5J2RA

Solution structure of ras binding domain (rbd) of b-raf
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
82
structure length
82
Chain Sequence
SPQKPIVRVFLPNKQRTVVPARCGVTVRDSLKKALMMRGLIPECCAVYRIQDGEKKPIGWDTDISWLTGEELHVEVLENVPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein binding
molecule keywords Serine/threonine-protein kinase B-raf
publication title A Small Molecule RAS-Mimetic Disrupts RAS Association with Effector Proteins to Block Signaling.
pubmed doi rcsb
source organism Homo sapiens
total genus 19
structure length 82
sequence length 82
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2016-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02196 RBD Raf-like Ras-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 5j2rA01
5L95C 3L13A 3PRMB 4BKTA 3L08A 3ZLZA 1WH3A 3PRPB 4GDKA 2GBMA 2KWCA 4NQKE 4FADA 4WJPA 5EDSA 2CHWA 2MLBA 1LQBA 2ZZPB 4MGYE 2G4DB 2ZEQA 1GJZA 2OOBB 4GOCA 5AZHA 2KLCA 2LZ6A 3PHWB 3IHPC 4DBGA 2LJ5A 3NHEB 4ZRKA 4G50A 2IZVB 4GDLA 4HK2A 2V3SA 5LXHA 2MRPA 1WR6E 3AULA 2BYEA 4M8NA 5CHWA 3T9LA 2FCMA 1Q0WB 2LD9A 4DHZB 2I1KA 2L0TA 1EO6A 2ZCBA 2KD0A 4G11A 3EFUA 3QK0A 4BKSD 2KTRA 1V5TA 2IO2B 1E7VA 2GOWA 5KHQA 4J6IA 1TZ1A 2I1JA 1FXTB 3DVNU 3PPAA 3VTVA 3M62B 4JGHB 2JRIB 4E71A 3DCGA 4AOFA 2MBQA 1RRBA 2LXAA 4URKA 2IYDB 1KLVA 4GB9A 3H7PB 4ANUA 3GOEA 2DYMA 3OJ3A 1XT9B 1E90A 1QZEA 5LXIB 2HD5B 3X0WA 4BKSA 4EFOA 5IA7A 5E6NA 3VH4B 4K7WA 1OEYJ 4GIVA 2N1WA 4JLCA 2GBNA 3ZDMC 3RD2A 1UH6A 2GMIC 3QQ8B 1C3TA 2K6DB 2KC1A 2ZPNA 3ZW3A 5J17A 2CS4A 4W9FA 2ZVNA 3N30A 2PEAA 4AJYB 1Z2MA 5CX3A 3T8MA 4IC7B 4KZ0A 1WX7A 3QX1A 2KANA 5L83A 1WXSA 4CYEA 2KX0A 2L00B 3UGBB 1TBEA 3TBLD 5DPWA 2DX5B 2K39A 4KSKC 3JW0X 1WM2A 2DZIA 3QWZB 4F8CB 1GG3A 2LASA 2NS5A 3APDA 3PLVA 1R4NI 3B08A 2N4FA 3NY5A 1H8CA 3W1YA 1KM7A 4JQWC 3S2AA 3PVLA 1NI2A 4NY0A 5JZEB 2KFKA 3CF6E 2FIFA 3B1LX 3PGEA 2FCQA 2JPHA 1GUAB 1RLFA 3V61A 3IBEA 2J0JA 1SIFA 3UQAA 4PS7A 4WQOB 4MELA 2D10A 3UINB 1D3ZA 4PS8A 5JHAA 3UQBA 4BBNF 4A3PA 3M95A 3VHTC 2BKFA 2L0FA 3DBRI 4MDKE 3DVGX 4EOYA 4FULA 2K8BA 3KUZA 2KO3A 3H9DA 4IG7B 1JRUA 4CO7A 2BYFA 1LM8B 2C60A 3C0RB 4LCDE 2AYOB 3JSVB 1WZ3A 3HIZA 3KYDD 2REXA 2LXCA 3VTUA 3ZRFA 5D7GA 3A9KA 4W9DA 5AZGA 3V6EB 3R66C 4HCPB 3ZNHB 1SE9A 2LRWA 3KVFB 4I6LB 4X57B 2IBIB 3PS6A 4BFRA 2AWTA 2BWES 2DYOA 2NBVB 3I3TB 4MJSB 4W9CA 5J18A 4HJKA 4MGKE 1G6JA 4BOZB 2RGFA 4K7SA 3TIXA 5G55A 2BYVE 4MSMB 1YD8U 2MBBB 4DHZE 4M8MA 3Q3FA 1WGYA 4NJ7A 1CMXB 3HM3A 4PS3A 3V62A 4ANXA 2RSUA 2V1YA 4WJNA 2A4ZA 2KQ7A 3RUIB 2Z0DB 3AU4A 3ZTDA 1E8XA 1XD3B 3A4RA 3EECA 3JYUA 3L10B 2ZPYA 3CSTA 3HK0A 4NQLB 4EEWA 2KDBA 2NCNA 2KKCA 3U30A 4DHJB 3U7DA 4KVGB 2ASQA 2KJRA 4KZCA 2C7HA 1ZKHA 1YX5B 1VD2A 2EKEC 3L17A 1UBIA 1WJUA 1WXVA 2BGFA 2WYQA 3W1SA 2N9EB 1P98A 4BOSC 4B95A 2LVQA 1WMHB 3IVFA 4HLEA 5JHBA 4JIOU 5DPRA 1RFAA 2M8SA 2DZKA 1WE7A 3QA8A 3PV1A 3A9JB 2C9WB 2R2OA 1WY8A 3ALBA 3H7PA 3H7SA 1WE6A 4DWFA 2DENB 2RPQA 2M0XA 1SGHA 2MWSB 3APCA 4GN1A 4KDLB 5E6OA 4EZJA 3DOWA 4TQ1A 5LLIA 1YX6B 1PQSA 2KHWB 4KV2A 5D6JB 3RYTA 2XEWA 1Q1OA 2DZJA 2N7EA 3OAWA 1EF1A 3PT2B 4EZLA 3U8ZA 2ZJDA 4FJVB 1WJNA 5AZFA 2M4NA 1EF5A 2K1FA 2RD0A 2LI5A 2EMTA 2IY0B 4ZRJA 1GC6A 3BY4B 1WGGA 3L54A 2NPTA 5G2NA 4B9KA 3KUDB 2JZ3B 3ML9A 3JVZX 4KIKB 1T0YA 2G45B 1WRDB 3LJ3A 2IO3B 3AU5A 4HWIB 4XX5A 1L7YA 4II2B 3DVNV 1WX8A 1WFYA 4ZRIA 1BT0A 2FAZA 2MCNB 1S3SG 4CHKA 3LDZE 3WAMA 4XZ4A 3MJWA 4IM0A 2JVCA 1V49A 2BF8B 2PPHA 3K9PB 1UD7A 5C23A 3KYCD 1Z5SB 2LWPA 2DAFA 2PE6B 2GBKA 1NDDA 4W9IA 4TUUA 3H1UA 4IWQA 1WGDA 3ZUNA 4LDTB 4AJWA 1UBQA 3SD5A 3NZSA 4IWPA 2NVUI 5CHVC 3ZNID 3A1QB 1K8RB 2ZNVC 1J8CA 4YL8A 2FIDA 1OTRB 3QAQA 4MGIE 2XK5B 3WIMA 4HDQA 2KWVB 3MHSD 1E7UA 1NBFC 3RCZA 3OLMD 3VFKA 4MM3A 3ZKJC 3P2BA 3QIJA 1V80A 3MTNB 1VCBA 4OVUA 4WWNA 3VTWA 4XC2A 2PE9A 3A4SC 3JSVA 3ONSA 1OQYA 2JF5A 2JRHA 1J0GA 4NAWB 1UELA 1IYFA 1TGZB 4FHJA 1F9JA 3ML8A 1V9JA 1WZ0A 4DDID 1J19A 2KDFB 2LGDA 2BWFA 4HPLB 4MJSA 3KW5B 5CTRC 4FN2A 3QCAA 4TQ0A 1A5RA 5IAAC 3SU8X 2CKHB 2KX3A 2KZRA 2MP2B 4BVUC 4EZKA 4HCNB 1WYWB 2IO0B 4ANWA 2J7QB 4IM2A 2CR5A 2EMSA 2KWUB 4DHJD 1I42A 2L8JA 2D07B 2KXJA 4ANVA 3DPDA 2CHZA 1U4AA 3PREA 1WX9A 1WF9A 2HE7A 2N7DA 5FR6A 1EUVB 3PHXB 4G0NB 2LUEA 2WX1A 4HVBA 2AL3A 1GC7A 4FJYA 2UYZB 4IW0A 5E6PA 3DBHI 3A33B 3IG3A 3NOBA 3Q3JA 2PJHA 4KDIC 2N9PC 5GMVA 2BKRB 4MH0E 1V81A 2DZMA 1X1MA 3L16A 2DAJA 2XBBC 3R3MA 3VDZA 2O2VB 3X23A 2AEHA 1V5OA 1OGWA 2Z59B 1WXMA 4F7ZA 3V60A 1WGHA 2MSED 1AARA 4TKNA 3R7RA 3KUCB 3ZNGC 4WWPA 1WI0A 2N9XA 3NZUA 2IY1B 3TJPA 2O6VB 2JXXA 2D2QA 3AXCA 1WMHA 3DDCB 2L76A 4K81A 3B0AA 1L2NA 2Z0EB 3PLUA 1YIWA 3N32A 2KN5A 5J2RA 3A9JA 4MSQB 3UF8A 2LGYA 3APFA 4IWOA 1MG8A 4EKUA 1KJTA 3ZNZB 2FUHB 1Q5WB 4W9KA 2ZCCA 1WXAA 1WIAA 3PSEB 4HDOA 3L0WB 3WAPA 4HXDA 2KLGA 4LJPB 2NPTB 3M3JA 2D11A 4KSLC 4M0WB 5KHOA 3VUXA 1TTNA 2LVOA 5DCNA 2J0MA 4FBJB 3ZTCA 2VRRB 4GDKB 2KVRA 1HE8A 3EHVA 4K1RB 4RMAA 4W9HA 4AP4C 2KK8A 4DK5A 2K6QA 4PYUA 2ZVOA 4E3CA 3KH0A 2R2QA 4PYZA 3ZVVA 2UWQA 4P7IA 3DBSA 3ZO5B 1E8ZA 1P3QU 2ZNVB 3HM6X 4W9GA 2JUOA 3K9OB 1LXDA 2QHOA 3PRZA 1OEYA 4KIKA 4GDLB 4GXBA 1WM3A 3TMPB 2NBUA 4LDTD 2DYBA 2W9NA 3VUYA 1UZXB 4RM9A 2BPSA 4WJOA 1P9DU 1ISNA 3N3KB 2LGXA 4W9LA 3RZFA 2KTRB 5C1ZA 4K7UA 4WJQA 3ZIMA 1XQQA 2WDTB 1ZGUB 2J0KA 2YVCA 3H6NA 2Y5BB 1V2YA 4ZYNA 4JL9A 1LFDA 2MX2A 3UIOB 3R7QA 1I35A 4AWJA 2WWZA 3UIPB 4MEMA 1IPGA 5BO4B 4NJ6A 2MA9B 4FJZA 2HTHA 1H4RA 2KJHB 1ZW7A 3TL5A 3QC8B 3RULA 3EC8A 3A1QA 2K8CA 5DPTA 3V6CB 2MBEA 4ASWC 4GMVA 3WA0A 2XK5A 5JH5C 2B3AA 1WJ4A 5D2MB 4W9EA 2CU1A 2YLMA 4BKGA 2KJ6A 5TR5A 3HHMA 3VQIA 1IP9A 3WAOA 4IM3A 4NAWA 2C5LC 2JZZA 2L7RA 4A20A 2KTFA 3W1SC 3PTFC 1S1QB 2KQSA 2C7MB 5HKHA 2MQJA 4I6PA 4N9F4 3CSFA 1R4MI 2K25A 3M63B 4G3XB 2JWZA 1C1YB 3ECIA 2KDIA 3GZNI 2A5UA 4OVVA 1KOTA 2K8HA 2MP2A 4GSWA 5CHFA 3AI5A 2CHXA 2JT4B 5AEKB 2NR2A 5D94A 2N1VA 2G4SA 3DQVA 3OJ4B 2MBHA 4LJOB 3RT3B 3VXWA 2KMAA 3VAWA 4GGQA 3ZRCA 1Y8RC 2RR9A 3PZDA 3QJZA 1WGRA 4EUTA 1P0RA 2AL6A 2KFKB 3NS8A 2L3ZA 4NPNA 2V4LA 2LRUA 1YQBA 4WAAA 2KMCA 4B6WA 3VH3B 3CMMB 3DVGY 2O6VD 4A3OA 2D3GA 3DBLI 1V86A 1E5WA 2M1MA 1E8YA 2WX0A 2KC2A 5DPSA 1V6EA 2OJRA 4DDGD 2KFJA 2KOXA 4GU2A 4RM8A 4F1SA 2O2VA 2GBJA 2M17A 2FCSA 4FHKA 3QHTA 1WJ6A 2MBOA 4I6NB 3SDLC 4AUQC 3RZWC 3VVWB 3IFWB 1M94A 4BBNC 1P1AA 2FCNA 1E8WA 2HJ8A 4HPMB 4TV3A 4W9JA 3VUWA 2FNJB 3A9KB 1YJ1A 2O6VA 3SHQA 3BINA 4FA6A 2NBWB 4WWOA 4ICVA 3WANA 3WALA 4ICUA 1GNUA 2GBRA 3TCAA 3ZDTA 4DXAB 4MGZE 4NNJB 4ZDVA 2IO1B 2LVPA 4IUMB 2MW5A 3ENEA 2KDEB 3O65B 2KNBA 1WR1A 2C7NB 2G3QB 2JY6A 1RAXA 4II3B 4E74A 1UGMA 2DHZA 3D32A 4FLHA 3QARA 2L05A
chains in the Genus database with same CATH superfamily
