2D5GA

Structure of ubiquitin fold protein r767e mutant
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
83
structure length
83
Chain Sequence
CDSIVVAYYFCGEPIPYETLVRGRAVTLGQFKELLTKKGSYRYYFKKVSDEFDCGVVFEEVREDEAILPVFEEKIIGKVEKVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of ubiquitin fold protein R767E mutant
rcsb
source organism Rattus norvegicus
molecule tags Signaling protein
molecule keywords Axin-1
total genus 16
structure length 83
sequence length 83
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2005-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00778 DIX DIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.380 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2d5gA00
2D5GA 1WSPA 4WIPA 3PZ7A 3PZ8A
chains in the Genus database with same CATH superfamily
3A9JB 5C1ZA 3DBRI 1SB3C 4JWSC 4BKSA 1T0RC 3RNAC 1WXAA 4XYCA 4P1BC 1FFVA 1YQ4B 3MC8A 1XQQA 3P4SB 3BVMA 2N7EA 3CIRB 3SD5A 1MJDA 2N0SB 3BWUD 3Q8EA 2OOBB 5GMVA 1JCKB 3U7DA 3LJ3A 5AZGA 3T8MA 1MHHE 3C0RB 4BOZB 2D2QA 4RH6A 5D94A 2WXMA 3I63C 4A3PA 2DZJA 1SE3A 1ZDXA 2KQ4X 4IDIA 4MM3B 3IFWB 4GN1A 1F9JA 4S17A 4TV3A 3NS8A 4HPPA 4DXGA 4C7ZA 3TIXA 3RNBC 2JUOA 3Q8AA 3IT4B 2LUMA 1MHXA 1J7CA 2VZKD 2NS5A 4WWPA 4JGHB 1WMHB 3ZIMA 2K22A 2C5LC 1T0YA 3HVDA 1F2RC 2MJEA 2MRPA 2WDRB 2WS3B 4ICVA 1FPYA 2MBEA 4GU2A 3EHVA 4NJ6A 3P2BA 3EA6A 1TYGB 4CYEA 2M1MA 2QSDA 5D3DA 1Z5SB 4L1BA 1DOYA 1AARA 3A1QB 4C4VA 4YWGG 2J4XA 2LJ5A 3HVZA 2JZZA 3L10B 4W9DA 3SDLC 3UF8A 3SHQA 3VTVA 1J7BA 2MCNB 2AQ2B 1E7PB 1EU3A 4I6PA 5IO9A 3PPAA 3AH7A 2N4FA 1RYJA 2G45B 3P4RB 1DOIA 1LQBA 1NYQA 2LZ6A 3APFA 1SE2A 1UWXA 2R61A 3SU8X 5HFYA 2LEKA 3OG5A 2D3CA 4A90A 2DAFA 1EWCA 1WRIA 2N1WA 4W9EA 4A55A 2LWPA 2LGYA 1GC7A 1NI3A 5G5HA 1FXAA 1L0VB 3ZQ4A 4ANWA 2V1YA 1KTKA 4IW0A 4ANVA 3J9CA 4MGYE 1NEKB 2LUEA 3P1MA 4CQNA 2JF5A 3LB8C 4OZCA 3WANA 4ZYNA 2N9KA 1MG8A 3ZRFA 2BYEA 4HVBA 2CJOA 2FCSA 3VVWB 2K3UA 4KGRA 4E74A 2NPTB 5HI1A 1WXVA 2KVRA 1L0YB 1WMHA 1T0QC 2KDEB 5AUIA 2QC8A 3ZNID 4XWWA 2I2YA 4NAMA 3DBRB 1LFDA 2GBKA 4X57B 3MJWA 2JY6A 1V1PB 3PV1A 1UF0A 3NZSA 3H7SA 4MM3A 4HRSA 4OVZA 1I4PA 1VD2A 1PGXA 2V9HA 2GB1A 3ZNZB 2RPQA 3AU5A 3IG3A 3APDA 3VR8B 3QARA 3PVLA 3VQIA 2K8BA 1GUAB 2LI5A 4GGQA 3A1QA 4C4VB 5CX3A 4NZLB 3SR6A 1J7AA 1AW7A 5D2MB 1WR1A 3IVFA 5AZHA 2WXPA 3QA8A 1JWSD 4NAWB 1V2YA 2AL6A 4N6EB 4LNIA 2IGHA 2IO1B 2REXA 5FR6A 3A9JA 2FIFA 2BT6A 1V81A 3V60A 5C2TB 4G11A 2V4LA 3N1XC 4M00A 4TSSA 4FLHA 1HEZE 2I1KA 1Q10A 1UZXB 1NI2A 3KWLA 1VRAB 1JRPA 3ZTDA 4DHJB 3KVFB 4GDLA 1LGRA 1TS3A 2FAZA 2KAJA 3P4PB 4B9KA 1NBFC 1WH3A 1CJEA 1YD8U 4MT5A 1YX6B 4ASWC 1E9MA 1R4NB 4MEMA 4F7ZA 4MJSB 3AEGB 3EFCA 1VDVA 4WJNA 2XEWA 2KJRA 3QX1A 2KZRA 2LGXA 4LJOB 2WYQA 4RNAA 3Q3FA 5JXVA 1WGRA 1SF0A 3L0WB 1L0XB 3WIMA 2PLPA 3AMZA 1FEHA 5L95C 1KRHA 4K81A 2KFKA 2FCMA 1OQYA 1EU4A 4W9FA 4LCDE 1WY8A 1ACCA 3L4PA 1N62A 2MHJA 2W55A 3VRBB 5TR5A 5E6OA 2CJNA 2BYFA 2DLBA 1ESFA 2BW2A 4W9KA 2RSUA 2IGDA 3GP7A 5IOIA 2KMAA 4BVUC 2QILA 2WU2B 3ZDTA 4WWNA 2MP2B 2A5UA 3RZFA 3Q6BA 2DYBA 1WM2A 4FBJB 4J6IA 1CMXB 2L32A 2WX0A 2KC2A 3ZDMC 2MW5A 3VH4B 4HEA1 5BYQA 1BXTA 4K3CA 4M0WA 4PK1A 2IZVB 2GRIA 4BBNC 1JWUD 4JX1C 1X1MA 1SJHD 2X8XX 2ZNVC 1TTNA 1FNVA 1KLGD 2QIEB 4AUQC 3KH0A 1HQRD 4WH4A 4XE0A 3A33B 2KDBA 3MHSD 2Y5PA 4A6QA 2QEJC 4UDUC 4RM9A 2LASA 2N9LA 4HJGE 4G50A 5AUKA 3RN9C 3N30A 3DBLI 3QC8B 2Z8LA 2QMTA 4W9GA 3AEFB 1XT9B 1VCBA 3RUIB 5CHWA 2PEAA 2KK8A 3QHTA 4GOCA 2PMVA 3MP9A 2QDFA 1ET6A 5HG2A 1I4HA 4GDKA 4IOIE 1ZW7A 4ZHOA 1T5XD 1KF6B 2KLGA 2WNMA 3BYYB 3T9LA 1SGHA 4LDTD 1L4DB 1T3QA 2R2QA 2N1VA 1EWYC 4GSWA 3B2GA 1R4MB 3ALBA 3IBEA 2JX5A 1R4MI 4NJCA 4ZOHC 3P63A 1UBQA 3RNEC 2NPTA 2IGGA 3K9OB 5MPOA 3L17A 1JALA 1N60A 1GPXA 1VJKA 3SFEB 5AZFA 3Q14C 1J0GA 4JIOU 3FILA 4WWMA 2JSVX 4YSYB 1V6EA 2Q5WD 3BK2A 2D5GA 3HIZA 2CKHB 2RGFA 3OWEB 2MA9B 1TJEA 3RNCC 3KQ4A 1VZ7A 2WLBA 1ZDVA 3ZTCA 4PS7A 4K7SA 2BGFA 4W9IA 3AXCA 3VH3B 2YLMA 4AOFA 2LVOA 3RD2A 4HCNB 2NBUA 1YN3A 3KUDB 3VTWA 1N5XA 4H2AA 3L08A 3K9PB 2JYEA 3RPFC 2GOWA 1WZ0A 2ZCCA 1KH0A 3AE1B 2C9WB 3AB5A 2K6DB 1HXYD 4C80A 3KYCD 3V6CB 3MJ5A 4OVUA 4L2YA 3I3TB 1ISNA 1C77A 2KMCA 4RM8A 2JZPA 4ZHPA 2V3PA 3RI7C 4KSKC 3ZXVA 1D5ZC 3Q8BA 1FCCC 2BWES 2J0KA 2WXOA 1RFAA 1P1AA 1TY0A 2KACA 3A9KA 3AEBB 1IP9A 2FUG1 3QJZA 4IM0A 4IG7B 1YJ1A 2C7NB 2L76A 4LNNA 5GXGB 2SAKA 4GXBA 1WXQA 1PDXA 1SSNA 2AYOB 1I4GA 3NVWA 5DPWA 3N20C 1B1ZA 1FM0D 3W1YA 4GLSC 2KD0A 4IKGA 1E90A 3ZVVA 1WJNA 1Q0WB 4IM3A 4WURA 5C23A 3NY5A 3AU4A 1M94A 4LTUA 2GMIC 4LLGM 1V49A 4BKGA 4WIPA 3DVNV 1EF5A 1GAQB 3PHXB 2MX2A 1E5WA 2ON8A 5EE9A 1XLNA 1R4NI 2KWUB 2PPHA 2ZVOA 2KHWB 3W5VB 1FXIA 2IY1B 2NR2A 4KDLB 5FKAC 3OAWA 2KWVB 2FCQA 1WJ6A 4AWJA 3R3MA 2PVOD 2YVCA 4KKIA 4NY0A 1LM8B 2M8SA 2IO3B 3IAS1 3N32A 4HXDA 2MJDA 3AEAB 3DHIC 3U52E 1QF6A 1WJ4A 4OHJA 1N63A 2ZEQA 5J17A 4KZCA 2KWCA 1BT0A 1P98A 3GB1A 4JE3B 3M95A 4RFBA 1SBBB 1WJUA 4XDCA 1VZ6A 4MDKE 3CF6E 4AQ7A 3ONSA 4DHJD 5J2RA 3RT3B 4F8CB 1D6EC 3NZUA 4FADA 4LNOA 2SEBD 4REZA 2L52A 1E10A 1QILA 1VR9A 3QIJA 1D4BA 1GG3A 1IGCA 3AE9B 3EGRA 4FXCA 3TSSA 1KFYB 2HTME 2WXHA 3M3JA 