2D5GA

Structure of ubiquitin fold protein r767e mutant
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
83
structure length
83
Chain Sequence
CDSIVVAYYFCGEPIPYETLVRGRAVTLGQFKELLTKKGSYRYYFKKVSDEFDCGVVFEEVREDEAILPVFEEKIIGKVEKVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Axin-1
publication title Structure of ubiquitin fold protein R767E mutant
rcsb
source organism Rattus norvegicus
molecule tags Signaling protein
total genus 16
structure length 83
sequence length 83
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2005-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00778 DIX DIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.380 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2d5gA00
4WIPA 1WSPA 3PZ8A 3PZ7A 2D5GA
chains in the Genus database with same CATH superfamily
1GB1A 2WU2B 3NVVA 3NS8A 2ZVNA 3NVYA 3HIZA 4NQKE 1E0ZA 4WJPA 2KOXA 1MG8A 1FNVA 1WXVA 3RI7C 2WDRB 3MFGA 3AEAB 5CHFA 3KVFB 4K3BA 1AW7A 2IY1B 2V0GA 1OQQA 5E6PA 4G3XB 4WJOA 1EU4A 1WGGA 2RPQA 1JROA 1HE8A 2L05A 3PZ8A 2IBIB 3Q3JA 4KIKA 3TCAA 3QHTA 3NVWA 1T0SC 1TZOA 3VHTC 5KHQA 3RUIB 5BMHA 4IOIE 1WX8A 2GBJA 4H2AA 2N1VA 1JRUA 1VDVA 1KH0A 3DVNU 1G6JA 3QC8B 1SE2A 2N9EB 2AQ3B 3JSVB 2L83A 4FJYA 4KGRA 1L0YB 5LXHA 4WJNA 1V6EA 3ZO5B 2DNFA 1KM7A 2AWTA 4CQNA 2BPSA 3B2GA 2L52A 2J0MA 3WALA 3OJ3A 1SE3A 2GBNA 3R2TA 1ACCA 3Q8FA 5IO9A 2MBEA 2MP2B 2KANA 1NVID 3DVGX 3W2DA 3WCQA 3VVWB 2ZCBA 1WM2A 4N9F4 2DLBA 4DDGD 3S2AA 2PPHA 3MJWA 5C23A 1XEEA 3E56A 3PTFC 3GZNB 3DOWA 3WAOA 1UF0A 3DHGC 2TSSA 4W9JA 4GDKA 4JWUC 3RD2A 2SEBD 4HKQA 1WXMA 5MPOA 2W54A 4LDTB 4DXGA 2KMAA 1WJNA 4I6NB 3AE2B 2Q5WD 3JW0X 1EM7A 4A90A 5G5GA 4XDCA 2BS2B 1R4MB 2CHZA 2BB5A 4S0RA 1TKGA 1M94A 3SFEB 4ZRIA 3APCA 1E7VA 1N5WA 3DBLI 1DYQA 1DOYA 4LLGM 1T0QC 1UD7A 1D5XC 4A9AA 2MJEA 4HPLB 3ZXVA 5G5HA 3RMKC 1NI3A 3Q3OC 3AU4A 2JQRB 1YX5B 1SGHA 5L95C 2OHFA 1WMHB 2G1EA 1D5MC 3C8YA 1E5WA 2I38A 3A9KA 5L83A 5CTRC 2O6VA 2HJ8A 3AE9B 3V6CB 1KLVA 4CYEA 1KOTA 2IO0B 4GSWA 2CKHB 3ZNZB 3HM6X 4A20A 2WQYB 2KWUB 4JIOU 2QHOA 4M8MA 1P9DU 2IO2B 5DPRA 4G50A 1FCCC 1V1OA 1IUEA 4HCNB 2W55A 1GB4A 1KJTA 3BY4B 1IBXB 1V81A 3DVNV 4GGQA 4YTMB 2FIDA 2INPE 1JWBD 4YTNB 1C4PA 4IW0A 2N9PC 4MELA 3SEBA 3M95A 2L0FA 4KZCA 3ONSA 2KX3A 5T8IA 2REXA 3IAS1 1TIFA 2ICIA 4DXAB 4WJQA 2BKFA 3Q6BA 3X23A 5IP4D 4LTUA 4F7ZA 5BYRA 4MDKE 1ZDVA 1OQYA 2KO3A 3NY5A 4OZAA 4IKGA 1WI0A 2IJ0A 5DCNA 3QAQA 2K39A 1HXYD 2KMCA 5IAAC 5LLIA 1I42A 2KC1A 3ZTDA 3N32A 4DXFA 4L1BA 5HI1A 4HPMB 5D7GA 1QOFA 3ZRCA 3Q3NC 1WF9A 2INDC 1N6ZA 4EOYA 3JSVA 2FNJB 3IXSA 2JU6X 1FFVA 5J18A 5IOIA 4HWIB 2DYMA 5HFYA 4NAMA 2K8BA 1FNUA 2KTFA 1WFYA 2MP2A 4HCPB 1TKYA 1YQBA 2JZ3B 3H8HA 2XEWA 3GE8C 1B9RA 2J0JA 4HDOA 2Z8LA 5FR3A 3I5JC 3NJTA 2BS4B 3PHWB 3VDZA 1T6BX 1TS4A 2LXCA 2WXRA 3NZ3A 2K0PA 2IY0B 1TS5A 3ML8A 4KSLC 4FHJA 1KF6B 3B2FA 4A55A 1SE9A 2MBOA 1GNUA 3A4RA 2WXMA 1C79A 2ZNVC 3KYDD 3OJ4B 2BWFA 2XNAC 4NZLB 5E6JA 5D6JB 2D3GA 4DHZE 2WXQA 3TEZA 1MFWA 4W9HA 2CHXA 1UH6A 1L5PA 2MBBB 3H1UA 4KV2A 2WLBA 2JX5A 4XX5A 1IGDA 3I3TB 3ZJTA 4RF1A 1C9FA 3P42A 4K7UA 1WYGA 1Q0WB 4B95A 1R4NB 5JXVA 2DAJA 2QIEB 1XLNA 3P63A 1VRAB 1FM0D 1RWSA 2N9LA 1WR1A 3P4PB 1M4VA 2QCZA 1GC7A 4OW0A 1CJEA 3ZKJC 4LNFA 4E3CA 1GUAB 3KQ4A 2KX0A 2LHEA 1J7CA 3W1SC 4NJCA 3N1ZC 1F1HA 1LO5D 1UNSA 2LVPA 1PQSA 1C4AA 1XLQA 1OQRA 2N7EA 4LNNA 3RNBC 1D6EC 3VRAB 2BYTA 3WANA 3TJPA 4BKGA 3V61A 1N62A 4GXBA 2V4IB 2XK5A 3IBEA 2KDEB 4TMAB 2ZVOA 2DZKA 4RCOA 5BO4B 3UQBA 3AE6B 1C1YB 2V4LA 4OVUA 4TUUA 4ZYSA 1GPXA 5E6OA 3TIXA 1S1QB 1ZPSA 1I35A 2FUG1 2JVCA 3CMMB 1I4GA 2I1KA 3DWGC 1WZ0A 5TSSA 2WX1A 4EZJA 2JWUA 1RM6C 2W3SA 2ZCCA 1OEYJ 3QX1A 2IO1B 1N63A 4KGTA 1IP9A 4MJSA 2D07B 3R7RA 1ISNA 3A1QB 4KIKB 2RR9A 3U7DA 1S3SG 1K8RB 1WXAA 3TEWA 1Z5SB 2FUHB 1YJ1A 3AE8B 1BT0A 2ASQA 4C7ZA 4BZAA 3AE5B 3RPFC 2G45B 2M1MA 5H92C 2D3CA 1HZ5A 3DQVA 2CHWA 2MWSB 5J17A 1JALA 3N9YC 1ZP0B 1BMLC 1XLOA 4ASWC 2R2QA 1FRRA 1RYJA 3DBLB 2AL6A 4YSZB 5EE1A 1QT9A 2L00B 2VH2A 3V6EB 5BMIA 2VZKD 2NVUI 4HRSA 1YN5A 3FKYA 4IWOA 2LGYA 3KUDB 4FLHA 1L0VB 1HA5A 3IVFA 2KJHB 2KDFB 4G11A 1BUIC 3L10B 3NRZA 3QK0A 1V5TA 4RF0A 1MHXA 1N5XA 1XQQA 2RDHA 4HROA 2N9KA 4GDKB 4J6IA 5AEKB 2VH1A 3BVGA 1ET6A 2OJRA 1HTOA 1JWAD 1XO3A 1UGJA 3ZNHB 2KTRB 2KWCA 1WJ4A 3R66C 3QJZA 3VH4B 2WYQA 3NOBA 5D94A 4REZA 2MBQA 4PS8A 2PE6B 5EE0A 2BGFA 2N7JA 2CJNA 3OG5A 3PRPB 3EGRA 5IKCM 1FCLA 1ZW7A 4DBGA 1NENB 2MX2A 3VAWA 4MSQB 3PVLA 3VQIA 3EFUA 3LDZE 2LJIA 4IM2A 2BYFA 2IGDA 1FD6A 3ZIMA 4KKIA 1DOXA 1V1PB 4LJPB 4KKJA 5EDSA 2VRRB 5AZHA 2X8XX 3AN1A 1SXTA 1J0GA 1E6EB 1YN3A 4LNKA 3URYA 1K50A 2HJ1A 3CIRB 4X57B 5C1ZA 1WGDA 4GLSC 2QMTA 1ZUD2 2O6VB 2JWZA 4GIVA 3RYTA 1AN8A 4S17A 4L23A 3U8ZA 2DX5B 1NYQA 4LNOA 2K6QA 4ZHOA 4IDIA 5EE3A 2D3BA 3TSSA 2H89B 4IM3A 1JMLA 3ETRA 4FBJB 2WDVB 4RM9A 2KMMA 4HLEA 4DK5A 3EECA 3L4PA 3PZ7A 2N7DA 3LYYA 1Q1OA 2LGIA 2EMTA 1VCBA 4MACA 2CU3A 1C76A 1NYRA 4IWQA 3SFDB 3AV8A 2UYZB 3A1QA 4BKSD 3M62B 3T3NA 4P1BC 1GC6A 1K51A 2IDYA 2K8HA 2YLMA 3PHXB 3ZDMC 3FAHA 1EO6A 3TL5A 4FULA 3B1LX 2GB1A 1T0YA 2NTSA 5CX3A 4BOSC 1UGMA 4ANWA 4LDTD 1LGRA 