2D5GA

Structure of ubiquitin fold protein r767e mutant
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
83
structure length
83
Chain Sequence
b'CDSIVVAYYFCGEPIPYETLVRGRAVTLGQFKELLTKKGSYRYYFKKVSDEFDCGVVFEEVREDEAILPVFEEKIIGKVEKVD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Axin-1
publication title Structure of ubiquitin fold protein R767E mutant
rcsb
source organism Rattus norvegicus
molecule tags Signaling protein
total genus 16
structure length 83
sequence length 83
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2005-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00778 DIX DIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.380 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2d5gA00
1WSPA 3PZ8A 3PZ7A 2D5GA 4WIPA
chains in the Genus database with same CATH superfamily
4J3OD 3GZNI 4IW0A 3FKYA 3IFWB 5CHFA 1QQRA 2MEKA 5HG2A 3NZUA 5D7GA 1FIQA 3DWMA 3ZJTA 3JVZX 1ISNA 2D3BA 3QA8A 2RDGA 5IOIA 1Q1OA 1YX6B 3B2GA 3AN1A 4W9CA 2JZZA 4NY0A 3IXSA 1KOTA 3W1SA 3GE3C 5EE1A 3APCA 2QEJC 2LGYA 1SGHA 1N61A 2WXLA 1WE7A 3AH7A 4AJYB 1ET6A 4ZYNA 4XDDA 3IT4B 2LXAA 4LJOB 1C4CA 2K22A 2GMIC 1ZXHA 5E6NA 3AI5A 1E9MA 3BINA 3WALA 1JWBD 4A3OA 2M8SA 4DHZB 1YX5B 2G1EA 4G50A 4BOZB 2BYTA 1UGMA 3DOWA 3P2BA 1L0YB 1Y8RC 2H88B 2W3SA 2GB1A 5IP4D 2K3UA 4NPNA 2Z59B 2JYEA 1WMHB 3TL5A 1PFDA 4TQ0A 4RH6A 2N7EA 3AEBB 3PGEA 2KDIA 4WJQA 3NS1A 2D3AA 1TZ1A 2KMMA 3TJPA 2MP2B 3PVLA 1FNUA 3RNGC 4MGKE 1WY8A 1CZPA 2C9WB 3TEZA 3L54A 2XBBC 4JE3B 3O65B 4MH0E 1UH6A 3VUXA 3SHQA 4JLCA 1F77A 2ZJDA 3MC8A 2WNMA 2IZVB 2OEDA 1HEZE 3HVDA 1D6EC 1I35A 2KC1A 1L0VB 1PQSA 2V4LA 3AE7B 1ZKHA 2ZW1A 4XDCA 5D3DA 2YVCA 3H7PA 3A1QA 1F2RI 1IYFA 4GB9A 2LEKA 2Z0EB 1J7BA 3CMMB 1FCCC 1SBBB 3SFEB 2RDHA 2EMSA 1TZOA 1V97A 4DWFA 4LK0M 3V61A 2JWZA 1WFYA 3ETRA 3E56A 1NENB 1OEYJ 3MJ5A 4DXFA 3GZNB 3AE4B 4DHZE 1XF5L 4YTPB 3LB8C 2KWCA 4DQOC 1WIAA 2PKOA 1R7SA 1YIWA 1ESFA 2QMTA 2KDEB 1C78A 2LZ6A 2KFJA 4R3DA 4CYEA 2FAZA 1L6VA 4MGZE 4ZRQA 2KJRA 1FFUA 3VTUA 4NJ7A 1TS2A 3KUZA 4K3CA 1E0ZA 3NOBA 5D94A 2C7MB 4BFRA 3NUHB 3D32A 3PLUA 2IO0B 4S0RA 3B2FA 3LYYA 2KC2A 1R4MI 4B0MA 1C4PA 3OJ3A 1NI3A 2C60A 2LXCA 2CHZA 4P1BC 2NMQA 2RGFA 4FA6A 1GJZA 3Q3JA 1M4VA 2WS3B 3RT3B 1IP9A 5LXIB 4WAAA 1RWSA 4ZRIA 3FC4A 4PT5A 3URYA 2WU5B 2WDQB 3QC8B 5T8IA 3KQ4A 1VDVA 1SE9A 5HFYA 4KGSA 3RNAC 2VH1A 2K9XA 1VZ6A 3SEBA 2L7RA 3ZO5B 1ZP0B 2LMCA 1V49A 4KSLC 4FADA 4OVVA 1XXGA 2XEWA 1TKGA 3OAWA 1TJEA 4FXCA 3CIRB 3QCAA 1F0ZA 1XLOA 3DVGY 4C4VB 1QOBA 1ZDVA 4NQKE 1B1ZA 4G11A 1WGRA 2WP9B 4N9F4 2PLPA 1MI0A 1WYGA 2ONQA 1UBQA 2AEHA 3A33B 2Z0DB 4CQNA 3AE9B 2L05A 4IDIA 1QZEA 4N59A 4OZAA 3AMZA 3TMPB 3RZFA 3AV8A 3P4SB 2FUHB 1H4RA 3U8ZA 2MSED 2PW9A 3W9CB 4LTUA 4HRSA 2FUG1 4IWPA 3P4RB 2KTRA 3DVGX 2CHXA 1FXIA 3SU8X 3A9JA 4GDLB 2FCMA 3N1XC 1MHHE 3W2DA 3AULA 2D2QA 2AL6A 5AEKB 2J7QB 3ZRFA 4WJPA 2LVPA 3EFUA 1E8YA 2XNAC 1ENFA 3VHTC 3EUB2 1K51A 2LGXA 4EZJA 2OHFA 2JT4B 2MCNB 2WXJA 3QIJA 3H6NA 2CJNA 4BZAA 3M3JA 1KLUD 1T5XD 3VAWA 1R4MB 4E74A 2QCZA 1GOZA 2NS5A 1FRRA 1WZ3A 4M02A 1E8WA 4MGIE 2LHEA 2PE6B 1J7CA 2LVQA 2NTSA 1UBIA 1TS5A 1JCKB 3PO0A 3JSVB 1YJJA 4WURA 2CR5A 3DHIC 4S17A 5EE3A 2WXIA 5EE0A 2YEPB 3NVZA 4REZA 4WH4A 4HJKA 2DBYA 2WYQA 1T3QA 1PDXA 3R7RA 4F1SA 2XN9C 4LNOA 4XE0A 4ZHPA 1I4XA 2PVGC 4HCPB 3OJ4B 1P7EA 5KHOA 3GS2A 2WXQA 3L4PA 1QOAA 1KF6B 4BBNF 1EF5A 2INDC 3ZJUA 3NG0A 4HJGE 3ZTDA 3WIMA 2WLBA 3V3XA 1HTOA 3H9DA 2IGHA 2NVUI 2VH2A 3NRZA 2N4FA 1L0XB 3DDCB 3HK0A 4TUUA 2LI5A 3PZ7A 2D3CA 2ZNVB 1V5TA 2N7JA 3Q3FA 3L08A 1WWTA 2LGIA 2A4ZA 1GUAB 3IVFA 1HE8A 2XK5B 2BKFA 1DGJA 2MJDA 3S2AA 2KLGA 2KN4A 3OG5A 5CX3A 3T8MA 1E90A 3R3MA 2INNE 4A3PA 3PRMB 2MLBA 2IO3B 1RRBA 3TBLD 3ML8A 4W9LA 2FNJB 4WQOB 5IO9A 4LNKA 4MEMA 4A55A 3M63B 2JVCA 1UF0A 2Y5BB 4AJWA 2JYTA 2N9EB 2JU6X 2JWUA 1Q0WB 2J4XA 1D5MC 4II3B 2KDFB 1R4NI 2DX5B 1V9JA 3B08A 1STEA 4YSYB 2BS3B 4IM3A 4K7SA 4XYCA 2WXFA 4HLEA 1C1YB 1WGHA 3Q8FA 2AX5A 4KZ0A 2ZNVC 1ACCA 3KVFB 4FHJA 2NPTA 5G2NA 5BO4B 2MA9B 2EKIA 3AE6B 2JRIB 3ENEA 1TS3A 1QT9A 2N1VA 2CU1A 1F9JA 3CWIA 2L8JA 3V6CB 3Q3MC 1L7YA 3OWEB 2WXNA 2GRIA 4L23A 2QJLA 4HKQA 3NHEB 4L2YA 3VH4B 5L83A 2MW5A 3RMKC 3NVYA 4RF1A 3WAMA 4RF0A 1WSPA 2N7DA 3ZQ4A 2RR9A 4JGHB 4RGTA 2LD9A 5C1ZA 1BUIC 5G5HA 3MTNB 4EOYA 1MVKA 4K1RB 1YNTE 2K25A 2DHZA 5KHQA 2L52A 2I2YA 4NQLB 3FILB 1WJ4A 1CMXB 1GB4A 3RI7C 1ZXIA 2K6QA 4ARIA 3NY5A 1E7VA 3A9KA 4ZRKA 3TSSA 2GI9A 4DBGA 1ROEA 1WR6E 2HE7A 1NYRA 3ZXRA 3HRDD 4IOIE 2L3ZA 1NEKB 1KLVA 1FD6A 5HHDG 3N1YC 1VZ8A 2L1AA 1SJED 4NAWA 2GBJA 2JSVX 4M01A 2J53A 1WM2A 3VQIA 2TSSA 5L95C 4AUQC 4JPSA 2O6VB 3QX1A 2BS2B 2PIAA 4IC7B 1LFDA 1UZXB 3DVNV 4B0EA 1C76A 4WWNA 1WX9A 1VCBA 1M94A 4MJSB 5LNK1 2KHWB 2WDTB 1TTNA 2LGDA 1XLPA 3X0WA 4C7ZA 4P1CC 1IGDA 3IAM1 4PYZA 4GU2A 3ZNHB 3EHVA 1R4NB 3PLVA 1HQRD 4WWPA 5GXGB 4W9HA 3A4RA 2GBNA 4CHKA 1FXTB 2ZPNA 2O6VD 2LWPA 4W9KA 1EM7A 3ZDMC 1PGAA 4M0WA 2KDMA 3WANA 1OFFA 2EMTA 2G9HD 4BKSD 2V9HA 2KAJA 1N62A 4URKA 3PRZA 2C5LC 2M0XA 4YL8A 2O2VA 2GBRA 2KVZA 1PUTA 3HM3A 1K53A 2I1KA 4K7WA 1P1AA 2N0SB 3DHHC 4RM8A 3RNEC 3AEAB 1LM8B 2NBVB 5BYSA 