEAB 5CGKA 1W6JA 2SAKA 1D5MC 1O7YA 2L55A 1B44D 3MXUA 1NYQA 1HPCA 1FNUA 2NVXB 2EYJA 5FOBB 2IL8A 2E75C 3H8HA 3SK4A 2JEBI 3MZ5A 3TP8A 1WYGA 3E9SA 3SFDB 1G91A 4IFDH 1ZUD2 1YQ3B 1DM0B 4WFN3 1Q1BA 2B2VC 3HRDD 1H9SB 2J42A 1C4CA 1KAAA 2AQ1B 4RF1A 1C9FA 4EQPA 3HOXB 2KMMA 2JXMB 1TS3A 2JP1A 3EQLC 1FNWA 2EXZA 1IYVA 5EQ0A 1EIGA 2D5DA 4V0BA 3PUYA 2E2DC 2FMCA 1OFFA 1QE6A 4DN4M 3BDOA 3NUHB 4ZRQA 2NMQA 1K83B 2K5WA 3I73A 3MEHA 4YWGG 2K04A 4KN4C 2H88B 1KRHA 1MGSA 2LMCA 4AYBB 1D1KA 2ZXPA 3AEBB 2Q8TA 5BYQA 1FCLA 3AE4B 2BE5D 1QF6A 3NZ3A 1AWDA 3ABVB 3NHHA 4YIJA 1PTOC 1I50B 4OZCA 4IDIA 4JE3B 1SDFA 2EY6A 1JWBD 1ESFA 3I90A 2F0UA 1ROEA 4MT5A 1H9KA 3TN2A 3W1SA 2WXFA 1L4DB 1JRPA 1OXUA 1DOLA 1J7BA 3P75A 3DM1A 4ILWA 4KMUC 1XX8A 4H0LC 5A35A 1E9MA 3HOYB 2V4DA 1E10A 5C4ZA 2B2VA 3WOEA 2K3UA 3CRLC 3EA6A 2HQEA 3BDLA 1L6VA 1KFYB 3J7AV 1IW7C 3EGRA 1TKYA 3P42A 2A6ED 2E6XA 5EE0A 1PLFA 2F0NA 1HFNA 4JX1C 2PZWA 4H44C 5A2QE 2R92B 4Y7NB 5AUKA 1JCKB 1ENAA 4IUNA 4KHZA 4K6LA 3C3LA 1XYIA 2D5GA 1SBBB 4G57A 4XDXA 3DWQA 1ESRA 2NN6H 4ZHOA 2K32A 3VR2A 2K6AA 5JEAJ 3GB1A 2A5HA 4KX6B 1SMYC 2PO4A 2WDVB 4KHVA 4MHEA 4A3FB 3FVQA 4PT5A 1MSHA 1SIJA 4L2YA 3WCQA 5G5GA 1VMCA 4RCNA 2MJ3A 3ZJUA 2NTTA 2B2YC 1ZDVA 1SF0A 3NP8A 4RKLA 2K1BA 3PUXA 2EJGC 2JE6I 1XCQL 3S16B 2WKDA 2A74C 3U9SA 2CQAA 1A2UA 1BCPB 4TRDA 2W3SA 2PQEA 4MM3B 4YTPB 1YN3A 1F2LA 3MXGA 1E0BA 1C76A 2AX5A 1OO9B 2OEDA 1SEBD 5CR3A 2A6HD 3AM9A 1AZPA 1STEA 1JB3A 1STNA 1YNJC 2KCNA 4US9A 3H91A 1TVXA 2NZ1D 2BW2A 4KGSA 1RDPD 5D7GA 1JWSD 1RYJA 3W9CB 1YN4A 5KNBA 5HI1A 2K03A 1ENFA 2LS01 5COYA 3J81L 1N61A 2N55A 3T3NA 2PW5A 1A15A 2F3WA 1X32A 2DYOA 1B9RA 