2D5GA

Structure of ubiquitin fold protein r767e mutant
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
83
structure length
83
Chain Sequence
CDSIVVAYYFCGEPIPYETLVRGRAVTLGQFKELLTKKGSYRYYFKKVSDEFDCGVVFEEVREDEAILPVFEEKIIGKVEKVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords Axin-1
publication title Structure of ubiquitin fold protein R767E mutant
rcsb
source organism Rattus norvegicus
total genus 16
structure length 83
sequence length 83
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2005-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00778 DIX DIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.380 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2d5gA00
4WIPA 2D5GA 1WSPA 3PZ7A 3PZ8A
chains in the Genus database with same CATH superfamily
1XEEA 1SXTA 1UZXB 2GBKA 3A1QB 4DXFA 1XCQL 2N7DA 4ZOHC 3RMKC 2DAFA 4YT0B 4KDLB 3APFA 3Q3NC 3AN1A 3B9JA 3R7RA 3GZNB 4RGOS 1TZ1A 3NHEB 3EC8A 1WMHB 2KHWB 4MELA 5DPRA 1YQ3B 1YN4A 4FN2A 3VHTC 2L8JA 2KFJA 2JY6A 4BKSA 1WGKA 1TS4A 4KZCA 4L2YA 3KYCD 4YXDB 5J17A 3ENEA 2CS4A 2X8XX 4YTPB 5CX3A 3VTVA 1WR1A 2GB1A 2WXFA 2REXA 3VR9B 3DPDA 4ICUA 2LVPA 4ZDVA 2JXTA 2WQYB 2QCZA 4GSWA 2BKFA 4A3OA 2MQJA 4ZRIA 2N4FA 1JWUD 1NI2A 1GAQB 2INNE 1SIJA 5IO9A 3R7QA 1XLNA 4MDKE 1LQBA 4F7ZA 2HTME 1FEHA 1RFKA 5CHVC 1KLGD 4M8NA 2VH2A 2KVZA 1C9FA 1C76A 4DXGA 4WWNA 1OEYA 2K8HA 2D3CA 2W3SA 2JZPA 1NDDA 1WZ3A 5BYRA 3NVWA 4BKSD 2BTEA 3DVNU 4ZRKA 2AEHA 2E3TA 3L16A 4E3CA 2L0TA 2KKCA 1FNUA 1WXVA 3DVNV 4DHZB 1WX8A 1UBIA 3DHIC 1M4VA 2M0XA 4JX1C 2KLGA 4AP4C 1J8CA 3NZUA 2WXJA 4MH8A 1L2NA 3NOBA 4DHZE 2BB6A 2KD0A 2INPE 3QX1A 4MT5A 4EZKA 5C23A 3IHPC 1TZOA 2WXIA 4R3DA 1P3QU 1UGMA 3B0AA 1E8XA 2PJHA 1YQBA 4B0MA 4EKUA 2BW2A 2PE9A 2GRIA 4CO7A 1XLPA 3AMZA 3N30A 1I4XA 3ZIMA 1J7BA 4FHJA 4PK1A 2WDTB 2MBEA 3P1MA 2AX5A 1STEA 2LZ6A 3ZRFA 3SR6A 4AS1A 3WANA 1QKZA 4ICVA 1I4QA 2MW5A 3L17A 2BYTA 2TSSA 2GBJA 4DWFA 2IYDB 2DYOA 3EECA 1C78A 1XCTL 3SU8X 3J9CA 2AL3A 3UGBB 4HRSA 2V9HA 2GOWA 4DDID 4WIPA 4XWTA 1GC7A 1JWSD 4JWUC 2VH1A 3CF6E 3MTNB 4AOFA 2LHEA 3H7PA 2JQRB 3H7PB 1P1AA 2IO0B 1PFDA 3PLUA 2H88B 2M1MA 1SB3C 4RM8A 5FKAC 3NJTA 3BINA 2V3NA 4BFRA 3B1LX 3AE4B 3WCQA 3IT4B 1OFFA 2PE6B 3U30A 2WHIA 1WX7A 2BS3B 3E56A 1I4PA 2C9WB 3ZNHB 4HWIB 1C4AA 2BF8B 1T0YA 2JZZA 4L1BA 2LMCA 3JW0X 1V81A 2DAJA 4DXAB 2MBBB 1SBBB 2O6VA 1E8YA 2JWUA 4BAXA 2M8SA 3FAHA 4W9KA 2QSDA 1WSPA 4W9GA 4MGIE 4HCNB 3ZTDA 2EELA 1HE8A 4LK0M 2BYEA 4EEWA 4BBNC 2KLCA 3AE2B 2LWPA 3BIID 1EU4A 4YTMB 4XGAB 1TS5A 4F8CB 3URYA 4HKZE 2B76B 3A33B 1FXTB 2KAJA 1FO4A 2W9NA 2JF5A 2PLPA 2ASQA 2NPTB 5FR6A 1DOIA 1F9JA 1DOXA 2LJIA 3RZWC 1E7VA 2CU1A 1HEZE 4KGRA 3PZ8A 1A70A 2FE8A 5AZFA 5GMVA 1JRPA 2G3QB 1BMLC 1D6EC 3HK0A 1GB4A 1E90A 1H4RA 2KVRA 1LO5D 1S3SG 1SE3A 2N9EB 2OEDA 2JVCA 2O6VD 4RNAA 4W9CA 4FA6A 2WWZA 2KX3A 3WA0A 5L83A 4IWQA 1L7YA 1GOZA 3HVDA 2RDBC 1EM7A 1UD7A 2YEPF 2K8CA 1WJ4A 4I6NB 1PGXA 2KMCA 3NZSA 1YJ1A 1L0VB 2FIFA 2XNAC 1KM7A 1PUTA 3BVZA 2KFKA 2C7MB 1GB1A 2DYBA 3P63A 4LJOB 4OVUA 3FKYA 2WDQB 2D3AA 3N3KB 1F52A 2M56B 3U7ZA 3LB8C 3ZNID 1KRHA 3NVVA 3GS2A 2LFIA 3QIJA 3BK1A 1WH3A 1XD3B 1RWSA 3ETRA 4ANXA 1IPGA 3AEBB 5BMGA 1UF0A 3Q8EA 4QAYA 3AM9A 3HVZA 1DOYA 3A9JB 2BT6A 1OQRA 2A5UA 4C00A 2WXGA 4GDLA 2KN5A 1FXAA 1Y8RC 2ACZB 5BMIA 4A6QA 3U52E 5HKHA 3A4SC 4A9AA 4K3BA 2GBMA 2BBCA 4RGNA 4BOSC 3ONSA 1TJEA 2LGDA 2X38A 1VLBA 2HD5B 3CSFA 2M19A 2DZMA 1V5OA 4GOCA 3DDCB 2K9XA 5JXVA 1GNUA 2LUEA 4DK5A 4WAFA 3SDLC 2MHJA 2LGYA 3ZGZA 3PREA 3KH0A 4ANVA 2J0KA 2V0GA 2Y5CA 1IYFA 2LUMA 3QK0A 4BKTA 4BBNF 3PSEB 4NJCA 5BO4B 1WXSA 1V9JA 4W9IA 1SJHD 3HUIA 3VDZA 2MEKA 2KC2A 1ESFA 2OHFA 4IC7B 1AWDA 2JRIB 2LGSA 1TBEA 4LNIA 2AL6A 3IAM1 3C8YA 1WJNA 3HM6X 2MX2A 4AJYB 2ONQA 4GDKA 2KWDA 1EF5A 2JYTA 3Q3FA 2ZW1A 3KVFB 4MSQB 2KJ6A 1ZXIA 3EHVA 1NBFC 1P9DU 4C7YA 2KQSA 3IG3A 2IO3B 5E6NA 4LNOA 1L4ZB 2GBRA 3BYYB 4RH6A 4MGZE 1SE9A 2KDIA 2PPHA 1L6UA 2L05A 1QZEA 5TR5A 4GXBA 3KWVA 3M62B 4P7IA 5TSSA 1JWAD 1E8ZA 2IBIB 4GU2A 4RGMA 3P4PB 1I42A 3JVZX 2RMMA 3QWZB 3KYDD 2M4NA 2G4SA 2O2VB 3DVGY 4KGTA 1VDVA 3WAMA 2KMMA 1QILA 3V3XA 3AEFB 1UGJA 4JWSC 1Y56A 5EE9A 2ZNVB 2KTRA 1KLUD 2KTRB 3RN9C 5FR3A 4IG7B 4IW0A 1LXDA 3M3JA 4XE0A 1QOFA 3DVGX 3AULA 2WXHA 4N6EB 2Y5BB 1T0QC 2KJHB 2QEJC 4MSMB 2QILA 2JU6X 4RF0A 4PS7A 1WM3A 5IA7A 5L95C 5FK9C 2K6QA 3ZNZB 5I4DA 2J4XA 4IKGA 3KUDB 1OQYA 1ZDVA 3PO0A 1MVKA 1EUVB 1WGHA 3NUHB 1WRIA 4P1BC 2K1FA 2PVGC 3N1ZC 4WAAA 4HROA 1WZ0A 2IY1B 1SJED 3EFCA 5G55A 2DYMA 3QCAA 3AEAB 3V60A 3WALA 4W9JA 2LVQA 1VRAB 2FCSA 4M0WA 1OQQA 4NQKE 1V2YA 3T3OA 1HZ6A 1D4BA 2BVCA 2DHZA 2MA9B 3ZJTA 2QDFA 3NY5A 2GLSA 3I57A 3FILA 2KO3A 2L83A 4K7SA 1MFWA 3NS8A 2AYOB 3OJ3A 2IJ0A 2LXAA 1Q0WB 4DBGA 3SFEB 3HHMA 2LEKA 1CJEA 3JYUA 4Q2JA 1E0ZA 3T9LA 3WAOA 3UQBA 4TUUA 3NRZA 3Q3MC 4MACA 4FLHA 2J42A 4JL9A 2LGXA 2DZKA 2RDHA 3KUCB 3DBHI 3VFKA 2QHOA 1QOGA 4REZA 2Z0DB 4W9FA 5JHBA 3PHWB 2KDMA 2MBOA 2DZIA 2OJWA 1IGCA 2WS3B 4C4VA 1YQ4B 1V97A 2CR5A 2V3PA 1YJJA 1TY0A 3AE9B 3RNFC 3SFDB 3AV8A 1NYQA 1YMHE 3W9CB 5E6PA 2W54A 4HJGE 3QARA 2XBBC 1K50A 2NTTA 3R66C 4A3PA 