1GC6A 1YJ1A 3HHMA 3AE8B 2IY0B 1XD3B 1QILA 3AEGB 3PPAA 2IY1B 3CSTA 5J18A 2I38A 2INCC 4M8MA 1B9RA 4ZHOA 3A4SC 1K50A 1E7UA 2J52A 1C4AA 4US8A 2Y5PA 4GGQA 1T0QC 3PTFC 1QOFA 2C7NB 4XWWA 1NDDA 2BB5A 2GLSA 2JXXA 2ZZPB 3VDZA 1C77A 3APFA 3M95A 3DCGA 4DK5A 1TIFA 4FN2A 5BYQA 2V3PA 1ZUD2 4XWTA 2KQ7A 4HEA1 3QJZA 1Y56A 4WJNA 1EU4A 1LQBA 2KVRA 3Q14C 4HKZE 2HD5B 2UYZB 1FPYA 5DPTA 3MC0B 3AU5A 4I6PA 3AE1B 1AW7A 2KD0A 3PSEB 1EO6A 4KDLB 1V5OA 4KVGB 2KYWA 4PS7A 4PK1A 2KWDA 2JUOA 3QWZB 2GBKA 1C9FA 3TCAA 1JWMD 1YN4A 2KX0A 3EGRA 3UQBA 3VTWA 1Z2MA 4RFBA 1VZ7A 2KOXA 1WX7A 2MBQA 4ITKA 2J0JA 1U4AA 3UQAA 2ZVOA 2L32A 4LNNA 1VLBA 2KZRA 3APDA 4LDTB 2KKCA 2D10A 3U2SC 1V8CA 1AN8A 3ZDTA 4EFOA 4P6VF 2DZJA 2RMMA 2A5UA 2DYMA 2IPKD 1YQBA 2B76B 3HM6X 4GDKA 1JW9D 3BYTB 3N9YC 2UWQA 4I6LB 2OJWA 4KDIC 4US9A 1H8CA 4TMAB 4ANUA 3ZYYX 4KSKC 3ZIMA 4MGYE 2MJEA 3BIID 2IGDA 2WX0A 3HUIA 4ANWA 3SD5A 1WX8A 4LDTD 4IUMB 2JXTA 4MSMB 2M17A 5BMGA 1RFAA 3IAS1 4P7IA 1RAXA 2QILA 2FCSA 4RGNA 3VH3B 5HI1A 2ASQA 4WJOA 1V1OA 2WHIA 2LFIA 1S3SG 2NPTB 3PZDA 1KRHA 3AEEB 2CU3A 3NZ3A 3VUWA 5D6JB 1V1PA 5JHAA 1YOVB 5DCNA 2BGFA 3VR8B 3RNCC 4FHKA 3VRAB 2AYOB 2IO1B 2BWES 3IHPC 4HCNB 5D2MB 1YQ3B 1E6EB 4W9DA 1IBXB 3RD2A 1RLFA 2DYOA 2UU7A 2NBUA 2G45B 1FEHA 2IDYA 3LXFA 1P0RA 1MG4A 2IJ0A 4JWUC 1WMHA 1XQQA 4EKUA 2GOWA 4YXDB 2JZ3B 5JHBA 5IAAC 2KJHB 5AZGA 2L83A 2BW2A 4DDGD 3N3KB 2WXPA 2MP2A 3Q3NC 1UELA 1WF9A 4WWOA 1ZDXA 3LDZE 5JZEB 4RMAA 2H89B 2IGGA 2NR2A 3Q8AA 2JF5A 2L00B 2DNFA 2J0MA 3DWGC 1FNVA 5C23A 1ET9A 3MJWA 3Q69A 1A70A 1YJIA 1UWMA 1F2RC 3KLSX 1V2YA 4DDID 3BWUD 5J17A 3V05A 3AE3B 1I4QA 1D5XC 3L17A 3ZUNA 2WDRB 4ASWC 2ZCBA 4KKJA 2KK8A 2DZIA 5G5GA 5H92C 4OHJA 4KIKA 3B9JA 3T3OA 1NVID 3AE5B 4G3XB 4KV2A 3BYYB 4NAWB 1V86A 5CHVC 2KACA 2E6XA 2AWTA 1ZOYB 4NJ6A 4IG7B 2DAJA 3MP9A 1YMHE 3AECB 3W5UB 1WXAA 5C2TB 2FIDA 2INPE 3UF8A 3T9LA 5FR3A 3AE2B 3J9CA 3PHWB 3R66C 4A90A 2G3QB 3KWVA 2DZMA 1C79A 4MT5A 2YEPF 5IN7A 3SDLC 2M1MA 2M19A 1CK1A 3GP7A 1EUVB 4E3CA 2PVOD 4BVUC 3U7ZA 4ACFA 4F7ZA 2ZVNA 2BVCA 1SB3C 4HDQA 2MBBB 2KT7A 1WYWB 1FCLA 2RPVA 1VRAB 4USAA 4OVZA 2PMVA 1GB1A 2WXMA 1HZ6A 2FCNA 1OGWA 4KGRA 4CO7A 3M62B 3T3NA 4RGOS 1EU3A 1I7HA 4MH8A 1IUEA 3RULA 2RSUA 2V4IB 3DHGC 1DYQA 2KXJA 3IG3A 3AM9A 3PHXB 3H7PB 2QDFA 1SIJA 2KMCA 3A1QB 5TR5A 1ZPSA 3H7SA 5BMIA 4ANXA 2V3NA 2CS4A 2JQRB 2MRPA 1XLNA 3Q8BA 1SIFA 2K8HA 3P1MA 4LLGM 4AP4C 2PTLA 1L4DB 2MWSB 1ZW7A 2IYDB 4OW0A 3DBLI 1LXDA 3P4QB 1HZ5A 3PS6A 4LCDE 4B95A 1SSNA 2E3TA 1GG3A 2K1FA 1JWUD 1FO4A 2KFKA 2MBOA 2G4DB 3AU4A 2KWVB 1AWDA 2J42A 3EC8A 3ZXVA 4C80A 4LNFA 5E6PA 1ZGUB 4OZCA 3U30A 2D07B 1V81A 1WM3A 2QSDA 2L0TA 4L1BA 4XZ4A 1WJNA 3HVZA 2LUMA 3NVVA 3VXWA 5LXHA 2KTFA 2KWUB 1JRUA 1QLBB 5E6JA 5DPRA 1TBEA 4HWIB 1WJ6A 2DAFA 2WXOA 3KYCD 1WGKA 2WU2B 1QOGA 3R2TA 1VR9A 4GDLA 5AZHA 2D5GA 3ZRCA 2I1JA 2M0AA 4YSXB 1J7AA 1K8RB 4AQ7A 3N1ZC 3DBHI 1ZE3D 4GDKB 4PS8A 3Q8EA 1TS4A 4KZCA 4NJCA 4FULA 2JX5A 3P63A 2NTTA 1BMLC 4ZRPA 1VD2A 1L4ZB 3GB1A 4KGTA 4JQWC 4EUTA 5AUKA 5DPSA 3TIXA 1WXQA 3H8HA 4JL9A 2MX2A 5CTRC 4G0NB 1P7FA 2WXRA 2IBIB 3R8BA 1WRDB 3C8YA 4GN1A 3JSVA 2X38A 1SXTA 2M4NA 2LHDA 3N32A 1HXYD 1V6EA 3QHTA 2HTME 2AQ2B 3U7DA 4JIOU 1MJDA 1WGYA 1L6UA 3QARA 4RGMA 4UDUC 4A8XC 1V1PB 2K39A 3CSFA 4A6QA 4D2KA 5BYRA 3VUYA 2WGSA 2K8BA 4HDOA 4AWJA 4EZLA 3DBRB 3DBLB 1FXAA 2LUEA 2KDBA 4BAXA 1I4HA 3CF6E 1JALA 2BWFA 2KTRB 1YQ4B 1DOXA 1RFKA 3A9JB 3DQVA 3WAPA 2KO3A 1QKZA 1D4BA 3VVWB 1N5XA 2OJRA 3ZTCA 2N9LA 3ALBA 4GMVA 1HTQA 2BKRB 1X1MA 2KMAA 2ACZB 1C3TA 1N60A 1RYJA 4FBJB 3Q3OC 2AL3A 1P9DU 1YN3A 2KANA 3QAQA 4EEWA 4NNJB 3ML9A 4ICVA 4W9JA 2DYBA 2XK5A 2K5PA 4GIVA 2SEBD 2J0KA 3NJTA 2WDVB 2C7HA 1N6ZA 4P16A 5G55A 3RNFC 4C7YA 4HPLB 4JX1C 1A5RA 2QIEB 4AS1A 4KIKB 2AQ3B 2CJOA 3RUIB 3HIZA 1P3QU 4E71A 4FJZA 1KM7A 1GAQB 2LRWA 5IA7A 3DBHB 1WXMA 4WWMA 1UGJA 2SAKA 4FJVB 3OLMD 4KX6B 3RPFC 3B0AA 3QK0A 4BOSC 1DOIA 3KUCB 1T0YA 2MBHA 4IM0A 3W1YA 2G4SA 1KLGD 1SF0A 3PREA 4ANVA 1AYFA 2FIFA 3R7QA 1K52A 2W55A 2OOBB 3MC9A 3DPDA 3JYUA 4YWGG 1GC7A 2PPHA 3AEFB 4GLSC 4C00A 1CJEA 3I63C 1MG8A 3Q8CA 1J8CA 1P98A 4N58A 3RNBC 2RDBC 1GPXA 2W54A 2DENB 3NZSA 1Q5WB 2X8XX 3UIOB 2N9XA 2DWQA 4K7UA 4MM3A 1PGBA 3KH0A 2WXHA 4J6IA 4GSWA 1TKYA 2L76A 1NBFC 1XCTL 3Q2AC 4II2B 2WXGA 4N6EB 3BY4B 3FAHA 2QHOA 2R2QA 1FFVA 2Y3AA 1MHXA 1I4RA 4HROA 1KH0A 1OTRB 3AEDB 4ZYSA 3L16A 3KUDB 3Q6BA 4MACA 3E9SA 1DOYA 3PT2B 1FM0D 2BYVE 3EA6A 4TKNA 4A9AA 1TYGB 4IM2A 1E8XA 3ABVB 1NI2A 3VR9B 4O1NA 1LO5D 2KQ4X 3ZNZB 2LRUA 2HJ8A 2LVOA 4ZRJA 1WH3A 1I4GA 3FILA 3RZWC 4RM9A 5FR6A 4XX5A 4QAYA 1PYWD 2K8CA 1NYQA 3U52E 1WZ0A 2V0GA 3N30A 3NVWA 3NS8A 4BKTA 3BZDB 3EECA 4B6WA 5C3JB 2PE9A 3GE8C 5JXVA 3MHZA 2MHJA 1JMLA 3V60A 2K0PA 4YTNB 2JPHA 3ZLZA 3TEYA 4ZOHC 1I42A 2MH7A 2R2OA 5AZFA 2FE8A 2KFKB 3DBSA 2MQJA 2O6VA 1EF1A 5AUIA 2PEAA 2DZKA 3GOEA 2WQYB 2D3GA 3I9V1 1WRIA 3W5VB 2W3RA 4MJSA 1Q10A 2KQSA 4BKSA 1WI0A 5E6OA 5H8YE 4HXDA 1EWYC 3WAOA 1OQRA 1WXVA 4PS3A 2FBWB 5EDSA 3L0WB 3RYTA 3VFKA 1J19A 3H1UA 4XC2A 3SR6A 2KX3A 2ON8A 3PZ8A 1L2NA 1BT0A 1FNWA 4IWOA 1TKEA 3PV1A 4MELA 4MSQB 4ARCA 3ZGZA 1YN5A 4GOCA 2DLBA 4JWSC 5BMHA 5HKHA 4W9IA 2WXKA 3IBEA 2ZEQA 2RPQA 2Y5CA 4WIPA 1GNUA 5MPOA 2NBWB 1JWSD 4FLHA 4YSZB 3TUOA 1KTKA 2Z8LA 1UUPA 4RCOA 2VZKB 3A9KB 3BVZA 2BBCA 1T0RC 4IKGA 4RNAA 1F52A 1IGCA 2HDEA 3I3TB 3PRPB 3ZJVA 1FRDA 1CQVA 5CHWA 2M56B 4YT0B 1E5WA 5GMVA 3C19A 2BTEA 1N5WA 1OQQA 3MHSD 1QF6A 1S1QB 3L13A 4K81A 1HA5A 3ZNGC 2MBEA 1SJHD 2V3SA 3U4EG 4TV3A 1WGGA 3KWLA 5JH5C 1E8ZA 4OVUA 3BVGA 1WE6A 2BQQA 1I4PA 4LJPB 4A20A 2BPSA 2VZKD 4K3BA 3ZVVA 4HVBA 2BS4B 2RD0A 3O13A 3ZKJC 4DHJB 3KYDD 3RCZA 2BYFA 4X57B 1XEEA 2ZPYA 3AXCA 3X23A 1EWCA 1RM6C 4PYUA 4Q2JA 3QQ8B 1TY0A 3K9OB 5LLIA 2ZW0A 1TY2A 1XO3A 2WX1A 4EE2A 2AQ1B 3LJ3A 1BXTA 3TEWA 4DXGA 1KFYB 3IT6B 2N1WA 4M0WB 1JWAD 2BF8B 3DVNU 4GXBA 2LJ5A 3I57A 3V62A 1V80A 4HPMB 3MFGA 2CHWA 2BB6A 3R2IA 4AOFA 1XLQA 3RFZB 2LJIA 3W1SC 3BK2A 2KLCA 4DHJD 2O2VB 1WGDA 1IPGA 2W82A 4TSSA 4DXAB 3ZNID 2MJ3A 4ZDVA 1G6JA 4NAMA 3B1LX 1JQ4A 1T6BX 3BK1A 1TT5B 3RN9C 2BT6A 1OEYA 3JW0X 2ZCCA 1T0SC 2JZPA 4M00A 2V1YA 3P4PB 3VRBB 2HJ1A 4BBNC 4FJYA 5DPWA 2KNBA 2JRHA 5FK9C 2EELA 4F8CB 1PGXA 3UIPB 4BKGA 1UNSA 1SEBD 1WXSA 3UGBB 1JROA 1YD8U 1SE3A 3UI3A 3AB5A 5IKCM 1FMAD 2PJHA 4ICUA 3DBRI 2LGSA 2CKHB 1UWXA 4C56C 4NZLB 3ZW3A 2GBMA 1N63A 1Z5SB 3I5JC 4H2AA 2W9NA 2Q5WD 1WJUA 4C4VA 2ICIA 3TEXA 3K9PB 3EFCA 1E7PB 5D3IB 2JY6A 2L0FA 2HTHA 2LASA 1UD7A 3N20C 2QC8A 4XGAB 2BYEA 2EKEC 4I6NB 1D3ZA 1LGRA 3L10B 1F1HA 5I4DA 2FCQA 3SFDB 4W9FA 3P42A 1KJTA 1VJKA 4HK2A 1AARA 3VTVA 2R61A 4MM3B 1XCQL 4W9GA 1J0GA 1OQYA 3WA0A 4WAFA 1IBXA 4KKIA 2D11A 4LNIA 2YLMA 1TGZB 3ECIA 4B9KA 2NCNA 3C0RB 2KJ6A 2N9PC 1XT9B 4YTMB 2KN5A 1SE4A 1WR1A 4MDKE 4WQMA 1SE2A 2B3AA 4W9EA 3V6EB 4EZKA 2REXA 2N9KA 1MPEA 1D5ZC 3ONSA 5EE9A 1E10A 3BVMA 4HPPA 2K6DB 2WWZA 4M8NA 4TQ1A 5J2RA 4IWQA 1JRPA 1MFWA 3WCQA 5TSSA 2IO2B 5FKAC 4OZBA 3UINB 2VRRB 1L5PA 3KW5B
chains in the Genus database with same CATH topology
1E6EB 4J3OD 2N7JA 1IBXB 1WWTA 1DOIA 2LGIA 2DYOA 1QQRA 2MEKA 1KLGD 1SF0A 5HG2A 1AYFA 1FEHA 2IDYA 5D7GA 3LXFA 1FIQA 1DGJA 1K52A 2W55A 3DWMA 3ZJTA 2MJDA 4YWGG 2KN4A 2RDGA 2IJ0A 3B2GA 3AN1A 4JWUC 3AEFB 2INNE 3IXSA 4YXDB 4GLSC 3W1SA 1CJEA 3Q8CA 5EE1A 2L83A 2QEJC 2BW2A 1N61A 2WXLA 3AH7A 1ET6A 2WXPA 4XDDA 3IT4B 4N58A 4A55A 1C4CA 1GPXA 1ZDXA 2W54A 2K22A 2H89B 2IGGA 3Q8AA 1ZXHA 3DWGC 1FNVA 2DWQA 1PGBA 2JYTA 2JU6X 1ET9A 1E9MA 2WXHA 2JWUA 3Q69A 1JWBD 1TKYA 1A70A 1YJIA 1UWMA 2J4XA 1D5MC 2G1EA 1XCTL 1F2RC 3KLSX 3BWUD 2BYTA 2WXGA 4N6EB 1STEA 4YSYB 3V05A 3FAHA 3AE3B 1L0YB 1I4QA 2BS3B 2WXFA 1FFVA 2H88B 2W3SA 2Y3AA 1D5XC 2GB1A 1MHXA 1I4RA 2K3UA 2WDRB 4HROA 1KH0A 4KKJA 5G5GA 2JYEA 3AEDB 5H92C 3Q8FA 4ZYSA 4OHJA 3B9JA 1PFDA 4TQ0A 3T3OA 4RH6A 4MACA 3E9SA 1DOYA 2AX5A 1NVID 3AEBB 1FM0D 3AE5B 3EA6A 3BYYB 1ACCA 4A9AA 4NAWB 1TYGB 3NS1A 3ABVB 3VR9B 2KMMA 2EKIA 1LO5D 2KACA 2KQ4X 4O1NA 2E6XA 3AE6B 1FNUA 1TS3A 1ZOYB 1I4GA 1QT9A 1CZPA 3FILA 3TEZA 3MP9A 3CWIA 1YMHE 3AECB 4JE3B 3W5UB 3OWEB 2WXNA 5C2TB 2GRIA 2INPE 4L23A 2QJLA 1F77A 1PYWD 4HKQA 1NYQA 3U52E 5FR3A 2V0GA 4L2YA 2WNMA 3NVWA 3AE2B 3J9CA 4A90A 3BZDB 3KWVA 2OEDA 5C3JB 1C79A 4MT5A 1HEZE 3HVDA 1D6EC 2YEPF 5JXVA 3MHZA 3NVYA 1L0VB 4RF1A 2M19A 3AE7B 4RF0A 1CK1A 1JMLA 2ZW1A 1WSPA 3GP7A 2K0PA 4XDCA 5D3DA 3ZQ4A 4YTNB 3TEYA 4ZOHC 2MH7A 4RGTA 1F2RI 2PVOD 2FE8A 1BUIC 5G5HA 3U7ZA 1SB3C 2LEKA 1MVKA 1J7BA 1YNTE 1FCCC 1SBBB 5AUIA 3SFEB 1FCLA 2L52A 2RDHA 2RPVA 2I2YA 1VRAB 4USAA 3FILB 2WQYB 4OVZA 3I9V1 1GB4A 1WRIA 1TZOA 1V97A 2PMVA 3W5VB 1GB1A 2W3RA 2WXMA 4LK0M 1ZXIA 1HZ6A 1Q10A 4KGRA 4ARIA 5H8YE 3ETRA 3E56A 1NENB 1EWYC 3MJ5A 4DXFA 1OQRA 3TSSA 2GI9A 1ROEA 3AE4B 4RGOS 1XF5L 4YTPB 1NYRA 3T3NA 2FBWB 1EU3A 1I7HA 3HRDD 4IOIE 4MH8A 1IUEA 3LB8C 1NEKB 1FD6A 2V4IB 4DQOC 1DYQA 5HHDG 2PKOA 3AM9A 3SR6A 1R7SA 1VZ8A 2ON8A 2L1AA 3PZ8A 1SJED 2JSVX 2J53A 1FNWA 1SIJA 1ESFA 1TKEA 2QMTA 1ZPSA 5BMIA 4ARCA 1C78A 3VQIA 2TSSA 1YN5A 3ZGZA 2V3NA 4JPSA 2JQRB 2DLBA 4JWSC 4R3DA 5BMHA 1XLNA 2WXKA 3Q8BA 1L6VA 4ZRQA 1FFUA 2BS2B 2PIAA 2Y5CA 4WIPA 1TS2A 3P1MA 4B0EA 5MPOA 1C76A 4LLGM 1E0ZA 1JWSD 4YSZB 5LNK1 2PTLA 3TUOA 1KTKA 1L4DB 2Z8LA 1UUPA 3NUHB 4RCOA 2VZKB 1XLPA 4C7ZA 3BVZA 2BBCA 4IKGA 1IGDA 3IAM1 1IGCA 3B2FA 4KX6B 4OW0A 2HDEA 3LYYA 4RNAA 3P4QB 1HZ5A 3ZJVA 4B0MA 1C4PA 1HQRD 1FRDA 1CQVA 2M56B 5GXGB 1NI3A 4YT0B 1SSNA 2E3TA 2BTEA 1JWUD 1N5WA 1OQQA 1FO4A 2NMQA 1QF6A 1M4VA 2WS3B 1AWDA 2J42A 1RWSA 4C80A 3FC4A 1EM7A 1HA5A 4PT5A 1PGAA 1SJHD 3U4EG 4M0WA 3URYA 2WU5B 2KDMA 4OZCA 2WDQB 3KWLA 1OFFA 5T8IA 3KQ4A 1VDVA 3BVGA 2G9HD 1I4PA 2QSDA 2KAJA 2VZKD 4L1BA 1N62A 5HFYA 4KGSA 2K9XA 1VZ6A 3SEBA 2BS4B 3HVZA 1ZP0B 2LUMA 3O13A 2LMCA 1PUTA 3NVVA 1K53A 1XEEA 1XXGA 1QLBB 2N0SB 5E6JA 1EWCA 1TKGA 1RM6C 1TJEA 3AEAB 4FXCA 3CIRB 4Q2JA 1TY0A 1F0ZA 2WXOA 2ZW0A 1WGKA 1XLOA 5BYSA 2WU2B 1TY2A 1XO3A 4EE2A 2AQ1B 1QOGA 1QOBA 3R2TA 1VR9A 3AE8B 1BXTA 1ZDVA 4DXGA 3TEWA 2D5GA 1KFYB 2M0AA 3IT6B 4YSXB 1J7AA 1B1ZA 1QILA 3AEGB 4AQ7A 1JWAD 2WP9B 3I57A 2I38A 2PLPA 1MI0A 1ZE3D 1WYGA 2ONQA 4GDKB 3Q8EA 1B9RA 1TS4A 3MFGA 2BB6A 4CQNA 4ZHOA 1K50A 3AE9B 3R2IA 1XLQA 2J52A 2LJIA 4NJCA 1C4AA 3RFZB 4US8A 2Y5PA 3BK2A 2W82A 1QOFA 4IDIA 4N59A 2JX5A 4TSSA 2MJ3A 4OZAA 4XWWA 