1VZ8A 2JVCA 1P7FA 2KDIA 2L8JA 3Q3OC 4AJWA 1WYWB 4JPSA 1I4RA 1HZ5A 2RMMA 4CO7A 3JVZX 1YMHE 3QK0A 4HLEA 2N9XA 2PTLA 3TEZA 5E6NA 4HPLB 1GB4A 2PJHA 4FN2A 2JYTA 3PGEA 3BINA 4IM2A 5DCNA 5LLIA 2PVGC 2YEPB 4RF0A 5G55A 1UELA 1K51A 1PGAA 1V5OA 1JWAD 1VLBA 1D5MC 1V5TA 1UGJA 3H1UA 3O65B 2FIDA 2H89B 1GJZA 3B9JA 3U8ZA 4E3CA 5FR3A 4MELA 4XWTA 1E8XA 3UINB 3ECIA 1JQ4A 4AP4C 3SFDB 1YQ3B 2DBYA 1DYQA 4N58A 2RDBC 2WDVB 4W9LA 4EZLA 4URKA 1JMLA 3AE5B 4M02A 1QT9A 1FXTB 4NJ7A 3R2TA 2LXCA 2Z0DB 2BBCA 4RMAA 2L1AA 2D10A 2MBQA 4WWOA 4DDGD 3QWZB 3R2IA 1KOTA 2JRIB 4TMAB 1QOAA 4WAFA 3UIPB 3RULA 2KJ6A 2L0FA 1F0ZA 4MGIE 4RGMA 4II2B 2V4IB 3RZWC 1A5RA 3NJTA 4A9AA 3CMMB 2K8CA 1WE6A 4OVVA 4CHKA 4EEWA 1GB1A 1L5PA 1UUPA 1E7UA 3HM6X 2N9EB 2WWZA 3MC0B 1FRDA 2J0JA 3MTNB 3PTFC 3Q3MC 1ZUD2 2N7JA 3AEEB 3NRZA 4W9CA 2IPKD 3NVVA 2WXNA 3ZNGC 4US8A 2M0XA 3N9YC 1JW9D 2LVPA 3GS2A 5IA7A 3QQ8B 2BS3B 3C19A 1I42A 3ML8A 2K25A 4QAYA 4O1NA 2I1JA 4K3BA 3RYTA 2NTSA 4ICUA 2O6VA 2KVZA 4HPMB 2TSSA 2HJ8A 1TKYA 2L00B 1IBXA 1OEYJ 3ZJUA 1H4RA 2RDHA 1QKZA 4NQLB 3ML9A 1Q1OA 1ET9A 2WXJA 2QJLA 1FNWA 4YT0B 2AQ1B 1E6EB 1V86A 1WGGA 2DZKA 2IO2B 4USAA 3AE8B 3AN1A 4D2KA 4NPNA 3RCZA 2KTRA 2OHFA 2MH7A 4KV2A 2K1FA 5L83A 3N1YC 2G4SA 3I57A 2W82A 2D07B 2NCNA 1ZKHA 1DGJA 1HTOA 1MG4A 4EFOA 1UGMA 3AE3B 2C60A 3CSFA 2MWSB 4M8NA 3NVYA 2YEPF 1YN5A 3RNGC 1TY2A 3Q69A 3GZNB 4OZAA 2JT4B 2JPHA 1YN4A 3B1LX 3NG0A 2PIAA 4US9A 3VRAB 4EOYA 2WXRA 5KHOA 3IHPC 3VHTC 2LHEA 3OJ3A 2K9XA 4LJPB 2KMMA 4KX6B 4HROA 2KJHB 3PT2B 3JSVB 4I6NB 1XF5L 2HD5B 4PYZA 4OZBA 1XCTL 1PUTA 1SJED 2UYZB 4ZYSA 1A70A 3T3NA 1P9DU 4HDQA 2XBBC 2GBMA 3Q8CA 4MH0E 3U7ZA 1RRBA 3TJPA 4IWPA 1KLVA 5CHVC 2INNE 2CHXA 1FO4A 3WAPA 2EMSA 3AEDB 4AS1A 2IY0B 3X23A 2ZPYA 4P6VF 3H9DA 3AM9A 2MBOA 2Y3AA 2NBWB 3HRDD 5H8YE 1BUIC 3V05A 1Q5WB 2N7DA 4E71A 1JWBD 2MSED 1RLFA 4C56C 3H6NA 1XO3A 2KC1A 4JQWC 1WX7A 2D3GA 1F1HA 2XK5A 3OJ4B 5HHDG 3V3XA 3VR9B 2D11A 1U4AA 4MGKE 2LMCA 5T8IA 5EE3A 1TKEA 2MBBB 1H8CA 2CHWA 1WFYA 3TEYA 1C4PA 3SEBA 1E8ZA 3UQAA 2BQQA 2DZIA 1IGDA 4HDOA 1QOBA 4NQKE 2V0GA 4KKJA 3H7PA 1WYGA 3DBHB 1SIFA 3U2SC 3PRPB 1OFFA 4II3B 3BVGA 1GOZA 2BF8B 4LNFA 4MSQB 2HJ1A 5EE1A 1IUEA 1WI0A 3AV8A 3IAM1 2ZJDA 1LXDA 3GOEA 5BMIA 1I4XA 3AE7B 2DHZA 3TBLD 1OGWA 1TS2A 3TEWA 5IN7A 5DPRA 4KIKA 2XK5B 3EC8A 2BYVE 4MH8A 2LRUA 3IT6B 2MQJA 2DWQA 1NENB 3MHZA 1WSPA 3TCAA 2FBWB 3KYDD 1OQRA 1WX8A 4BFRA 2IYDB 2K8HA 3RNFC 1QQRA 1N5WA 2J0MA 1TBEA 1GNUA 3UGBB 1C1YB 1FCLA 5DPTA 1DOXA 3ZKJC 3N3KB 4ZRQA 1WRDB 2PE6B 1STEA 1TS5A 3PO0A 2W3RA 2GBNA 1QLBB 2PW9A 1IPGA 2KWDA 2KDFB 2CS4A 1WE7A 2M0AA 1QOFA 2ZPNA 1FRRA 2KKCA 5EE0A 2O2VA 5AEKB 1TZOA 2MJ3A 3JSVA 2DNFA 1MI0A 2KANA 4JL9A 4WJQA 1AYFA 2WXLA 4FHKA 4Q2JA 1C4CA 1RAXA 1PGBA 2BTEA 1YJIA 5LXHA 2Y5BB 5IKCM 4LDTB 3PZDA 3Q3NC 2UU7A 1OEYA 2LXAA 3M63B 4C7YA 3H8HA 4GIVA 3VAWA 2MLBA 4FHJA 3ZRCA 3A9KB 4B0MA 4YSXB 1TGZB 3DBHI 3L16A 1L6UA 1C4AA 2JWZA 4ZRIA 5G2NA 4DDID 3HK0A 5CHFA 4ZRKA 4JLCA 1K8RB 2JQRB 1G6JA 4TQ1A 3GE8C 2K39A 4WQOB 5D3IB 1WXSA 2R2OA 4RCOA 1L4ZB 1FNUA 4RGOS 1YQBA 1L2NA 1YX5B 1AN8A 1PYWD 2KO3A 3IXSA 4RF1A 2WXIA 4EZKA 1S3SG 2BB6A 1HA5A 1R7SA 2BWFA 4PYUA 1IBXB 2Y5CA 2DENB 1QZEA 2L7RA 5KHQA 3EFUA 2O6VB 3LXFA 2INCC 3S2AA 2BVCA 2M4NA 1FD6A 1Y56A 1F2RI 4K7UA 1S1QB 2WXFA 3DDCB 2JU6X 3AE6B 3URYA 4B95A 2J53A 5FK9C 1PFDA 3HUIA 2FCNA 3OLMD 3VTUA 3KUZA 4NNJB 2BKFA 2KN4A 3V61A 4ANXA 1L7YA 1WGHA 2VH2A 1I4QA 2WDQB 1E8YA 3ZGZA 4FA6A 4BAXA 2LJIA 4WQMA 2KTRB 4F1SA 2DZMA 3FC4A 4J3OD 1YIWA 1V97A 1D5XC 4EKUA 2D3BA 2M19A 2W9NA 3PS6A 2KT7A 3B2FA 2VH1A 3RMKC 1ROEA 2KQ7A 4W9HA 1JRUA 2L0TA 3R7RA 3W9CB 3R66C 4ITKA 3BYTB 3E56A 4YTMB 3VDZA 4B6WA 1TIFA 2V3SA 3DHHC 1EF1A 1MFWA 5BYRA 3C8YA 4EUTA 3CSTA 1C76A 5J18A 1MPEA 5E6PA 4DQOC 3ZJTA 1SE4A 3NS1A 1CK1A 4PT5A 5JHBA 3QAQA 3Q3JA 2LGSA 1WM3A 1K50A 1NDDA 4BBNF 2X38A 2KNBA 3AE4B 1Z2MA 3UIOB 1ZXHA 3WALA 2KXJA 3PRZA 2AX5A 2JWUA 4P16A 1XLOA 4LNKA 3VUYA 4XDDA 2WXQA 2DYMA 1UH6A 3APCA 1B9RA 2ZNVB 4WAAA 2RR9A 1WZ3A 1EM7A 2BS4B 3DBSA 4HCPB 2UWQA 4K7WA 2EMTA 1TS4A 3ABVB 4OW0A 5G5GA 1HE8A 3DWMA 2KDMA 1E0ZA 2K0PA 2BS2B 3MFGA 1C9FA 1PQSA 1J19A 2W3SA 2WXGA 5D7GA 2M56B 2GBRA 2Z59B 4MGZE 5LNK1 2WP9B 3KUCB 1YJJA 2MP2A 2LHDA 4HWIB 3EECA 2KOXA 4ZDVA 2KN5A 3HM3A 1BMLC 5C3JB 4FJYA 2GI9A 2BYTA 2LRWA 4XC2A 3I5JC 3BIID 2O2VB 2ZW1A 4RGNA 2PKOA 1HTQA 1HZ6A 4EE2A 2EKEC 1WGKA 4AJYB 2VZKB 3ZYYX 3LDZE 2KX3A 4MSMB 2QHOA 2O6VD 2ACZB 3AECB 4IWOA 1V8CA 2OJWA 1V80A 1ENFA 1UD7A 4W9JA 1I35A 1P7EA 2BB5A 2L83A 4FJZA 2AQ3B 4KGSA 5BMGA 4B0EA 2M17A 2ZZPB 2VRRB 1SE9A 4DHZB 1IYFA 1TKGA 4DXAB 1NVID 3B0AA 1TT5B 4KIKB 4MJSA 4A3OA 3V62A 3VUXA 3Q2AC 3KWVA 2EELA 4R3DA 3PZ8A 1WGDA 2IDYA 2MEKA 3M62B 1TZ1A 3WAMA 4MACA 1UNSA 2KX0A 3VUWA 1LO5D 3W5UB 2B3AA 3BK1A 3VXWA 2ZCBA 4DHZE 3QCAA 1WR6E 1RWSA 4TKNA 1RM6C 1AWDA 4GB9A 1YOVB 3H7PB 2Z0EB 1E7VA 4G0NB 4S0RA 3ZNHB 3AE2B 1UBIA 2C7HA 3R7QA 5BMHA 5BO4B 1Y8RC 1K53A 1ZXIA 2WQYB 4XX5A 4DXFA 3B08A 2RPVA 4KZ0A 1WWTA 1P0RA 2WX1A 2DAJA 4NAWA 1C3TA 2A4ZA 3L13A 3DVNU 1FMAD 2INPE 1XXGA 1XLPA 1EUVB 3PSEB 2WU5B 4PS8A 2MBHA 1XEEA 4DK5A 3KLSX 3O13A 3T3OA 