5J2RA

Solution structure of ras binding domain (rbd) of b-raf
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
82
structure length
82
Chain Sequence
SPQKPIVRVFLPNKQRTVVPARCGVTVRDSLKKALMMRGLIPECCAVYRIQDGEKKPIGWDTDISWLTGEELHVEVLENVPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Serine/threonine-protein kinase B-raf
publication title A Small Molecule RAS-Mimetic Disrupts RAS Association with Effector Proteins to Block Signaling.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 19
structure length 82
sequence length 82
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2016-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02196 RBD Raf-like Ras-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 5j2rA01
2HE7A 4N9F4 2JPHA 3EECA 3ZDMC 4FULA 2LZ6A 1UH6A 2DYOA 3ZNZB 1C1YB 4NQLB 3WA0A 2KLCA 1NI2A 3WAPA 5HKHA 3WAMA 3QX1A 3WIMA 2ZCBA 3VTUA 4AJYB 1LFDA 2NS5A 2ZJDA 5KHOA 2C7NB 1WJNA 4NAWA 5EDSA 3N32A 3A9JA 5AEKB 4GDLB 4GOCA 3UIPB 1U4AA 2DZMA 2IYDB 2KWUB 4JLCA 4RMAA 1V81A 2XEWA 1Z5SB 2FIDA 1WZ0A 4AP4C 5DPTA 3DBLI 3IG3A 2KDIA 3V6EB 4ZRKA 3CMMB 2JRIB 2EKEC 4HLEA 4BVUC 5GMVA 5IAAC 2CS4A 2JF5A 4HWIB 2MBBB 3BY4B 3QHTA 4NNJB 4KDIC 2KZRA 3L17A 4ANUA 2KWCA 2YLMA 1OTRB 2N7EA 4A20A 2RSUA 3A1QA 5DPRA 1V9JA 5J18A 2A5UA 3ECIA 5JHBA 2GBJA 5JH5C 3VUWA 2N4FA 1V86A 2L7RA 2ZNVB 3HK0A 3KYCD 2NPTB 3DVGY 3PZDA 5DCNA 4AUQC 3ZVVA 4F8CB 4G0NB 1OQYA 2IBIB 4OVUA 3PHXB 4HK2A 4K81A 1E8WA 1LXDA 1WJ6A 2QHOA 4WJOA 1E7UA 4PS8A 2N9EB 2KD0A 1WGRA 2C5LC 1SE9A 1XD3B 3ZUNA 3M62B 4WJNA 3UQAA 2K39A 3UIOB 4ANWA 1EO6A 3RULA 2D10A 1IP9A 1V2YA 3KUZA 2J0JA 2PPHA 1WGDA 4IWOA 4F1SA 3U7DA 4DHZE 2V4LA 4BKSA 1IPGA 2KO3A 3DBHI 4X57B 1R4NI 2KXJA 2N7DA 4II3B 2LI5A 2ASQA 1WX7A 5LLIA 4KVGB 4HDQA 4EZJA 3PT2B 3JSVB 3RZWC 3DPDA 2N9PC 2N1VA 3HM6X 1FXTB 1V5TA 1EUVB 3P2BA 2VRRB 1TBEA 4EFOA 1UD7A 2AL6A 2LVQA 4GXBA 5C1ZA 3QWZB 3KW5B 4MGKE 4MGZE 1YD8U 4JQWC 4BOZB 4I6LB 3ZDTA 3EC8A 1QZEA 3V61A 3UQBA 3PGEA 1UZXB 1YIWA 2GBKA 1P0RA 4IWQA 3RZFA 2KQSA 2FIFA 5CTRC 4AWJA 1LM8B 3DBRI 2AL3A 2B3AA 4PS7A 5D7GA 3W1SC 2KVRA 2WX0A 2L05A 1HE8A 3H9DA 1L7YA 4IUMB 2CHXA 5JZEB 2OOBB 2DZKA 1A5RA 2BPSA 1H8CA 2MP2B 3OJ4B 4K7WA 2KANA 2MBHA 2KTRA 1Y8RC 2KC2A 4PS3A 3H7PA 2JVCA 3VVWB 4PYZA 1VD2A 2LVPA 2J7QB 3Q3FA 4TV3A 5D6JB 4FADA 2MBQA 2CHZA 3QK0A 3VTVA 5J2RA 3LJ3A 3X23A 3M63B 3M95A 2FAZA 1MG8A 3UF8A 3VFKA 3APDA 3K9OB 3PPAA 5G55A 5DPWA 1V80A 4KDLB 5AZFA 4XC2A 4JGHB 2R2OA 3NZUA 3RYTA 3VXWA 4W9HA 3HHMA 2LRWA 4FJYA 4G3XB 4NQKE 4NJ6A 4HDOA 4EZLA 4GB9A 2LGYA 2ZVNA 2I1JA 2G4SA 2LXCA 3QAQA 4I6PA 1PQSA 2O6VD 4TQ0A 5TR5A 2Y5BB 3QQ8B 2LJ5A 3LDZE 1UGMA 3RUIB 5LXIB 3K9PB 4AOFA 2KOXA 2KFJA 3VHTC 3NOBA 2EMTA 1E90A 2AYOB 3TBLD 3SHQA 3SD5A 2M17A 2K25A 3H7PB 4OVVA 1TZ1A 2K8HA 3ZKJC 2K1FA 1WMHA 3PS6A 4MH0E 4A3OA 2RD0A 2DAFA 3DCGA 2O2VA 2KFKB 4MGYE 5FR6A 3CF6E 3B08A 3PTFC 1XQQA 1YX5B 2KDBA 4BKSD 2FNJB 3PVLA 5IA7A 3DOWA 1WIAA 2L00B 2MWSB 3SDLC 4BBNF 3UGBB 3PLVA 4DDID 1K8RB 2FUHB 4ZYNA 2D07B 1WI0A 3UINB 2DHZA 3VAWA 2JY6A 4M8NA 2M1MA 3HIZA 3PHWB 2O6VA 2FCSA 2NR2A 2ZPYA 2KDFB 4A3PA 3TJPA 1EF5A 3DVGX 3A33B 1WXSA 1RLFA 1WYWB 1WE6A 3ZRFA 2IY0B 4BKGA 3MHSD 4WWOA 3VH3B 4ASWC 3RT3B 1RRBA 2JXXA 2L3ZA 4LDTD 4W9FA 4GMVA 4EOYA 2N9XA 2K8CA 4II2B 3ZIMA 3HM3A 1C3TA 1P3QU 2DX5B 1UELA 4B9KA 2HJ8A 3R3MA 4FA6A 4FN2A 2KLGA 1H4RA 3PREA 3ZW3A 2YVCA 2PJHA 3TMPB 2XBBC 2XK5A 1WX8A 4M8MA 4NAWB 3NY5A 1OEYJ 2GOWA 2IO2B 3A9JB 3PRPB 3PRZA 4GGQA 3TCAA 4BBNC 4P7IA 1OGWA 2DYBA 3Q3JA 2GMIC 1I35A 4BKTA 2GBRA 4E71A 3KYDD 5CHFA 2AEHA 1V5OA 2GBNA 2BYEA 3AXCA 4BFRA 2RPQA 4W9JA 1JRUA 2CR5A 3OLMD 2LUEA 1WE7A 5LXHA 2MSED 1G6JA 2FCNA 4B95A 1D3ZA 4GDKA 4NPNA 4G11A 2MRPA 2NBUA 3A1QB 2IO1B 3GZNI 1T0YA 3ML9A 4W9CA 1WXMA 2BKRB 1WR1A 1WXAA 2JWZA 3B1LX 3QCAA 5E6NA 1Q5WB 2K6DB 2UWQA 3DBSA 2D3GA 2BYFA 1V6EA 4IWPA 3AU4A 2KC1A 2KWVB 2CU1A 3NZSA 4EKUA 5AZHA 1ISNA 4W9EA 2DZIA 4MSQB 3NHEB 4CHKA 4NY0A 1P1AA 1WF9A 2GBMA 4MJSA 3W1YA 1S1QB 2MW5A 4ICVA 4HPMB 2DENB 4FLHA 4MGIE 4W9DA 4XX5A 1WJ4A 4TKNA 3EHVA 2WX1A 2C7MB 3RCZA 3L54A 1EF1A 2KMAA 1Q0WB 3ALBA 3DQVA 3JVZX 4MEMA 1TGZB 4LJPB 5BO4B 2G3QB 5CX3A 3ZLZA 3CSTA 3IVFA 4W9IA 4DHJD 2M0XA 3JW0X 4RM9A 3MTNB 1I42A 1KOTA 3U8ZA 3DVNV 3MJWA 3N30A 2KQ7A 4IM0A 3B0AA 1M94A 1J8CA 2I1KA 4GDLA 2CHWA 3ZO5B 4FBJB 2M4NA 4GN1A 1WGHA 2IO3B 2KHWB 2KN5A 3ML8A 2ZZPB 4WAAA 4CYEA 1WY8A 4F7ZA 2L76A 1GJZA 1RAXA 2OJRA 1RFAA 3ZRCA 2V1YA 3V60A 5CHVC 5AZGA 1GG3A 2L8JA 2NBWB 3D32A 3QJZA 5D2MB 3O65B 3GOEA 4LDTB 2LGXA 4HVBA 1WM2A 2J0KA 2LGDA 2R2QA 1BT0A 3VUXA 3DDCB 2WDTB 3VUYA 2PE9A 5KHQA 2IZVB 2BGFA 2KTRB 1E8ZA 2DZJA 1ZW7A 2NCNA 1F9JA 3JYUA 1SIFA 5J17A 2WYQA 2RR9A 2C9WB 3OAWA 4MJSB 3WAOA 1P98A 2NPTA 3V62A 4XZ4A 2FCQA 3A4SC 4W9KA 1WX9A 2BKFA 3L10B 4ZDVA 1WR6E 2C7HA 2KJHB 2LWPA 2MQJA 3ONSA 3BINA 4W9GA 3EFUA 2MA9B 1LQBA 1E5WA 4E74A 4FJZA 2KDEB 1Z2MA 1SGHA 4GIVA 2Z0EB 3T9LA 2IY1B 1X1MA 2ZVOA 4EZKA 2JZZA 3AU5A 2KK8A 3IBEA 3KUCB 4IM2A 3WALA 2KJ6A 2J0MA 1GC6A 3QC8B 3C0RB 4KIKA 2LASA 3ENEA 5JHAA 3JSVA 3APCA 3L16A 3U30A 3X0WA 2PEAA 4HJKA 4KSKC 1IYFA 3VDZA 2N1WA 3R66C 5CHWA 2L0TA 5D94A 2W9NA 2MBOA 2PE6B 4IG7B 4URKA 4E3CA 3H6NA 3IHPC 5L83A 3TIXA 4KSLC 3IFWB 2D2QA 2D11A 1KJTA 4DWFA 4FHKA 3R7RA 4MM3A 2AWTA 3ZTDA 4WQOB 2G45B 2NBVB 4IC7B 1WMHB 2Z0DB 2BWES 1OEYA 2MCNB 3VH4B 4FJVB 2V3SA 2K6QA 4WWNA 3L0WB 2MP2A 2Z59B 2O2VB 2ZCCA 4NJ7A 4DHJB 3PV1A 1WRDB 4HPLB 3KVFB 4DK5A 2RGFA 1Q1OA 3A9KA 3NS8A 1KM7A 1CMXB 1WZ3A 1UBIA 1VCBA 4I6NB 2C60A 4W9LA 1E8YA 3M3JA 3H7SA 3KH0A 4ZRJA 4B6WA 2O6VB 2FCMA 5L95C 1YQBA 2EMSA 1J19A 4KZCA 2JT4B 4WJPA 1NDDA 4J6IA 3AULA 3RD2A 2REXA 3H1UA 2LXAA 4KIKB 3PRMB 3APFA 3WANA 1KLVA 1E8XA 1YJ1A 1AARA 2M8SA 2MBEA 2NVUI 3QIJA 4EUTA 4YL8A 2ZEQA 3VQIA 1WGYA 1WM3A 5C23A 1V49A 4DXAB 2KKCA 4AJWA 4G50A 2K8BA 3DVNU 1WGGA 3R7QA 4DHZB 2KMCA 5G2NA 1WJUA 2HD5B 3T8MA 2XK5B 1GC7A 4TQ1A 2KTFA 2KNBA 4HXDA 4MELA 3QARA 4WWPA 2BYVE 4M0WB 3L13A 4KZ0A 2BWFA 2G4DB 1P9DU 2MX2A 4ANVA 2LRUA 2JRHA 2BF8B 4JL9A 4K7SA 4DDGD 4ZRIA 2JZ3B 2IO0B 1WXVA 3A4RA 3W1SA 4GU2A 2KX0A 4HCNB 1ZKHA 1GUAB 1YX6B 3A9KB 4RM8A 4K7UA 1WFYA 3N3KB 3L08A 2L0FA 4JIOU 3S2AA 3ZNGC 4MDKE 3AI5A 4BOSC 2KFKA 2A4ZA 3OJ3A 4IM3A 4GDKB 4TUUA 4FHJA 3ZNID 4ANXA 2JUOA 3VTWA 1GNUA 5E6OA 4LJOB 4DBGA 2ZPNA 3KUDB 4LCDE 1WH3A 5E6PA 3TL5A 1TTNA 3PSEB 2KJRA 2ZNVC 1L2NA 4K1RB 4PYUA 4WJQA 1XT9B 2MLBA 4CO7A 4IW0A 4ICUA 2LVOA 1S3SG 2CKHB 2HTHA 4KV2A 3ZNHB 1J0GA 4EEWA 3PLUA 3CSFA 3QA8A 5DPSA 3ZTCA 2UYZB 2DAJA 4MSMB 1ZGUB 1NBFC 1R4MI 1UBQA 1E7VA 2KX3A 4HCPB 3V6CB 2WWZA 2LD9A 2DYMA 3SU8X 3I3TB 4GSWA
chains in the Genus database with same CATH superfamily