3P63A 3AMZA 2NTTA 1BMLC 2BB5A 4ZRPA 1C77A 4NAMA 1L4ZB 3AV8A 3GB1A 3P4SB 4KGTA 2PW9A 3W9CB 5BYQA 2V3PA 1ZUD2 4XWTA 4HEA1 4LTUA 5AUKA 1Y56A 4HRSA 1T6BX 1JQ4A 3BK1A 1EU4A 1WXQA 2FUG1 3H8HA 4HKZE 2BT6A 3P4RB 2JZPA 1FXIA 1P7FA 2WXRA 3P4PB 4GDLB 3MC0B 3VRBB 3R8BA 1MHHE 3AE1B 1AW7A 3C8YA 2X38A 1SXTA 5FK9C 2EELA 2LHDA 3W2DA 1PGXA 2KWDA 1UNSA 1SEBD 1HXYD 2HTME 2AQ2B 1C9FA 1JROA 1JWMD 1YN4A 1SE3A 3UI3A 3AB5A 3EGRA 1L6UA 1FMAD 4RGMA 4UDUC 4RFBA 4A8XC 2XNAC 1VZ7A 4C56C 1ENFA 1UWXA 1V1PB 3EUB2 4NZLB 1K51A 4A6QA 2OHFA 4ITKA 4D2KA 1N63A 5BYRA 2WXJA 2L32A 1VLBA 4H2AA 2CJNA 3U2SC 1KLUD 1T5XD 1V8CA 2Q5WD 1FXAA 2ICIA 1I4HA 3TEXA 1GOZA 1AN8A 1FRRA 1JALA 2LHEA 1E7PB 1YQ4B 5D3IB 4P6VF 1DOXA 1RFKA 1J7CA 2RMMA 1QKZA 2DYMA 2IPKD 2NTSA 2B76B 1D4BA 1TS5A 1JCKB 1N5XA 3PO0A 2N9LA 1JW9D 3BYTB 3N9YC 1YJJA 4WURA 5I4DA 4US9A 5EE3A 4TMAB 2WXIA 5EE0A 3SFDB 2YEPB 3NVZA 3P42A 4REZA 3ZYYX 2MJEA 2ACZB 3BIID 2IGDA 4WH4A 1VJKA 1N60A 1RYJA 3HUIA 2R61A 4MM3B 1XCQL 1YN3A 2DBYA 4WAFA 2JXTA 1IBXA 1T3QA 4KKIA 1PDXA 5BMGA 2XN9C 4XE0A 4ZHPA 1I4XA 2PVGC 3IAS1 2K5PA 1P7EA 2QILA 3GS2A 2WXQA 3L4PA 1QOAA 2SEBD 1KF6B 4RGNA 4YTMB 2WDVB 3ZJUA 4P16A 5HI1A 4C7YA 4JX1C 2QIEB 4HJGE 4AS1A 1SE4A 4WQMA 1V1OA 2AQ3B 1SE2A 2WLBA 2CJOA 3V3XA 2N9KA 1MPEA 1D5ZC 5EE9A 2IGHA 2LFIA 1E10A 3BVMA 3NRZA 1GAQB 1KRHA 3AEEB 2CU3A 3NZ3A 4TQ1A 1L0XB 1JRPA 1V1PA 3WCQA 3VR8B 4WWMA 5TSSA 3PZ7A 3VRAB 1UGJA 5FKAC 4OZBA 2SAKA 1L5PA 1YQ3B 3RPFC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WSP A;  3PZ8 A;  3PZ7 A;  2D5G A;  4WIP A; 
#chains in the Genus database with same CATH topology
 4J3O D;  3GZN I;  4IW0 A;  3FKY A;  3IFW B;  5CHF A;  1QQR A;  2MEK A;  5HG2 A;  3NZU A;  5D7G A;  1FIQ A;  3DWM A;  3ZJT A;  3JVZ X;  1ISN A;  2D3B A;  3QA8 A;  2RDG A;  5IOI A;  1Q1O A;  1YX6 B;  3B2G A;  3AN1 A;  4W9C A;  2JZZ A;  4NY0 A;  3IXS A;  1KOT A;  3W1S A;  3GE3 C;  5EE1 A;  3APC A;  2QEJ C;  2LGY A;  1SGH A;  1N61 A;  2WXL A;  1WE7 A;  3AH7 A;  4AJY B;  1ET6 A;  4ZYN A;  4XDD A;  3IT4 B;  2LXA A;  4LJO B;  1C4C A;  2K22 A;  2GMI C;  1ZXH A;  5E6N A;  3AI5 A;  1E9M A;  3BIN A;  3WAL A;  1JWB D;  4A3O A;  2M8S A;  4DHZ B;  1YX5 B;  2G1E A;  4G50 A;  4BOZ B;  2BYT A;  1UGM A;  3DOW A;  3P2B A;  1L0Y B;  1Y8R C;  2H88 B;  2W3S A;  2GB1 A;  5IP4 D;  2K3U A;  4NPN A;  2Z59 B;  2JYE A;  1WMH B;  3TL5 A;  1PFD A;  4TQ0 A;  4RH6 A;  2N7E A;  3AEB B;  3PGE A;  2KDI A;  4WJQ A;  3NS1 A;  2D3A A;  1TZ1 A;  2KMM A;  3TJP A;  2MP2 B;  3PVL A;  1FNU A;  3RNG C;  4MGK E;  1WY8 A;  1CZP A;  2C9W B;  3TEZ A;  3L54 A;  2XBB C;  4JE3 B;  3O65 B;  4MH0 E;  1UH6 A;  3VUX A;  3SHQ A;  4JLC A;  1F77 A;  2ZJD A;  3MC8 A;  2WNM A;  2IZV B;  2OED A;  1HEZ E;  3HVD A;  1D6E C;  1I35 A;  2KC1 A;  1L0V B;  1PQS A;  2V4L A;  3AE7 B;  1ZKH A;  2ZW1 A;  4XDC A;  5D3D A;  2YVC A;  3H7P A;  3A1Q A;  1F2R I;  1IYF A;  4GB9 A;  2LEK A;  2Z0E B;  1J7B A;  3CMM B;  1FCC C;  1SBB B;  3SFE B;  2RDH A;  2EMS A;  1TZO A;  1V97 A;  4DWF A;  4LK0 M;  3V61 A;  2JWZ A;  1WFY A;  3ETR A;  3E56 A;  1NEN B;  1OEY J;  3MJ5 A;  4DXF A;  3GZN B;  3AE4 B;  4DHZ E;  1XF5 L;  4YTP B;  3LB8 C;  2KWC A;  4DQO C;  1WIA A;  2PKO A;  1R7S A;  1YIW A;  1ESF A;  2QMT A;  2KDE B;  1C78 A;  2LZ6 A;  2KFJ A;  4R3D A;  4CYE A;  2FAZ A;  1L6V A;  4MGZ E;  4ZRQ A;  2KJR A;  1FFU A;  3VTU A;  4NJ7 A;  1TS2 A;  3KUZ A;  4K3C A;  1E0Z A;  3NOB A;  5D94 A;  2C7M B;  4BFR A;  3NUH B;  3D32 A;  3PLU A;  2IO0 B;  4S0R A;  3B2F A;  3LYY A;  2KC2 A;  1R4M I;  4B0M A;  1C4P A;  3OJ3 A;  1NI3 A;  2C60 A;  2LXC A;  2CHZ A;  4P1B C;  2NMQ A;  2RGF A;  4FA6 A;  1GJZ A;  3Q3J A;  1M4V A;  2WS3 B;  3RT3 B;  1IP9 A;  5LXI B;  4WAA A;  1RWS A;  4ZRI A;  3FC4 A;  4PT5 A;  3URY A;  2WU5 B;  2WDQ B;  3QC8 B;  5T8I A;  3KQ4 A;  1VDV A;  1SE9 A;  5HFY A;  4KGS A;  3RNA C;  2VH1 A;  2K9X A;  1VZ6 A;  3SEB A;  2L7R A;  3ZO5 B;  1ZP0 B;  2LMC A;  1V49 A;  4KSL C;  4FAD A;  4OVV A;  1XXG A;  2XEW A;  1TKG A;  3OAW A;  1TJE A;  4FXC A;  3CIR B;  3QCA A;  1F0Z A;  1XLO A;  3DVG Y;  4C4V B;  1QOB A;  1ZDV A;  4NQK E;  1B1Z A;  4G11 A;  1WGR A;  2WP9 B;  4N9F 4;  2PLP A;  1MI0 A;  1WYG A;  2ONQ A;  1UBQ A;  2AEH A;  3A33 B;  2Z0D B;  4CQN A;  3AE9 B;  2L05 A;  4IDI A;  1QZE A;  4N59 A;  4OZA A;  3AMZ A;  3TMP B;  3RZF A;  3AV8 A;  3P4S B;  2FUH B;  1H4R A;  3U8Z A;  2MSE D;  2PW9 A;  3W9C B;  4LTU A;  4HRS A;  2FUG 1;  4IWP A;  3P4R B;  2KTR A;  3DVG X;  2CHX A;  1FXI A;  3SU8 X;  3A9J A;  4GDL B;  2FCM A;  3N1X C;  1MHH E;  3W2D A;  3AUL A;  2D2Q A;  2AL6 A;  5AEK B;  2J7Q B;  3ZRF A;  4WJP A;  2LVP A;  3EFU A;  1E8Y A;  2XNA C;  1ENF A;  3VHT C;  3EUB 2;  1K51 A;  2LGX A;  4EZJ A;  2OHF A;  2JT4 B;  2MCN B;  2WXJ A;  3QIJ A;  3H6N A;  2CJN A;  4BZA A;  3M3J A;  1KLU D;  1T5X D;  3VAW A;  1R4M B;  4E74 A;  2QCZ A;  1GOZ A;  2NS5 A;  1FRR A;  1WZ3 A;  4M02 A;  1E8W A;  4MGI E;  2LHE A;  2PE6 B;  1J7C A;  2LVQ A;  2NTS A;  1UBI A;  1TS5 A;  1JCK B;  3PO0 A;  3JSV B;  1YJJ A;  4WUR A;  2CR5 A;  3DHI C;  4S17 A;  