2V3NA 4ARIA 2QCZA 4BKTA 4FJVB 1ZPSA 3W1SA 3PZ7A 5IP4D 3BY4B 4ZRJA 2L3ZA 2B76B 2WHIA 3UQBA 4HKQA 3ZJVA 4N59A 1GC6A 2XNAC 2G3QB 1T6BX 4DBGA 1V1PA 4C00A 1C78A 1YNTE 5BYSA 4TUUA 4BKSD 2KFJA 1EO6A 4YSZB 3UI3A 3DVGX 4BZAA 3PHWB 3R8BA 1J8CA 3P4QB 4IC7B 1ZOYB 3FAHA 3EUB2 2WGSA 3GZNI 2AWTA 1WIAA 3W1SC 1V1OA 3DPDA 2JZ3B 3ENEA 2PE9A 1D3ZA 2K6QA 2CHZA 3AI5A 2FUHB 2WDTB 1K52A 2G4DB 1ZE3D 3NUHB 3P42A 4ANUA 5JH5C 3WA0A 4P1CC 4A20A 1FIQA 4I6LB 2AEHA 3NHEB 3A4SC 2E6XA 2ASQA 3ZW3A 1SEBD 4KVGB 2KYWA 3PREA 3BVZA 3PLUA 3HHMA 2FE8A 2JXXA 3NZ3A 1WGYA 4GMVA 4RGTA 4HKZE 3BZDB 2J7QB 3GE3C 4L23A 1OQQA 2H88B 1KM7A 2CU3A 4HK2A 3D32A 5LXIB 4YTNB 3PRMB 5D6JB 5H92C 1WF9A 4GDKB 1MVKA 3NVZA 2EKIA 2ZW0A 2J52A 3TEXA 1RFKA 4FULA 2XN9C 3PLVA 5CTRC 1V9JA 1JWMD 2GBJA 2ICIA 3A4RA 3VFKA 1SXTA 4ARCA 2BPSA 2NTTA 3DQVA 4PS3A 2KLCA 3E9SA 2OJRA 4YXDB 4P7IA 3FILB 2DYOA 3U30A 2KTFA 2LGDA 2J42A 1XLQA 4M01A 1N6ZA 4XZ4A 1OTRB 3FKYA 4K1RB 1P3QU 2NBVB 1XCQL 3DOWA 1FFUA 4DWFA 2HDEA 3X0WA 3ZUNA 2W54A 5JZEB 1F52A 2IJ0A 3TUOA 4KGTA 1L6VA 2OEDA 3JW0X 2WXKA 5DPSA 3U4EG 4IUMB 5TSSA 1N61A 4IWQA 1M4VA 1NYRA 1CZPA 2K5PA 5E6JA 3CWIA 5JHAA 2DX5B 4WJPA 4KSLC 4TQ0A 2E3TA 2LGIA 3TMPB 3KW5B 4YL8A 2KFKB 5HKHA 4YTPB 3N1ZC 4ZRPA 1KLUD 3AULA 2I38A 2LFIA 4G3XB 3DCGA 1XD3B 3DHGC 3I9V1 3WAOA 2RD0A 4ACFA 4KDIC 4M0WB 2L05A 2HE7A 2ONQA 2N9PC 4JWUC 2ZVNA 2IBIB 2LD9A 1JROA 2IO0B 2C7MB 1ZP0B 2KQSA 4EZJA 5EDSA 3ZO5B 1ZGUB 4N9F4 2FNJB 3DVGY 1E8WA 3ZXRA 2JXTA 2NMQA 2NVUI 2G1EA 4LK0M 1WX9A 3TL5A 2CR5A 2GLSA 3DBLB 4A8XC 3MC9A 3LYYA 4M8MA 1KJTA 3JYUA 3Q8FA 1F77A 1C79A 1SIJA 4BOSC 5IAAC 3W2DA 3ETRA 1WXMA 2LVQA 3ZLZA 3V6EB 4WJOA 2G9HD 4HJKA 2INDC 1I7HA 2AL3A 2JRHA 4GDLB 3WCQA 2CU1A 3L54A 1QOGA 1UWMA 4XGAB 3RFZB 5I4DA 3NOBA 2D3AA 1CQVA 3DWGC 1T0SC 2RDGA 2BKRB 2HTHA
chains in the Genus database with same CATH topology
1ET6A 3I57A 1BMLC 2W82A 5HG2A 5C3JB 2GI9A 2BYTA 1I4HA 4IOIE 4ZHOA 1T5XD 1SB3C 1DGJA 4JWSC 1KF6B 2WNMA 3BYYB 1L4DB 1T3QA 3BIID 3AE3B 1EWYC 1FFVA 1YQ4B 2ZW1A 3B2GA 4RGNA 3P4SB 3BVMA 2PKOA 3NVYA 2YEPF 2JX5A 1YN5A 3CIRB 1HZ6A 4NJCA 4ZOHC 1TY2A 3P63A 3Q69A 4OZAA 4EE2A 1WGKA 1YN4A 2VZKB 3ZYYX 2IGGA 5MPOA 2N0SB 1JALA 1N60A 3BWUD 1GPXA 3Q8EA 2PIAA 4US9A 1JCKB 3VRAB 1VJKA 2ACZB 3AECB 1V8CA 2WXRA 3SFEB 1MHHE 3FILA 4WWMA 2JSVX 4RH6A 4YSYB 1ENFA 2WXMA 2LHEA 2Q5WD 2K9XA 1SE3A 1ZDXA 2KQ4X 3BK2A 4IDIA 2D5GA 4MM3B 3OWEB 2KMMA 4KX6B 1P7EA 4HROA 1TJEA 2BB5A 3KQ4A 1VZ7A 2WLBA 4DXGA 4C7ZA 1ZDVA 2L83A 1XF5L 2AQ3B 3Q8AA 4KGSA 3IT4B 5BMGA 4B0EA 4OZBA 2LUMA 1MHXA 1J7CA 1XCTL 1PUTA 1SJED 4ZYSA 2VZKD 1A70A 1TKGA 3T3NA 1NVID 2K22A 3Q8CA 3U7ZA 3HVDA 1F2RC 3KWVA 2EELA 1YN3A 4R3DA 1N5XA 3PZ8A 4H2AA 2IDYA 2MEKA 2MJEA 2INNE 2WDRB 1UNSA 2WS3B 4MACA 1FO4A 3AEDB 1LO5D 2JYEA 3RPFC 3W5UB 3BK1A 4AS1A 4P6VF 1KH0A 3EA6A 3AM9A 3AE1B 1TYGB 2Y3AA 1RWSA 2QSDA 3AB5A 3HRDD 1BUIC 1RM6C 5D3DA 1AWDA 5H8YE 3V05A 1HXYD 4C80A 1JWBD 3MJ5A 4C56C 4L1BA 1DOYA 4L2YA 1XO3A 4YWGG 2J4XA 3HVZA 1C77A 3AE2B 1J7BA 2JZPA 4ZHPA 2V3PA 3VR9B 5HHDG 3V3XA 2AQ2B 1D5ZC 1E7PB 3Q8BA 1FCCC 1EU3A 2LMCA 5T8IA 5EE3A 2WXOA 5BMHA 1TKEA 4A6QA 1K53A 1ZXIA 2WQYB 4DXFA 2RPVA 3TEYA 1C4PA 1TY0A 2KACA 1WWTA 3SEBA 3AEBB 3AH7A 2FUG1 1RYJA 1IGDA 3P4RB 1QOBA 2V0GA 1DOIA 1FMAD 2INPE 1WYGA 1XXGA 1XLPA 4KKJA 1NYQA 5GXGB 3U2SC 2SAKA 1WXQA 2WU5B 1SE2A 1XEEA 1PDXA 1SSNA 1OFFA 1I4GA 1UWXA 2R61A 3NVWA 3KLSX 3O13A 3BVGA 2LEKA 5HFYA 1GOZA 2V3NA 3T3OA 4A90A 1B1ZA 4ARIA 1FM0D 5EE1A 4GLSC 1IUEA 3AV8A 3IAM1 1ZPSA 3W1SA 4IKGA 1EWCA 3PZ7A 1WRIA 5BMIA 4WURA 2B76B 1I4XA 3AE7B 4A55A 4HKQA 1TS2A 3TEWA 1NI3A 5G5HA 3ZJVA 1FXAA 1L0VB 4LTUA 4N59A 4MH8A 3ZQ4A 3IT6B 4LLGM 2XNAC 1KTKA 1T6BX 2DWQA 1NENB 3MHZA 1V1PA 1WSPA 4WIPA 2FBWB 1C78A 1YNTE 1OQRA 5BYSA 3J9CA 1NEKB 1GAQB 1QQRA 1N5WA 2ON8A 4YSZB 5EE9A 3UI3A 3P1MA 1FCLA 1XLNA 3R8BA 1DOXA 4CQNA 3LB8C 4OZCA 3P4QB 4ZRQA 1ZOYB 3FAHA 1STEA 1TS5A 3W5VB 2N9KA 1FXIA 2W3RA 3PO0A 3EUB2 5FKAC 1QLBB 2CJOA 2PW9A 2KWDA 2K3UA 4KGRA 2PVOD 2M0AA 4KKIA 1QOFA 5HI1A 1FRRA 1L0YB 1V1OA 5AUIA 3IAS1 4XWWA 2I2YA 2MJDA 4NAMA 3AEAB 3U52E 1QF6A 1K52A 4OHJA 1N63A 5EE0A 1ZE3D 3NUHB 3P42A 1TZOA 2MJ3A 1V1PB 1MI0A 1FIQA 3GB1A 4JE3B 4RFBA 1SBBB 4HRSA 4OVZA 2E6XA 1I4PA 4XDCA 1VZ6A 1PGXA 1SEBD 2GB1A 1AYFA 4AQ7A 2WXLA 3VR8B 3VQIA 1D6EC 4Q2JA 2SEBD 4REZA 2L52A 1E10A 1C4CA 1QILA 1VR9A 1PGBA 3BVZA 4NZLB 3SR6A 1YJIA 2BTEA 1J7AA 2FE8A 1IGCA 1D4BA 3AE9B 1AW7A 3EGRA 3NZ3A 4FXCA 4RGTA 3TSSA 1KFYB 4HKZE 3BZDB 2HTME 2WXHA 1VZ8A 4L23A 1OQQA 2H88B 2CU3A 4C7YA 3H8HA 2WXPA 1JWSD 4YTNB 4NAWB 1P7FA 4N6EB 4B0MA 5H92C 4JPSA 4YSXB 1I4RA 1HZ5A 2RMMA 2IGHA 1L6UA 1YMHE 1C4AA 4GDKB 2PTLA 3TEZA 2BT6A 1MVKA 5C2TB 3NVZA 2EKIA 2ZW0A 1GB4A 2JQRB 2J52A 4TQ1A 2JYTA 5D3IB 3TEXA 1RFKA 2XN9C 4TSSA 4RCOA 1HEZE 1Q10A 1L4ZB 1FNUA 4RGOS 1JWMD 2ICIA 3KWLA 1VRAB 1AN8A 1JRPA 2PVGC 1PYWD 1SXTA 2YEPB 4RF0A 4ARCA 2NTTA 3IXSA 1K51A 2WXIA 4RF1A 1PGAA 3E9SA 1JWAD 1VLBA 4YXDB 1D5MC 1UGJA 1TS3A 2BB6A 2H89B 1HA5A 1R7SA 3FILB 2DYOA 3B9JA 1IBXB 2KAJA 3P4PB 2Y5CA 2J42A 1CJEA 4MT5A 1XLQA 5FR3A 4XWTA 1E9MA 3LXFA 1JQ4A 3SFDB 1FD6A 1Y56A 1YQ3B 2DBYA 1XCQL 