2BB5A 3Q8EA 3RMKC 4FADA 3RI7C 3P42A 3IHPC 4DBGA 3NHEB 4ZRKA 2MRPA 4FXCA 2K5PA 5CHWA 2FCMA 2I1KA 1Y56A 2L0TA 4RGMA 1V5TA 1E7VA 1FD6A 2GOWA 5KHQA 2I1JA 3PPAA 4E71A 2BS3B 4GB9A 4ANUA 2DYMA 1MVKA 2I2YA 2WDVB 1N5XA 3VH4B 1OEYJ 4GIVA 4KGRA 2PVOD 3ZDMC 1TY2A 5J17A 2CS4A 3VRBB 1MI0A 3T8MA 3QX1A 5IKCM 5L83A 2KX0A 3AE3B 2OHFA 1N61A 5DPWA 3KWLA 1SEBD 1UF0A 3PO0A 2NS5A 3B08A 4IOIE 3NY5A 4OW0A 2GRIA 5AUKA 4JQWC 2L83A 1NI2A 4NY0A 1ZP0B 2OEDA 3AE2B 2FIFA 3CF6E 2KWDA 3PGEA 1T6BX 4KGTA 3IBEA 2J0JA 1GOZA 3RNFC 2D10A 3UINB 1BXTA 4PS8A 5JHAA 2MEKA 4AS1A 2OJWA 1VLBA 4MDKE 2KO3A 1WSPA 4IG7B 4CO7A 2BYFA 1LM8B 3P4PB 2LEKA 3KYDD 3HIZA 4C4VB 2L52A 2HJ1A 3V6EB 3ZNHB 1SE9A 2V3NA 4MJSB 3HVZA 4W9CA 4BOZB 3DWMA 3I5JC 4MSMB 4DHZE 3SFEB 4NJ7A 1XXGA 2V1YA 2Z0DB 1TYGB 2V4IB 1XD3B 2VZKD 2RDBC 2WXMA 2KDBA 3P4SB 4PT5A 3U7DA 5D3IB 2ASQA 4KZCA 2BGFA 1PUTA 1NENB 3W1SA 4HLEA 4JIOU 5DPRA 1GAQB 1WGKA 2AQ3B 3ALBA 3MC9A 3H7PA 1WE6A 1C4CA 1SGHA 2MWSB 4KDLB 5E6OA 3DOWA 3VRAB 2AQ2B 3EUB2 5D6JB 5FK9C 1ESFA 3W9CB 3B2FA 3PT2B 5AZFA 1EF5A 1GC6A 1JROA 1WGGA 3L54A 5G2NA 3KUDB 2JZ3B 1WRDB 2PLPA 2EKIA 4II2B 1WX8A 5HG2A 1JMLA 2DLBA 2MCNB 1TZOA 3WAMA 5D3DA 3MJWA 4IM0A 1FRRA 1UD7A 1XCTL 1Z5SB 2YEPF 1HZ5A 2PE6B 2NVUI 3A1QB 4IDIA 1J8CA 2FIDA 2WP9B 2KWVB 1C76A 1V80A 1VCBA 2K0PA 2PE9A 4XC2A 3A4SC 3JSVA 2N7JA 1OQYA 2JF5A 2JRHA 3DHIC 1J0GA 3DBRB 4YXDB 1V1OA 1F9JA 1PFDA 1V9JA 1TS2A 1F2RC 3C19A 3QCAA 4TQ0A 1F0ZA 5IAAC 2KZRA 1CZPA 4HCNB 2EMSA 1K50A 2WDRB 2N9LA 2CHZA 1U4AA 3PREA 1WX9A 5FR6A 2D3CA 2WX1A 4G0NB 4HVBA 1V97A 5E6PA 3U7ZA 3A33B 3Q3JA 3NOBA 4Q2JA 1V81A 3AE7B 2DAJA 3EFCA 2XBBC 1SJHD 5E6JA 2AEHA 3ZQ4A 1HA5A 1WXMA 1WGHA 1AARA 1D5MC 3FILB 2N9XA 2JXXA 3ABVB 4XWWA 2J52A 3N32A 4HPPA 3UF8A 2WNMA 2XN9C 1KJTA 2ZCCA 3TEYA 4C7ZA 1OQRA 1E7PB 4N58A 3R8BA 2NPTB 4KSLC 1IGDA 5DCNA 4FBJB 3Q3NC 4RGOS 1HE8A 3EHVA 4W9HA 4A9AA 4K3BA 2ZVOA 1HQRD 4XDDA 1ZXHA 1E8ZA 1AN8A 1P3QU 1KF6B 4W9GA 1WRIA 3I63C 4KIKA 4GDLB 3TMPB 3VUYA 2DYBA 4RM9A 4BAXA 3BWUD 2LGXA 4W9LA 4K7UA 3DHHC 2M56B 1XQQA 2PIAA 2J0KA 4A3OA 1F2RI 2Y5BB 2WWZA 4NJ6A 2MA9B 4FJZA 2HTHA 1ZW7A 5DPTA 4ZHOA 4GMVA 3WA0A 2B3AA 4P6VF 4W9EA 4XDCA 3RPFC 2KJ6A 1XLOA 3RNAC 3U52E 4NAWA 2C5LC 4A20A 5LNK1 2VH2A 3NJTA 4I6PA 4G3XB 2JWUA 3NVYA 1C1YB 3ECIA 2PTLA 2WLBA 4GSWA 4UDUC 2X8XX 2QSDA 2NR2A 1ZPSA 5D94A 2N1VA 2G4SA 3DQVA 3ZRCA 4LJOB 4OZBA 4GGQA 1Y8RC 1NEKB 1QQRA 2KFKB 3HUIA 2LHDA 3NS8A 1YQBA 2M0AA 2QILA 2KMCA 3CMMB 2O6VD 3AEDB 2W3RA 3EGRA 2OJRA 3BZDB 3VR9B 2M17A 3N1ZC 1WJ6A 4AUQC 3DBHB 1P1AA 3ZJTA 1I4HA 3IAS1 4TV3A 3AE8B 4LTUA 3BINA 4FA6A 4NAMA 3WALA 3ZDTA 4MGZE 4XGAB 2KDEB 2KNBA 1WR1A 5BMIA 1N60A 2G3QB 2RDHA 3V3XA 1SB3C 3D32A 3QARA 2L05A 3L13A 3PRMB 1V1PB 3L08A 3ZLZA 1EU4A 2KWCA 4WJPA 1JWSD 2CHWA 2MLBA 3MC0B 1IBXB 2G4DB 4YTNB 2QIEB 4GOCA 2KLCA 2LZ6A 1YOVB 1E10A 2IZVB 3AM9A 1WR6E 5T8IA 3AULA 1L6VA 1Q0WB 2LD9A 3TSSA 2ZCBA 2HTME 3QK0A 3AECB 4BKSD 2KTRA 4HEA1 2DBYA 1KH0A 2JRIB 2K3UA 3P63A 2H89B 2AX5A 1F52A 5LXIB 1ROEA 1XT9B 1E6EB 5IA7A 1T0SC 2N1WA 2GBNA 2GMIC 4DXGA 2KC1A 1SBBB 2ZPNA 2W54A 2BTEA 3N30A 4WIPA 4IC7B 4KZ0A 2LJIA 2WS3B 1AYFA 2KANA 1JW9D 2BB6A 1SE2A 2K39A 4KSKC 1VR9A 3GE8C 2LASA 3ZYYX 4QAYA 2PVGC 1KM7A 5JZEB 3BYYB 3B1LX 3HVDA 3FKYA 1GUAB 1N63A 1FNWA 4GLSC 4PS7A 1D3ZA 1YN3A 4C00A 2BKFA 1FCLA 1ET6A 2K8BA 4MM3B 1JRUA 2C60A 4AQ7A 1WZ3A 3ZRFA 2REXA 3VTUA 2WXIA 1FFUA 4W9DA 1CJEA 2LRWA 3KVFB 4I6LB 3PS6A 2AWTA 1XCQL 2QC8A 4HJKA 2WXRA 4MGKE 5H92C 1G6JA 3FC4A 1D5XC 2RGFA 1FFVA 2BYVE 4RNAA 2KACA 2MBBB 4KGSA 1VZ8A 1D4BA 1CMXB 1QOAA 2RSUA 4WJNA 2KQ7A 3RUIB 1SJED 2INPE 1MG4A 1E8XA 3ZGZA 3EECA 1UUPA 2NCNA 2KKCA 1C4AA 1ACCA 2MJEA 1YX5B 3L17A 1UBIA 1WJUA 1WXVA 2WYQA 1SXTA 1QLBB 4BOSC 1P98A 1FO4A 2LVQA 1WMHB 3IVFA 5JHBA 1RFAA 1MHHE 2DZKA 3QA8A 3TEZA 2DENB 2INNE 2CJNA 4TQ1A 5LLIA 1C9FA 1Q1OA 2DZJA 2N7EA 1QOBA 3I9V1 3U8ZA 2ZJDA 4FJVB 1WJNA 2K1FA 4M00A 2IY0B 2BBCA 4ZRJA 4MACA 3BY4B 3EA6A 4B9KA 3Q14C 2G45B 3LJ3A 3AU5A 4XX5A 1WFYA 2MJDA 1IGCA 5AUIA 3AE5B 1T0RC 1V49A 2PPHA 1XLPA 2KVZA 4W9IA 4TUUA 3H1UA 1L6UA 1UBQA 3ZNID 3AE1B 5FR3A 2XK5B 3WIMA 1PDXA 3OLMD 4N6EB 2QMTA 2IJ0A 5IOIA 1UELA 1TGZB 4FHJA 1J19A 1OFFA 4HPLB 2V3PA 2LFIA 4ZYSA 3KW5B 1C79A 4FN2A 3B9JA 3SU8X 2MP2B 4TMAB 2IO0B 4ANWA 4IM2A 2CR5A 1GB4A 2L8JA 2D07B 2KXJA 5MPOA 4ZOHC 3RNEC 1GC7A 1HEZE 1KTKA 3IG3A 3AEAB 1XLNA 4KDIC 2JYEA 1STEA 4MH0E 1X1MA 3L16A 2Z59B 3AEFB 2G1EA 3R7RA 3KUCB 4HRSA 4WWPA 2X38A 2D2QA 4K81A 3B0AA 2IPKD 3LYYA 1QOFA 4ARCA 2PW9A 4K3CA 2KN5A 5J2RA 3A9JA 4MSQB 4EKUA 5EE1A 3ZNZB 1I4QA 3FAHA 1WIAA 4DXFA 3L0WB 4HXDA 2KLGA 4LJPB 5KHOA 1C78A 2KN4A 4K1RB 4PYUA 1SE4A 3KH0A 2R2QA 4PYZA 2B76B 3DBSA 3AV8A 1RWSA 5GXGB 2WU5B 4GXBA 2WGSA 2W9NA 2JX5A 2BPSA 1P9DU 1ISNA 3N3KB 4WAFA 2YVCA 3P4QB 2L1AA 4OZCA 4JL9A 4HKZE 3R7QA 3UIPB 3B2GA 4WH4A 2KJHB 5C3JB 3QC8B 4XWTA 3EC8A 4OHJA 3V6CB 1PYWD 4ASWC 3AMZA 4TSSA 3MC8A 2K9XA 1YJIA 2BS4B 2YLMA 1FIQA 1IP9A 3DHGC 2N9KA 2QDFA 3RNGC 1UWXA 2L7RA 4US8A 3RFZB 3W1SC 2SAKA 3MHZA 1BMLC 5HKHA 2MQJA 4N9F4 1ZUD2 1R4MI 2K25A 2GLSA 1R4MB 3GZNI 4OVVA 3RNBC 1M4VA 2K8HA 5CHFA 1WWTA 4YSZB 3AI5A 3RT3B 2MBHA 2I38A 3VXWA 4LNIA 2CJOA 2JYTA 2RR9A 3PZDA 3QJZA 3ZJVA 4REZA 1V86A 2WX0A 4US9A 1V6EA 2KFJA 4GU2A 4RM8A 2O2VA 4MT5A 4FHKA 4B0EA 4I6NB 1C4PA 3Q6BA 4RGTA 1E8WA 1Q10A 2HJ8A 4HPMB 3L4PA 2FNJB 3AEEB 1YJ1A 2O6VA 4YSYB 1TT5B 1KLGD 4ICVA 4WWOA 3PZ8A 3WANA 1MPEA 1GNUA 2GBRA 3KWVA 2NTTA 1BUIC 1HTQA 1J7BA 2M19A 2JY6A 1FM0D 4II3B 4E74A 1UGMA 3PLVA 2DHZA 4LNOA 4M0WA 2Z8LA 1D6EC 5L95C 2ONQA 4BKTA 2LGIA 4GDKA 4NQKE 5EDSA 2JQRB 1LQBA 2ZZPB 4JPSA 1D5ZC 4MGYE 2ZEQA 3GE3C 1GJZA 2OOBB 5AZHA 3PHWB 4C56C 5LXHA 4HK2A 2V3SA 1JWBD 1DOXA 1NI3A 4M8NA 3T9LA 1T3QA 3Q69A 1EO6A 1ZOYB 2KD0A 4G11A 1OQQA 1DGJA 2H88B 1TZ1A 1FXTB 2R61A 3VTVA 5EE3A 2MBQA 5HI1A 2LXAA 4URKA 1JALA 3W5UB 1KLVA 3H7PB 4BKSA 1TY0A 5E6NA 4K7WA 4JLCA 4ITKA 3DWGC 1UH6A 4XE0A 1C3TA 2CU3A 2WXPA 5IP4D 4W9FA 2PEAA 2BT6A 3W2DA 4AJYB 3HRDD 1Z2MA 5CX3A 1WX7A 4CYEA 2L00B 4P1CC 1TBEA 3TBLD 1GG3A 1R4NI 2WXHA 1HTOA 2N4FA 1H8CA 2KMMA 2WHIA 3PVLA 3W5VB 2DNFA 2WXOA 1C77A 1FXIA 2JPHA 1ZDXA 3V61A 3UQAA 1SIFA 1LGRA 4WQOB 4IKGA 4BBNF 2L0FA 4EOYA 2QCZA 2V0GA 2AYOB 3JSVB 2LXCA 5D7GA 3A9KA 1CK1A 5AZGA 3R66C 5G5HA 2IBIB 2DYOA 3I3TB 1UWMA 2JZPA 2INCC 2AQ1B 1YNTE 4K7SA 3TIXA 5G55A 2BW2A 1YD8U 4M8MA 3Q3FA 1WGYA 4ANXA 3HM3A 2ICIA 3MP9A 3ZTDA 3GB1A 3A4RA 3AE4B 3JYUA 1L5PA 2WXLA 3HK0A 4EEWA 3U30A 4DHJB 3URYA 1EU3A 1FXAA 2KJRA 2C7HA 1ZKHA 2EKEC 3Q8BA 4D2KA 1ZDVA 1WE7A 3OWEB 4R3DA 2C9WB 2R2OA 1QT9A 1WY8A 1XF5L 3H7SA 4A55A 1UGJA 4GN1A 2Y5PA 1ET9A 5HFYA 1YX6B 2KHWB 3VR8B 1NYQA 2NMQA 1N6ZA 3OAWA 1T0QC 5EE9A 1K51A 2D3BA 2EMTA 2BQQA 2LGSA 3T3NA 4C80A 2FBWB 3JVZX 4KIKB 1T0YA 1K53A 2IGDA 2IO3B 4HWIB 1L7YA 3TEXA 3Q8CA 2W55A 4ZRIA 5BYRA 2J4XA 4M02A 1S3SG 3NS1A 2WXGA 4XZ4A 2QEJC 4HROA 3SFDB 2JVCA 4BZAA 3AEBB 2BF8B 3KYCD 1MJDA 3O13A 2LWPA 3IXSA 2GBKA 5I4DA 1NDDA 5TSSA 1WGDA 3ZUNA 4LDTB 1ENFA 3SD5A 3NZSA 4IWPA 1K8RB 5G5GA 1PGBA 3QAQA 2J42A 2QJLA 3RCZA 1HXYD 5BMGA 3QIJA 3MTNB 5EE0A 1JQ4A 3ONSA 4C4VA 4JWSC 2VH1A 4NAWB 1WZ0A 2KDFB 2LGDA 2BWFA 4MJSA 5BYQA 3SR6A 3NUHB 4CQNA 2CKHB 1I4GA 4BVUC 4EZKA 4N59A 1N62A 1E9MA 1VJKA 1I42A 2MJ3A 3DPDA 1SF0A 1ZE3D 2HE7A 2N7DA 4L23A 1EUVB 4ARIA 2K22A 2V9HA 4L2YA 4A90A 4FJYA 2UYZB 3Q3OC 2N9PC 5GMVA 2DZMA 2LMCA 3VDZA 1V5OA 1OGWA 4F7ZA 4HKQA 2Q5WD 3GP7A 3V60A 4P16A 1F1HA 2MSED 4TKNA 1WI0A 3TJPA 2IY1B 4KX6B 1N5WA 3DDCB 2L76A 2MH7A 1L2NA 1MFWA 1QOGA 2Z0EB 1YIWA 1TKGA 5FKAC 2LGYA 1MG8A 2FUHB 1Q5WB 1WXAA 3PSEB 4HDOA 4M01A 3WAPA 1VRAB 3M3JA 2D11A 2ON8A 1TTNA 2LVOA 2J0MA 2VRRB 1TIFA 3BK2A 1XLQA 4DK5A 4AP4C 3NVVA 1P7FA 3ZVVA 2W3SA 4YWGG 3ZO5B 1K52A 3HM6X 2IDYA 1XO3A 2JUOA 3K9OB 1LXDA 1KRHA 2QHOA 1OEYA 1I4RA 2NBUA 1UZXB 2PMVA 2YEPB 5JXVA 4WJOA 2W82A 4WWMA 3E9SA 1JWAD 3RZFA 2KTRB 2KAJA 3H6NA 2D5GA 1V2YA 4OZAA 5BO4B 