5EE3 A;  2WXI A;  5EE0 A;  2YEP B;  3NVZ A;  4REZ A;  4WH4 A;  4HJK A;  2DBY A;  2WYQ A;  1T3Q A;  1PDX A;  3R7R A;  4F1S A;  2XN9 C;  4LNO A;  4XE0 A;  4ZHP A;  1I4X A;  2PVG C;  4HCP B;  3OJ4 B;  1P7E A;  5KHO A;  3GS2 A;  2WXQ A;  3L4P A;  1QOA A;  1KF6 B;  4BBN F;  1EF5 A;  2IND C;  3ZJU A;  3NG0 A;  4HJG E;  3ZTD A;  3WIM A;  2WLB A;  3V3X A;  1HTO A;  3H9D A;  2IGH A;  2NVU I;  2VH2 A;  3NRZ A;  2N4F A;  1L0X B;  3DDC B;  3HK0 A;  4TUU A;  2LI5 A;  3PZ7 A;  2D3C A;  2ZNV B;  1V5T A;  2N7J A;  3Q3F A;  3L08 A;  1WWT A;  2LGI A;  2A4Z A;  1GUA B;  3IVF A;  1HE8 A;  2XK5 B;  2BKF A;  1DGJ A;  2MJD A;  3S2A A;  2KLG A;  2KN4 A;  3OG5 A;  5CX3 A;  3T8M A;  1E90 A;  3R3M A;  2INN E;  4A3P A;  3PRM B;  2MLB A;  2IO3 B;  1RRB A;  3TBL D;  3ML8 A;  4W9L A;  2FNJ B;  4WQO B;  5IO9 A;  4LNK A;  4MEM A;  4A55 A;  3M63 B;  2JVC A;  1UF0 A;  2Y5B B;  4AJW A;  2JYT A;  2N9E B;  2JU6 X;  2JWU A;  1Q0W B;  2J4X A;  1D5M C;  4II3 B;  2KDF B;  1R4N I;  2DX5 B;  1V9J A;  3B08 A;  1STE A;  4YSY B;  2BS3 B;  4IM3 A;  4K7S A;  4XYC A;  2WXF A;  4HLE A;  1C1Y B;  1WGH A;  3Q8F A;  2AX5 A;  4KZ0 A;  2ZNV C;  1ACC A;  3KVF B;  4FHJ A;  2NPT A;  5G2N A;  5BO4 B;  2MA9 B;  2EKI A;  3AE6 B;  2JRI B;  3ENE A;  1TS3 A;  1QT9 A;  2N1V A;  2CU1 A;  1F9J A;  3CWI A;  2L8J A;  3V6C B;  3Q3M C;  1L7Y A;  3OWE B;  2WXN A;  2GRI A;  4L23 A;  2QJL A;  4HKQ A;  3NHE B;  4L2Y A;  3VH4 B;  5L83 A;  2MW5 A;  3RMK C;  3NVY A;  4RF1 A;  3WAM A;  4RF0 A;  1WSP A;  2N7D A;  3ZQ4 A;  2RR9 A;  4JGH B;  4RGT A;  2LD9 A;  5C1Z A;  1BUI C;  5G5H A;  3MTN B;  4EOY A;  1MVK A;  4K1R B;  1YNT E;  2K25 A;  2DHZ A;  5KHQ A;  2L52 A;  2I2Y A;  4NQL B;  3FIL B;  1WJ4 A;  1CMX B;  1GB4 A;  3RI7 C;  1ZXI A;  2K6Q A;  4ARI A;  3NY5 A;  1E7V A;  3A9K A;  4ZRK A;  3TSS A;  2GI9 A;  4DBG A;  1ROE A;  1WR6 E;  2HE7 A;  1NYR A;  3ZXR A;  3HRD D;  4IOI E;  2L3Z A;  1NEK B;  1KLV A;  1FD6 A;  5HHD G;  3N1Y C;  1VZ8 A;  2L1A A;  1SJE D;  4NAW A;  2GBJ A;  2JSV X;  4M01 A;  2J53 A;  1WM2 A;  3VQI A;  2TSS A;  5L95 C;  4AUQ C;  4JPS A;  2O6V B;  3QX1 A;  2BS2 B;  2PIA A;  4IC7 B;  1LFD A;  1UZX B;  3DVN V;  4B0E A;  1C76 A;  4WWN A;  1WX9 A;  1VCB A;  1M94 A;  4MJS B;  5LNK 1;  2KHW B;  2WDT B;  1TTN A;  2LGD A;  1XLP A;  3X0W A;  4C7Z A;  4P1C C;  1IGD A;  3IAM 1;  4PYZ A;  4GU2 A;  3ZNH B;  3EHV A;  1R4N B;  3PLV A;  1HQR D;  4WWP A;  5GXG B;  4W9H A;  3A4R A;  2GBN A;  4CHK A;  1FXT B;  2ZPN A;  2O6V D;  2LWP A;  4W9K A;  1EM7 A;  3ZDM C;  1PGA A;  4M0W A;  2KDM A;  3WAN A;  1OFF A;  2EMT A;  2G9H D;  4BKS D;  2V9H A;  2KAJ A;  1N62 A;  4URK A;  3PRZ A;  2C5L C;  2M0X A;  4YL8 A;  2O2V A;  2GBR A;  2KVZ A;  1PUT A;  3HM3 A;  1K53 A;  2I1K A;  4K7W A;  1P1A A;  2N0S B;  3DHH C;  4RM8 A;  3RNE C;  3AEA B;  1LM8 B;  2NBV B;  5BYS A;  1GC6 A;  1YJ1 A;  3HHM A;  3AE8 B;  2IY0 B;  1XD3 B;  1QIL A;  3AEG B;  3PPA A;  2IY1 B;  3CST A;  5J18 A;  2I38 A;  2INC C;  4M8M A;  1B9R A;  4ZHO A;  3A4S C;  1K50 A;  1E7U A;  2J52 A;  1C4A A;  4US8 A;  2Y5P A;  4GGQ A;  1T0Q C;  3PTF C;  1QOF A;  2C7N B;  4XWW A;  1NDD A;  2BB5 A;  2GLS A;  2JXX A;  2ZZP B;  3VDZ A;  1C77 A;  3APF A;  3M95 A;  3DCG A;  4DK5 A;  1TIF A;  4FN2 A;  5BYQ A;  2V3P A;  1ZUD 2;  4XWT A;  2KQ7 A;  4HEA 1;  3QJZ A;  1Y56 A;  4WJN A;  1EU4 A;  1LQB A;  2KVR A;  3Q14 C;  4HKZ E;  2HD5 B;  2UYZ B;  1FPY A;  5DPT A;  3MC0 B;  3AU5 A;  4I6P A;  3AE1 B;  1AW7 A;  2KD0 A;  3PSE B;  1EO6 A;  4KDL B;  1V5O A;  4KVG B;  2KYW A;  4PS7 A;  4PK1 A;  2KWD A;  2JUO A;  3QWZ B;  2GBK A;  1C9F A;  3TCA A;  1JWM D;  1YN4 A;  2KX0 A;  3EGR A;  3UQB A;  3VTW A;  1Z2M A;  4RFB A;  1VZ7 A;  2KOX A;  1WX7 A;  2MBQ A;  4ITK A;  2J0J A;  1U4A A;  3UQA A;  2ZVO A;  2L32 A;  4LNN A;  1VLB A;  2KZR A;  3APD A;  4LDT B;  2KKC A;  2D10 A;  3U2S C;  1V8C A;  1AN8 A;  3ZDT A;  4EFO A;  4P6V F;  2DZJ A;  2RMM A;  2A5U A;  2DYM A;  2IPK D;  1YQB A;  2B76 B;  3HM6 X;  4GDK A;  1JW9 D;  3BYT B;  3N9Y C;  2UWQ A;  4I6L B;  2OJW A;  4KDI C;  4US9 A;  1H8C A;  4TMA B;  4ANU A;  3ZYY X;  4KSK C;  3ZIM A;  4MGY E;  2MJE A;  3BII D;  2IGD A;  2WX0 A;  3HUI A;  4ANW A;  3SD5 A;  1WX8 A;  4LDT D;  4IUM B;  2JXT A;  4MSM B;  2M17 A;  5BMG A;  1RFA A;  3IAS 1;  4P7I A;  1RAX A;  2QIL A;  2FCS A;  4RGN A;  3VH3 B;  5HI1 A;  2ASQ A;  4WJO A;  1V1O A;  2WHI A;  2LFI A;  1S3S G;  2NPT B;  3PZD A;  1KRH A;  3AEE B;  2CU3 A;  3NZ3 A;  3VUW A;  5D6J B;  1V1P A;  5JHA A;  1YOV B;  5DCN A;  2BGF A;  3VR8 B;  3RNC C;  4FHK A;  3VRA B;  2AYO B;  2IO1 B;  2BWE S;  3IHP C;  4HCN B;  5D2M B;  1YQ3 B;  1E6E B;  4W9D A;  1IBX B;  3RD2 A;  1RLF A;  2DYO A;  2UU7 A;  2NBU A;  2G45 B;  1FEH A;  2IDY A;  3LXF A;  1P0R A;  1MG4 A;  2IJ0 A;  4JWU C;  1WMH A;  1XQQ A;  4EKU A;  2GOW A;  4YXD B;  2JZ3 B;  5JHB A;  5IAA C;  2KJH B;  5AZG A;  2L83 A;  2BW2 A;  4DDG D;  3N3K B;  2WXP A;  2MP2 A;  3Q3N C;  1UEL A;  1WF9 A;  4WWO A;  1ZDX A;  3LDZ E;  5JZE B;  4RMA A;  2H89 B;  2IGG A;  2NR2 A;  3Q8A