2D5GA

Structure of ubiquitin fold protein r767e mutant
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
83
structure length
83
Chain Sequence
CDSIVVAYYFCGEPIPYETLVRGRAVTLGQFKELLTKKGSYRYYFKKVSDEFDCGVVFEEVREDEAILPVFEEKIIGKVEKVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of ubiquitin fold protein R767E mutant
rcsb
source organism Rattus norvegicus
molecule tags Signaling protein
molecule keywords Axin-1
total genus 16
structure length 83
sequence length 83
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2005-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00778 DIX DIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.380 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2d5gA00
1WSPA 2D5GA 4WIPA 3PZ8A 3PZ7A
chains in the Genus database with same CATH superfamily
4MH0E 3PZ8A 3U52E 3ZRFA 3V6CB 4BKSA 4C00A 1Q10A 4GXBA 2VH2A 4K81A 3TL5A 4BBNC 2LI5A 3LYYA 1GB4A 4O1NA 1JWSD 2JF5A 3QJZA 5E6NA 4C7ZA 4KZ0A 1K8RB 3QQ8B 3WAOA 4BFRA 4C7YA 3KWLA 2W9NA 1OGWA 1AARA 1ZDVA 2XBBC 4W9LA 2ZNVB 1WH3A 1I4HA 4WAAA 3AE1B 1T0QC 4EEWA 2MEKA 4USAA 5G55A 3MP9A 1VZ6A 3GE8C 2FIDA 3BWUD 1IBXB 2KVZA 3DBRI 4K7WA 3H8HA 2ZW0A 2V3PA 3NG0A 4G11A 2QJLA 1FRRA 1WX7A 4YSZB 2BW2A 4RGTA 2FE8A 2WU5B 3P63A 1N60A 3DHHC 2KO3A 3BYTB 1JRUA 3TEZA 2LUMA 4I6PA 4BKTA 5FK9C 3AE9B 2HD5B 3MJ5A 1WZ0A 2LVPA 3AE7B 3LDZE 2C9WB 3A9JB 2KDEB 1N5XA 3HM3A 4A3OA 2KJ6A 2LGYA 3EA6A 3NVZA 1GOZA 4Q2JA 3DVNV 1KRHA 1QKZA 5JHAA 2V9HA 1E0ZA 2KMMA 3ZQ4A 2YVCA 3N1YC 1XLQA 2LMCA 3H7PB 2D2QA 4MGIE 3TSSA 2VH1A 1J7AA 4TKNA 2IGHA 4MM3A 2H88B 3Q3JA 3ONSA 4BBNF 4A6QA 1C76A 3AEAB 4RF1A 4IDIA 1PFDA 1VDVA 4HLEA 3MC0B 2WDQB 5L95C 2V1YA 4LLGM 3Q8FA 3L0WB 1C79A 1RYJA 2CHZA 3R2TA 2RGFA 1F1HA 2JRHA 2LZ6A 4BKSD 4G0NB 4GDLA 2KWCA 3MC8A 2ZCBA 3W1SA 1QOGA 4HEA1 3DOWA 4FJZA 3RNCC 2INCC 4ZHOA 1UD7A 1M94A 3AMZA 2LFIA 2L8JA 2MQJA 1YIWA 4E3CA 2WXKA 1L4DB 1E9MA 3C19A 3U7ZA 1ZGUB 4LNKA 1WGHA 2JU6X 3EHVA 2RDGA 5D2MB 3SD5A 4JWSC 4WQOB 3W9CB 3M62B 3B1LX 3MHSD 1SE2A 2XEWA 1AN8A 2C7NB 4K7UA 5FR6A 2LGXA 2EKIA 4GSWA 1TY0A 2O6VD 3X0WA 4MT5A 1R4MB 2KYWA 3JW0X 3W1YA 2R2QA 2V4IB 2L00B 5BMHA 1GG3A 2EMTA 1CK1A 2EMSA 2BWFA 2IZVB 1JALA 2OHFA 4RGNA 3VH4B 2WGSA 1I4QA 3ZLZA 4L2YA 1EF5A 1L0VB 1FNWA 3PVLA 2QCZA 1WR6E 4PYUA 5HI1A 2IDYA 3V62A 1VLBA 1DOXA 1HZ5A 2M0XA 3HM6X 2WNMA 3LB8C 4A3PA 2HTME 2ZCCA 2MJDA 1KTKA 1NYQA 3ZTCA 3TMPB 1L7YA 3RNGC 4PYZA 3U2SC 4HK2A 1NI3A 2MJEA 2WDVB 3ZXVA 3R8BA 3FILA 1UBIA 2PE9A 3ZO5B 3QA8A 5LNK1 4NAMA 2QEJC 1D5XC 2V3SA 2K0PA 4W9IA 5EDSA 1RFKA 1U4AA 1UELA 2O6VB 3QWZB 1VD2A 1WGGA 2LD9A 4HWIB 1YN4A 1J19A 1MG4A 2KTRB 2MJ3A 1SXTA 4ARIA 2YLMA 2Y5CA 4PT5A 1JWMD 1FEHA 2KDFB 1YX6B 2JUOA 3EGRA 1YN5A 4REZA 3H1UA 2KJHB 2LJIA 2QIEB 4W9FA 1TS4A 4KKJA 1PYWD 3VUWA 4MJSA 2JT4B 4FA6A 1NYRA 3DDCB 3Q8BA 4M02A 2G9HD 2DX5B 1WI0A 1X1MA 1H8CA 2WU2B 4P1CC 2LVOA 4NZLB 1BUIC 1EM7A 3ML9A 2R2OA 2N9PC 1ISNA 1AW7A 4JX1C 1KLUD 4NPNA 4TQ1A 5AUIA 1WRDB 4AS1A 2WXMA 3VHTC 1YJ1A 2LVQA 2FBWB 4NJ6A 5IP4D 1ZXIA 4MSQB 2KZRA 4OW0A 2V0GA 3NZ3A 5EE3A 4ZOHC 1E10A 4KIKA 3NVVA 3RNBC 4F7ZA 4TUUA 2IO3B 2INDC 1TZ1A 2BTEA 3M3JA 4JWUC 1UF0A 2NTSA 3O13A 4XDCA 4S17A 4YL8A 3V6EB 2BGFA 3L4PA 2CU1A 3AEBB 4J6IA 1QOFA 2KDIA 1YQ3B 5DPSA 1V86A 3SDLC 3U8ZA 2KT7A 4BOZB 2ZVNA 1IBXA 2FIFA 1EF1A 3P4PB 1IGDA 1I42A 1WXVA 1XLPA 3I5JC 2KXJA 5D94A 1XO3A 3KVFB 1KF6B 4N9F4 1LO5D 5LXHA 1F2RI 4TQ0A 1C77A 3RUIB 2L0FA 2FUHB 4K3CA 4LCDE 2MHJA 3VRBB 4DHJD 3R7RA 4GDKB 2A4ZA 1NI2A 2WXGA 3DVNU 4RF0A 4MH8A 3RD2A 4URKA 3HIZA 4B0EA 4EKUA 2Y5BB 2DBYA 4KKIA 1OQYA 1QLBB 3WA0A 2KANA 3BYYB 4ANWA 1RWSA 1ZOYB 3Q2AC 5EE1A 1Z5SB 3H7PA 3I57A 1T6BX 2SEBD 1TJEA 2INNE 4ZRQA 1E6EB 5DPTA 4WJOA 2W54A 2RR9A 2GBKA 2MP2A 4H2AA 2N1VA 4LK0M 4TV3A 1GJZA 1YJIA 3P4SB 4HVBA 4DQOC 1WR1A 3RFZB 1XXGA 4RM8A 2DYBA 1XQQA 2IPKD 3EFCA 3AB5A 4J3OD 1WSPA 3RN9C 3DBSA 3V3XA 1E8ZA 2IO2B 3H7SA 3PTFC 4KGTA 4NY0A 4HJKA 4ZRPA 1MI0A 5G5HA 3ZNGC 3MTNB 3CIRB 4OVUA 1B9RA 2D10A 4W9GA 2KLCA 1NVID 5CTRC 4IG7B 2BYEA 5E6OA 5BYSA 2MWSB 1DYQA 2QDFA 4AQ7A 1ZPSA 2W82A 1AYFA 2G1EA 5AZHA 1TZOA 2E6XA 3A9KA 2HTHA 2XK5B 4IM2A 2KX0A 3AEEB 2RPVA 4P1BC 2ICIA 3IBEA 3PZ7A 2RSUA 3CWIA 3L13A 3A1QB 4IWQA 2KDBA 4XX5A 4WWNA 1UGJA 1S3SG 1WX9A 5D7GA 3RNEC 3JSVA 4A9AA 1QQRA 1DGJA 5JZEB 3Q3FA 4C4VA 5J18A 3N9YC 2D5GA 4A8XC 4S0RA 3GB1A 1KFYB 2ZNVC 1L6UA 3KQ4A 2INPE 3QX1A 4EOYA 2I38A 1A70A 2MCNB 1TKGA 4L1BA 2CJOA 4IWPA 5JH5C 2LXCA 3FKYA 3CSTA 2IO0B 1E7PB 2DYMA 2RMMA 4RGOS 3R66C 1HQRD 1XT9B 1V6EA 2EKEC 2LUEA 2IY1B 1KJTA 2N9KA 1UUPA 3Q14C 3ECIA 3L17A 5T8IA 2GOWA 2KVRA 2M8SA 4K1RB 2OEDA 3IT4B 3RT3B 2KN4A 2L05A 4FJVB 4DBGA 4RNAA 3HVZA 1FRDA 3AE8B 1ZE3D 2JRIB 5H92C 1P7EA 5EE9A 2CKHB 4W9HA 3A4RA 3P4RB 4MEMA 2BYTA 2BS2B 1FMAD 1R4MI 2D3CA 2K22A 1SF0A 1PGBA 4JGHB 3B2GA 2WX0A 3WANA 4I6LB 1SE3A 1IGCA 1HEZE 1P1AA 4XC2A 3OLMD 1TS2A 1VRAB 2LRUA 4FHKA 2RPQA 1V2YA 1XD3B 4RMAA 3WAPA 1RAXA 3OAWA 3RZFA 2CJNA 5L83A 4GN1A 4N58A 2L32A 2DLBA 2K3UA 2HJ1A 3KUCB 3L54A 1HZ6A 2J52A 4EZJA 4HDQA 1J7CA 2KAJA 1KM7A 2ZPNA 5C23A 3T8MA 2FCSA 4E71A 3UI3A 5D6JB 3AM9A 2MBEA 3VUYA 2AYOB 