1QKZA 1J7AA 3N9YC 1GB1A 1H4RA 3BIID 3I57A 3MJ5A 3A1QA 4HJGE 4L1BA 2MBEA 3BYTB 2HDEA 1TS3A 1WJ4A 5D2MB 2CU1A 4BKGA 5TR5A 1R7SA 3HHMA 3VQIA 1FMAD 2SEBD 4IM3A 2JZZA 1F77A 3M63B 2JWZA 2BS2B 2INDC 2FE8A 2JXTA 3VAWA 5IN7A 1WGRA 4EUTA 1PGXA 2AL6A 2RPVA 1NYRA 2L3ZA 4NPNA 2V4LA 4ACFA 2D3AA 3VH3B 3DVGY 2KT7A 5DPSA 1E5WA 2M1MA 1E8YA 1FNVA 4DDGD 2KOXA 4F1SA 2FCSA 3AB5A 3QHTA 3SDLC 1EM7A 3IFWB 1RFKA 3KLSX 4BBNC 3FILA 4W9JA 3VUWA 3SHQA 2NBWB 4ICUA 3TCAA 3BK1A 1JWUD 4ZDVA 2LVPA 2MW5A 1YN5A 3ENEA 4LNKA 3O65B 3R2TA 4LNFA 1WYGA 3TEWA 4B0MA 2NPTA 1WH3A 3PRPB 2GBMA 4NZLB 2KDMA 1SE3A 1YMHE 2RDGA 4EE2A 2EELA 2WDQB 2LJ5A 4G50A 3Q8AA 4GDLA 4J3OD 2BYEA 1TKEA 4DHZB 2IGGA 2VZKB 3EFUA 3MFGA 2IO2B 4J6IA 2WXJA 3DVNU 2WXKA 3M62B 4JGHB 3DCGA 4AOFA 3R2IA 1RRBA 2IYDB 1NVID 3GOEA 3OJ3A 1E90A 1QZEA 1DOIA 2HD5B 3X0WA 4EFOA 1TS4A 4LK0M 1MHXA 1FCCC 1B1ZA 2BVCA 5C2TB 3QQ8B 3RD2A 1UNSA 2K6DB 3NVWA 1YN4A 3ZW3A 2ZW1A 2ZVNA 4KKJA 3AE6B 4YTPB 2KQ4X 1WXSA 3AN1A 3UGBB 4RCOA 2DX5B 3ZXVA 3JW0X 1WM2A 2DZIA 1GPXA 4USAA 3QWZB 4F8CB 3APDA 3W1YA 3S2AA 3GZNB 2KFKA 3AE9B 3IAM1 1XEEA 2FCQA 1RLFA 2KYWA 1YQ4B 2N0SB 4MELA 2L32A 3UQBA 4A3PA 1L0XB 3IT6B 3M95A 3VHTC 4JE3B 2LHEA 3DBRI 3IT4B 3DVGX 4FULA 3KUZA 3H9DA 3C0RB 4LCDE 2XNAC 3KQ4A 3NG0A 1PGAA 4HCPB 2BYTA 1P7EA 4X57B 4BFRA 2BWES 5J18A 1J7CA 2NBVB 1QILA 3GS2A 4YTMB 1A70A 5BMHA 3LXFA 3NZ3A 4PS3A 3V62A 2A4ZA 1V1PA 4LNNA 3AU4A 3C8YA 3L10B 2ZPYA 4ZRQA 1IBXA 3CSTA 4NQLB 2ACZB 4KVGB 1RM6C 1VD2A 1RYJA 2N9EB 4B95A 2Y3AA 1AW7A 3AH7A 4RF0A 2M8SA 4RF1A 3RN9C 3PV1A 3A9JB 4DWFA 2RPQA 2M0XA 3APCA 2WXFA 4EZJA 1WXQA 4JWUC 1PQSA 4KV2A 3RYTA 2XEWA 1EF1A 1T5XD 4EZLA 2NTSA 3BVZA 3P1MA 2M4NA 4ZHPA 2RD0A 1JRPA 2LI5A 4O1NA 3ML9A 3Q2AC 5BYSA 3DVNV 1V8CA 1BT0A 2FAZA 4CHKA 3LDZE 3WCQA 1VZ7A 3K9PB 5C23A 1R4NB 2DAFA 4RGNA 2E6XA 4IWQA 3LB8C 4AJWA 1CQVA 1EWYC 5CHVC 1L0VB 3BVMA 3BVGA 2ZNVC 4YL8A 1OTRB 2WU2B 1KLUD 4MGIE 1I7HA 1JWMD 4HDQA 1QF6A 3MHSD 1E7UA 1NBFC 3VFKA 4MM3A 3ZKJC 3P2BA 3CIRB 4OVUA 4WWNA 3VTWA 2WQYB 2E3TA 1FPYA 1EWCA 1IYFA 3ML8A 4DDID 1TS5A 2LUMA 3AEGB 3N1YC 5CTRC 1A5RA 2IGHA 2KX3A 1WYWB 2J7QB 2RMMA 1L4ZB 2WXNA 2KWUB 4XYCA 4DHJD 2MHJA 2GI9A 1L4DB 4ANVA 1FEHA 4YSXB 3T3OA 1WF9A 3RNCC 3PHXB 2LUEA 2AL3A 2UU7A 1SSNA 3Q8FA 4IW0A 2JSVX 2PKOA 3DBHI 2PJHA 2BKRB 3H8HA 3R3MA 2O2VB 3X23A 3ZJUA 4JX1C 3ZNGC 3NZUA 4LLGM 2O6VB 3E56A 3AXCA 1WMHA 3PLUA 2ZW0A 4A8XC 3CWIA 3U2SC 3APFA 4IWOA 1E0ZA 4W9KA 3NRZA 2Y5CA 4KKIA 4ZRPA 4M0WB 3V05A 3VUXA 4DQOC 3ZTCA 3Q3MC 4GDKB 2KVRA 4RMAA 2KK8A 2K6QA 4E3CA 2G9HD 1TKYA 2UWQA 4P7IA 4A6QA 2ZNVB 3PRZA 5H8YE 1WM3A 1KFYB 4LDTD 3OG5A 1JCKB 2WXQA 1HZ6A 3UI3A 5C1ZA 4WJQA 3ZIMA 2WDTB 1ZGUB 3UIOB 4ZYNA 4OVZA 1AWDA 1LFDA 2MX2A 1I35A 4AWJA 4MEMA 1IPGA 1VDVA 2DWQA 4S0RA 4RH6A 3ZXRA 4S17A 3TL5A 5IO9A 3RULA 2K8CA 5HHDG 4MH8A 5JH5C 2XK5A 1DOYA 1VZ6A 4WQMA 4YT0B 2GB1A 4P1BC 3WAOA 4H2AA 4WURA 2KTFA 3PTFC 1DYQA 1S1QB 4NJCA 2KQSA 2C7MB 3ETRA 3CSFA 3N1XC 4C7YA 1FNUA 2KDIA 2A5UA 3N20C 3P4RB 1KOTA 2MP2A 3SEBA 1SIJA 1B9RA 2CHXA 1IUEA 2JT4B 5AEKB 2J53A 3OJ4B 2KMAA 1TJEA 1P0RA 1ZXIA 2LRUA 4WAAA 4PK1A 3PZ7A 4B6WA 1FRDA 2TSSA 2D3GA 3DBLI 3DBLB 2KC2A 1YQ3B 2GBJA 3J9CA 1YJJA 3TUOA 2MBOA 3RZWC 3VVWB 1M94A 1LO5D 3NVZA 2FCNA 2JU6X 1L0YB 3A9KB 4DXAB 2FUG1 4NNJB 1I4PA 2IO1B 4IUMB 4RFBA 1I4XA 2C7NB 3U4EG 1RAXA 4FLHA
chains in the Genus database with same CATH topology
5L95C 3L13A 3PRMB 4BKTA 3L08A 3ZLZA 1WH3A 3PRPB 4GDKA 2GBMA 2KWCA 4NQKE 4FADA 4WJPA 5EDSA 2CHWA 2MLBA 1LQBA 2ZZPB 4MGYE 2G4DB 2ZEQA 1GJZA 2OOBB 4GOCA 5AZHA 2KLCA 2LZ6A 3PHWB 3IHPC 4DBGA 2LJ5A 3NHEB 4ZRKA 4G50A 2IZVB 4GDLA 4HK2A 2V3SA 5LXHA 2MRPA 1WR6E 3AULA 2BYEA 4M8NA 5CHWA 3T9LA 2FCMA 1Q0WB 2LD9A 4DHZB 2I1KA 2L0TA 1EO6A 2ZCBA 2KD0A 4G11A 3EFUA 3QK0A 4BKSD 2KTRA 1V5TA 2IO2B 1E7VA 2GOWA 5KHQA 4J6IA 1TZ1A 2I1JA 1FXTB 3DVNU 3PPAA 3VTVA 3M62B 4JGHB 2JRIB 4E71A 3DCGA 4AOFA 2MBQA 1RRBA 2LXAA 4URKA 2IYDB 1KLVA 4GB9A 3H7PB 4ANUA 3GOEA 2DYMA 3OJ3A 1XT9B 1E90A 1QZEA 5LXIB 2HD5B 3X0WA 4BKSA 4EFOA 5IA7A 5E6NA 3VH4B 4K7WA 1OEYJ 4GIVA 2N1WA 4JLCA 2GBNA 3ZDMC 3RD2A 1UH6A 2GMIC 3QQ8B 1C3TA 2K6DB 2KC1A 2ZPNA 3ZW3A 5J17A 2CS4A 4W9FA 2ZVNA 3N30A 2PEAA 4AJYB 1Z2MA 5CX3A 3T8MA 4IC7B 4KZ0A 1WX7A 3QX1A 2KANA 5L83A 1WXSA 4CYEA 2KX0A 2L00B 3UGBB 1TBEA 3TBLD 5DPWA 2DX5B 2K39A 4KSKC 3JW0X 1WM2A 2DZIA 3QWZB 4F8CB 1GG3A 2LASA 2NS5A 3APDA 3PLVA 1R4NI 3B08A 2N4FA 3NY5A 1H8CA 3W1YA 1KM7A 4JQWC 3S2AA 3PVLA 1NI2A 4NY0A 5JZEB 2KFKA 3CF6E 2FIFA 3B1LX 3PGEA 2FCQA 2JPHA 1GUAB 1RLFA 3V61A 3IBEA 2J0JA 1SIFA 3UQAA 4PS7A 4WQOB 4MELA 2D10A 3UINB 1D3ZA 4PS8A 5JHAA 3UQBA 4BBNF 4A3PA 3M95A 3VHTC 2BKFA 2L0FA 3DBRI 4MDKE 3DVGX 4EOYA 4FULA 2K8BA 3KUZA 2KO3A 3H9DA 4IG7B 1JRUA 4CO7A 2BYFA 1LM8B 2C60A 3C0RB 4LCDE 2AYOB 3JSVB 1WZ3A 3HIZA 3KYDD 2REXA 2LXCA 3VTUA 3ZRFA 5D7GA 3A9KA 4W9DA 5AZGA 3V6EB 3R66C 4HCPB 3ZNHB 1SE9A 2LRWA 3KVFB 4I6LB 4X57B 2IBIB 3PS6A 4BFRA 2AWTA 2BWES 2DYOA 2NBVB 3I3TB 4MJSB 4W9CA 5J18A 4HJKA 4MGKE 1G6JA 4BOZB 2RGFA 4K7SA 3TIXA 5G55A 2BYVE 4MSMB 1YD8U 2MBBB 4DHZE 4M8MA 3Q3FA 1WGYA 4NJ7A 1CMXB 3HM3A 4PS3A 3V62A 4ANXA 2RSUA 2V1YA 4WJNA 2A4ZA 2KQ7A 3RUIB 2Z0DB 3AU4A 3ZTDA 1E8XA 1XD3B 3A4RA 3EECA 3JYUA 3L10B 2ZPYA 3CSTA 3HK0A 4NQLB 4EEWA 2KDBA 2NCNA 2KKCA 3U30A 4DHJB 3U7DA 4KVGB 2ASQA 2KJRA 4KZCA 2C7HA 1ZKHA 1YX5B 1VD2A 2EKEC 3L17A 1UBIA 1WJUA 1WXVA 2BGFA 2WYQA 3W1SA 2N9EB 1P98A 4BOSC 4B95A 2LVQA 1WMHB 3IVFA 4HLEA 5JHBA 4JIOU 5DPRA 1RFAA 2M8SA 2DZKA 1WE7A 3QA8A 3PV1A 3A9JB 2C9WB 2R2OA 1WY8A 3ALBA 3H7PA 3H7SA 1WE6A 4DWFA 2DENB 2RPQA 2M0XA 1SGHA 2MWSB 3APCA 4GN1A 4KDLB 5E6OA 4EZJA 3DOWA 4TQ1A 5LLIA 1YX6B 1PQSA 2KHWB 4KV2A 5D6JB 3RYTA 2XEWA 1Q1OA 2DZJA 2N7EA 3OAWA 1EF1A 3PT2B 4EZLA 3U8ZA 2ZJDA 4FJVB 1WJNA 5AZFA 2M4NA 1EF5A 2K1FA 2RD0A 2LI5A 2EMTA 2IY0B 4ZRJA 1GC6A 3BY4B 1WGGA 3L54A 2NPTA 5G2NA 4B9KA 3KUDB 2JZ3B 3ML9A 3JVZX 4KIKB 1T0YA 2G45B 1WRDB 3LJ3A 2IO3B 3AU5A 4HWIB 4XX5A 1L7YA 4II2B 3DVNV 1WX8A 1WFYA 4ZRIA 1BT0A 2FAZA 2MCNB 1S3SG 4CHKA 3LDZE 3WAMA 4XZ4A 3MJWA 4IM0A 2JVCA 1V49A 2BF8B 2PPHA 3K9PB 1UD7A 5C23A 3KYCD 1Z5SB 2LWPA 2DAFA 2PE6B 2GBKA 1NDDA 4W9IA 4TUUA 3H1UA 4IWQA 1WGDA 3ZUNA 4LDTB 4AJWA 1UBQA 3SD5A 3NZSA 4IWPA 2NVUI 5CHVC 3ZNID 3A1QB 1K8RB 2ZNVC 1J8CA 4YL8A 2FIDA 1OTRB 3QAQA 4MGIE 2XK5B 3WIMA 4HDQA 2KWVB 3MHSD 1E7UA 1NBFC 3RCZA 3OLMD 3VFKA 4MM3A 3ZKJC 3P2BA 3QIJA 1V80A 3MTNB 1VCBA 4OVUA 4WWNA 3VTWA 4XC2A 2PE9A 3A4SC 3JSVA 3ONSA 1OQYA 2JF5A 2JRHA 1J0GA 4NAWB 1UELA 1IYFA 1TGZB 4FHJA 1F9JA 3ML8A 1V9JA 1WZ0A 4DDID 1J19A 2KDFB 2LGDA 2BWFA 4HPLB 4MJSA 3KW5B 5CTRC 4FN2A 3QCAA 4TQ0A 1A5RA 5IAAC 3SU8X 2CKHB 2KX3A 2KZRA 2MP2B 4BVUC 4EZKA 4HCNB 1WYWB 2IO0B 4ANWA 2J7QB 4IM2A 2CR5A 2EMSA 2KWUB 4DHJD 1I42A 2L8JA 2D07B 2KXJA 4ANVA 3DPDA 2CHZA 1U4AA 3PREA 1WX9A 1WF9A 2HE7A 2N7DA 5FR6A 1EUVB 3PHXB 4G0NB 2LUEA 2WX1A 4HVBA 2AL3A 1GC7A 4FJYA 2UYZB 4IW0A 5E6PA 3DBHI 3A33B 3IG3A 3NOBA 3Q3JA 2PJHA 4KDIC 2N9PC 5GMVA 2BKRB 4MH0E 1V81A 2DZMA 1X1MA 3L16A 2DAJA 2XBBC 3R3MA 3VDZA 2O2VB 3X23A 2AEHA 1V5OA 1OGWA 2Z59B 1WXMA 4F7ZA 3V60A 1WGHA 2MSED 1AARA 4TKNA 3R7RA 3KUCB 3ZNGC 4WWPA 1WI0A 2N9XA 3NZUA 2IY1B 3TJPA 2O6VB 2JXXA 2D2QA 3AXCA 1WMHA 3DDCB 2L76A 4K81A 3B0AA 1L2NA 2Z0EB 3PLUA 1YIWA 3N32A 2KN5A 5J2RA 3A9JA 4MSQB 3UF8A 2LGYA 3APFA 4IWOA 