2MHJA

Solution structure of tpsb4 n-terminal potra domain from pseudomonas aeruginosa
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
95
structure length
95
Chain Sequence
MAHHHHHHVDDDDKMGGPTVLVKRFQLSGNRQFDDRRLLALLHDLPGQELNLSQLHAAAARIGDFYQEKGYVLARAFLPAQEIQDGTVRIEVLEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords TpsB4 protein
publication title Structure-function analysis reveals that the Pseudomonas aeruginosa Tps4 two-partner secretion system is involved in CupB5 translocation.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 24
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2013-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08479 POTRA_2 POTRA domain, ShlB-type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.310 Alpha Beta Roll Ubiquitin-like (UB roll) membrane protein fhac 2mhjA00
3OG5A 2QDFA 3EFCA 4C4VA 4BZAA 4PK1A 4QAYA 3MC9A 2VH2A 2QCZA 4C00A 2VH1A 2V9HA 3MC8A 4K3BA 2MHJA 4C4VB 3Q6BA 3NJTA 2X8XX 4XGAB 4K3CA
chains in the Genus database with same CATH superfamily
2OJWA 1V6EA 3KLSX 1A5RA 2LZ6A 1ZXIA 1IGCA 4B0EA 2INPE 4RM8A 3VH4B 4G50A 1WR1A 3VVWB 2W3SA 1R4NB 4NZLB 3W1SA 3ZXRA 1XQQA 3BVGA 2ZNVB 3NZUA 2EKIA 4W9IA 2ICIA 2RGFA 2RDBC 1R7SA 5D3DA 2N4FA 3NVZA 1P3QU 1V81A 4LNOA 1C1YB 5C1ZA 2GOWA 1VLBA 4W9LA 3ZTDA 3DCGA 4ITKA 4HPLB 2N9LA 2PKOA 2R61A 1DOYA 5LLIA 1OQYA 4DHJB 4P7IA 1I4PA 4REZA 2HE7A 1UNSA 4USAA 4PYUA 1C3TA 3B1LX 1ZGUB 2LHEA 5JZEB 2DHZA 4WAFA 3DBLI 1EU4A 3QC8B 2GBKA 2HD5B 4ZOHC 3VAWA 2DZKA 2K25A 1L7YA 4CYEA 4LDTD 1Y56A 4EEWA 4HK2A 1EUVB 1TZ1A 2WXNA 5IA7A 2WDTB 5H92C 1SJHD 1FXIA 3I5JC 3WAMA 1SXTA 2NCNA 1Z2MA 2GBMA 1F52A 2J52A 5CTRC 4IUMB 4WQOB 1Q5WB 3MFGA 2X38A 2WGSA 1J19A 1ZP0B 1BMLC 2HJ8A 3RUIB 3DBHI 1OFFA 3R3MA 4YT0B 1ENFA 2BQQA 1ZOYB 1Q1OA 4WWOA 5BMIA 2K9XA 4I6NB 1QLBB 4MDKE 1C4CA 2LWPA 1WH3A 2MHJA 2IO2B 4GOCA 2JRHA 4TKNA 3ZNHB 2XN9C 3ML9A 1EF5A 3ZW3A 2Q5WD 4HCPB 4ICVA 4W9JA 3A9KA 3AB5A 4LTUA 1TKGA 1I4QA 1RFAA 2PLPA 2WHIA 5D2MB 1V86A 4II2B 4PS7A 3FILA 3W9CB 1TBEA 2ZVNA 3GP7A 4BAXA 3VDZA 2L83A 1JMLA 3PSEB 2MRPA 2DYBA 2BVCA 3V60A 1WFYA 1WGYA 4L23A 2UU7A 1STEA 1UD7A 3A1QB 1FFVA 2FCNA 2C7NB 5DCNA 1FXTB 2MJ3A 2WXMA 3AE2B 4QAYA 5BYQA 1UELA 3PLUA 2GBJA 2KFKB 3TEYA 1SE2A 2V3NA 3ZLZA 2W54A 2L1AA 3N1YC 3DVNV 4IW0A 3O65B 2NVUI 4EFOA 4MACA 2GBNA 1QQRA 4DXAB 3DBHB 3AEFB 4ASWC 3PRMB 2N7DA 4GN1A 5KHQA 4NPNA 2DWQA 1UH6A 5HFYA 3HRDD 3DWGC 1KLVA 3TIXA 1ZKHA 3PT2B 1OTRB 2MH7A 1I35A 4NAWB 1KTKA 3PTFC 3U8ZA 2WQYB 1V80A 4C4VA 3JSVB 4LNKA 3APFA 3PV1A 3P1MA 3UI3A 2DAFA 4DDID 3GOEA 4A20A 3X23A 5AUKA 2G3QB 2QILA 2LRUA 3N20C 2NPTA 3OJ4B 1QILA 1IPGA 1WF9A 2C60A 2O2VB 2QEJC 3RD2A 3B9JA 3DHHC 1C76A 3TL5A 3P4RB 2LXCA 3NZSA 2LVQA 2AX5A 3M95A 3DPDA 3N1XC 3KUDB 5HKHA 3FKYA 5HG2A 2LD9A 2BKRB 3V62A 2YEPF 4E3CA 2N9XA 1NYQA 3SHQA 4JX1C 3QA8A 1E9MA 2NR2A 1WE7A 1J0GA 4XYCA 3QIJA 2PE6B 4AS1A 3Q3MC 3H9DA 5D3IB 1TTNA 1WGRA 2M19A 1PGBA 2V1YA 3MTNB 2WDQB 2D5GA 1QOAA 4ICUA 4US8A 4IM0A 1FPYA 1AW7A 4IOIE 1AARA 3JW0X 1D5XC 4GXBA 1UBQA 3KH0A 5C2TB 3UIPB 3EC8A 4C80A 3ZTCA 3H7PB 1L6VA 1V5OA 3PS6A 2LGXA 2LGIA 1XCQL 4AP4C 2MBQA 3ZNID 2DBYA 1Q10A 1WYWB 4K81A 4EZJA 2NBVB 4FXCA 1WMHA 3VRAB 2KJHB 1L4ZB 1JWBD 3DVNU 3AEBB 1WGKA 3IAM1 4YTNB 1FM0D 2I2YA 1ESFA 3ZUNA 3ECIA 3P63A 3MJWA 2IY0B 4M8NA 4BZAA 4HJGE 1WZ0A 3AN1A 4TQ1A 4DDGD 4K1RB 3W1YA 4XWWA 2N9PC 2KVZA 2C7HA 3VTUA 1F2RI 2IGHA 1T0QC 3NY5A 1C4AA 4FADA 4KZ0A 3GE3C 4YSZB 3MJ5A 2M17A 2KVRA 3AE5B 4ZYSA 1LM8B 3VHTC 2K6QA 1JWUD 2KQSA 1ZE3D 2PPHA 4KGSA 1KJTA 3VXWA 1RYJA 3AE1B 3M63B 5CHFA 2INDC 4GMVA 1MG8A 1OQRA 3P2BA 3APCA 4W9EA 2CKHB 2R2OA 5DPTA 1SIJA 1ISNA 2RD0A 3CSFA 1SB3C 4W9HA 4S17A 4ANWA 3KVFB 2KWVB 3C0RB 1EO6A 