1DYQA 1FFUA 1F2RI 4N58A 2WXFA 3AEGB 2JU6X 2HDEA 3AE6B 3URYA 1VDVA 2J53A 5FK9C 1PFDA 2W54A 2WDVB 3HUIA 2IJ0A 3TUOA 2KN4A 4KGTA 1L6VA 2OEDA 1JMLA 1I4QA 2WDQB 3ZGZA 2WXKA 3AE5B 1QT9A 4RNAA 3U4EG 5JXVA 3R2TA 2LJIA 4WQMA 5TSSA 1SF0A 2BBCA 2L1AA 1L0XB 1N61A 1M4VA 1NYRA 1CZPA 2PLPA 1V97A 3FC4A 4J3OD 1D5XC 3AMZA 2K5PA 3R2IA 1FEHA 2M19A 1KRHA 4TMAB 1QOAA 4WAFA 5E6JA 3B2FA 3CWIA 1EU4A 1ROEA 1F0ZA 1ACCA 3L4PA 3W9CB 4RGMA 4TQ0A 4ITKA 2E3TA 2LGIA 2V4IB 3BYTB 3E56A 4YTMB 4A9AA 1N62A 2W55A 3VRBB 1GB1A 1L5PA 1UUPA 4YTPB 2CJNA 2DLBA 5BYRA 4ZRPA 1KLUD 3MC0B 1ESFA 3C8YA 2I38A 2BW2A 2LFIA 1FRDA 2IGDA 1C76A 1MPEA 3GP7A 4DQOC 3I9V1 1ZUD2 3ZJTA 2N7JA 1SE4A 2QILA 2WU2B 3NS1A 1CK1A 3AEEB 3NRZA 4PT5A 2IPKD 2ONQA 3NVVA 4JWUC 2WXNA 1K50A 4US8A 2L32A 1JROA 2X38A 1JW9D 3N9YC 1ZP0B 3GS2A 3AE4B 4HEA1 5BYQA 2BS3B 1BXTA 1ZXHA 2JXTA 2NMQA 2G1EA 4LK0M 4O1NA 4M0WA 2AX5A 2JWUA 4P16A 1XLOA 2GRIA 4A8XC 1JWUD 2NTSA 4JX1C 4XDDA 2WXQA 3LYYA 2DYMA 1SJHD 1B9RA 3Q8FA 2TSSA 1EM7A 1F77A 2BS4B 1FNVA 1KLGD 2QIEB 1C79A 1SIJA 1TKYA 1TS4A 1IBXA 1HQRD 3W2DA 3ZJUA 2RDHA 1QKZA 3ETRA 3ABVB 4WH4A 4XE0A 4OW0A 5G5GA 3DWMA 1ET9A 2KDMA 2Y5PA 2G9HD 2QEJC 2WXJA 1I7HA 2QJLA 4UDUC 4GDLB 1FNWA 3WCQA 1E0ZA 4YT0B 2N9LA 4HJGE 2K0PA 2BS2B 2AQ1B 5AUKA 3MFGA 1QOGA 1C9FA 1E6EB 1UWMA 3RFZB 2W3SA 2Z8LA 2QMTA 5I4DA 2WXGA 3AEFB 4USAA 3AE8B 3AN1A 5D7GA 2M56B 4D2KA 5LNK1 2WP9B 1CQVA 3DWGC 2OHFA 1YJJA 2MH7A 2PMVA 3MP9A 2LHDA 2RDGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D5G A;  1WSP A;  4WIP A;  3PZ7 A;  3PZ8 A; 
#chains in the Genus database with same CATH topology
 3A9J B;  5C1Z A;  3DBR I;  1SB3 C;  4JWS C;  4BKS A;  1T0R C;  3RNA C;  1WXA A;  4XYC A;  4P1B C;  1FFV A;  1YQ4 B;  3MC8 A;  1XQQ A;  3P4S B;  3BVM A;  2N7E A;  3CIR B;  3SD5 A;  1MJD A;  2N0S B;  3BWU D;  3Q8E A;  2OOB B;  5GMV A;  1JCK B;  3U7D A;  3LJ3 A;  5AZG A;  3T8M A;  1MHH E;  3C0R B;  4BOZ B;  2D2Q A;  4RH6 A;  5D94 A;  2WXM A;  3I63 C;  4A3P A;  2DZJ A;  1SE3 A;  1ZDX A;  2KQ4 X;  4IDI A;  4MM3 B;  3IFW B;  4GN1 A;  1F9J A;  4S17 A;  4TV3 A;  3NS8 A;  4HPP A;  4DXG A;  4C7Z A;  3TIX A;  3RNB C;  2JUO A;  3Q8A A;  3IT4 B;  2LUM A;  1MHX A;  1J7C A;  2VZK D;  2NS5 A;  4WWP A;  4JGH B;  1WMH B;  3ZIM A;  2K22 A;  2C5L C;  1T0Y A;  3HVD A;  1F2R C;  2MJE A;  2MRP A;  2WDR B;  2WS3 B;  4ICV A;  1FPY A;  2MBE A;  4GU2 A;  3EHV A;  4NJ6 A;  3P2B A;  3EA6 A;  1TYG B;  4CYE A;  2M1M A;  2QSD A;  5D3D A;  1Z5S B;  4L1B A;  1DOY A;  1AAR A;  3A1Q B;  4C4V A;  4YWG G;  2J4X A;  2LJ5 A;  3HVZ A;  2JZZ A;  3L10 B;  4W9D A;  3SDL C;  3UF8 A;  3SHQ A;  3VTV A;  1J7B A;  2MCN B;  2AQ2 B;  1E7P B;  1EU3 A;  4I6P A;  5IO9 A;  3PPA A;  3AH7 A;  2N4F A;  1RYJ A;  2G45 B;  3P4R B;  1DOI A;  1LQB A;  1NYQ A;  2LZ6 A;  3APF A;  1SE2 A;  1UWX A;  2R61 A;  3SU8 X;  5HFY A;  2LEK A;  3OG5 A;  2D3C A;  4A90 A;  2DAF A;  1EWC A;  1WRI A;  2N1W A;  4W9E A;  4A55 A;  2LWP A;  2LGY A;  1GC7 A;  1NI3 A;  5G5H A;  1FXA A;  1L0V B;  3ZQ4 A;  4ANW A;  2V1Y A;  1KTK A;  4IW0 A;  4ANV A;  3J9C A;  4MGY E;  1NEK B;  2LUE A;  3P1M A;  4CQN A;  2JF5 A;  3LB8 C;  4OZC A;  3WAN A;  4ZYN A;  2N9K A;  1MG8 A;  3ZRF A;  2BYE A;  4HVB A;  2CJO A;  2FCS A;  3VVW B;  2K3U A;  4KGR A;  4E74 A;  2NPT B;  5HI1 A;  1WXV A;  2KVR A;  1L0Y B;  1WMH A;  1T0Q C;  2KDE B;  5AUI A;  2QC8 A;  3ZNI D;  4XWW A;  2I2Y A;  4NAM A;  3DBR B;  1LFD A;  2GBK A;  4X57 B;  3MJW A;  2JY6 A;  1V1P B;  3PV1 A;  1UF0 A;  3NZS A;  3H7S A;  4MM3 A;  4HRS A;  4OVZ A;  1I4P A;  1VD2 A;  1PGX A;  2V9H A;  2GB1 A;  3ZNZ B;  2RPQ A;  3AU5 A;  3IG3 A;  3APD A;  3VR8 B;  3QAR A;  3PVL A;  3VQI A;  2K8B A;  1GUA B;  2LI5 A;  4GGQ A;  3A1Q A;  4C4V B;  5CX3 A;  4NZL B;  3SR6 A;  1J7A A;  1AW7 A;  5D2M B;  1WR1 A;  3IVF A;  5AZH A;  2WXP A;  3QA8 A;  1JWS D;  4NAW B;  1V2Y A;  2AL6 A;  4N6E B;  4LNI A;  2IGH A;  2IO1 B;  2REX A;  5FR6 A;  3A9J A;  2FIF A;  2BT6 A;  1V81 A;  3V60 A;  5C2T B;  4G11 A;  2V4L A;  3N1X C;  4M00 A;  4TSS A;  4FLH A;  1HEZ E;  2I1K A;  1Q10 A;  1UZX B;  1NI2 A;  3KWL A;  1VRA B;  1JRP A;  3ZTD A;  4DHJ B;  3KVF B;  4GDL A;  1LGR A;  1TS3 A;  2FAZ A;  2KAJ A;  3P4P B;  4B9K A;  1NBF C;  1WH3 A;  1CJE A;  1YD8 U;  4MT5 A;  1YX6 B;  4ASW C;  1E9M A;  1R4N B;  4MEM A;  4F7Z A;  4MJS B;  3AEG B;  3EFC A;  1VDV A;  4WJN A;  2XEW A;  2KJR A;  3QX1 A;  2KZR A;  2LGX A;  4LJO B;  2WYQ A;  4RNA A;  3Q3F A;  5JXV A;  1WGR A;  1SF0 A;  3L0W B;  1L0X B;  3WIM A;  2PLP A;  3AMZ A;  1FEH A;  5L95 C;  1KRH A;  4K81 A;  2KFK A;  2FCM A;  1OQY A;  1EU4 A;  4W9F A;  4LCD E;  1WY8 A;  1ACC A;  3L4P A;  1N62 A;  2MHJ A;  2W55 A;  3VRB B;  5TR5 A;  5E6O A;  2CJN A;  2BYF A;  2DLB A;  1ESF A;  2BW2 A;  4W9K A;  2RSU A;  2IGD A;  3GP7 A;  5IOI A;  2KMA A;  4BVU C;  2QIL A;  2WU2 B;  3ZDT A;  4WWN A;  2MP2 B;  2A5U A;  3RZF A;  3Q6B A;  2DYB A;  1WM2 A;  4FBJ B;  4J6I A;  1CMX B;  2L32 A;  2WX0 A;  2KC2 A;  3ZDM C;  2MW5 A;  3VH4 B;  4HEA 1;  5BYQ A;  1BXT A;  4K3C A;  4M0W A;  4PK1 A;  2IZV B;  2GRI