3ZJVA 2KOXA 5DCNA 4M02A 1YIWA 1WRDB 2D07B 3QQ8B 1IGDA 1KF6B 1R4MI 2BKRB 1NEKB 2Z59B 3V62A 1K8RB 5AEKB 3W5UB 1WXQA 1GC6A 1HZ5A 4FJZA 2KJRA 2MBQA 4OZCA 2DZJA 1GPXA 4B95A 2DX5B 3O13A 4US9A 4FHKA 5BYQA 1U4AA 4PS8A 3ZO5B 5G2NA 3RNEC 2KANA 2L1AA 2WXOA 3ZNGC 4G3XB 4OHJA 4IWOA 3K9PB 4FXCA 4WJPA 4E74A 1FIQA 2G9HD 4LCDE 4GLSC 1CQVA 2D10A 2IGGA 2IPKD 1T6BX 4YTNB 1V6EA 3T3NA 3MP9A 3LXFA 4OVVA 5KHQA 4ZYSA 4C80A 3EUB2 4I6PA 2L52A 4WQMA 2WX0A 2CHZA 1RYJA 1SGHA 3AE8B 3AE6B 3TMPB 3P2BA 3L10B 1TY2A 3IBEA 4HPPA 3DBSA 5IP4D 1UELA 3PGEA 1X1MA 2N7EA 1IBXA 4S17A 2JSVX 3LYYA 3ZYYX 2FUHB 1N5XA 4IDIA 3DWMA 3ZKJC 3H6NA 4C56C 1S1QB 1FRDA 4O1NA 4E71A 1C3TA 4WJNA 4KKJA 1V80A 4MH0E 3TL5A 4P16A 3Q3OC 3LDZE 3VRBB 3SEBA 2QJLA 2FNJB 2WXMA 3C0RB 3Q6BA 1N6ZA 5AZGA 1D3ZA 3UQAA 4YSZB 4IM2A 4LJPB 1JALA 3VVWB 4URKA 2JYEA 4A55A 1VR9A 4WWMA 2FUG1 3L4PA 4B6WA 3N20C 2BYFA 3DBHB 2YEPB 2JUOA 4G11A 3ZXVA 4LDTB 2WXNA 2FCNA 4JE3B 2N9LA 2N1WA 3ABVB 2WXRA 2O6VB 4K3CA 1DGJA 2W82A 3PHXB 3TCAA 2J53A 2WXPA 4HK2A 5D6JB 1J0GA 1H8CA 1YX5B 5H8YE 3TBLD 1WM2A 4LTUA 2K39A 4NAMA 3X23A 1VZ8A 1QLBB 1T0SC 3ECIA 2ICIA 2WU2B 3APCA 4TMAB 1R4MB 3AE3B 4PS3A 2AQ3B 1N5WA 2V1YA 3ZVVA 3P4QB 1QF6A 3GB1A 1ZXHA 1TKYA 1C77A 4ITKA 1KH0A 4YL8A 3AE5B 4W9DA 3VRAB 2DENB 2K8BA 4J3OD 1TTNA 3VUYA 1MHXA 2K6DB 5D2MB 2KWCA 4LDTD 1XXGA 3GE3C 1KJTA 4NJ6A 4ZRPA 2N0SB 3BY4B 2KK8A 2OOBB 1XLOA 3DBRI 2D2QA 3Q8FA 3V61A 1V49A 3EGRA 1GJZA 4NAWA 1TT5B 3R2IA 2EMTA 1J19A 1WE7A 2AWTA 3W5VB 4FBJB 3Q69A 1WJUA 2WU5B 3VTUA 1KLVA 2J0MA 2JT4B 3RZFA 3MFGA 2KX0A 3Q8BA 1FMAD 2Y3AA 2ZVNA 2WXLA 1Q1OA 4RFBA 1WWTA 2MJEA 3H9DA 4ANWA 3UINB 4FJYA 1WGDA 1XLQA 2KFKB 4YWGG 2WYQA 1I4GA 3MC8A 4HCPB 1WX9A 3MC9A 1I35A 1T0RC 1CZPA 4N58A 4K7WA 4RM9A 4N9F4 4WURA 4B9KA 3AEGB 4IM0A 3VXWA 4JQWC 1QQRA 1PGAA 2WGSA 2FCMA 5AUIA 1J7AA 1PYWD 1EF1A 4CQNA 2MJ3A 2L76A 3A9KA 3RCZA 1QT9A 1FCLA 3N32A 2INDC 4GDLB 3V6CB 4XWWA 5JHAA 1IP9A 3DOWA 1V1PA 2CHXA 1Q10A 1GG3A 3JSVA 2ZZPB 2C7NB 3JSVB 4WQOB 2IZVB 5J18A 1CK1A 1HA5A 3Q8CA 3KLSX 2MH7A 2EMSA 4JPSA 3NVZA 4MJSA 1L0XB 4MJSB 1UUPA 2IO2B 1WGRA 1UWMA 3DCGA 4NJ7A 3UF8A 2L00B 2KYWA 3CWIA 2CJOA 1V1OA 1TKGA 3GZNI 3M63B 5E6OA 3ZUNA 2KDFB 1ZOYB 2LGIA 4FADA 2V4LA 4PYZA 3SHQA 2RDGA 3RYTA 1HTOA 3AEDB 2KXJA 4PT5A 3B08A 2IGHA 4MM3A 2XEWA 2B3AA 3I3TB 4MM3B 5LLIA 1FNWA 1IUEA 3VR8B 3U4EG 2LVOA 5J2RA 3L0WB 1ZPSA 1K53A 1PQSA 1XF5L 4UDUC 2PVOD 1RLFA 1KOTA 4KIKA 4BZAA 2MBHA 4K1RB 3MC0B 4LNKA 4GDKB 2M0AA 3MJ5A 2MWSB 1FM0D 3DHGC 2J0JA 3L13A 3OLMD 2MLBA 4NQLB 3R8BA 3B2GA 2FCQA 2V3SA 2BQQA 3DHHC 1TS2A 5LNK1 2LRWA 3BZDB 3IXSA 5CHWA 3PRPB 4ZRQA 4P6VF 4HKQA 4LLGM 2BYVE 2ON8A 1SSNA 1D5ZC 2R61A 4TKNA 4HPMB 3VH3B 2KN4A 4TV3A 5AZHA 3DQVA 1I4RA 3N9YC 4P1CC 3AH7A 2QMTA 2J7QB 5GXGB 1BT0A 5LXIB 2XK5A 2QC8A 5LXHA 2XK5B 1TGZB 1EWYC 4OW0A 2WX1A 4KX6B 5HHDG 1UNSA 2H89B 2L3ZA 2D3BA 3N1XC 3KUZA 2KDEB 2VZKD 3EA6A 2NVUI 2ZEQA 2Z0EB 4WJOA 1VCBA 3AEEB 1F0ZA 1F77A 2FAZA 3TIXA 1ZUD2 3PT2B 5KHOA 3Q3JA 1AARA 5DPSA 3APDA 3R2TA 2ZJDA 3VUXA 3W1SC 1RM6C 4TQ0A 3RT3B 2YLMA 2INCC 1JRUA 3OJ4B 2AQ1B 3BWUD 2K3UA 1ET6A 3PVLA 4WH4A 3DBLI 1YX6B 2JPHA 2HDEA 4XX5A 4A8XC 3IFWB 1YD8U 1AN8A 1C4CA 1MI0A 1NENB 1MJDA 4M0WB 1D5MC 1MPEA 2PKOA 1L4DB 1RAXA 3OG5A 4B0EA 2NTSA 2IDYA 1L6VA 4EOYA 5EE0A 1WGGA 3RNCC 3ZTCA 1TIFA 4RGTA 1ZDXA 3A1QA 3DWGC 2AQ2B 3FILB 4L23A 3TSSA 2KTFA 4USAA 1FFUA 1R4NI 1A5RA 4ZHPA 2WXKA 2G45B 1P0RA 5DPWA 3AE1B 1WMHA 2NR2A 3BVMA 4S0RA 1WYWB 5D7GA 1NVID 4GMVA 1G6JA 1YNTE 1LGRA 3PZ7A 2EKEC 3W1SA 1PDXA 2BPSA 1EWCA 4C4VB 3L54A 3K9OB 1WGYA 2WDVB 3CMMB 2V4IB 3CIRB 5G5HA 4AWJA 3AU5A 2JX5A 3NS1A 3QAQA 2C5LC 3HIZA 3RPFC 3L08A 2CJNA 2K22A 2LJ5A 4ZHOA 3U2SC 3MJWA 2BWES 4NNJB 1C79A 4JIOU 4C7ZA 2GI9A 1YJIA 3KQ4A 4JLCA 2RGFA 1JCKB 2E6XA 2I1JA 3CSTA 1RRBA 1AYFA 5HG2A 1N63A 2OJRA 2N9PC 2ZCCA 1ZGUB 1ZE3D 3MHZA 1WI0A 4XZ4A 2LXCA 4KZ0A 4KSLC 2CKHB 3E9SA 1UBQA 1J7CA 4HLEA 3H7SA 5G5GA 2ZVOA 3ZQ4A 2A4ZA 4HEA1 2NMQA 4FULA 4IUMB 3TEZA 1JWMD 3PRMB 3FC4A 2UYZB 4WWOA 3BVGA 2R2OA 3PLVA 4G50A 1WR6E 3D32A 3PTFC 1FD6A 2D3GA 4M8MA 1JWBD 3BYTB 4II3B 3IAS1 4KKIA 3V6EB 1T5XD 4PYUA 1B1ZA 1ET9A 3RFZB 1ACCA 2K0PA 2UWQA 2VRRB 1F1HA 1P7FA 4BOZB 4X57B 3R3MA 1IBXB 3DBLB 4NY0A 4EUTA 4W9LA 3U8ZA 5CHFA 4TSSA 1V86A 4HDOA 1JMLA 3TUOA 1ISNA 2NBUA 1N60A 3UIOB 1HXYD 1VJKA 3I63C 2PEAA 1ROEA 1WE6A 4RMAA 2CU3A 2EKIA 1OEYJ 1F2RI 1SIFA 1LM8B 4IOIE 4J6IA 3ML9A 4DQOC 2ZCBA 3AE7B 1NYRA 4HJKA 3W1YA 2BB5A 3BK2A 1N62A 2GMIC 2NS5A 2LHDA 4EE2A 2NBVB 1R4NB 1ZKHA 2WNMA 4TQ1A 5HI1A 3A4RA 2Q5WD 4RCOA 5JZEB 4LNNA 2K25A 2UU7A 3EFUA 3M95A 5BYSA 2IY0B 3ZDTA 1XQQA 4KGSA 3VH4B 2LASA 4ARCA 2DWQA 5BMHA 3VUWA 3B2FA 2IGDA 2WDRB 1WFYA 1FNVA 2MJDA 2K5PA 3TEXA 3U7DA 3QHTA 2D11A 2JRHA 4GIVA 3NG0A 5IN7A 5IOIA 2PTLA 4FJVB 1N61A 3Q2AC 3Q8AA 5D3DA 5D3IB 1M94A 1ENFA 3RI7C 3PV1A 2N9XA 3P4SB 1MG4A 4DDGD 3ALBA 3ZXRA 2KT7A 3AI5A 2M17A 1I7HA 2ZPYA 2WP9B 3RNGC 5EE3A 3NZ3A 2DNFA 2YVCA 1WY8A 3O65B 1FCCC 2WLBA 4MGKE 1Z5SB 4EZLA 3TJPA 1P7EA 1R7SA 1FRRA 2KDBA 1F2RC 3V05A 3GOEA 1JW9D 3P4RB 2KZRA 5T8IA 2NPTA 1YN3A 3PPAA 1UWXA 4CYEA 4KSKC 2RR9A 2Z8LA 3TEWA 1WXAA 