2XNAC 2L32A 5C3WA 3SK6A 2F0LA 2QF7A 3HKZB 5H92C 2WLBA 2L4NA 5EKKA 2EYOA 4IFDJ 3MVVA 1TS4A 1Q12A 2AWNA 3V96A 1YQ4B 1QJOA 1CA5A 3AE7B 1NSNS 3EVQA 4K5VA 1EZ6A 1K51A 1EEID 1PXUA 1SFOB 3NWSA 4C3JG 4WJWA 2B2YA 4EVOA 1PRTF 5BN4A 5E4WC 3T53B 3AH7A 4F88A 2YEPF 3KWLA 1EWHA 3Q8AA 4HMJA 2WXGA 3MFGA 1HUMA 3PUWA 3PV0A 1ILQA 1FXIA 1TZOA 4KKSA 2IPKD 1SNPA 3L3OC 4B08A 5KIXA 4HKQA 3KK7A 1F9QA 4D2KA 3SE0A 5KYIA 1EY4A 1S5DD 5BMGA 3OOCA 3PUVA 4IUVA 1KF6B 2K0PA 2RBMA 1PUTA 1WTQA 4CGYB 2RPVA 4Q2JA 5J1ZA 2XWBB 4N59A 2WU2B 3HOUB 3VA5A 4MH8A 1F9SA 4L23A 3Q23A 1ONLA 1MHHE 3ETRA 1H9SA 1Y8NB 5J39A 4HTHA 1FRRA 2I38A 3SVMA 2CJOA 5KGUA 1GUNA 4F87A 1DD2A 4WORA 2WNMA 3GP7A 1BO0A 1TKEA 4C80A 3E56A 1F0ZA 3EFXD 1FRDA 1ILPA 4I7ZC 3AE3B 4L6TB 1Y8PB 4WH4A 2RVLA 3C46A 2BE5C 1AZQA 1D5XC 1PYWD 5EE1A 3DUZA 5FO7B 2SNSA 2MJEA 4XQJA 4X3UA 4MACA 2KEDA 5BMIA 3DWAA 1KLGD 1L0YB 4XT1B 3GTQB 4BA1I 3TDQA 5J22A 4R9WA 2RMMA 2X38A 3C1FA 4IQZA 3MFYA 2EYFA 4ZQ3A 3K5NA 1DGJA 3U4EG 3OWFA 2A69C 4C2MB 4YTNB 4K5WA 5ELBA 1CZPA 1UAPA 2EPBA 5C0XJ 5M9OA 1F9RA 1JOQA 2ID0A 5K36G 1ZYRD 2MGSA 3URYA 3Q69A 2YYZA 4GLSC 2EDGA 4J1MA 1BCPC 1TS5A 3BDCA 5FKAC 4OO1I 1EY9A 1N63A 2VXWA 2KACA 2K5DA 1RKNA 4KKJA 4FXGC 5M5WB 2A68C 4KN7C 4RH6A 1SNCA 3R8BA 1F2YA 1AEXA 3HVZA 4C7ZA 1GOZA 3I9V1 5KYLA 3OMCA 2KQ4X 3D6CA 1JQYD 3A7LA 3B9JA 4J8QA 1Y8OB 1ZKOA 3SK5A 3CRKC 1K8MA 2IJ0A 4O42A 2RDGA 4JWUC 2LJIA 2F0TA 1SB3C 3NE5B 4NZLB 2EVBA 3I4MB 3QOJA 3NBIA 4DAYA 4HRSA 2WQYB 2K7VA 4OO1G 2CHBD 1HUNA 4DAVA 5HHDG 2JYTA 1TQOA 3TEWA 4DGZA 4REZA 1ACCA 2IDYA 3AE1B 2JQRB 1RF2D 4QF4A 3NVVA 1FFVA 3HRZC 4ME5A 1JROA 4GDLB 3BWUD 2MPMA 1B4OA 