2HE7A 2SEBD 4A90A 3ZDMC 1D4BA 3AE9B 2N0SB 1JMLA 4NQLB 2LMCA 1QF6A 4A9AA 4RF0A 1LFDA 2ZJDA 5H92C 1ZP0B 3A9JA 4WH4A 1CJEA 4BAXA 4JLCA 4RMAA 2I38A 1ACCA 1Z5SB 2FIDA 2K22A 3NS1A 1VZ7A 3AEEB 4ZRKA 1MJDA 3QHTA 3AEGB 4NNJB 4N59A 1OTRB 2RSUA 3A1QA 1V9JA 3GP7A 5JHBA 3KYCD 2ZNVB 1PUTA 2BBCA 4G0NB 4OVUA 3PHXB 4HKZE 2QHOA 1AW7A 2INNE 4RH6A 3M62B 2NTTA 3UQAA 2K39A 3UIOB 2MJEA 3KUZA 2J0JA 3RNFC 2KAJA 3B9JA 4BKSA 1IPGA 2KO3A 3DBHI 1OFFA 3RNGC 2INDC 2LI5A 5HI1A 3AEDB 4EZJA 3PT2B 3RZWC 1FXTB 3P2BA 1AN8A 1TBEA 1WSPA 1UD7A 2AL6A 2VRRB 3RPFC 3QWZB 3W9CB 3P4PB 4JQWC 3ZDTA 3V61A 3T3NA 3EFCA 3RZFA 1TY2A 4AWJA 4PS7A 2B3AA 2KVRA 2WX0A 1L7YA 1ENFA 1SEBD 3IXSA 2MP2B 3OJ4B 2K9XA 1Y8RC 1IUEA 3Q3FA 4OVZA 1ZOYB 3RN9C 1I4HA 1F2RC 3M63B 3M95A 2L1AA 4YTNB 3VFKA 3Q69A 1QQRA 3PPAA 5G55A 3I57A 3MC0B 5AZFA 4DQOC 1YQ4B 1L6VA 1YNTE 1MHXA 3FILB 1TIFA 3RYTA 3HHMA 1UGJA 1BXTA 3QAQA 4RFBA 1PQSA 4TQ0A 4ARIA 3LDZE 4AOFA 2FUG1 4XDDA 2KFJA 3NOBA 1E90A 4L23A 2AYOB 1N5XA 3SHQA 1VZ8A 1RFKA 2K25A 3H7PB 3KLSX 3N1YC 1FNWA 3Q8AA 2K1FA 3DCGA 4ZYSA 1QOAA 2KFKB 4BKSD 1XQQA 2KDBA 2W3SA 5IA7A 2L00B 4BBNF 1SJED 3SDLC 1XCTL 2V4IB 1WI0A 2DHZA 1P7FA 1DOIA 4M8NA 2M1MA 3HIZA 3LB8C 3PHWB 5MPOA 4A3PA 2NR2A 2W82A 2Y5PA 1WYWB 3MHSD 4WWOA 4JE3B 1RRBA 2JXXA 2L3ZA 4LDTD 4W9FA 3BVZA 2N9XA 3HM3A 2OJWA 1P3QU 3NVWA 2WXKA 4FA6A 4FN2A 4JWSC 2KQ4X 4MT5A 4XDCA 2XBBC 1PFDA 4NAWB 5DPRA 1E10A 3PRPB 3ZGZA 1I35A 1VDVA 2VH1A 1JW9D 2AEHA 1V5OA 2GBNA 4BFRA 2LUEA 2MSED 1G6JA 1XLQA 4GDKA 3GZNI 1T0YA 1C76A 2BKRB 1WR1A 2JWZA 3AEAB 3B1LX 5E6NA 2K6DB 2UWQA 3AU4A 2KC1A 2KWVB 3NZSA 4W9EA 1YQ3B 2DZIA 3W1YA 2L32A 2MW5A 3RMKC 2BS3B 4MGIE 1WJ4A 3EHVA 1XLNA 1Q0WB 3ALBA 3DQVA 3Q8EA 5BO4B 3ZLZA 1HQRD 3IVFA 4W9IA 1RM6C 3MTNB 4R3DA 1KOTA 3MJWA 1FM0D 2KQ7A 2H89B 1M94A 2I1KA 4GDLA 3ZO5B 1WGHA 3Q6BA 2ZZPB 4WAAA 4CYEA 1WY8A 4F7ZA 4US8A 1RAXA 4ZHPA 1RFAA 3DWMA 1GG3A 3D32A 5D2MB 4TSSA 1WM2A 3ZJUA 4XWWA 1BT0A 2LGIA 3DDCB 1C79A 3VUYA 2PE9A 5KHQA 2OEDA 3ABVB 2I2YA 1SIFA 2WP9B 2WYQA 2C9WB 1P98A 3V62A 2FCQA 2PVGC 1L5PA 3A4SC 2AQ1B 2BKFA 2DLBA 4CQNA 1WR6E 2BS2B 2KJHB 1LQBA 2KDEB 1QOBA 1Z2MA 1SF0A 3W2DA 2KK8A 3IBEA 4IM2A 3C0RB 5JHAA 3JSVA 1IBXB 3MP9A 4HJKA 4KSKC 2QMTA 3AH7A 2WDRB 3NG0A 2N1WA 4RCOA 1IYFA 1E6EB 1FNVA 5BMIA 2L0TA 5D94A 5EE1A 1YJIA 4URKA 4XWTA 2D11A 1JWMD 4DWFA 4XE0A 4FHKA 4P16A 3ZTDA 4WQOB 4IC7B 2E6XA 2BWES 1OEYA 2MCNB 2G1EA 2WXNA 4WWNA 3L0WB 3Q8CA 3ZXRA 4ZRPA 1WRDB 4HPLB 4P1CC 4DK5A 1CMXB 1WZ3A 4KGSA 4W9LA 1E8YA 3M3JA 3H7SA 1TYGB 3KH0A 3TUOA 4B6WA 2O6VB 5L95C 1YQBA 4WJPA 1NDDA 1MVKA 4DXFA 1SB3C 2LXAA 3PRMB 4OZAA 5TSSA 1JCKB 4WIPA 3TEYA 1YJ1A 4EUTA 1KLVA 1FRRA 4YL8A 5C23A 1HXYD 1V49A 2KKCA 3ETRA 3AE5B 1YMHE 5G5HA 1C4CA 1WJUA 1XCQL 4C7YA 2KNBA 1PGBA 3QARA 2NMQA 2BYVE 5FKAC 5D3DA 2BWFA 4KGTA 2JRHA 1WXVA 4HCNB 4Q2JA 4RM8A 2JQRB 4QAYA 3N3KB 1KLUD 4JIOU 3AI5A 1VJKA 4IM3A 3Q3MC 4ANXA 1GNUA 3KUDB 1PGXA 5E6PA 3PSEB 2E3TA 4A55A 2MLBA 4CO7A 2LVOA 2CKHB 4MSMB 2DAJA 1NBFC 4M01A 2WWZA 4HROA 2OHFA 3HUIA 2GB1A 2LZ6A 1C78A 2KLCA 2M56B 5HKHA 3WIMA 2ZCBA 4AJYB 2NS5A 3L4PA 5EDSA 1J7AA 2DZMA 2KWUB 4B0EA 3PZ8A 1IGDA 2LHEA 5IO9A 3IG3A 1FCLA 4IOIE 4HLEA 2CS4A 4LNFA 4KDIC 5T8IA 3AEBB 2Y5CA 2KWCA 2YLMA 1NI3A 5J18A 3ECIA 5JH5C 3VUWA 3HK0A 2L7RA 2NPTB 3DVGY 3ZVVA 4F8CB 3U2SC 1OQYA 4NAMA 4WJOA 4PS8A 2N9EB 1WGRA 1SE9A 1V1PA 1OQQA 1XD3B 2SAKA 4ANWA 3RULA 1IP9A 3IAS1 4IWOA 4F1SA 3DWGC 2K3UA 4X57B 2KXJA 1WX7A 4KVGB 4HDQA 4C00A 1I4QA 3HM6X 1F0ZA 5LNK1 4GXBA 1QOFA 4MGZE 4BOZB 3IT6B 2WXJA 3EC8A 1QZEA 1DOXA 2KT7A 1YIWA 2GBKA 2JZPA 4D2KA 2KWDA 5CTRC 3KWLA 2J52A 2L05A 1HE8A 2L83A 5JZEB 2OOBB 1A5RA 2BPSA 1H8CA 1HEZE 2KANA 2XNAC 2KTRA 2KC2A 3VVWB 1MI0A 5BYSA 1C4PA 5D6JB 4TV3A 2CHZA 2VZKB 3QK0A 5BMHA 5J2RA 4LNKA 2JU6X 3APDA 1TZOA 1T5XD 4KDLB 2KVZA 3V3XA 1HZ6A 5IN7A 3BYTB 3FKYA 3AE8B 3DHHC 3AE2B 4NQKE 4HDOA 2AX5A 1L0YB 1ZUD2 2ZVNA 1ZE3D 2LXCA 2O6VD 2BW2A 1AYFA 3K9PB 2KOXA 1B9RA 3VHTC 1N63A 3TBLD 2CU3A 4OVVA 1TZ1A 2BYTA 1K52A 1I4GA 3P63A 3ZKJC 1TS3A 4MH0E 1KH0A 4MGYE 5FR6A 3CF6E 3PTFC 2WXFA 4WAFA 1C9FA 2MWSB 3TEZA 2PW9A 4DDID 3PLVA 2FUHB 3TEXA 1XO3A 1E7PB 2D07B 4XYCA 1A70A 3DVGX 3A33B 1WXSA 4ARCA 1NEKB 1RLFA 1WE6A 1T0QC 2IY0B 4BKGA 3VH3B 1FMAD 2GI9A 4A6QA 4RGTA 2JSVX 4II2B 3AM9A 1D5ZC 1UELA 4B9KA 4OHJA 5IKCM 3R3MA 2KLGA 2QILA 1XEEA 1WX8A 1V8CA 4KX6B 2IO2B 4P7IA 4BKTA 2GBRA 3KYDD 5CHFA 4WWMA 2BYEA 1L0VB 4W9JA 2PTLA 5HG2A 2CR5A 1WE7A 1VR9A 1D3ZA 2DWQA 2NBUA 4M02A 2IO1B 5FR3A 2WXOA 3IAM1 1WXAA 3QCAA 2WHIA 3Q8BA 2KACA 4ZHOA 5AZHA 4LK0M 4YSZB 2GBMA 4TKNA 4YTMB 1NYQA 1NVID 1EF1A 2KMAA 3JVZX 1LGRA 4KGRA 3E9SA 1TKEA 2LUMA 1J8CA 4P1BC 4FBJB 4GN1A 5FK9C 2KHWB 3ML8A 4AS1A 2L76A 2OJRA 2V1YA 3V60A 1ROEA 2L8JA 2LGXA 2J0KA 2LGDA 2PVOD 4RNAA 1ZW7A 2JYEA 2RR9A 1Q10A 2QSDA 2LHDA 4L2YA 4C7ZA 3RI7C 2MA9B 3U4EG 4FJZA 3RFZB 1SGHA 2Z0EB 3SFEB 2PMVA 2FE8A 3NVZA 3KUCB 2IGDA 3WALA 2KJ6A 3KWVA 3QC8B 4KIKA 5EE3A 3ENEA 3WCQA 2KN4A 1EWYC 2PLPA 3APCA 3U30A 3X0WA 3VDZA 4JWUC 1WYGA 2PE6B 4B0MA 1CK1A 4US9A 1CQVA 5L83A 2D2QA 1JWSD 4NJCA 3R7RA 1JWAD 2AWTA 1L4DB 1L4ZB 2WXRA 2NBVB 1WMHB 1K53A 4M0WA 2K6QA 2MP2A 4DHJB 2O2VB 2RGFA 2HTME 1HZ5A 1OQRA 1UBIA 4I6NB 1FIQA 2C60A 3RNBC 1T3QA 1JWUD 2J42A 2AQ2B 1J19A 4KZCA 2PIAA 4N58A 2GRIA 1E8XA 2M8SA 1AARA 3DBHB 2NVUI 2CJOA 3VQIA 5BMGA 4J3OD 4DXAB 1B1ZA 4AJWA 3AB5A 4G50A 1GB1A 2K8BA 1L0XB 2MEKA 4DHZB 4H2AA 1NENB 2AQ3B 2XK5B 3GE8C 1QLBB 4HXDA 3SFDB 4WWPA 3L13A 4ANVA 4L1BA 2LRUA 2BF8B 4K7SA 1L6UA 2JZ3B 4ZRIA 3TSSA 1YX6B 4BZAA 4GLSC 4A8XC 3ZNGC 2L0FA 4BOSC 4MDKE 1MFWA 1JALA 2KFKA 3P4QB 4TUUA 3B2GA 3ZNID 2D5GA 2JUOA 1SE3A 2QDFA 4K3CA 1WH3A 4LNNA 4PYUA 1XT9B 3MC8A 4IW0A 4ICUA 1J0GA 1EM7A 3PLUA 4RGMA 3QA8A 2M0AA 5DPSA 2UYZB 3MJ5A 4C4VA 1UBQA 1R4MI 3V6CB 1UF0A 1QKZA 2UU7A 3SU8X 3I3TB 4N9F4 2JPHA 2N9LA 2IPKD 4FULA 1UH6A 2DYOA 1C1YB 1WGKA 3WA0A 3ZJVA 4KKIA 3QX1A 3VTUA 3BYYB 5KHOA 1WJNA 2EELA 4NAWA 4ITKA 5AEKB 3UIPB 1U4AA 2IYDB 5GXGB 2XEWA 1VRAB 4AP4C 4WQMA 3DBLI 4YTPB 2KDIA 2JRIB 2D3BA 3GS2A 2WXMA 5GMVA 5IAAC 2JF5A 4HWIB 2KZRA 3L17A 4ANUA 4P6VF 2N7EA 4A20A 2N4FA 2W54A 3PZDA 5DCNA 3AE3B 1TS2A 4C80A 1LXDA 1KFYB 3Q3OC 3Q3NC 4WJNA 3ZJTA 1EO6A 1V2YA 1WGDA 1QT9A 1R4NI 2ASQA 5LLIA 3DHIC 2N9PC 2N1VA 1V5TA 3TEWA 1EUVB 1PGAA 4EFOA 5C1ZA 1C3TA 2RDGA 4MGKE 3KW5B 5I4DA 3BK2A 5EE9A 4I6LB 1VLBA 3UQBA 3URYA 2WXIA 1P0RA 4IWQA 4MM3B 2FIFA 3VRBB 3DBRI 2AL3A 3W1SC 2WDQB 3H9DA 2CHXA 2DZKA 2R61A 1FD6A 3GZNB 4K7WA 2MBHA 1VD2A 2LVPA 3N1XC 4FADA 3VTVA 2FAZA 1MG8A 2DBYA 4YT0B 1Y56A 4LNIA 5DPWA 4MH8A 3HRDD 2L52A 4JGHB 2R2OA 1N60A 1ZDVA 3P4RB 4FJYA 2XN9C 5HHDG 2WU2B 2LGYA 1FNUA 4I6PA 1CZPA 3QQ8B 2LJ5A 1UGMA 1AWDA 4K3BA 2HDEA 2WLBA 2M17A 2BVCA 2WXLA 3BWUD 2V3PA 1UUPA 2WU5B 3PS6A 2RD0A 2DAFA 3KQ4A 3U52E 3B08A 4HRSA 1I4RA 2FNJB 3DOWA 3UGBB 1K8RB 1GPXA 4ZYNA 1WRIA 2WNMA 3BIID 1SBBB 1XLOA 3VAWA 2JY6A 4N6EB 2D3AA 2LEKA 2O6VA 3TJPA 2JX5A 2RDBC 3P42A 2JXTA 3ZRFA 4ASWC 1BMLC 4HEA1 1VZ6A 4GMVA 4EOYA 3VR9B 2K8CA 2QCZA 2HJ1A 4IKGA 2DX5B 2HJ8A 3EUB2 1GAQB 1H4RA 3PREA 3ZW3A 2YVCA 1XLPA 3TMPB 4M8MA 3TCAA 3NY5A 3A9JB 3Q8FA 2DYBA 3Q3JA 3BVMA 4E71A 2EKIA 1TY0A 1TKGA 2WGSA 2K5PA 3V05A 4B95A 4NPNA 4G11A 2MRPA 2YEPB 3A1QB 1J7BA 3ML9A 2MH7A 1WXMA 4RGNA 1K51A 2BYFA 4YWGG 1FO4A 1ISNA 1EWCA 4MSQB 3NHEB 4NY0A 4MJSA 1S1QB 4ICVA 4HPMB 4FLHA 5IP4D 2WX1A 2C7MB 3P4SB 3RCZA 1RWSA 3U7ZA 1R7SA 3O13A 2BTEA 2G3QB 3CSTA 2WXQA 1FPYA 2M0XA 3H8HA 3DVNV 4IM0A 2CHWA 2M4NA 2IO3B 2BS4B 3NVYA 1TS4A 2PKOA 2K0PA 1GJZA 3ZRCA 1TJEA 5CHVC 5AZGA 3ZQ4A 1ESFA 3O65B 4LDTB 4HVBA 2R2QA 1T0SC 2WDTB 2IZVB 2W55A 2NCNA 3JYUA 2BB6A 2RDHA 1KLGD 3OAWA 2NPTA 5C2TB 4XZ4A 1WX9A 3L10B 5E6JA 2VH2A 2LWPA 2MQJA 3ONSA 1F2RI 3BINA 4W9GA 3EFUA 1E5WA 1UWMA 1D5XC 4GIVA 2IY1B 4EZKA 3VR8B 2JZZA 3AU5A 1I7HA 2J0MA 1JROA 3P1MA 2PEAA 4AQ7A 2QIEB 3H6NA 1KJTA 3AE4B 2IGHA 2N9KA 2G45B 4REZA 4NJ7A 3R8BA 1UWXA 1JWBD 1Q1OA 3A9KA 2NTSA 1JQ4A 