A;  4BBN C;  1JWU D;  4JX1 C;  1X1M A;  1SJH D;  2X8X X;  2ZNV C;  1TTN A;  1FNV A;  1KLG D;  2QIE B;  4AUQ C;  3KH0 A;  1HQR D;  4WH4 A;  4XE0 A;  3A33 B;  2KDB A;  3MHS D;  2Y5P A;  4A6Q A;  2QEJ C;  4UDU C;  4RM9 A;  2LAS A;  2N9L A;  4HJG E;  4G50 A;  5AUK A;  3RN9 C;  3N30 A;  3DBL I;  3QC8 B;  2Z8L A;  2QMT A;  4W9G A;  3AEF B;  1XT9 B;  1VCB A;  3RUI B;  5CHW A;  2PEA A;  2KK8 A;  3QHT A;  4GOC A;  2PMV A;  3MP9 A;  2QDF A;  1ET6 A;  5HG2 A;  1I4H A;  4GDK A;  4IOI E;  1ZW7 A;  4ZHO A;  1T5X D;  1KF6 B;  2KLG A;  2WNM A;  3BYY B;  3T9L A;  1SGH A;  4LDT D;  1L4D B;  1T3Q A;  2R2Q A;  2N1V A;  1EWY C;  4GSW A;  3B2G A;  1R4M B;  3ALB A;  3IBE A;  2JX5 A;  1R4M I;  4NJC A;  4ZOH C;  3P63 A;  1UBQ A;  3RNE C;  2NPT A;  2IGG A;  3K9O B;  5MPO A;  3L17 A;  1JAL A;  1N60 A;  1GPX A;  1VJK A;  3SFE B;  5AZF A;  3Q14 C;  1J0G A;  4JIO U;  3FIL A;  4WWM A;  2JSV X;  4YSY B;  1V6E A;  2Q5W D;  3BK2 A;  2D5G A;  3HIZ A;  2CKH B;  2RGF A;  3OWE B;  2MA9 B;  1TJE A;  3RNC C;  3KQ4 A;  1VZ7 A;  2WLB A;  1ZDV A;  3ZTC A;  4PS7 A;  4K7S A;  2BGF A;  4W9I A;  3AXC A;  3VH3 B;  2YLM A;  4AOF A;  2LVO A;  3RD2 A;  4HCN B;  2NBU A;  1YN3 A;  3KUD B;  3VTW A;  1N5X A;  4H2A A;  3L08 A;  3K9P B;  2JYE A;  3RPF C;  2GOW A;  1WZ0 A;  2ZCC A;  1KH0 A;  3AE1 B;  2C9W B;  3AB5 A;  2K6D B;  1HXY D;  4C80 A;  3KYC D;  3V6C B;  3MJ5 A;  4OVU A;  4L2Y A;  3I3T B;  1ISN A;  1C77 A;  2KMC A;  4RM8 A;  2JZP A;  4ZHP A;  2V3P A;  3RI7 C;  4KSK C;  3ZXV A;  1D5Z C;  3Q8B A;  1FCC C;  2BWE S;  2J0K A;  2WXO A;  1RFA A;  1P1A A;  1TY0 A;  2KAC A;  3A9K A;  3AEB B;  1IP9 A;  2FUG 1;  3QJZ A;  4IM0 A;  4IG7 B;  1YJ1 A;  2C7N B;  2L76 A;  4LNN A;  5GXG B;  2SAK A;  4GXB A;  1WXQ A;  1PDX A;  1SSN A;  2AYO B;  1I4G A;  3NVW A;  5DPW A;  3N20 C;  1B1Z A;  1FM0 D;  3W1Y A;  4GLS C;  2KD0 A;  4IKG A;  1E90 A;  3ZVV A;  1WJN A;  1Q0W B;  4IM3 A;  4WUR A;  5C23 A;  3NY5 A;  3AU4 A;  1M94 A;  4LTU A;  2GMI C;  4LLG M;  1V49 A;  4BKG A;  4WIP A;  3DVN V;  1EF5 A;  1GAQ B;  3PHX B;  2MX2 A;  1E5W A;  2ON8 A;  5EE9 A;  1XLN A;  1R4N I;  2KWU B;  2PPH A;  2ZVO A;  2KHW B;  3W5V B;  1FXI A;  2IY1 B;  2NR2 A;  4KDL B;  5FKA C;  3OAW A;  2KWV B;  2FCQ A;  1WJ6 A;  4AWJ A;  3R3M A;  2PVO D;  2YVC A;  4KKI A;  4NY0 A;  1LM8 B;  2M8S A;  2IO3 B;  3IAS 1;  3N32 A;  4HXD A;  2MJD A;  3AEA B;  3DHI C;  3U52 E;  1QF6 A;  1WJ4 A;  4OHJ A;  1N63 A;  2ZEQ A;  5J17 A;  4KZC A;  2KWC A;  1BT0 A;  1P98 A;  3GB1 A;  4JE3 B;  3M95 A;  4RFB A;  1SBB B;  1WJU A;  4XDC A;  1VZ6 A;  4MDK E;  3CF6 E;  4AQ7 A;  3ONS A;  4DHJ D;  5J2R A;  3RT3 B;  4F8C B;  1D6E C;  3NZU A;  4FAD A;  4LNO A;  2SEB D;  4REZ A;  2L52 A;  1E10 A;  1QIL A;  1VR9 A;  3QIJ A;  1D4B A;  1GG3 A;  1IGC A;  3AE9 B;  3EGR A;  4FXC A;  3TSS A;  1KFY B;  2HTM E;  2WXH A;  3M3J A;  1VZ8 A;  2JVC A;  1P7F A;  2KDI A;  2L8J A;  3Q3O C;  4AJW A;  1WYW B;  4JPS A;  1I4R A;  1HZ5 A;  2RMM A;  4CO7 A;  3JVZ X;  1YMH E;  3QK0 A;  4HLE A;  2N9X A;  2PTL A;  3TEZ A;  5E6N A;  4HPL B;  1GB4 A;  2PJH A;  4FN2 A;  2JYT A;  3PGE A;  3BIN A;  4IM2 A;  5DCN A;  5LLI A;  2PVG C;  2YEP B;  4RF0 A;  5G55 A;  1UEL A;  1K51 A;  1PGA A;  1V5O A;  1JWA D;  1VLB A;  1D5M C;  1V5T A;  1UGJ A;  3H1U A;  3O65 B;  2FID A;  2H89 B;  1GJZ A;  3B9J A;  3U8Z A;  4E3C A;  5FR3 A;  4MEL A;  4XWT A;  1E8X A;  3UIN B;  3ECI A;  1JQ4 A;  4AP4 C;  3SFD B;  1YQ3 B;  2DBY A;  1DYQ A;  4N58 A;  2RDB C;  2WDV B;  4W9L A;  4EZL A;  4URK A;  1JML A;  3AE5 B;  4M02 A;  1QT9 A;  1FXT B;  4NJ7 A;  3R2T A;  2LXC A;  2Z0D B;  2BBC A;  4RMA A;  2L1A A;  2D10 A;  2MBQ A;  4WWO A;  4DDG D;  3QWZ B;  3R2I A;  1KOT A;  2JRI B;  4TMA B;  1QOA A;  4WAF A;  3UIP B;  3RUL A;  2KJ6 A;  2L0F A;  1F0Z A;  4MGI E;  4RGM A;  4II2 B;  2V4I B;  3RZW C;  1A5R A;  3NJT A;  4A9A A;  3CMM B;  2K8C A;  1WE6 A;  4OVV A;  4CHK A;  4EEW A;  1GB1 A;  1L5P A;  1UUP A;  1E7U A;  3HM6 X;  2N9E B;  2WWZ A;  3MC0 B;  1FRD A;  2J0J A;  3MTN B;  3PTF C;  3Q3M C;  1ZUD 2;  2N7J A;  3AEE B;  3NRZ A;  4W9C A;  2IPK D;  3NVV A;  2WXN A;  3ZNG C;  4US8 A;  2M0X A;  3N9Y C;  1JW9 D;  2LVP A;  3GS2 A;  5IA7 A;  3QQ8 B;  2BS3 B;  3C19 A;  1I42 A;  3ML8 A;  2K25 A;  4QAY A;  4O1N A;  2I1J A;  4K3B A;  3RYT A;  2NTS A;  4ICU A;  2O6V A;  2KVZ A;  4HPM B;  2TSS A;  2HJ8 A;  1TKY A;  2L00 B;  1IBX A;  1OEY J;  3ZJU A;  1H4R A;  2RDH A;  1QKZ A;  4NQL B;  3ML9 A;  1Q1O A;  1ET9 A;  2WXJ A;  2QJL A;  1FNW A;  4YT0 B;  2AQ1 B;  1E6E B;  1V86 A;  1WGG A;  2DZK A;  2IO2 B;  4USA A;  3AE8 B;  3AN1 A;  4D2K A;  4NPN A;  3RCZ A;  2KTR A;  2OHF A;  2MH7 A;  4KV2 A;  2K1F A;  5L83 A;  3N1Y C;  2G4S A;  3I57 A;  2W82 A;  2D07 B;  2NCN A;  1ZKH A;  1DGJ A;  1HTO A;  1MG4 A;  4EFO A;  1UGM A;  3AE3 B;  2C60 A;  3CSF A;  2MWS B;  4M8N A;  3NVY A;  2YEP F;  1YN5 A;  3RNG C;  1TY2 A;  3Q69 A;  3GZN B;  4OZA A;  2JT4 B;  2JPH A;  1YN4 A;  3B1L X;  3NG0 A;  2PIA A;  4US9 A;  3VRA B;  4EOY A;  2WXR A;  5KHO A;  3IHP C;  3VHT C;  