2FNJB 2J7QB 2DX5B 2FCMA 2KN5A 3NHEB 1GC6A 1YQ4B 2BWFA 2OJRA 1IBXA 3I3TB 3R7RA 1C79A 2KTRB 3APDA 5BO4B 1XEEA 2WU2B 3AI5A 3K9OB 1RAXA 4KGTA 1DOXA 5DPRA 2KWCA 4WH4A 5G2NA 4IDIA 2LVOA 1RLFA 2KOXA 2KX3A 2D07B 3ZIMA 2WXGA 1CMXB 1ET6A 3PO0A 5FK9C 2BB6A 4L2YA 2CHXA 1F1HA 1NENB 1J7BA 1N5WA 2O6VB 4A3OA 1LXDA 2KD0A 3SD5A 3R8BA 2WXQA 4MJSA 1DOIA 5G5GA 1YJJA 2NBUA 3S2AA 4WAAA 4ZHOA 2NTTA 5LXIB 1WM2A 2VH2A 3ML8A 4KKIA 4MH0E 4K3BA 4FULA 2MBEA 1MPEA 3QK0A 4KDLB 4ZRJA 2D3AA 5FR6A 1WGDA 3BWUD 1E8XA 3M62B 2K8BA 3QARA 2XNAC 2V3SA 2N9EB 3Q8BA 3RNFC 4MGKE 2JF5A 2K8HA 4ZRQA 3AULA 4KSKC 3NG0A 2Y5CA 3AU5A 4GU2A 1OEYA 2IBIB 5BMGA 3NS1A 1SBBB 4J6IA 4MM3B 2W82A 4RFBA 4FJYA 1TKYA 1XXGA 4CO7A 1T0RC 2JZPA 2K1FA 4TQ0A 1ZDXA 3N1ZC 2PJHA 1ZPSA 1SEBD 5AZGA 1K50A 2CHWA 1SGHA 1XF5L 3PZ7A 1V49A 3U30A 2SEBD 5IN7A 4HKZE 2D3CA 2FAZA 2UYZB 3AU4A 3GE8C 4B0MA 5EDSA 5EE1A 2TSSA 1DGJA 3KWLA 3DDCB 2BYVE 4W9DA 2W55A 4G3XB 4A3PA 4C00A 3A4RA 4Q2JA 2FBWB 1TS3A 2RMMA 4DK5A 2JXXA 1VR9A 2HTME 4N6EB 2BKFA 1HXYD 3AE8B 1XLOA 1TS5A 2K3UA 3PHWB 2ZNVC 3HIZA 3L17A 4DXGA 4DBGA 2JXTA 4WJQA 1WJ6A 1E8YA 2NMQA 2I38A 2LGDA 4H2AA 5C23A 1RWSA 4BKSA 1WJ4A 4PT5A 4E74A 1F9JA 5AEKB 1JRUA 2V3PA 1JRPA 2KQ7A 1XLQA 4A6QA 1YIWA 4MGZE 1UWXA 2Z59B 2FUG1 2ZCCA 5HHDG 4W9GA 2WU5B 1E5WA 1TKEA 3T8MA 1YMHE 1AYFA 4HKQA 3BVMA 4HVBA 4ZYNA 4LNFA 5IAAC 3KQ4A 4NJ7A 4C7YA 4EZLA 4RGTA 2BT6A 1YQ3B 2B3AA 3WIMA 2E6XA 4BOZB 5JHAA 1E8WA 2M8SA 4EZKA 4RGMA 3SU8X 5LXHA 3RNCC 3D32A 4K7WA 2NS5A 3LDZE 1KLGD 3W1SC 2ACZB 3V3XA 2L0TA 3MC9A 3DBRI 3A1QA 2KQ4X 2L00B 1T3QA 5D6JB 3VUYA 2L52A 1JWSD 2WXIA 1X1MA 2K5PA 3H1UA 3OG5A 1TJEA 2KFKA 1FCCC 3DVGY 4S0RA 3BYYB 3RZWC 3KYDD 2ON8A 4KVGB 3V6EB 2LGSA 1WGHA 1J8CA 2DLBA 1SJED 2KX0A 5L83A 1MI0A 5L95C 1PGAA 2MWSB 1MHXA 1TT5B 2KC2A 2J0MA 1ACCA 2FE8A 3TSSA 1S3SG 2L8JA 2BW2A 1ZUD2 1K52A 1WXQA 1TIFA 2EMTA 5GXGB 1MJDA 3BVZA 1QKZA 2KO3A 4A8XC 3DBLB 3BZDB 4NAWA 1T0SC 1N60A 3TEXA 1JWAD 1L5PA 5AZFA 2QCZA 1IP9A 1XLPA 3H8HA 3QWZB 2J53A 2MX2A 4G11A 4E71A 3JSVA 1GJZA 3VFKA 1N63A 5D7GA 3PPAA 1K53A 4YSYB 1WXMA 4YL8A 1L2NA 2KXJA 3NVVA 2DZMA 3VR9B 4CHKA 3R2IA 2VRRB 4FN2A 3IAS1 2E3TA 2BPSA 1PQSA 4PS8A 2OEDA 5TSSA 3A9JB 2O2VA 3DBRB 3UQAA 4GDLB 4LNIA 4NNJB 3WALA 3VTVA 1H8CA 2PVOD 3ENEA 5AUIA 3QX1A 3RNGC 1K8RB 3R7QA 2RPQA 2BGFA 1C4PA 4GDKB 1B9RA 2AQ1B 2MQJA 3V6CB 1HA5A 1UZXB 4BVUC 2CU1A 1RFKA 1P7EA 3LXFA 1C77A 4I6PA 4HWIB 2JSVX 2KLGA 3KUZA 3N30A 3H7PA 4G0NB 3VH3B 4DWFA 2IZVB 1HQRD 4GSWA 1F0ZA 3DHGC 3Q2AC 3P4SB 1GB1A 1EWCA 2WXFA 1M4VA 1EF1A 4HLEA 2J42A 3VTWA 4BKTA 3VQIA 3CF6E 2CJOA 4BOSC 2N1VA 2LI5A 2KAJA 2LUEA 1D5MC 4B6WA 3NJTA 2QJLA 4RGNA 2IO0B 3RYTA 1ET9A 2CR5A 3NUHB 1FRRA 3NRZA 3OAWA 3E56A 4WQMA 5G55A 2N9KA 3AE7B 1FMAD 4WWMA 3OJ3A 4CQNA 3IT4B 2K8CA 4DHJD 5FR3A 3QCAA 2Z0EB 3QAQA 3HK0A 4OVVA 2HTHA 2VZKB 1I4HA 2WXPA 3B0AA 1TY2A 4AQ7A 4R3DA 2BYTA 3ZNGC 4ARCA 4ZRIA 4JL9A 2H88B 3NS8A 1SIFA 3LYYA 4RGOS 1N6ZA 2KHWB 2RDGA 2BS3B 3N9YC 1A70A 2L32A 4ZRPA 2MP2B 1VZ8A 2C5LC 4MGIE 2KJRA 3DQVA 1OGWA 4MELA 1E0ZA 1T6BX 1N5XA 3L54A 2WWZA 4MEMA 1IGDA 4BKSD 1IYFA 3VRBB 1ZXHA 2BYFA 3TBLD 2KTRA 1P98A 4TMAB 2KJ6A 2FCQA 5GMVA 3HM6X 2KWDA 4L1BA 2DYOA 3MC0B 2J0JA 4RMAA 3AE6B 2HJ1A 3EGRA 2V0GA 1YQBA 2IYDB 2WDRB 1WX7A 2G4DB 2ZVOA 2O6VA 4RH6A 1BT0A 4NJ6A 2Y3AA 4FLHA 2LUMA 2MSED 4HJKA 4IKGA 1FEHA 3U7ZA 4JE3B 1V2YA 3PZ8A 3VR8B 3J9CA 2JVCA 1YN5A 2DENB 2MBBB 3U4EG 3U2SC 2QHOA 4FBJB 2BYEA 2G1EA 3UQBA 2LJIA 3IHPC 4NY0A 5JH5C 2KANA 4MSMB 3P4PB 2C9WB 5G5HA 1ROEA 2RPVA 2BF8B 1QOGA 1V8CA 2LRWA 3BYTB 2JZ3B 2KLCA 4BBNC 3BIID 1TGZB 1WX9A 5LNK1 4LK0M 5E6PA 2IO3B 2AQ2B 4F1SA 1VRAB 4B9KA 4LDTB 1OQQA 2LGYA 4K3CA 2BWES 4EUTA 1D4BA 2DNFA 5E6JA 5TR5A 2MBHA 2V4LA 3Q3FA 3N32A 4HPMB 