4N6EB 3VTUA 1E8YA 2WXOA 3M63B 4K3BA 3H6NA 3SEBA 3N3KB 4ARCA 3HUIA 3C8YA 3DWGC 2NPTA 2K9XA 3B9JA 2WXRA 3VVWB 3LJ3A 3ZJTA 1N63A 4MGZE 3OG5A 2DZJA 2UU7A 3I63C 1AWDA 2KFKB 4WIPA 3SR6A 1TS3A 5IKCM 2Z0DB 3E56A 2DENB 1R7SA 3A33B 1FXAA 1K52A 1K53A 4KV2A 2DWQA 1UH6A 1FXIA 3NUHB 1SJED 1QT9A 2JSVX 3NOBA 1F52A 1RRBA 2CS4A 2WS3B 5HHDG 3DWMA 3URYA 3BVGA 2AQ1B 4B9KA 3MJWA 5BYQA 3KW5B 1FFVA 5TSSA 5LXIB 2VRRB 1I4XA 2I1JA 1TTNA 3P2BA 2KQ4X 2MX2A 2B3AA 2KWUB 5E6JA 3PHWB 2J0KA 4KSLC 2KMCA 5AZFA 4FXCA 2JWUA 1PGAA 3ZNZB 3E9SA 1KLGD 1HA5A 1P9DU 2CHWA 4M01A 5JHBA 2ZW1A 2KTRA 2WXQA 3ZKJC 2NPTB 3TEXA 3UF8A 1PQSA 2K39A 1UBQA 2GI9A 3KYCD 4NQLB 3MC9A 3UIPB 3ZUNA 2IJ0A 2DZMA 5CHFA 4LNIA 1V49A 2LEKA 2AL3A 3N32A 3PT2B 1TKYA 1L0YB 1VZ8A 5HKHA 2PE6B 4KSKC 1Z2MA 4ZRJA 1FCCC 3QC8B 4G50A 3PHXB 2PW9A 2UWQA 5GMVA 2AWTA 2N7JA 2PKOA 5BMIA 2N9LA 5FR3A 4HCNB 3RNFC 2D3AA 1QZEA 4YTNB 1C1YB 3AULA 2CR5A 4WJNA 5HFYA 1WX8A 4MELA 3AECB 3LXFA 1WF9A 3JVZX 3NVYA 4ICUA 4OZBA 3I9V1 1K51A 2YEPB 2H89B 2FCMA 2J7QB 4HCPB 1SIJA 5C1ZA 3K9OB 1S1QB 2KJRA 3IHPC 2JYTA 4M8MA 1N6ZA 3IAS1 4E74A 2KDMA 2WX1A 4LNOA 4ANUA 4ANVA 3M95A 2J4XA 4XE0A 1IYFA 4ZRKA 1EU4A 4XYCA 3IXSA 4GOCA 2BB6A 2L0TA 1XLOA 2BVCA 2JX5A 4HDOA 2WXNA 3P1MA 3HRDD 1I4RA 3R2IA 3NZUA 4WJPA 3BIID 4MM3B 1UWMA 4KX6B 3D32A 3Q8AA 1FFUA 1XF5L 4CO7A 4IKGA 1L2NA 4IOIE 3ENEA 2HDEA 2D3BA 3CF6E 3IFWB 3PLUA 2NR2A 2NTTA 4GDKA 1EWYC 4PS3A 3DHIC 2SAKA 1WMHB 2QHOA 5DCNA 3QCAA 3ZDMC 1HTOA 4LNFA 3EC8A 1N61A 2ZZPB 1JCKB 1SGHA 3ZJUA 2G4DB 3V61A 2ONQA 3X23A 2KNBA 4JLCA 4LJOB 3WAMA 1YX5B 1KH0A 4X57B 2CHXA 4PS8A 3FC4A 1L4ZB 4FBJB 5C3JB 5DPWA 4WURA 3EECA 2GMIC 2E3TA 4C56C 2ACZB 1IUEA 4JPSA 1V80A 4BKGA 1MPEA 3BY4B 1FM0D 1SIFA 3UINB 2X8XX 3O65B 2K8HA 3DPDA 2WXHA 1WXQA 1WM2A 1OEYA 3R3MA 4W9DA 2PMVA 4DHZE 1WGKA 2KHWB 1R4NI 2JZPA 2XNAC 1A5RA 3AU5A 2AX5A 2MLBA 1EWCA 2L1AA 1YQ4B 3RYTA 3L08A 2MBQA 3ETRA 2KLGA 1KLVA 4HRSA 4AWJA 2G4SA 4MGKE 2N4FA 2WXPA 2Z59B 4KZCA 1K50A 1ZKHA 3AI5A 4JL9A 1WRIA 1EU3A 1T0SC 1ZXHA 2CU3A 2N7EA 1F0ZA 4LNNA 3UIOB 4AJWA 2K25A 2REXA 1WY8A 4GLSC 2IYDB 2KFKA 3WCQA 3TUOA 2LXAA 2KOXA 4A20A 2JVCA 2JXXA 2KC1A 3VXWA 4K7SA 2K8BA 3B0AA 4TMAB 4IM3A 3OWEB 4KDLB 3QK0A 4GGQA 3W5VB 2TSSA 2N1WA 2J53A 3R7QA 3APCA 2M1MA 2WDRB 5G2NA 1V8CA 2WXJA 4FHJA 1C4PA 3P4QB 2FNJB 1WJ4A 1OQQA 3TCAA 3A4SC 3ZVVA 5E6PA 3L16A 2Z0EB 1I7HA 3NS1A 3K9PB 2L76A 3CMMB 3UGBB 3AE6B 3KUZA 1C4AA 3I3TB 2D11A 3AEFB 3PREA 2GBNA 4PK1A 3TEWA 2PEAA 2LASA 5KHOA 1PUTA 5IO9A 3VAWA 1SE4A 3SHQA 4DXAB 1GPXA 1WYGA 3IG3A 3Q6BA 1J0GA 3ZNHB 4P7IA 1MG8A 1WYWB 4MACA 4CQNA 1JWUD 2EELA 3W5UB 3BVZA 2C60A 4KIKB 1WXSA 1N5WA 2M4NA 2M56B 4XWTA 1XCTL 4FADA 4M0WB 1P7FA 2LGDA 3ZNID 3NS8A 4QAYA 4IW0A 1YQBA 1ESFA 1VJKA 1D5ZC 2N9XA 3OJ4B 1V97A 5I4DA 4HPPA 2C7HA 3ALBA 4EZLA 1JROA 4JE3B 4ANXA 2GRIA 4DHJB 3VR8B 2Q5WD 1F77A 2RDBC 1V1PA 2ZJDA 4OZCA 4HROA 1F9JA 1C78A 2L7RA 1J8CA 2YEPF 4MSMB 3PV1A 4B6WA 2RD0A 2WXFA 2Z8LA 1FXTB 5MPOA 4UDUC 1V9JA 3KWVA 2BT6A 2ASQA 2KACA 2W3RA 3U4EG 2WP9B 1RFAA 3BK2A 1ET9A 2WHIA 4NQKE 4HXDA 2W55A 1WXAA 1J7BA 1V1OA 2Y5PA 4WH4A 4EUTA 3KLSX 5IAAC 4US9A 2PVOD 2A5UA 3APDA 1F2RC 3T3OA 1PDXA 4NJCA 3RI7C 3PPAA 4ZHPA 1P98A 3B08A 1E8WA 4EFOA 1ZW7A 2KX3A 3BZDB 3PRZA 2WXLA 2LRWA 3AE4B 1V81A 2NBUA 4FJYA 4TSSA 3Q8EA 1P3QU 3DBLI 2MBHA 3N20C 4LDTB 2VZKD 1WE6A 4DDGD 4WWPA 3VFKA 1V1PB 2BPSA 4ASWC 1WJ6A 4DXGA 2UYZB 4XDDA 1C9FA 2MH7A 3W2DA 4II2B 1T0YA 1JQ4A 1FPYA 1WXMA 1STEA 4MGYE 4W9CA 2GLSA 4YXDB 4BZAA 2MA9B 4II3B 1UZXB 2NBVB 2AL6A 4G3XB 1CQVA 4DK5A 2NCNA 4N59A 4HJGE 2IGGA 5D3DA 3W1SC 2BKRB 1LXDA 2ZPYA 4AP4C 2M19A 1E8XA 4YTPB 4ZYSA 3GE3C 3ZIMA 3A1QA 2D3GA 1P0RA 2KWVB 2DZKA 1ACCA 2MRPA 1SE9A 1N62A 3Q3MC 1EO6A 2N9EB 2KD0A 3T9LA 4PS7A 3TIXA 2M0AA 1FNUA 4GMVA 5BMGA 2O2VA 2HE7A 3TBLD 1HXYD 2DZIA 3MFGA 4XZ4A 2PJHA 4IC7B 3AEGB 2JYEA 1QILA 3AE3B 4WWMA 1KOTA 3GP7A 1TKEA 2VZKB 1JWBD 1TYGB 2C7MB 2DAFA 1ZUD2 3U7DA 4CHKA 2NS5A 3QARA 2Y3AA 5AUKA 3TJPA 3IAM1 1VCBA 2B76B 4XGAB 1FD6A 1Q5WB 2QSDA 1JW9D 1L5PA 3DBHB 2LGSA 1D5MC 2L52A 2MBBB 1E5WA 2IY0B 2KC2A 2PLPA 1XEEA 2BYVE 4DHZB 3SU8X 4AJYB 3KH0A 4LJPB 3V60A 1TGZB 4W9KA 4WJQA 2WQYB 2AQ2B 1WM3A 1GUAB 1LGRA 3A9JA 4L23A 2DNFA 1T0RC 3DVGY 3DVGX 5AZGA 1T3QA 3H9DA 4A90A 2GBJA 4W9EA 3NRZA 1QF6A 1CMXB 1CJEA 2NBWB 2KWDA 1C3TA 5GXGB 4YT0B 3UQBA 3C0RB 4XWWA 2ON8A 2OJRA 5JXVA 1XLNA 1V5OA 2G45B 1SBBB 3VR9B 3P42A 2JZZA 2OOBB 2V3NA 3AN1A 4HKQA 1TY2A 1FNVA 1ENFA 1MHHE 3GZNI 1IPGA 1SSNA 4RH6A 4FLHA 3IVFA 1NENB 5BYRA 4GB9A 1WZ3A 2O6VA 5TR5A 4GDLB 3ZW3A 1E7VA 1SJHD 3RCZA 4B95A 3Q3OC 2K6QA 4BOSC 3NJTA 3NY5A 4RCOA 1Q1OA 3N30A 5C2TB 2HJ8A 3HVDA 2KKCA 1FIQA 4LTUA 4NAWB 2BB5A 1WFYA 1HE8A 3Q3NC 2PTLA 1IP9A 1GNUA 3PZDA 1PGXA 3AEDB 4GIVA 1TS5A 3RZWC 3U30A 1UWXA 1OQRA 5G5GA 3BVMA 5IA7A 2JQRB 1R4NB 2WYQA 2G3QB 4ACFA 2K6DB 2LHDA 1BT0A 4WWOA 1WJUA 2LJ5A 3KYDD 3VDZA 3S2AA 1MHXA 4ZYNA 1DOYA 4HPLB 3VH3B 4YTMB 1YJJA 2BKFA 3HHMA 1D4BA 4R3DA 3Q69A 5DPRA 1LM8B 2QMTA 2IO1B 2KTFA 2V4LA 3GOEA 3ZYYX 4YSXB 4FN2A 3ML8A 2J0MA 2KMAA 3VTVA 2R61A 3MHZA 4KGSA 3ABVB 3AV8A 1ROEA 2FCQA 3Q8CA 2PIAA 2AQ3B 2FCNA 4WAFA 