A;  2JF5 A;  2L00 B;  2DNF A;  2J0M A;  3DWG C;  1FNV A;  5C23 A;  1ET9 A;  3MJW A;  3Q69 A;  1A70 A;  1YJI A;  1UWM A;  1F2R C;  3KLS X;  1V2Y A;  4DDI D;  3BWU D;  5J17 A;  3V05 A;  3AE3 B;  1I4Q A;  1D5X C;  3L17 A;  3ZUN A;  2WDR B;  4ASW C;  2ZCB A;  4KKJ A;  2KK8 A;  2DZI A;  5G5G A;  5H92 C;  4OHJ A;  4KIK A;  3B9J A;  3T3O A;  1NVI D;  3AE5 B;  4G3X B;  4KV2 A;  3BYY B;  4NAW B;  1V86 A;  5CHV C;  2KAC A;  2E6X A;  2AWT A;  1ZOY B;  4NJ6 A;  4IG7 B;  2DAJ A;  3MP9 A;  1YMH E;  3AEC B;  3W5U B;  1WXA A;  5C2T B;  2FID A;  2INP E;  3UF8 A;  3T9L A;  5FR3 A;  3AE2 B;  3J9C A;  3PHW B;  3R66 C;  4A90 A;  2G3Q B;  3KWV A;  2DZM A;  1C79 A;  4MT5 A;  2YEP F;  5IN7 A;  3SDL C;  2M1M A;  2M19 A;  1CK1 A;  3GP7 A;  1EUV B;  4E3C A;  2PVO D;  4BVU C;  3U7Z A;  4ACF A;  4F7Z A;  2ZVN A;  2BVC A;  1SB3 C;  4HDQ A;  2MBB B;  2KT7 A;  1WYW B;  1FCL A;  2RPV A;  1VRA B;  4USA A;  4OVZ A;  2PMV A;  1GB1 A;  2WXM A;  1HZ6 A;  2FCN A;  1OGW A;  4KGR A;  4CO7 A;  3M62 B;  3T3N A;  4RGO S;  1EU3 A;  1I7H A;  4MH8 A;  1IUE A;  3RUL A;  2RSU A;  2V4I B;  3DHG C;  1DYQ A;  2KXJ A;  3IG3 A;  3AM9 A;  3PHX B;  3H7P B;  2QDF A;  1SIJ A;  2KMC A;  3A1Q B;  5TR5 A;  1ZPS A;  3H7S A;  5BMI A;  4ANX A;  2V3N A;  2CS4 A;  2JQR B;  2MRP A;  1XLN A;  3Q8B A;  1SIF A;  2K8H A;  3P1M A;  4LLG M;  4AP4 C;  2PTL A;  1L4D B;  2MWS B;  1ZW7 A;  2IYD B;  4OW0 A;  3DBL I;  1LXD A;  3P4Q B;  1HZ5 A;  3PS6 A;  4LCD E;  4B95 A;  1SSN A;  2E3T A;  1GG3 A;  2K1F A;  1JWU D;  1FO4 A;  2KFK A;  2MBO A;  2G4D B;  3AU4 A;  2KWV B;  1AWD A;  2J42 A;  3EC8 A;  3ZXV A;  4C80 A;  4LNF A;  5E6P A;  1ZGU B;  4OZC A;  3U30 A;  2D07 B;  1V81 A;  1WM3 A;  2QSD A;  2L0T A;  4L1B A;  4XZ4 A;  1WJN A;  3HVZ A;  2LUM A;  3NVV A;  3VXW A;  5LXH A;  2KTF A;  2KWU B;  1JRU A;  1QLB B;  5E6J A;  5DPR A;  1TBE A;  4HWI B;  1WJ6 A;  2DAF A;  2WXO A;  3KYC D;  1WGK A;  2WU2 B;  1QOG A;  3R2T A;  1VR9 A;  4GDL A;  5AZH A;  2D5G A;  3ZRC A;  2I1J A;  2M0A A;  4YSX B;  1J7A A;  1K8R B;  4AQ7 A;  3N1Z C;  3DBH I;  1ZE3 D;  4GDK B;  4PS8 A;  3Q8E A;  1TS4 A;  4KZC A;  4NJC A;  4FUL A;  2JX5 A;  3P63 A;  2NTT A;  1BML C;  4ZRP A;  1VD2 A;  1L4Z B;  3GB1 A;  4KGT A;  4JQW C;  4EUT A;  5AUK A;  5DPS A;  3TIX A;  1WXQ A;  3H8H A;  4JL9 A;  2MX2 A;  5CTR C;  4G0N B;  1P7F A;  2WXR A;  2IBI B;  3R8B A;  1WRD B;  3C8Y A;  4GN1 A;  3JSV A;  2X38 A;  1SXT A;  2M4N A;  2LHD A;  3N32 A;  1HXY D;  1V6E A;  3QHT A;  2HTM E;  2AQ2 B;  3U7D A;  4JIO U;  1MJD A;  1WGY A;  1L6U A;  3QAR A;  4RGM A;  4UDU C;  4A8X C;  1V1P B;  2K39 A;  3CSF A;  4A6Q A;  4D2K A;  5BYR A;  3VUY A;  2WGS A;  2K8B A;  4HDO A;  4AWJ A;  4EZL A;  3DBR B;  3DBL B;  1FXA A;  2LUE A;  2KDB A;  4BAX A;  1I4H A;  3CF6 E;  1JAL A;  2BWF A;  2KTR B;  1YQ4 B;  1DOX A;  1RFK A;  3A9J B;  3DQV A;  3WAP A;  2KO3 A;  1QKZ A;  1D4B A;  3VVW B;  1N5X A;  2OJR A;  3ZTC A;  2N9L A;  3ALB A;  4GMV A;  1HTQ A;  2BKR B;  1X1M A;  2KMA A;  2ACZ B;  1C3T A;  1N60 A;  1RYJ A;  4FBJ B;  3Q3O C;  2AL3 A;  1P9D U;  1YN3 A;  2KAN A;  3QAQ A;  4EEW A;  4NNJ B;  3ML9 A;  4ICV A;  4W9J A;  2DYB A;  2XK5 A;  2K5P A;  4GIV A;  2SEB D;  2J0K A;  3NJT A;  2WDV B;  2C7H A;  1N6Z A;  4P16 A;  5G55 A;  3RNF C;  4C7Y A;  4HPL B;  4JX1 C;  1A5R A;  2QIE B;  4AS1 A;  4KIK B;  2AQ3 B;  2CJO A;  3RUI B;  3HIZ A;  1P3Q U;  4E71 A;  4FJZ A;  1KM7 A;  1GAQ B;  2LRW A;  5IA7 A;  3DBH B;  1WXM A;  4WWM A;  1UGJ A;  2SAK A;  4FJV B;  3OLM D;  4KX6 B;  3RPF C;  3B0A A;  3QK0 A;  4BOS C;  1DOI A;  3KUC B;  1T0Y A;  2MBH A;  4IM0 A;  3W1Y A;  2G4S A;  1KLG D;  1SF0 A;  3PRE A;  4ANV A;  1AYF A;  2FIF A;  3R7Q A;  1K52 A;  2W55 A;  2OOB B;  3MC9 A;  3DPD A;  3JYU A;  4YWG G;  1GC7 A;  2PPH A;  3AEF B;  4GLS C;  4C00 A;  1CJE A;  3I63 C;  1MG8 A;  3Q8C A;  1J8C A;  1P98 A;  4N58 A;  3RNB C;  2RDB C;  1GPX A;  2W54 A;  2DEN B;  3NZS A;  1Q5W B;  2X8X X;  3UIO B;  2N9X A;  2DWQ A;  4K7U A;  4MM3 A;  1PGB A;  3KH0 A;  2WXH A;  4J6I A;  4GSW A;  1TKY A;  2L76 A;  1NBF C;  1XCT L;  3Q2A C;  4II2 B;  2WXG A;  4N6E B;  3BY4 B;  3FAH A;  2QHO A;  2R2Q A;  1FFV A;  2Y3A A;  1MHX A;  1I4R A;  4HRO A;  1KH0 A;  1OTR B;  3AED B;  4ZYS A;  3L16 A;  3KUD B;  3Q6B A;  4MAC A;  3E9S A;  1DOY A;  3PT2 B;  1FM0 D;  2BYV E;  3EA6 A;  4TKN A;  4A9A A;  1TYG B;  4IM2 A;  1E8X A;  3ABV B;  1NI2 A;  3VR9 B;  4O1N A;  1LO5 D;  2KQ4 X;  3ZNZ B;  2LRU A;  2HJ8 A;  2LVO A;  4ZRJ A;  1WH3 A;  1I4G A;  3FIL A;  3RZW C;  4RM9 A;  5FR6 A;  4XX5 A;  4QAY A;  1PYW D;  2K8C A;  1NYQ A;  3U52 E;  1WZ0 A;  2V0G A;  3N30 A;  3NVW A;  3NS8 A;  4BKT A;  3BZD B;  3EEC A;  4B6W A;  5C3J B;  2PE9 A;  3GE8 C;  5JXV A;  3MHZ A;  2MHJ A;  1JML A;  3V60 A;  2K0P A;  4YTN B;  2JPH A;  3ZLZ A;  3TEY A;  4ZOH C;  1I42 A;  2MH7 A;  2R2O A;  5AZF A;  2FE8 A;  2KFK B;  3DBS A;  2MQJ A;  2O6V A;  1EF1 A;  5AUI A;  2PEA A;  2DZK A;  3GOE A;  2WQY B;  2D3G A;  3I9V 1;  1WRI A;  3W5V B;  2W3R A;  4MJS A;  1Q10 A;  2KQS A;  4BKS A;  1WI0 