3KUCB 2WDQB 1ZXIA 4FJVB 1SEBD 1A70A 4HKZE 3WAPA 1Q10A 3W9CB 2G4DB 3SD5A 2RD0A 1YMHE 2FE8A 1SB3C 2MRPA 2Z0DB 1XD3B 2V3NA 1DOIA 1I7HA 4ZRJA 4II3B 2LGSA 1FO4A 4WWMA 3IAM1 4WQMA 4K3CA 3K9OB 4B0EA 4NPNA 1EUVB 2WGSA 1H8CA 3L13A 2K3UA 1I4RA 2WXIA 3B0AA 2KTRA 1TKEA 2WU5B 3BK2A 1UZXB 4JL9A 1MHHE 3IT4B 3T3OA 2V3SA 2ZJDA 1L6UA 4W9CA 3WIMA 2WXNA 1XF5L 1UWMA 3AEBB 3AE4B 3KW5B 2LRWA 1QZEA 1F0ZA 4DHJB 1JRPA 4FADA 1JWSD 2D2QA 5CHWA 1V1PA 4N6EB 2JYEA 4RNAA 4MGYE 4MSMB 4F1SA 4TQ0A 2MJ3A 3B08A 5KHOA 3ZTCA 3KH0A 1FXTB 3SU8X 3PLUA 4G0NB 2FIFA 3FC4A 4ANVA 3VR9B 3BWUD 1V5OA 3EHVA 3I57A 3NZUA 2PVGC 1ESFA 2C7MB 2IGGA 2Z0EB 2JSVX 1WRDB 3BK1A 4GN1A 3DWMA 3EC8A 3U30A 2AQ1B 4CHKA 4A6QA 1OGWA 1JWUD 1P7EA 3MTNB 2KT7A 1WSPA 3Q3MC 1KFYB 4KVGB 1T5XD 3N1YC 4N58A 1WM3A 4C4VA 3VXWA 4W9DA 3K9PB 4XGAB 1ENFA 3CWIA 2M4NA 3VTVA 3MC8A 1YJIA 4HK2A 3MP9A 2K9XA 4PT5A 5JZEB 4ICUA 2KN5A 1ZDXA 1CMXB 1E7UA 4FN2A 4US9A 3VUXA 4P7IA 1P0RA 1Y56A 2XK5B 3C19A 4K81A 4KX6B 2INNE 3AULA 3PRZA 2K25A 2KHWB 4EKUA 4XZ4A 2Y3AA 1WZ3A 1T3QA 2KQ7A 2BVCA 1KLGD 1YNTE 2KYWA 4ZDVA 2CS4A 3VUYA 3ALBA 1SIJA 1E10A 5JHAA 2J52A 2JPHA 3J9CA 3NHEB 3CF6E 2K8CA 2LGDA 1CK1A 4WIPA 4IWPA 1EWCA 3M3JA 4AUQC 3V05A 3R8BA 4I6LB 1WGRA 2WXPA 3I9V1 4MJSB 3DBHI 1R7SA 3IG3A 2IZVB 2IPKD 4W9GA 4ARIA 4DHZB 4NJ7A 1PFDA 2D10A 3AMZA 2DBYA 4IM0A 4JE3B 1HTQA 1YQ4B 2WXHA 2LHDA 4OZCA 2PE9A 1V97A 1XXGA 2V9HA 5D2MB 1E8YA 2G4SA 2MH7A 2AX5A 3GE3C 3N3KB 5DPSA 1RRBA 4EFOA 3QQ8B 5HHDG 1FFUA 2IGHA 3AEGB 3DCGA 3CSFA 2WXLA 5BYQA 4WWPA 2I1JA 5G2NA 2WXGA 3T8MA 5HG2A 2KC2A 3U4EG 4CO7A 1WH3A 2KFJA 4I6PA 1L4DB 2MQJA 2DWQA 2HDEA 3ENEA 4FJZA 3Q3FA 4AP4C 2BTEA 2HD5B 2HE7A 4KDIC 2FCMA 4M01A 3LJ3A 3JYUA 5BMGA 3BVMA 4M02A 1J7AA 3PLVA 3U52E 1VR9A 4W9FA 4MH8A 1KTKA 2KN4A 3QA8A 4KDLB 1YD8U 2JZZA 1LXDA 2KXJA 1ZE3D 4HVBA 3KYCD 3TUOA 3RFZB 2ZW0A 1YOVB 4P16A 2BKRB 4OHJA 3GZNI 4ICVA 3IFWB 3V62A 1IPGA 3PZDA 3DBRI 3APDA 2K5PA 3P1MA 1FMAD 4BKTA 3M63B 1ZKHA 2GOWA 3GP7A 3SHQA 3APFA 2XBBC 4B6WA 4ACFA 2M17A 5IA7A 1VJKA 1ET9A 4YL8A 5AUKA 1SJHD 3UIOB 2PW9A 2NMQA 4MGKE 3AH7A 2NPTA 2FCNA 4RFBA 4KSKC 4JPSA 4R3DA 3EA6A 2L3ZA 2KNBA 2NBVB 2FAZA 4HDQA 1L2NA 3HUIA 3PO0A 1GOZA 3VUWA 3DDCB 3RZFA 1PUTA 3N20C 1WXSA 1C4CA 4FXCA 2IYDB 4NNJB 5AZGA 4HPPA 1TTNA 2CU1A 4FA6A 2C9WB 2L76A 3VR8B 3NVZA 1JW9D 3VRBB 3ZYYX 5C3JB 2FBWB 3ML9A 2J0KA 2JRIB 3L17A 4AJWA 2Y5BB 4PS7A 1LQBA 2M56B 2KDIA 1I4PA 2WXJA 3T9LA 3AEDB 4IC7B 1OEYA 2GI9A 3E9SA 2LD9A 1WGHA 3PPAA 3N1XC 3Q2AC 4WWOA 1WX7A 3KLSX 1WGYA 4NQLB 5J2RA 2ZEQA 1T0RC 3ZRFA 1J19A 1TY2A 1SF0A 3UF8A 2LFIA 4YTPB 1WJ6A 3VTUA 3L16A 4C80A 2BQQA 1SJED 2LZ6A 3MC0B 3R2IA 1EF5A 3OAWA 2NCNA 3LB8C 2BT6A 3V3XA 2IO3B 4AJYB 2NBWB 1PGXA 3ZW3A 2MHJA 4QAYA 2DZIA 1STEA 1VD2A 1VLBA 2QJLA 4II2B 1SBBB 1NI2A 4BAXA 3U2SC 2A4ZA 2ZZPB 2EKIA 3AU5A 3QIJA 1LFDA 2PMVA 1UUPA 2D3AA 1F2RC 2M8SA 2O6VD 3BZDB 1WX9A 2KACA 5BYSA 1K53A 4ZYNA 3BVZA 3GB1A 1E90A 1F9JA 2NS5A 1MG4A 1TS2A 1VZ6A 5AZFA 1WGKA 4YT0B 3RULA 2KQ4X 2KVRA 1V9JA 4ZHPA 5LXIB 1D3ZA 2KFKB 4L2YA 1XCTL 1QOGA 3P4QB 2Y5PA 1K52A 2KJRA 2AYOB 1PYWD 2KWVB 1WRIA 1Q5WB 2WXOA 3PGEA 3O13A 2CJOA 4JX1C 3TMPB 3RCZA 4WH4A 1X1MA 3VH3B 2H88B 3AE3B 1AWDA 1C3TA 3MC9A 2B3AA 3ZJVA 5C2TB 2LXAA 3RNFC 4JQWC 4RMAA 2RDGA 4C00A 5G55A 3P4RB 2QEJC 5D3IB 1N61A 4EEWA 4JLCA 4C4VB 2BF8B 2KKCA 2M19A 2ZPYA 3AEEB 4M8NA 2ZNVB 1C78A 1R4NI 4GDLB 2NBUA 3AEFB 1ZOYB 4C7YA 2BB6A 4ITKA 4RGOS 1L6VA 2JRHA 3RNAC 2DHZA 1FNWA 2GRIA 2XN9C 3L0WB 4GU2A 4W9LA 2LUEA 4HJKA 3H7PB 2HTHA 2JXTA 1TS3A 2D11A 3PS6A 4TSSA 3VTWA 3P4SB 3B9JA 4BVUC 4NY0A 2DENB 1XCQL 3ZNID 4E71A 2LJ5A 2J7QB 3EUB2 2ON8A 2LVOA 2ZPNA 2LVQA 4WWNA 1H4RA 2MEKA 2V1YA 4USAA 4EE2A 4RM8A 2BWES 1V80A 3BYTB 2DZJA 3DHIC 3L54A 4XWTA 2UU7A 4J3OD 3H7SA 1QF6A 4DHJD 4RGNA 1U4AA 5AUIA 5CHVC 1V86A 2OJWA 4OVVA 2ZW1A 2N0SB 2Z59B 1B1ZA 1D4BA 1P1AA 1PGBA 2NTTA 4MGZE 4A8XC 4OZBA 4WAAA 4E74A 4GOCA 2D5GA 2LGXA 3DBRB 1NEKB 3AB5A 3A9JB 5H8YE 4EZLA 1RFAA 3BIID 5HKHA 3WA0A 3ZDTA 3DPDA 2PEAA 1AARA 3HVZA 3AM9A 1J7BA 2A5UA 4NAWB 1AYFA 2KFKA 4BBNF 4ZRQA 1GAQB 3W5UB 4ANUA 2LUMA 2BW2A 2PJHA 3UQAA 5IN7A 2PIAA 1E8WA 4ANXA 3NUHB 1TGZB 2N1WA 2LRUA 1TT5B 2ACZB 5FK9C 1P7FA 1FIQA 3WAMA 2M0XA 2JZPA 4XC2A 1QKZA 1P98A 4IG7B 3UINB 2GBMA 3W1YA 1I4HA 2JXXA 3OWEB 4M0WB 4BFRA 3H9DA 5FR6A 3BYYB 4ZRPA 1MI0A 4MM3A 2HTME 4ZOHC 2GMIC 2L0TA 3D32A 1TYGB 2N9XA 3R7QA 2KLCA 2L7RA 2INCC 2K22A 4GDLA 2KQSA 1CQVA 1UBQA 3OLMD 4P1CC 4WURA 1FPYA 4W9IA 3CSTA 1MPEA 2DZMA 1Y8RC 1F52A 3N30A 3TBLD 4KZ0A 3RT3B 2NPTB 2K1FA 1JWMD 2QDFA 4YSYB 1ZXHA 3RNCC 2LMCA 4MH0E 4URKA 4C56C 3ZXRA 3H7PA 3Q8EA 4XWWA 4JGHB 3MHSD 4DQOC 3HM3A 3RNGC 1KRHA 4B9KA 2E6XA 2WXFA 4GMVA 3TEYA 3HVDA 3P2BA 1D5ZC 2R2OA 1WWTA 1E8XA 1V8CA 2LASA 3Q14C 2PKOA 3QWZB 4A3OA 2C60A 1QLBB 2C5LC 2J42A 2GBKA 2JUOA 1UWXA 3Q8BA 2W82A 4AOFA 4W9EA 1QOAA 1E7PB 5E6NA 1WIAA 2MCNB 4BOZB 4N59A 3RN9C 2E3TA 4XE0A 2PTLA 1HQRD 1L7YA 2WDTB 1YJJA 3W1SA 4Q2JA 3VFKA 3ZGZA 4BKSA 4DWFA 4HEA1 2EMSA 2FCSA 2GBRA 2RMMA 4O1NA 1IYFA 1WYWB 5JHBA 1C77A 2GLSA 2JT4B 1WE6A 2KD0A 4PYUA 3A9JA 2ONQA 3ZNGC 4LCDE 1I4QA 4RGTA 1CZPA 2EELA 4RGMA 1I4XA 