4RFBA 2PPHA 3T3NA 2OJWA 4DWFA 3BINA 2L83A 3VQIA 2MBOA 2BWES 3RPFC 2W3SA 4NAWA 2N7DA 3GZNB 3A9KB 1SB3C 3V05A 2JZ3B 2IBIB 3FILB 3SFEB 1GB1A 2KFJA 2LGIA 4IM0A 2IGDA 1DOIA 3PSEB 5D3IB 1M4VA 3PGEA 1NBFC 1YOVB 4P6VF 2GBMA 1ET6A 2KQSA 5H8YE 2GBRA 2JPHA 4NNJB 1D3ZA 1NEKB 4FULA 3APFA 1MVKA 3VUXA 2BS3B 4AOFA 4EZKA 2LWPA 5HG2A 4ITKA 3AU4A 1WE7A 3VRAB 1WGRA 2WXIA 2WDTB 3OJ3A 4JIOU 1WGDA 3AE2B 4I6NB 3JYUA 5KHQA 2L3ZA 4MJSB 2QC8A 2QILA 4BVUC 1QOAA 4HKZE 2N0SB 3QAQA 1FO4A 2ZEQA 3ZJVA 1XCQL 4WQMA 3VTWA 4OVVA 1Y56A 1MFWA 2K5PA 4P16A 3DQVA 3ZXRA 1QOBA 2ZVOA 1L0XB 2M17A 3L10B 5EE0A 4F1SA 2MW5A 1E90A 4HPMB 1I4PA 1I4GA 4B0MA 3IT6B 3DHGC 3WALA 3NHEB 1RM6C 1RLFA 3J9CA 2RDHA 4ICVA 1I35A 3PRMB 2NVUI 4M0WA 3ZGZA 3NVWA 4YWGG 2O2VB 1MJDA 1NDDA 4BAXA 2I1KA 3PLVA 4DXFA 4CYEA 4IWOA 2WWZA 1V5TA 2NMQA 4RM9A 1JMLA 4EE2A 4M00A 4OHJA 2J42A 3GS2A 2KK8A 2X38A 4M8NA 3PS6A 2WLBA 1GC6A 4KDIC 1GAQB 3KUDB 5IN7A 1HTQA 4ZDVA 1WJNA 2LHEA 3DBRB 4AUQC 1B1ZA 1SEBD 2DAJA 2K1FA 3DBHI 3RULA 2KN5A 2C5LC 1C4CA 4MDKE 3B2FA 1ZDXA 2K8CA 2GB1A 4JQWC 3HK0A 5FKAC 1UGMA 3AE5B 3AXCA 1WGYA 1OFFA 3RMKC 5CHVC 1WMHA 2J0JA 5IOIA 1WWTA 5J17A 3UQAA 4OVZA 1VZ7A 4A55A 2D07B 1YNTE 4LDTD 3EUB2 3PRPB 4IUMB 2I2YA 1OEYJ 2KQ7A 2BF8B 3N1XC 2XK5A 1OTRB 1YD8U 3JSVB 1TT5B 4D2KA 3FAHA 5AEKB 3QHTA 2XN9C 4GU2A 1TIFA 3N1ZC 2DHZA 4US8A 5J2RA 1D6EC 2PVGC 2FUG1 1E7UA 4ZRIA 1Q0WB 3RNAC 1L6VA 3DBLB 5CX3A 4C4VB 2BBCA 1EUVB 2AEHA 1T5XD 2JXTA 3AH7A 3BK1A 4KGRA 3DCGA 1BXTA 1BMLC 1CZPA 1H4RA 3CSFA 2DYOA 4KVGB 1TBEA 3ZTDA 3ZDTA 4DDID 5BO4B 1LFDA 2MP2B 4C80A 1LQBA 1WIAA 1ZP0B 4RGMA 1JRPA 1JWAD 1YMHE 5CHWA 2JY6A 2FAZA 4NJ7A 2MSED 3SFDB 3ZRCA 4W9JA 3EFUA 1G6JA 3WIMA 2BS4B 1UNSA 5LLIA 2JWZA 3QIJA 3NZSA 3TEYA 1VR9A 1Y8RC 4YSYB 1GC7A 2BQQA 1YN3A 4F8CB 2BYFA 3PO0A 1FCLA 4OZAA
chains in the Genus database with same CATH topology
2B76B 1TJEA 2HDEA 1FD6A 2INNE 2QSDA 1JW9D 1L5PA 4ZRQA 1E6EB 3PZ8A 3U52E 2W54A 1D5MC 4H2AA 2L52A 4LK0M 1Q10A 1YJIA 2NTTA 2PLPA 3P4SB 4DQOC 3LYYA 1XEEA 1EWYC 3RFZB 1GB4A 1XXGA 4O1NA 1JWSD 2IPKD 2SAKA 3AB5A 4C7ZA 4J3OD 1WSPA 3V3XA 4C7YA 4KGTA 3KWLA 4ZRPA 1MI0A 1ZDVA 2WQYB 2AQ2B 5G5HA 1B9RA 3CIRB 4L23A 1I4HA 3AE1B 1N61A 1T3QA 1JCKB 2MEKA 4A90A 4USAA 1NVID 3ZJUA 3MP9A 1VZ6A 3NRZA 1QF6A 2ONQA 1IBXB 3BWUD 1CJEA 2KWDA 3H8HA 5BYSA 2ZW0A 2V3PA 4YT0B 5GXGB 1DYQA 1KH0A 4XWWA 2ON8A 2QJLA 1FRRA 4AQ7A 1ZPSA 2W82A 1AYFA 2G1EA 1L4ZB 3FC4A 1TZOA 4YSZB 1XLNA 5JXVA 2E6XA 5C3JB 1SBBB 2BW2A 4WURA 2E3TA 3VR9B 4C56C 2ACZB 4RGTA 2FE8A 3P42A 3AEEB 2WU5B 2V3NA 3P63A 1IUEA 2RPVA 3AN1A 1N60A 4JPSA 2ICIA 1MPEA 1FM0D 3PZ7A 4HKQA 3BYTB 1TY2A 3CWIA 1FNVA 1ENFA 1MHHE 3TEZA 1SSNA 1UGJA 2LUMA 2WXHA 5FK9C 3AE9B 5D7GA 3MJ5A 4RH6A 1WXQA 1NENB 3AE7B 5BYRA 4A9AA 1QQRA 1DGJA 2PMVA 3N9YC 1N5XA 2D5GA 4GDLB 1WGKA 3EA6A 3NVZA 1GOZA 4Q2JA 4A8XC 1SJHD 1KRHA 2JZPA 2XNAC 1QKZA 3GB1A 1KFYB 1E0ZA 2KMMA 1L6UA 4RCOA 3ZQ4A 2AX5A 1EWCA 1XLQA 2INPE 2L1AA 2LMCA 3HVDA 3KQ4A 2I38A 1YQ4B 5C2TB 1A70A 3TSSA 3ETRA 1J7AA 1TKGA 1FIQA 4HRSA 4LTUA 4NAWB 2BB5A 2IGHA 2CJOA 4L1BA 2PTLA 2WXPA 1E7PB 2H88B 1K50A 2DYMA 1PGXA 3AEDB 1TS5A 1UWXA 4A6QA 1OQRA 1C76A 2RMMA 1WRIA 1EU3A 3AEAB 4RGOS 1HQRD 1ZXHA 2CU3A 3BVMA 4RF1A 4IDIA 5G5GA 1F0ZA 2JQRB 1PFDA 1VDVA 2LHDA 3MC0B 2WDQB 4GLSC 4LLGM 2N9KA 1UUPA 3Q8FA 1MHXA 1DOYA 1C79A 3WCQA 1RYJA 3R2TA 4YTMB 5T8IA 1YJJA 2OEDA 3TUOA 3IT4B 1D4BA 2KN4A 4R3DA 3Q69A 3W1SA 1QOGA 4HEA1 2QMTA 4RNAA 3HVZA 1FRDA 3ZYYX 3AE8B 4TMAB 1ZE3D 4YSXB 3OWEB 4ZHOA 5H92C 3AMZA 1P7EA 2R61A 5EE9A 2LFIA 3MHZA 3W5VB 4KGSA 2TSSA 2J53A 3P4RB 2WDRB 2WXKA 2BYTA 3ABVB 2BS2B 1V8CA 1FMAD 1L4DB 2WXJA 3AV8A 2K22A 1ROEA 1C4PA 3Q8CA 1SF0A 1E9MA 3U7ZA 1PGBA 3P4QB 2PIAA 2AQ3B 3B2GA 1OQQA 2JU6X 1SE3A 4WAFA 1IGCA 4RFBA 1HEZE 2RDGA 3T3NA 1TS2A 4JWSC 1VRAB 3W9CB 2L83A 3VQIA 1I7HA 3RPFC 1SE2A 2W3SA 1AN8A 3NS1A 2CJNA 1SB3C 3V05A 3AE6B 1C4AA 4N58A 3FILB 2L32A 3SFEB 1GB1A 2DLBA 2LGIA 2EKIA 2IGDA 1DOIA 1TY0A 2K3UA 3AEFB 4MT5A 3TEWA 5D3IB 1M4VA 1HZ6A 2J52A 1J7CA 2KAJA 1PUTA 2V4IB 1SE4A 5BMHA 4P6VF 1CK1A 1ET6A 5H8YE 1GPXA 1JALA 2OHFA 4RGNA 1NEKB 1I4QA 4L2YA 1WYGA 3UI3A 1L0VB 3AM9A 1FNWA 4MACA 4CQNA 2EELA 1JWUD 5HI1A 2IDYA 4N6EB 1MVKA 2BS3B 1VLBA 1DOXA 1HZ5A 3W5UB 3BVZA 2WNMA 2WXOA 3LB8C 5HG2A 2HTME 4ITKA 3SEBA 4ARCA 3HUIA 2MJDA 1N5WA 1KTKA 1NYQA 3C8YA 2M56B 3VRAB 4XWTA 3DWGC 2WXIA 2K9XA 3U2SC 3B9JA 3AE2B 1NI3A 2WXRA 1XCTL 3ZJTA 1N63A 2MJEA 1P7FA 2WDVB 2QILA 3R8BA 3FILA 1ESFA 1QOAA 1VJKA 1D5ZC 1V97A 4HKZE 2N0SB 5I4DA 5LNK1 1AWDA 4NAMA 1JROA 2QEJC 4JE3B 4WIPA 1FO4A 3SR6A 1TS3A 1D5XC 2K0PA 3E56A 2GRIA 3VR8B 2Q5WD 1F77A 1R7SA 3ZJVA 1RFKA 1XCQL 4WQMA 1V1PA 1FXAA 1K52A 1K53A 4OZCA 1Y56A 2DWQA 2K5PA 4HROA 1FXIA 4P16A 1C78A 3NUHB 2YEPF 1QOBA 1SJED 1QT9A 1L0XB 5EE0A 1YN4A 2JSVX 2MJ3A 2WXFA 2Z8LA 1SXTA 5MPOA 4ARIA 4UDUC 3KWVA 2BT6A 2Y5CA 2KACA 2W3RA 3U4EG 1I4PA 2WP9B 1JWMD 4PT5A 1I4GA 4B0MA 3IT6B 1FEHA 2WS3B 1RM6C 5HHDG 3DWMA 3EGRA 1YN5A 3URYA 3BK2A 1ET9A 4REZA 3BVGA 3J9CA 2AQ1B 2LJIA 2QIEB 2RDHA 2W55A 5BYQA 1J7BA 1TS4A 1FFVA 1PYWD 4KKJA 5TSSA 4M0WA 3ZGZA 1V1OA 1I4XA 1NYRA 2Y5PA 3NVWA 3Q8BA 4WH4A 