4ACFA 4LNFA 4NAWB 1HTQA 1NI3A 2IO1B 5EE1A 2N9KA 3H8HA 1YN5A 1T3QA 2KMAA 1B9RA 3IVFA 1BXTA 3PZDA 1E6EB 4A90A 3AXCA 1C1YB 1K52A 2BWFA 4HXDA 1P98A 3SD5A 3S2AA 2JXXA 2LRUA 3I5JC 2JWZA 4NZLB 1PGBA 4MGYE 4XYCA 3X0WA 1RFAA 5E6JA 1WIAA 1QOAA 2PIAA 4JGHB 2FBWB 1D5XC 4M01A 2W3RA 1YOVB 1L0YB 1EO6A 3AECB 2NCNA 1V8CA 2L0FA 1VZ6A 1ZP0B 5HFYA 4ARIA 1TKEA 4XC2A 1SF0A 2RPVA 4H2AA 1SE4A 4M00A 1JROA 3A9KB 4OZAA 1E7PB 1OGWA 1MG8A 1V1PB 4DHJB 2SAKA 2QIEB 4D2KA 2ZPNA 1VD2A 3A9JA 2RD0A 1TS3A 3H1UA 1FFVA 4OVZA 4EFOA 3LJ3A 2I1KA 1E9MA 4G0NB 5D94A 1VZ7A 3HRDD 1Q5WB 2BGFA 1OTRB 5DPTA 1FPYA 2KQ4X 5C3JB 3RNBC 3T8MA 4AJWA 5C1ZA 4AQ7A 1XT9B 1XO3A 3ML8A 3TEYA 1K51A 5JH5C 3N1YC 2KNBA 5IKCM 4ASWC 3KW5B 2W55A 2MP2A 1KTKA 4WJQA 2R2QA 2MP2B 4ZYNA 3RD2A 3VTWA 4K7UA 2LD9A 2BS2B 3AU4A 1E10A 2MCNB 3IT6B 2JZ3B 4YSYB 5AUKA 1LFDA 4XDDA 3RNAC 4WWPA 3ZJUA 3QA8A 3QJZA 2ZW0A 4DHJD 1V5TA 4IWPA 1FXIA 4I6LB 3ZRCA 2KWVB 4KIKB 2SEBD 2ZNVC 4NPNA 1E8WA 4ZRJA 2KC1A 3ZLZA 2HTHA 4RF1A 2KQ7A 2L7RA 3I9V1 2N1VA 1SE2A 2VZKB 2D5GA 2I2YA 1HQRD 1QOBA 4A20A 4GB9A 5C2TB 3VAWA 4CHKA 4ANUA 1Z2MA 4KDIC 2J52A 1KFYB 2KACA 2MSED 1I4HA 3DBRB 1GUAB 3WIMA 2Y5PA 3PRZA 1L5PA 1E7UA 4BKGA 5EDSA 3OWEB 3RULA 2LI5A 2RSUA 4HDQA 5IAAC 2G4DB 2G1EA 1BUIC 2GBNA 1MHHE 1C4PA 3W2DA 4GN1A 2L32A 2WXQA 2C7HA 1DYQA 4GGQA 2BS4B 2KWUB 3KWLA 3GE8C 1WXMA 4HVBA 3GP7A 1CMXB 2O2VA 3AB5A 3HM3A 3OAWA 4EZJA 3UI3A 1ZW7A 2HJ8A 3C19A 2DBYA 3MHSD 3NVYA 1WF9A 3WAPA 4BVUC 2RPQA 1UH6A 2PW9A 4W9HA 2N7JA 3P42A 3QC8B 2NBWB 4IM3A 5CTRC 5MPOA 4K81A 4US8A 1E5WA 2C60A 3PS6A 3ZDMC 1SEBD 2HE7A 1WJ6A 2DLBA 4II2B 3RUIB 4MEMA 2CHWA 3Q14C 4HPLB 1AW7A 4YSXB 1EU3A 4F1SA 3VQIA 2HJ1A 3ZW3A 4KV2A 5H92C 4KVGB 4N59A 2FIDA 2MRPA 4OZBA 3UIPB 2I38A 4XDCA 2XN9C 4W9EA 4AUQC 1TYGB 1WYGA 1JQ4A 2PMVA
chains in the Genus database with same CATH topology
1XEEA 1SXTA 4DXFA 4NJCA 1XCQL 1XXGA 4ZOHC 1P7FA 4ZRPA 1SJHD 4YT0B 2N0SB 3HUIA 1IBXB 2MEKA 3AN1A 3B9JA 1XLOA 4RGOS 1ESFA 2OHFA 1AWDA 3Q8FA 4TSSA 3EGRA 1JMLA 3TUOA 3IAM1 3R2IA 3C8YA 3W5VB 3Q69A 1N60A 2WU5B 1YQ3B 1YN4A 1HXYD 2ONQA 2KWDA 3MFGA 1VJKA 3Q8BA 1FMAD 2Y3AA 1ROEA 2JYTA 2WXLA 2CU3A 4RFBA 1WGKA 1TS4A 1WWTA 2ZW1A 2EKIA 2MJEA 1F2RI 4L2YA 4IOIE 4YXDB 1ZXIA 4DQOC 4C7YA 4YTPB 3AE7B 1XLQA 1NYRA 2GB1A 4YWGG 2BB5A 2WXFA 1N62A 3BK2A 1I4GA 3VR9B 1L4ZB 3BYYB 2LHDA 4EE2A 2WNMA 4RH6A 1CZPA 1L6UA 2JXTA 4N58A 4TQ1A 2WQYB 5HI1A 1JWUD 3KWVA 5TSSA 1JWAD 1GAQB 4WURA 2INNE 1SIJA 2Q5WD 4RCOA 3AEGB 4RGMA 3P4PB 1QQRA 1PGAA 1XLNA 2RMMA 5BYSA 2HTME 4KGSA 1FEHA 4KGTA 1VDVA 5AUIA 1J7AA 1RFKA 1PYWD 4ARCA 2DWQA 1KLGD 2KMMA 4CQNA 1QILA 3V3XA 5BMHA 2MJ3A 3AEFB 1UGJA 3B2FA 4JWSC 1C9FA 1C76A 1Y56A 2IGDA 5EE9A 2WDRB 4DXGA 1FNVA 2MJDA 1KLUD 1QT9A 2W3SA 2K5PA 5FR3A 1FCLA 4GDLB 4XWWA 2JZPA 3TEXA 5BYRA 3NVWA 1V1PA 2BTEA 1Q10A 2PTLA 2E3TA 4XE0A 1QOFA 1N61A 2WXHA 3Q8AA 4N6EB 5D3DA 5D3IB 1CK1A 1HA5A 2QEJC 1ENFA 1FNUA 2QILA 3Q8CA 2JU6X 3KLSX 2MH7A 4RF0A 4JPSA 3NVZA 1L0XB 5FK9C 1M4VA 3P4SB 4JX1C 1UUPA 5I4DA 2J4XA 4IKGA 1ZDVA 1I7HA 2WP9B 1UWMA 2WXJA 3NZ3A 3PO0A 1MVKA 4MH8A 5EE3A 1FCCC 2BB6A 3NUHB 2WLBA 2INPE 3CWIA 2CJOA 1WRIA 4J3OD 1V1OA 4MT5A 1TKGA 1P7EA 2PVGC 1TZOA 1ZOYB 2WXIA 1R7SA 4HROA 1FRRA 4R3DA 1F2RC 1SJED 2LGIA 3V05A 1JW9D 3P4RB 2DYMA 2RDGA 5T8IA 4B0MA 3AEAB 1YN3A 2BW2A 3AEDB 4PT5A 1UWXA 1VRAB 2GRIA 2IGHA 1XLPA 1OQQA 4M0WA 3AMZA 4MM3B 1I4XA 1FNWA 1IUEA 3VR8B 1J7BA 1HZ6A 3T3OA 3U4EG 2Z8LA 3TEWA 1ZPSA 3P1MA 1D4BA 2AX5A 1STEA 1K53A 3ZJTA 1XF5L 4NAWB 4UDUC 1NI3A 2PVOD 3I57A 3FILA 3SR6A 4AS1A 5EE1A 1QKZA 2L83A 2N9KA 3H8HA 3MC0B 1YN5A 1I4QA 1T3QA 2IJ0A 1B9RA 4GDKB 2BYTA 1BXTA 2M0AA 2TSSA 3MJ5A 1E6EB 4A90A 1FM0D 2DYOA 1K52A 1C78A 3SFEB 1XCTL 2LEKA 1CJEA 3J9CA 4Q2JA 3R8BA 3B2GA 1E0ZA 4HRSA 4NZLB 1PGBA 3NRZA 4WIPA 4XWTA 4MACA 1TS2A 1JWSD 5LNK1 4JWUC 2J42A 3BZDB 3IXSA 4ZRQA 5E6JA 4P6VF 1QOAA 4HKQA 2RDHA 4LLGM 2ON8A 1SSNA 2PIAA 2FBWB 1D5XC 1D5ZC 2R61A 1QOGA 2LHEA 2JQRB 2W3RA 4REZA 2KN4A 1L0YB 2KDMA 3AECB 1I4RA 3N9YC 1IGCA 2WS3B 1YQ4B 1V97A 3AH7A 1PFDA 2QMTA 5GXGB 1V8CA 2V3PA 1VZ6A 2H88B 1YJJA 1TY0A 1ZP0B 5HFYA 4ARIA 1SB3C 3AE9B 1TKEA 3SFDB 3AV8A 1SF0A 5FKAC 2RPVA 4H2AA 1NYQA 1YMHE 3W9CB 2V3NA 1EWYC 4OW0A 4KX6B 5HHDG 1SE4A 1UNSA 2H89B 2W54A 4HJGE 3AE4B 3WCQA 1JROA 3IT4B 1OFFA 4OZAA 1E7PB 1K50A 2NTTA 2BS3B 3ZJVA 3E56A 1I4PA 1V1PB 2VZKD 3EA6A 1IGDA 1KF6B 1NEKB 1C4AA 2SAKA 2QIEB 4D2KA 3AEEB 1F0ZA 4L1BA 1F77A 2LMCA 3W5UB 1TS3A 1ZUD2 1FFVA 1WXQA 1HZ5A 4OVZA 1SBBB 4OZCA 1GPXA 2JWUA 1E9MA 3O13A 1VZ7A 4US9A 3R2TA 3HRDD 5BYQA 1RM6C 4TQ0A 3FAHA 2QSDA 1WSPA 2L1AA 2KQ4X 2WXOA 5C3JB 2AQ1B 3BWUD 2K3UA 1ET6A 4OHJA 2EELA 4AQ7A 1XO3A 3TEYA 4FXCA 4WH4A 4LK0M 1K51A 1FIQA 2G9HD 4GLSC 1CQVA 2IGGA 2IPKD 1T6BX 3AE2B 3BIID 4YTNB 2HDEA 1EU4A 3T3NA 3MP9A 2W55A 3LXFA 1KTKA 4YTMB 1TS5A 3URYA 4HKZE 4A8XC 1E10A 2B76B 2BS2B 4ZYSA 4C80A 2KAJA 1FO4A 3IT6B 3EUB2 1AN8A 4YSYB 1C4CA 1MI0A 2PLPA 5AUKA 4XDDA 2L52A 4WQMA 1DOIA 1NENB 1DOXA 1D5MC 1MPEA 2LJIA 2PKOA 1L4DB 3ZJUA 4B0EA 2NTSA 1HEZE 2IDYA 4KGRA 2ZW0A 3PZ8A 1A70A 2FE8A 1RYJA 1L6VA 3AE8B 1JRPA 1FXIA 5EE0A 3AE6B 4RGTA 1BMLC 1D6EC 1ZDXA 