1OTRB 3A33B 4NAWA 2PLPA 2L8JA 1RLFA 2QC8A 3Q69A 2WP9B 3JVZX 2KLGA 3PRMB 1A5RA 1FRDA 1F77A 3ECIA 2LWPA 3AXCA 3IHPC 1SSNA 1TZ1A 5GXGB 4PK1A 3LXFA 1YX6B 3NZSA 3ABVB 2C7HA 2WWZA 1PDXA 4YWGG 2B76B 2O2VB 3PREA 4K7SA 2MA9B 3U7ZA 1YQ3B 3NG0A 1XT9B 3PSEB 4M00A 2WX0A 2JYTA 3NS1A 3X0WA 1WMHA 1WR6E 1WE7A 4M0WA 2WHIA 2KDBA 3KWLA 3KWVA 1SE4A 4MEMA 2MSED 2QILA 3W5VB 4US8A 1EWYC 3RZWC 2I2YA 1QQRA 4GB9A 2BS3B 1ROEA 2KWDA 1JCKB 2OOBB 3UI3A 3I63C 4IUMB 1IBXA 1VZ8A 1R4MI 2RDBC 5EE9A 3EFCA 3FILB 3UIPB 4KGSA 1TBEA 3KUZA 5DPWA 3DVGY 4NJ6A 1N60A 1PGAA 2AEHA 1NDDA 4AS1A 2G9HD 2J4XA 2C7NB 2SAKA 4HJGE 2KZRA 4LK0M 2YEPF 3UGBB 3BINA 1WY8A 1EF1A 2AL3A 3ZQ4A 3H6NA 3SDLC 3ZLZA 1EU3A 2LEKA 1WJUA 2OEDA 3ZVVA 1ZGUB 5JH5C 1P3QU 4ARCA 3A4SC 3TEXA 5FKAC 4XYCA 2RGFA 2G3QB 1L0XB 1L4ZB 4MT5A 2KVZA 2K6DB 4RH6A 1MVKA 1XLPA 1LM8B 2YEPB 2EKEC 2BYEA 3MHZA 3DBSA 3MJ5A 3Q8CA 2MJDA 1YIWA 4YSXB 2V3PA 2NR2A 4LNIA 2X38A 1NBFC 3AECB 4PYZA 5DPTA 4AQ7A 1V2YA 3R3MA 3V60A 3RNEC 4B0MA 1TJEA 2DYBA 4AWJA 1GJZA 2J53A 2JY6A 4LJOB 2DAFA 2L32A 4BBNC 4DDID 3L08A 3HK0A 2PVOD 3HRDD 4WAFA 2KK8A 2L1AA 1FXAA 1JQ4A 4F8CB 1F2RI 3GS2A 1FXIA 3SR6A 3PT2B 4K7WA 2DYOA 1RAXA 1RFKA 2BBCA 4TV3A 3ZUNA 4P6VF 4UDUC 2UWQA 1QOBA 2LI5A 1YN4A 3AI5A 3HHMA 2Y5CA 1E9MA 1KLUD 4TQ1A 4EZKA 2JF5A 5TR5A 2WXKA 2O2VA 4YXDB 2MBHA 1UELA 3AE1B 1Z2MA 4PS3A 4FHKA 2R61A 1J8CA 4HXDA 1UBIA 2CR5A 4JWSC 2MW5A 4OVZA 2QSDA 2VZKB 1V49A 1QILA 4ZRKA 4XDDA 2KDMA 1IGCA 5I4DA 1E8ZA 4MGIE 5D3DA 3AE7B 4TKNA 5LNK1 4A3PA 3O65B 3QCAA 4WQOB 2W9NA 2MLBA 2KJ6A 2FCQA 3PV1A 1WXQA 3FILA 1VZ7A 4W9KA 1OFFA 4EUTA 1HZ6A 2M0AA 2YVCA 2KAJA 2WS3B 3QARA 1GG3A 1FEHA 1BXTA 1TY0A 1SIFA 3A9KB 2WNMA 4MM3B 4K1RB 2N4FA 1HEZE 3GOEA 2AQ2B 3IT6B 3Q8AA 1DGJA 3DHHC 2RSUA 4D2KA 2W3RA 3DBHB 3C0RB 5GMVA 3ZJUA 1MJDA 2BYVE 2RPVA
chains in the Genus database with same CATH topology
3TEWA 2JZPA 1GB1A 2WU2B 3NVVA 1QKZA 3NVYA 3AE8B 5HG2A 3U4EG 1E0ZA 4C7ZA 3AE5B 1I4HA 3RPFC 1FNVA 5H92C 1L4DB 1HZ5A 2DWQA 2WDRB 3MFGA 3OWEB 2HDEA 1JALA 3AEAB 3BYYB 3N9YC 4ZRPA 1ZP0B 1MI0A 2BTEA 1BMLC 1AW7A 1XLOA 2HTME 1FRRA 1RYJA 2V0GA 1OQQA 4YSZB 1EU4A 4ZOHC 5BMGA 5EE1A 1QT9A 1JROA 3BVMA 5BMIA 2VZKD 3PZ8A 4HRSA 1TYGB 1J7AA 1YN5A 3U52E 1VR9A 3NVWA 1TZOA 2K22A 4MH8A 1KTKA 2KN4A 5BMHA 1CQVA 4IOIE 1L0VB 4H2AA 1HA5A 1ZE3D 4WURA 1MPEA 3TUOA 1VDVA 1KH0A 3RFZB 2ZW0A 1BUIC 3NRZA 1SE2A 4P16A 1JWMD 4OHJA 4YSYB 2AQ3B 1ZXHA 2L83A 1MHXA 2LMCA 1L0YB 1N5XA 2RDHA 4KGRA 4RF0A 4HROA 4C56C 2N9KA 4GDKB 3Q8EA 2K5PA 3P1MA 4XWWA 4DQOC 3B2GA 4CQNA 1FMAD 3BVGA 1ET6A 1KRHA 2L52A 1JWAD 2E6XA 1XO3A 1UGJA 2WXFA 1SE3A 3R2TA 3TEYA 3HVDA 1ACCA 3Q8FA 1D5ZC 4REZA 3GP7A 1NVID 1WWTA 3W2DA 3WCQA 1V8CA 1VJKA 5EE0A 1ET9A 2N7JA 2CJNA 2PKOA 2DLBA 3EGRA 1QLBB 5AUKA 1SJHD 1FCLA 2PW9A 2J42A 1XEEA 2NMQA 3E56A 1NENB 1UWXA 3AH7A 3Q8BA 3VQIA 4RFBA 2W82A 4JPSA 4R3DA 3EA6A 2TSSA 2LJIA 1QOAA 1E7PB 4JWUC 2IGDA 1FD6A 2SEBD 4KKIA 3HUIA 3PO0A 1GOZA 4HKQA 5MPOA 2W54A 1DOXA 1V1PB 4DXGA 4KKJA 4N59A 1PUTA 2RPVA 3AE2B 4XE0A 2PTLA 1HQRD 3AN1A 1SXTA 2Q5WD 3W1SA 1YJJA 4Q2JA 1E6EB 1YN3A 1C4CA 4FXCA 3ZGZA 1EM7A 3URYA 5G5GA 1K50A 4HEA1 4XDCA 4A90A 2BS2B 3CIRB 2RMMA 2BB5A 4GLSC 1TKGA 2QMTA 1ZUD2 3SFEB 3VR8B 3NVZA 4O1NA 1JW9D 3VRBB 1C77A 1AN8A 1N5WA 3ZYYX 1DYQA 4L23A 5C3JB 2FBWB 1NYQA 1DOYA 4LLGM 2WXGA 4ZHOA 4IDIA 2ONQA 1D5XC 5EE3A 4A9AA 2M56B 2MJEA 3TSSA 1I4PA 5G5HA 2WXJA 1NI3A 1I4QA 2H89B 4RGTA 1CZPA 2JQRB 3AEDB 2EELA 4RGMA 1I4XA 1JMLA 3ETRA 2OHFA 2GI9A 2G1EA 2PLPA 2WDVB 1D5MC 3C8YA 3E9SA 2KMMA 3Q69A 2WP9B 3L4PA 3PZ7A 2I38A 3LYYA 2LGIA 1FRDA 3KLSX 1F77A 3AE9B 1SSNA 4MACA 5GXGB 2CU3A 1C76A 2WQYB 3LXFA 1TY2A 1NYRA 1SF0A 3ABVB 3SFDB 1PDXA 4YWGG 3AV8A 2LFIA 2B76B 1FCCC 4YTPB 1V1OA 3T3NA 1IUEA 2W55A 1GB4A 4C80A 1K51A 1SJED 3MC0B 3U7ZA 1YQ3B 2IDYA 3R2IA 1IBXB 4YTMB 2INPE 1JWBD 3LB8C 4YTNB 3FAHA 2BT6A 2JYTA 3NS1A 3V3XA 1C4PA 3SEBA 1PGXA 4M0WA 2GB1A 2NTSA 3KWLA 5T8IA 3IAS1 2ICIA 1SE4A 3KWVA 1STEA 2QILA 1VLBA 3W5VB 4US8A 1EWYC 2QJLA 2I2YA 1QQRA 1SBBB 2WDQB 1ZXIA 1SEBD 1A70A 4LTUA 2BS3B 4HKZE 5BYRA 3U2SC 1ROEA 2EKIA 1Q10A 1JCKB 2KWDA 1ZDVA 3UI3A 3W9CB 2PMVA 1UUPA 4OZAA 4IKGA 1F2RC 2IJ0A 1YMHE 2FE8A 3BZDB 1IBXA 1VZ8A 2KACA 1HXYD 1SB3C 5BYSA 1K53A 5EE9A 2V3NA 1DOIA 1I7HA 3FILB 4KGSA 4DXFA 4L1BA 5HI1A 5D7GA 1QOFA 3BVZA 3GB1A 1FO4A 4WWMA 1TS2A 1VZ6A 1N60A 3IAM1 4WQMA 1WGKA 3IXSA 1PGAA 1FFVA 2JU6X 4B0EA 4YT0B 2KQ4X 4AS1A 4ZHPA 2G9HD 1XCTL 4L2YA 2J4XA 1QOGA 3P4QB 2Y5PA 1K52A 2DYMA 2K3UA 5HFYA 4NAMA 1I4RA 2SAKA 2WXIA 4HJGE 4LK0M 1PYWD 2YEPF 1TKEA 2WU5B 1WRIA 3BK2A 1FNUA 2WXOA 3O13A 2CJOA 4JX1C 4WH4A 1TKYA 2H88B 3ZQ4A 3H8HA 1MHHE 3IT4B 3T3OA 3AE3B 1EU3A 1L6UA 2LEKA 1AWDA 1B9RA 2OEDA 2WXNA 1XF5L 1UWMA 2Z8LA 3AEBB 5FR3A 3ZJVA 3AE4B 4ARCA 5C2TB 3TEXA 5FKAC 2BS4B 1F0ZA 1T6BX 1TS4A 1L0XB 1L4ZB 1JRPA 4MT5A 2WXRA 3NZ3A 2K0PA 4RH6A 2RDGA 1MVKA 1XLPA 1TS5A 1JWSD 1V1PA 4N6EB 2YEPB 2JYEA 4RNAA 1KF6B 4TQ0A 3MHZA 3MJ5A 3B2FA 3Q8CA 4A55A 2MJ3A 3P4RB 2MJDA 2QEJC 4YSXB 2V3PA 5D3IB 1N61A 2WXMA 1C79A 2X38A 3AECB 4AQ7A 3FC4A 2M19A 3AEEB 3VR9B 3BWUD 2XNAC 4NZLB 5E6JA 4B0MA 1C78A 1TJEA 3I57A 2WXQA 