2JYTA 3OWEB 5BYQA 1FXAA 4O1NA 2ICIA 3EA6A 4ZRQA 4HKQA 2FCMA 3N1ZC 2IJ0A 2EMSA 2V3NA 2JT4B 3MFGA 3AULA 3RD2A 2REXA 1TT5B 3NJTA 4KIKB 1I4XA 3AV8A 3APFA 3WANA 1K50A 2MBEA 1P7EA 1WM3A 3DVNU 2INPE 3R7QA 2ZW0A 3AE7B 5G2NA 2WDVB 1GC7A 2KTFA 1PDXA 4M0WB 2X8XX 3GB1A 3NUHB 1WWTA 1P9DU 2G4DB 1RYJA 4JL9A 3FC4A 2WS3B 3R2TA 2Y3AA 4GU2A 2KX0A 1ZKHA 1ZPSA 3L08A 3S2AA 1ZXHA 3C19A 1N61A 4GDKB 4FHJA 3AE1B 3VTWA 5G5GA 5E6OA 4LJOB 4LCDE 4OZCA 3NVVA 2KJRA 2Q5WD 1SE4A 2QC8A 1GOZA 2HTHA 2ON8A 3CIRB 1DYQA 3ZTCA 1ET9A 1DOYA 4HCPB 2MJDA 5AUKA 3AECB 2LD9A 3AEFB 2DYMA 4GSWA 3EECA 2ONQA 2BB5A 1FEHA 3ZNZB 3OG5A 3SEBA 2ZW1A 1NI2A 3WAPA 3WAMA 2C7NB 2VZKD 3N32A 1XF5L 2INCC 4GDLB 4GOCA 2M19A 3R2IA 2WXGA 1V81A 4DXGA 1NYRA 1WZ0A 5DPTA 3V6EB 1ET6A 3CMMB 2EKEC 1F1HA 4BVUC 4YXDB 2MBBB 3BY4B 1N62A 1KRHA 1FCCC 5HFYA 2A5UA 4S0RA 2GBJA 1V86A 4C4VB 4AUQC 2IBIB 4EE2A 4OZBA 4HK2A 4K81A 1E8WA 1WJ6A 2W3RA 1YOVB 1E7UA 3PZ7A 2KD0A 2C5LC 3ZUNA 1T0RC 1N6ZA 2D10A 1I4PA 2PPHA 4IDIA 3U7DA 4DHZE 2V4LA 1FXIA 5D3IB 2N7DA 4II3B 3JSVB 3FAHA 3Q14C 3DPDA 4YSYB 3FILA 1E0ZA 1TKYA 2LVQA 1F52A 1YD8U 4UDUC 4S17A 3PGEA 1UZXB 2QJLA 3RNAC 2KQSA 1LM8B 5D7GA 1SSNA 4XGAB 2TSSA 4IUMB 4PS3A 3H7PA 2JVCA 1GB4A 4PYZA 1PYWD 2V9HA 2J7QB 3AE6B 2MBQA 3LJ3A 1MPEA 3UI3A 3X23A 3UF8A 3K9OB 1V1OA 1V80A 3I9V1 4XC2A 4PT5A 2DNFA 3NZUA 3VXWA 2YEPF 4W9HA 2LRWA 4G3XB 4EZLA 4NJ6A 4GB9A 2I1JA 2G4SA 5TR5A 2Y5BB 3RUIB 5LXIB 3NZ3A 3RNCC 2GLSA 4USAA 2JWUA 3N20C 2EMTA 3SD5A 2KMMA 2V0GA 1J7CA 2K8HA 2CJNA 2QEJC 3VRAB 1WMHA 4RF1A 4A3OA 1SIJA 2O2VA 2J4XA 1YX5B 3PVLA 1WIAA 2FBWB 3UINB 2B76B 1UNSA 2FCSA 2ZPYA 2KDFB 3AMZA 2LGSA 4FXCA 1EU4A 1EF5A 2Z8LA 1YN3A 3E56A 1M4VA 3W5VB 3RT3B 3HVDA 2RPVA 2ACZB 1QOGA 3ZIMA 2WQYB 1XXGA 4ACFA 3I5JC 3T3OA 1STEA 2PJHA 1ZDXA 1EU3A 2XK5A 1OEYJ 2GOWA 4LNOA 3RNEC 3PRZA 4GGQA 4BBNC 1OGWA 2GMIC 4KKJA 5AUIA 3LXFA 3AXCA 2RPQA 1JRUA 3OLMD 5EE0A 4JPSA 1LO5D 4LLGM 5LXHA 2FCNA 3Q2AC 4OW0A 2IGGA 4W9CA 1Q5WB 3DBSA 2D3GA 1V6EA 1JRPA 1IGCA 4IWPA 2CU1A 4EKUA 1D5MC 3AN1A 4CHKA 1V1PB 1P1AA 1WF9A 3SR6A 4MACA 2DENB 4W9DA 4XX5A 2WXPA 4M00A 4JX1C 3L54A 3BK1A 4MEMA 1TGZB 4LJPB 5CX3A 4DHJD 3JW0X 4RM9A 1SXTA 1I42A 3U8ZA 3N30A 1YN4A 3BVGA 3B0AA 2KN5A 1F77A 1IBXA 3LYYA 2X38A 1MHHE 2NBWB 3QJZA 3J9CA 3GOEA 3DHGC 3VUXA 4TMAB 2BGFA 2KTRB 3BZDB 1E8ZA 2DZJA 1F9JA 5J17A 1V97A 2MHJA 4MJSB 3WAOA 4YSXB 3MHZA 4W9KA 1YJJA 4ZDVA 2C7HA 1R4MB 4C56C 3C8YA 2LJIA 1YN5A 3MC9A 4E74A 3PO0A 1FRDA 2LFIA 3T9LA 3ZXVA 1X1MA 2KDMA 2ZVOA 5C3JB 3N9YC 1N5WA 1GC6A 2LASA 1TS5A 3L16A 2WXHA 5BYRA 3R66C 3GE3C 5CHWA 1MG4A 1SE2A 2W9NA 2MBOA 4IG7B 1KF6B 4E3CA 3IHPC 3DBLB 3TIXA 4KSLC 3IFWB 3IT4B 1SJHD 4MM3A 3W5UB 2Z0DB 2IDYA 3VH4B 4FJVB 5IOIA 2V3SA 3EGRA 2Z59B 2ZCCA 1KTKA 2N7JA 3PV1A 3KVFB 2KYWA 3NS8A 2BQQA 1KM7A 1VCBA 2BT6A 2H88B 4ZRJA 2D3CA 1HTOA 4J6IA 2G9HD 3HVZA 1HA5A 3H1UA 4ZOHC 4NZLB 1C4AA 5JXVA 1WXQA 3QIJA 4PK1A 1E9MA 1C77A 2ZEQA 1R4NB 1WGYA 3CWIA 4HPPA 3I63C 1WGGA 2KMCA 1FFVA 2HD5B 3B2FA 3T8MA 4TQ1A 4HJGE 4MELA 3DBRB 4KZ0A 2MX2A 4DDGD 1DGJA 2IO0B 3A4RA 3W1SA 5H8YE 3A9KB 1GUAB 4K7UA 1WFYA 1ZXIA 1QILA 1BUIC 2A4ZA 3OJ3A 4WURA 4DBGA 2ZPNA 3TL5A 1TTNA 1D6EC 2ZNVC 1L2NA 3ZYYX 4K1RB 4LTUA 4WJQA 2MJ3A 1HTQA 4KV2A 1S3SG 3ZNHB 3NRZA 4EEWA 3CSFA 2RMMA 1ZGUB 1E7VA 2KX3A 1FFUA 4RGOS 1T6BX 2J53A
chains in the Genus database with same CATH topology
2HE7A 4N9F4 2JPHA 3EECA 3ZDMC 4FULA 2LZ6A 1UH6A 2DYOA 3ZNZB 1C1YB 4NQLB 3WA0A 2KLCA 1NI2A 3WAPA 5HKHA 3WAMA 3QX1A 3WIMA 2ZCBA 3VTUA 4AJYB 1LFDA 2NS5A 2ZJDA 5KHOA 2C7NB 1WJNA 4NAWA 5EDSA 3N32A 3A9JA 5AEKB 4GDLB 4GOCA 3UIPB 1U4AA 2DZMA 2IYDB 2KWUB 4JLCA 4RMAA 1V81A 2XEWA 1Z5SB 2FIDA 1WZ0A 4AP4C 5DPTA 3DBLI 3IG3A 2KDIA 3V6EB 4ZRKA 3CMMB 2JRIB 2EKEC 4HLEA 4BVUC 5GMVA 5IAAC 2CS4A 2JF5A 4HWIB 2MBBB 3BY4B 3QHTA 4NNJB 4KDIC 2KZRA 3L17A 4ANUA 2KWCA 2YLMA 1OTRB 2N7EA 4A20A 2RSUA 3A1QA 5DPRA 1V9JA 5J18A 2A5UA 3ECIA 5JHBA 2GBJA 5JH5C 3VUWA 2N4FA 1V86A 2L7RA 2ZNVB 3HK0A 3KYCD 2NPTB 3DVGY 3PZDA 5DCNA 4AUQC 3ZVVA 4F8CB 4G0NB 1OQYA 2IBIB 4OVUA 3PHXB 4HK2A 4K81A 1E8WA 1LXDA 1WJ6A 2QHOA 4WJOA 1E7UA 4PS8A 2N9EB 2KD0A 1WGRA 2C5LC 1SE9A 1XD3B 3ZUNA 3M62B 4WJNA 3UQAA 2K39A 3UIOB 4ANWA 1EO6A 3RULA 2D10A 1IP9A 1V2YA 3KUZA 2J0JA 2PPHA 1WGDA 4IWOA 4F1SA 3U7DA 4DHZE 2V4LA 4BKSA 1IPGA 2KO3A 3DBHI 4X57B 1R4NI 2KXJA 2N7DA 4II3B 2LI5A 2ASQA 1WX7A 5LLIA 4KVGB 4HDQA 4EZJA 3PT2B 3JSVB 3RZWC 3DPDA 2N9PC 2N1VA 3HM6X 1FXTB 1V5TA 1EUVB 3P2BA 2VRRB 1TBEA 4EFOA 1UD7A 2AL6A 2LVQA 4GXBA 5C1ZA 3QWZB 3KW5B 4MGKE 4MGZE 1YD8U 4JQWC 4BOZB 4I6LB 3ZDTA 3EC8A 1QZEA 3V61A 3UQBA 3PGEA 1UZXB 1YIWA 2GBKA 1P0RA 4IWQA 3RZFA 2KQSA 2FIFA 5CTRC 4AWJA 1LM8B 3DBRI 2AL3A 2B3AA 4PS7A 5D7GA 3W1SC 2KVRA 2WX0A 2L05A 1HE8A 3H9DA 1L7YA 4IUMB 2CHXA 5JZEB 2OOBB 2DZKA 1A5RA 2BPSA 1H8CA 2MP2B 3OJ4B 4K7WA 2KANA 2MBHA 2KTRA 1Y8RC 2KC2A 4PS3A 3H7PA 2JVCA 3VVWB 4PYZA 1VD2A 2LVPA 2J7QB 3Q3FA 4TV3A 5D6JB 4FADA 2MBQA 2CHZA 3QK0A 3VTVA 5J2RA 3LJ3A 3X23A 3M63B 3M95A 2FAZA 1MG8A 3UF8A 3VFKA 3APDA 3K9OB 3PPAA 5G55A 5DPWA 1V80A 4KDLB 5AZFA 4XC2A 4JGHB 2R2OA 3NZUA 3RYTA 3VXWA 4W9HA 3HHMA 2LRWA 4FJYA 4G3XB 4NQKE 4NJ6A 4HDOA 4EZLA 4GB9A 2LGYA 2ZVNA 2I1JA 2G4SA 2LXCA 3QAQA 4I6PA 1PQSA 2O6VD 4TQ0A 5TR5A 2Y5BB 3QQ8B 2LJ5A 3LDZE 1UGMA 3RUIB 5LXIB 3K9PB 4AOFA 2KOXA 2KFJA 3VHTC 3NOBA 2EMTA 1E90A 2AYOB 3TBLD 3SHQA 3SD5A 2M17A 2K25A 3H7PB 4OVVA 1TZ1A 2K8HA 3ZKJC 2K1FA 1WMHA 3PS6A 4MH0E 4A3OA 2RD0A 2DAFA 3DCGA 2O2VA 2KFKB 4MGYE 5FR6A 3CF6E 3B08A 3PTFC 1XQQA 1YX5B 2KDBA 4BKSD 2FNJB 3PVLA 5IA7A 3DOWA 1WIAA 2L00B 2MWSB 3SDLC 4BBNF 3UGBB 3PLVA 4DDID 1K8RB 2FUHB 4ZYNA 2D07B 1WI0A 3UINB 2DHZA 3VAWA 2JY6A 4M8NA 2M1MA 3HIZA 3PHWB 2O6VA 2FCSA 2NR2A 2ZPYA 2KDFB 4A3PA 3TJPA 1EF5A 3DVGX 3A33B 1WXSA 1RLFA 1WYWB 1WE6A 3ZRFA 2IY0B 4BKGA 3MHSD 4WWOA 3VH3B 4ASWC 3RT3B 1RRBA 2JXXA 2L3ZA 4LDTD 4W9FA 4GMVA 4EOYA 2N9XA 2K8CA 4II2B 3ZIMA 3HM3A 1C3TA 1P3QU 2DX5B 1UELA 4B9KA 2HJ8A 3R3MA 4FA6A 4FN2A 2KLGA 1H4RA 3PREA 3ZW3A 2YVCA 2PJHA 3TMPB 2XBBC 2XK5A 1WX8A 4M8MA 4NAWB 3NY5A 1OEYJ 2GOWA 2IO2B 3A9JB 3PRPB 3PRZA 4GGQA 3TCAA 4BBNC 4P7IA 1OGWA 2DYBA 3Q3JA 2GMIC 1I35A 4BKTA 2GBRA 4E71A 3KYDD 5CHFA 2AEHA 1V5OA 2GBNA 2BYEA 3AXCA 4BFRA 2RPQA 4W9JA 1JRUA 2CR5A 3OLMD 2LUEA 1WE7A 5LXHA 2MSED 1G6JA 2FCNA 4B95A 1D3ZA 4GDKA 4NPNA 4G11A 2MRPA 2NBUA 3A1QB 2IO1B 3GZNI 1T0YA 3ML9A 4W9CA 1WXMA 2BKRB 1WR1A 1WXAA 2JWZA 3B1LX 3QCAA 5E6NA 1Q5WB 2K6DB 2UWQA 3DBSA 2D3GA 2BYFA 1V6EA 4IWPA 3AU4A 2KC1A 2KWVB 2CU1A 3NZSA 4EKUA 5AZHA 1ISNA 4W9EA 2DZIA 4MSQB 3NHEB 4CHKA 4NY0A 1P1AA 1WF9A 2GBMA 4MJSA 3W1YA 1S1QB 2MW5A 4ICVA 4HPMB 2DENB 4FLHA 4MGIE 4W9DA 4XX5A 1WJ4A 4TKNA 3EHVA 2WX1A 2C7MB 3RCZA 3L54A 1EF1A 2KMAA 1Q0WB 3ALBA 3DQVA 3JVZX 4MEMA 1TGZB 4LJPB 5BO4B 2G3QB 5CX3A 3ZLZA 3CSTA 3IVFA 4W9IA 4DHJD 2M0XA 3JW0X 4RM9A 3MTNB 1I42A 1KOTA 3U8ZA 3DVNV 3MJWA 3N30A 2KQ7A 4IM0A 3B0AA 1M94A 1J8CA 2I1KA 4GDLA 2CHWA 3ZO5B 4FBJB 2M4NA 4GN1A 1WGHA 2IO3B 2KHWB 2KN5A 3ML8A 2ZZPB 4WAAA 4CYEA 1WY8A 4F7ZA 2L76A 1GJZA 1RAXA 2OJRA 1RFAA 3ZRCA 2V1YA 3V60A 5CHVC 5AZGA 1GG3A 2L8JA 2NBWB 3D32A 3QJZA 5D2MB 3O65B 3GOEA 4LDTB 2LGXA 4HVBA 1WM2A 2J0KA 2LGDA 2R2QA 1BT0A 3VUXA 3DDCB 2WDTB 3VUYA 2PE9A 5KHQA 2IZVB 2BGFA 2KTRB 1E8ZA 2DZJA 1ZW7A 2NCNA 1F9JA 3JYUA 1SIFA 5J17A 2WYQA 2RR9A 