4MM3A 2GBRA 3U7DA 1NI2A 1FFUA 1UF0A 4D2KA 2MW5A 2D3GA 1XO3A 4IWPA 4C7ZA 4URKA 1P0RA 3E9SA 1E10A 1NDDA 3PLVA 1U4AA 2J0KA 1FXAA 1EWYC 2ZPNA 3NZ3A 3ABVB 1EM7A 1JROA 5FKAC 5CHWA 2L3ZA 1WX8A 4JLCA 4AUQC 5IO9A 1XCTL 3PZDA 3P4QB 4F7ZA 2MCNB 1OEYJ 5J17A 1LGRA 5EE9A 1TY0A 3RPFC 2L0FA 1VD2A 4DXFA 1T0YA 2OOBB 1WRDB 3N3KB 4W9KA 4BBNF 2WNMA 5IOIA 4KIKB 2KC1A 2KDMA 3AECB 3R2TA 5BYSA 1WSPA 2M4NA 1GB4A 4XDCA 4HEA1 3RULA 3Q3OC 4NJCA 4HCNB 2VH1A 3AE4B 2FIFA 4MSQB 4DQOC 4WJOA 1YN4A 2KYWA 2G9HD 5EE3A 3ZQ4A 3WCQA 3RFZB 1CJEA 1FD6A 3RN9C 3HVDA 1WXSA 2NTSA 1J7AA 1YX6B 4AJYB 3C19A 4M0WB 2CS4A 5I4DA 3A4SC 4RF1A 2KMAA 4NAMA 3ZJTA 4HXDA 4ANUA 4WWNA 2WLBA 3PVLA 4P6VF 3L10B 1WZ3A 3W5VB 1D5ZC 4EKUA 1TS2A 3IXSA 1F77A 2ZEQA 4M00A 3ZJUA 4XZ4A 1VJKA 3ONSA 4WJNA 2IPKD 2XK5B 1DYQA 1T5XD 1N62A 2CHZA 1E7VA 4FA6A 2AL3A 3Q8EA 3H7SA 3VUXA 1GNUA 3WAOA 4WJPA 2BS2B 2C7MB 1L6UA 4OZAA 1XT9B 3EA6A 4PYZA 2MBOA 2XEWA 2NBWB 4JPSA 4NQKE 1HZ5A 1WIAA 5E6NA 3JYUA 3NVYA 3UINB 4MH8A 3FAHA 4YTMB 1KOTA 1WGGA 4P16A 4O1NA 3ZGZA 3LB8C 4GIVA 3LJ3A 2N1WA 1VZ7A 4LJOB 4OZCA 1V1PB 3QJZA 1YNTE 2JYEA 3RZFA 3ZDMC 3CSTA 4ZRKA 2FIDA 5BYRA 2JY6A 4HRSA 2KMMA 3KWVA 2JUOA 2INCC 4TSSA 4I6LB 3RNAC 4KSLC 1JQ4A 3TJPA 4IWOA 1WXVA 1D3ZA 2LFIA 3P42A 1SF0A 2MJEA 3AEEB 1QF6A 1PFDA 4N9F4 3Q3NC 3HHMA 1R4MI 1WM3A 4YXDB 5J2RA 1QZEA 3AEDB 2EKEC 1FO4A 1LQBA 4RF0A 2REXA 3SDLC 2K39A 4P1CC 1PUTA 3CIRB 4KX6B 2G45B 4IWQA 1P1AA 3I9V1 2UWQA 5EE0A 1WXAA 4A9AA 4M8MA 4ANXA 3MHSD 5CHVC 3A9JA 5DPWA 2N7EA 4GDLA 4F8CB 1C9FA 4AOFA 4C56C 4XC2A 1I42A 3W2DA 1NBFC 2WDVB 5JHBA 3CMMB 1KLUD 2Z8LA 1FNWA 2O6VD 4A55A 3SFDB 2JRIB 4OZBA 1E8ZA 4AJWA 2Y5PA 1V5TA 2QMTA 4XX5A 2MA9B 4KKJA 4DHZB 2BB5A 2KDEB 1EU3A 1PYWD 1QOBA 3UGBB 4GDKA 1I7HA 3FC4A 4MT5A 2W9NA 2K6DB 4MGYE 1E6EB 3ZRCA 2KDIA 1R4MB 3I63C 3DBSA 4OHJA 1SE3A 1KM7A 1YX5B 2H89B 4EOYA 4FJZA 2AL6A 1KFYB 2EELA 1NEKB 3ZRFA 2D10A 5H8YE 4YTPB 3HUIA 4YSXB 1V1OA 3B2FA 3ZKJC 3JVZX 1E7PB 3AEAB 1P7FA 2AYOB 3B2GA 1MFWA 3IVFA 2KDBA 1K51A 3AH7A 1HEZE 1UGJA 2X8XX 4LNNA 1JCKB 2JPHA 1FRDA 3B08A 5IKCM 1HE8A 1MHHE 1YJ1A 2M56B 2QDFA 3Q8FA 4AWJA 1B1ZA 3KYCD 3OWEB 5JXVA 3SR6A 1JALA 2BTEA 2DZJA 4W9CA 5AZHA 2YVCA 2WXKA 3AEGB 2AQ3B 2BS4B 3Q6BA 4P1BC 3AM9A 4EE2A 1NYRA 2CU3A 4ZDVA 1TYGB 3KW5B 2JQRB 3ZYYX 2YEPB 5KHOA 3BINA 1AN8A 3Q69A 2LVPA 2KT7A 1WRIA 1CK1A 4JIOU 4W9FA 2JWZA 3IT6B 3CWIA 4ARIA 3A9KB 2I1JA 1RM6C 3HM3A 2MP2A 3EFCA 4RCOA 3FILB 1D6EC 2KNBA 2KKCA 1ZDVA 3X0WA 4FHKA 2QIEB 4IM3A 2D2QA 2PEAA 1NI3A 2LHDA 4TUUA 4RNAA 3Q14C 1I4XA 2M0XA 1LFDA 4XGAB 2WP9B 2IDYA 2SAKA 1SE4A 2KACA 3EHVA 2RSUA 3PRPB 1YJIA 3DOWA 2JT4B 2LXAA 2J4XA 4IG7B 4XE0A 1I4GA 1Z5SB 1FNVA 2M1MA 4KGRA 2INNE 3W5UB 1S1QB 4IM2A 2LASA 2ZW0A 1SSNA 4LCDE 3RI7C 4N59A 1BXTA 1MVKA 3IBEA 3BK1A 2GI9A 2IGGA 2ZZPB 4JQWC 2V9HA 5CX3A 2LMCA 4K7UA 1VZ6A 2PTLA 4C4VB 4KDIC 1XD3B 2IY1B 4DHZE 2WX0A 3RNBC 2AEHA 2MJDA 4M01A 4N58A 2N0SB 4WIPA 3QQ8B 5J18A 3RCZA 1WE6A 4BKGA 2WXHA 3RMKC 3Q8AA 2WYQA 4II3B 1ZW7A 1AWDA 3GB1A 1KH0A 1HTOA 2NPTB 1P9DU 2BBCA 1QT9A 2FCSA 2JZZA 4BFRA 4ANVA 2WXOA 4KV2A 2JYTA 4FHJA 2WXLA 4WURA 1BUIC 5BMHA 1GC7A 1PDXA 2N7JA 2MLBA 2ZCBA 3TMPB 1WJNA 2FUHB 3T3OA 2PE9A 3Q8CA 4KZCA 2RR9A 4PS3A 2L05A 2L76A 5MPOA 1WWTA 1QOFA 2W3RA 4A90A 3ALBA 4JWUC 1G6JA 2ZPYA 3TEWA 1IUEA 2HDEA 3L16A 1WI0A 1VDVA 2PMVA 2KMCA 1HTQA 3L4PA 2D3BA 3BK2A 4YWGG 3L08A 3V61A 3AE3B 3L13A 4XWTA 1YN3A 1WR6E 4WWPA 1TS4A 2JWUA 3UIOB 1I4RA 3GS2A 4M02A 3IG3A 2YLMA 5C3JB 1L0VB 1WMHB 4UDUC 1MG4A 5HI1A 3RT3B 2OHFA 2KDFB 3QHTA 1L0YB 4OVUA 2ZW1A 3DHIC 4KIKA 1F2RC 2WS3B 3EECA 4GGQA 3PRZA 3M3JA 3TCAA 3K9PB 2Y5BB 2PIAA 3V05A 4HDOA 3MP9A 1GOZA 3BY4B 1TZOA 2KK8A 3ZVVA 2CJNA 2IJ0A 3C8YA 2B76B 3DVGX 2JX5A 1H4RA 3MHZA 1V9JA 2GMIC 