4GDLB 2J53A 2PVGC 3TEZA 2L32A 1ESFA 3AEFB 2IGGA 1ZOYB 2PVOD 2BB6A 2JSVX 3HRDD 4C7YA 4WAFA 3BK1A 3DWMA 1L5PA 4ITKA 4RGOS 1L6VA 2AQ1B 2WLBA 4A6QA 1FNWA 2L1AA 1JWUD 2GRIA 2XN9C 1P7EA 2JX5A 1WSPA 1IGDA 1FXAA 1TS3A 2JXTA 1JQ4A 3ZJTA 1F2RI 4TSSA 4RF1A 1KFYB 3GS2A 1FXIA 1T5XD 3B9JA 3P4SB 4N58A 3SR6A 1C9FA 2DYOA 1XCQL 3P42A 1RFKA 2BBCA 1WYGA 4P6VF 4UDUC 5JXVA 3EUB2 2ON8A 1ENFA 2QIEB 1QOBA 3CWIA 1XLNA 3P63A 1VRAB 1YN4A 2Y5CA 1E9MA 1KLUD 4TQ1A 1FM0D 1YJIA 1RWSA 3MP9A 2MEKA 2K9XA 2N9LA 4PT5A 2WXKA 3P4PB 1M4VA 4USAA 4EE2A 1ZDXA 4YXDB 4OW0A 1CJEA 4US9A 3AE1B 3BYTB 3KQ4A 1Y56A 4KX6B 2R61A 2INNE 2LHEA 1J7CA 4XWTA 4J3OD 4JWSC 4NJCA 2Y3AA 1T3QA 4OVZA 1QF6A 2QSDA 2VZKB 4RGNA 1LO5D 5AUIA 1UNSA 1KLGD 1QILA 1YNTE 4XDDA 1C4AA 1XLQA 2KDMA 1IGCA 1OQRA 1SIJA 5I4DA 1E10A 1D6EC 2ZW1A 3VRAB 2J52A 2BYTA 3J9CA 5D3DA 2N0SB 3AE7B 1CK1A 5LNK1 1B1ZA 4WIPA 1D4BA 1EWCA 1PGBA 2NTTA 3V05A 3R8BA 2WXPA 3I9V1 4OZBA 4A8XC 1N62A 1R7SA 4ARIA 2D5GA 2IPKD 1NEKB 3AB5A 1PFDA 2V4IB 3AMZA 2DBYA 4JE3B 5H8YE 1WXQA 3FILA 1VZ7A 3BIID 1YQ4B 2WXHA 4TMAB 2LHDA 1OFFA 1HZ6A 4OZCA 4RCOA 2M0AA 3HVZA 1V97A 2KAJA 2WS3B 1XXGA 1FEHA 3AM9A 1J7BA 3AE6B 1BXTA 4NAWB 2MH7A 4ZYSA 1AYFA 2AX5A 1GPXA 1TY0A 1ZPSA 2FUG1 4ZRQA 1GAQB 1I4GA 3W5UB 2WNMA 2LUMA 4MM3B 2BW2A 3DWGC 1HEZE 5TSSA 2AQ2B 5HHDG 1FFUA 3IT6B 3Q8AA 1DGJA 1RM6C 2JWUA 2PIAA 2IGHA 2W3SA 3AEGB 3NUHB 4D2KA 2W3RA 2WXLA 1N63A 4KGTA 2ACZB 5BYQA 3ZJUA 5FK9C 1P7FA 1FIQA 2E3TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WIP A;  1WSP A;  3PZ8 A;  3PZ7 A;  2D5G A; 
#chains in the Genus database with same CATH topology
 1GB1 A;  2WU2 B;  3NVV A;  3NS8 A;  2ZVN A;  3NVY A;  3HIZ A;  4NQK E;  1E0Z A;  4WJP A;  2KOX A;  1MG8 A;  1FNV A;  1WXV A;  3RI7 C;  2WDR B;  3MFG A;  3AEA B;  5CHF A;  3KVF B;  4K3B A;  1AW7 A;  2IY1 B;  2V0G A;  1OQQ A;  5E6P A;  4G3X B;  4WJO A;  1EU4 A;  1WGG A;  2RPQ A;  1JRO A;  1HE8 A;  2L05 A;  3PZ8 A;  2IBI B;  3Q3J A;  4KIK A;  3TCA A;  3QHT A;  3NVW A;  1T0S C;  1TZO A;  3VHT C;  5KHQ A;  3RUI B;  5BMH A;  4IOI E;  1WX8 A;  2GBJ A;  4H2A A;  2N1V A;  1JRU A;  1VDV A;  1KH0 A;  3DVN U;  1G6J A;  3QC8 B;  1SE2 A;  2N9E B;  2AQ3 B;  3JSV B;  2L83 A;  4FJY A;  4KGR A;  1L0Y B;  5LXH A;  4WJN A;  1V6E A;  3ZO5 B;  2DNF A;  1KM7 A;  2AWT A;  4CQN A;  2BPS A;  3B2G A;  2L52 A;  2J0M A;  3WAL A;  3OJ3 A;  1SE3 A;  2GBN A;  3R2T A;  1ACC A;  3Q8F A;  5IO9 A;  2MBE A;  2MP2 B;  2KAN A;  1NVI D;  3DVG X;  3W2D A;  3WCQ A;  3VVW B;  2ZCB A;  1WM2 A;  4N9F 4;  2DLB A;  4DDG D;  3S2A A;  2PPH A;  3MJW A;  5C23 A;  1XEE A;  3E56 A;  3PTF C;  3GZN B;  3DOW A;  3WAO A;  1UF0 A;  3DHG C;  2TSS A;  4W9J A;  4GDK A;  4JWU C;  3RD2 A;  2SEB D;  4HKQ A;  1WXM A;  5MPO A;  2W54 A;  4LDT B;  4DXG A;  2KMA A;  1WJN A;  4I6N B;  3AE2 B;  2Q5W D;  3JW0 X;  1EM7 A;  4A90 A;  5G5G A;  4XDC A;  2BS2 B;  1R4M B;  2CHZ A;  2BB5 A;  4S0R A;  1TKG A;  1M94 A;  3SFE B;  4ZRI A;  3APC A;  1E7V A;  1N5W A;  3DBL I;  1DYQ A;  1DOY A;  4LLG M;  1T0Q C;  1UD7 A;  1D5X C;  4A9A A;  2MJE A;  4HPL B;  3ZXV A;  5G5H A;  3RMK C;  1NI3 A;  3Q3O C;  3AU4 A;  2JQR B;  1YX5 B;  1SGH A;  5L95 C;  2OHF A;  1WMH B;  2G1E A;  1D5M C;  3C8Y A;  1E5W A;  2I38 A;  3A9K A;  5L83 A;  5CTR C;  2O6V A;  2HJ8 A;  3AE9 B;  3V6C B;  1KLV A;  4CYE A;  1KOT A;  2IO0 B;  4GSW A;  2CKH B;  3ZNZ B;  3HM6 X;  4A20 A;  2WQY B;  2KWU B;  4JIO U;  2QHO A;  4M8M A;  1P9D U;  2IO2 B;  5DPR A;  4G50 A;  1FCC C;  1V1O A;  1IUE A;  4HCN B;  2W55 A;  1GB4 A;  1KJT A;  3BY4 B;  1IBX B;  1V81 A;  3DVN V;  4GGQ A;  4YTM B;  2FID A;  2INP E;  1JWB D;  4YTN B;  1C4P A;  4IW0 A;  2N9P C;  4MEL A;  3SEB A;  3M95 A;  2L0F A;  4KZC A;  3ONS A;  2KX3 A;  5T8I A;  2REX A;  3IAS 1;  1TIF A;  2ICI A;  4DXA B;  4WJQ A;  2BKF A;  3Q6B A;  3X23 A;  5IP4 D;  4LTU A;  4F7Z A;  5BYR A;  4MDK E;  1ZDV A;  1OQY A;  2KO3 A;  3NY5 A;  4OZA A;  4IKG A;  1WI0 A;  2IJ0 A;  5DCN A;  3QAQ A;  2K39 A;  1HXY D;  2KMC A;  5IAA C;  5LLI A;  1I42 A;  2KC1 A;  3ZTD A;  3N32 A;  4DXF A;  4L1B A;  5HI1 A;  4HPM B;  5D7G A;  1QOF A;  3ZRC A;  3Q3N C;  1WF9 A;  2IND C;  1N6Z A;  4EOY A;  3JSV A;  2FNJ B;  3IXS A;  2JU6 X;  1FFV A;  5J18 A;  5IOI A;  4HWI B;  2DYM A;  5HFY A;  4NAM A;  2K8B A;  1FNU A;  2KTF A;  1WFY A;  2MP2 A;  4HCP B;  1TKY A;  1YQB A;  2JZ3 B;  3H8H A;  2XEW A;  3GE8 C;  1B9R A;  2J0J A;  4HDO A;  2Z8L A;  5FR3 A;  3I5J C;  3NJT A;  2BS4 B;  3PHW B;  3VDZ A;  1T6B X;  1TS4 A;  2LXC A;  2WXR A;  3NZ3 A;  2K0P A;  2IY0 B;  1TS5 A;  3ML8 A;  4KSL C;  4FHJ A;  1KF6 B;  3B2F A;  4A55 A;  1SE9 A;  2MBO A;  1GNU A;  3A4R A;  2WXM A;  1C79 A;  2ZNV C;  3KYD D;  3OJ4 B;  2BWF A;  2XNA C;  4NZL B;  5E6J A;  5D6J B;  2D3G A;  4DHZ E;  2WXQ A;  3TEZ A;  1MFW A;  4W9H A;  2CHX A;  1UH6 A;  1L5P A;  2MBB B;  3H1U A;  4KV2 A;  2WLB A;  2JX5 A;  4XX5 A;  1IGD A;  3I3T B;  3ZJT A;  4RF1 A;  1C9F A;  3P42 A;  4K7U A;  1WYG A;  1Q0W B;  4B95 A;  1R4N B;  5JXV A;  2DAJ A;  2QIE B;  1XLN A;  3P63 A;  1VRA B;  1FM0 D;  1RWS A;  