2D5GA

Structure of ubiquitin fold protein r767e mutant
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
83
structure length
83
Chain Sequence
CDSIVVAYYFCGEPIPYETLVRGRAVTLGQFKELLTKKGSYRYYFKKVSDEFDCGVVFEEVREDEAILPVFEEKIIGKVEKVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of ubiquitin fold protein R767E mutant
rcsb
source organism Rattus norvegicus
molecule tags Signaling protein
molecule keywords Axin-1
total genus 16
structure length 83
sequence length 83
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2005-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00778 DIX DIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.380 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2d5gA00
3PZ8A 2D5GA 4WIPA 3PZ7A 1WSPA
chains in the Genus database with same CATH superfamily
4WIPA 4WJNA 3X0WA 3T3NA 1FMAD 1N6ZA 5CTRC 5GMVA 2D2QA 1RAXA 4E3CA 3T3OA 2PMVA 1TJEA 2W55A 3PLVA 2DLBA 1GPXA 1UWMA 4ZRJA 1L4DB 1E7PB 1OFFA 3IG3A 3B2GA 2WNMA 4ZRPA 4WJQA 3NJTA 2K39A 3L0WB 4IM3A 1WM2A 5JXVA 1ZUD2 4NY0A 3NUHB 3C0RB 2IGGA 2GBNA 1WGRA 5EE3A 5TSSA 3AULA 3VFKA 3Q69A 2A4ZA 4BKGA 4EZLA 1WR6E 2AQ1B 3PVLA 1AYFA 4LK0M 2CJOA 2PLPA 2W82A 4BAXA 3NZUA 1ZXIA 3QX1A 4MELA 2C5LC 3TMPB 4A8XC 3RCZA 3RNBC 1VR9A 2Q5WD 1V80A 3DWGC 2OEDA 2C9WB 2QC8A 1WSPA 4EKUA 3CSTA 4OHJA 1ZKHA 4WWMA 4WAAA 1H4RA 3RT3B 1K53A 1TYGB 2KTRA 3UGBB 3DPDA 4LNOA 3AE1B 3TEXA 2OJWA 3Q3MC 1ZP0B 3KUDB 1UWXA 5CHVC 3W5VB 1N62A 2M0XA 2NBWB 1WGKA 2ZCCA 3QA8A 2ZVOA 2OHFA 2Z8LA 5MPOA 4BFRA 1R4NI 4N9F4 2GBMA 5BO4B 3R7QA 3DHIC 2L83A 2V3PA 3SDLC 2JWUA 3L4PA 1X1MA 1V86A 2INDC 3ML8A 1LFDA 1AN8A 4REZA 1V81A 2V4LA 1UELA 3GE3C 5BYQA 4ACFA 1SE9A 2PVGC 4ZDVA 1IPGA 1WWTA 2BYEA 3B9JA 5LLIA 1E10A 2BWES 3I3TB 2LGDA 3TSSA 2JXXA 1ZXHA 4JQWC 4GN1A 2X38A 3FKYA 4WH4A 3KWLA 2WXPA 3QHTA 1EM7A 2DYBA 3TBLD 1QT9A 4P1CC 1F9JA 1K50A 3OWEB 4KGRA 5D3IB 4MJSA 4P6VF 4NZLB 4XWTA 3O13A 4FHJA 3ZXRA 1MHXA 1ZDXA 1E8WA 2MJ3A 5AZHA 1HQRD 3SEBA 2H88B 2FAZA 1U4AA 3AH7A 3UF8A 3APDA 4HPPA 4NJ7A 4PYUA 4WJOA 1JROA 2PJHA 5J18A 3H8HA 3D32A 2K3UA 1YQBA 4O1NA 2LD9A 3AEAB 5IOIA 3P42A 2CHWA 2D11A 2BB6A 2B3AA 3VAWA 3HIZA 3KWVA 1IP9A 2FCQA 4PK1A 1FNVA 2MW5A 5IA7A 2NMQA 4OW0A 3DBLI 3AECB 5L83A 4W9DA 3UQBA 3RULA 1YJJA 2AX5A 2W3SA 1FCLA 1Q5WB 1WXQA 3KQ4A 1RFAA 4MDKE 3QC8B 2IO2B 1C4PA 4DHZB 2NVUI 1HEZE 1KLUD 5D6JB 1UUPA 2ZEQA 3PSEB 1QOAA 4AS1A 4XWWA 4LJOB 3PHWB 4L2YA 4FJZA 3NVVA 2K8HA 3Q8AA 3FILB 2J52A 2MA9B 3ZDTA 4CO7A 1WGHA 3GZNB 3K9PB 5IN7A 4CQNA 1L2NA 4DHJD 1D5XC 1L0YB 2XBBC 1J7BA 3IT6B 2IY1B 4P1BC 3N32A 1FEHA 2JZPA 5D3DA 1UH6A 2KJHB 2AQ2B 2WXOA 4OZAA 1WZ3A 1JWUD 4YTMB 1R4NB 3DVNV 3DBSA 5G5HA 3B1LX 3HHMA 2TSSA 4JWUC 1NEKB 2DWQA 4GB9A 4XE0A 2IO1B 3ZQ4A 1T0SC 1FNUA 2KVRA 3UINB 3WAPA 2EKEC 1BT0A 3A33B 4AUQC 4OVVA 2DZIA 4RGTA 4KVGB 3ALBA 2KFKB 5DPWA 2NS5A 2BGFA 3M95A 1CMXB 3DBRI 3EA6A 4EE2A 1Y8RC 1LO5D 2N1VA 3RYTA 1KJTA 3IFWB 1F77A 3BVGA 2JX5A 3DBHI 4GGQA 4GOCA 4XC2A 4KKIA 4KSKC 3JSVA 2BYTA 4W9HA 4LJPB 3WIMA 2BKRB 3RZWC 5EE1A 3VDZA 2DAJA 2KC1A 4KDLB 4JX1C 2PTLA 5FKAC 2KOXA 4DK5A 4EZKA 1P3QU 4YT0B 1V49A 2WHIA 4HPLB 2FIDA 2CU1A 4NJ6A 2AYOB 2O6VD 1TS4A 2MJDA 3PZDA 3A9JB 4ZRKA 2JRIB 2WP9B 4WQMA 3LYYA 1CQVA 4FBJB 4ARIA 3OJ3A 1GOZA 2JZ3B 2Y3AA 2DZJA 1P9DU 2L1AA 2KTRB 3BYTB 4TUUA 1MVKA 3V61A 1I42A 1RYJA 1E9MA 1YMHE 1MI0A 1AW7A 1R4MB 4YSZB 1AWDA 3ENEA 1T5XD 3Q8FA 1GG3A 1FD6A 5BYRA 2WS3B 4HJKA 2BS3B 3AE3B 1F52A 1PQSA 4RF1A 4BOZB 4JLCA 1JRUA 3GOEA 1UGJA 1FXTB 1NI2A 2WXIA 1NENB 3RFZB 3ZUNA 1WY8A 2QSDA 2WGSA 1I35A 3JVZX 5IO9A 4W9GA 2D5GA 1C4AA 2JSVX 2UWQA 1XXGA 2G9HD 2BS4B 2CHZA 2BYFA 4IG7B 3EHVA 4CHKA 3Q3NC 4WQOB 3ONSA 5E6JA 3MHZA 2IO0B 1D4BA 2KNBA 2JXTA 3BZDB 2O2VA 5BMGA 3MHSD 2LGXA 3ECIA 2HE7A 4TQ0A 2PKOA 2KHWB 3DCGA 3AEGB 2KWCA 4II3B 5C23A 1ZOYB 2LHEA 5BMIA 4JE3B 1R7SA 3W5UB 3BK1A 5EE9A 3ZGZA 1WJNA 3SHQA 2LASA 3O65B 2KAJA 2L3ZA 3E56A 3H7PB 3VXWA 4K7SA 1WXAA 2HDEA 1WGGA 1HXYD 3HVZA 4RM8A 1IGCA 4LTUA 4M00A 1Z2MA 4DDID 3IAS1 3N20C 1CJEA 4NPNA 3MP9A 2ZPYA 2MBEA 2LRUA 5LNK1 1LM8B 1YQ3B 4FJVB 3AE8B 4KDIC 3P4QB 2IBIB 1YJIA 3BINA 3VRBB 2GLSA 3R3MA 4HEA1 3ZJUA 3KUCB 3ZRFA 2M4NA 3QARA 1ZW7A 4GXBA 4JWSC 3N3KB 4P7IA 4Q2JA 1YIWA 4KGSA 2N9XA 3ZYYX 2IJ0A 1ISNA 4KKJA 2FIFA 3VQIA 1IYFA 4AJYB 5IKCM 4TKNA 1YJ1A 1OGWA 3P63A 3W1SA 2MBOA 1WGYA 1QF6A 3U4EG 2SAKA 4B0EA 4A55A 1L5PA 2V1YA 1XO3A 2LXCA 2V0GA 2NPTA 2LJIA 1F1HA 4RFBA 2WXGA 3UIPB 2DYMA 4W9FA 4I6LB 2FE8A 2KQSA 2L8JA 3LXFA 2BBCA 4G50A 2LGYA 4YL8A 2LHDA 5GXGB 1SEBD 4JPSA 3R2TA 3BY4B 1VZ7A 1FRRA 1WMHB 1I4PA 1XD3B 2WLBA 2WXJA 3WA0A 2HD5B 2I1JA 1UBIA 1FXAA 5L95C 3B2FA 4KSLC 2VH2A 2C60A 1XCQL 1XQQA 3L17A 3DBLB 3J9CA 1VD2A 4ANUA 1ZPSA 4KIKB 2RDGA 2CR5A 1WJUA 3Q6BA 1RLFA 3RNFC 2JY6A 2V4IB 1C77A 3AU4A 3PTFC 3QAQA 3NG0A 4RMAA 2MCNB 3C19A 2KFJA 3BVZA 3P1MA 3KW5B 3HVDA 3APCA 1KM7A 1YX5B 2K8CA 5AUKA 2D10A 2KT7A 2RD0A 5AZFA 1GC7A 1H8CA 5DPSA 1WM3A 3BVMA 2CHXA 4MH0E 5E6NA 2NBVB 3Q8BA 3UQAA 4TSSA 2KX3A 2R61A 5T8IA 2HJ8A 1TT5B 3HK0A 1QQRA 2FCNA 3V62A 5DPRA 4YTNB 1N5WA 2KMMA 2OJRA 2XK5A 5HI1A 3KH0A 4F1SA 2O6VB 3KYCD 3ZIMA 2LVPA 