3AE9B 1CQVA 1JW9D 2IGDA 2AWTA 5D94A 1KF6B 3UF8A 3L0WB 4JGHB 4GLSC 1V97A 4M0WA 4ZHPA 4K7SA 4HROA 2KWUB 3ZDTA 3U52E 1M94A 4HPPA 3GZNI 3NOBA 1YD8U 1FCLA 4JWSC 2D11A 2KTFA 4B95A 3RNEC 3WA0A 2WXJA 2L7RA 2ONQA 1Q0WB 1E90A 2GRIA 1UGMA 1JWMD 1Y8RC 2XK5A 3WANA 2ZJDA 2LEKA 1SE9A 3ZNZB 1UWMA 4X57B 2PW9A 2WXRA 2GLSA 3AXCA 1UBIA 3H6NA 4J3OD 5E6OA 4ACFA 4PK1A 2DYMA 2KN4A 1UUPA 3A33B 3AMZA 2K0PA 1WY8A 1J7CA 1L4DB 4LJPB 3PREA 1IBXB 4OVZA 2PVGC 1C78A 4RM9A 1GAQB 2EMSA 3SEBA 2I1KA 2JU6X 1LO5D 2DZIA 5DPSA 1YOVB 4HDQA 1WJUA 4NQLB 3DWMA 3URYA 3TUOA 1E7UA 2KFJA 3ZO5B 3SFEB 4TV3A 1R4NI 1GUAB 1L0XB 1PGXA 2KZRA 2MEKA 2G4SA 3VUWA 2VZKD 5IP4D 4IC7B 1V1PA 1WYGA 3EUB2 2LJ5A 1FIQA 1GG3A 1VCBA 4FJVB 2A5UA 3Q3JA 2IO1B 3ZXVA 3ETRA 2V4IB 3GZNB 2R2QA 1KRHA 1FNUA 2M0AA 2QC8A 3PHXB 4MJSB 1XLNA 4GB9A 3MC8A 3NVWA 3PGEA 1N61A 1CZPA 2RDHA 2K22A 3WAPA 2DAJA 2WX1A 1GPXA 3ZJVA 1RRBA 2Z0DB 3HVZA 2XBBC 3KUCB 3AV8A 3O13A 2A4ZA 2ASQA 4XDDA 3T3NA 4OW0A 2GB1A 3TEZA 5T8IA 1NVID 3T9LA 3OLMD 3R66C 2QSDA 4US9A 4LLGM 3EFUA 3I57A 1HZ6A 3IFWB
chains in the Genus database with same CATH topology
3OG5A 2QDFA 3EFCA 4C4VA 4BZAA 4PK1A 4QAYA 3MC9A 2VH2A 2QCZA 4C00A 2VH1A 2V9HA 3MC8A 4K3BA 2MHJA 4C4VB 3Q6BA 3NJTA 2X8XX 4XGAB 4K3CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OG5 A;  2QDF A;  3EFC A;  4C4V A;  4BZA A;  4PK1 A;  4QAY A;  3MC9 A;  2VH2 A;  2QCZ A;  4C00 A;  2VH1 A;  2V9H A;  3MC8 A;  4K3B A;  2MHJ A;  4C4V B;  3Q6B A;  3NJT A;  2X8X X;  4XGA B;  4K3C A; 
#chains in the Genus database with same CATH topology
 2OJW A;  1V6E A;  3KLS X;  1A5R A;  2LZ6 A;  1ZXI A;  1IGC A;  4B0E A;  2INP E;  4RM8 A;  3VH4 B;  4G50 A;  1WR1 A;  3VVW B;  2W3S A;  1R4N B;  4NZL B;  3W1S A;  3ZXR A;  1XQQ A;  3BVG A;  2ZNV B;  3NZU A;  2EKI A;  4W9I A;  2ICI A;  2RGF A;  2RDB C;  1R7S A;  5D3D A;  2N4F A;  3NVZ A;  1P3Q U;  1V81 A;  4LNO A;  1C1Y B;  5C1Z A;  2GOW A;  1VLB A;  4W9L A;  3ZTD A;  3DCG A;  4ITK A;  4HPL B;  2N9L A;  2PKO A;  2R61 A;  1DOY A;  5LLI A;  1OQY A;  4DHJ B;  4P7I A;  1I4P A;  4REZ A;  2HE7 A;  1UNS A;  4USA A;  4PYU A;  1C3T A;  3B1L X;  1ZGU B;  2LHE A;  5JZE B;  2DHZ A;  4WAF A;  3DBL I;  1EU4 A;  3QC8 B;  2GBK A;  2HD5 B;  4ZOH C;  3VAW A;  2DZK A;  2K25 A;  1L7Y A;  4CYE A;  4LDT D;  1Y56 A;  4EEW A;  4HK2 A;  1EUV B;  1TZ1 A;  2WXN A;  5IA7 A;  2WDT B;  5H92 C;  1SJH D;  1FXI A;  3I5J C;  3WAM A;  1SXT A;  2NCN A;  1Z2M A;  2GBM A;  1F52 A;  2J52 A;  5CTR C;  4IUM B;  4WQO B;  1Q5W B;  3MFG A;  2X38 A;  2WGS A;  1J19 A;  1ZP0 B;  1BML C;  2HJ8 A;  3RUI B;  3DBH I;  1OFF A;  3R3M A;  4YT0 B;  1ENF A;  2BQQ A;  1ZOY B;  1Q1O A;  4WWO A;  5BMI A;  2K9X A;  4I6N B;  1QLB B;  4MDK E;  1C4C A;  2LWP A;  1WH3 A;  2MHJ A;  2IO2 B;  4GOC A;  2JRH A;  4TKN A;  3ZNH B;  2XN9 C;  3ML9 A;  1EF5 A;  3ZW3 A;  2Q5W D;  4HCP B;  4ICV A;  4W9J A;  3A9K A;  3AB5 A;  4LTU A;  1TKG A;  1I4Q A;  1RFA A;  2PLP A;  2WHI A;  5D2M B;  1V86 A;  4II2 B;  4PS7 A;  3FIL A;  3W9C B;  1TBE A;  2ZVN A;  3GP7 A;  4BAX A;  3VDZ A;  2L83 A;  1JML A;  3PSE B;  2MRP A;  2DYB A;  2BVC A;  3V60 A;  1WFY A;  1WGY A;  4L23 A;  2UU7 A;  1STE A;  1UD7 A;  3A1Q B;  1FFV A;  2FCN A;  2C7N B;  5DCN A;  1FXT B;  2MJ3 A;  2WXM A;  3AE2 B;  4QAY A;  5BYQ A;  1UEL A;  3PLU A;  2GBJ A;  2KFK B;  3TEY A;  1SE2 A;  2V3N A;  3ZLZ A;  2W54 A;  2L1A A;  3N1Y C;  3DVN V;  4IW0 A;  3O65 B;  2NVU I;  4EFO A;  4MAC A;  2GBN A;  1QQR A;  4DXA B;  3DBH B;  3AEF B;  4ASW C;  3PRM B;  2N7D A;  4GN1 A;  5KHQ A;  4NPN A;  2DWQ A;  1UH6 A;  5HFY A;  3HRD D;  3DWG C;  1KLV A;  3TIX A;  1ZKH A;  3PT2 B;  1OTR B;  2MH7 A;  1I35 A;  4NAW B;  1KTK A;  3PTF C;  3U8Z