1MG8A 4EKUA 1KJTA 3ZNZB 2FUHB 1Q5WB 4W9KA 2ZCCA 1WXAA 1WIAA 3PSEB 4HDOA 3L0WB 3WAPA 4HXDA 2KLGA 4LJPB 2NPTB 3M3JA 2D11A 4KSLC 4M0WB 5KHOA 3VUXA 1TTNA 2LVOA 5DCNA 2J0MA 4FBJB 3ZTCA 2VRRB 4GDKB 2KVRA 1HE8A 3EHVA 4K1RB 4RMAA 4W9HA 4AP4C 2KK8A 4DK5A 2K6QA 4PYUA 2ZVOA 4E3CA 3KH0A 2R2QA 4PYZA 3ZVVA 2UWQA 4P7IA 3DBSA 3ZO5B 1E8ZA 1P3QU 2ZNVB 3HM6X 4W9GA 2JUOA 3K9OB 1LXDA 2QHOA 3PRZA 1OEYA 4KIKA 4GDLB 4GXBA 1WM3A 3TMPB 2NBUA 4LDTD 2DYBA 2W9NA 3VUYA 1UZXB 4RM9A 2BPSA 4WJOA 1P9DU 1ISNA 3N3KB 2LGXA 4W9LA 3RZFA 2KTRB 5C1ZA 4K7UA 4WJQA 3ZIMA 1XQQA 2WDTB 1ZGUB 2J0KA 2YVCA 3H6NA 2Y5BB 1V2YA 4ZYNA 4JL9A 1LFDA 2MX2A 3UIOB 3R7QA 1I35A 4AWJA 2WWZA 3UIPB 4MEMA 1IPGA 5BO4B 4NJ6A 2MA9B 4FJZA 2HTHA 1H4RA 2KJHB 1ZW7A 3TL5A 3QC8B 3RULA 3EC8A 3A1QA 2K8CA 5DPTA 3V6CB 2MBEA 4ASWC 4GMVA 3WA0A 2XK5A 5JH5C 2B3AA 1WJ4A 5D2MB 4W9EA 2CU1A 2YLMA 4BKGA 2KJ6A 5TR5A 3HHMA 3VQIA 1IP9A 3WAOA 4IM3A 4NAWA 2C5LC 2JZZA 2L7RA 4A20A 2KTFA 3W1SC 3PTFC 1S1QB 2KQSA 2C7MB 5HKHA 2MQJA 4I6PA 4N9F4 3CSFA 1R4MI 2K25A 3M63B 4G3XB 2JWZA 1C1YB 3ECIA 2KDIA 3GZNI 2A5UA 4OVVA 1KOTA 2K8HA 2MP2A 4GSWA 5CHFA 3AI5A 2CHXA 2JT4B 5AEKB 2NR2A 5D94A 2N1VA 2G4SA 3DQVA 3OJ4B 2MBHA 4LJOB 3RT3B 3VXWA 2KMAA 3VAWA 4GGQA 3ZRCA 1Y8RC 2RR9A 3PZDA 3QJZA 1WGRA 4EUTA 1P0RA 2AL6A 2KFKB 3NS8A 2L3ZA 4NPNA 2V4LA 2LRUA 1YQBA 4WAAA 2KMCA 4B6WA 3VH3B 3CMMB 3DVGY 2O6VD 4A3OA 2D3GA 3DBLI 1V86A 1E5WA 2M1MA 1E8YA 2WX0A 2KC2A 5DPSA 1V6EA 2OJRA 4DDGD 2KFJA 2KOXA 4GU2A 4RM8A 4F1SA 2O2VA 2GBJA 2M17A 2FCSA 4FHKA 3QHTA 1WJ6A 2MBOA 4I6NB 3SDLC 4AUQC 3RZWC 3VVWB 3IFWB 1M94A 4BBNC 1P1AA 2FCNA 1E8WA 2HJ8A 4HPMB 4TV3A 4W9JA 3VUWA 2FNJB 3A9KB 1YJ1A 2O6VA 3SHQA 3BINA 4FA6A 2NBWB 4WWOA 4ICVA 3WANA 3WALA 4ICUA 1GNUA 2GBRA 3TCAA 3ZDTA 4DXAB 4MGZE 4NNJB 4ZDVA 2IO1B 2LVPA 4IUMB 2MW5A 3ENEA 2KDEB 3O65B 2KNBA 1WR1A 2C7NB 2G3QB 2JY6A 1RAXA 4II3B 4E74A 1UGMA 2DHZA 3D32A 4FLHA 3QARA 2L05A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5L95 C;  3L13 A;  3PRM B;  4BKT A;  3L08 A;  3ZLZ A;  1WH3 A;  3PRP B;  4GDK A;  2GBM A;  2KWC A;  4NQK E;  4FAD A;  4WJP A;  5EDS A;  2CHW A;  2MLB A;  1LQB A;  2ZZP B;  4MGY E;  2G4D B;  2ZEQ A;  1GJZ A;  2OOB B;  4GOC A;  5AZH A;  2KLC A;  2LZ6 A;  3PHW B;  3IHP C;  4DBG A;  2LJ5 A;  3NHE B;  4ZRK A;  4G50 A;  2IZV B;  4GDL A;  4HK2 A;  2V3S A;  5LXH A;  2MRP A;  1WR6 E;  3AUL A;  2BYE A;  4M8N A;  5CHW A;  3T9L A;  2FCM A;  1Q0W B;  2LD9 A;  4DHZ B;  2I1K A;  2L0T A;  1EO6 A;  2ZCB A;  2KD0 A;  4G11 A;  3EFU A;  3QK0 A;  4BKS D;  2KTR A;  1V5T A;  2IO2 B;  1E7V A;  2GOW A;  5KHQ A;  4J6I A;  1TZ1 A;  2I1J A;  1FXT B;  3DVN U;  3PPA A;  3VTV A;  3M62 B;  4JGH B;  2JRI B;  4E71 A;  3DCG A;  4AOF A;  2MBQ A;  1RRB A;  2LXA A;  4URK A;  2IYD B;  1KLV A;  4GB9 A;  3H7P B;  4ANU A;  3GOE A;  2DYM A;  3OJ3 A;  1XT9 B;  1E90 A;  1QZE A;  5LXI B;  2HD5 B;  3X0W A;  4BKS A;  4EFO A;  5IA7 A;  5E6N A;  3VH4 B;  4K7W A;  1OEY J;  4GIV A;  2N1W A;  4JLC A;  2GBN A;  3ZDM C;  3RD2 A;  1UH6 A;  2GMI C;  3QQ8 B;  1C3T A;  2K6D B;  2KC1 A;  2ZPN A;  3ZW3 A;  5J17 A;  2CS4 A;  4W9F A;  2ZVN A;  3N30 A;  2PEA A;  4AJY B;  1Z2M A;  5CX3 A;  3T8M A;  4IC7 B;  4KZ0 A;  1WX7 A;  3QX1 A;  2KAN A;  5L83 A;  1WXS A;  4CYE A;  2KX0 A;  2L00 B;  3UGB B;  1TBE A;  3TBL D;  5DPW A;  2DX5 B;  2K39 A;  4KSK C;  3JW0 X;  1WM2 A;  2DZI A;  3QWZ B;  4F8C B;  1GG3 A;  2LAS A;  2NS5 A;  3APD A;  3PLV A;  1R4N I;  3B08 A;  2N4F A;  3NY5 A;  1H8C A;  3W1Y A;  1KM7 A;  4JQW C;  3S2A A;  3PVL A;  1NI2 A;  4NY0 A;  5JZE B;  2KFK A;  3CF6 E;  2FIF A;  3B1L X;  3PGE A;  2FCQ A;  2JPH A;  1GUA B;  1RLF A;  3V61 A;  3IBE A;  2J0J A;  1SIF A;  3UQA A;  4PS7 A;  4WQO B;  4MEL A;  2D10 A;  3UIN B;  1D3Z A;  4PS8 A;  5JHA A;  3UQB A;  4BBN F;  4A3P A;  3M95 A;  3VHT C;  2BKF A;  2L0F A;  3DBR I;  4MDK E;  3DVG X;  4EOY A;  4FUL A;  2K8B A;  3KUZ A;  2KO3 A;  3H9D A;  4IG7 B;  1JRU A;  4CO7 A;  2BYF A;  1LM8 B;  2C60 A;  3C0R B;  4LCD E;  2AYO B;  3JSV B;  1WZ3 A;  3HIZ A;  3KYD D;  2REX A;  2LXC A;  3VTU A;  3ZRF A;  5D7G A;  3A9K A;  4W9D A;  5AZG A;  3V6E B;  3R66 C;  4HCP B;  3ZNH B;  1SE9 A;  2LRW A;  3KVF B;  4I6L B;  4X57 B;  2IBI B;  3PS6 A;  4BFR A;  2AWT A;  2BWE S;  2DYO A;  2NBV B;  3I3T B;  4MJS B;  4W9C A;  5J18 A;  4HJK A;  4MGK E;  1G6J A;  4BOZ B;  2RGF A;  4K7S A;  3TIX A;  5G55 A;  2BYV E;  4MSM B;  1YD8 U;  2MBB B;  4DHZ E;  4M8M A;  3Q3F A;  1WGY A;  4NJ7 A;  1CMX B;  3HM3 A;  4PS3 A;  3V62 A;  4ANX A;  2RSU A;  2V1Y A;  4WJN A;  2A4Z A;  2KQ7 A;  3RUI B;  2Z0D B;  3AU4 A;  3ZTD A;  1E8X A;  1XD3 B;  3A4R A;  3EEC A;  3JYU A;  3L10 B;  2ZPY A;  3CST A;  3HK0 A;  4NQL B;  4EEW A;  2KDB A;  2NCN A;  2KKC A;  3U30 A;  4DHJ B;  3U7D A;  4KVG B;  2ASQ A;  2KJR A;  4KZC A;  2C7H A;  1ZKH A;  1YX5 B;  1VD2 A;  2EKE C;  3L17 A;  1UBI A;  1WJU A;  1WXV A;  2BGF A;  2WYQ A;  3W1S A;  2N9E B;  1P98 A;  4BOS C;  4B95 A;  2LVQ A;  1WMH B;  3IVF A;  4HLE A;  5JHB A;  4JIO U;  5DPR A;  1RFA A;  2M8S A;  2DZK A;  1WE7 A;  3QA8 A;  3PV1 A;  3A9J B;  2C9W B;  2R2O A;  1WY8 A;  3ALB A;  3H7P A;  3H7S A;  1WE6 A;  4DWF A;  2DEN B;  2RPQ A;  2M0X A;  1SGH A;  2MWS B;  3APC A;  4GN1 A;  4KDL B;  5E6O A;  4EZJ A;  3DOW A;  4TQ1 A;  5LLI A;  1YX6 B;  1PQS A;  2KHW B;  4KV2 A;  5D6J B;  3RYT A;  2XEW A;  1Q1O A;  2DZJ A;  2N7E A;  3OAW A;  1EF1 A;  3PT2 B;  4EZL A;  3U8Z A;  2ZJD A;  4FJV B;  1WJN A;  5AZF A;  2M4N A;  1EF5 A;  2K1F A;  2RD0 A;  2LI5 A;  2EMT A;  2IY0 B;  4ZRJ A;  1GC6 A;  3BY4 B;  1WGG A;  3L54 A;  2NPT A;  5G2N A;  4B9K A;  3KUD B;  2JZ3 B;  3ML9 A;  3JVZ X;  4KIK B;  1T0Y A;  2G45 B;  1WRD B;  3LJ3 A;  2IO3 B;  3AU5 A;  4HWI B;  4XX5 A;  1L7Y A;  4II2 B;  3DVN V;  1WX8 A;  1WFY A;  4ZRI A;  1BT0 A;  2FAZ A;  2MCN B;  1S3S G;  4CHK A;  3LDZ E;  3WAM A;  4XZ4 A;  3MJW A;  4IM0 A;  2JVC A;  1V49 A;  2BF8 B;  2PPH A;  3K9P B;  1UD7 A;  5C23 A;  3KYC D;  1Z5S B;  2LWP A;  2DAF A;  2PE6 B;  2GBK A;  1NDD A;  4W9I A;  4TUU A;  3H1U A;  4IWQ A;  1WGD A;  3ZUN A;  4LDT B;  4AJW A;  1UBQ A;  3SD5 A;  3NZS A;  4IWP A;  2NVU I;  5CHV C;  3ZNI D;  3A1Q B;  1K8R B;  2ZNV C;  1J8C A;  4YL8 A;  2FID A;  1OTR B;  3QAQ A;  4MGI E;  2XK5 B;  3WIM A;  4HDQ A;  2KWV B;  3MHS D;  1E7U A;  1NBF C;  3RCZ A;  3OLM D;  3VFK A;  4MM3 A;  3ZKJ C;  3P2B A;  3QIJ A;  1V80 A;  3MTN B;  1VCB A;  4OVU A;  4WWN A;  3VTW A;  4XC2 A;  2PE9 A;  3A4S C;  3JSV A;  3ONS A;  1OQY A;  2JF5 A;  2JRH A;  1J0G A;  4NAW B;  1UEL A;  1IYF A;  1TGZ B;  4FHJ A;  1F9J A;  3ML8 A;  1V9J A;  1WZ0 A;  4DDI D;  1J19 A;  2KDF B;  2LGD A;  2BWF A;  4HPL B;  4MJS A;  3KW5 B;  5CTR C;  4FN2 A;  3QCA A;  4TQ0 A;  1A5R A;  5IAA C;  3SU8 X;  2CKH B;  2KX3 A;  2KZR A;  2MP2 B;  4BVU C;  4EZK A;  4HCN B;  1WYW B;  2IO0 B;  4ANW A;  2J7Q B;  4IM2 A;  2CR5 A;  2EMS A;  2KWU B;  4DHJ D;  1I42 A;  2L8J A;  2D07 B;  2KXJ A;  4ANV A;  3DPD A;  2CHZ A;  1U4A A;  3PRE A;  1WX9 A;  1WF9 A;  2HE7 A;  2N7D A;  5FR6 A;  1EUV B;  3PHX B;  4G0N B;  2LUE A;  2WX1 A;  4HVB A;  2AL3 A;  1GC7 A;  4FJY A;  2UYZ B;  4IW0 A;  5E6P A;  3DBH I;  3A33 B;  3IG3 A;  3NOB A;  3Q3J A;  2PJH A;  4KDI C;  