2N9L A;  1WR1 A;  3P4P B;  1M4V A;  2QCZ A;  1GC7 A;  4OW0 A;  1CJE A;  3ZKJ C;  4LNF A;  4E3C A;  1GUA B;  3KQ4 A;  2KX0 A;  2LHE A;  1J7C A;  3W1S C;  4NJC A;  3N1Z C;  1F1H A;  1LO5 D;  1UNS A;  2LVP A;  1PQS A;  1C4A A;  1XLQ A;  1OQR A;  2N7E A;  4LNN A;  3RNB C;  1D6E C;  3VRA B;  2BYT A;  3WAN A;  3TJP A;  4BKG A;  3V61 A;  1N62 A;  4GXB A;  2V4I B;  2XK5 A;  3IBE A;  2KDE B;  4TMA B;  2ZVO A;  2DZK A;  4RCO A;  5BO4 B;  3UQB A;  3AE6 B;  1C1Y B;  2V4L A;  4OVU A;  4TUU A;  4ZYS A;  1GPX A;  5E6O A;  3TIX A;  1S1Q B;  1ZPS A;  1I35 A;  2FUG 1;  2JVC A;  3CMM B;  1I4G A;  2I1K A;  3DWG C;  1WZ0 A;  5TSS A;  2WX1 A;  4EZJ A;  2JWU A;  1RM6 C;  2W3S A;  2ZCC A;  1OEY J;  3QX1 A;  2IO1 B;  1N63 A;  4KGT A;  1IP9 A;  4MJS A;  2D07 B;  3R7R A;  1ISN A;  3A1Q B;  4KIK B;  2RR9 A;  3U7D A;  1S3S G;  1K8R B;  1WXA A;  3TEW A;  1Z5S B;  2FUH B;  1YJ1 A;  3AE8 B;  1BT0 A;  2ASQ A;  4C7Z A;  4BZA A;  3AE5 B;  3RPF C;  2G45 B;  2M1M A;  5H92 C;  2D3C A;  1HZ5 A;  3DQV A;  2CHW A;  2MWS B;  5J17 A;  1JAL A;  3N9Y C;  1ZP0 B;  1BML C;  1XLO A;  4ASW C;  2R2Q A;  1FRR A;  1RYJ A;  3DBL B;  2AL6 A;  4YSZ B;  5EE1 A;  1QT9 A;  2L00 B;  2VH2 A;  3V6E B;  5BMI A;  2VZK D;  2NVU I;  4HRS A;  1YN5 A;  3FKY A;  4IWO A;  2LGY A;  3KUD B;  4FLH A;  1L0V B;  1HA5 A;  3IVF A;  2KJH B;  2KDF B;  4G11 A;  1BUI C;  3L10 B;  3NRZ A;  3QK0 A;  1V5T A;  4RF0 A;  1MHX A;  1N5X A;  1XQQ A;  2RDH A;  4HRO A;  2N9K A;  4GDK B;  4J6I A;  5AEK B;  2VH1 A;  3BVG A;  1ET6 A;  2OJR A;  1HTO A;  1JWA D;  1XO3 A;  1UGJ A;  3ZNH B;  2KTR B;  2KWC A;  1WJ4 A;  3R66 C;  3QJZ A;  3VH4 B;  2WYQ A;  3NOB A;  5D94 A;  4REZ A;  2MBQ A;  4PS8 A;  2PE6 B;  5EE0 A;  2BGF A;  2N7J A;  2CJN A;  3OG5 A;  3PRP B;  3EGR A;  5IKC M;  1FCL A;  1ZW7 A;  4DBG A;  1NEN B;  2MX2 A;  3VAW A;  4MSQ B;  3PVL A;  3VQI A;  3EFU A;  3LDZ E;  2LJI A;  4IM2 A;  2BYF A;  2IGD A;  1FD6 A;  3ZIM A;  4KKI A;  1DOX A;  1V1P B;  4LJP B;  4KKJ A;  5EDS A;  2VRR B;  5AZH A;  2X8X X;  3AN1 A;  1SXT A;  1J0G A;  1E6E B;  1YN3 A;  4LNK A;  3URY A;  1K50 A;  2HJ1 A;  3CIR B;  4X57 B;  5C1Z A;  1WGD A;  4GLS C;  2QMT A;  1ZUD 2;  2O6V B;  2JWZ A;  4GIV A;  3RYT A;  1AN8 A;  4S17 A;  4L23 A;  3U8Z A;  2DX5 B;  1NYQ A;  4LNO A;  2K6Q A;  4ZHO A;  4IDI A;  5EE3 A;  2D3B A;  3TSS A;  2H89 B;  4IM3 A;  1JML A;  3ETR A;  4FBJ B;  2WDV B;  4RM9 A;  2KMM A;  4HLE A;  4DK5 A;  3EEC A;  3L4P A;  3PZ7 A;  2N7D A;  3LYY A;  1Q1O A;  2LGI A;  2EMT A;  1VCB A;  4MAC A;  2CU3 A;  1C76 A;  1NYR A;  4IWQ A;  3SFD B;  3AV8 A;  2UYZ B;  3A1Q A;  4BKS D;  3M62 B;  3T3N A;  4P1B C;  1GC6 A;  1K51 A;  2IDY A;  2K8H A;  2YLM A;  3PHX B;  3ZDM C;  3FAH A;  1EO6 A;  3TL5 A;  4FUL A;  3B1L X;  2GB1 A;  1T0Y A;  2NTS A;  5CX3 A;  4BOS C;  1UGM A;  4ANW A;  4LDT D;  1LGR A;  3KUC B;  2WDQ B;  1ZXI A;  4FJV B;  1SEB D;  1A70 A;  4HKZ E;  3WAP A;  1Q10 A;  3W9C B;  2G4D B;  3SD5 A;  2RD0 A;  1YMH E;  2FE8 A;  1SB3 C;  2MRP A;  2Z0D B;  1XD3 B;  2V3N A;  1DOI A;  1I7H A;  4ZRJ A;  4II3 B;  2LGS A;  1FO4 A;  4WWM A;  3IAM 1;  4WQM A;  4K3C A;  3K9O B;  4B0E A;  4NPN A;  1EUV B;  2WGS A;  1H8C A;  3L13 A;  2K3U A;  1I4R A;  2WXI A;  3B0A A;  2KTR A;  1TKE A;  2WU5 B;  3BK2 A;  1UZX B;  4JL9 A;  1MHH E;  3IT4 B;  3T3O A;  2V3S A;  2ZJD A;  1L6U A;  4W9C A;  3WIM A;  2WXN A;  1XF5 L;  1UWM A;  3AEB B;  3AE4 B;  3KW5 B;  2LRW A;  1QZE A;  1F0Z A;  4DHJ B;  1JRP A;  4FAD A;  1JWS D;  2D2Q A;  5CHW A;  1V1P A;  4N6E B;  2JYE A;  4RNA A;  4MGY E;  4MSM B;  4F1S A;  4TQ0 A;  2MJ3 A;  3B08 A;  5KHO A;  3ZTC A;  3KH0 A;  1FXT B;  3SU8 X;  3PLU A;  4G0N B;  2FIF A;  3FC4 A;  4ANV A;  3VR9 B;  3BWU D;  1V5O A;  3EHV A;  3I57 A;  3NZU A;  2PVG C;  1ESF A;  2C7M B;  2IGG A;  2Z0E B;  2JSV X;  1WRD B;  3BK1 A;  4GN1 A;  3DWM A;  3EC8 A;  3U30 A;  2AQ1 B;  4CHK A;  4A6Q A;  1OGW A;  1JWU D;  1P7E A;  3MTN B;  2KT7 A;  1WSP A;  3Q3M C;  1KFY B;  4KVG B;  1T5X D;  3N1Y C;  4N58 A;  1WM3 A;  4C4V A;  3VXW A;  4W9D A;  3K9P B;  4XGA B;  1ENF A;  3CWI A;  2M4N A;  3VTV A;  3MC8 A;  1YJI A;  4HK2 A;  3MP9 A;  2K9X A;  4PT5 A;  5JZE B;  4ICU A;  2KN5 A;  1ZDX A;  1CMX B;  1E7U A;  4FN2 A;  4US9 A;  3VUX A;  4P7I A;  1P0R A;  1Y56 A;  2XK5 B;  3C19 A;  4K81 A;  4KX6 B;  2INN E;  3AUL A;  3PRZ A;  2K25 A;  2KHW B;  4EKU A;  4XZ4 A;  2Y3A A;  1WZ3 A;  1T3Q A;  2KQ7 A;  2BVC A;  1KLG D;  1YNT E;  2KYW A;  4ZDV A;  2CS4 A;  3VUY A;  3ALB A;  1SIJ A;  1E10 A;  5JHA A;  2J52 A;  2JPH A;  3J9C A;  3NHE B;  3CF6 E;  2K8C A;  2LGD A;  1CK1 A;  4WIP A;  4IWP A;  1EWC A;  3M3J A;  4AUQ C;  3V05 A;  3R8B A;  4I6L B;  1WGR A;  2WXP A;  3I9V 1;  4MJS B;  3DBH I;  1R7S A;  3IG3 A;  2IZV B;  2IPK D;  4W9G A;  4ARI A;  4DHZ B;  4NJ7 A;  1PFD A;  2D10 A;  3AMZ A;  2DBY A;  4IM0 A;  4JE3 B;  1HTQ A;  1YQ4 B;  2WXH A;  2LHD A;  4OZC A;  2PE9 A;  1V97 A;  1XXG A;  2V9H A;  5D2M B;  1E8Y A;  2G4S A;  2MH7 A;  2AX5 A;  3GE3 C;  3N3K B;  5DPS A;  1RRB A;  4EFO A;  3QQ8 B;  5HHD