1TY2A 3DWGC 2AQ2B 1GB4A 3FILB 2SEBD 1LO5D 4L23A 3TSSA 4USAA 1SE3A 2OEDA 1FFUA 4RF1A 3I9V1 4RNAA 1IBXA 4ZHPA 2JSVX 1SE2A 2WXKA 3LYYA 3ZYYX 2VZKB 1N5XA 2D5GA 3AE1B 4IDIA 3DWMA 2I2YA 1HQRD 1QOBA 3BVMA 4C56C 1GOZA 3HVDA 5D7GA 1FRDA 4O1NA 1EM7A 5C2TB 2PMVA 1NVID 2YEPF 1YNTE 4KKJA 2J52A 4P16A 1PGXA 1KFYB 3PZ7A 2KACA 1I4HA 3W1SA 3VRBB 1L0VB 2XNAC 2Y5PA 3SEBA 2QJLA 1L5PA 1PDXA 1PUTA 2WXMA 1EWCA 3BVZA 3OWEB 2WDVB 2V4IB 3CIRB 5G5HA 4YSZB 2JX5A 3NS1A 1GB1A 2G1EA 1BUIC 3RPFC 3P63A 1MHHE 1JALA 1C4PA 3W2DA 2L32A 2WXQA 1DYQA 2CJNA 2WDQB 2K22A 2BS4B 2M56B 4ZHOA 3KWLA 3U7ZA 2JYEA 3U2SC 3LB8C 4A55A 1C79A 1KRHA 3NVVA 3GS2A 2LFIA 4C7ZA 1VR9A 3BK1A 3GP7A 4WWMA 2FUG1 2GI9A 1RWSA 1YJIA 3AB5A 3L4PA 3ETRA 3KQ4A 3AEBB 5BMGA 3Q8EA 1JCKB 3UI3A 2E6XA 3AM9A 2YEPB 3HVZA 1DOYA 2DBYA 2BT6A 1OQRA 1AYFA 5HG2A 2WXNA 2WXGA 3NVYA 1N63A 4JE3B 2N9LA 1ZE3D 3MHZA 3ABVB 2WXRA 1DGJA 1FXAA 2PW9A 2ACZB 2W82A 5BMIA 2N7JA 3P42A 3E9SA 4A6QA 2J53A 3U52E 1J7CA 2WXPA 4A9AA 5MPOA 4US8A 5G5GA 3ZQ4A 4HEA1 2BBCA 4RGNA 2NMQA 1TJEA 1SEBD 5H8YE 3TEZA 2X38A 1JWMD 1VLBA 4LTUA 4NAMA 1VZ8A 2DLBA 3FC4A 2M19A 3BVGA 1QLBB 2ICIA 1AW7A 2K9XA 4YSXB 2WU2B 5JXVA 1EU3A 4WAFA 3VQIA 4TMAB 3AE3B 5H92C 2AQ3B 1FD6A 1N5WA 4N59A 3P4QB 4OZBA 1QF6A 1JWBD 3BYTB 3GB1A 3ZGZA 1ZXHA 1TKYA 1C77A 2I38A 3IAS1 2Y5CA 4ITKA 1KH0A 4KKIA 2V0GA 1T5XD 2LUMA 4XDCA 3AE5B 1B1ZA 2XN9C 3VRAB 1ET9A 3RFZB 1ACCA 2K0PA 1TYGB 1WYGA 1JQ4A 1MHXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WIP A;  2D5G A;  1WSP A;  3PZ7 A;  3PZ8 A; 
#chains in the Genus database with same CATH topology
 1XEE A;  1SXT A;  1UZX B;  2GBK A;  3A1Q B;  4DXF A;  1XCQ L;  2N7D A;  4ZOH C;  3RMK C;  2DAF A;  4YT0 B;  4KDL B;  3APF A;  3Q3N C;  3AN1 A;  3B9J A;  3R7R A;  3GZN B;  4RGO S;  1TZ1 A;  3NHE B;  3EC8 A;  1WMH B;  2KHW B;  4MEL A;  5DPR A;  1YQ3 B;  1YN4 A;  4FN2 A;  3VHT C;  2L8J A;  2KFJ A;  2JY6 A;  4BKS A;  1WGK A;  1TS4 A;  4KZC A;  4L2Y A;  3KYC D;  4YXD B;  5J17 A;  3ENE A;  2CS4 A;  2X8X X;  4YTP B;  5CX3 A;  3VTV A;  1WR1 A;  2GB1 A;  2WXF A;  2REX A;  3VR9 B;  3DPD A;  4ICU A;  2LVP A;  4ZDV A;  2JXT A;  2WQY B;  2QCZ A;  4GSW A;  2BKF A;  4A3O A;  2MQJ A;  4ZRI A;  2N4F A;  1JWU D;  1NI2 A;  1GAQ B;  2INN E;  1SIJ A;  5IO9 A;  3R7Q A;  1XLN A;  4MDK E;  1LQB A;  4F7Z A;  2HTM E;  1FEH A;  1RFK A;  5CHV C;  1KLG D;  4M8N A;  2VH2 A;  2KVZ A;  1C9F A;  1C76 A;  4DXG A;  4WWN A;  1OEY A;  2K8H A;  2D3C A;  2W3S A;  2JZP A;  1NDD A;  1WZ3 A;  5BYR A;  3NVW A;  4BKS D;  2BTE A;  3DVN U;  4ZRK A;  2AEH A;  2E3T A;  3L16 A;  4E3C A;  2L0T A;  2KKC A;  1FNU A;  1WXV A;  3DVN V;  4DHZ B;  1WX8 A;  1UBI A;  3DHI C;  1M4V A;  2M0X A;  4JX1 C;  2KLG A;  4AP4 C;  1J8C A;  3NZU A;  2WXJ A;  4MH8 A;  1L2N A;  3NOB A;  4DHZ E;  2BB6 A;  2KD0 A;  2INP E;  3QX1 A;  4MT5 A;  4EZK A;  5C23 A;  3IHP C;  1TZO A;  2WXI A;  4R3D A;  1P3Q U;  1UGM A;  3B0A A;  1E8X A;  2PJH A;  1YQB A;  4B0M A;  4EKU A;  2BW2 A;  2PE9 A;  2GRI A;  4CO7 A;  1XLP A;  3AMZ A;  3N30 A;  1I4X A;  3ZIM A;  1J7B A;  4FHJ A;  4PK1 A;  2WDT B;  2MBE A;  3P1M A;  2AX5 A;  1STE A;  2LZ6 A;  3ZRF A;  3SR6 A;  4AS1 A;  3WAN A;  1QKZ A;  4ICV A;  1I4Q A;  2MW5 A;  3L17 A;  2BYT A;  2TSS A;  2GBJ A;  4DWF A;  2IYD B;  2DYO A;  3EEC A;  1C78 A;  1XCT L;  3SU8 X;  3J9C A;  2AL3 A;  3UGB B;  4HRS A;  2V9H A;  2GOW A;  4DDI D;  4WIP A;  4XWT A;  1GC7 A;  1JWS D;  4JWU C;  2VH1 A;  3CF6 E;  3MTN B;  4AOF A;  2LHE A;  3H7P A;  2JQR B;  3H7P B;  1P1A A;  2IO0 B;  1PFD A;  3PLU A;  2H88 B;  2M1M A;  1SB3 C;  4RM8 A;  5FKA C;  3NJT A;  3BIN A;  2V3N A;  4BFR A;  3B1L X;  3AE4 B;  3WCQ A;  3IT4 B;  1OFF A;  2PE6 B;  3U30 A;  2WHI A;  1WX7 A;  2BS3 B;  3E56 A;  1I4P A;  2C9W B;  3ZNH B;  4HWI B;  1C4A A;  2BF8 B;  1T0Y A;  2JZZ A;  4L1B A;  2LMC A;  3JW0 X;  1V81 A;  2DAJ A;  4DXA B;  2MBB B;  1SBB B;  2O6V A;  1E8Y A;  2JWU A;  4BAX A;  2M8S A;  3FAH A;  4W9K A;  2QSD A;  1WSP A;  4W9G A;  4MGI E;  4HCN B;  3ZTD A;  2EEL A;  1HE8 A;  4LK0 M;  2BYE A;  4EEW A;  4BBN C;  2KLC A;  3AE2 B;  2LWP A;  3BII D;  1EU4 A;  4YTM B;  4XGA B;  1TS5 A;  4F8C B;  3URY A;  4HKZ E;  2B76 B;  3A33 B;  1FXT B;  2KAJ A;  1FO4 A;  2W9N A;  2JF5 A;  2PLP A;  2ASQ A;  2NPT B;  5FR6 A;  1DOI A;  1F9J A;  1DOX A;  2LJI A;  3RZW C;  1E7V A;  2CU1 A;  1HEZ E;  4KGR A;  3PZ8 A;  1A70 A;  2FE8 A;  5AZF A;  5GMV A;  1JRP A;  2G3Q B;  1BML C;  1D6E C;  3HK0 A;  1GB4 A;  1E90 A;  1H4R A;  2KVR A;  1LO5 D;  1S3S G;  1SE3 A;  2N9E B;  2OED A;  2JVC A;  2O6V D;  4RNA A;  4W9C A;  4FA6 A;  2WWZ A;  2KX3 A;  3WA0 A;  5L83 A;  4IWQ A;  1L7Y A;  1GOZ A;  3HVD A;  2RDB C;  1EM7 A;  1UD7 A;  2YEP F;  2K8C A;  1WJ4 A;  4I6N B;  1PGX A;  2KMC A;  3NZS A;  1YJ1 A;  1L0V B;  2FIF A;  2XNA C;  1KM7 A;  1PUT A;  3BVZ A;  2KFK A;  2C7M B;  1GB1 A;  2DYB A;  3P63 A;  4LJO B;  4OVU A;  3FKY A;  2WDQ B;  2D3A A;  3N3K B;  1F52 A;  2M56 B;  3U7Z A;  3LB8 C;  3ZNI D;  1KRH A;  3NVV A;  3GS2 A;  2LFI A;  3QIJ A;  3BK1 A;  1WH3 A;  1XD3 B;  1RWS