3KLSX 4YWGG 4US9A 2G9HD 2KQ4X 2PVOD 4DXFA 2WU2B 1F2RC 5E6JA 2NMQA 3T3OA 1PDXA 1JMLA 4EE2A 4NJCA 4NZLB 4OHJA 1BUIC 2J42A 3GS2A 2X38A 1EM7A 4ZHPA 4FXCA 2JWUA 1PGAA 2WLBA 1GAQB 3E9SA 3BZDB 1KLGD 1HA5A 2WXLA 2LHEA 1AW7A 1B1ZA 3AE4B 1SEBD 1KLUD 4JX1C 4TQ1A 5AUIA 4AS1A 2WXMA 2ZW1A 4TSSA 3Q8EA 2WXQA 2FBWB 1C4CA 3B2FA 1ZDXA 3TEXA 1ZXIA 2GB1A 2VZKD 5FKAC 2GI9A 4OW0A 2V0GA 3AE5B 3NZ3A 5EE3A 1V1PB 2IJ0A 1OFFA 4ZOHC 4DXGA 1E10A 1WWTA 2LEKA 3NVVA 4XDDA 1TKYA 1L0YB 1VZ8A 1C9FA 2MH7A 2BTEA 4OVZA 3W2DA 1VZ7A 4A55A 4JWUC 1FCCC 1YNTE 2NTSA 3O13A 4XDCA 1JQ4A 1STEA 3EUB2 4YXDB 2I2YA 4IOIE 3L4PA 3AEBB 1QOFA 2PW9A 2N7JA 2PKOA 5BMIA 1YQ3B 2N9LA 1CQVA 4D2KA 3FAHA 5FR3A 4N59A 4HJGE 2IGGA 2XN9C 4YTNB 5D3DA 5HFYA 3AECB 3LXFA 1IBXA 3NVYA 4US8A 1IGDA 1D6EC 2M19A 2PVGC 2FUG1 3I9V1 3P4PB 1K51A 2YEPB 4OZBA 1XLPA 2H89B 1L6VA 1SIJA 1XO3A 1KF6B 4YTPB 4ZYSA 2BBCA 1LO5D 3AH7A 1T5XD 2JXTA 3BK1A 4KGRA 1F2RI 2JYTA 4TQ0A 1BXTA 1C77A 1BMLC 1CZPA 2DYOA 3IAS1 2KDMA 1ACCA 4C80A 1N62A 1ZP0B 3VRBB 4RGMA 1JRPA 1JWAD 4GDKB 1YMHE 2J4XA 4XE0A 2WXGA 3SFDB 2M0AA 1EU4A 1FNUA 4MH8A 4RF0A 3IXSA 5BMGA 2BB6A 4B0EA 1HXYD 1XLOA 2BS4B 1UNSA 2DBYA 2JX5A 3MFGA 4KKIA 2WXNA 3P1MA 3HRDD 3TEYA 1I4RA 3R2IA 3AEGB 2JYEA 1VR9A 1QILA 1QLBB 4YSYB 3BIID 4MM3B 1UWMA 3AE3B 4KX6B 4WWMA 3BYYB 1RWSA 1ZOYB 3Q8AA 1FFUA 3GP7A 1YN3A 1XF5L 1TKEA 2VZKB 1JWBD 5EE1A 1TYGB 1ZUD2 3I57A 3PO0A 1FCLA 1T6BX 4IKGA 2Y3AA 5AUKA 2SEBD 3IAM1 4OZAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WSP A;  2D5G A;  4WIP A;  3PZ8 A;  3PZ7 A; 
#chains in the Genus database with same CATH topology
 4MH0 E;  3PZ8 A;  3U52 E;  3ZRF A;  3V6C B;  4BKS A;  4C00 A;  1Q10 A;  4GXB A;  2VH2 A;  4K81 A;  3TL5 A;  4BBN C;  2LI5 A;  3LYY A;  1GB4 A;  4O1N A;  1JWS D;  2JF5 A;  3QJZ A;  5E6N A;  4C7Z A;  4KZ0 A;  1K8R B;  3QQ8 B;  3WAO A;  4BFR A;  4C7Y A;  3KWL A;  2W9N A;  1OGW A;  1AAR A;  1ZDV A;  2XBB C;  4W9L A;  2ZNV B;  1WH3 A;  1I4H A;  4WAA A;  3AE1 B;  1T0Q C;  4EEW A;  2MEK A;  4USA A;  5G55 A;  3MP9 A;  1VZ6 A;  3GE8 C;  2FID A;  3BWU D;  1IBX B;  2KVZ A;  3DBR I;  4K7W A;  3H8H A;  2ZW0 A;  2V3P A;  3NG0 A;  4G11 A;  2QJL A;  1FRR A;  1WX7 A;  4YSZ B;  2BW2 A;  4RGT A;  2FE8 A;  2WU5 B;  3P63 A;  1N60 A;  3DHH C;  2KO3 A;  3BYT B;  1JRU A;  3TEZ A;  2LUM A;  4I6P A;  4BKT A;  5FK9 C;  3AE9 B;  2HD5 B;  3MJ5 A;  1WZ0 A;  2LVP A;  3AE7 B;  3LDZ E;  2C9W B;  3A9J B;  2KDE B;  1N5X A;  3HM3 A;  4A3O A;  2KJ6 A;  2LGY A;  3EA6 A;  3NVZ A;  1GOZ A;  4Q2J A;  3DVN V;  1KRH A;  1QKZ A;  5JHA A;  2V9H A;  1E0Z A;  2KMM A;  3ZQ4 A;  2YVC A;  3N1Y C;  1XLQ A;  2LMC A;  3H7P B;  2D2Q A;  4MGI E;  3TSS A;  2VH1 A;  1J7A A;  4TKN A;  2IGH A;  4MM3 A;  2H88 B;  3Q3J A;  3ONS A;  4BBN F;  4A6Q A;  1C76 A;  3AEA B;  4RF1 A;  4IDI A;  1PFD A;  1VDV A;  4HLE A;  3MC0 B;  2WDQ B;  5L95 C;  2V1Y A;  4LLG M;  3Q8F A;  3L0W B;  1C79 A;  1RYJ A;  2CHZ A;  3R2T A;  2RGF A;  1F1H A;  2JRH A;  2LZ6 A;  4BKS D;  4G0N B;  4GDL A;  2KWC A;  3MC8 A;  2ZCB A;  3W1S A;  1QOG A;  4HEA 1;  3DOW A;  4FJZ A;  3RNC C;  2INC C;  4ZHO A;  1UD7 A;  1M94 A;  3AMZ A;  2LFI A;  2L8J A;  2MQJ A;  1YIW A;  4E3C A;  2WXK A;  1L4D B;  1E9M A;  3C19 A;  3U7Z A;  1ZGU B;  4LNK A;  1WGH A;  2JU6 X;  3EHV A;  2RDG A;  5D2M B;  3SD5 A;  4JWS C;  4WQO B;  3W9C B;  3M62 B;  3B1L X;  3MHS D;  1SE2 A;  2XEW A;  1AN8 A;  2C7N B;  4K7U A;  5FR6 A;  2LGX A;  2EKI A;  4GSW A;  1TY0 A;  2O6V D;  3X0W A;  4MT5 A;  1R4M B;  2KYW A;  3JW0 X;  3W1Y A;  2R2Q A;  2V4I B;  2L00 B;  5BMH A;  1GG3 A;  2EMT A;  1CK1 A;  2EMS A;  2BWF A;  2IZV B;  1JAL A;  2OHF A;  4RGN A;  3VH4 B;  2WGS A;  1I4Q A;  3ZLZ A;  4L2Y A;  1EF5 A;  1L0V B;  1FNW A;  3PVL A;  2QCZ A;  1WR6 E;  4PYU A;  5HI1 A;  2IDY A;  3V62 A;  1VLB A;  1DOX A;  1HZ5 A;  2M0X A;  3HM6 X;  2WNM A;  3LB8 C;  4A3P A;  2HTM E;  2ZCC A;  2MJD A;  1KTK A;  1NYQ A;  3ZTC A;  3TMP B;  1L7Y A;  3RNG C;  4PYZ A;  3U2S C;  4HK2 A;  1NI3 A;  2MJE A;  2WDV B;  3ZXV A;  3R8B A;  3FIL A;  1UBI A;  2PE9 A;  3ZO5 B;  3QA8 A;  5LNK 1;  4NAM A;  2QEJ C;  1D5X C;  2V3S A;  2K0P A;  4W9I A;  5EDS A;  1RFK A;  1U4A A;  1UEL A;  2O6V B;  3QWZ B;  1VD2 A;  1WGG A;  2LD9 A;  4HWI B;  1YN4 A;  1J19 A;  1MG4 A;  2KTR B;  2MJ3 A;  1SXT A;  4ARI A;  2YLM A;  2Y5C A;  4PT5 A;  1JWM D;  1FEH A;  2KDF B;  1YX6 B;  2JUO A;  3EGR A;  1YN5 A;  4REZ A;  3H1U A;  2KJH B;  2LJI A;  2QIE B;  4W9F A;  1TS4 A;  4KKJ A;  1PYW D;  3VUW A;  4MJS A;  2JT4 B;  4FA6 A;  1NYR A;  3DDC B;  3Q8B A;  4M02 A;  2G9H D;  2DX5 B;  1WI0 A;  1X1M A;  1H8C A;  2WU2 B;  4P1C C;  2LVO A;  4NZL B;  1BUI C;  1EM7 A;  3ML9 A;  2R2O A;  2N9P C;  1ISN A;  1AW7 A;  4JX1 C;  1KLU D;  4NPN A;  4TQ1 A;  5AUI A;  1WRD B;  4AS1 A;  2WXM A;  3VHT C;  1YJ1 A;  2LVQ A;  2FBW B;  4NJ6 A;  5IP4 D;  1ZXI A;  4MSQ B;  2KZR A;  4OW0 A;  2V0G A;  3NZ3 A;  5EE3 A;  4ZOH C;  1E10 A;  4KIK A;  3NVV A;  3RNB C;  4F7Z A;  4TUU A;  2IO3 B;  2IND C;  1TZ1 A;  2BTE A;  3M3J A;  4JWU C;  1UF0 A;  2NTS A;  3O13 A;  4XDC