2N9P C;  5GMV A;  2BKR B;  4MH0 E;  1V81 A;  2DZM A;  1X1M A;  3L16 A;  2DAJ A;  2XBB C;  3R3M A;  3VDZ A;  2O2V B;  3X23 A;  2AEH A;  1V5O A;  1OGW A;  2Z59 B;  1WXM A;  4F7Z A;  3V60 A;  1WGH A;  2MSE D;  1AAR A;  4TKN A;  3R7R A;  3KUC B;  3ZNG C;  4WWP A;  1WI0 A;  2N9X A;  3NZU A;  2IY1 B;  3TJP A;  2O6V B;  2JXX A;  2D2Q A;  3AXC A;  1WMH A;  3DDC B;  2L76 A;  4K81 A;  3B0A A;  1L2N A;  2Z0E B;  3PLU A;  1YIW A;  3N32 A;  2KN5 A;  5J2R A;  3A9J A;  4MSQ B;  3UF8 A;  2LGY A;  3APF A;  4IWO A;  1MG8 A;  4EKU A;  1KJT A;  3ZNZ B;  2FUH B;  1Q5W B;  4W9K A;  2ZCC A;  1WXA A;  1WIA A;  3PSE B;  4HDO A;  3L0W B;  3WAP A;  4HXD A;  2KLG A;  4LJP B;  2NPT B;  3M3J A;  2D11 A;  4KSL C;  4M0W B;  5KHO A;  3VUX A;  1TTN A;  2LVO A;  5DCN A;  2J0M A;  4FBJ B;  3ZTC A;  2VRR B;  4GDK B;  2KVR A;  1HE8 A;  3EHV A;  4K1R B;  4RMA A;  4W9H A;  4AP4 C;  2KK8 A;  4DK5 A;  2K6Q A;  4PYU A;  2ZVO A;  4E3C A;  3KH0 A;  2R2Q A;  4PYZ A;  3ZVV A;  2UWQ A;  4P7I A;  3DBS A;  3ZO5 B;  1E8Z A;  1P3Q U;  2ZNV B;  3HM6 X;  4W9G A;  2JUO A;  3K9O B;  1LXD A;  2QHO A;  3PRZ A;  1OEY A;  4KIK A;  4GDL B;  4GXB A;  1WM3 A;  3TMP B;  2NBU A;  4LDT D;  2DYB A;  2W9N A;  3VUY A;  1UZX B;  4RM9 A;  2BPS A;  4WJO A;  1P9D U;  1ISN A;  3N3K B;  2LGX A;  4W9L A;  3RZF A;  2KTR B;  5C1Z A;  4K7U A;  4WJQ A;  3ZIM A;  1XQQ A;  2WDT B;  1ZGU B;  2J0K A;  2YVC A;  3H6N A;  2Y5B B;  1V2Y A;  4ZYN A;  4JL9 A;  1LFD A;  2MX2 A;  3UIO B;  3R7Q A;  1I35 A;  4AWJ A;  2WWZ A;  3UIP B;  4MEM A;  1IPG A;  5BO4 B;  4NJ6 A;  2MA9 B;  4FJZ A;  2HTH A;  1H4R A;  2KJH B;  1ZW7 A;  3TL5 A;  3QC8 B;  3RUL A;  3EC8 A;  3A1Q A;  2K8C A;  5DPT A;  3V6C B;  2MBE A;  4ASW C;  4GMV A;  3WA0 A;  2XK5 A;  5JH5 C;  2B3A A;  1WJ4 A;  5D2M B;  4W9E A;  2CU1 A;  2YLM A;  4BKG A;  2KJ6 A;  5TR5 A;  3HHM A;  3VQI A;  1IP9 A;  3WAO A;  4IM3 A;  4NAW A;  2C5L C;  2JZZ A;  2L7R A;  4A20 A;  2KTF A;  3W1S C;  3PTF C;  1S1Q B;  2KQS A;  2C7M B;  5HKH A;  2MQJ A;  4I6P A;  4N9F 4;  3CSF A;  1R4M I;  2K25 A;  3M63 B;  4G3X B;  2JWZ A;  1C1Y B;  3ECI A;  2KDI A;  3GZN I;  2A5U A;  4OVV A;  1KOT A;  2K8H A;  2MP2 A;  4GSW A;  5CHF A;  3AI5 A;  2CHX A;  2JT4 B;  5AEK B;  2NR2 A;  5D94 A;  2N1V A;  2G4S A;  3DQV A;  3OJ4 B;  2MBH A;  4LJO B;  3RT3 B;  3VXW A;  2KMA A;  3VAW A;  4GGQ A;  3ZRC A;  1Y8R C;  2RR9 A;  3PZD A;  3QJZ A;  1WGR A;  4EUT A;  1P0R A;  2AL6 A;  2KFK B;  3NS8 A;  2L3Z A;  4NPN A;  2V4L A;  2LRU A;  1YQB A;  4WAA A;  2KMC A;  4B6W A;  3VH3 B;  3CMM B;  3DVG Y;  2O6V D;  4A3O A;  2D3G A;  3DBL I;  1V86 A;  1E5W A;  2M1M A;  1E8Y A;  2WX0 A;  2KC2 A;  5DPS A;  1V6E A;  2OJR A;  4DDG D;  2KFJ A;  2KOX A;  4GU2 A;  4RM8 A;  4F1S A;  2O2V A;  2GBJ A;  2M17 A;  2FCS A;  4FHK A;  3QHT A;  1WJ6 A;  2MBO A;  4I6N B;  3SDL C;  4AUQ C;  3RZW C;  3VVW B;  3IFW B;  1M94 A;  4BBN C;  1P1A A;  2FCN A;  1E8W A;  2HJ8 A;  4HPM B;  4TV3 A;  4W9J A;  3VUW A;  2FNJ B;  3A9K B;  1YJ1 A;  2O6V A;  3SHQ A;  3BIN A;  4FA6 A;  2NBW B;  4WWO A;  4ICV A;  3WAN A;  3WAL A;  4ICU A;  1GNU A;  2GBR A;  3TCA A;  3ZDT A;  4DXA B;  4MGZ E;  4NNJ B;  4ZDV A;  2IO1 B;  2LVP A;  4IUM B;  2MW5 A;  3ENE A;  2KDE B;  3O65 B;  2KNB A;  1WR1 A;  2C7N B;  2G3Q B;  2JY6 A;  1RAX A;  4II3 B;  4E74 A;  1UGM A;  2DHZ A;  3D32 A;  4FLH A;  3QAR A;  2L05 A; 
#chains in the Genus database with same CATH topology
 2BB5 A;  3Q8E A;  3RMK C;  4FAD A;  3RI7 C;  3P42 A;  3IHP C;  4DBG A;  3NHE B;  4ZRK A;  2MRP A;  4FXC A;  2K5P A;  5CHW A;  2FCM A;  2I1K A;  1Y56 A;  2L0T A;  4RGM A;  1V5T A;  1E7V A;  1FD6 A;  2GOW A;  5KHQ A;  2I1J A;  3PPA A;  4E71 A;  2BS3 B;  4GB9 A;  4ANU A;  2DYM A;  1MVK A;  2I2Y A;  2WDV B;  1N5X A;  3VH4 B;  1OEY J;  4GIV A;  4KGR A;  2PVO D;  3ZDM C;  1TY2 A;  5J17 A;  2CS4 A;  3VRB B;  1MI0 A;  3T8M A;  3QX1 A;  5IKC M;  5L83 A;  2KX0 A;  3AE3 B;  2OHF A;  1N61 A;  5DPW A;  3KWL A;  1SEB D;  1UF0 A;  3PO0 A;  2NS5 A;  3B08 A;  4IOI E;  3NY5 A;  4OW0 A;  2GRI A;  5AUK A;  4JQW C;  2L83 A;  1NI2 A;  4NY0 A;  1ZP0 B;  2OED A;  3AE2 B;  2FIF A;  3CF6 E;  2KWD A;  3PGE A;  1T6B X;  4KGT A;  3IBE A;  2J0J A;  1GOZ A;  3RNF C;  2D10 A;  3UIN B;  1BXT A;  4PS8 A;  5JHA A;  2MEK A;  4AS1 A;  2OJW A;  1VLB A;  4MDK E;  2KO3 A;  1WSP A;  4IG7 B;  4CO7 A;  2BYF A;  1LM8 B;  3P4P B;  2LEK A;  3KYD D;  3HIZ A;  4C4V B;  2L52 A;  2HJ1 A;  3V6E B;  3ZNH B;  1SE9 A;  2V3N A;  4MJS B;  3HVZ A;  4W9C A;  4BOZ B;  3DWM A;  3I5J C;  4MSM B;  4DHZ E;  3SFE B;  4NJ7 A;  1XXG A;  2V1Y A;  2Z0D B;  1TYG B;  2V4I B;  1XD3 B;  2VZK D;  2RDB C;  2WXM A;  2KDB A;  3P4S B;  4PT5 A;  3U7D A;  5D3I B;  2ASQ A;  4KZC A;  2BGF A;  1PUT A;  1NEN B;  3W1S A;  4HLE A;  4JIO U;  5DPR A;  1GAQ B;  1WGK A;  2AQ3 B;  3ALB A;  3MC9 A;  3H7P A;  1WE6 A;  1C4C A;  1SGH A;  2MWS B;  4KDL B;  5E6O A;  3DOW A;  3VRA B;  2AQ2 B;  3EUB 2;  5D6J B;  5FK9 C;  1ESF A;  3W9C B;  3B2F A;  3PT2 B;  5AZF A;  1EF5 A;  1GC6 A;  1JRO A;  1WGG A;  3L54 A;  5G2N A;  3KUD B;  2JZ3 B;  1WRD B;  2PLP A;  2EKI A;  4II2 B;  1WX8 A;  5HG2 A;  1JML A;  2DLB A;  2MCN B;  1TZO A;  3WAM A;  5D3D A;  3MJW A;  4IM0 A;  1FRR A;  1UD7 A;  1XCT L;  1Z5S B;  2YEP F;  1HZ5 A;  2PE6 B;  2NVU I;  3A1Q B;  4IDI A;  1J8C A;  2FID A;  2WP9 B;  2KWV B;  1C76 A;  1V80 A;  1VCB A;  2K0P A;  2PE9 A;  4XC2 A;  3A4S C;  3JSV A;  2N7J A;  1OQY A;  2JF5 A;  2JRH A;  3DHI C;  1J0G A;  3DBR B;  4YXD B;  1V1O A;  1F9J A;  1PFD A;  1V9J A;  1TS2 A;  1F2R C;  3C19 A;  3QCA A;  4TQ0 A;  1F0Z A;  5IAA C;  2KZR A;  1CZP A;  4HCN B;  2EMS A;  1K50 A;  2WDR B;  2N9L A;  2CHZ A;  1U4A A;  3PRE A;  1WX9 A;  5FR6 A;  2D3C A;  2WX1 A;  4G0N B;  4HVB A;  1V97 A;  5E6P A;  3U7Z A;  3A33 B;  3Q3J A;  3NOB A;  4Q2J A;  1V81 A;  3AE7 B;  2DAJ A;  3EFC A;  2XBB C;  1SJH D;  5E6J A;  2AEH A;  3ZQ4 A;  1HA5 A;  1WXM A;  1WGH A;  1AAR A;  1D5M C;  3FIL B;  2N9X A;  2JXX A;  3ABV B;  4XWW A;  2J52 A;  3N32 A;  4HPP A;  3UF8 A;  2WNM A;  2XN9 C;  1KJT A;  2ZCC A;  3TEY A;  4C7Z A;  1OQR A;  1E7P B;  4N58 A;  3R8B A;  2NPT B;  4KSL C;  1IGD A;  5DCN A;  4FBJ B;  3Q3N C;  4RGO S;  1HE8 A;  3EHV A;  4W9H A;  4A9A A;  4K3B A;  2ZVO A;  1HQR D;  4XDD A;  1ZXH A;  1E8Z A;  1AN8 A;  1P3Q U;  1KF6 B;  4W9G A;  1WRI A;  3I63 C;  4KIK A;  4GDL B;  3TMP B;  3VUY A;  2DYB A;  4RM9 A;  4BAX A;  3BWU D;  2LGX A;  4W9L A;  4K7U A;  3DHH C;  2M56 B;  1XQQ A;  2PIA A;  2J0K A;  4A3O A;  1F2R I;  2Y5B B;  2WWZ A;  4NJ6 A;  2MA9 B;  4FJZ A;  2HTH A;  1ZW7 A;  5DPT A;  4ZHO A;  4GMV A;  3WA0 A;  2B3A A;  4P6V F;  4W9E A;  4XDC A;  3RPF C;  2KJ6 A;  1XLO A;  3RNA C;  3U52 E;  4NAW A;  2C5L C;  4A20 A;  5LNK 1;  2VH2 A;  3NJT A;  4I6P A;  4G3X B;  2JWU A;  3NVY A;  1C1Y B;  3ECI A;  2PTL A;  2WLB A;  4GSW A;  4UDU C;  2X8X X;  2QSD A;  2NR2 A;  1ZPS A;  5D94 A;  2N1V A;  2G4S A;  3DQV A;  3ZRC A;  4LJO B;  4OZB A;  4GGQ A;  1Y8R C;  1NEK B;  1QQR A;  2KFK B;  3HUI A;  2LHD A;  3NS8 A;  1YQB A;  2M0A A;  2QIL A;  2KMC A;  3CMM B;  2O6V D;  3AED B;  2W3R A;  3EGR A;  2OJR A;  3BZD B;  3VR9 B;  2M17 A;  3N1Z C;  1WJ6 A;  4AUQ C;  3DBH B;  1P1A A;  3ZJT A;  1I4H A;  3IAS 1;  4TV3 A;  3AE8 B;  4LTU A;  3BIN A;  4FA6 A;  4NAM A;  3WAL A;  3ZDT A;  4MGZ E;  4XGA B;  2KDE B;  2KNB A;  1WR1 A;  5BMI A;  1N60 A;  2G3Q B;  2RDH A;  3V3X A;  1SB3 C;  3D32 A;  3QAR A;  2L05 A;  3L13 A;  3PRM B;  1V1P B;  3L08 A;  3ZLZ A;  1EU4 A;  2KWC A;  4WJP A;  1JWS D;  2CHW A;  2MLB A;  3MC0 B;  1IBX B;  2G4D B;  4YTN B;  2QIE B;  4GOC A;  2KLC A;  2LZ6 A;  1YOV B;  1E10 A;  2IZV B;  3AM9 A;  1WR6 E;  5T8I A;  3AUL A;  1L6V A;  1Q0W B;  2LD9 A;  3TSS A;  2ZCB A;  2HTM E;  3QK0 A;  3AEC B;  4BKS D;  2KTR A;  4HEA 1;  2DBY A;  1KH0 A;  2JRI B;  2K3U A;  3P63 A;  2H89 B;  2AX5 A;  1F52 A;  5LXI B;  1ROE A;  1XT9 B;  1E6E B;  5IA7 A;  1T0S C;  2N1W A;  2GBN A;  2GMI C;  4DXG A;  2KC1 A;  1SBB B;  2ZPN A;  2W54 A;  2BTE A;  3N30 A;  4WIP A;  4IC7 B;  4KZ0 A;  2LJI A;  2WS3 B;  1AYF A;  2KAN A;  1JW9 D;  2BB6 A;  1SE2 A;  2K39 A;  4KSK C;  1VR9 A;  3GE8 C;  2LAS A;  3ZYY X;  4QAY A;  2PVG C;  1KM7 A;  5JZE B;  3BYY B;  3B1L X;  3HVD A;  3FKY A;  1GUA B;  1N63 A;  1FNW A;  4GLS C;  4PS7 A;  1D3Z A;  1YN3 A;  4C00 A;  2BKF A;  1FCL A;  1ET6 A;  2K8B A;  4MM3 B;  1JRU A;  2C60 A;  4AQ7 A;  1WZ3 A;  3ZRF A;  2REX A;  3VTU A;  2WXI A;  1FFU A;  4W9D A;  1CJE A;  2LRW A;  3KVF B;  4I6L B;  3PS6 A;  2AWT A;  1XCQ L;  2QC8 A;  4HJK A;  2WXR A;  4MGK E;  5H92 C;  1G6J A;  3FC4 A;  1D5X C;  2RGF A;  1FFV A;  2BYV E;  4RNA A;  2KAC A;  2MBB B;  4KGS A;  1VZ8 A;  1D4B A;  1CMX B;  1QOA A;  2RSU A;  4WJN A;  2KQ7 A;  3RUI B;  1SJE D;  2INP E;  1MG4 A;  1E8X A;  3ZGZ A;  3EEC A;  1UUP A;  2NCN A;  2KKC A;  1C4A A;  1ACC A;  2MJE A;  1YX5 B;  3L17 A;  1UBI A;  1WJU A;  1WXV A;  2WYQ A;  1SXT A;  1QLB B;  4BOS C;  1P98 A;  1FO4 A;  2LVQ A;  1WMH B;  3IVF A;  5JHB A;  1RFA A;  1MHH E;  2DZK A;  3QA8 A;  3TEZ A;  2DEN B;  2INN E;  2CJN A;  4TQ1 A;  5LLI A;  1C9F A;  1Q1O A;  2DZJ A;  2N7E A;  1QOB A;  3I9V 1;  3U8Z A;  2ZJD A;  4FJV B;  1WJN A;  2K1F A;  4M00 A;  2IY0 B;  2BBC A;  4ZRJ A;  4MAC A;  3BY4 B;  3EA6 A;  4B9K A;  3Q14 C;  2G45 B;  3LJ3 A;  3AU5 A;  4XX5 A;  1WFY A;  2MJD A;  1IGC A;  5AUI A;  3AE5 B;  1T0R C;  1V49 A;  2PPH A;  1XLP A;  2KVZ A;  4W9I A;  4TUU A;  3H1U A;  1L6U A;  1UBQ A;  3ZNI D;  3AE1 B;  5FR3 A;  2XK5 B;  3WIM A;  1PDX A;  3OLM D;  4N6E B;  2QMT A;  2IJ0 A;  5IOI A;  1UEL A;  1TGZ B;  4FHJ A;  1J19 A;  1OFF A;  4HPL B;  2V3P A;  2LFI A;  4ZYS A;  3KW5 B;  1C79 A;  4FN2 A;  3B9J A;  3SU8 X;  2MP2 B;  4TMA B;  2IO0 B;  4ANW A;  4IM2 A;  2CR5 A;  1GB4 A;  2L8J A;  2D07 B;  2KXJ A;  5MPO A;  4ZOH C;  3RNE C;  1GC7 A;  1HEZ E;  1KTK A;  3IG3 A;  3AEA B;  1XLN A;  4KDI C;  2JYE A;  1STE A;  4MH0 E;  1X1M A;  3L16 A;  2Z59 B;  3AEF B;  2G1E A;  3R7R A;  3KUC B;  4HRS A;  4WWP A;  2X38 A;  2D2Q A;  4K81 A;  3B0A A;  2IPK D;  3LYY A;  1QOF A;  4ARC A;  2PW9 A;  4K3C A;  2KN5 A;  5J2R A;  3A9J A;  4MSQ B;  4EKU A;  5EE1 A;  3ZNZ B;  1I4Q A;  3FAH A;  1WIA A;  4DXF A;  3L0W B;  4HXD A;  2KLG A;  4LJP B;  5KHO A;  1C78 A;  2KN4 A;  4K1R B;  4PYU A;  1SE4 A;  3KH0 A;  2R2Q A;  4PYZ A;  2B76 B;  3DBS A;  3AV8 A;  1RWS A;  5GXG B;  2WU5 B;  4GXB A;  2WGS A;  2W9N A;  2JX5 A;  2BPS A;  1P9D U;  1ISN A;  3N3K B;  4WAF A;  2YVC A;  3P4Q B;  2L1A A;  4OZC A;  4JL9 A;  4HKZ E;  3R7Q A;  3UIP B;  3B2G A;  4WH4 A;  2KJH B;  5C3J B;  3QC8 B;  4XWT A;  3EC8 A;  4OHJ A;  3V6C B;  1PYW D;  4ASW C;  3AMZ A;  4TSS A;  3MC8 A;  2K9X A;  1YJI A;  2BS4 B;  2YLM A;  1FIQ A;  1IP9 A;  3DHG C;  2N9K A;  2QDF A;  3RNG C;  1UWX A;  2L7R A;  4US8 A;  3RFZ B;  3W1S C;  2SAK A;  3MHZ A;  1BML C;  5HKH A;  2MQJ A;  4N9F 4;  1ZUD 2;  1R4M I;  2K25 A;  2GLS A;  1R4M B;  3GZN I;  4OVV A;  3RNB C;  1M4V A;  2K8H A;  5CHF A;  1WWT A;  4YSZ B;  3AI5 A;  3RT3 B;  2MBH A;  2I38 A;  3VXW A;  4LNI A;  2CJO A;  2JYT A;  2RR9 A;  3PZD A;  3QJZ A;  3ZJV A;  4REZ A;  1V86 A;  2WX0 A;  4US9 A;  1V6E A;  2KFJ A;  4GU2 A;  4RM8 A;  2O2V A;  4MT5 A;  4FHK A;  4B0E A;  4I6N B;  1C4P A;  3Q6B A;  4RGT A;  1E8W A;  1Q10 A;  2HJ8 A;  4HPM B;  3L4P A;  2FNJ B;  3AEE B;  1YJ1 A;  2O6V A;  4YSY B;  1TT5 B;  1KLG D;  4ICV A;  4WWO A;  3PZ8 A;  3WAN A;  1MPE A;  1GNU A;  2GBR A;  3KWV A;  2NTT A;  1BUI C;  1HTQ A;  1J7B A;  2M19 A;  2JY6 A;  1FM0 D;  4II3 B;  4E74 A;  1UGM A;  3PLV A;  2DHZ A;  4LNO A;  4M0W A;  2Z8L A;  1D6E C;  5L95 C;  2ONQ A;  4BKT A;  2LGI A;  4GDK A;  4NQK E;  5EDS A;  2JQR B;  1LQB A;  2ZZP B;  4JPS A;  1D5Z C;  4MGY E;  2ZEQ A;  3GE3 C;  1GJZ A;  2OOB B;  5AZH A;  3PHW B;  4C56 C;  5LXH A;  4HK2 A;  2V3S A;  1JWB D;  1DOX A;  1NI3 A;  4M8N A;  3T9L A;  1T3Q A;  3Q69 A;  1EO6 A;  1ZOY B;  2KD0 A;  4G11 A;  1OQQ A;  1DGJ A;  2H88 B;  1TZ1 A;  1FXT B;  2R61 A;  3VTV A;  5EE3 A;  2MBQ A;  5HI1 A;  2LXA A;  4URK A;  1JAL A;  3W5U B;  1KLV A;  3H7P B;  4BKS A;  1TY0 A;  5E6N A;  4K7W A;  4JLC A;  4ITK A;  3DWG C;  1UH6 A;  4XE0 A;  1C3T A;  2CU3 A;  2WXP A;  5IP4 D;  4W9F A;  2PEA A;  2BT6 A;  3W2D A;  4AJY B;  3HRD D;  1Z2M A;  5CX3 A;  1WX7 A;  4CYE A;  2L00 B;  4P1C C;  1TBE A;  3TBL D;  1GG3 A;  1R4N I;  2WXH A;  1HTO A;  2N4F A;  1H8C A;  2KMM A;  2WHI A;  3PVL A;  3W5V B;  2DNF A;  2WXO A;  1C77 A;  1FXI A;  2JPH A;  1ZDX A;  3V61 A;  3UQA A;  1SIF A;  1LGR A;  4WQO B;  4IKG A;  4BBN F;  2L0F A;  4EOY A;  2QCZ A;  2V0G A;  2AYO B;  3JSV B;  2LXC A;  5D7G A;  3A9K A;  1CK1 A;  5AZG A;  3R66 C;  5G5H A;  2IBI B;  2DYO A;  3I3T B;  1UWM A;  2JZP A;  2INC C;  2AQ1 B;  1YNT E;  4K7S A;  3TIX A;  5G55 A;  2BW2 A;  1YD8 U;  4M8M A;  3Q3F A;  1WGY A;  4ANX A;  3HM3 A;  2ICI A;  3MP9 A;  3ZTD A;  3GB1 A;  3A4R A;  3AE4 B;  3JYU A;  1L5P A;  2WXL A;  3HK0 A;  4EEW A;  3U30 A;  4DHJ B;  3URY A;  1EU3 A;  1FXA A;  2KJR A;  2C7H A;  1ZKH A;  2EKE C;  3Q8B A;  4D2K A;  1ZDV A;  1WE7 A;  3OWE B;  4R3D A;  2C9W B;  2R2O A;  1QT9 A;  1WY8 A;  1XF5 L;  3H7S A;  4A55 A;  1UGJ A;  4GN1 A;  2Y5P A;  1ET9 A;  5HFY A;  1YX6 B;  2KHW B;  3VR8 B;  1NYQ A;  2NMQ A;  1N6Z A;  3OAW A;  1T0Q C;  5EE9 A;  1K51 A;  2D3B A;  2EMT A;  2BQQ A;  2LGS A;  3T3N A;  4C80 A;  2FBW B;  3JVZ X;  4KIK B;  1T0Y A;  1K53 A;  2IGD A;  2IO3 B;  4HWI B;  1L7Y A;  3TEX A;  3Q8C A;  2W55 A;  4ZRI A;  5BYR A;  2J4X A;  4M02 A;  1S3S G;  3NS1 A;  2WXG A;  4XZ4 A;  2QEJ C;  4HRO A;  3SFD B;  2JVC A;  4BZA A;  3AEB B;  2BF8 B;  3KYC D;  1MJD A;  3O13 A;  2LWP A;  3IXS A;  2GBK A;  5I4D A;  1NDD A;  5TSS A;  1WGD A;  3ZUN A;  4LDT B;  1ENF A;  3SD5 A;  3NZS A;  4IWP A;  1K8R B;  5G5G A;  1PGB A;  3QAQ A;  2J42 A;  2QJL A;  3RCZ A;  1HXY D;  5BMG A;  3QIJ A;  3MTN B;  5EE0 A;  1JQ4 A;  3ONS A;  4C4V A;  4JWS C;  2VH1 A;  4NAW B;  1WZ0 A;  2KDF B;  2LGD A;  2BWF A;  4MJS A;  5BYQ A;  3SR6 A;  3NUH B;  4CQN A;  2CKH B;  1I4G A;  4BVU C;  4EZK A;  4N59 A;  1N62 A;  1E9M A;  1VJK A;  1I42 A;  2MJ3 A;  3DPD A;  1SF0 A;  1ZE3 D;  2HE7 A;  2N7D A;  4L23 A;  1EUV B;  4ARI A;  2K22 A;  2V9H A;  4L2Y A;  4A90 A;  4FJY A;  2UYZ B;  3Q3O C;  2N9P C;  5GMV A;  2DZM A;  2LMC A;  3VDZ A;  1V5O A;  1OGW A;  4F7Z A;  4HKQ A;  2Q5W D;  3GP7 A;  3V60 A;  4P16 