A;  2WQY B;  1V80 A;  4C4V A;  3JSV B;  4LNK A;  3APF A;  3PV1 A;  3P1M A;  3UI3 A;  2DAF A;  4DDI D;  3GOE A;  4A20 A;  3X23 A;  5AUK A;  2G3Q B;  2QIL A;  2LRU A;  3N20 C;  2NPT A;  3OJ4 B;  1QIL A;  1IPG A;  1WF9 A;  2C60 A;  2O2V B;  2QEJ C;  3RD2 A;  3B9J A;  3DHH C;  1C76 A;  3TL5 A;  3P4R B;  2LXC A;  3NZS A;  2LVQ A;  2AX5 A;  3M95 A;  3DPD A;  3N1X C;  3KUD B;  5HKH A;  3FKY A;  5HG2 A;  2LD9 A;  2BKR B;  3V62 A;  2YEP F;  4E3C A;  2N9X A;  1NYQ A;  3SHQ A;  4JX1 C;  3QA8 A;  1E9M A;  2NR2 A;  1WE7 A;  1J0G A;  4XYC A;  3QIJ A;  2PE6 B;  4AS1 A;  3Q3M C;  3H9D A;  5D3I B;  1TTN A;  1WGR A;  2M19 A;  1PGB A;  2V1Y A;  3MTN B;  2WDQ B;  2D5G A;  1QOA A;  4ICU A;  4US8 A;  4IM0 A;  1FPY A;  1AW7 A;  4IOI E;  1AAR A;  3JW0 X;  1D5X C;  4GXB A;  1UBQ A;  3KH0 A;  5C2T B;  3UIP B;  3EC8 A;  4C80 A;  3ZTC A;  3H7P B;  1L6V A;  1V5O A;  3PS6 A;  2LGX A;  2LGI A;  1XCQ L;  4AP4 C;  2MBQ A;  3ZNI D;  2DBY A;  1Q10 A;  1WYW B;  4K81 A;  4EZJ A;  2NBV B;  4FXC A;  1WMH A;  3VRA B;  2KJH B;  1L4Z B;  1JWB D;  3DVN U;  3AEB B;  1WGK A;  3IAM 1;  4YTN B;  1FM0 D;  2I2Y A;  1ESF A;  3ZUN A;  3ECI A;  3P63 A;  3MJW A;  2IY0 B;  4M8N A;  4BZA A;  4HJG E;  1WZ0 A;  3AN1 A;  4TQ1 A;  4DDG D;  4K1R B;  3W1Y A;  4XWW A;  2N9P C;  2KVZ A;  2C7H A;  3VTU A;  1F2R I;  2IGH A;  1T0Q C;  3NY5 A;  1C4A A;  4FAD A;  4KZ0 A;  3GE3 C;  4YSZ B;  3MJ5 A;  2M17 A;  2KVR A;  3AE5 B;  4ZYS A;  1LM8 B;  3VHT C;  2K6Q A;  1JWU D;  2KQS A;  1ZE3 D;  2PPH A;  4KGS A;  1KJT A;  3VXW A;  1RYJ A;  3AE1 B;  3M63 B;  5CHF A;  2IND C;  4GMV A;  1MG8 A;  1OQR A;  3P2B A;  3APC A;  4W9E A;  2CKH B;  2R2O A;  5DPT A;  1SIJ A;  1ISN A;  2RD0 A;  3CSF A;  1SB3 C;  4W9H A;  4S17 A;  4ANW A;  3KVF B;  2KWV B;  3C0R B;  1EO6 A;  2FNJ B;  2J7Q B;  2DX5 B;  2FCM A;  2KN5 A;  3NHE B;  1GC6 A;  1YQ4 B;  2BWF A;  2OJR A;  1IBX A;  3I3T B;  3R7R A;  1C79 A;  2KTR B;  3APD A;  5BO4 B;  1XEE A;  2WU2 B;  3AI5 A;  3K9O B;  1RAX A;  4KGT A;  1DOX A;  5DPR A;  2KWC A;  4WH4 A;  5G2N A;  4IDI A;  2LVO A;  1RLF A;  2KOX A;  2KX3 A;  2D07 B;  3ZIM A;  2WXG A;  1CMX B;  1ET6 A;  3PO0 A;  5FK9 C;  2BB6 A;  4L2Y A;  2CHX A;  1F1H A;  1NEN B;  1J7B A;  1N5W A;  2O6V B;  4A3O A;  1LXD A;  2KD0 A;  3SD5 A;  3R8B A;  2WXQ A;  4MJS A;  1DOI A;  5G5G A;  1YJJ A;  2NBU A;  3S2A A;  4WAA A;  4ZHO A;  2NTT A;  5LXI B;  1WM2 A;  2VH2 A;  3ML8 A;  4KKI A;  4MH0 E;  4K3B A;  4FUL A;  2MBE A;  1MPE A;  3QK0 A;  4KDL B;  4ZRJ A;  2D3A A;  5FR6 A;  1WGD A;  3BWU D;  1E8X A;  3M62 B;  2K8B A;  3QAR A;  2XNA C;  2V3S A;  2N9E B;  3Q8B A;  3RNF C;  4MGK E;  2JF5 A;  2K8H A;  4ZRQ A;  3AUL A;  4KSK C;  3NG0 A;  2Y5C A;  3AU5 A;  4GU2 A;  1OEY A;  2IBI B;  5BMG A;  3NS1 A;  1SBB B;  4J6I A;  4MM3 B;  2W82 A;  4RFB A;  4FJY A;  1TKY A;  1XXG A;  4CO7 A;  1T0R C;  2JZP A;  2K1F A;  4TQ0 A;  1ZDX A;  3N1Z C;  2PJH A;  1ZPS A;  1SEB D;  5AZG A;  1K50 A;  2CHW A;  1SGH A;  1XF5 L;  3PZ7 A;  1V49 A;  3U30 A;  2SEB D;  5IN7 A;  4HKZ E;  2D3C A;  2FAZ A;  2UYZ B;  3AU4 A;  3GE8 C;  4B0M A;  5EDS A;  5EE1 A;  2TSS A;  1DGJ A;  3KWL A;  3DDC B;  2BYV E;  4W9D A;  2W55 A;  4G3X B;  4A3P A;  4C00 A;  3A4R A;  4Q2J A;  2FBW B;  1TS3 A;  2RMM A;  4DK5 A;  2JXX A;  1VR9 A;  2HTM E;  4N6E B;  2BKF A;  1HXY D;  3AE8 B;  1XLO A;  1TS5 A;  2K3U A;  3PHW B;  2ZNV C;  3HIZ A;  3L17 A;  4DXG A;  4DBG A;  2JXT A;  4WJQ A;  1WJ6 A;  1E8Y A;  2NMQ A;  2I38 A;  2LGD A;  4H2A A;  5C23 A;  1RWS A;  4BKS A;  1WJ4 A;  4PT5 A;  4E74 A;  1F9J A;  5AEK B;  1JRU A;  2V3P A;  1JRP A;  2KQ7 A;  1XLQ A;  4A6Q A;  1YIW A;  4MGZ E;  1UWX A;  2Z59 B;  2FUG 1;  2ZCC A;  