2C9WB 3OAWA 4MJSB 3WAOA 1P98A 2NPTA 3V62A 4XZ4A 2FCQA 3A4SC 4W9KA 1WX9A 2BKFA 3L10B 4ZDVA 1WR6E 2C7HA 2KJHB 2LWPA 2MQJA 3ONSA 3BINA 4W9GA 3EFUA 2MA9B 1LQBA 1E5WA 4E74A 4FJZA 2KDEB 1Z2MA 1SGHA 4GIVA 2Z0EB 3T9LA 2IY1B 1X1MA 2ZVOA 4EZKA 2JZZA 3AU5A 2KK8A 3IBEA 3KUCB 4IM2A 3WALA 2KJ6A 2J0MA 1GC6A 3QC8B 3C0RB 4KIKA 2LASA 3ENEA 5JHAA 3JSVA 3APCA 3L16A 3U30A 3X0WA 2PEAA 4HJKA 4KSKC 1IYFA 3VDZA 2N1WA 3R66C 5CHWA 2L0TA 5D94A 2W9NA 2MBOA 2PE6B 4IG7B 4URKA 4E3CA 3H6NA 3IHPC 5L83A 3TIXA 4KSLC 3IFWB 2D2QA 2D11A 1KJTA 4DWFA 4FHKA 3R7RA 4MM3A 2AWTA 3ZTDA 4WQOB 2G45B 2NBVB 4IC7B 1WMHB 2Z0DB 2BWES 1OEYA 2MCNB 3VH4B 4FJVB 2V3SA 2K6QA 4WWNA 3L0WB 2MP2A 2Z59B 2O2VB 2ZCCA 4NJ7A 4DHJB 3PV1A 1WRDB 4HPLB 3KVFB 4DK5A 2RGFA 1Q1OA 3A9KA 3NS8A 1KM7A 1CMXB 1WZ3A 1UBIA 1VCBA 4I6NB 2C60A 4W9LA 1E8YA 3M3JA 3H7SA 3KH0A 4ZRJA 4B6WA 2O6VB 2FCMA 5L95C 1YQBA 2EMSA 1J19A 4KZCA 2JT4B 4WJPA 1NDDA 4J6IA 3AULA 3RD2A 2REXA 3H1UA 2LXAA 4KIKB 3PRMB 3APFA 3WANA 1KLVA 1E8XA 1YJ1A 1AARA 2M8SA 2MBEA 2NVUI 3QIJA 4EUTA 4YL8A 2ZEQA 3VQIA 1WGYA 1WM3A 5C23A 1V49A 4DXAB 2KKCA 4AJWA 4G50A 2K8BA 3DVNU 1WGGA 3R7QA 4DHZB 2KMCA 5G2NA 1WJUA 2HD5B 3T8MA 2XK5B 1GC7A 4TQ1A 2KTFA 2KNBA 4HXDA 4MELA 3QARA 4WWPA 2BYVE 4M0WB 3L13A 4KZ0A 2BWFA 2G4DB 1P9DU 2MX2A 4ANVA 2LRUA 2JRHA 2BF8B 4JL9A 4K7SA 4DDGD 4ZRIA 2JZ3B 2IO0B 1WXVA 3A4RA 3W1SA 4GU2A 2KX0A 4HCNB 1ZKHA 1GUAB 1YX6B 3A9KB 4RM8A 4K7UA 1WFYA 3N3KB 3L08A 2L0FA 4JIOU 3S2AA 3ZNGC 4MDKE 3AI5A 4BOSC 2KFKA 2A4ZA 3OJ3A 4IM3A 4GDKB 4TUUA 4FHJA 3ZNID 4ANXA 2JUOA 3VTWA 1GNUA 5E6OA 4LJOB 4DBGA 2ZPNA 3KUDB 4LCDE 1WH3A 5E6PA 3TL5A 1TTNA 3PSEB 2KJRA 2ZNVC 1L2NA 4K1RB 4PYUA 4WJQA 1XT9B 2MLBA 4CO7A 4IW0A 4ICUA 2LVOA 1S3SG 2CKHB 2HTHA 4KV2A 3ZNHB 1J0GA 4EEWA 3PLUA 3CSFA 3QA8A 5DPSA 3ZTCA 2UYZB 2DAJA 4MSMB 1ZGUB 1NBFC 1R4MI 1UBQA 1E7VA 2KX3A 4HCPB 3V6CB 2WWZA 2LD9A 2DYMA 3SU8X 3I3TB 4GSWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HE7 A;  4N9F 4;  2JPH A;  3EEC A;  3ZDM C;  4FUL A;  2LZ6 A;  1UH6 A;  2DYO A;  3ZNZ B;  1C1Y B;  4NQL B;  3WA0 A;  2KLC A;  1NI2 A;  3WAP A;  5HKH A;  3WAM A;  3QX1 A;  3WIM A;  2ZCB A;  3VTU A;  4AJY B;  1LFD A;  2NS5 A;  2ZJD A;  5KHO A;  2C7N B;  1WJN A;  4NAW A;  5EDS A;  3N32 A;  3A9J A;  5AEK B;  4GDL B;  4GOC A;  3UIP B;  1U4A A;  2DZM A;  2IYD B;  2KWU B;  4JLC A;  4RMA A;  1V81 A;  2XEW A;  1Z5S B;  2FID A;  1WZ0 A;  4AP4 C;  5DPT A;  3DBL I;  3IG3 A;  2KDI A;  3V6E B;  4ZRK A;  3CMM B;  2JRI B;  2EKE C;  4HLE A;  4BVU C;  5GMV A;  5IAA C;  2CS4 A;  2JF5 A;  4HWI B;  2MBB B;  3BY4 B;  3QHT A;  4NNJ B;  4KDI C;  2KZR A;  3L17 A;  4ANU A;  2KWC A;  2YLM A;  1OTR B;  2N7E A;  4A20 A;  2RSU A;  3A1Q A;  5DPR A;  1V9J A;  5J18 A;  2A5U A;  3ECI A;  5JHB A;  2GBJ A;  5JH5 C;  3VUW A;  2N4F A;  1V86 A;  2L7R A;  2ZNV B;  3HK0 A;  3KYC D;  2NPT B;  3DVG Y;  3PZD A;  5DCN A;  4AUQ C;  3ZVV A;  4F8C B;  4G0N B;  1OQY A;  2IBI B;  4OVU A;  3PHX B;  4HK2 A;  4K81 A;  1E8W A;  1LXD A;  1WJ6 A;  2QHO A;  4WJO A;  1E7U A;  4PS8 A;  2N9E B;  2KD0 A;  1WGR A;  2C5L C;  1SE9 A;  1XD3 B;  3ZUN A;  3M62 B;  4WJN A;  3UQA A;  2K39 A;  3UIO B;  4ANW A;  1EO6 A;  3RUL A;  2D10 A;  1IP9 A;  1V2Y A;  3KUZ A;  2J0J A;  2PPH A;  1WGD A;  4IWO A;  4F1S A;  3U7D A;  4DHZ E;  2V4L A;  4BKS A;  1IPG A;  2KO3 A;  3DBH I;  4X57 B;  1R4N I;  2KXJ A;  2N7D A;  4II3 B;  2LI5 A;  2ASQ A;  1WX7 A;  5LLI A;  4KVG B;  4HDQ A;  4EZJ A;  3PT2 B;  3JSV B;  3RZW C;  3DPD A;  2N9P C;  2N1V A;  3HM6 X;  1FXT B;  1V5T A;  1EUV B;  3P2B A;  2VRR B;  1TBE A;  4EFO A;  1UD7 A;  2AL6 A;  2LVQ A;  4GXB A;  5C1Z A;  3QWZ B;  3KW5 B;  4MGK E;  4MGZ E;  1YD8 U;  4JQW C;  4BOZ B;  4I6L B;  3ZDT A;  3EC8 A;  1QZE A;  3V61 A;  3UQB A;  3PGE A;  1UZX B;  1YIW A;  2GBK A;  1P0R A;  4IWQ A;  3RZF A;  2KQS A;  2FIF A;  5CTR C;  4AWJ A;  1LM8 B;  3DBR I;  2AL3 A;  2B3A A;  4PS7 A;  5D7G A;  3W1S C;  2KVR A;  2WX0 A;  2L05 A;  1HE8 A;  3H9D A;  1L7Y A;  4IUM B;  2CHX A;  5JZE B;  2OOB B;  2DZK A;  1A5R A;  2BPS A;  1H8C A;  2MP2 B;  3OJ4 B;  4K7W A;  2KAN A;  2MBH A;  2KTR A;  1Y8R C;  2KC2 A;  4PS3 A;  3H7P A;  2JVC A;  3VVW B;  4PYZ A;  1VD2 A;  2LVP A;  2J7Q B;  3Q3F A;  4TV3 A;  5D6J B;  4FAD A;  2MBQ A;  2CHZ A;  3QK0 A;  3VTV A;  5J2R A;  3LJ3 A;  3X23 A;  3M63 B;  3M95 A;  2FAZ A;  1MG8 A;  3UF8 A;  3VFK A;  3APD A;  3K9O B;  3PPA A;  5G55 A;  5DPW A;  1V80 A;  4KDL B;  5AZF A;  4XC2 A;  4JGH B;  2R2O A;  3NZU A;  3RYT A;  3VXW A;  4W9H A;  3HHM A;  2LRW A;  4FJY A;  4G3X B;  4NQK E;  4NJ6 A;  4HDO A;  4EZL A;  4GB9 A;  2LGY A;  2ZVN A;  2I1J A;  2G4S A;  2LXC A;  3QAQ A;  4I6P A;  1PQS A;  2O6V D;  4TQ0 A;  5TR5 A;  2Y5B B;  3QQ8 B;  2LJ5 A;  3LDZ E;  1UGM A;  3RUI B;  5LXI B;  3K9P B;  4AOF A;  2KOX A;  2KFJ A;  3VHT C;  3NOB A;  2EMT A;  1E90 A;  2AYO B;  3TBL D;  3SHQ A;  3SD5 A;  2M17 A;  2K25 A;  3H7P B;  4OVV A;  1TZ1 A;  2K8H A;  3ZKJ C;  2K1F A;  1WMH A;  3PS6 A;  4MH0 E;  4A3O A;  2RD0 A;  2DAF A;  3DCG A;  2O2V A;  2KFK B;  4MGY E;  5FR6 A;  3CF6 E;  3B08 A;  3PTF C;  1XQQ A;  1YX5 B;  2KDB A;  4BKS D;  2FNJ B;  3PVL A;  5IA7 A;  3DOW A;  1WIA A;  2L00 B;  2MWS B;  3SDL C;  4BBN F;  3UGB B;  3PLV A;  4DDI D;  1K8R B;  2FUH B;  4ZYN A;  2D07 B;  1WI0 A;  3UIN B;  2DHZ A;  3VAW A;  2JY6 A;  4M8N A;  2M1M A;  3HIZ A;  3PHW B;  2O6V A;  2FCS A;  2NR2 A;  2ZPY A;  2KDF B;  4A3P A;  3TJP A;  1EF5 A;  3DVG X;  3A33 B;  1WXS A;  1RLF A;  1WYW B;  1WE6 A;  3ZRF A;  2IY0 B;  4BKG A;  3MHS D;  4WWO A;  3VH3 B;  4ASW C;  3RT3 B;  1RRB A;  2JXX A;  2L3Z A;  4LDT D;  4W9F A;  4GMV A;  4EOY A;  2N9X A;  2K8C A;  4II2 B;  3ZIM A;  3HM3 A;  1C3T A;  1P3Q U;  2DX5 B;  1UEL A;  4B9K A;  2HJ8 A;  3R3M A;  4FA6 A;  4FN2 A;  2KLG A;  1H4R A;  3PRE A;  3ZW3 A;  2YVC A;  2PJH A;  3TMP B;  2XBB C;  2XK5 A;  1WX8 A;  4M8M A;  4NAW B;  3NY5 A;  1OEY J;  2GOW A;  2IO2 B;  3A9J B;  3PRP B;  3PRZ A;  4GGQ A;  3TCA A;  4BBN C;  4P7I A;  1OGW A;  2DYB A;  3Q3J A;  2GMI C;  1I35 A;  4BKT A;  2GBR A;  4E71 A;  3KYD D;  5CHF A;  2AEH A;  1V5O A;  2GBN A;  2BYE A;  3AXC A;  4BFR A;  2RPQ A;  4W9J A;  1JRU A;  2CR5 A;  3OLM D;  2LUE A;  1WE7 A;  5LXH A;  2MSE D;  1G6J A;  2FCN A;  4B95 A;  1D3Z A;  4GDK A;  4NPN A;  4G11 A;  2MRP A;  2NBU A;  3A1Q B;  2IO1 B;  3GZN I;  1T0Y A;  3ML9 A;  4W9C A;  1WXM A;  2BKR B;  1WR1 A;  1WXA A;  2JWZ A;  3B1L X;  3QCA A;  5E6N A;  1Q5W B;  2K6D B;  2UWQ A;  3DBS A;  2D3G A;  2BYF A;  1V6E A;  4IWP A;  3AU4 A;  2KC1 A;  2KWV B;  2CU1 A;  3NZS A;  4EKU A;  5AZH A;  1ISN A;  4W9E A;  2DZI A;  4MSQ B;  3NHE B;  4CHK A;  4NY0 A;  1P1A A;  1WF9 A;  2GBM A;  4MJS A;  3W1Y A;  1S1Q B;  2MW5 A;  4ICV A;  4HPM B;  2DEN B;  4FLH A;  4MGI E;  4W9D A;  4XX5 A;  1WJ4 A;  4TKN A;  3EHV A;  2WX1 A;  2C7M B;  3RCZ A;  3L54 A;  1EF1 A;  2KMA A;  1Q0W B;  3ALB A;  3DQV A;  3JVZ X;  4MEM A;  1TGZ B;  4LJP B;  5BO4 B;  2G3Q B;  5CX3 A;  3ZLZ A;  3CST A;  3IVF A;  4W9I A;  4DHJ D;  2M0X A;  3JW0 X;  4RM9 A;  3MTN B;  1I42 A;  1KOT A;  3U8Z A;  3DVN V;  3MJW A;  3N30 A;  2KQ7 A;  4IM0 A;  3B0A A;  1M94 A;  1J8C A;  2I1K A;  4GDL A;  2CHW A;  3ZO5 B;  4FBJ B;  