A;  5E6O A;  5H8Y E;  4HXD A;  1EWY C;  3WAO A;  1OQR A;  1WXV A;  4PS3 A;  2FBW B;  5EDS A;  3L0W B;  3RYT A;  3VFK A;  1J19 A;  3H1U A;  4XC2 A;  3SR6 A;  2KX3 A;  2ON8 A;  3PZ8 A;  1L2N A;  1BT0 A;  1FNW A;  4IWO A;  1TKE A;  3PV1 A;  4MEL A;  4MSQ B;  4ARC A;  3ZGZ A;  1YN5 A;  4GOC A;  2DLB A;  4JWS C;  5BMH A;  5HKH A;  4W9I A;  2WXK A;  3IBE A;  2ZEQ A;  2RPQ A;  2Y5C A;  4WIP A;  1GNU A;  5MPO A;  2NBW B;  1JWS D;  4FLH A;  4YSZ B;  3TUO A;  1KTK A;  2Z8L A;  1UUP A;  4RCO A;  2VZK B;  3A9K B;  3BVZ A;  2BBC A;  1T0R C;  4IKG A;  4RNA A;  1F52 A;  1IGC A;  2HDE A;  3I3T B;  3PRP B;  3ZJV A;  1FRD A;  1CQV A;  5CHW A;  2M56 B;  4YT0 B;  1E5W A;  5GMV A;  3C19 A;  2BTE A;  1N5W A;  1OQQ A;  3MHS D;  1QF6 A;  1S1Q B;  3L13 A;  4K81 A;  1HA5 A;  3ZNG C;  2MBE A;  1SJH D;  2V3S A;  3U4E G;  4TV3 A;  1WGG A;  3KWL A;  5JH5 C;  1E8Z A;  4OVU A;  3BVG A;  1WE6 A;  2BQQ A;  1I4P A;  4LJP B;  4A20 A;  2BPS A;  2VZK D;  4K3B A;  3ZVV A;  4HVB A;  2BS4 B;  2RD0 A;  3O13 A;  3ZKJ C;  4DHJ B;  3KYD D;  3RCZ A;  2BYF A;  4X57 B;  1XEE A;  2ZPY A;  3AXC A;  3X23 A;  1EWC A;  1RM6 C;  4PYU A;  4Q2J A;  3QQ8 B;  1TY0 A;  3K9O B;  5LLI A;  2ZW0 A;  1TY2 A;  1XO3 A;  2WX1 A;  4EE2 A;  2AQ1 B;  3LJ3 A;  1BXT A;  3TEW A;  4DXG A;  1KFY B;  3IT6 B;  2N1W A;  4M0W B;  1JWA D;  2BF8 B;  3DVN U;  4GXB A;  2LJ5 A;  3I57 A;  3V62 A;  1V80 A;  4HPM B;  3MFG A;  2CHW A;  2BB6 A;  3R2I A;  4AOF A;  1XLQ A;  3RFZ B;  2LJI A;  3W1S C;  3BK2 A;  2KLC A;  4DHJ D;  2O2V B;  1WGD A;  1IPG A;  2W82 A;  4TSS A;  4DXA B;  3ZNI D;  2MJ3 A;  4ZDV A;  1G6J A;  4NAM A;  3B1L X;  1JQ4 A;  1T6B X;  3BK1 A;  1TT5 B;  3RN9 C;  2BT6 A;  1OEY A;  3JW0 X;  2ZCC A;  1T0S C;  2JZP A;  4M00 A;  2V1Y A;  3P4P B;  3VRB B;  2HJ1 A;  4BBN C;  4FJY A;  5DPW A;  2KNB A;  2JRH A;  5FK9 C;  2EEL A;  4F8C B;  1PGX A;  3UIP B;  4BKG A;  1UNS A;  1SEB D;  1WXS A;  3UGB B;  1JRO A;  1YD8 U;  1SE3 A;  3UI3 A;  3AB5 A;  5IKC M;  1FMA D;  2PJH A;  4ICU A;  3DBR I;  2LGS A;  2CKH B;  1UWX A;  4C56 C;  4NZL B;  3ZW3 A;  2GBM A;  1N63 A;  1Z5S B;  3I5J C;  4H2A A;  2W9N A;  2Q5W D;  1WJU A;  4C4V A;  2ICI A;  3TEX A;  3K9P B;  3EFC A;  1E7P B;  5D3I B;  2JY6 A;  2L0F A;  2HTH A;  2LAS A;  1UD7 A;  3N20 C;  2QC8 A;  4XGA B;  2BYE A;  2EKE C;  4I6N B;  1D3Z A;  1LGR A;  3L10 B;  1F1H A;  5I4D A;  2FCQ A;  3SFD B;  4W9F A;  3P42 A;  1KJT A;  1VJK A;  4HK2 A;  1AAR A;  3VTV A;  2R61 A;  4MM3 B;  1XCQ L;  4W9G A;  1J0G A;  1OQY A;  3WA0 A;  4WAF A;  1IBX A;  4KKI A;  2D11 A;  4LNI A;  2YLM A;  1TGZ B;  3ECI A;  4B9K A;  2NCN A;  3C0R B;  2KJ6 A;  2N9P C;  1XT9 B;  4YTM B;  2KN5 A;  1SE4 A;  1WR1 A;  4MDK E;  4WQM A;  1SE2 A;  2B3A A;  4W9E A;  3V6E B;  4EZK A;  2REX A;  2N9K A;  1MPE A;  1D5Z C;  3ONS A;  5EE9 A;  1E10 A;  3BVM A;  4HPP A;  2K6D B;  2WWZ A;  4M8N A;  4TQ1 A;  5J2R A;  4IWQ A;  1JRP A;  1MFW A;  3WCQ A;  5TSS A;  2IO2 B;  5FKA C;  4OZB A;  3UIN B;  2VRR B;  1L5P A;  3KW5 B; 
#chains in the Genus database with same CATH homology
 1E6E B;  4J3O D;  2N7J A;  1IBX B;  1WWT A;  1DOI A;  2LGI A;  2DYO A;  1QQR A;  2MEK A;  1KLG D;  1SF0 A;  5HG2 A;  1AYF A;  1FEH A;  2IDY A;  5D7G A;  3LXF A;  1FIQ A;  1DGJ A;  1K52 A;  2W55 A;  3DWM A;  3ZJT A;  2MJD A;  4YWG G;  2KN4 A;  2RDG A;  2IJ0 A;  3B2G A;  3AN1 A;  4JWU C;  3AEF B;  2INN E;  3IXS A;  4YXD B;  4GLS C;  3W1S A;  1CJE A;  3Q8C A;  5EE1 A;  2L83 A;  2QEJ C;  2BW2 A;  1N61 A;  2WXL A;  3AH7 A;  1ET6 A;  2WXP A;  4XDD A;  3IT4 B;  4N58 A;  4A55 A;  1C4C A;  1GPX A;  1ZDX A;  2W54 A;  2K22 A;  2H89 B;  2IGG A;  3Q8A A;  1ZXH A;  3DWG C;  1FNV A;  2DWQ A;  1PGB A;  2JYT A;  2JU6 X;  1ET9 A;  1E9M A;  2WXH A;  2JWU A;  3Q69 A;  1JWB D;  1TKY A;  1A70 A;  1YJI A;  1UWM A;  2J4X A;  1D5M C;  2G1E A;  1XCT L;  1F2R C;  3KLS X;  3BWU D;  2BYT A;  2WXG A;  4N6E B;  1STE A;  4YSY B;  3V05 A;  3FAH A;  3AE3 B;  1L0Y B;  1I4Q A;  2BS3 B;  2WXF A;  1FFV A;  2H88 B;  2W3S A;  2Y3A A;  1D5X C;  2GB1 A;  1MHX A;  1I4R A;  2K3U A;  2WDR B;  4HRO A;  1KH0 A;  4KKJ A;  5G5G A;  2JYE A;  3AED B;  5H92 C;  3Q8F A;  4ZYS A;  4OHJ A;  3B9J A;  1PFD A;  4TQ0 A;  3T3O A;  4RH6 A;  4MAC A;  3E9S A;  1DOY A;  2AX5 A;  1NVI D;  3AEB B;  1FM0 D;  3AE5 B;  3EA6 A;  3BYY B;  1ACC A;  4A9A A;  4NAW B;  1TYG B;  3NS1 A;  3ABV B;  3VR9 B;  2KMM A;  2EKI A;  1LO5 D;  2KAC A;  2KQ4 X;  4O1N A;  2E6X A;  3AE6 B;  1FNU A;  1TS3 A;  1ZOY B;  1I4G A;  1QT9 A;  1CZP A;  3FIL A;  3TEZ A;  3MP9 A;  3CWI A;  1YMH E;  3AEC B;  4JE3 B;  3W5U B;  3OWE B;  2WXN A;  5C2T B;  2GRI A;  2INP E;  4L23 A;  2QJL A;  1F77 A;  1PYW D;  4HKQ A;  1NYQ A;  3U52 E;  5FR3 A;  2V0G A;  4L2Y A;  2WNM A;  3NVW A;  3AE2 B;  3J9C A;  4A90 A;  3BZD B;  3KWV A;  2OED A;  5C3J B;  1C79 A;  4MT5 A;  1HEZ E;  3HVD A;  1D6E C;  2YEP F;  5JXV A;  3MHZ A;  3NVY A;  1L0V B;  4RF1 A;  2M19 A;  3AE7 B;  4RF0 A;  1CK1 A;  1JML A;  2ZW1 A;  1WSP A;  3GP7 A;  2K0P A;  4XDC A;  5D3D A;  3ZQ4 A;  4YTN B;  