1G291 1PZID 1ZDXA 1C77A 3AECB 3D6WA 4ZYSA 1KNEA 1BUVT 3TEXA 2Z8LA 3QO2A 4A3EB 1PFBA 1SE3A 3GQBA 4QCLA 3I3CA 1CM9A 3P20A 5BMHA 4CJ0B 3RPFC 1QB5D 3AMZA 1PGAA 2FFKB 2WDRB 4ZRPA 1PRTB 1Q90A 2YEPB 2MEKA 3BVMA 3SR1A 5T8IA 3NWTA 3CQZB 1ZE3D 1KDCA 5JPNC 1TWHB 1QOGA 1IUEA 2XIWA 3KLSA 2KOLA 1B2TA 2FHTA 3IFTA 2JEAI 1T3QA 5BYRA 2B63B 1STBA 1SYGA 1IGCA 3AE8B 2O4XA 3IT6B 3AV8A 3NBHA 3MAQA 3U7ZA 1HZ6A 3RD4A 1NUCA 4BBSB 3JAML 2EJFC 4DA2A 1R4PB 5HURA 2IX1A 2BOSA 1KNAA 2E76C 5JVH3 2VZKB 2OF1A 4A55A 5E4XA 1HEZE 3I70A 2KHSA 2NBFA 4HJGE 5HGTA 3R3OA 3K5MA 4DXFA 5EPLA 3AE9B 3SXHA 5E6JA 2CVRA 1U4PA 1FGBD 2G9DA 2B2UA 2PW9A 3WDNA 4RWSC 1SYCA 1EY7A 3C8YA 1WSPA 2QMTA 1PDQA 2I46A 3GS2A 1O7LA 4Q5VA 2KVMA 1DJRD 5CV5A 2DN8A 4RGMA 2EOTA 3RZOB 2NVQB 4RNAA 1D4BA 1G6ZA 2WXKA 1EIHA 4J3OD 2PVGC 3OPOA 1FM0D 3D4DA 4EGVA 1EY6A 3M4YA 4KTAA 2QSDA 1QCBD 2O5IC 2WXHA 4V190 2OEOA 4TKOB 1XWEA 1LTSD 1QKZA 4CKEA 1V1PB 3NRZA 4NW2A 5T1GA 2D62A 2XWJB 1F2RC 1CFMA 2L1AA 1PGBA 1GB1A 4G7OC 4ZHPA 1FR3A 4DFAA 4WURA 5IODA 4USAA 1QOBA 3BK2A 2AUKA 4OO1H 1F2RI 1DONA 1FFUA 2K22A 1L4ZB 3TP5A 2W54A 1KH0A 4HCEA 1GJXA 4YXDB 3MXPA 2J4XA 1KTKA 1T5EA 2M2LA 1XCTL 3GTLB 1L6UA 1PZJD 5IGBA 3P4RB 4FP5D 3Q24A 4AQ7A 2E3TA 4XIGS 4P2CB 4ZKCB 2JU6X 5IGCA 1WVLA 3GTPB 1S5FD 1VR9A 1RJTA 4ZUJA 3IKJA 1ET6A 2W82A 1ET9A 3I4NB 2LY7A 1PZKD 4K6DA 1FXAA 3GTKB 4M0WA 5I2XA 1A70A 5CC4A 1DCZA 3QIAA 1C4PA 1NEKB 3HOWB 2IGDA 1PRTC 2K33A 1W6KA 1XLOA 2KJXA 2N88A 3K58A 2NWGA 4LLGM 3BYYB 3LWUA 5KEEA 2J52A 1K8OA 2SOBA 2VUMB 2QIEB 1LABA 4DQOC 3CHBD 2DNCA 1LT4D 2LFNA 1J7CA 1CQFA 2PNRC 4HEDA 2ON8A 4F8MA 3JAME 1LTGD 5MPOA 5I9OA 3I4LA 