G;  1FFU A;  2IGH A;  3AEG B;  3DCG A;  3CSF A;  2WXL A;  5BYQ A;  4WWP A;  2I1J A;  5G2N A;  2WXG A;  3T8M A;  5HG2 A;  2KC2 A;  3U4E G;  4CO7 A;  1WH3 A;  2KFJ A;  4I6P A;  1L4D B;  2MQJ A;  2DWQ A;  2HDE A;  3ENE A;  4FJZ A;  3Q3F A;  4AP4 C;  2BTE A;  2HD5 B;  2HE7 A;  4KDI C;  2FCM A;  4M01 A;  3LJ3 A;  3JYU A;  5BMG A;  3BVM A;  4M02 A;  1J7A A;  3PLV A;  3U52 E;  1VR9 A;  4W9F A;  4MH8 A;  1KTK A;  2KN4 A;  3QA8 A;  4KDL B;  1YD8 U;  2JZZ A;  1LXD A;  2KXJ A;  1ZE3 D;  4HVB A;  3KYC D;  3TUO A;  3RFZ B;  2ZW0 A;  1YOV B;  4P16 A;  2BKR B;  4OHJ A;  3GZN I;  4ICV A;  3IFW B;  3V62 A;  1IPG A;  3PZD A;  3DBR I;  3APD A;  2K5P A;  3P1M A;  1FMA D;  4BKT A;  3M63 B;  1ZKH A;  2GOW A;  3GP7 A;  3SHQ A;  3APF A;  2XBB C;  4B6W A;  4ACF A;  2M17 A;  5IA7 A;  1VJK A;  1ET9 A;  4YL8 A;  5AUK A;  1SJH D;  3UIO B;  2PW9 A;  2NMQ A;  4MGK E;  3AH7 A;  2NPT A;  2FCN A;  4RFB A;  4KSK C;  4JPS A;  4R3D A;  3EA6 A;  2L3Z A;  2KNB A;  2NBV B;  2FAZ A;  4HDQ A;  1L2N A;  3HUI A;  3PO0 A;  1GOZ A;  3VUW A;  3DDC B;  3RZF A;  1PUT A;  3N20 C;  1WXS A;  1C4C A;  4FXC A;  2IYD B;  4NNJ B;  5AZG A;  4HPP A;  1TTN A;  2CU1 A;  4FA6 A;  2C9W B;  2L76 A;  3VR8 B;  3NVZ A;  1JW9 D;  3VRB B;  3ZYY X;  5C3J B;  2FBW B;  3ML9 A;  2J0K A;  2JRI B;  3L17 A;  4AJW A;  2Y5B B;  4PS7 A;  1LQB A;  2M56 B;  2KDI A;  1I4P A;  2WXJ A;  3T9L A;  3AED B;  4IC7 B;  1OEY A;  2GI9 A;  3E9S A;  2LD9 A;  1WGH A;  3PPA A;  3N1X C;  3Q2A C;  4WWO A;  1WX7 A;  3KLS X;  1WGY A;  4NQL B;  5J2R A;  2ZEQ A;  1T0R C;  3ZRF A;  1J19 A;  1TY2 A;  1SF0 A;  3UF8 A;  2LFI A;  4YTP B;  1WJ6 A;  3VTU A;  3L16 A;  4C80 A;  2BQQ A;  1SJE D;  2LZ6 A;  3MC0 B;  3R2I A;  1EF5 A;  3OAW A;  2NCN A;  3LB8 C;  2BT6 A;  3V3X A;  2IO3 B;  4AJY B;  2NBW B;  1PGX A;  3ZW3 A;  2MHJ A;  4QAY A;  2DZI A;  1STE A;  1VD2 A;  1VLB A;  2QJL A;  4II2 B;  1SBB B;  1NI2 A;  4BAX A;  3U2S C;  2A4Z A;  2ZZP B;  2EKI A;  3AU5 A;  3QIJ A;  1LFD A;  2PMV A;  1UUP A;  2D3A A;  1F2R C;  2M8S A;  2O6V D;  3BZD B;  1WX9 A;  2KAC A;  5BYS A;  1K53 A;  4ZYN A;  3BVZ A;  3GB1 A;  1E90 A;  1F9J A;  2NS5 A;  1MG4 A;  1TS2 A;  1VZ6 A;  5AZF A;  1WGK A;  4YT0 B;  3RUL A;  2KQ4 X;  2KVR A;  1V9J A;  4ZHP A;  5LXI B;  1D3Z A;  2KFK B;  4L2Y A;  1XCT L;  1QOG A;  3P4Q B;  2Y5P A;  1K52 A;  2KJR A;  2AYO B;  1PYW D;  2KWV B;  1WRI A;  1Q5W B;  2WXO A;  3PGE A;  3O13 A;  2CJO A;  4JX1 C;  3TMP B;  3RCZ A;  4WH4 A;  1X1M A;  3VH3 B;  2H88 B;  3AE3 B;  1AWD A;  1C3T A;  3MC9 A;  2B3A A;  3ZJV A;  5C2T B;  2LXA A;  3RNF C;  4JQW C;  4RMA A;  2RDG A;  4C00 A;  5G55 A;  3P4R B;  2QEJ C;  5D3I B;  1N61 A;  4EEW A;  4JLC A;  4C4V B;  2BF8 B;  2KKC A;  2M19 A;  2ZPY A;  3AEE B;  4M8N A;  2ZNV B;  1C78 A;  1R4N I;  4GDL B;  2NBU A;  3AEF B;  1ZOY B;  4C7Y A;  2BB6 A;  4ITK A;  4RGO S;  1L6V A;  2JRH A;  3RNA C;  2DHZ A;  1FNW A;  2GRI A;  2XN9 C;  3L0W B;  4GU2 A;  4W9L A;  2LUE A;  4HJK A;  3H7P B;  2HTH A;  2JXT A;  1TS3 A;  2D11 A;  3PS6 A;  4TSS A;  3VTW A;  3P4S B;  3B9J A;  4BVU C;  4NY0 A;  2DEN B;  1XCQ L;  3ZNI D;  4E71 A;  2LJ5 A;  2J7Q B;  3EUB 2;  2ON8 A;  2LVO A;  2ZPN A;  2LVQ A;  4WWN A;  1H4R A;  2MEK A;  2V1Y A;  4USA A;  4EE2 A;  4RM8 A;  2BWE S;  1V80 A;  3BYT B;  2DZJ A;  3DHI C;  3L54 A;  4XWT A;  2UU7 A;  4J3O D;  3H7S A;  1QF6 A;  4DHJ D;  4RGN A;  1U4A A;  5AUI A;  5CHV C;  1V86 A;  2OJW A;  4OVV A;  2ZW1 A;  2N0S B;  2Z59 B;  1B1Z A;  1D4B A;  1P1A A;  1PGB A;  2NTT A;  4MGZ E;  4A8X C;  4OZB A;  4WAA A;  4E74 A;  4GOC A;  2D5G A;  2LGX A;  3DBR B;  1NEK B;  3AB5 A;  3A9J B;  5H8Y E;  4EZL A;  1RFA A;  3BII D;  5HKH A;  3WA0 A;  3ZDT A;  3DPD A;  2PEA A;  1AAR A;  3HVZ A;  3AM9 A;  1J7B A;  2A5U A;  4NAW B;  1AYF A;  2KFK A;  4BBN F;  4ZRQ A;  1GAQ B;  3W5U B;  4ANU A;  2LUM A;  2BW2 A;  2PJH A;  3UQA A;  5IN7 A;  2PIA A;  1E8W A;  4ANX A;  3NUH B;  1TGZ B;  2N1W A;  2LRU A;  1TT5 B;  2ACZ B;  5FK9 C;  1P7F A;  1FIQ A;  3WAM A;  2M0X A;  2JZP A;  4XC2 A;  1QKZ A;  1P98 A;  4IG7 B;  3UIN B;  2GBM A;  3W1Y A;  1I4H A;  2JXX A;  3OWE B;  4M0W B;  4BFR A;  3H9D A;  5FR6 A;  3BYY B;  4ZRP A;  1MI0 A;  4MM3 A;  2HTM E;  4ZOH C;  2GMI C;  2L0T A;  3D32 A;  1TYG B;  2N9X A;  3R7Q A;  2KLC A;  2L7R A;  2INC C;  2K22 A;  4GDL A;  2KQS A;  1CQV A;  1UBQ A;  3OLM D;  4P1C C;  4WUR A;  1FPY A;  4W9I A;  3CST A;  1MPE A;  2DZM A;  1Y8R C;  1F52 A;  3N30 A;  3TBL D;  4KZ0 A;  3RT3 B;  2NPT B;  2K1F A;  1JWM D;  2QDF A;  4YSY B;  1ZXH A;  3RNC C;  2LMC A;  4MH0 E;  4URK A;  4C56 C;  3ZXR A;  3H7P A;  3Q8E A;  4XWW A;  4JGH B;  3MHS D;  4DQO C;  3HM3 A;  3RNG C;  1KRH A;  4B9K A;  2E6X A;  2WXF A;  4GMV A;  3TEY A;  3HVD A;  3P2B A;  1D5Z C;  2R2O A;  1WWT A;  1E8X A;  1V8C A;  2LAS A;  3Q14 C;  2PKO A;  3QWZ B;  4A3O A;  2C60 A;  1QLB B;  2C5L C;  2J42 A;  2GBK A;  2JUO A;  1UWX A;  3Q8B A;  2W82 A;  4AOF A;  4W9E A;  1QOA A;  1E7P B;  5E6N A;  1WIA A;  2MCN B;  4BOZ B;  4N59 A;  3RN9 C;  2E3T A;  4XE0 A;  2PTL A;  1HQR