3TEY A;  4ZOH C;  2MH7 A;  4RGT A;  1F2R I;  2PVO D;  2FE8 A;  1BUI C;  5G5H A;  3U7Z A;  1SB3 C;  2LEK A;  1MVK A;  1J7B A;  1YNT E;  1FCC C;  1SBB B;  5AUI A;  3SFE B;  1FCL A;  2L52 A;  2RDH A;  2RPV A;  2I2Y A;  1VRA B;  4USA A;  3FIL B;  2WQY B;  4OVZ A;  3I9V 1;  1GB4 A;  1WRI A;  1TZO A;  1V97 A;  2PMV A;  3W5V B;  1GB1 A;  2W3R A;  2WXM A;  4LK0 M;  1ZXI A;  1HZ6 A;  1Q10 A;  4KGR A;  4ARI A;  5H8Y E;  3ETR A;  3E56 A;  1NEN B;  1EWY C;  3MJ5 A;  4DXF A;  1OQR A;  3TSS A;  2GI9 A;  1ROE A;  3AE4 B;  4RGO S;  1XF5 L;  4YTP B;  1NYR A;  3T3N A;  2FBW B;  1EU3 A;  1I7H A;  3HRD D;  4IOI E;  4MH8 A;  1IUE A;  3LB8 C;  1NEK B;  1FD6 A;  2V4I B;  4DQO C;  1DYQ A;  5HHD G;  2PKO A;  3AM9 A;  3SR6 A;  1R7S A;  1VZ8 A;  2ON8 A;  2L1A A;  3PZ8 A;  1SJE D;  2JSV X;  2J53 A;  1FNW A;  1SIJ A;  1ESF A;  1TKE A;  2QMT A;  1ZPS A;  5BMI A;  4ARC A;  1C78 A;  3VQI A;  2TSS A;  1YN5 A;  3ZGZ A;  2V3N A;  4JPS A;  2JQR B;  2DLB A;  4JWS C;  4R3D A;  5BMH A;  1XLN A;  2WXK A;  3Q8B A;  1L6V A;  4ZRQ A;  1FFU A;  2BS2 B;  2PIA A;  2Y5C A;  4WIP A;  1TS2 A;  3P1M A;  4B0E A;  5MPO A;  1C76 A;  4LLG M;  1E0Z A;  1JWS D;  4YSZ B;  5LNK 1;  2PTL A;  3TUO A;  1KTK A;  1L4D B;  2Z8L A;  1UUP A;  3NUH B;  4RCO A;  2VZK B;  1XLP A;  4C7Z A;  3BVZ A;  2BBC A;  4IKG A;  1IGD A;  3IAM 1;  1IGC A;  3B2F A;  4KX6 B;  4OW0 A;  2HDE A;  3LYY A;  4RNA A;  3P4Q B;  1HZ5 A;  3ZJV A;  4B0M A;  1C4P A;  1HQR D;  1FRD A;  1CQV A;  2M56 B;  5GXG B;  1NI3 A;  4YT0 B;  1SSN A;  2E3T A;  2BTE A;  1JWU D;  1N5W A;  1OQQ A;  1FO4 A;  2NMQ A;  1QF6 A;  1M4V A;  2WS3 B;  1AWD A;  2J42 A;  1RWS A;  4C80 A;  3FC4 A;  1EM7 A;  1HA5 A;  4PT5 A;  1PGA A;  1SJH D;  3U4E G;  4M0W A;  3URY A;  2WU5 B;  2KDM A;  4OZC A;  2WDQ B;  3KWL A;  1OFF A;  5T8I A;  3KQ4 A;  1VDV A;  3BVG A;  2G9H D;  1I4P A;  2QSD A;  2KAJ A;  2VZK D;  4L1B A;  1N62 A;  5HFY A;  4KGS A;  2K9X A;  1VZ6 A;  3SEB A;  2BS4 B;  3HVZ A;  1ZP0 B;  2LUM A;  3O13 A;  2LMC A;  1PUT A;  3NVV A;  1K53 A;  1XEE A;  1XXG A;  1QLB B;  2N0S B;  5E6J A;  1EWC A;  1TKG A;  1RM6 C;  1TJE A;  3AEA B;  4FXC A;  3CIR B;  4Q2J A;  1TY0 A;  1F0Z A;  2WXO A;  2ZW0 A;  1WGK A;  1XLO A;  5BYS A;  2WU2 B;  1TY2 A;  1XO3 A;  4EE2 A;  2AQ1 B;  1QOG A;  1QOB A;  3R2T A;  1VR9 A;  3AE8 B;  1BXT A;  1ZDV A;  4DXG A;  3TEW A;  2D5G A;  1KFY B;  2M0A A;  3IT6 B;  4YSX B;  1J7A A;  1B1Z A;  1QIL A;  3AEG B;  4AQ7 A;  1JWA D;  2WP9 B;  3I57 A;  2I38 A;  2PLP A;  1MI0 A;  1ZE3 D;  1WYG A;  2ONQ A;  4GDK B;  3Q8E A;  1B9R A;  1TS4 A;  3MFG A;  2BB6 A;  4CQN A;  4ZHO A;  1K50 A;  3AE9 B;  3R2I A;  1XLQ A;  2J52 A;  2LJI A;  4NJC A;  1C4A A;  3RFZ B;  4US8 A;  2Y5P A;  3BK2 A;  2W82 A;  1QOF A;  4IDI A;  4N59 A;  2JX5 A;  4TSS A;  2MJ3 A;  4OZA A;  4XWW A;  3P63 A;  3AMZ A;  2NTT A;  1BML C;  2BB5 A;  4ZRP A;  1C77 A;  4NAM A;  1L4Z B;  3AV8 A;  3GB1 A;  3P4S B;  4KGT A;  2PW9 A;  3W9C B;  5BYQ A;  2V3P A;  1ZUD 2;  4XWT A;  4HEA 1;  4LTU A;  5AUK A;  1Y56 A;  4HRS A;  1T6B X;  1JQ4 A;  3BK1 A;  1EU4 A;  1WXQ A;  2FUG 1;  3H8H A;  4HKZ E;  2BT6 A;  3P4R B;  2JZP A;  1FXI A;  1P7F A;  2WXR A;  3P4P B;  4GDL B;  3MC0 B;  3VRB B;  3R8B A;  1MHH E;  3AE1 B;  1AW7 A;  3C8Y A;  2X38 A;  1SXT A;  5FK9 C;  2EEL A;  2LHD A;  3W2D A;  1PGX A;  2KWD A;  1UNS A;  1SEB D;  1HXY D;  2HTM E;  2AQ2 B;  1C9F A;  1JRO A;  1JWM D;  1YN4 A;  1SE3 A;  3UI3 A;  3AB5 A;  3EGR A;  1L6U A;  1FMA D;  4RGM A;  4UDU C;  4RFB A;  4A8X C;  2XNA C;  1VZ7 A;  4C56 C;  1ENF A;  1UWX A;  1V1P B;  3EUB 2;  4NZL B;  1K51 A;  4A6Q A;  2OHF A;  4ITK A;  4D2K A;  1N63 A;  5BYR A;  2WXJ A;  2L32 A;  1VLB A;  4H2A A;  2CJN A;  3U2S C;  1KLU D;  1T5X D;  1V8C A;  2Q5W D;  1FXA A;  2ICI A;  1I4H A;  3TEX A;  1GOZ A;  1AN8 A;  1FRR A;  1JAL A;  2LHE A;  1E7P B;  1YQ4 B;  5D3I B;  4P6V F;  1DOX A;  1RFK A;  1J7C A;  2RMM A;  1QKZ A;  2DYM A;  2IPK D;  2NTS A;  2B76 B;  1D4B A;  1TS5 A;  1JCK B;  1N5X A;  3PO0 A;  2N9L A;  1JW9 D;  3BYT B;  3N9Y C;  1YJJ A;  4WUR A;  5I4D A;  4US9 A;  5EE3 A;  4TMA B;  2WXI A;  5EE0 A;  3SFD B;  2YEP B;  3NVZ A;  3P42 A;  4REZ A;  3ZYY X;  2MJE A;  2ACZ B;  3BII D;  2IGD A;  4WH4 A;  1VJK A;  1N60 A;  1RYJ A;  3HUI A;  2R61 A;  4MM3 B;  1XCQ L;  1YN3 A;  2DBY A;  4WAF A;  2JXT A;  1IBX A;  1T3Q A;  4KKI A;  1PDX A;  5BMG A;  2XN9 C;  4XE0 A;  4ZHP A;  1I4X A;  2PVG C;  3IAS 1;  2K5P A;  1P7E A;  2QIL A;  3GS2 A;  2WXQ A;  3L4P A;  1QOA A;  2SEB D;  1KF6 B;  4RGN A;  4YTM B;  2WDV B;  3ZJU A;  4P16 A;  5HI1 A;  4C7Y A;  4JX1 C;  2QIE B;  4HJG E;  4AS1 A;  1SE4 A;  4WQM A;  1V1O A;  2AQ3 B;  1SE2 A;  2WLB A;  2CJO A;  3V3X A;  2N9K A;  1MPE A;  1D5Z C;  5EE9 A;  2IGH A;  2LFI A;  1E10 A;  3BVM A;  3NRZ A;  1GAQ B;  1KRH A;  3AEE B;  2CU3 A;  3NZ3 A;  4TQ1 A;  1L0X B;  1JRP A;  1V1P A;  3WCQ A;  3VR8 B;  4WWM A;  5TSS A;  3PZ7 A;  3VRA B;  1UGJ A;  5FKA C;  4OZB A;  2SAK A;  1L5P A;  1YQ3 B;  3RPF C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...