3PO2B 2K5QA 3GTMB 2BA1A 5ELDA 4PMWA 4KKUA 5EPJA 1L5PA 4C1NI 3J80E 1D1IA 3VR4A 4B9WA 1ZEQX 1HA6A 1WTRA 2R3ZA 1OXSC 3AE6B 4HSVA 3DMUA 3RLFA 2C9OA 1CZWA 1SJED 1ZXIA 2DLBA 4JK1C 3D31A 2Q8RE 4R8IA 1JE4A 3MTSA 4ITKA 2E2HB 1RWSA 2FMMA 5CYUA 1STGA 3QB3A 3DWPA 1SE2A 1UWMA 4A3BB 2PYKA 2ACZB 4YSXB 5LHY1 3ND8A 4YSYB 1C48A 2B8GA 2NVYB 2Y0SB 1QLBB 5IGEA 2PMZB 2GB1A 3PIO3 1KABA 4FF3A 1TKWB 3QWNA 1RHPA 3X3NA 1EU3A 1YJIA 1TIID 1ENCA 4CKCA 1UUPA 1VCIA 1STHA 1DXMA 1I4RA 2I2YA 4RGNA 2OXPA 4KJOA 1TWAB 3TP7A 1VF7A 4OZBA 5EJWA 3HOVB 5EE9A 4HR7B 4MN3A 2A73B 1GUSA 5D14A 4HMIA 3MJ5A 1ML0D 3AN1A 2JA6B 2DYMA 1NR2A 1SAPA 3B2GA 4LK1C 4TMAB 1LLRD 2KWDA 4RGOS 1WTXA 2KA7A 1CK1A 5AUIA 2B2WC 2EJMA 4FF2A 4CKBA 1FMAD 4A90A 4H2AA 1WTVA 4FXKC 1TS2A 3M7NA 1ICWA 4ZUIA 3FC4A 2PLPA 1XF5L 4K14A 3Q8BA 2WP8J 3A55A 2WXIA 3H0GB 3MHBA 4QIWB 3PMFA 2M56B 5M5XB 1GHJA 3NSWA 1N5WA 1YMHE 3OMGA 3RUZA 3KUPA 3PO0A 2M19A 1YN5A 3P1MA 3TBIB 3VR3A 4KGRA 1K53A 1STAA 5JJZA 2W55A 3I72A 1G8ZD 3TZUA 3A8IE 3HEJA 4XXEA 2ZW0A 4ZLTF 5JVG3 5KNDA 3TZDA 5C4XB 3MXNA 3J9CA 4UDUC 1C78A 1HTPA 3GV6A 5D3IB 1AYFA 3S9WA 1RD9D 2K9XA 1E0ZA 4UAIA 1LTTD 3NVWA 1HFGA 3PO3B 1TJEA 4RHRA 1CT1D 1EEFD 2CJNA 2MH7A 1GUOA 2FINB 2HDEA 3NQIA 2Q5WD 3HG9A 3MHZA 1DZ1A 1TU2B 3QG1A 1WXQA 2L0CA 1V1PA 1D5ZC 2M9VA 4ARIA 1WRIA 1TWGB 1XXGA 1SNOA 1NAPA 1H9JA 2SEBD 2VNUD 1FYCA 2X6LA 3K6OA 2WB1B 1B3AA 3J7AF 2PIAA 2EY2A 5CORA 3AEEB 1LTID 3PZ8A 2LFIA 1E2VA 2AWOA 1TT2A 3KLSX 2D2CC 2NB0A 1AFPA 5T1IA 2EYMA 3AMUA 3R2TA 2BTEA 3OSOA 2BDOA 2ICEC 1GPXA 4OIJA 3S17B 5IT9L 1N5XA 3A56A 4HAEA 3A54A 1OQRA 1QT9A 1CZGA 2PKOA 2V3NA 5I9PA 2WXLA 3IFDA 3H6MA 5H8YE