3VUYA 3HM3A 4GIVA 1JWSD 4IW0A 1NDDA 2LFIA 3TIXA 3RNGC 1MG8A 5D94A 1JWBD 3GE8C 2W54A 5G55A 4G3XB 4ASWC 3Q8EA 2ZW1A 5IP4D 1C1YB 3PO0A 2EELA 2Z0EB 4BBNC 1GJZA 1J0GA 3DWMA 1B1ZA 1V9JA 2M56B 2QJLA 3TUOA 1ACCA 2BS2B 3AE9B 1ZGUB 4FHKA 2C7NB 1TKYA 4MACA 2WWZA 3U8ZA 1PYWD 1QOGA 3LJ3A 1QOBA 1HTQA 3AEDB 2K6QA 2KLGA 2WXKA 3SD5A 1F0ZA 2DZMA 1JWMD 1YN5A 3IBEA 1MPEA 2Z0DB 4XYCA 2L32A 4HKZE 4D2KA 2NR2A 2PIAA 2RR9A 4W9KA 2DYOA 2KXJA 3AV8A 1E8YA 1P7EA 1L6VA 4OZCA 1SB3C 4YWGG 2J0JA 3ZLZA 1EWYC 4XZ4A 2BF8B 2N7EA 4ICUA 3VTVA 1Q1OA 1I4RA 4EOYA 4N58A 4IM2A 2BWFA 1ZE3D 3Q3OC 1L7YA 3PGEA 3SFDB 3ZJTA 2GBJA 3CF6E 2KQ4X 4KV2A 1EWCA 1SBBB 2WDQB 3I57A 3CWIA 1OEYJ 3AE4B 4OVUA 1D5MC 4EUTA 2LJ5A 4LNFA 2GOWA 4EFOA 4PS3A 3VTWA 1RRBA 1XCTL 2DZKA 5G5GA 4YXDB 2UU7A 3DBHB 3WANA 4WWNA 1IBXA 3IT4B 2MP2A 2LEKA 2BTEA 4AQ7A 1FNWA 1C79A 4K7UA 3I9V1 3AB5A 1YD8U 2JUOA 3DVNU 4PS7A 2VZKB 2MWSB 4MSQB 1P7FA 1TY2A 4A6QA 1V97A 5JZEB 3MJWA 4MM3A 3PZ8A 1WI0A 4DHJB 4A20A 4HDOA 4C4VA 1WXMA 2C7MB 2D07B 2K5PA 1E8XA 1VLBA 3L08A 3DHGC 5FR3A 1E5WA 1J19A 3HUIA 1SJED 4MH8A 2D3AA 3KLSX 3L13A 2A5UA 2GBRA 1WYWB 4ANXA 1E90A 3DQVA 3PRMB 5H92C 1OTRB 2KACA 1KOTA 2QHOA 3AE2B 1PGXA 3ZTDA 2MEKA 5H8YE 1SIJA 1D3ZA 1SE3A 2MH7A 3I5JC 1LQBA 4IUMB 2KJRA 2WDVB 1SGHA 4A9AA 1YNTE 2E3TA 2RPQA 3DOWA 4GMVA 2MBBB 3Q8CA 4ICVA 1XLPA 2N0SB 2J53A 2KN5A 1Q10A 4G11A 2DENB 2ZJDA 4BZAA 3TEYA 4IOIE 2ZZPB 2MQJA 4MGKE 4RNAA 2L0TA 1V6EA 1SE2A 3PZ7A 1RFKA 4RGOS 2R2OA 5C1ZA 4HK2A 1WXVA 1A5RA 4DBGA 1NBFC 4OVZA 2V3SA 2G4SA 1V5OA 1DYQA 1FM0D 4IWOA 2IGDA 3NS8A 1BUIC 3P2BA 4BKTA 1CK1A 4IKGA 2AWTA 3CIRB 3ZDMC 3WCQA 2MLBA 3AU5A 2J0MA 2X8XX 1K52A 2ICIA 2QCZA 5CHWA 3QIJA 1Y56A 4XX5A 4HJGE 2I2YA 4E74A 1EF5A 3PV1A 1UZXB 4AP4C 2IO3B 1WRDB 1P98A 3VHTC 1JW9D 4RH6A 5TR5A 5CHFA 4II2B 2INCC 2BW2A 2HTME 2WXFA 3EFCA 2KWUB 2LWPA 3DVGY 1YOVB 2KC2A 2J4XA 2DHZA 4JGHB 3GP7A 2D3GA 3U52E 4B9KA 2FNJB 4JIOU 4BKSD 2L0FA 3GZNI 1WZ0A 2M8SA 1GNUA 1LGRA 1HZ5A 2M0AA 1SIFA 1VDVA 2ON8A 3TL5A 1ESFA 1YX6B 1A70A 3MC0B 4MT5A 4RGNA 4IWQA 1V2YA 3FC4A 2KX0A 4HCPB 5EE0A 1D5ZC 4A3PA 3ETRA 3H1UA 5HHDG 2CKHB 2JU6X 2GRIA 3H7SA 4FLHA 2NCNA 4WAFA 2BYVE 1GUAB 2K0PA 3NRZA 3PS6A 4XDCA 4ZYNA 2LGSA 3Q2AC 1S1QB 4AWJA 4N59A 1RWSA 1ET9A 5D7GA 5J2RA 1QOFA 2RDHA 2KN4A 5C2TB 4K1RB 2W3RA 2D3CA 4MGIE 1DOXA 1NVID 2L76A 4K3BA 3ABVB 2K1FA 1WR1A 2YLMA 5E6OA 2FUHB 4TQ1A 1L0VB 4JL9A 1AARA 2AQ3B 2ZCBA 4XDDA 1V8CA 2ONQA 3P4SB 5HKHA 3SR6A 3E9SA 4LNIA 3RN9C 4EEWA 2QDFA 2GMIC 4KZ0A 1FFVA 4BVUC 1J7CA 2JWZA 3NOBA 3AM9A 1J7AA 1WE7A 4HROA 1B9RA 1I4XA 3VR9B 3MC8A 3APFA 1KLVA 2IGHA 2KD0A 1KH0A 4C56C 2CS4A 3S2AA 1JMLA 3RNEC 2O2VB 3ML9A 2NTSA 4B95A 2KDBA 2M17A 3EFUA 1GB4A 4DWFA 1XEEA 1N60A 1UGMA 4M01A 1VZ8A 3AE5B 1E7UA 3EGRA 3AMZA 5FR6A 2L52A 2VRRB 5J17A 2J0KA 4AOFA 2JQRB 2CJNA 3NZ3A 3N1XC 2XK5B 3AE7B 2RPVA 2MBQA 2G3QB 2LMCA 3NVWA 2QEJC 3ZNHB 3P4PB 2DAFA 2Y5BB 2QMTA 2CU3A 4OZBA 2KDFB 2MHJA 4DXGA 4GDKB 1QILA 2IZVB 4B0MA 1TIFA 1V5TA 4ANVA 2OOBB 1N63A 3TCAA 3WAMA 2KANA 2FCMA 3WAOA 1V1PA 5IAAC 2D3BA 2KTFA 1NYRA 3C8YA 3MTNB 4C7YA 2KDIA 3V60A 1PGBA 3DDCB 3QK0A 3NHEB 3KVFB 4DHZE 3P4RB 4C80A 4ZRIA 2LVOA 1N61A 3NY5A 2GBKA 3A9KA 3GS2A 2MP2B 1MFWA 3DBRB 4NAWB 1UNSA 3BYYB 1QZEA 3R8BA 3TEWA 1TGZB 1PDXA 3SFEB 1G6JA 1IGDA 1WX9A 1KLGD 2WX0A 3ZTCA 1UBQA 3N9YC 1OQRA 1C4CA 4ZHOA 4US9A 4ITKA 1MJDA 4HPMB 3OG5A 5G2NA 4HVBA 3RI7C 2DNFA 1TZ1A 2M1MA 2WXNA 3TEZA 2AL6A 1MHHE 3A4RA 4DQOC 4DXAB 3R2IA 4KZCA 1TKGA 3AI5A 2JVCA 4C00A 3LB8C 2QIEB 1DOYA 1KRHA 4GDLA 2N9KA 3QJZA 5AZGA 4J3OD 2XNAC 2KQ7A 1BXTA 2BT6A 2ACZB 3VVWB 1DGJA 2BPSA 3B08A 2KJ6A 4M0WB 3ZNID 3RNCC 4YTPB 1TS5A 3LDZE 4KGTA 2H89B 3FAHA 2EKIA 3L10B 4LLGM 1P1AA 3T9LA 3W1YA 4PS8A 1VJKA 1WFYA 2KWDA 2LUMA 4E71A 1BMLC 4W9CA 2FBWB 4R3DA 3MC9A 1XLNA 5KHQA 1WXSA 4YSXB 2G4DB 1L0XB 2LUEA 3N30A 3L54A 1QKZA 2DX5B 4MSMB 2G1EA 2KLCA 4RGMA 3PHXB 2GI9A 1VRAB 3W1SC 2G45B 4WJPA 1EO6A 1FXIA 1M4VA 3BWUD 4BBNF 3M63B 3CMMB 3M3JA 4EZJA 1EF1A 1T0RC 3QCAA 2KYWA 3SU8X 4IC7B 4HDQA 3KYDD 2C7HA 4LNKA 3OAWA 4GDLB 3RNAC 2K9XA 3VH4B 1WJ4A 3A4SC 2BQQA 3QQ8B 2KK8A 2JZZA 1FPYA 2HJ1A 3AE6B 3JW0X 4FN2A 1WGDA 4ZHPA 3NVZA 4I6PA 2SEBD 3OJ4B 3VUXA 3W2DA 3W9CB 3ZO5B 2LVQA 1M94A 5EDSA 5DCNA 4FXCA 2HTHA 3EECA 3BIID 4RM9A 4HKQA 1TBEA 1T0YA 2QILA 3AN1A 5E6PA 4TV3A 2XEWA 3R7RA 5JH5C 1K51A 5AEKB 2WXLA 5LXIB 4J6IA 1YN4A 1KF6B 3PPAA 1HTOA 3VRAB 2PE9A 4HWIB 3EC8A 2ZNVC 5KHOA 4ANWA 1EU4A 1T3QA 1HZ6A 3T8MA 4W9LA 2WXQA 4AJWA 3ZKJC 4MGZE 2EMSA 3N1YC 2O6VA 1ENFA 4RF0A 4K3CA 1OQQA 4HLEA 3DVGX 4FADA 5AUIA 1XLOA 1JALA 4C4VB 3H6NA 3EUB2 3K9OB 4GSWA 3OLMD 3TJPA 2KWVB 2PEAA 3NS1A 2REXA 2ZVNA 3V3XA 1OQYA 3A1QA 2L05A 1WRIA 4GDKA 2NPTB 2R2QA 2N9EB 2KFKA 1F2RI 1GC6A 2KZRA 2EMTA 2BB5A 1TY0A 1VCBA 5CX3A 1XF5L 2WU5B 4C7ZA 3NZSA 1S3SG 1JWAD 2MRPA 4RCOA 3IVFA 2LI5A 2B76B 3URYA 4KIKA 4MGYE 3MJ5A 3V6CB 1HE8A 3NVYA 2WU2B 2PPHA 1CZPA 1C3TA 3PLUA 4TMAB 2JRHA 1I4QA 3IAM1 3HM6X 4W9EA 1E0ZA 4UDUC 2JF5A 2JT4B 3KUZA 3Q14C 4MEMA 2WXMA 2NBUA 2RDBC 3IXSA 4IDIA 3ZVVA 2WQYB 1KFYB 2V3NA 4US8A 2L00B 3AEEB 4DDGD 1WMHA 3RD2A 1GAQB 4FJYA 3AEFB 1FFUA 1WX8A 