2M4N A;  4GN1 A;  1WGH A;  2IO3 B;  2KHW B;  2KN5 A;  3ML8 A;  2ZZP B;  4WAA A;  4CYE A;  1WY8 A;  4F7Z A;  2L76 A;  1GJZ A;  1RAX A;  2OJR A;  1RFA A;  3ZRC A;  2V1Y A;  3V60 A;  5CHV C;  5AZG A;  1GG3 A;  2L8J A;  2NBW B;  3D32 A;  3QJZ A;  5D2M B;  3O65 B;  3GOE A;  4LDT B;  2LGX A;  4HVB A;  1WM2 A;  2J0K A;  2LGD A;  2R2Q A;  1BT0 A;  3VUX A;  3DDC B;  2WDT B;  3VUY A;  2PE9 A;  5KHQ A;  2IZV B;  2BGF A;  2KTR B;  1E8Z A;  2DZJ A;  1ZW7 A;  2NCN A;  1F9J A;  3JYU A;  1SIF A;  5J17 A;  2WYQ A;  2RR9 A;  2C9W B;  3OAW A;  4MJS B;  3WAO A;  1P98 A;  2NPT A;  3V62 A;  4XZ4 A;  2FCQ A;  3A4S C;  4W9K A;  1WX9 A;  2BKF A;  3L10 B;  4ZDV A;  1WR6 E;  2C7H A;  2KJH B;  2LWP A;  2MQJ A;  3ONS A;  3BIN A;  4W9G A;  3EFU A;  2MA9 B;  1LQB A;  1E5W A;  4E74 A;  4FJZ A;  2KDE B;  1Z2M A;  1SGH A;  4GIV A;  2Z0E B;  3T9L A;  2IY1 B;  1X1M A;  2ZVO A;  4EZK A;  2JZZ A;  3AU5 A;  2KK8 A;  3IBE A;  3KUC B;  4IM2 A;  3WAL A;  2KJ6 A;  2J0M A;  1GC6 A;  3QC8 B;  3C0R B;  4KIK A;  2LAS A;  3ENE A;  5JHA A;  3JSV A;  3APC A;  3L16 A;  3U30 A;  3X0W A;  2PEA A;  4HJK A;  4KSK C;  1IYF A;  3VDZ A;  2N1W A;  3R66 C;  5CHW A;  2L0T A;  5D94 A;  2W9N A;  2MBO A;  2PE6 B;  4IG7 B;  4URK A;  4E3C A;  3H6N A;  3IHP C;  5L83 A;  3TIX A;  4KSL C;  3IFW B;  2D2Q A;  2D11 A;  1KJT A;  4DWF A;  4FHK A;  3R7R A;  4MM3 A;  2AWT A;  3ZTD A;  4WQO B;  2G45 B;  2NBV B;  4IC7 B;  1WMH B;  2Z0D B;  2BWE S;  1OEY A;  2MCN B;  3VH4 B;  4FJV B;  2V3S A;  2K6Q A;  4WWN A;  3L0W B;  2MP2 A;  2Z59 B;  2O2V B;  2ZCC A;  4NJ7 A;  4DHJ B;  3PV1 A;  1WRD B;  4HPL B;  3KVF B;  4DK5 A;  2RGF A;  1Q1O A;  3A9K A;  3NS8 A;  1KM7 A;  1CMX B;  1WZ3 A;  1UBI A;  1VCB A;  4I6N B;  2C60 A;  4W9L A;  1E8Y A;  3M3J A;  3H7S A;  3KH0 A;  4ZRJ A;  4B6W A;  2O6V B;  2FCM A;  5L95 C;  1YQB A;  2EMS A;  1J19 A;  4KZC A;  2JT4 B;  4WJP A;  1NDD A;  4J6I A;  3AUL A;  3RD2 A;  2REX A;  3H1U A;  2LXA A;  4KIK B;  3PRM B;  3APF A;  3WAN A;  1KLV A;  1E8X A;  1YJ1 A;  1AAR A;  2M8S A;  2MBE A;  2NVU I;  3QIJ A;  4EUT A;  4YL8 A;  2ZEQ A;  3VQI A;  1WGY A;  1WM3 A;  5C23 A;  1V49 A;  4DXA B;  2KKC A;  4AJW A;  4G50 A;  2K8B A;  3DVN U;  1WGG A;  3R7Q A;  4DHZ B;  2KMC A;  5G2N A;  1WJU A;  2HD5 B;  3T8M A;  2XK5 B;  1GC7 A;  4TQ1 A;  2KTF A;  2KNB A;  4HXD A;  4MEL A;  3QAR A;  4WWP A;  2BYV E;  4M0W B;  3L13 A;  4KZ0 A;  2BWF A;  2G4D B;  1P9D U;  2MX2 A;  4ANV A;  2LRU A;  2JRH A;  2BF8 B;  4JL9 A;  4K7S A;  4DDG D;  4ZRI A;  2JZ3 B;  2IO0 B;  1WXV A;  3A4R A;  3W1S A;  4GU2 A;  2KX0 A;  4HCN B;  1ZKH A;  1GUA B;  1YX6 B;  3A9K B;  4RM8 A;  4K7U A;  1WFY A;  3N3K B;  3L08 A;  2L0F A;  4JIO U;  3S2A A;  3ZNG C;  4MDK E;  3AI5 A;  4BOS C;  2KFK A;  2A4Z A;  3OJ3 A;  4IM3 A;  4GDK B;  4TUU A;  4FHJ A;  3ZNI D;  4ANX A;  2JUO A;  3VTW A;  1GNU A;  5E6O A;  4LJO B;  4DBG A;  2ZPN A;  3KUD B;  4LCD E;  1WH3 A;  5E6P A;  3TL5 A;  1TTN A;  3PSE B;  2KJR A;  2ZNV C;  1L2N A;  4K1R B;  4PYU A;  4WJQ A;  1XT9 B;  2MLB A;  4CO7 A;  4IW0 A;  4ICU A;  2LVO A;  1S3S G;  2CKH B;  2HTH A;  4KV2 A;  3ZNH B;  1J0G A;  4EEW A;  3PLU A;  3CSF A;  3QA8 A;  5DPS A;  3ZTC A;  2UYZ B;  2DAJ A;  4MSM B;  1ZGU B;  1NBF C;  1R4M I;  1UBQ A;  1E7V A;  2KX3 A;  4HCP B;  3V6C B;  2WWZ A;  2LD9 A;  2DYM A;  3SU8 X;  3I3T B;  4GSW A; 
#chains in the Genus database with same CATH topology
 2HE7 A;  2SEB D;  4A90 A;  3ZDM C;  1D4B A;  3AE9 B;  2N0S B;  1JML A;  4NQL B;  2LMC A;  1QF6 A;  4A9A A;  4RF0 A;  1LFD A;  2ZJD A;  5H92 C;  1ZP0 B;  3A9J A;  4WH4 A;  1CJE A;  4BAX A;  4JLC A;  4RMA A;  2I38 A;  1ACC A;  1Z5S B;  2FID A;  2K22 A;  3NS1 A;  1VZ7 A;  3AEE B;  4ZRK A;  1MJD A;  3QHT A;  3AEG B;  4NNJ B;  4N59 A;  1OTR B;  2RSU A;  3A1Q A;  1V9J A;  3GP7 A;  5JHB A;  3KYC D;  2ZNV B;  1PUT A;  2BBC A;  4G0N B;  4OVU A;  3PHX B;  4HKZ E;  2QHO A;  1AW7 A;  2INN E;  4RH6 A;  3M62 B;  2NTT A;  3UQA A;  2K39 A;  3UIO B;  2MJE A;  3KUZ A;  2J0J A;  3RNF C;  2KAJ A;  3B9J A;  4BKS A;  1IPG A;  2KO3 A;  3DBH I;  1OFF A;  3RNG C;  2IND C;  2LI5 A;  5HI1 A;  3AED B;  4EZJ A;  3PT2 B;  3RZW C;  1FXT B;  3P2B A;  1AN8 A;  1TBE A;  1WSP A;  1UD7 A;  2AL6 A;  2VRR B;  3RPF C;  3QWZ B;  3W9C B;  3P4P B;  4JQW C;  3ZDT A;  3V61 A;  3T3N A;  3EFC A;  3RZF A;  1TY2 A;  4AWJ A;  4PS7 A;  2B3A A;  2KVR A;  2WX0 A;  1L7Y A;  1ENF A;  1SEB D;  3IXS A;  2MP2 B;  3OJ4 B;  2K9X A;  1Y8R C;  1IUE A;  3Q3F A;  4OVZ A;  1ZOY B;  3RN9 C;  1I4H A;  1F2R C;  3M63 B;  3M95 A;  2L1A A;  4YTN B;  3VFK A;  3Q69 A;  1QQR A;  3PPA A;  5G55 A;  3I57 A;  3MC0 B;  5AZF A;  4DQO C;  1YQ4 B;  1L6V A;  1YNT E;  1MHX A;  3FIL B;  1TIF A;  3RYT A;  3HHM A;  1UGJ A;  1BXT A;  3QAQ A;  4RFB A;  1PQS A;  4TQ0 A;  4ARI A;  3LDZ E;  4AOF A;  2FUG 1;  4XDD A;  2KFJ A;  3NOB A;  1E90 A;  4L23 A;  2AYO B;  1N5X A;  3SHQ A;  1VZ8 A;  1RFK A;  2K25 A;  3H7P B;  3KLS X;  3N1Y C;  1FNW A;  3Q8A A;  2K1F A;  3DCG A;  4ZYS A;  1QOA A;  2KFK B;  4BKS D;  1XQQ A;  2KDB A;  2W3S A;  5IA7 A;  2L00 B;  4BBN F;  1SJE D;  3SDL C;  1XCT L;  2V4I B;  1WI0 A;  2DHZ A;  1P7F A;  1DOI A;  4M8N A;  2M1M A;  3HIZ A;  3LB8 C;  3PHW B;  5MPO A;  4A3P A;  2NR2 A;  2W82 A;  2Y5P A;  1WYW B;  3MHS D;  4WWO A;  4JE3 B;  1RRB A;  2JXX A;  2L3Z A;  4LDT D;  4W9F A;  3BVZ A;  2N9X A;  3HM3 A;  2OJW A;  1P3Q U;  3NVW A;  2WXK A;  4FA6 A;  4FN2 A;  4JWS C;  2KQ4 X;  4MT5 A;  4XDC A;  2XBB C;  1PFD A;  4NAW B;  5DPR A;  1E10 A;  3PRP B;  3ZGZ A;  1I35 A;  1VDV A;  2VH1 A;  1JW9 D;  2AEH A;  1V5O A;  2GBN A;  4BFR A;  2LUE A;  2MSE D;  1G6J A;  1XLQ A;  4GDK A;  3GZN I;  1T0Y A;  1C76 A;  2BKR B;  1WR1 A;  2JWZ A;  3AEA B;  3B1L X;  5E6N A;  2K6D B;  2UWQ A;  3AU4 A;  2KC1 A;  2KWV B;  3NZS A;  4W9E A;  1YQ3 B;  2DZI A;  3W1Y A;  2L32 A;  2MW5 A;  3RMK C;  2BS3 B;  4MGI E;  1WJ4 A;  3EHV A;  1XLN A;  1Q0W B;  3ALB A;  3DQV A;  3Q8E A;  5BO4 B;  3ZLZ A;  1HQR D;  3IVF A;  4W9I A;  1RM6 C;  3MTN B;  4R3D A;  1KOT A;  3MJW A;  1FM0 D;  2KQ7 A;  2H89 B;  1M94 A;  2I1K A;  4GDL A;  3ZO5 B;  1WGH A;  3Q6B A;  2ZZP B;  4WAA A;  4CYE A;  1WY8 A;  4F7Z A;  4US8 A;  1RAX A;  4ZHP A;  1RFA A;  3DWM A;  1GG3 A;  3D32 A;  5D2M B;  4TSS A;  1WM2 A;  3ZJU A;  4XWW A;  1BT0 A;  2LGI A;  3DDC B;  1C79 A;  3VUY A;  2PE9 A;  5KHQ A;  2OED A;  3ABV B;  2I2Y A;  1SIF A;  2WP9 B;  2WYQ A;  2C9W B;  1P98 A;  3V62 A;  2FCQ A;  2PVG C;  1L5P A;  3A4S C;  2AQ1 B;  2BKF A;  2DLB A;  4CQN A;  1WR6 E;  2BS2 B;  2KJH B;  1LQB A;  2KDE B;  1QOB A;  1Z2M A;  1SF0 A;  3W2D A;  2KK8 A;  3IBE A;  4IM2 A;  3C0R B;  5JHA A;  3JSV A;  1IBX B;  3MP9 A;  4HJK A;  4KSK C;  2QMT A;  3AH7 A;  2WDR B;  3NG0 A;  2N1W A;  4RCO A;  1IYF A;  1E6E B;  1FNV A;  5BMI A;  2L0T A;  5D94 A;  5EE1 A;  1YJI A;  4URK A;  4XWT A;  2D11 A;  1JWM D;  4DWF A;  4XE0 A;  4FHK A;  4P16 A;  3ZTD A;  4WQO B;  4IC7 B;  2E6X A;  2BWE S;  1OEY A;  2MCN B;  2G1E A;  2WXN A;  4WWN A;  3L0W B;  3Q8C A;  3ZXR A;  4ZRP A;  1WRD B;  4HPL B;  4P1C C;  4DK5 A;  1CMX B;  1WZ3 A;  4KGS A;  4W9L A;  1E8Y A;  3M3J A;  3H7S A;  1TYG B;  3KH0 A;  3TUO A;  4B6W A;  