A;  3ETR A;  4ANX A;  1IPG A;  3AEB B;  5BMG A;  1UF0 A;  3Q8E A;  4QAY A;  3AM9 A;  3HVZ A;  1DOY A;  3A9J B;  2BT6 A;  1OQR A;  2A5U A;  4C00 A;  2WXG A;  4GDL A;  2KN5 A;  1FXA A;  1Y8R C;  2ACZ B;  5BMI A;  4A6Q A;  3U52 E;  5HKH A;  3A4S C;  4A9A A;  4K3B A;  2GBM A;  2BBC A;  4RGN A;  4BOS C;  3ONS A;  1TJE A;  2LGD A;  2X38 A;  1VLB A;  2HD5 B;  3CSF A;  2M19 A;  2DZM A;  1V5O A;  4GOC A;  3DDC B;  2K9X A;  5JXV A;  1GNU A;  2LUE A;  4DK5 A;  4WAF A;  3SDL C;  2MHJ A;  2LGY A;  3ZGZ A;  3PRE A;  3KH0 A;  4ANV A;  2J0K A;  2V0G A;  2Y5C A;  1IYF A;  2LUM A;  3QK0 A;  4BKT A;  4BBN F;  3PSE B;  4NJC A;  5BO4 B;  1WXS A;  1V9J A;  4W9I A;  1SJH D;  3HUI A;  3VDZ A;  2MEK A;  2KC2 A;  1ESF A;  2OHF A;  4IC7 B;  1AWD A;  2JRI B;  2LGS A;  1TBE A;  4LNI A;  2AL6 A;  3IAM 1;  3C8Y A;  1WJN A;  3HM6 X;  2MX2 A;  4AJY B;  2ONQ A;  4GDK A;  2KWD A;  1EF5 A;  2JYT A;  3Q3F A;  2ZW1 A;  3KVF B;  4MSQ B;  2KJ6 A;  1ZXI A;  3EHV A;  1NBF C;  1P9D U;  4C7Y A;  2KQS A;  3IG3 A;  2IO3 B;  5E6N A;  4LNO A;  1L4Z B;  2GBR A;  3BYY B;  4RH6 A;  4MGZ E;  1SE9 A;  2KDI A;  2PPH A;  1L6U A;  2L05 A;  1QZE A;  5TR5 A;  4GXB A;  3KWV A;  3M62 B;  4P7I A;  5TSS A;  1JWA D;  1E8Z A;  2IBI B;  4GU2 A;  4RGM A;  3P4P B;  1I42 A;  3JVZ X;  2RMM A;  3QWZ B;  3KYD D;  2M4N A;  2G4S A;  2O2V B;  3DVG Y;  4KGT A;  1VDV A;  3WAM A;  2KMM A;  1QIL A;  3V3X A;  3AEF B;  1UGJ A;  4JWS C;  1Y56 A;  5EE9 A;  2ZNV B;  2KTR A;  1KLU D;  2KTR B;  3RN9 C;  5FR3 A;  4IG7 B;  4IW0 A;  1LXD A;  3M3J A;  4XE0 A;  1QOF A;  3DVG X;  3AUL A;  2WXH A;  4N6E B;  2Y5B B;  1T0Q C;  2KJH B;  2QEJ C;  4MSM B;  2QIL A;  2JU6 X;  4RF0 A;  4PS7 A;  1WM3 A;  5IA7 A;  5L95 C;  5FK9 C;  2K6Q A;  3ZNZ B;  5I4D A;  2J4X A;  4IKG A;  3KUD B;  1OQY A;  1ZDV A;  3PO0 A;  1MVK A;  1EUV B;  1WGH A;  3NUH B;  1WRI A;  4P1B C;  2K1F A;  2PVG C;  3N1Z C;  4WAA A;  4HRO A;  1WZ0 A;  2IY1 B;  1SJE D;  3EFC A;  5G55 A;  2DYM A;  3QCA A;  3AEA B;  3V60 A;  3WAL A;  4W9J A;  2LVQ A;  1VRA B;  2FCS A;  4M0W A;  1OQQ A;  4NQK E;  1V2Y A;  3T3O A;  1HZ6 A;  1D4B A;  2BVC A;  2DHZ A;  2MA9 B;  3ZJT A;  2QDF A;  3NY5 A;  2GLS A;  3I57 A;  3FIL A;  2KO3 A;  2L83 A;  4K7S A;  1MFW A;  3NS8 A;  2AYO B;  3OJ3 A;  2IJ0 A;  2LXA A;  1Q0W B;  4DBG A;  3SFE B;  3HHM A;  2LEK A;  1CJE A;  3JYU A;  4Q2J A;  1E0Z A;  3T9L A;  3WAO A;  3UQB A;  4TUU A;  3NRZ A;  3Q3M C;  4MAC A;  4FLH A;  2J42 A;  4JL9 A;  2LGX A;  2DZK A;  2RDH A;  3KUC B;  3DBH I;  3VFK A;  2QHO A;  1QOG A;  4REZ A;  2Z0D B;  4W9F A;  5JHB A;  3PHW B;  2KDM A;  2MBO A;  2DZI A;  2OJW A;  1IGC A;  2WS3 B;  4C4V A;  1YQ4 B;  1V97 A;  2CR5 A;  2V3P A;  1YJJ A;  1TY0 A;  3AE9 B;  3RNF C;  3SFD B;  3AV8 A;  1NYQ A;  1YMH E;  3W9C B;  5E6P A;  2W54 A;  4HJG E;  3QAR A;  2XBB C;  1K50 A;  2NTT A;  3R66 C;  4A3P A;  3ZJV A;  2KOX A;  5DCN A;  4M02 A;  1YIW A;  1WRD B;  2D07 B;  3QQ8 B;  1IGD A;  1KF6 B;  1R4M I;  2BKR B;  1NEK B;  2Z59 B;  3V62 A;  1K8R B;  5AEK B;  3W5U B;  1WXQ A;  1GC6 A;  1HZ5 A;  4FJZ A;  2KJR A;  2MBQ A;  4OZC A;  2DZJ A;  1GPX A;  4B95 A;  2DX5 B;  3O13 A;  4US9 A;  4FHK A;  5BYQ A;  1U4A A;  4PS8 A;  3ZO5 B;  5G2N A;  3RNE C;  2KAN A;  2L1A A;  2WXO A;  3ZNG C;  4G3X B;  4OHJ A;  4IWO A;  3K9P B;  4FXC A;  4WJP A;  4E74 A;  1FIQ A;  2G9H D;  4LCD E;  4GLS C;  1CQV A;  2D10 A;  2IGG A;  2IPK D;  1T6B X;  4YTN B;  1V6E A;  3T3N A;  3MP9 A;  3LXF A;  4OVV A;  5KHQ A;  4ZYS A;  4C80 A;  3EUB 2;  4I6P A;  2L52 A;  4WQM A;  2WX0 A;  2CHZ A;  1RYJ A;  1SGH A;  3AE8 B;  3AE6 B;  3TMP B;  3P2B A;  3L10 B;  1TY2 A;  3IBE A;  4HPP A;  3DBS A;  5IP4 D;  1UEL A;  3PGE A;  1X1M A;  2N7E A;  1IBX A;  4S17 A;  2JSV X;  3LYY A;  3ZYY X;  2FUH B;  1N5X A;  4IDI A;  3DWM A;  3ZKJ C;  3H6N A;  4C56 C;  1S1Q B;  1FRD A;  4O1N A;  4E71 A;  1C3T A;  4WJN A;  4KKJ A;  1V80 A;  4MH0 E;  3TL5 A;  4P16 A;  3Q3O C;  3LDZ E;  3VRB B;  3SEB A;  2QJL A;  2FNJ B;  2WXM A;  3C0R B;  3Q6B A;  1N6Z A;  5AZG A;  1D3Z A;  3UQA A;  4YSZ B;  4IM2 A;  4LJP B;  1JAL A;  3VVW B;  4URK A;  2JYE A;  4A55 A;  1VR9 A;  4WWM A;  2FUG 1;  3L4P A;  4B6W A;  3N20 C;  2BYF A;  3DBH B;  2YEP B;  2JUO A;  4G11 A;  3ZXV A;  4LDT B;  2WXN A;  2FCN A;  4JE3 B;  2N9L A;  2N1W A;  3ABV B;  2WXR A;  2O6V B;  4K3C A;  1DGJ A;  2W82 A;  3PHX B;  3TCA A;  2J53 A;  2WXP A;  4HK2 A;  5D6J B;  1J0G A;  1H8C A;  1YX5 B;  5H8Y E;  3TBL D;  1WM2 A;  4LTU A;  2K39 A;  4NAM A;  3X23 A;  1VZ8 A;  1QLB B;  1T0S C;  3ECI A;  2ICI A;  2WU2 B;  3APC A;  4TMA B;  1R4M B;  3AE3 B;  4PS3 A;  2AQ3 B;  1N5W A;  2V1Y A;  3ZVV A;  3P4Q B;  1QF6 A;  3GB1 A;  1ZXH A;  1TKY A;  1C77 A;  4ITK A;  1KH0 A;  4YL8 A;  3AE5 B;  4W9D A;  3VRA B;  2DEN B;  2K8B A;  4J3O D;  1TTN A;  3VUY A;  1MHX A;  2K6D B;  5D2M B;  2KWC A;  4LDT D;  1XXG A;  3GE3 C;  1KJT A;  4NJ6 A;  4ZRP A;  2N0S B;  3BY4 B;  2KK8 A;  2OOB B;  1XLO A;  3DBR I;  2D2Q A;  3Q8F A;  3V61 A;  1V49 A;  3EGR A;  1GJZ A;  4NAW A;  1TT5 B;  3R2I