5HHD G;  4W9G A;  2WU5 B;  1E5W A;  1TKE A;  3T8M A;  1YMH E;  1AYF A;  4HKQ A;  3BVM A;  4HVB A;  4ZYN A;  4LNF A;  5IAA C;  3KQ4 A;  4NJ7 A;  4C7Y A;  4EZL A;  4RGT A;  2BT6 A;  1YQ3 B;  2B3A A;  3WIM A;  2E6X A;  4BOZ B;  5JHA A;  1E8W A;  2M8S A;  4EZK A;  4RGM A;  3SU8 X;  5LXH A;  3RNC C;  3D32 A;  4K7W A;  2NS5 A;  3LDZ E;  1KLG D;  3W1S C;  2ACZ B;  3V3X A;  2L0T A;  3MC9 A;  3DBR I;  3A1Q A;  2KQ4 X;  2L00 B;  1T3Q A;  5D6J B;  3VUY A;  2L52 A;  1JWS D;  2WXI A;  1X1M A;  2K5P A;  3H1U A;  3OG5 A;  1TJE A;  2KFK A;  1FCC C;  3DVG Y;  4S0R A;  3BYY B;  3RZW C;  3KYD D;  2ON8 A;  4KVG B;  3V6E B;  2LGS A;  1WGH A;  1J8C A;  2DLB A;  1SJE D;  2KX0 A;  5L83 A;  1MI0 A;  5L95 C;  1PGA A;  2MWS B;  1MHX A;  1TT5 B;  2KC2 A;  2J0M A;  1ACC A;  2FE8 A;  3TSS A;  1S3S G;  2L8J A;  2BW2 A;  1ZUD 2;  1K52 A;  1WXQ A;  1TIF A;  2EMT A;  5GXG B;  1MJD A;  3BVZ A;  1QKZ A;  2KO3 A;  4A8X C;  3DBL B;  3BZD B;  4NAW A;  1T0S C;  1N60 A;  3TEX A;  1JWA D;  1L5P A;  5AZF A;  2QCZ A;  1IP9 A;  1XLP A;  3H8H A;  3QWZ B;  2J53 A;  2MX2 A;  4G11 A;  4E71 A;  3JSV A;  1GJZ A;  3VFK A;  1N63 A;  5D7G A;  3PPA A;  1K53 A;  4YSY B;  1WXM A;  4YL8 A;  1L2N A;  2KXJ A;  3NVV A;  2DZM A;  3VR9 B;  4CHK A;  3R2I A;  2VRR B;  4FN2 A;  3IAS 1;  2E3T A;  2BPS A;  1PQS A;  4PS8 A;  2OED A;  5TSS A;  3A9J B;  2O2V A;  3DBR B;  3UQA A;  4GDL B;  4LNI A;  4NNJ B;  3WAL A;  3VTV A;  1H8C A;  2PVO D;  3ENE A;  5AUI A;  3QX1 A;  3RNG C;  1K8R B;  3R7Q A;  2RPQ A;  2BGF A;  1C4P A;  4GDK B;  1B9R A;  2AQ1 B;  2MQJ A;  3V6C B;  1HA5 A;  1UZX B;  4BVU C;  2CU1 A;  1RFK A;  1P7E A;  3LXF A;  1C77 A;  4I6P A;  4HWI B;  2JSV X;  2KLG A;  3KUZ A;  3N30 A;  3H7P A;  4G0N B;  3VH3 B;  4DWF A;  2IZV B;  1HQR D;  4GSW A;  1F0Z A;  3DHG C;  3Q2A C;  3P4S B;  1GB1 A;  1EWC A;  2WXF A;  1M4V A;  1EF1 A;  4HLE A;  2J42 A;  3VTW A;  4BKT A;  3VQI A;  3CF6 E;  2CJO A;  4BOS C;  2N1V A;  2LI5 A;  2KAJ A;  2LUE A;  1D5M C;  4B6W A;  3NJT A;  2QJL A;  4RGN A;  2IO0 B;  3RYT A;  1ET9 A;  2CR5 A;  3NUH B;  1FRR A;  3NRZ A;  3OAW A;  3E56 A;  4WQM A;  5G55 A;  2N9K A;  3AE7 B;  1FMA D;  4WWM A;  3OJ3 A;  4CQN A;  3IT4 B;  2K8C A;  4DHJ D;  5FR3 A;  3QCA A;  2Z0E B;  3QAQ A;  3HK0 A;  4OVV A;  2HTH A;  2VZK B;  1I4H A;  2WXP A;  3B0A A;  1TY2 A;  4AQ7 A;  4R3D A;  2BYT A;  3ZNG C;  4ARC A;  4ZRI A;  4JL9 A;  2H88 B;  3NS8 A;  1SIF A;  3LYY A;  4RGO S;  1N6Z A;  2KHW B;  2RDG A;  2BS3 B;  3N9Y C;  1A70 A;  2L32 A;  4ZRP A;  2MP2 B;  1VZ8 A;  2C5L C;  4MGI E;  2KJR A;  3DQV A;  1OGW A;  4MEL A;  1E0Z A;  1T6B X;  1N5X A;  3L54 A;  2WWZ A;  4MEM A;  1IGD A;  4BKS D;  1IYF A;  3VRB B;  1ZXH A;  2BYF A;  3TBL D;  2KTR A;  1P98 A;  4TMA B;  2KJ6 A;  2FCQ A;  5GMV A;  3HM6 X;  2KWD A;  4L1B A;  2DYO A;  3MC0 B;  2J0J A;  4RMA A;  3AE6 B;  2HJ1 A;  3EGR A;  2V0G A;  1YQB A;  2IYD B;  2WDR B;  1WX7 A;  2G4D B;  2ZVO A;  2O6V A;  4RH6 A;  1BT0 A;  4NJ6 A;  2Y3A A;  4FLH A;  2LUM A;  2MSE D;  4HJK A;  4IKG A;  1FEH A;  3U7Z A;  4JE3 B;  1V2Y A;  3PZ8 A;  3VR8 B;  3J9C A;  2JVC A;  1YN5 A;  2DEN B;  2MBB B;  3U4E G;  3U2S C;  2QHO A;  4FBJ B;  2BYE A;  2G1E A;  3UQB A;  2LJI A;  3IHP C;  4NY0 A;  5JH5 C;  2KAN A;  4MSM B;  3P4P B;  2C9W B;  5G5H A;  1ROE A;  2RPV A;  2BF8 B;  1QOG A;  1V8C A;  2LRW A;  3BYT B;  2JZ3 B;  2KLC A;  4BBN C;  3BII D;  1TGZ B;  1WX9 A;  5LNK 1;  4LK0 M;  5E6P A;  2IO3 B;  2AQ2 B;  4F1S A;  1VRA B;  4B9K A;  4LDT B;  1OQQ A;  2LGY A;  4K3C A;  2BWE S;  4EUT A;  1D4B A;  2DNF A;  5E6J A;  5TR5 A;  2MBH A;  2V4L A;  3Q3F A;  3N32 A;  4HPM B;  4MM3 A;  2GBR A;  3U7D A;  1NI2 A;  1FFU A;  1UF0 