2LHE A;  3OJ3 A;  2K9X A;  4LJP B;  2KMM A;  4KX6 B;  4HRO A;  2KJH B;  3PT2 B;  3JSV B;  4I6N B;  1XF5 L;  2HD5 B;  4PYZ A;  4OZB A;  1XCT L;  1PUT A;  1SJE D;  2UYZ B;  4ZYS A;  1A70 A;  3T3N A;  1P9D U;  4HDQ A;  2XBB C;  2GBM A;  3Q8C A;  4MH0 E;  3U7Z A;  1RRB A;  3TJP A;  4IWP A;  1KLV A;  5CHV C;  2INN E;  2CHX A;  1FO4 A;  3WAP A;  2EMS A;  3AED B;  4AS1 A;  2IY0 B;  3X23 A;  2ZPY A;  4P6V F;  3H9D A;  3AM9 A;  2MBO A;  2Y3A A;  2NBW B;  3HRD D;  5H8Y E;  1BUI C;  3V05 A;  1Q5W B;  2N7D A;  4E71 A;  1JWB D;  2MSE D;  1RLF A;  4C56 C;  3H6N A;  1XO3 A;  2KC1 A;  4JQW C;  1WX7 A;  2D3G A;  1F1H A;  2XK5 A;  3OJ4 B;  5HHD G;  3V3X A;  3VR9 B;  2D11 A;  1U4A A;  4MGK E;  2LMC A;  5T8I A;  5EE3 A;  1TKE A;  2MBB B;  1H8C A;  2CHW A;  1WFY A;  3TEY A;  1C4P A;  3SEB A;  1E8Z A;  3UQA A;  2BQQ A;  2DZI A;  1IGD A;  4HDO A;  1QOB A;  4NQK E;  2V0G A;  4KKJ A;  3H7P A;  1WYG A;  3DBH B;  1SIF A;  3U2S C;  3PRP B;  1OFF A;  4II3 B;  3BVG A;  1GOZ A;  2BF8 B;  4LNF A;  4MSQ B;  2HJ1 A;  5EE1 A;  1IUE A;  1WI0 A;  3AV8 A;  3IAM 1;  2ZJD A;  1LXD A;  3GOE A;  5BMI A;  1I4X A;  3AE7 B;  2DHZ A;  3TBL D;  1OGW A;  1TS2 A;  3TEW A;  5IN7 A;  5DPR A;  4KIK A;  2XK5 B;  3EC8 A;  2BYV E;  4MH8 A;  2LRU A;  3IT6 B;  2MQJ A;  2DWQ A;  1NEN B;  3MHZ A;  1WSP A;  3TCA A;  2FBW B;  3KYD D;  1OQR A;  1WX8 A;  4BFR A;  2IYD B;  2K8H A;  3RNF C;  1QQR A;  1N5W A;  2J0M A;  1TBE A;  1GNU A;  3UGB B;  1C1Y B;  1FCL A;  5DPT A;  1DOX A;  3ZKJ C;  3N3K B;  4ZRQ A;  1WRD B;  2PE6 B;  1STE A;  1TS5 A;  3PO0 A;  2W3R A;  2GBN A;  1QLB B;  2PW9 A;  1IPG A;  2KWD A;  2KDF B;  2CS4 A;  1WE7 A;  2M0A A;  1QOF A;  2ZPN A;  1FRR A;  2KKC A;  5EE0 A;  2O2V A;  5AEK B;  1TZO A;  2MJ3 A;  3JSV A;  2DNF A;  1MI0 A;  2KAN A;  4JL9 A;  4WJQ A;  1AYF A;  2WXL A;  4FHK A;  4Q2J A;  1C4C A;  1RAX A;  1PGB A;  2BTE A;  1YJI A;  5LXH A;  2Y5B B;  5IKC M;  4LDT B;  3PZD A;  3Q3N C;  2UU7 A;  1OEY A;  2LXA A;  3M63 B;  4C7Y A;  3H8H A;  4GIV A;  3VAW A;  2MLB A;  4FHJ A;  3ZRC A;  3A9K B;  4B0M A;  4YSX B;  1TGZ B;  3DBH I;  3L16 A;  1L6U A;  1C4A A;  2JWZ A;  4ZRI A;  5G2N A;  4DDI D;  3HK0 A;  5CHF A;  4ZRK A;  4JLC A;  1K8R B;  2JQR B;  1G6J A;  4TQ1 A;  3GE8 C;  2K39 A;  4WQO B;  5D3I B;  1WXS A;  2R2O A;  4RCO A;  1L4Z B;  1FNU A;  4RGO S;  1YQB A;  1L2N A;  1YX5 B;  1AN8 A;  1PYW D;  2KO3 A;  3IXS A;  4RF1 A;  2WXI A;  4EZK A;  1S3S G;  2BB6 A;  1HA5 A;  1R7S A;  2BWF A;  4PYU A;  1IBX B;  2Y5C A;  2DEN B;  1QZE A;  2L7R A;  5KHQ A;  3EFU A;  2O6V B;  3LXF A;  2INC C;  3S2A A;  2BVC A;  2M4N A;  1FD6 A;  1Y56 A;  1F2R I;  4K7U A;  1S1Q B;  2WXF A;  3DDC B;  2JU6 X;  3AE6 B;  3URY A;  4B95 A;  2J53 A;  5FK9 C;  1PFD A;  3HUI A;  2FCN A;  3OLM D;  3VTU A;  3KUZ A;  4NNJ B;  2BKF A;  2KN4 A;  3V61 A;  4ANX A;  1L7Y A;  1WGH A;  2VH2 A;  1I4Q A;  2WDQ B;  1E8Y A;  3ZGZ A;  4FA6 A;  4BAX A;  2LJI A;  4WQM A;  2KTR B;  4F1S A;  2DZM A;  3FC4 A;  4J3O D;  1YIW A;  1V97 A;  1D5X C;  4EKU A;  2D3B A;  2M19 A;  2W9N A;  3PS6 A;  2KT7 A;  3B2F A;  2VH1 A;  3RMK C;  1ROE A;  2KQ7 A;  4W9H A;  1JRU A;  2L0T A;  3R7R A;  3W9C B;  3R66 C;  4ITK A;  3BYT B;  3E56 A;  4YTM B;  3VDZ A;  4B6W A;  1TIF A;  2V3S A;  3DHH C;  1EF1 A;  1MFW A;  5BYR A;  3C8Y A;  4EUT A;  3CST A;  1C76 A;  5J18 A;  1MPE A;  5E6P A;  4DQO C;  3ZJT A;  1SE4 A;  3NS1 A;  1CK1 A;  4PT5 A;  5JHB A;  3QAQ A;  3Q3J A;  2LGS A;  1WM3 A;  1K50 A;  1NDD A;  4BBN F;  2X38 A;  2KNB A;  3AE4 B;  1Z2M A;  3UIO B;  1ZXH A;  3WAL A;  2KXJ A;  3PRZ A;  2AX5 A;  2JWU A;  4P16 A;  1XLO A;  4LNK A;  3VUY A;  4XDD A;  2WXQ A;  2DYM A;  1UH6 A;  3APC A;  1B9R A;  2ZNV B;  4WAA A;  2RR9 A;  1WZ3 A;  1EM7 A;  2BS4 B;  3DBS A;  4HCP B;  2UWQ A;  4K7W A;  2EMT A;  1TS4 A;  3ABV B;  4OW0 A;  5G5G A;  1HE8 A;  3DWM A;  2KDM A;  1E0Z A;  2K0P A;  2BS2 B;  3MFG A;  1C9F A;  1PQS A;  1J19 A;  2W3S A;  2WXG A;  5D7G A;  2M56 B;  2GBR A;  2Z59 B;  4MGZ E;  5LNK 1;  2WP9 B;  3KUC B;  1YJJ A;  2MP2 A;  2LHD A;  4HWI B;  3EEC A;  2KOX A;  4ZDV A;  2KN5 A;  3HM3 A;  1BML C;  5C3J B;  4FJY A;  2GI9 A;  2BYT A;  2LRW A;  4XC2 A;  3I5J C;  3BII D;  2O2V B;  2ZW1 A;  4RGN A;  2PKO A;  1HTQ A;  1HZ6 A;  4EE2 A;  2EKE C;  1WGK A;  4AJY B;  2VZK B;  3ZYY X;  3LDZ E;  2KX3 A;  4MSM B;  2QHO A;  2O6V D;  2ACZ B;  3AEC B;  4IWO A;  1V8C A;  2OJW A;  1V80 A;  1ENF A;  1UD7 A;  4W9J A;  1I35 A;  1P7E A;  2BB5 A;  2L83 A;  4FJZ A;  2AQ3 B;  4KGS A;  5BMG A;  4B0E A;  2M17 A;  2ZZP B;  2VRR B;  1SE9 A;  4DHZ B;  1IYF A;  1TKG A;  4DXA B;  1NVI D;  3B0A A;  1TT5 B;  4KIK B;  4MJS A;  4A3O A;  3V62 A;  3VUX A;  3Q2A C;  3KWV A;  2EEL A;  4R3D A;  3PZ8 A;  1WGD A;  2IDY A;  2MEK A;  3M62 B;  1TZ1 A;  3WAM A;  4MAC A;  1UNS A;  2KX0 A;  3VUW A;  1LO5 D;  3W5U B;  2B3A A;  3BK1 A;  3VXW A;  2ZCB A;  4DHZ E;  3QCA A;  1WR6 E;  1RWS A;  4TKN A;  1RM6 C;  1AWD A;  4GB9 A;  1YOV B;  3H7P B;  2Z0E B;  1E7V A;  4G0N B;  4S0R A;  3ZNH B;  3AE2 B;  1UBI A;  2C7H