A;  2EMT A;  1J19 A;  1WE7 A;  2AWT A;  3W5V B;  4FBJ B;  3Q69 A;  1WJU A;  2WU5 B;  3VTU A;  1KLV A;  2J0M A;  2JT4 B;  3RZF A;  3MFG A;  2KX0 A;  3Q8B A;  1FMA D;  2Y3A A;  2ZVN A;  2WXL A;  1Q1O A;  4RFB A;  1WWT A;  2MJE A;  3H9D A;  4ANW A;  3UIN B;  4FJY A;  1WGD A;  1XLQ A;  2KFK B;  4YWG G;  2WYQ A;  1I4G A;  3MC8 A;  4HCP B;  1WX9 A;  3MC9 A;  1I35 A;  1T0R C;  1CZP A;  4N58 A;  4K7W A;  4RM9 A;  4N9F 4;  4WUR A;  4B9K A;  3AEG B;  4IM0 A;  3VXW A;  4JQW C;  1QQR A;  1PGA A;  2WGS A;  2FCM A;  5AUI A;  1J7A A;  1PYW D;  1EF1 A;  4CQN A;  2MJ3 A;  2L76 A;  3A9K A;  3RCZ A;  1QT9 A;  1FCL A;  3N32 A;  2IND C;  4GDL B;  3V6C B;  4XWW A;  5JHA A;  1IP9 A;  3DOW A;  1V1P A;  2CHX A;  1Q10 A;  1GG3 A;  3JSV A;  2ZZP B;  2C7N B;  3JSV B;  4WQO B;  2IZV B;  5J18 A;  1CK1 A;  1HA5 A;  3Q8C A;  3KLS X;  2MH7 A;  2EMS A;  4JPS A;  3NVZ A;  4MJS A;  1L0X B;  4MJS B;  1UUP A;  2IO2 B;  1WGR A;  1UWM A;  3DCG A;  4NJ7 A;  3UF8 A;  2L00 B;  2KYW A;  3CWI A;  2CJO A;  1V1O A;  1TKG A;  3GZN I;  3M63 B;  5E6O A;  3ZUN A;  2KDF B;  1ZOY B;  2LGI A;  4FAD A;  2V4L A;  4PYZ A;  3SHQ A;  2RDG A;  3RYT A;  1HTO A;  3AED B;  2KXJ A;  4PT5 A;  3B08 A;  2IGH A;  4MM3 A;  2XEW A;  2B3A A;  3I3T B;  4MM3 B;  5LLI A;  1FNW A;  1IUE A;  3VR8 B;  3U4E G;  2LVO A;  5J2R A;  3L0W B;  1ZPS A;  1K53 A;  1PQS A;  1XF5 L;  4UDU C;  2PVO D;  1RLF A;  1KOT A;  4KIK A;  4BZA A;  2MBH A;  4K1R B;  3MC0 B;  4LNK A;  4GDK B;  2M0A A;  3MJ5 A;  2MWS B;  1FM0 D;  3DHG C;  2J0J A;  3L13 A;  3OLM D;  2MLB A;  4NQL B;  3R8B A;  3B2G A;  2FCQ A;  2V3S A;  2BQQ A;  3DHH C;  1TS2 A;  5LNK 1;  2LRW A;  3BZD B;  3IXS A;  5CHW A;  3PRP B;  4ZRQ A;  4P6V F;  4HKQ A;  4LLG M;  2BYV E;  2ON8 A;  1SSN A;  1D5Z C;  2R61 A;  4TKN A;  4HPM B;  3VH3 B;  2KN4 A;  4TV3 A;  5AZH A;  3DQV A;  1I4R A;  3N9Y C;  4P1C C;  3AH7 A;  2QMT A;  2J7Q B;  5GXG B;  1BT0 A;  5LXI B;  2XK5 A;  2QC8 A;  5LXH A;  2XK5 B;  1TGZ B;  1EWY C;  4OW0 A;  2WX1 A;  4KX6 B;  5HHD G;  1UNS A;  2H89 B;  2L3Z A;  2D3B A;  3N1X C;  3KUZ A;  2KDE B;  2VZK D;  3EA6 A;  2NVU I;  2ZEQ A;  2Z0E B;  4WJO A;  1VCB A;  3AEE B;  1F0Z A;  1F77 A;  2FAZ A;  3TIX A;  1ZUD 2;  3PT2 B;  5KHO A;  3Q3J A;  1AAR A;  5DPS A;  3APD A;  3R2T A;  2ZJD A;  3VUX A;  3W1S C;  1RM6 C;  4TQ0 A;  3RT3 B;  2YLM A;  2INC C;  1JRU A;  3OJ4 B;  2AQ1 B;  3BWU D;  2K3U A;  1ET6 A;  3PVL A;  4WH4 A;  3DBL I;  1YX6 B;  2JPH A;  2HDE A;  4XX5 A;  4A8X C;  3IFW B;  1YD8 U;  1AN8 A;  1C4C A;  1MI0 A;  1NEN B;  1MJD A;  4M0W B;  1D5M C;  1MPE A;  2PKO A;  1L4D B;  1RAX A;  3OG5 A;  4B0E A;  2NTS A;  2IDY A;  1L6V A;  4EOY A;  5EE0 A;  1WGG A;  3RNC C;  3ZTC A;  1TIF A;  4RGT A;  1ZDX A;  3A1Q A;  3DWG C;  2AQ2 B;  3FIL B;  4L23 A;  3TSS A;  2KTF A;  4USA A;  1FFU A;  1R4N I;  1A5R A;  4ZHP A;  2WXK A;  2G45 B;  1P0R A;  5DPW A;  3AE1 B;  1WMH A;  2NR2 A;  3BVM A;  4S0R A;  1WYW B;  5D7G A;  1NVI D;  4GMV A;  1G6J A;  1YNT E;  1LGR A;  3PZ7 A;  2EKE C;  3W1S A;  1PDX A;  2BPS A;  1EWC A;  4C4V B;  3L54 A;  3K9O B;  1WGY A;  2WDV B;  3CMM B;  2V4I B;  3CIR B;  5G5H A;  4AWJ A;  3AU5 A;  2JX5 A;  3NS1 A;  3QAQ A;  2C5L C;  3HIZ A;  3RPF C;  3L08 A;  2CJN A;  2K22 A;  2LJ5 A;  4ZHO A;  3U2S C;  3MJW A;  2BWE S;  4NNJ B;  1C79 A;  4JIO U;  4C7Z A;  2GI9 A;  1YJI A;  3KQ4 A;  4JLC A;  2RGF A;  1JCK B;  2E6X A;  2I1J A;  3CST A;  1RRB A;  1AYF A;  5HG2 A;  1N63 A;  2OJR A;  2N9P C;  2ZCC A;  1ZGU B;  1ZE3 D;  3MHZ A;  1WI0 A;  4XZ4 A;  2LXC A;  4KZ0 A;  4KSL C;  2CKH B;  3E9S A;  1UBQ A;  1J7C A;  4HLE A;  3H7S A;  5G5G A;  2ZVO A;  3ZQ4 A;  2A4Z A;  4HEA 1;  2NMQ A;  4FUL A;  4IUM B;  3TEZ A;  1JWM D;  3PRM B;  3FC4 A;  2UYZ B;  4WWO A;  3BVG A;  2R2O A;  3PLV A;  4G50 A;  1WR6 E;  3D32 A;  3PTF C;  1FD6 A;  2D3G A;  4M8M A;  1JWB D;  3BYT B;  4II3 B;  3IAS 1;  4KKI A;  3V6E B;  1T5X D;  4PYU A;  1B1Z A;  1ET9 A;  3RFZ B;  1ACC A;  2K0P A;  2UWQ A;  2VRR B;  1F1H A;  1P7F A;  4BOZ B;  4X57 B;  3R3M A;  1IBX B;  3DBL B;  4NY0 A;  4EUT A;  4W9L A;  3U8Z A;  5CHF A;  4TSS A;  1V86 A;  4HDO A;  1JML A;  3TUO A;  1ISN A;  2NBU A;  1N60 A;  3UIO B;  1HXY D;  1VJK A;  3I63 C;  2PEA A;  1ROE A;  1WE6 A;  4RMA A;  2CU3 A;  2EKI A;  1OEY J;  1F2R I;  1SIF A;  1LM8 B;  4IOI E;  4J6I A;  3ML9 A;  4DQO C;  2ZCB A;  3AE7 B;  1NYR A;  4HJK A;  3W1Y A;  2BB5 A;  3BK2 A;  1N62 A;  2GMI C;  2NS5 A;  2LHD A;  4EE2 A;  2NBV B;  1R4N B;  1ZKH A;  2WNM A;  4TQ1 A;  5HI1 A;  3A4R A;  2Q5W D;  4RCO A;  5JZE B;  4LNN A;  2K25 A;  2UU7 A;  3EFU A;  3M95 A;  5BYS A;  2IY0 B;  3ZDT A;  1XQQ A;  4KGS A;  3VH4 B;  2LAS A;  4ARC A;  2DWQ A;  5BMH A;  3VUW A;  3B2F A;  2IGD A;  2WDR B;  1WFY A;  1FNV A;  2MJD A;  2K5P A;  3TEX A;  3U7D A;  3QHT A;  2D11 A;  2JRH A;  4GIV A;  3NG0 A;  5IN7 A;  5IOI A;  2PTL A;  4FJV B;  1N61 A;  3Q2A C;  3Q8A A;  5D3D A;  5D3I B;  1M94 A;  1ENF A;  3RI7 C;  3PV1 A;  2N9X A;  3P4S B;  1MG4 A;  4DDG D;  3ALB A;  3ZXR A;  2KT7 A;  3AI5 A;  2M17 A;  