5D2MB 4FULA 5BYSA 4ARCA 3VUWA 4NAMA 3Q3JA 1J8CA 3RMKC 1QLBB 3JYUA 1LXDA 4W9IA 3PREA 1C76A 4ZOHC 2PVOD 1ET6A 1L4ZB 1V1OA 2W9NA 1IUEA 2K25A 4HXDA 1YQ4B 4WURA 4L1BA 1EUVB 4NJCA 4URKA 2VZKD 1KTKA 1WJ6A 4S17A 3DHHC 5LXHA 4LCDE 1I4GA 1VZ6A 3A9KB 2WYQA 2LGIA 4H2AA 3ZRCA 4WWPA 2IYDB 2V9HA 5JHBA 3CSFA 1NI3A 5BMHA 4DXFA 2KMCA 4W9JA 2RMMA 1N5XA 1TKEA 3AXCA 4USAA 2J7QB 3JSVB 2KDEB 1TZOA 4S0RA 1FIQA 1STEA 3QWZB 4GLSC 4F8CB 4BOSC 3MFGA 4PYZA 4M0WA 2N9LA 3A1QB 3ZNGC 4PT5A 2YEPF 3ZXVA 2GB1A 3U7DA 4IWPA 2ZW0A 1PGAA 2KMAA 4NQKE 2K6DB 1GB1A 1WH3A 2KVZA 4A90A 4NQLB 2XN9C 4ZYSA 2WXHA 2Y5CA 3V6EB 4A3OA 2M19A 1MG4A 1SXTA 3VR8B 3UI3A 2PW9A 3U7ZA 2IDYA 2INPE 2RGFA 1PFDA 2FUG1 1UF0A 3WALA 2PE6B 1L6UA 2AEHA 2KDMA 3B0AA 4IM0A 2WDRB 5HG2A 4M8MA 1SJHD 1K8RB 4QAYA 2ZNVB 4LDTD 1E7VA 1SF0A 4NNJB 2FCSA 1IBXB 1NYQA 1OEYA 1RM6C 2BVCA 1I7HA 2K22A 2N9PC 1WIAA 3H9DA 2AL3A 3U2SC 4FA6A 4MJSB 4P16A 3M62B 4X57B 1TTNA 4LDTB 1C9FA 4G0NB 4CYEA 2L7RA 4K81A 1PUTA 1XT9B 2JPHA 2LRWA 1UD7A 2UYZB 3ZNZB 3VH3B 4XGAB 4KX6B 3GB1A 3PRPB 3I63C 3U30A 1C78A 1WX7A 2WXRA 2J42A 1WYGA 3ZW3A 2RSUA 2E6XA 2N7DA 2DBYA 3Q3FA 3X23A 3BK2A 2BKFA 1P0RA 4M02A 1DOIA 2I1KA 4GU2A 1D6EC 4YSYB 1SE4A 2MJEA 3HRDD 3VTUA 4BKSA 1TS2A 4LNNA 3ZJVA 2JYTA 3FILA 2KKCA 5C3JB 4NAWA 3PRZA 1F2RC 3RZFA 2KO3A 1Q0WB 2N4FA 1TS3A 2Y5PA 2WDTB 2MX2A 5FK9C 1T6BX 1I4HA 1R4MI 2LZ6A 2VH1A 1HA5A 2LXAA 2YVCA 2YEPB 4WWOA 2Z59B 1FO4A 2ASQA 2K8BA 2MBHA 2MSED 1ZDVA 1FCCC 1Z5SB 4L23A 1XLQA 1YN3A 3V05A 1FRDA 5HFYA 2N1WA 3AEBB 4HRSA 3RUIB 5JHAA 4ZRQA 2NTTA 3H7PA 4N6EB 1EU3A 4K7WA 2JYEA 5I4DA 1T0QC 2N7JA 3UIOB 2INNE 4MM3B 4HCNB 2WX1A 1WE6A 2I38A 2IPKD 1SSNA 3N1ZC 1JCKB 3PT2B 3R66C 1E8ZA 1E6EB 3IHPC 1V1PB 4I6NB 3RPFC 3A9JA 1ROEA 4B6WA 4F7ZA 2ZPNA 5DPTA 4M8NA 1JQ4A 2IY0B 1JRPA 3L16A 1WF9A
chains in the Genus database with same CATH topology
1R7SA 4WIPA 3NVZA 3W5UB 4ZHPA 2SEBD 3BK1A 5EE9A 3ZGZA 3W2DA 1DYQA 3T3NA 1FMAD 3W9CB 1FM0D 2KAJA 3E56A 3T3OA 2PMVA 2IGDA 1TJEA 2W55A 4FXCA 1BUIC 4HKQA 2DLBA 3BIID 1GPXA 1CK1A 1UWMA 4IKGA 2HDEA 1L4DB 1E7PB 1OFFA 3CIRB 1HXYD 2QILA 3B2GA 3AN1A 3HVZA 2WNMA 4ZRPA 3WCQA 1IGCA 4LTUA 1K52A 1K51A 5JXVA 2ICIA 2WXLA 3IAS1 1YN4A 1ZUD2 1KF6B 1CJEA 1Y56A 3MP9A 3VRAB 4HJGE 2I2YA 3NUHB 5LNK1 2IGGA 5EE3A 5TSSA 1YQ3B 3Q69A 1EU4A 1T3QA 3AE8B 1HZ6A 1JW9D 4RH6A 3P4QB 1YJIA 2BW2A 2HTME 2AQ1B 1AYFA 2WXQA 4LK0M 2WXFA 2CJOA 2PLPA 3VRBB 2W82A 1ZXIA 4HEA1 3ZJUA 2J4XA 4A8XC 1ENFA 4RF0A 1OQQA 4JWSC 1VR9A 2Q5WD 3GP7A 4Q2JA 5AUIA 3U52E 1XLOA 1JALA 3DWGC 4KGSA 3EUB2 3ZYYX 2OEDA 2IJ0A 3NS1A 1WSPA 4KKJA 3V3XA 3VQIA 4OHJA 4WWMA 1WRIA 1K53A 1TYGB 1HZ5A 2M0AA 1VDVA 2ON8A 3P63A 3AE1B 3TEXA 3W1SA 1F2RI 1ESFA 1ZP0B 1QF6A 2BB5A 1UWXA 1TY0A 3W5VB 3U4EG 1N62A 1A70A 2SAKA 4B0EA 1XF5L 4A55A 3MC0B 2WU5B 1L5PA 4MT5A 4C7ZA 4RGNA 1WGKA 1XO3A 1JWAD 3FC4A 4RCOA 5EE0A 2V0GA 2OHFA 1D5ZC 3ETRA 2B76B 2Z8LA 2LJIA 3URYA 5MPOA 5HHDG 4RFBA 2WXGA 2JU6X 2DYMA 2GRIA 2FE8A 3LXFA 3MJ5A 2BBCA 3NVYA 2WU2B 4WAFA 2L83A 2K0PA 1CZPA 2V3PA 3NRZA 4XDCA 2LHDA 5GXGB 1SEBD 2JWUA 4TMAB 3L4PA 4JPSA 3R2TA 1VZ7A 1FRRA 1I4QA 1AN8A 2WLBA 1I4PA 2WXJA 1RWSA 4N59A 3IAM1 4REZA 1ET9A 1E0ZA 1FXAA 4UDUC 5D7GA 5BYQA 3B2FA 1QOFA 2PVGC 2WXMA 3IXSA 4IDIA 1WWTA 2RDHA 2WQYB 1XCQL 1KFYB 2KN4A 2V3NA 3B9JA 1E10A 4US8A 5C2TB 3AEEB 2W3RA 3J9CA 1ZPSA 1DOXA 2RDGA 3TSSA 1NVID 1ZXHA 1GAQB 3ABVB 2X38A 5BYSA 3AEFB 1FFUA 4ARCA 4NAMA 1QLBB 4TQ1A 4WH4A 3KWLA 1L0VB 2WXPA 1EM7A 2V4IB 1C77A 1QT9A 1C76A 2AQ3B 4ZOHC 1K50A 2PVOD 1ET6A 1L4ZB 3OWEB 1V1OA 1V8CA 1IUEA 2ONQA 3P4SB 4XDDA 4KGRA 5D3IB 3SR6A 3E9SA 1YQ4B 4WURA 4P6VF 4L1BA 4NZLB 3BVZA 3P1MA 4XWTA 3HVDA 3O13A 1FFVA 1J7CA 4NJCA 1MHXA 1ZDXA 5AUKA 2MJ3A 2VZKD 1KTKA 1HQRD 3SEBA 2H88B 3BVMA 3AM9A 1J7AA 4HROA 1B9RA 3AH7A 1I4XA 3VR9B 3Q8BA 2IGHA 1KH0A 4TSSA 2R61A 5T8IA 4C56C 1JMLA 1I4GA 1JROA 1VZ6A 2LGIA 3H8HA 4H2AA 2K3UA 2NTSA 1QQRA 4O1NA 4YTNB 3AEAB 1N5WA 3P42A 1NI3A 5BMHA 2KMMA 4DXFA 1GB4A 2RMMA 1N5XA 1TKEA 2BB6A 5HI1A 4USAA 1XEEA 1N60A 3KWVA 1VZ8A 3AE5B 1FNVA 2NMQA 3EGRA 3AMZA 4OW0A 1JWSD 1TZOA 2L52A 3AECB 2LFIA 1FIQA 1STEA 1YJJA 1JWBD 2AX5A 2W3SA 4GLSC 1FCLA 3MFGA 2JQRB 1WXQA 2W54A 2CJNA 2N9LA 3KQ4A 4M0WA 3NZ3A 2YEPF 1C4PA 4PT5A 3Q8EA 2ZW1A 3AE7B 2GB1A 2RPVA 3PO0A 2EELA 2ZW0A 1PGAA 1HEZE 1KLUD 1UUPA 2LMCA 3DWMA 2QEJC 3NVWA 1B1ZA 2M56B 3P4PB 1QOAA 2QJLA 4AS1A 1GB1A 2QMTA 4A90A 2CU3A 4XWWA 4OZBA 4L2YA 2XN9C 3TUOA 4ZYSA 1ACCA 4DXGA 3NVVA 1QILA 2BS2B 4GDKB 2WXHA 2Y5CA 4B0MA 2M19A 3AE9B 3Q8AA 1SXTA 3VR8B 3FILB 3UI3A 2J52A 2PW9A 1TKYA 4MACA 3U7ZA 2IDYA 4CQNA 1N63A 1PYWD 1D5XC 1L0YB 1J7BA 3IT6B 1V1PA 1QOGA 2INPE 1PFDA 2FUG1 1FEHA 1QOBA 1NYRA 3AEDB 3C8YA 1L6UA 2JZPA 2WXKA 5D3DA 4C7YA 2AQ2B 2WXOA 1F0ZA 1PGBA 1JWMD 1YN5A 2KDMA 4OZAA 3P4RB 1MPEA 4C80A 1JWUD 2WDRB 2L32A 5HG2A 4HKZE 4D2KA 4YTMB 1SJHD 1N61A 2PIAA 5G5HA 3GS2A 2DYOA 4NAWB 2TSSA 1UNSA 4JWUC 3BYYB 1NEKB 1SF0A 3AV8A 1P7EA 1L6VA 2DWQA 4XE0A 3ZQ4A 1NYQA 1IBXB 4OZCA 1SB3C 4YWGG 3R8BA 1RM6C 1FNUA 3TEWA 1EWYC 1I7HA 1PDXA 2K22A 3SFEB 4RGTA 1I4RA 4N58A 1IGDA 1ZE3D 3U2SC 1KLGD 3N9YC 4P16A 1OQRA 1C4CA 3ZJTA 1C9FA 3SFDB 4ZHOA 