A;  1F1H A;  2MSE D;  4TKN A;  1WI0 A;  3TJP A;  2IY1 B;  4KX6 B;  1N5W A;  3DDC B;  2L76 A;  2MH7 A;  1L2N A;  1MFW A;  1QOG A;  2Z0E B;  1YIW A;  1TKG A;  5FKA C;  2LGY A;  1MG8 A;  2FUH B;  1Q5W B;  1WXA A;  3PSE B;  4HDO A;  4M01 A;  3WAP A;  1VRA B;  3M3J A;  2D11 A;  2ON8 A;  1TTN A;  2LVO A;  2J0M A;  2VRR B;  1TIF A;  3BK2 A;  1XLQ A;  4DK5 A;  4AP4 C;  3NVV A;  1P7F A;  3ZVV A;  2W3S A;  4YWG G;  3ZO5 B;  1K52 A;  3HM6 X;  2IDY A;  1XO3 A;  2JUO A;  3K9O B;  1LXD A;  1KRH A;  2QHO A;  1OEY A;  1I4R A;  2NBU A;  1UZX B;  2PMV A;  2YEP B;  5JXV A;  4WJO A;  2W82 A;  4WWM A;  3E9S A;  1JWA D;  3RZF A;  2KTR B;  2KAJ A;  3H6N A;  2D5G A;  1V2Y A;  4OZA A;  5BO4 B;  1QKZ A;  1J7A A;  3N9Y C;  1GB1 A;  1H4R A;  3BII D;  3I57 A;  3MJ5 A;  3A1Q A;  4HJG E;  4L1B A;  2MBE A;  3BYT B;  2HDE A;  1TS3 A;  1WJ4 A;  5D2M B;  2CU1 A;  4BKG A;  5TR5 A;  1R7S A;  3HHM A;  3VQI A;  1FMA D;  2SEB D;  4IM3 A;  2JZZ A;  1F77 A;  3M63 B;  2JWZ A;  2BS2 B;  2IND C;  2FE8 A;  2JXT A;  3VAW A;  5IN7 A;  1WGR A;  4EUT A;  1PGX A;  2AL6 A;  2RPV A;  1NYR A;  2L3Z A;  4NPN A;  2V4L A;  4ACF A;  2D3A A;  3VH3 B;  3DVG Y;  2KT7 A;  5DPS A;  1E5W A;  2M1M A;  1E8Y A;  1FNV A;  4DDG D;  2KOX A;  4F1S A;  2FCS A;  3AB5 A;  3QHT A;  3SDL C;  1EM7 A;  3IFW B;  1RFK A;  3KLS X;  4BBN C;  3FIL A;  4W9J A;  3VUW A;  3SHQ A;  2NBW B;  4ICU A;  3TCA A;  3BK1 A;  1JWU D;  4ZDV A;  2LVP A;  2MW5 A;  1YN5 A;  3ENE A;  4LNK A;  3O65 B;  3R2T A;  4LNF A;  1WYG A;  3TEW A;  4B0M A;  2NPT A;  1WH3 A;  3PRP B;  2GBM A;  4NZL B;  2KDM A;  1SE3 A;  1YMH E;  2RDG A;  4EE2 A;  2EEL A;  2WDQ B;  2LJ5 A;  4G50 A;  3Q8A A;  4GDL A;  4J3O D;  2BYE A;  1TKE A;  4DHZ B;  2IGG A;  2VZK B;  3EFU A;  3MFG A;  2IO2 B;  4J6I A;  2WXJ A;  3DVN U;  2WXK A;  3M62 B;  4JGH B;  3DCG A;  4AOF A;  3R2I A;  1RRB A;  2IYD B;  1NVI D;  3GOE A;  3OJ3 A;  1E90 A;  1QZE A;  1DOI A;  2HD5 B;  3X0W A;  4EFO A;  1TS4 A;  4LK0 M;  1MHX A;  1FCC C;  1B1Z A;  2BVC A;  5C2T B;  3QQ8 B;  3RD2 A;  1UNS A;  2K6D B;  3NVW A;  1YN4 A;  3ZW3 A;  2ZW1 A;  2ZVN A;  4KKJ A;  3AE6 B;  4YTP B;  2KQ4 X;  1WXS A;  3AN1 A;  3UGB B;  4RCO A;  2DX5 B;  3ZXV A;  3JW0 X;  1WM2 A;  2DZI A;  1GPX A;  4USA A;  3QWZ B;  4F8C B;  3APD A;  3W1Y A;  3S2A A;  3GZN B;  2KFK A;  3AE9 B;  3IAM 1;  1XEE A;  2FCQ A;  1RLF A;  2KYW A;  1YQ4 B;  2N0S B;  4MEL A;  2L32 A;  3UQB A;  4A3P A;  1L0X B;  3IT6 B;  3M95 A;  3VHT C;  4JE3 B;  2LHE A;  3DBR I;  3IT4 B;  3DVG X;  4FUL A;  3KUZ A;  3H9D A;  3C0R B;  4LCD E;  2XNA C;  3KQ4 A;  3NG0 A;  1PGA A;  4HCP B;  2BYT A;  1P7E A;  4X57 B;  4BFR A;  2BWE S;  5J18 A;  1J7C A;  2NBV B;  1QIL A;  3GS2 A;  4YTM B;  1A70 A;  5BMH A;  3LXF A;  3NZ3 A;  4PS3 A;  3V62 A;  2A4Z A;  1V1P A;  4LNN A;  3AU4 A;  3C8Y A;  3L10 B;  2ZPY A;  4ZRQ A;  1IBX A;  3CST A;  4NQL B;  2ACZ B;  4KVG B;  1RM6 C;  1VD2 A;  1RYJ A;  2N9E B;  4B95 A;  2Y3A A;  1AW7 A;  3AH7 A;  4RF0 A;  2M8S A;  4RF1 A;  3RN9 C;  3PV1 A;  3A9J B;  4DWF A;  2RPQ A;  2M0X A;  3APC A;  2WXF A;  4EZJ A;  1WXQ A;  4JWU C;  1PQS A;  4KV2 A;  3RYT A;  2XEW A;  1EF1 A;  1T5X D;  4EZL A;  2NTS A;  3BVZ A;  3P1M A;  2M4N A;  4ZHP A;  2RD0 A;  1JRP A;  2LI5 A;  4O1N A;  3ML9 A;  3Q2A C;  5BYS A;  3DVN V;  1V8C A;  1BT0 A;  2FAZ A;  4CHK A;  3LDZ E;  3WCQ A;  1VZ7 A;  3K9P B;  5C23 A;  1R4N B;  2DAF A;  4RGN A;  2E6X A;  4IWQ A;  3LB8 C;  4AJW A;  1CQV A;  1EWY C;  5CHV C;  1L0V B;  3BVM A;  3BVG A;  2ZNV C;  4YL8 A;  1OTR B;  2WU2 B;  1KLU D;  4MGI E;  1I7H A;  1JWM D;  4HDQ A;  1QF6 A;  3MHS D;  1E7U A;  1NBF C;  3VFK A;  4MM3 A;  3ZKJ C;  3P2B A;  3CIR B;  4OVU A;  4WWN A;  3VTW A;  2WQY B;  2E3T A;  1FPY A;  1EWC A;  1IYF A;  3ML8 A;  4DDI D;  1TS5 A;  2LUM A;  3AEG B;  3N1Y C;  5CTR C;  1A5R A;  2IGH A;  2KX3 A;  1WYW B;  2J7Q B;  2RMM A;  1L4Z B;  2WXN A;  2KWU B;  4XYC A;  4DHJ D;  2MHJ A;  2GI9 A;  1L4D B;  4ANV A;  1FEH A;  4YSX B;  3T3O A;  1WF9 A;  3RNC C;  3PHX B;  2LUE A;  2AL3 A;  2UU7 A;  1SSN A;  3Q8F A;  4IW0 A;  2JSV X;  2PKO A;  3DBH I;  2PJH A;  2BKR B;  3H8H A;  3R3M A;  2O2V B;  3X23 A;  3ZJU A;  4JX1 C;  3ZNG C;  3NZU A;  4LLG M;  2O6V B;  3E56 A;  3AXC A;  1WMH A;  3PLU A;  2ZW0 A;  4A8X C;  3CWI A;  3U2S C;  3APF A;  4IWO A;  1E0Z A;  4W9K A;  3NRZ A;  2Y5C A;  4KKI A;  4ZRP A;  4M0W B;  3V05 A;  3VUX A;  4DQO C;  3ZTC A;  3Q3M C;  4GDK B;  2KVR A;  4RMA A;  2KK8 A;  2K6Q A;  4E3C A;  2G9H D;  1TKY A;  2UWQ A;  4P7I A;  4A6Q A;  2ZNV B;  3PRZ A;  5H8Y E;  1WM3 A;  1KFY B;  4LDT D;  3OG5 A;  1JCK B;  2WXQ A;  1HZ6 A;  3UI3 A;  5C1Z A;  4WJQ A;  3ZIM A;  2WDT B;  1ZGU B;  3UIO B;  4ZYN A;  4OVZ A;  1AWD A;  1LFD A;  2MX2 A;  1I35 A;  4AWJ A;  4MEM A;  1IPG A;  1VDV A;  2DWQ A;  4S0R A;  4RH6 A;  3ZXR A;  4S17 A;  3TL5 A;  5IO9 A;  3RUL A;  2K8C A;  5HHD G;  4MH8 A;  5JH5 C;  2XK5 A;  1DOY A;  1VZ6 A;  4WQM A;  4YT0 B;  2GB1 A;  4P1B C;  3WAO A;  4H2A A;  4WUR A;  2KTF A;  3PTF C;  1DYQ A;  1S1Q B;  4NJC A;  2KQS A;  2C7M B;  3ETR A;  3CSF A;  3N1X C;  4C7Y A;  1FNU A;  2KDI A;  2A5U A;  3N20 C;  3P4R B;  1KOT A;  2MP2 A;  3SEB A;  1SIJ A;  1B9R A;  2CHX A;  1IUE A;  2JT4 B;  5AEK B;  2J53 A;  3OJ4 B;  2KMA A;  1TJE A;  1P0R A;  1ZXI A;  2LRU A;  4WAA A;  4PK1 A;  3PZ7 A;  4B6W A;  1FRD A;  2TSS A;  2D3G A;  3DBL I;  3DBL B;  2KC2 A;  1YQ3 B;  2GBJ A;  3J9C A;  1YJJ A;  3TUO A;  2MBO A;  3RZW C;  3VVW B;  1M94 A;  1LO5 D;  3NVZ A;  2FCN A;  2JU6 X;  1L0Y B;  3A9K B;  4DXA B;  2FUG 1;  4NNJ B;  1I4P A;  2IO1 B;  4IUM B;  4RFB A;  1I4X A;  2C7N B;  3U4E G;  1RAX A;  4FLH A; 
#chains in the Genus database with same CATH homology
 5L95 C;  3L13 A;  3PRM B;  4BKT A;  3L08 A;  3ZLZ A;  1WH3 A;  3PRP B;  4GDK A;  2GBM A;  2KWC A;  4NQK E;  4FAD A;  4WJP A;  5EDS A;  2CHW A;  2MLB A;  1LQB A;  2ZZP B;  4MGY E;  2G4D B;  2ZEQ A;  1GJZ A;  2OOB B;  4GOC A;  5AZH A;  2KLC A;  2LZ6 A;  3PHW B;  3IHP C;  4DBG A;  2LJ5 A;  3NHE B;  4ZRK A;  4G50 A;  2IZV B;  4GDL A;  4HK2 A;  2V3S A;  5LXH A;  2MRP A;  1WR6 E;  3AUL A;  2BYE A;  4M8N A;  5CHW A;  3T9L A;  2FCM A;  1Q0W B;  2LD9 A;  4DHZ B;  2I1K A;  2L0T A;  1EO6 A;  2ZCB A;  2KD0 A;  4G11 A;  3EFU A;  3QK0 A;  4BKS D;  2KTR A;  1V5T A;  2IO2 B;  1E7V A;  2GOW A;  5KHQ A;  4J6I A;  1TZ1 A;  2I1J A;  1FXT B;  3DVN U;  3PPA A;  3VTV A;  3M62 B;  4JGH B;  2JRI B;  4E71 A;  3DCG A;  4AOF A;  2MBQ A;  1RRB A;  2LXA A;  4URK A;  2IYD B;  1KLV A;  4GB9 A;  3H7P B;  4ANU A;  3GOE A;  2DYM A;  3OJ3 A;  1XT9 B;  1E90 A;  1QZE A;  5LXI B;  2HD5 B;  3X0W A;  4BKS A;  4EFO A;  5IA7 A;  5E6N A;  3VH4 B;  4K7W A;  1OEY J;  4GIV A;  2N1W A;  4JLC A;  2GBN A;  3ZDM C;  3RD2 A;  1UH6 A;  2GMI C;  3QQ8 B;  1C3T A;  2K6D B;  2KC1 A;  2ZPN A;  3ZW3 A;  5J17 A;  2CS4 A;  4W9F A;  2ZVN A;  3N30 A;  2PEA A;  4AJY B;  1Z2M A;  5CX3 A;  3T8M A;  4IC7 B;  4KZ0 A;  1WX7 A;  3QX1 A;  2KAN A;  5L83 A;  1WXS A;  4CYE A;  2KX0 A;  2L00 B;  3UGB B;  1TBE A;  3TBL D;  5DPW A;  2DX5 B;  2K39 A;  4KSK C;  3JW0 X;  1WM2 A;  2DZI A;  3QWZ B;  4F8C B;  1GG3 A;  2LAS A;  2NS5 A;  3APD A;  3PLV A;  1R4N I;  