A;  4D2K A;  2MW5 A;  2D3G A;  1XO3 A;  4IWP A;  4C7Z A;  4URK A;  1P0R A;  3E9S A;  1E10 A;  1NDD A;  3PLV A;  1U4A A;  2J0K A;  1FXA A;  1EWY C;  2ZPN A;  3NZ3 A;  3ABV B;  1EM7 A;  1JRO A;  5FKA C;  5CHW A;  2L3Z A;  1WX8 A;  4JLC A;  4AUQ C;  5IO9 A;  1XCT L;  3PZD A;  3P4Q B;  4F7Z A;  2MCN B;  1OEY J;  5J17 A;  1LGR A;  5EE9 A;  1TY0 A;  3RPF C;  2L0F A;  1VD2 A;  4DXF A;  1T0Y A;  2OOB B;  1WRD B;  3N3K B;  4W9K A;  4BBN F;  2WNM A;  5IOI A;  4KIK B;  2KC1 A;  2KDM A;  3AEC B;  3R2T A;  5BYS A;  1WSP A;  2M4N A;  1GB4 A;  4XDC A;  4HEA 1;  3RUL A;  3Q3O C;  4NJC A;  4HCN B;  2VH1 A;  3AE4 B;  2FIF A;  4MSQ B;  4DQO C;  4WJO A;  1YN4 A;  2KYW A;  2G9H D;  5EE3 A;  3ZQ4 A;  3WCQ A;  3RFZ B;  1CJE A;  1FD6 A;  3RN9 C;  3HVD A;  1WXS A;  2NTS A;  1J7A A;  1YX6 B;  4AJY B;  3C19 A;  4M0W B;  2CS4 A;  5I4D A;  3A4S C;  4RF1 A;  2KMA A;  4NAM A;  3ZJT A;  4HXD A;  4ANU A;  4WWN A;  2WLB A;  3PVL A;  4P6V F;  3L10 B;  1WZ3 A;  3W5V B;  1D5Z C;  4EKU A;  1TS2 A;  3IXS A;  1F77 A;  2ZEQ A;  4M00 A;  3ZJU A;  4XZ4 A;  1VJK A;  3ONS A;  4WJN A;  2IPK D;  2XK5 B;  1DYQ A;  1T5X D;  1N62 A;  2CHZ A;  1E7V A;  4FA6 A;  2AL3 A;  3Q8E A;  3H7S A;  3VUX A;  1GNU A;  3WAO A;  4WJP A;  2BS2 B;  2C7M B;  1L6U A;  4OZA A;  1XT9 B;  3EA6 A;  4PYZ A;  2MBO A;  2XEW A;  2NBW B;  4JPS A;  4NQK E;  1HZ5 A;  1WIA A;  5E6N A;  3JYU A;  3NVY A;  3UIN B;  4MH8 A;  3FAH A;  4YTM B;  1KOT A;  1WGG A;  4P16 A;  4O1N A;  3ZGZ A;  3LB8 C;  4GIV A;  3LJ3 A;  2N1W A;  1VZ7 A;  4LJO B;  4OZC A;  1V1P B;  3QJZ A;  1YNT E;  2JYE A;  3RZF A;  3ZDM C;  3CST A;  4ZRK A;  2FID A;  5BYR A;  2JY6 A;  4HRS A;  2KMM A;  3KWV A;  2JUO A;  2INC C;  4TSS A;  4I6L B;  3RNA C;  4KSL C;  1JQ4 A;  3TJP A;  4IWO A;  1WXV A;  1D3Z A;  2LFI A;  3P42 A;  1SF0 A;  2MJE A;  3AEE B;  1QF6 A;  1PFD A;  4N9F 4;  3Q3N C;  3HHM A;  1R4M I;  1WM3 A;  4YXD B;  5J2R A;  1QZE A;  3AED B;  2EKE C;  1FO4 A;  1LQB A;  4RF0 A;  2REX A;  3SDL C;  2K39 A;  4P1C C;  1PUT A;  3CIR B;  4KX6 B;  2G45 B;  4IWQ A;  1P1A A;  3I9V 1;  2UWQ A;  5EE0 A;  1WXA A;  4A9A A;  4M8M A;  4ANX A;  3MHS D;  5CHV C;  3A9J A;  5DPW A;  2N7E A;  4GDL A;  4F8C B;  1C9F A;  4AOF A;  4C56 C;  4XC2 A;  1I42 A;  3W2D A;  1NBF C;  2WDV B;  5JHB A;  3CMM B;  1KLU D;  2Z8L A;  1FNW A;  2O6V D;  4A55 A;  3SFD B;  2JRI B;  4OZB A;  1E8Z A;  4AJW A;  2Y5P A;  1V5T A;  2QMT A;  4XX5 A;  2MA9 B;  4KKJ A;  4DHZ B;  2BB5 A;  2KDE B;  1EU3 A;  1PYW D;  1QOB A;  3UGB B;  4GDK A;  1I7H A;  3FC4 A;  4MT5 A;  2W9N A;  2K6D B;  4MGY E;  1E6E B;  3ZRC A;  2KDI A;  1R4M B;  3I63 C;  3DBS A;  4OHJ A;  1SE3 A;  1KM7 A;  1YX5 B;  2H89 B;  4EOY A;  4FJZ A;  2AL6 A;  1KFY B;  2EEL A;  1NEK B;  3ZRF A;  2D10 A;  5H8Y E;  4YTP B;  3HUI A;  4YSX B;  1V1O A;  3B2F A;  3ZKJ C;  3JVZ X;  1E7P B;  3AEA B;  1P7F A;  2AYO B;  3B2G A;  1MFW A;  3IVF A;  2KDB A;  1K51 A;  3AH7 A;  1HEZ E;  1UGJ A;  2X8X X;  4LNN A;  1JCK B;  2JPH A;  1FRD A;  3B08 A;  5IKC M;  1HE8 A;  1MHH E;  1YJ1 A;  2M56 B;  2QDF A;  3Q8F A;  4AWJ A;  1B1Z A;  3KYC D;  3OWE B;  5JXV A;  3SR6 A;  1JAL A;  2BTE A;  2DZJ A;  4W9C A;  5AZH A;  2YVC A;  2WXK A;  3AEG B;  2AQ3 B;  2BS4 B;  3Q6B A;  4P1B C;  3AM9 A;  4EE2 A;  1NYR A;  2CU3 A;  4ZDV A;  1TYG B;  3KW5 B;  2JQR B;  3ZYY X;  2YEP B;  5KHO A;  3BIN A;  1AN8 A;  3Q69 A;  2LVP A;  2KT7 A;  1WRI A;  1CK1 A;  4JIO U;  4W9F A;  2JWZ A;  3IT6 B;  3CWI A;  4ARI A;  3A9K B;  2I1J A;  1RM6 C;  3HM3 A;  2MP2 A;  3EFC A;  4RCO A;  3FIL B;  1D6E C;  2KNB A;  2KKC A;  1ZDV A;  3X0W A;  4FHK A;  2QIE B;  4IM3 A;  2D2Q A;  2PEA A;  1NI3 A;  2LHD A;  4TUU A;  4RNA A;  