4US9A 2KQ4X 3EA6A 4ITKA 4EE2A 1EWCA 1LO5D 1SBBB 2WDQB 1PUTA 3I57A 3CWIA 3AE4B 1D5MC 1F77A 3BVGA 2JX5A 1XCTL 4KKIA 4KX6B 5G5GA 4YXDB 2BYTA 2WXNA 3GB1A 3TEZA 1MHHE 5EE1A 1IBXA 4DQOC 1C78A 3IT4B 2WXRA 2J42A 1WYGA 2LEKA 2BTEA 3R2IA 4AQ7A 1FNWA 1C79A 3I9V1 4JX1C 2PTLA 3AB5A 5FKAC 2E6XA 1TKGA 4YT0B 2VZKB 3LB8C 1P7FA 1TY2A 2QIEB 4A6QA 1V97A 1DOYA 1KRHA 2DBYA 2N9KA 1TS4A 3BK2A 3PZ8A 1DOIA 2MJDA 4J3OD 1D6EC 2XNAC 1BXTA 4YSYB 1SE4A 2WP9B 4WQMA 2BT6A 3LYYA 1CQVA 2K5PA 2MJEA 3HRDD 2ACZB 4ARIA 1VLBA 5FR3A 1TS2A 1DGJA 1GOZA 3ZJVA 2JYTA 3FILA 1SJED 2Y3AA 3HUIA 4MH8A 5C3JB 2L1AA 3BYTB 1MVKA 1F2RC 4YTPB 3KLSX 1TS5A 1RYJA 4KGTA 1E9MA 2H89B 1YMHE 1MI0A 3FAHA 1TS3A 1AW7A 2Y5PA 2EKIA 4YSZB 4LLGM 1AWDA 5FK9C 1T6BX 1T5XD 3Q8FA 1I4HA 1FD6A 5BYRA 2WS3B 5H92C 2KACA 1HA5A 2BS3B 1VJKA 2KWDA 3AE2B 2LUMA 2YEPB 3AE3B 1PGXA 4RF1A 1FO4A 1BMLC 2FBWB 1UGJA 4R3DA 2MEKA 1XLNA 5H8YE 4YSXB 1SIJA 1L0XB 2WXIA 1NENB 1ZDVA 1FCCC 2MH7A 1SE3A 4L23A 1XLQA 1YN3A 3V05A 1FRDA 3RFZB 5HFYA 1QKZA 3AEBB 2WDVB 4HRSA 4ZRQA 2NTTA 2QSDA 2G1EA 4N6EB 4A9AA 1EU3A 1YNTE 2JYEA 5I4DA 2N7JA 2E3TA 2D5GA 2INNE 1C4AA 4RGMA 2JSVX 4MM3B 2GI9A 1VRAB 1XXGA 2G9HD 2BS4B 2I38A 3Q8CA 1XLPA 2IPKD 2J53A 1FXIA 2N0SB 1M4VA 1SSNA 1Q10A 3BWUD 1JCKB 5E6JA 3TEYA 4IOIE 3MHZA 1E6EB 1D4BA 1V1PB 3RPFC 2JXTA 4RNAA 1ROEA 4GDLB 3BZDB 5BMGA 1SE2A 2K9XA 3PZ7A 4TQ0A 2PKOA 1RFKA 4RGOS 1JQ4A 3AEGB 1ZOYB 3AE6B 2LHEA 1JRPA 5BMIA 4OVZA 4JE3B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PZ8 A;  2D5G A;  4WIP A;  3PZ7 A;  1WSP A; 
#chains in the Genus database with same CATH topology
 4WIP A;  4WJN A;  3X0W A;  3T3N A;  1FMA D;  1N6Z A;  5CTR C;  5GMV A;  2D2Q A;  1RAX A;  4E3C A;  3T3O A;  2PMV A;  1TJE A;  2W55 A;  3PLV A;  2DLB A;  1GPX A;  1UWM A;  4ZRJ A;  1L4D B;  1E7P B;  1OFF A;  3IG3 A;  3B2G A;  2WNM A;  4ZRP A;  4WJQ A;  3NJT A;  2K39 A;  3L0W B;  4IM3 A;  1WM2 A;  5JXV A;  1ZUD 2;  4NY0 A;  3NUH B;  3C0R B;  2IGG A;  2GBN A;  1WGR A;  5EE3 A;  5TSS A;  3AUL A;  3VFK A;  3Q69 A;  2A4Z A;  4BKG A;  4EZL A;  1WR6 E;  2AQ1 B;  3PVL A;  1AYF A;  4LK0 M;  2CJO A;  2PLP A;  2W82 A;  4BAX A;  3NZU A;  1ZXI A;  3QX1 A;  4MEL A;  2C5L C;  3TMP B;  4A8X C;  3RCZ A;  3RNB C;  1VR9 A;  2Q5W D;  1V80 A;  3DWG C;  2OED A;  2C9W B;  2QC8 A;  1WSP A;  4EKU A;  3CST A;  4OHJ A;  1ZKH A;  4WWM A;  4WAA A;  1H4R A;  3RT3 B;  1K53 A;  1TYG B;  2KTR A;  3UGB B;  3DPD A;  4LNO A;  3AE1 B;  3TEX A;  2OJW A;  3Q3M C;  1ZP0 B;  3KUD B;  1UWX A;  5CHV C;  3W5V B;  1N62 A;  2M0X A;  2NBW B;  1WGK A;  2ZCC A;  3QA8 A;  2ZVO A;  2OHF A;  2Z8L A;  5MPO A;  4BFR A;  1R4N I;  4N9F 4;  2GBM A;  5BO4 B;  3R7Q A;  3DHI C;  2L83 A;  2V3P A;  3SDL C;  2JWU A;  3L4P A;  1X1M A;  1V86 A;  2IND C;  3ML8 A;  1LFD A;  1AN8 A;  4REZ A;  1V81 A;  2V4L A;  1UEL A;  3GE3 C;  5BYQ A;  4ACF A;  1SE9 A;  2PVG C;  4ZDV A;  1IPG A;  1WWT A;  2BYE A;  3B9J A;  5LLI A;  1E10 A;  2BWE S;  3I3T B;  2LGD A;  3TSS A;  2JXX A;  1ZXH A;  4JQW C;  4GN1 A;  2X38 A;  3FKY A;  4WH4 A;  3KWL A;  2WXP A;  3QHT A;  1EM7 A;  2DYB A;  3TBL D;  1QT9 A;  4P1C C;  1F9J A;  1K50 A;  3OWE B;  4KGR A;  5D3I B;  4MJS A;  4P6V F;  4NZL B;  4XWT A;  3O13 A;  4FHJ A;  3ZXR A;  1MHX A;  1ZDX A;  1E8W A;  2MJ3 A;  5AZH A;  1HQR D;  3SEB A;  2H88 B;  2FAZ A;  1U4A A;  3AH7 A;  3UF8 A;  3APD A;  4HPP A;  4NJ7 A;  4PYU A;  4WJO A;  1JRO A;  2PJH A;  5J18 A;  3H8H A;  3D32 A;  2K3U A;  1YQB A;  4O1N A;  2LD9 A;  3AEA B;  5IOI A;  3P42 A;  2CHW A;  2D11 A;  2BB6 A;  2B3A A;  3VAW A;  3HIZ A;  3KWV A;  1IP9 A;  2FCQ A;  4PK1 A;  1FNV A;  2MW5 A;  5IA7 A;  2NMQ A;  4OW0 A;  3DBL I;  3AEC B;  5L83 A;  4W9D A;  3UQB A;  3RUL A;  1YJJ A;  2AX5 A;  2W3S A;  1FCL A;  1Q5W B;  1WXQ A;  3KQ4 A;  1RFA A;  4MDK E;  3QC8 B;  2IO2 B;  1C4P A;  4DHZ B;  2NVU I;  1HEZ E;  1KLU D;  5D6J B;  1UUP A;  2ZEQ A;  3PSE B;  1QOA A;  4AS1 A;  4XWW A;  4LJO B;  3PHW B;  4L2Y A;  4FJZ A;  3NVV A;  2K8H A;  3Q8A A;  3FIL B;  2J52 A;  2MA9 B;  3ZDT A;  4CO7 A;  1WGH A;  3GZN B;  3K9P B;  5IN7 A;  4CQN A;  1L2N A;  4DHJ D;  1D5X C;  1L0Y B;  2XBB C;  1J7B A;  3IT6 B;  2IY1 B;  4P1B C;  3N32 A;  1FEH A;  2JZP A;  5D3D A;  1UH6 A;  2KJH B;  2AQ2 B;  2WXO A;  4OZA A;  1WZ3 A;  1JWU D;  4YTM B;  1R4N B;  3DVN V;  3DBS A;  5G5H A;  3B1L X;  3HHM A;  2TSS A;  4JWU C;  1NEK B;  2DWQ A;  4GB9 A;  4XE0 A;  2IO1 B;  3ZQ4 A;  1T0S C;  1FNU A;  2KVR A;  3UIN B;  3WAP A;  2EKE C;  1BT0 A;  3A33 B;  4AUQ C;  4OVV A;  2DZI A;  4RGT A;  4KVG B;  3ALB A;  2KFK B;  5DPW A;  2NS5 A;  2BGF A;  3M95 A;  1CMX B;  3DBR I;  3EA6 A;  4EE2 A;  1Y8R C;  1LO5 D;  2N1V A;  3RYT A;  1KJT A;  3IFW B;  1F77 A;  3BVG A;  2JX5 A;  3DBH I;  4GGQ A;  4GOC A;  4XC2 A;  4KKI A;  4KSK C;  3JSV A;  2BYT A;  4W9H A;  4LJP B;  3WIM A;  2BKR B;  3RZW C;  5EE1 A;  3VDZ A;  2DAJ A;  2KC1 A;  4KDL B;  4JX1 C;  2PTL A;  5FKA C;  2KOX A;  4DK5 A;  4EZK A;  1P3Q U;  4YT0 B;  1V49 A;  2WHI A;  4HPL B;  2FID A;  2CU1 A;  4NJ6 A;  2AYO B;  2O6V D;  1TS4 A;  2MJD