A;  3R7Q A;  5BMH A;  5BO4 B;  1Y8R C;  1K53 A;  1ZXI A;  2WQY B;  4XX5 A;  4DXF A;  3B08 A;  2RPV A;  4KZ0 A;  1WWT A;  1P0R A;  2WX1 A;  2DAJ A;  4NAW A;  1C3T A;  2A4Z A;  3L13 A;  3DVN U;  1FMA D;  2INP E;  1XXG A;  1XLP A;  1EUV B;  3PSE B;  2WU5 B;  4PS8 A;  2MBH A;  1XEE A;  4DK5 A;  3KLS X;  3O13 A;  3T3O A;  2V3N A;  4ARI A;  2QCZ A;  4BKT A;  4FJV B;  1ZPS A;  3W1S A;  3PZ7 A;  5IP4 D;  3BY4 B;  4ZRJ A;  2L3Z A;  2B76 B;  2WHI A;  3UQB A;  4HKQ A;  3ZJV A;  4N59 A;  1GC6 A;  2XNA C;  2G3Q B;  1T6B X;  4DBG A;  1V1P A;  4C00 A;  1C78 A;  1YNT E;  5BYS A;  4TUU A;  4BKS D;  2KFJ A;  1EO6 A;  4YSZ B;  3UI3 A;  3DVG X;  4BZA A;  3PHW B;  3R8B A;  1J8C A;  3P4Q B;  4IC7 B;  1ZOY B;  3FAH A;  3EUB 2;  2WGS A;  3GZN I;  2AWT A;  1WIA A;  3W1S C;  1V1O A;  3DPD A;  2JZ3 B;  3ENE A;  2PE9 A;  1D3Z A;  2K6Q A;  2CHZ A;  3AI5 A;  2FUH B;  2WDT B;  1K52 A;  2G4D B;  1ZE3 D;  3NUH B;  3P42 A;  4ANU A;  5JH5 C;  3WA0 A;  4P1C C;  4A20 A;  1FIQ A;  4I6L B;  2AEH A;  3NHE B;  3A4S C;  2E6X A;  2ASQ A;  3ZW3 A;  1SEB D;  4KVG B;  2KYW A;  3PRE A;  3BVZ A;  3PLU A;  3HHM A;  2FE8 A;  2JXX A;  3NZ3 A;  1WGY A;  4GMV A;  4RGT A;  4HKZ E;  3BZD B;  2J7Q B;  3GE3 C;  4L23 A;  1OQQ A;  2H88 B;  1KM7 A;  2CU3 A;  4HK2 A;  3D32 A;  5LXI B;  4YTN B;  3PRM B;  5D6J B;  5H92 C;  1WF9 A;  4GDK B;  1MVK A;  3NVZ A;  2EKI A;  2ZW0 A;  2J52 A;  3TEX A;  1RFK A;  4FUL A;  2XN9 C;  3PLV A;  5CTR C;  1V9J A;  1JWM D;  2GBJ A;  2ICI A;  3A4R A;  3VFK A;  1SXT A;  4ARC A;  2BPS A;  2NTT A;  3DQV A;  4PS3 A;  2KLC A;  3E9S A;  2OJR A;  4YXD B;  4P7I A;  3FIL B;  2DYO A;  3U30 A;  2KTF A;  2LGD A;  2J42 A;  1XLQ A;  4M01 A;  1N6Z A;  4XZ4 A;  1OTR B;  3FKY A;  4K1R B;  1P3Q U;  2NBV B;  1XCQ L;  3DOW A;  1FFU A;  4DWF A;  2HDE A;  3X0W A;  3ZUN A;  2W54 A;  5JZE B;  1F52 A;  2IJ0 A;  3TUO A;  4KGT A;  1L6V A;  2OED A;  3JW0 X;  2WXK A;  5DPS A;  3U4E G;  4IUM B;  5TSS A;  1N61 A;  4IWQ A;  1M4V A;  1NYR A;  1CZP A;  2K5P A;  5E6J A;  3CWI A;  5JHA A;  2DX5 B;  4WJP A;  4KSL C;  4TQ0 A;  2E3T A;  2LGI A;  3TMP B;  3KW5 B;  4YL8 A;  2KFK B;  5HKH A;  4YTP B;  3N1Z C;  4ZRP A;  1KLU D;  3AUL A;  2I38 A;  2LFI A;  4G3X B;  3DCG A;  1XD3 B;  3DHG C;  3I9V 1;  3WAO A;  2RD0 A;  4ACF A;  4KDI C;  4M0W B;  2L05 A;  2HE7 A;  2ONQ A;  2N9P C;  4JWU C;  2ZVN A;  2IBI B;  2LD9 A;  1JRO A;  2IO0 B;  2C7M B;  1ZP0 B;  2KQS A;  4EZJ A;  5EDS A;  3ZO5 B;  1ZGU B;  4N9F 4;  2FNJ B;  3DVG Y;  1E8W A;  3ZXR A;  2JXT A;  2NMQ A;  2NVU I;  2G1E A;  4LK0 M;  1WX9 A;  3TL5 A;  2CR5 A;  2GLS A;  3DBL B;  4A8X C;  3MC9 A;  3LYY A;  4M8M A;  1KJT A;  3JYU A;  3Q8F A;  1F77 A;  1C79 A;  1SIJ A;  4BOS C;  5IAA C;  3W2D A;  3ETR A;  1WXM A;  2LVQ A;  3ZLZ A;  3V6E B;  4WJO A;  2G9H D;  4HJK A;  2IND C;  1I7H A;  2AL3 A;  2JRH A;  4GDL B;  3WCQ A;  2CU1 A;  3L54 A;  1QOG A;  1UWM A;  4XGA B;  3RFZ B;  5I4D A;  3NOB A;  2D3A A;  1CQV A;  3DWG C;  1T0S C;  2RDG A;  2BKR B;  2HTH A; 
#chains in the Genus database with same CATH homology
 1ET6 A;  3I57 A;  1BML C;  2W82 A;  5HG2 A;  5C3J B;  2GI9 A;  2BYT A;  1I4H A;  4IOI E;  4ZHO A;  1T5X D;  1SB3 C;  1DGJ A;  4JWS C;  1KF6 B;  2WNM A;  3BYY B;  1L4D B;  1T3Q A;  3BII D;  3AE3 B;  1EWY C;  1FFV A;  1YQ4 B;  2ZW1 A;  3B2G A;  4RGN A;  3P4S B;  3BVM A;  2PKO A;  3NVY A;  2YEP F;  2JX5 A;  1YN5 A;  3CIR B;  1HZ6 A;  4NJC A;  4ZOH C;  1TY2 A;  3P63 A;  3Q69 A;  4OZA A;  4EE2 A;  1WGK A;  1YN4 A;  2VZK B;  3ZYY X;  2IGG A;  5MPO A;  2N0S B;  1JAL A;  1N60 A;  3BWU D;  1GPX A;  3Q8E A;  2PIA A;  4US9 A;  1JCK B;  3VRA B;  1VJK A;  2ACZ B;  3AEC B;  1V8C A;  2WXR A;  3SFE B;  1MHH E;  3FIL A;  4WWM A;  2JSV X;  4RH6 A;  4YSY B;  1ENF A;  2WXM A;  2LHE A;  2Q5W D;  2K9X A;  1SE3 A;  1ZDX A;  2KQ4 X;  3BK2 A;  4IDI A;  2D5G A;  4MM3 B;  3OWE B;  2KMM A;  4KX6 B;  1P7E A;  4HRO A;  1TJE A;  2BB5 A;  3KQ4 A;  1VZ7 A;  2WLB A;  4DXG A;  4C7Z A;  1ZDV A;  2L83 A;  1XF5 L;  2AQ3 B;  3Q8A A;  4KGS A;  3IT4 B;  5BMG A;  4B0E A;  4OZB A;  2LUM A;  1MHX A;  1J7C A;  1XCT L;  1PUT A;  1SJE D;  4ZYS A;  2VZK D;  1A70 A;  1TKG A;  3T3N A;  1NVI D;  2K22 A;  3Q8C A;  3U7Z A;  3HVD A;  1F2R C;  3KWV A;  2EEL A;  1YN3 A;  4R3D A;  1N5X A;  3PZ8 A;  4H2A A;  2IDY A;  2MEK A;  2MJE A;  2INN E;  2WDR B;  1UNS A;  2WS3 B;  4MAC A;  1FO4 A;  3AED B;  1LO5 D;  2JYE A;  3RPF C;  3W5U B;  3BK1 A;  4AS1 A;  4P6V F;  1KH0 A;  3EA6 A;  3AM9 A;  3AE1 B;  1TYG B;  2Y3A A;  1RWS A;  2QSD A;  3AB5 A;  3HRD D;  1BUI C;  1RM6 C;  5D3D A;  1AWD A;  5H8Y E;  3V05 A;  1HXY D;  4C80 A;  1JWB D;  3MJ5 A;  4C56 C;  4L1B A;  1DOY A;  4L2Y A;  1XO3 A;  4YWG G;  2J4X A;  3HVZ A;  1C77 A;  3AE2 B;  1J7B A;  2JZP A;  4ZHP A;  2V3P A;  3VR9 B;  5HHD G;  3V3X A;  2AQ2 B;  1D5Z C;  1E7P B;  3Q8B A;  1FCC C;  1EU3 A;  2LMC A;  5T8I A;  5EE3 A;  2WXO A;  5BMH A;  1TKE A;  4A6Q A;  1K53 A;  1ZXI A;  2WQY B;  4DXF A;  2RPV A;  3TEY A;  1C4P A;  1TY0 A;  2KAC A;  1WWT A;  3SEB A;  3AEB B;  