3Q14 C;  1I4X A;  2M0X A;  1LFD A;  4XGA B;  2WP9 B;  2IDY A;  2SAK A;  1SE4 A;  2KAC A;  3EHV A;  2RSU A;  3PRP B;  1YJI A;  3DOW A;  2JT4 B;  2LXA A;  2J4X A;  4IG7 B;  4XE0 A;  1I4G A;  1Z5S B;  1FNV A;  2M1M A;  4KGR A;  2INN E;  3W5U B;  1S1Q B;  4IM2 A;  2LAS A;  2ZW0 A;  1SSN A;  4LCD E;  3RI7 C;  4N59 A;  1BXT A;  1MVK A;  3IBE A;  3BK1 A;  2GI9 A;  2IGG A;  2ZZP B;  4JQW C;  2V9H A;  5CX3 A;  2LMC A;  4K7U A;  1VZ6 A;  2PTL A;  4C4V B;  4KDI C;  1XD3 B;  2IY1 B;  4DHZ E;  2WX0 A;  3RNB C;  2AEH A;  2MJD A;  4M01 A;  4N58 A;  2N0S B;  4WIP A;  3QQ8 B;  5J18 A;  3RCZ A;  1WE6 A;  4BKG A;  2WXH A;  3RMK C;  3Q8A A;  2WYQ A;  4II3 B;  1ZW7 A;  1AWD A;  3GB1 A;  1KH0 A;  1HTO A;  2NPT B;  1P9D U;  2BBC A;  1QT9 A;  2FCS A;  2JZZ A;  4BFR A;  4ANV A;  2WXO A;  4KV2 A;  2JYT A;  4FHJ A;  2WXL A;  4WUR A;  1BUI C;  5BMH A;  1GC7 A;  1PDX A;  2N7J A;  2MLB A;  2ZCB A;  3TMP B;  1WJN A;  2FUH B;  3T3O A;  2PE9 A;  3Q8C A;  4KZC A;  2RR9 A;  4PS3 A;  2L05 A;  2L76 A;  5MPO A;  1WWT A;  1QOF A;  2W3R A;  4A90 A;  3ALB A;  4JWU C;  1G6J A;  2ZPY A;  3TEW A;  1IUE A;  2HDE A;  3L16 A;  1WI0 A;  1VDV A;  2PMV A;  2KMC A;  1HTQ A;  3L4P A;  2D3B A;  3BK2 A;  4YWG G;  3L08 A;  3V61 A;  3AE3 B;  3L13 A;  4XWT A;  1YN3 A;  1WR6 E;  4WWP A;  1TS4 A;  2JWU A;  3UIO B;  1I4R A;  3GS2 A;  4M02 A;  3IG3 A;  2YLM A;  5C3J B;  1L0V B;  1WMH B;  4UDU C;  1MG4 A;  5HI1 A;  3RT3 B;  2OHF A;  2KDF B;  3QHT A;  1L0Y B;  4OVU A;  2ZW1 A;  3DHI C;  4KIK A;  1F2R C;  2WS3 B;  3EEC A;  4GGQ A;  3PRZ A;  3M3J A;  3TCA A;  3K9P B;  2Y5B B;  2PIA A;  3V05 A;  4HDO A;  3MP9 A;  1GOZ A;  3BY4 B;  1TZO A;  2KK8 A;  3ZVV A;  2CJN A;  2IJ0 A;  3C8Y A;  2B76 B;  3DVG X;  2JX5 A;  1H4R A;  3MHZ A;  1V9J A;  2GMI C;  3AE9 B;  1CQV A;  1JW9 D;  2IGD A;  2AWT A;  5D94 A;  1KF6 B;  3UF8 A;  3L0W B;  4JGH B;  4GLS C;  1V97 A;  4M0W A;  4ZHP A;  4K7S A;  4HRO A;  2KWU B;  3ZDT A;  3U52 E;  1M94 A;  4HPP A;  3GZN I;  3NOB A;  1YD8 U;  1FCL A;  4JWS C;  2D11 A;  2KTF A;  4B95 A;  3RNE C;  3WA0 A;  2WXJ A;  2L7R A;  2ONQ A;  1Q0W B;  1E90 A;  2GRI A;  1UGM A;  1JWM D;  1Y8R C;  2XK5 A;  3WAN A;  2ZJD A;  2LEK A;  1SE9 A;  3ZNZ B;  1UWM A;  4X57 B;  2PW9 A;  2WXR A;  2GLS A;  3AXC A;  1UBI A;  3H6N A;  4J3O D;  5E6O A;  4ACF A;  4PK1 A;  2DYM A;  2KN4 A;  1UUP A;  3A33 B;  3AMZ A;  2K0P A;  1WY8 A;  1J7C A;  1L4D B;  4LJP B;  3PRE A;  1IBX B;  4OVZ A;  2PVG C;  1C78 A;  4RM9 A;  1GAQ B;  2EMS A;  3SEB A;  2I1K A;  2JU6 X;  1LO5 D;  2DZI A;  5DPS A;  1YOV B;  4HDQ A;  1WJU A;  4NQL B;  3DWM A;  3URY A;  3TUO A;  1E7U A;  2KFJ A;  3ZO5 B;  3SFE B;  4TV3 A;  1R4N I;  1GUA B;  1L0X B;  1PGX A;  2KZR A;  2MEK A;  2G4S A;  3VUW A;  2VZK D;  5IP4 D;  4IC7 B;  1V1P A;  1WYG A;  3EUB 2;  2LJ5 A;  1FIQ A;  1GG3 A;  1VCB A;  4FJV B;  2A5U A;  3Q3J A;  2IO1 B;  3ZXV A;  3ETR A;  2V4I B;  3GZN B;  2R2Q A;  1KRH A;  1FNU A;  2M0A A;  2QC8 A;  3PHX B;  4MJS B;  1XLN A;  4GB9 A;  3MC8 A;  3NVW A;  3PGE A;  1N61 A;  1CZP A;  2RDH A;  2K22 A;  3WAP A;  2DAJ A;  2WX1 A;  1GPX A;  3ZJV A;  1RRB A;  2Z0D B;  3HVZ A;  2XBB C;  3KUC B;  3AV8 A;  3O13 A;  2A4Z A;  2ASQ A;  4XDD A;  3T3N A;  4OW0 A;  2GB1 A;  3TEZ A;  5T8I A;  1NVI D;  3T9L A;  3OLM D;  3R66 C;  2QSD A;  4US9 A;  4LLG M;  3EFU A;  3I57 A;  1HZ6 A;  3IFW B; 
#chains in the Genus database with same CATH homology
 3OG5 A;  2QDF A;  3EFC A;  4C4V A;  4BZA A;  4PK1 A;  4QAY A;  3MC9 A;  2VH2 A;  2QCZ A;  4C00 A;  2VH1 A;  2V9H A;  3MC8 A;  4K3B A;  2MHJ A;  4C4V B;  3Q6B A;  3NJT A;  2X8X X;  4XGA B;  4K3C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...