A;  3PZD A;  3A9J B;  4ZRK A;  2JRI B;  2WP9 B;  4WQM A;  3LYY A;  1CQV A;  4FBJ B;  4ARI A;  3OJ3 A;  1GOZ A;  2JZ3 B;  2Y3A A;  2DZJ A;  1P9D U;  2L1A A;  2KTR B;  3BYT B;  4TUU A;  1MVK A;  3V61 A;  1I42 A;  1RYJ A;  1E9M A;  1YMH E;  1MI0 A;  1AW7 A;  1R4M B;  4YSZ B;  1AWD A;  3ENE A;  1T5X D;  3Q8F A;  1GG3 A;  1FD6 A;  5BYR A;  2WS3 B;  4HJK A;  2BS3 B;  3AE3 B;  1F52 A;  1PQS A;  4RF1 A;  4BOZ B;  4JLC A;  1JRU A;  3GOE A;  1UGJ A;  1FXT B;  1NI2 A;  2WXI A;  1NEN B;  3RFZ B;  3ZUN A;  1WY8 A;  2QSD A;  2WGS A;  1I35 A;  3JVZ X;  5IO9 A;  4W9G A;  2D5G A;  1C4A A;  2JSV X;  2UWQ A;  1XXG A;  2G9H D;  2BS4 B;  2CHZ A;  2BYF A;  4IG7 B;  3EHV A;  4CHK A;  3Q3N C;  4WQO B;  3ONS A;  5E6J A;  3MHZ A;  2IO0 B;  1D4B A;  2KNB A;  2JXT A;  3BZD B;  2O2V A;  5BMG A;  3MHS D;  2LGX A;  3ECI A;  2HE7 A;  4TQ0 A;  2PKO A;  2KHW B;  3DCG A;  3AEG B;  2KWC A;  4II3 B;  5C23 A;  1ZOY B;  2LHE A;  5BMI A;  4JE3 B;  1R7S A;  3W5U B;  3BK1 A;  5EE9 A;  3ZGZ A;  1WJN A;  3SHQ A;  2LAS A;  3O65 B;  2KAJ A;  2L3Z A;  3E56 A;  3H7P B;  3VXW A;  4K7S A;  1WXA A;  2HDE A;  1WGG A;  1HXY D;  3HVZ A;  4RM8 A;  1IGC A;  4LTU A;  4M00 A;  1Z2M A;  4DDI D;  3IAS 1;  3N20 C;  1CJE A;  4NPN A;  3MP9 A;  2ZPY A;  2MBE A;  2LRU A;  5LNK 1;  1LM8 B;  1YQ3 B;  4FJV B;  3AE8 B;  4KDI C;  3P4Q B;  2IBI B;  1YJI A;  3BIN A;  3VRB B;  2GLS A;  3R3M A;  4HEA 1;  3ZJU A;  3KUC B;  3ZRF A;  2M4N A;  3QAR A;  1ZW7 A;  4GXB A;  4JWS C;  3N3K B;  4P7I A;  4Q2J A;  1YIW A;  4KGS A;  2N9X A;  3ZYY X;  2IJ0 A;  1ISN A;  4KKJ A;  2FIF A;  3VQI A;  1IYF A;  4AJY B;  5IKC M;  4TKN A;  1YJ1 A;  1OGW A;  3P63 A;  3W1S A;  2MBO A;  1WGY A;  1QF6 A;  3U4E G;  2SAK A;  4B0E A;  4A55 A;  1L5P A;  2V1Y A;  1XO3 A;  2LXC A;  2V0G A;  2NPT A;  2LJI A;  1F1H A;  4RFB A;  2WXG A;  3UIP B;  2DYM A;  4W9F A;  4I6L B;  2FE8 A;  2KQS A;  2L8J A;  3LXF A;  2BBC A;  4G50 A;  2LGY A;  4YL8 A;  2LHD A;  5GXG B;  1SEB D;  4JPS A;  3R2T A;  3BY4 B;  1VZ7 A;  1FRR A;  1WMH B;  1I4P A;  1XD3 B;  2WLB A;  2WXJ A;  3WA0 A;  2HD5 B;  2I1J A;  1UBI A;  1FXA A;  5L95 C;  3B2F A;  4KSL C;  2VH2 A;  2C60 A;  1XCQ L;  1XQQ A;  3L17 A;  3DBL B;  3J9C A;  1VD2 A;  4ANU A;  1ZPS A;  4KIK B;  2RDG A;  2CR5 A;  1WJU A;  3Q6B A;  1RLF A;  3RNF C;  2JY6 A;  2V4I B;  1C77 A;  3AU4 A;  3PTF C;  3QAQ A;  3NG0 A;  4RMA A;  2MCN B;  3C19 A;  2KFJ A;  3BVZ A;  3P1M A;  3KW5 B;  3HVD A;  3APC A;  1KM7 A;  1YX5 B;  2K8C A;  5AUK A;  2D10 A;  2KT7 A;  2RD0 A;  5AZF A;  1GC7 A;  1H8C A;  5DPS A;  1WM3 A;  3BVM A;  2CHX A;  4MH0 E;  5E6N A;  2NBV B;  3Q8B A;  3UQA A;  4TSS A;  2KX3 A;  2R61 A;  5T8I A;  2HJ8 A;  1TT5 B;  3HK0 A;  1QQR A;  2FCN A;  3V62 A;  5DPR A;  4YTN B;  1N5W A;  2KMM A;  2OJR A;  2XK5 A;  5HI1 A;  3KH0 A;  4F1S A;  2O6V B;  3KYC D;  3ZIM A;  2LVP A;  3VUY A;  3HM3 A;  4GIV A;  1JWS D;  4IW0 A;  1NDD A;  2LFI A;  3TIX A;  3RNG C;  1MG8 A;  5D94 A;  1JWB D;  3GE8 C;  2W54 A;  5G55 A;  4G3X B;  4ASW C;  3Q8E A;  2ZW1 A;  5IP4 D;  1C1Y B;  3PO0 A;  2EEL A;  2Z0E B;  4BBN C;  1GJZ A;  1J0G A;  3DWM A;  1B1Z A;  1V9J A;  2M56 B;  2QJL A;  3TUO A;  1ACC A;  2BS2 B;  3AE9 B;  1ZGU B;  4FHK A;  2C7N B;  1TKY A;  4MAC A;  2WWZ A;  3U8Z A;  1PYW D;  1QOG A;  3LJ3 A;  1QOB A;  1HTQ A;  3AED B;  2K6Q A;  2KLG A;  2WXK A;  3SD5 A;  1F0Z A;  2DZM A;  1JWM D;  1YN5 A;  3IBE A;  1MPE A;  2Z0D B;  4XYC A;  2L32 A;  4HKZ E;  4D2K A;  2NR2 A;  2PIA A;  2RR9 A;  4W9K A;  2DYO A;  2KXJ A;  3AV8 A;  1E8Y A;  1P7E A;  1L6V A;  4OZC A;  1SB3 C;  4YWG G;  2J0J A;  3ZLZ A;  1EWY C;  4XZ4 A;  2BF8 B;  2N7E A;  4ICU A;  3VTV A;  1Q1O A;  1I4R A;  4EOY A;  4N58 A;  4IM2 A;  2BWF A;  1ZE3 D;  3Q3O C;  1L7Y A;  3PGE A;  3SFD B;  3ZJT A;  2GBJ A;  3CF6 E;  2KQ4 X;  4KV2 A;  1EWC A;  1SBB B;  2WDQ B;  3I57 A;  3CWI A;  1OEY J;  3AE4 B;  4OVU A;  1D5M C;  4EUT A;  2LJ5 A;  4LNF A;  2GOW A;  4EFO A;  4PS3 A;  3VTW A;  1RRB A;  1XCT L;  2DZK A;  5G5G A;  4YXD B;  2UU7 A;  3DBH B;  3WAN A;  4WWN A;  1IBX A;  3IT4 B;  2MP2 A;  2LEK A;  2BTE A;  4AQ7 A;  1FNW A;  1C79 A;  4K7U A;  3I9V 1;  3AB5 A;  1YD8 U;  2JUO A;  3DVN U;  4PS7 A;  2VZK B;  2MWS B;  4MSQ B;  1P7F A;  1TY2 A;  4A6Q A;  1V97 A;  5JZE B;  3MJW A;  4MM3 A;  3PZ8 A;  1WI0 A;  4DHJ B;  4A20 A;  4HDO A;  4C4V A;  1WXM A;  2C7M B;  2D07 B;  2K5P A;  1E8X A;  1VLB A;  3L08 A;  3DHG C;  5FR3 A;  1E5W A;  1J19 A;  3HUI A;  1SJE D;  4MH8 A;  2D3A A;  3KLS X;  3L13 A;  2A5U A;  2GBR A;  1WYW B;  4ANX A;  1E90 A;  3DQV A;  3PRM B;  5H92 C;  1OTR B;  2KAC A;  1KOT A;  2QHO A;  3AE2 B;  1PGX A;  3ZTD A;  2MEK A;  5H8Y E;  1SIJ A;  1D3Z A;  1SE3 A;  2MH7 A;  3I5J C;  1LQB A;  4IUM B;  2KJR A;  2WDV B;  1SGH A;  4A9A A;  1YNT E;  2E3T A;  2RPQ A;  3DOW A;  4GMV A;  2MBB B;  3Q8C A;  4ICV A;  1XLP A;  2N0S B;  2J53 A;  2KN5 A;  1Q10 A;  4G11 A;  2DEN B;  2ZJD A;  4BZA A;  3TEY A;  4IOI E;  2ZZP B;  2MQJ A;  4MGK E;  4RNA A;  2L0T A;  1V6E A;  1SE2 A;  3PZ7 A;  1RFK A;  4RGO S;  