A;  4S17 A;  4YL8 A;  3V6E B;  2BGF A;  3L4P A;  2CU1 A;  3AEB B;  4J6I A;  1QOF A;  2KDI A;  1YQ3 B;  5DPS A;  1V86 A;  3SDL C;  3U8Z A;  2KT7 A;  4BOZ B;  2ZVN A;  1IBX A;  2FIF A;  1EF1 A;  3P4P B;  1IGD A;  1I42 A;  1WXV A;  1XLP A;  3I5J C;  2KXJ A;  5D94 A;  1XO3 A;  3KVF B;  1KF6 B;  4N9F 4;  1LO5 D;  5LXH A;  1F2R I;  4TQ0 A;  1C77 A;  3RUI B;  2L0F A;  2FUH B;  4K3C A;  4LCD E;  2MHJ A;  3VRB B;  4DHJ D;  3R7R A;  4GDK B;  2A4Z A;  1NI2 A;  2WXG A;  3DVN U;  4RF0 A;  4MH8 A;  3RD2 A;  4URK A;  3HIZ A;  4B0E A;  4EKU A;  2Y5B B;  2DBY A;  4KKI A;  1OQY A;  1QLB B;  3WA0 A;  2KAN A;  3BYY B;  4ANW A;  1RWS A;  1ZOY B;  3Q2A C;  5EE1 A;  1Z5S B;  3H7P A;  3I57 A;  1T6B X;  2SEB D;  1TJE A;  2INN E;  4ZRQ A;  1E6E B;  5DPT A;  4WJO A;  2W54 A;  2RR9 A;  2GBK A;  2MP2 A;  4H2A A;  2N1V A;  4LK0 M;  4TV3 A;  1GJZ A;  1YJI A;  3P4S B;  4HVB A;  4DQO C;  1WR1 A;  3RFZ B;  1XXG A;  4RM8 A;  2DYB A;  1XQQ A;  2IPK D;  3EFC A;  3AB5 A;  4J3O D;  1WSP A;  3RN9 C;  3DBS A;  3V3X A;  1E8Z A;  2IO2 B;  3H7S A;  3PTF C;  4KGT A;  4NY0 A;  4HJK A;  4ZRP A;  1MI0 A;  5G5H A;  3ZNG C;  3MTN B;  3CIR B;  4OVU A;  1B9R A;  2D10 A;  4W9G A;  2KLC A;  1NVI D;  5CTR C;  4IG7 B;  2BYE A;  5E6O A;  5BYS A;  2MWS B;  1DYQ A;  2QDF A;  4AQ7 A;  1ZPS A;  2W82 A;  1AYF A;  2G1E A;  5AZH A;  1TZO A;  2E6X A;  3A9K A;  2HTH A;  2XK5 B;  4IM2 A;  2KX0 A;  3AEE B;  2RPV A;  4P1B C;  2ICI A;  3IBE A;  3PZ7 A;  2RSU A;  3CWI A;  3L13 A;  3A1Q B;  4IWQ A;  2KDB A;  4XX5 A;  4WWN A;  1UGJ A;  1S3S G;  1WX9 A;  5D7G A;  3RNE C;  3JSV A;  4A9A A;  1QQR A;  1DGJ A;  5JZE B;  3Q3F A;  4C4V A;  5J18 A;  3N9Y C;  2D5G A;  4A8X C;  4S0R A;  3GB1 A;  1KFY B;  2ZNV C;  1L6U A;  3KQ4 A;  2INP E;  3QX1 A;  4EOY A;  2I38 A;  1A70 A;  2MCN B;  1TKG A;  4L1B A;  2CJO A;  4IWP A;  5JH5 C;  2LXC A;  3FKY A;  3CST A;  2IO0 B;  1E7P B;  2DYM A;  2RMM A;  4RGO S;  3R66 C;  1HQR D;  1XT9 B;  1V6E A;  2EKE C;  2LUE A;  2IY1 B;  1KJT A;  2N9K A;  1UUP A;  3Q14 C;  3ECI A;  3L17 A;  5T8I A;  2GOW A;  2KVR A;  2M8S A;  4K1R B;  2OED A;  3IT4 B;  3RT3 B;  2KN4 A;  2L05 A;  4FJV B;  4DBG A;  4RNA A;  3HVZ A;  1FRD A;  3AE8 B;  1ZE3 D;  2JRI B;  5H92 C;  1P7E A;  5EE9 A;  2CKH B;  4W9H A;  3A4R A;  3P4R B;  4MEM A;  2BYT A;  2BS2 B;  1FMA D;  1R4M I;  2D3C A;  2K22 A;  1SF0 A;  1PGB A;  4JGH B;  3B2G A;  2WX0 A;  3WAN A;  4I6L B;  1SE3 A;  1IGC A;  1HEZ E;  1P1A A;  4XC2 A;  3OLM D;  1TS2 A;  1VRA B;  2LRU A;  4FHK A;  2RPQ A;  1V2Y A;  1XD3 B;  4RMA A;  3WAP A;  1RAX A;  3OAW A;  3RZF A;  2CJN A;  5L83 A;  4GN1 A;  4N58 A;  2L32 A;  2DLB A;  2K3U A;  2HJ1 A;  3KUC B;  3L54 A;  1HZ6 A;  2J52 A;  4EZJ A;  4HDQ A;  1J7C A;  2KAJ A;  1KM7 A;  2ZPN A;  5C23 A;  3T8M A;  2FCS A;  4E71 A;  3UI3 A;  5D6J B;  3AM9 A;  2MBE A;  3VUY A;  2AYO B;  4N6E B;  3VTU A;  1E8Y A;  2WXO A;  3M63 B;  4K3B A;  3H6N A;  3SEB A;  3N3K B;  4ARC A;  3HUI A;  3C8Y A;  3DWG C;  2NPT A;  2K9X A;  3B9J A;  2WXR A;  3VVW B;  3LJ3 A;  3ZJT A;  1N63 A;  4MGZ E;  3OG5 A;  2DZJ A;  2UU7 A;  3I63 C;  1AWD A;  2KFK B;  4WIP A;  3SR6 A;  1TS3 A;  5IKC M;  2Z0D B;  3E56 A;  2DEN B;  1R7S A;  3A33 B;  1FXA A;  1K52 A;  1K53 A;  4KV2 A;  2DWQ A;  1UH6 A;  1FXI A;  3NUH B;  1SJE D;  1QT9 A;  2JSV X;  3NOB A;  1F52 A;  1RRB A;  2CS4 A;  2WS3 B;  5HHD G;  3DWM A;  3URY A;  3BVG A;  2AQ1 B;  4B9K A;  3MJW A;  5BYQ A;  3KW5 B;  1FFV A;  5TSS A;  5LXI B;  2VRR B;  1I4X A;  2I1J A;  1TTN A;  3P2B A;  2KQ4 X;  2MX2 A;  2B3A A;  2KWU B;  5E6J A;  3PHW B;  2J0K A;  4KSL C;  2KMC A;  5AZF A;  4FXC A;  2JWU A;  1PGA A;  3ZNZ B;  3E9S A;  1KLG D;  1HA5 A;  1P9D U;  2CHW A;  4M01 A;  5JHB A;  2ZW1 A;  2KTR A;  2WXQ A;  3ZKJ C;  2NPT B;  3TEX A;  3UF8 A;  1PQS A;  2K39 A;  1UBQ A;  2GI9 A;  3KYC D;  4NQL B;  3MC9 A;  3UIP B;  3ZUN A;  2IJ0 A;  2DZM A;  5CHF A;  4LNI A;  1V49 A;  2LEK A;  2AL3 A;  3N32 A;  3PT2 B;  1TKY A;  1L0Y B;  1VZ8 A;  5HKH A;  2PE6 B;  4KSK C;  1Z2M A;  4ZRJ A;  1FCC C;  3QC8 B;  4G50 A;  3PHX B;  2PW9 A;  2UWQ A;  5GMV A;  2AWT A;  2N7J A;  2PKO A;  5BMI A;  2N9L A;  5FR3 A;  4HCN B;  3RNF C;  2D3A A;  1QZE A;  4YTN B;  1C1Y B;  3AUL A;  2CR5 A;  4WJN A;  5HFY A;  1WX8 A;  4MEL A;  3AEC B;  3LXF A;  1WF9 A;  3JVZ X;  3NVY A;  4ICU A;  4OZB A;  3I9V 1;  1K51 A;  2YEP B;  2H89 B;  2FCM A;  2J7Q B;  4HCP B;  1SIJ A;  5C1Z A;  3K9O B;  1S1Q B;  2KJR A;  3IHP C;  2JYT A;  4M8M A;  1N6Z A;  3IAS 1;  4E74 A;  2KDM A;  2WX1 A;  4LNO A;  4ANU A;  4ANV A;  3M95 A;  2J4X A;  4XE0 A;  1IYF A;  4ZRK A;  1EU4 A;  4XYC A;  3IXS A;  4GOC A;  2BB6 A;  2L0T A;  1XLO A;  2BVC A;  2JX5 A;  4HDO A;  2WXN A;  3P1M A;  3HRD D;  1I4R A;  3R2I A;  3NZU A;  4WJP A;  3BII D;  4MM3 B;  1UWM A;  4KX6 B;  3D32 A;  3Q8A A;  1FFU A;  1XF5 L;  4CO7 A;  4IKG A;  1L2N A;  4IOI E;  3ENE A;  2HDE A;  2D3B A;  3CF6 E;  3IFW B;  3PLU A;  2NR2 A;  2NTT A;  4GDK A;  1EWY C;  4PS3 A;  3DHI C;  2SAK A;  1WMH B;  2QHO A;  5DCN A;  3QCA A;  3ZDM C;  