2O6V B;  5L95 C;  1YQB A;  4WJP A;  1NDD A;  1MVK A;  4DXF A;  1SB3 C;  2LXA A;  3PRM B;  4OZA A;  5TSS A;  1JCK B;  4WIP A;  3TEY A;  1YJ1 A;  4EUT A;  1KLV A;  1FRR A;  4YL8 A;  5C23 A;  1HXY D;  1V49 A;  2KKC A;  3ETR A;  3AE5 B;  1YMH E;  5G5H A;  1C4C A;  1WJU A;  1XCQ L;  4C7Y A;  2KNB A;  1PGB A;  3QAR A;  2NMQ A;  2BYV E;  5FKA C;  5D3D A;  2BWF A;  4KGT A;  2JRH A;  1WXV A;  4HCN B;  4Q2J A;  4RM8 A;  2JQR B;  4QAY A;  3N3K B;  1KLU D;  4JIO U;  3AI5 A;  1VJK A;  4IM3 A;  3Q3M C;  4ANX A;  1GNU A;  3KUD B;  1PGX A;  5E6P A;  3PSE B;  2E3T A;  4A55 A;  2MLB A;  4CO7 A;  2LVO A;  2CKH B;  4MSM B;  2DAJ A;  1NBF C;  4M01 A;  2WWZ A;  4HRO A;  2OHF A;  3HUI A;  2GB1 A;  2LZ6 A;  1C78 A;  2KLC A;  2M56 B;  5HKH A;  3WIM A;  2ZCB A;  4AJY B;  2NS5 A;  3L4P A;  5EDS A;  1J7A A;  2DZM A;  2KWU B;  4B0E A;  3PZ8 A;  1IGD A;  2LHE A;  5IO9 A;  3IG3 A;  1FCL A;  4IOI E;  4HLE A;  2CS4 A;  4LNF A;  4KDI C;  5T8I A;  3AEB B;  2Y5C A;  2KWC A;  2YLM A;  1NI3 A;  5J18 A;  3ECI A;  5JH5 C;  3VUW A;  3HK0 A;  2L7R A;  2NPT B;  3DVG Y;  3ZVV A;  4F8C B;  3U2S C;  1OQY A;  4NAM A;  4WJO A;  4PS8 A;  2N9E B;  1WGR A;  1SE9 A;  1V1P A;  1OQQ A;  1XD3 B;  2SAK A;  4ANW A;  3RUL A;  1IP9 A;  3IAS 1;  4IWO A;  4F1S A;  3DWG C;  2K3U A;  4X57 B;  2KXJ A;  1WX7 A;  4KVG B;  4HDQ A;  4C00 A;  1I4Q A;  3HM6 X;  1F0Z A;  5LNK 1;  4GXB A;  1QOF A;  4MGZ E;  4BOZ B;  3IT6 B;  2WXJ A;  3EC8 A;  1QZE A;  1DOX A;  2KT7 A;  1YIW A;  2GBK A;  2JZP A;  4D2K A;  2KWD A;  5CTR C;  3KWL A;  2J52 A;  2L05 A;  1HE8 A;  2L83 A;  5JZE B;  2OOB B;  1A5R A;  2BPS A;  1H8C A;  1HEZ E;  2KAN A;  2XNA C;  2KTR A;  2KC2 A;  3VVW B;  1MI0 A;  5BYS A;  1C4P A;  5D6J B;  4TV3 A;  2CHZ A;  2VZK B;  3QK0 A;  5BMH A;  5J2R A;  4LNK A;  2JU6 X;  3APD A;  1TZO A;  1T5X D;  4KDL B;  2KVZ A;  3V3X A;  1HZ6 A;  5IN7 A;  3BYT B;  3FKY A;  3AE8 B;  3DHH C;  3AE2 B;  4NQK E;  4HDO A;  2AX5 A;  1L0Y B;  1ZUD 2;  2ZVN A;  1ZE3 D;  2LXC A;  2O6V D;  2BW2 A;  1AYF A;  3K9P B;  2KOX A;  1B9R A;  3VHT C;  1N63 A;  3TBL D;  2CU3 A;  4OVV A;  1TZ1 A;  2BYT A;  1K52 A;  1I4G A;  3P63 A;  3ZKJ C;  1TS3 A;  4MH0 E;  1KH0 A;  4MGY E;  5FR6 A;  3CF6 E;  3PTF C;  2WXF A;  4WAF A;  1C9F A;  2MWS B;  3TEZ A;  2PW9 A;  4DDI D;  3PLV A;  2FUH B;  3TEX A;  1XO3 A;  1E7P B;  2D07 B;  4XYC A;  1A70 A;  3DVG X;  3A33 B;  1WXS A;  4ARC A;  1NEK B;  1RLF A;  1WE6 A;  1T0Q C;  2IY0 B;  4BKG A;  3VH3 B;  1FMA D;  2GI9 A;  4A6Q A;  4RGT A;  2JSV X;  4II2 B;  3AM9 A;  1D5Z C;  1UEL A;  4B9K A;  4OHJ A;  5IKC M;  3R3M A;  2KLG A;  2QIL A;  1XEE A;  1WX8 A;  1V8C A;  4KX6 B;  2IO2 B;  4P7I A;  4BKT A;  2GBR A;  3KYD D;  5CHF A;  4WWM A;  2BYE A;  1L0V B;  4W9J A;  2PTL A;  5HG2 A;  2CR5 A;  1WE7 A;  1VR9 A;  1D3Z A;  2DWQ A;  2NBU A;  4M02 A;  2IO1 B;  5FR3 A;  2WXO A;  3IAM 1;  1WXA A;  3QCA A;  2WHI A;  3Q8B A;  2KAC A;  4ZHO A;  5AZH A;  4LK0 M;  4YSZ B;  2GBM A;  4TKN A;  4YTM B;  1NYQ A;  1NVI D;  1EF1 A;  2KMA A;  3JVZ X;  1LGR A;  4KGR A;  3E9S A;  1TKE A;  2LUM A;  1J8C A;  4P1B C;  4FBJ B;  4GN1 A;  5FK9 C;  2KHW B;  3ML8 A;  4AS1 A;  2L76 A;  2OJR A;  2V1Y A;  3V60 A;  1ROE A;  2L8J A;  2LGX A;  2J0K A;  2LGD A;  2PVO D;  4RNA A;  1ZW7 A;  2JYE A;  2RR9 A;  1Q10 A;  2QSD A;  2LHD A;  4L2Y A;  4C7Z A;  3RI7 C;  2MA9 B;  3U4E G;  4FJZ A;  3RFZ B;  1SGH A;  2Z0E B;  3SFE B;  2PMV A;  2FE8 A;  3NVZ A;  3KUC B;  2IGD A;  3WAL A;  2KJ6 A;  3KWV A;  3QC8 B;  4KIK A;  5EE3 A;  3ENE A;  3WCQ A;  2KN4 A;  1EWY C;  2PLP A;  3APC A;  3U30 A;  3X0W A;  3VDZ A;  4JWU C;  1WYG A;  2PE6 B;  4B0M A;  1CK1 A;  4US9 A;  1CQV A;  5L83 A;  2D2Q A;  1JWS D;  4NJC A;  3R7R A;  1JWA D;  2AWT A;  1L4D B;  1L4Z B;  2WXR A;  2NBV B;  1WMH B;  1K53 A;  4M0W A;  2K6Q A;  2MP2 A;  4DHJ B;  2O2V B;  2RGF A;  2HTM E;  1HZ5 A;  1OQR A;  1UBI A;  4I6N B;  1FIQ A;  2C60 A;  3RNB C;  1T3Q A;  1JWU D;  2J42 A;  2AQ2 B;  1J19 A;  4KZC A;  2PIA A;  4N58 A;  2GRI A;  1E8X A;  2M8S A;  1AAR A;  3DBH B;  2NVU I;  2CJO A;  3VQI A;  5BMG A;  4J3O D;  4DXA B;  1B1Z A;  4AJW A;  3AB5 A;  4G50 A;  1GB1 A;  2K8B A;  1L0X B;  2MEK A;  4DHZ B;  4H2A A;  1NEN B;  2AQ3 B;  2XK5 B;  3GE8 C;  1QLB B;  4HXD A;  3SFD B;  4WWP A;  3L13 A;  4ANV A;  4L1B A;  2LRU A;  2BF8 B;  4K7S A;  1L6U A;  2JZ3 B;  4ZRI A;  3TSS A;  1YX6 B;  4BZA A;  4GLS C;  4A8X C;  3ZNG C;  2L0F A;  4BOS C;  4MDK E;  1MFW A;  1JAL A;  2KFK A;  3P4Q B;  4TUU A;  3B2G A;  3ZNI D;  2D5G A;  2JUO A;  1SE3 A;  2QDF A;  4K3C A;  1WH3 A;  4LNN A;  4PYU A;  1XT9 B;  3MC8 A;  4IW0 A;  4ICU A;  1J0G A;  1EM7 A;  3PLU A;  4RGM A;  3QA8 A;  2M0A A;  5DPS A;  2UYZ B;  3MJ5 A;  4C4V A;  1UBQ A;  1R4M I;  3V6C B;  1UF0 A;  1QKZ A;  2UU7 A;  3SU8 X;  3I3T B;  4N9F 4;  2JPH A;  2N9L A;  2IPK D;  4FUL A;  1UH6 A;  2DYO A;  1C1Y B;  1WGK A;  3WA0 A;  3ZJV A;  4KKI A;  3QX1 A;  3VTU A;  3BYY B;  5KHO A;  1WJN A;  2EEL A;  4NAW A;  4ITK A;  5AEK B;  3UIP B;  1U4A A;  2IYD B;  5GXG B;  2XEW A;  1VRA B;  4AP4 C;  4WQM A;  3DBL I;  4YTP B;  2KDI A;  2JRI B;  2D3B A;  3GS2 A;  2WXM A;  5GMV A;  5IAA C;  2JF5 A;  4HWI B;  2KZR A;  3L17 A;  4ANU A;  4P6V F;  2N7E A;  4A20 A;  2N4F A;  2W54 A;  3PZD A;  5DCN A;  3AE3 B;  1TS2 A;  4C80 A;  1LXD A;  1KFY B;  3Q3O C;  3Q3N C;  4WJN A;  3ZJT A;  1EO6 A;  1V2Y A;  1WGD A;  1QT9 A;  1R4N I;  2ASQ A;  5LLI A;  3DHI C;  2N9P C;  2N1V A;  1V5T A;  3TEW A;  1EUV B;  1PGA A;  4EFO A;  5C1Z A;  1C3T A;  2RDG A;  4MGK E;  3KW5 B;  5I4D A;  3BK2 A;  5EE9 A;  4I6L B;  1VLB A;  3UQB A;  3URY A;  2WXI A;  1P0R A;  4IWQ A;  4MM3 B;  2FIF A;  3VRB B;  3DBR I;  2AL3 A;  3W1S C;  2WDQ B;  3H9D A;  2CHX A;  2DZK A;  2R61 A;  1FD6 A;  3GZN B;  4K7W A;  2MBH A;  1VD2 A;  2LVP A;  3N1X C;  4FAD A;  3VTV A;  2FAZ A;  1MG8 A;  2DBY A;  4YT0 B;  1Y56 A;  4LNI A;  5DPW A;  4MH8 A;  3HRD D;  2L52 A;  4JGH B;  2R2O A;  1N60 A;  1ZDV A;  3P4R B;  4FJY A;  2XN9 C;  5HHD G;  2WU2 B;  2LGY A;  1FNU A;  4I6P A;  1CZP A;  3QQ8 B;  2LJ5 A;  1UGM A;  1AWD A;  4K3B A;  2HDE A;  2WLB A;  2M17 A;  2BVC A;  2WXL A;  3BWU D;  2V3P A;  1UUP A;  2WU5 B;  3PS6 A;  2RD0 A;  2DAF A;  3KQ4 A;  3U52 E;  3B08 A;  4HRS A;  1I4R A;  2FNJ B;  3DOW A;  3UGB B;  1K8R B;  1GPX A;  4ZYN A;  1WRI A;  2WNM A;  3BII D;  1SBB B;  1XLO A;  3VAW A;  2JY6 A;  4N6E B;  2D3A A;  2LEK A;  2O6V A;  3TJP A;  2JX5 A;  2RDB C;  3P42 A;  2JXT A;  3ZRF A;  4ASW C;  1BML C;  4HEA 1;  1VZ6 A;  4GMV A;  4EOY A;  3VR9 B;  2K8C A;  2QCZ A;  2HJ1 A;  4IKG A;  2DX5 B;  2HJ8 A;  3EUB 2;  1GAQ B;  1H4R A;  3PRE A;  3ZW3 A;  2YVC A;  1XLP A;  3TMP B;  4M8M A;  3TCA A;  3NY5 A;  3A9J B;  3Q8F A;  2DYB A;  3Q3J A;  3BVM A;  4E71 A;  2EKI A;  1TY0 A;  1TKG A;  2WGS A;  2K5P A;  3V05 A;  4B95 A;  4NPN A;  4G11 A;  2MRP A;  2YEP B;  3A1Q B;  1J7B A;  3ML9 A;  2MH7 A;  1WXM A;  4RGN A;  1K51 A;  2BYF A;  4YWG G;  1FO4 A;  1ISN A;  1EWC A;  4MSQ B;  3NHE B;  4NY0 A;  4MJS A;  1S1Q B;  4ICV A;  4HPM B;  4FLH A;  5IP4 D;  2WX1 A;  2C7M B;  3P4S B;  3RCZ A;  1RWS A;  3U7Z A;  1R7S A;  3O13 A;  2BTE A;  2G3Q B;  3CST A;  2WXQ A;  1FPY