3AH7 A;  2FUG 1;  1RYJ A;  1IGD A;  3P4R B;  1QOB A;  2V0G A;  1DOI A;  1FMA D;  2INP E;  1WYG A;  1XXG A;  1XLP A;  4KKJ A;  1NYQ A;  5GXG B;  3U2S C;  2SAK A;  1WXQ A;  2WU5 B;  1SE2 A;  1XEE A;  1PDX A;  1SSN A;  1OFF A;  1I4G A;  1UWX A;  2R61 A;  3NVW A;  3KLS X;  3O13 A;  3BVG A;  2LEK A;  5HFY A;  1GOZ A;  2V3N A;  3T3O A;  4A90 A;  1B1Z A;  4ARI A;  1FM0 D;  5EE1 A;  4GLS C;  1IUE A;  3AV8 A;  3IAM 1;  1ZPS A;  3W1S A;  4IKG A;  1EWC A;  3PZ7 A;  1WRI A;  5BMI A;  4WUR A;  2B76 B;  1I4X A;  3AE7 B;  4A55 A;  4HKQ A;  1TS2 A;  3TEW A;  1NI3 A;  5G5H A;  3ZJV A;  1FXA A;  1L0V B;  4LTU A;  4N59 A;  4MH8 A;  3ZQ4 A;  3IT6 B;  4LLG M;  2XNA C;  1KTK A;  1T6B X;  2DWQ A;  1NEN B;  3MHZ A;  1V1P A;  1WSP A;  4WIP A;  2FBW B;  1C78 A;  1YNT E;  1OQR A;  5BYS A;  3J9C A;  1NEK B;  1GAQ B;  1QQR A;  1N5W A;  2ON8 A;  4YSZ B;  5EE9 A;  3UI3 A;  3P1M A;  1FCL A;  1XLN A;  3R8B A;  1DOX A;  4CQN A;  3LB8 C;  4OZC A;  3P4Q B;  4ZRQ A;  1ZOY B;  3FAH A;  1STE A;  1TS5 A;  3W5V B;  2N9K A;  1FXI A;  2W3R A;  3PO0 A;  3EUB 2;  5FKA C;  1QLB B;  2CJO A;  2PW9 A;  2KWD A;  2K3U A;  4KGR A;  2PVO D;  2M0A A;  4KKI A;  1QOF A;  5HI1 A;  1FRR A;  1L0Y B;  1V1O A;  5AUI A;  3IAS 1;  4XWW A;  2I2Y A;  2MJD A;  4NAM A;  3AEA B;  3U52 E;  1QF6 A;  1K52 A;  4OHJ A;  1N63 A;  5EE0 A;  1ZE3 D;  3NUH B;  3P42 A;  1TZO A;  2MJ3 A;  1V1P B;  1MI0 A;  1FIQ A;  3GB1 A;  4JE3 B;  4RFB A;  1SBB B;  4HRS A;  4OVZ A;  2E6X A;  1I4P A;  4XDC A;  1VZ6 A;  1PGX A;  1SEB D;  2GB1 A;  1AYF A;  4AQ7 A;  2WXL A;  3VR8 B;  3VQI A;  1D6E C;  4Q2J A;  2SEB D;  4REZ A;  2L52 A;  1E10 A;  1C4C A;  1QIL A;  1VR9 A;  1PGB A;  3BVZ A;  4NZL B;  3SR6 A;  1YJI A;  2BTE A;  1J7A A;  2FE8 A;  1IGC A;  1D4B A;  3AE9 B;  1AW7 A;  3EGR A;  3NZ3 A;  4FXC A;  4RGT A;  3TSS A;  1KFY B;  4HKZ E;  3BZD B;  2HTM E;  2WXH A;  1VZ8 A;  4L23 A;  1OQQ A;  2H88 B;  2CU3 A;  4C7Y A;  3H8H A;  2WXP A;  1JWS D;  4YTN B;  4NAW B;  1P7F A;  4N6E B;  4B0M A;  5H92 C;  4JPS A;  4YSX B;  1I4R A;  1HZ5 A;  2RMM A;  2IGH A;  1L6U A;  1YMH E;  1C4A A;  4GDK B;  2PTL A;  3TEZ A;  2BT6 A;  1MVK A;  5C2T B;  3NVZ A;  2EKI A;  2ZW0 A;  1GB4 A;  2JQR B;  2J52 A;  4TQ1 A;  2JYT A;  5D3I B;  3TEX A;  1RFK A;  2XN9 C;  4TSS A;  4RCO A;  1HEZ E;  1Q10 A;  1L4Z B;  1FNU A;  4RGO S;  1JWM D;  2ICI A;  3KWL A;  1VRA B;  1AN8 A;  1JRP A;  2PVG C;  1PYW D;  1SXT A;  2YEP B;  4RF0 A;  4ARC A;  2NTT A;  3IXS A;  1K51 A;  2WXI A;  4RF1 A;  1PGA A;  3E9S A;  1JWA D;  1VLB A;  4YXD B;  1D5M C;  1UGJ A;  1TS3 A;  2BB6 A;  2H89 B;  1HA5 A;  1R7S A;  3FIL B;  2DYO A;  3B9J A;  1IBX B;  2KAJ A;  3P4P B;  2Y5C A;  2J42 A;  1CJE A;  4MT5 A;  1XLQ A;  5FR3 A;  4XWT A;  1E9M A;  3LXF A;  1JQ4 A;  3SFD B;  1FD6 A;  1Y56 A;  1YQ3 B;  2DBY A;  1XCQ L;  1DYQ A;  1FFU A;  1F2R I;  4N58 A;  2WXF A;  3AEG B;  2JU6 X;  2HDE A;  3AE6 B;  3URY A;  1VDV A;  2J53 A;  5FK9 C;  1PFD A;  2W54 A;  2WDV B;  3HUI A;  2IJ0 A;  3TUO A;  2KN4 A;  4KGT A;  1L6V A;  2OED A;  1JML A;  1I4Q A;  2WDQ B;  3ZGZ A;  2WXK A;  3AE5 B;  1QT9 A;  4RNA A;  3U4E G;  5JXV A;  3R2T A;  2LJI A;  4WQM A;  5TSS A;  1SF0 A;  2BBC A;  2L1A A;  1L0X B;  1N61 A;  1M4V A;  1NYR A;  1CZP A;  2PLP A;  1V97 A;  3FC4 A;  4J3O D;  1D5X C;  3AMZ A;  2K5P A;  3R2I A;  1FEH A;  2M19 A;  1KRH A;  4TMA B;  1QOA A;  4WAF A;  5E6J A;  3B2F A;  3CWI A;  1EU4 A;  1ROE A;  1F0Z A;  1ACC A;  3L4P A;  3W9C B;  4RGM A;  4TQ0 A;  4ITK A;  2E3T A;  2LGI A;  2V4I B;  3BYT B;  3E56 A;  4YTM B;  4A9A A;  1N62 A;  2W55 A;  3VRB B;  1GB1 A;  1L5P A;  1UUP A;  4YTP B;  2CJN A;  2DLB A;  5BYR A;  4ZRP A;  1KLU D;  3MC0 B;  1ESF A;  3C8Y A;  2I38 A;  2BW2 A;  2LFI A;  1FRD A;  2IGD A;  1C76 A;  1MPE A;  3GP7 A;  4DQO C;  3I9V 1;  1ZUD 2;  3ZJT A;  2N7J A;  1SE4 A;  2QIL A;  2WU2 B;  3NS1 A;  1CK1 A;  3AEE B;  3NRZ A;  4PT5 A;  2IPK D;  2ONQ A;  3NVV A;  4JWU C;  2WXN A;  1K50 A;  4US8 A;  2L32 A;  1JRO A;  2X38 A;  1JW9 D;  3N9Y C;  1ZP0 B;  3GS2 A;  3AE4 B;  4HEA 1;  5BYQ A;  2BS3 B;  1BXT A;  1ZXH A;  2JXT A;  2NMQ A;  2G1E A;  4LK0 M;  4O1N A;  4M0W A;  2AX5 A;  2JWU A;  4P16 A;  1XLO A;  2GRI A;  4A8X C;  1JWU D;  2NTS A;  4JX1 C;  4XDD A;  2WXQ A;  3LYY A;  2DYM A;  1SJH D;  1B9R A;  3Q8F A;  2TSS A;  1EM7 A;  1F77 A;  2BS4 B;  1FNV A;  1KLG D;  2QIE B;  1C79 A;  1SIJ A;  1TKY A;  1TS4 A;  1IBX A;  1HQR D;  3W2D A;  3ZJU A;  2RDH A;  1QKZ A;  3ETR A;  3ABV B;  4WH4 A;  4XE0 A;  4OW0 A;  5G5G A;  3DWM A;  1ET9 A;  2KDM A;  2Y5P A;  2G9H D;  2QEJ C;  2WXJ A;  1I7H A;  2QJL A;  4UDU C;  4GDL B;  1FNW A;  3WCQ A;  1E0Z A;  4YT0 B;  2N9L A;  4HJG E;  2K0P A;  2BS2 B;  2AQ1 B;  5AUK A;  3MFG A;  1QOG A;  1C9F A;  1E6E B;  1UWM A;  3RFZ B;  2W3S A;  2Z8L A;  2QMT A;  5I4D A;  2WXG A;  3AEF B;  4USA A;  3AE8 B;  3AN1 A;  5D7G A;  2M56 B;  4D2K A;  5LNK 1;  2WP9 B;  1CQV A;  3DWG C;  2OHF A;  1YJJ A;  2MH7 A;  2PMV A;  3MP9 A;  2LHD A;  2RDG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...