2R2O A;  5C1Z A;  4HK2 A;  1WXV A;  1A5R A;  4DBG A;  1NBF C;  4OVZ A;  2V3S A;  2G4S A;  1V5O A;  1DYQ A;  1FM0 D;  4IWO A;  2IGD A;  3NS8 A;  1BUI C;  3P2B A;  4BKT A;  1CK1 A;  4IKG A;  2AWT A;  3CIR B;  3ZDM C;  3WCQ A;  2MLB A;  3AU5 A;  2J0M A;  2X8X X;  1K52 A;  2ICI A;  2QCZ A;  5CHW A;  3QIJ A;  1Y56 A;  4XX5 A;  4HJG E;  2I2Y A;  4E74 A;  1EF5 A;  3PV1 A;  1UZX B;  4AP4 C;  2IO3 B;  1WRD B;  1P98 A;  3VHT C;  1JW9 D;  4RH6 A;  5TR5 A;  5CHF A;  4II2 B;  2INC C;  2BW2 A;  2HTM E;  2WXF A;  3EFC A;  2KWU B;  2LWP A;  3DVG Y;  1YOV B;  2KC2 A;  2J4X A;  2DHZ A;  4JGH B;  3GP7 A;  2D3G A;  3U52 E;  4B9K A;  2FNJ B;  4JIO U;  4BKS D;  2L0F A;  3GZN I;  1WZ0 A;  2M8S A;  1GNU A;  1LGR A;  1HZ5 A;  2M0A A;  1SIF A;  1VDV A;  2ON8 A;  3TL5 A;  1ESF A;  1YX6 B;  1A70 A;  3MC0 B;  4MT5 A;  4RGN A;  4IWQ A;  1V2Y A;  3FC4 A;  2KX0 A;  4HCP B;  5EE0 A;  1D5Z C;  4A3P A;  3ETR A;  3H1U A;  5HHD G;  2CKH B;  2JU6 X;  2GRI A;  3H7S A;  4FLH A;  2NCN A;  4WAF A;  2BYV E;  1GUA B;  2K0P A;  3NRZ A;  3PS6 A;  4XDC A;  4ZYN A;  2LGS A;  3Q2A C;  1S1Q B;  4AWJ A;  4N59 A;  1RWS A;  1ET9 A;  5D7G A;  5J2R A;  1QOF A;  2RDH A;  2KN4 A;  5C2T B;  4K1R B;  2W3R A;  2D3C A;  4MGI E;  1DOX A;  1NVI D;  2L76 A;  4K3B A;  3ABV B;  2K1F A;  1WR1 A;  2YLM A;  5E6O A;  2FUH B;  4TQ1 A;  1L0V B;  4JL9 A;  1AAR A;  2AQ3 B;  2ZCB A;  4XDD A;  1V8C A;  2ONQ A;  3P4S B;  5HKH A;  3SR6 A;  3E9S A;  4LNI A;  3RN9 C;  4EEW A;  2QDF A;  2GMI C;  4KZ0 A;  1FFV A;  4BVU C;  1J7C A;  2JWZ A;  3NOB A;  3AM9 A;  1J7A A;  1WE7 A;  4HRO A;  1B9R A;  1I4X A;  3VR9 B;  3MC8 A;  3APF A;  1KLV A;  2IGH A;  2KD0 A;  1KH0 A;  4C56 C;  2CS4 A;  3S2A A;  1JML A;  3RNE C;  2O2V B;  3ML9 A;  2NTS A;  4B95 A;  2KDB A;  2M17 A;  3EFU A;  1GB4 A;  4DWF A;  1XEE A;  1N60 A;  1UGM A;  4M01 A;  1VZ8 A;  3AE5 B;  1E7U A;  3EGR A;  3AMZ A;  5FR6 A;  2L52 A;  2VRR B;  5J17 A;  2J0K A;  4AOF A;  2JQR B;  2CJN A;  3NZ3 A;  3N1X C;  2XK5 B;  3AE7 B;  2RPV A;  2MBQ A;  2G3Q B;  2LMC A;  3NVW A;  2QEJ C;  3ZNH B;  3P4P B;  2DAF A;  2Y5B B;  2QMT A;  2CU3 A;  4OZB A;  2KDF B;  2MHJ A;  4DXG A;  4GDK B;  1QIL A;  2IZV B;  4B0M A;  1TIF A;  1V5T A;  4ANV A;  2OOB B;  1N63 A;  3TCA A;  3WAM A;  2KAN A;  2FCM A;  3WAO A;  1V1P A;  5IAA C;  2D3B A;  2KTF A;  1NYR A;  3C8Y A;  3MTN B;  4C7Y A;  2KDI A;  3V60 A;  1PGB A;  3DDC B;  3QK0 A;  3NHE B;  3KVF B;  4DHZ E;  3P4R B;  4C80 A;  4ZRI A;  2LVO A;  1N61 A;  3NY5 A;  2GBK A;  3A9K A;  3GS2 A;  2MP2 B;  1MFW A;  3DBR B;  4NAW B;  1UNS A;  3BYY B;  1QZE A;  3R8B A;  3TEW A;  1TGZ B;  1PDX A;  3SFE B;  1G6J A;  1IGD A;  1WX9 A;  1KLG D;  2WX0 A;  3ZTC A;  1UBQ A;  3N9Y C;  1OQR A;  1C4C A;  4ZHO A;  4US9 A;  4ITK A;  1MJD A;  4HPM B;  3OG5 A;  5G2N A;  4HVB A;  3RI7 C;  2DNF A;  1TZ1 A;  2M1M A;  2WXN A;  3TEZ A;  2AL6 A;  1MHH E;  3A4R A;  4DQO C;  4DXA B;  3R2I A;  4KZC A;  1TKG A;  3AI5 A;  2JVC A;  4C00 A;  3LB8 C;  2QIE B;  1DOY A;  1KRH A;  4GDL A;  2N9K A;  3QJZ A;  5AZG A;  4J3O D;  2XNA C;  2KQ7 A;  1BXT A;  2BT6 A;  2ACZ B;  3VVW B;  1DGJ A;  2BPS A;  3B08 A;  2KJ6 A;  4M0W B;  3ZNI D;  3RNC C;  4YTP B;  1TS5 A;  3LDZ E;  4KGT A;  2H89 B;  3FAH A;  2EKI A;  3L10 B;  4LLG M;  1P1A A;  3T9L A;  3W1Y A;  4PS8 A;  1VJK A;  1WFY A;  2KWD A;  2LUM A;  4E71 A;  1BML C;  4W9C A;  2FBW B;  4R3D A;  3MC9 A;  1XLN A;  5KHQ A;  1WXS A;  4YSX B;  2G4D B;  1L0X B;  2LUE A;  3N30 A;  3L54 A;  1QKZ A;  2DX5 B;  4MSM B;  2G1E A;  2KLC A;  4RGM A;  3PHX B;  2GI9 A;  1VRA B;  3W1S C;  2G45 B;  4WJP A;  1EO6 A;  1FXI A;  1M4V A;  3BWU D;  4BBN F;  3M63 B;  3CMM B;  3M3J A;  4EZJ A;  1EF1 A;  1T0R C;  3QCA A;  2KYW A;  3SU8 X;  4IC7 B;  4HDQ A;  3KYD D;  2C7H A;  4LNK A;  3OAW A;  4GDL B;  3RNA C;  2K9X A;  3VH4 B;  1WJ4 A;  3A4S C;  2BQQ A;  3QQ8 B;  2KK8 A;  2JZZ A;  1FPY A;  2HJ1 A;  3AE6 B;  3JW0 X;  4FN2 A;  1WGD A;  4ZHP A;  3NVZ A;  4I6P A;  2SEB D;  3OJ4 B;  3VUX A;  3W2D A;  3W9C B;  3ZO5 B;  2LVQ A;  1M94 A;  5EDS A;  5DCN A;  4FXC A;  2HTH A;  3EEC A;  3BII D;  4RM9 A;  4HKQ A;  1TBE A;  1T0Y A;  2QIL A;  3AN1 A;  5E6P A;  4TV3 A;  2XEW A;  3R7R A;  5JH5 C;  1K51 A;  5AEK B;  2WXL A;  5LXI B;  4J6I A;  1YN4 A;  1KF6 B;  3PPA A;  1HTO A;  3VRA B;  2PE9 A;  4HWI B;  3EC8 A;  2ZNV C;  5KHO A;  4ANW A;  1EU4 A;  1T3Q A;  1HZ6 A;  3T8M A;  4W9L A;  2WXQ A;  4AJW A;  3ZKJ C;  4MGZ E;  2EMS A;  3N1Y C;  2O6V A;  1ENF A;  4RF0 A;  4K3C A;  1OQQ A;  4HLE A;  3DVG X;  4FAD A;  5AUI A;  1XLO A;  1JAL A;  4C4V B;  3H6N A;  3EUB 2;  3K9O B;  4GSW A;  3OLM D;  3TJP A;  2KWV B;  2PEA A;  3NS1 A;  2REX A;  2ZVN A;  3V3X A;  1OQY A;  3A1Q A;  2L05 A;  1WRI A;  4GDK A;  2NPT B;  2R2Q A;  2N9E B;  2KFK A;  1F2R I;  1GC6 A;  2KZR A;  2EMT A;  2BB5 A;  1TY0 A;  1VCB A;  5CX3 A;  1XF5 L;  2WU5 B;  4C7Z A;  3NZS A;  1S3S G;  1JWA D;  2MRP A;  4RCO A;  3IVF A;  2LI5 A;  2B76 B;  3URY A;  4KIK A;  4MGY E;  3MJ5 A;  3V6C B;  1HE8 A;  3NVY A;  2WU2 B;  2PPH A;  1CZP