A;  2M0X A;  3H8H A;  3DVN V;  4IM0 A;  2CHW A;  2M4N A;  2IO3 B;  2BS4 B;  3NVY A;  1TS4 A;  2PKO A;  2K0P A;  1GJZ A;  3ZRC A;  1TJE A;  5CHV C;  5AZG A;  3ZQ4 A;  1ESF A;  3O65 B;  4LDT B;  4HVB A;  2R2Q A;  1T0S C;  2WDT B;  2IZV B;  2W55 A;  2NCN A;  3JYU A;  2BB6 A;  2RDH A;  1KLG D;  3OAW A;  2NPT A;  5C2T B;  4XZ4 A;  1WX9 A;  3L10 B;  5E6J A;  2VH2 A;  2LWP A;  2MQJ A;  3ONS A;  1F2R I;  3BIN A;  4W9G A;  3EFU A;  1E5W A;  1UWM A;  1D5X C;  4GIV A;  2IY1 B;  4EZK A;  3VR8 B;  2JZZ A;  3AU5 A;  1I7H A;  2J0M A;  1JRO A;  3P1M A;  2PEA A;  4AQ7 A;  2QIE B;  3H6N A;  1KJT A;  3AE4 B;  2IGH A;  2N9K A;  2G45 B;  4REZ A;  4NJ7 A;  3R8B A;  1UWX A;  1JWB D;  1Q1O A;  3A9K A;  2NTS A;  1JQ4 A;  2JYT A;  3OWE B;  5BYQ A;  1FXA A;  4O1N A;  2ICI A;  3EA6 A;  4ZRQ A;  4HKQ A;  2FCM A;  3N1Z C;  2IJ0 A;  2EMS A;  2V3N A;  2JT4 B;  3MFG A;  3AUL A;  3RD2 A;  2REX A;  1TT5 B;  3NJT A;  4KIK B;  1I4X A;  3AV8 A;  3APF A;  3WAN A;  1K50 A;  2MBE A;  1P7E A;  1WM3 A;  3DVN U;  2INP E;  3R7Q A;  2ZW0 A;  3AE7 B;  5G2N A;  2WDV B;  1GC7 A;  2KTF A;  1PDX A;  4M0W B;  2X8X X;  3GB1 A;  3NUH B;  1WWT A;  1P9D U;  2G4D B;  1RYJ A;  4JL9 A;  3FC4 A;  2WS3 B;  3R2T A;  2Y3A A;  4GU2 A;  2KX0 A;  1ZKH A;  1ZPS A;  3L08 A;  3S2A A;  1ZXH A;  3C19 A;  1N61 A;  4GDK B;  4FHJ A;  3AE1 B;  3VTW A;  5G5G A;  5E6O A;  4LJO B;  4LCD E;  4OZC A;  3NVV A;  2KJR A;  2Q5W D;  1SE4 A;  2QC8 A;  1GOZ A;  2HTH A;  2ON8 A;  3CIR B;  1DYQ A;  3ZTC A;  1ET9 A;  1DOY A;  4HCP B;  2MJD A;  5AUK A;  3AEC B;  2LD9 A;  3AEF B;  2DYM A;  4GSW A;  3EEC A;  2ONQ A;  2BB5 A;  1FEH A;  3ZNZ B;  3OG5 A;  3SEB A;  2ZW1 A;  1NI2 A;  3WAP A;  3WAM A;  2C7N B;  2VZK D;  3N32 A;  1XF5 L;  2INC C;  4GDL B;  4GOC A;  2M19 A;  3R2I A;  2WXG A;  1V81 A;  4DXG A;  1NYR A;  1WZ0 A;  5DPT A;  3V6E B;  1ET6 A;  3CMM B;  2EKE C;  1F1H A;  4BVU C;  4YXD B;  2MBB B;  3BY4 B;  1N62 A;  1KRH A;  1FCC C;  5HFY A;  2A5U A;  4S0R A;  2GBJ A;  1V86 A;  4C4V B;  4AUQ C;  2IBI B;  4EE2 A;  4OZB A;  4HK2 A;  4K81 A;  1E8W A;  1WJ6 A;  2W3R A;  1YOV B;  1E7U A;  3PZ7 A;  2KD0 A;  2C5L C;  3ZUN A;  1T0R C;  1N6Z A;  2D10 A;  1I4P A;  2PPH A;  4IDI A;  3U7D A;  4DHZ E;  2V4L A;  1FXI A;  5D3I B;  2N7D A;  4II3 B;  3JSV B;  3FAH A;  3Q14 C;  3DPD A;  4YSY B;  3FIL A;  1E0Z A;  1TKY A;  2LVQ A;  1F52 A;  1YD8 U;  4UDU C;  4S17 A;  3PGE A;  1UZX B;  2QJL A;  3RNA C;  2KQS A;  1LM8 B;  5D7G A;  1SSN A;  4XGA B;  2TSS A;  4IUM B;  4PS3 A;  3H7P A;  2JVC A;  1GB4 A;  4PYZ A;  1PYW D;  2V9H A;  2J7Q B;  3AE6 B;  2MBQ A;  3LJ3 A;  1MPE A;  3UI3 A;  3X23 A;  3UF8 A;  3K9O B;  1V1O A;  1V80 A;  3I9V 1;  4XC2 A;  4PT5 A;  2DNF A;  3NZU A;  3VXW A;  2YEP F;  4W9H A;  2LRW A;  4G3X B;  4EZL A;  4NJ6 A;  4GB9 A;  2I1J A;  2G4S A;  5TR5 A;  2Y5B B;  3RUI B;  5LXI B;  3NZ3 A;  3RNC C;  2GLS A;  4USA A;  2JWU A;  3N20 C;  2EMT A;  3SD5 A;  2KMM A;  2V0G A;  1J7C A;  2K8H A;  2CJN A;  2QEJ C;  3VRA B;  1WMH A;  4RF1 A;  4A3O A;  1SIJ A;  2O2V A;  2J4X A;  1YX5 B;  3PVL A;  1WIA A;  2FBW B;  3UIN B;  2B76 B;  1UNS A;  2FCS A;  2ZPY A;  2KDF B;  3AMZ A;  2LGS A;  4FXC A;  1EU4 A;  1EF5 A;  2Z8L A;  1YN3 A;  3E56 A;  1M4V A;  3W5V B;  3RT3 B;  3HVD A;  2RPV A;  2ACZ B;  1QOG A;  3ZIM A;  2WQY B;  1XXG A;  4ACF A;  3I5J C;  3T3O A;  1STE A;  2PJH A;  1ZDX A;  1EU3 A;  2XK5 A;  1OEY J;  2GOW A;  4LNO A;  3RNE C;  3PRZ A;  4GGQ A;  4BBN C;  1OGW A;  2GMI C;  4KKJ A;  5AUI A;  3LXF A;  3AXC A;  2RPQ A;  1JRU A;  3OLM D;  5EE0 A;  4JPS A;  1LO5 D;  4LLG M;  5LXH A;  2FCN A;  3Q2A C;  4OW0 A;  2IGG A;  4W9C A;  1Q5W B;  3DBS A;  2D3G A;  1V6E A;  1JRP A;  1IGC A;  4IWP A;  2CU1 A;  4EKU A;  1D5M C;  3AN1 A;  4CHK A;  1V1P B;  1P1A A;  1WF9 A;  3SR6 A;  4MAC A;  2DEN B;  4W9D A;  4XX5 A;  2WXP A;  4M00 A;  4JX1 C;  3L54 A;  3BK1 A;  4MEM A;  1TGZ B;  4LJP B;  5CX3 A;  4DHJ D;  3JW0 X;  4RM9 A;  1SXT A;  1I42 A;  3U8Z A;  3N30 A;  1YN4 A;  3BVG A;  3B0A A;  2KN5 A;  1F77 A;  1IBX A;  3LYY A;  2X38 A;  1MHH E;  2NBW B;  3QJZ A;  3J9C A;  3GOE A;  3DHG C;  3VUX A;  4TMA B;  2BGF A;  2KTR B;  3BZD B;  1E8Z A;  2DZJ A;  1F9J A;  5J17 A;  1V97 A;  2MHJ A;  4MJS B;  3WAO A;  4YSX B;  3MHZ A;  4W9K A;  1YJJ A;  4ZDV A;  2C7H A;  1R4M B;  4C56 C;  3C8Y A;  2LJI A;  1YN5 A;  3MC9 A;  4E74 A;  3PO0 A;  1FRD A;  2LFI A;  3T9L A;  3ZXV A;  1X1M A;  2KDM A;  2ZVO A;  5C3J B;  3N9Y C;  1N5W A;  1GC6 A;  2LAS A;  1TS5 A;  3L16 A;  2WXH A;  5BYR A;  3R66 C;  3GE3 C;  5CHW A;  1MG4 A;  1SE2 A;  2W9N A;  2MBO A;  4IG7 B;  1KF6 B;  4E3C A;  3IHP C;  3DBL B;  3TIX A;  4KSL C;  3IFW B;  3IT4 B;  1SJH D;  4MM3 A;  3W5U B;  2Z0D B;  2IDY A;  3VH4 B;  4FJV B;  5IOI A;  2V3S A;  3EGR A;  2Z59 B;  2ZCC A;  1KTK A;  2N7J A;  3PV1 A;  3KVF B;  2KYW A;  3NS8 A;  2BQQ A;  1KM7 A;  1VCB A;  2BT6 A;  2H88 B;  4ZRJ A;  2D3C A;  1HTO A;  4J6I A;  2G9H D;  3HVZ A;  1HA5 A;  3H1U A;  4ZOH C;  4NZL B;  1C4A A;  5JXV A;  1WXQ A;  3QIJ A;  4PK1 A;  1E9M A;  1C77 A;  2ZEQ A;  1R4N B;  1WGY A;  3CWI A;  4HPP A;  3I63 C;  1WGG A;  2KMC A;  1FFV A;  2HD5 B;  3B2F A;  3T8M A;  4TQ1 A;  4HJG E;  4MEL A;  3DBR B;  4KZ0 A;  2MX2 A;  4DDG D;  1DGJ A;  2IO0 B;  3A4R A;  3W1S A;  5H8Y E;  3A9K B;  1GUA B;  4K7U A;  1WFY A;  1ZXI A;  1QIL A;  1BUI C;  2A4Z A;  3OJ3 A;  4WUR A;  4DBG A;  2ZPN A;  3TL5 A;  1TTN A;  1D6E C;  2ZNV C;  1L2N A;  3ZYY X;  4K1R B;  4LTU A;  4WJQ A;  2MJ3 A;  1HTQ A;  4KV2 A;  1S3S G;  3ZNH B;  3NRZ A;  4EEW A;  3CSF A;  2RMM A;  1ZGU B;  1E7V A;  2KX3 A;  1FFU A;  4RGO S;  1T6B X;  2J53 A; 
#chains in the Genus database with same CATH homology
 2HE7 A;  4N9F 4;  2JPH A;  3EEC A;  3ZDM C;  4FUL A;  2LZ6 A;  1UH6 A;  2DYO A;  3ZNZ B;  1C1Y B;  4NQL B;  3WA0 A;  2KLC A;  1NI2 A;  3WAP A;  5HKH A;  3WAM A;  3QX1 A;  3WIM A;  2ZCB A;  3VTU A;  4AJY B;  1LFD A;  2NS5 A;  2ZJD A;  5KHO A;  2C7N B;  1WJN A;  4NAW A;  5EDS A;  3N32 A;  3A9J A;  5AEK B;  4GDL B;  4GOC A;  3UIP B;  1U4A A;  2DZM A;  2IYD B;  2KWU B;  4JLC A;  4RMA A;  1V81 A;  2XEW A;  1Z5S B;  2FID A;  1WZ0 A;  4AP4 C;  5DPT A;  3DBL I;  3IG3 A;  2KDI A;  3V6E B;  4ZRK A;  3CMM B;  2JRI B;  2EKE C;  4HLE A;  4BVU C;  5GMV A;  5IAA C;  2CS4 A;  2JF5 A;  4HWI B;  2MBB B;  3BY4 B;  3QHT A;  4NNJ B;  4KDI C;  2KZR A;  3L17 A;  4ANU A;  2KWC A;  2YLM A;  1OTR B;  2N7E A;  4A20 A;  2RSU A;  3A1Q A;  5DPR A;  1V9J A;  5J18 A;  2A5U A;  3ECI A;  5JHB A;  2GBJ A;  5JH5 C;  3VUW A;  2N4F A;  1V86 A;  2L7R A;  2ZNV B;  3HK0 A;  3KYC D;  2NPT B;  3DVG Y;  3PZD A;  5DCN A;  4AUQ C;  3ZVV A;  4F8C B;  4G0N B;  1OQY A;  2IBI B;  4OVU A;  3PHX B;  4HK2 A;  4K81 A;  1E8W A;  1LXD A;  1WJ6 A;  2QHO A;  4WJO A;  1E7U A;  4PS8 A;  2N9E B;  2KD0 A;  1WGR A;  2C5L C;  1SE9 A;  1XD3 B;  3ZUN A;  3M62 B;  4WJN A;  3UQA A;  2K39 A;  3UIO B;  4ANW A;  1EO6 A;  3RUL A;  2D10 A;  1IP9 A;  1V2Y A;  3KUZ A;  2J0J A;  2PPH A;  1WGD A;  4IWO A;  4F1S A;  3U7D A;  4DHZ E;  2V4L A;  4BKS A;  1IPG A;  2KO3 A;  3DBH I;  4X57 B;  1R4N I;  2KXJ A;  2N7D A;  4II3 B;  2LI5 A;  2ASQ A;  1WX7 A;  5LLI A;  4KVG