1I7H A;  2ZPY A;  2WP9 B;  3RNG C;  5EE3 A;  3NZ3 A;  2DNF A;  2YVC A;  1WY8 A;  3O65 B;  1FCC C;  2WLB A;  4MGK E;  1Z5S B;  4EZL A;  3TJP A;  1P7E A;  1R7S A;  1FRR A;  2KDB A;  1F2R C;  3V05 A;  3GOE A;  1JW9 D;  3P4R B;  2KZR A;  5T8I A;  2NPT A;  1YN3 A;  3PPA A;  1UWX A;  4CYE A;  4KSK C;  2RR9 A;  2Z8L A;  3TEW A;  1WXA A;  4ACF A;  4LNF A;  4NAW B;  1HTQ A;  1NI3 A;  2IO1 B;  5EE1 A;  2N9K A;  3H8H A;  1YN5 A;  1T3Q A;  2KMA A;  1B9R A;  3IVF A;  1BXT A;  3PZD A;  1E6E B;  4A90 A;  3AXC A;  1C1Y B;  1K52 A;  2BWF A;  4HXD A;  1P98 A;  3SD5 A;  3S2A A;  2JXX A;  2LRU A;  3I5J C;  2JWZ A;  4NZL B;  1PGB A;  4MGY E;  4XYC A;  3X0W A;  1RFA A;  5E6J A;  1WIA A;  1QOA A;  2PIA A;  4JGH B;  2FBW B;  1D5X C;  4M01 A;  2W3R A;  1YOV B;  1L0Y B;  1EO6 A;  3AEC B;  2NCN A;  1V8C A;  2L0F A;  1VZ6 A;  1ZP0 B;  5HFY A;  4ARI A;  1TKE A;  4XC2 A;  1SF0 A;  2RPV A;  4H2A A;  1SE4 A;  4M00 A;  1JRO A;  3A9K B;  4OZA A;  1E7P B;  1OGW A;  1MG8 A;  1V1P B;  4DHJ B;  2SAK A;  2QIE B;  4D2K A;  2ZPN A;  1VD2 A;  3A9J A;  2RD0 A;  1TS3 A;  3H1U A;  1FFV A;  4OVZ A;  4EFO A;  3LJ3 A;  2I1K A;  1E9M A;  4G0N B;  5D94 A;  1VZ7 A;  3HRD D;  1Q5W B;  2BGF A;  1OTR B;  5DPT A;  1FPY A;  2KQ4 X;  5C3J B;  3RNB C;  3T8M A;  4AJW A;  5C1Z A;  4AQ7 A;  1XT9 B;  1XO3 A;  3ML8 A;  3TEY A;  1K51 A;  5JH5 C;  3N1Y C;  2KNB A;  5IKC M;  4ASW C;  3KW5 B;  2W55 A;  2MP2 A;  1KTK A;  4WJQ A;  2R2Q A;  2MP2 B;  4ZYN A;  3RD2 A;  3VTW A;  4K7U A;  2LD9 A;  2BS2 B;  3AU4 A;  1E10 A;  2MCN B;  3IT6 B;  2JZ3 B;  4YSY B;  5AUK A;  1LFD A;  4XDD A;  3RNA C;  4WWP A;  3ZJU A;  3QA8 A;  3QJZ A;  2ZW0 A;  4DHJ D;  1V5T A;  4IWP A;  1FXI A;  4I6L B;  3ZRC A;  2KWV B;  4KIK B;  2SEB D;  2ZNV C;  4NPN A;  1E8W A;  4ZRJ A;  2KC1 A;  3ZLZ A;  2HTH A;  4RF1 A;  2KQ7 A;  2L7R A;  3I9V 1;  2N1V A;  1SE2 A;  2VZK B;  2D5G A;  2I2Y A;  1HQR D;  1QOB A;  4A20 A;  4GB9 A;  5C2T B;  3VAW A;  4CHK A;  4ANU A;  1Z2M A;  4KDI C;  2J52 A;  1KFY B;  2KAC A;  2MSE D;  1I4H A;  3DBR B;  1GUA B;  3WIM A;  2Y5P A;  3PRZ A;  1L5P A;  1E7U A;  4BKG A;  5EDS A;  3OWE B;  3RUL A;  2LI5 A;  2RSU A;  4HDQ A;  5IAA C;  2G4D B;  2G1E A;  1BUI C;  2GBN A;  1MHH E;  1C4P A;  3W2D A;  4GN1 A;  2L32 A;  2WXQ A;  2C7H A;  1DYQ A;  4GGQ A;  2BS4 B;  2KWU B;  3KWL A;  3GE8 C;  1WXM A;  4HVB A;  3GP7 A;  1CMX B;  2O2V A;  3AB5 A;  3HM3 A;  3OAW A;  4EZJ A;  3UI3 A;  1ZW7 A;  2HJ8 A;  3C19 A;  2DBY A;  3MHS D;  3NVY A;  1WF9 A;  3WAP A;  4BVU C;  2RPQ A;  1UH6 A;  2PW9 A;  4W9H A;  2N7J A;  3P42 A;  3QC8 B;  2NBW B;  4IM3 A;  5CTR C;  5MPO A;  4K81 A;  4US8 A;  1E5W A;  2C60 A;  3PS6 A;  3ZDM C;  1SEB D;  2HE7 A;  1WJ6 A;  2DLB A;  4II2 B;  3RUI B;  4MEM A;  2CHW A;  3Q14 C;  4HPL B;  1AW7 A;  4YSX B;  1EU3 A;  4F1S A;  3VQI A;  2HJ1 A;  3ZW3 A;  4KV2 A;  5H92 C;  4KVG B;  4N59 A;  2FID A;  2MRP A;  4OZB A;  3UIP B;  2I38 A;  4XDC A;  2XN9 C;  4W9E A;  4AUQ C;  1TYG B;  1WYG A;  1JQ4 A;  2PMV A; 
#chains in the Genus database with same CATH homology
 1XEE A;  1SXT A;  4DXF A;  4NJC A;  1XCQ L;  1XXG A;  4ZOH C;  1P7F A;  4ZRP A;  1SJH D;  4YT0 B;  2N0S B;  3HUI A;  1IBX B;  2MEK A;  3AN1 A;  3B9J A;  1XLO A;  4RGO S;  1ESF A;  2OHF A;  1AWD A;  3Q8F A;  4TSS A;  3EGR A;  1JML A;  3TUO A;  3IAM 1;  3R2I A;  3C8Y A;  3W5V B;  3Q69 A;  1N60 A;  2WU5 B;  1YQ3 B;  1YN4 A;  1HXY D;  2ONQ A;  2KWD A;  3MFG A;  1VJK A;  3Q8B A;  1FMA D;  2Y3A A;  1ROE A;  2JYT A;  2WXL A;  2CU3 A;  4RFB A;  1WGK A;  1TS4 A;  1WWT A;  2ZW1 A;  2EKI A;  2MJE A;  1F2R I;  4L2Y A;  4IOI E;  4YXD B;  1ZXI A;  4DQO C;  4C7Y A;  4YTP B;  3AE7 B;  1XLQ A;  1NYR A;  2GB1 A;  4YWG G;  2BB5 A;  2WXF A;  1N62 A;  3BK2 A;  1I4G A;  3VR9 B;  1L4Z B;  3BYY B;  2LHD A;  4EE2 A;  2WNM A;  4RH6 A;  1CZP A;  1L6U A;  2JXT A;  4N58 A;  4TQ1 A;  2WQY B;  5HI1 A;  1JWU D;  3KWV A;  5TSS A;  1JWA D;  1GAQ B;  4WUR A;  2INN E;  1SIJ A;  2Q5W D;  4RCO A;  3AEG B;  4RGM A;  3P4P B;  1QQR A;  1PGA A;  1XLN A;  2RMM A;  5BYS A;  2HTM E;  4KGS A;  1FEH A;  4KGT A;  1VDV A;  5AUI A;  1J7A A;  1RFK A;  1PYW D;  4ARC A;  2DWQ A;  1KLG D;  2KMM A;  4CQN A;  1QIL A;  3V3X A;  5BMH A;  2MJ3 A;  3AEF B;  1UGJ A;  3B2F A;  4JWS C;  1C9F A;  1C76 A;  1Y56 A;  2IGD A;  5EE9 A;  2WDR B;  4DXG A;  1FNV A;  2MJD A;  1KLU D;  1QT9 A;  2W3S A;  2K5P A;  5FR3 A;  1FCL A;  4GDL B;  4XWW A;  2JZP A;  3TEX A;  5BYR A;  3NVW A;  1V1P A;  2BTE A;  1Q10 A;  2PTL A;  2E3T A;  4XE0 A;  1QOF A;  1N61 A;  2WXH A;  3Q8A A;  4N6E B;  5D3D A;  5D3I B;  1CK1 A;  1HA5 A;  2QEJ C;  1ENF A;  1FNU A;  2QIL A;  3Q8C A;  2JU6 X;  3KLS X;  2MH7 A;  4RF0 A;  4JPS A;  3NVZ A;  1L0X B;  5FK9 C;  1M4V A;  3P4S B;  4JX1 C;  1UUP A;  5I4D A;  2J4X A;  4IKG A;  1ZDV A;  1I7H A;  2WP9 B;  1UWM A;  2WXJ A;  3NZ3 A;  3PO0 A;  1MVK A;  4MH8 A;  5EE3 A;  1FCC C;  2BB6 A;  3NUH B;  2WLB A;  2INP E;  3CWI A;  2CJO A;  1WRI A;  4J3O D;  1V1O A;  4MT5 A;  1TKG A;  1P7E A;  2PVG C;  1TZO A;  1ZOY B;  2WXI