A;  1C3T A;  3PLU A;  4TMA B;  2JRH A;  1I4Q A;  3IAM 1;  3HM6 X;  4W9E A;  1E0Z A;  4UDU C;  2JF5 A;  2JT4 B;  3KUZ A;  3Q14 C;  4MEM A;  2WXM A;  2NBU A;  2RDB C;  3IXS A;  4IDI A;  3ZVV A;  2WQY B;  1KFY B;  2V3N A;  4US8 A;  2L00 B;  3AEE B;  4DDG D;  1WMH A;  3RD2 A;  1GAQ B;  4FJY A;  3AEF B;  1FFU A;  1WX8 A;  5D2M B;  4FUL A;  5BYS A;  4ARC A;  3VUW A;  4NAM A;  3Q3J A;  1J8C A;  3RMK C;  1QLB B;  3JYU A;  1LXD A;  4W9I A;  3PRE A;  1C76 A;  4ZOH C;  2PVO D;  1ET6 A;  1L4Z B;  1V1O A;  2W9N A;  1IUE A;  2K25 A;  4HXD A;  1YQ4 B;  4WUR A;  4L1B A;  1EUV B;  4NJC A;  4URK A;  2VZK D;  1KTK A;  1WJ6 A;  4S17 A;  3DHH C;  5LXH A;  4LCD E;  1I4G A;  1VZ6 A;  3A9K B;  2WYQ A;  2LGI A;  4H2A A;  3ZRC A;  4WWP A;  2IYD B;  2V9H A;  5JHB A;  3CSF A;  1NI3 A;  5BMH A;  4DXF A;  2KMC A;  4W9J A;  2RMM A;  1N5X A;  1TKE A;  3AXC A;  4USA A;  2J7Q B;  3JSV B;  2KDE B;  1TZO A;  4S0R A;  1FIQ A;  1STE A;  3QWZ B;  4GLS C;  4F8C B;  4BOS C;  3MFG A;  4PYZ A;  4M0W A;  2N9L A;  3A1Q B;  3ZNG C;  4PT5 A;  2YEP F;  3ZXV A;  2GB1 A;  3U7D A;  4IWP A;  2ZW0 A;  1PGA A;  2KMA A;  4NQK E;  2K6D B;  1GB1 A;  1WH3 A;  2KVZ A;  4A90 A;  4NQL B;  2XN9 C;  4ZYS A;  2WXH A;  2Y5C A;  3V6E B;  4A3O A;  2M19 A;  1MG4 A;  1SXT A;  3VR8 B;  3UI3 A;  2PW9 A;  3U7Z A;  2IDY A;  2INP E;  2RGF A;  1PFD A;  2FUG 1;  1UF0 A;  3WAL A;  2PE6 B;  1L6U A;  2AEH A;  2KDM A;  3B0A A;  4IM0 A;  2WDR B;  5HG2 A;  4M8M A;  1SJH D;  1K8R B;  4QAY A;  2ZNV B;  4LDT D;  1E7V A;  1SF0 A;  4NNJ B;  2FCS A;  1IBX B;  1NYQ A;  1OEY A;  1RM6 C;  2BVC A;  1I7H A;  2K22 A;  2N9P C;  1WIA A;  3H9D A;  2AL3 A;  3U2S C;  4FA6 A;  4MJS B;  4P16 A;  3M62 B;  4X57 B;  1TTN A;  4LDT B;  1C9F A;  4G0N B;  4CYE A;  2L7R A;  4K81 A;  1PUT A;  1XT9 B;  2JPH A;  2LRW A;  1UD7 A;  2UYZ B;  3ZNZ B;  3VH3 B;  4XGA B;  4KX6 B;  3GB1 A;  3PRP B;  3I63 C;  3U30 A;  1C78 A;  1WX7 A;  2WXR A;  2J42 A;  1WYG A;  3ZW3 A;  2RSU A;  2E6X A;  2N7D A;  2DBY A;  3Q3F A;  3X23 A;  3BK2 A;  2BKF A;  1P0R A;  4M02 A;  1DOI A;  2I1K A;  4GU2 A;  1D6E C;  4YSY B;  1SE4 A;  2MJE A;  3HRD D;  3VTU A;  4BKS A;  1TS2 A;  4LNN A;  3ZJV A;  2JYT A;  3FIL A;  2KKC A;  5C3J B;  4NAW A;  3PRZ A;  1F2R C;  3RZF A;  2KO3 A;  1Q0W B;  2N4F A;  1TS3 A;  2Y5P A;  2WDT B;  2MX2 A;  5FK9 C;  1T6B X;  1I4H A;  1R4M I;  2LZ6 A;  2VH1 A;  1HA5 A;  2LXA A;  2YVC A;  2YEP B;  4WWO A;  2Z59 B;  1FO4 A;  2ASQ A;  2K8B A;  2MBH A;  2MSE D;  1ZDV A;  1FCC C;  1Z5S B;  4L23 A;  1XLQ A;  1YN3 A;  3V05 A;  1FRD A;  5HFY A;  2N1W A;  3AEB B;  4HRS A;  3RUI B;  5JHA A;  4ZRQ A;  2NTT A;  3H7P A;  4N6E B;  1EU3 A;  4K7W A;  2JYE A;  5I4D A;  1T0Q C;  2N7J A;  3UIO B;  2INN E;  4MM3 B;  4HCN B;  2WX1 A;  1WE6 A;  2I38 A;  2IPK D;  1SSN A;  3N1Z C;  1JCK B;  3PT2 B;  3R66 C;  1E8Z A;  1E6E B;  3IHP C;  1V1P B;  4I6N B;  3RPF C;  3A9J A;  1ROE A;  4B6W A;  4F7Z A;  2ZPN A;  5DPT A;  4M8N A;  1JQ4 A;  2IY0 B;  1JRP A;  3L16 A;  1WF9 A; 
#chains in the Genus database with same CATH homology
 1R7S A;  4WIP A;  3NVZ A;  3W5U B;  4ZHP A;  2SEB D;  3BK1 A;  5EE9 A;  3ZGZ A;  3W2D A;  1DYQ A;  3T3N A;  1FMA D;  3W9C B;  1FM0 D;  2KAJ A;  3E56 A;  3T3O A;  2PMV A;  2IGD A;  1TJE A;  2W55 A;  4FXC A;  1BUI C;  4HKQ A;  2DLB A;  3BII D;  1GPX A;  1CK1 A;  1UWM A;  4IKG A;  2HDE A;  1L4D B;  1E7P B;  1OFF A;  3CIR B;  1HXY D;  2QIL A;  3B2G A;  3AN1 A;  3HVZ A;  2WNM A;  4ZRP A;  3WCQ A;  1IGC A;  4LTU A;  1K52 A;  1K51 A;  5JXV A;  2ICI A;  2WXL A;  3IAS 1;  1YN4 A;  1ZUD 2;  1KF6 B;  1CJE A;  1Y56 A;  3MP9 A;  3VRA B;  4HJG E;  2I2Y A;  3NUH B;  5LNK 1;  2IGG A;  5EE3 A;  5TSS A;  1YQ3 B;  3Q69 A;  1EU4 A;  1T3Q A;  3AE8 B;  1HZ6 A;  1JW9 D;  4RH6 A;  3P4Q B;  1YJI A;  2BW2 A;  2HTM E;  2AQ1 B;  1AYF A;  2WXQ A;  4LK0 M;  2WXF A;  2CJO A;  2PLP A;  3VRB B;  2W82 A;  1ZXI A;  4HEA 1;  3ZJU A;  2J4X A;  4A8X C;  1ENF A;  4RF0 A;  1OQQ A;  4JWS C;  1VR9 A;  2Q5W D;  3GP7 A;  4Q2J A;  5AUI A;  3U52 E;  1XLO A;  1JAL A;  3DWG C;  4KGS A;  3EUB 2;  3ZYY X;  2OED A;  2IJ0 A;  3NS1 A;  1WSP A;  4KKJ A;  3V3X A;  3VQI A;  4OHJ A;  4WWM A;  1WRI A;  1K53 A;  1TYG B;  1HZ5 A;  2M0A A;  1VDV A;  2ON8 A;  3P63 A;  3AE1 B;  3TEX A;  3W1S A;  1F2R I;  1ESF A;  1ZP0 B;  1QF6 A;  2BB5 A;  1UWX A;  1TY0 A;  3W5V B;  3U4E G;  1N62 A;  1A70 A;  2SAK A;  4B0E A;  1XF5 L;  4A55 A;  3MC0 B;  2WU5 B;  1L5P A;  4MT5 A;  4C7Z A;  4RGN A;  1WGK A;  1XO3 A;  1JWA D;  3FC4 A;  4RCO A;  5EE0 A;  2V0G A;  2OHF A;  1D5Z C;  3ETR A;  2B76 B;  2Z8L A;  2LJI A;  3URY A;  5MPO A;  5HHD G;  4RFB A;  2WXG A;  2JU6 X;  2DYM A;  2GRI A;  2FE8 A;  3LXF A;  3MJ5 A;  2BBC A;  3NVY A;  2WU2 B;  4WAF A;  2L83 A;  2K0P A;  1CZP A;  2V3P A;  3NRZ A;  4XDC A;  2LHD A;  5GXG B;  1SEB D;  2JWU A;  4TMA B;  3L4P A;  4JPS A;  3R2T A;  1VZ7 A;  1FRR A;  1I4Q A;  1AN8 A;  2WLB A;  1I4P A;  2WXJ A;  1RWS A;  4N59 A;  3IAM 1;  4REZ A;  1ET9 A;  1E0Z A;  1FXA A;  4UDU C;  5D7G A;  5BYQ A;  3B2F A;  