D;  1L7Y A;  2WDT B;  1YJJ A;  3W1S A;  4Q2J A;  3VFK A;  3ZGZ A;  4BKS A;  4DWF A;  4HEA 1;  2EMS A;  2FCS A;  2GBR A;  2RMM A;  4O1N A;  1IYF A;  1WYW B;  5JHB A;  1C77 A;  2GLS A;  2JT4 B;  1WE6 A;  2KD0 A;  4PYU A;  3A9J A;  2ONQ A;  3ZNG C;  4LCD E;  1I4Q A;  4RGT A;  1CZP A;  2EEL A;  4RGM A;  1I4X A;  1OTR B;  3A33 B;  4NAW A;  2PLP A;  2L8J A;  1RLF A;  2QC8 A;  3Q69 A;  2WP9 B;  3JVZ X;  2KLG A;  3PRM B;  1A5R A;  1FRD A;  1F77 A;  3ECI A;  2LWP A;  3AXC A;  3IHP C;  1SSN A;  1TZ1 A;  5GXG B;  4PK1 A;  3LXF A;  1YX6 B;  3NZS A;  3ABV B;  2C7H A;  2WWZ A;  1PDX A;  4YWG G;  2B76 B;  2O2V B;  3PRE A;  4K7S A;  2MA9 B;  3U7Z A;  1YQ3 B;  3NG0 A;  1XT9 B;  3PSE B;  4M00 A;  2WX0 A;  2JYT A;  3NS1 A;  3X0W A;  1WMH A;  1WR6 E;  1WE7 A;  4M0W A;  2WHI A;  2KDB A;  3KWL A;  3KWV A;  1SE4 A;  4MEM A;  2MSE D;  2QIL A;  3W5V B;  4US8 A;  1EWY C;  3RZW C;  2I2Y A;  1QQR A;  4GB9 A;  2BS3 B;  1ROE A;  2KWD A;  1JCK B;  2OOB B;  3UI3 A;  3I63 C;  4IUM B;  1IBX A;  1VZ8 A;  1R4M I;  2RDB C;  5EE9 A;  3EFC A;  3FIL B;  3UIP B;  4KGS A;  1TBE A;  3KUZ A;  5DPW A;  3DVG Y;  4NJ6 A;  1N60 A;  1PGA A;  2AEH A;  1NDD A;  4AS1 A;  2G9H D;  2J4X A;  2C7N B;  2SAK A;  4HJG E;  2KZR A;  4LK0 M;  2YEP F;  3UGB B;  3BIN A;  1WY8 A;  1EF1 A;  2AL3 A;  3ZQ4 A;  3H6N A;  3SDL C;  3ZLZ A;  1EU3 A;  2LEK A;  1WJU A;  2OED A;  3ZVV A;  1ZGU B;  5JH5 C;  1P3Q U;  4ARC A;  3A4S C;  3TEX A;  5FKA C;  4XYC A;  2RGF A;  2G3Q B;  1L0X B;  1L4Z B;  4MT5 A;  2KVZ A;  2K6D B;  4RH6 A;  1MVK A;  1XLP A;  1LM8 B;  2YEP B;  2EKE C;  2BYE A;  3MHZ A;  3DBS A;  3MJ5 A;  3Q8C A;  2MJD A;  1YIW A;  4YSX B;  2V3P A;  2NR2 A;  4LNI A;  2X38 A;  1NBF C;  3AEC B;  4PYZ A;  5DPT A;  4AQ7 A;  1V2Y A;  3R3M A;  3V60 A;  3RNE C;  4B0M A;  1TJE A;  2DYB A;  4AWJ A;  1GJZ A;  2J53 A;  2JY6 A;  4LJO B;  2DAF A;  2L32 A;  4BBN C;  4DDI D;  3L08 A;  3HK0 A;  2PVO D;  3HRD D;  4WAF A;  2KK8 A;  2L1A A;  1FXA A;  1JQ4 A;  4F8C B;  1F2R I;  3GS2 A;  1FXI A;  3SR6 A;  3PT2 B;  4K7W A;  2DYO A;  1RAX A;  1RFK A;  2BBC A;  4TV3 A;  3ZUN A;  4P6V F;  4UDU C;  2UWQ A;  1QOB A;  2LI5 A;  1YN4 A;  3AI5 A;  3HHM A;  2Y5C A;  1E9M A;  1KLU D;  4TQ1 A;  4EZK A;  2JF5 A;  5TR5 A;  2WXK A;  2O2V A;  4YXD B;  2MBH A;  1UEL A;  3AE1 B;  1Z2M A;  4PS3 A;  4FHK A;  2R61 A;  1J8C A;  4HXD A;  1UBI A;  2CR5 A;  4JWS C;  2MW5 A;  4OVZ A;  2QSD A;  2VZK B;  1V49 A;  1QIL A;  4ZRK A;  4XDD A;  2KDM A;  1IGC A;  5I4D A;  1E8Z A;  4MGI E;  5D3D A;  3AE7 B;  4TKN A;  5LNK 1;  4A3P A;  3O65 B;  3QCA A;  4WQO B;  2W9N A;  2MLB A;  2KJ6 A;  2FCQ A;  3PV1 A;  1WXQ A;  3FIL A;  1VZ7 A;  4W9K A;  1OFF A;  4EUT A;  1HZ6 A;  2M0A A;  2YVC A;  2KAJ A;  2WS3 B;  3QAR A;  1GG3 A;  1FEH A;  1BXT A;  1TY0 A;  1SIF A;  3A9K B;  2WNM A;  4MM3 B;  4K1R B;  2N4F A;  1HEZ E;  3GOE A;  2AQ2 B;  3IT6 B;  3Q8A A;  1DGJ A;  3DHH C;  2RSU A;  4D2K A;  2W3R A;  3DBH B;  3C0R B;  5GMV A;  3ZJU A;  1MJD A;  2BYV E;  2RPV A; 
#chains in the Genus database with same CATH homology
 3TEW A;  2JZP A;  1GB1 A;  2WU2 B;  3NVV A;  1QKZ A;  3NVY A;  3AE8 B;  5HG2 A;  3U4E G;  1E0Z A;  4C7Z A;  3AE5 B;  1I4H A;  3RPF C;  1FNV A;  5H92 C;  1L4D B;  1HZ5 A;  2DWQ A;  2WDR B;  3MFG A;  3OWE B;  2HDE A;  1JAL A;  3AEA B;  3BYY B;  3N9Y C;  4ZRP A;  1ZP0 B;  1MI0 A;  2BTE A;  1BML C;  1AW7 A;  1XLO A;  2HTM E;  1FRR A;  1RYJ A;  2V0G A;  1OQQ A;  4YSZ B;  1EU4 A;  4ZOH C;  5BMG A;  5EE1 A;  1QT9 A;  1JRO A;  3BVM A;  5BMI A;  2VZK D;  3PZ8 A;  4HRS A;  1TYG B;  1J7A A;  1YN5 A;  3U52 E;  1VR9 A;  3NVW A;  1TZO A;  2K22 A;  4MH8 A;  1KTK A;  2KN4 A;  5BMH A;  1CQV A;  4IOI E;  1L0V B;  4H2A A;  1HA5 A;  1ZE3 D;  4WUR A;  1MPE A;  3TUO A;  1VDV A;  1KH0 A;  3RFZ B;  2ZW0 A;  1BUI C;  3NRZ A;  1SE2 A;  4P16 A;  1JWM D;  4OHJ A;  4YSY B;  2AQ3 B;  1ZXH A;  2L83 A;  1MHX A;  2LMC A;  1L0Y B;  1N5X A;  2RDH A;  4KGR A;  4RF0 A;  4HRO A;  4C56 C;  2N9K A;  4GDK B;  3Q8E A;  2K5P A;  3P1M A;  4XWW A;  4DQO C;  3B2G A;  4CQN A;  1FMA D;  3BVG A;  1ET6 A;  1KRH A;  2L52 A;  1JWA D;  2E6X A;  1XO3 A;  1UGJ A;  2WXF A;  1SE3 A;  3R2T A;  3TEY A;  3HVD A;  1ACC A;  3Q8F A;  1D5Z C;  4REZ A;  3GP7 A;  1NVI D;  1WWT A;  3W2D A;  3WCQ A;  1V8C A;  1VJK A;  5EE0 A;  1ET9 A;  2N7J A;  2CJN A;  2PKO A;  2DLB A;  3EGR A;  1QLB B;  5AUK A;  1SJH D;  1FCL A;  2PW9 A;  2J42 A;  1XEE A;  2NMQ A;  3E56 A;  1NEN B;  1UWX A;  3AH7 A;  3Q8B A;  3VQI A;  4RFB A;  2W82 A;  4JPS A;  4R3D A;  3EA6 A;  2TSS A;  2LJI A;  1QOA A;  1E7P B;  4JWU C;  2IGD A;  1FD6 A;  2SEB D;  4KKI A;  3HUI A;  3PO0 A;  1GOZ A;  4HKQ A;  5MPO A;  2W54 A;  1DOX A;  1V1P B;  4DXG A;  4KKJ A;  4N59 A;  1PUT A;  2RPV A;  3AE2 B;  4XE0 A;  2PTL A;  1HQR D;  3AN1 A;  1SXT A;  2Q5W D;  3W1S A;  1YJJ A;  4Q2J A;  1E6E B;  1YN3 A;  1C4C A;  4FXC A;  3ZGZ A;  1EM7 A;  3URY A;  5G5G A;  1K50 A;  4HEA 1;  4XDC A;  4A90 A;  2BS2 B;  3CIR B;  2RMM A;  2BB5 A;  4GLS C;  1TKG A;  2QMT A;  1ZUD 2;  3SFE B;  