A;  1R7S A;  4HRO A;  1FRR A;  4R3D A;  1F2R C;  1SJE D;  2LGI A;  3V05 A;  1JW9 D;  3P4R B;  2DYM A;  2RDG A;  5T8I A;  4B0M A;  3AEA B;  1YN3 A;  2BW2 A;  3AED B;  4PT5 A;  1UWX A;  1VRA B;  2GRI A;  2IGH A;  1XLP A;  1OQQ A;  4M0W A;  3AMZ A;  4MM3 B;  1I4X A;  1FNW A;  1IUE A;  3VR8 B;  1J7B A;  1HZ6 A;  3T3O A;  3U4E G;  2Z8L A;  3TEW A;  1ZPS A;  3P1M A;  1D4B A;  2AX5 A;  1STE A;  1K53 A;  3ZJT A;  1XF5 L;  4NAW B;  4UDU C;  1NI3 A;  2PVO D;  3I57 A;  3FIL A;  3SR6 A;  4AS1 A;  5EE1 A;  1QKZ A;  2L83 A;  2N9K A;  3H8H A;  3MC0 B;  1YN5 A;  1I4Q A;  1T3Q A;  2IJ0 A;  1B9R A;  4GDK B;  2BYT A;  1BXT A;  2M0A A;  2TSS A;  3MJ5 A;  1E6E B;  4A90 A;  1FM0 D;  2DYO A;  1K52 A;  1C78 A;  3SFE B;  1XCT L;  2LEK A;  1CJE A;  3J9C A;  4Q2J A;  3R8B A;  3B2G A;  1E0Z A;  4HRS A;  4NZL B;  1PGB A;  3NRZ A;  4WIP A;  4XWT A;  4MAC A;  1TS2 A;  1JWS D;  5LNK 1;  4JWU C;  2J42 A;  3BZD B;  3IXS A;  4ZRQ A;  5E6J A;  4P6V F;  1QOA A;  4HKQ A;  2RDH A;  4LLG M;  2ON8 A;  1SSN A;  2PIA A;  2FBW B;  1D5X C;  1D5Z C;  2R61 A;  1QOG A;  2LHE A;  2JQR B;  2W3R A;  4REZ A;  2KN4 A;  1L0Y B;  2KDM A;  3AEC B;  1I4R A;  3N9Y C;  1IGC A;  2WS3 B;  1YQ4 B;  1V97 A;  3AH7 A;  1PFD A;  2QMT A;  5GXG B;  1V8C A;  2V3P A;  1VZ6 A;  2H88 B;  1YJJ A;  1TY0 A;  1ZP0 B;  5HFY A;  4ARI A;  1SB3 C;  3AE9 B;  1TKE A;  3SFD B;  3AV8 A;  1SF0 A;  5FKA C;  2RPV A;  4H2A A;  1NYQ A;  1YMH E;  3W9C B;  2V3N A;  1EWY C;  4OW0 A;  4KX6 B;  5HHD G;  1SE4 A;  1UNS A;  2H89 B;  2W54 A;  4HJG E;  3AE4 B;  3WCQ A;  1JRO A;  3IT4 B;  1OFF A;  4OZA A;  1E7P B;  1K50 A;  2NTT A;  2BS3 B;  3ZJV A;  3E56 A;  1I4P A;  1V1P B;  2VZK D;  3EA6 A;  1IGD A;  1KF6 B;  1NEK B;  1C4A A;  2SAK A;  2QIE B;  4D2K A;  3AEE B;  1F0Z A;  4L1B A;  1F77 A;  2LMC A;  3W5U B;  1TS3 A;  1ZUD 2;  1FFV A;  1WXQ A;  1HZ5 A;  4OVZ A;  1SBB B;  4OZC A;  1GPX A;  2JWU A;  1E9M A;  3O13 A;  1VZ7 A;  4US9 A;  3R2T A;  3HRD D;  5BYQ A;  1RM6 C;  4TQ0 A;  3FAH A;  2QSD A;  1WSP A;  2L1A A;  2KQ4 X;  2WXO A;  5C3J B;  2AQ1 B;  3BWU D;  2K3U A;  1ET6 A;  4OHJ A;  2EEL A;  4AQ7 A;  1XO3 A;  3TEY A;  4FXC A;  4WH4 A;  4LK0 M;  1K51 A;  1FIQ A;  2G9H D;  4GLS C;  1CQV A;  2IGG A;  2IPK D;  1T6B X;  3AE2 B;  3BII D;  4YTN B;  2HDE A;  1EU4 A;  3T3N A;  3MP9 A;  2W55 A;  3LXF A;  1KTK A;  4YTM B;  1TS5 A;  3URY A;  4HKZ E;  4A8X C;  1E10 A;  2B76 B;  2BS2 B;  4ZYS A;  4C80 A;  2KAJ A;  1FO4 A;  3IT6 B;  3EUB 2;  1AN8 A;  4YSY B;  1C4C A;  1MI0 A;  2PLP A;  5AUK A;  4XDD A;  2L52 A;  4WQM A;  1DOI A;  1NEN B;  1DOX A;  1D5M C;  1MPE A;  2LJI A;  2PKO A;  1L4D B;  3ZJU A;  4B0E A;  2NTS A;  1HEZ E;  2IDY A;  4KGR A;  2ZW0 A;  3PZ8 A;  1A70 A;  2FE8 A;  1RYJ A;  1L6V A;  3AE8 B;  1JRP A;  1FXI A;  5EE0 A;  3AE6 B;  4RGT A;  1BML C;  1D6E C;  1ZDX A;  1TY2 A;  3DWG C;  2AQ2 B;  1GB4 A;  3FIL B;  2SEB D;  1LO5 D;  4L23 A;  3TSS A;  4USA A;  1SE3 A;  2OED A;  1FFU A;  4RF1 A;  3I9V 1;  4RNA A;  1IBX A;  4ZHP A;  2JSV X;  1SE2 A;  2WXK A;  3LYY A;  3ZYY X;  2VZK B;  1N5X A;  2D5G A;  3AE1 B;  4IDI A;  3DWM A;  2I2Y A;  1HQR D;  1QOB A;  3BVM A;  4C56 C;  1GOZ A;  3HVD A;  5D7G A;  1FRD A;  4O1N A;  1EM7 A;  5C2T B;  2PMV A;  1NVI D;  2YEP F;  1YNT E;  4KKJ A;  2J52 A;  4P16 A;  1PGX A;  1KFY B;  3PZ7 A;  2KAC A;  1I4H A;  3W1S A;  3VRB B;  1L0V B;  2XNA C;  2Y5P A;  3SEB A;  2QJL A;  1L5P A;  1PDX A;  1PUT A;  2WXM A;  1EWC A;  3BVZ A;  3OWE B;  2WDV B;  2V4I B;  3CIR B;  5G5H A;  4YSZ B;  2JX5 A;  3NS1 A;  1GB1 A;  2G1E A;  1BUI C;  3RPF C;  3P63 A;  1MHH E;  1JAL A;  1C4P A;  3W2D A;  2L32 A;  2WXQ A;  1DYQ A;  2CJN A;  2WDQ B;  2K22 A;  2BS4 B;  2M56 B;  4ZHO A;  3KWL A;  3U7Z A;  2JYE A;  3U2S C;  3LB8 C;  4A55 A;  1C79 A;  1KRH A;  3NVV A;  3GS2 A;  2LFI A;  4C7Z A;  1VR9 A;  3BK1 A;  3GP7 A;  4WWM A;  2FUG 1;  2GI9 A;  1RWS A;  1YJI A;  3AB5 A;  3L4P A;  3ETR A;  3KQ4 A;  3AEB B;  5BMG A;  3Q8E A;  1JCK B;  3UI3 A;  2E6X A;  3AM9 A;  2YEP B;  3HVZ A;  1DOY A;  2DBY A;  2BT6 A;  1OQR A;  1AYF A;  5HG2 A;  2WXN A;  2WXG A;  3NVY A;  1N63 A;  4JE3 B;  2N9L A;  1ZE3 D;  3MHZ A;  3ABV B;  2WXR A;  1DGJ A;  1FXA A;  2PW9 A;  2ACZ B;  2W82 A;  5BMI A;  2N7J A;  3P42 A;  3E9S A;  4A6Q A;  2J53 A;  3U52 E;  1J7C A;  2WXP A;  4A9A A;  5MPO A;  4US8 A;  5G5G A;  3ZQ4 A;  4HEA 1;  2BBC A;  4RGN A;  2NMQ A;  1TJE A;  1SEB D;  5H8Y E;  3TEZ A;  2X38 A;  1JWM D;  1VLB A;  4LTU A;  4NAM A;  1VZ8 A;  2DLB A;  3FC4 A;  2M19 A;  3BVG A;  1QLB B;  2ICI A;  1AW7 A;  2K9X A;  4YSX B;  2WU2 B;  5JXV A;  1EU3 A;  4WAF A;  3VQI A;  4TMA B;  3AE3 B;  5H92 C;  2AQ3 B;  1FD6 A;  1N5W A;  4N59 A;  3P4Q B;  4OZB A;  1QF6 A;  1JWB D;  3BYT B;  3GB1 A;  3ZGZ A;  1ZXH A;  1TKY A;  1C77 A;  2I38 A;  3IAS 1;  2Y5C A;  4ITK A;  1KH0 A;  4KKI A;  2V0G A;  1T5X D;  2LUM A;  4XDC A;  3AE5 B;  1B1Z A;  2XN9 C;  3VRA B;  1ET9 A;  3RFZ B;  1ACC A;  2K0P A;  1TYG B;  1WYG A;  1JQ4 A;  1MHX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...