1HTO A;  4LNF A;  3EC8 A;  1N61 A;  2ZZP B;  1JCK B;  1SGH A;  3ZJU A;  2G4D B;  3V61 A;  2ONQ A;  3X23 A;  2KNB A;  4JLC A;  4LJO B;  3WAM A;  1YX5 B;  1KH0 A;  4X57 B;  2CHX A;  4PS8 A;  3FC4 A;  1L4Z B;  4FBJ B;  5C3J B;  5DPW A;  4WUR A;  3EEC A;  2GMI C;  2E3T A;  4C56 C;  2ACZ B;  1IUE A;  4JPS A;  1V80 A;  4BKG A;  1MPE A;  3BY4 B;  1FM0 D;  1SIF A;  3UIN B;  2X8X X;  3O65 B;  2K8H A;  3DPD A;  2WXH A;  1WXQ A;  1WM2 A;  1OEY A;  3R3M A;  4W9D A;  2PMV A;  4DHZ E;  1WGK A;  2KHW B;  1R4N I;  2JZP A;  2XNA C;  1A5R A;  3AU5 A;  2AX5 A;  2MLB A;  1EWC A;  2L1A A;  1YQ4 B;  3RYT A;  3L08 A;  2MBQ A;  3ETR A;  2KLG A;  1KLV A;  4HRS A;  4AWJ A;  2G4S A;  4MGK E;  2N4F A;  2WXP A;  2Z59 B;  4KZC A;  1K50 A;  1ZKH A;  3AI5 A;  4JL9 A;  1WRI A;  1EU3 A;  1T0S C;  1ZXH A;  2CU3 A;  2N7E A;  1F0Z A;  4LNN A;  3UIO B;  4AJW A;  2K25 A;  2REX A;  1WY8 A;  4GLS C;  2IYD B;  2KFK A;  3WCQ A;  3TUO A;  2LXA A;  2KOX A;  4A20 A;  2JVC A;  2JXX A;  2KC1 A;  3VXW A;  4K7S A;  2K8B A;  3B0A A;  4TMA B;  4IM3 A;  3OWE B;  4KDL B;  3QK0 A;  4GGQ A;  3W5V B;  2TSS A;  2N1W A;  2J53 A;  3R7Q A;  3APC A;  2M1M A;  2WDR B;  5G2N A;  1V8C A;  2WXJ A;  4FHJ A;  1C4P A;  3P4Q B;  2FNJ B;  1WJ4 A;  1OQQ A;  3TCA A;  3A4S C;  3ZVV A;  5E6P A;  3L16 A;  2Z0E B;  1I7H A;  3NS1 A;  3K9P B;  2L76 A;  3CMM B;  3UGB B;  3AE6 B;  3KUZ A;  1C4A A;  3I3T B;  2D11 A;  3AEF B;  3PRE A;  2GBN A;  4PK1 A;  3TEW A;  2PEA A;  2LAS A;  5KHO A;  1PUT A;  5IO9 A;  3VAW A;  1SE4 A;  3SHQ A;  4DXA B;  1GPX A;  1WYG A;  3IG3 A;  3Q6B A;  1J0G A;  3ZNH B;  4P7I A;  1MG8 A;  1WYW B;  4MAC A;  4CQN A;  1JWU D;  2EEL A;  3W5U B;  3BVZ A;  2C60 A;  4KIK B;  1WXS A;  1N5W A;  2M4N A;  2M56 B;  4XWT A;  1XCT L;  4FAD A;  4M0W B;  1P7F A;  2LGD A;  3ZNI D;  3NS8 A;  4QAY A;  4IW0 A;  1YQB A;  1ESF A;  1VJK A;  1D5Z C;  2N9X A;  3OJ4 B;  1V97 A;  5I4D A;  4HPP A;  2C7H A;  3ALB A;  4EZL A;  1JRO A;  4JE3 B;  4ANX A;  2GRI A;  4DHJ B;  3VR8 B;  2Q5W D;  1F77 A;  2RDB C;  1V1P A;  2ZJD A;  4OZC A;  4HRO A;  1F9J A;  1C78 A;  2L7R A;  1J8C A;  2YEP F;  4MSM B;  3PV1 A;  4B6W A;  2RD0 A;  2WXF A;  2Z8L A;  1FXT B;  5MPO A;  4UDU C;  1V9J A;  3KWV A;  2BT6 A;  2ASQ A;  2KAC A;  2W3R A;  3U4E G;  2WP9 B;  1RFA A;  3BK2 A;  1ET9 A;  2WHI A;  4NQK E;  4HXD A;  2W55 A;  1WXA A;  1J7B A;  1V1O A;  2Y5P A;  4WH4 A;  4EUT A;  3KLS X;  5IAA C;  4US9 A;  2PVO D;  2A5U A;  3APD A;  1F2R C;  3T3O A;  1PDX A;  4NJC A;  3RI7 C;  3PPA A;  4ZHP A;  1P98 A;  3B08 A;  1E8W A;  4EFO A;  1ZW7 A;  2KX3 A;  3BZD B;  3PRZ A;  2WXL A;  2LRW A;  3AE4 B;  1V81 A;  2NBU A;  4FJY A;  4TSS A;  3Q8E A;  1P3Q U;  3DBL I;  2MBH A;  3N20 C;  4LDT B;  2VZK D;  1WE6 A;  4DDG D;  4WWP A;  3VFK A;  1V1P B;  2BPS A;  4ASW C;  1WJ6 A;  4DXG A;  2UYZ B;  4XDD A;  1C9F A;  2MH7 A;  3W2D A;  4II2 B;  1T0Y A;  1JQ4 A;  1FPY A;  1WXM A;  1STE A;  4MGY E;  4W9C A;  2GLS A;  4YXD B;  4BZA A;  2MA9 B;  4II3 B;  1UZX B;  2NBV B;  2AL6 A;  4G3X B;  1CQV A;  4DK5 A;  2NCN A;  4N59 A;  4HJG E;  2IGG A;  5D3D A;  3W1S C;  2BKR B;  1LXD A;  2ZPY A;  4AP4 C;  2M19 A;  1E8X A;  4YTP B;  4ZYS A;  3GE3 C;  3ZIM A;  3A1Q A;  2D3G A;  1P0R A;  2KWV B;  2DZK A;  1ACC A;  2MRP A;  1SE9 A;  1N62 A;  3Q3M C;  1EO6 A;  2N9E B;  2KD0 A;  3T9L A;  4PS7 A;  3TIX A;  2M0A A;  1FNU A;  4GMV A;  5BMG A;  2O2V A;  2HE7 A;  3TBL D;  1HXY D;  2DZI A;  3MFG A;  4XZ4 A;  2PJH A;  4IC7 B;  3AEG B;  2JYE A;  1QIL A;  3AE3 B;  4WWM A;  1KOT A;  3GP7 A;  1TKE A;  2VZK B;  1JWB D;  1TYG B;  2C7M B;  2DAF A;  1ZUD 2;  3U7D A;  4CHK A;  2NS5 A;  3QAR A;  2Y3A A;  5AUK A;  3TJP A;  3IAM 1;  1VCB A;  2B76 B;  4XGA B;  1FD6 A;  1Q5W B;  2QSD A;  1JW9 D;  1L5P A;  3DBH B;  2LGS A;  1D5M C;  2L52 A;  2MBB B;  1E5W A;  2IY0 B;  2KC2 A;  2PLP A;  1XEE A;  2BYV E;  4DHZ B;  3SU8 X;  4AJY B;  3KH0 A;  4LJP B;  3V60 A;  1TGZ B;  4W9K A;  4WJQ A;  2WQY B;  2AQ2 B;  1WM3 A;  1GUA B;  1LGR A;  3A9J A;  4L23 A;  2DNF A;  1T0R C;  3DVG Y;  3DVG X;  5AZG A;  1T3Q A;  3H9D A;  4A90 A;  2GBJ A;  4W9E A;  3NRZ A;  1QF6 A;  1CMX B;  1CJE A;  2NBW B;  2KWD A;  1C3T A;  5GXG B;  4YT0 B;  3UQB A;  3C0R B;  4XWW A;  2ON8 A;  2OJR A;  5JXV A;  1XLN A;  1V5O A;  2G45 B;  1SBB B;  3VR9 B;  3P42 A;  2JZZ A;  2OOB B;  2V3N A;  3AN1 A;  4HKQ A;  1TY2 A;  1FNV A;  1ENF A;  1MHH E;  3GZN I;  1IPG A;  1SSN A;  4RH6 A;  4FLH A;  3IVF A;  1NEN B;  5BYR A;  4GB9 A;  1WZ3 A;  2O6V A;  5TR5 A;  4GDL B;  3ZW3 A;  1E7V A;  1SJH D;  3RCZ A;  4B95 A;  3Q3O C;  2K6Q A;  4BOS C;  3NJT A;  3NY5 A;  4RCO A;  1Q1O A;  3N30 A;  5C2T B;  2HJ8 A;  3HVD A;  2KKC A;  1FIQ A;  4LTU A;  4NAW B;  2BB5 A;  1WFY A;  1HE8 A;  3Q3N C;  2PTL A;  1IP9 A;  1GNU A;  3PZD A;  1PGX A;  3AED B;  4GIV A;  1TS5 A;  3RZW C;  3U30 A;  1UWX A;  1OQR A;  5G5G A;  3BVM A;  5IA7 A;  2JQR B;  1R4N B;  2WYQ A;  2G3Q B;  4ACF A;  2K6D B;  2LHD A;  1BT0 A;  4WWO A;  1WJU A;  2LJ5 A;  3KYD D;  3VDZ A;  3S2A A;  1MHX A;  4ZYN A;  1DOY