3B08 A;  2N4F A;  3NY5 A;  1H8C A;  3W1Y A;  1KM7 A;  4JQW C;  3S2A A;  3PVL A;  1NI2 A;  4NY0 A;  5JZE B;  2KFK A;  3CF6 E;  2FIF A;  3B1L X;  3PGE A;  2FCQ A;  2JPH A;  1GUA B;  1RLF A;  3V61 A;  3IBE A;  2J0J A;  1SIF A;  3UQA A;  4PS7 A;  4WQO B;  4MEL A;  2D10 A;  3UIN B;  1D3Z A;  4PS8 A;  5JHA A;  3UQB A;  4BBN F;  4A3P A;  3M95 A;  3VHT C;  2BKF A;  2L0F A;  3DBR I;  4MDK E;  3DVG X;  4EOY A;  4FUL A;  2K8B A;  3KUZ A;  2KO3 A;  3H9D A;  4IG7 B;  1JRU A;  4CO7 A;  2BYF A;  1LM8 B;  2C60 A;  3C0R B;  4LCD E;  2AYO B;  3JSV B;  1WZ3 A;  3HIZ A;  3KYD D;  2REX A;  2LXC A;  3VTU A;  3ZRF A;  5D7G A;  3A9K A;  4W9D A;  5AZG A;  3V6E B;  3R66 C;  4HCP B;  3ZNH B;  1SE9 A;  2LRW A;  3KVF B;  4I6L B;  4X57 B;  2IBI B;  3PS6 A;  4BFR A;  2AWT A;  2BWE S;  2DYO A;  2NBV B;  3I3T B;  4MJS B;  4W9C A;  5J18 A;  4HJK A;  4MGK E;  1G6J A;  4BOZ B;  2RGF A;  4K7S A;  3TIX A;  5G55 A;  2BYV E;  4MSM B;  1YD8 U;  2MBB B;  4DHZ E;  4M8M A;  3Q3F A;  1WGY A;  4NJ7 A;  1CMX B;  3HM3 A;  4PS3 A;  3V62 A;  4ANX A;  2RSU A;  2V1Y A;  4WJN A;  2A4Z A;  2KQ7 A;  3RUI B;  2Z0D B;  3AU4 A;  3ZTD A;  1E8X A;  1XD3 B;  3A4R A;  3EEC A;  3JYU A;  3L10 B;  2ZPY A;  3CST A;  3HK0 A;  4NQL B;  4EEW A;  2KDB A;  2NCN A;  2KKC A;  3U30 A;  4DHJ B;  3U7D A;  4KVG B;  2ASQ A;  2KJR A;  4KZC A;  2C7H A;  1ZKH A;  1YX5 B;  1VD2 A;  2EKE C;  3L17 A;  1UBI A;  1WJU A;  1WXV A;  2BGF A;  2WYQ A;  3W1S A;  2N9E B;  1P98 A;  4BOS C;  4B95 A;  2LVQ A;  1WMH B;  3IVF A;  4HLE A;  5JHB A;  4JIO U;  5DPR A;  1RFA A;  2M8S A;  2DZK A;  1WE7 A;  3QA8 A;  3PV1 A;  3A9J B;  2C9W B;  2R2O A;  1WY8 A;  3ALB A;  3H7P A;  3H7S A;  1WE6 A;  4DWF A;  2DEN B;  2RPQ A;  2M0X A;  1SGH A;  2MWS B;  3APC A;  4GN1 A;  4KDL B;  5E6O A;  4EZJ A;  3DOW A;  4TQ1 A;  5LLI A;  1YX6 B;  1PQS A;  2KHW B;  4KV2 A;  5D6J B;  3RYT A;  2XEW A;  1Q1O A;  2DZJ A;  2N7E A;  3OAW A;  1EF1 A;  3PT2 B;  4EZL A;  3U8Z A;  2ZJD A;  4FJV B;  1WJN A;  5AZF A;  2M4N A;  1EF5 A;  2K1F A;  2RD0 A;  2LI5 A;  2EMT A;  2IY0 B;  4ZRJ A;  1GC6 A;  3BY4 B;  1WGG A;  3L54 A;  2NPT A;  5G2N A;  4B9K A;  3KUD B;  2JZ3 B;  3ML9 A;  3JVZ X;  4KIK B;  1T0Y A;  2G45 B;  1WRD B;  3LJ3 A;  2IO3 B;  3AU5 A;  4HWI B;  4XX5 A;  1L7Y A;  4II2 B;  3DVN V;  1WX8 A;  1WFY A;  4ZRI A;  1BT0 A;  2FAZ A;  2MCN B;  1S3S G;  4CHK A;  3LDZ E;  3WAM A;  4XZ4 A;  3MJW A;  4IM0 A;  2JVC A;  1V49 A;  2BF8 B;  2PPH A;  3K9P B;  1UD7 A;  5C23 A;  3KYC D;  1Z5S B;  2LWP A;  2DAF A;  2PE6 B;  2GBK A;  1NDD A;  4W9I A;  4TUU A;  3H1U A;  4IWQ A;  1WGD A;  3ZUN A;  4LDT B;  4AJW A;  1UBQ A;  3SD5 A;  3NZS A;  4IWP A;  2NVU I;  5CHV C;  3ZNI D;  3A1Q B;  1K8R B;  2ZNV C;  1J8C A;  4YL8 A;  2FID A;  1OTR B;  3QAQ A;  4MGI E;  2XK5 B;  3WIM A;  4HDQ A;  2KWV B;  3MHS D;  1E7U A;  1NBF C;  3RCZ A;  3OLM D;  3VFK A;  4MM3 A;  3ZKJ C;  3P2B A;  3QIJ A;  1V80 A;  3MTN B;  1VCB A;  4OVU A;  4WWN A;  3VTW A;  4XC2 A;  2PE9 A;  3A4S C;  3JSV A;  3ONS A;  1OQY A;  2JF5 A;  2JRH A;  1J0G A;  4NAW B;  1UEL A;  1IYF A;  1TGZ B;  4FHJ A;  1F9J A;  3ML8 A;  1V9J A;  1WZ0 A;  4DDI D;  1J19 A;  2KDF B;  2LGD A;  2BWF A;  4HPL B;  4MJS A;  3KW5 B;  5CTR C;  4FN2 A;  3QCA A;  4TQ0 A;  1A5R A;  5IAA C;  3SU8 X;  2CKH B;  2KX3 A;  2KZR A;  2MP2 B;  4BVU C;  4EZK A;  4HCN B;  1WYW B;  2IO0 B;  4ANW A;  2J7Q B;  4IM2 A;  2CR5 A;  2EMS A;  2KWU B;  4DHJ D;  1I42 A;  2L8J A;  2D07 B;  2KXJ A;  4ANV A;  3DPD A;  2CHZ A;  1U4A A;  3PRE A;  1WX9 A;  1WF9 A;  2HE7 A;  2N7D A;  5FR6 A;  1EUV B;  3PHX B;  4G0N B;  2LUE A;  2WX1 A;  4HVB A;  2AL3 A;  1GC7 A;  4FJY A;  2UYZ B;  4IW0 A;  5E6P A;  3DBH I;  3A33 B;  3IG3 A;  3NOB A;  3Q3J A;  2PJH A;  4KDI C;  2N9P C;  5GMV A;  2BKR B;  4MH0 E;  1V81 A;  2DZM A;  1X1M A;  3L16 A;  2DAJ A;  2XBB C;  3R3M A;  3VDZ A;  2O2V B;  3X23 A;  2AEH A;  1V5O A;  1OGW A;  2Z59 B;  1WXM A;  4F7Z A;  3V60 A;  1WGH A;  2MSE D;  1AAR A;  4TKN A;  3R7R A;  3KUC B;  3ZNG C;  4WWP A;  1WI0 A;  2N9X A;  3NZU A;  2IY1 B;  3TJP A;  2O6V B;  2JXX A;  2D2Q A;  3AXC A;  1WMH A;  3DDC B;  2L76 A;  4K81 A;  3B0A A;  1L2N A;  2Z0E B;  3PLU A;  1YIW A;  3N32 A;  2KN5 A;  5J2R A;  3A9J A;  4MSQ B;  3UF8 A;  2LGY A;  3APF A;  4IWO A;  1MG8 A;  4EKU A;  1KJT A;  3ZNZ B;  2FUH B;  1Q5W B;  4W9K A;  2ZCC A;  1WXA A;  1WIA A;  3PSE B;  4HDO A;  3L0W B;  3WAP A;  4HXD A;  2KLG A;  4LJP B;  2NPT B;  3M3J A;  2D11 A;  4KSL C;  4M0W B;  5KHO A;  3VUX A;  1TTN A;  2LVO A;  5DCN A;  2J0M A;  4FBJ B;  3ZTC A;  2VRR B;  4GDK B;  2KVR A;  1HE8 A;  3EHV A;  4K1R B;  4RMA A;  4W9H A;  4AP4 C;  2KK8 A;  4DK5 A;  2K6Q A;  4PYU A;  2ZVO A;  4E3C A;  3KH0 A;  2R2Q A;  4PYZ A;  3ZVV A;  2UWQ A;  4P7I A;  3DBS A;  3ZO5 B;  1E8Z A;  1P3Q U;  2ZNV B;  3HM6 X;  4W9G A;  2JUO A;  3K9O B;  1LXD A;  2QHO A;  3PRZ A;  1OEY A;  4KIK A;  4GDL B;  4GXB A;  1WM3 A;  3TMP B;  2NBU A;  4LDT D;  2DYB A;  2W9N A;  3VUY A;  1UZX B;  4RM9 A;  2BPS A;  4WJO A;  1P9D U;  1ISN A;  3N3K B;  2LGX A;  4W9L A;  3RZF A;  2KTR B;  5C1Z A;  4K7U A;  4WJQ A;  3ZIM A;  1XQQ A;  2WDT B;  1ZGU B;  2J0K A;  2YVC A;  3H6N A;  2Y5B B;  1V2Y A;  4ZYN A;  4JL9 A;  1LFD A;  2MX2 A;  3UIO B;  3R7Q A;  1I35 A;  4AWJ A;  2WWZ A;  3UIP B;  4MEM A;  1IPG A;  5BO4 B;  4NJ6 A;  2MA9 B;  4FJZ A;  2HTH A;  1H4R A;  2KJH B;  1ZW7 A;  3TL5 A;  3QC8 B;  3RUL A;  3EC8 A;  3A1Q A;  2K8C A;  5DPT A;  3V6C B;  2MBE A;  4ASW C;  4GMV A;  3WA0 A;  2XK5 A;  5JH5 C;  2B3A A;  1WJ4 A;  5D2M B;  4W9E A;  2CU1 A;  2YLM A;  4BKG A;  2KJ6 A;  5TR5 A;  3HHM A;  3VQI A;  1IP9 A;  3WAO A;  4IM3 A;  4NAW A;  2C5L C;  2JZZ A;  2L7R A;  4A20 A;  2KTF A;  3W1S C;  3PTF C;  1S1Q B;  2KQS A;  2C7M B;  5HKH A;  2MQJ A;  4I6P A;  4N9F 4;  3CSF A;  1R4M I;  2K25 A;  3M63 B;  4G3X B;  2JWZ A;  1C1Y B;  3ECI A;  2KDI A;  3GZN I;  2A5U A;  4OVV A;  1KOT A;  2K8H A;  2MP2 A;  4GSW A;  5CHF A;  3AI5 A;  2CHX A;  2JT4 B;  5AEK B;  2NR2 A;  5D94 A;  2N1V A;  2G4S A;  3DQV A;  3OJ4 B;  2MBH A;  4LJO B;  3RT3 B;  3VXW A;  2KMA A;  3VAW A;  4GGQ A;  3ZRC A;  1Y8R C;  2RR9 A;  3PZD A;  3QJZ A;  1WGR A;  4EUT A;  1P0R A;  2AL6 A;  2KFK B;  3NS8 A;  2L3Z A;  4NPN A;  2V4L A;  2LRU A;  1YQB A;  4WAA A;  2KMC A;  4B6W A;  3VH3 B;  3CMM B;  3DVG Y;  2O6V D;  4A3O A;  2D3G A;  3DBL I;  1V86 A;  1E5W A;  2M1M A;  1E8Y A;  2WX0 A;  2KC2 A;  5DPS A;  1V6E A;  2OJR A;  4DDG D;  2KFJ A;  2KOX A;  4GU2 A;  4RM8 A;  4F1S A;  2O2V A;  2GBJ A;  2M17 A;  2FCS A;  4FHK A;  3QHT A;  1WJ6 A;  2MBO A;  4I6N B;  3SDL C;  4AUQ C;  3RZW C;  3VVW B;  3IFW B;  1M94 A;  4BBN C;  1P1A A;  2FCN A;  1E8W A;  2HJ8 A;  4HPM B;  4TV3 A;  4W9J A;  3VUW A;  2FNJ B;  3A9K B;  1YJ1 A;  2O6V A;  3SHQ A;  3BIN A;  4FA6 A;  2NBW B;  4WWO A;  4ICV A;  3WAN A;  3WAL A;  4ICU A;  1GNU A;  2GBR A;  3TCA A;  3ZDT A;  4DXA B;  4MGZ E;  4NNJ B;  4ZDV A;  2IO1 B;  2LVP A;  4IUM B;  2MW5 A;  3ENE A;  2KDE B;  3O65 B;  2KNB A;  1WR1 A;  2C7N B;  2G3Q B;  2JY6 A;  1RAX A;  4II3 B;  4E74 A;  1UGM A;  2DHZ A;  3D32 A;  4FLH A;  3QAR A;  2L05 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...