1QOF A;  2PVG C;  2WXM A;  3IXS A;  4IDI A;  1WWT A;  2RDH A;  2WQY B;  1XCQ L;  1KFY B;  2KN4 A;  2V3N A;  3B9J A;  1E10 A;  4US8 A;  5C2T B;  3AEE B;  2W3R A;  3J9C A;  1ZPS A;  1DOX A;  2RDG A;  3TSS A;  1NVI D;  1ZXH A;  1GAQ B;  3ABV B;  2X38 A;  5BYS A;  3AEF B;  1FFU A;  4ARC A;  4NAM A;  1QLB B;  4TQ1 A;  4WH4 A;  3KWL A;  1L0V B;  2WXP A;  1EM7 A;  2V4I B;  1C77 A;  1QT9 A;  1C76 A;  2AQ3 B;  4ZOH C;  1K50 A;  2PVO D;  1ET6 A;  1L4Z B;  3OWE B;  1V1O A;  1V8C A;  1IUE A;  2ONQ A;  3P4S B;  4XDD A;  4KGR A;  5D3I B;  3SR6 A;  3E9S A;  1YQ4 B;  4WUR A;  4P6V F;  4L1B A;  4NZL B;  3BVZ A;  3P1M A;  4XWT A;  3HVD A;  3O13 A;  1FFV A;  1J7C A;  4NJC A;  1MHX A;  1ZDX A;  5AUK A;  2MJ3 A;  2VZK D;  1KTK A;  1HQR D;  3SEB A;  2H88 B;  3BVM A;  3AM9 A;  1J7A A;  4HRO A;  1B9R A;  3AH7 A;  1I4X A;  3VR9 B;  3Q8B A;  2IGH A;  1KH0 A;  4TSS A;  2R61 A;  5T8I A;  4C56 C;  1JML A;  1I4G A;  1JRO A;  1VZ6 A;  2LGI A;  3H8H A;  4H2A A;  2K3U A;  2NTS A;  1QQR A;  4O1N A;  4YTN B;  3AEA B;  1N5W A;  3P42 A;  1NI3 A;  5BMH A;  2KMM A;  4DXF A;  1GB4 A;  2RMM A;  1N5X A;  1TKE A;  2BB6 A;  5HI1 A;  4USA A;  1XEE A;  1N60 A;  3KWV A;  1VZ8 A;  3AE5 B;  1FNV A;  2NMQ A;  3EGR A;  3AMZ A;  4OW0 A;  1JWS D;  1TZO A;  2L52 A;  3AEC B;  2LFI A;  1FIQ A;  1STE A;  1YJJ A;  1JWB D;  2AX5 A;  2W3S A;  4GLS C;  1FCL A;  3MFG A;  2JQR B;  1WXQ A;  2W54 A;  2CJN A;  2N9L A;  3KQ4 A;  4M0W A;  3NZ3 A;  2YEP F;  1C4P A;  4PT5 A;  3Q8E A;  2ZW1 A;  3AE7 B;  2GB1 A;  2RPV A;  3PO0 A;  2EEL A;  2ZW0 A;  1PGA A;  1HEZ E;  1KLU D;  1UUP A;  2LMC A;  3DWM A;  2QEJ C;  3NVW A;  1B1Z A;  2M56 B;  3P4P B;  1QOA A;  2QJL A;  4AS1 A;  1GB1 A;  2QMT A;  4A90 A;  2CU3 A;  4XWW A;  4OZB A;  4L2Y A;  2XN9 C;  3TUO A;  4ZYS A;  1ACC A;  4DXG A;  3NVV A;  1QIL A;  2BS2 B;  4GDK B;  2WXH A;  2Y5C A;  4B0M A;  2M19 A;  3AE9 B;  3Q8A A;  1SXT A;  3VR8 B;  3FIL B;  3UI3 A;  2J52 A;  2PW9 A;  1TKY A;  4MAC A;  3U7Z A;  2IDY A;  4CQN A;  1N63 A;  1PYW D;  1D5X C;  1L0Y B;  1J7B A;  3IT6 B;  1V1P A;  1QOG A;  2INP E;  1PFD A;  2FUG 1;  1FEH A;  1QOB A;  1NYR A;  3AED B;  3C8Y A;  1L6U A;  2JZP A;  2WXK A;  5D3D A;  4C7Y A;  2AQ2 B;  2WXO A;  1F0Z A;  1PGB A;  1JWM D;  1YN5 A;  2KDM A;  4OZA A;  3P4R B;  1MPE A;  4C80 A;  1JWU D;  2WDR B;  2L32 A;  5HG2 A;  4HKZ E;  4D2K A;  4YTM B;  1SJH D;  1N61 A;  2PIA A;  5G5H A;  3GS2 A;  2DYO A;  4NAW B;  2TSS A;  1UNS A;  4JWU C;  3BYY B;  1NEK B;  1SF0 A;  3AV8 A;  1P7E A;  1L6V A;  2DWQ A;  4XE0 A;  3ZQ4 A;  1NYQ A;  1IBX B;  4OZC A;  1SB3 C;  4YWG G;  3R8B A;  1RM6 C;  1FNU A;  3TEW A;  1EWY C;  1I7H A;  1PDX A;  2K22 A;  3SFE B;  4RGT A;  1I4R A;  4N58 A;  1IGD A;  1ZE3 D;  3U2S C;  1KLG D;  3N9Y C;  4P16 A;  1OQR A;  1C4C A;  3ZJT A;  1C9F A;  3SFD B;  4ZHO A;  4US9 A;  2KQ4 X;  3EA6 A;  4ITK A;  4EE2 A;  1EWC A;  1LO5 D;  1SBB B;  2WDQ B;  1PUT A;  3I57 A;  3CWI A;  3AE4 B;  1D5M C;  1F77 A;  3BVG A;  2JX5 A;  1XCT L;  4KKI A;  4KX6 B;  5G5G A;  4YXD B;  2BYT A;  2WXN A;  3GB1 A;  3TEZ A;  1MHH E;  5EE1 A;  1IBX A;  4DQO C;  1C78 A;  3IT4 B;  2WXR A;  2J42 A;  1WYG A;  2LEK A;  2BTE A;  3R2I A;  4AQ7 A;  1FNW A;  1C79 A;  3I9V 1;  4JX1 C;  2PTL A;  3AB5 A;  5FKA C;  2E6X A;  1TKG A;  4YT0 B;  2VZK B;  3LB8 C;  1P7F A;  1TY2 A;  2QIE B;  4A6Q A;  1V97 A;  1DOY A;  1KRH A;  2DBY A;  2N9K A;  1TS4 A;  3BK2 A;  3PZ8 A;  1DOI A;  2MJD A;  4J3O D;  1D6E C;  2XNA C;  1BXT A;  4YSY B;  1SE4 A;  2WP9 B;  4WQM A;  2BT6 A;  3LYY A;  1CQV A;  2K5P A;  2MJE A;  3HRD D;  2ACZ B;  4ARI A;  1VLB A;  5FR3 A;  1TS2 A;  1DGJ A;  1GOZ A;  3ZJV A;  2JYT A;  3FIL A;  1SJE D;  2Y3A A;  3HUI A;  4MH8 A;  5C3J B;  2L1A A;  3BYT B;  1MVK A;  1F2R C;  4YTP B;  3KLS X;  1TS5 A;  1RYJ A;  4KGT A;  1E9M A;  2H89 B;  1YMH E;  1MI0 A;  3FAH A;  1TS3 A;  1AW7 A;  2Y5P A;  2EKI A;  4YSZ B;  4LLG M;  1AWD A;  5FK9 C;  1T6B X;  1T5X D;  3Q8F A;  1I4H A;  1FD6 A;  5BYR A;  2WS3 B;  5H92 C;  2KAC A;  1HA5 A;  2BS3 B;  1VJK A;  2KWD A;  3AE2 B;  2LUM A;  2YEP B;  3AE3 B;  1PGX A;  4RF1 A;  1FO4 A;  1BML C;  2FBW B;  1UGJ A;  4R3D A;  2MEK A;  1XLN A;  5H8Y E;  4YSX B;  1SIJ A;  1L0X B;  2WXI A;  1NEN B;  1ZDV A;  1FCC C;  2MH7 A;  1SE3 A;  4L23 A;  1XLQ A;  1YN3 A;  3V05 A;  1FRD A;  3RFZ B;  5HFY A;  1QKZ A;  3AEB B;  2WDV B;  4HRS A;  4ZRQ A;  2NTT A;  2QSD A;  2G1E A;  4N6E B;  4A9A A;  1EU3 A;  1YNT E;  2JYE A;  5I4D A;  2N7J A;  2E3T A;  2D5G A;  2INN E;  1C4A A;  4RGM A;  2JSV X;  4MM3 B;  2GI9 A;  1VRA B;  1XXG A;  2G9H D;  2BS4 B;  2I38 A;  3Q8C A;  1XLP A;  2IPK D;  2J53 A;  1FXI A;  2N0S B;  1M4V A;  1SSN A;  1Q10 A;  3BWU D;  1JCK B;  5E6J A;  3TEY A;  4IOI E;  3MHZ A;  1E6E B;  1D4B A;  1V1P B;  3RPF C;  2JXT A;  4RNA A;  1ROE A;  4GDL B;  3BZD B;  5BMG A;  1SE2 A;  2K9X A;  3PZ7 A;  4TQ0 A;  2PKO A;  1RFK A;  4RGO S;  1JQ4 A;  3AEG B;  1ZOY B;  3AE6 B;  2LHE A;  1JRP A;  5BMI A;  4OVZ A;  4JE3 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...