A;  4HPL B;  3VH3 B;  4YTM B;  1YJJ A;  2BKF A;  3HHM A;  1D4B A;  4R3D A;  3Q69 A;  5DPR A;  1LM8 B;  2QMT A;  2IO1 B;  2KTF A;  2V4L A;  3GOE A;  3ZYY X;  4YSX B;  4FN2 A;  3ML8 A;  2J0M A;  2KMA A;  3VTV A;  2R61 A;  3MHZ A;  4KGS A;  3ABV B;  3AV8 A;  1ROE A;  2FCQ A;  3Q8C A;  2PIA A;  2AQ3 B;  2FCN A;  4WAF A;  4RFB A;  2PPH A;  3T3N A;  2OJW A;  4DWF A;  3BIN A;  2L83 A;  3VQI A;  2MBO A;  2BWE S;  3RPF C;  2W3S A;  4NAW A;  2N7D A;  3GZN B;  3A9K B;  1SB3 C;  3V05 A;  2JZ3 B;  2IBI B;  3FIL B;  3SFE B;  1GB1 A;  2KFJ A;  2LGI A;  4IM0 A;  2IGD A;  1DOI A;  3PSE B;  5D3I B;  1M4V A;  3PGE A;  1NBF C;  1YOV B;  4P6V F;  2GBM A;  1ET6 A;  2KQS A;  5H8Y E;  2GBR A;  2JPH A;  4NNJ B;  1D3Z A;  1NEK B;  4FUL A;  3APF A;  1MVK A;  3VUX A;  2BS3 B;  4AOF A;  4EZK A;  2LWP A;  5HG2 A;  4ITK A;  3AU4 A;  1WE7 A;  3VRA B;  1WGR A;  2WXI A;  2WDT B;  3OJ3 A;  4JIO U;  1WGD A;  3AE2 B;  4I6N B;  3JYU A;  5KHQ A;  2L3Z A;  4MJS B;  2QC8 A;  2QIL A;  4BVU C;  1QOA A;  4HKZ E;  2N0S B;  3QAQ A;  1FO4 A;  2ZEQ A;  3ZJV A;  1XCQ L;  4WQM A;  3VTW A;  4OVV A;  1Y56 A;  1MFW A;  2K5P A;  4P16 A;  3DQV A;  3ZXR A;  1QOB A;  2ZVO A;  1L0X B;  2M17 A;  3L10 B;  5EE0 A;  4F1S A;  2MW5 A;  1E90 A;  4HPM B;  1I4P A;  1I4G A;  4B0M A;  3IT6 B;  3DHG C;  3WAL A;  3NHE B;  1RM6 C;  1RLF A;  3J9C A;  2RDH A;  4ICV A;  1I35 A;  3PRM B;  2NVU I;  4M0W A;  3ZGZ A;  3NVW A;  4YWG G;  2O2V B;  1MJD A;  1NDD A;  4BAX A;  2I1K A;  3PLV A;  4DXF A;  4CYE A;  4IWO A;  2WWZ A;  1V5T A;  2NMQ A;  4RM9 A;  1JML A;  4EE2 A;  4M00 A;  4OHJ A;  2J42 A;  3GS2 A;  2KK8 A;  2X38 A;  4M8N A;  3PS6 A;  2WLB A;  1GC6 A;  4KDI C;  1GAQ B;  3KUD B;  5IN7 A;  1HTQ A;  4ZDV A;  1WJN A;  2LHE A;  3DBR B;  4AUQ C;  1B1Z A;  1SEB D;  2DAJ A;  2K1F A;  3DBH I;  3RUL A;  2KN5 A;  2C5L C;  1C4C A;  4MDK E;  3B2F A;  1ZDX A;  2K8C A;  2GB1 A;  4JQW C;  3HK0 A;  5FKA C;  1UGM A;  3AE5 B;  3AXC A;  1WGY A;  1OFF A;  3RMK C;  5CHV C;  1WMH A;  2J0J A;  5IOI A;  1WWT A;  5J17 A;  3UQA A;  4OVZ A;  1VZ7 A;  4A55 A;  2D07 B;  1YNT E;  4LDT D;  3EUB 2;  3PRP B;  4IUM B;  2I2Y A;  1OEY J;  2KQ7 A;  2BF8 B;  3N1X C;  2XK5 A;  1OTR B;  1YD8 U;  3JSV B;  1TT5 B;  4D2K A;  3FAH A;  5AEK B;  3QHT A;  2XN9 C;  4GU2 A;  1TIF A;  3N1Z C;  2DHZ A;  4US8 A;  5J2R A;  1D6E C;  2PVG C;  2FUG 1;  1E7U A;  4ZRI A;  1Q0W B;  3RNA C;  1L6V A;  3DBL B;  5CX3 A;  4C4V B;  2BBC A;  1EUV B;  2AEH A;  1T5X D;  2JXT A;  3AH7 A;  3BK1 A;  4KGR A;  3DCG A;  1BXT A;  1BML C;  1CZP A;  1H4R A;  3CSF A;  2DYO A;  4KVG B;  1TBE A;  3ZTD A;  3ZDT A;  4DDI D;  5BO4 B;  1LFD A;  2MP2 B;  4C80 A;  1LQB A;  1WIA A;  1ZP0 B;  4RGM A;  1JRP A;  1JWA D;  1YMH E;  5CHW A;  2JY6 A;  2FAZ A;  4NJ7 A;  2MSE D;  3SFD B;  3ZRC A;  4W9J A;  3EFU A;  1G6J A;  3WIM A;  2BS4 B;  1UNS A;  5LLI A;  2JWZ A;  3QIJ A;  3NZS A;  3TEY A;  1VR9 A;  1Y8R C;  4YSY B;  1GC7 A;  2BQQ A;  1YN3 A;  4F8C B;  2BYF A;  3PO0 A;  1FCL A;  4OZA A; 
#chains in the Genus database with same CATH homology
 2B76 B;  1TJE A;  2HDE A;  1FD6 A;  2INN E;  2QSD A;  1JW9 D;  1L5P A;  4ZRQ A;  1E6E B;  3PZ8 A;  3U52 E;  2W54 A;  1D5M C;  4H2A A;  2L52 A;  4LK0 M;  1Q10 A;  1YJI A;  2NTT A;  2PLP A;  3P4S B;  4DQO C;  3LYY A;  1XEE A;  1EWY C;  3RFZ B;  1GB4 A;  1XXG A;  4O1N A;  1JWS D;  2IPK D;  2SAK A;  3AB5 A;  4C7Z A;  4J3O D;  1WSP A;  3V3X A;  4C7Y A;  4KGT A;  3KWL A;  4ZRP A;  1MI0 A;  1ZDV A;  2WQY B;  2AQ2 B;  5G5H A;  1B9R A;  3CIR B;  4L23 A;  1I4H A;  3AE1 B;  1N61 A;  1T3Q A;  1JCK B;  2MEK A;  4A90 A;  4USA A;  1NVI D;  3ZJU A;  3MP9 A;  1VZ6 A;  3NRZ A;  1QF6 A;  2ONQ A;  1IBX B;  3BWU D;  1CJE A;  2KWD A;  3H8H A;  5BYS A;  2ZW0 A;  2V3P A;  4YT0 B;  5GXG B;  1DYQ A;  1KH0 A;  4XWW A;  2ON8 A;  2QJL A;  1FRR A;  4AQ7 A;  1ZPS A;  2W82 A;  1AYF A;  2G1E A;  1L4Z B;  3FC4 A;  1TZO A;  4YSZ B;  1XLN A;  5JXV A;  2E6X A;  5C3J B;  1SBB B;  2BW2 A;  4WUR A;  2E3T A;  3VR9 B;  4C56 C;  2ACZ B;  4RGT A;  2FE8 A;  3P42 A;  3AEE B;  2WU5 B;  2V3N A;  3P63 A;  1IUE A;  2RPV A;  3AN1 A;  1N60 A;  4JPS A;  2ICI A;  1MPE A;  1FM0 D;  3PZ7 A;  4HKQ A;  3BYT B;  1TY2 A;  3CWI A;  1FNV A;  1ENF A;  1MHH E;  3TEZ A;  1SSN A;  1UGJ A;  2LUM A;  2WXH A;  5FK9 C;  3AE9 B;  5D7G A;  3MJ5 A;  4RH6 A;  1WXQ A;  1NEN B;  3AE7 B;  5BYR A;  4A9A A;  1QQR A;  1DGJ A;  2PMV A;  3N9Y C;  1N5X A;  2D5G A;  4GDL B;  1WGK A;  3EA6 A;  3NVZ A;  1GOZ A;  4Q2J A;  4A8X C;  1SJH D;  1KRH A;  2JZP A;  2XNA C;  1QKZ A;  3GB1 A;  1KFY B;  1E0Z A;  2KMM A;  1L6U A;  4RCO A;  3ZQ4 A;  2AX5 A;  1EWC A;  1XLQ A;  2INP E;  2L1A A;  2LMC A;  3HVD A;  3KQ4 A;  2I38 A;  1YQ4 B;  5C2T B;  1A70 A;  3TSS A;  3ETR A;  1J7A A;  1TKG A;  1FIQ A;  4HRS A;  4LTU A;  4NAW B;  2BB5 A;  2IGH A;  2CJO A;  4L1B A;  2PTL A;  2WXP A;  1E7P B;  2H88 B;  1K50 A;  2DYM A;  1PGX A;  3AED B;  1TS5 A;  1UWX A;  4A6Q A;  1OQR A;  1C76 A;  2RMM A;  1WRI A;  1EU3 A;  3AEA B;  4RGO S;  1HQR D;  1ZXH A;  2CU3 A;  