B;  4HDQ A;  4EZJ A;  3PT2 B;  3JSV B;  3RZW C;  3DPD A;  2N9P C;  2N1V A;  3HM6 X;  1FXT B;  1V5T A;  1EUV B;  3P2B A;  2VRR B;  1TBE A;  4EFO A;  1UD7 A;  2AL6 A;  2LVQ A;  4GXB A;  5C1Z A;  3QWZ B;  3KW5 B;  4MGK E;  4MGZ E;  1YD8 U;  4JQW C;  4BOZ B;  4I6L B;  3ZDT A;  3EC8 A;  1QZE A;  3V61 A;  3UQB A;  3PGE A;  1UZX B;  1YIW A;  2GBK A;  1P0R A;  4IWQ A;  3RZF A;  2KQS A;  2FIF A;  5CTR C;  4AWJ A;  1LM8 B;  3DBR I;  2AL3 A;  2B3A A;  4PS7 A;  5D7G A;  3W1S C;  2KVR A;  2WX0 A;  2L05 A;  1HE8 A;  3H9D A;  1L7Y A;  4IUM B;  2CHX A;  5JZE B;  2OOB B;  2DZK A;  1A5R A;  2BPS A;  1H8C A;  2MP2 B;  3OJ4 B;  4K7W A;  2KAN A;  2MBH A;  2KTR A;  1Y8R C;  2KC2 A;  4PS3 A;  3H7P A;  2JVC A;  3VVW B;  4PYZ A;  1VD2 A;  2LVP A;  2J7Q B;  3Q3F A;  4TV3 A;  5D6J B;  4FAD A;  2MBQ A;  2CHZ A;  3QK0 A;  3VTV A;  5J2R A;  3LJ3 A;  3X23 A;  3M63 B;  3M95 A;  2FAZ A;  1MG8 A;  3UF8 A;  3VFK A;  3APD A;  3K9O B;  3PPA A;  5G55 A;  5DPW A;  1V80 A;  4KDL B;  5AZF A;  4XC2 A;  4JGH B;  2R2O A;  3NZU A;  3RYT A;  3VXW A;  4W9H A;  3HHM A;  2LRW A;  4FJY A;  4G3X B;  4NQK E;  4NJ6 A;  4HDO A;  4EZL A;  4GB9 A;  2LGY A;  2ZVN A;  2I1J A;  2G4S A;  2LXC A;  3QAQ A;  4I6P A;  1PQS A;  2O6V D;  4TQ0 A;  5TR5 A;  2Y5B B;  3QQ8 B;  2LJ5 A;  3LDZ E;  1UGM A;  3RUI B;  5LXI B;  3K9P B;  4AOF A;  2KOX A;  2KFJ A;  3VHT C;  3NOB A;  2EMT A;  1E90 A;  2AYO B;  3TBL D;  3SHQ A;  3SD5 A;  2M17 A;  2K25 A;  3H7P B;  4OVV A;  1TZ1 A;  2K8H A;  3ZKJ C;  2K1F A;  1WMH A;  3PS6 A;  4MH0 E;  4A3O A;  2RD0 A;  2DAF A;  3DCG A;  2O2V A;  2KFK B;  4MGY E;  5FR6 A;  3CF6 E;  3B08 A;  3PTF C;  1XQQ A;  1YX5 B;  2KDB A;  4BKS D;  2FNJ B;  3PVL A;  5IA7 A;  3DOW A;  1WIA A;  2L00 B;  2MWS B;  3SDL C;  4BBN F;  3UGB B;  3PLV A;  4DDI D;  1K8R B;  2FUH B;  4ZYN A;  2D07 B;  1WI0 A;  3UIN B;  2DHZ A;  3VAW A;  2JY6 A;  4M8N A;  2M1M A;  3HIZ A;  3PHW B;  2O6V A;  2FCS A;  2NR2 A;  2ZPY A;  2KDF B;  4A3P A;  3TJP A;  1EF5 A;  3DVG X;  3A33 B;  1WXS A;  1RLF A;  1WYW B;  1WE6 A;  3ZRF A;  2IY0 B;  4BKG A;  3MHS D;  4WWO A;  3VH3 B;  4ASW C;  3RT3 B;  1RRB A;  2JXX A;  2L3Z A;  4LDT D;  4W9F A;  4GMV A;  4EOY A;  2N9X A;  2K8C A;  4II2 B;  3ZIM A;  3HM3 A;  1C3T A;  1P3Q U;  2DX5 B;  1UEL A;  4B9K A;  2HJ8 A;  3R3M A;  4FA6 A;  4FN2 A;  2KLG A;  1H4R A;  3PRE A;  3ZW3 A;  2YVC A;  2PJH A;  3TMP B;  2XBB C;  2XK5 A;  1WX8 A;  4M8M A;  4NAW B;  3NY5 A;  1OEY J;  2GOW A;  2IO2 B;  3A9J B;  3PRP B;  3PRZ A;  4GGQ A;  3TCA A;  4BBN C;  4P7I A;  1OGW A;  2DYB A;  3Q3J A;  2GMI C;  1I35 A;  4BKT A;  2GBR A;  4E71 A;  3KYD D;  5CHF A;  2AEH A;  1V5O A;  2GBN A;  2BYE A;  3AXC A;  4BFR A;  2RPQ A;  4W9J A;  1JRU A;  2CR5 A;  3OLM D;  2LUE A;  1WE7 A;  5LXH A;  2MSE D;  1G6J A;  2FCN A;  4B95 A;  1D3Z A;  4GDK A;  4NPN A;  4G11 A;  2MRP A;  2NBU A;  3A1Q B;  2IO1 B;  3GZN I;  1T0Y A;  3ML9 A;  4W9C A;  1WXM A;  2BKR B;  1WR1 A;  1WXA A;  2JWZ A;  3B1L X;  3QCA A;  5E6N A;  1Q5W B;  2K6D B;  2UWQ A;  3DBS A;  2D3G A;  2BYF A;  1V6E A;  4IWP A;  3AU4 A;  2KC1 A;  2KWV B;  2CU1 A;  3NZS A;  4EKU A;  5AZH A;  1ISN A;  4W9E A;  2DZI A;  4MSQ B;  3NHE B;  4CHK A;  4NY0 A;  1P1A A;  1WF9 A;  2GBM A;  4MJS A;  3W1Y A;  1S1Q B;  2MW5 A;  4ICV A;  4HPM B;  2DEN B;  4FLH A;  4MGI E;  4W9D A;  4XX5 A;  1WJ4 A;  4TKN A;  3EHV A;  2WX1 A;  2C7M B;  3RCZ A;  3L54 A;  1EF1 A;  2KMA A;  1Q0W B;  3ALB A;  3DQV A;  3JVZ X;  4MEM A;  1TGZ B;  4LJP B;  5BO4 B;  2G3Q B;  5CX3 A;  3ZLZ A;  3CST A;  3IVF A;  4W9I A;  4DHJ D;  2M0X A;  3JW0 X;  4RM9 A;  3MTN B;  1I42 A;  1KOT A;  3U8Z A;  3DVN V;  3MJW A;  3N30 A;  2KQ7 A;  4IM0 A;  3B0A A;  1M94 A;  1J8C A;  2I1K A;  4GDL A;  2CHW A;  3ZO5 B;  4FBJ B;  2M4N A;  4GN1 A;  1WGH A;  2IO3 B;  2KHW B;  2KN5 A;  3ML8 A;  2ZZP B;  4WAA A;  4CYE A;  1WY8 A;  4F7Z A;  2L76 A;  1GJZ A;  1RAX A;  2OJR A;  1RFA A;  3ZRC A;  2V1Y A;  3V60 A;  5CHV C;  5AZG A;  1GG3 A;  2L8J A;  2NBW B;  3D32 A;  3QJZ A;  5D2M B;  3O65 B;  3GOE A;  4LDT B;  2LGX A;  4HVB A;  1WM2 A;  2J0K A;  2LGD A;  2R2Q A;  1BT0 A;  3VUX A;  3DDC B;  2WDT B;  3VUY A;  2PE9 A;  5KHQ A;  2IZV B;  2BGF A;  2KTR B;  1E8Z A;  2DZJ A;  1ZW7 A;  2NCN A;  1F9J A;  3JYU A;  1SIF A;  5J17 A;  2WYQ A;  2RR9 A;  2C9W B;  3OAW A;  4MJS B;  3WAO A;  1P98 A;  2NPT A;  3V62 A;  4XZ4 A;  2FCQ A;  3A4S C;  4W9K A;  1WX9 A;  2BKF A;  3L10 B;  4ZDV A;  1WR6 E;  2C7H A;  2KJH B;  2LWP A;  2MQJ A;  3ONS A;  3BIN A;  4W9G A;  3EFU A;  2MA9 B;  1LQB A;  1E5W A;  4E74 A;  4FJZ A;  2KDE B;  1Z2M A;  1SGH A;  4GIV A;  2Z0E B;  3T9L A;  2IY1 B;  1X1M A;  2ZVO A;  4EZK A;  2JZZ A;  3AU5 A;  2KK8 A;  3IBE A;  3KUC B;  4IM2 A;  3WAL A;  2KJ6 A;  2J0M A;  1GC6 A;  3QC8 B;  3C0R B;  4KIK A;  2LAS A;  3ENE A;  5JHA A;  3JSV A;  3APC A;  3L16 A;  3U30 A;  3X0W A;  2PEA A;  4HJK A;  4KSK C;  1IYF A;  3VDZ A;  2N1W A;  3R66 C;  5CHW A;  2L0T A;  5D94 A;  2W9N A;  2MBO A;  2PE6 B;  4IG7 B;  4URK A;  4E3C A;  3H6N A;  3IHP C;  5L83 A;  3TIX A;  4KSL C;  3IFW B;  2D2Q A;  2D11 A;  1KJT A;  4DWF A;  4FHK A;  3R7R A;  4MM3 A;  2AWT A;  3ZTD A;  4WQO B;  2G45 B;  2NBV B;  4IC7 B;  1WMH B;  2Z0D B;  2BWE S;  1OEY A;  2MCN B;  3VH4 B;  4FJV B;  2V3S A;  2K6Q A;  4WWN A;  3L0W B;  2MP2 A;  2Z59 B;  2O2V B;  2ZCC A;  4NJ7 A;  4DHJ B;  3PV1 A;  1WRD B;  4HPL B;  3KVF B;  4DK5 A;  2RGF A;  1Q1O A;  3A9K A;  3NS8 A;  1KM7 A;  1CMX B;  1WZ3 A;  1UBI A;  1VCB A;  4I6N B;  2C60 A;  4W9L A;  1E8Y A;  3M3J A;  3H7S A;  3KH0 A;  4ZRJ A;  4B6W A;  2O6V B;  2FCM A;  5L95 C;  1YQB A;  2EMS A;  1J19 A;  4KZC A;  2JT4 B;  4WJP A;  1NDD A;  4J6I A;  3AUL A;  3RD2 A;  2REX A;  3H1U A;  2LXA A;  4KIK B;  3PRM B;  3APF A;  3WAN A;  1KLV A;  1E8X A;  1YJ1 A;  1AAR A;  2M8S A;  2MBE A;  2NVU I;  3QIJ A;  4EUT A;  4YL8 A;  2ZEQ A;  3VQI A;  1WGY A;  1WM3 A;  5C23 A;  1V49 A;  4DXA B;  2KKC A;  4AJW A;  4G50 A;  2K8B A;  3DVN U;  1WGG A;  3R7Q A;  4DHZ B;  2KMC A;  5G2N A;  1WJU A;  2HD5 B;  3T8M A;  2XK5 B;  1GC7 A;  4TQ1 A;  2KTF A;  2KNB A;  4HXD A;  4MEL A;  3QAR A;  4WWP A;  2BYV E;  4M0W B;  3L13 A;  4KZ0 A;  2BWF A;  2G4D B;  1P9D U;  2MX2 A;  4ANV A;  2LRU A;  2JRH A;  2BF8 B;  4JL9 A;  4K7S A;  4DDG D;  4ZRI A;  2JZ3 B;  2IO0 B;  1WXV A;  3A4R A;  3W1S A;  4GU2 A;  2KX0 A;  4HCN B;  1ZKH A;  1GUA B;  1YX6 B;  3A9K B;  4RM8 A;  4K7U A;  1WFY A;  3N3K B;  3L08 A;  2L0F A;  4JIO U;  3S2A A;  3ZNG C;  4MDK E;  3AI5 A;  4BOS C;  2KFK A;  2A4Z A;  3OJ3 A;  4IM3 A;  4GDK B;  4TUU A;  4FHJ A;  3ZNI D;  4ANX A;  2JUO A;  3VTW A;  1GNU A;  5E6O A;  4LJO B;  4DBG A;  2ZPN A;  3KUD B;  4LCD E;  1WH3 A;  5E6P A;  3TL5 A;  1TTN A;  3PSE B;  2KJR A;  2ZNV C;  1L2N A;  4K1R B;  4PYU A;  4WJQ A;  1XT9 B;  2MLB A;  4CO7 A;  4IW0 A;  4ICU A;  2LVO A;  1S3S G;  2CKH B;  2HTH A;  4KV2 A;  3ZNH B;  1J0G A;  4EEW A;  3PLU A;  3CSF A;  3QA8 A;  5DPS A;  3ZTC A;  2UYZ B;  2DAJ A;  4MSM B;  1ZGU B;  1NBF C;  1R4M I;  1UBQ A;  1E7V A;  2KX3 A;  4HCP B;  3V6C B;  2WWZ A;  2LD9 A;  2DYM A;  3SU8 X;  3I3T B;  4GSW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...