3VR8 B;  3NVZ A;  4O1N A;  1JW9 D;  3VRB B;  1C77 A;  1AN8 A;  1N5W A;  3ZYY X;  1DYQ A;  4L23 A;  5C3J B;  2FBW B;  1NYQ A;  1DOY A;  4LLG M;  2WXG A;  4ZHO A;  4IDI A;  2ONQ A;  1D5X C;  5EE3 A;  4A9A A;  2M56 B;  2MJE A;  3TSS A;  1I4P A;  5G5H A;  2WXJ A;  1NI3 A;  1I4Q A;  2H89 B;  4RGT A;  1CZP A;  2JQR B;  3AED B;  2EEL A;  4RGM A;  1I4X A;  1JML A;  3ETR A;  2OHF A;  2GI9 A;  2G1E A;  2PLP A;  2WDV B;  1D5M C;  3C8Y A;  3E9S A;  2KMM A;  3Q69 A;  2WP9 B;  3L4P A;  3PZ7 A;  2I38 A;  3LYY A;  2LGI A;  1FRD A;  3KLS X;  1F77 A;  3AE9 B;  1SSN A;  4MAC A;  5GXG B;  2CU3 A;  1C76 A;  2WQY B;  3LXF A;  1TY2 A;  1NYR A;  1SF0 A;  3ABV B;  3SFD B;  1PDX A;  4YWG G;  3AV8 A;  2LFI A;  2B76 B;  1FCC C;  4YTP B;  1V1O A;  3T3N A;  1IUE A;  2W55 A;  1GB4 A;  4C80 A;  1K51 A;  1SJE D;  3MC0 B;  3U7Z A;  1YQ3 B;  2IDY A;  3R2I A;  1IBX B;  4YTM B;  2INP E;  1JWB D;  3LB8 C;  4YTN B;  3FAH A;  2BT6 A;  2JYT A;  3NS1 A;  3V3X A;  1C4P A;  3SEB A;  1PGX A;  4M0W A;  2GB1 A;  2NTS A;  3KWL A;  5T8I A;  3IAS 1;  2ICI A;  1SE4 A;  3KWV A;  1STE A;  2QIL A;  1VLB A;  3W5V B;  4US8 A;  1EWY C;  2QJL A;  2I2Y A;  1QQR A;  1SBB B;  2WDQ B;  1ZXI A;  1SEB D;  1A70 A;  4LTU A;  2BS3 B;  4HKZ E;  5BYR A;  3U2S C;  1ROE A;  2EKI A;  1Q10 A;  1JCK B;  2KWD A;  1ZDV A;  3UI3 A;  3W9C B;  2PMV A;  1UUP A;  4OZA A;  4IKG A;  1F2R C;  2IJ0 A;  1YMH E;  2FE8 A;  3BZD B;  1IBX A;  1VZ8 A;  2KAC A;  1HXY D;  1SB3 C;  5BYS A;  1K53 A;  5EE9 A;  2V3N A;  1DOI A;  1I7H A;  3FIL B;  4KGS A;  4DXF A;  4L1B A;  5HI1 A;  5D7G A;  1QOF A;  3BVZ A;  3GB1 A;  1FO4 A;  4WWM A;  1TS2 A;  1VZ6 A;  1N60 A;  3IAM 1;  4WQM A;  1WGK A;  3IXS A;  1PGA A;  1FFV A;  2JU6 X;  4B0E A;  4YT0 B;  2KQ4 X;  4AS1 A;  4ZHP A;  2G9H D;  1XCT L;  4L2Y A;  2J4X A;  1QOG A;  3P4Q B;  2Y5P A;  1K52 A;  2DYM A;  2K3U A;  5HFY A;  4NAM A;  1I4R A;  2SAK A;  2WXI A;  4HJG E;  4LK0 M;  1PYW D;  2YEP F;  1TKE A;  2WU5 B;  1WRI A;  3BK2 A;  1FNU A;  2WXO A;  3O13 A;  2CJO A;  4JX1 C;  4WH4 A;  1TKY A;  2H88 B;  3ZQ4 A;  3H8H A;  1MHH E;  3IT4 B;  3T3O A;  3AE3 B;  1EU3 A;  1L6U A;  2LEK A;  1AWD A;  1B9R A;  2OED A;  2WXN A;  1XF5 L;  1UWM A;  2Z8L A;  3AEB B;  5FR3 A;  3ZJV A;  3AE4 B;  4ARC A;  5C2T B;  3TEX A;  5FKA C;  2BS4 B;  1F0Z A;  1T6B X;  1TS4 A;  1L0X B;  1L4Z B;  1JRP A;  4MT5 A;  2WXR A;  3NZ3 A;  2K0P A;  4RH6 A;  2RDG A;  1MVK A;  1XLP A;  1TS5 A;  1JWS D;  1V1P A;  4N6E B;  2YEP B;  2JYE A;  4RNA A;  1KF6 B;  4TQ0 A;  3MHZ A;  3MJ5 A;  3B2F A;  3Q8C A;  4A55 A;  2MJ3 A;  3P4R B;  2MJD A;  2QEJ C;  4YSX B;  2V3P A;  5D3I B;  1N61 A;  2WXM A;  1C79 A;  2X38 A;  3AEC B;  4AQ7 A;  3FC4 A;  2M19 A;  3AEE B;  3VR9 B;  3BWU D;  2XNA C;  4NZL B;  5E6J A;  4B0M A;  1C78 A;  1TJE A;  3I57 A;  2WXQ A;  4GDL B;  2J53 A;  2PVG C;  3TEZ A;  2L32 A;  1ESF A;  3AEF B;  2IGG A;  1ZOY B;  2PVO D;  2BB6 A;  2JSV X;  3HRD D;  4C7Y A;  4WAF A;  3BK1 A;  3DWM A;  1L5P A;  4ITK A;  4RGO S;  1L6V A;  2AQ1 B;  2WLB A;  4A6Q A;  1FNW A;  2L1A A;  1JWU D;  2GRI A;  2XN9 C;  1P7E A;  2JX5 A;  1WSP A;  1IGD A;  1FXA A;  1TS3 A;  2JXT A;  1JQ4 A;  3ZJT A;  1F2R I;  4TSS A;  4RF1 A;  1KFY B;  3GS2 A;  1FXI A;  1T5X D;  3B9J A;  3P4S B;  4N58 A;  3SR6 A;  1C9F A;  2DYO A;  1XCQ L;  3P42 A;  1RFK A;  2BBC A;  1WYG A;  4P6V F;  4UDU C;  5JXV A;  3EUB 2;  2ON8 A;  1ENF A;  2QIE B;  1QOB A;  3CWI A;  1XLN A;  3P63 A;  1VRA B;  1YN4 A;  2Y5C A;  1E9M A;  1KLU D;  4TQ1 A;  1FM0 D;  1YJI A;  1RWS A;  3MP9 A;  2MEK A;  2K9X A;  2N9L A;  4PT5 A;  2WXK A;  3P4P B;  1M4V A;  4USA A;  4EE2 A;  1ZDX A;  4YXD B;  4OW0 A;  1CJE A;  4US9 A;  3AE1 B;  3BYT B;  3KQ4 A;  1Y56 A;  4KX6 B;  2R61 A;  2INN E;  2LHE A;  1J7C A;  4XWT A;  4J3O D;  4JWS C;  4NJC A;  2Y3A A;  1T3Q A;  4OVZ A;  1QF6 A;  2QSD A;  2VZK B;  4RGN A;  1LO5 D;  5AUI A;  1UNS A;  1KLG D;  1QIL A;  1YNT E;  4XDD A;  1C4A A;  1XLQ A;  2KDM A;  1IGC A;  1OQR A;  1SIJ A;  5I4D A;  1E10 A;  1D6E C;  2ZW1 A;  3VRA B;  2J52 A;  2BYT A;  3J9C A;  5D3D A;  2N0S B;  3AE7 B;  1CK1 A;  5LNK 1;  1B1Z A;  4WIP A;  1D4B A;  1EWC A;  1PGB A;  2NTT A;  3V05 A;  3R8B A;  2WXP A;  3I9V 1;  4OZB A;  4A8X C;  1N62 A;  1R7S A;  4ARI A;  2D5G A;  2IPK D;  1NEK B;  3AB5 A;  1PFD A;  2V4I B;  3AMZ A;  2DBY A;  4JE3 B;  5H8Y E;  1WXQ A;  3FIL A;  1VZ7 A;  3BII D;  1YQ4 B;  2WXH A;  4TMA B;  2LHD A;  1OFF A;  1HZ6 A;  4OZC A;  4RCO A;  2M0A A;  3HVZ A;  1V97 A;  2KAJ A;  2WS3 B;  1XXG A;  1FEH A;  3AM9 A;  1J7B A;  3AE6 B;  1BXT A;  4NAW B;  2MH7 A;  4ZYS A;  1AYF A;  2AX5 A;  1GPX A;  1TY0 A;  1ZPS A;  2FUG 1;  4ZRQ A;  1GAQ B;  1I4G A;  3W5U B;  2WNM A;  2LUM A;  4MM3 B;  2BW2 A;  3DWG C;  1HEZ E;  5TSS A;  2AQ2 B;  5HHD G;  1FFU A;  3IT6 B;  3Q8A A;  1DGJ A;  1RM6 C;  2JWU A;  2PIA A;  2IGH A;  2W3S A;  3AEG B;  3NUH B;  4D2K A;  2W3R A;  2WXL A;  1N63 A;  4KGT A;  2ACZ B;  5BYQ A;  3ZJU A;  5FK9 C;  1P7F A;  1FIQ A;  2E3T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...