3BVM A;  4RF1 A;  4IDI A;  5G5G A;  1F0Z A;  2JQR B;  1PFD A;  1VDV A;  2LHD A;  3MC0 B;  2WDQ B;  4GLS C;  4LLG M;  2N9K A;  1UUP A;  3Q8F A;  1MHX A;  1DOY A;  1C79 A;  3WCQ A;  1RYJ A;  3R2T A;  4YTM B;  5T8I A;  1YJJ A;  2OED A;  3TUO A;  3IT4 B;  1D4B A;  2KN4 A;  4R3D A;  3Q69 A;  3W1S A;  1QOG A;  4HEA 1;  2QMT A;  4RNA A;  3HVZ A;  1FRD A;  3ZYY X;  3AE8 B;  4TMA B;  1ZE3 D;  4YSX B;  3OWE B;  4ZHO A;  5H92 C;  3AMZ A;  1P7E A;  2R61 A;  5EE9 A;  2LFI A;  3MHZ A;  3W5V B;  4KGS A;  2TSS A;  2J53 A;  3P4R B;  2WDR B;  2WXK A;  2BYT A;  3ABV B;  2BS2 B;  1V8C A;  1FMA D;  1L4D B;  2WXJ A;  3AV8 A;  2K22 A;  1ROE A;  1C4P A;  3Q8C A;  1SF0 A;  1E9M A;  3U7Z A;  1PGB A;  3P4Q B;  2PIA A;  2AQ3 B;  3B2G A;  1OQQ A;  2JU6 X;  1SE3 A;  4WAF A;  1IGC A;  4RFB A;  1HEZ E;  2RDG A;  3T3N A;  1TS2 A;  4JWS C;  1VRA B;  3W9C B;  2L83 A;  3VQI A;  1I7H A;  3RPF C;  1SE2 A;  2W3S A;  1AN8 A;  3NS1 A;  2CJN A;  1SB3 C;  3V05 A;  3AE6 B;  1C4A A;  4N58 A;  3FIL B;  2L32 A;  3SFE B;  1GB1 A;  2DLB A;  2LGI A;  2EKI A;  2IGD A;  1DOI A;  1TY0 A;  2K3U A;  3AEF B;  4MT5 A;  3TEW A;  5D3I B;  1M4V A;  1HZ6 A;  2J52 A;  1J7C A;  2KAJ A;  1PUT A;  2V4I B;  1SE4 A;  5BMH A;  4P6V F;  1CK1 A;  1ET6 A;  5H8Y E;  1GPX A;  1JAL A;  2OHF A;  4RGN A;  1NEK B;  1I4Q A;  4L2Y A;  1WYG A;  3UI3 A;  1L0V B;  3AM9 A;  1FNW A;  4MAC A;  4CQN A;  2EEL A;  1JWU D;  5HI1 A;  2IDY A;  4N6E B;  1MVK A;  2BS3 B;  1VLB A;  1DOX A;  1HZ5 A;  3W5U B;  3BVZ A;  2WNM A;  2WXO A;  3LB8 C;  5HG2 A;  2HTM E;  4ITK A;  3SEB A;  4ARC A;  3HUI A;  2MJD A;  1N5W A;  1KTK A;  1NYQ A;  3C8Y A;  2M56 B;  3VRA B;  4XWT A;  3DWG C;  2WXI A;  2K9X A;  3U2S C;  3B9J A;  3AE2 B;  1NI3 A;  2WXR A;  1XCT L;  3ZJT A;  1N63 A;  2MJE A;  1P7F A;  2WDV B;  2QIL A;  3R8B A;  3FIL A;  1ESF A;  1QOA A;  1VJK A;  1D5Z C;  1V97 A;  4HKZ E;  2N0S B;  5I4D A;  5LNK 1;  1AWD A;  4NAM A;  1JRO A;  2QEJ C;  4JE3 B;  4WIP A;  1FO4 A;  3SR6 A;  1TS3 A;  1D5X C;  2K0P A;  3E56 A;  2GRI A;  3VR8 B;  2Q5W D;  1F77 A;  1R7S A;  3ZJV A;  1RFK A;  1XCQ L;  4WQM A;  1V1P A;  1FXA A;  1K52 A;  1K53 A;  4OZC A;  1Y56 A;  2DWQ A;  2K5P A;  4HRO A;  1FXI A;  4P16 A;  1C78 A;  3NUH B;  2YEP F;  1QOB A;  1SJE D;  1QT9 A;  1L0X B;  5EE0 A;  1YN4 A;  2JSV X;  2MJ3 A;  2WXF A;  2Z8L A;  1SXT A;  5MPO A;  4ARI A;  4UDU C;  3KWV A;  2BT6 A;  2Y5C A;  2KAC A;  2W3R A;  3U4E G;  1I4P A;  2WP9 B;  1JWM D;  4PT5 A;  1I4G A;  4B0M A;  3IT6 B;  1FEH A;  2WS3 B;  1RM6 C;  5HHD G;  3DWM A;  3EGR A;  1YN5 A;  3URY A;  3BK2 A;  1ET9 A;  4REZ A;  3BVG A;  3J9C A;  2AQ1 B;  2LJI A;  2QIE B;  2RDH A;  2W55 A;  5BYQ A;  1J7B A;  1TS4 A;  1FFV A;  1PYW D;  4KKJ A;  5TSS A;  4M0W A;  3ZGZ A;  1V1O A;  1I4X A;  1NYR A;  2Y5P A;  3NVW A;  3Q8B A;  4WH4 A;  3KLS X;  4YWG G;  4US9 A;  2G9H D;  2KQ4 X;  2PVO D;  4DXF A;  2WU2 B;  1F2R C;  5E6J A;  2NMQ A;  3T3O A;  1PDX A;  1JML A;  4EE2 A;  4NJC A;  4NZL B;  4OHJ A;  1BUI C;  2J42 A;  3GS2 A;  2X38 A;  1EM7 A;  4ZHP A;  4FXC A;  2JWU A;  1PGA A;  2WLB A;  1GAQ B;  3E9S A;  3BZD B;  1KLG D;  1HA5 A;  2WXL A;  2LHE A;  1AW7 A;  1B1Z A;  3AE4 B;  1SEB D;  1KLU D;  4JX1 C;  4TQ1 A;  5AUI A;  4AS1 A;  2WXM A;  2ZW1 A;  4TSS A;  3Q8E A;  2WXQ A;  2FBW B;  1C4C A;  3B2F A;  1ZDX A;  3TEX A;  1ZXI A;  2GB1 A;  2VZK D;  5FKA C;  2GI9 A;  4OW0 A;  2V0G A;  3AE5 B;  3NZ3 A;  5EE3 A;  1V1P B;  2IJ0 A;  1OFF A;  4ZOH C;  4DXG A;  1E10 A;  1WWT A;  2LEK A;  3NVV A;  4XDD A;  1TKY A;  1L0Y B;  1VZ8 A;  1C9F A;  2MH7 A;  2BTE A;  4OVZ A;  3W2D A;  1VZ7 A;  4A55 A;  4JWU C;  1FCC C;  1YNT E;  2NTS A;  3O13 A;  4XDC A;  1JQ4 A;  1STE A;  3EUB 2;  4YXD B;  2I2Y A;  4IOI E;  3L4P A;  3AEB B;  1QOF A;  2PW9 A;  2N7J A;  2PKO A;  5BMI A;  1YQ3 B;  2N9L A;  1CQV A;  4D2K A;  3FAH A;  5FR3 A;  4N59 A;  4HJG E;  2IGG A;  2XN9 C;  4YTN B;  5D3D A;  5HFY A;  3AEC B;  3LXF A;  1IBX A;  3NVY A;  4US8 A;  1IGD A;  1D6E C;  2M19 A;  2PVG C;  2FUG 1;  3I9V 1;  3P4P B;  1K51 A;  2YEP B;  4OZB A;  1XLP A;  2H89 B;  1L6V A;  1SIJ A;  1XO3 A;  1KF6 B;  4YTP B;  4ZYS A;  2BBC A;  1LO5 D;  3AH7 A;  1T5X D;  2JXT A;  3BK1 A;  4KGR A;  1F2R I;  2JYT A;  4TQ0 A;  1BXT A;  1C77 A;  1BML C;  1CZP A;  2DYO A;  3IAS 1;  2KDM A;  1ACC A;  4C80 A;  1N62 A;  1ZP0 B;  3VRB B;  4RGM A;  1JRP A;  1JWA D;  4GDK B;  1YMH E;  2J4X A;  4XE0 A;  2WXG A;  3SFD B;  2M0A A;  1EU4 A;  1FNU A;  4MH8 A;  4RF0 A;  3IXS A;  5BMG A;  2BB6 A;  4B0E A;  1HXY D;  1XLO A;  2BS4 B;  1UNS A;  2DBY A;  2JX5 A;  3MFG A;  4KKI A;  2WXN A;  3P1M A;  3HRD D;  3TEY A;  1I4R A;  3R2I A;  3AEG B;  2JYE A;  1VR9 A;  1QIL A;  1QLB B;  4YSY B;  3BII D;  4MM3 B;  1UWM A;  3AE3 B;  4KX6 B;  4WWM A;  3BYY B;  1RWS A;  1ZOY B;  3Q8A A;  1FFU A;  3GP7 A;  1YN3 A;  1XF5 L;  1TKE A;  2VZK B;  1JWB D;  5EE1 A;  1TYG B;  1ZUD 2;  3I57 A;  3PO0 A;  1FCL A;  1T6B X;  4IKG A;  2Y3A A;  5AUK A;  2SEB D;  3IAM 1;  4OZA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...